3CC2Q

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cc2Q00
1YJ9Q 3CD6Q 3CXCP 3CMEQ 1YHQQ 1VQMQ 3I56Q 1KQSP 2OTLQ 2QEXQ 3CCQQ 1VQPQ 3CC4Q 3CCJQ 3G71Q 3CCSQ 1YJWQ 3G6EQ 1S72Q 1VQKQ 1K8AR 1K9MR 1Q81R 1JJ2P 1VQ8Q 3G4SQ 1YJNQ 1K73R 1YITQ 3CCRQ 3CMAQ 1N8RR 1NJIR 3OW2P 1VQ7Q 3CC7Q 1VQ6Q 1VQNQ 1M90R 1VQ5Q 1QVFP 3I55Q 3CPWP 2QA4Q 3CCLQ 2OTJQ 3CCVQ 3CCMQ 1VQOQ 3CCEQ 1Q86R 1QVGP 1M1KR 1Q82R 1VQ9Q 1YIJQ 1Q7YR 1VQLQ 3CCUQ 1KC8R 1VQ4Q 1W2BP 1YI2Q 3CC2Q 1KD1R
chains in the Genus database with same CATH superfamily
5A0DA 5GAN8 4GLMA 1TUDA 4E6RA 3QO3A 4DEYA 2VUBA 1Q86U 4J9FA 1PD0A 4AG2C 5GANh 3L2ZA 2CH4A 4C92A 2GBQA 4O6JA 1AWXA 2X35A 4XTWA 1YHQT 2CP2A 4GY5A 1AVZC 3E1SA 4RTUA 2K5FA 1ZLMA 5IXBA 1RI9A 1VQMA 2JJ9A 2A7YA 1W6XA 1BKBA 2LX9A 1YJNA 4C8QD 3V7CA 4BD3A 1YWOA 2L89A 2PUOB 1WQWA 1EZZB 1TG0A 1KHCA 1D1BA 3CMAQ 3UWNA 1VQPT 3FJPA 2YUNA 4FSXA 1QVFP 1QKWA 2HL3A 3MEAA 4M75D 2DL8A 4OB3B 2RHYA 1BBZA 3JAME 2RD1A 3GP8A 3L1AA 3RMQA 1H641 2DK3A 4AFUC 2VASA 1MUZA 3UATA 1JJ2S 2BIVA 3C95A 3JCMc 3AHUA 2MI6A 4CC3A 2DXCA 2A3LA 1TWBA 1M90R 3ZEHA 3OS2A 3G7ZA 3EGDB 1X01A 3CCMQ 3CCEQ 3J80E 1K73U 3BY7A 5LJ3j 3QZ9B 4NL2A 3PVLA 2DILA 2HEQA 2RI5A 1Q82C 5CR2A 4PJNA 4JRPA 3JB9J 2W0ZA 1X27A 4X9CA 3FLGA 4C5GA 1BCOA 4C5IA 1K8AR 2ZPBB 4EIKA 1PD1A 1UJYA 1U8RA 1OI1A 1X6GA 4M7AF 1WZOA 1AWOA 1TTHB 2LNVA 2X4YA 5GANe 5DM7R 2DEUA 5GMKl 2KR3A 3LH5A 2KSSA 2V8JA 5CIUA 3D7SB 4J6YA 2GNCA 4J9IA 1M1KU 2LT4A 4YTLA 4M7DE 4M75C 2DPPB 4BE2A 2DMOA 4OB2B 3I5RA 3G1JA 2WACA 2H8HA 1VQMT 1WQ7A 1G3YA 3CC2A 3ASKA 1SSHA 1IGUA 1YJNT 5GJWB 4D8KA 4M75B 1H92A 2EJGA 4WCIA 4A4HA 4X34A 4B9WA 5HCKA 4OP0A 2COZA 1ZQ1A 1FXXA 1R0CB 5GAN6 4ZN3A 1V1CA 3UA7A 3OSVA 1XJWB 2JW4A 1VIFA 2KNBB 3OW2S 2ENMA 1WFWA 2IPOB 2QDLA 1VQ5Q 4AG1C 1AHJB 4KRTA 2F2VA 4JJDA 1MNEA 2DL3A 2HNIA 3MP1A 4FW2A 2HD0A 2CP7A 1T3SA 2HQEA 1ARKA 2KXDA 1S72Q 5A0LA 1FMKA 2EYXA 1WYXA 1UE9A 3VU3C 2OTLA 1BI2A 1JRIA 1W2BA 2HL5C 2MMPA 4XAXB 2LJ0A 5I21A 1WHJA 1NLOC 2AKKA 4A53A 4C92E 1GFCA 2QA4A 3LGLA 3BDLA 1X69A 2LTOA 1SEMA 2NUPB 3M53A 4ESRA 4F7UB 4ZN1A 2E4HA 1Y57A 1ZUKA 3SWNC 1PCXA 1YP5A 3I5SA 1VQKA 1SSFA 2DO3A 2OX7A 2EQMA 3HFNA 3SWNB 2K4YA 4PKCC 4J9HA 5FLXE 3PE0A 4E7LA 2PVDB 5GAN2 1Y0MA 3DLMA 1VUBA 1YCYA 4OMLA 2RHZA 4JRKA 4EMKC 1TUCA 4LDWA 3EG0A 1M90U 2RHIA 3JCMX 3DLLA 3EFOB 1BB9A 2IIMA 2DIQA 5M9OA 4EMKB 2CYZB 5HK3A 2NUPA 3NMZC 1K8AU 2DTOA 2RI2A 3HRSA 3ULRB 2HBWA 2D6FA 1G5VA 3KBGA 2K3XA 3P8DA 2F5TX 1MNDA 2IG0A 1LPLA 3LX7A 3JB9G 1IGQA 3EG9A 1VQ6Q 5HY6A 2ZAEA 2DL5A 1XQHA 4ELZC 3JB9H 1KG1A 4L59A 2EJFA 4AFQC 3EAEA 5KH6A 5KYUB 2BUDA 4N4GA 1AWJA 2M0YA 1M2OA 4J9EA 2COYA 3CCUA 3EFOA 1ZA1B 1Z9QA 5IT9E 1VA7A 1SHFA 2CSIA 2E10A 4EMKA 2NUZA 1VQKT 2E6ZA 1YITT 3G71A 4KUDK 2YUOA 3A8GB 1JQQA 1VQ8A 2EQKA 4X1VA 2V8KA 3MCAB 3CCRA 4XQ3A 3V8JA 2EYYA 4IUVA 3THKA 5AT1B 2E5QA 5EC7A 2L3RA 2ECZA 2G3RA 3C4SA 3M4GA 5GMKi 1MMDA 2A36A 1RI0A 4C0FA 3AT1B 2EKOA 2A0FB 3S3OA 4BE0A 2JN0A 4E7SA 3EHRA 1XTDA 4J9GA 3VS0A 2FZKB 4M7DD 5LJ3d 1NBEB 3E9GA 2DTHA 2DKGA 5GMKh 2FPFA 4B9XA 1BU1A 3OBYA 4RG2A 4KH0B 2GTOA 1Q81C 2L3PA 1K8AC 2QQSA 4N0AC 4BB7A 5I11A 1W4SA 2M1HA 1CKAA 2AKLA 2ZPHB 3OMCA 1TXQA 3CEYA 1OULA 5CQXA 3UDCA 1UGSB 2M16A 1VQLA 1VQ9A 1LVKA 1JBMA 2PTKA 2ABLA 2DL7A 1PKSA 4BACA 5GMKj 1QP2A 4LN2A 3RKWA 3E2UA 3NTHA 2C06A 2FRYA 2LZ6B 4Z02A 5IXFA 3OY9A 1IHVA 4FIBA 5AYFA 5FRNA 2RM4A 4RMOA 2CREA 2VC8A 4GBQA 4RTZA 1WJQA 3OYKA 1SPKA 2EYWA 2K5IA 1JEGA 2DFUA 4M75F 3M0TA 3PTAA 4UC4A 3JV3A 4M7DC 4J7FA 3MEVA 1VQ8T 3CCRT 3RIRA 2P0KA 1QWEA 3BW1A 1UG1A 2L8DA 4QW2A 2K2VA 1TH7A 5LJ5g 4C92D 2XU8A 4FYWB 3ZBDA 2DA9A 2KI7A 4MMLA 1WHLA 3BDUA 4M7DB 1M27C 4N0AA 4OF1A 4M7DG 1FWZA 1VQNQ 4QT7A 4MDWA 3OYYA 4BI8B 8AT1B 3G6EA 1B34B 3R6NA 2CP3A 3MP6A 3VUZA 4KGVB 3CC4Q 2AZSA 3M59A 4PFOA 1WJRA 1GCQC 3L2VA 1QCOA 3HTRA 4J6WA 2EKHA 2RJEA 4PLLA 2WSEE 3A1PA 3S6WA 1GRIA 3E9FA 1B07A 3M9QA 1YJ9Q 2HAXA 4F7UF 1VQ9T 2QEXQ 1I81A 2AZVA 2O4XA 5CKEA 4XTZA 5HK0A 1GBRA 4LXCA 2PU9B 5CVIA 2Y90A 4C92C 4ZTJA 4Q5WA 1BI0A 4DOWA 1PSFA 4JZ4A 4R56A 2BTTA 3I56A 5D7UA 3HP9A 1NE8A 1V29B 3CMAT 4XU1A 4IKFA 2ATCB 4RTVA 2MOXA 2DYIA 3UF4A 1M4ZA 4FYXB 1B34A 3RESA 1EX4A 4C92B 5LJ5f 1PC0A 1HSQA 3PNWC 1ABOA 3X24B 3LH0A 4ORZA 1AEYA 5GAMh 4JJCA 1OU8A 2CH4W 5GAOp 2OTJQ 2RQVA 2OAWA 3TU4K 4EMGA 1S72A 4MMKA 1Z9ZA 3NHNA 2LX7A 3BE3A 3JCMJ 2F2WA 1KD1C 2J7IA 4BY6C 3RDVA 2RF0A 2V1QA 2BZYA 2HQHA 4RTYA 3OYMA 2ESWA 1I1JA 1BIAA 1C6VX 2OI3A 2X9HA 4BY6B 4M78G 3CCVQ 3JB9F 3QDFA 4HVVA 1N9RA 1QP3A 3M56A 3MP8A 4A4FA 2O01E 1M3CA 2HSEB 2LT1A 5GJVB 4J5YA 5D6YA 3F70A 2D8HA 1D1CA 5CAIA 2XDBA 1RAHB 3ME9A 1PM3A 2Y4YA 2RPNA 3GNGA 1H3ZA 2EYZA 1YN8A 3GIBA 3RBBB 3DB3A 2K3YA 3CPWS 4IUTA 4J7IA 4PLIA 2OJ2A 3HRUA 2EWNA 5I2SA 3INZA 2W10A 4ZGDB 2L2PA 1UDLA 2QYZA 1KC8C 1W2BP 4M77G 3VYGA 5A0GA 1VQ4Q 4ME7A 5GANg 1M30A 4JDSA 3OYCA 1NLPC 1K1ZA 4PJMA 4MZTA 2DE0X 2QG9B 8ATCB 3QG1A 1UJ0A 2RI3A 3I56T 4HCZA 2JT4A 5LJ3h 4M78A 4LD6A 4RUGA 1D0ZA 2VXEA 3OYAA 2DBMA 4KUIA 2RMOA 2FO0A 2WSCE 2DF6A 2B86A 2JOYA 4XU0A 3C12A 3L2RA 2J6OA 2QASA 2CGHA 2BE9B 1YNZA 1VOMA 3H0HA 1S72T 2DAQA 2RHXA 4Z89A 4K11A 4D8DA 3L2UA 4M77A 2HKQB 2YRCA 4HT9A 1ACMB 5D6XA 4BI3A 2RK1A 3GNFB 1WX6A 4D6WA 3OS5A 3O5ZA 3M57A 3OW2A 1Q81R 3G4SQ 3CC7Q 1BIBA 5CO7A 2EGCA 2MCNA 3CBOA 3MEWA 4LDUA 3CD6A 2KBTA 3JB9I 2QTXA 2KRNA 2MF2A 1Q7YR 5C0MA 2JUFA 1N6AA 2X3WD 3VYHB 2RQWA 4BDZA 2P84A 1KQSA 5ECAA 4ZGEB 2XK0A 1X2QA 1UB4A 2ED0A 2HMAA 5GANf 4C0DC 2P0QA 2FPDA 1RAIB 3X20B 5IH2A 4OGEA 2JZ2A 2MPXC 1YI2A 2MIOA 3QWYA 2CP0A 4KGXB 2R5MA 2EFIA 1YJWA 3IQLA 1PNJA 4C0DB 2RQUA 1YHQQ 2MYSA 4FT4A 3TCJA 3WXMB 3FB9A 1SKUB 1ZBJA 1IRXA 3M0SA 5LJ3e 5C6SA 2QQRA 1U1SA 4L5GA 5IN1A 2M51A 2IVWA 5KCOA 2VKNA 3VRYA 2ED1A 3REAB 2FRWA 3VUBA 4M7DF 2JMAA 3A8LB 3DKMA 3FRNA 3M58A 3WVDB 2RJDA 1VQPQ 1BK2A 1IREB 1Y07A 2PNIA 2GQIA 4A63B 2RQRA 1YFNA 2LQ8A 4MZPA 1VQ7Q 5GAN5 5FROA 1GL5A 3NFCA 1TS9A 3QHSA 1VQ6T 4KBMB 4DOVA 4JUVA 1X75C 3JB9D 2HQXA 1X6OA 3CPFA 1WHGA 3CCQQ 3SFMA 5KE3A 5J26A 3CD6T 1WXBA 2X4WA 4PJOA 2DNUA 4LNPA 3QWXX 3VS2A 4F17A 1FMWA 1I4K1 3PT9A 1WA7A 1OQKA 1SHGA 4P5NA 4CC7A 4JRQA 3UPUA 2FZGB 3TSZA 1ZBXA 1YITA 1CKBA 3A8HB 3M5AA 3I55A 4JRIA 3OYBA 2E70A 1YI2T 3HL8A 4OMPA 1XOVA 3EG9B 1K9MC 3FEOA 2V26A 4M78E 2PUKB 1M2VA 4C5EA 2CT3A 4N4HA 4E47A 1YJWT 3VRZA 5CKFA 1R77A 5L8RE 4C92F 2XDDA 2AHJB 1N9SA 2JMCA 2AT1B 4Z88A 1UGQB 4LDYA 1VQMQ 4C5HA 1MHNA 3CCJQ 1LCKA 2O88A 1TSFA 1QVPA 1SRLA 1VYTA 1F1BB 1BYMA 4M77E 1Q81U 3TQ7P 3EFRA 2XKOC 4L6V5 1KD1R 2YT6A 5I2MA 4OVAA 1MV0B 4A54A 1KSWA 5GAMd 1Q7YU 2PVOB 4V2SA 2R58A 6AT1B 1EIFA 1NEGA 2PZ1A 4Y92A 2F2XA 1G83A 1QVFS 3EG3A 2QEXA 2VB6A 1A0NB 1OOTA 1HXDA 5FRMA 2LCSA 5KYNA 3KUFA 9ATCB 2ZPFB 3EFSA 2CUDA 3OYLA 2DTIA 1U5SA 2KDSA 3LLRA 2LNHB 2E12A 4JS4A 3EH1A 3A98A 1JXOA 3M54A 2YLBA 3HRTA 4MDXA 2DM1A 2ROTA 2A37A 4HVUA 3CCLQ 2CT4A 1E6GA 2C0TA 3PGGA 3OQ5A 3V8LA 1KC8R 2ZPIB 3UA6A 3I55T 2VV5A 2K6DA 3REBB 2DZCA 4AMCA 4WF2A 2K2MA 4C0GA 1R8OB 4XU2A 2KYBA 4XTXA 3OYIA 2H3JA 1K9AA 3OYGA 1M3AA 1VQNT 1G8XA 3QBYA 3CC2Q 2AK5A 1AD5A 3LWHA 2KT1A 7AT1B 2K5LA 2DEQA 1LOJA 1WHHA 2EQJA 4QQGA 2Y4XA 1RADB 3CC4T 4HCBA 2LDMA 1M5Q1 1GCPA 5D6WA 1R0BG 2EW3A 1NG2A 3OS1A 2DJQA 1Q7YC 1TU0B 3MHXA 3CXCA 4N4IA 5FU7C 2NYSA 4ZGJB 2YHTA 2LQKA 1GFDA 2RNAA 3PVQA 4PJOE 1YJ9T 1WHKA 2JM8A 4ZTFA 3EH2A 1SRMA 1NPPA 5IHKA 2QEXT 3QZ5B 2JTMA 1HK9A 5KYXA 3QDRB 1E6HA 4KULA 5FU7B 2D1XA 3RERA 3ER0A 2K7AA 1IO6A 1H8KA 3A5ZB 3H6ZA 1WHMA 4JJNK 3CMAA 2KY9A 2OTLQ 2I2LA 2LJ1A 1G2BA 4XTUA 2CUBA 2KXCA 2WSFE 1K0XA 3ZFJA 3GF5A 2X4XA 4JJBA 1QQJA 1WI7A 2QA4Q 1KIKA 3MEUA 1VQOQ 2DJZA 3JSCA 3SD4A 3HSBA 1RABB 2O4XB 5FU6C 2KQWA 3WVEB 2MWOA 1OX9A 1KD1U 3J81E 3CCEA 3CCMA 1VQKQ 3QPHA 1MMAA 2RK2A 1BI1A 1N8RC 1OEBA 3MKDA 1RLQC 1QVGA 1M8VA 1UGPB 3H0IA 4Z8AA 5FU6B 1PG5B 5CQYA 3CC7A 2E5KA 5GMKe 2DETA 2EIFA 1BI3A 4JLGA 4GLKA 4FL6A 4IIMA 1I5LA 1RAAB 1OX8A 4M78D 4J9CA 2O9SA 5LJ5j 2VGMA 3VKIA 4R55A 1G3TA 2JTFA 4EPCA 4PFPA 1U1TA 2DD4A 2LP5A 3CMEQ 1KK7A 4DQ2A 3M0PA 1KC8U 3R6OA 4II1A 1D3BA 2GFAA 2KVQG 3QXEB 3OW2P 4M77D 1OV3A 2XD0A 1MV3A 1VIEA 2KRSA 2GCXA 4AFZC 4LDXA 1PKTA 2EQUA 5GAN3 2V8IA 5GAOm 1KQ2A 1OYXA 4NS5A 1KQSP 3X25B 1VQ5A 2RA2A 3QIIA 1WPYA 2YUPA 3CCSQ 4RKUE 2K9GA 1K9MR 2XHCA 2YXYA 4HA8A 3CPWA 5CCAA 1ABQA 1Y96A 3NTKA 1AZGB 3LGFA 3CCUQ 1I8FA 3CBMA 4M78C 3PMIA 2NUTA 2Z0WA 3UT1A 3CCMT 4LUEA 3CCET 3G71Q 2E64A 2KT8A 3LYIA 1WLPB 1X2KA 5GAMg 5KYYB 1VQ8Q 2COWA 3CCRQ 5KCHA 4M78B 1UTIA 2DZ9A 4ZNXA 2M02A 3CCQA 3CC7T 2DERA 1YIJQ 4HT8A 1I0CA 2EPDA 2L3SA 4IUQA 2GQVA 4QKUA 4VUBA 2HCKA 4M77C 3S3MA 2H3EB 3SDZA 2KMTA 4XTYA 4NOYA 1HJDA 5GAOq 1JJ2A 4BE1A 4FYVB 2E3HA 3M55A 5CKDA 3JRZA 1QMCA 1MGQA 1WXTA 4XU3A 1JB0E 2RO0A 3T9NA 4M77B 1Y7XA 4HXJA 3A8OB 5I22A 4E7HA 2GGRA 3H41A 2LCCA 4OMFB 2GF7A 1RUWA 2HSPA 3VV0A 4NL3A 1KQ1A 1WJSA 2R57A 5KYYA 2DXTA 2VXFA 2PVGB 4KGZB 3CCJA 1VQLQ 1VQ9Q 1E7OA 2RJFA 2FL7A 1VQ5T 4FW1A 2CZ7B 4IURA 2V1RA 2X51A 4C0ZA 4PJOD 2MAMA 1O75A 3JCMP 3VS1A 1UHCA 2P0PA 5GAMe 5LJ3g 2R5AA 5GANj 1RL2A 1T0JA 3QSUA 2CSQA 4KH1B 5GAMf 3LWIA 1VQ7T 1B7TA 3EG2A 4DBFA 1W70A 2K3BA 3PIPA 3M0RA 5CK9A 4M7AE 1ZSZC 1JU5C 1VQ6A 1QW1A 3RMSA 2X3XD 4QQ6A 1O9SA 3OA6A 2JS2A 2CZ6B 1PSEA 2LRQA 2LJ3A 3CCQT 4HCKA 3META 2X4JA 4RCCA 1ZSZB 3I9QA 2BZXA 3OBWA 4EDUA 1N27A 3MJXA 4CC4B 2EGAA 1MMGA 2DRMA 3H0FA 2EJ9A 3CCLA 1UFFA 1G3SA 4WTOB 3G6EQ 4C8QC 3OYFA 4J6XA 1NYGA 4O5VA 4PJOC 1KJWA 1K9MU 4AT1B 4QVDA 5GAOn 4M4ZA 2CKKA 1Q86C 3DB4A 1X43A 4XTVA 2D0NA 1NM7A 4J8OA 1IB8A 1NYFA 2HKNA 4C8QB 3OSSC 1TOVA 5DY9A 2FEIA 4PJOB 5GAN4 4C8QG 1AT1B 2XDPA 1QCFA 1RACB 3CCJT 2RHUA 4PJOG 2GFUA 3QJYA 5LJ3f 3A8MB 4OB0B 3EGDA 2DXBA 2ZZDA 3JCMd 1ZSZA 4PJJA 3P8BB 3TVTA 4M75G 3I56Q 1Y71A 4QQDA 1WDXA 3QYGB 2YDLA 1QWFA 2I0NA 4RTWA 1NZ9A 1KHIA 1M2VB 2YRDA 2KGTA 4HVWA 1N8RR 2VGNA 3RUXA 3JCMW 2FVUA 1M1FA 2ZPGB 4IIOA 4JZ3A 5LJ5d 3E19A 4JLIA 1HYOA 1K0SA 1J3TA 1LJOA 2ZCFB 1IZ6A 5GMKm 1LNXA 2KROA 1KQSS 2EVRA 2CZ0B 4C8QA 1QCNA 1NJIR 1K73C 2BZ8A 3RKYA 3Q1JA 1U06A 2RH2A 2AIRB 1V76A 3V7SA 2JVVA 2YLCA 3VS5A 2D8JA 4A4EA 3OYNA 4ELYC 4M75A 3CCLT 3OYEA 3CXCP 2ZGWA 3OYJA 1VQOA 1WNLA 3HKSA 5J39A 3TREA 1YWPA 1QVFA 3RNJA 2QXFA 3H9NA 2A08A 4PFZA 3PFSA 4F7UG 2RB6A 2CZ1B 2KEAA 2C0OA 2YSQA 1M1KC 1AZEA 1M8MA 4J9BA 2VYTA 1M9SA 1VQNA 4DEXA 3CC2T 3O8VA 2KK4A 1YJNQ 3VJPA 1YBYA 3ZL7C 1KFZA 2XMFA 1WXUA 1ZSGA 1UEBA 3CC4A 3LW5E 3OYHA 1YCSB 3EGXB 1W2BS 1UHFA 1TUGB 2DVJA 4ATOA 2J05A 2CP5A 1WIEA 2QDYB 5GAN7 4M78F 2J6FA 3GBQA 3QJ6A 1I5OB 3H8ZA 1ZX6A 2B8AA 4A4KA 4B6MA 1K4US 2G6FX 3OB9A 3I35A 2ZPEB 4RCBA 1B3QA 1M1GA 1YJ9A 4F7UA 3FIFA 3CMEA 1UUEA 2D9TA 2A28A 1PRMC 1JXMA 1QLYA 2PQWA 4PJLA 1QVGP 4ANJA 1OPKA 2BE7D 1RLPC 2RJCA 2NWMA 2LQNA 2KAFA 3MO8A 2J06A 4OB1B 2LC4A 1D0XA 2LVMA 4M77F 3TEEA 2OTLT 1OZ3A 3SWNA 1ZA2B 1MMNA 3SEMA 2O31A 2JTEA 4HCCA 3EG1A 1AWWA 3VS6A 1C1AA 5EG2A 4IUPA 5CKHA 3CCSA 2EYQA 2QA4T 4M7AD 2DYBA 1ZUUA 3CD6Q 4FYYB 3EGXA 1VQOT 3V7RA 1W1FA 2OTJA 5GAOr 2CP6A 5KYXB 1QKXA 5FW9A 2XG8D 3PIOA 4FU6A 5KYWB 2SEMA 2NLUA 3EGUA 3HFOA 2K57A 1UECA 5GANd 3JCMb 1N8RU 2XIDA 2DIGA 2FZCB 5FWCA 1YI2Q 1EFNA 2P4TA 4LUDA 2GTJA 3NTIA 5CKBA 2DXUA 3P8HA 1Q95G 2O2OA 5HKCA 2KE9A 1PWTA 4Y28E 2E1HA 3GPLA 3CCVA 2FG0A 1YJWQ 1YIJA 4DA4A 5FWBA 1NPRA 3BFMA 4F14A 5L23A 3GLXA 3CPWP 1M90C 4QVZA 2E3IA 4KT0E 1NJIU 2M0OA 3KXTA 5IHIA 2QQAA 2LQWA 4QVCA 3X28B 5KYUA 3NGPA 2EAYA 3KFVA 4C8QE 4J83A 3CMET 3QKJA 4JPBW 4M7AC 1VQ4A 3EHQA 1U3OA 1AOJA 1BCMA 5KYWA 2CDTA 1P92A 2MK5A 2KRMA 4M75E 1Q82R 1VYUA 3M0UA 2JNGA 2VWFA 4XK8E 4TVRA 4M7AB 3OMGA 1WGSA 2DRKA 1D1AA 1N5ZA 2DX1A 3JCMh 4M7AG 3N5BB 3L2WA 2KYMA 5DLQE 1JJ2P 4LD9K 3CCST 2FHDA 2DD5A 4C8QF 2EGEA 4E7IA 1SG5A 1Q86R 4FCYA 4PJOF 3FJ5A 4FM4B 1FX7A 2QGFB 3TSWA 2OTJT 2RQTA 1T3LA 3JCMg 2VVKA 3V8KA 3M0QA 4DBQA 3CCUT 5LJ5h 2L5QA 1D3BB 2QQ9A 2O9VA 2CS7A 2HZYA 1YITQ 3G71T 1D0YA 2HDAA 4LE9A 4A4GA 1RAGB 3JCMQ 1H3HA 3I55Q 2L0AA 2D0QB 2QAZA 2XI9A 1RAFB 1GBQA 5KE2A 3SHWA 2FPEA 3CXCS 3G4SA 2F1LA 5GAOl 3CCVT 1YIJT 1SF9A 2J6KA 3URGA 4BUGA 4IUUA 4M7AA 3OS0A 4E7ZA 2QQBA 1K76A 3CQTA 4F7UE 4FSSA 1S1NA 2EQIA 4Y91A 1DJ7B 3C94A 4RTTA 1NJIC 2C0IA 3S3NA 3X26B 1Y96B 2M9UA 3VS7A 4PL6A 2DVEA 5LL6S 1IXDA 2YWWA 4BDYA 1JO8A 2DL4A 2NUTB 4PK4A 2JM9A 2RN8A 4E7JA 3FDRA 3VS4A 2OAUA 2QK0A 4RTXA 1VQ4T 3U23A 1OPLA 1G3WA 1RAEB 4FT2A 2QI2A 2XICA 4X9DA 1K73R 4OMOA 3MPUB 4OGCA 2SRCA 3SB2A 1IHWA 2L3QA 1YHQA 1I07A 2QTVA 5A2QE 1M3BA 2E6NA 1HD3A 3FC3A 3VS3A 2JXBA 3JCMe 1VQLT 2YRVA 1CSKA 3OYDA 1ZHIA 2HBPA 2LCLA 4M7DA 4F16A 3JCMf 4RG8A 3RR6A 1D09B 4AFSC 3NPFA 1T0HA 2BKDN 1XNIA 1C0MA 1NEBA 2E65A 1QVGS 1X6BA 1VQPA 2F69A 4R0KA 4JS5A 1M1KR 4OMMA 4E7KA 1VYVA 5LJ5e 2LMJA 1UGRB 2QGGA 2MWPA 4J9DA 1FMVA 1PHTA 4CI0C 2FB7A 1VQ7A 3J7AF 3GOXA 4CC2A 4DBHA 4PNOA 2P4RA 1ZUYA 3PMTA 4C92G 2F5KA 1PRLC 3L42A 2DLPA 4E2FB 4DBRA 2DBKA 3JCMV 2EBPA 3G4ST 3C0CA 5IAYA 3HPWA 4EMHA 4HKEA 2ROLA 4BI4A 2E41A 1GXIE 4F04B 3HHTB 1GCQA 3M4YA 5J3BA 1Q82U 4OMNA 3QUIA 2K79A 1OZ2A 3RKXA 4OMQA 3CBPA 3G6ET 2FYKA 3QYHB 4MZMA 1UGVA 5IHNA 2JS0A 4CRIA 5GAMj 5DLOA 3L2QA 2YUQA 4LDVA 1FYNA 1OU9A
chains in the Genus database with same CATH topology
1YJ9Q 3CD6Q 3CXCP 3CMEQ 1YHQQ 1VQMQ 3I56Q 1KQSP 2OTLQ 2QEXQ 3CCQQ 1VQPQ 3CC4Q 3CCJQ 3G71Q 3CCSQ 1YJWQ 3G6EQ 1S72Q 1VQKQ 1K8AR 1K9MR 1Q81R 1JJ2P 1VQ8Q 3G4SQ 1YJNQ 1K73R 1YITQ 3CCRQ 3CMAQ 1N8RR 1NJIR 3OW2P 1VQ7Q 3CC7Q 1VQ6Q 1VQNQ 1M90R 1VQ5Q 1QVFP 3I55Q 3CPWP 2QA4Q 3CCLQ 2OTJQ 3CCVQ 3CCMQ 1VQOQ 3CCEQ 1Q86R 1QVGP 1M1KR 1Q82R 1VQ9Q 1YIJQ 1Q7YR 1VQLQ 3CCUQ 1KC8R 1VQ4Q 1W2BP 1YI2Q 3CC2Q 1KD1R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 Q;  3CD6 Q;  3CXC P;  3CME Q;  1YHQ Q;  1VQM Q;  3I56 Q;  1KQS P;  2OTL Q;  2QEX Q;  3CCQ Q;  1VQP Q;  3CC4 Q;  3CCJ Q;  3G71 Q;  3CCS Q;  1YJW Q;  3G6E Q;  1S72 Q;  1VQK Q;  1K8A R;  1K9M R;  1Q81 R;  1JJ2 P;  1VQ8 Q;  3G4S Q;  1YJN Q;  1K73 R;  1YIT Q;  3CCR Q;  3CMA Q;  1N8R R;  1NJI R;  3OW2 P;  1VQ7 Q;  3CC7 Q;  1VQ6 Q;  1VQN Q;  1M90 R;  1VQ5 Q;  1QVF P;  3I55 Q;  3CPW P;  2QA4 Q;  3CCL Q;  2OTJ Q;  3CCV Q;  3CCM Q;  1VQO Q;  3CCE Q;  1Q86 R;  1QVG P;  1M1K R;  1Q82 R;  1VQ9 Q;  1YIJ Q;  1Q7Y R;  1VQL Q;  3CCU Q;  1KC8 R;  1VQ4 Q;  1W2B P;  1YI2 Q;  3CC2 Q;  1KD1 R; 
#chains in the Genus database with same CATH topology
 5A0D A;  5GAN 8;  4GLM A;  1TUD A;  4E6R A;  3QO3 A;  4DEY A;  2VUB A;  1Q86 U;  4J9F A;  1PD0 A;  4AG2 C;  5GAN h;  3L2Z A;  2CH4 A;  4C92 A;  2GBQ A;  4O6J A;  1AWX A;  2X35 A;  4XTW A;  1YHQ T;  2CP2 A;  4GY5 A;  1AVZ C;  3E1S A;  4RTU A;  2K5F A;  1ZLM A;  5IXB A;  1RI9 A;  1VQM A;  2JJ9 A;  2A7Y A;  1W6X A;  1BKB A;  2LX9 A;  1YJN A;  4C8Q D;  3V7C A;  4BD3 A;  1YWO A;  2L89 A;  2PUO B;  1WQW A;  1EZZ B;  1TG0 A;  1KHC A;  1D1B A;  3CMA Q;  3UWN A;  1VQP T;  3FJP A;  2YUN A;  4FSX A;  1QVF P;  1QKW A;  2HL3 A;  3MEA A;  4M75 D;  2DL8 A;  4OB3 B;  2RHY A;  1BBZ A;  3JAM E;  2RD1 A;  3GP8 A;  3L1A A;  3RMQ A;  1H64 1;  2DK3 A;  4AFU C;  2VAS A;  1MUZ A;  3UAT A;  1JJ2 S;  2BIV A;  3C95 A;  3JCM c;  3AHU A;  2MI6 A;  4CC3 A;  2DXC A;  2A3L A;  1TWB A;  1M90 R;  3ZEH A;  3OS2 A;  3G7Z A;  3EGD B;  1X01 A;  3CCM Q;  3CCE Q;  3J80 E;  1K73 U;  3BY7 A;  5LJ3 j;  3QZ9 B;  4NL2 A;  3PVL A;  2DIL A;  2HEQ A;  2RI5 A;  1Q82 C;  5CR2 A;  4PJN A;  4JRP A;  3JB9 J;  2W0Z A;  1X27 A;  4X9C A;  3FLG A;  4C5G A;  1BCO A;  4C5I A;  1K8A R;  2ZPB B;  4EIK A;  1PD1 A;  1UJY A;  1U8R A;  1OI1 A;  1X6G A;  4M7A F;  1WZO A;  1AWO A;  1TTH B;  2LNV A;  2X4Y A;  5GAN e;  5DM7 R;  2DEU A;  5GMK l;  2KR3 A;  3LH5 A;  2KSS A;  2V8J A;  5CIU A;  3D7S B;  4J6Y A;  2GNC A;  4J9I A;  1M1K U;  2LT4 A;  4YTL A;  4M7D E;  4M75 C;  2DPP B;  4BE2 A;  2DMO A;  4OB2 B;  3I5R A;  3G1J A;  2WAC A;  2H8H A;  1VQM T;  1WQ7 A;  1G3Y A;  3CC2 A;  3ASK A;  1SSH A;  1IGU A;  1YJN T;  5GJW B;  4D8K A;  4M75 B;  1H92 A;  2EJG A;  4WCI A;  4A4H A;  4X34 A;  4B9W A;  5HCK A;  4OP0 A;  2COZ A;  1ZQ1 A;  1FXX A;  1R0C B;  5GAN 6;  4ZN3 A;  1V1C A;  3UA7 A;  3OSV A;  1XJW B;  2JW4 A;  1VIF A;  2KNB B;  3OW2 S;  2ENM A;  1WFW A;  2IPO B;  2QDL A;  1VQ5 Q;  4AG1 C;  1AHJ B;  4KRT A;  2F2V A;  4JJD A;  1MNE A;  2DL3 A;  2HNI A;  3MP1 A;  4FW2 A;  2HD0 A;  2CP7 A;  1T3S A;  2HQE A;  1ARK A;  2KXD A;  1S72 Q;  5A0L A;  1FMK A;  2EYX A;  1WYX A;  1UE9 A;  3VU3 C;  2OTL A;  1BI2 A;  1JRI A;  1W2B A;  2HL5 C;  2MMP A;  4XAX B;  2LJ0 A;  5I21 A;  1WHJ A;  1NLO C;  2AKK A;  4A53 A;  4C92 E;  1GFC A;  2QA4 A;  3LGL A;  3BDL A;  1X69 A;  2LTO A;  1SEM A;  2NUP B;  3M53 A;  4ESR A;  4F7U B;  4ZN1 A;  2E4H A;  1Y57 A;  1ZUK A;  3SWN C;  1PCX A;  1YP5 A;  3I5S A;  1VQK A;  1SSF A;  2DO3 A;  2OX7 A;  2EQM A;  3HFN A;  3SWN B;  2K4Y A;  4PKC C;  4J9H A;  5FLX E;  3PE0 A;  4E7L A;  2PVD B;  5GAN 2;  1Y0M A;  3DLM A;  1VUB A;  1YCY A;  4OML A;  2RHZ A;  4JRK A;  4EMK C;  1TUC A;  4LDW A;  3EG0 A;  1M90 U;  2RHI A;  3JCM X;  3DLL A;  3EFO B;  1BB9 A;  2IIM A;  2DIQ A;  5M9O A;  4EMK B;  2CYZ B;  5HK3 A;  2NUP A;  3NMZ C;  1K8A U;  2DTO A;  2RI2 A;  3HRS A;  3ULR B;  2HBW A;  2D6F A;  1G5V A;  3KBG A;  2K3X A;  3P8D A;  2F5T X;  1MND A;  2IG0 A;  1LPL A;  3LX7 A;  3JB9 G;  1IGQ A;  3EG9 A;  1VQ6 Q;  5HY6 A;  2ZAE A;  2DL5 A;  1XQH A;  4ELZ C;  3JB9 H;  1KG1 A;  4L59 A;  2EJF A;  4AFQ C;  3EAE A;  5KH6 A;  5KYU B;  2BUD A;  4N4G A;  1AWJ A;  2M0Y A;  1M2O A;  4J9E A;  2COY A;  3CCU A;  3EFO A;  1ZA1 B;  1Z9Q A;  5IT9 E;  1VA7 A;  1SHF A;  2CSI A;  2E10 A;  4EMK A;  2NUZ A;  1VQK T;  2E6Z A;  1YIT T;  3G71 A;  4KUD K;  2YUO A;  3A8G B;  1JQQ A;  1VQ8 A;  2EQK A;  4X1V A;  2V8K A;  3MCA B;  3CCR A;  4XQ3 A;  3V8J A;  2EYY A;  4IUV A;  3THK A;  5AT1 B;  2E5Q A;  5EC7 A;  2L3R A;  2ECZ A;  2G3R A;  3C4S A;  3M4G A;  5GMK i;  1MMD A;  2A36 A;  1RI0 A;  4C0F A;  3AT1 B;  2EKO A;  2A0F B;  3S3O A;  4BE0 A;  2JN0 A;  4E7S A;  3EHR A;  1XTD A;  4J9G A;  3VS0 A;  2FZK B;  4M7D D;  5LJ3 d;  1NBE B;  3E9G A;  2DTH A;  2DKG A;  5GMK h;  2FPF A;  4B9X A;  1BU1 A;  3OBY A;  4RG2 A;  4KH0 B;  2GTO A;  1Q81 C;  2L3P A;  1K8A C;  2QQS A;  4N0A C;  4BB7 A;  5I11 A;  1W4S A;  2M1H A;  1CKA A;  2AKL A;  2ZPH B;  3OMC A;  1TXQ A;  3CEY A;  1OUL A;  5CQX A;  3UDC A;  1UGS B;  2M16 A;  1VQL A;  1VQ9 A;  1LVK A;  1JBM A;  2PTK A;  2ABL A;  2DL7 A;  1PKS A;  4BAC A;  5GMK j;  1QP2 A;  4LN2 A;  3RKW A;  3E2U A;  3NTH A;  2C06 A;  2FRY A;  2LZ6 B;  4Z02 A;  5IXF A;  3OY9 A;  1IHV A;  4FIB A;  5AYF A;  5FRN A;  2RM4 A;  4RMO A;  2CRE A;  2VC8 A;  4GBQ A;  4RTZ A;  1WJQ A;  3OYK A;  1SPK A;  2EYW A;  2K5I A;  1JEG A;  2DFU A;  4M75 F;  3M0T A;  3PTA A;  4UC4 A;  3JV3 A;  4M7D C;  4J7F A;  3MEV A;  1VQ8 T;  3CCR T;  3RIR A;  2P0K A;  1QWE A;  3BW1 A;  1UG1 A;  2L8D A;  4QW2 A;  2K2V A;  1TH7 A;  5LJ5 g;  4C92 D;  2XU8 A;  4FYW B;  3ZBD A;  2DA9 A;  2KI7 A;  4MML A;  1WHL A;  3BDU A;  4M7D B;  1M27 C;  4N0A A;  4OF1 A;  4M7D G;  1FWZ A;  1VQN Q;  4QT7 A;  4MDW A;  3OYY A;  4BI8 B;  8AT1 B;  3G6E A;  1B34 B;  3R6N A;  2CP3 A;  3MP6 A;  3VUZ A;  4KGV B;  3CC4 Q;  2AZS A;  3M59 A;  4PFO A;  1WJR A;  1GCQ C;  3L2V A;  1QCO A;  3HTR A;  4J6W A;  2EKH A;  2RJE A;  4PLL A;  2WSE E;  3A1P A;  3S6W A;  1GRI A;  3E9F A;  1B07 A;  3M9Q A;  1YJ9 Q;  2HAX A;  4F7U F;  1VQ9 T;  2QEX Q;  1I81 A;  2AZV A;  2O4X A;  5CKE A;  4XTZ A;  5HK0 A;  1GBR A;  4LXC A;  2PU9 B;  5CVI A;  2Y90 A;  4C92 C;  4ZTJ A;  4Q5W A;  1BI0 A;  4DOW A;  1PSF A;  4JZ4 A;  4R56 A;  2BTT A;  3I56 A;  5D7U A;  3HP9 A;  1NE8 A;  1V29 B;  3CMA T;  4XU1 A;  4IKF A;  2ATC B;  4RTV A;  2MOX A;  2DYI A;  3UF4 A;  1M4Z A;  4FYX B;  1B34 A;  3RES A;  1EX4 A;  4C92 B;  5LJ5 f;  1PC0 A;  1HSQ A;  3PNW C;  1ABO A;  3X24 B;  3LH0 A;  4ORZ A;  1AEY A;  5GAM h;  4JJC A;  1OU8 A;  2CH4 W;  5GAO p;  2OTJ Q;  2RQV A;  2OAW A;  3TU4 K;  4EMG A;  1S72 A;  4MMK A;  1Z9Z A;  3NHN A;  2LX7 A;  3BE3 A;  3JCM J;  2F2W A;  1KD1 C;  2J7I A;  4BY6 C;  3RDV A;  2RF0 A;  2V1Q A;  2BZY A;  2HQH A;  4RTY A;  3OYM A;  2ESW A;  1I1J A;  1BIA A;  1C6V X;  2OI3 A;  2X9H A;  4BY6 B;  4M78 G;  3CCV Q;  3JB9 F;  3QDF A;  4HVV A;  1N9R A;  1QP3 A;  3M56 A;  3MP8 A;  4A4F A;  2O01 E;  1M3C A;  2HSE B;  2LT1 A;  5GJV B;  4J5Y A;  5D6Y A;  3F70 A;  2D8H A;  1D1C A;  5CAI A;  2XDB A;  1RAH B;  3ME9 A;  1PM3 A;  2Y4Y A;  2RPN A;  3GNG A;  1H3Z A;  2EYZ A;  1YN8 A;  3GIB A;  3RBB B;  3DB3 A;  2K3Y A;  3CPW S;  4IUT A;  4J7I A;  4PLI A;  2OJ2 A;  3HRU A;  2EWN A;  5I2S A;  3INZ A;  2W10 A;  4ZGD B;  2L2P A;  1UDL A;  2QYZ A;  1KC8 C;  1W2B P;  4M77 G;  3VYG A;  5A0G A;  1VQ4 Q;  4ME7 A;  5GAN g;  1M30 A;  4JDS A;  3OYC A;  1NLP C;  1K1Z A;  4PJM A;  4MZT A;  2DE0 X;  2QG9 B;  8ATC B;  3QG1 A;  1UJ0 A;  2RI3 A;  3I56 T;  4HCZ A;  2JT4 A;  5LJ3 h;  4M78 A;  4LD6 A;  4RUG A;  1D0Z A;  2VXE A;  3OYA A;  2DBM A;  4KUI A;  2RMO A;  2FO0 A;  2WSC E;  2DF6 A;  2B86 A;  2JOY A;  4XU0 A;  3C12 A;  3L2R A;  2J6O A;  2QAS A;  2CGH A;  2BE9 B;  1YNZ A;  1VOM A;  3H0H A;  1S72 T;  2DAQ A;  2RHX A;  4Z89 A;  4K11 A;  4D8D A;  3L2U A;  4M77 A;  2HKQ B;  2YRC A;  4HT9 A;  1ACM B;  5D6X A;  4BI3 A;  2RK1 A;  3GNF B;  1WX6 A;  4D6W A;  3OS5 A;  3O5Z A;  3M57 A;  3OW2 A;  1Q81 R;  3G4S Q;  3CC7 Q;  1BIB A;  5CO7 A;  2EGC A;  2MCN A;  3CBO A;  3MEW A;  4LDU A;  3CD6 A;  2KBT A;  3JB9 I;  2QTX A;  2KRN A;  2MF2 A;  1Q7Y R;  5C0M A;  2JUF A;  1N6A A;  2X3W D;  3VYH B;  2RQW A;  4BDZ A;  2P84 A;  1KQS A;  5ECA A;  4ZGE B;  2XK0 A;  1X2Q A;  1UB4 A;  2ED0 A;  2HMA A;  5GAN f;  4C0D C;  2P0Q A;  2FPD A;  1RAI B;  3X20 B;  5IH2 A;  4OGE A;  2JZ2 A;  2MPX C;  1YI2 A;  2MIO A;  3QWY A;  2CP0 A;  4KGX B;  2R5M A;  2EFI A;  1YJW A;  3IQL A;  1PNJ A;  4C0D B;  2RQU A;  1YHQ Q;  2MYS A;  4FT4 A;  3TCJ A;  3WXM B;  3FB9 A;  1SKU B;  1ZBJ A;  1IRX A;  3M0S A;  5LJ3 e;  5C6S A;  2QQR A;  1U1S A;  4L5G A;  5IN1 A;  2M51 A;  2IVW A;  5KCO A;  2VKN A;  3VRY A;  2ED1 A;  3REA B;  2FRW A;  3VUB A;  4M7D F;  2JMA A;  3A8L B;  3DKM A;  3FRN A;  3M58 A;  3WVD B;  2RJD A;  1VQP Q;  1BK2 A;  1IRE B;  1Y07 A;  2PNI A;  2GQI A;  4A63 B;  2RQR A;  1YFN A;  2LQ8 A;  4MZP A;  1VQ7 Q;  5GAN 5;  5FRO A;  1GL5 A;  3NFC A;  1TS9 A;  3QHS A;  1VQ6 T;  4KBM B;  4DOV A;  4JUV A;  1X75 C;  3JB9 D;  2HQX A;  1X6O A;  3CPF A;  1WHG A;  3CCQ Q;  3SFM A;  5KE3 A;  5J26 A;  3CD6 T;  1WXB A;  2X4W A;  4PJO A;  2DNU A;  4LNP A;  3QWX X;  3VS2 A;  4F17 A;  1FMW A;  1I4K 1;  3PT9 A;  1WA7 A;  1OQK A;  1SHG A;  4P5N A;  4CC7 A;  4JRQ A;  3UPU A;  2FZG B;  3TSZ A;  1ZBX A;  1YIT A;  1CKB A;  3A8H B;  3M5A A;  3I55 A;  4JRI A;  3OYB A;  2E70 A;  1YI2 T;  3HL8 A;  4OMP A;  1XOV A;  3EG9 B;  1K9M C;  3FEO A;  2V26 A;  4M78 E;  2PUK B;  1M2V A;  4C5E A;  2CT3 A;  4N4H A;  4E47 A;  1YJW T;  3VRZ A;  5CKF A;  1R77 A;  5L8R E;  4C92 F;  2XDD A;  2AHJ B;  1N9S A;  2JMC A;  2AT1 B;  4Z88 A;  1UGQ B;  4LDY A;  1VQM Q;  4C5H A;  1MHN A;  3CCJ Q;  1LCK A;  2O88 A;  1TSF A;  1QVP A;  1SRL A;  1VYT A;  1F1B B;  1BYM A;  4M77 E;  1Q81 U;  3TQ7 P;  3EFR A;  2XKO C;  4L6V 5;  1KD1 R;  2YT6 A;  5I2M A;  4OVA A;  1MV0 B;  4A54 A;  1KSW A;  5GAM d;  1Q7Y U;  2PVO B;  4V2S A;  2R58 A;  6AT1 B;  1EIF A;  1NEG A;  2PZ1 A;  4Y92 A;  2F2X A;  1G83 A;  1QVF S;  3EG3 A;  2QEX A;  2VB6 A;  1A0N B;  1OOT A;  1HXD A;  5FRM A;  2LCS A;  5KYN A;  3KUF A;  9ATC B;  2ZPF B;  3EFS A;  2CUD A;  3OYL A;  2DTI A;  1U5S A;  2KDS A;  3LLR A;  2LNH B;  2E12 A;  4JS4 A;  3EH1 A;  3A98 A;  1JXO A;  3M54 A;  2YLB A;  3HRT A;  4MDX A;  2DM1 A;  2ROT A;  2A37 A;  4HVU A;  3CCL Q;  2CT4 A;  1E6G A;  2C0T A;  3PGG A;  3OQ5 A;  3V8L A;  1KC8 R;  2ZPI B;  3UA6 A;  3I55 T;  2VV5 A;  2K6D A;  3REB B;  2DZC A;  4AMC A;  4WF2 A;  2K2M A;  4C0G A;  1R8O B;  4XU2 A;  2KYB A;  4XTX A;  3OYI A;  2H3J A;  1K9A A;  3OYG A;  1M3A A;  1VQN T;  1G8X A;  3QBY A;  3CC2 Q;  2AK5 A;  1AD5 A;  3LWH A;  2KT1 A;  7AT1 B;  2K5L A;  2DEQ A;  1LOJ A;  1WHH A;  2EQJ A;  4QQG A;  2Y4X A;  1RAD B;  3CC4 T;  4HCB A;  2LDM A;  1M5Q 1;  1GCP A;  5D6W A;  1R0B G;  2EW3 A;  1NG2 A;  3OS1 A;  2DJQ A;  1Q7Y C;  1TU0 B;  3MHX A;  3CXC A;  4N4I A;  5FU7 C;  2NYS A;  4ZGJ B;  2YHT A;  2LQK A;  1GFD A;  2RNA A;  3PVQ A;  4PJO E;  1YJ9 T;  1WHK A;  2JM8 A;  4ZTF A;  3EH2 A;  1SRM A;  1NPP A;  5IHK A;  2QEX T;  3QZ5 B;  2JTM A;  1HK9 A;  5KYX A;  3QDR B;  1E6H A;  4KUL A;  5FU7 B;  2D1X A;  3RER A;  3ER0 A;  2K7A A;  1IO6 A;  1H8K A;  3A5Z B;  3H6Z A;  1WHM A;  4JJN K;  3CMA A;  2KY9 A;  2OTL Q;  2I2L A;  2LJ1 A;  1G2B A;  4XTU A;  2CUB A;  2KXC A;  2WSF E;  1K0X A;  3ZFJ A;  3GF5 A;  2X4X A;  4JJB A;  1QQJ A;  1WI7 A;  2QA4 Q;  1KIK A;  3MEU A;  1VQO Q;  2DJZ A;  3JSC A;  3SD4 A;  3HSB A;  1RAB B;  2O4X B;  5FU6 C;  2KQW A;  3WVE B;  2MWO A;  1OX9 A;  1KD1 U;  3J81 E;  3CCE A;  3CCM A;  1VQK Q;  3QPH A;  1MMA A;  2RK2 A;  1BI1 A;  1N8R C;  1OEB A;  3MKD A;  1RLQ C;  1QVG A;  1M8V A;  1UGP B;  3H0I A;  4Z8A A;  5FU6 B;  1PG5 B;  5CQY A;  3CC7 A;  2E5K A;  5GMK e;  2DET A;  2EIF A;  1BI3 A;  4JLG A;  4GLK A;  4FL6 A;  4IIM A;  1I5L A;  1RAA B;  1OX8 A;  4M78 D;  4J9C A;  2O9S A;  5LJ5 j;  2VGM A;  3VKI A;  4R55 A;  1G3T A;  2JTF A;  4EPC A;  4PFP A;  1U1T A;  2DD4 A;  2LP5 A;  3CME Q;  1KK7 A;  4DQ2 A;  3M0P A;  1KC8 U;  3R6O A;  4II1 A;  1D3B A;  2GFA A;  2KVQ G;  3QXE B;  3OW2 P;  4M77 D;  1OV3 A;  2XD0 A;  1MV3 A;  1VIE A;  2KRS A;  2GCX A;  4AFZ C;  4LDX A;  1PKT A;  2EQU A;  5GAN 3;  2V8I A;  5GAO m;  1KQ2 A;  1OYX A;  4NS5 A;  1KQS P;  3X25 B;  1VQ5 A;  2RA2 A;  3QII A;  1WPY A;  2YUP A;  3CCS Q;  4RKU E;  2K9G A;  1K9M R;  2XHC A;  2YXY A;  4HA8 A;  3CPW A;  5CCA A;  1ABQ A;  1Y96 A;  3NTK A;  1AZG B;  3LGF A;  3CCU Q;  1I8F A;  3CBM A;  4M78 C;  3PMI A;  2NUT A;  2Z0W A;  3UT1 A;  3CCM T;  4LUE A;  3CCE T;  3G71 Q;  2E64 A;  2KT8 A;  3LYI A;  1WLP B;  1X2K A;  5GAM g;  5KYY B;  1VQ8 Q;  2COW A;  3CCR Q;  5KCH A;  4M78 B;  1UTI A;  2DZ9 A;  4ZNX A;  2M02 A;  3CCQ A;  3CC7 T;  2DER A;  1YIJ Q;  4HT8 A;  1I0C A;  2EPD A;  2L3S A;  4IUQ A;  2GQV A;  4QKU A;  4VUB A;  2HCK A;  4M77 C;  3S3M A;  2H3E B;  3SDZ A;  2KMT A;  4XTY A;  4NOY A;  1HJD A;  5GAO q;  1JJ2 A;  4BE1 A;  4FYV B;  2E3H A;  3M55 A;  5CKD A;  3JRZ A;  1QMC A;  1MGQ A;  1WXT A;  4XU3 A;  1JB0 E;  2RO0 A;  3T9N A;  4M77 B;  1Y7X A;  4HXJ A;  3A8O B;  5I22 A;  4E7H A;  2GGR A;  3H41 A;  2LCC A;  4OMF B;  2GF7 A;  1RUW A;  2HSP A;  3VV0 A;  4NL3 A;  1KQ1 A;  1WJS A;  2R57 A;  5KYY A;  2DXT A;  2VXF A;  2PVG B;  4KGZ B;  3CCJ A;  1VQL Q;  1VQ9 Q;  1E7O A;  2RJF A;  2FL7 A;  1VQ5 T;  4FW1 A;  2CZ7 B;  4IUR A;  2V1R A;  2X51 A;  4C0Z A;  4PJO D;  2MAM A;  1O75 A;  3JCM P;  3VS1 A;  1UHC A;  2P0P A;  5GAM e;  5LJ3 g;  2R5A A;  5GAN j;  1RL2 A;  1T0J A;  3QSU A;  2CSQ A;  4KH1 B;  5GAM f;  3LWI A;  1VQ7 T;  1B7T A;  3EG2 A;  4DBF A;  1W70 A;  2K3B A;  3PIP A;  3M0R A;  5CK9 A;  4M7A E;  1ZSZ C;  1JU5 C;  1VQ6 A;  1QW1 A;  3RMS A;  2X3X D;  4QQ6 A;  1O9S A;  3OA6 A;  2JS2 A;  2CZ6 B;  1PSE A;  2LRQ A;  2LJ3 A;  3CCQ T;  4HCK A;  3MET A;  2X4J A;  4RCC A;  1ZSZ B;  3I9Q A;  2BZX A;  3OBW A;  4EDU A;  1N27 A;  3MJX A;  4CC4 B;  2EGA A;  1MMG A;  2DRM A;  3H0F A;  2EJ9 A;  3CCL A;  1UFF A;  1G3S A;  4WTO B;  3G6E Q;  4C8Q C;  3OYF A;  4J6X A;  1NYG A;  4O5V A;  4PJO C;  1KJW A;  1K9M U;  4AT1 B;  4QVD A;  5GAO n;  4M4Z A;  2CKK A;  1Q86 C;  3DB4 A;  1X43 A;  4XTV A;  2D0N A;  1NM7 A;  4J8O A;  1IB8 A;  1NYF A;  2HKN A;  4C8Q B;  3OSS C;  1TOV A;  5DY9 A;  2FEI A;  4PJO B;  5GAN 4;  4C8Q G;  1AT1 B;  2XDP A;  1QCF A;  1RAC B;  3CCJ T;  2RHU A;  4PJO G;  2GFU A;  3QJY A;  5LJ3 f;  3A8M B;  4OB0 B;  3EGD A;  2DXB A;  2ZZD A;  3JCM d;  1ZSZ A;  4PJJ A;  3P8B B;  3TVT A;  4M75 G;  3I56 Q;  1Y71 A;  4QQD A;  1WDX A;  3QYG B;  2YDL A;  1QWF A;  2I0N A;  4RTW A;  1NZ9 A;  1KHI A;  1M2V B;  2YRD A;  2KGT A;  4HVW A;  1N8R R;  2VGN A;  3RUX A;  3JCM W;  2FVU A;  1M1F A;  2ZPG B;  4IIO A;  4JZ3 A;  5LJ5 d;  3E19 A;  4JLI A;  1HYO A;  1K0S A;  1J3T A;  1LJO A;  2ZCF B;  1IZ6 A;  5GMK m;  1LNX A;  2KRO A;  1KQS S;  2EVR A;  2CZ0 B;  4C8Q A;  1QCN A;  1NJI R;  1K73 C;  2BZ8 A;  3RKY A;  3Q1J A;  1U06 A;  2RH2 A;  2AIR B;  1V76 A;  3V7S A;  2JVV A;  2YLC A;  3VS5 A;  2D8J A;  4A4E A;  3OYN A;  4ELY C;  4M75 A;  3CCL T;  3OYE A;  3CXC P;  2ZGW A;  3OYJ A;  1VQO A;  1WNL A;  3HKS A;  5J39 A;  3TRE A;  1YWP A;  1QVF A;  3RNJ A;  2QXF A;  3H9N A;  2A08 A;  4PFZ A;  3PFS A;  4F7U G;  2RB6 A;  2CZ1 B;  2KEA A;  2C0O A;  2YSQ A;  1M1K C;  1AZE A;  1M8M A;  4J9B A;  2VYT A;  1M9S A;  1VQN A;  4DEX A;  3CC2 T;  3O8V A;  2KK4 A;  1YJN Q;  3VJP A;  1YBY A;  3ZL7 C;  1KFZ A;  2XMF A;  1WXU A;  1ZSG A;  1UEB A;  3CC4 A;  3LW5 E;  3OYH A;  1YCS B;  3EGX B;  1W2B S;  1UHF A;  1TUG B;  2DVJ A;  4ATO A;  2J05 A;  2CP5 A;  1WIE A;  2QDY B;  5GAN 7;  4M78 F;  2J6F A;  3GBQ A;  3QJ6 A;  1I5O B;  3H8Z A;  1ZX6 A;  2B8A A;  4A4K A;  4B6M A;  1K4U S;  2G6F X;  3OB9 A;  3I35 A;  2ZPE B;  4RCB A;  1B3Q A;  1M1G A;  1YJ9 A;  4F7U A;  3FIF A;  3CME A;  1UUE A;  2D9T A;  2A28 A;  1PRM C;  1JXM A;  1QLY A;  2PQW A;  4PJL A;  1QVG P;  4ANJ A;  1OPK A;  2BE7 D;  1RLP C;  2RJC A;  2NWM A;  2LQN A;  2KAF A;  3MO8 A;  2J06 A;  4OB1 B;  2LC4 A;  1D0X A;  2LVM A;  4M77 F;  3TEE A;  2OTL T;  1OZ3 A;  3SWN A;  1ZA2 B;  1MMN A;  3SEM A;  2O31 A;  2JTE A;  4HCC A;  3EG1 A;  1AWW A;  3VS6 A;  1C1A A;  5EG2 A;  4IUP A;  5CKH A;  3CCS A;  2EYQ A;  2QA4 T;  4M7A D;  2DYB A;  1ZUU A;  3CD6 Q;  4FYY B;  3EGX A;  1VQO T;  3V7R A;  1W1F A;  2OTJ A;  5GAO r;  2CP6 A;  5KYX B;  1QKX A;  5FW9 A;  2XG8 D;  3PIO A;  4FU6 A;  5KYW B;  2SEM A;  2NLU A;  3EGU A;  3HFO A;  2K57 A;  1UEC A;  5GAN d;  3JCM b;  1N8R U;  2XID A;  2DIG A;  2FZC B;  5FWC A;  1YI2 Q;  1EFN A;  2P4T A;  4LUD A;  2GTJ A;  3NTI A;  5CKB A;  2DXU A;  3P8H A;  1Q95 G;  2O2O A;  5HKC A;  2KE9 A;  1PWT A;  4Y28 E;  2E1H A;  3GPL A;  3CCV A;  2FG0 A;  1YJW Q;  1YIJ A;  4DA4 A;  5FWB A;  1NPR A;  3BFM A;  4F14 A;  5L23 A;  3GLX A;  3CPW P;  1M90 C;  4QVZ A;  2E3I A;  4KT0 E;  1NJI U;  2M0O A;  3KXT A;  5IHI A;  2QQA A;  2LQW A;  4QVC A;  3X28 B;  5KYU A;  3NGP A;  2EAY A;  3KFV A;  4C8Q E;  4J83 A;  3CME T;  3QKJ A;  4JPB W;  4M7A C;  1VQ4 A;  3EHQ A;  1U3O A;  1AOJ A;  1BCM A;  5KYW A;  2CDT A;  1P92 A;  2MK5 A;  2KRM A;  4M75 E;  1Q82 R;  1VYU A;  3M0U A;  2JNG A;  2VWF A;  4XK8 E;  4TVR A;  4M7A B;  3OMG A;  1WGS A;  2DRK A;  1D1A A;  1N5Z A;  2DX1 A;  3JCM h;  4M7A G;  3N5B B;  3L2W A;  2KYM A;  5DLQ E;  1JJ2 P;  4LD9 K;  3CCS T;  2FHD A;  2DD5 A;  4C8Q F;  2EGE A;  4E7I A;  1SG5 A;  1Q86 R;  4FCY A;  4PJO F;  3FJ5 A;  4FM4 B;  1FX7 A;  2QGF B;  3TSW A;  2OTJ T;  2RQT A;  1T3L A;  3JCM g;  2VVK A;  3V8K A;  3M0Q A;  4DBQ A;  3CCU T;  5LJ5 h;  2L5Q A;  1D3B B;  2QQ9 A;  2O9V A;  2CS7 A;  2HZY A;  1YIT Q;  3G71 T;  1D0Y A;  2HDA A;  4LE9 A;  4A4G A;  1RAG B;  3JCM Q;  1H3H A;  3I55 Q;  2L0A A;  2D0Q B;  2QAZ A;  2XI9 A;  1RAF B;  1GBQ A;  5KE2 A;  3SHW A;  2FPE A;  3CXC S;  3G4S A;  2F1L A;  5GAO l;  3CCV T;  1YIJ T;  1SF9 A;  2J6K A;  3URG A;  4BUG A;  4IUU A;  4M7A A;  3OS0 A;  4E7Z A;  2QQB A;  1K76 A;  3CQT A;  4F7U E;  4FSS A;  1S1N A;  2EQI A;  4Y91 A;  1DJ7 B;  3C94 A;  4RTT A;  1NJI C;  2C0I A;  3S3N A;  3X26 B;  1Y96 B;  2M9U A;  3VS7 A;  4PL6 A;  2DVE A;  5LL6 S;  1IXD A;  2YWW A;  4BDY A;  1JO8 A;  2DL4 A;  2NUT B;  4PK4 A;  2JM9 A;  2RN8 A;  4E7J A;  3FDR A;  3VS4 A;  2OAU A;  2QK0 A;  4RTX A;  1VQ4 T;  3U23 A;  1OPL A;  1G3W A;  1RAE B;  4FT2 A;  2QI2 A;  2XIC A;  4X9D A;  1K73 R;  4OMO A;  3MPU B;  4OGC A;  2SRC A;  3SB2 A;  1IHW A;  2L3Q A;  1YHQ A;  1I07 A;  2QTV A;  5A2Q E;  1M3B A;  2E6N A;  1HD3 A;  3FC3 A;  3VS3 A;  2JXB A;  3JCM e;  1VQL T;  2YRV A;  1CSK A;  3OYD A;  1ZHI A;  2HBP A;  2LCL A;  4M7D A;  4F16 A;  3JCM f;  4RG8 A;  3RR6 A;  1D09 B;  4AFS C;  3NPF A;  1T0H A;  2BKD N;  1XNI A;  1C0M A;  1NEB A;  2E65 A;  1QVG S;  1X6B A;  1VQP A;  2F69 A;  4R0K A;  4JS5 A;  1M1K R;  4OMM A;  4E7K A;  1VYV A;  5LJ5 e;  2LMJ A;  1UGR B;  2QGG A;  2MWP A;  4J9D A;  1FMV A;  1PHT A;  4CI0 C;  2FB7 A;  1VQ7 A;  3J7A F;  3GOX A;  4CC2 A;  4DBH A;  4PNO A;  2P4R A;  1ZUY A;  3PMT A;  4C92 G;  2F5K A;  1PRL C;  3L42 A;  2DLP A;  4E2F B;  4DBR A;  2DBK A;  3JCM V;  2EBP A;  3G4S T;  3C0C A;  5IAY A;  3HPW A;  4EMH A;  4HKE A;  2ROL A;  4BI4 A;  2E41 A;  1GXI E;  4F04 B;  3HHT B;  1GCQ A;  3M4Y A;  5J3B A;  1Q82 U;  4OMN A;  3QUI A;  2K79 A;  1OZ2 A;  3RKX A;  4OMQ A;  3CBP A;  3G6E T;  2FYK A;  3QYH B;  4MZM A;  1UGV A;  5IHN A;  2JS0 A;  4CRI A;  5GAM j;  5DLO A;  3L2Q A;  2YUQ A;  4LDV A;  1FYN A;  1OU9 A; 
#chains in the Genus database with same CATH homology
 1YJ9 Q;  3CD6 Q;  3CXC P;  3CME Q;  1YHQ Q;  1VQM Q;  3I56 Q;  1KQS P;  2OTL Q;  2QEX Q;  3CCQ Q;  1VQP Q;  3CC4 Q;  3CCJ Q;  3G71 Q;  3CCS Q;  1YJW Q;  3G6E Q;  1S72 Q;  1VQK Q;  1K8A R;  1K9M R;  1Q81 R;  1JJ2 P;  1VQ8 Q;  3G4S Q;  1YJN Q;  1K73 R;  1YIT Q;  3CCR Q;  3CMA Q;  1N8R R;  1NJI R;  3OW2 P;  1VQ7 Q;  3CC7 Q;  1VQ6 Q;  1VQN Q;  1M90 R;  1VQ5 Q;  1QVF P;  3I55 Q;  3CPW P;  2QA4 Q;  3CCL Q;  2OTJ Q;  3CCV Q;  3CCM Q;  1VQO Q;  3CCE Q;  1Q86 R;  1QVG P;  1M1K R;  1Q82 R;  1VQ9 Q;  1YIJ Q;  1Q7Y R;  1VQL Q;  3CCU Q;  1KC8 R;  1VQ4 Q;  1W2B P;  1YI2 Q;  3CC2 Q;  1KD1 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...