3CC2Q

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cc2Q00
1VQ4Q 3CMAQ 1VQOQ 1VQPQ 1N8RR 1Q7YR 1VQ6Q 1K9MR 2QA4Q 1Q82R 3CC2Q 1YI2Q 3CCSQ 1YHQQ 3I55Q 3CD6Q 3CC7Q 1W2BP 1K73R 1VQKQ 2OTLQ 3G6EQ 1JJ2P 1Q81R 1YJNQ 3G4SQ 3CCJQ 3CCVQ 1YJWQ 1QVFP 1K8AR 1S72Q 2QEXQ 1NJIR 3I56Q 2OTJQ 1KQSP 3CXCP 3CCRQ 3CCEQ 1YIJQ 3CC4Q 1VQLQ 1Q86R 3G71Q 1VQNQ 1YJ9Q 1KC8R 3CCLQ 1VQ9Q 1VQ8Q 3CCMQ 3CCQQ 3OW2P 1KD1R 1M1KR 1M90R 1VQ5Q 1VQ7Q 1QVGP 1YITQ 3CCUQ 3CPWP 1VQMQ 3CMEQ
chains in the Genus database with same CATH superfamily
1QP2A 2RM4A 3PFSA 3TEEA 4PLLA 1EX4A 1UECA 2VKNA 2O88A 2M1HA 3M57A 4C0FA 4XAXB 4ZN3A 1H92A 2LNHB 1JJ2P 1IHWA 4F17A 5GMKj 2YUQA 3C95A 4M4ZA 2SEMA 1RAEB 4E6RA 2DBMA 1OV3A 4J9FA 1LPLA 1Q95G 4ELYC 3CCEQ 5KYWB 3OYBA 4QVDA 2OAUA 4ZTJA 3DB3A 2FRWA 1VQPA 5DLQE 1VQPT 1QP3A 1NEGA 1VQKQ 1RI9A 1M1KC 3I5RA 1VQNA 1UGQB 1VQNT 2MK5A 2RQTA 1TU0B 4AMCA 4HVWA 3JCMX 2K3BA 4OMQA 3QJ6A 2GTJA 2KY9A 4X34A 3HRTA 2ECZA 1R0BG 2DBKA 3CPFA 2CH4A 2G6FX 4M7AB 3QUIA 5A2QE 4C8QC 4M78F 2H3JA 2Y90A 3RKXA 2A36A 2KSSA 2COWA 2HL5C 1QVGP 4FYWB 3OYNA 2KBTA 4XQ3A 4M75B 2F2XA 3QXEB 1X6GA 4GY5A 2DXUA 4RUGA 3S3MA 2FPDA 1NJIC 3OSSC 4J9DA 2R5MA 4C0GA 2HKQB 1K73R 1M90U 2MCNA 3G6EQ 2HSPA 1ZLMA 2NLUA 1FWZA 7AT1B 4J6YA 3HFNA 1PM3A 1TS9A 1VUBA 3QDFA 3OYYA 1VQMA 3TQ7P 1SRMA 1VQMT 3CPWA 4ZN1A 4X9DA 2P84A 2YUNA 2DK3A 4M77G 1ZHIA 4R55A 2BZ8A 2FPFA 2A0FB 2VXEA 2XD0A 1KQSP 2YLBA 2EBPA 3M5AA 2E1HA 2QG9B 2RQUA 1WDXA 2C0IA 4HT8A 3CPWP 3GNGA 4C8QE 1N9RA 2LVMA 1MMNA 3QZ9B 4M75G 4EDUA 1OU8A 2L2PA 2FO0A 5I22A 1Q86U 2LCLA 1VQ6A 4JPBW 1VQ6T 2ROTA 3VS7A 1MV3A 4BI8B 4LUEA 1HXDA 1U5SA 3HPWA 4OB1B 1YCSB 4PL6A 2A3LA 2KE9A 1NLOC 2LQWA 1VYTA 2OI3A 2M0OA 4RG2A 1M8MA 1ZSGA 4QW2A 1ZBXA 3CD6Q 4GBQA 1LJOA 5AYFA 2FZGB 4BY6C 4E7ZA 3JCMQ 1WLPB 2K4YA 4JRPA 1ARKA 8AT1B 2VWFA 3V7SA 1Q7YU 4B9XA 3L42A 2DAQA 2K5FA 1H3HA 2Y4XA 1JB0E 3HP9A 3T9NA 1VQOQ 4B9WA 4M7AD 1OOTA 2MOXA 5A0LA 3LWIA 2CT3A 1YI2A 3MEAA 1YI2T 2GCXA 4XTXA 5FWCA 2QEXA 2DE0X 2BZYA 2QEXT 2DKGA 4A4KA 3GF5A 1M90R 2HBWA 2MIOA 2CP6A 2YSQA 4HA8A 2JM9A 5I2MA 4JJDA 4OB3B 4ORZA 1AZEA 4F04B 1EZZB 4JJCA 2RN8A 2DL5A 4AFUC 2FZKB 2HAXA 4PK4A 4JLIA 5KYYB 2LJ1A 1D3BA 3VRZA 2QGFB 2SRCA 4DOWA 5LJ3j 4LNPA 3RIRA 1M3BA 5KYUB 2DJZA 1SSFA 1YJ9A 1FMWA 2KVQG 1YJ9T 1K9AA 2GBQA 2HQXA 3LW5E 2DL8A 1VQPQ 2ZAEA 2K79A 4XTWA 1RAIB 1D1CA 2D0QB 5CKDA 2CP0A 4F7UA 3QWYA 1VQNQ 1Q86R 1BIAA 2YHTA 1TSFA 2KNBB 2KROA 1KQ1A 2CS7A 2A7YA 2QGGA 3EGXA 2LX7A 5LJ5j 5C0MA 1KHIA 1KHCA 4BE2A 4FCYA 4M7DB 1OULA 4DBFA 2LTOA 1JJ2S 1TUDA 3INZA 2YLCA 2AKLA 3V7CA 1WNLA 2R57A 4IUUA 3GLXA 4XU1A 3ZBDA 2JJ9A 1D1BA 5CKHA 2WACA 1BU1A 3QKJA 5LJ5f 3EHQA 1Q7YR 2YUOA 3GPLA 2E5QA 1B34A 1KD1U 4MDWA 4C8QG 2LCSA 1W2BA 4D6WA 2DL7A 1VIFA 1SSHA 1WJQA 2D9TA 3JSCA 1TUGB 3J7AF 3EHRA 1N8RC 3TREA 3LX7A 4OB0B 1WQ7A 1X2KA 2D8JA 4ZGEB 1VQMQ 1Q82C 5IAYA 3JB9I 1YJWA 3BDUA 1YJWT 1Q81C 3MEWA 2RHIA 2K9GA 4C92B 1Y96B 4KRTA 2JXBA 1KC8U 3M4YA 1MV0B 1W2BP 2KT8A 2EQJA 4CC2A 4E7LA 5KYXA 3L2WA 2O4XA 3LWHA 4AFQC 3RKYA 3PIPA 1Y7XA 4JUVA 2D6FA 3MP8A 2ZGWA 3P8HA 2DL4A 3HFOA 2AZSA 1WHHA 1VQ6Q 2KK4A 4PFPA 3O5ZA 5CR2A 2I2LA 3PGGA 4JS4A 1YHQA 4Y91A 1YHQT 5GJVB 3BDLA 1DJ7B 1WQWA 1MMDA 2QQRA 4RTZA 1NG2A 1YIJA 2ATCB 2DRMA 1YIJT 5EC7A 4R0KA 1T0HA 2ZPFB 3DKMA 3NTHA 2VASA 2GNCA 2XI9A 1X69A 5LJ5h 4Z8AA 2XU8A 4CC4B 4IIMA 2J7IA 2RHUA 5CVIA 1SEMA 4LXCA 1PG5B 1KQSS 4WCIA 1RI0A 3SWNA 2J05A 2NUZA 2X4YA 4K11A 3CPWS 2M9UA 4L6V5 2KDSA 1I8FA 3M54A 1VQ4A 4M7DD 3FIFA 3RBBB 1VQ4T 3OS0A 1UE9A 2WSFE 2EKOA 2JTFA 1YI2Q 3PT9A 2MF2A 4IUTA 2F2VA 1FMKA 5IHKA 4RKUE 2QEXQ 3PVQA 4BD3A 1ABQA 1KD1R 1MMGA 1KSWA 1I5OB 1UUEA 4E7SA 4V2SA 1WXUA 3D7SB 1ZQ1A 1AOJA 3RERA 3KUFA 3RNJA 2F5TX 3E9GA 1M30A 3EG9B 3H0HA 4JZ4A 2GTOA 2NUTB 5FROA 3NMZC 3CC2A 4XTUA 3CC2T 1YFNA 4HVUA 2GFAA 4M7AC 2X51A 2RNAA 1IRXA 4ZGDB 4JDSA 2KGTA 1YJ9Q 1KC8R 4BACA 2LQ8A 4M78A 4C92D 3QJYA 4LN2A 2V8IA 2HSEB 3LH5A 4D8KA 1ABOA 3NTIA 2ED1A 1VIEA 2PVGB 4XTVA 4PJOF 2J6OA 3CCSA 2XG8D 2JOYA 3CCST 5DM7R 2NUPA 2LT4A 3G4SA 3G4ST 4PFZA 1YCYA 3G71Q 1KG1A 2ROLA 1OQKA 1YBYA 4OGCA 1B3QA 4NOYA 4ZTFA 3MEVA 4BI4A 4PJMA 1GBRA 5J26A 3WXMB 2KRNA 5A0DA 1QVPA 1WPYA 2RQVA 1M9SA 1MMAA 2BKDN 1PKTA 4KT0E 3M0PA 4O5VA 1PNJA 4EMKA 2AZVA 4M7AE 4IUQA 5I21A 2QK0A 1PCXA 2AT1B 1M3CA 2HD0A 1PSEA 3CQTA 5KCHA 3WVDB 4A4EA 3OYHA 2B86A 4N4HA 5I11A 4RTYA 1S72A 3THKA 3I56A 1S72T 3I56T 2EQKA 4MMKA 1K9MU 1YJWQ 1ZSZA 2YRDA 1WIEA 1M1GA 3CBMA 4CC7A 4A4GA 3L2QA 5KH6A 1QCFA 2E6ZA 4PJJA 3QSUA 1UEBA 2CZ0B 4P5NA 4PFOA 4LUDA 2QTXA 1D0YA 4OVAA 3HHTB 3ULRB 2W0ZA 3OSVA 1JJ2A 4E47A 2O9SA 4FSXA 3N5BB 3EG0A 1QWFA 5CCAA 1VQ7A 1OPLA 1VQ7T 3GBQA 1GFCA 1JU5C 1YHQQ 3A98A 3OBWA 1BIBA 4C5EA 5HY6A 5GAMg 1K1ZA 3MP1A 3OYMA 4QT7A 1LNXA 1YIJQ 1X27A 2RHXA 1QVFA 2HZYA 2KT1A 3JCMg 1X01A 2VUBA 1IGQA 1HSQA 1M5Q1 4UC4A 2FYKA 3JB9F 5GAN4 2X4XA 4E7IA 5HK0A 4OF1A 5IHNA 1K8AC 1K0XA 1UGRB 3URGA 3GP8A 5HKCA 3M0UA 4ESRA 1W2BS 1QVFP 1WXBA 2XK0A 2LJ3A 2DZCA 2PQWA 4FYYB 2C0TA 2PU9B 2KRMA 5CKFA 4M78D 3CC4A 2RJEA 3DB4A 2CZ7B 3CC4T 4M77A 3NTKA 1N27A 1VQ4Q 3MEUA 4DBHA 1YNZA 2MMPA 1QVGA 2DL3A 1R8OB 3VS5A 2P0QA 1EFNA 4EPCA 2V1QA 1BI1A 5GAN3 1A0NB 2DXCA 1ZUKA 3TSZA 3VS0A 5M9OA 4OMNA 4ZGJB 2V8KA 3OW2A 1G2BA 5HCKA 1SF9A 3I35A 2F5KA 3VJPA 1K9MR 3CC2Q 2GQIA 1M1FA 2ZPGB 3KFVA 1I5LA 4OP0A 4L5GA 4E7JA 4C0ZA 4M7DC 4PKCC 5GANg 3VS2A 3OW2P 2HEQA 1Q7YC 4LDUA 3V8JA 1KQSA 3A1PA 4Z88A 5GAN2 3CMEA 3TSWA 2GGRA 3CMET 2D8HA 3H41A 4IKFA 1NYGA 2E70A 4FL6A 5GAMe 3A8GB 2QASA 3CCSQ 1KJWA 1OPKA 4XU3A 3RDVA 3G4SQ 5GMKh 2ZPHB 4M7AG 1HK9A 3RMSA 2DEQA 3ZEHA 1M2VB 1BI0A 3OA6A 5AT1B 2CP5A 1JBMA 1AHJB 2RQRA 4Z89A 1JEGA 4QQDA 1GFDA 2DYBA 2A37A 2L3RA 3I5SA 4MZPA 2MWOA 2DNUA 2JTEA 3GNFB 4C92C 1M1KU 1QCOA 1NPRA 2JMCA 2X35A 5GAOn 2VGNA 1BB9A 2DPPB 4HXJA 1ZA2B 3M0SA 3M58A 2EW3A 2KAFA 2EAYA 2XMFA 4J83A 2DVEA 3H0IA 3C12A 1IB8A 2F2WA 2ED0A 1BK2A 3CCQA 4M7DE 1IO6A 4O6JA 3CCQT 3M56A 1C1AA 1RAHB 1M2OA 1GRIA 1R77A 4F7UE 3BFMA 4OMFB 2NWMA 4J8OA 2R5AA 1H8KA 3OYAA 3QWXX 4RMOA 1S72Q 4HCBA 4J9CA 3I56Q 2ZPEB 1Z9QA 3JRZA 4LD6A 3HSBA 2Y4YA 1V1CA 1FXXA 3ASKA 3JB9H 3TU4K 3BY7A 3OS1A 4C0DC 1WJSA 2YRCA 2CH4W 1C0MA 3E19A 4FU6A 1NJIU 1K0SA 2IIMA 2E10A 2EGEA 4CI0C 1SHGA 1I81A 2QQ9A 4JJNK 5GANe 3L1AA 3V8LA 3I55A 3I55T 3EAEA 4AT1B 3NHNA 2K2VA 3MKDA 2DX1A 1VQ7Q 4C92E 1D09B 4QVCA 5GAN7 4LDXA 5GJWB 3MCAB 4PNOA 4C5HA 2QDLA 3UPUA 5GAOq 1WX6A 3MHXA 1WXTA 4LDWA 2NYSA 4M77F 3OMCA 2C0OA 4BE1A 1OI1A 2HNIA 2QDYB 2DXTA 3JV3A 2LCCA 3SWNC 1XTDA 3OYGA 3OB9A 3WVEB 3M55A 4C8QA 4OMPA 4AG1C 1T0JA 1WFWA 5LJ3f 4M75F 1YWPA 2L3PA 3PNWC 1HJDA 1OX9A 3EFSA 2COYA 5KE3A 3CC4Q 3O8VA 1D3BB 1U8RA 2PVDB 1M1KR 4LDVA 3G71A 3LGLA 3G71T 4LDYA 1P92A 1KIKA 3F70A 2X9HA 1WJRA 4ANJA 1WHGA 1G3SA 2WSCE 4LD9K 2OTLA 3M0QA 2BIVA 2DMOA 2FB7A 2OTLT 4PJOA 4J9HA 2OTJA 1Z9ZA 2OTJT 3OYKA 4F7UB 5FU6C 1LOJA 3EFOA 4FW1A 5IN1A 1EIFA 4AFZC 5LJ3d 4RTTA 4M78C 3FJ5A 2CSQA 2JS2A 1QW1A 2VC8A 1CSKA 5FW9A 3EGXB 1QQJA 4GLMA 3P8DA 1NJIR 1QVFS 3R6OA 2IG0A 1VQ8A 1UGPB 4X1VA 4KH1B 1VQ8T 1WZOA 3CMEQ 4A4FA 2QAZA 2M0YA 3EGDA 4AFSC 1PRLC 2CGHA 9ATCB 3SDZA 2AHJB 4XU0A 1O9SA 2RQWA 2PVOB 2YUPA 1AD5A 4KH0B 1WHMA 3EH2A 5LJ3h 1TH7A 1B34B 4M7DG 2O2OA 1D1AA 2L89A 1G3TA 1WYXA 5LJ5d 4KUIA 4F7UG 2IVWA 4RG8A 1QVGS 1UFFA 3REAB 3PMIA 5ECAA 1MGQA 5I2SA 2YXYA 2VB6A 3X25B 2L3QA 2OAWA 1XNIA 3A5ZB 2R58A 1O75A 2BE9B 3VKIA 3EFRA 6AT1B 1UDLA 4M78E 1G5VA 1G3YA 1KK7A 1MHNA 2BTTA 1OU9A 1BCMA 2DYIA 5KYXB 2O9VA 2YT6A 2O4XB 2DILA 4AG2C 3CCQQ 3L2ZA 3OW2S 1XJWB 4C0DB 2M16A 1B07A 3JCMJ 3RMQA 2QQAA 2RI3A 4BDZA 3AHUA 4E2FB 1UJYA 2CZ6B 4KGVB 4C92G 1U1TA 1OZ2A 1K76A 1CKAA 4MMLA 4XTYA 3OYDA 1QCNA 5GAMj 4JZ3A 1BI3A 1FYNA 3RESA 1IXDA 1BBZA 1WI7A 1Y07A 2PUKB 1E6HA 3VS1A 5KCOA 2FVUA 3A8OB 3JCMV 4JRIA 2RMOA 4J9IA 3I55Q 3OYCA 5GAMf 5GMKm 3S6WA 4HT9A 5GAN5 1T3SA 5GAOm 1N8RU 5DLOA 1AT1B 1UG1A 1Q82U 4C8QF 3OYLA 3SWNB 4RCBA 3AT1B 3MJXA 1Q81U 2XDBA 3LYIA 2X3WD 2YRVA 2GF7A 1B7TA 2VVKA 2MI6A 4PJOD 2K5LA 1UB4A 1PD1A 2LDMA 3OS2A 4XU2A 3A8LB 2ZPIB 2AKKA 4HCCA 5GAN6 2KI7A 3QYHB 1CKBA 1K73C 2EGCA 2B8AA 1RL2A 3SEMA 4DBQA 5CK9A 2XIDA 4IUPA 1WHJA 3CCVA 2PNIA 3CCVT 1IREB 1FX7A 2XHCA 2EYZA 5GANj 3CXCA 2FHDA 2KR3A 5LL6S 3OYJA 1JO8A 4M78B 3CMAA 5CO7A 4DOVA 3CMAT 1SPKA 4QVZA 4WF2A 2VXFA 3SD4A 1RUWA 5D6YA 5FLXE 4NS5A 2OTLQ 1UGVA 2RPNA 1YN8A 5GAMh 1YJNA 2OTJQ 1GCQA 3CXCP 1H3ZA 1AEYA 3L2VA 1TUCA 1YJNT 2P0KA 4JRQA 1C6VX 2ZPBB 1R0CB 2BUDA 1F1BB 2NUPB 4KBMB 1VQ9A 3PIOA 1VQ9T 2L0AA 3CC7A 3CC7T 1QWEA 1AZGB 2RB6A 4IIOA 2ABLA 1WA7A 3QYGB 4Y28E 2KRSA 5C6SA 4L59A 1SKUB 2PUOB 4JS5A 1VQ8Q 5J39A 2O31A 1SRLA 3ZL7C 1PWTA 3X28B 5GAOp 5FRNA 1RAGB 4HVVA 1JXOA 1M4ZA 3HRUA 5CQXA 3CCUT 4XK8E 4F14A 4EMKB 2X4WA 1N8RR 2EFIA 4M78G 2L8DA 4R56A 2KMTA 4WTOB 3KXTA 1Q82R 2E3IA 4ATOA 5GMKl 2DRKA 1JQQA 1WHKA 2CP7A 3GIBA 1Q81R 1JRIA 4FSSA 2RD1A 3VYGA 4A63B 4E7KA 2A28A 1NZ9A 1RACB 2RHZA 2YWWA 3HL8A 2RI5A 2PTKA 3REBB 5FRMA 3LLRA 2XDPA 2EVRA 2W10A 1TWBA 1YITT 2HDAA 2V8JA 1ZSZB 3LGFA 3JB9D 2DXBA 3OYFA 2X4JA 2EYWA 2V1RA 2ZZDA 3FC3A 1M90C 2HCKA 3H0FA 2E12A 4DQ2A 3EH1A 2DTOA 4OMOA 5KYWA 4D8DA 3E1SA 2YDLA 3KBGA 3J81E 4MDXA 4MZMA 4HCZA 3NPFA 1RAAB 1VYUA 1GCPA 1PHTA 1X75C 1NM7A 1YWOA 2VGMA 2RI2A 3CCRA 3CCRT 1E6GA 2K6DA 4MZTA 3ER0A 1MNDA 1TG0A 2H3EB 4J9EA 5DY9A 1BI2A 2BE7D 4M7AA 4E7HA 2VV5A 3PTAA 1Q86C 3ME9A 4EIKA 4KULA 3HRSA 5CQYA 2K2MA 4IUVA 4OB2B 1PRMC 3FEOA 2J6KA 1PD0A 2L3SA 4M75A 2EIFA 2LQNA 3R6NA 3VS3A 1U06A 4KGZB 1G3WA 4BUGA 4BE0A 1K4US 4M77B 5FU7B 3QIIA 1G83A 3JCMc 3QG1A 2DO3A 3JCMW 1UHFA 1AWXA 1PSFA 1QLYA 3VUBA 3G1JA 1NPPA 2EQIA 4RTVA 2JS0A 3SHWA 1YP5A 3U23A 2P4RA 3UWNA 1SG5A 2F1LA 1AVZC 1LVKA 5IHIA 1M2VA 2P4TA 4GLKA 3CCVQ 2DEUA 4FT2A 3JCMe 1QKWA 1ZUUA 1E7OA 2RJCA 3C94A 2DETA 2OJ2A 1OYXA 1NEBA 3LH0A 4PJOC 2DD5A 4A53A 1RADB 3CMAQ 4PJNA 4N0AA 1K8AU 2LJ0A 5EG2A 2EKHA 4ZNXA 2PZ1A 1NLPC 2H8HA 2RA2A 3VRYA 1UTIA 1YJNQ 1TOVA 2CP2A 1J3TA 4BI3A 2GFUA 3QBYA 3MPUB 5IXFA 1FMVA 3PMTA 3C4SA 2RF0A 1VQ9Q 1VQLA 1VQLT 4J6WA 4QQGA 2EYQA 3CC7Q 3CBPA 4JJBA 1IHVA 4Y92A 1UJ0A 1W1FA 5D6WA 1ZX6A 2KYBA 4BDYA 5CIUA 1HD3A 5FWBA 1I07A 2MPXC 1X2QA 4HKEA 4KGXB 2JTMA 2Z0WA 3E9FA 2E41A 2EPDA 2QQSA 1V76A 2QYZA 2EYYA 2D1XA 3CCUQ 3TCJA 4EMHA 4J9BA 1BCOA 5IXBA 2M02A 4A54A 3FJPA 3META 1NYFA 1UHCA 4PJOE 3IQLA 3V8KA 2F69A 2KYMA 1X43A 3MO8A 1VA7A 3L2UA 1D0ZA 2AIRB 3CXCS 2EJGA 1D0XA 4M77D 5FU6B 2CREA 3S3NA 5GMKi 3UA6A 1YITQ 4Q5WA 2EQUA 2LNVA 4DA4A 1UGSB 2JW4A 5KYYA 1WHLA 2RO0A 2FPEA 1X6BA 1KD1C 1BKBA 5KYUA 2RHYA 3A8MB 4M75D 1XOVA 4FYVB 3UF4A 2J06A 3QDRB 2RH2A 5KYNA 2EJ9A 4B6MA 3QZ5B 1H641 1RLPC 2DZ9A 4RTWA 4M7AF 1U1SA 5CAIA 1N9SA 4Z02A 3RKWA 4N4IA 3QHSA 4N4GA 3VS6A 2LP5A 8ATCB 2CZ1B 4OGEA 4XTZA 4FM4B 2HL3A 1KC8C 5J3BA 1K8AR 2JT4A 2CYZB 3OS5A 4FW2A 3ZFJA 3CCRQ 3JB9J 2RK1A 2DVJA 3QO3A 4PJLA 1VOMA 3SFMA 4J9GA 2CT4A 1GBQA 1BYMA 3CBOA 3NFCA 2E64A 2JMAA 2WSEE 4DEYA 4M7DA 3TVTA 2LQKA 1AWJA 2QQBA 3VU3C 4C8QB 4F16A 3CCJA 3CCJT 3CCLA 3RUXA 3CCMA 3CCLT 1I1JA 3CCMT 1NBEB 4BB7A 1Y57A 1MUZA 3M59A 4OMLA 1QMCA 4C5IA 3EGUA 2LX9A 2QA4A 1JXMA 2QA4T 4J7IA 2EQMA 4YTLA 4RCCA 2VYTA 4PJOB 2AK5A 4RTXA 1SHFA 2ESWA 3QPHA 2CUDA 4C92A 1Y96A 2FEIA 2DF6A 2K3YA 3M9QA 5GMKe 2QTVA 3EFOB 1G8XA 3OY9A 3OYEA 4KUDK 2LMJA 2CSIA 1M8VA 3VUZA 4PLIA 2E65A 2LZ6B 4VUBA 2OX7A 2KXCA 2EJFA 3UA7A 2DIGA 3OYIA 1GCQC 5A0GA 2I0NA 1VQ5A 3S3OA 2E4HA 1VQ5T 4JRKA 2L5QA 3VYHB 2DD4A 5IH2A 4EMKC 1LCKA 2K3XA 3EGDB 2ZCFB 4ME7A 1ZBJA 3H6ZA 1PC0A 2JZ2A 2DLPA 5L8RE 4LE9A 1VQLQ 4FIBA 2DTIA 1IZ6A 2FRYA 4J6XA 1PKSA 5D6XA 4PJOG 2EYXA 2FL7A 3NGPA 4NL2A 1GL5A 4C5GA 1S1NA 3L2RA 1ZSZC 2COZA 4FT4A 3GOXA 2FZCB 4BY6B 2LRQA 2HQEA 4NL3A 2LT1A 3M0TA 2CDTA 2MAMA 3CCEA 3CCET 4C8QD 4DBRA 3M4GA 2K5IA 3VV0A 2IPOB 2JVVA 2GQVA 1VQKA 2DIQA 3UATA 1VQKT 1ACMB 2D0NA 1AWOA 1HYOA 5HK3A 3JCMf 3OQ5A 4J7FA 4A4HA 3FLGA 3MP6A 4DEXA 2CKKA 1W6XA 3EG9A 1OZ3A 2NUTA 1OEBA 3P8BB 4CC3A 3H9NA 1OX8A 2HQHA 5LJ3g 4RTUA 1N5ZA 2DJQA 1RABB 3E2UA 2HMAA 3FDRA 1QKXA 2ENMA 2HBPA 2QXFA 1K9MC 1W70A 1I4K1 1T3LA 1WGSA 4FYXB 1KQ2A 4M7DF 1KFZA 1I0CA 5GAMd 2C06A 3A8HB 4F7UF 3M53A 4M77C 2E5KA 2XKOC 5FU7C 3JCMd 2X3XD 3J80E 3C0CA 3G6EA 3G6ET 4X9CA 1NE8A 3G7ZA 3JAME 2E6NA 1Y0MA 3BW1A 2RJDA 2V26A 3RR6A 2RJFA 5IT9E 4M75C 5LJ5g 5GAN8 2P0PA 2EWNA 1U3OA 2G3RA 2XICA 3CCJQ 3BE3A 4CRIA 2DTHA 3HKSA 3JCMb 3V7RA 2K57A 3X20B 5GANf 1AWWA 3JB9G 3CCLQ 1Y71A 4C92F 3CCMQ 2JM8A 1RLQC 1GXIE 3OBYA 3JCMh 2JNGA 3UDCA 1M27C 2KEAA 3X24B 2A08A 2EGAA 2XDDA 5CKEA 2QA4Q 5CKBA 2JN0A 2RK2A 3EG2A 5L23A 1TXQA 3X26B 3DLLA 3I9QA 1TTHB 1IGUA 1X6OA 2KXDA 4OMMA 5KE2A 4QKUA 4M77E 1N6AA 4IURA 3EG1A 5D7UA 1RAFB 2E3HA 2KQWA 3M0RA 3CCUA 1MNEA 4HCKA 3VS4A 2LC4A 5LJ3e 4JLGA 2BZXA 2HKNA 4QQ6A 2DERA 4II1A 5GANd 2O01E 4N0AC 1XQHA 2CUBA 3PE0A 3CD6A 3CD6T 2DFUA 5GAOr 3DLMA 4M75E 3FRNA 2K7AA 2JUFA 5GAOl 1ZUYA 4EMGA 3H8ZA 1VYVA 1VQ5Q 3OMGA 4J5YA 3EG3A 2FG0A 2M51A 3UT1A 1K73U 1YITA 1M3AA 1W4SA 1VQOA 2MYSA 1VQOT 3CEYA 3FB9A 1ZA1B 2DA9A 4ELZC 3SB2A 3JCMP 3Q1JA 4TVRA 2MWPA 3PVLA 3HTRA 5GANh 1V29B 2CP3A 5LJ5e 2QI2A 2J6FA 2DM1A
chains in the Genus database with same CATH topology
1VQ4Q 3CMAQ 1VQOQ 1VQPQ 1N8RR 1Q7YR 1VQ6Q 1K9MR 2QA4Q 1Q82R 3CC2Q 1YI2Q 3CCSQ 1YHQQ 3I55Q 3CD6Q 3CC7Q 1W2BP 1K73R 1VQKQ 2OTLQ 3G6EQ 1JJ2P 1Q81R 1YJNQ 3G4SQ 3CCJQ 3CCVQ 1YJWQ 1QVFP 1K8AR 1S72Q 2QEXQ 1NJIR 3I56Q 2OTJQ 1KQSP 3CXCP 3CCRQ 3CCEQ 1YIJQ 3CC4Q 1VQLQ 1Q86R 3G71Q 1VQNQ 1YJ9Q 1KC8R 3CCLQ 1VQ9Q 1VQ8Q 3CCMQ 3CCQQ 3OW2P 1KD1R 1M1KR 1M90R 1VQ5Q 1VQ7Q 1QVGP 1YITQ 3CCUQ 3CPWP 1VQMQ 3CMEQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 Q;  3CMA Q;  1VQO Q;  1VQP Q;  1N8R R;  1Q7Y R;  1VQ6 Q;  1K9M R;  2QA4 Q;  1Q82 R;  3CC2 Q;  1YI2 Q;  3CCS Q;  1YHQ Q;  3I55 Q;  3CD6 Q;  3CC7 Q;  1W2B P;  1K73 R;  1VQK Q;  2OTL Q;  3G6E Q;  1JJ2 P;  1Q81 R;  1YJN Q;  3G4S Q;  3CCJ Q;  3CCV Q;  1YJW Q;  1QVF P;  1K8A R;  1S72 Q;  2QEX Q;  1NJI R;  3I56 Q;  2OTJ Q;  1KQS P;  3CXC P;  3CCR Q;  3CCE Q;  1YIJ Q;  3CC4 Q;  1VQL Q;  1Q86 R;  3G71 Q;  1VQN Q;  1YJ9 Q;  1KC8 R;  3CCL Q;  1VQ9 Q;  1VQ8 Q;  3CCM Q;  3CCQ Q;  3OW2 P;  1KD1 R;  1M1K R;  1M90 R;  1VQ5 Q;  1VQ7 Q;  1QVG P;  1YIT Q;  3CCU Q;  3CPW P;  1VQM Q;  3CME Q; 
#chains in the Genus database with same CATH topology
 1QP2 A;  2RM4 A;  3PFS A;  3TEE A;  4PLL A;  1EX4 A;  1UEC A;  2VKN A;  2O88 A;  2M1H A;  3M57 A;  4C0F A;  4XAX B;  4ZN3 A;  1H92 A;  2LNH B;  1JJ2 P;  1IHW A;  4F17 A;  5GMK j;  2YUQ A;  3C95 A;  4M4Z A;  2SEM A;  1RAE B;  4E6R A;  2DBM A;  1OV3 A;  4J9F A;  1LPL A;  1Q95 G;  4ELY C;  3CCE Q;  5KYW B;  3OYB A;  4QVD A;  2OAU A;  4ZTJ A;  3DB3 A;  2FRW A;  1VQP A;  5DLQ E;  1VQP T;  1QP3 A;  1NEG A;  1VQK Q;  1RI9 A;  1M1K C;  3I5R A;  1VQN A;  1UGQ B;  1VQN T;  2MK5 A;  2RQT A;  1TU0 B;  4AMC A;  4HVW A;  3JCM X;  2K3B A;  4OMQ A;  3QJ6 A;  2GTJ A;  2KY9 A;  4X34 A;  3HRT A;  2ECZ A;  1R0B G;  2DBK A;  3CPF A;  2CH4 A;  2G6F X;  4M7A B;  3QUI A;  5A2Q E;  4C8Q C;  4M78 F;  2H3J A;  2Y90 A;  3RKX A;  2A36 A;  2KSS A;  2COW A;  2HL5 C;  1QVG P;  4FYW B;  3OYN A;  2KBT A;  4XQ3 A;  4M75 B;  2F2X A;  3QXE B;  1X6G A;  4GY5 A;  2DXU A;  4RUG A;  3S3M A;  2FPD A;  1NJI C;  3OSS C;  4J9D A;  2R5M A;  4C0G A;  2HKQ B;  1K73 R;  1M90 U;  2MCN A;  3G6E Q;  2HSP A;  1ZLM A;  2NLU A;  1FWZ A;  7AT1 B;  4J6Y A;  3HFN A;  1PM3 A;  1TS9 A;  1VUB A;  3QDF A;  3OYY A;  1VQM A;  3TQ7 P;  1SRM A;  1VQM T;  3CPW A;  4ZN1 A;  4X9D A;  2P84 A;  2YUN A;  2DK3 A;  4M77 G;  1ZHI A;  4R55 A;  2BZ8 A;  2FPF A;  2A0F B;  2VXE A;  2XD0 A;  1KQS P;  2YLB A;  2EBP A;  3M5A A;  2E1H A;  2QG9 B;  2RQU A;  1WDX A;  2C0I A;  4HT8 A;  3CPW P;  3GNG A;  4C8Q E;  1N9R A;  2LVM A;  1MMN A;  3QZ9 B;  4M75 G;  4EDU A;  1OU8 A;  2L2P A;  2FO0 A;  5I22 A;  1Q86 U;  2LCL A;  1VQ6 A;  4JPB W;  1VQ6 T;  2ROT A;  3VS7 A;  1MV3 A;  4BI8 B;  4LUE A;  1HXD A;  1U5S A;  3HPW A;  4OB1 B;  1YCS B;  4PL6 A;  2A3L A;  2KE9 A;  1NLO C;  2LQW A;  1VYT A;  2OI3 A;  2M0O A;  4RG2 A;  1M8M A;  1ZSG A;  4QW2 A;  1ZBX A;  3CD6 Q;  4GBQ A;  1LJO A;  5AYF A;  2FZG B;  4BY6 C;  4E7Z A;  3JCM Q;  1WLP B;  2K4Y A;  4JRP A;  1ARK A;  8AT1 B;  2VWF A;  3V7S A;  1Q7Y U;  4B9X A;  3L42 A;  2DAQ A;  2K5F A;  1H3H A;  2Y4X A;  1JB0 E;  3HP9 A;  3T9N A;  1VQO Q;  4B9W A;  4M7A D;  1OOT A;  2MOX A;  5A0L A;  3LWI A;  2CT3 A;  1YI2 A;  3MEA A;  1YI2 T;  2GCX A;  4XTX A;  5FWC A;  2QEX A;  2DE0 X;  2BZY A;  2QEX T;  2DKG A;  4A4K A;  3GF5 A;  1M90 R;  2HBW A;  2MIO A;  2CP6 A;  2YSQ A;  4HA8 A;  2JM9 A;  5I2M A;  4JJD A;  4OB3 B;  4ORZ A;  1AZE A;  4F04 B;  1EZZ B;  4JJC A;  2RN8 A;  2DL5 A;  4AFU C;  2FZK B;  2HAX A;  4PK4 A;  4JLI A;  5KYY B;  2LJ1 A;  1D3B A;  3VRZ A;  2QGF B;  2SRC A;  4DOW A;  5LJ3 j;  4LNP A;  3RIR A;  1M3B A;  5KYU B;  2DJZ A;  1SSF A;  1YJ9 A;  1FMW A;  2KVQ G;  1YJ9 T;  1K9A A;  2GBQ A;  2HQX A;  3LW5 E;  2DL8 A;  1VQP Q;  2ZAE A;  2K79 A;  4XTW A;  1RAI B;  1D1C A;  2D0Q B;  5CKD A;  2CP0 A;  4F7U A;  3QWY A;  1VQN Q;  1Q86 R;  1BIA A;  2YHT A;  1TSF A;  2KNB B;  2KRO A;  1KQ1 A;  2CS7 A;  2A7Y A;  2QGG A;  3EGX A;  2LX7 A;  5LJ5 j;  5C0M A;  1KHI A;  1KHC A;  4BE2 A;  4FCY A;  4M7D B;  1OUL A;  4DBF A;  2LTO A;  1JJ2 S;  1TUD A;  3INZ A;  2YLC A;  2AKL A;  3V7C A;  1WNL A;  2R57 A;  4IUU A;  3GLX A;  4XU1 A;  3ZBD A;  2JJ9 A;  1D1B A;  5CKH A;  2WAC A;  1BU1 A;  3QKJ A;  5LJ5 f;  3EHQ A;  1Q7Y R;  2YUO A;  3GPL A;  2E5Q A;  1B34 A;  1KD1 U;  4MDW A;  4C8Q G;  2LCS A;  1W2B A;  4D6W A;  2DL7 A;  1VIF A;  1SSH A;  1WJQ A;  2D9T A;  3JSC A;  1TUG B;  3J7A F;  3EHR A;  1N8R C;  3TRE A;  3LX7 A;  4OB0 B;  1WQ7 A;  1X2K A;  2D8J A;  4ZGE B;  1VQM Q;  1Q82 C;  5IAY A;  3JB9 I;  1YJW A;  3BDU A;  1YJW T;  1Q81 C;  3MEW A;  2RHI A;  2K9G A;  4C92 B;  1Y96 B;  4KRT A;  2JXB A;  1KC8 U;  3M4Y A;  1MV0 B;  1W2B P;  2KT8 A;  2EQJ A;  4CC2 A;  4E7L A;  5KYX A;  3L2W A;  2O4X A;  3LWH A;  4AFQ C;  3RKY A;  3PIP A;  1Y7X A;  4JUV A;  2D6F A;  3MP8 A;  2ZGW A;  3P8H A;  2DL4 A;  3HFO A;  2AZS A;  1WHH A;  1VQ6 Q;  2KK4 A;  4PFP A;  3O5Z A;  5CR2 A;  2I2L A;  3PGG A;  4JS4 A;  1YHQ A;  4Y91 A;  1YHQ T;  5GJV B;  3BDL A;  1DJ7 B;  1WQW A;  1MMD A;  2QQR A;  4RTZ A;  1NG2 A;  1YIJ A;  2ATC B;  2DRM A;  1YIJ T;  5EC7 A;  4R0K A;  1T0H A;  2ZPF B;  3DKM A;  3NTH A;  2VAS A;  2GNC A;  2XI9 A;  1X69 A;  5LJ5 h;  4Z8A A;  2XU8 A;  4CC4 B;  4IIM A;  2J7I A;  2RHU A;  5CVI A;  1SEM A;  4LXC A;  1PG5 B;  1KQS S;  4WCI A;  1RI0 A;  3SWN A;  2J05 A;  2NUZ A;  2X4Y A;  4K11 A;  3CPW S;  2M9U A;  4L6V 5;  2KDS A;  1I8F A;  3M54 A;  1VQ4 A;  4M7D D;  3FIF A;  3RBB B;  1VQ4 T;  3OS0 A;  1UE9 A;  2WSF E;  2EKO A;  2JTF A;  1YI2 Q;  3PT9 A;  2MF2 A;  4IUT A;  2F2V A;  1FMK A;  5IHK A;  4RKU E;  2QEX Q;  3PVQ A;  4BD3 A;  1ABQ A;  1KD1 R;  1MMG A;  1KSW A;  1I5O B;  1UUE A;  4E7S A;  4V2S A;  1WXU A;  3D7S B;  1ZQ1 A;  1AOJ A;  3RER A;  3KUF A;  3RNJ A;  2F5T X;  3E9G A;  1M30 A;  3EG9 B;  3H0H A;  4JZ4 A;  2GTO A;  2NUT B;  5FRO A;  3NMZ C;  3CC2 A;  4XTU A;  3CC2 T;  1YFN A;  4HVU A;  2GFA A;  4M7A C;  2X51 A;  2RNA A;  1IRX A;  4ZGD B;  4JDS A;  2KGT A;  1YJ9 Q;  1KC8 R;  4BAC A;  2LQ8 A;  4M78 A;  4C92 D;  3QJY A;  4LN2 A;  2V8I A;  2HSE B;  3LH5 A;  4D8K A;  1ABO A;  3NTI A;  2ED1 A;  1VIE A;  2PVG B;  4XTV A;  4PJO F;  2J6O A;  3CCS A;  2XG8 D;  2JOY A;  3CCS T;  5DM7 R;  2NUP A;  2LT4 A;  3G4S A;  3G4S T;  4PFZ A;  1YCY A;  3G71 Q;  1KG1 A;  2ROL A;  1OQK A;  1YBY A;  4OGC A;  1B3Q A;  4NOY A;  4ZTF A;  3MEV A;  4BI4 A;  4PJM A;  1GBR A;  5J26 A;  3WXM B;  2KRN A;  5A0D A;  1QVP A;  1WPY A;  2RQV A;  1M9S A;  1MMA A;  2BKD N;  1PKT A;  4KT0 E;  3M0P A;  4O5V A;  1PNJ A;  4EMK A;  2AZV A;  4M7A E;  4IUQ A;  5I21 A;  2QK0 A;  1PCX A;  2AT1 B;  1M3C A;  2HD0 A;  1PSE A;  3CQT A;  5KCH A;  3WVD B;  4A4E A;  3OYH A;  2B86 A;  4N4H A;  5I11 A;  4RTY A;  1S72 A;  3THK A;  3I56 A;  1S72 T;  3I56 T;  2EQK A;  4MMK A;  1K9M U;  1YJW Q;  1ZSZ A;  2YRD A;  1WIE A;  1M1G A;  3CBM A;  4CC7 A;  4A4G A;  3L2Q A;  5KH6 A;  1QCF A;  2E6Z A;  4PJJ A;  3QSU A;  1UEB A;  2CZ0 B;  4P5N A;  4PFO A;  4LUD A;  2QTX A;  1D0Y A;  4OVA A;  3HHT B;  3ULR B;  2W0Z A;  3OSV A;  1JJ2 A;  4E47 A;  2O9S A;  4FSX A;  3N5B B;  3EG0 A;  1QWF A;  5CCA A;  1VQ7 A;  1OPL A;  1VQ7 T;  3GBQ A;  1GFC A;  1JU5 C;  1YHQ Q;  3A98 A;  3OBW A;  1BIB A;  4C5E A;  5HY6 A;  5GAM g;  1K1Z A;  3MP1 A;  3OYM A;  4QT7 A;  1LNX A;  1YIJ Q;  1X27 A;  2RHX A;  1QVF A;  2HZY A;  2KT1 A;  3JCM g;  1X01 A;  2VUB A;  1IGQ A;  1HSQ A;  1M5Q 1;  4UC4 A;  2FYK A;  3JB9 F;  5GAN 4;  2X4X A;  4E7I A;  5HK0 A;  4OF1 A;  5IHN A;  1K8A C;  1K0X A;  1UGR B;  3URG A;  3GP8 A;  5HKC A;  3M0U A;  4ESR A;  1W2B S;  1QVF P;  1WXB A;  2XK0 A;  2LJ3 A;  2DZC A;  2PQW A;  4FYY B;  2C0T A;  2PU9 B;  2KRM A;  5CKF A;  4M78 D;  3CC4 A;  2RJE A;  3DB4 A;  2CZ7 B;  3CC4 T;  4M77 A;  3NTK A;  1N27 A;  1VQ4 Q;  3MEU A;  4DBH A;  1YNZ A;  2MMP A;  1QVG A;  2DL3 A;  1R8O B;  3VS5 A;  2P0Q A;  1EFN A;  4EPC A;  2V1Q A;  1BI1 A;  5GAN 3;  1A0N B;  2DXC A;  1ZUK A;  3TSZ A;  3VS0 A;  5M9O A;  4OMN A;  4ZGJ B;  2V8K A;  3OW2 A;  1G2B A;  5HCK A;  1SF9 A;  3I35 A;  2F5K A;  3VJP A;  1K9M R;  3CC2 Q;  2GQI A;  1M1F A;  2ZPG B;  3KFV A;  1I5L A;  4OP0 A;  4L5G A;  4E7J A;  4C0Z A;  4M7D C;  4PKC C;  5GAN g;  3VS2 A;  3OW2 P;  2HEQ A;  1Q7Y C;  4LDU A;  3V8J A;  1KQS A;  3A1P A;  4Z88 A;  5GAN 2;  3CME A;  3TSW A;  2GGR A;  3CME T;  2D8H A;  3H41 A;  4IKF A;  1NYG A;  2E70 A;  4FL6 A;  5GAM e;  3A8G B;  2QAS A;  3CCS Q;  1KJW A;  1OPK A;  4XU3 A;  3RDV A;  3G4S Q;  5GMK h;  2ZPH B;  4M7A G;  1HK9 A;  3RMS A;  2DEQ A;  3ZEH A;  1M2V B;  1BI0 A;  3OA6 A;  5AT1 B;  2CP5 A;  1JBM A;  1AHJ B;  2RQR A;  4Z89 A;  1JEG A;  4QQD A;  1GFD A;  2DYB A;  2A37 A;  2L3R A;  3I5S A;  4MZP A;  2MWO A;  2DNU A;  2JTE A;  3GNF B;  4C92 C;  1M1K U;  1QCO A;  1NPR A;  2JMC A;  2X35 A;  5GAO n;  2VGN A;  1BB9 A;  2DPP B;  4HXJ A;  1ZA2 B;  3M0S A;  3M58 A;  2EW3 A;  2KAF A;  2EAY A;  2XMF A;  4J83 A;  2DVE A;  3H0I A;  3C12 A;  1IB8 A;  2F2W A;  2ED0 A;  1BK2 A;  3CCQ A;  4M7D E;  1IO6 A;  4O6J A;  3CCQ T;  3M56 A;  1C1A A;  1RAH B;  1M2O A;  1GRI A;  1R77 A;  4F7U E;  3BFM A;  4OMF B;  2NWM A;  4J8O A;  2R5A A;  1H8K A;  3OYA A;  3QWX X;  4RMO A;  1S72 Q;  4HCB A;  4J9C A;  3I56 Q;  2ZPE B;  1Z9Q A;  3JRZ A;  4LD6 A;  3HSB A;  2Y4Y A;  1V1C A;  1FXX A;  3ASK A;  3JB9 H;  3TU4 K;  3BY7 A;  3OS1 A;  4C0D C;  1WJS A;  2YRC A;  2CH4 W;  1C0M A;  3E19 A;  4FU6 A;  1NJI U;  1K0S A;  2IIM A;  2E10 A;  2EGE A;  4CI0 C;  1SHG A;  1I81 A;  2QQ9 A;  4JJN K;  5GAN e;  3L1A A;  3V8L A;  3I55 A;  3I55 T;  3EAE A;  4AT1 B;  3NHN A;  2K2V A;  3MKD A;  2DX1 A;  1VQ7 Q;  4C92 E;  1D09 B;  4QVC A;  5GAN 7;  4LDX A;  5GJW B;  3MCA B;  4PNO A;  4C5H A;  2QDL A;  3UPU A;  5GAO q;  1WX6 A;  3MHX A;  1WXT A;  4LDW A;  2NYS A;  4M77 F;  3OMC A;  2C0O A;  4BE1 A;  1OI1 A;  2HNI A;  2QDY B;  2DXT A;  3JV3 A;  2LCC A;  3SWN C;  1XTD A;  3OYG A;  3OB9 A;  3WVE B;  3M55 A;  4C8Q A;  4OMP A;  4AG1 C;  1T0J A;  1WFW A;  5LJ3 f;  4M75 F;  1YWP A;  2L3P A;  3PNW C;  1HJD A;  1OX9 A;  3EFS A;  2COY A;  5KE3 A;  3CC4 Q;  3O8V A;  1D3B B;  1U8R A;  2PVD B;  1M1K R;  4LDV A;  3G71 A;  3LGL A;  3G71 T;  4LDY A;  1P92 A;  1KIK A;  3F70 A;  2X9H A;  1WJR A;  4ANJ A;  1WHG A;  1G3S A;  2WSC E;  4LD9 K;  2OTL A;  3M0Q A;  2BIV A;  2DMO A;  2FB7 A;  2OTL T;  4PJO A;  4J9H A;  2OTJ A;  1Z9Z A;  2OTJ T;  3OYK A;  4F7U B;  5FU6 C;  1LOJ A;  3EFO A;  4FW1 A;  5IN1 A;  1EIF A;  4AFZ C;  5LJ3 d;  4RTT A;  4M78 C;  3FJ5 A;  2CSQ A;  2JS2 A;  1QW1 A;  2VC8 A;  1CSK A;  5FW9 A;  3EGX B;  1QQJ A;  4GLM A;  3P8D A;  1NJI R;  1QVF S;  3R6O A;  2IG0 A;  1VQ8 A;  1UGP B;  4X1V A;  4KH1 B;  1VQ8 T;  1WZO A;  3CME Q;  4A4F A;  2QAZ A;  2M0Y A;  3EGD A;  4AFS C;  1PRL C;  2CGH A;  9ATC B;  3SDZ A;  2AHJ B;  4XU0 A;  1O9S A;  2RQW A;  2PVO B;  2YUP A;  1AD5 A;  4KH0 B;  1WHM A;  3EH2 A;  5LJ3 h;  1TH7 A;  1B34 B;  4M7D G;  2O2O A;  1D1A A;  2L89 A;  1G3T A;  1WYX A;  5LJ5 d;  4KUI A;  4F7U G;  2IVW A;  4RG8 A;  1QVG S;  1UFF A;  3REA B;  3PMI A;  5ECA A;  1MGQ A;  5I2S A;  2YXY A;  2VB6 A;  3X25 B;  2L3Q A;  2OAW A;  1XNI A;  3A5Z B;  2R58 A;  1O75 A;  2BE9 B;  3VKI A;  3EFR A;  6AT1 B;  1UDL A;  4M78 E;  1G5V A;  1G3Y A;  1KK7 A;  1MHN A;  2BTT A;  1OU9 A;  1BCM A;  2DYI A;  5KYX B;  2O9V A;  2YT6 A;  2O4X B;  2DIL A;  4AG2 C;  3CCQ Q;  3L2Z A;  3OW2 S;  1XJW B;  4C0D B;  2M16 A;  1B07 A;  3JCM J;  3RMQ A;  2QQA A;  2RI3 A;  4BDZ A;  3AHU A;  4E2F B;  1UJY A;  2CZ6 B;  4KGV B;  4C92 G;  1U1T A;  1OZ2 A;  1K76 A;  1CKA A;  4MML A;  4XTY A;  3OYD A;  1QCN A;  5GAM j;  4JZ3 A;  1BI3 A;  1FYN A;  3RES A;  1IXD A;  1BBZ A;  1WI7 A;  1Y07 A;  2PUK B;  1E6H A;  3VS1 A;  5KCO A;  2FVU A;  3A8O B;  3JCM V;  4JRI A;  2RMO A;  4J9I A;  3I55 Q;  3OYC A;  5GAM f;  5GMK m;  3S6W A;  4HT9 A;  5GAN 5;  1T3S A;  5GAO m;  1N8R U;  5DLO A;  1AT1 B;  1UG1 A;  1Q82 U;  4C8Q F;  3OYL A;  3SWN B;  4RCB A;  3AT1 B;  3MJX A;  1Q81 U;  2XDB A;  3LYI A;  2X3W D;  2YRV A;  2GF7 A;  1B7T A;  2VVK A;  2MI6 A;  4PJO D;  2K5L A;  1UB4 A;  1PD1 A;  2LDM A;  3OS2 A;  4XU2 A;  3A8L B;  2ZPI B;  2AKK A;  4HCC A;  5GAN 6;  2KI7 A;  3QYH B;  1CKB A;  1K73 C;  2EGC A;  2B8A A;  1RL2 A;  3SEM A;  4DBQ A;  5CK9 A;  2XID A;  4IUP A;  1WHJ A;  3CCV A;  2PNI A;  3CCV T;  1IRE B;  1FX7 A;  2XHC A;  2EYZ A;  5GAN j;  3CXC A;  2FHD A;  2KR3 A;  5LL6 S;  3OYJ A;  1JO8 A;  4M78 B;  3CMA A;  5CO7 A;  4DOV A;  3CMA T;  1SPK A;  4QVZ A;  4WF2 A;  2VXF A;  3SD4 A;  1RUW A;  5D6Y A;  5FLX E;  4NS5 A;  2OTL Q;  1UGV A;  2RPN A;  1YN8 A;  5GAM h;  1YJN A;  2OTJ Q;  1GCQ A;  3CXC P;  1H3Z A;  1AEY A;  3L2V A;  1TUC A;  1YJN T;  2P0K A;  4JRQ A;  1C6V X;  2ZPB B;  1R0C B;  2BUD A;  1F1B B;  2NUP B;  4KBM B;  1VQ9 A;  3PIO A;  1VQ9 T;  2L0A A;  3CC7 A;  3CC7 T;  1QWE A;  1AZG B;  2RB6 A;  4IIO A;  2ABL A;  1WA7 A;  3QYG B;  4Y28 E;  2KRS A;  5C6S A;  4L59 A;  1SKU B;  2PUO B;  4JS5 A;  1VQ8 Q;  5J39 A;  2O31 A;  1SRL A;  3ZL7 C;  1PWT A;  3X28 B;  5GAO p;  5FRN A;  1RAG B;  4HVV A;  1JXO A;  1M4Z A;  3HRU A;  5CQX A;  3CCU T;  4XK8 E;  4F14 A;  4EMK B;  2X4W A;  1N8R R;  2EFI A;  4M78 G;  2L8D A;  4R56 A;  2KMT A;  4WTO B;  3KXT A;  1Q82 R;  2E3I A;  4ATO A;  5GMK l;  2DRK A;  1JQQ A;  1WHK A;  2CP7 A;  3GIB A;  1Q81 R;  1JRI A;  4FSS A;  2RD1 A;  3VYG A;  4A63 B;  4E7K A;  2A28 A;  1NZ9 A;  1RAC B;  2RHZ A;  2YWW A;  3HL8 A;  2RI5 A;  2PTK A;  3REB B;  5FRM A;  3LLR A;  2XDP A;  2EVR A;  2W10 A;  1TWB A;  1YIT T;  2HDA A;  2V8J A;  1ZSZ B;  3LGF A;  3JB9 D;  2DXB A;  3OYF A;  2X4J A;  2EYW A;  2V1R A;  2ZZD A;  3FC3 A;  1M90 C;  2HCK A;  3H0F A;  2E12 A;  4DQ2 A;  3EH1 A;  2DTO A;  4OMO A;  5KYW A;  4D8D A;  3E1S A;  2YDL A;  3KBG A;  3J81 E;  4MDX A;  4MZM A;  4HCZ A;  3NPF A;  1RAA B;  1VYU A;  1GCP A;  1PHT A;  1X75 C;  1NM7 A;  1YWO A;  2VGM A;  2RI2 A;  3CCR A;  3CCR T;  1E6G A;  2K6D A;  4MZT A;  3ER0 A;  1MND A;  1TG0 A;  2H3E B;  4J9E A;  5DY9 A;  1BI2 A;  2BE7 D;  4M7A A;  4E7H A;  2VV5 A;  3PTA A;  1Q86 C;  3ME9 A;  4EIK A;  4KUL A;  3HRS A;  5CQY A;  2K2M A;  4IUV A;  4OB2 B;  1PRM C;  3FEO A;  2J6K A;  1PD0 A;  2L3S A;  4M75 A;  2EIF A;  2LQN A;  3R6N A;  3VS3 A;  1U06 A;  4KGZ B;  1G3W A;  4BUG A;  4BE0 A;  1K4U S;  4M77 B;  5FU7 B;  3QII A;  1G83 A;  3JCM c;  3QG1 A;  2DO3 A;  3JCM W;  1UHF A;  1AWX A;  1PSF A;  1QLY A;  3VUB A;  3G1J A;  1NPP A;  2EQI A;  4RTV A;  2JS0 A;  3SHW A;  1YP5 A;  3U23 A;  2P4R A;  3UWN A;  1SG5 A;  2F1L A;  1AVZ C;  1LVK A;  5IHI A;  1M2V A;  2P4T A;  4GLK A;  3CCV Q;  2DEU A;  4FT2 A;  3JCM e;  1QKW A;  1ZUU A;  1E7O A;  2RJC A;  3C94 A;  2DET A;  2OJ2 A;  1OYX A;  1NEB A;  3LH0 A;  4PJO C;  2DD5 A;  4A53 A;  1RAD B;  3CMA Q;  4PJN A;  4N0A A;  1K8A U;  2LJ0 A;  5EG2 A;  2EKH A;  4ZNX A;  2PZ1 A;  1NLP C;  2H8H A;  2RA2 A;  3VRY A;  1UTI A;  1YJN Q;  1TOV A;  2CP2 A;  1J3T A;  4BI3 A;  2GFU A;  3QBY A;  3MPU B;  5IXF A;  1FMV A;  3PMT A;  3C4S A;  2RF0 A;  1VQ9 Q;  1VQL A;  1VQL T;  4J6W A;  4QQG A;  2EYQ A;  3CC7 Q;  3CBP A;  4JJB A;  1IHV A;  4Y92 A;  1UJ0 A;  1W1F A;  5D6W A;  1ZX6 A;  2KYB A;  4BDY A;  5CIU A;  1HD3 A;  5FWB A;  1I07 A;  2MPX C;  1X2Q A;  4HKE A;  4KGX B;  2JTM A;  2Z0W A;  3E9F A;  2E41 A;  2EPD A;  2QQS A;  1V76 A;  2QYZ A;  2EYY A;  2D1X A;  3CCU Q;  3TCJ A;  4EMH A;  4J9B A;  1BCO A;  5IXB A;  2M02 A;  4A54 A;  3FJP A;  3MET A;  1NYF A;  1UHC A;  4PJO E;  3IQL A;  3V8K A;  2F69 A;  2KYM A;  1X43 A;  3MO8 A;  1VA7 A;  3L2U A;  1D0Z A;  2AIR B;  3CXC S;  2EJG A;  1D0X A;  4M77 D;  5FU6 B;  2CRE A;  3S3N A;  5GMK i;  3UA6 A;  1YIT Q;  4Q5W A;  2EQU A;  2LNV A;  4DA4 A;  1UGS B;  2JW4 A;  5KYY A;  1WHL A;  2RO0 A;  2FPE A;  1X6B A;  1KD1 C;  1BKB A;  5KYU A;  2RHY A;  3A8M B;  4M75 D;  1XOV A;  4FYV B;  3UF4 A;  2J06 A;  3QDR B;  2RH2 A;  5KYN A;  2EJ9 A;  4B6M A;  3QZ5 B;  1H64 1;  1RLP C;  2DZ9 A;  4RTW A;  4M7A F;  1U1S A;  5CAI A;  1N9S A;  4Z02 A;  3RKW A;  4N4I A;  3QHS A;  4N4G A;  3VS6 A;  2LP5 A;  8ATC B;  2CZ1 B;  4OGE A;  4XTZ A;  4FM4 B;  2HL3 A;  1KC8 C;  5J3B A;  1K8A R;  2JT4 A;  2CYZ B;  3OS5 A;  4FW2 A;  3ZFJ A;  3CCR Q;  3JB9 J;  2RK1 A;  2DVJ A;  3QO3 A;  4PJL A;  1VOM A;  3SFM A;  4J9G A;  2CT4 A;  1GBQ A;  1BYM A;  3CBO A;  3NFC A;  2E64 A;  2JMA A;  2WSE E;  4DEY A;  4M7D A;  3TVT A;  2LQK A;  1AWJ A;  2QQB A;  3VU3 C;  4C8Q B;  4F16 A;  3CCJ A;  3CCJ T;  3CCL A;  3RUX A;  3CCM A;  3CCL T;  1I1J A;  3CCM T;  1NBE B;  4BB7 A;  1Y57 A;  1MUZ A;  3M59 A;  4OML A;  1QMC A;  4C5I A;  3EGU A;  2LX9 A;  2QA4 A;  1JXM A;  2QA4 T;  4J7I A;  2EQM A;  4YTL A;  4RCC A;  2VYT A;  4PJO B;  2AK5 A;  4RTX A;  1SHF A;  2ESW A;  3QPH A;  2CUD A;  4C92 A;  1Y96 A;  2FEI A;  2DF6 A;  2K3Y A;  3M9Q A;  5GMK e;  2QTV A;  3EFO B;  1G8X A;  3OY9 A;  3OYE A;  4KUD K;  2LMJ A;  2CSI A;  1M8V A;  3VUZ A;  4PLI A;  2E65 A;  2LZ6 B;  4VUB A;  2OX7 A;  2KXC A;  2EJF A;  3UA7 A;  2DIG A;  3OYI A;  1GCQ C;  5A0G A;  2I0N A;  1VQ5 A;  3S3O A;  2E4H A;  1VQ5 T;  4JRK A;  2L5Q A;  3VYH B;  2DD4 A;  5IH2 A;  4EMK C;  1LCK A;  2K3X A;  3EGD B;  2ZCF B;  4ME7 A;  1ZBJ A;  3H6Z A;  1PC0 A;  2JZ2 A;  2DLP A;  5L8R E;  4LE9 A;  1VQL Q;  4FIB A;  2DTI A;  1IZ6 A;  2FRY A;  4J6X A;  1PKS A;  5D6X A;  4PJO G;  2EYX A;  2FL7 A;  3NGP A;  4NL2 A;  1GL5 A;  4C5G A;  1S1N A;  3L2R A;  1ZSZ C;  2COZ A;  4FT4 A;  3GOX A;  2FZC B;  4BY6 B;  2LRQ A;  2HQE A;  4NL3 A;  2LT1 A;  3M0T A;  2CDT A;  2MAM A;  3CCE A;  3CCE T;  4C8Q D;  4DBR A;  3M4G A;  2K5I A;  3VV0 A;  2IPO B;  2JVV A;  2GQV A;  1VQK A;  2DIQ A;  3UAT A;  1VQK T;  1ACM B;  2D0N A;  1AWO A;  1HYO A;  5HK3 A;  3JCM f;  3OQ5 A;  4J7F A;  4A4H A;  3FLG A;  3MP6 A;  4DEX A;  2CKK A;  1W6X A;  3EG9 A;  1OZ3 A;  2NUT A;  1OEB A;  3P8B B;  4CC3 A;  3H9N A;  1OX8 A;  2HQH A;  5LJ3 g;  4RTU A;  1N5Z A;  2DJQ A;  1RAB B;  3E2U A;  2HMA A;  3FDR A;  1QKX A;  2ENM A;  2HBP A;  2QXF A;  1K9M C;  1W70 A;  1I4K 1;  1T3L A;  1WGS A;  4FYX B;  1KQ2 A;  4M7D F;  1KFZ A;  1I0C A;  5GAM d;  2C06 A;  3A8H B;  4F7U F;  3M53 A;  4M77 C;  2E5K A;  2XKO C;  5FU7 C;  3JCM d;  2X3X D;  3J80 E;  3C0C A;  3G6E A;  3G6E T;  4X9C A;  1NE8 A;  3G7Z A;  3JAM E;  2E6N A;  1Y0M A;  3BW1 A;  2RJD A;  2V26 A;  3RR6 A;  2RJF A;  5IT9 E;  4M75 C;  5LJ5 g;  5GAN 8;  2P0P A;  2EWN A;  1U3O A;  2G3R A;  2XIC A;  3CCJ Q;  3BE3 A;  4CRI A;  2DTH A;  3HKS A;  3JCM b;  3V7R A;  2K57 A;  3X20 B;  5GAN f;  1AWW A;  3JB9 G;  3CCL Q;  1Y71 A;  4C92 F;  3CCM Q;  2JM8 A;  1RLQ C;  1GXI E;  3OBY A;  3JCM h;  2JNG A;  3UDC A;  1M27 C;  2KEA A;  3X24 B;  2A08 A;  2EGA A;  2XDD A;  5CKE A;  2QA4 Q;  5CKB A;  2JN0 A;  2RK2 A;  3EG2 A;  5L23 A;  1TXQ A;  3X26 B;  3DLL A;  3I9Q A;  1TTH B;  1IGU A;  1X6O A;  2KXD A;  4OMM A;  5KE2 A;  4QKU A;  4M77 E;  1N6A A;  4IUR A;  3EG1 A;  5D7U A;  1RAF B;  2E3H A;  2KQW A;  3M0R A;  3CCU A;  1MNE A;  4HCK A;  3VS4 A;  2LC4 A;  5LJ3 e;  4JLG A;  2BZX A;  2HKN A;  4QQ6 A;  2DER A;  4II1 A;  5GAN d;  2O01 E;  4N0A C;  1XQH A;  2CUB A;  3PE0 A;  3CD6 A;  3CD6 T;  2DFU A;  5GAO r;  3DLM A;  4M75 E;  3FRN A;  2K7A A;  2JUF A;  5GAO l;  1ZUY A;  4EMG A;  3H8Z A;  1VYV A;  1VQ5 Q;  3OMG A;  4J5Y A;  3EG3 A;  2FG0 A;  2M51 A;  3UT1 A;  1K73 U;  1YIT A;  1M3A A;  1W4S A;  1VQO A;  2MYS A;  1VQO T;  3CEY A;  3FB9 A;  1ZA1 B;  2DA9 A;  4ELZ C;  3SB2 A;  3JCM P;  3Q1J A;  4TVR A;  2MWP A;  3PVL A;  3HTR A;  5GAN h;  1V29 B;  2CP3 A;  5LJ5 e;  2QI2 A;  2J6F A;  2DM1 A; 
#chains in the Genus database with same CATH homology
 1VQ4 Q;  3CMA Q;  1VQO Q;  1VQP Q;  1N8R R;  1Q7Y R;  1VQ6 Q;  1K9M R;  2QA4 Q;  1Q82 R;  3CC2 Q;  1YI2 Q;  3CCS Q;  1YHQ Q;  3I55 Q;  3CD6 Q;  3CC7 Q;  1W2B P;  1K73 R;  1VQK Q;  2OTL Q;  3G6E Q;  1JJ2 P;  1Q81 R;  1YJN Q;  3G4S Q;  3CCJ Q;  3CCV Q;  1YJW Q;  1QVF P;  1K8A R;  1S72 Q;  2QEX Q;  1NJI R;  3I56 Q;  2OTJ Q;  1KQS P;  3CXC P;  3CCR Q;  3CCE Q;  1YIJ Q;  3CC4 Q;  1VQL Q;  1Q86 R;  3G71 Q;  1VQN Q;  1YJ9 Q;  1KC8 R;  3CCL Q;  1VQ9 Q;  1VQ8 Q;  3CCM Q;  3CCQ Q;  3OW2 P;  1KD1 R;  1M1K R;  1M90 R;  1VQ5 Q;  1VQ7 Q;  1QVG P;  1YIT Q;  3CCU Q;  3CPW P;  1VQM Q;  3CME Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...