1SHGA

Crystal structure of a src-homology 3 (sh3) domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
b'KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-SPECTRIN SH3 DOMAIN
molecule tags Cytoskeleton
source organism Gallus gallus
publication title Crystal structure of a Src-homology 3 (SH3) domain.
pubmed doi rcsb
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1993-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1shgA00
3QWYA 2VVKA 1PKTA 2EYZA 2EVRA 2JW4A 3H0HA 1X6GA 5FWCA 1GCQC 1PHTA 2KBTA 3O5ZA 1CSKA 1M30A 3I35A 3EHQA 5GJVB 4CC7A 1AWJA 1UJ0A 4IIOA 3REBB 3SHWA 2K9GA 2EYXA 5I22A 3VS1A 1VYVA 2RNAA 4OMNA 4J9CA 2KE9A 1JO8A 2DNUA 3VRZA 1NEGA 2L3QA 1MV3A 2M51A 2A37A 1UTIA 1UHCA 2JS2A 1SEMA 2PNIA 2FPDA 2FPEA 2F2VA 1OPKA 4D8KA 5IH2A 1AWOA 3I5SA 4JJBA 4LUDA 2CH4A 1VA7A 1UECA 1Y57A 2C0TA 1AEYA 1FMKA 1I0CA 2F2WA 2E5KA 2EGAA 2J6FA 2JTEA 1UG1A 1SSHA 1Z9QA 1RUWA 1ARKA 1KFZA 1A0NB 1T0HA 2YUPA 1KSWA 2LX7A 3R6NA 1NEBA 2HSPA 3KFVA 1OEBA 1JXMA 1X6BA 3VS4A 3CQTA 2OJ2A 3PVLA 3VS2A 4F16A 4AFQC 2D8HA 2DMOA 3TSZA 1KIKA 1V1CA 1YCSB 2A36A 2LZ6B 2RQVA 4J9BA 1AOJA 3VS7A 1IO6A 2YT6A 4Z8AA 1M3CA 4GBQA 3REAB 1WI7A 2GGRA 2L2PA 1UDLA 4HVVA 1JXOA 1BK2A 4LUEA 4RTXA 4R0KA 1E7OA 1WX6A 2KEAA 2KGTA 4HXJA 3RNJA 1NYFA 1UJYA 4E6RA 2HEQA 1CKBA 2EGEA 3H0IA 2VKNA 5IHIA 2OI3A 2LQWA 1ZX6A 2CSIA 1U5SA 1GBQA 4J9GA 2ECZA 2AKKA 2EW3A 2G6FX 2JS0A 1GCPA 2LJ3A 2XMFA 1RI9A 1OV3A 2DE0X 2V1RA 3TVTA 3EGUA 4GLMA 2AK5A 3THKA 4AFSC 1NYGA 2JXBA 1NM7A 2EGCA 3UF4A 1QLYA 2JMAA 4J9EA 2LCSA 1GL5A 1I1JA 1YP5A 4RTUA 2KYMA 2P4RA 1PRMC 2YUNA 5IXFA 4ZNXA 2KRSA 2DILA 3NGPA 4OMMA 4K11A 4RTTA 5IHNA 4EIKA 2JT4A 4OMLA 2RMOA 2PZ1A 2KRNA 1GCQA 1M8MA 2X3XD 3M0SA 1AZEA 2J6OA 1GRIA 1ZLMA 2DJQA 2LJ1A 2KXDA 2K3BA 1X27A 2AZSA 2LQNA 1QKXA 2ED1A 1KJWA 1B3QA 4AFZC 5FW9A 1WFWA 1N5ZA 3VS5A 1LCKA 3C0CA 4F14A 1G2BA 4RTZA 1FYNA 2I0NA 2O9SA 3UA6A 1M3BA 1PRLC 1OOTA 4LE9A 3H0FA 1AWWA 1WXTA 2ESWA 4CC4B 2V1QA 3H41A 1X69A 5EC7A 4OMOA 1K9AA 3ULRB 2KR3A 1ZSGA 1JU5C 2DBMA 2SRCA 3NMZC 2DRKA 4F17A 1M3AA 2J6KA 2KXCA 2D0NA 1QKWA 1I07A 2NWMA 2BZXA 1RLPC 1HD3A 4LN2A 1H92A 4DEYA 2A08A 2MOXA 2CREA 3VS6A 3GBQA 1YN8A 3QWXX 1T3SA 2DL8A 1TG0A 1U3OA 3UA7A 2L0AA 2NUZA 2CUDA 1J3TA 4JJDA 2JM9A 1ZUKA 2D8JA 1EFNA 1WDXA 5FWBA 3VS0A 3LH5A 1WYXA 1JQQA 2BTTA 3EHRA 2O88A 3EG1A 2KT8A 3A98A 2CT3A 3M0RA 2DLPA 2LNHB 1NLOC 1X2KA 2DX1A 2FPFA 3NHNA 5ECAA 1AVZC 4OMQA 4J9IA 2A28A 2PTKA 2DL7A 2KT1A 2RPNA 2JMCA 2MCNA 1PKSA 4Z88A 2EBPA 4CC2A 2DVJA 2YDLA 5I11A 1WXUA 3UATA 2GTOA 2B86A 2GQIA 1YNZA 4AFUC 2K7AA 1UHFA 1GFCA 5IXBA 1SHFA 3RBBB 1SRLA 2OAWA 2LJ0A 2H8HA 3I9QA 2D1XA 2EQIA 1UFFA 2HDAA 1E6HA 4J9FA 3VS3A 1WA7A 1Y0MA 1AZGB 4Z89A 2RQUA 2L3SA 1NLPC 4RUGA 2K6DA 3M0UA 1ZUUA 4AG2C 2ENMA 2GTJA 1VYTA 1K1ZA 1X43A 1HJDA 2FRYA 4OMPA 1W70A 1YWOA 2J05A 2DL5A 2ROLA 2K79A 5IHKA 3IQLA 4A63B 1W1FA 1ABQA 4DEXA 2DA9A 1AD5A 2LMJA 1SPKA 1E6GA 2J7IA 2AKLA 3FJ5A 2SEMA 2DF6A 3PVQA 1CKAA 2DL3A 4JJCA 4CC3A 2HCKA 1UUEA 3EG2A 1WIEA 4Y92A 4HVUA 2O2OA 2RQRA 2C0IA 2O9VA 2CUBA 1PNJA 2FRWA 4J9HA 1T0JA 2GBQA 1WXBA 4HVWA 2O31A 1ZUYA 3PE0A 3NPFA 1NG2A 2VWFA 2FEIA 2KYBA 1QCFA 2AZVA 3M0TA 4X1VA 1Z9ZA 1H3HA 2KRMA 4JZ4A 1HSQA 2GNCA 4RTVA 2HBWA 1AWXA 3SEMA 2FG0A 4FSSA 2ED0A 3TSWA 2LP5A 3EG0A 2ABLA 1G83A 4JZ3A 1K0SA 2MIOA 2EYYA 4KRTA 2YUQA 3M0PA 2J06A 1GBRA 2YUOA 2KROA 2RN8A 1PWTA 2CSQA 1MUZA 1QWEA 3U23A 1MV0B 3VRYA 2DRMA 5HCKA 2DBKA 2JM8A 2FO0A 2K2MA 2RQWA 2KNBB 2RF0A 4D8DA 1JEGA 2IIMA 1BU1A 3JV3A 1BBZA 3EG3A 1SHGA 1ZBJA 2C0OA 1B07A 4QT7A 2DL4A 1YWPA 2W0ZA 2EKHA 5GJWB 1BB9A 2BZ8A 3ZL7C 1SRMA 1U06A 4JPBW 4J9DA 1UGVA 1XOVA 2L3PA 2EYWA 1GFDA 1M27C 4LNPA 4HCKA 1K4US 2F2XA 4WCIA 1QWFA 2ROTA 2RQTA 2X3WD 5L23A 1S1NA 1WLPB 1UE9A 4M4ZA 1K0XA 1VYUA 1W6XA 1K76A 2DM1A 1RLQC 2M0YA 2W10A 2YSQA 1OPLA 2QDLA 4ORZA 2CDTA 2DYBA 2CT4A 1ABOA 2BZYA 4RTWA 1T3LA 4ESRA 4IIMA 3M0QA 3I5RA 1TUDA 2EPDA 4RTYA 4AG1C 1H8KA 2CH4W 1X2QA 1TUCA
chains in the Genus database with same CATH superfamily
4PL6A 3OYKA 4LD6A 1PKTA 4PFZA 4FW1A 3JB9G 1PHTA 3O5ZA 5GJVB 4CC7A 2CP0A 1UJ0A 4IIOA 2K9GA 2EYXA 3CCJQ 2QYZA 5D6YA 3CC7A 3A8MB 2ZPEB 3DKMA 2DNUA 3VRZA 3NTKA 4BE0A 5LJ3h 4QW2A 3CCSA 3PIOA 1RACB 3WVEB 3JCMc 2JS2A 3RMQA 3CC7Q 2YXYA 3M9QA 1YJWQ 4N0AC 4PJOF 1KHCA 1K73U 3J7AF 5GAN6 4RCCA 4D8KA 1AWOA 1MMGA 1B34A 1YHQQ 2L89A 4PNOA 4A4KA 3OYMA 3VYHB 4EMHA 2ZPBB 1UG1A 2JTEA 1A0NB 4OGEA 2D6FA 1NEBA 3A8LB 2HSPA 4RG8A 1X6BA 3OYYA 3EG9A 3PVLA 2DFUA 1QCOA 3RERA 4F16A 2DMOA 3TSZA 3JCMb 3FC3A 4C0ZA 3ASKA 2E10A 2HBPA 3CCMT 2LZ6B 2F1LA 2MWOA 2RQVA 2EQJA 1OU9A 1AOJA 3FLGA 2XDPA 1M3CA 2P0QA 5KH6A 4FYXB 2BE9B 2LQ8A 3REAB 1M1FA 4N4HA 1K73R 2GGRA 5DY9A 3CCET 1VQ7Q 2V8KA 5DLQE 3WVDB 2RM4A 4R0KA 4HXJA 1UJYA 3BDLA 1UB4A 4XTVA 1X75C 3JB9F 2M0OA 2QEXQ 2HQEA 2Y4XA 2P0KA 2CSIA 2EWNA 1AHJB 2FVUA 2CZ1B 1VQ9Q 1GBQA 4J9GA 2ECZA 5HKCA 2AKKA 2L8DA 2G6FX 5M9OA 2JS0A 3P8DA 1EIFA 1RI9A 3CCRA 2DE0X 3TVTA 4ELYC 3E1SA 2HNIA 4X9CA 2EJGA 4M78F 4M77D 1NM7A 1EZZB 3UF4A 1YJNQ 2X51A 3QIIA 2PQWA 2LCSA 1VQPQ 3E9GA 3QZ5B 2OTLQ 2GFUA 3VUBA 2DZ9A 4LDXA 1WHJA 3V7SA 3ZBDA 2E12A 4BE2A 2DXTA 1OZ2A 3NGPA 7AT1B 1YCYA 2AIRB 5AYFA 1TUGB 2JT4A 2YLCA 1QVPA 2KRNA 1WHLA 2X4JA 3I56T 3CCVT 3QJ6A 1KHIA 5LJ3j 2GF7A 2DJQA 1X27A 1KQ2A 2XDDA 1KJWA 1QVFA 2DIQA 3DB3A 2KI7A 2VYTA 3C0CA 4F14A 4RTZA 1FYNA 2I0NA 2O9SA 1UGPB 1PRLC 3UA6A 1OOTA 4LE9A 2QEXA 2HD0A 1AWWA 1TH7A 3G7ZA 4CC4B 2V1QA 2EJ9A 3H41A 5KYWB 1X69A 4PJOC 1W2BA 4XU3A 2DXBA 3ULRB 2KR3A 1ZSGA 3OW2P 1JU5C 3V7RA 1QCNA 2CP6A 2HL5C 2NWMA 3GF5A 2BZXA 2PUOB 3PNWC 1BI3A 3VS6A 1YN8A 1VQPA 3C94A 3OW2A 1U3OA 3JCMJ 3OYCA 2L0AA 4LDYA 1VQKQ 2V8JA 1C1AA 2O88A 1Y07A 4F7UG 4NL3A 3EG1A 3A98A 3M0RA 3L2QA 1M2VB 4IKFA 1M1KR 5DM7R 2HKQB 5C0MA 1VQ4Q 1QVFS 1X2KA 2DX1A 5ECAA 4OMQA 2ZAEA 2A28A 3UDCA 2DL7A 4FIBA 3A8GB 5FU7C 1EX4A 2JMCA 2ZPFB 2DYIA 4HA8A 5I11A 4XTYA 2DPPB 2M1HA 1PM3A 2GTOA 3G6EQ 3MP8A 4C92B 1GFCA 1QP3A 1VQOT 1OI1A 2RH2A 5IXBA 2KSSA 3RBBB 2NUPA 5CCAA 5I2SA 2FB7A 2HDAA 2RI5A 1WPYA 1Y0MA 2PVDB 3M0UA 4AG2C 2ENMA 2GTJA 5KYNA 1VYTA 1O75A 2MAMA 2FRYA 1W70A 2J05A 1YJNT 2DL5A 2K79A 3IQLA 4DEXA 1M2OA 2DA9A 3CPFA 2COZA 4OF1A 2J7IA 4JRPA 5HY6A 2AKLA 1SF9A 2DF6A 3MHXA 2HCKA 4KGXB 3JCMd 2ZPIB 4PJOE 4N0AA 3QXEB 2O2OA 2O9VA 2CUBA 1PNJA 1UGQB 1T0JA 3QKJA 4II1A 3JRZA 2GQVA 1WXBA 4F7UF 4QVCA 3G71T 3EAEA 3RIRA 3CXCS 2FEIA 5LJ5h 1U1SA 2AZVA 1Z9ZA 1VQ7T 1H3HA 4JZ4A 1M90R 3SWNB 3HTRA 3META 4RTVA 1ZHIA 3DB4A 2EQMA 1AWXA 2F69A 3SEMA 2FG0A 2ED0A 3TSWA 4KULA 2LP5A 5A0DA 4X9DA 1RABB 1P92A 1IHWA 2O01E 2LCCA 3CC7T 1JJ2A 3N5BB 2CSQA 3CCSQ 4M75C 1M1KC 2HAXA 4JS5A 2DBKA 2K2MA 4NL2A 3JB9I 2XDBA 3PMIA 4DBFA 3RUXA 1PD1A 3CPWA 4HT9A 4Q5WA 1BIBA 4C5IA 3HPWA 1D0YA 1BB9A 2LTOA 3V8JA 4RCBA 5I2MA 2RHXA 4J9DA 2IPOB 1XOVA 5I21A 1W2BS 5KE2A 2EYWA 2R57A 3FJPA 2HL3A 3PIPA 1C0MA 3CPWP 3H9NA 2DD4A 3LLRA 3FDRA 3HFOA 1N8RR 4M4ZA 3OS1A 1I81A 1VUBA 2DM1A 2M0YA 4OB0B 1JRIA 2K5FA 3LW5E 4TVRA 4ORZA 3OW2S 9ATCB 3BE3A 2CT4A 4M75G 1ABOA 4P5NA 2AT1B 1WHKA 4J83A 5EG2A 3G6EA 3I55T 3E19A 4NOYA 4R56A 4C92F 3CD6Q 5KYXA 2E3HA 2DO3A 2K2VA 1TUCA 3INZA 4BB7A 2E4HA 2YWWA 1YITT 2EVRA 3H0HA 4YTLA 1CSKA 3I35A 3EHQA 4BI4A 4L5GA 3A8HB 2VXEA 4M75E 2LRQA 1Q82U 5I22A 3VS1A 5IT9E 4C8QE 3A8OB 4J9CA 2KE9A 2LNVA 1NEGA 1N8RU 4M77E 1GXIE 4L59A 4XTXA 2M51A 2A37A 1UTIA 1SEMA 2PNIA 2X35A 1VQKT 4QQ6A 3FIFA 2RHIA 2FPDA 3MP1A 4C0FA 2F2VA 4M7DA 2F5KA 3I5SA 5GAOp 1I5LA 2LQKA 2CP3A 3T9NA 5J26A 2C06A 2C0TA 3LH0A 3RDVA 4A4FA 4D6WA 3ER0A 4J6YA 2E5KA 1KQSP 2EGAA 2J6FA 3EFOB 1SSHA 3CC4T 2ZPGB 1KSWA 2LX7A 3HRTA 1WHGA 4IUVA 3G71Q 3OS5A 4ZGDB 1Q81C 5IAYA 3L2ZA 4C92C 4E7KA 1IGQA 2COYA 1KIKA 3I55Q 5J39A 2OTJA 1V1CA 2NUPB 1YCSB 2KDSA 1BCMA 4M75F 1IB8A 4MZMA 1ACMB 1YJWT 4XTZA 3WXMB 2L2PA 3QSUA 4KGVB 4M7AF 5A2QE 4HVVA 2HQHA 2P84A 5GAOm 1E7OA 2KGTA 4WTOB 4DOWA 5GAMe 1TSFA 5HK0A 1VQ8Q 1I8FA 1Q81U 5CKEA 4EDUA 1U5SA 3OSSC 5CIUA 2BIVA 3CCMA 2EW3A 3M57A 4QVDA 2DEQA 4M7DB 4J7IA 2XMFA 3QHSA 1VQKA 2KK4A 1OV3A 2RHYA 2V1RA 1W2BP 3EGUA 2LX9A 4GLMA 4JRIA 1NYGA 2JXBA 1N27A 1OULA 2CP5A 2JMAA 3QUIA 3OYAA 3CC4Q 1GL5A 1I1JA 1X01A 3S3NA 2YUNA 5IXFA 3LWIA 4E7LA 4KH0B 2DILA 3CCLQ 4MZTA 3CEYA 4RTTA 4DBRA 4FL6A 3CMAQ 1VQMA 2PZ1A 1GCQA 5GAN8 2L5QA 2X3XD 1AZEA 4M77B 2J6OA 1GRIA 2X9HA 1ZLMA 2KXDA 4QVZA 2K3BA 3EH1A 3QDRB 4C8QB 5DLOA 1MMAA 3NFCA 4AFZC 5GAOn 4M7AE 3CC2Q 1B7TA 1LCKA 4BD3A 3RKWA 2ATCB 5GANh 1YJWA 4XK8E 5GAN5 1NJIC 3H0FA 1WXTA 2ESWA 3UPUA 5KYXB 1K9AA 2OTLA 2DBMA 2R58A 3NMZC 2DRKA 3OYJA 1D09B 1M3AA 4M7AG 2KXCA 3O8VA 3OMCA 5GMKe 5CKBA 3JB9J 3L2UA 2MMPA 4A4EA 1H92A 2A08A 3FEOA 4MZPA 3OYNA 2XI9A 2LCLA 1T3SA 1PSEA 4RMOA 2QA4Q 3ME9A 4PKCC 4A53A 2PUKB 3JCMX 2NUZA 1Y96A 1VQ6A 1YITQ 5AT1B 2D8JA 1WDXA 2DIGA 4RG2A 3LH5A 5CO7A 4M77G 1HYOA 4M7DE 1WYXA 2BTTA 2I2LA 2KQWA 2CT3A 1MMDA 3QYGB 4KT0E 2YHTA 3OY9A 2YRVA 1M90C 1AVZC 1S72A 3OYHA 2FYKA 2PTKA 4FYWB 4J6XA 5CQYA 3EFOA 2QAZA 3QYHB 4OGCA 1WHHA 2RPNA 3HL8A 3OYLA 4Z88A 2EBPA 3Q1JA 4CC2A 3CCUT 2YDLA 1TWBA 5C6SA 4XTUA 1H641 2E6ZA 4AFUC 1D0XA 2K7AA 1YJ9Q 1YJ9T 2XK0A 1K8AC 2DETA 1SHFA 1SRLA 4C8QF 2JTMA 2VXFA 1Q7YR 4O5VA 5KYWA 5FRMA 5LJ5g 1RAFB 5CQXA 5LL6S 1WA7A 4E7SA 4RUGA 1SSFA 2RJEA 2DZCA 2RJFA 1X43A 1K73C 1VQ6Q 1TOVA 4OMPA 1YI2A 1ZQ1A 4GLKA 4PFOA 5GAN4 3M56A 2WSEE 2ROLA 3TREA 2COWA 4A63B 1ABQA 3X25B 1AD5A 1VQ9T 2HSEB 2QGFB 1E6GA 3CCQQ 1YI2Q 2SEMA 2DL3A 1UUEA 3EG2A 1WIEA 4VUBA 3X26B 4HVUA 2RQRA 3JCMe 3OMGA 3CCQA 3TQ7P 1NBEB 3M59A 4QQDA 4ATOA 4M77F 2ZPHB 3M53A 4M78G 3PE0A 1NG2A 2VWFA 2D0QB 2CZ7B 3CD6A 1VQLA 3HRUA 2GNCA 1D0ZA 2RK1A 2QDYB 1UEBA 4ZGEB 3JCMV 2HBWA 2HQXA 1SKUB 1HXDA 1YBYA 2RD1A 1VQLQ 4B9WA 4IUPA 1K0SA 2EYYA 2NLUA 1Y7XA 4C92E 3V8LA 1GBRA 1N6AA 1PWTA 3HSBA 4AMCA 1RAAB 4Y28E 3VRYA 4FT4A 2DRMA 3G4SQ 5HCKA 4C0DB 2CP2A 4C8QG 4D8DA 2QI2A 4LDWA 2MF2A 3MKDA 2A3LA 2JJ9A 2C0OA 3BFMA 2RI3A 1B07A 4BACA 3FRNA 1LOJA 5GJWB 2KMTA 1UGSB 3ZL7C 1BI2A 1SRMA 4C0DC 2ZCFB 2OTJQ 5LJ5j 1D1CA 1UGVA 5GAOq 2QGGA 1YHQT 3CCEQ 2L3PA 1MHNA 2DVEA 3GIBA 2H3EB 4HCKA 1VQ4A 4PLIA 2F2XA 2JN0A 3L1AA 1S72T 2XIDA 2RQTA 2X3WD 1OZ3A 1YIJT 2E5QA 1S1NA 5CKDA 1VYUA 1K76A 2K5IA 2QEXT 5GAOr 4J6WA 4IURA 2HKNA 3LGFA 3JCMf 4C5EA 3CCJA 1X6OA 1VIFA 2DYBA 1WNLA 1W4SA 4RTWA 5KYYB 2PU9B 3KBGA 5GMKm 3EH2A 1OQKA 1ZA2B 4DOVA 4AG1C 1PD0A 4B9XA 2HMAA 1ZSZB 3QWYA 3H8ZA 2VVKA 2LT1A 2A7YA 4M77C 1X6GA 5FWCA 1GCQC 2KBTA 1M30A 1FX7A 1Q82C 2JUFA 3VKIA 2E65A 3REBB 1QVGP 3QG1A 2QG9B 4OMNA 4FSXA 3EFSA 4PJNA 1YJNA 2L3QA 1MV3A 2XU8A 2EQUA 3X20B 4KBMB 1WHMA 4KUDK 3CCUQ 2YLBA 4OB2B 2FPEA 5IH2A 2CH4A 1VA7A 2CZ6B 2MWPA 4BDZA 1WGSA 4LDVA 4UC4A 1FMKA 1I0CA 2QASA 3KXTA 1VQMT 1YIJQ 1Z9QA 2BUDA 1T0HA 3MP6A 5GAMd 5LJ3e 1NZ9A 3RKYA 2K3YA 3KFVA 2VGMA 3CQTA 2CZ0B 3CCJT 4AFQC 2D8HA 2X4YA 1BI1A 1V76A 3SB2A 1IGUA 3CC2A 2A36A 2XG8D 4FM4B 1VQLT 1F1BB 4J9BA 4OB3B 1U1TA 1IO6A 2RJDA 2YT6A 1G3WA 4Z8AA 1KQSS 3D7SB 2KVQG 1WI7A 3RMSA 3CPWS 3ZFJA 3UT1A 1UDLA 1JXOA 4M78B 1VQ5A 1BK2A 3G6ET 2KEAA 2LC4A 2KAFA 3RNJA 1NYFA 8ATCB 1CKBA 2EGEA 3H0IA 2VKNA 2ZZDA 1QMCA 1ZX6A 2LQWA 1VQ5Q 1Q86R 3QO3A 1ZA1B 2OAUA 3VYGA 1YI2T 3OBYA 1TXQA 1QW1A 1TU0B 2LJ3A 5GAN7 1VQ4T 1NPPA 4M78D 3EGXB 4FCYA 2AK5A 3THKA 4AFSC 1KD1R 1JB0E 4PJJA 1WQWA 4HT8A 5FU7B 4M78E 2DXUA 3JAME 4XTWA 1RADB 1YP5A 1R8OB 3M54A 2KYMA 4PLLA 1PRMC 3JCMg 1XNIA 4PJMA 2KRSA 2P0PA 4LDUA 4NS5A 1K8AR 2EAYA 3L2RA 4EIKA 3RKXA 2QQ9A 2RMOA 2VASA 4JJNK 1FWZA 1U8RA 4ZTJA 2LJ1A 4C8QA 2AZSA 2LQNA 4EPCA 5FLXE 2MI6A 1QKXA 4F7UA 2ED1A 5CK9A 5GMKi 5FW9A 4HCCA 1WFWA 4BI8B 4ANJA 3V7CA 3CCLT 1Y71A 5FRNA 1G2BA 2FL7A 1VIEA 1IREB 2A0FB 3M58A 5KYYA 5FROA 3MJXA 5LJ3d 5LJ5f 5GANd 4C8QC 3RESA 2JVVA 2VB6A 5EC7A 4OMOA 1BYMA 1BCOA 1I5OB 4GY5A 4KH1B 2G3RA 1K9MC 4LXCA 2D0NA 2OTJT 3G1JA 4BE1A 3CCLA 4BI3A 3V8KA 1RLPC 1UGRB 1HD3A 2CREA 3OYDA 1XJWB 4PK4A 2XICA 5FU6C 3EGXA 1TG0A 2V8IA 3LX7A 3M4YA 3UA7A 2CUDA 3JCMh 4JJDA 5GAOl 3I55A 2JM9A 2MK5A 4FW2A 1ZUKA 1D1BA 1EFNA 3VS0A 1IZ6A 4O6JA 2OTLT 4DA4A 3HP9A 3EHRA 2KT8A 3C95A 4M7AB 2DLPA 3TEEA 4C92D 3TU4K 4L6V5 2E3IA 2HZYA 1XTDA 1IXDA 3OA6A 1NPRA 4N4IA 4M77A 4C8QD 2KT1A 2H3JA 1YHQA 4EMKB 1R0BG 2MCNA 1PKSA 5A0GA 4XU2A 3OB9A 5CKFA 1WXUA 3MCAB 1YJ9A 3OS0A 1R0CB 2B86A 2NUTA 2GQIA 1UHFA 2L3RA 1D3BA 4FYVB 4C92A 3TCJA 2OAWA 2H8HA 5GANj 2D1XA 4EMKC 1G3TA 4V2SA 4BUGA 4J9FA 1VQ5T 1Q86U 3CCQT 1AZGB 1WJSA 3QJYA 2MYSA 1KD1C 2K6DA 1RAGB 1ZUUA 4OP0A 1JBMA 1K1ZA 3VUZA 2RA2A 3CCEA 4M78A 5KYUA 1HJDA 4BDYA 3EFRA 1S72Q 3OYIA 3FB9A 3S3MA 1OX9A 2OX7A 2DXCA 3QZ9B 1G8XA 2R5MA 2YRCA 3FJ5A 3JCMP 1IHVA 3PVQA 4CC3A 1VOMA 4Y92A 3JSCA 2FRWA 3M55A 4FU6A 4J9HA 2Y90A 5LJ3f 1VQNT 2E41A 1KD1U 2M16A 4MMKA 3CMEA 2GBQA 3CXCP 3GOXA 4HKEA 4HVWA 2O31A 1ZUYA 1FXXA 3PTAA 3NPFA 1LJOA 1BKBA 5GAN3 1M5Q1 2BKDN 1KC8R 5HK3A 2NYSA 2BE7D 3CCRQ 4ZGJB 1MMNA 3SFMA 3NTHA 5GAMh 5CR2A 5D7UA 2K3XA 3CCUA 3J80E 1H3ZA 2ABLA 1ZBXA 3L2WA 4JZ3A 2YUQA 3M4GA 2YUOA 1V29B 4F7UB 4M7DC 5GAMg 2DERA 1QWEA 2PVGB 4XAXB 1I4K1 4KGZB 2JM8A 1M9SA 2RQWA 3UWNA 2FZCB 2RF0A 1JEGA 2IIMA 1BU1A 2E1HA 3JV3A 5KYUB 1BBZA 3EG3A 1ZBJA 3CMAA 1VQMQ 2EIFA 4CRIA 1VQPT 2V26A 4PJOD 1RAIB 1YWPA 2EKHA 2BZ8A 3EG9B 1MNEA 1U06A 4JPBW 2X4XA 4B6MA 2RJCA 1TTHB 2ZGWA 1O9SA 3H6ZA 3PMTA 4XU1A 1QQJA 2FZKB 5KE3A 2XD0A 4WCIA 2CKKA 2ROTA 1Q95G 4LD9K 1VQNQ 4OB1B 3GLXA 1Q82R 1BIAA 4X34A 2JNGA 1OPLA 2QA4A 1VQNA 1T3LA 3LWHA 4M7DG 4M7AA 4OMFB 3I5RA 1TUDA 2EPDA 4E2FB 3MPUB 1PG5B 4JDSA 1H8KA 1ZSZA 2WSCE 1X2QA 2VC8A 4E7HA 3PFSA 3AT1B 2EYZA 2R5AA 2JW4A 5IN1A 2E6NA 4N4GA 1VQOA 4ELZC 3E2UA 1AWJA 3P8BB 3SHWA 1DJ7B 5FU6B 2QTVA 1VYVA 2RNAA 3S3OA 2NUTB 1JO8A 4E7IA 1AT1B 4XQ3A 1UHCA 2M02A 1FMVA 3VV0A 2CYZB 2XHCA 4J8OA 1OPKA 1QP2A 4JJBA 4LUDA 1UECA 4DQ2A 1Y57A 4MDXA 5GAMj 1AEYA 1R77A 8AT1B 4A4GA 2F2WA 1KC8C 1Q86C 2VV5A 6AT1B 4ZTFA 1KFZA 1OX8A 1RUWA 1ARKA 2YUPA 3R6NA 2DTHA 4EMKA 1RAHB 2DJZA 1LNXA 2B8AA 2E64A 1OU8A 4PJOA 1OEBA 1JXMA 3GNFB 3VS4A 2IVWA 3CCST 2OJ2A 1BI0A 2JZ2A 5LJ5d 3VS2A 1FMWA 3QBYA 1OYXA 1JJ2S 2QA4T 1SG5A 3A5ZB 4JS4A 2CP7A 1Q81R 1M90U 3VS7A 4Z02A 4GBQA 3OYEA 4M7DF 2KY9A 4M7AD 2DTOA 5CAIA 1WQ7A 2VUBA 4BY6C 3G4SA 5LJ5e 4LUEA 4RTXA 4R55A 5GMKj 1WX6A 3JCMW 2K57A 4E6RA 4JRQA 2HEQA 1N9SA 2RHZA 3BDUA 3R6OA 4JUVA 5IHIA 5GMKl 2OI3A 4PFPA 4KUIA 3OYFA 4OVAA 2Y4YA 5GANg 1WZOA 3M5AA 3I56A 3CCVA 1RI0A 1HK9A 1Q7YU 1PCXA 1TS9A 1GCPA 4ZN3A 1LVKA 3HFNA 1KG1A 3AHUA 2EYQA 1M8VA 2WACA 2EGCA 4CI0C 3NTIA 1M4ZA 1QLYA 4J9EA 2RB6A 2DD5A 4RTUA 1NJIU 1WJRA 5GAN2 2P4RA 3QPHA 3SWNC 1M2VA 4ZNXA 3CCRT 4OMMA 1PC0A 3QDFA 4K11A 3PGGA 5IHNA 4OMLA 3CD6T 1RAEB 1M8MA 2D9TA 1QVGS 3M0SA 3HRSA 3JCMQ 1WJQA 2QXFA 1YITA 3OYGA 3X28B 1LPLA 2XKOC 1PSFA 3HHTB 1B3QA 3URGA 4ME7A 1C6VX 1N5ZA 3VS5A 4WF2A 3GNGA 2LVMA 1M3BA 2QK0A 3MEUA 1NJIR 3EGDB 1G3SA 3GPLA 2SRCA 2K4YA 5GANf 4F17A 1VQ7A 2J6KA 1YIJA 4J5YA 1QKWA 1I07A 2RK2A 4M7DD 1G5VA 2IG0A 4LN2A 4DEYA 2MOXA 1KK7A 3GBQA 2O4XA 3QWXX 3SD4A 2QQRA 2DK3A 2DEUA 1QVGA 2DL8A 1Y96B 2EJFA 1IRXA 1J3TA 1M1GA 5FWBA 4J7FA 2QQAA 1JQQA 2EKOA 3CBOA 4HCZA 4C92G 4IUQA 1QVFP 2LNHB 1B34B 2CGHA 1NLOC 2YRDA 2FPFA 3C4SA 3NHNA 5GMKh 2RHUA 4DBHA 2E70A 1XQHA 4J9IA 3GP8A 3A1PA 3E9FA 4FYYB 3P8HA 3KUFA 3CC4A 3L42A 2DVJA 3SWNA 4IUTA 4ZN1A 3UATA 4JLGA 4E7ZA 4XU0A 1YNZA 2EFIA 1VQ6T 3CXCA 3CMET 3EGDA 4C5GA 3J81E 2LJ0A 3I9QA 3MEAA 3G71A 2EQIA 1UFFA 3SDZA 4EMGA 1E6HA 5GAMf 5D6XA 4AT1B 3VS3A 5J3BA 2DAQA 4Z89A 4MMLA 2RQUA 2L3SA 1NLPC 2QQSA 3G4ST 1D1AA 1KQ1A 2WSFE 2QTXA 1KQSA 2LT4A 4M78C 1YWOA 2VGNA 1VQ9A 5IHKA 5CKHA 4M75A 1W1FA 4PJOB 2LMJA 1SPKA 5D6WA 5L8RE 2LDMA 1CKAA 4JJCA 4MDWA 3DLMA 4A54A 5LJ3g 1MGQA 3CMEQ 2C0IA 4JRKA 1VQOQ 4QQGA 3PT9A 2FZGB 3JB9D 1M1KU 1Q7YC 3HKSA 2KYBA 4BY6B 1QCFA 3BY7A 3M0TA 4A4HA 4X1VA 2DTIA 2KRMA 1HSQA 4FT2A 4QKUA 2Z0WA 1K8AU 5KCOA 2P4TA 2RO0A 2PVOB 5CVIA 1NE8A 4FSSA 3EG0A 3CCMQ 1G83A 1VQ8T 2MIOA 4JLIA 5A0LA 4KRTA 3M0PA 2J06A 3X24B 3F70A 2KROA 1KC8U 3LYIA 2RN8A 3RR6A 1MUZA 3U23A 1MV0B 3C12A 4PJOG 3ZEHA 4PJLA 2GCXA 2FO0A 2KNBB 3CMAT 1N9RA 2CS7A 2FHDA 5GANe 3L2VA 2RI2A 4F04B 4Y91A 3BW1A 3OBWA 1SHGA 2JTFA 1D3BB 3OS2A 4QT7A 1K9MR 2DL4A 2W0ZA 2M9UA 4M75B 2DKGA 3MO8A 4RKUE 1MNDA 1G3YA 3LGLA 2AHJB 3CBMA 4IUUA 3MEWA 4HCBA 2F5TX 2JOYA 2EQKA 1GFDA 1VQ8A 1M27C 4LNPA 1K4US 3MEVA 2QQBA 1QWFA 2O4XB 1RL2A 4C0GA 5L23A 1WLPB 4E7JA 1UE9A 3OYBA 1K0XA 1W6XA 1K9MU 1RLQC 3S6WA 2W10A 2YSQA 1N8RC 1ZSZC 4E47A 2QDLA 4M75D 3CC2T 2CDTA 3OQ5A 2BZYA 4DBQA 4ESRA 4F7UE 1JJ2P 4IIMA 2GFAA 3M0QA 1YFNA 2MPXC 4C5HA 2X4WA 4M7AC 3I56Q 3CCVQ 2K5LA 3VJPA 3DLLA 4RTYA 3OSVA 3JB9H 2CH4W 3CBPA 3VU3C 5KCHA
chains in the Genus database with same CATH topology
3QWYA 2VVKA 1PKTA 2EYZA 2EVRA 2JW4A 3H0HA 1X6GA 5FWCA 1GCQC 1PHTA 2KBTA 3O5ZA 1CSKA 1M30A 3I35A 3EHQA 5GJVB 4CC7A 1AWJA 1UJ0A 4IIOA 3REBB 3SHWA 2K9GA 2EYXA 5I22A 3VS1A 1VYVA 2RNAA 4OMNA 4J9CA 2KE9A 1JO8A 2DNUA 3VRZA 1NEGA 2L3QA 1MV3A 2M51A 2A37A 1UTIA 1UHCA 2JS2A 1SEMA 2PNIA 2FPDA 2FPEA 2F2VA 1OPKA 4D8KA 5IH2A 1AWOA 3I5SA 4JJBA 4LUDA 2CH4A 1VA7A 1UECA 1Y57A 2C0TA 1AEYA 1FMKA 1I0CA 2F2WA 2E5KA 2EGAA 2J6FA 2JTEA 1UG1A 1SSHA 1Z9QA 1RUWA 1ARKA 1KFZA 1A0NB 1T0HA 2YUPA 1KSWA 2LX7A 3R6NA 1NEBA 2HSPA 3KFVA 1OEBA 1JXMA 1X6BA 3VS4A 3CQTA 2OJ2A 3PVLA 3VS2A 4F16A 4AFQC 2D8HA 2DMOA 3TSZA 1KIKA 1V1CA 1YCSB 2A36A 2LZ6B 2RQVA 4J9BA 1AOJA 3VS7A 1IO6A 2YT6A 4Z8AA 1M3CA 4GBQA 3REAB 1WI7A 2GGRA 2L2PA 1UDLA 4HVVA 1JXOA 1BK2A 4LUEA 4RTXA 4R0KA 1E7OA 1WX6A 2KEAA 2KGTA 4HXJA 3RNJA 1NYFA 1UJYA 4E6RA 2HEQA 1CKBA 2EGEA 3H0IA 2VKNA 5IHIA 2OI3A 2LQWA 1ZX6A 2CSIA 1U5SA 1GBQA 4J9GA 2ECZA 2AKKA 2EW3A 2G6FX 2JS0A 1GCPA 2LJ3A 2XMFA 1RI9A 1OV3A 2DE0X 2V1RA 3TVTA 3EGUA 4GLMA 2AK5A 3THKA 4AFSC 1NYGA 2JXBA 1NM7A 2EGCA 3UF4A 1QLYA 2JMAA 4J9EA 2LCSA 1GL5A 1I1JA 1YP5A 4RTUA 2KYMA 2P4RA 1PRMC 2YUNA 5IXFA 4ZNXA 2KRSA 2DILA 3NGPA 4OMMA 4K11A 4RTTA 5IHNA 4EIKA 2JT4A 4OMLA 2RMOA 2PZ1A 2KRNA 1GCQA 1M8MA 2X3XD 3M0SA 1AZEA 2J6OA 1GRIA 1ZLMA 2DJQA 2LJ1A 2KXDA 2K3BA 1X27A 2AZSA 2LQNA 1QKXA 2ED1A 1KJWA 1B3QA 4AFZC 5FW9A 1WFWA 1N5ZA 3VS5A 1LCKA 3C0CA 4F14A 1G2BA 4RTZA 1FYNA 2I0NA 2O9SA 3UA6A 1M3BA 1PRLC 1OOTA 4LE9A 3H0FA 1AWWA 1WXTA 2ESWA 4CC4B 2V1QA 3H41A 1X69A 5EC7A 4OMOA 1K9AA 3ULRB 2KR3A 1ZSGA 1JU5C 2DBMA 2SRCA 3NMZC 2DRKA 4F17A 1M3AA 2J6KA 2KXCA 2D0NA 1QKWA 1I07A 2NWMA 2BZXA 1RLPC 1HD3A 4LN2A 1H92A 4DEYA 2A08A 2MOXA 2CREA 3VS6A 3GBQA 1YN8A 3QWXX 1T3SA 2DL8A 1TG0A 1U3OA 3UA7A 2L0AA 2NUZA 2CUDA 1J3TA 4JJDA 2JM9A 1ZUKA 2D8JA 1EFNA 1WDXA 5FWBA 3VS0A 3LH5A 1WYXA 1JQQA 2BTTA 3EHRA 2O88A 3EG1A 2KT8A 3A98A 2CT3A 3M0RA 2DLPA 2LNHB 1NLOC 1X2KA 2DX1A 2FPFA 3NHNA 5ECAA 1AVZC 4OMQA 4J9IA 2A28A 2PTKA 2DL7A 2KT1A 2RPNA 2JMCA 2MCNA 1PKSA 4Z88A 2EBPA 4CC2A 2DVJA 2YDLA 5I11A 1WXUA 3UATA 2GTOA 2B86A 2GQIA 1YNZA 4AFUC 2K7AA 1UHFA 1GFCA 5IXBA 1SHFA 3RBBB 1SRLA 2OAWA 2LJ0A 2H8HA 3I9QA 2D1XA 2EQIA 1UFFA 2HDAA 1E6HA 4J9FA 3VS3A 1WA7A 1Y0MA 1AZGB 4Z89A 2RQUA 2L3SA 1NLPC 4RUGA 2K6DA 3M0UA 1ZUUA 4AG2C 2ENMA 2GTJA 1VYTA 1K1ZA 1X43A 1HJDA 2FRYA 4OMPA 1W70A 1YWOA 2J05A 2DL5A 2ROLA 2K79A 5IHKA 3IQLA 4A63B 1W1FA 1ABQA 4DEXA 2DA9A 1AD5A 2LMJA 1SPKA 1E6GA 2J7IA 2AKLA 3FJ5A 2SEMA 2DF6A 3PVQA 1CKAA 2DL3A 4JJCA 4CC3A 2HCKA 1UUEA 3EG2A 1WIEA 4Y92A 4HVUA 2O2OA 2RQRA 2C0IA 2O9VA 2CUBA 1PNJA 2FRWA 4J9HA 1T0JA 2GBQA 1WXBA 4HVWA 2O31A 1ZUYA 3PE0A 3NPFA 1NG2A 2VWFA 2FEIA 2KYBA 1QCFA 2AZVA 3M0TA 4X1VA 1Z9ZA 1H3HA 2KRMA 4JZ4A 1HSQA 2GNCA 4RTVA 2HBWA 1AWXA 3SEMA 2FG0A 4FSSA 2ED0A 3TSWA 2LP5A 3EG0A 2ABLA 1G83A 4JZ3A 1K0SA 2MIOA 2EYYA 4KRTA 2YUQA 3M0PA 2J06A 1GBRA 2YUOA 2KROA 2RN8A 1PWTA 2CSQA 1MUZA 1QWEA 3U23A 1MV0B 3VRYA 2DRMA 5HCKA 2DBKA 2JM8A 2FO0A 2K2MA 2RQWA 2KNBB 2RF0A 4D8DA 1JEGA 2IIMA 1BU1A 3JV3A 1BBZA 3EG3A 1SHGA 1ZBJA 2C0OA 1B07A 4QT7A 2DL4A 1YWPA 2W0ZA 2EKHA 5GJWB 1BB9A 2BZ8A 3ZL7C 1SRMA 1U06A 4JPBW 4J9DA 1UGVA 1XOVA 2L3PA 2EYWA 1GFDA 1M27C 4LNPA 4HCKA 1K4US 2F2XA 4WCIA 1QWFA 2ROTA 2RQTA 2X3WD 5L23A 1S1NA 1WLPB 1UE9A 4M4ZA 1K0XA 1VYUA 1W6XA 1K76A 2DM1A 1RLQC 2M0YA 2W10A 2YSQA 1OPLA 2QDLA 4ORZA 2CDTA 2DYBA 2CT4A 1ABOA 2BZYA 4RTWA 1T3LA 4ESRA 4IIMA 3M0QA 3I5RA 1TUDA 2EPDA 4RTYA 4AG1C 1H8KA 2CH4W 1X2QA 1TUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWY A;  2VVK A;  1PKT A;  2EYZ A;  2EVR A;  2JW4 A;  3H0H A;  1X6G A;  5FWC A;  1GCQ C;  1PHT A;  2KBT A;  3O5Z A;  1CSK A;  1M30 A;  3I35 A;  3EHQ A;  5GJV B;  4CC7 A;  1AWJ A;  1UJ0 A;  4IIO A;  3REB B;  3SHW A;  2K9G A;  2EYX A;  5I22 A;  3VS1 A;  1VYV A;  2RNA A;  4OMN A;  4J9C A;  2KE9 A;  1JO8 A;  2DNU A;  3VRZ A;  1NEG A;  2L3Q A;  1MV3 A;  2M51 A;  2A37 A;  1UTI A;  1UHC A;  2JS2 A;  1SEM A;  2PNI A;  2FPD A;  2FPE A;  2F2V A;  1OPK A;  4D8K A;  5IH2 A;  1AWO A;  3I5S A;  4JJB A;  4LUD A;  2CH4 A;  1VA7 A;  1UEC A;  1Y57 A;  2C0T A;  1AEY A;  1FMK A;  1I0C A;  2F2W A;  2E5K A;  2EGA A;  2J6F A;  2JTE A;  1UG1 A;  1SSH A;  1Z9Q A;  1RUW A;  1ARK A;  1KFZ A;  1A0N B;  1T0H A;  2YUP A;  1KSW A;  2LX7 A;  3R6N A;  1NEB A;  2HSP A;  3KFV A;  1OEB A;  1JXM A;  1X6B A;  3VS4 A;  3CQT A;  2OJ2 A;  3PVL A;  3VS2 A;  4F16 A;  4AFQ C;  2D8H A;  2DMO A;  3TSZ A;  1KIK A;  1V1C A;  1YCS B;  2A36 A;  2LZ6 B;  2RQV A;  4J9B A;  1AOJ A;  3VS7 A;  1IO6 A;  2YT6 A;  4Z8A A;  1M3C A;  4GBQ A;  3REA B;  1WI7 A;  2GGR A;  2L2P A;  1UDL A;  4HVV A;  1JXO A;  1BK2 A;  4LUE A;  4RTX A;  4R0K A;  1E7O A;  1WX6 A;  2KEA A;  2KGT A;  4HXJ A;  3RNJ A;  1NYF A;  1UJY A;  4E6R A;  2HEQ A;  1CKB A;  2EGE A;  3H0I A;  2VKN A;  5IHI A;  2OI3 A;  2LQW A;  1ZX6 A;  2CSI A;  1U5S A;  1GBQ A;  4J9G A;  2ECZ A;  2AKK A;  2EW3 A;  2G6F X;  2JS0 A;  1GCP A;  2LJ3 A;  2XMF A;  1RI9 A;  1OV3 A;  2DE0 X;  2V1R A;  3TVT A;  3EGU A;  4GLM A;  2AK5 A;  3THK A;  4AFS C;  1NYG A;  2JXB A;  1NM7 A;  2EGC A;  3UF4 A;  1QLY A;  2JMA A;  4J9E A;  2LCS A;  1GL5 A;  1I1J A;  1YP5 A;  4RTU A;  2KYM A;  2P4R A;  1PRM C;  2YUN A;  5IXF A;  4ZNX A;  2KRS A;  2DIL A;  3NGP A;  4OMM A;  4K11 A;  4RTT A;  5IHN A;  4EIK A;  2JT4 A;  4OML A;  2RMO A;  2PZ1 A;  2KRN A;  1GCQ A;  1M8M A;  2X3X D;  3M0S A;  1AZE A;  2J6O A;  1GRI A;  1ZLM A;  2DJQ A;  2LJ1 A;  2KXD A;  2K3B A;  1X27 A;  2AZS A;  2LQN A;  1QKX A;  2ED1 A;  1KJW A;  1B3Q A;  4AFZ C;  5FW9 A;  1WFW A;  1N5Z A;  3VS5 A;  1LCK A;  3C0C A;  4F14 A;  1G2B A;  4RTZ A;  1FYN A;  2I0N A;  2O9S A;  3UA6 A;  1M3B A;  1PRL C;  1OOT A;  4LE9 A;  3H0F A;  1AWW A;  1WXT A;  2ESW A;  4CC4 B;  2V1Q A;  3H41 A;  1X69 A;  5EC7 A;  4OMO A;  1K9A A;  3ULR B;  2KR3 A;  1ZSG A;  1JU5 C;  2DBM A;  2SRC A;  3NMZ C;  2DRK A;  4F17 A;  1M3A A;  2J6K A;  2KXC A;  2D0N A;  1QKW A;  1I07 A;  2NWM A;  2BZX A;  1RLP C;  1HD3 A;  4LN2 A;  1H92 A;  4DEY A;  2A08 A;  2MOX A;  2CRE A;  3VS6 A;  3GBQ A;  1YN8 A;  3QWX X;  1T3S A;  2DL8 A;  1TG0 A;  1U3O A;  3UA7 A;  2L0A A;  2NUZ A;  2CUD A;  1J3T A;  4JJD A;  2JM9 A;  1ZUK A;  2D8J A;  1EFN A;  1WDX A;  5FWB A;  3VS0 A;  3LH5 A;  1WYX A;  1JQQ A;  2BTT A;  3EHR A;  2O88 A;  3EG1 A;  2KT8 A;  3A98 A;  2CT3 A;  3M0R A;  2DLP A;  2LNH B;  1NLO C;  1X2K A;  2DX1 A;  2FPF A;  3NHN A;  5ECA A;  1AVZ C;  4OMQ A;  4J9I A;  2A28 A;  2PTK A;  2DL7 A;  2KT1 A;  2RPN A;  2JMC A;  2MCN A;  1PKS A;  4Z88 A;  2EBP A;  4CC2 A;  2DVJ A;  2YDL A;  5I11 A;  1WXU A;  3UAT A;  2GTO A;  2B86 A;  2GQI A;  1YNZ A;  4AFU C;  2K7A A;  1UHF A;  1GFC A;  5IXB A;  1SHF A;  3RBB B;  1SRL A;  2OAW A;  2LJ0 A;  2H8H A;  3I9Q A;  2D1X A;  2EQI A;  1UFF A;  2HDA A;  1E6H A;  4J9F A;  3VS3 A;  1WA7 A;  1Y0M A;  1AZG B;  4Z89 A;  2RQU A;  2L3S A;  1NLP C;  4RUG A;  2K6D A;  3M0U A;  1ZUU A;  4AG2 C;  2ENM A;  2GTJ A;  1VYT A;  1K1Z A;  1X43 A;  1HJD A;  2FRY A;  4OMP A;  1W70 A;  1YWO A;  2J05 A;  2DL5 A;  2ROL A;  2K79 A;  5IHK A;  3IQL A;  4A63 B;  1W1F A;  1ABQ A;  4DEX A;  2DA9 A;  1AD5 A;  2LMJ A;  1SPK A;  1E6G A;  2J7I A;  2AKL A;  3FJ5 A;  2SEM A;  2DF6 A;  3PVQ A;  1CKA A;  2DL3 A;  4JJC A;  4CC3 A;  2HCK A;  1UUE A;  3EG2 A;  1WIE A;  4Y92 A;  4HVU A;  2O2O A;  2RQR A;  2C0I A;  2O9V A;  2CUB A;  1PNJ A;  2FRW A;  4J9H A;  1T0J A;  2GBQ A;  1WXB A;  4HVW A;  2O31 A;  1ZUY A;  3PE0 A;  3NPF A;  1NG2 A;  2VWF A;  2FEI A;  2KYB A;  1QCF A;  2AZV A;  3M0T A;  4X1V A;  1Z9Z A;  1H3H A;  2KRM A;  4JZ4 A;  1HSQ A;  2GNC A;  4RTV A;  2HBW A;  1AWX A;  3SEM A;  2FG0 A;  4FSS A;  2ED0 A;  3TSW A;  2LP5 A;  3EG0 A;  2ABL A;  1G83 A;  4JZ3 A;  1K0S A;  2MIO A;  2EYY A;  4KRT A;  2YUQ A;  3M0P A;  2J06 A;  1GBR A;  2YUO A;  2KRO A;  2RN8 A;  1PWT A;  2CSQ A;  1MUZ A;  1QWE A;  3U23 A;  1MV0 B;  3VRY A;  2DRM A;  5HCK A;  2DBK A;  2JM8 A;  2FO0 A;  2K2M A;  2RQW A;  2KNB B;  2RF0 A;  4D8D A;  1JEG A;  2IIM A;  1BU1 A;  3JV3 A;  1BBZ A;  3EG3 A;  1SHG A;  1ZBJ A;  2C0O A;  1B07 A;  4QT7 A;  2DL4 A;  1YWP A;  2W0Z A;  2EKH A;  5GJW B;  1BB9 A;  2BZ8 A;  3ZL7 C;  1SRM A;  1U06 A;  4JPB W;  4J9D A;  1UGV A;  1XOV A;  2L3P A;  2EYW A;  1GFD A;  1M27 C;  4LNP A;  4HCK A;  1K4U S;  2F2X A;  4WCI A;  1QWF A;  2ROT A;  2RQT A;  2X3W D;  5L23 A;  1S1N A;  1WLP B;  1UE9 A;  4M4Z A;  1K0X A;  1VYU A;  1W6X A;  1K76 A;  2DM1 A;  1RLQ C;  2M0Y A;  2W10 A;  2YSQ A;  1OPL A;  2QDL A;  4ORZ A;  2CDT A;  2DYB A;  2CT4 A;  1ABO A;  2BZY A;  4RTW A;  1T3L A;  4ESR A;  4IIM A;  3M0Q A;  3I5R A;  1TUD A;  2EPD A;  4RTY A;  4AG1 C;  1H8K A;  2CH4 W;  1X2Q A;  1TUC A; 
#chains in the Genus database with same CATH topology
 4PL6 A;  3OYK A;  4LD6 A;  1PKT A;  4PFZ A;  4FW1 A;  3JB9 G;  1PHT A;  3O5Z A;  5GJV B;  4CC7 A;  2CP0 A;  1UJ0 A;  4IIO A;  2K9G A;  2EYX A;  3CCJ Q;  2QYZ A;  5D6Y A;  3CC7 A;  3A8M B;  2ZPE B;  3DKM A;  2DNU A;  3VRZ A;  3NTK A;  4BE0 A;  5LJ3 h;  4QW2 A;  3CCS A;  3PIO A;  1RAC B;  3WVE B;  3JCM c;  2JS2 A;  3RMQ A;  3CC7 Q;  2YXY A;  3M9Q A;  1YJW Q;  4N0A C;  4PJO F;  1KHC A;  1K73 U;  3J7A F;  5GAN 6;  4RCC A;  4D8K A;  1AWO A;  1MMG A;  1B34 A;  1YHQ Q;  2L89 A;  4PNO A;  4A4K A;  3OYM A;  3VYH B;  4EMH A;  2ZPB B;  1UG1 A;  2JTE A;  1A0N B;  4OGE A;  2D6F A;  1NEB A;  3A8L B;  2HSP A;  4RG8 A;  1X6B A;  3OYY A;  3EG9 A;  3PVL A;  2DFU A;  1QCO A;  3RER A;  4F16 A;  2DMO A;  3TSZ A;  3JCM b;  3FC3 A;  4C0Z A;  3ASK A;  2E10 A;  2HBP A;  3CCM T;  2LZ6 B;  2F1L A;  2MWO A;  2RQV A;  2EQJ A;  1OU9 A;  1AOJ A;  3FLG A;  2XDP A;  1M3C A;  2P0Q A;  5KH6 A;  4FYX B;  2BE9 B;  2LQ8 A;  3REA B;  1M1F A;  4N4H A;  1K73 R;  2GGR A;  5DY9 A;  3CCE T;  1VQ7 Q;  2V8K A;  5DLQ E;  3WVD B;  2RM4 A;  4R0K A;  4HXJ A;  1UJY A;  3BDL A;  1UB4 A;  4XTV A;  1X75 C;  3JB9 F;  2M0O A;  2QEX Q;  2HQE A;  2Y4X A;  2P0K A;  2CSI A;  2EWN A;  1AHJ B;  2FVU A;  2CZ1 B;  1VQ9 Q;  1GBQ A;  4J9G A;  2ECZ A;  5HKC A;  2AKK A;  2L8D A;  2G6F X;  5M9O A;  2JS0 A;  3P8D A;  1EIF A;  1RI9 A;  3CCR A;  2DE0 X;  3TVT A;  4ELY C;  3E1S A;  2HNI A;  4X9C A;  2EJG A;  4M78 F;  4M77 D;  1NM7 A;  1EZZ B;  3UF4 A;  1YJN Q;  2X51 A;  3QII A;  2PQW A;  2LCS A;  1VQP Q;  3E9G A;  3QZ5 B;  2OTL Q;  2GFU A;  3VUB A;  2DZ9 A;  4LDX A;  1WHJ A;  3V7S A;  3ZBD A;  2E12 A;  4BE2 A;  2DXT A;  1OZ2 A;  3NGP A;  7AT1 B;  1YCY A;  2AIR B;  5AYF A;  1TUG B;  2JT4 A;  2YLC A;  1QVP A;  2KRN A;  1WHL A;  2X4J A;  3I56 T;  3CCV T;  3QJ6 A;  1KHI A;  5LJ3 j;  2GF7 A;  2DJQ A;  1X27 A;  1KQ2 A;  2XDD A;  1KJW A;  1QVF A;  2DIQ A;  3DB3 A;  2KI7 A;  2VYT A;  3C0C A;  4F14 A;  4RTZ A;  1FYN A;  2I0N A;  2O9S A;  1UGP B;  1PRL C;  3UA6 A;  1OOT A;  4LE9 A;  2QEX A;  2HD0 A;  1AWW A;  1TH7 A;  3G7Z A;  4CC4 B;  2V1Q A;  2EJ9 A;  3H41 A;  5KYW B;  1X69 A;  4PJO C;  1W2B A;  4XU3 A;  2DXB A;  3ULR B;  2KR3 A;  1ZSG A;  3OW2 P;  1JU5 C;  3V7R A;  1QCN A;  2CP6 A;  2HL5 C;  2NWM A;  3GF5 A;  2BZX A;  2PUO B;  3PNW C;  1BI3 A;  3VS6 A;  1YN8 A;  1VQP A;  3C94 A;  3OW2 A;  1U3O A;  3JCM J;  3OYC A;  2L0A A;  4LDY A;  1VQK Q;  2V8J A;  1C1A A;  2O88 A;  1Y07 A;  4F7U G;  4NL3 A;  3EG1 A;  3A98 A;  3M0R A;  3L2Q A;  1M2V B;  4IKF A;  1M1K R;  5DM7 R;  2HKQ B;  5C0M A;  1VQ4 Q;  1QVF S;  1X2K A;  2DX1 A;  5ECA A;  4OMQ A;  2ZAE A;  2A28 A;  3UDC A;  2DL7 A;  4FIB A;  3A8G B;  5FU7 C;  1EX4 A;  2JMC A;  2ZPF B;  2DYI A;  4HA8 A;  5I11 A;  4XTY A;  2DPP B;  2M1H A;  1PM3 A;  2GTO A;  3G6E Q;  3MP8 A;  4C92 B;  1GFC A;  1QP3 A;  1VQO T;  1OI1 A;  2RH2 A;  5IXB A;  2KSS A;  3RBB B;  2NUP A;  5CCA A;  5I2S A;  2FB7 A;  2HDA A;  2RI5 A;  1WPY A;  1Y0M A;  2PVD B;  3M0U A;  4AG2 C;  2ENM A;  2GTJ A;  5KYN A;  1VYT A;  1O75 A;  2MAM A;  2FRY A;  1W70 A;  2J05 A;  1YJN T;  2DL5 A;  2K79 A;  3IQL A;  4DEX A;  1M2O A;  2DA9 A;  3CPF A;  2COZ A;  4OF1 A;  2J7I A;  4JRP A;  5HY6 A;  2AKL A;  1SF9 A;  2DF6 A;  3MHX A;  2HCK A;  4KGX B;  3JCM d;  2ZPI B;  4PJO E;  4N0A A;  3QXE B;  2O2O A;  2O9V A;  2CUB A;  1PNJ A;  1UGQ B;  1T0J A;  3QKJ A;  4II1 A;  3JRZ A;  2GQV A;  1WXB A;  4F7U F;  4QVC A;  3G71 T;  3EAE A;  3RIR A;  3CXC S;  2FEI A;  5LJ5 h;  1U1S A;  2AZV A;  1Z9Z A;  1VQ7 T;  1H3H A;  4JZ4 A;  1M90 R;  3SWN B;  3HTR A;  3MET A;  4RTV A;  1ZHI A;  3DB4 A;  2EQM A;  1AWX A;  2F69 A;  3SEM A;  2FG0 A;  2ED0 A;  3TSW A;  4KUL A;  2LP5 A;  5A0D A;  4X9D A;  1RAB B;  1P92 A;  1IHW A;  2O01 E;  2LCC A;  3CC7 T;  1JJ2 A;  3N5B B;  2CSQ A;  3CCS Q;  4M75 C;  1M1K C;  2HAX A;  4JS5 A;  2DBK A;  2K2M A;  4NL2 A;  3JB9 I;  2XDB A;  3PMI A;  4DBF A;  3RUX A;  1PD1 A;  3CPW A;  4HT9 A;  4Q5W A;  1BIB A;  4C5I A;  3HPW A;  1D0Y A;  1BB9 A;  2LTO A;  3V8J A;  4RCB A;  5I2M A;  2RHX A;  4J9D A;  2IPO B;  1XOV A;  5I21 A;  1W2B S;  5KE2 A;  2EYW A;  2R57 A;  3FJP A;  2HL3 A;  3PIP A;  1C0M A;  3CPW P;  3H9N A;  2DD4 A;  3LLR A;  3FDR A;  3HFO A;  1N8R R;  4M4Z A;  3OS1 A;  1I81 A;  1VUB A;  2DM1 A;  2M0Y A;  4OB0 B;  1JRI A;  2K5F A;  3LW5 E;  4TVR A;  4ORZ A;  3OW2 S;  9ATC B;  3BE3 A;  2CT4 A;  4M75 G;  1ABO A;  4P5N A;  2AT1 B;  1WHK A;  4J83 A;  5EG2 A;  3G6E A;  3I55 T;  3E19 A;  4NOY A;  4R56 A;  4C92 F;  3CD6 Q;  5KYX A;  2E3H A;  2DO3 A;  2K2V A;  1TUC A;  3INZ A;  4BB7 A;  2E4H A;  2YWW A;  1YIT T;  2EVR A;  3H0H A;  4YTL A;  1CSK A;  3I35 A;  3EHQ A;  4BI4 A;  4L5G A;  3A8H B;  2VXE A;  4M75 E;  2LRQ A;  1Q82 U;  5I22 A;  3VS1 A;  5IT9 E;  4C8Q E;  3A8O B;  4J9C A;  2KE9 A;  2LNV A;  1NEG A;  1N8R U;  4M77 E;  1GXI E;  4L59 A;  4XTX A;  2M51 A;  2A37 A;  1UTI A;  1SEM A;  2PNI A;  2X35 A;  1VQK T;  4QQ6 A;  3FIF A;  2RHI A;  2FPD A;  3MP1 A;  4C0F A;  2F2V A;  4M7D A;  2F5K A;  3I5S A;  5GAO p;  1I5L A;  2LQK A;  2CP3 A;  3T9N A;  5J26 A;  2C06 A;  2C0T A;  3LH0 A;  3RDV A;  4A4F A;  4D6W A;  3ER0 A;  4J6Y A;  2E5K A;  1KQS P;  2EGA A;  2J6F A;  3EFO B;  1SSH A;  3CC4 T;  2ZPG B;  1KSW A;  2LX7 A;  3HRT A;  1WHG A;  4IUV A;  3G71 Q;  3OS5 A;  4ZGD B;  1Q81 C;  5IAY A;  3L2Z A;  4C92 C;  4E7K A;  1IGQ A;  2COY A;  1KIK A;  3I55 Q;  5J39 A;  2OTJ A;  1V1C A;  2NUP B;  1YCS B;  2KDS A;  1BCM A;  4M75 F;  1IB8 A;  4MZM A;  1ACM B;  1YJW T;  4XTZ A;  3WXM B;  2L2P A;  3QSU A;  4KGV B;  4M7A F;  5A2Q E;  4HVV A;  2HQH A;  2P84 A;  5GAO m;  1E7O A;  2KGT A;  4WTO B;  4DOW A;  5GAM e;  1TSF A;  5HK0 A;  1VQ8 Q;  1I8F A;  1Q81 U;  5CKE A;  4EDU A;  1U5S A;  3OSS C;  5CIU A;  2BIV A;  3CCM A;  2EW3 A;  3M57 A;  4QVD A;  2DEQ A;  4M7D B;  4J7I A;  2XMF A;  3QHS A;  1VQK A;  2KK4 A;  1OV3 A;  2RHY A;  2V1R A;  1W2B P;  3EGU A;  2LX9 A;  4GLM A;  4JRI A;  1NYG A;  2JXB A;  1N27 A;  1OUL A;  2CP5 A;  2JMA A;  3QUI A;  3OYA A;  3CC4 Q;  1GL5 A;  1I1J A;  1X01 A;  3S3N A;  2YUN A;  5IXF A;  3LWI A;  4E7L A;  4KH0 B;  2DIL A;  3CCL Q;  4MZT A;  3CEY A;  4RTT A;  4DBR A;  4FL6 A;  3CMA Q;  1VQM A;  2PZ1 A;  1GCQ A;  5GAN 8;  2L5Q A;  2X3X D;  1AZE A;  4M77 B;  2J6O A;  1GRI A;  2X9H A;  1ZLM A;  2KXD A;  4QVZ A;  2K3B A;  3EH1 A;  3QDR B;  4C8Q B;  5DLO A;  1MMA A;  3NFC A;  4AFZ C;  5GAO n;  4M7A E;  3CC2 Q;  1B7T A;  1LCK A;  4BD3 A;  3RKW A;  2ATC B;  5GAN h;  1YJW A;  4XK8 E;  5GAN 5;  1NJI C;  3H0F A;  1WXT A;  2ESW A;  3UPU A;  5KYX B;  1K9A A;  2OTL A;  2DBM A;  2R58 A;  3NMZ C;  2DRK A;  3OYJ A;  1D09 B;  1M3A A;  4M7A G;  2KXC A;  3O8V A;  3OMC A;  5GMK e;  5CKB A;  3JB9 J;  3L2U A;  2MMP A;  4A4E A;  1H92 A;  2A08 A;  3FEO A;  4MZP A;  3OYN A;  2XI9 A;  2LCL A;  1T3S A;  1PSE A;  4RMO A;  2QA4 Q;  3ME9 A;  4PKC C;  4A53 A;  2PUK B;  3JCM X;  2NUZ A;  1Y96 A;  1VQ6 A;  1YIT Q;  5AT1 B;  2D8J A;  1WDX A;  2DIG A;  4RG2 A;  3LH5 A;  5CO7 A;  4M77 G;  1HYO A;  4M7D E;  1WYX A;  2BTT A;  2I2L A;  2KQW A;  2CT3 A;  1MMD A;  3QYG B;  4KT0 E;  2YHT A;  3OY9 A;  2YRV A;  1M90 C;  1AVZ C;  1S72 A;  3OYH A;  2FYK A;  2PTK A;  4FYW B;  4J6X A;  5CQY A;  3EFO A;  2QAZ A;  3QYH B;  4OGC A;  1WHH A;  2RPN A;  3HL8 A;  3OYL A;  4Z88 A;  2EBP A;  3Q1J A;  4CC2 A;  3CCU T;  2YDL A;  1TWB A;  5C6S A;  4XTU A;  1H64 1;  2E6Z A;  4AFU C;  1D0X A;  2K7A A;  1YJ9 Q;  1YJ9 T;  2XK0 A;  1K8A C;  2DET A;  1SHF A;  1SRL A;  4C8Q F;  2JTM A;  2VXF A;  1Q7Y R;  4O5V A;  5KYW A;  5FRM A;  5LJ5 g;  1RAF B;  5CQX A;  5LL6 S;  1WA7 A;  4E7S A;  4RUG A;  1SSF A;  2RJE A;  2DZC A;  2RJF A;  1X43 A;  1K73 C;  1VQ6 Q;  1TOV A;  4OMP A;  1YI2 A;  1ZQ1 A;  4GLK A;  4PFO A;  5GAN 4;  3M56 A;  2WSE E;  2ROL A;  3TRE A;  2COW A;  4A63 B;  1ABQ A;  3X25 B;  1AD5 A;  1VQ9 T;  2HSE B;  2QGF B;  1E6G A;  3CCQ Q;  1YI2 Q;  2SEM A;  2DL3 A;  1UUE A;  3EG2 A;  1WIE A;  4VUB A;  3X26 B;  4HVU A;  2RQR A;  3JCM e;  3OMG A;  3CCQ A;  3TQ7 P;  1NBE B;  3M59 A;  4QQD A;  4ATO A;  4M77 F;  2ZPH B;  3M53 A;  4M78 G;  3PE0 A;  1NG2 A;  2VWF A;  2D0Q B;  2CZ7 B;  3CD6 A;  1VQL A;  3HRU A;  2GNC A;  1D0Z A;  2RK1 A;  2QDY B;  1UEB A;  4ZGE B;  3JCM V;  2HBW A;  2HQX A;  1SKU B;  1HXD A;  1YBY A;  2RD1 A;  1VQL Q;  4B9W A;  4IUP A;  1K0S A;  2EYY A;  2NLU A;  1Y7X A;  4C92 E;  3V8L A;  1GBR A;  1N6A A;  1PWT A;  3HSB A;  4AMC A;  1RAA B;  4Y28 E;  3VRY A;  4FT4 A;  2DRM A;  3G4S Q;  5HCK A;  4C0D B;  2CP2 A;  4C8Q G;  4D8D A;  2QI2 A;  4LDW A;  2MF2 A;  3MKD A;  2A3L A;  2JJ9 A;  2C0O A;  3BFM A;  2RI3 A;  1B07 A;  4BAC A;  3FRN A;  1LOJ A;  5GJW B;  2KMT A;  1UGS B;  3ZL7 C;  1BI2 A;  1SRM A;  4C0D C;  2ZCF B;  2OTJ Q;  5LJ5 j;  1D1C A;  1UGV A;  5GAO q;  2QGG A;  1YHQ T;  3CCE Q;  2L3P A;  1MHN A;  2DVE A;  3GIB A;  2H3E B;  4HCK A;  1VQ4 A;  4PLI A;  2F2X A;  2JN0 A;  3L1A A;  1S72 T;  2XID A;  2RQT A;  2X3W D;  1OZ3 A;  1YIJ T;  2E5Q A;  1S1N A;  5CKD A;  1VYU A;  1K76 A;  2K5I A;  2QEX T;  5GAO r;  4J6W A;  4IUR A;  2HKN A;  3LGF A;  3JCM f;  4C5E A;  3CCJ A;  1X6O A;  1VIF A;  2DYB A;  1WNL A;  1W4S A;  4RTW A;  5KYY B;  2PU9 B;  3KBG A;  5GMK m;  3EH2 A;  1OQK A;  1ZA2 B;  4DOV A;  4AG1 C;  1PD0 A;  4B9X A;  2HMA A;  1ZSZ B;  3QWY A;  3H8Z A;  2VVK A;  2LT1 A;  2A7Y A;  4M77 C;  1X6G A;  5FWC A;  1GCQ C;  2KBT A;  1M30 A;  1FX7 A;  1Q82 C;  2JUF A;  3VKI A;  2E65 A;  3REB B;  1QVG P;  3QG1 A;  2QG9 B;  4OMN A;  4FSX A;  3EFS A;  4PJN A;  1YJN A;  2L3Q A;  1MV3 A;  2XU8 A;  2EQU A;  3X20 B;  4KBM B;  1WHM A;  4KUD K;  3CCU Q;  2YLB A;  4OB2 B;  2FPE A;  5IH2 A;  2CH4 A;  1VA7 A;  2CZ6 B;  2MWP A;  4BDZ A;  1WGS A;  4LDV A;  4UC4 A;  1FMK A;  1I0C A;  2QAS A;  3KXT A;  1VQM T;  1YIJ Q;  1Z9Q A;  2BUD A;  1T0H A;  3MP6 A;  5GAM d;  5LJ3 e;  1NZ9 A;  3RKY A;  2K3Y A;  3KFV A;  2VGM A;  3CQT A;  2CZ0 B;  3CCJ T;  4AFQ C;  2D8H A;  2X4Y A;  1BI1 A;  1V76 A;  3SB2 A;  1IGU A;  3CC2 A;  2A36 A;  2XG8 D;  4FM4 B;  1VQL T;  1F1B B;  4J9B A;  4OB3 B;  1U1T A;  1IO6 A;  2RJD A;  2YT6 A;  1G3W A;  4Z8A A;  1KQS S;  3D7S B;  2KVQ G;  1WI7 A;  3RMS A;  3CPW S;  3ZFJ A;  3UT1 A;  1UDL A;  1JXO A;  4M78 B;  1VQ5 A;  1BK2 A;  3G6E T;  2KEA A;  2LC4 A;  2KAF A;  3RNJ A;  1NYF A;  8ATC B;  1CKB A;  2EGE A;  3H0I A;  2VKN A;  2ZZD A;  1QMC A;  1ZX6 A;  2LQW A;  1VQ5 Q;  1Q86 R;  3QO3 A;  1ZA1 B;  2OAU A;  3VYG A;  1YI2 T;  3OBY A;  1TXQ A;  1QW1 A;  1TU0 B;  2LJ3 A;  5GAN 7;  1VQ4 T;  1NPP A;  4M78 D;  3EGX B;  4FCY A;  2AK5 A;  3THK A;  4AFS C;  1KD1 R;  1JB0 E;  4PJJ A;  1WQW A;  4HT8 A;  5FU7 B;  4M78 E;  2DXU A;  3JAM E;  4XTW A;  1RAD B;  1YP5 A;  1R8O B;  3M54 A;  2KYM A;  4PLL A;  1PRM C;  3JCM g;  1XNI A;  4PJM A;  2KRS A;  2P0P A;  4LDU A;  4NS5 A;  1K8A R;  2EAY A;  3L2R A;  4EIK A;  3RKX A;  2QQ9 A;  2RMO A;  2VAS A;  4JJN K;  1FWZ A;  1U8R A;  4ZTJ A;  2LJ1 A;  4C8Q A;  2AZS A;  2LQN A;  4EPC A;  5FLX E;  2MI6 A;  1QKX A;  4F7U A;  2ED1 A;  5CK9 A;  5GMK i;  5FW9 A;  4HCC A;  1WFW A;  4BI8 B;  4ANJ A;  3V7C A;  3CCL T;  1Y71 A;  5FRN A;  1G2B A;  2FL7 A;  1VIE A;  1IRE B;  2A0F B;  3M58 A;  5KYY A;  5FRO A;  3MJX A;  5LJ3 d;  5LJ5 f;  5GAN d;  4C8Q C;  3RES A;  2JVV A;  2VB6 A;  5EC7 A;  4OMO A;  1BYM A;  1BCO A;  1I5O B;  4GY5 A;  4KH1 B;  2G3R A;  1K9M C;  4LXC A;  2D0N A;  2OTJ T;  3G1J A;  4BE1 A;  3CCL A;  4BI3 A;  3V8K A;  1RLP C;  1UGR B;  1HD3 A;  2CRE A;  3OYD A;  1XJW B;  4PK4 A;  2XIC A;  5FU6 C;  3EGX A;  1TG0 A;  2V8I A;  3LX7 A;  3M4Y A;  3UA7 A;  2CUD A;  3JCM h;  4JJD A;  5GAO l;  3I55 A;  2JM9 A;  2MK5 A;  4FW2 A;  1ZUK A;  1D1B A;  1EFN A;  3VS0 A;  1IZ6 A;  4O6J A;  2OTL T;  4DA4 A;  3HP9 A;  3EHR A;  2KT8 A;  3C95 A;  4M7A B;  2DLP A;  3TEE A;  4C92 D;  3TU4 K;  4L6V 5;  2E3I A;  2HZY A;  1XTD A;  1IXD A;  3OA6 A;  1NPR A;  4N4I A;  4M77 A;  4C8Q D;  2KT1 A;  2H3J A;  1YHQ A;  4EMK B;  1R0B G;  2MCN A;  1PKS A;  5A0G A;  4XU2 A;  3OB9 A;  5CKF A;  1WXU A;  3MCA B;  1YJ9 A;  3OS0 A;  1R0C B;  2B86 A;  2NUT A;  2GQI A;  1UHF A;  2L3R A;  1D3B A;  4FYV B;  4C92 A;  3TCJ A;  2OAW A;  2H8H A;  5GAN j;  2D1X A;  4EMK C;  1G3T A;  4V2S A;  4BUG A;  4J9F A;  1VQ5 T;  1Q86 U;  3CCQ T;  1AZG B;  1WJS A;  3QJY A;  2MYS A;  1KD1 C;  2K6D A;  1RAG B;  1ZUU A;  4OP0 A;  1JBM A;  1K1Z A;  3VUZ A;  2RA2 A;  3CCE A;  4M78 A;  5KYU A;  1HJD A;  4BDY A;  3EFR A;  1S72 Q;  3OYI A;  3FB9 A;  3S3M A;  1OX9 A;  2OX7 A;  2DXC A;  3QZ9 B;  1G8X A;  2R5M A;  2YRC A;  3FJ5 A;  3JCM P;  1IHV A;  3PVQ A;  4CC3 A;  1VOM A;  4Y92 A;  3JSC A;  2FRW A;  3M55 A;  4FU6 A;  4J9H A;  2Y90 A;  5LJ3 f;  1VQN T;  2E41 A;  1KD1 U;  2M16 A;  4MMK A;  3CME A;  2GBQ A;  3CXC P;  3GOX A;  4HKE A;  4HVW A;  2O31 A;  1ZUY A;  1FXX A;  3PTA A;  3NPF A;  1LJO A;  1BKB A;  5GAN 3;  1M5Q 1;  2BKD N;  1KC8 R;  5HK3 A;  2NYS A;  2BE7 D;  3CCR Q;  4ZGJ B;  1MMN A;  3SFM A;  3NTH A;  5GAM h;  5CR2 A;  5D7U A;  2K3X A;  3CCU A;  3J80 E;  1H3Z A;  2ABL A;  1ZBX A;  3L2W A;  4JZ3 A;  2YUQ A;  3M4G A;  2YUO A;  1V29 B;  4F7U B;  4M7D C;  5GAM g;  2DER A;  1QWE A;  2PVG B;  4XAX B;  1I4K 1;  4KGZ B;  2JM8 A;  1M9S A;  2RQW A;  3UWN A;  2FZC B;  2RF0 A;  1JEG A;  2IIM A;  1BU1 A;  2E1H A;  3JV3 A;  5KYU B;  1BBZ A;  3EG3 A;  1ZBJ A;  3CMA A;  1VQM Q;  2EIF A;  4CRI A;  1VQP T;  2V26 A;  4PJO D;  1RAI B;  1YWP A;  2EKH A;  2BZ8 A;  3EG9 B;  1MNE A;  1U06 A;  4JPB W;  2X4X A;  4B6M A;  2RJC A;  1TTH B;  2ZGW A;  1O9S A;  3H6Z A;  3PMT A;  4XU1 A;  1QQJ A;  2FZK B;  5KE3 A;  2XD0 A;  4WCI A;  2CKK A;  2ROT A;  1Q95 G;  4LD9 K;  1VQN Q;  4OB1 B;  3GLX A;  1Q82 R;  1BIA A;  4X34 A;  2JNG A;  1OPL A;  2QA4 A;  1VQN A;  1T3L A;  3LWH A;  4M7D G;  4M7A A;  4OMF B;  3I5R A;  1TUD A;  2EPD A;  4E2F B;  3MPU B;  1PG5 B;  4JDS A;  1H8K A;  1ZSZ A;  2WSC E;  1X2Q A;  2VC8 A;  4E7H A;  3PFS A;  3AT1 B;  2EYZ A;  2R5A A;  2JW4 A;  5IN1 A;  2E6N A;  4N4G A;  1VQO A;  4ELZ C;  3E2U A;  1AWJ A;  3P8B B;  3SHW A;  1DJ7 B;  5FU6 B;  2QTV A;  1VYV A;  2RNA A;  3S3O A;  2NUT B;  1JO8 A;  4E7I A;  1AT1 B;  4XQ3 A;  1UHC A;  2M02 A;  1FMV A;  3VV0 A;  2CYZ B;  2XHC A;  4J8O A;  1OPK A;  1QP2 A;  4JJB A;  4LUD A;  1UEC A;  4DQ2 A;  1Y57 A;  4MDX A;  5GAM j;  1AEY A;  1R77 A;  8AT1 B;  4A4G A;  2F2W A;  1KC8 C;  1Q86 C;  2VV5 A;  6AT1 B;  4ZTF A;  1KFZ A;  1OX8 A;  1RUW A;  1ARK A;  2YUP A;  3R6N A;  2DTH A;  4EMK A;  1RAH B;  2DJZ A;  1LNX A;  2B8A A;  2E64 A;  1OU8 A;  4PJO A;  1OEB A;  1JXM A;  3GNF B;  3VS4 A;  2IVW A;  3CCS T;  2OJ2 A;  1BI0 A;  2JZ2 A;  5LJ5 d;  3VS2 A;  1FMW A;  3QBY A;  1OYX A;  1JJ2 S;  2QA4 T;  1SG5 A;  3A5Z B;  4JS4 A;  2CP7 A;  1Q81 R;  1M90 U;  3VS7 A;  4Z02 A;  4GBQ A;  3OYE A;  4M7D F;  2KY9 A;  4M7A D;  2DTO A;  5CAI A;  1WQ7 A;  2VUB A;  4BY6 C;  3G4S A;  5LJ5 e;  4LUE A;  4RTX A;  4R55 A;  5GMK j;  1WX6 A;  3JCM W;  2K57 A;  4E6R A;  4JRQ A;  2HEQ A;  1N9S A;  2RHZ A;  3BDU A;  3R6O A;  4JUV A;  5IHI A;  5GMK l;  2OI3 A;  4PFP A;  4KUI A;  3OYF A;  4OVA A;  2Y4Y A;  5GAN g;  1WZO A;  3M5A A;  3I56 A;  3CCV A;  1RI0 A;  1HK9 A;  1Q7Y U;  1PCX A;  1TS9 A;  1GCP A;  4ZN3 A;  1LVK A;  3HFN A;  1KG1 A;  3AHU A;  2EYQ A;  1M8V A;  2WAC A;  2EGC A;  4CI0 C;  3NTI A;  1M4Z A;  1QLY A;  4J9E A;  2RB6 A;  2DD5 A;  4RTU A;  1NJI U;  1WJR A;  5GAN 2;  2P4R A;  3QPH A;  3SWN C;  1M2V A;  4ZNX A;  3CCR T;  4OMM A;  1PC0 A;  3QDF A;  4K11 A;  3PGG A;  5IHN A;  4OML A;  3CD6 T;  1RAE B;  1M8M A;  2D9T A;  1QVG S;  3M0S A;  3HRS A;  3JCM Q;  1WJQ A;  2QXF A;  1YIT A;  3OYG A;  3X28 B;  1LPL A;  2XKO C;  1PSF A;  3HHT B;  1B3Q A;  3URG A;  4ME7 A;  1C6V X;  1N5Z A;  3VS5 A;  4WF2 A;  3GNG A;  2LVM A;  1M3B A;  2QK0 A;  3MEU A;  1NJI R;  3EGD B;  1G3S A;  3GPL A;  2SRC A;  2K4Y A;  5GAN f;  4F17 A;  1VQ7 A;  2J6K A;  1YIJ A;  4J5Y A;  1QKW A;  1I07 A;  2RK2 A;  4M7D D;  1G5V A;  2IG0 A;  4LN2 A;  4DEY A;  2MOX A;  1KK7 A;  3GBQ A;  2O4X A;  3QWX X;  3SD4 A;  2QQR A;  2DK3 A;  2DEU A;  1QVG A;  2DL8 A;  1Y96 B;  2EJF A;  1IRX A;  1J3T A;  1M1G A;  5FWB A;  4J7F A;  2QQA A;  1JQQ A;  2EKO A;  3CBO A;  4HCZ A;  4C92 G;  4IUQ A;  1QVF P;  2LNH B;  1B34 B;  2CGH A;  1NLO C;  2YRD A;  2FPF A;  3C4S A;  3NHN A;  5GMK h;  2RHU A;  4DBH A;  2E70 A;  1XQH A;  4J9I A;  3GP8 A;  3A1P A;  3E9F A;  4FYY B;  3P8H A;  3KUF A;  3CC4 A;  3L42 A;  2DVJ A;  3SWN A;  4IUT A;  4ZN1 A;  3UAT A;  4JLG A;  4E7Z A;  4XU0 A;  1YNZ A;  2EFI A;  1VQ6 T;  3CXC A;  3CME T;  3EGD A;  4C5G A;  3J81 E;  2LJ0 A;  3I9Q A;  3MEA A;  3G71 A;  2EQI A;  1UFF A;  3SDZ A;  4EMG A;  1E6H A;  5GAM f;  5D6X A;  4AT1 B;  3VS3 A;  5J3B A;  2DAQ A;  4Z89 A;  4MML A;  2RQU A;  2L3S A;  1NLP C;  2QQS A;  3G4S T;  1D1A A;  1KQ1 A;  2WSF E;  2QTX A;  1KQS A;  2LT4 A;  4M78 C;  1YWO A;  2VGN A;  1VQ9 A;  5IHK A;  5CKH A;  4M75 A;  1W1F A;  4PJO B;  2LMJ A;  1SPK A;  5D6W A;  5L8R E;  2LDM A;  1CKA A;  4JJC A;  4MDW A;  3DLM A;  4A54 A;  5LJ3 g;  1MGQ A;  3CME Q;  2C0I A;  4JRK A;  1VQO Q;  4QQG A;  3PT9 A;  2FZG B;  3JB9 D;  1M1K U;  1Q7Y C;  3HKS A;  2KYB A;  4BY6 B;  1QCF A;  3BY7 A;  3M0T A;  4A4H A;  4X1V A;  2DTI A;  2KRM A;  1HSQ A;  4FT2 A;  4QKU A;  2Z0W A;  1K8A U;  5KCO A;  2P4T A;  2RO0 A;  2PVO B;  5CVI A;  1NE8 A;  4FSS A;  3EG0 A;  3CCM Q;  1G83 A;  1VQ8 T;  2MIO A;  4JLI A;  5A0L A;  4KRT A;  3M0P A;  2J06 A;  3X24 B;  3F70 A;  2KRO A;  1KC8 U;  3LYI A;  2RN8 A;  3RR6 A;  1MUZ A;  3U23 A;  1MV0 B;  3C12 A;  4PJO G;  3ZEH A;  4PJL A;  2GCX A;  2FO0 A;  2KNB B;  3CMA T;  1N9R A;  2CS7 A;  2FHD A;  5GAN e;  3L2V A;  2RI2 A;  4F04 B;  4Y91 A;  3BW1 A;  3OBW A;  1SHG A;  2JTF A;  1D3B B;  3OS2 A;  4QT7 A;  1K9M R;  2DL4 A;  2W0Z A;  2M9U A;  4M75 B;  2DKG A;  3MO8 A;  4RKU E;  1MND A;  1G3Y A;  3LGL A;  2AHJ B;  3CBM A;  4IUU A;  3MEW A;  4HCB A;  2F5T X;  2JOY A;  2EQK A;  1GFD A;  1VQ8 A;  1M27 C;  4LNP A;  1K4U S;  3MEV A;  2QQB A;  1QWF A;  2O4X B;  1RL2 A;  4C0G A;  5L23 A;  1WLP B;  4E7J A;  1UE9 A;  3OYB A;  1K0X A;  1W6X A;  1K9M U;  1RLQ C;  3S6W A;  2W10 A;  2YSQ A;  1N8R C;  1ZSZ C;  4E47 A;  2QDL A;  4M75 D;  3CC2 T;  2CDT A;  3OQ5 A;  2BZY A;  4DBQ A;  4ESR A;  4F7U E;  1JJ2 P;  4IIM A;  2GFA A;  3M0Q A;  1YFN A;  2MPX C;  4C5H A;  2X4W A;  4M7A C;  3I56 Q;  3CCV Q;  2K5L A;  3VJP A;  3DLL A;  4RTY A;  3OSV A;  3JB9 H;  2CH4 W;  3CBP A;  3VU3 C;  5KCH A; 
#chains in the Genus database with same CATH homology
 3QWY A;  2VVK A;  1PKT A;  2EYZ A;  2EVR A;  2JW4 A;  3H0H A;  1X6G A;  5FWC A;  1GCQ C;  1PHT A;  2KBT A;  3O5Z A;  1CSK A;  1M30 A;  3I35 A;  3EHQ A;  5GJV B;  4CC7 A;  1AWJ A;  1UJ0 A;  4IIO A;  3REB B;  3SHW A;  2K9G A;  2EYX A;  5I22 A;  3VS1 A;  1VYV A;  2RNA A;  4OMN A;  4J9C A;  2KE9 A;  1JO8 A;  2DNU A;  3VRZ A;  1NEG A;  2L3Q A;  1MV3 A;  2M51 A;  2A37 A;  1UTI A;  1UHC A;  2JS2 A;  1SEM A;  2PNI A;  2FPD A;  2FPE A;  2F2V A;  1OPK A;  4D8K A;  5IH2 A;  1AWO A;  3I5S A;  4JJB A;  4LUD A;  2CH4 A;  1VA7 A;  1UEC A;  1Y57 A;  2C0T A;  1AEY A;  1FMK A;  1I0C A;  2F2W A;  2E5K A;  2EGA A;  2J6F A;  2JTE A;  1UG1 A;  1SSH A;  1Z9Q A;  1RUW A;  1ARK A;  1KFZ A;  1A0N B;  1T0H A;  2YUP A;  1KSW A;  2LX7 A;  3R6N A;  1NEB A;  2HSP A;  3KFV A;  1OEB A;  1JXM A;  1X6B A;  3VS4 A;  3CQT A;  2OJ2 A;  3PVL A;  3VS2 A;  4F16 A;  4AFQ C;  2D8H A;  2DMO A;  3TSZ A;  1KIK A;  1V1C A;  1YCS B;  2A36 A;  2LZ6 B;  2RQV A;  4J9B A;  1AOJ A;  3VS7 A;  1IO6 A;  2YT6 A;  4Z8A A;  1M3C A;  4GBQ A;  3REA B;  1WI7 A;  2GGR A;  2L2P A;  1UDL A;  4HVV A;  1JXO A;  1BK2 A;  4LUE A;  4RTX A;  4R0K A;  1E7O A;  1WX6 A;  2KEA A;  2KGT A;  4HXJ A;  3RNJ A;  1NYF A;  1UJY A;  4E6R A;  2HEQ A;  1CKB A;  2EGE A;  3H0I A;  2VKN A;  5IHI A;  2OI3 A;  2LQW A;  1ZX6 A;  2CSI A;  1U5S A;  1GBQ A;  4J9G A;  2ECZ A;  2AKK A;  2EW3 A;  2G6F X;  2JS0 A;  1GCP A;  2LJ3 A;  2XMF A;  1RI9 A;  1OV3 A;  2DE0 X;  2V1R A;  3TVT A;  3EGU A;  4GLM A;  2AK5 A;  3THK A;  4AFS C;  1NYG A;  2JXB A;  1NM7 A;  2EGC A;  3UF4 A;  1QLY A;  2JMA A;  4J9E A;  2LCS A;  1GL5 A;  1I1J A;  1YP5 A;  4RTU A;  2KYM A;  2P4R A;  1PRM C;  2YUN A;  5IXF A;  4ZNX A;  2KRS A;  2DIL A;  3NGP A;  4OMM A;  4K11 A;  4RTT A;  5IHN A;  4EIK A;  2JT4 A;  4OML A;  2RMO A;  2PZ1 A;  2KRN A;  1GCQ A;  1M8M A;  2X3X D;  3M0S A;  1AZE A;  2J6O A;  1GRI A;  1ZLM A;  2DJQ A;  2LJ1 A;  2KXD A;  2K3B A;  1X27 A;  2AZS A;  2LQN A;  1QKX A;  2ED1 A;  1KJW A;  1B3Q A;  4AFZ C;  5FW9 A;  1WFW A;  1N5Z A;  3VS5 A;  1LCK A;  3C0C A;  4F14 A;  1G2B A;  4RTZ A;  1FYN A;  2I0N A;  2O9S A;  3UA6 A;  1M3B A;  1PRL C;  1OOT A;  4LE9 A;  3H0F A;  1AWW A;  1WXT A;  2ESW A;  4CC4 B;  2V1Q A;  3H41 A;  1X69 A;  5EC7 A;  4OMO A;  1K9A A;  3ULR B;  2KR3 A;  1ZSG A;  1JU5 C;  2DBM A;  2SRC A;  3NMZ C;  2DRK A;  4F17 A;  1M3A A;  2J6K A;  2KXC A;  2D0N A;  1QKW A;  1I07 A;  2NWM A;  2BZX A;  1RLP C;  1HD3 A;  4LN2 A;  1H92 A;  4DEY A;  2A08 A;  2MOX A;  2CRE A;  3VS6 A;  3GBQ A;  1YN8 A;  3QWX X;  1T3S A;  2DL8 A;  1TG0 A;  1U3O A;  3UA7 A;  2L0A A;  2NUZ A;  2CUD A;  1J3T A;  4JJD A;  2JM9 A;  1ZUK A;  2D8J A;  1EFN A;  1WDX A;  5FWB A;  3VS0 A;  3LH5 A;  1WYX A;  1JQQ A;  2BTT A;  3EHR A;  2O88 A;  3EG1 A;  2KT8 A;  3A98 A;  2CT3 A;  3M0R A;  2DLP A;  2LNH B;  1NLO C;  1X2K A;  2DX1 A;  2FPF A;  3NHN A;  5ECA A;  1AVZ C;  4OMQ A;  4J9I A;  2A28 A;  2PTK A;  2DL7 A;  2KT1 A;  2RPN A;  2JMC A;  2MCN A;  1PKS A;  4Z88 A;  2EBP A;  4CC2 A;  2DVJ A;  2YDL A;  5I11 A;  1WXU A;  3UAT A;  2GTO A;  2B86 A;  2GQI A;  1YNZ A;  4AFU C;  2K7A A;  1UHF A;  1GFC A;  5IXB A;  1SHF A;  3RBB B;  1SRL A;  2OAW A;  2LJ0 A;  2H8H A;  3I9Q A;  2D1X A;  2EQI A;  1UFF A;  2HDA A;  1E6H A;  4J9F A;  3VS3 A;  1WA7 A;  1Y0M A;  1AZG B;  4Z89 A;  2RQU A;  2L3S A;  1NLP C;  4RUG A;  2K6D A;  3M0U A;  1ZUU A;  4AG2 C;  2ENM A;  2GTJ A;  1VYT A;  1K1Z A;  1X43 A;  1HJD A;  2FRY A;  4OMP A;  1W70 A;  1YWO A;  2J05 A;  2DL5 A;  2ROL A;  2K79 A;  5IHK A;  3IQL A;  4A63 B;  1W1F A;  1ABQ A;  4DEX A;  2DA9 A;  1AD5 A;  2LMJ A;  1SPK A;  1E6G A;  2J7I A;  2AKL A;  3FJ5 A;  2SEM A;  2DF6 A;  3PVQ A;  1CKA A;  2DL3 A;  4JJC A;  4CC3 A;  2HCK A;  1UUE A;  3EG2 A;  1WIE A;  4Y92 A;  4HVU A;  2O2O A;  2RQR A;  2C0I A;  2O9V A;  2CUB A;  1PNJ A;  2FRW A;  4J9H A;  1T0J A;  2GBQ A;  1WXB A;  4HVW A;  2O31 A;  1ZUY A;  3PE0 A;  3NPF A;  1NG2 A;  2VWF A;  2FEI A;  2KYB A;  1QCF A;  2AZV A;  3M0T A;  4X1V A;  1Z9Z A;  1H3H A;  2KRM A;  4JZ4 A;  1HSQ A;  2GNC A;  4RTV A;  2HBW A;  1AWX A;  3SEM A;  2FG0 A;  4FSS A;  2ED0 A;  3TSW A;  2LP5 A;  3EG0 A;  2ABL A;  1G83 A;  4JZ3 A;  1K0S A;  2MIO A;  2EYY A;  4KRT A;  2YUQ A;  3M0P A;  2J06 A;  1GBR A;  2YUO A;  2KRO A;  2RN8 A;  1PWT A;  2CSQ A;  1MUZ A;  1QWE A;  3U23 A;  1MV0 B;  3VRY A;  2DRM A;  5HCK A;  2DBK A;  2JM8 A;  2FO0 A;  2K2M A;  2RQW A;  2KNB B;  2RF0 A;  4D8D A;  1JEG A;  2IIM A;  1BU1 A;  3JV3 A;  1BBZ A;  3EG3 A;  1SHG A;  1ZBJ A;  2C0O A;  1B07 A;  4QT7 A;  2DL4 A;  1YWP A;  2W0Z A;  2EKH A;  5GJW B;  1BB9 A;  2BZ8 A;  3ZL7 C;  1SRM A;  1U06 A;  4JPB W;  4J9D A;  1UGV A;  1XOV A;  2L3P A;  2EYW A;  1GFD A;  1M27 C;  4LNP A;  4HCK A;  1K4U S;  2F2X A;  4WCI A;  1QWF A;  2ROT A;  2RQT A;  2X3W D;  5L23 A;  1S1N A;  1WLP B;  1UE9 A;  4M4Z A;  1K0X A;  1VYU A;  1W6X A;  1K76 A;  2DM1 A;  1RLQ C;  2M0Y A;  2W10 A;  2YSQ A;  1OPL A;  2QDL A;  4ORZ A;  2CDT A;  2DYB A;  2CT4 A;  1ABO A;  2BZY A;  4RTW A;  1T3L A;  4ESR A;  4IIM A;  3M0Q A;  3I5R A;  1TUD A;  2EPD A;  4RTY A;  4AG1 C;  1H8K A;  2CH4 W;  1X2Q A;  1TUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...