4M75B

Crystal structure of lsm1-7 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
91
structure length
91
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 13
structure length 91
sequence length 91
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75B00
1WQ7A 2RB6A 2DZCA 3QUIA 3SWNB 3V7RA 3VU3C 5GAMf 2DJZA 4M7AG 3SWNA 4C8QG 1U1TA 4A54A 2YLCA 5LJ5f 4M77F 4EMGA 3JB9D 3JCMc 4HT8A 5GAMh 2QTXA 2VXFA 3JCMb 4M77A 3RERA 5LJ3d 4C92G 2DXUA 4XU2A 4PNOA 3SB2A 4PJOD 1I4K1 5DY9A 4XU1A 3QHSA 4JRKA 4M7DB 3EFRA 3L1AA 3JCMe 4M7DA 4M78G 2FB7A 2DZ9A 4M7AE 4F7UF 4Y91A 4M75B 3BFMA 2VXEA 4PJOF 4C8QE 4RCCA 2YHTA 3V7CA 4F7UA 3JB9J 4PJOA 4M75A 5GAOm 2ZGWA 5GAOr 4JRIA 2DEQA 3JB9H 3JCMX 3JB9F 4C92E 5GAN6 1U1SA 5GANh 1D3BB 3HSBA 3JCMf 1X01A 1I5LA 4JLIA 2JN0A 5LJ3f 1D3BA 3RKYA 4M77B 1I8FA 4EMKC 3JCMJ 2E64A 2K57A 3EFSA 4J6XA 4M7DG 3FIFA 4M78E 5LJ3h 4J6WA 4M7AC 4C8QC 5GANj 3JCMd 1JBMA 3JCMV 4X9CA 5LJ5h 4N0AC 2HNIA 4NOYA 2E1HA 4M7AD 4M75G 4XTVA 4C8QD 5GMKi 5GAN8 3GIBA 2RM4A 5CAIA 4C92C 1HK9A 2RD1A 4HA8A 5GAMj 5GAN7 4WF2A 5LJ5j 1WPYA 3M4GA 5GAN2 4F7UB 4XQ3A 5GAOp 4C92D 3JB9G 4PJOB 1M8VA 3FJPA 3QSUA 1KQ2A 4M78C 4M7DE 3PGGA 3BDUA 5GMKh 3V7SA 3SWNC 4M77G 4NL2A 2EJ9A 3V8LA 4M78D 3V8KA 3JCMW 5GMKl 4M75E 3JCMP 4EMKB 1N9RA 1B34B 2E10A 3L2ZA 4MMLA 5GMKj 3BW1A 5GANe 4M7AF 4V2SA 3JCMh 4EMKA 1B34A 4C8QF 1WNLA 2FYKA 4M7AA 4C8QA 4M7DC 3FB9A 3QO3A 4F7UG 1TH7A 1N9SA 1BIBA 4N0AA 4PJOG 5GAMe 3JCMQ 2Y90A 3BY7A 4M77E 4XU3A 4C92F 4MMKA 4DQ2A 5GAN4 4M7DD 4EMHA 5LJ3j 3JB9I 4C92A 4M75C 2I2LA 4J5YA 5I21A 1LOJA 5LJ3g 5GAMg 2RA2A 4XTZA 1YCYA 5GAN5 1LJOA 3RKWA 4M75D 4M78F 5LJ5g 1Y96B 2DXTA 4M78A 3RUXA 2DTIA 5GANd 3RESA 1Y96A 2EWNA 1H641 4F7UE 4OP0A 5GMKe 4M77C 5GMKm 4PJOE 1BIAA 2EAYA 2YLBA 5GAMd 5GANg 4M7AB 2EJFA 4M77D 3RIRA 4C8QB 5LJ5d 3V8JA 4M7DF 2VC8A 4X9DA 4RCBA 1LNXA 4JUVA 3RKXA 1HXDA 1I81A 2EJGA 4J6YA 5LJ3e 5GAN3 5GAOn 4A53A 4C92B 1M5Q1 2E65A 4QVCA 5GAOq 4XTUA 4XTYA 2DTHA 4M75F 1JRIA 1MGQA 3HFNA 2DKGA 4XTXA 2CGHA 5LJ5e 2DTOA 3AHUA 4PJOC 5GANf 1WQWA 3JCMg 5GAOl 2E41A 4XTWA 2DVEA 3INZA 1KQ1A 4M78B 4QVDA 3HFOA 4XU0A 4NL3A 4HT9A
chains in the Genus database with same CATH superfamily
1TWBA 2CH4W 4DA4A 5IHKA 4JJDA 4KGZB 1S72T 2JS2A 1X2QA 3CD6Q 4XU1A 1K9MR 3KUFA 3EFRA 1H92A 4RG8A 4E7JA 4KRTA 2COWA 3OYMA 2LRQA 4PJOA 4M75A 2FO0A 5GAOm 5GAOr 4AFUC 3HKSA 2R5AA 5GAN6 4LE9A 2J06A 1G3TA 1YHQT 2LCCA 4J7IA 1I8FA 3E9GA 3P8HA 4LD6A 2E64A 2LTOA 1M30A 2EVRA 4M78E 2F5TX 2EFIA 1BCOA 2B86A 1HK9A 3EG0A 4B9WA 3CD6T 1M8VA 3M4GA 2EKOA 2RMOA 4Q5WA 2AZVA 2LNVA 1KSWA 2DL4A 2AKKA 4OMFB 3QJYA 3NTHA 4JPBW 2E3HA 3DB3A 1U8RA 3G71A 2HL3A 2E6NA 2E5QA 2DIQA 2RF0A 4C8QA 4PLLA 2ENMA 1YN8A 2BTTA 2M0YA 1BIBA 1M2VB 2J6OA 2KRNA 1N6AA 1ZSZA 2I2LA 4QW2A 5I21A 1D1AA 2WSEE 4XTZA 3CC4A 1GCQA 4KH1B 3MP8A 4M75D 3PFSA 1Y96B 1QVGS 4E7HA 2PUOB 4KULA 1TUDA 3QYGB 2ED0A 1YIJA 4E7KA 2HQEA 3META 1RAGB 3SD4A 3M58A 5KYWB 1T3LA 1K73U 5HY6A 4C0DB 2CS7A 2X35A 3MEVA 5GAOq 2H8HA 1VQMA 1M3CA 2DTOA 3AHUA 1ZX6A 4GBQA 5GAOl 1WYXA 3CC2T 4M78B 2X9HA 3S6WA 1GBQA 2RQWA 4PJMA 3OMCA 1PD1A 1WI7A 3ZEHA 2HAXA 3U23A 4D6WA 2A0FB 3M0QA 3RERA 1QP3A 1MMAA 2M51A 3OYHA 1KD1U 2GFAA 3CMET 1VQKQ 4M7AE 2ZPEB 3I56A 1Y57A 4A4FA 2ZZDA 3PVLA 2FEIA 4C92E 1TTHB 3G7ZA 3HSBA 1X01A 2MAMA 1T0JA 2X4YA 3M56A 3RKYA 3VJPA 1VQ6T 1ZBXA 1MUZA 3RNJA 3JCMV 1KIKA 5GMKi 4OMPA 3E2UA 3WXMB 2IVWA 1G3WA 3LLRA 3A8OB 1OOTA 2LCSA 2QDYB 4M7DE 1WA7A 3RMQA 2HBWA 2RHUA 5GANe 2OAUA 1B34A 3M9QA 3OYBA 5CVIA 5DLQE 5KYNA 5AYFA 1HYOA 4M77E 1UHFA 4LD9K 2DETA 5HKCA 2QGGA 3H6ZA 2R5MA 2X4JA 4BD3A 4AFQC 3J80E 2QEXA 4PJLA 2RK1A 3RESA 1I1JA 3H0IA 3OYCA 3PMIA 4OB0B 4M7AB 2M02A 2EJFA 3WVDB 1WGSA 1WHMA 4BDYA 3RKXA 1BI1A 4C92B 3LWHA 3RDVA 2MWPA 3HFNA 5GANf 3ER0A 5IHIA 1V1CA 1KD1C 3X20B 2RB6A 2MWOA 3V7RA 1V76A 2DJZA 2RI3A 5LJ5f 3EG9B 4X1VA 3JB9D 3JCMc 4RTVA 2JNGA 1D0XA 2H3JA 1QWFA 1K9MU 1O9SA 4BDZA 4RTTA 4M7DB 3L1AA 3BE3A 5A0DA 2A3LA 3LWIA 1D0ZA 1SF9A 1UJ0A 4RTWA 2D9TA 2GTOA 4HVUA 1FXXA 3OBWA 1YJNT 2OI3A 2RN8A 2VVKA 2MMPA 4VUBA 4M77B 2DRKA 2AZSA 3FIFA 1JBMA 2ZPBB 3OYJA 1QKWA 4ZN3A 3CBOA 4C0DC 3JV3A 1VQ8A 1K0SA 1CKAA 3OY9A 1VQPQ 2FVUA 2L3RA 1NEBA 4F04B 1I5OB 4M78C 1X69A 2A36A 3M0PA 3Q1JA 2M1HA 4M75E 1KC8R 1VYTA 2G3RA 1SHGA 4C0GA 3LYIA 1OI1A 3BY7A 1CSKA 5C0MA 4J5YA 1UEBA 2DM1A 5LJ3g 2SRCA 4LNPA 2DXCA 3FDRA 5KH6A 2K2MA 5D6WA 1N27A 4RUGA 4OP0A 4DOVA 5GMKe 5GMKm 3CC7A 4AFZC 2GQIA 3CCUT 2PVGB 4PJJA 2DYIA 3S3OA 2SEMA 2EJGA 1VUBA 4XTUA 3HP9A 1VQ9Q 4C5EA 1PM3A 5J3BA 4A4KA 5KYYB 1K9MC 4XTWA 1KQ1A 1VQNT 2LQKA 4J83A 1VQ6A 1M4ZA 2O9SA 3NHNA 2QGFB 1IB8A 3FRNA 4E47A 2LJ0A 3SB2A 1YP5A 2DF6A 3NMZC 1ACMB 4BE0A 2YXYA 1B3QA 2DZ9A 4M75B 3I35A 2VXEA 1JJ2S 1VQ7A 2GNCA 3M0UA 3CCVA 3CCRA 4JRQA 3C0CA 4JRIA 4X34A 1VQ9T 2EGCA 2RHIA 1UECA 2L3PA 2JT4A 2QQ9A 3LX7A 2XKOC 2G6FX 3OQ5A 2V8KA 4M7AC 3JCMd 5I2SA 2KXCA 4X9CA 1ZSGA 4C92C 5GAN7 2BE7D 2M16A 4JJBA 4HXJA 1QCFA 5KYUA 4QQGA 1KQ2A 2P0KA 2KK4A 2EJ9A 5GJWB 5GMKl 3LGFA 3DKMA 5FRNA 1EX4A 4AG1C 2E10A 2RHXA 4OB2B 2LT1A 1UGSB 4EMKA 1WNLA 2CP7A 2CSQA 4M7DC 5GANg 2O01E 2Y90A 1ZSZB 1YBYA 2DXBA 3KBGA 3VS7A 5DM7R 3LW5E 3L2QA 4QQDA 1BKBA 1LJOA 1OX8A 3ZFJA 5LJ5g 2H3EB 3RUXA 2DIGA 4BE2A 4BI3A 1UUEA 4F7UE 4Z02A 3OBYA 4M77C 3P8DA 3G71Q 4J9BA 4BACA 1IO6A 1RAHB 1Q7YR 5IXBA 3N5BB 3VS4A 5C6SA 2V1RA 1H3ZA 2EIFA 1KQSS 1W2BS 1YJNA 3CC4Q 3ME9A 2DL7A 2O31A 1KHIA 1YCSB 4RTUA 5A0LA 1MMGA 2P4RA 1YIJQ 4EMGA 1GFDA 1TUCA 3OYIA 3UDCA 3CCQQ 3G71T 1I4K1 2D0QB 3M0RA 2PUKB 3CBPA 4IUPA 4KUDK 1WZOA 4CC7A 1M1FA 3OB9A 1VQMQ 4ZNXA 1TU0B 2OTJA 4Y92A 2DRMA 2RHYA 2RK2A 1M9SA 1JU5C 1V29B 4JLIA 2XD0A 2NLUA 4DBRA 3NPFA 4PFOA 5GANj 3J7AF 1YI2T 1WJQA 1EZZB 1SRMA 2MYSA 1PKTA 5LJ5j 1WPYA 3JB9G 4F7UB 4XQ3A 2CZ1B 3I56Q 4IKFA 1T3SA 1E6HA 4NL2A 3OYKA 1KC8U 1WLPB 3CCUA 3NFCA 1B34B 2WSCE 9ATCB 2F2WA 3QO3A 1RUWA 2CH4A 2L8DA 2O4XA 1NYFA 1M3BA 4M75C 4AT1B 3L2WA 1FMKA 2HKQB 2EYZA 4M78F 4Y28E 3QWXX 4RKUE 2EYQA 4MZTA 5CKEA 2ECZA 2JJ9A 1WHLA 1K1ZA 5CKBA 2MF2A 3J81E 4P5NA 3I9QA 2BZ8A 4CC2A 3TU4K 2KNBB 3RIRA 2DMOA 3MEWA 1Q86R 2LVMA 2CREA 4ZGDB 2O9VA 4XTYA 2ROLA 2ZPHB 3CQTA 1WJRA 3PT9A 2X4XA 3EG2A 4V2SA 3M4YA 1KK7A 4AFSC 3OYYA 1B7TA 4A54A 2L3SA 2KGTA 2CP0A 3EGDA 4RTXA 4F14A 3CPWA 2DXUA 4FL6A 1MMDA 1ZSZC 2GQVA 3KXTA 4IUQA 1QVFA 5KYXA 4JZ4A 1GCQC 3BFMA 1Q82R 4A4EA 3JB9H 1NE8A 3OSVA 2RH2A 2VKNA 3CPWP 3JCMf 1IXDA 2PZ1A 3VYGA 5CKFA 1AD5A 1D3BA 2QEXT 4ELZC 2LP5A 3CCET 2DVJA 1PCXA 1ZQ1A 1QVFP 2DL5A 2JMAA 4N0AC 4EIKA 1KC8C 2HNIA 3VUZA 2M0OA 4L6V5 1RL2A 1NPRA 2RJEA 2HEQA 1OU8A 1XTDA 2VUBA 3MJXA 4PK4A 2YRDA 5GMKj 3X28B 2VWFA 4M7AF 4OGEA 4E7IA 3VS3A 1NLPC 4FYXB 1TH7A 3PIPA 2KYBA 4J9GA 1VQ8Q 2Y4XA 4C92F 4MMKA 3X24B 4DQ2A 1K4US 4GLMA 2CP5A 2R58A 1YCYA 1JXOA 1LPLA 4C0FA 2EWNA 2L89A 2GFUA 1Q7YU 2YWWA 1MNEA 4M7DF 4R0KA 2FRWA 1I81A 4J6YA 1OZ2A 3EHQA 3OMGA 5LJ3e 2R57A 1IHVA 4GLKA 3CC2Q 1VQLA 2PTKA 1VQ8T 3E19A 4ZGEB 3HFOA 4PJOD 4XU0A 2A7YA 2NUPA 2YUNA 3VU3C 1U3OA 2KI7A 1UDLA 2DLPA 1GRIA 2RHZA 3CC7Q 4M77F 3SHWA 2D6FA 4ZTJA 1YI2A 4XU2A 5D6YA 1X43A 3CMEQ 2EGEA 3R6NA 1NZ9A 1AEYA 3MP1A 2HD0A 4M78G 4B9XA 2MOXA 3A1PA 3EGUA 4LUEA 3OYNA 2E4HA 2KBTA 1QCNA 2JN0A 5LJ3f 1VQ6Q 1JB0E 4OMNA 3JCMJ 2BKDN 2VGMA 3VS2A 3OS5A 3CC7T 3A8HB 2KMTA 4C8QD 4HCZA 2RI2A 3A8MB 1O75A 5KYUB 3H41A 3QJ6A 1VQ7Q 1EIFA 2QXFA 4BE1A 3CCVQ 3V7SA 4HVVA 2B8AA 4RG2A 1VIFA 2CP6A 4L59A 1TXQA 2E3IA 3JCMP 4EMKB 5HK3A 1W1FA 3CXCA 2HBPA 2GCXA 4CC4B 1WHGA 2W0ZA 2JMCA 3LH5A 1QP2A 5GAMe 1RAAB 3VS1A 3FC3A 1MHNA 1Q7YC 2EBPA 3A98A 4HCCA 4JZ3A 1VQ7T 1WXUA 1VQ5A 3CXCP 2F69A 3CCVT 5HK0A 3CCRT 2E70A 1YITT 1BIAA 1AWWA 3QG1A 2Z0WA 3F70A 2LJ3A 1Q86U 3OS1A 3EGXB 2VC8A 1VQ4A 1LNXA 3OYAA 4FT2A 2Y4YA 5LJ5e 4M75F 2KEAA 4XTXA 1QWEA 3TCJA 2FZCB 3JCMg 2V8IA 3QZ9B 2DBKA 2EQKA 3JSCA 2P4TA 2P0PA 1OYXA 2YT6A 1YJ9T 5GAMf 4M7AG 3CCEA 1NJIR 2HZYA 2CP2A 1X75C 4ESRA 2XK0A 4C92G 1R77A 5IT9E 1UGVA 4BY6B 4ATOA 3OW2A 2MI6A 4E7ZA 2EQJA 3TSZA 1Z9QA 1BBZA 2YDLA 5HCKA 1X2KA 2FZGB 2JZ2A 1Q82U 3NTKA 2DK3A 4QKUA 1YJNQ 3QKJA 4J9DA 5CIUA 2DEQA 3JCMX 5CO7A 4MDWA 1I5LA 3P8BB 3OW2P 3H9NA 1SSHA 3FLGA 4OB1B 3CCST 4M7DG 2J6FA 5LJ3h 1XOVA 4HCKA 1FMVA 5FW9A 1QVPA 2ROTA 2HKNA 2F5KA 5J26A 3LGLA 2XDPA 1OQKA 4PFZA 1F1BB 2K4YA 2KR3A 3FJPA 3C12A 1A0NB 2OTJQ 3R6OA 1YNZA 3FJ5A 4M77G 3V8LA 3PE0A 1VOMA 1KFZA 1K0XA 2PVOB 2XMFA 2JTMA 3L2ZA 2DEUA 4XK8E 2AT1B 2CYZB 2O4XB 1PD0A 2P84A 2C0OA 5GAN4 1ZLMA 1FX7A 3CBMA 1WXTA 2D0NA 4EPCA 4E6RA 1Q86C 1M1KR 2J7IA 4FYVB 1AT1B 3A5ZB 3CCUQ 2CDTA 2OTJT 2BUDA 1TSFA 1SG5A 4PJOE 2AKLA 3X25B 1PRMC 2O88A 2K9GA 3EH2A 2O2OA 3CCJT 5CKHA 1HXDA 4IURA 3NGPA 1JEGA 2L0AA 1JRIA 1EFNA 5L8RE 2CGHA 1VQNQ 1OULA 4D8DA 2FPFA 2DD5A 2FL7A 4OMQA 2DZCA 1MNDA 1YWOA 2F2VA 4KT0E 4RMOA 2KYMA 1QLYA 1RLQC 1U1TA 1U5SA 2EPDA 4FW1A 1C0MA 1Q82C 5GAMh 3DLMA 2C06A 2EYWA 2QQSA 5DY9A 5DLOA 4KH0B 5KYXB 1IRXA 1PSFA 3I55T 4F7UF 2LZ6B 4ANJA 4C8QE 2YHTA 2ZPFB 2XDBA 3FEOA 3JB9F 5GANh 1D3BB 2VV5A 4J9FA 1SPKA 1S1NA 2K57A 4J6XA 5FWBA 1RABB 3PNWC 3KFVA 5LJ5h 1D0YA 4M75G 1PHTA 5CAIA 3SFMA 4E2FB 3GPLA 4ORZA 2K3BA 4PJOB 2JTEA 3PGGA 2L5QA 1YITA 2V1QA 1Z9ZA 2LDMA 1TUGB 4EDUA 1OX9A 3CCLT 4BY6C 2HQHA 4FSSA 4JS5A 2RPNA 5LJ3j 1MV0B 4GY5A 1LOJA 5GAMg 2RA2A 4LDUA 1GCPA 1YJ9A 1XJWB 3NTIA 4M78A 3L42A 1QCOA 2DTIA 4HVWA 2DX1A 2KY9A 2YLBA 5L23A 1LVKA 3UWNA 4C8QB 2EW3A 4FU6A 3HRTA 3WVEB 1J3TA 4JUVA 1OPLA 2QAZA 4A53A 1M5Q1 1RACB 2E65A 2YRCA 5CQYA 5IN1A 2DKGA 1G3SA 1VYVA 3E1SA 1C1AA 2KRSA 4C0ZA 3M5AA 3O5ZA 2A08A 4NL3A 3QUIA 5FU6B 1NJIU 3OA6A 4AMCA 3QXEB 3CCSA 3SWNA 3OYLA 3H8ZA 1NBEB 3D7SB 1PNJA 4RTYA 3QIIA 3JCMb 1B07A 1AWXA 4PNOA 3GLXA 2F2XA 3E9FA 3CCMT 4O5VA 1BU1A 1VQLQ 2K5IA 1H3HA 2JOYA 2RI5A 4DOWA 2MCNA 2QG9B 1UGQB 4J9HA 1YI2Q 1C6VX 2M9UA 1GXIE 2X51A 2GF7A 5GAMj 5I22A 4WF2A 3M57A 2WACA 1ABOA 3TQ7P 1IZ6A 3OYDA 2L2PA 5GMKh 2DAQA 1VQLT 2EKHA 2DYBA 1WHJA 1AZEA 3MKDA 2KT8A 2E6ZA 1SSFA 3CCJA 2ABLA 4QQ6A 2PU9B 4M7AA 2ZCFB 4B6MA 1K73R 2I0NA 4F7UG 3JCMQ 2FPDA 2QK0A 4C92A 2ATCB 3VKIA 1T0HA 1HJDA 3RBBB 2XU8A 2OAWA 3HTRA 1P92A 2VYTA 2LCLA 4A4HA 2QA4A 2LJ1A 3ULRB 1ZBJA 1NJIC 1UTIA 1WX6A 3I55A 3HRSA 2BZXA 1AHJB 3UATA 2FG0A 1VQPA 1N8RR 4PJOC 1NYGA 4OMLA 3VYHB 3INZA 5EG2A 1RI0A 3SEMA 3VRYA 1WQ7A 1YWPA 5CK9A 1VQ5Q 4E7SA 2DPPB 2FHDA 2YLCA 1H8KA 1SRLA 3JAME 5FROA 3PTAA 1E7OA 4M77A 1IREB 1MMNA 3X26B 1VQ4Q 1UGRB 4IUUA 3REBB 1WHHA 4WTOB 3JCMe 1VQOT 1GBRA 3UPUA 2ZGWA 1WFWA 3OYFA 2HCKA 2QEXQ 1M27C 3CCEQ 1OEBA 3CCLA 3EG3A 1VQ5T 3EFSA 1K8AR 2EQUA 5KE2A 4C8QC 5KE3A 1G83A 2E1HA 3HHTB 1I0CA 4FCYA 4IIOA 4CI0C 3VS0A 2KDSA 4ZTFA 1VQ4T 2DNUA 2JS0A 3L2VA 1QVGA 2K5FA 1NG2A 2OJ2A 2OTLT 4QT7A 1ZA2B 5FU6C 2LX7A 2RO0A 3A8LB 2QASA 1Y0MA 4DEYA 4JJNK 3TREA 3OYEA 4BB7A 2KAFA 1X6GA 2QTVA 5IXFA 3G6EA 2LQ8A 4F16A 1JQQA 3M0TA 4R55A 2X3WD 2YUQA 3CMAA 4XU3A 3EG1A 1R0CB 2CUDA 3M0SA 4A4GA 2ZPIB 4PKCC 2LQNA 3TVTA 2E5KA 1KHCA 4PLIA 3EAEA 4K11A 1QKXA 5GANd 5FU7B 2FPEA 2WSFE 1BB9A 2CP3A 4OB3B 3G4ST 5LJ5d 1G8XA 5CQXA 1M1GA 2RJFA 3V8JA 3CCMA 3M59A 4J9IA 3AT1B 2DTHA 3PVQA 1RAEB 2KT1A 2DO3A 4DEXA 2EYXA 2BIVA 4FSXA 4HT8A 1UG1A 1NEGA 3UF4A 1Q95G 4IIMA 4ME7A 2JXBA 4UC4A 1RAIB 3GF5A 3G1JA 2JW4A 2BZYA 1PRLC 4OMOA 1OZ3A 2KQWA 4MDXA 1QQJA 2RJCA 2JVVA 2AIRB 1R8OB 1OPKA 4OVAA 3ZBDA 2KXDA 3VV0A 3CPWS 3CPFA 4HA8A 4FYYB 2PNIA 5GAOp 1AZGB 5GAN2 1BCMA 2XI9A 6AT1B 2YRVA 1PWTA 2OX7A 1QVFS 2W10A 3REAB 5M9OA 3PIOA 2NWMA 1ZUUA 1M90R 1N9RA 3CCQA 3JCMh 4LDVA 2FYKA 4MZMA 4N0AA 4EMHA 2A28A 2XG8D 2DL3A 3JB9I 4HCBA 2JTFA 4YTLA 1VYUA 1WIEA 2EQIA 5GAN5 2HQXA 3CCRQ 2NUTA 1YITQ 3QBYA 2EGAA 1YJWA 2K6DA 5KCOA 2RJDA 2BE9B 1Q81R 1Y71A 3ZL7C 1R0BG 1VQOA 2JM9A 3MO8A 1JXMA 2X3XD 4OMMA 1N8RU 3GP8A 3JRZA 1PC0A 1MGQA 4QVZA 3MEAA 1WQWA 1IGUA 4OGCA 2E41A 1YJ9Q 5CR2A 1FWZA 4PJNA 3CEYA 3SWNB 4M4ZA 5J39A 1W70A 4JDSA 1RADB 2AHJB 2QTXA 1WJSA 1N5ZA 2XICA 2QDLA 4BUGA 1CKBA 2HSPA 2VGNA 2OTLA 1G3YA 2D8HA 2DD4A 4Y91A 1TG0A 4PJOF 4F7UA 2XIDA 3JB9J 1VQKT 2LQWA 2X4WA 2JM8A 1VIEA 2K7AA 1BI3A 2RQRA 5FU7C 3CCSQ 1K8AU 5FLXE 4J9EA 3UA6A 8AT1B 2RNAA 2RQUA 4XTVA 3GIBA 1LCKA 3O8VA 2CZ0B 2IPOB 1ZHIA 1UHCA 1K73C 3QSUA 2QQAA 2COYA 2LX9A 1WXBA 3V8KA 3JCMW 3S3NA 3URGA 1SHFA 2EYYA 1S72A 3EH1A 3G4SA 2CT4A 3BW1A 4C8QF 5FRMA 2LMJA 2MPXC 1N9SA 4JJCA 1D1BA 1X6OA 4JRPA 5A2QE 1UFFA 1M2OA 3EFOA 5ECAA 2D1XA 1YHQA 1N8RC 2DXTA 3VRZA 4PL6A 4C5HA 1KG1A 4J9CA 2HSEB 3CCJQ 1FMWA 2YUPA 3CD6A 3CXCS 1JJ2A 3QYHB 2ED1A 5GAOn 2L3QA 1Y07A 2MK5A 3IQLA 4DBQA 4QVDA 2F1LA 1VA7A 4HT9A 1AWOA 4FYWB 4NS5A 3TSWA 4JLGA 5AT1B 1ZUYA 2QA4Q 1JJ2P 2DFUA 1OU9A 1XNIA 4LN2A 1W4SA 3OS2A 3H0FA 3I55Q 1K8AC 2E12A 5FWCA 3GBQA 4BI4A 1KJWA 4J8OA 3C95A 3UA7A 2IIMA 3MPUB 2QQRA 1DJ7B 2RQTA 4KGVB 4E7LA 3EGDB 4EMKC 5EC7A 4BI8B 3TEEA 1ZUKA 2P0QA 4FW2A 2QA4T 2IG0A 3OYGA 2AK5A 2RD1A 2DERA 3CC2A 3OW2S 2HMAA 5GJVB 1NLOC 1VQPT 1MV3A 4AG2C 1AWJA 1OV3A 4CRIA 1UGPB 3BDUA 3C94A 3SWNC 1WHKA 3RR6A 1M90U 5CCAA 4LDXA 2KROA 2KSSA 1FYNA 3CCLQ 3QDFA 1ZA1B 2VASA 4Z89A 1RI9A 3CMEA 4Z8AA 3THKA 3FB9A 2COZA 4PJOG 1KQSA 1W2BA 2XHCA 3QDRB 1SKUB 1M2VA 4RTZA 3RKWA 5IH2A 4KUIA 2K2VA 3MP6A 2J05A 1Y96A 1Q81U 4II1A 1X27A 1Y7XA 3SDZA 3UT1A 1KQSP 2EAYA 1W2BP 3M54A 3VUBA 3G6EQ 1ARKA 4RCBA 5D6XA 5KYWA 3QWYA 3CMAQ 5IAYA 2GBQA 1VQKA 3M53A 2DL8A 2D8JA 1JO8A 3M55A 2HL5C 4C8QG 2QQBA 4JS4A 1IHWA 1GFCA 4FM4B 4FIBA 1BI0A 1U06A 3CCMQ 3QHSA 4JRKA 1IGQA 2MIOA 3I5SA 1SEMA 1GL5A 3G6ET 4ZGJB 2FB7A 4KBMB 2J6KA 3CMAT 1UE9A 3V7CA 3BDLA 2NUPB 2RQVA 4LUDA 2K3YA 1U1SA 4R56A 3OSSC 8ATCB 4C5IA 4J6WA 1D09B 2K79A 3GNFB 3MEUA 1M90C 2LC4A 3GOXA 3PMTA 1QW1A 1TOVA 2RM4A 2A37A 2C0TA 2C0IA 2V8JA 3GNGA 1UB4A 2CZ7B 3OS0A 3MCAB 4CC3A 4M78D 1G5VA 3DLLA 2HDAA 4L5GA 4DBHA 4LDYA 2FZKB 2DJQA 4KGXB 4XAXB 2DA9A 3LH0A 1Q81C 1K9AA 3EGXA 3EHRA 2CZ6B 1NPPA 1AOJA 4TVRA 2NUTB 2YSQA 1NM7A 5LL6S 1AVZC 4LDWA 4WCIA 3C4SA 3HRUA 4FT4A 1QMCA 2DILA 2DE0X 1E6GA 4N4HA 4ZN1A 1D1CA 2PVDB 1W6XA 4X9DA 2KRMA 2KVQG 3RMSA 4LXCA 5GAN3 1PSEA 4QVCA 3I5RA 2QYZA 1M1KU 2VB6A 5I2MA 2DVEA 5A0GA 1X6BA 2CUBA 3CC4T 1YJWQ 2K3XA 2VXFA 3EG9A 2LNHB 1YIJT 5LJ3d 1TS9A 3VS5A 1VQOQ 3ASKA 3CCQT 1ABQA 1KD1R 2V26A 3T9NA 4M7DA 2NYSA 5CKDA 1BYMA 4RCCA 4O6JA 1HSQA 2ZAEA 4MZPA 2GTJA 3H0HA 1VQMT 3L2UA 3L2RA 1BI2A 3QZ5B 2QI2A 4J7FA 1WDXA 2LT4A 4IUVA 1M8MA 2CSIA 2K5LA 1YJWT 2JUFA 2DBMA 4N4IA 2KE9A 2FRYA 3QPHA 4C5GA 3HPWA 2CT3A 3DB4A 4M7AD 4NOYA 5GAN8 4DBFA 2XDDA 3HL8A 2OTLQ 2ZPGB 1VQNA 1UJYA 4A63B 4C92D 2YUOA 3I56T 3VS6A 5D7UA 4MMLA 2CKKA 4IUTA 2PQWA 1RLPC 3A8GB 4M7DD 1XQHA 1VQ9A 3EFOB 2NUZA 4ELYC 4HKEA 7AT1B 4PFPA 3S3MA 1K76A 1H641 1PG5B 1S72Q 1M1KC 5KCHA 3G4SQ 5GAMd 1HD3A 1PKSA 5IHNA 4N4GA 4M77D 2ESWA 4OF1A 1YFNA 4Z88A 1G2BA 1QVGP 2GGRA 1M3AA 4D8KA 2EQMA 5I11A 3MHXA 1RAFB 4F17A 1BK2A 5KYYA 1YHQQ 1I07A
chains in the Genus database with same CATH topology
3CEYA 3ME9A 3SWNB 2DZCA 4KT0E 1KHIA 4RMOA 5A0LA 1U1TA 5J39A 4DA4A 4EMGA 1Q82C 4JDSA 2AHJB 5GAMh 2QTXA 3OYIA 1WJSA 3DLMA 2C06A 2XICA 1S72T 3UDCA 4BUGA 3G71T 2QQSA 1I4K1 5DY9A 2D0QB 4XU1A 5DLOA 3KUFA 3EFRA 2PUKB 2VGNA 3CBPA 4RG8A 4E7JA 4IUPA 2OTLA 4KUDK 3I55T 1PSFA 1M1FA 1G3YA 4F7UF 2DD4A 4Y91A 4PJOF 3OB9A 4C8QE 2YHTA 4F7UA 2XIDA 3OYMA 2ZPFB 2LRQA 3JB9J 4M75A 1VQKT 2XDBA 4PJOA 2X4WA 2OTJA 5GAOm 5GAOr 2RHYA 1VIEA 3HKSA 2R5AA 3FEOA 2RK2A 5GAN6 3JB9F 1BI3A 1M9SA 1D3BB 5GANh 1V29B 2VV5A 4JLIA 5FU7C 2XD0A 2NLUA 1G3TA 1YHQT 2LCCA 1K8AU 4J7IA 1I8FA 3E9GA 3P8HA 4LD6A 2E64A 2K57A 2LTOA 4J6XA 4M78E 5FLXE 2F5TX 5GANj 3PNWC 5LJ5h 3J7AF 2EFIA 4M75G 4XTVA 3GIBA 1YI2T 1WJQA 5CAIA 1HK9A 3SFMA 3O8VA 4B9WA 2CZ0B 3CD6T 3GPLA 5LJ5j 1WPYA 3M4GA 2EKOA 1ZHIA 4XQ3A 4F7UB 4Q5WA 3JB9G 4PJOB 1M8VA 2CZ1B 1K73C 3QSUA 2LNVA 2QQAA 3PGGA 2L5QA 4OMFB 1YITA 4IKFA 2LX9A 4NL2A 3OYKA 3QJYA 1KC8U 3CCUA 3V8KA 3JCMW 3S3NA 3URGA 1S72A 3NFCA 3NTHA 2LDMA 3DB3A 1B34B 2WSCE 3G4SA 4EDUA 3G71A 1U8RA 3BW1A 2E6NA 2E5QA 3CCLT 2DIQA 4C8QF 5FRMA 4BY6C 4C8QA 4PLLA 3QO3A 1N9SA 1BIBA 4JS5A 2L8DA 2O4XA 1N6AA 1X6OA 5LJ3j 4JRPA 5A2QE 4M75C 2I2LA 4QW2A 5I21A 4GY5A 1LOJA 3L2WA 5GAMg 2RA2A 4LDUA 2WSEE 4XTZA 3CC4A 1YJ9A 4M75D 4M78F 3MP8A 3PFSA 1Y96B 3NTIA 1YHQA 1QVGS 1N8RC 2DXTA 4M78A 3L42A 4Y28E 2DTIA 2PUOB 4PL6A 4RKUE 2EYQA 4KULA 4MZTA 5CKEA 3QYGB 4C5HA 4E7HA 5CKBA 2MF2A 3J81E 1YIJA 1KG1A 2KY9A 4P5NA 4E7KA 2HQEA 2YLBA 3META 3TU4K 3SD4A 3RIRA 3UWNA 4C8QB 3M58A 4FU6A 3HRTA 3WVEB 3MEWA 3CD6A 2LVMA 1K73U 5HY6A 4C0DB 4JUVA 3CXCS 1JJ2A 3QYHB 4ZGDB 2CS7A 2X35A 5GAOn 4A53A 3MEVA 1M5Q1 2E65A 5GAOq 1Y07A 4XTYA 5CQYA 5IN1A 2ZPHB 2DKGA 1G3SA 1VQMA 2DTOA 3AHUA 3E1SA 5GAOl 1WJRA 4C0ZA 3CC2T 3PT9A 2X4XA 4M78B 4QVDA 3M5AA 3M4YA 3S6WA 4V2SA 4NL3A 4HT9A 3QUIA 5FU6B 1NJIU 4NS5A 3OA6A 3OMCA 3QXEB 3ZEHA 3OYYA 3CCSA 2HAXA 3SWNA 3OYLA 1VQ7A 4A54A 4D6WA 4JLGA 3H8ZA 3JCMb 3QIIA 1XNIA 3RERA 1QP3A 3CPWA 2DXUA 4PNOA 4FL6A 3GLXA 1W4SA 3OS2A 3OYHA 1KD1U 3E9FA 3KXTA 2GQVA 4IUQA 2GFAA 1K8AC 2E12A 3CCMT 3CMET 4O5VA 4BI4A 1QVFA 4J8OA 4M7AE 3C95A 3BFMA 2ZPEB 2K5IA 2JOYA 3I56A 2RI5A 4A4EA 4A4FA 4DOWA 2ZZDA 3JB9H 1NE8A 2QQRA 3OSVA 4C92E 2RH2A 1DJ7B 3G7ZA 3HSBA 3JCMf 1X01A 2MAMA 3VYGA 5CKFA 2X4YA 1D3BA 3M56A 3RKYA 1UGQB 3VJPA 4ELZC 4EMKC 2QEXT 4E7LA 3CCET 1VQ6T 1ZBXA 4BI8B 1ZQ1A 3JCMV 3TEEA 2M9UA 2P0QA 2QA4T 4N0AC 1KC8C 2HNIA 3VUZA 2M0OA 5GMKi 2IG0A 1GXIE 2GF7A 4L6V5 5GAMj 2RD1A 1RL2A 3OYGA 3WXMB 2IVWA 3CC2A 1NPRA 1G3WA 3LLRA 3A8OB 2WACA 3M57A 4WF2A 3OW2S 1IZ6A 2QDYB 1VQPT 3OYDA 2RJEA 4M7DE 4CRIA 1UGPB 3BDUA 5GMKh 2DAQA 3C94A 1VQLT 3SWNC 1XTDA 1M90U 2VUBA 5CCAA 4LDXA 2KSSA 3RMQA 5GMKj 3X28B 2RHUA 2E6ZA 5GANe 1SSFA 2OAUA 4OGEA 3CCJA 4QQ6A 4E7IA 1B34A 4M7AF 2PU9B 3M9QA 4M7AA 2ZCFB 3OYBA 3CMEA 3FB9A 5CVIA 5DLQE 4F7UG 3JCMQ 1TH7A 5AYFA 4PJOG 3PIPA 1KQSA 2Y4XA 2XHCA 4M77E 4C92F 4MMKA 3X24B 3QDRB 4DQ2A 1W2BA 4LD9K 4C92A 5HKCA 3VKIA 2R58A 3H6ZA 1YCYA 3RKWA 2R5MA 2X4JA 2XU8A 4BD3A 4KUIA 3J80E 4C0FA 2QEXA 2K2VA 1P92A 2VYTA 2RK1A 3MP6A 3RESA 1Y96A 3OYCA 1Q81U 2EWNA 3PMIA 2LCLA 4A4HA 4II1A 3UT1A 1Y7XA 2L89A 3SDZA 2QA4A 4OB0B 2EAYA 2GFUA 4M7AB 1Q7YU 2EJFA 3WVDB 1WGSA 3M54A 3VUBA 4BDYA 1NJIC 4M7DF 3RKXA 4RCBA 3I55A 3HRSA 1AHJB 1I81A 4J6YA 1OZ2A 3OMGA 5D6XA 1BI1A 5LJ3e 4C92B 1VQPA 3LWHA 2R57A 5IAYA 1VQKA 2MWPA 4GLKA 3M53A 3HFNA 1VQLA 4PJOC 1VQ8T 5GANf 3ER0A 3E19A 3VYHB 4ZGEB 3INZA 3HFOA 1KD1C 4XU0A 3M55A 2A7YA 5EG2A 1RI0A 3X20B 4PJOD 1WQ7A 2RB6A 5CK9A 2MWOA 3V7RA 3VU3C 2DJZA 2DPPB 2RI3A 4C8QG 2FHDA 2QQBA 2RHZA 2YLCA 4M77F 5LJ5f 3JAME 3JCMc 4JS4A 5FROA 3JB9D 3PTAA 2JNGA 4FM4B 4M77A 4ZTJA 2D6FA 4FIBA 1BI0A 2H3JA 1YI2A 1K9MU 1O9SA 4XU2A 4BDZA 5D6YA 1IREB 3X26B 3QHSA 1UGRB 4JRKA 4M7DB 3L1AA 4IUUA 1NZ9A 3MP1A 5A0DA 2A3LA 3JCMe 3G6ET 1VQOT 2HD0A 3LWIA 4M78G 2FB7A 4ZGJB 4B9XA 2D9TA 4KBMB 3CMAT 3V7CA 1FXXA 3OBWA 3BDLA 3OYNA 3UPUA 2ZGWA 3OYFA 1YJNT 2K3YA 1U1SA 4R56A 3OSSC 2JN0A 5LJ3f 1JB0E 2MMPA 4C5IA 3CCLA 4VUBA 4M77B 1VQ5T 3JCMJ 3EFSA 3FIFA 2BKDN 2VGMA 2EQUA 4J6WA 4C8QC 5KE2A 3GNFB 1JBMA 2ZPBB 3MEUA 3OS5A 4ZN3A 5KE3A 3OYJA 1M90C 3CC7T 3CBOA 2LC4A 4C0DC 3A8HB 2E1HA 3GOXA 3HHTB 2KMTA 4C8QD 3PMTA 1QW1A 1VQ8A 2RM4A 4CI0C 4HCZA 2KDSA 4ZTFA 2RI2A 3A8MB 1O75A 3OY9A 1VQ4T 3QJ6A 3L2VA 1QVGA 2FVUA 1EIFA 2K5FA 2QXFA 2L3RA 2V8JA 3GNGA 4BE1A 2OTLT 1UB4A 2CZ7B 4M78C 3OS0A 3Q1JA 3MCAB 3V7SA 5FU6C 2B8AA 4RG2A 1VIFA 4M78D 1G5VA 2RO0A 3A8LB 4L59A 2M1HA 4M75E 4JJNK 3TREA 3DLLA 4EMKB 3OYEA 3JCMP 4L5GA 4LDYA 5HK3A 2G3RA 4BB7A 2KAFA 3CXCA 2HBPA 3G6EA 2GCXA 2LQ8A 3LYIA 1OI1A 4XAXB 3LH0A 4C0GA 4R55A 1Q81C 1QP2A 5GAMe 3CMAA 3BY7A 4XU3A 2CZ6B 5C0MA 3FC3A 1MHNA 1NPPA 4A4GA 4J5YA 2ZPIB 1Q7YC 1UEBA 4TVRA 4PKCC 5LJ3g 2DXCA 3FDRA 4HCCA 5LL6S 4LDWA 1KHCA 4PLIA 1VQ7T 1VQ5A 5KH6A 3C4SA 2F69A 3EAEA 3HRUA 5HK0A 5GANd 3CCRT 4FT4A 2E70A 3CCVT 5D6WA 1YITT 5FU7B 1N27A 4DOVA 4OP0A 5GMKe 5GMKm 3CC7A 4N4HA 3CCUT 2PVGB 1BIAA 2WSFE 4ZN1A 3QG1A 3F70A 4OB3B 1Q86U 2PVDB 3G4ST 3OS1A 5LJ5d 5CQXA 1M1GA 2RJFA 3V8JA 2VC8A 4X9DA 3CCMA 1LNXA 2KVQG 3S3OA 1VQ4A 3OYAA 2EJGA 3M59A 3RMSA 1VUBA 5GAN3 1PSEA 4FT2A 2Y4YA 4QVCA 4XTUA 5LJ5e 2DTHA 3HP9A 4M75F 4XTXA 4C5EA 5J3BA 1M1KU 3TCJA 4A4KA 2DO3A 5I2MA 3JCMg 2V8IA 3QZ9B 1K9MC 4XTWA 2DVEA 5A0GA 1KQ1A 2EQKA 1VQNT 3JSCA 2P4TA 2LQKA 2P0PA 1OYXA 3CC4T 1YJ9T 5GAMf 2K3XA 4J83A 4M7AG 1VQ6A 3CCEA 1M4ZA 2BIVA 4FSXA 4HT8A 1X75C 2VXFA 3FRNA 4E47A 1YIJT 5LJ3d 2XK0A 4C92G 3SB2A 5IT9E 4ATOA 4BY6B 3OW2A 2MI6A 3ASKA 3CCQT 2EQJA 4BE0A 3T9NA 4ME7A 4M7DA 4UC4A 2DZ9A 5CKDA 1BYMA 3GF5A 4M75B 2VXEA 1JJ2S 2JZ2A 4RCCA 4O6JA 3NTKA 2DK3A 1Q82U 3CCVA 3CCRA 4JRQA 4MZPA 3QKJA 1OZ3A 2KQWA 4MDXA 1VQMT 5CIUA 4JRIA 2DEQA 4X34A 3L2UA 1VQ9T 3JCMX 3L2RA 2RJCA 2RHIA 5CO7A 1BI2A 3QZ5B 4MDWA 1I5LA 2QI2A 4J7FA 2JVVA 2QQ9A 3LX7A 3P8BB 2LT4A 4IUVA 2K5LA 3FLGA 4OB1B 1YJWT 1R8OB 3CCST 2JUFA 2XKOC 3OQ5A 2V8KA 4N4IA 4OVAA 5LJ3h 4M7AC 4M7DG 1XOVA 4C5GA 3QPHA 5I2SA 3JCMd 3HPWA 4X9CA 3ZBDA 3DB4A 4M7AD 4NOYA 1QVPA 3VV0A 5GAN8 2F5KA 5J26A 3CPWS 3CPFA 4C92C 3LGLA 4HA8A 3HL8A 5GAN7 2XDDA 2XDPA 2ZPGB 2K4YA 2M16A 5GAOp 1VQNA 5GAN2 4C92D 2XI9A 3FJPA 3C12A 4QQGA 2YRVA 1KQ2A 2P0KA 1QVFS 3R6OA 3I56T 4M77G 2KK4A 5M9OA 2EJ9A 3V8LA 3PIOA 5GMKl 3LGFA 3DKMA 5FRNA 2PVOB 1N9RA 2E10A 2JTMA 2RHXA 3L2ZA 4MMLA 2CKKA 4OB2B 2CYZB 2LT1A 4XK8E 1UGSB 3CCQA 3JCMh 4EMKA 4LDVA 1WNLA 4IUTA 2FYKA 2PQWA 2O4XB 4MZMA 4M7DC 4N0AA 5GANg 2O01E 5GAN4 2Y90A 3A8GB 1YBYA 2DXBA 1FX7A 3KBGA 3CBMA 3LW5E 4EMHA 2XG8D 5DM7R 4M7DD 3JB9I 4HCBA 3L2QA 4EPCA 2JTFA 1XQHA 1VQ9A 1Q86C 4YTLA 4QQDA 4ELYC 1BKBA 5GAN5 4HKEA 1LJOA 2HQXA 3ZFJA 5LJ5g 3RUXA 3QBYA 3S3MA 2DIGA 1YJWA 3A5ZB 4BI3A 4BE2A 2OTJT 1H641 5KCOA 2BUDA 4F7UE 4Z02A 2RJDA 3OBYA 4PJOE 4M77C 1M1KC 5KCHA 3P8DA 3X25B 1Y71A 5GAMd 4BACA 4N4GA 4M77D 4OF1A 1VQOA 3CCJT 5CKHA 3N5BB 3MO8A 1HXDA 1N8RU 4IURA 3GP8A 5C6SA 3JRZA 2EQMA 5L8RE 1JRIA 1MGQA 3MHXA 1H3ZA 2CGHA 2EIFA 4QVZA 1KQSS 3MEAA 1W2BS 1WQWA 1YJNA 4OGCA 2E41A 5CR2A 1FWZA 2DD5A 2FL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQ7 A;  2RB6 A;  2DZC A;  3QUI A;  3SWN B;  3V7R A;  3VU3 C;  5GAM f;  2DJZ A;  4M7A G;  3SWN A;  4C8Q G;  1U1T A;  4A54 A;  2YLC A;  5LJ5 f;  4M77 F;  4EMG A;  3JB9 D;  3JCM c;  4HT8 A;  5GAM h;  2QTX A;  2VXF A;  3JCM b;  4M77 A;  3RER A;  5LJ3 d;  4C92 G;  2DXU A;  4XU2 A;  4PNO A;  3SB2 A;  4PJO D;  1I4K 1;  5DY9 A;  4XU1 A;  3QHS A;  4JRK A;  4M7D B;  3EFR A;  3L1A A;  3JCM e;  4M7D A;  4M78 G;  2FB7 A;  2DZ9 A;  4M7A E;  4F7U F;  4Y91 A;  4M75 B;  3BFM A;  2VXE A;  4PJO F;  4C8Q E;  4RCC A;  2YHT A;  3V7C A;  4F7U A;  3JB9 J;  4PJO A;  4M75 A;  5GAO m;  2ZGW A;  5GAO r;  4JRI A;  2DEQ A;  3JB9 H;  3JCM X;  3JB9 F;  4C92 E;  5GAN 6;  1U1S A;  5GAN h;  1D3B B;  3HSB A;  3JCM f;  1X01 A;  1I5L A;  4JLI A;  2JN0 A;  5LJ3 f;  1D3B A;  3RKY A;  4M77 B;  1I8F A;  4EMK C;  3JCM J;  2E64 A;  2K57 A;  3EFS A;  4J6X A;  4M7D G;  3FIF A;  4M78 E;  5LJ3 h;  4J6W A;  4M7A C;  4C8Q C;  5GAN j;  3JCM d;  1JBM A;  3JCM V;  4X9C A;  5LJ5 h;  4N0A C;  2HNI A;  4NOY A;  2E1H A;  4M7A D;  4M75 G;  4XTV A;  4C8Q D;  5GMK i;  5GAN 8;  3GIB A;  2RM4 A;  5CAI A;  4C92 C;  1HK9 A;  2RD1 A;  4HA8 A;  5GAM j;  5GAN 7;  4WF2 A;  5LJ5 j;  1WPY A;  3M4G A;  5GAN 2;  4F7U B;  4XQ3 A;  5GAO p;  4C92 D;  3JB9 G;  4PJO B;  1M8V A;  3FJP A;  3QSU A;  1KQ2 A;  4M78 C;  4M7D E;  3PGG A;  3BDU A;  5GMK h;  3V7S A;  3SWN C;  4M77 G;  4NL2 A;  2EJ9 A;  3V8L A;  4M78 D;  3V8K A;  3JCM W;  5GMK l;  4M75 E;  3JCM P;  4EMK B;  1N9R A;  1B34 B;  2E10 A;  3L2Z A;  4MML A;  5GMK j;  3BW1 A;  5GAN e;  4M7A F;  4V2S A;  3JCM h;  4EMK A;  1B34 A;  4C8Q F;  1WNL A;  2FYK A;  4M7A A;  4C8Q A;  4M7D C;  3FB9 A;  3QO3 A;  4F7U G;  1TH7 A;  1N9S A;  1BIB A;  4N0A A;  4PJO G;  5GAM e;  3JCM Q;  2Y90 A;  3BY7 A;  4M77 E;  4XU3 A;  4C92 F;  4MMK A;  4DQ2 A;  5GAN 4;  4M7D D;  4EMH A;  5LJ3 j;  3JB9 I;  4C92 A;  4M75 C;  2I2L A;  4J5Y A;  5I21 A;  1LOJ A;  5LJ3 g;  5GAM g;  2RA2 A;  4XTZ A;  1YCY A;  5GAN 5;  1LJO A;  3RKW A;  4M75 D;  4M78 F;  5LJ5 g;  1Y96 B;  2DXT A;  4M78 A;  3RUX A;  2DTI A;  5GAN d;  3RES A;  1Y96 A;  2EWN A;  1H64 1;  4F7U E;  4OP0 A;  5GMK e;  4M77 C;  5GMK m;  4PJO E;  1BIA A;  2EAY A;  2YLB A;  5GAM d;  5GAN g;  4M7A B;  2EJF A;  4M77 D;  3RIR A;  4C8Q B;  5LJ5 d;  3V8J A;  4M7D F;  2VC8 A;  4X9D A;  4RCB A;  1LNX A;  4JUV A;  3RKX A;  1HXD A;  1I81 A;  2EJG A;  4J6Y A;  5LJ3 e;  5GAN 3;  5GAO n;  4A53 A;  4C92 B;  1M5Q 1;  2E65 A;  4QVC A;  5GAO q;  4XTU A;  4XTY A;  2DTH A;  4M75 F;  1JRI A;  1MGQ A;  3HFN A;  2DKG A;  4XTX A;  2CGH A;  5LJ5 e;  2DTO A;  3AHU A;  4PJO C;  5GAN f;  1WQW A;  3JCM g;  5GAO l;  2E41 A;  4XTW A;  2DVE A;  3INZ A;  1KQ1 A;  4M78 B;  4QVD A;  3HFO A;  4XU0 A;  4NL3 A;  4HT9 A; 
#chains in the Genus database with same CATH topology
 1TWB A;  2CH4 W;  4DA4 A;  5IHK A;  4JJD A;  4KGZ B;  1S72 T;  2JS2 A;  1X2Q A;  3CD6 Q;  4XU1 A;  1K9M R;  3KUF A;  3EFR A;  1H92 A;  4RG8 A;  4E7J A;  4KRT A;  2COW A;  3OYM A;  2LRQ A;  4PJO A;  4M75 A;  2FO0 A;  5GAO m;  5GAO r;  4AFU C;  3HKS A;  2R5A A;  5GAN 6;  4LE9 A;  2J06 A;  1G3T A;  1YHQ T;  2LCC A;  4J7I A;  1I8F A;  3E9G A;  3P8H A;  4LD6 A;  2E64 A;  2LTO A;  1M30 A;  2EVR A;  4M78 E;  2F5T X;  2EFI A;  1BCO A;  2B86 A;  1HK9 A;  3EG0 A;  4B9W A;  3CD6 T;  1M8V A;  3M4G A;  2EKO A;  2RMO A;  4Q5W A;  2AZV A;  2LNV A;  1KSW A;  2DL4 A;  2AKK A;  4OMF B;  3QJY A;  3NTH A;  4JPB W;  2E3H A;  3DB3 A;  1U8R A;  3G71 A;  2HL3 A;  2E6N A;  2E5Q A;  2DIQ A;  2RF0 A;  4C8Q A;  4PLL A;  2ENM A;  1YN8 A;  2BTT A;  2M0Y A;  1BIB A;  1M2V B;  2J6O A;  2KRN A;  1N6A A;  1ZSZ A;  2I2L A;  4QW2 A;  5I21 A;  1D1A A;  2WSE E;  4XTZ A;  3CC4 A;  1GCQ A;  4KH1 B;  3MP8 A;  4M75 D;  3PFS A;  1Y96 B;  1QVG S;  4E7H A;  2PUO B;  4KUL A;  1TUD A;  3QYG B;  2ED0 A;  1YIJ A;  4E7K A;  2HQE A;  3MET A;  1RAG B;  3SD4 A;  3M58 A;  5KYW B;  1T3L A;  1K73 U;  5HY6 A;  4C0D B;  2CS7 A;  2X35 A;  3MEV A;  5GAO q;  2H8H A;  1VQM A;  1M3C A;  2DTO A;  3AHU A;  1ZX6 A;  4GBQ A;  5GAO l;  1WYX A;  3CC2 T;  4M78 B;  2X9H A;  3S6W A;  1GBQ A;  2RQW A;  4PJM A;  3OMC A;  1PD1 A;  1WI7 A;  3ZEH A;  2HAX A;  3U23 A;  4D6W A;  2A0F B;  3M0Q A;  3RER A;  1QP3 A;  1MMA A;  2M51 A;  3OYH A;  1KD1 U;  2GFA A;  3CME T;  1VQK Q;  4M7A E;  2ZPE B;  3I56 A;  1Y57 A;  4A4F A;  2ZZD A;  3PVL A;  2FEI A;  4C92 E;  1TTH B;  3G7Z A;  3HSB A;  1X01 A;  2MAM A;  1T0J A;  2X4Y A;  3M56 A;  3RKY A;  3VJP A;  1VQ6 T;  1ZBX A;  1MUZ A;  3RNJ A;  3JCM V;  1KIK A;  5GMK i;  4OMP A;  3E2U A;  3WXM B;  2IVW A;  1G3W A;  3LLR A;  3A8O B;  1OOT A;  2LCS A;  2QDY B;  4M7D E;  1WA7 A;  3RMQ A;  2HBW A;  2RHU A;  5GAN e;  2OAU A;  1B34 A;  3M9Q A;  3OYB A;  5CVI A;  5DLQ E;  5KYN A;  5AYF A;  1HYO A;  4M77 E;  1UHF A;  4LD9 K;  2DET A;  5HKC A;  2QGG A;  3H6Z A;  2R5M A;  2X4J A;  4BD3 A;  4AFQ C;  3J80 E;  2QEX A;  4PJL A;  2RK1 A;  3RES A;  1I1J A;  3H0I A;  3OYC A;  3PMI A;  4OB0 B;  4M7A B;  2M02 A;  2EJF A;  3WVD B;  1WGS A;  1WHM A;  4BDY A;  3RKX A;  1BI1 A;  4C92 B;  3LWH A;  3RDV A;  2MWP A;  3HFN A;  5GAN f;  3ER0 A;  5IHI A;  1V1C A;  1KD1 C;  3X20 B;  2RB6 A;  2MWO A;  3V7R A;  1V76 A;  2DJZ A;  2RI3 A;  5LJ5 f;  3EG9 B;  4X1V A;  3JB9 D;  3JCM c;  4RTV A;  2JNG A;  1D0X A;  2H3J A;  1QWF A;  1K9M U;  1O9S A;  4BDZ A;  4RTT A;  4M7D B;  3L1A A;  3BE3 A;  5A0D A;  2A3L A;  3LWI A;  1D0Z A;  1SF9 A;  1UJ0 A;  4RTW A;  2D9T A;  2GTO A;  4HVU A;  1FXX A;  3OBW A;  1YJN T;  2OI3 A;  2RN8 A;  2VVK A;  2MMP A;  4VUB A;  4M77 B;  2DRK A;  2AZS A;  3FIF A;  1JBM A;  2ZPB B;  3OYJ A;  1QKW A;  4ZN3 A;  3CBO A;  4C0D C;  3JV3 A;  1VQ8 A;  1K0S A;  1CKA A;  3OY9 A;  1VQP Q;  2FVU A;  2L3R A;  1NEB A;  4F04 B;  1I5O B;  4M78 C;  1X69 A;  2A36 A;  3M0P A;  3Q1J A;  2M1H A;  4M75 E;  1KC8 R;  1VYT A;  2G3R A;  1SHG A;  4C0G A;  3LYI A;  1OI1 A;  3BY7 A;  1CSK A;  5C0M A;  4J5Y A;  1UEB A;  2DM1 A;  5LJ3 g;  2SRC A;  4LNP A;  2DXC A;  3FDR A;  5KH6 A;  2K2M A;  5D6W A;  1N27 A;  4RUG A;  4OP0 A;  4DOV A;  5GMK e;  5GMK m;  3CC7 A;  4AFZ C;  2GQI A;  3CCU T;  2PVG B;  4PJJ A;  2DYI A;  3S3O A;  2SEM A;  2EJG A;  1VUB A;  4XTU A;  3HP9 A;  1VQ9 Q;  4C5E A;  1PM3 A;  5J3B A;  4A4K A;  5KYY B;  1K9M C;  4XTW A;  1KQ1 A;  1VQN T;  2LQK A;  4J83 A;  1VQ6 A;  1M4Z A;  2O9S A;  3NHN A;  2QGF B;  1IB8 A;  3FRN A;  4E47 A;  2LJ0 A;  3SB2 A;  1YP5 A;  2DF6 A;  3NMZ C;  1ACM B;  4BE0 A;  2YXY A;  1B3Q A;  2DZ9 A;  4M75 B;  3I35 A;  2VXE A;  1JJ2 S;  1VQ7 A;  2GNC A;  3M0U A;  3CCV A;  3CCR A;  4JRQ A;  3C0C A;  4JRI A;  4X34 A;  1VQ9 T;  2EGC A;  2RHI A;  1UEC A;  2L3P A;  2JT4 A;  2QQ9 A;  3LX7 A;  2XKO C;  2G6F X;  3OQ5 A;  2V8K A;  4M7A C;  3JCM d;  5I2S A;  2KXC A;  4X9C A;  1ZSG A;  4C92 C;  5GAN 7;  2BE7 D;  2M16 A;  4JJB A;  4HXJ A;  1QCF A;  5KYU A;  4QQG A;  1KQ2 A;  2P0K A;  2KK4 A;  2EJ9 A;  5GJW B;  5GMK l;  3LGF A;  3DKM A;  5FRN A;  1EX4 A;  4AG1 C;  2E10 A;  2RHX A;  4OB2 B;  2LT1 A;  1UGS B;  4EMK A;  1WNL A;  2CP7 A;  2CSQ A;  4M7D C;  5GAN g;  2O01 E;  2Y90 A;  1ZSZ B;  1YBY A;  2DXB A;  3KBG A;  3VS7 A;  5DM7 R;  3LW5 E;  3L2Q A;  4QQD A;  1BKB A;  1LJO A;  1OX8 A;  3ZFJ A;  5LJ5 g;  2H3E B;  3RUX A;  2DIG A;  4BE2 A;  4BI3 A;  1UUE A;  4F7U E;  4Z02 A;  3OBY A;  4M77 C;  3P8D A;  3G71 Q;  4J9B A;  4BAC A;  1IO6 A;  1RAH B;  1Q7Y R;  5IXB A;  3N5B B;  3VS4 A;  5C6S A;  2V1R A;  1H3Z A;  2EIF A;  1KQS S;  1W2B S;  1YJN A;  3CC4 Q;  3ME9 A;  2DL7 A;  2O31 A;  1KHI A;  1YCS B;  4RTU A;  5A0L A;  1MMG A;  2P4R A;  1YIJ Q;  4EMG A;  1GFD A;  1TUC A;  3OYI A;  3UDC A;  3CCQ Q;  3G71 T;  1I4K 1;  2D0Q B;  3M0R A;  2PUK B;  3CBP A;  4IUP A;  4KUD K;  1WZO A;  4CC7 A;  1M1F A;  3OB9 A;  1VQM Q;  4ZNX A;  1TU0 B;  2OTJ A;  4Y92 A;  2DRM A;  2RHY A;  2RK2 A;  1M9S A;  1JU5 C;  1V29 B;  4JLI A;  2XD0 A;  2NLU A;  4DBR A;  3NPF A;  4PFO A;  5GAN j;  3J7A F;  1YI2 T;  1WJQ A;  1EZZ B;  1SRM A;  2MYS A;  1PKT A;  5LJ5 j;  1WPY A;  3JB9 G;  4F7U B;  4XQ3 A;  2CZ1 B;  3I56 Q;  4IKF A;  1T3S A;  1E6H A;  4NL2 A;  3OYK A;  1KC8 U;  1WLP B;  3CCU A;  3NFC A;  1B34 B;  2WSC E;  9ATC B;  2F2W A;  3QO3 A;  1RUW A;  2CH4 A;  2L8D A;  2O4X A;  1NYF A;  1M3B A;  4M75 C;  4AT1 B;  3L2W A;  1FMK A;  2HKQ B;  2EYZ A;  4M78 F;  4Y28 E;  3QWX X;  4RKU E;  2EYQ A;  4MZT A;  5CKE A;  2ECZ A;  2JJ9 A;  1WHL A;  1K1Z A;  5CKB A;  2MF2 A;  3J81 E;  4P5N A;  3I9Q A;  2BZ8 A;  4CC2 A;  3TU4 K;  2KNB B;  3RIR A;  2DMO A;  3MEW A;  1Q86 R;  2LVM A;  2CRE A;  4ZGD B;  2O9V A;  4XTY A;  2ROL A;  2ZPH B;  3CQT A;  1WJR A;  3PT9 A;  2X4X A;  3EG2 A;  4V2S A;  3M4Y A;  1KK7 A;  4AFS C;  3OYY A;  1B7T A;  4A54 A;  2L3S A;  2KGT A;  2CP0 A;  3EGD A;  4RTX A;  4F14 A;  3CPW A;  2DXU A;  4FL6 A;  1MMD A;  1ZSZ C;  2GQV A;  3KXT A;  4IUQ A;  1QVF A;  5KYX A;  4JZ4 A;  1GCQ C;  3BFM A;  1Q82 R;  4A4E A;  3JB9 H;  1NE8 A;  3OSV A;  2RH2 A;  2VKN A;  3CPW P;  3JCM f;  1IXD A;  2PZ1 A;  3VYG A;  5CKF A;  1AD5 A;  1D3B A;  2QEX T;  4ELZ C;  2LP5 A;  3CCE T;  2DVJ A;  1PCX A;  1ZQ1 A;  1QVF P;  2DL5 A;  2JMA A;  4N0A C;  4EIK A;  1KC8 C;  2HNI A;  3VUZ A;  2M0O A;  4L6V 5;  1RL2 A;  1NPR A;  2RJE A;  2HEQ A;  1OU8 A;  1XTD A;  2VUB A;  3MJX A;  4PK4 A;  2YRD A;  5GMK j;  3X28 B;  2VWF A;  4M7A F;  4OGE A;  4E7I A;  3VS3 A;  1NLP C;  4FYX B;  1TH7 A;  3PIP A;  2KYB A;  4J9G A;  1VQ8 Q;  2Y4X A;  4C92 F;  4MMK A;  3X24 B;  4DQ2 A;  1K4U S;  4GLM A;  2CP5 A;  2R58 A;  1YCY A;  1JXO A;  1LPL A;  4C0F A;  2EWN A;  2L89 A;  2GFU A;  1Q7Y U;  2YWW A;  1MNE A;  4M7D F;  4R0K A;  2FRW A;  1I81 A;  4J6Y A;  1OZ2 A;  3EHQ A;  3OMG A;  5LJ3 e;  2R57 A;  1IHV A;  4GLK A;  3CC2 Q;  1VQL A;  2PTK A;  1VQ8 T;  3E19 A;  4ZGE B;  3HFO A;  4PJO D;  4XU0 A;  2A7Y A;  2NUP A;  2YUN A;  3VU3 C;  1U3O A;  2KI7 A;  1UDL A;  2DLP A;  1GRI A;  2RHZ A;  3CC7 Q;  4M77 F;  3SHW A;  2D6F A;  4ZTJ A;  1YI2 A;  4XU2 A;  5D6Y A;  1X43 A;  3CME Q;  2EGE A;  3R6N A;  1NZ9 A;  1AEY A;  3MP1 A;  2HD0 A;  4M78 G;  4B9X A;  2MOX A;  3A1P A;  3EGU A;  4LUE A;  3OYN A;  2E4H A;  2KBT A;  1QCN A;  2JN0 A;  5LJ3 f;  1VQ6 Q;  1JB0 E;  4OMN A;  3JCM J;  2BKD N;  2VGM A;  3VS2 A;  3OS5 A;  3CC7 T;  3A8H B;  2KMT A;  4C8Q D;  4HCZ A;  2RI2 A;  3A8M B;  1O75 A;  5KYU B;  3H41 A;  3QJ6 A;  1VQ7 Q;  1EIF A;  2QXF A;  4BE1 A;  3CCV Q;  3V7S A;  4HVV A;  2B8A A;  4RG2 A;  1VIF A;  2CP6 A;  4L59 A;  1TXQ A;  2E3I A;  3JCM P;  4EMK B;  5HK3 A;  1W1F A;  3CXC A;  2HBP A;  2GCX A;  4CC4 B;  1WHG A;  2W0Z A;  2JMC A;  3LH5 A;  1QP2 A;  5GAM e;  1RAA B;  3VS1 A;  3FC3 A;  1MHN A;  1Q7Y C;  2EBP A;  3A98 A;  4HCC A;  4JZ3 A;  1VQ7 T;  1WXU A;  1VQ5 A;  3CXC P;  2F69 A;  3CCV T;  5HK0 A;  3CCR T;  2E70 A;  1YIT T;  1BIA A;  1AWW A;  3QG1 A;  2Z0W A;  3F70 A;  2LJ3 A;  1Q86 U;  3OS1 A;  3EGX B;  2VC8 A;  1VQ4 A;  1LNX A;  3OYA A;  4FT2 A;  2Y4Y A;  5LJ5 e;  4M75 F;  2KEA A;  4XTX A;  1QWE A;  3TCJ A;  2FZC B;  3JCM g;  2V8I A;  3QZ9 B;  2DBK A;  2EQK A;  3JSC A;  2P4T A;  2P0P A;  1OYX A;  2YT6 A;  1YJ9 T;  5GAM f;  4M7A G;  3CCE A;  1NJI R;  2HZY A;  2CP2 A;  1X75 C;  4ESR A;  2XK0 A;  4C92 G;  1R77 A;  5IT9 E;  1UGV A;  4BY6 B;  4ATO A;  3OW2 A;  2MI6 A;  4E7Z A;  2EQJ A;  3TSZ A;  1Z9Q A;  1BBZ A;  2YDL A;  5HCK A;  1X2K A;  2FZG B;  2JZ2 A;  1Q82 U;  3NTK A;  2DK3 A;  4QKU A;  1YJN Q;  3QKJ A;  4J9D A;  5CIU A;  2DEQ A;  3JCM X;  5CO7 A;  4MDW A;  1I5L A;  3P8B B;  3OW2 P;  3H9N A;  1SSH A;  3FLG A;  4OB1 B;  3CCS T;  4M7D G;  2J6F A;  5LJ3 h;  1XOV A;  4HCK A;  1FMV A;  5FW9 A;  1QVP A;  2ROT A;  2HKN A;  2F5K A;  5J26 A;  3LGL A;  2XDP A;  1OQK A;  4PFZ A;  1F1B B;  2K4Y A;  2KR3 A;  3FJP A;  3C12 A;  1A0N B;  2OTJ Q;  3R6O A;  1YNZ A;  3FJ5 A;  4M77 G;  3V8L A;  3PE0 A;  1VOM A;  1KFZ A;  1K0X A;  2PVO B;  2XMF A;  2JTM A;  3L2Z A;  2DEU A;  4XK8 E;  2AT1 B;  2CYZ B;  2O4X B;  1PD0 A;  2P84 A;  2C0O A;  5GAN 4;  1ZLM A;  1FX7 A;  3CBM A;  1WXT A;  2D0N A;  4EPC A;  4E6R A;  1Q86 C;  1M1K R;  2J7I A;  4FYV B;  1AT1 B;  3A5Z B;  3CCU Q;  2CDT A;  2OTJ T;  2BUD A;  1TSF A;  1SG5 A;  4PJO E;  2AKL A;  3X25 B;  1PRM C;  2O88 A;  2K9G A;  3EH2 A;  2O2O A;  3CCJ T;  5CKH A;  1HXD A;  4IUR A;  3NGP A;  1JEG A;  2L0A A;  1JRI A;  1EFN A;  5L8R E;  2CGH A;  1VQN Q;  1OUL A;  4D8D A;  2FPF A;  2DD5 A;  2FL7 A;  4OMQ A;  2DZC A;  1MND A;  1YWO A;  2F2V A;  4KT0 E;  4RMO A;  2KYM A;  1QLY A;  1RLQ C;  1U1T A;  1U5S A;  2EPD A;  4FW1 A;  1C0M A;  1Q82 C;  5GAM h;  3DLM A;  2C06 A;  2EYW A;  2QQS A;  5DY9 A;  5DLO A;  4KH0 B;  5KYX B;  1IRX A;  1PSF A;  3I55 T;  4F7U F;  2LZ6 B;  4ANJ A;  4C8Q E;  2YHT A;  2ZPF B;  2XDB A;  3FEO A;  3JB9 F;  5GAN h;  1D3B B;  2VV5 A;  4J9F A;  1SPK A;  1S1N A;  2K57 A;  4J6X A;  5FWB A;  1RAB B;  3PNW C;  3KFV A;  5LJ5 h;  1D0Y A;  4M75 G;  1PHT A;  5CAI A;  3SFM A;  4E2F B;  3GPL A;  4ORZ A;  2K3B A;  4PJO B;  2JTE A;  3PGG A;  2L5Q A;  1YIT A;  2V1Q A;  1Z9Z A;  2LDM A;  1TUG B;  4EDU A;  1OX9 A;  3CCL T;  4BY6 C;  2HQH A;  4FSS A;  4JS5 A;  2RPN A;  5LJ3 j;  1MV0 B;  4GY5 A;  1LOJ A;  5GAM g;  2RA2 A;  4LDU A;  1GCP A;  1YJ9 A;  1XJW B;  3NTI A;  4M78 A;  3L42 A;  1QCO A;  2DTI A;  4HVW A;  2DX1 A;  2KY9 A;  2YLB A;  5L23 A;  1LVK A;  3UWN A;  4C8Q B;  2EW3 A;  4FU6 A;  3HRT A;  3WVE B;  1J3T A;  4JUV A;  1OPL A;  2QAZ A;  4A53 A;  1M5Q 1;  1RAC B;  2E65 A;  2YRC A;  5CQY A;  5IN1 A;  2DKG A;  1G3S A;  1VYV A;  3E1S A;  1C1A A;  2KRS A;  4C0Z A;  3M5A A;  3O5Z A;  2A08 A;  4NL3 A;  3QUI A;  5FU6 B;  1NJI U;  3OA6 A;  4AMC A;  3QXE B;  3CCS A;  3SWN A;  3OYL A;  3H8Z A;  1NBE B;  3D7S B;  1PNJ A;  4RTY A;  3QII A;  3JCM b;  1B07 A;  1AWX A;  4PNO A;  3GLX A;  2F2X A;  3E9F A;  3CCM T;  4O5V A;  1BU1 A;  1VQL Q;  2K5I A;  1H3H A;  2JOY A;  2RI5 A;  4DOW A;  2MCN A;  2QG9 B;  1UGQ B;  4J9H A;  1YI2 Q;  1C6V X;  2M9U A;  1GXI E;  2X51 A;  2GF7 A;  5GAM j;  5I22 A;  4WF2 A;  3M57 A;  2WAC A;  1ABO A;  3TQ7 P;  1IZ6 A;  3OYD A;  2L2P A;  5GMK h;  2DAQ A;  1VQL T;  2EKH A;  2DYB A;  1WHJ A;  1AZE A;  3MKD A;  2KT8 A;  2E6Z A;  1SSF A;  3CCJ A;  2ABL A;  4QQ6 A;  2PU9 B;  4M7A A;  2ZCF B;  4B6M A;  1K73 R;  2I0N A;  4F7U G;  3JCM Q;  2FPD A;  2QK0 A;  4C92 A;  2ATC B;  3VKI A;  1T0H A;  1HJD A;  3RBB B;  2XU8 A;  2OAW A;  3HTR A;  1P92 A;  2VYT A;  2LCL A;  4A4H A;  2QA4 A;  2LJ1 A;  3ULR B;  1ZBJ A;  1NJI C;  1UTI A;  1WX6 A;  3I55 A;  3HRS A;  2BZX A;  1AHJ B;  3UAT A;  2FG0 A;  1VQP A;  1N8R R;  4PJO C;  1NYG A;  4OML A;  3VYH B;  3INZ A;  5EG2 A;  1RI0 A;  3SEM A;  3VRY A;  1WQ7 A;  1YWP A;  5CK9 A;  1VQ5 Q;  4E7S A;  2DPP B;  2FHD A;  2YLC A;  1H8K A;  1SRL A;  3JAM E;  5FRO A;  3PTA A;  1E7O A;  4M77 A;  1IRE B;  1MMN A;  3X26 B;  1VQ4 Q;  1UGR B;  4IUU A;  3REB B;  1WHH A;  4WTO B;  3JCM e;  1VQO T;  1GBR A;  3UPU A;  2ZGW A;  1WFW A;  3OYF A;  2HCK A;  2QEX Q;  1M27 C;  3CCE Q;  1OEB A;  3CCL A;  3EG3 A;  1VQ5 T;  3EFS A;  1K8A R;  2EQU A;  5KE2 A;  4C8Q C;  5KE3 A;  1G83 A;  2E1H A;  3HHT B;  1I0C A;  4FCY A;  4IIO A;  4CI0 C;  3VS0 A;  2KDS A;  4ZTF A;  1VQ4 T;  2DNU A;  2JS0 A;  3L2V A;  1QVG A;  2K5F A;  1NG2 A;  2OJ2 A;  2OTL T;  4QT7 A;  1ZA2 B;  5FU6 C;  2LX7 A;  2RO0 A;  3A8L B;  2QAS A;  1Y0M A;  4DEY A;  4JJN K;  3TRE A;  3OYE A;  4BB7 A;  2KAF A;  1X6G A;  2QTV A;  5IXF A;  3G6E A;  2LQ8 A;  4F16 A;  1JQQ A;  3M0T A;  4R55 A;  2X3W D;  2YUQ A;  3CMA A;  4XU3 A;  3EG1 A;  1R0C B;  2CUD A;  3M0S A;  4A4G A;  2ZPI B;  4PKC C;  2LQN A;  3TVT A;  2E5K A;  1KHC A;  4PLI A;  3EAE A;  4K11 A;  1QKX A;  5GAN d;  5FU7 B;  2FPE A;  2WSF E;  1BB9 A;  2CP3 A;  4OB3 B;  3G4S T;  5LJ5 d;  1G8X A;  5CQX A;  1M1G A;  2RJF A;  3V8J A;  3CCM A;  3M59 A;  4J9I A;  3AT1 B;  2DTH A;  3PVQ A;  1RAE B;  2KT1 A;  2DO3 A;  4DEX A;  2EYX A;  2BIV A;  4FSX A;  4HT8 A;  1UG1 A;  1NEG A;  3UF4 A;  1Q95 G;  4IIM A;  4ME7 A;  2JXB A;  4UC4 A;  1RAI B;  3GF5 A;  3G1J A;  2JW4 A;  2BZY A;  1PRL C;  4OMO A;  1OZ3 A;  2KQW A;  4MDX A;  1QQJ A;  2RJC A;  2JVV A;  2AIR B;  1R8O B;  1OPK A;  4OVA A;  3ZBD A;  2KXD A;  3VV0 A;  3CPW S;  3CPF A;  4HA8 A;  4FYY B;  2PNI A;  5GAO p;  1AZG B;  5GAN 2;  1BCM A;  2XI9 A;  6AT1 B;  2YRV A;  1PWT A;  2OX7 A;  1QVF S;  2W10 A;  3REA B;  5M9O A;  3PIO A;  2NWM A;  1ZUU A;  1M90 R;  1N9R A;  3CCQ A;  3JCM h;  4LDV A;  2FYK A;  4MZM A;  4N0A A;  4EMH A;  2A28 A;  2XG8 D;  2DL3 A;  3JB9 I;  4HCB A;  2JTF A;  4YTL A;  1VYU A;  1WIE A;  2EQI A;  5GAN 5;  2HQX A;  3CCR Q;  2NUT A;  1YIT Q;  3QBY A;  2EGA A;  1YJW A;  2K6D A;  5KCO A;  2RJD A;  2BE9 B;  1Q81 R;  1Y71 A;  3ZL7 C;  1R0B G;  1VQO A;  2JM9 A;  3MO8 A;  1JXM A;  2X3X D;  4OMM A;  1N8R U;  3GP8 A;  3JRZ A;  1PC0 A;  1MGQ A;  4QVZ A;  3MEA A;  1WQW A;  1IGU A;  4OGC A;  2E41 A;  1YJ9 Q;  5CR2 A;  1FWZ A;  4PJN A;  3CEY A;  3SWN B;  4M4Z A;  5J39 A;  1W70 A;  4JDS A;  1RAD B;  2AHJ B;  2QTX A;  1WJS A;  1N5Z A;  2XIC A;  2QDL A;  4BUG A;  1CKB A;  2HSP A;  2VGN A;  2OTL A;  1G3Y A;  2D8H A;  2DD4 A;  4Y91 A;  1TG0 A;  4PJO F;  4F7U A;  2XID A;  3JB9 J;  1VQK T;  2LQW A;  2X4W A;  2JM8 A;  1VIE A;  2K7A A;  1BI3 A;  2RQR A;  5FU7 C;  3CCS Q;  1K8A U;  5FLX E;  4J9E A;  3UA6 A;  8AT1 B;  2RNA A;  2RQU A;  4XTV A;  3GIB A;  1LCK A;  3O8V A;  2CZ0 B;  2IPO B;  1ZHI A;  1UHC A;  1K73 C;  3QSU A;  2QQA A;  2COY A;  2LX9 A;  1WXB A;  3V8K A;  3JCM W;  3S3N A;  3URG A;  1SHF A;  2EYY A;  1S72 A;  3EH1 A;  3G4S A;  2CT4 A;  3BW1 A;  4C8Q F;  5FRM A;  2LMJ A;  2MPX C;  1N9S A;  4JJC A;  1D1B A;  1X6O A;  4JRP A;  5A2Q E;  1UFF A;  1M2O A;  3EFO A;  5ECA A;  2D1X A;  1YHQ A;  1N8R C;  2DXT A;  3VRZ A;  4PL6 A;  4C5H A;  1KG1 A;  4J9C A;  2HSE B;  3CCJ Q;  1FMW A;  2YUP A;  3CD6 A;  3CXC S;  1JJ2 A;  3QYH B;  2ED1 A;  5GAO n;  2L3Q A;  1Y07 A;  2MK5 A;  3IQL A;  4DBQ A;  4QVD A;  2F1L A;  1VA7 A;  4HT9 A;  1AWO A;  4FYW B;  4NS5 A;  3TSW A;  4JLG A;  5AT1 B;  1ZUY A;  2QA4 Q;  1JJ2 P;  2DFU A;  1OU9 A;  1XNI A;  4LN2 A;  1W4S A;  3OS2 A;  3H0F A;  3I55 Q;  1K8A C;  2E12 A;  5FWC A;  3GBQ A;  4BI4 A;  1KJW A;  4J8O A;  3C95 A;  3UA7 A;  2IIM A;  3MPU B;  2QQR A;  1DJ7 B;  2RQT A;  4KGV B;  4E7L A;  3EGD B;  4EMK C;  5EC7 A;  4BI8 B;  3TEE A;  1ZUK A;  2P0Q A;  4FW2 A;  2QA4 T;  2IG0 A;  3OYG A;  2AK5 A;  2RD1 A;  2DER A;  3CC2 A;  3OW2 S;  2HMA A;  5GJV B;  1NLO C;  1VQP T;  1MV3 A;  4AG2 C;  1AWJ A;  1OV3 A;  4CRI A;  1UGP B;  3BDU A;  3C94 A;  3SWN C;  1WHK A;  3RR6 A;  1M90 U;  5CCA A;  4LDX A;  2KRO A;  2KSS A;  1FYN A;  3CCL Q;  3QDF A;  1ZA1 B;  2VAS A;  4Z89 A;  1RI9 A;  3CME A;  4Z8A A;  3THK A;  3FB9 A;  2COZ A;  4PJO G;  1KQS A;  1W2B A;  2XHC A;  3QDR B;  1SKU B;  1M2V A;  4RTZ A;  3RKW A;  5IH2 A;  4KUI A;  2K2V A;  3MP6 A;  2J05 A;  1Y96 A;  1Q81 U;  4II1 A;  1X27 A;  1Y7X A;  3SDZ A;  3UT1 A;  1KQS P;  2EAY A;  1W2B P;  3M54 A;  3VUB A;  3G6E Q;  1ARK A;  4RCB A;  5D6X A;  5KYW A;  3QWY A;  3CMA Q;  5IAY A;  2GBQ A;  1VQK A;  3M53 A;  2DL8 A;  2D8J A;  1JO8 A;  3M55 A;  2HL5 C;  4C8Q G;  2QQB A;  4JS4 A;  1IHW A;  1GFC A;  4FM4 B;  4FIB A;  1BI0 A;  1U06 A;  3CCM Q;  3QHS A;  4JRK A;  1IGQ A;  2MIO A;  3I5S A;  1SEM A;  1GL5 A;  3G6E T;  4ZGJ B;  2FB7 A;  4KBM B;  2J6K A;  3CMA T;  1UE9 A;  3V7C A;  3BDL A;  2NUP B;  2RQV A;  4LUD A;  2K3Y A;  1U1S A;  4R56 A;  3OSS C;  8ATC B;  4C5I A;  4J6W A;  1D09 B;  2K79 A;  3GNF B;  3MEU A;  1M90 C;  2LC4 A;  3GOX A;  3PMT A;  1QW1 A;  1TOV A;  2RM4 A;  2A37 A;  2C0T A;  2C0I A;  2V8J A;  3GNG A;  1UB4 A;  2CZ7 B;  3OS0 A;  3MCA B;  4CC3 A;  4M78 D;  1G5V A;  3DLL A;  2HDA A;  4L5G A;  4DBH A;  4LDY A;  2FZK B;  2DJQ A;  4KGX B;  4XAX B;  2DA9 A;  3LH0 A;  1Q81 C;  1K9A A;  3EGX A;  3EHR A;  2CZ6 B;  1NPP A;  1AOJ A;  4TVR A;  2NUT B;  2YSQ A;  1NM7 A;  5LL6 S;  1AVZ C;  4LDW A;  4WCI A;  3C4S A;  3HRU A;  4FT4 A;  1QMC A;  2DIL A;  2DE0 X;  1E6G A;  4N4H A;  4ZN1 A;  1D1C A;  2PVD B;  1W6X A;  4X9D A;  2KRM A;  2KVQ G;  3RMS A;  4LXC A;  5GAN 3;  1PSE A;  4QVC A;  3I5R A;  2QYZ A;  1M1K U;  2VB6 A;  5I2M A;  2DVE A;  5A0G A;  1X6B A;  2CUB A;  3CC4 T;  1YJW Q;  2K3X A;  2VXF A;  3EG9 A;  2LNH B;  1YIJ T;  5LJ3 d;  1TS9 A;  3VS5 A;  1VQO Q;  3ASK A;  3CCQ T;  1ABQ A;  1KD1 R;  2V26 A;  3T9N A;  4M7D A;  2NYS A;  5CKD A;  1BYM A;  4RCC A;  4O6J A;  1HSQ A;  2ZAE A;  4MZP A;  2GTJ A;  3H0H A;  1VQM T;  3L2U A;  3L2R A;  1BI2 A;  3QZ5 B;  2QI2 A;  4J7F A;  1WDX A;  2LT4 A;  4IUV A;  1M8M A;  2CSI A;  2K5L A;  1YJW T;  2JUF A;  2DBM A;  4N4I A;  2KE9 A;  2FRY A;  3QPH A;  4C5G A;  3HPW A;  2CT3 A;  3DB4 A;  4M7A D;  4NOY A;  5GAN 8;  4DBF A;  2XDD A;  3HL8 A;  2OTL Q;  2ZPG B;  1VQN A;  1UJY A;  4A63 B;  4C92 D;  2YUO A;  3I56 T;  3VS6 A;  5D7U A;  4MML A;  2CKK A;  4IUT A;  2PQW A;  1RLP C;  3A8G B;  4M7D D;  1XQH A;  1VQ9 A;  3EFO B;  2NUZ A;  4ELY C;  4HKE A;  7AT1 B;  4PFP A;  3S3M A;  1K76 A;  1H64 1;  1PG5 B;  1S72 Q;  1M1K C;  5KCH A;  3G4S Q;  5GAM d;  1HD3 A;  1PKS A;  5IHN A;  4N4G A;  4M77 D;  2ESW A;  4OF1 A;  1YFN A;  4Z88 A;  1G2B A;  1QVG P;  2GGR A;  1M3A A;  4D8K A;  2EQM A;  5I11 A;  3MHX A;  1RAF B;  4F17 A;  1BK2 A;  5KYY A;  1YHQ Q;  1I07 A; 
#chains in the Genus database with same CATH homology
 3CEY A;  3ME9 A;  3SWN B;  2DZC A;  4KT0 E;  1KHI A;  4RMO A;  5A0L A;  1U1T A;  5J39 A;  4DA4 A;  4EMG A;  1Q82 C;  4JDS A;  2AHJ B;  5GAM h;  2QTX A;  3OYI A;  1WJS A;  3DLM A;  2C06 A;  2XIC A;  1S72 T;  3UDC A;  4BUG A;  3G71 T;  2QQS A;  1I4K 1;  5DY9 A;  2D0Q B;  4XU1 A;  5DLO A;  3KUF A;  3EFR A;  2PUK B;  2VGN A;  3CBP A;  4RG8 A;  4E7J A;  4IUP A;  2OTL A;  4KUD K;  3I55 T;  1PSF A;  1M1F A;  1G3Y A;  4F7U F;  2DD4 A;  4Y91 A;  4PJO F;  3OB9 A;  4C8Q E;  2YHT A;  4F7U A;  2XID A;  3OYM A;  2ZPF B;  2LRQ A;  3JB9 J;  4M75 A;  1VQK T;  2XDB A;  4PJO A;  2X4W A;  2OTJ A;  5GAO m;  5GAO r;  2RHY A;  1VIE A;  3HKS A;  2R5A A;  3FEO A;  2RK2 A;  5GAN 6;  3JB9 F;  1BI3 A;  1M9S A;  1D3B B;  5GAN h;  1V29 B;  2VV5 A;  4JLI A;  5FU7 C;  2XD0 A;  2NLU A;  1G3T A;  1YHQ T;  2LCC A;  1K8A U;  4J7I A;  1I8F A;  3E9G A;  3P8H A;  4LD6 A;  2E64 A;  2K57 A;  2LTO A;  4J6X A;  4M78 E;  5FLX E;  2F5T X;  5GAN j;  3PNW C;  5LJ5 h;  3J7A F;  2EFI A;  4M75 G;  4XTV A;  3GIB A;  1YI2 T;  1WJQ A;  5CAI A;  1HK9 A;  3SFM A;  3O8V A;  4B9W A;  2CZ0 B;  3CD6 T;  3GPL A;  5LJ5 j;  1WPY A;  3M4G A;  2EKO A;  1ZHI A;  4XQ3 A;  4F7U B;  4Q5W A;  3JB9 G;  4PJO B;  1M8V A;  2CZ1 B;  1K73 C;  3QSU A;  2LNV A;  2QQA A;  3PGG A;  2L5Q A;  4OMF B;  1YIT A;  4IKF A;  2LX9 A;  4NL2 A;  3OYK A;  3QJY A;  1KC8 U;  3CCU A;  3V8K A;  3JCM W;  3S3N A;  3URG A;  1S72 A;  3NFC A;  3NTH A;  2LDM A;  3DB3 A;  1B34 B;  2WSC E;  3G4S A;  4EDU A;  3G71 A;  1U8R A;  3BW1 A;  2E6N A;  2E5Q A;  3CCL T;  2DIQ A;  4C8Q F;  5FRM A;  4BY6 C;  4C8Q A;  4PLL A;  3QO3 A;  1N9S A;  1BIB A;  4JS5 A;  2L8D A;  2O4X A;  1N6A A;  1X6O A;  5LJ3 j;  4JRP A;  5A2Q E;  4M75 C;  2I2L A;  4QW2 A;  5I21 A;  4GY5 A;  1LOJ A;  3L2W A;  5GAM g;  2RA2 A;  4LDU A;  2WSE E;  4XTZ A;  3CC4 A;  1YJ9 A;  4M75 D;  4M78 F;  3MP8 A;  3PFS A;  1Y96 B;  3NTI A;  1YHQ A;  1QVG S;  1N8R C;  2DXT A;  4M78 A;  3L42 A;  4Y28 E;  2DTI A;  2PUO B;  4PL6 A;  4RKU E;  2EYQ A;  4KUL A;  4MZT A;  5CKE A;  3QYG B;  4C5H A;  4E7H A;  5CKB A;  2MF2 A;  3J81 E;  1YIJ A;  1KG1 A;  2KY9 A;  4P5N A;  4E7K A;  2HQE A;  2YLB A;  3MET A;  3TU4 K;  3SD4 A;  3RIR A;  3UWN A;  4C8Q B;  3M58 A;  4FU6 A;  3HRT A;  3WVE B;  3MEW A;  3CD6 A;  2LVM A;  1K73 U;  5HY6 A;  4C0D B;  4JUV A;  3CXC S;  1JJ2 A;  3QYH B;  4ZGD B;  2CS7 A;  2X35 A;  5GAO n;  4A53 A;  3MEV A;  1M5Q 1;  2E65 A;  5GAO q;  1Y07 A;  4XTY A;  5CQY A;  5IN1 A;  2ZPH B;  2DKG A;  1G3S A;  1VQM A;  2DTO A;  3AHU A;  3E1S A;  5GAO l;  1WJR A;  4C0Z A;  3CC2 T;  3PT9 A;  2X4X A;  4M78 B;  4QVD A;  3M5A A;  3M4Y A;  3S6W A;  4V2S A;  4NL3 A;  4HT9 A;  3QUI A;  5FU6 B;  1NJI U;  4NS5 A;  3OA6 A;  3OMC A;  3QXE B;  3ZEH A;  3OYY A;  3CCS A;  2HAX A;  3SWN A;  3OYL A;  1VQ7 A;  4A54 A;  4D6W A;  4JLG A;  3H8Z A;  3JCM b;  3QII A;  1XNI A;  3RER A;  1QP3 A;  3CPW A;  2DXU A;  4PNO A;  4FL6 A;  3GLX A;  1W4S A;  3OS2 A;  3OYH A;  1KD1 U;  3E9F A;  3KXT A;  2GQV A;  4IUQ A;  2GFA A;  1K8A C;  2E12 A;  3CCM T;  3CME T;  4O5V A;  4BI4 A;  1QVF A;  4J8O A;  4M7A E;  3C95 A;  3BFM A;  2ZPE B;  2K5I A;  2JOY A;  3I56 A;  2RI5 A;  4A4E A;  4A4F A;  4DOW A;  2ZZD A;  3JB9 H;  1NE8 A;  2QQR A;  3OSV A;  4C92 E;  2RH2 A;  1DJ7 B;  3G7Z A;  3HSB A;  3JCM f;  1X01 A;  2MAM A;  3VYG A;  5CKF A;  2X4Y A;  1D3B A;  3M56 A;  3RKY A;  1UGQ B;  3VJP A;  4ELZ C;  4EMK C;  2QEX T;  4E7L A;  3CCE T;  1VQ6 T;  1ZBX A;  4BI8 B;  1ZQ1 A;  3JCM V;  3TEE A;  2M9U A;  2P0Q A;  2QA4 T;  4N0A C;  1KC8 C;  2HNI A;  3VUZ A;  2M0O A;  5GMK i;  2IG0 A;  1GXI E;  2GF7 A;  4L6V 5;  5GAM j;  2RD1 A;  1RL2 A;  3OYG A;  3WXM B;  2IVW A;  3CC2 A;  1NPR A;  1G3W A;  3LLR A;  3A8O B;  2WAC A;  3M57 A;  4WF2 A;  3OW2 S;  1IZ6 A;  2QDY B;  1VQP T;  3OYD A;  2RJE A;  4M7D E;  4CRI A;  1UGP B;  3BDU A;  5GMK h;  2DAQ A;  3C94 A;  1VQL T;  3SWN C;  1XTD A;  1M90 U;  2VUB A;  5CCA A;  4LDX A;  2KSS A;  3RMQ A;  5GMK j;  3X28 B;  2RHU A;  2E6Z A;  5GAN e;  1SSF A;  2OAU A;  4OGE A;  3CCJ A;  4QQ6 A;  4E7I A;  1B34 A;  4M7A F;  2PU9 B;  3M9Q A;  4M7A A;  2ZCF B;  3OYB A;  3CME A;  3FB9 A;  5CVI A;  5DLQ E;  4F7U G;  3JCM Q;  1TH7 A;  5AYF A;  4PJO G;  3PIP A;  1KQS A;  2Y4X A;  2XHC A;  4M77 E;  4C92 F;  4MMK A;  3X24 B;  3QDR B;  4DQ2 A;  1W2B A;  4LD9 K;  4C92 A;  5HKC A;  3VKI A;  2R58 A;  3H6Z A;  1YCY A;  3RKW A;  2R5M A;  2X4J A;  2XU8 A;  4BD3 A;  4KUI A;  3J80 E;  4C0F A;  2QEX A;  2K2V A;  1P92 A;  2VYT A;  2RK1 A;  3MP6 A;  3RES A;  1Y96 A;  3OYC A;  1Q81 U;  2EWN A;  3PMI A;  2LCL A;  4A4H A;  4II1 A;  3UT1 A;  1Y7X A;  2L89 A;  3SDZ A;  2QA4 A;  4OB0 B;  2EAY A;  2GFU A;  4M7A B;  1Q7Y U;  2EJF A;  3WVD B;  1WGS A;  3M54 A;  3VUB A;  4BDY A;  1NJI C;  4M7D F;  3RKX A;  4RCB A;  3I55 A;  3HRS A;  1AHJ B;  1I81 A;  4J6Y A;  1OZ2 A;  3OMG A;  5D6X A;  1BI1 A;  5LJ3 e;  4C92 B;  1VQP A;  3LWH A;  2R57 A;  5IAY A;  1VQK A;  2MWP A;  4GLK A;  3M53 A;  3HFN A;  1VQL A;  4PJO C;  1VQ8 T;  5GAN f;  3ER0 A;  3E19 A;  3VYH B;  4ZGE B;  3INZ A;  3HFO A;  1KD1 C;  4XU0 A;  3M55 A;  2A7Y A;  5EG2 A;  1RI0 A;  3X20 B;  4PJO D;  1WQ7 A;  2RB6 A;  5CK9 A;  2MWO A;  3V7R A;  3VU3 C;  2DJZ A;  2DPP B;  2RI3 A;  4C8Q G;  2FHD A;  2QQB A;  2RHZ A;  2YLC A;  4M77 F;  5LJ5 f;  3JAM E;  3JCM c;  4JS4 A;  5FRO A;  3JB9 D;  3PTA A;  2JNG A;  4FM4 B;  4M77 A;  4ZTJ A;  2D6F A;  4FIB A;  1BI0 A;  2H3J A;  1YI2 A;  1K9M U;  1O9S A;  4XU2 A;  4BDZ A;  5D6Y A;  1IRE B;  3X26 B;  3QHS A;  1UGR B;  4JRK A;  4M7D B;  3L1A A;  4IUU A;  1NZ9 A;  3MP1 A;  5A0D A;  2A3L A;  3JCM e;  3G6E T;  1VQO T;  2HD0 A;  3LWI A;  4M78 G;  2FB7 A;  4ZGJ B;  4B9X A;  2D9T A;  4KBM B;  3CMA T;  3V7C A;  1FXX A;  3OBW A;  3BDL A;  3OYN A;  3UPU A;  2ZGW A;  3OYF A;  1YJN T;  2K3Y A;  1U1S A;  4R56 A;  3OSS C;  2JN0 A;  5LJ3 f;  1JB0 E;  2MMP A;  4C5I A;  3CCL A;  4VUB A;  4M77 B;  1VQ5 T;  3JCM J;  3EFS A;  3FIF A;  2BKD N;  2VGM A;  2EQU A;  4J6W A;  4C8Q C;  5KE2 A;  3GNF B;  1JBM A;  2ZPB B;  3MEU A;  3OS5 A;  4ZN3 A;  5KE3 A;  3OYJ A;  1M90 C;  3CC7 T;  3CBO A;  2LC4 A;  4C0D C;  3A8H B;  2E1H A;  3GOX A;  3HHT B;  2KMT A;  4C8Q D;  3PMT A;  1QW1 A;  1VQ8 A;  2RM4 A;  4CI0 C;  4HCZ A;  2KDS A;  4ZTF A;  2RI2 A;  3A8M B;  1O75 A;  3OY9 A;  1VQ4 T;  3QJ6 A;  3L2V A;  1QVG A;  2FVU A;  1EIF A;  2K5F A;  2QXF A;  2L3R A;  2V8J A;  3GNG A;  4BE1 A;  2OTL T;  1UB4 A;  2CZ7 B;  4M78 C;  3OS0 A;  3Q1J A;  3MCA B;  3V7S A;  5FU6 C;  2B8A A;  4RG2 A;  1VIF A;  4M78 D;  1G5V A;  2RO0 A;  3A8L B;  4L59 A;  2M1H A;  4M75 E;  4JJN K;  3TRE A;  3DLL A;  4EMK B;  3OYE A;  3JCM P;  4L5G A;  4LDY A;  5HK3 A;  2G3R A;  4BB7 A;  2KAF A;  3CXC A;  2HBP A;  3G6E A;  2GCX A;  2LQ8 A;  3LYI A;  1OI1 A;  4XAX B;  3LH0 A;  4C0G A;  4R55 A;  1Q81 C;  1QP2 A;  5GAM e;  3CMA A;  3BY7 A;  4XU3 A;  2CZ6 B;  5C0M A;  3FC3 A;  1MHN A;  1NPP A;  4A4G A;  4J5Y A;  2ZPI B;  1Q7Y C;  1UEB A;  4TVR A;  4PKC C;  5LJ3 g;  2DXC A;  3FDR A;  4HCC A;  5LL6 S;  4LDW A;  1KHC A;  4PLI A;  1VQ7 T;  1VQ5 A;  5KH6 A;  3C4S A;  2F69 A;  3EAE A;  3HRU A;  5HK0 A;  5GAN d;  3CCR T;  4FT4 A;  2E70 A;  3CCV T;  5D6W A;  1YIT T;  5FU7 B;  1N27 A;  4DOV A;  4OP0 A;  5GMK e;  5GMK m;  3CC7 A;  4N4H A;  3CCU T;  2PVG B;  1BIA A;  2WSF E;  4ZN1 A;  3QG1 A;  3F70 A;  4OB3 B;  1Q86 U;  2PVD B;  3G4S T;  3OS1 A;  5LJ5 d;  5CQX A;  1M1G A;  2RJF A;  3V8J A;  2VC8 A;  4X9D A;  3CCM A;  1LNX A;  2KVQ G;  3S3O A;  1VQ4 A;  3OYA A;  2EJG A;  3M59 A;  3RMS A;  1VUB A;  5GAN 3;  1PSE A;  4FT2 A;  2Y4Y A;  4QVC A;  4XTU A;  5LJ5 e;  2DTH A;  3HP9 A;  4M75 F;  4XTX A;  4C5E A;  5J3B A;  1M1K U;  3TCJ A;  4A4K A;  2DO3 A;  5I2M A;  3JCM g;  2V8I A;  3QZ9 B;  1K9M C;  4XTW A;  2DVE A;  5A0G A;  1KQ1 A;  2EQK A;  1VQN T;  3JSC A;  2P4T A;  2LQK A;  2P0P A;  1OYX A;  3CC4 T;  1YJ9 T;  5GAM f;  2K3X A;  4J83 A;  4M7A G;  1VQ6 A;  3CCE A;  1M4Z A;  2BIV A;  4FSX A;  4HT8 A;  1X75 C;  2VXF A;  3FRN A;  4E47 A;  1YIJ T;  5LJ3 d;  2XK0 A;  4C92 G;  3SB2 A;  5IT9 E;  4ATO A;  4BY6 B;  3OW2 A;  2MI6 A;  3ASK A;  3CCQ T;  2EQJ A;  4BE0 A;  3T9N A;  4ME7 A;  4M7D A;  4UC4 A;  2DZ9 A;  5CKD A;  1BYM A;  3GF5 A;  4M75 B;  2VXE A;  1JJ2 S;  2JZ2 A;  4RCC A;  4O6J A;  3NTK A;  2DK3 A;  1Q82 U;  3CCV A;  3CCR A;  4JRQ A;  4MZP A;  3QKJ A;  1OZ3 A;  2KQW A;  4MDX A;  1VQM T;  5CIU A;  4JRI A;  2DEQ A;  4X34 A;  3L2U A;  1VQ9 T;  3JCM X;  3L2R A;  2RJC A;  2RHI A;  5CO7 A;  1BI2 A;  3QZ5 B;  4MDW A;  1I5L A;  2QI2 A;  4J7F A;  2JVV A;  2QQ9 A;  3LX7 A;  3P8B B;  2LT4 A;  4IUV A;  2K5L A;  3FLG A;  4OB1 B;  1YJW T;  1R8O B;  3CCS T;  2JUF A;  2XKO C;  3OQ5 A;  2V8K A;  4N4I A;  4OVA A;  5LJ3 h;  4M7A C;  4M7D G;  1XOV A;  4C5G A;  3QPH A;  5I2S A;  3JCM d;  3HPW A;  4X9C A;  3ZBD A;  3DB4 A;  4M7A D;  4NOY A;  1QVP A;  3VV0 A;  5GAN 8;  2F5K A;  5J26 A;  3CPW S;  3CPF A;  4C92 C;  3LGL A;  4HA8 A;  3HL8 A;  5GAN 7;  2XDD A;  2XDP A;  2ZPG B;  2K4Y A;  2M16 A;  5GAO p;  1VQN A;  5GAN 2;  4C92 D;  2XI9 A;  3FJP A;  3C12 A;  4QQG A;  2YRV A;  1KQ2 A;  2P0K A;  1QVF S;  3R6O A;  3I56 T;  4M77 G;  2KK4 A;  5M9O A;  2EJ9 A;  3V8L A;  3PIO A;  5GMK l;  3LGF A;  3DKM A;  5FRN A;  2PVO B;  1N9R A;  2E10 A;  2JTM A;  2RHX A;  3L2Z A;  4MML A;  2CKK A;  4OB2 B;  2CYZ B;  2LT1 A;  4XK8 E;  1UGS B;  3CCQ A;  3JCM h;  4EMK A;  4LDV A;  1WNL A;  4IUT A;  2FYK A;  2PQW A;  2O4X B;  4MZM A;  4M7D C;  4N0A A;  5GAN g;  2O01 E;  5GAN 4;  2Y90 A;  3A8G B;  1YBY A;  2DXB A;  1FX7 A;  3KBG A;  3CBM A;  3LW5 E;  4EMH A;  2XG8 D;  5DM7 R;  4M7D D;  3JB9 I;  4HCB A;  3L2Q A;  4EPC A;  2JTF A;  1XQH A;  1VQ9 A;  1Q86 C;  4YTL A;  4QQD A;  4ELY C;  1BKB A;  5GAN 5;  4HKE A;  1LJO A;  2HQX A;  3ZFJ A;  5LJ5 g;  3RUX A;  3QBY A;  3S3M A;  2DIG A;  1YJW A;  3A5Z B;  4BI3 A;  4BE2 A;  2OTJ T;  1H64 1;  5KCO A;  2BUD A;  4F7U E;  4Z02 A;  2RJD A;  3OBY A;  4PJO E;  4M77 C;  1M1K C;  5KCH A;  3P8D A;  3X25 B;  1Y71 A;  5GAM d;  4BAC A;  4N4G A;  4M77 D;  4OF1 A;  1VQO A;  3CCJ T;  5CKH A;  3N5B B;  3MO8 A;  1HXD A;  1N8R U;  4IUR A;  3GP8 A;  5C6S A;  3JRZ A;  2EQM A;  5L8R E;  1JRI A;  1MGQ A;  3MHX A;  1H3Z A;  2CGH A;  2EIF A;  4QVZ A;  1KQS S;  3MEA A;  1W2B S;  1WQW A;  1YJN A;  4OGC A;  2E41 A;  5CR2 A;  1FWZ A;  2DD5 A;  2FL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...