4MZMA

Mazf from s. aureus crystal form i, p212121, 2.1 a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
b'DPIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA interferase MazF
molecule tags Hydrolase
source organism Staphylococcus aureus subsp. aureus
publication title Structural and biophysical characterization of Staphylococcus aureus SaMazF shows conservation of functional dynamics.
pubmed doi rcsb
total genus 36
structure length 115
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mzmA00
5CR2A 5CKDA 2VUBA 5DLOA 2MF2A 1VUBA 5CKFA 5CKBA 4OF1A 5CQXA 5CCAA 5HK3A 4VUBA 4MZPA 4ELZC 3G7ZA 5HK0A 4MDXA 5HKCA 4MZMA 1UB4A 4HKEA 3NFCA 1M1FA 3HPWA 2KMTA 5CQYA 5CKEA 3TCJA 3JSCA 2C06A 4ME7A 5CK9A 4ELYC 1NE8A 3JRZA 5CKHA 1X75C 5CO7A 4MZTA 3VUBA
chains in the Genus database with same CATH superfamily
4B9WA 2ZPGB 4ZTFA 2RQUA 1OX9A 2KT8A 1ZSZB 5CIUA 4C5GA 2HAXA 2VGMA 3EG3A 4ESRA 3HL8A 2CSIA 4J6XA 3CMET 4FM4B 3OW2A 4KUDK 3VV0A 1M2VA 3D7SB 1K8AC 3A8GB 5CKDA 1SHFA 4OB1B 3QZ9B 1ZSZC 3OS2A 1YIJQ 4LDVA 2MMPA 3TQ7P 1MV3A 1M2OA 3EGDA 3FLGA 1W2BA 2ZPEB 5KYWB 4N0AA 2J05A 4NS5A 1JO8A 2DVEA 2RF0A 3MEUA 2RI5A 3JCMV 4DBFA 2VASA 2QQ9A 1VQOA 2K57A 2EQKA 2LCCA 4JLIA 3RIRA 4NL2A 3OYAA 2ED0A 5L8RE 4C8QB 4KGZB 1X69A 1WI7A 5GAOq 4F7UG 1ZBJA 3RR6A 3O8VA 1VYUA 2WACA 2YRDA 4F16A 5KE3A 4RG8A 1KD1C 1WQWA 1YIJT 5IXFA 1KK7A 1SSHA 2CZ0B 3QDRB 4J9GA 2QQAA 4M7AF 1VQNA 1OQKA 2F69A 1H8KA 2CKKA 1KSWA 4PJOD 1QVGS 3L2RA 3HP9A 2DXTA 5FRMA 1JRIA 2PU9B 4FYVB 3LH0A 3VRZA 2R58A 2RA2A 1EX4A 2CGHA 3NGPA 1KFZA 2YUQA 4BDYA 4PK4A 4BD3A 3HFOA 3I56A 2LT4A 2G3RA 3UATA 3JCMc 2DL3A 4OGCA 4F04B 4XTYA 2KXDA 1OV3A 1VA7A 4J7IA 1YJNA 4NOYA 2RPNA 3QBYA 3A98A 4OVAA 3OY9A 2VVKA 2K2VA 3TCJA 1K73U 4C8QC 1M1KU 2LQWA 2E65A 3ER0A 4AG2C 2EVRA 1YI2T 4ZGEB 2DA9A 3RERA 4E7JA 4M78E 3G71A 3INZA 4CC7A 2QA4A 4A54A 3M4GA 3OYCA 4HVVA 4C92B 1D0YA 1X43A 2E3HA 2A7YA 2EGCA 2KROA 2YRVA 4E7SA 1BU1A 4LE9A 2RJDA 3WVDB 3CC7Q 2XHCA 1HSQA 1UUEA 2LNVA 4C0ZA 1EFNA 1C1AA 2VGNA 3G7ZA 3BFMA 5EC7A 1WHHA 2X4WA 3LGLA 2CP3A 4BI8B 3CC4T 4L5GA 4M78C 5ECAA 2DZ9A 1UE9A 1X27A 2RQRA 3RMQA 4QVCA 3MEVA 1QVFP 1PKTA 3E9FA 4LUEA 4J9IA 3JCMJ 3M0QA 1VUBA 2GTJA 3PNWC 4HCZA 2YDLA 2FZCB 4IURA 8ATCB 3VS0A 5GANh 4F7UA 1T0HA 3UPUA 2EJFA 2MWPA 3G4SA 1M1FA 3OYGA 3FEOA 4M77F 4FSXA 5CQYA 3WVEB 1GRIA 1IRXA 2GFAA 5LJ5e 2GTOA 3ZEHA 1WHLA 1RUWA 3NPFA 4J9BA 4FSSA 1S72A 2FEIA 4C92F 3SFMA 2E5QA 2E12A 5DLQE 2L3PA 1D09B 2JZ2A 3MEWA 5HK0A 2WSCE 2EJ9A 3BDLA 1M1KR 5FU6C 5GAMh 5M9OA 1YCYA 1KQSS 3ASKA 1B34B 3TREA 3CEYA 2DEQA 3G1JA 4M78G 2KRSA 4MZTA 1YJ9Q 1VQ4Q 2XK0A 1ZLMA 3CD6T 4V2SA 3MKDA 5I22A 1NG2A 2GBQA 1RADB 4ELZC 5LJ3j 2KR3A 1NEGA 5D6YA 3NTKA 2K5FA 1VQ4T 1YJ9T 3EGXB 3F70A 5KYXB 1IO6A 2KE9A 3GBQA 1XTDA 2JXBA 1NE8A 1N5ZA 5KCHA 1VQPQ 4PFPA 5LJ5d 3G6ET 2OTLT 2DX1A 4IUQA 3GIBA 3CCLQ 5KYUA 1G3SA 4M7AA 2D0QB 2CS7A 3EG0A 5FLXE 2KXCA 2FHDA 3H0FA 5LJ3f 5LJ3g 5GAMj 2EJGA 2EYZA 1MMNA 4PLLA 4M7DB 3A8MB 3OYFA 2K5LA 5AYFA 2QQRA 3QZ5B 4C5IA 2HBWA 2CT3A 2YRCA 5DM7R 2DD5A 4QKUA 3RUXA 3IQLA 2KYBA 3OW2P 2GCXA 1WXUA 1BKBA 2RD1A 7AT1B 1AT1B 2VXFA 4RG2A 2XIDA 4IUPA 4RTWA 4RTUA 4AT1B 1QWEA 2OX7A 2P0KA 1VQ8Q 1W2BP 2X4YA 3HHTB 4ELYC 1B3QA 1YIJA 1OU9A 1NJIC 1W6XA 1AWOA 4M7AD 1YJNQ 1PCXA 4D8DA 4HT8A 4A4HA 1TWBA 2DLPA 4PJOF 4ATOA 3NFCA 1BCMA 2FYKA 3M0UA 1NM7A 4XU0A 1CKBA 1I4K1 3H41A 1VQMT 1VQPA 3QKJA 1TOVA 3I56T 2QYZA 1RL2A 4EMKC 4RCBA 1WXTA 2COYA 5J3BA 1TTHB 4C8QA 3G6EQ 4J5YA 3V8LA 1NJIR 2RJFA 1IXDA 4GBQA 1D1AA 1QW1A 4C92A 3JCMX 4IIOA 5GAOp 2L2PA 1GFDA 1SRMA 1U1TA 4JS4A 1HD3A 2DRMA 2KAFA 3OSVA 1LJOA 4M7DF 5FROA 1VQ6Q 1OI1A 4RMOA 2RK1A 2ROTA 2RK2A 5LJ3e 2V8KA 3JB9J 4BE2A 4C0DC 1XOVA 5J26A 4JJNK 1Y57A 3AHUA 4J9CA 1JXOA 4DA4A 3QYGB 5CR2A 3X20B 3Q1JA 4PJNA 4J83A 4J7FA 4E7HA 1YNZA 2GQIA 4RKUE 2QQBA 1WJRA 1Q81U 2PVGB 3OYBA 2HQEA 5GAN8 2ZPFB 3VS3A 4E47A 5LJ5g 3G71T 4ZN1A 1LOJA 2DEUA 2I0NA 4IIMA 5D6XA 1M5Q1 4F7UF 2MF2A 2ZZDA 4JPBW 3QSUA 1RLPC 1N8RC 1MNDA 2ENMA 1V76A 4BY6C 3PVQA 2DJQA 2EFIA 3LGFA 3RMSA 2HDAA 4GLMA 4OMMA 2MOXA 1TXQA 3R6NA 4M77D 1QP3A 1U1SA 2JN0A 4FYXB 1OZ2A 4PJOE 2B8AA 5GANf 2J6FA 1GCQC 4A4GA 2FPEA 3M4YA 3RKYA 1UJYA 1ZBXA 1TU0B 3M56A 3QWYA 4JZ4A 2NWMA 2E3IA 1YITA 1N8RU 1PD1A 2HSPA 3CMEA 2A08A 3V8JA 1TH7A 2HNIA 1UTIA 4IUTA 1N8RR 5IHIA 4OMLA 2RH2A 2EYXA 1QWFA 2YSQA 2E5KA 4E7IA 2ATCB 4LN2A 4BUGA 4RTXA 9ATCB 1D1CA 2FG0A 3TVTA 4C0FA 2V1RA 1UGQB 5KYNA 5GAMf 2A28A 1UDLA 4FU6A 4LUDA 2CP2A 5A0DA 4LD9K 2LCLA 2DM1A 4A4KA 1R0BG 4ZTJA 3PMIA 1VQOT 2CREA 1OOTA 1YI2Q 4F7UB 3CMAT 3MP6A 5GMKm 2D8JA 1RAAB 3TU4K 4C92G 4MMLA 3I55T 4RTZA 2QAZA 2JMCA 1PNJA 2G6FX 2JTEA 3LLRA 3VS5A 2E4HA 3CCSQ 1JB0E 5GMKl 4Z02A 2FRWA 2O9SA 4LDXA 4OF1A 1G3TA 4XTWA 2X3WD 3VS7A 1BCOA 1M90U 2D1XA 2GNCA 2V8JA 4XTXA 1YJNT 2WSFE 4Y91A 5A0LA 1Q82U 5C0MA 2YUOA 3EAEA 2XICA 1WGSA 5LL6S 2VB6A 2FL7A 3SHWA 5FU6B 1Q7YU 5IAYA 2JM9A 2W10A 2DPPB 4BDZA 2LJ1A 2E41A 4FT2A 3RNJA 2COZA 1SSFA 2JMAA 5A2QE 3CCMQ 1KHIA 2IIMA 3EGXA 4M77C 5I11A 3M53A 4QVZA 3BE3A 5GMKi 2X9HA 2JT4A 2DE0X 3L2ZA 5GAN7 2XG8D 1FXXA 1UECA 4PJJA 4DBHA 5HK3A 2OTJA 1XQHA 5C6SA 5I2SA 4O6JA 4M75D 2A3LA 2EGAA 4K11A 2HL5C 1SF9A 4M7AB 1BI0A 3OYEA 4Z88A 2M02A 2DXUA 5FU7B 1G8XA 3QPHA 4LDUA 2KSSA 1K9MC 2DFUA 2GQVA 1YP5A 1G2BA 1M30A 3PMTA 1WHKA 2PUKB 2J7IA 2MWOA 4M78B 3MO8A 5CKBA 1G83A 5IHKA 2CP5A 1K4US 2AZVA 2DBKA 2VKNA 1GCPA 3M0RA 1PD0A 3MP1A 3L42A 1Q81R 4R0KA 1HXDA 3GF5A 4HA8A 1HK9A 2L5QA 2O88A 2IVWA 2J6KA 4FYYB 2PVDB 3CCUT 1UEBA 1PM3A 5LJ5f 1KQ2A 5GAN5 2RB6A 2OI3A 2NLUA 2C0TA 4A53A 4KULA 3OYDA 2QG9B 2HEQA 3CCQA 1VQMQ 2OAWA 2DYIA 3JRZA 4M7AE 1K9MU 4JS5A 2E70A 4JRQA 1WDXA 2XKOC 3KUFA 3MPUB 1Q81C 4WCIA 3EHRA 3V8KA 3JCMQ 1AVZC 4AG1C 2V26A 4JJDA 2H8HA 2HBPA 2LC4A 2DBMA 1V1CA 3META 4KGXB 2W0ZA 3JCMg 4C5EA 1A0NB 2A36A 3LX7A 3OBWA 2DILA 1NEBA 2HMAA 4YTLA 3CC2A 5DLOA 3EGDB 1RAEB 1ZUUA 2YLCA 3ME9A 5GJVB 2QA4Q 1UFFA 1Z9ZA 4KUIA 3GOXA 1VQ7A 1RLQC 4WTOB 3LYIA 3QDFA 2LQKA 1EIFA 1RAHB 2OTJT 2EPDA 3OYLA 2KI7A 4A4EA 3NTHA 3V7SA 2O2OA 1GL5A 3PTAA 3M0SA 1VQLQ 3CCMT 3JCMb 3M9QA 2MPXC 3EG2A 1ACMB 2DJZA 4WF2A 3JSCA 4J6WA 1KQSP 2JOYA 4F7UE 3PGGA 2CZ7B 1SRLA 1JQQA 1JBMA 2J6OA 2RMOA 3OYMA 1WJSA 1UHCA 2QEXT 2RHZA 3SWNC 2L0AA 2KQWA 4M75A 2XDBA 3CCUA 4L6V5 4ANJA 1SKUB 4DEYA 2M9UA 2BE9B 3CPWS 1VQ9A 3RKXA 3JCMf 3PIPA 1QCOA 1Y96A 4KBMB 1VQKT 1WXBA 1WPYA 4FYWB 2QGFB 1YCSB 3CC2T 2PNIA 4HVUA 1QLYA 2DL7A 2HD0A 5GMKe 1BIAA 1LPLA 1PSEA 2D6FA 2JVVA 3RKWA 3KXTA 1BI1A 4AMCA 1YJWQ 1Q86R 3PT9A 5CKEA 2M51A 2WSEE 3REBB 2YUPA 1IHVA 2EQIA 3JAME 3KBGA 1T0JA 1K73C 4OMPA 3HRUA 4OMOA 1QMCA 3DB3A 2DL5A 4KH0B 3CMAA 3G4ST 2KRMA 1YJWT 1HYOA 4HT9A 3CCJT 3VYHB 3CCEQ 4J9FA 1WX6A 4CI0C 3OS1A 4M7DG 1FMWA 5HY6A 3TSZA 5GAOn 2EQJA 1S1NA 1YN8A 1R0CB 2HQHA 3VS4A 2E6ZA 3EFOA 4X9CA 5LJ3h 1D3BA 4EDUA 2QEXA 4J9DA 2EBPA 1VQ8T 1CKAA 5GAMg 1K73R 3KFVA 1T3SA 3PVLA 2J06A 1ZA2B 2LX9A 1WA7A 1YFNA 1VQ5T 1DJ7B 2YHTA 4M77G 2HZYA 4C92D 3CCMA 5KYUB 1KD1U 3OYIA 1NLOC 2P4RA 2HKNA 5FWCA 1X2KA 4CC3A 2M1HA 4QQ6A 2EWNA 2K7AA 1SG5A 3UF4A 1CSKA 1Q7YC 4FW1A 1ZUKA 4C0GA 4MDXA 2K5IA 2IG0A 4M78D 4PFOA 5GANg 3GP8A 2GF7A 3EFSA 1NPRA 1NLPC 2FPFA 2JNGA 1Q82C 1BIBA 2JM8A 5D6WA 2F1LA 2K79A 2B86A 3OYNA 1M90C 1VQNT 4JRKA 2QTXA 3LWIA 3GPLA 4AFQC 1K0SA 2LJ0A 1RI0A 1YI2A 3G4SQ 4XU1A 3V7CA 3LWHA 2QGGA 2DZCA 1M1GA 3S6WA 1N27A 3EG9A 3OS5A 1NBEB 2DTOA 3EGUA 1K9AA 1X6BA 1O9SA 3BW1A 2L3SA 4XQ3A 2ZGWA 3P8HA 3HFNA 2KT1A 3L2UA 4M78A 5KYYA 5GMKj 4XU3A 1JU5C 2CUDA 1V29B 4MMKA 5FW9A 1B07A 2K6DA 1FMKA 1VQ5A 1M27C 1X75C 2CH4A 3VS1A 3WXMB 2XU8A 3OB9A 1ZUYA 4C8QE 4PJOA 1AZGB 3GNFB 3VYGA 1I5OB 2SEMA 2F2WA 3CQTA 1VQ9Q 4ZN3A 1ZQ1A 3OYYA 4RUGA 3CCST 3CBMA 3JV3A 1O75A 1I81A 2BKDN 4HXJA 1TUCA 3CC2Q 2ROLA 4M78F 4N4IA 2KGTA 3CCUQ 2JTMA 3OMCA 3M57A 3AT1B 2RI3A 4QQGA 2DERA 2AT1B 3M5AA 4N0AC 2HL3A 2KRNA 3C4SA 4BI4A 4M77E 3OA6A 3OQ5A 2ZPHB 3JB9H 4TVRA 1QVGA 1Y71A 3TSWA 1TSFA 3CPWP 1G5VA 3OYKA 1H641 4M75B 4BI3A 4M77A 1WQ7A 3MP8A 4XK8E 1KIKA 2X51A 2KEAA 2BTTA 1JXMA 1LCKA 1WIEA 1G3YA 1GBRA 4JRIA 1D0ZA 3L2VA 1JJ2A 2JTFA 3OYHA 2RO0A 2AZSA 1IHWA 3JB9I 3OMGA 4J9HA 1JJ2S 1UHFA 2OJ2A 2JW4A 4GY5A 5AT1B 2BZXA 2MYSA 1KJWA 2RNAA 3R6OA 3QIIA 2F2XA 3FJ5A 3CCRQ 4M7DD 1E7OA 4CC2A 4C8QG 4D6WA 3QHSA 2E64A 1NZ9A 5GAMd 3UA6A 1VQ5Q 4C92E 5GANe 4E2FB 4RCCA 5GAN6 4OB0B 1YBYA 5LJ5j 2DK3A 2DVJA 1OYXA 1WYXA 2EQUA 2P4TA 3X25B 1I5LA 1VQOQ 4DOVA 2ECZA 3JCMh 3UT1A 5LJ3d 3LH5A 4XTVA 3EFOB 2QDLA 2RN8A 4CRIA 4C92C 3E9GA 1BBZA 3C0CA 5GAMe 1M8VA 1K8AU 4BY6B 2RHUA 2X35A 2DD4A 2FPDA 2Y4YA 4IUVA 4Y28E 1T3LA 4E6RA 3I56Q 3THKA 3CBPA 3P8DA 5CVIA 2LNHB 1U3OA 1AHJB 2H3JA 1Y96B 2XDDA 5DY9A 1SHGA 4OP0A 3CCEA 2BUDA 3H8ZA 2BZYA 2F2VA 1NJIU 1GXIE 2QEXQ 2NUZA 5EG2A 2K9GA 1FWZA 4P5NA 3M55A 3CCVA 1W1FA 1VQ8A 3ULRB 3CCQQ 3A8LB 8AT1B 1ZA1B 2LVMA 3M0TA 1N6AA 4KH1B 4AFUC 4D8KA 2RHYA 1BI2A 2LJ3A 1KQSA 1ZSZA 3MCAB 2KVQG 5A0GA 1VQLT 3UDCA 2DMOA 3HPWA 2LP5A 1W4SA 1Q95G 3EH2A 1X01A 4BB7A 4PKCC 2FVUA 3EG9B 2LT1A 1KD1R 3M0PA 4O5VA 1MMAA 1ZHIA 3BY7A 4Y92A 2AKLA 4PLIA 2MCNA 2DL8A 2CH4W 4F17A 4EMKB 2EW3A 1N9RA 5LJ5h 3M54A 3S3NA 1G3WA 1OX8A 3NHNA 2KDSA 5KYWA 4J9EA 2HSEB 2LRQA 2K3YA 2VUBA 1VOMA 5CCAA 1FYNA 1SEMA 3CC7T 1VQ6A 4E7KA 2DETA 1VQPT 1X2QA 4PJMA 1YHQA 2YXYA 4X9DA 5HCKA 1E6GA 1M3CA 2D9TA 1TUDA 3CMAQ 3M59A 5IHNA 1QQJA 2V8IA 1W70A 4DBRA 1S72T 2FZGB 3V7RA 4GLKA 3L2WA 3RBBB 2RQTA 3H0HA 1RACB 2XI9A 2OTLQ 1ARKA 3CD6Q 2X4XA 2FO0A 1VQKA 4XTUA 1M4ZA 1BK2A 3SWNB 2YUNA 2Y90A 2KY9A 2RI2A 1GFCA 1UGRB 4RTTA 3VUZA 5CK9A 3CCJQ 3E1SA 5GMKh 1GCQA 2EYYA 3URGA 4IUUA 3MEAA 3CCRA 3P8BB 2CP6A 4M75F 4RTVA 2DXCA 3M58A 3JB9F 1QVPA 5GAN4 4C8QD 4C5HA 3REAB 2LQNA 1I07A 3ZFJA 1YITQ 5KYYB 3CCJA 2O4XA 3VUBA 3HRTA 4JUVA 4OB2B 2BE7D 4M7DC 2IPOB 2E1HA 2XDPA 4HCBA 4Q5WA 1OPKA 2BZ8A 2L89A 3EHQA 1WHMA 5KH6A 2Z0WA 1ZX6A 1YHQT 4ME7A 1R8OB 1RI9A 2DRKA 5GAOm 4DEXA 2EAYA 3FC3A 1U8RA 3CC4Q 4EPCA 4Z8AA 1I1JA 2PZ1A 1MGQA 2GFUA 1BI3A 5FU7C 5GAOl 2DO3A 5IXBA 5GAN2 1OEBA 3CCQT 4A4FA 5KE2A 4JDSA 4OGEA 2R5MA 2H3EB 2VWFA 1M1KC 3FB9A 3CXCS 2C0OA 4LXCA 1E6HA 1TS9A 4M77B 1KC8R 3CXCA 3S3OA 3VKIA 4ORZA 1K9MR 3QG1A 4N4GA 2GGRA 2DYBA 3CBOA 2DXBA 2OTJQ 1MUZA 3QYHB 4AFZC 3VS2A 3HRSA 3A8HB 1QKWA 2FB7A 1MHNA 4HCCA 4L59A 2QA4T 2EGEA 4II1A 1OULA 2BIVA 4OMNA 1PKSA 3E2UA 3JCMP 5CKFA 1VQ7T 1H3HA 4M75C 4VUBA 4MZPA 4PNOA 4RTYA 5I21A 4EIKA 5GANj 4AFSC 4JZ3A 1WJQA 1KC8C 1MV0B 1OU8A 2C06A 4JJCA 1UGSB 3EH1A 1FMVA 3EG1A 3X28B 2Y4XA 2DAQA 3CCET 3X24B 1OZ3A 5GAN3 1AWJA 4ZNXA 2RHIA 1QVGP 1IB8A 3C95A 2COWA 3C94A 4OMFB 3I55Q 1KQ1A 2PUOB 2AIRB 1D1BA 1Y07A 4PL6A 4HKEA 4M7AC 2KNBB 4LDYA 2P0PA 2RJEA 4X34A 2DTIA 3I5RA 2HKQB 2CSQA 1B7TA 4OMQA 4J8OA 2VXEA 1AD5A 3SB2A 3JCMW 2MI6A 4ZGJB 4Z89A 2I2LA 4HVWA 2EIFA 1NYFA 3VU3C 1K76A 4N4HA 2QASA 2R57A 2AK5A 1WHGA 1UG1A 1WHJA 1QCNA 4OB3B 1H92A 1D3BB 3CD6A 1U06A 3TEEA 1LNXA 1M3AA 1AZEA 3LW5E 3NMZC 5GAOr 1WNLA 2DF6A 1GBQA 2LCSA 2KK4A 3QO3A 2OTLA 2KYMA 3MHXA 4JLGA 5CAIA 2E6NA 3FJPA 6AT1B 2HCKA 2CZ6B 2NUPA 3G6EA 1YJWA 1TUGB 3VRYA 2K4YA 2YLBA 2EKHA 2NUTA 1JJ2P 1Y7XA 2CUBA 2LDMA 1NPPA 4JJBA 1B34A 4M75G 3FDRA 1AOJA 3RDVA 3SWNA 1YHQQ 1PC0A 1YITT 3OW2S 2YWWA 2VV5A 5HKCA 4FCYA 4FL6A 2QDYB 1UB4A 2YT6A 2MK5A 1S72Q 2QQSA 3N5BB 4B6MA 3SEMA 1YWPA 1VQ7Q 1I0CA 1RABB 5IT9E 4EMKA 3X26B 1PHTA 1ABQA 5KYXA 2M0OA 2CYZB 1QKXA 1ZSGA 2O4XB 4QT7A 1BB9A 2A0FB 4M7AG 5D7UA 5KCOA 2AHJB 4X1VA 4CC4B 1JEGA 3QWXX 3JCMe 2LQ8A 3ZL7C 4R56A 3JB9D 4C8QF 5IN1A 2PQWA 3S3MA 2X4JA 3BDUA 4M7DA 2LX7A 1KHCA 1Q86C 3MJXA 5CQXA 2FZKB 2MIOA 2DIGA 4FW2A 3ZBDA 2M0YA 3OS0A 2DKGA 3NTIA 2F5KA 1K0XA 3CCRT 3I5SA 5IH2A 2QXFA 1IGUA 1P92A 2DTHA 4KT0E 3RESA 4UC4A 4XU2A 5CKHA 4PJLA 3CCVT 2KBTA 2RHXA 2XMFA 1IREB 4PJOG 2CZ1B 4BE0A 2XD0A 3T9NA 2EKOA 3H0IA 4FIBA 3G71Q 3A1PA 4FT4A 3FRNA 1RAIB 4DQ2A 1QVFA 2K2MA 3H6ZA 1Q86U 4E7ZA 2LZ6B 2KMTA 1SPKA 1QVFS 1AWXA 1UGPB 1VIFA 1VIEA 4LDWA 3J81E 1X6GA 1C6VX 4DOWA 1EZZB 1IGQA 3DKMA 1UJ0A 2ZAEA 5GJWB 2A37A 2CT4A 1AWWA 1M2VB 3E19A 1Y0MA 3QXEB 3J7AF 1VQ4A 1YJ9A 3HKSA 3SDZA 2C0IA 1VYVA 1Q7YR 2D8HA 2JS0A 2JJ9A 4QQDA 3OSSC 5J39A 2L8DA 3DLLA 2O31A 1RAGB 2AKKA 2ESWA 2ZPBB 4QW2A 3CCVQ 1J3TA 3CPFA 4LNPA 4EMHA 1N9SA 2L3RA 1Q82R 4XTZA 1BYMA 2RM4A 2E10A 3QJYA 1PWTA 1QP2A 1W2BS 1M90R 2JUFA 4DBQA 4M7DE 3CCLT 4PJOB 3DLMA 1UGVA 3FIFA 2VC8A 1M9SA 1PSFA 2ZPIB 4KRTA 1MMGA 2O01E 2K3BA 4KGVB 3UWNA 3VJPA 1I8FA 1KG1A 1NYGA 4NL3A 1TG0A 2K3XA 4MDWA 1R77A 2DNUA 1WLPB 3EFRA 3JCMd 1U5SA 1VQ6T 2RQWA 4PJOC 2P0QA 1WFWA 2VYTA 2SRCA 2EYWA 2JS2A 3O5ZA 3GNGA 2ZCFB 3I35A 4JRPA 3CC7A 2O9VA 4A63B 2MAMA 3PIOA 1WZOA 2R5AA 1ABOA 2QI2A 1D0XA 2DIQA 4BACA 3QUIA 3HTRA 3A8OB 3OBYA 2NUPB 2LMJA 4QVDA 5FWBA 3I55A 2NUTB 2CP0A 3CC4A 3L1AA 3DB4A 4ZGDB 3U23A 3CPWA 3VS6A 2M16A 1VQMA 2LTOA 1C0MA 2CDTA 1PRMC 1MNEA 3GLXA 3L2QA 4IKFA 1M8MA 2DL4A 5I2MA 3CXCP 4EMGA 4E7LA 5CO7A 2FRYA 2OAUA 3CCLA 1KC8U 2RQVA 2ABLA 2QK0A 2HQXA 1M3BA 2PVOB 3I9QA 5FRNA 1H3ZA 1PRLC 2F5TX 3JB9G 4XAXB 2EYQA 3PE0A 1X6OA 4MZMA 3PFSA 2P84A 3H9NA 4J6YA 1XJWB 1OPLA 2V1QA 3J80E 2QTVA 1PG5B 1VYTA 1QCFA 4M75E 3CMEQ 1FX7A 3UA7A 1LVKA 1MMDA 3QJ6A 3C12A 4BE1A 1AEYA 1VQ9T 1RAFB 4B9XA 3OYJA 2D0NA 4R55A 2CP7A 2NYSA 5L23A 1Z9QA 3A5ZB 5GANd 2PTKA 3HSBA 1HJDA 1F1BB 2EQMA 2L3QA 1VQLA 1K8AR 4M4ZA 4PFZA 1VQKQ 4LD6A 4HCKA 1IZ6A 1XNIA 1VQNQ 3CCSA 3SD4A 4C0DB 1YWOA 2X3XD 2ED1A 2RJCA 4F14A 1K1ZA
chains in the Genus database with same CATH topology
4B9WA 2ZPGB 1BIBA 4ZTFA 5D6XA 3JCMP 5D6WA 1M5Q1 4F7UF 2MF2A 5CKFA 2ZZDA 1M90C 1VQNT 3OYNA 1VQ7T 4JRKA 3QSUA 2QTXA 5CIUA 4C5GA 4M75C 4VUBA 4MZPA 3LWIA 2VGMA 3GPLA 1N8RC 2HAXA 4BY6C 4PNOA 5I21A 3HL8A 2EFIA 3LGFA 5GANj 1RI0A 1YI2A 3RMSA 4XU1A 1WJQA 3V7CA 4J6XA 3LWHA 1KC8C 2DZCA 3CMET 2C06A 4FM4B 1UGSB 3OW2A 4M77D 1M1GA 3S6WA 1N27A 1QP3A 1U1SA 2JN0A 4KUDK 3X28B 2Y4XA 3VV0A 3OS5A 1OZ2A 2DAQA 3CCET 3X24B 4PJOE 2DTOA 2B8AA 3A8GB 5CKDA 1K8AC 1OZ3A 5GAN3 4OB1B 1O9SA 2RHIA 3BW1A 3QZ9B 3C95A 5GANf 3C94A 4OMFB 4A4GA 3OS2A 4XQ3A 2ZGWA 4LDVA 2MMPA 1KQ1A 3M4YA 3RKYA 1ZBXA 3P8HA 2PUOB 3HFNA 3M56A 1YITA 1N8RU 3L2UA 4M78A 3FLGA 1Y07A 3CMEA 3V8JA 4PL6A 4HKEA 5GMKj 1W2BA 4M7AC 1TH7A 4LDYA 4XU3A 2ZPEB 2HNIA 2P0PA 2RJEA 4X34A 4N0AA 4NS5A 2DTIA 4IUTA 1V29B 4MMKA 2DVEA 3MEUA 2RI5A 2RH2A 1VQ5A 1X75C 3JCMV 3WXMB 4E7IA 2QQ9A 4J8OA 2VXEA 2XU8A 3SB2A 3OB9A 2MI6A 2K57A 4BUGA 3JCMW 1VQOA 4C8QE 2EQKA 2LCCA 4JLIA 3RIRA 4NL2A 4C0FA 1UGQB 4ZGJB 3GNFB 3OYAA 4PJOA 5L8RE 5GAMf 3VYGA 4C8QB 2I2LA 4FU6A 5GAOq 4F7UG 2EIFA 4ZN3A 1ZQ1A 3OYYA 3VU3C 5A0DA 4LD9K 3CCST 3CBMA 4N4HA 2LCLA 1O75A 1I81A 2BKDN 2R57A 3O8VA 4A4KA 4ZTJA 3PMIA 1VQOT 2WACA 4OB3B 4F7UB 3CMAT 1D3BB 4M78F 4N4IA 3MP6A 3CD6A 2JTMA 3OMCA 3M57A 3TEEA 5KE3A 4RG8A 1LNXA 4C92G 1WQWA 4MMLA 5GMKm 3TU4K 2RI3A 3LW5E 3I55T 1YIJT 2CZ0B 4QQGA 3QDRB 1WNLA 3LLRA 2QQAA 5GAOr 3M5AA 4N0AC 4M7AF 1VQNA 2F69A 1JB0E 5GMKl 4Z02A 2CKKA 2KK4A 3QO3A 2OTLA 4LDXA 3C4SA 4OF1A 1G3TA 1QVGS 4PJOD 4XTWA 3HP9A 4BI4A 4M77E 3MHXA 4JLGA 3L2RA 3OA6A 3OQ5A 2ZPHB 5CAIA 2DXTA 4TVRA 2E6NA 5FRMA 3JB9H 1QVGA 1JRIA 3FJPA 1Y71A 2PU9B 1M90U 3LH0A 2CZ6B 3G6EA 1YJWA 2V8JA 4XTXA 2R58A 1YJNT 2RA2A 2K4YA 1G5VA 2WSFE 2YLBA 3OYKA 4Y91A 1H641 4M75B 5A0LA 4BI3A 1Q82U 4M77A 1WQ7A 3MP8A 2CGHA 1Y7XA 4XK8E 2LDMA 5C0MA 4BDYA 1NPPA 3EAEA 1B34A 4M75G 4BD3A 2XICA 3FDRA 3SWNA 3HFOA 1WGSA 5LL6S 3I56A 2FL7A 1G3YA 2LT4A 2G3RA 1YITT 3OW2S 4JRIA 3JCMc 5FU6B 1Q7YU 4OGCA 5IAYA 4XTYA 3L2VA 2DPPB 4BDZA 1JJ2A 2JTFA 2VV5A 2RO0A 3OYHA 4J7IA 5HKCA 4FL6A 2QDYB 4NOYA 1YJNA 3QBYA 1UB4A 3JB9I 2E41A 3OMGA 4FT2A 4OVAA 1JJ2S 3OY9A 2K2VA 2QQSA 3N5BB 3TCJA 1K73U 1SSFA 4GY5A 5A2QE 4C8QC 1M1KU 1KHIA 2E65A 3ER0A 3R6OA 4EMKA 5IT9E 3X26B 4M77C 3QIIA 3M53A 4QVZA 4M7DD 2M0OA 2CYZB 1YI2T 4ZGEB 4C8QG 5GMKi 4D6WA 3QHSA 2E64A 1NZ9A 3L2ZA 5GAMd 5GAN7 2O4XB 2XG8D 1FXXA 4E7JA 3RERA 4M78E 5HK3A 4M7AG 3G71A 3INZA 2OTJA 1XQHA 4C92E 5C6SA 5GANe 5I2SA 5KCOA 2QA4A 4A54A 4O6JA 3M4GA 4M75D 2A3LA 4RCCA 3OYCA 5GAN6 4OB0B 1YBYA 2AHJB 4C92B 4M7AB 1BI0A 5LJ5j 3OYEA 2DXUA 2A7YA 2DK3A 5FU7B 2LQ8A 1OYXA 3QPHA 2KSSA 4LDUA 3JCMe 4R56A 3JB9D 2EQUA 2P4TA 1K9MC 2GQVA 2YRVA 4C8QF 5IN1A 2PQWA 3PMTA 2RJDA 3S3MA 2X4JA 3X25B 3WVDB 3BDUA 1I5LA 4M7DA 4DOVA 2XHCA 1KHCA 2PUKB 2LNVA 2MWOA 3JCMh 4M78B 1Q86C 3MO8A 5CKBA 3UT1A 5CQXA 5LJ3d 4C0ZA 4XTVA 2DIGA 3ZBDA 2VGNA 3G7ZA 3OS0A 3BFMA 2DKGA 2X4WA 3LGLA 3NTIA 4CRIA 2F5KA 4BI8B 4C92C 3E9GA 3CC4T 3MP1A 5GAMe 1M8VA 4L5GA 4M78C 3CCRT 2DZ9A 3L42A 1K8AU 2QXFA 3RMQA 4BY6B 1P92A 2RHUA 3MEVA 4QVCA 2X35A 2DTHA 2DD4A 4KT0E 1HXDA 3GF5A 4HA8A 4UC4A 1HK9A 2Y4YA 2L5QA 3E9FA 4IUVA 3RESA 4XU2A 4Y28E 5CKHA 2IVWA 3CCVT 2PVDB 2RHXA 3CCUT 3JCMJ 1IREB 1UEBA 5LJ5f 3CBPA 4PJOG 1VUBA 1KQ2A 3P8DA 5CVIA 5GAN5 2CZ1B 4BE0A 2XD0A 3PNWC 4HCZA 1AHJB 4IURA 3T9NA 2H3JA 2RB6A 2EKOA 1Y96B 2NLUA 4FIBA 4OP0A 4FT4A 5DY9A 2BUDA 3FRNA 3H8ZA 4F7UA 2XDDA 3CCEA 4A53A 4DQ2A 3UPUA 2EJFA 2MWPA 4KULA 1QVFA 1Q86U 3H6ZA 1NJIU 1GXIE 3G4SA 1M1FA 3OYDA 3FEOA 3OYGA 4M77F 2KMTA 4FSXA 5CQYA 5EG2A 3CCQA 1QVFS 3WVEB 1FWZA 1UGPB 1VIFA 2GFAA 4P5NA 5LJ5e 3M55A 1VIEA 4LDWA 3J81E 3CCVA 3ZEHA 1VQ8A 3JRZA 4M7AE 1K9MU 4JS5A 2E70A 3A8LB 4JRQA 1S72A 4C92F 4DOWA 3SFMA 2LVMA 1N6AA 2E5QA 2XKOC 3KUFA 1Q81C 2E12A 3DKMA 2RHYA 5DLQE 3MEWA 1BI2A 2JZ2A 5HK0A 2WSCE 2EJ9A 3V8KA 3BDLA 3JCMQ 1KQSA 5FU6C 5GAMh 3MCAB 2KVQG 5A0GA 5M9OA 1VQLT 3UDCA 3HPWA 1YCYA 2HBPA 2LC4A 3ASKA 1B34B 1W4SA 3E19A 3QXEB 1KQSS 3J7AF 1VQ4A 1YJ9A 3HKSA 3TREA 3CEYA 2DEQA 3META 1X01A 3SDZA 3JCMg 4C5EA 4M78G 3LX7A 4BB7A 3OBWA 4MZTA 4PKCC 5GANh 4QQDA 2XK0A 3OSSC 5J39A 2L8DA 4YTLA 2FVUA 3DLLA 3CC2A 5DLOA 3CD6T 4V2SA 2LT1A 3ME9A 2YLCA 4O5VA 4ELZC 1ZHIA 2ZPBB 3BY7A 4KUIA 5LJ3j 4QW2A 4PLIA 3GOXA 1VQ7A 3CPFA 4EMHA 1N9SA 2L3RA 5D6YA 3NTKA 4XTZA 2K5FA 1BYMA 1VQ4T 1YJ9T 4EMKB 3LYIA 2RM4A 2LQKA 1EIFA 2E10A 3F70A 3QJYA 1QP2A 1N9RA 5LJ5h 1W2BS 2D6FA 2JUFA 2OTJT 3M54A 3OYLA 3S3NA 4M7DE 1G3WA 1XTDA 4A4EA 3CCLT 4PJOB 1NE8A 2KDSA 3DLMA 5KCHA 5LJ5d 3NTHA 3G6ET 3FIFA 2VC8A 2OTLT 1M9SA 3V7SA 1PSFA 2LRQA 2ZPIB 2K3YA 2VUBA 4IUQA 3GIBA 3PTAA 1G3SA 5CCAA 2D0QB 2CS7A 4M7AA 5FLXE 2O01E 3UWNA 2FHDA 3VJPA 3CC7T 5LJ3g 5LJ3f 1VQ6A 5GAMj 3CCMT 4E7KA 1VQPT 3JCMb 1I8FA 2EJGA 3M9QA 1KG1A 4NL3A 2DJZA 1YHQA 2K3XA 4MDWA 4WF2A 4PLLA 4M7DB 3JSCA 4X9DA 4J6WA 3EFRA 3JCMd 2JOYA 4F7UE 3A8MB 3OYFA 1VQ6T 2K5LA 3PGGA 4PJOC 5AYFA 2P0QA 2CZ7B 2VYTA 2D9TA 2QQRA 3QZ5B 4C5IA 5DM7R 2DD5A 3M59A 1JBMA 3RUXA 3GNGA 2V8IA 2GCXA 2ZCFB 3OYMA 1WJSA 3CC7A 4JRPA 1S72T 2MAMA 2QEXT 3V7RA 4GLKA 3L2WA 1BKBA 2RHZA 3PIOA 3SWNC 2R5AA 2RD1A 2KQWA 4M75A 2QI2A 2VXFA 2XI9A 4RG2A 2XDBA 3CCUA 2DIQA 2XIDA 4L6V5 4IUPA 4BACA 2X4XA 3QUIA 1VQKA 4XTUA 1M4ZA 2M9UA 3SWNB 2P0KA 3A8OB 3CPWS 2Y90A 2KY9A 2RI2A 1UGRB 2X4YA 3HHTB 3OBYA 3VUZA 4ELYC 4QVDA 5CK9A 1VQ9A 3E1SA 3RKXA 3JCMf 5GMKh 3PIPA 3I55A 1YIJA 1Y96A 4KBMB 3CC4A 1VQKT 3URGA 3L1AA 1NJIC 1WPYA 4IUUA 3DB4A 3MEAA 3CCRA 4M7AD 3P8BB 3CC2T 4M75F 4ZGDB 3CPWA 4A4HA 4HT8A 2M16A 2HD0A 1VQMA 4PJOF 5GMKe 2DXCA 2LTOA 1BIAA 3M58A 3JB9F 1QVPA 1PSEA 5GAN4 2JVVA 3RKWA 3KXTA 1BI1A 3NFCA 4C8QD 4C5HA 3GLXA 3L2QA 4ATOA 4IKFA 3PT9A 5CKEA 2WSEE 5I2MA 3ZFJA 2FYKA 3JAME 3KBGA 3CCJA 2O4XA 4EMGA 4XU0A 4E7LA 1K73C 5CO7A 1I4K1 2OAUA 3VUBA 3CCLA 1KC8U 3HRUA 3HRTA 4JUVA 3DB3A 4OB2B 3CMAA 3G4ST 4M7DC 1YJWT 2HQXA 2PVOB 5FRNA 1VQMT 1H3ZA 2F5TX 3JB9G 1VQPA 2E1HA 2XDPA 3QKJA 4XAXB 3VYHB 3CCJT 4HT9A 3I56T 4CI0C 4HCBA 2EYQA 3OS1A 4M7DG 4Q5WA 1RL2A 1X6OA 4MZMA 5HY6A 3PFSA 4EMKC 4RCBA 2L89A 5J3BA 5GAOn 4C8QA 4J6YA 5KH6A 4J5YA 3V8LA 2EQJA 2RJFA 1YHQT 3J80E 4ME7A 1QW1A 4C92A 3JCMX 1R8OB 2E6ZA 5GAOp 5GAOm 4X9CA 5LJ3h 1D3BA 4EDUA 2EAYA 2QEXA 3FC3A 1U1TA 4JS4A 1U8RA 4M75E 4EPCA 2KAFA 3OSVA 1LJOA 4M7DF 1FX7A 1MGQA 2GFUA 5FROA 1BI3A 1OI1A 5FU7C 5GAOl 1VQ8T 2DO3A 4RMOA 2RK1A 2RK2A 5GAN2 5LJ3e 2V8KA 5GAMg 3QJ6A 3JB9J 3C12A 3CCQT 4BE1A 4BE2A 4C0DC 4A4FA 5KE2A 2LX9A 1VQ9T 1XOVA 5J26A 4JJNK 1VQ5T 1DJ7B 4JDSA 4B9XA 4OGEA 2YHTA 4R55A 4M77G 3OYJA 3AHUA 2R5MA 4C92D 3CCMA 1M1KC 1KD1U 3FB9A 3OYIA 3CXCS 4DA4A 3QYGB 5CR2A 3X20B 3A5ZB 5GANd 4M77B 3Q1JA 3CXCA 2M1HA 4QQ6A 4J83A 3VKIA 2EWNA 3S3OA 4J7FA 3HSBA 3QG1A 4N4GA 4E7HA 4RKUE 2QQBA 3CBOA 1WJRA 2DXBA 2EQMA 1Q7YC 4C0GA 1Q81U 1VQLA 2PVGB 4MDXA 3QYHB 2K5IA 3OYBA 2HQEA 2IG0A 4M78D 4LD6A 3HRSA 1IZ6A 3A8HB 5GAN8 2ZPFB 1XNIA 2FB7A 1MHNA 5GANg 4E47A 5LJ5g 2GF7A 3GP8A 3CCSA 3SD4A 4C0DB 3G71T 4ZN1A 3EFSA 4HCCA 4L59A 2RJCA 1LOJA 1NPRA 2QA4T 2JNGA 4II1A 1Q82C 1KD1C 2BIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CR2 A;  5CKD A;  2VUB A;  5DLO A;  2MF2 A;  1VUB A;  5CKF A;  5CKB A;  4OF1 A;  5CQX A;  5CCA A;  5HK3 A;  4VUB A;  4MZP A;  4ELZ C;  3G7Z A;  5HK0 A;  4MDX A;  5HKC A;  4MZM A;  1UB4 A;  4HKE A;  3NFC A;  1M1F A;  3HPW A;  2KMT A;  5CQY A;  5CKE A;  3TCJ A;  3JSC A;  2C06 A;  4ME7 A;  5CK9 A;  4ELY C;  1NE8 A;  3JRZ A;  5CKH A;  1X75 C;  5CO7 A;  4MZT A;  3VUB A; 
#chains in the Genus database with same CATH topology
 4B9W A;  2ZPG B;  4ZTF A;  2RQU A;  1OX9 A;  2KT8 A;  1ZSZ B;  5CIU A;  4C5G A;  2HAX A;  2VGM A;  3EG3 A;  4ESR A;  3HL8 A;  2CSI A;  4J6X A;  3CME T;  4FM4 B;  3OW2 A;  4KUD K;  3VV0 A;  1M2V A;  3D7S B;  1K8A C;  3A8G B;  5CKD A;  1SHF A;  4OB1 B;  3QZ9 B;  1ZSZ C;  3OS2 A;  1YIJ Q;  4LDV A;  2MMP A;  3TQ7 P;  1MV3 A;  1M2O A;  3EGD A;  3FLG A;  1W2B A;  2ZPE B;  5KYW B;  4N0A A;  2J05 A;  4NS5 A;  1JO8 A;  2DVE A;  2RF0 A;  3MEU A;  2RI5 A;  3JCM V;  4DBF A;  2VAS A;  2QQ9 A;  1VQO A;  2K57 A;  2EQK A;  2LCC A;  4JLI A;  3RIR A;  4NL2 A;  3OYA A;  2ED0 A;  5L8R E;  4C8Q B;  4KGZ B;  1X69 A;  1WI7 A;  5GAO q;  4F7U G;  1ZBJ A;  3RR6 A;  3O8V A;  1VYU A;  2WAC A;  2YRD A;  4F16 A;  5KE3 A;  4RG8 A;  1KD1 C;  1WQW A;  1YIJ T;  5IXF A;  1KK7 A;  1SSH A;  2CZ0 B;  3QDR B;  4J9G A;  2QQA A;  4M7A F;  1VQN A;  1OQK A;  2F69 A;  1H8K A;  2CKK A;  1KSW A;  4PJO D;  1QVG S;  3L2R A;  3HP9 A;  2DXT A;  5FRM A;  1JRI A;  2PU9 B;  4FYV B;  3LH0 A;  3VRZ A;  2R58 A;  2RA2 A;  1EX4 A;  2CGH A;  3NGP A;  1KFZ A;  2YUQ A;  4BDY A;  4PK4 A;  4BD3 A;  3HFO A;  3I56 A;  2LT4 A;  2G3R A;  3UAT A;  3JCM c;  2DL3 A;  4OGC A;  4F04 B;  4XTY A;  2KXD A;  1OV3 A;  1VA7 A;  4J7I A;  1YJN A;  4NOY A;  2RPN A;  3QBY A;  3A98 A;  4OVA A;  3OY9 A;  2VVK A;  2K2V A;  3TCJ A;  1K73 U;  4C8Q C;  1M1K U;  2LQW A;  2E65 A;  3ER0 A;  4AG2 C;  2EVR A;  1YI2 T;  4ZGE B;  2DA9 A;  3RER A;  4E7J A;  4M78 E;  3G71 A;  3INZ A;  4CC7 A;  2QA4 A;  4A54 A;  3M4G A;  3OYC A;  4HVV A;  4C92 B;  1D0Y A;  1X43 A;  2E3H A;  2A7Y A;  2EGC A;  2KRO A;  2YRV A;  4E7S A;  1BU1 A;  4LE9 A;  2RJD A;  3WVD B;  3CC7 Q;  2XHC A;  1HSQ A;  1UUE A;  2LNV A;  4C0Z A;  1EFN A;  1C1A A;  2VGN A;  3G7Z A;  3BFM A;  5EC7 A;  1WHH A;  2X4W A;  3LGL A;  2CP3 A;  4BI8 B;  3CC4 T;  4L5G A;  4M78 C;  5ECA A;  2DZ9 A;  1UE9 A;  1X27 A;  2RQR A;  3RMQ A;  4QVC A;  3MEV A;  1QVF P;  1PKT A;  3E9F A;  4LUE A;  4J9I A;  3JCM J;  3M0Q A;  1VUB A;  2GTJ A;  3PNW C;  4HCZ A;  2YDL A;  2FZC B;  4IUR A;  8ATC B;  3VS0 A;  5GAN h;  4F7U A;  1T0H A;  3UPU A;  2EJF A;  2MWP A;  3G4S A;  1M1F A;  3OYG A;  3FEO A;  4M77 F;  4FSX A;  5CQY A;  3WVE B;  1GRI A;  1IRX A;  2GFA A;  5LJ5 e;  2GTO A;  3ZEH A;  1WHL A;  1RUW A;  3NPF A;  4J9B A;  4FSS A;  1S72 A;  2FEI A;  4C92 F;  3SFM A;  2E5Q A;  2E12 A;  5DLQ E;  2L3P A;  1D09 B;  2JZ2 A;  3MEW A;  5HK0 A;  2WSC E;  2EJ9 A;  3BDL A;  1M1K R;  5FU6 C;  5GAM h;  5M9O A;  1YCY A;  1KQS S;  3ASK A;  1B34 B;  3TRE A;  3CEY A;  2DEQ A;  3G1J A;  4M78 G;  2KRS A;  4MZT A;  1YJ9 Q;  1VQ4 Q;  2XK0 A;  1ZLM A;  3CD6 T;  4V2S A;  3MKD A;  5I22 A;  1NG2 A;  2GBQ A;  1RAD B;  4ELZ C;  5LJ3 j;  2KR3 A;  1NEG A;  5D6Y A;  3NTK A;  2K5F A;  1VQ4 T;  1YJ9 T;  3EGX B;  3F70 A;  5KYX B;  1IO6 A;  2KE9 A;  3GBQ A;  1XTD A;  2JXB A;  1NE8 A;  1N5Z A;  5KCH A;  1VQP Q;  4PFP A;  5LJ5 d;  3G6E T;  2OTL T;  2DX1 A;  4IUQ A;  3GIB A;  3CCL Q;  5KYU A;  1G3S A;  4M7A A;  2D0Q B;  2CS7 A;  3EG0 A;  5FLX E;  2KXC A;  2FHD A;  3H0F A;  5LJ3 f;  5LJ3 g;  5GAM j;  2EJG A;  2EYZ A;  1MMN A;  4PLL A;  4M7D B;  3A8M B;  3OYF A;  2K5L A;  5AYF A;  2QQR A;  3QZ5 B;  4C5I A;  2HBW A;  2CT3 A;  2YRC A;  5DM7 R;  2DD5 A;  4QKU A;  3RUX A;  3IQL A;  2KYB A;  3OW2 P;  2GCX A;  1WXU A;  1BKB A;  2RD1 A;  7AT1 B;  1AT1 B;  2VXF A;  4RG2 A;  2XID A;  4IUP A;  4RTW A;  4RTU A;  4AT1 B;  1QWE A;  2OX7 A;  2P0K A;  1VQ8 Q;  1W2B P;  2X4Y A;  3HHT B;  4ELY C;  1B3Q A;  1YIJ A;  1OU9 A;  1NJI C;  1W6X A;  1AWO A;  4M7A D;  1YJN Q;  1PCX A;  4D8D A;  4HT8 A;  4A4H A;  1TWB A;  2DLP A;  4PJO F;  4ATO A;  3NFC A;  1BCM A;  2FYK A;  3M0U A;  1NM7 A;  4XU0 A;  1CKB A;  1I4K 1;  3H41 A;  1VQM T;  1VQP A;  3QKJ A;  1TOV A;  3I56 T;  2QYZ A;  1RL2 A;  4EMK C;  4RCB A;  1WXT A;  2COY A;  5J3B A;  1TTH B;  4C8Q A;  3G6E Q;  4J5Y A;  3V8L A;  1NJI R;  2RJF A;  1IXD A;  4GBQ A;  1D1A A;  1QW1 A;  4C92 A;  3JCM X;  4IIO A;  5GAO p;  2L2P A;  1GFD A;  1SRM A;  1U1T A;  4JS4 A;  1HD3 A;  2DRM A;  2KAF A;  3OSV A;  1LJO A;  4M7D F;  5FRO A;  1VQ6 Q;  1OI1 A;  4RMO A;  2RK1 A;  2ROT A;  2RK2 A;  5LJ3 e;  2V8K A;  3JB9 J;  4BE2 A;  4C0D C;  1XOV A;  5J26 A;  4JJN K;  1Y57 A;  3AHU A;  4J9C A;  1JXO A;  4DA4 A;  3QYG B;  5CR2 A;  3X20 B;  3Q1J A;  4PJN A;  4J83 A;  4J7F A;  4E7H A;  1YNZ A;  2GQI A;  4RKU E;  2QQB A;  1WJR A;  1Q81 U;  2PVG B;  3OYB A;  2HQE A;  5GAN 8;  2ZPF B;  3VS3 A;  4E47 A;  5LJ5 g;  3G71 T;  4ZN1 A;  1LOJ A;  2DEU A;  2I0N A;  4IIM A;  5D6X A;  1M5Q 1;  4F7U F;  2MF2 A;  2ZZD A;  4JPB W;  3QSU A;  1RLP C;  1N8R C;  1MND A;  2ENM A;  1V76 A;  4BY6 C;  3PVQ A;  2DJQ A;  2EFI A;  3LGF A;  3RMS A;  2HDA A;  4GLM A;  4OMM A;  2MOX A;  1TXQ A;  3R6N A;  4M77 D;  1QP3 A;  1U1S A;  2JN0 A;  4FYX B;  1OZ2 A;  4PJO E;  2B8A A;  5GAN f;  2J6F A;  1GCQ C;  4A4G A;  2FPE A;  3M4Y A;  3RKY A;  1UJY A;  1ZBX A;  1TU0 B;  3M56 A;  3QWY A;  4JZ4 A;  2NWM A;  2E3I A;  1YIT A;  1N8R U;  1PD1 A;  2HSP A;  3CME A;  2A08 A;  3V8J A;  1TH7 A;  2HNI A;  1UTI A;  4IUT A;  1N8R R;  5IHI A;  4OML A;  2RH2 A;  2EYX A;  1QWF A;  2YSQ A;  2E5K A;  4E7I A;  2ATC B;  4LN2 A;  4BUG A;  4RTX A;  9ATC B;  1D1C A;  2FG0 A;  3TVT A;  4C0F A;  2V1R A;  1UGQ B;  5KYN A;  5GAM f;  2A28 A;  1UDL A;  4FU6 A;  4LUD A;  2CP2 A;  5A0D A;  4LD9 K;  2LCL A;  2DM1 A;  4A4K A;  1R0B G;  4ZTJ A;  3PMI A;  1VQO T;  2CRE A;  1OOT A;  1YI2 Q;  4F7U B;  3CMA T;  3MP6 A;  5GMK m;  2D8J A;  1RAA B;  3TU4 K;  4C92 G;  4MML A;  3I55 T;  4RTZ A;  2QAZ A;  2JMC A;  1PNJ A;  2G6F X;  2JTE A;  3LLR A;  3VS5 A;  2E4H A;  3CCS Q;  1JB0 E;  5GMK l;  4Z02 A;  2FRW A;  2O9S A;  4LDX A;  4OF1 A;  1G3T A;  4XTW A;  2X3W D;  3VS7 A;  1BCO A;  1M90 U;  2D1X A;  2GNC A;  2V8J A;  4XTX A;  1YJN T;  2WSF E;  4Y91 A;  5A0L A;  1Q82 U;  5C0M A;  2YUO A;  3EAE A;  2XIC A;  1WGS A;  5LL6 S;  2VB6 A;  2FL7 A;  3SHW A;  5FU6 B;  1Q7Y U;  5IAY A;  2JM9 A;  2W10 A;  2DPP B;  4BDZ A;  2LJ1 A;  2E41 A;  4FT2 A;  3RNJ A;  2COZ A;  1SSF A;  2JMA A;  5A2Q E;  3CCM Q;  1KHI A;  2IIM A;  3EGX A;  4M77 C;  5I11 A;  3M53 A;  4QVZ A;  3BE3 A;  5GMK i;  2X9H A;  2JT4 A;  2DE0 X;  3L2Z A;  5GAN 7;  2XG8 D;  1FXX A;  1UEC A;  4PJJ A;  4DBH A;  5HK3 A;  2OTJ A;  1XQH A;  5C6S A;  5I2S A;  4O6J A;  4M75 D;  2A3L A;  2EGA A;  4K11 A;  2HL5 C;  1SF9 A;  4M7A B;  1BI0 A;  3OYE A;  4Z88 A;  2M02 A;  2DXU A;  5FU7 B;  1G8X A;  3QPH A;  4LDU A;  2KSS A;  1K9M C;  2DFU A;  2GQV A;  1YP5 A;  1G2B A;  1M30 A;  3PMT A;  1WHK A;  2PUK B;  2J7I A;  2MWO A;  4M78 B;  3MO8 A;  5CKB A;  1G83 A;  5IHK A;  2CP5 A;  1K4U S;  2AZV A;  2DBK A;  2VKN A;  1GCP A;  3M0R A;  1PD0 A;  3MP1 A;  3L42 A;  1Q81 R;  4R0K A;  1HXD A;  3GF5 A;  4HA8 A;  1HK9 A;  2L5Q A;  2O88 A;  2IVW A;  2J6K A;  4FYY B;  2PVD B;  3CCU T;  1UEB A;  1PM3 A;  5LJ5 f;  1KQ2 A;  5GAN 5;  2RB6 A;  2OI3 A;  2NLU A;  2C0T A;  4A53 A;  4KUL A;  3OYD A;  2QG9 B;  2HEQ A;  3CCQ A;  1VQM Q;  2OAW A;  2DYI A;  3JRZ A;  4M7A E;  1K9M U;  4JS5 A;  2E70 A;  4JRQ A;  1WDX A;  2XKO C;  3KUF A;  3MPU B;  1Q81 C;  4WCI A;  3EHR A;  3V8K A;  3JCM Q;  1AVZ C;  4AG1 C;  2V26 A;  4JJD A;  2H8H A;  2HBP A;  2LC4 A;  2DBM A;  1V1C A;  3MET A;  4KGX B;  2W0Z A;  3JCM g;  4C5E A;  1A0N B;  2A36 A;  3LX7 A;  3OBW A;  2DIL A;  1NEB A;  2HMA A;  4YTL A;  3CC2 A;  5DLO A;  3EGD B;  1RAE B;  1ZUU A;  2YLC A;  3ME9 A;  5GJV B;  2QA4 Q;  1UFF A;  1Z9Z A;  4KUI A;  3GOX A;  1VQ7 A;  1RLQ C;  4WTO B;  3LYI A;  3QDF A;  2LQK A;  1EIF A;  1RAH B;  2OTJ T;  2EPD A;  3OYL A;  2KI7 A;  4A4E A;  3NTH A;  3V7S A;  2O2O A;  1GL5 A;  3PTA A;  3M0S A;  1VQL Q;  3CCM T;  3JCM b;  3M9Q A;  2MPX C;  3EG2 A;  1ACM B;  2DJZ A;  4WF2 A;  3JSC A;  4J6W A;  1KQS P;  2JOY A;  4F7U E;  3PGG A;  2CZ7 B;  1SRL A;  1JQQ A;  1JBM A;  2J6O A;  2RMO A;  3OYM A;  1WJS A;  1UHC A;  2QEX T;  2RHZ A;  3SWN C;  2L0A A;  2KQW A;  4M75 A;  2XDB A;  3CCU A;  4L6V 5;  4ANJ A;  1SKU B;  4DEY A;  2M9U A;  2BE9 B;  3CPW S;  1VQ9 A;  3RKX A;  3JCM f;  3PIP A;  1QCO A;  1Y96 A;  4KBM B;  1VQK T;  1WXB A;  1WPY A;  4FYW B;  2QGF B;  1YCS B;  3CC2 T;  2PNI A;  4HVU A;  1QLY A;  2DL7 A;  2HD0 A;  5GMK e;  1BIA A;  1LPL A;  1PSE A;  2D6F A;  2JVV A;  3RKW A;  3KXT A;  1BI1 A;  4AMC A;  1YJW Q;  1Q86 R;  3PT9 A;  5CKE A;  2M51 A;  2WSE E;  3REB B;  2YUP A;  1IHV A;  2EQI A;  3JAM E;  3KBG A;  1T0J A;  1K73 C;  4OMP A;  3HRU A;  4OMO A;  1QMC A;  3DB3 A;  2DL5 A;  4KH0 B;  3CMA A;  3G4S T;  2KRM A;  1YJW T;  1HYO A;  4HT9 A;  3CCJ T;  3VYH B;  3CCE Q;  4J9F A;  1WX6 A;  4CI0 C;  3OS1 A;  4M7D G;  1FMW A;  5HY6 A;  3TSZ A;  5GAO n;  2EQJ A;  1S1N A;  1YN8 A;  1R0C B;  2HQH A;  3VS4 A;  2E6Z A;  3EFO A;  4X9C A;  5LJ3 h;  1D3B A;  4EDU A;  2QEX A;  4J9D A;  2EBP A;  1VQ8 T;  1CKA A;  5GAM g;  1K73 R;  3KFV A;  1T3S A;  3PVL A;  2J06 A;  1ZA2 B;  2LX9 A;  1WA7 A;  1YFN A;  1VQ5 T;  1DJ7 B;  2YHT A;  4M77 G;  2HZY A;  4C92 D;  3CCM A;  5KYU B;  1KD1 U;  3OYI A;  1NLO C;  2P4R A;  2HKN A;  5FWC A;  1X2K A;  4CC3 A;  2M1H A;  4QQ6 A;  2EWN A;  2K7A A;  1SG5 A;  3UF4 A;  1CSK A;  1Q7Y C;  4FW1 A;  1ZUK A;  4C0G A;  4MDX A;  2K5I A;  2IG0 A;  4M78 D;  4PFO A;  5GAN g;  3GP8 A;  2GF7 A;  3EFS A;  1NPR A;  1NLP C;  2FPF A;  2JNG A;  1Q82 C;  1BIB A;  2JM8 A;  5D6W A;  2F1L A;  2K79 A;  2B86 A;  3OYN A;  1M90 C;  1VQN T;  4JRK A;  2QTX A;  3LWI A;  3GPL A;  4AFQ C;  1K0S A;  2LJ0 A;  1RI0 A;  1YI2 A;  3G4S Q;  4XU1 A;  3V7C A;  3LWH A;  2QGG A;  2DZC A;  1M1G A;  3S6W A;  1N27 A;  3EG9 A;  3OS5 A;  1NBE B;  2DTO A;  3EGU A;  1K9A A;  1X6B A;  1O9S A;  3BW1 A;  2L3S A;  4XQ3 A;  2ZGW A;  3P8H A;  3HFN A;  2KT1 A;  3L2U A;  4M78 A;  5KYY A;  5GMK j;  4XU3 A;  1JU5 C;  2CUD A;  1V29 B;  4MMK A;  5FW9 A;  1B07 A;  2K6D A;  1FMK A;  1VQ5 A;  1M27 C;  1X75 C;  2CH4 A;  3VS1 A;  3WXM B;  2XU8 A;  3OB9 A;  1ZUY A;  4C8Q E;  4PJO A;  1AZG B;  3GNF B;  3VYG A;  1I5O B;  2SEM A;  2F2W A;  3CQT A;  1VQ9 Q;  4ZN3 A;  1ZQ1 A;  3OYY A;  4RUG A;  3CCS T;  3CBM A;  3JV3 A;  1O75 A;  1I81 A;  2BKD N;  4HXJ A;  1TUC A;  3CC2 Q;  2ROL A;  4M78 F;  4N4I A;  2KGT A;  3CCU Q;  2JTM A;  3OMC A;  3M57 A;  3AT1 B;  2RI3 A;  4QQG A;  2DER A;  2AT1 B;  3M5A A;  4N0A C;  2HL3 A;  2KRN A;  3C4S A;  4BI4 A;  4M77 E;  3OA6 A;  3OQ5 A;  2ZPH B;  3JB9 H;  4TVR A;  1QVG A;  1Y71 A;  3TSW A;  1TSF A;  3CPW P;  1G5V A;  3OYK A;  1H64 1;  4M75 B;  4BI3 A;  4M77 A;  1WQ7 A;  3MP8 A;  4XK8 E;  1KIK A;  2X51 A;  2KEA A;  2BTT A;  1JXM A;  1LCK A;  1WIE A;  1G3Y A;  1GBR A;  4JRI A;  1D0Z A;  3L2V A;  1JJ2 A;  2JTF A;  3OYH A;  2RO0 A;  2AZS A;  1IHW A;  3JB9 I;  3OMG A;  4J9H A;  1JJ2 S;  1UHF A;  2OJ2 A;  2JW4 A;  4GY5 A;  5AT1 B;  2BZX A;  2MYS A;  1KJW A;  2RNA A;  3R6O A;  3QII A;  2F2X A;  3FJ5 A;  3CCR Q;  4M7D D;  1E7O A;  4CC2 A;  4C8Q G;  4D6W A;  3QHS A;  2E64 A;  1NZ9 A;  5GAM d;  3UA6 A;  1VQ5 Q;  4C92 E;  5GAN e;  4E2F B;  4RCC A;  5GAN 6;  4OB0 B;  1YBY A;  5LJ5 j;  2DK3 A;  2DVJ A;  1OYX A;  1WYX A;  2EQU A;  2P4T A;  3X25 B;  1I5L A;  1VQO Q;  4DOV A;  2ECZ A;  3JCM h;  3UT1 A;  5LJ3 d;  3LH5 A;  4XTV A;  3EFO B;  2QDL A;  2RN8 A;  4CRI A;  4C92 C;  3E9G A;  1BBZ A;  3C0C A;  5GAM e;  1M8V A;  1K8A U;  4BY6 B;  2RHU A;  2X35 A;  2DD4 A;  2FPD A;  2Y4Y A;  4IUV A;  4Y28 E;  1T3L A;  4E6R A;  3I56 Q;  3THK A;  3CBP A;  3P8D A;  5CVI A;  2LNH B;  1U3O A;  1AHJ B;  2H3J A;  1Y96 B;  2XDD A;  5DY9 A;  1SHG A;  4OP0 A;  3CCE A;  2BUD A;  3H8Z A;  2BZY A;  2F2V A;  1NJI U;  1GXI E;  2QEX Q;  2NUZ A;  5EG2 A;  2K9G A;  1FWZ A;  4P5N A;  3M55 A;  3CCV A;  1W1F A;  1VQ8 A;  3ULR B;  3CCQ Q;  3A8L B;  8AT1 B;  1ZA1 B;  2LVM A;  3M0T A;  1N6A A;  4KH1 B;  4AFU C;  4D8K A;  2RHY A;  1BI2 A;  2LJ3 A;  1KQS A;  1ZSZ A;  3MCA B;  2KVQ G;  5A0G A;  1VQL T;  3UDC A;  2DMO A;  3HPW A;  2LP5 A;  1W4S A;  1Q95 G;  3EH2 A;  1X01 A;  4BB7 A;  4PKC C;  2FVU A;  3EG9 B;  2LT1 A;  1KD1 R;  3M0P A;  4O5V A;  1MMA A;  1ZHI A;  3BY7 A;  4Y92 A;  2AKL A;  4PLI A;  2MCN A;  2DL8 A;  2CH4 W;  4F17 A;  4EMK B;  2EW3 A;  1N9R A;  5LJ5 h;  3M54 A;  3S3N A;  1G3W A;  1OX8 A;  3NHN A;  2KDS A;  5KYW A;  4J9E A;  2HSE B;  2LRQ A;  2K3Y A;  2VUB A;  1VOM A;  5CCA A;  1FYN A;  1SEM A;  3CC7 T;  1VQ6 A;  4E7K A;  2DET A;  1VQP T;  1X2Q A;  4PJM A;  1YHQ A;  2YXY A;  4X9D A;  5HCK A;  1E6G A;  1M3C A;  2D9T A;  1TUD A;  3CMA Q;  3M59 A;  5IHN A;  1QQJ A;  2V8I A;  1W70 A;  4DBR A;  1S72 T;  2FZG B;  3V7R A;  4GLK A;  3L2W A;  3RBB B;  2RQT A;  3H0H A;  1RAC B;  2XI9 A;  2OTL Q;  1ARK A;  3CD6 Q;  2X4X A;  2FO0 A;  1VQK A;  4XTU A;  1M4Z A;  1BK2 A;  3SWN B;  2YUN A;  2Y90 A;  2KY9 A;  2RI2 A;  1GFC A;  1UGR B;  4RTT A;  3VUZ A;  5CK9 A;  3CCJ Q;  3E1S A;  5GMK h;  1GCQ A;  2EYY A;  3URG A;  4IUU A;  3MEA A;  3CCR A;  3P8B B;  2CP6 A;  4M75 F;  4RTV A;  2DXC A;  3M58 A;  3JB9 F;  1QVP A;  5GAN 4;  4C8Q D;  4C5H A;  3REA B;  2LQN A;  1I07 A;  3ZFJ A;  1YIT Q;  5KYY B;  3CCJ A;  2O4X A;  3VUB A;  3HRT A;  4JUV A;  4OB2 B;  2BE7 D;  4M7D C;  2IPO B;  2E1H A;  2XDP A;  4HCB A;  4Q5W A;  1OPK A;  2BZ8 A;  2L89 A;  3EHQ A;  1WHM A;  5KH6 A;  2Z0W A;  1ZX6 A;  1YHQ T;  4ME7 A;  1R8O B;  1RI9 A;  2DRK A;  5GAO m;  4DEX A;  2EAY A;  3FC3 A;  1U8R A;  3CC4 Q;  4EPC A;  4Z8A A;  1I1J A;  2PZ1 A;  1MGQ A;  2GFU A;  1BI3 A;  5FU7 C;  5GAO l;  2DO3 A;  5IXB A;  5GAN 2;  1OEB A;  3CCQ T;  4A4F A;  5KE2 A;  4JDS A;  4OGE A;  2R5M A;  2H3E B;  2VWF A;  1M1K C;  3FB9 A;  3CXC S;  2C0O A;  4LXC A;  1E6H A;  1TS9 A;  4M77 B;  1KC8 R;  3CXC A;  3S3O A;  3VKI A;  4ORZ A;  1K9M R;  3QG1 A;  4N4G A;  2GGR A;  2DYB A;  3CBO A;  2DXB A;  2OTJ Q;  1MUZ A;  3QYH B;  4AFZ C;  3VS2 A;  3HRS A;  3A8H B;  1QKW A;  2FB7 A;  1MHN A;  4HCC A;  4L59 A;  2QA4 T;  2EGE A;  4II1 A;  1OUL A;  2BIV A;  4OMN A;  1PKS A;  3E2U A;  3JCM P;  5CKF A;  1VQ7 T;  1H3H A;  4M75 C;  4VUB A;  4MZP A;  4PNO A;  4RTY A;  5I21 A;  4EIK A;  5GAN j;  4AFS C;  4JZ3 A;  1WJQ A;  1KC8 C;  1MV0 B;  1OU8 A;  2C06 A;  4JJC A;  1UGS B;  3EH1 A;  1FMV A;  3EG1 A;  3X28 B;  2Y4X A;  2DAQ A;  3CCE T;  3X24 B;  1OZ3 A;  5GAN 3;  1AWJ A;  4ZNX A;  2RHI A;  1QVG P;  1IB8 A;  3C95 A;  2COW A;  3C94 A;  4OMF B;  3I55 Q;  1KQ1 A;  2PUO B;  2AIR B;  1D1B A;  1Y07 A;  4PL6 A;  4HKE A;  4M7A C;  2KNB B;  4LDY A;  2P0P A;  2RJE A;  4X34 A;  2DTI A;  3I5R A;  2HKQ B;  2CSQ A;  1B7T A;  4OMQ A;  4J8O A;  2VXE A;  1AD5 A;  3SB2 A;  3JCM W;  2MI6 A;  4ZGJ B;  4Z89 A;  2I2L A;  4HVW A;  2EIF A;  1NYF A;  3VU3 C;  1K76 A;  4N4H A;  2QAS A;  2R57 A;  2AK5 A;  1WHG A;  1UG1 A;  1WHJ A;  1QCN A;  4OB3 B;  1H92 A;  1D3B B;  3CD6 A;  1U06 A;  3TEE A;  1LNX A;  1M3A A;  1AZE A;  3LW5 E;  3NMZ C;  5GAO r;  1WNL A;  2DF6 A;  1GBQ A;  2LCS A;  2KK4 A;  3QO3 A;  2OTL A;  2KYM A;  3MHX A;  4JLG A;  5CAI A;  2E6N A;  3FJP A;  6AT1 B;  2HCK A;  2CZ6 B;  2NUP A;  3G6E A;  1YJW A;  1TUG B;  3VRY A;  2K4Y A;  2YLB A;  2EKH A;  2NUT A;  1JJ2 P;  1Y7X A;  2CUB A;  2LDM A;  1NPP A;  4JJB A;  1B34 A;  4M75 G;  3FDR A;  1AOJ A;  3RDV A;  3SWN A;  1YHQ Q;  1PC0 A;  1YIT T;  3OW2 S;  2YWW A;  2VV5 A;  5HKC A;  4FCY A;  4FL6 A;  2QDY B;  1UB4 A;  2YT6 A;  2MK5 A;  1S72 Q;  2QQS A;  3N5B B;  4B6M A;  3SEM A;  1YWP A;  1VQ7 Q;  1I0C A;  1RAB B;  5IT9 E;  4EMK A;  3X26 B;  1PHT A;  1ABQ A;  5KYX A;  2M0O A;  2CYZ B;  1QKX A;  1ZSG A;  2O4X B;  4QT7 A;  1BB9 A;  2A0F B;  4M7A G;  5D7U A;  5KCO A;  2AHJ B;  4X1V A;  4CC4 B;  1JEG A;  3QWX X;  3JCM e;  2LQ8 A;  3ZL7 C;  4R56 A;  3JB9 D;  4C8Q F;  5IN1 A;  2PQW A;  3S3M A;  2X4J A;  3BDU A;  4M7D A;  2LX7 A;  1KHC A;  1Q86 C;  3MJX A;  5CQX A;  2FZK B;  2MIO A;  2DIG A;  4FW2 A;  3ZBD A;  2M0Y A;  3OS0 A;  2DKG A;  3NTI A;  2F5K A;  1K0X A;  3CCR T;  3I5S A;  5IH2 A;  2QXF A;  1IGU A;  1P92 A;  2DTH A;  4KT0 E;  3RES A;  4UC4 A;  4XU2 A;  5CKH A;  4PJL A;  3CCV T;  2KBT A;  2RHX A;  2XMF A;  1IRE B;  4PJO G;  2CZ1 B;  4BE0 A;  2XD0 A;  3T9N A;  2EKO A;  3H0I A;  4FIB A;  3G71 Q;  3A1P A;  4FT4 A;  3FRN A;  1RAI B;  4DQ2 A;  1QVF A;  2K2M A;  3H6Z A;  1Q86 U;  4E7Z A;  2LZ6 B;  2KMT A;  1SPK A;  1QVF S;  1AWX A;  1UGP B;  1VIF A;  1VIE A;  4LDW A;  3J81 E;  1X6G A;  1C6V X;  4DOW A;  1EZZ B;  1IGQ A;  3DKM A;  1UJ0 A;  2ZAE A;  5GJW B;  2A37 A;  2CT4 A;  1AWW A;  1M2V B;  3E19 A;  1Y0M A;  3QXE B;  3J7A F;  1VQ4 A;  1YJ9 A;  3HKS A;  3SDZ A;  2C0I A;  1VYV A;  1Q7Y R;  2D8H A;  2JS0 A;  2JJ9 A;  4QQD A;  3OSS C;  5J39 A;  2L8D A;  3DLL A;  2O31 A;  1RAG B;  2AKK A;  2ESW A;  2ZPB B;  4QW2 A;  3CCV Q;  1J3T A;  3CPF A;  4LNP A;  4EMH A;  1N9S A;  2L3R A;  1Q82 R;  4XTZ A;  1BYM A;  2RM4 A;  2E10 A;  3QJY A;  1PWT A;  1QP2 A;  1W2B S;  1M90 R;  2JUF A;  4DBQ A;  4M7D E;  3CCL T;  4PJO B;  3DLM A;  1UGV A;  3FIF A;  2VC8 A;  1M9S A;  1PSF A;  2ZPI B;  4KRT A;  1MMG A;  2O01 E;  2K3B A;  4KGV B;  3UWN A;  3VJP A;  1I8F A;  1KG1 A;  1NYG A;  4NL3 A;  1TG0 A;  2K3X A;  4MDW A;  1R77 A;  2DNU A;  1WLP B;  3EFR A;  3JCM d;  1U5S A;  1VQ6 T;  2RQW A;  4PJO C;  2P0Q A;  1WFW A;  2VYT A;  2SRC A;  2EYW A;  2JS2 A;  3O5Z A;  3GNG A;  2ZCF B;  3I35 A;  4JRP A;  3CC7 A;  2O9V A;  4A63 B;  2MAM A;  3PIO A;  1WZO A;  2R5A A;  1ABO A;  2QI2 A;  1D0X A;  2DIQ A;  4BAC A;  3QUI A;  3HTR A;  3A8O B;  3OBY A;  2NUP B;  2LMJ A;  4QVD A;  5FWB A;  3I55 A;  2NUT B;  2CP0 A;  3CC4 A;  3L1A A;  3DB4 A;  4ZGD B;  3U23 A;  3CPW A;  3VS6 A;  2M16 A;  1VQM A;  2LTO A;  1C0M A;  2CDT A;  1PRM C;  1MNE A;  3GLX A;  3L2Q A;  4IKF A;  1M8M A;  2DL4 A;  5I2M A;  3CXC P;  4EMG A;  4E7L A;  5CO7 A;  2FRY A;  2OAU A;  3CCL A;  1KC8 U;  2RQV A;  2ABL A;  2QK0 A;  2HQX A;  1M3B A;  2PVO B;  3I9Q A;  5FRN A;  1H3Z A;  1PRL C;  2F5T X;  3JB9 G;  4XAX B;  2EYQ A;  3PE0 A;  1X6O A;  4MZM A;  3PFS A;  2P84 A;  3H9N A;  4J6Y A;  1XJW B;  1OPL A;  2V1Q A;  3J80 E;  2QTV A;  1PG5 B;  1VYT A;  1QCF A;  4M75 E;  3CME Q;  1FX7 A;  3UA7 A;  1LVK A;  1MMD A;  3QJ6 A;  3C12 A;  4BE1 A;  1AEY A;  1VQ9 T;  1RAF B;  4B9X A;  3OYJ A;  2D0N A;  4R55 A;  2CP7 A;  2NYS A;  5L23 A;  1Z9Q A;  3A5Z B;  5GAN d;  2PTK A;  3HSB A;  1HJD A;  1F1B B;  2EQM A;  2L3Q A;  1VQL A;  1K8A R;  4M4Z A;  4PFZ A;  1VQK Q;  4LD6 A;  4HCK A;  1IZ6 A;  1XNI A;  1VQN Q;  3CCS A;  3SD4 A;  4C0D B;  1YWO A;  2X3X D;  2ED1 A;  2RJC A;  4F14 A;  1K1Z A; 
#chains in the Genus database with same CATH homology
 4B9W A;  2ZPG B;  1BIB A;  4ZTF A;  5D6X A;  3JCM P;  5D6W A;  1M5Q 1;  4F7U F;  2MF2 A;  5CKF A;  2ZZD A;  1M90 C;  1VQN T;  3OYN A;  1VQ7 T;  4JRK A;  3QSU A;  2QTX A;  5CIU A;  4C5G A;  4M75 C;  4VUB A;  4MZP A;  3LWI A;  2VGM A;  3GPL A;  1N8R C;  2HAX A;  4BY6 C;  4PNO A;  5I21 A;  3HL8 A;  2EFI A;  3LGF A;  5GAN j;  1RI0 A;  1YI2 A;  3RMS A;  4XU1 A;  1WJQ A;  3V7C A;  4J6X A;  3LWH A;  1KC8 C;  2DZC A;  3CME T;  2C06 A;  4FM4 B;  1UGS B;  3OW2 A;  4M77 D;  1M1G A;  3S6W A;  1N27 A;  1QP3 A;  1U1S A;  2JN0 A;  4KUD K;  3X28 B;  2Y4X A;  3VV0 A;  3OS5 A;  1OZ2 A;  2DAQ A;  3CCE T;  3X24 B;  4PJO E;  2DTO A;  2B8A A;  3A8G B;  5CKD A;  1K8A C;  1OZ3 A;  5GAN 3;  4OB1 B;  1O9S A;  2RHI A;  3BW1 A;  3QZ9 B;  3C95 A;  5GAN f;  3C94 A;  4OMF B;  4A4G A;  3OS2 A;  4XQ3 A;  2ZGW A;  4LDV A;  2MMP A;  1KQ1 A;  3M4Y A;  3RKY A;  1ZBX A;  3P8H A;  2PUO B;  3HFN A;  3M56 A;  1YIT A;  1N8R U;  3L2U A;  4M78 A;  3FLG A;  1Y07 A;  3CME A;  3V8J A;  4PL6 A;  4HKE A;  5GMK j;  1W2B A;  4M7A C;  1TH7 A;  4LDY A;  4XU3 A;  2ZPE B;  2HNI A;  2P0P A;  2RJE A;  4X34 A;  4N0A A;  4NS5 A;  2DTI A;  4IUT A;  1V29 B;  4MMK A;  2DVE A;  3MEU A;  2RI5 A;  2RH2 A;  1VQ5 A;  1X75 C;  3JCM V;  3WXM B;  4E7I A;  2QQ9 A;  4J8O A;  2VXE A;  2XU8 A;  3SB2 A;  3OB9 A;  2MI6 A;  2K57 A;  4BUG A;  3JCM W;  1VQO A;  4C8Q E;  2EQK A;  2LCC A;  4JLI A;  3RIR A;  4NL2 A;  4C0F A;  1UGQ B;  4ZGJ B;  3GNF B;  3OYA A;  4PJO A;  5L8R E;  5GAM f;  3VYG A;  4C8Q B;  2I2L A;  4FU6 A;  5GAO q;  4F7U G;  2EIF A;  4ZN3 A;  1ZQ1 A;  3OYY A;  3VU3 C;  5A0D A;  4LD9 K;  3CCS T;  3CBM A;  4N4H A;  2LCL A;  1O75 A;  1I81 A;  2BKD N;  2R57 A;  3O8V A;  4A4K A;  4ZTJ A;  3PMI A;  1VQO T;  2WAC A;  4OB3 B;  4F7U B;  3CMA T;  1D3B B;  4M78 F;  4N4I A;  3MP6 A;  3CD6 A;  2JTM A;  3OMC A;  3M57 A;  3TEE A;  5KE3 A;  4RG8 A;  1LNX A;  4C92 G;  1WQW A;  4MML A;  5GMK m;  3TU4 K;  2RI3 A;  3LW5 E;  3I55 T;  1YIJ T;  2CZ0 B;  4QQG A;  3QDR B;  1WNL A;  3LLR A;  2QQA A;  5GAO r;  3M5A A;  4N0A C;  4M7A F;  1VQN A;  2F69 A;  1JB0 E;  5GMK l;  4Z02 A;  2CKK A;  2KK4 A;  3QO3 A;  2OTL A;  4LDX A;  3C4S A;  4OF1 A;  1G3T A;  1QVG S;  4PJO D;  4XTW A;  3HP9 A;  4BI4 A;  4M77 E;  3MHX A;  4JLG A;  3L2R A;  3OA6 A;  3OQ5 A;  2ZPH B;  5CAI A;  2DXT A;  4TVR A;  2E6N A;  5FRM A;  3JB9 H;  1QVG A;  1JRI A;  3FJP A;  1Y71 A;  2PU9 B;  1M90 U;  3LH0 A;  2CZ6 B;  3G6E A;  1YJW A;  2V8J A;  4XTX A;  2R58 A;  1YJN T;  2RA2 A;  2K4Y A;  1G5V A;  2WSF E;  2YLB A;  3OYK A;  4Y91 A;  1H64 1;  4M75 B;  5A0L A;  4BI3 A;  1Q82 U;  4M77 A;  1WQ7 A;  3MP8 A;  2CGH A;  1Y7X A;  4XK8 E;  2LDM A;  5C0M A;  4BDY A;  1NPP A;  3EAE A;  1B34 A;  4M75 G;  4BD3 A;  2XIC A;  3FDR A;  3SWN A;  3HFO A;  1WGS A;  5LL6 S;  3I56 A;  2FL7 A;  1G3Y A;  2LT4 A;  2G3R A;  1YIT T;  3OW2 S;  4JRI A;  3JCM c;  5FU6 B;  1Q7Y U;  4OGC A;  5IAY A;  4XTY A;  3L2V A;  2DPP B;  4BDZ A;  1JJ2 A;  2JTF A;  2VV5 A;  2RO0 A;  3OYH A;  4J7I A;  5HKC A;  4FL6 A;  2QDY B;  4NOY A;  1YJN A;  3QBY A;  1UB4 A;  3JB9 I;  2E41 A;  3OMG A;  4FT2 A;  4OVA A;  1JJ2 S;  3OY9 A;  2K2V A;  2QQS A;  3N5B B;  3TCJ A;  1K73 U;  1SSF A;  4GY5 A;  5A2Q E;  4C8Q C;  1M1K U;  1KHI A;  2E65 A;  3ER0 A;  3R6O A;  4EMK A;  5IT9 E;  3X26 B;  4M77 C;  3QII A;  3M53 A;  4QVZ A;  4M7D D;  2M0O A;  2CYZ B;  1YI2 T;  4ZGE B;  4C8Q G;  5GMK i;  4D6W A;  3QHS A;  2E64 A;  1NZ9 A;  3L2Z A;  5GAM d;  5GAN 7;  2O4X B;  2XG8 D;  1FXX A;  4E7J A;  3RER A;  4M78 E;  5HK3 A;  4M7A G;  3G71 A;  3INZ A;  2OTJ A;  1XQH A;  4C92 E;  5C6S A;  5GAN e;  5I2S A;  5KCO A;  2QA4 A;  4A54 A;  4O6J A;  3M4G A;  4M75 D;  2A3L A;  4RCC A;  3OYC A;  5GAN 6;  4OB0 B;  1YBY A;  2AHJ B;  4C92 B;  4M7A B;  1BI0 A;  5LJ5 j;  3OYE A;  2DXU A;  2A7Y A;  2DK3 A;  5FU7 B;  2LQ8 A;  1OYX A;  3QPH A;  2KSS A;  4LDU A;  3JCM e;  4R56 A;  3JB9 D;  2EQU A;  2P4T A;  1K9M C;  2GQV A;  2YRV A;  4C8Q F;  5IN1 A;  2PQW A;  3PMT A;  2RJD A;  3S3M A;  2X4J A;  3X25 B;  3WVD B;  3BDU A;  1I5L A;  4M7D A;  4DOV A;  2XHC A;  1KHC A;  2PUK B;  2LNV A;  2MWO A;  3JCM h;  4M78 B;  1Q86 C;  3MO8 A;  5CKB A;  3UT1 A;  5CQX A;  5LJ3 d;  4C0Z A;  4XTV A;  2DIG A;  3ZBD A;  2VGN A;  3G7Z A;  3OS0 A;  3BFM A;  2DKG A;  2X4W A;  3LGL A;  3NTI A;  4CRI A;  2F5K A;  4BI8 B;  4C92 C;  3E9G A;  3CC4 T;  3MP1 A;  5GAM e;  1M8V A;  4L5G A;  4M78 C;  3CCR T;  2DZ9 A;  3L42 A;  1K8A U;  2QXF A;  3RMQ A;  4BY6 B;  1P92 A;  2RHU A;  3MEV A;  4QVC A;  2X35 A;  2DTH A;  2DD4 A;  4KT0 E;  1HXD A;  3GF5 A;  4HA8 A;  4UC4 A;  1HK9 A;  2Y4Y A;  2L5Q A;  3E9F A;  4IUV A;  3RES A;  4XU2 A;  4Y28 E;  5CKH A;  2IVW A;  3CCV T;  2PVD B;  2RHX A;  3CCU T;  3JCM J;  1IRE B;  1UEB A;  5LJ5 f;  3CBP A;  4PJO G;  1VUB A;  1KQ2 A;  3P8D A;  5CVI A;  5GAN 5;  2CZ1 B;  4BE0 A;  2XD0 A;  3PNW C;  4HCZ A;  1AHJ B;  4IUR A;  3T9N A;  2H3J A;  2RB6 A;  2EKO A;  1Y96 B;  2NLU A;  4FIB A;  4OP0 A;  4FT4 A;  5DY9 A;  2BUD A;  3FRN A;  3H8Z A;  4F7U A;  2XDD A;  3CCE A;  4A53 A;  4DQ2 A;  3UPU A;  2EJF A;  2MWP A;  4KUL A;  1QVF A;  1Q86 U;  3H6Z A;  1NJI U;  1GXI E;  3G4S A;  1M1F A;  3OYD A;  3FEO A;  3OYG A;  4M77 F;  2KMT A;  4FSX A;  5CQY A;  5EG2 A;  3CCQ A;  1QVF S;  3WVE B;  1FWZ A;  1UGP B;  1VIF A;  2GFA A;  4P5N A;  5LJ5 e;  3M55 A;  1VIE A;  4LDW A;  3J81 E;  3CCV A;  3ZEH A;  1VQ8 A;  3JRZ A;  4M7A E;  1K9M U;  4JS5 A;  2E70 A;  3A8L B;  4JRQ A;  1S72 A;  4C92 F;  4DOW A;  3SFM A;  2LVM A;  1N6A A;  2E5Q A;  2XKO C;  3KUF A;  1Q81 C;  2E12 A;  3DKM A;  2RHY A;  5DLQ E;  3MEW A;  1BI2 A;  2JZ2 A;  5HK0 A;  2WSC E;  2EJ9 A;  3V8K A;  3BDL A;  3JCM Q;  1KQS A;  5FU6 C;  5GAM h;  3MCA B;  2KVQ G;  5A0G A;  5M9O A;  1VQL T;  3UDC A;  3HPW A;  1YCY A;  2HBP A;  2LC4 A;  3ASK A;  1B34 B;  1W4S A;  3E19 A;  3QXE B;  1KQS S;  3J7A F;  1VQ4 A;  1YJ9 A;  3HKS A;  3TRE A;  3CEY A;  2DEQ A;  3MET A;  1X01 A;  3SDZ A;  3JCM g;  4C5E A;  4M78 G;  3LX7 A;  4BB7 A;  3OBW A;  4MZT A;  4PKC C;  5GAN h;  4QQD A;  2XK0 A;  3OSS C;  5J39 A;  2L8D A;  4YTL A;  2FVU A;  3DLL A;  3CC2 A;  5DLO A;  3CD6 T;  4V2S A;  2LT1 A;  3ME9 A;  2YLC A;  4O5V A;  4ELZ C;  1ZHI A;  2ZPB B;  3BY7 A;  4KUI A;  5LJ3 j;  4QW2 A;  4PLI A;  3GOX A;  1VQ7 A;  3CPF A;  4EMH A;  1N9S A;  2L3R A;  5D6Y A;  3NTK A;  4XTZ A;  2K5F A;  1BYM A;  1VQ4 T;  1YJ9 T;  4EMK B;  3LYI A;  2RM4 A;  2LQK A;  1EIF A;  2E10 A;  3F70 A;  3QJY A;  1QP2 A;  1N9R A;  5LJ5 h;  1W2B S;  2D6F A;  2JUF A;  2OTJ T;  3M54 A;  3OYL A;  3S3N A;  4M7D E;  1G3W A;  1XTD A;  4A4E A;  3CCL T;  4PJO B;  1NE8 A;  2KDS A;  3DLM A;  5KCH A;  5LJ5 d;  3NTH A;  3G6E T;  3FIF A;  2VC8 A;  2OTL T;  1M9S A;  3V7S A;  1PSF A;  2LRQ A;  2ZPI B;  2K3Y A;  2VUB A;  4IUQ A;  3GIB A;  3PTA A;  1G3S A;  5CCA A;  2D0Q B;  2CS7 A;  4M7A A;  5FLX E;  2O01 E;  3UWN A;  2FHD A;  3VJP A;  3CC7 T;  5LJ3 g;  5LJ3 f;  1VQ6 A;  5GAM j;  3CCM T;  4E7K A;  1VQP T;  3JCM b;  1I8F A;  2EJG A;  3M9Q A;  1KG1 A;  4NL3 A;  2DJZ A;  1YHQ A;  2K3X A;  4MDW A;  4WF2 A;  4PLL A;  4M7D B;  3JSC A;  4X9D A;  4J6W A;  3EFR A;  3JCM d;  2JOY A;  4F7U E;  3A8M B;  3OYF A;  1VQ6 T;  2K5L A;  3PGG A;  4PJO C;  5AYF A;  2P0Q A;  2CZ7 B;  2VYT A;  2D9T A;  2QQR A;  3QZ5 B;  4C5I A;  5DM7 R;  2DD5 A;  3M59 A;  1JBM A;  3RUX A;  3GNG A;  2V8I A;  2GCX A;  2ZCF B;  3OYM A;  1WJS A;  3CC7 A;  4JRP A;  1S72 T;  2MAM A;  2QEX T;  3V7R A;  4GLK A;  3L2W A;  1BKB A;  2RHZ A;  3PIO A;  3SWN C;  2R5A A;  2RD1 A;  2KQW A;  4M75 A;  2QI2 A;  2VXF A;  2XI9 A;  4RG2 A;  2XDB A;  3CCU A;  2DIQ A;  2XID A;  4L6V 5;  4IUP A;  4BAC A;  2X4X A;  3QUI A;  1VQK A;  4XTU A;  1M4Z A;  2M9U A;  3SWN B;  2P0K A;  3A8O B;  3CPW S;  2Y90 A;  2KY9 A;  2RI2 A;  1UGR B;  2X4Y A;  3HHT B;  3OBY A;  3VUZ A;  4ELY C;  4QVD A;  5CK9 A;  1VQ9 A;  3E1S A;  3RKX A;  3JCM f;  5GMK h;  3PIP A;  3I55 A;  1YIJ A;  1Y96 A;  4KBM B;  3CC4 A;  1VQK T;  3URG A;  3L1A A;  1NJI C;  1WPY A;  4IUU A;  3DB4 A;  3MEA A;  3CCR A;  4M7A D;  3P8B B;  3CC2 T;  4M75 F;  4ZGD B;  3CPW A;  4A4H A;  4HT8 A;  2M16 A;  2HD0 A;  1VQM A;  4PJO F;  5GMK e;  2DXC A;  2LTO A;  1BIA A;  3M58 A;  3JB9 F;  1QVP A;  1PSE A;  5GAN 4;  2JVV A;  3RKW A;  3KXT A;  1BI1 A;  3NFC A;  4C8Q D;  4C5H A;  3GLX A;  3L2Q A;  4ATO A;  4IKF A;  3PT9 A;  5CKE A;  2WSE E;  5I2M A;  3ZFJ A;  2FYK A;  3JAM E;  3KBG A;  3CCJ A;  2O4X A;  4EMG A;  4XU0 A;  4E7L A;  1K73 C;  5CO7 A;  1I4K 1;  2OAU A;  3VUB A;  3CCL A;  1KC8 U;  3HRU A;  3HRT A;  4JUV A;  3DB3 A;  4OB2 B;  3CMA A;  3G4S T;  4M7D C;  1YJW T;  2HQX A;  2PVO B;  5FRN A;  1VQM T;  1H3Z A;  2F5T X;  3JB9 G;  1VQP A;  2E1H A;  2XDP A;  3QKJ A;  4XAX B;  3VYH B;  3CCJ T;  4HT9 A;  3I56 T;  4CI0 C;  4HCB A;  2EYQ A;  3OS1 A;  4M7D G;  4Q5W A;  1RL2 A;  1X6O A;  4MZM A;  5HY6 A;  3PFS A;  4EMK C;  4RCB A;  2L89 A;  5J3B A;  5GAO n;  4C8Q A;  4J6Y A;  5KH6 A;  4J5Y A;  3V8L A;  2EQJ A;  2RJF A;  1YHQ T;  3J80 E;  4ME7 A;  1QW1 A;  4C92 A;  3JCM X;  1R8O B;  2E6Z A;  5GAO p;  5GAO m;  4X9C A;  5LJ3 h;  1D3B A;  4EDU A;  2EAY A;  2QEX A;  3FC3 A;  1U1T A;  4JS4 A;  1U8R A;  4M75 E;  4EPC A;  2KAF A;  3OSV A;  1LJO A;  4M7D F;  1FX7 A;  1MGQ A;  2GFU A;  5FRO A;  1BI3 A;  1OI1 A;  5FU7 C;  5GAO l;  1VQ8 T;  2DO3 A;  4RMO A;  2RK1 A;  2RK2 A;  5GAN 2;  5LJ3 e;  2V8K A;  5GAM g;  3QJ6 A;  3JB9 J;  3C12 A;  3CCQ T;  4BE1 A;  4BE2 A;  4C0D C;  4A4F A;  5KE2 A;  2LX9 A;  1VQ9 T;  1XOV A;  5J26 A;  4JJN K;  1VQ5 T;  1DJ7 B;  4JDS A;  4B9X A;  4OGE A;  2YHT A;  4R55 A;  4M77 G;  3OYJ A;  3AHU A;  2R5M A;  4C92 D;  3CCM A;  1M1K C;  1KD1 U;  3FB9 A;  3OYI A;  3CXC S;  4DA4 A;  3QYG B;  5CR2 A;  3X20 B;  3A5Z B;  5GAN d;  4M77 B;  3Q1J A;  3CXC A;  2M1H A;  4QQ6 A;  4J83 A;  3VKI A;  2EWN A;  3S3O A;  4J7F A;  3HSB A;  3QG1 A;  4N4G A;  4E7H A;  4RKU E;  2QQB A;  3CBO A;  1WJR A;  2DXB A;  2EQM A;  1Q7Y C;  4C0G A;  1Q81 U;  1VQL A;  2PVG B;  4MDX A;  3QYH B;  2K5I A;  3OYB A;  2HQE A;  2IG0 A;  4M78 D;  4LD6 A;  3HRS A;  1IZ6 A;  3A8H B;  5GAN 8;  2ZPF B;  1XNI A;  2FB7 A;  1MHN A;  5GAN g;  4E47 A;  5LJ5 g;  2GF7 A;  3GP8 A;  3CCS A;  3SD4 A;  4C0D B;  3G71 T;  4ZN1 A;  3EFS A;  4HCC A;  4L59 A;  2RJC A;  1LOJ A;  1NPR A;  2QA4 T;  2JNG A;  4II1 A;  1Q82 C;  1KD1 C;  2BIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...