1SHGA

Crystal structure of a src-homology 3 (sh3) domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Src-homology 3 (SH3) domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cytoskeleton
molecule keywords ALPHA-SPECTRIN SH3 DOMAIN
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1993-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1shgA00
1E7OA 4GBQA 2J6OA 1V1CA 1NLOC 2H8HA 1VA7A 3M0UA 4HVVA 1M30A 1AD5A 2RQRA 2EYZA 2KBTA 1X43A 2ROTA 1T3LA 3VS3A 1A0NB 2K2MA 2KT8A 1BU1A 1Y0MA 1UECA 1SRLA 2YUOA 1QWEA 4JPBW 1NM7A 3EHQA 1NYGA 5IHNA 4F16A 2KEAA 1X69A 1B07A 3IQLA 2DL8A 2K6DA 2L3SA 2JW4A 1X6GA 4J9FA 2AZVA 5ECAA 2B86A 2YUNA 1K0SA 2G6FX 2JS2A 3VS5A 2JM9A 1Y57A 4M4ZA 1NEGA 4ESRA 1OV3A 3NPFA 3PVLA 1QLYA 2DMOA 3M0TA 2KXDA 1RLQC 1MUZA 1WXBA 2HCKA 2VKNA 4ZNXA 2AZSA 2OAWA 4RTXA 2EW3A 2A36A 5FWBA 3M0RA 2K3BA 2A28A 2W0ZA 2ECZA 3M0SA 2DL5A 1GL5A 1QKWA 1OPLA 3EG1A 4RTWA 2ENMA 2LCSA 1WDXA 3NHNA 1M3CA 1QCFA 4AFZC 4JZ3A 2ED1A 3TSWA 4F17A 1PNJA 2CREA 2J05A 1WX6A 2YUQA 3KFVA 2EYYA 1Z9QA 1UHFA 3REAB 2FPFA 2IIMA 2J6KA 2KXCA 1ZX6A 2RQTA 3NGPA 1X27A 4OMPA 4HCKA 3VS7A 1G83A 3EG3A 3U23A 2SEMA 2D1XA 2DBMA 3M0QA 2EGEA 1GCQC 2L3QA 1J3TA 2DLPA 1UJYA 2KYBA 1YNZA 1K9AA 3SEMA 5I11A 4Y92A 2L0AA 1KIKA 1VYVA 4J9HA 1YN8A 2DL3A 1QWFA 1OPKA 4EIKA 2KYMA 2EPDA 2CT4A 2VWFA 1UFFA 2RMOA 1GCPA 3JV3A 1ZSGA 2E5KA 4RTUA 1H8KA 2RQVA 2LJ3A 3H0FA 2KNBB 1AZGB 3GBQA 3I35A 2MCNA 2LJ1A 2JMAA 2ESWA 2YT6A 1UE9A 4LE9A 5IHKA 2DJQA 2FPEA 2GGRA 1YWPA 1SRMA 1UHCA 1U5SA 3PVQA 4AFQC 2DL4A 2X3WD 1GBRA 2CH4W 2CH4A 2CSQA 2DBKA 1JO8A 1BK2A 2F2VA 1BB9A 1VYTA 3VS0A 1AVZC 1ZUYA 2QDLA 2FPDA 1WA7A 4E6RA 2PTKA 4FSSA 2RPNA 4D8DA 3C0CA 2F2XA 4DEYA 2CT3A 2KRNA 1XOVA 2LJ0A 1PKSA 2C0OA 2SRCA 1E6GA 1GFDA 3RNJA 1HSQA 1TG0A 3VS2A 3H0HA 1HJDA 2GQIA 5EC7A 2D8JA 1WIEA 1M27C 3A98A 2HBWA 3H0IA 5IH2A 4JJCA 2KR3A 2J06A 1ZBJA 1ZLMA 4CC2A 1WI7A 1EFNA 1S1NA 4CC7A 4RTVA 2DRKA 2AK5A 2DA9A 1UTIA 2EVRA 2DX1A 1SSHA 1KFZA 1GBQA 2O88A 3ULRB 3VRZA 1H3HA 4K11A 1AWWA 1ZUKA 4J9BA 2VVKA 4OMNA 2KGTA 2HEQA 3RBBB 3QWXX 2O31A 2F2WA 4QT7A 1PHTA 3EG0A 2DVJA 1GCQA 3LH5A 5L23A 1N5ZA 1CKAA 2EYWA 2AKKA 4OMQA 1IO6A 1PWTA 1RLPC 2GTJA 2A37A 1TUDA 3EG2A 2LQNA 2M51A 1NYFA 4D8KA 1FYNA 1SEMA 1YWOA 2EYXA 4J9GA 2C0TA 2BZYA 4J9IA 3UA7A 1AWXA 2HSPA 2CUDA 3FJ5A 2LP5A 1SPKA 4IIOA 2PNIA 4OMOA 1JU5C 2ED0A 1FMKA 2GNCA 1SHGA 1GRIA 4Z8AA 3I5SA 4AFSC 3EGUA 3VS6A 1X2KA 2LZ6B 1T0JA 5IHIA 2EGCA 2RNAA 3H41A 5I22A 3ZL7C 3VRYA 4KRTA 1Z9ZA 3THKA 2EGAA 2RQUA 2RQWA 2YUPA 1WLPB 5FWCA 1X6BA 1ABQA 1ABOA 1AEYA 2DILA 2DNUA 2CSIA 1WFWA 1B3QA 1W1FA 2CDTA 1CSKA 1TUCA 1QKXA 4LN2A 1UG1A 1UUEA 4RTYA 5FW9A 3M0PA 2DRMA 2EBPA 2JMCA 1PRLC 2KRSA 2RN8A 1UGVA 2V1QA 2D0NA 2MIOA 4WCIA 3I9QA 1KJWA 4X1VA 3UA6A 2DM1A 1NLPC 2LNHB 2GBQA 2JTEA 3R6NA 2OI3A 4RUGA 1YP5A 1M3AA 2NWMA 1WXUA 3UF4A 4A63B 2O2OA 3NMZC 1OEBA 5GJWB 2GTOA 5IXBA 1JQQA 1U06A 2HDAA 2JT4A 2J6FA 2MOXA 1UDLA 2BZXA 2O9SA 3TVTA 4R0KA 1RI9A 4ORZA 4JJBA 2M0YA 4F14A 1JXOA 4JZ4A 3CQTA 4AG2C 1ZUUA 4GLMA 1YCSB 2XMFA 2DYBA 1OOTA 4JJDA 1VYUA 2L2PA 2KROA 2LMJA 2EKHA 1LCKA 2BZ8A 2PZ1A 1K76A 3TSZA 2W10A 4J9CA 2YSQA 4LUEA 2DL7A 3VS4A 1AWJA 2BTTA 2KT1A 1JXMA 4LNPA 4J9EA 4DEXA 1NG2A 1T0HA 2OJ2A 1K4US 2K7AA 2KE9A 3PE0A 1H92A 2YDLA 2DF6A 2ABLA 2NUZA 1E6HA 1K1ZA 2V1RA 1PRMC 4RTTA 2C0IA 2O9VA 4AG1C 1CKBA 2AKLA 5IXFA 2FRWA 2DE0X 3O5ZA 2K79A 3QWYA 2FRYA 1ARKA 1MV3A 1U3OA 1AZEA 2FG0A 1WYXA 1T3SA 1GFCA 1UJ0A 2LX7A 5GJVB 2FO0A 1RUWA 2P4RA 3I5RA 4HVUA 4HVWA 2EQIA 4AFUC 1AOJA 4OMMA 4RTZA 4CC3A 2LQWA 1HD3A 1M8MA 1W6XA 2I0NA 4IIMA 1I07A 1NEBA 1I1JA 2A08A 2JS0A 1WXTA 2JM8A 3REBB 1AWOA 2D8HA 3UATA 2RF0A 3VS1A 2FEIA 4LUDA 2L3PA 4OMLA 2X3XD 1I0CA 4Z89A 1G2BA 2J7IA 3SHWA 4Z88A 5HCKA 1MV0B 2KRMA 1M3BA 2CUBA 2JXBA 2K9GA 1JEGA 1K0XA 1BBZA 4HXJA 1PKTA 1KSWA 4CC4B 1X2QA 1W70A 4J9DA 3EHRA 1SHFA 2ROLA
chains in the Genus database with same CATH superfamily
5LJ5j 1D0XA 4EMHA 2H3JA 2J6OA 1D3BB 3L42A 1Q81C 1KG1A 5GANe 1VQ8T 5J26A 2L89A 3I55Q 1MMAA 2JTMA 3UWNA 2IG0A 2RQRA 3HKSA 2EYZA 2KBTA 1C6VX 4M78F 3G6ET 1T3LA 1IHVA 2G3RA 5GAN8 3J81E 4N4IA 1UECA 4PJOD 1NM7A 3EHQA 4BE2A 1B07A 2RI2A 2CS7A 2K6DA 3OY9A 4AT1B 4FU6A 1LNXA 2GQVA 4J9FA 3UT1A 2AZVA 2L5QA 2YUNA 1JJ2A 1WQ7A 1TTHB 3OMCA 4LDVA 2HL3A 1NEGA 1WHGA 1H641 4RMOA 3PVLA 3FJPA 4Q5WA 2LNVA 1QCOA 4R55A 3CMEQ 4DBHA 1R0BG 3DB3A 2E12A 1UGRB 2AZSA 5IAYA 2RHYA 2A36A 1KQSS 3M0RA 1RAHB 1W2BA 2A3LA 1IB8A 5GMKj 2DL5A 1HK9A 1QKWA 4RTWA 3ASKA 1WDXA 4ME7A 1KD1U 3T9NA 4M7DA 4HKEA 1WNLA 1N9RA 2J05A 1W2BP 3P8HA 2ZPHB 3HFNA 1N8RR 4JLIA 2FB7A 3JSCA 1IREB 3G7ZA 2RQTA 4HCKA 4B9XA 2K3XA 3EG3A 1M5Q1 2ZZDA 2D1XA 4M78D 2DBMA 2EGEA 1M9SA 4FCYA 4B6MA 1JJ2P 2YLBA 2OX7A 4F7UA 1VQLT 5CR2A 3LGFA 1IGQA 1VYVA 3LX7A 5C0MA 1YN8A 2JUFA 3OYBA 1OPKA 2PU9B 4F7UE 2KYMA 3HRSA 2F5KA 4EMKA 2VWFA 5CQYA 2BKDN 1G3WA 3I56Q 2LJ3A 3JB9J 2KNBB 1AZGB 4A4KA 3JB9G 2QA4A 2ESWA 2FPEA 4ELZC 1SRMA 1FX7A 1UHCA 3EGDA 5KYXB 4XTXA 4KGZB 2VASA 4AFQC 2D6FA 3LWIA 2E6NA 2Y4YA 4FYXB 3PMTA 1PG5B 3D7SB 1BK2A 4NOYA 3CCJT 3CPWP 4IUUA 2FPDA 6AT1B 3CCUQ 4KGVB 1OZ3A 5HK0A 2BE7D 3C0CA 2LCLA 2QQ9A 3QDRB 1VQMT 2X4JA 1GFDA 3OYGA 1TG0A 2DK3A 4J6WA 2GQIA 4IUQA 5A0GA 1M27C 5DLOA 2E6ZA 2KY9A 2HBWA 2OTLT 3M9QA 1VQ5T 2J06A 1ZLMA 2DXTA 3ME9A 4CC2A 1OX9A 1K73R 2L8DA 1YITQ 2DRKA 4ZTJA 2GFAA 1PSEA 2EVRA 3A5ZB 2RHZA 2F69A 4BE1A 2KQWA 3ULRB 1WGSA 1ZUKA 4OMNA 1OULA 2KGTA 4M78E 4C92D 2R57A 1Q7YU 3QWXX 2O31A 2WSEE 2MYSA 2CP5A 2VGMA 2P0PA 2QQRA 2EWNA 2DVJA 5L23A 2Y90A 4PKCC 4M7AE 3CMEA 3RERA 4V2SA 5GAN4 4BACA 3EG2A 3OMGA 4ATOA 2EYXA 5CKHA 4PFZA 1SPKA 1I4K1 5CQXA 1I5OB 4NL3A 2DETA 1VQPA 3MJXA 1TXQA 5CIUA 1WHLA 4C5EA 3CC7A 2GNCA 1ZBXA 3I5SA 4M75G 4AFSC 1YI2Q 1TUGB 1TH7A 1Y07A 1JB0E 1MMGA 2NLUA 2RNAA 2V8JA 5I22A 1VQLA 3VRYA 1EZZB 3CBMA 1UB4A 2MF2A 2EGAA 5GAOr 2RQWA 3OA6A 1WLPB 1R8OB 3OSSC 1ABQA 4PJOE 3JCMb 2DNUA 1WFWA 1B3QA 1CSKA 3OYLA 3M54A 3V8KA 4FL6A 1LPLA 2JMCA 4XU3A 3INZA 4BI8B 4RG8A 3OYAA 5GAMe 2MIOA 4WCIA 1WJRA 2FHDA 2QQBA 1NJIU 2DTIA 3RKXA 2WACA 5DLQE 1M2VA 1ZA2B 2KI7A 3E9GA 4J5YA 2JTEA 5LJ3h 2NUTA 2OI3A 1UGSB 1G5VA 3C94A 1VQKQ 5CKEA 2NWMA 4A63B 1WHMA 2O2OA 1OEBA 4DA4A 5GJWB 1NE8A 1W2BS 2Z0WA 2JZ2A 2QEXQ 3OS2A 3CC4A 3L2UA 4F7UF 4X9CA 1C0MA 2M0YA 1AHJB 4F14A 4QQGA 2YHTA 3CQTA 1QVGA 4GLMA 2DYBA 4M77D 4BB7A 2BUDA 5GAOp 2EKHA 3JB9F 4M7AD 3CC7Q 3OQ5A 3TSZA 2W10A 4LUEA 3CCLA 2RB6A 3CXCA 1AWJA 2KT1A 5GAMd 1JXMA 1OQKA 3H6ZA 4M77E 1NG2A 3JCMf 4M75E 2K7AA 2KE9A 2ATCB 2YDLA 2ABLA 2NYSA 4RTTA 5AYFA 3M58A 2NUPB 4PJOA 2R5AA 2K2VA 5J3BA 3OW2A 4KH1B 3QWYA 3HPWA 1MV3A 2FG0A 3I56A 3NFCA 1GFCA 1YHQQ 2CGHA 5GJVB 3I5RA 2P84A 2QI2A 3LGLA 1AOJA 1JBMA 2QYZA 3E2UA 3X28B 4CC3A 3QZ9B 2VXEA 5KYNA 4PNOA 5A0DA 1W6XA 1VQMQ 2E64A 2A08A 1WXTA 3E1SA 2D9TA 2DJZA 3UATA 4M7DD 3M53A 1QVFP 2PVGB 1ZA1B 1B34A 2ZPGB 1Q82C 4Z89A 1YJWQ 2HKQB 1MV0B 3GOXA 2KRMA 4EPCA 1QQJA 3QHSA 1YI2T 2K9GA 1BBZA 1PKTA 2HNIA 1X2QA 1YJWA 4J9DA 2RHXA 4JDSA 3CCLQ 1BIAA 1QVGS 2OTJA 3P8BB 1V1CA 5CCAA 3CCQT 2YWWA 4UC4A 1TS9A 1VQ7A 1Q95G 4PJMA 2DKGA 2RJCA 2P4TA 1X43A 3QO3A 1OI1A 3DLLA 1YJ9A 1SRLA 2XKOC 1M1KR 1NYGA 5IHNA 2KEAA 4LXCA 3UDCA 2DL8A 1VQNQ 2B86A 1K0SA 2JS2A 2PVOB 1YIJA 4QW2A 2JM9A 1ZQ1A 4M4ZA 1D1CA 2NUTB 1QLYA 2DEQA 2OTJT 1WXBA 2HCKA 4RTXA 5FWBA 3MPUB 1TU0B 1RAFB 2BIVA 1GL5A 2ENMA 4NL2A 3V8JA 3EGXB 3QZ5B 1M3CA 2K5FA 3CCET 4JZ3A 2ED1A 4BI3A 3TSWA 3CCVQ 3QSUA 3QPHA 2CREA 1WX6A 2YUQA 5FU7B 2R58A 3SB2A 3TEEA 1Z9QA 4EDUA 1UHFA 4OP0A 1K9MC 1VQKA 2FPFA 3GP8A 1P92A 2IIMA 4IUVA 1ZX6A 1G83A 4XTWA 4C8QE 3I55A 2JNGA 2X4WA 1J3TA 1UJYA 2KYBA 3CBPA 5KYYB 1D09B 2RI3A 1V29B 4M75F 4YTLA 5I11A 2X4YA 2QTXA 2CZ6B 3FIFA 2OAUA 4Y92A 3PIOA 3CCQQ 1ZSZA 2DL3A 1KC8C 5GAMj 3OB9A 1IZ6A 1GCPA 1UGPB 1ZSGA 1H8KA 1PSFA 1KHCA 1VIFA 2MCNA 2YT6A 2L3RA 4LE9A 2MI6A 4HT8A 1YWPA 4E7JA 3TQ7P 4M77G 3HP9A 2GCXA 2DL4A 2X3WD 4RKUE 4PL6A 4PJJA 1YCYA 2CZ7B 1Q86C 1H3ZA 1M90R 1YJWT 1VQNT 2DBKA 4PLLA 1JO8A 4ANJA 1NJIR 4A54A 2K5IA 3QXEB 2QDLA 4A53A 1YHQA 2GFUA 5I2MA 4EMKB 2F2XA 1K9MR 1VQ9A 1YI2A 3CCMT 3QBYA 1PKSA 4C92B 5GAN7 3PGGA 1HSQA 1D1BA 1M1KC 3H0HA 2AIRB 5EC7A 4II1A 3EGDB 2JVVA 4FSXA 8AT1B 3A98A 4JJCA 4DOWA 2KR3A 1ZBJA 1WI7A 1KD1C 1EFNA 4R56A 4RTVA 1VQNA 1B7TA 3VUZA 1B34B 5D6YA 1SSHA 1KFZA 4RCCA 3URGA 3VRZA 1QCNA 1M1KU 4J9BA 3PMIA 5LJ5d 1M4ZA 4BDYA 4QT7A 2KVQG 4J6YA 4MZMA 4M7AG 1BKBA 3VUBA 2QEXA 1CKAA 2AKKA 4XTVA 5LJ3e 2EFIA 3CCEA 2VGNA 4OMQA 2ZGWA 2E1HA 4A4EA 4M75C 4HCZA 5I21A 2ZPEB 3AHUA 4D8KA 1FYNA 1SEMA 3X24B 4PJOG 1YWOA 4M78G 4J9GA 2BZYA 5DY9A 1AWXA 3FJ5A 1Q86U 2LP5A 4M77A 3CCLT 2PNIA 1FWZA 5LJ3j 1MMDA 1Q7YR 1JU5C 4X9DA 1FMKA 2DIGA 4JUVA 4C5IA 4Y28E 1SHGA 4IURA 2XG8D 2EAYA 4FIBA 2COYA 2QQSA 2EQKA 1T0JA 2PVDB 2RI5A 3H41A 3CCRQ 1OU9A 5LJ5f 1YIJT 4EMKC 3THKA 3M4YA 5L8RE 3JCMJ 3S3OA 3V7SA 1M90C 1YITT 2COWA 1KC8U 2R5MA 2CSIA 2CDTA 1NPRA 4LN2A 1UG1A 1IGUA 5FW9A 4FT4A 4DBRA 1Y71A 4ZGJB 2EBPA 2EYQA 2EJFA 1MHNA 1QP2A 4FW1A 3CCRA 3GF5A 2RN8A 1EIFA 5HKCA 2DEUA 2D0NA 5LJ5g 4AMCA 1ZSZB 3UA6A 4MMLA 5GMKe 1K9MU 1NLPC 3FC3A 3R6NA 3RESA 3C95A 4PJOF 4RUGA 4GLKA 1M3AA 2M0OA 1WXUA 3UF4A 1KQ1A 3MP1A 5FU7C 2VV5A 3OS0A 3OBYA 2FYKA 3LH0A 5IXBA 1RAAB 4C0GA 3CD6T 5CAIA 3JCMd 4Y91A 4F7UG 1U06A 4QQDA 2HDAA 4M75B 4OB1B 4C0FA 2BZXA 2O9SA 4M77B 1VQ9Q 1EX4A 3S3NA 4O5VA 4JZ4A 3NTHA 1ZUUA 1KHIA 2XMFA 1OOTA 1NPPA 1VYUA 2D0QB 4XU2A 1RI0A 1KK7A 2L2PA 2BZ8A 3A8OB 2PZ1A 3QUIA 3C12A 1JRIA 5KCHA 3QDFA 3CCUA 3CCMA 3VS4A 3OYEA 2CP7A 5GANj 2BTTA 1S72T 1VQPT 4J9EA 2HD0A 4DEXA 2BE9B 3HHTB 1T0HA 1K4US 5LJ5e 4RCBA 1YBYA 1VQOQ 2CZ0B 3ZBDA 1K1ZA 2RA2A 1PC0A 2K4YA 1VQ6A 2AKLA 4QVZA 3AT1B 2DE0X 3O5ZA 4KUIA 4QVDA 5GAOn 1AZEA 3EG9A 4C5GA 1WJSA 1M2OA 2LX7A 4FYYB 2FO0A 4J8OA 4HVUA 1Y96B 2EQIA 3BDUA 1VOMA 4JJNK 4LDXA 2CKKA 4FM4B 2LCCA 3N5BB 2DVEA 1UEBA 3PNWC 3GIBA 3QIIA 1Q82U 2O4XA 2I0NA 4L6V5 2PQWA 1I07A 3EFOB 1AT1B 4XTUA 2JS0A 3CC4T 1QVPA 4OGEA 3S6WA 4LDWA 3VS1A 4M77C 4OMLA 3CD6Q 5GAN2 1I0CA 3SHWA 5GAOl 4PJNA 1N27A 4C92F 3KXTA 5LJ3g 5HK3A 1JEGA 3GPLA 1Q86R 4HXJA 1VQ5A 1KSWA 3CCRT 2HSEB 2QXFA 2X9HA 3EHRA 2DTOA 1D3BA 1E7OA 7AT1B 2AT1B 1BI0A 2DTHA 1ZHIA 2QQAA 3O8VA 2FZCB 2H8HA 5GMKh 4XQ3A 1VA7A 4HVVA 3L2WA 2P0KA 5FLXE 2ROTA 3EH2A 3VS3A 1A0NB 2KT8A 4WF2A 1PD0A 4XK8E 1BU1A 3RMSA 2XDBA 4JPBW 4X34A 2EIFA 4F16A 4C0ZA 1ACMB 1MGQA 4MDWA 1X69A 2JW4A 3G71Q 5ECAA 1M2VB 4C8QA 3VS5A 2P0QA 4JS5A 4ESRA 9ATCB 1OV3A 3NPFA 1KQ2A 5GAMf 2O4XB 1RLQC 1MUZA 2VKNA 4ZNXA 2MWPA 1K73U 2OAWA 2DXUA 1XNIA 5GMKl 4P5NA 2A28A 2RK2A 3DKMA 2W0ZA 4E7ZA 4C8QG 3CMAT 1QP3A 4FT2A 4PFOA 3NHNA 1O9SA 5LJ5h 4AFZC 3CMET 3CPWS 1FMVA 2E10A 1RAEB 1XQHA 1PNJA 1M90U 2E5QA 5IT9E 3L2VA 2KAFA 2EYYA 3OYNA 1YJNA 4F04B 5GAMh 5CKBA 4KUDK 1RAIB 3A8HB 2J6KA 2KXCA 2QAZA 3NGPA 4KBMB 1KC8R 3U23A 2SEMA 2H3EB 3M0QA 1GCQC 2L3QA 4XU0A 1YNZA 1D1AA 3HRTA 1OU8A 3CBOA 3CEYA 4BY6B 3LW5E 4C92C 4DBFA 2O01E 3SFMA 2L0AA 3PT9A 1KIKA 3L2RA 3WVDB 4DBQA 2HQXA 3CCJA 3CCSQ 1QWFA 4EIKA 1OX8A 2EPDA 1X01A 2CP0A 5LL6S 1UFFA 3BDLA 3JV3A 3RR6A 4OMFB 3I35A 1Y96A 2LJ1A 2JMAA 1UE9A 5IHKA 4M7AB 1I81A 2DJQA 2GGRA 2LT4A 2LDMA 1U8RA 1U5SA 2IPOB 1K8AR 2AHJB 2E3HA 2HL5C 4M78B 4E47A 3G71T 4M7DF 3EFOA 2DO3A 2F2VA 2RHUA 4LD6A 2ZCFB 4M75D 3MP6A 1WA7A 2M1HA 4E6RA 3V7RA 1VUBA 2PTKA 4FSSA 4D8DA 4DEYA 5GANg 2OTLQ 3CMAQ 4HT9A 3RIRA 3BE3A 1XOVA 2LJ0A 4N4HA 3CPFA 3X26B 4J7FA 2C0OA 4M7DG 1VQ6Q 1FMWA 2D8JA 1WIEA 1RACB 3H0IA 5IH2A 2EJ9A 3A8GB 1LVKA 2DPPB 2RO0A 2FL7A 4CC7A 1N6AA 2AK5A 5KE2A 5KH6A 4IKFA 2PUOB 2DX1A 1GBQA 4E7SA 2KMTA 1H3HA 5GAN5 1VIEA 1AWWA 1YIJQ 2LT1A 3QG1A 2HEQA 4FW2A 1VQ5Q 3KBGA 4BI4A 1S72Q 3META 2MK5A 3MEAA 2F2WA 1N9SA 4FYVB 1WHHA 3JCMV 1PHTA 4IUPA 1WPYA 3EG0A 2LC4A 1GCQA 3LH5A 1QVFS 3M4GA 4M78C 2EYWA 4OGCA 1X6OA 2HAXA 3JB9D 4M7AF 2GTJA 1PWTA 1RLPC 4DOVA 2A37A 2LQNA 1NYFA 1G3YA 2C0TA 2RHIA 2HSPA 4C92G 5GMKm 3CC2T 2XI9A 2E65A 4IIOA 4OMOA 4F7UB 1KQSA 2ED0A 3P8DA 1VQ4A 3F70A 4RG2A 1GRIA 4Z8AA 2YRDA 2XIDA 2QGGA 1X2KA 2LZ6B 2EJGA 3CCQA 5IHIA 2EGCA 4Z02A 3ZL7C 3OYMA 1K8AC 2HKNA 3FDRA 4KRTA 1RAGB 3Q1JA 2RQUA 3LYIA 2M02A 1MNDA 5D6XA 1VQOA 5FWCA 1X6BA 5KE3A 1Q82R 3OSVA 3ZFJA 1FXXA 5FU6B 3V8LA 5KYXA 4KH0B 1W1FA 3M5AA 1TUCA 1QKXA 4C8QC 4RTYA 3OS1A 2DRMA 2LTOA 1VQ6T 5AT1B 1PRLC 1W4SA 2KRSA 4ZN3A 3KUFA 3QYHB 4PJOC 4XU1A 1UGVA 5I2SA 1M1FA 2HMAA 4MZTA 3CCST 4X1VA 2FVUA 3MCAB 2MAMA 2RK1A 3LWHA 2DM1A 3SWNC 3OBWA 4EMGA 2LNHB 3VYHB 2QEXT 2X4XA 3L1AA 1R0CB 1YP5A 2DD4A 2QA4T 2RD1A 2XD0A 2WSFE 4QKUA 3E19A 2RJFA 3NMZC 1XTDA 4KT0E 2YRVA 1KD1R 1JQQA 1U1TA 5KYUA 4OB2B 4BUGA 3RMQA 2MOXA 1UDLA 2RM4A 3TVTA 5IN1A 1RI9A 2QASA 1DJ7B 4JJBA 5GAN3 1JXOA 2DXBA 1VQKT 3FRNA 2M9UA 3R6OA 1YCSB 1KQSP 2MMPA 2LMJA 2KROA 4C0DB 3JCMe 3EAEA 1K76A 2YSQA 2VYTA 2RJEA 2DL7A 2JOYA 4LNPA 4M77F 5M9OA 1VQLQ 1D0YA 4ZN1A 2K57A 3PE0A 1TWBA 2DF6A 2NUZA 2V1RA 1E6HA 2LRQA 2C0IA 2O9VA 2XHCA 4AG1C 3GNFB 5FU6C 1CKBA 3G4SQ 5IXFA 1JJ2S 3V7CA 3G71A 2FRWA 5CO7A 3VJPA 3EGXA 4HCBA 4E7KA 3FEOA 4N0AA 4C8QD 1T3SA 5GANh 2OTLA 5C6SA 1YJ9Q 4L59A 1RUWA 3H8ZA 4HVWA 4AFUC 2KDSA 4OMMA 4RTZA 2CP2A 2LQWA 5LJ3f 3MEUA 5GAMg 5CK9A 3CC2Q 2COZA 2GF7A 4M7DC 2EQUA 3PFSA 3QYGB 2JM8A 4J7IA 3REBB 1AWOA 1YJNT 3CXCS 2D8HA 1SG5A 2FEIA 4LUDA 2ZPIB 4PLIA 1BI1A 3CMAA 3A8MB 3JB9H 1VQ4T 5FRNA 2J7IA 3G4SA 3QKJA 1X75C 5HCKA 3BW1A 2I2LA 3CC2A 2CUBA 2JXBA 3RDVA 5FRMA 1M8VA 1K0XA 3HRUA 1G8XA 3OW2S 2YRCA 3OYFA 5D6WA 3CC7T 2DD5A 1BIBA 1SHFA 2ROLA 1QMCA 3BFMA 1K8AU 2B8AA 2FZGB 4GBQA 4BE0A 2DZ9A 2WSCE 1NLOC 3TREA 1NZ9A 5FROA 3M0UA 1M30A 1AD5A 3MO8A 2VC8A 2EKOA 2XICA 2K2MA 1QW1A 1S72A 1Y0MA 2YUOA 1QWEA 3M59A 2V26A 4D6WA 1QVGP 3OYJA 3IQLA 3CCJQ 1HYOA 1Q81U 2L3SA 3CCSA 3M57A 4ELYC 2XDPA 1X6GA 4OB3B 4M7DB 2G6FX 1QVFA 4IUTA 4M7AC 1NJIC 1Y57A 1BI3A 2XK0A 2LQ8A 4XAXB 3MHXA 1VQOT 3H9NA 2VUBA 2DMOA 1I5LA 3M0TA 2JN0A 3RUXA 3CCEQ 2KXDA 2X35A 1SF9A 4M75A 2EW3A 4PJLA 3OYYA 3JCMQ 4OVAA 2F5TX 1BI2A 2K3BA 3J80E 1PM3A 1VQMA 2E70A 2ECZA 3QJYA 3M0SA 3NTIA 3JCMX 3EG1A 1OPLA 4OB0B 2LCSA 1M1GA 2LVMA 4JRPA 1K73C 1QCFA 3EH1A 4PFPA 5LJ3d 1WHJA 3CCMQ 4F17A 3KFVA 1SKUB 3JCMh 4A4FA 2V8IA 2OTJQ 3A1PA 5GAOm 3REAB 5J39A 3VV0A 1RADB 1WHKA 4OMPA 1X27A 3VS7A 4BD3A 4JLGA 4FYWB 4LDUA 4QVCA 1F1BB 2K3YA 2DLPA 1K9AA 1GXIE 3PTAA 3SEMA 2IVWA 1C1AA 1OYXA 3X25B 4J9HA 2Y4XA 2A0FB 2E4HA 8ATCB 2DZCA 2JJ9A 3J7AF 3OYKA 5GANd 3OYDA 3DB4A 2CT4A 4ZGEB 2A7YA 2RMOA 2XU8A 2E5KA 4RTUA 2RQVA 3WXMB 3H0FA 3GBQA 4LD9K 2DXCA 4JRQA 4WTOB 2QG9B 3PIPA 4O6JA 3M55A 3PVQA 2LQKA 2HZYA 1OZ2A 1GBRA 4MDXA 2ZPFB 2CH4W 4L5GA 2CH4A 1VQ4Q 3VKIA 3JCMP 2CSQA 3QJ6A 2ZPBB 1BB9A 1VYTA 3VS0A 1AVZC 1ZUYA 2DERA 1WQWA 3CC4Q 3VYGA 4DQ2A 2RPNA 2CP3A 4XTZA 4ZTFA 4M7AA 3LLRA 3CD6A 2CT3A 2CYZB 3FB9A 2KRNA 2MWOA 1LOJA 1D0ZA 2SRCA 1E6GA 2HQEA 4N0AC 3RNJA 3X20B 3VS2A 3L2QA 1HJDA 3M56A 2HQHA 1TOVA 3TCJA 4MZPA 3OYHA 3UPUA 3MP8A 3HTRA 1S1NA 2RJDA 4M78A 1N8RC 2DA9A 1UTIA 2DYIA 1G3SA 3S3MA 1LJOA 5CKDA 3G1JA 3CPWA 2O88A 1ZSZC 4K11A 2VVKA 3OW2P 1VQ7T 2ZAEA 3RBBB 1O75A 4GY5A 1I8FA 3GNGA 1PCXA 3SDZA 1N5ZA 1WZOA 1IO6A 3L2ZA 2KK4A 2LX9A 1TUDA 3CXCP 2M51A 2M16A 3C4SA 5KYWA 4J9IA 3UA7A 2CUDA 4A4HA 1NBEB 4E7IA 5KYYA 3VU3C 4E7HA 3MEWA 2XDDA 2RH2A 1YJ9T 4NS5A 2C06A 2DIQA 1MNEA 3EGUA 3VS6A 3SWNA 3GLXA 4C8QF 1SSFA 1VQ8A 4KULA 2EQMA 2X51A 1Z9ZA 2YUPA 4C92E 2VXFA 3G6EA 3TU4K 2QGFB 4CRIA 1ABOA 1YJNQ 1AEYA 1Q81R 1Y7XA 2DILA 4N4GA 3I56T 5D7UA 2QDYB 3I55T 4HA8A 3RKYA 1MMNA 1UUEA 3WVEB 3G6EQ 3M0PA 3JB9I 4E2FB 1U1SA 1VQ8Q 1N8RU 2V1QA 4J83A 3I9QA 1KJWA 3ER0A 4C0DC 2MPXC 3DLMA 2GBQA 3CCUT 1RL2A 4C92A 1VQ7Q 1YHQT 4QQ6A 1WJQA 3MKDA 4ZGDB 3G4ST 4JRKA 4KGXB 4LDYA 3JCMc 2GTOA 5EG2A 2QA4Q 5KYWB 4J6XA 4M7DE 4JS4A 4A4GA 2JT4A 2J6FA 2FZKB 2QTVA 3ZEHA 4B9WA 5GAOq 4R0KA 4ORZA 2E3IA 3FLGA 2NUPA 4PJOB 1IXDA 5GAN6 3EFSA 2KSSA 5CKFA 4HCCA 5KCOA 4AG2C 5GMKi 3OS5A 2V8KA 4JJDA 3E9FA 1UGQB 1YFNA 3NTKA 4VUBA 4BY6C 3SWNB 5HY6A 1LCKA 5A2QE 3RKWA 2HBPA 4C8QB 1VQ9T 4J9CA 2DAQA 4CI0C 1TSFA 2QK0A 1XJWB 4C5HA 5GANf 3BY7A 3OYCA 2E41A 1BCOA 2OJ2A 1H92A 4MMKA 3JRZA 5KYUB 1PRMC 5CVIA 2EQJA 2YXYA 3OYIA 3A8LB 2K79A 1ARKA 2FRYA 1IRXA 1V76A 1U3OA 4OF1A 1WYXA 5A0LA 1UJ0A 3EG9B 1VQPQ 1IHWA 2P4RA 1G3TA 3CCVT 2F1LA 4BDZA 1BYMA 4JRIA 1Q7YC 3SD4A 1HXDA 3MEVA 2JTFA 3EFRA 1RABB 3JAME 4XTYA 1HD3A 1M8MA 2CP6A 2VB6A 4PK4A 3HSBA 2YLCA 3JCMg 4IIMA 4TVRA 1NEBA 1I1JA 1R77A 2CZ1B 1PD1A 2RF0A 2L3PA 2X3XD 3HL8A 1YITA 1G2BA 3HFOA 2K5LA 4Z88A 3JCMW 1M3BA 2DFUA 3CCVA 1BCMA 2PUKB 4CC4B 1W70A 5DM7R 4E7LA
chains in the Genus database with same CATH topology
1E7OA 4GBQA 2J6OA 1V1CA 1NLOC 2H8HA 1VA7A 3M0UA 4HVVA 1M30A 1AD5A 2RQRA 2EYZA 2KBTA 1X43A 2ROTA 1T3LA 3VS3A 1A0NB 2K2MA 2KT8A 1BU1A 1Y0MA 1UECA 1SRLA 2YUOA 1QWEA 4JPBW 1NM7A 3EHQA 1NYGA 5IHNA 4F16A 2KEAA 1X69A 1B07A 3IQLA 2DL8A 2K6DA 2L3SA 2JW4A 1X6GA 4J9FA 2AZVA 5ECAA 2B86A 2YUNA 1K0SA 2G6FX 2JS2A 3VS5A 2JM9A 1Y57A 4M4ZA 1NEGA 4ESRA 1OV3A 3NPFA 3PVLA 1QLYA 2DMOA 3M0TA 2KXDA 1RLQC 1MUZA 1WXBA 2HCKA 2VKNA 4ZNXA 2AZSA 2OAWA 4RTXA 2EW3A 2A36A 5FWBA 3M0RA 2K3BA 2A28A 2W0ZA 2ECZA 3M0SA 2DL5A 1GL5A 1QKWA 1OPLA 3EG1A 4RTWA 2ENMA 2LCSA 1WDXA 3NHNA 1M3CA 1QCFA 4AFZC 4JZ3A 2ED1A 3TSWA 4F17A 1PNJA 2CREA 2J05A 1WX6A 2YUQA 3KFVA 2EYYA 1Z9QA 1UHFA 3REAB 2FPFA 2IIMA 2J6KA 2KXCA 1ZX6A 2RQTA 3NGPA 1X27A 4OMPA 4HCKA 3VS7A 1G83A 3EG3A 3U23A 2SEMA 2D1XA 2DBMA 3M0QA 2EGEA 1GCQC 2L3QA 1J3TA 2DLPA 1UJYA 2KYBA 1YNZA 1K9AA 3SEMA 5I11A 4Y92A 2L0AA 1KIKA 1VYVA 4J9HA 1YN8A 2DL3A 1QWFA 1OPKA 4EIKA 2KYMA 2EPDA 2CT4A 2VWFA 1UFFA 2RMOA 1GCPA 3JV3A 1ZSGA 2E5KA 4RTUA 1H8KA 2RQVA 2LJ3A 3H0FA 2KNBB 1AZGB 3GBQA 3I35A 2MCNA 2LJ1A 2JMAA 2ESWA 2YT6A 1UE9A 4LE9A 5IHKA 2DJQA 2FPEA 2GGRA 1YWPA 1SRMA 1UHCA 1U5SA 3PVQA 4AFQC 2DL4A 2X3WD 1GBRA 2CH4W 2CH4A 2CSQA 2DBKA 1JO8A 1BK2A 2F2VA 1BB9A 1VYTA 3VS0A 1AVZC 1ZUYA 2QDLA 2FPDA 1WA7A 4E6RA 2PTKA 4FSSA 2RPNA 4D8DA 3C0CA 2F2XA 4DEYA 2CT3A 2KRNA 1XOVA 2LJ0A 1PKSA 2C0OA 2SRCA 1E6GA 1GFDA 3RNJA 1HSQA 1TG0A 3VS2A 3H0HA 1HJDA 2GQIA 5EC7A 2D8JA 1WIEA 1M27C 3A98A 2HBWA 3H0IA 5IH2A 4JJCA 2KR3A 2J06A 1ZBJA 1ZLMA 4CC2A 1WI7A 1EFNA 1S1NA 4CC7A 4RTVA 2DRKA 2AK5A 2DA9A 1UTIA 2EVRA 2DX1A 1SSHA 1KFZA 1GBQA 2O88A 3ULRB 3VRZA 1H3HA 4K11A 1AWWA 1ZUKA 4J9BA 2VVKA 4OMNA 2KGTA 2HEQA 3RBBB 3QWXX 2O31A 2F2WA 4QT7A 1PHTA 3EG0A 2DVJA 1GCQA 3LH5A 5L23A 1N5ZA 1CKAA 2EYWA 2AKKA 4OMQA 1IO6A 1PWTA 1RLPC 2GTJA 2A37A 1TUDA 3EG2A 2LQNA 2M51A 1NYFA 4D8KA 1FYNA 1SEMA 1YWOA 2EYXA 4J9GA 2C0TA 2BZYA 4J9IA 3UA7A 1AWXA 2HSPA 2CUDA 3FJ5A 2LP5A 1SPKA 4IIOA 2PNIA 4OMOA 1JU5C 2ED0A 1FMKA 2GNCA 1SHGA 1GRIA 4Z8AA 3I5SA 4AFSC 3EGUA 3VS6A 1X2KA 2LZ6B 1T0JA 5IHIA 2EGCA 2RNAA 3H41A 5I22A 3ZL7C 3VRYA 4KRTA 1Z9ZA 3THKA 2EGAA 2RQUA 2RQWA 2YUPA 1WLPB 5FWCA 1X6BA 1ABQA 1ABOA 1AEYA 2DILA 2DNUA 2CSIA 1WFWA 1B3QA 1W1FA 2CDTA 1CSKA 1TUCA 1QKXA 4LN2A 1UG1A 1UUEA 4RTYA 5FW9A 3M0PA 2DRMA 2EBPA 2JMCA 1PRLC 2KRSA 2RN8A 1UGVA 2V1QA 2D0NA 2MIOA 4WCIA 3I9QA 1KJWA 4X1VA 3UA6A 2DM1A 1NLPC 2LNHB 2GBQA 2JTEA 3R6NA 2OI3A 4RUGA 1YP5A 1M3AA 2NWMA 1WXUA 3UF4A 4A63B 2O2OA 3NMZC 1OEBA 5GJWB 2GTOA 5IXBA 1JQQA 1U06A 2HDAA 2JT4A 2J6FA 2MOXA 1UDLA 2BZXA 2O9SA 3TVTA 4R0KA 1RI9A 4ORZA 4JJBA 2M0YA 4F14A 1JXOA 4JZ4A 3CQTA 4AG2C 1ZUUA 4GLMA 1YCSB 2XMFA 2DYBA 1OOTA 4JJDA 1VYUA 2L2PA 2KROA 2LMJA 2EKHA 1LCKA 2BZ8A 2PZ1A 1K76A 3TSZA 2W10A 4J9CA 2YSQA 4LUEA 2DL7A 3VS4A 1AWJA 2BTTA 2KT1A 1JXMA 4LNPA 4J9EA 4DEXA 1NG2A 1T0HA 2OJ2A 1K4US 2K7AA 2KE9A 3PE0A 1H92A 2YDLA 2DF6A 2ABLA 2NUZA 1E6HA 1K1ZA 2V1RA 1PRMC 4RTTA 2C0IA 2O9VA 4AG1C 1CKBA 2AKLA 5IXFA 2FRWA 2DE0X 3O5ZA 2K79A 3QWYA 2FRYA 1ARKA 1MV3A 1U3OA 1AZEA 2FG0A 1WYXA 1T3SA 1GFCA 1UJ0A 2LX7A 5GJVB 2FO0A 1RUWA 2P4RA 3I5RA 4HVUA 4HVWA 2EQIA 4AFUC 1AOJA 4OMMA 4RTZA 4CC3A 2LQWA 1HD3A 1M8MA 1W6XA 2I0NA 4IIMA 1I07A 1NEBA 1I1JA 2A08A 2JS0A 1WXTA 2JM8A 3REBB 1AWOA 2D8HA 3UATA 2RF0A 3VS1A 2FEIA 4LUDA 2L3PA 4OMLA 2X3XD 1I0CA 4Z89A 1G2BA 2J7IA 3SHWA 4Z88A 5HCKA 1MV0B 2KRMA 1M3BA 2CUBA 2JXBA 2K9GA 1JEGA 1K0XA 1BBZA 4HXJA 1PKTA 1KSWA 4CC4B 1X2QA 1W70A 4J9DA 3EHRA 1SHFA 2ROLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7O A;  4GBQ A;  2J6O A;  1V1C A;  1NLO C;  2H8H A;  1VA7 A;  3M0U A;  4HVV A;  1M30 A;  1AD5 A;  2RQR A;  2EYZ A;  2KBT A;  1X43 A;  2ROT A;  1T3L A;  3VS3 A;  1A0N B;  2K2M A;  2KT8 A;  1BU1 A;  1Y0M A;  1UEC A;  1SRL A;  2YUO A;  1QWE A;  4JPB W;  1NM7 A;  3EHQ A;  1NYG A;  5IHN A;  4F16 A;  2KEA A;  1X69 A;  1B07 A;  3IQL A;  2DL8 A;  2K6D A;  2L3S A;  2JW4 A;  1X6G A;  4J9F A;  2AZV A;  5ECA A;  2B86 A;  2YUN A;  1K0S A;  2G6F X;  2JS2 A;  3VS5 A;  2JM9 A;  1Y57 A;  4M4Z A;  1NEG A;  4ESR A;  1OV3 A;  3NPF A;  3PVL A;  1QLY A;  2DMO A;  3M0T A;  2KXD A;  1RLQ C;  1MUZ A;  1WXB A;  2HCK A;  2VKN A;  4ZNX A;  2AZS A;  2OAW A;  4RTX A;  2EW3 A;  2A36 A;  5FWB A;  3M0R A;  2K3B A;  2A28 A;  2W0Z A;  2ECZ A;  3M0S A;  2DL5 A;  1GL5 A;  1QKW A;  1OPL A;  3EG1 A;  4RTW A;  2ENM A;  2LCS A;  1WDX A;  3NHN A;  1M3C A;  1QCF A;  4AFZ C;  4JZ3 A;  2ED1 A;  3TSW A;  4F17 A;  1PNJ A;  2CRE A;  2J05 A;  1WX6 A;  2YUQ A;  3KFV A;  2EYY A;  1Z9Q A;  1UHF A;  3REA B;  2FPF A;  2IIM A;  2J6K A;  2KXC A;  1ZX6 A;  2RQT A;  3NGP A;  1X27 A;  4OMP A;  4HCK A;  3VS7 A;  1G83 A;  3EG3 A;  3U23 A;  2SEM A;  2D1X A;  2DBM A;  3M0Q A;  2EGE A;  1GCQ C;  2L3Q A;  1J3T A;  2DLP A;  1UJY A;  2KYB A;  1YNZ A;  1K9A A;  3SEM A;  5I11 A;  4Y92 A;  2L0A A;  1KIK A;  1VYV A;  4J9H A;  1YN8 A;  2DL3 A;  1QWF A;  1OPK A;  4EIK A;  2KYM A;  2EPD A;  2CT4 A;  2VWF A;  1UFF A;  2RMO A;  1GCP A;  3JV3 A;  1ZSG A;  2E5K A;  4RTU A;  1H8K A;  2RQV A;  2LJ3 A;  3H0F A;  2KNB B;  1AZG B;  3GBQ A;  3I35 A;  2MCN A;  2LJ1 A;  2JMA A;  2ESW A;  2YT6 A;  1UE9 A;  4LE9 A;  5IHK A;  2DJQ A;  2FPE A;  2GGR A;  1YWP A;  1SRM A;  1UHC A;  1U5S A;  3PVQ A;  4AFQ C;  2DL4 A;  2X3W D;  1GBR A;  2CH4 W;  2CH4 A;  2CSQ A;  2DBK A;  1JO8 A;  1BK2 A;  2F2V A;  1BB9 A;  1VYT A;  3VS0 A;  1AVZ C;  1ZUY A;  2QDL A;  2FPD A;  1WA7 A;  4E6R A;  2PTK A;  4FSS A;  2RPN A;  4D8D A;  3C0C A;  2F2X A;  4DEY A;  2CT3 A;  2KRN A;  1XOV A;  2LJ0 A;  1PKS A;  2C0O A;  2SRC A;  1E6G A;  1GFD A;  3RNJ A;  1HSQ A;  1TG0 A;  3VS2 A;  3H0H A;  1HJD A;  2GQI A;  5EC7 A;  2D8J A;  1WIE A;  1M27 C;  3A98 A;  2HBW A;  3H0I A;  5IH2 A;  4JJC A;  2KR3 A;  2J06 A;  1ZBJ A;  1ZLM A;  4CC2 A;  1WI7 A;  1EFN A;  1S1N A;  4CC7 A;  4RTV A;  2DRK A;  2AK5 A;  2DA9 A;  1UTI A;  2EVR A;  2DX1 A;  1SSH A;  1KFZ A;  1GBQ A;  2O88 A;  3ULR B;  3VRZ A;  1H3H A;  4K11 A;  1AWW A;  1ZUK A;  4J9B A;  2VVK A;  4OMN A;  2KGT A;  2HEQ A;  3RBB B;  3QWX X;  2O31 A;  2F2W A;  4QT7 A;  1PHT A;  3EG0 A;  2DVJ A;  1GCQ A;  3LH5 A;  5L23 A;  1N5Z A;  1CKA A;  2EYW A;  2AKK A;  4OMQ A;  1IO6 A;  1PWT A;  1RLP C;  2GTJ A;  2A37 A;  1TUD A;  3EG2 A;  2LQN A;  2M51 A;  1NYF A;  4D8K A;  1FYN A;  1SEM A;  1YWO A;  2EYX A;  4J9G A;  2C0T A;  2BZY A;  4J9I A;  3UA7 A;  1AWX A;  2HSP A;  2CUD A;  3FJ5 A;  2LP5 A;  1SPK A;  4IIO A;  2PNI A;  4OMO A;  1JU5 C;  2ED0 A;  1FMK A;  2GNC A;  1SHG A;  1GRI A;  4Z8A A;  3I5S A;  4AFS C;  3EGU A;  3VS6 A;  1X2K A;  2LZ6 B;  1T0J A;  5IHI A;  2EGC A;  2RNA A;  3H41 A;  5I22 A;  3ZL7 C;  3VRY A;  4KRT A;  1Z9Z A;  3THK A;  2EGA A;  2RQU A;  2RQW A;  2YUP A;  1WLP B;  5FWC A;  1X6B A;  1ABQ A;  1ABO A;  1AEY A;  2DIL A;  2DNU A;  2CSI A;  1WFW A;  1B3Q A;  1W1F A;  2CDT A;  1CSK A;  1TUC A;  1QKX A;  4LN2 A;  1UG1 A;  1UUE A;  4RTY A;  5FW9 A;  3M0P A;  2DRM A;  2EBP A;  2JMC A;  1PRL C;  2KRS A;  2RN8 A;  1UGV A;  2V1Q A;  2D0N A;  2MIO A;  4WCI A;  3I9Q A;  1KJW A;  4X1V A;  3UA6 A;  2DM1 A;  1NLP C;  2LNH B;  2GBQ A;  2JTE A;  3R6N A;  2OI3 A;  4RUG A;  1YP5 A;  1M3A A;  2NWM A;  1WXU A;  3UF4 A;  4A63 B;  2O2O A;  3NMZ C;  1OEB A;  5GJW B;  2GTO A;  5IXB A;  1JQQ A;  1U06 A;  2HDA A;  2JT4 A;  2J6F A;  2MOX A;  1UDL A;  2BZX A;  2O9S A;  3TVT A;  4R0K A;  1RI9 A;  4ORZ A;  4JJB A;  2M0Y A;  4F14 A;  1JXO A;  4JZ4 A;  3CQT A;  4AG2 C;  1ZUU A;  4GLM A;  1YCS B;  2XMF A;  2DYB A;  1OOT A;  4JJD A;  1VYU A;  2L2P A;  2KRO A;  2LMJ A;  2EKH A;  1LCK A;  2BZ8 A;  2PZ1 A;  1K76 A;  3TSZ A;  2W10 A;  4J9C A;  2YSQ A;  4LUE A;  2DL7 A;  3VS4 A;  1AWJ A;  2BTT A;  2KT1 A;  1JXM A;  4LNP A;  4J9E A;  4DEX A;  1NG2 A;  1T0H A;  2OJ2 A;  1K4U S;  2K7A A;  2KE9 A;  3PE0 A;  1H92 A;  2YDL A;  2DF6 A;  2ABL A;  2NUZ A;  1E6H A;  1K1Z A;  2V1R A;  1PRM C;  4RTT A;  2C0I A;  2O9V A;  4AG1 C;  1CKB A;  2AKL A;  5IXF A;  2FRW A;  2DE0 X;  3O5Z A;  2K79 A;  3QWY A;  2FRY A;  1ARK A;  1MV3 A;  1U3O A;  1AZE A;  2FG0 A;  1WYX A;  1T3S A;  1GFC A;  1UJ0 A;  2LX7 A;  5GJV B;  2FO0 A;  1RUW A;  2P4R A;  3I5R A;  4HVU A;  4HVW A;  2EQI A;  4AFU C;  1AOJ A;  4OMM A;  4RTZ A;  4CC3 A;  2LQW A;  1HD3 A;  1M8M A;  1W6X A;  2I0N A;  4IIM A;  1I07 A;  1NEB A;  1I1J A;  2A08 A;  2JS0 A;  1WXT A;  2JM8 A;  3REB B;  1AWO A;  2D8H A;  3UAT A;  2RF0 A;  3VS1 A;  2FEI A;  4LUD A;  2L3P A;  4OML A;  2X3X D;  1I0C A;  4Z89 A;  1G2B A;  2J7I A;  3SHW A;  4Z88 A;  5HCK A;  1MV0 B;  2KRM A;  1M3B A;  2CUB A;  2JXB A;  2K9G A;  1JEG A;  1K0X A;  1BBZ A;  4HXJ A;  1PKT A;  1KSW A;  4CC4 B;  1X2Q A;  1W70 A;  4J9D A;  3EHR A;  1SHF A;  2ROL A; 
#chains in the Genus database with same CATH topology
 5LJ5 j;  1D0X A;  4EMH A;  2H3J A;  2J6O A;  1D3B B;  3L42 A;  1Q81 C;  1KG1 A;  5GAN e;  1VQ8 T;  5J26 A;  2L89 A;  3I55 Q;  1MMA A;  2JTM A;  3UWN A;  2IG0 A;  2RQR A;  3HKS A;  2EYZ A;  2KBT A;  1C6V X;  4M78 F;  3G6E T;  1T3L A;  1IHV A;  2G3R A;  5GAN 8;  3J81 E;  4N4I A;  1UEC A;  4PJO D;  1NM7 A;  3EHQ A;  4BE2 A;  1B07 A;  2RI2 A;  2CS7 A;  2K6D A;  3OY9 A;  4AT1 B;  4FU6 A;  1LNX A;  2GQV A;  4J9F A;  3UT1 A;  2AZV A;  2L5Q A;  2YUN A;  1JJ2 A;  1WQ7 A;  1TTH B;  3OMC A;  4LDV A;  2HL3 A;  1NEG A;  1WHG A;  1H64 1;  4RMO A;  3PVL A;  3FJP A;  4Q5W A;  2LNV A;  1QCO A;  4R55 A;  3CME Q;  4DBH A;  1R0B G;  3DB3 A;  2E12 A;  1UGR B;  2AZS A;  5IAY A;  2RHY A;  2A36 A;  1KQS S;  3M0R A;  1RAH B;  1W2B A;  2A3L A;  1IB8 A;  5GMK j;  2DL5 A;  1HK9 A;  1QKW A;  4RTW A;  3ASK A;  1WDX A;  4ME7 A;  1KD1 U;  3T9N A;  4M7D A;  4HKE A;  1WNL A;  1N9R A;  2J05 A;  1W2B P;  3P8H A;  2ZPH B;  3HFN A;  1N8R R;  4JLI A;  2FB7 A;  3JSC A;  1IRE B;  3G7Z A;  2RQT A;  4HCK A;  4B9X A;  2K3X A;  3EG3 A;  1M5Q 1;  2ZZD A;  2D1X A;  4M78 D;  2DBM A;  2EGE A;  1M9S A;  4FCY A;  4B6M A;  1JJ2 P;  2YLB A;  2OX7 A;  4F7U A;  1VQL T;  5CR2 A;  3LGF A;  1IGQ A;  1VYV A;  3LX7 A;  5C0M A;  1YN8 A;  2JUF A;  3OYB A;  1OPK A;  2PU9 B;  4F7U E;  2KYM A;  3HRS A;  2F5K A;  4EMK A;  2VWF A;  5CQY A;  2BKD N;  1G3W A;  3I56 Q;  2LJ3 A;  3JB9 J;  2KNB B;  1AZG B;  4A4K A;  3JB9 G;  2QA4 A;  2ESW A;  2FPE A;  4ELZ C;  1SRM A;  1FX7 A;  1UHC A;  3EGD A;  5KYX B;  4XTX A;  4KGZ B;  2VAS A;  4AFQ C;  2D6F A;  3LWI A;  2E6N A;  2Y4Y A;  4FYX B;  3PMT A;  1PG5 B;  3D7S B;  1BK2 A;  4NOY A;  3CCJ T;  3CPW P;  4IUU A;  2FPD A;  6AT1 B;  3CCU Q;  4KGV B;  1OZ3 A;  5HK0 A;  2BE7 D;  3C0C A;  2LCL A;  2QQ9 A;  3QDR B;  1VQM T;  2X4J A;  1GFD A;  3OYG A;  1TG0 A;  2DK3 A;  4J6W A;  2GQI A;  4IUQ A;  5A0G A;  1M27 C;  5DLO A;  2E6Z A;  2KY9 A;  2HBW A;  2OTL T;  3M9Q A;  1VQ5 T;  2J06 A;  1ZLM A;  2DXT A;  3ME9 A;  4CC2 A;  1OX9 A;  1K73 R;  2L8D A;  1YIT Q;  2DRK A;  4ZTJ A;  2GFA A;  1PSE A;  2EVR A;  3A5Z B;  2RHZ A;  2F69 A;  4BE1 A;  2KQW A;  3ULR B;  1WGS A;  1ZUK A;  4OMN A;  1OUL A;  2KGT A;  4M78 E;  4C92 D;  2R57 A;  1Q7Y U;  3QWX X;  2O31 A;  2WSE E;  2MYS A;  2CP5 A;  2VGM A;  2P0P A;  2QQR A;  2EWN A;  2DVJ A;  5L23 A;  2Y90 A;  4PKC C;  4M7A E;  3CME A;  3RER A;  4V2S A;  5GAN 4;  4BAC A;  3EG2 A;  3OMG A;  4ATO A;  2EYX A;  5CKH A;  4PFZ A;  1SPK A;  1I4K 1;  5CQX A;  1I5O B;  4NL3 A;  2DET A;  1VQP A;  3MJX A;  1TXQ A;  5CIU A;  1WHL A;  4C5E A;  3CC7 A;  2GNC A;  1ZBX A;  3I5S A;  4M75 G;  4AFS C;  1YI2 Q;  1TUG B;  1TH7 A;  1Y07 A;  1JB0 E;  1MMG A;  2NLU A;  2RNA A;  2V8J A;  5I22 A;  1VQL A;  3VRY A;  1EZZ B;  3CBM A;  1UB4 A;  2MF2 A;  2EGA A;  5GAO r;  2RQW A;  3OA6 A;  1WLP B;  1R8O B;  3OSS C;  1ABQ A;  4PJO E;  3JCM b;  2DNU A;  1WFW A;  1B3Q A;  1CSK A;  3OYL A;  3M54 A;  3V8K A;  4FL6 A;  1LPL A;  2JMC A;  4XU3 A;  3INZ A;  4BI8 B;  4RG8 A;  3OYA A;  5GAM e;  2MIO A;  4WCI A;  1WJR A;  2FHD A;  2QQB A;  1NJI U;  2DTI A;  3RKX A;  2WAC A;  5DLQ E;  1M2V A;  1ZA2 B;  2KI7 A;  3E9G A;  4J5Y A;  2JTE A;  5LJ3 h;  2NUT A;  2OI3 A;  1UGS B;  1G5V A;  3C94 A;  1VQK Q;  5CKE A;  2NWM A;  4A63 B;  1WHM A;  2O2O A;  1OEB A;  4DA4 A;  5GJW B;  1NE8 A;  1W2B S;  2Z0W A;  2JZ2 A;  2QEX Q;  3OS2 A;  3CC4 A;  3L2U A;  4F7U F;  4X9C A;  1C0M A;  2M0Y A;  1AHJ B;  4F14 A;  4QQG A;  2YHT A;  3CQT A;  1QVG A;  4GLM A;  2DYB A;  4M77 D;  4BB7 A;  2BUD A;  5GAO p;  2EKH A;  3JB9 F;  4M7A D;  3CC7 Q;  3OQ5 A;  3TSZ A;  2W10 A;  4LUE A;  3CCL A;  2RB6 A;  3CXC A;  1AWJ A;  2KT1 A;  5GAM d;  1JXM A;  1OQK A;  3H6Z A;  4M77 E;  1NG2 A;  3JCM f;  4M75 E;  2K7A A;  2KE9 A;  2ATC B;  2YDL A;  2ABL A;  2NYS A;  4RTT A;  5AYF A;  3M58 A;  2NUP B;  4PJO A;  2R5A A;  2K2V A;  5J3B A;  3OW2 A;  4KH1 B;  3QWY A;  3HPW A;  1MV3 A;  2FG0 A;  3I56 A;  3NFC A;  1GFC A;  1YHQ Q;  2CGH A;  5GJV B;  3I5R A;  2P84 A;  2QI2 A;  3LGL A;  1AOJ A;  1JBM A;  2QYZ A;  3E2U A;  3X28 B;  4CC3 A;  3QZ9 B;  2VXE A;  5KYN A;  4PNO A;  5A0D A;  1W6X A;  1VQM Q;  2E64 A;  2A08 A;  1WXT A;  3E1S A;  2D9T A;  2DJZ A;  3UAT A;  4M7D D;  3M53 A;  1QVF P;  2PVG B;  1ZA1 B;  1B34 A;  2ZPG B;  1Q82 C;  4Z89 A;  1YJW Q;  2HKQ B;  1MV0 B;  3GOX A;  2KRM A;  4EPC A;  1QQJ A;  3QHS A;  1YI2 T;  2K9G A;  1BBZ A;  1PKT A;  2HNI A;  1X2Q A;  1YJW A;  4J9D A;  2RHX A;  4JDS A;  3CCL Q;  1BIA A;  1QVG S;  2OTJ A;  3P8B B;  1V1C A;  5CCA A;  3CCQ T;  2YWW A;  4UC4 A;  1TS9 A;  1VQ7 A;  1Q95 G;  4PJM A;  2DKG A;  2RJC A;  2P4T A;  1X43 A;  3QO3 A;  1OI1 A;  3DLL A;  1YJ9 A;  1SRL A;  2XKO C;  1M1K R;  1NYG A;  5IHN A;  2KEA A;  4LXC A;  3UDC A;  2DL8 A;  1VQN Q;  2B86 A;  1K0S A;  2JS2 A;  2PVO B;  1YIJ A;  4QW2 A;  2JM9 A;  1ZQ1 A;  4M4Z A;  1D1C A;  2NUT B;  1QLY A;  2DEQ A;  2OTJ T;  1WXB A;  2HCK A;  4RTX A;  5FWB A;  3MPU B;  1TU0 B;  1RAF B;  2BIV A;  1GL5 A;  2ENM A;  4NL2 A;  3V8J A;  3EGX B;  3QZ5 B;  1M3C A;  2K5F A;  3CCE T;  4JZ3 A;  2ED1 A;  4BI3 A;  3TSW A;  3CCV Q;  3QSU A;  3QPH A;  2CRE A;  1WX6 A;  2YUQ A;  5FU7 B;  2R58 A;  3SB2 A;  3TEE A;  1Z9Q A;  4EDU A;  1UHF A;  4OP0 A;  1K9M C;  1VQK A;  2FPF A;  3GP8 A;  1P92 A;  2IIM A;  4IUV A;  1ZX6 A;  1G83 A;  4XTW A;  4C8Q E;  3I55 A;  2JNG A;  2X4W A;  1J3T A;  1UJY A;  2KYB A;  3CBP A;  5KYY B;  1D09 B;  2RI3 A;  1V29 B;  4M75 F;  4YTL A;  5I11 A;  2X4Y A;  2QTX A;  2CZ6 B;  3FIF A;  2OAU A;  4Y92 A;  3PIO A;  3CCQ Q;  1ZSZ A;  2DL3 A;  1KC8 C;  5GAM j;  3OB9 A;  1IZ6 A;  1GCP A;  1UGP B;  1ZSG A;  1H8K A;  1PSF A;  1KHC A;  1VIF A;  2MCN A;  2YT6 A;  2L3R A;  4LE9 A;  2MI6 A;  4HT8 A;  1YWP A;  4E7J A;  3TQ7 P;  4M77 G;  3HP9 A;  2GCX A;  2DL4 A;  2X3W D;  4RKU E;  4PL6 A;  4PJJ A;  1YCY A;  2CZ7 B;  1Q86 C;  1H3Z A;  1M90 R;  1YJW T;  1VQN T;  2DBK A;  4PLL A;  1JO8 A;  4ANJ A;  1NJI R;  4A54 A;  2K5I A;  3QXE B;  2QDL A;  4A53 A;  1YHQ A;  2GFU A;  5I2M A;  4EMK B;  2F2X A;  1K9M R;  1VQ9 A;  1YI2 A;  3CCM T;  3QBY A;  1PKS A;  4C92 B;  5GAN 7;  3PGG A;  1HSQ A;  1D1B A;  1M1K C;  3H0H A;  2AIR B;  5EC7 A;  4II1 A;  3EGD B;  2JVV A;  4FSX A;  8AT1 B;  3A98 A;  4JJC A;  4DOW A;  2KR3 A;  1ZBJ A;  1WI7 A;  1KD1 C;  1EFN A;  4R56 A;  4RTV A;  1VQN A;  1B7T A;  3VUZ A;  1B34 B;  5D6Y A;  1SSH A;  1KFZ A;  4RCC A;  3URG A;  3VRZ A;  1QCN A;  1M1K U;  4J9B A;  3PMI A;  5LJ5 d;  1M4Z A;  4BDY A;  4QT7 A;  2KVQ G;  4J6Y A;  4MZM A;  4M7A G;  1BKB A;  3VUB A;  2QEX A;  1CKA A;  2AKK A;  4XTV A;  5LJ3 e;  2EFI A;  3CCE A;  2VGN A;  4OMQ A;  2ZGW A;  2E1H A;  4A4E A;  4M75 C;  4HCZ A;  5I21 A;  2ZPE B;  3AHU A;  4D8K A;  1FYN A;  1SEM A;  3X24 B;  4PJO G;  1YWO A;  4M78 G;  4J9G A;  2BZY A;  5DY9 A;  1AWX A;  3FJ5 A;  1Q86 U;  2LP5 A;  4M77 A;  3CCL T;  2PNI A;  1FWZ A;  5LJ3 j;  1MMD A;  1Q7Y R;  1JU5 C;  4X9D A;  1FMK A;  2DIG A;  4JUV A;  4C5I A;  4Y28 E;  1SHG A;  4IUR A;  2XG8 D;  2EAY A;  4FIB A;  2COY A;  2QQS A;  2EQK A;  1T0J A;  2PVD B;  2RI5 A;  3H41 A;  3CCR Q;  1OU9 A;  5LJ5 f;  1YIJ T;  4EMK C;  3THK A;  3M4Y A;  5L8R E;  3JCM J;  3S3O A;  3V7S A;  1M90 C;  1YIT T;  2COW A;  1KC8 U;  2R5M A;  2CSI A;  2CDT A;  1NPR A;  4LN2 A;  1UG1 A;  1IGU A;  5FW9 A;  4FT4 A;  4DBR A;  1Y71 A;  4ZGJ B;  2EBP A;  2EYQ A;  2EJF A;  1MHN A;  1QP2 A;  4FW1 A;  3CCR A;  3GF5 A;  2RN8 A;  1EIF A;  5HKC A;  2DEU A;  2D0N A;  5LJ5 g;  4AMC A;  1ZSZ B;  3UA6 A;  4MML A;  5GMK e;  1K9M U;  1NLP C;  3FC3 A;  3R6N A;  3RES A;  3C95 A;  4PJO F;  4RUG A;  4GLK A;  1M3A A;  2M0O A;  1WXU A;  3UF4 A;  1KQ1 A;  3MP1 A;  5FU7 C;  2VV5 A;  3OS0 A;  3OBY A;  2FYK A;  3LH0 A;  5IXB A;  1RAA B;  4C0G A;  3CD6 T;  5CAI A;  3JCM d;  4Y91 A;  4F7U G;  1U06 A;  4QQD A;  2HDA A;  4M75 B;  4OB1 B;  4C0F A;  2BZX A;  2O9S A;  4M77 B;  1VQ9 Q;  1EX4 A;  3S3N A;  4O5V A;  4JZ4 A;  3NTH A;  1ZUU A;  1KHI A;  2XMF A;  1OOT A;  1NPP A;  1VYU A;  2D0Q B;  4XU2 A;  1RI0 A;  1KK7 A;  2L2P A;  2BZ8 A;  3A8O B;  2PZ1 A;  3QUI A;  3C12 A;  1JRI A;  5KCH A;  3QDF A;  3CCU A;  3CCM A;  3VS4 A;  3OYE A;  2CP7 A;  5GAN j;  2BTT A;  1S72 T;  1VQP T;  4J9E A;  2HD0 A;  4DEX A;  2BE9 B;  3HHT B;  1T0H A;  1K4U S;  5LJ5 e;  4RCB A;  1YBY A;  1VQO Q;  2CZ0 B;  3ZBD A;  1K1Z A;  2RA2 A;  1PC0 A;  2K4Y A;  1VQ6 A;  2AKL A;  4QVZ A;  3AT1 B;  2DE0 X;  3O5Z A;  4KUI A;  4QVD A;  5GAO n;  1AZE A;  3EG9 A;  4C5G A;  1WJS A;  1M2O A;  2LX7 A;  4FYY B;  2FO0 A;  4J8O A;  4HVU A;  1Y96 B;  2EQI A;  3BDU A;  1VOM A;  4JJN K;  4LDX A;  2CKK A;  4FM4 B;  2LCC A;  3N5B B;  2DVE A;  1UEB A;  3PNW C;  3GIB A;  3QII A;  1Q82 U;  2O4X A;  2I0N A;  4L6V 5;  2PQW A;  1I07 A;  3EFO B;  1AT1 B;  4XTU A;  2JS0 A;  3CC4 T;  1QVP A;  4OGE A;  3S6W A;  4LDW A;  3VS1 A;  4M77 C;  4OML A;  3CD6 Q;  5GAN 2;  1I0C A;  3SHW A;  5GAO l;  4PJN A;  1N27 A;  4C92 F;  3KXT A;  5LJ3 g;  5HK3 A;  1JEG A;  3GPL A;  1Q86 R;  4HXJ A;  1VQ5 A;  1KSW A;  3CCR T;  2HSE B;  2QXF A;  2X9H A;  3EHR A;  2DTO A;  1D3B A;  1E7O A;  7AT1 B;  2AT1 B;  1BI0 A;  2DTH A;  1ZHI A;  2QQA A;  3O8V A;  2FZC B;  2H8H A;  5GMK h;  4XQ3 A;  1VA7 A;  4HVV A;  3L2W A;  2P0K A;  5FLX E;  2ROT A;  3EH2 A;  3VS3 A;  1A0N B;  2KT8 A;  4WF2 A;  1PD0 A;  4XK8 E;  1BU1 A;  3RMS A;  2XDB A;  4JPB W;  4X34 A;  2EIF A;  4F16 A;  4C0Z A;  1ACM B;  1MGQ A;  4MDW A;  1X69 A;  2JW4 A;  3G71 Q;  5ECA A;  1M2V B;  4C8Q A;  3VS5 A;  2P0Q A;  4JS5 A;  4ESR A;  9ATC B;  1OV3 A;  3NPF A;  1KQ2 A;  5GAM f;  2O4X B;  1RLQ C;  1MUZ A;  2VKN A;  4ZNX A;  2MWP A;  1K73 U;  2OAW A;  2DXU A;  1XNI A;  5GMK l;  4P5N A;  2A28 A;  2RK2 A;  3DKM A;  2W0Z A;  4E7Z A;  4C8Q G;  3CMA T;  1QP3 A;  4FT2 A;  4PFO A;  3NHN A;  1O9S A;  5LJ5 h;  4AFZ C;  3CME T;  3CPW S;  1FMV A;  2E10 A;  1RAE B;  1XQH A;  1PNJ A;  1M90 U;  2E5Q A;  5IT9 E;  3L2V A;  2KAF A;  2EYY A;  3OYN A;  1YJN A;  4F04 B;  5GAM h;  5CKB A;  4KUD K;  1RAI B;  3A8H B;  2J6K A;  2KXC A;  2QAZ A;  3NGP A;  4KBM B;  1KC8 R;  3U23 A;  2SEM A;  2H3E B;  3M0Q A;  1GCQ C;  2L3Q A;  4XU0 A;  1YNZ A;  1D1A A;  3HRT A;  1OU8 A;  3CBO A;  3CEY A;  4BY6 B;  3LW5 E;  4C92 C;  4DBF A;  2O01 E;  3SFM A;  2L0A A;  3PT9 A;  1KIK A;  3L2R A;  3WVD B;  4DBQ A;  2HQX A;  3CCJ A;  3CCS Q;  1QWF A;  4EIK A;  1OX8 A;  2EPD A;  1X01 A;  2CP0 A;  5LL6 S;  1UFF A;  3BDL A;  3JV3 A;  3RR6 A;  4OMF B;  3I35 A;  1Y96 A;  2LJ1 A;  2JMA A;  1UE9 A;  5IHK A;  4M7A B;  1I81 A;  2DJQ A;  2GGR A;  2LT4 A;  2LDM A;  1U8R A;  1U5S A;  2IPO B;  1K8A R;  2AHJ B;  2E3H A;  2HL5 C;  4M78 B;  4E47 A;  3G71 T;  4M7D F;  3EFO A;  2DO3 A;  2F2V A;  2RHU A;  4LD6 A;  2ZCF B;  4M75 D;  3MP6 A;  1WA7 A;  2M1H A;  4E6R A;  3V7R A;  1VUB A;  2PTK A;  4FSS A;  4D8D A;  4DEY A;  5GAN g;  2OTL Q;  3CMA Q;  4HT9 A;  3RIR A;  3BE3 A;  1XOV A;  2LJ0 A;  4N4H A;  3CPF A;  3X26 B;  4J7F A;  2C0O A;  4M7D G;  1VQ6 Q;  1FMW A;  2D8J A;  1WIE A;  1RAC B;  3H0I A;  5IH2 A;  2EJ9 A;  3A8G B;  1LVK A;  2DPP B;  2RO0 A;  2FL7 A;  4CC7 A;  1N6A A;  2AK5 A;  5KE2 A;  5KH6 A;  4IKF A;  2PUO B;  2DX1 A;  1GBQ A;  4E7S A;  2KMT A;  1H3H A;  5GAN 5;  1VIE A;  1AWW A;  1YIJ Q;  2LT1 A;  3QG1 A;  2HEQ A;  4FW2 A;  1VQ5 Q;  3KBG A;  4BI4 A;  1S72 Q;  3MET A;  2MK5 A;  3MEA A;  2F2W A;  1N9S A;  4FYV B;  1WHH A;  3JCM V;  1PHT A;  4IUP A;  1WPY A;  3EG0 A;  2LC4 A;  1GCQ A;  3LH5 A;  1QVF S;  3M4G A;  4M78 C;  2EYW A;  4OGC A;  1X6O A;  2HAX A;  3JB9 D;  4M7A F;  2GTJ A;  1PWT A;  1RLP C;  4DOV A;  2A37 A;  2LQN A;  1NYF A;  1G3Y A;  2C0T A;  2RHI A;  2HSP A;  4C92 G;  5GMK m;  3CC2 T;  2XI9 A;  2E65 A;  4IIO A;  4OMO A;  4F7U B;  1KQS A;  2ED0 A;  3P8D A;  1VQ4 A;  3F70 A;  4RG2 A;  1GRI A;  4Z8A A;  2YRD A;  2XID A;  2QGG A;  1X2K A;  2LZ6 B;  2EJG A;  3CCQ A;  5IHI A;  2EGC A;  4Z02 A;  3ZL7 C;  3OYM A;  1K8A C;  2HKN A;  3FDR A;  4KRT A;  1RAG B;  3Q1J A;  2RQU A;  3LYI A;  2M02 A;  1MND A;  5D6X A;  1VQO A;  5FWC A;  1X6B A;  5KE3 A;  1Q82 R;  3OSV A;  3ZFJ A;  1FXX A;  5FU6 B;  3V8L A;  5KYX A;  4KH0 B;  1W1F A;  3M5A A;  1TUC A;  1QKX A;  4C8Q C;  4RTY A;  3OS1 A;  2DRM A;  2LTO A;  1VQ6 T;  5AT1 B;  1PRL C;  1W4S A;  2KRS A;  4ZN3 A;  3KUF A;  3QYH B;  4PJO C;  4XU1 A;  1UGV A;  5I2S A;  1M1F A;  2HMA A;  4MZT A;  3CCS T;  4X1V A;  2FVU A;  3MCA B;  2MAM A;  2RK1 A;  3LWH A;  2DM1 A;  3SWN C;  3OBW A;  4EMG A;  2LNH B;  3VYH B;  2QEX T;  2X4X A;  3L1A A;  1R0C B;  1YP5 A;  2DD4 A;  2QA4 T;  2RD1 A;  2XD0 A;  2WSF E;  4QKU A;  3E19 A;  2RJF A;  3NMZ C;  1XTD A;  4KT0 E;  2YRV A;  1KD1 R;  1JQQ A;  1U1T A;  5KYU A;  4OB2 B;  4BUG A;  3RMQ A;  2MOX A;  1UDL A;  2RM4 A;  3TVT A;  5IN1 A;  1RI9 A;  2QAS A;  1DJ7 B;  4JJB A;  5GAN 3;  1JXO A;  2DXB A;  1VQK T;  3FRN A;  2M9U A;  3R6O A;  1YCS B;  1KQS P;  2MMP A;  2LMJ A;  2KRO A;  4C0D B;  3JCM e;  3EAE A;  1K76 A;  2YSQ A;  2VYT A;  2RJE A;  2DL7 A;  2JOY A;  4LNP A;  4M77 F;  5M9O A;  1VQL Q;  1D0Y A;  4ZN1 A;  2K57 A;  3PE0 A;  1TWB A;  2DF6 A;  2NUZ A;  2V1R A;  1E6H A;  2LRQ A;  2C0I A;  2O9V A;  2XHC A;  4AG1 C;  3GNF B;  5FU6 C;  1CKB A;  3G4S Q;  5IXF A;  1JJ2 S;  3V7C A;  3G71 A;  2FRW A;  5CO7 A;  3VJP A;  3EGX A;  4HCB A;  4E7K A;  3FEO A;  4N0A A;  4C8Q D;  1T3S A;  5GAN h;  2OTL A;  5C6S A;  1YJ9 Q;  4L59 A;  1RUW A;  3H8Z A;  4HVW A;  4AFU C;  2KDS A;  4OMM A;  4RTZ A;  2CP2 A;  2LQW A;  5LJ3 f;  3MEU A;  5GAM g;  5CK9 A;  3CC2 Q;  2COZ A;  2GF7 A;  4M7D C;  2EQU A;  3PFS A;  3QYG B;  2JM8 A;  4J7I A;  3REB B;  1AWO A;  1YJN T;  3CXC S;  2D8H A;  1SG5 A;  2FEI A;  4LUD A;  2ZPI B;  4PLI A;  1BI1 A;  3CMA A;  3A8M B;  3JB9 H;  1VQ4 T;  5FRN A;  2J7I A;  3G4S A;  3QKJ A;  1X75 C;  5HCK A;  3BW1 A;  2I2L A;  3CC2 A;  2CUB A;  2JXB A;  3RDV A;  5FRM A;  1M8V A;  1K0X A;  3HRU A;  1G8X A;  3OW2 S;  2YRC A;  3OYF A;  5D6W A;  3CC7 T;  2DD5 A;  1BIB A;  1SHF A;  2ROL A;  1QMC A;  3BFM A;  1K8A U;  2B8A A;  2FZG B;  4GBQ A;  4BE0 A;  2DZ9 A;  2WSC E;  1NLO C;  3TRE A;  1NZ9 A;  5FRO A;  3M0U A;  1M30 A;  1AD5 A;  3MO8 A;  2VC8 A;  2EKO A;  2XIC A;  2K2M A;  1QW1 A;  1S72 A;  1Y0M A;  2YUO A;  1QWE A;  3M59 A;  2V26 A;  4D6W A;  1QVG P;  3OYJ A;  3IQL A;  3CCJ Q;  1HYO A;  1Q81 U;  2L3S A;  3CCS A;  3M57 A;  4ELY C;  2XDP A;  1X6G A;  4OB3 B;  4M7D B;  2G6F X;  1QVF A;  4IUT A;  4M7A C;  1NJI C;  1Y57 A;  1BI3 A;  2XK0 A;  2LQ8 A;  4XAX B;  3MHX A;  1VQO T;  3H9N A;  2VUB A;  2DMO A;  1I5L A;  3M0T A;  2JN0 A;  3RUX A;  3CCE Q;  2KXD A;  2X35 A;  1SF9 A;  4M75 A;  2EW3 A;  4PJL A;  3OYY A;  3JCM Q;  4OVA A;  2F5T X;  1BI2 A;  2K3B A;  3J80 E;  1PM3 A;  1VQM A;  2E70 A;  2ECZ A;  3QJY A;  3M0S A;  3NTI A;  3JCM X;  3EG1 A;  1OPL A;  4OB0 B;  2LCS A;  1M1G A;  2LVM A;  4JRP A;  1K73 C;  1QCF A;  3EH1 A;  4PFP A;  5LJ3 d;  1WHJ A;  3CCM Q;  4F17 A;  3KFV A;  1SKU B;  3JCM h;  4A4F A;  2V8I A;  2OTJ Q;  3A1P A;  5GAO m;  3REA B;  5J39 A;  3VV0 A;  1RAD B;  1WHK A;  4OMP A;  1X27 A;  3VS7 A;  4BD3 A;  4JLG A;  4FYW B;  4LDU A;  4QVC A;  1F1B B;  2K3Y A;  2DLP A;  1K9A A;  1GXI E;  3PTA A;  3SEM A;  2IVW A;  1C1A A;  1OYX A;  3X25 B;  4J9H A;  2Y4X A;  2A0F B;  2E4H A;  8ATC B;  2DZC A;  2JJ9 A;  3J7A F;  3OYK A;  5GAN d;  3OYD A;  3DB4 A;  2CT4 A;  4ZGE B;  2A7Y A;  2RMO A;  2XU8 A;  2E5K A;  4RTU A;  2RQV A;  3WXM B;  3H0F A;  3GBQ A;  4LD9 K;  2DXC A;  4JRQ A;  4WTO B;  2QG9 B;  3PIP A;  4O6J A;  3M55 A;  3PVQ A;  2LQK A;  2HZY A;  1OZ2 A;  1GBR A;  4MDX A;  2ZPF B;  2CH4 W;  4L5G A;  2CH4 A;  1VQ4 Q;  3VKI A;  3JCM P;  2CSQ A;  3QJ6 A;  2ZPB B;  1BB9 A;  1VYT A;  3VS0 A;  1AVZ C;  1ZUY A;  2DER A;  1WQW A;  3CC4 Q;  3VYG A;  4DQ2 A;  2RPN A;  2CP3 A;  4XTZ A;  4ZTF A;  4M7A A;  3LLR A;  3CD6 A;  2CT3 A;  2CYZ B;  3FB9 A;  2KRN A;  2MWO A;  1LOJ A;  1D0Z A;  2SRC A;  1E6G A;  2HQE A;  4N0A C;  3RNJ A;  3X20 B;  3VS2 A;  3L2Q A;  1HJD A;  3M56 A;  2HQH A;  1TOV A;  3TCJ A;  4MZP A;  3OYH A;  3UPU A;  3MP8 A;  3HTR A;  1S1N A;  2RJD A;  4M78 A;  1N8R C;  2DA9 A;  1UTI A;  2DYI A;  1G3S A;  3S3M A;  1LJO A;  5CKD A;  3G1J A;  3CPW A;  2O88 A;  1ZSZ C;  4K11 A;  2VVK A;  3OW2 P;  1VQ7 T;  2ZAE A;  3RBB B;  1O75 A;  4GY5 A;  1I8F A;  3GNG A;  1PCX A;  3SDZ A;  1N5Z A;  1WZO A;  1IO6 A;  3L2Z A;  2KK4 A;  2LX9 A;  1TUD A;  3CXC P;  2M51 A;  2M16 A;  3C4S A;  5KYW A;  4J9I A;  3UA7 A;  2CUD A;  4A4H A;  1NBE B;  4E7I A;  5KYY A;  3VU3 C;  4E7H A;  3MEW A;  2XDD A;  2RH2 A;  1YJ9 T;  4NS5 A;  2C06 A;  2DIQ A;  1MNE A;  3EGU A;  3VS6 A;  3SWN A;  3GLX A;  4C8Q F;  1SSF A;  1VQ8 A;  4KUL A;  2EQM A;  2X51 A;  1Z9Z A;  2YUP A;  4C92 E;  2VXF A;  3G6E A;  3TU4 K;  2QGF B;  4CRI A;  1ABO A;  1YJN Q;  1AEY A;  1Q81 R;  1Y7X A;  2DIL A;  4N4G A;  3I56 T;  5D7U A;  2QDY B;  3I55 T;  4HA8 A;  3RKY A;  1MMN A;  1UUE A;  3WVE B;  3G6E Q;  3M0P A;  3JB9 I;  4E2F B;  1U1S A;  1VQ8 Q;  1N8R U;  2V1Q A;  4J83 A;  3I9Q A;  1KJW A;  3ER0 A;  4C0D C;  2MPX C;  3DLM A;  2GBQ A;  3CCU T;  1RL2 A;  4C92 A;  1VQ7 Q;  1YHQ T;  4QQ6 A;  1WJQ A;  3MKD A;  4ZGD B;  3G4S T;  4JRK A;  4KGX B;  4LDY A;  3JCM c;  2GTO A;  5EG2 A;  2QA4 Q;  5KYW B;  4J6X A;  4M7D E;  4JS4 A;  4A4G A;  2JT4 A;  2J6F A;  2FZK B;  2QTV A;  3ZEH A;  4B9W A;  5GAO q;  4R0K A;  4ORZ A;  2E3I A;  3FLG A;  2NUP A;  4PJO B;  1IXD A;  5GAN 6;  3EFS A;  2KSS A;  5CKF A;  4HCC A;  5KCO A;  4AG2 C;  5GMK i;  3OS5 A;  2V8K A;  4JJD A;  3E9F A;  1UGQ B;  1YFN A;  3NTK A;  4VUB A;  4BY6 C;  3SWN B;  5HY6 A;  1LCK A;  5A2Q E;  3RKW A;  2HBP A;  4C8Q B;  1VQ9 T;  4J9C A;  2DAQ A;  4CI0 C;  1TSF A;  2QK0 A;  1XJW B;  4C5H A;  5GAN f;  3BY7 A;  3OYC A;  2E41 A;  1BCO A;  2OJ2 A;  1H92 A;  4MMK A;  3JRZ A;  5KYU B;  1PRM C;  5CVI A;  2EQJ A;  2YXY A;  3OYI A;  3A8L B;  2K79 A;  1ARK A;  2FRY A;  1IRX A;  1V76 A;  1U3O A;  4OF1 A;  1WYX A;  5A0L A;  1UJ0 A;  3EG9 B;  1VQP Q;  1IHW A;  2P4R A;  1G3T A;  3CCV T;  2F1L A;  4BDZ A;  1BYM A;  4JRI A;  1Q7Y C;  3SD4 A;  1HXD A;  3MEV A;  2JTF A;  3EFR A;  1RAB B;  3JAM E;  4XTY A;  1HD3 A;  1M8M A;  2CP6 A;  2VB6 A;  4PK4 A;  3HSB A;  2YLC A;  3JCM g;  4IIM A;  4TVR A;  1NEB A;  1I1J A;  1R77 A;  2CZ1 B;  1PD1 A;  2RF0 A;  2L3P A;  2X3X D;  3HL8 A;  1YIT A;  1G2B A;  3HFO A;  2K5L A;  4Z88 A;  3JCM W;  1M3B A;  2DFU A;  3CCV A;  1BCM A;  2PUK B;  4CC4 B;  1W70 A;  5DM7 R;  4E7L A; 
#chains in the Genus database with same CATH homology
 1E7O A;  4GBQ A;  2J6O A;  1V1C A;  1NLO C;  2H8H A;  1VA7 A;  3M0U A;  4HVV A;  1M30 A;  1AD5 A;  2RQR A;  2EYZ A;  2KBT A;  1X43 A;  2ROT A;  1T3L A;  3VS3 A;  1A0N B;  2K2M A;  2KT8 A;  1BU1 A;  1Y0M A;  1UEC A;  1SRL A;  2YUO A;  1QWE A;  4JPB W;  1NM7 A;  3EHQ A;  1NYG A;  5IHN A;  4F16 A;  2KEA A;  1X69 A;  1B07 A;  3IQL A;  2DL8 A;  2K6D A;  2L3S A;  2JW4 A;  1X6G A;  4J9F A;  2AZV A;  5ECA A;  2B86 A;  2YUN A;  1K0S A;  2G6F X;  2JS2 A;  3VS5 A;  2JM9 A;  1Y57 A;  4M4Z A;  1NEG A;  4ESR A;  1OV3 A;  3NPF A;  3PVL A;  1QLY A;  2DMO A;  3M0T A;  2KXD A;  1RLQ C;  1MUZ A;  1WXB A;  2HCK A;  2VKN A;  4ZNX A;  2AZS A;  2OAW A;  4RTX A;  2EW3 A;  2A36 A;  5FWB A;  3M0R A;  2K3B A;  2A28 A;  2W0Z A;  2ECZ A;  3M0S A;  2DL5 A;  1GL5 A;  1QKW A;  1OPL A;  3EG1 A;  4RTW A;  2ENM A;  2LCS A;  1WDX A;  3NHN A;  1M3C A;  1QCF A;  4AFZ C;  4JZ3 A;  2ED1 A;  3TSW A;  4F17 A;  1PNJ A;  2CRE A;  2J05 A;  1WX6 A;  2YUQ A;  3KFV A;  2EYY A;  1Z9Q A;  1UHF A;  3REA B;  2FPF A;  2IIM A;  2J6K A;  2KXC A;  1ZX6 A;  2RQT A;  3NGP A;  1X27 A;  4OMP A;  4HCK A;  3VS7 A;  1G83 A;  3EG3 A;  3U23 A;  2SEM A;  2D1X A;  2DBM A;  3M0Q A;  2EGE A;  1GCQ C;  2L3Q A;  1J3T A;  2DLP A;  1UJY A;  2KYB A;  1YNZ A;  1K9A A;  3SEM A;  5I11 A;  4Y92 A;  2L0A A;  1KIK A;  1VYV A;  4J9H A;  1YN8 A;  2DL3 A;  1QWF A;  1OPK A;  4EIK A;  2KYM A;  2EPD A;  2CT4 A;  2VWF A;  1UFF A;  2RMO A;  1GCP A;  3JV3 A;  1ZSG A;  2E5K A;  4RTU A;  1H8K A;  2RQV A;  2LJ3 A;  3H0F A;  2KNB B;  1AZG B;  3GBQ A;  3I35 A;  2MCN A;  2LJ1 A;  2JMA A;  2ESW A;  2YT6 A;  1UE9 A;  4LE9 A;  5IHK A;  2DJQ A;  2FPE A;  2GGR A;  1YWP A;  1SRM A;  1UHC A;  1U5S A;  3PVQ A;  4AFQ C;  2DL4 A;  2X3W D;  1GBR A;  2CH4 W;  2CH4 A;  2CSQ A;  2DBK A;  1JO8 A;  1BK2 A;  2F2V A;  1BB9 A;  1VYT A;  3VS0 A;  1AVZ C;  1ZUY A;  2QDL A;  2FPD A;  1WA7 A;  4E6R A;  2PTK A;  4FSS A;  2RPN A;  4D8D A;  3C0C A;  2F2X A;  4DEY A;  2CT3 A;  2KRN A;  1XOV A;  2LJ0 A;  1PKS A;  2C0O A;  2SRC A;  1E6G A;  1GFD A;  3RNJ A;  1HSQ A;  1TG0 A;  3VS2 A;  3H0H A;  1HJD A;  2GQI A;  5EC7 A;  2D8J A;  1WIE A;  1M27 C;  3A98 A;  2HBW A;  3H0I A;  5IH2 A;  4JJC A;  2KR3 A;  2J06 A;  1ZBJ A;  1ZLM A;  4CC2 A;  1WI7 A;  1EFN A;  1S1N A;  4CC7 A;  4RTV A;  2DRK A;  2AK5 A;  2DA9 A;  1UTI A;  2EVR A;  2DX1 A;  1SSH A;  1KFZ A;  1GBQ A;  2O88 A;  3ULR B;  3VRZ A;  1H3H A;  4K11 A;  1AWW A;  1ZUK A;  4J9B A;  2VVK A;  4OMN A;  2KGT A;  2HEQ A;  3RBB B;  3QWX X;  2O31 A;  2F2W A;  4QT7 A;  1PHT A;  3EG0 A;  2DVJ A;  1GCQ A;  3LH5 A;  5L23 A;  1N5Z A;  1CKA A;  2EYW A;  2AKK A;  4OMQ A;  1IO6 A;  1PWT A;  1RLP C;  2GTJ A;  2A37 A;  1TUD A;  3EG2 A;  2LQN A;  2M51 A;  1NYF A;  4D8K A;  1FYN A;  1SEM A;  1YWO A;  2EYX A;  4J9G A;  2C0T A;  2BZY A;  4J9I A;  3UA7 A;  1AWX A;  2HSP A;  2CUD A;  3FJ5 A;  2LP5 A;  1SPK A;  4IIO A;  2PNI A;  4OMO A;  1JU5 C;  2ED0 A;  1FMK A;  2GNC A;  1SHG A;  1GRI A;  4Z8A A;  3I5S A;  4AFS C;  3EGU A;  3VS6 A;  1X2K A;  2LZ6 B;  1T0J A;  5IHI A;  2EGC A;  2RNA A;  3H41 A;  5I22 A;  3ZL7 C;  3VRY A;  4KRT A;  1Z9Z A;  3THK A;  2EGA A;  2RQU A;  2RQW A;  2YUP A;  1WLP B;  5FWC A;  1X6B A;  1ABQ A;  1ABO A;  1AEY A;  2DIL A;  2DNU A;  2CSI A;  1WFW A;  1B3Q A;  1W1F A;  2CDT A;  1CSK A;  1TUC A;  1QKX A;  4LN2 A;  1UG1 A;  1UUE A;  4RTY A;  5FW9 A;  3M0P A;  2DRM A;  2EBP A;  2JMC A;  1PRL C;  2KRS A;  2RN8 A;  1UGV A;  2V1Q A;  2D0N A;  2MIO A;  4WCI A;  3I9Q A;  1KJW A;  4X1V A;  3UA6 A;  2DM1 A;  1NLP C;  2LNH B;  2GBQ A;  2JTE A;  3R6N A;  2OI3 A;  4RUG A;  1YP5 A;  1M3A A;  2NWM A;  1WXU A;  3UF4 A;  4A63 B;  2O2O A;  3NMZ C;  1OEB A;  5GJW B;  2GTO A;  5IXB A;  1JQQ A;  1U06 A;  2HDA A;  2JT4 A;  2J6F A;  2MOX A;  1UDL A;  2BZX A;  2O9S A;  3TVT A;  4R0K A;  1RI9 A;  4ORZ A;  4JJB A;  2M0Y A;  4F14 A;  1JXO A;  4JZ4 A;  3CQT A;  4AG2 C;  1ZUU A;  4GLM A;  1YCS B;  2XMF A;  2DYB A;  1OOT A;  4JJD A;  1VYU A;  2L2P A;  2KRO A;  2LMJ A;  2EKH A;  1LCK A;  2BZ8 A;  2PZ1 A;  1K76 A;  3TSZ A;  2W10 A;  4J9C A;  2YSQ A;  4LUE A;  2DL7 A;  3VS4 A;  1AWJ A;  2BTT A;  2KT1 A;  1JXM A;  4LNP A;  4J9E A;  4DEX A;  1NG2 A;  1T0H A;  2OJ2 A;  1K4U S;  2K7A A;  2KE9 A;  3PE0 A;  1H92 A;  2YDL A;  2DF6 A;  2ABL A;  2NUZ A;  1E6H A;  1K1Z A;  2V1R A;  1PRM C;  4RTT A;  2C0I A;  2O9V A;  4AG1 C;  1CKB A;  2AKL A;  5IXF A;  2FRW A;  2DE0 X;  3O5Z A;  2K79 A;  3QWY A;  2FRY A;  1ARK A;  1MV3 A;  1U3O A;  1AZE A;  2FG0 A;  1WYX A;  1T3S A;  1GFC A;  1UJ0 A;  2LX7 A;  5GJV B;  2FO0 A;  1RUW A;  2P4R A;  3I5R A;  4HVU A;  4HVW A;  2EQI A;  4AFU C;  1AOJ A;  4OMM A;  4RTZ A;  4CC3 A;  2LQW A;  1HD3 A;  1M8M A;  1W6X A;  2I0N A;  4IIM A;  1I07 A;  1NEB A;  1I1J A;  2A08 A;  2JS0 A;  1WXT A;  2JM8 A;  3REB B;  1AWO A;  2D8H A;  3UAT A;  2RF0 A;  3VS1 A;  2FEI A;  4LUD A;  2L3P A;  4OML A;  2X3X D;  1I0C A;  4Z89 A;  1G2B A;  2J7I A;  3SHW A;  4Z88 A;  5HCK A;  1MV0 B;  2KRM A;  1M3B A;  2CUB A;  2JXB A;  2K9G A;  1JEG A;  1K0X A;  1BBZ A;  4HXJ A;  1PKT A;  1KSW A;  4CC4 B;  1X2Q A;  1W70 A;  4J9D A;  3EHR A;  1SHF A;  2ROL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...