1OU8A

Structure of an aaa+ protease delivery protein in complex with a peptide degradation tag
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
b'SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B homolog
molecule tags Transport protein
source organism Haemophilus influenzae
publication title Structure of a delivery protein for an AAA+ protease in complex with a peptide degradation tag
pubmed doi rcsb
total genus 28
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1ou8A00
1YFNA 1OX9A 2QAZA 2QASA 1ZSZC 2NYSA 1OU8A 1OX8A 1ZSZA 1OULA 1TWBA 1ZSZB 1OU9A
chains in the Genus database with same CATH superfamily
3P8HA 1NYFA 4JS4A 4F16A 3QXEB 1YITQ 3GNGA 3SB2A 1YWOA 2ZPFB 1U5SA 2E41A 2HQEA 5FROA 2QA4Q 3MP1A 5DY9A 2KAFA 1Y71A 1I81A 2B8AA 3THKA 3VUZA 2K7AA 4LE9A 2QA4A 3CD6Q 1QKXA 2P0KA 1JXMA 4J6YA 4M75F 3CPWS 2FL7A 1N8RR 2LDMA 3TREA 4ZGEB 4O6JA 2OTJA 1BI1A 3UA7A 1ZLMA 1NPPA 2DM1A 4LUEA 4R55A 1X43A 2DIGA 1EZZB 1JJ2A 1K8AU 3G4SA 3CCQQ 3FJ5A 4Y91A 3JB9G 1Q82C 2NUPA 2BZXA 3DLMA 2GQIA 1AD5A 3TQ7P 3FLGA 2PQWA 5I2MA 1ZSGA 5IXFA 4J9DA 2MAMA 2K9GA 2QASA 4BE0A 4EPCA 1ZUUA 5KYYA 1YJWA 3QPHA 1UHCA 2K6DA 2VV5A 2DJZA 1CSKA 2KYBA 4PJOD 2D8HA 3H0FA 4Z89A 2DL8A 3OA6A 1YHQQ 3SEMA 3CMET 5LL6S 1VQ5A 5L8RE 1YWPA 1IREB 2QQSA 3JCMV 2E70A 1VQPQ 1U8RA 2HBPA 4M7DB 2LJ0A 1Q81U 2BE9B 3EG9B 4OMMA 1I07A 2ZPEB 1OU8A 3M0QA 4J6XA 3H8ZA 4ZNXA 3RMSA 1PG5B 1G3WA 4J9FA 3I55A 3GIBA 3D7SB 4AFUC 3H6ZA 2QK0A 4MMKA 5LJ5f 3G4SQ 3CCQA 1S72A 4M7DE 3HFOA 1EIFA 3E19A 4IUPA 2KT1A 3CC2T 5IN1A 4D8KA 3Q1JA 3CCSQ 4E7HA 1UFFA 1E6GA 3OW2P 1VQ6T 2J7IA 4FYWB 3ER0A 1P92A 3TCJA 2EJ9A 1I0CA 1QP3A 2OAWA 2KQWA 1TUCA 3OS2A 4C92D 3X26B 5GANf 1AWOA 1YJ9Q 4R0KA 4K11A 3UA6A 5KYXA 2JVVA 1WHGA 1Q86R 1TU0B 2JM9A 5GAMd 1Q95G 2NLUA 2PVDB 2AT1B 1G83A 4ZGDB 1QVFP 2YRVA 3OSSC 3ZEHA 3C94A 4C8QD 4E7ZA 5GAN6 2ZPIB 3VYHB 4FYVB 1XNIA 1KC8R 4KULA 4HCZA 5GAN7 2ROLA 4DEXA 3GBQA 3OW2S 4DBFA 4KGZB 4J9CA 1AWJA 2VUBA 4FW2A 4QT7A 4ORZA 2OTLA 1QKWA 2CREA 3I9QA 4RTUA 2W10A 1QP2A 1D0YA 2JW4A 5IXBA 1KQSA 1W2BA 3CCQT 1YJNQ 2EGAA 4M7DF 4OMPA 1BKBA 2CP2A 3CC7Q 4M77B 1PKSA 1VQ4T 1NJIR 2YUNA 4MZMA 1QLYA 2L2PA 1KSWA 3H0HA 4CI0C 3QIIA 4IUTA 2ESWA 2CP3A 1OZ3A 5CQYA 1GFCA 1KQSS 1IO6A 4BI4A 1TS9A 2RO0A 4XQ3A 2JJ9A 3V8KA 1N8RU 3I5RA 4C0ZA 1JO8A 1RAAB 2X35A 4QVZA 1VQLQ 1IHWA 4AG1C 4Y92A 3I5SA 3VRZA 1WHJA 3CMEQ 3RESA 3QBYA 2RJFA 3TSWA 1H641 4LDVA 1JRIA 4CC2A 1U3OA 2KSSA 3REBB 2D9TA 1YIJQ 1RAGB 1GBQA 1BK2A 1TH7A 5A2QE 1KK7A 1WHHA 2A7YA 4PJOA 3X25B 2QGFB 5CKHA 2CZ7B 3EFOB 2FG0A 4AFSC 2ZCFB 2CP5A 4KGVB 1M27C 2X4XA 4DQ2A 4BE1A 3OYGA 3NTKA 4F7UA 1IXDA 5I2SA 2AHJB 2RQRA 2RF0A 2OTLT 3CCUQ 1E7OA 5HK3A 1K0SA 1PNJA 4M4ZA 2X4JA 2XDBA 4F14A 4BI8B 3ASKA 1M1KU 1NJIU 1OZ2A 3G4ST 3KXTA 2LQWA 5A0LA 4LD6A 3TVTA 1KHIA 2KK4A 1QVFA 8AT1B 4JLIA 4MDWA 4PJOG 2CP0A 1HJDA 3J7AF 1M3CA 3G6EA 3DLLA 2BTTA 4M75D 1TG0A 3I56A 3E2UA 3L2QA 1SSFA 1JU5C 4M78D 4M77F 3MEAA 5M9OA 3QDRB 3VS4A 3BFMA 2FEIA 3EGXA 2BZYA 4LN2A 3TSZA 3CCUT 3GF5A 2LNHB 4OF1A 1MHNA 3OYCA 3INZA 4OB0B 4F7UE 2VKNA 1IZ6A 3MKDA 5CKFA 4C8QA 2DVJA 1AZGB 2DRKA 1I5OB 4NL3A 2QDYB 1YJ9A 2NUTA 4J83A 3QKJA 3LLRA 3MPUB 2PTKA 3I55T 2O88A 1K73U 4FT2A 1VYUA 5FW9A 4N0AC 3REAB 5KYUB 1Q7YR 2JTFA 1GFDA 2NYSA 4XU1A 2JXBA 4BI3A 1OX9A 5GAMj 3EG9A 2QG9B 3EG2A 4PFPA 4OMFB 5LJ3g 2OTJT 1WJRA 4JRPA 1H8KA 2F2WA 2VB6A 3FC3A 2DJQA 1SSHA 2YLBA 1HXDA 1K4US 1M9SA 3CC7A 1Z9ZA 4N4GA 1YITT 2RK1A 4D6WA 5I11A 4AG2C 2RNAA 3CC7T 4II1A 3HRTA 1VQ9Q 2RQUA 3CPWP 1VQ4A 3BW1A 1Y7XA 1X6OA 2ENMA 4Z02A 3V8LA 3EH1A 4BDZA 2FRYA 4M77C 3TU4K 3CCMT 3PTAA 3ZBDA 1K9MU 5CKDA 2LRQA 1NG2A 4E47A 1QCFA 4C0DB 3CBOA 5KCOA 1WHKA 3JCMg 3CCVA 2F69A 1KQ1A 2MI6A 1WYXA 1K9AA 4QVCA 4J7FA 3M4YA 5GANg 2EYWA 3JB9H 4V2SA 2QXFA 2DXUA 2FPEA 4X1VA 2C06A 2JNGA 5DM7R 2KROA 3M56A 3ZFJA 2XDPA 2V8JA 2YUOA 2EJGA 5GAMf 1BIAA 2LJ1A 3G71T 4NS5A 3ULRB 4C92E 3JAME 1I4K1 2EQMA 4QQGA 4A4FA 5LJ5d 3J80E 3S6WA 2DXCA 2ZGWA 1QVFS 2O9SA 4RG8A 3L2UA 1MV0B 4E7SA 2LJ3A 4EIKA 3OBWA 2X4WA 2E4HA 4E7KA 2JM8A 2MK5A 4M7DG 1S1NA 3SWNC 4ZN1A 3UDCA 2M02A 2P0PA 2HAXA 1SPKA 2X9HA 2EPDA 1V1CA 4C5GA 5IT9E 2QTXA 1AZEA 1OPKA 3OBYA 4LDUA 1UGQB 1HYOA 2YWWA 4OGCA 1SRMA 3HRSA 4C0DC 1UE9A 1K8AC 4N4HA 4PJOB 3OSVA 4M7DA 1UUEA 4JZ4A 4FCYA 2HSPA 2LQ8A 2ZPGB 4M7AA 5KYYB 2DA9A 4B6MA 2FO0A 2EYQA 2P4TA 2SRCA 5CVIA 5D6XA 1UGRB 3OYIA 1VQKQ 4M7AF 1KIKA 3JCMf 3CMAT 1MNEA 5LJ5h 3A5ZB 1BI3A 4XAXB 2O9VA 1GCQA 2DLPA 1VQOT 2XMFA 1X75C 2HKNA 4QQ6A 1SHFA 1Y96A 2M51A 2CGHA 3EG0A 2WACA 3OYNA 5FWCA 2P4RA 4Y28E 3CBPA 4YTLA 2E5QA 1WJSA 3JCMP 3JSCA 4OVAA 2ED1A 3A8HB 2X3XD 4J8OA 2O31A 3ZL7C 3RIRA 3RKXA 1PCXA 1RI9A 5KYNA 2AIRB 3OYYA 1VQ8A 2JMCA 4D8DA 3X20B 2ZZDA 2QYZA 4RUGA 4C92F 4JRIA 2BZ8A 3M54A 4PJMA 3GP8A 2G3RA 1R0BG 1VOMA 1M8MA 2V1RA 3NMZC 2RD1A 3OMGA 4C8QB 3URGA 1GXIE 3AT1B 1ZBJA 4M75B 3OYJA 2DYBA 5GAN8 2V8KA 2CSQA 2QDLA 2FRWA 2GBQA 1J3TA 2IVWA 2KRNA 1KD1C 1WNLA 1UEBA 2LCCA 3DB4A 3CCVT 3QG1A 2O2OA 3VUBA 2BKDN 1NEBA 4HVUA 1VQ8Q 2EIFA 2K2MA 4A4EA 5IH2A 2WSFE 3X24B 1W1FA 5GAN2 2V1QA 1YHQT 1OQKA 1C6VX 2K5FA 2KI7A 4XTUA 2CUDA 4PKCC 5CIUA 2KDSA 4OMQA 2LQKA 3LWIA 1YJNA 2DVEA 5CQXA 1SKUB 4FU6A 4XU3A 3G71A 1WI7A 2MOXA 4Q5WA 2LNVA 4WF2A 1YI2T 1QVPA 3HKSA 2KGTA 2LT1A 2PUOB 4J9HA 3PMTA 4FYYB 1V29B 2OTLQ 4LD9K 3G71Q 3ME9A 1OI1A 2JTMA 4HKEA 4HCKA 1M1FA 1G8XA 1ZA1B 2P0QA 2EYYA 1VQNQ 3JCMh 2KXCA 2COZA 4M78G 3X28B 2F5KA 3SWNB 1X2QA 3OB9A 1X69A 1UTIA 3O5ZA 2K79A 3NGPA 4CC4B 3A8MB 2KXDA 4N0AA 2EKOA 3CXCP 3CCSA 1VQOQ 2DEQA 1FMVA 1HK9A 4ZTJA 3CCST 3OYLA 1OOTA 5KH6A 4F7UG 1GRIA 3CCMA 1S72Q 1BU1A 3VU3C 2A08A 3OYEA 1K0XA 2NWMA 2YT6A 3M9QA 4PLLA 2YLCA 2EBPA 1M1KC 1QCNA 4CC3A 4JJCA 2E64A 7AT1B 4PLIA 4RTWA 2O4XB 1Y0MA 1CKBA 3U23A 3M53A 5L23A 4N4IA 2ROTA 5C6SA 2XDDA 1UGVA 5AYFA 3JB9J 3I55Q 4KUDK 1PSFA 2L3QA 2Y4YA 4OMNA 1WIEA 1KHCA 4ZTFA 1PD0A 3NHNA 3FB9A 2FHDA 2M0OA 1KC8U 1WHMA 2EYXA 2JMAA 3RMQA 3CCVQ 4HA8A 2OI3A 3HTRA 2HQXA 2YXYA 4DOWA 3EH2A 2VXEA 1D1AA 2EQKA 3EGXB 2XICA 2CH4W 3GNFB 3LWHA 5GAOn 4FIBA 1Y96B 4J9IA 2RQWA 4HCBA 4NL2A 4PNOA 4EDUA 4M78C 2HL3A 3QO3A 4M75C 4C8QF 4EMHA 6AT1B 2I0NA 4LDWA 4RTZA 1W2BP 2AKLA 3EFRA 2XKOC 4OB3B 3MHXA 4MZPA 5GAOp 1M90U 5IHNA 1AT1B 1AHJB 4LNPA 5GMKm 3VJPA 1X01A 2EW3A 1K73C 3GPLA 1ZSZA 2K57A 2JT4A 2QAZA 2R57A 3VS5A 1PRMC 4KH0B 1X27A 4IIOA 2LMJA 5LJ3j 4X34A 1YCYA 1JB0E 5I22A 3R6OA 2JTEA 1VUBA 2VGNA 2RHUA 5LJ5e 2F2VA 1HSQA 3QUIA 1NM7A 1KG1A 2XIDA 5FLXE 4NOYA 2J05A 3VS7A 2QQBA 4HVWA 3MEUA 3G6EQ 4M78E 2DF6A 2M1HA 4J9GA 1TSFA 5GMKj 3PT9A 2DEUA 2EQIA 1RAFB 1PWTA 3S3NA 3BDLA 1C1AA 3JV3A 1WFWA 1MMAA 1NPRA 2NUZA 1D0ZA 2HQHA 2MF2A 2FYKA 2ZPBB 2K5IA 3I35A 2ZAEA 4KGXB 3M0UA 4M77G 2VVKA 2K3BA 1BI0A 2BUDA 3LGFA 2RQVA 5GANj 2A28A 4JRQA 2VC8A 1BBZA 4RMOA 1IRXA 2FB7A 2LP5A 3BE3A 1M3BA 3QWXX 3UT1A 1RI0A 3SHWA 1GCPA 2MYSA 3SFMA 5HY6A 1VQ4Q 2RN8A 3A8LB 3AHUA 3SDZA 4PK4A 5DLOA 1UJYA 2QGGA 2K3YA 2DKGA 3L42A 2K5LA 2RQTA 1YITA 2CH4A 3TEEA 2DE0X 1W2BS 2EWNA 2YUPA 3UPUA 2HD0A 3PNWC 1GCQC 2FVUA 1MGQA 1RABB 1NYGA 2EGEA 3T9NA 1YJ9T 4M7DD 1MMDA 1TTHB 4M78F 2DZCA 3EGDB 1SG5A 1KFZA 2L89A 3GOXA 3OW2A 1IB8A 2RK2A 3CCJT 3RDVA 3CEYA 2W0ZA 3M57A 4JRKA 3VS2A 4A54A 1W4SA 2JN0A 3FJPA 3CCRT 1N5ZA 4XU0A 5CKBA 1OEBA 2CUBA 4ME7A 3META 1G2BA 2LVMA 1PSEA 2F2XA 8ATCB 3MP8A 1ABOA 1O9SA 2H3EB 1UECA 1YFNA 3V8JA 3QZ5B 1W6XA 3RKYA 4DBQA 5D6WA 3V7SA 5A0DA 3I56T 2MIOA 1G3SA 2ABLA 2LT4A 3C4SA 4FW1A 4ANJA 1N8RC 2DZ9A 1KC8C 3IQLA 1VQ5T 1M4ZA 2D0NA 1NEGA 1MMGA 1PC0A 4MZTA 4AMCA 4JPBW 4JUVA 5FRNA 2IPOB 2DL7A 5J3BA 1VQ6Q 1M2VB 3RBBB 2KEAA 1WXUA 2ZPHB 5HCKA 2CP7A 1UG1A 4FL6A 2GNCA 1WA7A 3UF4A 4M77A 2QQAA 1VQMQ 2WSEE 1K76A 3H0IA 2M9UA 3MP6A 1OU9A 1WXTA 2V26A 4KUIA 2EGCA 3VKIA 4HT9A 2GF7A 1ARKA 2CDTA 1IGUA 3NPFA 3CCEA 3BDUA 1FXXA 1E6HA 1VQNT 3JB9F 1ZBXA 4RTYA 2NUPB 2DNUA 2KNBB 2M0YA 2AKKA 2DPPB 5GAMe 4QQDA 4XTZA 3OY9A 5J39A 3M55A 3VS1A 2RJDA 1Y07A 1M1GA 2EQJA 2YUQA 1VQLA 2C0IA 2A37A 4X9DA 3MCAB 3N5BB 4FYXB 4M7AD 2QEXA 5GMKi 5CK9A 3PVLA 4ATOA 3EG1A 1XTDA 1ZUKA 4XU2A 2E3IA 1D1BA 9ATCB 2GCXA 5GMKh 1VIEA 2K3XA 4L59A 2CT3A 4PJNA 5IHIA 5GAOm 2HSEB 2A36A 5FU7B 3DKMA 2DD4A 2RI3A 2VGMA 4BDYA 2F1LA 4B9XA 2AZVA 3OYHA 1HD3A 2D0QB 3EHQA 2HZYA 4RTXA 4QVDA 1LJOA 4XTWA 1SEMA 4F7UB 1VYVA 1W70A 2XG8D 2FPFA 2Z0WA 1NLPC 4C5IA 2CS7A 1SHGA 4MMLA 5LJ3d 3M5AA 3HFNA 3VV0A 5EC7A 1M2VA 2BE7D 1R77A 2JUFA 1N6AA 1YIJT 1VQKA 3E1SA 2AZSA 1PKTA 3QJYA 2PZ1A 3QSUA 4LXCA 2QA4T 2DRMA 1WX6A 2L0AA 2YHTA 2CYZB 3EHRA 4JS5A 1SF9A 2J6KA 1KJWA 1MV3A 5IAYA 1PRLC 2I2LA 2CSIA 5LJ3e 1T3LA 3OYMA 1LVKA 1D0XA 2KR3A 3EAEA 1G3YA 3CCJQ 1WPYA 4CRIA 4EMKA 1GL5A 3QHSA 3UATA 4OP0A 1VYTA 3CD6A 3EFSA 3LH0A 2PUKB 3JCMW 4PJLA 4UC4A 3PIOA 1N9RA 3GLXA 4M78B 4PJOF 5EG2A 5FU7C 1UJ0A 4RCBA 2J06A 1K9MC 1B07A 4PJOE 4XK8E 3KFVA 5CKEA 1YJWT 2DTIA 3P8BB 2K2VA 4KBMB 1VQOA 2VWFA 3FEOA 2DIQA 4FSSA 1ZQ1A 2LC4A 1B34B 1G5VA 5GAOq 3KBGA 2O4XA 4M7AB 1D3BA 4A4HA 2M16A 1TOVA 2B86A 2DD5A 1YNZA 3CC4T 4M77D 2LTOA 2XD0A 4AFQC 1R0CB 1WLPB 2YRCA 1GBRA 1JJ2P 5A0GA 1SRLA 3CXCS 4OMLA 2IIMA 4GLMA 1ZHIA 3QDFA 2DL4A 5GMKl 2DBKA 2EQUA 1R8OB 3A1PA 1O75A 3KUFA 4E6RA 2PVGB 3M0RA 2D1XA 3G6ET 3JB9D 4Z8AA 4IURA 3A98A 3HL8A 4LDYA 1MMNA 3H41A 2O01E 1DJ7B 2XU8A 3EGUA 1VQ8T 4KH1B 5KE3A 3M4GA 2OTJQ 2JS0A 3EFOA 1VQ9A 1QWFA 1Q82R 1N27A 3CMAA 1JJ2S 1OPLA 2GFAA 4BE2A 4J9EA 4IIMA 1JBMA 1RLPC 4FSXA 1UHFA 2HNIA 2E6NA 2HBWA 4PFOA 4A63B 1CKAA 2J6OA 3PGGA 1XQHA 1I5LA 2JS2A 5GJWB 3CCET 3LW5E 4MDXA 3CCMQ 1YP5A 3JCMd 2FZKB 2EAYA 2ED0A 4LUDA 4IUUA 1QWEA 1RL2A 1RAEB 4HT8A 3OQ5A 1UDLA 3HSBA 5CR2A 5FRMA 2RPNA 4C92C 3FIFA 5GMKe 2BIVA 2KVQG 4M77E 3A8GB 3OYKA 3S3OA 1BCOA 4LDXA 1NJIC 4DBHA 4EMKB 1IGQA 2X4YA 3LH5A 1UGPB 2EKHA 1M1KR 3OS1A 2DBMA 4C5HA 5KE2A 1U1SA 2HMAA 1Q7YC 3RERA 5KYWA 2HL5C 1VQNA 2QTVA 1AOJA 4DBRA 3M0TA 3L2ZA 5DLQE 3WVEB 2D8JA 3CCRQ 1FYNA 2A3LA 1H3HA 2PU9B 3CC2A 2KMTA 1FWZA 4OGEA 4XTVA 1TUGB 3CCUA 1NE8A 4F17A 5KYUA 4JZ3A 3R6NA 5HKCA 2DILA 5AT1B 1K8AR 2GTJA 1LNXA 3SWNA 2NUTB 1V76A 1G3TA 4OB1B 4IUQA 1YBYA 3WXMB 4JJDA 3NTHA 4E7IA 3NTIA 3OS5A 1YI2Q 1A0NB 5LJ3h 1B7TA 3HP9A 4KRTA 2A0FB 1VQMT 1QMCA 1YIJA 4EMGA 3CPFA 3VRYA 1K73R 2E12A 3VS0A 2L3PA 2R58A 1OYXA 3DB3A 4M7AG 1EX4A 4E2FB 2KYMA 1TXQA 2K4YA 1WHLA 1Q7YU 4ELYC 4PFZA 1ZA2B 2KBTA 3HPWA 1ZUYA 3CXCA 2QEXT 4TVRA 3CBMA 4B9WA 1WGSA 3M0SA 2RMOA 4FT4A 3JRZA 2EVRA 3JB9I 2VYTA 5GAN5 2MWOA 1EFNA 2YSQA 1QVGS 1D09B 4KT0E 4DOVA 3C12A 1MUZA 2DO3A 4GBQA 1D1CA 4M75E 1RUWA 4P5NA 2GTOA 1ZSZC 1BIBA 4XTYA 1VQ6A 1XOVA 4ELZC 4PJJA 1M90R 2RHZA 1QW1A 3LX7A 4X9CA 4AT1B 1VQPA 3CC4A 2LX7A 4M75A 5GAN3 1YHQA 2DXTA 4M78A 2RA2A 4CC7A 1AWXA 1XJWB 3SD4A 3CD6T 4C5EA 5GAMg 4GY5A 2DX1A 3CCLQ 3HHTB 5GANd 3JCMQ 2KRSA 3OS0A 4L6V5 5J26A 2OJ2A 4C0GA 3EG3A 2RI2A 1KQSP 2DETA 1D3BB 2RH2A 2LCSA 5GANh 2FZGB 4DA4A 1N9SA 4BY6B 5LJ5j 2ATCB 2Y4XA 4C0FA 5CAIA 1Q81C 2LZ6B 1YCSB 2KE9A 1UGSB 2RB6A 2COYA 2RM4A 2DFUA 2LQNA 2JOYA 5HK0A 3OMCA 3JCMX 3L2WA 5GAMh 5C0MA 2HCKA 4J7IA 1B34A 2V8IA 3OYBA 3PVQA 2QI2A 1KQ2A 2MCNA 2RHIA 3PMIA 3OYFA 1BI2A 1OV3A 3F70A 2GGRA 4JDSA 2E3HA 2LCLA 1TWBA 5LJ5g 2COWA 2DXBA 4DEYA 2QQ9A 3CCJA 1JQQA 1M30A 4FM4B 1H3ZA 4HVVA 1ABQA 3LYIA 3M58A 4RKUE 4C92A 4L5GA 4C8QE 2EFIA 3E9FA 1RLQC 1NLOC 2R5MA 2Y90A 4OB2B 4WTOB 1IHVA 4QW2A 2R5AA 1K1ZA 3MEWA 1NBEB 2EYZA 3L2VA 4IUVA 4M7DC 1JXOA 3CC4Q 2P84A 5GAOl 4C92G 4JLGA 3I56Q 1JEGA 2YDLA 4F7UF 3S3MA 2CT4A 3M59A 1VQ5Q 2CZ1B 2VXFA 3RR6A 4BY6C 4Z88A 1M90C 4E7JA 5KYXB 3V7CA 4RCCA 2DL5A 1YJWQ 2GFUA 4A53A 4O5VA 1X2KA 2GQVA 4A4GA 4GLKA 5FWBA 1Q82U 2FPDA 3VS3A 2AK5A 4ZN3A 2X3WD 4M75G 1QVGA 3O8VA 2KT8A 2QEXQ 2DTOA 1YN8A 2RHXA 2X51A 1RAHB 1M2OA 3G1JA 4JJBA 3C95A 2J6FA 1I1JA 1M3AA 1AWWA 3VYGA 3VS6A 1WJQA 1Q81R 3E9GA 1ZSZB 1K9MR 2MMPA 3RNJA 5FU6C 3A8OB 2VASA 4RG2A 2D6FA 2H8HA 2HKQB 4RTTA 5IHKA 2CP6A 3CMEA 4F04B 2CZ0B 1M5Q1 3QYHB 1VQ7A 1C0MA 5KYWB 1U1TA 3FDRA 1VQMA 1M8VA 2E10A 1FMWA 4WCIA 3CCLA 1VA7A 2QQRA 1QCOA 4R56A 4E7LA 1LPLA 1T3SA 3CCEQ 3CCLT 4BB7A 1YI2A 2RHYA 4HCCA 4A4KA 2OX7A 2XI9A 2FZCB 3JCMe 3NFCA 4J5YA 2KRMA 3WVDB 3QYGB 1TUDA 3V7RA 2DL3A 3CPWA 1S72T 4IKFA 2DERA 1WZOA 2RJCA 2L5QA 1T0HA 1QVGP 4EMKC 4XTXA 3LGLA 3MJXA 2F5TX 1RACB 5KCHA 2L8DA 1VQLT 3RKWA 1OX8A 1AEYA 1WQWA 1VQPT 2KY9A 1X6GA 5GAN4 3C0CA 1LCKA 1KD1R 1LOJA 5CCAA 4C8QC 3QWYA 1MNDA 3H9NA 1ZX6A 4VUBA 5GJVB 3UWNA 1PD1A 2WSCE 5FU6B 2MPXC 4ZGJB 1I8FA 1NZ9A 2RI5A 2DTHA 2OAUA 3PFSA 1U06A 1QQJA 3FRNA 2RJEA 5D6YA 4M7AC 2ECZA 5CO7A 2E6ZA 3QZ9B 1KD1U 2H3JA 3CQTA 1BB9A 1PM3A 5I21A 1Y57A 1FX7A 1X6BA 2DYIA 3CMAQ 2C0TA 2DMOA 2E5KA 1WQ7A 3RUXA 3MEVA 2IG0A 1AVZC 1WDXA 4AFZC 4HXJA 5GAOr 3JCMJ 3JCMb 3L1AA 1F1BB 4OMOA 3PE0A 1T0JA 1UB4A 4C8QG 2JZ2A 2HEQA 4BUGA 2MWPA 5D7UA 1WXBA 2DAQA 2CKKA 2CZ6B 4J9BA 3OYDA 4JJNK 2HDAA 3JCMc 3CCRA 4J6WA 3BY7A 1Z9QA 4QKUA 2L3RA 1VQKT 4PL6A 2PVOB 5LJ3f 5GANe 2XHCA 4BD3A 2PNIA 1RAIB 1RADB 3EGDA 1FMKA 4M7AE 1OULA 4PJOC 3CC2Q 1ACMB 2G6FX 3L2RA 3QJ6A 3HRUA 4RTVA 2XK0A 2L3SA 1YJNT 1Q86C 3J81E 5ECAA 1Q86U 1VQ7Q 1H92A 1B3QA 1BYMA 3M0PA 1PHTA 4ESRA 2C0OA 2LX9A 2YRDA 3OYAA 4BACA 1VQ9T 2E65A 1VIFA 3G7ZA 1VQ7T 2EJFA 3MO8A 2SEMA 1BCMA 3P8DA 2DK3A 4C92B 3PIPA 2E1HA
chains in the Genus database with same CATH topology
1YFNA 1OX9A 2QAZA 2QASA 1ZSZC 2NYSA 1OU8A 1OX8A 1ZSZA 1OULA 1TWBA 1ZSZB 1OU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YFN A;  1OX9 A;  2QAZ A;  2QAS A;  1ZSZ C;  2NYS A;  1OU8 A;  1OX8 A;  1ZSZ A;  1OUL A;  1TWB A;  1ZSZ B;  1OU9 A; 
#chains in the Genus database with same CATH topology
 3P8H A;  1NYF A;  4JS4 A;  4F16 A;  3QXE B;  1YIT Q;  3GNG A;  3SB2 A;  1YWO A;  2ZPF B;  1U5S A;  2E41 A;  2HQE A;  5FRO A;  2QA4 Q;  3MP1 A;  5DY9 A;  2KAF A;  1Y71 A;  1I81 A;  2B8A A;  3THK A;  3VUZ A;  2K7A A;  4LE9 A;  2QA4 A;  3CD6 Q;  1QKX A;  2P0K A;  1JXM A;  4J6Y A;  4M75 F;  3CPW S;  2FL7 A;  1N8R R;  2LDM A;  3TRE A;  4ZGE B;  4O6J A;  2OTJ A;  1BI1 A;  3UA7 A;  1ZLM A;  1NPP A;  2DM1 A;  4LUE A;  4R55 A;  1X43 A;  2DIG A;  1EZZ B;  1JJ2 A;  1K8A U;  3G4S A;  3CCQ Q;  3FJ5 A;  4Y91 A;  3JB9 G;  1Q82 C;  2NUP A;  2BZX A;  3DLM A;  2GQI A;  1AD5 A;  3TQ7 P;  3FLG A;  2PQW A;  5I2M A;  1ZSG A;  5IXF A;  4J9D A;  2MAM A;  2K9G A;  2QAS A;  4BE0 A;  4EPC A;  1ZUU A;  5KYY A;  1YJW A;  3QPH A;  1UHC A;  2K6D A;  2VV5 A;  2DJZ A;  1CSK A;  2KYB A;  4PJO D;  2D8H A;  3H0F A;  4Z89 A;  2DL8 A;  3OA6 A;  1YHQ Q;  3SEM A;  3CME T;  5LL6 S;  1VQ5 A;  5L8R E;  1YWP A;  1IRE B;  2QQS A;  3JCM V;  2E70 A;  1VQP Q;  1U8R A;  2HBP A;  4M7D B;  2LJ0 A;  1Q81 U;  2BE9 B;  3EG9 B;  4OMM A;  1I07 A;  2ZPE B;  1OU8 A;  3M0Q A;  4J6X A;  3H8Z A;  4ZNX A;  3RMS A;  1PG5 B;  1G3W A;  4J9F A;  3I55 A;  3GIB A;  3D7S B;  4AFU C;  3H6Z A;  2QK0 A;  4MMK A;  5LJ5 f;  3G4S Q;  3CCQ A;  1S72 A;  4M7D E;  3HFO A;  1EIF A;  3E19 A;  4IUP A;  2KT1 A;  3CC2 T;  5IN1 A;  4D8K A;  3Q1J A;  3CCS Q;  4E7H A;  1UFF A;  1E6G A;  3OW2 P;  1VQ6 T;  2J7I A;  4FYW B;  3ER0 A;  1P92 A;  3TCJ A;  2EJ9 A;  1I0C A;  1QP3 A;  2OAW A;  2KQW A;  1TUC A;  3OS2 A;  4C92 D;  3X26 B;  5GAN f;  1AWO A;  1YJ9 Q;  4R0K A;  4K11 A;  3UA6 A;  5KYX A;  2JVV A;  1WHG A;  1Q86 R;  1TU0 B;  2JM9 A;  5GAM d;  1Q95 G;  2NLU A;  2PVD B;  2AT1 B;  1G83 A;  4ZGD B;  1QVF P;  2YRV A;  3OSS C;  3ZEH A;  3C94 A;  4C8Q D;  4E7Z A;  5GAN 6;  2ZPI B;  3VYH B;  4FYV B;  1XNI A;  1KC8 R;  4KUL A;  4HCZ A;  5GAN 7;  2ROL A;  4DEX A;  3GBQ A;  3OW2 S;  4DBF A;  4KGZ B;  4J9C A;  1AWJ A;  2VUB A;  4FW2 A;  4QT7 A;  4ORZ A;  2OTL A;  1QKW A;  2CRE A;  3I9Q A;  4RTU A;  2W10 A;  1QP2 A;  1D0Y A;  2JW4 A;  5IXB A;  1KQS A;  1W2B A;  3CCQ T;  1YJN Q;  2EGA A;  4M7D F;  4OMP A;  1BKB A;  2CP2 A;  3CC7 Q;  4M77 B;  1PKS A;  1VQ4 T;  1NJI R;  2YUN A;  4MZM A;  1QLY A;  2L2P A;  1KSW A;  3H0H A;  4CI0 C;  3QII A;  4IUT A;  2ESW A;  2CP3 A;  1OZ3 A;  5CQY A;  1GFC A;  1KQS S;  1IO6 A;  4BI4 A;  1TS9 A;  2RO0 A;  4XQ3 A;  2JJ9 A;  3V8K A;  1N8R U;  3I5R A;  4C0Z A;  1JO8 A;  1RAA B;  2X35 A;  4QVZ A;  1VQL Q;  1IHW A;  4AG1 C;  4Y92 A;  3I5S A;  3VRZ A;  1WHJ A;  3CME Q;  3RES A;  3QBY A;  2RJF A;  3TSW A;  1H64 1;  4LDV A;  1JRI A;  4CC2 A;  1U3O A;  2KSS A;  3REB B;  2D9T A;  1YIJ Q;  1RAG B;  1GBQ A;  1BK2 A;  1TH7 A;  5A2Q E;  1KK7 A;  1WHH A;  2A7Y A;  4PJO A;  3X25 B;  2QGF B;  5CKH A;  2CZ7 B;  3EFO B;  2FG0 A;  4AFS C;  2ZCF B;  2CP5 A;  4KGV B;  1M27 C;  2X4X A;  4DQ2 A;  4BE1 A;  3OYG A;  3NTK A;  4F7U A;  1IXD A;  5I2S A;  2AHJ B;  2RQR A;  2RF0 A;  2OTL T;  3CCU Q;  1E7O A;  5HK3 A;  1K0S A;  1PNJ A;  4M4Z A;  2X4J A;  2XDB A;  4F14 A;  4BI8 B;  3ASK A;  1M1K U;  1NJI U;  1OZ2 A;  3G4S T;  3KXT A;  2LQW A;  5A0L A;  4LD6 A;  3TVT A;  1KHI A;  2KK4 A;  1QVF A;  8AT1 B;  4JLI A;  4MDW A;  4PJO G;  2CP0 A;  1HJD A;  3J7A F;  1M3C A;  3G6E A;  3DLL A;  2BTT A;  4M75 D;  1TG0 A;  3I56 A;  3E2U A;  3L2Q A;  1SSF A;  1JU5 C;  4M78 D;  4M77 F;  3MEA A;  5M9O A;  3QDR B;  3VS4 A;  3BFM A;  2FEI A;  3EGX A;  2BZY A;  4LN2 A;  3TSZ A;  3CCU T;  3GF5 A;  2LNH B;  4OF1 A;  1MHN A;  3OYC A;  3INZ A;  4OB0 B;  4F7U E;  2VKN A;  1IZ6 A;  3MKD A;  5CKF A;  4C8Q A;  2DVJ A;  1AZG B;  2DRK A;  1I5O B;  4NL3 A;  2QDY B;  1YJ9 A;  2NUT A;  4J83 A;  3QKJ A;  3LLR A;  3MPU B;  2PTK A;  3I55 T;  2O88 A;  1K73 U;  4FT2 A;  1VYU A;  5FW9 A;  4N0A C;  3REA B;  5KYU B;  1Q7Y R;  2JTF A;  1GFD A;  2NYS A;  4XU1 A;  2JXB A;  4BI3 A;  1OX9 A;  5GAM j;  3EG9 A;  2QG9 B;  3EG2 A;  4PFP A;  4OMF B;  5LJ3 g;  2OTJ T;  1WJR A;  4JRP A;  1H8K A;  2F2W A;  2VB6 A;  3FC3 A;  2DJQ A;  1SSH A;  2YLB A;  1HXD A;  1K4U S;  1M9S A;  3CC7 A;  1Z9Z A;  4N4G A;  1YIT T;  2RK1 A;  4D6W A;  5I11 A;  4AG2 C;  2RNA A;  3CC7 T;  4II1 A;  3HRT A;  1VQ9 Q;  2RQU A;  3CPW P;  1VQ4 A;  3BW1 A;  1Y7X A;  1X6O A;  2ENM A;  4Z02 A;  3V8L A;  3EH1 A;  4BDZ A;  2FRY A;  4M77 C;  3TU4 K;  3CCM T;  3PTA A;  3ZBD A;  1K9M U;  5CKD A;  2LRQ A;  1NG2 A;  4E47 A;  1QCF A;  4C0D B;  3CBO A;  5KCO A;  1WHK A;  3JCM g;  3CCV A;  2F69 A;  1KQ1 A;  2MI6 A;  1WYX A;  1K9A A;  4QVC A;  4J7F A;  3M4Y A;  5GAN g;  2EYW A;  3JB9 H;  4V2S A;  2QXF A;  2DXU A;  2FPE A;  4X1V A;  2C06 A;  2JNG A;  5DM7 R;  2KRO A;  3M56 A;  3ZFJ A;  2XDP A;  2V8J A;  2YUO A;  2EJG A;  5GAM f;  1BIA A;  2LJ1 A;  3G71 T;  4NS5 A;  3ULR B;  4C92 E;  3JAM E;  1I4K 1;  2EQM A;  4QQG A;  4A4F A;  5LJ5 d;  3J80 E;  3S6W A;  2DXC A;  2ZGW A;  1QVF S;  2O9S A;  4RG8 A;  3L2U A;  1MV0 B;  4E7S A;  2LJ3 A;  4EIK A;  3OBW A;  2X4W A;  2E4H A;  4E7K A;  2JM8 A;  2MK5 A;  4M7D G;  1S1N A;  3SWN C;  4ZN1 A;  3UDC A;  2M02 A;  2P0P A;  2HAX A;  1SPK A;  2X9H A;  2EPD A;  1V1C A;  4C5G A;  5IT9 E;  2QTX A;  1AZE A;  1OPK A;  3OBY A;  4LDU A;  1UGQ B;  1HYO A;  2YWW A;  4OGC A;  1SRM A;  3HRS A;  4C0D C;  1UE9 A;  1K8A C;  4N4H A;  4PJO B;  3OSV A;  4M7D A;  1UUE A;  4JZ4 A;  4FCY A;  2HSP A;  2LQ8 A;  2ZPG B;  4M7A A;  5KYY B;  2DA9 A;  4B6M A;  2FO0 A;  2EYQ A;  2P4T A;  2SRC A;  5CVI A;  5D6X A;  1UGR B;  3OYI A;  1VQK Q;  4M7A F;  1KIK A;  3JCM f;  3CMA T;  1MNE A;  5LJ5 h;  3A5Z B;  1BI3 A;  4XAX B;  2O9V A;  1GCQ A;  2DLP A;  1VQO T;  2XMF A;  1X75 C;  2HKN A;  4QQ6 A;  1SHF A;  1Y96 A;  2M51 A;  2CGH A;  3EG0 A;  2WAC A;  3OYN A;  5FWC A;  2P4R A;  4Y28 E;  3CBP A;  4YTL A;  2E5Q A;  1WJS A;  3JCM P;  3JSC A;  4OVA A;  2ED1 A;  3A8H B;  2X3X D;  4J8O A;  2O31 A;  3ZL7 C;  3RIR A;  3RKX A;  1PCX A;  1RI9 A;  5KYN A;  2AIR B;  3OYY A;  1VQ8 A;  2JMC A;  4D8D A;  3X20 B;  2ZZD A;  2QYZ A;  4RUG A;  4C92 F;  4JRI A;  2BZ8 A;  3M54 A;  4PJM A;  3GP8 A;  2G3R A;  1R0B G;  1VOM A;  1M8M A;  2V1R A;  3NMZ C;  2RD1 A;  3OMG A;  4C8Q B;  3URG A;  1GXI E;  3AT1 B;  1ZBJ A;  4M75 B;  3OYJ A;  2DYB A;  5GAN 8;  2V8K A;  2CSQ A;  2QDL A;  2FRW A;  2GBQ A;  1J3T A;  2IVW A;  2KRN A;  1KD1 C;  1WNL A;  1UEB A;  2LCC A;  3DB4 A;  3CCV T;  3QG1 A;  2O2O A;  3VUB A;  2BKD N;  1NEB A;  4HVU A;  1VQ8 Q;  2EIF A;  2K2M A;  4A4E A;  5IH2 A;  2WSF E;  3X24 B;  1W1F A;  5GAN 2;  2V1Q A;  1YHQ T;  1OQK A;  1C6V X;  2K5F A;  2KI7 A;  4XTU A;  2CUD A;  4PKC C;  5CIU A;  2KDS A;  4OMQ A;  2LQK A;  3LWI A;  1YJN A;  2DVE A;  5CQX A;  1SKU B;  4FU6 A;  4XU3 A;  3G71 A;  1WI7 A;  2MOX A;  4Q5W A;  2LNV A;  4WF2 A;  1YI2 T;  1QVP A;  3HKS A;  2KGT A;  2LT1 A;  2PUO B;  4J9H A;  3PMT A;  4FYY B;  1V29 B;  2OTL Q;  4LD9 K;  3G71 Q;  3ME9 A;  1OI1 A;  2JTM A;  4HKE A;  4HCK A;  1M1F A;  1G8X A;  1ZA1 B;  2P0Q A;  2EYY A;  1VQN Q;  3JCM h;  2KXC A;  2COZ A;  4M78 G;  3X28 B;  2F5K A;  3SWN B;  1X2Q A;  3OB9 A;  1X69 A;  1UTI A;  3O5Z A;  2K79 A;  3NGP A;  4CC4 B;  3A8M B;  2KXD A;  4N0A A;  2EKO A;  3CXC P;  3CCS A;  1VQO Q;  2DEQ A;  1FMV A;  1HK9 A;  4ZTJ A;  3CCS T;  3OYL A;  1OOT A;  5KH6 A;  4F7U G;  1GRI A;  3CCM A;  1S72 Q;  1BU1 A;  3VU3 C;  2A08 A;  3OYE A;  1K0X A;  2NWM A;  2YT6 A;  3M9Q A;  4PLL A;  2YLC A;  2EBP A;  1M1K C;  1QCN A;  4CC3 A;  4JJC A;  2E64 A;  7AT1 B;  4PLI A;  4RTW A;  2O4X B;  1Y0M A;  1CKB A;  3U23 A;  3M53 A;  5L23 A;  4N4I A;  2ROT A;  5C6S A;  2XDD A;  1UGV A;  5AYF A;  3JB9 J;  3I55 Q;  4KUD K;  1PSF A;  2L3Q A;  2Y4Y A;  4OMN A;  1WIE A;  1KHC A;  4ZTF A;  1PD0 A;  3NHN A;  3FB9 A;  2FHD A;  2M0O A;  1KC8 U;  1WHM A;  2EYX A;  2JMA A;  3RMQ A;  3CCV Q;  4HA8 A;  2OI3 A;  3HTR A;  2HQX A;  2YXY A;  4DOW A;  3EH2 A;  2VXE A;  1D1A A;  2EQK A;  3EGX B;  2XIC A;  2CH4 W;  3GNF B;  3LWH A;  5GAO n;  4FIB A;  1Y96 B;  4J9I A;  2RQW A;  4HCB A;  4NL2 A;  4PNO A;  4EDU A;  4M78 C;  2HL3 A;  3QO3 A;  4M75 C;  4C8Q F;  4EMH A;  6AT1 B;  2I0N A;  4LDW A;  4RTZ A;  1W2B P;  2AKL A;  3EFR A;  2XKO C;  4OB3 B;  3MHX A;  4MZP A;  5GAO p;  1M90 U;  5IHN A;  1AT1 B;  1AHJ B;  4LNP A;  5GMK m;  3VJP A;  1X01 A;  2EW3 A;  1K73 C;  3GPL A;  1ZSZ A;  2K57 A;  2JT4 A;  2QAZ A;  2R57 A;  3VS5 A;  1PRM C;  4KH0 B;  1X27 A;  4IIO A;  2LMJ A;  5LJ3 j;  4X34 A;  1YCY A;  1JB0 E;  5I22 A;  3R6O A;  2JTE A;  1VUB A;  2VGN A;  2RHU A;  5LJ5 e;  2F2V A;  1HSQ A;  3QUI A;  1NM7 A;  1KG1 A;  2XID A;  5FLX E;  4NOY A;  2J05 A;  3VS7 A;  2QQB A;  4HVW A;  3MEU A;  3G6E Q;  4M78 E;  2DF6 A;  2M1H A;  4J9G A;  1TSF A;  5GMK j;  3PT9 A;  2DEU A;  2EQI A;  1RAF B;  1PWT A;  3S3N A;  3BDL A;  1C1A A;  3JV3 A;  1WFW A;  1MMA A;  1NPR A;  2NUZ A;  1D0Z A;  2HQH A;  2MF2 A;  2FYK A;  2ZPB B;  2K5I A;  3I35 A;  2ZAE A;  4KGX B;  3M0U A;  4M77 G;  2VVK A;  2K3B A;  1BI0 A;  2BUD A;  3LGF A;  2RQV A;  5GAN j;  2A28 A;  4JRQ A;  2VC8 A;  1BBZ A;  4RMO A;  1IRX A;  2FB7 A;  2LP5 A;  3BE3 A;  1M3B A;  3QWX X;  3UT1 A;  1RI0 A;  3SHW A;  1GCP A;  2MYS A;  3SFM A;  5HY6 A;  1VQ4 Q;  2RN8 A;  3A8L B;  3AHU A;  3SDZ A;  4PK4 A;  5DLO A;  1UJY A;  2QGG A;  2K3Y A;  2DKG A;  3L42 A;  2K5L A;  2RQT A;  1YIT A;  2CH4 A;  3TEE A;  2DE0 X;  1W2B S;  2EWN A;  2YUP A;  3UPU A;  2HD0 A;  3PNW C;  1GCQ C;  2FVU A;  1MGQ A;  1RAB B;  1NYG A;  2EGE A;  3T9N A;  1YJ9 T;  4M7D D;  1MMD A;  1TTH B;  4M78 F;  2DZC A;  3EGD B;  1SG5 A;  1KFZ A;  2L89 A;  3GOX A;  3OW2 A;  1IB8 A;  2RK2 A;  3CCJ T;  3RDV A;  3CEY A;  2W0Z A;  3M57 A;  4JRK A;  3VS2 A;  4A54 A;  1W4S A;  2JN0 A;  3FJP A;  3CCR T;  1N5Z A;  4XU0 A;  5CKB A;  1OEB A;  2CUB A;  4ME7 A;  3MET A;  1G2B A;  2LVM A;  1PSE A;  2F2X A;  8ATC B;  3MP8 A;  1ABO A;  1O9S A;  2H3E B;  1UEC A;  1YFN A;  3V8J A;  3QZ5 B;  1W6X A;  3RKY A;  4DBQ A;  5D6W A;  3V7S A;  5A0D A;  3I56 T;  2MIO A;  1G3S A;  2ABL A;  2LT4 A;  3C4S A;  4FW1 A;  4ANJ A;  1N8R C;  2DZ9 A;  1KC8 C;  3IQL A;  1VQ5 T;  1M4Z A;  2D0N A;  1NEG A;  1MMG A;  1PC0 A;  4MZT A;  4AMC A;  4JPB W;  4JUV A;  5FRN A;  2IPO B;  2DL7 A;  5J3B A;  1VQ6 Q;  1M2V B;  3RBB B;  2KEA A;  1WXU A;  2ZPH B;  5HCK A;  2CP7 A;  1UG1 A;  4FL6 A;  2GNC A;  1WA7 A;  3UF4 A;  4M77 A;  2QQA A;  1VQM Q;  2WSE E;  1K76 A;  3H0I A;  2M9U A;  3MP6 A;  1OU9 A;  1WXT A;  2V26 A;  4KUI A;  2EGC A;  3VKI A;  4HT9 A;  2GF7 A;  1ARK A;  2CDT A;  1IGU A;  3NPF A;  3CCE A;  3BDU A;  1FXX A;  1E6H A;  1VQN T;  3JB9 F;  1ZBX A;  4RTY A;  2NUP B;  2DNU A;  2KNB B;  2M0Y A;  2AKK A;  2DPP B;  5GAM e;  4QQD A;  4XTZ A;  3OY9 A;  5J39 A;  3M55 A;  3VS1 A;  2RJD A;  1Y07 A;  1M1G A;  2EQJ A;  2YUQ A;  1VQL A;  2C0I A;  2A37 A;  4X9D A;  3MCA B;  3N5B B;  4FYX B;  4M7A D;  2QEX A;  5GMK i;  5CK9 A;  3PVL A;  4ATO A;  3EG1 A;  1XTD A;  1ZUK A;  4XU2 A;  2E3I A;  1D1B A;  9ATC B;  2GCX A;  5GMK h;  1VIE A;  2K3X A;  4L59 A;  2CT3 A;  4PJN A;  5IHI A;  5GAO m;  2HSE B;  2A36 A;  5FU7 B;  3DKM A;  2DD4 A;  2RI3 A;  2VGM A;  4BDY A;  2F1L A;  4B9X A;  2AZV A;  3OYH A;  1HD3 A;  2D0Q B;  3EHQ A;  2HZY A;  4RTX A;  4QVD A;  1LJO A;  4XTW A;  1SEM A;  4F7U B;  1VYV A;  1W70 A;  2XG8 D;  2FPF A;  2Z0W A;  1NLP C;  4C5I A;  2CS7 A;  1SHG A;  4MML A;  5LJ3 d;  3M5A A;  3HFN A;  3VV0 A;  5EC7 A;  1M2V A;  2BE7 D;  1R77 A;  2JUF A;  1N6A A;  1YIJ T;  1VQK A;  3E1S A;  2AZS A;  1PKT A;  3QJY A;  2PZ1 A;  3QSU A;  4LXC A;  2QA4 T;  2DRM A;  1WX6 A;  2L0A A;  2YHT A;  2CYZ B;  3EHR A;  4JS5 A;  1SF9 A;  2J6K A;  1KJW A;  1MV3 A;  5IAY A;  1PRL C;  2I2L A;  2CSI A;  5LJ3 e;  1T3L A;  3OYM A;  1LVK A;  1D0X A;  2KR3 A;  3EAE A;  1G3Y A;  3CCJ Q;  1WPY A;  4CRI A;  4EMK A;  1GL5 A;  3QHS A;  3UAT A;  4OP0 A;  1VYT A;  3CD6 A;  3EFS A;  3LH0 A;  2PUK B;  3JCM W;  4PJL A;  4UC4 A;  3PIO A;  1N9R A;  3GLX A;  4M78 B;  4PJO F;  5EG2 A;  5FU7 C;  1UJ0 A;  4RCB A;  2J06 A;  1K9M C;  1B07 A;  4PJO E;  4XK8 E;  3KFV A;  5CKE A;  1YJW T;  2DTI A;  3P8B B;  2K2V A;  4KBM B;  1VQO A;  2VWF A;  3FEO A;  2DIQ A;  4FSS A;  1ZQ1 A;  2LC4 A;  1B34 B;  1G5V A;  5GAO q;  3KBG A;  2O4X A;  4M7A B;  1D3B A;  4A4H A;  2M16 A;  1TOV A;  2B86 A;  2DD5 A;  1YNZ A;  3CC4 T;  4M77 D;  2LTO A;  2XD0 A;  4AFQ C;  1R0C B;  1WLP B;  2YRC A;  1GBR A;  1JJ2 P;  5A0G A;  1SRL A;  3CXC S;  4OML A;  2IIM A;  4GLM A;  1ZHI A;  3QDF A;  2DL4 A;  5GMK l;  2DBK A;  2EQU A;  1R8O B;  3A1P A;  1O75 A;  3KUF A;  4E6R A;  2PVG B;  3M0R A;  2D1X A;  3G6E T;  3JB9 D;  4Z8A A;  4IUR A;  3A98 A;  3HL8 A;  4LDY A;  1MMN A;  3H41 A;  2O01 E;  1DJ7 B;  2XU8 A;  3EGU A;  1VQ8 T;  4KH1 B;  5KE3 A;  3M4G A;  2OTJ Q;  2JS0 A;  3EFO A;  1VQ9 A;  1QWF A;  1Q82 R;  1N27 A;  3CMA A;  1JJ2 S;  1OPL A;  2GFA A;  4BE2 A;  4J9E A;  4IIM A;  1JBM A;  1RLP C;  4FSX A;  1UHF A;  2HNI A;  2E6N A;  2HBW A;  4PFO A;  4A63 B;  1CKA A;  2J6O A;  3PGG A;  1XQH A;  1I5L A;  2JS2 A;  5GJW B;  3CCE T;  3LW5 E;  4MDX A;  3CCM Q;  1YP5 A;  3JCM d;  2FZK B;  2EAY A;  2ED0 A;  4LUD A;  4IUU A;  1QWE A;  1RL2 A;  1RAE B;  4HT8 A;  3OQ5 A;  1UDL A;  3HSB A;  5CR2 A;  5FRM A;  2RPN A;  4C92 C;  3FIF A;  5GMK e;  2BIV A;  2KVQ G;  4M77 E;  3A8G B;  3OYK A;  3S3O A;  1BCO A;  4LDX A;  1NJI C;  4DBH A;  4EMK B;  1IGQ A;  2X4Y A;  3LH5 A;  1UGP B;  2EKH A;  1M1K R;  3OS1 A;  2DBM A;  4C5H A;  5KE2 A;  1U1S A;  2HMA A;  1Q7Y C;  3RER A;  5KYW A;  2HL5 C;  1VQN A;  2QTV A;  1AOJ A;  4DBR A;  3M0T A;  3L2Z A;  5DLQ E;  3WVE B;  2D8J A;  3CCR Q;  1FYN A;  2A3L A;  1H3H A;  2PU9 B;  3CC2 A;  2KMT A;  1FWZ A;  4OGE A;  4XTV A;  1TUG B;  3CCU A;  1NE8 A;  4F17 A;  5KYU A;  4JZ3 A;  3R6N A;  5HKC A;  2DIL A;  5AT1 B;  1K8A R;  2GTJ A;  1LNX A;  3SWN A;  2NUT B;  1V76 A;  1G3T A;  4OB1 B;  4IUQ A;  1YBY A;  3WXM B;  4JJD A;  3NTH A;  4E7I A;  3NTI A;  3OS5 A;  1YI2 Q;  1A0N B;  5LJ3 h;  1B7T A;  3HP9 A;  4KRT A;  2A0F B;  1VQM T;  1QMC A;  1YIJ A;  4EMG A;  3CPF A;  3VRY A;  1K73 R;  2E12 A;  3VS0 A;  2L3P A;  2R58 A;  1OYX A;  3DB3 A;  4M7A G;  1EX4 A;  4E2F B;  2KYM A;  1TXQ A;  2K4Y A;  1WHL A;  1Q7Y U;  4ELY C;  4PFZ A;  1ZA2 B;  2KBT A;  3HPW A;  1ZUY A;  3CXC A;  2QEX T;  4TVR A;  3CBM A;  4B9W A;  1WGS A;  3M0S A;  2RMO A;  4FT4 A;  3JRZ A;  2EVR A;  3JB9 I;  2VYT A;  5GAN 5;  2MWO A;  1EFN A;  2YSQ A;  1QVG S;  1D09 B;  4KT0 E;  4DOV A;  3C12 A;  1MUZ A;  2DO3 A;  4GBQ A;  1D1C A;  4M75 E;  1RUW A;  4P5N A;  2GTO A;  1ZSZ C;  1BIB A;  4XTY A;  1VQ6 A;  1XOV A;  4ELZ C;  4PJJ A;  1M90 R;  2RHZ A;  1QW1 A;  3LX7 A;  4X9C A;  4AT1 B;  1VQP A;  3CC4 A;  2LX7 A;  4M75 A;  5GAN 3;  1YHQ A;  2DXT A;  4M78 A;  2RA2 A;  4CC7 A;  1AWX A;  1XJW B;  3SD4 A;  3CD6 T;  4C5E A;  5GAM g;  4GY5 A;  2DX1 A;  3CCL Q;  3HHT B;  5GAN d;  3JCM Q;  2KRS A;  3OS0 A;  4L6V 5;  5J26 A;  2OJ2 A;  4C0G A;  3EG3 A;  2RI2 A;  1KQS P;  2DET A;  1D3B B;  2RH2 A;  2LCS A;  5GAN h;  2FZG B;  4DA4 A;  1N9S A;  4BY6 B;  5LJ5 j;  2ATC B;  2Y4X A;  4C0F A;  5CAI A;  1Q81 C;  2LZ6 B;  1YCS B;  2KE9 A;  1UGS B;  2RB6 A;  2COY A;  2RM4 A;  2DFU A;  2LQN A;  2JOY A;  5HK0 A;  3OMC A;  3JCM X;  3L2W A;  5GAM h;  5C0M A;  2HCK A;  4J7I A;  1B34 A;  2V8I A;  3OYB A;  3PVQ A;  2QI2 A;  1KQ2 A;  2MCN A;  2RHI A;  3PMI A;  3OYF A;  1BI2 A;  1OV3 A;  3F70 A;  2GGR A;  4JDS A;  2E3H A;  2LCL A;  1TWB A;  5LJ5 g;  2COW A;  2DXB A;  4DEY A;  2QQ9 A;  3CCJ A;  1JQQ A;  1M30 A;  4FM4 B;  1H3Z A;  4HVV A;  1ABQ A;  3LYI A;  3M58 A;  4RKU E;  4C92 A;  4L5G A;  4C8Q E;  2EFI A;  3E9F A;  1RLQ C;  1NLO C;  2R5M A;  2Y90 A;  4OB2 B;  4WTO B;  1IHV A;  4QW2 A;  2R5A A;  1K1Z A;  3MEW A;  1NBE B;  2EYZ A;  3L2V A;  4IUV A;  4M7D C;  1JXO A;  3CC4 Q;  2P84 A;  5GAO l;  4C92 G;  4JLG A;  3I56 Q;  1JEG A;  2YDL A;  4F7U F;  3S3M A;  2CT4 A;  3M59 A;  1VQ5 Q;  2CZ1 B;  2VXF A;  3RR6 A;  4BY6 C;  4Z88 A;  1M90 C;  4E7J A;  5KYX B;  3V7C A;  4RCC A;  2DL5 A;  1YJW Q;  2GFU A;  4A53 A;  4O5V A;  1X2K A;  2GQV A;  4A4G A;  4GLK A;  5FWB A;  1Q82 U;  2FPD A;  3VS3 A;  2AK5 A;  4ZN3 A;  2X3W D;  4M75 G;  1QVG A;  3O8V A;  2KT8 A;  2QEX Q;  2DTO A;  1YN8 A;  2RHX A;  2X51 A;  1RAH B;  1M2O A;  3G1J A;  4JJB A;  3C95 A;  2J6F A;  1I1J A;  1M3A A;  1AWW A;  3VYG A;  3VS6 A;  1WJQ A;  1Q81 R;  3E9G A;  1ZSZ B;  1K9M R;  2MMP A;  3RNJ A;  5FU6 C;  3A8O B;  2VAS A;  4RG2 A;  2D6F A;  2H8H A;  2HKQ B;  4RTT A;  5IHK A;  2CP6 A;  3CME A;  4F04 B;  2CZ0 B;  1M5Q 1;  3QYH B;  1VQ7 A;  1C0M A;  5KYW B;  1U1T A;  3FDR A;  1VQM A;  1M8V A;  2E10 A;  1FMW A;  4WCI A;  3CCL A;  1VA7 A;  2QQR A;  1QCO A;  4R56 A;  4E7L A;  1LPL A;  1T3S A;  3CCE Q;  3CCL T;  4BB7 A;  1YI2 A;  2RHY A;  4HCC A;  4A4K A;  2OX7 A;  2XI9 A;  2FZC B;  3JCM e;  3NFC A;  4J5Y A;  2KRM A;  3WVD B;  3QYG B;  1TUD A;  3V7R A;  2DL3 A;  3CPW A;  1S72 T;  4IKF A;  2DER A;  1WZO A;  2RJC A;  2L5Q A;  1T0H A;  1QVG P;  4EMK C;  4XTX A;  3LGL A;  3MJX A;  2F5T X;  1RAC B;  5KCH A;  2L8D A;  1VQL T;  3RKW A;  1OX8 A;  1AEY A;  1WQW A;  1VQP T;  2KY9 A;  1X6G A;  5GAN 4;  3C0C A;  1LCK A;  1KD1 R;  1LOJ A;  5CCA A;  4C8Q C;  3QWY A;  1MND A;  3H9N A;  1ZX6 A;  4VUB A;  5GJV B;  3UWN A;  1PD1 A;  2WSC E;  5FU6 B;  2MPX C;  4ZGJ B;  1I8F A;  1NZ9 A;  2RI5 A;  2DTH A;  2OAU A;  3PFS A;  1U06 A;  1QQJ A;  3FRN A;  2RJE A;  5D6Y A;  4M7A C;  2ECZ A;  5CO7 A;  2E6Z A;  3QZ9 B;  1KD1 U;  2H3J A;  3CQT A;  1BB9 A;  1PM3 A;  5I21 A;  1Y57 A;  1FX7 A;  1X6B A;  2DYI A;  3CMA Q;  2C0T A;  2DMO A;  2E5K A;  1WQ7 A;  3RUX A;  3MEV A;  2IG0 A;  1AVZ C;  1WDX A;  4AFZ C;  4HXJ A;  5GAO r;  3JCM J;  3JCM b;  3L1A A;  1F1B B;  4OMO A;  3PE0 A;  1T0J A;  1UB4 A;  4C8Q G;  2JZ2 A;  2HEQ A;  4BUG A;  2MWP A;  5D7U A;  1WXB A;  2DAQ A;  2CKK A;  2CZ6 B;  4J9B A;  3OYD A;  4JJN K;  2HDA A;  3JCM c;  3CCR A;  4J6W A;  3BY7 A;  1Z9Q A;  4QKU A;  2L3R A;  1VQK T;  4PL6 A;  2PVO B;  5LJ3 f;  5GAN e;  2XHC A;  4BD3 A;  2PNI A;  1RAI B;  1RAD B;  3EGD A;  1FMK A;  4M7A E;  1OUL A;  4PJO C;  3CC2 Q;  1ACM B;  2G6F X;  3L2R A;  3QJ6 A;  3HRU A;  4RTV A;  2XK0 A;  2L3S A;  1YJN T;  1Q86 C;  3J81 E;  5ECA A;  1Q86 U;  1VQ7 Q;  1H92 A;  1B3Q A;  1BYM A;  3M0P A;  1PHT A;  4ESR A;  2C0O A;  2LX9 A;  2YRD A;  3OYA A;  4BAC A;  1VQ9 T;  2E65 A;  1VIF A;  3G7Z A;  1VQ7 T;  2EJF A;  3MO8 A;  2SEM A;  1BCM A;  3P8D A;  2DK3 A;  4C92 B;  3PIP A;  2E1H A; 
#chains in the Genus database with same CATH homology
 1YFN A;  1OX9 A;  2QAZ A;  2QAS A;  1ZSZ C;  2NYS A;  1OU8 A;  1OX8 A;  1ZSZ A;  1OUL A;  1TWB A;  1ZSZ B;  1OU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...