3CC2Q

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cc2Q00
1QVGP 3G6EQ 1QVFP 3CC2Q 2OTLQ 1YJ9Q 1N8RR 1YJWQ 1K8AR 1VQMQ 1KC8R 3CC4Q 1NJIR 1VQ5Q 3CCLQ 1VQKQ 3CCQQ 1YITQ 1YI2Q 1VQ8Q 1Q82R 1YIJQ 1YJNQ 3CCRQ 1W2BP 1VQOQ 1K73R 3CMAQ 3G4SQ 1VQ6Q 1JJ2P 2QEXQ 1KD1R 1M1KR 1S72Q 3I56Q 1Q7YR 3CC7Q 3CCSQ 3I55Q 2QA4Q 1VQPQ 1VQ4Q 3CCVQ 3CCEQ 2OTJQ 1VQ7Q 3CMEQ 1KQSP 3CCMQ 1VQ9Q 3CCJQ 3G71Q 1Q81R 3CXCP 1YHQQ 3OW2P 3CPWP 1K9MR 1VQNQ 3CD6Q 1VQLQ 3CCUQ 1Q86R 1M90R
chains in the Genus database with same CATH superfamily
4KGXB 1RAEB 4OMOA 3C12A 1M1KU 4KULA 5A2QE 5LJ3j 1UGPB 4ZN3A 1QWEA 4II1A 3SHWA 2YRDA 4PLLA 4J9GA 4ZN1A 5KYXA 3FC3A 3PGGA 4OMLA 1NYGA 5GAMd 2XG8D 4C92F 1UFFA 1N27A 1WJSA 4NS5A 5KYNA 2B8AA 3G71Q 5IHKA 2DZCA 2FO0A 4RG2A 2GBQA 2JM9A 2RJFA 4IURA 1BKBA 3QUIA 1G3SA 2GNCA 5ECAA 4FSXA 1Q7YC 5D6YA 2PUKB 3FRNA 3VUBA 4C8QG 4XU2A 2K7AA 5GJWB 2LQKA 1Y71A 1PD1A 1WA7A 2A7YA 3NGPA 4F14A 4BY6C 4EDUA 9ATCB 4PJOC 5KYXB 1B07A 1OU8A 3C4SA 1K4US 1G3YA 2OTJA 3H41A 5KYWA 2OAWA 2MPXC 2E3IA 3M0RA 4IUQA 1X6OA 3BY7A 1KIKA 2YUQA 5GMKm 4M7AD 2P0KA 4A4FA 4PKCC 1N5ZA 1KC8C 2FZCB 2GCXA 4LDYA 3L2VA 1HK9A 3Q1JA 3QPHA 2CP6A 1NBEB 2KT8A 3MEWA 4PJJA 1Y0MA 1VQ4A 3C0CA 4JRPA 4BE2A 2CH4W 3JAME 3TCJA 1Y96A 1WHGA 2E3HA 2QYZA 2V8JA 2J6KA 2J7IA 4DA4A 5GAOl 1QMCA 3OYKA 4OB1B 1IHWA 4C5IA 4JS4A 2HDAA 5KYWB 4LN2A 2P0QA 5CKEA 3LW5E 1N8RR 1QQJA 2KK4A 1OZ3A 3G4ST 1AVZC 1SG5A 2L3SA 1BCMA 2QA4A 1BI0A 3CMEA 1QVGA 1C1AA 1QVFA 1JXMA 2E1HA 1VQOQ 4Y28E 3CCET 3OYFA 3PT9A 3OS1A 2HAXA 1RABB 4J9BA 1X69A 4A4HA 4FT4A 2NLUA 2V1QA 1Y96B 2RJEA 1KD1C 3JCMe 4MDWA 1I8FA 4JJDA 1JO8A 2RH2A 3MEUA 2MF2A 3MP8A 1I5OB 2FB7A 4B6MA 3JCMX 3QBYA 2WSCE 3FIFA 3LH0A 5IT9E 1B34A 3X24B 1TTHB 3OBYA 3H9NA 3QYGB 2KSSA 2RNAA 3ZEHA 4B9XA 1SKUB 2V8IA 2O31A 2V1RA 1LVKA 4C8QC 4ESRA 5GANg 1WHKA 5CIUA 4DEYA 4M7AF 3RERA 4KGZB 4IUUA 2EQUA 2J6OA 2QASA 1SF9A 4J6YA 5AYFA 2L0AA 5CQXA 4F04B 5LJ5d 1QW1A 3RDVA 2DYIA 1KK7A 3GF5A 1VQNQ 1X2KA 2DERA 2E70A 2YLCA 1Q82C 1HJDA 3VS6A 1VQMQ 3VS1A 3CC4Q 5AT1B 1MUZA 2JJ9A 1K73R 3EGXA 3CCVT 1B34B 4RTXA 2X4YA 3PFSA 4ZGJB 4J9FA 2DBMA 4E7IA 2M9UA 1Q86C 2HD0A 2JVVA 2DAQA 5IHNA 2K5IA 1ZUYA 3RR6A 1TXQA 4EPCA 2HMAA 2VB6A 1NYFA 1BI1A 4NL3A 3NFCA 1S1NA 2JS0A 2CP5A 1KHCA 3OYNA 1JJ2S 4A4EA 1UJ0A 2DMOA 2J6FA 2Y90A 1VQ6Q 1BI3A 1VQPQ 1SEMA 1IO6A 2DRKA 1WJQA 1M3CA 1LJOA 2KBTA 2MOXA 5GAOq 4LUEA 4R0KA 4RG8A 3EGXB 4D6WA 5KCOA 1YITT 1BYMA 1OULA 2GQVA 2EJGA 2DIGA 5FWBA 2RB6A 5GMKi 3CC2A 4QQDA 4PFPA 4FSSA 1SSHA 1VA7A 4JJNK 3CD6Q 2NWMA 4FW2A 1YIJA 1I1JA 1IZ6A 3BDUA 1K0SA 2RA2A 2RQTA 4FM4B 4PJMA 2DZ9A 1PG5B 3CCQQ 4L6V5 2HEQA 5IAYA 3CBOA 4F7UE 3J81E 2HQEA 3CPWS 3TQ7P 1MMDA 5GAMj 5LJ3g 1M1GA 4LD6A 4E6RA 4XTUA 2LCLA 5FU6B 2BE7D 2DL5A 1KD1U 4BDYA 2OTLQ 2CSQA 3CCLT 1VIFA 3RBBB 3CXCA 3FLGA 1D1AA 1HXDA 1BIBA 3VJPA 2F1LA 2QTVA 1WNLA 1OX9A 2HKQB 2EGAA 3HFOA 1W2BA 1RLPC 2DO3A 1W6XA 4PJOD 2DXUA 5GAOr 2D8JA 4J9IA 2KMTA 2KRMA 1QVPA 3EG3A 3CQTA 2HKNA 3EFRA 1ZUUA 1K8AR 1UUEA 1VQ8T 2IVWA 4C0DB 2RHXA 1SPKA 3RKWA 3G71A 3JCMQ 1H3ZA 1U5SA 3S3MA 4J9HA 3LWIA 2CYZB 3QIIA 1XQHA 4DBQA 2DLPA 1ZBXA 4AFQC 2EW3A 4ZTJA 3CCUQ 1LCKA 4GLMA 1KQSA 3OW2A 4PL6A 1R77A 1ABQA 3LX7A 1U06A 3X20B 2EAYA 3QJYA 2JNGA 5GAOn 4PJNA 2DJZA 3UPUA 3M0QA 2KRSA 1Q86U 3M0UA 2ZPBB 1RAGB 2E12A 3FJ5A 3OYGA 1I0CA 1ARKA 2DE0X 1XNIA 2A37A 2MI6A 3MEAA 5I2SA 4M7DA 1NJIR 1ZQ1A 3VUZA 1YJNQ 1OU9A 3OQ5A 2NYSA 2A28A 4IUPA 2MCNA 3FB9A 1RAIB 4BB7A 5IN1A 1ZX6A 4M77A 5HK3A 4R56A 4QW2A 4OGCA 4Z8AA 1FX7A 4PFZA 2W0ZA 2CT4A 1M90R 3V8LA 4JDSA 1YCSB 3SEMA 1JU5C 1RAAB 5KCHA 1D3BA 1TU0B 3OBWA 2KYMA 4PJOF 4EMGA 2DRMA 2L8DA 1YHQT 1IREB 2AT1B 1IRXA 2XICA 4X9CA 3GOXA 2QQAA 2FEIA 3I5RA 2K6DA 4XK8E 1VQMT 4M7DB 3MEVA 4N4HA 3CC4T 3JCMg 4C8QD 4J7IA 1WXBA 2X9HA 3HHTB 2DX1A 2E5QA 3SWNC 2VWFA 1GCPA 4M77B 2EYZA 2QQ9A 2EJ9A 1M2VA 1GRIA 4EIKA 2MWOA 2RI2A 4IIOA 4F7UG 3I55Q 2EYYA 1UGRB 5GANe 1IGQA 2KI7A 4XU3A 2EVRA 3MHXA 5LJ5j 1D3BB 3JCMd 4ZTFA 3JRZA 2A36A 2M51A 4J6WA 4YTLA 2YRVA 3OYMA 3A5ZB 5GANh 2HZYA 2JTEA 1VQ7T 1E6GA 2LX7A 3M9QA 3I56Q 4HCCA 1GL5A 1WIEA 4LXCA 1MHNA 3S6WA 4M78A 2RI3A 2ZPHB 2FZKB 4KT0E 3HRSA 1M2VB 4C5GA 2P4RA 1GCQA 4J9CA 2LC4A 3UA6A 3OYAA 3ZBDA 4ELZC 1UHCA 2HBWA 1VQNA 1X6GA 1M1FA 1B7TA 3CCSQ 3CD6T 1WXTA 2YUNA 1X43A 1VQMA 3EFSA 3CC4A 3TEEA 1NEGA 3MO8A 5LL6S 1YN8A 4X9DA 3LYIA 1X01A 4HCZA 4A63B 1ZSZA 2X51A 1PHTA 4MMLA 4X1VA 2VXFA 4M78B 1TUDA 3SD4A 1E6HA 2CT3A 4C8QF 2EIFA 4F17A 1FMWA 2OTLT 5GANf 3TU4K 2A3LA 1VQ6A 1Z9ZA 4M75A 2VXEA 1CSKA 3EFOB 1VQPA 4WCIA 1VQ7A 3UDCA 2FG0A 1MMNA 3SB2A 4EMHA 1YBYA 2M1HA 3A8MB 3QSUA 1OEBA 1UGVA 2ED0A 3KXTA 2MYSA 4B9WA 1JRIA 1UE9A 1ZSZB 3MKDA 1O9SA 2HSPA 5LJ3e 4BD3A 3HTRA 1Q81U 1NE8A 1VQ4T 5FU7B 1JJ2P 2RHYA 2KVQG 3CD6A 4C92A 3E19A 4XAXB 1M1KR 2YUPA 1CKAA 4OVAA 2NUPA 2EYQA 3WVDB 3L2QA 3CCUT 4M75B 5LJ3h 2AKKA 4FU6A 3CCQA 5GAN7 1WZOA 1OZ2A 2HNIA 4Z02A 2I0NA 4LD9K 1T0JA 3UF4A 3HFNA 3DKMA 2QA4T 3HRUA 3CMET 2XKOC 3JB9J 4N4IA 4FYVB 1HD3A 2OTLA 4KBMB 4RCCA 4EMKA 2PVOB 4BI3A 3WXMB 2LCCA 3OS5A 2K79A 5FROA 1YJNT 1VOMA 1Y7XA 4C92B 5J3BA 1WPYA 2WACA 2EYWA 2IG0A 2NUPB 3VRZA 4AG1C 4J9DA 5I2MA 4Y91A 4A53A 1AD5A 4CC4B 2JOYA 2KRNA 1NEBA 1YP5A 2DM1A 1NM7A 3M57A 3CPWP 3N5BB 4D8DA 2F5TX 2K57A 3EG0A 2C06A 2LZ6B 1X6BA 4HVWA 3PMTA 4AFSC 1YJWQ 1LPLA 2EQJA 3INZA 5GAN2 2HCKA 5LJ3f 3M59A 4BE1A 2HL3A 1WHJA 1WI7A 1FXXA 4EMKB 1K9MU 1GFCA 1UGQB 4IIMA 3CCUA 2O9SA 1K1ZA 1EZZB 2CZ7B 2LVMA 3OYJA 5GMKj 1D09B 3HKSA 4E7KA 1QWFA 2E10A 4OGEA 1D0ZA 2ZPEB 4OMFB 2XIDA 2VGMA 3OA6A 3P8HA 2NUZA 2I2LA 5HY6A 3H0HA 4MMKA 5GAN6 4OB0B 2ENMA 1PRMC 2EYXA 1IHVA 2FPEA 2P4TA 1YJNA 2RHIA 1TWBA 2F2XA 1J3TA 3QDRB 4MZTA 3QWYA 4XU1A 3VKIA 3I56T 4OMQA 3QO3A 1SRMA 4N0AC 1SHFA 2DL4A 2Y4XA 5I11A 4OB2B 3HPWA 3JCMh 4FT2A 4D8KA 7AT1B 1NLOC 1I5LA 1WHLA 1D1CA 2QI2A 5CQYA 1PRLC 1YCYA 3D7SB 3PNWC 1HSQA 3OS0A 4M7AA 3CCST 2BE9B 2OI3A 2DF6A 4AFZC 4C5EA 5HK0A 5M9OA 1TSFA 1K8AC 2DPPB 3CC2T 8AT1B 2FRYA 3A98A 3AT1B 2ZCFB 4Z88A 1Q7YU 2DTOA 1YIJT 4J6XA 3I55A 1D0YA 1X75C 3TSZA 5GANd 1N9SA 3ER0A 5C0MA 2EWNA 2CREA 3S3OA 3CBMA 5FRMA 2KROA 2LJ1A 1VQ9Q 2RJDA 4M7AB 1M27C 2CP7A 2RMOA 3I56A 1KFZA 2YDLA 3G7ZA 2Z0WA 3JCMf 4DOVA 3E9FA 4HXJA 2QEXQ 4C0GA 2YUOA 4Q5WA 4JS5A 1H8KA 1KC8U 2GQIA 3V7RA 3H6ZA 1TOVA 1NJIC 1R8OB 1VUBA 4JJBA 5J26A 3VRYA 4GBQA 4XTYA 4RTUA 3BDLA 1CKBA 4QKUA 2XMFA 3CCSA 4BACA 3RMSA 3O5ZA 4E7JA 3ZL7C 3VS2A 2DL7A 1C6VX 4R55A 4QQ6A 3FJPA 8ATCB 3G71T 3KFVA 3NTHA 3JCMb 1M90C 4J83A 1AWXA 3EG9A 1M3AA 2ZPIB 1VYTA 1WQ7A 1BI2A 5J39A 1PKSA 4DEXA 1G2BA 1G8XA 1EIFA 2AK5A 1PD0A 4RTWA 2FYKA 3RIRA 2CZ0B 2PNIA 5KE2A 2R5MA 4QVDA 3JB9G 2W10A 1OOTA 2XDBA 5GAMe 5D6XA 4RMOA 2ZAEA 2BUDA 2LQ8A 2IIMA 3NMZC 2CDTA 2HBPA 5KE3A 3A8LB 1PC0A 2VYTA 1JXOA 3H8ZA 3EG9B 5I21A 2QG9B 4BUGA 2MAMA 2CP3A 1JB0E 4RTZA 1N9RA 2D1XA 2K5FA 1H641 1K0XA 2JN0A 2CS7A 3RNJA 2Y4YA 1YJWT 2EGCA 2JS2A 2XU8A 5LJ3d 3UT1A 1VQLQ 3OB9A 2VUBA 3PMIA 4ATOA 3ZFJA 3P8DA 4JJCA 5DLOA 4M7DE 3EG2A 3ULRB 1MNDA 3A8OB 1UEBA 5CR2A 3OYCA 2HQHA 2EGEA 3JB9I 4LDWA 4M77E 2CH4A 2RN8A 2OX7A 4X34A 2O2OA 3L1AA 1OI1A 2DKGA 5FLXE 1Q82U 2MWPA 1YJ9Q 3M0PA 1VQOT 1P92A 4M4ZA 2DTHA 3MP6A 3O8VA 3CMAQ 2BKDN 4KGVB 2FVUA 1PSEA 1ZHIA 1RAFB 1ZBJA 4F7UF 4OF1A 2ED1A 2DXBA 4OMMA 1A0NB 1Q86R 4OP0A 4RTYA 3QJ6A 1FYNA 1UECA 1QCOA 1AEYA 4RTVA 2K3YA 1OQKA 3M53A 2X35A 2QK0A 3H0IA 2QDYB 1ZLMA 1TUGB 3EGUA 5CKFA 1YJWA 1WXUA 5CKDA 4P5NA 2DTIA 4FYYB 4LUDA 4PJOA 3RKYA 4J7FA 1YI2Q 5C6SA 3S3NA 2KT1A 5L8RE 4KH1B 2P84A 2F69A 1VQNT 1OYXA 4M78E 4XQ3A 5GAOp 4Z89A 3G1JA 1QP3A 2ZPGB 4KUDK 1VQOA 5A0LA 3IQLA 5GJVB 4MDXA 1NPPA 2DK3A 1M1KC 2C0IA 1C0MA 2E5KA 3E1SA 2BZYA 1MGQA 2PVDB 4ME7A 4LDUA 1XTDA 2YRCA 2GGRA 1JJ2A 3CXCP 2L3PA 2RM4A 4BY6B 2CSIA 2YSQA 4PJOB 2RQRA 3OMGA 1G5VA 1I81A 3PVQA 2E6NA 1VQ6T 1T3SA 2L3RA 3NPFA 4J9EA 4JPBW 3M4GA 1VQPT 3G4SQ 3VS4A 2AIRB 3CCEQ 1OPLA 2LQWA 1NPRA 1RUWA 2CP0A 1QVGS 1QVFS 2DA9A 1LOJA 3NTKA 1UDLA 2BIVA 2RQUA 2LT4A 2LNHB 2LJ0A 4M75E 3DLLA 4JRKA 4M7DG 5FU6C 2D0NA 2VGNA 3J7AF 2K2VA 4A54A 1VYVA 4HVVA 4MZMA 3RMQA 3EFOA 4M77G 3A1PA 1ZUKA 4DOWA 1KQSP 4OB3B 4HT9A 2P0PA 2H3JA 3JCMJ 1X2QA 2ESWA 3OSSC 2QGGA 3CCQT 1R0CB 2QAZA 1M5Q1 3CPWA 4DBHA 2O4XA 1X27A 4C0DC 1MMGA 4CC7A 3MPUB 4C92E 2XHCA 1RL2A 2CGHA 2DJQA 2RHZA 4C8QA 1VQ9A 1IB8A 3I9QA 3PVLA 2MIOA 2E4HA 2K2MA 4QVCA 1AWJA 1VIEA 1N8RC 3VYHB 4HT8A 2FL7A 4IUVA 2DILA 3C95A 6AT1B 2QEXA 1B3QA 2KXDA 2M0YA 3VS5A 1SSFA 1ZA2B 2F2VA 2AZVA 2K3BA 3CCVQ 3REBB 1UHFA 3RKXA 1AHJB 4XTWA 2DEUA 1PCXA 2O4XB 5HKCA 2JMAA 5HCKA 2GTOA 5KYUA 2BZXA 2X3WD 4C8QB 3MJXA 1VQKQ 3E9GA 5KH6A 2C0OA 5GAMg 2KXCA 4AG2C 1MNEA 2EQKA 3LWHA 3H0FA 2VVKA 4M78G 4WF2A 1Q81R 3R6NA 3A8HB 1PSFA 4E7HA 1KHIA 3X28B 1G83A 3G6EQ 5IH2A 3UWNA 2KAFA 1NG2A 1WX6A 4K11A 3QDFA 4FW1A 3CMAT 1EX4A 1M3BA 2LP5A 4QT7A 3META 1YITQ 3M0TA 4QVZA 1N6AA 3SFMA 4RUGA 1UGSB 2JUFA 2XK0A 5GMKl 1M30A 5KYUB 1VYUA 5DLQE 4BDZA 2J05A 1SHGA 3EAEA 2O88A 2O01E 4JZ3A 4E7LA 2CZ6B 2MMPA 2OJ2A 4M7DC 1K73C 3F70A 4E7ZA 4KUIA 4O5VA 1M2OA 3RUXA 3DB3A 3T9NA 2AZSA 1BBZA 2V26A 2MK5A 4M77C 1VQLA 1YWPA 5CAIA 1BCOA 4ZGDB 3CEYA 3E2UA 2DVEA 2YHTA 4M75G 1YI2T 2DYBA 4OMNA 2K4YA 3OYHA 4FCYA 4XTXA 1XOVA 1U1TA 3JV3A 5A0DA 3CCLQ 1D1BA 1WGSA 3BE3A 2KR3A 3CCRQ 4GY5A 1RACB 2K5LA 3VS7A 3CXCS 1YJ9A 4BI4A 1GBQA 5GMKe 3CCJQ 1U3OA 1K9MR 2JTFA 1YFNA 2QQBA 2RHUA 3EH1A 3CMAA 1RAHB 3JB9D 4BI8B 1RLQC 2EFIA 1W2BS 2FRWA 4M7AE 3JSCA 4J5YA 4HCKA 1VQ8Q 2DL3A 1XJWB 3EH2A 5GMKh 4C92G 3I55T 1JQQA 5CK9A 1S72Q 1BK2A 5I22A 1IXDA 3JCMV 1N8RU 4JLGA 2ECZA 1M8VA 2VKNA 2AKLA 2RF0A 4QQGA 2D9TA 3TREA 2LDMA 2RJCA 3M0SA 2R57A 3VU3C 4PK4A 2ZGWA 4JLIA 3AHUA 1QCFA 2DFUA 2YWWA 2X3XD 4DBFA 1KQSS 1QKWA 3OW2S 1AT1B 4M78C 4IKFA 2DXTA 3KUFA 2JXBA 2LT1A 2VC8A 5GAOm 1YWOA 2G3RA 5D7UA 1YI2A 3GPLA 1R0BG 1RI9A 3NHNA 1GCQC 1QCNA 2IPOB 2DBKA 2H3EB 2JTMA 3THKA 4HA8A 2E6ZA 3C94A 1PNJA 1UJYA 2E65A 2QQSA 2PZ1A 5LJ5g 4MZPA 1M4ZA 3I35A 1U1SA 3X25B 3X26B 3VS3A 1OV3A 4E2FB 2F5KA 1ZSZC 4C0ZA 4E7SA 3OSVA 2PUOB 3V8JA 3VYGA 3L2WA 3L2RA 1VQ5Q 3I5SA 2YXYA 2LQNA 1AWWA 3SDZA 2DIQA 3DLMA 1Q7YR 5FU7C 4FYXB 3V8KA 2KYBA 1YHQQ 3JB9F 2QTXA 3WVEB 1V1CA 4M75C 1WYXA 1K73U 2O9VA 4GLKA 3G4SA 2KQWA 1OX8A 5FW9A 4ZNXA 1F1BB 2CZ1B 2X4WA 3PTAA 3CCEA 3QZ9B 1TS9A 2CUDA 4NOYA 3SWNA 2R5AA 2QQRA 1FMVA 4AMCA 4AFUC 3JCMP 1BU1A 2GFAA 2RK1A 2RPNA 4KRTA 5DY9A 5IXBA 3FEOA 3OYLA 5KYYA 2JMCA 1VQKT 4CRIA 4OMPA 2LX9A 2COWA 1KC8R 3GIBA 2DEQA 4C92C 5DM7R 4NL2A 5D6WA 1M8MA 3L42A 1QKXA 2QXFA 3CC7Q 4RKUE 2V8KA 1VQ7Q 4ELYC 5GAN8 3G6ET 3CCMQ 4CI0C 4C0FA 3GNGA 2KDSA 1Q95G 2EBPA 1QVGP 1QVFP 2RQVA 3SWNB 3EHRA 3GBQA 2COYA 2RO0A 1NLPC 4M7AG 1K9AA 4CC3A 1WJRA 3VS0A 1SRLA 1AZGB 2ZZDA 2KNBB 1H92A 2GF7A 2OAUA 4FYWB 4EMKC 5KYYB 1I07A 1KJWA 4CC2A 3HL8A 3QWXX 4L59A 1MV0B 2EJFA 1MV3A 2D8HA 1PM3A 3URGA 1KSWA 1WDXA 2WSFE 1JEGA 1W1FA 2LRQA 3REAB 3CCVA 2DETA 3L2ZA 1V29B 5GAMh 1KD1R 1MMAA 4M7DD 2BTTA 2CP2A 1G3WA 1T3LA 4AT1B 3M54A 4JRQA 1VQKA 2R58A 1NZ9A 3V7CA 3KBGA 1AWOA 4M77D 3L2UA 3CCRT 2KY9A 2FPDA 3BFMA 2C0TA 2ZPFB 1WHHA 5A0GA 1RADB 3CCJT 2EKOA 3QZ5B 3G6EA 4PLIA 1K8AU 2OTJQ 1UTIA 1GBRA 4LNPA 2K9GA 1YITA 1KG1A 3VV0A 1IGUA 1EFNA 2PQWA 1UB4A 2FPFA 3EGDA 4FL6A 4PJOE 2YT6A 5EG2A 1ABOA 3LGFA 1S72T 3UATA 1Q82R 4HCBA 4XTZA 2L89A 4J8OA 1VQ4Q 1V76A 4F7UA 4RCBA 1KQ2A 2DD4A 5GAMf 2DXCA 2FHDA 4PJLA 2VASA 2RD1A 2L3QA 1M9SA 2GTJA 2L5QA 3LGLA 2KE9A 3MCAB 3J80E 3NTIA 4VUBA 3EG1A 2SEMA 1OPKA 4A4KA 4LDXA 4Y92A 2LCSA 1O75A 2QA4Q 2H8HA 3CMEQ 3U23A 3EGDB 1BB9A 1NJIU 3CCLA 5GAN4 2AHJB 4PNOA 5L23A 2J06A 3CCRA 1JBMA 2JM8A 2A08A 5CKBA 2M0OA 4M7AC 2L2PA 4ANJA 4M78D 1UG1A 2DNUA 2HL5C 4F7UB 3CCJA 4M7DF 2NUTA 3DB4A 4C5HA 2EPDA 1M90U 2QDLA 1YNZA 3LLRA 1FMKA 1FWZA 2KEAA 2JT4A 3FDRA 4M77F 2A0FB 3JCMW 1QLYA 1TH7A 1VQ8A 1Z9QA 1KQ1A 2SRCA 5IXFA 3GNFB 4UC4A 4XU0A 3OYYA 4L5GA 1VQ5T 3GP8A 1S72A 1GFDA 2E64A 2QGFB 3QXEB 2YLBA 1W70A 4PFOA 2K3XA 1W4SA 1Q81C 4HVUA 2ROLA 2CKKA 1ZSGA 5CVIA 3QHSA 2XI9A 5GAN3 1VQ9T 3R6OA 2DVJA 4V2SA 5LJ5e 4HKEA 2LNVA 2NUTB 2JZ2A 2D6FA 4F16A 2BZ8A 2QEXT 4LE9A 4DQ2A 1W2BP 2RQWA 4C8QE 3HRTA 3M56A 4M75D 2LMJA 4JUVA 3MP1A 3QYHB 2COZA 5LJ5h 3PIOA 1PWTA 2G6FX 5GANj 5EC7A 3QKJA 3PE0A 2X4JA 5CCAA 3OYDA 3OYBA 2HQXA 2XDDA 1I4K1 1LNXA 5IHIA 3CC7T 2D0QB 4ZGEB 2X4XA 3CCMT 4BE0A 3OYIA 2VV5A 2DL8A 3M5AA 2DD5A 4O6JA 4FIBA 2EQIA 4N0AA 4IUTA 2ABLA 3OW2P 1VQ5A 3OS2A 2RK2A 4C92D 3HSBA 2GFUA 4M78F 3OMCA 2XDPA 1H3HA 2JW4A 2RI5A 1AZEA 1WHMA 4PJOG 1WQWA 2B86A 1U8RA 2PTKA 3A8GB 1GXIE 1YHQA 2M02A 3ASKA 1K9MC 4DBRA 3M58A 1WFWA 4JZ4A 2LTOA 3M55A 3V7SA 3GLXA 2EQMA 3PIPA 2LJ3A 1G3TA 1TG0A 1QP2A 3CBPA 3OY9A 3CC2Q 4TVRA 4JRIA 5LJ5f 2F2WA 2CUBA 2WSEE 3HP9A 3UA7A 1T0HA 3CPFA 2EKHA 3TSWA 1WLPB 1TUCA 5FRNA 3EHQA 3JB9H 4LDVA 4ORZA 1YIJQ 1K76A 2ATCB 4N4GA 5FWCA 1PKTA 1RI0A 2HSEB 3ME9A 5CO7A 1Y07A 3OYEA 1AOJA 1VQLT 4RTTA 2KGTA 2ROTA 4WTOB 1HYOA 2PU9B 3P8BB 1Y57A 3QG1A 2XD0A 3CC7A 4M75F 1E7OA 4XTVA 1DJ7B 3M4YA 3LH5A 3CCMA 5GAN5 1D0XA 2OTJT 4E47A 4KH0B 1ACMB 1ZA1B 2PVGB 5CKHA 2M16A 2FZGB 3TVTA 1BIAA 2E41A 3BW1A 1YJ9T 4A4GA 3JCMc 3RESA
chains in the Genus database with same CATH topology
1QVGP 3G6EQ 1QVFP 3CC2Q 2OTLQ 1YJ9Q 1N8RR 1YJWQ 1K8AR 1VQMQ 1KC8R 3CC4Q 1NJIR 1VQ5Q 3CCLQ 1VQKQ 3CCQQ 1YITQ 1YI2Q 1VQ8Q 1Q82R 1YIJQ 1YJNQ 3CCRQ 1W2BP 1VQOQ 1K73R 3CMAQ 3G4SQ 1VQ6Q 1JJ2P 2QEXQ 1KD1R 1M1KR 1S72Q 3I56Q 1Q7YR 3CC7Q 3CCSQ 3I55Q 2QA4Q 1VQPQ 1VQ4Q 3CCVQ 3CCEQ 2OTJQ 1VQ7Q 3CMEQ 1KQSP 3CCMQ 1VQ9Q 3CCJQ 3G71Q 1Q81R 3CXCP 1YHQQ 3OW2P 3CPWP 1K9MR 1VQNQ 3CD6Q 1VQLQ 3CCUQ 1Q86R 1M90R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG P;  3G6E Q;  1QVF P;  3CC2 Q;  2OTL Q;  1YJ9 Q;  1N8R R;  1YJW Q;  1K8A R;  1VQM Q;  1KC8 R;  3CC4 Q;  1NJI R;  1VQ5 Q;  3CCL Q;  1VQK Q;  3CCQ Q;  1YIT Q;  1YI2 Q;  1VQ8 Q;  1Q82 R;  1YIJ Q;  1YJN Q;  3CCR Q;  1W2B P;  1VQO Q;  1K73 R;  3CMA Q;  3G4S Q;  1VQ6 Q;  1JJ2 P;  2QEX Q;  1KD1 R;  1M1K R;  1S72 Q;  3I56 Q;  1Q7Y R;  3CC7 Q;  3CCS Q;  3I55 Q;  2QA4 Q;  1VQP Q;  1VQ4 Q;  3CCV Q;  3CCE Q;  2OTJ Q;  1VQ7 Q;  3CME Q;  1KQS P;  3CCM Q;  1VQ9 Q;  3CCJ Q;  3G71 Q;  1Q81 R;  3CXC P;  1YHQ Q;  3OW2 P;  3CPW P;  1K9M R;  1VQN Q;  3CD6 Q;  1VQL Q;  3CCU Q;  1Q86 R;  1M90 R; 
#chains in the Genus database with same CATH topology
 4KGX B;  1RAE B;  4OMO A;  3C12 A;  1M1K U;  4KUL A;  5A2Q E;  5LJ3 j;  1UGP B;  4ZN3 A;  1QWE A;  4II1 A;  3SHW A;  2YRD A;  4PLL A;  4J9G A;  4ZN1 A;  5KYX A;  3FC3 A;  3PGG A;  4OML A;  1NYG A;  5GAM d;  2XG8 D;  4C92 F;  1UFF A;  1N27 A;  1WJS A;  4NS5 A;  5KYN A;  2B8A A;  3G71 Q;  5IHK A;  2DZC A;  2FO0 A;  4RG2 A;  2GBQ A;  2JM9 A;  2RJF A;  4IUR A;  1BKB A;  3QUI A;  1G3S A;  2GNC A;  5ECA A;  4FSX A;  1Q7Y C;  5D6Y A;  2PUK B;  3FRN A;  3VUB A;  4C8Q G;  4XU2 A;  2K7A A;  5GJW B;  2LQK A;  1Y71 A;  1PD1 A;  1WA7 A;  2A7Y A;  3NGP A;  4F14 A;  4BY6 C;  4EDU A;  9ATC B;  4PJO C;  5KYX B;  1B07 A;  1OU8 A;  3C4S A;  1K4U S;  1G3Y A;  2OTJ A;  3H41 A;  5KYW A;  2OAW A;  2MPX C;  2E3I A;  3M0R A;  4IUQ A;  1X6O A;  3BY7 A;  1KIK A;  2YUQ A;  5GMK m;  4M7A D;  2P0K A;  4A4F A;  4PKC C;  1N5Z A;  1KC8 C;  2FZC B;  2GCX A;  4LDY A;  3L2V A;  1HK9 A;  3Q1J A;  3QPH A;  2CP6 A;  1NBE B;  2KT8 A;  3MEW A;  4PJJ A;  1Y0M A;  1VQ4 A;  3C0C A;  4JRP A;  4BE2 A;  2CH4 W;  3JAM E;  3TCJ A;  1Y96 A;  1WHG A;  2E3H A;  2QYZ A;  2V8J A;  2J6K A;  2J7I A;  4DA4 A;  5GAO l;  1QMC A;  3OYK A;  4OB1 B;  1IHW A;  4C5I A;  4JS4 A;  2HDA A;  5KYW B;  4LN2 A;  2P0Q A;  5CKE A;  3LW5 E;  1N8R R;  1QQJ A;  2KK4 A;  1OZ3 A;  3G4S T;  1AVZ C;  1SG5 A;  2L3S A;  1BCM A;  2QA4 A;  1BI0 A;  3CME A;  1QVG A;  1C1A A;  1QVF A;  1JXM A;  2E1H A;  1VQO Q;  4Y28 E;  3CCE T;  3OYF A;  3PT9 A;  3OS1 A;  2HAX A;  1RAB B;  4J9B A;  1X69 A;  4A4H A;  4FT4 A;  2NLU A;  2V1Q A;  1Y96 B;  2RJE A;  1KD1 C;  3JCM e;  4MDW A;  1I8F A;  4JJD A;  1JO8 A;  2RH2 A;  3MEU A;  2MF2 A;  3MP8 A;  1I5O B;  2FB7 A;  4B6M A;  3JCM X;  3QBY A;  2WSC E;  3FIF A;  3LH0 A;  5IT9 E;  1B34 A;  3X24 B;  1TTH B;  3OBY A;  3H9N A;  3QYG B;  2KSS A;  2RNA A;  3ZEH A;  4B9X A;  1SKU B;  2V8I A;  2O31 A;  2V1R A;  1LVK A;  4C8Q C;  4ESR A;  5GAN g;  1WHK A;  5CIU A;  4DEY A;  4M7A F;  3RER A;  4KGZ B;  4IUU A;  2EQU A;  2J6O A;  2QAS A;  1SF9 A;  4J6Y A;  5AYF A;  2L0A A;  5CQX A;  4F04 B;  5LJ5 d;  1QW1 A;  3RDV A;  2DYI A;  1KK7 A;  3GF5 A;  1VQN Q;  1X2K A;  2DER A;  2E70 A;  2YLC A;  1Q82 C;  1HJD A;  3VS6 A;  1VQM Q;  3VS1 A;  3CC4 Q;  5AT1 B;  1MUZ A;  2JJ9 A;  1K73 R;  3EGX A;  3CCV T;  1B34 B;  4RTX A;  2X4Y A;  3PFS A;  4ZGJ B;  4J9F A;  2DBM A;  4E7I A;  2M9U A;  1Q86 C;  2HD0 A;  2JVV A;  2DAQ A;  5IHN A;  2K5I A;  1ZUY A;  3RR6 A;  1TXQ A;  4EPC A;  2HMA A;  2VB6 A;  1NYF A;  1BI1 A;  4NL3 A;  3NFC A;  1S1N A;  2JS0 A;  2CP5 A;  1KHC A;  3OYN A;  1JJ2 S;  4A4E A;  1UJ0 A;  2DMO A;  2J6F A;  2Y90 A;  1VQ6 Q;  1BI3 A;  1VQP Q;  1SEM A;  1IO6 A;  2DRK A;  1WJQ A;  1M3C A;  1LJO A;  2KBT A;  2MOX A;  5GAO q;  4LUE A;  4R0K A;  4RG8 A;  3EGX B;  4D6W A;  5KCO A;  1YIT T;  1BYM A;  1OUL A;  2GQV A;  2EJG A;  2DIG A;  5FWB A;  2RB6 A;  5GMK i;  3CC2 A;  4QQD A;  4PFP A;  4FSS A;  1SSH A;  1VA7 A;  4JJN K;  3CD6 Q;  2NWM A;  4FW2 A;  1YIJ A;  1I1J A;  1IZ6 A;  3BDU A;  1K0S A;  2RA2 A;  2RQT A;  4FM4 B;  4PJM A;  2DZ9 A;  1PG5 B;  3CCQ Q;  4L6V 5;  2HEQ A;  5IAY A;  3CBO A;  4F7U E;  3J81 E;  2HQE A;  3CPW S;  3TQ7 P;  1MMD A;  5GAM j;  5LJ3 g;  1M1G A;  4LD6 A;  4E6R A;  4XTU A;  2LCL A;  5FU6 B;  2BE7 D;  2DL5 A;  1KD1 U;  4BDY A;  2OTL Q;  2CSQ A;  3CCL T;  1VIF A;  3RBB B;  3CXC A;  3FLG A;  1D1A A;  1HXD A;  1BIB A;  3VJP A;  2F1L A;  2QTV A;  1WNL A;  1OX9 A;  2HKQ B;  2EGA A;  3HFO A;  1W2B A;  1RLP C;  2DO3 A;  1W6X A;  4PJO D;  2DXU A;  5GAO r;  2D8J A;  4J9I A;  2KMT A;  2KRM A;  1QVP A;  3EG3 A;  3CQT A;  2HKN A;  3EFR A;  1ZUU A;  1K8A R;  1UUE A;  1VQ8 T;  2IVW A;  4C0D B;  2RHX A;  1SPK A;  3RKW A;  3G71 A;  3JCM Q;  1H3Z A;  1U5S A;  3S3M A;  4J9H A;  3LWI A;  2CYZ B;  3QII A;  1XQH A;  4DBQ A;  2DLP A;  1ZBX A;  4AFQ C;  2EW3 A;  4ZTJ A;  3CCU Q;  1LCK A;  4GLM A;  1KQS A;  3OW2 A;  4PL6 A;  1R77 A;  1ABQ A;  3LX7 A;  1U06 A;  3X20 B;  2EAY A;  3QJY A;  2JNG A;  5GAO n;  4PJN A;  2DJZ A;  3UPU A;  3M0Q A;  2KRS A;  1Q86 U;  3M0U A;  2ZPB B;  1RAG B;  2E12 A;  3FJ5 A;  3OYG A;  1I0C A;  1ARK A;  2DE0 X;  1XNI A;  2A37 A;  2MI6 A;  3MEA A;  5I2S A;  4M7D A;  1NJI R;  1ZQ1 A;  3VUZ A;  1YJN Q;  1OU9 A;  3OQ5 A;  2NYS A;  2A28 A;  4IUP A;  2MCN A;  3FB9 A;  1RAI B;  4BB7 A;  5IN1 A;  1ZX6 A;  4M77 A;  5HK3 A;  4R56 A;  4QW2 A;  4OGC A;  4Z8A A;  1FX7 A;  4PFZ A;  2W0Z A;  2CT4 A;  1M90 R;  3V8L A;  4JDS A;  1YCS B;  3SEM A;  1JU5 C;  1RAA B;  5KCH A;  1D3B A;  1TU0 B;  3OBW A;  2KYM A;  4PJO F;  4EMG A;  2DRM A;  2L8D A;  1YHQ T;  1IRE B;  2AT1 B;  1IRX A;  2XIC A;  4X9C A;  3GOX A;  2QQA A;  2FEI A;  3I5R A;  2K6D A;  4XK8 E;  1VQM T;  4M7D B;  3MEV A;  4N4H A;  3CC4 T;  3JCM g;  4C8Q D;  4J7I A;  1WXB A;  2X9H A;  3HHT B;  2DX1 A;  2E5Q A;  3SWN C;  2VWF A;  1GCP A;  4M77 B;  2EYZ A;  2QQ9 A;  2EJ9 A;  1M2V A;  1GRI A;  4EIK A;  2MWO A;  2RI2 A;  4IIO A;  4F7U G;  3I55 Q;  2EYY A;  1UGR B;  5GAN e;  1IGQ A;  2KI7 A;  4XU3 A;  2EVR A;  3MHX A;  5LJ5 j;  1D3B B;  3JCM d;  4ZTF A;  3JRZ A;  2A36 A;  2M51 A;  4J6W A;  4YTL A;  2YRV A;  3OYM A;  3A5Z B;  5GAN h;  2HZY A;  2JTE A;  1VQ7 T;  1E6G A;  2LX7 A;  3M9Q A;  3I56 Q;  4HCC A;  1GL5 A;  1WIE A;  4LXC A;  1MHN A;  3S6W A;  4M78 A;  2RI3 A;  2ZPH B;  2FZK B;  4KT0 E;  3HRS A;  1M2V B;  4C5G A;  2P4R A;  1GCQ A;  4J9C A;  2LC4 A;  3UA6 A;  3OYA A;  3ZBD A;  4ELZ C;  1UHC A;  2HBW A;  1VQN A;  1X6G A;  1M1F A;  1B7T A;  3CCS Q;  3CD6 T;  1WXT A;  2YUN A;  1X43 A;  1VQM A;  3EFS A;  3CC4 A;  3TEE A;  1NEG A;  3MO8 A;  5LL6 S;  1YN8 A;  4X9D A;  3LYI A;  1X01 A;  4HCZ A;  4A63 B;  1ZSZ A;  2X51 A;  1PHT A;  4MML A;  4X1V A;  2VXF A;  4M78 B;  1TUD A;  3SD4 A;  1E6H A;  2CT3 A;  4C8Q F;  2EIF A;  4F17 A;  1FMW A;  2OTL T;  5GAN f;  3TU4 K;  2A3L A;  1VQ6 A;  1Z9Z A;  4M75 A;  2VXE A;  1CSK A;  3EFO B;  1VQP A;  4WCI A;  1VQ7 A;  3UDC A;  2FG0 A;  1MMN A;  3SB2 A;  4EMH A;  1YBY A;  2M1H A;  3A8M B;  3QSU A;  1OEB A;  1UGV A;  2ED0 A;  3KXT A;  2MYS A;  4B9W A;  1JRI A;  1UE9 A;  1ZSZ B;  3MKD A;  1O9S A;  2HSP A;  5LJ3 e;  4BD3 A;  3HTR A;  1Q81 U;  1NE8 A;  1VQ4 T;  5FU7 B;  1JJ2 P;  2RHY A;  2KVQ G;  3CD6 A;  4C92 A;  3E19 A;  4XAX B;  1M1K R;  2YUP A;  1CKA A;  4OVA A;  2NUP A;  2EYQ A;  3WVD B;  3L2Q A;  3CCU T;  4M75 B;  5LJ3 h;  2AKK A;  4FU6 A;  3CCQ A;  5GAN 7;  1WZO A;  1OZ2 A;  2HNI A;  4Z02 A;  2I0N A;  4LD9 K;  1T0J A;  3UF4 A;  3HFN A;  3DKM A;  2QA4 T;  3HRU A;  3CME T;  2XKO C;  3JB9 J;  4N4I A;  4FYV B;  1HD3 A;  2OTL A;  4KBM B;  4RCC A;  4EMK A;  2PVO B;  4BI3 A;  3WXM B;  2LCC A;  3OS5 A;  2K79 A;  5FRO A;  1YJN T;  1VOM A;  1Y7X A;  4C92 B;  5J3B A;  1WPY A;  2WAC A;  2EYW A;  2IG0 A;  2NUP B;  3VRZ A;  4AG1 C;  4J9D A;  5I2M A;  4Y91 A;  4A53 A;  1AD5 A;  4CC4 B;  2JOY A;  2KRN A;  1NEB A;  1YP5 A;  2DM1 A;  1NM7 A;  3M57 A;  3CPW P;  3N5B B;  4D8D A;  2F5T X;  2K57 A;  3EG0 A;  2C06 A;  2LZ6 B;  1X6B A;  4HVW A;  3PMT A;  4AFS C;  1YJW Q;  1LPL A;  2EQJ A;  3INZ A;  5GAN 2;  2HCK A;  5LJ3 f;  3M59 A;  4BE1 A;  2HL3 A;  1WHJ A;  1WI7 A;  1FXX A;  4EMK B;  1K9M U;  1GFC A;  1UGQ B;  4IIM A;  3CCU A;  2O9S A;  1K1Z A;  1EZZ B;  2CZ7 B;  2LVM A;  3OYJ A;  5GMK j;  1D09 B;  3HKS A;  4E7K A;  1QWF A;  2E10 A;  4OGE A;  1D0Z A;  2ZPE B;  4OMF B;  2XID A;  2VGM A;  3OA6 A;  3P8H A;  2NUZ A;  2I2L A;  5HY6 A;  3H0H A;  4MMK A;  5GAN 6;  4OB0 B;  2ENM A;  1PRM C;  2EYX A;  1IHV A;  2FPE A;  2P4T A;  1YJN A;  2RHI A;  1TWB A;  2F2X A;  1J3T A;  3QDR B;  4MZT A;  3QWY A;  4XU1 A;  3VKI A;  3I56 T;  4OMQ A;  3QO3 A;  1SRM A;  4N0A C;  1SHF A;  2DL4 A;  2Y4X A;  5I11 A;  4OB2 B;  3HPW A;  3JCM h;  4FT2 A;  4D8K A;  7AT1 B;  1NLO C;  1I5L A;  1WHL A;  1D1C A;  2QI2 A;  5CQY A;  1PRL C;  1YCY A;  3D7S B;  3PNW C;  1HSQ A;  3OS0 A;  4M7A A;  3CCS T;  2BE9 B;  2OI3 A;  2DF6 A;  4AFZ C;  4C5E A;  5HK0 A;  5M9O A;  1TSF A;  1K8A C;  2DPP B;  3CC2 T;  8AT1 B;  2FRY A;  3A98 A;  3AT1 B;  2ZCF B;  4Z88 A;  1Q7Y U;  2DTO A;  1YIJ T;  4J6X A;  3I55 A;  1D0Y A;  1X75 C;  3TSZ A;  5GAN d;  1N9S A;  3ER0 A;  5C0M A;  2EWN A;  2CRE A;  3S3O A;  3CBM A;  5FRM A;  2KRO A;  2LJ1 A;  1VQ9 Q;  2RJD A;  4M7A B;  1M27 C;  2CP7 A;  2RMO A;  3I56 A;  1KFZ A;  2YDL A;  3G7Z A;  2Z0W A;  3JCM f;  4DOV A;  3E9F A;  4HXJ A;  2QEX Q;  4C0G A;  2YUO A;  4Q5W A;  4JS5 A;  1H8K A;  1KC8 U;  2GQI A;  3V7R A;  3H6Z A;  1TOV A;  1NJI C;  1R8O B;  1VUB A;  4JJB A;  5J26 A;  3VRY A;  4GBQ A;  4XTY A;  4RTU A;  3BDL A;  1CKB A;  4QKU A;  2XMF A;  3CCS A;  4BAC A;  3RMS A;  3O5Z A;  4E7J A;  3ZL7 C;  3VS2 A;  2DL7 A;  1C6V X;  4R55 A;  4QQ6 A;  3FJP A;  8ATC B;  3G71 T;  3KFV A;  3NTH A;  3JCM b;  1M90 C;  4J83 A;  1AWX A;  3EG9 A;  1M3A A;  2ZPI B;  1VYT A;  1WQ7 A;  1BI2 A;  5J39 A;  1PKS A;  4DEX A;  1G2B A;  1G8X A;  1EIF A;  2AK5 A;  1PD0 A;  4RTW A;  2FYK A;  3RIR A;  2CZ0 B;  2PNI A;  5KE2 A;  2R5M A;  4QVD A;  3JB9 G;  2W10 A;  1OOT A;  2XDB A;  5GAM e;  5D6X A;  4RMO A;  2ZAE A;  2BUD A;  2LQ8 A;  2IIM A;  3NMZ C;  2CDT A;  2HBP A;  5KE3 A;  3A8L B;  1PC0 A;  2VYT A;  1JXO A;  3H8Z A;  3EG9 B;  5I21 A;  2QG9 B;  4BUG A;  2MAM A;  2CP3 A;  1JB0 E;  4RTZ A;  1N9R A;  2D1X A;  2K5F A;  1H64 1;  1K0X A;  2JN0 A;  2CS7 A;  3RNJ A;  2Y4Y A;  1YJW T;  2EGC A;  2JS2 A;  2XU8 A;  5LJ3 d;  3UT1 A;  1VQL Q;  3OB9 A;  2VUB A;  3PMI A;  4ATO A;  3ZFJ A;  3P8D A;  4JJC A;  5DLO A;  4M7D E;  3EG2 A;  3ULR B;  1MND A;  3A8O B;  1UEB A;  5CR2 A;  3OYC A;  2HQH A;  2EGE A;  3JB9 I;  4LDW A;  4M77 E;  2CH4 A;  2RN8 A;  2OX7 A;  4X34 A;  2O2O A;  3L1A A;  1OI1 A;  2DKG A;  5FLX E;  1Q82 U;  2MWP A;  1YJ9 Q;  3M0P A;  1VQO T;  1P92 A;  4M4Z A;  2DTH A;  3MP6 A;  3O8V A;  3CMA Q;  2BKD N;  4KGV B;  2FVU A;  1PSE A;  1ZHI A;  1RAF B;  1ZBJ A;  4F7U F;  4OF1 A;  2ED1 A;  2DXB A;  4OMM A;  1A0N B;  1Q86 R;  4OP0 A;  4RTY A;  3QJ6 A;  1FYN A;  1UEC A;  1QCO A;  1AEY A;  4RTV A;  2K3Y A;  1OQK A;  3M53 A;  2X35 A;  2QK0 A;  3H0I A;  2QDY B;  1ZLM A;  1TUG B;  3EGU A;  5CKF A;  1YJW A;  1WXU A;  5CKD A;  4P5N A;  2DTI A;  4FYY B;  4LUD A;  4PJO A;  3RKY A;  4J7F A;  1YI2 Q;  5C6S A;  3S3N A;  2KT1 A;  5L8R E;  4KH1 B;  2P84 A;  2F69 A;  1VQN T;  1OYX A;  4M78 E;  4XQ3 A;  5GAO p;  4Z89 A;  3G1J A;  1QP3 A;  2ZPG B;  4KUD K;  1VQO A;  5A0L A;  3IQL A;  5GJV B;  4MDX A;  1NPP A;  2DK3 A;  1M1K C;  2C0I A;  1C0M A;  2E5K A;  3E1S A;  2BZY A;  1MGQ A;  2PVD B;  4ME7 A;  4LDU A;  1XTD A;  2YRC A;  2GGR A;  1JJ2 A;  3CXC P;  2L3P A;  2RM4 A;  4BY6 B;  2CSI A;  2YSQ A;  4PJO B;  2RQR A;  3OMG A;  1G5V A;  1I81 A;  3PVQ A;  2E6N A;  1VQ6 T;  1T3S A;  2L3R A;  3NPF A;  4J9E A;  4JPB W;  3M4G A;  1VQP T;  3G4S Q;  3VS4 A;  2AIR B;  3CCE Q;  1OPL A;  2LQW A;  1NPR A;  1RUW A;  2CP0 A;  1QVG S;  1QVF S;  2DA9 A;  1LOJ A;  3NTK A;  1UDL A;  2BIV A;  2RQU A;  2LT4 A;  2LNH B;  2LJ0 A;  4M75 E;  3DLL A;  4JRK A;  4M7D G;  5FU6 C;  2D0N A;  2VGN A;  3J7A F;  2K2V A;  4A54 A;  1VYV A;  4HVV A;  4MZM A;  3RMQ A;  3EFO A;  4M77 G;  3A1P A;  1ZUK A;  4DOW A;  1KQS P;  4OB3 B;  4HT9 A;  2P0P A;  2H3J A;  3JCM J;  1X2Q A;  2ESW A;  3OSS C;  2QGG A;  3CCQ T;  1R0C B;  2QAZ A;  1M5Q 1;  3CPW A;  4DBH A;  2O4X A;  1X27 A;  4C0D C;  1MMG A;  4CC7 A;  3MPU B;  4C92 E;  2XHC A;  1RL2 A;  2CGH A;  2DJQ A;  2RHZ A;  4C8Q A;  1VQ9 A;  1IB8 A;  3I9Q A;  3PVL A;  2MIO A;  2E4H A;  2K2M A;  4QVC A;  1AWJ A;  1VIE A;  1N8R C;  3VYH B;  4HT8 A;  2FL7 A;  4IUV A;  2DIL A;  3C95 A;  6AT1 B;  2QEX A;  1B3Q A;  2KXD A;  2M0Y A;  3VS5 A;  1SSF A;  1ZA2 B;  2F2V A;  2AZV A;  2K3B A;  3CCV Q;  3REB B;  1UHF A;  3RKX A;  1AHJ B;  4XTW A;  2DEU A;  1PCX A;  2O4X B;  5HKC A;  2JMA A;  5HCK A;  2GTO A;  5KYU A;  2BZX A;  2X3W D;  4C8Q B;  3MJX A;  1VQK Q;  3E9G A;  5KH6 A;  2C0O A;  5GAM g;  2KXC A;  4AG2 C;  1MNE A;  2EQK A;  3LWH A;  3H0F A;  2VVK A;  4M78 G;  4WF2 A;  1Q81 R;  3R6N A;  3A8H B;  1PSF A;  4E7H A;  1KHI A;  3X28 B;  1G83 A;  3G6E Q;  5IH2 A;  3UWN A;  2KAF A;  1NG2 A;  1WX6 A;  4K11 A;  3QDF A;  4FW1 A;  3CMA T;  1EX4 A;  1M3B A;  2LP5 A;  4QT7 A;  3MET A;  1YIT Q;  3M0T A;  4QVZ A;  1N6A A;  3SFM A;  4RUG A;  1UGS B;  2JUF A;  2XK0 A;  5GMK l;  1M30 A;  5KYU B;  1VYU A;  5DLQ E;  4BDZ A;  2J05 A;  1SHG A;  3EAE A;  2O88 A;  2O01 E;  4JZ3 A;  4E7L A;  2CZ6 B;  2MMP A;  2OJ2 A;  4M7D C;  1K73 C;  3F70 A;  4E7Z A;  4KUI A;  4O5V A;  1M2O A;  3RUX A;  3DB3 A;  3T9N A;  2AZS A;  1BBZ A;  2V26 A;  2MK5 A;  4M77 C;  1VQL A;  1YWP A;  5CAI A;  1BCO A;  4ZGD B;  3CEY A;  3E2U A;  2DVE A;  2YHT A;  4M75 G;  1YI2 T;  2DYB A;  4OMN A;  2K4Y A;  3OYH A;  4FCY A;  4XTX A;  1XOV A;  1U1T A;  3JV3 A;  5A0D A;  3CCL Q;  1D1B A;  1WGS A;  3BE3 A;  2KR3 A;  3CCR Q;  4GY5 A;  1RAC B;  2K5L A;  3VS7 A;  3CXC S;  1YJ9 A;  4BI4 A;  1GBQ A;  5GMK e;  3CCJ Q;  1U3O A;  1K9M R;  2JTF A;  1YFN A;  2QQB A;  2RHU A;  3EH1 A;  3CMA A;  1RAH B;  3JB9 D;  4BI8 B;  1RLQ C;  2EFI A;  1W2B S;  2FRW A;  4M7A E;  3JSC A;  4J5Y A;  4HCK A;  1VQ8 Q;  2DL3 A;  1XJW B;  3EH2 A;  5GMK h;  4C92 G;  3I55 T;  1JQQ A;  5CK9 A;  1S72 Q;  1BK2 A;  5I22 A;  1IXD A;  3JCM V;  1N8R U;  4JLG A;  2ECZ A;  1M8V A;  2VKN A;  2AKL A;  2RF0 A;  4QQG A;  2D9T A;  3TRE A;  2LDM A;  2RJC A;  3M0S A;  2R57 A;  3VU3 C;  4PK4 A;  2ZGW A;  4JLI A;  3AHU A;  1QCF A;  2DFU A;  2YWW A;  2X3X D;  4DBF A;  1KQS S;  1QKW A;  3OW2 S;  1AT1 B;  4M78 C;  4IKF A;  2DXT A;  3KUF A;  2JXB A;  2LT1 A;  2VC8 A;  5GAO m;  1YWO A;  2G3R A;  5D7U A;  1YI2 A;  3GPL A;  1R0B G;  1RI9 A;  3NHN A;  1GCQ C;  1QCN A;  2IPO B;  2DBK A;  2H3E B;  2JTM A;  3THK A;  4HA8 A;  2E6Z A;  3C94 A;  1PNJ A;  1UJY A;  2E65 A;  2QQS A;  2PZ1 A;  5LJ5 g;  4MZP A;  1M4Z A;  3I35 A;  1U1S A;  3X25 B;  3X26 B;  3VS3 A;  1OV3 A;  4E2F B;  2F5K A;  1ZSZ C;  4C0Z A;  4E7S A;  3OSV A;  2PUO B;  3V8J A;  3VYG A;  3L2W A;  3L2R A;  1VQ5 Q;  3I5S A;  2YXY A;  2LQN A;  1AWW A;  3SDZ A;  2DIQ A;  3DLM A;  1Q7Y R;  5FU7 C;  4FYX B;  3V8K A;  2KYB A;  1YHQ Q;  3JB9 F;  2QTX A;  3WVE B;  1V1C A;  4M75 C;  1WYX A;  1K73 U;  2O9V A;  4GLK A;  3G4S A;  2KQW A;  1OX8 A;  5FW9 A;  4ZNX A;  1F1B B;  2CZ1 B;  2X4W A;  3PTA A;  3CCE A;  3QZ9 B;  1TS9 A;  2CUD A;  4NOY A;  3SWN A;  2R5A A;  2QQR A;  1FMV A;  4AMC A;  4AFU C;  3JCM P;  1BU1 A;  2GFA A;  2RK1 A;  2RPN A;  4KRT A;  5DY9 A;  5IXB A;  3FEO A;  3OYL A;  5KYY A;  2JMC A;  1VQK T;  4CRI A;  4OMP A;  2LX9 A;  2COW A;  1KC8 R;  3GIB A;  2DEQ A;  4C92 C;  5DM7 R;  4NL2 A;  5D6W A;  1M8M A;  3L42 A;  1QKX A;  2QXF A;  3CC7 Q;  4RKU E;  2V8K A;  1VQ7 Q;  4ELY C;  5GAN 8;  3G6E T;  3CCM Q;  4CI0 C;  4C0F A;  3GNG A;  2KDS A;  1Q95 G;  2EBP A;  1QVG P;  1QVF P;  2RQV A;  3SWN B;  3EHR A;  3GBQ A;  2COY A;  2RO0 A;  1NLP C;  4M7A G;  1K9A A;  4CC3 A;  1WJR A;  3VS0 A;  1SRL A;  1AZG B;  2ZZD A;  2KNB B;  1H92 A;  2GF7 A;  2OAU A;  4FYW B;  4EMK C;  5KYY B;  1I07 A;  1KJW A;  4CC2 A;  3HL8 A;  3QWX X;  4L59 A;  1MV0 B;  2EJF A;  1MV3 A;  2D8H A;  1PM3 A;  3URG A;  1KSW A;  1WDX A;  2WSF E;  1JEG A;  1W1F A;  2LRQ A;  3REA B;  3CCV A;  2DET A;  3L2Z A;  1V29 B;  5GAM h;  1KD1 R;  1MMA A;  4M7D D;  2BTT A;  2CP2 A;  1G3W A;  1T3L A;  4AT1 B;  3M54 A;  4JRQ A;  1VQK A;  2R58 A;  1NZ9 A;  3V7C A;  3KBG A;  1AWO A;  4M77 D;  3L2U A;  3CCR T;  2KY9 A;  2FPD A;  3BFM A;  2C0T A;  2ZPF B;  1WHH A;  5A0G A;  1RAD B;  3CCJ T;  2EKO A;  3QZ5 B;  3G6E A;  4PLI A;  1K8A U;  2OTJ Q;  1UTI A;  1GBR A;  4LNP A;  2K9G A;  1YIT A;  1KG1 A;  3VV0 A;  1IGU A;  1EFN A;  2PQW A;  1UB4 A;  2FPF A;  3EGD A;  4FL6 A;  4PJO E;  2YT6 A;  5EG2 A;  1ABO A;  3LGF A;  1S72 T;  3UAT A;  1Q82 R;  4HCB A;  4XTZ A;  2L89 A;  4J8O A;  1VQ4 Q;  1V76 A;  4F7U A;  4RCB A;  1KQ2 A;  2DD4 A;  5GAM f;  2DXC A;  2FHD A;  4PJL A;  2VAS A;  2RD1 A;  2L3Q A;  1M9S A;  2GTJ A;  2L5Q A;  3LGL A;  2KE9 A;  3MCA B;  3J80 E;  3NTI A;  4VUB A;  3EG1 A;  2SEM A;  1OPK A;  4A4K A;  4LDX A;  4Y92 A;  2LCS A;  1O75 A;  2QA4 Q;  2H8H A;  3CME Q;  3U23 A;  3EGD B;  1BB9 A;  1NJI U;  3CCL A;  5GAN 4;  2AHJ B;  4PNO A;  5L23 A;  2J06 A;  3CCR A;  1JBM A;  2JM8 A;  2A08 A;  5CKB A;  2M0O A;  4M7A C;  2L2P A;  4ANJ A;  4M78 D;  1UG1 A;  2DNU A;  2HL5 C;  4F7U B;  3CCJ A;  4M7D F;  2NUT A;  3DB4 A;  4C5H A;  2EPD A;  1M90 U;  2QDL A;  1YNZ A;  3LLR A;  1FMK A;  1FWZ A;  2KEA A;  2JT4 A;  3FDR A;  4M77 F;  2A0F B;  3JCM W;  1QLY A;  1TH7 A;  1VQ8 A;  1Z9Q A;  1KQ1 A;  2SRC A;  5IXF A;  3GNF B;  4UC4 A;  4XU0 A;  3OYY A;  4L5G A;  1VQ5 T;  3GP8 A;  1S72 A;  1GFD A;  2E64 A;  2QGF B;  3QXE B;  2YLB A;  1W70 A;  4PFO A;  2K3X A;  1W4S A;  1Q81 C;  4HVU A;  2ROL A;  2CKK A;  1ZSG A;  5CVI A;  3QHS A;  2XI9 A;  5GAN 3;  1VQ9 T;  3R6O A;  2DVJ A;  4V2S A;  5LJ5 e;  4HKE A;  2LNV A;  2NUT B;  2JZ2 A;  2D6F A;  4F16 A;  2BZ8 A;  2QEX T;  4LE9 A;  4DQ2 A;  1W2B P;  2RQW A;  4C8Q E;  3HRT A;  3M56 A;  4M75 D;  2LMJ A;  4JUV A;  3MP1 A;  3QYH B;  2COZ A;  5LJ5 h;  3PIO A;  1PWT A;  2G6F X;  5GAN j;  5EC7 A;  3QKJ A;  3PE0 A;  2X4J A;  5CCA A;  3OYD A;  3OYB A;  2HQX A;  2XDD A;  1I4K 1;  1LNX A;  5IHI A;  3CC7 T;  2D0Q B;  4ZGE B;  2X4X A;  3CCM T;  4BE0 A;  3OYI A;  2VV5 A;  2DL8 A;  3M5A A;  2DD5 A;  4O6J A;  4FIB A;  2EQI A;  4N0A A;  4IUT A;  2ABL A;  3OW2 P;  1VQ5 A;  3OS2 A;  2RK2 A;  4C92 D;  3HSB A;  2GFU A;  4M78 F;  3OMC A;  2XDP A;  1H3H A;  2JW4 A;  2RI5 A;  1AZE A;  1WHM A;  4PJO G;  1WQW A;  2B86 A;  1U8R A;  2PTK A;  3A8G B;  1GXI E;  1YHQ A;  2M02 A;  3ASK A;  1K9M C;  4DBR A;  3M58 A;  1WFW A;  4JZ4 A;  2LTO A;  3M55 A;  3V7S A;  3GLX A;  2EQM A;  3PIP A;  2LJ3 A;  1G3T A;  1TG0 A;  1QP2 A;  3CBP A;  3OY9 A;  3CC2 Q;  4TVR A;  4JRI A;  5LJ5 f;  2F2W A;  2CUB A;  2WSE E;  3HP9 A;  3UA7 A;  1T0H A;  3CPF A;  2EKH A;  3TSW A;  1WLP B;  1TUC A;  5FRN A;  3EHQ A;  3JB9 H;  4LDV A;  4ORZ A;  1YIJ Q;  1K76 A;  2ATC B;  4N4G A;  5FWC A;  1PKT A;  1RI0 A;  2HSE B;  3ME9 A;  5CO7 A;  1Y07 A;  3OYE A;  1AOJ A;  1VQL T;  4RTT A;  2KGT A;  2ROT A;  4WTO B;  1HYO A;  2PU9 B;  3P8B B;  1Y57 A;  3QG1 A;  2XD0 A;  3CC7 A;  4M75 F;  1E7O A;  4XTV A;  1DJ7 B;  3M4Y A;  3LH5 A;  3CCM A;  5GAN 5;  1D0X A;  2OTJ T;  4E47 A;  4KH0 B;  1ACM B;  1ZA1 B;  2PVG B;  5CKH A;  2M16 A;  2FZG B;  3TVT A;  1BIA A;  2E41 A;  3BW1 A;  1YJ9 T;  4A4G A;  3JCM c;  3RES A; 
#chains in the Genus database with same CATH homology
 1QVG P;  3G6E Q;  1QVF P;  3CC2 Q;  2OTL Q;  1YJ9 Q;  1N8R R;  1YJW Q;  1K8A R;  1VQM Q;  1KC8 R;  3CC4 Q;  1NJI R;  1VQ5 Q;  3CCL Q;  1VQK Q;  3CCQ Q;  1YIT Q;  1YI2 Q;  1VQ8 Q;  1Q82 R;  1YIJ Q;  1YJN Q;  3CCR Q;  1W2B P;  1VQO Q;  1K73 R;  3CMA Q;  3G4S Q;  1VQ6 Q;  1JJ2 P;  2QEX Q;  1KD1 R;  1M1K R;  1S72 Q;  3I56 Q;  1Q7Y R;  3CC7 Q;  3CCS Q;  3I55 Q;  2QA4 Q;  1VQP Q;  1VQ4 Q;  3CCV Q;  3CCE Q;  2OTJ Q;  1VQ7 Q;  3CME Q;  1KQS P;  3CCM Q;  1VQ9 Q;  3CCJ Q;  3G71 Q;  1Q81 R;  3CXC P;  1YHQ Q;  3OW2 P;  3CPW P;  1K9M R;  1VQN Q;  3CD6 Q;  1VQL Q;  3CCU Q;  1Q86 R;  1M90 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...