3CC2Q

The refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution with rrna sequence for the 23s rrna and genome-derived sequences for r-proteins
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cc2Q00
3CXCP 1KC8R 3CMEQ 3CC7Q 1VQPQ 3CCLQ 3CCVQ 3I55Q 1Q86R 3G71Q 3CCUQ 1YITQ 3CD6Q 2OTJQ 1YI2Q 3CC4Q 1VQ4Q 1K73R 1VQKQ 1VQ7Q 1Q7YR 1YIJQ 3CMAQ 1Q81R 1M1KR 1KQSP 1JJ2P 1VQ8Q 1M90R 1N8RR 3CCEQ 3CCJQ 1YHQQ 2QA4Q 1K9MR 3CC2Q 1NJIR 3G6EQ 3G4SQ 3CCRQ 3CCSQ 1KD1R 2OTLQ 1VQNQ 3CPWP 3CCMQ 1VQ9Q 1VQMQ 1S72Q 1YJNQ 1Q82R 1QVFP 1W2BP 1VQOQ 3I56Q 2QEXQ 1VQLQ 3CCQQ 1QVGP 3OW2P 1VQ5Q 1VQ6Q 1YJWQ 1YJ9Q 1K8AR
chains in the Genus database with same CATH superfamily
1O75A 1KFZA 2CH4A 2H3EB 4MZPA 1YI2T 1Q86U 1YI2Q 4M78B 2L8DA 2DJQA 3EG1A 4FYYB 1X6GA 2GF7A 1X69A 2E6ZA 3CPWA 1Q81R 2FO0A 2F5TX 3VKIA 3L1AA 1G83A 1MHNA 5AYFA 1GBRA 3JCMh 2JW4A 2X51A 4C8QF 2QEXQ 2XMFA 5LJ3g 1VQLA 4M75D 4XTYA 3EH1A 3OYGA 2L3RA 4RTWA 9ATCB 3H41A 4PKCC 4M4ZA 1M30A 2C0IA 3ZFJA 3QDFA 5CKHA 3QXEB 1JBMA 1QLYA 2OAWA 2HSPA 3IQLA 2FHDA 2OJ2A 3CPWP 5DY9A 3QJYA 2L2PA 4C8QE 3SDZA 2AIRB 1AWWA 3A8OB 2V8IA 3A1PA 3EHRA 5FWBA 3EFSA 1JXOA 3RDVA 2QQBA 3HRSA 4M7AA 1NM7A 1OPLA 3EG9B 5GMKh 1PCXA 4R0KA 1M8VA 2K4YA 2RHIA 2CS7A 1IHWA 2VC8A 1KJWA 5GAN2 1VQLT 1VQLQ 2DL5A 2YUOA 4FT2A 2WACA 4HCBA 5FROA 4M75B 4RG8A 2QK0A 5GAMf 1JO8A 2KY9A 3M54A 1OU9A 1ZSZC 1I8FA 4ELZC 3G71Q 1K73C 4DBFA 3LX7A 4C92G 3OSSC 3E1SA 4A4FA 5HK0A 3JCMX 2RNAA 2YXYA 2C0TA 5D7UA 4C5GA 5FU7B 2KXCA 2HL3A 5GMKj 1M8MA 1OV3A 1Q82U 1D3BA 2ZZDA 4AT1B 3CPWS 4OMPA 1DJ7B 2WSCE 3OSVA 4KGZB 4BB7A 4E7KA 1OZ2A 4JLIA 3J80E 4RG2A 3OY9A 2DVEA 3H0FA 3CCUA 4LD6A 4A4GA 3JCMJ 3CBMA 1VQ4A 2RHYA 4IUTA 2L0AA 1UECA 4JZ4A 4EMKC 2RMOA 2HBPA 1RAAB 4II1A 4J9CA 4BDZA 4C92F 3VU3C 2Y90A 4E7HA 2O88A 4KULA 3VV0A 2FPFA 3X28B 1I5OB 1NPPA 1BBZA 5CIUA 5IXBA 1BI3A 1U5SA 1P92A 3M59A 2FG0A 2X4YA 2VYTA 2LT4A 3NHNA 3GPLA 4MMLA 3CCJA 1QVGA 3REAB 2QQRA 4XK8E 1VA7A 2YRDA 4C92E 2VGMA 4J6WA 1GFCA 1M9SA 1WPYA 3CCUT 3CCUQ 3MJXA 2F5KA 2FB7A 3V8LA 3A8MB 1VQ4T 1VQ4Q 4QT7A 2KR3A 2M0YA 3JCMW 3S3OA 2PVGB 2NYSA 4KGVB 4DEYA 4N4HA 2J06A 3E9GA 1IGQA 1ARKA 4M7AG 4BY6C 3UA7A 2KT1A 2YLBA 3VS6A 2ZCFB 1QVGP 3M0PA 2HEQA 5FWCA 1MMDA 1UEBA 2XDBA 1B07A 1QWEA 1MGQA 4ZGEB 3CCJT 3L2UA 3CCJQ 3CMAA 3V7CA 1KQ1A 3L2WA 1K9MU 1PWTA 3AT1B 4OP0A 5GAOl 3RKWA 3ZEHA 3KXTA 2ZPFB 2E3HA 2LZ6B 3DKMA 2KAFA 1PG5B 1ZA2B 1K8AR 1KC8R 5LJ5d 1K0SA 2DERA 2W0ZA 1WJRA 3CC4A 8ATCB 1VIFA 1M1KR 1U3OA 2NWMA 1YHQA 2EYWA 1SPKA 3LWIA 3CCRA 2COWA 4PFZA 1AWXA 4HA8A 3C4SA 1MMAA 3UPUA 4M7AE 3OYKA 1HSQA 2JMAA 3CMAT 1KIKA 3CMAQ 1T3LA 1G3TA 2RJCA 4MMKA 5A2QE 2JM9A 4KGXB 1MNDA 3FRNA 4X9CA 1RABB 3L2ZA 1HK9A 1RI0A 4ELYC 2V8JA 2M1HA 4CC7A 5CKDA 2DL8A 2E1HA 2GBQA 5GMKl 2BE9B 3A8GB 4FM4B 3CC4T 2RK2A 4PL6A 1WIEA 2E65A 2EGAA 1WX6A 2E5QA 1YHQT 2E4HA 5LL6S 4OMQA 3CCRT 3CCRQ 4PJOD 3M0TA 4CC2A 2ROTA 4LDYA 1WJSA 2KK4A 3X26B 1XTDA 1X01A 1TG0A 1YJ9Q 2HDAA 1C6VX 4ZTJA 2LDMA 4O5VA 1JQQA 1AZEA 4C5EA 3QWYA 3OA6A 3QG1A 1WLPB 4QQ6A 3WVDB 4ME7A 3SFMA 4N0AA 2CP0A 2QTXA 1MNEA 2QA4A 4M7AC 2BZ8A 3EGDA 1X2KA 2DXUA 2FZCB 4A4HA 3M53A 1IO6A 2XK0A 3I55T 5IN1A 1UUEA 4CRIA 2CKKA 2XDDA 1Q7YC 1ABOA 3OMGA 5LJ5e 1KHCA 2DBKA 1FMKA 1QP2A 4PJOB 2DVJA 1NZ9A 1OZ3A 4M77G 3P8DA 2X4JA 2M0OA 2BTTA 4QKUA 4B9XA 1C1AA 3JV3A 3QYHB 2GNCA 1Z9QA 3FB9A 3JCMg 1FX7A 2EW3A 1IB8A 2JUFA 3FJ5A 3MEVA 4LD9K 4LDVA 5FU6C 2QA4T 2XU8A 2QA4Q 2XI9A 5GAN8 4F7UA 1Y57A 1KSWA 2RA2A 3EGXA 3VS5A 1WFWA 1X27A 1YN8A 6AT1B 4P5NA 3OYCA 2RQTA 3RNJA 2ZPIB 4M7DD 4E7IA 1SRLA 3FJPA 5A0LA 4M77F 2EBPA 4XAXB 1I5LA 5CKFA 1VQ8A 2X4XA 2EQMA 2EYYA 2RI3A 3HRTA 1C0MA 3BDUA 2COYA 3RR6A 1OX9A 1S1NA 1TUDA 3FEOA 1LPLA 2ZAEA 1ZQ1A 4OMNA 1R8OB 3FDRA 1RAIB 2A08A 5CAIA 4XU3A 4M77E 3G4SQ 1Q82C 2DILA 2L3SA 5FW9A 3BE3A 3GNGA 5J26A 4A4EA 4R56A 2FVUA 4C8QA 3JCMc 3DB4A 4J9IA 4HXJA 3EFRA 5HK3A 2R57A 3M56A 3VS4A 3PT9A 2HCKA 2YWWA 1T3SA 1TOVA 3M0RA 3M0SA 2K3XA 4BE2A 5CO7A 3MP8A 5EG2A 1VQ8T 5CQXA 1VQ8Q 1H8KA 2M9UA 1UHFA 2BKDN 2F1LA 2JTFA 3EHQA 1X43A 3EFOB 4O6JA 5J39A 4PNOA 2X3WD 4J7FA 4AFSC 1JB0E 4RCBA 2ENMA 3A8LB 1RADB 5FRMA 5LJ5f 2KDSA 2DX1A 2XHCA 4HKEA 4JJCA 1NLOC 2ESWA 2DAQA 4FU6A 1SHGA 4F16A 1M3BA 2CREA 3VS3A 2K3YA 1AD5A 3J7AF 5I11A 4FW2A 2P0PA 2GQIA 3LWHA 1Y0MA 2O01E 4XTWA 1H92A 2H3JA 5CCAA 3SWNB 1K73R 1YBYA 1N8RR 4XTZA 3HFNA 2E70A 4DBQA 1NJIU 2O4XA 3MP1A 1B34B 3JRZA 1YWOA 2ECZA 2EQKA 2EKHA 2DNUA 3PE0A 4HVWA 2JS2A 4M78G 2KNBB 2JVVA 2MMPA 1M4ZA 4ZN3A 4D8KA 3HL8A 4D8DA 1K9MC 3RIRA 4DBHA 1D1BA 2K7AA 2CGHA 2PVDB 5I22A 2DTOA 2E3IA 1FYNA 3P8BB 4C92A 2KYBA 2VVKA 1BIAA 1K0XA 1BI1A 1BI2A 3GOXA 1PKSA 4OB3B 2J6KA 5GANd 2JTMA 1QMCA 2RM4A 1WHKA 4FSSA 2W10A 2SEMA 4Z8AA 4IUPA 3M55A 2DL3A 1ZBXA 3QUIA 1QKWA 4ATOA 1O9SA 1TXQA 1Y96B 2LX7A 4M78F 2A37A 3CQTA 4RKUE 2QXFA 4XTXA 1JXMA 1NE8A 1LOJA 4N0AC 3MO8A 3VRZA 5KYWA 3SB2A 3CC7A 1D1CA 4MDWA 3S3MA 3CBOA 2CSQA 3QSUA 1Q7YU 4IIOA 2JJ9A 1KD1U 1AOJA 4V2SA 4X9DA 2MI6A 4JRQA 2DZ9A 4M78E 2K5FA 2LQKA 2RK1A 3EG3A 3LGLA 3PMIA 4M75G 1ZSZB 1ZHIA 2EKOA 1HXDA 1RLQC 3QZ9B 1VQPA 4D6WA 3QYGB 4KT0E 5GAMh 4KUIA 2NUZA 2PNIA 1M2VA 1LNXA 2P0QA 3GBQA 3PIOA 4Z88A 4WTOB 3NTKA 1AWJA 1SEMA 3FLGA 4ZTFA 3NFCA 4Y91A 3CC7T 3CC7Q 2V8KA 2A7YA 1UFFA 1G3YA 2P4RA 5GAN6 2DYBA 4K11A 4XTVA 4M75F 4EMKB 3MHXA 2DF6A 2XG8D 1RI9A 5GAMj 2QDLA 4F17A 1WXTA 2D0QB 2M16A 4LDUA 1GXIE 1RAEB 1K8AU 1VQPT 2CZ7B 2VKNA 3BY7A 4EMGA 1OU8A 3META 5LJ3d 3M0QA 1KQSA 2KE9A 1JU5C 1T0HA 1ZUKA 4M75E 2VGNA 4IURA 4ZN1A 5GANe 3HTRA 2GCXA 5CQYA 1BIBA 2RI2A 1ABQA 4GY5A 2ZPBB 3VUZA 4JJBA 3NTHA 2RB6A 1RAGB 4ZNXA 1UTIA 3ER0A 2DM1A 3MPUB 1FMWA 5A0GA 2A3LA 4LUDA 4C8QC 1KQSP 1UB4A 5KE3A 5GAN7 3REBB 3UA6A 1IRXA 2RJFA 1PKTA 4BY6B 2DD4A 1R0BG 2F2XA 1ZUUA 4X1VA 2JTEA 1SF9A 3ULRB 5GAN4 1D0ZA 2CP7A 1BCOA 1ZSGA 3JB9D 1YJWA 2LJ0A 3O5ZA 3LLRA 3CBPA 3SEMA 1E6HA 2DE0X 1M90R 1K76A 2LCCA 5I21A 3VYGA 3EG2A 2RJDA 1W2BA 1X75C 3P8HA 3MKDA 1M1FA 3NPFA 2LTOA 2ZPHB 4PJJA 2DRMA 3S6WA 2Y4XA 4LN2A 1SHFA 4IKFA 1V1CA 2P4TA 3OBYA 3ZL7C 2XIDA 4E7SA 4E7ZA 4OMOA 4GLKA 1Q86R 5KYYA 5GJVB 2X3XD 2EGCA 3UATA 1YWPA 1UJYA 1UGPB 1GRIA 2JNGA 2EGEA 2HSEB 4XU0A 1KQSS 1RACB 2MWOA 3F70A 2E12A 5CKBA 5LJ5g 1W2BP 2JM8A 1UJ0A 3QWXX 1X6BA 2YSQA 1YJWT 1YJWQ 1VQ5A 1WHGA 4NL3A 3JCMP 3CCVA 2AK5A 4AG2C 2K79A 3WVEB 2ZPEB 4HCZA 2EWNA 2YUNA 2D8JA 5LJ3e 1YP5A 4WCIA 1T0JA 4M7AD 3CCSA 2YUQA 1QWFA 2PUKB 3JCMQ 4JLGA 2RQRA 3PMTA 3INZA 3N5BB 1WGSA 3A5ZB 5GANf 3DLMA 8AT1B 5DLOA 4C92C 2ZPGB 3QO3A 1Q95G 1UGVA 1Y7XA 1SG5A 4M77A 4J9FA 2P84A 3VS2A 5C0MA 1K4US 1WNLA 3URGA 3OYIA 1WHHA 1OPKA 1NEBA 3AHUA 5GAN3 2RQVA 1VQ5T 1VQ5Q 3H0IA 3QPHA 1D1AA 4QQDA 4Z02A 4Y28E 1W2BS 3CCVT 1WDXA 3CCVQ 2EPDA 1QVGS 1RL2A 1UGSB 1JJ2A 2ABLA 3PVLA 2CDTA 2D0NA 3EGUA 2EYXA 1OQKA 2LNVA 2HKNA 1NJIC 2MF2A 2J7IA 2SRCA 3CCST 4F14A 3OB9A 4M7AB 2VASA 4NL2A 5KCHA 1MV3A 1Q82R 2DEQA 1KHIA 2F2VA 4UC4A 4J9HA 4OB0B 4RTUA 1TTHB 5D6YA 2HQEA 1H641 2K9GA 3GLXA 3CCLA 1FXXA 3CC4Q 3I55A 2NUPB 3RUXA 3MEAA 1JJ2P 5GAN5 1YHQQ 2HZYA 2OI3A 3V7SA 4IIMA 2QASA 3HFOA 3ME9A 5CR2A 2C06A 1N9SA 3OYEA 4KRTA 2MYSA 1CSKA 2XD0A 3I9QA 5KYXA 4HVUA 1K1ZA 1WYXA 2PU9B 1E6GA 2X35A 4BD3A 2LX9A 4NS5A 3R6OA 1D3BB 1YITA 1VUBA 2KRSA 1AZGB 5FU6B 1WQWA 2KBTA 4J9DA 1UG1A 2HQHA 2IVWA 2DO3A 1IXDA 1YJNA 3THKA 3OYMA 3ASKA 1PRLC 2KI7A 3CCLT 5D6XA 4PJOF 1VQ6A 5LJ3f 4DQ2A 3I55Q 2AZVA 4MZMA 4PJLA 3H8ZA 4J9GA 1VYUA 1M2OA 3TVTA 1KD1C 2A0FB 1JJ2S 2DEUA 2QGGA 3CCQT 1WA7A 2V1RA 1G3WA 1YITT 2K3BA 5IT9E 3OS5A 1G8XA 4BI3A 1BKBA 1HYOA 3HP9A 4BUGA 4Q5WA 3PTAA 5IAYA 1N8RU 2DRKA 4CC4B 2LCSA 3OYYA 1K9MR 2PQWA 2EJGA 1YJNT 5GAMg 2MK5A 1TWBA 5EC7A 1VQ6T 1VQ6Q 1D0XA 2LRQA 4OMMA 2KQWA 3BDLA 4OMFB 3I35A 4C0DC 2C0OA 3J81E 3S3NA 5A0DA 3QHSA 1AT1B 2EAYA 2K6DA 1ZBJA 3E9FA 3VS7A 2D9TA 2VV5A 4HT8A 3OYHA 1I81A 2RO0A 1WHJA 4E7LA 4C5IA 1K8AC 4M78A 4C0GA 5M9OA 5AT1B 2ED0A 1I07A 1BYMA 4GLMA 2GQVA 4ZGDB 3OS2A 3VUBA 5LJ5h 2EYZA 2VWFA 3JCMd 5KE2A 4M7DF 4Y92A 1YCYA 3HKSA 3TEEA 2RHZA 2P0KA 1QW1A 2QAZA 1K9AA 2VB6A 7AT1B 2XICA 4MZTA 3UF4A 3OS1A 1HD3A 3PGGA 4M7DB 1Y07A 3QIIA 5KCOA 3L2RA 2AZSA 4DBRA 1Q81U 3SHWA 3T9NA 5LJ5j 1R0CB 2CT4A 4HCKA 1M3AA 3EG9A 3H0HA 2KROA 1B7TA 3I56A 1WHLA 4DEXA 5C6SA 5KYUB 1AVZC 4EDUA 4N4GA 5L23A 1TS9A 2YT6A 4TVRA 2MIOA 1SSFA 1BI0A 2E64A 1N9RA 4M75A 1M5Q1 3DLLA 5FLXE 1WXUA 3L2QA 3CXCA 4DA4A 2EQJA 3VJPA 3FIFA 1WI7A 3WXMB 3RKYA 4M77C 4QQGA 2RH2A 1WHMA 3BW1A 2AKLA 2ZGWA 3G6EA 4L59A 2JT4A 2H8HA 2CP6A 1MMNA 3I56T 3I56Q 4KBMB 2PTKA 3CXCP 3JB9I 1TH7A 3EGDB 2KXDA 2R5AA 2LQNA 2LNHB 1JRIA 2NUTB 2F2WA 1WXBA 3OW2A 3PNWC 3JCMe 3R6NA 1VQMA 1TUCA 3UWNA 2GFAA 4OB1B 4QVDA 1W6XA 5GAOq 3JB9J 2LJ1A 2RPNA 3EAEA 4J5YA 1IHVA 3QDRB 3OBWA 3G6ET 1F1BB 2G3RA 5J3BA 2LP5A 2DXCA 2OTLA 4FYVB 4A53A 2VXEA 1VYVA 3OW2P 1GFDA 2QEXA 3RMSA 4OGEA 1G5VA 2XDPA 2PUOB 2YHTA 4F7UB 2KVQG 3RESA 4VUBA 3X25B 2DD5A 3JCMb 4MDXA 1GCPA 1G3SA 3H6ZA 4C8QD 3CXCS 1GCQA 5IHNA 2HKQB 5GMKe 3V8KA 2HQXA 2WSFE 1SKUB 1Y71A 1VQMT 1WQ7A 1VQMQ 2DBMA 3KFVA 2DA9A 3EG0A 2CZ1B 3PFSA 1UDLA 4JS4A 4J8OA 2J05A 2K2MA 5L8RE 1VQOA 1AHJB 3OYLA 4XTUA 4J9EA 4KH0B 1OI1A 2EQIA 3M5AA 2CP3A 2GGRA 4AFUC 4OMLA 1YFNA 2A36A 2JS0A 3RMQA 4QW2A 4B9WA 2OTLT 2RN8A 2OTLQ 3VS1A 2CH4W 2JN0A 2LC4A 2CP5A 2DLPA 2QEXT 5D6WA 1UE9A 4FT4A 2O9VA 2VUBA 2DETA 2KRMA 2L3QA 3FC3A 1XJWB 3OW2S 2JZ2A 2LCLA 2OAUA 3G71A 4C8QB 1KK7A 1SSHA 1D09B 3HSBA 4PLLA 2HAXA 5GAOp 1I0CA 1EZZB 1ACMB 4OGCA 2GFUA 2DL7A 1VQOT 1VQOQ 4FIBA 2RHXA 1OEBA 2I0NA 3HRUA 1VQPQ 1KC8U 1EFNA 2GTOA 2V1QA 4M78C 1CKAA 3JCMf 1PSFA 3GP8A 4A54A 4JPBW 1RAFB 1M1KU 4N4IA 1NJIR 2DL4A 4CI0C 1W1FA 1MMGA 3X24B 2KT8A 1VQNA 2DTHA 2NUPA 2RHUA 2EFIA 2J6OA 2CZ6B 2ROLA 4AFZC 5GMKi 3G71T 5I2MA 1YCSB 2AKKA 2R5MA 3CPFA 1NYGA 4QVCA 4C92D 4RTTA 1N8RC 3BFMA 1W4SA 3LGFA 1PD1A 2M51A 1XNIA 1OOTA 2CYZB 1TU0B 2O2OA 2RF0A 1N5ZA 2R58A 4JUVA 3JB9G 3JSCA 4FL6A 1KQ2A 2J6FA 1AWOA 2O4XB 3VRYA 1VIEA 4BI4A 2E41A 2YUPA 1PSEA 2IG0A 2F69A 2AHJB 2G6FX 2MPXC 2QQ9A 1J3TA 3SD4A 2BZYA 1VQNT 1VQNQ 4RUGA 3Q1JA 4RCCA 3TREA 1OYXA 4ZGJB 5IXFA 4FW1A 1PHTA 2LMJA 1NEGA 3C0CA 3L2VA 4M75C 3OYDA 1ZA1B 2CUDA 4PJOA 3CMEA 2VXFA 1ZX6A 3UDCA 4C92B 2B86A 1Q7YR 1NBEB 3OYFA 5GANh 2V26A 3JB9F 4X34A 5FU7C 1KD1R 2FPEA 2CZ0B 2RQWA 2YRCA 1WZOA 4J83A 3ZBDA 2YDLA 4J7IA 1RLPC 2D6FA 2DTIA 3E2UA 4DOVA 3NTIA 2DXBA 4QVZA 1TUGB 3HPWA 1Q81C 1JEGA 1EX4A 1X6OA 4B6MA 1W70A 4J9BA 1V76A 2DYIA 5KYWB 4BACA 2EQUA 2YLCA 3CEYA 4JRKA 1QCOA 1N6AA 1GL5A 1UGQB 1V29B 5GANj 2E10A 2E6NA 3U23A 3CMET 3CMEQ 1TSFA 3QJ6A 1GBQA 2X4WA 3UT1A 3X20B 3QKJA 2KSSA 1A0NB 5FRNA 1M2VB 4HT9A 1IZ6A 1M27C 4IUVA 5GAOr 1U06A 1NYFA 1BU1A 4JDSA 2LQ8A 2DXTA 3DB3A 1QCNA 4A4KA 4M7AF 2BE7D 3G1JA 4FYWB 3TSZA 1PNJA 1SRMA 2FEIA 4PFOA 1G2BA 3D7SB 4EPCA 1R77A 1H3ZA 5KYNA 2IPOB 2FYKA 4IUUA 1QVFA 3TU4K 3CCSQ 4KUDK 2K57A 4M7DA 3A98A 3L42A 2EVRA 1CKBA 1GCQC 2CT3A 4C0FA 2ED1A 3LH5A 1X2QA 1VOMA 4NOYA 1YJ9A 1BCMA 1OX8A 5IHKA 3NGPA 3EFOA 5LJ3h 4XU2A 4RTZA 2D1XA 5GAOm 2B8AA 4PJOG 2QQSA 3I5SA 5GJWB 5KYUA 1QVPA 1QVFP 3MEUA 1QP3A 1D0YA 1S72A 3CCQA 2QQAA 3M4GA 4ORZA 3C12A 2HMAA 1ZLMA 3JAME 4DOWA 4E7JA 1RUWA 2OTJA 4JJNK 2AT1B 4LUEA 1VQKA 1HJDA 2K5IA 4L5GA 1NLPC 3CC2A 2MWPA 5LJ3j 1U1TA 3SWNA 1YJ9T 1U8RA 4GBQA 4C0DB 2FRWA 1E7OA 3CCLQ 2RJEA 2CSIA 4ANJA 3M57A 2OX7A 3M0UA 1M90C 1NPRA 1FWZA 4Z89A 4CC3A 2KEAA 4EIKA 1B34A 2EJFA 2LQWA 5HCKA 2L5QA 1S72T 1S72Q 5GMKm 4FCYA 3CCQQ 4PJMA 2BZXA 2NUTA 1Q86C 1QVFS 3M58A 2HD0A 4PLIA 2LJ3A 2DJZA 1YITQ 4PJOE 2OTJT 4PJNA 2OTJQ 1LVKA 4OB2B 1VQKT 1VQKQ 1K73U 4OVAA 4BE0A 4OF1A 3CC2T 3CC2Q 2X9HA 1PRMC 1QQJA 5KYYB 1YJNQ 2A28A 2PZ1A 2QGFB 1NG2A 4J6XA 5GAOn 2FZKB 2L3PA 1EIFA 4M77D 1LCKA 1I1JA 4IUQA 1U1SA 1B3QA 2BUDA 2MOXA 3MCAB 3MEWA 4M7DG 2FL7A 2PVOB 1AEYA 2BIVA 1Y96A 2RQUA 3C95A 5IH2A 5IHIA 4PFPA 1M1GA 3QZ5B 3NMZC 3OYNA 3O8VA 3CCEA 3G4SA 2IIMA 3MP6A 1PC0A 2LVMA 2DIGA 2M02A 1KC8C 2K5LA 3KUFA 4C0ZA 4E47A 4RMOA 4E2FB 3LW5E 1OULA 5KH6A 3OQ5A 1M1KC 3CD6A 2NLUA 2DFUA 4LDXA 2JMCA 3PVQA 4XU1A 2I2LA 4BDYA 1MUZA 4XQ3A 1ZSZA 2QG9B 3GF5A 2K2VA 1Z9ZA 4PJOC 4JRIA 1IGUA 3CCMA 1LJOA 2HNIA 4JZ3A 3E19A 4M77B 5CK9A 3I5RA 5DLQE 5GAMd 5CKEA 1N27A 1ZUYA 2L89A 4FYXB 2CUBA 4L6V5 4LDWA 4FSXA 3VYHB 1BB9A 2DK3A 3TQ7P 3CCET 3CCEQ 3G4ST 3G7ZA 2D8HA 1WJQA 3RBBB 3QBYA 4BI8B 2FRYA 4M7DE 3M9QA 3OYAA 2DZCA 2KGTA 2FZGB 4EMKA 3OMCA 2Z0WA 4JRPA 2HL5C 4J6YA 4R55A 4BE1A 2XKOC 3CD6T 3CD6Q 2Y4YA 3KBGA 2QTVA 3LH0A 2E5KA 2YRVA 4YTLA 3TCJA 3HHTB 3V7RA 1H3HA 2KMTA 3CCMT 3CCMQ 2CP2A 1BK2A 1PD0A 3TSWA 1YNZA 3OYJA 3LYIA 2RD1A 1M3CA 1FMVA 2DKGA 3JB9H 5HY6A 2JXBA 3V8JA 4JJDA 2COZA 5KYXB 1VQ7A 1YIJA 3A8HB 2RI5A 2MCNA 2GTJA 1I4K1 5CVIA 1VQ9A 4HCCA 4EMHA 4AG1C 4LXCA 1QCFA 3JCMV 2EIFA 4F7UG 1KG1A 5GANg 2DIQA 2ATCB 4M7DC 1XQHA 3C94A 3EH2A 4JS5A 2QI2A 2MAMA 3VS0A 1MV0B 1QKXA 4ESRA 5ECAA 1UHCA 1PM3A 2EJ9A 3GNFB 3OYBA 3OS0A 2FPDA 1VYTA 5I2SA 2DPPB 2WSEE 4RTXA 4HVVA 2QDYB 2JOYA 4RTVA 4M78D 3M4YA 2O31A 5DM7R 5GAMe 1YI2A 1VQ7T 1YIJT 1VQ7Q 1YIJQ 4WF2A 4F7UF 3G6EQ 5HKCA 4KH1B 1VQ9T 1VQ9Q 3RERA 4F04B 4E6RA 3PIPA 1UGRB 2QYZA 2DMOA 1XOVA 4LE9A 4PK4A 2KYMA 3RKXA 1RAHB 2EYQA 4C8QG 3EGXB 4RTYA 4AFQC 3SWNC 2LT1A 4LNPA 1M90U 4AMCA 4F7UE 4A63B 3GIBA 2O9SA 3H9NA 1IREB 4C5HA 2HBWA 2KRNA
chains in the Genus database with same CATH topology
3CXCP 1KC8R 3CMEQ 3CC7Q 1VQPQ 3CCLQ 3CCVQ 3I55Q 1Q86R 3G71Q 3CCUQ 1YITQ 3CD6Q 2OTJQ 1YI2Q 3CC4Q 1VQ4Q 1K73R 1VQKQ 1VQ7Q 1Q7YR 1YIJQ 3CMAQ 1Q81R 1M1KR 1KQSP 1JJ2P 1VQ8Q 1M90R 1N8RR 3CCEQ 3CCJQ 1YHQQ 2QA4Q 1K9MR 3CC2Q 1NJIR 3G6EQ 3G4SQ 3CCRQ 3CCSQ 1KD1R 2OTLQ 1VQNQ 3CPWP 3CCMQ 1VQ9Q 1VQMQ 1S72Q 1YJNQ 1Q82R 1QVFP 1W2BP 1VQOQ 3I56Q 2QEXQ 1VQLQ 3CCQQ 1QVGP 3OW2P 1VQ5Q 1VQ6Q 1YJWQ 1YJ9Q 1K8AR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC P;  1KC8 R;  3CME Q;  3CC7 Q;  1VQP Q;  3CCL Q;  3CCV Q;  3I55 Q;  1Q86 R;  3G71 Q;  3CCU Q;  1YIT Q;  3CD6 Q;  2OTJ Q;  1YI2 Q;  3CC4 Q;  1VQ4 Q;  1K73 R;  1VQK Q;  1VQ7 Q;  1Q7Y R;  1YIJ Q;  3CMA Q;  1Q81 R;  1M1K R;  1KQS P;  1JJ2 P;  1VQ8 Q;  1M90 R;  1N8R R;  3CCE Q;  3CCJ Q;  1YHQ Q;  2QA4 Q;  1K9M R;  3CC2 Q;  1NJI R;  3G6E Q;  3G4S Q;  3CCR Q;  3CCS Q;  1KD1 R;  2OTL Q;  1VQN Q;  3CPW P;  3CCM Q;  1VQ9 Q;  1VQM Q;  1S72 Q;  1YJN Q;  1Q82 R;  1QVF P;  1W2B P;  1VQO Q;  3I56 Q;  2QEX Q;  1VQL Q;  3CCQ Q;  1QVG P;  3OW2 P;  1VQ5 Q;  1VQ6 Q;  1YJW Q;  1YJ9 Q;  1K8A R; 
#chains in the Genus database with same CATH topology
 1O75 A;  1KFZ A;  2CH4 A;  2H3E B;  4MZP A;  1YI2 T;  1Q86 U;  1YI2 Q;  4M78 B;  2L8D A;  2DJQ A;  3EG1 A;  4FYY B;  1X6G A;  2GF7 A;  1X69 A;  2E6Z A;  3CPW A;  1Q81 R;  2FO0 A;  2F5T X;  3VKI A;  3L1A A;  1G83 A;  1MHN A;  5AYF A;  1GBR A;  3JCM h;  2JW4 A;  2X51 A;  4C8Q F;  2QEX Q;  2XMF A;  5LJ3 g;  1VQL A;  4M75 D;  4XTY A;  3EH1 A;  3OYG A;  2L3R A;  4RTW A;  9ATC B;  3H41 A;  4PKC C;  4M4Z A;  1M30 A;  2C0I A;  3ZFJ A;  3QDF A;  5CKH A;  3QXE B;  1JBM A;  1QLY A;  2OAW A;  2HSP A;  3IQL A;  2FHD A;  2OJ2 A;  3CPW P;  5DY9 A;  3QJY A;  2L2P A;  4C8Q E;  3SDZ A;  2AIR B;  1AWW A;  3A8O B;  2V8I A;  3A1P A;  3EHR A;  5FWB A;  3EFS A;  1JXO A;  3RDV A;  2QQB A;  3HRS A;  4M7A A;  1NM7 A;  1OPL A;  3EG9 B;  5GMK h;  1PCX A;  4R0K A;  1M8V A;  2K4Y A;  2RHI A;  2CS7 A;  1IHW A;  2VC8 A;  1KJW A;  5GAN 2;  1VQL T;  1VQL Q;  2DL5 A;  2YUO A;  4FT2 A;  2WAC A;  4HCB A;  5FRO A;  4M75 B;  4RG8 A;  2QK0 A;  5GAM f;  1JO8 A;  2KY9 A;  3M54 A;  1OU9 A;  1ZSZ C;  1I8F A;  4ELZ C;  3G71 Q;  1K73 C;  4DBF A;  3LX7 A;  4C92 G;  3OSS C;  3E1S A;  4A4F A;  5HK0 A;  3JCM X;  2RNA A;  2YXY A;  2C0T A;  5D7U A;  4C5G A;  5FU7 B;  2KXC A;  2HL3 A;  5GMK j;  1M8M A;  1OV3 A;  1Q82 U;  1D3B A;  2ZZD A;  4AT1 B;  3CPW S;  4OMP A;  1DJ7 B;  2WSC E;  3OSV A;  4KGZ B;  4BB7 A;  4E7K A;  1OZ2 A;  4JLI A;  3J80 E;  4RG2 A;  3OY9 A;  2DVE A;  3H0F A;  3CCU A;  4LD6 A;  4A4G A;  3JCM J;  3CBM A;  1VQ4 A;  2RHY A;  4IUT A;  2L0A A;  1UEC A;  4JZ4 A;  4EMK C;  2RMO A;  2HBP A;  1RAA B;  4II1 A;  4J9C A;  4BDZ A;  4C92 F;  3VU3 C;  2Y90 A;  4E7H A;  2O88 A;  4KUL A;  3VV0 A;  2FPF A;  3X28 B;  1I5O B;  1NPP A;  1BBZ A;  5CIU A;  5IXB A;  1BI3 A;  1U5S A;  1P92 A;  3M59 A;  2FG0 A;  2X4Y A;  2VYT A;  2LT4 A;  3NHN A;  3GPL A;  4MML A;  3CCJ A;  1QVG A;  3REA B;  2QQR A;  4XK8 E;  1VA7 A;  2YRD A;  4C92 E;  2VGM A;  4J6W A;  1GFC A;  1M9S A;  1WPY A;  3CCU T;  3CCU Q;  3MJX A;  2F5K A;  2FB7 A;  3V8L A;  3A8M B;  1VQ4 T;  1VQ4 Q;  4QT7 A;  2KR3 A;  2M0Y A;  3JCM W;  3S3O A;  2PVG B;  2NYS A;  4KGV B;  4DEY A;  4N4H A;  2J06 A;  3E9G A;  1IGQ A;  1ARK A;  4M7A G;  4BY6 C;  3UA7 A;  2KT1 A;  2YLB A;  3VS6 A;  2ZCF B;  1QVG P;  3M0P A;  2HEQ A;  5FWC A;  1MMD A;  1UEB A;  2XDB A;  1B07 A;  1QWE A;  1MGQ A;  4ZGE B;  3CCJ T;  3L2U A;  3CCJ Q;  3CMA A;  3V7C A;  1KQ1 A;  3L2W A;  1K9M U;  1PWT A;  3AT1 B;  4OP0 A;  5GAO l;  3RKW A;  3ZEH A;  3KXT A;  2ZPF B;  2E3H A;  2LZ6 B;  3DKM A;  2KAF A;  1PG5 B;  1ZA2 B;  1K8A R;  1KC8 R;  5LJ5 d;  1K0S A;  2DER A;  2W0Z A;  1WJR A;  3CC4 A;  8ATC B;  1VIF A;  1M1K R;  1U3O A;  2NWM A;  1YHQ A;  2EYW A;  1SPK A;  3LWI A;  3CCR A;  2COW A;  4PFZ A;  1AWX A;  4HA8 A;  3C4S A;  1MMA A;  3UPU A;  4M7A E;  3OYK A;  1HSQ A;  2JMA A;  3CMA T;  1KIK A;  3CMA Q;  1T3L A;  1G3T A;  2RJC A;  4MMK A;  5A2Q E;  2JM9 A;  4KGX B;  1MND A;  3FRN A;  4X9C A;  1RAB B;  3L2Z A;  1HK9 A;  1RI0 A;  4ELY C;  2V8J A;  2M1H A;  4CC7 A;  5CKD A;  2DL8 A;  2E1H A;  2GBQ A;  5GMK l;  2BE9 B;  3A8G B;  4FM4 B;  3CC4 T;  2RK2 A;  4PL6 A;  1WIE A;  2E65 A;  2EGA A;  1WX6 A;  2E5Q A;  1YHQ T;  2E4H A;  5LL6 S;  4OMQ A;  3CCR T;  3CCR Q;  4PJO D;  3M0T A;  4CC2 A;  2ROT A;  4LDY A;  1WJS A;  2KK4 A;  3X26 B;  1XTD A;  1X01 A;  1TG0 A;  1YJ9 Q;  2HDA A;  1C6V X;  4ZTJ A;  2LDM A;  4O5V A;  1JQQ A;  1AZE A;  4C5E A;  3QWY A;  3OA6 A;  3QG1 A;  1WLP B;  4QQ6 A;  3WVD B;  4ME7 A;  3SFM A;  4N0A A;  2CP0 A;  2QTX A;  1MNE A;  2QA4 A;  4M7A C;  2BZ8 A;  3EGD A;  1X2K A;  2DXU A;  2FZC B;  4A4H A;  3M53 A;  1IO6 A;  2XK0 A;  3I55 T;  5IN1 A;  1UUE A;  4CRI A;  2CKK A;  2XDD A;  1Q7Y C;  1ABO A;  3OMG A;  5LJ5 e;  1KHC A;  2DBK A;  1FMK A;  1QP2 A;  4PJO B;  2DVJ A;  1NZ9 A;  1OZ3 A;  4M77 G;  3P8D A;  2X4J A;  2M0O A;  2BTT A;  4QKU A;  4B9X A;  1C1A A;  3JV3 A;  3QYH B;  2GNC A;  1Z9Q A;  3FB9 A;  3JCM g;  1FX7 A;  2EW3 A;  1IB8 A;  2JUF A;  3FJ5 A;  3MEV A;  4LD9 K;  4LDV A;  5FU6 C;  2QA4 T;  2XU8 A;  2QA4 Q;  2XI9 A;  5GAN 8;  4F7U A;  1Y57 A;  1KSW A;  2RA2 A;  3EGX A;  3VS5 A;  1WFW A;  1X27 A;  1YN8 A;  6AT1 B;  4P5N A;  3OYC A;  2RQT A;  3RNJ A;  2ZPI B;  4M7D D;  4E7I A;  1SRL A;  3FJP A;  5A0L A;  4M77 F;  2EBP A;  4XAX B;  1I5L A;  5CKF A;  1VQ8 A;  2X4X A;  2EQM A;  2EYY A;  2RI3 A;  3HRT A;  1C0M A;  3BDU A;  2COY A;  3RR6 A;  1OX9 A;  1S1N A;  1TUD A;  3FEO A;  1LPL A;  2ZAE A;  1ZQ1 A;  4OMN A;  1R8O B;  3FDR A;  1RAI B;  2A08 A;  5CAI A;  4XU3 A;  4M77 E;  3G4S Q;  1Q82 C;  2DIL A;  2L3S A;  5FW9 A;  3BE3 A;  3GNG A;  5J26 A;  4A4E A;  4R56 A;  2FVU A;  4C8Q A;  3JCM c;  3DB4 A;  4J9I A;  4HXJ A;  3EFR A;  5HK3 A;  2R57 A;  3M56 A;  3VS4 A;  3PT9 A;  2HCK A;  2YWW A;  1T3S A;  1TOV A;  3M0R A;  3M0S A;  2K3X A;  4BE2 A;  5CO7 A;  3MP8 A;  5EG2 A;  1VQ8 T;  5CQX A;  1VQ8 Q;  1H8K A;  2M9U A;  1UHF A;  2BKD N;  2F1L A;  2JTF A;  3EHQ A;  1X43 A;  3EFO B;  4O6J A;  5J39 A;  4PNO A;  2X3W D;  4J7F A;  4AFS C;  1JB0 E;  4RCB A;  2ENM A;  3A8L B;  1RAD B;  5FRM A;  5LJ5 f;  2KDS A;  2DX1 A;  2XHC A;  4HKE A;  4JJC A;  1NLO C;  2ESW A;  2DAQ A;  4FU6 A;  1SHG A;  4F16 A;  1M3B A;  2CRE A;  3VS3 A;  2K3Y A;  1AD5 A;  3J7A F;  5I11 A;  4FW2 A;  2P0P A;  2GQI A;  3LWH A;  1Y0M A;  2O01 E;  4XTW A;  1H92 A;  2H3J A;  5CCA A;  3SWN B;  1K73 R;  1YBY A;  1N8R R;  4XTZ A;  3HFN A;  2E70 A;  4DBQ A;  1NJI U;  2O4X A;  3MP1 A;  1B34 B;  3JRZ A;  1YWO A;  2ECZ A;  2EQK A;  2EKH A;  2DNU A;  3PE0 A;  4HVW A;  2JS2 A;  4M78 G;  2KNB B;  2JVV A;  2MMP A;  1M4Z A;  4ZN3 A;  4D8K A;  3HL8 A;  4D8D A;  1K9M C;  3RIR A;  4DBH A;  1D1B A;  2K7A A;  2CGH A;  2PVD B;  5I22 A;  2DTO A;  2E3I A;  1FYN A;  3P8B B;  4C92 A;  2KYB A;  2VVK A;  1BIA A;  1K0X A;  1BI1 A;  1BI2 A;  3GOX A;  1PKS A;  4OB3 B;  2J6K A;  5GAN d;  2JTM A;  1QMC A;  2RM4 A;  1WHK A;  4FSS A;  2W10 A;  2SEM A;  4Z8A A;  4IUP A;  3M55 A;  2DL3 A;  1ZBX A;  3QUI A;  1QKW A;  4ATO A;  1O9S A;  1TXQ A;  1Y96 B;  2LX7 A;  4M78 F;  2A37 A;  3CQT A;  4RKU E;  2QXF A;  4XTX A;  1JXM A;  1NE8 A;  1LOJ A;  4N0A C;  3MO8 A;  3VRZ A;  5KYW A;  3SB2 A;  3CC7 A;  1D1C A;  4MDW A;  3S3M A;  3CBO A;  2CSQ A;  3QSU A;  1Q7Y U;  4IIO A;  2JJ9 A;  1KD1 U;  1AOJ A;  4V2S A;  4X9D A;  2MI6 A;  4JRQ A;  2DZ9 A;  4M78 E;  2K5F A;  2LQK A;  2RK1 A;  3EG3 A;  3LGL A;  3PMI A;  4M75 G;  1ZSZ B;  1ZHI A;  2EKO A;  1HXD A;  1RLQ C;  3QZ9 B;  1VQP A;  4D6W A;  3QYG B;  4KT0 E;  5GAM h;  4KUI A;  2NUZ A;  2PNI A;  1M2V A;  1LNX A;  2P0Q A;  3GBQ A;  3PIO A;  4Z88 A;  4WTO B;  3NTK A;  1AWJ A;  1SEM A;  3FLG A;  4ZTF A;  3NFC A;  4Y91 A;  3CC7 T;  3CC7 Q;  2V8K A;  2A7Y A;  1UFF A;  1G3Y A;  2P4R A;  5GAN 6;  2DYB A;  4K11 A;  4XTV A;  4M75 F;  4EMK B;  3MHX A;  2DF6 A;  2XG8 D;  1RI9 A;  5GAM j;  2QDL A;  4F17 A;  1WXT A;  2D0Q B;  2M16 A;  4LDU A;  1GXI E;  1RAE B;  1K8A U;  1VQP T;  2CZ7 B;  2VKN A;  3BY7 A;  4EMG A;  1OU8 A;  3MET A;  5LJ3 d;  3M0Q A;  1KQS A;  2KE9 A;  1JU5 C;  1T0H A;  1ZUK A;  4M75 E;  2VGN A;  4IUR A;  4ZN1 A;  5GAN e;  3HTR A;  2GCX A;  5CQY A;  1BIB A;  2RI2 A;  1ABQ A;  4GY5 A;  2ZPB B;  3VUZ A;  4JJB A;  3NTH A;  2RB6 A;  1RAG B;  4ZNX A;  1UTI A;  3ER0 A;  2DM1 A;  3MPU B;  1FMW A;  5A0G A;  2A3L A;  4LUD A;  4C8Q C;  1KQS P;  1UB4 A;  5KE3 A;  5GAN 7;  3REB B;  3UA6 A;  1IRX A;  2RJF A;  1PKT A;  4BY6 B;  2DD4 A;  1R0B G;  2F2X A;  1ZUU A;  4X1V A;  2JTE A;  1SF9 A;  3ULR B;  5GAN 4;  1D0Z A;  2CP7 A;  1BCO A;  1ZSG A;  3JB9 D;  1YJW A;  2LJ0 A;  3O5Z A;  3LLR A;  3CBP A;  3SEM A;  1E6H A;  2DE0 X;  1M90 R;  1K76 A;  2LCC A;  5I21 A;  3VYG A;  3EG2 A;  2RJD A;  1W2B A;  1X75 C;  3P8H A;  3MKD A;  1M1F A;  3NPF A;  2LTO A;  2ZPH B;  4PJJ A;  2DRM A;  3S6W A;  2Y4X A;  4LN2 A;  1SHF A;  4IKF A;  1V1C A;  2P4T A;  3OBY A;  3ZL7 C;  2XID A;  4E7S A;  4E7Z A;  4OMO A;  4GLK A;  1Q86 R;  5KYY A;  5GJV B;  2X3X D;  2EGC A;  3UAT A;  1YWP A;  1UJY A;  1UGP B;  1GRI A;  2JNG A;  2EGE A;  2HSE B;  4XU0 A;  1KQS S;  1RAC B;  2MWO A;  3F70 A;  2E12 A;  5CKB A;  5LJ5 g;  1W2B P;  2JM8 A;  1UJ0 A;  3QWX X;  1X6B A;  2YSQ A;  1YJW T;  1YJW Q;  1VQ5 A;  1WHG A;  4NL3 A;  3JCM P;  3CCV A;  2AK5 A;  4AG2 C;  2K79 A;  3WVE B;  2ZPE B;  4HCZ A;  2EWN A;  2YUN A;  2D8J A;  5LJ3 e;  1YP5 A;  4WCI A;  1T0J A;  4M7A D;  3CCS A;  2YUQ A;  1QWF A;  2PUK B;  3JCM Q;  4JLG A;  2RQR A;  3PMT A;  3INZ A;  3N5B B;  1WGS A;  3A5Z B;  5GAN f;  3DLM A;  8AT1 B;  5DLO A;  4C92 C;  2ZPG B;  3QO3 A;  1Q95 G;  1UGV A;  1Y7X A;  1SG5 A;  4M77 A;  4J9F A;  2P84 A;  3VS2 A;  5C0M A;  1K4U S;  1WNL A;  3URG A;  3OYI A;  1WHH A;  1OPK A;  1NEB A;  3AHU A;  5GAN 3;  2RQV A;  1VQ5 T;  1VQ5 Q;  3H0I A;  3QPH A;  1D1A A;  4QQD A;  4Z02 A;  4Y28 E;  1W2B S;  3CCV T;  1WDX A;  3CCV Q;  2EPD A;  1QVG S;  1RL2 A;  1UGS B;  1JJ2 A;  2ABL A;  3PVL A;  2CDT A;  2D0N A;  3EGU A;  2EYX A;  1OQK A;  2LNV A;  2HKN A;  1NJI C;  2MF2 A;  2J7I A;  2SRC A;  3CCS T;  4F14 A;  3OB9 A;  4M7A B;  2VAS A;  4NL2 A;  5KCH A;  1MV3 A;  1Q82 R;  2DEQ A;  1KHI A;  2F2V A;  4UC4 A;  4J9H A;  4OB0 B;  4RTU A;  1TTH B;  5D6Y A;  2HQE A;  1H64 1;  2K9G A;  3GLX A;  3CCL A;  1FXX A;  3CC4 Q;  3I55 A;  2NUP B;  3RUX A;  3MEA A;  1JJ2 P;  5GAN 5;  1YHQ Q;  2HZY A;  2OI3 A;  3V7S A;  4IIM A;  2QAS A;  3HFO A;  3ME9 A;  5CR2 A;  2C06 A;  1N9S A;  3OYE A;  4KRT A;  2MYS A;  1CSK A;  2XD0 A;  3I9Q A;  5KYX A;  4HVU A;  1K1Z A;  1WYX A;  2PU9 B;  1E6G A;  2X35 A;  4BD3 A;  2LX9 A;  4NS5 A;  3R6O A;  1D3B B;  1YIT A;  1VUB A;  2KRS A;  1AZG B;  5FU6 B;  1WQW A;  2KBT A;  4J9D A;  1UG1 A;  2HQH A;  2IVW A;  2DO3 A;  1IXD A;  1YJN A;  3THK A;  3OYM A;  3ASK A;  1PRL C;  2KI7 A;  3CCL T;  5D6X A;  4PJO F;  1VQ6 A;  5LJ3 f;  4DQ2 A;  3I55 Q;  2AZV A;  4MZM A;  4PJL A;  3H8Z A;  4J9G A;  1VYU A;  1M2O A;  3TVT A;  1KD1 C;  2A0F B;  1JJ2 S;  2DEU A;  2QGG A;  3CCQ T;  1WA7 A;  2V1R A;  1G3W A;  1YIT T;  2K3B A;  5IT9 E;  3OS5 A;  1G8X A;  4BI3 A;  1BKB A;  1HYO A;  3HP9 A;  4BUG A;  4Q5W A;  3PTA A;  5IAY A;  1N8R U;  2DRK A;  4CC4 B;  2LCS A;  3OYY A;  1K9M R;  2PQW A;  2EJG A;  1YJN T;  5GAM g;  2MK5 A;  1TWB A;  5EC7 A;  1VQ6 T;  1VQ6 Q;  1D0X A;  2LRQ A;  4OMM A;  2KQW A;  3BDL A;  4OMF B;  3I35 A;  4C0D C;  2C0O A;  3J81 E;  3S3N A;  5A0D A;  3QHS A;  1AT1 B;  2EAY A;  2K6D A;  1ZBJ A;  3E9F A;  3VS7 A;  2D9T A;  2VV5 A;  4HT8 A;  3OYH A;  1I81 A;  2RO0 A;  1WHJ A;  4E7L A;  4C5I A;  1K8A C;  4M78 A;  4C0G A;  5M9O A;  5AT1 B;  2ED0 A;  1I07 A;  1BYM A;  4GLM A;  2GQV A;  4ZGD B;  3OS2 A;  3VUB A;  5LJ5 h;  2EYZ A;  2VWF A;  3JCM d;  5KE2 A;  4M7D F;  4Y92 A;  1YCY A;  3HKS A;  3TEE A;  2RHZ A;  2P0K A;  1QW1 A;  2QAZ A;  1K9A A;  2VB6 A;  7AT1 B;  2XIC A;  4MZT A;  3UF4 A;  3OS1 A;  1HD3 A;  3PGG A;  4M7D B;  1Y07 A;  3QII A;  5KCO A;  3L2R A;  2AZS A;  4DBR A;  1Q81 U;  3SHW A;  3T9N A;  5LJ5 j;  1R0C B;  2CT4 A;  4HCK A;  1M3A A;  3EG9 A;  3H0H A;  2KRO A;  1B7T A;  3I56 A;  1WHL A;  4DEX A;  5C6S A;  5KYU B;  1AVZ C;  4EDU A;  4N4G A;  5L23 A;  1TS9 A;  2YT6 A;  4TVR A;  2MIO A;  1SSF A;  1BI0 A;  2E64 A;  1N9R A;  4M75 A;  1M5Q 1;  3DLL A;  5FLX E;  1WXU A;  3L2Q A;  3CXC A;  4DA4 A;  2EQJ A;  3VJP A;  3FIF A;  1WI7 A;  3WXM B;  3RKY A;  4M77 C;  4QQG A;  2RH2 A;  1WHM A;  3BW1 A;  2AKL A;  2ZGW A;  3G6E A;  4L59 A;  2JT4 A;  2H8H A;  2CP6 A;  1MMN A;  3I56 T;  3I56 Q;  4KBM B;  2PTK A;  3CXC P;  3JB9 I;  1TH7 A;  3EGD B;  2KXD A;  2R5A A;  2LQN A;  2LNH B;  1JRI A;  2NUT B;  2F2W A;  1WXB A;  3OW2 A;  3PNW C;  3JCM e;  3R6N A;  1VQM A;  1TUC A;  3UWN A;  2GFA A;  4OB1 B;  4QVD A;  1W6X A;  5GAO q;  3JB9 J;  2LJ1 A;  2RPN A;  3EAE A;  4J5Y A;  1IHV A;  3QDR B;  3OBW A;  3G6E T;  1F1B B;  2G3R A;  5J3B A;  2LP5 A;  2DXC A;  2OTL A;  4FYV B;  4A53 A;  2VXE A;  1VYV A;  3OW2 P;  1GFD A;  2QEX A;  3RMS A;  4OGE A;  1G5V A;  2XDP A;  2PUO B;  2YHT A;  4F7U B;  2KVQ G;  3RES A;  4VUB A;  3X25 B;  2DD5 A;  3JCM b;  4MDX A;  1GCP A;  1G3S A;  3H6Z A;  4C8Q D;  3CXC S;  1GCQ A;  5IHN A;  2HKQ B;  5GMK e;  3V8K A;  2HQX A;  2WSF E;  1SKU B;  1Y71 A;  1VQM T;  1WQ7 A;  1VQM Q;  2DBM A;  3KFV A;  2DA9 A;  3EG0 A;  2CZ1 B;  3PFS A;  1UDL A;  4JS4 A;  4J8O A;  2J05 A;  2K2M A;  5L8R E;  1VQO A;  1AHJ B;  3OYL A;  4XTU A;  4J9E A;  4KH0 B;  1OI1 A;  2EQI A;  3M5A A;  2CP3 A;  2GGR A;  4AFU C;  4OML A;  1YFN A;  2A36 A;  2JS0 A;  3RMQ A;  4QW2 A;  4B9W A;  2OTL T;  2RN8 A;  2OTL Q;  3VS1 A;  2CH4 W;  2JN0 A;  2LC4 A;  2CP5 A;  2DLP A;  2QEX T;  5D6W A;  1UE9 A;  4FT4 A;  2O9V A;  2VUB A;  2DET A;  2KRM A;  2L3Q A;  3FC3 A;  1XJW B;  3OW2 S;  2JZ2 A;  2LCL A;  2OAU A;  3G71 A;  4C8Q B;  1KK7 A;  1SSH A;  1D09 B;  3HSB A;  4PLL A;  2HAX A;  5GAO p;  1I0C A;  1EZZ B;  1ACM B;  4OGC A;  2GFU A;  2DL7 A;  1VQO T;  1VQO Q;  4FIB A;  2RHX A;  1OEB A;  2I0N A;  3HRU A;  1VQP Q;  1KC8 U;  1EFN A;  2GTO A;  2V1Q A;  4M78 C;  1CKA A;  3JCM f;  1PSF A;  3GP8 A;  4A54 A;  4JPB W;  1RAF B;  1M1K U;  4N4I A;  1NJI R;  2DL4 A;  4CI0 C;  1W1F A;  1MMG A;  3X24 B;  2KT8 A;  1VQN A;  2DTH A;  2NUP A;  2RHU A;  2EFI A;  2J6O A;  2CZ6 B;  2ROL A;  4AFZ C;  5GMK i;  3G71 T;  5I2M A;  1YCS B;  2AKK A;  2R5M A;  3CPF A;  1NYG A;  4QVC A;  4C92 D;  4RTT A;  1N8R C;  3BFM A;  1W4S A;  3LGF A;  1PD1 A;  2M51 A;  1XNI A;  1OOT A;  2CYZ B;  1TU0 B;  2O2O A;  2RF0 A;  1N5Z A;  2R58 A;  4JUV A;  3JB9 G;  3JSC A;  4FL6 A;  1KQ2 A;  2J6F A;  1AWO A;  2O4X B;  3VRY A;  1VIE A;  4BI4 A;  2E41 A;  2YUP A;  1PSE A;  2IG0 A;  2F69 A;  2AHJ B;  2G6F X;  2MPX C;  2QQ9 A;  1J3T A;  3SD4 A;  2BZY A;  1VQN T;  1VQN Q;  4RUG A;  3Q1J A;  4RCC A;  3TRE A;  1OYX A;  4ZGJ B;  5IXF A;  4FW1 A;  1PHT A;  2LMJ A;  1NEG A;  3C0C A;  3L2V A;  4M75 C;  3OYD A;  1ZA1 B;  2CUD A;  4PJO A;  3CME A;  2VXF A;  1ZX6 A;  3UDC A;  4C92 B;  2B86 A;  1Q7Y R;  1NBE B;  3OYF A;  5GAN h;  2V26 A;  3JB9 F;  4X34 A;  5FU7 C;  1KD1 R;  2FPE A;  2CZ0 B;  2RQW A;  2YRC A;  1WZO A;  4J83 A;  3ZBD A;  2YDL A;  4J7I A;  1RLP C;  2D6F A;  2DTI A;  3E2U A;  4DOV A;  3NTI A;  2DXB A;  4QVZ A;  1TUG B;  3HPW A;  1Q81 C;  1JEG A;  1EX4 A;  1X6O A;  4B6M A;  1W70 A;  4J9B A;  1V76 A;  2DYI A;  5KYW B;  4BAC A;  2EQU A;  2YLC A;  3CEY A;  4JRK A;  1QCO A;  1N6A A;  1GL5 A;  1UGQ B;  1V29 B;  5GAN j;  2E10 A;  2E6N A;  3U23 A;  3CME T;  3CME Q;  1TSF A;  3QJ6 A;  1GBQ A;  2X4W A;  3UT1 A;  3X20 B;  3QKJ A;  2KSS A;  1A0N B;  5FRN A;  1M2V B;  4HT9 A;  1IZ6 A;  1M27 C;  4IUV A;  5GAO r;  1U06 A;  1NYF A;  1BU1 A;  4JDS A;  2LQ8 A;  2DXT A;  3DB3 A;  1QCN A;  4A4K A;  4M7A F;  2BE7 D;  3G1J A;  4FYW B;  3TSZ A;  1PNJ A;  1SRM A;  2FEI A;  4PFO A;  1G2B A;  3D7S B;  4EPC A;  1R77 A;  1H3Z A;  5KYN A;  2IPO B;  2FYK A;  4IUU A;  1QVF A;  3TU4 K;  3CCS Q;  4KUD K;  2K57 A;  4M7D A;  3A98 A;  3L42 A;  2EVR A;  1CKB A;  1GCQ C;  2CT3 A;  4C0F A;  2ED1 A;  3LH5 A;  1X2Q A;  1VOM A;  4NOY A;  1YJ9 A;  1BCM A;  1OX8 A;  5IHK A;  3NGP A;  3EFO A;  5LJ3 h;  4XU2 A;  4RTZ A;  2D1X A;  5GAO m;  2B8A A;  4PJO G;  2QQS A;  3I5S A;  5GJW B;  5KYU A;  1QVP A;  1QVF P;  3MEU A;  1QP3 A;  1D0Y A;  1S72 A;  3CCQ A;  2QQA A;  3M4G A;  4ORZ A;  3C12 A;  2HMA A;  1ZLM A;  3JAM E;  4DOW A;  4E7J A;  1RUW A;  2OTJ A;  4JJN K;  2AT1 B;  4LUE A;  1VQK A;  1HJD A;  2K5I A;  4L5G A;  1NLP C;  3CC2 A;  2MWP A;  5LJ3 j;  1U1T A;  3SWN A;  1YJ9 T;  1U8R A;  4GBQ A;  4C0D B;  2FRW A;  1E7O A;  3CCL Q;  2RJE A;  2CSI A;  4ANJ A;  3M57 A;  2OX7 A;  3M0U A;  1M90 C;  1NPR A;  1FWZ A;  4Z89 A;  4CC3 A;  2KEA A;  4EIK A;  1B34 A;  2EJF A;  2LQW A;  5HCK A;  2L5Q A;  1S72 T;  1S72 Q;  5GMK m;  4FCY A;  3CCQ Q;  4PJM A;  2BZX A;  2NUT A;  1Q86 C;  1QVF S;  3M58 A;  2HD0 A;  4PLI A;  2LJ3 A;  2DJZ A;  1YIT Q;  4PJO E;  2OTJ T;  4PJN A;  2OTJ Q;  1LVK A;  4OB2 B;  1VQK T;  1VQK Q;  1K73 U;  4OVA A;  4BE0 A;  4OF1 A;  3CC2 T;  3CC2 Q;  2X9H A;  1PRM C;  1QQJ A;  5KYY B;  1YJN Q;  2A28 A;  2PZ1 A;  2QGF B;  1NG2 A;  4J6X A;  5GAO n;  2FZK B;  2L3P A;  1EIF A;  4M77 D;  1LCK A;  1I1J A;  4IUQ A;  1U1S A;  1B3Q A;  2BUD A;  2MOX A;  3MCA B;  3MEW A;  4M7D G;  2FL7 A;  2PVO B;  1AEY A;  2BIV A;  1Y96 A;  2RQU A;  3C95 A;  5IH2 A;  5IHI A;  4PFP A;  1M1G A;  3QZ5 B;  3NMZ C;  3OYN A;  3O8V A;  3CCE A;  3G4S A;  2IIM A;  3MP6 A;  1PC0 A;  2LVM A;  2DIG A;  2M02 A;  1KC8 C;  2K5L A;  3KUF A;  4C0Z A;  4E47 A;  4RMO A;  4E2F B;  3LW5 E;  1OUL A;  5KH6 A;  3OQ5 A;  1M1K C;  3CD6 A;  2NLU A;  2DFU A;  4LDX A;  2JMC A;  3PVQ A;  4XU1 A;  2I2L A;  4BDY A;  1MUZ A;  4XQ3 A;  1ZSZ A;  2QG9 B;  3GF5 A;  2K2V A;  1Z9Z A;  4PJO C;  4JRI A;  1IGU A;  3CCM A;  1LJO A;  2HNI A;  4JZ3 A;  3E19 A;  4M77 B;  5CK9 A;  3I5R A;  5DLQ E;  5GAM d;  5CKE A;  1N27 A;  1ZUY A;  2L89 A;  4FYX B;  2CUB A;  4L6V 5;  4LDW A;  4FSX A;  3VYH B;  1BB9 A;  2DK3 A;  3TQ7 P;  3CCE T;  3CCE Q;  3G4S T;  3G7Z A;  2D8H A;  1WJQ A;  3RBB B;  3QBY A;  4BI8 B;  2FRY A;  4M7D E;  3M9Q A;  3OYA A;  2DZC A;  2KGT A;  2FZG B;  4EMK A;  3OMC A;  2Z0W A;  4JRP A;  2HL5 C;  4J6Y A;  4R55 A;  4BE1 A;  2XKO C;  3CD6 T;  3CD6 Q;  2Y4Y A;  3KBG A;  2QTV A;  3LH0 A;  2E5K A;  2YRV A;  4YTL A;  3TCJ A;  3HHT B;  3V7R A;  1H3H A;  2KMT A;  3CCM T;  3CCM Q;  2CP2 A;  1BK2 A;  1PD0 A;  3TSW A;  1YNZ A;  3OYJ A;  3LYI A;  2RD1 A;  1M3C A;  1FMV A;  2DKG A;  3JB9 H;  5HY6 A;  2JXB A;  3V8J A;  4JJD A;  2COZ A;  5KYX B;  1VQ7 A;  1YIJ A;  3A8H B;  2RI5 A;  2MCN A;  2GTJ A;  1I4K 1;  5CVI A;  1VQ9 A;  4HCC A;  4EMH A;  4AG1 C;  4LXC A;  1QCF A;  3JCM V;  2EIF A;  4F7U G;  1KG1 A;  5GAN g;  2DIQ A;  2ATC B;  4M7D C;  1XQH A;  3C94 A;  3EH2 A;  4JS5 A;  2QI2 A;  2MAM A;  3VS0 A;  1MV0 B;  1QKX A;  4ESR A;  5ECA A;  1UHC A;  1PM3 A;  2EJ9 A;  3GNF B;  3OYB A;  3OS0 A;  2FPD A;  1VYT A;  5I2S A;  2DPP B;  2WSE E;  4RTX A;  4HVV A;  2QDY B;  2JOY A;  4RTV A;  4M78 D;  3M4Y A;  2O31 A;  5DM7 R;  5GAM e;  1YI2 A;  1VQ7 T;  1YIJ T;  1VQ7 Q;  1YIJ Q;  4WF2 A;  4F7U F;  3G6E Q;  5HKC A;  4KH1 B;  1VQ9 T;  1VQ9 Q;  3RER A;  4F04 B;  4E6R A;  3PIP A;  1UGR B;  2QYZ A;  2DMO A;  1XOV A;  4LE9 A;  4PK4 A;  2KYM A;  3RKX A;  1RAH B;  2EYQ A;  4C8Q G;  3EGX B;  4RTY A;  4AFQ C;  3SWN C;  2LT1 A;  4LNP A;  1M90 U;  4AMC A;  4F7U E;  4A63 B;  3GIB A;  2O9S A;  3H9N A;  1IRE B;  4C5H A;  2HBW A;  2KRN A; 
#chains in the Genus database with same CATH homology
 3CXC P;  1KC8 R;  3CME Q;  3CC7 Q;  1VQP Q;  3CCL Q;  3CCV Q;  3I55 Q;  1Q86 R;  3G71 Q;  3CCU Q;  1YIT Q;  3CD6 Q;  2OTJ Q;  1YI2 Q;  3CC4 Q;  1VQ4 Q;  1K73 R;  1VQK Q;  1VQ7 Q;  1Q7Y R;  1YIJ Q;  3CMA Q;  1Q81 R;  1M1K R;  1KQS P;  1JJ2 P;  1VQ8 Q;  1M90 R;  1N8R R;  3CCE Q;  3CCJ Q;  1YHQ Q;  2QA4 Q;  1K9M R;  3CC2 Q;  1NJI R;  3G6E Q;  3G4S Q;  3CCR Q;  3CCS Q;  1KD1 R;  2OTL Q;  1VQN Q;  3CPW P;  3CCM Q;  1VQ9 Q;  1VQM Q;  1S72 Q;  1YJN Q;  1Q82 R;  1QVF P;  1W2B P;  1VQO Q;  3I56 Q;  2QEX Q;  1VQL Q;  3CCQ Q;  1QVG P;  3OW2 P;  1VQ5 Q;  1VQ6 Q;  1YJW Q;  1YJ9 Q;  1K8A R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...