1SHGA

Crystal structure of a src-homology 3 (sh3) domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Src-homology 3 (SH3) domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cytoskeleton
molecule keywords ALPHA-SPECTRIN SH3 DOMAIN
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1993-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1shgA00
4QT7A 3M0UA 2DE0X 4Z88A 1UGVA 2JS2A 3EG2A 1CKBA 2K9GA 2CSIA 2JS0A 5FWBA 1B3QA 1T0JA 1K4US 1WLPB 3SHWA 2LX7A 4CC7A 2GTOA 1UHCA 2FG0A 5IHKA 3M0TA 2HEQA 1AWOA 4OMNA 1X2QA 1X69A 1K76A 3I5SA 1YNZA 1UG1A 1QWFA 1K0XA 1SRMA 1GFDA 2K3BA 1HSQA 3NPFA 2LJ3A 3I9QA 2LQNA 3EHRA 2LQWA 3NGPA 4Z8AA 1UDLA 2DNUA 3GBQA 2CDTA 2KR3A 2RQTA 1LCKA 1Z9QA 1FMKA 3KFVA 1WI7A 1H92A 1NYGA 1OV3A 2A08A 2FPFA 4JJCA 1OEBA 2GTJA 4D8DA 1G2BA 1I07A 1BU1A 4RTYA 2NUZA 1K1ZA 1W1FA 1PHTA 5IXBA 2KT8A 1V1CA 3VRZA 2EKHA 4AG2C 1Y0MA 3EG0A 2O88A 4Y92A 2ESWA 4RTZA 3VS3A 3JV3A 2I0NA 2EYYA 4RTVA 2JM8A 3I35A 2YUPA 1AVZC 1K9AA 4RTXA 2RN8A 2L0AA 4ZNXA 2CT4A 2LJ0A 3EG3A 4RTWA 3EGUA 2CH4W 1OPLA 2AZSA 2EPDA 2CUBA 2KBTA 2M51A 1PRLC 2D0NA 1KSWA 2K79A 3VS5A 1ZUKA 2FPDA 2JTEA 4ESRA 1Y57A 2FRWA 3O5ZA 5I11A 5IHNA 2J05A 1JU5C 3U23A 1SPKA 2LMJA 3H41A 1GL5A 2HBWA 3EHQA 4OMQA 1VYTA 2DRMA 4F17A 1W6XA 2BTTA 1MV3A 1WYXA 5I22A 2D8HA 1JEGA 4J9EA 1PKTA 4JJBA 2V1QA 2JT4A 1J3TA 2DM1A 2DRKA 1UTIA 3TSWA 1KJWA 2W0ZA 2GQIA 4OMOA 4FSSA 1WDXA 1K0SA 2YDLA 3THKA 1H8KA 2AKKA 4LUDA 1W70A 2SRCA 4X1VA 4JJDA 1NYFA 1YN8A 2KEAA 4LE9A 1FYNA 2DMOA 2K2MA 2EYZA 3REAB 2HCKA 2C0OA 1E7OA 1GBQA 1SRLA 1U06A 1AD5A 2BZYA 2M0YA 2KROA 2DILA 4AFSC 4K11A 1EFNA 2FRYA 2VWFA 2IIMA 2OAWA 2P4RA 4A63B 2DX1A 1ZSGA 2G6FX 4R0KA 2JXBA 1GCPA 2GBQA 1MV0B 2DL4A 3UATA 2YT6A 2RQUA 1B07A 4GLMA 2F2WA 4J9FA 1PNJA 1OOTA 2JMCA 2C0TA 2LZ6B 1NEGA 2FO0A 1OPKA 2J06A 1AWJA 2O9VA 2V1RA 1WFWA 3ZL7C 4RUGA 2L3SA 2NWMA 3SEMA 1ARKA 1JXOA 2LP5A 2AZVA 1HD3A 1VA7A 2J6FA 1YP5A 1HJDA 1WIEA 4M4ZA 2EBPA 1M27C 2JW4A 4HXJA 2F2VA 2YUQA 4E6RA 1UE9A 1UJ0A 3M0RA 1IO6A 3UA6A 3TVTA 2EVRA 4AG1C 2ABLA 3R6NA 1PWTA 1M3AA 1SSHA 2DBKA 2RQVA 2EW3A 2RQRA 2DL7A 3NMZC 2YUNA 2L2PA 2KE9A 2GGRA 3M0PA 4LUEA 1WXUA 1AOJA 1M30A 1T3LA 4HVVA 4OMMA 4J9DA 4J9HA 1UFFA 2X3XD 2X3WD 2AK5A 3EG1A 2DA9A 1SEMA 1PRMC 1YCSB 1MUZA 3RBBB 2EYXA 1ZX6A 2MCNA 2BZXA 3VS1A 2W10A 1RLPC 2EGEA 3NHNA 3VS4A 2PTKA 1WXTA 2PNIA 1I0CA 5GJWB 1NEBA 1ABQA 2D1XA 1BB9A 2KRMA 1UHFA 2CREA 2EGAA 1ZUUA 4LN2A 5IH2A 5ECAA 4AFUC 1N5ZA 3QWYA 2J6KA 3QWXX 2LJ1A 1VYVA 1M3BA 1UJYA 1GBRA 4F14A 1Z9ZA 1YWOA 4DEYA 4IIOA 1NM7A 4LNPA 2F2XA 2A28A 1E6HA 2KRSA 2EQIA 5IXFA 2MIOA 3H0IA 2K6DA 2LNHB 3M0SA 2L3QA 1X2KA 3I5RA 3VRYA 1AEYA 1BK2A 2A37A 1VYUA 4WCIA 2JMAA 3M0QA 2E5KA 4CC2A 4IIMA 1ZLMA 2H8HA 2DLPA 2K7AA 2YUOA 1JO8A 5GJVB 2J7IA 2ED1A 4F16A 1AWXA 1RI9A 1ABOA 1E6GA 3UF4A 2CH4A 2VVKA 2HSPA 4JPBW 4RTUA 1RLQC 2EGCA 3TSZA 4DEXA 1M3CA 1M8MA 1X27A 1I1JA 2ED0A 1WX6A 2YSQA 2PZ1A 2DL8A 3REBB 1S1NA 2D8JA 3VS6A 1PKSA 1ZUYA 1XOVA 2OJ2A 2KYMA 2HDAA 2DBMA 2DL5A 3A98A 5HCKA 3VS2A 4EIKA 2B86A 2L3PA 3PE0A 1GFCA 3IQLA 1GRIA 2O2OA 5FW9A 2RQWA 1QWEA 1WA7A 2ECZA 1A0NB 5IHIA 1GCQA 2RMOA 1NLOC 5EC7A 1H3HA 3RNJA 1WXBA 1BBZA 1NLPC 2JM9A 1AZEA 4HVUA 1UUEA 1GCQC 1NG2A 4RTTA 1CKAA 1G83A 2CSQA 2GNCA 1X6GA 1AWWA 4AFQC 2DL3A 2CUDA 2KXCA 1KFZA 2RNAA 1QLYA 4OMLA 2FPEA 2O31A 4HVWA 1T0HA 2RPNA 2MOXA 4J9IA 3VS7A 3VS0A 3ULRB 2DF6A 3PVQA 1SHGA 2A36A 2KYBA 2SEMA 1RUWA 4J9GA 2DYBA 4CC4B 2KGTA 4GBQA 4OMPA 2DJQA 4J9CA 1TUCA 1X6BA 2KXDA 1ZBJA 2ROTA 3H0FA 2KNBB 1UECA 1KIKA 4CC3A 1AZGB 2BZ8A 4Z89A 1U5SA 3FJ5A 2VKNA 3PVLA 5FWCA 4ORZA 1TG0A 4JZ3A 4AFZC 2C0IA 2CT3A 1TUDA 4HCKA 1QCFA 2LCSA 2KT1A 2XMFA 1YWPA 1JQQA 2J6OA 4D8KA 1CSKA 2OI3A 3CQTA 2RF0A 1QKXA 1SHFA 2AKLA 2O9SA 4JZ4A 4J9BA 1X43A 2QDLA 1U3OA 2ROLA 3LH5A 5L23A 2FEIA 3H0HA 3C0CA 2KRNA 4KRTA 1QKWA 3UA7A 2EYWA 2ENMA 1T3SA 1JXMA 2DVJA
chains in the Genus database with same CATH superfamily
4L6V5 4QT7A 2DE0X 3JCMc 4Z88A 2ZPHB 3GLXA 1RADB 4IURA 3R6OA 3CXCA 2CSIA 3QDFA 2JS0A 4FIBA 3VUZA 3OS0A 3LH0A 2LX7A 4ZN1A 4CC7A 2YHTA 3FJPA 5IHKA 1O75A 5CQYA 1X2QA 3HKSA 3I5SA 1UG1A 1JJ2P 1K73C 1YJ9Q 3G7ZA 3S3OA 1K0XA 1UGPB 4PJOB 4ELZC 3I55Q 2E4HA 1UDLA 4ZGDB 1OI1A 1NJIR 3GBQA 2CDTA 2RQTA 3KFVA 6AT1B 4CI0C 1OEBA 4N4HA 4B9WA 3CCUA 1VQKA 2GTJA 1N8RC 4D8DA 3L2UA 1BU1A 4RTYA 3RDVA 2NUZA 3WVDB 1YJWT 2L5QA 1K1ZA 1W1FA 2ZCFB 2E10A 1BIAA 3ASKA 5GAMg 2DETA 4AG2C 3EH2A 2O88A 2PUOB 3VS3A 4HA8A 4KH1B 3MP6A 2JM8A 2YRVA 1OX8A 2YUPA 3DKMA 3G4ST 4WTOB 2RD1A 3D7SB 3VUBA 4OB0B 2HKNA 4RTWA 3EGUA 1OPLA 1WHLA 4M78E 4C92B 3M9QA 2P0QA 2DXCA 2F5KA 4KGZB 1KSWA 2K79A 2BE7D 2HNIA 5AYFA 2VXEA 3L2VA 1XJWB 4E7IA 3RKXA 1WJQA 5I11A 1YJNQ 5IHNA 3U23A 3H41A 3CCRA 3LWIA 1M5Q1 3EHQA 4OMQA 4OMFB 4M78A 4M77B 4F17A 4EPCA 3URGA 1Q86R 5GAOp 1IB8A 1K9MU 5LJ5j 4PJJA 5GAMd 1OU8A 2NUPB 4L59A 4J9EA 4JJBA 3UPUA 4QQGA 5LJ5e 1WGSA 2ZPIB 4C92G 2GQIA 4LDUA 1IGUA 1K0SA 2HSEB 1EX4A 1R0CB 4WF2A 2DIQA 1KG1A 4LUDA 2QQ9A 4X1VA 3LWHA 5GANf 5GAOr 4A4FA 2K2MA 3OYBA 2HCKA 1GBQA 1M1KC 3MJXA 2KROA 2DILA 4K11A 3TREA 3OYEA 2RHYA 3HL8A 2EWNA 2P4RA 1I5LA 1ZSGA 1VQ4T 2JXBA 4F7UB 1MV0B 2DL4A 3UATA 2QQAA 2EQUA 2RQUA 5I2MA 4BE1A 2OTLQ 4J9FA 3G6EQ 1WHHA 2JMCA 1NEGA 4EMKC 2J06A 2O9VA 2V1RA 1QVGP 3ZL7C 3I55T 2L3SA 3SEMA 1JXOA 1KQ2A 2QQRA 2J6FA 1YITA 2QA4A 5J3BA 1WIEA 1YJ9T 3CCRQ 1VQ7T 2EBPA 1YITT 1KHIA 3E19A 1M27C 3EH1A 2JW4A 3OSSC 3BDUA 1IO6A 1P92A 1YJNA 1FMWA 1PWTA 5KYWB 3M56A 3PFSA 2RQVA 1HXDA 2YUNA 2L2PA 2YLCA 2GGRA 3HRSA 4LUEA 1T3LA 4DOWA 1Q81U 1K9MC 4J9HA 4M7AF 1G3SA 3CBMA 3OW2P 1KQSS 3CCJQ 2D9TA 2K5FA 2NLUA 3VS4A 3M57A 1SKUB 3CCJT 4DBHA 3JCMg 1U1SA 3CC2A 2KRMA 3V8LA 4XTUA 5HK3A 5LJ3j 5ECAA 4AFUC 3SWNA 8AT1B 3MP8A 9ATCB 1N5ZA 2J6KA 4M77A 1YJ9A 1M3BA 4DEYA 2CP0A 3JB9I 4LNPA 2XDDA 1C0MA 2P84A 4EMHA 2JUFA 3JCMe 3RIRA 3ZFJA 4M7AC 3CCEA 1E6HA 1B34A 4FW1A 1M8VA 2IPOB 5IXFA 4O5VA 1C1AA 4M7DA 3SWNB 3H0IA 2K6DA 2LNHB 4C92E 4PJNA 2L3QA 3VRYA 3CCQA 3A8GB 2JMAA 3META 3OYAA 1LNXA 4PJMA 4CC2A 1SSFA 1WHGA 3QSUA 3CPFA 2K7AA 5GJVB 2JNGA 2AIRB 4F16A 1AWXA 1B34B 3M5AA 2MF2A 2VVKA 3QZ5B 1VQMQ 4IUVA 3RMQA 4M75G 3CPWP 4HCCA 5LJ5d 2EGCA 3TSZA 1M3CA 4BUGA 1M8MA 4M7AE 2X35A 4M7AG 2DL8A 3HSBA 3EGXA 4NS5A 1S1NA 4C92C 3EFOA 2OJ2A 2HDAA 1B7TA 1ZA1B 5A0LA 2M16A 4QVCA 1VQ5Q 2R57A 4EIKA 3OMCA 2MMPA 3CCMT 1GRIA 2KSSA 4D6WA 4F7UE 2RQWA 4A54A 5IHIA 2LVMA 2RMOA 5EC7A 1H3HA 1PG5B 4C5GA 1D3BB 5GANj 3RNJA 4MMKA 5GAOn 2M9UA 1WHJA 4PJOF 4RTTA 4P5NA 1YFNA 1KD1U 2V8IA 1G83A 4J8OA 2DEUA 2P4TA 1X6GA 2NYSA 4AFQC 2E1HA 2CUDA 2KXCA 1ZHIA 1W2BS 2RM4A 5I2SA 4OMLA 2FPEA 2O31A 4F7UA 4HVWA 2RPNA 3LYIA 3VS7A 3VS0A 3I56Q 2VV5A 5LJ5f 3CC4A 3ULRB 2DF6A 2A36A 1VQPQ 1RUWA 4J9CA 1TUCA 4QQDA 2Y4YA 2PVOB 1X6BA 4N0AC 3LX7A 2KXDA 1VQ8Q 1IHWA 4J5YA 5KCOA 1M1KU 2YXYA 1KIKA 1X75C 1M1FA 3CCVA 4OP0A 5CKBA 1U5SA 4Z89A 3QO3A 2VKNA 3PVLA 1QCOA 5FWCA 2VGNA 4ORZA 2QAZA 5GANh 2COWA 1TUDA 5A0DA 3KXTA 1N9SA 5J26A 4C8QE 4D8KA 4IUTA 3SDZA 4TVRA 4Z02A 4KH0B 1CSKA 2XKOC 2RF0A 3QZ9B 1QKXA 3HHTB 1S72T 2AKLA 4IUQA 2O9SA 2RJCA 1U3OA 1VQOT 1OYXA 3LH5A 1RAFB 3EFRA 5L23A 2V8JA 2A3LA 2CKKA 3H0HA 4J7IA 4KRTA 4M78D 1YJWA 2MWPA 1NJIC 2EYWA 2Y90A 5GAMe 4JLIA 2FZCB 1WZOA 1YHQQ 1G3TA 3AT1B 1KQSP 3QJYA 2QEXA 2JS2A 2LCLA 5KYUB 5AT1B 3CCVQ 3EAEA 1AHJB 7AT1B 3A1PA 2A0FB 3V7CA 3EGDA 1B3QA 3MEUA 5L8RE 1UEBA 2GTOA 1UHCA 4KGXB 2FG0A 2DK3A 2Z0WA 4E7SA 1AWOA 3OYDA 1X69A 2FHDA 1YNZA 3JCMV 5EG2A 2DJZA 1SRMA 5FLXE 1GFDA 1M1KR 5LL6S 4QVDA 2LQWA 1Q95G 2DNUA 3C95A 2RI5A 4ZTJA 1LCKA 3OS1A 1WI7A 4BE2A 1S72Q 4JJCA 5CVIA 3H6ZA 1Q81R 3A8MB 5IXBA 1V1CA 3MEAA 5KE2A 4R55A 2EKHA 1Y0MA 1VQ9T 4DBQA 4RTZA 5GAN6 1R0BG 1Q86U 2EYYA 4XTZA 1N9RA 2OX7A 1ZA2B 2YRDA 2RN8A 4RG2A 2ZZDA 5LJ3f 2LJ0A 2CH4W 2WSFE 4OGEA 2RK2A 1TXQA 4E47A 1PRLC 1RI0A 2MAMA 2D0NA 3L1AA 1VQPT 4PKCC 4E7LA 1XTDA 1NJIU 3CCET 2FPDA 1EIFA 4J6XA 1KQSA 4YTLA 2FRWA 5GMKi 1VQ6A 3HFNA 1VQ6T 5CCAA 1MGQA 2LMJA 3CC4T 3QYGB 1GL5A 4BI8B 1VYTA 4PJOE 3TU4K 3C94A 1LPLA 3T9NA 3CCUT 5GMKm 1QW1A 1WYXA 1IREB 3JSCA 2D8HA 2MPXC 1NPRA 1PKTA 1J3TA 2DM1A 3WXMB 3CCMQ 1Q7YU 2DRKA 1YI2T 1V76A 5KCHA 1M4ZA 2XK0A 4OMOA 4JJNK 5GAMj 2LQ8A 2AKKA 1KD1C 1W70A 4E7KA 1QVFA 1NYFA 3EG9A 1MMGA 1YN8A 4XU2A 4M78G 4LE9A 1JB0E 2DKGA 3VV0A 3CCLT 2BZYA 1SRLA 1U06A 4OF1A 1WQ7A 1PD1A 1EFNA 3UT1A 2CP6A 4BI4A 2OAWA 1TWBA 2HQHA 1I8FA 4IKFA 2DTIA 2YRCA 3CCJA 3OW2A 2L3RA 2YT6A 3MPUB 3RESA 1B07A 4GLMA 2F2WA 2DO3A 4C92D 3CD6Q 4EMKB 4ATOA 5CKFA 2C0TA 4M78F 1WFWA 3DB4A 4LXCA 1H641 1D1CA 2AZVA 1VA7A 2QI2A 1I5OB 1VQ6Q 3TQ7P 1Q82U 4HXJA 2X4XA 1UJ0A 3UA6A 4KGVB 4AG1C 3R6NA 2PVDB 2M0OA 1M3AA 2LCCA 4PNOA 2KVQG 2DBKA 3INZA 4LDWA 4BD3A 2DL7A 4A4KA 1G3YA 2KE9A 3P8HA 2QA4Q 5LJ3d 3PGGA 2FL7A 2COZA 5KE3A 2K3YA 4J9DA 5GANe 1YCSB 2F1LA 4M78B 3G6EA 1IGQA 3RBBB 3EFSA 1Q7YC 4HKEA 1JRIA 2W10A 2ZPFB 1RLPC 4IUUA 5KYXA 3G1JA 1FWZA 1I0CA 2D0QB 4C0FA 1ABQA 3RKWA 2QGFB 4R56A 2JN0A 1UHFA 5KYNA 4LN2A 5IH2A 4X9DA 3FLGA 2O4XB 3QWXX 4EDUA 4XU3A 2LJ1A 1D1AA 1D0YA 1Z9ZA 3O8VA 1YWOA 3GOXA 2A28A 3QDRB 4OB3B 2KRSA 2EQIA 3Q1JA 3JCMQ 4KUIA 3CMAQ 2MIOA 3SFMA 4M7AD 1X2KA 2EIFA 3I5RA 1AEYA 1AT1B 1BI2A 2A37A 4WCIA 3X25B 2CZ7B 1NZ9A 4MZTA 4M75D 5IAYA 2L89A 2RO0A 8ATCB 1JO8A 2E64A 4JLGA 4FU6A 2J7IA 2NUTA 1I4K1 2ED1A 2A7YA 1RI9A 1BKBA 1KHCA 3OBWA 4E7HA 3UF4A 5GAMf 2HAXA 1R8OB 2QTXA 3V8JA 5D7UA 2DTOA 2JJ9A 1YI2A 5CK9A 2DYIA 2LNVA 3OQ5A 3PIPA 1VQNT 1I1JA 3P8DA 2XI9A 3JCMh 2VB6A 2L8DA 1ZUYA 1XOVA 2KYMA 2RJEA 2Y4XA 5GAN3 4HT8A 5D6YA 1VOMA 4PLIA 3HRUA 3JRZA 1UGRB 3CCSQ 4JS5A 2O2OA 1N8RR 1UB4A 5FW9A 1WA7A 1A0NB 3EGXB 3HPWA 4M7DF 1BCOA 1GCQA 1NLOC 4LDYA 2K4YA 1NLPC 3J7AF 1AZEA 4HVUA 4FSXA 1UUEA 1GCQC 5D6WA 1D0ZA 5GANg 1VQ8A 3OYKA 3JB9G 1AWWA 1KFZA 2COYA 1OQKA 4BY6C 4ME7A 4C92F 3I56T 2FZGB 4J9IA 3SWNC 1MNEA 4F04B 4J6WA 2CP2A 2E12A 3OW2S 1R77A 4C0GA 3A8OB 3H8ZA 1K73U 1IRXA 2CS7A 5I21A 4JRIA 1WNLA 2DJQA 3OYNA 5FRMA 2GFAA 3FC3A 2KNBB 5GAN4 4FL6A 4Q5WA 4CC3A 4BACA 3PNWC 2RB6A 5CAIA 4J7FA 2OTJQ 3VYGA 3QG1A 4MZPA 1TG0A 3A8LB 2C0IA 2CT3A 1PSEA 2LCSA 4HT9A 2XMFA 5GAN5 2J6OA 4C8QB 2OTJT 3G4SA 2DTHA 2OI3A 3CQTA 5IT9E 3CC7Q 3CCLQ 2WACA 2ZGWA 3CMET 4C92A 4RKUE 2DXBA 4J9BA 3HFOA 1X43A 2RHUA 3QJ6A 2FEIA 2YWWA 1Q82C 3CC7A 3PT9A 2KRNA 4BDYA 1VQMA 4LDXA 2XICA 4KBMB 1VQMT 3UA7A 3UWNA 3WVEB 2QASA 1VQ9A 3M0UA 1I81A 1UGVA 2EQJA 3DLMA 5FU6C 2GFUA 2K9GA 2X4WA 5FWBA 1UGQB 2CZ1B 1T0JA 1K4US 3KUFA 3SHWA 2FYKA 2KMTA 2RI2A 2DVEA 4M77E 4M7DC 1F1BB 1K8AU 2FZKB 1ZSZA 2OAUA 3JCMb 4PJLA 1EZZB 4N0AA 2DIGA 1QMCA 1QWFA 1HSQA 3NPFA 3H9NA 4C5IA 3EHRA 4FW2A 3VU3C 2CZ0B 3MHXA 5LJ5h 2PVGB 4MDWA 3HP9A 2FB7A 1NYGA 1OV3A 1RAIB 2FPFA 2IG0A 3CC2Q 1NBEB 5HK0A 4E7JA 2JTMA 1G2BA 1M90R 3VKIA 3NFCA 1RACB 2K5IA 4F7UF 4IUPA 1W2BP 4C0DB 1MMAA 1PHTA 4M7AB 2ESWA 1N6AA 3JV3A 4XTWA 1YBYA 4ZTFA 2I0NA 4RTVA 2LX9A 3I35A 1AVZC 1K9AA 4ZGEB 4ZNXA 2L0AA 1VQLQ 4PFOA 2DZ9A 2AZSA 4FCYA 2LTOA 2DEQA 3QKJA 3JCMW 3OYMA 2LC4A 2KQWA 1QVGA 5KYXB 1HYOA 3QPHA 4ESRA 1Y57A 5CIUA 2DZCA 4VUBA 4QKUA 1RAAB 1YITQ 3JCMJ 2J05A 1JU5C 2C06A 3G71A 4II1A 4M7DB 1BIBA 1WHMA 4JRKA 3RR6A 2R5AA 4B9XA 2HBWA 4Y91A 1SG5A 2BTTA 1MV3A 4OB2B 5KYUA 1Q81C 3G6ET 2DERA 1DJ7B 1WPYA 3BDLA 5I22A 2QQSA 4XQ3A 4A53A 4GY5A 1M2VA 2JT4A 4BB7A 1MNDA 2QYZA 1Y96B 3FB9A 2HL5C 1UTIA 3TCJA 2H3JA 3TSWA 2EKOA 2PU9B 2M1HA 1KJWA 4X34A 4ZGJB 3THKA 1H8KA 1VQOQ 1BI3A 3CMEA 1FYNA 3L2ZA 1JJ2S 3CMEQ 4M77D 1N8RU 2EYZA 3CPWA 3REAB 1TU0B 3EFOB 1MMNA 1AD5A 4C5EA 1IXDA 3RKYA 3BW1A 4C8QC 2FRYA 2VWFA 2IIMA 2JTFA 4A63B 2CZ6B 3JCMf 4M75E 3L2WA 1RAEB 2LT1A 3BE3A 3CC2T 1PNJA 3S3NA 1OOTA 2CYZB 4PJOG 1OPKA 1AWJA 2EQKA 2NWMA 4OVAA 1HD3A 2K2VA 3CD6T 4M4ZA 3X24B 1K73R 2F2VA 2YUQA 5HKCA 3G71Q 1UE9A 5GAOq 2EVRA 2ABLA 4F7UG 2ATCB 5LJ3e 2RQRA 3M0PA 2DXUA 1D1BA 4HVVA 2FVUA 4OMMA 1UFFA 2X3XD 2AK5A 1SEMA 2QK0A 3GNGA 2CP5A 1MUZA 5CO7A 2EYXA 4M75F 5KYYA 1KC8C 2MCNA 1BCMA 3VS1A 2EGEA 2DD5A 2KDSA 4M75C 2VYTA 2ZPEB 3CCST 3DB3A 1KD1R 2D1XA 1RAGB 1BB9A 4HCZA 3RUXA 4LD9K 2EGAA 2QDYB 1TSFA 3I55A 4N4GA 4ELYC 2XIDA 4JUVA 5A2QE 1VYVA 3FIFA 4JRQA 1BYMA 4F14A 4PL6A 1D0XA 1NM7A 3OYJA 2F2XA 3LLRA 3V7SA 5DLOA 2E6ZA 2QGGA 5FU7C 4KUDK 3AHUA 2YLBA 2EJFA 3CCMA 4FT2A 2XG8D 3L2QA 3QUIA 4C8QD 1Q86C 2E5KA 2WSEE 2RA2A 4FYVB 4E7ZA 5GMKj 1RAHB 1ZLMA 4AT1B 2BKDN 2DLPA 2EFIA 2BUDA 4PJOC 2YUOA 3X20B 3S6WA 1E6GA 1YHQT 1PCXA 1VQ9Q 1N27A 2HSPA 3ZEHA 4RTUA 3OYCA 1OZ2A 1RLQC 4XU1A 2RK1A 5DM7R 2HMAA 3OMGA 3JAME 1X27A 2ED0A 1WX6A 2MI6A 2PZ1A 3J80E 1VQNA 3VS6A 4BI3A 3DLLA 4XAXB 1Y7XA 2E6NA 1Q7YR 2QXFA 4MDXA 1TH7A 4XU0A 2QTVA 3A98A 2RJFA 3RMSA 3CCLA 3JB9J 2HQEA 1XNIA 4J83A 1MHNA 3J81E 1QWEA 2ECZA 1QVFP 1OU9A 1NPPA 3L2RA 1BBZA 2JM9A 3OYHA 2E70A 1W2BA 3M58A 1CKAA 1PD0A 5CKDA 2CSQA 3OA6A 1ZSZB 2G3RA 4JDSA 3OS5A 2X51A 3P8BB 3ZBDA 3OYIA 1IHVA 4RCBA 3PVQA 2DYBA 4GLKA 1TTHB 4CC4B 1Q82R 2KGTA 4GBQA 4X9CA 4C8QA 3N5BB 2GF7A 3SB2A 1ZBJA 3H0FA 4UC4A 3E9GA 5GMKe 3GPLA 3CCVT 4KT0E 1AZGB 3GNFB 4RCCA 2BZ8A 2E3IA 2V26A 3NTKA 3M53A 3NTHA 3FJ5A 2DAQA 2JVVA 3OB9A 4JZ3A 4AFZC 1D3BA 4HCKA 1QCFA 3MCAB 2KT1A 4C0DC 3C12A 4PJOD 4E2FB 1WJRA 1JQQA 3CCSA 4EMGA 2X4JA 2XDPA 1BI1A 1QQJA 4JRPA 2LQKA 2O4XA 3JB9F 1FXXA 2QDLA 1U8RA 2KY9A 3CPWS 2ROLA 2AHJB 1JJ2A 3CEYA 5GAOl 1M2VB 1WJSA 3C0CA 4M7DG 1YI2Q 1QKWA 2D6FA 3G71T 1JXMA 4FT4A 5LJ5g 2QEXT 2EJGA 4C5HA 1RABB 3MP1A 3EG2A 1CKBA 1M90C 5LJ3g 2JZ2A 2K3XA 3FDRA 4ANJA 4DBFA 1WLPB 2QA4T 2OTLA 1H3ZA 4XTYA 2XHCA 3M0TA 2HEQA 2QQBA 1UGSB 4C8QF 4AMCA 2LT4A 4OMNA 3A8HB 1K76A 3CMAA 4M7AA 3PTAA 3JB9H 2HL3A 2F69A 3PMTA 4DA4A 3F70A 2K3BA 2LJ3A 2P0KA 3I9QA 2LQNA 3NGPA 4Z8AA 4DOVA 5CKHA 1VQOA 1QVGS 4M77C 5FRNA 2KR3A 3E1SA 1Z9QA 4B6MA 1FMKA 1ZQ1A 1RL2A 2RH2A 1H92A 1PC0A 2A08A 4L5GA 2B8AA 1I07A 4NOYA 2VC8A 1VQ4A 3CXCP 1HK9A 4N4IA 3UDCA 2KT8A 3VRZA 3OYYA 1OX9A 3EG0A 2X4YA 4Y92A 2K5LA 2VASA 4Y28E 1TUGB 1ZSZC 3BY7A 5GAN8 4RTXA 2CT4A 5GAMh 3EG3A 1GXIE 4QW2A 2EPDA 2CUBA 2KBTA 5CQXA 1VQNQ 5KYYB 2M51A 4C0ZA 3GP8A 1YIJA 3VS5A 3KBGA 3MEWA 1YIJT 1ZUKA 3OYLA 2JTEA 3CMAT 1QVFS 1G8XA 5GAN2 3O5ZA 4M77F 4BY6B 2DXTA 3QIIA 1Y96A 5FU7B 2QG9B 1SPKA 2RHIA 1V29B 2E41A 4O6JA 1NE8A 1VQLA 2XU8A 2DRMA 1W6XA 1VQLT 1ACMB 3GIBA 1ZBXA 1X01A 2CP3A 2E65A 1G5VA 1TOVA 3A5ZB 3QHSA 1JEGA 3CD6A 2HBPA 5GMKl 3CCQQ 2MK5A 1BI0A 2RHZA 2V1QA 2R58A 1QP3A 3CCEQ 4M75B 1VQKQ 2W0ZA 4PLLA 1KK7A 2K57A 4FSSA 4KULA 1WDXA 5LJ3h 3M55A 4DQ2A 2YDLA 3M59A 5C0MA 4FYXB 5CR2A 2SRCA 4JJDA 3FRNA 4OGCA 4MZMA 2KEAA 2BE9B 2DMOA 4M7DD 4V2SA 4QQ6A 3OYGA 2C0OA 1E7OA 2M0YA 2AT1B 2MWOA 4AFSC 1QP2A 4M77G 5A0GA 1Y71A 1FX7A 2DX1A 3LGFA 3TEEA 2G6FX 4R0KA 1X6OA 3CCQT 1GCPA 2GBQA 4FYWB 2IVWA 1SF9A 5CKEA 2LZ6B 2P0PA 2FO0A 1Y07A 4A4EA 3JCMP 1MMDA 4RUGA 3VYHB 3X26B 1M1GA 1ARKA 2LP5A 5FROA 3S3MA 2H3EB 1YP5A 3JCMX 1HJDA 2LRQA 2HKQB 4E6RA 3OS2A 4MMLA 4M7DE 2WSCE 3M0RA 1WHKA 3TVTA 1YIJQ 3ME9A 1LOJA 1SSHA 3M4YA 2EW3A 3NMZC 5M9OA 1C6VX 1WXUA 2BIVA 2DD4A 1AOJA 1M30A 2E5QA 2X3WD 1TS9A 3EG1A 2DA9A 4RG8A 3CBOA 1PRMC 4XK8E 3E2UA 3G4SQ 2LDMA 5DY9A 1QVPA 5GMKh 3JB9D 4FYYB 1ZX6A 3L42A 1VQ4Q 2BZXA 1K8AC 1G3WA 1D09B 2I2LA 3NHNA 2OTJA 1IZ6A 2PTKA 1LVKA 1WXTA 2PNIA 2CGHA 1VIEA 4EMKA 5GJWB 1NEBA 1K8AR 2EAYA 2VUBA 1O9SA 1S72A 1M90U 5HY6A 2CREA 1ZUUA 2RI3A 4PK4A 5J39A 4XTVA 1FMVA 3OBYA 2PQWA 3RERA 2VXFA 3QWYA 4OB1B 2F5TX 4ZN3A 3EG9B 3CC7T 1VQ7A 1UJYA 1GBRA 3CXCS 4QVZA 4IIOA 2CP7A 3ER0A 1KQ1A 5DLQE 2EYQA 1YJNT 4J6YA 3FEOA 3SD4A 1M9SA 2JOYA 1JBMA 3M0SA 4A4HA 3HTRA 4CRIA 1BK2A 1VYUA 3M0QA 4JS4A 2R5MA 1XQHA 4IIMA 2HD0A 2H8HA 4PJOA 4DBRA 3V8KA 5KH6A 2QEXQ 4BDZA 1ABOA 4LD6A 2CH4A 2KI7A 1YHQA 4JPBW 3MO8A 4M78C 4A4GA 1U1TA 2EJ9A 5C6SA 4C8QG 1YJWQ 1VQ5T 4DEXA 2V8KA 5KYWA 2YSQA 2HZYA 1WQWA 3REBB 5IN1A 2D8JA 1LJOA 1PKSA 2NUPA 3JCMd 1KC8R 4HCBA 1VUBA 2X9HA 3QBYA 2DBMA 4NL3A 2DL5A 3C4SA 5HCKA 3VS2A 3QXEB 2B86A 2EQMA 4RMOA 2L3PA 3PE0A 1GFCA 3IQLA 1K9MR 2ZAEA 2KK4A 3M4GA 1WXBA 2XDBA 3CCUQ 3QYHB 2KAFA 1M2OA 4PFPA 1NG2A 1QCNA 1VIFA 2DPPB 3LW5E 1VQPA 2GNCA 3CC4Q 2RJDA 3M54A 2DL3A 4FM4B 2RNAA 1QLYA 4XTXA 5GAN7 3I56A 3LGLA 2GQVA 1T0HA 2MOXA 1OZ3A 2E3HA 3MKDA 1SHGA 2KYBA 3PIOA 2SEMA 4J9GA 3NTIA 3CCRT 1VQ7Q 5GAOm 3OSVA 4OMPA 1PM3A 3X28B 4M75A 2MYSA 2ZPGB 3CBPA 3OYFA 2ROTA 3BFMA 3V7RA 2ZPBB 4NL2A 3E9FA 1UECA 5GANd 2OTLT 2VGMA 2RHXA 2DFUA 1W4SA 2NUTB 1OULA 2M02A 1YWPA 3MEVA 2HQXA 1YCYA 1VQ5A 1SHFA 2PUKB 4JZ4A 1VQ8T 2XD0A 3VJPA 1PSFA 5D6XA 4LDVA 2GCXA 5FU6B 3OY9A 3HRTA 2O01E 3GF5A 1VQKT 3EGDB 3PMIA 4PFZA 1KC8U 2ENMA 1T3SA 4BE0A 2DVJA
chains in the Genus database with same CATH topology
4QT7A 3M0UA 2DE0X 4Z88A 1UGVA 2JS2A 3EG2A 1CKBA 2K9GA 2CSIA 2JS0A 5FWBA 1B3QA 1T0JA 1K4US 1WLPB 3SHWA 2LX7A 4CC7A 2GTOA 1UHCA 2FG0A 5IHKA 3M0TA 2HEQA 1AWOA 4OMNA 1X2QA 1X69A 1K76A 3I5SA 1YNZA 1UG1A 1QWFA 1K0XA 1SRMA 1GFDA 2K3BA 1HSQA 3NPFA 2LJ3A 3I9QA 2LQNA 3EHRA 2LQWA 3NGPA 4Z8AA 1UDLA 2DNUA 3GBQA 2CDTA 2KR3A 2RQTA 1LCKA 1Z9QA 1FMKA 3KFVA 1WI7A 1H92A 1NYGA 1OV3A 2A08A 2FPFA 4JJCA 1OEBA 2GTJA 4D8DA 1G2BA 1I07A 1BU1A 4RTYA 2NUZA 1K1ZA 1W1FA 1PHTA 5IXBA 2KT8A 1V1CA 3VRZA 2EKHA 4AG2C 1Y0MA 3EG0A 2O88A 4Y92A 2ESWA 4RTZA 3VS3A 3JV3A 2I0NA 2EYYA 4RTVA 2JM8A 3I35A 2YUPA 1AVZC 1K9AA 4RTXA 2RN8A 2L0AA 4ZNXA 2CT4A 2LJ0A 3EG3A 4RTWA 3EGUA 2CH4W 1OPLA 2AZSA 2EPDA 2CUBA 2KBTA 2M51A 1PRLC 2D0NA 1KSWA 2K79A 3VS5A 1ZUKA 2FPDA 2JTEA 4ESRA 1Y57A 2FRWA 3O5ZA 5I11A 5IHNA 2J05A 1JU5C 3U23A 1SPKA 2LMJA 3H41A 1GL5A 2HBWA 3EHQA 4OMQA 1VYTA 2DRMA 4F17A 1W6XA 2BTTA 1MV3A 1WYXA 5I22A 2D8HA 1JEGA 4J9EA 1PKTA 4JJBA 2V1QA 2JT4A 1J3TA 2DM1A 2DRKA 1UTIA 3TSWA 1KJWA 2W0ZA 2GQIA 4OMOA 4FSSA 1WDXA 1K0SA 2YDLA 3THKA 1H8KA 2AKKA 4LUDA 1W70A 2SRCA 4X1VA 4JJDA 1NYFA 1YN8A 2KEAA 4LE9A 1FYNA 2DMOA 2K2MA 2EYZA 3REAB 2HCKA 2C0OA 1E7OA 1GBQA 1SRLA 1U06A 1AD5A 2BZYA 2M0YA 2KROA 2DILA 4AFSC 4K11A 1EFNA 2FRYA 2VWFA 2IIMA 2OAWA 2P4RA 4A63B 2DX1A 1ZSGA 2G6FX 4R0KA 2JXBA 1GCPA 2GBQA 1MV0B 2DL4A 3UATA 2YT6A 2RQUA 1B07A 4GLMA 2F2WA 4J9FA 1PNJA 1OOTA 2JMCA 2C0TA 2LZ6B 1NEGA 2FO0A 1OPKA 2J06A 1AWJA 2O9VA 2V1RA 1WFWA 3ZL7C 4RUGA 2L3SA 2NWMA 3SEMA 1ARKA 1JXOA 2LP5A 2AZVA 1HD3A 1VA7A 2J6FA 1YP5A 1HJDA 1WIEA 4M4ZA 2EBPA 1M27C 2JW4A 4HXJA 2F2VA 2YUQA 4E6RA 1UE9A 1UJ0A 3M0RA 1IO6A 3UA6A 3TVTA 2EVRA 4AG1C 2ABLA 3R6NA 1PWTA 1M3AA 1SSHA 2DBKA 2RQVA 2EW3A 2RQRA 2DL7A 3NMZC 2YUNA 2L2PA 2KE9A 2GGRA 3M0PA 4LUEA 1WXUA 1AOJA 1M30A 1T3LA 4HVVA 4OMMA 4J9DA 4J9HA 1UFFA 2X3XD 2X3WD 2AK5A 3EG1A 2DA9A 1SEMA 1PRMC 1YCSB 1MUZA 3RBBB 2EYXA 1ZX6A 2MCNA 2BZXA 3VS1A 2W10A 1RLPC 2EGEA 3NHNA 3VS4A 2PTKA 1WXTA 2PNIA 1I0CA 5GJWB 1NEBA 1ABQA 2D1XA 1BB9A 2KRMA 1UHFA 2CREA 2EGAA 1ZUUA 4LN2A 5IH2A 5ECAA 4AFUC 1N5ZA 3QWYA 2J6KA 3QWXX 2LJ1A 1VYVA 1M3BA 1UJYA 1GBRA 4F14A 1Z9ZA 1YWOA 4DEYA 4IIOA 1NM7A 4LNPA 2F2XA 2A28A 1E6HA 2KRSA 2EQIA 5IXFA 2MIOA 3H0IA 2K6DA 2LNHB 3M0SA 2L3QA 1X2KA 3I5RA 3VRYA 1AEYA 1BK2A 2A37A 1VYUA 4WCIA 2JMAA 3M0QA 2E5KA 4CC2A 4IIMA 1ZLMA 2H8HA 2DLPA 2K7AA 2YUOA 1JO8A 5GJVB 2J7IA 2ED1A 4F16A 1AWXA 1RI9A 1ABOA 1E6GA 3UF4A 2CH4A 2VVKA 2HSPA 4JPBW 4RTUA 1RLQC 2EGCA 3TSZA 4DEXA 1M3CA 1M8MA 1X27A 1I1JA 2ED0A 1WX6A 2YSQA 2PZ1A 2DL8A 3REBB 1S1NA 2D8JA 3VS6A 1PKSA 1ZUYA 1XOVA 2OJ2A 2KYMA 2HDAA 2DBMA 2DL5A 3A98A 5HCKA 3VS2A 4EIKA 2B86A 2L3PA 3PE0A 1GFCA 3IQLA 1GRIA 2O2OA 5FW9A 2RQWA 1QWEA 1WA7A 2ECZA 1A0NB 5IHIA 1GCQA 2RMOA 1NLOC 5EC7A 1H3HA 3RNJA 1WXBA 1BBZA 1NLPC 2JM9A 1AZEA 4HVUA 1UUEA 1GCQC 1NG2A 4RTTA 1CKAA 1G83A 2CSQA 2GNCA 1X6GA 1AWWA 4AFQC 2DL3A 2CUDA 2KXCA 1KFZA 2RNAA 1QLYA 4OMLA 2FPEA 2O31A 4HVWA 1T0HA 2RPNA 2MOXA 4J9IA 3VS7A 3VS0A 3ULRB 2DF6A 3PVQA 1SHGA 2A36A 2KYBA 2SEMA 1RUWA 4J9GA 2DYBA 4CC4B 2KGTA 4GBQA 4OMPA 2DJQA 4J9CA 1TUCA 1X6BA 2KXDA 1ZBJA 2ROTA 3H0FA 2KNBB 1UECA 1KIKA 4CC3A 1AZGB 2BZ8A 4Z89A 1U5SA 3FJ5A 2VKNA 3PVLA 5FWCA 4ORZA 1TG0A 4JZ3A 4AFZC 2C0IA 2CT3A 1TUDA 4HCKA 1QCFA 2LCSA 2KT1A 2XMFA 1YWPA 1JQQA 2J6OA 4D8KA 1CSKA 2OI3A 3CQTA 2RF0A 1QKXA 1SHFA 2AKLA 2O9SA 4JZ4A 4J9BA 1X43A 2QDLA 1U3OA 2ROLA 3LH5A 5L23A 2FEIA 3H0HA 3C0CA 2KRNA 4KRTA 1QKWA 3UA7A 2EYWA 2ENMA 1T3SA 1JXMA 2DVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QT7 A;  3M0U A;  2DE0 X;  4Z88 A;  1UGV A;  2JS2 A;  3EG2 A;  1CKB A;  2K9G A;  2CSI A;  2JS0 A;  5FWB A;  1B3Q A;  1T0J A;  1K4U S;  1WLP B;  3SHW A;  2LX7 A;  4CC7 A;  2GTO A;  1UHC A;  2FG0 A;  5IHK A;  3M0T A;  2HEQ A;  1AWO A;  4OMN A;  1X2Q A;  1X69 A;  1K76 A;  3I5S A;  1YNZ A;  1UG1 A;  1QWF A;  1K0X A;  1SRM A;  1GFD A;  2K3B A;  1HSQ A;  3NPF A;  2LJ3 A;  3I9Q A;  2LQN A;  3EHR A;  2LQW A;  3NGP A;  4Z8A A;  1UDL A;  2DNU A;  3GBQ A;  2CDT A;  2KR3 A;  2RQT A;  1LCK A;  1Z9Q A;  1FMK A;  3KFV A;  1WI7 A;  1H92 A;  1NYG A;  1OV3 A;  2A08 A;  2FPF A;  4JJC A;  1OEB A;  2GTJ A;  4D8D A;  1G2B A;  1I07 A;  1BU1 A;  4RTY A;  2NUZ A;  1K1Z A;  1W1F A;  1PHT A;  5IXB A;  2KT8 A;  1V1C A;  3VRZ A;  2EKH A;  4AG2 C;  1Y0M A;  3EG0 A;  2O88 A;  4Y92 A;  2ESW A;  4RTZ A;  3VS3 A;  3JV3 A;  2I0N A;  2EYY A;  4RTV A;  2JM8 A;  3I35 A;  2YUP A;  1AVZ C;  1K9A A;  4RTX A;  2RN8 A;  2L0A A;  4ZNX A;  2CT4 A;  2LJ0 A;  3EG3 A;  4RTW A;  3EGU A;  2CH4 W;  1OPL A;  2AZS A;  2EPD A;  2CUB A;  2KBT A;  2M51 A;  1PRL C;  2D0N A;  1KSW A;  2K79 A;  3VS5 A;  1ZUK A;  2FPD A;  2JTE A;  4ESR A;  1Y57 A;  2FRW A;  3O5Z A;  5I11 A;  5IHN A;  2J05 A;  1JU5 C;  3U23 A;  1SPK A;  2LMJ A;  3H41 A;  1GL5 A;  2HBW A;  3EHQ A;  4OMQ A;  1VYT A;  2DRM A;  4F17 A;  1W6X A;  2BTT A;  1MV3 A;  1WYX A;  5I22 A;  2D8H A;  1JEG A;  4J9E A;  1PKT A;  4JJB A;  2V1Q A;  2JT4 A;  1J3T A;  2DM1 A;  2DRK A;  1UTI A;  3TSW A;  1KJW A;  2W0Z A;  2GQI A;  4OMO A;  4FSS A;  1WDX A;  1K0S A;  2YDL A;  3THK A;  1H8K A;  2AKK A;  4LUD A;  1W70 A;  2SRC A;  4X1V A;  4JJD A;  1NYF A;  1YN8 A;  2KEA A;  4LE9 A;  1FYN A;  2DMO A;  2K2M A;  2EYZ A;  3REA B;  2HCK A;  2C0O A;  1E7O A;  1GBQ A;  1SRL A;  1U06 A;  1AD5 A;  2BZY A;  2M0Y A;  2KRO A;  2DIL A;  4AFS C;  4K11 A;  1EFN A;  2FRY A;  2VWF A;  2IIM A;  2OAW A;  2P4R A;  4A63 B;  2DX1 A;  1ZSG A;  2G6F X;  4R0K A;  2JXB A;  1GCP A;  2GBQ A;  1MV0 B;  2DL4 A;  3UAT A;  2YT6 A;  2RQU A;  1B07 A;  4GLM A;  2F2W A;  4J9F A;  1PNJ A;  1OOT A;  2JMC A;  2C0T A;  2LZ6 B;  1NEG A;  2FO0 A;  1OPK A;  2J06 A;  1AWJ A;  2O9V A;  2V1R A;  1WFW A;  3ZL7 C;  4RUG A;  2L3S A;  2NWM A;  3SEM A;  1ARK A;  1JXO A;  2LP5 A;  2AZV A;  1HD3 A;  1VA7 A;  2J6F A;  1YP5 A;  1HJD A;  1WIE A;  4M4Z A;  2EBP A;  1M27 C;  2JW4 A;  4HXJ A;  2F2V A;  2YUQ A;  4E6R A;  1UE9 A;  1UJ0 A;  3M0R A;  1IO6 A;  3UA6 A;  3TVT A;  2EVR A;  4AG1 C;  2ABL A;  3R6N A;  1PWT A;  1M3A A;  1SSH A;  2DBK A;  2RQV A;  2EW3 A;  2RQR A;  2DL7 A;  3NMZ C;  2YUN A;  2L2P A;  2KE9 A;  2GGR A;  3M0P A;  4LUE A;  1WXU A;  1AOJ A;  1M30 A;  1T3L A;  4HVV A;  4OMM A;  4J9D A;  4J9H A;  1UFF A;  2X3X D;  2X3W D;  2AK5 A;  3EG1 A;  2DA9 A;  1SEM A;  1PRM C;  1YCS B;  1MUZ A;  3RBB B;  2EYX A;  1ZX6 A;  2MCN A;  2BZX A;  3VS1 A;  2W10 A;  1RLP C;  2EGE A;  3NHN A;  3VS4 A;  2PTK A;  1WXT A;  2PNI A;  1I0C A;  5GJW B;  1NEB A;  1ABQ A;  2D1X A;  1BB9 A;  2KRM A;  1UHF A;  2CRE A;  2EGA A;  1ZUU A;  4LN2 A;  5IH2 A;  5ECA A;  4AFU C;  1N5Z A;  3QWY A;  2J6K A;  3QWX X;  2LJ1 A;  1VYV A;  1M3B A;  1UJY A;  1GBR A;  4F14 A;  1Z9Z A;  1YWO A;  4DEY A;  4IIO A;  1NM7 A;  4LNP A;  2F2X A;  2A28 A;  1E6H A;  2KRS A;  2EQI A;  5IXF A;  2MIO A;  3H0I A;  2K6D A;  2LNH B;  3M0S A;  2L3Q A;  1X2K A;  3I5R A;  3VRY A;  1AEY A;  1BK2 A;  2A37 A;  1VYU A;  4WCI A;  2JMA A;  3M0Q A;  2E5K A;  4CC2 A;  4IIM A;  1ZLM A;  2H8H A;  2DLP A;  2K7A A;  2YUO A;  1JO8 A;  5GJV B;  2J7I A;  2ED1 A;  4F16 A;  1AWX A;  1RI9 A;  1ABO A;  1E6G A;  3UF4 A;  2CH4 A;  2VVK A;  2HSP A;  4JPB W;  4RTU A;  1RLQ C;  2EGC A;  3TSZ A;  4DEX A;  1M3C A;  1M8M A;  1X27 A;  1I1J A;  2ED0 A;  1WX6 A;  2YSQ A;  2PZ1 A;  2DL8 A;  3REB B;  1S1N A;  2D8J A;  3VS6 A;  1PKS A;  1ZUY A;  1XOV A;  2OJ2 A;  2KYM A;  2HDA A;  2DBM A;  2DL5 A;  3A98 A;  5HCK A;  3VS2 A;  4EIK A;  2B86 A;  2L3P A;  3PE0 A;  1GFC A;  3IQL A;  1GRI A;  2O2O A;  5FW9 A;  2RQW A;  1QWE A;  1WA7 A;  2ECZ A;  1A0N B;  5IHI A;  1GCQ A;  2RMO A;  1NLO C;  5EC7 A;  1H3H A;  3RNJ A;  1WXB A;  1BBZ A;  1NLP C;  2JM9 A;  1AZE A;  4HVU A;  1UUE A;  1GCQ C;  1NG2 A;  4RTT A;  1CKA A;  1G83 A;  2CSQ A;  2GNC A;  1X6G A;  1AWW A;  4AFQ C;  2DL3 A;  2CUD A;  2KXC A;  1KFZ A;  2RNA A;  1QLY A;  4OML A;  2FPE A;  2O31 A;  4HVW A;  1T0H A;  2RPN A;  2MOX A;  4J9I A;  3VS7 A;  3VS0 A;  3ULR B;  2DF6 A;  3PVQ A;  1SHG A;  2A36 A;  2KYB A;  2SEM A;  1RUW A;  4J9G A;  2DYB A;  4CC4 B;  2KGT A;  4GBQ A;  4OMP A;  2DJQ A;  4J9C A;  1TUC A;  1X6B A;  2KXD A;  1ZBJ A;  2ROT A;  3H0F A;  2KNB B;  1UEC A;  1KIK A;  4CC3 A;  1AZG B;  2BZ8 A;  4Z89 A;  1U5S A;  3FJ5 A;  2VKN A;  3PVL A;  5FWC A;  4ORZ A;  1TG0 A;  4JZ3 A;  4AFZ C;  2C0I A;  2CT3 A;  1TUD A;  4HCK A;  1QCF A;  2LCS A;  2KT1 A;  2XMF A;  1YWP A;  1JQQ A;  2J6O A;  4D8K A;  1CSK A;  2OI3 A;  3CQT A;  2RF0 A;  1QKX A;  1SHF A;  2AKL A;  2O9S A;  4JZ4 A;  4J9B A;  1X43 A;  2QDL A;  1U3O A;  2ROL A;  3LH5 A;  5L23 A;  2FEI A;  3H0H A;  3C0C A;  2KRN A;  4KRT A;  1QKW A;  3UA7 A;  2EYW A;  2ENM A;  1T3S A;  1JXM A;  2DVJ A; 
#chains in the Genus database with same CATH topology
 4L6V 5;  4QT7 A;  2DE0 X;  3JCM c;  4Z88 A;  2ZPH B;  3GLX A;  1RAD B;  4IUR A;  3R6O A;  3CXC A;  2CSI A;  3QDF A;  2JS0 A;  4FIB A;  3VUZ A;  3OS0 A;  3LH0 A;  2LX7 A;  4ZN1 A;  4CC7 A;  2YHT A;  3FJP A;  5IHK A;  1O75 A;  5CQY A;  1X2Q A;  3HKS A;  3I5S A;  1UG1 A;  1JJ2 P;  1K73 C;  1YJ9 Q;  3G7Z A;  3S3O A;  1K0X A;  1UGP B;  4PJO B;  4ELZ C;  3I55 Q;  2E4H A;  1UDL A;  4ZGD B;  1OI1 A;  1NJI R;  3GBQ A;  2CDT A;  2RQT A;  3KFV A;  6AT1 B;  4CI0 C;  1OEB A;  4N4H A;  4B9W A;  3CCU A;  1VQK A;  2GTJ A;  1N8R C;  4D8D A;  3L2U A;  1BU1 A;  4RTY A;  3RDV A;  2NUZ A;  3WVD B;  1YJW T;  2L5Q A;  1K1Z A;  1W1F A;  2ZCF B;  2E10 A;  1BIA A;  3ASK A;  5GAM g;  2DET A;  4AG2 C;  3EH2 A;  2O88 A;  2PUO B;  3VS3 A;  4HA8 A;  4KH1 B;  3MP6 A;  2JM8 A;  2YRV A;  1OX8 A;  2YUP A;  3DKM A;  3G4S T;  4WTO B;  2RD1 A;  3D7S B;  3VUB A;  4OB0 B;  2HKN A;  4RTW A;  3EGU A;  1OPL A;  1WHL A;  4M78 E;  4C92 B;  3M9Q A;  2P0Q A;  2DXC A;  2F5K A;  4KGZ B;  1KSW A;  2K79 A;  2BE7 D;  2HNI A;  5AYF A;  2VXE A;  3L2V A;  1XJW B;  4E7I A;  3RKX A;  1WJQ A;  5I11 A;  1YJN Q;  5IHN A;  3U23 A;  3H41 A;  3CCR A;  3LWI A;  1M5Q 1;  3EHQ A;  4OMQ A;  4OMF B;  4M78 A;  4M77 B;  4F17 A;  4EPC A;  3URG A;  1Q86 R;  5GAO p;  1IB8 A;  1K9M U;  5LJ5 j;  4PJJ A;  5GAM d;  1OU8 A;  2NUP B;  4L59 A;  4J9E A;  4JJB A;  3UPU A;  4QQG A;  5LJ5 e;  1WGS A;  2ZPI B;  4C92 G;  2GQI A;  4LDU A;  1IGU A;  1K0S A;  2HSE B;  1EX4 A;  1R0C B;  4WF2 A;  2DIQ A;  1KG1 A;  4LUD A;  2QQ9 A;  4X1V A;  3LWH A;  5GAN f;  5GAO r;  4A4F A;  2K2M A;  3OYB A;  2HCK A;  1GBQ A;  1M1K C;  3MJX A;  2KRO A;  2DIL A;  4K11 A;  3TRE A;  3OYE A;  2RHY A;  3HL8 A;  2EWN A;  2P4R A;  1I5L A;  1ZSG A;  1VQ4 T;  2JXB A;  4F7U B;  1MV0 B;  2DL4 A;  3UAT A;  2QQA A;  2EQU A;  2RQU A;  5I2M A;  4BE1 A;  2OTL Q;  4J9F A;  3G6E Q;  1WHH A;  2JMC A;  1NEG A;  4EMK C;  2J06 A;  2O9V A;  2V1R A;  1QVG P;  3ZL7 C;  3I55 T;  2L3S A;  3SEM A;  1JXO A;  1KQ2 A;  2QQR A;  2J6F A;  1YIT A;  2QA4 A;  5J3B A;  1WIE A;  1YJ9 T;  3CCR Q;  1VQ7 T;  2EBP A;  1YIT T;  1KHI A;  3E19 A;  1M27 C;  3EH1 A;  2JW4 A;  3OSS C;  3BDU A;  1IO6 A;  1P92 A;  1YJN A;  1FMW A;  1PWT A;  5KYW B;  3M56 A;  3PFS A;  2RQV A;  1HXD A;  2YUN A;  2L2P A;  2YLC A;  2GGR A;  3HRS A;  4LUE A;  1T3L A;  4DOW A;  1Q81 U;  1K9M C;  4J9H A;  4M7A F;  1G3S A;  3CBM A;  3OW2 P;  1KQS S;  3CCJ Q;  2D9T A;  2K5F A;  2NLU A;  3VS4 A;  3M57 A;  1SKU B;  3CCJ T;  4DBH A;  3JCM g;  1U1S A;  3CC2 A;  2KRM A;  3V8L A;  4XTU A;  5HK3 A;  5LJ3 j;  5ECA A;  4AFU C;  3SWN A;  8AT1 B;  3MP8 A;  9ATC B;  1N5Z A;  2J6K A;  4M77 A;  1YJ9 A;  1M3B A;  4DEY A;  2CP0 A;  3JB9 I;  4LNP A;  2XDD A;  1C0M A;  2P84 A;  4EMH A;  2JUF A;  3JCM e;  3RIR A;  3ZFJ A;  4M7A C;  3CCE A;  1E6H A;  1B34 A;  4FW1 A;  1M8V A;  2IPO B;  5IXF A;  4O5V A;  1C1A A;  4M7D A;  3SWN B;  3H0I A;  2K6D A;  2LNH B;  4C92 E;  4PJN A;  2L3Q A;  3VRY A;  3CCQ A;  3A8G B;  2JMA A;  3MET A;  3OYA A;  1LNX A;  4PJM A;  4CC2 A;  1SSF A;  1WHG A;  3QSU A;  3CPF A;  2K7A A;  5GJV B;  2JNG A;  2AIR B;  4F16 A;  1AWX A;  1B34 B;  3M5A A;  2MF2 A;  2VVK A;  3QZ5 B;  1VQM Q;  4IUV A;  3RMQ A;  4M75 G;  3CPW P;  4HCC A;  5LJ5 d;  2EGC A;  3TSZ A;  1M3C A;  4BUG A;  1M8M A;  4M7A E;  2X35 A;  4M7A G;  2DL8 A;  3HSB A;  3EGX A;  4NS5 A;  1S1N A;  4C92 C;  3EFO A;  2OJ2 A;  2HDA A;  1B7T A;  1ZA1 B;  5A0L A;  2M16 A;  4QVC A;  1VQ5 Q;  2R57 A;  4EIK A;  3OMC A;  2MMP A;  3CCM T;  1GRI A;  2KSS A;  4D6W A;  4F7U E;  2RQW A;  4A54 A;  5IHI A;  2LVM A;  2RMO A;  5EC7 A;  1H3H A;  1PG5 B;  4C5G A;  1D3B B;  5GAN j;  3RNJ A;  4MMK A;  5GAO n;  2M9U A;  1WHJ A;  4PJO F;  4RTT A;  4P5N A;  1YFN A;  1KD1 U;  2V8I A;  1G83 A;  4J8O A;  2DEU A;  2P4T A;  1X6G A;  2NYS A;  4AFQ C;  2E1H A;  2CUD A;  2KXC A;  1ZHI A;  1W2B S;  2RM4 A;  5I2S A;  4OML A;  2FPE A;  2O31 A;  4F7U A;  4HVW A;  2RPN A;  3LYI A;  3VS7 A;  3VS0 A;  3I56 Q;  2VV5 A;  5LJ5 f;  3CC4 A;  3ULR B;  2DF6 A;  2A36 A;  1VQP Q;  1RUW A;  4J9C A;  1TUC A;  4QQD A;  2Y4Y A;  2PVO B;  1X6B A;  4N0A C;  3LX7 A;  2KXD A;  1VQ8 Q;  1IHW A;  4J5Y A;  5KCO A;  1M1K U;  2YXY A;  1KIK A;  1X75 C;  1M1F A;  3CCV A;  4OP0 A;  5CKB A;  1U5S A;  4Z89 A;  3QO3 A;  2VKN A;  3PVL A;  1QCO A;  5FWC A;  2VGN A;  4ORZ A;  2QAZ A;  5GAN h;  2COW A;  1TUD A;  5A0D A;  3KXT A;  1N9S A;  5J26 A;  4C8Q E;  4D8K A;  4IUT A;  3SDZ A;  4TVR A;  4Z02 A;  4KH0 B;  1CSK A;  2XKO C;  2RF0 A;  3QZ9 B;  1QKX A;  3HHT B;  1S72 T;  2AKL A;  4IUQ A;  2O9S A;  2RJC A;  1U3O A;  1VQO T;  1OYX A;  3LH5 A;  1RAF B;  3EFR A;  5L23 A;  2V8J A;  2A3L A;  2CKK A;  3H0H A;  4J7I A;  4KRT A;  4M78 D;  1YJW A;  2MWP A;  1NJI C;  2EYW A;  2Y90 A;  5GAM e;  4JLI A;  2FZC B;  1WZO A;  1YHQ Q;  1G3T A;  3AT1 B;  1KQS P;  3QJY A;  2QEX A;  2JS2 A;  2LCL A;  5KYU B;  5AT1 B;  3CCV Q;  3EAE A;  1AHJ B;  7AT1 B;  3A1P A;  2A0F B;  3V7C A;  3EGD A;  1B3Q A;  3MEU A;  5L8R E;  1UEB A;  2GTO A;  1UHC A;  4KGX B;  2FG0 A;  2DK3 A;  2Z0W A;  4E7S A;  1AWO A;  3OYD A;  1X69 A;  2FHD A;  1YNZ A;  3JCM V;  5EG2 A;  2DJZ A;  1SRM A;  5FLX E;  1GFD A;  1M1K R;  5LL6 S;  4QVD A;  2LQW A;  1Q95 G;  2DNU A;  3C95 A;  2RI5 A;  4ZTJ A;  1LCK A;  3OS1 A;  1WI7 A;  4BE2 A;  1S72 Q;  4JJC A;  5CVI A;  3H6Z A;  1Q81 R;  3A8M B;  5IXB A;  1V1C A;  3MEA A;  5KE2 A;  4R55 A;  2EKH A;  1Y0M A;  1VQ9 T;  4DBQ A;  4RTZ A;  5GAN 6;  1R0B G;  1Q86 U;  2EYY A;  4XTZ A;  1N9R A;  2OX7 A;  1ZA2 B;  2YRD A;  2RN8 A;  4RG2 A;  2ZZD A;  5LJ3 f;  2LJ0 A;  2CH4 W;  2WSF E;  4OGE A;  2RK2 A;  1TXQ A;  4E47 A;  1PRL C;  1RI0 A;  2MAM A;  2D0N A;  3L1A A;  1VQP T;  4PKC C;  4E7L A;  1XTD A;  1NJI U;  3CCE T;  2FPD A;  1EIF A;  4J6X A;  1KQS A;  4YTL A;  2FRW A;  5GMK i;  1VQ6 A;  3HFN A;  1VQ6 T;  5CCA A;  1MGQ A;  2LMJ A;  3CC4 T;  3QYG B;  1GL5 A;  4BI8 B;  1VYT A;  4PJO E;  3TU4 K;  3C94 A;  1LPL A;  3T9N A;  3CCU T;  5GMK m;  1QW1 A;  1WYX A;  1IRE B;  3JSC A;  2D8H A;  2MPX C;  1NPR A;  1PKT A;  1J3T A;  2DM1 A;  3WXM B;  3CCM Q;  1Q7Y U;  2DRK A;  1YI2 T;  1V76 A;  5KCH A;  1M4Z A;  2XK0 A;  4OMO A;  4JJN K;  5GAM j;  2LQ8 A;  2AKK A;  1KD1 C;  1W70 A;  4E7K A;  1QVF A;  1NYF A;  3EG9 A;  1MMG A;  1YN8 A;  4XU2 A;  4M78 G;  4LE9 A;  1JB0 E;  2DKG A;  3VV0 A;  3CCL T;  2BZY A;  1SRL A;  1U06 A;  4OF1 A;  1WQ7 A;  1PD1 A;  1EFN A;  3UT1 A;  2CP6 A;  4BI4 A;  2OAW A;  1TWB A;  2HQH A;  1I8F A;  4IKF A;  2DTI A;  2YRC A;  3CCJ A;  3OW2 A;  2L3R A;  2YT6 A;  3MPU B;  3RES A;  1B07 A;  4GLM A;  2F2W A;  2DO3 A;  4C92 D;  3CD6 Q;  4EMK B;  4ATO A;  5CKF A;  2C0T A;  4M78 F;  1WFW A;  3DB4 A;  4LXC A;  1H64 1;  1D1C A;  2AZV A;  1VA7 A;  2QI2 A;  1I5O B;  1VQ6 Q;  3TQ7 P;  1Q82 U;  4HXJ A;  2X4X A;  1UJ0 A;  3UA6 A;  4KGV B;  4AG1 C;  3R6N A;  2PVD B;  2M0O A;  1M3A A;  2LCC A;  4PNO A;  2KVQ G;  2DBK A;  3INZ A;  4LDW A;  4BD3 A;  2DL7 A;  4A4K A;  1G3Y A;  2KE9 A;  3P8H A;  2QA4 Q;  5LJ3 d;  3PGG A;  2FL7 A;  2COZ A;  5KE3 A;  2K3Y A;  4J9D A;  5GAN e;  1YCS B;  2F1L A;  4M78 B;  3G6E A;  1IGQ A;  3RBB B;  3EFS A;  1Q7Y C;  4HKE A;  1JRI A;  2W10 A;  2ZPF B;  1RLP C;  4IUU A;  5KYX A;  3G1J A;  1FWZ A;  1I0C A;  2D0Q B;  4C0F A;  1ABQ A;  3RKW A;  2QGF B;  4R56 A;  2JN0 A;  1UHF A;  5KYN A;  4LN2 A;  5IH2 A;  4X9D A;  3FLG A;  2O4X B;  3QWX X;  4EDU A;  4XU3 A;  2LJ1 A;  1D1A A;  1D0Y A;  1Z9Z A;  3O8V A;  1YWO A;  3GOX A;  2A28 A;  3QDR B;  4OB3 B;  2KRS A;  2EQI A;  3Q1J A;  3JCM Q;  4KUI A;  3CMA Q;  2MIO A;  3SFM A;  4M7A D;  1X2K A;  2EIF A;  3I5R A;  1AEY A;  1AT1 B;  1BI2 A;  2A37 A;  4WCI A;  3X25 B;  2CZ7 B;  1NZ9 A;  4MZT A;  4M75 D;  5IAY A;  2L89 A;  2RO0 A;  8ATC B;  1JO8 A;  2E64 A;  4JLG A;  4FU6 A;  2J7I A;  2NUT A;  1I4K 1;  2ED1 A;  2A7Y A;  1RI9 A;  1BKB A;  1KHC A;  3OBW A;  4E7H A;  3UF4 A;  5GAM f;  2HAX A;  1R8O B;  2QTX A;  3V8J A;  5D7U A;  2DTO A;  2JJ9 A;  1YI2 A;  5CK9 A;  2DYI A;  2LNV A;  3OQ5 A;  3PIP A;  1VQN T;  1I1J A;  3P8D A;  2XI9 A;  3JCM h;  2VB6 A;  2L8D A;  1ZUY A;  1XOV A;  2KYM A;  2RJE A;  2Y4X A;  5GAN 3;  4HT8 A;  5D6Y A;  1VOM A;  4PLI A;  3HRU A;  3JRZ A;  1UGR B;  3CCS Q;  4JS5 A;  2O2O A;  1N8R R;  1UB4 A;  5FW9 A;  1WA7 A;  1A0N B;  3EGX B;  3HPW A;  4M7D F;  1BCO A;  1GCQ A;  1NLO C;  4LDY A;  2K4Y A;  1NLP C;  3J7A F;  1AZE A;  4HVU A;  4FSX A;  1UUE A;  1GCQ C;  5D6W A;  1D0Z A;  5GAN g;  1VQ8 A;  3OYK A;  3JB9 G;  1AWW A;  1KFZ A;  2COY A;  1OQK A;  4BY6 C;  4ME7 A;  4C92 F;  3I56 T;  2FZG B;  4J9I A;  3SWN C;  1MNE A;  4F04 B;  4J6W A;  2CP2 A;  2E12 A;  3OW2 S;  1R77 A;  4C0G A;  3A8O B;  3H8Z A;  1K73 U;  1IRX A;  2CS7 A;  5I21 A;  4JRI A;  1WNL A;  2DJQ A;  3OYN A;  5FRM A;  2GFA A;  3FC3 A;  2KNB B;  5GAN 4;  4FL6 A;  4Q5W A;  4CC3 A;  4BAC A;  3PNW C;  2RB6 A;  5CAI A;  4J7F A;  2OTJ Q;  3VYG A;  3QG1 A;  4MZP A;  1TG0 A;  3A8L B;  2C0I A;  2CT3 A;  1PSE A;  2LCS A;  4HT9 A;  2XMF A;  5GAN 5;  2J6O A;  4C8Q B;  2OTJ T;  3G4S A;  2DTH A;  2OI3 A;  3CQT A;  5IT9 E;  3CC7 Q;  3CCL Q;  2WAC A;  2ZGW A;  3CME T;  4C92 A;  4RKU E;  2DXB A;  4J9B A;  3HFO A;  1X43 A;  2RHU A;  3QJ6 A;  2FEI A;  2YWW A;  1Q82 C;  3CC7 A;  3PT9 A;  2KRN A;  4BDY A;  1VQM A;  4LDX A;  2XIC A;  4KBM B;  1VQM T;  3UA7 A;  3UWN A;  3WVE B;  2QAS A;  1VQ9 A;  3M0U A;  1I81 A;  1UGV A;  2EQJ A;  3DLM A;  5FU6 C;  2GFU A;  2K9G A;  2X4W A;  5FWB A;  1UGQ B;  2CZ1 B;  1T0J A;  1K4U S;  3KUF A;  3SHW A;  2FYK A;  2KMT A;  2RI2 A;  2DVE A;  4M77 E;  4M7D C;  1F1B B;  1K8A U;  2FZK B;  1ZSZ A;  2OAU A;  3JCM b;  4PJL A;  1EZZ B;  4N0A A;  2DIG A;  1QMC A;  1QWF A;  1HSQ A;  3NPF A;  3H9N A;  4C5I A;  3EHR A;  4FW2 A;  3VU3 C;  2CZ0 B;  3MHX A;  5LJ5 h;  2PVG B;  4MDW A;  3HP9 A;  2FB7 A;  1NYG A;  1OV3 A;  1RAI B;  2FPF A;  2IG0 A;  3CC2 Q;  1NBE B;  5HK0 A;  4E7J A;  2JTM A;  1G2B A;  1M90 R;  3VKI A;  3NFC A;  1RAC B;  2K5I A;  4F7U F;  4IUP A;  1W2B P;  4C0D B;  1MMA A;  1PHT A;  4M7A B;  2ESW A;  1N6A A;  3JV3 A;  4XTW A;  1YBY A;  4ZTF A;  2I0N A;  4RTV A;  2LX9 A;  3I35 A;  1AVZ C;  1K9A A;  4ZGE B;  4ZNX A;  2L0A A;  1VQL Q;  4PFO A;  2DZ9 A;  2AZS A;  4FCY A;  2LTO A;  2DEQ A;  3QKJ A;  3JCM W;  3OYM A;  2LC4 A;  2KQW A;  1QVG A;  5KYX B;  1HYO A;  3QPH A;  4ESR A;  1Y57 A;  5CIU A;  2DZC A;  4VUB A;  4QKU A;  1RAA B;  1YIT Q;  3JCM J;  2J05 A;  1JU5 C;  2C06 A;  3G71 A;  4II1 A;  4M7D B;  1BIB A;  1WHM A;  4JRK A;  3RR6 A;  2R5A A;  4B9X A;  2HBW A;  4Y91 A;  1SG5 A;  2BTT A;  1MV3 A;  4OB2 B;  5KYU A;  1Q81 C;  3G6E T;  2DER A;  1DJ7 B;  1WPY A;  3BDL A;  5I22 A;  2QQS A;  4XQ3 A;  4A53 A;  4GY5 A;  1M2V A;  2JT4 A;  4BB7 A;  1MND A;  2QYZ A;  1Y96 B;  3FB9 A;  2HL5 C;  1UTI A;  3TCJ A;  2H3J A;  3TSW A;  2EKO A;  2PU9 B;  2M1H A;  1KJW A;  4X34 A;  4ZGJ B;  3THK A;  1H8K A;  1VQO Q;  1BI3 A;  3CME A;  1FYN A;  3L2Z A;  1JJ2 S;  3CME Q;  4M77 D;  1N8R U;  2EYZ A;  3CPW A;  3REA B;  1TU0 B;  3EFO B;  1MMN A;  1AD5 A;  4C5E A;  1IXD A;  3RKY A;  3BW1 A;  4C8Q C;  2FRY A;  2VWF A;  2IIM A;  2JTF A;  4A63 B;  2CZ6 B;  3JCM f;  4M75 E;  3L2W A;  1RAE B;  2LT1 A;  3BE3 A;  3CC2 T;  1PNJ A;  3S3N A;  1OOT A;  2CYZ B;  4PJO G;  1OPK A;  1AWJ A;  2EQK A;  2NWM A;  4OVA A;  1HD3 A;  2K2V A;  3CD6 T;  4M4Z A;  3X24 B;  1K73 R;  2F2V A;  2YUQ A;  5HKC A;  3G71 Q;  1UE9 A;  5GAO q;  2EVR A;  2ABL A;  4F7U G;  2ATC B;  5LJ3 e;  2RQR A;  3M0P A;  2DXU A;  1D1B A;  4HVV A;  2FVU A;  4OMM A;  1UFF A;  2X3X D;  2AK5 A;  1SEM A;  2QK0 A;  3GNG A;  2CP5 A;  1MUZ A;  5CO7 A;  2EYX A;  4M75 F;  5KYY A;  1KC8 C;  2MCN A;  1BCM A;  3VS1 A;  2EGE A;  2DD5 A;  2KDS A;  4M75 C;  2VYT A;  2ZPE B;  3CCS T;  3DB3 A;  1KD1 R;  2D1X A;  1RAG B;  1BB9 A;  4HCZ A;  3RUX A;  4LD9 K;  2EGA A;  2QDY B;  1TSF A;  3I55 A;  4N4G A;  4ELY C;  2XID A;  4JUV A;  5A2Q E;  1VYV A;  3FIF A;  4JRQ A;  1BYM A;  4F14 A;  4PL6 A;  1D0X A;  1NM7 A;  3OYJ A;  2F2X A;  3LLR A;  3V7S A;  5DLO A;  2E6Z A;  2QGG A;  5FU7 C;  4KUD K;  3AHU A;  2YLB A;  2EJF A;  3CCM A;  4FT2 A;  2XG8 D;  3L2Q A;  3QUI A;  4C8Q D;  1Q86 C;  2E5K A;  2WSE E;  2RA2 A;  4FYV B;  4E7Z A;  5GMK j;  1RAH B;  1ZLM A;  4AT1 B;  2BKD N;  2DLP A;  2EFI A;  2BUD A;  4PJO C;  2YUO A;  3X20 B;  3S6W A;  1E6G A;  1YHQ T;  1PCX A;  1VQ9 Q;  1N27 A;  2HSP A;  3ZEH A;  4RTU A;  3OYC A;  1OZ2 A;  1RLQ C;  4XU1 A;  2RK1 A;  5DM7 R;  2HMA A;  3OMG A;  3JAM E;  1X27 A;  2ED0 A;  1WX6 A;  2MI6 A;  2PZ1 A;  3J80 E;  1VQN A;  3VS6 A;  4BI3 A;  3DLL A;  4XAX B;  1Y7X A;  2E6N A;  1Q7Y R;  2QXF A;  4MDX A;  1TH7 A;  4XU0 A;  2QTV A;  3A98 A;  2RJF A;  3RMS A;  3CCL A;  3JB9 J;  2HQE A;  1XNI A;  4J83 A;  1MHN A;  3J81 E;  1QWE A;  2ECZ A;  1QVF P;  1OU9 A;  1NPP A;  3L2R A;  1BBZ A;  2JM9 A;  3OYH A;  2E70 A;  1W2B A;  3M58 A;  1CKA A;  1PD0 A;  5CKD A;  2CSQ A;  3OA6 A;  1ZSZ B;  2G3R A;  4JDS A;  3OS5 A;  2X51 A;  3P8B B;  3ZBD A;  3OYI A;  1IHV A;  4RCB A;  3PVQ A;  2DYB A;  4GLK A;  1TTH B;  4CC4 B;  1Q82 R;  2KGT A;  4GBQ A;  4X9C A;  4C8Q A;  3N5B B;  2GF7 A;  3SB2 A;  1ZBJ A;  3H0F A;  4UC4 A;  3E9G A;  5GMK e;  3GPL A;  3CCV T;  4KT0 E;  1AZG B;  3GNF B;  4RCC A;  2BZ8 A;  2E3I A;  2V26 A;  3NTK A;  3M53 A;  3NTH A;  3FJ5 A;  2DAQ A;  2JVV A;  3OB9 A;  4JZ3 A;  4AFZ C;  1D3B A;  4HCK A;  1QCF A;  3MCA B;  2KT1 A;  4C0D C;  3C12 A;  4PJO D;  4E2F B;  1WJR A;  1JQQ A;  3CCS A;  4EMG A;  2X4J A;  2XDP A;  1BI1 A;  1QQJ A;  4JRP A;  2LQK A;  2O4X A;  3JB9 F;  1FXX A;  2QDL A;  1U8R A;  2KY9 A;  3CPW S;  2ROL A;  2AHJ B;  1JJ2 A;  3CEY A;  5GAO l;  1M2V B;  1WJS A;  3C0C A;  4M7D G;  1YI2 Q;  1QKW A;  2D6F A;  3G71 T;  1JXM A;  4FT4 A;  5LJ5 g;  2QEX T;  2EJG A;  4C5H A;  1RAB B;  3MP1 A;  3EG2 A;  1CKB A;  1M90 C;  5LJ3 g;  2JZ2 A;  2K3X A;  3FDR A;  4ANJ A;  4DBF A;  1WLP B;  2QA4 T;  2OTL A;  1H3Z A;  4XTY A;  2XHC A;  3M0T A;  2HEQ A;  2QQB A;  1UGS B;  4C8Q F;  4AMC A;  2LT4 A;  4OMN A;  3A8H B;  1K76 A;  3CMA A;  4M7A A;  3PTA A;  3JB9 H;  2HL3 A;  2F69 A;  3PMT A;  4DA4 A;  3F70 A;  2K3B A;  2LJ3 A;  2P0K A;  3I9Q A;  2LQN A;  3NGP A;  4Z8A A;  4DOV A;  5CKH A;  1VQO A;  1QVG S;  4M77 C;  5FRN A;  2KR3 A;  3E1S A;  1Z9Q A;  4B6M A;  1FMK A;  1ZQ1 A;  1RL2 A;  2RH2 A;  1H92 A;  1PC0 A;  2A08 A;  4L5G A;  2B8A A;  1I07 A;  4NOY A;  2VC8 A;  1VQ4 A;  3CXC P;  1HK9 A;  4N4I A;  3UDC A;  2KT8 A;  3VRZ A;  3OYY A;  1OX9 A;  3EG0 A;  2X4Y A;  4Y92 A;  2K5L A;  2VAS A;  4Y28 E;  1TUG B;  1ZSZ C;  3BY7 A;  5GAN 8;  4RTX A;  2CT4 A;  5GAM h;  3EG3 A;  1GXI E;  4QW2 A;  2EPD A;  2CUB A;  2KBT A;  5CQX A;  1VQN Q;  5KYY B;  2M51 A;  4C0Z A;  3GP8 A;  1YIJ A;  3VS5 A;  3KBG A;  3MEW A;  1YIJ T;  1ZUK A;  3OYL A;  2JTE A;  3CMA T;  1QVF S;  1G8X A;  5GAN 2;  3O5Z A;  4M77 F;  4BY6 B;  2DXT A;  3QII A;  1Y96 A;  5FU7 B;  2QG9 B;  1SPK A;  2RHI A;  1V29 B;  2E41 A;  4O6J A;  1NE8 A;  1VQL A;  2XU8 A;  2DRM A;  1W6X A;  1VQL T;  1ACM B;  3GIB A;  1ZBX A;  1X01 A;  2CP3 A;  2E65 A;  1G5V A;  1TOV A;  3A5Z B;  3QHS A;  1JEG A;  3CD6 A;  2HBP A;  5GMK l;  3CCQ Q;  2MK5 A;  1BI0 A;  2RHZ A;  2V1Q A;  2R58 A;  1QP3 A;  3CCE Q;  4M75 B;  1VQK Q;  2W0Z A;  4PLL A;  1KK7 A;  2K57 A;  4FSS A;  4KUL A;  1WDX A;  5LJ3 h;  3M55 A;  4DQ2 A;  2YDL A;  3M59 A;  5C0M A;  4FYX B;  5CR2 A;  2SRC A;  4JJD A;  3FRN A;  4OGC A;  4MZM A;  2KEA A;  2BE9 B;  2DMO A;  4M7D D;  4V2S A;  4QQ6 A;  3OYG A;  2C0O A;  1E7O A;  2M0Y A;  2AT1 B;  2MWO A;  4AFS C;  1QP2 A;  4M77 G;  5A0G A;  1Y71 A;  1FX7 A;  2DX1 A;  3LGF A;  3TEE A;  2G6F X;  4R0K A;  1X6O A;  3CCQ T;  1GCP A;  2GBQ A;  4FYW B;  2IVW A;  1SF9 A;  5CKE A;  2LZ6 B;  2P0P A;  2FO0 A;  1Y07 A;  4A4E A;  3JCM P;  1MMD A;  4RUG A;  3VYH B;  3X26 B;  1M1G A;  1ARK A;  2LP5 A;  5FRO A;  3S3M A;  2H3E B;  1YP5 A;  3JCM X;  1HJD A;  2LRQ A;  2HKQ B;  4E6R A;  3OS2 A;  4MML A;  4M7D E;  2WSC E;  3M0R A;  1WHK A;  3TVT A;  1YIJ Q;  3ME9 A;  1LOJ A;  1SSH A;  3M4Y A;  2EW3 A;  3NMZ C;  5M9O A;  1C6V X;  1WXU A;  2BIV A;  2DD4 A;  1AOJ A;  1M30 A;  2E5Q A;  2X3W D;  1TS9 A;  3EG1 A;  2DA9 A;  4RG8 A;  3CBO A;  1PRM C;  4XK8 E;  3E2U A;  3G4S Q;  2LDM A;  5DY9 A;  1QVP A;  5GMK h;  3JB9 D;  4FYY B;  1ZX6 A;  3L42 A;  1VQ4 Q;  2BZX A;  1K8A C;  1G3W A;  1D09 B;  2I2L A;  3NHN A;  2OTJ A;  1IZ6 A;  2PTK A;  1LVK A;  1WXT A;  2PNI A;  2CGH A;  1VIE A;  4EMK A;  5GJW B;  1NEB A;  1K8A R;  2EAY A;  2VUB A;  1O9S A;  1S72 A;  1M90 U;  5HY6 A;  2CRE A;  1ZUU A;  2RI3 A;  4PK4 A;  5J39 A;  4XTV A;  1FMV A;  3OBY A;  2PQW A;  3RER A;  2VXF A;  3QWY A;  4OB1 B;  2F5T X;  4ZN3 A;  3EG9 B;  3CC7 T;  1VQ7 A;  1UJY A;  1GBR A;  3CXC S;  4QVZ A;  4IIO A;  2CP7 A;  3ER0 A;  1KQ1 A;  5DLQ E;  2EYQ A;  1YJN T;  4J6Y A;  3FEO A;  3SD4 A;  1M9S A;  2JOY A;  1JBM A;  3M0S A;  4A4H A;  3HTR A;  4CRI A;  1BK2 A;  1VYU A;  3M0Q A;  4JS4 A;  2R5M A;  1XQH A;  4IIM A;  2HD0 A;  2H8H A;  4PJO A;  4DBR A;  3V8K A;  5KH6 A;  2QEX Q;  4BDZ A;  1ABO A;  4LD6 A;  2CH4 A;  2KI7 A;  1YHQ A;  4JPB W;  3MO8 A;  4M78 C;  4A4G A;  1U1T A;  2EJ9 A;  5C6S A;  4C8Q G;  1YJW Q;  1VQ5 T;  4DEX A;  2V8K A;  5KYW A;  2YSQ A;  2HZY A;  1WQW A;  3REB B;  5IN1 A;  2D8J A;  1LJO A;  1PKS A;  2NUP A;  3JCM d;  1KC8 R;  4HCB A;  1VUB A;  2X9H A;  3QBY A;  2DBM A;  4NL3 A;  2DL5 A;  3C4S A;  5HCK A;  3VS2 A;  3QXE B;  2B86 A;  2EQM A;  4RMO A;  2L3P A;  3PE0 A;  1GFC A;  3IQL A;  1K9M R;  2ZAE A;  2KK4 A;  3M4G A;  1WXB A;  2XDB A;  3CCU Q;  3QYH B;  2KAF A;  1M2O A;  4PFP A;  1NG2 A;  1QCN A;  1VIF A;  2DPP B;  3LW5 E;  1VQP A;  2GNC A;  3CC4 Q;  2RJD A;  3M54 A;  2DL3 A;  4FM4 B;  2RNA A;  1QLY A;  4XTX A;  5GAN 7;  3I56 A;  3LGL A;  2GQV A;  1T0H A;  2MOX A;  1OZ3 A;  2E3H A;  3MKD A;  1SHG A;  2KYB A;  3PIO A;  2SEM A;  4J9G A;  3NTI A;  3CCR T;  1VQ7 Q;  5GAO m;  3OSV A;  4OMP A;  1PM3 A;  3X28 B;  4M75 A;  2MYS A;  2ZPG B;  3CBP A;  3OYF A;  2ROT A;  3BFM A;  3V7R A;  2ZPB B;  4NL2 A;  3E9F A;  1UEC A;  5GAN d;  2OTL T;  2VGM A;  2RHX A;  2DFU A;  1W4S A;  2NUT B;  1OUL A;  2M02 A;  1YWP A;  3MEV A;  2HQX A;  1YCY A;  1VQ5 A;  1SHF A;  2PUK B;  4JZ4 A;  1VQ8 T;  2XD0 A;  3VJP A;  1PSF A;  5D6X A;  4LDV A;  2GCX A;  5FU6 B;  3OY9 A;  3HRT A;  2O01 E;  3GF5 A;  1VQK T;  3EGD B;  3PMI A;  4PFZ A;  1KC8 U;  2ENM A;  1T3S A;  4BE0 A;  2DVJ A; 
#chains in the Genus database with same CATH homology
 4QT7 A;  3M0U A;  2DE0 X;  4Z88 A;  1UGV A;  2JS2 A;  3EG2 A;  1CKB A;  2K9G A;  2CSI A;  2JS0 A;  5FWB A;  1B3Q A;  1T0J A;  1K4U S;  1WLP B;  3SHW A;  2LX7 A;  4CC7 A;  2GTO A;  1UHC A;  2FG0 A;  5IHK A;  3M0T A;  2HEQ A;  1AWO A;  4OMN A;  1X2Q A;  1X69 A;  1K76 A;  3I5S A;  1YNZ A;  1UG1 A;  1QWF A;  1K0X A;  1SRM A;  1GFD A;  2K3B A;  1HSQ A;  3NPF A;  2LJ3 A;  3I9Q A;  2LQN A;  3EHR A;  2LQW A;  3NGP A;  4Z8A A;  1UDL A;  2DNU A;  3GBQ A;  2CDT A;  2KR3 A;  2RQT A;  1LCK A;  1Z9Q A;  1FMK A;  3KFV A;  1WI7 A;  1H92 A;  1NYG A;  1OV3 A;  2A08 A;  2FPF A;  4JJC A;  1OEB A;  2GTJ A;  4D8D A;  1G2B A;  1I07 A;  1BU1 A;  4RTY A;  2NUZ A;  1K1Z A;  1W1F A;  1PHT A;  5IXB A;  2KT8 A;  1V1C A;  3VRZ A;  2EKH A;  4AG2 C;  1Y0M A;  3EG0 A;  2O88 A;  4Y92 A;  2ESW A;  4RTZ A;  3VS3 A;  3JV3 A;  2I0N A;  2EYY A;  4RTV A;  2JM8 A;  3I35 A;  2YUP A;  1AVZ C;  1K9A A;  4RTX A;  2RN8 A;  2L0A A;  4ZNX A;  2CT4 A;  2LJ0 A;  3EG3 A;  4RTW A;  3EGU A;  2CH4 W;  1OPL A;  2AZS A;  2EPD A;  2CUB A;  2KBT A;  2M51 A;  1PRL C;  2D0N A;  1KSW A;  2K79 A;  3VS5 A;  1ZUK A;  2FPD A;  2JTE A;  4ESR A;  1Y57 A;  2FRW A;  3O5Z A;  5I11 A;  5IHN A;  2J05 A;  1JU5 C;  3U23 A;  1SPK A;  2LMJ A;  3H41 A;  1GL5 A;  2HBW A;  3EHQ A;  4OMQ A;  1VYT A;  2DRM A;  4F17 A;  1W6X A;  2BTT A;  1MV3 A;  1WYX A;  5I22 A;  2D8H A;  1JEG A;  4J9E A;  1PKT A;  4JJB A;  2V1Q A;  2JT4 A;  1J3T A;  2DM1 A;  2DRK A;  1UTI A;  3TSW A;  1KJW A;  2W0Z A;  2GQI A;  4OMO A;  4FSS A;  1WDX A;  1K0S A;  2YDL A;  3THK A;  1H8K A;  2AKK A;  4LUD A;  1W70 A;  2SRC A;  4X1V A;  4JJD A;  1NYF A;  1YN8 A;  2KEA A;  4LE9 A;  1FYN A;  2DMO A;  2K2M A;  2EYZ A;  3REA B;  2HCK A;  2C0O A;  1E7O A;  1GBQ A;  1SRL A;  1U06 A;  1AD5 A;  2BZY A;  2M0Y A;  2KRO A;  2DIL A;  4AFS C;  4K11 A;  1EFN A;  2FRY A;  2VWF A;  2IIM A;  2OAW A;  2P4R A;  4A63 B;  2DX1 A;  1ZSG A;  2G6F X;  4R0K A;  2JXB A;  1GCP A;  2GBQ A;  1MV0 B;  2DL4 A;  3UAT A;  2YT6 A;  2RQU A;  1B07 A;  4GLM A;  2F2W A;  4J9F A;  1PNJ A;  1OOT A;  2JMC A;  2C0T A;  2LZ6 B;  1NEG A;  2FO0 A;  1OPK A;  2J06 A;  1AWJ A;  2O9V A;  2V1R A;  1WFW A;  3ZL7 C;  4RUG A;  2L3S A;  2NWM A;  3SEM A;  1ARK A;  1JXO A;  2LP5 A;  2AZV A;  1HD3 A;  1VA7 A;  2J6F A;  1YP5 A;  1HJD A;  1WIE A;  4M4Z A;  2EBP A;  1M27 C;  2JW4 A;  4HXJ A;  2F2V A;  2YUQ A;  4E6R A;  1UE9 A;  1UJ0 A;  3M0R A;  1IO6 A;  3UA6 A;  3TVT A;  2EVR A;  4AG1 C;  2ABL A;  3R6N A;  1PWT A;  1M3A A;  1SSH A;  2DBK A;  2RQV A;  2EW3 A;  2RQR A;  2DL7 A;  3NMZ C;  2YUN A;  2L2P A;  2KE9 A;  2GGR A;  3M0P A;  4LUE A;  1WXU A;  1AOJ A;  1M30 A;  1T3L A;  4HVV A;  4OMM A;  4J9D A;  4J9H A;  1UFF A;  2X3X D;  2X3W D;  2AK5 A;  3EG1 A;  2DA9 A;  1SEM A;  1PRM C;  1YCS B;  1MUZ A;  3RBB B;  2EYX A;  1ZX6 A;  2MCN A;  2BZX A;  3VS1 A;  2W10 A;  1RLP C;  2EGE A;  3NHN A;  3VS4 A;  2PTK A;  1WXT A;  2PNI A;  1I0C A;  5GJW B;  1NEB A;  1ABQ A;  2D1X A;  1BB9 A;  2KRM A;  1UHF A;  2CRE A;  2EGA A;  1ZUU A;  4LN2 A;  5IH2 A;  5ECA A;  4AFU C;  1N5Z A;  3QWY A;  2J6K A;  3QWX X;  2LJ1 A;  1VYV A;  1M3B A;  1UJY A;  1GBR A;  4F14 A;  1Z9Z A;  1YWO A;  4DEY A;  4IIO A;  1NM7 A;  4LNP A;  2F2X A;  2A28 A;  1E6H A;  2KRS A;  2EQI A;  5IXF A;  2MIO A;  3H0I A;  2K6D A;  2LNH B;  3M0S A;  2L3Q A;  1X2K A;  3I5R A;  3VRY A;  1AEY A;  1BK2 A;  2A37 A;  1VYU A;  4WCI A;  2JMA A;  3M0Q A;  2E5K A;  4CC2 A;  4IIM A;  1ZLM A;  2H8H A;  2DLP A;  2K7A A;  2YUO A;  1JO8 A;  5GJV B;  2J7I A;  2ED1 A;  4F16 A;  1AWX A;  1RI9 A;  1ABO A;  1E6G A;  3UF4 A;  2CH4 A;  2VVK A;  2HSP A;  4JPB W;  4RTU A;  1RLQ C;  2EGC A;  3TSZ A;  4DEX A;  1M3C A;  1M8M A;  1X27 A;  1I1J A;  2ED0 A;  1WX6 A;  2YSQ A;  2PZ1 A;  2DL8 A;  3REB B;  1S1N A;  2D8J A;  3VS6 A;  1PKS A;  1ZUY A;  1XOV A;  2OJ2 A;  2KYM A;  2HDA A;  2DBM A;  2DL5 A;  3A98 A;  5HCK A;  3VS2 A;  4EIK A;  2B86 A;  2L3P A;  3PE0 A;  1GFC A;  3IQL A;  1GRI A;  2O2O A;  5FW9 A;  2RQW A;  1QWE A;  1WA7 A;  2ECZ A;  1A0N B;  5IHI A;  1GCQ A;  2RMO A;  1NLO C;  5EC7 A;  1H3H A;  3RNJ A;  1WXB A;  1BBZ A;  1NLP C;  2JM9 A;  1AZE A;  4HVU A;  1UUE A;  1GCQ C;  1NG2 A;  4RTT A;  1CKA A;  1G83 A;  2CSQ A;  2GNC A;  1X6G A;  1AWW A;  4AFQ C;  2DL3 A;  2CUD A;  2KXC A;  1KFZ A;  2RNA A;  1QLY A;  4OML A;  2FPE A;  2O31 A;  4HVW A;  1T0H A;  2RPN A;  2MOX A;  4J9I A;  3VS7 A;  3VS0 A;  3ULR B;  2DF6 A;  3PVQ A;  1SHG A;  2A36 A;  2KYB A;  2SEM A;  1RUW A;  4J9G A;  2DYB A;  4CC4 B;  2KGT A;  4GBQ A;  4OMP A;  2DJQ A;  4J9C A;  1TUC A;  1X6B A;  2KXD A;  1ZBJ A;  2ROT A;  3H0F A;  2KNB B;  1UEC A;  1KIK A;  4CC3 A;  1AZG B;  2BZ8 A;  4Z89 A;  1U5S A;  3FJ5 A;  2VKN A;  3PVL A;  5FWC A;  4ORZ A;  1TG0 A;  4JZ3 A;  4AFZ C;  2C0I A;  2CT3 A;  1TUD A;  4HCK A;  1QCF A;  2LCS A;  2KT1 A;  2XMF A;  1YWP A;  1JQQ A;  2J6O A;  4D8K A;  1CSK A;  2OI3 A;  3CQT A;  2RF0 A;  1QKX A;  1SHF A;  2AKL A;  2O9S A;  4JZ4 A;  4J9B A;  1X43 A;  2QDL A;  1U3O A;  2ROL A;  3LH5 A;  5L23 A;  2FEI A;  3H0H A;  3C0C A;  2KRN A;  4KRT A;  1QKW A;  3UA7 A;  2EYW A;  2ENM A;  1T3S A;  1JXM A;  2DVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...