4MZMA

Mazf from s. aureus crystal form i, p212121, 2.1 a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
DPIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords mRNA interferase MazF
publication title Structural and biophysical characterization of Staphylococcus aureus SaMazF shows conservation of functional dynamics.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 36
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mzmA00
4ME7A 5DLOA 2C06A 1UB4A 4ELYC 3VUBA 3JRZA 5CKFA 5HKCA 2VUBA 4VUBA 5CKHA 3G7ZA 1M1FA 4HKEA 5CQYA 4MDXA 5CKBA 5CK9A 1X75C 5CR2A 5CCAA 5HK0A 5CQXA 3JSCA 5CO7A 3TCJA 4ELZC 4MZTA 4MZMA 5HK3A 3NFCA 4OF1A 1VUBA 5CKEA 5CKDA 4MZPA 2KMTA 1NE8A 2MF2A 3HPWA
chains in the Genus database with same CATH superfamily
2VGNA 2D8HA 2J6FA 3V7SA 2J06A 5GAOp 4ZGEB 1VA7A 3VUZA 3RMSA 1RACB 4PJLA 4C8QG 2BZXA 3PE0A 3OYLA 2OTLT 1C1AA 1KC8R 1OU9A 2X4YA 1HYOA 1K9AA 2GFUA 3E19A 5CKDA 3RIRA 1RI9A 2ENMA 3A1PA 3MEVA 2P0QA 2MAMA 1QKWA 4XTZA 4RTZA 3MEWA 1K0XA 4LE9A 1YITQ 5HKCA 1TG0A 1AZGB 5M9OA 3MP1A 2EGEA 5I11A 2KVQG 1WHLA 3M0PA 3WVDB 1ZBJA 1W2BP 3G71Q 2KQWA 1M2VA 4QQ6A 1R0CB 5I21A 2EYQA 2IG0A 5KCOA 3MEUA 3V8KA 3EGDB 2L3RA 1PSFA 8ATCB 4OGCA 2LNHB 5GJVB 4CC4B 4JZ4A 3A8LB 3LW5E 1M90R 2D1XA 1NLOC 3JAME 4EMHA 3I55Q 3O5ZA 1ZUKA 2X4XA 1WHJA 2QGFB 1MMAA 3WXMB 4BI8B 2EYYA 5AT1B 2QDLA 1M9SA 4F7UE 1WYXA 2X3WD 1OPLA 4M7AD 1AWXA 2C0IA 2YHTA 2A08A 2LNVA 4MDWA 2KBTA 1PKSA 2V8IA 1TSFA 3NFCA 3CC2A 2DVEA 1B34A 3CCJT 1OU8A 5GMKj 1UTIA 2HL3A 1U5SA 1QW1A 1KSWA 3FEOA 3T9NA 4A4GA 2QDYB 1WI7A 2LTOA 4R55A 2XK0A 4JRKA 1WPYA 1K9MU 2CP6A 2ZPGB 1PD1A 2XMFA 2I0NA 1TUCA 3CCRA 3FJPA 1VQNQ 1KQ2A 3KFVA 4RG2A 1OZ2A 1WNLA 2YRVA 3L1AA 3DLMA 4C8QE 1VQ9T 5IAYA 1IXDA 1BI2A 1WXBA 1YJWT 2RNAA 2FZCB 2DL3A 3CCET 5GAMg 2D9TA 2M0YA 3UA7A 4IUTA 4PJOF 2HSEB 4OB2B 3TSWA 1VQPQ 2E3IA 2MYSA 1RABB 3VRYA 1FX7A 2CP3A 4OMNA 1OZ3A 2MK5A 2RQUA 3FB9A 2YUPA 1OI1A 4F7UA 2DL7A 5A0LA 4R56A 2DLPA 4MZMA 3M0TA 4GBQA 4KGXB 2HBPA 3QZ9B 4KH0B 4OB3B 2C0OA 1K8AU 3M0RA 3CMAQ 4J9EA 5CAIA 4FCYA 2MMPA 4M7DC 4J83A 5GAN6 3CXCP 1BI1A 4J9BA 3CC7A 2FG0A 3X20B 1ZSZA 2GQVA 1H641 3J81E 4PLIA 1DJ7B 5D6YA 1N6AA 2YWWA 5GANg 5DM7R 2EQMA 1BYMA 1NLPC 4L6V5 3I35A 3PMTA 4LDWA 3G4SQ 2DTOA 4C8QA 1Z9ZA 2L2PA 4PJNA 1U3OA 3CQTA 1GRIA 4ORZA 3OYFA 3RERA 2CP7A 1VQ5Q 2F5KA 4M77F 2LJ3A 5FLXE 5GMKl 2DXTA 3QIIA 5HY6A 1SF9A 1S72A 4M78F 1VQ7T 1ZHIA 1Y7XA 2JJ9A 2QASA 3MPUB 4LN2A 2VWFA 2HBWA 1MUZA 1KC8U 2DILA 2HQEA 3M5AA 3CCVT 1AHJB 2NUZA 1Y57A 3S3NA 4EIKA 2MF2A 5DLQE 1SKUB 3L2QA 2LQ8A 3EG1A 4WTOB 3JRZA 1XTDA 4FSSA 3TVTA 2GTJA 1JO8A 5FRMA 2JW4A 3SFMA 3UATA 1LNXA 2HKQB 3RKWA 4HT8A 3S6WA 4XU0A 2CSIA 4X9DA 1QQJA 2YRDA 4FW2A 4LDVA 2DTHA 3S3OA 4RMOA 2KRSA 4O6JA 4JRQA 2OTLA 1KG1A 1X43A 4BI3A 2Y90A 4BY6C 2RHYA 2KEAA 1UGVA 4C8QD 5GAOl 2JTMA 3N5BB 2KDSA 5LJ3j 3EGDA 4IURA 5L23A 2JTFA 4CC2A 2COWA 2VC8A 2KGTA 2MPXC 3OA6A 3KBGA 1AVZC 1SSHA 2BE7D 1YJNQ 3NHNA 1YIJT 2CREA 3TSZA 3CD6Q 2DFUA 1N27A 1TU0B 5KYUA 1D3BB 1AD5A 4Y28E 1ACMB 2ZPFB 2RB6A 3HRSA 3TQ7P 1GXIE 2J7IA 3QKJA 2XDBA 2LZ6B 1Y0MA 1AT1B 2DTIA 1ZLMA 1MNEA 2CGHA 3FDRA 2DRMA 2HQXA 3BW1A 5IN1A 4C92C 2QGGA 1TUDA 2RJEA 4M75D 4J9FA 2V8KA 3JB9H 3CCUT 1G3TA 2DZ9A 3E2UA 1EFNA 2A36A 4M7AC 1I07A 2DEQA 1IGQA 1X6BA 2CZ1B 2YRCA 3RNJA 3LLRA 3RKXA 3HPWA 1D1AA 1ZSGA 1S1NA 2HZYA 3EG3A 1QVFP 3QSUA 2QYZA 5D6WA 2FL7A 2DA9A 2VXFA 1ZUYA 1OULA 3G6EA 1WGSA 4C0FA 2DEUA 4J6WA 3OQ5A 2DO3A 2RN8A 1OX9A 2QA4T 1V1CA 2RI3A 2VKNA 2M9UA 2O31A 3J80E 2C06A 2OJ2A 1UB4A 3WVEB 2DL5A 2HMAA 1YJWA 1V76A 3CCEA 1EZZB 3V7RA 5LJ5d 3C0CA 2IPOB 5LJ3e 2O01E 2JM8A 5A0DA 3VS6A 3VYHB 1X69A 4IUVA 4N0AC 4ZTJA 3ER0A 5KH6A 1VQKT 2QG9B 3VUBA 2LQNA 3X28B 4PJOB 3HTRA 2YUNA 3QHSA 5CKBA 1VQ6T 4GLMA 1QKXA 2RQVA 2HQHA 1QP3A 3A8MB 2JN0A 2JMCA 2LC4A 1QCOA 4OB0B 1QWEA 2RI2A 5IXFA 1BU1A 2A0FB 2E64A 1I5OB 3A5ZB 2JZ2A 3CCLT 2EKOA 2BIVA 3KXTA 2J6OA 3MO8A 2CZ0B 2DMOA 2V1RA 1NZ9A 1R0BG 2RHXA 3C12A 4PJOG 3EFRA 1Q81C 2CT4A 3M0UA 4V2SA 1J3TA 1GFDA 2LX9A 2DETA 4XTXA 3EHRA 2VGMA 1YI2T 3M54A 1K9MR 2OTJA 1T3SA 2EFIA 2EAYA 3M57A 5CO7A 4M77B 3M0QA 1D09B 4EMKB 1O9SA 4OMFB 1M1KC 4PJMA 1CKAA 1PD0A 1RAFB 1P92A 3CCVA 2P0KA 2J6KA 3CC2Q 1JEGA 3JB9F 2M51A 1NBEB 4M7DF 3I56A 1K73C 4XU1A 3J7AF 2AZVA 4Y91A 1YCYA 4DOVA 1KJWA 4JZ3A 3TCJA 1LCKA 1AEYA 2JTEA 1BK2A 3HFOA 1D1BA 3CCRQ 2HEQA 1YBYA 4CC3A 1IREB 4CRIA 4EPCA 4BD3A 4M77G 3QYHB 1WHMA 1ZSZB 5CKHA 2GCXA 3MJXA 3RKYA 4J7FA 4Z02A 3JCMd 3V8LA 3QWYA 2F69A 1M1KR 1E6HA 3UF4A 4ZN1A 4KUIA 1XJWB 4C8QC 1RLPC 4EMGA 2K57A 3SHWA 2YUOA 2RF0A 3LWHA 3HRUA 1K76A 3PVQA 1K73R 2KXDA 5GAN3 4HCKA 2AZSA 2KYMA 4FW1A 3GLXA 4E7SA 2CP2A 1LVKA 3CPWS 1BIBA 4MMKA 2COZA 3JCMb 1E7OA 2VXEA 3LH5A 3FRNA 3G71T 5FROA 3CC7Q 4RCBA 2XDPA 4DBFA 2EGCA 1VQMT 2FRYA 1UE9A 1VYUA 4PJOE 4HVWA 4IIMA 2VUBA 3KUFA 2DL4A 2D0NA 3OSVA 2GNCA 3OYBA 1IGUA 1FYNA 2EJFA 3JSCA 4JRIA 3M56A 4RTVA 3H0IA 2QEXA 2K3BA 4E2FB 4M75B 1XOVA 2M02A 4OMLA 3I55T 4JDSA 3E9GA 3OYGA 1JXMA 2AKLA 1D0ZA 2JVVA 1S72Q 4HKEA 3CPWA 2CUDA 5GAN8 2EQUA 4J6YA 3CCQA 1OYXA 3BDUA 4WF2A 3NTIA 2K3YA 1QCFA 3NTKA 2P0PA 1UFFA 1UJ0A 5GAN7 2XICA 3PFSA 1NG2A 2WACA 2ATCB 1D1CA 5A2QE 1X2KA 5DY9A 4HCBA 1H3HA 1VIEA 2QA4A 2F1LA 2MCNA 2DZCA 3R6NA 1E6GA 4M77E 3P8DA 4M75G 4PJOA 4A4KA 4QVZA 2DD4A 2ESWA 2SEMA 5LJ5g 1NPPA 4RTWA 1EX4A 1YFNA 3CBOA 3OYCA 4J7IA 2K79A 1ARKA 1CKBA 5KYUB 2JNGA 2OTLQ 4C92F 1WX6A 2HDAA 1VQPT 2FPEA 5IHNA 2ZPHB 1ZX6A 3C4SA 3ASKA 1I0CA 1ZBXA 5CKEA 2O88A 4QQGA 5LL6S 4F17A 3UPUA 2FPDA 3MCAB 4ZGJB 4PKCC 3IQLA 1H3ZA 2K6DA 3CMAT 3H6ZA 2A37A 4D8DA 3JCMX 1SRLA 4E7KA 2ZPIB 3M59A 3RMQA 4J5YA 4HCCA 1YP5A 2K4YA 4C5EA 4EDUA 2F2XA 1UDLA 1BKBA 4M77A 4EMKA 2E1HA 1G8XA 6AT1B 1HJDA 5I22A 3RDVA 1WJQA 1VYVA 3UT1A 3G7ZA 3QO3A 4OGEA 4A4FA 1X75C 4E7HA 2NYSA 2DNUA 2NUPB 4PK4A 4FU6A 4PJOD 1Q95G 4J9HA 2IVWA 3E9FA 3CBPA 3D7SB 3LH0A 1W4SA 4RTXA 1H8KA 2PVDB 3A8HB 5FW9A 2F2WA 2YSQA 2DXUA 2LX7A 2LP5A 1M1KU 2QI2A 2E5QA 1M2OA 2LMJA 3OMGA 3CC4A 1JJ2P 2GBQA 2P4RA 5GAOr 4JPBW 2A28A 2R58A 1NYGA 4M75E 4QVDA 3G6EQ 2RD1A 3L2ZA 1K73U 2LCCA 1RLQC 1QCNA 1RAGB 2FB7A 1PSEA 2Y4YA 5CIUA 1YJ9T 1VQ4T 3VS2A 2NLUA 4OMMA 4IKFA 1WQWA 5CQYA 3DB4A 5HK0A 4Z88A 5C6SA 1Y71A 1YJWQ 5GMKm 5GMKi 3CCEQ 3JCMg 1NM7A 1M30A 3QPHA 5IT9E 1RUWA 1M8VA 3R6OA 1M3CA 4O5VA 4M77D 1ZA2B 2W0ZA 2JS2A 2RJFA 4CI0C 2K2VA 1JJ2S 5KE3A 2CYZB 3H9NA 2H3JA 1M1GA 1WDXA 1I81A 4M78D 4ZNXA 4E7LA 1GCPA 1SG5A 1I4K1 3JB9G 3ZFJA 4LUEA 4M7DG 4FT4A 5I2SA 4AG1C 1U1TA 5GAMj 1KHIA 3C94A 4M75A 2FVUA 1M1FA 1YJNT 2KE9A 1VQMA 3SWNA 2DIGA 4C0DB 8AT1B 3CD6T 1WHGA 2DAQA 2JS0A 4PJJA 3HKSA 3REBB 2G6FX 1UG1A 5D6XA 5GAMf 3EH1A 3VKIA 2AKKA 5GAN5 1IHVA 1JJ2A 2FHDA 2CDTA 2EJGA 1I1JA 5GAOm 1BBZA 3PVLA 1TS9A 3X25B 4C8QF 2OTJQ 1VQOT 1TTHB 1AWJA 2OAWA 3LX7A 3MP6A 4BDZA 3PNWC 1BI3A 5GANj 2EWNA 2QAZA 4LNPA 2RJDA 2RM4A 4RTUA 3CCST 1Q7YC 2KRNA 2E4HA 3CCVQ 1K0SA 4ZN3A 3X26B 2D0QB 5GMKh 2RA2A 3INZA 3P8HA 3I56Q 3TU4K 5GANf 1MMGA 2IIMA 4BI4A 1M5Q1 1WQ7A 4FT2A 2K9GA 1D0XA 1N9SA 1BB9A 2R5MA 1TWBA 2L3SA 1T3LA 1HXDA 1X6OA 2DJZA 4LDXA 1ABQA 2RH2A 1M4ZA 1WA7A 5J39A 4IUPA 1FMKA 3LGLA 2CP5A 4PLLA 1ZA1B 1WLPB 1YN8A 2B86A 3CPFA 1Q86C 2MWPA 4L5GA 5IHIA 1OQKA 5FWCA 1FXXA 4JJCA 2ABLA 2E6NA 2GQIA 5GAMe 3JCMW 1YWPA 1LOJA 1WXTA 3FJ5A 2ECZA 3CCJA 4M7DE 1WXUA 5AYFA 5CR2A 3L2UA 5LJ5h 4XK8E 1GL5A 3GOXA 1UEBA 4JUVA 1G3WA 4OB1B 3VS7A 1JXOA 3M0SA 3NGPA 3QDRB 5GAN4 2GFAA 3M4YA 4NOYA 4QKUA 3CCMT 2EGAA 4LD9K 2NUPA 1B7TA 2W10A 5L8RE 2CS7A 5FU7B 2XG8D 4FYVB 1VQ9A 2DL8A 3A8GB 4F16A 1I5LA 1KK7A 1C0MA 4IUQA 1GCQA 4A4EA 4XAXB 3VS3A 3HSBA 1M27C 2ZAEA 4D6WA 4AT1B 4BACA 4HT9A 5GANe 1VYTA 2QEXQ 3M53A 4J9DA 1IRXA 4PJOC 1ZUUA 2Z0WA 1MHNA 2CH4W 2XKOC 2EYZA 4C0ZA 2ED0A 3CMET 1QWFA 1YHQT 3CBMA 3CCQQ 2RHUA 4M7DA 1PKTA 3URGA 3E1SA 4FIBA 1UGRB 3QUIA 4UC4A 2EQKA 3A98A 3EHQA 4AFUC 4BE0A 1VQ8T 2DXCA 1G3SA 3CC2T 1VQLT 1YJ9A 3OYMA 1VQ4A 1UGPB 2QA4Q 2DRKA 5KYWB 2OI3A 2LJ0A 1VIFA 2KROA 3CCRT 4ZTFA 1ZQ1A 1VOMA 3EG9B 3JCMc 2BZYA 2FRWA 2KSSA 4NL2A 2BKDN 4M77C 1QVGP 1VQ7A 2F2VA 4EMKC 1N8RC 2EBPA 5A0GA 3QG1A 2LT4A 1NJIC 3Q1JA 3I5SA 3OB9A 2YUQA 1H92A 2PNIA 1NPRA 4M78B 2GGRA 5LJ3h 1PC0A 1UJYA 1IZ6A 2QQSA 4JLGA 2JM9A 3JCMh 3MEAA 1Y96A 2V1QA 2L3PA 1KQ1A 2DE0X 4E7IA 3JB9D 1MMDA 3S3MA 1Q81R 3CPWP 1UGQB 4AMCA 3NPFA 4M7DD 5KCHA 1BCOA 1RI0A 1NE8A 2DVJA 5D7UA 2KNBB 2K5IA 2BZ8A 5LJ3d 1ZSZC 2VV5A 1QVGS 1MNDA 4A54A 4RTYA 4RCCA 3QZ5B 4XTYA 1G2BA 3PT9A 4J9CA 2XIDA 2PUKB 2RK1A 2HD0A 3PIOA 3OYNA 1UHCA 3GPLA 2EYWA 3META 4JJBA 3THKA 3EGUA 3ZBDA 4M78G 1NJIR 1G5VA 3ULRB 4DQ2A 3AHUA 3EFSA 2LQWA 4HA8A 1MV0B 1VQOA 2HNIA 2KI7A 2LRQA 1NEBA 2R5AA 3M55A 2DXBA 1YITT 3H41A 4YTLA 1YIJA 3CCSA 5KE2A 2K5LA 3CC4Q 1YNZA 3FIFA 3H0HA 1SSFA 5FU6B 2XU8A 4J9IA 2DM1A 1Q7YU 1UECA 2RI5A 4HXJA 4LDUA 1RL2A 3OS2A 1QVGA 1KFZA 3X24B 2AK5A 3V7CA 1NYFA 5GAOn 2L8DA 3DB3A 2AHJB 4J9GA 4M4ZA 5CQXA 1M8MA 2O4XB 4M75C 3JCMP 3CCUA 4PNOA 4ME7A 3SWNB 2KT1A 2ROTA 4NS5A 4XU2A 1Q82C 2QQAA 2YT6A 1Q86U 4DBRA 1JQQA 4KGVB 2K7AA 3GF5A 3FLGA 4KULA 4C5HA 4DBQA 1M90C 1BCMA 1X27A 3HL8A 2MI6A 4HVVA 1TOVA 2DD5A 4BDYA 1M3AA 2K5FA 3HHTB 2H3EB 1R8OB 3CCMA 2P84A 2LJ1A 2CT3A 3U23A 5IH2A 1VQMQ 3TEEA 2RMOA 3PMIA 2HKNA 4A53A 2EIFA 1VQNT 2FZGB 2QTXA 2VVKA 4X1VA 2RK2A 2EQIA 4M78E 3VV0A 2O2OA 7AT1B 3LGFA 4LXCA 3OYKA 2E65A 1Q82R 2QQBA 3VS5A 4N0AA 5FRNA 3OYYA 2YDLA 4FYWB 1VQKA 4M7AF 4RUGA 3UWNA 2K2MA 4II1A 3VJPA 1KD1C 1VQ6A 3CMEA 2YLBA 4B6MA 4F14A 3OYEA 4KUDK 4C92D 1G3YA 1YHQA 2I2LA 1OV3A 3L2RA 4BE1A 2ZPEB 4Y92A 5KYWA 2LCLA 1W2BS 2MWOA 1HK9A 2L89A 4RG8A 3OS5A 3EG9A 4PFOA 1W70A 1QMCA 1O75A 1VQ8A 4KRTA 4RKUE 2COYA 1LJOA 1VQLA 2RQTA 3CCLA 2DJQA 5IHKA 2E6ZA 2FYKA 4AG2C 3M4GA 4DEXA 5KYYA 4AFQC 3G6ET 3VS4A 3I9QA 2AT1B 1D0YA 3G4ST 4M78A 4HVUA 3C95A 2D6FA 4QW2A 1KD1R 3GIBA 2KXCA 3UA6A 5CVIA 1Q81U 3F70A 1VQ5T 2NUTB 3MP8A 5KYXA 4B9WA 1YI2A 3OW2P 4NL3A 3DLLA 1MMNA 4D8KA 1GCQC 3OYHA 1W2BA 3LYIA 1N9RA 1N8RU 2YLCA 2H8HA 2CZ7B 2CH4A 3AT1B 2X9HA 3CCJQ 1NJIU 3OSSC 4HCZA 3QDFA 4KT0E 2DF6A 4DOWA 3QWXX 4X9CA 3ZEHA 2KAFA 5LJ5j 1F1BB 3EFOB 1JB0E 2A7YA 3OYJA 4PFPA 3UDCA 4TVRA 2JMAA 4M7DB 2J05A 5LJ3g 1Y07A 2O9SA 5LJ5f 3OW2S 2HL5C 4MZTA 4N4HA 1VQ9Q 3TREA 3HP9A 3QXEB 3LWIA 3JCMV 4FSXA 2ZCFB 2ROLA 2Y4XA 2DX1A 4OVAA 3OS1A 2XD0A 2PQWA 2AIRB 1OEBA 2DYIA 3P8BB 3NTHA 3BY7A 2DPPB 3VRZA 3SB2A 5ECAA 2PZ1A 4A63B 2FZKB 1SRMA 1TXQA 1HD3A 3I5RA 4AFZC 2VB6A 3M9QA 2QXFA 2X3XD 4PL6A 5EC7A 5J26A 1YITA 5GMKe 3HFNA 3EG0A 2OTJT 1IB8A 3CXCS 1NEGA 4Z8AA 4Z89A 2QK0A 4F7UF 4ESRA 2P4TA 2O4XA 3G71A 3GBQA 4R0KA 1B07A 2FPFA 4C0DC 3OW2A 2CSQA 2L5QA 1WZOA 2LT1A 2KT8A 2RQRA 3BDLA 1YJ9Q 3I56T 4JS5A 1VQ4Q 3RBBB 1T0HA 1JU5C 3SEMA 3JB9J 2MIOA 1W1FA 2DKGA 4L59A 2L3QA 2JXBA 1IHWA 2LDMA 1PWTA 3EGXB 1Y96B 2X51A 3V8JA 1FMWA 2DIQA 2EKHA 3I55A 1U1SA 2GF7A 2E12A 1TH7A 1Z9QA 4ANJA 1X01A 1VQ7Q 4BUGA 4Q5WA 1YCSB 1OX8A 2ZGWA 3PIPA 3CXCA 5LJ5e 3BE3A 5GAN2 3RUXA 1RAAB 1Q82U 1BIAA 2KRMA 2LCSA 4BY6B 1U06A 1KIKA 1M90U 3HRTA 1WIEA 2V26A 4KBMB 2PVGB 1W6XA 3FC3A 1V29B 1CSKA 2MOXA 1U8RA 1R77A 3VYGA 4IIOA 1ABOA 5GAOq 3L2VA 2QTVA 4XQ3A 3GNFB 1QP2A 1AWWA 4GY5A 2LQKA 1VQNA 5LJ3f 4DBHA 2RHZA 1T0JA 1WJRA 2B8AA 1K4US 3JCMf 4ELZC 4JRPA 4LDYA 1MV3A 4M75F 4P5NA 4PFZA 1VQPA 4C5IA 1Q7YR 1LPLA 3OYDA 4B9XA 4ELYC 3QBYA 3NMZC 3OBWA 4ZGDB 5EG2A 2QEXT 2JUFA 1TUGB 1AZEA 4JJDA 4C92B 1VQOQ 1KD1U 2V8JA 2K3XA 4F04B 4DEYA 4M7AB 1GBQA 4C5GA 1PNJA 1G83A 3OS0A 3MHXA 3CMAA 1RADB 2RQWA 2NWMA 3GP8A 2BE9B 3CCQT 1N5ZA 4E7ZA 1YIJQ 3CCSQ 4N4IA 1GBRA 3EH2A 4XTWA 1IO6A 2M16A 5FU7C 5DLOA 2ZPBB 2NUTA 4BE2A 1MGQA 2PU9B 2X4JA 4RTTA 4MDXA 1WHKA 1GFCA 1OPKA 2EJ9A 3L42A 4K11A 1B3QA 2KR3A 2G3RA 1WJSA 5HCKA 2VYTA 4JLIA 1AOJA 3GNGA 4QT7A 5GJWB 1Q86R 2WSCE 1X2QA 3G4SA 2CKKA 1JRIA 2JT4A 4C92G 2M0OA 1VQ5A 4OMOA 4WCIA 2RO0A 4XTVA 3CCUQ 2X35A 4KH1B 2RHIA 4M7AG 2CUBA 2KK4A 2SRCA 2E70A 3EFOA 1M2VB 4LUDA 2WSEE 2XDDA 1KQSP 2WSFE 2BTTA 2OAUA 2C0TA 2KY9A 1FMVA 3M58A 3OYAA 2LVMA 3JCMe 2QQ9A 3VS0A 1QVFS 1SHFA 3RESA 1I8FA 4ATOA 2BUDA 1M3BA 1PM3A 2EPDA 2ZZDA 3L2WA 1SEMA 3A8OB 5FWBA 4FYYB 1K9MC 2JOYA 3CCMQ 3VU3C 5GAMh 1OOTA 4IUUA 4N4GA 1PHTA 4FM4B 4J6XA 5KYNA 1QLYA 4OMQA 4E7JA 1KQSS 4A4HA 4X34A 5C0MA 2E5KA 4LD6A 5CK9A 4BB7A 1B34B 3PTAA 1WHHA 3G1JA 3RR6A 1RAHB 4OP0A 2RPNA 1X6GA 2X4WA 1HSQA 2OX7A 2HSPA 5GAMd 4MMLA 5J3BA 3OYIA 5KYYB 4OF1A 1QVFA 3QYGB 1VQKQ 1SPKA 1XNIA 2KMTA 2DYBA 4XTUA 3O8VA 4M78C 3H0FA 2CP0A 4J8OA 9ATCB 3CMEQ 2O9VA 1VQ6Q 2PVOB 1YWOA 2F5TX 1YHQQ 3DKMA 1K8AC 3ME9A 2DERA 1FWZA 5KYXB 1PG5B 5GANh 4OMPA 1RAEB 1UUEA 2E10A 1PRMC 3EGXA 3OMCA 1K1ZA 2XI9A 5HK3A 1BI0A 2R57A 2D8JA 3JCMQ 1YJNA 4GLKA 1VQ8Q 2FEIA 3REAB 1VUBA 1XQHA 3JV3A 3VS1A 1PRLC 3CD6A 3CC4T 2E41A 1VQLQ 1KQSA 3CC7T 3ZL7C 3OY9A 4F7UB 3CCLQ 3OBYA 3EG2A 4C0GA 1SHGA 3BFMA 4C92E 1N8RR 4E6RA 5GANd 2DBKA 4FL6A 1UHFA 1EIFA 5IXBA 2CZ6B 2DBMA 2EQJA 4M7AE 3QJ6A 4MZPA 1WFWA 3JCMJ 2M1HA 3PGGA 2EW3A 4DA4A 4JJNK 1YI2Q 1K8AR 4FYXB 2KYBA 1QVPA 4XU3A 3EAEA 4QVCA 2E3HA 2HCKA 3QJYA 2PTKA 4AFSC 1S72T 2XHCA 2RJCA 3JB9I 2GTOA 1A0NB 1RAIB 5FU6C 1KC8C 2L0AA 1D3BA 4F7UG 2HAXA 1JBMA 2EVRA 2VASA 4C8QB 4E47A 4CC7A 4QQDA 1C6VX 4JS4A 2YXYA 3H8ZA 3SDZA 2EYXA 4KGZB 2PUOB 5I2MA 5CKFA 4VUBA 2ED1A 2FO0A 1AWOA 5CCAA 3CEYA 2A3LA 1UGSB 3MKDA 4C92A 3SD4A 2DK3A 1KHCA 2QQRA 3SWNC 1PCXA 4M7AA
chains in the Genus database with same CATH topology
3OYHA 2VGNA 1W2BA 2E64A 3LYIA 2RJDA 1N9RA 2RM4A 3CCST 1N8RU 1Q7YC 3V7SA 2YLCA 3A5ZB 5GAOp 4ZGEB 2JZ2A 3VUZA 3CCLT 2CZ7B 3RMSA 4ZN3A 3G71T 2EKOA 3X26B 2BIVA 4C8QG 3KXTA 2D0QB 5GMKh 2RA2A 3OYLA 3INZA 3P8HA 2OTLT 3TU4K 5GANf 1NJIU 2X4YA 3OSSC 3MO8A 4HCZA 4KT0E 2CZ0B 4DOWA 2GFUA 4X9CA 1NZ9A 2RHXA 3E19A 3C12A 4BI4A 1M5Q1 1WQ7A 2KAFA 4FT2A 4PJOG 3EFRA 3ZEHA 5CKDA 5LJ5j 1Q81C 1N9SA 3RIRA 4V2SA 3MEVA 2P0QA 2MAMA 2R5MA 2LX9A 1HXDA 4XTZA 4XTXA 3MEWA 1JB0E 1X6OA 2A7YA 2DJZA 3OYJA 5HKCA 3UDCA 4TVRA 4LDXA 2VGMA 2RH2A 3MP1A 5M9OA 1M4ZA 1YI2T 3M54A 4M7DB 2OTJA 2KVQG 5J39A 2EFIA 4IUPA 2EAYA 3M57A 5LJ3g 3LGLA 5CO7A 1Y07A 3WVDB 4M77B 5LJ5f 3OW2S 4PLLA 4MZTA 4N4HA 4EMKB 1O9SA 3TREA 3HP9A 3QXEB 4OMFB 3LWIA 1M1KC 3JCMV 4FSXA 3CPFA 2KQWA 2ZCFB 4QQ6A 2Y4XA 1Q86C 5I21A 2EYQA 2MWPA 4L5GA 2IG0A 1P92A 4OVAA 3OS1A 3CCVA 2P0KA 5KCOA 1FXXA 2XD0A 2PQWA 3MEUA 2E6NA 3JB9F 3P8BB 3V8KA 3NTHA 5GAMe 1LOJA 3BY7A 3JCMW 4M7DF 2L3RA 3I56A 3CCJA 1K73C 1PSFA 2DPPB 4XU1A 3J7AF 4M7DE 1W2BS 4OGCA 3SB2A 4Y91A 1YCYA 5AYFA 5CR2A 4DOVA 3L2UA 3TCJA 5LJ5h 3A8LB 4XK8E 3LW5E 3GOXA 1UEBA 4JUVA 3M9QA 1G3WA 3HFOA 4OB1B 3JAME 4EMHA 2QXFA 3QDRB 5GAN4 1YBYA 2GFAA 3M4YA 4PL6A 5J26A 2X4XA 4NOYA 3CCMT 5GMKe 3HFNA 1YITA 4LD9K 2OTJT 3WXMB 1IREB 4CRIA 4EPCA 3CXCS 4BI8B 4F7UF 1M9SA 2P4TA 4F7UE 5L8RE 4BD3A 2CS7A 2O4XA 4M77G 5FU7B 2XG8D 3QYHB 4M7AD 3G71A 1VQ9A 5CKHA 2GCXA 3A8GB 1I5LA 3RKYA 4J7FA 4Z02A 4C0DC 3JCMd 2YHTA 3V8LA 3OW2A 2LNVA 2L5QA 4IUQA 4MDWA 2F69A 2LT1A 4A4EA 4XAXB 4ZN1A 2V8IA 3NFCA 4KUIA 4C8QC 4EMGA 3CC2A 3HSBA 2K57A 3BDLA 2DVEA 1B34A 3I56T 4D6WA 3CCJT 4JS5A 5GMKj 4BACA 1QW1A 3LWHA 4HT9A 3HRUA 3FEOA 5GANe 3T9NA 4A4GA 3JB9J 2QDYB 3M53A 2LTOA 4R55A 2DKGA 2XK0A 4L59A 4PJOC 5GAN3 4JRKA 1WPYA 1MHNA 2LDMA 1K9MU 2XKOC 3GLXA 2ZPGB 4C0ZA 1Y96B 3V8JA 3CMET 2DIQA 3CPWS 3FJPA 3CCRA 1BIBA 3I55A 1U1SA 2GF7A 4MMKA 1KQ2A 1YHQT 4RG2A 3CBMA 2E12A 3JCMb 1OZ2A 1WNLA 1TH7A 2RHUA 2YRVA 4M7DA 1X01A 3L1AA 2VXEA 3FRNA 3DLMA 3URGA 4BUGA 4Q5WA 3E1SA 4C8QE 4FIBA 5FROA 1UGRB 5IAYA 3QUIA 1BI2A 4RCBA 2ZGWA 4UC4A 2XDPA 3PIPA 3CXCA 2EQKA 5LJ5e 1YJWT 1VQMT 3CCET 5GAMg 2D9TA 5GAN2 3RUXA 4BE0A 1VQ8T 4IUTA 4PJOF 1Q82U 4OB2B 4PJOE 2DXCA 1G3SA 1BIAA 2VUBA 3KUFA 3CC2T 4BY6B 1FX7A 1VQLT 3OSVA 1OZ3A 3HRTA 1M90U 1YJ9A 3OYBA 3OYMA 2EJFA 3FB9A 1OI1A 3JSCA 4KBMB 2PVGB 1UGPB 4F7UA 5A0LA 4JRIA 4R56A 1VQ4A 3M56A 3FC3A 1V29B 4MZMA 2QEXA 2HBPA 3QZ9B 1U8RA 1VIFA 4OB3B 4M75B 3VYGA 1XOVA 5GAOq 3CCRT 4ZTFA 1ZQ1A 3I55T 3L2VA 1K8AU 4JDSA 4XQ3A 3JCMc 3E9GA 3GNFB 1QP2A 5CAIA 3OYGA 2KSSA 4GY5A 2LQKA 1VQNA 5LJ3f 2MMPA 2BKDN 4NL2A 4M7DC 4J83A 2JVVA 4HKEA 3CPWA 5GAN6 5GAN8 2EQUA 4J6YA 3CCQA 2RHZA 1BI1A 1WJRA 2B8AA 4M77C 1VQ7A 1OYXA 3BDUA 4EMKC 1N8RC 3JCMf 3CC7A 4WF2A 3NTIA 4ELZC 3X20B 2K3YA 4JRPA 2GQVA 1H641 3NTKA 5A0GA 3J81E 4PLIA 4LDYA 2P0PA 1DJ7B 5D6YA 1N6AA 4M75F 5GANg 5GAN7 3QG1A 5DM7R 2EQMA 2LT4A 2XICA 3PFSA 4P5NA 1BYMA 1VQPA 1NJIC 2WACA 3Q1JA 5A2QE 4L6V5 3OB9A 3PMTA 4C5IA 4LDWA 1NPRA 5DY9A 4HCBA 4M78B 3OYDA 4B9XA 4ELYC 2DTOA 1VIEA 3OBWA 3QBYA 4C8QA 5LJ3h 4ZGDB 5EG2A 2QEXT 2JUFA 2QA4A 2DZCA 1IZ6A 3OYFA 2QQSA 3RERA 4JLGA 4C92B 1KD1U 2V8JA 2F5KA 4M77F 3JCMh 4M77E 3P8DA 2K3XA 3MEAA 4M75G 4PJOA 4A4KA 4QVZA 5FLXE 1Y96A 5GMKl 1KQ1A 2DXTA 3QIIA 2DD4A 4E7IA 4M7AB 5HY6A 4C5GA 3JB9D 5LJ5g 1NPPA 3S3MA 3OS0A 1UGQB 3MHXA 3CMAA 3GP8A 4M7DD 5KCHA 3CCQT 3CBOA 1RI0A 4N4IA 3OYCA 1NE8A 4J7IA 1S72A 4M78F 4XTWA 1VQ7T 1ZHIA 1Y7XA 5FU7C 2M16A 5DLOA 2K5IA 2ZPBB 4BE2A 2JNGA 5LJ3d 1QVGS 2VV5A 1MGQA 2PU9B 2X4JA 4C92F 4A54A 4MDXA 4RCCA 3QZ5B 4XTYA 1KC8U 1VQPT 3PT9A 2HQEA 2XIDA 2PUKB 2EJ9A 3M5AA 3L42A 2RK1A 2ZPHB 3CCVT 2HD0A 2G3RA 1AHJB 1WJSA 2VYTA 4JLIA 3PIOA 3OYNA 3GNGA 3GPLA 3ZBDA 3META 3C4SA 4M78G 3ASKA 1G5VA 2WSCE 1ZBXA 3G4SA 3S3NA 5CKEA 2CKKA 4DQ2A 3AHUA 3EFSA 1JRIA 4HA8A 2MF2A 5DLQE 2M0OA 4QQGA 4C92G 5LL6S 3UPUA 3L2QA 2LQ8A 1VQOA 3MCAB 1VQ5A 2HNIA 4ZGJB 3JRZA 2RO0A 4PKCC 1XTDA 4XTVA 2LRQA 2X35A 1H3ZA 2R5AA 2RHIA 4M7AG 2KK4A 3CMAT 2E70A 3H6ZA 3JCMX 5FRMA 3M55A 2DXBA 2WSEE 1YITT 2XDDA 3SFMA 2WSFE 4E7KA 2ZPIB 3M59A 3RMQA 4J5YA 1LNXA 4HCCA 4YTLA 3RKWA 1YIJA 4HT8A 3S6WA 2OAUA 4XU0A 2KY9A 5KE2A 4X9DA 3CCSA 2K4YA 4C5EA 3M58A 3OYAA 2K5LA 3FIFA 1SSFA 4EDUA 5FU6B 1BKBA 2LVMA 2XU8A 4LDVA 2DTHA 2QQ9A 4M77A 3JCMe 3S3OA 4RMOA 4JRQA 4O6JA 4EMKA 1VQ9T 1Q7YU 2OTLA 1QVFS 3RESA 1KG1A 1I8FA 4ATOA 2BUDA 2RI5A 2E1HA 1RL2A 4LDUA 3OS2A 1QVGA 4BI3A 2Y90A 2ZZDA 3V7CA 3X24B 2RHYA 4BY6C 5GAOn 3L2WA 1WJQA 2L8DA 3UT1A 3DB3A 3G7ZA 3QO3A 4OGEA 4A4FA 3A8OB 2AHJB 4C8QD 1X75C 2JTMA 5GAOl 4E7HA 5CQXA 3N5BB 1K9MC 2JOYA 2KDSA 5LJ3j 4IURA 2JTFA 3VU3C 4FU6A 2VC8A 5GAMh 4PJOD 2O4XB 4M75C 2IVWA 3E9FA 4IUUA 4N4GA 3JCMP 3CBPA 4FM4B 4J6XA 3CCUA 3OA6A 3LH0A 4PNOA 1W4SA 3KBGA 4ME7A 3SWNB 1YIJT 2PVDB 3A8HB 4E7JA 1KQSS 4A4HA 4X34A 5C0MA 4NS5A 4LD6A 2DXUA 4XU2A 5CK9A 1N27A 1M1KU 4BB7A 2QI2A 1B34B 2E5QA 1D3BB 2QQAA 3OMGA 3PTAA 1Q82C 4OP0A 4Y28E 3CC4A 1Q86U 2ZPFB 2X4WA 2RB6A 3GF5A 3FLGA 3HRSA 4KULA 4C5HA 4MMLA 5J3BA 5GAMd 3OYIA 1M90C 1GXIE 4OF1A 5GAOr 3HL8A 1QVFA 3QKJA 3QYGB 2R58A 4QVDA 2MI6A 4M75E 1XNIA 2KMTA 2XDBA 2RD1A 2DD5A 3L2ZA 4XTUA 2LCCA 4BDYA 1K73U 3O8VA 2K5FA 2DTIA 3HHTB 2FB7A 4M78C 2Y4YA 1PSEA 5CIUA 1YJ9T 4J8OA 1VQ4T 2CGHA 2NLUA 2PVOB 4IKFA 3FDRA 2HQXA 1R8OB 3CCMA 2F5TX 3BW1A 5IN1A 1WQWA 4C92C 3DKMA 1K8AC 5CQYA 3ME9A 2RJEA 1FWZA 4M75D 3DB4A 2V8KA 5HK0A 3JB9H 5C6SA 3CCUT 1G3TA 2DZ9A 1Y71A 5GANh 4M7AC 2E10A 5GMKm 5GMKi 3OMCA 2DEQA 2XI9A 3TEEA 5HK3A 1BI0A 3JCMg 2CZ1B 2R57A 3PMIA 4A53A 3JCMQ 2EIFA 4GLKA 3QPHA 1YJNA 1VQNT 1VUBA 1XQHA 3LLRA 5IT9E 3RKXA 2QTXA 1M8VA 3R6OA 3CD6A 3CC4T 4O5VA 2RK2A 2E41A 3HPWA 4M77D 1KQSA 4M78E 3VV0A 3CC7T 3OY9A 4F7UB 2RJFA 3OBYA 4CI0C 2K2VA 3LGFA 3OYKA 3QSUA 2E65A 2QQBA 1JJ2S 4C0GA 5KE3A 4N0AA 2CYZB 3BFMA 4C92E 5D6WA 2FL7A 2VXFA 5GANd 5FRNA 3OYYA 4FL6A 1EIFA 2H3JA 1VQKA 1M1GA 1I81A 4M78D 3G6EA 4M7AF 4E7LA 1WGSA 2CZ6B 2EQJA 4C0FA 4M7AE 4J6WA 3UWNA 4II1A 3VJPA 1KD1C 3OQ5A 3QJ6A 2DO3A 3JB9G 3CMEA 1I4K1 2YLBA 3OYEA 1VQ6A 4KUDK 3ZFJA 4MZPA 4C92D 2QA4T 2RI3A 1G3YA 2M1HA 3JCMJ 1YHQA 4M7DG 2M9UA 2I2LA 3L2RA 4FT4A 2ZPEB 5I2SA 3J80E 4BE1A 3PGGA 1U1TA 2C06A 5GAMj 4DA4A 4JJNK 1UB4A 2LCLA 3WVEB 1KHIA 1QVPA 2MWOA 1HK9A 2L89A 3C94A 4M75A 2FVUA 4RG8A 1M1FA 1YJWA 4XU3A 1YJNT 3CCEA 3OS5A 1VQMA 3EAEA 3V7RA 4QVCA 3SWNA 5LJ5d 2DIGA 4C0DB 1VQ8A 1O75A 3QJYA 3CD6T 1S72T 2XHCA 2DAQA 2RJCA 3HKSA 5LJ3e 4RKUE 3JB9I 2O01E 1LJOA 5A0DA 5FU6C 1KC8C 1VQLA 1D3BA 4F7UG 5D6XA 1JBMA 5GAMf 4C8QB 2HAXA 4E47A 3CCLA 3VYHB 4QQDA 2E6ZA 4IUVA 4N0AC 4JS4A 3ER0A 3H8ZA 2FYKA 5KH6A 4ZTJA 3VKIA 3M4GA 3SDZA 5GAN5 2PUOB 1VQKT 5I2MA 3G6ET 3VUBA 5CKFA 3X28B 1JJ2A 4PJOB 4VUBA 2FHDA 2EJGA 3QHSA 5CKBA 1VQ6T 5GAOm 5CCAA 3CEYA 3G4ST 4M78A 3X25B 1QP3A 2A3LA 3C95A 4QW2A 3A8MB 2D6FA 3GIBA 2JN0A 1UGSB 1Q81U 5CVIA 2LC4A 4C8QF 1VQOT 3F70A 1VQ5T 3MP8A 3LX7A 3MP6A 4OB0B 4C92A 4BDZA 3SD4A 4B9WA 1YI2A 3PNWC 2DK3A 1BI3A 1KHCA 5GANj 4NL3A 3DLLA 2EWNA 2QQRA 3SWNC 2RI2A 4M7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME7 A;  5DLO A;  2C06 A;  1UB4 A;  4ELY C;  3VUB A;  3JRZ A;  5CKF A;  5HKC A;  2VUB A;  4VUB A;  5CKH A;  3G7Z A;  1M1F A;  4HKE A;  5CQY A;  4MDX A;  5CKB A;  5CK9 A;  1X75 C;  5CR2 A;  5CCA A;  5HK0 A;  5CQX A;  3JSC A;  5CO7 A;  3TCJ A;  4ELZ C;  4MZT A;  4MZM A;  5HK3 A;  3NFC A;  4OF1 A;  1VUB A;  5CKE A;  5CKD A;  4MZP A;  2KMT A;  1NE8 A;  2MF2 A;  3HPW A; 
#chains in the Genus database with same CATH topology
 2VGN A;  2D8H A;  2J6F A;  3V7S A;  2J06 A;  5GAO p;  4ZGE B;  1VA7 A;  3VUZ A;  3RMS A;  1RAC B;  4PJL A;  4C8Q G;  2BZX A;  3PE0 A;  3OYL A;  2OTL T;  1C1A A;  1KC8 R;  1OU9 A;  2X4Y A;  1HYO A;  1K9A A;  2GFU A;  3E19 A;  5CKD A;  3RIR A;  1RI9 A;  2ENM A;  3A1P A;  3MEV A;  2P0Q A;  2MAM A;  1QKW A;  4XTZ A;  4RTZ A;  3MEW A;  1K0X A;  4LE9 A;  1YIT Q;  5HKC A;  1TG0 A;  1AZG B;  5M9O A;  3MP1 A;  2EGE A;  5I11 A;  2KVQ G;  1WHL A;  3M0P A;  3WVD B;  1ZBJ A;  1W2B P;  3G71 Q;  2KQW A;  1M2V A;  4QQ6 A;  1R0C B;  5I21 A;  2EYQ A;  2IG0 A;  5KCO A;  3MEU A;  3V8K A;  3EGD B;  2L3R A;  1PSF A;  8ATC B;  4OGC A;  2LNH B;  5GJV B;  4CC4 B;  4JZ4 A;  3A8L B;  3LW5 E;  1M90 R;  2D1X A;  1NLO C;  3JAM E;  4EMH A;  3I55 Q;  3O5Z A;  1ZUK A;  2X4X A;  1WHJ A;  2QGF B;  1MMA A;  3WXM B;  4BI8 B;  2EYY A;  5AT1 B;  2QDL A;  1M9S A;  4F7U E;  1WYX A;  2X3W D;  1OPL A;  4M7A D;  1AWX A;  2C0I A;  2YHT A;  2A08 A;  2LNV A;  4MDW A;  2KBT A;  1PKS A;  2V8I A;  1TSF A;  3NFC A;  3CC2 A;  2DVE A;  1B34 A;  3CCJ T;  1OU8 A;  5GMK j;  1UTI A;  2HL3 A;  1U5S A;  1QW1 A;  1KSW A;  3FEO A;  3T9N A;  4A4G A;  2QDY B;  1WI7 A;  2LTO A;  4R55 A;  2XK0 A;  4JRK A;  1WPY A;  1K9M U;  2CP6 A;  2ZPG B;  1PD1 A;  2XMF A;  2I0N A;  1TUC A;  3CCR A;  3FJP A;  1VQN Q;  1KQ2 A;  3KFV A;  4RG2 A;  1OZ2 A;  1WNL A;  2YRV A;  3L1A A;  3DLM A;  4C8Q E;  1VQ9 T;  5IAY A;  1IXD A;  1BI2 A;  1WXB A;  1YJW T;  2RNA A;  2FZC B;  2DL3 A;  3CCE T;  5GAM g;  2D9T A;  2M0Y A;  3UA7 A;  4IUT A;  4PJO F;  2HSE B;  4OB2 B;  3TSW A;  1VQP Q;  2E3I A;  2MYS A;  1RAB B;  3VRY A;  1FX7 A;  2CP3 A;  4OMN A;  1OZ3 A;  2MK5 A;  2RQU A;  3FB9 A;  2YUP A;  1OI1 A;  4F7U A;  2DL7 A;  5A0L A;  4R56 A;  2DLP A;  4MZM A;  3M0T A;  4GBQ A;  4KGX B;  2HBP A;  3QZ9 B;  4KH0 B;  4OB3 B;  2C0O A;  1K8A U;  3M0R A;  3CMA Q;  4J9E A;  5CAI A;  4FCY A;  2MMP A;  4M7D C;  4J83 A;  5GAN 6;  3CXC P;  1BI1 A;  4J9B A;  3CC7 A;  2FG0 A;  3X20 B;  1ZSZ A;  2GQV A;  1H64 1;  3J81 E;  4PLI A;  1DJ7 B;  5D6Y A;  1N6A A;  2YWW A;  5GAN g;  5DM7 R;  2EQM A;  1BYM A;  1NLP C;  4L6V 5;  3I35 A;  3PMT A;  4LDW A;  3G4S Q;  2DTO A;  4C8Q A;  1Z9Z A;  2L2P A;  4PJN A;  1U3O A;  3CQT A;  1GRI A;  4ORZ A;  3OYF A;  3RER A;  2CP7 A;  1VQ5 Q;  2F5K A;  4M77 F;  2LJ3 A;  5FLX E;  5GMK l;  2DXT A;  3QII A;  5HY6 A;  1SF9 A;  1S72 A;  4M78 F;  1VQ7 T;  1ZHI A;  1Y7X A;  2JJ9 A;  2QAS A;  3MPU B;  4LN2 A;  2VWF A;  2HBW A;  1MUZ A;  1KC8 U;  2DIL A;  2HQE A;  3M5A A;  3CCV T;  1AHJ B;  2NUZ A;  1Y57 A;  3S3N A;  4EIK A;  2MF2 A;  5DLQ E;  1SKU B;  3L2Q A;  2LQ8 A;  3EG1 A;  4WTO B;  3JRZ A;  1XTD A;  4FSS A;  3TVT A;  2GTJ A;  1JO8 A;  5FRM A;  2JW4 A;  3SFM A;  3UAT A;  1LNX A;  2HKQ B;  3RKW A;  4HT8 A;  3S6W A;  4XU0 A;  2CSI A;  4X9D A;  1QQJ A;  2YRD A;  4FW2 A;  4LDV A;  2DTH A;  3S3O A;  4RMO A;  2KRS A;  4O6J A;  4JRQ A;  2OTL A;  1KG1 A;  1X43 A;  4BI3 A;  2Y90 A;  4BY6 C;  2RHY A;  2KEA A;  1UGV A;  4C8Q D;  5GAO l;  2JTM A;  3N5B B;  2KDS A;  5LJ3 j;  3EGD A;  4IUR A;  5L23 A;  2JTF A;  4CC2 A;  2COW A;  2VC8 A;  2KGT A;  2MPX C;  3OA6 A;  3KBG A;  1AVZ C;  1SSH A;  2BE7 D;  1YJN Q;  3NHN A;  1YIJ T;  2CRE A;  3TSZ A;  3CD6 Q;  2DFU A;  1N27 A;  1TU0 B;  5KYU A;  1D3B B;  1AD5 A;  4Y28 E;  1ACM B;  2ZPF B;  2RB6 A;  3HRS A;  3TQ7 P;  1GXI E;  2J7I A;  3QKJ A;  2XDB A;  2LZ6 B;  1Y0M A;  1AT1 B;  2DTI A;  1ZLM A;  1MNE A;  2CGH A;  3FDR A;  2DRM A;  2HQX A;  3BW1 A;  5IN1 A;  4C92 C;  2QGG A;  1TUD A;  2RJE A;  4M75 D;  4J9F A;  2V8K A;  3JB9 H;  3CCU T;  1G3T A;  2DZ9 A;  3E2U A;  1EFN A;  2A36 A;  4M7A C;  1I07 A;  2DEQ A;  1IGQ A;  1X6B A;  2CZ1 B;  2YRC A;  3RNJ A;  3LLR A;  3RKX A;  3HPW A;  1D1A A;  1ZSG A;  1S1N A;  2HZY A;  3EG3 A;  1QVF P;  3QSU A;  2QYZ A;  5D6W A;  2FL7 A;  2DA9 A;  2VXF A;  1ZUY A;  1OUL A;  3G6E A;  1WGS A;  4C0F A;  2DEU A;  4J6W A;  3OQ5 A;  2DO3 A;  2RN8 A;  1OX9 A;  2QA4 T;  1V1C A;  2RI3 A;  2VKN A;  2M9U A;  2O31 A;  3J80 E;  2C06 A;  2OJ2 A;  1UB4 A;  3WVE B;  2DL5 A;  2HMA A;  1YJW A;  1V76 A;  3CCE A;  1EZZ B;  3V7R A;  5LJ5 d;  3C0C A;  2IPO B;  5LJ3 e;  2O01 E;  2JM8 A;  5A0D A;  3VS6 A;  3VYH B;  1X69 A;  4IUV A;  4N0A C;  4ZTJ A;  3ER0 A;  5KH6 A;  1VQK T;  2QG9 B;  3VUB A;  2LQN A;  3X28 B;  4PJO B;  3HTR A;  2YUN A;  3QHS A;  5CKB A;  1VQ6 T;  4GLM A;  1QKX A;  2RQV A;  2HQH A;  1QP3 A;  3A8M B;  2JN0 A;  2JMC A;  2LC4 A;  1QCO A;  4OB0 B;  1QWE A;  2RI2 A;  5IXF A;  1BU1 A;  2A0F B;  2E64 A;  1I5O B;  3A5Z B;  2JZ2 A;  3CCL T;  2EKO A;  2BIV A;  3KXT A;  2J6O A;  3MO8 A;  2CZ0 B;  2DMO A;  2V1R A;  1NZ9 A;  1R0B G;  2RHX A;  3C12 A;  4PJO G;  3EFR A;  1Q81 C;  2CT4 A;  3M0U A;  4V2S A;  1J3T A;  1GFD A;  2LX9 A;  2DET A;  4XTX A;  3EHR A;  2VGM A;  1YI2 T;  3M54 A;  1K9M R;  2OTJ A;  1T3S A;  2EFI A;  2EAY A;  3M57 A;  5CO7 A;  4M77 B;  3M0Q A;  1D09 B;  4EMK B;  1O9S A;  4OMF B;  1M1K C;  4PJM A;  1CKA A;  1PD0 A;  1RAF B;  1P92 A;  3CCV A;  2P0K A;  2J6K A;  3CC2 Q;  1JEG A;  3JB9 F;  2M51 A;  1NBE B;  4M7D F;  3I56 A;  1K73 C;  4XU1 A;  3J7A F;  2AZV A;  4Y91 A;  1YCY A;  4DOV A;  1KJW A;  4JZ3 A;  3TCJ A;  1LCK A;  1AEY A;  2JTE A;  1BK2 A;  3HFO A;  1D1B A;  3CCR Q;  2HEQ A;  1YBY A;  4CC3 A;  1IRE B;  4CRI A;  4EPC A;  4BD3 A;  4M77 G;  3QYH B;  1WHM A;  1ZSZ B;  5CKH A;  2GCX A;  3MJX A;  3RKY A;  4J7F A;  4Z02 A;  3JCM d;  3V8L A;  3QWY A;  2F69 A;  1M1K R;  1E6H A;  3UF4 A;  4ZN1 A;  4KUI A;  1XJW B;  4C8Q C;  1RLP C;  4EMG A;  2K57 A;  3SHW A;  2YUO A;  2RF0 A;  3LWH A;  3HRU A;  1K76 A;  3PVQ A;  1K73 R;  2KXD A;  5GAN 3;  4HCK A;  2AZS A;  2KYM A;  4FW1 A;  3GLX A;  4E7S A;  2CP2 A;  1LVK A;  3CPW S;  1BIB A;  4MMK A;  2COZ A;  3JCM b;  1E7O A;  2VXE A;  3LH5 A;  3FRN A;  3G71 T;  5FRO A;  3CC7 Q;  4RCB A;  2XDP A;  4DBF A;  2EGC A;  1VQM T;  2FRY A;  1UE9 A;  1VYU A;  4PJO E;  4HVW A;  4IIM A;  2VUB A;  3KUF A;  2DL4 A;  2D0N A;  3OSV A;  2GNC A;  3OYB A;  1IGU A;  1FYN A;  2EJF A;  3JSC A;  4JRI A;  3M56 A;  4RTV A;  3H0I A;  2QEX A;  2K3B A;  4E2F B;  4M75 B;  1XOV A;  2M02 A;  4OML A;  3I55 T;  4JDS A;  3E9G A;  3OYG A;  1JXM A;  2AKL A;  1D0Z A;  2JVV A;  1S72 Q;  4HKE A;  3CPW A;  2CUD A;  5GAN 8;  2EQU A;  4J6Y A;  3CCQ A;  1OYX A;  3BDU A;  4WF2 A;  3NTI A;  2K3Y A;  1QCF A;  3NTK A;  2P0P A;  1UFF A;  1UJ0 A;  5GAN 7;  2XIC A;  3PFS A;  1NG2 A;  2WAC A;  2ATC B;  1D1C A;  5A2Q E;  1X2K A;  5DY9 A;  4HCB A;  1H3H A;  1VIE A;  2QA4 A;  2F1L A;  2MCN A;  2DZC A;  3R6N A;  1E6G A;  4M77 E;  3P8D A;  4M75 G;  4PJO A;  4A4K A;  4QVZ A;  2DD4 A;  2ESW A;  2SEM A;  5LJ5 g;  1NPP A;  4RTW A;  1EX4 A;  1YFN A;  3CBO A;  3OYC A;  4J7I A;  2K79 A;  1ARK A;  1CKB A;  5KYU B;  2JNG A;  2OTL Q;  4C92 F;  1WX6 A;  2HDA A;  1VQP T;  2FPE A;  5IHN A;  2ZPH B;  1ZX6 A;  3C4S A;  3ASK A;  1I0C A;  1ZBX A;  5CKE A;  2O88 A;  4QQG A;  5LL6 S;  4F17 A;  3UPU A;  2FPD A;  3MCA B;  4ZGJ B;  4PKC C;  3IQL A;  1H3Z A;  2K6D A;  3CMA T;  3H6Z A;  2A37 A;  4D8D A;  3JCM X;  1SRL A;  4E7K A;  2ZPI B;  3M59 A;  3RMQ A;  4J5Y A;  4HCC A;  1YP5 A;  2K4Y A;  4C5E A;  4EDU A;  2F2X A;  1UDL A;  1BKB A;  4M77 A;  4EMK A;  2E1H A;  1G8X A;  6AT1 B;  1HJD A;  5I22 A;  3RDV A;  1WJQ A;  1VYV A;  3UT1 A;  3G7Z A;  3QO3 A;  4OGE A;  4A4F A;  1X75 C;  4E7H A;  2NYS A;  2DNU A;  2NUP B;  4PK4 A;  4FU6 A;  4PJO D;  1Q95 G;  4J9H A;  2IVW A;  3E9F A;  3CBP A;  3D7S B;  3LH0 A;  1W4S A;  4RTX A;  1H8K A;  2PVD B;  3A8H B;  5FW9 A;  2F2W A;  2YSQ A;  2DXU A;  2LX7 A;  2LP5 A;  1M1K U;  2QI2 A;  2E5Q A;  1M2O A;  2LMJ A;  3OMG A;  3CC4 A;  1JJ2 P;  2GBQ A;  2P4R A;  5GAO r;  4JPB W;  2A28 A;  2R58 A;  1NYG A;  4M75 E;  4QVD A;  3G6E Q;  2RD1 A;  3L2Z A;  1K73 U;  2LCC A;  1RLQ C;  1QCN A;  1RAG B;  2FB7 A;  1PSE A;  2Y4Y A;  5CIU A;  1YJ9 T;  1VQ4 T;  3VS2 A;  2NLU A;  4OMM A;  4IKF A;  1WQW A;  5CQY A;  3DB4 A;  5HK0 A;  4Z88 A;  5C6S A;  1Y71 A;  1YJW Q;  5GMK m;  5GMK i;  3CCE Q;  3JCM g;  1NM7 A;  1M30 A;  3QPH A;  5IT9 E;  1RUW A;  1M8V A;  3R6O A;  1M3C A;  4O5V A;  4M77 D;  1ZA2 B;  2W0Z A;  2JS2 A;  2RJF A;  4CI0 C;  2K2V A;  1JJ2 S;  5KE3 A;  2CYZ B;  3H9N A;  2H3J A;  1M1G A;  1WDX A;  1I81 A;  4M78 D;  4ZNX A;  4E7L A;  1GCP A;  1SG5 A;  1I4K 1;  3JB9 G;  3ZFJ A;  4LUE A;  4M7D G;  4FT4 A;  5I2S A;  4AG1 C;  1U1T A;  5GAM j;  1KHI A;  3C94 A;  4M75 A;  2FVU A;  1M1F A;  1YJN T;  2KE9 A;  1VQM A;  3SWN A;  2DIG A;  4C0D B;  8AT1 B;  3CD6 T;  1WHG A;  2DAQ A;  2JS0 A;  4PJJ A;  3HKS A;  3REB B;  2G6F X;  1UG1 A;  5D6X A;  5GAM f;  3EH1 A;  3VKI A;  2AKK A;  5GAN 5;  1IHV A;  1JJ2 A;  2FHD A;  2CDT A;  2EJG A;  1I1J A;  5GAO m;  1BBZ A;  3PVL A;  1TS9 A;  3X25 B;  4C8Q F;  2OTJ Q;  1VQO T;  1TTH B;  1AWJ A;  2OAW A;  3LX7 A;  3MP6 A;  4BDZ A;  3PNW C;  1BI3 A;  5GAN j;  2EWN A;  2QAZ A;  4LNP A;  2RJD A;  2RM4 A;  4RTU A;  3CCS T;  1Q7Y C;  2KRN A;  2E4H A;  3CCV Q;  1K0S A;  4ZN3 A;  3X26 B;  2D0Q B;  5GMK h;  2RA2 A;  3INZ A;  3P8H A;  3I56 Q;  3TU4 K;  5GAN f;  1MMG A;  2IIM A;  4BI4 A;  1M5Q 1;  1WQ7 A;  4FT2 A;  2K9G A;  1D0X A;  1N9S A;  1BB9 A;  2R5M A;  1TWB A;  2L3S A;  1T3L A;  1HXD A;  1X6O A;  2DJZ A;  4LDX A;  1ABQ A;  2RH2 A;  1M4Z A;  1WA7 A;  5J39 A;  4IUP A;  1FMK A;  3LGL A;  2CP5 A;  4PLL A;  1ZA1 B;  1WLP B;  1YN8 A;  2B86 A;  3CPF A;  1Q86 C;  2MWP A;  4L5G A;  5IHI A;  1OQK A;  5FWC A;  1FXX A;  4JJC A;  2ABL A;  2E6N A;  2GQI A;  5GAM e;  3JCM W;  1YWP A;  1LOJ A;  1WXT A;  3FJ5 A;  2ECZ A;  3CCJ A;  4M7D E;  1WXU A;  5AYF A;  5CR2 A;  3L2U A;  5LJ5 h;  4XK8 E;  1GL5 A;  3GOX A;  1UEB A;  4JUV A;  1G3W A;  4OB1 B;  3VS7 A;  1JXO A;  3M0S A;  3NGP A;  3QDR B;  5GAN 4;  2GFA A;  3M4Y A;  4NOY A;  4QKU A;  3CCM T;  2EGA A;  4LD9 K;  2NUP A;  1B7T A;  2W10 A;  5L8R E;  2CS7 A;  5FU7 B;  2XG8 D;  4FYV B;  1VQ9 A;  2DL8 A;  3A8G B;  4F16 A;  1I5L A;  1KK7 A;  1C0M A;  4IUQ A;  1GCQ A;  4A4E A;  4XAX B;  3VS3 A;  3HSB A;  1M27 C;  2ZAE A;  4D6W A;  4AT1 B;  4BAC A;  4HT9 A;  5GAN e;  1VYT A;  2QEX Q;  3M53 A;  4J9D A;  1IRX A;  4PJO C;  1ZUU A;  2Z0W A;  1MHN A;  2CH4 W;  2XKO C;  2EYZ A;  4C0Z A;  2ED0 A;  3CME T;  1QWF A;  1YHQ T;  3CBM A;  3CCQ Q;  2RHU A;  4M7D A;  1PKT A;  3URG A;  3E1S A;  4FIB A;  1UGR B;  3QUI A;  4UC4 A;  2EQK A;  3A98 A;  3EHQ A;  4AFU C;  4BE0 A;  1VQ8 T;  2DXC A;  1G3S A;  3CC2 T;  1VQL T;  1YJ9 A;  3OYM A;  1VQ4 A;  1UGP B;  2QA4 Q;  2DRK A;  5KYW B;  2OI3 A;  2LJ0 A;  1VIF A;  2KRO A;  3CCR T;  4ZTF A;  1ZQ1 A;  1VOM A;  3EG9 B;  3JCM c;  2BZY A;  2FRW A;  2KSS A;  4NL2 A;  2BKD N;  4M77 C;  1QVG P;  1VQ7 A;  2F2V A;  4EMK C;  1N8R C;  2EBP A;  5A0G A;  3QG1 A;  2LT4 A;  1NJI C;  3Q1J A;  3I5S A;  3OB9 A;  2YUQ A;  1H92 A;  2PNI A;  1NPR A;  4M78 B;  2GGR A;  5LJ3 h;  1PC0 A;  1UJY A;  1IZ6 A;  2QQS A;  4JLG A;  2JM9 A;  3JCM h;  3MEA A;  1Y96 A;  2V1Q A;  2L3P A;  1KQ1 A;  2DE0 X;  4E7I A;  3JB9 D;  1MMD A;  3S3M A;  1Q81 R;  3CPW P;  1UGQ B;  4AMC A;  3NPF A;  4M7D D;  5KCH A;  1BCO A;  1RI0 A;  1NE8 A;  2DVJ A;  5D7U A;  2KNB B;  2K5I A;  2BZ8 A;  5LJ3 d;  1ZSZ C;  2VV5 A;  1QVG S;  1MND A;  4A54 A;  4RTY A;  4RCC A;  3QZ5 B;  4XTY A;  1G2B A;  3PT9 A;  4J9C A;  2XID A;  2PUK B;  2RK1 A;  2HD0 A;  3PIO A;  3OYN A;  1UHC A;  3GPL A;  2EYW A;  3MET A;  4JJB A;  3THK A;  3EGU A;  3ZBD A;  4M78 G;  1NJI R;  1G5V A;  3ULR B;  4DQ2 A;  3AHU A;  3EFS A;  2LQW A;  4HA8 A;  1MV0 B;  1VQO A;  2HNI A;  2KI7 A;  2LRQ A;  1NEB A;  2R5A A;  3M55 A;  2DXB A;  1YIT T;  3H41 A;  4YTL A;  1YIJ A;  3CCS A;  5KE2 A;  2K5L A;  3CC4 Q;  1YNZ A;  3FIF A;  3H0H A;  1SSF A;  5FU6 B;  2XU8 A;  4J9I A;  2DM1 A;  1Q7Y U;  1UEC A;  2RI5 A;  4HXJ A;  4LDU A;  1RL2 A;  3OS2 A;  1QVG A;  1KFZ A;  3X24 B;  2AK5 A;  3V7C A;  1NYF A;  5GAO n;  2L8D A;  3DB3 A;  2AHJ B;  4J9G A;  4M4Z A;  5CQX A;  1M8M A;  2O4X B;  4M75 C;  3JCM P;  3CCU A;  4PNO A;  4ME7 A;  3SWN B;  2KT1 A;  2ROT A;  4NS5 A;  4XU2 A;  1Q82 C;  2QQA A;  2YT6 A;  1Q86 U;  4DBR A;  1JQQ A;  4KGV B;  2K7A A;  3GF5 A;  3FLG A;  4KUL A;  4C5H A;  4DBQ A;  1M90 C;  1BCM A;  1X27 A;  3HL8 A;  2MI6 A;  4HVV A;  1TOV A;  2DD5 A;  4BDY A;  1M3A A;  2K5F A;  3HHT B;  2H3E B;  1R8O B;  3CCM A;  2P84 A;  2LJ1 A;  2CT3 A;  3U23 A;  5IH2 A;  1VQM Q;  3TEE A;  2RMO A;  3PMI A;  2HKN A;  4A53 A;  2EIF A;  1VQN T;  2FZG B;  2QTX A;  2VVK A;  4X1V A;  2RK2 A;  2EQI A;  4M78 E;  3VV0 A;  2O2O A;  7AT1 B;  3LGF A;  4LXC A;  3OYK A;  2E65 A;  1Q82 R;  2QQB A;  3VS5 A;  4N0A A;  5FRN A;  3OYY A;  2YDL A;  4FYW B;  1VQK A;  4M7A F;  4RUG A;  3UWN A;  2K2M A;  4II1 A;  3VJP A;  1KD1 C;  1VQ6 A;  3CME A;  2YLB A;  4B6M A;  4F14 A;  3OYE A;  4KUD K;  4C92 D;  1G3Y A;  1YHQ A;  2I2L A;  1OV3 A;  3L2R A;  4BE1 A;  2ZPE B;  4Y92 A;  5KYW A;  2LCL A;  1W2B S;  2MWO A;  1HK9 A;  2L89 A;  4RG8 A;  3OS5 A;  3EG9 A;  4PFO A;  1W70 A;  1QMC A;  1O75 A;  1VQ8 A;  4KRT A;  4RKU E;  2COY A;  1LJO A;  1VQL A;  2RQT A;  3CCL A;  2DJQ A;  5IHK A;  2E6Z A;  2FYK A;  4AG2 C;  3M4G A;  4DEX A;  5KYY A;  4AFQ C;  3G6E T;  3VS4 A;  3I9Q A;  2AT1 B;  1D0Y A;  3G4S T;  4M78 A;  4HVU A;  3C95 A;  2D6F A;  4QW2 A;  1KD1 R;  3GIB A;  2KXC A;  3UA6 A;  5CVI A;  1Q81 U;  3F70 A;  1VQ5 T;  2NUT B;  3MP8 A;  5KYX A;  4B9W A;  1YI2 A;  3OW2 P;  4NL3 A;  3DLL A;  1MMN A;  4D8K A;  1GCQ C;  3OYH A;  1W2B A;  3LYI A;  1N9R A;  1N8R U;  2YLC A;  2H8H A;  2CZ7 B;  2CH4 A;  3AT1 B;  2X9H A;  3CCJ Q;  1NJI U;  3OSS C;  4HCZ A;  3QDF A;  4KT0 E;  2DF6 A;  4DOW A;  3QWX X;  4X9C A;  3ZEH A;  2KAF A;  5LJ5 j;  1F1B B;  3EFO B;  1JB0 E;  2A7Y A;  3OYJ A;  4PFP A;  3UDC A;  4TVR A;  2JMA A;  4M7D B;  2J05 A;  5LJ3 g;  1Y07 A;  2O9S A;  5LJ5 f;  3OW2 S;  2HL5 C;  4MZT A;  4N4H A;  1VQ9 Q;  3TRE A;  3HP9 A;  3QXE B;  3LWI A;  3JCM V;  4FSX A;  2ZCF B;  2ROL A;  2Y4X A;  2DX1 A;  4OVA A;  3OS1 A;  2XD0 A;  2PQW A;  2AIR B;  1OEB A;  2DYI A;  3P8B B;  3NTH A;  3BY7 A;  2DPP B;  3VRZ A;  3SB2 A;  5ECA A;  2PZ1 A;  4A63 B;  2FZK B;  1SRM A;  1TXQ A;  1HD3 A;  3I5R A;  4AFZ C;  2VB6 A;  3M9Q A;  2QXF A;  2X3X D;  4PL6 A;  5EC7 A;  5J26 A;  1YIT A;  5GMK e;  3HFN A;  3EG0 A;  2OTJ T;  1IB8 A;  3CXC S;  1NEG A;  4Z8A A;  4Z89 A;  2QK0 A;  4F7U F;  4ESR A;  2P4T A;  2O4X A;  3G71 A;  3GBQ A;  4R0K A;  1B07 A;  2FPF A;  4C0D C;  3OW2 A;  2CSQ A;  2L5Q A;  1WZO A;  2LT1 A;  2KT8 A;  2RQR A;  3BDL A;  1YJ9 Q;  3I56 T;  4JS5 A;  1VQ4 Q;  3RBB B;  1T0H A;  1JU5 C;  3SEM A;  3JB9 J;  2MIO A;  1W1F A;  2DKG A;  4L59 A;  2L3Q A;  2JXB A;  1IHW A;  2LDM A;  1PWT A;  3EGX B;  1Y96 B;  2X51 A;  3V8J A;  1FMW A;  2DIQ A;  2EKH A;  3I55 A;  1U1S A;  2GF7 A;  2E12 A;  1TH7 A;  1Z9Q A;  4ANJ A;  1X01 A;  1VQ7 Q;  4BUG A;  4Q5W A;  1YCS B;  1OX8 A;  2ZGW A;  3PIP A;  3CXC A;  5LJ5 e;  3BE3 A;  5GAN 2;  3RUX A;  1RAA B;  1Q82 U;  1BIA A;  2KRM A;  2LCS A;  4BY6 B;  1U06 A;  1KIK A;  1M90 U;  3HRT A;  1WIE A;  2V26 A;  4KBM B;  2PVG B;  1W6X A;  3FC3 A;  1V29 B;  1CSK A;  2MOX A;  1U8R A;  1R77 A;  3VYG A;  4IIO A;  1ABO A;  5GAO q;  3L2V A;  2QTV A;  4XQ3 A;  3GNF B;  1QP2 A;  1AWW A;  4GY5 A;  2LQK A;  1VQN A;  5LJ3 f;  4DBH A;  2RHZ A;  1T0J A;  1WJR A;  2B8A A;  1K4U S;  3JCM f;  4ELZ C;  4JRP A;  4LDY A;  1MV3 A;  4M75 F;  4P5N A;  4PFZ A;  1VQP A;  4C5I A;  1Q7Y R;  1LPL A;  3OYD A;  4B9X A;  4ELY C;  3QBY A;  3NMZ C;  3OBW A;  4ZGD B;  5EG2 A;  2QEX T;  2JUF A;  1TUG B;  1AZE A;  4JJD A;  4C92 B;  1VQO Q;  1KD1 U;  2V8J A;  2K3X A;  4F04 B;  4DEY A;  4M7A B;  1GBQ A;  4C5G A;  1PNJ A;  1G83 A;  3OS0 A;  3MHX A;  3CMA A;  1RAD B;  2RQW A;  2NWM A;  3GP8 A;  2BE9 B;  3CCQ T;  1N5Z A;  4E7Z A;  1YIJ Q;  3CCS Q;  4N4I A;  1GBR A;  3EH2 A;  4XTW A;  1IO6 A;  2M16 A;  5FU7 C;  5DLO A;  2ZPB B;  2NUT A;  4BE2 A;  1MGQ A;  2PU9 B;  2X4J A;  4RTT A;  4MDX A;  1WHK A;  1GFC A;  1OPK A;  2EJ9 A;  3L42 A;  4K11 A;  1B3Q A;  2KR3 A;  2G3R A;  1WJS A;  5HCK A;  2VYT A;  4JLI A;  1AOJ A;  3GNG A;  4QT7 A;  5GJW B;  1Q86 R;  2WSC E;  1X2Q A;  3G4S A;  2CKK A;  1JRI A;  2JT4 A;  4C92 G;  2M0O A;  1VQ5 A;  4OMO A;  4WCI A;  2RO0 A;  4XTV A;  3CCU Q;  2X35 A;  4KH1 B;  2RHI A;  4M7A G;  2CUB A;  2KK4 A;  2SRC A;  2E70 A;  3EFO A;  1M2V B;  4LUD A;  2WSE E;  2XDD A;  1KQS P;  2WSF E;  2BTT A;  2OAU A;  2C0T A;  2KY9 A;  1FMV A;  3M58 A;  3OYA A;  2LVM A;  3JCM e;  2QQ9 A;  3VS0 A;  1QVF S;  1SHF A;  3RES A;  1I8F A;  4ATO A;  2BUD A;  1M3B A;  1PM3 A;  2EPD A;  2ZZD A;  3L2W A;  1SEM A;  3A8O B;  5FWB A;  4FYY B;  1K9M C;  2JOY A;  3CCM Q;  3VU3 C;  5GAM h;  1OOT A;  4IUU A;  4N4G A;  1PHT A;  4FM4 B;  4J6X A;  5KYN A;  1QLY A;  4OMQ A;  4E7J A;  1KQS S;  4A4H A;  4X34 A;  5C0M A;  2E5K A;  4LD6 A;  5CK9 A;  4BB7 A;  1B34 B;  3PTA A;  1WHH A;  3G1J A;  3RR6 A;  1RAH B;  4OP0 A;  2RPN A;  1X6G A;  2X4W A;  1HSQ A;  2OX7 A;  2HSP A;  5GAM d;  4MML A;  5J3B A;  3OYI A;  5KYY B;  4OF1 A;  1QVF A;  3QYG B;  1VQK Q;  1SPK A;  1XNI A;  2KMT A;  2DYB A;  4XTU A;  3O8V A;  4M78 C;  3H0F A;  2CP0 A;  4J8O A;  9ATC B;  3CME Q;  2O9V A;  1VQ6 Q;  2PVO B;  1YWO A;  2F5T X;  1YHQ Q;  3DKM A;  1K8A C;  3ME9 A;  2DER A;  1FWZ A;  5KYX B;  1PG5 B;  5GAN h;  4OMP A;  1RAE B;  1UUE A;  2E10 A;  1PRM C;  3EGX A;  3OMC A;  1K1Z A;  2XI9 A;  5HK3 A;  1BI0 A;  2R57 A;  2D8J A;  3JCM Q;  1YJN A;  4GLK A;  1VQ8 Q;  2FEI A;  3REA B;  1VUB A;  1XQH A;  3JV3 A;  3VS1 A;  1PRL C;  3CD6 A;  3CC4 T;  2E41 A;  1VQL Q;  1KQS A;  3CC7 T;  3ZL7 C;  3OY9 A;  4F7U B;  3CCL Q;  3OBY A;  3EG2 A;  4C0G A;  1SHG A;  3BFM A;  4C92 E;  1N8R R;  4E6R A;  5GAN d;  2DBK A;  4FL6 A;  1UHF A;  1EIF A;  5IXB A;  2CZ6 B;  2DBM A;  2EQJ A;  4M7A E;  3QJ6 A;  4MZP A;  1WFW A;  3JCM J;  2M1H A;  3PGG A;  2EW3 A;  4DA4 A;  4JJN K;  1YI2 Q;  1K8A R;  4FYX B;  2KYB A;  1QVP A;  4XU3 A;  3EAE A;  4QVC A;  2E3H A;  2HCK A;  3QJY A;  2PTK A;  4AFS C;  1S72 T;  2XHC A;  2RJC A;  3JB9 I;  2GTO A;  1A0N B;  1RAI B;  5FU6 C;  1KC8 C;  2L0A A;  1D3B A;  4F7U G;  2HAX A;  1JBM A;  2EVR A;  2VAS A;  4C8Q B;  4E47 A;  4CC7 A;  4QQD A;  1C6V X;  4JS4 A;  2YXY A;  3H8Z A;  3SDZ A;  2EYX A;  4KGZ B;  2PUO B;  5I2M A;  5CKF A;  4VUB A;  2ED1 A;  2FO0 A;  1AWO A;  5CCA A;  3CEY A;  2A3L A;  1UGS B;  3MKD A;  4C92 A;  3SD4 A;  2DK3 A;  1KHC A;  2QQR A;  3SWN C;  1PCX A;  4M7A A; 
#chains in the Genus database with same CATH homology
 3OYH A;  2VGN A;  1W2B A;  2E64 A;  3LYI A;  2RJD A;  1N9R A;  2RM4 A;  3CCS T;  1N8R U;  1Q7Y C;  3V7S A;  2YLC A;  3A5Z B;  5GAO p;  4ZGE B;  2JZ2 A;  3VUZ A;  3CCL T;  2CZ7 B;  3RMS A;  4ZN3 A;  3G71 T;  2EKO A;  3X26 B;  2BIV A;  4C8Q G;  3KXT A;  2D0Q B;  5GMK h;  2RA2 A;  3OYL A;  3INZ A;  3P8H A;  2OTL T;  3TU4 K;  5GAN f;  1NJI U;  2X4Y A;  3OSS C;  3MO8 A;  4HCZ A;  4KT0 E;  2CZ0 B;  4DOW A;  2GFU A;  4X9C A;  1NZ9 A;  2RHX A;  3E19 A;  3C12 A;  4BI4 A;  1M5Q 1;  1WQ7 A;  2KAF A;  4FT2 A;  4PJO G;  3EFR A;  3ZEH A;  5CKD A;  5LJ5 j;  1Q81 C;  1N9S A;  3RIR A;  4V2S A;  3MEV A;  2P0Q A;  2MAM A;  2R5M A;  2LX9 A;  1HXD A;  4XTZ A;  4XTX A;  3MEW A;  1JB0 E;  1X6O A;  2A7Y A;  2DJZ A;  3OYJ A;  5HKC A;  3UDC A;  4TVR A;  4LDX A;  2VGM A;  2RH2 A;  3MP1 A;  5M9O A;  1M4Z A;  1YI2 T;  3M54 A;  4M7D B;  2OTJ A;  2KVQ G;  5J39 A;  2EFI A;  4IUP A;  2EAY A;  3M57 A;  5LJ3 g;  3LGL A;  5CO7 A;  1Y07 A;  3WVD B;  4M77 B;  5LJ5 f;  3OW2 S;  4PLL A;  4MZT A;  4N4H A;  4EMK B;  1O9S A;  3TRE A;  3HP9 A;  3QXE B;  4OMF B;  3LWI A;  1M1K C;  3JCM V;  4FSX A;  3CPF A;  2KQW A;  2ZCF B;  4QQ6 A;  2Y4X A;  1Q86 C;  5I21 A;  2EYQ A;  2MWP A;  4L5G A;  2IG0 A;  1P92 A;  4OVA A;  3OS1 A;  3CCV A;  2P0K A;  5KCO A;  1FXX A;  2XD0 A;  2PQW A;  3MEU A;  2E6N A;  3JB9 F;  3P8B B;  3V8K A;  3NTH A;  5GAM e;  1LOJ A;  3BY7 A;  3JCM W;  4M7D F;  2L3R A;  3I56 A;  3CCJ A;  1K73 C;  1PSF A;  2DPP B;  4XU1 A;  3J7A F;  4M7D E;  1W2B S;  4OGC A;  3SB2 A;  4Y91 A;  1YCY A;  5AYF A;  5CR2 A;  4DOV A;  3L2U A;  3TCJ A;  5LJ5 h;  3A8L B;  4XK8 E;  3LW5 E;  3GOX A;  1UEB A;  4JUV A;  3M9Q A;  1G3W A;  3HFO A;  4OB1 B;  3JAM E;  4EMH A;  2QXF A;  3QDR B;  5GAN 4;  1YBY A;  2GFA A;  3M4Y A;  4PL6 A;  5J26 A;  2X4X A;  4NOY A;  3CCM T;  5GMK e;  3HFN A;  1YIT A;  4LD9 K;  2OTJ T;  3WXM B;  1IRE B;  4CRI A;  4EPC A;  3CXC S;  4BI8 B;  4F7U F;  1M9S A;  2P4T A;  4F7U E;  5L8R E;  4BD3 A;  2CS7 A;  2O4X A;  4M77 G;  5FU7 B;  2XG8 D;  3QYH B;  4M7A D;  3G71 A;  1VQ9 A;  5CKH A;  2GCX A;  3A8G B;  1I5L A;  3RKY A;  4J7F A;  4Z02 A;  4C0D C;  3JCM d;  2YHT A;  3V8L A;  3OW2 A;  2LNV A;  2L5Q A;  4IUQ A;  4MDW A;  2F69 A;  2LT1 A;  4A4E A;  4XAX B;  4ZN1 A;  2V8I A;  3NFC A;  4KUI A;  4C8Q C;  4EMG A;  3CC2 A;  3HSB A;  2K57 A;  3BDL A;  2DVE A;  1B34 A;  3I56 T;  4D6W A;  3CCJ T;  4JS5 A;  5GMK j;  4BAC A;  1QW1 A;  3LWH A;  4HT9 A;  3HRU A;  3FEO A;  5GAN e;  3T9N A;  4A4G A;  3JB9 J;  2QDY B;  3M53 A;  2LTO A;  4R55 A;  2DKG A;  2XK0 A;  4L59 A;  4PJO C;  5GAN 3;  4JRK A;  1WPY A;  1MHN A;  2LDM A;  1K9M U;  2XKO C;  3GLX A;  2ZPG B;  4C0Z A;  1Y96 B;  3V8J A;  3CME T;  2DIQ A;  3CPW S;  3FJP A;  3CCR A;  1BIB A;  3I55 A;  1U1S A;  2GF7 A;  4MMK A;  1KQ2 A;  1YHQ T;  4RG2 A;  3CBM A;  2E12 A;  3JCM b;  1OZ2 A;  1WNL A;  1TH7 A;  2RHU A;  2YRV A;  4M7D A;  1X01 A;  3L1A A;  2VXE A;  3FRN A;  3DLM A;  3URG A;  4BUG A;  4Q5W A;  3E1S A;  4C8Q E;  4FIB A;  5FRO A;  1UGR B;  5IAY A;  3QUI A;  1BI2 A;  4RCB A;  2ZGW A;  4UC4 A;  2XDP A;  3PIP A;  3CXC A;  2EQK A;  5LJ5 e;  1YJW T;  1VQM T;  3CCE T;  5GAM g;  2D9T A;  5GAN 2;  3RUX A;  4BE0 A;  1VQ8 T;  4IUT A;  4PJO F;  1Q82 U;  4OB2 B;  4PJO E;  2DXC A;  1G3S A;  1BIA A;  2VUB A;  3KUF A;  3CC2 T;  4BY6 B;  1FX7 A;  1VQL T;  3OSV A;  1OZ3 A;  3HRT A;  1M90 U;  1YJ9 A;  3OYB A;  3OYM A;  2EJF A;  3FB9 A;  1OI1 A;  3JSC A;  4KBM B;  2PVG B;  1UGP B;  4F7U A;  5A0L A;  4JRI A;  4R56 A;  1VQ4 A;  3M56 A;  3FC3 A;  1V29 B;  4MZM A;  2QEX A;  2HBP A;  3QZ9 B;  1U8R A;  1VIF A;  4OB3 B;  4M75 B;  3VYG A;  1XOV A;  5GAO q;  3CCR T;  4ZTF A;  1ZQ1 A;  3I55 T;  3L2V A;  1K8A U;  4JDS A;  4XQ3 A;  3JCM c;  3E9G A;  3GNF B;  1QP2 A;  5CAI A;  3OYG A;  2KSS A;  4GY5 A;  2LQK A;  1VQN A;  5LJ3 f;  2MMP A;  2BKD N;  4NL2 A;  4M7D C;  4J83 A;  2JVV A;  4HKE A;  3CPW A;  5GAN 6;  5GAN 8;  2EQU A;  4J6Y A;  3CCQ A;  2RHZ A;  1BI1 A;  1WJR A;  2B8A A;  4M77 C;  1VQ7 A;  1OYX A;  3BDU A;  4EMK C;  1N8R C;  3JCM f;  3CC7 A;  4WF2 A;  3NTI A;  4ELZ C;  3X20 B;  2K3Y A;  4JRP A;  2GQV A;  1H64 1;  3NTK A;  5A0G A;  3J81 E;  4PLI A;  4LDY A;  2P0P A;  1DJ7 B;  5D6Y A;  1N6A A;  4M75 F;  5GAN g;  5GAN 7;  3QG1 A;  5DM7 R;  2EQM A;  2LT4 A;  2XIC A;  3PFS A;  4P5N A;  1BYM A;  1VQP A;  1NJI C;  2WAC A;  3Q1J A;  5A2Q E;  4L6V 5;  3OB9 A;  3PMT A;  4C5I A;  4LDW A;  1NPR A;  5DY9 A;  4HCB A;  4M78 B;  3OYD A;  4B9X A;  4ELY C;  2DTO A;  1VIE A;  3OBW A;  3QBY A;  4C8Q A;  5LJ3 h;  4ZGD B;  5EG2 A;  2QEX T;  2JUF A;  2QA4 A;  2DZC A;  1IZ6 A;  3OYF A;  2QQS A;  3RER A;  4JLG A;  4C92 B;  1KD1 U;  2V8J A;  2F5K A;  4M77 F;  3JCM h;  4M77 E;  3P8D A;  2K3X A;  3MEA A;  4M75 G;  4PJO A;  4A4K A;  4QVZ A;  5FLX E;  1Y96 A;  5GMK l;  1KQ1 A;  2DXT A;  3QII A;  2DD4 A;  4E7I A;  4M7A B;  5HY6 A;  4C5G A;  3JB9 D;  5LJ5 g;  1NPP A;  3S3M A;  3OS0 A;  1UGQ B;  3MHX A;  3CMA A;  3GP8 A;  4M7D D;  5KCH A;  3CCQ T;  3CBO A;  1RI0 A;  4N4I A;  3OYC A;  1NE8 A;  4J7I A;  1S72 A;  4M78 F;  4XTW A;  1VQ7 T;  1ZHI A;  1Y7X A;  5FU7 C;  2M16 A;  5DLO A;  2K5I A;  2ZPB B;  4BE2 A;  2JNG A;  5LJ3 d;  1QVG S;  2VV5 A;  1MGQ A;  2PU9 B;  2X4J A;  4C92 F;  4A54 A;  4MDX A;  4RCC A;  3QZ5 B;  4XTY A;  1KC8 U;  1VQP T;  3PT9 A;  2HQE A;  2XID A;  2PUK B;  2EJ9 A;  3M5A A;  3L42 A;  2RK1 A;  2ZPH B;  3CCV T;  2HD0 A;  2G3R A;  1AHJ B;  1WJS A;  2VYT A;  4JLI A;  3PIO A;  3OYN A;  3GNG A;  3GPL A;  3ZBD A;  3MET A;  3C4S A;  4M78 G;  3ASK A;  1G5V A;  2WSC E;  1ZBX A;  3G4S A;  3S3N A;  5CKE A;  2CKK A;  4DQ2 A;  3AHU A;  3EFS A;  1JRI A;  4HA8 A;  2MF2 A;  5DLQ E;  2M0O A;  4QQG A;  4C92 G;  5LL6 S;  3UPU A;  3L2Q A;  2LQ8 A;  1VQO A;  3MCA B;  1VQ5 A;  2HNI A;  4ZGJ B;  3JRZ A;  2RO0 A;  4PKC C;  1XTD A;  4XTV A;  2LRQ A;  2X35 A;  1H3Z A;  2R5A A;  2RHI A;  4M7A G;  2KK4 A;  3CMA T;  2E70 A;  3H6Z A;  3JCM X;  5FRM A;  3M55 A;  2DXB A;  2WSE E;  1YIT T;  2XDD A;  3SFM A;  2WSF E;  4E7K A;  2ZPI B;  3M59 A;  3RMQ A;  4J5Y A;  1LNX A;  4HCC A;  4YTL A;  3RKW A;  1YIJ A;  4HT8 A;  3S6W A;  2OAU A;  4XU0 A;  2KY9 A;  5KE2 A;  4X9D A;  3CCS A;  2K4Y A;  4C5E A;  3M58 A;  3OYA A;  2K5L A;  3FIF A;  1SSF A;  4EDU A;  5FU6 B;  1BKB A;  2LVM A;  2XU8 A;  4LDV A;  2DTH A;  2QQ9 A;  4M77 A;  3JCM e;  3S3O A;  4RMO A;  4JRQ A;  4O6J A;  4EMK A;  1VQ9 T;  1Q7Y U;  2OTL A;  1QVF S;  3RES A;  1KG1 A;  1I8F A;  4ATO A;  2BUD A;  2RI5 A;  2E1H A;  1RL2 A;  4LDU A;  3OS2 A;  1QVG A;  4BI3 A;  2Y90 A;  2ZZD A;  3V7C A;  3X24 B;  2RHY A;  4BY6 C;  5GAO n;  3L2W A;  1WJQ A;  2L8D A;  3UT1 A;  3DB3 A;  3G7Z A;  3QO3 A;  4OGE A;  4A4F A;  3A8O B;  2AHJ B;  4C8Q D;  1X75 C;  2JTM A;  5GAO l;  4E7H A;  5CQX A;  3N5B B;  1K9M C;  2JOY A;  2KDS A;  5LJ3 j;  4IUR A;  2JTF A;  3VU3 C;  4FU6 A;  2VC8 A;  5GAM h;  4PJO D;  2O4X B;  4M75 C;  2IVW A;  3E9F A;  4IUU A;  4N4G A;  3JCM P;  3CBP A;  4FM4 B;  4J6X A;  3CCU A;  3OA6 A;  3LH0 A;  4PNO A;  1W4S A;  3KBG A;  4ME7 A;  3SWN B;  1YIJ T;  2PVD B;  3A8H B;  4E7J A;  1KQS S;  4A4H A;  4X34 A;  5C0M A;  4NS5 A;  4LD6 A;  2DXU A;  4XU2 A;  5CK9 A;  1N27 A;  1M1K U;  4BB7 A;  2QI2 A;  1B34 B;  2E5Q A;  1D3B B;  2QQA A;  3OMG A;  3PTA A;  1Q82 C;  4OP0 A;  4Y28 E;  3CC4 A;  1Q86 U;  2ZPF B;  2X4W A;  2RB6 A;  3GF5 A;  3FLG A;  3HRS A;  4KUL A;  4C5H A;  4MML A;  5J3B A;  5GAM d;  3OYI A;  1M90 C;  1GXI E;  4OF1 A;  5GAO r;  3HL8 A;  1QVF A;  3QKJ A;  3QYG B;  2R58 A;  4QVD A;  2MI6 A;  4M75 E;  1XNI A;  2KMT A;  2XDB A;  2RD1 A;  2DD5 A;  3L2Z A;  4XTU A;  2LCC A;  4BDY A;  1K73 U;  3O8V A;  2K5F A;  2DTI A;  3HHT B;  2FB7 A;  4M78 C;  2Y4Y A;  1PSE A;  5CIU A;  1YJ9 T;  4J8O A;  1VQ4 T;  2CGH A;  2NLU A;  2PVO B;  4IKF A;  3FDR A;  2HQX A;  1R8O B;  3CCM A;  2F5T X;  3BW1 A;  5IN1 A;  1WQW A;  4C92 C;  3DKM A;  1K8A C;  5CQY A;  3ME9 A;  2RJE A;  1FWZ A;  4M75 D;  3DB4 A;  2V8K A;  5HK0 A;  3JB9 H;  5C6S A;  3CCU T;  1G3T A;  2DZ9 A;  1Y71 A;  5GAN h;  4M7A C;  2E10 A;  5GMK m;  5GMK i;  3OMC A;  2DEQ A;  2XI9 A;  3TEE A;  5HK3 A;  1BI0 A;  3JCM g;  2CZ1 B;  2R57 A;  3PMI A;  4A53 A;  3JCM Q;  2EIF A;  4GLK A;  3QPH A;  1YJN A;  1VQN T;  1VUB A;  1XQH A;  3LLR A;  5IT9 E;  3RKX A;  2QTX A;  1M8V A;  3R6O A;  3CD6 A;  3CC4 T;  4O5V A;  2RK2 A;  2E41 A;  3HPW A;  4M77 D;  1KQS A;  4M78 E;  3VV0 A;  3CC7 T;  3OY9 A;  4F7U B;  2RJF A;  3OBY A;  4CI0 C;  2K2V A;  3LGF A;  3OYK A;  3QSU A;  2E65 A;  2QQB A;  1JJ2 S;  4C0G A;  5KE3 A;  4N0A A;  2CYZ B;  3BFM A;  4C92 E;  5D6W A;  2FL7 A;  2VXF A;  5GAN d;  5FRN A;  3OYY A;  4FL6 A;  1EIF A;  2H3J A;  1VQK A;  1M1G A;  1I81 A;  4M78 D;  3G6E A;  4M7A F;  4E7L A;  1WGS A;  2CZ6 B;  2EQJ A;  4C0F A;  4M7A E;  4J6W A;  3UWN A;  4II1 A;  3VJP A;  1KD1 C;  3OQ5 A;  3QJ6 A;  2DO3 A;  3JB9 G;  3CME A;  1I4K 1;  2YLB A;  3OYE A;  1VQ6 A;  4KUD K;  3ZFJ A;  4MZP A;  4C92 D;  2QA4 T;  2RI3 A;  1G3Y A;  2M1H A;  3JCM J;  1YHQ A;  4M7D G;  2M9U A;  2I2L A;  3L2R A;  4FT4 A;  2ZPE B;  5I2S A;  3J80 E;  4BE1 A;  3PGG A;  1U1T A;  2C06 A;  5GAM j;  4DA4 A;  4JJN K;  1UB4 A;  2LCL A;  3WVE B;  1KHI A;  1QVP A;  2MWO A;  1HK9 A;  2L89 A;  3C94 A;  4M75 A;  2FVU A;  4RG8 A;  1M1F A;  1YJW A;  4XU3 A;  1YJN T;  3CCE A;  3OS5 A;  1VQM A;  3EAE A;  3V7R A;  4QVC A;  3SWN A;  5LJ5 d;  2DIG A;  4C0D B;  1VQ8 A;  1O75 A;  3QJY A;  3CD6 T;  1S72 T;  2XHC A;  2DAQ A;  2RJC A;  3HKS A;  5LJ3 e;  4RKU E;  3JB9 I;  2O01 E;  1LJO A;  5A0D A;  5FU6 C;  1KC8 C;  1VQL A;  1D3B A;  4F7U G;  5D6X A;  1JBM A;  5GAM f;  4C8Q B;  2HAX A;  4E47 A;  3CCL A;  3VYH B;  4QQD A;  2E6Z A;  4IUV A;  4N0A C;  4JS4 A;  3ER0 A;  3H8Z A;  2FYK A;  5KH6 A;  4ZTJ A;  3VKI A;  3M4G A;  3SDZ A;  5GAN 5;  2PUO B;  1VQK T;  5I2M A;  3G6E T;  3VUB A;  5CKF A;  3X28 B;  1JJ2 A;  4PJO B;  4VUB A;  2FHD A;  2EJG A;  3QHS A;  5CKB A;  1VQ6 T;  5GAO m;  5CCA A;  3CEY A;  3G4S T;  4M78 A;  3X25 B;  1QP3 A;  2A3L A;  3C95 A;  4QW2 A;  3A8M B;  2D6F A;  3GIB A;  2JN0 A;  1UGS B;  1Q81 U;  5CVI A;  2LC4 A;  4C8Q F;  1VQO T;  3F70 A;  1VQ5 T;  3MP8 A;  3LX7 A;  3MP6 A;  4OB0 B;  4C92 A;  4BDZ A;  3SD4 A;  4B9W A;  1YI2 A;  3PNW C;  2DK3 A;  1BI3 A;  1KHC A;  5GAN j;  4NL3 A;  3DLL A;  2EWN A;  2QQR A;  3SWN C;  2RI2 A;  4M7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...