1OU8A

Structure of an aaa+ protease delivery protein in complex with a peptide degradation tag
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B homolog
publication title Structure of a delivery protein for an AAA+ protease in complex with a peptide degradation tag
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
total genus 28
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1ou8A00
1OU8A 1YFNA 1ZSZB 1ZSZC 1TWBA 2QASA 1OULA 2QAZA 2NYSA 1OX8A 1ZSZA 1OX9A 1OU9A
chains in the Genus database with same CATH superfamily
2ZCFB 3CBPA 1K76A 1M3AA 1ZSZA 5CAIA 1HK9A 4E7SA 4MMLA 4J9DA 2VV5A 4MDXA 1UG1A 2JVVA 1K73C 2EGEA 3HSBA 2JOYA 2JZ2A 5LJ3j 1JQQA 2RQUA 1RUWA 2R5MA 2M9UA 4LD9K 2XI9A 3EGDA 1WHKA 1E6HA 5FRMA 2ZPIB 1DJ7B 2EQUA 1TTHB 1JJ2A 3QWYA 1NG2A 3R6NA 5KYYA 2NUTA 3A98A 1X6OA 1OOTA 3E19A 2ATCB 1V29B 1QWEA 1QQJA 4JJNK 2RNAA 3CC7A 2X9HA 3M54A 3SWNB 3LWHA 1UB4A 4M77F 2GQIA 1YJNA 1KC8R 3M55A 1VQ7A 2F69A 1QVGA 2EYQA 2IPOB 3OYAA 2JXBA 4OMLA 4PFOA 1TS9A 2K6DA 4LDYA 2E4HA 2K2VA 2CREA 2QEXA 1W70A 4BI3A 2RB6A 4JS4A 2CSIA 2QXFA 2ED0A 2X3WD 3EHQA 1H641 2P0KA 3PIOA 2K5IA 2DIQA 4II1A 4C8QC 2D6FA 3META 4OF1A 4RG2A 1NJIR 5FU7B 3L1AA 1IHWA 4BDZA 3FEOA 4ZTFA 2FZCB 3OYNA 2CS7A 3PFSA 3PVQA 4RCCA 1FMVA 4IUVA 2FPEA 2DYIA 2F2VA 4B9WA 4HVWA 1AWJA 3RESA 1G3TA 2YHTA 1GRIA 2LQKA 3VS6A 5KYUA 3G71T 3J81E 3H8ZA 1BCOA 3SEMA 4FYVB 1HYOA 4AT1B 3HHTB 2C0TA 5CKFA 2KEAA 4BE0A 4C5GA 1M2VA 4RTVA 3J7AF 5GMKl 2L89A 4NL3A 2RPNA 3PMTA 2LCLA 2C0OA 2HCKA 3H9NA 4QQ6A 4XTVA 4M75B 4RTXA 4MZPA 2OJ2A 4PJOG 2QAZA 1M3CA 5L23A 2MPXC 4F7UB 3GOXA 3CMEA 2EPDA 1K9MU 4C5HA 5GANf 4PJJA 3A1PA 2V1QA 2FZKB 2HD0A 3VUBA 5DM7R 4FT4A 2LP5A 3OS1A 1WNLA 2QQSA 1I5LA 4JUVA 4ZGEB 3RKXA 1K8AR 2CT4A 3A8MB 4PL6A 1OPKA 4MDWA 1Q81C 1BBZA 2VC8A 1KG1A 3EHRA 3G71Q 4KUDK 4JZ3A 1B34A 3HRSA 2BUDA 5LJ5f 3OYGA 1WLPB 4Y91A 2L3SA 4AFQC 1ARKA 2EYXA 3QJ6A 3MEUA 1VQ8T 1NZ9A 4OB2B 2RN8A 1E6GA 4PFPA 1BB9A 1LVKA 5GJVB 3UT1A 4KUIA 3V7SA 3I56A 2GCXA 5KH6A 1OULA 3EG9B 3U23A 1NPRA 2NUPA 4AMCA 1KQ1A 1WI7A 1KHCA 2V1RA 5GANe 1O9SA 2QQBA 2LX9A 3TU4K 2ROLA 3E9GA 5I2SA 1Q95G 2ZPHB 4D8KA 3NFCA 2JTMA 3RBBB 1R0CB 2OI3A 5EG2A 1NE8A 2E12A 4E7LA 1D0ZA 4KBMB 4F04B 4M7AA 3UATA 3VS0A 2KXCA 2HKQB 1TH7A 4P5NA 3I9QA 3FJ5A 2QGGA 1M1KR 3VUZA 3FC3A 4C92G 2KBTA 4XQ3A 1VQNA 4D6WA 1VQ8Q 1Q86R 3KFVA 2X3XD 1WDXA 2FEIA 4QT7A 2HSPA 4FU6A 4GY5A 4PJMA 3JCMQ 2RMOA 4V2SA 1M1FA 4QQDA 1N8RR 1OV3A 4XU0A 3ZFJA 2A37A 2CUDA 2D8HA 1VOMA 3JB9I 1I5OB 3MEVA 5GAMh 1ZSGA 1U3OA 1PC0A 2KDSA 2KY9A 3LW5E 2O88A 1KQSP 3G4SA 1PHTA 1YJWT 4CC4B 2LJ3A 2EQKA 1MNEA 4B9XA 3OW2A 4XTUA 5GAN2 5C6SA 4LDUA 1BI3A 1OU9A 5GJWB 2OX7A 1ZBXA 2LC4A 4HCCA 3CCLT 1PSEA 4ZNXA 2EJ9A 2IVWA 1D1AA 3CPWA 4IKFA 1WHHA 3JB9G 2RF0A 1JJ2S 4N4GA 1ABOA 5GAMe 3RERA 4BY6B 1JBMA 1XOVA 2DBKA 1PWTA 5CCAA 1RL2A 1KC8C 2DRKA 3MPUB 4Z88A 1AWOA 2LTOA 4CI0C 4OB0B 3FB9A 2QA4A 2M51A 3M4YA 1S72T 2LDMA 4OMQA 3CCST 2ZPGB 5GAN6 3CXCA 4M77B 5D6WA 4LXCA 2WSFE 5KE2A 1AWWA 5DY9A 1QVGS 4FM4B 1NJIC 2M0YA 2L8DA 3HTRA 4J9HA 1YJWQ 3C12A 3M59A 3M0QA 4ZGJB 3CBMA 1D3BB 2XDDA 3SWNC 3M0TA 1GBQA 2HL5C 3CCLQ 4Z89A 2Y4XA 1ZUKA 4EIKA 3CCVT 1G3YA 2W10A 2YLCA 2JM8A 2F5KA 4RCBA 2LNVA 4C8QE 1QVFP 1AD5A 2HBWA 1NYGA 2RI3A 2E65A 1M9SA 4FCYA 4EMKA 3VS7A 4A4FA 2CSQA 1PSFA 4KH1B 3QBYA 3ULRB 3CCEA 1Y96A 2LMJA 5FU7C 1FYNA 5KYWA 3CCSQ 5ECAA 1W4SA 1X27A 5I21A 3VRZA 1UEBA 4CC3A 1YFNA 2F5TX 1CKAA 1N27A 3UF4A 1Q7YU 3RMQA 2HEQA 4C8QD 2ENMA 5GMKm 1ZSZB 3DLLA 2WACA 1VQPT 3NHNA 1T0JA 2O4XA 3P8HA 4NL2A 5LJ3f 2RK2A 2RQVA 2HQXA 3AT1B 2RQWA 2KVQG 2X4WA 1AT1B 2PNIA 1K1ZA 3EG0A 1MMGA 3CCVQ 4N4HA 3EGDB 3CD6T 1UTIA 3QYHB 1AWXA 3X25B 4ZTJA 3NGPA 2QTXA 1SSFA 4CRIA 2O2OA 3F70A 1W2BA 3MP6A 2B8AA 4LUDA 2DZCA 5KYYB 2FPDA 1NLOC 2NUTB 2DVJA 4JJBA 1JRIA 4M75C 1C6VX 1VQKA 5FW9A 1E7OA 3MKDA 1N6AA 3L2VA 2A36A 2EGCA 3CCUT 3BFMA 4RTWA 4PNOA 4XTWA 2CZ0B 2QASA 4JZ4A 1VQ9Q 1WHJA 2COYA 2F2XA 2DIGA 2YUQA 2D0NA 3OB9A 5J26A 1K8AU 2MK5A 4XTZA 1VQPQ 1GCPA 1VYUA 2KQWA 1Q82C 1WX6A 1ZUYA 1RLQC 2RK1A 4IURA 2DXBA 3CD6Q 3JB9H 4M75G 4LNPA 1MMAA 2DBMA 1QLYA 2PVDB 4F7UG 1M1KC 4C0FA 1XTDA 4ANJA 2KXDA 1QW1A 2MWOA 1JXMA 1Q86C 2G6FX 1KD1U 3LWIA 1IGQA 1UGSB 2WSEE 3DB4A 1CSKA 5LL6S 3CCRT 1ZLMA 1M90R 3OYBA 1OX9A 4J9GA 2P4TA 3FIFA 3VS2A 3CCUQ 5GAN4 1BK2A 4R0KA 1EIFA 3X20B 3QPHA 3QWXX 4HCKA 3NTIA 4DEXA 2K3BA 1X2KA 2GFAA 3I5RA 1M2VB 4EPCA 1PG5B 4IUQA 3EGXB 2L3RA 2FHDA 1R8OB 3JCMX 3QDRB 2M0OA 1SEMA 4YTLA 4MMKA 3VU3C 3E1SA 2DTHA 2ZPEB 2P4RA 3OS5A 4C8QA 2YSQA 3OYEA 1M5Q1 4BD3A 5CK9A 3OSSC 3FJPA 1RAGB 3HP9A 1YI2A 3ASKA 3OW2S 2X4JA 2RI5A 1X01A 1N8RU 1VIFA 5IHNA 1BKBA 2EJFA 4OGEA 3MEWA 3THKA 2K5LA 1QP3A 3QZ5B 1I4K1 4KGZB 3OSVA 4RKUE 3CCRQ 4AG2C 2X4XA 3OMGA 1JEGA 1B34B 2DM1A 4CC2A 2WSCE 2SRCA 1PCXA 4HA8A 3JCMP 3OQ5A 4BACA 3C0CA 3CCQQ 3QHSA 1N9RA 1D09B 3OYIA 4L5GA 3CXCS 3JCMf 2GTOA 1Z9QA 2F1LA 1XNIA 2NUPB 1PKTA 1Z9ZA 1H3HA 1IO6A 4L59A 3O5ZA 2BE7D 3HPWA 4N0AC 3QJYA 3EAEA 2P0QA 4AFZC 4DBRA 1VA7A 4NOYA 1SHFA 2ESWA 2J06A 4KH0B 1MGQA 1GFDA 7AT1B 2G3RA 2CP3A 3MP1A 4M77C 4PLLA 3KBGA 2YT6A 1VQ4T 1K73U 1NPPA 4QQGA 4EMGA 1Y57A 2CT3A 2CKKA 4M7AB 1VQOT 1UGQB 2HQEA 4WTOB 1Y07A 1KFZA 5FRNA 4BUGA 2DMOA 1M8VA 4Z02A 4QVCA 4AFSC 3KXTA 5GAOr 4OMNA 3X26B 4X34A 3M0PA 3L2RA 4C5IA 3OYLA 3JCMe 3M56A 1LCKA 2HMAA 1GCQA 2HQHA 4M78E 4PJOC 3L2UA 1QP2A 5KCHA 3FRNA 4ELZC 2CH4A 4BDYA 1VQ5T 1YJ9A 2HDAA 2IIMA 2CZ6B 4HCZA 5FWCA 2E6ZA 4C8QF 4M77G 3CC2T 2FPFA 1H3ZA 1WHLA 3OYMA 3E9FA 1VQMA 3N5BB 1WZOA 1YCYA 4CC7A 2BZ8A 2KMTA 4J9EA 4J6WA 1VQ4Q 1ZUUA 1JXOA 2E10A 3V8JA 1VQOQ 4XTXA 4M78D 1N5ZA 3EGXA 3NTKA 5FU6B 3OS0A 1ZSZC 1W2BS 3G6EA 3A8HB 3JV3A 4LDXA 4M7DE 5GAOn 4IUTA 3OYHA 2M16A 2E6NA 4AG1C 1VQ6T 2ROTA 1S72A 1SSHA 2VVKA 3OBYA 3H0FA 3TSWA 1AVZC 2RA2A 2CYZB 4J6XA 2DTOA 1G3SA 3LYIA 2LCCA 3JCMV 3OMCA 2PQWA 2D8JA 2YWWA 1G3WA 2E5QA 2P0PA 1TWBA 3BDUA 1VQ5Q 1X75C 4RTUA 1G83A 1WPYA 2CP6A 4A4KA 4C0ZA 1ZX6A 2ED1A 2EVRA 4JRQA 5GANg 5GANd 1UGRB 3CC2Q 3JCMc 3CMAT 3JAME 3V7RA 4M7DD 1TUCA 4KGXB 5GANh 2EW3A 3LGLA 3M9QA 2CZ1B 3H41A 2QI2A 3Q1JA 1UFFA 1LPLA 3G7ZA 3H0IA 1JO8A 2OTLA 5GMKh 4XK8E 1FX7A 3HFOA 4LUEA 3ZL7C 3CCMT 3S3OA 4C92C 1M90C 3VS5A 1VQ6Q 1KHIA 1UHCA 4FSSA 5CKHA 4EMKB 2K2MA 5LJ5h 2X51A 3ER0A 3M4GA 2AT1B 1ZHIA 3M5AA 2L5QA 4DOVA 4E7ZA 1Y96B 1VYVA 2JTEA 1Q81U 5KYNA 2AKKA 5KYWB 4FYWB 5GMKe 4OB1B 1N9SA 1RAIB 1Q82R 1BI2A 3PVLA 2LT4A 2ZPFB 1RI9A 1NYFA 2MWPA 2ECZA 2R57A 3FLGA 3VV0A 2BZYA 1WA7A 2EFIA 4PLIA 3CMAQ 1ABQA 1K9AA 1Y7XA 5LJ5e 2A0FB 4A53A 2O4XB 2DZ9A 3CCJA 1U8RA 1QMCA 1PKSA 4PFZA 1ZBJA 3FDRA 2BTTA 2BKDN 1KQ2A 3OS2A 1MHNA 3CCMQ 1B3QA 3CC7T 3GBQA 3ZBDA 3S3NA 2OTJT 1M8MA 3CC4A 1PM3A 1YJNT 3JCMb 5GAMd 5GAMg 2JS0A 3UWNA 1VQ7T 3VYHB 2KRSA 2AHJB 3BE3A 4M78A 3X28B 5CKDA 5C0MA 1GXIE 4O6JA 1KQSA 1YIJA 4JPBW 4ESRA 1UJYA 2QEXT 2KYBA 4C0GA 2FVUA 4QW2A 3VJPA 2DRMA 3MJXA 3EH1A 4E7HA 4GLMA 5GAN3 3L2QA 2RH2A 2FO0A 1X6GA 1YITA 1YWOA 2VYTA 1A0NB 1J3TA 4QVDA 5D7UA 5AT1B 2CP7A 1AOJA 1K0SA 1SG5A 1YCSB 3UA6A 1CKBA 3M53A 2BE9B 2CP2A 3QYGB 1PD0A 3M0RA 4M7DA 2J6FA 3CC7Q 1YHQA 2A28A 4HKEA 1UJ0A 2OAUA 2OTJQ 2E64A 2K7AA 1YJNQ 2DL8A 1VQ7Q 3EG2A 3S6WA 1RAEB 2DXTA 5IXBA 4VUBA 4FL6A 2C0IA 2O31A 2KRNA 1SPKA 1HXDA 2HSEB 2QEXQ 3PNWC 1K0XA 5L8RE 3VRYA 4OMFB 2PVGB 2DLPA 5GANj 2QTVA 4JJDA 1C1AA 2RO0A 4FIBA 4FW1A 1FXXA 3CMET 1X43A 3CXCP 2QDYB 1UECA 2F2WA 1KC8U 2KT1A 1M1GA 1KIKA 1MMDA 1QVFA 4R56A 2D1XA 4M7AC 2PZ1A 2A08A 5A0LA 5GMKj 4RG8A 1RADB 4JLGA 5FROA 2EYZA 2CH4W 1AEYA 4JRPA 1HJDA 3EG1A 4PJOE 4C8QB 1OEBA 4D8DA 1I1JA 2QYZA 1NJIU 2B86A 4OB3B 1AZEA 4LD6A 1VQ9T 3RIRA 2FYKA 2YRCA 1QVPA 4WCIA 4BE2A 2KROA 2CGHA 4M78F 3I56T 2H3JA 2XK0A 2AIRB 1ACMB 4RMOA 4M7AG 2DXUA 2RD1A 2RHUA 1X2QA 2K9GA 2YRDA 4PJOD 1M30A 3QIIA 1IRXA 3CMEQ 2XMFA 1BI1A 2K79A 5KCOA 1QCFA 2CUBA 1WJRA 2JNGA 4Q5WA 3GLXA 1TUGB 4DBHA 2HAXA 2RJDA 3BDLA 2EQJA 2L0AA 4LDWA 2DPPB 1H8KA 4OMMA 5FU6C 4F17A 1OZ3A 1RABB 5HCKA 4IIMA 2RQRA 3I55T 5LJ3h 2PU9B 1NBEB 2VB6A 1C0MA 2FB7A 4C0DB 3S3MA 1BIBA 4M7DF 1SKUB 1K9MR 5GAMj 3X24B 2VGMA 2OAWA 4X9CA 5A2QE 2H8HA 1T3SA 1VQNT 1WIEA 1JB0E 2O9VA 3JSCA 1QCNA 4LE9A 2I2LA 4E2FB 4OGCA 3A5ZB 1VQLT 2DK3A 3I56Q 3M0SA 2QQAA 5LJ3e 2ABLA 1IREB 4HT8A 1V76A 5IN1A 3QZ9B 2HKNA 3RKYA 3OY9A 5CQXA 1R0BG 2DJZA 1WQ7A 1UHFA 4C92E 4HVVA 2QQRA 2V8JA 4PJNA 1BCMA 2VUBA 2JM9A 1U5SA 2V8IA 5I2MA 2R58A 2DKGA 4A4HA 4WF2A 1TXQA 2CP5A 2DEQA 3CPFA 5A0DA 4A63B 2HNIA 5EC7A 4XU3A 3I55Q 4LDVA 2E1HA 3RDVA 4EMKC 3G71A 2QG9B 3UA7A 1VYTA 2CDTA 4C92D 1VQNQ 2VWFA 4HXJA 5CIUA 2QDLA 1Q82U 5J39A 2DE0X 1XQHA 2EYWA 3A8GB 1KSWA 2Y4YA 4ORZA 2MMPA 2QA4T 4JRKA 3RKWA 5DLQE 1VQLQ 2NWMA 3WVDB 4BI4A 2LVMA 3DLMA 4FSXA 4ME7A 3CCQT 4JS5A 2RQTA 5GAOl 3AHUA 1M1KU 4ZN3A 2EJGA 4ZGDB 2D9TA 2GTJA 5CR2A 4ZN1A 5IAYA 1Q86U 1KQSS 2MF2A 1OYXA 3G4SQ 3VS3A 3RR6A 2K5FA 5DLOA 5FLXE 4PJOA 4DOWA 2Y90A 4KGVB 2SEMA 2DO3A 3C95A 2C06A 1MMNA 1QKXA 4Y92A 3VKIA 4F14A 5GAOp 3CPWS 4X9DA 4OP0A 3JB9D 1VQ8A 4XTYA 8ATCB 1IXDA 4FW2A 3MO8A 2VGNA 1T0HA 2P84A 2J7IA 1V1CA 3CCET 1D0YA 4J9IA 4DBQA 2K57A 5HKCA 2QA4Q 3R6OA 3KUFA 5IT9E 3EFSA 2XU8A 1Y71A 1SRMA 1JU5C 4DBFA 4L6V5 1X69A 3RNJA 3VS4A 3VS1A 2ZPBB 5I11A 1GFCA 2DNUA 2DFUA 3HRTA 4BY6C 4DA4A 3C4SA 2DA9A 1P92A 2I0NA 2YUPA 1RLPC 2E41A 2XDBA 3GNFB 2DJQA 2DD4A 3JCMg 3JCMd 3J80E 4TVRA 3NMZC 3V7CA 3QUIA 2KE9A 3JCMh 3JCMJ 1IGUA 3OA6A 5AYFA 4J5YA 3PIPA 2QGFB 1QVFS 1JJ2P 2JTFA 3WVEB 3JRZA 3HL8A 3PMIA 3MP8A 4M7AE 2KSSA 2EBPA 2PVOB 1VQKT 3CCEQ 2OTJA 4N4IA 5M9OA 1B7TA 2GGRA 2PUOB 2EGAA 4C92A 5IHKA 4GLKA 2EQIA 2EIFA 2FZGB 3M57A 1QVGP 3OYDA 1AHJB 2DD5A 5KE3A 3SD4A 3TEEA 1G2BA 3WXMB 1YJWA 2GBQA 4M78B 1OZ2A 2FG0A 3V8KA 2XG8D 2KYMA 1G5VA 2JJ9A 1ZA2B 3EGUA 3MCAB 2MI6A 4M7AD 2XICA 3CCLA 2ZZDA 1PRMC 4PJOF 1AZGB 2QK0A 2LJ1A 1FMWA 4XU1A 1YP5A 2A3LA 2MCNA 1Q7YR 5J3BA 1ZA1B 1K9MC 1YN8A 4ATOA 2RJCA 2XKOC 5GMKi 1U1SA 3A8OB 2DF6A 2X4YA 5HK0A 2L3PA 4A54A 2XIDA 1VQKQ 3GP8A 3CEYA 1F1BB 3CCSA 2DERA 1W6XA 4M7DB 3I5SA 5KYXA 4OVAA 4IUUA 3PE0A 4M75E 2V26A 3INZA 3HRUA 4C8QG 2DXCA 3PT9A 4F7UE 1YBYA 3TCJA 4J7FA 4BE1A 2MYSA 3P8BB 1W1FA 4FYYB 1TUDA 3H0HA 3L2ZA 4MZTA 1HSQA 4C0DC 3CBOA 1IB8A 3EFOA 1QWFA 1WYXA 3SDZA 3CCVA 1M3BA 4Y28E 2KAFA 1Y0MA 2EWNA 3JB9J 1I8FA 2RHYA 2VXEA 3DKMA 3HFNA 1YI2T 4M75D 2A7YA 4J7IA 2AZSA 1M27C 1SHGA 4KULA 2HL3A 2LCSA 3OYJA 5LJ5g 3V8LA 5LJ5d 3EG3A 1VIEA 1H92A 2RHIA 1LJOA 4Z8AA 4RUGA 4E7KA 2AZVA 1VQ9A 2M1HA 2LT1A 2NLUA 4J8OA 1GCQC 1YNZA 4C92F 1D1BA 1MV0B 3HKSA 1UGPB 2BIVA 4AFUC 3EH2A 1VQPA 1D0XA 5A0GA 2NYSA 1KD1R 1BYMA 2MAMA 5GAOm 4K11A 1M90U 5CO7A 3LGFA 2LNHB 4RTTA 2XD0A 3E2UA 2IG0A 2RJFA 4PKCC 1RI0A 3CD6A 4A4EA 1UUEA 2ZAEA 3SWNA 2XDPA 2HZYA 2RM4A 2LRQA 2LZ6B 1YI2Q 2R5AA 2PUKB 5IXFA 3TSZA 3I55A 4X1VA 2JT4A 4EMHA 2GFUA 2E3IA 3G1JA 2BZXA 2KI7A 3CCUA 1FWZA 5GAMf 3LH0A 3LX7A 3QDFA 3JB9F 4FYXB 4R55A 1U1TA 2DYBA 5CKEA 1PRLC 1T3LA 3D7SB 5GAN8 1VQLA 3JCMW 2DVEA 3ME9A 2K3XA 3NPFA 1D1CA 2LX7A 4MZMA 1X6BA 1U06A 3GNGA 2NUZA 2RJEA 2K3YA 1MNDA 8AT1B 1M4ZA 2CZ7B 1NM7A 3OYYA 4IUPA 1YJ9T 3OYFA 2LQ8A 4JLIA 1UDLA 4F16A 1TU0B 4JDSA 3OW2P 3OYCA 2O9SA 1FMKA 1WXBA 1VQMT 2QQ9A 1PNJA 4J9BA 1OX8A 4RTZA 1WHMA 2HBPA 3CPWP 3CCRA 2YRVA 4NS5A 1RAFB 5GAN5 4JRIA 2YUOA 4M75A 4EDUA 2FL7A 3A8LB 5CKBA 1EX4A 1WFWA 1GL5A 2J6OA 2JUFA 4F7UA 1B07A 4OMOA 4M77E 3G6ET 2AKLA 3MEAA 3L42A 3CCQA 4E6RA 6AT1B 2EYYA 4DEYA 2W0ZA 1K73R 1OQKA 2PTKA 2EQMA 2VXFA 3O8VA 3MHXA 1HD3A 2VKNA 2V8KA 4PK4A 1I0CA 3GPLA 3LLRA 1YJ9Q 1QKWA 3VYGA 4E7IA 1IZ6A 2EAYA 5D6YA 3IQLA 4M77D 2E3HA 5D6XA 1VQMQ 1Q7YC 5LJ5j 1MUZA 4M7AF 4PJOB 2GNCA 1RAAB 4OMPA 2RHZA 3EG9A 2OTLT 4QVZA 2COZA 2K4YA 3REAB 2L3QA 2YDLA 1G8XA 2DETA 4M78C 1NEGA 4HT9A 4J83A 4GBQA 3G6EQ 2DEUA 1R77A 1RAHB 2ZGWA 2JMCA 1S72Q 1VUBA 2AK5A 4BI8B 3REBB 1WJQA 4A4GA 3M58A 5IHIA 1M2OA 2EKHA 2DX1A 3QO3A 3SFMA 4RTYA 3TQ7P 3TREA 2YXYA 3L2WA 2LQWA 3SB2A 1KK7A 2L2PA 1PD1A 4LN2A 5LJ3d 5LJ3g 2YLBA 3SHWA 2KRMA 3QG1A 2M02A 4XAXB 4E7JA 2DL3A 4J9FA 4E47A 4M7DC 1EZZB 1ZQ1A 1VQ4A 1EFNA 2J05A 3T9NA 3CCJT 1K8AC 4M78G 1VQOA 2CP0A 2X35A 4IIOA 3UPUA 2OTLQ 1WXUA 3BW1A 3UDCA 2FRWA 5IH2A 2JN0A 1W2BP 2MIOA 4M75F 1YWPA 3CC4T 4F7UF 2Z0WA 3OYKA 1NLPC 3P8DA 4ELYC 3TVTA 4HVUA 1BU1A 1YIJT 1TG0A 5GAN7 3BY7A 4BB7A 3H6ZA 1KD1C 3G4ST 1MV3A 4HCBA 2JW4A 1QCOA 1WQWA 2MOXA 1VQ5A 4XU2A 4C92B 4C5EA 2KGTA 2KK4A 4DQ2A 2GF7A 2J6KA 2DL5A 4UC4A 4M7DG 2DTIA 2KR3A 3CC2A 4B6MA 1YITT 2RHXA 1RACB 1WGSA 2EKOA 4N0AA 3QKJA 1BIAA 1UGVA 2GQVA 1OU8A 3CCJQ 3RUXA 3ZEHA 3GIBA 2DILA 1SF9A 2E5KA 1Q81R 1OI1A 4M4ZA 2E70A 1I81A 2JS2A 1I07A 4M77A 1TOVA 1WHGA 2VASA 4KRTA 2XHCA 1YHQT 5I22A 1VQ6A 3QXEB 9ATCB 3CC4Q 4FT2A 5FWBA 2FRYA 3M0UA 2O01E 1WXTA 2DL4A 1LNXA 5KYUB 5GAOq 4J9CA 1SRLA 1N8RC 3GF5A 1D3BA 1YIJQ 3CQTA 1LOJA 1TSFA 4O5VA 2DAQA 5KYXB 4QKUA 2KT8A 4JJCA 2D0QB 2COWA 1GBRA 1IHVA 3LH5A 3CMAA 3C94A 1YITQ 2KNBB 4J6YA 1BI0A 3RMSA 1WJSA 2DL7A 2RI2A 2YUNA 5HK3A 3DB3A 2LJ0A 2LQNA 1OPLA 1XJWB 2JMAA 1UE9A 1KJWA 3EFOB 3I35A 3OBWA 1K4US 4PJLA 5CQYA 1NEBA 3CCMA 3PGGA 3URGA 1S1NA 3NTHA 5HY6A 1YHQQ 4KT0E 2H3EB 5CVIA 3PTAA 3QSUA 1O75A 3EFRA
chains in the Genus database with same CATH topology
1OU8A 1YFNA 1ZSZB 1ZSZC 1TWBA 2QASA 1OULA 2QAZA 2NYSA 1OX8A 1ZSZA 1OX9A 1OU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OU8 A;  1YFN A;  1ZSZ B;  1ZSZ C;  1TWB A;  2QAS A;  1OUL A;  2QAZ A;  2NYS A;  1OX8 A;  1ZSZ A;  1OX9 A;  1OU9 A; 
#chains in the Genus database with same CATH topology
 2ZCF B;  3CBP A;  1K76 A;  1M3A A;  1ZSZ A;  5CAI A;  1HK9 A;  4E7S A;  4MML A;  4J9D A;  2VV5 A;  4MDX A;  1UG1 A;  2JVV A;  1K73 C;  2EGE A;  3HSB A;  2JOY A;  2JZ2 A;  5LJ3 j;  1JQQ A;  2RQU A;  1RUW A;  2R5M A;  2M9U A;  4LD9 K;  2XI9 A;  3EGD A;  1WHK A;  1E6H A;  5FRM A;  2ZPI B;  1DJ7 B;  2EQU A;  1TTH B;  1JJ2 A;  3QWY A;  1NG2 A;  3R6N A;  5KYY A;  2NUT A;  3A98 A;  1X6O A;  1OOT A;  3E19 A;  2ATC B;  1V29 B;  1QWE A;  1QQJ A;  4JJN K;  2RNA A;  3CC7 A;  2X9H A;  3M54 A;  3SWN B;  3LWH A;  1UB4 A;  4M77 F;  2GQI A;  1YJN A;  1KC8 R;  3M55 A;  1VQ7 A;  2F69 A;  1QVG A;  2EYQ A;  2IPO B;  3OYA A;  2JXB A;  4OML A;  4PFO A;  1TS9 A;  2K6D A;  4LDY A;  2E4H A;  2K2V A;  2CRE A;  2QEX A;  1W70 A;  4BI3 A;  2RB6 A;  4JS4 A;  2CSI A;  2QXF A;  2ED0 A;  2X3W D;  3EHQ A;  1H64 1;  2P0K A;  3PIO A;  2K5I A;  2DIQ A;  4II1 A;  4C8Q C;  2D6F A;  3MET A;  4OF1 A;  4RG2 A;  1NJI R;  5FU7 B;  3L1A A;  1IHW A;  4BDZ A;  3FEO A;  4ZTF A;  2FZC B;  3OYN A;  2CS7 A;  3PFS A;  3PVQ A;  4RCC A;  1FMV A;  4IUV A;  2FPE A;  2DYI A;  2F2V A;  4B9W A;  4HVW A;  1AWJ A;  3RES A;  1G3T A;  2YHT A;  1GRI A;  2LQK A;  3VS6 A;  5KYU A;  3G71 T;  3J81 E;  3H8Z A;  1BCO A;  3SEM A;  4FYV B;  1HYO A;  4AT1 B;  3HHT B;  2C0T A;  5CKF A;  2KEA A;  4BE0 A;  4C5G A;  1M2V A;  4RTV A;  3J7A F;  5GMK l;  2L89 A;  4NL3 A;  2RPN A;  3PMT A;  2LCL A;  2C0O A;  2HCK A;  3H9N A;  4QQ6 A;  4XTV A;  4M75 B;  4RTX A;  4MZP A;  2OJ2 A;  4PJO G;  2QAZ A;  1M3C A;  5L23 A;  2MPX C;  4F7U B;  3GOX A;  3CME A;  2EPD A;  1K9M U;  4C5H A;  5GAN f;  4PJJ A;  3A1P A;  2V1Q A;  2FZK B;  2HD0 A;  3VUB A;  5DM7 R;  4FT4 A;  2LP5 A;  3OS1 A;  1WNL A;  2QQS A;  1I5L A;  4JUV A;  4ZGE B;  3RKX A;  1K8A R;  2CT4 A;  3A8M B;  4PL6 A;  1OPK A;  4MDW A;  1Q81 C;  1BBZ A;  2VC8 A;  1KG1 A;  3EHR A;  3G71 Q;  4KUD K;  4JZ3 A;  1B34 A;  3HRS A;  2BUD A;  5LJ5 f;  3OYG A;  1WLP B;  4Y91 A;  2L3S A;  4AFQ C;  1ARK A;  2EYX A;  3QJ6 A;  3MEU A;  1VQ8 T;  1NZ9 A;  4OB2 B;  2RN8 A;  1E6G A;  4PFP A;  1BB9 A;  1LVK A;  5GJV B;  3UT1 A;  4KUI A;  3V7S A;  3I56 A;  2GCX A;  5KH6 A;  1OUL A;  3EG9 B;  3U23 A;  1NPR A;  2NUP A;  4AMC A;  1KQ1 A;  1WI7 A;  1KHC A;  2V1R A;  5GAN e;  1O9S A;  2QQB A;  2LX9 A;  3TU4 K;  2ROL A;  3E9G A;  5I2S A;  1Q95 G;  2ZPH B;  4D8K A;  3NFC A;  2JTM A;  3RBB B;  1R0C B;  2OI3 A;  5EG2 A;  1NE8 A;  2E12 A;  4E7L A;  1D0Z A;  4KBM B;  4F04 B;  4M7A A;  3UAT A;  3VS0 A;  2KXC A;  2HKQ B;  1TH7 A;  4P5N A;  3I9Q A;  3FJ5 A;  2QGG A;  1M1K R;  3VUZ A;  3FC3 A;  4C92 G;  2KBT A;  4XQ3 A;  1VQN A;  4D6W A;  1VQ8 Q;  1Q86 R;  3KFV A;  2X3X D;  1WDX A;  2FEI A;  4QT7 A;  2HSP A;  4FU6 A;  4GY5 A;  4PJM A;  3JCM Q;  2RMO A;  4V2S A;  1M1F A;  4QQD A;  1N8R R;  1OV3 A;  4XU0 A;  3ZFJ A;  2A37 A;  2CUD A;  2D8H A;  1VOM A;  3JB9 I;  1I5O B;  3MEV A;  5GAM h;  1ZSG A;  1U3O A;  1PC0 A;  2KDS A;  2KY9 A;  3LW5 E;  2O88 A;  1KQS P;  3G4S A;  1PHT A;  1YJW T;  4CC4 B;  2LJ3 A;  2EQK A;  1MNE A;  4B9X A;  3OW2 A;  4XTU A;  5GAN 2;  5C6S A;  4LDU A;  1BI3 A;  1OU9 A;  5GJW B;  2OX7 A;  1ZBX A;  2LC4 A;  4HCC A;  3CCL T;  1PSE A;  4ZNX A;  2EJ9 A;  2IVW A;  1D1A A;  3CPW A;  4IKF A;  1WHH A;  3JB9 G;  2RF0 A;  1JJ2 S;  4N4G A;  1ABO A;  5GAM e;  3RER A;  4BY6 B;  1JBM A;  1XOV A;  2DBK A;  1PWT A;  5CCA A;  1RL2 A;  1KC8 C;  2DRK A;  3MPU B;  4Z88 A;  1AWO A;  2LTO A;  4CI0 C;  4OB0 B;  3FB9 A;  2QA4 A;  2M51 A;  3M4Y A;  1S72 T;  2LDM A;  4OMQ A;  3CCS T;  2ZPG B;  5GAN 6;  3CXC A;  4M77 B;  5D6W A;  4LXC A;  2WSF E;  5KE2 A;  1AWW A;  5DY9 A;  1QVG S;  4FM4 B;  1NJI C;  2M0Y A;  2L8D A;  3HTR A;  4J9H A;  1YJW Q;  3C12 A;  3M59 A;  3M0Q A;  4ZGJ B;  3CBM A;  1D3B B;  2XDD A;  3SWN C;  3M0T A;  1GBQ A;  2HL5 C;  3CCL Q;  4Z89 A;  2Y4X A;  1ZUK A;  4EIK A;  3CCV T;  1G3Y A;  2W10 A;  2YLC A;  2JM8 A;  2F5K A;  4RCB A;  2LNV A;  4C8Q E;  1QVF P;  1AD5 A;  2HBW A;  1NYG A;  2RI3 A;  2E65 A;  1M9S A;  4FCY A;  4EMK A;  3VS7 A;  4A4F A;  2CSQ A;  1PSF A;  4KH1 B;  3QBY A;  3ULR B;  3CCE A;  1Y96 A;  2LMJ A;  5FU7 C;  1FYN A;  5KYW A;  3CCS Q;  5ECA A;  1W4S A;  1X27 A;  5I21 A;  3VRZ A;  1UEB A;  4CC3 A;  1YFN A;  2F5T X;  1CKA A;  1N27 A;  3UF4 A;  1Q7Y U;  3RMQ A;  2HEQ A;  4C8Q D;  2ENM A;  5GMK m;  1ZSZ B;  3DLL A;  2WAC A;  1VQP T;  3NHN A;  1T0J A;  2O4X A;  3P8H A;  4NL2 A;  5LJ3 f;  2RK2 A;  2RQV A;  2HQX A;  3AT1 B;  2RQW A;  2KVQ G;  2X4W A;  1AT1 B;  2PNI A;  1K1Z A;  3EG0 A;  1MMG A;  3CCV Q;  4N4H A;  3EGD B;  3CD6 T;  1UTI A;  3QYH B;  1AWX A;  3X25 B;  4ZTJ A;  3NGP A;  2QTX A;  1SSF A;  4CRI A;  2O2O A;  3F70 A;  1W2B A;  3MP6 A;  2B8A A;  4LUD A;  2DZC A;  5KYY B;  2FPD A;  1NLO C;  2NUT B;  2DVJ A;  4JJB A;  1JRI A;  4M75 C;  1C6V X;  1VQK A;  5FW9 A;  1E7O A;  3MKD A;  1N6A A;  3L2V A;  2A36 A;  2EGC A;  3CCU T;  3BFM A;  4RTW A;  4PNO A;  4XTW A;  2CZ0 B;  2QAS A;  4JZ4 A;  1VQ9 Q;  1WHJ A;  2COY A;  2F2X A;  2DIG A;  2YUQ A;  2D0N A;  3OB9 A;  5J26 A;  1K8A U;  2MK5 A;  4XTZ A;  1VQP Q;  1GCP A;  1VYU A;  2KQW A;  1Q82 C;  1WX6 A;  1ZUY A;  1RLQ C;  2RK1 A;  4IUR A;  2DXB A;  3CD6 Q;  3JB9 H;  4M75 G;  4LNP A;  1MMA A;  2DBM A;  1QLY A;  2PVD B;  4F7U G;  1M1K C;  4C0F A;  1XTD A;  4ANJ A;  2KXD A;  1QW1 A;  2MWO A;  1JXM A;  1Q86 C;  2G6F X;  1KD1 U;  3LWI A;  1IGQ A;  1UGS B;  2WSE E;  3DB4 A;  1CSK A;  5LL6 S;  3CCR T;  1ZLM A;  1M90 R;  3OYB A;  1OX9 A;  4J9G A;  2P4T A;  3FIF A;  3VS2 A;  3CCU Q;  5GAN 4;  1BK2 A;  4R0K A;  1EIF A;  3X20 B;  3QPH A;  3QWX X;  4HCK A;  3NTI A;  4DEX A;  2K3B A;  1X2K A;  2GFA A;  3I5R A;  1M2V B;  4EPC A;  1PG5 B;  4IUQ A;  3EGX B;  2L3R A;  2FHD A;  1R8O B;  3JCM X;  3QDR B;  2M0O A;  1SEM A;  4YTL A;  4MMK A;  3VU3 C;  3E1S A;  2DTH A;  2ZPE B;  2P4R A;  3OS5 A;  4C8Q A;  2YSQ A;  3OYE A;  1M5Q 1;  4BD3 A;  5CK9 A;  3OSS C;  3FJP A;  1RAG B;  3HP9 A;  1YI2 A;  3ASK A;  3OW2 S;  2X4J A;  2RI5 A;  1X01 A;  1N8R U;  1VIF A;  5IHN A;  1BKB A;  2EJF A;  4OGE A;  3MEW A;  3THK A;  2K5L A;  1QP3 A;  3QZ5 B;  1I4K 1;  4KGZ B;  3OSV A;  4RKU E;  3CCR Q;  4AG2 C;  2X4X A;  3OMG A;  1JEG A;  1B34 B;  2DM1 A;  4CC2 A;  2WSC E;  2SRC A;  1PCX A;  4HA8 A;  3JCM P;  3OQ5 A;  4BAC A;  3C0C A;  3CCQ Q;  3QHS A;  1N9R A;  1D09 B;  3OYI A;  4L5G A;  3CXC S;  3JCM f;  2GTO A;  1Z9Q A;  2F1L A;  1XNI A;  2NUP B;  1PKT A;  1Z9Z A;  1H3H A;  1IO6 A;  4L59 A;  3O5Z A;  2BE7 D;  3HPW A;  4N0A C;  3QJY A;  3EAE A;  2P0Q A;  4AFZ C;  4DBR A;  1VA7 A;  4NOY A;  1SHF A;  2ESW A;  2J06 A;  4KH0 B;  1MGQ A;  1GFD A;  7AT1 B;  2G3R A;  2CP3 A;  3MP1 A;  4M77 C;  4PLL A;  3KBG A;  2YT6 A;  1VQ4 T;  1K73 U;  1NPP A;  4QQG A;  4EMG A;  1Y57 A;  2CT3 A;  2CKK A;  4M7A B;  1VQO T;  1UGQ B;  2HQE A;  4WTO B;  1Y07 A;  1KFZ A;  5FRN A;  4BUG A;  2DMO A;  1M8V A;  4Z02 A;  4QVC A;  4AFS C;  3KXT A;  5GAO r;  4OMN A;  3X26 B;  4X34 A;  3M0P A;  3L2R A;  4C5I A;  3OYL A;  3JCM e;  3M56 A;  1LCK A;  2HMA A;  1GCQ A;  2HQH A;  4M78 E;  4PJO C;  3L2U A;  1QP2 A;  5KCH A;  3FRN A;  4ELZ C;  2CH4 A;  4BDY A;  1VQ5 T;  1YJ9 A;  2HDA A;  2IIM A;  2CZ6 B;  4HCZ A;  5FWC A;  2E6Z A;  4C8Q F;  4M77 G;  3CC2 T;  2FPF A;  1H3Z A;  1WHL A;  3OYM A;  3E9F A;  1VQM A;  3N5B B;  1WZO A;  1YCY A;  4CC7 A;  2BZ8 A;  2KMT A;  4J9E A;  4J6W A;  1VQ4 Q;  1ZUU A;  1JXO A;  2E10 A;  3V8J A;  1VQO Q;  4XTX A;  4M78 D;  1N5Z A;  3EGX A;  3NTK A;  5FU6 B;  3OS0 A;  1ZSZ C;  1W2B S;  3G6E A;  3A8H B;  3JV3 A;  4LDX A;  4M7D E;  5GAO n;  4IUT A;  3OYH A;  2M16 A;  2E6N A;  4AG1 C;  1VQ6 T;  2ROT A;  1S72 A;  1SSH A;  2VVK A;  3OBY A;  3H0F A;  3TSW A;  1AVZ C;  2RA2 A;  2CYZ B;  4J6X A;  2DTO A;  1G3S A;  3LYI A;  2LCC A;  3JCM V;  3OMC A;  2PQW A;  2D8J A;  2YWW A;  1G3W A;  2E5Q A;  2P0P A;  1TWB A;  3BDU A;  1VQ5 Q;  1X75 C;  4RTU A;  1G83 A;  1WPY A;  2CP6 A;  4A4K A;  4C0Z A;  1ZX6 A;  2ED1 A;  2EVR A;  4JRQ A;  5GAN g;  5GAN d;  1UGR B;  3CC2 Q;  3JCM c;  3CMA T;  3JAM E;  3V7R A;  4M7D D;  1TUC A;  4KGX B;  5GAN h;  2EW3 A;  3LGL A;  3M9Q A;  2CZ1 B;  3H41 A;  2QI2 A;  3Q1J A;  1UFF A;  1LPL A;  3G7Z A;  3H0I A;  1JO8 A;  2OTL A;  5GMK h;  4XK8 E;  1FX7 A;  3HFO A;  4LUE A;  3ZL7 C;  3CCM T;  3S3O A;  4C92 C;  1M90 C;  3VS5 A;  1VQ6 Q;  1KHI A;  1UHC A;  4FSS A;  5CKH A;  4EMK B;  2K2M A;  5LJ5 h;  2X51 A;  3ER0 A;  3M4G A;  2AT1 B;  1ZHI A;  3M5A A;  2L5Q A;  4DOV A;  4E7Z A;  1Y96 B;  1VYV A;  2JTE A;  1Q81 U;  5KYN A;  2AKK A;  5KYW B;  4FYW B;  5GMK e;  4OB1 B;  1N9S A;  1RAI B;  1Q82 R;  1BI2 A;  3PVL A;  2LT4 A;  2ZPF B;  1RI9 A;  1NYF A;  2MWP A;  2ECZ A;  2R57 A;  3FLG A;  3VV0 A;  2BZY A;  1WA7 A;  2EFI A;  4PLI A;  3CMA Q;  1ABQ A;  1K9A A;  1Y7X A;  5LJ5 e;  2A0F B;  4A53 A;  2O4X B;  2DZ9 A;  3CCJ A;  1U8R A;  1QMC A;  1PKS A;  4PFZ A;  1ZBJ A;  3FDR A;  2BTT A;  2BKD N;  1KQ2 A;  3OS2 A;  1MHN A;  3CCM Q;  1B3Q A;  3CC7 T;  3GBQ A;  3ZBD A;  3S3N A;  2OTJ T;  1M8M A;  3CC4 A;  1PM3 A;  1YJN T;  3JCM b;  5GAM d;  5GAM g;  2JS0 A;  3UWN A;  1VQ7 T;  3VYH B;  2KRS A;  2AHJ B;  3BE3 A;  4M78 A;  3X28 B;  5CKD A;  5C0M A;  1GXI E;  4O6J A;  1KQS A;  1YIJ A;  4JPB W;  4ESR A;  1UJY A;  2QEX T;  2KYB A;  4C0G A;  2FVU A;  4QW2 A;  3VJP A;  2DRM A;  3MJX A;  3EH1 A;  4E7H A;  4GLM A;  5GAN 3;  3L2Q A;  2RH2 A;  2FO0 A;  1X6G A;  1YIT A;  1YWO A;  2VYT A;  1A0N B;  1J3T A;  4QVD A;  5D7U A;  5AT1 B;  2CP7 A;  1AOJ A;  1K0S A;  1SG5 A;  1YCS B;  3UA6 A;  1CKB A;  3M53 A;  2BE9 B;  2CP2 A;  3QYG B;  1PD0 A;  3M0R A;  4M7D A;  2J6F A;  3CC7 Q;  1YHQ A;  2A28 A;  4HKE A;  1UJ0 A;  2OAU A;  2OTJ Q;  2E64 A;  2K7A A;  1YJN Q;  2DL8 A;  1VQ7 Q;  3EG2 A;  3S6W A;  1RAE B;  2DXT A;  5IXB A;  4VUB A;  4FL6 A;  2C0I A;  2O31 A;  2KRN A;  1SPK A;  1HXD A;  2HSE B;  2QEX Q;  3PNW C;  1K0X A;  5L8R E;  3VRY A;  4OMF B;  2PVG B;  2DLP A;  5GAN j;  2QTV A;  4JJD A;  1C1A A;  2RO0 A;  4FIB A;  4FW1 A;  1FXX A;  3CME T;  1X43 A;  3CXC P;  2QDY B;  1UEC A;  2F2W A;  1KC8 U;  2KT1 A;  1M1G A;  1KIK A;  1MMD A;  1QVF A;  4R56 A;  2D1X A;  4M7A C;  2PZ1 A;  2A08 A;  5A0L A;  5GMK j;  4RG8 A;  1RAD B;  4JLG A;  5FRO A;  2EYZ A;  2CH4 W;  1AEY A;  4JRP A;  1HJD A;  3EG1 A;  4PJO E;  4C8Q B;  1OEB A;  4D8D A;  1I1J A;  2QYZ A;  1NJI U;  2B86 A;  4OB3 B;  1AZE A;  4LD6 A;  1VQ9 T;  3RIR A;  2FYK A;  2YRC A;  1QVP A;  4WCI A;  4BE2 A;  2KRO A;  2CGH A;  4M78 F;  3I56 T;  2H3J A;  2XK0 A;  2AIR B;  1ACM B;  4RMO A;  4M7A G;  2DXU A;  2RD1 A;  2RHU A;  1X2Q A;  2K9G A;  2YRD A;  4PJO D;  1M30 A;  3QII A;  1IRX A;  3CME Q;  2XMF A;  1BI1 A;  2K79 A;  5KCO A;  1QCF A;  2CUB A;  1WJR A;  2JNG A;  4Q5W A;  3GLX A;  1TUG B;  4DBH A;  2HAX A;  2RJD A;  3BDL A;  2EQJ A;  2L0A A;  4LDW A;  2DPP B;  1H8K A;  4OMM A;  5FU6 C;  4F17 A;  1OZ3 A;  1RAB B;  5HCK A;  4IIM A;  2RQR A;  3I55 T;  5LJ3 h;  2PU9 B;  1NBE B;  2VB6 A;  1C0M A;  2FB7 A;  4C0D B;  3S3M A;  1BIB A;  4M7D F;  1SKU B;  1K9M R;  5GAM j;  3X24 B;  2VGM A;  2OAW A;  4X9C A;  5A2Q E;  2H8H A;  1T3S A;  1VQN T;  1WIE A;  1JB0 E;  2O9V A;  3JSC A;  1QCN A;  4LE9 A;  2I2L A;  4E2F B;  4OGC A;  3A5Z B;  1VQL T;  2DK3 A;  3I56 Q;  3M0S A;  2QQA A;  5LJ3 e;  2ABL A;  1IRE B;  4HT8 A;  1V76 A;  5IN1 A;  3QZ9 B;  2HKN A;  3RKY A;  3OY9 A;  5CQX A;  1R0B G;  2DJZ A;  1WQ7 A;  1UHF A;  4C92 E;  4HVV A;  2QQR A;  2V8J A;  4PJN A;  1BCM A;  2VUB A;  2JM9 A;  1U5S A;  2V8I A;  5I2M A;  2R58 A;  2DKG A;  4A4H A;  4WF2 A;  1TXQ A;  2CP5 A;  2DEQ A;  3CPF A;  5A0D A;  4A63 B;  2HNI A;  5EC7 A;  4XU3 A;  3I55 Q;  4LDV A;  2E1H A;  3RDV A;  4EMK C;  3G71 A;  2QG9 B;  3UA7 A;  1VYT A;  2CDT A;  4C92 D;  1VQN Q;  2VWF A;  4HXJ A;  5CIU A;  2QDL A;  1Q82 U;  5J39 A;  2DE0 X;  1XQH A;  2EYW A;  3A8G B;  1KSW A;  2Y4Y A;  4ORZ A;  2MMP A;  2QA4 T;  4JRK A;  3RKW A;  5DLQ E;  1VQL Q;  2NWM A;  3WVD B;  4BI4 A;  2LVM A;  3DLM A;  4FSX A;  4ME7 A;  3CCQ T;  4JS5 A;  2RQT A;  5GAO l;  3AHU A;  1M1K U;  4ZN3 A;  2EJG A;  4ZGD B;  2D9T A;  2GTJ A;  5CR2 A;  4ZN1 A;  5IAY A;  1Q86 U;  1KQS S;  2MF2 A;  1OYX A;  3G4S Q;  3VS3 A;  3RR6 A;  2K5F A;  5DLO A;  5FLX E;  4PJO A;  4DOW A;  2Y90 A;  4KGV B;  2SEM A;  2DO3 A;  3C95 A;  2C06 A;  1MMN A;  1QKX A;  4Y92 A;  3VKI A;  4F14 A;  5GAO p;  3CPW S;  4X9D A;  4OP0 A;  3JB9 D;  1VQ8 A;  4XTY A;  8ATC B;  1IXD A;  4FW2 A;  3MO8 A;  2VGN A;  1T0H A;  2P84 A;  2J7I A;  1V1C A;  3CCE T;  1D0Y A;  4J9I A;  4DBQ A;  2K57 A;  5HKC A;  2QA4 Q;  3R6O A;  3KUF A;  5IT9 E;  3EFS A;  2XU8 A;  1Y71 A;  1SRM A;  1JU5 C;  4DBF A;  4L6V 5;  1X69 A;  3RNJ A;  3VS4 A;  3VS1 A;  2ZPB B;  5I11 A;  1GFC A;  2DNU A;  2DFU A;  3HRT A;  4BY6 C;  4DA4 A;  3C4S A;  2DA9 A;  1P92 A;  2I0N A;  2YUP A;  1RLP C;  2E41 A;  2XDB A;  3GNF B;  2DJQ A;  2DD4 A;  3JCM g;  3JCM d;  3J80 E;  4TVR A;  3NMZ C;  3V7C A;  3QUI A;  2KE9 A;  3JCM h;  3JCM J;  1IGU A;  3OA6 A;  5AYF A;  4J5Y A;  3PIP A;  2QGF B;  1QVF S;  1JJ2 P;  2JTF A;  3WVE B;  3JRZ A;  3HL8 A;  3PMI A;  3MP8 A;  4M7A E;  2KSS A;  2EBP A;  2PVO B;  1VQK T;  3CCE Q;  2OTJ A;  4N4I A;  5M9O A;  1B7T A;  2GGR A;  2PUO B;  2EGA A;  4C92 A;  5IHK A;  4GLK A;  2EQI A;  2EIF A;  2FZG B;  3M57 A;  1QVG P;  3OYD A;  1AHJ B;  2DD5 A;  5KE3 A;  3SD4 A;  3TEE A;  1G2B A;  3WXM B;  1YJW A;  2GBQ A;  4M78 B;  1OZ2 A;  2FG0 A;  3V8K A;  2XG8 D;  2KYM A;  1G5V A;  2JJ9 A;  1ZA2 B;  3EGU A;  3MCA B;  2MI6 A;  4M7A D;  2XIC A;  3CCL A;  2ZZD A;  1PRM C;  4PJO F;  1AZG B;  2QK0 A;  2LJ1 A;  1FMW A;  4XU1 A;  1YP5 A;  2A3L A;  2MCN A;  1Q7Y R;  5J3B A;  1ZA1 B;  1K9M C;  1YN8 A;  4ATO A;  2RJC A;  2XKO C;  5GMK i;  1U1S A;  3A8O B;  2DF6 A;  2X4Y A;  5HK0 A;  2L3P A;  4A54 A;  2XID A;  1VQK Q;  3GP8 A;  3CEY A;  1F1B B;  3CCS A;  2DER A;  1W6X A;  4M7D B;  3I5S A;  5KYX A;  4OVA A;  4IUU A;  3PE0 A;  4M75 E;  2V26 A;  3INZ A;  3HRU A;  4C8Q G;  2DXC A;  3PT9 A;  4F7U E;  1YBY A;  3TCJ A;  4J7F A;  4BE1 A;  2MYS A;  3P8B B;  1W1F A;  4FYY B;  1TUD A;  3H0H A;  3L2Z A;  4MZT A;  1HSQ A;  4C0D C;  3CBO A;  1IB8 A;  3EFO A;  1QWF A;  1WYX A;  3SDZ A;  3CCV A;  1M3B A;  4Y28 E;  2KAF A;  1Y0M A;  2EWN A;  3JB9 J;  1I8F A;  2RHY A;  2VXE A;  3DKM A;  3HFN A;  1YI2 T;  4M75 D;  2A7Y A;  4J7I A;  2AZS A;  1M27 C;  1SHG A;  4KUL A;  2HL3 A;  2LCS A;  3OYJ A;  5LJ5 g;  3V8L A;  5LJ5 d;  3EG3 A;  1VIE A;  1H92 A;  2RHI A;  1LJO A;  4Z8A A;  4RUG A;  4E7K A;  2AZV A;  1VQ9 A;  2M1H A;  2LT1 A;  2NLU A;  4J8O A;  1GCQ C;  1YNZ A;  4C92 F;  1D1B A;  1MV0 B;  3HKS A;  1UGP B;  2BIV A;  4AFU C;  3EH2 A;  1VQP A;  1D0X A;  5A0G A;  2NYS A;  1KD1 R;  1BYM A;  2MAM A;  5GAO m;  4K11 A;  1M90 U;  5CO7 A;  3LGF A;  2LNH B;  4RTT A;  2XD0 A;  3E2U A;  2IG0 A;  2RJF A;  4PKC C;  1RI0 A;  3CD6 A;  4A4E A;  1UUE A;  2ZAE A;  3SWN A;  2XDP A;  2HZY A;  2RM4 A;  2LRQ A;  2LZ6 B;  1YI2 Q;  2R5A A;  2PUK B;  5IXF A;  3TSZ A;  3I55 A;  4X1V A;  2JT4 A;  4EMH A;  2GFU A;  2E3I A;  3G1J A;  2BZX A;  2KI7 A;  3CCU A;  1FWZ A;  5GAM f;  3LH0 A;  3LX7 A;  3QDF A;  3JB9 F;  4FYX B;  4R55 A;  1U1T A;  2DYB A;  5CKE A;  1PRL C;  1T3L A;  3D7S B;  5GAN 8;  1VQL A;  3JCM W;  2DVE A;  3ME9 A;  2K3X A;  3NPF A;  1D1C A;  2LX7 A;  4MZM A;  1X6B A;  1U06 A;  3GNG A;  2NUZ A;  2RJE A;  2K3Y A;  1MND A;  8AT1 B;  1M4Z A;  2CZ7 B;  1NM7 A;  3OYY A;  4IUP A;  1YJ9 T;  3OYF A;  2LQ8 A;  4JLI A;  1UDL A;  4F16 A;  1TU0 B;  4JDS A;  3OW2 P;  3OYC A;  2O9S A;  1FMK A;  1WXB A;  1VQM T;  2QQ9 A;  1PNJ A;  4J9B A;  1OX8 A;  4RTZ A;  1WHM A;  2HBP A;  3CPW P;  3CCR A;  2YRV A;  4NS5 A;  1RAF B;  5GAN 5;  4JRI A;  2YUO A;  4M75 A;  4EDU A;  2FL7 A;  3A8L B;  5CKB A;  1EX4 A;  1WFW A;  1GL5 A;  2J6O A;  2JUF A;  4F7U A;  1B07 A;  4OMO A;  4M77 E;  3G6E T;  2AKL A;  3MEA A;  3L42 A;  3CCQ A;  4E6R A;  6AT1 B;  2EYY A;  4DEY A;  2W0Z A;  1K73 R;  1OQK A;  2PTK A;  2EQM A;  2VXF A;  3O8V A;  3MHX A;  1HD3 A;  2VKN A;  2V8K A;  4PK4 A;  1I0C A;  3GPL A;  3LLR A;  1YJ9 Q;  1QKW A;  3VYG A;  4E7I A;  1IZ6 A;  2EAY A;  5D6Y A;  3IQL A;  4M77 D;  2E3H A;  5D6X A;  1VQM Q;  1Q7Y C;  5LJ5 j;  1MUZ A;  4M7A F;  4PJO B;  2GNC A;  1RAA B;  4OMP A;  2RHZ A;  3EG9 A;  2OTL T;  4QVZ A;  2COZ A;  2K4Y A;  3REA B;  2L3Q A;  2YDL A;  1G8X A;  2DET A;  4M78 C;  1NEG A;  4HT9 A;  4J83 A;  4GBQ A;  3G6E Q;  2DEU A;  1R77 A;  1RAH B;  2ZGW A;  2JMC A;  1S72 Q;  1VUB A;  2AK5 A;  4BI8 B;  3REB B;  1WJQ A;  4A4G A;  3M58 A;  5IHI A;  1M2O A;  2EKH A;  2DX1 A;  3QO3 A;  3SFM A;  4RTY A;  3TQ7 P;  3TRE A;  2YXY A;  3L2W A;  2LQW A;  3SB2 A;  1KK7 A;  2L2P A;  1PD1 A;  4LN2 A;  5LJ3 d;  5LJ3 g;  2YLB A;  3SHW A;  2KRM A;  3QG1 A;  2M02 A;  4XAX B;  4E7J A;  2DL3 A;  4J9F A;  4E47 A;  4M7D C;  1EZZ B;  1ZQ1 A;  1VQ4 A;  1EFN A;  2J05 A;  3T9N A;  3CCJ T;  1K8A C;  4M78 G;  1VQO A;  2CP0 A;  2X35 A;  4IIO A;  3UPU A;  2OTL Q;  1WXU A;  3BW1 A;  3UDC A;  2FRW A;  5IH2 A;  2JN0 A;  1W2B P;  2MIO A;  4M75 F;  1YWP A;  3CC4 T;  4F7U F;  2Z0W A;  3OYK A;  1NLP C;  3P8D A;  4ELY C;  3TVT A;  4HVU A;  1BU1 A;  1YIJ T;  1TG0 A;  5GAN 7;  3BY7 A;  4BB7 A;  3H6Z A;  1KD1 C;  3G4S T;  1MV3 A;  4HCB A;  2JW4 A;  1QCO A;  1WQW A;  2MOX A;  1VQ5 A;  4XU2 A;  4C92 B;  4C5E A;  2KGT A;  2KK4 A;  4DQ2 A;  2GF7 A;  2J6K A;  2DL5 A;  4UC4 A;  4M7D G;  2DTI A;  2KR3 A;  3CC2 A;  4B6M A;  1YIT T;  2RHX A;  1RAC B;  1WGS A;  2EKO A;  4N0A A;  3QKJ A;  1BIA A;  1UGV A;  2GQV A;  1OU8 A;  3CCJ Q;  3RUX A;  3ZEH A;  3GIB A;  2DIL A;  1SF9 A;  2E5K A;  1Q81 R;  1OI1 A;  4M4Z A;  2E70 A;  1I81 A;  2JS2 A;  1I07 A;  4M77 A;  1TOV A;  1WHG A;  2VAS A;  4KRT A;  2XHC A;  1YHQ T;  5I22 A;  1VQ6 A;  3QXE B;  9ATC B;  3CC4 Q;  4FT2 A;  5FWB A;  2FRY A;  3M0U A;  2O01 E;  1WXT A;  2DL4 A;  1LNX A;  5KYU B;  5GAO q;  4J9C A;  1SRL A;  1N8R C;  3GF5 A;  1D3B A;  1YIJ Q;  3CQT A;  1LOJ A;  1TSF A;  4O5V A;  2DAQ A;  5KYX B;  4QKU A;  2KT8 A;  4JJC A;  2D0Q B;  2COW A;  1GBR A;  1IHV A;  3LH5 A;  3CMA A;  3C94 A;  1YIT Q;  2KNB B;  4J6Y A;  1BI0 A;  3RMS A;  1WJS A;  2DL7 A;  2RI2 A;  2YUN A;  5HK3 A;  3DB3 A;  2LJ0 A;  2LQN A;  1OPL A;  1XJW B;  2JMA A;  1UE9 A;  1KJW A;  3EFO B;  3I35 A;  3OBW A;  1K4U S;  4PJL A;  5CQY A;  1NEB A;  3CCM A;  3PGG A;  3URG A;  1S1N A;  3NTH A;  5HY6 A;  1YHQ Q;  4KT0 E;  2H3E B;  5CVI A;  3PTA A;  3QSU A;  1O75 A;  3EFR A; 
#chains in the Genus database with same CATH homology
 1OU8 A;  1YFN A;  1ZSZ B;  1ZSZ C;  1TWB A;  2QAS A;  1OUL A;  2QAZ A;  2NYS A;  1OX8 A;  1ZSZ A;  1OX9 A;  1OU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...