1SHGA

Crystal structure of a src-homology 3 (sh3) domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-SPECTRIN SH3 DOMAIN
publication title Crystal structure of a Src-homology 3 (SH3) domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cytoskeleton
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1993-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1shgA00
1LCKA 2K2MA 4M4ZA 2O2OA 2EGEA 2GBQA 2GTJA 2B86A 4AFUC 2O88A 1V1CA 1QWEA 4DEYA 1WIEA 1W6XA 1AZGB 1ZSGA 2CSQA 1WI7A 4CC3A 2RF0A 2SRCA 4AG2C 2AZVA 1E6HA 2DL7A 4D8KA 1HD3A 2CSIA 1PKSA 2MOXA 3TSWA 1OPLA 1UJYA 3UATA 1GCQC 2ROTA 2J05A 2HSPA 4ESRA 4Z88A 1H8KA 2D1XA 4AG1C 2BZXA 4OMMA 3M0SA 2LX7A 1AZEA 1AWWA 2DL5A 5I11A 1AWOA 4OMLA 1IO6A 1OPKA 2KROA 4J9HA 1RUWA 3M0RA 4LUDA 3THKA 2KT8A 1M30A 2C0IA 2CUBA 4CC7A 3UF4A 2LNHB 1SSHA 4LE9A 2RQVA 1K4US 1KFZA 4JPBW 2LJ1A 2W0ZA 2GNCA 2PNIA 4OMNA 1X2KA 2JM8A 3M0PA 3H0FA 1K76A 2RQWA 1X6BA 1X6GA 1QLYA 2DILA 2FPDA 5GJWB 1JXOA 4EIKA 2K6DA 4RTWA 4OMOA 2DL3A 2YUQA 2FRYA 3VS5A 1T3LA 4JJBA 2FPFA 2ROLA 1T0HA 1ZUKA 2BZYA 1JO8A 2DRKA 1ARKA 1ZUUA 2EGAA 2KRSA 1AOJA 1WLPB 1VYUA 3PVQA 1K0XA 2C0TA 1SHGA 2AKKA 1UE9A 1T0JA 2KXDA 2M0YA 1VYVA 4Y92A 1JXMA 2VVKA 1KIKA 4JZ4A 1GL5A 2LQNA 2LCSA 3UA7A 3H41A 4LNPA 4ORZA 2FPEA 2L3QA 1UG1A 1GFCA 1NG2A 2HCKA 1CKAA 2KNBB 4Z89A 1W1FA 2I0NA 2EKHA 5FW9A 1B07A 4LUEA 2H8HA 1UFFA 3TVTA 1YWPA 4HVUA 1ZUYA 1UHCA 3EG3A 5I22A 2RQUA 2HDAA 1K0SA 2DNUA 5EC7A 2LJ3A 1UECA 2V1RA 2EBPA 2DL4A 1VYTA 3RNJA 2DVJA 3M0QA 2J7IA 1N5ZA 3REBB 1HJDA 1NYGA 4GLMA 3SEMA 2BZ8A 3EG0A 3EGUA 4RTZA 1XOVA 1UTIA 1PWTA 1M3CA 2PTKA 1VA7A 1U06A 3PE0A 1G83A 4JZ3A 1OEBA 2GQIA 5GJVB 5IXBA 3NPFA 2V1QA 1Z9QA 4F14A 3EG2A 1AD5A 4X1VA 2F2WA 2DLPA 2YSQA 2X3WD 1Y57A 1EFNA 2DMOA 4HCKA 4R0KA 1AEYA 2JXBA 2LJ0A 4F16A 1NM7A 2ENMA 3I5RA 2EYZA 1ZBJA 2JMCA 4FSSA 1KJWA 2FRWA 3NMZC 4AFZC 1WXBA 2OI3A 1I0CA 1ABQA 1WA7A 2K79A 2E5KA 5IH2A 1Z9ZA 2NUZA 1OV3A 3VS3A 4IIOA 2X3XD 2JM9A 3VS2A 4HVVA 1B3QA 1BBZA 1G2BA 2DBMA 3LH5A 2CH4W 2CUDA 2DA9A 4F17A 2MIOA 1NEGA 1M3BA 1GBQA 2ED1A 1SRLA 4HVWA 3SHWA 5IXFA 1YWOA 2DX1A 2JT4A 3TSZA 2RN8A 1Y0MA 3VS4A 2OJ2A 2EGCA 1FYNA 3GBQA 3EG1A 2EYWA 1H92A 2HEQA 1JQQA 2J6KA 1M8MA 5HCKA 2JMAA 2KGTA 2LMJA 1MV3A 2ECZA 1MUZA 3VRYA 4D8DA 2FO0A 2KYBA 1I1JA 1X69A 1UHFA 2K7AA 1RLQC 2JS0A 2QDLA 3M0UA 1U5SA 1GBRA 1PHTA 4J9EA 3VS0A 2CDTA 1CSKA 1YCSB 1OOTA 1UUEA 3I9QA 4J9DA 2FEIA 1JEGA 1BK2A 3QWYA 3ULRB 2EYXA 3VRZA 2F2VA 3UA6A 1TUCA 2GTOA 2L3SA 1WX6A 1UGVA 2L0AA 2K3BA 2DL8A 2O9VA 4K11A 2M51A 3NGPA 2P4RA 1YN8A 2RPNA 3M0TA 1S1NA 5IHNA 1NLOC 2F2XA 2SEMA 2DYBA 2CH4A 2ABLA 1SRMA 4IIMA 1CKBA 2CT4A 1QWFA 1NEBA 4JJCA 1UJ0A 2KR3A 4RUGA 2DF6A 1BB9A 1SEMA 2EW3A 5IHIA 3REAB 1H3HA 1W70A 2AZSA 2AK5A 1YNZA 2DM1A 1TUDA 1BU1A 2KRMA 4AFSC 1M27C 1E6GA 2D0NA 4Z8AA 4OMQA 1A0NB 2RNAA 2LZ6B 2MCNA 3I5SA 2YUPA 4DEXA 2JTEA 2KT1A 1ZLMA 1E7OA 2J6FA 1WXTA 4AFQC 2YUOA 3JV3A 1GCPA 2JS2A 1X43A 4RTXA 1YP5A 1SPKA 3QWXX 2HBWA 1JU5C 1PRLC 1RLPC 5FWCA 2GGRA 1SHFA 2G6FX 3FJ5A 1T3SA 4JJDA 1WXUA 1UDLA 1X2QA 1PNJA 4RTVA 1NLPC 4ZNXA 1TG0A 4A63B 2J6OA 4J9BA 2AKLA 4J9IA 1K1ZA 4CC4B 3KFVA 2KRNA 2D8JA 2PZ1A 1U3OA 1QCFA 2KE9A 1WFWA 2CREA 2LQWA 3IQLA 1K9AA 2L3PA 1I07A 2KBTA 2EPDA 2EVRA 4RTUA 4CC2A 4LN2A 4QT7A 3VS1A 1WDXA 3C0CA 3VS7A 1AWXA 2A28A 1ABOA 1ZX6A 4E6RA 1QKWA 2D8HA 1MV0B 2L2PA 2A08A 2K9GA 3NHNA 2RQRA 2LP5A 1GRIA 2DRMA 3EHQA 2VKNA 3U23A 2KYMA 4KRTA 1J3TA 4OMPA 3O5ZA 2ED0A 2O9SA 2J06A 3H0HA 2IIMA 2A37A 2CT3A 2O31A 4J9CA 2DBKA 2BTTA 2FG0A 1QKXA 2JW4A 3H0IA 3CQTA 1PRMC 1GFDA 2A36A 1WYXA 2KXCA 5L23A 1FMKA 2EQIA 2DJQA 1KSWA 5FWBA 2OAWA 3R6NA 3VS6A 1GCQA 2YT6A 2YUNA 4RTYA 4J9GA 5IHKA 1NYFA 2W10A 2DE0X 1X27A 2RMOA 2NWMA 2RQTA 2ESWA 2VWFA 3PVLA 3ZL7C 3I35A 2EYYA 2YDLA 2KEAA 4HXJA 3RBBB 2XMFA 2C0OA 4J9FA 1RI9A 4RTTA 1AWJA 1M3AA 3EHRA 5ECAA 1AVZC 3A98A 1PKTA 4GBQA 4WCIA 1HSQA
chains in the Genus database with same CATH superfamily
4OB1B 4PJNA 2O2OA 3EGDA 3X28B 4E7SA 3UPUA 3PGGA 1RAIB 3I55Q 2E4HA 3PFSA 3X20B 4CI0C 1AZGB 2MK5A 2CSQA 3Q1JA 1WI7A 3M5AA 5GANd 4LDXA 4D8KA 4LDVA 1HD3A 2CSIA 4MDWA 1PKSA 5A2QE 3G4ST 1G3WA 3UATA 4C92B 3DB4A 1MMGA 1GCQC 2QA4A 1QVGA 1IZ6A 4ESRA 2DXTA 3HTRA 5CKDA 1VQ6T 1MHNA 3CCJT 2D1XA 4KGVB 1K9MU 2E3HA 2LX7A 3C95A 5I11A 4OMLA 2ZPHB 4X34A 4PJOE 2KROA 4J9HA 2EJGA 4QQDA 1UB4A 2KT8A 3LYIA 3SWNC 2CUBA 1I8FA 3UF4A 2LNHB 1SSHA 2RQVA 5A0GA 2E10A 2GNCA 5LJ5j 3V7SA 2O4XA 3JB9J 2VUBA 1YJ9A 5I2MA 1XTDA 2P84A 4A4FA 1RABB 3CCQQ 3S3MA 5FU7B 2KVQG 2RHXA 2DILA 5GJWB 1D3BA 5LJ5h 1VQMT 2YUQA 2XKOC 3SD4A 3QDFA 8AT1B 4XQ3A 1KQ2A 1IGUA 2VGNA 4BI8B 3JCMc 2XHCA 5CO7A 4KH0B 1WLPB 2E6ZA 5DY9A 3EAEA 4BI4A 3SB2A 5HY6A 1VQ9Q 1Q86R 2KXDA 3CC2A 1VYVA 3P8HA 4Y92A 1JXMA 4M77F 1OX8A 3BDUA 4A53A 3CPWS 2NUPA 2F1LA 4JZ4A 4M77A 3S6WA 1NZ9A 3RERA 4XU0A 4LNPA 3EFOA 1TWBA 1CKAA 2RD1A 2X4JA 1B07A 1Y96A 2LVMA 4LUEA 3CCST 4M7DE 3OYNA 2LDMA 1OZ3A 3RKWA 1ZUYA 2DXBA 4C5IA 5CKEA 1UECA 2V1RA 2DL4A 4N0AA 1VYTA 3VKIA 2CP7A 3V8LA 1UEBA 2DETA 3J7AF 2RA2A 2HZYA 3MCAB 2NUTA 4LDWA 3EGUA 5C0MA 1PWTA 5GAMj 4RG8A 1M3CA 4XTXA 2PTKA 2JTMA 1VQ7A 3PE0A 4JZ3A 3JCMe 2GQIA 4LDYA 3BW1A 5GAMh 3FB9A 1Q95G 3GNGA 4OGEA 2OTLQ 2F2WA 1W2BS 1Y57A 1EFNA 2DMOA 3N5BB 5CKFA 4F16A 4C92G 4C92C 5KE3A 1H3ZA 1ZBJA 2FRWA 1Q7YC 3BFMA 3NMZC 2HKNA 1X75C 3LW5E 1LVKA 2E5KA 1Z9ZA 2NUZA 2P4TA 1OV3A 1YJWT 1KD1U 5KYXB 4IIOA 2X3XD 1PD1A 4ME7A 3CPFA 4HVVA 5GANj 1BIAA 1WQWA 1G2BA 3CC7A 4OB2B 4JDSA 4PJJA 3RKXA 4A4GA 2MIOA 3CPWP 1GBQA 2ED1A 3RUXA 3SHWA 2P0KA 5IXFA 4ZTJA 1M90C 4C5EA 5GANh 2QA4Q 2MF2A 5KH6A 1TTHB 3GBQA 4MZPA 1YITT 2EYWA 1JQQA 2J6KA 3OS1A 3A8OB 3FRNA 4BE1A 2ZPGB 2JMAA 2LMJA 5FU7C 3VRYA 3EG9A 4FSXA 1X69A 5CKHA 2WSCE 2JS0A 3JB9F 3OB9A 1GBRA 2E65A 4J9EA 3VS0A 1VQKA 1VQNA 1YCSB 2HAXA 3INZA 1JEGA 4KH1B 4FU6A 2R58A 1YJ9Q 1TUGB 2O9VA 3L2VA 5KYYB 1QP2A 1YN8A 4MZMA 4PJOF 3OYKA 1VQ4A 3LX7A 1EZZB 1S1NA 1W2BP 2K5FA 1RAFB 2SEMA 2RJFA 2QEXA 3OYGA 1B7TA 4C8QD 3HFNA 1KQSA 2MPXC 4PFOA 4OMFB 1WHMA 2KR3A 1Q7YU 3OQ5A 2EFIA 2AK5A 3CMAA 3M4GA 2KSSA 2KRMA 4JLGA 4AFSC 3CC2Q 4BD3A 2OTJT 4OMQA 2RJDA 3V7CA 1VQPA 9ATCB 5GMKi 1VQ8T 3QIIA 4FL6A 1WJRA 1ZLMA 2ZZDA 3HHTB 4C5HA 1M90U 2BE7D 2K5IA 3OYCA 2VXFA 2YUOA 4BACA 1Q86C 1KC8U 2HSEB 1YP5A 2O01E 3QSUA 2K3XA 1RLPC 2G6FX 3META 1VQOA 1KQSS 1Q81R 2CGHA 2RI5A 1UGSB 1WXUA 4JJDA 3X25B 4J5YA 2CP5A 4RTVA 5FLXE 3G71A 3JCMf 5GAN6 3MJXA 5AYFA 4E7KA 1WQ7A 4J9IA 4XTYA 3CCEA 4HCCA 4CC4B 2LNVA 5IAYA 2IVWA 1U3OA 1VQ7Q 2CREA 1BCMA 5GAOn 4IUQA 4QT7A 3C0CA 4M78B 3GF5A 1ABOA 4E6RA 1M2VA 3JCMg 2LX9A 3NHNA 1M8VA 2HBPA 1GRIA 3V8JA 3HPWA 4R56A 2VKNA 1Y71A 2PQWA 2RI3A 3M9QA 3OS2A 2PVGB 2LQ8A 1G5VA 2ED0A 4MMLA 4C0FA 1WNLA 2O31A 4J9CA 4QQGA 1QKXA 3CC7Q 3OYLA 3ZFJA 1C0MA 4M75B 1KQ1A 3CPWA 2A36A 2ZPIB 2VYTA 3LGLA 4OP0A 2VV5A 1M2OA 5GAN8 3I56A 1K8AR 2DJQA 3R6NA 4XU1A 2VGMA 3QZ5B 4L59A 2YUNA 2WSEE 2GFAA 1R0CB 3PIOA 4J9GA 1Q86U 3VV0A 1D0ZA 4N4GA 4IURA 2DE0X 2NWMA 3TEEA 3VYHB 1VOMA 1F1BB 2VWFA 4Z02A 2EYYA 2DTIA 4C92A 5J3BA 1VQKQ 1VQNQ 4DBRA 4GBQA 3QBYA 2JVVA 2AHJB 4EMGA 3CCRT 4C8QE 1LNXA 2DAQA 4TVRA 5GMKl 1V1CA 1R0BG 3JB9I 3OBWA 1M1KR 4B6MA 3CCJA 1VQ4Q 2AZVA 1E6HA 5J26A 2DL7A 1W2BA 3MO8A 4HCBA 4PKCC 3FIFA 4PJOB 5D6WA 2QEXQ 4HA8A 1C1AA 2QGGA 4Z88A 1YBYA 5LL6S 1H8KA 4AG1C 2VC8A 2A7YA 5GAN2 3DKMA 4WTOB 3CMAQ 2FYKA 4O5VA 1VQ5T 1O75A 1OPKA 2QQRA 1M30A 1HXDA 2QK0A 4DQ2A 2C0IA 1VQPQ 1WJSA 2PVOB 1VQMA 3NTIA 1K4US 2LC4A 4EMKA 2VXEA 2LJ1A 3ME9A 2XIDA 1X2KA 4F04B 2EYQA 3QYHB 3P8DA 1YI2T 1K76A 1XNIA 2KDSA 1X6BA 2F5KA 2E6NA 2MAMA 1X6GA 1ZQ1A 4IUPA 2K57A 4X9DA 1VQOQ 1WJQA 5FRMA 1JXOA 2K6DA 4JJNK 4M78C 1I5LA 1W4SA 3G71Q 3E1SA 2DTHA 1BI2A 1IRXA 4JJBA 2FPFA 1C6VX 2EQMA 3CCEQ 2ROLA 1T0HA 3UWNA 2HL5C 3G6EQ 2DIGA 3VUZA 3QKJA 2EGAA 3TU4K 1AOJA 3RMQA 3QG1A 1H641 3KUFA 1Q81C 3PVQA 1SHGA 3L2QA 2AKKA 3JCMP 4C0DB 2NLUA 1EIFA 2QG9B 3CCSA 3EH1A 2M0YA 4M7DB 4IUVA 2VVKA 3C12A 1KIKA 4M75G 4M75C 5KYUA 2COYA 2RHUA 1U1TA 2L3QA 2MWOA 2FZGB 2HCKA 2KNBB 4Z89A 3LWIA 1FWZA 2H8HA 1D1BA 1UFFA 1YWPA 4HVUA 2CS7A 5I22A 2RQUA 1M1FA 5GAOm 2Y4YA 4QVDA 2DNUA 4NL2A 2V26A 5EC7A 2I2LA 1IB8A 2EBPA 2PUKB 2DEQA 3PTAA 3CCMT 3CC4Q 2J7IA 3REBB 1NYGA 3SEMA 2BZ8A 4RTZA 3A8MB 3TCJA 4PFPA 3OYAA 3I56Q 3CCLQ 5GAOp 1M90R 2JNGA 5GJVB 4Y91A 3NPFA 4IUTA 2V1QA 4M7AB 5LJ5e 4F14A 2YHTA 3UT1A 1Q82R 1YIJT 3AT1B 4QKUA 3VUBA 4C92D 2VASA 4ZGEB 5GAN7 1K8AC 4PJOC 3I5RA 2ENMA 3H9NA 2EYZA 2JMCA 3DB3A 4FSSA 3OW2S 5CVIA 3G4SQ 4A4KA 1WXBA 2QQ9A 1B34A 2OI3A 3JCMX 4EPCA 1RAEB 3OYJA 4XTZA 1Q81U 4LXCA 3FEOA 4F7UB 2JM9A 3CCJQ 2MYSA 4YTLA 2DBMA 1OULA 4KUDK 5HK3A 3LH5A 5AT1B 3CCQT 2CH4W 2CUDA 3WVEB 1SRLA 3JCMb 1RACB 1VIEA 2DZ9A 3CBPA 4J6XA 1YWOA 2DX1A 3PMIA 3TSZA 2FVUA 1PSFA 1EX4A 1M1KC 1FYNA 2CZ7B 1PM3A 4C8QF 3EG1A 3A8GB 3UDCA 5CK9A 4C8QA 5HCKA 4PFZA 1MV3A 1MUZA 2K7AA 1RLQC 1M1GA 1U5SA 2DXUA 1WHKA 2EWNA 1CSKA 1ACMB 1MMNA 1VQMQ 3JCMV 1BK2A 3VRZA 2F2VA 2K4YA 3KBGA 3OMGA 2GTOA 2JN0A 3PT9A 1WX6A 5D6XA 4KUIA 1YFNA 2L0AA 2QGFB 5GAMe 2P4RA 3ER0A 4C0DC 1HYOA 2DYIA 2RPNA 4M7DG 4M7DC 2BE9B 1MNEA 1OX9A 1ZSZB 3M59A 5IHNA 4KGZB 1OI1A 3EFSA 3MHXA 3MP6A 2OTJA 5A0DA 3TQ7P 3FDRA 2ABLA 3QZ9B 3FC3A 3ASKA 4II1A 1KHIA 3JSCA 4RCCA 1VQ8A 1PCXA 4PNOA 3OW2P 3GLXA 1BB9A 1WPYA 2EW3A 1H3HA 1IHWA 2HQXA 1W70A 5CQYA 1BU1A 1P92A 3CCSQ 1V76A 2QASA 2ZAEA 3RMSA 2YXYA 3QHSA 3MEAA 2G3RA 2R5MA 2YUPA 5GANe 1SSFA 4J6WA 2WSFE 4FYWB 3S3OA 1NJIR 3JV3A 1GCPA 3D7SB 1YHQT 4NOYA 1X43A 2KI7A 1M1KU 3QWXX 4GY5A 2GGRA 3HRTA 4M7AG 1SG5A 5A0LA 4M7AC 1PNJA 1NLPC 1OU8A 4A63B 3EGDB 2J6OA 2AKLA 1ZA2B 2FZCB 5LJ5f 4E7IA 1K1ZA 4C92E 2KRNA 2ZPEB 2PZ1A 2KE9A 1WFWA 2LQWA 1YJNT 1K9AA 2QQBA 2KBTA 3L42A 4CC2A 3VU3C 3MEUA 3VS1A 4F7UG 2A28A 1ZX6A 4E7HA 2D8HA 1MV0B 2H3JA 2L2PA 1YJWQ 5LJ3d 3JAME 2K9GA 2XDDA 2HQEA 2LP5A 3PNWC 3MEVA 5LJ5g 2DRMA 1UGRB 3P8BB 4ZTFA 4KRTA 2DZCA 1J3TA 4E7ZA 3M55A 3GNFB 3EGXA 4FYXB 3KXTA 1RAGB 2J06A 3CMET 4N4HA 1Q82C 5CIUA 1QCOA 1QW1A 3BE3A 3H8ZA 3V8KA 2JW4A 2L89A 4J83A 2O4XB 1M5Q1 2QQAA 2PU9B 3TREA 2E12A 2F69A 1M9SA 2CP3A 1GCQA 4VUBA 2XD0A 2RMOA 2P0QA 1TH7A 2ESWA 3CCRA 3I35A 2YDLA 5I2SA 5GAOl 3RBBB 2XMFA 4J9FA 2PUOB 1ZSZC 3OMCA 4RTTA 3CC2T 3LH0A 4A4HA 4JRIA 5GAMf 3MKDA 4WCIA 3SWNA 2K2MA 4BDZA 2M02A 2EGEA 2GBQA 2GTJA 2QXFA 2B86A 4AFUC 1OYXA 2NUPB 4AT1B 4M77B 4DEYA 4BE2A 1W6XA 4CC3A 2RF0A 2SRCA 1OPLA 1VQLT 5GAMg 2DVEA 1G3TA 4EMHA 2OTJQ 2HSPA 3HSBA 3OW2A 1OQKA 2DKGA 1VQ8Q 5FU6B 3JCMQ 3M0SA 2P0PA 3RIRA 5GANf 2CP6A 1AWWA 2L8DA 3G6EA 1Q82U 4PLLA 5KYWA 2NUTB 3M0RA 1YI2A 5GAOr 3THKA 4LDUA 2CZ0B 2WACA 5GAN4 4RG2A 3M4YA 2A3LA 2V8JA 4JPBW 3M58A 2W0ZA 2PNIA 5GANg 3H0FA 2CYZB 2LTOA 4D6WA 1QLYA 4EIKA 3EH2A 5LJ3e 3OYMA 4OMOA 2DL3A 4LD9K 5IN1A 3WXMB 4KBMB 2AT1B 3VS5A 3C94A 1T3LA 1NJIC 2XG8D 5GAOq 2M9UA 2BZYA 2E5QA 1QP3A 8ATCB 2JJ9A 4E7LA 1JO8A 3LGFA 1ARKA 1ZUUA 2KRSA 3RESA 3CC4A 1VYUA 4PL6A 1K0XA 2NYSA 3MPUB 3OSSC 3FLGA 2E1HA 3LLRA 3CCLA 1XJWB 2D9TA 4M75D 5LJ3j 5J39A 1M4ZA 3BDLA 4L5GA 3JB9H 3UA7A 3H41A 2FPEA 4QVZA 1UG1A 1GFCA 3CCMA 3QXEB 5LJ3h 4C92F 5FW9A 2EKHA 5CCAA 3SFMA 3EG9B 2K2VA 2CZ1B 4QVCA 2DO3A 1QVPA 4IKFA 2QDYB 3TVTA 3EG3A 1D0YA 1OZ2A 4A54A 1VUBA 3G4SA 3F70A 4JRKA 1KHCA 1QVGP 3RNJA 4XU2A 1QVFP 3M0QA 4PJLA 1VQ6A 1N5ZA 3EG0A 1YIJA 2LCCA 1XOVA 1OU9A 3QJYA 2D0QB 1U06A 1G83A 2YRCA 3CCVT 1ZA1B 1S72T 5HKCA 3RR6A 2DPPB 4V2SA 4F7UA 2Z0WA 4M77G 4RMOA 4M77C 3OSVA 1AD5A 1IGQA 2EQUA 3VJPA 3CCRQ 2R57A 4X1VA 1UGPB 3CMAT 1WHHA 2DLPA 3X26B 1BI0A 4HCKA 1N9SA 4R0KA 4RCBA 2JXBA 1PG5B 3OS0A 1NM7A 1NJIU 4BI3A 1KJWA 1SKUB 1ZHIA 4CRIA 1KD1R 2IPOB 1R8OB 2PVDB 1IREB 1ABQA 2K79A 2LT4A 4N0AC 1MNDA 5IH2A 3VS3A 5FU6C 1YCYA 1HK9A 3VS2A 3E2UA 3G1JA 2DTOA 2DA9A 4F17A 1VQ5Q 1M3BA 3CCUT 2DD4A 4NS5A 2JT4A 4M78G 2XDBA 3NTKA 2RHZA 1PC0A 2Y4XA 5D7UA 3URGA 2RHIA 3VS4A 2EGCA 3CCET 1RADB 4KULA 1M8MA 2KGTA 4BDYA 1I1JA 1YI2Q 1UHFA 4FM4B 4ELYC 1ZSZA 2QDLA 3M0UA 1PHTA 2AIRB 3MP1A 2CDTA 3HRUA 3J81E 1UUEA 3I9QA 4J9DA 2FEIA 1BI3A 3JCMJ 3QWYA 5D6YA 3O8VA 1RAAB 3NTHA 2DXCA 1M2VB 3QUIA 3CD6T 2X51A 3CEYA 2K3BA 2DL8A 4K11A 2M51A 1N27A 3NGPA 2EQJA 2RO0A 3M0TA 4OB3B 3OY9A 4ZN1A 2ATCB 4A4EA 2DYBA 2DJZA 3GIBA 1TOVA 5M9OA 2FZKB 3I55T 4WF2A 2EQKA 2DERA 2CT4A 1QWFA 4PJMA 4JS4A 1UJ0A 2MMPA 5IT9E 4RUGA 2DF6A 1SEMA 3REAB 1NPRA 1D1CA 2HL3A 2X4WA 4J7IA 1BIBA 3OYDA 3NFCA 1U1SA 1YHQA 3JB9G 4ATOA 4MMKA 1E6GA 3RKYA 3L2RA 2D0NA 4Z8AA 1X6OA 2RNAA 2YRDA 4JS5A 2LZ6B 2RM4A 4IUUA 2MCNA 5KYXA 1LOJA 4DEXA 3M53A 3R6OA 3JCMd 1KC8R 3CBMA 1WXTA 4XAXB 2MI6A 2MWPA 2JOYA 1Y07A 4LD6A 3CCMQ 1YJWA 4ANJA 4C0ZA 2LQKA 2JS2A 2C06A 4PJOG 5CKBA 4M7AD 1GXIE 1PRLC 4GLKA 1WHJA 2KQWA 2YWWA 4KT0E 1T3SA 1YJNA 4FT4A 1AHJB 1Y7XA 2QI2A 1QVFA 2CKKA 4ZNXA 1TG0A 4ZGJB 2HKQB 2QTVA 1VQ6Q 4J9BA 3G7ZA 1YITA 2GFUA 1YIJQ 2HNIA 3HL8A 4C0GA 2RK1A 2D8JA 3OYYA 1WGSA 2KK4A 3IQLA 4NL3A 2EPDA 2EVRA 2E64A 3HFOA 2JZ2A 2RI2A 3DLMA 2OX7A 3A8LB 2H3EB 4FW1A 1AWXA 1QCNA 4FIBA 1QKWA 3CMEA 2ZPFB 1JJ2P 2A08A 4JLIA 5KYYA 2QYZA 1IHVA 1WZOA 2DD5A 1BKBA 3PMTA 3EHQA 2LRQA 3M54A 3E9FA 1VQ9T 3CXCS 1UGQB 3QPHA 2X9HA 2A0FB 4J7FA 5DLOA 5GMKe 2XDPA 2DFUA 2IIMA 1N8RR 2FG0A 1LJOA 4FYYB 1JB0E 3H0IA 4PLIA 3CQTA 4EMKB 1PRMC 1KQSP 2GF7A 3RDVA 1GFDA 1K73R 2KXCA 1KD1C 3OYEA 1FMKA 5CQXA 3VYGA 1JRIA 2OAWA 4JUVA 3VS6A 3SDZA 2YT6A 2XK0A 4KGXB 4RTYA 3HRSA 1U8RA 2LCLA 3GOXA 1FMVA 1K8AU 5IHKA 1NYFA 5GMKj 2K5LA 1JBMA 4HT8A 2F5TX 4XK8E 2GQVA 4OB0B 3PVLA 3ZL7C 2L5QA 5CAIA 2C0OA 4BUGA 1FX7A 3L2ZA 4OF1A 5GMKh 1I4K1 2EJFA 3A1PA 1AWJA 1M3AA 3EHRA 5ECAA 4P5NA 3A98A 1PKTA 3C4SA 1HSQA 1LCKA 1VQLA 4M4ZA 4HT9A 2RB6A 3ZEHA 4UC4A 2DIQA 2O88A 2HMAA 2OTLT 1NBEB 1TXQA 3MEWA 4MDXA 1QWEA 2E3IA 1WIEA 5KYUB 1ZSGA 5DM7R 4AG2C 2KAFA 5GMKm 2MOXA 3TSWA 1UJYA 4M78F 1QMCA 2ROTA 4M78A 4QW2A 2J05A 4E47A 4DBQA 3CXCP 2BZXA 1RAHB 2FHDA 4OMMA 2QTXA 4E7JA 1AZEA 2DL5A 1AWOA 1IO6A 1YHQQ 1I81A 4BY6B 1RUWA 4LUDA 2RK2A 2QA4T 3GPLA 4M7AE 2DEUA 4CC7A 4LE9A 5FRNA 1NE8A 4M75F 2XI9A 3WVDB 1KFZA 4M75A 4OMNA 2JM8A 3M0PA 1VIFA 3OYBA 2ZGWA 2YLCA 3JCMh 2KMTA 1N9RA 3QDRB 2RQWA 4N4IA 2VB6A 1AT1B 2FPDA 2KY9A 4XTVA 1YJNQ 3OYFA 4RTWA 1KC8C 2FRYA 4F7UE 1KG1A 5GAN5 1B34B 1XQHA 2Y90A 2CP2A 2X4YA 1YJ9T 1YITQ 1ZUKA 2EKOA 2X35A 2DRKA 4DOVA 7AT1B 2M1HA 3E9GA 4Q5WA 4EDUA 5EG2A 3AHUA 2C0TA 2FL7A 1UE9A 1T0JA 4XTUA 1D3BB 3CMEQ 1JJ2A 2RH2A 1GL5A 4EMKC 3HKSA 2LQNA 2LCSA 2HD0A 4ORZA 4C8QB 1NG2A 5KYNA 1W1FA 2I0NA 5GAN3 2YLBA 1G8XA 4PJOA 5KE2A 4ZGDB 1UHCA 2HDAA 1K0SA 5KCOA 2LJ3A 3CCVA 1S72A 2E41A 2DVJA 3L2WA 5DLQE 4JRQA 1HJDA 2L3RA 4GLMA 2R5AA 3EFOB 1UTIA 2RJEA 2DK3A 3LWHA 1VA7A 1VQ5A 1Y96B 1OEBA 5IXBA 4M77D 3MP8A 4BB7A 1N8RC 2COWA 1TU0B 1K9MR 1Z9QA 2E70A 4MZTA 3GP8A 2B8AA 3EG2A 1K73C 2YSQA 2X3WD 1AEYA 2LJ0A 3QJ6A 1VQ7T 1MGQA 1QVGS 6AT1B 3J80E 3CCUA 3A8HB 1QVFS 1VQLQ 4AFZC 1I0CA 3OYHA 1WA7A 4B9XA 2LT1A 1B3QA 4O6JA 1BBZA 3EFRA 4BY6C 4HKEA 4M7DF 1NEGA 4HVWA 1BI1A 4M7DA 4M78D 2RN8A 5HK0A 4XU3A 4AMCA 3JCMW 1Y0MA 3CXCA 4FYVB 1D0XA 2OJ2A 3CBOA 3CC7T 1H92A 2HEQA 3T9NA 1D09B 4D8DA 2ECZA 2FO0A 3CD6A 2KYBA 3L1AA 2EJ9A 5KCHA 1PSEA 4E2FB 5L8RE 4C5GA 5CR2A 1OOTA 1O9SA 3ULRB 2EYXA 1TSFA 2ZCFB 4DBFA 3BY7A 3UA6A 1TUCA 2QAZA 4DA4A 1KK7A 2L3SA 2RHYA 3M56A 3I55A 1UGVA 2COZA 1N8RU 2V8KA 2EAYA 4L6V5 1VQKT 1VQNT 4M7AF 1K73U 3E19A 1NLOC 2F2XA 4M7AA 3EGXB 2CH4A 4FW2A 3OA6A 2V8IA 1SRMA 4IIMA 5FROA 1CKBA 4C8QG 1NEBA 1V29B 4JJCA 4C8QC 3H6ZA 2YRVA 1VQ4T 5C6SA 2XICA 5IHIA 2AZSA 2M0OA 3JB9D 2CP0A 2JTFA 1YNZA 2DM1A 1TUDA 1MMAA 1M27C 2BUDA 1A0NB 2QEXT 1IXDA 4J6YA 4F7UF 3S3NA 2FB7A 1N6AA 2IG0A 3I5SA 1SF9A 2JTEA 2KT1A 3OBYA 1E7OA 2J6FA 1PD0A 1I5OB 3A5ZB 4AFQC 1D1AA 5LJ5d 4PJOD 1WHGA 4RTXA 4RKUE 2JUFA 1BCOA 1SPKA 3OS5A 3CCQA 2HBWA 1JU5C 3X24B 5FWCA 1SHFA 4DOWA 1VQPT 4J8OA 3FJ5A 3FJPA 2X4XA 1UDLA 3CCVQ 1X2QA 1S72Q 3SWNB 4M77E 2BIVA 2GCXA 3QYGB 3L2UA 3KFVA 1QCFA 1VQOT 4R55A 4JRPA 2L3PA 1I07A 1MMDA 4FT2A 3QO3A 4RTUA 1VQ9A 3M57A 4FCYA 3G71T 4LN2A 1BYMA 1WDXA 4OGCA 4QQ6A 1TS9A 3VS7A 1WHLA 1RL2A 3PIPA 5I21A 4B9WA 2RQRA 3G6ET 2K3YA 2CZ6B 3HP9A 3U23A 2KYMA 2XU8A 3DLLA 4OVAA 3CCUQ 5KYWB 4X9CA 1R77A 4OMPA 1X01A 3O5ZA 4M78E 1K9MC 4Y28E 2O9SA 1ZBXA 3H0HA 1FMWA 3V7RA 2D6FA 2A37A 2CT3A 1RI0A 2DBKA 2BTTA 4DBHA 1QQJA 5LJ3f 3ZBDA 4ELZC 1WYXA 4PK4A 4M7DD 2QQSA 4ZN3A 5L23A 2EQIA 4XTWA 4BE0A 1NPPA 1JJ2S 1KSWA 5GAMd 5FWBA 1FXXA 2EIFA 3OYIA 1Q7YR 2BKDN 4M75E 2W10A 1X27A 2RQTA 2RJCA 1DJ7B 1LPLA 5LJ3g 2OAUA 3CC4T 2OTLA 3CD6Q 2KEAA 4HXJA 2M16A 3I56T 3CCLT 1RI9A 1G3YA 4HCZA 1AVZC 1G3SA 2HQHA 3JRZA 2ZPBB
chains in the Genus database with same CATH topology
1LCKA 2K2MA 4M4ZA 2O2OA 2EGEA 2GBQA 2GTJA 2B86A 4AFUC 2O88A 1V1CA 1QWEA 4DEYA 1WIEA 1W6XA 1AZGB 1ZSGA 2CSQA 1WI7A 4CC3A 2RF0A 2SRCA 4AG2C 2AZVA 1E6HA 2DL7A 4D8KA 1HD3A 2CSIA 1PKSA 2MOXA 3TSWA 1OPLA 1UJYA 3UATA 1GCQC 2ROTA 2J05A 2HSPA 4ESRA 4Z88A 1H8KA 2D1XA 4AG1C 2BZXA 4OMMA 3M0SA 2LX7A 1AZEA 1AWWA 2DL5A 5I11A 1AWOA 4OMLA 1IO6A 1OPKA 2KROA 4J9HA 1RUWA 3M0RA 4LUDA 3THKA 2KT8A 1M30A 2C0IA 2CUBA 4CC7A 3UF4A 2LNHB 1SSHA 4LE9A 2RQVA 1K4US 1KFZA 4JPBW 2LJ1A 2W0ZA 2GNCA 2PNIA 4OMNA 1X2KA 2JM8A 3M0PA 3H0FA 1K76A 2RQWA 1X6BA 1X6GA 1QLYA 2DILA 2FPDA 5GJWB 1JXOA 4EIKA 2K6DA 4RTWA 4OMOA 2DL3A 2YUQA 2FRYA 3VS5A 1T3LA 4JJBA 2FPFA 2ROLA 1T0HA 1ZUKA 2BZYA 1JO8A 2DRKA 1ARKA 1ZUUA 2EGAA 2KRSA 1AOJA 1WLPB 1VYUA 3PVQA 1K0XA 2C0TA 1SHGA 2AKKA 1UE9A 1T0JA 2KXDA 2M0YA 1VYVA 4Y92A 1JXMA 2VVKA 1KIKA 4JZ4A 1GL5A 2LQNA 2LCSA 3UA7A 3H41A 4LNPA 4ORZA 2FPEA 2L3QA 1UG1A 1GFCA 1NG2A 2HCKA 1CKAA 2KNBB 4Z89A 1W1FA 2I0NA 2EKHA 5FW9A 1B07A 4LUEA 2H8HA 1UFFA 3TVTA 1YWPA 4HVUA 1ZUYA 1UHCA 3EG3A 5I22A 2RQUA 2HDAA 1K0SA 2DNUA 5EC7A 2LJ3A 1UECA 2V1RA 2EBPA 2DL4A 1VYTA 3RNJA 2DVJA 3M0QA 2J7IA 1N5ZA 3REBB 1HJDA 1NYGA 4GLMA 3SEMA 2BZ8A 3EG0A 3EGUA 4RTZA 1XOVA 1UTIA 1PWTA 1M3CA 2PTKA 1VA7A 1U06A 3PE0A 1G83A 4JZ3A 1OEBA 2GQIA 5GJVB 5IXBA 3NPFA 2V1QA 1Z9QA 4F14A 3EG2A 1AD5A 4X1VA 2F2WA 2DLPA 2YSQA 2X3WD 1Y57A 1EFNA 2DMOA 4HCKA 4R0KA 1AEYA 2JXBA 2LJ0A 4F16A 1NM7A 2ENMA 3I5RA 2EYZA 1ZBJA 2JMCA 4FSSA 1KJWA 2FRWA 3NMZC 4AFZC 1WXBA 2OI3A 1I0CA 1ABQA 1WA7A 2K79A 2E5KA 5IH2A 1Z9ZA 2NUZA 1OV3A 3VS3A 4IIOA 2X3XD 2JM9A 3VS2A 4HVVA 1B3QA 1BBZA 1G2BA 2DBMA 3LH5A 2CH4W 2CUDA 2DA9A 4F17A 2MIOA 1NEGA 1M3BA 1GBQA 2ED1A 1SRLA 4HVWA 3SHWA 5IXFA 1YWOA 2DX1A 2JT4A 3TSZA 2RN8A 1Y0MA 3VS4A 2OJ2A 2EGCA 1FYNA 3GBQA 3EG1A 2EYWA 1H92A 2HEQA 1JQQA 2J6KA 1M8MA 5HCKA 2JMAA 2KGTA 2LMJA 1MV3A 2ECZA 1MUZA 3VRYA 4D8DA 2FO0A 2KYBA 1I1JA 1X69A 1UHFA 2K7AA 1RLQC 2JS0A 2QDLA 3M0UA 1U5SA 1GBRA 1PHTA 4J9EA 3VS0A 2CDTA 1CSKA 1YCSB 1OOTA 1UUEA 3I9QA 4J9DA 2FEIA 1JEGA 1BK2A 3QWYA 3ULRB 2EYXA 3VRZA 2F2VA 3UA6A 1TUCA 2GTOA 2L3SA 1WX6A 1UGVA 2L0AA 2K3BA 2DL8A 2O9VA 4K11A 2M51A 3NGPA 2P4RA 1YN8A 2RPNA 3M0TA 1S1NA 5IHNA 1NLOC 2F2XA 2SEMA 2DYBA 2CH4A 2ABLA 1SRMA 4IIMA 1CKBA 2CT4A 1QWFA 1NEBA 4JJCA 1UJ0A 2KR3A 4RUGA 2DF6A 1BB9A 1SEMA 2EW3A 5IHIA 3REAB 1H3HA 1W70A 2AZSA 2AK5A 1YNZA 2DM1A 1TUDA 1BU1A 2KRMA 4AFSC 1M27C 1E6GA 2D0NA 4Z8AA 4OMQA 1A0NB 2RNAA 2LZ6B 2MCNA 3I5SA 2YUPA 4DEXA 2JTEA 2KT1A 1ZLMA 1E7OA 2J6FA 1WXTA 4AFQC 2YUOA 3JV3A 1GCPA 2JS2A 1X43A 4RTXA 1YP5A 1SPKA 3QWXX 2HBWA 1JU5C 1PRLC 1RLPC 5FWCA 2GGRA 1SHFA 2G6FX 3FJ5A 1T3SA 4JJDA 1WXUA 1UDLA 1X2QA 1PNJA 4RTVA 1NLPC 4ZNXA 1TG0A 4A63B 2J6OA 4J9BA 2AKLA 4J9IA 1K1ZA 4CC4B 3KFVA 2KRNA 2D8JA 2PZ1A 1U3OA 1QCFA 2KE9A 1WFWA 2CREA 2LQWA 3IQLA 1K9AA 2L3PA 1I07A 2KBTA 2EPDA 2EVRA 4RTUA 4CC2A 4LN2A 4QT7A 3VS1A 1WDXA 3C0CA 3VS7A 1AWXA 2A28A 1ABOA 1ZX6A 4E6RA 1QKWA 2D8HA 1MV0B 2L2PA 2A08A 2K9GA 3NHNA 2RQRA 2LP5A 1GRIA 2DRMA 3EHQA 2VKNA 3U23A 2KYMA 4KRTA 1J3TA 4OMPA 3O5ZA 2ED0A 2O9SA 2J06A 3H0HA 2IIMA 2A37A 2CT3A 2O31A 4J9CA 2DBKA 2BTTA 2FG0A 1QKXA 2JW4A 3H0IA 3CQTA 1PRMC 1GFDA 2A36A 1WYXA 2KXCA 5L23A 1FMKA 2EQIA 2DJQA 1KSWA 5FWBA 2OAWA 3R6NA 3VS6A 1GCQA 2YT6A 2YUNA 4RTYA 4J9GA 5IHKA 1NYFA 2W10A 2DE0X 1X27A 2RMOA 2NWMA 2RQTA 2ESWA 2VWFA 3PVLA 3ZL7C 3I35A 2EYYA 2YDLA 2KEAA 4HXJA 3RBBB 2XMFA 2C0OA 4J9FA 1RI9A 4RTTA 1AWJA 1M3AA 3EHRA 5ECAA 1AVZC 3A98A 1PKTA 4GBQA 4WCIA 1HSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LCK A;  2K2M A;  4M4Z A;  2O2O A;  2EGE A;  2GBQ A;  2GTJ A;  2B86 A;  4AFU C;  2O88 A;  1V1C A;  1QWE A;  4DEY A;  1WIE A;  1W6X A;  1AZG B;  1ZSG A;  2CSQ A;  1WI7 A;  4CC3 A;  2RF0 A;  2SRC A;  4AG2 C;  2AZV A;  1E6H A;  2DL7 A;  4D8K A;  1HD3 A;  2CSI A;  1PKS A;  2MOX A;  3TSW A;  1OPL A;  1UJY A;  3UAT A;  1GCQ C;  2ROT A;  2J05 A;  2HSP A;  4ESR A;  4Z88 A;  1H8K A;  2D1X A;  4AG1 C;  2BZX A;  4OMM A;  3M0S A;  2LX7 A;  1AZE A;  1AWW A;  2DL5 A;  5I11 A;  1AWO A;  4OML A;  1IO6 A;  1OPK A;  2KRO A;  4J9H A;  1RUW A;  3M0R A;  4LUD A;  3THK A;  2KT8 A;  1M30 A;  2C0I A;  2CUB A;  4CC7 A;  3UF4 A;  2LNH B;  1SSH A;  4LE9 A;  2RQV A;  1K4U S;  1KFZ A;  4JPB W;  2LJ1 A;  2W0Z A;  2GNC A;  2PNI A;  4OMN A;  1X2K A;  2JM8 A;  3M0P A;  3H0F A;  1K76 A;  2RQW A;  1X6B A;  1X6G A;  1QLY A;  2DIL A;  2FPD A;  5GJW B;  1JXO A;  4EIK A;  2K6D A;  4RTW A;  4OMO A;  2DL3 A;  2YUQ A;  2FRY A;  3VS5 A;  1T3L A;  4JJB A;  2FPF A;  2ROL A;  1T0H A;  1ZUK A;  2BZY A;  1JO8 A;  2DRK A;  1ARK A;  1ZUU A;  2EGA A;  2KRS A;  1AOJ A;  1WLP B;  1VYU A;  3PVQ A;  1K0X A;  2C0T A;  1SHG A;  2AKK A;  1UE9 A;  1T0J A;  2KXD A;  2M0Y A;  1VYV A;  4Y92 A;  1JXM A;  2VVK A;  1KIK A;  4JZ4 A;  1GL5 A;  2LQN A;  2LCS A;  3UA7 A;  3H41 A;  4LNP A;  4ORZ A;  2FPE A;  2L3Q A;  1UG1 A;  1GFC A;  1NG2 A;  2HCK A;  1CKA A;  2KNB B;  4Z89 A;  1W1F A;  2I0N A;  2EKH A;  5FW9 A;  1B07 A;  4LUE A;  2H8H A;  1UFF A;  3TVT A;  1YWP A;  4HVU A;  1ZUY A;  1UHC A;  3EG3 A;  5I22 A;  2RQU A;  2HDA A;  1K0S A;  2DNU A;  5EC7 A;  2LJ3 A;  1UEC A;  2V1R A;  2EBP A;  2DL4 A;  1VYT A;  3RNJ A;  2DVJ A;  3M0Q A;  2J7I A;  1N5Z A;  3REB B;  1HJD A;  1NYG A;  4GLM A;  3SEM A;  2BZ8 A;  3EG0 A;  3EGU A;  4RTZ A;  1XOV A;  1UTI A;  1PWT A;  1M3C A;  2PTK A;  1VA7 A;  1U06 A;  3PE0 A;  1G83 A;  4JZ3 A;  1OEB A;  2GQI A;  5GJV B;  5IXB A;  3NPF A;  2V1Q A;  1Z9Q A;  4F14 A;  3EG2 A;  1AD5 A;  4X1V A;  2F2W A;  2DLP A;  2YSQ A;  2X3W D;  1Y57 A;  1EFN A;  2DMO A;  4HCK A;  4R0K A;  1AEY A;  2JXB A;  2LJ0 A;  4F16 A;  1NM7 A;  2ENM A;  3I5R A;  2EYZ A;  1ZBJ A;  2JMC A;  4FSS A;  1KJW A;  2FRW A;  3NMZ C;  4AFZ C;  1WXB A;  2OI3 A;  1I0C A;  1ABQ A;  1WA7 A;  2K79 A;  2E5K A;  5IH2 A;  1Z9Z A;  2NUZ A;  1OV3 A;  3VS3 A;  4IIO A;  2X3X D;  2JM9 A;  3VS2 A;  4HVV A;  1B3Q A;  1BBZ A;  1G2B A;  2DBM A;  3LH5 A;  2CH4 W;  2CUD A;  2DA9 A;  4F17 A;  2MIO A;  1NEG A;  1M3B A;  1GBQ A;  2ED1 A;  1SRL A;  4HVW A;  3SHW A;  5IXF A;  1YWO A;  2DX1 A;  2JT4 A;  3TSZ A;  2RN8 A;  1Y0M A;  3VS4 A;  2OJ2 A;  2EGC A;  1FYN A;  3GBQ A;  3EG1 A;  2EYW A;  1H92 A;  2HEQ A;  1JQQ A;  2J6K A;  1M8M A;  5HCK A;  2JMA A;  2KGT A;  2LMJ A;  1MV3 A;  2ECZ A;  1MUZ A;  3VRY A;  4D8D A;  2FO0 A;  2KYB A;  1I1J A;  1X69 A;  1UHF A;  2K7A A;  1RLQ C;  2JS0 A;  2QDL A;  3M0U A;  1U5S A;  1GBR A;  1PHT A;  4J9E A;  3VS0 A;  2CDT A;  1CSK A;  1YCS B;  1OOT A;  1UUE A;  3I9Q A;  4J9D A;  2FEI A;  1JEG A;  1BK2 A;  3QWY A;  3ULR B;  2EYX A;  3VRZ A;  2F2V A;  3UA6 A;  1TUC A;  2GTO A;  2L3S A;  1WX6 A;  1UGV A;  2L0A A;  2K3B A;  2DL8 A;  2O9V A;  4K11 A;  2M51 A;  3NGP A;  2P4R A;  1YN8 A;  2RPN A;  3M0T A;  1S1N A;  5IHN A;  1NLO C;  2F2X A;  2SEM A;  2DYB A;  2CH4 A;  2ABL A;  1SRM A;  4IIM A;  1CKB A;  2CT4 A;  1QWF A;  1NEB A;  4JJC A;  1UJ0 A;  2KR3 A;  4RUG A;  2DF6 A;  1BB9 A;  1SEM A;  2EW3 A;  5IHI A;  3REA B;  1H3H A;  1W70 A;  2AZS A;  2AK5 A;  1YNZ A;  2DM1 A;  1TUD A;  1BU1 A;  2KRM A;  4AFS C;  1M27 C;  1E6G A;  2D0N A;  4Z8A A;  4OMQ A;  1A0N B;  2RNA A;  2LZ6 B;  2MCN A;  3I5S A;  2YUP A;  4DEX A;  2JTE A;  2KT1 A;  1ZLM A;  1E7O A;  2J6F A;  1WXT A;  4AFQ C;  2YUO A;  3JV3 A;  1GCP A;  2JS2 A;  1X43 A;  4RTX A;  1YP5 A;  1SPK A;  3QWX X;  2HBW A;  1JU5 C;  1PRL C;  1RLP C;  5FWC A;  2GGR A;  1SHF A;  2G6F X;  3FJ5 A;  1T3S A;  4JJD A;  1WXU A;  1UDL A;  1X2Q A;  1PNJ A;  4RTV A;  1NLP C;  4ZNX A;  1TG0 A;  4A63 B;  2J6O A;  4J9B A;  2AKL A;  4J9I A;  1K1Z A;  4CC4 B;  3KFV A;  2KRN A;  2D8J A;  2PZ1 A;  1U3O A;  1QCF A;  2KE9 A;  1WFW A;  2CRE A;  2LQW A;  3IQL A;  1K9A A;  2L3P A;  1I07 A;  2KBT A;  2EPD A;  2EVR A;  4RTU A;  4CC2 A;  4LN2 A;  4QT7 A;  3VS1 A;  1WDX A;  3C0C A;  3VS7 A;  1AWX A;  2A28 A;  1ABO A;  1ZX6 A;  4E6R A;  1QKW A;  2D8H A;  1MV0 B;  2L2P A;  2A08 A;  2K9G A;  3NHN A;  2RQR A;  2LP5 A;  1GRI A;  2DRM A;  3EHQ A;  2VKN A;  3U23 A;  2KYM A;  4KRT A;  1J3T A;  4OMP A;  3O5Z A;  2ED0 A;  2O9S A;  2J06 A;  3H0H A;  2IIM A;  2A37 A;  2CT3 A;  2O31 A;  4J9C A;  2DBK A;  2BTT A;  2FG0 A;  1QKX A;  2JW4 A;  3H0I A;  3CQT A;  1PRM C;  1GFD A;  2A36 A;  1WYX A;  2KXC A;  5L23 A;  1FMK A;  2EQI A;  2DJQ A;  1KSW A;  5FWB A;  2OAW A;  3R6N A;  3VS6 A;  1GCQ A;  2YT6 A;  2YUN A;  4RTY A;  4J9G A;  5IHK A;  1NYF A;  2W10 A;  2DE0 X;  1X27 A;  2RMO A;  2NWM A;  2RQT A;  2ESW A;  2VWF A;  3PVL A;  3ZL7 C;  3I35 A;  2EYY A;  2YDL A;  2KEA A;  4HXJ A;  3RBB B;  2XMF A;  2C0O A;  4J9F A;  1RI9 A;  4RTT A;  1AWJ A;  1M3A A;  3EHR A;  5ECA A;  1AVZ C;  3A98 A;  1PKT A;  4GBQ A;  4WCI A;  1HSQ A; 
#chains in the Genus database with same CATH topology
 4OB1 B;  4PJN A;  2O2O A;  3EGD A;  3X28 B;  4E7S A;  3UPU A;  3PGG A;  1RAI B;  3I55 Q;  2E4H A;  3PFS A;  3X20 B;  4CI0 C;  1AZG B;  2MK5 A;  2CSQ A;  3Q1J A;  1WI7 A;  3M5A A;  5GAN d;  4LDX A;  4D8K A;  4LDV A;  1HD3 A;  2CSI A;  4MDW A;  1PKS A;  5A2Q E;  3G4S T;  1G3W A;  3UAT A;  4C92 B;  3DB4 A;  1MMG A;  1GCQ C;  2QA4 A;  1QVG A;  1IZ6 A;  4ESR A;  2DXT A;  3HTR A;  5CKD A;  1VQ6 T;  1MHN A;  3CCJ T;  2D1X A;  4KGV B;  1K9M U;  2E3H A;  2LX7 A;  3C95 A;  5I11 A;  4OML A;  2ZPH B;  4X34 A;  4PJO E;  2KRO A;  4J9H A;  2EJG A;  4QQD A;  1UB4 A;  2KT8 A;  3LYI A;  3SWN C;  2CUB A;  1I8F A;  3UF4 A;  2LNH B;  1SSH A;  2RQV A;  5A0G A;  2E10 A;  2GNC A;  5LJ5 j;  3V7S A;  2O4X A;  3JB9 J;  2VUB A;  1YJ9 A;  5I2M A;  1XTD A;  2P84 A;  4A4F A;  1RAB B;  3CCQ Q;  3S3M A;  5FU7 B;  2KVQ G;  2RHX A;  2DIL A;  5GJW B;  1D3B A;  5LJ5 h;  1VQM T;  2YUQ A;  2XKO C;  3SD4 A;  3QDF A;  8AT1 B;  4XQ3 A;  1KQ2 A;  1IGU A;  2VGN A;  4BI8 B;  3JCM c;  2XHC A;  5CO7 A;  4KH0 B;  1WLP B;  2E6Z A;  5DY9 A;  3EAE A;  4BI4 A;  3SB2 A;  5HY6 A;  1VQ9 Q;  1Q86 R;  2KXD A;  3CC2 A;  1VYV A;  3P8H A;  4Y92 A;  1JXM A;  4M77 F;  1OX8 A;  3BDU A;  4A53 A;  3CPW S;  2NUP A;  2F1L A;  4JZ4 A;  4M77 A;  3S6W A;  1NZ9 A;  3RER A;  4XU0 A;  4LNP A;  3EFO A;  1TWB A;  1CKA A;  2RD1 A;  2X4J A;  1B07 A;  1Y96 A;  2LVM A;  4LUE A;  3CCS T;  4M7D E;  3OYN A;  2LDM A;  1OZ3 A;  3RKW A;  1ZUY A;  2DXB A;  4C5I A;  5CKE A;  1UEC A;  2V1R A;  2DL4 A;  4N0A A;  1VYT A;  3VKI A;  2CP7 A;  3V8L A;  1UEB A;  2DET A;  3J7A F;  2RA2 A;  2HZY A;  3MCA B;  2NUT A;  4LDW A;  3EGU A;  5C0M A;  1PWT A;  5GAM j;  4RG8 A;  1M3C A;  4XTX A;  2PTK A;  2JTM A;  1VQ7 A;  3PE0 A;  4JZ3 A;  3JCM e;  2GQI A;  4LDY A;  3BW1 A;  5GAM h;  3FB9 A;  1Q95 G;  3GNG A;  4OGE A;  2OTL Q;  2F2W A;  1W2B S;  1Y57 A;  1EFN A;  2DMO A;  3N5B B;  5CKF A;  4F16 A;  4C92 G;  4C92 C;  5KE3 A;  1H3Z A;  1ZBJ A;  2FRW A;  1Q7Y C;  3BFM A;  3NMZ C;  2HKN A;  1X75 C;  3LW5 E;  1LVK A;  2E5K A;  1Z9Z A;  2NUZ A;  2P4T A;  1OV3 A;  1YJW T;  1KD1 U;  5KYX B;  4IIO A;  2X3X D;  1PD1 A;  4ME7 A;  3CPF A;  4HVV A;  5GAN j;  1BIA A;  1WQW A;  1G2B A;  3CC7 A;  4OB2 B;  4JDS A;  4PJJ A;  3RKX A;  4A4G A;  2MIO A;  3CPW P;  1GBQ A;  2ED1 A;  3RUX A;  3SHW A;  2P0K A;  5IXF A;  4ZTJ A;  1M90 C;  4C5E A;  5GAN h;  2QA4 Q;  2MF2 A;  5KH6 A;  1TTH B;  3GBQ A;  4MZP A;  1YIT T;  2EYW A;  1JQQ A;  2J6K A;  3OS1 A;  3A8O B;  3FRN A;  4BE1 A;  2ZPG B;  2JMA A;  2LMJ A;  5FU7 C;  3VRY A;  3EG9 A;  4FSX A;  1X69 A;  5CKH A;  2WSC E;  2JS0 A;  3JB9 F;  3OB9 A;  1GBR A;  2E65 A;  4J9E A;  3VS0 A;  1VQK A;  1VQN A;  1YCS B;  2HAX A;  3INZ A;  1JEG A;  4KH1 B;  4FU6 A;  2R58 A;  1YJ9 Q;  1TUG B;  2O9V A;  3L2V A;  5KYY B;  1QP2 A;  1YN8 A;  4MZM A;  4PJO F;  3OYK A;  1VQ4 A;  3LX7 A;  1EZZ B;  1S1N A;  1W2B P;  2K5F A;  1RAF B;  2SEM A;  2RJF A;  2QEX A;  3OYG A;  1B7T A;  4C8Q D;  3HFN A;  1KQS A;  2MPX C;  4PFO A;  4OMF B;  1WHM A;  2KR3 A;  1Q7Y U;  3OQ5 A;  2EFI A;  2AK5 A;  3CMA A;  3M4G A;  2KSS A;  2KRM A;  4JLG A;  4AFS C;  3CC2 Q;  4BD3 A;  2OTJ T;  4OMQ A;  2RJD A;  3V7C A;  1VQP A;  9ATC B;  5GMK i;  1VQ8 T;  3QII A;  4FL6 A;  1WJR A;  1ZLM A;  2ZZD A;  3HHT B;  4C5H A;  1M90 U;  2BE7 D;  2K5I A;  3OYC A;  2VXF A;  2YUO A;  4BAC A;  1Q86 C;  1KC8 U;  2HSE B;  1YP5 A;  2O01 E;  3QSU A;  2K3X A;  1RLP C;  2G6F X;  3MET A;  1VQO A;  1KQS S;  1Q81 R;  2CGH A;  2RI5 A;  1UGS B;  1WXU A;  4JJD A;  3X25 B;  4J5Y A;  2CP5 A;  4RTV A;  5FLX E;  3G71 A;  3JCM f;  5GAN 6;  3MJX A;  5AYF A;  4E7K A;  1WQ7 A;  4J9I A;  4XTY A;  3CCE A;  4HCC A;  4CC4 B;  2LNV A;  5IAY A;  2IVW A;  1U3O A;  1VQ7 Q;  2CRE A;  1BCM A;  5GAO n;  4IUQ A;  4QT7 A;  3C0C A;  4M78 B;  3GF5 A;  1ABO A;  4E6R A;  1M2V A;  3JCM g;  2LX9 A;  3NHN A;  1M8V A;  2HBP A;  1GRI A;  3V8J A;  3HPW A;  4R56 A;  2VKN A;  1Y71 A;  2PQW A;  2RI3 A;  3M9Q A;  3OS2 A;  2PVG B;  2LQ8 A;  1G5V A;  2ED0 A;  4MML A;  4C0F A;  1WNL A;  2O31 A;  4J9C A;  4QQG A;  1QKX A;  3CC7 Q;  3OYL A;  3ZFJ A;  1C0M A;  4M75 B;  1KQ1 A;  3CPW A;  2A36 A;  2ZPI B;  2VYT A;  3LGL A;  4OP0 A;  2VV5 A;  1M2O A;  5GAN 8;  3I56 A;  1K8A R;  2DJQ A;  3R6N A;  4XU1 A;  2VGM A;  3QZ5 B;  4L59 A;  2YUN A;  2WSE E;  2GFA A;  1R0C B;  3PIO A;  4J9G A;  1Q86 U;  3VV0 A;  1D0Z A;  4N4G A;  4IUR A;  2DE0 X;  2NWM A;  3TEE A;  3VYH B;  1VOM A;  1F1B B;  2VWF A;  4Z02 A;  2EYY A;  2DTI A;  4C92 A;  5J3B A;  1VQK Q;  1VQN Q;  4DBR A;  4GBQ A;  3QBY A;  2JVV A;  2AHJ B;  4EMG A;  3CCR T;  4C8Q E;  1LNX A;  2DAQ A;  4TVR A;  5GMK l;  1V1C A;  1R0B G;  3JB9 I;  3OBW A;  1M1K R;  4B6M A;  3CCJ A;  1VQ4 Q;  2AZV A;  1E6H A;  5J26 A;  2DL7 A;  1W2B A;  3MO8 A;  4HCB A;  4PKC C;  3FIF A;  4PJO B;  5D6W A;  2QEX Q;  4HA8 A;  1C1A A;  2QGG A;  4Z88 A;  1YBY A;  5LL6 S;  1H8K A;  4AG1 C;  2VC8 A;  2A7Y A;  5GAN 2;  3DKM A;  4WTO B;  3CMA Q;  2FYK A;  4O5V A;  1VQ5 T;  1O75 A;  1OPK A;  2QQR A;  1M30 A;  1HXD A;  2QK0 A;  4DQ2 A;  2C0I A;  1VQP Q;  1WJS A;  2PVO B;  1VQM A;  3NTI A;  1K4U S;  2LC4 A;  4EMK A;  2VXE A;  2LJ1 A;  3ME9 A;  2XID A;  1X2K A;  4F04 B;  2EYQ A;  3QYH B;  3P8D A;  1YI2 T;  1K76 A;  1XNI A;  2KDS A;  1X6B A;  2F5K A;  2E6N A;  2MAM A;  1X6G A;  1ZQ1 A;  4IUP A;  2K57 A;  4X9D A;  1VQO Q;  1WJQ A;  5FRM A;  1JXO A;  2K6D A;  4JJN K;  4M78 C;  1I5L A;  1W4S A;  3G71 Q;  3E1S A;  2DTH A;  1BI2 A;  1IRX A;  4JJB A;  2FPF A;  1C6V X;  2EQM A;  3CCE Q;  2ROL A;  1T0H A;  3UWN A;  2HL5 C;  3G6E Q;  2DIG A;  3VUZ A;  3QKJ A;  2EGA A;  3TU4 K;  1AOJ A;  3RMQ A;  3QG1 A;  1H64 1;  3KUF A;  1Q81 C;  3PVQ A;  1SHG A;  3L2Q A;  2AKK A;  3JCM P;  4C0D B;  2NLU A;  1EIF A;  2QG9 B;  3CCS A;  3EH1 A;  2M0Y A;  4M7D B;  4IUV A;  2VVK A;  3C12 A;  1KIK A;  4M75 G;  4M75 C;  5KYU A;  2COY A;  2RHU A;  1U1T A;  2L3Q A;  2MWO A;  2FZG B;  2HCK A;  2KNB B;  4Z89 A;  3LWI A;  1FWZ A;  2H8H A;  1D1B A;  1UFF A;  1YWP A;  4HVU A;  2CS7 A;  5I22 A;  2RQU A;  1M1F A;  5GAO m;  2Y4Y A;  4QVD A;  2DNU A;  4NL2 A;  2V26 A;  5EC7 A;  2I2L A;  1IB8 A;  2EBP A;  2PUK B;  2DEQ A;  3PTA A;  3CCM T;  3CC4 Q;  2J7I A;  3REB B;  1NYG A;  3SEM A;  2BZ8 A;  4RTZ A;  3A8M B;  3TCJ A;  4PFP A;  3OYA A;  3I56 Q;  3CCL Q;  5GAO p;  1M90 R;  2JNG A;  5GJV B;  4Y91 A;  3NPF A;  4IUT A;  2V1Q A;  4M7A B;  5LJ5 e;  4F14 A;  2YHT A;  3UT1 A;  1Q82 R;  1YIJ T;  3AT1 B;  4QKU A;  3VUB A;  4C92 D;  2VAS A;  4ZGE B;  5GAN 7;  1K8A C;  4PJO C;  3I5R A;  2ENM A;  3H9N A;  2EYZ A;  2JMC A;  3DB3 A;  4FSS A;  3OW2 S;  5CVI A;  3G4S Q;  4A4K A;  1WXB A;  2QQ9 A;  1B34 A;  2OI3 A;  3JCM X;  4EPC A;  1RAE B;  3OYJ A;  4XTZ A;  1Q81 U;  4LXC A;  3FEO A;  4F7U B;  2JM9 A;  3CCJ Q;  2MYS A;  4YTL A;  2DBM A;  1OUL A;  4KUD K;  5HK3 A;  3LH5 A;  5AT1 B;  3CCQ T;  2CH4 W;  2CUD A;  3WVE B;  1SRL A;  3JCM b;  1RAC B;  1VIE A;  2DZ9 A;  3CBP A;  4J6X A;  1YWO A;  2DX1 A;  3PMI A;  3TSZ A;  2FVU A;  1PSF A;  1EX4 A;  1M1K C;  1FYN A;  2CZ7 B;  1PM3 A;  4C8Q F;  3EG1 A;  3A8G B;  3UDC A;  5CK9 A;  4C8Q A;  5HCK A;  4PFZ A;  1MV3 A;  1MUZ A;  2K7A A;  1RLQ C;  1M1G A;  1U5S A;  2DXU A;  1WHK A;  2EWN A;  1CSK A;  1ACM B;  1MMN A;  1VQM Q;  3JCM V;  1BK2 A;  3VRZ A;  2F2V A;  2K4Y A;  3KBG A;  3OMG A;  2GTO A;  2JN0 A;  3PT9 A;  1WX6 A;  5D6X A;  4KUI A;  1YFN A;  2L0A A;  2QGF B;  5GAM e;  2P4R A;  3ER0 A;  4C0D C;  1HYO A;  2DYI A;  2RPN A;  4M7D G;  4M7D C;  2BE9 B;  1MNE A;  1OX9 A;  1ZSZ B;  3M59 A;  5IHN A;  4KGZ B;  1OI1 A;  3EFS A;  3MHX A;  3MP6 A;  2OTJ A;  5A0D A;  3TQ7 P;  3FDR A;  2ABL A;  3QZ9 B;  3FC3 A;  3ASK A;  4II1 A;  1KHI A;  3JSC A;  4RCC A;  1VQ8 A;  1PCX A;  4PNO A;  3OW2 P;  3GLX A;  1BB9 A;  1WPY A;  2EW3 A;  1H3H A;  1IHW A;  2HQX A;  1W70 A;  5CQY A;  1BU1 A;  1P92 A;  3CCS Q;  1V76 A;  2QAS A;  2ZAE A;  3RMS A;  2YXY A;  3QHS A;  3MEA A;  2G3R A;  2R5M A;  2YUP A;  5GAN e;  1SSF A;  4J6W A;  2WSF E;  4FYW B;  3S3O A;  1NJI R;  3JV3 A;  1GCP A;  3D7S B;  1YHQ T;  4NOY A;  1X43 A;  2KI7 A;  1M1K U;  3QWX X;  4GY5 A;  2GGR A;  3HRT A;  4M7A G;  1SG5 A;  5A0L A;  4M7A C;  1PNJ A;  1NLP C;  1OU8 A;  4A63 B;  3EGD B;  2J6O A;  2AKL A;  1ZA2 B;  2FZC B;  5LJ5 f;  4E7I A;  1K1Z A;  4C92 E;  2KRN A;  2ZPE B;  2PZ1 A;  2KE9 A;  1WFW A;  2LQW A;  1YJN T;  1K9A A;  2QQB A;  2KBT A;  3L42 A;  4CC2 A;  3VU3 C;  3MEU A;  3VS1 A;  4F7U G;  2A28 A;  1ZX6 A;  4E7H A;  2D8H A;  1MV0 B;  2H3J A;  2L2P A;  1YJW Q;  5LJ3 d;  3JAM E;  2K9G A;  2XDD A;  2HQE A;  2LP5 A;  3PNW C;  3MEV A;  5LJ5 g;  2DRM A;  1UGR B;  3P8B B;  4ZTF A;  4KRT A;  2DZC A;  1J3T A;  4E7Z A;  3M55 A;  3GNF B;  3EGX A;  4FYX B;  3KXT A;  1RAG B;  2J06 A;  3CME T;  4N4H A;  1Q82 C;  5CIU A;  1QCO A;  1QW1 A;  3BE3 A;  3H8Z A;  3V8K A;  2JW4 A;  2L89 A;  4J83 A;  2O4X B;  1M5Q 1;  2QQA A;  2PU9 B;  3TRE A;  2E12 A;  2F69 A;  1M9S A;  2CP3 A;  1GCQ A;  4VUB A;  2XD0 A;  2RMO A;  2P0Q A;  1TH7 A;  2ESW A;  3CCR A;  3I35 A;  2YDL A;  5I2S A;  5GAO l;  3RBB B;  2XMF A;  4J9F A;  2PUO B;  1ZSZ C;  3OMC A;  4RTT A;  3CC2 T;  3LH0 A;  4A4H A;  4JRI A;  5GAM f;  3MKD A;  4WCI A;  3SWN A;  2K2M A;  4BDZ A;  2M02 A;  2EGE A;  2GBQ A;  2GTJ A;  2QXF A;  2B86 A;  4AFU C;  1OYX A;  2NUP B;  4AT1 B;  4M77 B;  4DEY A;  4BE2 A;  1W6X A;  4CC3 A;  2RF0 A;  2SRC A;  1OPL A;  1VQL T;  5GAM g;  2DVE A;  1G3T A;  4EMH A;  2OTJ Q;  2HSP A;  3HSB A;  3OW2 A;  1OQK A;  2DKG A;  1VQ8 Q;  5FU6 B;  3JCM Q;  3M0S A;  2P0P A;  3RIR A;  5GAN f;  2CP6 A;  1AWW A;  2L8D A;  3G6E A;  1Q82 U;  4PLL A;  5KYW A;  2NUT B;  3M0R A;  1YI2 A;  5GAO r;  3THK A;  4LDU A;  2CZ0 B;  2WAC A;  5GAN 4;  4RG2 A;  3M4Y A;  2A3L A;  2V8J A;  4JPB W;  3M58 A;  2W0Z A;  2PNI A;  5GAN g;  3H0F A;  2CYZ B;  2LTO A;  4D6W A;  1QLY A;  4EIK A;  3EH2 A;  5LJ3 e;  3OYM A;  4OMO A;  2DL3 A;  4LD9 K;  5IN1 A;  3WXM B;  4KBM B;  2AT1 B;  3VS5 A;  3C94 A;  1T3L A;  1NJI C;  2XG8 D;  5GAO q;  2M9U A;  2BZY A;  2E5Q A;  1QP3 A;  8ATC B;  2JJ9 A;  4E7L A;  1JO8 A;  3LGF A;  1ARK A;  1ZUU A;  2KRS A;  3RES A;  3CC4 A;  1VYU A;  4PL6 A;  1K0X A;  2NYS A;  3MPU B;  3OSS C;  3FLG A;  2E1H A;  3LLR A;  3CCL A;  1XJW B;  2D9T A;  4M75 D;  5LJ3 j;  5J39 A;  1M4Z A;  3BDL A;  4L5G A;  3JB9 H;  3UA7 A;  3H41 A;  2FPE A;  4QVZ A;  1UG1 A;  1GFC A;  3CCM A;  3QXE B;  5LJ3 h;  4C92 F;  5FW9 A;  2EKH A;  5CCA A;  3SFM A;  3EG9 B;  2K2V A;  2CZ1 B;  4QVC A;  2DO3 A;  1QVP A;  4IKF A;  2QDY B;  3TVT A;  3EG3 A;  1D0Y A;  1OZ2 A;  4A54 A;  1VUB A;  3G4S A;  3F70 A;  4JRK A;  1KHC A;  1QVG P;  3RNJ A;  4XU2 A;  1QVF P;  3M0Q A;  4PJL A;  1VQ6 A;  1N5Z A;  3EG0 A;  1YIJ A;  2LCC A;  1XOV A;  1OU9 A;  3QJY A;  2D0Q B;  1U06 A;  1G83 A;  2YRC A;  3CCV T;  1ZA1 B;  1S72 T;  5HKC A;  3RR6 A;  2DPP B;  4V2S A;  4F7U A;  2Z0W A;  4M77 G;  4RMO A;  4M77 C;  3OSV A;  1AD5 A;  1IGQ A;  2EQU A;  3VJP A;  3CCR Q;  2R57 A;  4X1V A;  1UGP B;  3CMA T;  1WHH A;  2DLP A;  3X26 B;  1BI0 A;  4HCK A;  1N9S A;  4R0K A;  4RCB A;  2JXB A;  1PG5 B;  3OS0 A;  1NM7 A;  1NJI U;  4BI3 A;  1KJW A;  1SKU B;  1ZHI A;  4CRI A;  1KD1 R;  2IPO B;  1R8O B;  2PVD B;  1IRE B;  1ABQ A;  2K79 A;  2LT4 A;  4N0A C;  1MND A;  5IH2 A;  3VS3 A;  5FU6 C;  1YCY A;  1HK9 A;  3VS2 A;  3E2U A;  3G1J A;  2DTO A;  2DA9 A;  4F17 A;  1VQ5 Q;  1M3B A;  3CCU T;  2DD4 A;  4NS5 A;  2JT4 A;  4M78 G;  2XDB A;  3NTK A;  2RHZ A;  1PC0 A;  2Y4X A;  5D7U A;  3URG A;  2RHI A;  3VS4 A;  2EGC A;  3CCE T;  1RAD B;  4KUL A;  1M8M A;  2KGT A;  4BDY A;  1I1J A;  1YI2 Q;  1UHF A;  4FM4 B;  4ELY C;  1ZSZ A;  2QDL A;  3M0U A;  1PHT A;  2AIR B;  3MP1 A;  2CDT A;  3HRU A;  3J81 E;  1UUE A;  3I9Q A;  4J9D A;  2FEI A;  1BI3 A;  3JCM J;  3QWY A;  5D6Y A;  3O8V A;  1RAA B;  3NTH A;  2DXC A;  1M2V B;  3QUI A;  3CD6 T;  2X51 A;  3CEY A;  2K3B A;  2DL8 A;  4K11 A;  2M51 A;  1N27 A;  3NGP A;  2EQJ A;  2RO0 A;  3M0T A;  4OB3 B;  3OY9 A;  4ZN1 A;  2ATC B;  4A4E A;  2DYB A;  2DJZ A;  3GIB A;  1TOV A;  5M9O A;  2FZK B;  3I55 T;  4WF2 A;  2EQK A;  2DER A;  2CT4 A;  1QWF A;  4PJM A;  4JS4 A;  1UJ0 A;  2MMP A;  5IT9 E;  4RUG A;  2DF6 A;  1SEM A;  3REA B;  1NPR A;  1D1C A;  2HL3 A;  2X4W A;  4J7I A;  1BIB A;  3OYD A;  3NFC A;  1U1S A;  1YHQ A;  3JB9 G;  4ATO A;  4MMK A;  1E6G A;  3RKY A;  3L2R A;  2D0N A;  4Z8A A;  1X6O A;  2RNA A;  2YRD A;  4JS5 A;  2LZ6 B;  2RM4 A;  4IUU A;  2MCN A;  5KYX A;  1LOJ A;  4DEX A;  3M53 A;  3R6O A;  3JCM d;  1KC8 R;  3CBM A;  1WXT A;  4XAX B;  2MI6 A;  2MWP A;  2JOY A;  1Y07 A;  4LD6 A;  3CCM Q;  1YJW A;  4ANJ A;  4C0Z A;  2LQK A;  2JS2 A;  2C06 A;  4PJO G;  5CKB A;  4M7A D;  1GXI E;  1PRL C;  4GLK A;  1WHJ A;  2KQW A;  2YWW A;  4KT0 E;  1T3S A;  1YJN A;  4FT4 A;  1AHJ B;  1Y7X A;  2QI2 A;  1QVF A;  2CKK A;  4ZNX A;  1TG0 A;  4ZGJ B;  2HKQ B;  2QTV A;  1VQ6 Q;  4J9B A;  3G7Z A;  1YIT A;  2GFU A;  1YIJ Q;  2HNI A;  3HL8 A;  4C0G A;  2RK1 A;  2D8J A;  3OYY A;  1WGS A;  2KK4 A;  3IQL A;  4NL3 A;  2EPD A;  2EVR A;  2E64 A;  3HFO A;  2JZ2 A;  2RI2 A;  3DLM A;  2OX7 A;  3A8L B;  2H3E B;  4FW1 A;  1AWX A;  1QCN A;  4FIB A;  1QKW A;  3CME A;  2ZPF B;  1JJ2 P;  2A08 A;  4JLI A;  5KYY A;  2QYZ A;  1IHV A;  1WZO A;  2DD5 A;  1BKB A;  3PMT A;  3EHQ A;  2LRQ A;  3M54 A;  3E9F A;  1VQ9 T;  3CXC S;  1UGQ B;  3QPH A;  2X9H A;  2A0F B;  4J7F A;  5DLO A;  5GMK e;  2XDP A;  2DFU A;  2IIM A;  1N8R R;  2FG0 A;  1LJO A;  4FYY B;  1JB0 E;  3H0I A;  4PLI A;  3CQT A;  4EMK B;  1PRM C;  1KQS P;  2GF7 A;  3RDV A;  1GFD A;  1K73 R;  2KXC A;  1KD1 C;  3OYE A;  1FMK A;  5CQX A;  3VYG A;  1JRI A;  2OAW A;  4JUV A;  3VS6 A;  3SDZ A;  2YT6 A;  2XK0 A;  4KGX B;  4RTY A;  3HRS A;  1U8R A;  2LCL A;  3GOX A;  1FMV A;  1K8A U;  5IHK A;  1NYF A;  5GMK j;  2K5L A;  1JBM A;  4HT8 A;  2F5T X;  4XK8 E;  2GQV A;  4OB0 B;  3PVL A;  3ZL7 C;  2L5Q A;  5CAI A;  2C0O A;  4BUG A;  1FX7 A;  3L2Z A;  4OF1 A;  5GMK h;  1I4K 1;  2EJF A;  3A1P A;  1AWJ A;  1M3A A;  3EHR A;  5ECA A;  4P5N A;  3A98 A;  1PKT A;  3C4S A;  1HSQ A;  1LCK A;  1VQL A;  4M4Z A;  4HT9 A;  2RB6 A;  3ZEH A;  4UC4 A;  2DIQ A;  2O88 A;  2HMA A;  2OTL T;  1NBE B;  1TXQ A;  3MEW A;  4MDX A;  1QWE A;  2E3I A;  1WIE A;  5KYU B;  1ZSG A;  5DM7 R;  4AG2 C;  2KAF A;  5GMK m;  2MOX A;  3TSW A;  1UJY A;  4M78 F;  1QMC A;  2ROT A;  4M78 A;  4QW2 A;  2J05 A;  4E47 A;  4DBQ A;  3CXC P;  2BZX A;  1RAH B;  2FHD A;  4OMM A;  2QTX A;  4E7J A;  1AZE A;  2DL5 A;  1AWO A;  1IO6 A;  1YHQ Q;  1I81 A;  4BY6 B;  1RUW A;  4LUD A;  2RK2 A;  2QA4 T;  3GPL A;  4M7A E;  2DEU A;  4CC7 A;  4LE9 A;  5FRN A;  1NE8 A;  4M75 F;  2XI9 A;  3WVD B;  1KFZ A;  4M75 A;  4OMN A;  2JM8 A;  3M0P A;  1VIF A;  3OYB A;  2ZGW A;  2YLC A;  3JCM h;  2KMT A;  1N9R A;  3QDR B;  2RQW A;  4N4I A;  2VB6 A;  1AT1 B;  2FPD A;  2KY9 A;  4XTV A;  1YJN Q;  3OYF A;  4RTW A;  1KC8 C;  2FRY A;  4F7U E;  1KG1 A;  5GAN 5;  1B34 B;  1XQH A;  2Y90 A;  2CP2 A;  2X4Y A;  1YJ9 T;  1YIT Q;  1ZUK A;  2EKO A;  2X35 A;  2DRK A;  4DOV A;  7AT1 B;  2M1H A;  3E9G A;  4Q5W A;  4EDU A;  5EG2 A;  3AHU A;  2C0T A;  2FL7 A;  1UE9 A;  1T0J A;  4XTU A;  1D3B B;  3CME Q;  1JJ2 A;  2RH2 A;  1GL5 A;  4EMK C;  3HKS A;  2LQN A;  2LCS A;  2HD0 A;  4ORZ A;  4C8Q B;  1NG2 A;  5KYN A;  1W1F A;  2I0N A;  5GAN 3;  2YLB A;  1G8X A;  4PJO A;  5KE2 A;  4ZGD B;  1UHC A;  2HDA A;  1K0S A;  5KCO A;  2LJ3 A;  3CCV A;  1S72 A;  2E41 A;  2DVJ A;  3L2W A;  5DLQ E;  4JRQ A;  1HJD A;  2L3R A;  4GLM A;  2R5A A;  3EFO B;  1UTI A;  2RJE A;  2DK3 A;  3LWH A;  1VA7 A;  1VQ5 A;  1Y96 B;  1OEB A;  5IXB A;  4M77 D;  3MP8 A;  4BB7 A;  1N8R C;  2COW A;  1TU0 B;  1K9M R;  1Z9Q A;  2E70 A;  4MZT A;  3GP8 A;  2B8A A;  3EG2 A;  1K73 C;  2YSQ A;  2X3W D;  1AEY A;  2LJ0 A;  3QJ6 A;  1VQ7 T;  1MGQ A;  1QVG S;  6AT1 B;  3J80 E;  3CCU A;  3A8H B;  1QVF S;  1VQL Q;  4AFZ C;  1I0C A;  3OYH A;  1WA7 A;  4B9X A;  2LT1 A;  1B3Q A;  4O6J A;  1BBZ A;  3EFR A;  4BY6 C;  4HKE A;  4M7D F;  1NEG A;  4HVW A;  1BI1 A;  4M7D A;  4M78 D;  2RN8 A;  5HK0 A;  4XU3 A;  4AMC A;  3JCM W;  1Y0M A;  3CXC A;  4FYV B;  1D0X A;  2OJ2 A;  3CBO A;  3CC7 T;  1H92 A;  2HEQ A;  3T9N A;  1D09 B;  4D8D A;  2ECZ A;  2FO0 A;  3CD6 A;  2KYB A;  3L1A A;  2EJ9 A;  5KCH A;  1PSE A;  4E2F B;  5L8R E;  4C5G A;  5CR2 A;  1OOT A;  1O9S A;  3ULR B;  2EYX A;  1TSF A;  2ZCF B;  4DBF A;  3BY7 A;  3UA6 A;  1TUC A;  2QAZ A;  4DA4 A;  1KK7 A;  2L3S A;  2RHY A;  3M56 A;  3I55 A;  1UGV A;  2COZ A;  1N8R U;  2V8K A;  2EAY A;  4L6V 5;  1VQK T;  1VQN T;  4M7A F;  1K73 U;  3E19 A;  1NLO C;  2F2X A;  4M7A A;  3EGX B;  2CH4 A;  4FW2 A;  3OA6 A;  2V8I A;  1SRM A;  4IIM A;  5FRO A;  1CKB A;  4C8Q G;  1NEB A;  1V29 B;  4JJC A;  4C8Q C;  3H6Z A;  2YRV A;  1VQ4 T;  5C6S A;  2XIC A;  5IHI A;  2AZS A;  2M0O A;  3JB9 D;  2CP0 A;  2JTF A;  1YNZ A;  2DM1 A;  1TUD A;  1MMA A;  1M27 C;  2BUD A;  1A0N B;  2QEX T;  1IXD A;  4J6Y A;  4F7U F;  3S3N A;  2FB7 A;  1N6A A;  2IG0 A;  3I5S A;  1SF9 A;  2JTE A;  2KT1 A;  3OBY A;  1E7O A;  2J6F A;  1PD0 A;  1I5O B;  3A5Z B;  4AFQ C;  1D1A A;  5LJ5 d;  4PJO D;  1WHG A;  4RTX A;  4RKU E;  2JUF A;  1BCO A;  1SPK A;  3OS5 A;  3CCQ A;  2HBW A;  1JU5 C;  3X24 B;  5FWC A;  1SHF A;  4DOW A;  1VQP T;  4J8O A;  3FJ5 A;  3FJP A;  2X4X A;  1UDL A;  3CCV Q;  1X2Q A;  1S72 Q;  3SWN B;  4M77 E;  2BIV A;  2GCX A;  3QYG B;  3L2U A;  3KFV A;  1QCF A;  1VQO T;  4R55 A;  4JRP A;  2L3P A;  1I07 A;  1MMD A;  4FT2 A;  3QO3 A;  4RTU A;  1VQ9 A;  3M57 A;  4FCY A;  3G71 T;  4LN2 A;  1BYM A;  1WDX A;  4OGC A;  4QQ6 A;  1TS9 A;  3VS7 A;  1WHL A;  1RL2 A;  3PIP A;  5I21 A;  4B9W A;  2RQR A;  3G6E T;  2K3Y A;  2CZ6 B;  3HP9 A;  3U23 A;  2KYM A;  2XU8 A;  3DLL A;  4OVA A;  3CCU Q;  5KYW B;  4X9C A;  1R77 A;  4OMP A;  1X01 A;  3O5Z A;  4M78 E;  1K9M C;  4Y28 E;  2O9S A;  1ZBX A;  3H0H A;  1FMW A;  3V7R A;  2D6F A;  2A37 A;  2CT3 A;  1RI0 A;  2DBK A;  2BTT A;  4DBH A;  1QQJ A;  5LJ3 f;  3ZBD A;  4ELZ C;  1WYX A;  4PK4 A;  4M7D D;  2QQS A;  4ZN3 A;  5L23 A;  2EQI A;  4XTW A;  4BE0 A;  1NPP A;  1JJ2 S;  1KSW A;  5GAM d;  5FWB A;  1FXX A;  2EIF A;  3OYI A;  1Q7Y R;  2BKD N;  4M75 E;  2W10 A;  1X27 A;  2RQT A;  2RJC A;  1DJ7 B;  1LPL A;  5LJ3 g;  2OAU A;  3CC4 T;  2OTL A;  3CD6 Q;  2KEA A;  4HXJ A;  2M16 A;  3I56 T;  3CCL T;  1RI9 A;  1G3Y A;  4HCZ A;  1AVZ C;  1G3S A;  2HQH A;  3JRZ A;  2ZPB B; 
#chains in the Genus database with same CATH homology
 1LCK A;  2K2M A;  4M4Z A;  2O2O A;  2EGE A;  2GBQ A;  2GTJ A;  2B86 A;  4AFU C;  2O88 A;  1V1C A;  1QWE A;  4DEY A;  1WIE A;  1W6X A;  1AZG B;  1ZSG A;  2CSQ A;  1WI7 A;  4CC3 A;  2RF0 A;  2SRC A;  4AG2 C;  2AZV A;  1E6H A;  2DL7 A;  4D8K A;  1HD3 A;  2CSI A;  1PKS A;  2MOX A;  3TSW A;  1OPL A;  1UJY A;  3UAT A;  1GCQ C;  2ROT A;  2J05 A;  2HSP A;  4ESR A;  4Z88 A;  1H8K A;  2D1X A;  4AG1 C;  2BZX A;  4OMM A;  3M0S A;  2LX7 A;  1AZE A;  1AWW A;  2DL5 A;  5I11 A;  1AWO A;  4OML A;  1IO6 A;  1OPK A;  2KRO A;  4J9H A;  1RUW A;  3M0R A;  4LUD A;  3THK A;  2KT8 A;  1M30 A;  2C0I A;  2CUB A;  4CC7 A;  3UF4 A;  2LNH B;  1SSH A;  4LE9 A;  2RQV A;  1K4U S;  1KFZ A;  4JPB W;  2LJ1 A;  2W0Z A;  2GNC A;  2PNI A;  4OMN A;  1X2K A;  2JM8 A;  3M0P A;  3H0F A;  1K76 A;  2RQW A;  1X6B A;  1X6G A;  1QLY A;  2DIL A;  2FPD A;  5GJW B;  1JXO A;  4EIK A;  2K6D A;  4RTW A;  4OMO A;  2DL3 A;  2YUQ A;  2FRY A;  3VS5 A;  1T3L A;  4JJB A;  2FPF A;  2ROL A;  1T0H A;  1ZUK A;  2BZY A;  1JO8 A;  2DRK A;  1ARK A;  1ZUU A;  2EGA A;  2KRS A;  1AOJ A;  1WLP B;  1VYU A;  3PVQ A;  1K0X A;  2C0T A;  1SHG A;  2AKK A;  1UE9 A;  1T0J A;  2KXD A;  2M0Y A;  1VYV A;  4Y92 A;  1JXM A;  2VVK A;  1KIK A;  4JZ4 A;  1GL5 A;  2LQN A;  2LCS A;  3UA7 A;  3H41 A;  4LNP A;  4ORZ A;  2FPE A;  2L3Q A;  1UG1 A;  1GFC A;  1NG2 A;  2HCK A;  1CKA A;  2KNB B;  4Z89 A;  1W1F A;  2I0N A;  2EKH A;  5FW9 A;  1B07 A;  4LUE A;  2H8H A;  1UFF A;  3TVT A;  1YWP A;  4HVU A;  1ZUY A;  1UHC A;  3EG3 A;  5I22 A;  2RQU A;  2HDA A;  1K0S A;  2DNU A;  5EC7 A;  2LJ3 A;  1UEC A;  2V1R A;  2EBP A;  2DL4 A;  1VYT A;  3RNJ A;  2DVJ A;  3M0Q A;  2J7I A;  1N5Z A;  3REB B;  1HJD A;  1NYG A;  4GLM A;  3SEM A;  2BZ8 A;  3EG0 A;  3EGU A;  4RTZ A;  1XOV A;  1UTI A;  1PWT A;  1M3C A;  2PTK A;  1VA7 A;  1U06 A;  3PE0 A;  1G83 A;  4JZ3 A;  1OEB A;  2GQI A;  5GJV B;  5IXB A;  3NPF A;  2V1Q A;  1Z9Q A;  4F14 A;  3EG2 A;  1AD5 A;  4X1V A;  2F2W A;  2DLP A;  2YSQ A;  2X3W D;  1Y57 A;  1EFN A;  2DMO A;  4HCK A;  4R0K A;  1AEY A;  2JXB A;  2LJ0 A;  4F16 A;  1NM7 A;  2ENM A;  3I5R A;  2EYZ A;  1ZBJ A;  2JMC A;  4FSS A;  1KJW A;  2FRW A;  3NMZ C;  4AFZ C;  1WXB A;  2OI3 A;  1I0C A;  1ABQ A;  1WA7 A;  2K79 A;  2E5K A;  5IH2 A;  1Z9Z A;  2NUZ A;  1OV3 A;  3VS3 A;  4IIO A;  2X3X D;  2JM9 A;  3VS2 A;  4HVV A;  1B3Q A;  1BBZ A;  1G2B A;  2DBM A;  3LH5 A;  2CH4 W;  2CUD A;  2DA9 A;  4F17 A;  2MIO A;  1NEG A;  1M3B A;  1GBQ A;  2ED1 A;  1SRL A;  4HVW A;  3SHW A;  5IXF A;  1YWO A;  2DX1 A;  2JT4 A;  3TSZ A;  2RN8 A;  1Y0M A;  3VS4 A;  2OJ2 A;  2EGC A;  1FYN A;  3GBQ A;  3EG1 A;  2EYW A;  1H92 A;  2HEQ A;  1JQQ A;  2J6K A;  1M8M A;  5HCK A;  2JMA A;  2KGT A;  2LMJ A;  1MV3 A;  2ECZ A;  1MUZ A;  3VRY A;  4D8D A;  2FO0 A;  2KYB A;  1I1J A;  1X69 A;  1UHF A;  2K7A A;  1RLQ C;  2JS0 A;  2QDL A;  3M0U A;  1U5S A;  1GBR A;  1PHT A;  4J9E A;  3VS0 A;  2CDT A;  1CSK A;  1YCS B;  1OOT A;  1UUE A;  3I9Q A;  4J9D A;  2FEI A;  1JEG A;  1BK2 A;  3QWY A;  3ULR B;  2EYX A;  3VRZ A;  2F2V A;  3UA6 A;  1TUC A;  2GTO A;  2L3S A;  1WX6 A;  1UGV A;  2L0A A;  2K3B A;  2DL8 A;  2O9V A;  4K11 A;  2M51 A;  3NGP A;  2P4R A;  1YN8 A;  2RPN A;  3M0T A;  1S1N A;  5IHN A;  1NLO C;  2F2X A;  2SEM A;  2DYB A;  2CH4 A;  2ABL A;  1SRM A;  4IIM A;  1CKB A;  2CT4 A;  1QWF A;  1NEB A;  4JJC A;  1UJ0 A;  2KR3 A;  4RUG A;  2DF6 A;  1BB9 A;  1SEM A;  2EW3 A;  5IHI A;  3REA B;  1H3H A;  1W70 A;  2AZS A;  2AK5 A;  1YNZ A;  2DM1 A;  1TUD A;  1BU1 A;  2KRM A;  4AFS C;  1M27 C;  1E6G A;  2D0N A;  4Z8A A;  4OMQ A;  1A0N B;  2RNA A;  2LZ6 B;  2MCN A;  3I5S A;  2YUP A;  4DEX A;  2JTE A;  2KT1 A;  1ZLM A;  1E7O A;  2J6F A;  1WXT A;  4AFQ C;  2YUO A;  3JV3 A;  1GCP A;  2JS2 A;  1X43 A;  4RTX A;  1YP5 A;  1SPK A;  3QWX X;  2HBW A;  1JU5 C;  1PRL C;  1RLP C;  5FWC A;  2GGR A;  1SHF A;  2G6F X;  3FJ5 A;  1T3S A;  4JJD A;  1WXU A;  1UDL A;  1X2Q A;  1PNJ A;  4RTV A;  1NLP C;  4ZNX A;  1TG0 A;  4A63 B;  2J6O A;  4J9B A;  2AKL A;  4J9I A;  1K1Z A;  4CC4 B;  3KFV A;  2KRN A;  2D8J A;  2PZ1 A;  1U3O A;  1QCF A;  2KE9 A;  1WFW A;  2CRE A;  2LQW A;  3IQL A;  1K9A A;  2L3P A;  1I07 A;  2KBT A;  2EPD A;  2EVR A;  4RTU A;  4CC2 A;  4LN2 A;  4QT7 A;  3VS1 A;  1WDX A;  3C0C A;  3VS7 A;  1AWX A;  2A28 A;  1ABO A;  1ZX6 A;  4E6R A;  1QKW A;  2D8H A;  1MV0 B;  2L2P A;  2A08 A;  2K9G A;  3NHN A;  2RQR A;  2LP5 A;  1GRI A;  2DRM A;  3EHQ A;  2VKN A;  3U23 A;  2KYM A;  4KRT A;  1J3T A;  4OMP A;  3O5Z A;  2ED0 A;  2O9S A;  2J06 A;  3H0H A;  2IIM A;  2A37 A;  2CT3 A;  2O31 A;  4J9C A;  2DBK A;  2BTT A;  2FG0 A;  1QKX A;  2JW4 A;  3H0I A;  3CQT A;  1PRM C;  1GFD A;  2A36 A;  1WYX A;  2KXC A;  5L23 A;  1FMK A;  2EQI A;  2DJQ A;  1KSW A;  5FWB A;  2OAW A;  3R6N A;  3VS6 A;  1GCQ A;  2YT6 A;  2YUN A;  4RTY A;  4J9G A;  5IHK A;  1NYF A;  2W10 A;  2DE0 X;  1X27 A;  2RMO A;  2NWM A;  2RQT A;  2ESW A;  2VWF A;  3PVL A;  3ZL7 C;  3I35 A;  2EYY A;  2YDL A;  2KEA A;  4HXJ A;  3RBB B;  2XMF A;  2C0O A;  4J9F A;  1RI9 A;  4RTT A;  1AWJ A;  1M3A A;  3EHR A;  5ECA A;  1AVZ C;  3A98 A;  1PKT A;  4GBQ A;  4WCI A;  1HSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...