1OU8A

Structure of an aaa+ protease delivery protein in complex with a peptide degradation tag
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
SSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGVMFEPEEIYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Stringent starvation protein B homolog
publication title Structure of a delivery protein for an AAA+ protease in complex with a peptide degradation tag
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 28
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1ou8A00
1TWBA 1ZSZB 2QASA 1OU9A 2QAZA 1ZSZA 1OX8A 2NYSA 1YFNA 1OU8A 1OX9A 1OULA 1ZSZC
chains in the Genus database with same CATH superfamily
3L1AA 4BB7A 4M78D 2D9TA 2EWNA 1WZOA 2CSIA 3RKXA 5KE3A 3CCVT 3CPFA 4LNPA 5GAN8 5GAOm 2R5AA 4PJOC 1ZBJA 5GAN7 1MNDA 3X28B 4M7DA 3NPFA 2A0FB 2RHUA 4FU6A 3RERA 1AWXA 3NFCA 2GFAA 2CP0A 5CQXA 1NE8A 5HK3A 4C0DB 2CSQA 1YHQQ 4M75B 4OGCA 3MEUA 4XTWA 1KC8U 4PFPA 1BCOA 4KUIA 5L23A 4Y92A 2EKOA 2FPDA 1NBEB 3CMEQ 3OYCA 4M7DG 4DA4A 1XNIA 4QQGA 3UPUA 3VS7A 4IIOA 5FROA 4XK8E 2V8IA 1U1TA 3HRTA 4RMOA 1YI2A 3CPWS 1QW1A 2QQAA 2DPPB 3JB9I 3V7SA 1YIJA 1W2BP 2JVVA 4DQ2A 1D1AA 1UGPB 2EYZA 4GBQA 2CH4A 3E2UA 4FT4A 2MOXA 2D6FA 4IIMA 2QA4Q 5IT9E 3QYGB 1K0SA 3ZEHA 1Y0MA 2NYSA 1AOJA 3H0FA 3V7RA 5HK0A 1WGSA 2CH4W 3J81E 2HAXA 1HXDA 1WHHA 3MO8A 4LD6A 2X3WD 4E6RA 2OAWA 3BY7A 3A8HB 4L6V5 4XTUA 3LWHA 3JCMf 2OX7A 1WLPB 2RM4A 1BKBA 1SG5A 3RMSA 1X6BA 4II1A 4FSSA 1WXUA 2BUDA 3UWNA 1TTHB 2ZPFB 4JRKA 4KH1B 3OYDA 3CCMA 4FYXB 2RQRA 2SEMA 4QT7A 4J6XA 5EC7A 4NL2A 4XQ3A 4F16A 3MEWA 2YHTA 1WJRA 2O01E 2JMCA 4TVRA 4AMCA 4HT8A 1PSFA 2CYZB 4E7SA 4M78B 2EYWA 1ABQA 4OB2B 3ER0A 4OMQA 5C6SA 3NTKA 3FEOA 1Q82U 4MMLA 3I5SA 1NJIR 1BI2A 3MP6A 1RI0A 2CGHA 2X3XD 1LVKA 4PJNA 4X34A 3H8ZA 1YJ9Q 3CCLA 3QJYA 1WJQA 3JCMX 5GANh 4AFZC 1M5Q1 1A0NB 4XTXA 3MCAB 1XTDA 5J3BA 1VQKA 1M3CA 4Y28E 1M90C 1WIEA 2DF6A 5LJ5d 3LX7A 2IIMA 4M77C 1VQOA 1X75C 3VS5A 1V1CA 1Y57A 4IKFA 1AWOA 2E5QA 1QVFP 3A98A 3EG3A 5GAOp 3G71Q 1IHWA 1YITQ 2FZCB 2K4YA 2XICA 5GAMh 2DL5A 2KBTA 3N5BB 4PJJA 1VQMQ 3H0IA 1WDXA 1BI3A 4C8QF 4MZPA 3QDFA 1ABOA 2ZCFB 1G3SA 2YWWA 3CXCP 3INZA 4LN2A 2FPFA 2AZVA 3I56A 1TXQA 4RKUE 1LPLA 5GANe 3HRSA 2DERA 1Z9QA 4M7DB 2BZXA 4M7AC 1D0YA 2FYKA 2ZPIB 2LT4A 4IUQA 4DEXA 2QYZA 2X4JA 4AFSC 4JLGA 4FM4B 2QQBA 3EG2A 5DLOA 3U23A 4HCKA 3HL8A 1UECA 1KJWA 4PFOA 3FDRA 2RQWA 1S72T 1ZSZC 3PGGA 2HDAA 2K3BA 2K9GA 1VQ7A 4RTWA 5GAMe 4J8OA 4BI4A 2KEAA 1IGQA 2FZKB 2NWMA 2QGGA 2LQKA 5IH2A 3GNGA 2HQXA 4BE0A 4PJOE 2DL7A 2KYMA 2JTFA 3CCUA 2MI6A 1QVFS 4NL3A 1QP2A 4JRPA 1MNEA 3X25B 3QXEB 1ZBXA 1RAGB 5KYNA 1PD1A 1P92A 3JCMc 2HEQA 4XTYA 1H641 1ZQ1A 1YNZA 1QVGA 1QCNA 2KNBB 3VKIA 2L3PA 3CCJA 2RN8A 1Q7YU 4AFUC 3CXCS 2JTEA 1TUDA 1BB9A 1OEBA 2M16A 4HVVA 2R57A 1SRLA 5DY9A 2B8AA 3EGDA 1TH7A 2LJ0A 2VGMA 1BI0A 1MUZA 1Y07A 3CMAQ 4CC3A 3UA7A 1G2BA 2AZSA 4EDUA 1NM7A 2KGTA 1V29B 4QW2A 4F7UE 2E10A 4VUBA 2LVMA 3GNFB 4C92A 3RESA 4ZGDB 1NLPC 2LQNA 4ATOA 1IGUA 4XU0A 5FWBA 2YXYA 3J7AF 2OI3A 9ATCB 3META 3VV0A 3A8OB 1WHGA 1YI2Q 2JS0A 3JCMW 2ROTA 4HCZA 1D3BA 2LX9A 4OMPA 1VIEA 1OPLA 2P0KA 2ATCB 1VQ8Q 3ZFJA 4C92G 1D09B 3V8LA 1YCYA 3FJ5A 4JUVA 4OMMA 3CPWA 1R0BG 3HP9A 2C0TA 2DEUA 4JRQA 1G83A 1Q82C 2QXFA 1KD1U 4C0ZA 1N5ZA 1N9SA 4A63B 5L8RE 2A08A 1YJWQ 1D1CA 3M56A 2L3SA 3CCQQ 2JXBA 1FWZA 5GAMf 2DA9A 1VQ4Q 1UE9A 4F17A 2PVDB 4C92D 4OGEA 2EIFA 2M51A 3SWNB 1K8AU 2XDDA 3OS2A 2GTJA 2GCXA 4MZTA 3EG9A 1H8KA 1M27C 1OU8A 2QA4A 2ZZDA 4EMKA 3SD4A 1IO6A 1VQ6Q 3C4SA 2K5IA 4JLIA 2CKKA 3M57A 4M77E 1VQ5T 4DBHA 2PU9B 1M90R 2VYTA 4JJDA 1W70A 3LGLA 3RUXA 3CBMA 3SHWA 1RAFB 3VUBA 3OYEA 2CZ6B 1VOMA 2LX7A 4A54A 3HRUA 2RNAA 4BDZA 2F69A 2FO0A 4DOVA 3BDLA 1WJSA 2V1RA 3G4ST 2OTLT 1PG5B 5LJ3g 3EFSA 1VQKQ 4PJOA 5GAMj 5IHIA 5GAOn 3V8JA 1MMNA 4FYYB 3R6OA 2L2PA 2K7AA 1VQPT 2LCCA 1VQOQ 2QG9B 1SHFA 4M7AE 3V8KA 4E7LA 5CKFA 5LJ5h 2O88A 3NTHA 1M8MA 2DZCA 2GNCA 2LRQA 1X6GA 2YSQA 3SEMA 5GAOq 4ZTFA 1R8OB 4PJOG 3OBWA 2YUNA 2KAFA 4R55A 3OYMA 5FWCA 5GAN5 5AT1B 3HFOA 1I81A 2HCKA 2DL8A 2LZ6B 2OJ2A 2JJ9A 3EGDB 4QQDA 5FU7C 1GCPA 3G6EQ 2M0OA 1QVGP 2OTJT 3M53A 3GF5A 2CP2A 1SHGA 1B07A 4HA8A 2D1XA 1UFFA 3JB9H 3M0QA 1YJNT 1BCMA 3EFRA 2DAQA 4ZN1A 1K73C 2Y4YA 2QK0A 2G6FX 2DEQA 4EPCA 1Y7XA 2L89A 4M75D 4F7UA 3GOXA 1YITA 1SSFA 1ZA1B 4IUUA 3G4SQ 2MF2A 4ELYC 4HT9A 1VQMA 2ENMA 1Q7YC 4C92B 3CC4T 5FU6B 4J9CA 4CI0C 4J9BA 2M1HA 4ELZC 5KYYA 2ZGWA 3RBBB 1QWEA 1ZUKA 1M9SA 3HTRA 2E41A 4UC4A 2O4XA 5GAOr 1Q86C 4F7UG 3EGXA 1G8XA 3OMGA 1SSHA 1D3BB 2MAMA 1UJYA 1JXOA 2IPOB 1T0HA 2RJCA 1Q81U 4RCBA 1K1ZA 2JM9A 2L3QA 2X4XA 2MK5A 2EPDA 2QI2A 2DM1A 4JS4A 1K0XA 1QVFA 1CSKA 1SKUB 3MHXA 3QJ6A 1HYOA 2ROLA 2RHXA 3VUZA 3L2RA 1UGQB 3JAME 2EQMA 1OULA 2CUDA 2D8HA 3RMQA 1QCOA 1FYNA 1FMKA 4KULA 1YJNQ 3J80E 5I2SA 1OU9A 2J7IA 2KI7A 3CXCA 2C06A 3CPWP 4C8QC 4YTLA 4EMKB 1QLYA 2DX1A 2V26A 3CC4Q 4M77A 4LDWA 2HMAA 1NYFA 2AHJB 1KHCA 1JJ2P 4J9HA 5CIUA 2JT4A 2RQTA 3A5ZB 2DMOA 3GP8A 5A0DA 2AK5A 3MEAA 4J7IA 4J83A 4P5NA 5GANg 3S3OA 1Q82R 2VXEA 1OYXA 3CMAA 1U5SA 3C94A 5HY6A 2LT1A 4PJOB 4X1VA 4RCCA 2LCSA 1H3ZA 3MKDA 1VQNQ 2X51A 4M7AA 3CEYA 1H3HA 2DTOA 1PKSA 1WHJA 4J6WA 2RK1A 3H6ZA 2MWPA 3EG1A 4DBQA 2DVJA 4PLIA 4XTVA 2QQRA 5LJ5f 3ME9A 2F2WA 3GPLA 1WI7A 2P84A 5FLXE 2LNHB 2D0QB 1ZSZA 5KH6A 2VKNA 4O6JA 1YP5A 5GAOl 4LD9K 4M7AG 1JBMA 4V2SA 5A2QE 3MP1A 2E3IA 3CC2T 2LNVA 3BE3A 1E6HA 5CQYA 3TU4K 1VQ8A 1X27A 1PWTA 4M7DD 1ZLMA 4A4GA 1JJ2S 1HSQA 2NUPA 3QSUA 4FT2A 4C5EA 3CCVQ 1UTIA 3JB9F 2FPEA 1UJ0A 2GGRA 2EVRA 1MHNA 2HL5C 4F7UB 3QIIA 5IAYA 3PMIA 4WTOB 4JS5A 1YJWA 2CP5A 1XJWB 3CCQA 5D6YA 3EGUA 3LYIA 5LJ5j 1VQ4A 4EIKA 4CC7A 2C0IA 5KYWA 1JRIA 5KYYB 4JZ4A 1GBRA 2EGAA 4RUGA 2J05A 3AHUA 3FB9A 2DD5A 2O4XB 3RKWA 4OVAA 3ZBDA 1N8RC 1HD3A 1JEGA 6AT1B 1VQ6A 1VQ9T 2GQIA 3BW1A 4GY5A 2YUQA 3M4GA 3CCST 2QEXT 3P8DA 4RTYA 4CRIA 3I55T 2O2OA 1JB0E 3PIOA 4AFQC 2RQUA 2HBPA 1W4SA 3NGPA 2YDLA 3CC2Q 2J6OA 2GBQA 4HKEA 2KSSA 3EH1A 3A8GB 1K73R 2RD1A 3V7CA 1N9RA 2RH2A 2E1HA 2X9HA 2DYIA 4N4HA 1RADB 2MIOA 2KT8A 1OI1A 1PCXA 1BBZA 1WNLA 1Q7YR 2LDMA 4LDYA 3OA6A 1PC0A 3OYIA 1NPPA 2SRCA 2K3YA 2A3LA 3QDRB 3CBPA 1OPKA 1U06A 1AZGB 4KGVB 1Q86R 2DRKA 2ED0A 3M58A 2ECZA 3VRYA 4N0AA 2F1LA 4M77B 1MMDA 4OB1B 5EG2A 1ZX6A 1SF9A 2EBPA 2K2MA 1NEBA 3MPUB 3CC7T 2CZ7B 1X69A 1C0MA 4K11A 2BKDN 2DXTA 1E6GA 1SEMA 3CBOA 3G6EA 3QPHA 4HCCA 3UATA 1AHJB 1PRLC 1VQLT 2DFUA 4MDXA 4A4FA 4C8QE 2CUBA 4M7AB 3RNJA 2FG0A 4RTZA 5KYXA 4R56A 3SDZA 3G4SA 2O31A 4DBFA 2ZAEA 3RIRA 2VB6A 1LOJA 2P0QA 3P8BB 5GAN4 1K9MU 1OQKA 3EHRA 5IXFA 2ED1A 1ZSZB 2HKQB 1T3SA 4FL6A 1TSFA 4M75F 3JCMb 3PTAA 2FZGB 3M0TA 3M0UA 4AG2C 1V76A 5D6WA 2EQIA 3I9QA 1LJOA 2RPNA 2NUPB 1LNXA 4HCBA 1KC8C 2DL3A 1FMWA 3CC7Q 2PTKA 3JB9J 1IB8A 2JM8A 1YIJT 2FEIA 3OSVA 3CQTA 3M0RA 1H92A 4GLMA 4GLKA 3CD6T 1WPYA 2O9SA 3QBYA 1YJNA 5KYWB 2XMFA 1O9SA 4QQ6A 4JJNK 1N6AA 4ORZA 3KXTA 3UA6A 2RI2A 2XI9A 2KY9A 5LJ3d 1S72Q 3REBB 3CC4A 1PKTA 1X2QA 5CAIA 1WQWA 2E12A 4BDYA 4JJBA 4KH0B 3OYHA 2K79A 3JCMJ 1GXIE 1D0ZA 1FMVA 4LDXA 2BIVA 4RTVA 2DTHA 3CCMT 2EGCA 3CCET 1RAEB 5IXBA 1AT1B 4Y91A 2XK0A 1I07A 1Y71A 3FRNA 4M78F 3F70A 4PLLA 3QWYA 2P0PA 1PNJA 3HSBA 3EFOA 1VQNA 4N0AC 4HXJA 4ZNXA 2AT1B 3OS5A 3JCMg 1TU0B 2HZYA 4OMFB 3QYHB 1IHVA 4B9WA 1YN8A 3JRZA 2YRDA 1N8RR 2EAYA 4N4GA 4M78E 2HQHA 2FRYA 3DLMA 3GLXA 3CCLT 2LCLA 1I4K1 1IRXA 1QKXA 1M4ZA 2C0OA 5CKEA 1JJ2A 2KXCA 2COZA 2XKOC 4JDSA 2DYBA 2CT4A 5GMKh 1I8FA 3NTIA 5CVIA 4HVUA 3P8HA 2E70A 3OBYA 3QWXX 5CK9A 4RTUA 2HQEA 3DLLA 4BUGA 2CS7A 4PKCC 3X24B 2ZPBB 4ESRA 3CCVA 1UG1A 5DLQE 4C8QA 5CR2A 1Y96A 3TREA 3NMZC 3PMTA 1WX6A 1MMGA 2J06A 2CZ1B 5KYXB 4XU3A 5GMKm 2Z0WA 2DXCA 2DJQA 4WF2A 1RABB 4KGZB 2NUTA 4CC4B 2JUFA 5GJWB 1R0CB 4M7DF 4JRIA 1OZ3A 5GAN3 5CO7A 4C8QG 3THKA 2KDSA 3H0HA 1NLOC 2V8KA 3QG1A 5GMKe 3PIPA 1C1AA 1VYUA 4KUDK 3BDUA 1UGSB 3QUIA 3TCJA 1QP3A 1QWFA 2EYYA 2MCNA 2HNIA 5CKDA 1VQ7T 3CC2A 1M2VA 5CCAA 2KROA 3SB2A 1M8VA 2EJFA 4A53A 2LTOA 3RDVA 1K9MC 3T9NA 4E2FB 3CCUT 1UHFA 1X43A 1M1KU 7AT1B 1VQ5Q 4ZN3A 3MJXA 2K3XA 2BE9B 3LGFA 4MDWA 4E7JA 4PJOD 3WXMB 5FU7B 1MGQA 2QASA 3H41A 3L2WA 3CCJT 2KT1A 2VGNA 4OF1A 1B7TA 4FYVB 5LJ5e 2FVUA 2OTLQ 3PVLA 3URGA 4PJLA 1FXXA 2W10A 3HKSA 5IHKA 4X9CA 3BFMA 3HFNA 1VQPQ 2V8JA 2DXBA 2HD0A 1KC8R 1VQ9A 3OYBA 2COWA 2EQUA 2PVOB 2PNIA 4DOWA 1OV3A 3I55A 2DBMA 4B9XA 4Z89A 1FX7A 2E64A 2GTOA 1NEGA 4KRTA 3EFOB 5D7UA 2JOYA 2L5QA 4ANJA 2LQWA 3M0PA 1E7OA 2XD0A 5IN1A 4M78A 3QZ9B 1ZA2B 2OTJQ 2RO0A 1TS9A 1NPRA 1QCFA 2HL3A 3OYYA 1UHCA 2CP6A 3VJPA 4LXCA 1U8RA 1YWPA 1QQJA 3SFMA 1TOVA 3IQLA 1K76A 5C0MA 3PT9A 2E4HA 1YHQT 2DE0X 3EG9B 3OYFA 3LW5E 2GQVA 3LLRA 1KQ2A 1QVPA 4XAXB 1QMCA 4F14A 4D8DA 3CMET 4QVDA 5LJ3h 2DRMA 4C5HA 2E6NA 4C8QB 3D7SB 3CC7A 1Y96B 1UGRB 1WFWA 4FSXA 3WVEB 4B6MA 2CDTA 2F5TX 2JTMA 5IHNA 2COYA 1M30A 1KD1C 3EG0A 1NYGA 4WCIA 4M4ZA 3M59A 2NUTB 2EJGA 1RAAB 1VQLA 3TVTA 3KUFA 3G1JA 4Z02A 4C5IA 2A7YA 2KQWA 2J6FA 4M77G 2QA4T 1K8AC 2P4TA 3O8VA 3JCMQ 2RB6A 2RHYA 2DJZA 3NHNA 1S72A 3S3NA 2ABLA 1S1NA 2QTXA 4E7IA 2W0ZA 3CCRT 1TUGB 3G7ZA 5GMKj 1YBYA 4C0DC 3OW2P 3E19A 4M75C 2BZ8A 3QZ5B 5LJ3e 1M1FA 2DIQA 1EZZB 5FRMA 5GAMg 2RJEA 1JXMA 4M77D 1M2VB 2H3EB 4PFZA 2E65A 5CKHA 2KRMA 2DO3A 4F04B 1GBQA 5LL6S 5KCOA 3TSWA 1TUCA 2XIDA 2EQKA 1M2OA 1CKBA 4XU1A 2F2XA 2M9UA 2YRCA 3S3MA 1JQQA 1W1FA 4E7HA 3CD6A 1PM3A 2XU8A 4M7AD 1QKWA 4C0GA 1YJ9T 3OYAA 2DIGA 3I5RA 3JCMV 3GIBA 4NOYA 3RKYA 2VV5A 1G3YA 4JZ3A 4QVZA 1AEYA 2DILA 2HBWA 3KFVA 1NG2A 3VYHB 4D6WA 2I2LA 2KK4A 3CCRQ 4J7FA 2QTVA 1CKAA 1KQSA 2CREA 4ZGEB 1M1KC 3EGXB 3OW2S 3VS3A 2K5LA 4KBMB 1K9MR 1KQ1A 4LE9A 1OX8A 3G71T 1PSEA 4FW2A 3QKJA 1EX4A 4XU2A 1YITT 2RA2A 4E7KA 4M78C 4C92F 1LCKA 4LDUA 3VYGA 3CCEA 1VQMT 4KT0E 5I2MA 2A37A 4OMLA 3VS4A 3WVDB 5J26A 1U3OA 1PRMC 4IUVA 4RG8A 4ZTJA 1KFZA 5GAN6 2H8HA 5HKCA 3OY9A 4FYWB 1SRMA 3PE0A 2JN0A 4C92E 2EKHA 4E7ZA 1W2BS 1KK7A 3E9FA 2RK2A 1KIKA 2VVKA 4KGXB 4LUEA 3FJPA 2KMTA 3E1SA 2CZ0B 2RJFA 2LC4A 2H3JA 2QQ9A 3A1PA 3M54A 3Q1JA 2WSCE 2L8DA 1Q81C 2V1QA 1WHKA 2MPXC 5GMKi 1EFNA 2YRVA 1N27A 2KRSA 2ZPGB 1TG0A 5LJ3f 3LWIA 2HSEB 2LJ3A 4A4HA 1T0JA 1WA7A 5M9OA 2I0NA 1HK9A 2IG0A 3A8LB 4OMNA 1VQ9Q 4FW1A 3CCSQ 2QEXQ 1VQ5A 4C5GA 3UT1A 5A0LA 3I55Q 1AWJA 1GCQA 2FL7A 2J6KA 4MMKA 3ULRB 1YCSB 3SWNA 4M7DC 4IUPA 3OMCA 2VUBA 2KE9A 5ECAA 5KE2A 2GFUA 5A0GA 2JW4A 2E5KA 2XG8D 1UDLA 2OTLA 1GFCA 1MMAA 1RI9A 3VRZA 4AG1C 2DLPA 3JCMd 4BE2A 5I22A 1UEBA 1C6VX 1I5OB 1J3TA 3OB9A 3E9GA 1BK2A 3M9QA 1VQPA 3CMAT 4OB0B 5I11A 5LJ3j 4PJOF 2VC8A 5FRNA 4OP0A 8ATCB 2VWFA 1BIAA 1KD1R 2K5FA 1MV0B 3M0SA 3L2VA 3QO3A 2KYBA 4C0FA 2K2VA 2RF0A 4JJCA 1NJIU 3OS0A 4RTXA 2NLUA 2BTTA 1AVZC 4J9EA 1K8AR 2JMAA 1Z9ZA 2QGFB 2EJ9A 2RHZA 1ZUYA 4M75E 1YI2T 1K73U 2OTJA 1SPKA 2KR3A 2PVGB 3PVQA 2X4YA 2L0AA 1RACB 3X20B 1BYMA 1VQLQ 1D0XA 2PZ1A 2QDYB 1VQ8T 1BI1A 2XDPA 2P4RA 3DB3A 3JV3A 4DBRA 4LDVA 1KSWA 2KRNA 2M0YA 4BI3A 2X35A 1DJ7B 2LQ8A 1RLQC 4OB3B 4X9DA 4LUDA 4F7UF 1Q86U 5HCKA 5KYUA 1JO8A 2LMJA 2FHDA 5LJ5g 4IURA 2VASA 1G5VA 3DB4A 1YJWT 1BIBA 2YLCA 1VYTA 2ESWA 5CKBA 2AKKA 2RI3A 2DETA 3CCQT 2WSFE 3JB9G 4A4EA 4Q5WA 1VQ4T 1JU5C 1K9AA 3KBGA 5J39A 4J9DA 2WACA 1XOVA 1OZ2A 1KQSP 3MP8A 1GFDA 2R5MA 1F1BB 3VS2A 2CT3A 2Y90A 2DL4A 1WQ7A 4O5VA 2AIRB 2D8JA 2RI5A 3QHSA 1VQ6T 2HSPA 5GAN2 1WXBA 1IREB 3L2UA 2LP5A 1PHTA 3VS6A 3JB9D 1YIJQ 1KHIA 2A36A 1MV3A 1B34A 2PQWA 3CD6Q 1WYXA 1ARKA 5GANf 1M1KR 2BE7D 3EH2A 2YLBA 3M55A 3EHQA 2EFIA 1YHQA 2WSEE 1WHLA 3C0CA 3OQ5A 3AT1B 3UDCA 1VQKT 3LH0A 2PUOB 3ASKA 4PNOA 3CMEA 1UGVA 1GCQC 4PJMA 2YUOA 2DD4A 3UF4A 3VU3C 3SWNC 4QVCA 1VQOT 1PD0A 1UB4A 1X2KA 3S6WA 3FLGA 3L2ZA 3TQ7P 4M77F 4RTTA 2K6DA 3FIFA 4D8KA 2QQSA 4EMGA 3CCMQ 2M02A 3CCEQ 1T3LA 2EQJA 8AT1B 3PNWC 4HVWA 4J9FA 5FW9A 4BACA 1AZEA 1KQSS 2DNUA 5KCHA 3OW2A 2R58A 4BE1A 1RAHB 5GANj 1HJDA 3I56T 2ZPEB 1ZHIA 4Z88A 1Q81R 3OSSC 1GRIA 3G6ET 3GBQA 3A8MB 4E47A 3CCRA 1RLPC 2LJ1A 4ME7A 1IZ6A 2KVQG 1OX9A 4M7AF 1NZ9A 2RJDA 3DKMA 3OYLA 1VIFA 3CCLQ 2NUZA 1ACMB 2CP3A 2DVEA 2GF7A 2PUKB 4R0KA 4M7DE 3JSCA 3FC3A 2EW3A 1Q95G 1W2BA 4C8QD 1X01A 4J5YA 2A28A 2JZ2A 2DBKA 5GMKl 2D0NA 4M75A 5I21A 2FRWA 2EYQA 2EGEA 2QAZA 3ZL7C 3REAB 4EMHA 1RAIB 4AT1B 1TWBA 1O75A 2YT6A 1RUWA 2QDLA 3TSZA 1M1GA 2EYXA 2K57A 4L5GA 5GANd 1W6XA 1OOTA 1YJ9A 4RG2A 1AD5A 2DTIA 4M75G 4Z8AA 3OYGA 2E6ZA 1VUBA 1KG1A 1XQHA 2E3HA 2HKNA 2IVWA 2CP7A 3TEEA 2RQVA 2VXFA 3I56Q 1N8RU 5KYUB 2ZPHB 1NJIC 3OYNA 1EIFA 4ZGJB 3OS1A 2F2VA 4FCYA 2X4WA 3L42A 1B3QA 3C12A 4BY6C 2RHIA 2F5KA 3JCMh 3H9NA 1R77A 4C92C 5GAMd 3G71A 5FU6C 3CCSA 2DKGA 2QEXA 1M3BA 2DXUA 2XHCA 1ZUUA 4JPBW 1I5LA 4BY6B 3C95A 3VS1A 1ZSGA 3M5AA 2JNGA 2JS2A 4XTZA 2B86A 1BU1A 1VQ7Q 3I35A 5D6XA 5AYFA 4OMOA 2DZ9A 4BI8B 2MYSA 3EAEA 1M90U 2G3RA 3PFSA 2YUPA 4FIBA 2DK3A 3OYKA 1X6OA 1GL5A 3X26B 4A4KA 4L59A 3CCUQ 1B34B 4MZMA 2O9VA 1M3AA 1VYVA 2XDBA 1G3TA 2RMOA 3MEVA 2KXDA 4J9GA 1K4US 3HHTB 3JCMP 2Y4XA 3O5ZA 2L3RA 4PL6A 1WHMA 4QKUA 3JCMe 1YWOA 3CCJQ 3HPWA 1G3WA 4CC2A 4DEYA 1VQNT 4M78G 1I1JA 1AWWA 1IXDA 2OAUA 4BD3A 4J6YA 5GJVB 5DM7R 1RL2A 1I0CA 1QVGS 3L2QA 1U1SA 3OYJA 3M4YA 3RR6A 4EMKC 3VS0A 4IUTA 4J9IA 3R6NA 1UUEA 2MWOA 2BZYA 2MMPA 4PK4A 3LH5A 1WXTA 1D1BA 1VA7A 4N4IA 2FB7A 2AKLA 4NS5A 1YFNA
chains in the Genus database with same CATH topology
1TWBA 1ZSZB 2QASA 1OU9A 2QAZA 1ZSZA 1OX8A 2NYSA 1YFNA 1OU8A 1OX9A 1OULA 1ZSZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWB A;  1ZSZ B;  2QAS A;  1OU9 A;  2QAZ A;  1ZSZ A;  1OX8 A;  2NYS A;  1YFN A;  1OU8 A;  1OX9 A;  1OUL A;  1ZSZ C; 
#chains in the Genus database with same CATH topology
 3L1A A;  4BB7 A;  4M78 D;  2D9T A;  2EWN A;  1WZO A;  2CSI A;  3RKX A;  5KE3 A;  3CCV T;  3CPF A;  4LNP A;  5GAN 8;  5GAO m;  2R5A A;  4PJO C;  1ZBJ A;  5GAN 7;  1MND A;  3X28 B;  4M7D A;  3NPF A;  2A0F B;  2RHU A;  4FU6 A;  3RER A;  1AWX A;  3NFC A;  2GFA A;  2CP0 A;  5CQX A;  1NE8 A;  5HK3 A;  4C0D B;  2CSQ A;  1YHQ Q;  4M75 B;  4OGC A;  3MEU A;  4XTW A;  1KC8 U;  4PFP A;  1BCO A;  4KUI A;  5L23 A;  4Y92 A;  2EKO A;  2FPD A;  1NBE B;  3CME Q;  3OYC A;  4M7D G;  4DA4 A;  1XNI A;  4QQG A;  3UPU A;  3VS7 A;  4IIO A;  5FRO A;  4XK8 E;  2V8I A;  1U1T A;  3HRT A;  4RMO A;  1YI2 A;  3CPW S;  1QW1 A;  2QQA A;  2DPP B;  3JB9 I;  3V7S A;  1YIJ A;  1W2B P;  2JVV A;  4DQ2 A;  1D1A A;  1UGP B;  2EYZ A;  4GBQ A;  2CH4 A;  3E2U A;  4FT4 A;  2MOX A;  2D6F A;  4IIM A;  2QA4 Q;  5IT9 E;  3QYG B;  1K0S A;  3ZEH A;  1Y0M A;  2NYS A;  1AOJ A;  3H0F A;  3V7R A;  5HK0 A;  1WGS A;  2CH4 W;  3J81 E;  2HAX A;  1HXD A;  1WHH A;  3MO8 A;  4LD6 A;  2X3W D;  4E6R A;  2OAW A;  3BY7 A;  3A8H B;  4L6V 5;  4XTU A;  3LWH A;  3JCM f;  2OX7 A;  1WLP B;  2RM4 A;  1BKB A;  1SG5 A;  3RMS A;  1X6B A;  4II1 A;  4FSS A;  1WXU A;  2BUD A;  3UWN A;  1TTH B;  2ZPF B;  4JRK A;  4KH1 B;  3OYD A;  3CCM A;  4FYX B;  2RQR A;  2SEM A;  4QT7 A;  4J6X A;  5EC7 A;  4NL2 A;  4XQ3 A;  4F16 A;  3MEW A;  2YHT A;  1WJR A;  2O01 E;  2JMC A;  4TVR A;  4AMC A;  4HT8 A;  1PSF A;  2CYZ B;  4E7S A;  4M78 B;  2EYW A;  1ABQ A;  4OB2 B;  3ER0 A;  4OMQ A;  5C6S A;  3NTK A;  3FEO A;  1Q82 U;  4MML A;  3I5S A;  1NJI R;  1BI2 A;  3MP6 A;  1RI0 A;  2CGH A;  2X3X D;  1LVK A;  4PJN A;  4X34 A;  3H8Z A;  1YJ9 Q;  3CCL A;  3QJY A;  1WJQ A;  3JCM X;  5GAN h;  4AFZ C;  1M5Q 1;  1A0N B;  4XTX A;  3MCA B;  1XTD A;  5J3B A;  1VQK A;  1M3C A;  4Y28 E;  1M90 C;  1WIE A;  2DF6 A;  5LJ5 d;  3LX7 A;  2IIM A;  4M77 C;  1VQO A;  1X75 C;  3VS5 A;  1V1C A;  1Y57 A;  4IKF A;  1AWO A;  2E5Q A;  1QVF P;  3A98 A;  3EG3 A;  5GAO p;  3G71 Q;  1IHW A;  1YIT Q;  2FZC B;  2K4Y A;  2XIC A;  5GAM h;  2DL5 A;  2KBT A;  3N5B B;  4PJJ A;  1VQM Q;  3H0I A;  1WDX A;  1BI3 A;  4C8Q F;  4MZP A;  3QDF A;  1ABO A;  2ZCF B;  1G3S A;  2YWW A;  3CXC P;  3INZ A;  4LN2 A;  2FPF A;  2AZV A;  3I56 A;  1TXQ A;  4RKU E;  1LPL A;  5GAN e;  3HRS A;  2DER A;  1Z9Q A;  4M7D B;  2BZX A;  4M7A C;  1D0Y A;  2FYK A;  2ZPI B;  2LT4 A;  4IUQ A;  4DEX A;  2QYZ A;  2X4J A;  4AFS C;  4JLG A;  4FM4 B;  2QQB A;  3EG2 A;  5DLO A;  3U23 A;  4HCK A;  3HL8 A;  1UEC A;  1KJW A;  4PFO A;  3FDR A;  2RQW A;  1S72 T;  1ZSZ C;  3PGG A;  2HDA A;  2K3B A;  2K9G A;  1VQ7 A;  4RTW A;  5GAM e;  4J8O A;  4BI4 A;  2KEA A;  1IGQ A;  2FZK B;  2NWM A;  2QGG A;  2LQK A;  5IH2 A;  3GNG A;  2HQX A;  4BE0 A;  4PJO E;  2DL7 A;  2KYM A;  2JTF A;  3CCU A;  2MI6 A;  1QVF S;  4NL3 A;  1QP2 A;  4JRP A;  1MNE A;  3X25 B;  3QXE B;  1ZBX A;  1RAG B;  5KYN A;  1PD1 A;  1P92 A;  3JCM c;  2HEQ A;  4XTY A;  1H64 1;  1ZQ1 A;  1YNZ A;  1QVG A;  1QCN A;  2KNB B;  3VKI A;  2L3P A;  3CCJ A;  2RN8 A;  1Q7Y U;  4AFU C;  3CXC S;  2JTE A;  1TUD A;  1BB9 A;  1OEB A;  2M16 A;  4HVV A;  2R57 A;  1SRL A;  5DY9 A;  2B8A A;  3EGD A;  1TH7 A;  2LJ0 A;  2VGM A;  1BI0 A;  1MUZ A;  1Y07 A;  3CMA Q;  4CC3 A;  3UA7 A;  1G2B A;  2AZS A;  4EDU A;  1NM7 A;  2KGT A;  1V29 B;  4QW2 A;  4F7U E;  2E10 A;  4VUB A;  2LVM A;  3GNF B;  4C92 A;  3RES A;  4ZGD B;  1NLP C;  2LQN A;  4ATO A;  1IGU A;  4XU0 A;  5FWB A;  2YXY A;  3J7A F;  2OI3 A;  9ATC B;  3MET A;  3VV0 A;  3A8O B;  1WHG A;  1YI2 Q;  2JS0 A;  3JCM W;  2ROT A;  4HCZ A;  1D3B A;  2LX9 A;  4OMP A;  1VIE A;  1OPL A;  2P0K A;  2ATC B;  1VQ8 Q;  3ZFJ A;  4C92 G;  1D09 B;  3V8L A;  1YCY A;  3FJ5 A;  4JUV A;  4OMM A;  3CPW A;  1R0B G;  3HP9 A;  2C0T A;  2DEU A;  4JRQ A;  1G83 A;  1Q82 C;  2QXF A;  1KD1 U;  4C0Z A;  1N5Z A;  1N9S A;  4A63 B;  5L8R E;  2A08 A;  1YJW Q;  1D1C A;  3M56 A;  2L3S A;  3CCQ Q;  2JXB A;  1FWZ A;  5GAM f;  2DA9 A;  1VQ4 Q;  1UE9 A;  4F17 A;  2PVD B;  4C92 D;  4OGE A;  2EIF A;  2M51 A;  3SWN B;  1K8A U;  2XDD A;  3OS2 A;  2GTJ A;  2GCX A;  4MZT A;  3EG9 A;  1H8K A;  1M27 C;  1OU8 A;  2QA4 A;  2ZZD A;  4EMK A;  3SD4 A;  1IO6 A;  1VQ6 Q;  3C4S A;  2K5I A;  4JLI A;  2CKK A;  3M57 A;  4M77 E;  1VQ5 T;  4DBH A;  2PU9 B;  1M90 R;  2VYT A;  4JJD A;  1W70 A;  3LGL A;  3RUX A;  3CBM A;  3SHW A;  1RAF B;  3VUB A;  3OYE A;  2CZ6 B;  1VOM A;  2LX7 A;  4A54 A;  3HRU A;  2RNA A;  4BDZ A;  2F69 A;  2FO0 A;  4DOV A;  3BDL A;  1WJS A;  2V1R A;  3G4S T;  2OTL T;  1PG5 B;  5LJ3 g;  3EFS A;  1VQK Q;  4PJO A;  5GAM j;  5IHI A;  5GAO n;  3V8J A;  1MMN A;  4FYY B;  3R6O A;  2L2P A;  2K7A A;  1VQP T;  2LCC A;  1VQO Q;  2QG9 B;  1SHF A;  4M7A E;  3V8K A;  4E7L A;  5CKF A;  5LJ5 h;  2O88 A;  3NTH A;  1M8M A;  2DZC A;  2GNC A;  2LRQ A;  1X6G A;  2YSQ A;  3SEM A;  5GAO q;  4ZTF A;  1R8O B;  4PJO G;  3OBW A;  2YUN A;  2KAF A;  4R55 A;  3OYM A;  5FWC A;  5GAN 5;  5AT1 B;  3HFO A;  1I81 A;  2HCK A;  2DL8 A;  2LZ6 B;  2OJ2 A;  2JJ9 A;  3EGD B;  4QQD A;  5FU7 C;  1GCP A;  3G6E Q;  2M0O A;  1QVG P;  2OTJ T;  3M53 A;  3GF5 A;  2CP2 A;  1SHG A;  1B07 A;  4HA8 A;  2D1X A;  1UFF A;  3JB9 H;  3M0Q A;  1YJN T;  1BCM A;  3EFR A;  2DAQ A;  4ZN1 A;  1K73 C;  2Y4Y A;  2QK0 A;  2G6F X;  2DEQ A;  4EPC A;  1Y7X A;  2L89 A;  4M75 D;  4F7U A;  3GOX A;  1YIT A;  1SSF A;  1ZA1 B;  4IUU A;  3G4S Q;  2MF2 A;  4ELY C;  4HT9 A;  1VQM A;  2ENM A;  1Q7Y C;  4C92 B;  3CC4 T;  5FU6 B;  4J9C A;  4CI0 C;  4J9B A;  2M1H A;  4ELZ C;  5KYY A;  2ZGW A;  3RBB B;  1QWE A;  1ZUK A;  1M9S A;  3HTR A;  2E41 A;  4UC4 A;  2O4X A;  5GAO r;  1Q86 C;  4F7U G;  3EGX A;  1G8X A;  3OMG A;  1SSH A;  1D3B B;  2MAM A;  1UJY A;  1JXO A;  2IPO B;  1T0H A;  2RJC A;  1Q81 U;  4RCB A;  1K1Z A;  2JM9 A;  2L3Q A;  2X4X A;  2MK5 A;  2EPD A;  2QI2 A;  2DM1 A;  4JS4 A;  1K0X A;  1QVF A;  1CSK A;  1SKU B;  3MHX A;  3QJ6 A;  1HYO A;  2ROL A;  2RHX A;  3VUZ A;  3L2R A;  1UGQ B;  3JAM E;  2EQM A;  1OUL A;  2CUD A;  2D8H A;  3RMQ A;  1QCO A;  1FYN A;  1FMK A;  4KUL A;  1YJN Q;  3J80 E;  5I2S A;  1OU9 A;  2J7I A;  2KI7 A;  3CXC A;  2C06 A;  3CPW P;  4C8Q C;  4YTL A;  4EMK B;  1QLY A;  2DX1 A;  2V26 A;  3CC4 Q;  4M77 A;  4LDW A;  2HMA A;  1NYF A;  2AHJ B;  1KHC A;  1JJ2 P;  4J9H A;  5CIU A;  2JT4 A;  2RQT A;  3A5Z B;  2DMO A;  3GP8 A;  5A0D A;  2AK5 A;  3MEA A;  4J7I A;  4J83 A;  4P5N A;  5GAN g;  3S3O A;  1Q82 R;  2VXE A;  1OYX A;  3CMA A;  1U5S A;  3C94 A;  5HY6 A;  2LT1 A;  4PJO B;  4X1V A;  4RCC A;  2LCS A;  1H3Z A;  3MKD A;  1VQN Q;  2X51 A;  4M7A A;  3CEY A;  1H3H A;  2DTO A;  1PKS A;  1WHJ A;  4J6W A;  2RK1 A;  3H6Z A;  2MWP A;  3EG1 A;  4DBQ A;  2DVJ A;  4PLI A;  4XTV A;  2QQR A;  5LJ5 f;  3ME9 A;  2F2W A;  3GPL A;  1WI7 A;  2P84 A;  5FLX E;  2LNH B;  2D0Q B;  1ZSZ A;  5KH6 A;  2VKN A;  4O6J A;  1YP5 A;  5GAO l;  4LD9 K;  4M7A G;  1JBM A;  4V2S A;  5A2Q E;  3MP1 A;  2E3I A;  3CC2 T;  2LNV A;  3BE3 A;  1E6H A;  5CQY A;  3TU4 K;  1VQ8 A;  1X27 A;  1PWT A;  4M7D D;  1ZLM A;  4A4G A;  1JJ2 S;  1HSQ A;  2NUP A;  3QSU A;  4FT2 A;  4C5E A;  3CCV Q;  1UTI A;  3JB9 F;  2FPE A;  1UJ0 A;  2GGR A;  2EVR A;  1MHN A;  2HL5 C;  4F7U B;  3QII A;  5IAY A;  3PMI A;  4WTO B;  4JS5 A;  1YJW A;  2CP5 A;  1XJW B;  3CCQ A;  5D6Y A;  3EGU A;  3LYI A;  5LJ5 j;  1VQ4 A;  4EIK A;  4CC7 A;  2C0I A;  5KYW A;  1JRI A;  5KYY B;  4JZ4 A;  1GBR A;  2EGA A;  4RUG A;  2J05 A;  3AHU A;  3FB9 A;  2DD5 A;  2O4X B;  3RKW A;  4OVA A;  3ZBD A;  1N8R C;  1HD3 A;  1JEG A;  6AT1 B;  1VQ6 A;  1VQ9 T;  2GQI A;  3BW1 A;  4GY5 A;  2YUQ A;  3M4G A;  3CCS T;  2QEX T;  3P8D A;  4RTY A;  4CRI A;  3I55 T;  2O2O A;  1JB0 E;  3PIO A;  4AFQ C;  2RQU A;  2HBP A;  1W4S A;  3NGP A;  2YDL A;  3CC2 Q;  2J6O A;  2GBQ A;  4HKE A;  2KSS A;  3EH1 A;  3A8G B;  1K73 R;  2RD1 A;  3V7C A;  1N9R A;  2RH2 A;  2E1H A;  2X9H A;  2DYI A;  4N4H A;  1RAD B;  2MIO A;  2KT8 A;  1OI1 A;  1PCX A;  1BBZ A;  1WNL A;  1Q7Y R;  2LDM A;  4LDY A;  3OA6 A;  1PC0 A;  3OYI A;  1NPP A;  2SRC A;  2K3Y A;  2A3L A;  3QDR B;  3CBP A;  1OPK A;  1U06 A;  1AZG B;  4KGV B;  1Q86 R;  2DRK A;  2ED0 A;  3M58 A;  2ECZ A;  3VRY A;  4N0A A;  2F1L A;  4M77 B;  1MMD A;  4OB1 B;  5EG2 A;  1ZX6 A;  1SF9 A;  2EBP A;  2K2M A;  1NEB A;  3MPU B;  3CC7 T;  2CZ7 B;  1X69 A;  1C0M A;  4K11 A;  2BKD N;  2DXT A;  1E6G A;  1SEM A;  3CBO A;  3G6E A;  3QPH A;  4HCC A;  3UAT A;  1AHJ B;  1PRL C;  1VQL T;  2DFU A;  4MDX A;  4A4F A;  4C8Q E;  2CUB A;  4M7A B;  3RNJ A;  2FG0 A;  4RTZ A;  5KYX A;  4R56 A;  3SDZ A;  3G4S A;  2O31 A;  4DBF A;  2ZAE A;  3RIR A;  2VB6 A;  1LOJ A;  2P0Q A;  3P8B B;  5GAN 4;  1K9M U;  1OQK A;  3EHR A;  5IXF A;  2ED1 A;  1ZSZ B;  2HKQ B;  1T3S A;  4FL6 A;  1TSF A;  4M75 F;  3JCM b;  3PTA A;  2FZG B;  3M0T A;  3M0U A;  4AG2 C;  1V76 A;  5D6W A;  2EQI A;  3I9Q A;  1LJO A;  2RPN A;  2NUP B;  1LNX A;  4HCB A;  1KC8 C;  2DL3 A;  1FMW A;  3CC7 Q;  2PTK A;  3JB9 J;  1IB8 A;  2JM8 A;  1YIJ T;  2FEI A;  3OSV A;  3CQT A;  3M0R A;  1H92 A;  4GLM A;  4GLK A;  3CD6 T;  1WPY A;  2O9S A;  3QBY A;  1YJN A;  5KYW B;  2XMF A;  1O9S A;  4QQ6 A;  4JJN K;  1N6A A;  4ORZ A;  3KXT A;  3UA6 A;  2RI2 A;  2XI9 A;  2KY9 A;  5LJ3 d;  1S72 Q;  3REB B;  3CC4 A;  1PKT A;  1X2Q A;  5CAI A;  1WQW A;  2E12 A;  4BDY A;  4JJB A;  4KH0 B;  3OYH A;  2K79 A;  3JCM J;  1GXI E;  1D0Z A;  1FMV A;  4LDX A;  2BIV A;  4RTV A;  2DTH A;  3CCM T;  2EGC A;  3CCE T;  1RAE B;  5IXB A;  1AT1 B;  4Y91 A;  2XK0 A;  1I07 A;  1Y71 A;  3FRN A;  4M78 F;  3F70 A;  4PLL A;  3QWY A;  2P0P A;  1PNJ A;  3HSB A;  3EFO A;  1VQN A;  4N0A C;  4HXJ A;  4ZNX A;  2AT1 B;  3OS5 A;  3JCM g;  1TU0 B;  2HZY A;  4OMF B;  3QYH B;  1IHV A;  4B9W A;  1YN8 A;  3JRZ A;  2YRD A;  1N8R R;  2EAY A;  4N4G A;  4M78 E;  2HQH A;  2FRY A;  3DLM A;  3GLX A;  3CCL T;  2LCL A;  1I4K 1;  1IRX A;  1QKX A;  1M4Z A;  2C0O A;  5CKE A;  1JJ2 A;  2KXC A;  2COZ A;  2XKO C;  4JDS A;  2DYB A;  2CT4 A;  5GMK h;  1I8F A;  3NTI A;  5CVI A;  4HVU A;  3P8H A;  2E70 A;  3OBY A;  3QWX X;  5CK9 A;  4RTU A;  2HQE A;  3DLL A;  4BUG A;  2CS7 A;  4PKC C;  3X24 B;  2ZPB B;  4ESR A;  3CCV A;  1UG1 A;  5DLQ E;  4C8Q A;  5CR2 A;  1Y96 A;  3TRE A;  3NMZ C;  3PMT A;  1WX6 A;  1MMG A;  2J06 A;  2CZ1 B;  5KYX B;  4XU3 A;  5GMK m;  2Z0W A;  2DXC A;  2DJQ A;  4WF2 A;  1RAB B;  4KGZ B;  2NUT A;  4CC4 B;  2JUF A;  5GJW B;  1R0C B;  4M7D F;  4JRI A;  1OZ3 A;  5GAN 3;  5CO7 A;  4C8Q G;  3THK A;  2KDS A;  3H0H A;  1NLO C;  2V8K A;  3QG1 A;  5GMK e;  3PIP A;  1C1A A;  1VYU A;  4KUD K;  3BDU A;  1UGS B;  3QUI A;  3TCJ A;  1QP3 A;  1QWF A;  2EYY A;  2MCN A;  2HNI A;  5CKD A;  1VQ7 T;  3CC2 A;  1M2V A;  5CCA A;  2KRO A;  3SB2 A;  1M8V A;  2EJF A;  4A53 A;  2LTO A;  3RDV A;  1K9M C;  3T9N A;  4E2F B;  3CCU T;  1UHF A;  1X43 A;  1M1K U;  7AT1 B;  1VQ5 Q;  4ZN3 A;  3MJX A;  2K3X A;  2BE9 B;  3LGF A;  4MDW A;  4E7J A;  4PJO D;  3WXM B;  5FU7 B;  1MGQ A;  2QAS A;  3H41 A;  3L2W A;  3CCJ T;  2KT1 A;  2VGN A;  4OF1 A;  1B7T A;  4FYV B;  5LJ5 e;  2FVU A;  2OTL Q;  3PVL A;  3URG A;  4PJL A;  1FXX A;  2W10 A;  3HKS A;  5IHK A;  4X9C A;  3BFM A;  3HFN A;  1VQP Q;  2V8J A;  2DXB A;  2HD0 A;  1KC8 R;  1VQ9 A;  3OYB A;  2COW A;  2EQU A;  2PVO B;  2PNI A;  4DOW A;  1OV3 A;  3I55 A;  2DBM A;  4B9X A;  4Z89 A;  1FX7 A;  2E64 A;  2GTO A;  1NEG A;  4KRT A;  3EFO B;  5D7U A;  2JOY A;  2L5Q A;  4ANJ A;  2LQW A;  3M0P A;  1E7O A;  2XD0 A;  5IN1 A;  4M78 A;  3QZ9 B;  1ZA2 B;  2OTJ Q;  2RO0 A;  1TS9 A;  1NPR A;  1QCF A;  2HL3 A;  3OYY A;  1UHC A;  2CP6 A;  3VJP A;  4LXC A;  1U8R A;  1YWP A;  1QQJ A;  3SFM A;  1TOV A;  3IQL A;  1K76 A;  5C0M A;  3PT9 A;  2E4H A;  1YHQ T;  2DE0 X;  3EG9 B;  3OYF A;  3LW5 E;  2GQV A;  3LLR A;  1KQ2 A;  1QVP A;  4XAX B;  1QMC A;  4F14 A;  4D8D A;  3CME T;  4QVD A;  5LJ3 h;  2DRM A;  4C5H A;  2E6N A;  4C8Q B;  3D7S B;  3CC7 A;  1Y96 B;  1UGR B;  1WFW A;  4FSX A;  3WVE B;  4B6M A;  2CDT A;  2F5T X;  2JTM A;  5IHN A;  2COY A;  1M30 A;  1KD1 C;  3EG0 A;  1NYG A;  4WCI A;  4M4Z A;  3M59 A;  2NUT B;  2EJG A;  1RAA B;  1VQL A;  3TVT A;  3KUF A;  3G1J A;  4Z02 A;  4C5I A;  2A7Y A;  2KQW A;  2J6F A;  4M77 G;  2QA4 T;  1K8A C;  2P4T A;  3O8V A;  3JCM Q;  2RB6 A;  2RHY A;  2DJZ A;  3NHN A;  1S72 A;  3S3N A;  2ABL A;  1S1N A;  2QTX A;  4E7I A;  2W0Z A;  3CCR T;  1TUG B;  3G7Z A;  5GMK j;  1YBY A;  4C0D C;  3OW2 P;  3E19 A;  4M75 C;  2BZ8 A;  3QZ5 B;  5LJ3 e;  1M1F A;  2DIQ A;  1EZZ B;  5FRM A;  5GAM g;  2RJE A;  1JXM A;  4M77 D;  1M2V B;  2H3E B;  4PFZ A;  2E65 A;  5CKH A;  2KRM A;  2DO3 A;  4F04 B;  1GBQ A;  5LL6 S;  5KCO A;  3TSW A;  1TUC A;  2XID A;  2EQK A;  1M2O A;  1CKB A;  4XU1 A;  2F2X A;  2M9U A;  2YRC A;  3S3M A;  1JQQ A;  1W1F A;  4E7H A;  3CD6 A;  1PM3 A;  2XU8 A;  4M7A D;  1QKW A;  4C0G A;  1YJ9 T;  3OYA A;  2DIG A;  3I5R A;  3JCM V;  3GIB A;  4NOY A;  3RKY A;  2VV5 A;  1G3Y A;  4JZ3 A;  4QVZ A;  1AEY A;  2DIL A;  2HBW A;  3KFV A;  1NG2 A;  3VYH B;  4D6W A;  2I2L A;  2KK4 A;  3CCR Q;  4J7F A;  2QTV A;  1CKA A;  1KQS A;  2CRE A;  4ZGE B;  1M1K C;  3EGX B;  3OW2 S;  3VS3 A;  2K5L A;  4KBM B;  1K9M R;  1KQ1 A;  4LE9 A;  1OX8 A;  3G71 T;  1PSE A;  4FW2 A;  3QKJ A;  1EX4 A;  4XU2 A;  1YIT T;  2RA2 A;  4E7K A;  4M78 C;  4C92 F;  1LCK A;  4LDU A;  3VYG A;  3CCE A;  1VQM T;  4KT0 E;  5I2M A;  2A37 A;  4OML A;  3VS4 A;  3WVD B;  5J26 A;  1U3O A;  1PRM C;  4IUV A;  4RG8 A;  4ZTJ A;  1KFZ A;  5GAN 6;  2H8H A;  5HKC A;  3OY9 A;  4FYW B;  1SRM A;  3PE0 A;  2JN0 A;  4C92 E;  2EKH A;  4E7Z A;  1W2B S;  1KK7 A;  3E9F A;  2RK2 A;  1KIK A;  2VVK A;  4KGX B;  4LUE A;  3FJP A;  2KMT A;  3E1S A;  2CZ0 B;  2RJF A;  2LC4 A;  2H3J A;  2QQ9 A;  3A1P A;  3M54 A;  3Q1J A;  2WSC E;  2L8D A;  1Q81 C;  2V1Q A;  1WHK A;  2MPX C;  5GMK i;  1EFN A;  2YRV A;  1N27 A;  2KRS A;  2ZPG B;  1TG0 A;  5LJ3 f;  3LWI A;  2HSE B;  2LJ3 A;  4A4H A;  1T0J A;  1WA7 A;  5M9O A;  2I0N A;  1HK9 A;  2IG0 A;  3A8L B;  4OMN A;  1VQ9 Q;  4FW1 A;  3CCS Q;  2QEX Q;  1VQ5 A;  4C5G A;  3UT1 A;  5A0L A;  3I55 Q;  1AWJ A;  1GCQ A;  2FL7 A;  2J6K A;  4MMK A;  3ULR B;  1YCS B;  3SWN A;  4M7D C;  4IUP A;  3OMC A;  2VUB A;  2KE9 A;  5ECA A;  5KE2 A;  2GFU A;  5A0G A;  2JW4 A;  2E5K A;  2XG8 D;  1UDL A;  2OTL A;  1GFC A;  1MMA A;  1RI9 A;  3VRZ A;  4AG1 C;  2DLP A;  3JCM d;  4BE2 A;  5I22 A;  1UEB A;  1C6V X;  1I5O B;  1J3T A;  3OB9 A;  3E9G A;  1BK2 A;  3M9Q A;  1VQP A;  3CMA T;  4OB0 B;  5I11 A;  5LJ3 j;  4PJO F;  2VC8 A;  5FRN A;  4OP0 A;  8ATC B;  2VWF A;  1BIA A;  1KD1 R;  2K5F A;  1MV0 B;  3M0S A;  3L2V A;  3QO3 A;  2KYB A;  4C0F A;  2K2V A;  2RF0 A;  4JJC A;  1NJI U;  3OS0 A;  4RTX A;  2NLU A;  2BTT A;  1AVZ C;  4J9E A;  1K8A R;  2JMA A;  1Z9Z A;  2QGF B;  2EJ9 A;  2RHZ A;  1ZUY A;  4M75 E;  1YI2 T;  1K73 U;  2OTJ A;  1SPK A;  2KR3 A;  2PVG B;  3PVQ A;  2X4Y A;  2L0A A;  1RAC B;  3X20 B;  1BYM A;  1VQL Q;  1D0X A;  2PZ1 A;  2QDY B;  1VQ8 T;  1BI1 A;  2XDP A;  2P4R A;  3DB3 A;  3JV3 A;  4DBR A;  4LDV A;  1KSW A;  2KRN A;  2M0Y A;  4BI3 A;  2X35 A;  1DJ7 B;  2LQ8 A;  1RLQ C;  4OB3 B;  4X9D A;  4LUD A;  4F7U F;  1Q86 U;  5HCK A;  5KYU A;  1JO8 A;  2LMJ A;  2FHD A;  5LJ5 g;  4IUR A;  2VAS A;  1G5V A;  3DB4 A;  1YJW T;  1BIB A;  2YLC A;  1VYT A;  2ESW A;  5CKB A;  2AKK A;  2RI3 A;  2DET A;  3CCQ T;  2WSF E;  3JB9 G;  4A4E A;  4Q5W A;  1VQ4 T;  1JU5 C;  1K9A A;  3KBG A;  5J39 A;  4J9D A;  2WAC A;  1XOV A;  1OZ2 A;  1KQS P;  3MP8 A;  1GFD A;  2R5M A;  1F1B B;  3VS2 A;  2CT3 A;  2Y90 A;  2DL4 A;  1WQ7 A;  4O5V A;  2AIR B;  2D8J A;  2RI5 A;  3QHS A;  1VQ6 T;  2HSP A;  5GAN 2;  1WXB A;  1IRE B;  3L2U A;  2LP5 A;  1PHT A;  3VS6 A;  3JB9 D;  1YIJ Q;  1KHI A;  2A36 A;  1MV3 A;  1B34 A;  2PQW A;  3CD6 Q;  1WYX A;  1ARK A;  5GAN f;  1M1K R;  2BE7 D;  3EH2 A;  2YLB A;  3M55 A;  3EHQ A;  2EFI A;  1YHQ A;  2WSE E;  1WHL A;  3C0C A;  3OQ5 A;  3AT1 B;  3UDC A;  1VQK T;  3LH0 A;  2PUO B;  3ASK A;  4PNO A;  3CME A;  1UGV A;  1GCQ C;  4PJM A;  2YUO A;  2DD4 A;  3UF4 A;  3VU3 C;  3SWN C;  4QVC A;  1VQO T;  1PD0 A;  1UB4 A;  1X2K A;  3S6W A;  3FLG A;  3L2Z A;  3TQ7 P;  4M77 F;  4RTT A;  2K6D A;  3FIF A;  4D8K A;  2QQS A;  4EMG A;  3CCM Q;  2M02 A;  3CCE Q;  1T3L A;  2EQJ A;  8AT1 B;  3PNW C;  4HVW A;  4J9F A;  5FW9 A;  4BAC A;  1AZE A;  1KQS S;  2DNU A;  5KCH A;  3OW2 A;  2R58 A;  4BE1 A;  1RAH B;  5GAN j;  1HJD A;  3I56 T;  2ZPE B;  1ZHI A;  4Z88 A;  1Q81 R;  3OSS C;  1GRI A;  3G6E T;  3GBQ A;  3A8M B;  4E47 A;  3CCR A;  1RLP C;  2LJ1 A;  4ME7 A;  1IZ6 A;  2KVQ G;  1OX9 A;  4M7A F;  1NZ9 A;  2RJD A;  3DKM A;  3OYL A;  1VIF A;  3CCL Q;  2NUZ A;  1ACM B;  2CP3 A;  2DVE A;  2GF7 A;  2PUK B;  4R0K A;  4M7D E;  3JSC A;  3FC3 A;  2EW3 A;  1Q95 G;  1W2B A;  4C8Q D;  1X01 A;  4J5Y A;  2A28 A;  2JZ2 A;  2DBK A;  5GMK l;  2D0N A;  4M75 A;  5I21 A;  2FRW A;  2EYQ A;  2EGE A;  2QAZ A;  3ZL7 C;  3REA B;  4EMH A;  1RAI B;  4AT1 B;  1TWB A;  1O75 A;  2YT6 A;  1RUW A;  2QDL A;  3TSZ A;  1M1G A;  2EYX A;  2K57 A;  4L5G A;  5GAN d;  1W6X A;  1OOT A;  1YJ9 A;  4RG2 A;  1AD5 A;  2DTI A;  4M75 G;  4Z8A A;  3OYG A;  2E6Z A;  1VUB A;  1KG1 A;  1XQH A;  2E3H A;  2HKN A;  2IVW A;  2CP7 A;  3TEE A;  2RQV A;  2VXF A;  3I56 Q;  1N8R U;  5KYU B;  2ZPH B;  1NJI C;  3OYN A;  1EIF A;  4ZGJ B;  3OS1 A;  2F2V A;  4FCY A;  2X4W A;  3L42 A;  1B3Q A;  3C12 A;  4BY6 C;  2RHI A;  2F5K A;  3JCM h;  3H9N A;  1R77 A;  4C92 C;  5GAM d;  3G71 A;  5FU6 C;  3CCS A;  2DKG A;  2QEX A;  1M3B A;  2DXU A;  2XHC A;  1ZUU A;  4JPB W;  1I5L A;  4BY6 B;  3C95 A;  3VS1 A;  1ZSG A;  3M5A A;  2JNG A;  2JS2 A;  4XTZ A;  2B86 A;  1BU1 A;  1VQ7 Q;  3I35 A;  5D6X A;  5AYF A;  4OMO A;  2DZ9 A;  4BI8 B;  2MYS A;  3EAE A;  1M90 U;  2G3R A;  3PFS A;  2YUP A;  4FIB A;  2DK3 A;  3OYK A;  1X6O A;  1GL5 A;  3X26 B;  4A4K A;  4L59 A;  3CCU Q;  1B34 B;  4MZM A;  2O9V A;  1M3A A;  1VYV A;  2XDB A;  1G3T A;  2RMO A;  3MEV A;  2KXD A;  4J9G A;  1K4U S;  3HHT B;  3JCM P;  2Y4X A;  3O5Z A;  2L3R A;  4PL6 A;  1WHM A;  4QKU A;  3JCM e;  1YWO A;  3CCJ Q;  3HPW A;  1G3W A;  4CC2 A;  4DEY A;  1VQN T;  4M78 G;  1I1J A;  1AWW A;  1IXD A;  2OAU A;  4BD3 A;  4J6Y A;  5GJV B;  5DM7 R;  1RL2 A;  1I0C A;  1QVG S;  3L2Q A;  1U1S A;  3OYJ A;  3M4Y A;  3RR6 A;  4EMK C;  3VS0 A;  4IUT A;  4J9I A;  3R6N A;  1UUE A;  2MWO A;  2BZY A;  2MMP A;  4PK4 A;  3LH5 A;  1WXT A;  1D1B A;  1VA7 A;  4N4I A;  2FB7 A;  2AKL A;  4NS5 A;  1YFN A; 
#chains in the Genus database with same CATH homology
 1TWB A;  1ZSZ B;  2QAS A;  1OU9 A;  2QAZ A;  1ZSZ A;  1OX8 A;  2NYS A;  1YFN A;  1OU8 A;  1OX9 A;  1OUL A;  1ZSZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...