1SHGA

Crystal structure of a src-homology 3 (sh3) domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytoskeleton
molecule keywords ALPHA-SPECTRIN SH3 DOMAIN
publication title Crystal structure of a Src-homology 3 (SH3) domain.
pubmed doi rcsb
source organism Gallus gallus
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1993-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1shgA00
3UA6A 3EG3A 4RTVA 2FPEA 4Y92A 4WCIA 1EFNA 5IXBA 1YP5A 1MUZA 4AG2C 1X43A 4F14A 2O88A 1WYXA 1MV0B 2JW4A 1WXBA 2CSQA 3M0UA 2EYXA 1B3QA 1SSHA 1KJWA 1ABQA 2FPFA 3PVQA 4X1VA 1UJYA 1BK2A 3IQLA 4IIMA 3H0HA 2EYYA 4RTXA 3VS6A 4R0KA 4RTUA 4E6RA 1NYGA 1M3AA 2L2PA 3M0PA 2OJ2A 1GL5A 1QKWA 2HDAA 2LJ0A 1W70A 2EGAA 1X6GA 2O2OA 5GJWB 2CREA 1NLOC 1NG2A 2LJ3A 1UG1A 4K11A 1UJ0A 1QKXA 1UTIA 3RBBB 1ZSGA 1HJDA 1ARKA 2YUQA 2F2VA 1WLPB 2GGRA 4Z8AA 2CH4W 1M8MA 4AFZC 5GJVB 2C0OA 4LN2A 1CKAA 2RPNA 4ESRA 4J9FA 4LNPA 2A36A 2ENMA 4QT7A 3PE0A 1X2QA 2LP5A 2W10A 4HXJA 1H3HA 1Y0MA 2OI3A 2VKNA 3TVTA 1J3TA 2AKKA 5IHKA 1AEYA 5HCKA 4D8DA 2KXDA 4J9GA 2QDLA 1ZUKA 1NEBA 2M0YA 2HBWA 1PWTA 1ZLMA 5IH2A 1GBRA 2YUNA 2IIMA 2LMJA 3TSZA 1YCSB 2DA9A 2BZYA 1CKBA 1WDXA 1K0SA 2EGEA 1E6GA 4J9CA 3VS0A 4J9IA 2DYBA 2PZ1A 1H8KA 1PNJA 2VWFA 2LJ1A 3RNJA 3M0QA 2A08A 1OPKA 1UFFA 2C0IA 2A28A 1QLYA 2AZSA 1GCQA 3A98A 1JXMA 2J05A 2EPDA 3M0SA 2ABLA 5ECAA 3REBB 1XOVA 2BZ8A 1NEGA 4AFQC 4CC2A 1WX6A 3QWXX 2DM1A 2DBMA 2O9VA 1QWEA 2DILA 4RTTA 2X3WD 1AZEA 2AKLA 1E7OA 2BZXA 1JQQA 1WIEA 1M27C 4CC7A 2DRKA 2KXCA 2ESWA 2MIOA 4A63B 2X3XD 1K0XA 2W0ZA 3SHWA 3PVLA 1AVZC 1I1JA 2CH4A 2YSQA 3NPFA 2EGCA 2DLPA 4EIKA 2GTJA 3UATA 1AOJA 2RQTA 3C0CA 3ZL7C 1YN8A 1T3LA 4RTZA 2KNBB 1T3SA 2VVKA 3JV3A 2NUZA 2K79A 1AWJA 2GBQA 2EYWA 3H0FA 2XMFA 2DL8A 3I5RA 3VS2A 4JZ3A 2YUOA 1VA7A 1KSWA 2D8HA 3VS3A 1U06A 4LUDA 2DL5A 2M51A 2P4RA 1B07A 2DJQA 1NM7A 1UGVA 2V1RA 2J06A 1Z9QA 4Z89A 2D8JA 1W1FA 4CC4B 1YNZA 3ULRB 4J9EA 2DE0X 1KIKA 4OMOA 2D0NA 2ROTA 1BU1A 2V1QA 3QWYA 1E6HA 1GCQC 2J7IA 4GLMA 1AWOA 3NGPA 2L3QA 1V1CA 3NMZC 1FYNA 2ROLA 3REAB 4J9DA 1G83A 4RTYA 2KT8A 1K1ZA 1Z9ZA 2GQIA 1JU5C 2E5KA 2FRWA 2SRCA 3EG0A 1X69A 4HVVA 1SPKA 2J6FA 2DL7A 1CSKA 1AWWA 2FEIA 1QWFA 1HD3A 4LE9A 1X6BA 1VYTA 2AK5A 3FJ5A 2EBPA 2CDTA 5L23A 1WXUA 3M0TA 1JEGA 2HEQA 2DNUA 1OOTA 1SHGA 2L3SA 2RQWA 4CC3A 1SRMA 1AZGB 4Z88A 1K9AA 1QCFA 1VYUA 3VS5A 2LZ6B 2RQUA 2DL4A 2JMCA 2RMOA 1UHFA 1VYVA 3U23A 1WI7A 2HCKA 2F2XA 2DF6A 3SEMA 1M3BA 1OEBA 4F17A 4DEYA 1T0HA 2RQRA 2YDLA 1S1NA 3NHNA 3I5SA 1ZUYA 1UE9A 2FO0A 1GFDA 2D1XA 3R6NA 2JT4A 4JJCA 4AG1C 2CUBA 2KT1A 1NYFA 1SRLA 2OAWA 1HSQA 2O9SA 2RNAA 2JS2A 4J9HA 1K4US 3VRYA 2DX1A 4JPBW 3UF4A 2JMAA 4ZNXA 1I0CA 2K2MA 4HVWA 4IIOA 1TG0A 2K7AA 2MOXA 3H41A 4HCKA 2AZVA 2J6KA 1A0NB 1SEMA 2DRMA 2KGTA 1JO8A 2JM8A 5FWCA 2L0AA 1PHTA 2I0NA 1WFWA 2K3BA 2LNHB 2DBKA 2EYZA 3EHQA 2DL3A 2RQVA 2LX7A 2O31A 1FMKA 1GBQA 1SHFA 2EKHA 4JJDA 1RUWA 2LQWA 1BBZA 3VRZA 1PKSA 2KROA 1UECA 4ORZA 1AWXA 4JZ4A 2KRSA 1OPLA 3EHRA 2RF0A 1KFZA 2K6DA 2KBTA 4HVUA 1X2KA 2KYBA 1OV3A 4AFSC 2EVRA 3EG1A 2NWMA 1LCKA 3I9QA 5I22A 4AFUC 1UUEA 5IXFA 4JJBA 3VS1A 3VS4A 4RUGA 3O5ZA 2MCNA 2JTEA 3UA7A 2G6FX 1YWPA 2HSPA 4OMLA 2LQNA 3KFVA 2SEMA 2A37A 1TUCA 2CT4A 2ED0A 2C0TA 2ED1A 5IHIA 1ZUUA 5IHNA 4D8KA 4LUEA 1BB9A 1Y57A 2YUPA 2F2WA 1H92A 2DMOA 1K76A 3M0RA 4M4ZA 1M30A 1UDLA 3TSWA 2FPDA 3I35A 3THKA 4FSSA 1RI9A 1GRIA 2EW3A 2J6OA 1U3OA 4J9BA 2KRNA 2ECZA 4F16A 5FWBA 2L3PA 5EC7A 1GFCA 2KEAA 1PRMC 1ZBJA 1X27A 2PTKA 2GTOA 4OMPA 2K9GA 1YWOA 4KRTA 4GBQA 1PRLC 4DEXA 1RLPC 2CUDA 1UHCA 2FG0A 4RTWA 2KR3A 1W6XA 1PKTA 2EQIA 1M3CA 3EGUA 5I11A 1ABOA 2PNIA 1WXTA 2CSIA 3VS7A 2BTTA 1U5SA 1G2BA 4OMNA 3H0IA 3LH5A 2H8HA 2FRYA 1AD5A 1NLPC 1WA7A 2LCSA 1IO6A 2B86A 2JS0A 1T0JA 1ZX6A 2RN8A 2YT6A 2GNCA 1N5ZA 1GCPA 2JM9A 2DVJA 2CT3A 1JXOA 1MV3A 3EG2A 1I07A 3CQTA 2KRMA 5FW9A 4OMQA 1TUDA 2KYMA 4OMMA 3GBQA 2KE9A 2JXBA 1RLQC
chains in the Genus database with same CATH superfamily
3OS0A 3META 2FPEA 4WCIA 2DXUA 2DZ9A 1NZ9A 3M0UA 1B3QA 1WNLA 1KJWA 2M02A 1ABQA 4OP0A 1IXDA 2DXCA 2QQRA 3EH2A 4BE1A 3EFOB 4X1VA 3NTIA 3IQLA 2COZA 2ZPIB 4R0KA 3VKIA 4RTUA 4PJOC 1M3AA 3KXTA 1GL5A 3EAEA 2AT1B 1FXXA 3CCUT 3G71Q 1QQJA 1VIEA 4KGVB 5GJWB 3CCUA 2CREA 1NG2A 1UG1A 1I81A 4II1A 4B9WA 1HJDA 5KYNA 1MMAA 1IGQA 1VQOT 3M55A 4AFZC 3M9QA 4ESRA 4E7LA 2E64A 5IAYA 2MF2A 2IVWA 1I5OB 4QT7A 5FU7B 2Y90A 4BDZA 2OTLA 1HXDA 3OYKA 3UWNA 3OW2A 4BI4A 2O01E 4D8DA 5GANe 5GAMj 2QDLA 1ZUKA 5KE3A 4IUVA 4AMCA 4MMKA 4PFPA 3QBYA 2MMPA 1KQ1A 2IIMA 1YCSB 2KAFA 4M7DC 4KBMB 2OTJT 3D7SB 1CKBA 2E10A 1BI3A 2EGEA 2ZZDA 4J9CA 2QG9B 4JRQA 2A08A 1OPKA 4E7IA 1BKBA 3A98A 2JOYA 2VV5A 1X01A 3UT1A 4M75A 4OGEA 2E6NA 2LCCA 1Q86U 4AFQC 3X25B 4CC2A 2OTLQ 4M75E 4C0DC 1D1CA 1YJWT 1VQNA 1UGSB 3HTRA 1QWEA 2DILA 2AKLA 2K3YA 5J39A 2O4XB 2MIOA 2FB7A 5FRNA 3PVLA 2PVGB 1PG5B 2CH4A 2R5MA 4EIKA 5LJ3j 3BDLA 4A4HA 2XDBA 3WVEB 3V7RA 3C0CA 4C0GA 2QQ9A 1YN8A 2XI9A 1LNXA 1T3LA 3MP1A 5LJ5e 1T3SA 4BE2A 1KQSS 5GMKi 1KC8U 4MZMA 2FZKB 2XMFA 2DL8A 5FRMA 3VS2A 1Y96A 2E3IA 2P0PA 2ZPGB 4LUDA 2CP2A 2NUTA 1VQNQ 1UGVA 2V1RA 3M54A 1M1KR 2LQ8A 4O6JA 1VQKT 1W1FA 2RI5A 2DJZA 3RKWA 3X24B 3NFCA 4OMOA 5J3BA 1BCOA 2D0NA 5FROA 1E6HA 2AIRB 3OYHA 1AWOA 2XICA 5HK3A 3OYYA 4A54A 5LL6S 5GAOn 4RTYA 4F7UE 1OYXA 1K1ZA 2KT8A 3QJ6A 3F70A 2FZGB 4HVVA 3ZFJA 1AHJB 2ATCB 2C06A 1QWFA 3E19A 3HPWA 1RAGB 1VYTA 4C92B 5GAMf 1G3SA 2RHUA 1VQ7T 1QP2A 1VQ7A 4JUVA 1FX7A 2OX7A 3CCMA 2RQWA 2LT4A 1SRMA 3MHXA 1AZGB 3C12A 3OYCA 3VS5A 1K9MR 4C8QD 2WSFE 2RMOA 3CXCA 3OW2S 2DF6A 3SEMA 1M3BA 1S1NA 3NHNA 4KGZB 4C5IA 1GFDA 4M77G 1G5VA 2QAZA 4AG1C 3HKSA 2KT1A 3M58A 2OAWA 2JS2A 2COWA 3LGLA 3VRYA 4C8QF 3CPWA 4JPBW 3CCJA 1I0CA 4JLGA 4HVWA 4QVCA 3BY7A 2YHTA 4M78F 3JCMg 3CCMQ 1SEMA 2KGTA 2XU8A 4DOWA 2WACA 1OQKA 2L0AA 1PHTA 1M1KC 3MCAB 2RHXA 2K3XA 5KYWA 1Q81U 5LJ3f 1R0BG 2F69A 3M4YA 4N4GA 2FZCB 3SWNC 2DL3A 2LX7A 1GBQA 4OGCA 1VQMT 4IUTA 3JB9D 1VQMA 1RUWA 2PVOB 2KROA 1G3TA 1UECA 5GAN4 1YITT 1AWXA 4ZTJA 4JZ4A 2CS7A 3EHRA 4EMKC 3VV0A 1OV3A 4AFSC 5EG2A 4OMFB 1Q82R 5KYXA 4E2FB 3OBYA 3J7AF 2YRDA 5LJ3h 1VQ4T 4FSXA 3QZ5B 4M7AA 4PJMA 3VS4A 1EX4A 3C95A 3CCJQ 3O5ZA 3UA7A 2G6FX 4E47A 1YWPA 3JCMJ 3JB9F 3BDUA 4ATOA 4JJNK 4M7AE 2LX9A 3JAME 4EMGA 4E7ZA 4JS4A 3CC2T 5GMKj 1VQLA 2A37A 1QVFA 4BACA 2RJCA 4D8KA 1Y57A 4N4HA 1VQ8T 4PFZA 3HRTA 1U8RA 1VQ8A 1H92A 1K9MC 5GAOl 1K76A 4DOVA 4Y28E 4LDVA 5CKDA 2FPDA 4M77C 1M90R 1K8AU 1GRIA 4XU2A 2GFUA 2KRNA 5FWBA 1IHWA 5EC7A 3M56A 3QPHA 3M5AA 5I21A 2K9GA 2LNVA 4PJOA 3MJXA 3CCRT 1H641 2FG0A 2I2LA 1QVPA 5FU6B 3MPUB 3EGUA 2KY9A 1VQLQ 2PNIA 4NOYA 4DBHA 2JNGA 4ELYC 2BTTA 1U5SA 1G2BA 4OMNA 2MAMA 1PD0A 1VQ8Q 3QYHB 2L89A 3LH5A 2FRYA 3A8LB 1AD5A 4HT9A 3R6OA 5IN1A 3TU4K 2ZPFB 3RMSA 3LGFA 5A2QE 1ZSZB 1OI1A 2FHDA 2YT6A 1D0XA 2JM9A 1MV3A 5GMKl 2K57A 3E9FA 3CQTA 5FW9A 3CXCS 4OMQA 2QXFA 3L2UA 3GBQA 3JRZA 3ASKA 4FYVB 3MEUA 3ZEHA 4DBQA 2VASA 2E3HA 1RL2A 1ACMB 3EG3A 2R5AA 2LVMA 2VUBA 1EFNA 3X28B 4ZN3A 5IXBA 3L2VA 1JJ2A 4M7DA 1YP5A 1MUZA 4AG2C 2O88A 3CBMA 2JW4A 2XG8D 1WPYA 2KDSA 2EYXA 1SSHA 3NTHA 3CPWS 3PVQA 3FC3A 2DIGA 1KG1A 4IIMA 3H0HA 3J81E 4L6V5 4OVAA 2VXFA 3LH0A 3QO3A 4DQ2A 2E70A 3EG9A 1QKXA 2MWPA 1RADB 1UTIA 1MMGA 1TTHB 2YUQA 4FU6A 5D6WA 2GGRA 1M8MA 1N6AA 1S72A 2C0OA 4LN2A 1WQWA 1YI2A 4J9FA 4LNPA 5GAOp 3PE0A 1X2QA 2G3RA 4M78E 4HXJA 4FT4A 3QXEB 1H3HA 4NL2A 2OI3A 4RCBA 2AKKA 5IHKA 1AEYA 2M9UA 4QQGA 4EPCA 3C94A 2HQHA 2K2VA 2KXDA 2P0QA 2M0YA 3EGXA 1IGUA 1D0YA 1IZ6A 2EQKA 2RJFA 5GMKh 1PWTA 1YJNT 1QVFS 2YUNA 1YJNA 1LVKA 2QEXT 2EYQA 1YHQA 1WDXA 3CMEA 5KE2A 1TSFA 3I56A 1E6GA 3VS0A 4PKCC 2DYBA 5GAMe 1PNJA 4PLIA 2F5KA 3RNJA 5C6SA 1S72Q 1UFFA 2MYSA 3CCLT 2AZSA 1JXMA 1YI2Q 1LOJA 2EPDA 2BIVA 3M0SA 3G1JA 4LDUA 1I4K1 1XOVA 2BZ8A 2F1LA 1WX6A 2DM1A 3T9NA 4KUIA 4RTTA 1AZEA 2HSEB 2BZXA 4BB7A 1JQQA 1W4SA 1WIEA 5KYUA 2DRKA 3OYNA 1ZBXA 2ESWA 1D3BA 2X3XD 3JCMW 2DXTA 3SHWA 2EQUA 2CP5A 3EH1A 2EGCA 2K5IA 2DK3A 3SB2A 3J80E 1YHQQ 1G3YA 1WQ7A 2GTJA 3CMEQ 1PCXA 1TS9A 3I56Q 2RK1A 3QG1A 3ZL7C 4JDSA 1GXIE 4C5HA 2KNBB 4C0FA 1K8AC 2M0OA 4C92D 1QW1A 3FEOA 2K79A 1LJOA 4XK8E 2HQXA 4JZ3A 2YUOA 1VA7A 2KI7A 4C8QG 2QQSA 1U06A 3PFSA 1XNIA 5LJ3e 2M51A 1B07A 2X4JA 1SKUB 3M59A 3CCVT 4M78G 2BKDN 2D8JA 4CC4B 4MZTA 3OYEA 4C92F 1JJ2S 1VQ5T 1VQOA 1KIKA 2WSEE 3QWYA 3OYJA 2YRCA 1GCQC 1RAAB 1YIJT 1V1CA 1M1KU 1FYNA 2ROLA 1G3WA 1LPLA 3REAB 4J9DA 3UDCA 2L5QA 3PMIA 3AT1B 1O75A 5CKEA 1JU5C 4EMHA 4B6MA 3SWNA 3PGGA 1M9SA 1CSKA 3JCMP 3TEEA 3HFOA 4DBRA 1HD3A 2YXYA 1X6BA 2DZCA 4L59A 3FJ5A 2CDTA 4ZGEB 5L23A 1WXUA 5GANg 3RERA 3CCUQ 1NE8A 2HEQA 2L8DA 4BUGA 1NBEB 2DKGA 4EMKA 1OOTA 2OTJA 3JB9G 4J7IA 4PNOA 1WHMA 2HBPA 1RAHB 4M75B 3MP6A 1VYUA 1VQOQ 2XDPA 3BE3A 2QA4T 2RQUA 2P84A 2K5FA 4IKFA 3RKYA 4XU3A 7AT1B 2VXEA 1OEBA 3RUXA 3PMTA 1K9MU 1ZUYA 1UE9A 3OYDA 2WSCE 2QTXA 1YJWA 4C5GA 2CP6A 3L2RA 1BCMA 4PL6A 1NYFA 2HNIA 4C8QC 4BI3A 3DB4A 4J9HA 4M77A 2BUDA 2QQAA 2DX1A 2JMAA 1RACB 4M78C 1VQ6T 1TG0A 2HMAA 2K7AA 4P5NA 4M77E 3VJPA 3Q1JA 2AZVA 4DBFA 2OTJQ 2DRMA 3CBOA 1JO8A 3CCET 1D09B 2K3BA 4E7HA 1DJ7B 1Y96B 2X51A 2HL5C 2K4YA 1FMKA 2NUTB 1M2OA 1SHFA 4PJOD 2EKHA 2LQWA 3VRZA 4BD3A 1N8RR 5LJ5g 2CP7A 2RO0A 4ORZA 5CIUA 3JCMd 1UGQB 1YBYA 4BY6B 1YJWQ 2K6DA 2GQVA 2E5QA 2RHZA 1X2KA 2KYBA 4BE0A 3EG1A 2NWMA 1LCKA 3ME9A 3INZA 4PFOA 5GAN8 1VQKA 3KUFA 4JRKA 2CYZB 5IXFA 2DVEA 1W2BA 4RUGA 2MCNA 2JTEA 2DTHA 1H3ZA 4F7UA 1UGRB 1MMNA 3ER0A 2R57A 1F1BB 1M2VA 1V76A 2EJGA 2JZ2A 3VUZA 3G4ST 3OMCA 4LDWA 2CT4A 2ED0A 4N0AC 4ZTFA 2ED1A 2RJDA 2X4WA 2PVDB 1BIBA 2X9HA 3CC7T 1YCYA 1MNDA 3CC7A 4PLLA 3M0RA 3CEYA 3MP8A 3TSWA 3HRUA 1FWZA 4FSSA 5CQXA 2MK5A 5GAOm 2QQBA 2FYKA 2J6OA 4M7DD 1U3OA 1BI2A 3VU3C 2DETA 4XU0A 2ECZA 4F16A 2L3PA 5GMKe 1YJ9T 2KMTA 2E41A 1M90U 5A0LA 1X6OA 2DD4A 2KQWA 1VQKQ 4RG8A 1VQPT 2LDMA 1YWOA 3H8ZA 3P8BB 4GBQA 3E1SA 4J6YA 2YWWA 4DEXA 4LDXA 1UHCA 4KT0E 3OA6A 1W6XA 3JCMV 3M4GA 5CKFA 4BI8B 4ELZC 1TUGB 1TWBA 3BFMA 5DM7R 5HK0A 4TVRA 2DTIA 3CCQT 1ZA1B 3CCQA 2H3JA 4ZN1A 1KQSP 2KK4A 1NLPC 1WA7A 4JS5A 2OAUA 2KSSA 3L42A 5GAN2 1KQ2A 2B86A 2JS0A 4OB3B 1VQ7Q 4FYXB 3RDVA 5KYWB 1GCPA 2CZ7B 2DVJA 4FYYB 3OYIA 1MGQA 2KRMA 1JBMA 4O5VA 3QZ9B 2GFAA 3VUBA 2PU9B 5KYYA 2CKKA 5GMKm 1TOVA 2PUOB 2XD0A 5CR2A 4Y92A 9ATCB 1YITA 4XAXB 3JB9H 2JTFA 5KYXB 2CSQA 2DIQA 3E2UA 4BDYA 4M7AB 1IHVA 1JRIA 3QHSA 2FPFA 1KHCA 1UJYA 2V8JA 2ZCFB 5FU7C 3LX7A 3TQ7P 4C5EA 5KCOA 4IUUA 1VQ4A 1WHKA 4IUPA 4E6RA 1NYGA 1IB8A 1IREB 1OU9A 3M0PA 2HDAA 2NLUA 2LJ0A 1W70A 2EGAA 4V2SA 2O2OA 1NLOC 5IT9E 2LJ3A 3DLLA 1C0MA 3VYHB 3RBBB 3EGDA 3CC2A 1ZSGA 2HAXA 1G8XA 2F2VA 3VYGA 1M4ZA 1WLPB 4Z8AA 2CH4W 4GY5A 1NPPA 1KD1R 5FLXE 2K5LA 1VQMQ 3QIIA 5HKCA 1YITQ 5D7UA 4IUQA 1M1FA 1AT1B 1N9RA 1Y0MA 1D1BA 3V7SA 2VKNA 3TVTA 1D1AA 1B34A 1WZOA 3QKJA 1W2BS 4PJOB 2XKOC 3OYAA 1ZA2B 2IG0A 3G6ET 4J9GA 4J6WA 1VQ4Q 4FYWB 3I55T 2Y4XA 2A0FB 1B7TA 4C92G 1ZLMA 3CCRA 3TSZA 2DA9A 3A8HB 1Q95G 3CC2Q 3SFMA 1BYMA 1IRXA 4J9IA 4Q5WA 2A28A 2C0IA 1QLYA 1GCQA 1TU0B 2J05A 3OYMA 2E65A 4XTZA 3REBB 3CCST 4X9DA 1XQHA 4N4IA 2AHJB 1EZZB 1NPRA 1QVGP 3EFSA 3OQ5A 3WXMB 2RJEA 2X3WD 1E7OA 1Q82C 3GOXA 1M27C 4CC7A 3QJYA 1K0XA 4M7DB 4HCZA 1AVZC 3NPFA 3CCRQ 2RK2A 5LJ5f 2YRVA 1Y71A 5CVIA 1PC0A 4FM4B 3UATA 2RQTA 3M53A 4VUBA 4L5GA 3CC4T 3CC4A 1BI0A 2HKQB 1MHNA 2MPXC 1PD1A 1N27A 2PQWA 1P92A 3GLXA 1N9SA 1AWJA 2GBQA 1KD1C 2EYWA 3H0FA 3FIFA 3I5RA 1VQ9T 3EG9B 4M75D 5LJ5h 1M90C 3GIBA 3TCJA 3CD6T 3CD6A 4E7JA 4MDXA 1NM7A 2J06A 3OB9A 4Z89A 4C8QA 4C92C 4J9EA 2DE0X 4FIBA 2RM4A 2X35A 1BU1A 2V1QA 3GP8A 2E6ZA 4C8QE 4M78A 2J7IA 4GLMA 2L3QA 3DB3A 3NMZC 1UB4A 4M75F 1OX8A 4FW2A 2RA2A 3OYGA 3EGXB 2GQIA 1Q7YR 1D0ZA 1V29B 2ZPHB 5GAN3 1X69A 2BE9B 2DL7A 2EWNA 1AWWA 2FEIA 3S6WA 2AK5A 3C4SA 3MO8A 3CD6Q 1JEGA 2DERA 1WJQA 4GLKA 2QEXA 3GPLA 2CP0A 1FMWA 4PJOG 2L3SA 4Z88A 4IURA 3A8MB 3G7ZA 2LRQA 1QCFA 2VC8A 1UEBA 2CP3A 2DXBA 2NUPA 3SDZA 2LZ6B 4R55A 3LYIA 3CCLA 1UHFA 3U23A 2HCKA 3O8VA 2QYZA 3HHTB 2XDDA 2D9TA 4MMLA 2L3RA 1KHIA 2YDLA 4DEYA 5GAMg 3JCMf 1QP3A 2FO0A 3ZBDA 5KYUB 3M57A 4N0AA 1D3BB 3R6NA 2JT4A 1QCOA 3OSVA 5CQYA 1SRLA 1HSQA 2O9SA 2RNAA 3A5ZB 1K4US 1OZ3A 1SG5A 2LC4A 3UF4A 4JRPA 2JVVA 2BE7D 2K2MA 1YJNQ 2RH2A 3G71T 4HA8A 1NJIR 3H41A 2QEXQ 2XK0A 4PK4A 1BI1A 3JCMh 2JM8A 5FWCA 2I0NA 1WFWA 2LNHB 1TH7A 2DBKA 1RI0A 4M7DG 2DPPB 3EHQA 3OS5A 2M1HA 3CCLQ 3MEVA 1VUBA 1I5LA 1R8OB 5CKHA 5A0DA 2H3EB 1ZHIA 3A8OB 2JN0A 4OB0B 1BBZA 3UPUA 3MEAA 3FDRA 4MZPA 1K73R 2KRSA 3S3OA 2RF0A 4J8OA 3LWIA 1Q7YC 1WJSA 2EVRA 1N8RU 3CCVA 4Y91A 1VOMA 1UUEA 5LJ3g 1VQ5A 1WHLA 3EFOA 3OS1A 5LJ5d 1YIJA 5CKBA 3X20B 4LD6A 3V8KA 2RHIA 2QGGA 2RB6A 1QVFP 1RAEB 4OMLA 4HCBA 2LQNA 3SWNB 3X26B 2X4YA 5C0MA 1TUCA 2HQEA 2ZGWA 5IHIA 4ZGJB 3AHUA 5IHNA 4LUEA 5FU6C 1BB9A 2F2WA 8ATCB 4UC4A 2QGFB 2KVQG 2E12A 4AT1B 4EMKB 4A4FA 2VGNA 4XQ3A 4NL3A 3I35A 1OX9A 4KUDK 2EW3A 4RKUE 2EAYA 2OTLT 5CO7A 2RI3A 2KEAA 1PRMC 3CCVQ 1ZSZC 1ZBJA 3KBGA 1PSFA 2PTKA 2GTOA 1VQ5Q 4KRTA 2QDYB 2QA4A 1PRLC 1UGPB 3PT9A 1RAIB 4DA4A 1YIJQ 4M7AD 1RLPC 2CUDA 2FVUA 1PKTA 2EQIA 4LDYA 1NJIC 1M8VA 1M3CA 2CZ1B 1ABOA 1WXTA 4M77B 2DYIA 4FT2A 1XTDA 4E7SA 4WTOB 3H0IA 4KGXB 2DD5A 4MDWA 3V7CA 4Z02A 1OZ2A 2P0KA 1M5Q1 4X9CA 3URGA 4JRIA 4M7AF 4R56A 2HD0A 1K73C 1VQ6A 2GF7A 4OF1A 1ZX6A 2RN8A 1VQNT 1N5ZA 4PJNA 4WF2A 2CT3A 2VYTA 3MEWA 3CCEA 1RABB 2JJ9A 2V8IA 3JB9I 1QVGA 1TUDA 1Y07A 2LQKA 2KE9A 2QA4Q 1JJ2P 2JXBA 2E1HA 5AYFA 2Y4YA 3UA6A 5M9OA 4A4GA 4RTVA 2O4XA 3L2WA 3QDFA 1X43A 4F14A 1WYXA 1MV0B 1WXBA 1VIFA 2A7YA 1QMCA 3RESA 1C1AA 4F7UB 1BK2A 3RMQA 2EYYA 1M2VB 4RTXA 3VS6A 1FMVA 4J5YA 2RD1A 2L2PA 2OJ2A 2QASA 1QKWA 1VQ6Q 4PJOF 1Q82U 1X6GA 2EFIA 2RHYA 5KH6A 1MNEA 1OU8A 3G4SA 4K11A 1UJ0A 4YTLA 5DLQE 1BIAA 3CCEQ 3QUIA 1ARKA 2EQMA 3H9NA 5GANj 4B9XA 3FJPA 3HSBA 2MWOA 5GJVB 1CKAA 2RPNA 2DEUA 3MKDA 4QQ6A 2A36A 2ENMA 2M16A 3OYLA 2LP5A 2W10A 2DTOA 3OBWA 1KD1U 2X4XA 1J3TA 4X34A 5HCKA 4ZGDB 1YJ9A 2A3LA 2XIDA 4KULA 3L2QA 1NEBA 3L1AA 2HL3A 2HBWA 1VQPA 4XTXA 2LT1A 2PUKB 4XTUA 5DY9A 4JLIA 5IH2A 5AT1B 1GBRA 4A4EA 2LMJA 2BZYA 3G4SQ 4E7KA 2YLCA 3CCMT 4M7DF 1K0SA 3P8HA 4M75G 4C92A 1SF9A 2VB6A 5DLOA 1Q86R 2PZ1A 1H8KA 2VWFA 2LJ1A 1JB0E 3M0QA 3CC7Q 3GNFB 1WHHA 4C92E 3FRNA 4ANJA 4PJJA 5A0GA 3L2ZA 3CPFA 4C0ZA 2ABLA 4M78D 5ECAA 2JUFA 1N8RC 1WHJA 5GAMh 1NEGA 1R77A 3QWXX 4LD9K 4FL6A 5GAN5 2DBMA 3DKMA 1YJ9Q 2O9VA 2EKOA 5LJ5j 5KYYB 2KXCA 3JCMe 4A63B 1VQPQ 1R0CB 2W0ZA 2B8AA 2JTMA 3FB9A 3CCJT 1U1SA 3PIPA 1I1JA 2YSQA 4QVDA 2DLPA 4F04B 5I2SA 1PM3A 1AOJA 1I8FA 4RMOA 3FLGA 1KC8R 1EIFA 3CCQQ 4RTZA 2VVKA 2GCXA 4PJLA 3JV3A 2NUZA 5KCHA 3BW1A 1M1GA 5L8RE 1KSWA 2D8HA 3EGDB 1WHGA 3VS3A 2DL5A 3NTKA 2P4RA 1QVGS 4HCCA 2DJQA 2DAQA 1Z9QA 3A8GB 4CRIA 2V8KA 4F7UG 4QW2A 2ZAEA 5CCAA 3LWHA 1YNZA 3ULRB 1HK9A 2NYSA 5CAIA 2ROTA 4XTYA 3QDRB 3NGPA 4M75C 3JCMc 1B34B 4OB2B 5GANf 3OW2P 3CMAT 3CMAA 1VQLT 1G83A 4LXCA 1WJRA 2LTOA 5D6XA 1Z9ZA 2E5KA 2FRWA 2COYA 2SRCA 3DLMA 3EG0A 1Q86C 3OSSC 4RG2A 1SPKA 3H6ZA 2J6FA 4J7FA 2FL7A 2P4TA 3G6EA 3HP9A 3RIRA 3HFNA 4LE9A 1Q7YU 3I55A 2EBPA 3OMGA 3P8DA 3M0TA 5GANh 2DNUA 5J26A 2CGHA 3JCMb 5GAOr 4QQDA 5GAN7 2HZYA 1SHGA 2DO3A 4CC3A 1K9AA 3WVDB 6AT1B 1HYOA 2EIFA 4HKEA 2DL4A 2JMCA 1VYVA 2EJFA 1PSEA 1WI7A 3PNWC 2F2XA 4XTWA 3CMAQ 4PJOE 4F17A 1T0HA 2RQRA 3CCSA 5HY6A 3I5SA 4A4KA 2D1XA 1KC8C 2IPOB 4JJCA 2CUBA 3PIOA 3G6EQ 4BY6C 1ZQ1A 1C6VX 1RAFB 3I55Q 4OB1B 2LCLA 4ZNXA 3JCMQ 4IIOA 4HT8A 4XTVA 5GAMd 2XHCA 2MOXA 2DEQA 4HCKA 1Q81R 2J6KA 3CBPA 1A0NB 1SSFA 1ZSZA 3HL8A 3S3NA 2EYZA 3V8JA 1NJIU 4FCYA 2RI2A 1OULA 2O31A 2RQVA 4C0DB 3GF5A 4JJDA 1PKSA 1VQ9A 1QCNA 3CCSQ 2ZPEB 1OPLA 4C8QB 4FW1A 1KFZA 2KBTA 4M7AG 4M7DE 4HVUA 2ZPBB 2DFUA 2F5TX 1W2BP 4M78B 2EJ9A 2Z0WA 1K73U 3I9QA 5I22A 4AFUC 3A1PA 3PTAA 4JJBA 3VS1A 2HKNA 5I2MA 3RKXA 4M77D 4ME7A 2HSPA 2QTVA 4KH1B 3EFRA 3KFVA 3CC4Q 1TXQA 2SEMA 3GNGA 3V8LA 4D6WA 2QK0A 2C0TA 1K8AR 1Y7XA 1ZUUA 2YUPA 3OYFA 5LJ3d 1S72T 2DMOA 4M4ZA 4A53A 4KH0B 3JB9J 4QKUA 1M30A 1UDLA 2D0QB 1YI2T 4EDUA 3THKA 2V26A 1VQ9Q 1RI9A 4M77F 4QVZA 4XU1A 4J83A 4J9BA 1X75C 1O9SA 3OS2A 2NUPB 1GFCA 3HRSA 2E4HA 3QSUA 5GAOq 1X27A 2YLBA 3JSCA 4OMPA 3CXCP 2D6FA 1YFNA 3LW5E 5D6YA 4RTWA 2KR3A 5GANd 1YHQT 2CZ0B 1Q81C 1XJWB 5I11A 3CMET 3SD4A 3I56T 3OY9A 4J6XA 2CSIA 3VS7A 5GAN6 3N5BB 3OYBA 3CPWP 2H8HA 2QI2A 5CK9A 1MMDA 3S3MA 2LCSA 4M7AC 1U1TA 1IO6A 1KQSA 3LLRA 1T0JA 3G71A 4NS5A 3RR6A 2EQJA 2CZ6B 4F7UF 2GNCA 4RCCA 2VGMA 3JCMX 1KK7A 1JXOA 3EG2A 3QYGB 1I07A 2MI6A 1WGSA 4CI0C 8AT1B 3TREA 4OMMA 2KYMA 2R58A 3E9GA 1RLQC
chains in the Genus database with same CATH topology
3UA6A 3EG3A 4RTVA 2FPEA 4Y92A 4WCIA 1EFNA 5IXBA 1YP5A 1MUZA 4AG2C 1X43A 4F14A 2O88A 1WYXA 1MV0B 2JW4A 1WXBA 2CSQA 3M0UA 2EYXA 1B3QA 1SSHA 1KJWA 1ABQA 2FPFA 3PVQA 4X1VA 1UJYA 1BK2A 3IQLA 4IIMA 3H0HA 2EYYA 4RTXA 3VS6A 4R0KA 4RTUA 4E6RA 1NYGA 1M3AA 2L2PA 3M0PA 2OJ2A 1GL5A 1QKWA 2HDAA 2LJ0A 1W70A 2EGAA 1X6GA 2O2OA 5GJWB 2CREA 1NLOC 1NG2A 2LJ3A 1UG1A 4K11A 1UJ0A 1QKXA 1UTIA 3RBBB 1ZSGA 1HJDA 1ARKA 2YUQA 2F2VA 1WLPB 2GGRA 4Z8AA 2CH4W 1M8MA 4AFZC 5GJVB 2C0OA 4LN2A 1CKAA 2RPNA 4ESRA 4J9FA 4LNPA 2A36A 2ENMA 4QT7A 3PE0A 1X2QA 2LP5A 2W10A 4HXJA 1H3HA 1Y0MA 2OI3A 2VKNA 3TVTA 1J3TA 2AKKA 5IHKA 1AEYA 5HCKA 4D8DA 2KXDA 4J9GA 2QDLA 1ZUKA 1NEBA 2M0YA 2HBWA 1PWTA 1ZLMA 5IH2A 1GBRA 2YUNA 2IIMA 2LMJA 3TSZA 1YCSB 2DA9A 2BZYA 1CKBA 1WDXA 1K0SA 2EGEA 1E6GA 4J9CA 3VS0A 4J9IA 2DYBA 2PZ1A 1H8KA 1PNJA 2VWFA 2LJ1A 3RNJA 3M0QA 2A08A 1OPKA 1UFFA 2C0IA 2A28A 1QLYA 2AZSA 1GCQA 3A98A 1JXMA 2J05A 2EPDA 3M0SA 2ABLA 5ECAA 3REBB 1XOVA 2BZ8A 1NEGA 4AFQC 4CC2A 1WX6A 3QWXX 2DM1A 2DBMA 2O9VA 1QWEA 2DILA 4RTTA 2X3WD 1AZEA 2AKLA 1E7OA 2BZXA 1JQQA 1WIEA 1M27C 4CC7A 2DRKA 2KXCA 2ESWA 2MIOA 4A63B 2X3XD 1K0XA 2W0ZA 3SHWA 3PVLA 1AVZC 1I1JA 2CH4A 2YSQA 3NPFA 2EGCA 2DLPA 4EIKA 2GTJA 3UATA 1AOJA 2RQTA 3C0CA 3ZL7C 1YN8A 1T3LA 4RTZA 2KNBB 1T3SA 2VVKA 3JV3A 2NUZA 2K79A 1AWJA 2GBQA 2EYWA 3H0FA 2XMFA 2DL8A 3I5RA 3VS2A 4JZ3A 2YUOA 1VA7A 1KSWA 2D8HA 3VS3A 1U06A 4LUDA 2DL5A 2M51A 2P4RA 1B07A 2DJQA 1NM7A 1UGVA 2V1RA 2J06A 1Z9QA 4Z89A 2D8JA 1W1FA 4CC4B 1YNZA 3ULRB 4J9EA 2DE0X 1KIKA 4OMOA 2D0NA 2ROTA 1BU1A 2V1QA 3QWYA 1E6HA 1GCQC 2J7IA 4GLMA 1AWOA 3NGPA 2L3QA 1V1CA 3NMZC 1FYNA 2ROLA 3REAB 4J9DA 1G83A 4RTYA 2KT8A 1K1ZA 1Z9ZA 2GQIA 1JU5C 2E5KA 2FRWA 2SRCA 3EG0A 1X69A 4HVVA 1SPKA 2J6FA 2DL7A 1CSKA 1AWWA 2FEIA 1QWFA 1HD3A 4LE9A 1X6BA 1VYTA 2AK5A 3FJ5A 2EBPA 2CDTA 5L23A 1WXUA 3M0TA 1JEGA 2HEQA 2DNUA 1OOTA 1SHGA 2L3SA 2RQWA 4CC3A 1SRMA 1AZGB 4Z88A 1K9AA 1QCFA 1VYUA 3VS5A 2LZ6B 2RQUA 2DL4A 2JMCA 2RMOA 1UHFA 1VYVA 3U23A 1WI7A 2HCKA 2F2XA 2DF6A 3SEMA 1M3BA 1OEBA 4F17A 4DEYA 1T0HA 2RQRA 2YDLA 1S1NA 3NHNA 3I5SA 1ZUYA 1UE9A 2FO0A 1GFDA 2D1XA 3R6NA 2JT4A 4JJCA 4AG1C 2CUBA 2KT1A 1NYFA 1SRLA 2OAWA 1HSQA 2O9SA 2RNAA 2JS2A 4J9HA 1K4US 3VRYA 2DX1A 4JPBW 3UF4A 2JMAA 4ZNXA 1I0CA 2K2MA 4HVWA 4IIOA 1TG0A 2K7AA 2MOXA 3H41A 4HCKA 2AZVA 2J6KA 1A0NB 1SEMA 2DRMA 2KGTA 1JO8A 2JM8A 5FWCA 2L0AA 1PHTA 2I0NA 1WFWA 2K3BA 2LNHB 2DBKA 2EYZA 3EHQA 2DL3A 2RQVA 2LX7A 2O31A 1FMKA 1GBQA 1SHFA 2EKHA 4JJDA 1RUWA 2LQWA 1BBZA 3VRZA 1PKSA 2KROA 1UECA 4ORZA 1AWXA 4JZ4A 2KRSA 1OPLA 3EHRA 2RF0A 1KFZA 2K6DA 2KBTA 4HVUA 1X2KA 2KYBA 1OV3A 4AFSC 2EVRA 3EG1A 2NWMA 1LCKA 3I9QA 5I22A 4AFUC 1UUEA 5IXFA 4JJBA 3VS1A 3VS4A 4RUGA 3O5ZA 2MCNA 2JTEA 3UA7A 2G6FX 1YWPA 2HSPA 4OMLA 2LQNA 3KFVA 2SEMA 2A37A 1TUCA 2CT4A 2ED0A 2C0TA 2ED1A 5IHIA 1ZUUA 5IHNA 4D8KA 4LUEA 1BB9A 1Y57A 2YUPA 2F2WA 1H92A 2DMOA 1K76A 3M0RA 4M4ZA 1M30A 1UDLA 3TSWA 2FPDA 3I35A 3THKA 4FSSA 1RI9A 1GRIA 2EW3A 2J6OA 1U3OA 4J9BA 2KRNA 2ECZA 4F16A 5FWBA 2L3PA 5EC7A 1GFCA 2KEAA 1PRMC 1ZBJA 1X27A 2PTKA 2GTOA 4OMPA 2K9GA 1YWOA 4KRTA 4GBQA 1PRLC 4DEXA 1RLPC 2CUDA 1UHCA 2FG0A 4RTWA 2KR3A 1W6XA 1PKTA 2EQIA 1M3CA 3EGUA 5I11A 1ABOA 2PNIA 1WXTA 2CSIA 3VS7A 2BTTA 1U5SA 1G2BA 4OMNA 3H0IA 3LH5A 2H8HA 2FRYA 1AD5A 1NLPC 1WA7A 2LCSA 1IO6A 2B86A 2JS0A 1T0JA 1ZX6A 2RN8A 2YT6A 2GNCA 1N5ZA 1GCPA 2JM9A 2DVJA 2CT3A 1JXOA 1MV3A 3EG2A 1I07A 3CQTA 2KRMA 5FW9A 4OMQA 1TUDA 2KYMA 4OMMA 3GBQA 2KE9A 2JXBA 1RLQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UA6 A;  3EG3 A;  4RTV A;  2FPE A;  4Y92 A;  4WCI A;  1EFN A;  5IXB A;  1YP5 A;  1MUZ A;  4AG2 C;  1X43 A;  4F14 A;  2O88 A;  1WYX A;  1MV0 B;  2JW4 A;  1WXB A;  2CSQ A;  3M0U A;  2EYX A;  1B3Q A;  1SSH A;  1KJW A;  1ABQ A;  2FPF A;  3PVQ A;  4X1V A;  1UJY A;  1BK2 A;  3IQL A;  4IIM A;  3H0H A;  2EYY A;  4RTX A;  3VS6 A;  4R0K A;  4RTU A;  4E6R A;  1NYG A;  1M3A A;  2L2P A;  3M0P A;  2OJ2 A;  1GL5 A;  1QKW A;  2HDA A;  2LJ0 A;  1W70 A;  2EGA A;  1X6G A;  2O2O A;  5GJW B;  2CRE A;  1NLO C;  1NG2 A;  2LJ3 A;  1UG1 A;  4K11 A;  1UJ0 A;  1QKX A;  1UTI A;  3RBB B;  1ZSG A;  1HJD A;  1ARK A;  2YUQ A;  2F2V A;  1WLP B;  2GGR A;  4Z8A A;  2CH4 W;  1M8M A;  4AFZ C;  5GJV B;  2C0O A;  4LN2 A;  1CKA A;  2RPN A;  4ESR A;  4J9F A;  4LNP A;  2A36 A;  2ENM A;  4QT7 A;  3PE0 A;  1X2Q A;  2LP5 A;  2W10 A;  4HXJ A;  1H3H A;  1Y0M A;  2OI3 A;  2VKN A;  3TVT A;  1J3T A;  2AKK A;  5IHK A;  1AEY A;  5HCK A;  4D8D A;  2KXD A;  4J9G A;  2QDL A;  1ZUK A;  1NEB A;  2M0Y A;  2HBW A;  1PWT A;  1ZLM A;  5IH2 A;  1GBR A;  2YUN A;  2IIM A;  2LMJ A;  3TSZ A;  1YCS B;  2DA9 A;  2BZY A;  1CKB A;  1WDX A;  1K0S A;  2EGE A;  1E6G A;  4J9C A;  3VS0 A;  4J9I A;  2DYB A;  2PZ1 A;  1H8K A;  1PNJ A;  2VWF A;  2LJ1 A;  3RNJ A;  3M0Q A;  2A08 A;  1OPK A;  1UFF A;  2C0I A;  2A28 A;  1QLY A;  2AZS A;  1GCQ A;  3A98 A;  1JXM A;  2J05 A;  2EPD A;  3M0S A;  2ABL A;  5ECA A;  3REB B;  1XOV A;  2BZ8 A;  1NEG A;  4AFQ C;  4CC2 A;  1WX6 A;  3QWX X;  2DM1 A;  2DBM A;  2O9V A;  1QWE A;  2DIL A;  4RTT A;  2X3W D;  1AZE A;  2AKL A;  1E7O A;  2BZX A;  1JQQ A;  1WIE A;  1M27 C;  4CC7 A;  2DRK A;  2KXC A;  2ESW A;  2MIO A;  4A63 B;  2X3X D;  1K0X A;  2W0Z A;  3SHW A;  3PVL A;  1AVZ C;  1I1J A;  2CH4 A;  2YSQ A;  3NPF A;  2EGC A;  2DLP A;  4EIK A;  2GTJ A;  3UAT A;  1AOJ A;  2RQT A;  3C0C A;  3ZL7 C;  1YN8 A;  1T3L A;  4RTZ A;  2KNB B;  1T3S A;  2VVK A;  3JV3 A;  2NUZ A;  2K79 A;  1AWJ A;  2GBQ A;  2EYW A;  3H0F A;  2XMF A;  2DL8 A;  3I5R A;  3VS2 A;  4JZ3 A;  2YUO A;  1VA7 A;  1KSW A;  2D8H A;  3VS3 A;  1U06 A;  4LUD A;  2DL5 A;  2M51 A;  2P4R A;  1B07 A;  2DJQ A;  1NM7 A;  1UGV A;  2V1R A;  2J06 A;  1Z9Q A;  4Z89 A;  2D8J A;  1W1F A;  4CC4 B;  1YNZ A;  3ULR B;  4J9E A;  2DE0 X;  1KIK A;  4OMO A;  2D0N A;  2ROT A;  1BU1 A;  2V1Q A;  3QWY A;  1E6H A;  1GCQ C;  2J7I A;  4GLM A;  1AWO A;  3NGP A;  2L3Q A;  1V1C A;  3NMZ C;  1FYN A;  2ROL A;  3REA B;  4J9D A;  1G83 A;  4RTY A;  2KT8 A;  1K1Z A;  1Z9Z A;  2GQI A;  1JU5 C;  2E5K A;  2FRW A;  2SRC A;  3EG0 A;  1X69 A;  4HVV A;  1SPK A;  2J6F A;  2DL7 A;  1CSK A;  1AWW A;  2FEI A;  1QWF A;  1HD3 A;  4LE9 A;  1X6B A;  1VYT A;  2AK5 A;  3FJ5 A;  2EBP A;  2CDT A;  5L23 A;  1WXU A;  3M0T A;  1JEG A;  2HEQ A;  2DNU A;  1OOT A;  1SHG A;  2L3S A;  2RQW A;  4CC3 A;  1SRM A;  1AZG B;  4Z88 A;  1K9A A;  1QCF A;  1VYU A;  3VS5 A;  2LZ6 B;  2RQU A;  2DL4 A;  2JMC A;  2RMO A;  1UHF A;  1VYV A;  3U23 A;  1WI7 A;  2HCK A;  2F2X A;  2DF6 A;  3SEM A;  1M3B A;  1OEB A;  4F17 A;  4DEY A;  1T0H A;  2RQR A;  2YDL A;  1S1N A;  3NHN A;  3I5S A;  1ZUY A;  1UE9 A;  2FO0 A;  1GFD A;  2D1X A;  3R6N A;  2JT4 A;  4JJC A;  4AG1 C;  2CUB A;  2KT1 A;  1NYF A;  1SRL A;  2OAW A;  1HSQ A;  2O9S A;  2RNA A;  2JS2 A;  4J9H A;  1K4U S;  3VRY A;  2DX1 A;  4JPB W;  3UF4 A;  2JMA A;  4ZNX A;  1I0C A;  2K2M A;  4HVW A;  4IIO A;  1TG0 A;  2K7A A;  2MOX A;  3H41 A;  4HCK A;  2AZV A;  2J6K A;  1A0N B;  1SEM A;  2DRM A;  2KGT A;  1JO8 A;  2JM8 A;  5FWC A;  2L0A A;  1PHT A;  2I0N A;  1WFW A;  2K3B A;  2LNH B;  2DBK A;  2EYZ A;  3EHQ A;  2DL3 A;  2RQV A;  2LX7 A;  2O31 A;  1FMK A;  1GBQ A;  1SHF A;  2EKH A;  4JJD A;  1RUW A;  2LQW A;  1BBZ A;  3VRZ A;  1PKS A;  2KRO A;  1UEC A;  4ORZ A;  1AWX A;  4JZ4 A;  2KRS A;  1OPL A;  3EHR A;  2RF0 A;  1KFZ A;  2K6D A;  2KBT A;  4HVU A;  1X2K A;  2KYB A;  1OV3 A;  4AFS C;  2EVR A;  3EG1 A;  2NWM A;  1LCK A;  3I9Q A;  5I22 A;  4AFU C;  1UUE A;  5IXF A;  4JJB A;  3VS1 A;  3VS4 A;  4RUG A;  3O5Z A;  2MCN A;  2JTE A;  3UA7 A;  2G6F X;  1YWP A;  2HSP A;  4OML A;  2LQN A;  3KFV A;  2SEM A;  2A37 A;  1TUC A;  2CT4 A;  2ED0 A;  2C0T A;  2ED1 A;  5IHI A;  1ZUU A;  5IHN A;  4D8K A;  4LUE A;  1BB9 A;  1Y57 A;  2YUP A;  2F2W A;  1H92 A;  2DMO A;  1K76 A;  3M0R A;  4M4Z A;  1M30 A;  1UDL A;  3TSW A;  2FPD A;  3I35 A;  3THK A;  4FSS A;  1RI9 A;  1GRI A;  2EW3 A;  2J6O A;  1U3O A;  4J9B A;  2KRN A;  2ECZ A;  4F16 A;  5FWB A;  2L3P A;  5EC7 A;  1GFC A;  2KEA A;  1PRM C;  1ZBJ A;  1X27 A;  2PTK A;  2GTO A;  4OMP A;  2K9G A;  1YWO A;  4KRT A;  4GBQ A;  1PRL C;  4DEX A;  1RLP C;  2CUD A;  1UHC A;  2FG0 A;  4RTW A;  2KR3 A;  1W6X A;  1PKT A;  2EQI A;  1M3C A;  3EGU A;  5I11 A;  1ABO A;  2PNI A;  1WXT A;  2CSI A;  3VS7 A;  2BTT A;  1U5S A;  1G2B A;  4OMN A;  3H0I A;  3LH5 A;  2H8H A;  2FRY A;  1AD5 A;  1NLP C;  1WA7 A;  2LCS A;  1IO6 A;  2B86 A;  2JS0 A;  1T0J A;  1ZX6 A;  2RN8 A;  2YT6 A;  2GNC A;  1N5Z A;  1GCP A;  2JM9 A;  2DVJ A;  2CT3 A;  1JXO A;  1MV3 A;  3EG2 A;  1I07 A;  3CQT A;  2KRM A;  5FW9 A;  4OMQ A;  1TUD A;  2KYM A;  4OMM A;  3GBQ A;  2KE9 A;  2JXB A;  1RLQ C; 
#chains in the Genus database with same CATH topology
 3OS0 A;  3MET A;  2FPE A;  4WCI A;  2DXU A;  2DZ9 A;  1NZ9 A;  3M0U A;  1B3Q A;  1WNL A;  1KJW A;  2M02 A;  1ABQ A;  4OP0 A;  1IXD A;  2DXC A;  2QQR A;  3EH2 A;  4BE1 A;  3EFO B;  4X1V A;  3NTI A;  3IQL A;  2COZ A;  2ZPI B;  4R0K A;  3VKI A;  4RTU A;  4PJO C;  1M3A A;  3KXT A;  1GL5 A;  3EAE A;  2AT1 B;  1FXX A;  3CCU T;  3G71 Q;  1QQJ A;  1VIE A;  4KGV B;  5GJW B;  3CCU A;  2CRE A;  1NG2 A;  1UG1 A;  1I81 A;  4II1 A;  4B9W A;  1HJD A;  5KYN A;  1MMA A;  1IGQ A;  1VQO T;  3M55 A;  4AFZ C;  3M9Q A;  4ESR A;  4E7L A;  2E64 A;  5IAY A;  2MF2 A;  2IVW A;  1I5O B;  4QT7 A;  5FU7 B;  2Y90 A;  4BDZ A;  2OTL A;  1HXD A;  3OYK A;  3UWN A;  3OW2 A;  4BI4 A;  2O01 E;  4D8D A;  5GAN e;  5GAM j;  2QDL A;  1ZUK A;  5KE3 A;  4IUV A;  4AMC A;  4MMK A;  4PFP A;  3QBY A;  2MMP A;  1KQ1 A;  2IIM A;  1YCS B;  2KAF A;  4M7D C;  4KBM B;  2OTJ T;  3D7S B;  1CKB A;  2E10 A;  1BI3 A;  2EGE A;  2ZZD A;  4J9C A;  2QG9 B;  4JRQ A;  2A08 A;  1OPK A;  4E7I A;  1BKB A;  3A98 A;  2JOY A;  2VV5 A;  1X01 A;  3UT1 A;  4M75 A;  4OGE A;  2E6N A;  2LCC A;  1Q86 U;  4AFQ C;  3X25 B;  4CC2 A;  2OTL Q;  4M75 E;  4C0D C;  1D1C A;  1YJW T;  1VQN A;  1UGS B;  3HTR A;  1QWE A;  2DIL A;  2AKL A;  2K3Y A;  5J39 A;  2O4X B;  2MIO A;  2FB7 A;  5FRN A;  3PVL A;  2PVG B;  1PG5 B;  2CH4 A;  2R5M A;  4EIK A;  5LJ3 j;  3BDL A;  4A4H A;  2XDB A;  3WVE B;  3V7R A;  3C0C A;  4C0G A;  2QQ9 A;  1YN8 A;  2XI9 A;  1LNX A;  1T3L A;  3MP1 A;  5LJ5 e;  1T3S A;  4BE2 A;  1KQS S;  5GMK i;  1KC8 U;  4MZM A;  2FZK B;  2XMF A;  2DL8 A;  5FRM A;  3VS2 A;  1Y96 A;  2E3I A;  2P0P A;  2ZPG B;  4LUD A;  2CP2 A;  2NUT A;  1VQN Q;  1UGV A;  2V1R A;  3M54 A;  1M1K R;  2LQ8 A;  4O6J A;  1VQK T;  1W1F A;  2RI5 A;  2DJZ A;  3RKW A;  3X24 B;  3NFC A;  4OMO A;  5J3B A;  1BCO A;  2D0N A;  5FRO A;  1E6H A;  2AIR B;  3OYH A;  1AWO A;  2XIC A;  5HK3 A;  3OYY A;  4A54 A;  5LL6 S;  5GAO n;  4RTY A;  4F7U E;  1OYX A;  1K1Z A;  2KT8 A;  3QJ6 A;  3F70 A;  2FZG B;  4HVV A;  3ZFJ A;  1AHJ B;  2ATC B;  2C06 A;  1QWF A;  3E19 A;  3HPW A;  1RAG B;  1VYT A;  4C92 B;  5GAM f;  1G3S A;  2RHU A;  1VQ7 T;  1QP2 A;  1VQ7 A;  4JUV A;  1FX7 A;  2OX7 A;  3CCM A;  2RQW A;  2LT4 A;  1SRM A;  3MHX A;  1AZG B;  3C12 A;  3OYC A;  3VS5 A;  1K9M R;  4C8Q D;  2WSF E;  2RMO A;  3CXC A;  3OW2 S;  2DF6 A;  3SEM A;  1M3B A;  1S1N A;  3NHN A;  4KGZ B;  4C5I A;  1GFD A;  4M77 G;  1G5V A;  2QAZ A;  4AG1 C;  3HKS A;  2KT1 A;  3M58 A;  2OAW A;  2JS2 A;  2COW A;  3LGL A;  3VRY A;  4C8Q F;  3CPW A;  4JPB W;  3CCJ A;  1I0C A;  4JLG A;  4HVW A;  4QVC A;  3BY7 A;  2YHT A;  4M78 F;  3JCM g;  3CCM Q;  1SEM A;  2KGT A;  2XU8 A;  4DOW A;  2WAC A;  1OQK A;  2L0A A;  1PHT A;  1M1K C;  3MCA B;  2RHX A;  2K3X A;  5KYW A;  1Q81 U;  5LJ3 f;  1R0B G;  2F69 A;  3M4Y A;  4N4G A;  2FZC B;  3SWN C;  2DL3 A;  2LX7 A;  1GBQ A;  4OGC A;  1VQM T;  4IUT A;  3JB9 D;  1VQM A;  1RUW A;  2PVO B;  2KRO A;  1G3T A;  1UEC A;  5GAN 4;  1YIT T;  1AWX A;  4ZTJ A;  4JZ4 A;  2CS7 A;  3EHR A;  4EMK C;  3VV0 A;  1OV3 A;  4AFS C;  5EG2 A;  4OMF B;  1Q82 R;  5KYX A;  4E2F B;  3OBY A;  3J7A F;  2YRD A;  5LJ3 h;  1VQ4 T;  4FSX A;  3QZ5 B;  4M7A A;  4PJM A;  3VS4 A;  1EX4 A;  3C95 A;  3CCJ Q;  3O5Z A;  3UA7 A;  2G6F X;  4E47 A;  1YWP A;  3JCM J;  3JB9 F;  3BDU A;  4ATO A;  4JJN K;  4M7A E;  2LX9 A;  3JAM E;  4EMG A;  4E7Z A;  4JS4 A;  3CC2 T;  5GMK j;  1VQL A;  2A37 A;  1QVF A;  4BAC A;  2RJC A;  4D8K A;  1Y57 A;  4N4H A;  1VQ8 T;  4PFZ A;  3HRT A;  1U8R A;  1VQ8 A;  1H92 A;  1K9M C;  5GAO l;  1K76 A;  4DOV A;  4Y28 E;  4LDV A;  5CKD A;  2FPD A;  4M77 C;  1M90 R;  1K8A U;  1GRI A;  4XU2 A;  2GFU A;  2KRN A;  5FWB A;  1IHW A;  5EC7 A;  3M56 A;  3QPH A;  3M5A A;  5I21 A;  2K9G A;  2LNV A;  4PJO A;  3MJX A;  3CCR T;  1H64 1;  2FG0 A;  2I2L A;  1QVP A;  5FU6 B;  3MPU B;  3EGU A;  2KY9 A;  1VQL Q;  2PNI A;  4NOY A;  4DBH A;  2JNG A;  4ELY C;  2BTT A;  1U5S A;  1G2B A;  4OMN A;  2MAM A;  1PD0 A;  1VQ8 Q;  3QYH B;  2L89 A;  3LH5 A;  2FRY A;  3A8L B;  1AD5 A;  4HT9 A;  3R6O A;  5IN1 A;  3TU4 K;  2ZPF B;  3RMS A;  3LGF A;  5A2Q E;  1ZSZ B;  1OI1 A;  2FHD A;  2YT6 A;  1D0X A;  2JM9 A;  1MV3 A;  5GMK l;  2K57 A;  3E9F A;  3CQT A;  5FW9 A;  3CXC S;  4OMQ A;  2QXF A;  3L2U A;  3GBQ A;  3JRZ A;  3ASK A;  4FYV B;  3MEU A;  3ZEH A;  4DBQ A;  2VAS A;  2E3H A;  1RL2 A;  1ACM B;  3EG3 A;  2R5A A;  2LVM A;  2VUB A;  1EFN A;  3X28 B;  4ZN3 A;  5IXB A;  3L2V A;  1JJ2 A;  4M7D A;  1YP5 A;  1MUZ A;  4AG2 C;  2O88 A;  3CBM A;  2JW4 A;  2XG8 D;  1WPY A;  2KDS A;  2EYX A;  1SSH A;  3NTH A;  3CPW S;  3PVQ A;  3FC3 A;  2DIG A;  1KG1 A;  4IIM A;  3H0H A;  3J81 E;  4L6V 5;  4OVA A;  2VXF A;  3LH0 A;  3QO3 A;  4DQ2 A;  2E70 A;  3EG9 A;  1QKX A;  2MWP A;  1RAD B;  1UTI A;  1MMG A;  1TTH B;  2YUQ A;  4FU6 A;  5D6W A;  2GGR A;  1M8M A;  1N6A A;  1S72 A;  2C0O A;  4LN2 A;  1WQW A;  1YI2 A;  4J9F A;  4LNP A;  5GAO p;  3PE0 A;  1X2Q A;  2G3R A;  4M78 E;  4HXJ A;  4FT4 A;  3QXE B;  1H3H A;  4NL2 A;  2OI3 A;  4RCB A;  2AKK A;  5IHK A;  1AEY A;  2M9U A;  4QQG A;  4EPC A;  3C94 A;  2HQH A;  2K2V A;  2KXD A;  2P0Q A;  2M0Y A;  3EGX A;  1IGU A;  1D0Y A;  1IZ6 A;  2EQK A;  2RJF A;  5GMK h;  1PWT A;  1YJN T;  1QVF S;  2YUN A;  1YJN A;  1LVK A;  2QEX T;  2EYQ A;  1YHQ A;  1WDX A;  3CME A;  5KE2 A;  1TSF A;  3I56 A;  1E6G A;  3VS0 A;  4PKC C;  2DYB A;  5GAM e;  1PNJ A;  4PLI A;  2F5K A;  3RNJ A;  5C6S A;  1S72 Q;  1UFF A;  2MYS A;  3CCL T;  2AZS A;  1JXM A;  1YI2 Q;  1LOJ A;  2EPD A;  2BIV A;  3M0S A;  3G1J A;  4LDU A;  1I4K 1;  1XOV A;  2BZ8 A;  2F1L A;  1WX6 A;  2DM1 A;  3T9N A;  4KUI A;  4RTT A;  1AZE A;  2HSE B;  2BZX A;  4BB7 A;  1JQQ A;  1W4S A;  1WIE A;  5KYU A;  2DRK A;  3OYN A;  1ZBX A;  2ESW A;  1D3B A;  2X3X D;  3JCM W;  2DXT A;  3SHW A;  2EQU A;  2CP5 A;  3EH1 A;  2EGC A;  2K5I A;  2DK3 A;  3SB2 A;  3J80 E;  1YHQ Q;  1G3Y A;  1WQ7 A;  2GTJ A;  3CME Q;  1PCX A;  1TS9 A;  3I56 Q;  2RK1 A;  3QG1 A;  3ZL7 C;  4JDS A;  1GXI E;  4C5H A;  2KNB B;  4C0F A;  1K8A C;  2M0O A;  4C92 D;  1QW1 A;  3FEO A;  2K79 A;  1LJO A;  4XK8 E;  2HQX A;  4JZ3 A;  2YUO A;  1VA7 A;  2KI7 A;  4C8Q G;  2QQS A;  1U06 A;  3PFS A;  1XNI A;  5LJ3 e;  2M51 A;  1B07 A;  2X4J A;  1SKU B;  3M59 A;  3CCV T;  4M78 G;  2BKD N;  2D8J A;  4CC4 B;  4MZT A;  3OYE A;  4C92 F;  1JJ2 S;  1VQ5 T;  1VQO A;  1KIK A;  2WSE E;  3QWY A;  3OYJ A;  2YRC A;  1GCQ C;  1RAA B;  1YIJ T;  1V1C A;  1M1K U;  1FYN A;  2ROL A;  1G3W A;  1LPL A;  3REA B;  4J9D A;  3UDC A;  2L5Q A;  3PMI A;  3AT1 B;  1O75 A;  5CKE A;  1JU5 C;  4EMH A;  4B6M A;  3SWN A;  3PGG A;  1M9S A;  1CSK A;  3JCM P;  3TEE A;  3HFO A;  4DBR A;  1HD3 A;  2YXY A;  1X6B A;  2DZC A;  4L59 A;  3FJ5 A;  2CDT A;  4ZGE B;  5L23 A;  1WXU A;  5GAN g;  3RER A;  3CCU Q;  1NE8 A;  2HEQ A;  2L8D A;  4BUG A;  1NBE B;  2DKG A;  4EMK A;  1OOT A;  2OTJ A;  3JB9 G;  4J7I A;  4PNO A;  1WHM A;  2HBP A;  1RAH B;  4M75 B;  3MP6 A;  1VYU A;  1VQO Q;  2XDP A;  3BE3 A;  2QA4 T;  2RQU A;  2P84 A;  2K5F A;  4IKF A;  3RKY A;  4XU3 A;  7AT1 B;  2VXE A;  1OEB A;  3RUX A;  3PMT A;  1K9M U;  1ZUY A;  1UE9 A;  3OYD A;  2WSC E;  2QTX A;  1YJW A;  4C5G A;  2CP6 A;  3L2R A;  1BCM A;  4PL6 A;  1NYF A;  2HNI A;  4C8Q C;  4BI3 A;  3DB4 A;  4J9H A;  4M77 A;  2BUD A;  2QQA A;  2DX1 A;  2JMA A;  1RAC B;  4M78 C;  1VQ6 T;  1TG0 A;  2HMA A;  2K7A A;  4P5N A;  4M77 E;  3VJP A;  3Q1J A;  2AZV A;  4DBF A;  2OTJ Q;  2DRM A;  3CBO A;  1JO8 A;  3CCE T;  1D09 B;  2K3B A;  4E7H A;  1DJ7 B;  1Y96 B;  2X51 A;  2HL5 C;  2K4Y A;  1FMK A;  2NUT B;  1M2O A;  1SHF A;  4PJO D;  2EKH A;  2LQW A;  3VRZ A;  4BD3 A;  1N8R R;  5LJ5 g;  2CP7 A;  2RO0 A;  4ORZ A;  5CIU A;  3JCM d;  1UGQ B;  1YBY A;  4BY6 B;  1YJW Q;  2K6D A;  2GQV A;  2E5Q A;  2RHZ A;  1X2K A;  2KYB A;  4BE0 A;  3EG1 A;  2NWM A;  1LCK A;  3ME9 A;  3INZ A;  4PFO A;  5GAN 8;  1VQK A;  3KUF A;  4JRK A;  2CYZ B;  5IXF A;  2DVE A;  1W2B A;  4RUG A;  2MCN A;  2JTE A;  2DTH A;  1H3Z A;  4F7U A;  1UGR B;  1MMN A;  3ER0 A;  2R57 A;  1F1B B;  1M2V A;  1V76 A;  2EJG A;  2JZ2 A;  3VUZ A;  3G4S T;  3OMC A;  4LDW A;  2CT4 A;  2ED0 A;  4N0A C;  4ZTF A;  2ED1 A;  2RJD A;  2X4W A;  2PVD B;  1BIB A;  2X9H A;  3CC7 T;  1YCY A;  1MND A;  3CC7 A;  4PLL A;  3M0R A;  3CEY A;  3MP8 A;  3TSW A;  3HRU A;  1FWZ A;  4FSS A;  5CQX A;  2MK5 A;  5GAO m;  2QQB A;  2FYK A;  2J6O A;  4M7D D;  1U3O A;  1BI2 A;  3VU3 C;  2DET A;  4XU0 A;  2ECZ A;  4F16 A;  2L3P A;  5GMK e;  1YJ9 T;  2KMT A;  2E41 A;  1M90 U;  5A0L A;  1X6O A;  2DD4 A;  2KQW A;  1VQK Q;  4RG8 A;  1VQP T;  2LDM A;  1YWO A;  3H8Z A;  3P8B B;  4GBQ A;  3E1S A;  4J6Y A;  2YWW A;  4DEX A;  4LDX A;  1UHC A;  4KT0 E;  3OA6 A;  1W6X A;  3JCM V;  3M4G A;  5CKF A;  4BI8 B;  4ELZ C;  1TUG B;  1TWB A;  3BFM A;  5DM7 R;  5HK0 A;  4TVR A;  2DTI A;  3CCQ T;  1ZA1 B;  3CCQ A;  2H3J A;  4ZN1 A;  1KQS P;  2KK4 A;  1NLP C;  1WA7 A;  4JS5 A;  2OAU A;  2KSS A;  3L42 A;  5GAN 2;  1KQ2 A;  2B86 A;  2JS0 A;  4OB3 B;  1VQ7 Q;  4FYX B;  3RDV A;  5KYW B;  1GCP A;  2CZ7 B;  2DVJ A;  4FYY B;  3OYI A;  1MGQ A;  2KRM A;  1JBM A;  4O5V A;  3QZ9 B;  2GFA A;  3VUB A;  2PU9 B;  5KYY A;  2CKK A;  5GMK m;  1TOV A;  2PUO B;  2XD0 A;  5CR2 A;  4Y92 A;  9ATC B;  1YIT A;  4XAX B;  3JB9 H;  2JTF A;  5KYX B;  2CSQ A;  2DIQ A;  3E2U A;  4BDY A;  4M7A B;  1IHV A;  1JRI A;  3QHS A;  2FPF A;  1KHC A;  1UJY A;  2V8J A;  2ZCF B;  5FU7 C;  3LX7 A;  3TQ7 P;  4C5E A;  5KCO A;  4IUU A;  1VQ4 A;  1WHK A;  4IUP A;  4E6R A;  1NYG A;  1IB8 A;  1IRE B;  1OU9 A;  3M0P A;  2HDA A;  2NLU A;  2LJ0 A;  1W70 A;  2EGA A;  4V2S A;  2O2O A;  1NLO C;  5IT9 E;  2LJ3 A;  3DLL A;  1C0M A;  3VYH B;  3RBB B;  3EGD A;  3CC2 A;  1ZSG A;  2HAX A;  1G8X A;  2F2V A;  3VYG A;  1M4Z A;  1WLP B;  4Z8A A;  2CH4 W;  4GY5 A;  1NPP A;  1KD1 R;  5FLX E;  2K5L A;  1VQM Q;  3QII A;  5HKC A;  1YIT Q;  5D7U A;  4IUQ A;  1M1F A;  1AT1 B;  1N9R A;  1Y0M A;  1D1B A;  3V7S A;  2VKN A;  3TVT A;  1D1A A;  1B34 A;  1WZO A;  3QKJ A;  1W2B S;  4PJO B;  2XKO C;  3OYA A;  1ZA2 B;  2IG0 A;  3G6E T;  4J9G A;  4J6W A;  1VQ4 Q;  4FYW B;  3I55 T;  2Y4X A;  2A0F B;  1B7T A;  4C92 G;  1ZLM A;  3CCR A;  3TSZ A;  2DA9 A;  3A8H B;  1Q95 G;  3CC2 Q;  3SFM A;  1BYM A;  1IRX A;  4J9I A;  4Q5W A;  2A28 A;  2C0I A;  1QLY A;  1GCQ A;  1TU0 B;  2J05 A;  3OYM A;  2E65 A;  4XTZ A;  3REB B;  3CCS T;  4X9D A;  1XQH A;  4N4I A;  2AHJ B;  1EZZ B;  1NPR A;  1QVG P;  3EFS A;  3OQ5 A;  3WXM B;  2RJE A;  2X3W D;  1E7O A;  1Q82 C;  3GOX A;  1M27 C;  4CC7 A;  3QJY A;  1K0X A;  4M7D B;  4HCZ A;  1AVZ C;  3NPF A;  3CCR Q;  2RK2 A;  5LJ5 f;  2YRV A;  1Y71 A;  5CVI A;  1PC0 A;  4FM4 B;  3UAT A;  2RQT A;  3M53 A;  4VUB A;  4L5G A;  3CC4 T;  3CC4 A;  1BI0 A;  2HKQ B;  1MHN A;  2MPX C;  1PD1 A;  1N27 A;  2PQW A;  1P92 A;  3GLX A;  1N9S A;  1AWJ A;  2GBQ A;  1KD1 C;  2EYW A;  3H0F A;  3FIF A;  3I5R A;  1VQ9 T;  3EG9 B;  4M75 D;  5LJ5 h;  1M90 C;  3GIB A;  3TCJ A;  3CD6 T;  3CD6 A;  4E7J A;  4MDX A;  1NM7 A;  2J06 A;  3OB9 A;  4Z89 A;  4C8Q A;  4C92 C;  4J9E A;  2DE0 X;  4FIB A;  2RM4 A;  2X35 A;  1BU1 A;  2V1Q A;  3GP8 A;  2E6Z A;  4C8Q E;  4M78 A;  2J7I A;  4GLM A;  2L3Q A;  3DB3 A;  3NMZ C;  1UB4 A;  4M75 F;  1OX8 A;  4FW2 A;  2RA2 A;  3OYG A;  3EGX B;  2GQI A;  1Q7Y R;  1D0Z A;  1V29 B;  2ZPH B;  5GAN 3;  1X69 A;  2BE9 B;  2DL7 A;  2EWN A;  1AWW A;  2FEI A;  3S6W A;  2AK5 A;  3C4S A;  3MO8 A;  3CD6 Q;  1JEG A;  2DER A;  1WJQ A;  4GLK A;  2QEX A;  3GPL A;  2CP0 A;  1FMW A;  4PJO G;  2L3S A;  4Z88 A;  4IUR A;  3A8M B;  3G7Z A;  2LRQ A;  1QCF A;  2VC8 A;  1UEB A;  2CP3 A;  2DXB A;  2NUP A;  3SDZ A;  2LZ6 B;  4R55 A;  3LYI A;  3CCL A;  1UHF A;  3U23 A;  2HCK A;  3O8V A;  2QYZ A;  3HHT B;  2XDD A;  2D9T A;  4MML A;  2L3R A;  1KHI A;  2YDL A;  4DEY A;  5GAM g;  3JCM f;  1QP3 A;  2FO0 A;  3ZBD A;  5KYU B;  3M57 A;  4N0A A;  1D3B B;  3R6N A;  2JT4 A;  1QCO A;  3OSV A;  5CQY A;  1SRL A;  1HSQ A;  2O9S A;  2RNA A;  3A5Z B;  1K4U S;  1OZ3 A;  1SG5 A;  2LC4 A;  3UF4 A;  4JRP A;  2JVV A;  2BE7 D;  2K2M A;  1YJN Q;  2RH2 A;  3G71 T;  4HA8 A;  1NJI R;  3H41 A;  2QEX Q;  2XK0 A;  4PK4 A;  1BI1 A;  3JCM h;  2JM8 A;  5FWC A;  2I0N A;  1WFW A;  2LNH B;  1TH7 A;  2DBK A;  1RI0 A;  4M7D G;  2DPP B;  3EHQ A;  3OS5 A;  2M1H A;  3CCL Q;  3MEV A;  1VUB A;  1I5L A;  1R8O B;  5CKH A;  5A0D A;  2H3E B;  1ZHI A;  3A8O B;  2JN0 A;  4OB0 B;  1BBZ A;  3UPU A;  3MEA A;  3FDR A;  4MZP A;  1K73 R;  2KRS A;  3S3O A;  2RF0 A;  4J8O A;  3LWI A;  1Q7Y C;  1WJS A;  2EVR A;  1N8R U;  3CCV A;  4Y91 A;  1VOM A;  1UUE A;  5LJ3 g;  1VQ5 A;  1WHL A;  3EFO A;  3OS1 A;  5LJ5 d;  1YIJ A;  5CKB A;  3X20 B;  4LD6 A;  3V8K A;  2RHI A;  2QGG A;  2RB6 A;  1QVF P;  1RAE B;  4OML A;  4HCB A;  2LQN A;  3SWN B;  3X26 B;  2X4Y A;  5C0M A;  1TUC A;  2HQE A;  2ZGW A;  5IHI A;  4ZGJ B;  3AHU A;  5IHN A;  4LUE A;  5FU6 C;  1BB9 A;  2F2W A;  8ATC B;  4UC4 A;  2QGF B;  2KVQ G;  2E12 A;  4AT1 B;  4EMK B;  4A4F A;  2VGN A;  4XQ3 A;  4NL3 A;  3I35 A;  1OX9 A;  4KUD K;  2EW3 A;  4RKU E;  2EAY A;  2OTL T;  5CO7 A;  2RI3 A;  2KEA A;  1PRM C;  3CCV Q;  1ZSZ C;  1ZBJ A;  3KBG A;  1PSF A;  2PTK A;  2GTO A;  1VQ5 Q;  4KRT A;  2QDY B;  2QA4 A;  1PRL C;  1UGP B;  3PT9 A;  1RAI B;  4DA4 A;  1YIJ Q;  4M7A D;  1RLP C;  2CUD A;  2FVU A;  1PKT A;  2EQI A;  4LDY A;  1NJI C;  1M8V A;  1M3C A;  2CZ1 B;  1ABO A;  1WXT A;  4M77 B;  2DYI A;  4FT2 A;  1XTD A;  4E7S A;  4WTO B;  3H0I A;  4KGX B;  2DD5 A;  4MDW A;  3V7C A;  4Z02 A;  1OZ2 A;  2P0K A;  1M5Q 1;  4X9C A;  3URG A;  4JRI A;  4M7A F;  4R56 A;  2HD0 A;  1K73 C;  1VQ6 A;  2GF7 A;  4OF1 A;  1ZX6 A;  2RN8 A;  1VQN T;  1N5Z A;  4PJN A;  4WF2 A;  2CT3 A;  2VYT A;  3MEW A;  3CCE A;  1RAB B;  2JJ9 A;  2V8I A;  3JB9 I;  1QVG A;  1TUD A;  1Y07 A;  2LQK A;  2KE9 A;  2QA4 Q;  1JJ2 P;  2JXB A;  2E1H A;  5AYF A;  2Y4Y A;  3UA6 A;  5M9O A;  4A4G A;  4RTV A;  2O4X A;  3L2W A;  3QDF A;  1X43 A;  4F14 A;  1WYX A;  1MV0 B;  1WXB A;  1VIF A;  2A7Y A;  1QMC A;  3RES A;  1C1A A;  4F7U B;  1BK2 A;  3RMQ A;  2EYY A;  1M2V B;  4RTX A;  3VS6 A;  1FMV A;  4J5Y A;  2RD1 A;  2L2P A;  2OJ2 A;  2QAS A;  1QKW A;  1VQ6 Q;  4PJO F;  1Q82 U;  1X6G A;  2EFI A;  2RHY A;  5KH6 A;  1MNE A;  1OU8 A;  3G4S A;  4K11 A;  1UJ0 A;  4YTL A;  5DLQ E;  1BIA A;  3CCE Q;  3QUI A;  1ARK A;  2EQM A;  3H9N A;  5GAN j;  4B9X A;  3FJP A;  3HSB A;  2MWO A;  5GJV B;  1CKA A;  2RPN A;  2DEU A;  3MKD A;  4QQ6 A;  2A36 A;  2ENM A;  2M16 A;  3OYL A;  2LP5 A;  2W10 A;  2DTO A;  3OBW A;  1KD1 U;  2X4X A;  1J3T A;  4X34 A;  5HCK A;  4ZGD B;  1YJ9 A;  2A3L A;  2XID A;  4KUL A;  3L2Q A;  1NEB A;  3L1A A;  2HL3 A;  2HBW A;  1VQP A;  4XTX A;  2LT1 A;  2PUK B;  4XTU A;  5DY9 A;  4JLI A;  5IH2 A;  5AT1 B;  1GBR A;  4A4E A;  2LMJ A;  2BZY A;  3G4S Q;  4E7K A;  2YLC A;  3CCM T;  4M7D F;  1K0S A;  3P8H A;  4M75 G;  4C92 A;  1SF9 A;  2VB6 A;  5DLO A;  1Q86 R;  2PZ1 A;  1H8K A;  2VWF A;  2LJ1 A;  1JB0 E;  3M0Q A;  3CC7 Q;  3GNF B;  1WHH A;  4C92 E;  3FRN A;  4ANJ A;  4PJJ A;  5A0G A;  3L2Z A;  3CPF A;  4C0Z A;  2ABL A;  4M78 D;  5ECA A;  2JUF A;  1N8R C;  1WHJ A;  5GAM h;  1NEG A;  1R77 A;  3QWX X;  4LD9 K;  4FL6 A;  5GAN 5;  2DBM A;  3DKM A;  1YJ9 Q;  2O9V A;  2EKO A;  5LJ5 j;  5KYY B;  2KXC A;  3JCM e;  4A63 B;  1VQP Q;  1R0C B;  2W0Z A;  2B8A A;  2JTM A;  3FB9 A;  3CCJ T;  1U1S A;  3PIP A;  1I1J A;  2YSQ A;  4QVD A;  2DLP A;  4F04 B;  5I2S A;  1PM3 A;  1AOJ A;  1I8F A;  4RMO A;  3FLG A;  1KC8 R;  1EIF A;  3CCQ Q;  4RTZ A;  2VVK A;  2GCX A;  4PJL A;  3JV3 A;  2NUZ A;  5KCH A;  3BW1 A;  1M1G A;  5L8R E;  1KSW A;  2D8H A;  3EGD B;  1WHG A;  3VS3 A;  2DL5 A;  3NTK A;  2P4R A;  1QVG S;  4HCC A;  2DJQ A;  2DAQ A;  1Z9Q A;  3A8G B;  4CRI A;  2V8K A;  4F7U G;  4QW2 A;  2ZAE A;  5CCA A;  3LWH A;  1YNZ A;  3ULR B;  1HK9 A;  2NYS A;  5CAI A;  2ROT A;  4XTY A;  3QDR B;  3NGP A;  4M75 C;  3JCM c;  1B34 B;  4OB2 B;  5GAN f;  3OW2 P;  3CMA T;  3CMA A;  1VQL T;  1G83 A;  4LXC A;  1WJR A;  2LTO A;  5D6X A;  1Z9Z A;  2E5K A;  2FRW A;  2COY A;  2SRC A;  3DLM A;  3EG0 A;  1Q86 C;  3OSS C;  4RG2 A;  1SPK A;  3H6Z A;  2J6F A;  4J7F A;  2FL7 A;  2P4T A;  3G6E A;  3HP9 A;  3RIR A;  3HFN A;  4LE9 A;  1Q7Y U;  3I55 A;  2EBP A;  3OMG A;  3P8D A;  3M0T A;  5GAN h;  2DNU A;  5J26 A;  2CGH A;  3JCM b;  5GAO r;  4QQD A;  5GAN 7;  2HZY A;  1SHG A;  2DO3 A;  4CC3 A;  1K9A A;  3WVD B;  6AT1 B;  1HYO A;  2EIF A;  4HKE A;  2DL4 A;  2JMC A;  1VYV A;  2EJF A;  1PSE A;  1WI7 A;  3PNW C;  2F2X A;  4XTW A;  3CMA Q;  4PJO E;  4F17 A;  1T0H A;  2RQR A;  3CCS A;  5HY6 A;  3I5S A;  4A4K A;  2D1X A;  1KC8 C;  2IPO B;  4JJC A;  2CUB A;  3PIO A;  3G6E Q;  4BY6 C;  1ZQ1 A;  1C6V X;  1RAF B;  3I55 Q;  4OB1 B;  2LCL A;  4ZNX A;  3JCM Q;  4IIO A;  4HT8 A;  4XTV A;  5GAM d;  2XHC A;  2MOX A;  2DEQ A;  4HCK A;  1Q81 R;  2J6K A;  3CBP A;  1A0N B;  1SSF A;  1ZSZ A;  3HL8 A;  3S3N A;  2EYZ A;  3V8J A;  1NJI U;  4FCY A;  2RI2 A;  1OUL A;  2O31 A;  2RQV A;  4C0D B;  3GF5 A;  4JJD A;  1PKS A;  1VQ9 A;  1QCN A;  3CCS Q;  2ZPE B;  1OPL A;  4C8Q B;  4FW1 A;  1KFZ A;  2KBT A;  4M7A G;  4M7D E;  4HVU A;  2ZPB B;  2DFU A;  2F5T X;  1W2B P;  4M78 B;  2EJ9 A;  2Z0W A;  1K73 U;  3I9Q A;  5I22 A;  4AFU C;  3A1P A;  3PTA A;  4JJB A;  3VS1 A;  2HKN A;  5I2M A;  3RKX A;  4M77 D;  4ME7 A;  2HSP A;  2QTV A;  4KH1 B;  3EFR A;  3KFV A;  3CC4 Q;  1TXQ A;  2SEM A;  3GNG A;  3V8L A;  4D6W A;  2QK0 A;  2C0T A;  1K8A R;  1Y7X A;  1ZUU A;  2YUP A;  3OYF A;  5LJ3 d;  1S72 T;  2DMO A;  4M4Z A;  4A53 A;  4KH0 B;  3JB9 J;  4QKU A;  1M30 A;  1UDL A;  2D0Q B;  1YI2 T;  4EDU A;  3THK A;  2V26 A;  1VQ9 Q;  1RI9 A;  4M77 F;  4QVZ A;  4XU1 A;  4J83 A;  4J9B A;  1X75 C;  1O9S A;  3OS2 A;  2NUP B;  1GFC A;  3HRS A;  2E4H A;  3QSU A;  5GAO q;  1X27 A;  2YLB A;  3JSC A;  4OMP A;  3CXC P;  2D6F A;  1YFN A;  3LW5 E;  5D6Y A;  4RTW A;  2KR3 A;  5GAN d;  1YHQ T;  2CZ0 B;  1Q81 C;  1XJW B;  5I11 A;  3CME T;  3SD4 A;  3I56 T;  3OY9 A;  4J6X A;  2CSI A;  3VS7 A;  5GAN 6;  3N5B B;  3OYB A;  3CPW P;  2H8H A;  2QI2 A;  5CK9 A;  1MMD A;  3S3M A;  2LCS A;  4M7A C;  1U1T A;  1IO6 A;  1KQS A;  3LLR A;  1T0J A;  3G71 A;  4NS5 A;  3RR6 A;  2EQJ A;  2CZ6 B;  4F7U F;  2GNC A;  4RCC A;  2VGM A;  3JCM X;  1KK7 A;  1JXO A;  3EG2 A;  3QYG B;  1I07 A;  2MI6 A;  1WGS A;  4CI0 C;  8AT1 B;  3TRE A;  4OMM A;  2KYM A;  2R58 A;  3E9G A;  1RLQ C; 
#chains in the Genus database with same CATH homology
 3UA6 A;  3EG3 A;  4RTV A;  2FPE A;  4Y92 A;  4WCI A;  1EFN A;  5IXB A;  1YP5 A;  1MUZ A;  4AG2 C;  1X43 A;  4F14 A;  2O88 A;  1WYX A;  1MV0 B;  2JW4 A;  1WXB A;  2CSQ A;  3M0U A;  2EYX A;  1B3Q A;  1SSH A;  1KJW A;  1ABQ A;  2FPF A;  3PVQ A;  4X1V A;  1UJY A;  1BK2 A;  3IQL A;  4IIM A;  3H0H A;  2EYY A;  4RTX A;  3VS6 A;  4R0K A;  4RTU A;  4E6R A;  1NYG A;  1M3A A;  2L2P A;  3M0P A;  2OJ2 A;  1GL5 A;  1QKW A;  2HDA A;  2LJ0 A;  1W70 A;  2EGA A;  1X6G A;  2O2O A;  5GJW B;  2CRE A;  1NLO C;  1NG2 A;  2LJ3 A;  1UG1 A;  4K11 A;  1UJ0 A;  1QKX A;  1UTI A;  3RBB B;  1ZSG A;  1HJD A;  1ARK A;  2YUQ A;  2F2V A;  1WLP B;  2GGR A;  4Z8A A;  2CH4 W;  1M8M A;  4AFZ C;  5GJV B;  2C0O A;  4LN2 A;  1CKA A;  2RPN A;  4ESR A;  4J9F A;  4LNP A;  2A36 A;  2ENM A;  4QT7 A;  3PE0 A;  1X2Q A;  2LP5 A;  2W10 A;  4HXJ A;  1H3H A;  1Y0M A;  2OI3 A;  2VKN A;  3TVT A;  1J3T A;  2AKK A;  5IHK A;  1AEY A;  5HCK A;  4D8D A;  2KXD A;  4J9G A;  2QDL A;  1ZUK A;  1NEB A;  2M0Y A;  2HBW A;  1PWT A;  1ZLM A;  5IH2 A;  1GBR A;  2YUN A;  2IIM A;  2LMJ A;  3TSZ A;  1YCS B;  2DA9 A;  2BZY A;  1CKB A;  1WDX A;  1K0S A;  2EGE A;  1E6G A;  4J9C A;  3VS0 A;  4J9I A;  2DYB A;  2PZ1 A;  1H8K A;  1PNJ A;  2VWF A;  2LJ1 A;  3RNJ A;  3M0Q A;  2A08 A;  1OPK A;  1UFF A;  2C0I A;  2A28 A;  1QLY A;  2AZS A;  1GCQ A;  3A98 A;  1JXM A;  2J05 A;  2EPD A;  3M0S A;  2ABL A;  5ECA A;  3REB B;  1XOV A;  2BZ8 A;  1NEG A;  4AFQ C;  4CC2 A;  1WX6 A;  3QWX X;  2DM1 A;  2DBM A;  2O9V A;  1QWE A;  2DIL A;  4RTT A;  2X3W D;  1AZE A;  2AKL A;  1E7O A;  2BZX A;  1JQQ A;  1WIE A;  1M27 C;  4CC7 A;  2DRK A;  2KXC A;  2ESW A;  2MIO A;  4A63 B;  2X3X D;  1K0X A;  2W0Z A;  3SHW A;  3PVL A;  1AVZ C;  1I1J A;  2CH4 A;  2YSQ A;  3NPF A;  2EGC A;  2DLP A;  4EIK A;  2GTJ A;  3UAT A;  1AOJ A;  2RQT A;  3C0C A;  3ZL7 C;  1YN8 A;  1T3L A;  4RTZ A;  2KNB B;  1T3S A;  2VVK A;  3JV3 A;  2NUZ A;  2K79 A;  1AWJ A;  2GBQ A;  2EYW A;  3H0F A;  2XMF A;  2DL8 A;  3I5R A;  3VS2 A;  4JZ3 A;  2YUO A;  1VA7 A;  1KSW A;  2D8H A;  3VS3 A;  1U06 A;  4LUD A;  2DL5 A;  2M51 A;  2P4R A;  1B07 A;  2DJQ A;  1NM7 A;  1UGV A;  2V1R A;  2J06 A;  1Z9Q A;  4Z89 A;  2D8J A;  1W1F A;  4CC4 B;  1YNZ A;  3ULR B;  4J9E A;  2DE0 X;  1KIK A;  4OMO A;  2D0N A;  2ROT A;  1BU1 A;  2V1Q A;  3QWY A;  1E6H A;  1GCQ C;  2J7I A;  4GLM A;  1AWO A;  3NGP A;  2L3Q A;  1V1C A;  3NMZ C;  1FYN A;  2ROL A;  3REA B;  4J9D A;  1G83 A;  4RTY A;  2KT8 A;  1K1Z A;  1Z9Z A;  2GQI A;  1JU5 C;  2E5K A;  2FRW A;  2SRC A;  3EG0 A;  1X69 A;  4HVV A;  1SPK A;  2J6F A;  2DL7 A;  1CSK A;  1AWW A;  2FEI A;  1QWF A;  1HD3 A;  4LE9 A;  1X6B A;  1VYT A;  2AK5 A;  3FJ5 A;  2EBP A;  2CDT A;  5L23 A;  1WXU A;  3M0T A;  1JEG A;  2HEQ A;  2DNU A;  1OOT A;  1SHG A;  2L3S A;  2RQW A;  4CC3 A;  1SRM A;  1AZG B;  4Z88 A;  1K9A A;  1QCF A;  1VYU A;  3VS5 A;  2LZ6 B;  2RQU A;  2DL4 A;  2JMC A;  2RMO A;  1UHF A;  1VYV A;  3U23 A;  1WI7 A;  2HCK A;  2F2X A;  2DF6 A;  3SEM A;  1M3B A;  1OEB A;  4F17 A;  4DEY A;  1T0H A;  2RQR A;  2YDL A;  1S1N A;  3NHN A;  3I5S A;  1ZUY A;  1UE9 A;  2FO0 A;  1GFD A;  2D1X A;  3R6N A;  2JT4 A;  4JJC A;  4AG1 C;  2CUB A;  2KT1 A;  1NYF A;  1SRL A;  2OAW A;  1HSQ A;  2O9S A;  2RNA A;  2JS2 A;  4J9H A;  1K4U S;  3VRY A;  2DX1 A;  4JPB W;  3UF4 A;  2JMA A;  4ZNX A;  1I0C A;  2K2M A;  4HVW A;  4IIO A;  1TG0 A;  2K7A A;  2MOX A;  3H41 A;  4HCK A;  2AZV A;  2J6K A;  1A0N B;  1SEM A;  2DRM A;  2KGT A;  1JO8 A;  2JM8 A;  5FWC A;  2L0A A;  1PHT A;  2I0N A;  1WFW A;  2K3B A;  2LNH B;  2DBK A;  2EYZ A;  3EHQ A;  2DL3 A;  2RQV A;  2LX7 A;  2O31 A;  1FMK A;  1GBQ A;  1SHF A;  2EKH A;  4JJD A;  1RUW A;  2LQW A;  1BBZ A;  3VRZ A;  1PKS A;  2KRO A;  1UEC A;  4ORZ A;  1AWX A;  4JZ4 A;  2KRS A;  1OPL A;  3EHR A;  2RF0 A;  1KFZ A;  2K6D A;  2KBT A;  4HVU A;  1X2K A;  2KYB A;  1OV3 A;  4AFS C;  2EVR A;  3EG1 A;  2NWM A;  1LCK A;  3I9Q A;  5I22 A;  4AFU C;  1UUE A;  5IXF A;  4JJB A;  3VS1 A;  3VS4 A;  4RUG A;  3O5Z A;  2MCN A;  2JTE A;  3UA7 A;  2G6F X;  1YWP A;  2HSP A;  4OML A;  2LQN A;  3KFV A;  2SEM A;  2A37 A;  1TUC A;  2CT4 A;  2ED0 A;  2C0T A;  2ED1 A;  5IHI A;  1ZUU A;  5IHN A;  4D8K A;  4LUE A;  1BB9 A;  1Y57 A;  2YUP A;  2F2W A;  1H92 A;  2DMO A;  1K76 A;  3M0R A;  4M4Z A;  1M30 A;  1UDL A;  3TSW A;  2FPD A;  3I35 A;  3THK A;  4FSS A;  1RI9 A;  1GRI A;  2EW3 A;  2J6O A;  1U3O A;  4J9B A;  2KRN A;  2ECZ A;  4F16 A;  5FWB A;  2L3P A;  5EC7 A;  1GFC A;  2KEA A;  1PRM C;  1ZBJ A;  1X27 A;  2PTK A;  2GTO A;  4OMP A;  2K9G A;  1YWO A;  4KRT A;  4GBQ A;  1PRL C;  4DEX A;  1RLP C;  2CUD A;  1UHC A;  2FG0 A;  4RTW A;  2KR3 A;  1W6X A;  1PKT A;  2EQI A;  1M3C A;  3EGU A;  5I11 A;  1ABO A;  2PNI A;  1WXT A;  2CSI A;  3VS7 A;  2BTT A;  1U5S A;  1G2B A;  4OMN A;  3H0I A;  3LH5 A;  2H8H A;  2FRY A;  1AD5 A;  1NLP C;  1WA7 A;  2LCS A;  1IO6 A;  2B86 A;  2JS0 A;  1T0J A;  1ZX6 A;  2RN8 A;  2YT6 A;  2GNC A;  1N5Z A;  1GCP A;  2JM9 A;  2DVJ A;  2CT3 A;  1JXO A;  1MV3 A;  3EG2 A;  1I07 A;  3CQT A;  2KRM A;  5FW9 A;  4OMQ A;  1TUD A;  2KYM A;  4OMM A;  3GBQ A;  2KE9 A;  2JXB A;  1RLQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...