4MMKA

Q8a hfq from pseudomonas aeruginosa
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
b'SKGHSLADPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hfq
publication title Effect of conserved intersubunit amino Acid substitutions on hfq protein structure and stability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
total genus 15
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mmkA00
2DTOA 3QUIA 4M77C 2E65A 3JCMb 3BY7A 4PJOF 4HT8A 4HT9A 4M77G 1JRIA 4C92F 2YLCA 3V8KA 4C8QC 5GAN6 5I21A 5GAN8 5GAOl 2K57A 5GAOr 4M7AB 2YLBA 4C8QG 4NL3A 3RUXA 3JB9F 4M7AC 4M77A 3JB9H 4XTVA 4M7AG 4WF2A 3EFSA 2DZ9A 5GMKi 2DVEA 4C8QA 4JLIA 3M4GA 4M7DF 5GAMh 1H641 4M75D 3FJPA 1JBMA 5GANf 2VXFA 2EJGA 5LJ5j 1Y96B 4PJOD 3HFNA 3JB9J 4C92D 1YCYA 5GAN2 5GAN3 4HA8A 2DEQA 4N0AC 2Y90A 1HK9A 5LJ3j 2ZGWA 5GANg 5GAOn 4J6YA 3QSUA 2RA2A 3JB9D 4PNOA 4XU0A 4EMGA 2VC8A 1M5Q1 3HFOA 4M7DD 1U1SA 4QVDA 4N0AA 1Y96A 4XU1A 4C8QB 4J6WA 4JRIA 3RKYA 5GMKm 2RM4A 2FYKA 2E64A 5GAMf 2DZCA 5GANd 4JRKA 5GAOp 1WQWA 4M78F 3V7SA 2EJFA 3JCMQ 3AHUA 3QO3A 2DXUA 2EWNA 4M7AF 2RD1A 4M77E 3JCMe 3JCMh 4OP0A 5LJ3h 5GAMe 5GAOq 1KQ2A 4XU2A 4C8QE 1D3BA 4F7UF 1WQ7A 5GAN4 1I4K1 5GMKj 2DXTA 1HXDA 4A53A 2EAYA 5GAMd 4M78D 1BIAA 1I81A 2DKGA 1LOJA 4M7AD 4XU3A 4EMHA 4PJOC 5GANj 4PJOG 3BFMA 2CGHA 2JN0A 2E10A 4NOYA 4M75A 4X9CA 1LJOA 3JCMf 4M77F 2EJ9A 5LJ3f 5GAN7 3V8LA 3BW1A 3INZA 4PJOA 1D3BB 4C8QF 4C92A 5DY9A 3JCMV 3JCMg 5GAMg 1X01A 4X9DA 2E1HA 5LJ5e 5LJ5h 4EMKA 1N9SA 4M75F 3PGGA 4J5YA 2VXEA 3VU3C 2DTHA 5GMKe 5GMKh 5LJ3e 5GAN5 4M7DA 4RCBA 3L2ZA 3FIFA 3RIRA 1WNLA 3RKXA 4M77D 3QHSA 3V7CA 3V7RA 4M75B 4JUVA 2I2LA 3RESA 4C8QD 4XTXA 3JCMd 4QVCA 4M75C 4PJOB 4RCCA 4C92B 3EFRA 4M75G 4DQ2A 3JB9I 3GIBA 1WPYA 4C92C 4M78B 4XTZA 5GAOm 1TH7A 4C92G 5LJ5f 4EMKB 2HNIA 3SWNA 4XTUA 4M78C 3FB9A 2YHTA 3JCMJ 4M78G 1N9RA 4EMKC 5GMKl 4M75E 5LJ5g 4M7DB 3JB9G 4J6XA 2FB7A 1LNXA 1B34A 5CAIA 4M7DC 3JCMW 4F7UB 5LJ3g 4M7AE 4PJOE 4C92E 4M7DG 2DJZA 2QTXA 4M78A 4MMKA 3JCMX 3HSBA 4XTYA 1M8VA 3RKWA 1U1TA 4A54A 4M78E 4F7UG 4M7AA 4V2SA 2DTIA 1KQ1A 5GAMj 1MGQA 4NL2A 3JCMP 4M7DE 2E41A 1I8FA 3BDUA 4F7UA 5LJ5d 3L1AA 4MMLA 3SWNB 3V8JA 3RERA 4F7UE 5GANe 3JCMc 5GANh 5LJ3d 4Y91A 1BIBA 3SB2A 4M77B 4XQ3A 3SWNC 2RB6A 1I5LA 4XTWA 1B34B
chains in the Genus database with same CATH superfamily
3OYGA 1QW1A 3HPWA 4FYYB 4NL3A 1UG1A 2LQWA 3BDLA 1D1AA 4M7AC 4M7AG 5I2MA 4DOWA 2MOXA 3EG9A 1RUWA 4PKCC 1YJWQ 1OPLA 5LJ5j 1VQPT 3I55T 1KSWA 3A8GB 3TQ7P 3G4ST 4M7AE 4N0AC 1RAIB 3CCRQ 1YHQA 3CMEQ 2EGAA 1YJ9Q 3H0FA 1TXQA 2FHDA 2RJCA 2HQHA 2V1RA 2JVVA 3C12A 4E7JA 4HVWA 3CCUT 2ZPBB 1X27A 2JXBA 4ZN3A 2NUPB 1WGSA 4FL6A 3QYHB 1K8AR 1E6HA 5GAMd 1WDXA 8AT1B 4C0DC 3META 2A0FB 2PTKA 2R5AA 1QVFS 3CCQT 1VQ4Q 2XDBA 1NZ9A 1XTDA 2D0QB 4PJOA 3PMTA 2KROA 1JJ2S 2HAXA 3MEUA 3VS4A 3CCSQ 4DEYA 2D8JA 5GMKe 3VRYA 1TOVA 2OAWA 2LQKA 2YRVA 3M9QA 4Z8AA 2DETA 1VQOQ 3V7RA 4B9XA 3CMAA 1M2VA 1UDLA 3EH1A 2EKOA 1Y57A 1LNXA 1B34A 4ELYC 4B9WA 1ZSZC 4X34A 4YTLA 3CCLQ 1MMNA 4A54A 4M7AA 4ME7A 3MJXA 1OU8A 3BDUA 2BE7D 2JTFA 2JNGA 1I5LA 1VYVA 2DTOA 3M0QA 2E65A 5CKHA 1AWJA 1VQ7T 4Y28E 5FU7B 1IHWA 5CCAA 2P0KA 3LGFA 3SD4A 2DVEA 1Y0MA 3I5RA 4JLIA 3EHRA 1Y96B 2B8AA 3QSUA 3HRUA 3CC7A 3CPWS 2RA2A 4HCKA 2YUNA 1W6XA 2XDPA 3CC2T 4OB0B 2GFAA 4M7DD 1S72Q 1S1NA 4UC4A 3EG9B 1K1ZA 3PVQA 1NPRA 3V7SA 3M5AA 2DIGA 4M77E 1KQSA 1KQ2A 2GBQA 2K7AA 1WHHA 4LD6A 1M30A 1Q81U 5FRMA 2P4TA 4QQGA 3FC3A 4NOYA 5FU6C 1X6GA 5KYNA 1UGSB 1VQ9A 5HK0A 2X35A 5IAYA 2RNAA 1G2BA 2Y4YA 1VQ6Q 4RTVA 2VXEA 5GAN5 2MPXC 3TU4K 3G7ZA 4A63B 4PJOB 2CP2A 2MWPA 1WYXA 1KQSP 2VGMA 2QG9B 3VUZA 3VYGA 1HJDA 1IREB 2RHIA 1NEBA 3CCVA 4C5IA 4Z89A 1MV3A 5J26A 2LRQA 1M2VB 2JOYA 1TWBA 4FW2A 3L2QA 3P8BB 1MGQA 2KQWA 5KYXA 1YCSB 2E41A 2BTTA 3QZ9B 3QG1A 1Q81C 3H0IA 1VQMA 1B34B 1UGRB 2WSFE 3A8OB 3CMAT 2COZA 3OB9A 4M7AB 2YLBA 1SPKA 1KFZA 2E3IA 2EBPA 4M77A 2A28A 1V1CA 4L5GA 4A4HA 3UWNA 1QKXA 1H641 5A0DA 1PKTA 3CC4Q 4KH0B 3MEWA 1YJ9A 2XG8D 2IPOB 2J06A 3OYLA 1Z9QA 2KI7A 2C0TA 1RADB 1JO8A 2DJQA 3OQ5A 2XI9A 4PLLA 1B3QA 2GTOA 2RN8A 3OS2A 2EVRA 3JCMQ 3ME9A 3OSVA 1OU9A 2H3EB 1IGQA 2W10A 4E2FB 1WI7A 2F69A 2PVOB 5HKCA 1VQ4A 1SHGA 4C0DB 3CC7T 4XU3A 1BCOA 5GANj 2HCKA 2VB6A 4C5GA 4MZPA 3A8LB 5AT1B 1WX6A 3PVLA 3CCJA 2C06A 3JV3A 5LJ5e 1VQOA 3L2ZA 3DB4A 1M3AA 4E7IA 2J05A 1Q95G 2HSEB 1RACB 4E7KA 1RAHB 4CC4B 1VUBA 4C92C 4C92G 1NYGA 2CUDA 4Z88A 2R58A 2EQJA 4OB3B 3JCMJ 1KIKA 1ZSZB 3OYDA 1VQ9T 4JPBW 4C92E 2WACA 2KAFA 2RQVA 1M90U 4V2SA 2L5QA 3QWYA 2PVGB 3OSSC 1EIFA 2LCSA 4C0ZA 2VASA 2D1XA 1U06A 2DD5A 4MDWA 1VYTA 4OMQA 2PZ1A 4HXJA 3M0PA 1JRIA 2X4XA 1K0XA 1ZSGA 1PC0A 5HCKA 2KY9A 4GLMA 3VJPA 2DL4A 4WF2A 3X20B 3CBOA 2AKLA 3D7SB 2KNBB 4RTTA 4LDYA 3ASKA 3WVEB 5LJ3j 4RTYA 5KE3A 2AT1B 1WIEA 4BI8B 1WZOA 3G6EQ 3GP8A 2M0OA 2OTJQ 3E2UA 3MEVA 2M9UA 2BIVA 4F17A 4J6WA 4JRIA 5KYUA 2RM4A 4JJBA 1CKAA 4KT0E 1VQMT 4RG8A 4FSXA 3ZL7C 4M78F 2EJFA 3VS7A 1H8KA 2CP5A 3OYAA 2EYWA 5HK3A 5A0GA 2BZXA 1M90C 1D3BA 3I5SA 2MI6A 4O6JA 5GMKj 4A53A 2F2WA 1BIAA 4J9FA 3GBQA 1QVFA 2CH4A 5FU6B 3PIPA 2P4RA 1K0SA 2DLPA 1JJ2A 2VVKA 4DBHA 4RKUE 1RI9A 1E6GA 4C92A 1G8XA 5GAMg 3GF5A 2MIOA 4KUIA 2OX7A 2CP3A 3CBPA 4AG2C 3FIFA 4HCCA 3OBYA 3QHSA 1QQJA 5FLXE 2ABLA 3I56T 3EG0A 2QA4A 3OYHA 3MO8A 1P92A 2L2PA 1VQ4T 3EFOB 1VQ8Q 3PIOA 3KBGA 1HD3A 4J6XA 4KUDK 1C0MA 1GRIA 4HVVA 3CCJT 3L2VA 1VQOT 2MF2A 4N4HA 1JJ2P 1FWZA 4F7UA 1HYOA 1X2KA 3QKJA 1K73R 2LNVA 4Q5WA 2CKKA 1DJ7B 1NYFA 1YWPA 2O2OA 4PJNA 3EFSA 3L2WA 2EQKA 3TSWA 2FPFA 5IHNA 3CPWA 3RERA 3OMCA 1YI2A 1Q86U 2LDMA 1M4ZA 4F14A 2CT4A 2ZZDA 1UECA 3O5ZA 2F2XA 1PM3A 3LLRA 2OTLA 2HBWA 2KE9A 1XNIA 1Q7YR 4E7SA 5CR2A 1RL2A 2CUBA 4JS5A 2A37A 1GBRA 4BDYA 3JCMe 2AK5A 3CCMT 1GCQC 5KYUB 2LQ8A 2KK4A 4IUPA 3HHTB 1X69A 4AFUC 4BE0A 3UA6A 3LWHA 1GFDA 1M1KR 2BKDN 1D3BB 3ULRB 3OMGA 3SHWA 1W70A 1X01A 4AFQC 3C4SA 2RPNA 1WNLA 3RKXA 1Q86C 2GF7A 2AZSA 2GTJA 2MAMA 2XK0A 2SRCA 2RMOA 4RCCA 4C92B 2EPDA 1WPYA 4ELZC 4M78C 2EKHA 1UEBA 4M78G 4DOVA 2D6FA 4M7DC 1FXXA 2M0YA 3LH5A 4M7DG 4J7IA 4HCZA 3I9QA 2CP7A 1M8VA 1G3SA 2W0ZA 1AWXA 3R6OA 4M78E 2A08A 1K9MR 4M7DE 1BB9A 1WXUA 3EHQA 3O8VA 3MP8A 5GANe 2PNIA 4BDZA 2RB6A 2M16A 1VQNQ 4AMCA 2OJ2A 3QUIA 2IIMA 2QA4T 2CZ0B 2JTEA 2K57A 4E7LA 3QYGB 3RR6A 5M9OA 3M4GA 3FJPA 2ATCB 2EJGA 3G6EA 4WCIA 2DFUA 1YIJA 1ZUYA 3C0CA 2AIRB 3ZFJA 5D6XA 3ZBDA 1QVGS 2K5FA 1Y96A 2NLUA 3G71Q 2DILA 5D7UA 3S6WA 2NWMA 4KH1B 1XOVA 5CQXA 1WQWA 1RLQC 2V26A 2C0OA 3X24B 3F70A 4WTOB 5L8RE 1ACMB 2DIQA 2Y4XA 3U23A 5C0MA 2CZ6B 1N8RR 2HL3A 4C5HA 3FEOA 1ZBXA 1UGVA 2M02A 2DKGA 2KT1A 5IXFA 1YI2T 1T0HA 3BFMA 1I0CA 2E5KA 2DF6A 4X9CA 1QP2A 2DERA 2OTLT 2CZ1B 4BE2A 2ESWA 2ZAEA 5KYYA 1RAFB 4FW1A 4BD3A 2CREA 3CD6Q 2DL5A 2FRWA 5LJ3e 4M7DA 3GLXA 2K5LA 3HKSA 2YSQA 3EGUA 4JUVA 1VOMA 1VQ8A 3EFRA 5CKEA 1R8OB 3H9NA 1KJWA 3I35A 4IIOA 1ABQA 3SDZA 1VQLT 1G83A 3PNWC 5CQYA 4Y92A 1SRMA 2FZKB 2X51A 2DTIA 1JU5C 2HQEA 1TUGB 2LC4A 4KBMB 3V8JA 2RI5A 4M75F 2P0PA 4J9DA 1SEMA 4HT8A 3OYCA 1AZGB 5GAN8 2J6FA 2MK5A 3HTRA 2CSQA 3HRTA 4CI0C 2DE0X 1VA7A 4II1A 3VYHB 2QTVA 1JBMA 2DVJA 2VXFA 5HY6A 4IUVA 3SFMA 1PD0A 4HA8A 1UFFA 2GNCA 5GAOr 2BUDA 3EAEA 1M5Q1 1KG1A 3WXMB 4N0AA 2E4HA 3DLLA 4J9HA 4D8DA 5GMKm 3EGDA 2LT1A 1RAGB 4LDXA 2KDSA 2LT4A 5GAOq 4OP0A 2HD0A 4XU2A 1AWWA 2QAZA 4FSSA 2DXCA 2DBKA 1IRXA 3G6ET 4M78D 1YIJT 2RF0A 3H0HA 1EX4A 2CGHA 1NBEB 4JJCA 5AYFA 4C8QF 1AEYA 1PCXA 2BZYA 3S3OA 2FG0A 2FRYA 1JQQA 1SF9A 4XTXA 4ZNXA 2K3BA 1I5OB 1M1GA 1K8AU 2EFIA 4M78B 3MEAA 1YHQT 5KYYB 1AT1B 2EYYA 1AOJA 2YHTA 4M7DB 4LN2A 3KFVA 2FB7A 1WHKA 2JMAA 3JRZA 5FWCA 1EZZB 4XTYA 1BK2A 2L3SA 2YXYA 3X26B 2KRNA 2ZPGB 1NJIR 1PSFA 4NL2A 1MMDA 1ZSZA 4QQ6A 3L1AA 3FLGA 5IHKA 1X75C 1TUCA 1VIEA 3QWXX 3MCAB 1VQ8T 1EFNA 3C94A 3V8KA 5GAOl 3SEMA 2KYMA 4FT2A 4LXCA 4CC7A 3ER0A 2R5MA 1C6VX 1YJNQ 2FZCB 2LJ0A 3HP9A 1D0XA 1M1FA 3S3MA 2K3YA 3GOXA 2OAUA 1N27A 3M57A 3OY9A 1QCOA 4FU6A 5GAN2 1WHMA 2GGRA 3M53A 4N4GA 4JRQA 7AT1B 4R56A 3A8HB 1K8AC 5I22A 2E5QA 1BI3A 2ZPHB 3A8MB 3X25B 3OYNA 3AHUA 1YJWA 2RD1A 3DLMA 3CCRA 3CMEA 1J3TA 4X1VA 3EGDB 3RNJA 1D1CA 1OULA 2X3WD 1QLYA 1MUZA 3QDRB 1O9SA 3PMIA 2L3PA 5LJ3f 1OYXA 3IQLA 2QYZA 2JJ9A 3INZA 4E7HA 1PNJA 5LL6S 3RMSA 3M59A 1IB8A 5IN1A 3H8ZA 3PGGA 3BE3A 3I55Q 2X4JA 4JZ3A 3G4SQ 2ECZA 1PRMC 4QVCA 2RI2A 5EC7A 2YUOA 3CCSA 4LUDA 5FROA 1G3YA 2F5KA 2K4YA 5J3BA 3EFOA 2O4XB 2RQWA 2DL3A 1Y7XA 1QMCA 2AZVA 4OB2B 3AT1B 2COYA 3TVTA 1K76A 4PFOA 4XQ3A 3J7AF 2F5TX 3EG1A 3CCQQ 2YLCA 4C8QC 5GAN6 1BYMA 2XIDA 4C8QG 3OYIA 1WHLA 3CCLA 2RHYA 1WFWA 3JB9F 1R77A 2KMTA 1AD5A 2X4WA 4XTVA 4J83A 2X4YA 3REAB 3E9FA 1M27C 2XMFA 4KGXB 2R57A 1ZHIA 1QVGA 4ZGDB 5DM7R 4XU0A 4PLIA 4CRIA 1OV3A 1YP5A 2G3RA 3VS1A 1KD1R 3RKYA 2V1QA 3OYMA 2YRCA 1M2OA 5CO7A 4F16A 8ATCB 3JAME 1BCMA 2Z0WA 2DXUA 3M0TA 2P0QA 4LDVA 3TEEA 2QEXQ 5LJ3h 2HZYA 1GBQA 2CYZB 4A4GA 3CCVT 1ZBJA 4OB1B 2QDLA 4RTZA 1UGPB 1F1BB 1S72A 1OZ2A 1W4SA 1LPLA 2EYQA 5KE2A 5J39A 1VQKQ 1BI2A 2PUOB 1LJOA 2K5IA 1VQ7Q 2EJ9A 1B07A 3P8HA 4DBRA 4BACA 1UJ0A 2IVWA 4BUGA 3OYEA 1H3ZA 3M0RA 4R0KA 4LNPA 2EYXA 2YT6A 1N5ZA 5GMKh 2DPPB 1YJWT 3UA7A 4IURA 3MP1A 2QASA 1PWTA 3CCRT 2QQRA 3MKDA 2JS0A 3CMET 1YJ9T 3CC2Q 2GFUA 3JB9I 2K6DA 2RQTA 1CKBA 4XTZA 4KGVB 2HKQB 4JRPA 1E7OA 1UGQB 2CH4W 4EMKC 5GMKl 3OYBA 1VQ6A 3NFCA 3QIIA 2LNHB 1TS9A 1Q82R 1B7TA 3HSBA 1FMKA 2E6ZA 3OS1A 5GAMj 3A98A 1I07A 3TSZA 1O75A 3JCMc 4FCYA 3SWNC 1WJQA 4PJOF 2COWA 2E6NA 2GCXA 2A36A 1UTIA 3CCST 1TU0B 5GMKi 2QQBA 1WJRA 5KCOA 2RH2A 4GY5A 4M75D 3CBMA 3OYKA 2XU8A 1QVFP 1KQSS 1KC8R 1NM7A 3HFNA 4J6YA 4BI4A 1PKSA 2G6FX 4OMMA 3LWIA 3UT1A 1KHIA 5CKDA 4PFPA 1ZUUA 2HSPA 4DBFA 2J6KA 3OYJA 4IKFA 2QQSA 2ZPFB 3CC4A 1D09B 4K11A 4M7AF 1QWEA 2MWOA 3CCLT 3EGXB 1T3LA 3E9GA 4HCBA 4D8KA 1RABB 2VWFA 2RQRA 2VV5A 2DXTA 2PUKB 2EAYA 2CSIA 3NTKA 9ATCB 2DEUA 1BKBA 1IGUA 1X6OA 3QJ6A 1PD1A 2E10A 2QGGA 2FZGB 3CCEQ 2XDDA 3BW1A 2GQVA 4D6WA 4MZTA 4IUUA 3LH0A 4EMKA 4RTUA 2LMJA 5KH6A 3LX7A 2JMCA 2K9GA 3KUFA 1OI1A 1WHGA 4C8QD 1IZ6A 1S72T 1QVPA 2LJ3A 5GAOm 5LJ5f 2ROLA 3SWNA 4OMOA 3CPWP 4XK8E 2NYSA 2LZ6B 2K2MA 4RUGA 4MMKA 2L89A 3JCMP 1LCKA 5GJVB 2F1LA 3CCQA 2VGNA 1YFNA 3SB2A 3CC7Q 4LD9K 1D0ZA 4Z02A 2AKKA 4OMNA 4OGCA 2XICA 2QI2A 4QT7A 3JB9H 4IUTA 2E70A 1G3TA 4N4IA 2DZ9A 5CIUA 1VQ6T 1OPKA 3VRZA 5GAN3 4J9EA 4EMGA 3HFOA 2H8HA 4QW2A 3VS0A 4QVDA 2FVUA 2VKNA 1QCFA 1K73U 1UB4A 3HRSA 2QEXA 3KXTA 3GNFB 2QXFA 4DEXA 1RI0A 4ATOA 1TTHB 4E47A 1HXDA 2OTJA 2O31A 3OYFA 1VQKA 4LDWA 1I81A 1LOJA 4JS4A 1PHTA 4PJOC 1R0BG 1GCQA 4PJOG 1XQHA 3NTHA 1MNEA 4M77F 1MV0B 3QDFA 2DMOA 5LJ5h 3X28B 3G1JA 1QKWA 1Q7YU 2DTHA 4AT1B 3CC4T 2DL7A 4PJJA 4OVAA 3CC2A 2KRSA 4FIBA 4BE1A 2XD0A 2D9TA 4RTXA 2XHCA 1X43A 4FM4B 3VS2A 4EMKB 1UHCA 1K73C 3A5ZB 4XTUA 2JZ2A 1VQMQ 2DBMA 4J9IA 5LJ5g 1YWOA 3R6NA 4PK4A 2DJZA 2KXDA 4M78A 3JCMX 1M1KU 3RKWA 4PL6A 1LVKA 2DRKA 3M56A 5D6WA 2ED1A 1H3HA 2VUBA 4M4ZA 2RHUA 3SWNB 4Y91A 3QPHA 5I11A 1W2BS 1JB0E 3S3NA 1G5VA 2RJDA 1SG5A 1U3OA 4FYXB 2LTOA 1D0YA 1SHFA 2F2VA 2DYIA 1Q7YC 1FMVA 5DLOA 1K9AA 1Q81R 2AHJB 3GPLA 3Q1JA 1ZA2B 2DL8A 3I56Q 4L6V5 3JB9D 2QQ9A 3OS5A 2VC8A 1K9MU 1FYNA 3QXEB 4J9GA 3CXCS 2CP6A 2YWWA 4OF1A 5GAOp 3M0SA 4B6MA 1M1KC 1U8RA 2QDYB 5GAMe 2FPDA 3CCJQ 4TVRA 5IH2A 2JW4A 3CCEA 3M4YA 3OYYA 4KRTA 3NMZC 3JCMf 3MPUB 3A1PA 4OMPA 1YITQ 2YDLA 4X9DA 2E1HA 2QEXT 3RESA 3MHXA 1K9MC 1N8RU 4ZGEB 2OTJT 1VQKT 2KRMA 2M51A 1RAAB 2DO3A 3UATA 2DAQA 4ZTJA 2LVMA 3M54A 3OBWA 2C0IA 4IIMA 3CCMQ 2QK0A 5DLQE 1W1FA 2WSEE 4BY6C 1BBZA 2PU9B 4XTWA 2O4XA 4M77C 3PT9A 2RHXA 4M77G 4C92F 1VQ5Q 1IO6A 2K2VA 3NHNA 4C0FA 5A0LA 4EPCA 3RUXA 1FMWA 2ROTA 3RMQA 5D6YA 1YBYA 5GANf 4KGZB 4PJOD 3EG3A 2DEQA 2Y90A 1HK9A 1VQNA 3UF4A 1Y07A 1N8RC 3DB3A 1U1SA 2A7YA 4XU1A 2QQAA 2E64A 3FRNA 1BI0A 2KEAA 2V8IA 4EIKA 2O9VA 2EQMA 3J81E 4HVUA 1OEBA 1GFCA 1A0NB 2J6OA 3JCMh 5A2QE 5FWBA 1WLPB 3C95A 4F7UF 1WQ7A 4PFZA 5IT9E 6AT1B 1G3WA 3G71A 4M7AD 4EMHA 2JN0A 3OW2S 1N6AA 2JT4A 3N5BB 2QA4Q 2CT3A 2NUZA 5GAN7 3EG2A 1M90R 3MP6A 1M3BA 1PG5B 5DY9A 3JCMg 2HDAA 1TUDA 4AG1C 3DKMA 2QGFB 3OA6A 3VU3C 4GBQA 4RTWA 2O01E 5CKBA 3REBB 3NGPA 4E6RA 2I2LA 4E7ZA 4M75C 4M75G 2D8HA 3GIBA 4PJLA 2JTMA 3CEYA 1YNZA 3CCET 1YN8A 1IXDA 5L23A 1SKUB 4M75E 4LDUA 3CD6A 1OX9A 2QTXA 5IXBA 3CQTA 1SRLA 2DNUA 1Y71A 1AWOA 1VQPQ 2MCNA 1ZA1B 1I8FA 2ZCFB 2CS7A 1AVZC 2DA9A 5LJ5d 2LJ1A 2E3HA 5GANh 4C5EA 1YI2Q 3URGA 4J9BA 3VUBA 1MMGA 3BY7A 1U5SA 4A4EA 3UPUA 2OTLQ 3CCUQ 4AFZC 1NEGA 1M3CA 3I56A 4J8OA 3VKIA 5GANg 5EG2A 3QZ5B 2DD4A 4PNOA 2LX9A 3L2RA 2EGCA 3P8DA 1NJIU 1JXOA 1M8MA 1WA7A 2FYKA 5GAMf 2DX1A 2A3LA 4DA4A 2IG0A 2K79A 1VQLQ 3GNGA 5FW9A 2RJFA 1H92A 2JS2A 4FYVB 4ORZA 2NUTA 4C8QE 4ZN1A 1QP3A 1MNDA 4ESRA 1I4K1 4MZMA 2DXBA 4QVZA 2P84A 3EGXA 3VS3A 1VQNT 2KR3A 3RBBB 1YITA 4M75A 1NG2A 3VS5A 4BI3A 4RMOA 2PVDB 3H41A 2RK1A 1GL5A 3LGLA 2K3XA 4J5YA 1MMAA 4JDSA 2RHZA 4M77D 3V7CA 1OZ3A 5CVIA 5ECAA 1NJIC 1D1BA 2YRDA 3G71T 1HSQA 1I1JA 2WSCE 2ENMA 2FO0A 5KYWA 2LQNA 3FB9A 2HMAA 5KYXB 2I0NA 1QCNA 5CAIA 5LJ3g 1QVGP 3CCMA 1T0JA 4LUEA 1SSHA 1Q86R 4F7UG 2LCCA 5CK9A 4BY6B 4MMLA 1W2BA 4F7UE 1YIJQ 1VQ5A 4M77B 4LE9A 3JCMb 4HT9A 2DM1A 5IHIA 4JJDA 1KK7A 1AZEA 2DRMA 4CC3A 4M7DF 4C8QA 5GAMh 3CD6T 2FPEA 1TSFA 4VUBA 3JB9J 3VV0A 1YCYA 2MYSA 5GAOn 2E12A 2ZGWA 1OX8A 1ZLMA 2RO0A 3CXCA 4JZ4A 4QKUA 2HL5C 1YHQQ 1NPPA 1IHVA 1YJNA 2L8DA 2DZCA 3EH2A 4F04B 1V29B 1VIFA 2EQUA 3PFSA 4KULA 1W2BP 5KCHA 2EQIA 1ZUKA 1ZQ1A 2DYBA 5GJWB 3T9NA 2EGEA 2LX7A 4PJMA 2FL7A 2M1HA 1UE9A 2X3XD 5FRNA 2YUQA 4J7FA 4FT4A 2OI3A 3ZEHA 2FEIA 2NUTB 4MDXA 4CC2A 3THKA 2KBTA 3JCMV 1AHJB 1KD1U 4P5NA 2CZ7B 4NS5A 1N9SA 3FJ5A 3CXCP 1Z9ZA 3QJYA 4RCBA 4JJNK 4OMLA 5CKFA 2HQXA 4M75B 1JEGA 1WJSA 3JCMd 2HKNA 1FX7A 1NE8A 2ED0A 2ZPEB 4DQ2A 4OGEA 2LP5A 1RLPC 4HKEA 3VS6A 1TH7A 3M0UA 1RAEB 3CMAQ 3QBYA 3J80E 3RDVA 3JB9G 1YITT 1UHFA 2X9HA 1VQPA 3JCMW 4A4FA 2D0NA 3I55A 1XJWB 3G4SA 1U1TA 3L42A 3L2UA 3HL8A 2BE9B 3PE0A 2RI3A 5KYWB 2HEQA 2H3JA 2RJEA 3NTIA 1BIBA 2KSSA 1WXTA 4R55A 4RG2A 1BU1A 2SEMA 1M9SA 2CDTA 2KXCA 5I21A 3CCUA 1CSKA 3M55A 2O88A 1R0CB 1MHNA 1KD1C 4QQDA 5FU7C 4OMFB 1C1AA 2XKOC 1QWFA 4L59A 4O5VA 4C92D 1Q82U 1X2QA 2MMPA 2NUPA 4DBQA 1JXMA 1VQLA 2RQUA 2EW3A 4BB7A 4C8QB 4J9CA 1VQ5T 4IUQA 1T3SA 2CP0A 3PTAA 3LW5E 5GANd 4JRKA 1PRLC 1KHCA 5C6SA 3JSCA 2EWNA 3QO3A 2JM9A 4A4KA 2JUFA 2PQWA 2J7IA 2L0AA 1UJYA 5GAN4 1NLPC 1ZX6A 1OQKA 2EIFA 2ZPIB 4GLKA 3TREA 4ZGJB 3OS0A 3OW2A 1KC8U 4ANJA 3NPFA 4EDUA 3CPFA 4ZTFA 3V8LA 1TG0A 1WHJA 2KGTA 4C0GA 2KYBA 1YJNT 3WVDB 1OOTA 2HBPA 3UDCA 4AFSC 1VQ9Q 2BZ8A 3RIRA 2DK3A 2RK2A 2O9SA 1Q82C 3FDRA 2LCLA 5I2SA 4JLGA 2GQIA 1VQ7A 2L3RA 2L3QA 1UUEA 1WXBA 2HNIA 3H6ZA 1GCPA 3M58A 2KT8A 2VYTA 1N9RA 2V8JA 1K4US 2B86A 1BI1A 2KVQG 4F7UB 1PSEA 4PJOE 3TCJA 3OW2P 2V8KA 1VYUA 3CCVQ 1V76A 1KQ1A 1X6BA 2YUPA 3LYIA 4FYWB 2EYZA 1ABOA 1ARKA 3E1SA 1GXIE 3E19A 4XAXB 1KC8C 1SSFA 5LJ3d 2JM8A 1NLOC
chains in the Genus database with same CATH topology
2F5TX 2CKKA 2O4XA 1DJ7B 3PT9A 4M77C 1QW1A 3HPWA 3OYGA 2RHXA 4M77G 4C92F 2YLCA 4C8QC 5GAN6 1BYMA 2XIDA 2K2VA 4C8QG 3OYIA 4NL3A 4C0FA 5A0LA 3CCLA 4EPCA 2RHYA 3BDLA 3RUXA 3JB9F 4M7AC 2KMTA 2X4WA 4XTVA 5I2MA 3RMQA 5D6YA 3EFSA 4M7AG 4J83A 4DOWA 1YBYA 3L2WA 2X4YA 2EQKA 4PKCC 5GANf 1VQPT 5LJ5j 3E9FA 3CPWA 3I55T 4PJOD 3A8GB 3G4ST 3RERA 4M7AE 2DEQA 2R57A 2Y90A 1HK9A 3OMCA 1ZHIA 4N0AC 1YI2A 1Q86U 2LDMA 1QVGA 1VQNA 4ZGDB 1M4ZA 5DM7R 1YHQA 1Y07A 4XU0A 2ZZDA 4PLIA 3DB3A 4CRIA 1N8RC 1U1SA 2G3RA 2A7YA 4XU1A 2QQAA 2FHDA 3RKYA 3LLRA 2RJCA 3OYMA 2E64A 2OTLA 3FRNA 1XNIA 1BI0A 2JVVA 2V8IA 3C12A 4E7JA 5CO7A 3JAME 5CR2A 3CCUT 1RL2A 2ZPBB 2DXUA 2EQMA 3J81E 4JS5A 2P0QA 4LDVA 4BDYA 3TEEA 3JCMe 3JCMh 5LJ3h 4ZN3A 5A2QE 2CYZB 4A4GA 3CCVT 3C95A 4F7UF 1WGSA 4FL6A 3CCMT 4OB1B 1WQ7A 5IT9E 1UGPB 3QYHB 1S72A 1G3WA 1OZ2A 1W4SA 5GAMd 3G71A 4M7AD 2EYQA 2LQ8A 2KK4A 4IUPA 3HHTB 4EMHA 5KE2A 5J39A 4BE0A 4C0DC 2JN0A 3META 3OW2S 2R5AA 1QVFS 1BI2A 3LWHA 1N6AA 2PUOB 3CCQT 1LJOA 2K5IA 3N5BB 2XDBA 2EJ9A 1NZ9A 1XTDA 2BKDN 2D0QB 3P8HA 5GAN7 3MP6A 4BACA 4PJOA 1D3BB 3PMTA 2IVWA 5DY9A 4BUGA 3JCMg 1JJ2S 2HAXA 3OMGA 3OYEA 3MEUA 1H3ZA 1X01A 3DKMA 3C4SA 3OA6A 3VU3C 5GMKe 5GMKh 2DPPB 1YJWT 2LQKA 2YRVA 4IURA 3MP1A 2O01E 3M9QA 1WNLA 5CKBA 3RKXA 1Q86C 2GF7A 3V7RA 2QQRA 3CCRT 2I2LA 4B9XA 2MAMA 2XK0A 4M75C 3CMET 1YJ9T 4RCCA 4C92B 3CMAA 2GFUA 4M75G 3JB9I 3GIBA 1WPYA 2JTMA 4XTZA 3CEYA 4ELZC 3CCET 2EKOA 4M78C 4JRPA 1UGQB 1UEBA 4M78G 4EMKC 5GMKl 3OYBA 4M75E 1VQ6A 4LDUA 4DOVA 3CD6A 1LNXA 1B34A 2D6FA 3NFCA 1FXXA 3QIIA 4B9WA 4ELYC 4M7DC 4M7DG 4J7IA 2QTXA 4X34A 4HCZA 4YTLA 3HSBA 1M8VA 1G3SA 1Y71A 3R6OA 2E6ZA 4M78E 4A54A 4M7AA 4ME7A 3OS1A 5GAMj 4M7DE 1I8FA 2ZCFB 3BDUA 2CS7A 5LJ5d 3O8VA 3MP8A 2JTFA 5GANe 1O75A 3JCMc 2JNGA 5GANh 3SWNC 4C5EA 4BDZA 2RB6A 3URGA 2M16A 1I5LA 3VUBA 2DTOA 1WJQA 3QUIA 2E65A 3BY7A 5CKHA 4PJOF 2E6NA 2QA4T 1VQ7T 2CZ0B 2K57A 4Y28E 4A4EA 3QYGB 4E7LA 5FU7B 2GCXA 2P0KA 5CCAA 3UPUA 5M9OA 3LGFA 3CCST 5GMKi 2QQBA 3SD4A 2DVEA 1WJRA 4JLIA 3M4GA 5KCOA 2RH2A 4GY5A 4M75D 3CBMA 3FJPA 3OYKA 2XU8A 2EJGA 3I56A 1KQSS 3G6EA 1Y96B 3HFNA 2B8AA 4J8OA 1YIJA 3VKIA 5GANg 3QSUA 3HRUA 3CC7A 5EG2A 4J6YA 3CPWS 3ZFJA 2RA2A 4BI4A 3QZ5B 2DD4A 4PNOA 2LX9A 3L2RA 3P8DA 5D6XA 3ZBDA 2XDPA 3LWIA 4OB0B 2GFAA 3UT1A 1KHIA 1QVGS 1NJIU 3CC2T 2K5FA 4M7DD 1Y96A 2NLUA 4UC4A 5CKDA 2FYKA 5GAMf 2A3LA 3OYJA 4DA4A 4IKFA 2IG0A 3S6WA 1NPRA 1XOVA 5CQXA 1WQWA 3V7SA 2QQSA 2ZPFB 3CC4A 3GNGA 2DIGA 3M5AA 4M7AF 2MWOA 2RJFA 3X24B 3F70A 4M77E 3CCLT 1KQSA 3E9GA 4HCBA 5L8RE 2DIQA 2Y4XA 5C0MA 1KQ2A 4C8QE 2CZ6B 4ZN1A 1QP3A 1I4K1 2VV5A 4MZMA 2DXTA 2PUKB 1ZBXA 3FEOA 4C5HA 2DXBA 2EAYA 2DKGA 4QVZA 3NTKA 4LD6A 1BKBA 1YI2T 1Q81U 1VQNT 1X6OA 3QJ6A 5FRMA 2P4TA 3BFMA 4QQGA 3FC3A 2E10A 4NOYA 5FU6C 1YITA 4M75A 4X9CA 1UGSB 2XDDA 1VQ9A 1QP2A 5HK0A 3BW1A 2X35A 2GQVA 4BI3A 4D6WA 5IAYA 4RMOA 2OTLT 2PVDB 2CZ1B 4MZTA 4IUUA 4BE2A 2RK1A 2Y4YA 3LH0A 3LGLA 4EMKA 2K3XA 4J5YA 4BD3A 2VXEA 5GAN5 5LJ3e 4M7DA 4JDSA 2RHZA 5KH6A 3GLXA 3LX7A 4M77D 3TU4K 3KUFA 2K5LA 3G7ZA 1OZ3A 1OI1A 3HKSA 3V7CA 4JUVA 4C8QD 1IZ6A 5CVIA 1VQ8A 1NJIC 4PJOB 3EFRA 1S72T 1QVPA 2MWPA 5CKEA 3G71T 1R8OB 5GAOm 2WSCE 5LJ5f 2VGMA 3SWNA 3FB9A 3VUZA 3VYGA 1IREB 2RHIA 4XK8E 3SDZA 1VQLT 5CAIA 3CCVA 4C5IA 3PNWC 5LJ3g 3CCMA 5CQYA 4MMKA 5J26A 4F7UG 2LRQA 2DTIA 2JOYA 2LCCA 3L2QA 5CK9A 3P8BB 1MGQA 2L89A 2KQWA 3JCMP 2HQEA 2E41A 2LC4A 4KBMB 4BY6B 4MMLA 3V8JA 1W2BA 3CCQA 2RI5A 3QZ9B 4F7UE 2VGNA 1VQ5A 3QG1A 3SB2A 4M77B 1Q81C 4M75F 4LD9K 1VQMA 1B34B 2P0PA 4Z02A 1UGRB 3JCMb 4HT9A 4HT8A 2WSFE 3A8OB 3OYCA 3CMAT 5GAN8 3OB9A 4M7AB 2YLBA 4OGCA 2XICA 2QI2A 3HRTA 4CI0C 4M77A 4II1A 3JB9H 4IUTA 2E70A 1G3TA 4L5GA 2DZ9A 4N4IA 5CIUA 3UWNA 3VYHB 4A4HA 4C8QA 1VQ6T 4M7DF 5GAMh 1H641 5A0DA 1JBMA 3CD6T 2VXFA 5HY6A 4VUBA 3JB9J 3MEWA 3VV0A 1YCYA 2XG8D 4IUVA 3SFMA 1YJ9A 5GAN3 4HA8A 5GAOr 5GAOn 2E12A 3OYLA 2ZGWA 2BUDA 3EAEA 4EMGA 1M5Q1 1KG1A 3HFOA 3WXMB 4QW2A 2RO0A 3CXCA 4QVDA 4N0AA 2FVUA 3DLLA 5GMKm 3OQ5A 1NPPA 2XI9A 2LT1A 1K73U 1YJNA 2L8DA 2DZCA 1UB4A 3HRSA 4PLLA 2QEXA 3KXTA 3GNFB 1V29B 3OS2A 3JCMQ 1VIFA 2QXFA 2EQUA 4LDXA 3PFSA 2KDSA 2LT4A 4KULA 3ME9A 3OSVA 5GAOq 4OP0A 2HD0A 5KCHA 1RI0A 4XU2A 1ZQ1A 4ATOA 2F69A 2PVOB 5HKCA 4E47A 2DXCA 3T9NA 1HXDA 2OTJA 3OYFA 3G6ET 1VQKA 4M78D 4LDWA 1I81A 1VQ4A 2FL7A 1LOJA 1YIJT 2M1HA 4C0DB 4JS4A 4XU3A 3CC7T 4PJOC 5GANj 4PJOG 2CGHA 1XQHA 3NTHA 4C5GA 5FRNA 4J7FA 4FT4A 4MZPA 4M77F 3ZEHA 3A8LB 4MDXA 5AYFA 4C8QF 3JCMV 1AHJB 1KD1U 3CCJA 2C06A 4P5NA 2CZ7B 4NS5A 5LJ5e 5LJ5h 1VQOA 1N9SA 3X28B 1Q7YU 2DTHA 3CC4T 3QJYA 4RCBA 3L2ZA 4OVAA 3DB4A 4JJNK 3S3OA 3CC2A 4FIBA 4E7IA 5CKFA 4BE1A 2HQXA 4M75B 1WJSA 2XD0A 2D9TA 4XTXA 3JCMd 1FX7A 1NE8A 2ZPEB 2XHCA 4DQ2A 4OGEA 4E7KA 1M1GA 1K8AU 2EFIA 1VUBA 4FM4B 4C92C 4M78B 4HKEA 3MEAA 1YHQT 1TH7A 4C92G 4EMKB 1K73C 3A5ZB 4XTUA 2R58A 2JZ2A 2YHTA 2EQJA 4OB3B 3QBYA 3J80E 3JCMJ 5LJ5g 4M7DB 3JB9G 1YITT 2FB7A 3OYDA 1VQPA 3JCMW 4A4FA 3I55A 4C92E 1VQ9T 3JRZA 2DJZA 2WACA 2KAFA 4M78A 3JCMX 3G4SA 4XTYA 1M1KU 1M90U 3RKWA 1U1TA 4PL6A 4V2SA 3M56A 3X26B 5D6WA 3L42A 2L5QA 2ZPGB 1PSFA 3L2UA 3HL8A 4NL2A 2PVGB 2VUBA 3OSSC 2RHUA 1EIFA 4QQ6A 2RI3A 4C0ZA 3L1AA 3SWNB 3FLGA 1X75C 2H3JA 2DD5A 2RJEA 3NTIA 1BIBA 2KSSA 3QPHA 4MDWA 4RG2A 4Y91A 4R55A 1W2BS 1M9SA 1VIEA 1JB0E 3MCAB 3S3NA 1VQ8T 3CCUA 1JRIA 2RJDA 5I21A 3C94A 3V8KA 5GAOl 1G5VA 2X4XA 3M55A 4FT2A 2KY9A 1MHNA 2LTOA 3ER0A 1KD1C 2R5MA 4QQDA 5FU7C 3VJPA 4OMFB 4WF2A 3X20B 2XKOC 3HP9A 3CBOA 1M1FA 3S3MA 2K3YA 3GOXA 2OAUA 1Q7YC 1N27A 3M57A 5DLOA 4L59A 3ASKA 4LDYA 3OY9A 4O5VA 3WVEB 4C92D 4FU6A 5GAN2 5LJ3j 2AHJB 3GPLA 3Q1JA 1Q82U 3M53A 5KE3A 4BI8B 2MMPA 3JB9D 4L6V5 4N4GA 2QQ9A 3OS5A 2M0OA 2VC8A 3GP8A 4JRQA 1K9MU 4R56A 3A8HB 3MEVA 1K8AC 2E5QA 2M9UA 1VQLA 2BIVA 1BI3A 3QXEB 4J6WA 4JRIA 4BB7A 4C8QB 2RM4A 4IUQA 2ZPHB 3A8MB 3CXCS 1VQ5T 3PTAA 4KT0E 1VQMT 3LW5E 5GANd 4RG8A 4JRKA 4FSXA 4OF1A 3X25B 5GAOp 4M78F 2EJFA 3OYNA 1KHCA 5C6SA 3JSCA 2EWNA 3QO3A 1YJWA 3AHUA 3OYAA 2RD1A 5HK3A 1M1KC 1U8RA 2QDYB 4A4KA 5A0GA 1M90C 3DLMA 2JUFA 5GAMe 3CCRA 2PQWA 1D3BA 4TVRA 2MI6A 3CMEA 4O6JA 5GAN4 5GMKj 4A53A 1BIAA 4GLKA 2EIFA 2ZPIB 3OS0A 3TREA 4ZGJB 3CCEA 3OW2A 1KC8U 3QDRB 1QVFA 5FU6B 3M4YA 3PIPA 1O9SA 3OYYA 3PMIA 4EDUA 3CPFA 5LJ3f 1OYXA 3JCMf 4ZTFA 3V8LA 1JJ2A 4RKUE 3INZA 4E7HA 4C92A 4C0GA 5GAMg 3GF5A 5LL6S 1YJNT 4X9DA 3RMSA 3M59A 3WVDB 2E1HA 2HBPA 4KUIA 5IN1A 3H8ZA 3UDCA 2QEXT 3PGGA 3CBPA 2X4JA 3FIFA 3RIRA 2DK3A 2RK2A 4HCCA 3OBYA 1Q82C 3FDRA 3QHSA 2LCLA 3RESA 5I2SA 5FLXE 3MHXA 4QVCA 3I56T 1K9MC 4JLGA 1N8RU 4ZGEB 2QA4A 3OYHA 1VQ7A 3MO8A 2OTJT 2RI2A 1P92A 2L3RA 1VQKT 1VQ4T 3H6ZA 2HNIA 3PIOA 3KBGA 3CCSA 3M58A 2VYTA 1N9RA 5FROA 1G3YA 2F5KA 2V8JA 2DO3A 4J6XA 4KUDK 1BI1A 2K4YA 2KVQG 1PSEA 4F7UB 4PJOE 2DAQA 5J3BA 4ZTJA 2LVMA 3TCJA 3M54A 2V8KA 3CCJT 3L2VA 3OBWA 1KQ1A 2O4XB 1VQOT 3LYIA 2MF2A 4N4HA 1Y7XA 3E1SA 5DLQE 1GXIE 1FWZA 2WSEE 4OB2B 4F7UA 3E19A 4XAXB 1KC8C 3QKJA 1SSFA 2LNVA 5LJ3d 4BY6C 4Q5WA 2PU9B 4XQ3A 3J7AF 4XTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTO A;  3QUI A;  4M77 C;  2E65 A;  3JCM b;  3BY7 A;  4PJO F;  4HT8 A;  4HT9 A;  4M77 G;  1JRI A;  4C92 F;  2YLC A;  3V8K A;  4C8Q C;  5GAN 6;  5I21 A;  5GAN 8;  5GAO l;  2K57 A;  5GAO r;  4M7A B;  2YLB A;  4C8Q G;  4NL3 A;  3RUX A;  3JB9 F;  4M7A C;  4M77 A;  3JB9 H;  4XTV A;  4M7A G;  4WF2 A;  3EFS A;  2DZ9 A;  5GMK i;  2DVE A;  4C8Q A;  4JLI A;  3M4G A;  4M7D F;  5GAM h;  1H64 1;  4M75 D;  3FJP A;  1JBM A;  5GAN f;  2VXF A;  2EJG A;  5LJ5 j;  1Y96 B;  4PJO D;  3HFN A;  3JB9 J;  4C92 D;  1YCY A;  5GAN 2;  5GAN 3;  4HA8 A;  2DEQ A;  4N0A C;  2Y90 A;  1HK9 A;  5LJ3 j;  2ZGW A;  5GAN g;  5GAO n;  4J6Y A;  3QSU A;  2RA2 A;  3JB9 D;  4PNO A;  4XU0 A;  4EMG A;  2VC8 A;  1M5Q 1;  3HFO A;  4M7D D;  1U1S A;  4QVD A;  4N0A A;  1Y96 A;  4XU1 A;  4C8Q B;  4J6W A;  4JRI A;  3RKY A;  5GMK m;  2RM4 A;  2FYK A;  2E64 A;  5GAM f;  2DZC A;  5GAN d;  4JRK A;  5GAO p;  1WQW A;  4M78 F;  3V7S A;  2EJF A;  3JCM Q;  3AHU A;  3QO3 A;  2DXU A;  2EWN A;  4M7A F;  2RD1 A;  4M77 E;  3JCM e;  3JCM h;  4OP0 A;  5LJ3 h;  5GAM e;  5GAO q;  1KQ2 A;  4XU2 A;  4C8Q E;  1D3B A;  4F7U F;  1WQ7 A;  5GAN 4;  1I4K 1;  5GMK j;  2DXT A;  1HXD A;  4A53 A;  2EAY A;  5GAM d;  4M78 D;  1BIA A;  1I81 A;  2DKG A;  1LOJ A;  4M7A D;  4XU3 A;  4EMH A;  4PJO C;  5GAN j;  4PJO G;  3BFM A;  2CGH A;  2JN0 A;  2E10 A;  4NOY A;  4M75 A;  4X9C A;  1LJO A;  3JCM f;  4M77 F;  2EJ9 A;  5LJ3 f;  5GAN 7;  3V8L A;  3BW1 A;  3INZ A;  4PJO A;  1D3B B;  4C8Q F;  4C92 A;  5DY9 A;  3JCM V;  3JCM g;  5GAM g;  1X01 A;  4X9D A;  2E1H A;  5LJ5 e;  5LJ5 h;  4EMK A;  1N9S A;  4M75 F;  3PGG A;  4J5Y A;  2VXE A;  3VU3 C;  2DTH A;  5GMK e;  5GMK h;  5LJ3 e;  5GAN 5;  4M7D A;  4RCB A;  3L2Z A;  3FIF A;  3RIR A;  1WNL A;  3RKX A;  4M77 D;  3QHS A;  3V7C A;  3V7R A;  4M75 B;  4JUV A;  2I2L A;  3RES A;  4C8Q D;  4XTX A;  3JCM d;  4QVC A;  4M75 C;  4PJO B;  4RCC A;  4C92 B;  3EFR A;  4M75 G;  4DQ2 A;  3JB9 I;  3GIB A;  1WPY A;  4C92 C;  4M78 B;  4XTZ A;  5GAO m;  1TH7 A;  4C92 G;  5LJ5 f;  4EMK B;  2HNI A;  3SWN A;  4XTU A;  4M78 C;  3FB9 A;  2YHT A;  3JCM J;  4M78 G;  1N9R A;  4EMK C;  5GMK l;  4M75 E;  5LJ5 g;  4M7D B;  3JB9 G;  4J6X A;  2FB7 A;  1LNX A;  1B34 A;  5CAI A;  4M7D C;  3JCM W;  4F7U B;  5LJ3 g;  4M7A E;  4PJO E;  4C92 E;  4M7D G;  2DJZ A;  2QTX A;  4M78 A;  4MMK A;  3JCM X;  3HSB A;  4XTY A;  1M8V A;  3RKW A;  1U1T A;  4A54 A;  4M78 E;  4F7U G;  4M7A A;  4V2S A;  2DTI A;  1KQ1 A;  5GAM j;  1MGQ A;  4NL2 A;  3JCM P;  4M7D E;  2E41 A;  1I8F A;  3BDU A;  4F7U A;  5LJ5 d;  3L1A A;  4MML A;  3SWN B;  3V8J A;  3RER A;  4F7U E;  5GAN e;  3JCM c;  5GAN h;  5LJ3 d;  4Y91 A;  1BIB A;  3SB2 A;  4M77 B;  4XQ3 A;  3SWN C;  2RB6 A;  1I5L A;  4XTW A;  1B34 B; 
#chains in the Genus database with same CATH topology
 3OYG A;  1QW1 A;  3HPW A;  4FYY B;  4NL3 A;  1UG1 A;  2LQW A;  3BDL A;  1D1A A;  4M7A C;  4M7A G;  5I2M A;  4DOW A;  2MOX A;  3EG9 A;  1RUW A;  4PKC C;  1YJW Q;  1OPL A;  5LJ5 j;  1VQP T;  3I55 T;  1KSW A;  3A8G B;  3TQ7 P;  3G4S T;  4M7A E;  4N0A C;  1RAI B;  3CCR Q;  1YHQ A;  3CME Q;  2EGA A;  1YJ9 Q;  3H0F A;  1TXQ A;  2FHD A;  2RJC A;  2HQH A;  2V1R A;  2JVV A;  3C12 A;  4E7J A;  4HVW A;  3CCU T;  2ZPB B;  1X27 A;  2JXB A;  4ZN3 A;  2NUP B;  1WGS A;  4FL6 A;  3QYH B;  1K8A R;  1E6H A;  5GAM d;  1WDX A;  8AT1 B;  4C0D C;  3MET A;  2A0F B;  2PTK A;  2R5A A;  1QVF S;  3CCQ T;  1VQ4 Q;  2XDB A;  1NZ9 A;  1XTD A;  2D0Q B;  4PJO A;  3PMT A;  2KRO A;  1JJ2 S;  2HAX A;  3MEU A;  3VS4 A;  3CCS Q;  4DEY A;  2D8J A;  5GMK e;  3VRY A;  1TOV A;  2OAW A;  2LQK A;  2YRV A;  3M9Q A;  4Z8A A;  2DET A;  1VQO Q;  3V7R A;  4B9X A;  3CMA A;  1M2V A;  1UDL A;  3EH1 A;  2EKO A;  1Y57 A;  1LNX A;  1B34 A;  4ELY C;  4B9W A;  1ZSZ C;  4X34 A;  4YTL A;  3CCL Q;  1MMN A;  4A54 A;  4M7A A;  4ME7 A;  3MJX A;  1OU8 A;  3BDU A;  2BE7 D;  2JTF A;  2JNG A;  1I5L A;  1VYV A;  2DTO A;  3M0Q A;  2E65 A;  5CKH A;  1AWJ A;  1VQ7 T;  4Y28 E;  5FU7 B;  1IHW A;  5CCA A;  2P0K A;  3LGF A;  3SD4 A;  2DVE A;  1Y0M A;  3I5R A;  4JLI A;  3EHR A;  1Y96 B;  2B8A A;  3QSU A;  3HRU A;  3CC7 A;  3CPW S;  2RA2 A;  4HCK A;  2YUN A;  1W6X A;  2XDP A;  3CC2 T;  4OB0 B;  2GFA A;  4M7D D;  1S72 Q;  1S1N A;  4UC4 A;  3EG9 B;  1K1Z A;  3PVQ A;  1NPR A;  3V7S A;  3M5A A;  2DIG A;  4M77 E;  1KQS A;  1KQ2 A;  2GBQ A;  2K7A A;  1WHH A;  4LD6 A;  1M30 A;  1Q81 U;  5FRM A;  2P4T A;  4QQG A;  3FC3 A;  4NOY A;  5FU6 C;  1X6G A;  5KYN A;  1UGS B;  1VQ9 A;  5HK0 A;  2X35 A;  5IAY A;  2RNA A;  1G2B A;  2Y4Y A;  1VQ6 Q;  4RTV A;  2VXE A;  5GAN 5;  2MPX C;  3TU4 K;  3G7Z A;  4A63 B;  4PJO B;  2CP2 A;  2MWP A;  1WYX A;  1KQS P;  2VGM A;  2QG9 B;  3VUZ A;  3VYG A;  1HJD A;  1IRE B;  2RHI A;  1NEB A;  3CCV A;  4C5I A;  4Z89 A;  1MV3 A;  5J26 A;  2LRQ A;  1M2V B;  2JOY A;  1TWB A;  4FW2 A;  3L2Q A;  3P8B B;  1MGQ A;  2KQW A;  5KYX A;  1YCS B;  2E41 A;  2BTT A;  3QZ9 B;  3QG1 A;  1Q81 C;  3H0I A;  1VQM A;  1B34 B;  1UGR B;  2WSF E;  3A8O B;  3CMA T;  2COZ A;  3OB9 A;  4M7A B;  2YLB A;  1SPK A;  1KFZ A;  2E3I A;  2EBP A;  4M77 A;  2A28 A;  1V1C A;  4L5G A;  4A4H A;  3UWN A;  1QKX A;  1H64 1;  5A0D A;  1PKT A;  3CC4 Q;  4KH0 B;  3MEW A;  1YJ9 A;  2XG8 D;  2IPO B;  2J06 A;  3OYL A;  1Z9Q A;  2KI7 A;  2C0T A;  1RAD B;  1JO8 A;  2DJQ A;  3OQ5 A;  2XI9 A;  4PLL A;  1B3Q A;  2GTO A;  2RN8 A;  3OS2 A;  2EVR A;  3JCM Q;  3ME9 A;  3OSV A;  1OU9 A;  2H3E B;  1IGQ A;  2W10 A;  4E2F B;  1WI7 A;  2F69 A;  2PVO B;  5HKC A;  1VQ4 A;  1SHG A;  4C0D B;  3CC7 T;  4XU3 A;  1BCO A;  5GAN j;  2HCK A;  2VB6 A;  4C5G A;  4MZP A;  3A8L B;  5AT1 B;  1WX6 A;  3PVL A;  3CCJ A;  2C06 A;  3JV3 A;  5LJ5 e;  1VQO A;  3L2Z A;  3DB4 A;  1M3A A;  4E7I A;  2J05 A;  1Q95 G;  2HSE B;  1RAC B;  4E7K A;  1RAH B;  4CC4 B;  1VUB A;  4C92 C;  4C92 G;  1NYG A;  2CUD A;  4Z88 A;  2R58 A;  2EQJ A;  4OB3 B;  3JCM J;  1KIK A;  1ZSZ B;  3OYD A;  1VQ9 T;  4JPB W;  4C92 E;  2WAC A;  2KAF A;  2RQV A;  1M90 U;  4V2S A;  2L5Q A;  3QWY A;  2PVG B;  3OSS C;  1EIF A;  2LCS A;  4C0Z A;  2VAS A;  2D1X A;  1U06 A;  2DD5 A;  4MDW A;  1VYT A;  4OMQ A;  2PZ1 A;  4HXJ A;  3M0P A;  1JRI A;  2X4X A;  1K0X A;  1ZSG A;  1PC0 A;  5HCK A;  2KY9 A;  4GLM A;  3VJP A;  2DL4 A;  4WF2 A;  3X20 B;  3CBO A;  2AKL A;  3D7S B;  2KNB B;  4RTT A;  4LDY A;  3ASK A;  3WVE B;  5LJ3 j;  4RTY A;  5KE3 A;  2AT1 B;  1WIE A;  4BI8 B;  1WZO A;  3G6E Q;  3GP8 A;  2M0O A;  2OTJ Q;  3E2U A;  3MEV A;  2M9U A;  2BIV A;  4F17 A;  4J6W A;  4JRI A;  5KYU A;  2RM4 A;  4JJB A;  1CKA A;  4KT0 E;  1VQM T;  4RG8 A;  4FSX A;  3ZL7 C;  4M78 F;  2EJF A;  3VS7 A;  1H8K A;  2CP5 A;  3OYA A;  2EYW A;  5HK3 A;  5A0G A;  2BZX A;  1M90 C;  1D3B A;  3I5S A;  2MI6 A;  4O6J A;  5GMK j;  4A53 A;  2F2W A;  1BIA A;  4J9F A;  3GBQ A;  1QVF A;  2CH4 A;  5FU6 B;  3PIP A;  2P4R A;  1K0S A;  2DLP A;  1JJ2 A;  2VVK A;  4DBH A;  4RKU E;  1RI9 A;  1E6G A;  4C92 A;  1G8X A;  5GAM g;  3GF5 A;  2MIO A;  4KUI A;  2OX7 A;  2CP3 A;  3CBP A;  4AG2 C;  3FIF A;  4HCC A;  3OBY A;  3QHS A;  1QQJ A;  5FLX E;  2ABL A;  3I56 T;  3EG0 A;  2QA4 A;  3OYH A;  3MO8 A;  1P92 A;  2L2P A;  1VQ4 T;  3EFO B;  1VQ8 Q;  3PIO A;  3KBG A;  1HD3 A;  4J6X A;  4KUD K;  1C0M A;  1GRI A;  4HVV A;  3CCJ T;  3L2V A;  1VQO T;  2MF2 A;  4N4H A;  1JJ2 P;  1FWZ A;  4F7U A;  1HYO A;  1X2K A;  3QKJ A;  1K73 R;  2LNV A;  4Q5W A;  2CKK A;  1DJ7 B;  1NYF A;  1YWP A;  2O2O A;  4PJN A;  3EFS A;  3L2W A;  2EQK A;  3TSW A;  2FPF A;  5IHN A;  3CPW A;  3RER A;  3OMC A;  1YI2 A;  1Q86 U;  2LDM A;  1M4Z A;  4F14 A;  2CT4 A;  2ZZD A;  1UEC A;  3O5Z A;  2F2X A;  1PM3 A;  3LLR A;  2OTL A;  2HBW A;  2KE9 A;  1XNI A;  1Q7Y R;  4E7S A;  5CR2 A;  1RL2 A;  2CUB A;  4JS5 A;  2A37 A;  1GBR A;  4BDY A;  3JCM e;  2AK5 A;  3CCM T;  1GCQ C;  5KYU B;  2LQ8 A;  2KK4 A;  4IUP A;  3HHT B;  1X69 A;  4AFU C;  4BE0 A;  3UA6 A;  3LWH A;  1GFD A;  1M1K R;  2BKD N;  1D3B B;  3ULR B;  3OMG A;  3SHW A;  1W70 A;  1X01 A;  4AFQ C;  3C4S A;  2RPN A;  1WNL A;  3RKX A;  1Q86 C;  2GF7 A;  2AZS A;  2GTJ A;  2MAM A;  2XK0 A;  2SRC A;  2RMO A;  4RCC A;  4C92 B;  2EPD A;  1WPY A;  4ELZ C;  4M78 C;  2EKH A;  1UEB A;  4M78 G;  4DOV A;  2D6F A;  4M7D C;  1FXX A;  2M0Y A;  3LH5 A;  4M7D G;  4J7I A;  4HCZ A;  3I9Q A;  2CP7 A;  1M8V A;  1G3S A;  2W0Z A;  1AWX A;  3R6O A;  4M78 E;  2A08 A;  1K9M R;  4M7D E;  1BB9 A;  1WXU A;  3EHQ A;  3O8V A;  3MP8 A;  5GAN e;  2PNI A;  4BDZ A;  2RB6 A;  2M16 A;  1VQN Q;  4AMC A;  2OJ2 A;  3QUI A;  2IIM A;  2QA4 T;  2CZ0 B;  2JTE A;  2K57 A;  4E7L A;  3QYG B;  3RR6 A;  5M9O A;  3M4G A;  3FJP A;  2ATC B;  2EJG A;  3G6E A;  4WCI A;  2DFU A;  1YIJ A;  1ZUY A;  3C0C A;  2AIR B;  3ZFJ A;  5D6X A;  3ZBD A;  1QVG S;  2K5F A;  1Y96 A;  2NLU A;  3G71 Q;  2DIL A;  5D7U A;  3S6W A;  2NWM A;  4KH1 B;  1XOV A;  5CQX A;  1WQW A;  1RLQ C;  2V26 A;  2C0O A;  3X24 B;  3F70 A;  4WTO B;  5L8R E;  1ACM B;  2DIQ A;  2Y4X A;  3U23 A;  5C0M A;  2CZ6 B;  1N8R R;  2HL3 A;  4C5H A;  3FEO A;  1ZBX A;  1UGV A;  2M02 A;  2DKG A;  2KT1 A;  5IXF A;  1YI2 T;  1T0H A;  3BFM A;  1I0C A;  2E5K A;  2DF6 A;  4X9C A;  1QP2 A;  2DER A;  2OTL T;  2CZ1 B;  4BE2 A;  2ESW A;  2ZAE A;  5KYY A;  1RAF B;  4FW1 A;  4BD3 A;  2CRE A;  3CD6 Q;  2DL5 A;  2FRW A;  5LJ3 e;  4M7D A;  3GLX A;  2K5L A;  3HKS A;  2YSQ A;  3EGU A;  4JUV A;  1VOM A;  1VQ8 A;  3EFR A;  5CKE A;  1R8O B;  3H9N A;  1KJW A;  3I35 A;  4IIO A;  1ABQ A;  3SDZ A;  1VQL T;  1G83 A;  3PNW C;  5CQY A;  4Y92 A;  1SRM A;  2FZK B;  2X51 A;  2DTI A;  1JU5 C;  2HQE A;  1TUG B;  2LC4 A;  4KBM B;  3V8J A;  2RI5 A;  4M75 F;  2P0P A;  4J9D A;  1SEM A;  4HT8 A;  3OYC A;  1AZG B;  5GAN 8;  2J6F A;  2MK5 A;  3HTR A;  2CSQ A;  3HRT A;  4CI0 C;  2DE0 X;  1VA7 A;  4II1 A;  3VYH B;  2QTV A;  1JBM A;  2DVJ A;  2VXF A;  5HY6 A;  4IUV A;  3SFM A;  1PD0 A;  4HA8 A;  1UFF A;  2GNC A;  5GAO r;  2BUD A;  3EAE A;  1M5Q 1;  1KG1 A;  3WXM B;  4N0A A;  2E4H A;  3DLL A;  4J9H A;  4D8D A;  5GMK m;  3EGD A;  2LT1 A;  1RAG B;  4LDX A;  2KDS A;  2LT4 A;  5GAO q;  4OP0 A;  2HD0 A;  4XU2 A;  1AWW A;  2QAZ A;  4FSS A;  2DXC A;  2DBK A;  1IRX A;  3G6E T;  4M78 D;  1YIJ T;  2RF0 A;  3H0H A;  1EX4 A;  2CGH A;  1NBE B;  4JJC A;  5AYF A;  4C8Q F;  1AEY A;  1PCX A;  2BZY A;  3S3O A;  2FG0 A;  2FRY A;  1JQQ A;  1SF9 A;  4XTX A;  4ZNX A;  2K3B A;  1I5O B;  1M1G A;  1K8A U;  2EFI A;  4M78 B;  3MEA A;  1YHQ T;  5KYY B;  1AT1 B;  2EYY A;  1AOJ A;  2YHT A;  4M7D B;  4LN2 A;  3KFV A;  2FB7 A;  1WHK A;  2JMA A;  3JRZ A;  5FWC A;  1EZZ B;  4XTY A;  1BK2 A;  2L3S A;  2YXY A;  3X26 B;  2KRN A;  2ZPG B;  1NJI R;  1PSF A;  4NL2 A;  1MMD A;  1ZSZ A;  4QQ6 A;  3L1A A;  3FLG A;  5IHK A;  1X75 C;  1TUC A;  1VIE A;  3QWX X;  3MCA B;  1VQ8 T;  1EFN A;  3C94 A;  3V8K A;  5GAO l;  3SEM A;  2KYM A;  4FT2 A;  4LXC A;  4CC7 A;  3ER0 A;  2R5M A;  1C6V X;  1YJN Q;  2FZC B;  2LJ0 A;  3HP9 A;  1D0X A;  1M1F A;  3S3M A;  2K3Y A;  3GOX A;  2OAU A;  1N27 A;  3M57 A;  3OY9 A;  1QCO A;  4FU6 A;  5GAN 2;  1WHM A;  2GGR A;  3M53 A;  4N4G A;  4JRQ A;  7AT1 B;  4R56 A;  3A8H B;  1K8A C;  5I22 A;  2E5Q A;  1BI3 A;  2ZPH B;  3A8M B;  3X25 B;  3OYN A;  3AHU A;  1YJW A;  2RD1 A;  3DLM A;  3CCR A;  3CME A;  1J3T A;  4X1V A;  3EGD B;  3RNJ A;  1D1C A;  1OUL A;  2X3W D;  1QLY A;  1MUZ A;  3QDR B;  1O9S A;  3PMI A;  2L3P A;  5LJ3 f;  1OYX A;  3IQL A;  2QYZ A;  2JJ9 A;  3INZ A;  4E7H A;  1PNJ A;  5LL6 S;  3RMS A;  3M59 A;  1IB8 A;  5IN1 A;  3H8Z A;  3PGG A;  3BE3 A;  3I55 Q;  2X4J A;  4JZ3 A;  3G4S Q;  2ECZ A;  1PRM C;  4QVC A;  2RI2 A;  5EC7 A;  2YUO A;  3CCS A;  4LUD A;  5FRO A;  1G3Y A;  2F5K A;  2K4Y A;  5J3B A;  3EFO A;  2O4X B;  2RQW A;  2DL3 A;  1Y7X A;  1QMC A;  2AZV A;  4OB2 B;  3AT1 B;  2COY A;  3TVT A;  1K76 A;  4PFO A;  4XQ3 A;  3J7A F;  2F5T X;  3EG1 A;  3CCQ Q;  2YLC A;  4C8Q C;  5GAN 6;  1BYM A;  2XID A;  4C8Q G;  3OYI A;  1WHL A;  3CCL A;  2RHY A;  1WFW A;  3JB9 F;  1R77 A;  2KMT A;  1AD5 A;  2X4W A;  4XTV A;  4J83 A;  2X4Y A;  3REA B;  3E9F A;  1M27 C;  2XMF A;  4KGX B;  2R57 A;  1ZHI A;  1QVG A;  4ZGD B;  5DM7 R;  4XU0 A;  4PLI A;  4CRI A;  1OV3 A;  1YP5 A;  2G3R A;  3VS1 A;  1KD1 R;  3RKY A;  2V1Q A;  3OYM A;  2YRC A;  1M2O A;  5CO7 A;  4F16 A;  8ATC B;  3JAM E;  1BCM A;  2Z0W A;  2DXU A;  3M0T A;  2P0Q A;  4LDV A;  3TEE A;  2QEX Q;  5LJ3 h;  2HZY A;  1GBQ A;  2CYZ B;  4A4G A;  3CCV T;  1ZBJ A;  4OB1 B;  2QDL A;  4RTZ A;  1UGP B;  1F1B B;  1S72 A;  1OZ2 A;  1W4S A;  1LPL A;  2EYQ A;  5KE2 A;  5J39 A;  1VQK Q;  1BI2 A;  2PUO B;  1LJO A;  2K5I A;  1VQ7 Q;  2EJ9 A;  1B07 A;  3P8H A;  4DBR A;  4BAC A;  1UJ0 A;  2IVW A;  4BUG A;  3OYE A;  1H3Z A;  3M0R A;  4R0K A;  4LNP A;  2EYX A;  2YT6 A;  1N5Z A;  5GMK h;  2DPP B;  1YJW T;  3UA7 A;  4IUR A;  3MP1 A;  2QAS A;  1PWT A;  3CCR T;  2QQR A;  3MKD A;  2JS0 A;  3CME T;  1YJ9 T;  3CC2 Q;  2GFU A;  3JB9 I;  2K6D A;  2RQT A;  1CKB A;  4XTZ A;  4KGV B;  2HKQ B;  4JRP A;  1E7O A;  1UGQ B;  2CH4 W;  4EMK C;  5GMK l;  3OYB A;  1VQ6 A;  3NFC A;  3QII A;  2LNH B;  1TS9 A;  1Q82 R;  1B7T A;  3HSB A;  1FMK A;  2E6Z A;  3OS1 A;  5GAM j;  3A98 A;  1I07 A;  3TSZ A;  1O75 A;  3JCM c;  4FCY A;  3SWN C;  1WJQ A;  4PJO F;  2COW A;  2E6N A;  2GCX A;  2A36 A;  1UTI A;  3CCS T;  1TU0 B;  5GMK i;  2QQB A;  1WJR A;  5KCO A;  2RH2 A;  4GY5 A;  4M75 D;  3CBM A;  3OYK A;  2XU8 A;  1QVF P;  1KQS S;  1KC8 R;  1NM7 A;  3HFN A;  4J6Y A;  4BI4 A;  1PKS A;  2G6F X;  4OMM A;  3LWI A;  3UT1 A;  1KHI A;  5CKD A;  4PFP A;  1ZUU A;  2HSP A;  4DBF A;  2J6K A;  3OYJ A;  4IKF A;  2QQS A;  2ZPF B;  3CC4 A;  1D09 B;  4K11 A;  4M7A F;  1QWE A;  2MWO A;  3CCL T;  3EGX B;  1T3L A;  3E9G A;  4HCB A;  4D8K A;  1RAB B;  2VWF A;  2RQR A;  2VV5 A;  2DXT A;  2PUK B;  2EAY A;  2CSI A;  3NTK A;  9ATC B;  2DEU A;  1BKB A;  1IGU A;  1X6O A;  3QJ6 A;  1PD1 A;  2E10 A;  2QGG A;  2FZG B;  3CCE Q;  2XDD A;  3BW1 A;  2GQV A;  4D6W A;  4MZT A;  4IUU A;  3LH0 A;  4EMK A;  4RTU A;  2LMJ A;  5KH6 A;  3LX7 A;  2JMC A;  2K9G A;  3KUF A;  1OI1 A;  1WHG A;  4C8Q D;  1IZ6 A;  1S72 T;  1QVP A;  2LJ3 A;  5GAO m;  5LJ5 f;  2ROL A;  3SWN A;  4OMO A;  3CPW P;  4XK8 E;  2NYS A;  2LZ6 B;  2K2M A;  4RUG A;  4MMK A;  2L89 A;  3JCM P;  1LCK A;  5GJV B;  2F1L A;  3CCQ A;  2VGN A;  1YFN A;  3SB2 A;  3CC7 Q;  4LD9 K;  1D0Z A;  4Z02 A;  2AKK A;  4OMN A;  4OGC A;  2XIC A;  2QI2 A;  4QT7 A;  3JB9 H;  4IUT A;  2E70 A;  1G3T A;  4N4I A;  2DZ9 A;  5CIU A;  1VQ6 T;  1OPK A;  3VRZ A;  5GAN 3;  4J9E A;  4EMG A;  3HFO A;  2H8H A;  4QW2 A;  3VS0 A;  4QVD A;  2FVU A;  2VKN A;  1QCF A;  1K73 U;  1UB4 A;  3HRS A;  2QEX A;  3KXT A;  3GNF B;  2QXF A;  4DEX A;  1RI0 A;  4ATO A;  1TTH B;  4E47 A;  1HXD A;  2OTJ A;  2O31 A;  3OYF A;  1VQK A;  4LDW A;  1I81 A;  1LOJ A;  4JS4 A;  1PHT A;  4PJO C;  1R0B G;  1GCQ A;  4PJO G;  1XQH A;  3NTH A;  1MNE A;  4M77 F;  1MV0 B;  3QDF A;  2DMO A;  5LJ5 h;  3X28 B;  3G1J A;  1QKW A;  1Q7Y U;  2DTH A;  4AT1 B;  3CC4 T;  2DL7 A;  4PJJ A;  4OVA A;  3CC2 A;  2KRS A;  4FIB A;  4BE1 A;  2XD0 A;  2D9T A;  4RTX A;  2XHC A;  1X43 A;  4FM4 B;  3VS2 A;  4EMK B;  1UHC A;  1K73 C;  3A5Z B;  4XTU A;  2JZ2 A;  1VQM Q;  2DBM A;  4J9I A;  5LJ5 g;  1YWO A;  3R6N A;  4PK4 A;  2DJZ A;  2KXD A;  4M78 A;  3JCM X;  1M1K U;  3RKW A;  4PL6 A;  1LVK A;  2DRK A;  3M56 A;  5D6W A;  2ED1 A;  1H3H A;  2VUB A;  4M4Z A;  2RHU A;  3SWN B;  4Y91 A;  3QPH A;  5I11 A;  1W2B S;  1JB0 E;  3S3N A;  1G5V A;  2RJD A;  1SG5 A;  1U3O A;  4FYX B;  2LTO A;  1D0Y A;  1SHF A;  2F2V A;  2DYI A;  1Q7Y C;  1FMV A;  5DLO A;  1K9A A;  1Q81 R;  2AHJ B;  3GPL A;  3Q1J A;  1ZA2 B;  2DL8 A;  3I56 Q;  4L6V 5;  3JB9 D;  2QQ9 A;  3OS5 A;  2VC8 A;  1K9M U;  1FYN A;  3QXE B;  4J9G A;  3CXC S;  2CP6 A;  2YWW A;  4OF1 A;  5GAO p;  3M0S A;  4B6M A;  1M1K C;  1U8R A;  2QDY B;  5GAM e;  2FPD A;  3CCJ Q;  4TVR A;  5IH2 A;  2JW4 A;  3CCE A;  3M4Y A;  3OYY A;  4KRT A;  3NMZ C;  3JCM f;  3MPU B;  3A1P A;  4OMP A;  1YIT Q;  2YDL A;  4X9D A;  2E1H A;  2QEX T;  3RES A;  3MHX A;  1K9M C;  1N8R U;  4ZGE B;  2OTJ T;  1VQK T;  2KRM A;  2M51 A;  1RAA B;  2DO3 A;  3UAT A;  2DAQ A;  4ZTJ A;  2LVM A;  3M54 A;  3OBW A;  2C0I A;  4IIM A;  3CCM Q;  2QK0 A;  5DLQ E;  1W1F A;  2WSE E;  4BY6 C;  1BBZ A;  2PU9 B;  4XTW A;  2O4X A;  4M77 C;  3PT9 A;  2RHX A;  4M77 G;  4C92 F;  1VQ5 Q;  1IO6 A;  2K2V A;  3NHN A;  4C0F A;  5A0L A;  4EPC A;  3RUX A;  1FMW A;  2ROT A;  3RMQ A;  5D6Y A;  1YBY A;  5GAN f;  4KGZ B;  4PJO D;  3EG3 A;  2DEQ A;  2Y90 A;  1HK9 A;  1VQN A;  3UF4 A;  1Y07 A;  1N8R C;  3DB3 A;  1U1S A;  2A7Y A;  4XU1 A;  2QQA A;  2E64 A;  3FRN A;  1BI0 A;  2KEA A;  2V8I A;  4EIK A;  2O9V A;  2EQM A;  3J81 E;  4HVU A;  1OEB A;  1GFC A;  1A0N B;  2J6O A;  3JCM h;  5A2Q E;  5FWB A;  1WLP B;  3C95 A;  4F7U F;  1WQ7 A;  4PFZ A;  5IT9 E;  6AT1 B;  1G3W A;  3G71 A;  4M7A D;  4EMH A;  2JN0 A;  3OW2 S;  1N6A A;  2JT4 A;  3N5B B;  2QA4 Q;  2CT3 A;  2NUZ A;  5GAN 7;  3EG2 A;  1M90 R;  3MP6 A;  1M3B A;  1PG5 B;  5DY9 A;  3JCM g;  2HDA A;  1TUD A;  4AG1 C;  3DKM A;  2QGF B;  3OA6 A;  3VU3 C;  4GBQ A;  4RTW A;  2O01 E;  5CKB A;  3REB B;  3NGP A;  4E6R A;  2I2L A;  4E7Z A;  4M75 C;  4M75 G;  2D8H A;  3GIB A;  4PJL A;  2JTM A;  3CEY A;  1YNZ A;  3CCE T;  1YN8 A;  1IXD A;  5L23 A;  1SKU B;  4M75 E;  4LDU A;  3CD6 A;  1OX9 A;  2QTX A;  5IXB A;  3CQT A;  1SRL A;  2DNU A;  1Y71 A;  1AWO A;  1VQP Q;  2MCN A;  1ZA1 B;  1I8F A;  2ZCF B;  2CS7 A;  1AVZ C;  2DA9 A;  5LJ5 d;  2LJ1 A;  2E3H A;  5GAN h;  4C5E A;  1YI2 Q;  3URG A;  4J9B A;  3VUB A;  1MMG A;  3BY7 A;  1U5S A;  4A4E A;  3UPU A;  2OTL Q;  3CCU Q;  4AFZ C;  1NEG A;  1M3C A;  3I56 A;  4J8O A;  3VKI A;  5GAN g;  5EG2 A;  3QZ5 B;  2DD4 A;  4PNO A;  2LX9 A;  3L2R A;  2EGC A;  3P8D A;  1NJI U;  1JXO A;  1M8M A;  1WA7 A;  2FYK A;  5GAM f;  2DX1 A;  2A3L A;  4DA4 A;  2IG0 A;  2K79 A;  1VQL Q;  3GNG A;  5FW9 A;  2RJF A;  1H92 A;  2JS2 A;  4FYV B;  4ORZ A;  2NUT A;  4C8Q E;  4ZN1 A;  1QP3 A;  1MND A;  4ESR A;  1I4K 1;  4MZM A;  2DXB A;  4QVZ A;  2P84 A;  3EGX A;  3VS3 A;  1VQN T;  2KR3 A;  3RBB B;  1YIT A;  4M75 A;  1NG2 A;  3VS5 A;  4BI3 A;  4RMO A;  2PVD B;  3H41 A;  2RK1 A;  1GL5 A;  3LGL A;  2K3X A;  4J5Y A;  1MMA A;  4JDS A;  2RHZ A;  4M77 D;  3V7C A;  1OZ3 A;  5CVI A;  5ECA A;  1NJI C;  1D1B A;  2YRD A;  3G71 T;  1HSQ A;  1I1J A;  2WSC E;  2ENM A;  2FO0 A;  5KYW A;  2LQN A;  3FB9 A;  2HMA A;  5KYX B;  2I0N A;  1QCN A;  5CAI A;  5LJ3 g;  1QVG P;  3CCM A;  1T0J A;  4LUE A;  1SSH A;  1Q86 R;  4F7U G;  2LCC A;  5CK9 A;  4BY6 B;  4MML A;  1W2B A;  4F7U E;  1YIJ Q;  1VQ5 A;  4M77 B;  4LE9 A;  3JCM b;  4HT9 A;  2DM1 A;  5IHI A;  4JJD A;  1KK7 A;  1AZE A;  2DRM A;  4CC3 A;  4M7D F;  4C8Q A;  5GAM h;  3CD6 T;  2FPE A;  1TSF A;  4VUB A;  3JB9 J;  3VV0 A;  1YCY A;  2MYS A;  5GAO n;  2E12 A;  2ZGW A;  1OX8 A;  1ZLM A;  2RO0 A;  3CXC A;  4JZ4 A;  4QKU A;  2HL5 C;  1YHQ Q;  1NPP A;  1IHV A;  1YJN A;  2L8D A;  2DZC A;  3EH2 A;  4F04 B;  1V29 B;  1VIF A;  2EQU A;  3PFS A;  4KUL A;  1W2B P;  5KCH A;  2EQI A;  1ZUK A;  1ZQ1 A;  2DYB A;  5GJW B;  3T9N A;  2EGE A;  2LX7 A;  4PJM A;  2FL7 A;  2M1H A;  1UE9 A;  2X3X D;  5FRN A;  2YUQ A;  4J7F A;  4FT4 A;  2OI3 A;  3ZEH A;  2FEI A;  2NUT B;  4MDX A;  4CC2 A;  3THK A;  2KBT A;  3JCM V;  1AHJ B;  1KD1 U;  4P5N A;  2CZ7 B;  4NS5 A;  1N9S A;  3FJ5 A;  3CXC P;  1Z9Z A;  3QJY A;  4RCB A;  4JJN K;  4OML A;  5CKF A;  2HQX A;  4M75 B;  1JEG A;  1WJS A;  3JCM d;  2HKN A;  1FX7 A;  1NE8 A;  2ED0 A;  2ZPE B;  4DQ2 A;  4OGE A;  2LP5 A;  1RLP C;  4HKE A;  3VS6 A;  1TH7 A;  3M0U A;  1RAE B;  3CMA Q;  3QBY A;  3J80 E;  3RDV A;  3JB9 G;  1YIT T;  1UHF A;  2X9H A;  1VQP A;  3JCM W;  4A4F A;  2D0N A;  3I55 A;  1XJW B;  3G4S A;  1U1T A;  3L42 A;  3L2U A;  3HL8 A;  2BE9 B;  3PE0 A;  2RI3 A;  5KYW B;  2HEQ A;  2H3J A;  2RJE A;  3NTI A;  1BIB A;  2KSS A;  1WXT A;  4R55 A;  4RG2 A;  1BU1 A;  2SEM A;  1M9S A;  2CDT A;  2KXC A;  5I21 A;  3CCU A;  1CSK A;  3M55 A;  2O88 A;  1R0C B;  1MHN A;  1KD1 C;  4QQD A;  5FU7 C;  4OMF B;  1C1A A;  2XKO C;  1QWF A;  4L59 A;  4O5V A;  4C92 D;  1Q82 U;  1X2Q A;  2MMP A;  2NUP A;  4DBQ A;  1JXM A;  1VQL A;  2RQU A;  2EW3 A;  4BB7 A;  4C8Q B;  4J9C A;  1VQ5 T;  4IUQ A;  1T3S A;  2CP0 A;  3PTA A;  3LW5 E;  5GAN d;  4JRK A;  1PRL C;  1KHC A;  5C6S A;  3JSC A;  2EWN A;  3QO3 A;  2JM9 A;  4A4K A;  2JUF A;  2PQW A;  2J7I A;  2L0A A;  1UJY A;  5GAN 4;  1NLP C;  1ZX6 A;  1OQK A;  2EIF A;  2ZPI B;  4GLK A;  3TRE A;  4ZGJ B;  3OS0 A;  3OW2 A;  1KC8 U;  4ANJ A;  3NPF A;  4EDU A;  3CPF A;  4ZTF A;  3V8L A;  1TG0 A;  1WHJ A;  2KGT A;  4C0G A;  2KYB A;  1YJN T;  3WVD B;  1OOT A;  2HBP A;  3UDC A;  4AFS C;  1VQ9 Q;  2BZ8 A;  3RIR A;  2DK3 A;  2RK2 A;  2O9S A;  1Q82 C;  3FDR A;  2LCL A;  5I2S A;  4JLG A;  2GQI A;  1VQ7 A;  2L3R A;  2L3Q A;  1UUE A;  1WXB A;  2HNI A;  3H6Z A;  1GCP A;  3M58 A;  2KT8 A;  2VYT A;  1N9R A;  2V8J A;  1K4U S;  2B86 A;  1BI1 A;  2KVQ G;  4F7U B;  1PSE A;  4PJO E;  3TCJ A;  3OW2 P;  2V8K A;  1VYU A;  3CCV Q;  1V76 A;  1KQ1 A;  1X6B A;  2YUP A;  3LYI A;  4FYW B;  2EYZ A;  1ABO A;  1ARK A;  3E1S A;  1GXI E;  3E19 A;  4XAX B;  1KC8 C;  1SSF A;  5LJ3 d;  2JM8 A;  1NLO C; 
#chains in the Genus database with same CATH homology
 2F5T X;  2CKK A;  2O4X A;  1DJ7 B;  3PT9 A;  4M77 C;  1QW1 A;  3HPW A;  3OYG A;  2RHX A;  4M77 G;  4C92 F;  2YLC A;  4C8Q C;  5GAN 6;  1BYM A;  2XID A;  2K2V A;  4C8Q G;  3OYI A;  4NL3 A;  4C0F A;  5A0L A;  3CCL A;  4EPC A;  2RHY A;  3BDL A;  3RUX A;  3JB9 F;  4M7A C;  2KMT A;  2X4W A;  4XTV A;  5I2M A;  3RMQ A;  5D6Y A;  3EFS A;  4M7A G;  4J83 A;  4DOW A;  1YBY A;  3L2W A;  2X4Y A;  2EQK A;  4PKC C;  5GAN f;  1VQP T;  5LJ5 j;  3E9F A;  3CPW A;  3I55 T;  4PJO D;  3A8G B;  3G4S T;  3RER A;  4M7A E;  2DEQ A;  2R57 A;  2Y90 A;  1HK9 A;  3OMC A;  1ZHI A;  4N0A C;  1YI2 A;  1Q86 U;  2LDM A;  1QVG A;  1VQN A;  4ZGD B;  1M4Z A;  5DM7 R;  1YHQ A;  1Y07 A;  4XU0 A;  2ZZD A;  4PLI A;  3DB3 A;  4CRI A;  1N8R C;  1U1S A;  2G3R A;  2A7Y A;  4XU1 A;  2QQA A;  2FHD A;  3RKY A;  3LLR A;  2RJC A;  3OYM A;  2E64 A;  2OTL A;  3FRN A;  1XNI A;  1BI0 A;  2JVV A;  2V8I A;  3C12 A;  4E7J A;  5CO7 A;  3JAM E;  5CR2 A;  3CCU T;  1RL2 A;  2ZPB B;  2DXU A;  2EQM A;  3J81 E;  4JS5 A;  2P0Q A;  4LDV A;  4BDY A;  3TEE A;  3JCM e;  3JCM h;  5LJ3 h;  4ZN3 A;  5A2Q E;  2CYZ B;  4A4G A;  3CCV T;  3C95 A;  4F7U F;  1WGS A;  4FL6 A;  3CCM T;  4OB1 B;  1WQ7 A;  5IT9 E;  1UGP B;  3QYH B;  1S72 A;  1G3W A;  1OZ2 A;  1W4S A;  5GAM d;  3G71 A;  4M7A D;  2EYQ A;  2LQ8 A;  2KK4 A;  4IUP A;  3HHT B;  4EMH A;  5KE2 A;  5J39 A;  4BE0 A;  4C0D C;  2JN0 A;  3MET A;  3OW2 S;  2R5A A;  1QVF S;  1BI2 A;  3LWH A;  1N6A A;  2PUO B;  3CCQ T;  1LJO A;  2K5I A;  3N5B B;  2XDB A;  2EJ9 A;  1NZ9 A;  1XTD A;  2BKD N;  2D0Q B;  3P8H A;  5GAN 7;  3MP6 A;  4BAC A;  4PJO A;  1D3B B;  3PMT A;  2IVW A;  5DY9 A;  4BUG A;  3JCM g;  1JJ2 S;  2HAX A;  3OMG A;  3OYE A;  3MEU A;  1H3Z A;  1X01 A;  3DKM A;  3C4S A;  3OA6 A;  3VU3 C;  5GMK e;  5GMK h;  2DPP B;  1YJW T;  2LQK A;  2YRV A;  4IUR A;  3MP1 A;  2O01 E;  3M9Q A;  1WNL A;  5CKB A;  3RKX A;  1Q86 C;  2GF7 A;  3V7R A;  2QQR A;  3CCR T;  2I2L A;  4B9X A;  2MAM A;  2XK0 A;  4M75 C;  3CME T;  1YJ9 T;  4RCC A;  4C92 B;  3CMA A;  2GFU A;  4M75 G;  3JB9 I;  3GIB A;  1WPY A;  2JTM A;  4XTZ A;  3CEY A;  4ELZ C;  3CCE T;  2EKO A;  4M78 C;  4JRP A;  1UGQ B;  1UEB A;  4M78 G;  4EMK C;  5GMK l;  3OYB A;  4M75 E;  1VQ6 A;  4LDU A;  4DOV A;  3CD6 A;  1LNX A;  1B34 A;  2D6F A;  3NFC A;  1FXX A;  3QII A;  4B9W A;  4ELY C;  4M7D C;  4M7D G;  4J7I A;  2QTX A;  4X34 A;  4HCZ A;  4YTL A;  3HSB A;  1M8V A;  1G3S A;  1Y71 A;  3R6O A;  2E6Z A;  4M78 E;  4A54 A;  4M7A A;  4ME7 A;  3OS1 A;  5GAM j;  4M7D E;  1I8F A;  2ZCF B;  3BDU A;  2CS7 A;  5LJ5 d;  3O8V A;  3MP8 A;  2JTF A;  5GAN e;  1O75 A;  3JCM c;  2JNG A;  5GAN h;  3SWN C;  4C5E A;  4BDZ A;  2RB6 A;  3URG A;  2M16 A;  1I5L A;  3VUB A;  2DTO A;  1WJQ A;  3QUI A;  2E65 A;  3BY7 A;  5CKH A;  4PJO F;  2E6N A;  2QA4 T;  1VQ7 T;  2CZ0 B;  2K57 A;  4Y28 E;  4A4E A;  3QYG B;  4E7L A;  5FU7 B;  2GCX A;  2P0K A;  5CCA A;  3UPU A;  5M9O A;  3LGF A;  3CCS T;  5GMK i;  2QQB A;  3SD4 A;  2DVE A;  1WJR A;  4JLI A;  3M4G A;  5KCO A;  2RH2 A;  4GY5 A;  4M75 D;  3CBM A;  3FJP A;  3OYK A;  2XU8 A;  2EJG A;  3I56 A;  1KQS S;  3G6E A;  1Y96 B;  3HFN A;  2B8A A;  4J8O A;  1YIJ A;  3VKI A;  5GAN g;  3QSU A;  3HRU A;  3CC7 A;  5EG2 A;  4J6Y A;  3CPW S;  3ZFJ A;  2RA2 A;  4BI4 A;  3QZ5 B;  2DD4 A;  4PNO A;  2LX9 A;  3L2R A;  3P8D A;  5D6X A;  3ZBD A;  2XDP A;  3LWI A;  4OB0 B;  2GFA A;  3UT1 A;  1KHI A;  1QVG S;  1NJI U;  3CC2 T;  2K5F A;  4M7D D;  1Y96 A;  2NLU A;  4UC4 A;  5CKD A;  2FYK A;  5GAM f;  2A3L A;  3OYJ A;  4DA4 A;  4IKF A;  2IG0 A;  3S6W A;  1NPR A;  1XOV A;  5CQX A;  1WQW A;  3V7S A;  2QQS A;  2ZPF B;  3CC4 A;  3GNG A;  2DIG A;  3M5A A;  4M7A F;  2MWO A;  2RJF A;  3X24 B;  3F70 A;  4M77 E;  3CCL T;  1KQS A;  3E9G A;  4HCB A;  5L8R E;  2DIQ A;  2Y4X A;  5C0M A;  1KQ2 A;  4C8Q E;  2CZ6 B;  4ZN1 A;  1QP3 A;  1I4K 1;  2VV5 A;  4MZM A;  2DXT A;  2PUK B;  1ZBX A;  3FEO A;  4C5H A;  2DXB A;  2EAY A;  2DKG A;  4QVZ A;  3NTK A;  4LD6 A;  1BKB A;  1YI2 T;  1Q81 U;  1VQN T;  1X6O A;  3QJ6 A;  5FRM A;  2P4T A;  3BFM A;  4QQG A;  3FC3 A;  2E10 A;  4NOY A;  5FU6 C;  1YIT A;  4M75 A;  4X9C A;  1UGS B;  2XDD A;  1VQ9 A;  1QP2 A;  5HK0 A;  3BW1 A;  2X35 A;  2GQV A;  4BI3 A;  4D6W A;  5IAY A;  4RMO A;  2OTL T;  2PVD B;  2CZ1 B;  4MZT A;  4IUU A;  4BE2 A;  2RK1 A;  2Y4Y A;  3LH0 A;  3LGL A;  4EMK A;  2K3X A;  4J5Y A;  4BD3 A;  2VXE A;  5GAN 5;  5LJ3 e;  4M7D A;  4JDS A;  2RHZ A;  5KH6 A;  3GLX A;  3LX7 A;  4M77 D;  3TU4 K;  3KUF A;  2K5L A;  3G7Z A;  1OZ3 A;  1OI1 A;  3HKS A;  3V7C A;  4JUV A;  4C8Q D;  1IZ6 A;  5CVI A;  1VQ8 A;  1NJI C;  4PJO B;  3EFR A;  1S72 T;  1QVP A;  2MWP A;  5CKE A;  3G71 T;  1R8O B;  5GAO m;  2WSC E;  5LJ5 f;  2VGM A;  3SWN A;  3FB9 A;  3VUZ A;  3VYG A;  1IRE B;  2RHI A;  4XK8 E;  3SDZ A;  1VQL T;  5CAI A;  3CCV A;  4C5I A;  3PNW C;  5LJ3 g;  3CCM A;  5CQY A;  4MMK A;  5J26 A;  4F7U G;  2LRQ A;  2DTI A;  2JOY A;  2LCC A;  3L2Q A;  5CK9 A;  3P8B B;  1MGQ A;  2L89 A;  2KQW A;  3JCM P;  2HQE A;  2E41 A;  2LC4 A;  4KBM B;  4BY6 B;  4MML A;  3V8J A;  1W2B A;  3CCQ A;  2RI5 A;  3QZ9 B;  4F7U E;  2VGN A;  1VQ5 A;  3QG1 A;  3SB2 A;  4M77 B;  1Q81 C;  4M75 F;  4LD9 K;  1VQM A;  1B34 B;  2P0P A;  4Z02 A;  1UGR B;  3JCM b;  4HT9 A;  4HT8 A;  2WSF E;  3A8O B;  3OYC A;  3CMA T;  5GAN 8;  3OB9 A;  4M7A B;  2YLB A;  4OGC A;  2XIC A;  2QI2 A;  3HRT A;  4CI0 C;  4M77 A;  4II1 A;  3JB9 H;  4IUT A;  2E70 A;  1G3T A;  4L5G A;  2DZ9 A;  4N4I A;  5CIU A;  3UWN A;  3VYH B;  4A4H A;  4C8Q A;  1VQ6 T;  4M7D F;  5GAM h;  1H64 1;  5A0D A;  1JBM A;  3CD6 T;  2VXF A;  5HY6 A;  4VUB A;  3JB9 J;  3MEW A;  3VV0 A;  1YCY A;  2XG8 D;  4IUV A;  3SFM A;  1YJ9 A;  5GAN 3;  4HA8 A;  5GAO r;  5GAO n;  2E12 A;  3OYL A;  2ZGW A;  2BUD A;  3EAE A;  4EMG A;  1M5Q 1;  1KG1 A;  3HFO A;  3WXM B;  4QW2 A;  2RO0 A;  3CXC A;  4QVD A;  4N0A A;  2FVU A;  3DLL A;  5GMK m;  3OQ5 A;  1NPP A;  2XI9 A;  2LT1 A;  1K73 U;  1YJN A;  2L8D A;  2DZC A;  1UB4 A;  3HRS A;  4PLL A;  2QEX A;  3KXT A;  3GNF B;  1V29 B;  3OS2 A;  3JCM Q;  1VIF A;  2QXF A;  2EQU A;  4LDX A;  3PFS A;  2KDS A;  2LT4 A;  4KUL A;  3ME9 A;  3OSV A;  5GAO q;  4OP0 A;  2HD0 A;  5KCH A;  1RI0 A;  4XU2 A;  1ZQ1 A;  4ATO A;  2F69 A;  2PVO B;  5HKC A;  4E47 A;  2DXC A;  3T9N A;  1HXD A;  2OTJ A;  3OYF A;  3G6E T;  1VQK A;  4M78 D;  4LDW A;  1I81 A;  1VQ4 A;  2FL7 A;  1LOJ A;  1YIJ T;  2M1H A;  4C0D B;  4JS4 A;  4XU3 A;  3CC7 T;  4PJO C;  5GAN j;  4PJO G;  2CGH A;  1XQH A;  3NTH A;  4C5G A;  5FRN A;  4J7F A;  4FT4 A;  4MZP A;  4M77 F;  3ZEH A;  3A8L B;  4MDX A;  5AYF A;  4C8Q F;  3JCM V;  1AHJ B;  1KD1 U;  3CCJ A;  2C06 A;  4P5N A;  2CZ7 B;  4NS5 A;  5LJ5 e;  5LJ5 h;  1VQO A;  1N9S A;  3X28 B;  1Q7Y U;  2DTH A;  3CC4 T;  3QJY A;  4RCB A;  3L2Z A;  4OVA A;  3DB4 A;  4JJN K;  3S3O A;  3CC2 A;  4FIB A;  4E7I A;  5CKF A;  4BE1 A;  2HQX A;  4M75 B;  1WJS A;  2XD0 A;  2D9T A;  4XTX A;  3JCM d;  1FX7 A;  1NE8 A;  2ZPE B;  2XHC A;  4DQ2 A;  4OGE A;  4E7K A;  1M1G A;  1K8A U;  2EFI A;  1VUB A;  4FM4 B;  4C92 C;  4M78 B;  4HKE A;  3MEA A;  1YHQ T;  1TH7 A;  4C92 G;  4EMK B;  1K73 C;  3A5Z B;  4XTU A;  2R58 A;  2JZ2 A;  2YHT A;  2EQJ A;  4OB3 B;  3QBY A;  3J80 E;  3JCM J;  5LJ5 g;  4M7D B;  3JB9 G;  1YIT T;  2FB7 A;  3OYD A;  1VQP A;  3JCM W;  4A4F A;  3I55 A;  4C92 E;  1VQ9 T;  3JRZ A;  2DJZ A;  2WAC A;  2KAF A;  4M78 A;  3JCM X;  3G4S A;  4XTY A;  1M1K U;  1M90 U;  3RKW A;  1U1T A;  4PL6 A;  4V2S A;  3M56 A;  3X26 B;  5D6W A;  3L42 A;  2L5Q A;  2ZPG B;  1PSF A;  3L2U A;  3HL8 A;  4NL2 A;  2PVG B;  2VUB A;  3OSS C;  2RHU A;  1EIF A;  4QQ6 A;  2RI3 A;  4C0Z A;  3L1A A;  3SWN B;  3FLG A;  1X75 C;  2H3J A;  2DD5 A;  2RJE A;  3NTI A;  1BIB A;  2KSS A;  3QPH A;  4MDW A;  4RG2 A;  4Y91 A;  4R55 A;  1W2B S;  1M9S A;  1VIE A;  1JB0 E;  3MCA B;  3S3N A;  1VQ8 T;  3CCU A;  1JRI A;  2RJD A;  5I21 A;  3C94 A;  3V8K A;  5GAO l;  1G5V A;  2X4X A;  3M55 A;  4FT2 A;  2KY9 A;  1MHN A;  2LTO A;  3ER0 A;  1KD1 C;  2R5M A;  4QQD A;  5FU7 C;  3VJP A;  4OMF B;  4WF2 A;  3X20 B;  2XKO C;  3HP9 A;  3CBO A;  1M1F A;  3S3M A;  2K3Y A;  3GOX A;  2OAU A;  1Q7Y C;  1N27 A;  3M57 A;  5DLO A;  4L59 A;  3ASK A;  4LDY A;  3OY9 A;  4O5V A;  3WVE B;  4C92 D;  4FU6 A;  5GAN 2;  5LJ3 j;  2AHJ B;  3GPL A;  3Q1J A;  1Q82 U;  3M53 A;  5KE3 A;  4BI8 B;  2MMP A;  3JB9 D;  4L6V 5;  4N4G A;  2QQ9 A;  3OS5 A;  2M0O A;  2VC8 A;  3GP8 A;  4JRQ A;  1K9M U;  4R56 A;  3A8H B;  3MEV A;  1K8A C;  2E5Q A;  2M9U A;  1VQL A;  2BIV A;  1BI3 A;  3QXE B;  4J6W A;  4JRI A;  4BB7 A;  4C8Q B;  2RM4 A;  4IUQ A;  2ZPH B;  3A8M B;  3CXC S;  1VQ5 T;  3PTA A;  4KT0 E;  1VQM T;  3LW5 E;  5GAN d;  4RG8 A;  4JRK A;  4FSX A;  4OF1 A;  3X25 B;  5GAO p;  4M78 F;  2EJF A;  3OYN A;  1KHC A;  5C6S A;  3JSC A;  2EWN A;  3QO3 A;  1YJW A;  3AHU A;  3OYA A;  2RD1 A;  5HK3 A;  1M1K C;  1U8R A;  2QDY B;  4A4K A;  5A0G A;  1M90 C;  3DLM A;  2JUF A;  5GAM e;  3CCR A;  2PQW A;  1D3B A;  4TVR A;  2MI6 A;  3CME A;  4O6J A;  5GAN 4;  5GMK j;  4A53 A;  1BIA A;  4GLK A;  2EIF A;  2ZPI B;  3OS0 A;  3TRE A;  4ZGJ B;  3CCE A;  3OW2 A;  1KC8 U;  3QDR B;  1QVF A;  5FU6 B;  3M4Y A;  3PIP A;  1O9S A;  3OYY A;  3PMI A;  4EDU A;  3CPF A;  5LJ3 f;  1OYX A;  3JCM f;  4ZTF A;  3V8L A;  1JJ2 A;  4RKU E;  3INZ A;  4E7H A;  4C92 A;  4C0G A;  5GAM g;  3GF5 A;  5LL6 S;  1YJN T;  4X9D A;  3RMS A;  3M59 A;  3WVD B;  2E1H A;  2HBP A;  4KUI A;  5IN1 A;  3H8Z A;  3UDC A;  2QEX T;  3PGG A;  3CBP A;  2X4J A;  3FIF A;  3RIR A;  2DK3 A;  2RK2 A;  4HCC A;  3OBY A;  1Q82 C;  3FDR A;  3QHS A;  2LCL A;  3RES A;  5I2S A;  5FLX E;  3MHX A;  4QVC A;  3I56 T;  1K9M C;  4JLG A;  1N8R U;  4ZGE B;  2QA4 A;  3OYH A;  1VQ7 A;  3MO8 A;  2OTJ T;  2RI2 A;  1P92 A;  2L3R A;  1VQK T;  1VQ4 T;  3H6Z A;  2HNI A;  3PIO A;  3KBG A;  3CCS A;  3M58 A;  2VYT A;  1N9R A;  5FRO A;  1G3Y A;  2F5K A;  2V8J A;  2DO3 A;  4J6X A;  4KUD K;  1BI1 A;  2K4Y A;  2KVQ G;  1PSE A;  4F7U B;  4PJO E;  2DAQ A;  5J3B A;  4ZTJ A;  2LVM A;  3TCJ A;  3M54 A;  2V8K A;  3CCJ T;  3L2V A;  3OBW A;  1KQ1 A;  2O4X B;  1VQO T;  3LYI A;  2MF2 A;  4N4H A;  1Y7X A;  3E1S A;  5DLQ E;  1GXI E;  1FWZ A;  2WSE E;  4OB2 B;  4F7U A;  3E19 A;  4XAX B;  1KC8 C;  3QKJ A;  1SSF A;  2LNV A;  5LJ3 d;  4BY6 C;  4Q5W A;  2PU9 B;  4XQ3 A;  3J7A F;  4XTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...