4MZMA

Mazf from s. aureus crystal form i, p212121, 2.1 a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
DPIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA interferase MazF
publication title Structural and biophysical characterization of Staphylococcus aureus SaMazF shows conservation of functional dynamics.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
total genus 36
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mzmA00
5CKBA 2KMTA 5HK0A 2MF2A 4MZMA 4HKEA 3JSCA 3JRZA 1X75C 2C06A 4MZTA 2VUBA 4ELZC 4ME7A 5HK3A 5DLOA 5HKCA 1VUBA 3G7ZA 3VUBA 4MZPA 4ELYC 5CR2A 4MDXA 5CCAA 1UB4A 3TCJA 5CKFA 4OF1A 4VUBA 5CKEA 1M1FA 5CKDA 3HPWA 1NE8A 5CKHA 3NFCA 5CQYA 5CQXA 5CO7A 5CK9A
chains in the Genus database with same CATH superfamily
4PJMA 1YBYA 3JCMh 3MP8A 2JS0A 4KULA 4ZN3A 1K8AC 4O5VA 2BZYA 1VQ5A 1I8FA 4HCCA 4M7AC 1SG5A 2MWOA 3RESA 1VQKQ 1CKBA 4LNPA 5KYWA 1YCYA 3MCAB 2FHDA 4M7DD 4E7KA 2FEIA 1KC8C 2A36A 1VIFA 2AZVA 1MV3A 1YITT 2DE0X 4ANJA 2JMCA 2OTLT 2DF6A 5FLXE 3EFRA 2JM8A 4MZTA 4PLIA 2JVVA 3UWNA 3UA7A 4KRTA 3DB4A 3CCUQ 4M4ZA 3EGDA 4IUPA 4AFZC 3C94A 3EFSA 2R57A 3ZEHA 1K4US 1NZ9A 3QSUA 1W4SA 2CP6A 3UF4A 4EPCA 4J6XA 4DQ2A 4AMCA 1C0MA 1K73U 1Q82R 2K4YA 1AWOA 1GCPA 4IIOA 2E6NA 2QAZA 3CCQA 4HCKA 3URGA 5IXBA 4CC3A 1EZZB 2RF0A 1PSEA 4QQGA 2CH4W 1YJNT 4CRIA 1D1AA 1VQ6Q 1YIJT 1R0CB 1IREB 2X51A 5KYYB 2JXBA 1YJ9T 1KD1C 1SRLA 1CKAA 4OGCA 5LJ3g 2P0QA 1UHCA 3I55Q 2OI3A 4RTXA 3SWNC 1VQLQ 4P5NA 2CSQA 4L5GA 2D1XA 1ZA2B 2F1LA 3CC4Q 2EGCA 4GLMA 3T9NA 2JJ9A 2E70A 1OPKA 2DBMA 2DK3A 1PNJA 1N8RR 3ER0A 3MKDA 2KE9A 1RLPC 5LJ5f 2KNBB 2RN8A 3FRNA 3HFNA 2FPDA 1UECA 1M2VB 2KYBA 1YHQQ 4FSSA 1M1KU 4X9CA 2K6DA 1VQPA 3OYAA 1R8OB 4GBQA 4XTZA 2KR3A 4A4KA 2KROA 3G4SQ 1OU9A 1UGQB 2QQ9A 2M1HA 3A8GB 1ZUUA 3CC7Q 5A0DA 3G6EA 1VQMT 2EYWA 3JCMV 3M0RA 5CQXA 3H0FA 2X9HA 2RMOA 4F04B 2MF2A 2LCSA 1VQKT 1Q86U 1UUEA 2BZ8A 3ZFJA 3WVDB 2V8JA 3OYGA 5I2MA 4XTXA 1D0XA 1I81A 2EQJA 2XG8D 3HRUA 2XIDA 2PQWA 3QHSA 3JB9J 3EFOA 1NJIC 3PGGA 2ROTA 5FWBA 1QKWA 4KT0E 1M4ZA 2L3PA 2PZ1A 5FRMA 2E6ZA 2MPXC 3CCUT 4DBFA 5GAN8 1WIEA 3M55A 4C92E 3CMAQ 4MDXA 2F2XA 2KI7A 1ZLMA 5AYFA 3VS7A 2WSCE 1NYGA 1VQ5Q 4JRQA 2CP3A 3SD4A 1MHNA 2RM4A 4OB0B 1UGRB 5GAMg 3UA6A 5I21A 3L1AA 3OYBA 2O88A 2J6KA 2ENMA 4BI4A 1QKXA 4FSXA 3VS3A 3VS4A 4N0AA 2RH2A 1VQ6T 1QCOA 1TOVA 3CXCP 1GBQA 1OI1A 1QP2A 4E7JA 2FYKA 1BYMA 2EJFA 3RKYA 4FYXB 4C92A 1Q81R 3AHUA 1VQLT 3LX7A 5I22A 1TUCA 2A08A 1O9SA 1ZX6A 1H641 4AG1C 5D6XA 1WXTA 4GY5A 3MO8A 1IO6A 1K8AR 4KUDK 2E10A 3NTKA 2KK4A 4C5GA 3QO3A 2DAQA 3Q1JA 1B3QA 5FU7B 3TCJA 3PFSA 2LRQA 3P8HA 1YHQT 3V8KA 3CCQQ 1KC8R 2DETA 4ESRA 3EHRA 2P4TA 4YTLA 5GANf 1YI2T 2QDYB 4IUQA 4M78B 3G4ST 1WHKA 3IQLA 3I5RA 5LJ5h 2VYTA 2A0FB 1MMGA 3ZL7C 3GOXA 4PLLA 2RQVA 3CCLT 1W70A 1QVGP 2YXYA 4ZNXA 2H8HA 5CO7A 4KGZB 4M78F 4WF2A 3CQTA 4BDYA 4RTYA 2EYQA 4C92G 1MUZA 2O31A 3EGUA 2EQUA 2ECZA 2ZAEA 3QWXX 1YFNA 2RJCA 1UFFA 3H9NA 2FB7A 2DPPB 2V26A 3PIPA 2LT4A 5KE2A 4A53A 1NBEB 1KD1R 1AZEA 1PRMC 2YHTA 4MDWA 1C1AA 2OAUA 1DJ7B 3MPUB 2QDLA 4M7DB 1N8RU 2HQEA 2DXCA 2EGEA 2ZPIB 2EYZA 4C0DC 3CMAT 3L42A 2DMOA 1E6HA 3I5SA 1RAGB 3O8VA 4M75C 3G6EQ 1M90C 1FYNA 2FRYA 1QVFA 1WGSA 3CC2A 2LX9A 1PRLC 1VQ5T 1JXMA 4BY6B 5KYXB 2IG0A 5D6YA 2ZPEB 2LC4A 3MEUA 4M7DF 4PJOE 2D6FA 2DM1A 2KVQG 3VU3C 2J6OA 2JNGA 4M77G 1WZOA 2R5AA 2F5TX 4ZN1A 3M58A 2NUZA 1OQKA 3EGXA 4M7AD 1W6XA 2AHJB 2X4YA 2E1HA 3TSZA 1VQNA 5GAMf 3TVTA 1XQHA 4PJOA 2FL7A 3QIIA 1YJWA 4OGEA 1JRIA 3MJXA 5D7UA 3VV0A 2NYSA 2DTOA 5FROA 1UGSB 2VKNA 2VGMA 3CCQT 5IT9E 4PJNA 5CKEA 5GMKi 2DXTA 1BI0A 1NJIR 1TH7A 1ZBXA 1YWOA 1T3LA 4M7AE 3MEWA 4N4GA 3M0UA 2HSPA 1VYVA 1KFZA 2MWPA 4AG2C 1IRXA 4J7FA 2QA4Q 4RG8A 5FW9A 2D8JA 1Q7YU 1M1FA 5LJ3h 1Y71A 3OW2P 5J3BA 4F17A 2F69A 3OYKA 3A8LB 4KH0B 3H41A 1FMKA 3JRZA 3L2UA 3M4GA 4PK4A 2K5IA 2JW4A 3MEAA 1FWZA 2CSIA 2K57A 1JJ2P 1SPKA 1X01A 2HKQB 4RTTA 3WXMB 4EMKC 3VRYA 4M77C 1WPYA 2RB6A 2QTXA 2HKNA 1VQPT 5IAYA 1NE8A 2QQSA 1K8AU 3GP8A 3ULRB 4PJOG 1VQ9A 3S3MA 1LCKA 3G6ET 4NL2A 2VVKA 3RERA 4F7UE 2FZCB 2MK5A 4XU2A 5HY6A 2I0NA 4JS4A 3JCMb 1XTDA 1KC8U 2O4XA 2JTFA 3EHQA 3RBBB 1BBZA 1YWPA 2JN0A 2KQWA 1ZUKA 5GAN2 3JCMQ 1B34A 2HL5C 4RTWA 3OW2S 2RK2A 5C0MA 2HBWA 1ZSZA 1JO8A 2XMFA 2EWNA 2MMPA 3DLLA 3JSCA 3I9QA 5CIUA 2EQMA 2DFUA 5GAN5 1G3TA 1JJ2S 1PD1A 4NOYA 4CI0C 1QW1A 4LD9K 5HCKA 1KHCA 2AIRB 4RG2A 3PT9A 2HDAA 5GJVB 3SWNA 3PNWC 3CMEA 4DBRA 2A28A 2EQIA 4CC2A 3OYHA 1JXOA 1LJOA 1RADB 3CPWA 4L6V5 3QUIA 4IIMA 4C0ZA 1WI7A 3NFCA 5GAMh 2B86A 3CEYA 4EMHA 3U23A 2GBQA 1LNXA 1PHTA 3JAME 1VUBA 4DOVA 4E7IA 4C5HA 2P0KA 2NUTA 4AFUC 2I2LA 2KEAA 3VYHB 1V1CA 1BI1A 1WXBA 5FU6B 1VQNQ 1OEBA 3LH0A 4LXCA 1IB8A 1BKBA 4XTVA 1SSFA 2MI6A 3FC3A 3E9GA 2MYSA 1YJWQ 4HVWA 2FG0A 5GMKm 4ELYC 2O01E 2ED1A 4C8QE 3BFMA 4V2SA 2ZPGB 4A63B 2RJFA 2X35A 2CDTA 1RI0A 1I5OB 2HL3A 2NUPB 4QKUA 4OB2B 1ZHIA 3GIBA 2A7YA 2DXBA 2E5QA 3HP9A 2WSEE 3LWHA 2LJ1A 1NJIU 3O5ZA 3GF5A 4VUBA 4C8QA 1RAAB 2K2MA 4BACA 2DIGA 3KFVA 5CK9A 3QXEB 1B07A 3X28B 3UATA 1SF9A 1MMAA 1QP3A 3VRZA 2BIVA 2RHZA 1K9MC 2K3BA 4OMPA 4KGVB 4C0FA 4XU3A 2X3XD 3ASKA 4ATOA 2VASA 3QKJA 1SEMA 4R56A 1TS9A 2G6FX 2DYIA 5GAOn 1RAEB 3BE3A 2J7IA 5KYUB 3OS1A 5EG2A 1OZ2A 2ABLA 2L0AA 1ZSZC 3RUXA 3DB3A 3M4YA 5L8RE 4A4HA 3CC2T 3UDCA 4M7AB 3X26B 4E7HA 1G5VA 2DL5A 1PKTA 3AT1B 1FMWA 2PVOB 3RDVA 1KG1A 4RTUA 3E9FA 4LDVA 3DKMA 1GFDA 3I56A 2YRVA 3E2UA 5GANg 4M7AF 4OP0A 2DRKA 2RI2A 3BDLA 4HKEA 2DZ9A 2QEXA 4Y91A 4JLIA 2CZ0B 2YUOA 3GNFB 2GFUA 1HYOA 2V8IA 1X6GA 3VS1A 4C8QG 4OMNA 1VQNT 3OYCA 2HEQA 4Z8AA 3MHXA 2CP0A 5C6SA 3CMEQ 2YLBA 1YJWT 3EG1A 2D8HA 1AT1B 1W2BA 2F2WA 4M75E 3A8MB 1LOJA 2LDMA 1YI2Q 2ZCFB 3MP1A 5KCOA 2K7AA 4B6MA 4F7UB 1G2BA 2PVGB 2DLPA 4ORZA 3C12A 1E6GA 3CPFA 2R58A 4J8OA 1ABQA 1NPPA 1FX7A 3CCLQ 2GQVA 4M78G 3NTHA 2RHUA 4LN2A 3J7AF 2HCKA 9ATCB 2CT3A 3PMTA 3OS5A 1KHIA 4HXJA 4C92D 2LNHB 2HD0A 4J5YA 4F7UF 1I0CA 4M75A 2ZZDA 4J9FA 2EJGA 1SSHA 2PVDB 2Y4XA 2C0OA 2GNCA 5LJ3e 2LZ6B 4CC7A 1AEYA 5LL6S 2RA2A 1BIAA 1Y96A 2LJ3A 2V8KA 2EKHA 2LCCA 5IHKA 2VXEA 1I07A 1AOJA 2GF7A 3GBQA 2E5KA 2XDDA 2DKGA 3JCMd 4IKFA 4D6WA 2YT6A 1VQ9T 3JCMJ 4C8QC 3CBMA 5A2QE 3H8ZA 1U1SA 3M0TA 1Q95G 5KYNA 3JCMP 2EBPA 3FIFA 3OSVA 4BDZA 1RACB 1ZSGA 4M77D 3OA6A 1OYXA 3KXTA 2RPNA 4FYVB 4D8KA 1TUGB 2P84A 4II1A 3TQ7P 4DBQA 5LJ5j 4J9CA 4N4IA 3TU4K 3OYLA 2QQRA 2YLCA 1PG5B 3UPUA 3CCVA 1G3WA 1K73C 4M75G 4M78C 1IZ6A 4PNOA 1WFWA 2HBPA 4M77E 5KYWB 1QVFP 3F70A 3A98A 2C0TA 3CCMA 2L3SA 3CMET 3CBOA 4Y28E 3OMGA 1BK2A 1BI2A 3PVQA 2M16A 1GCQC 2Y90A 1MNDA 2GGRA 2JM9A 1K9MR 4ZTJA 3CXCS 3EGDB 3I56Q 1Q82U 1WDXA 4EMKA 1U8RA 4M77A 2ZGWA 5M9OA 4R55A 2MOXA 4IUTA 2QEXQ 1D0ZA 3EG0A 4AFSC 5CKBA 2LX7A 1V76A 2DJZA 1JB0E 1QQJA 1VQ7A 1K9AA 2W0ZA 3PIOA 1M1KC 3OYYA 1VYUA 4E7SA 1QVFS 4PKCC 4PL6A 4KBMB 2DX1A 1JU5C 1D1CA 4PJOD 5GJWB 4F16A 4R0KA 3EG9A 3THKA 3TEEA 1VQPQ 3NTIA 4LDWA 3L2WA 3SFMA 2COWA 2OJ2A 3SDZA 3QPHA 4RMOA 1Q86C 1BIBA 2E41A 2K5FA 1PKSA 3RKWA 2QGFB 2K79A 1AD5A 2EKOA 1QVGS 2YUQA 2WSFE 1UJ0A 2RHYA 4E47A 1BCMA 2DZCA 3JCMe 3VUZA 2PTKA 3H6ZA 3V8JA 3VS0A 1X27A 5L23A 1NG2A 4J6WA 1X69A 3JB9G 1U1TA 4X34A 4AFQC 3EG2A 2HMAA 1VA7A 3SEMA 5IH2A 4QQDA 4BB7A 4E6RA 1ZQ1A 5LJ3j 4XTYA 1RL2A 3GNGA 1PCXA 2KGTA 4RTVA 3V7RA 1C6VX 1U3OA 5A0GA 1EFNA 4FU6A 2LQ8A 2G3RA 1PD0A 3LGLA 1KIKA 2YUPA 4FYWB 4OMQA 2ESWA 4HT9A 1KK7A 4MZPA 4L59A 1M1GA 2CUDA 1M27C 3J80E 3M0QA 1H3HA 4J9HA 2KXCA 3JB9H 3EFOB 1Y57A 1WJQA 2M0YA 1KQSA 1LPLA 3HRTA 4Q5WA 3LLRA 2KBTA 2EQKA 1MV0B 1QVPA 2M0OA 4DEYA 4RCCA 4FCYA 3I56T 4ZGJB 4RCBA 1KSWA 2OTJA 1WHLA 2K3YA 3FB9A 1HK9A 2LP5A 1GL5A 2A3LA 3CCVQ 3X25B 2QEXT 1CSKA 3S3OA 2P0PA 5GANh 3OYMA 4KGXB 3VS2A 2GTOA 2M51A 3L2QA 4X1VA 2DTHA 4BI3A 1Q81U 1BB9A 1H92A 2CYZB 1JEGA 4LDXA 3CCMQ 5CR2A 3CPWP 4C92B 2QI2A 4J83A 4FT2A 4DOWA 1YP5A 3CCRA 1IGQA 2O9SA 1AWJA 2HQXA 2DEUA 5LJ5d 3WVEB 1ZBJA 1LVKA 1AHJB 5GAOl 2AK5A 1WX6A 1UEBA 1K73R 4FL6A 2B8AA 3JB9I 2LQNA 4C92F 4LD6A 5CVIA 2CP5A 3VS5A 1W1FA 1VQ4A 1MNEA 4UC4A 5KYYA 5D6WA 1VQ7Q 5GAMj 4PFOA 3KBGA 2CT4A 1X75C 4A54A 5KE3A 4LUDA 3G1JA 3QYGB 3VKIA 2VUBA 3FDRA 2ZPHB 4RUGA 3HFOA 4M77B 1S72A 2E65A 2HSEB 3PMIA 1TXQA 1AZGB 5FWCA 2D9TA 1M2VA 3INZA 2DILA 5ECAA 3QJ6A 1EIFA 3I55A 3VS6A 1AWWA 2EJ9A 3CC2Q 4QT7A 3CC4A 1N5ZA 1M1KR 1KD1U 2EYYA 1K0SA 5FU6C 1I1JA 1NLPC 1QCFA 1KJWA 2JT4A 4OMFB 1NLOC 1JQQA 4BE1A 3NMZC 4C8QD 1RAFB 1JJ2A 3A8HB 2YRDA 2DD4A 1D1BA 3NGPA 3CCVT 1Q86R 2M02A 3QZ5B 3OSSC 1M90R 2RNAA 5GMKh 4XU1A 4OMOA 3FLGA 3CC7A 1AVZC 4OMMA 2QK0A 3OMCA 4MZMA 4B9WA 1PSFA 3CCMT 2JS2A 2YRCA 3OY9A 2X3WD 4E7LA 4RTZA 5GAOq 4BE2A 4LDYA 1YCSB 3EGXB 3LW5E 3JCMc 1G3SA 1WHHA 2JOYA 1VOMA 2BKDN 5IXFA 1Q7YC 2CZ6B 2EGAA 1N9SA 1NEGA 1ZA1B 1O75A 2DL4A 4JJBA 4PJOB 2OTJQ 3OYIA 2J6FA 4KUIA 2K5LA 4ME7A 3EH1A 2HZYA 1M30A 2YDLA 5LJ3d 2MIOA 2KSSA 5LJ5e 3KUFA 2CZ7B 3V7SA 3QYHB 2XD0A 4A4EA 1NYFA 2RI3A 2DL7A 2BE7D 2RJEA 1VQ7T 3G71A 1M3AA 5IHIA 1TWBA 1MMNA 3REBB 4M78E 3J81E 2H3JA 1X2QA 3HKSA 4PJOF 5J39A 2C06A 1W2BP 3L2VA 2SEMA 2AKLA 2RQWA 2DD5A 4NL3A 5HKCA 1ZUYA 1X6OA 3CCRQ 2HQHA 4EDUA 2X4JA 2E12A 1XJWB 1GFCA 3NHNA 1VQ9Q 3CD6A 2RHIA 4FW2A 2O9VA 2IIMA 1H3ZA 1FMVA 2K9GA 4J9IA 4M78A 2OX7A 2AZSA 1M5Q1 1VQ4Q 1MMDA 3HL8A 5DLOA 4HVUA 2RQRA 2DIQA 2DEQA 2LQKA 4XU0A 2M9UA 2L2PA 4E2FB 4LE9A 4OF1A 3C0CA 1M2OA 1M3BA 2FPEA 4JJDA 4XTWA 5IHNA 4M7DE 4Z88A 1WHMA 3CCJA 1T0JA 4M75D 2VXFA 4K11A 1W2BS 3CCEA 3R6NA 2J06A 2QG9B 3M57A 2L3QA 1SHGA 5CAIA 1ABOA 1OX9A 1GCQA 1S72Q 3NPFA 2O4XB 2WACA 3TSWA 4JRKA 1B34B 3A8OB 2LT1A 2YSQA 1I4K1 4E7ZA 1A0NB 1ZSZB 1Z9QA 4J6YA 4ZGEB 4HVVA 4FM4B 3QG1A 3OYJA 2PU9B 1UJYA 4M7DA 3QBYA 1Y7XA 3S6WA 2E3HA 2GFAA 4A4GA 2KRNA 4ELZC 4Z89A 1TUDA 2AKKA 2XKOC 3EG3A 2V1QA 5GAMd 1UGVA 2GTJA 3MEVA 2L8DA 4Y92A 4PFPA 1WQWA 3M56A 1SHFA 5KYXA 3JV3A 1RABB 1QLYA 4JZ4A 1OU8A 4KH1B 2RHXA 2E64A 1NEBA 2DERA 1GRIA 5IN1A 2MCNA 3SWNB 2OTJT 1RUWA 3A5ZB 3C4SA 4QW2A 2KT1A 4XTUA 1WJSA 2O2OA 1WXUA 3OB9A 2ATCB 1QMCA 1JBMA 1VQ8A 1KQ2A 3OYEA 5GANe 2VV5A 2DYBA 1M90U 4IUUA 4QVDA 2LTOA 4QVZA 1ARKA 1Y07A 2X4WA 3CCRT 2NUTB 4OB1B 3META 4JZ3A 1WQ7A 1B7TA 2A37A 1D3BA 4M7DG 4PFZA 4RKUE 5DLQE 4PJLA 2CREA 2DVJA 2BUDA 1VQ4T 4WCIA 1D09B 3REAB 3L2ZA 2LQWA 3JB9D 3G71Q 1S1NA 1X2KA 3CCSA 4QVCA 5FU7C 4BE0A 5DM7R 1WJRA 1HD3A 4HCBA 1SRMA 1K0XA 3OS0A 1QWFA 5I2SA 2KMTA 2DVEA 4OVAA 2FPFA 4D8DA 2R5MA 1Q7YR 1G8XA 1TTHB 1YNZA 1S72T 3LWIA 3MP6A 3E1SA 3JCMX 4JUVA 1WLPB 2BZXA 4ZGDB 2GQIA 3CD6Q 4HA8A 1I5LA 3S3NA 3I55T 2COYA 1UTIA 4BD3A 4C8QB 2QA4A 2PUKB 2VC8A 1YN8A 3CC4T 3X20B 1H8KA 2EPDA 5I11A 3CBPA 1WA7A 1VQOA 1V29B 4O6JA 1X43A 2XU8A 2FO0A 4XK8E 4DEXA 2GCXA 2EVRA 2JMAA 3RR6A 4GLKA 3H0HA 4C8QF 3CCJQ 1RAIB 3M9QA 1GBRA 2BTTA 2KAFA 4QQ6A 1PM3A 3CCEQ 5LJ3f 4JPBW 2DJQA 5DY9A 1OZ3A 5GAMe 1HSQA 2VWFA 3JCMg 3RNJA 4M7DC 4Z02A 2Z0WA 3RIRA 4FW1A 2L3RA 2JTMA 3OYDA 4MMLA 3EH2A 3CC7T 3P8BB 2HNIA 1UDLA 2QYZA 1ACMB 1PC0A 1SKUB 4BY6C 3EAEA 5GMKe 3GLXA 1G3YA 1KQSP 3LGFA 3A1PA 5GAOr 2CZ1B 4PJJA 4ZTFA 2CS7A 2JZ2A 2YUNA 2IVWA 1UE9A 5FRNA 4DBHA 1R77A 3OYNA 1YITA 2BE9B 3CXCA 5AT1B 3VJPA 2OTLA 4J9DA 3QZ9B 3LYIA 1FXXA 1XOVA 4A4FA 2KXDA 1OV3A 2CP7A 2NLUA 1N6AA 3C95A 1WHGA 5GAN7 2ZPFB 3FJPA 3QJYA 1E7OA 2F2VA 2NWMA 5EC7A 1WNLA 3SHWA 3QDFA 2V1RA 5KCHA 5HK3A 3G71T 3HHTB 4JRIA 4CC4B 1VQ8Q 1UGPB 4C0GA 2HAXA 2CKKA 3E19A 3V8LA 1KQSS 2KYMA 2ROLA 2PUOB 4NS5A 2L5QA 2VB6A 1YJNA 5GANj 4IURA 1YIJA 1WHJA 2DRMA 2XICA 2IPOB 1YJ9A 2AT1B 4JDSA 3BDUA 4C0DB 3D7SB 1VIEA 3QDRB 1Y0MA 4M75B 2JTEA 3PTAA 3CD6T 4C5EA 4IUVA 2K3XA 1TU0B 2DNUA 1QVGA 2COZA 3R6OA 2CP2A 1Y96B 3X24B 2NUPA 2D0NA 2DO3A 4JJNK 3SB2A 2Y4YA 1RAHB 3HRSA 3JCMW 1D0YA 4WTOB 3CCSQ 1M9SA 1RI9A 4M75F 1KQ1A 4N0AC 3G7ZA 1GXIE 3CCJT 3ZBDA 2QQBA 1AWXA 4OB3B 3OYFA 4C92C 1PWTA 3CCET 2PNIA 2RJDA 5CKFA 2D0QB 1D3BB 5CKDA 1IHWA 2DL8A 1OX8A 2KY9A 2FZKB 2P4RA 2QQAA 3RMQA 4HCZA 3OBWA 5GAOp 2XI9A 1U06A 2EAYA 1VYTA 2EFIA 1VQMA 1Z9ZA 2DA9A 7AT1B 4JS5A 1UB4A 1VQKA 3M53A 4JRPA 5KYUA 1Q82C 3DLMA 2XDPA 1J3TA 1VQOQ 2J05A 3OBYA 5GAN3 2VGNA 5GAN6 1IXDA 4J9GA 4JLGA 2ZPBB 3JCMf 2KRMA 4M7AA 2FZGB 2EW3A 2RO0A 2RQTA 3VUBA 3ME9A 1G83A 1HXDA 2FVUA 5A0LA 3M54A 2XK0A 1UG1A 3H0IA 2OAWA 3CCUA 1RLQC 1T3SA 3M0PA 5CKHA 2EYXA 2RQUA 1TG0A 1M8VA 2F5KA 5GMKl 4N4HA 2ED0A 2MAMA 1K9MU 3PE0A 5HK0A 3RKXA 2YWWA 3I35A 4BI8B 4EIKA 3OS2A 4HT8A 1VQ8T 1N8RC 2L89A 4F14A 2QXFA 3FJ5A 1OULA 3CPWS 4LDUA 1HJDA 4EMKB 2W10A 2DBKA 2EIFA 5GMKj 1IHVA 2RK1A 1VQ6A 5CQYA 1M3CA 2E3IA 3BY7A 1WYXA 1N9RA 1YITQ 2KDSA 2OTLQ 1NM7A 1VQLA 2QGGA 4X9DA 4F7UA 3HSBA 2KRSA 4M77F 2RI5A 3L2RA 2CUBA 3BW1A 1BI3A 1XNIA 3JB9F 2C0IA 5J26A 2FRWA 4MMKA 3OW2A 3RMSA 4EMGA 2DXUA 4J9EA 2XHCA 1R0BG 3EG9B 3P8DA 4M7AG 4DA4A 1OPLA 3CCST 2LVMA 2SRCA 4BUGA 4LUEA 3M59A 2KT8A 1BU1A 1QCNA 1YHQA 2X4XA 3PVLA 1MGQA 4J7IA 5LJ5g 1X6BA 1YI2A 2QASA 1M8MA 1YJNQ 4B9XA 3G4SA 1YIJQ 5GAN4 2JUFA 4JJCA 2XDBA 1YJ9Q 1UHFA 1T0HA 6AT1B 2RD1A 1IGUA 3CCLA 3QWYA 2E4HA 1K1ZA 8AT1B 4XQ3A 1TSFA 4PJOC 2QA4T 8ATCB 2DTIA 2CGHA 3FEOA 3GPLA 3M0SA 5KH6A 5GAOm 4TVRA 3M5AA 4FT4A 3LH5A 3V7CA 1N27A 1U5SA 4M78D 1VQOT 3HPWA 3UT1A 2LJ0A 5CCAA 4OMLA 4FIBA 4AT1B 1BCOA 2K2VA 4C5IA 2LCLA 1NPRA 4F7UG 2QTVA 1F1BB 2CH4A 3N5BB 1QWEA 2DL3A 1P92A 1EX4A 2LMJA 1Q81C 2LNVA 2H3EB 4XAXB 5GANd 1K76A 1OOTA 3OQ5A 3TREA 3HTRA 3CMAA 4FYYB 3VYGA 1VQMQ 4J9BA
chains in the Genus database with same CATH topology
1YBYA 4PJOG 3JCMh 5GANe 3MP8A 3NTIA 4KULA 4LDWA 2VV5A 4ZN3A 1K8AC 4O5VA 3L2WA 3SFMA 1I8FA 1M90U 1VQ5A 1VQ9A 4HCCA 3S3MA 4IUUA 3G6ET 4M7AC 2MWOA 4QVDA 4NL2A 3RERA 3RESA 2LTOA 4QVZA 4F7UE 1Y07A 2X4WA 4XU2A 5HY6A 3SDZA 3QPHA 4RMOA 3JCMb 3CCRT 4JS4A 1BIBA 1Q86C 1XTDA 2E41A 2K5FA 2JTFA 2O4XA 1KC8U 4OB1B 3RKWA 2JN0A 2KQWA 3META 5GAN2 1YCYA 3MCAB 3JCMQ 2FHDA 1B34A 4M7DD 4E7KA 2EKOA 3OW2S 1WQ7A 2RK2A 1QVGS 1KC8C 1VIFA 2WSFE 1D3BA 5C0MA 4M7DG 2RHYA 4RKUE 1YITT 5DLQE 4E47A 2OTLT 5FLXE 2EWNA 2DZCA 2MMPA 3JCMe 3EFRA 3DLLA 3JSCA 2BUDA 5CIUA 1VQ4T 4MZTA 3VUZA 2EQMA 4PLIA 2JVVA 3UWNA 3H6ZA 5GAN5 1G3TA 1JJ2S 3V8JA 3DB4A 3L2ZA 3JB9D 4NOYA 3CCSA 4J6WA 4CI0C 4IUPA 1QW1A 3JB9G 1U1TA 4X34A 4QVCA 4LD9K 5FU7C 1KHCA 3C94A 5DM7R 1WJRA 3EFSA 4BE0A 4QQDA 2R57A 3ZEHA 1ZQ1A 4BB7A 4HCBA 1NZ9A 5LJ3j 3QSUA 1W4SA 4XTYA 1RL2A 3GNGA 4RG2A 4EPCA 4J6XA 3V7RA 4DQ2A 3PT9A 5A0GA 3OS0A 5I2SA 1K73U 2K4YA 2KMTA 4FU6A 2DVEA 4OVAA 3SWNA 2LQ8A 2E6NA 2R5MA 2G3RA 3PNWC 3LGLA 3CCQA 1S72T 3URGA 3CMEA 3LWIA 3MP6A 3E1SA 3JCMX 4JUVA 4HT9A 4MZPA 1PSEA 1M1GA 4L59A 3OYHA 4QQGA 1YJNT 3J80E 4CRIA 1LJOA 4ZGDB 3CPWA 1YIJT 4L6V5 4HA8A 1I5LA 3QUIA 3S3NA 3I55T 1IREB 4BD3A 4C8QB 1YJ9T 1KD1C 3JB9H 2QA4A 2PUKB 1WJQA 2VC8A 4OGCA 4C0ZA 5LJ3g 1KQSA 2P0QA 3NFCA 5GAMh 3CC4T 3HRTA 4Q5WA 3LLRA 3X20B 3CEYA 4EMHA 3SWNC 4P5NA 4L5GA 2EQKA 3CBPA 1QVPA 1LNXA 1VQOA 2M0OA 1V29B 4RCCA 3JAME 4O6JA 3T9NA 4XK8E 2XU8A 2E70A 3I56T 1VUBA 4ZGJB 2GCXA 4DOVA 4E7IA 4RCBA 4C5HA 2P0KA 2DK3A 3ER0A 2OTJA 4GLKA 5LJ5f 2I2LA 2K3YA 4C8QF 3FB9A 1HK9A 3FRNA 3M9QA 3VYHB 2A3LA 1BI1A 3X25B 2QEXT 5FU6B 2KAFA 3HFNA 4QQ6A 3LH0A 2P0PA 3S3OA 5LJ3f 5DY9A 1BKBA 4XTVA 5GANh 1SSFA 2MI6A 3OYMA 1OZ3A 3L2QA 3E9GA 5GAMe 3FC3A 3JCMg 1M1KU 4M7DC 4X9CA 4Z02A 2DTHA 4BI3A 3RIRA 1VQPA 3OYAA 1Q81U 1R8OB 2L3RA 2CYZB 2JTMA 3OYDA 4XTZA 4MMLA 4A4KA 5GMKm 4LDXA 4ELYC 2O01E 1UGQB 3CC7T 5CR2A 3P8BB 2HNIA 2QQ9A 4C8QE 2M1HA 3BFMA 2QI2A 4C92B 3A8GB 4J83A 4V2SA 5A0DA 2ZPGB 3G6EA 4FT2A 4BY6C 5GMKe 3EAEA 4DOWA 2RJFA 3GLXA 2X35A 1VQMT 3CCRA 1RI0A 1G3YA 3JCMV 5CQXA 3LGFA 2HQXA 5GAOr 2CZ1B 5LJ5d 4ZTFA 3WVEB 2MF2A 2CS7A 2JZ2A 4OB2B 1AHJB 1ZHIA 5GAOl 1Q86U 1VQKT 2IVWA 3GIBA 2A7YA 1UEBA 2DXBA 2E5QA 3HP9A 2V8JA 4FL6A 3WVDB 2B8AA 3ZFJA 3JB9I 3OYGA 5FRNA 2WSEE 5I2MA 3OYNA 3LWHA 1YITA 4XTXA 3CXCA 1I81A 1NJIU 4C92F 3VJPA 2OTLA 4LD6A 5CVIA 3QZ9B 2EQJA 3LYIA 2XG8D 1VQ4A 1FXXA 1XOVA 2PQWA 2XIDA 3GF5A 3HRUA 3QHSA 4VUBA 4A4FA 4UC4A 4C8QA 5D6WA 3JB9J 1NJIC 3PGGA 4BACA 2DIGA 2NLUA 1M4ZA 4KT0E 1N6AA 3C95A 5CK9A 5GAMj 3QXEB 5FRMA 2E6ZA 3KBGA 5GAN7 3X28B 2ZPFB 3FJPA 3QJYA 1X75C 1QP3A 4A54A 5KE3A 2BIVA 2RHZA 3QYGB 1K9MC 3CCUT 3VKIA 1WNLA 2VUBA 3FDRA 5HK3A 5KCHA 5GAN8 3G71T 4C0FA 3M55A 2ZPHB 4C92E 4XU3A 3ASKA 3HHTB 4JRIA 4ATOA 4MDXA 1UGPB 4C0GA 4R56A 3HFOA 3QKJA 2HAXA 4M77B 5AYFA 1S72A 5GAOn 2E65A 2CKKA 2WSCE 3OS1A 3E19A 3PMIA 1OZ2A 5EG2A 4NS5A 3V8LA 2PUOB 3SD4A 4JRQA 1KQSS 2RM4A 1MHNA 4OB0B 2L5QA 2D9TA 1UGRB 3DB3A 3RUXA 3INZA 5GAMg 1YJNA 5GANj 4IURA 5I21A 3M4YA 5L8RE 3L1AA 3OYBA 1YIJA 4A4HA 3QJ6A 3CC2T 1EIFA 2XICA 3UDCA 4M7AB 3X26B 3I55A 4E7HA 1YJ9A 1G5VA 4BI4A 4JDSA 2EJ9A 3BDUA 4FSXA 4C0DB 1VIEA 3QDRB 4N0AA 4M75B 2RH2A 3CC4A 1VQ6T 2PVOB 3OYEA 3PTAA 3CD6T 3E9FA 4C5EA 1KD1U 1KG1A 4LDVA 1OI1A 1QP2A 4E7JA 2FYKA 1BYMA 4IUVA 2EJFA 2K3XA 3RKYA 4C92A 3DKMA 5FU6C 1QVGA 3R6OA 3I56A 3AHUA 1VQLT 1Y96B 3LX7A 3X24B 2DO3A 2YRVA 4JJNK 3SB2A 1O9SA 2Y4YA 5GANg 3HRSA 1H641 4M7AF 5D6XA 4OP0A 2RI2A 3JCMW 3BDLA 4HKEA 4GY5A 4OMFB 2DZ9A 2QEXA 4Y91A 4JLIA 2CZ0B 3MO8A 1M9SA 4BE1A 4M75F 4KUDK 3GNFB 4C8QD 2GFUA 1KQ1A 2E10A 2V8IA 4N0AC 3A8HB 3G7ZA 1JJ2A 1GXIE 3NTKA 2KK4A 2DD4A 4C5GA 3CCJT 4C8QG 3QO3A 3ZBDA 2DAQA 2QQBA 3Q1JA 4OB3B 3CCVT 3QZ5B 3OSSC 4C92C 3OYCA 5FU7B 3TCJA 3OYFA 2RJDA 5CKFA 3CCET 5GMKh 2D0QB 3PFSA 2LRQA 1D3BB 5CKDA 3MHXA 4XU1A 3P8HA 2KY9A 3FLGA 2QQAA 3V8KA 1YHQT 3RMQA 5C6SA 3CC7A 2YLBA 1YJWT 4HCZA 2P4TA 4YTLA 5GANf 1YI2T 3OMCA 4MZMA 3OBWA 4B9WA 2QDYB 2XI9A 2EAYA 5GAOp 1W2BA 4IUQA 2EFIA 4M75E 3A8MB 4M78B 1PSFA 3CCMT 1VQMA 3G4ST 1LOJA 2LDMA 2ZCFB 3MP1A 3OY9A 4E7LA 5KCOA 5LJ5h 2VYTA 4F7UB 2PVGB 3GOXA 4JS5A 5GAOq 4BE2A 4PLLA 1UB4A 4LDYA 3CCLT 1VQKA 3LW5E 3C12A 3M53A 4JRPA 3JCMc 3CPFA 1G3SA 2R58A 4J8OA 1NPPA 3DLMA 1FX7A 1Q82C 2XDPA 2GQVA 4M78G 2JOYA 3NTHA 2BKDN 2RHUA 3OBYA 5CO7A 5GAN3 2VGNA 5GAN6 1Q7YC 3J7AF 2CZ6B 4M78F 4WF2A 1N9SA 3PMTA 4JLGA 3OS5A 1KHIA 1O75A 2ZPBB 3JCMf 4C92D 4M7AA 4PJOB 4BDYA 3OYIA 4KUIA 2HD0A 2K5LA 4J5YA 4ME7A 2EYQA 4F7UF 4C92G 2RO0A 3VUBA 5LJ3d 3ME9A 4M75A 2ZZDA 1HXDA 2KSSA 2FVUA 5A0LA 2EQUA 2EJGA 5LJ5e 3KUFA 3M54A 2RJCA 2XK0A 2CZ7B 3V7SA 2FB7A 3QYHB 2XD0A 2DPPB 4A4EA 3PIPA 2PVDB 2Y4XA 2RI3A 2RJEA 3CCUA 2LT4A 5KE2A 1VQ7T 3G71A 4A53A 5CKHA 5LJ3e 5LL6S 2RA2A 1BIAA 1Y96A 2YHTA 2F5KA 1M8VA 4M78E 4MDWA 2V8KA 2OAUA 2MAMA 1DJ7B 2H3JA 4N4HA 5GMKl 3J81E 1K9MU 5HK0A 2LCCA 3HKSA 1N8RU 3RKXA 4PJOF 4M7DB 5J39A 2HQEA 2DXCA 2VXEA 4BI8B 2C06A 3L2VA 2ZPIB 2DD5A 3OS2A 4C0DC 4NL3A 3L42A 3CMAT 4HT8A 1VQ8T 5HKCA 1N8RC 2L89A 3O8VA 1M90C 2GF7A 4M75C 2QXFA 1X6OA 3CPWS 1WGSA 1QVFA 3CC2A 2XDDA 2LX9A 4EDUA 2DKGA 4LDUA 3JCMd 4EMKB 4IKFA 2X4JA 1VQ5T 2E12A 4BY6B 4D6WA 1VQ9T 2EIFA 2IG0A 5GMKj 3JCMJ 5D6YA 4C8QC 2ZPEB 3CBMA 5A2QE 3H8ZA 2LC4A 2RK1A 3MEUA 1VQNT 1VQ6A 5CQYA 3CD6A 4M7DF 1U1SA 3JCMP 2RHIA 4PJOE 3BY7A 1H3ZA 1N9RA 3FIFA 3OSVA 2D6FA 2KDSA 4BDZA 3OA6A 4M77D 4M78A 2KVQG 1M5Q1 1OYXA 3KXTA 3VU3C 5DLOA 3HL8A 2JNGA 1VQLA 4M77G 2DIQA 2DEQA 2LQKA 4X9DA 4XU0A 2R5AA 4II1A 5LJ5j 2F5TX 4ZN1A 2M9UA 4F7UA 3HSBA 3M58A 4N4IA 4M77F 2RI5A 3L2RA 3TU4K 3BW1A 4OF1A 3OYLA 1BI3A 1XNIA 2QQRA 2YLCA 4XTWA 5J26A 3JB9F 4MMKA 3OW2A 4M7AD 3RMSA 2AHJB 4EMGA 2DXUA 4M7DE 3CCJA 2XHCA 3P8DA 3UPUA 4M7AG 2X4YA 4M75D 2E1HA 3CCVA 4DA4A 2VXFA 1VQNA 3CCST 1W2BS 5GAMf 3CCEA 1G3WA 1K73C 2LVMA 3M57A 4M75G 4M78C 1IZ6A 4BUGA 3M59A 1XQHA 4PJOA 4PNOA 5CAIA 1YHQA 2FL7A 2X4XA 1MGQA 3QIIA 4J7IA 1YJWA 2HBPA 2O4XB 4M77E 4OGEA 5LJ5g 1JRIA 1YI2A 3VV0A 2WACA 2DTOA 3F70A 1B34B 4JRKA 3A8OB 2LT1A 5FROA 1UGSB 4B9XA 3CCMA 2VGMA 3CCQT 3G4SA 5IT9E 5CKEA 5GMKi 5GAN4 2JUFA 3CMET 1I4K1 4J6YA 4ZGEB 2XDBA 2DXTA 1BI0A 4FM4B 1TH7A 1ZBXA 3QG1A 3OYJA 2RD1A 4M7AE 2PU9B 3CBOA 4Y28E 3OMGA 3CCLA 3MEWA 4M7DA 3QBYA 4N4GA 1Y7XA 3S6WA 4XQ3A 1BI2A 4PJOC 2M16A 2GFAA 4A4GA 4ELZC 2QA4T 2Y90A 2MWPA 2DTIA 2CGHA 2XKOC 3FEOA 3CXCS 3GPLA 4ZTJA 4J7FA 5KH6A 5GAOm 4TVRA 5GAMd 4RG8A 3M5AA 1Q82U 3MEVA 2L8DA 4FT4A 4EMKA 1U8RA 1WQWA 3M56A 4M77A 3V7CA 2ZGWA 5M9OA 1Q7YU 1M1FA 1N27A 4M78D 4R55A 1VQOT 5LJ3h 3HPWA 3UT1A 1Y71A 4IUTA 5J3BA 2RHXA 2E64A 5CCAA 2F69A 5CKBA 3OYKA 3A8LB 5IN1A 3SWNB 2DJZA 4FIBA 2K2VA 4C5IA 2OTJT 3A5ZB 1JB0E 2LCLA 3C4SA 3JRZA 3L2UA 3M4GA 4QW2A 1NPRA 1VQ7A 4F7UG 2K5IA 3N5BB 4XTUA 3PIOA 1WJSA 1M1KC 3OYYA 1P92A 3MEAA 1FWZA 2K57A 1QVFS 1Q81C 4PKCC 2LNVA 1X01A 4PL6A 4KBMB 5GANd 3OB9A 4XAXB 3WXMB 4EMKC 4M77C 1WPYA 2RB6A 2QTXA 3OQ5A 1JBMA 3TREA 1VQPT 5IAYA 3CMAA 1NE8A 2QQSA 1K8AU 1VQ8A 4PJOD 1KQ2A 3VYGA 3GP8A 3TEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKB A;  2KMT A;  5HK0 A;  2MF2 A;  4MZM A;  4HKE A;  3JSC A;  3JRZ A;  1X75 C;  2C06 A;  4MZT A;  2VUB A;  4ELZ C;  4ME7 A;  5HK3 A;  5DLO A;  5HKC A;  1VUB A;  3G7Z A;  3VUB A;  4MZP A;  4ELY C;  5CR2 A;  4MDX A;  5CCA A;  1UB4 A;  3TCJ A;  5CKF A;  4OF1 A;  4VUB A;  5CKE A;  1M1F A;  5CKD A;  3HPW A;  1NE8 A;  5CKH A;  3NFC A;  5CQY A;  5CQX A;  5CO7 A;  5CK9 A; 
#chains in the Genus database with same CATH topology
 4PJM A;  1YBY A;  3JCM h;  3MP8 A;  2JS0 A;  4KUL A;  4ZN3 A;  1K8A C;  4O5V A;  2BZY A;  1VQ5 A;  1I8F A;  4HCC A;  4M7A C;  1SG5 A;  2MWO A;  3RES A;  1VQK Q;  1CKB A;  4LNP A;  5KYW A;  1YCY A;  3MCA B;  2FHD A;  4M7D D;  4E7K A;  2FEI A;  1KC8 C;  2A36 A;  1VIF A;  2AZV A;  1MV3 A;  1YIT T;  2DE0 X;  4ANJ A;  2JMC A;  2OTL T;  2DF6 A;  5FLX E;  3EFR A;  2JM8 A;  4MZT A;  4PLI A;  2JVV A;  3UWN A;  3UA7 A;  4KRT A;  3DB4 A;  3CCU Q;  4M4Z A;  3EGD A;  4IUP A;  4AFZ C;  3C94 A;  3EFS A;  2R57 A;  3ZEH A;  1K4U S;  1NZ9 A;  3QSU A;  1W4S A;  2CP6 A;  3UF4 A;  4EPC A;  4J6X A;  4DQ2 A;  4AMC A;  1C0M A;  1K73 U;  1Q82 R;  2K4Y A;  1AWO A;  1GCP A;  4IIO A;  2E6N A;  2QAZ A;  3CCQ A;  4HCK A;  3URG A;  5IXB A;  4CC3 A;  1EZZ B;  2RF0 A;  1PSE A;  4QQG A;  2CH4 W;  1YJN T;  4CRI A;  1D1A A;  1VQ6 Q;  1YIJ T;  1R0C B;  1IRE B;  2X51 A;  5KYY B;  2JXB A;  1YJ9 T;  1KD1 C;  1SRL A;  1CKA A;  4OGC A;  5LJ3 g;  2P0Q A;  1UHC A;  3I55 Q;  2OI3 A;  4RTX A;  3SWN C;  1VQL Q;  4P5N A;  2CSQ A;  4L5G A;  2D1X A;  1ZA2 B;  2F1L A;  3CC4 Q;  2EGC A;  4GLM A;  3T9N A;  2JJ9 A;  2E70 A;  1OPK A;  2DBM A;  2DK3 A;  1PNJ A;  1N8R R;  3ER0 A;  3MKD A;  2KE9 A;  1RLP C;  5LJ5 f;  2KNB B;  2RN8 A;  3FRN A;  3HFN A;  2FPD A;  1UEC A;  1M2V B;  2KYB A;  1YHQ Q;  4FSS A;  1M1K U;  4X9C A;  2K6D A;  1VQP A;  3OYA A;  1R8O B;  4GBQ A;  4XTZ A;  2KR3 A;  4A4K A;  2KRO A;  3G4S Q;  1OU9 A;  1UGQ B;  2QQ9 A;  2M1H A;  3A8G B;  1ZUU A;  3CC7 Q;  5A0D A;  3G6E A;  1VQM T;  2EYW A;  3JCM V;  3M0R A;  5CQX A;  3H0F A;  2X9H A;  2RMO A;  4F04 B;  2MF2 A;  2LCS A;  1VQK T;  1Q86 U;  1UUE A;  2BZ8 A;  3ZFJ A;  3WVD B;  2V8J A;  3OYG A;  5I2M A;  4XTX A;  1D0X A;  1I81 A;  2EQJ A;  2XG8 D;  3HRU A;  2XID A;  2PQW A;  3QHS A;  3JB9 J;  3EFO A;  1NJI C;  3PGG A;  2ROT A;  5FWB A;  1QKW A;  4KT0 E;  1M4Z A;  2L3P A;  2PZ1 A;  5FRM A;  2E6Z A;  2MPX C;  3CCU T;  4DBF A;  5GAN 8;  1WIE A;  3M55 A;  4C92 E;  3CMA Q;  4MDX A;  2F2X A;  2KI7 A;  1ZLM A;  5AYF A;  3VS7 A;  2WSC E;  1NYG A;  1VQ5 Q;  4JRQ A;  2CP3 A;  3SD4 A;  1MHN A;  2RM4 A;  4OB0 B;  1UGR B;  5GAM g;  3UA6 A;  5I21 A;  3L1A A;  3OYB A;  2O88 A;  2J6K A;  2ENM A;  4BI4 A;  1QKX A;  4FSX A;  3VS3 A;  3VS4 A;  4N0A A;  2RH2 A;  1VQ6 T;  1QCO A;  1TOV A;  3CXC P;  1GBQ A;  1OI1 A;  1QP2 A;  4E7J A;  2FYK A;  1BYM A;  2EJF A;  3RKY A;  4FYX B;  4C92 A;  1Q81 R;  3AHU A;  1VQL T;  3LX7 A;  5I22 A;  1TUC A;  2A08 A;  1O9S A;  1ZX6 A;  1H64 1;  4AG1 C;  5D6X A;  1WXT A;  4GY5 A;  3MO8 A;  1IO6 A;  1K8A R;  4KUD K;  2E10 A;  3NTK A;  2KK4 A;  4C5G A;  3QO3 A;  2DAQ A;  3Q1J A;  1B3Q A;  5FU7 B;  3TCJ A;  3PFS A;  2LRQ A;  3P8H A;  1YHQ T;  3V8K A;  3CCQ Q;  1KC8 R;  2DET A;  4ESR A;  3EHR A;  2P4T A;  4YTL A;  5GAN f;  1YI2 T;  2QDY B;  4IUQ A;  4M78 B;  3G4S T;  1WHK A;  3IQL A;  3I5R A;  5LJ5 h;  2VYT A;  2A0F B;  1MMG A;  3ZL7 C;  3GOX A;  4PLL A;  2RQV A;  3CCL T;  1W70 A;  1QVG P;  2YXY A;  4ZNX A;  2H8H A;  5CO7 A;  4KGZ B;  4M78 F;  4WF2 A;  3CQT A;  4BDY A;  4RTY A;  2EYQ A;  4C92 G;  1MUZ A;  2O31 A;  3EGU A;  2EQU A;  2ECZ A;  2ZAE A;  3QWX X;  1YFN A;  2RJC A;  1UFF A;  3H9N A;  2FB7 A;  2DPP B;  2V26 A;  3PIP A;  2LT4 A;  5KE2 A;  4A53 A;  1NBE B;  1KD1 R;  1AZE A;  1PRM C;  2YHT A;  4MDW A;  1C1A A;  2OAU A;  1DJ7 B;  3MPU B;  2QDL A;  4M7D B;  1N8R U;  2HQE A;  2DXC A;  2EGE A;  2ZPI B;  2EYZ A;  4C0D C;  3CMA T;  3L42 A;  2DMO A;  1E6H A;  3I5S A;  1RAG B;  3O8V A;  4M75 C;  3G6E Q;  1M90 C;  1FYN A;  2FRY A;  1QVF A;  1WGS A;  3CC2 A;  2LX9 A;  1PRL C;  1VQ5 T;  1JXM A;  4BY6 B;  5KYX B;  2IG0 A;  5D6Y A;  2ZPE B;  2LC4 A;  3MEU A;  4M7D F;  4PJO E;  2D6F A;  2DM1 A;  2KVQ G;  3VU3 C;  2J6O A;  2JNG A;  4M77 G;  1WZO A;  2R5A A;  2F5T X;  4ZN1 A;  3M58 A;  2NUZ A;  1OQK A;  3EGX A;  4M7A D;  1W6X A;  2AHJ B;  2X4Y A;  2E1H A;  3TSZ A;  1VQN A;  5GAM f;  3TVT A;  1XQH A;  4PJO A;  2FL7 A;  3QII A;  1YJW A;  4OGE A;  1JRI A;  3MJX A;  5D7U A;  3VV0 A;  2NYS A;  2DTO A;  5FRO A;  1UGS B;  2VKN A;  2VGM A;  3CCQ T;  5IT9 E;  4PJN A;  5CKE A;  5GMK i;  2DXT A;  1BI0 A;  1NJI R;  1TH7 A;  1ZBX A;  1YWO A;  1T3L A;  4M7A E;  3MEW A;  4N4G A;  3M0U A;  2HSP A;  1VYV A;  1KFZ A;  2MWP A;  4AG2 C;  1IRX A;  4J7F A;  2QA4 Q;  4RG8 A;  5FW9 A;  2D8J A;  1Q7Y U;  1M1F A;  5LJ3 h;  1Y71 A;  3OW2 P;  5J3B A;  4F17 A;  2F69 A;  3OYK A;  3A8L B;  4KH0 B;  3H41 A;  1FMK A;  3JRZ A;  3L2U A;  3M4G A;  4PK4 A;  2K5I A;  2JW4 A;  3MEA A;  1FWZ A;  2CSI A;  2K57 A;  1JJ2 P;  1SPK A;  1X01 A;  2HKQ B;  4RTT A;  3WXM B;  4EMK C;  3VRY A;  4M77 C;  1WPY A;  2RB6 A;  2QTX A;  2HKN A;  1VQP T;  5IAY A;  1NE8 A;  2QQS A;  1K8A U;  3GP8 A;  3ULR B;  4PJO G;  1VQ9 A;  3S3M A;  1LCK A;  3G6E T;  4NL2 A;  2VVK A;  3RER A;  4F7U E;  2FZC B;  2MK5 A;  4XU2 A;  5HY6 A;  2I0N A;  4JS4 A;  3JCM b;  1XTD A;  1KC8 U;  2O4X A;  2JTF A;  3EHQ A;  3RBB B;  1BBZ A;  1YWP A;  2JN0 A;  2KQW A;  1ZUK A;  5GAN 2;  3JCM Q;  1B34 A;  2HL5 C;  4RTW A;  3OW2 S;  2RK2 A;  5C0M A;  2HBW A;  1ZSZ A;  1JO8 A;  2XMF A;  2EWN A;  2MMP A;  3DLL A;  3JSC A;  3I9Q A;  5CIU A;  2EQM A;  2DFU A;  5GAN 5;  1G3T A;  1JJ2 S;  1PD1 A;  4NOY A;  4CI0 C;  1QW1 A;  4LD9 K;  5HCK A;  1KHC A;  2AIR B;  4RG2 A;  3PT9 A;  2HDA A;  5GJV B;  3SWN A;  3PNW C;  3CME A;  4DBR A;  2A28 A;  2EQI A;  4CC2 A;  3OYH A;  1JXO A;  1LJO A;  1RAD B;  3CPW A;  4L6V 5;  3QUI A;  4IIM A;  4C0Z A;  1WI7 A;  3NFC A;  5GAM h;  2B86 A;  3CEY A;  4EMH A;  3U23 A;  2GBQ A;  1LNX A;  1PHT A;  3JAM E;  1VUB A;  4DOV A;  4E7I A;  4C5H A;  2P0K A;  2NUT A;  4AFU C;  2I2L A;  2KEA A;  3VYH B;  1V1C A;  1BI1 A;  1WXB A;  5FU6 B;  1VQN Q;  1OEB A;  3LH0 A;  4LXC A;  1IB8 A;  1BKB A;  4XTV A;  1SSF A;  2MI6 A;  3FC3 A;  3E9G A;  2MYS A;  1YJW Q;  4HVW A;  2FG0 A;  5GMK m;  4ELY C;  2O01 E;  2ED1 A;  4C8Q E;  3BFM A;  4V2S A;  2ZPG B;  4A63 B;  2RJF A;  2X35 A;  2CDT A;  1RI0 A;  1I5O B;  2HL3 A;  2NUP B;  4QKU A;  4OB2 B;  1ZHI A;  3GIB A;  2A7Y A;  2DXB A;  2E5Q A;  3HP9 A;  2WSE E;  3LWH A;  2LJ1 A;  1NJI U;  3O5Z A;  3GF5 A;  4VUB A;  4C8Q A;  1RAA B;  2K2M A;  4BAC A;  2DIG A;  3KFV A;  5CK9 A;  3QXE B;  1B07 A;  3X28 B;  3UAT A;  1SF9 A;  1MMA A;  1QP3 A;  3VRZ A;  2BIV A;  2RHZ A;  1K9M C;  2K3B A;  4OMP A;  4KGV B;  4C0F A;  4XU3 A;  2X3X D;  3ASK A;  4ATO A;  2VAS A;  3QKJ A;  1SEM A;  4R56 A;  1TS9 A;  2G6F X;  2DYI A;  5GAO n;  1RAE B;  3BE3 A;  2J7I A;  5KYU B;  3OS1 A;  5EG2 A;  1OZ2 A;  2ABL A;  2L0A A;  1ZSZ C;  3RUX A;  3DB3 A;  3M4Y A;  5L8R E;  4A4H A;  3CC2 T;  3UDC A;  4M7A B;  3X26 B;  4E7H A;  1G5V A;  2DL5 A;  1PKT A;  3AT1 B;  1FMW A;  2PVO B;  3RDV A;  1KG1 A;  4RTU A;  3E9F A;  4LDV A;  3DKM A;  1GFD A;  3I56 A;  2YRV A;  3E2U A;  5GAN g;  4M7A F;  4OP0 A;  2DRK A;  2RI2 A;  3BDL A;  4HKE A;  2DZ9 A;  2QEX A;  4Y91 A;  4JLI A;  2CZ0 B;  2YUO A;  3GNF B;  2GFU A;  1HYO A;  2V8I A;  1X6G A;  3VS1 A;  4C8Q G;  4OMN A;  1VQN T;  3OYC A;  2HEQ A;  4Z8A A;  3MHX A;  2CP0 A;  5C6S A;  3CME Q;  2YLB A;  1YJW T;  3EG1 A;  2D8H A;  1AT1 B;  1W2B A;  2F2W A;  4M75 E;  3A8M B;  1LOJ A;  2LDM A;  1YI2 Q;  2ZCF B;  3MP1 A;  5KCO A;  2K7A A;  4B6M A;  4F7U B;  1G2B A;  2PVG B;  2DLP A;  4ORZ A;  3C12 A;  1E6G A;  3CPF A;  2R58 A;  4J8O A;  1ABQ A;  1NPP A;  1FX7 A;  3CCL Q;  2GQV A;  4M78 G;  3NTH A;  2RHU A;  4LN2 A;  3J7A F;  2HCK A;  9ATC B;  2CT3 A;  3PMT A;  3OS5 A;  1KHI A;  4HXJ A;  4C92 D;  2LNH B;  2HD0 A;  4J5Y A;  4F7U F;  1I0C A;  4M75 A;  2ZZD A;  4J9F A;  2EJG A;  1SSH A;  2PVD B;  2Y4X A;  2C0O A;  2GNC A;  5LJ3 e;  2LZ6 B;  4CC7 A;  1AEY A;  5LL6 S;  2RA2 A;  1BIA A;  1Y96 A;  2LJ3 A;  2V8K A;  2EKH A;  2LCC A;  5IHK A;  2VXE A;  1I07 A;  1AOJ A;  2GF7 A;  3GBQ A;  2E5K A;  2XDD A;  2DKG A;  3JCM d;  4IKF A;  4D6W A;  2YT6 A;  1VQ9 T;  3JCM J;  4C8Q C;  3CBM A;  5A2Q E;  3H8Z A;  1U1S A;  3M0T A;  1Q95 G;  5KYN A;  3JCM P;  2EBP A;  3FIF A;  3OSV A;  4BDZ A;  1RAC B;  1ZSG A;  4M77 D;  3OA6 A;  1OYX A;  3KXT A;  2RPN A;  4FYV B;  4D8K A;  1TUG B;  2P84 A;  4II1 A;  3TQ7 P;  4DBQ A;  5LJ5 j;  4J9C A;  4N4I A;  3TU4 K;  3OYL A;  2QQR A;  2YLC A;  1PG5 B;  3UPU A;  3CCV A;  1G3W A;  1K73 C;  4M75 G;  4M78 C;  1IZ6 A;  4PNO A;  1WFW A;  2HBP A;  4M77 E;  5KYW B;  1QVF P;  3F70 A;  3A98 A;  2C0T A;  3CCM A;  2L3S A;  3CME T;  3CBO A;  4Y28 E;  3OMG A;  1BK2 A;  1BI2 A;  3PVQ A;  2M16 A;  1GCQ C;  2Y90 A;  1MND A;  2GGR A;  2JM9 A;  1K9M R;  4ZTJ A;  3CXC S;  3EGD B;  3I56 Q;  1Q82 U;  1WDX A;  4EMK A;  1U8R A;  4M77 A;  2ZGW A;  5M9O A;  4R55 A;  2MOX A;  4IUT A;  2QEX Q;  1D0Z A;  3EG0 A;  4AFS C;  5CKB A;  2LX7 A;  1V76 A;  2DJZ A;  1JB0 E;  1QQJ A;  1VQ7 A;  1K9A A;  2W0Z A;  3PIO A;  1M1K C;  3OYY A;  1VYU A;  4E7S A;  1QVF S;  4PKC C;  4PL6 A;  4KBM B;  2DX1 A;  1JU5 C;  1D1C A;  4PJO D;  5GJW B;  4F16 A;  4R0K A;  3EG9 A;  3THK A;  3TEE A;  1VQP Q;  3NTI A;  4LDW A;  3L2W A;  3SFM A;  2COW A;  2OJ2 A;  3SDZ A;  3QPH A;  4RMO A;  1Q86 C;  1BIB A;  2E41 A;  2K5F A;  1PKS A;  3RKW A;  2QGF B;  2K79 A;  1AD5 A;  2EKO A;  1QVG S;  2YUQ A;  2WSF E;  1UJ0 A;  2RHY A;  4E47 A;  1BCM A;  2DZC A;  3JCM e;  3VUZ A;  2PTK A;  3H6Z A;  3V8J A;  3VS0 A;  1X27 A;  5L23 A;  1NG2 A;  4J6W A;  1X69 A;  3JB9 G;  1U1T A;  4X34 A;  4AFQ C;  3EG2 A;  2HMA A;  1VA7 A;  3SEM A;  5IH2 A;  4QQD A;  4BB7 A;  4E6R A;  1ZQ1 A;  5LJ3 j;  4XTY A;  1RL2 A;  3GNG A;  1PCX A;  2KGT A;  4RTV A;  3V7R A;  1C6V X;  1U3O A;  5A0G A;  1EFN A;  4FU6 A;  2LQ8 A;  2G3R A;  1PD0 A;  3LGL A;  1KIK A;  2YUP A;  4FYW B;  4OMQ A;  2ESW A;  4HT9 A;  1KK7 A;  4MZP A;  4L59 A;  1M1G A;  2CUD A;  1M27 C;  3J80 E;  3M0Q A;  1H3H A;  4J9H A;  2KXC A;  3JB9 H;  3EFO B;  1Y57 A;  1WJQ A;  2M0Y A;  1KQS A;  1LPL A;  3HRT A;  4Q5W A;  3LLR A;  2KBT A;  2EQK A;  1MV0 B;  1QVP A;  2M0O A;  4DEY A;  4RCC A;  4FCY A;  3I56 T;  4ZGJ B;  4RCB A;  1KSW A;  2OTJ A;  1WHL A;  2K3Y A;  3FB9 A;  1HK9 A;  2LP5 A;  1GL5 A;  2A3L A;  3CCV Q;  3X25 B;  2QEX T;  1CSK A;  3S3O A;  2P0P A;  5GAN h;  3OYM A;  4KGX B;  3VS2 A;  2GTO A;  2M51 A;  3L2Q A;  4X1V A;  2DTH A;  4BI3 A;  1Q81 U;  1BB9 A;  1H92 A;  2CYZ B;  1JEG A;  4LDX A;  3CCM Q;  5CR2 A;  3CPW P;  4C92 B;  2QI2 A;  4J83 A;  4FT2 A;  4DOW A;  1YP5 A;  3CCR A;  1IGQ A;  2O9S A;  1AWJ A;  2HQX A;  2DEU A;  5LJ5 d;  3WVE B;  1ZBJ A;  1LVK A;  1AHJ B;  5GAO l;  2AK5 A;  1WX6 A;  1UEB A;  1K73 R;  4FL6 A;  2B8A A;  3JB9 I;  2LQN A;  4C92 F;  4LD6 A;  5CVI A;  2CP5 A;  3VS5 A;  1W1F A;  1VQ4 A;  1MNE A;  4UC4 A;  5KYY A;  5D6W A;  1VQ7 Q;  5GAM j;  4PFO A;  3KBG A;  2CT4 A;  1X75 C;  4A54 A;  5KE3 A;  4LUD A;  3G1J A;  3QYG B;  3VKI A;  2VUB A;  3FDR A;  2ZPH B;  4RUG A;  3HFO A;  4M77 B;  1S72 A;  2E65 A;  2HSE B;  3PMI A;  1TXQ A;  1AZG B;  5FWC A;  2D9T A;  1M2V A;  3INZ A;  2DIL A;  5ECA A;  3QJ6 A;  1EIF A;  3I55 A;  3VS6 A;  1AWW A;  2EJ9 A;  3CC2 Q;  4QT7 A;  3CC4 A;  1N5Z A;  1M1K R;  1KD1 U;  2EYY A;  1K0S A;  5FU6 C;  1I1J A;  1NLP C;  1QCF A;  1KJW A;  2JT4 A;  4OMF B;  1NLO C;  1JQQ A;  4BE1 A;  3NMZ C;  4C8Q D;  1RAF B;  1JJ2 A;  3A8H B;  2YRD A;  2DD4 A;  1D1B A;  3NGP A;  3CCV T;  1Q86 R;  2M02 A;  3QZ5 B;  3OSS C;  1M90 R;  2RNA A;  5GMK h;  4XU1 A;  4OMO A;  3FLG A;  3CC7 A;  1AVZ C;  4OMM A;  2QK0 A;  3OMC A;  4MZM A;  4B9W A;  1PSF A;  3CCM T;  2JS2 A;  2YRC A;  3OY9 A;  2X3W D;  4E7L A;  4RTZ A;  5GAO q;  4BE2 A;  4LDY A;  1YCS B;  3EGX B;  3LW5 E;  3JCM c;  1G3S A;  1WHH A;  2JOY A;  1VOM A;  2BKD N;  5IXF A;  1Q7Y C;  2CZ6 B;  2EGA A;  1N9S A;  1NEG A;  1ZA1 B;  1O75 A;  2DL4 A;  4JJB A;  4PJO B;  2OTJ Q;  3OYI A;  2J6F A;  4KUI A;  2K5L A;  4ME7 A;  3EH1 A;  2HZY A;  1M30 A;  2YDL A;  5LJ3 d;  2MIO A;  2KSS A;  5LJ5 e;  3KUF A;  2CZ7 B;  3V7S A;  3QYH B;  2XD0 A;  4A4E A;  1NYF A;  2RI3 A;  2DL7 A;  2BE7 D;  2RJE A;  1VQ7 T;  3G71 A;  1M3A A;  5IHI A;  1TWB A;  1MMN A;  3REB B;  4M78 E;  3J81 E;  2H3J A;  1X2Q A;  3HKS A;  4PJO F;  5J39 A;  2C06 A;  1W2B P;  3L2V A;  2SEM A;  2AKL A;  2RQW A;  2DD5 A;  4NL3 A;  5HKC A;  1ZUY A;  1X6O A;  3CCR Q;  2HQH A;  4EDU A;  2X4J A;  2E12 A;  1XJW B;  1GFC A;  3NHN A;  1VQ9 Q;  3CD6 A;  2RHI A;  4FW2 A;  2O9V A;  2IIM A;  1H3Z A;  1FMV A;  2K9G A;  4J9I A;  4M78 A;  2OX7 A;  2AZS A;  1M5Q 1;  1VQ4 Q;  1MMD A;  3HL8 A;  5DLO A;  4HVU A;  2RQR A;  2DIQ A;  2DEQ A;  2LQK A;  4XU0 A;  2M9U A;  2L2P A;  4E2F B;  4LE9 A;  4OF1 A;  3C0C A;  1M2O A;  1M3B A;  2FPE A;  4JJD A;  4XTW A;  5IHN A;  4M7D E;  4Z88 A;  1WHM A;  3CCJ A;  1T0J A;  4M75 D;  2VXF A;  4K11 A;  1W2B S;  3CCE A;  3R6N A;  2J06 A;  2QG9 B;  3M57 A;  2L3Q A;  1SHG A;  5CAI A;  1ABO A;  1OX9 A;  1GCQ A;  1S72 Q;  3NPF A;  2O4X B;  2WAC A;  3TSW A;  4JRK A;  1B34 B;  3A8O B;  2LT1 A;  2YSQ A;  1I4K 1;  4E7Z A;  1A0N B;  1ZSZ B;  1Z9Q A;  4J6Y A;  4ZGE B;  4HVV A;  4FM4 B;  3QG1 A;  3OYJ A;  2PU9 B;  1UJY A;  4M7D A;  3QBY A;  1Y7X A;  3S6W A;  2E3H A;  2GFA A;  4A4G A;  2KRN A;  4ELZ C;  4Z89 A;  1TUD A;  2AKK A;  2XKO C;  3EG3 A;  2V1Q A;  5GAM d;  1UGV A;  2GTJ A;  3MEV A;  2L8D A;  4Y92 A;  4PFP A;  1WQW A;  3M56 A;  1SHF A;  5KYX A;  3JV3 A;  1RAB B;  1QLY A;  4JZ4 A;  1OU8 A;  4KH1 B;  2RHX A;  2E64 A;  1NEB A;  2DER A;  1GRI A;  5IN1 A;  2MCN A;  3SWN B;  2OTJ T;  1RUW A;  3A5Z B;  3C4S A;  4QW2 A;  2KT1 A;  4XTU A;  1WJS A;  2O2O A;  1WXU A;  3OB9 A;  2ATC B;  1QMC A;  1JBM A;  1VQ8 A;  1KQ2 A;  3OYE A;  5GAN e;  2VV5 A;  2DYB A;  1M90 U;  4IUU A;  4QVD A;  2LTO A;  4QVZ A;  1ARK A;  1Y07 A;  2X4W A;  3CCR T;  2NUT B;  4OB1 B;  3MET A;  4JZ3 A;  1WQ7 A;  1B7T A;  2A37 A;  1D3B A;  4M7D G;  4PFZ A;  4RKU E;  5DLQ E;  4PJL A;  2CRE A;  2DVJ A;  2BUD A;  1VQ4 T;  4WCI A;  1D09 B;  3REA B;  3L2Z A;  2LQW A;  3JB9 D;  3G71 Q;  1S1N A;  1X2K A;  3CCS A;  4QVC A;  5FU7 C;  4BE0 A;  5DM7 R;  1WJR A;  1HD3 A;  4HCB A;  1SRM A;  1K0X A;  3OS0 A;  1QWF A;  5I2S A;  2KMT A;  2DVE A;  4OVA A;  2FPF A;  4D8D A;  2R5M A;  1Q7Y R;  1G8X A;  1TTH B;  1YNZ A;  1S72 T;  3LWI A;  3MP6 A;  3E1S A;  3JCM X;  4JUV A;  1WLP B;  2BZX A;  4ZGD B;  2GQI A;  3CD6 Q;  4HA8 A;  1I5L A;  3S3N A;  3I55 T;  2COY A;  1UTI A;  4BD3 A;  4C8Q B;  2QA4 A;  2PUK B;  2VC8 A;  1YN8 A;  3CC4 T;  3X20 B;  1H8K A;  2EPD A;  5I11 A;  3CBP A;  1WA7 A;  1VQO A;  1V29 B;  4O6J A;  1X43 A;  2XU8 A;  2FO0 A;  4XK8 E;  4DEX A;  2GCX A;  2EVR A;  2JMA A;  3RR6 A;  4GLK A;  3H0H A;  4C8Q F;  3CCJ Q;  1RAI B;  3M9Q A;  1GBR A;  2BTT A;  2KAF A;  4QQ6 A;  1PM3 A;  3CCE Q;  5LJ3 f;  4JPB W;  2DJQ A;  5DY9 A;  1OZ3 A;  5GAM e;  1HSQ A;  2VWF A;  3JCM g;  3RNJ A;  4M7D C;  4Z02 A;  2Z0W A;  3RIR A;  4FW1 A;  2L3R A;  2JTM A;  3OYD A;  4MML A;  3EH2 A;  3CC7 T;  3P8B B;  2HNI A;  1UDL A;  2QYZ A;  1ACM B;  1PC0 A;  1SKU B;  4BY6 C;  3EAE A;  5GMK e;  3GLX A;  1G3Y A;  1KQS P;  3LGF A;  3A1P A;  5GAO r;  2CZ1 B;  4PJJ A;  4ZTF A;  2CS7 A;  2JZ2 A;  2YUN A;  2IVW A;  1UE9 A;  5FRN A;  4DBH A;  1R77 A;  3OYN A;  1YIT A;  2BE9 B;  3CXC A;  5AT1 B;  3VJP A;  2OTL A;  4J9D A;  3QZ9 B;  3LYI A;  1FXX A;  1XOV A;  4A4F A;  2KXD A;  1OV3 A;  2CP7 A;  2NLU A;  1N6A A;  3C95 A;  1WHG A;  5GAN 7;  2ZPF B;  3FJP A;  3QJY A;  1E7O A;  2F2V A;  2NWM A;  5EC7 A;  1WNL A;  3SHW A;  3QDF A;  2V1R A;  5KCH A;  5HK3 A;  3G71 T;  3HHT B;  4JRI A;  4CC4 B;  1VQ8 Q;  1UGP B;  4C0G A;  2HAX A;  2CKK A;  3E19 A;  3V8L A;  1KQS S;  2KYM A;  2ROL A;  2PUO B;  4NS5 A;  2L5Q A;  2VB6 A;  1YJN A;  5GAN j;  4IUR A;  1YIJ A;  1WHJ A;  2DRM A;  2XIC A;  2IPO B;  1YJ9 A;  2AT1 B;  4JDS A;  3BDU A;  4C0D B;  3D7S B;  1VIE A;  3QDR B;  1Y0M A;  4M75 B;  2JTE A;  3PTA A;  3CD6 T;  4C5E A;  4IUV A;  2K3X A;  1TU0 B;  2DNU A;  1QVG A;  2COZ A;  3R6O A;  2CP2 A;  1Y96 B;  3X24 B;  2NUP A;  2D0N A;  2DO3 A;  4JJN K;  3SB2 A;  2Y4Y A;  1RAH B;  3HRS A;  3JCM W;  1D0Y A;  4WTO B;  3CCS Q;  1M9S A;  1RI9 A;  4M75 F;  1KQ1 A;  4N0A C;  3G7Z A;  1GXI E;  3CCJ T;  3ZBD A;  2QQB A;  1AWX A;  4OB3 B;  3OYF A;  4C92 C;  1PWT A;  3CCE T;  2PNI A;  2RJD A;  5CKF A;  2D0Q B;  1D3B B;  5CKD A;  1IHW A;  2DL8 A;  1OX8 A;  2KY9 A;  2FZK B;  2P4R A;  2QQA A;  3RMQ A;  4HCZ A;  3OBW A;  5GAO p;  2XI9 A;  1U06 A;  2EAY A;  1VYT A;  2EFI A;  1VQM A;  1Z9Z A;  2DA9 A;  7AT1 B;  4JS5 A;  1UB4 A;  1VQK A;  3M53 A;  4JRP A;  5KYU A;  1Q82 C;  3DLM A;  2XDP A;  1J3T A;  1VQO Q;  2J05 A;  3OBY A;  5GAN 3;  2VGN A;  5GAN 6;  1IXD A;  4J9G A;  4JLG A;  2ZPB B;  3JCM f;  2KRM A;  4M7A A;  2FZG B;  2EW3 A;  2RO0 A;  2RQT A;  3VUB A;  3ME9 A;  1G83 A;  1HXD A;  2FVU A;  5A0L A;  3M54 A;  2XK0 A;  1UG1 A;  3H0I A;  2OAW A;  3CCU A;  1RLQ C;  1T3S A;  3M0P A;  5CKH A;  2EYX A;  2RQU A;  1TG0 A;  1M8V A;  2F5K A;  5GMK l;  4N4H A;  2ED0 A;  2MAM A;  1K9M U;  3PE0 A;  5HK0 A;  3RKX A;  2YWW A;  3I35 A;  4BI8 B;  4EIK A;  3OS2 A;  4HT8 A;  1VQ8 T;  1N8R C;  2L89 A;  4F14 A;  2QXF A;  3FJ5 A;  1OUL A;  3CPW S;  4LDU A;  1HJD A;  4EMK B;  2W10 A;  2DBK A;  2EIF A;  5GMK j;  1IHV A;  2RK1 A;  1VQ6 A;  5CQY A;  1M3C A;  2E3I A;  3BY7 A;  1WYX A;  1N9R A;  1YIT Q;  2KDS A;  2OTL Q;  1NM7 A;  1VQL A;  2QGG A;  4X9D A;  4F7U A;  3HSB A;  2KRS A;  4M77 F;  2RI5 A;  3L2R A;  2CUB A;  3BW1 A;  1BI3 A;  1XNI A;  3JB9 F;  2C0I A;  5J26 A;  2FRW A;  4MMK A;  3OW2 A;  3RMS A;  4EMG A;  2DXU A;  4J9E A;  2XHC A;  1R0B G;  3EG9 B;  3P8D A;  4M7A G;  4DA4 A;  1OPL A;  3CCS T;  2LVM A;  2SRC A;  4BUG A;  4LUE A;  3M59 A;  2KT8 A;  1BU1 A;  1QCN A;  1YHQ A;  2X4X A;  3PVL A;  1MGQ A;  4J7I A;  5LJ5 g;  1X6B A;  1YI2 A;  2QAS A;  1M8M A;  1YJN Q;  4B9X A;  3G4S A;  1YIJ Q;  5GAN 4;  2JUF A;  4JJC A;  2XDB A;  1YJ9 Q;  1UHF A;  1T0H A;  6AT1 B;  2RD1 A;  1IGU A;  3CCL A;  3QWY A;  2E4H A;  1K1Z A;  8AT1 B;  4XQ3 A;  1TSF A;  4PJO C;  2QA4 T;  8ATC B;  2DTI A;  2CGH A;  3FEO A;  3GPL A;  3M0S A;  5KH6 A;  5GAO m;  4TVR A;  3M5A A;  4FT4 A;  3LH5 A;  3V7C A;  1N27 A;  1U5S A;  4M78 D;  1VQO T;  3HPW A;  3UT1 A;  2LJ0 A;  5CCA A;  4OML A;  4FIB A;  4AT1 B;  1BCO A;  2K2V A;  4C5I A;  2LCL A;  1NPR A;  4F7U G;  2QTV A;  1F1B B;  2CH4 A;  3N5B B;  1QWE A;  2DL3 A;  1P92 A;  1EX4 A;  2LMJ A;  1Q81 C;  2LNV A;  2H3E B;  4XAX B;  5GAN d;  1K76 A;  1OOT A;  3OQ5 A;  3TRE A;  3HTR A;  3CMA A;  4FYY B;  3VYG A;  1VQM Q;  4J9B A; 
#chains in the Genus database with same CATH homology
 1YBY A;  4PJO G;  3JCM h;  5GAN e;  3MP8 A;  3NTI A;  4KUL A;  4LDW A;  2VV5 A;  4ZN3 A;  1K8A C;  4O5V A;  3L2W A;  3SFM A;  1I8F A;  1M90 U;  1VQ5 A;  1VQ9 A;  4HCC A;  3S3M A;  4IUU A;  3G6E T;  4M7A C;  2MWO A;  4QVD A;  4NL2 A;  3RER A;  3RES A;  2LTO A;  4QVZ A;  4F7U E;  1Y07 A;  2X4W A;  4XU2 A;  5HY6 A;  3SDZ A;  3QPH A;  4RMO A;  3JCM b;  3CCR T;  4JS4 A;  1BIB A;  1Q86 C;  1XTD A;  2E41 A;  2K5F A;  2JTF A;  2O4X A;  1KC8 U;  4OB1 B;  3RKW A;  2JN0 A;  2KQW A;  3MET A;  5GAN 2;  1YCY A;  3MCA B;  3JCM Q;  2FHD A;  1B34 A;  4M7D D;  4E7K A;  2EKO A;  3OW2 S;  1WQ7 A;  2RK2 A;  1QVG S;  1KC8 C;  1VIF A;  2WSF E;  1D3B A;  5C0M A;  4M7D G;  2RHY A;  4RKU E;  1YIT T;  5DLQ E;  4E47 A;  2OTL T;  5FLX E;  2EWN A;  2DZC A;  2MMP A;  3JCM e;  3EFR A;  3DLL A;  3JSC A;  2BUD A;  5CIU A;  1VQ4 T;  4MZT A;  3VUZ A;  2EQM A;  4PLI A;  2JVV A;  3UWN A;  3H6Z A;  5GAN 5;  1G3T A;  1JJ2 S;  3V8J A;  3DB4 A;  3L2Z A;  3JB9 D;  4NOY A;  3CCS A;  4J6W A;  4CI0 C;  4IUP A;  1QW1 A;  3JB9 G;  1U1T A;  4X34 A;  4QVC A;  4LD9 K;  5FU7 C;  1KHC A;  3C94 A;  5DM7 R;  1WJR A;  3EFS A;  4BE0 A;  4QQD A;  2R57 A;  3ZEH A;  1ZQ1 A;  4BB7 A;  4HCB A;  1NZ9 A;  5LJ3 j;  3QSU A;  1W4S A;  4XTY A;  1RL2 A;  3GNG A;  4RG2 A;  4EPC A;  4J6X A;  3V7R A;  4DQ2 A;  3PT9 A;  5A0G A;  3OS0 A;  5I2S A;  1K73 U;  2K4Y A;  2KMT A;  4FU6 A;  2DVE A;  4OVA A;  3SWN A;  2LQ8 A;  2E6N A;  2R5M A;  2G3R A;  3PNW C;  3LGL A;  3CCQ A;  1S72 T;  3URG A;  3CME A;  3LWI A;  3MP6 A;  3E1S A;  3JCM X;  4JUV A;  4HT9 A;  4MZP A;  1PSE A;  1M1G A;  4L59 A;  3OYH A;  4QQG A;  1YJN T;  3J80 E;  4CRI A;  1LJO A;  4ZGD B;  3CPW A;  1YIJ T;  4L6V 5;  4HA8 A;  1I5L A;  3QUI A;  3S3N A;  3I55 T;  1IRE B;  4BD3 A;  4C8Q B;  1YJ9 T;  1KD1 C;  3JB9 H;  2QA4 A;  2PUK B;  1WJQ A;  2VC8 A;  4OGC A;  4C0Z A;  5LJ3 g;  1KQS A;  2P0Q A;  3NFC A;  5GAM h;  3CC4 T;  3HRT A;  4Q5W A;  3LLR A;  3X20 B;  3CEY A;  4EMH A;  3SWN C;  4P5N A;  4L5G A;  2EQK A;  3CBP A;  1QVP A;  1LNX A;  1VQO A;  2M0O A;  1V29 B;  4RCC A;  3JAM E;  4O6J A;  3T9N A;  4XK8 E;  2XU8 A;  2E70 A;  3I56 T;  1VUB A;  4ZGJ B;  2GCX A;  4DOV A;  4E7I A;  4RCB A;  4C5H A;  2P0K A;  2DK3 A;  3ER0 A;  2OTJ A;  4GLK A;  5LJ5 f;  2I2L A;  2K3Y A;  4C8Q F;  3FB9 A;  1HK9 A;  3FRN A;  3M9Q A;  3VYH B;  2A3L A;  1BI1 A;  3X25 B;  2QEX T;  5FU6 B;  2KAF A;  3HFN A;  4QQ6 A;  3LH0 A;  2P0P A;  3S3O A;  5LJ3 f;  5DY9 A;  1BKB A;  4XTV A;  5GAN h;  1SSF A;  2MI6 A;  3OYM A;  1OZ3 A;  3L2Q A;  3E9G A;  5GAM e;  3FC3 A;  3JCM g;  1M1K U;  4M7D C;  4X9C A;  4Z02 A;  2DTH A;  4BI3 A;  3RIR A;  1VQP A;  3OYA A;  1Q81 U;  1R8O B;  2L3R A;  2CYZ B;  2JTM A;  3OYD A;  4XTZ A;  4MML A;  4A4K A;  5GMK m;  4LDX A;  4ELY C;  2O01 E;  1UGQ B;  3CC7 T;  5CR2 A;  3P8B B;  2HNI A;  2QQ9 A;  4C8Q E;  2M1H A;  3BFM A;  2QI2 A;  4C92 B;  3A8G B;  4J83 A;  4V2S A;  5A0D A;  2ZPG B;  3G6E A;  4FT2 A;  4BY6 C;  5GMK e;  3EAE A;  4DOW A;  2RJF A;  3GLX A;  2X35 A;  1VQM T;  3CCR A;  1RI0 A;  1G3Y A;  3JCM V;  5CQX A;  3LGF A;  2HQX A;  5GAO r;  2CZ1 B;  5LJ5 d;  4ZTF A;  3WVE B;  2MF2 A;  2CS7 A;  2JZ2 A;  4OB2 B;  1AHJ B;  1ZHI A;  5GAO l;  1Q86 U;  1VQK T;  2IVW A;  3GIB A;  2A7Y A;  1UEB A;  2DXB A;  2E5Q A;  3HP9 A;  2V8J A;  4FL6 A;  3WVD B;  2B8A A;  3ZFJ A;  3JB9 I;  3OYG A;  5FRN A;  2WSE E;  5I2M A;  3OYN A;  3LWH A;  1YIT A;  4XTX A;  3CXC A;  1I81 A;  1NJI U;  4C92 F;  3VJP A;  2OTL A;  4LD6 A;  5CVI A;  3QZ9 B;  2EQJ A;  3LYI A;  2XG8 D;  1VQ4 A;  1FXX A;  1XOV A;  2PQW A;  2XID A;  3GF5 A;  3HRU A;  3QHS A;  4VUB A;  4A4F A;  4UC4 A;  4C8Q A;  5D6W A;  3JB9 J;  1NJI C;  3PGG A;  4BAC A;  2DIG A;  2NLU A;  1M4Z A;  4KT0 E;  1N6A A;  3C95 A;  5CK9 A;  5GAM j;  3QXE B;  5FRM A;  2E6Z A;  3KBG A;  5GAN 7;  3X28 B;  2ZPF B;  3FJP A;  3QJY A;  1X75 C;  1QP3 A;  4A54 A;  5KE3 A;  2BIV A;  2RHZ A;  3QYG B;  1K9M C;  3CCU T;  3VKI A;  1WNL A;  2VUB A;  3FDR A;  5HK3 A;  5KCH A;  5GAN 8;  3G71 T;  4C0F A;  3M55 A;  2ZPH B;  4C92 E;  4XU3 A;  3ASK A;  3HHT B;  4JRI A;  4ATO A;  4MDX A;  1UGP B;  4C0G A;  4R56 A;  3HFO A;  3QKJ A;  2HAX A;  4M77 B;  5AYF A;  1S72 A;  5GAO n;  2E65 A;  2CKK A;  2WSC E;  3OS1 A;  3E19 A;  3PMI A;  1OZ2 A;  5EG2 A;  4NS5 A;  3V8L A;  2PUO B;  3SD4 A;  4JRQ A;  1KQS S;  2RM4 A;  1MHN A;  4OB0 B;  2L5Q A;  2D9T A;  1UGR B;  3DB3 A;  3RUX A;  3INZ A;  5GAM g;  1YJN A;  5GAN j;  4IUR A;  5I21 A;  3M4Y A;  5L8R E;  3L1A A;  3OYB A;  1YIJ A;  4A4H A;  3QJ6 A;  3CC2 T;  1EIF A;  2XIC A;  3UDC A;  4M7A B;  3X26 B;  3I55 A;  4E7H A;  1YJ9 A;  1G5V A;  4BI4 A;  4JDS A;  2EJ9 A;  3BDU A;  4FSX A;  4C0D B;  1VIE A;  3QDR B;  4N0A A;  4M75 B;  2RH2 A;  3CC4 A;  1VQ6 T;  2PVO B;  3OYE A;  3PTA A;  3CD6 T;  3E9F A;  4C5E A;  1KD1 U;  1KG1 A;  4LDV A;  1OI1 A;  1QP2 A;  4E7J A;  2FYK A;  1BYM A;  4IUV A;  2EJF A;  2K3X A;  3RKY A;  4C92 A;  3DKM A;  5FU6 C;  1QVG A;  3R6O A;  3I56 A;  3AHU A;  1VQL T;  1Y96 B;  3LX7 A;  3X24 B;  2DO3 A;  2YRV A;  4JJN K;  3SB2 A;  1O9S A;  2Y4Y A;  5GAN g;  3HRS A;  1H64 1;  4M7A F;  5D6X A;  4OP0 A;  2RI2 A;  3JCM W;  3BDL A;  4HKE A;  4GY5 A;  4OMF B;  2DZ9 A;  2QEX A;  4Y91 A;  4JLI A;  2CZ0 B;  3MO8 A;  1M9S A;  4BE1 A;  4M75 F;  4KUD K;  3GNF B;  4C8Q D;  2GFU A;  1KQ1 A;  2E10 A;  2V8I A;  4N0A C;  3A8H B;  3G7Z A;  1JJ2 A;  1GXI E;  3NTK A;  2KK4 A;  2DD4 A;  4C5G A;  3CCJ T;  4C8Q G;  3QO3 A;  3ZBD A;  2DAQ A;  2QQB A;  3Q1J A;  4OB3 B;  3CCV T;  3QZ5 B;  3OSS C;  4C92 C;  3OYC A;  5FU7 B;  3TCJ A;  3OYF A;  2RJD A;  5CKF A;  3CCE T;  5GMK h;  2D0Q B;  3PFS A;  2LRQ A;  1D3B B;  5CKD A;  3MHX A;  4XU1 A;  3P8H A;  2KY9 A;  3FLG A;  2QQA A;  3V8K A;  1YHQ T;  3RMQ A;  5C6S A;  3CC7 A;  2YLB A;  1YJW T;  4HCZ A;  2P4T A;  4YTL A;  5GAN f;  1YI2 T;  3OMC A;  4MZM A;  3OBW A;  4B9W A;  2QDY B;  2XI9 A;  2EAY A;  5GAO p;  1W2B A;  4IUQ A;  2EFI A;  4M75 E;  3A8M B;  4M78 B;  1PSF A;  3CCM T;  1VQM A;  3G4S T;  1LOJ A;  2LDM A;  2ZCF B;  3MP1 A;  3OY9 A;  4E7L A;  5KCO A;  5LJ5 h;  2VYT A;  4F7U B;  2PVG B;  3GOX A;  4JS5 A;  5GAO q;  4BE2 A;  4PLL A;  1UB4 A;  4LDY A;  3CCL T;  1VQK A;  3LW5 E;  3C12 A;  3M53 A;  4JRP A;  3JCM c;  3CPF A;  1G3S A;  2R58 A;  4J8O A;  1NPP A;  3DLM A;  1FX7 A;  1Q82 C;  2XDP A;  2GQV A;  4M78 G;  2JOY A;  3NTH A;  2BKD N;  2RHU A;  3OBY A;  5CO7 A;  5GAN 3;  2VGN A;  5GAN 6;  1Q7Y C;  3J7A F;  2CZ6 B;  4M78 F;  4WF2 A;  1N9S A;  3PMT A;  4JLG A;  3OS5 A;  1KHI A;  1O75 A;  2ZPB B;  3JCM f;  4C92 D;  4M7A A;  4PJO B;  4BDY A;  3OYI A;  4KUI A;  2HD0 A;  2K5L A;  4J5Y A;  4ME7 A;  2EYQ A;  4F7U F;  4C92 G;  2RO0 A;  3VUB A;  5LJ3 d;  3ME9 A;  4M75 A;  2ZZD A;  1HXD A;  2KSS A;  2FVU A;  5A0L A;  2EQU A;  2EJG A;  5LJ5 e;  3KUF A;  3M54 A;  2RJC A;  2XK0 A;  2CZ7 B;  3V7S A;  2FB7 A;  3QYH B;  2XD0 A;  2DPP B;  4A4E A;  3PIP A;  2PVD B;  2Y4X A;  2RI3 A;  2RJE A;  3CCU A;  2LT4 A;  5KE2 A;  1VQ7 T;  3G71 A;  4A53 A;  5CKH A;  5LJ3 e;  5LL6 S;  2RA2 A;  1BIA A;  1Y96 A;  2YHT A;  2F5K A;  1M8V A;  4M78 E;  4MDW A;  2V8K A;  2OAU A;  2MAM A;  1DJ7 B;  2H3J A;  4N4H A;  5GMK l;  3J81 E;  1K9M U;  5HK0 A;  2LCC A;  3HKS A;  1N8R U;  3RKX A;  4PJO F;  4M7D B;  5J39 A;  2HQE A;  2DXC A;  2VXE A;  4BI8 B;  2C06 A;  3L2V A;  2ZPI B;  2DD5 A;  3OS2 A;  4C0D C;  4NL3 A;  3L42 A;  3CMA T;  4HT8 A;  1VQ8 T;  5HKC A;  1N8R C;  2L89 A;  3O8V A;  1M90 C;  2GF7 A;  4M75 C;  2QXF A;  1X6O A;  3CPW S;  1WGS A;  1QVF A;  3CC2 A;  2XDD A;  2LX9 A;  4EDU A;  2DKG A;  4LDU A;  3JCM d;  4EMK B;  4IKF A;  2X4J A;  1VQ5 T;  2E12 A;  4BY6 B;  4D6W A;  1VQ9 T;  2EIF A;  2IG0 A;  5GMK j;  3JCM J;  5D6Y A;  4C8Q C;  2ZPE B;  3CBM A;  5A2Q E;  3H8Z A;  2LC4 A;  2RK1 A;  3MEU A;  1VQN T;  1VQ6 A;  5CQY A;  3CD6 A;  4M7D F;  1U1S A;  3JCM P;  2RHI A;  4PJO E;  3BY7 A;  1H3Z A;  1N9R A;  3FIF A;  3OSV A;  2D6F A;  2KDS A;  4BDZ A;  3OA6 A;  4M77 D;  4M78 A;  2KVQ G;  1M5Q 1;  1OYX A;  3KXT A;  3VU3 C;  5DLO A;  3HL8 A;  2JNG A;  1VQL A;  4M77 G;  2DIQ A;  2DEQ A;  2LQK A;  4X9D A;  4XU0 A;  2R5A A;  4II1 A;  5LJ5 j;  2F5T X;  4ZN1 A;  2M9U A;  4F7U A;  3HSB A;  3M58 A;  4N4I A;  4M77 F;  2RI5 A;  3L2R A;  3TU4 K;  3BW1 A;  4OF1 A;  3OYL A;  1BI3 A;  1XNI A;  2QQR A;  2YLC A;  4XTW A;  5J26 A;  3JB9 F;  4MMK A;  3OW2 A;  4M7A D;  3RMS A;  2AHJ B;  4EMG A;  2DXU A;  4M7D E;  3CCJ A;  2XHC A;  3P8D A;  3UPU A;  4M7A G;  2X4Y A;  4M75 D;  2E1H A;  3CCV A;  4DA4 A;  2VXF A;  1VQN A;  3CCS T;  1W2B S;  5GAM f;  3CCE A;  1G3W A;  1K73 C;  2LVM A;  3M57 A;  4M75 G;  4M78 C;  1IZ6 A;  4BUG A;  3M59 A;  1XQH A;  4PJO A;  4PNO A;  5CAI A;  1YHQ A;  2FL7 A;  2X4X A;  1MGQ A;  3QII A;  4J7I A;  1YJW A;  2HBP A;  2O4X B;  4M77 E;  4OGE A;  5LJ5 g;  1JRI A;  1YI2 A;  3VV0 A;  2WAC A;  2DTO A;  3F70 A;  1B34 B;  4JRK A;  3A8O B;  2LT1 A;  5FRO A;  1UGS B;  4B9X A;  3CCM A;  2VGM A;  3CCQ T;  3G4S A;  5IT9 E;  5CKE A;  5GMK i;  5GAN 4;  2JUF A;  3CME T;  1I4K 1;  4J6Y A;  4ZGE B;  2XDB A;  2DXT A;  1BI0 A;  4FM4 B;  1TH7 A;  1ZBX A;  3QG1 A;  3OYJ A;  2RD1 A;  4M7A E;  2PU9 B;  3CBO A;  4Y28 E;  3OMG A;  3CCL A;  3MEW A;  4M7D A;  3QBY A;  4N4G A;  1Y7X A;  3S6W A;  4XQ3 A;  1BI2 A;  4PJO C;  2M16 A;  2GFA A;  4A4G A;  4ELZ C;  2QA4 T;  2Y90 A;  2MWP A;  2DTI A;  2CGH A;  2XKO C;  3FEO A;  3CXC S;  3GPL A;  4ZTJ A;  4J7F A;  5KH6 A;  5GAO m;  4TVR A;  5GAM d;  4RG8 A;  3M5A A;  1Q82 U;  3MEV A;  2L8D A;  4FT4 A;  4EMK A;  1U8R A;  1WQW A;  3M56 A;  4M77 A;  3V7C A;  2ZGW A;  5M9O A;  1Q7Y U;  1M1F A;  1N27 A;  4M78 D;  4R55 A;  1VQO T;  5LJ3 h;  3HPW A;  3UT1 A;  1Y71 A;  4IUT A;  5J3B A;  2RHX A;  2E64 A;  5CCA A;  2F69 A;  5CKB A;  3OYK A;  3A8L B;  5IN1 A;  3SWN B;  2DJZ A;  4FIB A;  2K2V A;  4C5I A;  2OTJ T;  3A5Z B;  1JB0 E;  2LCL A;  3C4S A;  3JRZ A;  3L2U A;  3M4G A;  4QW2 A;  1NPR A;  1VQ7 A;  4F7U G;  2K5I A;  3N5B B;  4XTU A;  3PIO A;  1WJS A;  1M1K C;  3OYY A;  1P92 A;  3MEA A;  1FWZ A;  2K57 A;  1QVF S;  1Q81 C;  4PKC C;  2LNV A;  1X01 A;  4PL6 A;  4KBM B;  5GAN d;  3OB9 A;  4XAX B;  3WXM B;  4EMK C;  4M77 C;  1WPY A;  2RB6 A;  2QTX A;  3OQ5 A;  1JBM A;  3TRE A;  1VQP T;  5IAY A;  3CMA A;  1NE8 A;  2QQS A;  1K8A U;  1VQ8 A;  4PJO D;  1KQ2 A;  3VYG A;  3GP8 A;  3TEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...