4M75B

Crystal structure of lsm1-7 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
91
structure length
91
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 13
structure length 91
sequence length 91
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75B00
4NL3A 4C8QB 1I8FA 3BW1A 2VXEA 4M7AB 2HNIA 4M77D 4J6WA 3JCMX 1WPYA 5LJ3h 3V8LA 2E1HA 4XTUA 3AHUA 4M78C 4XU3A 5GAOp 5LJ5j 3JCMP 4HT9A 4V2SA 1X01A 3BY7A 5GAMd 4F7UE 1TH7A 4M77A 2DVEA 4M7DB 4QVDA 2RM4A 3VU3C 1H641 4MMKA 4M78F 4C8QD 4C92F 4EMKB 2I2LA 3QUIA 4WF2A 4A54A 1U1TA 3QHSA 5GAOq 5GANg 1I5LA 4J6XA 4M7AD 4M75B 4M77G 4X9CA 3BFMA 4F7UF 2JN0A 5LJ3d 2YHTA 4JRKA 3SB2A 3V8JA 4C8QA 1B34B 5CAIA 1U1SA 4PJOB 1HXDA 4JLIA 1JRIA 2RA2A 3INZA 4JRIA 4MMLA 4M7AA 4M7DD 2DKGA 5GMKj 3V7SA 4C8QG 5GANe 4C92D 4N0AA 3HFNA 3HFOA 4M77E 4M75D 4M7AG 4X9DA 2DTHA 5GAOr 3EFSA 4HT8A 4M7DA 1M8VA 1I81A 3SWNB 4EMKA 2FYKA 1N9SA 2CGHA 3L2ZA 5LJ3f 5LJ5g 3QSUA 2E65A 4PJOD 3JCMg 4J5YA 2VC8A 4M75A 3V7CA 5GAMj 1WQWA 1YCYA 4XTYA 4A53A 1I4K1 4C8QE 2YLCA 1D3BB 4XU2A 4M7AE 4M78B 4J6YA 1B34A 5DY9A 3V7RA 4M75G 3V8KA 2RB6A 2DZ9A 4C92B 4EMHA 4Y91A 2FB7A 3M4GA 5LJ5e 3HSBA 3JB9F 2DJZA 4F7UB 3JCMe 1M5Q1 5LJ3j 2K57A 5GAOl 1WNLA 3QO3A 5GANh 5GAN5 3RESA 2E41A 4XTWA 4DQ2A 3SWNA 1KQ1A 5GAN7 1LNXA 4M78D 2QTXA 4XTZA 4M75E 1WQ7A 3FIFA 2E10A 4PNOA 3RKYA 4M77C 5GMKh 3JB9D 5GMKl 1D3BA 2EJGA 4M78A 4C92A 5GAN6 3JCMb 5GMKe 2RD1A 3FJPA 2DTOA 3RKXA 5GAMg 5GANd 2DXUA 4M77F 5GAN8 4M7DG 4PJOA 3PGGA 1BIAA 2DZCA 4F7UA 1LJOA 4M78G 4C92G 3JCMW 5LJ5h 4RCCA 3RIRA 4C8QC 3JCMQ 2DEQA 2ZGWA 3EFRA 5I21A 3JCMh 1KQ2A 5GAMh 1BIBA 4HA8A 3JCMV 4M7AC 4RCBA 5LJ3g 4C8QF 3RERA 4PJOG 5GAMe 3BDUA 2DTIA 3JB9H 1Y96B 4N0AC 5GAN3 4M7AF 4M7DE 2YLBA 1HK9A 5GAN2 4NL2A 5GANf 4M7DC 4M78E 4C92E 1LOJA 4EMKC 1JBMA 5LJ5d 1MGQA 2E64A 4C92C 2EAYA 4XU0A 5LJ3e 3JCMd 3JCMJ 2DXTA 4M75C 4M7DF 4XTVA 3L1AA 5GAOn 3JB9J 4OP0A 4EMGA 2EJ9A 3JB9I 2Y90A 2VXFA 3RKWA 3RUXA 5GAN4 4PJOE 2EJFA 3FB9A 5GAOm 4M75F 4PJOC 3GIBA 3JCMc 2EWNA 5GANj 4M77B 4QVCA 4JUVA 4XQ3A 4PJOF 1Y96A 4NOYA 5LJ5f 4XU1A 5GMKi 3JCMf 3JB9G 4F7UG 5GAMf 1N9RA 5GMKm 3SWNC 4XTXA
chains in the Genus database with same CATH superfamily
1I8FA 1AVZC 4ELYC 4LN2A 3E19A 4IUVA 2G6FX 2JVVA 4E6RA 2RK2A 1IREB 3H41A 3L2QA 1MMNA 4HCCA 2V8KA 4QW2A 1E7OA 2E12A 2JNGA 2EW3A 2X4WA 2KGTA 3DLMA 2X9HA 3S6WA 1Q7YC 4E7ZA 2D0NA 4YTLA 3ER0A 4GBQA 1ZA2B 2E6NA 5LJ3d 3M0QA 2YHTA 3HKSA 4JRPA 1J3TA 3EGDB 2RH2A 2CSQA 2JXBA 4MMLA 2HMAA 1S1NA 3CC4T 4M77E 4KT0E 2DD4A 3FJ5A 1I81A 1KQSS 5D6YA 2E65A 2AK5A 3CMAQ 1NJIC 5GAMj 4GLKA 1JO8A 2GTOA 2RPNA 3QYGB 1MNEA 8ATCB 5DY9A 3UA6A 2YUQA 4M75G 5J39A 3OW2S 1VYTA 1SEMA 4OB3B 2LRQA 3CCMT 1K8AC 3OBWA 1PSEA 2EBPA 5GANh 2BKDN 2FPEA 2E4HA 3REBB 4M78D 4ANJA 1WQ7A 2COYA 4ZTFA 2E10A 4PNOA 3G6ET 3CCET 1M90C 1VQKA 4M78A 3A8HB 4C0DC 1GBQA 4BD3A 3CEYA 1WHMA 1VQOA 3VS3A 1KC8R 3RBBB 3JCMh 1BK2A 2KRMA 1QWFA 1EIFA 2DTIA 4C0GA 2JT4A 3OYYA 1P92A 2E64A 3QYHB 2MMPA 4F17A 1BYMA 2FEIA 2Y90A 4O5VA 2AIRB 3VYGA 1K0XA 3GIBA 4DA4A 5GANj 5DM7R 2DMOA 3G71Q 1K4US 5LJ5f 1VQLQ 2J6FA 2X4XA 3G1JA 2QA4T 1VQ5T 2DXCA 2L3QA 1KQSP 2L5QA 3P8HA 5D6XA 1ZX6A 3JCMP 2O01E 1OX9A 3OW2P 2AKKA 4M78F 2K2MA 4EDUA 3QHSA 3E9GA 4M77G 2K2VA 4IUUA 2AZSA 2ZZDA 3GOXA 1RABB 3INZA 1K73R 3HTRA 4HVVA 4RTZA 4AT1B 2A37A 5KYWA 2DO3A 4M75D 4RTTA 1YN8A 2D0QB 1AOJA 3IQLA 3SWNB 5L23A 1IHVA 4EMKA 3PVLA 3JRZA 4AG1C 2EQKA 4M75A 3V7CA 2J6KA 2DVJA 4EMHA 3JV3A 2K5FA 3CC7T 3QDFA 4N4IA 1HSQA 4E7LA 2ZPHB 2K57A 2DILA 2M16A 1M8MA 5FU7C 1OULA 5KYXB 2HD0A 1X2QA 1Q7YU 3VRZA 2F69A 3JB9D 4AFQC 1M1KC 1PRLC 2DXUA 1YJNT 1N8RC 4R0KA 1IXDA 2FL7A 4DBFA 1LCKA 2LNVA 1JJ2S 2XKOC 2LCCA 5GAMe 4N4HA 2YLBA 1NJIU 1OQKA 4C92E 2Z0WA 1QCOA 1YCSB 5CQXA 2PNIA 3EH1A 2VXFA 4J8OA 4BACA 3S3MA 1K8AU 4M75F 2DL3A 4A4KA 2HQEA 2EYQA 1IB8A 2EQJA 4F14A 2K79A 1Y71A 2L0AA 1VQPT 1M90U 1M30A 1G3YA 2XICA 4FT4A 6AT1B 1VQNA 4M77D 2RHUA 1OI1A 2BE7D 1YNZA 3KUFA 3AHUA 2QAZA 2ZPBB 4B6MA 3CC4A 3VKIA 4BY6C 3UDCA 2W10A 4M77A 1AWWA 2ENMA 4QVDA 3MP1A 4L59A 1F1BB 3QUIA 2HBWA 2DL4A 2EYYA 3M0PA 3OW2A 1I5OB 1G3WA 4GY5A 4QKUA 1U1SA 2RHXA 2RA2A 2KXCA 1W2BA 5GANe 1WGSA 1KIKA 1RAFB 2HSPA 3EFSA 2HCKA 4PJOD 3DB3A 2GFUA 3G6EA 2YSQA 3CCEA 3U23A 1JJ2P 4TVRA 3WVEB 4ZN1A 4M78B 4PJOA 2L89A 2VGMA 1QKXA 3CMEQ 1ABOA 3JCMe 1V1CA 2H3EB 4CRIA 1M9SA 1IGUA 4KRTA 1JEGA 1QVFS 4B9WA 2QTXA 3P8DA 3I56T 4II1A 2MAMA 1ACMB 2X4JA 4CC3A 2LNHB 3REAB 2A0FB 5GAN8 4M77F 2OTJT 4C5HA 2ECZA 4C92G 4JLGA 4C8QC 2CP7A 1K1ZA 3UATA 4RCBA 5A0LA 4NS5A 2X4YA 4OB0B 2V8JA 1VQ5A 1JBMA 3MEWA 4QQ6A 4RMOA 3CCRA 1VQ9A 4OP0A 1G3TA 3FB9A 3MKDA 3CPWS 3URGA 2EWNA 2MCNA 3R6OA 2LQNA 4JRQA 4PJOF 1UUEA 1RAHB 2QDLA 1NLPC 2BUDA 1X6OA 2RN8A 4KUDK 5GMKm 2HL5C 2JZ2A 2VXEA 4Z88A 1Y0MA 4FCYA 2K5LA 2D1XA 3I55T 2IG0A 2ED1A 1N8RU 2M1HA 2E1HA 5KYWB 2QEXT 2DD5A 5LL6S 4J9IA 3MEVA 4EMKB 3TSWA 3PVQA 1VQMT 5I2SA 4M75B 3I35A 3BFMA 3LGFA 1QVGP 1QVFP 4JRKA 2LJ3A 3MJXA 3CC7A 4DBHA 4D8DA 1VQ4Q 4E2FB 2EIFA 1ZLMA 2OTLQ 1U3OA 2FYKA 3QSUA 1VQ7T 1NBEB 1BB9A 3QDRB 2DIGA 1D09B 5IH2A 4C8QE 4ZGDB 2JUFA 2AHJB 3QXEB 5J26A 1PNJA 3O5ZA 1R77A 1M2OA 3OB9A 2FG0A 2KI7A 3VS1A 4C0FA 2ZPIB 5FWCA 1SHFA 3CPWP 3NFCA 2O4XA 3MP8A 1TUCA 4C92A 1PM3A 2QQAA 3H9NA 2IIMA 5LJ5h 2MI6A 4M7AC 5M9OA 2L3RA 3OS2A 3L2VA 1NZ9A 3CCLQ 4MDWA 1C6VX 1M4ZA 1AZGB 2RQUA 1VQPA 1Q7YR 1WHJA 4AFZC 1K9AA 1S72T 1YHQT 3EHQA 2YUPA 2JM8A 1NEGA 4M77B 1YITQ 2NUPA 2GGRA 1XOVA 3ASKA 1H92A 2BZ8A 1SPKA 4XTXA 1NJIR 1Y7XA 3JCMX 5CKDA 2K3XA 2V8IA 5KYNA 2OJ2A 5LJ5j 1N6AA 3QJ6A 2K3YA 2YRCA 1OYXA 1K8AR 2I0NA 4C92F 1TXQA 2DETA 2DEUA 2A08A 4CC4B 1YJWT 4PJOB 2M0YA 1T3LA 4OMMA 1M90R 4BE1A 3FEOA 3M53A 4C8QG 3P8BB 1QVGA 4RTYA 4EPCA 2WACA 2V26A 2BE9B 3UF4A 3I56A 4RG8A 4MZMA 4M7AE 4J6YA 2MIOA 3CCJT 1JXMA 3X26B 3PFSA 4PLLA 2KBTA 1M5Q1 2A3LA 2XHCA 2K9GA 2DYIA 3G4SQ 1M1GA 3SEMA 2QGGA 3QWXX 4AFUC 3OYFA 3NTKA 4HVUA 1UFFA 2DJQA 3CCVQ 4DBRA 5GAMg 4JDSA 2OX7A 2QYZA 3CC2T 3G7ZA 1IGQA 2QQRA 5FLXE 3ZBDA 4FYVB 2FZGB 5GAN3 3FRNA 1YFNA 5GAN2 3CMAT 1NE8A 4FW2A 1NLOC 4XTVA 3I55A 5GAOn 4LDVA 3LWIA 3C0CA 3RUXA 1E6GA 3S3OA 2QEXA 2CH4W 2BZXA 4JUVA 1C1AA 3CCJQ 4C0DB 4IKFA 3M5AA 1VQMA 1LPLA 1N9RA 2P0QA 4WTOB 2RQWA 4A4EA 2EFIA 3M0TA 4NL3A 3NTIA 4XK8E 4J6WA 1DJ7B 2G3RA 1G8XA 2DE0X 3HRTA 3BY7A 3VYHB 1YJ9T 1TH7A 1AWJA 4C8QD 1R0CB 1VQ7A 2DIQA 5A0DA 4J6XA 5GANg 1BI3A 1NPRA 1VQOQ 3SFMA 2MK5A 4C8QA 4FSXA 1MMGA 4CI0C 3EG2A 1PWTA 1HD3A 1U06A 1N8RR 4M7AG 1PRMC 3HRSA 3OYAA 2VGNA 4CC2A 3HRUA 3A98A 3JCMg 3CCST 3G71T 1YCYA 2O4XB 3OQ5A 2KT1A 3UA7A 4C92B 2CP5A 2LQWA 2HL3A 4PJMA 5LJ5e 4LUEA 1AEYA 1G5VA 2DL5A 4DQ2A 1IZ6A 2RMOA 1GL5A 3UT1A 5FU6C 3CXCA 3FIFA 1GFDA 3H8ZA 4FM4B 5GMKh 2DRMA 1K76A 2A36A 1S72A 2DZCA 1YHQA 2XD0A 1OZ2A 2EPDA 5I21A 3MEUA 2DK3A 3EHRA 4C8QF 2NUPB 3OYLA 2DFUA 3JB9H 1W2BS 2JTEA 1WZOA 4RKUE 2EAYA 2DXTA 3CD6A 1AD5A 1UG1A 2CZ1B 4IUTA 4HXJA 5FU7B 3JB9I 4PJOE 2FVUA 4C5IA 2J06A 2E3IA 3C4SA 3RMSA 3JB9G 5ECAA 2XMFA 3BW1A 1YJWA 2FRYA 4E7HA 1SG5A 1Q81C 4XAXB 4FU6A 1YI2A 4CC7A 1KSWA 1YWOA 2NWMA 3NHNA 4WF2A 1VQ8Q 5GAOq 2L3PA 2ZPEB 4M7AD 4KUIA 3EAEA 4JS4A 2HQXA 2DYBA 4M7AA 1X75C 2RO0A 4PFZA 3V7SA 4QQGA 4JJCA 2X51A 2JMAA 1W4SA 3HFOA 3GNGA 4OMLA 1FWZA 4ZGEB 4M4ZA 3OYMA 1KHIA 1N9SA 5LJ3f 4FSSA 2RJCA 3QKJA 3X20B 4A53A 4BDYA 2RF0A 4AFSC 5FW9A 2RB6A 1A0NB 4BY6B 2FB7A 3M4GA 1W2BP 2K7AA 1PKTA 3CC2A 3M54A 1GCQC 3CBMA 3QPHA 1O75A 5DLQE 2CT3A 2XI9A 1VQNQ 3LWHA 1YBYA 1BI2A 4E7IA 3CMAA 4F04B 1PSFA 3DB4A 2L8DA 3FC3A 2M51A 4E7JA 2COWA 3JCMW 3JCMQ 4ME7A 2DEQA 3L2WA 2D8HA 2HKQB 1R8OB 4PJOG 4M7AF 1WHHA 1VQ6Q 3CCUA 2HSEB 2O88A 1OV3A 3CCQA 2P0PA 2SRCA 3CMET 3CCEQ 1XNIA 1RAAB 4RTXA 1YJ9A 3JCMc 3BE3A 2RHYA 1ZUKA 2JW4A 2J6OA 2HAXA 1Q95G 4J7IA 2D6FA 4C8QB 1RAIB 1Z9ZA 4LNPA 2O9SA 2DA9A 4LDYA 4KGXB 1PCXA 1N5ZA 1X01A 5GAMd 1M3BA 3VS2A 7AT1B 2DVEA 2E6ZA 3T9NA 1H641 1TS9A 3CCSA 5CKBA 1KFZA 1QQJA 3G71A 5IHKA 2YRDA 1X6BA 3SB2A 1BCMA 1ZBXA 3N5BB 1UJ0A 4L6V5 2LVMA 3J7AF 5GAOr 1YP5A 1CKBA 3L2ZA 2CGHA 3Q1JA 3CCRQ 1VQ9Q 1SRLA 3J80E 3R6NA 2YLCA 1RL2A 2KXDA 3OYBA 4RG2A 3M56A 3OA6A 1OOTA 3JB9F 3JSCA 2K4YA 1Q81U 2F5TX 1Q82C 1UE9A 1KQ1A 4DOVA 3CCMA 4DOWA 1TSFA 3AT1B 2MF2A 3M58A 3RKYA 1D3BA 4KH1B 4OMQA 1ZA1B 5D6WA 4BE0A 1RI9A 5GANd 3A8OB 2AKLA 2EKOA 3TCJA 1SKUB 1VQ4T 1ZUYA 2OTLT 1BIBA 1WHGA 2RI5A 1WHLA 3PE0A 2C0IA 2LDMA 1QVGS 5FRMA 4M7DC 1GRIA 2X35A 1LOJA 1UB4A 3GBQA 3META 1TU0B 2KNBB 2RI2A 3JCMd 3PIOA 3OYEA 3L1AA 3UWNA 4LUDA 2LQKA 1NPPA 4E7KA 3QG1A 3M57A 2NYSA 3PMTA 1WFWA 1OPLA 4BI4A 4LE9A 2CZ6B 5GAMf 1JU5C 3LLRA 4KGVB 2EYWA 4M7AB 2EYZA 2M02A 2Y4YA 3J81E 2QA4A 2C06A 4JS5A 3V8LA 4XTUA 1WA7A 3A8GB 4Z02A 4DEYA 1B3QA 1U1TA 1I5LA 3CCLT 3GNFB 2RNAA 4O6JA 2WSCE 2PVGB 4AMCA 1Q86C 4C0ZA 2XDBA 2NLUA 2GFAA 3GF5A 2ZCFB 3PNWC 1VQPQ 4ZNXA 5LJ5g 1UHFA 1YITT 2A28A 3RNJA 2YUNA 2CP6A 2CP3A 1B34A 4Z8AA 1PD1A 3HSBA 4EIKA 2C0TA 1NEBA 3VS4A 5GAOl 5CIUA 1TWBA 1D1CA 1LNXA 2R58A 1VYUA 2B8AA 2ATCB 4OMFB 2CS7A 1UHCA 2PQWA 2O9VA 1VUBA 3EGXA 1PKSA 3PGGA 4AG2C 3I5RA 3CMEA 3OYNA 2ZGWA 3EFRA 2R57A 1X69A 2CKKA 1YJNA 1UGVA 1WYXA 1ZQ1A 3OSVA 2COZA 2AZVA 1E6HA 2KE9A 2BTTA 1MGQA 3NTHA 2P84A 2CYZB 4ORZA 1WDXA 1TUDA 3RKWA 3I56Q 4HKEA 2QQBA 4PJLA 1Q82U 1I0CA 1QP3A 1BBZA 2GBQA 1UJYA 3CQTA 1D1BA 1NG2A 2KSSA 3G4ST 3QJYA 1GCQA 4PJNA 2FZCB 2JJ9A 5KCHA 3CXCS 4OGEA 3QZ5B 3CCVT 2JTFA 2KK4A 5LJ3h 4OMNA 4BB7A 4L5GA 2CSIA 5GAOp 4J7FA 4D6WA 3MHXA 1OU8A 1BU1A 1Y07A 4ELZC 1YWPA 3SHWA 1KC8U 4LDXA 2ROLA 3A1PA 2V1RA 4D8KA 5KE3A 4JLIA 4JRIA 3MCAB 2RK1A 2HZYA 2LJ1A 2X3WD 3M55A 1YIJT 4HT8A 1M8VA 2OI3A 2YXYA 2VVKA 1X27A 4J5YA 5CCAA 3M9QA 1WQWA 1WXTA 1I4K1 3VS7A 2FO0A 1D3BB 1UGPB 2ZAEA 2CP0A 1SHGA 3A5ZB 4Y91A 1GXIE 4FYYB 1H3HA 1RI0A 1VQMQ 5LJ3j 4Z89A 4P5NA 2M0OA 2OTLA 1ZBJA 5EG2A 3D7SB 1RAGB 5GAN7 1IRXA 3HP9A 2X3XD 5IHNA 2RHZA 1VQOT 2RD1A 2DTOA 3OYIA 1Q86U 4PK4A 3C94A 1BIAA 1W70A 3VRYA 4PLIA 2OAWA 3OYGA 1Q81R 3JCMV 5IT9E 2OTJA 1M3AA 2DXBA 3CXCP 3OY9A 2M9UA 3ZFJA 3E2UA 2HEQA 2QASA 2MOXA 2EGEA 2DM1A 1ZSZC 3NGPA 3JB9J 2FPFA 5FU6B 3I9QA 3X24B 2VUBA 1WI7A 4Y28E 1WJQA 5GMKi 2RI3A 3CCLA 4BUGA 1EZZB 1FYNA 2WSFE 5AT1B 2L2PA 2D9TA 1GBRA 1UTIA 5A0GA 2HNIA 4RUGA 3E9FA 1FMVA 1GCPA 8AT1B 2LJ0A 5CO7A 2E5QA 4MMKA 4E7SA 4OGCA 2RQRA 2XDDA 1YITA 4IIOA 3GPLA 1YHQQ 2MYSA 2JN0A 2DNUA 1KJWA 1B34B 2LQ8A 1FX7A 1OEBA 4M7DD 2MWOA 4C5EA 4J83A 2F2WA 1VYVA 3NPFA 3VS5A 3EGUA 4KGZB 4PFOA 5HCKA 5L8RE 4M7DA 2E70A 2CUBA 1D0ZA 3CD6Q 2ROTA 1VQKQ 3OMCA 1T3SA 3TREA 1RLQC 3RMQA 1GFCA 3EGXB 5CKEA 1QCFA 3DKMA 1WNLA 3PTAA 5C0MA 1EX4A 2E41A 4XTWA 1MUZA 4ZGJB 4C5GA 1I1JA 2PVDB 3OS1A 4RTWA 4ZTJA 2XG8D 1YI2Q 1VQ8T 1V29B 3UPUA 3NMZC 4OVAA 1ARKA 4BI8B 3RKXA 4RTUA 5IXFA 3LX7A 4PL6A 2KRSA 4F7UA 5J3BA 4J9FA 1VQLT 1D0YA 1W6XA 1OZ3A 4E47A 5GAMh 2GQIA 4FW1A 1HYOA 2ABLA 1TUGB 4X34A 5CKFA 1HK9A 2D8JA 2EVRA 2CUDA 3G4SA 5LJ5d 2PUOB 5LJ3e 4M7DF 3CCVA 1TOVA 1T0HA 1M2VA 3VJPA 2QQ9A 1V76A 4BI3A 1NYFA 3OS0A 1TG0A 4DEXA 1ZHIA 1CSKA 4VUBA 1T0JA 3CC2Q 4LD9K 1VQNT 2EGCA 4JJBA 3ZEHA 2O31A 3SD4A 4GLMA 5CKHA 1NYGA 2LZ6B 3EFOA 2J7IA 2QI2A 3S3NA 4V2SA 3QZ9B 4FYXB 5KCOA 1YIJA 1X43A 2F2VA 2RM4A 1M27C 1MNDA 2CH4A 1Q82R 4A54A 2NUZA 4HCZA 1NM7A 2QGFB 4X9CA 4F7UF 2F1LA 3C95A 3VUZA 1VQ6T 5KH6A 1JRIA 1O9SA 5GMKj 1X2KA 4RTVA 1BI1A 3M0UA 2DTHA 2E3HA 4BDZA 5I2MA 3CCUQ 2QTVA 1MV0B 2HKNA 1UEBA 3CCQQ 1QVPA 4XTYA 1YJ9Q 5EC7A 3V8KA 3MP6A 2OAUA 1VA7A 4JZ3A 2P0KA 2YWWA 1AWXA 2DJZA 3OSSC 3CCJA 2KYMA 3QBYA 2VWFA 3OYKA 4HCBA 3H0IA 4LDUA 1H8KA 5CQYA 3OYDA 2JM9A 4A4GA 3FJPA 2KRNA 2LTOA 4J9BA 1IO6A 2B86A 3ME9A 1K0SA 5IN1A 3CCSQ 2EQUA 1K9MC 2ZPGB 3RR6A 1N27A 2IPOB 4FIBA 2QXFA 4N0AC 4BE2A 3F70A 4KBMB 5KE2A 1WXBA 3CCRT 1VQ9T 2VKNA 2AT1B 2CZ0B 4C92C 1MHNA 4XU0A 2LP5A 2K6DA 3CC4Q 5GAN4 2EJFA 1Q86R 2KDSA 4PKCC 3M4YA 2W0ZA 4QQDA 1WXUA 3MO8A 1D1AA 2J05A 2H3JA 2FRWA 3RDVA 4IURA 3CCMQ 1G3SA 2ZPFB 1KD1C 2JMCA 2YDLA 4HT9A 3TEEA 4M7DB 1FMKA 5I11A 3A8MB 3G6EQ 1I07A 1RUWA 2YT6A 4R55A 2LCSA 3TQ7P 3V8JA 1D0XA 2DBMA 5CAIA 1HXDA 4JJNK 5KYUA 3MEAA 3TVTA 2JTMA 5CVIA 2LMJA 1WHKA 2DX1A 2HDAA 2DLPA 3SDZA 3WXMB 1ZSZA 2VC8A 1MMAA 3HHTB 1VQ8A 1KK7A 4PFPA 2K3BA 4F7UB 1VQLA 1G2BA 3QO3A 5GAN5 3RESA 2DL7A 2QA4Q 1VQ5Q 4OB2B 1SF9A 1M3CA 2KEAA 5GMKl 3C12A 2EJGA 5GMKe 5FRNA 2LT1A 4J9DA 1SSHA 3HL8A 4F16A 4A4FA 4RCCA 1M2VB 1WX6A 1KQ2A 2LX9A 1OU9A 2DAQA 3DLLA 2KAFA 3L2UA 1B07A 1TTHB 2QQSA 1ZUUA 4LDWA 2KY9A 2VV5A 3KFVA 3EG3A 1KQSA 1QCNA 3WVDB 2LT4A 3EH2A 1RAEB 2DBKA 3EFOB 4J9GA 2VB6A 4MZTA 2CZ7B 3HPWA 2FZKB 2IVWA 4NOYA 2GCXA 4OB1B 4XU1A 3SWNC 2GTJA 3CC7Q 1LVKA 2JOYA 1VQ6A 5DLOA 1KC8C 3PT9A 2R5MA 2H8HA 2PVOB 1K9MU 4IIMA 4OMOA 2HBPA 4X1VA 4QVZA 1W1FA 2KQWA 1QLYA 5A2QE 1XQHA 1YJNQ 1U8RA 2F5KA 2DKGA 2NUTA 2PU9B 2KROA 2Y4XA 1X6GA 1B7TA 2VASA 3LH0A 2A7YA 1SRMA 2MWPA 4Y92A 5CK9A 2RJEA 2K5IA 2P4RA 4UC4A 5HY6A 3E1SA 3V7RA 2DZ9A 3OS5A 2DRKA 1VIFA 2XDPA 1KG1A 1KD1U 3FLGA 3M0SA 3FDRA 3TSZA 1HJDA 3X28B 3BDLA 1JXOA 4HVWA 2PZ1A 1OPKA 1K73C 3JCMb 2PUKB 3EG9A 4N4GA 3L2RA 1BI0A 5LJ3g 1BCOA 3RERA 5IAYA 3BDUA 4M7DE 1M1KU 1UDLA 2MPXC 3I5SA 5GANf 3M59A 2EKHA 1UECA 3A8LB 1H3ZA 3KXTA 4J9CA 2JS2A 3QWYA 1SSFA 1C0MA 3KBGA 1VIEA 1KHCA 1UGSB 2EQIA 1WJRA 1Z9QA 3JAME 4XQ3A 2SEMA 1Y96A 1QKWA 3GP8A 4LXCA 3JCMf 4EMGA 1M1KR 1RACB 5GJWB 2CREA 5KYUB 3LW5E 4M78C 4XU3A 1JQQA 3VUBA 4F7UE 5KYYA 3VU3C 4FL6A 3EG1A 1RLPC 1UGRB 1ZSZB 4FT2A 3VV0A 1JJ2A 2OTJQ 2QG9B 9ATCB 2R5AA 4JZ4A 4C92D 4N0AA 2DL8A 3HFNA 4QT7A 2WSEE 3OMGA 1AT1B 1AHJB 4K11A 4A4HA 2XIDA 2RJDA 5AYFA 2XU8A 3EGDA 3LH5A 2FHDA 2RQTA 2BZYA 3PIPA 2ESWA 1XJWB 1MV3A 1UGQB 2GQVA 5HK0A 4XTZA 4R56A 1U5SA 1OX8A 3GLXA 5GAN6 3I55Q 2CDTA 4M7DG 2QEXQ 3RIRA 3ULRB 3EG0A 4MZPA 2O2OA 4DBQA 3TU4K 2DF6A 3QIIA 4ESRA 1VQ4A 1JB0E 2C0OA 3CPFA 4NL2A 3CD6T 4M78E 1FXXA 2ED0A 2KVQG 1VQKT 4EMKC 1QWEA 3H0HA 4M75C 2KT8A 2QK0A 2EJ9A 1WLPB 2QDYB 5GAOm 2GNCA 4B9XA 2V1QA 3OYCA 1VQ7Q 4QVCA 2GF7A 2EYXA 2DERA 4Q5WA 4JJDA 4F7UG 2L3SA 3H6ZA 4JPBW 3OBYA 4WCIA 1K73U 1YI2T 1QVFA 4A63B 4MDXA 2NUTB 2BIVA 1WPYA 1BKBA 3X25B 1EFNA 2KYBA 1PC0A 2CP2A 2I2LA 4KULA 1XTDA 4ATOA 3OYJA 1G83A 3CBOA 2JS0A 1Y57A 4X9DA 1M1FA 3MPUB 4IUPA 1K9MR 2LCLA 2EQMA 2KMTA 3L42A 3CPWA 1R0BG 4XU2A 4KH0B 1S72Q 4ZN3A 2XK0A 1MMDA 4LD6A 3EG9B 3O8VA 2FPDA 2PTKA 2F2XA 2RJFA 4FYWB 4J9EA 5D7UA 1WJSA 3SWNA 5IHIA 3THKA 3ZL7C 3H0FA 4M75E 5I22A 1QMCA 2LX7A 4M77C 2KR3A 1YIJQ 4HCKA 3LGLA 3M0RA 5FWBA 1CKAA 1WIEA 2LC4A 1LJOA 4M78G 5IXBA 1FMWA 1PG5B 4HA8A 4PJJA 5GJVB 1AZEA 3CBPA 1KD1R 1PHTA 4IUQA 5KYXA 5CR2A 1AWOA 1ABQA 3CCUT 1Y96B 2DPPB 2YRVA 3CCQT 3LYIA 2EGAA 1YJWQ 2RQVA 2VYTA 1QP2A 3VS6A 2HQHA 4J9HA 2P4TA 5HKCA 2E5KA 3JCMJ 5C6SA 3OYHA 2YUOA 2RHIA 4OF1A 4PJOC 1PD0A 1QW1A 5FROA 3PMIA 1VOMA 5KYYB 1IHWA 4OMPA 1RADB 5HK3A 2CT4A 1ZSGA 3VS0A
chains in the Genus database with same CATH topology
3LLRA 1I8FA 4ELYC 1Y7XA 2QA4A 4M7AB 3E19A 2C06A 4IURA 2Y4YA 4IUVA 3JCMX 5CKDA 2K3XA 2JVVA 2V8IA 3J81E 1G3SA 3V8LA 2RK2A 1IREB 2ZPFB 4XTUA 3L2QA 4JS5A 1KD1C 4HCCA 5LJ5j 4HT9A 1N6AA 2V8KA 3QJ6A 4QW2A 3A8GB 2K3YA 4Z02A 3TEEA 2E12A 2JNGA 1OYXA 2X4WA 4M7DB 3DLMA 3S6WA 4C92F 3A8MB 1Q7YC 1U1TA 4YTLA 1I5LA 3ER0A 3CCLT 2E6NA 4R55A 5LJ3d 3GNFB 2YHTA 4O6JA 3V8JA 3HKSA 4JRPA 2WSCE 2PVGB 1YJWT 5CAIA 4PJOB 1HXDA 2RH2A 1Q86C 4C0ZA 4JJNK 4MMLA 4BE1A 3MEAA 2XDBA 2NLUA 2JTMA 3FEOA 3M53A 5CVIA 4C8QG 3P8BB 1QVGA 2GFAA 3GF5A 3CC4T 4M77E 2ZCFB 3PNWC 4KT0E 2DD4A 4EPCA 1I81A 2WACA 1KQSS 5D6YA 5LJ5g 3SDZA 1YITT 2E65A 3WXMB 2VC8A 3I56A 4RG8A 1NJIC 5GAMj 4MZMA 3HHTB 4GLKA 1VQ8A 3QYGB 4M7AE 4J6YA 1B34A 5DY9A 4M75G 3CCJT 5J39A 3OW2S 3X26B 3PFSA 4PLLA 3HSBA 4OB3B 2LRQA 4F7UB 1M5Q1 1VQLA 5GAOl 3CCMT 1K8AC 3OBWA 5CIUA 1PSEA 3QO3A 5GANh 5GAN5 2BKDN 3RESA 2A3LA 2XHCA 1LNXA 2R58A 4M78D 1M1GA 1WQ7A 4ZTFA 2E10A 4PNOA 2B8AA 4OB2B 4OMFB 3G6ET 3CCET 2CS7A 1M90C 5GMKl 3OYFA 3NTKA 1VQKA 3C12A 2EJGA 2PQWA 4M78A 3A8HB 4C0DC 5GMKe 1VUBA 5GAMg 5FRNA 2LT1A 4JDSA 3PGGA 3CEYA 4BD3A 3CC2T 3HL8A 1VQOA 3G7ZA 3CMEA 4A4FA 4RCCA 3OYNA 2ZGWA 3EFRA 3JCMh 2R57A 1KQ2A 2LX9A 2CKKA 1YJNA 2QQRA 2DAQA 5FLXE 3DLLA 2KAFA 1ZQ1A 3ZBDA 3OSVA 3L2UA 1EIFA 2DTIA 5GAN3 3FRNA 2QQSA 4C0GA 5GAN2 4LDWA 3OYYA 2KY9A 2VV5A 3CMAT 1P92A 1MGQA 2E64A 3NTHA 1KQSA 1NE8A 2CYZB 3WVDB 3QYHB 2MMPA 4XTVA 2LT4A 4LDVA 5GAOn 3I55A 3LWIA 2Y90A 4O5VA 3RKWA 3RUXA 1BYMA 4HKEA 2QQBA 3VYGA 4MZTA 3GIBA 3S3OA 2QEXA 1Q82U 4DA4A 5GANj 5DM7R 2CZ7B 1QP3A 3HPWA 4JUVA 2IVWA 4C0DB 4IKFA 3M5AA 1VQMA 4NOYA 2GCXA 5LJ5f 2KSSA 4OB1B 4XU1A 3G4ST 3QJYA 2P0QA 1N9RA 2X4XA 3SWNC 2QA4T 1VQ5T 4NL3A 2JOYA 2DXCA 2EFIA 4A4EA 2L5QA 5KCHA 1VQ6A 5DLOA 3NTIA 3P8HA 4XK8E 3CXCS 1KC8C 3PT9A 4OGEA 3QZ5B 5D6XA 2JTFA 2KK4A 4J6WA 3CCVT 1DJ7B 2R5MA 5LJ3h 4BB7A 2G3RA 4L5GA 2PVOB 5GAOp 1K9MU 3JCMP 2O01E 3HRTA 3BY7A 3VYHB 4J7FA 1YJ9T 1TH7A 4D6WA 2HBPA 3MHXA 4QVZA 4M78F 4C8QD 4EDUA 1VQ7A 1Y07A 4ELZC 3QHSA 2DIQA 3E9GA 4J6XA 5A0DA 1BI3A 1NPRA 2KQWA 4M77G 2K2VA 4IUUA 1KC8U 2ZZDA 3GOXA 4LDXA 3SFMA 5A2QE 1XQHA 4C8QA 5KE3A 1U8RA 4JLIA 2F5KA 3INZA 4FSXA 4JRIA 3MCAB 2DKGA 2RK1A 2PU9B 2Y4XA 4CI0C 2DO3A 3M55A 4M7AG 4M75D 1YIJT 3LH0A 4HT8A 2A7YA 1M8VA 3HRSA 2MWPA 2D0QB 2VGNA 3OYAA 3SWNB 4EMKA 3HRUA 5CK9A 3JRZA 2RJEA 2K5IA 3JCMg 4J5YA 2EQKA 3CCST 3G71T 4M75A 5CCAA 3V7CA 3M9QA 1WQWA 1YCYA 4UC4A 1I4K1 2O4XB 3OQ5A 1D3BB 1UGPB 4C92B 5HY6A 3E1SA 3V7RA 4EMHA 2DZ9A 2K5FA 3A5ZB 4Y91A 4N4IA 3CC7T 1GXIE 4E7LA 3OS5A 5LJ5e 2ZPHB 1RI0A 1VIFA 2XDPA 2K57A 5LJ3j 4P5NA 2M0OA 2OTLA 1KD1U 1G5VA 1KG1A 2M16A 3FLGA 4DQ2A 5EG2A 1IZ6A 3FDRA 5GAN7 3UT1A 5FU7C 3X28B 2HD0A 5FU6C 3CXCA 3BDLA 3FIFA 1Q7YU 3H8ZA 3HP9A 4FM4B 5GMKh 2F69A 3JB9D 2RHZA 1K73C 1VQOT 3JCMb 2RD1A 1M1KC 2DTOA 3OYIA 2DXUA 1Q86U 1YJNT 1N8RC 3C94A 1BIAA 1S72A 2DZCA 1YHQA 2PUKB 4PLIA 2FL7A 1OZ2A 2XD0A 5I21A 2LNVA 1JJ2S 3MEUA 4N4GA 1BI0A 2DK3A 3JCMV 3OYGA 3L2RA 5IT9E 2OTJA 2XKOC 2DXBA 5LJ3g 2LCCA 3OY9A 4C8QF 3OYLA 3RERA 5GAMe 5IAYA 3BDUA 3JB9H 4M7DE 4N4HA 1W2BS 2M9UA 2YLBA 3ZFJA 1M1KU 1NJIU 5GANf 3M59A 4C92E 4RKUE 3A8LB 2EAYA 1H3ZA 2DXTA 3CD6A 5CQXA 3JB9J 3KXTA 2CZ1B 4IUTA 5FU7B 3JB9I 2VXFA 4J8OA 5FU6B 4BACA 4PJOE 1SSFA 3S3MA 1K8AU 3KBGA 4M75F 1VIEA 1KHCA 3X24B 1UGSB 4A4KA 2HQEA 2VUBA 1WJRA 2FVUA 2EYQA 4C5IA 2EQJA 3JAME 4XQ3A 4Y28E 1Y96A 1WJQA 3GP8A 3C4SA 5GMKi 2RI3A 3RMSA 3JCMf 3CCLA 4BUGA 2WSFE 1Y71A 3JB9G 4EMGA 1VQPT 1M90U 3BW1A 1G3YA 2D9TA 2XICA 5A0GA 1YJWA 4FT4A 1VQNA 2HNIA 2RHUA 1OI1A 4M77D 4E7HA 3LW5E 1Q81C 4XAXB 4FU6A 1YI2A 3KUFA 3AHUA 3E9FA 2ZPBB 4M78C 4XU3A 3CC4A 3VKIA 5CO7A 4BY6C 3UDCA 2E5QA 3VUBA 4F7UE 4M77A 4QVDA 3MP1A 4FL6A 4MMKA 3VU3C 4OGCA 4L59A 2XDDA 3QUIA 1YITA 4WF2A 1UGRB 5GAOq 2ZPEB 4FT2A 3GPLA 4M7AD 2JN0A 3OW2A 4KUIA 3VV0A 1JJ2A 1G3WA 4GY5A 3EAEA 1B34B 4JS4A 1U1SA 2LQ8A 1FX7A 2HQXA 2R5AA 2RA2A 2MWOA 2RHXA 4M7AA 4M7DD 1X75C 4C5EA 2RO0A 3V7SA 4J83A 1W2BA 4QQGA 4C92D 5GANe 1W4SA 4N0AA 3HFNA 3HFOA 1WGSA 3GNGA 1FWZA 5L8RE 3EFSA 4ZGEB 2E70A 4M7DA 2WSEE 3OYMA 3OMGA 1AHJB 1KHIA 1N9SA 5LJ3f 3DB3A 4PJOD 4A4HA 2GFUA 2XIDA 2RJCA 3QKJA 2RJDA 5AYFA 3X20B 3G6EA 3CCEA 4A53A 3OMCA 4BDYA 4TVRA 3WVEB 2XU8A 4ZN1A 3TREA 4M78B 4PJOA 2FHDA 3RMQA 2RB6A 4BY6B 2L89A 2FB7A 2VGMA 5CKEA 5GANg 3M4GA 3CC2A 3M54A 3DKMA 3JCMe 3PIPA 3CBMA 4CRIA 3QPHA 1WNLA 3PTAA 5C0MA 1M9SA 2E41A 4XTWA 1QVFS 1O75A 1UGQB 2GQVA 5DLQE 4B9WA 2XI9A 4ZGJB 2QTXA 5HK0A 4XTZA 4C5GA 2PVDB 3OS1A 3LWHA 1YBYA 1BI2A 3P8DA 4R56A 3I56T 4II1A 4ZTJA 2MAMA 2X4JA 2XG8D 4E7IA 1VQ8T 3GLXA 1V29B 3CMAA 3UPUA 1PSFA 4OVAA 5GAN6 3DB4A 4BI8B 3RKXA 2L8DA 5GAN8 4M7DG 4M77F 3FC3A 2OTJT 4C5HA 3LX7A 4PL6A 4F7UA 4C92G 5J3BA 4E7JA 3JCMW 4JLGA 1VQLT 3RIRA 4C8QC 4ME7A 3JCMQ 2DEQA 1OZ3A 4MZPA 4E47A 5GAMh 3L2WA 4RCBA 3TU4K 1R8OB 4PJOG 3QIIA 4X34A 5A0LA 4NS5A 5CKFA 1VQ4A 4M7AF 2X4YA 1HK9A 1JB0E 3G4SA 3CPFA 4NL2A 3CD6T 4OB0B 4M78E 1FXXA 2V8JA 2KVQG 1VQ5A 1VQKT 4EMKC 1JBMA 3CCUA 3MEWA 5LJ5d 2PUOB 4QQ6A 5LJ3e 3CCQA 4M7DF 2P0PA 4RMOA 4M75C 3CCVA 3CCRA 1VQ9A 4OP0A 2EJ9A 1G3TA 3CMET 2QDYB 3FB9A 5GAOm 3VJPA 4B9XA 3CPWS 2QQ9A 4BI3A 1XNIA 1YJ9A 3URGA 3OYCA 3JCMc 3OS0A 2EWNA 4QVCA 2GF7A 1ZHIA 3R6OA 2RHYA 4JRQA 4VUBA 4PJOF 2BUDA 1X6OA 4LD9K 1VQNT 2HAXA 4KUDK 4Q5WA 4F7UG 3H6ZA 5GMKm 3OBYA 2JZ2A 4J7IA 3ZEHA 1YI2T 4C8QB 1K73U 2D6FA 1QVFA 2VXEA 3SD4A 2K5LA 4MDXA 4LDYA 3I55T 2IG0A 2BIVA 5CKHA 1WPYA 1N8RU 1BKBA 2M1HA 3X25B 2E1HA 2QI2A 3S3NA 4V2SA 3QZ9B 1X01A 5KCOA 5GAMd 1YIJA 2QEXT 2DD5A 2DVEA 5LL6S 2RM4A 2E6ZA 3MEVA 1H641 3T9NA 4EMKB 2I2LA 4A54A 1VQMT 4HCZA 3CCSA 4KULA 5CKBA 5I2SA 3G71A 4M75B 1XTDA 4X9CA 4ATOA 3OYJA 3BFMA 3LGFA 4F7UF 3C95A 4JRKA 3SB2A 3VUZA 1VQ6T 5KH6A 3CBOA 3CC7A 1JRIA 1O9SA 1ZBXA 3N5BB 4L6V5 2EIFA 5GMKj 2LVMA 3J7AF 1BI1A 4X9DA 2DTHA 5GAOr 1M1FA 4BDZA 5I2MA 4IUPA 2FYKA 2LCLA 1UEBA 3L2ZA 2CGHA 1VQ7T 3QSUA 3Q1JA 2EQMA 3QDRB 2DIGA 3J80E 2KMTA 3L42A 1QVPA 4XTYA 4C8QE 4ZGDB 2JUFA 3CPWA 2YLCA 1RL2A 4XU2A 2AHJB 3QXEB 3MP6A 2OAUA 5J26A 3V8KA 3OYBA 2P0KA 4RG2A 3M56A 4ZN3A 3OA6A 2XK0A 3JB9F 3JSCA 2K4YA 3OB9A 2DJZA 4LD6A 1Q81U 3O8VA 2RJFA 3OSSC 3CCJA 2F5TX 1Q82C 3QBYA 3OYKA 1WJSA 3SWNA 1KQ1A 4DOVA 4HCBA 4M75E 4DOWA 3CCMA 4C0FA 4LDUA 2ZPIB 2MF2A 3M58A 3NFCA 4M77C 3RKYA 2O4XA 5CQYA 1D3BA 5D6WA 3MP8A 3OYDA 4C92A 4BE0A 3LGLA 4A4GA 3FJPA 2LTOA 5GANd 3ME9A 3A8OB 2EKOA 2QQAA 5IN1A 3TCJA 2LC4A 1LJOA 4M78G 2EQUA 5LJ5h 1K9MC 1VQ4T 2OTLT 2ZPGB 2MI6A 1BIBA 4HA8A 5M9OA 4M7AC 2L3RA 2RI5A 3CBPA 4IUQA 5CR2A 1N27A 3OS2A 3L2VA 1NZ9A 3CCUT 4FIBA 1Y96B 2QXFA 4MDWA 4N0AC 3F70A 4BE2A 2DPPB 2LDMA 1M4ZA 2YRVA 3CCQT 1QVGS 4KBMB 5KE2A 3LYIA 5FRMA 4M7DC 3CCRT 2X35A 2VYTA 1VQ9T 1VQPA 1LOJA 1UB4A 1QP2A 2CZ0B 4C92C 3META 1MHNA 2P4TA 4XU0A 2RI2A 5HKCA 3JCMd 5C6SA 3PIOA 3OYEA 3JCMJ 3OYHA 3L1AA 3UWNA 1S72T 2LQKA 1YHQT 1NPPA 4E7KA 3QG1A 5GAN4 2EJFA 3M57A 2RHIA 4OF1A 4PJOC 1QW1A 3PMTA 2KDSA 5FROA 3PMIA 4M77B 4PKCC 3M4YA 4QQDA 3MO8A 4BI4A 5HK3A 2H3JA 1XOVA 3ASKA 2CZ6B 5GAMf 4XTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NL3 A;  4C8Q B;  1I8F A;  3BW1 A;  2VXE A;  4M7A B;  2HNI A;  4M77 D;  4J6W A;  3JCM X;  1WPY A;  5LJ3 h;  3V8L A;  2E1H A;  4XTU A;  3AHU A;  4M78 C;  4XU3 A;  5GAO p;  5LJ5 j;  3JCM P;  4HT9 A;  4V2S A;  1X01 A;  3BY7 A;  5GAM d;  4F7U E;  1TH7 A;  4M77 A;  2DVE A;  4M7D B;  4QVD A;  2RM4 A;  3VU3 C;  1H64 1;  4MMK A;  4M78 F;  4C8Q D;  4C92 F;  4EMK B;  2I2L A;  3QUI A;  4WF2 A;  4A54 A;  1U1T A;  3QHS A;  5GAO q;  5GAN g;  1I5L A;  4J6X A;  4M7A D;  4M75 B;  4M77 G;  4X9C A;  3BFM A;  4F7U F;  2JN0 A;  5LJ3 d;  2YHT A;  4JRK A;  3SB2 A;  3V8J A;  4C8Q A;  1B34 B;  5CAI A;  1U1S A;  4PJO B;  1HXD A;  4JLI A;  1JRI A;  2RA2 A;  3INZ A;  4JRI A;  4MML A;  4M7A A;  4M7D D;  2DKG A;  5GMK j;  3V7S A;  4C8Q G;  5GAN e;  4C92 D;  4N0A A;  3HFN A;  3HFO A;  4M77 E;  4M75 D;  4M7A G;  4X9D A;  2DTH A;  5GAO r;  3EFS A;  4HT8 A;  4M7D A;  1M8V A;  1I81 A;  3SWN B;  4EMK A;  2FYK A;  1N9S A;  2CGH A;  3L2Z A;  5LJ3 f;  5LJ5 g;  3QSU A;  2E65 A;  4PJO D;  3JCM g;  4J5Y A;  2VC8 A;  4M75 A;  3V7C A;  5GAM j;  1WQW A;  1YCY A;  4XTY A;  4A53 A;  1I4K 1;  4C8Q E;  2YLC A;  1D3B B;  4XU2 A;  4M7A E;  4M78 B;  4J6Y A;  1B34 A;  5DY9 A;  3V7R A;  4M75 G;  3V8K A;  2RB6 A;  2DZ9 A;  4C92 B;  4EMH A;  4Y91 A;  2FB7 A;  3M4G A;  5LJ5 e;  3HSB A;  3JB9 F;  2DJZ A;  4F7U B;  3JCM e;  1M5Q 1;  5LJ3 j;  2K57 A;  5GAO l;  1WNL A;  3QO3 A;  5GAN h;  5GAN 5;  3RES A;  2E41 A;  4XTW A;  4DQ2 A;  3SWN A;  1KQ1 A;  5GAN 7;  1LNX A;  4M78 D;  2QTX A;  4XTZ A;  4M75 E;  1WQ7 A;  3FIF A;  2E10 A;  4PNO A;  3RKY A;  4M77 C;  5GMK h;  3JB9 D;  5GMK l;  1D3B A;  2EJG A;  4M78 A;  4C92 A;  5GAN 6;  3JCM b;  5GMK e;  2RD1 A;  3FJP A;  2DTO A;  3RKX A;  5GAM g;  5GAN d;  2DXU A;  4M77 F;  5GAN 8;  4M7D G;  4PJO A;  3PGG A;  1BIA A;  2DZC A;  4F7U A;  1LJO A;  4M78 G;  4C92 G;  3JCM W;  5LJ5 h;  4RCC A;  3RIR A;  4C8Q C;  3JCM Q;  2DEQ A;  2ZGW A;  3EFR A;  5I21 A;  3JCM h;  1KQ2 A;  5GAM h;  1BIB A;  4HA8 A;  3JCM V;  4M7A C;  4RCB A;  5LJ3 g;  4C8Q F;  3RER A;  4PJO G;  5GAM e;  3BDU A;  2DTI A;  3JB9 H;  1Y96 B;  4N0A C;  5GAN 3;  4M7A F;  4M7D E;  2YLB A;  1HK9 A;  5GAN 2;  4NL2 A;  5GAN f;  4M7D C;  4M78 E;  4C92 E;  1LOJ A;  4EMK C;  1JBM A;  5LJ5 d;  1MGQ A;  2E64 A;  4C92 C;  2EAY A;  4XU0 A;  5LJ3 e;  3JCM d;  3JCM J;  2DXT A;  4M75 C;  4M7D F;  4XTV A;  3L1A A;  5GAO n;  3JB9 J;  4OP0 A;  4EMG A;  2EJ9 A;  3JB9 I;  2Y90 A;  2VXF A;  3RKW A;  3RUX A;  5GAN 4;  4PJO E;  2EJF A;  3FB9 A;  5GAO m;  4M75 F;  4PJO C;  3GIB A;  3JCM c;  2EWN A;  5GAN j;  4M77 B;  4QVC A;  4JUV A;  4XQ3 A;  4PJO F;  1Y96 A;  4NOY A;  5LJ5 f;  4XU1 A;  5GMK i;  3JCM f;  3JB9 G;  4F7U G;  5GAM f;  1N9R A;  5GMK m;  3SWN C;  4XTX A; 
#chains in the Genus database with same CATH topology
 1I8F A;  1AVZ C;  4ELY C;  4LN2 A;  3E19 A;  4IUV A;  2G6F X;  2JVV A;  4E6R A;  2RK2 A;  1IRE B;  3H41 A;  3L2Q A;  1MMN A;  4HCC A;  2V8K A;  4QW2 A;  1E7O A;  2E12 A;  2JNG A;  2EW3 A;  2X4W A;  2KGT A;  3DLM A;  2X9H A;  3S6W A;  1Q7Y C;  4E7Z A;  2D0N A;  4YTL A;  3ER0 A;  4GBQ A;  1ZA2 B;  2E6N A;  5LJ3 d;  3M0Q A;  2YHT A;  3HKS A;  4JRP A;  1J3T A;  3EGD B;  2RH2 A;  2CSQ A;  2JXB A;  4MML A;  2HMA A;  1S1N A;  3CC4 T;  4M77 E;  4KT0 E;  2DD4 A;  3FJ5 A;  1I81 A;  1KQS S;  5D6Y A;  2E65 A;  2AK5 A;  3CMA Q;  1NJI C;  5GAM j;  4GLK A;  1JO8 A;  2GTO A;  2RPN A;  3QYG B;  1MNE A;  8ATC B;  5DY9 A;  3UA6 A;  2YUQ A;  4M75 G;  5J39 A;  3OW2 S;  1VYT A;  1SEM A;  4OB3 B;  2LRQ A;  3CCM T;  1K8A C;  3OBW A;  1PSE A;  2EBP A;  5GAN h;  2BKD N;  2FPE A;  2E4H A;  3REB B;  4M78 D;  4ANJ A;  1WQ7 A;  2COY A;  4ZTF A;  2E10 A;  4PNO A;  3G6E T;  3CCE T;  1M90 C;  1VQK A;  4M78 A;  3A8H B;  4C0D C;  1GBQ A;  4BD3 A;  3CEY A;  1WHM A;  1VQO A;  3VS3 A;  1KC8 R;  3RBB B;  3JCM h;  1BK2 A;  2KRM A;  1QWF A;  1EIF A;  2DTI A;  4C0G A;  2JT4 A;  3OYY A;  1P92 A;  2E64 A;  3QYH B;  2MMP A;  4F17 A;  1BYM A;  2FEI A;  2Y90 A;  4O5V A;  2AIR B;  3VYG A;  1K0X A;  3GIB A;  4DA4 A;  5GAN j;  5DM7 R;  2DMO A;  3G71 Q;  1K4U S;  5LJ5 f;  1VQL Q;  2J6F A;  2X4X A;  3G1J A;  2QA4 T;  1VQ5 T;  2DXC A;  2L3Q A;  1KQS P;  2L5Q A;  3P8H A;  5D6X A;  1ZX6 A;  3JCM P;  2O01 E;  1OX9 A;  3OW2 P;  2AKK A;  4M78 F;  2K2M A;  4EDU A;  3QHS A;  3E9G A;  4M77 G;  2K2V A;  4IUU A;  2AZS A;  2ZZD A;  3GOX A;  1RAB B;  3INZ A;  1K73 R;  3HTR A;  4HVV A;  4RTZ A;  4AT1 B;  2A37 A;  5KYW A;  2DO3 A;  4M75 D;  4RTT A;  1YN8 A;  2D0Q B;  1AOJ A;  3IQL A;  3SWN B;  5L23 A;  1IHV A;  4EMK A;  3PVL A;  3JRZ A;  4AG1 C;  2EQK A;  4M75 A;  3V7C A;  2J6K A;  2DVJ A;  4EMH A;  3JV3 A;  2K5F A;  3CC7 T;  3QDF A;  4N4I A;  1HSQ A;  4E7L A;  2ZPH B;  2K57 A;  2DIL A;  2M16 A;  1M8M A;  5FU7 C;  1OUL A;  5KYX B;  2HD0 A;  1X2Q A;  1Q7Y U;  3VRZ A;  2F69 A;  3JB9 D;  4AFQ C;  1M1K C;  1PRL C;  2DXU A;  1YJN T;  1N8R C;  4R0K A;  1IXD A;  2FL7 A;  4DBF A;  1LCK A;  2LNV A;  1JJ2 S;  2XKO C;  2LCC A;  5GAM e;  4N4H A;  2YLB A;  1NJI U;  1OQK A;  4C92 E;  2Z0W A;  1QCO A;  1YCS B;  5CQX A;  2PNI A;  3EH1 A;  2VXF A;  4J8O A;  4BAC A;  3S3M A;  1K8A U;  4M75 F;  2DL3 A;  4A4K A;  2HQE A;  2EYQ A;  1IB8 A;  2EQJ A;  4F14 A;  2K79 A;  1Y71 A;  2L0A A;  1VQP T;  1M90 U;  1M30 A;  1G3Y A;  2XIC A;  4FT4 A;  6AT1 B;  1VQN A;  4M77 D;  2RHU A;  1OI1 A;  2BE7 D;  1YNZ A;  3KUF A;  3AHU A;  2QAZ A;  2ZPB B;  4B6M A;  3CC4 A;  3VKI A;  4BY6 C;  3UDC A;  2W10 A;  4M77 A;  1AWW A;  2ENM A;  4QVD A;  3MP1 A;  4L59 A;  1F1B B;  3QUI A;  2HBW A;  2DL4 A;  2EYY A;  3M0P A;  3OW2 A;  1I5O B;  1G3W A;  4GY5 A;  4QKU A;  1U1S A;  2RHX A;  2RA2 A;  2KXC A;  1W2B A;  5GAN e;  1WGS A;  1KIK A;  1RAF B;  2HSP A;  3EFS A;  2HCK A;  4PJO D;  3DB3 A;  2GFU A;  3G6E A;  2YSQ A;  3CCE A;  3U23 A;  1JJ2 P;  4TVR A;  3WVE B;  4ZN1 A;  4M78 B;  4PJO A;  2L89 A;  2VGM A;  1QKX A;  3CME Q;  1ABO A;  3JCM e;  1V1C A;  2H3E B;  4CRI A;  1M9S A;  1IGU A;  4KRT A;  1JEG A;  1QVF S;  4B9W A;  2QTX A;  3P8D A;  3I56 T;  4II1 A;  2MAM A;  1ACM B;  2X4J A;  4CC3 A;  2LNH B;  3REA B;  2A0F B;  5GAN 8;  4M77 F;  2OTJ T;  4C5H A;  2ECZ A;  4C92 G;  4JLG A;  4C8Q C;  2CP7 A;  1K1Z A;  3UAT A;  4RCB A;  5A0L A;  4NS5 A;  2X4Y A;  4OB0 B;  2V8J A;  1VQ5 A;  1JBM A;  3MEW A;  4QQ6 A;  4RMO A;  3CCR A;  1VQ9 A;  4OP0 A;  1G3T A;  3FB9 A;  3MKD A;  3CPW S;  3URG A;  2EWN A;  2MCN A;  3R6O A;  2LQN A;  4JRQ A;  4PJO F;  1UUE A;  1RAH B;  2QDL A;  1NLP C;  2BUD A;  1X6O A;  2RN8 A;  4KUD K;  5GMK m;  2HL5 C;  2JZ2 A;  2VXE A;  4Z88 A;  1Y0M A;  4FCY A;  2K5L A;  2D1X A;  3I55 T;  2IG0 A;  2ED1 A;  1N8R U;  2M1H A;  2E1H A;  5KYW B;  2QEX T;  2DD5 A;  5LL6 S;  4J9I A;  3MEV A;  4EMK B;  3TSW A;  3PVQ A;  1VQM T;  5I2S A;  4M75 B;  3I35 A;  3BFM A;  3LGF A;  1QVG P;  1QVF P;  4JRK A;  2LJ3 A;  3MJX A;  3CC7 A;  4DBH A;  4D8D A;  1VQ4 Q;  4E2F B;  2EIF A;  1ZLM A;  2OTL Q;  1U3O A;  2FYK A;  3QSU A;  1VQ7 T;  1NBE B;  1BB9 A;  3QDR B;  2DIG A;  1D09 B;  5IH2 A;  4C8Q E;  4ZGD B;  2JUF A;  2AHJ B;  3QXE B;  5J26 A;  1PNJ A;  3O5Z A;  1R77 A;  1M2O A;  3OB9 A;  2FG0 A;  2KI7 A;  3VS1 A;  4C0F A;  2ZPI B;  5FWC A;  1SHF A;  3CPW P;  3NFC A;  2O4X A;  3MP8 A;  1TUC A;  4C92 A;  1PM3 A;  2QQA A;  3H9N A;  2IIM A;  5LJ5 h;  2MI6 A;  4M7A C;  5M9O A;  2L3R A;  3OS2 A;  3L2V A;  1NZ9 A;  3CCL Q;  4MDW A;  1C6V X;  1M4Z A;  1AZG B;  2RQU A;  1VQP A;  1Q7Y R;  1WHJ A;  4AFZ C;  1K9A A;  1S72 T;  1YHQ T;  3EHQ A;  2YUP A;  2JM8 A;  1NEG A;  4M77 B;  1YIT Q;  2NUP A;  2GGR A;  1XOV A;  3ASK A;  1H92 A;  2BZ8 A;  1SPK A;  4XTX A;  1NJI R;  1Y7X A;  3JCM X;  5CKD A;  2K3X A;  2V8I A;  5KYN A;  2OJ2 A;  5LJ5 j;  1N6A A;  3QJ6 A;  2K3Y A;  2YRC A;  1OYX A;  1K8A R;  2I0N A;  4C92 F;  1TXQ A;  2DET A;  2DEU A;  2A08 A;  4CC4 B;  1YJW T;  4PJO B;  2M0Y A;  1T3L A;  4OMM A;  1M90 R;  4BE1 A;  3FEO A;  3M53 A;  4C8Q G;  3P8B B;  1QVG A;  4RTY A;  4EPC A;  2WAC A;  2V26 A;  2BE9 B;  3UF4 A;  3I56 A;  4RG8 A;  4MZM A;  4M7A E;  4J6Y A;  2MIO A;  3CCJ T;  1JXM A;  3X26 B;  3PFS A;  4PLL A;  2KBT A;  1M5Q 1;  2A3L A;  2XHC A;  2K9G A;  2DYI A;  3G4S Q;  1M1G A;  3SEM A;  2QGG A;  3QWX X;  4AFU C;  3OYF A;  3NTK A;  4HVU A;  1UFF A;  2DJQ A;  3CCV Q;  4DBR A;  5GAM g;  4JDS A;  2OX7 A;  2QYZ A;  3CC2 T;  3G7Z A;  1IGQ A;  2QQR A;  5FLX E;  3ZBD A;  4FYV B;  2FZG B;  5GAN 3;  3FRN A;  1YFN A;  5GAN 2;  3CMA T;  1NE8 A;  4FW2 A;  1NLO C;  4XTV A;  3I55 A;  5GAO n;  4LDV A;  3LWI A;  3C0C A;  3RUX A;  1E6G A;  3S3O A;  2QEX A;  2CH4 W;  2BZX A;  4JUV A;  1C1A A;  3CCJ Q;  4C0D B;  4IKF A;  3M5A A;  1VQM A;  1LPL A;  1N9R A;  2P0Q A;  4WTO B;  2RQW A;  4A4E A;  2EFI A;  3M0T A;  4NL3 A;  3NTI A;  4XK8 E;  4J6W A;  1DJ7 B;  2G3R A;  1G8X A;  2DE0 X;  3HRT A;  3BY7 A;  3VYH B;  1YJ9 T;  1TH7 A;  1AWJ A;  4C8Q D;  1R0C B;  1VQ7 A;  2DIQ A;  5A0D A;  4J6X A;  5GAN g;  1BI3 A;  1NPR A;  1VQO Q;  3SFM A;  2MK5 A;  4C8Q A;  4FSX A;  1MMG A;  4CI0 C;  3EG2 A;  1PWT A;  1HD3 A;  1U06 A;  1N8R R;  4M7A G;  1PRM C;  3HRS A;  3OYA A;  2VGN A;  4CC2 A;  3HRU A;  3A98 A;  3JCM g;  3CCS T;  3G71 T;  1YCY A;  2O4X B;  3OQ5 A;  2KT1 A;  3UA7 A;  4C92 B;  2CP5 A;  2LQW A;  2HL3 A;  4PJM A;  5LJ5 e;  4LUE A;  1AEY A;  1G5V A;  2DL5 A;  4DQ2 A;  1IZ6 A;  2RMO A;  1GL5 A;  3UT1 A;  5FU6 C;  3CXC A;  3FIF A;  1GFD A;  3H8Z A;  4FM4 B;  5GMK h;  2DRM A;  1K76 A;  2A36 A;  1S72 A;  2DZC A;  1YHQ A;  2XD0 A;  1OZ2 A;  2EPD A;  5I21 A;  3MEU A;  2DK3 A;  3EHR A;  4C8Q F;  2NUP B;  3OYL A;  2DFU A;  3JB9 H;  1W2B S;  2JTE A;  1WZO A;  4RKU E;  2EAY A;  2DXT A;  3CD6 A;  1AD5 A;  1UG1 A;  2CZ1 B;  4IUT A;  4HXJ A;  5FU7 B;  3JB9 I;  4PJO E;  2FVU A;  4C5I A;  2J06 A;  2E3I A;  3C4S A;  3RMS A;  3JB9 G;  5ECA A;  2XMF A;  3BW1 A;  1YJW A;  2FRY A;  4E7H A;  1SG5 A;  1Q81 C;  4XAX B;  4FU6 A;  1YI2 A;  4CC7 A;  1KSW A;  1YWO A;  2NWM A;  3NHN A;  4WF2 A;  1VQ8 Q;  5GAO q;  2L3P A;  2ZPE B;  4M7A D;  4KUI A;  3EAE A;  4JS4 A;  2HQX A;  2DYB A;  4M7A A;  1X75 C;  2RO0 A;  4PFZ A;  3V7S A;  4QQG A;  4JJC A;  2X51 A;  2JMA A;  1W4S A;  3HFO A;  3GNG A;  4OML A;  1FWZ A;  4ZGE B;  4M4Z A;  3OYM A;  1KHI A;  1N9S A;  5LJ3 f;  4FSS A;  2RJC A;  3QKJ A;  3X20 B;  4A53 A;  4BDY A;  2RF0 A;  4AFS C;  5FW9 A;  2RB6 A;  1A0N B;  4BY6 B;  2FB7 A;  3M4G A;  1W2B P;  2K7A A;  1PKT A;  3CC2 A;  3M54 A;  1GCQ C;  3CBM A;  3QPH A;  1O75 A;  5DLQ E;  2CT3 A;  2XI9 A;  1VQN Q;  3LWH A;  1YBY A;  1BI2 A;  4E7I A;  3CMA A;  4F04 B;  1PSF A;  3DB4 A;  2L8D A;  3FC3 A;  2M51 A;  4E7J A;  2COW A;  3JCM W;  3JCM Q;  4ME7 A;  2DEQ A;  3L2W A;  2D8H A;  2HKQ B;  1R8O B;  4PJO G;  4M7A F;  1WHH A;  1VQ6 Q;  3CCU A;  2HSE B;  2O88 A;  1OV3 A;  3CCQ A;  2P0P A;  2SRC A;  3CME T;  3CCE Q;  1XNI A;  1RAA B;  4RTX A;  1YJ9 A;  3JCM c;  3BE3 A;  2RHY A;  1ZUK A;  2JW4 A;  2J6O A;  2HAX A;  1Q95 G;  4J7I A;  2D6F A;  4C8Q B;  1RAI B;  1Z9Z A;  4LNP A;  2O9S A;  2DA9 A;  4LDY A;  4KGX B;  1PCX A;  1N5Z A;  1X01 A;  5GAM d;  1M3B A;  3VS2 A;  7AT1 B;  2DVE A;  2E6Z A;  3T9N A;  1H64 1;  1TS9 A;  3CCS A;  5CKB A;  1KFZ A;  1QQJ A;  3G71 A;  5IHK A;  2YRD A;  1X6B A;  3SB2 A;  1BCM A;  1ZBX A;  3N5B B;  1UJ0 A;  4L6V 5;  2LVM A;  3J7A F;  5GAO r;  1YP5 A;  1CKB A;  3L2Z A;  2CGH A;  3Q1J A;  3CCR Q;  1VQ9 Q;  1SRL A;  3J80 E;  3R6N A;  2YLC A;  1RL2 A;  2KXD A;  3OYB A;  4RG2 A;  3M56 A;  3OA6 A;  1OOT A;  3JB9 F;  3JSC A;  2K4Y A;  1Q81 U;  2F5T X;  1Q82 C;  1UE9 A;  1KQ1 A;  4DOV A;  3CCM A;  4DOW A;  1TSF A;  3AT1 B;  2MF2 A;  3M58 A;  3RKY A;  1D3B A;  4KH1 B;  4OMQ A;  1ZA1 B;  5D6W A;  4BE0 A;  1RI9 A;  5GAN d;  3A8O B;  2AKL A;  2EKO A;  3TCJ A;  1SKU B;  1VQ4 T;  1ZUY A;  2OTL T;  1BIB A;  1WHG A;  2RI5 A;  1WHL A;  3PE0 A;  2C0I A;  2LDM A;  1QVG S;  5FRM A;  4M7D C;  1GRI A;  2X35 A;  1LOJ A;  1UB4 A;  3GBQ A;  3MET A;  1TU0 B;  2KNB B;  2RI2 A;  3JCM d;  3PIO A;  3OYE A;  3L1A A;  3UWN A;  4LUD A;  2LQK A;  1NPP A;  4E7K A;  3QG1 A;  3M57 A;  2NYS A;  3PMT A;  1WFW A;  1OPL A;  4BI4 A;  4LE9 A;  2CZ6 B;  5GAM f;  1JU5 C;  3LLR A;  4KGV B;  2EYW A;  4M7A B;  2EYZ A;  2M02 A;  2Y4Y A;  3J81 E;  2QA4 A;  2C06 A;  4JS5 A;  3V8L A;  4XTU A;  1WA7 A;  3A8G B;  4Z02 A;  4DEY A;  1B3Q A;  1U1T A;  1I5L A;  3CCL T;  3GNF B;  2RNA A;  4O6J A;  2WSC E;  2PVG B;  4AMC A;  1Q86 C;  4C0Z A;  2XDB A;  2NLU A;  2GFA A;  3GF5 A;  2ZCF B;  3PNW C;  1VQP Q;  4ZNX A;  5LJ5 g;  1UHF A;  1YIT T;  2A28 A;  3RNJ A;  2YUN A;  2CP6 A;  2CP3 A;  1B34 A;  4Z8A A;  1PD1 A;  3HSB A;  4EIK A;  2C0T A;  1NEB A;  3VS4 A;  5GAO l;  5CIU A;  1TWB A;  1D1C A;  1LNX A;  2R58 A;  1VYU A;  2B8A A;  2ATC B;  4OMF B;  2CS7 A;  1UHC A;  2PQW A;  2O9V A;  1VUB A;  3EGX A;  1PKS A;  3PGG A;  4AG2 C;  3I5R A;  3CME A;  3OYN A;  2ZGW A;  3EFR A;  2R57 A;  1X69 A;  2CKK A;  1YJN A;  1UGV A;  1WYX A;  1ZQ1 A;  3OSV A;  2COZ A;  2AZV A;  1E6H A;  2KE9 A;  2BTT A;  1MGQ A;  3NTH A;  2P84 A;  2CYZ B;  4ORZ A;  1WDX A;  1TUD A;  3RKW A;  3I56 Q;  4HKE A;  2QQB A;  4PJL A;  1Q82 U;  1I0C A;  1QP3 A;  1BBZ A;  2GBQ A;  1UJY A;  3CQT A;  1D1B A;  1NG2 A;  2KSS A;  3G4S T;  3QJY A;  1GCQ A;  4PJN A;  2FZC B;  2JJ9 A;  5KCH A;  3CXC S;  4OGE A;  3QZ5 B;  3CCV T;  2JTF A;  2KK4 A;  5LJ3 h;  4OMN A;  4BB7 A;  4L5G A;  2CSI A;  5GAO p;  4J7F A;  4D6W A;  3MHX A;  1OU8 A;  1BU1 A;  1Y07 A;  4ELZ C;  1YWP A;  3SHW A;  1KC8 U;  4LDX A;  2ROL A;  3A1P A;  2V1R A;  4D8K A;  5KE3 A;  4JLI A;  4JRI A;  3MCA B;  2RK1 A;  2HZY A;  2LJ1 A;  2X3W D;  3M55 A;  1YIJ T;  4HT8 A;  1M8V A;  2OI3 A;  2YXY A;  2VVK A;  1X27 A;  4J5Y A;  5CCA A;  3M9Q A;  1WQW A;  1WXT A;  1I4K 1;  3VS7 A;  2FO0 A;  1D3B B;  1UGP B;  2ZAE A;  2CP0 A;  1SHG A;  3A5Z B;  4Y91 A;  1GXI E;  4FYY B;  1H3H A;  1RI0 A;  1VQM Q;  5LJ3 j;  4Z89 A;  4P5N A;  2M0O A;  2OTL A;  1ZBJ A;  5EG2 A;  3D7S B;  1RAG B;  5GAN 7;  1IRX A;  3HP9 A;  2X3X D;  5IHN A;  2RHZ A;  1VQO T;  2RD1 A;  2DTO A;  3OYI A;  1Q86 U;  4PK4 A;  3C94 A;  1BIA A;  1W70 A;  3VRY A;  4PLI A;  2OAW A;  3OYG A;  1Q81 R;  3JCM V;  5IT9 E;  2OTJ A;  1M3A A;  2DXB A;  3CXC P;  3OY9 A;  2M9U A;  3ZFJ A;  3E2U A;  2HEQ A;  2QAS A;  2MOX A;  2EGE A;  2DM1 A;  1ZSZ C;  3NGP A;  3JB9 J;  2FPF A;  5FU6 B;  3I9Q A;  3X24 B;  2VUB A;  1WI7 A;  4Y28 E;  1WJQ A;  5GMK i;  2RI3 A;  3CCL A;  4BUG A;  1EZZ B;  1FYN A;  2WSF E;  5AT1 B;  2L2P A;  2D9T A;  1GBR A;  1UTI A;  5A0G A;  2HNI A;  4RUG A;  3E9F A;  1FMV A;  1GCP A;  8AT1 B;  2LJ0 A;  5CO7 A;  2E5Q A;  4MMK A;  4E7S A;  4OGC A;  2RQR A;  2XDD A;  1YIT A;  4IIO A;  3GPL A;  1YHQ Q;  2MYS A;  2JN0 A;  2DNU A;  1KJW A;  1B34 B;  2LQ8 A;  1FX7 A;  1OEB A;  4M7D D;  2MWO A;  4C5E A;  4J83 A;  2F2W A;  1VYV A;  3NPF A;  3VS5 A;  3EGU A;  4KGZ B;  4PFO A;  5HCK A;  5L8R E;  4M7D A;  2E70 A;  2CUB A;  1D0Z A;  3CD6 Q;  2ROT A;  1VQK Q;  3OMC A;  1T3S A;  3TRE A;  1RLQ C;  3RMQ A;  1GFC A;  3EGX B;  5CKE A;  1QCF A;  3DKM A;  1WNL A;  3PTA A;  5C0M A;  1EX4 A;  2E41 A;  4XTW A;  1MUZ A;  4ZGJ B;  4C5G A;  1I1J A;  2PVD B;  3OS1 A;  4RTW A;  4ZTJ A;  2XG8 D;  1YI2 Q;  1VQ8 T;  1V29 B;  3UPU A;  3NMZ C;  4OVA A;  1ARK A;  4BI8 B;  3RKX A;  4RTU A;  5IXF A;  3LX7 A;  4PL6 A;  2KRS A;  4F7U A;  5J3B A;  4J9F A;  1VQL T;  1D0Y A;  1W6X A;  1OZ3 A;  4E47 A;  5GAM h;  2GQI A;  4FW1 A;  1HYO A;  2ABL A;  1TUG B;  4X34 A;  5CKF A;  1HK9 A;  2D8J A;  2EVR A;  2CUD A;  3G4S A;  5LJ5 d;  2PUO B;  5LJ3 e;  4M7D F;  3CCV A;  1TOV A;  1T0H A;  1M2V A;  3VJP A;  2QQ9 A;  1V76 A;  4BI3 A;  1NYF A;  3OS0 A;  1TG0 A;  4DEX A;  1ZHI A;  1CSK A;  4VUB A;  1T0J A;  3CC2 Q;  4LD9 K;  1VQN T;  2EGC A;  4JJB A;  3ZEH A;  2O31 A;  3SD4 A;  4GLM A;  5CKH A;  1NYG A;  2LZ6 B;  3EFO A;  2J7I A;  2QI2 A;  3S3N A;  4V2S A;  3QZ9 B;  4FYX B;  5KCO A;  1YIJ A;  1X43 A;  2F2V A;  2RM4 A;  1M27 C;  1MND A;  2CH4 A;  1Q82 R;  4A54 A;  2NUZ A;  4HCZ A;  1NM7 A;  2QGF B;  4X9C A;  4F7U F;  2F1L A;  3C95 A;  3VUZ A;  1VQ6 T;  5KH6 A;  1JRI A;  1O9S A;  5GMK j;  1X2K A;  4RTV A;  1BI1 A;  3M0U A;  2DTH A;  2E3H A;  4BDZ A;  5I2M A;  3CCU Q;  2QTV A;  1MV0 B;  2HKN A;  1UEB A;  3CCQ Q;  1QVP A;  4XTY A;  1YJ9 Q;  5EC7 A;  3V8K A;  3MP6 A;  2OAU A;  1VA7 A;  4JZ3 A;  2P0K A;  2YWW A;  1AWX A;  2DJZ A;  3OSS C;  3CCJ A;  2KYM A;  3QBY A;  2VWF A;  3OYK A;  4HCB A;  3H0I A;  4LDU A;  1H8K A;  5CQY A;  3OYD A;  2JM9 A;  4A4G A;  3FJP A;  2KRN A;  2LTO A;  4J9B A;  1IO6 A;  2B86 A;  3ME9 A;  1K0S A;  5IN1 A;  3CCS Q;  2EQU A;  1K9M C;  2ZPG B;  3RR6 A;  1N27 A;  2IPO B;  4FIB A;  2QXF A;  4N0A C;  4BE2 A;  3F70 A;  4KBM B;  5KE2 A;  1WXB A;  3CCR T;  1VQ9 T;  2VKN A;  2AT1 B;  2CZ0 B;  4C92 C;  1MHN A;  4XU0 A;  2LP5 A;  2K6D A;  3CC4 Q;  5GAN 4;  2EJF A;  1Q86 R;  2KDS A;  4PKC C;  3M4Y A;  2W0Z A;  4QQD A;  1WXU A;  3MO8 A;  1D1A A;  2J05 A;  2H3J A;  2FRW A;  3RDV A;  4IUR A;  3CCM Q;  1G3S A;  2ZPF B;  1KD1 C;  2JMC A;  2YDL A;  4HT9 A;  3TEE A;  4M7D B;  1FMK A;  5I11 A;  3A8M B;  3G6E Q;  1I07 A;  1RUW A;  2YT6 A;  4R55 A;  2LCS A;  3TQ7 P;  3V8J A;  1D0X A;  2DBM A;  5CAI A;  1HXD A;  4JJN K;  5KYU A;  3MEA A;  3TVT A;  2JTM A;  5CVI A;  2LMJ A;  1WHK A;  2DX1 A;  2HDA A;  2DLP A;  3SDZ A;  3WXM B;  1ZSZ A;  2VC8 A;  1MMA A;  3HHT B;  1VQ8 A;  1KK7 A;  4PFP A;  2K3B A;  4F7U B;  1VQL A;  1G2B A;  3QO3 A;  5GAN 5;  3RES A;  2DL7 A;  2QA4 Q;  1VQ5 Q;  4OB2 B;  1SF9 A;  1M3C A;  2KEA A;  5GMK l;  3C12 A;  2EJG A;  5GMK e;  5FRN A;  2LT1 A;  4J9D A;  1SSH A;  3HL8 A;  4F16 A;  4A4F A;  4RCC A;  1M2V B;  1WX6 A;  1KQ2 A;  2LX9 A;  1OU9 A;  2DAQ A;  3DLL A;  2KAF A;  3L2U A;  1B07 A;  1TTH B;  2QQS A;  1ZUU A;  4LDW A;  2KY9 A;  2VV5 A;  3KFV A;  3EG3 A;  1KQS A;  1QCN A;  3WVD B;  2LT4 A;  3EH2 A;  1RAE B;  2DBK A;  3EFO B;  4J9G A;  2VB6 A;  4MZT A;  2CZ7 B;  3HPW A;  2FZK B;  2IVW A;  4NOY A;  2GCX A;  4OB1 B;  4XU1 A;  3SWN C;  2GTJ A;  3CC7 Q;  1LVK A;  2JOY A;  1VQ6 A;  5DLO A;  1KC8 C;  3PT9 A;  2R5M A;  2H8H A;  2PVO B;  1K9M U;  4IIM A;  4OMO A;  2HBP A;  4X1V A;  4QVZ A;  1W1F A;  2KQW A;  1QLY A;  5A2Q E;  1XQH A;  1YJN Q;  1U8R A;  2F5K A;  2DKG A;  2NUT A;  2PU9 B;  2KRO A;  2Y4X A;  1X6G A;  1B7T A;  2VAS A;  3LH0 A;  2A7Y A;  1SRM A;  2MWP A;  4Y92 A;  5CK9 A;  2RJE A;  2K5I A;  2P4R A;  4UC4 A;  5HY6 A;  3E1S A;  3V7R A;  2DZ9 A;  3OS5 A;  2DRK A;  1VIF A;  2XDP A;  1KG1 A;  1KD1 U;  3FLG A;  3M0S A;  3FDR A;  3TSZ A;  1HJD A;  3X28 B;  3BDL A;  1JXO A;  4HVW A;  2PZ1 A;  1OPK A;  1K73 C;  3JCM b;  2PUK B;  3EG9 A;  4N4G A;  3L2R A;  1BI0 A;  5LJ3 g;  1BCO A;  3RER A;  5IAY A;  3BDU A;  4M7D E;  1M1K U;  1UDL A;  2MPX C;  3I5S A;  5GAN f;  3M59 A;  2EKH A;  1UEC A;  3A8L B;  1H3Z A;  3KXT A;  4J9C A;  2JS2 A;  3QWY A;  1SSF A;  1C0M A;  3KBG A;  1VIE A;  1KHC A;  1UGS B;  2EQI A;  1WJR A;  1Z9Q A;  3JAM E;  4XQ3 A;  2SEM A;  1Y96 A;  1QKW A;  3GP8 A;  4LXC A;  3JCM f;  4EMG A;  1M1K R;  1RAC B;  5GJW B;  2CRE A;  5KYU B;  3LW5 E;  4M78 C;  4XU3 A;  1JQQ A;  3VUB A;  4F7U E;  5KYY A;  3VU3 C;  4FL6 A;  3EG1 A;  1RLP C;  1UGR B;  1ZSZ B;  4FT2 A;  3VV0 A;  1JJ2 A;  2OTJ Q;  2QG9 B;  9ATC B;  2R5A A;  4JZ4 A;  4C92 D;  4N0A A;  2DL8 A;  3HFN A;  4QT7 A;  2WSE E;  3OMG A;  1AT1 B;  1AHJ B;  4K11 A;  4A4H A;  2XID A;  2RJD A;  5AYF A;  2XU8 A;  3EGD A;  3LH5 A;  2FHD A;  2RQT A;  2BZY A;  3PIP A;  2ESW A;  1XJW B;  1MV3 A;  1UGQ B;  2GQV A;  5HK0 A;  4XTZ A;  4R56 A;  1U5S A;  1OX8 A;  3GLX A;  5GAN 6;  3I55 Q;  2CDT A;  4M7D G;  2QEX Q;  3RIR A;  3ULR B;  3EG0 A;  4MZP A;  2O2O A;  4DBQ A;  3TU4 K;  2DF6 A;  3QII A;  4ESR A;  1VQ4 A;  1JB0 E;  2C0O A;  3CPF A;  4NL2 A;  3CD6 T;  4M78 E;  1FXX A;  2ED0 A;  2KVQ G;  1VQK T;  4EMK C;  1QWE A;  3H0H A;  4M75 C;  2KT8 A;  2QK0 A;  2EJ9 A;  1WLP B;  2QDY B;  5GAO m;  2GNC A;  4B9X A;  2V1Q A;  3OYC A;  1VQ7 Q;  4QVC A;  2GF7 A;  2EYX A;  2DER A;  4Q5W A;  4JJD A;  4F7U G;  2L3S A;  3H6Z A;  4JPB W;  3OBY A;  4WCI A;  1K73 U;  1YI2 T;  1QVF A;  4A63 B;  4MDX A;  2NUT B;  2BIV A;  1WPY A;  1BKB A;  3X25 B;  1EFN A;  2KYB A;  1PC0 A;  2CP2 A;  2I2L A;  4KUL A;  1XTD A;  4ATO A;  3OYJ A;  1G83 A;  3CBO A;  2JS0 A;  1Y57 A;  4X9D A;  1M1F A;  3MPU B;  4IUP A;  1K9M R;  2LCL A;  2EQM A;  2KMT A;  3L42 A;  3CPW A;  1R0B G;  4XU2 A;  4KH0 B;  1S72 Q;  4ZN3 A;  2XK0 A;  1MMD A;  4LD6 A;  3EG9 B;  3O8V A;  2FPD A;  2PTK A;  2F2X A;  2RJF A;  4FYW B;  4J9E A;  5D7U A;  1WJS A;  3SWN A;  5IHI A;  3THK A;  3ZL7 C;  3H0F A;  4M75 E;  5I22 A;  1QMC A;  2LX7 A;  4M77 C;  2KR3 A;  1YIJ Q;  4HCK A;  3LGL A;  3M0R A;  5FWB A;  1CKA A;  1WIE A;  2LC4 A;  1LJO A;  4M78 G;  5IXB A;  1FMW A;  1PG5 B;  4HA8 A;  4PJJ A;  5GJV B;  1AZE A;  3CBP A;  1KD1 R;  1PHT A;  4IUQ A;  5KYX A;  5CR2 A;  1AWO A;  1ABQ A;  3CCU T;  1Y96 B;  2DPP B;  2YRV A;  3CCQ T;  3LYI A;  2EGA A;  1YJW Q;  2RQV A;  2VYT A;  1QP2 A;  3VS6 A;  2HQH A;  4J9H A;  2P4T A;  5HKC A;  2E5K A;  3JCM J;  5C6S A;  3OYH A;  2YUO A;  2RHI A;  4OF1 A;  4PJO C;  1PD0 A;  1QW1 A;  5FRO A;  3PMI A;  1VOM A;  5KYY B;  1IHW A;  4OMP A;  1RAD B;  5HK3 A;  2CT4 A;  1ZSG A;  3VS0 A; 
#chains in the Genus database with same CATH homology
 3LLR A;  1I8F A;  4ELY C;  1Y7X A;  2QA4 A;  4M7A B;  3E19 A;  2C06 A;  4IUR A;  2Y4Y A;  4IUV A;  3JCM X;  5CKD A;  2K3X A;  2JVV A;  2V8I A;  3J81 E;  1G3S A;  3V8L A;  2RK2 A;  1IRE B;  2ZPF B;  4XTU A;  3L2Q A;  4JS5 A;  1KD1 C;  4HCC A;  5LJ5 j;  4HT9 A;  1N6A A;  2V8K A;  3QJ6 A;  4QW2 A;  3A8G B;  2K3Y A;  4Z02 A;  3TEE A;  2E12 A;  2JNG A;  1OYX A;  2X4W A;  4M7D B;  3DLM A;  3S6W A;  4C92 F;  3A8M B;  1Q7Y C;  1U1T A;  4YTL A;  1I5L A;  3ER0 A;  3CCL T;  2E6N A;  4R55 A;  5LJ3 d;  3GNF B;  2YHT A;  4O6J A;  3V8J A;  3HKS A;  4JRP A;  2WSC E;  2PVG B;  1YJW T;  5CAI A;  4PJO B;  1HXD A;  2RH2 A;  1Q86 C;  4C0Z A;  4JJN K;  4MML A;  4BE1 A;  3MEA A;  2XDB A;  2NLU A;  2JTM A;  3FEO A;  3M53 A;  5CVI A;  4C8Q G;  3P8B B;  1QVG A;  2GFA A;  3GF5 A;  3CC4 T;  4M77 E;  2ZCF B;  3PNW C;  4KT0 E;  2DD4 A;  4EPC A;  1I81 A;  2WAC A;  1KQS S;  5D6Y A;  5LJ5 g;  3SDZ A;  1YIT T;  2E65 A;  3WXM B;  2VC8 A;  3I56 A;  4RG8 A;  1NJI C;  5GAM j;  4MZM A;  3HHT B;  4GLK A;  1VQ8 A;  3QYG B;  4M7A E;  4J6Y A;  1B34 A;  5DY9 A;  4M75 G;  3CCJ T;  5J39 A;  3OW2 S;  3X26 B;  3PFS A;  4PLL A;  3HSB A;  4OB3 B;  2LRQ A;  4F7U B;  1M5Q 1;  1VQL A;  5GAO l;  3CCM T;  1K8A C;  3OBW A;  5CIU A;  1PSE A;  3QO3 A;  5GAN h;  5GAN 5;  2BKD N;  3RES A;  2A3L A;  2XHC A;  1LNX A;  2R58 A;  4M78 D;  1M1G A;  1WQ7 A;  4ZTF A;  2E10 A;  4PNO A;  2B8A A;  4OB2 B;  4OMF B;  3G6E T;  3CCE T;  2CS7 A;  1M90 C;  5GMK l;  3OYF A;  3NTK A;  1VQK A;  3C12 A;  2EJG A;  2PQW A;  4M78 A;  3A8H B;  4C0D C;  5GMK e;  1VUB A;  5GAM g;  5FRN A;  2LT1 A;  4JDS A;  3PGG A;  3CEY A;  4BD3 A;  3CC2 T;  3HL8 A;  1VQO A;  3G7Z A;  3CME A;  4A4F A;  4RCC A;  3OYN A;  2ZGW A;  3EFR A;  3JCM h;  2R57 A;  1KQ2 A;  2LX9 A;  2CKK A;  1YJN A;  2QQR A;  2DAQ A;  5FLX E;  3DLL A;  2KAF A;  1ZQ1 A;  3ZBD A;  3OSV A;  3L2U A;  1EIF A;  2DTI A;  5GAN 3;  3FRN A;  2QQS A;  4C0G A;  5GAN 2;  4LDW A;  3OYY A;  2KY9 A;  2VV5 A;  3CMA T;  1P92 A;  1MGQ A;  2E64 A;  3NTH A;  1KQS A;  1NE8 A;  2CYZ B;  3WVD B;  3QYH B;  2MMP A;  4XTV A;  2LT4 A;  4LDV A;  5GAO n;  3I55 A;  3LWI A;  2Y90 A;  4O5V A;  3RKW A;  3RUX A;  1BYM A;  4HKE A;  2QQB A;  3VYG A;  4MZT A;  3GIB A;  3S3O A;  2QEX A;  1Q82 U;  4DA4 A;  5GAN j;  5DM7 R;  2CZ7 B;  1QP3 A;  3HPW A;  4JUV A;  2IVW A;  4C0D B;  4IKF A;  3M5A A;  1VQM A;  4NOY A;  2GCX A;  5LJ5 f;  2KSS A;  4OB1 B;  4XU1 A;  3G4S T;  3QJY A;  2P0Q A;  1N9R A;  2X4X A;  3SWN C;  2QA4 T;  1VQ5 T;  4NL3 A;  2JOY A;  2DXC A;  2EFI A;  4A4E A;  2L5Q A;  5KCH A;  1VQ6 A;  5DLO A;  3NTI A;  3P8H A;  4XK8 E;  3CXC S;  1KC8 C;  3PT9 A;  4OGE A;  3QZ5 B;  5D6X A;  2JTF A;  2KK4 A;  4J6W A;  3CCV T;  1DJ7 B;  2R5M A;  5LJ3 h;  4BB7 A;  2G3R A;  4L5G A;  2PVO B;  5GAO p;  1K9M U;  3JCM P;  2O01 E;  3HRT A;  3BY7 A;  3VYH B;  4J7F A;  1YJ9 T;  1TH7 A;  4D6W A;  2HBP A;  3MHX A;  4QVZ A;  4M78 F;  4C8Q D;  4EDU A;  1VQ7 A;  1Y07 A;  4ELZ C;  3QHS A;  2DIQ A;  3E9G A;  4J6X A;  5A0D A;  1BI3 A;  1NPR A;  2KQW A;  4M77 G;  2K2V A;  4IUU A;  1KC8 U;  2ZZD A;  3GOX A;  4LDX A;  3SFM A;  5A2Q E;  1XQH A;  4C8Q A;  5KE3 A;  1U8R A;  4JLI A;  2F5K A;  3INZ A;  4FSX A;  4JRI A;  3MCA B;  2DKG A;  2RK1 A;  2PU9 B;  2Y4X A;  4CI0 C;  2DO3 A;  3M55 A;  4M7A G;  4M75 D;  1YIJ T;  3LH0 A;  4HT8 A;  2A7Y A;  1M8V A;  3HRS A;  2MWP A;  2D0Q B;  2VGN A;  3OYA A;  3SWN B;  4EMK A;  3HRU A;  5CK9 A;  3JRZ A;  2RJE A;  2K5I A;  3JCM g;  4J5Y A;  2EQK A;  3CCS T;  3G71 T;  4M75 A;  5CCA A;  3V7C A;  3M9Q A;  1WQW A;  1YCY A;  4UC4 A;  1I4K 1;  2O4X B;  3OQ5 A;  1D3B B;  1UGP B;  4C92 B;  5HY6 A;  3E1S A;  3V7R A;  4EMH A;  2DZ9 A;  2K5F A;  3A5Z B;  4Y91 A;  4N4I A;  3CC7 T;  1GXI E;  4E7L A;  3OS5 A;  5LJ5 e;  2ZPH B;  1RI0 A;  1VIF A;  2XDP A;  2K57 A;  5LJ3 j;  4P5N A;  2M0O A;  2OTL A;  1KD1 U;  1G5V A;  1KG1 A;  2M16 A;  3FLG A;  4DQ2 A;  5EG2 A;  1IZ6 A;  3FDR A;  5GAN 7;  3UT1 A;  5FU7 C;  3X28 B;  2HD0 A;  5FU6 C;  3CXC A;  3BDL A;  3FIF A;  1Q7Y U;  3H8Z A;  3HP9 A;  4FM4 B;  5GMK h;  2F69 A;  3JB9 D;  2RHZ A;  1K73 C;  1VQO T;  3JCM b;  2RD1 A;  1M1K C;  2DTO A;  3OYI A;  2DXU A;  1Q86 U;  1YJN T;  1N8R C;  3C94 A;  1BIA A;  1S72 A;  2DZC A;  1YHQ A;  2PUK B;  4PLI A;  2FL7 A;  1OZ2 A;  2XD0 A;  5I21 A;  2LNV A;  1JJ2 S;  3MEU A;  4N4G A;  1BI0 A;  2DK3 A;  3JCM V;  3OYG A;  3L2R A;  5IT9 E;  2OTJ A;  2XKO C;  2DXB A;  5LJ3 g;  2LCC A;  3OY9 A;  4C8Q F;  3OYL A;  3RER A;  5GAM e;  5IAY A;  3BDU A;  3JB9 H;  4M7D E;  4N4H A;  1W2B S;  2M9U A;  2YLB A;  3ZFJ A;  1M1K U;  1NJI U;  5GAN f;  3M59 A;  4C92 E;  4RKU E;  3A8L B;  2EAY A;  1H3Z A;  2DXT A;  3CD6 A;  5CQX A;  3JB9 J;  3KXT A;  2CZ1 B;  4IUT A;  5FU7 B;  3JB9 I;  2VXF A;  4J8O A;  5FU6 B;  4BAC A;  4PJO E;  1SSF A;  3S3M A;  1K8A U;  3KBG A;  4M75 F;  1VIE A;  1KHC A;  3X24 B;  1UGS B;  4A4K A;  2HQE A;  2VUB A;  1WJR A;  2FVU A;  2EYQ A;  4C5I A;  2EQJ A;  3JAM E;  4XQ3 A;  4Y28 E;  1Y96 A;  1WJQ A;  3GP8 A;  3C4S A;  5GMK i;  2RI3 A;  3RMS A;  3JCM f;  3CCL A;  4BUG A;  2WSF E;  1Y71 A;  3JB9 G;  4EMG A;  1VQP T;  1M90 U;  3BW1 A;  1G3Y A;  2D9T A;  2XIC A;  5A0G A;  1YJW A;  4FT4 A;  1VQN A;  2HNI A;  2RHU A;  1OI1 A;  4M77 D;  4E7H A;  3LW5 E;  1Q81 C;  4XAX B;  4FU6 A;  1YI2 A;  3KUF A;  3AHU A;  3E9F A;  2ZPB B;  4M78 C;  4XU3 A;  3CC4 A;  3VKI A;  5CO7 A;  4BY6 C;  3UDC A;  2E5Q A;  3VUB A;  4F7U E;  4M77 A;  4QVD A;  3MP1 A;  4FL6 A;  4MMK A;  3VU3 C;  4OGC A;  4L59 A;  2XDD A;  3QUI A;  1YIT A;  4WF2 A;  1UGR B;  5GAO q;  2ZPE B;  4FT2 A;  3GPL A;  4M7A D;  2JN0 A;  3OW2 A;  4KUI A;  3VV0 A;  1JJ2 A;  1G3W A;  4GY5 A;  3EAE A;  1B34 B;  4JS4 A;  1U1S A;  2LQ8 A;  1FX7 A;  2HQX A;  2R5A A;  2RA2 A;  2MWO A;  2RHX A;  4M7A A;  4M7D D;  1X75 C;  4C5E A;  2RO0 A;  3V7S A;  4J83 A;  1W2B A;  4QQG A;  4C92 D;  5GAN e;  1W4S A;  4N0A A;  3HFN A;  3HFO A;  1WGS A;  3GNG A;  1FWZ A;  5L8R E;  3EFS A;  4ZGE B;  2E70 A;  4M7D A;  2WSE E;  3OYM A;  3OMG A;  1AHJ B;  1KHI A;  1N9S A;  5LJ3 f;  3DB3 A;  4PJO D;  4A4H A;  2GFU A;  2XID A;  2RJC A;  3QKJ A;  2RJD A;  5AYF A;  3X20 B;  3G6E A;  3CCE A;  4A53 A;  3OMC A;  4BDY A;  4TVR A;  3WVE B;  2XU8 A;  4ZN1 A;  3TRE A;  4M78 B;  4PJO A;  2FHD A;  3RMQ A;  2RB6 A;  4BY6 B;  2L89 A;  2FB7 A;  2VGM A;  5CKE A;  5GAN g;  3M4G A;  3CC2 A;  3M54 A;  3DKM A;  3JCM e;  3PIP A;  3CBM A;  4CRI A;  3QPH A;  1WNL A;  3PTA A;  5C0M A;  1M9S A;  2E41 A;  4XTW A;  1QVF S;  1O75 A;  1UGQ B;  2GQV A;  5DLQ E;  4B9W A;  2XI9 A;  4ZGJ B;  2QTX A;  5HK0 A;  4XTZ A;  4C5G A;  2PVD B;  3OS1 A;  3LWH A;  1YBY A;  1BI2 A;  3P8D A;  4R56 A;  3I56 T;  4II1 A;  4ZTJ A;  2MAM A;  2X4J A;  2XG8 D;  4E7I A;  1VQ8 T;  3GLX A;  1V29 B;  3CMA A;  3UPU A;  1PSF A;  4OVA A;  5GAN 6;  3DB4 A;  4BI8 B;  3RKX A;  2L8D A;  5GAN 8;  4M7D G;  4M77 F;  3FC3 A;  2OTJ T;  4C5H A;  3LX7 A;  4PL6 A;  4F7U A;  4C92 G;  5J3B A;  4E7J A;  3JCM W;  4JLG A;  1VQL T;  3RIR A;  4C8Q C;  4ME7 A;  3JCM Q;  2DEQ A;  1OZ3 A;  4MZP A;  4E47 A;  5GAM h;  3L2W A;  4RCB A;  3TU4 K;  1R8O B;  4PJO G;  3QII A;  4X34 A;  5A0L A;  4NS5 A;  5CKF A;  1VQ4 A;  4M7A F;  2X4Y A;  1HK9 A;  1JB0 E;  3G4S A;  3CPF A;  4NL2 A;  3CD6 T;  4OB0 B;  4M78 E;  1FXX A;  2V8J A;  2KVQ G;  1VQ5 A;  1VQK T;  4EMK C;  1JBM A;  3CCU A;  3MEW A;  5LJ5 d;  2PUO B;  4QQ6 A;  5LJ3 e;  3CCQ A;  4M7D F;  2P0P A;  4RMO A;  4M75 C;  3CCV A;  3CCR A;  1VQ9 A;  4OP0 A;  2EJ9 A;  1G3T A;  3CME T;  2QDY B;  3FB9 A;  5GAO m;  3VJP A;  4B9X A;  3CPW S;  2QQ9 A;  4BI3 A;  1XNI A;  1YJ9 A;  3URG A;  3OYC A;  3JCM c;  3OS0 A;  2EWN A;  4QVC A;  2GF7 A;  1ZHI A;  3R6O A;  2RHY A;  4JRQ A;  4VUB A;  4PJO F;  2BUD A;  1X6O A;  4LD9 K;  1VQN T;  2HAX A;  4KUD K;  4Q5W A;  4F7U G;  3H6Z A;  5GMK m;  3OBY A;  2JZ2 A;  4J7I A;  3ZEH A;  1YI2 T;  4C8Q B;  1K73 U;  2D6F A;  1QVF A;  2VXE A;  3SD4 A;  2K5L A;  4MDX A;  4LDY A;  3I55 T;  2IG0 A;  2BIV A;  5CKH A;  1WPY A;  1N8R U;  1BKB A;  2M1H A;  3X25 B;  2E1H A;  2QI2 A;  3S3N A;  4V2S A;  3QZ9 B;  1X01 A;  5KCO A;  5GAM d;  1YIJ A;  2QEX T;  2DD5 A;  2DVE A;  5LL6 S;  2RM4 A;  2E6Z A;  3MEV A;  1H64 1;  3T9N A;  4EMK B;  2I2L A;  4A54 A;  1VQM T;  4HCZ A;  3CCS A;  4KUL A;  5CKB A;  5I2S A;  3G71 A;  4M75 B;  1XTD A;  4X9C A;  4ATO A;  3OYJ A;  3BFM A;  3LGF A;  4F7U F;  3C95 A;  4JRK A;  3SB2 A;  3VUZ A;  1VQ6 T;  5KH6 A;  3CBO A;  3CC7 A;  1JRI A;  1O9S A;  1ZBX A;  3N5B B;  4L6V 5;  2EIF A;  5GMK j;  2LVM A;  3J7A F;  1BI1 A;  4X9D A;  2DTH A;  5GAO r;  1M1F A;  4BDZ A;  5I2M A;  4IUP A;  2FYK A;  2LCL A;  1UEB A;  3L2Z A;  2CGH A;  1VQ7 T;  3QSU A;  3Q1J A;  2EQM A;  3QDR B;  2DIG A;  3J80 E;  2KMT A;  3L42 A;  1QVP A;  4XTY A;  4C8Q E;  4ZGD B;  2JUF A;  3CPW A;  2YLC A;  1RL2 A;  4XU2 A;  2AHJ B;  3QXE B;  3MP6 A;  2OAU A;  5J26 A;  3V8K A;  3OYB A;  2P0K A;  4RG2 A;  3M56 A;  4ZN3 A;  3OA6 A;  2XK0 A;  3JB9 F;  3JSC A;  2K4Y A;  3OB9 A;  2DJZ A;  4LD6 A;  1Q81 U;  3O8V A;  2RJF A;  3OSS C;  3CCJ A;  2F5T X;  1Q82 C;  3QBY A;  3OYK A;  1WJS A;  3SWN A;  1KQ1 A;  4DOV A;  4HCB A;  4M75 E;  4DOW A;  3CCM A;  4C0F A;  4LDU A;  2ZPI B;  2MF2 A;  3M58 A;  3NFC A;  4M77 C;  3RKY A;  2O4X A;  5CQY A;  1D3B A;  5D6W A;  3MP8 A;  3OYD A;  4C92 A;  4BE0 A;  3LGL A;  4A4G A;  3FJP A;  2LTO A;  5GAN d;  3ME9 A;  3A8O B;  2EKO A;  2QQA A;  5IN1 A;  3TCJ A;  2LC4 A;  1LJO A;  4M78 G;  2EQU A;  5LJ5 h;  1K9M C;  1VQ4 T;  2OTL T;  2ZPG B;  2MI6 A;  1BIB A;  4HA8 A;  5M9O A;  4M7A C;  2L3R A;  2RI5 A;  3CBP A;  4IUQ A;  5CR2 A;  1N27 A;  3OS2 A;  3L2V A;  1NZ9 A;  3CCU T;  4FIB A;  1Y96 B;  2QXF A;  4MDW A;  4N0A C;  3F70 A;  4BE2 A;  2DPP B;  2LDM A;  1M4Z A;  2YRV A;  3CCQ T;  1QVG S;  4KBM B;  5KE2 A;  3LYI A;  5FRM A;  4M7D C;  3CCR T;  2X35 A;  2VYT A;  1VQ9 T;  1VQP A;  1LOJ A;  1UB4 A;  1QP2 A;  2CZ0 B;  4C92 C;  3MET A;  1MHN A;  2P4T A;  4XU0 A;  2RI2 A;  5HKC A;  3JCM d;  5C6S A;  3PIO A;  3OYE A;  3JCM J;  3OYH A;  3L1A A;  3UWN A;  1S72 T;  2LQK A;  1YHQ T;  1NPP A;  4E7K A;  3QG1 A;  5GAN 4;  2EJF A;  3M57 A;  2RHI A;  4OF1 A;  4PJO C;  1QW1 A;  3PMT A;  2KDS A;  5FRO A;  3PMI A;  4M77 B;  4PKC C;  3M4Y A;  4QQD A;  3MO8 A;  4BI4 A;  5HK3 A;  2H3J A;  1XOV A;  3ASK A;  2CZ6 B;  5GAM f;  4XTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...