3CC2Q

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cc2Q00
3CCUQ 3CC4Q 1Q81R 1Q82R 1VQMQ 1KD1R 3CC2Q 1VQOQ 3CMAQ 1VQPQ 3CCQQ 1K73R 3I56Q 1VQ9Q 3OW2P 2OTLQ 3CCVQ 1N8RR 1YITQ 1QVGP 1VQ4Q 1K8AR 1KQSP 1VQNQ 3G4SQ 2QA4Q 1YJNQ 1YJ9Q 3G6EQ 1VQ8Q 1QVFP 3CD6Q 1W2BP 2QEXQ 3CCJQ 1S72Q 1JJ2P 1VQLQ 3CXCP 1YJWQ 3CMEQ 1KC8R 1M1KR 1VQ5Q 1YHQQ 1VQKQ 2OTJQ 3CCLQ 3CC7Q 3I55Q 3CPWP 1VQ7Q 3G71Q 1VQ6Q 1YI2Q 1K9MR 3CCEQ 3CCSQ 1M90R 1YIJQ 3CCMQ 3CCRQ 1Q7YR 1NJIR 1Q86R
chains in the Genus database with same CATH superfamily
1MUZA 4M7AB 2W10A 2QQAA 3PT9A 4C92D 1YBYA 2QQ9A 1UFFA 1N8RR 2DXTA 1MMAA 1KD1U 2HMAA 1TOVA 4PJLA 2VWFA 2DTOA 5GAOr 2B8AA 3CCJQ 1H8KA 2DK3A 4PLIA 1TG0A 1OV3A 3CBPA 3PGGA 3QHSA 1I5LA 2RQTA 4EIKA 3CCEQ 3CCSQ 4Z89A 3JCMb 2L0AA 3G6ET 5L8RE 4HVVA 2DXCA 3VS1A 1N27A 2NUPB 1RL2A 4C5IA 1KHIA 5D7UA 2AT1B 4HT9A 2C0TA 1RLQC 4F7UF 3RKWA 5GMKl 2W0ZA 2YUNA 2XDPA 2I2LA 5LJ5j 4MZMA 4XTVA 2DXBA 4E47A 2YSQA 2LVMA 5GAN5 1GXIE 3CMAQ 1K9MU 4QVCA 2CP3A 1YFNA 3FB9A 4J9HA 5AT1B 5A2QE 5IT9E 1YIJA 2DA9A 3AT1B 3DB3A 5D6XA 1OI1A 3CD6Q 3GF5A 3A8OB 4PJOA 4F7UE 1GBQA 3KBGA 1M90R 1CSKA 3A8GB 4OB0B 3CCRA 2J6FA 2RMOA 2RHUA 2KVQG 1QVFA 4JLIA 1NG2A 2WSFE 4XTXA 4M7AC 2O4XB 3G4SQ 1ZA2B 1YJ9Q 1X6BA 3VRYA 1QVFP 2KXDA 1UHFA 1S72Q 1SSFA 3FDRA 4OGCA 5CQXA 3H9NA 2DLPA 2L8DA 3CCJA 3RNJA 3L2WA 2X4XA 2DL3A 2G3RA 1Q81R 1BYMA 2RF0A 3UATA 2LJ0A 3A8LB 3ZBDA 3JB9J 3M57A 2M0YA 5CAIA 2LQWA 3QWYA 3TEEA 1IZ6A 3VUZA 2JTMA 8ATCB 4M7DB 2KBTA 4F7UB 3PE0A 1R0BG 3MEWA 2ZPBB 5C6SA 1N5ZA 2A3LA 2SEMA 4CI0C 2VUBA 4ZGDB 3D7SB 4HVWA 3WVEB 1ABQA 4RG8A 1NPRA 1LPLA 4LD6A 4LXCA 1V1CA 4C0GA 1N8RU 2RQUA 5GANg 4AG2C 4JPBW 2FB7A 3OBYA 2DE0X 3FEOA 3NTKA 4KH0B 1MHNA 4IUVA 4ZN1A 1I0CA 2Y4XA 1VYTA 2A37A 3JB9G 1YJNT 3QDFA 2X3WD 3CC4Q 5GMKj 1X75C 3X20B 1G3TA 2JTEA 1WFWA 2HBWA 1VQNQ 3NPFA 1KG1A 1HXDA 1SHGA 2LQKA 1VQ8T 1FMWA 1U06A 3CCUA 1VQLQ 2F2VA 2ESWA 3CCST 1WHJA 3QKJA 5DLOA 2G6FX 2MF2A 3O5ZA 5LJ3h 2RH2A 4E7SA 5HCKA 3ZEHA 1S72A 2LNHB 2EYYA 1ZUYA 1YNZA 4J6XA 1M3CA 3EG9A 2FPFA 4E7IA 2OI3A 1PCXA 2OTLT 4K11A 2MPXC 1I4K1 3EFSA 1GRIA 3MPUB 4C8QB 3UA6A 4PJOF 3OYKA 1KJWA 4E7KA 2NLUA 1RAIB 1M90U 1WQ7A 4DA4A 3J81E 3OW2A 2DO3A 1YHQT 4PK4A 2DJZA 2XK0A 3HFNA 3VKIA 1D0XA 1FX7A 3JCMV 2ZPIB 3Q1JA 4OMQA 3CXCA 2J06A 2DBKA 1IRXA 2E6ZA 2IG0A 2EQMA 1U8RA 3LYIA 5CKEA 4BY6C 2CP7A 1LNXA 1VQ7T 2COZA 2GQVA 3M59A 3FRNA 5GAMg 4KT0E 3CC2A 1HD3A 3OYCA 3L2UA 1UB4A 1BIAA 2AHJB 1K9AA 4JRIA 2BZYA 5GANd 3PMIA 4RTTA 4E7ZA 3J80E 3L2ZA 2EAYA 5J39A 1IHVA 4EMGA 3EGDA 5C0MA 1E7OA 3QIIA 3EG0A 1UGVA 3PVQA 1KSWA 2ZCFB 4NL2A 2JNGA 4M7DD 2QXFA 1YJNQ 2RHXA 2DL8A 4NS5A 4E7JA 1VQ8Q 2E12A 1HJDA 2DTIA 3L2RA 2M02A 4DEYA 3EAEA 1RLPC 3OYMA 1E6HA 3G71A 4PJMA 1BB9A 3I56Q 3FIFA 1KC8U 4FYXB 1JB0E 1NBEB 5CO7A 4C0FA 3OYAA 3UDCA 5GAMj 3UF4A 1VQ5Q 1VQ4A 3LWHA 3ER0A 2DL5A 1YIJQ 4RCCA 2CZ0B 3VJPA 4OP0A 4O6JA 4EMKC 1I5OB 3CCRT 2FVUA 5IXBA 1RI9A 1YITT 2CGHA 3H41A 3A8HB 1VIFA 4OF1A 3QZ9B 1BIBA 2CSQA 4OMOA 1Z9ZA 4D6WA 1UE9A 1YIJT 2FRYA 1WA7A 3C0CA 1WGSA 1TS9A 3O8VA 2FHDA 3S3MA 1WJSA 1ZUUA 5FU7C 2V1QA 3LH5A 3E9FA 3F70A 1I07A 2I0NA 2DNUA 4N0AA 2CP0A 2F2WA 1BI0A 3C4SA 1M8MA 4X9DA 4ESRA 1KC8C 4M7DF 4FCYA 5GAOq 3OYNA 2VASA 5GAN7 3LWIA 5KYXB 4J6WA 2FZCB 5CKDA 1D1AA 5DLQE 4J8OA 4FW1A 4Q5WA 4J9CA 2K5IA 4XAXB 3QDRB 3CCVA 2RI5A 1KQSS 3CC2Q 2F69A 3H6ZA 1NPPA 5LJ3e 1H641 3CC2T 2B86A 3E1SA 1W4SA 4QQDA 1MMGA 3E19A 2HD0A 1K73U 3M0QA 4KGXB 1R0CB 1NLOC 5KE3A 2LMJA 2LT4A 5CKHA 1M30A 3JB9F 3BE3A 1T3SA 2LQ8A 1G3YA 2HBPA 2XMFA 5I2SA 2AZSA 1QCFA 3JB9I 2AKLA 2WSCE 2GTOA 2V8KA 4M77F 2CKKA 3EH1A 2ROTA 1U1SA 2KR3A 3CCET 2QEXQ 2JS2A 4PFOA 3M55A 4MZTA 4BE2A 1UGSB 4CC2A 3G71Q 4M7DA 5FU6C 5GAOp 3RDVA 3MKDA 4GLMA 1OZ2A 4IURA 4B6MA 1NLPC 2K6DA 2WACA 4C0DC 5FWBA 4DBRA 4IUPA 1OU8A 3MEUA 4M7DG 4RTWA 4AFZC 1U1TA 1TUDA 4HCKA 3X28B 1VQ7A 2O88A 1R77A 3OYYA 2DILA 5KYYA 4HXJA 2FEIA 1WXTA 2L3PA 4HCBA 1Q86C 1UTIA 3EGXB 4M77D 1YJWA 2OTLQ 1M1KU 3KFVA 3M0SA 3M4GA 9ATCB 1VYUA 4C8QC 1WYXA 4M7AE 1T0JA 5LJ5f 2VGNA 3G7ZA 4XU2A 2IVWA 4Z02A 1Y96A 4M78C 5GJVB 3DLLA 1S1NA 5DM7R 4AT1B 3HRUA 2QQRA 2Y90A 1N8RC 2H3EB 4KRTA 4BI3A 2ROLA 3ME9A 5EG2A 3JCMJ 1Q81U 1AD5A 3CBMA 1P92A 1WHKA 2X35A 4LDWA 2QGGA 2HKNA 5LJ3d 1ZLMA 4LDXA 4A54A 1VQKQ 1TWBA 3BDLA 3NTHA 4CRIA 2YUPA 2KSSA 1U3OA 1NYFA 1WHMA 1X2QA 2R57A 3JCMc 1UGPB 2YRDA 4FL6A 4AMCA 2PU9B 1VQ8A 4OVAA 4IUUA 3CQTA 2QYZA 1OZ3A 4M7DE 2H8HA 2CREA 5CQYA 3QZ5B 5LJ5e 2RHYA 2RI3A 3SEMA 1Y7XA 3H0FA 1X43A 1M3AA 4LE9A 4HCZA 2K5FA 3V8LA 1WJRA 1I8FA 4A4FA 4BDZA 2JMAA 2X3XD 2EQJA 2K57A 3CCVT 4HA8A 3DKMA 2RHZA 2XKOC 4C5EA 1T3LA 1BI1A 1YI2Q 3HHTB 1VQLT 3MP6A 5LJ3f 1AZGB 4C5GA 4L5GA 2BE9B 4FYVB 1UG1A 3OMGA 4HCCA 4F7UG 2HCKA 2YRVA 2EKOA 3CCMT 4QT7A 5KYXA 4P5NA 3CCLA 1RADB 1MMDA 2GFUA 4BD3A 1M4ZA 4C0ZA 3JB9H 5IHIA 3OYGA 2EYXA 4KGZB 2K2MA 4X34A 1Q82U 5GAN8 1YJ9T 1W2BS 2A0FB 2X51A 3THKA 2HEQA 3UA7A 2YUOA 3QBYA 4M78F 2CH4A 2RPNA 5KYUB 2K5LA 3QYGB 1QKXA 2M16A 2ZAEA 1WX6A 1WHGA 2K2VA 5GANf 4Y92A 2JTFA 2QI2A 5GMKi 1ABOA 3CMET 2RN8A 1QVGP 1K1ZA 4JUVA 4CC7A 5FWCA 3OMCA 1CKBA 2KDSA 2Y4YA 4ELZC 3P8BB 1UECA 1K0XA 2DYBA 1H3ZA 2PTKA 4OMNA 4R55A 4A53A 3MP1A 4C0DB 2GNCA 2RJEA 3CCEA 3GOXA 4C8QG 2DERA 4RTYA 4FT2A 2DPPB 3OSSC 2ZGWA 3CD6A 2L5QA 2RA2A 4WCIA 5GANe 1SRLA 3GIBA 4KH1B 1PNJA 3HSBA 2P4RA 4LD9K 2EGAA 1VUBA 3CEYA 2XU8A 1VQLA 2V8IA 4PJOC 4FYWB 4E6RA 4WTOB 3TCJA 3J7AF 5D6WA 4NOYA 2JT4A 5IHNA 2EWNA 2JN0A 2LRQA 3G6EA 5FLXE 1LJOA 2KNBB 2VXEA 1D0YA 1KQ1A 1G8XA 2RK1A 3CC4T 5FU6B 3QG1A 1FWZA 1JJ2P 1HYOA 2O9SA 2DMOA 4M78G 4J9EA 3VS3A 4M7AF 2XICA 5GAOm 3RESA 2LC4A 3HRTA 3CCRQ 2EFIA 3C12A 1WZOA 2GGRA 5KYNA 3FJ5A 1XQHA 1GFCA 2VGMA 1JJ2A 1RAGB 4JZ3A 1D09B 2X4YA 1Y71A 4JDSA 4NL3A 2F5KA 1PWTA 3HPWA 1MNEA 2YRCA 5LJ5g 1VQNT 2EIFA 2DZ9A 2PUKB 3I9QA 3M4YA 4O5VA 1NJIR 3VRZA 3A8MB 3EHRA 4M7AD 4C8QF 4M75C 4J7IA 2O4XA 2QTVA 2RNAA 3CMEA 1OU9A 4XU0A 3PFSA 3BFMA 2VYTA 2PVDB 1J3TA 3X25B 2OTJQ 1HK9A 3A98A 2D1XA 5I22A 1O9SA 2GCXA 2QQSA 5GAOl 1QQJA 3G1JA 3GLXA 3I56A 5KH6A 3OYLA 1VQPA 3QYHB 2LCCA 1VQ9T 2ATCB 3OQ5A 4ELYC 1TUCA 4MZPA 2ED0A 1JXMA 3LGLA 1K9MC 2LQNA 5KCOA 1M8VA 4OGEA 2WSEE 4J9BA 1KD1C 1VQMA 3EH2A 5DY9A 2NUPA 5KYUA 1X01A 1GCQC 2KRMA 1HSQA 1QKWA 1FMVA 1UEBA 3LH0A 3PVLA 1UUEA 4JS4A 2HZYA 1SPKA 5ECAA 2CS7A 1ZX6A 1KD1R 1EFNA 1VQPQ 2L2PA 2J05A 3M54A 3EGXA 5GAN4 1Q7YU 1XTDA 4JS5A 5FROA 1IXDA 4AG1C 2DM1A 2VC8A 1K8AC 2MI6A 2HDAA 3RMSA 4LDUA 2V8JA 4B9XA 3JCMg 2VKNA 2CH4W 1PC0A 1UGQB 5CR2A 1D3BA 2EKHA 3CMAA 3EG2A 1OPLA 2LZ6B 2CP6A 3V8KA 1IREB 1V29B 2QASA 4M77G 1VQ6T 3OS1A 1NYGA 1YN8A 4A63B 2OJ2A 4BB7A 5GAN3 4C5HA 3CC7A 3CMAT 2KE9A 2P0KA 4A4KA 3UT1A 4A4GA 4M75F 2EVRA 4F16A 4M77C 3V7RA 2QEXA 2A36A 1EZZB 1NM7A 3JCMd 1KIKA 3HL8A 2E5KA 1G3SA 2VV5A 1OULA 1FMKA 1KQ2A 1S72T 3NFCA 1WLPB 4M75A 3VS6A 4KUIA 1D0ZA 1VYVA 2EW3A 1YCYA 3KXTA 1IB8A 4IUQA 2AK5A 4J83A 1X6OA 1VQOT 4C92B 2FPDA 4RTXA 2J7IA 1VA7A 4BDYA 1MGQA 1YITA 5D6YA 3M53A 2HSEB 2F2XA 3SWNB 3JCMe 1YHQA 1AVZC 3RUXA 3QUIA 2A08A 3CCQT 3U23A 4E7HA 3OS5A 1QLYA 2EQKA 8AT1B 1XJWB 3CPWA 3WXMB 2LNVA 1ZSGA 2JW4A 3H0IA 3T9NA 1V76A 5I2MA 2C0IA 5CKFA 4PNOA 1QWEA 5KYWB 1G2BA 4M77B 1YI2T 1WI7A 1OEBA 3M56A 3V8JA 3CPWP 4JRKA 4C92E 3PTAA 4ZTJA 4RTVA 7AT1B 4MMLA 1VQNA 4XTYA 3LGFA 3M0UA 2EPDA 3I55A 1ZUKA 4ZGEB 1W1FA 2K3YA 3I55T 2ZZDA 4M4ZA 5EC7A 2DETA 2YT6A 4UC4A 3CCUT 5M9OA 4JJDA 4JRQA 2E6NA 4IIMA 4C92C 3OY9A 1AZEA 2QDYB 1YI2A 3CCJT 5GMKe 5HY6A 4RTUA 4PJJA 5GMKm 2KROA 2RHIA 1LVKA 2RJFA 4FIBA 4TVRA 4L6V5 2E1HA 3INZA 3V7SA 1K8AR 2CUDA 4JLGA 2CYZB 1SG5A 3E9GA 1UJYA 3L42A 2O31A 3CCLQ 1PRMC 4ATOA 3UWNA 1A0NB 2E65A 2QK0A 1WJQA 2GTJA 4XK8E 2O2OA 1Q82R 1KHCA 1BK2A 4LN2A 4WF2A 2DRMA 2LX9A 1PG5B 4A4EA 2ZPEB 3VS2A 3OW2S 4ORZA 1G83A 3OYDA 1M27C 3CMEQ 1M3BA 4KGVB 4JZ4A 2D0QB 3TU4K 2L3SA 2DIQA 2J6KA 1X2KA 4DBHA 1WXBA 3SFMA 3VS7A 4LDYA 1KQSA 1EX4A 3MHXA 2DBMA 1NJIC 2H3JA 2HKQB 2DX1A 3URGA 4CC3A 4J9DA 5GANh 4HT8A 3SWNA 1SRMA 2YLBA 3CPWS 4ZNXA 2FZKB 1JRIA 2KYMA 1W6XA 4QW2A 4QQ6A 4JJCA 2XHCA 1AWWA 2PVGB 1QMCA 1NE8A 2YWWA 3CCQQ 3GBQA 4BI4A 2KT1A 2O9VA 2PZ1A 4PJNA 1XOVA 3ZL7C 1Y96B 4BACA 4DQ2A 1WDXA 2DFUA 2CZ6B 1TU0B 1M2VA 2CZ1B 1VQ7Q 2PQWA 4OB2B 4XQ3A 1PRLC 4RCBA 5CVIA 5L23A 1IHWA 2EGEA 3QPHA 4M77A 4ZTFA 4M7AA 3MEVA 5KYWA 3EHQA 1RAFB 4LNPA 2P84A 1WXUA 2F1LA 2KRNA 1BCMA 1VQ4Q 1Q95G 3JRZA 4YTLA 1NZ9A 1K76A 2MYSA 2K3XA 2EJFA 1NEBA 3S3OA 2P4TA 3M0PA 2YXYA 3M5AA 3GNGA 3X24B 2JVVA 1ZQ1A 4FM4B 2XIDA 3CCLT 1Q7YC 4JJBA 4HKEA 3VYHB 4EMKA 3CCVQ 4C92A 3CC4A 3FJPA 1PM3A 1O75A 3HTRA 1MV3A 2F5TX 4M7AG 5A0DA 4AFQC 1IGUA 1BKBA 2RJCA 4F14A 3C95A 4XU3A 4OMMA 2P0QA 3CCMQ 3MCAB 4PL6A 1WHLA 1TXQA 4M78B 3EFOB 2O01E 4GLKA 3MEAA 5IN1A 1BBZA 4C92G 1R8OB 1TUGB 3WVDB 3CD6T 1AEYA 3QJYA 3EG9B 3CXCP 3M58A 4JRPA 1YCSB 1LOJA 1PSFA 5GANj 3CC7Q 1JU5C 2CZ7B 4Z8AA 1M9SA 1X27A 4EPCA 4XTWA 2M51A 3OS2A 3I5RA 2KQWA 4X1VA 1K0SA 1PKSA 2OAWA 3RIRA 5A0GA 3CXCS 4M75E 1GFDA 1JXOA 3QSUA 1D3BB 4PFPA 1BI3A 4D8KA 4J9FA 3OSVA 3RMQA 2MWPA 3REBB 1C1AA 2YLCA 1OX8A 2A28A 4QKUA 2IPOB 5FU7B 5LJ3g 2ECZA 1JQQA 4DOVA 3LX7A 2EBPA 1K73R 4PJOE 2ED1A 1RUWA 1NJIU 2E4HA 1N9SA 4XTZA 2L3QA 1YJWT 1W70A 4N4GA 1D1BA 1YJWQ 1Y57A 4XTUA 5GAMd 4R56A 1GL5A 3DLMA 3L2VA 1D1CA 1U5SA 4DBFA 1B07A 3SB2A 1B34A 1Q7YR 3LLRA 4B9WA 4J5YA 4L59A 3FC3A 1F1BB 2E41A 2HL5C 3CCMA 3NHNA 1IO6A 2R5AA 1QCNA 1OX9A 2LX7A 2X4JA 2V1RA 1CKAA 4V2SA 3HP9A 2BUDA 1KC8R 1VQOA 3I55Q 3OYBA 4EDUA 5GAMe 2MWOA 2QA4T 1QVPA 2HQXA 3OA6A 1H92A 2R5MA 3E2UA 1JBMA 2XDDA 2P0PA 3SHWA 5IXFA 2MOXA 2D6FA 4AFSC 1BCOA 1AHJB 1MNDA 4M78E 3ASKA 1AWJA 3A5ZB 1SKUB 2DD4A 2PNIA 3A1PA 4M77E 3V7CA 3JB9D 2OX7A 4BUGA 2VXFA 3R6NA 2CT3A 4A4HA 2E5QA 1M2VB 2ABLA 3VV0A 1N9RA 2A7YA 1VQOQ 3CC7T 3RR6A 1QVGA 4PFZA 1QP3A 5AYFA 2VB6A 2K7AA 2E3IA 1YITQ 1GBRA 2DIGA 5FRNA 2NWMA 3MP8A 4N4IA 4N4HA 4RMOA 1FXXA 2DL7A 4CC4B 1C6VX 2KXCA 4N0AC 4EMKB 2FG0A 3VS4A 3OYIA 1RACB 2LTOA 5CKBA 2R58A 2DEQA 3GPLA 3JCMQ 2GF7A 2C06A 1M2OA 3KUFA 3JCMf 4BE0A 2BZXA 1YHQQ 2LJ1A 4Y91A 2LDMA 5CIUA 5KCHA 1VQKT 4DOWA 3JCMP 1M5Q1 4M78D 2CDTA 4J9IA 4Y28E 4OB1B 5LJ5h 3M0TA 3CPFA 2LT1A 1SF9A 2ENMA 4F17A 2EGCA 2QDLA 2MMPA 3ULRB 1B34B 1ZBXA 2E3HA 2JM9A 2COYA 4EMHA 3RKYA 1QVGS 1LCKA 1OPKA 3EFOA 5HK3A 1M90C 1ZA1B 2RM4A 1VQ9A 4ME7A 4XU1A 2XDBA 3S6WA 1FYNA 1Y07A 5I21A 1B3QA 2SRCA 2QEXT 3G4SA 2PVOB 4C8QD 2QA4Q 1JJ2S 3MJXA 4QVDA 1K4US 3SWNC 4DEXA 1UJ0A 1MV0B 1ZBJA 3I56T 3I35A 4QQGA 4BY6B 2HL3A 2RQRA 5HKCA 3BDUA 4M75G 1UHCA 2JJ9A 5GMKh 5HK0A 3OBWA 1VQ6A 2X4WA 1Z9QA 4GY5A 1M1FA 2AKKA 4MDWA 2XG8D 4QVZA 3R6OA 2D8HA 3VS5A 4ZN3A 2KYBA 2DVEA 4DBQA 3PIOA 2MCNA 2OTJT 2LP5A 4HVUA 1KK7A 4OB3B 1NEGA 3X26B 3VUBA 3S3NA 5LJ5d 5GAN6 3I5SA 5IHKA 5I11A 2L89A 2FRWA 4RG2A 2CP5A 2M9UA 4D8DA 2GFAA 1GCPA 1RAHB 2HSPA 1I1JA 4C92F 1IGQA 4KUDK 1X6GA 3EGUA 1ACMB 3TREA 4C8QE 3L1AA 1UDLA 2HAXA 5CCAA 1VQ9Q 4E7LA 1YJNA 1KQSP 5LL6S 1VQ5A 2JM8A 1N6AA 2KY9A 1QWFA 1W2BP 2DEUA 2X9HA 4PJOD 2LCLA 3RERA 3TSZA 2FL7A 2Z0WA 3H8ZA 3NMZC 3QJ6A 2COWA 4M75B 4BE1A 2RJDA 2K79A 1ZSZA 3TVTA 4VUBA 1Y0MA 3IQLA 2KGTA 1VQPT 1W2BA 2BIVA 2FPEA 2DF6A 2KRSA 3OW2P 3VS0A 4M78A 3VYGA 3G6EQ 2EYQA 1BI2A 2V26A 5GAN2 2D0NA 5IAYA 1AT1B 4LUDA 3P8DA 3SDZA 1OQKA 2BKDN 2K9GA 1WQWA 4JJNK 3P8HA 3CCSA 5J26A 1VQ4T 1BU1A 3LW5E 3OYFA 4GBQA 1Q81C 2E70A 3JSCA 1DJ7B 5J3BA 3NTIA 2ZPHB 2KAFA 3G71T 4M75D 2XI9A 3FLGA 4IKFA 5GAMf 4OMLA 4J9GA 4IIOA 3JCMW 2VVKA 1QW1A 2JXBA 2EYZA 4J7FA 1RABB 2DKGA 1JEGA 1EIFA 1T0HA 2E64A 3CCQA 2RI2A 3PNWC 3QO3A 1SHFA 2HQEA 2XD0A 2BTTA 3M9QA 1YJ9A 1JO8A 2EYWA 1RAAB 5GAMh 6AT1B 3NGPA 5KE2A 3HFOA 2HNIA 3G4ST 4ANJA 3DB4A 1VIEA 3SD4A 2YHTA 4F04B 1AOJA 1TH7A 4BI8B 3EGDB 2DJQA 2KI7A 2EQIA 4LDVA 2MAMA 2JOYA 1WHHA 4Z88A 2QAZA 3N5BB 2JS0A 2OTJA 2PUOB 3UPUA 2YDLA 1VQMQ 1RI0A 3JV3A 2HQHA 1WIEA 4LUEA 1PSEA 3TQ7P 3RKXA 3HKSA 1VQMT 1X69A 3BY7A 2CT4A 2LCSA 2DVJA 5LJ3j 1UGRB 1TSFA 4FSSA 2RD1A 3EG3A 2IIMA 2DAQA 2QTXA 2QG9B 1RAEB 3BW1A 1Q82C 3REAB 4ZGJB 3H0HA 3VU3C 2EJGA 3TSWA 2OTLA 2NUTA 4RUGA 2DRKA 1M1KC 4RKUE 3GP8A 4C8QA 1ARKA 2K4YA 3JCMh 2KMTA 1GCQA 2NUZA 4MDXA 2BZ8A 4E2FB 4AFUC 3OS0A 1OYXA 3META 3OYHA 1ZHIA 2ZPGB 2NYSA 3CCUQ 2M0OA 1ZSZB 5GJWB 1QVFS 2DL4A 1TTHB 4MMKA 3PIPA 4F7UA 1YP5A 2D9TA 1C0MA 4II1A 2MIOA 3QWXX 5A0LA 4IUTA 2ZPFB 1MMNA 2GQIA 1SEMA 4M7DC 2OAUA 3AHUA 1E6GA 2AZVA 2LJ3A 4X9CA 1I81A 1Q86U 3HRSA 2JUFA 2KK4A 1SSHA 1VQ6Q 4FYYB 1K9MR 2DXUA 1VQKA 3JCMX 4KULA 1M1GA 2JMCA 1PKTA 2L3RA 3PMTA 2EQUA 1PD1A 2M1HA 2C0OA 4RTZA 3QXEB 4OMPA 4FW2A 1VQ5T 2QA4A 3EFRA 3C94A 3OYJA 2FO0A 1XNIA 3MO8A 1YWPA 2DD5A 4R0KA 2K3BA 4FT4A 1QCOA 1YWOA 2KT8A 2AIRB 5IH2A 4PLLA 4FU6A 1OOTA 1K73C 5FRMA 3GNFB 3CBOA 1G3WA 2RQWA 2NUTB 2D8JA 2QQBA 2RB6A 2DTHA 5CK9A 4PJOB 1WPYA 2FZGB 5KYYB 1G5VA 2RO0A 2MK5A 2DZCA 3OYEA 4OMFB 5FW9A 2YUQA 2RK2A 1PD0A 2QGFB 2RQVA 1H3HA 2CUBA 4FSXA 1QP2A 4PKCC 2CP2A 2E10A 4KBMB 5GAOn 1KFZA 1Q86R 4PJOG 3EG1A 1K8AU 3ZFJA 3L2QA 2FYKA 2BE7D 1B7TA 1VOMA 3RBBB 2GBQA 4J6YA 3M0RA 2CSIA 3OB9A 1AWOA 1PHTA 2KEAA 1M1KR 2DYIA 2EJ9A 1AWXA 3JAME 2J6OA 1WNLA 1ZSZC 2JZ2A
chains in the Genus database with same CATH topology
3CCUQ 3CC4Q 1Q81R 1Q82R 1VQMQ 1KD1R 3CC2Q 1VQOQ 3CMAQ 1VQPQ 3CCQQ 1K73R 3I56Q 1VQ9Q 3OW2P 2OTLQ 3CCVQ 1N8RR 1YITQ 1QVGP 1VQ4Q 1K8AR 1KQSP 1VQNQ 3G4SQ 2QA4Q 1YJNQ 1YJ9Q 3G6EQ 1VQ8Q 1QVFP 3CD6Q 1W2BP 2QEXQ 3CCJQ 1S72Q 1JJ2P 1VQLQ 3CXCP 1YJWQ 3CMEQ 1KC8R 1M1KR 1VQ5Q 1YHQQ 1VQKQ 2OTJQ 3CCLQ 3CC7Q 3I55Q 3CPWP 1VQ7Q 3G71Q 1VQ6Q 1YI2Q 1K9MR 3CCEQ 3CCSQ 1M90R 1YIJQ 3CCMQ 3CCRQ 1Q7YR 1NJIR 1Q86R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU Q;  3CC4 Q;  1Q81 R;  1Q82 R;  1VQM Q;  1KD1 R;  3CC2 Q;  1VQO Q;  3CMA Q;  1VQP Q;  3CCQ Q;  1K73 R;  3I56 Q;  1VQ9 Q;  3OW2 P;  2OTL Q;  3CCV Q;  1N8R R;  1YIT Q;  1QVG P;  1VQ4 Q;  1K8A R;  1KQS P;  1VQN Q;  3G4S Q;  2QA4 Q;  1YJN Q;  1YJ9 Q;  3G6E Q;  1VQ8 Q;  1QVF P;  3CD6 Q;  1W2B P;  2QEX Q;  3CCJ Q;  1S72 Q;  1JJ2 P;  1VQL Q;  3CXC P;  1YJW Q;  3CME Q;  1KC8 R;  1M1K R;  1VQ5 Q;  1YHQ Q;  1VQK Q;  2OTJ Q;  3CCL Q;  3CC7 Q;  3I55 Q;  3CPW P;  1VQ7 Q;  3G71 Q;  1VQ6 Q;  1YI2 Q;  1K9M R;  3CCE Q;  3CCS Q;  1M90 R;  1YIJ Q;  3CCM Q;  3CCR Q;  1Q7Y R;  1NJI R;  1Q86 R; 
#chains in the Genus database with same CATH topology
 1MUZ A;  4M7A B;  2W10 A;  2QQA A;  3PT9 A;  4C92 D;  1YBY A;  2QQ9 A;  1UFF A;  1N8R R;  2DXT A;  1MMA A;  1KD1 U;  2HMA A;  1TOV A;  4PJL A;  2VWF A;  2DTO A;  5GAO r;  2B8A A;  3CCJ Q;  1H8K A;  2DK3 A;  4PLI A;  1TG0 A;  1OV3 A;  3CBP A;  3PGG A;  3QHS A;  1I5L A;  2RQT A;  4EIK A;  3CCE Q;  3CCS Q;  4Z89 A;  3JCM b;  2L0A A;  3G6E T;  5L8R E;  4HVV A;  2DXC A;  3VS1 A;  1N27 A;  2NUP B;  1RL2 A;  4C5I A;  1KHI A;  5D7U A;  2AT1 B;  4HT9 A;  2C0T A;  1RLQ C;  4F7U F;  3RKW A;  5GMK l;  2W0Z A;  2YUN A;  2XDP A;  2I2L A;  5LJ5 j;  4MZM A;  4XTV A;  2DXB A;  4E47 A;  2YSQ A;  2LVM A;  5GAN 5;  1GXI E;  3CMA Q;  1K9M U;  4QVC A;  2CP3 A;  1YFN A;  3FB9 A;  4J9H A;  5AT1 B;  5A2Q E;  5IT9 E;  1YIJ A;  2DA9 A;  3AT1 B;  3DB3 A;  5D6X A;  1OI1 A;  3CD6 Q;  3GF5 A;  3A8O B;  4PJO A;  4F7U E;  1GBQ A;  3KBG A;  1M90 R;  1CSK A;  3A8G B;  4OB0 B;  3CCR A;  2J6F A;  2RMO A;  2RHU A;  2KVQ G;  1QVF A;  4JLI A;  1NG2 A;  2WSF E;  4XTX A;  4M7A C;  2O4X B;  3G4S Q;  1ZA2 B;  1YJ9 Q;  1X6B A;  3VRY A;  1QVF P;  2KXD A;  1UHF A;  1S72 Q;  1SSF A;  3FDR A;  4OGC A;  5CQX A;  3H9N A;  2DLP A;  2L8D A;  3CCJ A;  3RNJ A;  3L2W A;  2X4X A;  2DL3 A;  2G3R A;  1Q81 R;  1BYM A;  2RF0 A;  3UAT A;  2LJ0 A;  3A8L B;  3ZBD A;  3JB9 J;  3M57 A;  2M0Y A;  5CAI A;  2LQW A;  3QWY A;  3TEE A;  1IZ6 A;  3VUZ A;  2JTM A;  8ATC B;  4M7D B;  2KBT A;  4F7U B;  3PE0 A;  1R0B G;  3MEW A;  2ZPB B;  5C6S A;  1N5Z A;  2A3L A;  2SEM A;  4CI0 C;  2VUB A;  4ZGD B;  3D7S B;  4HVW A;  3WVE B;  1ABQ A;  4RG8 A;  1NPR A;  1LPL A;  4LD6 A;  4LXC A;  1V1C A;  4C0G A;  1N8R U;  2RQU A;  5GAN g;  4AG2 C;  4JPB W;  2FB7 A;  3OBY A;  2DE0 X;  3FEO A;  3NTK A;  4KH0 B;  1MHN A;  4IUV A;  4ZN1 A;  1I0C A;  2Y4X A;  1VYT A;  2A37 A;  3JB9 G;  1YJN T;  3QDF A;  2X3W D;  3CC4 Q;  5GMK j;  1X75 C;  3X20 B;  1G3T A;  2JTE A;  1WFW A;  2HBW A;  1VQN Q;  3NPF A;  1KG1 A;  1HXD A;  1SHG A;  2LQK A;  1VQ8 T;  1FMW A;  1U06 A;  3CCU A;  1VQL Q;  2F2V A;  2ESW A;  3CCS T;  1WHJ A;  3QKJ A;  5DLO A;  2G6F X;  2MF2 A;  3O5Z A;  5LJ3 h;  2RH2 A;  4E7S A;  5HCK A;  3ZEH A;  1S72 A;  2LNH B;  2EYY A;  1ZUY A;  1YNZ A;  4J6X A;  1M3C A;  3EG9 A;  2FPF A;  4E7I A;  2OI3 A;  1PCX A;  2OTL T;  4K11 A;  2MPX C;  1I4K 1;  3EFS A;  1GRI A;  3MPU B;  4C8Q B;  3UA6 A;  4PJO F;  3OYK A;  1KJW A;  4E7K A;  2NLU A;  1RAI B;  1M90 U;  1WQ7 A;  4DA4 A;  3J81 E;  3OW2 A;  2DO3 A;  1YHQ T;  4PK4 A;  2DJZ A;  2XK0 A;  3HFN A;  3VKI A;  1D0X A;  1FX7 A;  3JCM V;  2ZPI B;  3Q1J A;  4OMQ A;  3CXC A;  2J06 A;  2DBK A;  1IRX A;  2E6Z A;  2IG0 A;  2EQM A;  1U8R A;  3LYI A;  5CKE A;  4BY6 C;  2CP7 A;  1LNX A;  1VQ7 T;  2COZ A;  2GQV A;  3M59 A;  3FRN A;  5GAM g;  4KT0 E;  3CC2 A;  1HD3 A;  3OYC A;  3L2U A;  1UB4 A;  1BIA A;  2AHJ B;  1K9A A;  4JRI A;  2BZY A;  5GAN d;  3PMI A;  4RTT A;  4E7Z A;  3J80 E;  3L2Z A;  2EAY A;  5J39 A;  1IHV A;  4EMG A;  3EGD A;  5C0M A;  1E7O A;  3QII A;  3EG0 A;  1UGV A;  3PVQ A;  1KSW A;  2ZCF B;  4NL2 A;  2JNG A;  4M7D D;  2QXF A;  1YJN Q;  2RHX A;  2DL8 A;  4NS5 A;  4E7J A;  1VQ8 Q;  2E12 A;  1HJD A;  2DTI A;  3L2R A;  2M02 A;  4DEY A;  3EAE A;  1RLP C;  3OYM A;  1E6H A;  3G71 A;  4PJM A;  1BB9 A;  3I56 Q;  3FIF A;  1KC8 U;  4FYX B;  1JB0 E;  1NBE B;  5CO7 A;  4C0F A;  3OYA A;  3UDC A;  5GAM j;  3UF4 A;  1VQ5 Q;  1VQ4 A;  3LWH A;  3ER0 A;  2DL5 A;  1YIJ Q;  4RCC A;  2CZ0 B;  3VJP A;  4OP0 A;  4O6J A;  4EMK C;  1I5O B;  3CCR T;  2FVU A;  5IXB A;  1RI9 A;  1YIT T;  2CGH A;  3H41 A;  3A8H B;  1VIF A;  4OF1 A;  3QZ9 B;  1BIB A;  2CSQ A;  4OMO A;  1Z9Z A;  4D6W A;  1UE9 A;  1YIJ T;  2FRY A;  1WA7 A;  3C0C A;  1WGS A;  1TS9 A;  3O8V A;  2FHD A;  3S3M A;  1WJS A;  1ZUU A;  5FU7 C;  2V1Q A;  3LH5 A;  3E9F A;  3F70 A;  1I07 A;  2I0N A;  2DNU A;  4N0A A;  2CP0 A;  2F2W A;  1BI0 A;  3C4S A;  1M8M A;  4X9D A;  4ESR A;  1KC8 C;  4M7D F;  4FCY A;  5GAO q;  3OYN A;  2VAS A;  5GAN 7;  3LWI A;  5KYX B;  4J6W A;  2FZC B;  5CKD A;  1D1A A;  5DLQ E;  4J8O A;  4FW1 A;  4Q5W A;  4J9C A;  2K5I A;  4XAX B;  3QDR B;  3CCV A;  2RI5 A;  1KQS S;  3CC2 Q;  2F69 A;  3H6Z A;  1NPP A;  5LJ3 e;  1H64 1;  3CC2 T;  2B86 A;  3E1S A;  1W4S A;  4QQD A;  1MMG A;  3E19 A;  2HD0 A;  1K73 U;  3M0Q A;  4KGX B;  1R0C B;  1NLO C;  5KE3 A;  2LMJ A;  2LT4 A;  5CKH A;  1M30 A;  3JB9 F;  3BE3 A;  1T3S A;  2LQ8 A;  1G3Y A;  2HBP A;  2XMF A;  5I2S A;  2AZS A;  1QCF A;  3JB9 I;  2AKL A;  2WSC E;  2GTO A;  2V8K A;  4M77 F;  2CKK A;  3EH1 A;  2ROT A;  1U1S A;  2KR3 A;  3CCE T;  2QEX Q;  2JS2 A;  4PFO A;  3M55 A;  4MZT A;  4BE2 A;  1UGS B;  4CC2 A;  3G71 Q;  4M7D A;  5FU6 C;  5GAO p;  3RDV A;  3MKD A;  4GLM A;  1OZ2 A;  4IUR A;  4B6M A;  1NLP C;  2K6D A;  2WAC A;  4C0D C;  5FWB A;  4DBR A;  4IUP A;  1OU8 A;  3MEU A;  4M7D G;  4RTW A;  4AFZ C;  1U1T A;  1TUD A;  4HCK A;  3X28 B;  1VQ7 A;  2O88 A;  1R77 A;  3OYY A;  2DIL A;  5KYY A;  4HXJ A;  2FEI A;  1WXT A;  2L3P A;  4HCB A;  1Q86 C;  1UTI A;  3EGX B;  4M77 D;  1YJW A;  2OTL Q;  1M1K U;  3KFV A;  3M0S A;  3M4G A;  9ATC B;  1VYU A;  4C8Q C;  1WYX A;  4M7A E;  1T0J A;  5LJ5 f;  2VGN A;  3G7Z A;  4XU2 A;  2IVW A;  4Z02 A;  1Y96 A;  4M78 C;  5GJV B;  3DLL A;  1S1N A;  5DM7 R;  4AT1 B;  3HRU A;  2QQR A;  2Y90 A;  1N8R C;  2H3E B;  4KRT A;  4BI3 A;  2ROL A;  3ME9 A;  5EG2 A;  3JCM J;  1Q81 U;  1AD5 A;  3CBM A;  1P92 A;  1WHK A;  2X35 A;  4LDW A;  2QGG A;  2HKN A;  5LJ3 d;  1ZLM A;  4LDX A;  4A54 A;  1VQK Q;  1TWB A;  3BDL A;  3NTH A;  4CRI A;  2YUP A;  2KSS A;  1U3O A;  1NYF A;  1WHM A;  1X2Q A;  2R57 A;  3JCM c;  1UGP B;  2YRD A;  4FL6 A;  4AMC A;  2PU9 B;  1VQ8 A;  4OVA A;  4IUU A;  3CQT A;  2QYZ A;  1OZ3 A;  4M7D E;  2H8H A;  2CRE A;  5CQY A;  3QZ5 B;  5LJ5 e;  2RHY A;  2RI3 A;  3SEM A;  1Y7X A;  3H0F A;  1X43 A;  1M3A A;  4LE9 A;  4HCZ A;  2K5F A;  3V8L A;  1WJR A;  1I8F A;  4A4F A;  4BDZ A;  2JMA A;  2X3X D;  2EQJ A;  2K57 A;  3CCV T;  4HA8 A;  3DKM A;  2RHZ A;  2XKO C;  4C5E A;  1T3L A;  1BI1 A;  1YI2 Q;  3HHT B;  1VQL T;  3MP6 A;  5LJ3 f;  1AZG B;  4C5G A;  4L5G A;  2BE9 B;  4FYV B;  1UG1 A;  3OMG A;  4HCC A;  4F7U G;  2HCK A;  2YRV A;  2EKO A;  3CCM T;  4QT7 A;  5KYX A;  4P5N A;  3CCL A;  1RAD B;  1MMD A;  2GFU A;  4BD3 A;  1M4Z A;  4C0Z A;  3JB9 H;  5IHI A;  3OYG A;  2EYX A;  4KGZ B;  2K2M A;  4X34 A;  1Q82 U;  5GAN 8;  1YJ9 T;  1W2B S;  2A0F B;  2X51 A;  3THK A;  2HEQ A;  3UA7 A;  2YUO A;  3QBY A;  4M78 F;  2CH4 A;  2RPN A;  5KYU B;  2K5L A;  3QYG B;  1QKX A;  2M16 A;  2ZAE A;  1WX6 A;  1WHG A;  2K2V A;  5GAN f;  4Y92 A;  2JTF A;  2QI2 A;  5GMK i;  1ABO A;  3CME T;  2RN8 A;  1QVG P;  1K1Z A;  4JUV A;  4CC7 A;  5FWC A;  3OMC A;  1CKB A;  2KDS A;  2Y4Y A;  4ELZ C;  3P8B B;  1UEC A;  1K0X A;  2DYB A;  1H3Z A;  2PTK A;  4OMN A;  4R55 A;  4A53 A;  3MP1 A;  4C0D B;  2GNC A;  2RJE A;  3CCE A;  3GOX A;  4C8Q G;  2DER A;  4RTY A;  4FT2 A;  2DPP B;  3OSS C;  2ZGW A;  3CD6 A;  2L5Q A;  2RA2 A;  4WCI A;  5GAN e;  1SRL A;  3GIB A;  4KH1 B;  1PNJ A;  3HSB A;  2P4R A;  4LD9 K;  2EGA A;  1VUB A;  3CEY A;  2XU8 A;  1VQL A;  2V8I A;  4PJO C;  4FYW B;  4E6R A;  4WTO B;  3TCJ A;  3J7A F;  5D6W A;  4NOY A;  2JT4 A;  5IHN A;  2EWN A;  2JN0 A;  2LRQ A;  3G6E A;  5FLX E;  1LJO A;  2KNB B;  2VXE A;  1D0Y A;  1KQ1 A;  1G8X A;  2RK1 A;  3CC4 T;  5FU6 B;  3QG1 A;  1FWZ A;  1JJ2 P;  1HYO A;  2O9S A;  2DMO A;  4M78 G;  4J9E A;  3VS3 A;  4M7A F;  2XIC A;  5GAO m;  3RES A;  2LC4 A;  3HRT A;  3CCR Q;  2EFI A;  3C12 A;  1WZO A;  2GGR A;  5KYN A;  3FJ5 A;  1XQH A;  1GFC A;  2VGM A;  1JJ2 A;  1RAG B;  4JZ3 A;  1D09 B;  2X4Y A;  1Y71 A;  4JDS A;  4NL3 A;  2F5K A;  1PWT A;  3HPW A;  1MNE A;  2YRC A;  5LJ5 g;  1VQN T;  2EIF A;  2DZ9 A;  2PUK B;  3I9Q A;  3M4Y A;  4O5V A;  1NJI R;  3VRZ A;  3A8M B;  3EHR A;  4M7A D;  4C8Q F;  4M75 C;  4J7I A;  2O4X A;  2QTV A;  2RNA A;  3CME A;  1OU9 A;  4XU0 A;  3PFS A;  3BFM A;  2VYT A;  2PVD B;  1J3T A;  3X25 B;  2OTJ Q;  1HK9 A;  3A98 A;  2D1X A;  5I22 A;  1O9S A;  2GCX A;  2QQS A;  5GAO l;  1QQJ A;  3G1J A;  3GLX A;  3I56 A;  5KH6 A;  3OYL A;  1VQP A;  3QYH B;  2LCC A;  1VQ9 T;  2ATC B;  3OQ5 A;  4ELY C;  1TUC A;  4MZP A;  2ED0 A;  1JXM A;  3LGL A;  1K9M C;  2LQN A;  5KCO A;  1M8V A;  4OGE A;  2WSE E;  4J9B A;  1KD1 C;  1VQM A;  3EH2 A;  5DY9 A;  2NUP A;  5KYU A;  1X01 A;  1GCQ C;  2KRM A;  1HSQ A;  1QKW A;  1FMV A;  1UEB A;  3LH0 A;  3PVL A;  1UUE A;  4JS4 A;  2HZY A;  1SPK A;  5ECA A;  2CS7 A;  1ZX6 A;  1KD1 R;  1EFN A;  1VQP Q;  2L2P A;  2J05 A;  3M54 A;  3EGX A;  5GAN 4;  1Q7Y U;  1XTD A;  4JS5 A;  5FRO A;  1IXD A;  4AG1 C;  2DM1 A;  2VC8 A;  1K8A C;  2MI6 A;  2HDA A;  3RMS A;  4LDU A;  2V8J A;  4B9X A;  3JCM g;  2VKN A;  2CH4 W;  1PC0 A;  1UGQ B;  5CR2 A;  1D3B A;  2EKH A;  3CMA A;  3EG2 A;  1OPL A;  2LZ6 B;  2CP6 A;  3V8K A;  1IRE B;  1V29 B;  2QAS A;  4M77 G;  1VQ6 T;  3OS1 A;  1NYG A;  1YN8 A;  4A63 B;  2OJ2 A;  4BB7 A;  5GAN 3;  4C5H A;  3CC7 A;  3CMA T;  2KE9 A;  2P0K A;  4A4K A;  3UT1 A;  4A4G A;  4M75 F;  2EVR A;  4F16 A;  4M77 C;  3V7R A;  2QEX A;  2A36 A;  1EZZ B;  1NM7 A;  3JCM d;  1KIK A;  3HL8 A;  2E5K A;  1G3S A;  2VV5 A;  1OUL A;  1FMK A;  1KQ2 A;  1S72 T;  3NFC A;  1WLP B;  4M75 A;  3VS6 A;  4KUI A;  1D0Z A;  1VYV A;  2EW3 A;  1YCY A;  3KXT A;  1IB8 A;  4IUQ A;  2AK5 A;  4J83 A;  1X6O A;  1VQO T;  4C92 B;  2FPD A;  4RTX A;  2J7I A;  1VA7 A;  4BDY A;  1MGQ A;  1YIT A;  5D6Y A;  3M53 A;  2HSE B;  2F2X A;  3SWN B;  3JCM e;  1YHQ A;  1AVZ C;  3RUX A;  3QUI A;  2A08 A;  3CCQ T;  3U23 A;  4E7H A;  3OS5 A;  1QLY A;  2EQK A;  8AT1 B;  1XJW B;  3CPW A;  3WXM B;  2LNV A;  1ZSG A;  2JW4 A;  3H0I A;  3T9N A;  1V76 A;  5I2M A;  2C0I A;  5CKF A;  4PNO A;  1QWE A;  5KYW B;  1G2B A;  4M77 B;  1YI2 T;  1WI7 A;  1OEB A;  3M56 A;  3V8J A;  3CPW P;  4JRK A;  4C92 E;  3PTA A;  4ZTJ A;  4RTV A;  7AT1 B;  4MML A;  1VQN A;  4XTY A;  3LGF A;  3M0U A;  2EPD A;  3I55 A;  1ZUK A;  4ZGE B;  1W1F A;  2K3Y A;  3I55 T;  2ZZD A;  4M4Z A;  5EC7 A;  2DET A;  2YT6 A;  4UC4 A;  3CCU T;  5M9O A;  4JJD A;  4JRQ A;  2E6N A;  4IIM A;  4C92 C;  3OY9 A;  1AZE A;  2QDY B;  1YI2 A;  3CCJ T;  5GMK e;  5HY6 A;  4RTU A;  4PJJ A;  5GMK m;  2KRO A;  2RHI A;  1LVK A;  2RJF A;  4FIB A;  4TVR A;  4L6V 5;  2E1H A;  3INZ A;  3V7S A;  1K8A R;  2CUD A;  4JLG A;  2CYZ B;  1SG5 A;  3E9G A;  1UJY A;  3L42 A;  2O31 A;  3CCL Q;  1PRM C;  4ATO A;  3UWN A;  1A0N B;  2E65 A;  2QK0 A;  1WJQ A;  2GTJ A;  4XK8 E;  2O2O A;  1Q82 R;  1KHC A;  1BK2 A;  4LN2 A;  4WF2 A;  2DRM A;  2LX9 A;  1PG5 B;  4A4E A;  2ZPE B;  3VS2 A;  3OW2 S;  4ORZ A;  1G83 A;  3OYD A;  1M27 C;  3CME Q;  1M3B A;  4KGV B;  4JZ4 A;  2D0Q B;  3TU4 K;  2L3S A;  2DIQ A;  2J6K A;  1X2K A;  4DBH A;  1WXB A;  3SFM A;  3VS7 A;  4LDY A;  1KQS A;  1EX4 A;  3MHX A;  2DBM A;  1NJI C;  2H3J A;  2HKQ B;  2DX1 A;  3URG A;  4CC3 A;  4J9D A;  5GAN h;  4HT8 A;  3SWN A;  1SRM A;  2YLB A;  3CPW S;  4ZNX A;  2FZK B;  1JRI A;  2KYM A;  1W6X A;  4QW2 A;  4QQ6 A;  4JJC A;  2XHC A;  1AWW A;  2PVG B;  1QMC A;  1NE8 A;  2YWW A;  3CCQ Q;  3GBQ A;  4BI4 A;  2KT1 A;  2O9V A;  2PZ1 A;  4PJN A;  1XOV A;  3ZL7 C;  1Y96 B;  4BAC A;  4DQ2 A;  1WDX A;  2DFU A;  2CZ6 B;  1TU0 B;  1M2V A;  2CZ1 B;  1VQ7 Q;  2PQW A;  4OB2 B;  4XQ3 A;  1PRL C;  4RCB A;  5CVI A;  5L23 A;  1IHW A;  2EGE A;  3QPH A;  4M77 A;  4ZTF A;  4M7A A;  3MEV A;  5KYW A;  3EHQ A;  1RAF B;  4LNP A;  2P84 A;  1WXU A;  2F1L A;  2KRN A;  1BCM A;  1VQ4 Q;  1Q95 G;  3JRZ A;  4YTL A;  1NZ9 A;  1K76 A;  2MYS A;  2K3X A;  2EJF A;  1NEB A;  3S3O A;  2P4T A;  3M0P A;  2YXY A;  3M5A A;  3GNG A;  3X24 B;  2JVV A;  1ZQ1 A;  4FM4 B;  2XID A;  3CCL T;  1Q7Y C;  4JJB A;  4HKE A;  3VYH B;  4EMK A;  3CCV Q;  4C92 A;  3CC4 A;  3FJP A;  1PM3 A;  1O75 A;  3HTR A;  1MV3 A;  2F5T X;  4M7A G;  5A0D A;  4AFQ C;  1IGU A;  1BKB A;  2RJC A;  4F14 A;  3C95 A;  4XU3 A;  4OMM A;  2P0Q A;  3CCM Q;  3MCA B;  4PL6 A;  1WHL A;  1TXQ A;  4M78 B;  3EFO B;  2O01 E;  4GLK A;  3MEA A;  5IN1 A;  1BBZ A;  4C92 G;  1R8O B;  1TUG B;  3WVD B;  3CD6 T;  1AEY A;  3QJY A;  3EG9 B;  3CXC P;  3M58 A;  4JRP A;  1YCS B;  1LOJ A;  1PSF A;  5GAN j;  3CC7 Q;  1JU5 C;  2CZ7 B;  4Z8A A;  1M9S A;  1X27 A;  4EPC A;  4XTW A;  2M51 A;  3OS2 A;  3I5R A;  2KQW A;  4X1V A;  1K0S A;  1PKS A;  2OAW A;  3RIR A;  5A0G A;  3CXC S;  4M75 E;  1GFD A;  1JXO A;  3QSU A;  1D3B B;  4PFP A;  1BI3 A;  4D8K A;  4J9F A;  3OSV A;  3RMQ A;  2MWP A;  3REB B;  1C1A A;  2YLC A;  1OX8 A;  2A28 A;  4QKU A;  2IPO B;  5FU7 B;  5LJ3 g;  2ECZ A;  1JQQ A;  4DOV A;  3LX7 A;  2EBP A;  1K73 R;  4PJO E;  2ED1 A;  1RUW A;  1NJI U;  2E4H A;  1N9S A;  4XTZ A;  2L3Q A;  1YJW T;  1W70 A;  4N4G A;  1D1B A;  1YJW Q;  1Y57 A;  4XTU A;  5GAM d;  4R56 A;  1GL5 A;  3DLM A;  3L2V A;  1D1C A;  1U5S A;  4DBF A;  1B07 A;  3SB2 A;  1B34 A;  1Q7Y R;  3LLR A;  4B9W A;  4J5Y A;  4L59 A;  3FC3 A;  1F1B B;  2E41 A;  2HL5 C;  3CCM A;  3NHN A;  1IO6 A;  2R5A A;  1QCN A;  1OX9 A;  2LX7 A;  2X4J A;  2V1R A;  1CKA A;  4V2S A;  3HP9 A;  2BUD A;  1KC8 R;  1VQO A;  3I55 Q;  3OYB A;  4EDU A;  5GAM e;  2MWO A;  2QA4 T;  1QVP A;  2HQX A;  3OA6 A;  1H92 A;  2R5M A;  3E2U A;  1JBM A;  2XDD A;  2P0P A;  3SHW A;  5IXF A;  2MOX A;  2D6F A;  4AFS C;  1BCO A;  1AHJ B;  1MND A;  4M78 E;  3ASK A;  1AWJ A;  3A5Z B;  1SKU B;  2DD4 A;  2PNI A;  3A1P A;  4M77 E;  3V7C A;  3JB9 D;  2OX7 A;  4BUG A;  2VXF A;  3R6N A;  2CT3 A;  4A4H A;  2E5Q A;  1M2V B;  2ABL A;  3VV0 A;  1N9R A;  2A7Y A;  1VQO Q;  3CC7 T;  3RR6 A;  1QVG A;  4PFZ A;  1QP3 A;  5AYF A;  2VB6 A;  2K7A A;  2E3I A;  1YIT Q;  1GBR A;  2DIG A;  5FRN A;  2NWM A;  3MP8 A;  4N4I A;  4N4H A;  4RMO A;  1FXX A;  2DL7 A;  4CC4 B;  1C6V X;  2KXC A;  4N0A C;  4EMK B;  2FG0 A;  3VS4 A;  3OYI A;  1RAC B;  2LTO A;  5CKB A;  2R58 A;  2DEQ A;  3GPL A;  3JCM Q;  2GF7 A;  2C06 A;  1M2O A;  3KUF A;  3JCM f;  4BE0 A;  2BZX A;  1YHQ Q;  2LJ1 A;  4Y91 A;  2LDM A;  5CIU A;  5KCH A;  1VQK T;  4DOW A;  3JCM P;  1M5Q 1;  4M78 D;  2CDT A;  4J9I A;  4Y28 E;  4OB1 B;  5LJ5 h;  3M0T A;  3CPF A;  2LT1 A;  1SF9 A;  2ENM A;  4F17 A;  2EGC A;  2QDL A;  2MMP A;  3ULR B;  1B34 B;  1ZBX A;  2E3H A;  2JM9 A;  2COY A;  4EMH A;  3RKY A;  1QVG S;  1LCK A;  1OPK A;  3EFO A;  5HK3 A;  1M90 C;  1ZA1 B;  2RM4 A;  1VQ9 A;  4ME7 A;  4XU1 A;  2XDB A;  3S6W A;  1FYN A;  1Y07 A;  5I21 A;  1B3Q A;  2SRC A;  2QEX T;  3G4S A;  2PVO B;  4C8Q D;  2QA4 Q;  1JJ2 S;  3MJX A;  4QVD A;  1K4U S;  3SWN C;  4DEX A;  1UJ0 A;  1MV0 B;  1ZBJ A;  3I56 T;  3I35 A;  4QQG A;  4BY6 B;  2HL3 A;  2RQR A;  5HKC A;  3BDU A;  4M75 G;  1UHC A;  2JJ9 A;  5GMK h;  5HK0 A;  3OBW A;  1VQ6 A;  2X4W A;  1Z9Q A;  4GY5 A;  1M1F A;  2AKK A;  4MDW A;  2XG8 D;  4QVZ A;  3R6O A;  2D8H A;  3VS5 A;  4ZN3 A;  2KYB A;  2DVE A;  4DBQ A;  3PIO A;  2MCN A;  2OTJ T;  2LP5 A;  4HVU A;  1KK7 A;  4OB3 B;  1NEG A;  3X26 B;  3VUB A;  3S3N A;  5LJ5 d;  5GAN 6;  3I5S A;  5IHK A;  5I11 A;  2L89 A;  2FRW A;  4RG2 A;  2CP5 A;  2M9U A;  4D8D A;  2GFA A;  1GCP A;  1RAH B;  2HSP A;  1I1J A;  4C92 F;  1IGQ A;  4KUD K;  1X6G A;  3EGU A;  1ACM B;  3TRE A;  4C8Q E;  3L1A A;  1UDL A;  2HAX A;  5CCA A;  1VQ9 Q;  4E7L A;  1YJN A;  1KQS P;  5LL6 S;  1VQ5 A;  2JM8 A;  1N6A A;  2KY9 A;  1QWF A;  1W2B P;  2DEU A;  2X9H A;  4PJO D;  2LCL A;  3RER A;  3TSZ A;  2FL7 A;  2Z0W A;  3H8Z A;  3NMZ C;  3QJ6 A;  2COW A;  4M75 B;  4BE1 A;  2RJD A;  2K79 A;  1ZSZ A;  3TVT A;  4VUB A;  1Y0M A;  3IQL A;  2KGT A;  1VQP T;  1W2B A;  2BIV A;  2FPE A;  2DF6 A;  2KRS A;  3OW2 P;  3VS0 A;  4M78 A;  3VYG A;  3G6E Q;  2EYQ A;  1BI2 A;  2V26 A;  5GAN 2;  2D0N A;  5IAY A;  1AT1 B;  4LUD A;  3P8D A;  3SDZ A;  1OQK A;  2BKD N;  2K9G A;  1WQW A;  4JJN K;  3P8H A;  3CCS A;  5J26 A;  1VQ4 T;  1BU1 A;  3LW5 E;  3OYF A;  4GBQ A;  1Q81 C;  2E70 A;  3JSC A;  1DJ7 B;  5J3B A;  3NTI A;  2ZPH B;  2KAF A;  3G71 T;  4M75 D;  2XI9 A;  3FLG A;  4IKF A;  5GAM f;  4OML A;  4J9G A;  4IIO A;  3JCM W;  2VVK A;  1QW1 A;  2JXB A;  2EYZ A;  4J7F A;  1RAB B;  2DKG A;  1JEG A;  1EIF A;  1T0H A;  2E64 A;  3CCQ A;  2RI2 A;  3PNW C;  3QO3 A;  1SHF A;  2HQE A;  2XD0 A;  2BTT A;  3M9Q A;  1YJ9 A;  1JO8 A;  2EYW A;  1RAA B;  5GAM h;  6AT1 B;  3NGP A;  5KE2 A;  3HFO A;  2HNI A;  3G4S T;  4ANJ A;  3DB4 A;  1VIE A;  3SD4 A;  2YHT A;  4F04 B;  1AOJ A;  1TH7 A;  4BI8 B;  3EGD B;  2DJQ A;  2KI7 A;  2EQI A;  4LDV A;  2MAM A;  2JOY A;  1WHH A;  4Z88 A;  2QAZ A;  3N5B B;  2JS0 A;  2OTJ A;  2PUO B;  3UPU A;  2YDL A;  1VQM Q;  1RI0 A;  3JV3 A;  2HQH A;  1WIE A;  4LUE A;  1PSE A;  3TQ7 P;  3RKX A;  3HKS A;  1VQM T;  1X69 A;  3BY7 A;  2CT4 A;  2LCS A;  2DVJ A;  5LJ3 j;  1UGR B;  1TSF A;  4FSS A;  2RD1 A;  3EG3 A;  2IIM A;  2DAQ A;  2QTX A;  2QG9 B;  1RAE B;  3BW1 A;  1Q82 C;  3REA B;  4ZGJ B;  3H0H A;  3VU3 C;  2EJG A;  3TSW A;  2OTL A;  2NUT A;  4RUG A;  2DRK A;  1M1K C;  4RKU E;  3GP8 A;  4C8Q A;  1ARK A;  2K4Y A;  3JCM h;  2KMT A;  1GCQ A;  2NUZ A;  4MDX A;  2BZ8 A;  4E2F B;  4AFU C;  3OS0 A;  1OYX A;  3MET A;  3OYH A;  1ZHI A;  2ZPG B;  2NYS A;  3CCU Q;  2M0O A;  1ZSZ B;  5GJW B;  1QVF S;  2DL4 A;  1TTH B;  4MMK A;  3PIP A;  4F7U A;  1YP5 A;  2D9T A;  1C0M A;  4II1 A;  2MIO A;  3QWX X;  5A0L A;  4IUT A;  2ZPF B;  1MMN A;  2GQI A;  1SEM A;  4M7D C;  2OAU A;  3AHU A;  1E6G A;  2AZV A;  2LJ3 A;  4X9C A;  1I81 A;  1Q86 U;  3HRS A;  2JUF A;  2KK4 A;  1SSH A;  1VQ6 Q;  4FYY B;  1K9M R;  2DXU A;  1VQK A;  3JCM X;  4KUL A;  1M1G A;  2JMC A;  1PKT A;  2L3R A;  3PMT A;  2EQU A;  1PD1 A;  2M1H A;  2C0O A;  4RTZ A;  3QXE B;  4OMP A;  4FW2 A;  1VQ5 T;  2QA4 A;  3EFR A;  3C94 A;  3OYJ A;  2FO0 A;  1XNI A;  3MO8 A;  1YWP A;  2DD5 A;  4R0K A;  2K3B A;  4FT4 A;  1QCO A;  1YWO A;  2KT8 A;  2AIR B;  5IH2 A;  4PLL A;  4FU6 A;  1OOT A;  1K73 C;  5FRM A;  3GNF B;  3CBO A;  1G3W A;  2RQW A;  2NUT B;  2D8J A;  2QQB A;  2RB6 A;  2DTH A;  5CK9 A;  4PJO B;  1WPY A;  2FZG B;  5KYY B;  1G5V A;  2RO0 A;  2MK5 A;  2DZC A;  3OYE A;  4OMF B;  5FW9 A;  2YUQ A;  2RK2 A;  1PD0 A;  2QGF B;  2RQV A;  1H3H A;  2CUB A;  4FSX A;  1QP2 A;  4PKC C;  2CP2 A;  2E10 A;  4KBM B;  5GAO n;  1KFZ A;  1Q86 R;  4PJO G;  3EG1 A;  1K8A U;  3ZFJ A;  3L2Q A;  2FYK A;  2BE7 D;  1B7T A;  1VOM A;  3RBB B;  2GBQ A;  4J6Y A;  3M0R A;  2CSI A;  3OB9 A;  1AWO A;  1PHT A;  2KEA A;  1M1K R;  2DYI A;  2EJ9 A;  1AWX A;  3JAM E;  2J6O A;  1WNL A;  1ZSZ C;  2JZ2 A; 
#chains in the Genus database with same CATH homology
 3CCU Q;  3CC4 Q;  1Q81 R;  1Q82 R;  1VQM Q;  1KD1 R;  3CC2 Q;  1VQO Q;  3CMA Q;  1VQP Q;  3CCQ Q;  1K73 R;  3I56 Q;  1VQ9 Q;  3OW2 P;  2OTL Q;  3CCV Q;  1N8R R;  1YIT Q;  1QVG P;  1VQ4 Q;  1K8A R;  1KQS P;  1VQN Q;  3G4S Q;  2QA4 Q;  1YJN Q;  1YJ9 Q;  3G6E Q;  1VQ8 Q;  1QVF P;  3CD6 Q;  1W2B P;  2QEX Q;  3CCJ Q;  1S72 Q;  1JJ2 P;  1VQL Q;  3CXC P;  1YJW Q;  3CME Q;  1KC8 R;  1M1K R;  1VQ5 Q;  1YHQ Q;  1VQK Q;  2OTJ Q;  3CCL Q;  3CC7 Q;  3I55 Q;  3CPW P;  1VQ7 Q;  3G71 Q;  1VQ6 Q;  1YI2 Q;  1K9M R;  3CCE Q;  3CCS Q;  1M90 R;  1YIJ Q;  3CCM Q;  3CCR Q;  1Q7Y R;  1NJI R;  1Q86 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...