1OU8A

Structure of an aaa+ protease delivery protein in complex with a peptide degradation tag
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
b'SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B homolog
publication title Structure of a delivery protein for an AAA+ protease in complex with a peptide degradation tag
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
total genus 28
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1ou8A00
1ZSZB 1OU9A 1OU8A 1ZSZC 1OULA 2QAZA 1OX8A 2NYSA 1OX9A 1ZSZA 1YFNA 2QASA 1TWBA
chains in the Genus database with same CATH superfamily
1OPLA 2XIDA 1SF9A 3M55A 1D3BA 1ACMB 3CCVQ 3E19A 2DL8A 1VQ4T 4P5NA 4C92B 2L89A 3FDRA 1NPRA 3QJ6A 2LMJA 4RMOA 5GAOm 1WHGA 2RHIA 1PCXA 2DKGA 4M78F 3HTRA 2KXDA 1VQPA 2LDMA 1KQSS 3EG9A 4OB3B 2OX7A 1MMAA 4GLMA 1VQPT 2CH4W 1HJDA 1QVFS 4MZMA 4BD3A 3RDVA 2CZ1B 3J7AF 2DX1A 2DTHA 4M7AF 2R5AA 2KYMA 1VQPQ 2EYZA 2L5QA 3C95A 1PSFA 1GRIA 4ZTFA 1UTIA 1VQLT 5I21A 2YWWA 5KH6A 3RKXA 1RI0A 3EGDA 3X28B 2K6DA 1GFCA 3RERA 1G8XA 2VV5A 2XG8D 4CC4B 1ZLMA 1OV3A 1VQLQ 3C0CA 2LQ8A 4QVDA 2HAXA 2E1HA 4YTLA 2DAQA 1UEBA 1QCFA 4PJOD 3X25B 1WXUA 2D9TA 1ZUUA 3M0RA 2K7AA 4M7DA 2O9SA 2RHXA 1YCSB 5GAMg 2GGRA 3R6OA 1N9SA 2QTVA 1IXDA 4ZGEB 1TTHB 1GBRA 2LC4A 1B34B 4NS5A 4RTVA 3CCUT 2DVEA 3PIPA 4XU3A 1B7TA 1MMNA 3VV0A 5GAOr 4AFQC 1EIFA 4AT1B 3CCUQ 1OYXA 2KMTA 2IVWA 4JJBA 4M75C 1UHFA 1N8RR 4CI0C 1K73U 2QAZA 3KBGA 3CCET 2F69A 1PD0A 1WI7A 2MF2A 4N0AC 1MGQA 4ZGDB 4C8QD 1K73C 2DXTA 4ELZC 5KYWA 3JV3A 3JSCA 2JUFA 4EDUA 4OB2B 2LNHB 2BZXA 1K1ZA 4DBHA 2QXFA 2KEAA 5LJ5j 1U1TA 2FL7A 3I9QA 4D8DA 1Z9ZA 5A2QE 3UT1A 3JCMc 2WSFE 2F5KA 4ATOA 1Y57A 2PZ1A 2DYBA 3JCMP 2AHJB 2Z0WA 5FRNA 2F2XA 4E7HA 1QVGA 3QSUA 1N8RC 2EJFA 2XK0A 3OMGA 1YJNA 4MMKA 1JJ2S 2AIRB 2KRSA 1OQKA 2E5KA 3M0PA 1TS9A 2LJ1A 3VS7A 3C12A 1BYMA 1MMGA 3OA6A 4J8OA 1YHQA 2ZZDA 2QDYB 1PRLC 1AVZC 3I5SA 1WGSA 2KQWA 4BI8B 4C0DC 1WXBA 1RACB 1D1CA 3EG3A 2E3IA 4KUDK 4MDWA 1FYNA 1AZEA 4B9XA 4M78C 1YHQQ 3D7SB 5CCAA 5GAOq 1M30A 2FHDA 3ER0A 4XTZA 1BB9A 5L8RE 1VQNA 3NMZC 2QQSA 5KE3A 3ZL7C 2KK4A 4M7AC 2QA4A 3LGFA 4RTXA 2ROTA 5LJ5d 1X43A 1M1KR 1PKSA 2H3EB 4OP0A 1WQWA 2KI7A 4FSXA 4OB0B 4GBQA 6AT1B 2JW4A 3OS0A 1K9MR 3PVLA 4KBMB 4IIOA 1VQ9A 2QA4Q 4HVWA 5GJWB 4EMGA 1R0BG 2PUOB 4LXCA 3OYNA 3L2QA 2Y4YA 1ARKA 3S6WA 5GANg 3QG1A 3M0QA 1T0HA 2EQJA 4A4KA 1KQSP 5L23A 3V7RA 2C06A 4C5GA 4LUDA 2F5TX 1OZ3A 1QVFP 3EH1A 5FU7C 4E2FB 4M75E 3I56A 3OB9A 2P4RA 2O2OA 3RBBB 4PJOA 1VA7A 3H41A 2DBKA 4IIMA 3V7SA 5KCOA 2ED1A 3H0HA 2DF6A 2O31A 2PNIA 1M1KC 3L2UA 2G6FX 5GAN7 1M2VB 1ABQA 1F1BB 2YXYA 1ZSZA 2L8DA 1K9MC 5GANh 5CVIA 4RCCA 2P84A 1X27A 2ECZA 1NJIR 5LL6S 1JQQA 1ZX6A 4QKUA 2IG0A 4JZ3A 5DY9A 1CSKA 2AT1B 2DZCA 4L6V5 2EJ9A 5IAYA 3X26B 3CCLT 2DLPA 3M56A 2CUDA 1KG1A 2COZA 1VQ6T 2FVUA 2EGEA 1FX7A 3QO3A 2YHTA 2V26A 1KJWA 4LUEA 2DXBA 4DOWA 4QT7A 2LRQA 1P92A 5HK3A 1GFDA 1UJ0A 2ED0A 2CS7A 4J9IA 3GLXA 4C8QA 1NJIU 4MDXA 1W2BS 3TCJA 3OYGA 3A8LB 4QVCA 1KSWA 4L5GA 4XU0A 2HQEA 3FEOA 1QCOA 1NJIC 2I2LA 4PJOF 1ABOA 4M78E 4OB1B 1U06A 3U23A 2KYBA 2K3YA 2D0QB 2RI2A 2KNBB 1QQJA 1KC8U 1Y07A 3DB4A 4ZN1A 1N9RA 4N4HA 3P8HA 3ME9A 4AMCA 1Q7YR 3OMCA 2BKDN 1U1SA 1H3HA 4J9DA 4XU2A 5C6SA 1IGUA 1UGSB 5KYUA 4M77D 3JCMh 3PGGA 1M8MA 4ZGJB 3V8KA 3LH0A 1WJSA 2DZ9A 1CKBA 3RMSA 4J9FA 5GMKm 2R58A 2DE0X 1M3CA 1Y96A 3QHSA 1WQ7A 4KRTA 3G1JA 4QQDA 2QASA 3VRZA 4M75B 3CCMT 1Q82U 1TUGB 3VJPA 4C8QF 4M78G 2EW3A 5A0LA 2KRMA 2YRDA 4F16A 4OMLA 4PLIA 1RADB 3EFOB 1JJ2P 3VKIA 2LQWA 3LYIA 1UE9A 2RK2A 2YLBA 1LPLA 1Q7YC 1YITA 2A7YA 2LCLA 3H8ZA 1C0MA 1FMVA 2ZPIB 1H8KA 1IGQA 2LJ3A 5GMKl 4JJDA 1I4K1 3R6NA 3M0UA 3BW1A 1LJOA 4O6JA 1RAAB 2J7IA 3SHWA 1YITQ 2DTOA 2EBPA 3M53A 4OMFB 4M7DD 1D1AA 3PMIA 8AT1B 1G83A 2RQVA 1D09B 1QKXA 2E65A 2MK5A 5FWCA 3QJYA 5LJ5f 3VUBA 2GFAA 4D6WA 1SG5A 2LVMA 2C0OA 4M77G 4WF2A 2OAUA 4C0DB 1AEYA 2AKKA 2H3JA 2A28A 2MWPA 2XI9A 2VVKA 4M7DE 1VQOT 2KVQG 4M78B 4LN2A 2YSQA 3JB9H 5M9OA 2QTXA 3A8GB 5CKFA 2RD1A 1UECA 4KULA 1I81A 3PIOA 1VQOQ 1YJ9A 2DETA 2XKOC 1IB8A 4AFSC 1KHCA 7AT1B 1Q86U 1BI1A 2C0TA 1I5OB 3JCMd 1OU8A 2EKOA 2MWOA 5KCHA 4JJCA 4RKUE 4OVAA 3JCMb 3GOXA 3EG2A 2LQNA 1TOVA 2K2VA 2K9GA 1YJ9Q 2V1QA 2E10A 3P8BB 3X20B 3A98A 3CCRA 1YIJA 1WXTA 1HSQA 2K2MA 5GAN2 4PJOC 1G2BA 3OYEA 3RUXA 2ZGWA 3TSZA 1QVGS 3UATA 2RJEA 2RHUA 4JRQA 3O5ZA 2GCXA 5IHKA 3AHUA 4RTWA 3OYCA 2C0IA 3NGPA 1VQMA 3L1AA 4F7UA 4M7DG 1PHTA 4J9HA 1PC0A 1AHJB 1D3BB 2YUPA 5GAN5 2COYA 1U3OA 5FU7B 2OTLA 1XOVA 2CSQA 3OS2A 5GAMj 2GBQA 5IH2A 1K76A 2Y90A 1NM7A 1VQMQ 3J80E 4X9CA 4F04B 4BE1A 2YLCA 2DL3A 2GQIA 3EG9B 4HKEA 2CT3A 2P0KA 8ATCB 1W2BP 1N27A 1VQ4A 2OTLQ 1MHNA 4M77A 2EAYA 2K57A 1NZ9A 5FWBA 2LT4A 3QPHA 2RHZA 3A8HB 2D6FA 4GY5A 3OYIA 1YWPA 4BY6C 3UWNA 1GL5A 2YUOA 4RTZA 2GQVA 2OAWA 3OYLA 1VQ4Q 4C8QC 1TG0A 4XQ3A 3ASKA 2RQWA 1KIKA 4WCIA 5KYYA 2JN0A 1JBMA 5LJ3e 4XAXB 1I1JA 3EGDB 1WDXA 4J83A 1YN8A 4C0GA 1NEGA 4XTYA 1K9AA 3FC3A 4LD9K 4A4HA 4FW2A 1VQLA 1GXIE 3QDFA 5GMKe 2CZ6B 4F7UF 5GAOl 4M7DB 3WVEB 4AFUC 1V76A 1T0JA 3THKA 2QQ9A 1ZA2B 1SRLA 4DA4A 2DPPB 1RAIB 1HYOA 5GAMd 2DA9A 5EC7A 2HSEB 2COWA 2M0YA 4FYYB 2VYTA 4IUQA 4XTWA 3V8JA 1RAGB 1Y0MA 3HRUA 3PTAA 3LH5A 1K73R 1MNDA 1W6XA 4M77F 2J06A 2P4TA 3OW2A 2DNUA 2EYYA 4PKCC 3OS1A 1H92A 1JXOA 4DQ2A 3G4ST 3HFOA 4FSSA 3G7ZA 2QI2A 5FU6B 4A4GA 2EQMA 2KR3A 2XMFA 1RUWA 1V1CA 2PVOB 1HD3A 3NTHA 2E12A 3CCUA 1Z9QA 2K79A 2QGGA 3LW5E 2PU9B 3EHQA 4X1VA 3EGXA 2DEUA 3CPWS 3GNGA 5KYWB 1UDLA 3G71T 4PJOE 4B9WA 2EGCA 1JRIA 1RABB 2O4XA 3C94A 3CCEA 1UJYA 4OMQA 2X4JA 2L0AA 3OYDA 3RNJA 1M9SA 3BY7A 2HMAA 2K3XA 4CC2A 1WIEA 5FROA 2NUZA 3MP8A 1VQ8T 2DBMA 3OBWA 5AYFA 3CCEQ 1RLPC 2BE7D 4R56A 1R0CB 2EQUA 2LX7A 1WZOA 1AT1B 4EMKA 2O9VA 3UDCA 3JB9D 1VQ8Q 3A5ZB 4PJJA 4NL3A 2MMPA 3EFRA 3L42A 1M27C 2GTJA 2EKHA 2RJDA 3NFCA 4M7DF 4BDZA 2FZCB 1D0YA 4MZTA 2O01E 3CC7A 3E1SA 1GCQC 2KE9A 3CC7T 1VIFA 4NOYA 2YUNA 1ZQ1A 1BBZA 2VASA 5D6YA 4PJOG 3G6EA 2A36A 4C8QE 3LWHA 1D0ZA 1M3AA 1TXQA 2YRCA 1OULA 4VUBA 3G6ET 2B86A 2X4YA 2HL3A 1VQKT 2JS2A 1JEGA 2L3QA 3JCMQ 3CC7Q 3JCMf 3OYFA 4C5IA 4J6YA 2LT1A 3G6EQ 3VS4A 3L2RA 3CD6T 3MKDA 2X4WA 1WYXA 4N4GA 4DOVA 5GJVB 3ULRB 1QVGP 3OY9A 3CQTA 4HCZA 2CUBA 1PD1A 2WACA 1OOTA 1NYFA 2XHCA 2EJGA 4J6WA 3SWNA 2KDSA 3HPWA 1VQ5T 2DL7A 3PT9A 1WPYA 4ESRA 1GCPA 2MI6A 1RAHB 5LJ3j 9ATCB 3OS5A 4C8QG 2FZGB 5KYNA 1WHMA 2CZ7B 1VQ5Q 2EWNA 5GANd 2JVVA 4IKFA 3MO8A 2GNCA 2RHYA 3JCMe 3H0IA 4OGEA 4HXJA 4DEYA 1SHFA 3CC4T 1YJWT 2A0FB 1KHIA 5GMKj 4PJOB 4RCBA 2XDDA 3RESA 2X3XD 2ENMA 1KQSA 2JT4A 3CC4Q 1YJWQ 2W10A 2KXCA 1Q95G 4JRKA 1QVFA 5KE2A 1ZSZB 4J9EA 1M8VA 2HBWA 2NLUA 4M77C 2ZCFB 5LJ5g 2NUPA 2D1XA 4KUIA 3H0FA 2DL5A 1AWOA 3VS5A 2V8KA 2DERA 1Y71A 3WXMB 3OYKA 1AWJA 1ZA1B 3REAB 4J5YA 3MPUB 1S1NA 1YBYA 1SSFA 2JOYA 1I07A 3EH2A 4Z02A 4JPBW 4BY6B 5GAMf 4ORZA 1NLPC 5LJ5h 3CCLA 3TVTA 3L2VA 5LJ3d 2IIMA 4C8QB 5A0DA 1VQ6A 4X34A 3FJPA 2F2WA 3CBMA 1BK2A 1YFNA 2X35A 3CCST 1KFZA 2V8IA 1KC8R 1YCYA 2HSPA 3CCLQ 2E6ZA 1EFNA 2FPEA 4FT2A 1BCMA 3S3OA 2LX9A 1VQ6Q 2JS0A 2RA2A 3RMQA 4II1A 1M2VA 5CAIA 2VXEA 1QWEA 1I0CA 2ZPFB 4LNPA 1OZ2A 4ME7A 4RG8A 2DO3A 3RR6A 2DJQA 3VS1A 1MUZA 2ATCB 4M7DC 2DYIA 3OYMA 4FIBA 5I2SA 3CPWP 3OSVA 1KD1R 2BE9B 4LDUA 5KYUB 2RQRA 1C6VX 1WX6A 3NTIA 1X6OA 3HRTA 1OX8A 5J39A 3IQLA 4IURA 5GAMe 4L59A 2BIVA 2CGHA 1XNIA 2V8JA 3MP6A 4LDWA 1Q82R 4J9CA 2DM1A 2ROLA 3QIIA 1U8RA 1KC8C 2RMOA 1JXMA 3QYGB 1K0SA 5FU6C 1WHLA 2MYSA 2RNAA 2EYXA 3QWYA 4JS5A 3QDRB 1VQ7T 4HT9A 4F7UE 1M1FA 2DJZA 3CCQT 1KD1U 3EHRA 4JLIA 2XICA 1QWFA 5CKBA 2MAMA 1YI2A 1KD1C 3RKWA 3CCQQ 2RQUA 3CCMA 2K4YA 1YI2T 4OMOA 1W1FA 4EMKC 1UGPB 2LJ0A 2GTOA 2W0ZA 2DD5A 2QGFB 4OMMA 2XU8A 3HP9A 2FZKB 2PVDB 1YI2Q 4M77E 2ZPEB 2VUBA 2EYQA 3BDUA 1Q82C 2H8HA 4FCYA 2HKQB 1EX4A 1E6HA 1OX9A 3CCMQ 1V29B 3JB9F 4PFPA 2CP6A 1HK9A 1WHHA 1YNZA 4J9GA 4C92D 2FB7A 1OPKA 2HNIA 4JLGA 2DRMA 1T3LA 3M9QA 1NEBA 1MMDA 5FRMA 2YUQA 1BI2A 4F7UG 1X6BA 3OW2S 1B3QA 4FW1A 3S3NA 4HCCA 2E41A 4A63B 4N0AA 2FYKA 3GBQA 1A0NB 2JJ9A 2PQWA 3HFNA 2RO0A 2KBTA 2G3RA 1Q86R 5IXBA 2OJ2A 3ZBDA 1UHCA 5KYXA 5GANf 1NPPA 1GBQA 4PK4A 3RKYA 3SWNC 5GAN8 2VGNA 3QWXX 2GF7A 2M9UA 1K8AU 1H3ZA 1VQOA 2FO0A 2QQAA 3L2WA 5GAOp 1M4ZA 4XU1A 1O9SA 2NUTA 2FEIA 3WVDB 2K5LA 4KGZB 3MP1A 5GMKi 3VU3C 2QK0A 2LCCA 3CPFA 3MEUA 4HT8A 1NBEB 2GFUA 2BTTA 4B6MA 1PG5B 2WSCE 1PRMC 2RF0A 3DB3A 3M0SA 4E7SA 1X2QA 2RJCA 3A8OB 1X2KA 2RB6A 3EGUA 4JUVA 2IPOB 4TVRA 1Q86C 2SEMA 4F7UB 4AG1C 1TSFA 4C92G 1UGRB 2PTKA 4J7FA 3J81E 1N6AA 4HA8A 4RUGA 5GANe 3LLRA 2CT4A 3M57A 1KK7A 5GAN6 4R0KA 1IHWA 3A8MB 1DJ7B 5LJ3f 5CKHA 3CXCA 3CCJT 2MIOA 4JJNK 4UC4A 3UA6A 4BI4A 4Z88A 1ZSZC 3TSWA 2ESWA 3M4YA 2FRWA 2M02A 4F17A 3AT1B 4M77B 1ZUKA 2RN8A 4M7AA 2MCNA 4BE2A 2AZSA 3Q1JA 2VGMA 4FU6A 2FRYA 2DVJA 4PL6A 2VB6A 3F70A 1QMCA 3CMET 1NLOC 2XDBA 2KY9A 2QYZA 1W2BA 1OI1A 4C0FA 3LX7A 4C0ZA 3CC2T 5ECAA 4OGCA 1W70A 4FT4A 3PMTA 1NYGA 5KYYB 3CMEQ 2OTJT 1TU0B 2Y4XA 4A4FA 1QVPA 3KFVA 4RTTA 3CCVT 1M90R 2X3WD 4QW2A 2P0PA 3SD4A 2JTFA 4ZNXA 3I55T 2DIQA 2NWMA 3JB9J 2OTJQ 5FW9A 2KGTA 1VIEA 1RL2A 2FPDA 2HQXA 2K5IA 3I55Q 2V1RA 1D0XA 1MV0B 4XTUA 1WHKA 2HQHA 4MZPA 5D6XA 1EZZB 1VUBA 2F2VA 1PWTA 2DRKA 4Z8AA 3GNFB 2KT1A 3I5RA 4FL6A 4A53A 1WJQA 3VUZA 1T3SA 3VRYA 2HL5C 4JRPA 2CKKA 2JM8A 2JTMA 3CBPA 3OYJA 1XQHA 1M90U 1CKAA 4C92A 4D8KA 5I11A 3GIBA 4XK8E 1M90C 2E70A 4ANJA 3M5AA 3QXEB 4A4EA 4Y92A 3FLGA 3QBYA 1BIAA 3EGXB 3G4SA 1BIBA 4M4ZA 4A54A 2PUKB 1MV3A 1X01A 1K4US 2O4XB 3OBYA 4N4IA 2KRNA 1M3BA 5GAN4 1LVKA 2JMCA 4PNOA 3G4SQ 1SKUB 4F14A 1TWBA 2R57A 3G71A 1QP3A 2DTIA 4V2SA 1UB4A 4IUUA 3MEAA 4EMHA 1XJWB 3L2ZA 5HY6A 2KROA 3OW2P 4MMLA 4EMKB 3M54A 1WLPB 3FB9A 1BCOA 3G71Q 1VQ8A 3URGA 2LZ6B 1X75C 1G3TA 2LP5A 2EQIA 4QVZA 4JRIA 2PVGB 1E6GA 2QQRA 2XD0A 4C92F 2J6KA 1UGQB 4KGXB 2D8HA 5IXFA 4J9BA 3I35A 2YT6A 5GAMh 3INZA 2K5FA 4DBQA 1B34A 5HK0A 1IZ6A 2DFUA 4AG2C 1G3WA 2JTEA 1O75A 1VOMA 2CYZB 2DL4A 5HCKA 1I8FA 3EG0A 2VXFA 5GANj 4E6RA 4E47A 2D8JA 1N5ZA 2RH2A 2ZPBB 3HHTB 1JO8A 3M0TA 3SB2A 1JU5C 2E6NA 4ELYC 3E9FA 2HEQA 1VQKA 1UGVA 3QKJA 5J3BA 2KSSA 2M1HA 1YP5A 2I0NA 4O5VA 1G5VA 4IUPA 1Q81R 1N8RU 3E2UA 1WFWA 4C5EA 3CD6A 4HVVA 2KT8A 2NYSA 1NG2A 2A3LA 3SWNB 4BACA 1IRXA 1WA7A 4FYWB 4DBRA 2AKLA 1VQKQ 2ZPGB 4E7ZA 1BI3A 3QZ5B 5DM7R 2RI3A 3TQ7P 3HL8A 2HBPA 3OQ5A 1VYUA 4J6XA 1SPKA 3CD6Q 2DXCA 3JCMW 1YJNT 3MJXA 1J3TA 1VQ5A 3SFMA 1H641 5CO7A 1YHQT 2JNGA 2WSEE 1SHGA 5AT1B 1BI0A 3V8LA 2LTOA 5DLQE 4K11A 1YJNQ 1Y7XA 1QLYA 4QQ6A 3O8VA 3T9NA 1Q81U 2J05A 4OMPA 3M59A 4E7IA 3EFSA 1R8OB 3ZFJA 4X9DA 4JS4A 3RIRA 1Q81C 3CC4A 1YJWA 3OYAA 3JB9G 3VS6A 3DLMA 1ZBXA 5D7UA 1VQNT 2NUPB 3LGLA 1MNEA 3META 4JDSA 2A37A 2L3SA 2XDPA 4EPCA 2X51A 2QA4T 5J26A 2EQKA 2J6OA 2M16A 4M75D 1FMKA 3X24B 2RPNA 1VQNQ 1IHVA 1R77A 3H9NA 3VS2A 5GAN3 4KGVB 4KH0B 2QG9B 4DEXA 5CK9A 1VQ9T 1PSEA 2DEQA 2MOXA 1AOJA 4Y28E 4Y91A 3V7CA 4BDYA 3BDLA 1VQ9Q 3FJ5A 2L3RA 4KT0E 5CR2A 1RAEB 2JMAA 2RQTA 3PNWC 1M1KU 2CSIA 1ZSGA 5IN1A 1VYVA 5CIUA 4JZ4A 2QDLA 5D6WA 3I56T 2DIGA 1K9MU 1IREB 1SEMA 1S72A 3NTKA 3VYGA 3NPFA 2DXUA 2A08A 2KAFA 4OMNA 1S72T 3CCSA 1TUCA 4GLKA 3I56Q 1AZGB 1QKWA 3PVQA 1M5Q1 1W4SA 3QUIA 4IUTA 2BZ8A 2YDLA 4C92C 2K3BA 1S72Q 4RG2A 2F1LA 2BUDA 3BFMA 1RI9A 3CCSQ 5FLXE 4NL2A 2ABLA 3VYHB 2ZPHB 4FYVB 4WTOB 4BE0A 3CXCS 4M78D 2L3PA 3VS0A 1RAFB 3CPWA 4J7IA 3UPUA 5LJ3g 2AK5A 4M75G 2OI3A 4M7AD 3PE0A 1LCKA 4PLLA 2CP7A 1M1GA 2E5QA 3NHNA 2RM4A 3OYBA 3OYYA 3P8DA 4E7LA 2HDAA 3JCMX 2E64A 5A0GA 3PFSA 2ZAEA 1Y96B 1PNJA 2EIFA 3KUFA 2YRVA 5CKEA 1LNXA 2EYWA 4ZN3A 1ZUYA 1VQ7A 3CCQA 5LJ3h 2DMOA 3MHXA 3SEMA 1X69A 2LQKA 4LD6A 4R55A 1E7OA 2AZVA 4LDYA 2RI5A 1C1AA 4M7AE 1I5LA 3CEYA 3M58A 1VQ7Q 5HKCA 3DLLA 4LDXA 5GMKh 4LE9A 3EAEA 3JCMJ 3S3MA 1ZHIA 4KH1B 3ZEHA 3HKSA 1OU9A 1JJ2A 3N5BB 1AWXA 4FM4B 2D0NA 3HRSA 4CRIA 4AFZC 2CP3A 5CQXA 3HSBA 2VKNA 4C5HA 1SRMA 3MEVA 1WJRA 4HCKA 3CMAA 2EGAA 4Z89A 4QQGA 1PKTA 2VWFA 1Q7YU 3CMAT 2RJFA 5IHIA 3MEWA 1LOJA 4CC3A 3TREA 2DK3A 4RTYA 4BI3A 1HXDA 1WHJA 3TU4K 1K8AR 3FRNA 2B8AA 4CC7A 1RLQC 1JB0E 1QCNA 3JRZA 3JB9I 1KQ2A 3CMAQ 5KYXB 2CREA 2X9HA 1FMWA 2M0OA 1YITT 4M7AG 2HZYA 2CZ0B 4M75A 3QZ9B 2LNVA 4FYXB 2J6FA 2NUTB 2FPFA 3EFOA 2EPDA 1BU1A 2E4HA 1UG1A 2X4XA 4OF1A 4C92E 1U5SA 2QQBA 2CP0A 3KXTA 1TUDA 1IO6A 3C4SA 3VS3A 1M2OA 5CKDA 2DILA 4ZTJA 5EG2A 4PJNA 1UUEA 2VC8A 1D1BA 2LCSA 5I2MA 3UA7A 3JAME 4DBFA 4EIKA 1G3YA 1K8AC 2R5MA 2P0QA 4HCBA 1GCQA 5IHNA 2JXBA 4Q5WA 4BB7A 3MCAB 1ZBJA 1K0XA 1XTDA 2CDTA 3M4GA 4LDVA 5DLOA 3LWIA 2QEXA 3E9GA 2JM9A 1X6GA 1FXXA 2QEXT 1TH7A 3GF5A 1YWOA 4RTUA 4PFOA 2FG0A 1SSHA 1UFFA 1WNLA 5C0MA 1AD5A 4PFZA 1QW1A 2MPXC 1NE8A 4M7AB 4M75F 2QEXQ 1YJ9T 2HD0A 2EVRA 4M78A 1AWWA 3CCJA 3TEEA 3A1PA 4PJMA 4E7KA 4PJLA 1VYTA 1KQ1A 5LJ5e 2CP5A 3CBOA 4XTXA 5IT9E 3SDZA 2EFIA 3UF4A 3QYHB 5I22A 1QP2A 3EG1A 3CCRT 1YIJT 3JCMg 4IUVA 2O88A 3CCJQ 3REBB 2DD4A 3OSSC 3CMEA 1G3SA 4XTVA 1FWZA 3GP8A 4E7JA 3CC2A 2CP2A 4HVUA 1OEBA 2M51A 2SRCA 3H6ZA 3CCRQ 1YIJQ 2RK1A 1VQMT 2OTJA 3CXCP 1PM3A 3BE3A 2HCKA 3FIFA 2CH4A 3JCMV 5GAOn 3GPLA 3CCVA 2E3HA 1B07A 3OYHA 2BZYA 2OTLT 3CC2Q 1BKBA 4BUGA 2L2PA 3I55A 3DKMA 2HKNA 2JZ2A 5CQYA
chains in the Genus database with same CATH topology
1ZSZB 1OU9A 1OU8A 1ZSZC 1OULA 2QAZA 1OX8A 2NYSA 1OX9A 1ZSZA 1YFNA 2QASA 1TWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZSZ B;  1OU9 A;  1OU8 A;  1ZSZ C;  1OUL A;  2QAZ A;  1OX8 A;  2NYS A;  1OX9 A;  1ZSZ A;  1YFN A;  2QAS A;  1TWB A; 
#chains in the Genus database with same CATH topology
 1OPL A;  2XID A;  1SF9 A;  3M55 A;  1D3B A;  1ACM B;  3CCV Q;  3E19 A;  2DL8 A;  1VQ4 T;  4P5N A;  4C92 B;  2L89 A;  3FDR A;  1NPR A;  3QJ6 A;  2LMJ A;  4RMO A;  5GAO m;  1WHG A;  2RHI A;  1PCX A;  2DKG A;  4M78 F;  3HTR A;  2KXD A;  1VQP A;  2LDM A;  1KQS S;  3EG9 A;  4OB3 B;  2OX7 A;  1MMA A;  4GLM A;  1VQP T;  2CH4 W;  1HJD A;  1QVF S;  4MZM A;  4BD3 A;  3RDV A;  2CZ1 B;  3J7A F;  2DX1 A;  2DTH A;  4M7A F;  2R5A A;  2KYM A;  1VQP Q;  2EYZ A;  2L5Q A;  3C95 A;  1PSF A;  1GRI A;  4ZTF A;  1UTI A;  1VQL T;  5I21 A;  2YWW A;  5KH6 A;  3RKX A;  1RI0 A;  3EGD A;  3X28 B;  2K6D A;  1GFC A;  3RER A;  1G8X A;  2VV5 A;  2XG8 D;  4CC4 B;  1ZLM A;  1OV3 A;  1VQL Q;  3C0C A;  2LQ8 A;  4QVD A;  2HAX A;  2E1H A;  4YTL A;  2DAQ A;  1UEB A;  1QCF A;  4PJO D;  3X25 B;  1WXU A;  2D9T A;  1ZUU A;  3M0R A;  2K7A A;  4M7D A;  2O9S A;  2RHX A;  1YCS B;  5GAM g;  2GGR A;  3R6O A;  1N9S A;  2QTV A;  1IXD A;  4ZGE B;  1TTH B;  1GBR A;  2LC4 A;  1B34 B;  4NS5 A;  4RTV A;  3CCU T;  2DVE A;  3PIP A;  4XU3 A;  1B7T A;  1MMN A;  3VV0 A;  5GAO r;  4AFQ C;  1EIF A;  4AT1 B;  3CCU Q;  1OYX A;  2KMT A;  2IVW A;  4JJB A;  4M75 C;  1UHF A;  1N8R R;  4CI0 C;  1K73 U;  2QAZ A;  3KBG A;  3CCE T;  2F69 A;  1PD0 A;  1WI7 A;  2MF2 A;  4N0A C;  1MGQ A;  4ZGD B;  4C8Q D;  1K73 C;  2DXT A;  4ELZ C;  5KYW A;  3JV3 A;  3JSC A;  2JUF A;  4EDU A;  4OB2 B;  2LNH B;  2BZX A;  1K1Z A;  4DBH A;  2QXF A;  2KEA A;  5LJ5 j;  1U1T A;  2FL7 A;  3I9Q A;  4D8D A;  1Z9Z A;  5A2Q E;  3UT1 A;  3JCM c;  2WSF E;  2F5K A;  4ATO A;  1Y57 A;  2PZ1 A;  2DYB A;  3JCM P;  2AHJ B;  2Z0W A;  5FRN A;  2F2X A;  4E7H A;  1QVG A;  3QSU A;  1N8R C;  2EJF A;  2XK0 A;  3OMG A;  1YJN A;  4MMK A;  1JJ2 S;  2AIR B;  2KRS A;  1OQK A;  2E5K A;  3M0P A;  1TS9 A;  2LJ1 A;  3VS7 A;  3C12 A;  1BYM A;  1MMG A;  3OA6 A;  4J8O A;  1YHQ A;  2ZZD A;  2QDY B;  1PRL C;  1AVZ C;  3I5S A;  1WGS A;  2KQW A;  4BI8 B;  4C0D C;  1WXB A;  1RAC B;  1D1C A;  3EG3 A;  2E3I A;  4KUD K;  4MDW A;  1FYN A;  1AZE A;  4B9X A;  4M78 C;  1YHQ Q;  3D7S B;  5CCA A;  5GAO q;  1M30 A;  2FHD A;  3ER0 A;  4XTZ A;  1BB9 A;  5L8R E;  1VQN A;  3NMZ C;  2QQS A;  5KE3 A;  3ZL7 C;  2KK4 A;  4M7A C;  2QA4 A;  3LGF A;  4RTX A;  2ROT A;  5LJ5 d;  1X43 A;  1M1K R;  1PKS A;  2H3E B;  4OP0 A;  1WQW A;  2KI7 A;  4FSX A;  4OB0 B;  4GBQ A;  6AT1 B;  2JW4 A;  3OS0 A;  1K9M R;  3PVL A;  4KBM B;  4IIO A;  1VQ9 A;  2QA4 Q;  4HVW A;  5GJW B;  4EMG A;  1R0B G;  2PUO B;  4LXC A;  3OYN A;  3L2Q A;  2Y4Y A;  1ARK A;  3S6W A;  5GAN g;  3QG1 A;  3M0Q A;  1T0H A;  2EQJ A;  4A4K A;  1KQS P;  5L23 A;  3V7R A;  2C06 A;  4C5G A;  4LUD A;  2F5T X;  1OZ3 A;  1QVF P;  3EH1 A;  5FU7 C;  4E2F B;  4M75 E;  3I56 A;  3OB9 A;  2P4R A;  2O2O A;  3RBB B;  4PJO A;  1VA7 A;  3H41 A;  2DBK A;  4IIM A;  3V7S A;  5KCO A;  2ED1 A;  3H0H A;  2DF6 A;  2O31 A;  2PNI A;  1M1K C;  3L2U A;  2G6F X;  5GAN 7;  1M2V B;  1ABQ A;  1F1B B;  2YXY A;  1ZSZ A;  2L8D A;  1K9M C;  5GAN h;  5CVI A;  4RCC A;  2P84 A;  1X27 A;  2ECZ A;  1NJI R;  5LL6 S;  1JQQ A;  1ZX6 A;  4QKU A;  2IG0 A;  4JZ3 A;  5DY9 A;  1CSK A;  2AT1 B;  2DZC A;  4L6V 5;  2EJ9 A;  5IAY A;  3X26 B;  3CCL T;  2DLP A;  3M56 A;  2CUD A;  1KG1 A;  2COZ A;  1VQ6 T;  2FVU A;  2EGE A;  1FX7 A;  3QO3 A;  2YHT A;  2V26 A;  1KJW A;  4LUE A;  2DXB A;  4DOW A;  4QT7 A;  2LRQ A;  1P92 A;  5HK3 A;  1GFD A;  1UJ0 A;  2ED0 A;  2CS7 A;  4J9I A;  3GLX A;  4C8Q A;  1NJI U;  4MDX A;  1W2B S;  3TCJ A;  3OYG A;  3A8L B;  4QVC A;  1KSW A;  4L5G A;  4XU0 A;  2HQE A;  3FEO A;  1QCO A;  1NJI C;  2I2L A;  4PJO F;  1ABO A;  4M78 E;  4OB1 B;  1U06 A;  3U23 A;  2KYB A;  2K3Y A;  2D0Q B;  2RI2 A;  2KNB B;  1QQJ A;  1KC8 U;  1Y07 A;  3DB4 A;  4ZN1 A;  1N9R A;  4N4H A;  3P8H A;  3ME9 A;  4AMC A;  1Q7Y R;  3OMC A;  2BKD N;  1U1S A;  1H3H A;  4J9D A;  4XU2 A;  5C6S A;  1IGU A;  1UGS B;  5KYU A;  4M77 D;  3JCM h;  3PGG A;  1M8M A;  4ZGJ B;  3V8K A;  3LH0 A;  1WJS A;  2DZ9 A;  1CKB A;  3RMS A;  4J9F A;  5GMK m;  2R58 A;  2DE0 X;  1M3C A;  1Y96 A;  3QHS A;  1WQ7 A;  4KRT A;  3G1J A;  4QQD A;  2QAS A;  3VRZ A;  4M75 B;  3CCM T;  1Q82 U;  1TUG B;  3VJP A;  4C8Q F;  4M78 G;  2EW3 A;  5A0L A;  2KRM A;  2YRD A;  4F16 A;  4OML A;  4PLI A;  1RAD B;  3EFO B;  1JJ2 P;  3VKI A;  2LQW A;  3LYI A;  1UE9 A;  2RK2 A;  2YLB A;  1LPL A;  1Q7Y C;  1YIT A;  2A7Y A;  2LCL A;  3H8Z A;  1C0M A;  1FMV A;  2ZPI B;  1H8K A;  1IGQ A;  2LJ3 A;  5GMK l;  4JJD A;  1I4K 1;  3R6N A;  3M0U A;  3BW1 A;  1LJO A;  4O6J A;  1RAA B;  2J7I A;  3SHW A;  1YIT Q;  2DTO A;  2EBP A;  3M53 A;  4OMF B;  4M7D D;  1D1A A;  3PMI A;  8AT1 B;  1G83 A;  2RQV A;  1D09 B;  1QKX A;  2E65 A;  2MK5 A;  5FWC A;  3QJY A;  5LJ5 f;  3VUB A;  2GFA A;  4D6W A;  1SG5 A;  2LVM A;  2C0O A;  4M77 G;  4WF2 A;  2OAU A;  4C0D B;  1AEY A;  2AKK A;  2H3J A;  2A28 A;  2MWP A;  2XI9 A;  2VVK A;  4M7D E;  1VQO T;  2KVQ G;  4M78 B;  4LN2 A;  2YSQ A;  3JB9 H;  5M9O A;  2QTX A;  3A8G B;  5CKF A;  2RD1 A;  1UEC A;  4KUL A;  1I81 A;  3PIO A;  1VQO Q;  1YJ9 A;  2DET A;  2XKO C;  1IB8 A;  4AFS C;  1KHC A;  7AT1 B;  1Q86 U;  1BI1 A;  2C0T A;  1I5O B;  3JCM d;  1OU8 A;  2EKO A;  2MWO A;  5KCH A;  4JJC A;  4RKU E;  4OVA A;  3JCM b;  3GOX A;  3EG2 A;  2LQN A;  1TOV A;  2K2V A;  2K9G A;  1YJ9 Q;  2V1Q A;  2E10 A;  3P8B B;  3X20 B;  3A98 A;  3CCR A;  1YIJ A;  1WXT A;  1HSQ A;  2K2M A;  5GAN 2;  4PJO C;  1G2B A;  3OYE A;  3RUX A;  2ZGW A;  3TSZ A;  1QVG S;  3UAT A;  2RJE A;  2RHU A;  4JRQ A;  3O5Z A;  2GCX A;  5IHK A;  3AHU A;  4RTW A;  3OYC A;  2C0I A;  3NGP A;  1VQM A;  3L1A A;  4F7U A;  4M7D G;  1PHT A;  4J9H A;  1PC0 A;  1AHJ B;  1D3B B;  2YUP A;  5GAN 5;  2COY A;  1U3O A;  5FU7 B;  2OTL A;  1XOV A;  2CSQ A;  3OS2 A;  5GAM j;  2GBQ A;  5IH2 A;  1K76 A;  2Y90 A;  1NM7 A;  1VQM Q;  3J80 E;  4X9C A;  4F04 B;  4BE1 A;  2YLC A;  2DL3 A;  2GQI A;  3EG9 B;  4HKE A;  2CT3 A;  2P0K A;  8ATC B;  1W2B P;  1N27 A;  1VQ4 A;  2OTL Q;  1MHN A;  4M77 A;  2EAY A;  2K57 A;  1NZ9 A;  5FWB A;  2LT4 A;  3QPH A;  2RHZ A;  3A8H B;  2D6F A;  4GY5 A;  3OYI A;  1YWP A;  4BY6 C;  3UWN A;  1GL5 A;  2YUO A;  4RTZ A;  2GQV A;  2OAW A;  3OYL A;  1VQ4 Q;  4C8Q C;  1TG0 A;  4XQ3 A;  3ASK A;  2RQW A;  1KIK A;  4WCI A;  5KYY A;  2JN0 A;  1JBM A;  5LJ3 e;  4XAX B;  1I1J A;  3EGD B;  1WDX A;  4J83 A;  1YN8 A;  4C0G A;  1NEG A;  4XTY A;  1K9A A;  3FC3 A;  4LD9 K;  4A4H A;  4FW2 A;  1VQL A;  1GXI E;  3QDF A;  5GMK e;  2CZ6 B;  4F7U F;  5GAO l;  4M7D B;  3WVE B;  4AFU C;  1V76 A;  1T0J A;  3THK A;  2QQ9 A;  1ZA2 B;  1SRL A;  4DA4 A;  2DPP B;  1RAI B;  1HYO A;  5GAM d;  2DA9 A;  5EC7 A;  2HSE B;  2COW A;  2M0Y A;  4FYY B;  2VYT A;  4IUQ A;  4XTW A;  3V8J A;  1RAG B;  1Y0M A;  3HRU A;  3PTA A;  3LH5 A;  1K73 R;  1MND A;  1W6X A;  4M77 F;  2J06 A;  2P4T A;  3OW2 A;  2DNU A;  2EYY A;  4PKC C;  3OS1 A;  1H92 A;  1JXO A;  4DQ2 A;  3G4S T;  3HFO A;  4FSS A;  3G7Z A;  2QI2 A;  5FU6 B;  4A4G A;  2EQM A;  2KR3 A;  2XMF A;  1RUW A;  1V1C A;  2PVO B;  1HD3 A;  3NTH A;  2E12 A;  3CCU A;  1Z9Q A;  2K79 A;  2QGG A;  3LW5 E;  2PU9 B;  3EHQ A;  4X1V A;  3EGX A;  2DEU A;  3CPW S;  3GNG A;  5KYW B;  1UDL A;  3G71 T;  4PJO E;  4B9W A;  2EGC A;  1JRI A;  1RAB B;  2O4X A;  3C94 A;  3CCE A;  1UJY A;  4OMQ A;  2X4J A;  2L0A A;  3OYD A;  3RNJ A;  1M9S A;  3BY7 A;  2HMA A;  2K3X A;  4CC2 A;  1WIE A;  5FRO A;  2NUZ A;  3MP8 A;  1VQ8 T;  2DBM A;  3OBW A;  5AYF A;  3CCE Q;  1RLP C;  2BE7 D;  4R56 A;  1R0C B;  2EQU A;  2LX7 A;  1WZO A;  1AT1 B;  4EMK A;  2O9V A;  3UDC A;  3JB9 D;  1VQ8 Q;  3A5Z B;  4PJJ A;  4NL3 A;  2MMP A;  3EFR A;  3L42 A;  1M27 C;  2GTJ A;  2EKH A;  2RJD A;  3NFC A;  4M7D F;  4BDZ A;  2FZC B;  1D0Y A;  4MZT A;  2O01 E;  3CC7 A;  3E1S A;  1GCQ C;  2KE9 A;  3CC7 T;  1VIF A;  4NOY A;  2YUN A;  1ZQ1 A;  1BBZ A;  2VAS A;  5D6Y A;  4PJO G;  3G6E A;  2A36 A;  4C8Q E;  3LWH A;  1D0Z A;  1M3A A;  1TXQ A;  2YRC A;  1OUL A;  4VUB A;  3G6E T;  2B86 A;  2X4Y A;  2HL3 A;  1VQK T;  2JS2 A;  1JEG A;  2L3Q A;  3JCM Q;  3CC7 Q;  3JCM f;  3OYF A;  4C5I A;  4J6Y A;  2LT1 A;  3G6E Q;  3VS4 A;  3L2R A;  3CD6 T;  3MKD A;  2X4W A;  1WYX A;  4N4G A;  4DOV A;  5GJV B;  3ULR B;  1QVG P;  3OY9 A;  3CQT A;  4HCZ A;  2CUB A;  1PD1 A;  2WAC A;  1OOT A;  1NYF A;  2XHC A;  2EJG A;  4J6W A;  3SWN A;  2KDS A;  3HPW A;  1VQ5 T;  2DL7 A;  3PT9 A;  1WPY A;  4ESR A;  1GCP A;  2MI6 A;  1RAH B;  5LJ3 j;  9ATC B;  3OS5 A;  4C8Q G;  2FZG B;  5KYN A;  1WHM A;  2CZ7 B;  1VQ5 Q;  2EWN A;  5GAN d;  2JVV A;  4IKF A;  3MO8 A;  2GNC A;  2RHY A;  3JCM e;  3H0I A;  4OGE A;  4HXJ A;  4DEY A;  1SHF A;  3CC4 T;  1YJW T;  2A0F B;  1KHI A;  5GMK j;  4PJO B;  4RCB A;  2XDD A;  3RES A;  2X3X D;  2ENM A;  1KQS A;  2JT4 A;  3CC4 Q;  1YJW Q;  2W10 A;  2KXC A;  1Q95 G;  4JRK A;  1QVF A;  5KE2 A;  1ZSZ B;  4J9E A;  1M8V A;  2HBW A;  2NLU A;  4M77 C;  2ZCF B;  5LJ5 g;  2NUP A;  2D1X A;  4KUI A;  3H0F A;  2DL5 A;  1AWO A;  3VS5 A;  2V8K A;  2DER A;  1Y71 A;  3WXM B;  3OYK A;  1AWJ A;  1ZA1 B;  3REA B;  4J5Y A;  3MPU B;  1S1N A;  1YBY A;  1SSF A;  2JOY A;  1I07 A;  3EH2 A;  4Z02 A;  4JPB W;  4BY6 B;  5GAM f;  4ORZ A;  1NLP C;  5LJ5 h;  3CCL A;  3TVT A;  3L2V A;  5LJ3 d;  2IIM A;  4C8Q B;  5A0D A;  1VQ6 A;  4X34 A;  3FJP A;  2F2W A;  3CBM A;  1BK2 A;  1YFN A;  2X35 A;  3CCS T;  1KFZ A;  2V8I A;  1KC8 R;  1YCY A;  2HSP A;  3CCL Q;  2E6Z A;  1EFN A;  2FPE A;  4FT2 A;  1BCM A;  3S3O A;  2LX9 A;  1VQ6 Q;  2JS0 A;  2RA2 A;  3RMQ A;  4II1 A;  1M2V A;  5CAI A;  2VXE A;  1QWE A;  1I0C A;  2ZPF B;  4LNP A;  1OZ2 A;  4ME7 A;  4RG8 A;  2DO3 A;  3RR6 A;  2DJQ A;  3VS1 A;  1MUZ A;  2ATC B;  4M7D C;  2DYI A;  3OYM A;  4FIB A;  5I2S A;  3CPW P;  3OSV A;  1KD1 R;  2BE9 B;  4LDU A;  5KYU B;  2RQR A;  1C6V X;  1WX6 A;  3NTI A;  1X6O A;  3HRT A;  1OX8 A;  5J39 A;  3IQL A;  4IUR A;  5GAM e;  4L59 A;  2BIV A;  2CGH A;  1XNI A;  2V8J A;  3MP6 A;  4LDW A;  1Q82 R;  4J9C A;  2DM1 A;  2ROL A;  3QII A;  1U8R A;  1KC8 C;  2RMO A;  1JXM A;  3QYG B;  1K0S A;  5FU6 C;  1WHL A;  2MYS A;  2RNA A;  2EYX A;  3QWY A;  4JS5 A;  3QDR B;  1VQ7 T;  4HT9 A;  4F7U E;  1M1F A;  2DJZ A;  3CCQ T;  1KD1 U;  3EHR A;  4JLI A;  2XIC A;  1QWF A;  5CKB A;  2MAM A;  1YI2 A;  1KD1 C;  3RKW A;  3CCQ Q;  2RQU A;  3CCM A;  2K4Y A;  1YI2 T;  4OMO A;  1W1F A;  4EMK C;  1UGP B;  2LJ0 A;  2GTO A;  2W0Z A;  2DD5 A;  2QGF B;  4OMM A;  2XU8 A;  3HP9 A;  2FZK B;  2PVD B;  1YI2 Q;  4M77 E;  2ZPE B;  2VUB A;  2EYQ A;  3BDU A;  1Q82 C;  2H8H A;  4FCY A;  2HKQ B;  1EX4 A;  1E6H A;  1OX9 A;  3CCM Q;  1V29 B;  3JB9 F;  4PFP A;  2CP6 A;  1HK9 A;  1WHH A;  1YNZ A;  4J9G A;  4C92 D;  2FB7 A;  1OPK A;  2HNI A;  4JLG A;  2DRM A;  1T3L A;  3M9Q A;  1NEB A;  1MMD A;  5FRM A;  2YUQ A;  1BI2 A;  4F7U G;  1X6B A;  3OW2 S;  1B3Q A;  4FW1 A;  3S3N A;  4HCC A;  2E41 A;  4A63 B;  4N0A A;  2FYK A;  3GBQ A;  1A0N B;  2JJ9 A;  2PQW A;  3HFN A;  2RO0 A;  2KBT A;  2G3R A;  1Q86 R;  5IXB A;  2OJ2 A;  3ZBD A;  1UHC A;  5KYX A;  5GAN f;  1NPP A;  1GBQ A;  4PK4 A;  3RKY A;  3SWN C;  5GAN 8;  2VGN A;  3QWX X;  2GF7 A;  2M9U A;  1K8A U;  1H3Z A;  1VQO A;  2FO0 A;  2QQA A;  3L2W A;  5GAO p;  1M4Z A;  4XU1 A;  1O9S A;  2NUT A;  2FEI A;  3WVD B;  2K5L A;  4KGZ B;  3MP1 A;  5GMK i;  3VU3 C;  2QK0 A;  2LCC A;  3CPF A;  3MEU A;  4HT8 A;  1NBE B;  2GFU A;  2BTT A;  4B6M A;  1PG5 B;  2WSC E;  1PRM C;  2RF0 A;  3DB3 A;  3M0S A;  4E7S A;  1X2Q A;  2RJC A;  3A8O B;  1X2K A;  2RB6 A;  3EGU A;  4JUV A;  2IPO B;  4TVR A;  1Q86 C;  2SEM A;  4F7U B;  4AG1 C;  1TSF A;  4C92 G;  1UGR B;  2PTK A;  4J7F A;  3J81 E;  1N6A A;  4HA8 A;  4RUG A;  5GAN e;  3LLR A;  2CT4 A;  3M57 A;  1KK7 A;  5GAN 6;  4R0K A;  1IHW A;  3A8M B;  1DJ7 B;  5LJ3 f;  5CKH A;  3CXC A;  3CCJ T;  2MIO A;  4JJN K;  4UC4 A;  3UA6 A;  4BI4 A;  4Z88 A;  1ZSZ C;  3TSW A;  2ESW A;  3M4Y A;  2FRW A;  2M02 A;  4F17 A;  3AT1 B;  4M77 B;  1ZUK A;  2RN8 A;  4M7A A;  2MCN A;  4BE2 A;  2AZS A;  3Q1J A;  2VGM A;  4FU6 A;  2FRY A;  2DVJ A;  4PL6 A;  2VB6 A;  3F70 A;  1QMC A;  3CME T;  1NLO C;  2XDB A;  2KY9 A;  2QYZ A;  1W2B A;  1OI1 A;  4C0F A;  3LX7 A;  4C0Z A;  3CC2 T;  5ECA A;  4OGC A;  1W70 A;  4FT4 A;  3PMT A;  1NYG A;  5KYY B;  3CME Q;  2OTJ T;  1TU0 B;  2Y4X A;  4A4F A;  1QVP A;  3KFV A;  4RTT A;  3CCV T;  1M90 R;  2X3W D;  4QW2 A;  2P0P A;  3SD4 A;  2JTF A;  4ZNX A;  3I55 T;  2DIQ A;  2NWM A;  3JB9 J;  2OTJ Q;  5FW9 A;  2KGT A;  1VIE A;  1RL2 A;  2FPD A;  2HQX A;  2K5I A;  3I55 Q;  2V1R A;  1D0X A;  1MV0 B;  4XTU A;  1WHK A;  2HQH A;  4MZP A;  5D6X A;  1EZZ B;  1VUB A;  2F2V A;  1PWT A;  2DRK A;  4Z8A A;  3GNF B;  2KT1 A;  3I5R A;  4FL6 A;  4A53 A;  1WJQ A;  3VUZ A;  1T3S A;  3VRY A;  2HL5 C;  4JRP A;  2CKK A;  2JM8 A;  2JTM A;  3CBP A;  3OYJ A;  1XQH A;  1M90 U;  1CKA A;  4C92 A;  4D8K A;  5I11 A;  3GIB A;  4XK8 E;  1M90 C;  2E70 A;  4ANJ A;  3M5A A;  3QXE B;  4A4E A;  4Y92 A;  3FLG A;  3QBY A;  1BIA A;  3EGX B;  3G4S A;  1BIB A;  4M4Z A;  4A54 A;  2PUK B;  1MV3 A;  1X01 A;  1K4U S;  2O4X B;  3OBY A;  4N4I A;  2KRN A;  1M3B A;  5GAN 4;  1LVK A;  2JMC A;  4PNO A;  3G4S Q;  1SKU B;  4F14 A;  1TWB A;  2R57 A;  3G71 A;  1QP3 A;  2DTI A;  4V2S A;  1UB4 A;  4IUU A;  3MEA A;  4EMH A;  1XJW B;  3L2Z A;  5HY6 A;  2KRO A;  3OW2 P;  4MML A;  4EMK B;  3M54 A;  1WLP B;  3FB9 A;  1BCO A;  3G71 Q;  1VQ8 A;  3URG A;  2LZ6 B;  1X75 C;  1G3T A;  2LP5 A;  2EQI A;  4QVZ A;  4JRI A;  2PVG B;  1E6G A;  2QQR A;  2XD0 A;  4C92 F;  2J6K A;  1UGQ B;  4KGX B;  2D8H A;  5IXF A;  4J9B A;  3I35 A;  2YT6 A;  5GAM h;  3INZ A;  2K5F A;  4DBQ A;  1B34 A;  5HK0 A;  1IZ6 A;  2DFU A;  4AG2 C;  1G3W A;  2JTE A;  1O75 A;  1VOM A;  2CYZ B;  2DL4 A;  5HCK A;  1I8F A;  3EG0 A;  2VXF A;  5GAN j;  4E6R A;  4E47 A;  2D8J A;  1N5Z A;  2RH2 A;  2ZPB B;  3HHT B;  1JO8 A;  3M0T A;  3SB2 A;  1JU5 C;  2E6N A;  4ELY C;  3E9F A;  2HEQ A;  1VQK A;  1UGV A;  3QKJ A;  5J3B A;  2KSS A;  2M1H A;  1YP5 A;  2I0N A;  4O5V A;  1G5V A;  4IUP A;  1Q81 R;  1N8R U;  3E2U A;  1WFW A;  4C5E A;  3CD6 A;  4HVV A;  2KT8 A;  2NYS A;  1NG2 A;  2A3L A;  3SWN B;  4BAC A;  1IRX A;  1WA7 A;  4FYW B;  4DBR A;  2AKL A;  1VQK Q;  2ZPG B;  4E7Z A;  1BI3 A;  3QZ5 B;  5DM7 R;  2RI3 A;  3TQ7 P;  3HL8 A;  2HBP A;  3OQ5 A;  1VYU A;  4J6X A;  1SPK A;  3CD6 Q;  2DXC A;  3JCM W;  1YJN T;  3MJX A;  1J3T A;  1VQ5 A;  3SFM A;  1H64 1;  5CO7 A;  1YHQ T;  2JNG A;  2WSE E;  1SHG A;  5AT1 B;  1BI0 A;  3V8L A;  2LTO A;  5DLQ E;  4K11 A;  1YJN Q;  1Y7X A;  1QLY A;  4QQ6 A;  3O8V A;  3T9N A;  1Q81 U;  2J05 A;  4OMP A;  3M59 A;  4E7I A;  3EFS A;  1R8O B;  3ZFJ A;  4X9D A;  4JS4 A;  3RIR A;  1Q81 C;  3CC4 A;  1YJW A;  3OYA A;  3JB9 G;  3VS6 A;  3DLM A;  1ZBX A;  5D7U A;  1VQN T;  2NUP B;  3LGL A;  1MNE A;  3MET A;  4JDS A;  2A37 A;  2L3S A;  2XDP A;  4EPC A;  2X51 A;  2QA4 T;  5J26 A;  2EQK A;  2J6O A;  2M16 A;  4M75 D;  1FMK A;  3X24 B;  2RPN A;  1VQN Q;  1IHV A;  1R77 A;  3H9N A;  3VS2 A;  5GAN 3;  4KGV B;  4KH0 B;  2QG9 B;  4DEX A;  5CK9 A;  1VQ9 T;  1PSE A;  2DEQ A;  2MOX A;  1AOJ A;  4Y28 E;  4Y91 A;  3V7C A;  4BDY A;  3BDL A;  1VQ9 Q;  3FJ5 A;  2L3R A;  4KT0 E;  5CR2 A;  1RAE B;  2JMA A;  2RQT A;  3PNW C;  1M1K U;  2CSI A;  1ZSG A;  5IN1 A;  1VYV A;  5CIU A;  4JZ4 A;  2QDL A;  5D6W A;  3I56 T;  2DIG A;  1K9M U;  1IRE B;  1SEM A;  1S72 A;  3NTK A;  3VYG A;  3NPF A;  2DXU A;  2A08 A;  2KAF A;  4OMN A;  1S72 T;  3CCS A;  1TUC A;  4GLK A;  3I56 Q;  1AZG B;  1QKW A;  3PVQ A;  1M5Q 1;  1W4S A;  3QUI A;  4IUT A;  2BZ8 A;  2YDL A;  4C92 C;  2K3B A;  1S72 Q;  4RG2 A;  2F1L A;  2BUD A;  3BFM A;  1RI9 A;  3CCS Q;  5FLX E;  4NL2 A;  2ABL A;  3VYH B;  2ZPH B;  4FYV B;  4WTO B;  4BE0 A;  3CXC S;  4M78 D;  2L3P A;  3VS0 A;  1RAF B;  3CPW A;  4J7I A;  3UPU A;  5LJ3 g;  2AK5 A;  4M75 G;  2OI3 A;  4M7A D;  3PE0 A;  1LCK A;  4PLL A;  2CP7 A;  1M1G A;  2E5Q A;  3NHN A;  2RM4 A;  3OYB A;  3OYY A;  3P8D A;  4E7L A;  2HDA A;  3JCM X;  2E64 A;  5A0G A;  3PFS A;  2ZAE A;  1Y96 B;  1PNJ A;  2EIF A;  3KUF A;  2YRV A;  5CKE A;  1LNX A;  2EYW A;  4ZN3 A;  1ZUY A;  1VQ7 A;  3CCQ A;  5LJ3 h;  2DMO A;  3MHX A;  3SEM A;  1X69 A;  2LQK A;  4LD6 A;  4R55 A;  1E7O A;  2AZV A;  4LDY A;  2RI5 A;  1C1A A;  4M7A E;  1I5L A;  3CEY A;  3M58 A;  1VQ7 Q;  5HKC A;  3DLL A;  4LDX A;  5GMK h;  4LE9 A;  3EAE A;  3JCM J;  3S3M A;  1ZHI A;  4KH1 B;  3ZEH A;  3HKS A;  1OU9 A;  1JJ2 A;  3N5B B;  1AWX A;  4FM4 B;  2D0N A;  3HRS A;  4CRI A;  4AFZ C;  2CP3 A;  5CQX A;  3HSB A;  2VKN A;  4C5H A;  1SRM A;  3MEV A;  1WJR A;  4HCK A;  3CMA A;  2EGA A;  4Z89 A;  4QQG A;  1PKT A;  2VWF A;  1Q7Y U;  3CMA T;  2RJF A;  5IHI A;  3MEW A;  1LOJ A;  4CC3 A;  3TRE A;  2DK3 A;  4RTY A;  4BI3 A;  1HXD A;  1WHJ A;  3TU4 K;  1K8A R;  3FRN A;  2B8A A;  4CC7 A;  1RLQ C;  1JB0 E;  1QCN A;  3JRZ A;  3JB9 I;  1KQ2 A;  3CMA Q;  5KYX B;  2CRE A;  2X9H A;  1FMW A;  2M0O A;  1YIT T;  4M7A G;  2HZY A;  2CZ0 B;  4M75 A;  3QZ9 B;  2LNV A;  4FYX B;  2J6F A;  2NUT B;  2FPF A;  3EFO A;  2EPD A;  1BU1 A;  2E4H A;  1UG1 A;  2X4X A;  4OF1 A;  4C92 E;  1U5S A;  2QQB A;  2CP0 A;  3KXT A;  1TUD A;  1IO6 A;  3C4S A;  3VS3 A;  1M2O A;  5CKD A;  2DIL A;  4ZTJ A;  5EG2 A;  4PJN A;  1UUE A;  2VC8 A;  1D1B A;  2LCS A;  5I2M A;  3UA7 A;  3JAM E;  4DBF A;  4EIK A;  1G3Y A;  1K8A C;  2R5M A;  2P0Q A;  4HCB A;  1GCQ A;  5IHN A;  2JXB A;  4Q5W A;  4BB7 A;  3MCA B;  1ZBJ A;  1K0X A;  1XTD A;  2CDT A;  3M4G A;  4LDV A;  5DLO A;  3LWI A;  2QEX A;  3E9G A;  2JM9 A;  1X6G A;  1FXX A;  2QEX T;  1TH7 A;  3GF5 A;  1YWO A;  4RTU A;  4PFO A;  2FG0 A;  1SSH A;  1UFF A;  1WNL A;  5C0M A;  1AD5 A;  4PFZ A;  1QW1 A;  2MPX C;  1NE8 A;  4M7A B;  4M75 F;  2QEX Q;  1YJ9 T;  2HD0 A;  2EVR A;  4M78 A;  1AWW A;  3CCJ A;  3TEE A;  3A1P A;  4PJM A;  4E7K A;  4PJL A;  1VYT A;  1KQ1 A;  5LJ5 e;  2CP5 A;  3CBO A;  4XTX A;  5IT9 E;  3SDZ A;  2EFI A;  3UF4 A;  3QYH B;  5I22 A;  1QP2 A;  3EG1 A;  3CCR T;  1YIJ T;  3JCM g;  4IUV A;  2O88 A;  3CCJ Q;  3REB B;  2DD4 A;  3OSS C;  3CME A;  1G3S A;  4XTV A;  1FWZ A;  3GP8 A;  4E7J A;  3CC2 A;  2CP2 A;  4HVU A;  1OEB A;  2M51 A;  2SRC A;  3H6Z A;  3CCR Q;  1YIJ Q;  2RK1 A;  1VQM T;  2OTJ A;  3CXC P;  1PM3 A;  3BE3 A;  2HCK A;  3FIF A;  2CH4 A;  3JCM V;  5GAO n;  3GPL A;  3CCV A;  2E3H A;  1B07 A;  3OYH A;  2BZY A;  2OTL T;  3CC2 Q;  1BKB A;  4BUG A;  2L2P A;  3I55 A;  3DKM A;  2HKN A;  2JZ2 A;  5CQY A; 
#chains in the Genus database with same CATH homology
 1ZSZ B;  1OU9 A;  1OU8 A;  1ZSZ C;  1OUL A;  2QAZ A;  1OX8 A;  2NYS A;  1OX9 A;  1ZSZ A;  1YFN A;  2QAS A;  1TWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...