4M75B

Crystal structure of lsm1-7 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
91
structure length
91
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 13
structure length 91
sequence length 91
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75B00
2DTIA 1HK9A 3BDUA 4M7AC 1I8FA 3INZA 2DEQA 3JCMg 4V2SA 2VXFA 5LJ3g 4XTVA 4XTZA 4M77D 4PJOF 3VU3C 5GAMf 5GMKl 4C92D 5LJ5e 5GANe 4M7AE 3JCMb 4RCBA 4M75F 5GAN7 5GAOp 3V8KA 3JB9F 3FIFA 5CAIA 1H641 4DQ2A 4C8QF 3EFRA 4N0AA 1TH7A 5LJ5g 5GANg 3AHUA 5GMKe 4PJOE 5GMKh 4M7AB 2E10A 2EJFA 2QTXA 3QO3A 4EMKA 5LJ3j 4M75E 3JCMW 3FJPA 3SWNC 2E41A 1N9RA 4X9DA 4M77A 4XU3A 5GAN6 4HT9A 4M7DD 4C92A 4C8QE 5GAN2 5GMKi 2Y90A 4M78D 2VC8A 4JRKA 4MMLA 4J6XA 3BFMA 1Y96A 1U1SA 5DY9A 3RIRA 5LJ5j 5GAN8 5GANj 3QUIA 4PJOB 1YCYA 3L1AA 4XTWA 5GAN3 3JCMd 1KQ2A 4M75B 2E1HA 4M77G 4F7UG 5GAOm 2DKGA 4C92G 4J5YA 5GAMe 4HT8A 1KQ1A 5GAMh 1U1TA 4C8QB 3SB2A 4NOYA 1BIBA 3JCMV 5GAOn 2DXTA 3JCMc 5GMKj 1LJOA 4JRIA 3V7RA 4M7DA 1WQWA 1D3BB 4M78A 4MMKA 1I81A 5LJ5d 2EJGA 5GANd 1B34B 2DTHA 4NL3A 1JBMA 2EAYA 4A54A 3GIBA 4M7DG 4XTUA 1LOJA 3V7SA 3JCMf 2E64A 3JCMJ 3HSBA 5LJ3f 4WF2A 3JCMQ 4M78G 2FB7A 4XTXA 1I5LA 3RERA 4M7AD 2RA2A 4M7DC 3L2ZA 3RUXA 4XQ3A 4C8QA 4M78C 4XTYA 3V8LA 4NL2A 2RB6A 2VXEA 4N0AC 5GAOq 2YLBA 3BY7A 4M77F 3V7CA 1HXDA 4F7UF 4C92F 5LJ5f 3FB9A 5GANf 2YHTA 1BIAA 5LJ3d 4RCCA 4XU1A 4PJOD 2DXUA 4OP0A 4EMKC 3HFOA 3SWNB 2E65A 3BW1A 4M75D 5GAOl 4M77C 3JCMX 4M7AA 3JB9D 4C92C 1WNLA 2I2LA 4C8QD 1I4K1 4M77E 5GAMg 2DZ9A 4F7UE 1M8VA 4C92E 2ZGWA 3PGGA 4QVCA 2EJ9A 3JB9I 4M7DF 3M4GA 4J6WA 5I21A 3JCMe 5GAN4 5GAOr 3JCMh 4A53A 4M78F 4M7AG 4PJOA 1MGQA 4QVDA 4M75A 3QHSA 4JUVA 4M77B 5GMKm 4F7UB 4C92B 5GAMj 1WPYA 3SWNA 3RESA 4M7DE 4HA8A 4XU0A 1Y96B 2DJZA 5LJ5h 1D3BA 2DTOA 4M78E 4PJOG 5GANh 2DZCA 3HFNA 1B34A 2JN0A 4M75G 3JB9J 1M5Q1 2HNIA 4Y91A 3JB9G 4PJOC 4C8QG 1LNXA 1N9SA 2EWNA 4M75C 3RKXA 4M7DB 5GAMd 1JRIA 1X01A 4J6YA 4PNOA 3RKWA 5GAN5 4C8QC 2DVEA 4M78B 3JCMP 2FYKA 4XU2A 4F7UA 3QSUA 3JB9H 3RKYA 3V8JA 4EMGA 4M7AF 2RD1A 2K57A 2YLCA 2RM4A 1WQ7A 4JLIA 4X9CA 3EFSA 5LJ3e 5LJ3h 4EMKB 2CGHA 4EMHA
chains in the Genus database with same CATH superfamily
2J6OA 1F1BB 4Z89A 2RQRA 1S1NA 3VU3C 2RQTA 5GAN7 5GAOp 8AT1B 2GTOA 3QJYA 8ATCB 4QT7A 1OOTA 1PRMC 1UUEA 2RJCA 3QO3A 1UFFA 2R5MA 5FRNA 5KCOA 4HT9A 2JJ9A 3PIOA 3SDZA 3GP8A 3BFMA 1U1SA 1W6XA 2P4RA 1YCYA 2ZPHB 2DKGA 4J5YA 1IHVA 3URGA 1AT1B 2ZPFB 1VQ4T 3GNFB 3VS5A 1VQ4Q 2KR3A 2OAWA 2R57A 2YRDA 2O01E 2EAYA 3ER0A 1X69A 3GIBA 4J83A 5D6XA 3V7SA 3UATA 3HSBA 2E3IA 1RL2A 1KFZA 2B86A 3OY9A 3MP8A 1RAGB 4XTYA 5FLXE 3OBWA 1X2KA 1K8AC 3G6EA 1YJNT 1K4US 1WHKA 4FL6A 1LPLA 2CZ0B 3G7ZA 3JCMX 5CKBA 1BKBA 3TREA 4C0GA 5HK0A 4J6WA 5FU7C 5GAOr 2JXBA 1NZ9A 5GMKm 1Q86C 3UF4A 1YNZA 1Y96B 2CZ1B 4M78E 5EG2A 1AWJA 3HFNA 4OMOA 1B34A 4IIOA 2HSPA 1E6GA 2HEQA 3L2QA 1NJIR 1JRIA 2X3WD 1K9MC 2RMOA 1MV0B 2EFIA 4IUPA 2EYWA 5IXFA 3KBGA 4Z88A 1M2VB 2D9TA 4XTZA 1D0YA 1WHJA 5FW9A 3CBPA 1VQ7T 1GFCA 5IH2A 1VQ7Q 1QVGP 3CC7T 3A8HB 4PJOE 2HZYA 2EW3A 3CC7Q 1EX4A 2GF7A 2QQSA 4XU3A 3ZFJA 2Y90A 3QPHA 1M1GA 1QCOA 2HDAA 5CVIA 2X35A 4DBFA 2OJ2A 2RI5A 3L42A 4HT8A 2QQAA 2NUTB 1YIJA 3HL8A 3MEAA 4OMNA 3QG1A 1QQJA 2RHYA 1YJWT 2O2OA 1FX7A 1YJWQ 4PLIA 1LOJA 2DA9A 5FRMA 5IT9E 1G8XA 4WF2A 2CDTA 4O6JA 2CP5A 3OW2P 2RA2A 1MV3A 1AHJB 2V8IA 1BI1A 3CBMA 1BI2A 3OSSC 4PFPA 4B9XA 3OMCA 2EIFA 1D09B 2DL4A 1SF9A 2DXUA 4OP0A 3BW1A 3CEYA 1VQPT 2DEUA 1WNLA 2RQUA 1AD5A 4F7UE 3N5BB 4ELZC 1WHLA 1PM3A 2EJ9A 2R58A 2X9HA 4A53A 5KYUB 4GY5A 2HD0A 2IVWA 1KHCA 3O8VA 4PJNA 2XKOC 1UHFA 2P84A 2D6FA 5FROA 3OB9A 1N8RR 2CP0A 1SHGA 2FRYA 2V26A 1VQNT 3HRSA 1ZHIA 2YSQA 4HCBA 4OMFB 4BUGA 1N8RU 2K5FA 4QVZA 3TU4K 3OSVA 4FYXB 2YUQA 2CUBA 1VQ6A 4EMHA 4PK4A 4C0ZA 2J7IA 1ZA1B 4RKUE 1RAIB 4M75F 3DB4A 1YCSB 5C0MA 1BI0A 4N0AA 4N4IA 4OMLA 4JZ3A 3OYHA 4EMKA 1VQ5A 1B7TA 3FJPA 2AZVA 1YHQQ 2DERA 5CIUA 3EGUA 1WXTA 2YRCA 1MHNA 5KE3A 1Y96A 4B6MA 3RIRA 2DM1A 1YITT 1VQ4A 3FRNA 3QDRB 4M75B 2R5AA 3OYIA 5IHNA 3LH5A 1Y57A 3CCJQ 3VYGA 4CC2A 2VB6A 2KEAA 2EJGA 2BZ8A 4GLMA 4PFZA 2QEXT 2B8AA 2DIQA 4A54A 1TOVA 2M02A 4LDYA 1YJNA 3RUXA 5KYXB 1OU9A 1QCNA 4PJJA 4R56A 1W2BP 4JJCA 1Z9ZA 2FZCB 4BI3A 4JPBW 3CPWA 3DB3A 3VS2A 3I5SA 2MPXC 2AIRB 1WDXA 5KCHA 3A8MB 4J9HA 1CKBA 3MKDA 1Y07A 4JUVA 2PVOB 3NMZC 4ZTJA 2DRKA 4JJDA 1XNIA 2ATCB 3C94A 5FWBA 4CC7A 4M75G 2X4YA 1NG2A 3GNGA 4KH1B 2AT1B 4C8QC 4KGVB 1PCXA 3FJ5A 3P8DA 3RNJA 4X9CA 5LJ3h 2WACA 3EG9B 3G1JA 1BBZA 2DEQA 3QJ6A 2DBKA 1ZBXA 3MHXA 1K1ZA 2A28A 3EHRA 1NBEB 5KYUA 1H3ZA 1G3WA 3UDCA 2KXDA 3EG1A 5LJ5j 3O5ZA 2EPDA 1M4ZA 1WJSA 2ENMA 5J26A 1LVKA 1W70A 3J7AF 4RUGA 1FMWA 1PKTA 4HVUA 2PQWA 1WHHA 4E7JA 2ROLA 2VWFA 2SEMA 1W1FA 3IQLA 3CPFA 1M90R 3OYDA 4IUVA 4QKUA 2E64A 1K73C 1I5LA 2CZ6B 2RH2A 3RR6A 2HKNA 1KG1A 5LL6S 2VGMA 1GBRA 1KK7A 1VQPA 1TG0A 1PHTA 2DMOA 4C92F 2PTKA 1U06A 3CXCS 1PC0A 1MNDA 3SWNB 4M75D 2AZSA 1X6GA 3M0SA 3PGGA 5IHIA 1Q81R 4AFSC 2LP5A 2DL8A 1TU0B 2IIMA 3M0QA 4M75A 4J9EA 4E2FB 4RMOA 4C92B 5A0GA 2ZPEB 3RESA 1Q81U 1VQNA 4M7DE 1Y0MA 4J7FA 2DJZA 3LGLA 2YT6A 2HL3A 1H8KA 1QMCA 2EYXA 3OBYA 3RKXA 3G6ET 1IB8A 3RKWA 3G6EQ 2ZCFB 2LNVA 4F7UA 5KYXA 2FL7A 3TCJA 2DFUA 2WSFE 3RMSA 4BI4A 2DF6A 1AEYA 1NYFA 3P8HA 2LDMA 5GANe 1N6AA 4J9IA 2LX7A 2M0OA 2MWOA 1VYVA 1X6OA 4BDZA 4BE0A 2EVRA 2V8KA 3QYHB 1YITA 5GAN6 2ZAEA 1QCFA 1FYNA 4LD6A 3CPWP 4E7HA 1KSWA 2XU8A 2MYSA 3CMAT 2QK0A 4RTUA 4XTWA 1HYOA 3CMAQ 3OS0A 3LX7A 1KC8C 2GNCA 4C92G 5GAMh 4CRIA 3I55A 5CK9A 2CS7A 2QEXA 2KDSA 2KK4A 2O31A 1VYUA 3THKA 3AT1B 2COZA 1VOMA 2E70A 4A4FA 2QA4T 2O9VA 2KMTA 2QA4Q 3EG9A 4GLKA 4M4ZA 3CMEA 2VXEA 4M77F 2DETA 1M3BA 5LJ3d 1BCMA 4J9CA 1U3OA 1UB4A 5CKEA 1YIJT 1XQHA 3QWYA 1WJRA 1YIJQ 2VUBA 4IUUA 4M77B 2FEIA 1Y71A 4XU0A 1ZSZC 4AG1C 3S3OA 2LNHB 2OAUA 4KH0B 2HNIA 4RG8A 2EWNA 3I56A 1MUZA 1VQ9A 2K57A 2CH4A 3EG3A 2PUOB 4M7AC 1EIFA 1WYXA 5J3BA 4V2SA 2P0QA 1SSFA 2FO0A 2YUOA 4XTVA 2X4XA 4J9GA 4M7AE 4C92D 4NS5A 2Y4YA 1BYMA 2OTJT 2X51A 3QXEB 4P5NA 3EFRA 2L3RA 2MCNA 1VIFA 1KJWA 2BZXA 2P4TA 4C5GA 4OB2B 4D8DA 1M3AA 2V1QA 3LW5E 1PWTA 4C92A 5GAN2 5I2MA 2CKKA 1VQKA 3MEVA 1B07A 1PNJA 1JEGA 2E1HA 4M77G 3M53A 4FW1A 3OQ5A 5GAOm 1K8AR 1BIBA 3V7RA 1VQ6T 1QVFP 1UG1A 2JUFA 2VV5A 5AYFA 3DLMA 1VQ6Q 2FG0A 3UWNA 1BK2A 1JBMA 4LDUA 2XHCA 3FEOA 1FMVA 1VQOT 4XTUA 2DPPB 3CCVT 2A37A 3JCMJ 4E7SA 5I22A 5A0LA 4KT0E 2AKKA 3CCVQ 2EQUA 2LZ6B 4XQ3A 2M16A 2LX9A 2E6NA 2DD5A 1VQ5T 4F16A 1Q82C 5IN1A 1VQ5Q 1HXDA 3PT9A 3OYBA 1BIAA 1WA7A 2KRSA 4RCCA 1Q86R 4PKCC 2QG9B 3HRTA 2RK1A 1ACMB 5GAMg 2NLUA 1KHIA 2ZGWA 2JM8A 3PMIA 4JS4A 2EQJA 2DBMA 1KIKA 4BY6B 1WXUA 5C6SA 1SHFA 3OYMA 1TUDA 2ZPGB 2GQVA 3P8BB 1OV3A 1PD0A 2CH4W 5GANh 2O4XA 1WLPB 5HY6A 3OYYA 5DM7R 2CP6A 1YJNQ 2FPEA 1M5Q1 5EC7A 3NPFA 4PFOA 4J9BA 4R0KA 3S3NA 5GAMd 4OMPA 2K5LA 2LQKA 2XI9A 4DOWA 5HKCA 1BU1A 4RTZA 4EMKB 4Z02A 4HCKA 2P0PA 2DL3A 4M77D 5GAMf 5A2QE 3CC4T 2CZ7B 3R6NA 4KUIA 1H641 1WHMA 2LT4A 1UE9A 4AT1B 3HKSA 5GMKh 4RTVA 1NYGA 1KQSS 5LJ3j 3CMAA 3E2UA 4LDVA 3JSCA 4M77A 2VASA 3M0RA 1JXMA 2LCCA 3RBBB 4ME7A 1OI1A 1NJIU 2KXCA 2QASA 5GAN3 2XD0A 1OULA 4HCCA 2PZ1A 2XICA 2DXCA 2GFAA 2CUDA 3CD6T 2QA4A 2OTLT 3JCMc 1WQWA 3CD6Q 3HHTB 2OTLQ 2MK5A 2XMFA 2RQVA 4NL3A 2BE9B 1VQ8A 2J05A 4KULA 2M9UA 3EFOA 1M3CA 2RI3A 2EQMA 1ZUKA 2SRCA 3LLRA 2JOYA 4L59A 2RHIA 2KY9A 1NPPA 1TS9A 4F14A 2DNUA 3JB9I 1GCQA 2CP3A 1SG5A 1ARKA 1QP3A 3JCMh 4M78F 1M27C 4FYWB 4JS5A 2RF0A 2XK0A 1JU5C 1U5SA 1IXDA 4A4HA 1UJYA 1WX6A 1Q7YR 1VQLA 5I2SA 1N9SA 1JJ2S 4M75C 3QDFA 1VQPQ 4J7IA 4TVRA 4M78B 2MMPA 3M4YA 2ABLA 2RHUA 1Q7YU 2DYIA 1CSKA 3OS2A 4XAXB 2OTJA 4L6V5 1VYTA 1ZSGA 3LH0A 3BDLA 2D1XA 4PJOF 3LWIA 1IGUA 2L0AA 1KQSA 3C12A 4FM4B 2QDYB 2W10A 3FLGA 1TH7A 1OZ3A 2G3RA 9ATCB 1SPKA 5GANg 3CCST 4HVVA 5KH6A 1VQNQ 2E12A 2MF2A 3OA6A 1N27A 3QIIA 5GJWB 4Q5WA 3PNWC 2DLPA 4PJOB 1C6VX 1OX8A 1IRXA 1XTDA 4E47A 1MMGA 3UA6A 2L3QA 3NTKA 3KUFA 4CI0C 2BTTA 2V8JA 1LJOA 2JZ2A 1VQOA 3CCVA 5IHKA 3ZL7C 4AMCA 5GANd 1ZUYA 4J9FA 4CC4B 3VKIA 5DLQE 2ZZDA 1D0XA 3VV0A 1AWOA 3CCLT 3CCMT 3JCMQ 2EYZA 4M78G 1D1CA 3CCMQ 3QWXX 3L2WA 4LDWA 1X75C 4NL2A 4J9DA 2NWMA 5GAOq 4F7UF 5GANf 1YITQ 4OMQA 5IAYA 2A3LA 2LC4A 1G3SA 4N4GA 3WVEB 4Y92A 2CT3A 2LQWA 3I55T 1EZZB 3X25B 4QVCA 1R0BG 1YP5A 4UC4A 3I55Q 4BDYA 2QEXQ 4F7UB 2AHJB 1WI7A 1N8RC 4FCYA 2MI6A 2VVKA 2DTOA 4PJOG 1VA7A 4ORZA 1QW1A 2ED1A 3OYJA 3HRUA 3CMET 1UGSB 2KT1A 3CMEQ 1ZQ1A 4J6YA 3VS6A 4PJMA 3M0PA 3QSUA 3TSWA 1M1KR 4GBQA 1WQ7A 1GFDA 5KE2A 3CC4A 2X4WA 3DLLA 2DTIA 1RI9A 3NTIA 1Q95G 3JCMg 3H6ZA 5GMKl 2M0YA 1T0HA 5GJVB 1M1KU 1JB0E 2L3PA 1UGPB 2L89A 1OX9A 2K4YA 3AHUA 1D0ZA 4C5EA 4E7LA 3SWNC 1N9RA 4WCIA 4OB1B 2RI2A 2HCKA 4C8QE 4M78D 2CSQA 4HXJA 2COWA 1QKWA 5IXBA 5GAN8 3CD6A 4D8KA 2OTLA 3I56T 3KFVA 2ROTA 1VQ9T 3JCMd 3I56Q 4F7UG 1R8OB 1VQ9Q 4ATOA 3OYCA 1FWZA 3JCMV 1UECA 2LJ0A 1OEBA 3H0HA 1UJ0A 3MP6A 4M78A 4JZ4A 4QQDA 3C95A 2DILA 2RJFA 3A5ZB 2C0IA 3EHQA 4ZGJB 3SFMA 1NEGA 3JCMf 2HBWA 4KBMB 2QQ9A 1DJ7B 1NM7A 4PL6A 3OS5A 3S3MA 3PE0A 3BY7A 2JMAA 5KYNA 4PJOD 3OYNA 1YN8A 4WTOB 2DO3A 3HFOA 2E65A 3PFSA 3J80E 1VQKT 1VQKQ 2QI2A 3HTRA 4C0FA 1KQSP 1ABQA 3CCRA 3NFCA 5I21A 1RUWA 4PJOA 3G71A 2LCLA 2MAMA 1FXXA 2A08A 3NTHA 3QHSA 1QLYA 4OGCA 2GCXA 4HA8A 1M90U 1C1AA 2E4HA 4ZGDB 2D8JA 1RAHB 1YWOA 3JV3A 2J6FA 2XDPA 2ECZA 4Z8AA 1G83A 3I35A 2E5QA 1BCOA 4XU2A 3A8OB 1OPLA 4ZGEB 1QWFA 1YBYA 1YJ9A 1UGQB 1M9SA 4KGZB 2EGEA 3QZ5B 6AT1B 1B3QA 5CQXA 3ME9A 2LCSA 3CCSA 5LJ5e 4IKFA 3META 1KC8R 4RG2A 2CSIA 1I07A 3EGDA 2WSEE 2FZGB 4LD9K 3TVTA 4OB3B 2LQNA 4MMLA 2XG8D 3JAME 5DY9A 2MWPA 3SD4A 1KD1R 4BD3A 4F17A 2DJQA 1KQ1A 4ANJA 1OYXA 3SB2A 5GMKj 2DE0X 1QVGS 1KD1U 4HKEA 3CCMA 2RNAA 3CCLA 1K76A 4AFQC 3E9FA 4LN2A 5KYYB 1AVZC 2EBPA 4A4GA 1SEMA 1ZA2B 2ZPBB 4O5VA 4ZN3A 1QWEA 2QGFB 4DEXA 2KYBA 4XK8E 3V8LA 2RB6A 4IURA 2F5KA 4RTTA 3TEEA 2EQKA 1H3HA 1QKXA 3QKJA 2K5IA 5AT1B 4K11A 3EH1A 4LNPA 1OPKA 4LDXA 1Q81C 2JT4A 4KGXB 2O4XB 2K7AA 3J81E 2EGCA 2A36A 2CREA 1I1JA 4EPCA 4M7DF 2DIGA 3OW2S 4EDUA 1PKSA 2E6ZA 3EH2A 2HKQB 3M0TA 2LVMA 1RLQC 1IHWA 1VQ8T 2WSCE 2F1LA 2DD4A 2X3XD 1VQ8Q 3CXCA 3M54A 1ZBJA 1NPRA 2JS0A 1UGRB 1NE8A 4E7IA 3CBOA 2DRMA 3JB9J 1WXBA 4DEYA 2JW4A 1V76A 4M7DB 3M55A 1TUGB 3VS0A 3QZ9B 1TTHB 3M56A 3RKYA 4LUEA 2H3JA 5HCKA 1UEBA 2EYYA 1HK9A 3INZA 3GLXA 2VXFA 3L2VA 1MMAA 2HSEB 2OI3A 3TQ7P 1QP2A 3H0IA 1M2OA 1UGVA 3OYLA 1S72T 3CCUA 2QTXA 2K6DA 1TXQA 3JCMW 3RDVA 1VQLT 2E41A 1S72Q 1VQLQ 1GBQA 3EFOB 2A7YA 3CCQA 1RAEB 1Z9QA 3L1AA 3LWHA 3T9NA 4BY6C 1NLPC 2K9GA 2L5QA 3PVLA 3WXMB 2GTJA 5CCAA 2OTJQ 3G4ST 2X4JA 4M7DG 3D7SB 1RLPC 1W4SA 2M1HA 1P92A 1G3YA 1OU8A 3MPUB 4C8QA 3CC2T 2E3HA 3REBB 4RTYA 4N0AC 2HQXA 3M59A 3X26B 4FYVB 3CC2Q 1WZOA 1SKUB 2FRWA 3EAEA 2QQBA 3M5AA 4EMKC 3VS1A 2I2LA 1IO6A 3NHNA 1ABOA 3FC3A 3OW2A 3WVDB 1R0CB 4C0DB 2KAFA 5M9OA 3EGXB 1K8AU 1GXIE 1MGQA 1VQOQ 2K2MA 4ZTFA 1W2BS 1TSFA 5LJ5h 2F2VA 4J8OA 4MZMA 4RTXA 2DL7A 3PVQA 5KYYA 4HCZA 2RPNA 1WHGA 4PJLA 1YI2A 3JCMP 3H9NA 1YFNA 1Q86U 4AFZC 1ZSZB 2QDLA 3MCAB 2F5TX 3X20B 4JRQA 4DBQA 4M7AF 3DKMA 2CYZB 1C0MA 1K9MR 3GBQA 3H8ZA 4A4EA 4ZNXA 1K9MU 1I5OB 3FIFA 2Y4XA 3UPUA 4L5GA 4M7AB 2E10A 4M7DD 2JTEA 2L2PA 1ZUUA 2DYBA 1WGSA 4BACA 1QVPA 2RO0A 2ZPIB 5FU6B 3EG2A 3X28B 3CXCP 2DXTA 3SHWA 4M7DA 2JM9A 4JRIA 2G6FX 3CC4Q 1PSFA 2PVDB 2PU9B 1SRMA 2PVGB 2FB7A 2QQRA 2Z0WA 5KYWA 2VYTA 3L2ZA 1D1AA 1JQQA 1U8RA 4M78C 1TUCA 5FWCA 4FYYB 1OQKA 1M8VA 1O75A 4DBRA 1IZ6A 1XOVA 3R6OA 4B9WA 1X2QA 4JDSA 5L23A 2KYMA 2LJ3A 2HAXA 1E6HA 4KUDK 4MDWA 3M0UA 4M7AG 1W2BA 3VRZA 4D6WA 1WPYA 2PNIA 4QQGA 1M30A 4C5IA 2MIOA 2JVVA 4DBHA 2NUPB 4PJOC 4Y91A 3VJPA 2KSSA 5CKDA 1BB9A 3GOXA 1X01A 2DK3A 2RHZA 4MDXA 2FYKA 2C0OA 3OYAA 5LJ3e 3EFSA 4QW2A 2ED0A 2I0NA 2CGHA 1JO8A 3CCRT 2GFUA 3CCRQ 2O88A 3G71T 3JCMb 1S72A 3G71Q 1NJIC 5FU7B 3JB9F 1PSEA 4JJNK 4IIMA 5LJ5g 3EGXA 1EFNA 3C4SA 2FPDA 1X43A 3E1SA 1SRLA 2K3XA 2RJDA 4M75E 1N5ZA 2EGAA 2ESWA 1RAFB 4CC3A 2YUNA 3QUIA 1KQ2A 1OZ2A 2W0ZA 1GL5A 1YJ9T 3A1PA 3A8LB 1U1TA 3G4SA 4FT4A 4NOYA 1YJ9Q 2YWWA 5GAOn 2GQIA 2L8DA 1YWPA 2E5KA 4OF1A 1I81A 5LJ5d 2KT8A 2DTHA 1ZSZA 4KRTA 3VYHB 2YXYA 3CCSQ 1VQMA 2GBQA 3CC2A 2EKHA 2VKNA 2J6KA 3CPWS 3X24B 1Y7XA 4M7AD 3E19A 4X1VA 3QBYA 4IUQA 1K0XA 1VUBA 2YLBA 5LJ5f 1AZGB 2HMAA 3H0FA 1WJQA 4XU1A 2H8HA 1UHCA 5CKFA 2BUDA 5GAOl 4M7AA 1I4K1 1AWXA 2BE7D 3VRYA 3M4GA 3VUZA 1PG5B 3OYFA 4QQ6A 2KRMA 3SEMA 2FHDA 3CCLQ 5D6WA 5L8RE 5GAMj 2LT1A 1Q7YC 2NYSA 2FZKB 2RJEA 1WIEA 2JN0A 3OYKA 3JB9G 3M57A 2H3EB 2O9SA 1LNXA 2DVJA 2RN8A 1UTIA 5GAN5 1YHQT 2COYA 3JRZA 3LGFA 4AFUC 2QAZA 3MP1A 4FT2A 3EGDB 4Y28E 1R77A 7AT1B 1XJWB 2C06A 3HPWA 3CCJT 1JJ2A 3V8KA 1NEBA 5CAIA 3KXTA 1BI3A 2EYQA 2A0FB 2JTMA 2RQWA 3TSZA 4X9DA 2CT4A 5GMKi 1T0JA 1M2VA 2VC8A 2CP7A 4J6XA 4E7KA 3VS4A 2NUPA 3EG0A 2HL5C 5GAMe 3ULRB 3CCET 3ASKA 3CCEQ 1MMNA 5CR2A 3MO8A 1G5VA 2JTFA 2IG0A 1A0NB 1RABB 4JLGA 2GGRA 4XTXA 3RERA 1X27A 2V1RA 3OYGA 2NUTA 3CCUT 1K73R 1JXOA 4BE2A 3CCUQ 4IUTA 2MOXA 4BI8B 3FB9A 4EIKA 4MZTA 1QVFS 1D1BA 1NLOC 3F70A 2OX7A 3CCQT 4JRPA 3JB9D 4C92C 1X6BA 3CCQQ 1K73U 2DZ9A 4C92E 1H92A 2F2WA 2IPOB 3A8GB 2CP2A 2DL5A 2AK5A 1K9AA 1GCPA 3A98A 4QVDA 4BE1A 1VQ7A 1ZX6A 2EKOA 4OB0B 3ZBDA 4FSSA 1IREB 3CC7A 5A0DA 5J39A 1RACB 4PLLA 3PIPA 2XIDA 4ZN1A 2KBTA 2KRNA 1M1KC 4VUBA 4YTLA 2AKLA 3V8JA 2J06A 4JLIA 5DLOA 5CO7A 2M51A 2K3YA 3BDUA 4LUDA 1GRIA 1YJWA 4X34A 4C8QF 1E7OA 1AWWA 2QXFA 3UA7A 3QYGB 2P0KA 2LJ1A 3I9QA 2DAQA 2DXBA 2FPFA 5GANj 1YI2T 4HVWA 1YI2Q 4MZPA 2BKDN 1AZEA 3PMTA 1RI0A 4C8QB 1D3BB 2KGTA 3I5RA 1LCKA 1M1FA 5I11A 2RHXA 3BE3A 2YRVA 1KC8U 3MJXA 4M7DC 4C5HA 1FMKA 3M58A 1QVFA 1V1CA 2XDDA 1IGQA 3V7CA 2DX1A 2YDLA 1MMDA 2YHTA 2NUZA 1MNEA 4M77C 4DA4A 2XDBA 3OS1A 1M90C 3M9QA 4E7ZA 4M77E 2KNBB 5ECAA 1JJ2P 3CQTA 2K3BA 2LMJA 5GAN4 2D0NA 2K79A 3OMGA 3NGPA 1CKAA 1VIEA 2D0QB 2RK2A 2DZCA 1YHQA 4C8QG 4FU6A 4A4KA 2QTVA 4PNOA 4RTWA 3S6WA 3JB9H 2LRQA 2FVUA 4OMMA 4EMGA 3CCJA 4ESRA 1HD3A 4N4HA 3GF5A 1I8FA 4A63B 2C0TA 3MEWA 5LJ3g 4II1A 1RAAB 4RCBA 2JNGA 1GCQC 3REAB 3LYIA 4DQ2A 1T3LA 4R55A 2BZYA 1HSQA 5GMKe 1G2BA 1AOJA 2EJFA 2KE9A 1PD1A 2JS2A 3H41A 5D6YA 1KD1C 2PUKB 4AG2C 4JRKA 2K2VA 5CQYA 4LXCA 4C0DC 2HQEA 3CCEA 2KVQG 1ZLMA 4FSXA 3ZEHA 2F2XA 5KYWB 1K0SA 2HQHA 1G3TA 3VS3A 4MMKA 1HJDA 1B34B 4LE9A 3UT1A 2JMCA 3MEUA 2VGNA 1RADB 3RMQA 5LJ3f 1V29B 4ELYC 2EQIA 2QYZA 1T3SA 4E6RA 3L2RA 1UDLA 2KROA 1I0CA 4OVAA 1O9SA 5HK3A 3VS7A 2KI7A 1QVGA 1Q82R 4OGEA 4DOVA 4C8QD 3Q1JA 1TWBA 1WFWA 3G4SQ 1Q82U 3U23A 3JCMe 3C0CA 4F04B 2BIVA 1M8MA 3VUBA 2D8HA 4BB7A 1VQMT 2QGGA 3SWNA 1VQMQ 1SSHA 4FIBA 1D3BA 3E9GA 2KQWA 2YUPA 3PTAA 5CKHA 2L3SA 1J3TA 3FDRA 5FU6C 2DVEA 2HBPA 2LTOA 2LQ8A 2F69A 2RD1A 2YLCA 1PRLC 2RM4A 4FW2A 3GPLA 4JJBA 5D7UA 3L2UA 3OYEA 3HP9A
chains in the Genus database with same CATH topology
2DTIA 3NTIA 3CCRT 3JCMg 2GFUA 3H6ZA 3P8HA 5GMKl 3VU3C 2LDMA 5GANe 3G71T 1N6AA 3JCMb 1M1KU 1S72A 1JB0E 5GAN7 5GAOp 1NJIC 5FU7B 3JB9F 1PSEA 3QJYA 4JJNK 1UGPB 2L89A 5LJ5g 2K4YA 2M0OA 2MWOA 3AHUA 1X6OA 4BDZA 3C4SA 4BE0A 2RJCA 4C5EA 4E7LA 3E1SA 2V8KA 3QYHB 3QO3A 2K3XA 2RJDA 4M75E 3SWNC 1YITA 1N9RA 2R5MA 4OB1B 5GAN6 2RI2A 5KCOA 5FRNA 4HT9A 4C8QE 3PIOA 4M78D 3SDZA 4LD6A 4E7HA 3GP8A 3BFMA 3DLLA 5GAN8 1U1SA 2XU8A 3CD6A 3CMAT 2OTLA 3QUIA 1YCYA 4XTWA 3I56T 1VQ9T 3JCMd 3OS0A 3LX7A 1OZ2A 1KC8C 4F7UG 1KQ2A 2ZPHB 2DKGA 1R8OB 3A8LB 4J5YA 4C92G 1YJ9T 5GAMh 4CRIA 1U1TA 3I55A 5CK9A 3G4SA 4FT4A 2CS7A 4NOYA 1FWZA 2ZPFB 3JCMV 3URGA 5GAOn 3OYCA 2QEXA 2KDSA 1VQ4T 2L8DA 3MP6A 4M78A 3GNFB 4QQDA 2KK4A 3C95A 1I81A 2R57A 4OF1A 5LJ5d 2DTHA 2RJFA 2O01E 2E70A 4A4FA 2EAYA 3VYHB 2QA4T 3ER0A 1VQMA 3A5ZB 3GIBA 4J83A 4ZGJB 3SFMA 5D6XA 2KMTA 3CC2A 3V7SA 3JCMf 4GLKA 3HSBA 4KBMB 3CPWS 3X24B 1Y7XA 4M7AD 2QQ9A 1RL2A 1DJ7B 3E19A 4PL6A 3QBYA 3OY9A 4IUQA 3MP8A 3OS5A 4XTYA 3CMEA 5FLXE 1VUBA 2VXEA 3OBWA 3S3MA 2YLBA 3BY7A 4M77F 5LJ5f 1K8AC 3G6EA 1YJNT 1WJQA 5LJ3d 4XU1A 4PJOD 3OYNA 4FL6A 5CKFA 2DO3A 3HFOA 2BUDA 2E65A 3PFSA 2CZ0B 3G7ZA 3J80E 5GAOl 1VQKT 3JCMX 4M7AA 5CKBA 1I4K1 1UB4A 5CKEA 2QI2A 1BKBA 3TREA 4C0GA 1YIJT 4C0FA 3CCRA 1XQHA 3NFCA 1WJRA 3M4GA 4J6WA 5FU7C 5I21A 5HK0A 3VUZA 5GAOr 4PJOA 3G71A 2VUBA 2LCLA 3OYFA 2MAMA 1FXXA 1NZ9A 2FHDA 3NTHA 3QHSA 4IUUA 4M77B 4QQ6A 5GMKm 5D6WA 5L8RE 5GAMj 4OGCA 2GCXA 1Q86C 1Y71A 2LT1A 1Q7YC 4HA8A 1M90U 4XU0A 1Y96B 2CZ1B 4M78E 5EG2A 4ZGDB 2RJEA 3S3OA 3HFNA 2OAUA 1B34A 2JN0A 2HNIA 3OYKA 3L2QA 3JB9G 3M57A 4RG8A 1LNXA 2EWNA 2XDPA 1JRIA 5GAN5 1YHQT 2E5QA 3JRZA 3LGFA 3I56A 1K9MC 4XU2A 1VQ9A 3A8OB 4ZGEB 1NJIU 1YBYA 3MP1A 4FT2A 1YJ9A 2K57A 1UGQB 2XD0A 1M9SA 4Y28E 3QZ5B 2EFIA 2C06A 2PUOB 4IUPA 3KBGA 3HPWA 1EIFA 5CQXA 4M7AC 3ME9A 5J3BA 4V2SA 3CCJT 2D9TA 2P0QA 1SSFA 4XTVA 4XTZA 3CCSA 2X4XA 4M7AE 5LJ5e 4C92D 4NS5A 2Y4YA 4IKFA 1BYMA 2OTJT 3CBPA 1VQ7T 3META 1JJ2A 3V8KA 3QXEB 4RG2A 4P5NA 5CAIA 3KXTA 1BI3A 3EFRA 2L3RA 2EYQA 3CC7T 2JTMA 3A8HB 1VIFA 4PJOE 2WSEE 2P4TA 4C5GA 4LD9K 2GF7A 2QQSA 4OB2B 4OB3B 4X9DA 3LW5E 4XU3A 4C92A 5GAN2 3ZFJA 5GMKi 2Y90A 3QPHA 2VC8A 4MMLA 5I2MA 2XG8D 3JAME 4J6XA 4E7KA 1M1GA 5CVIA 2CKKA 5DY9A 2MWPA 2X35A 3SD4A 1VQKA 3MEVA 4BD3A 2E1HA 4M77G 3M53A 3OQ5A 5GAOm 2RI5A 3L42A 5GAMe 4HT8A 1KQ1A 1OYXA 2QQAA 3SB2A 1YIJA 3CCET 1BIBA 3HL8A 3ASKA 3MEAA 3V7RA 5GMKj 1QVGS 2JUFA 1VQ6T 3QG1A 1KD1U 4HKEA 2VV5A 5AYFA 3DLMA 5CR2A 3CCMA 3CCLA 2RHYA 3UWNA 1JBMA 1YJWT 3E9FA 4LDUA 3MO8A 2XHCA 1FX7A 3FEOA 1G5VA 2JTFA 4PLIA 1VQOT 2IG0A 4XTUA 1LOJA 2DPPB 4A4GA 3CCVT 5IT9E 3JCMJ 5FRMA 4JLGA 4WF2A 4O6JA 4KT0E 4XTXA 5A0LA 2EQUA 3RERA 2RA2A 2ZPBB 4O5VA 4ZN3A 1AHJB 4XQ3A 2V8IA 1BI1A 2M16A 3OYGA 2LX9A 3CBMA 3CCUT 1BI2A 2E6NA 2DD5A 4XK8E 2RB6A 3OSSC 2F5KA 4IURA 3V8LA 3TEEA 5IN1A 2EQKA 4B9XA 4BE2A 1Q82C 3OMCA 2EIFA 1HXDA 3PT9A 4IUTA 4BI8B 3FB9A 3OYBA 1BIAA 4RCCA 4MZTA 2DXUA 4PKCC 1QVFS 3QKJA 4OP0A 3HRTA 2K5IA 2RK1A 3BW1A 3CEYA 3F70A 3CCQT 4JRPA 4LDXA 3JB9D 4C92C 1VQPT 1Q81C 1WNLA 2O4XB 1K73U 5GAMg 2DZ9A 2NLUA 4F7UE 4C92E 1KHIA 2ZGWA 3N5BB 3J81E 3JB9H 3PMIA 4ELZC 2EJ9A 4EPCA 3A8GB 4M7DF 4JS4A 2DIGA 2EQJA 2R58A 4EDUA 3OW2S 2E6ZA 4A53A 2LVMA 4BY6B 1VQ5T 4GY5A 4QVDA 1VQ8T 2HD0A 2WSCE 5C6SA 2IVWA 4BE1A 1VQ7A 2DD4A 1KHCA 3O8VA 2XKOC 3OYMA 2EKOA 4OB0B 3ZBDA 3CXCA 1IREB 2GQVA 2ZPGB 3M54A 3P8BB 2D6FA 3CC7A 1NPRA 5A0DA 5FROA 5J39A 2O4XA 5GANh 5HY6A 3OYYA 5DM7R 1UGRB 1NE8A 3OB9A 4E7IA 3CBOA 4PLLA 3PIPA 1M5Q1 2XIDA 3JB9J 3HRSA 1VQNT 1ZHIA 4ZN1A 3S3NA 4M7DB 5GAMd 3M55A 1M1KC 4VUBA 4HCBA 2K5LA 4OMFB 3QZ9B 4YTLA 3M56A 2LQKA 4BUGA 3RKYA 1N8RU 2K5FA 3V8JA 4QVZA 3TU4K 2H3JA 2XI9A 3OSVA 4JLIA 4DOWA 5HKCA 5DLOA 1UEBA 5CO7A 4EMKB 4Z02A 4EMHA 1VQ6A 2K3YA 4C0ZA 1HK9A 3BDUA 3INZA 2P0PA 3GLXA 2VXFA 4M77D 5GAMf 4RKUE 3L2VA 1YJWA 5A2QE 3CC4T 4M75F 2CZ7B 3DB4A 1QP2A 4KUIA 4X34A 1H641 5C0MA 4C8QF 1BI0A 2LT4A 4N0AA 3HKSA 3OYLA 4N4IA 5GMKh 2QXFA 3OYHA 1S72T 1KQSS 5LJ3j 2QTXA 3CCUA 4EMKA 3CMAA 4LDVA 3JCMW 3FJPA 1VQ5A 1VQLT 2E41A 3JSCA 2P0KA 3QYGB 4M77A 2DAQA 2DXBA 5CIUA 2LCCA 4ME7A 1MHNA 5KE3A 1Y96A 2A7YA 3RIRA 1OI1A 5GANj 3CCQA 1YI2T 5GAN3 3L1AA 3LWHA 1VQ4A 1YITT 3T9NA 3FRNA 4HCCA 2XICA 3QDRB 4M75B 4MZPA 2BKDN 2DXCA 2GFAA 2R5AA 3OYIA 3PMTA 4BY6C 1RI0A 4C8QB 3CD6T 2L5QA 3WXMB 3VYGA 2QA4A 3JCMc 2OTLT 5CCAA 1WQWA 1D3BB 3HHTB 4NL3A 2EJGA 1VQ8A 4KULA 3G4ST 2X4JA 2QEXT 1M1FA 2B8AA 2DIQA 2M9UA 2RHXA 4A54A 4M7DG 2YRVA 4LDYA 2RI3A 1W4SA 1KC8U 2M1HA 1YJNA 1P92A 1G3YA 4M7DC 3RUXA 2EQMA 3HP9A 4C5HA 3M58A 4C8QA 3CC2T 1QVFA 4R56A 4N0AC 2HQXA 3M59A 3X26B 3LLRA 3V7CA 2XDDA 2YHTA 3EAEA 2QQBA 3M5AA 2JOYA 4EMKC 4L59A 4M77C 4DA4A 2RHIA 2XDBA 2KY9A 2I2LA 1NPPA 3OS1A 1M90C 4BI3A 3M9QA 3FC3A 3OW2A 4M77E 3WVDB 4C0DB 2KAFA 3CPWA 3DB3A 3JB9I 5M9OA 1QP3A 5GAN4 3JCMh 1K8AU 4M78F 3A8MB 5KCHA 1GXIE 1MGQA 3OMGA 4ZTFA 4JS5A 1VIEA 1Y07A 4JUVA 2XK0A 2PVOB 1W2BS 4ZTJA 2D0QB 2RK2A 5LJ5h 4A4HA 2DZCA 1XNIA 1YHQA 3C94A 4J8OA 4MZMA 4M75G 1VQLA 2X4YA 5I2SA 4C8QG 1N9SA 4HCZA 3GNGA 1JJ2S 4FU6A 4M75C 4A4KA 4PNOA 4J7IA 4C8QC 4TVRA 4M78B 3JCMP 3S6WA 1YI2A 1Q86U 2MMPA 3M4YA 4JRQA 2LRQA 2RHUA 2F5TX 2FVUA 3MCAB 3P8DA 3X20B 4EMGA 3CCJA 1Q7YU 4M7AF 4X9CA 3DKMA 3OS2A 2CYZB 2WACA 5LJ3h 4XAXB 4N4HA 3GF5A 4L6V5 2OTJA 1I8FA 2DEQA 3H8ZA 3MEWA 3LH0A 3QJ6A 5LJ3g 3BDLA 4PJOF 4A4EA 1ZBXA 4II1A 3LWIA 4RCBA 2JNGA 1K9MU 1KQSA 3FIFA 3C12A 3MHXA 3LYIA 2Y4XA 4FM4B 2QDYB 4DQ2A 3FLGA 3CCST 1TH7A 1OZ3A 2G3RA 5GANg 3UPUA 4L5GA 5KH6A 4R55A 5GMKe 2E12A 2MF2A 4M7AB 2E10A 2EJFA 1H3ZA 1G3WA 3UDCA 3OA6A 4M7DD 1N27A 3QIIA 5D6YA 1KD1C 4Q5WA 2PUKB 3PNWC 4JRKA 2K2VA 5CQYA 4C0DC 2HQEA 3CCEA 5LJ5j 1WGSA 2KVQG 4PJOB 4FSXA 3ZEHA 4BACA 1M4ZA 1QVPA 1XTDA 4E47A 1WJSA 2RO0A 2ZPIB 5FU6B 3NTKA 5J26A 3KUFA 4CI0C 3J7AF 3X28B 2DXTA 2V8JA 1G3TA 1LJOA 4JRIA 4M7DA 2JZ2A 1VQOA 2PQWA 3CCVA 4E7JA 1PSFA 4MMKA 2PVDB 5GANd 1B34B 2PU9B 3UT1A 3MEUA 3CPFA 2VGNA 3OYDA 3VKIA 5DLQE 4IUVA 2ZZDA 3VV0A 2E64A 3CCLT 3RMQA 3CCMT 2PVGB 1V29B 5LJ3f 4ELYC 4M78G 2FB7A 2QQRA 3JCMQ 1K73C 2CZ6B 2RH2A 1I5LA 2VYTA 3L2ZA 3L2RA 3L2WA 1U8RA 5LL6S 2VGMA 1KG1A 4M78C 4LDWA 1X75C 4NL2A 4OVAA 5GAOq 1O9SA 5HK3A 1VQPA 4F7UF 5GANf 1M8VA 4C92F 1QVGA 1O75A 5IAYA 3CXCS 1IZ6A 2A3LA 1XOVA 2LC4A 4OGEA 3SWNB 4M75D 1G3SA 3R6OA 4N4GA 3WVEB 4B9WA 4DOVA 4C8QD 4JDSA 2HAXA 3Q1JA 3I55T 3X25B 3PGGA 4QVCA 4UC4A 4KUDK 4MDWA 4BDYA 1Q82U 3JCMe 4M7AG 1W2BA 2BIVA 4M75A 4D6WA 3VUBA 4F7UB 4RMOA 4BB7A 4C92B 1VQMT 5A0GA 4ATOA 1WPYA 2AHJB 2ZPEB 3SWNA 4QQGA 3RESA 1Q81U 1N8RC 1VQNA 4M7DE 4C5IA 4FIBA 2MI6A 2DJZA 4J7FA 1D3BA 2DTOA 4PJOG 2JVVA 3E9GA 2KQWA 3PTAA 3LGLA 1QW1A 5CKHA 3OYJA 4PJOC 3HRUA 4Y91A 3VJPA 3CMET 2KSSA 1UGSB 3OBYA 3RKXA 5CKDA 3G6ET 1ZQ1A 3GOXA 1X01A 4J6YA 3FDRA 2DK3A 2RHZA 3RKWA 5FU6C 4MDXA 2DVEA 2HBPA 2LTOA 2FYKA 2ZCFB 2LNVA 2LQ8A 4F7UA 2FL7A 3TCJA 3QSUA 2F69A 3OYAA 2WSFE 3RMSA 2RD1A 2YLCA 3GPLA 2RM4A 1WQ7A 5LJ3e 3EFSA 4QW2A 4BI4A 5KE2A 3L2UA 3OYEA 3CC4A 2X4WA 2CGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTI A;  1HK9 A;  3BDU A;  4M7A C;  1I8F A;  3INZ A;  2DEQ A;  3JCM g;  4V2S A;  2VXF A;  5LJ3 g;  4XTV A;  4XTZ A;  4M77 D;  4PJO F;  3VU3 C;  5GAM f;  5GMK l;  4C92 D;  5LJ5 e;  5GAN e;  4M7A E;  3JCM b;  4RCB A;  4M75 F;  5GAN 7;  5GAO p;  3V8K A;  3JB9 F;  3FIF A;  5CAI A;  1H64 1;  4DQ2 A;  4C8Q F;  3EFR A;  4N0A A;  1TH7 A;  5LJ5 g;  5GAN g;  3AHU A;  5GMK e;  4PJO E;  5GMK h;  4M7A B;  2E10 A;  2EJF A;  2QTX A;  3QO3 A;  4EMK A;  5LJ3 j;  4M75 E;  3JCM W;  3FJP A;  3SWN C;  2E41 A;  1N9R A;  4X9D A;  4M77 A;  4XU3 A;  5GAN 6;  4HT9 A;  4M7D D;  4C92 A;  4C8Q E;  5GAN 2;  5GMK i;  2Y90 A;  4M78 D;  2VC8 A;  4JRK A;  4MML A;  4J6X A;  3BFM A;  1Y96 A;  1U1S A;  5DY9 A;  3RIR A;  5LJ5 j;  5GAN 8;  5GAN j;  3QUI A;  4PJO B;  1YCY A;  3L1A A;  4XTW A;  5GAN 3;  3JCM d;  1KQ2 A;  4M75 B;  2E1H A;  4M77 G;  4F7U G;  5GAO m;  2DKG A;  4C92 G;  4J5Y A;  5GAM e;  4HT8 A;  1KQ1 A;  5GAM h;  1U1T A;  4C8Q B;  3SB2 A;  4NOY A;  1BIB A;  3JCM V;  5GAO n;  2DXT A;  3JCM c;  5GMK j;  1LJO A;  4JRI A;  3V7R A;  4M7D A;  1WQW A;  1D3B B;  4M78 A;  4MMK A;  1I81 A;  5LJ5 d;  2EJG A;  5GAN d;  1B34 B;  2DTH A;  4NL3 A;  1JBM A;  2EAY A;  4A54 A;  3GIB A;  4M7D G;  4XTU A;  1LOJ A;  3V7S A;  3JCM f;  2E64 A;  3JCM J;  3HSB A;  5LJ3 f;  4WF2 A;  3JCM Q;  4M78 G;  2FB7 A;  4XTX A;  1I5L A;  3RER A;  4M7A D;  2RA2 A;  4M7D C;  3L2Z A;  3RUX A;  4XQ3 A;  4C8Q A;  4M78 C;  4XTY A;  3V8L A;  4NL2 A;  2RB6 A;  2VXE A;  4N0A C;  5GAO q;  2YLB A;  3BY7 A;  4M77 F;  3V7C A;  1HXD A;  4F7U F;  4C92 F;  5LJ5 f;  3FB9 A;  5GAN f;  2YHT A;  1BIA A;  5LJ3 d;  4RCC A;  4XU1 A;  4PJO D;  2DXU A;  4OP0 A;  4EMK C;  3HFO A;  3SWN B;  2E65 A;  3BW1 A;  4M75 D;  5GAO l;  4M77 C;  3JCM X;  4M7A A;  3JB9 D;  4C92 C;  1WNL A;  2I2L A;  4C8Q D;  1I4K 1;  4M77 E;  5GAM g;  2DZ9 A;  4F7U E;  1M8V A;  4C92 E;  2ZGW A;  3PGG A;  4QVC A;  2EJ9 A;  3JB9 I;  4M7D F;  3M4G A;  4J6W A;  5I21 A;  3JCM e;  5GAN 4;  5GAO r;  3JCM h;  4A53 A;  4M78 F;  4M7A G;  4PJO A;  1MGQ A;  4QVD A;  4M75 A;  3QHS A;  4JUV A;  4M77 B;  5GMK m;  4F7U B;  4C92 B;  5GAM j;  1WPY A;  3SWN A;  3RES A;  4M7D E;  4HA8 A;  4XU0 A;  1Y96 B;  2DJZ A;  5LJ5 h;  1D3B A;  2DTO A;  4M78 E;  4PJO G;  5GAN h;  2DZC A;  3HFN A;  1B34 A;  2JN0 A;  4M75 G;  3JB9 J;  1M5Q 1;  2HNI A;  4Y91 A;  3JB9 G;  4PJO C;  4C8Q G;  1LNX A;  1N9S A;  2EWN A;  4M75 C;  3RKX A;  4M7D B;  5GAM d;  1JRI A;  1X01 A;  4J6Y A;  4PNO A;  3RKW A;  5GAN 5;  4C8Q C;  2DVE A;  4M78 B;  3JCM P;  2FYK A;  4XU2 A;  4F7U A;  3QSU A;  3JB9 H;  3RKY A;  3V8J A;  4EMG A;  4M7A F;  2RD1 A;  2K57 A;  2YLC A;  2RM4 A;  1WQ7 A;  4JLI A;  4X9C A;  3EFS A;  5LJ3 e;  5LJ3 h;  4EMK B;  2CGH A;  4EMH A; 
#chains in the Genus database with same CATH topology
 2J6O A;  1F1B B;  4Z89 A;  2RQR A;  1S1N A;  3VU3 C;  2RQT A;  5GAN 7;  5GAO p;  8AT1 B;  2GTO A;  3QJY A;  8ATC B;  4QT7 A;  1OOT A;  1PRM C;  1UUE A;  2RJC A;  3QO3 A;  1UFF A;  2R5M A;  5FRN A;  5KCO A;  4HT9 A;  2JJ9 A;  3PIO A;  3SDZ A;  3GP8 A;  3BFM A;  1U1S A;  1W6X A;  2P4R A;  1YCY A;  2ZPH B;  2DKG A;  4J5Y A;  1IHV A;  3URG A;  1AT1 B;  2ZPF B;  1VQ4 T;  3GNF B;  3VS5 A;  1VQ4 Q;  2KR3 A;  2OAW A;  2R57 A;  2YRD A;  2O01 E;  2EAY A;  3ER0 A;  1X69 A;  3GIB A;  4J83 A;  5D6X A;  3V7S A;  3UAT A;  3HSB A;  2E3I A;  1RL2 A;  1KFZ A;  2B86 A;  3OY9 A;  3MP8 A;  1RAG B;  4XTY A;  5FLX E;  3OBW A;  1X2K A;  1K8A C;  3G6E A;  1YJN T;  1K4U S;  1WHK A;  4FL6 A;  1LPL A;  2CZ0 B;  3G7Z A;  3JCM X;  5CKB A;  1BKB A;  3TRE A;  4C0G A;  5HK0 A;  4J6W A;  5FU7 C;  5GAO r;  2JXB A;  1NZ9 A;  5GMK m;  1Q86 C;  3UF4 A;  1YNZ A;  1Y96 B;  2CZ1 B;  4M78 E;  5EG2 A;  1AWJ A;  3HFN A;  4OMO A;  1B34 A;  4IIO A;  2HSP A;  1E6G A;  2HEQ A;  3L2Q A;  1NJI R;  1JRI A;  2X3W D;  1K9M C;  2RMO A;  1MV0 B;  2EFI A;  4IUP A;  2EYW A;  5IXF A;  3KBG A;  4Z88 A;  1M2V B;  2D9T A;  4XTZ A;  1D0Y A;  1WHJ A;  5FW9 A;  3CBP A;  1VQ7 T;  1GFC A;  5IH2 A;  1VQ7 Q;  1QVG P;  3CC7 T;  3A8H B;  4PJO E;  2HZY A;  2EW3 A;  3CC7 Q;  1EX4 A;  2GF7 A;  2QQS A;  4XU3 A;  3ZFJ A;  2Y90 A;  3QPH A;  1M1G A;  1QCO A;  2HDA A;  5CVI A;  2X35 A;  4DBF A;  2OJ2 A;  2RI5 A;  3L42 A;  4HT8 A;  2QQA A;  2NUT B;  1YIJ A;  3HL8 A;  3MEA A;  4OMN A;  3QG1 A;  1QQJ A;  2RHY A;  1YJW T;  2O2O A;  1FX7 A;  1YJW Q;  4PLI A;  1LOJ A;  2DA9 A;  5FRM A;  5IT9 E;  1G8X A;  4WF2 A;  2CDT A;  4O6J A;  2CP5 A;  3OW2 P;  2RA2 A;  1MV3 A;  1AHJ B;  2V8I A;  1BI1 A;  3CBM A;  1BI2 A;  3OSS C;  4PFP A;  4B9X A;  3OMC A;  2EIF A;  1D09 B;  2DL4 A;  1SF9 A;  2DXU A;  4OP0 A;  3BW1 A;  3CEY A;  1VQP T;  2DEU A;  1WNL A;  2RQU A;  1AD5 A;  4F7U E;  3N5B B;  4ELZ C;  1WHL A;  1PM3 A;  2EJ9 A;  2R58 A;  2X9H A;  4A53 A;  5KYU B;  4GY5 A;  2HD0 A;  2IVW A;  1KHC A;  3O8V A;  4PJN A;  2XKO C;  1UHF A;  2P84 A;  2D6F A;  5FRO A;  3OB9 A;  1N8R R;  2CP0 A;  1SHG A;  2FRY A;  2V26 A;  1VQN T;  3HRS A;  1ZHI A;  2YSQ A;  4HCB A;  4OMF B;  4BUG A;  1N8R U;  2K5F A;  4QVZ A;  3TU4 K;  3OSV A;  4FYX B;  2YUQ A;  2CUB A;  1VQ6 A;  4EMH A;  4PK4 A;  4C0Z A;  2J7I A;  1ZA1 B;  4RKU E;  1RAI B;  4M75 F;  3DB4 A;  1YCS B;  5C0M A;  1BI0 A;  4N0A A;  4N4I A;  4OML A;  4JZ3 A;  3OYH A;  4EMK A;  1VQ5 A;  1B7T A;  3FJP A;  2AZV A;  1YHQ Q;  2DER A;  5CIU A;  3EGU A;  1WXT A;  2YRC A;  1MHN A;  5KE3 A;  1Y96 A;  4B6M A;  3RIR A;  2DM1 A;  1YIT T;  1VQ4 A;  3FRN A;  3QDR B;  4M75 B;  2R5A A;  3OYI A;  5IHN A;  3LH5 A;  1Y57 A;  3CCJ Q;  3VYG A;  4CC2 A;  2VB6 A;  2KEA A;  2EJG A;  2BZ8 A;  4GLM A;  4PFZ A;  2QEX T;  2B8A A;  2DIQ A;  4A54 A;  1TOV A;  2M02 A;  4LDY A;  1YJN A;  3RUX A;  5KYX B;  1OU9 A;  1QCN A;  4PJJ A;  4R56 A;  1W2B P;  4JJC A;  1Z9Z A;  2FZC B;  4BI3 A;  4JPB W;  3CPW A;  3DB3 A;  3VS2 A;  3I5S A;  2MPX C;  2AIR B;  1WDX A;  5KCH A;  3A8M B;  4J9H A;  1CKB A;  3MKD A;  1Y07 A;  4JUV A;  2PVO B;  3NMZ C;  4ZTJ A;  2DRK A;  4JJD A;  1XNI A;  2ATC B;  3C94 A;  5FWB A;  4CC7 A;  4M75 G;  2X4Y A;  1NG2 A;  3GNG A;  4KH1 B;  2AT1 B;  4C8Q C;  4KGV B;  1PCX A;  3FJ5 A;  3P8D A;  3RNJ A;  4X9C A;  5LJ3 h;  2WAC A;  3EG9 B;  3G1J A;  1BBZ A;  2DEQ A;  3QJ6 A;  2DBK A;  1ZBX A;  3MHX A;  1K1Z A;  2A28 A;  3EHR A;  1NBE B;  5KYU A;  1H3Z A;  1G3W A;  3UDC A;  2KXD A;  3EG1 A;  5LJ5 j;  3O5Z A;  2EPD A;  1M4Z A;  1WJS A;  2ENM A;  5J26 A;  1LVK A;  1W70 A;  3J7A F;  4RUG A;  1FMW A;  1PKT A;  4HVU A;  2PQW A;  1WHH A;  4E7J A;  2ROL A;  2VWF A;  2SEM A;  1W1F A;  3IQL A;  3CPF A;  1M90 R;  3OYD A;  4IUV A;  4QKU A;  2E64 A;  1K73 C;  1I5L A;  2CZ6 B;  2RH2 A;  3RR6 A;  2HKN A;  1KG1 A;  5LL6 S;  2VGM A;  1GBR A;  1KK7 A;  1VQP A;  1TG0 A;  1PHT A;  2DMO A;  4C92 F;  2PTK A;  1U06 A;  3CXC S;  1PC0 A;  1MND A;  3SWN B;  4M75 D;  2AZS A;  1X6G A;  3M0S A;  3PGG A;  5IHI A;  1Q81 R;  4AFS C;  2LP5 A;  2DL8 A;  1TU0 B;  2IIM A;  3M0Q A;  4M75 A;  4J9E A;  4E2F B;  4RMO A;  4C92 B;  5A0G A;  2ZPE B;  3RES A;  1Q81 U;  1VQN A;  4M7D E;  1Y0M A;  4J7F A;  2DJZ A;  3LGL A;  2YT6 A;  2HL3 A;  1H8K A;  1QMC A;  2EYX A;  3OBY A;  3RKX A;  3G6E T;  1IB8 A;  3RKW A;  3G6E Q;  2ZCF B;  2LNV A;  4F7U A;  5KYX A;  2FL7 A;  3TCJ A;  2DFU A;  2WSF E;  3RMS A;  4BI4 A;  2DF6 A;  1AEY A;  1NYF A;  3P8H A;  2LDM A;  5GAN e;  1N6A A;  4J9I A;  2LX7 A;  2M0O A;  2MWO A;  1VYV A;  1X6O A;  4BDZ A;  4BE0 A;  2EVR A;  2V8K A;  3QYH B;  1YIT A;  5GAN 6;  2ZAE A;  1QCF A;  1FYN A;  4LD6 A;  3CPW P;  4E7H A;  1KSW A;  2XU8 A;  2MYS A;  3CMA T;  2QK0 A;  4RTU A;  4XTW A;  1HYO A;  3CMA Q;  3OS0 A;  3LX7 A;  1KC8 C;  2GNC A;  4C92 G;  5GAM h;  4CRI A;  3I55 A;  5CK9 A;  2CS7 A;  2QEX A;  2KDS A;  2KK4 A;  2O31 A;  1VYU A;  3THK A;  3AT1 B;  2COZ A;  1VOM A;  2E70 A;  4A4F A;  2QA4 T;  2O9V A;  2KMT A;  2QA4 Q;  3EG9 A;  4GLK A;  4M4Z A;  3CME A;  2VXE A;  4M77 F;  2DET A;  1M3B A;  5LJ3 d;  1BCM A;  4J9C A;  1U3O A;  1UB4 A;  5CKE A;  1YIJ T;  1XQH A;  3QWY A;  1WJR A;  1YIJ Q;  2VUB A;  4IUU A;  4M77 B;  2FEI A;  1Y71 A;  4XU0 A;  1ZSZ C;  4AG1 C;  3S3O A;  2LNH B;  2OAU A;  4KH0 B;  2HNI A;  4RG8 A;  2EWN A;  3I56 A;  1MUZ A;  1VQ9 A;  2K57 A;  2CH4 A;  3EG3 A;  2PUO B;  4M7A C;  1EIF A;  1WYX A;  5J3B A;  4V2S A;  2P0Q A;  1SSF A;  2FO0 A;  2YUO A;  4XTV A;  2X4X A;  4J9G A;  4M7A E;  4C92 D;  4NS5 A;  2Y4Y A;  1BYM A;  2OTJ T;  2X51 A;  3QXE B;  4P5N A;  3EFR A;  2L3R A;  2MCN A;  1VIF A;  1KJW A;  2BZX A;  2P4T A;  4C5G A;  4OB2 B;  4D8D A;  1M3A A;  2V1Q A;  3LW5 E;  1PWT A;  4C92 A;  5GAN 2;  5I2M A;  2CKK A;  1VQK A;  3MEV A;  1B07 A;  1PNJ A;  1JEG A;  2E1H A;  4M77 G;  3M53 A;  4FW1 A;  3OQ5 A;  5GAO m;  1K8A R;  1BIB A;  3V7R A;  1VQ6 T;  1QVF P;  1UG1 A;  2JUF A;  2VV5 A;  5AYF A;  3DLM A;  1VQ6 Q;  2FG0 A;  3UWN A;  1BK2 A;  1JBM A;  4LDU A;  2XHC A;  3FEO A;  1FMV A;  1VQO T;  4XTU A;  2DPP B;  3CCV T;  2A37 A;  3JCM J;  4E7S A;  5I22 A;  5A0L A;  4KT0 E;  2AKK A;  3CCV Q;  2EQU A;  2LZ6 B;  4XQ3 A;  2M16 A;  2LX9 A;  2E6N A;  2DD5 A;  1VQ5 T;  4F16 A;  1Q82 C;  5IN1 A;  1VQ5 Q;  1HXD A;  3PT9 A;  3OYB A;  1BIA A;  1WA7 A;  2KRS A;  4RCC A;  1Q86 R;  4PKC C;  2QG9 B;  3HRT A;  2RK1 A;  1ACM B;  5GAM g;  2NLU A;  1KHI A;  2ZGW A;  2JM8 A;  3PMI A;  4JS4 A;  2EQJ A;  2DBM A;  1KIK A;  4BY6 B;  1WXU A;  5C6S A;  1SHF A;  3OYM A;  1TUD A;  2ZPG B;  2GQV A;  3P8B B;  1OV3 A;  1PD0 A;  2CH4 W;  5GAN h;  2O4X A;  1WLP B;  5HY6 A;  3OYY A;  5DM7 R;  2CP6 A;  1YJN Q;  2FPE A;  1M5Q 1;  5EC7 A;  3NPF A;  4PFO A;  4J9B A;  4R0K A;  3S3N A;  5GAM d;  4OMP A;  2K5L A;  2LQK A;  2XI9 A;  4DOW A;  5HKC A;  1BU1 A;  4RTZ A;  4EMK B;  4Z02 A;  4HCK A;  2P0P A;  2DL3 A;  4M77 D;  5GAM f;  5A2Q E;  3CC4 T;  2CZ7 B;  3R6N A;  4KUI A;  1H64 1;  1WHM A;  2LT4 A;  1UE9 A;  4AT1 B;  3HKS A;  5GMK h;  4RTV A;  1NYG A;  1KQS S;  5LJ3 j;  3CMA A;  3E2U A;  4LDV A;  3JSC A;  4M77 A;  2VAS A;  3M0R A;  1JXM A;  2LCC A;  3RBB B;  4ME7 A;  1OI1 A;  1NJI U;  2KXC A;  2QAS A;  5GAN 3;  2XD0 A;  1OUL A;  4HCC A;  2PZ1 A;  2XIC A;  2DXC A;  2GFA A;  2CUD A;  3CD6 T;  2QA4 A;  2OTL T;  3JCM c;  1WQW A;  3CD6 Q;  3HHT B;  2OTL Q;  2MK5 A;  2XMF A;  2RQV A;  4NL3 A;  2BE9 B;  1VQ8 A;  2J05 A;  4KUL A;  2M9U A;  3EFO A;  1M3C A;  2RI3 A;  2EQM A;  1ZUK A;  2SRC A;  3LLR A;  2JOY A;  4L59 A;  2RHI A;  2KY9 A;  1NPP A;  1TS9 A;  4F14 A;  2DNU A;  3JB9 I;  1GCQ A;  2CP3 A;  1SG5 A;  1ARK A;  1QP3 A;  3JCM h;  4M78 F;  1M27 C;  4FYW B;  4JS5 A;  2RF0 A;  2XK0 A;  1JU5 C;  1U5S A;  1IXD A;  4A4H A;  1UJY A;  1WX6 A;  1Q7Y R;  1VQL A;  5I2S A;  1N9S A;  1JJ2 S;  4M75 C;  3QDF A;  1VQP Q;  4J7I A;  4TVR A;  4M78 B;  2MMP A;  3M4Y A;  2ABL A;  2RHU A;  1Q7Y U;  2DYI A;  1CSK A;  3OS2 A;  4XAX B;  2OTJ A;  4L6V 5;  1VYT A;  1ZSG A;  3LH0 A;  3BDL A;  2D1X A;  4PJO F;  3LWI A;  1IGU A;  2L0A A;  1KQS A;  3C12 A;  4FM4 B;  2QDY B;  2W10 A;  3FLG A;  1TH7 A;  1OZ3 A;  2G3R A;  9ATC B;  1SPK A;  5GAN g;  3CCS T;  4HVV A;  5KH6 A;  1VQN Q;  2E12 A;  2MF2 A;  3OA6 A;  1N27 A;  3QII A;  5GJW B;  4Q5W A;  3PNW C;  2DLP A;  4PJO B;  1C6V X;  1OX8 A;  1IRX A;  1XTD A;  4E47 A;  1MMG A;  3UA6 A;  2L3Q A;  3NTK A;  3KUF A;  4CI0 C;  2BTT A;  2V8J A;  1LJO A;  2JZ2 A;  1VQO A;  3CCV A;  5IHK A;  3ZL7 C;  4AMC A;  5GAN d;  1ZUY A;  4J9F A;  4CC4 B;  3VKI A;  5DLQ E;  2ZZD A;  1D0X A;  3VV0 A;  1AWO A;  3CCL T;  3CCM T;  3JCM Q;  2EYZ A;  4M78 G;  1D1C A;  3CCM Q;  3QWX X;  3L2W A;  4LDW A;  1X75 C;  4NL2 A;  4J9D A;  2NWM A;  5GAO q;  4F7U F;  5GAN f;  1YIT Q;  4OMQ A;  5IAY A;  2A3L A;  2LC4 A;  1G3S A;  4N4G A;  3WVE B;  4Y92 A;  2CT3 A;  2LQW A;  3I55 T;  1EZZ B;  3X25 B;  4QVC A;  1R0B G;  1YP5 A;  4UC4 A;  3I55 Q;  4BDY A;  2QEX Q;  4F7U B;  2AHJ B;  1WI7 A;  1N8R C;  4FCY A;  2MI6 A;  2VVK A;  2DTO A;  4PJO G;  1VA7 A;  4ORZ A;  1QW1 A;  2ED1 A;  3OYJ A;  3HRU A;  3CME T;  1UGS B;  2KT1 A;  3CME Q;  1ZQ1 A;  4J6Y A;  3VS6 A;  4PJM A;  3M0P A;  3QSU A;  3TSW A;  1M1K R;  4GBQ A;  1WQ7 A;  1GFD A;  5KE2 A;  3CC4 A;  2X4W A;  3DLL A;  2DTI A;  1RI9 A;  3NTI A;  1Q95 G;  3JCM g;  3H6Z A;  5GMK l;  2M0Y A;  1T0H A;  5GJV B;  1M1K U;  1JB0 E;  2L3P A;  1UGP B;  2L89 A;  1OX9 A;  2K4Y A;  3AHU A;  1D0Z A;  4C5E A;  4E7L A;  3SWN C;  1N9R A;  4WCI A;  4OB1 B;  2RI2 A;  2HCK A;  4C8Q E;  4M78 D;  2CSQ A;  4HXJ A;  2COW A;  1QKW A;  5IXB A;  5GAN 8;  3CD6 A;  4D8K A;  2OTL A;  3I56 T;  3KFV A;  2ROT A;  1VQ9 T;  3JCM d;  3I56 Q;  4F7U G;  1R8O B;  1VQ9 Q;  4ATO A;  3OYC A;  1FWZ A;  3JCM V;  1UEC A;  2LJ0 A;  1OEB A;  3H0H A;  1UJ0 A;  3MP6 A;  4M78 A;  4JZ4 A;  4QQD A;  3C95 A;  2DIL A;  2RJF A;  3A5Z B;  2C0I A;  3EHQ A;  4ZGJ B;  3SFM A;  1NEG A;  3JCM f;  2HBW A;  4KBM B;  2QQ9 A;  1DJ7 B;  1NM7 A;  4PL6 A;  3OS5 A;  3S3M A;  3PE0 A;  3BY7 A;  2JMA A;  5KYN A;  4PJO D;  3OYN A;  1YN8 A;  4WTO B;  2DO3 A;  3HFO A;  2E65 A;  3PFS A;  3J80 E;  1VQK T;  1VQK Q;  2QI2 A;  3HTR A;  4C0F A;  1KQS P;  1ABQ A;  3CCR A;  3NFC A;  5I21 A;  1RUW A;  4PJO A;  3G71 A;  2LCL A;  2MAM A;  1FXX A;  2A08 A;  3NTH A;  3QHS A;  1QLY A;  4OGC A;  2GCX A;  4HA8 A;  1M90 U;  1C1A A;  2E4H A;  4ZGD B;  2D8J A;  1RAH B;  1YWO A;  3JV3 A;  2J6F A;  2XDP A;  2ECZ A;  4Z8A A;  1G83 A;  3I35 A;  2E5Q A;  1BCO A;  4XU2 A;  3A8O B;  1OPL A;  4ZGE B;  1QWF A;  1YBY A;  1YJ9 A;  1UGQ B;  1M9S A;  4KGZ B;  2EGE A;  3QZ5 B;  6AT1 B;  1B3Q A;  5CQX A;  3ME9 A;  2LCS A;  3CCS A;  5LJ5 e;  4IKF A;  3MET A;  1KC8 R;  4RG2 A;  2CSI A;  1I07 A;  3EGD A;  2WSE E;  2FZG B;  4LD9 K;  3TVT A;  4OB3 B;  2LQN A;  4MML A;  2XG8 D;  3JAM E;  5DY9 A;  2MWP A;  3SD4 A;  1KD1 R;  4BD3 A;  4F17 A;  2DJQ A;  1KQ1 A;  4ANJ A;  1OYX A;  3SB2 A;  5GMK j;  2DE0 X;  1QVG S;  1KD1 U;  4HKE A;  3CCM A;  2RNA A;  3CCL A;  1K76 A;  4AFQ C;  3E9F A;  4LN2 A;  5KYY B;  1AVZ C;  2EBP A;  4A4G A;  1SEM A;  1ZA2 B;  2ZPB B;  4O5V A;  4ZN3 A;  1QWE A;  2QGF B;  4DEX A;  2KYB A;  4XK8 E;  3V8L A;  2RB6 A;  4IUR A;  2F5K A;  4RTT A;  3TEE A;  2EQK A;  1H3H A;  1QKX A;  3QKJ A;  2K5I A;  5AT1 B;  4K11 A;  3EH1 A;  4LNP A;  1OPK A;  4LDX A;  1Q81 C;  2JT4 A;  4KGX B;  2O4X B;  2K7A A;  3J81 E;  2EGC A;  2A36 A;  2CRE A;  1I1J A;  4EPC A;  4M7D F;  2DIG A;  3OW2 S;  4EDU A;  1PKS A;  2E6Z A;  3EH2 A;  2HKQ B;  3M0T A;  2LVM A;  1RLQ C;  1IHW A;  1VQ8 T;  2WSC E;  2F1L A;  2DD4 A;  2X3X D;  1VQ8 Q;  3CXC A;  3M54 A;  1ZBJ A;  1NPR A;  2JS0 A;  1UGR B;  1NE8 A;  4E7I A;  3CBO A;  2DRM A;  3JB9 J;  1WXB A;  4DEY A;  2JW4 A;  1V76 A;  4M7D B;  3M55 A;  1TUG B;  3VS0 A;  3QZ9 B;  1TTH B;  3M56 A;  3RKY A;  4LUE A;  2H3J A;  5HCK A;  1UEB A;  2EYY A;  1HK9 A;  3INZ A;  3GLX A;  2VXF A;  3L2V A;  1MMA A;  2HSE B;  2OI3 A;  3TQ7 P;  1QP2 A;  3H0I A;  1M2O A;  1UGV A;  3OYL A;  1S72 T;  3CCU A;  2QTX A;  2K6D A;  1TXQ A;  3JCM W;  3RDV A;  1VQL T;  2E41 A;  1S72 Q;  1VQL Q;  1GBQ A;  3EFO B;  2A7Y A;  3CCQ A;  1RAE B;  1Z9Q A;  3L1A A;  3LWH A;  3T9N A;  4BY6 C;  1NLP C;  2K9G A;  2L5Q A;  3PVL A;  3WXM B;  2GTJ A;  5CCA A;  2OTJ Q;  3G4S T;  2X4J A;  4M7D G;  3D7S B;  1RLP C;  1W4S A;  2M1H A;  1P92 A;  1G3Y A;  1OU8 A;  3MPU B;  4C8Q A;  3CC2 T;  2E3H A;  3REB B;  4RTY A;  4N0A C;  2HQX A;  3M59 A;  3X26 B;  4FYV B;  3CC2 Q;  1WZO A;  1SKU B;  2FRW A;  3EAE A;  2QQB A;  3M5A A;  4EMK C;  3VS1 A;  2I2L A;  1IO6 A;  3NHN A;  1ABO A;  3FC3 A;  3OW2 A;  3WVD B;  1R0C B;  4C0D B;  2KAF A;  5M9O A;  3EGX B;  1K8A U;  1GXI E;  1MGQ A;  1VQO Q;  2K2M A;  4ZTF A;  1W2B S;  1TSF A;  5LJ5 h;  2F2V A;  4J8O A;  4MZM A;  4RTX A;  2DL7 A;  3PVQ A;  5KYY A;  4HCZ A;  2RPN A;  1WHG A;  4PJL A;  1YI2 A;  3JCM P;  3H9N A;  1YFN A;  1Q86 U;  4AFZ C;  1ZSZ B;  2QDL A;  3MCA B;  2F5T X;  3X20 B;  4JRQ A;  4DBQ A;  4M7A F;  3DKM A;  2CYZ B;  1C0M A;  1K9M R;  3GBQ A;  3H8Z A;  4A4E A;  4ZNX A;  1K9M U;  1I5O B;  3FIF A;  2Y4X A;  3UPU A;  4L5G A;  4M7A B;  2E10 A;  4M7D D;  2JTE A;  2L2P A;  1ZUU A;  2DYB A;  1WGS A;  4BAC A;  1QVP A;  2RO0 A;  2ZPI B;  5FU6 B;  3EG2 A;  3X28 B;  3CXC P;  2DXT A;  3SHW A;  4M7D A;  2JM9 A;  4JRI A;  2G6F X;  3CC4 Q;  1PSF A;  2PVD B;  2PU9 B;  1SRM A;  2PVG B;  2FB7 A;  2QQR A;  2Z0W A;  5KYW A;  2VYT A;  3L2Z A;  1D1A A;  1JQQ A;  1U8R A;  4M78 C;  1TUC A;  5FWC A;  4FYY B;  1OQK A;  1M8V A;  1O75 A;  4DBR A;  1IZ6 A;  1XOV A;  3R6O A;  4B9W A;  1X2Q A;  4JDS A;  5L23 A;  2KYM A;  2LJ3 A;  2HAX A;  1E6H A;  4KUD K;  4MDW A;  3M0U A;  4M7A G;  1W2B A;  3VRZ A;  4D6W A;  1WPY A;  2PNI A;  4QQG A;  1M30 A;  4C5I A;  2MIO A;  2JVV A;  4DBH A;  2NUP B;  4PJO C;  4Y91 A;  3VJP A;  2KSS A;  5CKD A;  1BB9 A;  3GOX A;  1X01 A;  2DK3 A;  2RHZ A;  4MDX A;  2FYK A;  2C0O A;  3OYA A;  5LJ3 e;  3EFS A;  4QW2 A;  2ED0 A;  2I0N A;  2CGH A;  1JO8 A;  3CCR T;  2GFU A;  3CCR Q;  2O88 A;  3G71 T;  3JCM b;  1S72 A;  3G71 Q;  1NJI C;  5FU7 B;  3JB9 F;  1PSE A;  4JJN K;  4IIM A;  5LJ5 g;  3EGX A;  1EFN A;  3C4S A;  2FPD A;  1X43 A;  3E1S A;  1SRL A;  2K3X A;  2RJD A;  4M75 E;  1N5Z A;  2EGA A;  2ESW A;  1RAF B;  4CC3 A;  2YUN A;  3QUI A;  1KQ2 A;  1OZ2 A;  2W0Z A;  1GL5 A;  1YJ9 T;  3A1P A;  3A8L B;  1U1T A;  3G4S A;  4FT4 A;  4NOY A;  1YJ9 Q;  2YWW A;  5GAO n;  2GQI A;  2L8D A;  1YWP A;  2E5K A;  4OF1 A;  1I81 A;  5LJ5 d;  2KT8 A;  2DTH A;  1ZSZ A;  4KRT A;  3VYH B;  2YXY A;  3CCS Q;  1VQM A;  2GBQ A;  3CC2 A;  2EKH A;  2VKN A;  2J6K A;  3CPW S;  3X24 B;  1Y7X A;  4M7A D;  3E19 A;  4X1V A;  3QBY A;  4IUQ A;  1K0X A;  1VUB A;  2YLB A;  5LJ5 f;  1AZG B;  2HMA A;  3H0F A;  1WJQ A;  4XU1 A;  2H8H A;  1UHC A;  5CKF A;  2BUD A;  5GAO l;  4M7A A;  1I4K 1;  1AWX A;  2BE7 D;  3VRY A;  3M4G A;  3VUZ A;  1PG5 B;  3OYF A;  4QQ6 A;  2KRM A;  3SEM A;  2FHD A;  3CCL Q;  5D6W A;  5L8R E;  5GAM j;  2LT1 A;  1Q7Y C;  2NYS A;  2FZK B;  2RJE A;  1WIE A;  2JN0 A;  3OYK A;  3JB9 G;  3M57 A;  2H3E B;  2O9S A;  1LNX A;  2DVJ A;  2RN8 A;  1UTI A;  5GAN 5;  1YHQ T;  2COY A;  3JRZ A;  3LGF A;  4AFU C;  2QAZ A;  3MP1 A;  4FT2 A;  3EGD B;  4Y28 E;  1R77 A;  7AT1 B;  1XJW B;  2C06 A;  3HPW A;  3CCJ T;  1JJ2 A;  3V8K A;  1NEB A;  5CAI A;  3KXT A;  1BI3 A;  2EYQ A;  2A0F B;  2JTM A;  2RQW A;  3TSZ A;  4X9D A;  2CT4 A;  5GMK i;  1T0J A;  1M2V A;  2VC8 A;  2CP7 A;  4J6X A;  4E7K A;  3VS4 A;  2NUP A;  3EG0 A;  2HL5 C;  5GAM e;  3ULR B;  3CCE T;  3ASK A;  3CCE Q;  1MMN A;  5CR2 A;  3MO8 A;  1G5V A;  2JTF A;  2IG0 A;  1A0N B;  1RAB B;  4JLG A;  2GGR A;  4XTX A;  3RER A;  1X27 A;  2V1R A;  3OYG A;  2NUT A;  3CCU T;  1K73 R;  1JXO A;  4BE2 A;  3CCU Q;  4IUT A;  2MOX A;  4BI8 B;  3FB9 A;  4EIK A;  4MZT A;  1QVF S;  1D1B A;  1NLO C;  3F70 A;  2OX7 A;  3CCQ T;  4JRP A;  3JB9 D;  4C92 C;  1X6B A;  3CCQ Q;  1K73 U;  2DZ9 A;  4C92 E;  1H92 A;  2F2W A;  2IPO B;  3A8G B;  2CP2 A;  2DL5 A;  2AK5 A;  1K9A A;  1GCP A;  3A98 A;  4QVD A;  4BE1 A;  1VQ7 A;  1ZX6 A;  2EKO A;  4OB0 B;  3ZBD A;  4FSS A;  1IRE B;  3CC7 A;  5A0D A;  5J39 A;  1RAC B;  4PLL A;  3PIP A;  2XID A;  4ZN1 A;  2KBT A;  2KRN A;  1M1K C;  4VUB A;  4YTL A;  2AKL A;  3V8J A;  2J06 A;  4JLI A;  5DLO A;  5CO7 A;  2M51 A;  2K3Y A;  3BDU A;  4LUD A;  1GRI A;  1YJW A;  4X34 A;  4C8Q F;  1E7O A;  1AWW A;  2QXF A;  3UA7 A;  3QYG B;  2P0K A;  2LJ1 A;  3I9Q A;  2DAQ A;  2DXB A;  2FPF A;  5GAN j;  1YI2 T;  4HVW A;  1YI2 Q;  4MZP A;  2BKD N;  1AZE A;  3PMT A;  1RI0 A;  4C8Q B;  1D3B B;  2KGT A;  3I5R A;  1LCK A;  1M1F A;  5I11 A;  2RHX A;  3BE3 A;  2YRV A;  1KC8 U;  3MJX A;  4M7D C;  4C5H A;  1FMK A;  3M58 A;  1QVF A;  1V1C A;  2XDD A;  1IGQ A;  3V7C A;  2DX1 A;  2YDL A;  1MMD A;  2YHT A;  2NUZ A;  1MNE A;  4M77 C;  4DA4 A;  2XDB A;  3OS1 A;  1M90 C;  3M9Q A;  4E7Z A;  4M77 E;  2KNB B;  5ECA A;  1JJ2 P;  3CQT A;  2K3B A;  2LMJ A;  5GAN 4;  2D0N A;  2K79 A;  3OMG A;  3NGP A;  1CKA A;  1VIE A;  2D0Q B;  2RK2 A;  2DZC A;  1YHQ A;  4C8Q G;  4FU6 A;  4A4K A;  2QTV A;  4PNO A;  4RTW A;  3S6W A;  3JB9 H;  2LRQ A;  2FVU A;  4OMM A;  4EMG A;  3CCJ A;  4ESR A;  1HD3 A;  4N4H A;  3GF5 A;  1I8F A;  4A63 B;  2C0T A;  3MEW A;  5LJ3 g;  4II1 A;  1RAA B;  4RCB A;  2JNG A;  1GCQ C;  3REA B;  3LYI A;  4DQ2 A;  1T3L A;  4R55 A;  2BZY A;  1HSQ A;  5GMK e;  1G2B A;  1AOJ A;  2EJF A;  2KE9 A;  1PD1 A;  2JS2 A;  3H41 A;  5D6Y A;  1KD1 C;  2PUK B;  4AG2 C;  4JRK A;  2K2V A;  5CQY A;  4LXC A;  4C0D C;  2HQE A;  3CCE A;  2KVQ G;  1ZLM A;  4FSX A;  3ZEH A;  2F2X A;  5KYW B;  1K0S A;  2HQH A;  1G3T A;  3VS3 A;  4MMK A;  1HJD A;  1B34 B;  4LE9 A;  3UT1 A;  2JMC A;  3MEU A;  2VGN A;  1RAD B;  3RMQ A;  5LJ3 f;  1V29 B;  4ELY C;  2EQI A;  2QYZ A;  1T3S A;  4E6R A;  3L2R A;  1UDL A;  2KRO A;  1I0C A;  4OVA A;  1O9S A;  5HK3 A;  3VS7 A;  2KI7 A;  1QVG A;  1Q82 R;  4OGE A;  4DOV A;  4C8Q D;  3Q1J A;  1TWB A;  1WFW A;  3G4S Q;  1Q82 U;  3U23 A;  3JCM e;  3C0C A;  4F04 B;  2BIV A;  1M8M A;  3VUB A;  2D8H A;  4BB7 A;  1VQM T;  2QGG A;  3SWN A;  1VQM Q;  1SSH A;  4FIB A;  1D3B A;  3E9G A;  2KQW A;  2YUP A;  3PTA A;  5CKH A;  2L3S A;  1J3T A;  3FDR A;  5FU6 C;  2DVE A;  2HBP A;  2LTO A;  2LQ8 A;  2F69 A;  2RD1 A;  2YLC A;  1PRL C;  2RM4 A;  4FW2 A;  3GPL A;  4JJB A;  5D7U A;  3L2U A;  3OYE A;  3HP9 A; 
#chains in the Genus database with same CATH homology
 2DTI A;  3NTI A;  3CCR T;  3JCM g;  2GFU A;  3H6Z A;  3P8H A;  5GMK l;  3VU3 C;  2LDM A;  5GAN e;  3G71 T;  1N6A A;  3JCM b;  1M1K U;  1S72 A;  1JB0 E;  5GAN 7;  5GAO p;  1NJI C;  5FU7 B;  3JB9 F;  1PSE A;  3QJY A;  4JJN K;  1UGP B;  2L89 A;  5LJ5 g;  2K4Y A;  2M0O A;  2MWO A;  3AHU A;  1X6O A;  4BDZ A;  3C4S A;  4BE0 A;  2RJC A;  4C5E A;  4E7L A;  3E1S A;  2V8K A;  3QYH B;  3QO3 A;  2K3X A;  2RJD A;  4M75 E;  3SWN C;  1YIT A;  1N9R A;  2R5M A;  4OB1 B;  5GAN 6;  2RI2 A;  5KCO A;  5FRN A;  4HT9 A;  4C8Q E;  3PIO A;  4M78 D;  3SDZ A;  4LD6 A;  4E7H A;  3GP8 A;  3BFM A;  3DLL A;  5GAN 8;  1U1S A;  2XU8 A;  3CD6 A;  3CMA T;  2OTL A;  3QUI A;  1YCY A;  4XTW A;  3I56 T;  1VQ9 T;  3JCM d;  3OS0 A;  3LX7 A;  1OZ2 A;  1KC8 C;  4F7U G;  1KQ2 A;  2ZPH B;  2DKG A;  1R8O B;  3A8L B;  4J5Y A;  4C92 G;  1YJ9 T;  5GAM h;  4CRI A;  1U1T A;  3I55 A;  5CK9 A;  3G4S A;  4FT4 A;  2CS7 A;  4NOY A;  1FWZ A;  2ZPF B;  3JCM V;  3URG A;  5GAO n;  3OYC A;  2QEX A;  2KDS A;  1VQ4 T;  2L8D A;  3MP6 A;  4M78 A;  3GNF B;  4QQD A;  2KK4 A;  3C95 A;  1I81 A;  2R57 A;  4OF1 A;  5LJ5 d;  2DTH A;  2RJF A;  2O01 E;  2E70 A;  4A4F A;  2EAY A;  3VYH B;  2QA4 T;  3ER0 A;  1VQM A;  3A5Z B;  3GIB A;  4J83 A;  4ZGJ B;  3SFM A;  5D6X A;  2KMT A;  3CC2 A;  3V7S A;  3JCM f;  4GLK A;  3HSB A;  4KBM B;  3CPW S;  3X24 B;  1Y7X A;  4M7A D;  2QQ9 A;  1RL2 A;  1DJ7 B;  3E19 A;  4PL6 A;  3QBY A;  3OY9 A;  4IUQ A;  3MP8 A;  3OS5 A;  4XTY A;  3CME A;  5FLX E;  1VUB A;  2VXE A;  3OBW A;  3S3M A;  2YLB A;  3BY7 A;  4M77 F;  5LJ5 f;  1K8A C;  3G6E A;  1YJN T;  1WJQ A;  5LJ3 d;  4XU1 A;  4PJO D;  3OYN A;  4FL6 A;  5CKF A;  2DO3 A;  3HFO A;  2BUD A;  2E65 A;  3PFS A;  2CZ0 B;  3G7Z A;  3J80 E;  5GAO l;  1VQK T;  3JCM X;  4M7A A;  5CKB A;  1I4K 1;  1UB4 A;  5CKE A;  2QI2 A;  1BKB A;  3TRE A;  4C0G A;  1YIJ T;  4C0F A;  3CCR A;  1XQH A;  3NFC A;  1WJR A;  3M4G A;  4J6W A;  5FU7 C;  5I21 A;  5HK0 A;  3VUZ A;  5GAO r;  4PJO A;  3G71 A;  2VUB A;  2LCL A;  3OYF A;  2MAM A;  1FXX A;  1NZ9 A;  2FHD A;  3NTH A;  3QHS A;  4IUU A;  4M77 B;  4QQ6 A;  5GMK m;  5D6W A;  5L8R E;  5GAM j;  4OGC A;  2GCX A;  1Q86 C;  1Y71 A;  2LT1 A;  1Q7Y C;  4HA8 A;  1M90 U;  4XU0 A;  1Y96 B;  2CZ1 B;  4M78 E;  5EG2 A;  4ZGD B;  2RJE A;  3S3O A;  3HFN A;  2OAU A;  1B34 A;  2JN0 A;  2HNI A;  3OYK A;  3L2Q A;  3JB9 G;  3M57 A;  4RG8 A;  1LNX A;  2EWN A;  2XDP A;  1JRI A;  5GAN 5;  1YHQ T;  2E5Q A;  3JRZ A;  3LGF A;  3I56 A;  1K9M C;  4XU2 A;  1VQ9 A;  3A8O B;  4ZGE B;  1NJI U;  1YBY A;  3MP1 A;  4FT2 A;  1YJ9 A;  2K57 A;  1UGQ B;  2XD0 A;  1M9S A;  4Y28 E;  3QZ5 B;  2EFI A;  2C06 A;  2PUO B;  4IUP A;  3KBG A;  3HPW A;  1EIF A;  5CQX A;  4M7A C;  3ME9 A;  5J3B A;  4V2S A;  3CCJ T;  2D9T A;  2P0Q A;  1SSF A;  4XTV A;  4XTZ A;  3CCS A;  2X4X A;  4M7A E;  5LJ5 e;  4C92 D;  4NS5 A;  2Y4Y A;  4IKF A;  1BYM A;  2OTJ T;  3CBP A;  1VQ7 T;  3MET A;  1JJ2 A;  3V8K A;  3QXE B;  4RG2 A;  4P5N A;  5CAI A;  3KXT A;  1BI3 A;  3EFR A;  2L3R A;  2EYQ A;  3CC7 T;  2JTM A;  3A8H B;  1VIF A;  4PJO E;  2WSE E;  2P4T A;  4C5G A;  4LD9 K;  2GF7 A;  2QQS A;  4OB2 B;  4OB3 B;  4X9D A;  3LW5 E;  4XU3 A;  4C92 A;  5GAN 2;  3ZFJ A;  5GMK i;  2Y90 A;  3QPH A;  2VC8 A;  4MML A;  5I2M A;  2XG8 D;  3JAM E;  4J6X A;  4E7K A;  1M1G A;  5CVI A;  2CKK A;  5DY9 A;  2MWP A;  2X35 A;  3SD4 A;  1VQK A;  3MEV A;  4BD3 A;  2E1H A;  4M77 G;  3M53 A;  3OQ5 A;  5GAO m;  2RI5 A;  3L42 A;  5GAM e;  4HT8 A;  1KQ1 A;  1OYX A;  2QQA A;  3SB2 A;  1YIJ A;  3CCE T;  1BIB A;  3HL8 A;  3ASK A;  3MEA A;  3V7R A;  5GMK j;  1QVG S;  2JUF A;  1VQ6 T;  3QG1 A;  1KD1 U;  4HKE A;  2VV5 A;  5AYF A;  3DLM A;  5CR2 A;  3CCM A;  3CCL A;  2RHY A;  3UWN A;  1JBM A;  1YJW T;  3E9F A;  4LDU A;  3MO8 A;  2XHC A;  1FX7 A;  3FEO A;  1G5V A;  2JTF A;  4PLI A;  1VQO T;  2IG0 A;  4XTU A;  1LOJ A;  2DPP B;  4A4G A;  3CCV T;  5IT9 E;  3JCM J;  5FRM A;  4JLG A;  4WF2 A;  4O6J A;  4KT0 E;  4XTX A;  5A0L A;  2EQU A;  3RER A;  2RA2 A;  2ZPB B;  4O5V A;  4ZN3 A;  1AHJ B;  4XQ3 A;  2V8I A;  1BI1 A;  2M16 A;  3OYG A;  2LX9 A;  3CBM A;  3CCU T;  1BI2 A;  2E6N A;  2DD5 A;  4XK8 E;  2RB6 A;  3OSS C;  2F5K A;  4IUR A;  3V8L A;  3TEE A;  5IN1 A;  2EQK A;  4B9X A;  4BE2 A;  1Q82 C;  3OMC A;  2EIF A;  1HXD A;  3PT9 A;  4IUT A;  4BI8 B;  3FB9 A;  3OYB A;  1BIA A;  4RCC A;  4MZT A;  2DXU A;  4PKC C;  1QVF S;  3QKJ A;  4OP0 A;  3HRT A;  2K5I A;  2RK1 A;  3BW1 A;  3CEY A;  3F70 A;  3CCQ T;  4JRP A;  4LDX A;  3JB9 D;  4C92 C;  1VQP T;  1Q81 C;  1WNL A;  2O4X B;  1K73 U;  5GAM g;  2DZ9 A;  2NLU A;  4F7U E;  4C92 E;  1KHI A;  2ZGW A;  3N5B B;  3J81 E;  3JB9 H;  3PMI A;  4ELZ C;  2EJ9 A;  4EPC A;  3A8G B;  4M7D F;  4JS4 A;  2DIG A;  2EQJ A;  2R58 A;  4EDU A;  3OW2 S;  2E6Z A;  4A53 A;  2LVM A;  4BY6 B;  1VQ5 T;  4GY5 A;  4QVD A;  1VQ8 T;  2HD0 A;  2WSC E;  5C6S A;  2IVW A;  4BE1 A;  1VQ7 A;  2DD4 A;  1KHC A;  3O8V A;  2XKO C;  3OYM A;  2EKO A;  4OB0 B;  3ZBD A;  3CXC A;  1IRE B;  2GQV A;  2ZPG B;  3M54 A;  3P8B B;  2D6F A;  3CC7 A;  1NPR A;  5A0D A;  5FRO A;  5J39 A;  2O4X A;  5GAN h;  5HY6 A;  3OYY A;  5DM7 R;  1UGR B;  1NE8 A;  3OB9 A;  4E7I A;  3CBO A;  4PLL A;  3PIP A;  1M5Q 1;  2XID A;  3JB9 J;  3HRS A;  1VQN T;  1ZHI A;  4ZN1 A;  3S3N A;  4M7D B;  5GAM d;  3M55 A;  1M1K C;  4VUB A;  4HCB A;  2K5L A;  4OMF B;  3QZ9 B;  4YTL A;  3M56 A;  2LQK A;  4BUG A;  3RKY A;  1N8R U;  2K5F A;  3V8J A;  4QVZ A;  3TU4 K;  2H3J A;  2XI9 A;  3OSV A;  4JLI A;  4DOW A;  5HKC A;  5DLO A;  1UEB A;  5CO7 A;  4EMK B;  4Z02 A;  4EMH A;  1VQ6 A;  2K3Y A;  4C0Z A;  1HK9 A;  3BDU A;  3INZ A;  2P0P A;  3GLX A;  2VXF A;  4M77 D;  5GAM f;  4RKU E;  3L2V A;  1YJW A;  5A2Q E;  3CC4 T;  4M75 F;  2CZ7 B;  3DB4 A;  1QP2 A;  4KUI A;  4X34 A;  1H64 1;  5C0M A;  4C8Q F;  1BI0 A;  2LT4 A;  4N0A A;  3HKS A;  3OYL A;  4N4I A;  5GMK h;  2QXF A;  3OYH A;  1S72 T;  1KQS S;  5LJ3 j;  2QTX A;  3CCU A;  4EMK A;  3CMA A;  4LDV A;  3JCM W;  3FJP A;  1VQ5 A;  1VQL T;  2E41 A;  3JSC A;  2P0K A;  3QYG B;  4M77 A;  2DAQ A;  2DXB A;  5CIU A;  2LCC A;  4ME7 A;  1MHN A;  5KE3 A;  1Y96 A;  2A7Y A;  3RIR A;  1OI1 A;  5GAN j;  3CCQ A;  1YI2 T;  5GAN 3;  3L1A A;  3LWH A;  1VQ4 A;  1YIT T;  3T9N A;  3FRN A;  4HCC A;  2XIC A;  3QDR B;  4M75 B;  4MZP A;  2BKD N;  2DXC A;  2GFA A;  2R5A A;  3OYI A;  3PMT A;  4BY6 C;  1RI0 A;  4C8Q B;  3CD6 T;  2L5Q A;  3WXM B;  3VYG A;  2QA4 A;  3JCM c;  2OTL T;  5CCA A;  1WQW A;  1D3B B;  3HHT B;  4NL3 A;  2EJG A;  1VQ8 A;  4KUL A;  3G4S T;  2X4J A;  2QEX T;  1M1F A;  2B8A A;  2DIQ A;  2M9U A;  2RHX A;  4A54 A;  4M7D G;  2YRV A;  4LDY A;  2RI3 A;  1W4S A;  1KC8 U;  2M1H A;  1YJN A;  1P92 A;  1G3Y A;  4M7D C;  3RUX A;  2EQM A;  3HP9 A;  4C5H A;  3M58 A;  4C8Q A;  3CC2 T;  1QVF A;  4R56 A;  4N0A C;  2HQX A;  3M59 A;  3X26 B;  3LLR A;  3V7C A;  2XDD A;  2YHT A;  3EAE A;  2QQB A;  3M5A A;  2JOY A;  4EMK C;  4L59 A;  4M77 C;  4DA4 A;  2RHI A;  2XDB A;  2KY9 A;  2I2L A;  1NPP A;  3OS1 A;  1M90 C;  4BI3 A;  3M9Q A;  3FC3 A;  3OW2 A;  4M77 E;  3WVD B;  4C0D B;  2KAF A;  3CPW A;  3DB3 A;  3JB9 I;  5M9O A;  1QP3 A;  5GAN 4;  3JCM h;  1K8A U;  4M78 F;  3A8M B;  5KCH A;  1GXI E;  1MGQ A;  3OMG A;  4ZTF A;  4JS5 A;  1VIE A;  1Y07 A;  4JUV A;  2XK0 A;  2PVO B;  1W2B S;  4ZTJ A;  2D0Q B;  2RK2 A;  5LJ5 h;  4A4H A;  2DZC A;  1XNI A;  1YHQ A;  3C94 A;  4J8O A;  4MZM A;  4M75 G;  1VQL A;  2X4Y A;  5I2S A;  4C8Q G;  1N9S A;  4HCZ A;  3GNG A;  1JJ2 S;  4FU6 A;  4M75 C;  4A4K A;  4PNO A;  4J7I A;  4C8Q C;  4TVR A;  4M78 B;  3JCM P;  3S6W A;  1YI2 A;  1Q86 U;  2MMP A;  3M4Y A;  4JRQ A;  2LRQ A;  2RHU A;  2F5T X;  2FVU A;  3MCA B;  3P8D A;  3X20 B;  4EMG A;  3CCJ A;  1Q7Y U;  4M7A F;  4X9C A;  3DKM A;  3OS2 A;  2CYZ B;  2WAC A;  5LJ3 h;  4XAX B;  4N4H A;  3GF5 A;  4L6V 5;  2OTJ A;  1I8F A;  2DEQ A;  3H8Z A;  3MEW A;  3LH0 A;  3QJ6 A;  5LJ3 g;  3BDL A;  4PJO F;  4A4E A;  1ZBX A;  4II1 A;  3LWI A;  4RCB A;  2JNG A;  1K9M U;  1KQS A;  3FIF A;  3C12 A;  3MHX A;  3LYI A;  2Y4X A;  4FM4 B;  2QDY B;  4DQ2 A;  3FLG A;  3CCS T;  1TH7 A;  1OZ3 A;  2G3R A;  5GAN g;  3UPU A;  4L5G A;  5KH6 A;  4R55 A;  5GMK e;  2E12 A;  2MF2 A;  4M7A B;  2E10 A;  2EJF A;  1H3Z A;  1G3W A;  3UDC A;  3OA6 A;  4M7D D;  1N27 A;  3QII A;  5D6Y A;  1KD1 C;  4Q5W A;  2PUK B;  3PNW C;  4JRK A;  2K2V A;  5CQY A;  4C0D C;  2HQE A;  3CCE A;  5LJ5 j;  1WGS A;  2KVQ G;  4PJO B;  4FSX A;  3ZEH A;  4BAC A;  1M4Z A;  1QVP A;  1XTD A;  4E47 A;  1WJS A;  2RO0 A;  2ZPI B;  5FU6 B;  3NTK A;  5J26 A;  3KUF A;  4CI0 C;  3J7A F;  3X28 B;  2DXT A;  2V8J A;  1G3T A;  1LJO A;  4JRI A;  4M7D A;  2JZ2 A;  1VQO A;  2PQW A;  3CCV A;  4E7J A;  1PSF A;  4MMK A;  2PVD B;  5GAN d;  1B34 B;  2PU9 B;  3UT1 A;  3MEU A;  3CPF A;  2VGN A;  3OYD A;  3VKI A;  5DLQ E;  4IUV A;  2ZZD A;  3VV0 A;  2E64 A;  3CCL T;  3RMQ A;  3CCM T;  2PVG B;  1V29 B;  5LJ3 f;  4ELY C;  4M78 G;  2FB7 A;  2QQR A;  3JCM Q;  1K73 C;  2CZ6 B;  2RH2 A;  1I5L A;  2VYT A;  3L2Z A;  3L2R A;  3L2W A;  1U8R A;  5LL6 S;  2VGM A;  1KG1 A;  4M78 C;  4LDW A;  1X75 C;  4NL2 A;  4OVA A;  5GAO q;  1O9S A;  5HK3 A;  1VQP A;  4F7U F;  5GAN f;  1M8V A;  4C92 F;  1QVG A;  1O75 A;  5IAY A;  3CXC S;  1IZ6 A;  2A3L A;  1XOV A;  2LC4 A;  4OGE A;  3SWN B;  4M75 D;  1G3S A;  3R6O A;  4N4G A;  3WVE B;  4B9W A;  4DOV A;  4C8Q D;  4JDS A;  2HAX A;  3Q1J A;  3I55 T;  3X25 B;  3PGG A;  4QVC A;  4UC4 A;  4KUD K;  4MDW A;  4BDY A;  1Q82 U;  3JCM e;  4M7A G;  1W2B A;  2BIV A;  4M75 A;  4D6W A;  3VUB A;  4F7U B;  4RMO A;  4BB7 A;  4C92 B;  1VQM T;  5A0G A;  4ATO A;  1WPY A;  2AHJ B;  2ZPE B;  3SWN A;  4QQG A;  3RES A;  1Q81 U;  1N8R C;  1VQN A;  4M7D E;  4C5I A;  4FIB A;  2MI6 A;  2DJZ A;  4J7F A;  1D3B A;  2DTO A;  4PJO G;  2JVV A;  3E9G A;  2KQW A;  3PTA A;  3LGL A;  1QW1 A;  5CKH A;  3OYJ A;  4PJO C;  3HRU A;  4Y91 A;  3VJP A;  3CME T;  2KSS A;  1UGS B;  3OBY A;  3RKX A;  5CKD A;  3G6E T;  1ZQ1 A;  3GOX A;  1X01 A;  4J6Y A;  3FDR A;  2DK3 A;  2RHZ A;  3RKW A;  5FU6 C;  4MDX A;  2DVE A;  2HBP A;  2LTO A;  2FYK A;  2ZCF B;  2LNV A;  2LQ8 A;  4F7U A;  2FL7 A;  3TCJ A;  3QSU A;  2F69 A;  3OYA A;  2WSF E;  3RMS A;  2RD1 A;  2YLC A;  3GPL A;  2RM4 A;  1WQ7 A;  5LJ3 e;  3EFS A;  4QW2 A;  4BI4 A;  5KE2 A;  3L2U A;  3OYE A;  3CC4 A;  2X4W A;  2CGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...