1OU8A

Structure of an aaa+ protease delivery protein in complex with a peptide degradation tag
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a delivery protein for an AAA+ protease in complex with a peptide degradation tag
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
molecule keywords Stringent starvation protein B homolog
total genus 28
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1ou8A00
1ZSZC 2QAZA 1OX8A 1TWBA 1ZSZA 2NYSA 1OU8A 1ZSZB 1OU9A 2QASA 1YFNA 1OX9A 1OULA
chains in the Genus database with same CATH superfamily
2DK3A 1BI3A 2DX1A 2MPXC 2XKOC 1YJ9T 3M56A 4GLMA 4MMLA 4CC7A 1JQQA 4RTYA 1WHKA 2F2XA 2F69A 3PIOA 2MCNA 2K5IA 3RUXA 1YJWQ 2LVMA 3L2ZA 2FZKB 4M75B 3I9QA 2CT4A 2LJ0A 2VKNA 3HP9A 3V7CA 1KC8U 3C95A 2YUOA 2JT4A 4OB0B 3M0PA 1TSFA 2CZ0B 2JZ2A 3M54A 3ZBDA 1A0NB 2BZ8A 3A5ZB 1MNEA 3E19A 2QEXQ 5C6SA 1VQ4Q 1M4ZA 2H8HA 2HBPA 2K57A 2P0KA 1VQKQ 2MOXA 2QQSA 1M30A 2RH2A 4X9CA 2X51A 4J8OA 2RJDA 1GBQA 1TWBA 3CCJA 5DY9A 4BI3A 3DLMA 2HCKA 2E3IA 4M4ZA 2ROTA 3SB2A 4HA8A 1VYVA 4PJOC 1NLOC 1WA7A 5CK9A 2OTLT 4C92A 3CCQQ 4LE9A 1NPRA 3RKWA 4IKFA 3BW1A 2MF2A 4JJDA 5FROA 1TU0B 5LJ3d 4L5GA 3CMET 2X4WA 3UF4A 5KYXB 2A37A 3CXCA 4JRIA 3M4GA 3EG0A 2HL5C 5GMKh 3NGPA 3G71A 4FT2A 4PFZA 2XI9A 4FW2A 3JCMV 2YRVA 2CSQA 1PNJA 1BI1A 1LNXA 3E9FA 5FWBA 3M58A 2KBTA 4DEYA 3QZ5B 2ED0A 1SSHA 1X2KA 4F16A 4ZGJB 2EQJA 1OULA 1ZX6A 1G2BA 1BIAA 1NG2A 2QGGA 2R5AA 3VS2A 3FB9A 3RR6A 1VQ7Q 1K1ZA 4M78F 5I2SA 2QQ9A 3E9GA 2GCXA 2DLPA 4PFOA 2K2VA 3EG9B 1MGQA 2V8IA 1RAHB 2EKOA 2CH4W 1NJIC 4CI0C 1YP5A 2XMFA 1VQ9T 4C8QD 1K0XA 1PWTA 3MPUB 1SRLA 3EFSA 1H641 1NYFA 2DEQA 3EGDA 3PT9A 1VQNA 4M78A 1Q82R 5GAOl 2D1XA 2XG8D 3GLXA 4CC2A 1UB4A 4GY5A 2COYA 4LDUA 4MMKA 2MWOA 1PRMC 1K9MR 1QWEA 2J6OA 2X4YA 3ZL7C 1QKXA 1UGPB 2RJFA 2RHZA 1YITA 4M7DE 5GMKm 1Y07A 4C0DB 3J80E 4IIOA 5A0GA 1VQNQ 2K79A 3CCSA 1WJQA 2DXTA 3CCRQ 2D0NA 4ZGEB 2ATCB 4O6JA 1X6OA 1VIEA 3N5BB 3M5AA 4A4EA 3URGA 2GFAA 1JJ2A 1C1AA 2LNVA 2ZGWA 1TXQA 2FPEA 2KYBA 1D0XA 2LQWA 4WCIA 2HAXA 4PL6A 2O9VA 2LTOA 1OZ3A 1VQPQ 2EJGA 2YWWA 2CKKA 1KC8C 1M1KC 3QG1A 1NJIR 4RTUA 4PLLA 2GQIA 2MAMA 4R0KA 2MIOA 3OYHA 1WJRA 2K3BA 2XDBA 2F1LA 4M77F 3CCLT 2C0TA 2XK0A 2O2OA 4M77C 2X35A 3RMQA 1Q86U 1JBMA 4M7AC 4F7UE 4KUIA 3CBOA 1SSFA 5LJ5h 4A63B 4JS5A 1M90U 4M75D 4DBHA 3OYJA 1QQJA 3O5ZA 4BDZA 1Y71A 4LD9K 2DFUA 4L6V5 5D6YA 1I07A 3CC4T 1U3OA 3AT1B 3CXCS 1I5LA 1PD1A 3REBB 2RHUA 2CDTA 4WF2A 4M7AE 1RUWA 3BDUA 3O8VA 3VS5A 4KGXB 3M4YA 1NEBA 5IXBA 1ZSZB 2BE9B 1MMNA 2DL3A 3EFRA 2HQEA 3EGDB 2ZAEA 1R8OB 1HSQA 2VGNA 1OX8A 4J9DA 2K7AA 1QCFA 5D6XA 4M7DB 2AZVA 1G83A 1D1CA 1B7TA 2DJZA 2RF0A 4L59A 3L2RA 1OQKA 3CCSQ 1QKWA 2BTTA 2D8HA 4DOVA 5FU7B 1ABOA 3KXTA 1UECA 1PHTA 5GAN7 2RQRA 3HL8A 2GQVA 4HCCA 5GJWB 4E6RA 3EFOB 2ABLA 3PVQA 4QVZA 3MEAA 1ZBJA 1N9SA 1W70A 2KGTA 2DNUA 2DAQA 1BCOA 4Z8AA 5KYWB 1RADB 1WNLA 4HT8A 1AEYA 3V7RA 1I0CA 4R55A 4IUVA 3CCMA 2EGAA 3I56Q 1N27A 1MMAA 4M77D 5CKFA 1JRIA 3JB9D 5CAIA 2DL7A 4XAXB 2R58A 1M1KR 5GAMh 2HQHA 2O31A 3LH0A 2JVVA 3RESA 4ZN1A 1GCQA 2KXCA 1BK2A 4JRPA 1ARKA 3NPFA 4M77G 1ZA2B 3M0RA 4A4FA 2FVUA 2KRMA 1VQOA 1K8AC 3H0HA 4B9XA 1ZLMA 5J26A 2C0IA 1YCYA 1X43A 1X01A 2AZSA 4AFQC 1UGRB 3X20B 1KK7A 5J3BA 3LGLA 5LJ3g 2YLCA 2J06A 1JJ2S 2OI3A 1YJNQ 4WTOB 1QMCA 4JJBA 5DLQE 5D7UA 1D1BA 2HMAA 2QXFA 2E64A 3CCST 4BACA 2EFIA 1SHFA 1YNZA 4X1VA 2VWFA 2RB6A 1IGQA 1SHGA 4J6YA 2FB7A 3VS7A 2IPOB 1M1GA 3BY7A 1UGQB 3OYDA 3CCEQ 4II1A 1U8RA 4ZGDB 3UT1A 3LYIA 4E7SA 2RQWA 1Q81U 1PKSA 1Y96B 3X28B 3HRSA 1VA7A 2KEAA 2M0YA 3CC4Q 2YRCA 2XU8A 5L8RE 3HPWA 5FU6B 1LVKA 4XTVA 2EPDA 3UATA 5GAOp 4DBFA 1HXDA 5KCOA 4CC4B 4C92B 2ZPFB 4XTXA 2EQIA 3ULRB 1PSFA 2NYSA 3EFOA 2E5KA 2JJ9A 1K9AA 2DRKA 2QG9B 4HCBA 1MMGA 1KQSS 3OSVA 2KNBB 1E6GA 2PQWA 3RIRA 2LQKA 4MZTA 1K8AU 2NUZA 1CKBA 3VUZA 4FW1A 1C6VX 4FSXA 5LL6S 4BY6C 4V2SA 4M7AD 2L3RA 3CCUQ 4KH0B 1Q82U 4ATOA 4OMMA 3CCQT 4JRQA 2NUPB 3A98A 2OJ2A 3GP8A 3CCRT 3BFMA 4LD6A 2L8DA 2J05A 3CQTA 3CEYA 4XU0A 3MEUA 4JZ3A 1UEBA 4IUPA 4DBQA 1KQ1A 3VS6A 2DILA 5HKCA 4N4GA 3CCMT 3OYGA 4C8QC 1WYXA 3TCJA 2YUPA 1VQ4T 3GIBA 1RAEB 4PJMA 2LT1A 2W0ZA 5J39A 1VIFA 4C5IA 1M90R 1AOJA 2AK5A 1V29B 2DVEA 2V26A 2RHYA 1QVPA 2WSEE 4QVCA 2CH4A 1N6AA 2V1RA 1OV3A 3LWIA 1D1AA 2DXUA 2F2VA 5DLOA 4E7JA 2JMCA 2AT1B 1RL2A 3I55A 3PIPA 3OYNA 3RERA 2DVJA 4M7DG 4F04B 1Q95G 3FRNA 1N5ZA 2EQUA 3H41A 1OPLA 3UWNA 1C0MA 2QEXA 2RPNA 3QXEB 4KT0E 2PVGB 3E2UA 1GBRA 1UE9A 4QT7A 1K73R 1AZGB 3JCMd 5GANd 4J9EA 4M77E 1Z9ZA 4C8QB 2P4RA 5A0DA 5HK3A 3OMCA 3OYFA 4J6XA 1BYMA 1D0ZA 4ELZC 3M9QA 4M7DF 5C0MA 3C0CA 1TUCA 2DXCA 4LDYA 3TU4K 1PC0A 3J7AF 4HT9A 4N0AA 2IIMA 2P0PA 4J9GA 1VQ8Q 3G7ZA 2A7YA 4KRTA 4JJCA 4OMLA 2MI6A 3LW5E 2RQTA 3CCVT 3CC2T 1AWJA 3L2VA 2IG0A 2AKLA 4LDVA 2DYBA 1W2BS 3PMIA 1WDXA 4J6WA 1N8RR 3QO3A 2SRCA 4A4KA 1FWZA 2KXDA 1UJ0A 4A4GA 1EX4A 2OTJQ 1S72A 5HK0A 3CBMA 3M57A 4XTZA 3NTIA 3HTRA 3J81E 3V8LA 2V8JA 1KD1U 1M1FA 3D7SB 3M59A 2XDPA 1QCNA 2O9SA 5CKBA 4KULA 3SDZA 2MK5A 4RTWA 2LCCA 3QWXX 1NLPC 3OYCA 4BUGA 4A53A 4E47A 4HVVA 3GBQA 1VQ5A 1OEBA 2LC4A 3I56T 1P92A 1SRMA 3MCAB 2I0NA 3QPHA 4M78B 5M9OA 1XJWB 2ZCFB 1XOVA 4FU6A 2QASA 1I8FA 4OMOA 2FPDA 2YRDA 4J9CA 2H3JA 1UHFA 5IHIA 2JTEA 2HD0A 1TUDA 1GL5A 4M7AF 3JB9J 1OU8A 1S1NA 1M3BA 2FG0A 2P0QA 3CMAQ 1QVGP 3QHSA 2JMAA 1YI2A 1WXUA 2DA9A 4C0ZA 2HSEB 4FYXB 4AT1B 1IGUA 2COZA 1CSKA 1WGSA 1SPKA 4J7IA 3VS4A 3A8MB 1IRXA 1ZUUA 4Q5WA 5LJ5j 2AHJB 4J5YA 3PTAA 5KYWA 1K76A 3KFVA 1OZ2A 2RD1A 4E7LA 2NLUA 3CCEA 3WXMB 2PVOB 4OMPA 2QDYB 1VQMT 3DB4A 2L89A 2CZ1B 1SKUB 1WFWA 2LZ6B 4EPCA 2K5LA 2JTMA 4DEXA 1FMVA 4M7AG 2GNCA 3OMGA 3BE3A 1KJWA 3PMTA 2GBQA 1K73U 1ZUKA 3F70A 1U5SA 4HVWA 2Z0WA 3JCMc 2YDLA 3Q1JA 4EIKA 4Z02A 1U1SA 4HVUA 2DKGA 3ZEHA 1K0SA 2DIQA 2J6KA 1AVZC 4PFPA 4M7DD 2G3RA 3L2UA 1ZSZA 5IHNA 2ZPEB 4OGCA 3CPWP 1BB9A 2A36A 2H3EB 2QQRA 1IHVA 3JCMP 8AT1B 1LJOA 3ZFJA 1M2VB 3C4SA 1XTDA 1Q7YU 5GJVB 2ED1A 2ZZDA 5GAN4 3EH1A 3HFNA 2RK2A 2LQNA 2QQAA 2KAFA 1QVFS 4O5VA 4YTLA 5CR2A 3CC7A 4PNOA 4FYVB 2CREA 4C8QE 3MP1A 1BCMA 1VUBA 2QTVA 3MJXA 4M77B 1M5Q1 2L3QA 2HNIA 4DA4A 1ZHIA 4M7DC 5GAOq 3VS3A 1F1BB 3QYGB 8ATCB 1S72T 2V1QA 1TG0A 4XTWA 5KYNA 1G3YA 5GAOr 2KRNA 1M2OA 1Q86R 2X4JA 4BB7A 1UJYA 4HXJA 3LWHA 1WX6A 1YHQQ 2ZPGB 3MO8A 1LOJA 5KCHA 5GAN6 4XU3A 2A08A 2VXEA 1IO6A 1O9SA 2IVWA 2RHXA 2G6FX 4M75A 4F7UG 2MWPA 2R5MA 5CKDA 2K2MA 5KE2A 4JS4A 3GPLA 2KVQG 1MHNA 1Z9QA 2L3SA 3GOXA 3H0IA 7AT1B 1YJ9A 3MP8A 4HCZA 1IXDA 4KGZB 2EGCA 3X26B 3CCUA 1YHQT 3CMAT 4ZNXA 2WSFE 1YWOA 3L2WA 2M16A 5GMKl 1U06A 3EGXB 3VU3C 1WXBA 4QQGA 3H0FA 5CCAA 2F5KA 1WHMA 1VQLT 1I1JA 4C8QF 5CQYA 5HY6A 2VASA 4IUTA 5HCKA 2R57A 1AHJB 2ROLA 3H9NA 2QA4A 4B6MA 1S72Q 3G1JA 3JCMX 4OP0A 1Q7YR 4M78G 3A8GB 2QAZA 3EAEA 4EMKB 3CD6Q 1AD5A 2X3XD 4B9WA 2WACA 3JCMf 5GANf 3DB3A 4JDSA 3LLRA 1WHJA 2CS7A 1K4US 4PJLA 1R77A 1WJSA 1HK9A 4OGEA 4D8DA 1TH7A 1VQ7A 2LT4A 2JN0A 3META 2CSIA 2X3WD 1YI2T 3QBYA 2LX7A 4NS5A 4BE1A 2DMOA 3CCVQ 2EAYA 2QA4Q 5CO7A 1XQHA 1H92A 4AFUC 3CD6T 1T3SA 4LDWA 2ZPIB 2GFUA 4C92E 1QW1A 2DRMA 2VYTA 1YIJT 9ATCB 3S3OA 5GAMf 1IHWA 2EYZA 4PJNA 4FT4A 1K9MU 3IQLA 1HD3A 1Q81C 1VQ8T 3CCVA 1D3BA 1EIFA 1W4SA 2DL8A 3AHUA 1WQWA 4ME7A 1M90C 5KYXA 5IXFA 4LNPA 2FEIA 3G4SA 2HDAA 2DL5A 2FRWA 2RO0A 2HZYA 4E7KA 4PJOB 4QW2A 2L3PA 1WI7A 1NM7A 2Y4XA 2Y90A 1D0YA 1FMWA 1KD1C 1RABB 2SEMA 1R0CB 2MMPA 3QKJA 1RAIB 2LRQA 4XQ3A 3FC3A 2QYZA 4M7AA 4OB3B 2CP7A 2LCSA 2JOYA 3WVDB 3QDRB 2KRSA 3OA6A 1ZA1B 1G3TA 2FO0A 1WHLA 3JCMb 1N9RA 3QYHB 3THKA 3CCJT 3CCMQ 2LCLA 2C06A 2DD5A 2JNGA 2D0QB 3QSUA 3EH2A 2E41A 5GAN3 1B07A 2B8AA 4VUBA 1RI0A 3SEMA 3I55Q 3JAME 2K4YA 1Y0MA 1ZSGA 4PJOG 2DETA 2MYSA 3TQ7P 3JRZA 4E7IA 1KQSP 2F2WA 2WSCE 3CMEA 1KHIA 3VUBA 4Z89A 1T0JA 5GAOn 2GTJA 3OBYA 1NJIU 3OY9A 4MZMA 4C5HA 1YITT 1M8VA 4XK8E 3EGUA 1ZUYA 1BI2A 3DLLA 3OS2A 2RA2A 1O75A 1ZBXA 4FCYA 1UGSB 5KE3A 2KE9A 3SHWA 2DERA 1G5VA 2YLBA 1VQLA 3QJYA 4BI4A 1EFNA 1BU1A 2DF6A 5CQXA 2M02A 1RI9A 1JXMA 1VQ8A 3A8LB 4ORZA 5CKEA 4ANJA 3GF5A 2PNIA 2OTJT 3QIIA 3CPWA 5IH2A 3BDLA 4FYWB 2HBWA 3EHQA 4XTUA 1GCQC 2LP5A 1UUEA 2PUOB 2EQKA 1NPPA 5FLXE 3WVEB 3JB9H 1PD0A 2GF7A 5FWCA 3GNGA 1Y57A 2CP6A 1M8MA 3G6ET 1TS9A 4M77A 2QTXA 1Y96A 2DZ9A 2YHTA 5CIUA 2QDLA 4PJJA 4KH1B 5L23A 3TSWA 1KD1R 4N4IA 2FZGB 4IUQA 2QGFB 3G71Q 3T9NA 4RUGA 2L0AA 2RK1A 3JB9I 1PSEA 1B34A 4ELYC 2HQXA 4QKUA 3CC7T 5IHKA 1WHGA 1X6BA 4F7UB 2NUTA 5KYUA 1OU9A 3CCLA 3V7SA 1UFFA 4KBMB 2A28A 4LUDA 1OI1A 4ZTJA 4AG1C 4EMHA 1VQ6T 4FL6A 4NL3A 3H6ZA 5KH6A 3OBWA 1MUZA 2OAWA 3INZA 3OYLA 5I11A 2E1HA 2CP2A 2KSSA 3UA6A 1WLPB 3FDRA 1XNIA 4NL2A 3VRZA 5KYYB 3HRTA 1EZZB 1KSWA 3KUFA 4RTVA 3V8JA 3QDFA 3HSBA 2EWNA 5LJ3j 4C8QA 4OVAA 2DBKA 4C0GA 4J9HA 3M53A 5GANe 3JCMe 2EIFA 2JM9A 2LMJA 1LCKA 1OYXA 2EYYA 2NWMA 4C92G 1AWXA 1Y7XA 4OMFB 1QLYA 1YHQA 1NBEB 1K9MC 5FU7C 2DBMA 3OW2S 4IURA 2LDMA 1PCXA 2QI2A 4C5GA 4DBRA 5GAMd 2YUNA 4DQ2A 1RAGB 2JXBA 1YJWA 4OMQA 4LDXA 3G4SQ 3MP6A 1V1CA 1KQ2A 1K73C 3A8OB 2HEQA 3H8ZA 2KK4A 3JCMg 2VUBA 5GANg 3CC7Q 4PJOF 3ER0A 4M78E 3RBBB 1JU5C 2LNHB 3U23A 1JO8A 2EKHA 1QP2A 3PFSA 1TOVA 5LJ5e 2VVKA 3OYEA 1FXXA 1VQMQ 4ZN3A 1GXIE 2EYXA 1V76A 4M75C 5LJ3h 3NTHA 4J9BA 1HJDA 3FJ5A 3TVTA 2DM1A 3CD6A 2VXFA 1KFZA 2LJ1A 1YIJQ 1SEMA 3JSCA 4JJNK 5I22A 4J83A 3I56A 5FRMA 1X69A 1MNDA 4C92F 3P8BB 3RNJA 4XU2A 3EHRA 1VOMA 1MV3A 2RI3A 1YJNT 3RKYA 1H3ZA 3JCMW 3QWYA 2COWA 4X9DA 4AFZC 2FRYA 2PZ1A 2ECZA 2LX9A 2KROA 3SFMA 4RCCA 2KDSA 2CP3A 2E6ZA 4PJOE 1E7OA 5LJ3e 1M2VA 5CKHA 4RG8A 2DXBA 1VQNT 3I35A 1WXTA 3VS0A 5IT9E 4M75G 4F7UA 2HL3A 4GLKA 3CCUT 1RAAB 2VC8A 1KQSA 1JXOA 4M78D 4JPBW 5A0LA 1VQ9A 3VKIA 2BUDA 3L42A 3OS5A 1VQKT 2JTFA 1M1KU 2BZXA 3M55A 2LQ8A 3CPFA 2JW4A 3OS0A 1DJ7B 2FZCB 4RKUE 1UDLA 1QCOA 5D6WA 5I21A 3JCMQ 4N0AC 2VV5A 2K6DA 3X24B 4C92C 5FU6C 5CVIA 1QVGS 2PUKB 3LGFA 3CMAA 3S3MA 3JCMJ 1VQ9Q 2DO3A 2E65A 5GAN5 2KMTA 4M75E 1TUGB 4N4HA 2HKQB 3M0SA 3EG2A 3KBGA 3CC2Q 3PGGA 2OAUA 1H3HA 3PNWC 4IUUA 2JS2A 3HRUA 3JCMh 1WZOA 5GANh 1Q81R 4LN2A 2K3XA 1UG1A 4M78C 2RN8A 3EG9A 2AKKA 5ECAA 2RI2A 3OQ5A 2CT3A 2KQWA 4FYYB 2EVRA 3VV0A 3NHNA 2X4XA 2RJCA 1YIJA 3CCET 2KT8A 3R6OA 5GAOm 1SF9A 1VQ7T 3PE0A 4Z88A 2ZPHB 1X6GA 2DPPB 2OTJA 2DL4A 3G6EQ 2DTHA 3HFOA 3L1AA 1K8AR 4PJOD 3S3NA 1WIEA 5LJ5f 2KR3A 4K11A 4FIBA 4PK4A 4Y92A 2X9HA 3I5SA 1OX9A 3S6WA 2CP0A 1WQ7A 3MEWA 4C0FA 1X75C 2FYKA 3RDVA 2DZCA 5EG2A 2GGRA 2DE0X 1G3WA 2M9UA 2OTLQ 1OPKA 3CBPA 3MKDA 2J7IA 2O4XB 2D6FA 4Y28E 3G6EA 2OX7A 1JEGA 4LUEA 1OOTA 2RNAA 3CCLQ 1VYUA 1FMKA 1YBYA 3UDCA 3OYKA 1WPYA 1NEGA 4RMOA 2L5QA 1YITQ 4BD3A 1QVFP 2CGHA 2CUDA 4OB2B 5FW9A 3G4ST 4CC3A 4PLIA 3FLGA 2DYIA 4RTZA 3E1SA 5EC7A 2CZ7B 2E4HA 5GAMg 3A1PA 3OYIA 4OMNA 3CMEQ 3RMSA 2JUFA 3SWNA 3QJ6A 3SD4A 5KYUB 4E7HA 2A0FB 1N8RU 2BE7D 4IIMA 3R6NA 4D6WA 3EG1A 2EBPA 1PKTA 4PJOA 1X27A 3TEEA 3UA7A 4J7FA 2CUBA 2BIVA 2W10A 2V8KA 1YCSB 4RTXA 3I55T 1VQLQ 2ENMA 4GBQA 2EYQA 2EYWA 3CCQA 4BE0A 1VQOQ 1BKBA 1KIKA 3NFCA 2JS0A 1BIBA 1B34B 2FHDA 3I5RA 3OW2P 1GFDA 4AFSC 5GAMe 2KI7A 4E7ZA 1M3AA 1RLQC 1YJ9Q 2ZPBB 1AWOA 1VQ6Q 2NUTB 1I4K1 2E3HA 1YFNA 5FRNA 3SWNB 1PG5B 2OTLA 5AYFA 4HKEA 2LJ3A 1M27C 5I2MA 2QQBA 3OSSC 1VQ4A 1CKAA 4F14A 3OB9A 2ESWA 2O4XA 4J9FA 3VJPA 4AG2C 3OYYA 4A54A 2RQVA 1VQKA 2EQMA 4ESRA 5IAYA 1VQPA 2F5TX 2DTOA 2XIDA 3G71T 1W2BA 3EG3A 3OYBA 1YN8A 4QVDA 2E10A 3P8DA 4KGVB 1ACMB 2M1HA 1H8KA 3UPUA 2EW3A 4P5NA 4BE2A 3CC4A 4MDWA 4EMGA 4BDYA 1KHCA 4XU1A 2YT6A 1ZSZC 3VRYA 3ASKA 1KC8R 1WHHA 2BZYA 1BBZA 4RTTA 1I5OB 1IB8A 3C12A 4OB1B 2Y4YA 3FJPA 2E6NA 5LJ5g 1QP3A 2EJ9A 3V8KA 3JV3A 1NZ9A 5GMKe 2EJFA 2E12A 4D8KA 1E6HA 6AT1B 3TREA 4C0DC 4JZ4A 5IN1A 2DEUA 2K5FA 4EDUA 3SWNC 4J9IA 4JUVA 1T3LA 4XTYA 1GFCA 3OYMA 3NTKA 1M3CA 3M0TA 1VQMA 2PVDB 2RMOA 4QQ6A 1JB0E 1W2BP 2EGEA 4M7AB 1TTHB 3CCJQ 2L2PA 4QQDA 1Q86C 2DD4A 1I81A 1D3BB 1JJ2P 2QEXT 5GMKj 3PVLA 1GRIA 1ZQ1A 5LJ5d 1FYNA 1X2QA 1QWFA 4JLIA 1RLPC 3C94A 1LPLA 4F17A 3M0UA 3VYGA 2I2LA 2RJEA 3OYAA 2E70A 1UHCA 1Q82C 4NOYA 4BY6B 4HCKA 1IREB 1QVGA 1MMDA 3ME9A 1VQ5Q 2C0OA 4TVRA 4X34A 2P84A 3LH5A 3OW2A 1VQ5T 1AZEA 2B86A 2KYMA 4EMKC 4DOWA 4C5EA 2RI5A 2YXYA 2QK0A 3CC2A 1YJWT 1VQOT 1D09B 5GMKi 1MV0B 3MEVA 3M0QA 1M9SA 3LX7A 3CCRA 2VB6A 1G8XA 1VYTA 3GNFB 1AWWA 1W6XA 2E5QA 4EMKA 3DKMA 2A3LA 3VS1A 2CP5A 4FM4B 4F7UF 4FSSA 3RKXA 2M0OA 2PTKA 1W1FA 4JLGA 1PRLC 2VGMA 5A2QE 4AMCA 3QUIA 4CRIA 3FIFA 4RCBA 1Q7YC 2XD0A 2DIGA 4LXCA 3EGXA 1HYOA 1UTIA 2K9GA 2K3YA 5GAMj 2AIRB 2CYZB 1YI2Q 5GAN8 2J6FA 5KYYA 3JB9F 4PKCC 2RQUA 3NMZC 3HKSA 1R0BG 2D9TA 2P4TA 3REAB 5LJ3f 2YUQA 4KUDK 1RACB 1GCPA 4Y91A 1QVFA 3OS1A 3A8HB 2PU9B 2XDDA 3CPWS 1SG5A 2XICA 1B3QA 3QZ9B 4OF1A 3L2QA 4A4HA 1AT1B 1ABQA 2HSPA 2JM8A 1RAFB 1BI0A 3P8HA 4C8QG 2QA4T 1NYGA 2CZ6B 1YJNA 2D8JA 3CXCP 2FL7A 3JB9G 3FEOA 4E2FB 2KY9A 1UGVA 1U1TA 1T0HA 2YSQA 2DTIA 4UC4A 4MDXA 1J3TA 1G3SA 3HHTB 1IZ6A 1NE8A 1VQ6A 4JRKA 1N8RC 2BKDN 2RHIA 1VQPT 5AT1B 2HKNA 4ZTFA 4MZPA 3MHXA 1FX7A 3X25B 1KG1A 5DM7R 1YWPA 4M75F 5GANj 2M51A 4R56A 4BI8B 2NUPA 3TSZA 5GAN2 2GTOA 2RM4A 2O01E 3VYHB 2DJQA 2O88A 2KT1A 2FPFA 4RG2A 2XHCA 4M7DA 1PM3A 4C92D
chains in the Genus database with same CATH topology
1ZSZC 2QAZA 1OX8A 1TWBA 1ZSZA 2NYSA 1OU8A 1ZSZB 1OU9A 2QASA 1YFNA 1OX9A 1OULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZSZ C;  2QAZ A;  1OX8 A;  1TWB A;  1ZSZ A;  2NYS A;  1OU8 A;  1ZSZ B;  1OU9 A;  2QAS A;  1YFN A;  1OX9 A;  1OUL A; 
#chains in the Genus database with same CATH topology
 2DK3 A;  1BI3 A;  2DX1 A;  2MPX C;  2XKO C;  1YJ9 T;  3M56 A;  4GLM A;  4MML A;  4CC7 A;  1JQQ A;  4RTY A;  1WHK A;  2F2X A;  2F69 A;  3PIO A;  2MCN A;  2K5I A;  3RUX A;  1YJW Q;  2LVM A;  3L2Z A;  2FZK B;  4M75 B;  3I9Q A;  2CT4 A;  2LJ0 A;  2VKN A;  3HP9 A;  3V7C A;  1KC8 U;  3C95 A;  2YUO A;  2JT4 A;  4OB0 B;  3M0P A;  1TSF A;  2CZ0 B;  2JZ2 A;  3M54 A;  3ZBD A;  1A0N B;  2BZ8 A;  3A5Z B;  1MNE A;  3E19 A;  2QEX Q;  5C6S A;  1VQ4 Q;  1M4Z A;  2H8H A;  2HBP A;  2K57 A;  2P0K A;  1VQK Q;  2MOX A;  2QQS A;  1M30 A;  2RH2 A;  4X9C A;  2X51 A;  4J8O A;  2RJD A;  1GBQ A;  1TWB A;  3CCJ A;  5DY9 A;  4BI3 A;  3DLM A;  2HCK A;  2E3I A;  4M4Z A;  2ROT A;  3SB2 A;  4HA8 A;  1VYV A;  4PJO C;  1NLO C;  1WA7 A;  5CK9 A;  2OTL T;  4C92 A;  3CCQ Q;  4LE9 A;  1NPR A;  3RKW A;  4IKF A;  3BW1 A;  2MF2 A;  4JJD A;  5FRO A;  1TU0 B;  5LJ3 d;  4L5G A;  3CME T;  2X4W A;  3UF4 A;  5KYX B;  2A37 A;  3CXC A;  4JRI A;  3M4G A;  3EG0 A;  2HL5 C;  5GMK h;  3NGP A;  3G71 A;  4FT2 A;  4PFZ A;  2XI9 A;  4FW2 A;  3JCM V;  2YRV A;  2CSQ A;  1PNJ A;  1BI1 A;  1LNX A;  3E9F A;  5FWB A;  3M58 A;  2KBT A;  4DEY A;  3QZ5 B;  2ED0 A;  1SSH A;  1X2K A;  4F16 A;  4ZGJ B;  2EQJ A;  1OUL A;  1ZX6 A;  1G2B A;  1BIA A;  1NG2 A;  2QGG A;  2R5A A;  3VS2 A;  3FB9 A;  3RR6 A;  1VQ7 Q;  1K1Z A;  4M78 F;  5I2S A;  2QQ9 A;  3E9G A;  2GCX A;  2DLP A;  4PFO A;  2K2V A;  3EG9 B;  1MGQ A;  2V8I A;  1RAH B;  2EKO A;  2CH4 W;  1NJI C;  4CI0 C;  1YP5 A;  2XMF A;  1VQ9 T;  4C8Q D;  1K0X A;  1PWT A;  3MPU B;  1SRL A;  3EFS A;  1H64 1;  1NYF A;  2DEQ A;  3EGD A;  3PT9 A;  1VQN A;  4M78 A;  1Q82 R;  5GAO l;  2D1X A;  2XG8 D;  3GLX A;  4CC2 A;  1UB4 A;  4GY5 A;  2COY A;  4LDU A;  4MMK A;  2MWO A;  1PRM C;  1K9M R;  1QWE A;  2J6O A;  2X4Y A;  3ZL7 C;  1QKX A;  1UGP B;  2RJF A;  2RHZ A;  1YIT A;  4M7D E;  5GMK m;  1Y07 A;  4C0D B;  3J80 E;  4IIO A;  5A0G A;  1VQN Q;  2K79 A;  3CCS A;  1WJQ A;  2DXT A;  3CCR Q;  2D0N A;  4ZGE B;  2ATC B;  4O6J A;  1X6O A;  1VIE A;  3N5B B;  3M5A A;  4A4E A;  3URG A;  2GFA A;  1JJ2 A;  1C1A A;  2LNV A;  2ZGW A;  1TXQ A;  2FPE A;  2KYB A;  1D0X A;  2LQW A;  4WCI A;  2HAX A;  4PL6 A;  2O9V A;  2LTO A;  1OZ3 A;  1VQP Q;  2EJG A;  2YWW A;  2CKK A;  1KC8 C;  1M1K C;  3QG1 A;  1NJI R;  4RTU A;  4PLL A;  2GQI A;  2MAM A;  4R0K A;  2MIO A;  3OYH A;  1WJR A;  2K3B A;  2XDB A;  2F1L A;  4M77 F;  3CCL T;  2C0T A;  2XK0 A;  2O2O A;  4M77 C;  2X35 A;  3RMQ A;  1Q86 U;  1JBM A;  4M7A C;  4F7U E;  4KUI A;  3CBO A;  1SSF A;  5LJ5 h;  4A63 B;  4JS5 A;  1M90 U;  4M75 D;  4DBH A;  3OYJ A;  1QQJ A;  3O5Z A;  4BDZ A;  1Y71 A;  4LD9 K;  2DFU A;  4L6V 5;  5D6Y A;  1I07 A;  3CC4 T;  1U3O A;  3AT1 B;  3CXC S;  1I5L A;  1PD1 A;  3REB B;  2RHU A;  2CDT A;  4WF2 A;  4M7A E;  1RUW A;  3BDU A;  3O8V A;  3VS5 A;  4KGX B;  3M4Y A;  1NEB A;  5IXB A;  1ZSZ B;  2BE9 B;  1MMN A;  2DL3 A;  3EFR A;  2HQE A;  3EGD B;  2ZAE A;  1R8O B;  1HSQ A;  2VGN A;  1OX8 A;  4J9D A;  2K7A A;  1QCF A;  5D6X A;  4M7D B;  2AZV A;  1G83 A;  1D1C A;  1B7T A;  2DJZ A;  2RF0 A;  4L59 A;  3L2R A;  1OQK A;  3CCS Q;  1QKW A;  2BTT A;  2D8H A;  4DOV A;  5FU7 B;  1ABO A;  3KXT A;  1UEC A;  1PHT A;  5GAN 7;  2RQR A;  3HL8 A;  2GQV A;  4HCC A;  5GJW B;  4E6R A;  3EFO B;  2ABL A;  3PVQ A;  4QVZ A;  3MEA A;  1ZBJ A;  1N9S A;  1W70 A;  2KGT A;  2DNU A;  2DAQ A;  1BCO A;  4Z8A A;  5KYW B;  1RAD B;  1WNL A;  4HT8 A;  1AEY A;  3V7R A;  1I0C A;  4R55 A;  4IUV A;  3CCM A;  2EGA A;  3I56 Q;  1N27 A;  1MMA A;  4M77 D;  5CKF A;  1JRI A;  3JB9 D;  5CAI A;  2DL7 A;  4XAX B;  2R58 A;  1M1K R;  5GAM h;  2HQH A;  2O31 A;  3LH0 A;  2JVV A;  3RES A;  4ZN1 A;  1GCQ A;  2KXC A;  1BK2 A;  4JRP A;  1ARK A;  3NPF A;  4M77 G;  1ZA2 B;  3M0R A;  4A4F A;  2FVU A;  2KRM A;  1VQO A;  1K8A C;  3H0H A;  4B9X A;  1ZLM A;  5J26 A;  2C0I A;  1YCY A;  1X43 A;  1X01 A;  2AZS A;  4AFQ C;  1UGR B;  3X20 B;  1KK7 A;  5J3B A;  3LGL A;  5LJ3 g;  2YLC A;  2J06 A;  1JJ2 S;  2OI3 A;  1YJN Q;  4WTO B;  1QMC A;  4JJB A;  5DLQ E;  5D7U A;  1D1B A;  2HMA A;  2QXF A;  2E64 A;  3CCS T;  4BAC A;  2EFI A;  1SHF A;  1YNZ A;  4X1V A;  2VWF A;  2RB6 A;  1IGQ A;  1SHG A;  4J6Y A;  2FB7 A;  3VS7 A;  2IPO B;  1M1G A;  3BY7 A;  1UGQ B;  3OYD A;  3CCE Q;  4II1 A;  1U8R A;  4ZGD B;  3UT1 A;  3LYI A;  4E7S A;  2RQW A;  1Q81 U;  1PKS A;  1Y96 B;  3X28 B;  3HRS A;  1VA7 A;  2KEA A;  2M0Y A;  3CC4 Q;  2YRC A;  2XU8 A;  5L8R E;  3HPW A;  5FU6 B;  1LVK A;  4XTV A;  2EPD A;  3UAT A;  5GAO p;  4DBF A;  1HXD A;  5KCO A;  4CC4 B;  4C92 B;  2ZPF B;  4XTX A;  2EQI A;  3ULR B;  1PSF A;  2NYS A;  3EFO A;  2E5K A;  2JJ9 A;  1K9A A;  2DRK A;  2QG9 B;  4HCB A;  1MMG A;  1KQS S;  3OSV A;  2KNB B;  1E6G A;  2PQW A;  3RIR A;  2LQK A;  4MZT A;  1K8A U;  2NUZ A;  1CKB A;  3VUZ A;  4FW1 A;  1C6V X;  4FSX A;  5LL6 S;  4BY6 C;  4V2S A;  4M7A D;  2L3R A;  3CCU Q;  4KH0 B;  1Q82 U;  4ATO A;  4OMM A;  3CCQ T;  4JRQ A;  2NUP B;  3A98 A;  2OJ2 A;  3GP8 A;  3CCR T;  3BFM A;  4LD6 A;  2L8D A;  2J05 A;  3CQT A;  3CEY A;  4XU0 A;  3MEU A;  4JZ3 A;  1UEB A;  4IUP A;  4DBQ A;  1KQ1 A;  3VS6 A;  2DIL A;  5HKC A;  4N4G A;  3CCM T;  3OYG A;  4C8Q C;  1WYX A;  3TCJ A;  2YUP A;  1VQ4 T;  3GIB A;  1RAE B;  4PJM A;  2LT1 A;  2W0Z A;  5J39 A;  1VIF A;  4C5I A;  1M90 R;  1AOJ A;  2AK5 A;  1V29 B;  2DVE A;  2V26 A;  2RHY A;  1QVP A;  2WSE E;  4QVC A;  2CH4 A;  1N6A A;  2V1R A;  1OV3 A;  3LWI A;  1D1A A;  2DXU A;  2F2V A;  5DLO A;  4E7J A;  2JMC A;  2AT1 B;  1RL2 A;  3I55 A;  3PIP A;  3OYN A;  3RER A;  2DVJ A;  4M7D G;  4F04 B;  1Q95 G;  3FRN A;  1N5Z A;  2EQU A;  3H41 A;  1OPL A;  3UWN A;  1C0M A;  2QEX A;  2RPN A;  3QXE B;  4KT0 E;  2PVG B;  3E2U A;  1GBR A;  1UE9 A;  4QT7 A;  1K73 R;  1AZG B;  3JCM d;  5GAN d;  4J9E A;  4M77 E;  1Z9Z A;  4C8Q B;  2P4R A;  5A0D A;  5HK3 A;  3OMC A;  3OYF A;  4J6X A;  1BYM A;  1D0Z A;  4ELZ C;  3M9Q A;  4M7D F;  5C0M A;  3C0C A;  1TUC A;  2DXC A;  4LDY A;  3TU4 K;  1PC0 A;  3J7A F;  4HT9 A;  4N0A A;  2IIM A;  2P0P A;  4J9G A;  1VQ8 Q;  3G7Z A;  2A7Y A;  4KRT A;  4JJC A;  4OML A;  2MI6 A;  3LW5 E;  2RQT A;  3CCV T;  3CC2 T;  1AWJ A;  3L2V A;  2IG0 A;  2AKL A;  4LDV A;  2DYB A;  1W2B S;  3PMI A;  1WDX A;  4J6W A;  1N8R R;  3QO3 A;  2SRC A;  4A4K A;  1FWZ A;  2KXD A;  1UJ0 A;  4A4G A;  1EX4 A;  2OTJ Q;  1S72 A;  5HK0 A;  3CBM A;  3M57 A;  4XTZ A;  3NTI A;  3HTR A;  3J81 E;  3V8L A;  2V8J A;  1KD1 U;  1M1F A;  3D7S B;  3M59 A;  2XDP A;  1QCN A;  2O9S A;  5CKB A;  4KUL A;  3SDZ A;  2MK5 A;  4RTW A;  2LCC A;  3QWX X;  1NLP C;  3OYC A;  4BUG A;  4A53 A;  4E47 A;  4HVV A;  3GBQ A;  1VQ5 A;  1OEB A;  2LC4 A;  3I56 T;  1P92 A;  1SRM A;  3MCA B;  2I0N A;  3QPH A;  4M78 B;  5M9O A;  1XJW B;  2ZCF B;  1XOV A;  4FU6 A;  2QAS A;  1I8F A;  4OMO A;  2FPD A;  2YRD A;  4J9C A;  2H3J A;  1UHF A;  5IHI A;  2JTE A;  2HD0 A;  1TUD A;  1GL5 A;  4M7A F;  3JB9 J;  1OU8 A;  1S1N A;  1M3B A;  2FG0 A;  2P0Q A;  3CMA Q;  1QVG P;  3QHS A;  2JMA A;  1YI2 A;  1WXU A;  2DA9 A;  4C0Z A;  2HSE B;  4FYX B;  4AT1 B;  1IGU A;  2COZ A;  1CSK A;  1WGS A;  1SPK A;  4J7I A;  3VS4 A;  3A8M B;  1IRX A;  1ZUU A;  4Q5W A;  5LJ5 j;  2AHJ B;  4J5Y A;  3PTA A;  5KYW A;  1K76 A;  3KFV A;  1OZ2 A;  2RD1 A;  4E7L A;  2NLU A;  3CCE A;  3WXM B;  2PVO B;  4OMP A;  2QDY B;  1VQM T;  3DB4 A;  2L89 A;  2CZ1 B;  1SKU B;  1WFW A;  2LZ6 B;  4EPC A;  2K5L A;  2JTM A;  4DEX A;  1FMV A;  4M7A G;  2GNC A;  3OMG A;  3BE3 A;  1KJW A;  3PMT A;  2GBQ A;  1K73 U;  1ZUK A;  3F70 A;  1U5S A;  4HVW A;  2Z0W A;  3JCM c;  2YDL A;  3Q1J A;  4EIK A;  4Z02 A;  1U1S A;  4HVU A;  2DKG A;  3ZEH A;  1K0S A;  2DIQ A;  2J6K A;  1AVZ C;  4PFP A;  4M7D D;  2G3R A;  3L2U A;  1ZSZ A;  5IHN A;  2ZPE B;  4OGC A;  3CPW P;  1BB9 A;  2A36 A;  2H3E B;  2QQR A;  1IHV A;  3JCM P;  8AT1 B;  1LJO A;  3ZFJ A;  1M2V B;  3C4S A;  1XTD A;  1Q7Y U;  5GJV B;  2ED1 A;  2ZZD A;  5GAN 4;  3EH1 A;  3HFN A;  2RK2 A;  2LQN A;  2QQA A;  2KAF A;  1QVF S;  4O5V A;  4YTL A;  5CR2 A;  3CC7 A;  4PNO A;  4FYV B;  2CRE A;  4C8Q E;  3MP1 A;  1BCM A;  1VUB A;  2QTV A;  3MJX A;  4M77 B;  1M5Q 1;  2L3Q A;  2HNI A;  4DA4 A;  1ZHI A;  4M7D C;  5GAO q;  3VS3 A;  1F1B B;  3QYG B;  8ATC B;  1S72 T;  2V1Q A;  1TG0 A;  4XTW A;  5KYN A;  1G3Y A;  5GAO r;  2KRN A;  1M2O A;  1Q86 R;  2X4J A;  4BB7 A;  1UJY A;  4HXJ A;  3LWH A;  1WX6 A;  1YHQ Q;  2ZPG B;  3MO8 A;  1LOJ A;  5KCH A;  5GAN 6;  4XU3 A;  2A08 A;  2VXE A;  1IO6 A;  1O9S A;  2IVW A;  2RHX A;  2G6F X;  4M75 A;  4F7U G;  2MWP A;  2R5M A;  5CKD A;  2K2M A;  5KE2 A;  4JS4 A;  3GPL A;  2KVQ G;  1MHN A;  1Z9Q A;  2L3S A;  3GOX A;  3H0I A;  7AT1 B;  1YJ9 A;  3MP8 A;  4HCZ A;  1IXD A;  4KGZ B;  2EGC A;  3X26 B;  3CCU A;  1YHQ T;  3CMA T;  4ZNX A;  2WSF E;  1YWO A;  3L2W A;  2M16 A;  5GMK l;  1U06 A;  3EGX B;  3VU3 C;  1WXB A;  4QQG A;  3H0F A;  5CCA A;  2F5K A;  1WHM A;  1VQL T;  1I1J A;  4C8Q F;  5CQY A;  5HY6 A;  2VAS A;  4IUT A;  5HCK A;  2R57 A;  1AHJ B;  2ROL A;  3H9N A;  2QA4 A;  4B6M A;  1S72 Q;  3G1J A;  3JCM X;  4OP0 A;  1Q7Y R;  4M78 G;  3A8G B;  2QAZ A;  3EAE A;  4EMK B;  3CD6 Q;  1AD5 A;  2X3X D;  4B9W A;  2WAC A;  3JCM f;  5GAN f;  3DB3 A;  4JDS A;  3LLR A;  1WHJ A;  2CS7 A;  1K4U S;  4PJL A;  1R77 A;  1WJS A;  1HK9 A;  4OGE A;  4D8D A;  1TH7 A;  1VQ7 A;  2LT4 A;  2JN0 A;  3MET A;  2CSI A;  2X3W D;  1YI2 T;  3QBY A;  2LX7 A;  4NS5 A;  4BE1 A;  2DMO A;  3CCV Q;  2EAY A;  2QA4 Q;  5CO7 A;  1XQH A;  1H92 A;  4AFU C;  3CD6 T;  1T3S A;  4LDW A;  2ZPI B;  2GFU A;  4C92 E;  1QW1 A;  2DRM A;  2VYT A;  1YIJ T;  9ATC B;  3S3O A;  5GAM f;  1IHW A;  2EYZ A;  4PJN A;  4FT4 A;  1K9M U;  3IQL A;  1HD3 A;  1Q81 C;  1VQ8 T;  3CCV A;  1D3B A;  1EIF A;  1W4S A;  2DL8 A;  3AHU A;  1WQW A;  4ME7 A;  1M90 C;  5KYX A;  5IXF A;  4LNP A;  2FEI A;  3G4S A;  2HDA A;  2DL5 A;  2FRW A;  2RO0 A;  2HZY A;  4E7K A;  4PJO B;  4QW2 A;  2L3P A;  1WI7 A;  1NM7 A;  2Y4X A;  2Y90 A;  1D0Y A;  1FMW A;  1KD1 C;  1RAB B;  2SEM A;  1R0C B;  2MMP A;  3QKJ A;  1RAI B;  2LRQ A;  4XQ3 A;  3FC3 A;  2QYZ A;  4M7A A;  4OB3 B;  2CP7 A;  2LCS A;  2JOY A;  3WVD B;  3QDR B;  2KRS A;  3OA6 A;  1ZA1 B;  1G3T A;  2FO0 A;  1WHL A;  3JCM b;  1N9R A;  3QYH B;  3THK A;  3CCJ T;  3CCM Q;  2LCL A;  2C06 A;  2DD5 A;  2JNG A;  2D0Q B;  3QSU A;  3EH2 A;  2E41 A;  5GAN 3;  1B07 A;  2B8A A;  4VUB A;  1RI0 A;  3SEM A;  3I55 Q;  3JAM E;  2K4Y A;  1Y0M A;  1ZSG A;  4PJO G;  2DET A;  2MYS A;  3TQ7 P;  3JRZ A;  4E7I A;  1KQS P;  2F2W A;  2WSC E;  3CME A;  1KHI A;  3VUB A;  4Z89 A;  1T0J A;  5GAO n;  2GTJ A;  3OBY A;  1NJI U;  3OY9 A;  4MZM A;  4C5H A;  1YIT T;  1M8V A;  4XK8 E;  3EGU A;  1ZUY A;  1BI2 A;  3DLL A;  3OS2 A;  2RA2 A;  1O75 A;  1ZBX A;  4FCY A;  1UGS B;  5KE3 A;  2KE9 A;  3SHW A;  2DER A;  1G5V A;  2YLB A;  1VQL A;  3QJY A;  4BI4 A;  1EFN A;  1BU1 A;  2DF6 A;  5CQX A;  2M02 A;  1RI9 A;  1JXM A;  1VQ8 A;  3A8L B;  4ORZ A;  5CKE A;  4ANJ A;  3GF5 A;  2PNI A;  2OTJ T;  3QII A;  3CPW A;  5IH2 A;  3BDL A;  4FYW B;  2HBW A;  3EHQ A;  4XTU A;  1GCQ C;  2LP5 A;  1UUE A;  2PUO B;  2EQK A;  1NPP A;  5FLX E;  3WVE B;  3JB9 H;  1PD0 A;  2GF7 A;  5FWC A;  3GNG A;  1Y57 A;  2CP6 A;  1M8M A;  3G6E T;  1TS9 A;  4M77 A;  2QTX A;  1Y96 A;  2DZ9 A;  2YHT A;  5CIU A;  2QDL A;  4PJJ A;  4KH1 B;  5L23 A;  3TSW A;  1KD1 R;  4N4I A;  2FZG B;  4IUQ A;  2QGF B;  3G71 Q;  3T9N A;  4RUG A;  2L0A A;  2RK1 A;  3JB9 I;  1PSE A;  1B34 A;  4ELY C;  2HQX A;  4QKU A;  3CC7 T;  5IHK A;  1WHG A;  1X6B A;  4F7U B;  2NUT A;  5KYU A;  1OU9 A;  3CCL A;  3V7S A;  1UFF A;  4KBM B;  2A28 A;  4LUD A;  1OI1 A;  4ZTJ A;  4AG1 C;  4EMH A;  1VQ6 T;  4FL6 A;  4NL3 A;  3H6Z A;  5KH6 A;  3OBW A;  1MUZ A;  2OAW A;  3INZ A;  3OYL A;  5I11 A;  2E1H A;  2CP2 A;  2KSS A;  3UA6 A;  1WLP B;  3FDR A;  1XNI A;  4NL2 A;  3VRZ A;  5KYY B;  3HRT A;  1EZZ B;  1KSW A;  3KUF A;  4RTV A;  3V8J A;  3QDF A;  3HSB A;  2EWN A;  5LJ3 j;  4C8Q A;  4OVA A;  2DBK A;  4C0G A;  4J9H A;  3M53 A;  5GAN e;  3JCM e;  2EIF A;  2JM9 A;  2LMJ A;  1LCK A;  1OYX A;  2EYY A;  2NWM A;  4C92 G;  1AWX A;  1Y7X A;  4OMF B;  1QLY A;  1YHQ A;  1NBE B;  1K9M C;  5FU7 C;  2DBM A;  3OW2 S;  4IUR A;  2LDM A;  1PCX A;  2QI2 A;  4C5G A;  4DBR A;  5GAM d;  2YUN A;  4DQ2 A;  1RAG B;  2JXB A;  1YJW A;  4OMQ A;  4LDX A;  3G4S Q;  3MP6 A;  1V1C A;  1KQ2 A;  1K73 C;  3A8O B;  2HEQ A;  3H8Z A;  2KK4 A;  3JCM g;  2VUB A;  5GAN g;  3CC7 Q;  4PJO F;  3ER0 A;  4M78 E;  3RBB B;  1JU5 C;  2LNH B;  3U23 A;  1JO8 A;  2EKH A;  1QP2 A;  3PFS A;  1TOV A;  5LJ5 e;  2VVK A;  3OYE A;  1FXX A;  1VQM Q;  4ZN3 A;  1GXI E;  2EYX A;  1V76 A;  4M75 C;  5LJ3 h;  3NTH A;  4J9B A;  1HJD A;  3FJ5 A;  3TVT A;  2DM1 A;  3CD6 A;  2VXF A;  1KFZ A;  2LJ1 A;  1YIJ Q;  1SEM A;  3JSC A;  4JJN K;  5I22 A;  4J83 A;  3I56 A;  5FRM A;  1X69 A;  1MND A;  4C92 F;  3P8B B;  3RNJ A;  4XU2 A;  3EHR A;  1VOM A;  1MV3 A;  2RI3 A;  1YJN T;  3RKY A;  1H3Z A;  3JCM W;  3QWY A;  2COW A;  4X9D A;  4AFZ C;  2FRY A;  2PZ1 A;  2ECZ A;  2LX9 A;  2KRO A;  3SFM A;  4RCC A;  2KDS A;  2CP3 A;  2E6Z A;  4PJO E;  1E7O A;  5LJ3 e;  1M2V A;  5CKH A;  4RG8 A;  2DXB A;  1VQN T;  3I35 A;  1WXT A;  3VS0 A;  5IT9 E;  4M75 G;  4F7U A;  2HL3 A;  4GLK A;  3CCU T;  1RAA B;  2VC8 A;  1KQS A;  1JXO A;  4M78 D;  4JPB W;  5A0L A;  1VQ9 A;  3VKI A;  2BUD A;  3L42 A;  3OS5 A;  1VQK T;  2JTF A;  1M1K U;  2BZX A;  3M55 A;  2LQ8 A;  3CPF A;  2JW4 A;  3OS0 A;  1DJ7 B;  2FZC B;  4RKU E;  1UDL A;  1QCO A;  5D6W A;  5I21 A;  3JCM Q;  4N0A C;  2VV5 A;  2K6D A;  3X24 B;  4C92 C;  5FU6 C;  5CVI A;  1QVG S;  2PUK B;  3LGF A;  3CMA A;  3S3M A;  3JCM J;  1VQ9 Q;  2DO3 A;  2E65 A;  5GAN 5;  2KMT A;  4M75 E;  1TUG B;  4N4H A;  2HKQ B;  3M0S A;  3EG2 A;  3KBG A;  3CC2 Q;  3PGG A;  2OAU A;  1H3H A;  3PNW C;  4IUU A;  2JS2 A;  3HRU A;  3JCM h;  1WZO A;  5GAN h;  1Q81 R;  4LN2 A;  2K3X A;  1UG1 A;  4M78 C;  2RN8 A;  3EG9 A;  2AKK A;  5ECA A;  2RI2 A;  3OQ5 A;  2CT3 A;  2KQW A;  4FYY B;  2EVR A;  3VV0 A;  3NHN A;  2X4X A;  2RJC A;  1YIJ A;  3CCE T;  2KT8 A;  3R6O A;  5GAO m;  1SF9 A;  1VQ7 T;  3PE0 A;  4Z88 A;  2ZPH B;  1X6G A;  2DPP B;  2OTJ A;  2DL4 A;  3G6E Q;  2DTH A;  3HFO A;  3L1A A;  1K8A R;  4PJO D;  3S3N A;  1WIE A;  5LJ5 f;  2KR3 A;  4K11 A;  4FIB A;  4PK4 A;  4Y92 A;  2X9H A;  3I5S A;  1OX9 A;  3S6W A;  2CP0 A;  1WQ7 A;  3MEW A;  4C0F A;  1X75 C;  2FYK A;  3RDV A;  2DZC A;  5EG2 A;  2GGR A;  2DE0 X;  1G3W A;  2M9U A;  2OTL Q;  1OPK A;  3CBP A;  3MKD A;  2J7I A;  2O4X B;  2D6F A;  4Y28 E;  3G6E A;  2OX7 A;  1JEG A;  4LUE A;  1OOT A;  2RNA A;  3CCL Q;  1VYU A;  1FMK A;  1YBY A;  3UDC A;  3OYK A;  1WPY A;  1NEG A;  4RMO A;  2L5Q A;  1YIT Q;  4BD3 A;  1QVF P;  2CGH A;  2CUD A;  4OB2 B;  5FW9 A;  3G4S T;  4CC3 A;  4PLI A;  3FLG A;  2DYI A;  4RTZ A;  3E1S A;  5EC7 A;  2CZ7 B;  2E4H A;  5GAM g;  3A1P A;  3OYI A;  4OMN A;  3CME Q;  3RMS A;  2JUF A;  3SWN A;  3QJ6 A;  3SD4 A;  5KYU B;  4E7H A;  2A0F B;  1N8R U;  2BE7 D;  4IIM A;  3R6N A;  4D6W A;  3EG1 A;  2EBP A;  1PKT A;  4PJO A;  1X27 A;  3TEE A;  3UA7 A;  4J7F A;  2CUB A;  2BIV A;  2W10 A;  2V8K A;  1YCS B;  4RTX A;  3I55 T;  1VQL Q;  2ENM A;  4GBQ A;  2EYQ A;  2EYW A;  3CCQ A;  4BE0 A;  1VQO Q;  1BKB A;  1KIK A;  3NFC A;  2JS0 A;  1BIB A;  1B34 B;  2FHD A;  3I5R A;  3OW2 P;  1GFD A;  4AFS C;  5GAM e;  2KI7 A;  4E7Z A;  1M3A A;  1RLQ C;  1YJ9 Q;  2ZPB B;  1AWO A;  1VQ6 Q;  2NUT B;  1I4K 1;  2E3H A;  1YFN A;  5FRN A;  3SWN B;  1PG5 B;  2OTL A;  5AYF A;  4HKE A;  2LJ3 A;  1M27 C;  5I2M A;  2QQB A;  3OSS C;  1VQ4 A;  1CKA A;  4F14 A;  3OB9 A;  2ESW A;  2O4X A;  4J9F A;  3VJP A;  4AG2 C;  3OYY A;  4A54 A;  2RQV A;  1VQK A;  2EQM A;  4ESR A;  5IAY A;  1VQP A;  2F5T X;  2DTO A;  2XID A;  3G71 T;  1W2B A;  3EG3 A;  3OYB A;  1YN8 A;  4QVD A;  2E10 A;  3P8D A;  4KGV B;  1ACM B;  2M1H A;  1H8K A;  3UPU A;  2EW3 A;  4P5N A;  4BE2 A;  3CC4 A;  4MDW A;  4EMG A;  4BDY A;  1KHC A;  4XU1 A;  2YT6 A;  1ZSZ C;  3VRY A;  3ASK A;  1KC8 R;  1WHH A;  2BZY A;  1BBZ A;  4RTT A;  1I5O B;  1IB8 A;  3C12 A;  4OB1 B;  2Y4Y A;  3FJP A;  2E6N A;  5LJ5 g;  1QP3 A;  2EJ9 A;  3V8K A;  3JV3 A;  1NZ9 A;  5GMK e;  2EJF A;  2E12 A;  4D8K A;  1E6H A;  6AT1 B;  3TRE A;  4C0D C;  4JZ4 A;  5IN1 A;  2DEU A;  2K5F A;  4EDU A;  3SWN C;  4J9I A;  4JUV A;  1T3L A;  4XTY A;  1GFC A;  3OYM A;  3NTK A;  1M3C A;  3M0T A;  1VQM A;  2PVD B;  2RMO A;  4QQ6 A;  1JB0 E;  1W2B P;  2EGE A;  4M7A B;  1TTH B;  3CCJ Q;  2L2P A;  4QQD A;  1Q86 C;  2DD4 A;  1I81 A;  1D3B B;  1JJ2 P;  2QEX T;  5GMK j;  3PVL A;  1GRI A;  1ZQ1 A;  5LJ5 d;  1FYN A;  1X2Q A;  1QWF A;  4JLI A;  1RLP C;  3C94 A;  1LPL A;  4F17 A;  3M0U A;  3VYG A;  2I2L A;  2RJE A;  3OYA A;  2E70 A;  1UHC A;  1Q82 C;  4NOY A;  4BY6 B;  4HCK A;  1IRE B;  1QVG A;  1MMD A;  3ME9 A;  1VQ5 Q;  2C0O A;  4TVR A;  4X34 A;  2P84 A;  3LH5 A;  3OW2 A;  1VQ5 T;  1AZE A;  2B86 A;  2KYM A;  4EMK C;  4DOW A;  4C5E A;  2RI5 A;  2YXY A;  2QK0 A;  3CC2 A;  1YJW T;  1VQO T;  1D09 B;  5GMK i;  1MV0 B;  3MEV A;  3M0Q A;  1M9S A;  3LX7 A;  3CCR A;  2VB6 A;  1G8X A;  1VYT A;  3GNF B;  1AWW A;  1W6X A;  2E5Q A;  4EMK A;  3DKM A;  2A3L A;  3VS1 A;  2CP5 A;  4FM4 B;  4F7U F;  4FSS A;  3RKX A;  2M0O A;  2PTK A;  1W1F A;  4JLG A;  1PRL C;  2VGM A;  5A2Q E;  4AMC A;  3QUI A;  4CRI A;  3FIF A;  4RCB A;  1Q7Y C;  2XD0 A;  2DIG A;  4LXC A;  3EGX A;  1HYO A;  1UTI A;  2K9G A;  2K3Y A;  5GAM j;  2AIR B;  2CYZ B;  1YI2 Q;  5GAN 8;  2J6F A;  5KYY A;  3JB9 F;  4PKC C;  2RQU A;  3NMZ C;  3HKS A;  1R0B G;  2D9T A;  2P4T A;  3REA B;  5LJ3 f;  2YUQ A;  4KUD K;  1RAC B;  1GCP A;  4Y91 A;  1QVF A;  3OS1 A;  3A8H B;  2PU9 B;  2XDD A;  3CPW S;  1SG5 A;  2XIC A;  1B3Q A;  3QZ9 B;  4OF1 A;  3L2Q A;  4A4H A;  1AT1 B;  1ABQ A;  2HSP A;  2JM8 A;  1RAF B;  1BI0 A;  3P8H A;  4C8Q G;  2QA4 T;  1NYG A;  2CZ6 B;  1YJN A;  2D8J A;  3CXC P;  2FL7 A;  3JB9 G;  3FEO A;  4E2F B;  2KY9 A;  1UGV A;  1U1T A;  1T0H A;  2YSQ A;  2DTI A;  4UC4 A;  4MDX A;  1J3T A;  1G3S A;  3HHT B;  1IZ6 A;  1NE8 A;  1VQ6 A;  4JRK A;  1N8R C;  2BKD N;  2RHI A;  1VQP T;  5AT1 B;  2HKN A;  4ZTF A;  4MZP A;  3MHX A;  1FX7 A;  3X25 B;  1KG1 A;  5DM7 R;  1YWP A;  4M75 F;  5GAN j;  2M51 A;  4R56 A;  4BI8 B;  2NUP A;  3TSZ A;  5GAN 2;  2GTO A;  2RM4 A;  2O01 E;  3VYH B;  2DJQ A;  2O88 A;  2KT1 A;  2FPF A;  4RG2 A;  2XHC A;  4M7D A;  1PM3 A;  4C92 D; 
#chains in the Genus database with same CATH homology
 1ZSZ C;  2QAZ A;  1OX8 A;  1TWB A;  1ZSZ A;  2NYS A;  1OU8 A;  1ZSZ B;  1OU9 A;  2QAS A;  1YFN A;  1OX9 A;  1OUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...