4MMKA

Q8a hfq from pseudomonas aeruginosa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
SKGHSLADPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Protein hfq
publication title Effect of conserved intersubunit amino Acid substitutions on hfq protein structure and stability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 15
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mmkA00
2CGHA 1WPYA 5GAOn 1WNLA 4M7AB 5GMKi 1N9SA 1B34B 2HNIA 2DTOA 4M77D 4XTZA 3BDUA 5GANf 4M7DE 4M7DG 3EFSA 2VXEA 3FB9A 3JCMf 5GANd 5GAOr 4HT8A 3PGGA 2VC8A 4M77B 5CAIA 3JCMd 3JB9G 4X9CA 4M75F 4EMKB 3L1AA 1LJOA 3V7SA 5GMKm 4NL2A 1WQ7A 4EMHA 4HT9A 3BFMA 4XTVA 2DJZA 2E41A 2RA2A 3FJPA 4PJOA 1LOJA 3JCMh 5GAN6 5GANj 4MMKA 4F7UE 5GAN7 4PJOG 1BIBA 5LJ5f 1JRIA 4XTXA 1I4K1 4C92D 1H641 2RB6A 5LJ3e 5LJ5d 5GAN4 4PJOB 4M7AE 4M77A 5GMKe 3RUXA 3BW1A 1KQ2A 3QSUA 4M7AG 1I8FA 4OP0A 4C8QD 4M75A 4C92B 4M78F 3V7RA 3L2ZA 2DXUA 5GAOl 1MGQA 4C8QF 4M77E 5LJ5h 4M77G 4C8QB 2DXTA 4M75D 2DZ9A 1LNXA 4NOYA 3RKXA 4DQ2A 3M4GA 2DEQA 4M75G 4A53A 5LJ3g 4EMGA 5GAMe 5LJ5j 3SWNB 4M7DC 2EAYA 3QHSA 4M75B 4RCBA 3RKWA 3FIFA 3VU3C 1BIAA 1TH7A 1N9RA 2VXFA 1KQ1A 3HFNA 4J5YA 4J6YA 5GAN5 2EJFA 4C92A 3AHUA 2DTIA 2YLBA 2YLCA 2QTXA 3JCMQ 4M78A 4PJOE 5GAOq 4V2SA 3RKYA 4EMKA 4XTYA 4A54A 4C8QA 4Y91A 4C92E 1HXDA 2EWNA 4M78D 3JB9J 4C92G 5GAN3 4PJOC 4M7DF 3SWNA 1U1TA 4N0AA 1Y96A 4C8QG 3EFRA 4M78B 1U1SA 3HFOA 3GIBA 3JB9F 4XTUA 2I2LA 4XU0A 5GAOm 4M7AC 1D3BA 3RIRA 4M75E 4QVDA 5GAN8 4XTWA 5GANe 4XU3A 1I5LA 1YCYA 3HSBA 4M77C 1HK9A 1Y96B 3JCMe 4PNOA 4EMKC 5LJ3f 4M75C 3SB2A 2EJ9A 1D3BB 4F7UF 5LJ3d 3JCMX 4F7UB 3JCMc 3QO3A 4RCCA 1JBMA 2FYKA 4M7DA 4XU1A 5GANg 3V8KA 5GAMg 3JCMW 4JUVA 3JCMg 4QVCA 4M7AF 5LJ3h 2FB7A 2EJGA 3JCMV 4M7DD 4J6XA 5GMKh 3JCMP 2JN0A 5GAMf 3JB9D 2E64A 1M8VA 4HA8A 4M78E 3RESA 5GAN2 4MMLA 4M78G 5LJ3j 5LJ5e 4M77F 4XQ3A 5GAMd 1I81A 4C8QE 5GMKj 3JB9I 4NL3A 5I21A 5GMKl 2DZCA 3BY7A 4M7DB 4C92C 3JCMJ 1X01A 2DVEA 4J6WA 4JRKA 4M78C 2E65A 3JB9H 4F7UA 1M5Q1 2E10A 3V7CA 4C8QC 5GAMh 5GANh 5DY9A 4XU2A 3JCMb 1WQWA 5LJ5g 2E1HA 4JLIA 4JRIA 5GAMj 3SWNC 2YHTA 3QUIA 4WF2A 3RERA 4N0AC 3V8JA 2RM4A 4F7UG 4M7AA 1B34A 2DTHA 4PJOD 3V8LA 2Y90A 4PJOF 4M7AD 2K57A 5GAOp 2DKGA 4X9DA 3INZA 2RD1A 4C92F 2ZGWA
chains in the Genus database with same CATH superfamily
3M53A 4M7AB 2NUZA 3CCVT 2L3SA 2DTOA 4IUVA 2XK0A 4KBMB 3RMSA 2MOXA 2MF2A 2ZPFB 1K0SA 1RAAB 3GLXA 3JCMh 1SRLA 2CUDA 2R5AA 4B6MA 2V8JA 4C92D 2QASA 2EGAA 2F1LA 1X75C 1SRMA 2GQVA 1VQ5A 1Z9QA 4X34A 3CCEQ 1GBRA 2LNVA 1WXTA 1SKUB 3G6EQ 4A63B 3MKDA 3VV0A 4J9GA 3VRZA 1PRMC 4QT7A 3CC4T 4IURA 1K8AU 4J6YA 3EFOB 2EJFA 4XTYA 4WTOB 3CD6Q 3X26B 2EQJA 1RAEB 1QQJA 2A3LA 3CMAQ 5EC7A 2FZGB 3I35A 2KXCA 3R6NA 2VKNA 5CKDA 1KD1U 2ZPBB 3EH2A 2V26A 3M0PA 2DF6A 5FU7C 1M90C 2X4YA 2NLUA 3JV3A 2FEIA 2F2VA 2O31A 3A1PA 1KQSS 2LJ3A 3JB9D 3VYHB 4EPCA 1H3HA 3JCMJ 1X01A 4C8QC 2QYZA 1GL5A 4JRIA 4E47A 2Y90A 1VIFA 2DVJA 3JRZA 4L59A 1VIEA 1YJ9Q 3CCVA 4QQDA 3PVLA 4M7DG 2BTTA 1NYFA 1P92A 3KBGA 3PGGA 2COWA 1CKAA 5CAIA 2E6NA 3CPWS 5HKCA 5J3BA 2RJCA 1B7TA 1Y57A 2K3BA 2HAXA 3OYCA 4LXCA 1QKXA 1WXBA 1QVPA 2R5MA 3FJPA 4J9IA 3ER0A 3RDVA 1XTDA 1JXOA 2QTVA 4F7UE 5GAN7 3X25B 1QP2A 1YIJQ 2KGTA 1NZ9A 1DJ7B 2RK2A 3H0FA 4C8QD 3L2ZA 2D0QB 4Y92A 1K0XA 4KUIA 5IN1A 4NOYA 1YCSB 2DEQA 3CMEQ 1JU5C 4RCBA 3CC4A 3PIPA 4XK8E 5L23A 1FMVA 2JS2A 4DBQA 3CXCA 3I56Q 2F69A 5GAN5 4C92A 2YLBA 2YT6A 5J39A 1UDLA 2A0FB 1E6HA 2DILA 1NJIR 1FXXA 4FU6A 1NYGA 1OZ3A 4M7DF 1JB0E 2KT8A 1U1SA 1UJYA 1V29B 4AG2C 1WHLA 4JS4A 4XTWA 5L8RE 1VQ9A 4J8OA 4PFOA 2VGMA 3SB2A 3E19A 1PM3A 2DETA 2K4YA 4ESRA 2KROA 4BE1A 3QO3A 3M56A 2YUNA 2RK1A 1O9SA 2M02A 3OYBA 1IREB 4RUGA 4J6XA 2ATCB 5GMKh 2QQAA 3CCLQ 3OYYA 4R56A 3HTRA 5I21A 3GNGA 2OTLT 3CCJT 1WLPB 4RKUE 4KUDK 4PFPA 1M5Q1 4A4KA 1Q95G 4PJLA 3L42A 1UECA 4N0AC 1JXMA 4J7FA 5CCAA 4N4HA 3RBBB 1RABB 1OQKA 4MZMA 2HSPA 1I0CA 2JMCA 3CCMA 4RTTA 4HT8A 3EG0A 2AKKA 3CXCP 4F04B 3QPHA 2DL5A 1VQOT 2HEQA 3G4ST 1UGSB 1YP5A 4PJOG 4R55A 1WFWA 1ZX6A 2EW3A 1MMDA 5KCHA 3SFMA 1M1KR 2BUDA 1M2VB 5CK9A 2LT4A 4M75G 1UHFA 2HD0A 4M7DC 2LCSA 3CCST 2KY9A 3JCMQ 2RHIA 4C8QA 1Q86C 4CC4B 1U1TA 1ZSZB 1AWJA 3CPFA 1N27A 3AT1B 1SSFA 2O88A 1TOVA 4XU3A 2NUPA 3KFVA 5LJ3f 3X20B 1JEGA 2X4WA 4D8DA 3HRTA 2DXCA 1JBMA 1GFDA 2FYKA 1WDXA 2F5KA 2PUOB 3QKJA 2QEXA 2FB7A 3REBB 4M7DD 4M78E 3RESA 2EQKA 4IIOA 1RLQC 2DYIA 2YSQA 2PTKA 3VUBA 5GMKj 3BY7A 3VUZA 3CCJA 1M3BA 1K8AC 2CP5A 2E12A 4R0KA 3L2QA 3M0TA 1UEBA 3EGXA 4ANJA 1W6XA 3I55T 2RQVA 1OPLA 2RF0A 3UPUA 2YUQA 4B9XA 5GMKi 3NTKA 1SEMA 1XOVA 3MP1A 1QMCA 4HVWA 1G3TA 1KD1C 1T3LA 1KC8U 3ZFJA 3UA6A 3L1AA 2CP6A 2YXYA 4BB7A 4EIKA 3S3MA 2L8DA 4AT1B 1YI2T 4MMKA 1G8XA 2GF7A 3UA7A 1IHWA 1AZGB 2B8AA 4E6RA 2Y4XA 4KH1B 3M5AA 1KHCA 2J06A 4F14A 2DXUA 3J81E 5LJ5h 4C0DC 4HCKA 1W70A 2JTEA 3U23A 5GAMe 2EAYA 2EIFA 4FW2A 3RKWA 4O6JA 3M59A 1RUWA 2K79A 1UTIA 4E7IA 4BDZA 2Z0WA 4L6V5 1M90R 1Q82U 5KYXA 4DBFA 1OV3A 4C5GA 4GY5A 3H0IA 4FL6A 1G3SA 1R0BG 2QQBA 2MPXC 4PJOC 4N0AA 3HFOA 1PCXA 3J7AF 5HK0A 3OYGA 4QVDA 4LDXA 3OSVA 2DJQA 4J9FA 5CQXA 1HK9A 3LGLA 1N5ZA 4EMKC 3CC2Q 4M75C 1VQ5Q 5LJ3d 3EG1A 1PC0A 1MMAA 3I5RA 1Y71A 2EBPA 4OGCA 2CREA 2E64A 2CSIA 5EG2A 3LX7A 2RQRA 1K9MU 2HBPA 4BI8B 3P8DA 4FSXA 2CS7A 4J9EA 3TSZA 2E5KA 1UGVA 2YHTA 5KYUA 4PJOD 4ORZA 3EG9A 4A4HA 3PVQA 4BY6B 3MEAA 4X9DA 2FL7A 3INZA 3GNFB 2RD1A 1ZUKA 1G3YA 1IGQA 1N9SA 2LCLA 1ZA1B 2HQEA 2NWMA 1R0CB 3LWHA 2DL7A 2HL5C 1YI2A 2AKLA 3REAB 3I5SA 1RI9A 3FJ5A 5GANj 1FX7A 1YJNT 2K3XA 1GCPA 2XD0A 5FU6C 1VQ7T 1JQQA 1KQSA 1VUBA 1M8MA 2DM1A 8AT1B 2BE9B 1EIFA 4M77G 1G3WA 1OOTA 4A53A 5LJ3g 2KRNA 5LJ5j 2ROLA 3MEVA 3VS6A 3CCQT 2ED0A 3CCVQ 1Q81U 2GFUA 3BDLA 2CDTA 2K5FA 3DKMA 8ATCB 2E6ZA 1OU9A 1TG0A 2DTIA 3HPWA 5GAOq 3RKYA 3SDZA 4FYWB 2K7AA 4C92E 3L2UA 3JAME 1RAHB 1YJWA 3CPWA 3OMGA 4M78B 3OW2S 3CCUT 1D3BA 2QA4Q 3RIRA 4AMCA 3E1SA 2JT4A 1YHQT 4J9DA 2QDLA 3I9QA 3OYDA 2DLPA 2RI5A 1AT1B 1W4SA 1YN8A 1PNJA 1NLOC 2QQRA 2RI2A 3E9FA 1VA7A 4M77F 2SRCA 5IXBA 5CVIA 3HRSA 3C94A 1E7OA 1NE8A 4LUEA 2V8IA 3SHWA 3WXMB 2J05A 2RI3A 1KQSP 2OAUA 3RERA 2RM4A 1QWFA 2HDAA 2XIDA 2XKOC 4KH0B 2KE9A 1QVGA 4LE9A 1H3ZA 2X3XD 1WPYA 1VQ9Q 1WJSA 1MMGA 1BBZA 3M0SA 1PD1A 3GP8A 4OF1A 4X9CA 2L3QA 1NBEB 1GCQA 3GF5A 1ZUYA 2EYYA 3M58A 4DA4A 1X27A 2DL3A 4PJOA 3EHQA 2GCXA 2OX7A 1OULA 1JJ2A 3CPWP 1W2BS 1PWTA 1RLPC 1N8RR 1Q86R 4OP0A 4M75A 1WJQA 1QP3A 2M0YA 4PFZA 1MGQA 3M0QA 4JZ3A 4OMLA 4C8QF 1Q7YU 3M4GA 2WSEE 1BYMA 2JMAA 1I1JA 3PIOA 2YDLA 2E5QA 1VQLQ 4ZGDB 2DO3A 2ENMA 4DBHA 3CCMQ 1RAGB 3JSCA 1OI1A 3EGUA 2VWFA 5KH6A 2W0ZA 3P8BB 1W1FA 2C0TA 4GLMA 1MV3A 3G1JA 1XNIA 3OS0A 3H8ZA 4ELZC 3RNJA 1N6AA 2CP2A 4LDVA 2F5TX 3SD4A 2IG0A 2P4RA 5DM7R 4M77C 1AHJB 1TUCA 1NLPC 3M0RA 2JS0A 2MAMA 4LNPA 3G71T 3MEUA 1NPRA 4PL6A 3NFCA 4IUTA 3OYJA 1VQPT 1BI1A 1G83A 2ED1A 2ECZA 1UE9A 2RQTA 3CC7T 3R6OA 4E7HA 1I81A 2DZCA 2O4XA 5KYWA 4D6WA 3FDRA 1FWZA 4OB1B 1NPPA 4BI4A 4LD9K 3OQ5A 3SWNC 2DMOA 4F7UG 3Q1JA 4M7AA 2FRYA 2RJEA 5CO7A 4BUGA 1NM7A 4CRIA 2DKGA 3VS3A 2R57A 2QI2A 1IRXA 2H3JA 4M77D 1AWWA 4C0GA 4BE0A 4OB2B 1ZHIA 2EYXA 1X6GA 5M9OA 5D6XA 4OMPA 1SSHA 2QEXQ 1G5VA 3A8MB 5GAN6 5KE2A 3WVEB 4D8KA 2JZ2A 3QYGB 4TVRA 2KNBB 1QLYA 1KQ2A 2OTJT 4KGZB 3S3OA 1C0MA 4C92B 1UJ0A 2EGEA 2DXBA 2CZ1B 1ZQ1A 2O01E 1VQNT 4QVZA 3QXEB 2JVVA 2E4HA 2J7IA 2GTOA 4C5IA 1K76A 2A36A 1WZOA 2AHJB 3OSSC 1RL2A 1SF9A 1PKTA 1MNDA 1KG1A 2RJFA 3MJXA 2DNUA 4JLGA 1KK7A 4PLLA 3OBWA 5GAOm 2XDBA 2KAFA 4RTYA 2DL8A 1K9AA 3JCMe 1TUDA 4JRQA 3HKSA 4MDWA 1D0XA 3CCET 1WA7A 3JCMc 1VQPA 2X51A 3VS1A 3JCMW 4C5EA 3URGA 2D6FA 2HMAA 3JCMV 3PT9A 1BKBA 1S72Q 1M30A 5GAMf 4MDXA 3MCAB 1QVGS 2VV5A 3FRNA 3OYNA 1Q81C 4J6WA 2DERA 4J7IA 5DY9A 1TU0B 2LJ1A 3VJPA 3HP9A 4A4EA 4F16A 3CMAT 3ZBDA 1QWEA 4IKFA 4QQ6A 3NGPA 1K73R 3UT1A 3VS2A 3M9QA 1WNLA 1WYXA 1JJ2S 2HNIA 4M7DE 3BDUA 4E7JA 1NJIU 4ZN3A 4CC7A 2IIMA 3VYGA 1XJWB 2KYBA 3CCRQ 3MPUB 4KGXB 5FU7B 3A8GB 2FPFA 2D0NA 4FIBA 1T3SA 2EKHA 1TSFA 2O9VA 3OA6A 2GGRA 2RB6A 2JTFA 5GAN4 1TWBA 3QG1A 4M77A 2RO0A 3LWIA 4ZTFA 1AWOA 4YTLA 4HVUA 5I2MA 1YWPA 2ABLA 4C8QB 2DZ9A 3QWYA 1VQNA 4OMQA 3TCJA 1WXUA 1H8KA 2JOYA 1QVFA 1YJ9T 3TEEA 3OMCA 3UWNA 1AWXA 2DX1A 1S1NA 3DB4A 2L3RA 3LH0A 1VQ6Q 2EGCA 2NUPB 1M1FA 3SWNA 2M16A 5IHIA 1VQKT 4PJJA 3GIBA 2XMFA 1YIJT 2G6FX 2GFAA 5HY6A 2SEMA 5A0DA 1Y96B 5KCOA 2V1QA 4ZTJA 2WACA 2A08A 2VUBA 3CMET 4IUUA 5IT9E 1ABOA 1M3CA 4QVCA 2VASA 2KYMA 1UFFA 1U06A 2LT1A 4HA8A 1VQ4Q 5GAMd 1EZZB 3I56T 1M1KU 1WGSA 2LMJA 2HQXA 2L3PA 1XQHA 2RQWA 2CZ7B 1T0HA 3CQTA 2GBQA 1YJWQ 2EKOA 4FW1A 1IHVA 1OX8A 3V8LA 4PJOF 1YNZA 3MO8A 1UHCA 3WVDB 3PNWC 1M1GA 5I22A 4ATOA 4L5GA 3OW2A 3UATA 2FHDA 1QVFP 5CKHA 1NEGA 3A98A 2VC8A 2OTLA 2KI7A 2EPDA 4FYVB 4M75F 4HT9A 2DL4A 5FWBA 2RA2A 3CCLT 2A28A 2BKDN 2CH4A 1X2KA 2RH2A 2XICA 2CP0A 5CQYA 2X3WD 1M2VA 4N4GA 2HCKA 2A7YA 2LVMA 5GMKe 4M7AG 2GTJA 5KYXB 5GAOl 1T0JA 1PHTA 5FRNA 1FYNA 3HHTB 2COZA 5I11A 3FIFA 1BIAA 1TH7A 1VQOA 3G4SA 4J5YA 2P0KA 2QAZA 2JUFA 2JW4A 4E7LA 2D9TA 1PSEA 1ZBXA 1MHNA 2LQWA 2KSSA 1UGRB 2LJ0A 1VQKA 5A0GA 1YITQ 3EFRA 1YIJA 1G2BA 9ATCB 1IB8A 2YUPA 4PJNA 4BACA 1PSFA 3CCSA 4OB3B 2MIOA 2R58A 1W2BA 1LCKA 2DIQA 1Y07A 2KRMA 3OW2P 2MCNA 2CYZB 1TTHB 4M7AF 5LJ3h 4AFSC 1AOJA 3VS7A 1GCQC 2HBWA 3EG9B 3HL8A 4XQ3A 2HSEB 4M7DB 1VYUA 1SHGA 2MWOA 1RACB 4M78C 2DK3A 4F7UA 1MMNA 6AT1B 4A4FA 2E1HA 4OMFB 1K4US 2RMOA 2DTHA 3LGFA 1BCMA 3TVTA 1BK2A 3H9NA 2WSCE 4FT4A 1M90U 1FMWA 1B34B 4XTZA 2F2XA 2QXFA 3QDFA 1WHMA 1QW1A 3PFSA 5GMKm 2CZ0B 3CCLA 1MNEA 2BZXA 4OGEA 1QVFS 1VYTA 3I55A 3OYMA 3CBMA 2PUKB 1TUGB 3VS0A 3X24B 1I8FA 2DRMA 5FWCA 2XDDA 3ME9A 2X4XA 3GBQA 2HKNA 4M75D 1LNXA 4DQ2A 5CKEA 4DEYA 2J6KA 4PKCC 1Y7XA 3M0UA 3QHSA 1OEBA 1W2BP 5KYYA 2PU9B 1N9RA 2FRWA 2ZPGB 2ESWA 2FZCB 2V8KA 2YRDA 4OMMA 4FYXB 2HL3A 1IO6A 2K2MA 4LUDA 2ZAEA 1WHKA 2OJ2A 2RHZA 4M7AC 2LQNA 3KXTA 1Q81R 2EQUA 2PZ1A 5GANe 3MP6A 3HSBA 1CKBA 2VVKA 2CUBA 4PNOA 4AFZC 3RMQA 1VQMT 3OS1A 4JUVA 3QWXX 1U3OA 4C0DB 2NUTB 2JNGA 5LJ3j 5LJ5e 2RHUA 2DVEA 3EGDA 2QK0A 2RN8A 4MZPA 3TSWA 3JCMb 2C06A 1WQWA 4Y28E 2PVGB 3QIIA 3L2VA 2XU8A 4ZGEB 4QQGA 1ZSGA 4M7AD 4N4IA 3A5ZB 5KE3A 2KXDA 1GBQA 3CC2T 3EG2A 3CC4Q 2D8JA 2MWPA 3H41A 3JCMf 1WX6A 2K5IA 5LL6S 1RAIB 4EMKB 1VQPQ 1LJOA 2HZYA 4ZNXA 1C1AA 1IXDA 2VYTA 3O8VA 4XTVA 1D09B 2FG0A 2PVDB 1ZLMA 2DBMA 2PVOB 4JJNK 4OVAA 4J9HA 3LW5E 4P5NA 3RUXA 2RPNA 3NHNA 1GXIE 1PG5B 3V7RA 3DLLA 4M77E 3TQ7P 2MMPA 1BCOA 4Q5WA 4QW2A 4JRPA 3CEYA 4RMOA 3VU3C 1KJWA 3LH5A 3H0HA 4RG2A 3CBPA 3E2UA 1YJNA 3FC3A 1U8RA 1VQ7A 4M78A 2E70A 3M55A 4M4ZA 4DEXA 2EWNA 2VB6A 3RR6A 1I07A 2XDPA 2WSFE 2DA9A 2E3HA 4JJCA 3C95A 2CKKA 4FM4B 4II1A 2P0QA 3VS5A 3CCQA 1YBYA 2LC4A 1KIKA 5FU6B 3HRUA 3JCMX 1VQMA 1VYVA 2P4TA 1RI0A 1VQNQ 2L89A 4XU1A 3QJYA 2CZ6B 4HXJA 1R77A 1B07A 2KRSA 5GAN2 1KC8C 1N8RU 3JB9I 2RHYA 4C8QE 1Q86U 4JJBA 5GMKl 3CCUA 2BZ8A 2YRCA 2DD4A 1YHQA 3JB9H 4QKUA 3LLRA 1K8AR 5FW9A 1IGUA 2CP3A 2V1RA 4J9CA 2LRQA 1V1CA 1QVGP 1SPKA 2QA4T 2L5QA 2LQ8A 3T9NA 3SEMA 2M9UA 4BI3A 4DOVA 3PE0A 3F70A 3CC2A 2FPEA 7AT1B 4GLKA 3JCMd 1BB9A 1KD1R 2RHXA 1OPKA 3VRYA 2BE7D 4AFQC 1OX9A 1AD5A 1Q82C 1JJ2P 1PKSA 2CT4A 1JRIA 1VOMA 1VQ8T 2GNCA 4CC3A 2L2PA 3L2WA 2O9SA 2AK5A 1UG1A 1ZBJA 2QDYB 3MP8A 1ZA2B 3QZ9B 1VQ9T 1WHGA 3HFNA 3PMTA 2QG9B 2OTLQ 3S3NA 2YLCA 5IAYA 3CCJQ 5AT1B 3OYLA 1X6BA 1MV0B 3ZL7C 1K9MC 1U5SA 4WCIA 1J3TA 1RAFB 2I2LA 4E2FB 1EFNA 1OYXA 4BDYA 3EFOA 4E7KA 3QBYA 4KULA 1NG2A 2EJ9A 4F7UF 5D6YA 2DD5A 2JJ9A 3JCMg 2MYSA 1B3QA 2EJGA 3A8OB 1VQLT 2JN0A 1VQOQ 4Z89A 2PQWA 3G4SQ 4NL3A 3CCMT 4JS5A 4PJMA 5CR2A 5D6WA 4OB0B 2KEAA 1HJDA 3OYFA 1D0YA 3H6ZA 1VQKQ 3V8JA 2QA4A 2J6OA 3IQLA 3G71A 5IXFA 3G6ET 4JZ4A 3CC7A 5GJWB 3CCSQ 3EFSA 2LTOA 5GAOr 4M77B 3OBYA 1ZSZC 1V76A 1WQ7A 4EMHA 3M54A 3CD6T 3ASKA 2E41A 4LD6A 5CKFA 4IUQA 2J6FA 4RTZA 4JDSA 4RTUA 1VQ8A 1BIBA 1CSKA 1WIEA 3VS4A 2FPDA 2X35A 1UGQB 3BW1A 4IIMA 3QSUA 3VKIA 1O75A 3OS2A 1UUEA 2LP5A 2DEUA 2AIRB 2VGNA 5D7UA 3SWNB 1Z9ZA 4J83A 4LDUA 3OYKA 2D1XA 3META 2QTXA 1OU8A 2QGFB 1K73U 2QEXT 2OTJA 5HCKA 4JJDA 3I55Q 3O5ZA 4EDUA 2O2OA 4IUPA 3MHXA 3DB3A 2P0PA 1K1ZA 3V8KA 1VQLA 3EHRA 1YI2Q 4MMLA 4M78G 4VUBA 2W10A 4RG8A 4KT0E 2CT3A 2EYWA 3OS5A 5GAMh 2LX9A 2X4JA 2OI3A 1GFCA 3CCEA 5C0MA 1M27C 5FRMA 3UF4A 2LZ6B 1ZUUA 2FO0A 3KUFA 4X1VA 3G6EA 3EGXB 3NTIA 2LX7A 2DFUA 1YFNA 2ZGWA 2K9GA 5GAOn 2EYZA 1Q7YC 5GANf 2DBKA 1AEYA 4DBRA 1QCNA 2ROTA 3V7SA 1R8OB 1D1AA 3CD6A 4DOWA 3BFMA 1S72T 4FSSA 4HCBA 1SHFA 3CMAA 3QJ6A 5A2QE 2C0IA 4ZGJB 1OZ2A 5LJ5f 4XTXA 1N8RC 1I4K1 4FYYB 2D8HA 3ULRB 4A4GA 1FMKA 3TREA 1QKWA 4M78F 2KVQG 2FVUA 2LCCA 1C6VX 1GRIA 2JTMA 2KDSA 2QQSA 3RKXA 3S6WA 2AT1B 2M51A 3D7SB 4AFUC 2VXFA 1KQ1A 2DE0X 1LPLA 4J9BA 2EQMA 2EFIA 4PJOE 2LDMA 4V2SA 1AVZC 3C0CA 2M0OA 3CCRT 3LYIA 2QQ9A 1HXDA 1X43A 3PMIA 4OMNA 5FROA 5GAN3 1UB4A 2LNHB 2NYSA 4KRTA 4BY6C 1KC8R 1Y96A 4HVVA 1SG5A 4PLIA 1WJRA 3CBOA 4XU0A 4OMOA 2JM8A 4M75E 5FLXE 1ARKA 5GAN8 2KR3A 2KQWA 1YJ9A 1YCYA 3MEWA 4RTXA 1YWOA 3OYHA 2AZVA 2ZPEB 4F7UB 1ZSZA 5GAMg 2BIVA 1TXQA 1UGPB 2P84A 3G7ZA 1PRLC 3OY9A 1LVKA 3OB9A 2I0NA 2KBTA 1YJNQ 2DRKA 1VQ6T 1VQ7Q 5AYFA 4JRKA 2Y4YA 4F17A 3C4SA 5GANh 3GPLA 4XU2A 4KGVB 4LN2A 5GAMj 3E9GA 1Q82R 1I5OB 3QUIA 1X2QA 4RTWA 2X9HA 3CXCS 3BE3A 3CMEA 2K57A 1M3AA 3CCQQ 2CGHA 2DPPB 5KYUB 1MUZA 5KYNA 2DAQA 5DLOA 3I56A 3FB9A 1VQMQ 5GANd 4O5VA 1D0ZA 4NL2A 3OYEA 4GBQA 1QCFA 4UC4A 1TS9A 1S72A 3P8HA 1LOJA 1VQ4T 2GQIA 4FT2A 1HD3A 3CCUQ 1M4ZA 5KYYB 1YHQQ 5LJ5d 4M7AE 2IPOB 4HCCA 2QGGA 2K6DA 2G3RA 1YJWT 1K9MR 2AZSA 4K11A 3J80E 2RNAA 4XAXB 1BI2A 2DXTA 2H8HA 3QYHB 4FCYA 4C5HA 1WHHA 4C0ZA 3PTAA 1E6GA 1Y0MA 1WI7A 3CCRA 1HSQA 3EH1A 4NS5A 3UDCA 1KHIA 2JXBA 4M78D 4C92G 3JB9J 3X28B 2LQKA 2PNIA 4LDWA 3THKA 5IH2A 2EQIA 3NPFA 4BD3A 2ZCFB 3QDRB 2IVWA 1H92A 3TU4K 5J26A 1ACMB 2K3YA 2KT1A 1RADB 3FEOA 1KFZA 1D3BB 3EGDB 4C0FA 2EYQA 4M7DA 5GANg 4ME7A 4Z88A 5IHNA 3EAEA 1NJIC 4RTVA 4ZN1A 1M8VA 3GOXA 1WHJA 1VQ6A 2YRVA 2K5LA 2E65A 2FZKB 3A8HB 1IZ6A 2E10A 3V7CA 1BI3A 2ZPHB 3NMZC 5LJ5g 2COYA 1YITT 2B86A 1K73C 1B34A 2F2WA 4HKEA 1X69A 2C0OA 5DLQE 2BZYA 5IHKA 3M4YA 2HQHA 4C92F 3FLGA 4LDYA 3QZ5B 2VXEA 1AZEA 2OAWA 2EVRA 3L2RA 5CKBA 3ZEHA 3JB9G 1X6OA 4E7SA 2DJZA 2HKQB 3EG3A 1VQ4A 2CP7A 2KK4A 4B9WA 2A37A 1PD0A 1H641 5LJ3e 4PJOB 3OYIA 1BU1A 4BE2A 2XG8D 5GJVB 1VQ5T 2YWWA 2E3IA 3G71Q 1EX4A 1A0NB 1QCOA 4HCZA 4EMGA 1BI0A 4M75B 3C12A 3OYAA 2MI6A 1NEBA 3CC7Q 1ABQA 4CI0C 3A8LB 2RQUA 2H3EB 1D1CA 4JPBW 5A0LA 4E7ZA 1KSWA 1F1BB 2ZPIB 3AHUA 2DIGA 5HK3A 2KMTA 2DYBA 4A54A 2ZZDA 4Y91A 5ECAA 1M1KC 4PK4A 4C8QG 3JB9F 4XTUA 1M9SA 5C6SA 1VQ8Q 3M57A 2XHCA 1I5LA 1M2OA 2RJDA 3DLMA 2NUTA 4MZTA 4RCCA 2JM9A 4AG1C 2CSQA 5I2SA 3JCMP 1Q7YR 2M1HA 4Z02A 2L0AA 4C92C 2CH4W 4ELYC 3NTHA 2OTJQ 2K2VA 2XI9A 4CC2A 4JLIA 1YITA 2YUOA 2O4XB 5KYWB 1D1BA 4WF2A 2MK5A 1JO8A 1HYOA 5CIUA 3N5BB 5GAOp 4Z8AA 4EMKA
chains in the Genus database with same CATH topology
3M53A 1G3YA 4ATOA 4L5GA 3OW2A 4M7AB 3CC7A 1N9SA 2LCLA 3CCVT 2DTOA 2FHDA 4IUVA 2HQEA 3EFSA 5CKHA 2LTOA 2XK0A 5GAOr 4KBMB 3RMSA 2VC8A 4M77B 3LWHA 2ZPFB 2MF2A 3OBYA 2OTLA 4M75F 1WQ7A 4EMHA 3GLXA 3M54A 4HT9A 3CD6T 3ASKA 2E41A 2RA2A 4LD6A 5CKFA 3CCLT 4IUQA 3JCMh 1YI2A 4JDSA 5GANj 1FX7A 2BKDN 1YJNT 2K3XA 2RH2A 2R5AA 2XICA 2XD0A 5FU6C 1VQ7T 1BIBA 1VQ8A 5CQYA 2V8JA 4C92D 1KQSA 4N4GA 1VUBA 2X35A 1UGQB 2A7YA 2LVMA 5GMKe 3BW1A 3QSUA 4M7AG 3VKIA 1O75A 1X75C 3OS2A 1Q7YU 2GQVA 1VQ5A 4X34A 5GAOl 1EIFA 2LNVA 4M77G 1G3WA 5FRNA 4A53A 5LJ3g 3HHTB 5LJ5j 2VGNA 3SWNB 3MEVA 3VV0A 3FIFA 1BIAA 1TH7A 3CCQT 1Q81U 1VQOA 2GFUA 3CC4T 3BDLA 4IURA 3G4SA 1K8AU 4J5YA 2P0KA 2K5FA 3DKMA 4J83A 4LDUA 4J6YA 2JUFA 3OYKA 4E7LA 2E6ZA 2EJFA 3HPWA 2DTIA 3META 2QTXA 5GAOq 2D9TA 1PSEA 3RKYA 1ZBXA 4XTYA 3SDZA 1MHNA 3X26B 2QEXT 1K73U 4C92E 3L2UA 2OTJA 3JAME 2EQJA 2KSSA 1YJWA 1UGRB 2A3LA 3CPWA 1VQKA 3OMGA 5A0GA 3EFRA 4M78B 3OW2S 3CCUT 1YIJA 1D3BA 3RIRA 3GNFB 4EDUA 3E1SA 1YHQT 3OYDA 4IUPA 1KD1U 5CKDA 2ZPBB 2RI5A 4BACA 1PSFA 3MHXA 3CCSA 4OB3B 1W4SA 2R58A 3DB3A 1W2BA 2DIQA 1Y07A 5FU7C 1M90C 2P0PA 2X4YA 2NLUA 3V8KA 2CYZB 4M7AF 1VQLA 5LJ3h 2QQRA 2RI2A 3HL8A 3E9FA 1KQSS 4MMLA 4M78G 3JB9D 4M77F 4XQ3A 4VUBA 4M7DB 4RG8A 4KT0E 3VYHB 3OS5A 4EPCA 2MWOA 3HRSA 5CVIA 3JCMJ 1X01A 3C94A 4M78C 2DK3A 4F7UA 5GAMh 1NE8A 4C8QC 2LX9A 2V8IA 4A4FA 3WXMB 2E1HA 2RI3A 2X4JA 4JRIA 3CCEA 2OAUA 3RERA 4OMFB 5C0MA 2RM4A 2DTHA 5FRMA 3LGFA 3KUFA 4E47A 2XIDA 2Y90A 1VIFA 2XKOC 3G6EA 3NTIA 1QVGA 2WSCE 4FT4A 3JRZA 1H3ZA 1M90U 2ZGWA 4L59A 1VIEA 3CCVA 1WPYA 4QQDA 5GAOn 1WJSA 1Q7YC 1B34B 4XTZA 2QXFA 5GANf 4M7DG 1P92A 3KBGA 1QW1A 3PGGA 3PFSA 3GP8A 5CAIA 4OF1A 2E6NA 3CPWS 4X9CA 5HKCA 5J3BA 2RJCA 3V7SA 1R8OB 2CZ0B 5GMKm 2HAXA 3GF5A 4DOWA 3OYCA 3BFMA 3CD6A 3M58A 4DA4A 3CCLA 4OGEA 1QVPA 2R5MA 3FJPA 1S72T 4PJOA 4HCBA 3CMAA 3ER0A 1XTDA 1QVFS 2GCXA 3QJ6A 4F7UE 3I55A 3OYMA 5A2QE 5GAN7 3CBMA 2PUKB 4ZGJB 3X25B 1OZ2A 1QP2A 5LJ5f 1JJ2A 4XTXA 1W2BS 1I4K1 1N8RC 3X24B 1NZ9A 4A4GA 3TREA 1I8FA 1DJ7B 2RK2A 4OP0A 4M75A 4C8QD 4M78F 1WJQA 2KVQG 2XDDA 1QP3A 2D0QB 3L2ZA 2FVUA 2X4XA 3ME9A 1MGQA 4C8QF 2LCCA 4KUIA 2JTMA 4M75D 5IN1A 1LNXA 2KDSA 2QQSA 4NOYA 5CKEA 3M4GA 2DEQA 3RKXA 3S6WA 4DQ2A 2WSEE 1BYMA 4PKCC 1Y7XA 3QHSA 4RCBA 3PIOA 2PU9B 2E5QA 3CC4A 1N9RA 2VXFA 2ZPGB 4XK8E 1KQ1A 3PIPA 4ZGDB 3CXCA 2DO3A 2F69A 5GAN5 2EQMA 2V8KA 2EFIA 4C92A 3JSCA 2YLBA 1OI1A 4PJOE 2LDMA 5J39A 4V2SA 5KH6A 3P8BB 2M0OA 3CCRT 3LYIA 2QQ9A 1HXDA 3PMIA 5FROA 5GAN3 1XNIA 1UB4A 1FXXA 4FU6A 1OZ3A 4M7DF 4BY6C 1JB0E 1QVFA 1Y96A 3OS0A 3H8ZA 2RHZA 1U1SA 4ELZC 1N6AA 4PLIA 1WJRA 3CBOA 1V29B 4LDVA 4XU0A 4M7AC 3KXTA 2EQUA 2F5TX 4M75E 3SD4A 5FLXE 5GAN8 4JS4A 2IG0A 2KQWA 4XTWA 5L8RE 5GANe 3MP6A 1YJ9A 1YCYA 5DM7R 4M77C 3HSBA 3MEWA 1AHJB 1VQ9A 4PNOA 4J8OA 2VGMA 3SB2A 3E19A 3OYHA 2ZPEB 2MAMA 3RMQA 2K4YA 4F7UB 1VQMT 3OS1A 3QO3A 3M56A 4BE1A 3G71T 3MEUA 1NPRA 4PL6A 3NFCA 5GAMg 2RK1A 4IUTA 3OYJA 1VQPT 1BI1A 1O9SA 2BIVA 4JUVA 1UGPB 3OYBA 1IREB 3G7ZA 4C0DB 4J6XA 5GMKh 3OY9A 2QQAA 3CC7T 3OB9A 3R6OA 2JNGA 5LJ3j 3OYYA 5LJ5e 4E7HA 1I81A 4R56A 2RHUA 5I21A 2DZCA 2O4XA 3GNGA 2OTLT 1VQ6T 3CCJT 2DVEA 4RKUE 5AYFA 4JRKA 2Y4YA 4D6WA 4KUDK 3FDRA 3C4SA 1M5Q1 4A4KA 5GANh 4MZPA 3GPLA 1FWZA 4OB1B 4XU2A 3JCMb 1WQWA 2C06A 1NPPA 4BI4A 4LD9K 5GAMj 3E9GA 3OQ5A 4Y28E 3QUIA 3L42A 3SWNC 4N0AC 3Q1JA 4F7UG 4M7AA 2PVGB 3QIIA 4J7FA 3L2VA 2XU8A 5CCAA 4N4HA 2RJEA 5CO7A 4BUGA 4ZGEB 4QQGA 3CXCS 3CMEA 4CRIA 2K57A 4M7AD 4MZMA 4N4IA 2DKGA 2R57A 3A5ZB 5KE3A 2CGHA 2DPPB 2QI2A 3CC2T 2H3JA 4M77D 2DAQA 2MWPA 5DLOA 3I56A 4C0GA 3FB9A 3JCMf 5GANd 3CCMA 4BE0A 4HT8A 2K5IA 4OB2B 4O5VA 5LL6S 1ZHIA 4EMKB 1LJOA 5M9OA 5D6XA 4NL2A 3OYEA 2VYTA 3O8VA 4UC4A 4XTVA 1S72A 3QPHA 1G5VA 2PVDB 1LOJA 3P8HA 1VQOT 1VQ4T 3G4ST 1UGSB 3A8MB 5GAN6 4FT2A 2PVOB 5KE2A 3WVEB 1M4ZA 2JZ2A 3QYGB 4OVAA 4TVRA 4PJOG 4R55A 3LW5E 4JJNK 4P5NA 5KCHA 3PNWC 5LJ5d 4M7AE 1KQ2A 2OTJT 3RUXA 3SFMA 4HCCA 3S3OA 4C92B 2G3RA 1YJWT 1GXIE 3V7RA 3DLLA 2DXBA 3J80E 4M77E 4XAXB 2CZ1B 1BI2A 2BUDA 2DXTA 2MMPA 5CK9A 1ZQ1A 2LT4A 4M75G 4Q5WA 4QW2A 2O01E 3QYHB 4JRPA 4QVZA 3QXEB 1VQNT 2HD0A 3CEYA 4M7DC 4C5HA 4RMOA 3VU3C 2JVVA 4C0ZA 4RG2A 3CBPA 3CCST 4C5IA 1YJNA 3FC3A 3PTAA 2KY9A 3JCMQ 2AHJB 3OSSC 1U8RA 4M78A 2RHIA 1VQ7A 2E70A 3M55A 1RL2A 3CCRA 4C8QA 4NS5A 3UDCA 2EWNA 1KHIA 4M78D 3JB9J 4C92G 1Q86C 2XDPA 1KG1A 2RJFA 3X28B 2LQKA 4LDWA 1U1TA 2WSFE 4JLGA 4PLLA 3OBWA 2ZCFB 4BD3A 5GAOm 2XDBA 3QDRB 2KAFA 2CKKA 3C95A 3CPFA 1N27A 2IVWA 4FM4B 2P0QA 1SSFA 4II1A 3TU4K 5J26A 4XU3A 3CCQA 1YBYA 3JCMe 2LC4A 2K3YA 4JRQA 3HKSA 5FU6B 5LJ3f 3FEOA 3HRUA 4MDWA 3X20B 3MO8A 3JCMX 1D3BB 4C0FA 1VQMA 3CCET 2P4TA 2EYQA 2X4WA 3JCMc 1RI0A 3HRTA 2DXCA 1JBMA 1VQPA 2FYKA 4M7DA 2L89A 4XU1A 5GANg 3AHUA 3JCMW 4ME7A 2F5KA 2PUOB 4C5EA 3QKJA 3URGA 3EAEA 2QEXA 3QJYA 2D6FA 2FB7A 3JCMV 2CZ6B 3PT9A 4ZN1A 1BKBA 1NJIC 4M7DD 1M8VA 5GAMf 4MDXA 3GOXA 3MCAB 4M78E 3RESA 2EQKA 5GAN2 1QVGS 1KC8C 3JB9I 1N8RU 2RHYA 2VV5A 3FRNA 3VUBA 4C8QE 5GMKj 5GMKl 3OYNA 3BY7A 2YRVA 3VUZA 3CCJA 3CCUA 1Q81C 2K5LA 1VQ6A 4J6WA 2DD4A 1K8AC 1YHQA 2E65A 3JB9H 2E12A 3A8HB 1IZ6A 2E10A 3LLRA 3V7CA 3L2QA 1BI3A 1UEBA 2ZPHB 4J7IA 5DY9A 5LJ5g 3VJPA 3HP9A 4A4EA 3CMAT 3ZBDA 2LRQA 1YITT 4IKFA 1K73C 3I55T 1B34A 4QQ6A 4HKEA 3UT1A 2QA4T 5DLQE 2L5QA 2LQ8A 3M9QA 3T9NA 3M4YA 2M9UA 4BI3A 4DOVA 3UPUA 4C92F 3F70A 3FLGA 3CC2A 4LDYA 3QZ5B 1WNLA 4B9XA 5GMKi 1JJ2S 2HNIA 4M7DE 3BDUA 3NTKA 4E7JA 2VXEA 1NJIU 4ZN3A 3MP1A 1XOVA 4GLKA 3L2RA 1G3TA 5CKBA 3ZEHA 3JCMd 3JB9G 1KC8U 1KD1C 3ZFJA 3L1AA 1X6OA 3VYGA 2RHXA 4BB7A 2DJZA 3S3MA 1VQ4A 5FU7B 2L8DA 3A8GB 1YI2T 1Q82C 3WVDB 2KK4A 4FIBA 4MMKA 2GF7A 4B9WA 1JRIA 3OA6A 2B8AA 1VQ8T 1H641 2RB6A 2JTFA 5LJ3e 5GAN4 3OYIA 3QG1A 4M77A 4PJOB 2RO0A 3LWIA 2Y4XA 3M5AA 1KHCA 3L2WA 4BE2A 4ZTFA 4YTLA 2DXUA 3J81E 5I2MA 2XG8D 1VQ5T 5LJ5h 4C8QB 4C0DC 2DZ9A 1VQNA 3TCJA 4HCZA 2QDYB 2JOYA 3MP8A 4EMGA 5GAMe 1BI0A 2EAYA 3C12A 4M75B 2EIFA 2MI6A 3QZ9B 3RKWA 3OYAA 4O6JA 1YJ9T 3M59A 3TEEA 1VQ9T 3OMCA 3UWNA 3A8LB 3HFNA 4CI0C 4E7IA 5A0LA 4BDZA 3PMTA 2ZPIB 2L3RA 3DB4A 2DIGA 2YLCA 3LH0A 4L6V5 2KMTA 5IAYA 5HK3A 3S3NA 1Q82U 4C5GA 4A54A 2ZZDA 4FL6A 4GY5A 4Y91A 3OYLA 1G3SA 1M1FA 2QQBA 1M1KC 4PJOC 1K9MC 3SWNA 2M16A 4N0AA 4C8QG 1VQKT 3HFOA 3GIBA 3J7AF 5HK0A 3JB9F 4XTUA 2I2LA 1M9SA 5C6SA 3OYGA 1YIJT 1OYXA 2XHCA 3M57A 4QVDA 4BDYA 3OSVA 4LDXA 2GFAA 5HY6A 4E7KA 5CQXA 5A0DA 1I5LA 1HK9A 1Y96B 3LGLA 3QBYA 5KCOA 4KULA 4EMKC 4M75C 2WACA 4ZTJA 2RJDA 2EJ9A 3DLMA 4F7UF 5LJ3d 5D6YA 2DD5A 4MZTA 4RCCA 1Y71A 2VUBA 3CMET 4IUUA 5IT9E 3JCMg 4QVCA 2EJGA 5I2SA 3A8OB 1VQLT 3JCMP 2JN0A 2LT1A 4OGCA 2E64A 4HA8A 2PQWA 2M1HA 5GAMd 5EG2A 3LX7A 4Z02A 4NL3A 3I56T 3CCMT 4JS5A 1M1KU 1WGSA 1K9MU 4C92C 2HBPA 4BI8B 5D6WA 4OB0B 2HQXA 3P8DA 4ELYC 3NTHA 5CR2A 4FSXA 2CS7A 1XQHA 2CZ7B 1Q86U 2K2VA 2XI9A 3OYFA 2EKOA 4JLIA 1YITA 2O4XB 3H6ZA 2YHTA 4WF2A 4PJOD 3V8JA 2QA4A 4A4HA 3G71A 3V8LA 4PJOF 5CIUA 3N5BB 4BY6B 5GAOp 3MEAA 3G6ET 4X9DA 2FL7A 3INZA 2RD1A 4EMKA 1M1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CGH A;  1WPY A;  5GAO n;  1WNL A;  4M7A B;  5GMK i;  1N9S A;  1B34 B;  2HNI A;  2DTO A;  4M77 D;  4XTZ A;  3BDU A;  5GAN f;  4M7D E;  4M7D G;  3EFS A;  2VXE A;  3FB9 A;  3JCM f;  5GAN d;  5GAO r;  4HT8 A;  3PGG A;  2VC8 A;  4M77 B;  5CAI A;  3JCM d;  3JB9 G;  4X9C A;  4M75 F;  4EMK B;  3L1A A;  1LJO A;  3V7S A;  5GMK m;  4NL2 A;  1WQ7 A;  4EMH A;  4HT9 A;  3BFM A;  4XTV A;  2DJZ A;  2E41 A;  2RA2 A;  3FJP A;  4PJO A;  1LOJ A;  3JCM h;  5GAN 6;  5GAN j;  4MMK A;  4F7U E;  5GAN 7;  4PJO G;  1BIB A;  5LJ5 f;  1JRI A;  4XTX A;  1I4K 1;  4C92 D;  1H64 1;  2RB6 A;  5LJ3 e;  5LJ5 d;  5GAN 4;  4PJO B;  4M7A E;  4M77 A;  5GMK e;  3RUX A;  3BW1 A;  1KQ2 A;  3QSU A;  4M7A G;  1I8F A;  4OP0 A;  4C8Q D;  4M75 A;  4C92 B;  4M78 F;  3V7R A;  3L2Z A;  2DXU A;  5GAO l;  1MGQ A;  4C8Q F;  4M77 E;  5LJ5 h;  4M77 G;  4C8Q B;  2DXT A;  4M75 D;  2DZ9 A;  1LNX A;  4NOY A;  3RKX A;  4DQ2 A;  3M4G A;  2DEQ A;  4M75 G;  4A53 A;  5LJ3 g;  4EMG A;  5GAM e;  5LJ5 j;  3SWN B;  4M7D C;  2EAY A;  3QHS A;  4M75 B;  4RCB A;  3RKW A;  3FIF A;  3VU3 C;  1BIA A;  1TH7 A;  1N9R A;  2VXF A;  1KQ1 A;  3HFN A;  4J5Y A;  4J6Y A;  5GAN 5;  2EJF A;  4C92 A;  3AHU A;  2DTI A;  2YLB A;  2YLC A;  2QTX A;  3JCM Q;  4M78 A;  4PJO E;  5GAO q;  4V2S A;  3RKY A;  4EMK A;  4XTY A;  4A54 A;  4C8Q A;  4Y91 A;  4C92 E;  1HXD A;  2EWN A;  4M78 D;  3JB9 J;  4C92 G;  5GAN 3;  4PJO C;  4M7D F;  3SWN A;  1U1T A;  4N0A A;  1Y96 A;  4C8Q G;  3EFR A;  4M78 B;  1U1S A;  3HFO A;  3GIB A;  3JB9 F;  4XTU A;  2I2L A;  4XU0 A;  5GAO m;  4M7A C;  1D3B A;  3RIR A;  4M75 E;  4QVD A;  5GAN 8;  4XTW A;  5GAN e;  4XU3 A;  1I5L A;  1YCY A;  3HSB A;  4M77 C;  1HK9 A;  1Y96 B;  3JCM e;  4PNO A;  4EMK C;  5LJ3 f;  4M75 C;  3SB2 A;  2EJ9 A;  1D3B B;  4F7U F;  5LJ3 d;  3JCM X;  4F7U B;  3JCM c;  3QO3 A;  4RCC A;  1JBM A;  2FYK A;  4M7D A;  4XU1 A;  5GAN g;  3V8K A;  5GAM g;  3JCM W;  4JUV A;  3JCM g;  4QVC A;  4M7A F;  5LJ3 h;  2FB7 A;  2EJG A;  3JCM V;  4M7D D;  4J6X A;  5GMK h;  3JCM P;  2JN0 A;  5GAM f;  3JB9 D;  2E64 A;  1M8V A;  4HA8 A;  4M78 E;  3RES A;  5GAN 2;  4MML A;  4M78 G;  5LJ3 j;  5LJ5 e;  4M77 F;  4XQ3 A;  5GAM d;  1I81 A;  4C8Q E;  5GMK j;  3JB9 I;  4NL3 A;  5I21 A;  5GMK l;  2DZC A;  3BY7 A;  4M7D B;  4C92 C;  3JCM J;  1X01 A;  2DVE A;  4J6W A;  4JRK A;  4M78 C;  2E65 A;  3JB9 H;  4F7U A;  1M5Q 1;  2E10 A;  3V7C A;  4C8Q C;  5GAM h;  5GAN h;  5DY9 A;  4XU2 A;  3JCM b;  1WQW A;  5LJ5 g;  2E1H A;  4JLI A;  4JRI A;  5GAM j;  3SWN C;  2YHT A;  3QUI A;  4WF2 A;  3RER A;  4N0A C;  3V8J A;  2RM4 A;  4F7U G;  4M7A A;  1B34 A;  2DTH A;  4PJO D;  3V8L A;  2Y90 A;  4PJO F;  4M7A D;  2K57 A;  5GAO p;  2DKG A;  4X9D A;  3INZ A;  2RD1 A;  4C92 F;  2ZGW A; 
#chains in the Genus database with same CATH topology
 3M53 A;  4M7A B;  2NUZ A;  3CCV T;  2L3S A;  2DTO A;  4IUV A;  2XK0 A;  4KBM B;  3RMS A;  2MOX A;  2MF2 A;  2ZPF B;  1K0S A;  1RAA B;  3GLX A;  3JCM h;  1SRL A;  2CUD A;  2R5A A;  4B6M A;  2V8J A;  4C92 D;  2QAS A;  2EGA A;  2F1L A;  1X75 C;  1SRM A;  2GQV A;  1VQ5 A;  1Z9Q A;  4X34 A;  3CCE Q;  1GBR A;  2LNV A;  1WXT A;  1SKU B;  3G6E Q;  4A63 B;  3MKD A;  3VV0 A;  4J9G A;  3VRZ A;  1PRM C;  4QT7 A;  3CC4 T;  4IUR A;  1K8A U;  4J6Y A;  3EFO B;  2EJF A;  4XTY A;  4WTO B;  3CD6 Q;  3X26 B;  2EQJ A;  1RAE B;  1QQJ A;  2A3L A;  3CMA Q;  5EC7 A;  2FZG B;  3I35 A;  2KXC A;  3R6N A;  2VKN A;  5CKD A;  1KD1 U;  2ZPB B;  3EH2 A;  2V26 A;  3M0P A;  2DF6 A;  5FU7 C;  1M90 C;  2X4Y A;  2NLU A;  3JV3 A;  2FEI A;  2F2V A;  2O31 A;  3A1P A;  1KQS S;  2LJ3 A;  3JB9 D;  3VYH B;  4EPC A;  1H3H A;  3JCM J;  1X01 A;  4C8Q C;  2QYZ A;  1GL5 A;  4JRI A;  4E47 A;  2Y90 A;  1VIF A;  2DVJ A;  3JRZ A;  4L59 A;  1VIE A;  1YJ9 Q;  3CCV A;  4QQD A;  3PVL A;  4M7D G;  2BTT A;  1NYF A;  1P92 A;  3KBG A;  3PGG A;  2COW A;  1CKA A;  5CAI A;  2E6N A;  3CPW S;  5HKC A;  5J3B A;  2RJC A;  1B7T A;  1Y57 A;  2K3B A;  2HAX A;  3OYC A;  4LXC A;  1QKX A;  1WXB A;  1QVP A;  2R5M A;  3FJP A;  4J9I A;  3ER0 A;  3RDV A;  1XTD A;  1JXO A;  2QTV A;  4F7U E;  5GAN 7;  3X25 B;  1QP2 A;  1YIJ Q;  2KGT A;  1NZ9 A;  1DJ7 B;  2RK2 A;  3H0F A;  4C8Q D;  3L2Z A;  2D0Q B;  4Y92 A;  1K0X A;  4KUI A;  5IN1 A;  4NOY A;  1YCS B;  2DEQ A;  3CME Q;  1JU5 C;  4RCB A;  3CC4 A;  3PIP A;  4XK8 E;  5L23 A;  1FMV A;  2JS2 A;  4DBQ A;  3CXC A;  3I56 Q;  2F69 A;  5GAN 5;  4C92 A;  2YLB A;  2YT6 A;  5J39 A;  1UDL A;  2A0F B;  1E6H A;  2DIL A;  1NJI R;  1FXX A;  4FU6 A;  1NYG A;  1OZ3 A;  4M7D F;  1JB0 E;  2KT8 A;  1U1S A;  1UJY A;  1V29 B;  4AG2 C;  1WHL A;  4JS4 A;  4XTW A;  5L8R E;  1VQ9 A;  4J8O A;  4PFO A;  2VGM A;  3SB2 A;  3E19 A;  1PM3 A;  2DET A;  2K4Y A;  4ESR A;  2KRO A;  4BE1 A;  3QO3 A;  3M56 A;  2YUN A;  2RK1 A;  1O9S A;  2M02 A;  3OYB A;  1IRE B;  4RUG A;  4J6X A;  2ATC B;  5GMK h;  2QQA A;  3CCL Q;  3OYY A;  4R56 A;  3HTR A;  5I21 A;  3GNG A;  2OTL T;  3CCJ T;  1WLP B;  4RKU E;  4KUD K;  4PFP A;  1M5Q 1;  4A4K A;  1Q95 G;  4PJL A;  3L42 A;  1UEC A;  4N0A C;  1JXM A;  4J7F A;  5CCA A;  4N4H A;  3RBB B;  1RAB B;  1OQK A;  4MZM A;  2HSP A;  1I0C A;  2JMC A;  3CCM A;  4RTT A;  4HT8 A;  3EG0 A;  2AKK A;  3CXC P;  4F04 B;  3QPH A;  2DL5 A;  1VQO T;  2HEQ A;  3G4S T;  1UGS B;  1YP5 A;  4PJO G;  4R55 A;  1WFW A;  1ZX6 A;  2EW3 A;  1MMD A;  5KCH A;  3SFM A;  1M1K R;  2BUD A;  1M2V B;  5CK9 A;  2LT4 A;  4M75 G;  1UHF A;  2HD0 A;  4M7D C;  2LCS A;  3CCS T;  2KY9 A;  3JCM Q;  2RHI A;  4C8Q A;  1Q86 C;  4CC4 B;  1U1T A;  1ZSZ B;  1AWJ A;  3CPF A;  1N27 A;  3AT1 B;  1SSF A;  2O88 A;  1TOV A;  4XU3 A;  2NUP A;  3KFV A;  5LJ3 f;  3X20 B;  1JEG A;  2X4W A;  4D8D A;  3HRT A;  2DXC A;  1JBM A;  1GFD A;  2FYK A;  1WDX A;  2F5K A;  2PUO B;  3QKJ A;  2QEX A;  2FB7 A;  3REB B;  4M7D D;  4M78 E;  3RES A;  2EQK A;  4IIO A;  1RLQ C;  2DYI A;  2YSQ A;  2PTK A;  3VUB A;  5GMK j;  3BY7 A;  3VUZ A;  3CCJ A;  1M3B A;  1K8A C;  2CP5 A;  2E12 A;  4R0K A;  3L2Q A;  3M0T A;  1UEB A;  3EGX A;  4ANJ A;  1W6X A;  3I55 T;  2RQV A;  1OPL A;  2RF0 A;  3UPU A;  2YUQ A;  4B9X A;  5GMK i;  3NTK A;  1SEM A;  1XOV A;  3MP1 A;  1QMC A;  4HVW A;  1G3T A;  1KD1 C;  1T3L A;  1KC8 U;  3ZFJ A;  3UA6 A;  3L1A A;  2CP6 A;  2YXY A;  4BB7 A;  4EIK A;  3S3M A;  2L8D A;  4AT1 B;  1YI2 T;  4MMK A;  1G8X A;  2GF7 A;  3UA7 A;  1IHW A;  1AZG B;  2B8A A;  4E6R A;  2Y4X A;  4KH1 B;  3M5A A;  1KHC A;  2J06 A;  4F14 A;  2DXU A;  3J81 E;  5LJ5 h;  4C0D C;  4HCK A;  1W70 A;  2JTE A;  3U23 A;  5GAM e;  2EAY A;  2EIF A;  4FW2 A;  3RKW A;  4O6J A;  3M59 A;  1RUW A;  2K79 A;  1UTI A;  4E7I A;  4BDZ A;  2Z0W A;  4L6V 5;  1M90 R;  1Q82 U;  5KYX A;  4DBF A;  1OV3 A;  4C5G A;  4GY5 A;  3H0I A;  4FL6 A;  1G3S A;  1R0B G;  2QQB A;  2MPX C;  4PJO C;  4N0A A;  3HFO A;  1PCX A;  3J7A F;  5HK0 A;  3OYG A;  4QVD A;  4LDX A;  3OSV A;  2DJQ A;  4J9F A;  5CQX A;  1HK9 A;  3LGL A;  1N5Z A;  4EMK C;  3CC2 Q;  4M75 C;  1VQ5 Q;  5LJ3 d;  3EG1 A;  1PC0 A;  1MMA A;  3I5R A;  1Y71 A;  2EBP A;  4OGC A;  2CRE A;  2E64 A;  2CSI A;  5EG2 A;  3LX7 A;  2RQR A;  1K9M U;  2HBP A;  4BI8 B;  3P8D A;  4FSX A;  2CS7 A;  4J9E A;  3TSZ A;  2E5K A;  1UGV A;  2YHT A;  5KYU A;  4PJO D;  4ORZ A;  3EG9 A;  4A4H A;  3PVQ A;  4BY6 B;  3MEA A;  4X9D A;  2FL7 A;  3INZ A;  3GNF B;  2RD1 A;  1ZUK A;  1G3Y A;  1IGQ A;  1N9S A;  2LCL A;  1ZA1 B;  2HQE A;  2NWM A;  1R0C B;  3LWH A;  2DL7 A;  2HL5 C;  1YI2 A;  2AKL A;  3REA B;  3I5S A;  1RI9 A;  3FJ5 A;  5GAN j;  1FX7 A;  1YJN T;  2K3X A;  1GCP A;  2XD0 A;  5FU6 C;  1VQ7 T;  1JQQ A;  1KQS A;  1VUB A;  1M8M A;  2DM1 A;  8AT1 B;  2BE9 B;  1EIF A;  4M77 G;  1G3W A;  1OOT A;  4A53 A;  5LJ3 g;  2KRN A;  5LJ5 j;  2ROL A;  3MEV A;  3VS6 A;  3CCQ T;  2ED0 A;  3CCV Q;  1Q81 U;  2GFU A;  3BDL A;  2CDT A;  2K5F A;  3DKM A;  8ATC B;  2E6Z A;  1OU9 A;  1TG0 A;  2DTI A;  3HPW A;  5GAO q;  3RKY A;  3SDZ A;  4FYW B;  2K7A A;  4C92 E;  3L2U A;  3JAM E;  1RAH B;  1YJW A;  3CPW A;  3OMG A;  4M78 B;  3OW2 S;  3CCU T;  1D3B A;  2QA4 Q;  3RIR A;  4AMC A;  3E1S A;  2JT4 A;  1YHQ T;  4J9D A;  2QDL A;  3I9Q A;  3OYD A;  2DLP A;  2RI5 A;  1AT1 B;  1W4S A;  1YN8 A;  1PNJ A;  1NLO C;  2QQR A;  2RI2 A;  3E9F A;  1VA7 A;  4M77 F;  2SRC A;  5IXB A;  5CVI A;  3HRS A;  3C94 A;  1E7O A;  1NE8 A;  4LUE A;  2V8I A;  3SHW A;  3WXM B;  2J05 A;  2RI3 A;  1KQS P;  2OAU A;  3RER A;  2RM4 A;  1QWF A;  2HDA A;  2XID A;  2XKO C;  4KH0 B;  2KE9 A;  1QVG A;  4LE9 A;  1H3Z A;  2X3X D;  1WPY A;  1VQ9 Q;  1WJS A;  1MMG A;  1BBZ A;  3M0S A;  1PD1 A;  3GP8 A;  4OF1 A;  4X9C A;  2L3Q A;  1NBE B;  1GCQ A;  3GF5 A;  1ZUY A;  2EYY A;  3M58 A;  4DA4 A;  1X27 A;  2DL3 A;  4PJO A;  3EHQ A;  2GCX A;  2OX7 A;  1OUL A;  1JJ2 A;  3CPW P;  1W2B S;  1PWT A;  1RLP C;  1N8R R;  1Q86 R;  4OP0 A;  4M75 A;  1WJQ A;  1QP3 A;  2M0Y A;  4PFZ A;  1MGQ A;  3M0Q A;  4JZ3 A;  4OML A;  4C8Q F;  1Q7Y U;  3M4G A;  2WSE E;  1BYM A;  2JMA A;  1I1J A;  3PIO A;  2YDL A;  2E5Q A;  1VQL Q;  4ZGD B;  2DO3 A;  2ENM A;  4DBH A;  3CCM Q;  1RAG B;  3JSC A;  1OI1 A;  3EGU A;  2VWF A;  5KH6 A;  2W0Z A;  3P8B B;  1W1F A;  2C0T A;  4GLM A;  1MV3 A;  3G1J A;  1XNI A;  3OS0 A;  3H8Z A;  4ELZ C;  3RNJ A;  1N6A A;  2CP2 A;  4LDV A;  2F5T X;  3SD4 A;  2IG0 A;  2P4R A;  5DM7 R;  4M77 C;  1AHJ B;  1TUC A;  1NLP C;  3M0R A;  2JS0 A;  2MAM A;  4LNP A;  3G71 T;  3MEU A;  1NPR A;  4PL6 A;  3NFC A;  4IUT A;  3OYJ A;  1VQP T;  1BI1 A;  1G83 A;  2ED1 A;  2ECZ A;  1UE9 A;  2RQT A;  3CC7 T;  3R6O A;  4E7H A;  1I81 A;  2DZC A;  2O4X A;  5KYW A;  4D6W A;  3FDR A;  1FWZ A;  4OB1 B;  1NPP A;  4BI4 A;  4LD9 K;  3OQ5 A;  3SWN C;  2DMO A;  4F7U G;  3Q1J A;  4M7A A;  2FRY A;  2RJE A;  5CO7 A;  4BUG A;  1NM7 A;  4CRI A;  2DKG A;  3VS3 A;  2R57 A;  2QI2 A;  1IRX A;  2H3J A;  4M77 D;  1AWW A;  4C0G A;  4BE0 A;  4OB2 B;  1ZHI A;  2EYX A;  1X6G A;  5M9O A;  5D6X A;  4OMP A;  1SSH A;  2QEX Q;  1G5V A;  3A8M B;  5GAN 6;  5KE2 A;  3WVE B;  4D8K A;  2JZ2 A;  3QYG B;  4TVR A;  2KNB B;  1QLY A;  1KQ2 A;  2OTJ T;  4KGZ B;  3S3O A;  1C0M A;  4C92 B;  1UJ0 A;  2EGE A;  2DXB A;  2CZ1 B;  1ZQ1 A;  2O01 E;  1VQN T;  4QVZ A;  3QXE B;  2JVV A;  2E4H A;  2J7I A;  2GTO A;  4C5I A;  1K76 A;  2A36 A;  1WZO A;  2AHJ B;  3OSS C;  1RL2 A;  1SF9 A;  1PKT A;  1MND A;  1KG1 A;  2RJF A;  3MJX A;  2DNU A;  4JLG A;  1KK7 A;  4PLL A;  3OBW A;  5GAO m;  2XDB A;  2KAF A;  4RTY A;  2DL8 A;  1K9A A;  3JCM e;  1TUD A;  4JRQ A;  3HKS A;  4MDW A;  1D0X A;  3CCE T;  1WA7 A;  3JCM c;  1VQP A;  2X51 A;  3VS1 A;  3JCM W;  4C5E A;  3URG A;  2D6F A;  2HMA A;  3JCM V;  3PT9 A;  1BKB A;  1S72 Q;  1M30 A;  5GAM f;  4MDX A;  3MCA B;  1QVG S;  2VV5 A;  3FRN A;  3OYN A;  1Q81 C;  4J6W A;  2DER A;  4J7I A;  5DY9 A;  1TU0 B;  2LJ1 A;  3VJP A;  3HP9 A;  4A4E A;  4F16 A;  3CMA T;  3ZBD A;  1QWE A;  4IKF A;  4QQ6 A;  3NGP A;  1K73 R;  3UT1 A;  3VS2 A;  3M9Q A;  1WNL A;  1WYX A;  1JJ2 S;  2HNI A;  4M7D E;  3BDU A;  4E7J A;  1NJI U;  4ZN3 A;  4CC7 A;  2IIM A;  3VYG A;  1XJW B;  2KYB A;  3CCR Q;  3MPU B;  4KGX B;  5FU7 B;  3A8G B;  2FPF A;  2D0N A;  4FIB A;  1T3S A;  2EKH A;  1TSF A;  2O9V A;  3OA6 A;  2GGR A;  2RB6 A;  2JTF A;  5GAN 4;  1TWB A;  3QG1 A;  4M77 A;  2RO0 A;  3LWI A;  4ZTF A;  1AWO A;  4YTL A;  4HVU A;  5I2M A;  1YWP A;  2ABL A;  4C8Q B;  2DZ9 A;  3QWY A;  1VQN A;  4OMQ A;  3TCJ A;  1WXU A;  1H8K A;  2JOY A;  1QVF A;  1YJ9 T;  3TEE A;  3OMC A;  3UWN A;  1AWX A;  2DX1 A;  1S1N A;  3DB4 A;  2L3R A;  3LH0 A;  1VQ6 Q;  2EGC A;  2NUP B;  1M1F A;  3SWN A;  2M16 A;  5IHI A;  1VQK T;  4PJJ A;  3GIB A;  2XMF A;  1YIJ T;  2G6F X;  2GFA A;  5HY6 A;  2SEM A;  5A0D A;  1Y96 B;  5KCO A;  2V1Q A;  4ZTJ A;  2WAC A;  2A08 A;  2VUB A;  3CME T;  4IUU A;  5IT9 E;  1ABO A;  1M3C A;  4QVC A;  2VAS A;  2KYM A;  1UFF A;  1U06 A;  2LT1 A;  4HA8 A;  1VQ4 Q;  5GAM d;  1EZZ B;  3I56 T;  1M1K U;  1WGS A;  2LMJ A;  2HQX A;  2L3P A;  1XQH A;  2RQW A;  2CZ7 B;  1T0H A;  3CQT A;  2GBQ A;  1YJW Q;  2EKO A;  4FW1 A;  1IHV A;  1OX8 A;  3V8L A;  4PJO F;  1YNZ A;  3MO8 A;  1UHC A;  3WVD B;  3PNW C;  1M1G A;  5I22 A;  4ATO A;  4L5G A;  3OW2 A;  3UAT A;  2FHD A;  1QVF P;  5CKH A;  1NEG A;  3A98 A;  2VC8 A;  2OTL A;  2KI7 A;  2EPD A;  4FYV B;  4M75 F;  4HT9 A;  2DL4 A;  5FWB A;  2RA2 A;  3CCL T;  2A28 A;  2BKD N;  2CH4 A;  1X2K A;  2RH2 A;  2XIC A;  2CP0 A;  5CQY A;  2X3W D;  1M2V A;  4N4G A;  2HCK A;  2A7Y A;  2LVM A;  5GMK e;  4M7A G;  2GTJ A;  5KYX B;  5GAO l;  1T0J A;  1PHT A;  5FRN A;  1FYN A;  3HHT B;  2COZ A;  5I11 A;  3FIF A;  1BIA A;  1TH7 A;  1VQO A;  3G4S A;  4J5Y A;  2P0K A;  2QAZ A;  2JUF A;  2JW4 A;  4E7L A;  2D9T A;  1PSE A;  1ZBX A;  1MHN A;  2LQW A;  2KSS A;  1UGR B;  2LJ0 A;  1VQK A;  5A0G A;  1YIT Q;  3EFR A;  1YIJ A;  1G2B A;  9ATC B;  1IB8 A;  2YUP A;  4PJN A;  4BAC A;  1PSF A;  3CCS A;  4OB3 B;  2MIO A;  2R58 A;  1W2B A;  1LCK A;  2DIQ A;  1Y07 A;  2KRM A;  3OW2 P;  2MCN A;  2CYZ B;  1TTH B;  4M7A F;  5LJ3 h;  4AFS C;  1AOJ A;  3VS7 A;  1GCQ C;  2HBW A;  3EG9 B;  3HL8 A;  4XQ3 A;  2HSE B;  4M7D B;  1VYU A;  1SHG A;  2MWO A;  1RAC B;  4M78 C;  2DK3 A;  4F7U A;  1MMN A;  6AT1 B;  4A4F A;  2E1H A;  4OMF B;  1K4U S;  2RMO A;  2DTH A;  3LGF A;  1BCM A;  3TVT A;  1BK2 A;  3H9N A;  2WSC E;  4FT4 A;  1M90 U;  1FMW A;  1B34 B;  4XTZ A;  2F2X A;  2QXF A;  3QDF A;  1WHM A;  1QW1 A;  3PFS A;  5GMK m;  2CZ0 B;  3CCL A;  1MNE A;  2BZX A;  4OGE A;  1QVF S;  1VYT A;  3I55 A;  3OYM A;  3CBM A;  2PUK B;  1TUG B;  3VS0 A;  3X24 B;  1I8F A;  2DRM A;  5FWC A;  2XDD A;  3ME9 A;  2X4X A;  3GBQ A;  2HKN A;  4M75 D;  1LNX A;  4DQ2 A;  5CKE A;  4DEY A;  2J6K A;  4PKC C;  1Y7X A;  3M0U A;  3QHS A;  1OEB A;  1W2B P;  5KYY A;  2PU9 B;  1N9R A;  2FRW A;  2ZPG B;  2ESW A;  2FZC B;  2V8K A;  2YRD A;  4OMM A;  4FYX B;  2HL3 A;  1IO6 A;  2K2M A;  4LUD A;  2ZAE A;  1WHK A;  2OJ2 A;  2RHZ A;  4M7A C;  2LQN A;  3KXT A;  1Q81 R;  2EQU A;  2PZ1 A;  5GAN e;  3MP6 A;  3HSB A;  1CKB A;  2VVK A;  2CUB A;  4PNO A;  4AFZ C;  3RMQ A;  1VQM T;  3OS1 A;  4JUV A;  3QWX X;  1U3O A;  4C0D B;  2NUT B;  2JNG A;  5LJ3 j;  5LJ5 e;  2RHU A;  2DVE A;  3EGD A;  2QK0 A;  2RN8 A;  4MZP A;  3TSW A;  3JCM b;  2C06 A;  1WQW A;  4Y28 E;  2PVG B;  3QII A;  3L2V A;  2XU8 A;  4ZGE B;  4QQG A;  1ZSG A;  4M7A D;  4N4I A;  3A5Z B;  5KE3 A;  2KXD A;  1GBQ A;  3CC2 T;  3EG2 A;  3CC4 Q;  2D8J A;  2MWP A;  3H41 A;  3JCM f;  1WX6 A;  2K5I A;  5LL6 S;  1RAI B;  4EMK B;  1VQP Q;  1LJO A;  2HZY A;  4ZNX A;  1C1A A;  1IXD A;  2VYT A;  3O8V A;  4XTV A;  1D09 B;  2FG0 A;  2PVD B;  1ZLM A;  2DBM A;  2PVO B;  4JJN K;  4OVA A;  4J9H A;  3LW5 E;  4P5N A;  3RUX A;  2RPN A;  3NHN A;  1GXI E;  1PG5 B;  3V7R A;  3DLL A;  4M77 E;  3TQ7 P;  2MMP A;  1BCO A;  4Q5W A;  4QW2 A;  4JRP A;  3CEY A;  4RMO A;  3VU3 C;  1KJW A;  3LH5 A;  3H0H A;  4RG2 A;  3CBP A;  3E2U A;  1YJN A;  3FC3 A;  1U8R A;  1VQ7 A;  4M78 A;  2E70 A;  3M55 A;  4M4Z A;  4DEX A;  2EWN A;  2VB6 A;  3RR6 A;  1I07 A;  2XDP A;  2WSF E;  2DA9 A;  2E3H A;  4JJC A;  3C95 A;  2CKK A;  4FM4 B;  4II1 A;  2P0Q A;  3VS5 A;  3CCQ A;  1YBY A;  2LC4 A;  1KIK A;  5FU6 B;  3HRU A;  3JCM X;  1VQM A;  1VYV A;  2P4T A;  1RI0 A;  1VQN Q;  2L89 A;  4XU1 A;  3QJY A;  2CZ6 B;  4HXJ A;  1R77 A;  1B07 A;  2KRS A;  5GAN 2;  1KC8 C;  1N8R U;  3JB9 I;  2RHY A;  4C8Q E;  1Q86 U;  4JJB A;  5GMK l;  3CCU A;  2BZ8 A;  2YRC A;  2DD4 A;  1YHQ A;  3JB9 H;  4QKU A;  3LLR A;  1K8A R;  5FW9 A;  1IGU A;  2CP3 A;  2V1R A;  4J9C A;  2LRQ A;  1V1C A;  1QVG P;  1SPK A;  2QA4 T;  2L5Q A;  2LQ8 A;  3T9N A;  3SEM A;  2M9U A;  4BI3 A;  4DOV A;  3PE0 A;  3F70 A;  3CC2 A;  2FPE A;  7AT1 B;  4GLK A;  3JCM d;  1BB9 A;  1KD1 R;  2RHX A;  1OPK A;  3VRY A;  2BE7 D;  4AFQ C;  1OX9 A;  1AD5 A;  1Q82 C;  1JJ2 P;  1PKS A;  2CT4 A;  1JRI A;  1VOM A;  1VQ8 T;  2GNC A;  4CC3 A;  2L2P A;  3L2W A;  2O9S A;  2AK5 A;  1UG1 A;  1ZBJ A;  2QDY B;  3MP8 A;  1ZA2 B;  3QZ9 B;  1VQ9 T;  1WHG A;  3HFN A;  3PMT A;  2QG9 B;  2OTL Q;  3S3N A;  2YLC A;  5IAY A;  3CCJ Q;  5AT1 B;  3OYL A;  1X6B A;  1MV0 B;  3ZL7 C;  1K9M C;  1U5S A;  4WCI A;  1J3T A;  1RAF B;  2I2L A;  4E2F B;  1EFN A;  1OYX A;  4BDY A;  3EFO A;  4E7K A;  3QBY A;  4KUL A;  1NG2 A;  2EJ9 A;  4F7U F;  5D6Y A;  2DD5 A;  2JJ9 A;  3JCM g;  2MYS A;  1B3Q A;  2EJG A;  3A8O B;  1VQL T;  2JN0 A;  1VQO Q;  4Z89 A;  2PQW A;  3G4S Q;  4NL3 A;  3CCM T;  4JS5 A;  4PJM A;  5CR2 A;  5D6W A;  4OB0 B;  2KEA A;  1HJD A;  3OYF A;  1D0Y A;  3H6Z A;  1VQK Q;  3V8J A;  2QA4 A;  2J6O A;  3IQL A;  3G71 A;  5IXF A;  3G6E T;  4JZ4 A;  3CC7 A;  5GJW B;  3CCS Q;  3EFS A;  2LTO A;  5GAO r;  4M77 B;  3OBY A;  1ZSZ C;  1V76 A;  1WQ7 A;  4EMH A;  3M54 A;  3CD6 T;  3ASK A;  2E41 A;  4LD6 A;  5CKF A;  4IUQ A;  2J6F A;  4RTZ A;  4JDS A;  4RTU A;  1VQ8 A;  1BIB A;  1CSK A;  1WIE A;  3VS4 A;  2FPD A;  2X35 A;  1UGQ B;  3BW1 A;  4IIM A;  3QSU A;  3VKI A;  1O75 A;  3OS2 A;  1UUE A;  2LP5 A;  2DEU A;  2AIR B;  2VGN A;  5D7U A;  3SWN B;  1Z9Z A;  4J83 A;  4LDU A;  3OYK A;  2D1X A;  3MET A;  2QTX A;  1OU8 A;  2QGF B;  1K73 U;  2QEX T;  2OTJ A;  5HCK A;  4JJD A;  3I55 Q;  3O5Z A;  4EDU A;  2O2O A;  4IUP A;  3MHX A;  3DB3 A;  2P0P A;  1K1Z A;  3V8K A;  1VQL A;  3EHR A;  1YI2 Q;  4MML A;  4M78 G;  4VUB A;  2W10 A;  4RG8 A;  4KT0 E;  2CT3 A;  2EYW A;  3OS5 A;  5GAM h;  2LX9 A;  2X4J A;  2OI3 A;  1GFC A;  3CCE A;  5C0M A;  1M27 C;  5FRM A;  3UF4 A;  2LZ6 B;  1ZUU A;  2FO0 A;  3KUF A;  4X1V A;  3G6E A;  3EGX B;  3NTI A;  2LX7 A;  2DFU A;  1YFN A;  2ZGW A;  2K9G A;  5GAO n;  2EYZ A;  1Q7Y C;  5GAN f;  2DBK A;  1AEY A;  4DBR A;  1QCN A;  2ROT A;  3V7S A;  1R8O B;  1D1A A;  3CD6 A;  4DOW A;  3BFM A;  1S72 T;  4FSS A;  4HCB A;  1SHF A;  3CMA A;  3QJ6 A;  5A2Q E;  2C0I A;  4ZGJ B;  1OZ2 A;  5LJ5 f;  4XTX A;  1N8R C;  1I4K 1;  4FYY B;  2D8H A;  3ULR B;  4A4G A;  1FMK A;  3TRE A;  1QKW A;  4M78 F;  2KVQ G;  2FVU A;  2LCC A;  1C6V X;  1GRI A;  2JTM A;  2KDS A;  2QQS A;  3RKX A;  3S6W A;  2AT1 B;  2M51 A;  3D7S B;  4AFU C;  2VXF A;  1KQ1 A;  2DE0 X;  1LPL A;  4J9B A;  2EQM A;  2EFI A;  4PJO E;  2LDM A;  4V2S A;  1AVZ C;  3C0C A;  2M0O A;  3CCR T;  3LYI A;  2QQ9 A;  1HXD A;  1X43 A;  3PMI A;  4OMN A;  5FRO A;  5GAN 3;  1UB4 A;  2LNH B;  2NYS A;  4KRT A;  4BY6 C;  1KC8 R;  1Y96 A;  4HVV A;  1SG5 A;  4PLI A;  1WJR A;  3CBO A;  4XU0 A;  4OMO A;  2JM8 A;  4M75 E;  5FLX E;  1ARK A;  5GAN 8;  2KR3 A;  2KQW A;  1YJ9 A;  1YCY A;  3MEW A;  4RTX A;  1YWO A;  3OYH A;  2AZV A;  2ZPE B;  4F7U B;  1ZSZ A;  5GAM g;  2BIV A;  1TXQ A;  1UGP B;  2P84 A;  3G7Z A;  1PRL C;  3OY9 A;  1LVK A;  3OB9 A;  2I0N A;  2KBT A;  1YJN Q;  2DRK A;  1VQ6 T;  1VQ7 Q;  5AYF A;  4JRK A;  2Y4Y A;  4F17 A;  3C4S A;  5GAN h;  3GPL A;  4XU2 A;  4KGV B;  4LN2 A;  5GAM j;  3E9G A;  1Q82 R;  1I5O B;  3QUI A;  1X2Q A;  4RTW A;  2X9H A;  3CXC S;  3BE3 A;  3CME A;  2K57 A;  1M3A A;  3CCQ Q;  2CGH A;  2DPP B;  5KYU B;  1MUZ A;  5KYN A;  2DAQ A;  5DLO A;  3I56 A;  3FB9 A;  1VQM Q;  5GAN d;  4O5V A;  1D0Z A;  4NL2 A;  3OYE A;  4GBQ A;  1QCF A;  4UC4 A;  1TS9 A;  1S72 A;  3P8H A;  1LOJ A;  1VQ4 T;  2GQI A;  4FT2 A;  1HD3 A;  3CCU Q;  1M4Z A;  5KYY B;  1YHQ Q;  5LJ5 d;  4M7A E;  2IPO B;  4HCC A;  2QGG A;  2K6D A;  2G3R A;  1YJW T;  1K9M R;  2AZS A;  4K11 A;  3J80 E;  2RNA A;  4XAX B;  1BI2 A;  2DXT A;  2H8H A;  3QYH B;  4FCY A;  4C5H A;  1WHH A;  4C0Z A;  3PTA A;  1E6G A;  1Y0M A;  1WI7 A;  3CCR A;  1HSQ A;  3EH1 A;  4NS5 A;  3UDC A;  1KHI A;  2JXB A;  4M78 D;  4C92 G;  3JB9 J;  3X28 B;  2LQK A;  2PNI A;  4LDW A;  3THK A;  5IH2 A;  2EQI A;  3NPF A;  4BD3 A;  2ZCF B;  3QDR B;  2IVW A;  1H92 A;  3TU4 K;  5J26 A;  1ACM B;  2K3Y A;  2KT1 A;  1RAD B;  3FEO A;  1KFZ A;  1D3B B;  3EGD B;  4C0F A;  2EYQ A;  4M7D A;  5GAN g;  4ME7 A;  4Z88 A;  5IHN A;  3EAE A;  1NJI C;  4RTV A;  4ZN1 A;  1M8V A;  3GOX A;  1WHJ A;  1VQ6 A;  2YRV A;  2K5L A;  2E65 A;  2FZK B;  3A8H B;  1IZ6 A;  2E10 A;  3V7C A;  1BI3 A;  2ZPH B;  3NMZ C;  5LJ5 g;  2COY A;  1YIT T;  2B86 A;  1K73 C;  1B34 A;  2F2W A;  4HKE A;  1X69 A;  2C0O A;  5DLQ E;  2BZY A;  5IHK A;  3M4Y A;  2HQH A;  4C92 F;  3FLG A;  4LDY A;  3QZ5 B;  2VXE A;  1AZE A;  2OAW A;  2EVR A;  3L2R A;  5CKB A;  3ZEH A;  3JB9 G;  1X6O A;  4E7S A;  2DJZ A;  2HKQ B;  3EG3 A;  1VQ4 A;  2CP7 A;  2KK4 A;  4B9W A;  2A37 A;  1PD0 A;  1H64 1;  5LJ3 e;  4PJO B;  3OYI A;  1BU1 A;  4BE2 A;  2XG8 D;  5GJV B;  1VQ5 T;  2YWW A;  2E3I A;  3G71 Q;  1EX4 A;  1A0N B;  1QCO A;  4HCZ A;  4EMG A;  1BI0 A;  4M75 B;  3C12 A;  3OYA A;  2MI6 A;  1NEB A;  3CC7 Q;  1ABQ A;  4CI0 C;  3A8L B;  2RQU A;  2H3E B;  1D1C A;  4JPB W;  5A0L A;  4E7Z A;  1KSW A;  1F1B B;  2ZPI B;  3AHU A;  2DIG A;  5HK3 A;  2KMT A;  2DYB A;  4A54 A;  2ZZD A;  4Y91 A;  5ECA A;  1M1K C;  4PK4 A;  4C8Q G;  3JB9 F;  4XTU A;  1M9S A;  5C6S A;  1VQ8 Q;  3M57 A;  2XHC A;  1I5L A;  1M2O A;  2RJD A;  3DLM A;  2NUT A;  4MZT A;  4RCC A;  2JM9 A;  4AG1 C;  2CSQ A;  5I2S A;  3JCM P;  1Q7Y R;  2M1H A;  4Z02 A;  2L0A A;  4C92 C;  2CH4 W;  4ELY C;  3NTH A;  2OTJ Q;  2K2V A;  2XI9 A;  4CC2 A;  4JLI A;  1YIT A;  2YUO A;  2O4X B;  5KYW B;  1D1B A;  4WF2 A;  2MK5 A;  1JO8 A;  1HYO A;  5CIU A;  3N5B B;  5GAO p;  4Z8A A;  4EMK A; 
#chains in the Genus database with same CATH homology
 3M53 A;  1G3Y A;  4ATO A;  4L5G A;  3OW2 A;  4M7A B;  3CC7 A;  1N9S A;  2LCL A;  3CCV T;  2DTO A;  2FHD A;  4IUV A;  2HQE A;  3EFS A;  5CKH A;  2LTO A;  2XK0 A;  5GAO r;  4KBM B;  3RMS A;  2VC8 A;  4M77 B;  3LWH A;  2ZPF B;  2MF2 A;  3OBY A;  2OTL A;  4M75 F;  1WQ7 A;  4EMH A;  3GLX A;  3M54 A;  4HT9 A;  3CD6 T;  3ASK A;  2E41 A;  2RA2 A;  4LD6 A;  5CKF A;  3CCL T;  4IUQ A;  3JCM h;  1YI2 A;  4JDS A;  5GAN j;  1FX7 A;  2BKD N;  1YJN T;  2K3X A;  2RH2 A;  2R5A A;  2XIC A;  2XD0 A;  5FU6 C;  1VQ7 T;  1BIB A;  1VQ8 A;  5CQY A;  2V8J A;  4C92 D;  1KQS A;  4N4G A;  1VUB A;  2X35 A;  1UGQ B;  2A7Y A;  2LVM A;  5GMK e;  3BW1 A;  3QSU A;  4M7A G;  3VKI A;  1O75 A;  1X75 C;  3OS2 A;  1Q7Y U;  2GQV A;  1VQ5 A;  4X34 A;  5GAO l;  1EIF A;  2LNV A;  4M77 G;  1G3W A;  5FRN A;  4A53 A;  5LJ3 g;  3HHT B;  5LJ5 j;  2VGN A;  3SWN B;  3MEV A;  3VV0 A;  3FIF A;  1BIA A;  1TH7 A;  3CCQ T;  1Q81 U;  1VQO A;  2GFU A;  3CC4 T;  3BDL A;  4IUR A;  3G4S A;  1K8A U;  4J5Y A;  2P0K A;  2K5F A;  3DKM A;  4J83 A;  4LDU A;  4J6Y A;  2JUF A;  3OYK A;  4E7L A;  2E6Z A;  2EJF A;  3HPW A;  2DTI A;  3MET A;  2QTX A;  5GAO q;  2D9T A;  1PSE A;  3RKY A;  1ZBX A;  4XTY A;  3SDZ A;  1MHN A;  3X26 B;  2QEX T;  1K73 U;  4C92 E;  3L2U A;  2OTJ A;  3JAM E;  2EQJ A;  2KSS A;  1YJW A;  1UGR B;  2A3L A;  3CPW A;  1VQK A;  3OMG A;  5A0G A;  3EFR A;  4M78 B;  3OW2 S;  3CCU T;  1YIJ A;  1D3B A;  3RIR A;  3GNF B;  4EDU A;  3E1S A;  1YHQ T;  3OYD A;  4IUP A;  1KD1 U;  5CKD A;  2ZPB B;  2RI5 A;  4BAC A;  1PSF A;  3MHX A;  3CCS A;  4OB3 B;  1W4S A;  2R58 A;  3DB3 A;  1W2B A;  2DIQ A;  1Y07 A;  5FU7 C;  1M90 C;  2P0P A;  2X4Y A;  2NLU A;  3V8K A;  2CYZ B;  4M7A F;  1VQL A;  5LJ3 h;  2QQR A;  2RI2 A;  3HL8 A;  3E9F A;  1KQS S;  4MML A;  4M78 G;  3JB9 D;  4M77 F;  4XQ3 A;  4VUB A;  4M7D B;  4RG8 A;  4KT0 E;  3VYH B;  3OS5 A;  4EPC A;  2MWO A;  3HRS A;  5CVI A;  3JCM J;  1X01 A;  3C94 A;  4M78 C;  2DK3 A;  4F7U A;  5GAM h;  1NE8 A;  4C8Q C;  2LX9 A;  2V8I A;  4A4F A;  3WXM B;  2E1H A;  2RI3 A;  2X4J A;  4JRI A;  3CCE A;  2OAU A;  3RER A;  4OMF B;  5C0M A;  2RM4 A;  2DTH A;  5FRM A;  3LGF A;  3KUF A;  4E47 A;  2XID A;  2Y90 A;  1VIF A;  2XKO C;  3G6E A;  3NTI A;  1QVG A;  2WSC E;  4FT4 A;  3JRZ A;  1H3Z A;  1M90 U;  2ZGW A;  4L59 A;  1VIE A;  3CCV A;  1WPY A;  4QQD A;  5GAO n;  1WJS A;  1Q7Y C;  1B34 B;  4XTZ A;  2QXF A;  5GAN f;  4M7D G;  1P92 A;  3KBG A;  1QW1 A;  3PGG A;  3PFS A;  3GP8 A;  5CAI A;  4OF1 A;  2E6N A;  3CPW S;  4X9C A;  5HKC A;  5J3B A;  2RJC A;  3V7S A;  1R8O B;  2CZ0 B;  5GMK m;  2HAX A;  3GF5 A;  4DOW A;  3OYC A;  3BFM A;  3CD6 A;  3M58 A;  4DA4 A;  3CCL A;  4OGE A;  1QVP A;  2R5M A;  3FJP A;  1S72 T;  4PJO A;  4HCB A;  3CMA A;  3ER0 A;  1XTD A;  1QVF S;  2GCX A;  3QJ6 A;  4F7U E;  3I55 A;  3OYM A;  5A2Q E;  5GAN 7;  3CBM A;  2PUK B;  4ZGJ B;  3X25 B;  1OZ2 A;  1QP2 A;  5LJ5 f;  1JJ2 A;  4XTX A;  1W2B S;  1I4K 1;  1N8R C;  3X24 B;  1NZ9 A;  4A4G A;  3TRE A;  1I8F A;  1DJ7 B;  2RK2 A;  4OP0 A;  4M75 A;  4C8Q D;  4M78 F;  1WJQ A;  2KVQ G;  2XDD A;  1QP3 A;  2D0Q B;  3L2Z A;  2FVU A;  2X4X A;  3ME9 A;  1MGQ A;  4C8Q F;  2LCC A;  4KUI A;  2JTM A;  4M75 D;  5IN1 A;  1LNX A;  2KDS A;  2QQS A;  4NOY A;  5CKE A;  3M4G A;  2DEQ A;  3RKX A;  3S6W A;  4DQ2 A;  2WSE E;  1BYM A;  4PKC C;  1Y7X A;  3QHS A;  4RCB A;  3PIO A;  2PU9 B;  2E5Q A;  3CC4 A;  1N9R A;  2VXF A;  2ZPG B;  4XK8 E;  1KQ1 A;  3PIP A;  4ZGD B;  3CXC A;  2DO3 A;  2F69 A;  5GAN 5;  2EQM A;  2V8K A;  2EFI A;  4C92 A;  3JSC A;  2YLB A;  1OI1 A;  4PJO E;  2LDM A;  5J39 A;  4V2S A;  5KH6 A;  3P8B B;  2M0O A;  3CCR T;  3LYI A;  2QQ9 A;  1HXD A;  3PMI A;  5FRO A;  5GAN 3;  1XNI A;  1UB4 A;  1FXX A;  4FU6 A;  1OZ3 A;  4M7D F;  4BY6 C;  1JB0 E;  1QVF A;  1Y96 A;  3OS0 A;  3H8Z A;  2RHZ A;  1U1S A;  4ELZ C;  1N6A A;  4PLI A;  1WJR A;  3CBO A;  1V29 B;  4LDV A;  4XU0 A;  4M7A C;  3KXT A;  2EQU A;  2F5T X;  4M75 E;  3SD4 A;  5FLX E;  5GAN 8;  4JS4 A;  2IG0 A;  2KQW A;  4XTW A;  5L8R E;  5GAN e;  3MP6 A;  1YJ9 A;  1YCY A;  5DM7 R;  4M77 C;  3HSB A;  3MEW A;  1AHJ B;  1VQ9 A;  4PNO A;  4J8O A;  2VGM A;  3SB2 A;  3E19 A;  3OYH A;  2ZPE B;  2MAM A;  3RMQ A;  2K4Y A;  4F7U B;  1VQM T;  3OS1 A;  3QO3 A;  3M56 A;  4BE1 A;  3G71 T;  3MEU A;  1NPR A;  4PL6 A;  3NFC A;  5GAM g;  2RK1 A;  4IUT A;  3OYJ A;  1VQP T;  1BI1 A;  1O9S A;  2BIV A;  4JUV A;  1UGP B;  3OYB A;  1IRE B;  3G7Z A;  4C0D B;  4J6X A;  5GMK h;  3OY9 A;  2QQA A;  3CC7 T;  3OB9 A;  3R6O A;  2JNG A;  5LJ3 j;  3OYY A;  5LJ5 e;  4E7H A;  1I81 A;  4R56 A;  2RHU A;  5I21 A;  2DZC A;  2O4X A;  3GNG A;  2OTL T;  1VQ6 T;  3CCJ T;  2DVE A;  4RKU E;  5AYF A;  4JRK A;  2Y4Y A;  4D6W A;  4KUD K;  3FDR A;  3C4S A;  1M5Q 1;  4A4K A;  5GAN h;  4MZP A;  3GPL A;  1FWZ A;  4OB1 B;  4XU2 A;  3JCM b;  1WQW A;  2C06 A;  1NPP A;  4BI4 A;  4LD9 K;  5GAM j;  3E9G A;  3OQ5 A;  4Y28 E;  3QUI A;  3L42 A;  3SWN C;  4N0A C;  3Q1J A;  4F7U G;  4M7A A;  2PVG B;  3QII A;  4J7F A;  3L2V A;  2XU8 A;  5CCA A;  4N4H A;  2RJE A;  5CO7 A;  4BUG A;  4ZGE B;  4QQG A;  3CXC S;  3CME A;  4CRI A;  2K57 A;  4M7A D;  4MZM A;  4N4I A;  2DKG A;  2R57 A;  3A5Z B;  5KE3 A;  2CGH A;  2DPP B;  2QI2 A;  3CC2 T;  2H3J A;  4M77 D;  2DAQ A;  2MWP A;  5DLO A;  3I56 A;  4C0G A;  3FB9 A;  3JCM f;  5GAN d;  3CCM A;  4BE0 A;  4HT8 A;  2K5I A;  4OB2 B;  4O5V A;  5LL6 S;  1ZHI A;  4EMK B;  1LJO A;  5M9O A;  5D6X A;  4NL2 A;  3OYE A;  2VYT A;  3O8V A;  4UC4 A;  4XTV A;  1S72 A;  3QPH A;  1G5V A;  2PVD B;  1LOJ A;  3P8H A;  1VQO T;  1VQ4 T;  3G4S T;  1UGS B;  3A8M B;  5GAN 6;  4FT2 A;  2PVO B;  5KE2 A;  3WVE B;  1M4Z A;  2JZ2 A;  3QYG B;  4OVA A;  4TVR A;  4PJO G;  4R55 A;  3LW5 E;  4JJN K;  4P5N A;  5KCH A;  3PNW C;  5LJ5 d;  4M7A E;  1KQ2 A;  2OTJ T;  3RUX A;  3SFM A;  4HCC A;  3S3O A;  4C92 B;  2G3R A;  1YJW T;  1GXI E;  3V7R A;  3DLL A;  2DXB A;  3J80 E;  4M77 E;  4XAX B;  2CZ1 B;  1BI2 A;  2BUD A;  2DXT A;  2MMP A;  5CK9 A;  1ZQ1 A;  2LT4 A;  4M75 G;  4Q5W A;  4QW2 A;  2O01 E;  3QYH B;  4JRP A;  4QVZ A;  3QXE B;  1VQN T;  2HD0 A;  3CEY A;  4M7D C;  4C5H A;  4RMO A;  3VU3 C;  2JVV A;  4C0Z A;  4RG2 A;  3CBP A;  3CCS T;  4C5I A;  1YJN A;  3FC3 A;  3PTA A;  2KY9 A;  3JCM Q;  2AHJ B;  3OSS C;  1U8R A;  4M78 A;  2RHI A;  1VQ7 A;  2E70 A;  3M55 A;  1RL2 A;  3CCR A;  4C8Q A;  4NS5 A;  3UDC A;  2EWN A;  1KHI A;  4M78 D;  3JB9 J;  4C92 G;  1Q86 C;  2XDP A;  1KG1 A;  2RJF A;  3X28 B;  2LQK A;  4LDW A;  1U1T A;  2WSF E;  4JLG A;  4PLL A;  3OBW A;  2ZCF B;  4BD3 A;  5GAO m;  2XDB A;  3QDR B;  2KAF A;  2CKK A;  3C95 A;  3CPF A;  1N27 A;  2IVW A;  4FM4 B;  2P0Q A;  1SSF A;  4II1 A;  3TU4 K;  5J26 A;  4XU3 A;  3CCQ A;  1YBY A;  3JCM e;  2LC4 A;  2K3Y A;  4JRQ A;  3HKS A;  5FU6 B;  5LJ3 f;  3FEO A;  3HRU A;  4MDW A;  3X20 B;  3MO8 A;  3JCM X;  1D3B B;  4C0F A;  1VQM A;  3CCE T;  2P4T A;  2EYQ A;  2X4W A;  3JCM c;  1RI0 A;  3HRT A;  2DXC A;  1JBM A;  1VQP A;  2FYK A;  4M7D A;  2L89 A;  4XU1 A;  5GAN g;  3AHU A;  3JCM W;  4ME7 A;  2F5K A;  2PUO B;  4C5E A;  3QKJ A;  3URG A;  3EAE A;  2QEX A;  3QJY A;  2D6F A;  2FB7 A;  3JCM V;  2CZ6 B;  3PT9 A;  4ZN1 A;  1BKB A;  1NJI C;  4M7D D;  1M8V A;  5GAM f;  4MDX A;  3GOX A;  3MCA B;  4M78 E;  3RES A;  2EQK A;  5GAN 2;  1QVG S;  1KC8 C;  3JB9 I;  1N8R U;  2RHY A;  2VV5 A;  3FRN A;  3VUB A;  4C8Q E;  5GMK j;  5GMK l;  3OYN A;  3BY7 A;  2YRV A;  3VUZ A;  3CCJ A;  3CCU A;  1Q81 C;  2K5L A;  1VQ6 A;  4J6W A;  2DD4 A;  1K8A C;  1YHQ A;  2E65 A;  3JB9 H;  2E12 A;  3A8H B;  1IZ6 A;  2E10 A;  3LLR A;  3V7C A;  3L2Q A;  1BI3 A;  1UEB A;  2ZPH B;  4J7I A;  5DY9 A;  5LJ5 g;  3VJP A;  3HP9 A;  4A4E A;  3CMA T;  3ZBD A;  2LRQ A;  1YIT T;  4IKF A;  1K73 C;  3I55 T;  1B34 A;  4QQ6 A;  4HKE A;  3UT1 A;  2QA4 T;  5DLQ E;  2L5Q A;  2LQ8 A;  3M9Q A;  3T9N A;  3M4Y A;  2M9U A;  4BI3 A;  4DOV A;  3UPU A;  4C92 F;  3F70 A;  3FLG A;  3CC2 A;  4LDY A;  3QZ5 B;  1WNL A;  4B9X A;  5GMK i;  1JJ2 S;  2HNI A;  4M7D E;  3BDU A;  3NTK A;  4E7J A;  2VXE A;  1NJI U;  4ZN3 A;  3MP1 A;  1XOV A;  4GLK A;  3L2R A;  1G3T A;  5CKB A;  3ZEH A;  3JCM d;  3JB9 G;  1KC8 U;  1KD1 C;  3ZFJ A;  3L1A A;  1X6O A;  3VYG A;  2RHX A;  4BB7 A;  2DJZ A;  3S3M A;  1VQ4 A;  5FU7 B;  2L8D A;  3A8G B;  1YI2 T;  1Q82 C;  3WVD B;  2KK4 A;  4FIB A;  4MMK A;  2GF7 A;  4B9W A;  1JRI A;  3OA6 A;  2B8A A;  1VQ8 T;  1H64 1;  2RB6 A;  2JTF A;  5LJ3 e;  5GAN 4;  3OYI A;  3QG1 A;  4M77 A;  4PJO B;  2RO0 A;  3LWI A;  2Y4X A;  3M5A A;  1KHC A;  3L2W A;  4BE2 A;  4ZTF A;  4YTL A;  2DXU A;  3J81 E;  5I2M A;  2XG8 D;  1VQ5 T;  5LJ5 h;  4C8Q B;  4C0D C;  2DZ9 A;  1VQN A;  3TCJ A;  4HCZ A;  2QDY B;  2JOY A;  3MP8 A;  4EMG A;  5GAM e;  1BI0 A;  2EAY A;  3C12 A;  4M75 B;  2EIF A;  2MI6 A;  3QZ9 B;  3RKW A;  3OYA A;  4O6J A;  1YJ9 T;  3M59 A;  3TEE A;  1VQ9 T;  3OMC A;  3UWN A;  3A8L B;  3HFN A;  4CI0 C;  4E7I A;  5A0L A;  4BDZ A;  3PMT A;  2ZPI B;  2L3R A;  3DB4 A;  2DIG A;  2YLC A;  3LH0 A;  4L6V 5;  2KMT A;  5IAY A;  5HK3 A;  3S3N A;  1Q82 U;  4C5G A;  4A54 A;  2ZZD A;  4FL6 A;  4GY5 A;  4Y91 A;  3OYL A;  1G3S A;  1M1F A;  2QQB A;  1M1K C;  4PJO C;  1K9M C;  3SWN A;  2M16 A;  4N0A A;  4C8Q G;  1VQK T;  3HFO A;  3GIB A;  3J7A F;  5HK0 A;  3JB9 F;  4XTU A;  2I2L A;  1M9S A;  5C6S A;  3OYG A;  1YIJ T;  1OYX A;  2XHC A;  3M57 A;  4QVD A;  4BDY A;  3OSV A;  4LDX A;  2GFA A;  5HY6 A;  4E7K A;  5CQX A;  5A0D A;  1I5L A;  1HK9 A;  1Y96 B;  3LGL A;  3QBY A;  5KCO A;  4KUL A;  4EMK C;  4M75 C;  2WAC A;  4ZTJ A;  2RJD A;  2EJ9 A;  3DLM A;  4F7U F;  5LJ3 d;  5D6Y A;  2DD5 A;  4MZT A;  4RCC A;  1Y71 A;  2VUB A;  3CME T;  4IUU A;  5IT9 E;  3JCM g;  4QVC A;  2EJG A;  5I2S A;  3A8O B;  1VQL T;  3JCM P;  2JN0 A;  2LT1 A;  4OGC A;  2E64 A;  4HA8 A;  2PQW A;  2M1H A;  5GAM d;  5EG2 A;  3LX7 A;  4Z02 A;  4NL3 A;  3I56 T;  3CCM T;  4JS5 A;  1M1K U;  1WGS A;  1K9M U;  4C92 C;  2HBP A;  4BI8 B;  5D6W A;  4OB0 B;  2HQX A;  3P8D A;  4ELY C;  3NTH A;  5CR2 A;  4FSX A;  2CS7 A;  1XQH A;  2CZ7 B;  1Q86 U;  2K2V A;  2XI9 A;  3OYF A;  2EKO A;  4JLI A;  1YIT A;  2O4X B;  3H6Z A;  2YHT A;  4WF2 A;  4PJO D;  3V8J A;  2QA4 A;  4A4H A;  3G71 A;  3V8L A;  4PJO F;  5CIU A;  3N5B B;  4BY6 B;  5GAO p;  3MEA A;  3G6E T;  4X9D A;  2FL7 A;  3INZ A;  2RD1 A;  4EMK A;  1M1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...