4M75B

Crystal structure of lsm1-7 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
91
structure length
91
Chain Sequence
b'MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
molecule tags Rna binding protein
source organism Saccharomyces cerevisiae
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
total genus 13
structure length 91
sequence length 91
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75B00
1I8FA 1M5Q1 3QUIA 5LJ5d 2VXEA 4XTXA 4PNOA 3JB9J 1MGQA 2DKGA 5GAOq 2EWNA 2VXFA 3V8JA 4M7DG 2YLCA 1U1TA 4M75F 2RD1A 2DXTA 5GANd 2EAYA 4XU1A 4EMGA 4XTWA 3JCMb 3JB9H 3JCMQ 4M78A 5GMKj 3JB9D 5GAMf 5I21A 2K57A 3JCMg 3RERA 4RCBA 2E1HA 4M7DB 4Y91A 5GAN6 4NOYA 4M7AA 5LJ3j 5LJ5g 4EMKC 1JRIA 4M78C 3V7SA 3JCMJ 1LNXA 3QSUA 5GAOn 4EMHA 2E65A 1WQ7A 4X9DA 3V8KA 2DVEA 5GMKi 5GAMd 5GAOp 3JCMX 4C8QC 5GAMg 5GAN5 2DZCA 2EJ9A 1LJOA 3QO3A 4M78D 4N0AC 5GMKl 1BIAA 4M75G 4M78E 4HT9A 2RM4A 4OP0A 3BDUA 5GAMh 3SB2A 4M7AD 5GANj 1N9RA 3BW1A 4C8QF 5GAN4 3V7RA 4N0AA 4RCCA 1N9SA 3HFOA 5GANf 4M7DE 3JCMh 5LJ5e 4PJOD 5LJ3h 2Y90A 2DEQA 5LJ3d 4HT8A 5GAMe 2DJZA 3L2ZA 4PJOC 2E64A 3RUXA 2RA2A 4QVCA 4M77F 2HNIA 2JN0A 3RKYA 1I5LA 2EJGA 4C8QE 4QVDA 1HK9A 4XTYA 3EFSA 4HA8A 2VC8A 2DTHA 4M7DF 3RKXA 4M77C 4C8QG 4F7UG 5GAMj 5GAOl 4DQ2A 2DZ9A 2I2LA 3JCMf 4NL3A 4C92D 4XTZA 3RKWA 3EFRA 4M75C 4NL2A 4WF2A 5LJ3e 5GAN3 4C92G 3INZA 5GANh 3AHUA 1H641 3GIBA 3HFNA 3JCMP 5DY9A 4XTVA 3RESA 4A53A 4J6YA 4M7AG 4M7DC 4PJOB 5LJ3f 1BIBA 3SWNC 1KQ1A 4M7AE 4XU0A 3QHSA 4M7AB 3V8LA 2EJFA 4M77D 4M7DA 5GAN7 4J6XA 4C92B 5GAOr 2YLBA 2YHTA 1JBMA 1U1SA 4M78B 2FYKA 3JCMV 4C8QB 4J5YA 5GAN8 5GAOm 3L1AA 2CGHA 3JCMW 1M8VA 3FB9A 3FJPA 1Y96B 2RB6A 1X01A 1TH7A 4PJOG 1HXDA 5GMKh 5LJ5h 3JCMe 5GMKe 2FB7A 1WNLA 5CAIA 3VU3C 4MMKA 4M7AF 3HSBA 5LJ5f 2QTXA 4F7UE 4M75D 4M77B 3M4GA 4MMLA 4C92F 4F7UB 4JLIA 1YCYA 4M78F 4XQ3A 5GAN2 4M77A 4M7DD 2E41A 2DTIA 4C92E 2DXUA 3RIRA 4M7AC 4M75A 1WQWA 4EMKA 1D3BA 4XTUA 3SWNB 4C92C 1B34A 3JCMc 2ZGWA 4XU3A 1Y96A 3BY7A 3JCMd 4J6WA 1B34B 4A54A 3JB9I 4XU2A 1I4K1 4M75E 1LOJA 3SWNA 3BFMA 2E10A 4M77G 1D3BB 4X9CA 3V7CA 4M75B 4C8QA 4C92A 4EMKB 4F7UF 5GANe 5GMKm 2DTOA 5GANg 1WPYA 3PGGA 4M77E 3FIFA 4PJOF 3JB9F 4JUVA 4V2SA 4JRKA 5LJ5j 1KQ2A 4F7UA 5LJ3g 1I81A 4PJOE 4JRIA 3JB9G 4C8QD 4PJOA 4M78G
chains in the Genus database with same CATH superfamily
4HVVA 1PG5B 1YFNA 3JB9J 1PC0A 3ZEHA 2EW3A 2QYZA 3V8JA 3NHNA 3R6NA 2CS7A 4CC3A 4ORZA 3CCJA 1K9AA 1UGPB 1N6AA 4JJBA 2LZ6B 2CUBA 5CQXA 4EIKA 2QASA 5KYUB 3V8KA 3BE3A 2DJQA 2DZCA 2EJ9A 5GMKl 3E9FA 2CYZB 3EGXA 1AZGB 2QTVA 3HKSA 4C8QF 5GAN4 2XDDA 2QI2A 5HK0A 3CBMA 1VIFA 1TUDA 1X43A 1U5SA 4DBFA 3NTKA 3GNFB 2RHUA 2RPNA 1YWOA 2EJGA 1FXXA 5KE2A 2DTHA 4M7DF 5GAOl 1YITT 4AMCA 1V1CA 4WF2A 1YCSB 1J3TA 5GANh 4KUDK 3REAB 2CKKA 2QDYB 3OMGA 3UT1A 1JXMA 4OB2B 1TOVA 3V8LA 1OU9A 3PT9A 4ELYC 4QT7A 3PVQA 1NYFA 2EQMA 2M0YA 3PIPA 1VQ4Q 4BE1A 2BUDA 5CKBA 2YUNA 4R55A 2EYYA 4JRQA 2NLUA 3CCSQ 3LX7A 2AZSA 1RACB 1M90R 5GJVB 4CC2A 1VQ6Q 3G6EA 4KH0B 2LNVA 2RQRA 4QKUA 1VQLQ 5CIUA 4EMKA 1KQSS 1IGQA 1VQMA 1IREB 4X9CA 1MHNA 4ZN3A 2RH2A 4J7FA 3M59A 2EGCA 3EG3A 1R0CB 2M16A 2KYBA 2RMOA 2RI5A 3UATA 4PNOA 2DKGA 4ZN1A 1VQKT 4NS5A 4C0ZA 1VQNA 1H3HA 1UGRB 4FW1A 5IHNA 3U23A 4M78A 2K57A 2CP5A 2DIGA 4C5IA 5CKEA 1NLOC 4AT1B 5LJ3j 1RL2A 1M90C 2LRQA 3CD6A 2DF6A 2CP0A 4L59A 4MZPA 1BIAA 1WI7A 2RN8A 5GANj 2BZXA 3VYHB 2KSSA 2XHCA 2L3SA 1GCPA 4M7DE 5CR2A 2LJ1A 3CC2A 1ABQA 1VQ7T 4HCBA 4R0KA 2DL3A 1VQLT 3M0UA 3CPWA 5IAYA 2P4TA 2EYWA 1I5LA 4BB7A 1KIKA 2VC8A 2L5QA 1MV3A 1UECA 3CMEA 2XICA 2KRNA 2DFUA 2QEXT 1VQ7A 3M55A 3I55A 3OS1A 1G3YA 1IO6A 1BCOA 1VQKQ 4XU0A 2ZAEA 1UHCA 3PNWC 2YRVA 1C0MA 1KD1R 2OTLQ 1Y96B 1NJIC 1D1CA 1M3AA 3L2VA 4O5VA 3M54A 5D6XA 5IHKA 1GCQC 2VGNA 4GLKA 4C92F 4JLIA 2ROLA 2E41A 4Y92A 3H6ZA 3OYGA 3Q1JA 2L2PA 3CBPA 2HQEA 3CCET 2NYSA 3RDVA 2F1LA 2AKLA 3JB9I 3JCMb 4C8QA 3LGLA 1SEMA 4C92A 3A8MB 2IVWA 1UE9A 5LJ5j 1UDLA 2LJ3A 1YHQQ 4PFZA 5LJ5d 3VS4A 1YIJA 2EWNA 1D1AA 2PU9B 1WXUA 3UWNA 1PHTA 3EAEA 1BI3A 2LCSA 5GAMf 4LE9A 5I21A 3G71A 3RERA 1KFZA 2YT6A 3OSSC 2DPPB 1QW1A 4X1VA 5GAOn 1YJWQ 5GAMd 1I0CA 3LH5A 3EGDB 2M0OA 1JB0E 1VQOQ 5DM7R 1Q95G 4IURA 1PM3A 1N9RA 1YJWA 2L0AA 3ASKA 5GANf 4Y28E 4C5HA 2JTEA 2DX1A 2CSIA 3EG2A 3E2UA 2A36A 3L2ZA 5D7UA 1E7OA 1VQ7Q 4FT4A 2WSCE 1WYXA 4ZTJA 1M8MA 3G6ET 2AZVA 1UFFA 3QBYA 3JCMf 1YHQA 3CCJQ 4OMPA 1SSHA 3CCLT 2M9UA 1QVGA 4OMQA 3RESA 2YRDA 3CQTA 1YITQ 2ENMA 3OBYA 2QAZA 2DYBA 4QQGA 3ZL7C 4M7DA 5L8RE 2YHTA 1JBMA 2PVDB 1PRMC 1V29B 1AHJB 1QP3A 2L3QA 2E70A 2E6ZA 1AOJA 4M7AF 1DJ7B 4BUGA 2JM8A 3CC4A 3C0CA 1I5OB 2MIOA 2EVRA 2DLPA 4BI8B 2NUTA 2A0FB 4J6WA 3VS2A 2GQIA 4XU2A 2NUTB 5CKDA 3CC7T 1RAIB 4M77E 2KGTA 3ULRB 2KT8A 1RABB 3SDZA 2ZPBB 1NPPA 1M5Q1 3H0FA 1C6VX 4J9BA 2LC4A 3S6WA 3E19A 3M0QA 4CC4B 2PQWA 1NEBA 4PJMA 2D8JA 2BZYA 5GANd 3VS6A 3JB9H 1WHKA 2WSEE 3JCMg 2QQBA 3CMAT 4RCBA 4B9WA 4M7DB 2RK1A 1OEBA 1QKWA 2LQNA 4NOYA 1GFDA 1S72Q 3LLRA 2PUOB 3OYKA 2B8AA 1YJ9A 3OS0A 1UGSB 3H9NA 5IT9E 3SD4A 2D9TA 1X27A 1ZLMA 2XDBA 2ATCB 1K73C 3VV0A 1I07A 1VQOT 1NE8A 1SKUB 3BW1A 4N0AA 3CXCS 4HXJA 2OTJT 1QCNA 2HMAA 2HZYA 5A0LA 1H92A 4PJOD 2KXDA 2Y90A 2DEQA 1UJ0A 5LJ3d 1QVFP 4RMOA 1M1GA 3M56A 4AFZC 1W4SA 3QWYA 2X9HA 3OYEA 3RKYA 4QVDA 2K5FA 3C4SA 3GP8A 1AZEA 3MP8A 4RTUA 7AT1B 5M9OA 3WVDB 4M77C 4C8QG 1QVFA 1MMNA 3G4SQ 1YIJT 3A8LB 1VQ5Q 3TREA 1OPLA 1D0YA 4RG2A 1PD1A 3J80E 5FRNA 2ED0A 3OYAA 2ESWA 2L3PA 1GL5A 2OX7A 3OYDA 1K0XA 3TCJA 4P5NA 2F2XA 4JJCA 2E3IA 3O5ZA 2E5KA 1H8KA 1ZX6A 2RI2A 2ABLA 2MWOA 2FB7A 3HSBA 3C94A 2I0NA 2RF0A 1VQ8T 4M77A 4E47A 1WLPB 3CCUA 4GBQA 2CZ7B 4B6MA 4CC7A 2OTLT 1EIFA 2QGFB 1OZ3A 5IH2A 1I4K1 2EGEA 5EG2A 1VQ6T 3NTHA 4PFOA 1TSFA 3JB9F 4PK4A 3CCEQ 3A1PA 1XOVA 4JZ4A 3OYFA 2A08A 3QIIA 4AG2C 3QWXX 3MCAB 2B86A 3D7SB 5HY6A 5IN1A 1TWBA 1U1TA 3UA7A 5LL6S 1W2BS 2CH4W 1K8AR 5GMKj 3OYLA 1N8RC 1NBEB 4Y91A 4WTOB 1HJDA 3V7SA 3FLGA 1WJQA 1U3OA 3QSUA 1TTHB 4ANJA 3KFVA 3JCMX 3CMEQ 2KEAA 2P0PA 2NUPA 2LP5A 2RQUA 2JT4A 4N0AC 3CC4T 1MNDA 3QJ6A 2RM4A 1Q7YU 4II1A 2VASA 3HFOA 3NFCA 1S1NA 1JXOA 3CCST 3FEOA 3OYNA 5GAMe 4LN2A 2D0NA 4JZ3A 2VB6A 3CCMA 4IUVA 8AT1B 3E1SA 1Q86R 5EC7A 3C95A 2F2VA 3P8HA 4HA8A 1OYXA 3RKXA 5KH6A 1QVPA 2ZPHB 3KBGA 2R57A 4E7KA 2DVJA 5ECAA 3HFNA 1YN8A 1WA7A 2C0TA 5LJ3f 2C06A 1BIBA 3SWNC 3HRUA 4RTVA 3MPUB 4J6XA 1YJNQ 4M78B 1OQKA 3CMAA 4XAXB 1ZQ1A 4F04B 2DETA 1SPKA 1TS9A 3QYGB 3TEEA 2F2WA 3OYYA 1TG0A 2D0QB 2J05A 1KJWA 2RNAA 4XTUA 1K1ZA 1UGQB 2QA4A 4JPBW 2DERA 2W10A 1PSEA 1TUGB 2DE0X 3R6OA 4EMKB 1QWEA 4VUBA 1WPYA 2JM9A 3CCVQ 3A8OB 3I56A 3VUZA 1PKSA 3CCMQ 3C12A 2LCLA 3EH1A 3QJYA 2JUFA 3E9GA 2DXTA 1ZA1B 3JB9D 4ZGEB 2CUDA 4RUGA 1SF9A 4HCKA 4PL6A 3GLXA 2XU8A 2OTJA 1HSQA 3X20B 3S3MA 3CC7A 4Z02A 2O31A 2JNGA 1ABOA 4DBHA 2VGMA 3V7RA 2GQVA 3JCMh 4UC4A 3RUXA 2KDSA 2RI3A 4HKEA 3TSWA 2ZPGB 4OMFB 1QVGP 4F17A 1UJYA 2E5QA 1Z9QA 4PFPA 5LJ3e 2HQHA 4A53A 3FC3A 6AT1B 1YIJQ 4J6YA 4BACA 1SRLA 3QXEB 1FWZA 2R5MA 4KGVB 2KR3A 4FYYB 1ZSZC 2YUOA 5DLQE 3JCMW 3MP6A 2DM1A 3OW2P 1QVGS 2EQKA 5FU6B 2CP3A 4F7UB 2DILA 3MEAA 1KQSP 3VS1A 4LDXA 3GPLA 4OVAA 1QMCA 2LCCA 1B34A 2ZGWA 1SHGA 3CD6T 1VQ5A 1AVZC 2H8HA 4A54A 4OGCA 2LJ0A 3META 4M77G 2GFUA 1KG1A 1VA7A 1BB9A 3PGGA 4J8OA 1RI9A 2W0ZA 1PNJA 3JB9G 1SRMA 5CCAA 1M8VA 4C0DC 2JW4A 3G1JA 5FWCA 4C0GA 3OY9A 2QQ9A 1WGSA 3CCQA 2L89A 2MCNA 3VS3A 5D6YA 1YJNA 1Q81U 1OOTA 2YLCA 2PVOB 2IG0A 2H3JA 2O88A 1U06A 4J7IA 3PMIA 1C1AA 1NZ9A 2DBMA 5GAN6 1Q82C 1MUZA 2J6FA 3M0SA 2EFIA 1JRIA 4M78C 2V1RA 1EZZB 3CCJT 2KRSA 4EMHA 5FLXE 4LD9K 1WQ7A 2HL3A 1YJ9Q 3CC2Q 2MYSA 3QO3A 1XNIA 1QQJA 4M75G 1RAFB 3SB2A 1JJ2S 1NG2A 3UPUA 1UG1A 5LJ5e 1VQ9T 3X24B 5LJ3h 1OV3A 2GCXA 1VQPT 1RAEB 4RG8A 1WJRA 3OQ5A 2HEQA 1G2BA 1E6GA 3JRZA 3NMZC 3OW2S 5FRMA 1D0XA 4C92D 2KYMA 3RKWA 3VKIA 3INZA 5CO7A 2RHYA 1M2VA 3I5SA 2CZ6B 2RQWA 1ZSZA 2LTOA 1M27C 9ATCB 3VJPA 5GAOr 2X4YA 2YLBA 2FG0A 1UEBA 2E4HA 4FU6A 2FPEA 1M3CA 1VQMQ 2FPFA 5L23A 5HCKA 3H41A 1Q7YC 1PRLC 1AEYA 2FZGB 2KAFA 2DD5A 5GAN2 4N4HA 3M0RA 4C92E 3FRNA 2OAWA 1IGUA 4HCZA 2CREA 3PIOA 4A4KA 2CP7A 1X6GA 4LXCA 5KYYB 4PJOC 3CPWS 2JZ2A 4L6V5 4A4FA 5I2MA 1GBRA 4XK8E 2WACA 3OYMA 1XTDA 2HAXA 2EAYA 4XU1A 4OB1B 4OMNA 2EQIA 1X69A 4ZNXA 1NYGA 5CQYA 4M7AA 5C6SA 1YP5A 1LNXA 1MMDA 3FDRA 2X4JA 3NTIA 4HT9A 4MZTA 1RAHB 2MF2A 3I55Q 3HPWA 1H3ZA 1U8RA 4RCCA 1OPKA 3MHXA 1I1JA 3JSCA 1VQ8Q 3P8DA 4FSXA 3I55T 5AYFA 3SHWA 2JN0A 3HHTB 3WXMB 1AWJA 1WHMA 4JS5A 1UTIA 4KRTA 1ZHIA 2K3BA 4PKCC 3GBQA 4FYXB 3H0IA 1VQ5T 5C0MA 2JTFA 1KQSA 3LWIA 3PE0A 2A3LA 2EKOA 1MV0B 3GOXA 2ROTA 3GF5A 1KQ1A 1MNEA 4E7IA 5FROA 3VS7A 4RKUE 3L42A 1XJWB 3A5ZB 2CGHA 1LVKA 3QKJA 3RBBB 1TH7A 3CCLQ 3OA6A 3VS5A 5LJ5h 2PZ1A 2COWA 4C5EA 2GNCA 4D8DA 2QK0A 2KT1A 3EG0A 2NWMA 1M1FA 2KXCA 2X3WD 1M1KR 4JJDA 4LUEA 4M75E 2LDMA 2JMAA 3CC4Q 3M0TA 3HP9A 4JRKA 1RLPC 4C8QD 2WSFE 3S3OA 4LNPA 1VQ6A 5GAOq 1YITA 2E12A 5FW9A 3OYHA 2V8IA 2JTMA 2L8DA 2CH4A 4LDVA 2F5KA 4AG1C 1Y07A 4O6JA 4QW2A 1WHJA 2DL4A 1FMVA 5GAOp 3CPFA 2G3RA 1W1FA 1GBQA 4M78D 1YWPA 2J7IA 2VV5A 4M78E 1KC8U 2QEXQ 4E2FB 1N9SA 4LD6A 2K2MA 4PLIA 2FZCB 2FO0A 2K79A 1IB8A 1P92A 4Z88A 4ESRA 4FW2A 2RA2A 1EFNA 2ZPFB 3A8GB 2YWWA 5GAMj 4DQ2A 1WIEA 4K11A 1IXDA 2J6KA 1TU0B 1VYVA 2KY9A 1UB4A 4KT0E 3OMCA 4E6RA 5GAN3 3AHUA 5DY9A 5A2QE 3G71Q 2K6DA 4KGZB 4RTYA 2QG9B 2QXFA 4AFQC 5KYWB 2EJFA 1R0BG 5GJWB 3L1AA 4KGXB 1YBYA 4KULA 3CCUQ 2XI9A 1HXDA 5CVIA 8ATCB 4MMKA 4ZGJB 1X6BA 3CBOA 4FT2A 4M78F 2K9GA 1KC8C 1VQMT 2EPDA 3JAME 1WQWA 1IHVA 1D3BA 1AT1B 4J9DA 2QA4Q 3JCMc 2QGGA 2GTOA 2E10A 2V1QA 1ZA2B 1JEGA 2KVQG 1G3SA 2OTLA 1KQ2A 3NPFA 2HBWA 3G4SA 3A98A 5KE3A 1G8XA 1X75C 2KK4A 3PMTA 4M7DG 4A63B 4OGEA 4JDSA 3URGA 1VQKA 1VQNT 1Y57A 3LGFA 5I22A 1WJSA 2JVVA 4C5GA 2KROA 3UA6A 2DL8A 3EH2A 4BE2A 2FEIA 3HRTA 3H8ZA 4OB0B 1VYUA 1VUBA 2LX9A 3I56T 1X6OA 3PFSA 1BI0A 3EG9A 1LPLA 1M2OA 1UGVA 2DMOA 2COZA 3L2WA 2QA4T 3LWHA 4F16A 5A0GA 1VQ9Q 4OMLA 1K8AC 4F7UG 1QKXA 2XD0A 4E7JA 2KQWA 4BY6C 2MWPA 4BY6B 2CT3A 1WZOA 4J9HA 1VQ4T 4M7AG 3HTRA 5KYXA 3QHSA 3EHRA 3TU4K 3RR6A 1VIEA 4C0DB 4DOWA 2K5IA 1WX6A 2BZ8A 2XMFA 4F7UE 2LQWA 2E6NA 3CCEA 2JMCA 2V26A 1BK2A 3OBWA 3REBB 1A0NB 1SG5A 3SWNB 1VQLA 2EYQA 1K0SA 1UUEA 2AHJB 1O9SA 2M02A 2DXBA 2CP6A 1G3WA 3BFMA 2HSPA 4M75B 4F7UF 4B9XA 1S72T 3CPWP 4V2SA 3EFOB 2MI6A 2P84A 1I81A 3TVTA 1Q81R 3SEMA 3RNJA 3VRYA 2IPOB 1Y7XA 2VXFA 2RD1A 1WXTA 3X26B 4EMGA 1K73U 1WFWA 3SFMA 3M0PA 2HKQB 4GLMA 2L3RA 2O4XA 2DAQA 1ZUKA 1FYNA 2DXCA 4FM4B 3OW2A 3O8VA 1YHQT 3G4ST 2PVGB 4DEYA 3ME9A 5FWBA 1Y71A 4FCYA 1VOMA 2GFAA 4DEXA 3J81E 2RQTA 2MOXA 4ZGDB 1T0JA 1ZBJA 4C8QE 1K9MC 3OYJA 3UF4A 4XTZA 3KXTA 1OU8A 2FL7A 4C92G 1H641 4FL6A 3M57A 3QYHB 2O2OA 4YTLA 2ED1A 1XQHA 4Z8AA 3CXCP 1T0HA 2QDLA 3OSVA 3DKMA 3MKDA 4EPCA 4M77D 3I5RA 2X35A 1Q86U 1ARKA 3FJPA 1IRXA 1X2KA 4QQDA 2BE9B 1TUCA 2YUQA 2QQSA 1FMKA 4XQ3A 1M30A 1OULA 1PWTA 2PNIA 4PJNA 2DTIA 4OB3B 3M58A 1CKAA 2RJFA 2RHZA 3BY7A 3JCMd 1KD1U 2MPXC 3EGUA 3OS5A 1OI1A 2OJ2A 5GANg 4J9EA 2KBTA 2RQVA 2IIMA 4RTWA 3QZ9B 1OX8A 4M75D 3CCLA 4M78G 2H3EB 2A7YA 4IUPA 2FPDA 4XTXA 2DL7A 4WCIA 1VQ9A 2DRMA 1Q82U 3CCRA 4BI3A 1CSKA 4XTWA 3RMQA 5DLOA 3L2RA 2FHDA 4RTTA 2KNBB 2E1HA 4JLGA 1RADB 1Q82R 2MMPA 1IZ6A 1WXBA 5CKHA 3T9NA 2DVEA 4C8QC 1VQ4A 5HK3A 4JRPA 1LJOA 2D6FA 1VQ8A 2SEMA 3ZFJA 5IHIA 3CC2T 2FZKB 1YNZA 2NUPB 1NJIR 1WDXA 1G83A 2G6FX 2DJZA 2KMTA 1E6HA 4HVWA 4IIOA 3RMSA 2X3XD 2Y4XA 3M53A 1HK9A 1JO8A 3F70A 2EIFA 2K2VA 5FU7B 2HBPA 4RTZA 2M51A 4A4HA 1ZUUA 4HVUA 2C0IA 4LDYA 5KYNA 2O4XB 3DLMA 1M1KC 5J3BA 2RJCA 1M90U 2QEXA 5GAN8 1VQPA 5GAOm 4PJOG 3G6EQ 1X01A 5KCOA 2RJDA 2K7AA 2OI3A 1Q7YR 1PCXA 2DIQA 5CAIA 5IXFA 3CCVT 4ATOA 2K3XA 4MDWA 4M77B 1MMAA 3EFOA 4GY5A 4M7DD 3OB9A 2P4RA 1FMWA 2DXUA 2K5LA 2VKNA 1WHLA 2DNUA 3AT1B 4M75A 4E7ZA 3I56Q 1JJ2A 3CXCA 3VUBA 1RUWA 2DO3A 3SWNA 1LOJA 3S3NA 5GMKm 1B07A 2EKHA 4PJLA 2BIVA 4JUVA 4IUTA 1YI2Q 1WHHA 2X4XA 1BYMA 3QUIA 2HCKA 3CMET 1MGQA 2GBQA 4AFUC 2QQAA 4MDXA 2JJ9A 4BDYA 4OMMA 3VYGA 3JCMQ 1ACMB 1BI1A 3CCQT 1JJ2P 1R8OB 1RLQC 4F14A 1RI0A 3CCMT 3CC7Q 5KYXB 1NJIU 3MEVA 3MP1A 5I11A 1KD1C 1ZSGA 2OTJQ 4X9DA 1QCFA 2GTJA 5GAMg 2PTKA 1M9SA 2DBKA 2JXBA 1W2BP 2DRKA 2AK5A 2R5AA 1NPRA 1QP2A 3MJXA 2VYTA 2F5TX 2CT4A 3M4YA 1QLYA 2HL5C 4JJNK 4ELZC 1PSFA 1B7TA 3EG1A 3EG9B 3CCVA 1KHCA 3OS2A 2LX7A 3UDCA 1OZ2A 4FSSA 1NEGA 3GIBA 2P0KA 1Q86C 2DYIA 4BI4A 3LW5E 4HCCA 1JU5C 2ZCFB 1AWXA 2X4WA 2FYKA 2CZ1B 1VQNQ 2XIDA 1MMGA 3JCMe 1QCOA 3CCRT 1WNLA 5FU7C 2CZ0B 2OAUA 5KCHA 3M4GA 3DB4A 4MMLA 4DOVA 1YCYA 2JS2A 2O01E 4C0FA 1K4US 1ZBXA 1YI2A 4N4GA 4BD3A 3OYCA 1GXIE 3G7ZA 1D3BB 5GANe 2KE9A 2Y4YA 1K9MU 1KHIA 3MEWA 2LT1A 3FIFA 4PJOF 1ZUYA 2LQKA 1Z9ZA 4E7HA 1UHFA 2AT1B 1KC8R 4A4EA 1PKTA 2BE7D 2EBPA 2YXYA 1T3LA 2ECZA 5FU6C 2K3YA 5KYWA 1VQPQ 2LVMA 3DB3A 2XDPA 2SRCA 4BDZA 1KSWA 2E65A 2VVKA 1IHWA 1OX9A 4J9IA 2HKNA 3LYIA 1PD0A 4J9FA 2A37A 4DA4A 1WHGA 2DD4A 3FJ5A 2NUZA 1VYTA 2GGRA 1X2QA 1RAGB 4D6WA 2FRWA 3EGDA 3NGPA 2DA9A 2LNHB 5D6WA 4PJJA 2HD0A 2O9VA 2E64A 1G5VA 4OF1A 1NM7A 1T3SA 3GNGA 4TVRA 2QQRA 4DBQA 4XTYA 2FRYA 3EFSA 2CDTA 2DZ9A 2I2LA 4NL3A 1Q81C 2D1XA 3PTAA 1BU1A 4NL2A 1AWWA 2JOYA 2EYXA 2YSQA 1D09B 3P8BB 4M7DC 1YI2T 1YJWT 3J7AF 1HYOA 5GAN7 4C92B 2V8KA 4Z89A 4C8QB 2RK2A 3G71T 3OYBA 4MZMA 1Y0MA 4QQ6A 2MK5A 4LDUA 2M1HA 5GMKh 2EQJA 1JQQA 3TQ7P 1K73R 4KH1B 4OMOA 2R58A 4ME7A 2BKDN 5HKCA 2LQ8A 1N8RU 1BBZA 1Y96A 2JS0A 3WVEB 2ZPEB 1KK7A 4IUQA 2KRMA 1SHFA 2DTOA 3CMAQ 1N27A 1YJNT 1I8FA 2YRCA 2VXEA 5I2SA 1G3TA 3QPHA 4M75F 1AD5A 2FVUA 2V8JA 1W70A 2XKOC 4EMKC 4J9GA 3JCMJ 2BTTA 2HQXA 2VUBA 2EQUA 2GF7A 2J6OA 1S72A 3BDUA 5GAMh 1RAAB 1D1BA 4M7AD 4J9CA 2MAMA 4IKFA 4DBRA 3CCRQ 3KUFA 2HSEB 2HDAA 4M77F 2HNIA 3L2QA 4N4IA 4RTXA 1GCQA 2DEUA 3QZ5B 1N5ZA 2Z0WA 1YJ9T 2J06A 3VS0A 4M75C 3BDLA 2RO0A 5AT1B 4XTVA 3TSZA 3MO8A 4M7AE 4M7AB 3OYIA 2YDLA 4LDWA 3JCMV 4L5GA 4CRIA 3FB9A 2D8HA 2RB6A 5CK9A 2RJEA 4AFSC 3DLLA 1B3QA 3VU3C 2AKKA 3I9QA 1HD3A 1M4ZA 1F1BB 3A8HB 1TXQA 1K76A 5KYYA 3THKA 3ER0A 3CCSA 3I35A 4C92C 3X28B 4XU3A 3V7CA 4FYVB 2DL5A 2LT4A 2XK0A 1BI2A 3VRZA 1LCKA 2EGAA 4QVZA 1V76A 1QVFS 3LH0A 4X34A 2ZZDA 5CKFA 4LUDA 1W6XA 3H0HA 1W2BA 2C0OA 2PUKB 1SSFA 4E7SA 2K4YA 1BKBA 5LJ5g 1VQOA 1ZSZB 2LMJA 1CKBA 5J39A 2XG8D 4ZTFA 5J26A 1M2VB 5GMKi 2RHXA 2DK3A 2E3HA 4KBMB 5GAN5 5A0DA 1QWFA 4OP0A 2YUPA 3N5BB 3EGXB 4A4GA 2ZPIB 4EDUA 2EYZA 1D0ZA 4FYWB 4IUUA 3JV3A 3IQLA 4D8KA 3EHQA 1O75A 4HT8A 2KI7A 5KYUA 3ZBDA 4QVCA 2O9SA 4FIBA 2P0QA 2COYA 3PVLA 2F69A 3QDFA 1NLPC 3CCUT 3HRSA 1K9MR 4PLLA 2RHIA 4KUIA 3CEYA 2CSQA 3EFRA 4R56A 4E7LA 3JCMP 1GRIA 2VWFA 4Q5WA 4BE0A 4PJOB 3MEUA 1N8RR 1GFCA 3CD6Q 1U1SA 2X51A 3QG1A 4J5YA 4CI0C 3CCQQ 1FX7A 5IXBA 5GMKe 2A28A 4IIMA 3M9QA 3X25B 5LJ5f 2QTXA 1K8AU 1M1KU 1R77A 1BCMA 3RIRA 4M7AC 4M4ZA 3QDRB 3L2UA 2AIRB 1B34B 4J83A 1EX4A 3HL8A 3M5AA 1AWOA 2CP2A 4F7UA 5LJ3g 4JS4A 4PJOE 4JRIA 4PJOA 1M3BA
chains in the Genus database with same CATH topology
3QUIA 3QIIA 3S3OA 3MCAB 3CMET 3JB9J 1VQ6A 1MGQA 5GAOq 5HY6A 3ZEHA 5IN1A 2QQAA 3V8JA 1YITA 4MDXA 1U1TA 4BDYA 2E12A 5LL6S 3OYHA 1W2BS 3VYGA 3JCMQ 1BI1A 2CS7A 2V8IA 2JTMA 2L8DA 5GMKj 3OYFA 3OYLA 1R8OB 3CCJA 3CCQT 4LDVA 1N8RC 1UGPB 4Y91A 2F5KA 1RI0A 3CCMT 1N6AA 1NJIU 1Y07A 3MEVA 3FLGA 1WJQA 3MP1A 4O6JA 4QW2A 3V7SA 1KD1C 5CQXA 3QSUA 3V8KA 4X9DA 5GAOp 3CPFA 3JCMX 5GAMg 2G3RA 2DZCA 2P0PA 2EJ9A 1M9SA 4M78D 4N0AC 2VV5A 3E9FA 2CYZB 5GMKl 3QJ6A 4M78E 3CC4T 2RM4A 1KC8U 1Q7YU 4II1A 3HKSA 4C8QF 5GAN4 2XDDA 1N9SA 2QI2A 3HFOA 4LD6A 3NFCA 3CCST 2R5AA 3FEOA 1NPRA 1QP2A 4PLIA 5HK0A 3CBMA 1VIFA 3OYNA 2VYTA 5GAMe 2F5TX 3CCUT 1P92A 3M4YA 2RA2A 4JJNK 3CCMA 4ELZC 1PSFA 1Q81U 4IUVA 3NTKA 3GNFB 2RHUA 3E1SA 3CCVA 2ZPFB 3A8GB 2EJGA 3C95A 1FXXA 5KE2A 3P8HA 4HA8A 1KHCA 1OYXA 2DTHA 3RKXA 5KH6A 5GAMj 5GAOl 3UDCA 3OS2A 1QVPA 4DQ2A 1YITT 4M7DF 2ZPHB 3KBGA 2R57A 1OZ2A 1UB4A 2KY9A 3OMCA 4KT0E 4WF2A 5GAN3 4E7KA 5GANh 3AHUA 4KUDK 3GIBA 3HFNA 2CKKA 5DY9A 2P0KA 2QDYB 3OMGA 3UT1A 5A2QE 5LJ3f 1Q86C 2C06A 1BIBA 3SWNC 4BI4A 3HRUA 3LW5E 4HCCA 4OB2B 2QXFA 3V8LA 2EJFA 2ZCFB 4ELYC 3PT9A 2X4WA 4J6XA 4M78B 2FYKA 2CZ1B 3L1AA 3CMAA 4XAXB 2EQMA 3PIPA 1YBYA 1ZQ1A 2BUDA 4KULA 5CKBA 4BE1A 2XIDA 1HXDA 2XI9A 3QYGB 5CVIA 3TEEA 3JCMe 4R55A 3CCRT 1WNLA 2NLUA 5FU7C 4JRQA 2CZ0B 4MMKA 3LX7A 2OAUA 4ZGJB 3OYYA 5KCHA 3CBOA 3M4GA 3DB4A 4MMLA 4FT2A 4DOVA 1YCYA 4M78F 1KC8C 2O01E 3G6EA 4C0FA 1VQMT 2D0QB 2LNVA 3JAME 1ZBXA 1WQWA 5CIUA 1D3BA 4EMKA 1KQSS 4XTUA 1YI2A 1UGQB 3JCMc 4N4GA 1VQMA 4BD3A 2QA4A 3OYCA 1GXIE 1PSEA 3G7ZA 1IREB 2E10A 1D3BB 3R6OA 4X9CA 2Y4YA 4EMKB 5GANe 1KHIA 1MHNA 4VUBA 1K9MU 1WPYA 1G3SA 2KVQG 2LT1A 2RH2A 3FIFA 3MEWA 4J7FA 3M59A 4PJOF 4ZN3A 2LQKA 2OTLA 4E7HA 3A8OB 1KQ2A 3I56A 3VUZA 3G4SA 2M16A 2RI5A 3C12A 5KE3A 4PNOA 2LCLA 2DKGA 1X75C 2KK4A 3PMTA 4NS5A 4C0ZA 4ZN1A 4A4EA 1VQKT 1VQNA 3QJYA 4M7DG 1UGRB 2JUFA 3E9GA 2DXTA 4OGEA 4JDSA 4M78A 3URGA 3JB9D 1VQKA 1VQNT 2K57A 2DIGA 5FU6C 4C5IA 4ZGEB 5CKEA 2K3YA 5LJ3j 1RL2A 3LGFA 1M90C 2LVMA 1WJSA 2LRQA 4PL6A 3DB3A 2JVVA 3CD6A 2XDPA 3GLXA 4C5GA 4BDZA 2E65A 2XU8A 4L59A 2OTJA 3X20B 3S3MA 4MZPA 1BIAA 3CC7A 4Z02A 4BE2A 3LYIA 2JNGA 3HRTA 3H8ZA 4OB0B 4DA4A 5GANj 2DD4A 3VYHB 2KSSA 2VGMA 3V7RA 1VUBA 2LX9A 2XHCA 3I56T 1X6OA 3PFSA 1BI0A 2GQVA 4D6WA 4M7DE 3JCMh 5CR2A 4UC4A 5D6WA 3CC2A 2HD0A 2E64A 3RUXA 2KDSA 2RI3A 1VQ7T 4HCBA 4HKEA 3L2WA 2QA4T 2ZPGB 4OMFB 4OF1A 1G5VA 1VQLT 3LWHA 3CPWA 5A0GA 3GNGA 5IAYA 2P4TA 4TVRA 2E5QA 2QQRA 4BB7A 1I5LA 4XTYA 3EFSA 2VC8A 1K8AC 2L5QA 4F7UG 2DZ9A 2I2LA 4NL3A 3CMEA 2XICA 1Q81C 2QEXT 3PTAA 1VQ7A 2XD0A 5LJ3e 4E7JA 3M55A 4NL2A 3I55A 2KQWA 4BY6C 2JOYA 2MWPA 3OS1A 4BY6B 1G3YA 1VQ4T 4A53A 3FC3A 3P8BB 4M7AG 4J6YA 1YI2T 4M7DC 4BACA 1YJWT 3J7AF 3QXEB 4XU0A 3QHSA 1FWZA 2R5MA 3PNWC 5GAN7 3TU4K 4C92B 2V8KA 2YRVA 5DLQE 4C8QB 3JCMW 2RK2A 3MP6A 3G71T 3OYBA 4MZMA 1VIEA 4C0DB 4QQ6A 1Y96B 1NJIC 4DOWA 4LDUA 3L2VA 2M1HA 2K5IA 5GMKh 4O5VA 1KG1A 3M54A 2EQJA 5D6XA 1QVGS 2EQKA 2VGNA 4GLKA 5FU6B 4F7UE 2E6NA 4C92F 4F7UB 3CCEA 4JLIA 2R58A 4ME7A 3MEAA 2E41A 2BKDN 3H6ZA 3OBWA 5HKCA 3OYGA 2LQ8A 1N8RU 3Q1JA 4LDXA 3GPLA 4OVAA 3CBPA 2HQEA 3SWNB 2LCCA 1VQLA 1B34A 3CCET 2ZGWA 1Y96A 3WVEB 2EYQA 3CD6T 2AHJB 1VQ5A 4A54A 3JB9I 1O9SA 3JCMb 2DXBA 4OGCA 1G3WA 2ZPEB 2GFUA 3BFMA 3LGLA 3META 4IUQA 4M77G 4M75B 4C8QA 4C92A 4B9XA 3A8MB 4F7UF 1S72T 2DTOA 3PGGA 4J8OA 4V2SA 2IVWA 2MI6A 5LJ5j 1N27A 1I81A 1YJNT 3JB9G 5CCAA 1M8VA 1I8FA 5LJ5d 2VXEA 4C0DC 4C0GA 5I2SA 3OY9A 1G3TA 2QQ9A 1YIJA 1WGSA 1Y7XA 2EWNA 2L89A 2PU9B 5D6YA 2VXFA 3QPHA 3CCQA 1YJNA 2YLCA 4M75F 2PVOB 2IG0A 3UWNA 2RD1A 2H3JA 3X26B 4EMGA 3EAEA 1BI3A 1K73U 2FVUA 4J7IA 5GAMf 3PMIA 5I21A 3G71A 3RERA 1NZ9A 3SFMA 2V8JA 2XKOC 5GAN6 1Q82C 4EMKC 2EFIA 1JRIA 2L3RA 2O4XA 3OSSC 2DAQA 2DPPB 1QW1A 2HQXA 2VUBA 4M78C 3CCJT 2EQUA 5GAOn 4EMHA 2DXCA 2GF7A 4FM4B 1WQ7A 5FLXE 4LD9K 5GAMd 3OW2A 3O8VA 2M0OA 3QO3A 1JB0E 1XNIA 4M75G 1S72A 1YHQT 5DM7R 3BDUA 4IURA 5GAMh 3G4ST 3SB2A 2PVGB 4M7AD 1JJ2S 1N9RA 1YJWA 3ASKA 5GANf 2MAMA 4IKFA 4Y28E 3ME9A 4C5HA 1Y71A 3UPUA 5LJ5e 1VQ9T 3X24B 3KUFA 5LJ3h 2GFAA 3L2ZA 2GCXA 1VQPT 3J81E 4M77F 2HNIA 1WJRA 3OQ5A 4RG8A 3L2QA 4N4IA 4ZGDB 4FT4A 2WSCE 4ZTJA 3JRZA 4C8QE 1K9MC 3QZ5B 3OYJA 3G6ET 3OW2S 1YJ9T 5FRMA 3QBYA 3JCMf 4C92D 1YHQA 4XTZA 3RKWA 3VKIA 4M75C 3KXTA 3BDLA 2FL7A 3INZA 5CO7A 4C92G 1H641 4FL6A 3CCLT 2RO0A 3M57A 2M9UA 3QYHB 2RHYA 1QVGA 3RESA 4XTVA 4YTLA 2CZ6B 1XQHA 3MO8A 3OBYA 4M7AE 2LTOA 4M7AB 4QQGA 3OSVA 3DKMA 4EPCA 4M77D 4M7DA 3OYIA 3VJPA 5L8RE 5GAOr 2X4YA 2YLBA 2YHTA 1JBMA 2X35A 4LDWA 4L5GA 3JCMV 4CRIA 2PVDB 1Q86U 1V29B 1UEBA 3FB9A 3FJPA 1AHJB 2RB6A 5CK9A 1QP3A 4FU6A 2RJEA 4QQDA 2E70A 2E6ZA 3DLLA 3VU3C 1Q7YC 4M7AF 1DJ7B 2QQSA 4BUGA 3CC4A 1M4ZA 2KAFA 2DD5A 4XQ3A 5GAN2 4N4HA 2DTIA 4C92E 3A8HB 4OB3B 3FRNA 3M58A 4BI8B 2RJFA 3ER0A 3CCSA 4HCZA 2RHZA 4C92C 3X28B 4XU3A 3BY7A 3PIOA 3JCMd 1KD1U 4J6WA 4A4KA 4XU2A 3OS5A 1OI1A 3V7CA 5GANg 5CKDA 3CC7T 4PJOC 4M77E 2LT4A 2XK0A 1BI2A 3QZ9B 3SDZA 2JZ2A 3CPWS 2ZPBB 4M75D 3CCLA 1NPPA 4L6V5 4M78G 1M5Q1 4A4FA 2A7YA 5I2MA 4QVZA 4IUPA 4XTXA 1QVFS 3S6WA 2LC4A 3E19A 3LH0A 4XK8E 2WACA 4X34A 2PQWA 1XTDA 2ZZDA 5CKFA 3OYMA 1Q82U 1VQ9A 2HAXA 3CCRA 5GANd 2EAYA 4XU1A 4BI3A 4XTWA 3RMQA 5DLOA 3JB9H 1W2BA 3L2RA 2WSEE 2FHDA 4OB1B 3JCMg 2QQBA 2PUKB 1SSFA 3CMAT 4RCBA 2E1HA 4B9WA 2RK1A 4M7DB 4JLGA 2K4YA 4NOYA 5CQYA 4M7AA 1BKBA 5LJ5g 3LLRA 5C6SA 1VQOA 2PUOB 3OYKA 2MMPA 5J39A 2XG8D 2B8AA 1IZ6A 1LNXA 4ZTFA 5J26A 1YJ9A 5CKHA 3T9NA 3OS0A 5GMKi 2RHXA 2DVEA 1UGSB 2DK3A 3FDRA 4C8QC 4KBMB 5IT9E 5HK3A 3SD4A 2D9TA 5A0DA 5GAN5 2X4JA 3NTIA 4JRPA 1LJOA 2D6FA 2XDBA 4HT9A 1K73C 1VQ8A 3VV0A 4OP0A 3JCMJ 1VQOT 4MZTA 2MF2A 3N5BB 3ZFJA 1NE8A 1H3ZA 3HPWA 3BW1A 1U8RA 3CC2T 4N0AA 2ZPIB 4RCCA 4A4GA 3CXCS 4EDUA 3MHXA 2OTJT 4IUUA 5A0LA 4PJOD 2Y90A 2DEQA 1O75A 5LJ3d 3JSCA 4HT8A 3P8DA 2DJZA 4RMOA 2KMTA 1M1GA 3M56A 3ZBDA 4QVCA 4FSXA 1W4SA 3I55T 3RMSA 5AYFA 4FIBA 2P0QA 3OYEA 2JN0A 3HHTB 3RKYA 3WXMB 2Y4XA 3M53A 4JS5A 2F69A 4QVDA 1HK9A 2K5FA 3C4SA 3GP8A 1ZHIA 3HRSA 3MP8A 5M9OA 4PLLA 2RHIA 3F70A 3CEYA 4KUIA 4M77C 3WVDB 4C8QG 2EIFA 4PKCC 2K2VA 1VQ4A 1QVFA 1YIJT 3A8LB 5FU7B 3EFRA 2HBPA 4R56A 4A4HA 3TREA 4E7LA 3JCMP 5C0MA 1VQ5T 2JTFA 1KQSA 3LWIA 2A3LA 2EKOA 4Q5WA 4BE0A 4LDYA 4RG2A 3J80E 5FRNA 3GOXA 4PJOB 3GF5A 2O4XB 1KQ1A 3DLMA 4E7IA 3OYAA 5J3BA 1M1KC 2RJCA 5FROA 1M90U 3MEUA 3OYDA 2QEXA 3TCJA 4RKUE 4P5NA 3L42A 1U1SA 5GAN8 3QG1A 4J5YA 3A5ZB 4CI0C 2CGHA 5GAOm 1VQPA 4PJOG 3QKJA 1X01A 1TH7A 1FX7A 3OA6A 2RI2A 5KCOA 2MWOA 5GMKe 2RJDA 2FB7A 5LJ5h 4ATOA 2DIQA 3M9QA 5CAIA 3X25B 4C5EA 3CCVT 3HSBA 2K3XA 5LJ5f 4MDWA 2QTXA 1K8AU 4M77B 1M1KU 3C94A 1VQ8T 4GY5A 4M77A 4E47A 4M7DD 3OB9A 3CCUA 2DXUA 2CZ7B 2K5LA 3RIRA 4M7AC 3QDRB 4M75A 1M1FA 2OTLT 1EIFA 1JJ2A 1OZ3A 3L2UA 3CXCA 3VUBA 2DO3A 1B34B 1I4K1 2LDMA 1LOJA 4J83A 4M75E 5EG2A 3SWNA 5GMKm 3S3NA 1VQ6T 3NTHA 3HL8A 3JB9F 2BIVA 4JUVA 4IUTA 3HP9A 3M5AA 4JRKA 2X4XA 4F7UA 5LJ3g 4JS4A 4PJOE 4JRIA 1XOVA 1BYMA 4C8QD 4PJOA 2WSFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I8F A;  1M5Q 1;  3QUI A;  5LJ5 d;  2VXE A;  4XTX A;  4PNO A;  3JB9 J;  1MGQ A;  2DKG A;  5GAO q;  2EWN A;  2VXF A;  3V8J A;  4M7D G;  2YLC A;  1U1T A;  4M75 F;  2RD1 A;  2DXT A;  5GAN d;  2EAY A;  4XU1 A;  4EMG A;  4XTW A;  3JCM b;  3JB9 H;  3JCM Q;  4M78 A;  5GMK j;  3JB9 D;  5GAM f;  5I21 A;  2K57 A;  3JCM g;  3RER A;  4RCB A;  2E1H A;  4M7D B;  4Y91 A;  5GAN 6;  4NOY A;  4M7A A;  5LJ3 j;  5LJ5 g;  4EMK C;  1JRI A;  4M78 C;  3V7S A;  3JCM J;  1LNX A;  3QSU A;  5GAO n;  4EMH A;  2E65 A;  1WQ7 A;  4X9D A;  3V8K A;  2DVE A;  5GMK i;  5GAM d;  5GAO p;  3JCM X;  4C8Q C;  5GAM g;  5GAN 5;  2DZC A;  2EJ9 A;  1LJO A;  3QO3 A;  4M78 D;  4N0A C;  5GMK l;  1BIA A;  4M75 G;  4M78 E;  4HT9 A;  2RM4 A;  4OP0 A;  3BDU A;  5GAM h;  3SB2 A;  4M7A D;  5GAN j;  1N9R A;  3BW1 A;  4C8Q F;  5GAN 4;  3V7R A;  4N0A A;  4RCC A;  1N9S A;  3HFO A;  5GAN f;  4M7D E;  3JCM h;  5LJ5 e;  4PJO D;  5LJ3 h;  2Y90 A;  2DEQ A;  5LJ3 d;  4HT8 A;  5GAM e;  2DJZ A;  3L2Z A;  4PJO C;  2E64 A;  3RUX A;  2RA2 A;  4QVC A;  4M77 F;  2HNI A;  2JN0 A;  3RKY A;  1I5L A;  2EJG A;  4C8Q E;  4QVD A;  1HK9 A;  4XTY A;  3EFS A;  4HA8 A;  2VC8 A;  2DTH A;  4M7D F;  3RKX A;  4M77 C;  4C8Q G;  4F7U G;  5GAM j;  5GAO l;  4DQ2 A;  2DZ9 A;  2I2L A;  3JCM f;  4NL3 A;  4C92 D;  4XTZ A;  3RKW A;  3EFR A;  4M75 C;  4NL2 A;  4WF2 A;  5LJ3 e;  5GAN 3;  4C92 G;  3INZ A;  5GAN h;  3AHU A;  1H64 1;  3GIB A;  3HFN A;  3JCM P;  5DY9 A;  4XTV A;  3RES A;  4A53 A;  4J6Y A;  4M7A G;  4M7D C;  4PJO B;  5LJ3 f;  1BIB A;  3SWN C;  1KQ1 A;  4M7A E;  4XU0 A;  3QHS A;  4M7A B;  3V8L A;  2EJF A;  4M77 D;  4M7D A;  5GAN 7;  4J6X A;  4C92 B;  5GAO r;  2YLB A;  2YHT A;  1JBM A;  1U1S A;  4M78 B;  2FYK A;  3JCM V;  4C8Q B;  4J5Y A;  5GAN 8;  5GAO m;  3L1A A;  2CGH A;  3JCM W;  1M8V A;  3FB9 A;  3FJP A;  1Y96 B;  2RB6 A;  1X01 A;  1TH7 A;  4PJO G;  1HXD A;  5GMK h;  5LJ5 h;  3JCM e;  5GMK e;  2FB7 A;  1WNL A;  5CAI A;  3VU3 C;  4MMK A;  4M7A F;  3HSB A;  5LJ5 f;  2QTX A;  4F7U E;  4M75 D;  4M77 B;  3M4G A;  4MML A;  4C92 F;  4F7U B;  4JLI A;  1YCY A;  4M78 F;  4XQ3 A;  5GAN 2;  4M77 A;  4M7D D;  2E41 A;  2DTI A;  4C92 E;  2DXU A;  3RIR A;  4M7A C;  4M75 A;  1WQW A;  4EMK A;  1D3B A;  4XTU A;  3SWN B;  4C92 C;  1B34 A;  3JCM c;  2ZGW A;  4XU3 A;  1Y96 A;  3BY7 A;  3JCM d;  4J6W A;  1B34 B;  4A54 A;  3JB9 I;  4XU2 A;  1I4K 1;  4M75 E;  1LOJ A;  3SWN A;  3BFM A;  2E10 A;  4M77 G;  1D3B B;  4X9C A;  3V7C A;  4M75 B;  4C8Q A;  4C92 A;  4EMK B;  4F7U F;  5GAN e;  5GMK m;  2DTO A;  5GAN g;  1WPY A;  3PGG A;  4M77 E;  3FIF A;  4PJO F;  3JB9 F;  4JUV A;  4V2S A;  4JRK A;  5LJ5 j;  1KQ2 A;  4F7U A;  5LJ3 g;  1I81 A;  4PJO E;  4JRI A;  3JB9 G;  4C8Q D;  4PJO A;  4M78 G; 
#chains in the Genus database with same CATH topology
 4HVV A;  1PG5 B;  1YFN A;  3JB9 J;  1PC0 A;  3ZEH A;  2EW3 A;  2QYZ A;  3V8J A;  3NHN A;  3R6N A;  2CS7 A;  4CC3 A;  4ORZ A;  3CCJ A;  1K9A A;  1UGP B;  1N6A A;  4JJB A;  2LZ6 B;  2CUB A;  5CQX A;  4EIK A;  2QAS A;  5KYU B;  3V8K A;  3BE3 A;  2DJQ A;  2DZC A;  2EJ9 A;  5GMK l;  3E9F A;  2CYZ B;  3EGX A;  1AZG B;  2QTV A;  3HKS A;  4C8Q F;  5GAN 4;  2XDD A;  2QI2 A;  5HK0 A;  3CBM A;  1VIF A;  1TUD A;  1X43 A;  1U5S A;  4DBF A;  3NTK A;  3GNF B;  2RHU A;  2RPN A;  1YWO A;  2EJG A;  1FXX A;  5KE2 A;  2DTH A;  4M7D F;  5GAO l;  1YIT T;  4AMC A;  1V1C A;  4WF2 A;  1YCS B;  1J3T A;  5GAN h;  4KUD K;  3REA B;  2CKK A;  2QDY B;  3OMG A;  3UT1 A;  1JXM A;  4OB2 B;  1TOV A;  3V8L A;  1OU9 A;  3PT9 A;  4ELY C;  4QT7 A;  3PVQ A;  1NYF A;  2EQM A;  2M0Y A;  3PIP A;  1VQ4 Q;  4BE1 A;  2BUD A;  5CKB A;  2YUN A;  4R55 A;  2EYY A;  4JRQ A;  2NLU A;  3CCS Q;  3LX7 A;  2AZS A;  1RAC B;  1M90 R;  5GJV B;  4CC2 A;  1VQ6 Q;  3G6E A;  4KH0 B;  2LNV A;  2RQR A;  4QKU A;  1VQL Q;  5CIU A;  4EMK A;  1KQS S;  1IGQ A;  1VQM A;  1IRE B;  4X9C A;  1MHN A;  4ZN3 A;  2RH2 A;  4J7F A;  3M59 A;  2EGC A;  3EG3 A;  1R0C B;  2M16 A;  2KYB A;  2RMO A;  2RI5 A;  3UAT A;  4PNO A;  2DKG A;  4ZN1 A;  1VQK T;  4NS5 A;  4C0Z A;  1VQN A;  1H3H A;  1UGR B;  4FW1 A;  5IHN A;  3U23 A;  4M78 A;  2K57 A;  2CP5 A;  2DIG A;  4C5I A;  5CKE A;  1NLO C;  4AT1 B;  5LJ3 j;  1RL2 A;  1M90 C;  2LRQ A;  3CD6 A;  2DF6 A;  2CP0 A;  4L59 A;  4MZP A;  1BIA A;  1WI7 A;  2RN8 A;  5GAN j;  2BZX A;  3VYH B;  2KSS A;  2XHC A;  2L3S A;  1GCP A;  4M7D E;  5CR2 A;  2LJ1 A;  3CC2 A;  1ABQ A;  1VQ7 T;  4HCB A;  4R0K A;  2DL3 A;  1VQL T;  3M0U A;  3CPW A;  5IAY A;  2P4T A;  2EYW A;  1I5L A;  4BB7 A;  1KIK A;  2VC8 A;  2L5Q A;  1MV3 A;  1UEC A;  3CME A;  2XIC A;  2KRN A;  2DFU A;  2QEX T;  1VQ7 A;  3M55 A;  3I55 A;  3OS1 A;  1G3Y A;  1IO6 A;  1BCO A;  1VQK Q;  4XU0 A;  2ZAE A;  1UHC A;  3PNW C;  2YRV A;  1C0M A;  1KD1 R;  2OTL Q;  1Y96 B;  1NJI C;  1D1C A;  1M3A A;  3L2V A;  4O5V A;  3M54 A;  5D6X A;  5IHK A;  1GCQ C;  2VGN A;  4GLK A;  4C92 F;  4JLI A;  2ROL A;  2E41 A;  4Y92 A;  3H6Z A;  3OYG A;  3Q1J A;  2L2P A;  3CBP A;  2HQE A;  3CCE T;  2NYS A;  3RDV A;  2F1L A;  2AKL A;  3JB9 I;  3JCM b;  4C8Q A;  3LGL A;  1SEM A;  4C92 A;  3A8M B;  2IVW A;  1UE9 A;  5LJ5 j;  1UDL A;  2LJ3 A;  1YHQ Q;  4PFZ A;  5LJ5 d;  3VS4 A;  1YIJ A;  2EWN A;  1D1A A;  2PU9 B;  1WXU A;  3UWN A;  1PHT A;  3EAE A;  1BI3 A;  2LCS A;  5GAM f;  4LE9 A;  5I21 A;  3G71 A;  3RER A;  1KFZ A;  2YT6 A;  3OSS C;  2DPP B;  1QW1 A;  4X1V A;  5GAO n;  1YJW Q;  5GAM d;  1I0C A;  3LH5 A;  3EGD B;  2M0O A;  1JB0 E;  1VQO Q;  5DM7 R;  1Q95 G;  4IUR A;  1PM3 A;  1N9R A;  1YJW A;  2L0A A;  3ASK A;  5GAN f;  4Y28 E;  4C5H A;  2JTE A;  2DX1 A;  2CSI A;  3EG2 A;  3E2U A;  2A36 A;  3L2Z A;  5D7U A;  1E7O A;  1VQ7 Q;  4FT4 A;  2WSC E;  1WYX A;  4ZTJ A;  1M8M A;  3G6E T;  2AZV A;  1UFF A;  3QBY A;  3JCM f;  1YHQ A;  3CCJ Q;  4OMP A;  1SSH A;  3CCL T;  2M9U A;  1QVG A;  4OMQ A;  3RES A;  2YRD A;  3CQT A;  1YIT Q;  2ENM A;  3OBY A;  2QAZ A;  2DYB A;  4QQG A;  3ZL7 C;  4M7D A;  5L8R E;  2YHT A;  1JBM A;  2PVD B;  1PRM C;  1V29 B;  1AHJ B;  1QP3 A;  2L3Q A;  2E70 A;  2E6Z A;  1AOJ A;  4M7A F;  1DJ7 B;  4BUG A;  2JM8 A;  3CC4 A;  3C0C A;  1I5O B;  2MIO A;  2EVR A;  2DLP A;  4BI8 B;  2NUT A;  2A0F B;  4J6W A;  3VS2 A;  2GQI A;  4XU2 A;  2NUT B;  5CKD A;  3CC7 T;  1RAI B;  4M77 E;  2KGT A;  3ULR B;  2KT8 A;  1RAB B;  3SDZ A;  2ZPB B;  1NPP A;  1M5Q 1;  3H0F A;  1C6V X;  4J9B A;  2LC4 A;  3S6W A;  3E19 A;  3M0Q A;  4CC4 B;  2PQW A;  1NEB A;  4PJM A;  2D8J A;  2BZY A;  5GAN d;  3VS6 A;  3JB9 H;  1WHK A;  2WSE E;  3JCM g;  2QQB A;  3CMA T;  4RCB A;  4B9W A;  4M7D B;  2RK1 A;  1OEB A;  1QKW A;  2LQN A;  4NOY A;  1GFD A;  1S72 Q;  3LLR A;  2PUO B;  3OYK A;  2B8A A;  1YJ9 A;  3OS0 A;  1UGS B;  3H9N A;  5IT9 E;  3SD4 A;  2D9T A;  1X27 A;  1ZLM A;  2XDB A;  2ATC B;  1K73 C;  3VV0 A;  1I07 A;  1VQO T;  1NE8 A;  1SKU B;  3BW1 A;  4N0A A;  3CXC S;  4HXJ A;  2OTJ T;  1QCN A;  2HMA A;  2HZY A;  5A0L A;  1H92 A;  4PJO D;  2KXD A;  2Y90 A;  2DEQ A;  1UJ0 A;  5LJ3 d;  1QVF P;  4RMO A;  1M1G A;  3M56 A;  4AFZ C;  1W4S A;  3QWY A;  2X9H A;  3OYE A;  3RKY A;  4QVD A;  2K5F A;  3C4S A;  3GP8 A;  1AZE A;  3MP8 A;  4RTU A;  7AT1 B;  5M9O A;  3WVD B;  4M77 C;  4C8Q G;  1QVF A;  1MMN A;  3G4S Q;  1YIJ T;  3A8L B;  1VQ5 Q;  3TRE A;  1OPL A;  1D0Y A;  4RG2 A;  1PD1 A;  3J80 E;  5FRN A;  2ED0 A;  3OYA A;  2ESW A;  2L3P A;  1GL5 A;  2OX7 A;  3OYD A;  1K0X A;  3TCJ A;  4P5N A;  2F2X A;  4JJC A;  2E3I A;  3O5Z A;  2E5K A;  1H8K A;  1ZX6 A;  2RI2 A;  2ABL A;  2MWO A;  2FB7 A;  3HSB A;  3C94 A;  2I0N A;  2RF0 A;  1VQ8 T;  4M77 A;  4E47 A;  1WLP B;  3CCU A;  4GBQ A;  2CZ7 B;  4B6M A;  4CC7 A;  2OTL T;  1EIF A;  2QGF B;  1OZ3 A;  5IH2 A;  1I4K 1;  2EGE A;  5EG2 A;  1VQ6 T;  3NTH A;  4PFO A;  1TSF A;  3JB9 F;  4PK4 A;  3CCE Q;  3A1P A;  1XOV A;  4JZ4 A;  3OYF A;  2A08 A;  3QII A;  4AG2 C;  3QWX X;  3MCA B;  2B86 A;  3D7S B;  5HY6 A;  5IN1 A;  1TWB A;  1U1T A;  3UA7 A;  5LL6 S;  1W2B S;  2CH4 W;  1K8A R;  5GMK j;  3OYL A;  1N8R C;  1NBE B;  4Y91 A;  4WTO B;  1HJD A;  3V7S A;  3FLG A;  1WJQ A;  1U3O A;  3QSU A;  1TTH B;  4ANJ A;  3KFV A;  3JCM X;  3CME Q;  2KEA A;  2P0P A;  2NUP A;  2LP5 A;  2RQU A;  2JT4 A;  4N0A C;  3CC4 T;  1MND A;  3QJ6 A;  2RM4 A;  1Q7Y U;  4II1 A;  2VAS A;  3HFO A;  3NFC A;  1S1N A;  1JXO A;  3CCS T;  3FEO A;  3OYN A;  5GAM e;  4LN2 A;  2D0N A;  4JZ3 A;  2VB6 A;  3CCM A;  4IUV A;  8AT1 B;  3E1S A;  1Q86 R;  5EC7 A;  3C95 A;  2F2V A;  3P8H A;  4HA8 A;  1OYX A;  3RKX A;  5KH6 A;  1QVP A;  2ZPH B;  3KBG A;  2R57 A;  4E7K A;  2DVJ A;  5ECA A;  3HFN A;  1YN8 A;  1WA7 A;  2C0T A;  5LJ3 f;  2C06 A;  1BIB A;  3SWN C;  3HRU A;  4RTV A;  3MPU B;  4J6X A;  1YJN Q;  4M78 B;  1OQK A;  3CMA A;  4XAX B;  1ZQ1 A;  4F04 B;  2DET A;  1SPK A;  1TS9 A;  3QYG B;  3TEE A;  2F2W A;  3OYY A;  1TG0 A;  2D0Q B;  2J05 A;  1KJW A;  2RNA A;  4XTU A;  1K1Z A;  1UGQ B;  2QA4 A;  4JPB W;  2DER A;  2W10 A;  1PSE A;  1TUG B;  2DE0 X;  3R6O A;  4EMK B;  1QWE A;  4VUB A;  1WPY A;  2JM9 A;  3CCV Q;  3A8O B;  3I56 A;  3VUZ A;  1PKS A;  3CCM Q;  3C12 A;  2LCL A;  3EH1 A;  3QJY A;  2JUF A;  3E9G A;  2DXT A;  1ZA1 B;  3JB9 D;  4ZGE B;  2CUD A;  4RUG A;  1SF9 A;  4HCK A;  4PL6 A;  3GLX A;  2XU8 A;  2OTJ A;  1HSQ A;  3X20 B;  3S3M A;  3CC7 A;  4Z02 A;  2O31 A;  2JNG A;  1ABO A;  4DBH A;  2VGM A;  3V7R A;  2GQV A;  3JCM h;  4UC4 A;  3RUX A;  2KDS A;  2RI3 A;  4HKE A;  3TSW A;  2ZPG B;  4OMF B;  1QVG P;  4F17 A;  1UJY A;  2E5Q A;  1Z9Q A;  4PFP A;  5LJ3 e;  2HQH A;  4A53 A;  3FC3 A;  6AT1 B;  1YIJ Q;  4J6Y A;  4BAC A;  1SRL A;  3QXE B;  1FWZ A;  2R5M A;  4KGV B;  2KR3 A;  4FYY B;  1ZSZ C;  2YUO A;  5DLQ E;  3JCM W;  3MP6 A;  2DM1 A;  3OW2 P;  1QVG S;  2EQK A;  5FU6 B;  2CP3 A;  4F7U B;  2DIL A;  3MEA A;  1KQS P;  3VS1 A;  4LDX A;  3GPL A;  4OVA A;  1QMC A;  2LCC A;  1B34 A;  2ZGW A;  1SHG A;  3CD6 T;  1VQ5 A;  1AVZ C;  2H8H A;  4A54 A;  4OGC A;  2LJ0 A;  3MET A;  4M77 G;  2GFU A;  1KG1 A;  1VA7 A;  1BB9 A;  3PGG A;  4J8O A;  1RI9 A;  2W0Z A;  1PNJ A;  3JB9 G;  1SRM A;  5CCA A;  1M8V A;  4C0D C;  2JW4 A;  3G1J A;  5FWC A;  4C0G A;  3OY9 A;  2QQ9 A;  1WGS A;  3CCQ A;  2L89 A;  2MCN A;  3VS3 A;  5D6Y A;  1YJN A;  1Q81 U;  1OOT A;  2YLC A;  2PVO B;  2IG0 A;  2H3J A;  2O88 A;  1U06 A;  4J7I A;  3PMI A;  1C1A A;  1NZ9 A;  2DBM A;  5GAN 6;  1Q82 C;  1MUZ A;  2J6F A;  3M0S A;  2EFI A;  1JRI A;  4M78 C;  2V1R A;  1EZZ B;  3CCJ T;  2KRS A;  4EMH A;  5FLX E;  4LD9 K;  1WQ7 A;  2HL3 A;  1YJ9 Q;  3CC2 Q;  2MYS A;  3QO3 A;  1XNI A;  1QQJ A;  4M75 G;  1RAF B;  3SB2 A;  1JJ2 S;  1NG2 A;  3UPU A;  1UG1 A;  5LJ5 e;  1VQ9 T;  3X24 B;  5LJ3 h;  1OV3 A;  2GCX A;  1VQP T;  1RAE B;  4RG8 A;  1WJR A;  3OQ5 A;  2HEQ A;  1G2B A;  1E6G A;  3JRZ A;  3NMZ C;  3OW2 S;  5FRM A;  1D0X A;  4C92 D;  2KYM A;  3RKW A;  3VKI A;  3INZ A;  5CO7 A;  2RHY A;  1M2V A;  3I5S A;  2CZ6 B;  2RQW A;  1ZSZ A;  2LTO A;  1M27 C;  9ATC B;  3VJP A;  5GAO r;  2X4Y A;  2YLB A;  2FG0 A;  1UEB A;  2E4H A;  4FU6 A;  2FPE A;  1M3C A;  1VQM Q;  2FPF A;  5L23 A;  5HCK A;  3H41 A;  1Q7Y C;  1PRL C;  1AEY A;  2FZG B;  2KAF A;  2DD5 A;  5GAN 2;  4N4H A;  3M0R A;  4C92 E;  3FRN A;  2OAW A;  1IGU A;  4HCZ A;  2CRE A;  3PIO A;  4A4K A;  2CP7 A;  1X6G A;  4LXC A;  5KYY B;  4PJO C;  3CPW S;  2JZ2 A;  4L6V 5;  4A4F A;  5I2M A;  1GBR A;  4XK8 E;  2WAC A;  3OYM A;  1XTD A;  2HAX A;  2EAY A;  4XU1 A;  4OB1 B;  4OMN A;  2EQI A;  1X69 A;  4ZNX A;  1NYG A;  5CQY A;  4M7A A;  5C6S A;  1YP5 A;  1LNX A;  1MMD A;  3FDR A;  2X4J A;  3NTI A;  4HT9 A;  4MZT A;  1RAH B;  2MF2 A;  3I55 Q;  3HPW A;  1H3Z A;  1U8R A;  4RCC A;  1OPK A;  3MHX A;  1I1J A;  3JSC A;  1VQ8 Q;  3P8D A;  4FSX A;  3I55 T;  5AYF A;  3SHW A;  2JN0 A;  3HHT B;  3WXM B;  1AWJ A;  1WHM A;  4JS5 A;  1UTI A;  4KRT A;  1ZHI A;  2K3B A;  4PKC C;  3GBQ A;  4FYX B;  3H0I A;  1VQ5 T;  5C0M A;  2JTF A;  1KQS A;  3LWI A;  3PE0 A;  2A3L A;  2EKO A;  1MV0 B;  3GOX A;  2ROT A;  3GF5 A;  1KQ1 A;  1MNE A;  4E7I A;  5FRO A;  3VS7 A;  4RKU E;  3L42 A;  1XJW B;  3A5Z B;  2CGH A;  1LVK A;  3QKJ A;  3RBB B;  1TH7 A;  3CCL Q;  3OA6 A;  3VS5 A;  5LJ5 h;  2PZ1 A;  2COW A;  4C5E A;  2GNC A;  4D8D A;  2QK0 A;  2KT1 A;  3EG0 A;  2NWM A;  1M1F A;  2KXC A;  2X3W D;  1M1K R;  4JJD A;  4LUE A;  4M75 E;  2LDM A;  2JMA A;  3CC4 Q;  3M0T A;  3HP9 A;  4JRK A;  1RLP C;  4C8Q D;  2WSF E;  3S3O A;  4LNP A;  1VQ6 A;  5GAO q;  1YIT A;  2E12 A;  5FW9 A;  3OYH A;  2V8I A;  2JTM A;  2L8D A;  2CH4 A;  4LDV A;  2F5K A;  4AG1 C;  1Y07 A;  4O6J A;  4QW2 A;  1WHJ A;  2DL4 A;  1FMV A;  5GAO p;  3CPF A;  2G3R A;  1W1F A;  1GBQ A;  4M78 D;  1YWP A;  2J7I A;  2VV5 A;  4M78 E;  1KC8 U;  2QEX Q;  4E2F B;  1N9S A;  4LD6 A;  2K2M A;  4PLI A;  2FZC B;  2FO0 A;  2K79 A;  1IB8 A;  1P92 A;  4Z88 A;  4ESR A;  4FW2 A;  2RA2 A;  1EFN A;  2ZPF B;  3A8G B;  2YWW A;  5GAM j;  4DQ2 A;  1WIE A;  4K11 A;  1IXD A;  2J6K A;  1TU0 B;  1VYV A;  2KY9 A;  1UB4 A;  4KT0 E;  3OMC A;  4E6R A;  5GAN 3;  3AHU A;  5DY9 A;  5A2Q E;  3G71 Q;  2K6D A;  4KGZ B;  4RTY A;  2QG9 B;  2QXF A;  4AFQ C;  5KYW B;  2EJF A;  1R0B G;  5GJW B;  3L1A A;  4KGX B;  1YBY A;  4KUL A;  3CCU Q;  2XI9 A;  1HXD A;  5CVI A;  8ATC B;  4MMK A;  4ZGJ B;  1X6B A;  3CBO A;  4FT2 A;  4M78 F;  2K9G A;  1KC8 C;  1VQM T;  2EPD A;  3JAM E;  1WQW A;  1IHV A;  1D3B A;  1AT1 B;  4J9D A;  2QA4 Q;  3JCM c;  2QGG A;  2GTO A;  2E10 A;  2V1Q A;  1ZA2 B;  1JEG A;  2KVQ G;  1G3S A;  2OTL A;  1KQ2 A;  3NPF A;  2HBW A;  3G4S A;  3A98 A;  5KE3 A;  1G8X A;  1X75 C;  2KK4 A;  3PMT A;  4M7D G;  4A63 B;  4OGE A;  4JDS A;  3URG A;  1VQK A;  1VQN T;  1Y57 A;  3LGF A;  5I22 A;  1WJS A;  2JVV A;  4C5G A;  2KRO A;  3UA6 A;  2DL8 A;  3EH2 A;  4BE2 A;  2FEI A;  3HRT A;  3H8Z A;  4OB0 B;  1VYU A;  1VUB A;  2LX9 A;  3I56 T;  1X6O A;  3PFS A;  1BI0 A;  3EG9 A;  1LPL A;  1M2O A;  1UGV A;  2DMO A;  2COZ A;  3L2W A;  2QA4 T;  3LWH A;  4F16 A;  5A0G A;  1VQ9 Q;  4OML A;  1K8A C;  4F7U G;  1QKX A;  2XD0 A;  4E7J A;  2KQW A;  4BY6 C;  2MWP A;  4BY6 B;  2CT3 A;  1WZO A;  4J9H A;  1VQ4 T;  4M7A G;  3HTR A;  5KYX A;  3QHS A;  3EHR A;  3TU4 K;  3RR6 A;  1VIE A;  4C0D B;  4DOW A;  2K5I A;  1WX6 A;  2BZ8 A;  2XMF A;  4F7U E;  2LQW A;  2E6N A;  3CCE A;  2JMC A;  2V26 A;  1BK2 A;  3OBW A;  3REB B;  1A0N B;  1SG5 A;  3SWN B;  1VQL A;  2EYQ A;  1K0S A;  1UUE A;  2AHJ B;  1O9S A;  2M02 A;  2DXB A;  2CP6 A;  1G3W A;  3BFM A;  2HSP A;  4M75 B;  4F7U F;  4B9X A;  1S72 T;  3CPW P;  4V2S A;  3EFO B;  2MI6 A;  2P84 A;  1I81 A;  3TVT A;  1Q81 R;  3SEM A;  3RNJ A;  3VRY A;  2IPO B;  1Y7X A;  2VXF A;  2RD1 A;  1WXT A;  3X26 B;  4EMG A;  1K73 U;  1WFW A;  3SFM A;  3M0P A;  2HKQ B;  4GLM A;  2L3R A;  2O4X A;  2DAQ A;  1ZUK A;  1FYN A;  2DXC A;  4FM4 B;  3OW2 A;  3O8V A;  1YHQ T;  3G4S T;  2PVG B;  4DEY A;  3ME9 A;  5FWB A;  1Y71 A;  4FCY A;  1VOM A;  2GFA A;  4DEX A;  3J81 E;  2RQT A;  2MOX A;  4ZGD B;  1T0J A;  1ZBJ A;  4C8Q E;  1K9M C;  3OYJ A;  3UF4 A;  4XTZ A;  3KXT A;  1OU8 A;  2FL7 A;  4C92 G;  1H64 1;  4FL6 A;  3M57 A;  3QYH B;  2O2O A;  4YTL A;  2ED1 A;  1XQH A;  4Z8A A;  3CXC P;  1T0H A;  2QDL A;  3OSV A;  3DKM A;  3MKD A;  4EPC A;  4M77 D;  3I5R A;  2X35 A;  1Q86 U;  1ARK A;  3FJP A;  1IRX A;  1X2K A;  4QQD A;  2BE9 B;  1TUC A;  2YUQ A;  2QQS A;  1FMK A;  4XQ3 A;  1M30 A;  1OUL A;  1PWT A;  2PNI A;  4PJN A;  2DTI A;  4OB3 B;  3M58 A;  1CKA A;  2RJF A;  2RHZ A;  3BY7 A;  3JCM d;  1KD1 U;  2MPX C;  3EGU A;  3OS5 A;  1OI1 A;  2OJ2 A;  5GAN g;  4J9E A;  2KBT A;  2RQV A;  2IIM A;  4RTW A;  3QZ9 B;  1OX8 A;  4M75 D;  3CCL A;  4M78 G;  2H3E B;  2A7Y A;  4IUP A;  2FPD A;  4XTX A;  2DL7 A;  4WCI A;  1VQ9 A;  2DRM A;  1Q82 U;  3CCR A;  4BI3 A;  1CSK A;  4XTW A;  3RMQ A;  5DLO A;  3L2R A;  2FHD A;  4RTT A;  2KNB B;  2E1H A;  4JLG A;  1RAD B;  1Q82 R;  2MMP A;  1IZ6 A;  1WXB A;  5CKH A;  3T9N A;  2DVE A;  4C8Q C;  1VQ4 A;  5HK3 A;  4JRP A;  1LJO A;  2D6F A;  1VQ8 A;  2SEM A;  3ZFJ A;  5IHI A;  3CC2 T;  2FZK B;  1YNZ A;  2NUP B;  1NJI R;  1WDX A;  1G83 A;  2G6F X;  2DJZ A;  2KMT A;  1E6H A;  4HVW A;  4IIO A;  3RMS A;  2X3X D;  2Y4X A;  3M53 A;  1HK9 A;  1JO8 A;  3F70 A;  2EIF A;  2K2V A;  5FU7 B;  2HBP A;  4RTZ A;  2M51 A;  4A4H A;  1ZUU A;  4HVU A;  2C0I A;  4LDY A;  5KYN A;  2O4X B;  3DLM A;  1M1K C;  5J3B A;  2RJC A;  1M90 U;  2QEX A;  5GAN 8;  1VQP A;  5GAO m;  4PJO G;  3G6E Q;  1X01 A;  5KCO A;  2RJD A;  2K7A A;  2OI3 A;  1Q7Y R;  1PCX A;  2DIQ A;  5CAI A;  5IXF A;  3CCV T;  4ATO A;  2K3X A;  4MDW A;  4M77 B;  1MMA A;  3EFO A;  4GY5 A;  4M7D D;  3OB9 A;  2P4R A;  1FMW A;  2DXU A;  2K5L A;  2VKN A;  1WHL A;  2DNU A;  3AT1 B;  4M75 A;  4E7Z A;  3I56 Q;  1JJ2 A;  3CXC A;  3VUB A;  1RUW A;  2DO3 A;  3SWN A;  1LOJ A;  3S3N A;  5GMK m;  1B07 A;  2EKH A;  4PJL A;  2BIV A;  4JUV A;  4IUT A;  1YI2 Q;  1WHH A;  2X4X A;  1BYM A;  3QUI A;  2HCK A;  3CME T;  1MGQ A;  2GBQ A;  4AFU C;  2QQA A;  4MDX A;  2JJ9 A;  4BDY A;  4OMM A;  3VYG A;  3JCM Q;  1ACM B;  1BI1 A;  3CCQ T;  1JJ2 P;  1R8O B;  1RLQ C;  4F14 A;  1RI0 A;  3CCM T;  3CC7 Q;  5KYX B;  1NJI U;  3MEV A;  3MP1 A;  5I11 A;  1KD1 C;  1ZSG A;  2OTJ Q;  4X9D A;  1QCF A;  2GTJ A;  5GAM g;  2PTK A;  1M9S A;  2DBK A;  2JXB A;  1W2B P;  2DRK A;  2AK5 A;  2R5A A;  1NPR A;  1QP2 A;  3MJX A;  2VYT A;  2F5T X;  2CT4 A;  3M4Y A;  1QLY A;  2HL5 C;  4JJN K;  4ELZ C;  1PSF A;  1B7T A;  3EG1 A;  3EG9 B;  3CCV A;  1KHC A;  3OS2 A;  2LX7 A;  3UDC A;  1OZ2 A;  4FSS A;  1NEG A;  3GIB A;  2P0K A;  1Q86 C;  2DYI A;  4BI4 A;  3LW5 E;  4HCC A;  1JU5 C;  2ZCF B;  1AWX A;  2X4W A;  2FYK A;  2CZ1 B;  1VQN Q;  2XID A;  1MMG A;  3JCM e;  1QCO A;  3CCR T;  1WNL A;  5FU7 C;  2CZ0 B;  2OAU A;  5KCH A;  3M4G A;  3DB4 A;  4MML A;  4DOV A;  1YCY A;  2JS2 A;  2O01 E;  4C0F A;  1K4U S;  1ZBX A;  1YI2 A;  4N4G A;  4BD3 A;  3OYC A;  1GXI E;  3G7Z A;  1D3B B;  5GAN e;  2KE9 A;  2Y4Y A;  1K9M U;  1KHI A;  3MEW A;  2LT1 A;  3FIF A;  4PJO F;  1ZUY A;  2LQK A;  1Z9Z A;  4E7H A;  1UHF A;  2AT1 B;  1KC8 R;  4A4E A;  1PKT A;  2BE7 D;  2EBP A;  2YXY A;  1T3L A;  2ECZ A;  5FU6 C;  2K3Y A;  5KYW A;  1VQP Q;  2LVM A;  3DB3 A;  2XDP A;  2SRC A;  4BDZ A;  1KSW A;  2E65 A;  2VVK A;  1IHW A;  1OX9 A;  4J9I A;  2HKN A;  3LYI A;  1PD0 A;  4J9F A;  2A37 A;  4DA4 A;  1WHG A;  2DD4 A;  3FJ5 A;  2NUZ A;  1VYT A;  2GGR A;  1X2Q A;  1RAG B;  4D6W A;  2FRW A;  3EGD A;  3NGP A;  2DA9 A;  2LNH B;  5D6W A;  4PJJ A;  2HD0 A;  2O9V A;  2E64 A;  1G5V A;  4OF1 A;  1NM7 A;  1T3S A;  3GNG A;  4TVR A;  2QQR A;  4DBQ A;  4XTY A;  2FRY A;  3EFS A;  2CDT A;  2DZ9 A;  2I2L A;  4NL3 A;  1Q81 C;  2D1X A;  3PTA A;  1BU1 A;  4NL2 A;  1AWW A;  2JOY A;  2EYX A;  2YSQ A;  1D09 B;  3P8B B;  4M7D C;  1YI2 T;  1YJW T;  3J7A F;  1HYO A;  5GAN 7;  4C92 B;  2V8K A;  4Z89 A;  4C8Q B;  2RK2 A;  3G71 T;  3OYB A;  4MZM A;  1Y0M A;  4QQ6 A;  2MK5 A;  4LDU A;  2M1H A;  5GMK h;  2EQJ A;  1JQQ A;  3TQ7 P;  1K73 R;  4KH1 B;  4OMO A;  2R58 A;  4ME7 A;  2BKD N;  5HKC A;  2LQ8 A;  1N8R U;  1BBZ A;  1Y96 A;  2JS0 A;  3WVE B;  2ZPE B;  1KK7 A;  4IUQ A;  2KRM A;  1SHF A;  2DTO A;  3CMA Q;  1N27 A;  1YJN T;  1I8F A;  2YRC A;  2VXE A;  5I2S A;  1G3T A;  3QPH A;  4M75 F;  1AD5 A;  2FVU A;  2V8J A;  1W70 A;  2XKO C;  4EMK C;  4J9G A;  3JCM J;  2BTT A;  2HQX A;  2VUB A;  2EQU A;  2GF7 A;  2J6O A;  1S72 A;  3BDU A;  5GAM h;  1RAA B;  1D1B A;  4M7A D;  4J9C A;  2MAM A;  4IKF A;  4DBR A;  3CCR Q;  3KUF A;  2HSE B;  2HDA A;  4M77 F;  2HNI A;  3L2Q A;  4N4I A;  4RTX A;  1GCQ A;  2DEU A;  3QZ5 B;  1N5Z A;  2Z0W A;  1YJ9 T;  2J06 A;  3VS0 A;  4M75 C;  3BDL A;  2RO0 A;  5AT1 B;  4XTV A;  3TSZ A;  3MO8 A;  4M7A E;  4M7A B;  3OYI A;  2YDL A;  4LDW A;  3JCM V;  4L5G A;  4CRI A;  3FB9 A;  2D8H A;  2RB6 A;  5CK9 A;  2RJE A;  4AFS C;  3DLL A;  1B3Q A;  3VU3 C;  2AKK A;  3I9Q A;  1HD3 A;  1M4Z A;  1F1B B;  3A8H B;  1TXQ A;  1K76 A;  5KYY A;  3THK A;  3ER0 A;  3CCS A;  3I35 A;  4C92 C;  3X28 B;  4XU3 A;  3V7C A;  4FYV B;  2DL5 A;  2LT4 A;  2XK0 A;  1BI2 A;  3VRZ A;  1LCK A;  2EGA A;  4QVZ A;  1V76 A;  1QVF S;  3LH0 A;  4X34 A;  2ZZD A;  5CKF A;  4LUD A;  1W6X A;  3H0H A;  1W2B A;  2C0O A;  2PUK B;  1SSF A;  4E7S A;  2K4Y A;  1BKB A;  5LJ5 g;  1VQO A;  1ZSZ B;  2LMJ A;  1CKB A;  5J39 A;  2XG8 D;  4ZTF A;  5J26 A;  1M2V B;  5GMK i;  2RHX A;  2DK3 A;  2E3H A;  4KBM B;  5GAN 5;  5A0D A;  1QWF A;  4OP0 A;  2YUP A;  3N5B B;  3EGX B;  4A4G A;  2ZPI B;  4EDU A;  2EYZ A;  1D0Z A;  4FYW B;  4IUU A;  3JV3 A;  3IQL A;  4D8K A;  3EHQ A;  1O75 A;  4HT8 A;  2KI7 A;  5KYU A;  3ZBD A;  4QVC A;  2O9S A;  4FIB A;  2P0Q A;  2COY A;  3PVL A;  2F69 A;  3QDF A;  1NLP C;  3CCU T;  3HRS A;  1K9M R;  4PLL A;  2RHI A;  4KUI A;  3CEY A;  2CSQ A;  3EFR A;  4R56 A;  4E7L A;  3JCM P;  1GRI A;  2VWF A;  4Q5W A;  4BE0 A;  4PJO B;  3MEU A;  1N8R R;  1GFC A;  3CD6 Q;  1U1S A;  2X51 A;  3QG1 A;  4J5Y A;  4CI0 C;  3CCQ Q;  1FX7 A;  5IXB A;  5GMK e;  2A28 A;  4IIM A;  3M9Q A;  3X25 B;  5LJ5 f;  2QTX A;  1K8A U;  1M1K U;  1R77 A;  1BCM A;  3RIR A;  4M7A C;  4M4Z A;  3QDR B;  3L2U A;  2AIR B;  1B34 B;  4J83 A;  1EX4 A;  3HL8 A;  3M5A A;  1AWO A;  2CP2 A;  4F7U A;  5LJ3 g;  4JS4 A;  4PJO E;  4JRI A;  4PJO A;  1M3B A; 
#chains in the Genus database with same CATH homology
 3QUI A;  3QII A;  3S3O A;  3MCA B;  3CME T;  3JB9 J;  1VQ6 A;  1MGQ A;  5GAO q;  5HY6 A;  3ZEH A;  5IN1 A;  2QQA A;  3V8J A;  1YIT A;  4MDX A;  1U1T A;  4BDY A;  2E12 A;  5LL6 S;  3OYH A;  1W2B S;  3VYG A;  3JCM Q;  1BI1 A;  2CS7 A;  2V8I A;  2JTM A;  2L8D A;  5GMK j;  3OYF A;  3OYL A;  1R8O B;  3CCJ A;  3CCQ T;  4LDV A;  1N8R C;  1UGP B;  4Y91 A;  2F5K A;  1RI0 A;  3CCM T;  1N6A A;  1NJI U;  1Y07 A;  3MEV A;  3FLG A;  1WJQ A;  3MP1 A;  4O6J A;  4QW2 A;  3V7S A;  1KD1 C;  5CQX A;  3QSU A;  3V8K A;  4X9D A;  5GAO p;  3CPF A;  3JCM X;  5GAM g;  2G3R A;  2DZC A;  2P0P A;  2EJ9 A;  1M9S A;  4M78 D;  4N0A C;  2VV5 A;  3E9F A;  2CYZ B;  5GMK l;  3QJ6 A;  4M78 E;  3CC4 T;  2RM4 A;  1KC8 U;  1Q7Y U;  4II1 A;  3HKS A;  4C8Q F;  5GAN 4;  2XDD A;  1N9S A;  2QI2 A;  3HFO A;  4LD6 A;  3NFC A;  3CCS T;  2R5A A;  3FEO A;  1NPR A;  1QP2 A;  4PLI A;  5HK0 A;  3CBM A;  1VIF A;  3OYN A;  2VYT A;  5GAM e;  2F5T X;  3CCU T;  1P92 A;  3M4Y A;  2RA2 A;  4JJN K;  3CCM A;  4ELZ C;  1PSF A;  1Q81 U;  4IUV A;  3NTK A;  3GNF B;  2RHU A;  3E1S A;  3CCV A;  2ZPF B;  3A8G B;  2EJG A;  3C95 A;  1FXX A;  5KE2 A;  3P8H A;  4HA8 A;  1KHC A;  1OYX A;  2DTH A;  3RKX A;  5KH6 A;  5GAM j;  5GAO l;  3UDC A;  3OS2 A;  1QVP A;  4DQ2 A;  1YIT T;  4M7D F;  2ZPH B;  3KBG A;  2R57 A;  1OZ2 A;  1UB4 A;  2KY9 A;  3OMC A;  4KT0 E;  4WF2 A;  5GAN 3;  4E7K A;  5GAN h;  3AHU A;  4KUD K;  3GIB A;  3HFN A;  2CKK A;  5DY9 A;  2P0K A;  2QDY B;  3OMG A;  3UT1 A;  5A2Q E;  5LJ3 f;  1Q86 C;  2C06 A;  1BIB A;  3SWN C;  4BI4 A;  3HRU A;  3LW5 E;  4HCC A;  4OB2 B;  2QXF A;  3V8L A;  2EJF A;  2ZCF B;  4ELY C;  3PT9 A;  2X4W A;  4J6X A;  4M78 B;  2FYK A;  2CZ1 B;  3L1A A;  3CMA A;  4XAX B;  2EQM A;  3PIP A;  1YBY A;  1ZQ1 A;  2BUD A;  4KUL A;  5CKB A;  4BE1 A;  2XID A;  1HXD A;  2XI9 A;  3QYG B;  5CVI A;  3TEE A;  3JCM e;  4R55 A;  3CCR T;  1WNL A;  2NLU A;  5FU7 C;  4JRQ A;  2CZ0 B;  4MMK A;  3LX7 A;  2OAU A;  4ZGJ B;  3OYY A;  5KCH A;  3CBO A;  3M4G A;  3DB4 A;  4MML A;  4FT2 A;  4DOV A;  1YCY A;  4M78 F;  1KC8 C;  2O01 E;  3G6E A;  4C0F A;  1VQM T;  2D0Q B;  2LNV A;  3JAM E;  1ZBX A;  1WQW A;  5CIU A;  1D3B A;  4EMK A;  1KQS S;  4XTU A;  1YI2 A;  1UGQ B;  3JCM c;  4N4G A;  1VQM A;  4BD3 A;  2QA4 A;  3OYC A;  1GXI E;  1PSE A;  3G7Z A;  1IRE B;  2E10 A;  1D3B B;  3R6O A;  4X9C A;  2Y4Y A;  4EMK B;  5GAN e;  1KHI A;  1MHN A;  4VUB A;  1K9M U;  1WPY A;  1G3S A;  2KVQ G;  2LT1 A;  2RH2 A;  3FIF A;  3MEW A;  4J7F A;  3M59 A;  4PJO F;  4ZN3 A;  2LQK A;  2OTL A;  4E7H A;  3A8O B;  1KQ2 A;  3I56 A;  3VUZ A;  3G4S A;  2M16 A;  2RI5 A;  3C12 A;  5KE3 A;  4PNO A;  2LCL A;  2DKG A;  1X75 C;  2KK4 A;  3PMT A;  4NS5 A;  4C0Z A;  4ZN1 A;  4A4E A;  1VQK T;  1VQN A;  3QJY A;  4M7D G;  1UGR B;  2JUF A;  3E9G A;  2DXT A;  4OGE A;  4JDS A;  4M78 A;  3URG A;  3JB9 D;  1VQK A;  1VQN T;  2K57 A;  2DIG A;  5FU6 C;  4C5I A;  4ZGE B;  5CKE A;  2K3Y A;  5LJ3 j;  1RL2 A;  3LGF A;  1M90 C;  2LVM A;  1WJS A;  2LRQ A;  4PL6 A;  3DB3 A;  2JVV A;  3CD6 A;  2XDP A;  3GLX A;  4C5G A;  4BDZ A;  2E65 A;  2XU8 A;  4L59 A;  2OTJ A;  3X20 B;  3S3M A;  4MZP A;  1BIA A;  3CC7 A;  4Z02 A;  4BE2 A;  3LYI A;  2JNG A;  3HRT A;  3H8Z A;  4OB0 B;  4DA4 A;  5GAN j;  2DD4 A;  3VYH B;  2KSS A;  2VGM A;  3V7R A;  1VUB A;  2LX9 A;  2XHC A;  3I56 T;  1X6O A;  3PFS A;  1BI0 A;  2GQV A;  4D6W A;  4M7D E;  3JCM h;  5CR2 A;  4UC4 A;  5D6W A;  3CC2 A;  2HD0 A;  2E64 A;  3RUX A;  2KDS A;  2RI3 A;  1VQ7 T;  4HCB A;  4HKE A;  3L2W A;  2QA4 T;  2ZPG B;  4OMF B;  4OF1 A;  1G5V A;  1VQL T;  3LWH A;  3CPW A;  5A0G A;  3GNG A;  5IAY A;  2P4T A;  4TVR A;  2E5Q A;  2QQR A;  4BB7 A;  1I5L A;  4XTY A;  3EFS A;  2VC8 A;  1K8A C;  2L5Q A;  4F7U G;  2DZ9 A;  2I2L A;  4NL3 A;  3CME A;  2XIC A;  1Q81 C;  2QEX T;  3PTA A;  1VQ7 A;  2XD0 A;  5LJ3 e;  4E7J A;  3M55 A;  4NL2 A;  3I55 A;  2KQW A;  4BY6 C;  2JOY A;  2MWP A;  3OS1 A;  4BY6 B;  1G3Y A;  1VQ4 T;  4A53 A;  3FC3 A;  3P8B B;  4M7A G;  4J6Y A;  1YI2 T;  4M7D C;  4BAC A;  1YJW T;  3J7A F;  3QXE B;  4XU0 A;  3QHS A;  1FWZ A;  2R5M A;  3PNW C;  5GAN 7;  3TU4 K;  4C92 B;  2V8K A;  2YRV A;  5DLQ E;  4C8Q B;  3JCM W;  2RK2 A;  3MP6 A;  3G71 T;  3OYB A;  4MZM A;  1VIE A;  4C0D B;  4QQ6 A;  1Y96 B;  1NJI C;  4DOW A;  4LDU A;  3L2V A;  2M1H A;  2K5I A;  5GMK h;  4O5V A;  1KG1 A;  3M54 A;  2EQJ A;  5D6X A;  1QVG S;  2EQK A;  2VGN A;  4GLK A;  5FU6 B;  4F7U E;  2E6N A;  4C92 F;  4F7U B;  3CCE A;  4JLI A;  2R58 A;  4ME7 A;  3MEA A;  2E41 A;  2BKD N;  3H6Z A;  3OBW A;  5HKC A;  3OYG A;  2LQ8 A;  1N8R U;  3Q1J A;  4LDX A;  3GPL A;  4OVA A;  3CBP A;  2HQE A;  3SWN B;  2LCC A;  1VQL A;  1B34 A;  3CCE T;  2ZGW A;  1Y96 A;  3WVE B;  2EYQ A;  3CD6 T;  2AHJ B;  1VQ5 A;  4A54 A;  3JB9 I;  1O9S A;  3JCM b;  2DXB A;  4OGC A;  1G3W A;  2ZPE B;  2GFU A;  3BFM A;  3LGL A;  3MET A;  4IUQ A;  4M77 G;  4M75 B;  4C8Q A;  4C92 A;  4B9X A;  3A8M B;  4F7U F;  1S72 T;  2DTO A;  3PGG A;  4J8O A;  4V2S A;  2IVW A;  2MI6 A;  5LJ5 j;  1N27 A;  1I81 A;  1YJN T;  3JB9 G;  5CCA A;  1M8V A;  1I8F A;  5LJ5 d;  2VXE A;  4C0D C;  4C0G A;  5I2S A;  3OY9 A;  1G3T A;  2QQ9 A;  1YIJ A;  1WGS A;  1Y7X A;  2EWN A;  2L89 A;  2PU9 B;  5D6Y A;  2VXF A;  3QPH A;  3CCQ A;  1YJN A;  2YLC A;  4M75 F;  2PVO B;  2IG0 A;  3UWN A;  2RD1 A;  2H3J A;  3X26 B;  4EMG A;  3EAE A;  1BI3 A;  1K73 U;  2FVU A;  4J7I A;  5GAM f;  3PMI A;  5I21 A;  3G71 A;  3RER A;  1NZ9 A;  3SFM A;  2V8J A;  2XKO C;  5GAN 6;  1Q82 C;  4EMK C;  2EFI A;  1JRI A;  2L3R A;  2O4X A;  3OSS C;  2DAQ A;  2DPP B;  1QW1 A;  2HQX A;  2VUB A;  4M78 C;  3CCJ T;  2EQU A;  5GAO n;  4EMH A;  2DXC A;  2GF7 A;  4FM4 B;  1WQ7 A;  5FLX E;  4LD9 K;  5GAM d;  3OW2 A;  3O8V A;  2M0O A;  3QO3 A;  1JB0 E;  1XNI A;  4M75 G;  1S72 A;  1YHQ T;  5DM7 R;  3BDU A;  4IUR A;  5GAM h;  3G4S T;  3SB2 A;  2PVG B;  4M7A D;  1JJ2 S;  1N9R A;  1YJW A;  3ASK A;  5GAN f;  2MAM A;  4IKF A;  4Y28 E;  3ME9 A;  4C5H A;  1Y71 A;  3UPU A;  5LJ5 e;  1VQ9 T;  3X24 B;  3KUF A;  5LJ3 h;  2GFA A;  3L2Z A;  2GCX A;  1VQP T;  3J81 E;  4M77 F;  2HNI A;  1WJR A;  3OQ5 A;  4RG8 A;  3L2Q A;  4N4I A;  4ZGD B;  4FT4 A;  2WSC E;  4ZTJ A;  3JRZ A;  4C8Q E;  1K9M C;  3QZ5 B;  3OYJ A;  3G6E T;  3OW2 S;  1YJ9 T;  5FRM A;  3QBY A;  3JCM f;  4C92 D;  1YHQ A;  4XTZ A;  3RKW A;  3VKI A;  4M75 C;  3KXT A;  3BDL A;  2FL7 A;  3INZ A;  5CO7 A;  4C92 G;  1H64 1;  4FL6 A;  3CCL T;  2RO0 A;  3M57 A;  2M9U A;  3QYH B;  2RHY A;  1QVG A;  3RES A;  4XTV A;  4YTL A;  2CZ6 B;  1XQH A;  3MO8 A;  3OBY A;  4M7A E;  2LTO A;  4M7A B;  4QQG A;  3OSV A;  3DKM A;  4EPC A;  4M77 D;  4M7D A;  3OYI A;  3VJP A;  5L8R E;  5GAO r;  2X4Y A;  2YLB A;  2YHT A;  1JBM A;  2X35 A;  4LDW A;  4L5G A;  3JCM V;  4CRI A;  2PVD B;  1Q86 U;  1V29 B;  1UEB A;  3FB9 A;  3FJP A;  1AHJ B;  2RB6 A;  5CK9 A;  1QP3 A;  4FU6 A;  2RJE A;  4QQD A;  2E70 A;  2E6Z A;  3DLL A;  3VU3 C;  1Q7Y C;  4M7A F;  1DJ7 B;  2QQS A;  4BUG A;  3CC4 A;  1M4Z A;  2KAF A;  2DD5 A;  4XQ3 A;  5GAN 2;  4N4H A;  2DTI A;  4C92 E;  3A8H B;  4OB3 B;  3FRN A;  3M58 A;  4BI8 B;  2RJF A;  3ER0 A;  3CCS A;  4HCZ A;  2RHZ A;  4C92 C;  3X28 B;  4XU3 A;  3BY7 A;  3PIO A;  3JCM d;  1KD1 U;  4J6W A;  4A4K A;  4XU2 A;  3OS5 A;  1OI1 A;  3V7C A;  5GAN g;  5CKD A;  3CC7 T;  4PJO C;  4M77 E;  2LT4 A;  2XK0 A;  1BI2 A;  3QZ9 B;  3SDZ A;  2JZ2 A;  3CPW S;  2ZPB B;  4M75 D;  3CCL A;  1NPP A;  4L6V 5;  4M78 G;  1M5Q 1;  4A4F A;  2A7Y A;  5I2M A;  4QVZ A;  4IUP A;  4XTX A;  1QVF S;  3S6W A;  2LC4 A;  3E19 A;  3LH0 A;  4XK8 E;  2WAC A;  4X34 A;  2PQW A;  1XTD A;  2ZZD A;  5CKF A;  3OYM A;  1Q82 U;  1VQ9 A;  2HAX A;  3CCR A;  5GAN d;  2EAY A;  4XU1 A;  4BI3 A;  4XTW A;  3RMQ A;  5DLO A;  3JB9 H;  1W2B A;  3L2R A;  2WSE E;  2FHD A;  4OB1 B;  3JCM g;  2QQB A;  2PUK B;  1SSF A;  3CMA T;  4RCB A;  2E1H A;  4B9W A;  2RK1 A;  4M7D B;  4JLG A;  2K4Y A;  4NOY A;  5CQY A;  4M7A A;  1BKB A;  5LJ5 g;  3LLR A;  5C6S A;  1VQO A;  2PUO B;  3OYK A;  2MMP A;  5J39 A;  2XG8 D;  2B8A A;  1IZ6 A;  1LNX A;  4ZTF A;  5J26 A;  1YJ9 A;  5CKH A;  3T9N A;  3OS0 A;  5GMK i;  2RHX A;  2DVE A;  1UGS B;  2DK3 A;  3FDR A;  4C8Q C;  4KBM B;  5IT9 E;  5HK3 A;  3SD4 A;  2D9T A;  5A0D A;  5GAN 5;  2X4J A;  3NTI A;  4JRP A;  1LJO A;  2D6F A;  2XDB A;  4HT9 A;  1K73 C;  1VQ8 A;  3VV0 A;  4OP0 A;  3JCM J;  1VQO T;  4MZT A;  2MF2 A;  3N5B B;  3ZFJ A;  1NE8 A;  1H3Z A;  3HPW A;  3BW1 A;  1U8R A;  3CC2 T;  4N0A A;  2ZPI B;  4RCC A;  4A4G A;  3CXC S;  4EDU A;  3MHX A;  2OTJ T;  4IUU A;  5A0L A;  4PJO D;  2Y90 A;  2DEQ A;  1O75 A;  5LJ3 d;  3JSC A;  4HT8 A;  3P8D A;  2DJZ A;  4RMO A;  2KMT A;  1M1G A;  3M56 A;  3ZBD A;  4QVC A;  4FSX A;  1W4S A;  3I55 T;  3RMS A;  5AYF A;  4FIB A;  2P0Q A;  3OYE A;  2JN0 A;  3HHT B;  3RKY A;  3WXM B;  2Y4X A;  3M53 A;  4JS5 A;  2F69 A;  4QVD A;  1HK9 A;  2K5F A;  3C4S A;  3GP8 A;  1ZHI A;  3HRS A;  3MP8 A;  5M9O A;  4PLL A;  2RHI A;  3F70 A;  3CEY A;  4KUI A;  4M77 C;  3WVD B;  4C8Q G;  2EIF A;  4PKC C;  2K2V A;  1VQ4 A;  1QVF A;  1YIJ T;  3A8L B;  5FU7 B;  3EFR A;  2HBP A;  4R56 A;  4A4H A;  3TRE A;  4E7L A;  3JCM P;  5C0M A;  1VQ5 T;  2JTF A;  1KQS A;  3LWI A;  2A3L A;  2EKO A;  4Q5W A;  4BE0 A;  4LDY A;  4RG2 A;  3J80 E;  5FRN A;  3GOX A;  4PJO B;  3GF5 A;  2O4X B;  1KQ1 A;  3DLM A;  4E7I A;  3OYA A;  5J3B A;  1M1K C;  2RJC A;  5FRO A;  1M90 U;  3MEU A;  3OYD A;  2QEX A;  3TCJ A;  4RKU E;  4P5N A;  3L42 A;  1U1S A;  5GAN 8;  3QG1 A;  4J5Y A;  3A5Z B;  4CI0 C;  2CGH A;  5GAO m;  1VQP A;  4PJO G;  3QKJ A;  1X01 A;  1TH7 A;  1FX7 A;  3OA6 A;  2RI2 A;  5KCO A;  2MWO A;  5GMK e;  2RJD A;  2FB7 A;  5LJ5 h;  4ATO A;  2DIQ A;  3M9Q A;  5CAI A;  3X25 B;  4C5E A;  3CCV T;  3HSB A;  2K3X A;  5LJ5 f;  4MDW A;  2QTX A;  1K8A U;  4M77 B;  1M1K U;  3C94 A;  1VQ8 T;  4GY5 A;  4M77 A;  4E47 A;  4M7D D;  3OB9 A;  3CCU A;  2DXU A;  2CZ7 B;  2K5L A;  3RIR A;  4M7A C;  3QDR B;  4M75 A;  1M1F A;  2OTL T;  1EIF A;  1JJ2 A;  1OZ3 A;  3L2U A;  3CXC A;  3VUB A;  2DO3 A;  1B34 B;  1I4K 1;  2LDM A;  1LOJ A;  4J83 A;  4M75 E;  5EG2 A;  3SWN A;  5GMK m;  3S3N A;  1VQ6 T;  3NTH A;  3HL8 A;  3JB9 F;  2BIV A;  4JUV A;  4IUT A;  3HP9 A;  3M5A A;  4JRK A;  2X4X A;  4F7U A;  5LJ3 g;  4JS4 A;  4PJO E;  4JRI A;  1XOV A;  1BYM A;  4C8Q D;  4PJO A;  2WSF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...