4MZMA

Mazf from s. aureus crystal form i, p212121, 2.1 a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
b'DPIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA interferase MazF
publication title Structural and biophysical characterization of Staphylococcus aureus SaMazF shows conservation of functional dynamics.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase
total genus 36
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mzmA00
5HKCA 1UB4A 2VUBA 4MZMA 5CKHA 4MDXA 3JSCA 5CQYA 4ELYC 4MZTA 5CQXA 2KMTA 5CO7A 5CK9A 4MZPA 1X75C 3TCJA 5CKEA 4ME7A 3HPWA 4HKEA 4ELZC 5HK0A 4VUBA 1NE8A 5HK3A 3JRZA 5DLOA 1M1FA 5CKBA 5CKDA 2MF2A 3VUBA 3NFCA 2C06A 5CCAA 5CR2A 1VUBA 3G7ZA 5CKFA 4OF1A
chains in the Genus database with same CATH superfamily
3FLGA 2QQSA 4FU6A 3F70A 4C92G 1GL5A 2EKOA 1CKAA 1I4K1 5IHIA 3OYDA 4JS5A 2LRQA 3OMGA 1M4ZA 3MHXA 3A8OB 2OTLA 3CCVA 3X20B 3CEYA 2I0NA 1K8AU 2HKNA 1JJ2A 4B6MA 1VQ8T 1D3BB 5GAOr 4JPBW 4Q5WA 1IXDA 1YIJT 2RJDA 5CQXA 1O9SA 2RHZA 2GFUA 3OMCA 5GAOq 4N0AC 3TCJA 5FWBA 3HTRA 4Z02A 2CYZB 3HL8A 3JAME 2DVJA 1BB9A 1QP3A 1X6BA 3CCLT 3GLXA 3RKYA 1ARKA 2QEXQ 4MMKA 2EJFA 4C8QF 3RR6A 3GBQA 3JCMe 1UGPB 2DXTA 1NEGA 1WDXA 2EFIA 2FG0A 4LUEA 2RQRA 3HRTA 3J7AF 1D09B 3FIFA 1KC8C 1NZ9A 2LDMA 2ZCFB 4LNPA 3M0TA 4B9WA 1M90U 3PGGA 3LH5A 4AFZC 3OYGA 1ABQA 3CCVQ 1XJWB 4C8QA 5GJWB 1FYNA 6AT1B 1RLPC 4J6XA 1WI7A 4IUPA 1PD0A 5LJ5f 4L5GA 8AT1B 2C06A 2NUPB 3EHRA 5M9OA 1U8RA 3ZFJA 1I8FA 2VV5A 4M78F 3H0IA 5GMKi 1QVGP 3CC2A 2A3LA 2DERA 2M02A 1DJ7B 3L1AA 1VQMQ 2RPNA 4X1VA 5GANf 3KFVA 4EMGA 2QDLA 2CH4A 1M8MA 3EFSA 2V8KA 3EGDA 2X4YA 3OYLA 2DTOA 4FW1A 4M78A 4QVZA 4F7UF 3ASKA 2P0QA 2XHCA 3JCMJ 5LJ5e 3VRYA 1MMGA 2KYBA 3G71A 5HCKA 4LDWA 4LDUA 1ZSZB 4ESRA 3LWIA 4PJJA 1G83A 1VA7A 4NL3A 3EH2A 2JNGA 3DB3A 4F7UA 5GANe 2XIDA 5HK3A 1ZUKA 2QASA 4WCIA 1LCKA 4RCCA 2DJQA 4C5IA 2EYQA 3JCMV 3OS0A 1M1KU 1U1TA 3CC2Q 2AT1B 3JCMg 4KUDK 1BU1A 2DVEA 5D6YA 2FO0A 4JRPA 4GBQA 4PL6A 1B7TA 3SHWA 1Y96B 2D0NA 5KYUA 1OX9A 2BE7D 4Y28E 4M7AB 3OBYA 1CSKA 1TTHB 2DLPA 1WJRA 5IH2A 2COYA 2EYWA 1ZBXA 1SSFA 2X51A 4RUGA 1ZSZC 5CK9A 4OMFB 3UATA 4KBMB 4M75D 4JJNK 2HBPA 2VKNA 7AT1B 3QJYA 3X25B 2IVWA 5L23A 2CZ6B 3IQLA 1N8RC 1G5VA 3RUXA 1WHLA 2VC8A 1VQNA 2FRWA 1X6GA 4J8OA 3KXTA 1HD3A 5LJ5g 1W70A 1ZBJA 1SF9A 1SRMA 3I56Q 3ER0A 3OW2A 3P8HA 3M0QA 3C0CA 4M7AC 5GANg 2C0OA 4ZN3A 4B9XA 2O01E 1R0BG 2VGMA 4FSSA 5L8RE 1BCMA 1VQ5T 4RTXA 1XTDA 3BDUA 3QZ5B 1VQ9Q 3QXEB 3RDVA 1VQLQ 2L0AA 1YITT 3CCQT 3QPHA 4J7FA 3MEVA 4JUVA 2F2WA 5CCAA 4PJLA 3BW1A 1V76A 4V2SA 2M51A 2LQKA 4L6V5 1YWPA 1WJQA 4NL2A 2GFAA 5LJ5d 4R56A 2FRYA 2QTXA 4CRIA 2FPDA 4XU0A 2DF6A 1KQSA 1E6GA 3I55T 2J06A 4C5HA 2KE9A 1Q82U 2ECZA 2LT1A 4HCZA 2DEUA 2DL4A 5GANd 2X4WA 2EQUA 3SEMA 1NPRA 1M8VA 2RO0A 5KE3A 1BIAA 1X75C 1UEBA 3LH0A 3BDLA 4FL6A 2FVUA 2DRKA 3CD6T 1ZQ1A 1WHHA 4LD9K 5CKBA 4IUTA 2E1HA 1VQOA 1QMCA 3JCMb 1Q7YC 3ZEHA 2E6ZA 2ROLA 3OYCA 1KQ2A 3KBGA 4PJOF 5I2SA 3L2RA 2RM4A 3A1PA 3OYNA 1ZSZA 2CP0A 3X28B 3LWHA 1AZGB 3R6NA 1D1AA 3G4SA 2RH2A 1M5Q1 5KE2A 2P0PA 2YWWA 1NBEB 1M1FA 4IIMA 3SB2A 2QQBA 2BE9B 1KC8R 4PJOA 2W0ZA 2GBQA 2V26A 2A7YA 2GGRA 5KCHA 3CMET 2W10A 4F7UE 1HJDA 4EMHA 5CAIA 4JS4A 2VB6A 2K3XA 2DL5A 3X24B 4A4EA 2HQEA 2LT4A 1VQOQ 1Y96A 3REAB 1SRLA 5IT9E 4O5VA 2DYBA 2PQWA 2QEXT 1KIKA 4O6JA 4FYVB 2FZGB 2AIRB 1OULA 1VQ6Q 4OMNA 2R58A 1VQPQ 2X35A 3CC4A 4ATOA 3REBB 2YDLA 3URGA 2D8HA 4JRQA 3JCMh 2NLUA 4LDVA 1WFWA 2QTVA 2EWNA 4C0FA 2XK0A 3EAEA 2DIQA 1GCQC 4X9CA 3EG2A 5IAYA 2PZ1A 1VQMT 3JCMc 4HVWA 1IHVA 2VVKA 2ZPIB 2XICA 5AYFA 1KJWA 2LX7A 2QG9B 2LCCA 2DL8A 4M7AD 2DE0X 2C0IA 4X9DA 1AZEA 3A8MB 1NJIR 1BYMA 2K2MA 2LVMA 4OMMA 4BE1A 2ENMA 3CC4Q 4LDXA 4NOYA 2CSQA 3MP6A 3INZA 4HCKA 4M77B 2LNVA 3N5BB 2MAMA 5CKFA 4Y92A 1EX4A 3CCET 2YXYA 5LJ5h 4F16A 3GNGA 5LJ3f 3CC2T 5J26A 4M7DF 3OYHA 1UGRB 1WQ7A 1ZLMA 4C92B 2CKKA 4PJNA 3E9FA 2ED0A 2HKQB 2MIOA 1TUCA 1GBQA 5GANh 5HY6A 4QQ6A 1KC8U 2V8JA 4GY5A 1JU5C 2JN0A 2KYMA 4M7DA 1AT1B 4XU1A 3C95A 4QVDA 2JS2A 2LP5A 3CC7A 4OMQA 3MKDA 2RJEA 2G6FX 2PNIA 1YJ9Q 5LJ3e 4DA4A 4ZGJB 1AHJB 4R55A 2JOYA 4BB7A 1SEMA 2D0QB 3L2UA 3I5RA 4M77C 3MO8A 1KHCA 1IGQA 9ATCB 1GBRA 4E2FB 4BE0A 1KFZA 3H41A 1YJNA 3DLLA 2PVGB 1W1FA 5KYXA 1VQ7A 2Z0WA 1JO8A 1MGQA 3KUFA 3JB9J 1GXIE 5FU7B 1WXTA 2D1XA 3CMAA 4C92C 2E41A 3L2ZA 1M90R 1BCOA 1JJ2S 4A4GA 3OYMA 2JVVA 3QKJA 2DKGA 3JRZA 1W4SA 3SD4A 3I56T 2RN8A 1Q86C 2PUKB 2EYYA 1FWZA 2E12A 2RD1A 3CC7Q 2PU9B 3JSCA 2JS0A 4DQ2A 1N5ZA 1UUEA 5AT1B 3CXCA 4TVRA 1GCQA 2KK4A 4PJOE 1H3ZA 4GLMA 4RG2A 2G3RA 2YSQA 1VQ9T 2MF2A 4A53A 1VQLT 2LZ6B 2VXFA 2E64A 3LYIA 2DFUA 1VOMA 5GAN5 1VQ7Q 5KCOA 5GAMj 1TG0A 1AWWA 2A36A 2FPEA 2KI7A 1M2VB 3CMAQ 2PVOB 5FU7C 1RAAB 3PIPA 5IHNA 2HL5C 5GANj 2RQWA 1ABOA 2RNAA 1PG5B 5LJ3g 1NPPA 1RL2A 3Q1JA 4LUDA 3NFCA 4QQDA 2AZSA 2DETA 3EFOA 2MYSA 1JRIA 3CCMA 3SFMA 3L2VA 2JTFA 1M1KR 1S1NA 1GFDA 1N8RU 2X3XD 1R77A 2LQNA 3JB9D 3VS2A 3EGXB 3NTHA 4FIBA 2M0OA 1SHFA 2J05A 3NTKA 4C8QG 4NS5A 2HEQA 4Z88A 1MHNA 2QAZA 1P92A 2F5KA 5GAN7 2QA4A 3P8BB 2DMOA 2DD4A 2RI3A 2AZVA 1WLPB 3QYGB 2JMCA 2NUTB 2K9GA 1VQ4A 1YNZA 1Y07A 4QVCA 2LCLA 1TS9A 3CCMQ 1KSWA 5LJ3d 2KT8A 2P84A 1U1SA 2VXEA 3PMTA 1X43A 2YRVA 2E3IA 3V8LA 3VUZA 3G6EA 1X6OA 4M78G 3PMIA 2CP6A 2K3YA 2OJ2A 4LN2A 4IUVA 4A4HA 1OV3A 3VS6A 2FEIA 1YCYA 2OTLQ 1VIFA 2SEMA 4HVVA 2MOXA 3LW5E 4DBRA 1UJ0A 4AT1B 1KK7A 1QVFA 4IURA 4OVAA 1PKSA 2CZ7B 5GAMf 1BK2A 1N27A 3CCRA 4F7UG 5GAN2 5A0GA 4C0DB 2OAUA 1VQOT 1K9MC 1QQJA 3I9QA 1Z9ZA 2CP2A 3H0HA 4ELYC 1RI0A 2CUBA 1IZ6A 5DLQE 4BI4A 2XI9A 3UPUA 1UFFA 4M75F 4HCBA 3QDFA 4QT7A 1VQ6T 4M7DE 2VGNA 2CT4A 3QWYA 4N4HA 4D6WA 4LE9A 1VQPT 2FYKA 3G6EQ 4M77D 4OMOA 3HRUA 3UDCA 5GAMe 2KROA 2ZPGB 2ZPEB 3OW2S 2BUDA 3RMQA 4M75A 2P4TA 2C0TA 4JRKA 2J6OA 2GNCA 2XG8D 4XTXA 3RBBB 4AG2C 1U06A 1Q7YU 2CH4W 3EG1A 3A8HB 3OA6A 4BD3A 4C92D 2EGEA 2KRSA 2CP5A 2Y90A 1Q82R 1TOVA 4PLLA 4C0DC 5KYNA 1HSQA 4J5YA 2DILA 3MEAA 4IKFA 3OYAA 4IUQA 2DTIA 4KT0E 3VS1A 3NMZC 2M9UA 5CKEA 2LJ0A 1AWOA 3MPUB 2EYXA 3H9NA 2CZ1B 4RG8A 2RK2A 3OS1A 1KG1A 1H8KA 4HT8A 4DOVA 3CC4T 2V1RA 1BBZA 3JCMW 2OTJA 3G71Q 1G3WA 1K73C 1XOVA 2GTJA 1KQSS 1I5LA 1ZUYA 5GAN3 2LCSA 2KMTA 3QIIA 1TH7A 2QXFA 3C12A 1NYGA 2YLBA 3EG9A 1YI2T 2YUNA 4N0AA 1VQKT 4E6RA 3DLMA 4EPCA 2KVQG 3V8KA 3JCMQ 4J6YA 1VYUA 2QK0A 1M9SA 2NWMA 3HFNA 2RQTA 2ZGWA 1QKXA 2ED1A 1K0XA 5GAMg 2MI6A 3HHTB 4A54A 5GAN6 3JB9H 3QYHB 1S72A 2LMJA 1AVZC 1MUZA 3M4GA 5I22A 4HKEA 1QKWA 4XAXB 1SG5A 3EGXA 4Y91A 1FMVA 1TUGB 1H3HA 1YJ9T 2DZ9A 4OGCA 1JJ2P 4PFPA 2RI5A 4DBFA 2OTJQ 1QCNA 1JEGA 1V29B 1ZSGA 1ZX6A 3C94A 1MV0B 1I5OB 1BI2A 2L3QA 1RLQC 1D3BA 5J39A 1WGSA 2CS7A 1W2BA 4RTWA 2O4XB 4RTTA 2XD0A 1K9AA 2LX9A 1ZA2B 1QWFA 5LJ3h 2QQRA 5FLXE 1VQNQ 4PFOA 1JXOA 3GPLA 3J81E 2MK5A 3CCSA 3M0RA 2HZYA 3NTIA 2KXDA 3H8ZA 1YHQT 2LTOA 2EBPA 2ROTA 5GAMd 3PIOA 2D9TA 4OF1A 4PJMA 1YIJA 2NUPA 3RNJA 4J83A 2QQAA 2EYZA 2KSSA 4EMKB 2RI2A 4C8QE 1WHKA 1IB8A 4PJOG 2KAFA 4HCCA 3CCLA 4ORZA 2L89A 2L5QA 3UWNA 2DZCA 1K76A 3CCSQ 1EFNA 5KYWB 2K3BA 3VS7A 4XK8E 3SDZA 2CP7A 1NEBA 1M3CA 3OYBA 4CC2A 4E7IA 1IO6A 1IRXA 2CUDA 3AT1B 2EQJA 4JDSA 5GJVB 2F2VA 3QUIA 2BTTA 4M78E 4RKUE 1WJSA 1AEYA 3NGPA 1ZA1B 2D8JA 4OB0B 2HQHA 3HRSA 2KDSA 1WHGA 3EH1A 1WXUA 3FC3A 4M75E 1D0XA 2J7IA 2K4YA 2K57A 3VS3A 1LJOA 4EMKC 2DXBA 4M7AF 2P4RA 4PKCC 3CCLQ 4R0KA 4MZPA 4A63B 5FW9A 1I81A 1SPKA 2LNHB 2YHTA 5LJ3j 1YFNA 1WZOA 1Q86U 5KYYB 4AMCA 1D1CA 3S6WA 1K9MR 2XU8A 3CPWA 1AD5A 4M7AA 3E19A 3ZBDA 5FWCA 2DXUA 2SRCA 4CC7A 5ECAA 5CO7A 1OI1A 5IXBA 2HQXA 1RABB 3G4SQ 3M56A 3M0PA 2KXCA 2K5LA 1NE8A 1MV3A 5CKDA 3EGUA 2OTLT 3CCVT 5EG2A 2JM9A 5GAOp 4XQ3A 3A8LB 2JZ2A 4E7SA 1WQWA 1X27A 3OW2P 4C5EA 1AOJA 4PNOA 4PFZA 1PHTA 4IUUA 2WSEE 4HVUA 1HXDA 2DTHA 2DRMA 2VASA 4J9IA 2QQ9A 5DM7R 2JT4A 2FB7A 1UG1A 2RHUA 2EJ9A 1WA7A 4XTYA 1G2BA 4HA8A 4QW2A 4WTOB 3GNFB 3G6ET 3OYJA 2AKLA 3ULRB 4M7DG 2O88A 3VS0A 4F14A 5GMKj 3MJXA 3PTAA 1Q81C 1T3SA 4C0ZA 2K7AA 5CKHA 1OEBA 4LDYA 4Z89A 2YUQA 3SWNB 3CXCS 4KULA 1K4US 5GAMh 2HSPA 5I2MA 1M2OA 1EIFA 4FYXB 2EGAA 1KQSP 2FPFA 4KGXB 1N8RR 3G1JA 3M55A 3OS2A 4XU2A 2MWPA 3M4YA 2E4HA 1PSEA 2RMOA 4YTLA 4CC3A 2DPPB 3UA6A 4J9BA 1SHGA 4LD6A 1VQ5A 1WIEA 2DL3A 5GMKm 1YCSB 1ZHIA 4K11A 2KQWA 2WACA 3G71T 1YITA 2HCKA 3CCQA 1Y57A 2BIVA 1RUWA 1WHMA 1RAHB 5A0LA 4ZNXA 3PT9A 1K9MU 4JJBA 3OYFA 1PM3A 1KD1C 2PTKA 4LXCA 1YBYA 4BUGA 3SWNC 3DB4A 3VU3C 5C0MA 4N4GA 1QVGA 1K1ZA 3UA7A 1UTIA 4UC4A 5FROA 3H0FA 3I55A 3CBOA 1Y0MA 2H8HA 2CP3A 3EHQA 2JM8A 1OU9A 4FT4A 4XTUA 2ATCB 3JB9F 4II1A 3M0SA 1VQ5Q 2CT3A 1WXBA 3A5ZB 2GF7A 4HXJA 2AK5A 2XDDA 4KH0B 5IXFA 2JTEA 2K79A 3I35A 1RI9A 1YITQ 4IIOA 1J3TA 2DM1A 1SKUB 1RACB 2FHDA 3CD6A 1VYVA 4F7UB 2CSIA 4JJCA 2B86A 2FZKB 2O2OA 4C0GA 5A2QE 5KYYA 4DBHA 3MEUA 3FEOA 1B3QA 1TWBA 2YLCA 1KQ1A 1BIBA 2YT6A 3BY7A 3WXMB 3MP1A 4P5NA 1YJNQ 1PSFA 1QVPA 2OI3A 1VQNT 2K5IA 3FJ5A 5CQYA 3TU4K 2EQIA 2COWA 3A8GB 1QVFS 1YN8A 1UGVA 3M54A 4ELZC 4M7AE 2E65A 5GMKe 1K73U 1Q7YR 5CIUA 1M1GA 1OYXA 3CMEA 1QWEA 2CGHA 3E9GA 4E7LA 3RMSA 1LOJA 1V1CA 2IG0A 2ZPBB 3JB9I 1N6AA 2JMAA 1N9SA 3CQTA 3TREA 3V7SA 2FZCB 2PVDB 2X3WD 3G7ZA 3V8JA 1XQHA 5LL6S 2DIGA 4RTZA 3CCST 3NHNA 4PK4A 5GAN8 4M77F 2XDBA 3M58A 4AG1C 3OSSC 1M27C 2M0YA 1MMAA 1B34B 2MCNA 3JCMf 5C6SA 2M16A 1UE9A 3RKWA 2F1LA 3WVEB 2KY9A 3CMEQ 5IN1A 4BDYA 5CR2A 3FJPA 2YRDA 4C92F 4M77A 3U23A 2DBMA 2EPDA 1WX6A 2LJ1A 2RJCA 1FX7A 2F5TX 4PLIA 3SWNA 1VQMA 3UF4A 2JUFA 1SSHA 2BZ8A 3EG0A 2KBTA 1TUDA 4M75G 4C92A 2RHYA 1GFCA 1WNLA 3MEWA 3VJPA 4J9EA 2A0FB 2MMPA 2LQWA 2EGCA 2QA4Q 4D8DA 2H3EB 2E5QA 2Y4XA 1N9RA 1LPLA 1OX8A 4RMOA 4JZ4A 3E2UA 1VQ4Q 2ZPFB 4FYWB 4VUBA 2DAQA 4ZTFA 3RIRA 1UECA 1TSFA 1U3OA 3VRZA 3G4ST 3QWXX 1JBMA 2MWOA 3CCEA 4E7JA 2E6NA 2A08A 3S3OA 3WVDB 1M3AA 2EW3A 1OQKA 3QJ6A 2YUOA 2WSFE 2HL3A 3H6ZA 3PNWC 4XTVA 2DXCA 3VS4A 3T9NA 1Q81R 4BI3A 2X4XA 1YJWA 2I2LA 3GF5A 2H3JA 1I1JA 2GQVA 2F69A 3CCRQ 1PCXA 2OX7A 4MDWA 1W2BS 3AHUA 4C5GA 4A4KA 3M5AA 1UGQB 1Y7XA 4FCYA 3V7CA 3ZL7C 1YWOA 2DA9A 3OB9A 3TEEA 3CCUA 3CXCP 1T0HA 4C8QD 4OMLA 1B07A 2A28A 2KR3A 2EIFA 4PJOB 3CCEQ 2K5FA 2Y4YA 2NYSA 5FU6B 1X2QA 2LJ3A 4XU3A 4MZMA 2KEAA 4MDXA 4BDZA 1UDLA 2LQ8A 1R8OB 5FRNA 1G3YA 3I5SA 1M2VA 1NJIC 1IREB 1YJWQ 3O5ZA 4DOWA 1KD1R 4JZ3A 3THKA 4A4FA 3I56A 4M4ZA 2ABLA 2L3RA 4M78D 1MNEA 4CI0C 1PRMC 1I07A 5GAOn 2M1HA 4OMPA 4E47A 2JJ9A 5I21A 4ANJA 2JXBA 2F2XA 3CCUQ 3A98A 1T3LA 1X69A 3ME9A 2AKKA 4EDUA 1VQ9A 5DY9A 4CC4B 2ZAEA 1GCPA 1VQLA 2DNUA 4PJOC 1MNDA 2L3PA 3RESA 2QEXA 1Q86R 4E7HA 3QZ9B 5FU6C 4KRTA 1FXXA 2O9VA 2A37A 3JCMd 3JV3A 1K8AC 1OOTA 4MZTA 3CCJA 3OYYA 1KHIA 4DEYA 2R57A 2O9SA 2RQUA 1NG2A 1VIEA 4WF2A 1H92A 3GP8A 1B34A 1I0CA 1QW1A 4AFSC 1W6XA 3TQ7P 2NUTA 2WSCE 5I11A 3OQ5A 1QCFA 2KT1A 2DYIA 3CPFA 2HSEB 1C1AA 1Q95G 1S72Q 4JJDA 1Q81U 2VWFA 1PKTA 3LX7A 2E10A 3CC7T 4J9HA 4M77E 1IGUA 1O75A 3CPWS 3HKSA 1G3TA 3DKMA 1QVFP 1M90C 1ACMB 1D0YA 1H641 2COZA 4BY6B 1ZUUA 4Z8AA 3RERA 4OP0A 1JB0E 4ZN1A 1C0MA 1VQ8A 1K0SA 1PWTA 2DEQA 2NUZA 5A0DA 3LGLA 3L42A 4DEXA 2RHXA 3O8VA 3CCJQ 3X26B 1NLPC 1IHWA 4C92E 2E70A 1YJNT 1OZ3A 3NPFA 1VQ7T 2L2PA 1BI0A 4RCBA 5GAN4 1R0CB 1F1BB 2RQVA 3META 3CMAT 2DO3A 5DLOA 3C4SA 3OYEA 3JCMX 4M7DB 3HSBA 1LVKA 1G8XA 2CREA 2HAXA 4BACA 2FL7A 2RJFA 3L2WA 2IIMA 4M7AG 4J9CA 1KD1U 1E6HA 5HK0A 2BZYA 1VQ8Q 1OZ2A 4KGVB 4BY6C 1RAFB 4EIKA 5GMKh 3J80E 1QCOA 1YIJQ 1VUBA 2LC4A 1NLOC 3JCMP 1D1BA 3R6OA 5KYXB 2YRCA 3RKXA 1OU8A 1TU0B 3OBWA 1M1KC 3M9QA 2QGGA 1AWJA 2HNIA 4FSXA 1VQ6A 2D6FA 1VQPA 4D8KA 5EC7A 4QQGA 1WHJA 1FMKA 3LLRA 1Z9QA 2IPOB 1UHCA 3LGFA 4M7DC 2QI2A 1PRLC 3PFSA 2J6FA 1OPKA 3CCMT 3QHSA 4X34A 2BZXA 2RK1A 3CBMA 2VYTA 2JW4A 2AHJB 3P8DA 5GAOl 4XTZA 3QG1A 3VUBA 2CDTA 2ZZDA 2V1QA 1M30A 5IHKA 4DBQA 4KGZB 3VYGA 3OYKA 1D0ZA 4OB2B 4F17A 3HP9A 2QA4T 2K6DA 2EKHA 1RAGB 1UJYA 4AFUC 2DX1A 3EFOB 3M53A 4KUIA 5FRMA 1QLYA 3M0UA 1VQ4T 1NYFA 1QVGS 4PJOD 4FW2A 4HT9A 4JLGA 1JQQA 2OAWA 1MMDA 2O31A 1W2BP 2L8DA 5GAOm 5CVIA 2JTMA 2DJZA 2GQIA 1YI2A 1VQKA 5GMKl 4ME7A 2DBKA 1RAEB 3S3NA 4ZTJA 4ZGEB 2O4XA 3OSVA 3OS5A 2HBWA 3CBPA 3MP8A 1XNIA 3TSWA 3BE3A 3OYIA 4J6WA 2R5AA 1YP5A 1LNXA 3TVTA 3EFRA 4OGEA 3HPWA 5J3BA 1K73R 1PNJA 2HD0A 2DD5A 2CZ0B 1PD1A 3FDRA 2X9HA 3CCRT 1MMNA 2B8AA 2EAYA 3L2QA 1QP2A 2QYZA 3EG3A 2XKOC 2QGFB 1HK9A 1YJ9A 4FT2A 2RF0A 2E5KA 4RTUA 4RTVA 3VV0A 2EQMA 1WYXA 3QDRB 3PE0A 5D6WA 4J9FA 3VS5A 5D7UA 1UB4A 2E3HA 2L3SA 3QSUA 1Q82C 4E7KA 4AFQC 4F04B 1YI2Q 1Y71A 2J6KA 4MMLA 4XTWA 1VQKQ 3GIBA 4JRIA 4EMKA 2ESWA 4GLKA 3E1SA 4C8QB 3HFOA 1BI3A 4OB1B 1M3BA 2KRMA 2DK3A 2EVRA 3QBYA 3QO3A 3JB9G 1YJWT 1GRIA 2V8IA 3M59A 1JXMA 1K8AR 1VYTA 4J7IA 5KYWA 1FMWA 2XDPA 1YHQA 4E7ZA 4QKUA 2ZPHB 1BI1A 3M57A 4J9GA 1G3SA 1CKBA 2XMFA 3MCAB 2YUPA 2DL7A 1UHFA 3EGDB 3CCUT 3S3MA 1AWXA 4M78B 1X01A 2GCXA 2P0KA 2R5MA 3TSZA 3FB9A 3BFMA 4M75B 2X4JA 4JLIA 1C6VX 1TXQA 2OTJT 1WPYA 2PUOB 3CCQQ 1T0JA 4C8QC 2BKDN 3VKIA 4RTYA 1BKBA 1PC0A 2KNBB 1NM7A 3FRNA 4N4IA 3CPWP 1YHQQ 4L59A 5KH6A 1UGSB 1EZZB 3V7RA 2EQKA 4M7DD 1RADB 2RB6A 3I55Q 1U5SA 2MPXC 4J9DA 8ATCB 3GOXA 5KYUB 3UT1A 1S72T 4M78C 2KGTA 1E7OA 4BE2A 2RHIA 4KH1B 1A0NB 1OPLA 5LJ5j 5HKCA 4ZGDB 1NJIU 2VUBA 4FM4B 4FYYB 4M75C 1HYOA 3VYHB 3CD6Q 2HDAA 4OB3B 3D7SB 4M77G 5D6XA 1X2KA 3CCJT 3EG9B 2KRNA 4BI8B 2HMAA 3OY9A 2QDYB 3PVQA 2GTOA 2RA2A 1RAIB 2EJGA 2K2VA 3PVLA
chains in the Genus database with same CATH topology
3FLGA 2QQSA 4XU3A 4FU6A 3F70A 4MZMA 4C92G 3OYBA 4E7IA 2EKOA 3CCET 4MDXA 5LJ5h 2EQJA 4JDSA 4BDZA 2QA4A 1I4K1 1R8OB 2LQ8A 3GNGA 3QUIA 5J26A 5LJ3f 3CC2T 3OYDA 4JS5A 5FRNA 4M7DF 1G3YA 3OYHA 1UGRB 1WQ7A 1IREB 1NJIC 2LRQA 4M78E 4RKUE 4DOWA 1WJSA 4C92B 2CKKA 3E9FA 3OMGA 1M4ZA 3MHXA 4A4FA 3I56A 3A8OB 2OTLA 4OB0B 3CCVA 3X20B 3CEYA 5GANh 2L3RA 5HY6A 4QQ6A 3HRSA 1KC8U 1K8AU 2KDSA 2V8JA 4GY5A 4M78D 1JJ2A 3FC3A 4M75E 4CI0C 2JN0A 5GAOn 2M1HA 1VQ8T 4E47A 1D3BB 4M7DA 5GAOr 2K4YA 2K57A 5I21A 1LJOA 4Q5WA 4EMKC 2DXBA 4XU1A 3C95A 4QVDA 1YIJT 4M7AF 2RJDA 4PKCC 5CQXA 1O9SA 2RHZA 4MZPA 2GFUA 3CC7A 3ME9A 3OMCA 1I81A 2RJEA 4EDUA 4N0AC 3TCJA 5GAOq 1VQ9A 4Z02A 5LJ3e 5DY9A 2CYZB 2YHTA 5LJ3j 4ZGJB 4DA4A 1AHJB 3HL8A 3JAME 4R55A 1VQLA 2JOYA 1Q86U 1QP3A 3CCLT 4BB7A 2D0QB 3GLXA 3RESA 3RKYA 3L2UA 2QEXA 4M77C 3MO8A 4PJOC 4MMKA 2EJFA 3S6WA 4C8QF 1KHCA 3JCMe 1UGPB 2DXTA 4E7HA 3QZ9B 5FU6C 2XU8A 3CPWA 2EFIA 4M7AA 3E19A 3ZBDA 2DXUA 3HRTA 4BE0A 1FXXA 3J7AF 3FIFA 3JCMd 1YJNA 3DLLA 1KC8C 1K8AC 2PVGB 1VQ7A 4MZTA 1MGQA 1NZ9A 2LDMA 2ZCFB 3KUFA 5CO7A 4B9WA 3CCJA 3OYYA 3JB9J 1OI1A 1M90U 1KHIA 2HQXA 2R57A 3PGGA 5FU7B 1GXIE 3CMAA 4C92C 2E41A 3L2ZA 3OYGA 1VIEA 3M56A 4WF2A 4C8QA 4A4GA 3OYMA 2K5LA 1JJ2S 2JVVA 1B34A 1NE8A 2DKGA 3QKJA 3GP8A 3JRZA 1W4SA 1QW1A 4J6XA 4IUPA 3SD4A 5CKDA 5LJ5f 4L5GA 3I56T 2WSCE 2C06A 2OTLT 3CCVT 5M9OA 1U8RA 3OQ5A 5EG2A 3ZFJA 3CPFA 5GAOp 1Q86C 1I8FA 2PUKB 4XQ3A 1FWZA 2VV5A 3A8LB 2E12A 2RD1A 4M78F 4M7AE 2JZ2A 5GMKi 3CC2A 2A3LA 2PU9B 3JSCA 1WQWA 1DJ7B 3L1AA 4DQ2A 5GANf 1Q81U 3LX7A 2E10A 4C5EA 4EMGA 3CXCA 4PNOA 4TVRA 2KK4A 3CC7T 4PJOE 1H3ZA 4RG2A 4IUUA 4M77E 2WSEE 1O75A 2G3RA 3HKSA 1HXDA 1G3TA 3DKMA 2V8KA 3EFSA 3CPWS 2DTHA 1VQ9T 1M90C 1H641 2X4YA 2QQ9A 2DTOA 4BY6B 5DM7R 3OYLA 3RERA 2FB7A 2MF2A 4OP0A 1JB0E 4M78A 4QVZA 4A53A 4F7UF 4ZN1A 1VQ8A 2RHUA 1VQLT 2VXFA 2E64A 2EJ9A 3LYIA 2DEQA 3ASKA 2P0QA 2XHCA 5A0DA 3JCMJ 3LGLA 5LJ5e 3L42A 5GAN5 5KCOA 5GAMj 4XTYA 2RHXA 3O8VA 4HA8A 4QW2A 3G71A 3X26B 4LDWA 3GNFB 4LDUA 2PVOB 4C92E 2E70A 3G6ET 5FU7C 3OYJA 1YJNT 3LWIA 1OZ3A 4M7DG 3PIPA 1VQ7T 1BI0A 4NL3A 4RCBA 2JNGA 3DB3A 4F7UA 5GANe 5GAN4 5GANj 2XIDA 5HK3A 3META 3CMAT 5GMKj 2DO3A 3PTAA 5LJ3g 1NPPA 5DLOA 4RCCA 1Q81C 1RL2A 3Q1JA 3C4SA 3NFCA 4QQDA 4C5IA 3OYEA 2EYQA 3JCMV 3JCMX 4M7DB 3HSBA 3OS0A 1M1KU 1U1TA 1JRIA 3CCMA 3JCMg 4C0ZA 4KUDK 5CKHA 3SFMA 4LDYA 3L2VA 2HAXA 2JTFA 3SWNB 3CXCS 4KULA 4BACA 2FL7A 2RJFA 5GAMh 2DVEA 5I2MA 3L2WA 1N8RU 4M7AG 5D6YA 1KD1U 1EIFA 4JRPA 3JB9D 3NTHA 3M55A 5HK0A 3OS2A 4XU2A 4FIBA 4PL6A 2MWPA 1Y96B 3M4YA 1OZ2A 1PSEA 4BY6C 4YTLA 4Y28E 4M7AB 2DPPB 2M0OA 3OBYA 5GMKh 3J80E 4LD6A 1VUBA 3NTKA 1VQ5A 4C8QG 2LC4A 4NS5A 3JCMP 3R6OA 1WJRA 1MHNA 3RKXA 5GMKm 1ZBXA 1P92A 1SSFA 1ZHIA 3OBWA 2F5KA 4OMFB 2KQWA 3P8BB 4KBMB 4M75D 5CK9A 5GAN7 2WACA 2HBPA 3M9QA 4JJNK 3G71T 2HNIA 4FSXA 3CCQA 2DD4A 2RI3A 1YITA 1VQ6A 2BIVA 3QYGB 3QJYA 2D6FA 5A0LA 3X25B 2IVWA 1VQ4A 1VQPA 2CZ6B 3PT9A 1K9MU 1N8RC 4QQGA 1G5VA 3OYFA 1Y07A 4QVCA 2LCLA 1KD1C 3RUXA 4M7DC 3LLRA 2VC8A 3LGFA 1VQNA 5LJ3d 2QI2A 1U1SA 2VXEA 3PFSA 3PMTA 1YBYA 2YRVA 4BUGA 4J8OA 3V8LA 3SWNC 3DB4A 3KXTA 3VUZA 3VU3C 5C0MA 3QHSA 1X6OA 4M78G 4N4GA 4X34A 5LJ5g 3G6EA 3CCMT 1QVGA 4UC4A 5FROA 3PMIA 2K3YA 3CBOA 3I55A 4A4HA 4IUVA 2RK1A 3CBMA 2VYTA 3ER0A 1YCYA 2AHJB 3P8DA 3OW2A 5GAOl 1VIFA 4FT4A 4XTUA 3P8HA 3LW5E 3JB9F 4II1A 1QVFA 4XTZA 4M7AC 3QG1A 4IURA 4OVAA 5GANg 3VUBA 4ZN3A 4B9XA 2CZ7B 3A5ZB 2O01E 5GAMf 2ZZDA 2GF7A 1N27A 2XDDA 2VGMA 3CCRA 4F7UG 5L8RE 5A0GA 5GAN2 4C0DB 2OAUA 3VYGA 3OYKA 1VQOT 1K9MC 1VQ5T 4ELYC 1XTDA 1RI0A 3BDUA 3QZ5B 4OB2B 1IZ6A 2FHDA 5DLQE 3CD6A 3QXEB 3HP9A 4BI4A 4F7UB 2XI9A 3UPUA 2QA4T 4M75F 4HCBA 1YITT 3CCQT 3QPHA 1VQ6T 4M7DE 2VGNA 4J7FA 3MEVA 4JUVA 4N4HA 4C0GA 4D6WA 3M53A 5A2QE 4KUIA 5FRMA 3MEUA 5CCAA 1VQ4T 1VQPT 3FEOA 1QVGS 2FYKA 2YLCA 4PJOD 1KQ1A 1BIBA 3BY7A 3WXMB 4M77D 3MP1A 3BW1A 3HRUA 4P5NA 1PSFA 1QVPA 3UDCA 1VQNT 4HT9A 2K5IA 5GAMe 4V2SA 4JLGA 2ZPGB 2ZPEB 5CQYA 3OW2S 2BUDA 2LQKA 3RMQA 4L6V5 4M75A 2L8DA 3TU4K 1WJQA 4NL2A 2P4TA 5GAOm 2GFAA 5CVIA 2JTMA 4JRKA 4XTXA 2DJZA 2XG8D 2QTXA 3A8GB 4CRIA 5LJ5d 4R56A 5GMKl 1YI2A 4XU0A 1VQKA 1QVFS 4ME7A 3M54A 1KQSA 4ELZC 3I55T 3S3NA 1Q7YU 4ZTJA 4ZGEB 2E65A 2O4XA 3A8HB 3OSVA 3OS5A 4C5HA 3OA6A 3CBPA 3MP8A 5GMKe 4BD3A 1XNIA 1Q82U 4C92D 3OYIA 1K73U 2LT1A 4HCZA 5CIUA 4J6WA 2R5AA 1LNXA 1M1GA 1OYXA 2Y90A 3EFRA 3HPWA 4OGEA 5J3BA 5GANd 2X4WA 3CMEA 2HD0A 4PLLA 4C0DC 2DD5A 2CGHA 2CZ0B 2EQUA 4J5YA 3E9GA 3FDRA 3MEAA 3CCRT 4IKFA 1M8VA 1NPRA 2B8AA 3OYAA 2RO0A 4IUQA 2DTIA 4E7LA 2EAYA 4KT0E 1BIAA 5KE3A 3L2QA 1X75C 1UEBA 3LH0A 1QP2A 3BDLA 2M9UA 4FL6A 1LOJA 2ZPBB 2FVUA 2IG0A 3RMSA 3JB9I 1N6AA 2XKOC 5CKEA 1N9SA 3TREA 3CD6T 3V7SA 1HK9A 1YJ9A 4FT2A 2CZ1B 1ZQ1A 4RG8A 4LD9K 2RK2A 5CKBA 3OS1A 4IUTA 2PVDB 1KG1A 3VV0A 2EQMA 3QDRB 2E1HA 5D6WA 4HT8A 3G7ZA 4DOVA 3CC4T 1VQOA 3V8JA 1Q7YC 3JCMb 1XQHA 3ZEHA 5LL6S 3JCMW 2OTJA 2E6ZA 1UB4A 2DIGA 3OYCA 3CCST 3QSUA 1G3WA 1Q82C 4E7KA 1KQ2A 1K73C 5GAN8 3KBGA 4PJOF 1XOVA 4M77F 5I2SA 1KQSS 3L2RA 1Y71A 2RM4A 4MMLA 4XTWA 2KMTA 5GAN3 1I5LA 2XDBA 3GIBA 3M58A 4JRIA 4EMKA 3OSSC 4GLKA 3OYNA 3E1SA 3QIIA 3X28B 4C8QB 1TH7A 3LWHA 2QXFA 1B34B 3C12A 3HFOA 3JCMf 3G4SA 5C6SA 2RH2A 2YLBA 1BI3A 2M16A 1M5Q1 3RKWA 4N0AA 2P0PA 4OB1B 5KE2A 1YI2T 1VQKT 3WVEB 2DK3A 3QBYA 2KY9A 1M1FA 5IN1A 3DLMA 3QO3A 3JB9G 1YJWT 3SB2A 4EPCA 4BDYA 2V8IA 2QQBA 5CR2A 2KVQG 3V8KA 3JCMQ 3FJPA 3M59A 4PJOA 4C92F 4J6YA 4J7IA 4M77A 2A7YA 5KCHA 1M9SA 2XDPA 1YHQA 3CMET 2RJCA 1FX7A 4F7UE 2ZPHB 3HFNA 2ZGWA 1BI1A 3M57A 4EMHA 2F5TX 4PLIA 3SWNA 5GAMg 1G3SA 2MI6A 5CAIA 4JS4A 3HHTB 4A54A 1VQMA 2K3XA 5GAN6 3JB9H 3QYHB 1S72A 3MCAB 2JUFA 3X24B 4A4EA 3M4GA 4HKEA 4XAXB 3CCUT 2HQEA 3S3MA 2LT4A 4Y91A 4M75G 4C92A 4M78B 2RHYA 1X01A 2GCXA 1Y96A 1YJ9T 2DZ9A 4OGCA 2P0KA 1WNLA 2RI5A 3MEWA 5IT9E 1V29B 3VJPA 2R5MA 2MMPA 4O5VA 2PQWA 3FB9A 3C94A 3BFMA 2QEXT 4M75B 4O6JA 2X4JA 1BI2A 4JLIA 1D3BA 2OTJT 5FU6B 1WPYA 5J39A 2PUOB 1WGSA 2CS7A 1W2BA 1M1KC 2E5QA 2Y4XA 1N9RA 4C8QC 2O4XB 2R58A 2XD0A 4RMOA 2BKDN 2ZPFB 2LX9A 3VKIA 4VUBA 1BKBA 2DAQA 4ZTFA 3RIRA 5LJ3h 2QQRA 5FLXE 2X35A 3G4ST 3CC4A 4ATOA 3FRNA 1JBMA 3GPLA 3J81E 2MWOA 4N4IA 3URGA 3CCSA 3CCEA 4L59A 4E7JA 3NTIA 2E6NA 4JRQA 3JCMh 2NLUA 4LDVA 5KH6A 1UGSB 3H8ZA 3S3OA 3V7RA 2EQKA 4M7DD 3WVDB 2EWNA 4C0FA 2XK0A 3EAEA 2RB6A 3QJ6A 2DIQA 2WSFE 3H6ZA 1YHQT 2LTOA 3PNWC 4XTVA 4X9CA 2DXCA 5IAYA 5GAMd 3PIOA 3T9NA 3GOXA 4BI3A 2X4XA 3UT1A 3JCMc 1VQMT 1S72T 1YJWA 2I2LA 3GF5A 4M78C 2ZPIB 2H3JA 2XICA 2D9TA 5AYFA 2GQVA 2F69A 4BE2A 2RHIA 2LCCA 4OF1A 5LJ5j 1YIJA 4M7AD 4MDWA 5HKCA 4ZGDB 1W2BS 2VUBA 1NJIU 4FM4B 4J83A 4M75C 3AHUA 2QQAA 4X9DA 2KSSA 4EMKB 3A8MB 4C5GA 3VYHB 2RI2A 3M5AA 1UGQB 1Y7XA 4A4KA 3V7CA 4C8QE 1BYMA 4PJOG 4OB3B 2KAFA 4M77G 3OB9A 3TEEA 4HCCA 5D6XA 2LVMA 3CCUA 3CCJT 4BE1A 3CCLA 2L89A 4BI8B 2L5QA 3UWNA 4C8QD 2DZCA 4NOYA 4LDXA 3MP6A 3OY9A 2QDYB 2EIFA 4PJOB 3INZA 2K5FA 2Y4YA 4M77B 2RA2A 2LNVA 3N5BB 2MAMA 5CKFA 4XK8E 2EJGA 2K2VA 3SDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKC A;  1UB4 A;  2VUB A;  4MZM A;  5CKH A;  4MDX A;  3JSC A;  5CQY A;  4ELY C;  4MZT A;  5CQX A;  2KMT A;  5CO7 A;  5CK9 A;  4MZP A;  1X75 C;  3TCJ A;  5CKE A;  4ME7 A;  3HPW A;  4HKE A;  4ELZ C;  5HK0 A;  4VUB A;  1NE8 A;  5HK3 A;  3JRZ A;  5DLO A;  1M1F A;  5CKB A;  5CKD A;  2MF2 A;  3VUB A;  3NFC A;  2C06 A;  5CCA A;  5CR2 A;  1VUB A;  3G7Z A;  5CKF A;  4OF1 A; 
#chains in the Genus database with same CATH topology
 3FLG A;  2QQS A;  4FU6 A;  3F70 A;  4C92 G;  1GL5 A;  2EKO A;  1CKA A;  1I4K 1;  5IHI A;  3OYD A;  4JS5 A;  2LRQ A;  3OMG A;  1M4Z A;  3MHX A;  3A8O B;  2OTL A;  3CCV A;  3X20 B;  3CEY A;  2I0N A;  1K8A U;  2HKN A;  1JJ2 A;  4B6M A;  1VQ8 T;  1D3B B;  5GAO r;  4JPB W;  4Q5W A;  1IXD A;  1YIJ T;  2RJD A;  5CQX A;  1O9S A;  2RHZ A;  2GFU A;  3OMC A;  5GAO q;  4N0A C;  3TCJ A;  5FWB A;  3HTR A;  4Z02 A;  2CYZ B;  3HL8 A;  3JAM E;  2DVJ A;  1BB9 A;  1QP3 A;  1X6B A;  3CCL T;  3GLX A;  3RKY A;  1ARK A;  2QEX Q;  4MMK A;  2EJF A;  4C8Q F;  3RR6 A;  3GBQ A;  3JCM e;  1UGP B;  2DXT A;  1NEG A;  1WDX A;  2EFI A;  2FG0 A;  4LUE A;  2RQR A;  3HRT A;  3J7A F;  1D09 B;  3FIF A;  1KC8 C;  1NZ9 A;  2LDM A;  2ZCF B;  4LNP A;  3M0T A;  4B9W A;  1M90 U;  3PGG A;  3LH5 A;  4AFZ C;  3OYG A;  1ABQ A;  3CCV Q;  1XJW B;  4C8Q A;  5GJW B;  1FYN A;  6AT1 B;  1RLP C;  4J6X A;  1WI7 A;  4IUP A;  1PD0 A;  5LJ5 f;  4L5G A;  8AT1 B;  2C06 A;  2NUP B;  3EHR A;  5M9O A;  1U8R A;  3ZFJ A;  1I8F A;  2VV5 A;  4M78 F;  3H0I A;  5GMK i;  1QVG P;  3CC2 A;  2A3L A;  2DER A;  2M02 A;  1DJ7 B;  3L1A A;  1VQM Q;  2RPN A;  4X1V A;  5GAN f;  3KFV A;  4EMG A;  2QDL A;  2CH4 A;  1M8M A;  3EFS A;  2V8K A;  3EGD A;  2X4Y A;  3OYL A;  2DTO A;  4FW1 A;  4M78 A;  4QVZ A;  4F7U F;  3ASK A;  2P0Q A;  2XHC A;  3JCM J;  5LJ5 e;  3VRY A;  1MMG A;  2KYB A;  3G71 A;  5HCK A;  4LDW A;  4LDU A;  1ZSZ B;  4ESR A;  3LWI A;  4PJJ A;  1G83 A;  1VA7 A;  4NL3 A;  3EH2 A;  2JNG A;  3DB3 A;  4F7U A;  5GAN e;  2XID A;  5HK3 A;  1ZUK A;  2QAS A;  4WCI A;  1LCK A;  4RCC A;  2DJQ A;  4C5I A;  2EYQ A;  3JCM V;  3OS0 A;  1M1K U;  1U1T A;  3CC2 Q;  2AT1 B;  3JCM g;  4KUD K;  1BU1 A;  2DVE A;  5D6Y A;  2FO0 A;  4JRP A;  4GBQ A;  4PL6 A;  1B7T A;  3SHW A;  1Y96 B;  2D0N A;  5KYU A;  1OX9 A;  2BE7 D;  4Y28 E;  4M7A B;  3OBY A;  1CSK A;  1TTH B;  2DLP A;  1WJR A;  5IH2 A;  2COY A;  2EYW A;  1ZBX A;  1SSF A;  2X51 A;  4RUG A;  1ZSZ C;  5CK9 A;  4OMF B;  3UAT A;  4KBM B;  4M75 D;  4JJN K;  2HBP A;  2VKN A;  7AT1 B;  3QJY A;  3X25 B;  2IVW A;  5L23 A;  2CZ6 B;  3IQL A;  1N8R C;  1G5V A;  3RUX A;  1WHL A;  2VC8 A;  1VQN A;  2FRW A;  1X6G A;  4J8O A;  3KXT A;  1HD3 A;  5LJ5 g;  1W70 A;  1ZBJ A;  1SF9 A;  1SRM A;  3I56 Q;  3ER0 A;  3OW2 A;  3P8H A;  3M0Q A;  3C0C A;  4M7A C;  5GAN g;  2C0O A;  4ZN3 A;  4B9X A;  2O01 E;  1R0B G;  2VGM A;  4FSS A;  5L8R E;  1BCM A;  1VQ5 T;  4RTX A;  1XTD A;  3BDU A;  3QZ5 B;  1VQ9 Q;  3QXE B;  3RDV A;  1VQL Q;  2L0A A;  1YIT T;  3CCQ T;  3QPH A;  4J7F A;  3MEV A;  4JUV A;  2F2W A;  5CCA A;  4PJL A;  3BW1 A;  1V76 A;  4V2S A;  2M51 A;  2LQK A;  4L6V 5;  1YWP A;  1WJQ A;  4NL2 A;  2GFA A;  5LJ5 d;  4R56 A;  2FRY A;  2QTX A;  4CRI A;  2FPD A;  4XU0 A;  2DF6 A;  1KQS A;  1E6G A;  3I55 T;  2J06 A;  4C5H A;  2KE9 A;  1Q82 U;  2ECZ A;  2LT1 A;  4HCZ A;  2DEU A;  2DL4 A;  5GAN d;  2X4W A;  2EQU A;  3SEM A;  1NPR A;  1M8V A;  2RO0 A;  5KE3 A;  1BIA A;  1X75 C;  1UEB A;  3LH0 A;  3BDL A;  4FL6 A;  2FVU A;  2DRK A;  3CD6 T;  1ZQ1 A;  1WHH A;  4LD9 K;  5CKB A;  4IUT A;  2E1H A;  1VQO A;  1QMC A;  3JCM b;  1Q7Y C;  3ZEH A;  2E6Z A;  2ROL A;  3OYC A;  1KQ2 A;  3KBG A;  4PJO F;  5I2S A;  3L2R A;  2RM4 A;  3A1P A;  3OYN A;  1ZSZ A;  2CP0 A;  3X28 B;  3LWH A;  1AZG B;  3R6N A;  1D1A A;  3G4S A;  2RH2 A;  1M5Q 1;  5KE2 A;  2P0P A;  2YWW A;  1NBE B;  1M1F A;  4IIM A;  3SB2 A;  2QQB A;  2BE9 B;  1KC8 R;  4PJO A;  2W0Z A;  2GBQ A;  2V26 A;  2A7Y A;  2GGR A;  5KCH A;  3CME T;  2W10 A;  4F7U E;  1HJD A;  4EMH A;  5CAI A;  4JS4 A;  2VB6 A;  2K3X A;  2DL5 A;  3X24 B;  4A4E A;  2HQE A;  2LT4 A;  1VQO Q;  1Y96 A;  3REA B;  1SRL A;  5IT9 E;  4O5V A;  2DYB A;  2PQW A;  2QEX T;  1KIK A;  4O6J A;  4FYV B;  2FZG B;  2AIR B;  1OUL A;  1VQ6 Q;  4OMN A;  2R58 A;  1VQP Q;  2X35 A;  3CC4 A;  4ATO A;  3REB B;  2YDL A;  3URG A;  2D8H A;  4JRQ A;  3JCM h;  2NLU A;  4LDV A;  1WFW A;  2QTV A;  2EWN A;  4C0F A;  2XK0 A;  3EAE A;  2DIQ A;  1GCQ C;  4X9C A;  3EG2 A;  5IAY A;  2PZ1 A;  1VQM T;  3JCM c;  4HVW A;  1IHV A;  2VVK A;  2ZPI B;  2XIC A;  5AYF A;  1KJW A;  2LX7 A;  2QG9 B;  2LCC A;  2DL8 A;  4M7A D;  2DE0 X;  2C0I A;  4X9D A;  1AZE A;  3A8M B;  1NJI R;  1BYM A;  2K2M A;  2LVM A;  4OMM A;  4BE1 A;  2ENM A;  3CC4 Q;  4LDX A;  4NOY A;  2CSQ A;  3MP6 A;  3INZ A;  4HCK A;  4M77 B;  2LNV A;  3N5B B;  2MAM A;  5CKF A;  4Y92 A;  1EX4 A;  3CCE T;  2YXY A;  5LJ5 h;  4F16 A;  3GNG A;  5LJ3 f;  3CC2 T;  5J26 A;  4M7D F;  3OYH A;  1UGR B;  1WQ7 A;  1ZLM A;  4C92 B;  2CKK A;  4PJN A;  3E9F A;  2ED0 A;  2HKQ B;  2MIO A;  1TUC A;  1GBQ A;  5GAN h;  5HY6 A;  4QQ6 A;  1KC8 U;  2V8J A;  4GY5 A;  1JU5 C;  2JN0 A;  2KYM A;  4M7D A;  1AT1 B;  4XU1 A;  3C95 A;  4QVD A;  2JS2 A;  2LP5 A;  3CC7 A;  4OMQ A;  3MKD A;  2RJE A;  2G6F X;  2PNI A;  1YJ9 Q;  5LJ3 e;  4DA4 A;  4ZGJ B;  1AHJ B;  4R55 A;  2JOY A;  4BB7 A;  1SEM A;  2D0Q B;  3L2U A;  3I5R A;  4M77 C;  3MO8 A;  1KHC A;  1IGQ A;  9ATC B;  1GBR A;  4E2F B;  4BE0 A;  1KFZ A;  3H41 A;  1YJN A;  3DLL A;  2PVG B;  1W1F A;  5KYX A;  1VQ7 A;  2Z0W A;  1JO8 A;  1MGQ A;  3KUF A;  3JB9 J;  1GXI E;  5FU7 B;  1WXT A;  2D1X A;  3CMA A;  4C92 C;  2E41 A;  3L2Z A;  1M90 R;  1BCO A;  1JJ2 S;  4A4G A;  3OYM A;  2JVV A;  3QKJ A;  2DKG A;  3JRZ A;  1W4S A;  3SD4 A;  3I56 T;  2RN8 A;  1Q86 C;  2PUK B;  2EYY A;  1FWZ A;  2E12 A;  2RD1 A;  3CC7 Q;  2PU9 B;  3JSC A;  2JS0 A;  4DQ2 A;  1N5Z A;  1UUE A;  5AT1 B;  3CXC A;  4TVR A;  1GCQ A;  2KK4 A;  4PJO E;  1H3Z A;  4GLM A;  4RG2 A;  2G3R A;  2YSQ A;  1VQ9 T;  2MF2 A;  4A53 A;  1VQL T;  2LZ6 B;  2VXF A;  2E64 A;  3LYI A;  2DFU A;  1VOM A;  5GAN 5;  1VQ7 Q;  5KCO A;  5GAM j;  1TG0 A;  1AWW A;  2A36 A;  2FPE A;  2KI7 A;  1M2V B;  3CMA Q;  2PVO B;  5FU7 C;  1RAA B;  3PIP A;  5IHN A;  2HL5 C;  5GAN j;  2RQW A;  1ABO A;  2RNA A;  1PG5 B;  5LJ3 g;  1NPP A;  1RL2 A;  3Q1J A;  4LUD A;  3NFC A;  4QQD A;  2AZS A;  2DET A;  3EFO A;  2MYS A;  1JRI A;  3CCM A;  3SFM A;  3L2V A;  2JTF A;  1M1K R;  1S1N A;  1GFD A;  1N8R U;  2X3X D;  1R77 A;  2LQN A;  3JB9 D;  3VS2 A;  3EGX B;  3NTH A;  4FIB A;  2M0O A;  1SHF A;  2J05 A;  3NTK A;  4C8Q G;  4NS5 A;  2HEQ A;  4Z88 A;  1MHN A;  2QAZ A;  1P92 A;  2F5K A;  5GAN 7;  2QA4 A;  3P8B B;  2DMO A;  2DD4 A;  2RI3 A;  2AZV A;  1WLP B;  3QYG B;  2JMC A;  2NUT B;  2K9G A;  1VQ4 A;  1YNZ A;  1Y07 A;  4QVC A;  2LCL A;  1TS9 A;  3CCM Q;  1KSW A;  5LJ3 d;  2KT8 A;  2P84 A;  1U1S A;  2VXE A;  3PMT A;  1X43 A;  2YRV A;  2E3I A;  3V8L A;  3VUZ A;  3G6E A;  1X6O A;  4M78 G;  3PMI A;  2CP6 A;  2K3Y A;  2OJ2 A;  4LN2 A;  4IUV A;  4A4H A;  1OV3 A;  3VS6 A;  2FEI A;  1YCY A;  2OTL Q;  1VIF A;  2SEM A;  4HVV A;  2MOX A;  3LW5 E;  4DBR A;  1UJ0 A;  4AT1 B;  1KK7 A;  1QVF A;  4IUR A;  4OVA A;  1PKS A;  2CZ7 B;  5GAM f;  1BK2 A;  1N27 A;  3CCR A;  4F7U G;  5GAN 2;  5A0G A;  4C0D B;  2OAU A;  1VQO T;  1K9M C;  1QQJ A;  3I9Q A;  1Z9Z A;  2CP2 A;  3H0H A;  4ELY C;  1RI0 A;  2CUB A;  1IZ6 A;  5DLQ E;  4BI4 A;  2XI9 A;  3UPU A;  1UFF A;  4M75 F;  4HCB A;  3QDF A;  4QT7 A;  1VQ6 T;  4M7D E;  2VGN A;  2CT4 A;  3QWY A;  4N4H A;  4D6W A;  4LE9 A;  1VQP T;  2FYK A;  3G6E Q;  4M77 D;  4OMO A;  3HRU A;  3UDC A;  5GAM e;  2KRO A;  2ZPG B;  2ZPE B;  3OW2 S;  2BUD A;  3RMQ A;  4M75 A;  2P4T A;  2C0T A;  4JRK A;  2J6O A;  2GNC A;  2XG8 D;  4XTX A;  3RBB B;  4AG2 C;  1U06 A;  1Q7Y U;  2CH4 W;  3EG1 A;  3A8H B;  3OA6 A;  4BD3 A;  4C92 D;  2EGE A;  2KRS A;  2CP5 A;  2Y90 A;  1Q82 R;  1TOV A;  4PLL A;  4C0D C;  5KYN A;  1HSQ A;  4J5Y A;  2DIL A;  3MEA A;  4IKF A;  3OYA A;  4IUQ A;  2DTI A;  4KT0 E;  3VS1 A;  3NMZ C;  2M9U A;  5CKE A;  2LJ0 A;  1AWO A;  3MPU B;  2EYX A;  3H9N A;  2CZ1 B;  4RG8 A;  2RK2 A;  3OS1 A;  1KG1 A;  1H8K A;  4HT8 A;  4DOV A;  3CC4 T;  2V1R A;  1BBZ A;  3JCM W;  2OTJ A;  3G71 Q;  1G3W A;  1K73 C;  1XOV A;  2GTJ A;  1KQS S;  1I5L A;  1ZUY A;  5GAN 3;  2LCS A;  2KMT A;  3QII A;  1TH7 A;  2QXF A;  3C12 A;  1NYG A;  2YLB A;  3EG9 A;  1YI2 T;  2YUN A;  4N0A A;  1VQK T;  4E6R A;  3DLM A;  4EPC A;  2KVQ G;  3V8K A;  3JCM Q;  4J6Y A;  1VYU A;  2QK0 A;  1M9S A;  2NWM A;  3HFN A;  2RQT A;  2ZGW A;  1QKX A;  2ED1 A;  1K0X A;  5GAM g;  2MI6 A;  3HHT B;  4A54 A;  5GAN 6;  3JB9 H;  3QYH B;  1S72 A;  2LMJ A;  1AVZ C;  1MUZ A;  3M4G A;  5I22 A;  4HKE A;  1QKW A;  4XAX B;  1SG5 A;  3EGX A;  4Y91 A;  1FMV A;  1TUG B;  1H3H A;  1YJ9 T;  2DZ9 A;  4OGC A;  1JJ2 P;  4PFP A;  2RI5 A;  4DBF A;  2OTJ Q;  1QCN A;  1JEG A;  1V29 B;  1ZSG A;  1ZX6 A;  3C94 A;  1MV0 B;  1I5O B;  1BI2 A;  2L3Q A;  1RLQ C;  1D3B A;  5J39 A;  1WGS A;  2CS7 A;  1W2B A;  4RTW A;  2O4X B;  4RTT A;  2XD0 A;  1K9A A;  2LX9 A;  1ZA2 B;  1QWF A;  5LJ3 h;  2QQR A;  5FLX E;  1VQN Q;  4PFO A;  1JXO A;  3GPL A;  3J81 E;  2MK5 A;  3CCS A;  3M0R A;  2HZY A;  3NTI A;  2KXD A;  3H8Z A;  1YHQ T;  2LTO A;  2EBP A;  2ROT A;  5GAM d;  3PIO A;  2D9T A;  4OF1 A;  4PJM A;  1YIJ A;  2NUP A;  3RNJ A;  4J83 A;  2QQA A;  2EYZ A;  2KSS A;  4EMK B;  2RI2 A;  4C8Q E;  1WHK A;  1IB8 A;  4PJO G;  2KAF A;  4HCC A;  3CCL A;  4ORZ A;  2L89 A;  2L5Q A;  3UWN A;  2DZC A;  1K76 A;  3CCS Q;  1EFN A;  5KYW B;  2K3B A;  3VS7 A;  4XK8 E;  3SDZ A;  2CP7 A;  1NEB A;  1M3C A;  3OYB A;  4CC2 A;  4E7I A;  1IO6 A;  1IRX A;  2CUD A;  3AT1 B;  2EQJ A;  4JDS A;  5GJV B;  2F2V A;  3QUI A;  2BTT A;  4M78 E;  4RKU E;  1WJS A;  1AEY A;  3NGP A;  1ZA1 B;  2D8J A;  4OB0 B;  2HQH A;  3HRS A;  2KDS A;  1WHG A;  3EH1 A;  1WXU A;  3FC3 A;  4M75 E;  1D0X A;  2J7I A;  2K4Y A;  2K57 A;  3VS3 A;  1LJO A;  4EMK C;  2DXB A;  4M7A F;  2P4R A;  4PKC C;  3CCL Q;  4R0K A;  4MZP A;  4A63 B;  5FW9 A;  1I81 A;  1SPK A;  2LNH B;  2YHT A;  5LJ3 j;  1YFN A;  1WZO A;  1Q86 U;  5KYY B;  4AMC A;  1D1C A;  3S6W A;  1K9M R;  2XU8 A;  3CPW A;  1AD5 A;  4M7A A;  3E19 A;  3ZBD A;  5FWC A;  2DXU A;  2SRC A;  4CC7 A;  5ECA A;  5CO7 A;  1OI1 A;  5IXB A;  2HQX A;  1RAB B;  3G4S Q;  3M56 A;  3M0P A;  2KXC A;  2K5L A;  1NE8 A;  1MV3 A;  5CKD A;  3EGU A;  2OTL T;  3CCV T;  5EG2 A;  2JM9 A;  5GAO p;  4XQ3 A;  3A8L B;  2JZ2 A;  4E7S A;  1WQW A;  1X27 A;  3OW2 P;  4C5E A;  1AOJ A;  4PNO A;  4PFZ A;  1PHT A;  4IUU A;  2WSE E;  4HVU A;  1HXD A;  2DTH A;  2DRM A;  2VAS A;  4J9I A;  2QQ9 A;  5DM7 R;  2JT4 A;  2FB7 A;  1UG1 A;  2RHU A;  2EJ9 A;  1WA7 A;  4XTY A;  1G2B A;  4HA8 A;  4QW2 A;  4WTO B;  3GNF B;  3G6E T;  3OYJ A;  2AKL A;  3ULR B;  4M7D G;  2O88 A;  3VS0 A;  4F14 A;  5GMK j;  3MJX A;  3PTA A;  1Q81 C;  1T3S A;  4C0Z A;  2K7A A;  5CKH A;  1OEB A;  4LDY A;  4Z89 A;  2YUQ A;  3SWN B;  3CXC S;  4KUL A;  1K4U S;  5GAM h;  2HSP A;  5I2M A;  1M2O A;  1EIF A;  4FYX B;  2EGA A;  1KQS P;  2FPF A;  4KGX B;  1N8R R;  3G1J A;  3M55 A;  3OS2 A;  4XU2 A;  2MWP A;  3M4Y A;  2E4H A;  1PSE A;  2RMO A;  4YTL A;  4CC3 A;  2DPP B;  3UA6 A;  4J9B A;  1SHG A;  4LD6 A;  1VQ5 A;  1WIE A;  2DL3 A;  5GMK m;  1YCS B;  1ZHI A;  4K11 A;  2KQW A;  2WAC A;  3G71 T;  1YIT A;  2HCK A;  3CCQ A;  1Y57 A;  2BIV A;  1RUW A;  1WHM A;  1RAH B;  5A0L A;  4ZNX A;  3PT9 A;  1K9M U;  4JJB A;  3OYF A;  1PM3 A;  1KD1 C;  2PTK A;  4LXC A;  1YBY A;  4BUG A;  3SWN C;  3DB4 A;  3VU3 C;  5C0M A;  4N4G A;  1QVG A;  1K1Z A;  3UA7 A;  1UTI A;  4UC4 A;  5FRO A;  3H0F A;  3I55 A;  3CBO A;  1Y0M A;  2H8H A;  2CP3 A;  3EHQ A;  2JM8 A;  1OU9 A;  4FT4 A;  4XTU A;  2ATC B;  3JB9 F;  4II1 A;  3M0S A;  1VQ5 Q;  2CT3 A;  1WXB A;  3A5Z B;  2GF7 A;  4HXJ A;  2AK5 A;  2XDD A;  4KH0 B;  5IXF A;  2JTE A;  2K79 A;  3I35 A;  1RI9 A;  1YIT Q;  4IIO A;  1J3T A;  2DM1 A;  1SKU B;  1RAC B;  2FHD A;  3CD6 A;  1VYV A;  4F7U B;  2CSI A;  4JJC A;  2B86 A;  2FZK B;  2O2O A;  4C0G A;  5A2Q E;  5KYY A;  4DBH A;  3MEU A;  3FEO A;  1B3Q A;  1TWB A;  2YLC A;  1KQ1 A;  1BIB A;  2YT6 A;  3BY7 A;  3WXM B;  3MP1 A;  4P5N A;  1YJN Q;  1PSF A;  1QVP A;  2OI3 A;  1VQN T;  2K5I A;  3FJ5 A;  5CQY A;  3TU4 K;  2EQI A;  2COW A;  3A8G B;  1QVF S;  1YN8 A;  1UGV A;  3M54 A;  4ELZ C;  4M7A E;  2E65 A;  5GMK e;  1K73 U;  1Q7Y R;  5CIU A;  1M1G A;  1OYX A;  3CME A;  1QWE A;  2CGH A;  3E9G A;  4E7L A;  3RMS A;  1LOJ A;  1V1C A;  2IG0 A;  2ZPB B;  3JB9 I;  1N6A A;  2JMA A;  1N9S A;  3CQT A;  3TRE A;  3V7S A;  2FZC B;  2PVD B;  2X3W D;  3G7Z A;  3V8J A;  1XQH A;  5LL6 S;  2DIG A;  4RTZ A;  3CCS T;  3NHN A;  4PK4 A;  5GAN 8;  4M77 F;  2XDB A;  3M58 A;  4AG1 C;  3OSS C;  1M27 C;  2M0Y A;  1MMA A;  1B34 B;  2MCN A;  3JCM f;  5C6S A;  2M16 A;  1UE9 A;  3RKW A;  2F1L A;  3WVE B;  2KY9 A;  3CME Q;  5IN1 A;  4BDY A;  5CR2 A;  3FJP A;  2YRD A;  4C92 F;  4M77 A;  3U23 A;  2DBM A;  2EPD A;  1WX6 A;  2LJ1 A;  2RJC A;  1FX7 A;  2F5T X;  4PLI A;  3SWN A;  1VQM A;  3UF4 A;  2JUF A;  1SSH A;  2BZ8 A;  3EG0 A;  2KBT A;  1TUD A;  4M75 G;  4C92 A;  2RHY A;  1GFC A;  1WNL A;  3MEW A;  3VJP A;  4J9E A;  2A0F B;  2MMP A;  2LQW A;  2EGC A;  2QA4 Q;  4D8D A;  2H3E B;  2E5Q A;  2Y4X A;  1N9R A;  1LPL A;  1OX8 A;  4RMO A;  4JZ4 A;  3E2U A;  1VQ4 Q;  2ZPF B;  4FYW B;  4VUB A;  2DAQ A;  4ZTF A;  3RIR A;  1UEC A;  1TSF A;  1U3O A;  3VRZ A;  3G4S T;  3QWX X;  1JBM A;  2MWO A;  3CCE A;  4E7J A;  2E6N A;  2A08 A;  3S3O A;  3WVD B;  1M3A A;  2EW3 A;  1OQK A;  3QJ6 A;  2YUO A;  2WSF E;  2HL3 A;  3H6Z A;  3PNW C;  4XTV A;  2DXC A;  3VS4 A;  3T9N A;  1Q81 R;  4BI3 A;  2X4X A;  1YJW A;  2I2L A;  3GF5 A;  2H3J A;  1I1J A;  2GQV A;  2F69 A;  3CCR Q;  1PCX A;  2OX7 A;  4MDW A;  1W2B S;  3AHU A;  4C5G A;  4A4K A;  3M5A A;  1UGQ B;  1Y7X A;  4FCY A;  3V7C A;  3ZL7 C;  1YWO A;  2DA9 A;  3OB9 A;  3TEE A;  3CCU A;  3CXC P;  1T0H A;  4C8Q D;  4OML A;  1B07 A;  2A28 A;  2KR3 A;  2EIF A;  4PJO B;  3CCE Q;  2K5F A;  2Y4Y A;  2NYS A;  5FU6 B;  1X2Q A;  2LJ3 A;  4XU3 A;  4MZM A;  2KEA A;  4MDX A;  4BDZ A;  1UDL A;  2LQ8 A;  1R8O B;  5FRN A;  1G3Y A;  3I5S A;  1M2V A;  1NJI C;  1IRE B;  1YJW Q;  3O5Z A;  4DOW A;  1KD1 R;  4JZ3 A;  3THK A;  4A4F A;  3I56 A;  4M4Z A;  2ABL A;  2L3R A;  4M78 D;  1MNE A;  4CI0 C;  1PRM C;  1I07 A;  5GAO n;  2M1H A;  4OMP A;  4E47 A;  2JJ9 A;  5I21 A;  4ANJ A;  2JXB A;  2F2X A;  3CCU Q;  3A98 A;  1T3L A;  1X69 A;  3ME9 A;  2AKK A;  4EDU A;  1VQ9 A;  5DY9 A;  4CC4 B;  2ZAE A;  1GCP A;  1VQL A;  2DNU A;  4PJO C;  1MND A;  2L3P A;  3RES A;  2QEX A;  1Q86 R;  4E7H A;  3QZ9 B;  5FU6 C;  4KRT A;  1FXX A;  2O9V A;  2A37 A;  3JCM d;  3JV3 A;  1K8A C;  1OOT A;  4MZT A;  3CCJ A;  3OYY A;  1KHI A;  4DEY A;  2R57 A;  2O9S A;  2RQU A;  1NG2 A;  1VIE A;  4WF2 A;  1H92 A;  3GP8 A;  1B34 A;  1I0C A;  1QW1 A;  4AFS C;  1W6X A;  3TQ7 P;  2NUT A;  2WSC E;  5I11 A;  3OQ5 A;  1QCF A;  2KT1 A;  2DYI A;  3CPF A;  2HSE B;  1C1A A;  1Q95 G;  1S72 Q;  4JJD A;  1Q81 U;  2VWF A;  1PKT A;  3LX7 A;  2E10 A;  3CC7 T;  4J9H A;  4M77 E;  1IGU A;  1O75 A;  3CPW S;  3HKS A;  1G3T A;  3DKM A;  1QVF P;  1M90 C;  1ACM B;  1D0Y A;  1H64 1;  2COZ A;  4BY6 B;  1ZUU A;  4Z8A A;  3RER A;  4OP0 A;  1JB0 E;  4ZN1 A;  1C0M A;  1VQ8 A;  1K0S A;  1PWT A;  2DEQ A;  2NUZ A;  5A0D A;  3LGL A;  3L42 A;  4DEX A;  2RHX A;  3O8V A;  3CCJ Q;  3X26 B;  1NLP C;  1IHW A;  4C92 E;  2E70 A;  1YJN T;  1OZ3 A;  3NPF A;  1VQ7 T;  2L2P A;  1BI0 A;  4RCB A;  5GAN 4;  1R0C B;  1F1B B;  2RQV A;  3MET A;  3CMA T;  2DO3 A;  5DLO A;  3C4S A;  3OYE A;  3JCM X;  4M7D B;  3HSB A;  1LVK A;  1G8X A;  2CRE A;  2HAX A;  4BAC A;  2FL7 A;  2RJF A;  3L2W A;  2IIM A;  4M7A G;  4J9C A;  1KD1 U;  1E6H A;  5HK0 A;  2BZY A;  1VQ8 Q;  1OZ2 A;  4KGV B;  4BY6 C;  1RAF B;  4EIK A;  5GMK h;  3J80 E;  1QCO A;  1YIJ Q;  1VUB A;  2LC4 A;  1NLO C;  3JCM P;  1D1B A;  3R6O A;  5KYX B;  2YRC A;  3RKX A;  1OU8 A;  1TU0 B;  3OBW A;  1M1K C;  3M9Q A;  2QGG A;  1AWJ A;  2HNI A;  4FSX A;  1VQ6 A;  2D6F A;  1VQP A;  4D8K A;  5EC7 A;  4QQG A;  1WHJ A;  1FMK A;  3LLR A;  1Z9Q A;  2IPO B;  1UHC A;  3LGF A;  4M7D C;  2QI2 A;  1PRL C;  3PFS A;  2J6F A;  1OPK A;  3CCM T;  3QHS A;  4X34 A;  2BZX A;  2RK1 A;  3CBM A;  2VYT A;  2JW4 A;  2AHJ B;  3P8D A;  5GAO l;  4XTZ A;  3QG1 A;  3VUB A;  2CDT A;  2ZZD A;  2V1Q A;  1M30 A;  5IHK A;  4DBQ A;  4KGZ B;  3VYG A;  3OYK A;  1D0Z A;  4OB2 B;  4F17 A;  3HP9 A;  2QA4 T;  2K6D A;  2EKH A;  1RAG B;  1UJY A;  4AFU C;  2DX1 A;  3EFO B;  3M53 A;  4KUI A;  5FRM A;  1QLY A;  3M0U A;  1VQ4 T;  1NYF A;  1QVG S;  4PJO D;  4FW2 A;  4HT9 A;  4JLG A;  1JQQ A;  2OAW A;  1MMD A;  2O31 A;  1W2B P;  2L8D A;  5GAO m;  5CVI A;  2JTM A;  2DJZ A;  2GQI A;  1YI2 A;  1VQK A;  5GMK l;  4ME7 A;  2DBK A;  1RAE B;  3S3N A;  4ZTJ A;  4ZGE B;  2O4X A;  3OSV A;  3OS5 A;  2HBW A;  3CBP A;  3MP8 A;  1XNI A;  3TSW A;  3BE3 A;  3OYI A;  4J6W A;  2R5A A;  1YP5 A;  1LNX A;  3TVT A;  3EFR A;  4OGE A;  3HPW A;  5J3B A;  1K73 R;  1PNJ A;  2HD0 A;  2DD5 A;  2CZ0 B;  1PD1 A;  3FDR A;  2X9H A;  3CCR T;  1MMN A;  2B8A A;  2EAY A;  3L2Q A;  1QP2 A;  2QYZ A;  3EG3 A;  2XKO C;  2QGF B;  1HK9 A;  1YJ9 A;  4FT2 A;  2RF0 A;  2E5K A;  4RTU A;  4RTV A;  3VV0 A;  2EQM A;  1WYX A;  3QDR B;  3PE0 A;  5D6W A;  4J9F A;  3VS5 A;  5D7U A;  1UB4 A;  2E3H A;  2L3S A;  3QSU A;  1Q82 C;  4E7K A;  4AFQ C;  4F04 B;  1YI2 Q;  1Y71 A;  2J6K A;  4MML A;  4XTW A;  1VQK Q;  3GIB A;  4JRI A;  4EMK A;  2ESW A;  4GLK A;  3E1S A;  4C8Q B;  3HFO A;  1BI3 A;  4OB1 B;  1M3B A;  2KRM A;  2DK3 A;  2EVR A;  3QBY A;  3QO3 A;  3JB9 G;  1YJW T;  1GRI A;  2V8I A;  3M59 A;  1JXM A;  1K8A R;  1VYT A;  4J7I A;  5KYW A;  1FMW A;  2XDP A;  1YHQ A;  4E7Z A;  4QKU A;  2ZPH B;  1BI1 A;  3M57 A;  4J9G A;  1G3S A;  1CKB A;  2XMF A;  3MCA B;  2YUP A;  2DL7 A;  1UHF A;  3EGD B;  3CCU T;  3S3M A;  1AWX A;  4M78 B;  1X01 A;  2GCX A;  2P0K A;  2R5M A;  3TSZ A;  3FB9 A;  3BFM A;  4M75 B;  2X4J A;  4JLI A;  1C6V X;  1TXQ A;  2OTJ T;  1WPY A;  2PUO B;  3CCQ Q;  1T0J A;  4C8Q C;  2BKD N;  3VKI A;  4RTY A;  1BKB A;  1PC0 A;  2KNB B;  1NM7 A;  3FRN A;  4N4I A;  3CPW P;  1YHQ Q;  4L59 A;  5KH6 A;  1UGS B;  1EZZ B;  3V7R A;  2EQK A;  4M7D D;  1RAD B;  2RB6 A;  3I55 Q;  1U5S A;  2MPX C;  4J9D A;  8ATC B;  3GOX A;  5KYU B;  3UT1 A;  1S72 T;  4M78 C;  2KGT A;  1E7O A;  4BE2 A;  2RHI A;  4KH1 B;  1A0N B;  1OPL A;  5LJ5 j;  5HKC A;  4ZGD B;  1NJI U;  2VUB A;  4FM4 B;  4FYY B;  4M75 C;  1HYO A;  3VYH B;  3CD6 Q;  2HDA A;  4OB3 B;  3D7S B;  4M77 G;  5D6X A;  1X2K A;  3CCJ T;  3EG9 B;  2KRN A;  4BI8 B;  2HMA A;  3OY9 A;  2QDY B;  3PVQ A;  2GTO A;  2RA2 A;  1RAI B;  2EJG A;  2K2V A;  3PVL A; 
#chains in the Genus database with same CATH homology
 3FLG A;  2QQS A;  4XU3 A;  4FU6 A;  3F70 A;  4MZM A;  4C92 G;  3OYB A;  4E7I A;  2EKO A;  3CCE T;  4MDX A;  5LJ5 h;  2EQJ A;  4JDS A;  4BDZ A;  2QA4 A;  1I4K 1;  1R8O B;  2LQ8 A;  3GNG A;  3QUI A;  5J26 A;  5LJ3 f;  3CC2 T;  3OYD A;  4JS5 A;  5FRN A;  4M7D F;  1G3Y A;  3OYH A;  1UGR B;  1WQ7 A;  1IRE B;  1NJI C;  2LRQ A;  4M78 E;  4RKU E;  4DOW A;  1WJS A;  4C92 B;  2CKK A;  3E9F A;  3OMG A;  1M4Z A;  3MHX A;  4A4F A;  3I56 A;  3A8O B;  2OTL A;  4OB0 B;  3CCV A;  3X20 B;  3CEY A;  5GAN h;  2L3R A;  5HY6 A;  4QQ6 A;  3HRS A;  1KC8 U;  1K8A U;  2KDS A;  2V8J A;  4GY5 A;  4M78 D;  1JJ2 A;  3FC3 A;  4M75 E;  4CI0 C;  2JN0 A;  5GAO n;  2M1H A;  1VQ8 T;  4E47 A;  1D3B B;  4M7D A;  5GAO r;  2K4Y A;  2K57 A;  5I21 A;  1LJO A;  4Q5W A;  4EMK C;  2DXB A;  4XU1 A;  3C95 A;  4QVD A;  1YIJ T;  4M7A F;  2RJD A;  4PKC C;  5CQX A;  1O9S A;  2RHZ A;  4MZP A;  2GFU A;  3CC7 A;  3ME9 A;  3OMC A;  1I81 A;  2RJE A;  4EDU A;  4N0A C;  3TCJ A;  5GAO q;  1VQ9 A;  4Z02 A;  5LJ3 e;  5DY9 A;  2CYZ B;  2YHT A;  5LJ3 j;  4ZGJ B;  4DA4 A;  1AHJ B;  3HL8 A;  3JAM E;  4R55 A;  1VQL A;  2JOY A;  1Q86 U;  1QP3 A;  3CCL T;  4BB7 A;  2D0Q B;  3GLX A;  3RES A;  3RKY A;  3L2U A;  2QEX A;  4M77 C;  3MO8 A;  4PJO C;  4MMK A;  2EJF A;  3S6W A;  4C8Q F;  1KHC A;  3JCM e;  1UGP B;  2DXT A;  4E7H A;  3QZ9 B;  5FU6 C;  2XU8 A;  3CPW A;  2EFI A;  4M7A A;  3E19 A;  3ZBD A;  2DXU A;  3HRT A;  4BE0 A;  1FXX A;  3J7A F;  3FIF A;  3JCM d;  1YJN A;  3DLL A;  1KC8 C;  1K8A C;  2PVG B;  1VQ7 A;  4MZT A;  1MGQ A;  1NZ9 A;  2LDM A;  2ZCF B;  3KUF A;  5CO7 A;  4B9W A;  3CCJ A;  3OYY A;  3JB9 J;  1OI1 A;  1M90 U;  1KHI A;  2HQX A;  2R57 A;  3PGG A;  5FU7 B;  1GXI E;  3CMA A;  4C92 C;  2E41 A;  3L2Z A;  3OYG A;  1VIE A;  3M56 A;  4WF2 A;  4C8Q A;  4A4G A;  3OYM A;  2K5L A;  1JJ2 S;  2JVV A;  1B34 A;  1NE8 A;  2DKG A;  3QKJ A;  3GP8 A;  3JRZ A;  1W4S A;  1QW1 A;  4J6X A;  4IUP A;  3SD4 A;  5CKD A;  5LJ5 f;  4L5G A;  3I56 T;  2WSC E;  2C06 A;  2OTL T;  3CCV T;  5M9O A;  1U8R A;  3OQ5 A;  5EG2 A;  3ZFJ A;  3CPF A;  5GAO p;  1Q86 C;  1I8F A;  2PUK B;  4XQ3 A;  1FWZ A;  2VV5 A;  3A8L B;  2E12 A;  2RD1 A;  4M78 F;  4M7A E;  2JZ2 A;  5GMK i;  3CC2 A;  2A3L A;  2PU9 B;  3JSC A;  1WQW A;  1DJ7 B;  3L1A A;  4DQ2 A;  5GAN f;  1Q81 U;  3LX7 A;  2E10 A;  4C5E A;  4EMG A;  3CXC A;  4PNO A;  4TVR A;  2KK4 A;  3CC7 T;  4PJO E;  1H3Z A;  4RG2 A;  4IUU A;  4M77 E;  2WSE E;  1O75 A;  2G3R A;  3HKS A;  1HXD A;  1G3T A;  3DKM A;  2V8K A;  3EFS A;  3CPW S;  2DTH A;  1VQ9 T;  1M90 C;  1H64 1;  2X4Y A;  2QQ9 A;  2DTO A;  4BY6 B;  5DM7 R;  3OYL A;  3RER A;  2FB7 A;  2MF2 A;  4OP0 A;  1JB0 E;  4M78 A;  4QVZ A;  4A53 A;  4F7U F;  4ZN1 A;  1VQ8 A;  2RHU A;  1VQL T;  2VXF A;  2E64 A;  2EJ9 A;  3LYI A;  2DEQ A;  3ASK A;  2P0Q A;  2XHC A;  5A0D A;  3JCM J;  3LGL A;  5LJ5 e;  3L42 A;  5GAN 5;  5KCO A;  5GAM j;  4XTY A;  2RHX A;  3O8V A;  4HA8 A;  4QW2 A;  3G71 A;  3X26 B;  4LDW A;  3GNF B;  4LDU A;  2PVO B;  4C92 E;  2E70 A;  3G6E T;  5FU7 C;  3OYJ A;  1YJN T;  3LWI A;  1OZ3 A;  4M7D G;  3PIP A;  1VQ7 T;  1BI0 A;  4NL3 A;  4RCB A;  2JNG A;  3DB3 A;  4F7U A;  5GAN e;  5GAN 4;  5GAN j;  2XID A;  5HK3 A;  3MET A;  3CMA T;  5GMK j;  2DO3 A;  3PTA A;  5LJ3 g;  1NPP A;  5DLO A;  4RCC A;  1Q81 C;  1RL2 A;  3Q1J A;  3C4S A;  3NFC A;  4QQD A;  4C5I A;  3OYE A;  2EYQ A;  3JCM V;  3JCM X;  4M7D B;  3HSB A;  3OS0 A;  1M1K U;  1U1T A;  1JRI A;  3CCM A;  3JCM g;  4C0Z A;  4KUD K;  5CKH A;  3SFM A;  4LDY A;  3L2V A;  2HAX A;  2JTF A;  3SWN B;  3CXC S;  4KUL A;  4BAC A;  2FL7 A;  2RJF A;  5GAM h;  2DVE A;  5I2M A;  3L2W A;  1N8R U;  4M7A G;  5D6Y A;  1KD1 U;  1EIF A;  4JRP A;  3JB9 D;  3NTH A;  3M55 A;  5HK0 A;  3OS2 A;  4XU2 A;  4FIB A;  4PL6 A;  2MWP A;  1Y96 B;  3M4Y A;  1OZ2 A;  1PSE A;  4BY6 C;  4YTL A;  4Y28 E;  4M7A B;  2DPP B;  2M0O A;  3OBY A;  5GMK h;  3J80 E;  4LD6 A;  1VUB A;  3NTK A;  1VQ5 A;  4C8Q G;  2LC4 A;  4NS5 A;  3JCM P;  3R6O A;  1WJR A;  1MHN A;  3RKX A;  5GMK m;  1ZBX A;  1P92 A;  1SSF A;  1ZHI A;  3OBW A;  2F5K A;  4OMF B;  2KQW A;  3P8B B;  4KBM B;  4M75 D;  5CK9 A;  5GAN 7;  2WAC A;  2HBP A;  3M9Q A;  4JJN K;  3G71 T;  2HNI A;  4FSX A;  3CCQ A;  2DD4 A;  2RI3 A;  1YIT A;  1VQ6 A;  2BIV A;  3QYG B;  3QJY A;  2D6F A;  5A0L A;  3X25 B;  2IVW A;  1VQ4 A;  1VQP A;  2CZ6 B;  3PT9 A;  1K9M U;  1N8R C;  4QQG A;  1G5V A;  3OYF A;  1Y07 A;  4QVC A;  2LCL A;  1KD1 C;  3RUX A;  4M7D C;  3LLR A;  2VC8 A;  3LGF A;  1VQN A;  5LJ3 d;  2QI2 A;  1U1S A;  2VXE A;  3PFS A;  3PMT A;  1YBY A;  2YRV A;  4BUG A;  4J8O A;  3V8L A;  3SWN C;  3DB4 A;  3KXT A;  3VUZ A;  3VU3 C;  5C0M A;  3QHS A;  1X6O A;  4M78 G;  4N4G A;  4X34 A;  5LJ5 g;  3G6E A;  3CCM T;  1QVG A;  4UC4 A;  5FRO A;  3PMI A;  2K3Y A;  3CBO A;  3I55 A;  4A4H A;  4IUV A;  2RK1 A;  3CBM A;  2VYT A;  3ER0 A;  1YCY A;  2AHJ B;  3P8D A;  3OW2 A;  5GAO l;  1VIF A;  4FT4 A;  4XTU A;  3P8H A;  3LW5 E;  3JB9 F;  4II1 A;  1QVF A;  4XTZ A;  4M7A C;  3QG1 A;  4IUR A;  4OVA A;  5GAN g;  3VUB A;  4ZN3 A;  4B9X A;  2CZ7 B;  3A5Z B;  2O01 E;  5GAM f;  2ZZD A;  2GF7 A;  1N27 A;  2XDD A;  2VGM A;  3CCR A;  4F7U G;  5L8R E;  5A0G A;  5GAN 2;  4C0D B;  2OAU A;  3VYG A;  3OYK A;  1VQO T;  1K9M C;  1VQ5 T;  4ELY C;  1XTD A;  1RI0 A;  3BDU A;  3QZ5 B;  4OB2 B;  1IZ6 A;  2FHD A;  5DLQ E;  3CD6 A;  3QXE B;  3HP9 A;  4BI4 A;  4F7U B;  2XI9 A;  3UPU A;  2QA4 T;  4M75 F;  4HCB A;  1YIT T;  3CCQ T;  3QPH A;  1VQ6 T;  4M7D E;  2VGN A;  4J7F A;  3MEV A;  4JUV A;  4N4H A;  4C0G A;  4D6W A;  3M53 A;  5A2Q E;  4KUI A;  5FRM A;  3MEU A;  5CCA A;  1VQ4 T;  1VQP T;  3FEO A;  1QVG S;  2FYK A;  2YLC A;  4PJO D;  1KQ1 A;  1BIB A;  3BY7 A;  3WXM B;  4M77 D;  3MP1 A;  3BW1 A;  3HRU A;  4P5N A;  1PSF A;  1QVP A;  3UDC A;  1VQN T;  4HT9 A;  2K5I A;  5GAM e;  4V2S A;  4JLG A;  2ZPG B;  2ZPE B;  5CQY A;  3OW2 S;  2BUD A;  2LQK A;  3RMQ A;  4L6V 5;  4M75 A;  2L8D A;  3TU4 K;  1WJQ A;  4NL2 A;  2P4T A;  5GAO m;  2GFA A;  5CVI A;  2JTM A;  4JRK A;  4XTX A;  2DJZ A;  2XG8 D;  2QTX A;  3A8G B;  4CRI A;  5LJ5 d;  4R56 A;  5GMK l;  1YI2 A;  4XU0 A;  1VQK A;  1QVF S;  4ME7 A;  3M54 A;  1KQS A;  4ELZ C;  3I55 T;  3S3N A;  1Q7Y U;  4ZTJ A;  4ZGE B;  2E65 A;  2O4X A;  3A8H B;  3OSV A;  3OS5 A;  4C5H A;  3OA6 A;  3CBP A;  3MP8 A;  5GMK e;  4BD3 A;  1XNI A;  1Q82 U;  4C92 D;  3OYI A;  1K73 U;  2LT1 A;  4HCZ A;  5CIU A;  4J6W A;  2R5A A;  1LNX A;  1M1G A;  1OYX A;  2Y90 A;  3EFR A;  3HPW A;  4OGE A;  5J3B A;  5GAN d;  2X4W A;  3CME A;  2HD0 A;  4PLL A;  4C0D C;  2DD5 A;  2CGH A;  2CZ0 B;  2EQU A;  4J5Y A;  3E9G A;  3FDR A;  3MEA A;  3CCR T;  4IKF A;  1M8V A;  1NPR A;  2B8A A;  3OYA A;  2RO0 A;  4IUQ A;  2DTI A;  4E7L A;  2EAY A;  4KT0 E;  1BIA A;  5KE3 A;  3L2Q A;  1X75 C;  1UEB A;  3LH0 A;  1QP2 A;  3BDL A;  2M9U A;  4FL6 A;  1LOJ A;  2ZPB B;  2FVU A;  2IG0 A;  3RMS A;  3JB9 I;  1N6A A;  2XKO C;  5CKE A;  1N9S A;  3TRE A;  3CD6 T;  3V7S A;  1HK9 A;  1YJ9 A;  4FT2 A;  2CZ1 B;  1ZQ1 A;  4RG8 A;  4LD9 K;  2RK2 A;  5CKB A;  3OS1 A;  4IUT A;  2PVD B;  1KG1 A;  3VV0 A;  2EQM A;  3QDR B;  2E1H A;  5D6W A;  4HT8 A;  3G7Z A;  4DOV A;  3CC4 T;  1VQO A;  3V8J A;  1Q7Y C;  3JCM b;  1XQH A;  3ZEH A;  5LL6 S;  3JCM W;  2OTJ A;  2E6Z A;  1UB4 A;  2DIG A;  3OYC A;  3CCS T;  3QSU A;  1G3W A;  1Q82 C;  4E7K A;  1KQ2 A;  1K73 C;  5GAN 8;  3KBG A;  4PJO F;  1XOV A;  4M77 F;  5I2S A;  1KQS S;  3L2R A;  1Y71 A;  2RM4 A;  4MML A;  4XTW A;  2KMT A;  5GAN 3;  1I5L A;  2XDB A;  3GIB A;  3M58 A;  4JRI A;  4EMK A;  3OSS C;  4GLK A;  3OYN A;  3E1S A;  3QII A;  3X28 B;  4C8Q B;  1TH7 A;  3LWH A;  2QXF A;  1B34 B;  3C12 A;  3HFO A;  3JCM f;  3G4S A;  5C6S A;  2RH2 A;  2YLB A;  1BI3 A;  2M16 A;  1M5Q 1;  3RKW A;  4N0A A;  2P0P A;  4OB1 B;  5KE2 A;  1YI2 T;  1VQK T;  3WVE B;  2DK3 A;  3QBY A;  2KY9 A;  1M1F A;  5IN1 A;  3DLM A;  3QO3 A;  3JB9 G;  1YJW T;  3SB2 A;  4EPC A;  4BDY A;  2V8I A;  2QQB A;  5CR2 A;  2KVQ G;  3V8K A;  3JCM Q;  3FJP A;  3M59 A;  4PJO A;  4C92 F;  4J6Y A;  4J7I A;  4M77 A;  2A7Y A;  5KCH A;  1M9S A;  2XDP A;  1YHQ A;  3CME T;  2RJC A;  1FX7 A;  4F7U E;  2ZPH B;  3HFN A;  2ZGW A;  1BI1 A;  3M57 A;  4EMH A;  2F5T X;  4PLI A;  3SWN A;  5GAM g;  1G3S A;  2MI6 A;  5CAI A;  4JS4 A;  3HHT B;  4A54 A;  1VQM A;  2K3X A;  5GAN 6;  3JB9 H;  3QYH B;  1S72 A;  3MCA B;  2JUF A;  3X24 B;  4A4E A;  3M4G A;  4HKE A;  4XAX B;  3CCU T;  2HQE A;  3S3M A;  2LT4 A;  4Y91 A;  4M75 G;  4C92 A;  4M78 B;  2RHY A;  1X01 A;  2GCX A;  1Y96 A;  1YJ9 T;  2DZ9 A;  4OGC A;  2P0K A;  1WNL A;  2RI5 A;  3MEW A;  5IT9 E;  1V29 B;  3VJP A;  2R5M A;  2MMP A;  4O5V A;  2PQW A;  3FB9 A;  3C94 A;  3BFM A;  2QEX T;  4M75 B;  4O6J A;  2X4J A;  1BI2 A;  4JLI A;  1D3B A;  2OTJ T;  5FU6 B;  1WPY A;  5J39 A;  2PUO B;  1WGS A;  2CS7 A;  1W2B A;  1M1K C;  2E5Q A;  2Y4X A;  1N9R A;  4C8Q C;  2O4X B;  2R58 A;  2XD0 A;  4RMO A;  2BKD N;  2ZPF B;  2LX9 A;  3VKI A;  4VUB A;  1BKB A;  2DAQ A;  4ZTF A;  3RIR A;  5LJ3 h;  2QQR A;  5FLX E;  2X35 A;  3G4S T;  3CC4 A;  4ATO A;  3FRN A;  1JBM A;  3GPL A;  3J81 E;  2MWO A;  4N4I A;  3URG A;  3CCS A;  3CCE A;  4L59 A;  4E7J A;  3NTI A;  2E6N A;  4JRQ A;  3JCM h;  2NLU A;  4LDV A;  5KH6 A;  1UGS B;  3H8Z A;  3S3O A;  3V7R A;  2EQK A;  4M7D D;  3WVD B;  2EWN A;  4C0F A;  2XK0 A;  3EAE A;  2RB6 A;  3QJ6 A;  2DIQ A;  2WSF E;  3H6Z A;  1YHQ T;  2LTO A;  3PNW C;  4XTV A;  4X9C A;  2DXC A;  5IAY A;  5GAM d;  3PIO A;  3T9N A;  3GOX A;  4BI3 A;  2X4X A;  3UT1 A;  3JCM c;  1VQM T;  1S72 T;  1YJW A;  2I2L A;  3GF5 A;  4M78 C;  2ZPI B;  2H3J A;  2XIC A;  2D9T A;  5AYF A;  2GQV A;  2F69 A;  4BE2 A;  2RHI A;  2LCC A;  4OF1 A;  5LJ5 j;  1YIJ A;  4M7A D;  4MDW A;  5HKC A;  4ZGD B;  1W2B S;  2VUB A;  1NJI U;  4FM4 B;  4J83 A;  4M75 C;  3AHU A;  2QQA A;  4X9D A;  2KSS A;  4EMK B;  3A8M B;  4C5G A;  3VYH B;  2RI2 A;  3M5A A;  1UGQ B;  1Y7X A;  4A4K A;  3V7C A;  4C8Q E;  1BYM A;  4PJO G;  4OB3 B;  2KAF A;  4M77 G;  3OB9 A;  3TEE A;  4HCC A;  5D6X A;  2LVM A;  3CCU A;  3CCJ T;  4BE1 A;  3CCL A;  2L89 A;  4BI8 B;  2L5Q A;  3UWN A;  4C8Q D;  2DZC A;  4NOY A;  4LDX A;  3MP6 A;  3OY9 A;  2QDY B;  2EIF A;  4PJO B;  3INZ A;  2K5F A;  2Y4Y A;  4M77 B;  2RA2 A;  2LNV A;  3N5B B;  2MAM A;  5CKF A;  4XK8 E;  2EJG A;  2K2V A;  3SDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...