3ME9A

Crystal structure of sgf29 in complex with h3k4me3 peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
174
structure length
174
Chain Sequence
GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAGA-associated factor 29 homolog
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 36
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3me9A02
3MP1A 3PNWC 3OYJA 3OYGA 2WACA 3MEVA 1WJSA 3LGLA 5KCOA 4IURA 2R58A 2EQMA 4II1A 3OYIA 4IUVA 2L89A 2YRVA 5FROA 3LLRA 3OYLA 4EDUA 4PLIA 2RJCA 3UT1A 1OI1A 2R5MA 3L2RA 1N27A 2QQSA 4FL6A 3OS1A 2RO0A 4CRIA 4C5IA 5C6SA 4BE2A 3QIIA 4FU6A 4HCZA 3S6WA 3UWNA 4A4HA 4C5EA 1WJQA 3OMCA 2RI3A 4N4HA 1SSFA 2EFIA 4Q5WA 2NLUA 5KE3A 3OYEA 4L59A 3OA6A 2PQWA 5FRNA 2LCCA 2BIVA 2XK0A 3QBYA 3OYKA 3L2UA 2X4WA 4IKFA 2DIGA 2EQUA 1XNIA 4X34A 4BE0A 4E7JA 2R5AA 3P8DA 5FRMA 3OYAA 3DB3A 3OYBA 3OYCA 1H3ZA 4E7LA 5KCHA 2EQJA 4QQDA 4QVZA 2RJFA 3NTKA 2R57A 4BE1A 2G3RA 2LDMA 3ASKA 2RJDA 3C4SA 2D9TA 2O4XB 2RI2A 2GFAA 2L3RA 1G5VA 2VYTA 2XDPA 3QKJA 3OS0A 3OQ5A 3P8HA 4A4EA 3L2QA 4BACA 4OVAA 3OYNA 3MEUA 1OYXA 3S3MA 3BDLA 4LD6A 4BD3A 5IN1A 3L2VA 3DLMA 4BDZA 2RHZA 2FHDA 2EQKA 4A4FA 4E7HA 3LH0A 2GF7A 4N4IA 3META 3S3NA 1WGSA 5C0MA 3F70A 3H8ZA 2P0KA 4IUUA 2X4XA 4ZTJA 3LYIA 1OZ3A 2IG0A 2RI5A 1WJRA 2M1HA 3GOXA 5KE2A 3FDRA 3LGFA 3PMTA 3MP6A 2BKDN 3CEYA 3H6ZA 3O8VA 4IUTA 3ME9A 2K3YA 3NTIA 3MEAA 5KH6A 4UC4A 3L42A 1OZ2A 3EAEA 4C5HA 3Q1JA 4ZTFA 2DIQA 2LRQA 2MWPA 5D6YA 3NTHA 3OB9A 2F5KA 3FEOA 4GY5A 4NS5A 2EKOA 3E9GA 5IAYA 3FC3A 2GFUA 2M0OA 1KHCA 4Z02A 2K3XA 3KUFA 2HQXA 2QQRA 3MO8A 3OS2A 3OYFA 3SD4A 2LTOA 4QQGA 4QQ6A 3L2WA 4E7IA 4BDYA 4C5GA 2JTFA 2M16A 2MWOA 4B9WA 2E5QA 3OYDA 3DB4A 3S3OA 4B9XA 4PL6A 2DAQA 2O4XA 2RHXA 1RI0A 5M9OA 3LX7A 2X4YA 3PFSA 4QW2A 2X35A 2RHUA 2CKKA 4PLLA 5D6XA 3MP8A 4N4GA 3MEWA 3OMGA 2LVMA 3FLGA 4IUPA 5J39A 3OY9A 2BUDA 2JZ2A 3PMIA 2RHYA 4IUQA 3E9FA 2RHIA 2HQEA 4RG2A 5CIUA 3QJ6A 5D6WA 2E6NA 2L8DA 3OYMA 1MHNA 2B8AA 4E7KA 3ZEHA 3OYHA 3M9QA 5J26A 4A4GA 2RJEA
chains in the Genus database with same CATH superfamily
1NE8A 1ZSGA 2LQWA 4PFOA 5FU6C 3I35A 1X6GA 3G4SQ 4PLIA 4X9DA 1YHQA 2OAWA 2O88A 2EGEA 2CUDA 1VOMA 4FU6A 5GAOr 1TWBA 2GTJA 4PJJA 2DERA 4EIKA 4JJDA 3OYEA 4XTYA 2DF6A 3VS2A 3GF5A 2XK0A 5CQYA 4IKFA 4CI0C 2EQUA 3CC2A 2YDLA 1AZGB 4BE0A 4E7JA 3DB3A 2M02A 3GIBA 3TEEA 2HDAA 2M51A 1SEMA 2HKQB 2QEXQ 2KRNA 2RI2A 2D6FA 1ZQ1A 2V26A 5GAN8 1WIEA 4Y28E 4QT7A 1K9MR 1IGUA 3CD6Q 3ZL7C 4HCBA 2RF0A 2DPPB 1TSFA 1LJOA 3HP9A 4O5VA 5A0LA 2F69A 5C0MA 2OTJQ 2PNIA 2CDTA 1W2BA 2E65A 4C8QG 1CSKA 2CGHA 5I2MA 3MP6A 1R0BG 2EKHA 3R6OA 3CEYA 2MMPA 2F2XA 1WHGA 2BZXA 3KBGA 5CR2A 3PT9A 4RUGA 1BK2A 2DYIA 4CC7A 3CC7Q 3HHTB 3E9GA 1UJ0A 4M7DF 3L2WA 4GLKA 3CMEQ 1VQMT 2YRDA 4HA8A 4PJNA 1J3TA 2LCLA 3MKDA 2AT1B 5CK9A 3N5BB 1RI0A 5M9OA 3PFSA 3MEWA 1YJNA 2NUTA 2BUDA 4WTOB 4J83A 3VJPA 2C0IA 3QZ9B 2JNGA 3CCRA 1JXOA 2O2OA 1YHQQ 1FMWA 3EFOB 4D8KA 1G2BA 1WJSA 2L5QA 3G6EA 1KQ2A 1OX8A 1QVGS 2YRVA 3HFNA 1O75A 2RNAA 3M0PA 3CC2Q 1X6BA 2A28A 2RO0A 3JB9G 3QIIA 2DL8A 4M78C 5FWBA 3QZ5B 1GCQA 3JCMP 3JV3A 4AFQC 4BI3A 2HSPA 2L3SA 1H3ZA 5GMKj 3A8MB 2DXCA 2D8JA 5GAOq 1ZSZC 1YITT 2CP2A 4MZTA 3CCLA 3GBQA 4KGZB 1VQ9T 2K5FA 3EG9A 1QVFA 2XDPA 3QKJA 2LQ8A 4M77G 2FVUA 5IN1A 3J81E 1Y57A 4A4FA 3G1JA 2EGCA 1KQ1A 4J9HA 1KD1C 2KI7A 4LNPA 2RMOA 3X24B 5IHIA 3VS1A 5GAMh 1KC8R 1BI0A 4JLIA 4C8QA 3LGFA 3RDVA 3UF4A 2PUKB 3NTIA 5KH6A 2DX1A 1M1KU 1XQHA 1M90U 2DTIA 4P5NA 4E2FB 3WVDB 2L3QA 1WI7A 2M0OA 2PVGB 3V7RA 1YJNQ 2ZPGB 1Q81U 2HL3A 3SDZA 1UGPB 2MWOA 1N9SA 3TVTA 3CCRQ 5I21A 1PD1A 2KGTA 4VUBA 4F17A 3G6EQ 2LVMA 2GQIA 3FLGA 3ER0A 3MJXA 4WCIA 1ZHIA 1BI1A 3QJYA 3H41A 4BB7A 3VKIA 2G6FX 1YJWT 4AMCA 1ABQA 1I4K1 1UUEA 1GFCA 2ESWA 4DBFA 1VQLT 3JB9J 1PG5B 3CPWP 4HT8A 2R5MA 1ZUUA 5HK3A 1GBRA 2DA9A 1WA7A 4XTWA 3I56T 1RAHB 5CCAA 3OMCA 9ATCB 1BCMA 2A37A 2EFIA 3CBPA 3D7SB 1VQ6T 3CCLQ 2YHTA 4BI4A 1DJ7B 3WXMB 4J9FA 3G7ZA 2K4YA 5FRMA 4E47A 1RAEB 4ZN3A 2BTTA 1TUCA 3OYCA 4J8OA 3EH2A 5L23A 3T9NA 2R57A 4E7ZA 2MAMA 2J6FA 3BY7A 2VB6A 3OS0A 2ZPEB 4DEYA 4M77A 1VQOA 3MEUA 1YJ9A 4X1VA 4RTWA 1NLPC 2K2MA 1VUBA 5LJ3f 4J6XA 1VIFA 2PZ1A 4RCBA 3PE0A 3PGGA 1WJRA 1F1BB 2B86A 3QDRB 3X28B 2I0NA 3O8VA 4IUTA 1PWTA 1VQKT 2FG0A 4JPBW 2YUPA 1D0YA 2RH2A 2MOXA 5IHKA 2ATCB 5LJ3j 2ED0A 2MWPA 1KQSS 2JW4A 2KAFA 1KG1A 3CBMA 4B9WA 2K9GA 4B9XA 3QSUA 1G3WA 1ZBXA 1AZEA 5A2QE 2CSQA 5EC7A 1R0CB 3HL8A 4E6RA 4HCCA 5D6WA 4AG1C 2L8DA 1JJ2S 5GMKl 3ZFJA 1TTHB 2RJEA 1D0ZA 1YIJA 3MP1A 2DILA 1NBEB 1LNXA 5LJ5g 1PM3A 1ZSZB 3G71T 2EYXA 1N8RR 3BW1A 1QWFA 2C0OA 3L2RA 1N27A 2HAXA 2RQWA 1IXDA 4FL6A 1HSQA 2X9HA 2FPFA 4HVWA 2AHJB 2LJ3A 3S6WA 1FYNA 1PNJA 4OB1B 3QWXX 2D8HA 2CSIA 2KRSA 1OU9A 2C06A 5CKEA 3CXCA 1XNIA 4J7FA 4X34A 1WQWA 4AFUC 1VQOQ 3SWNA 3JCMg 1YJ9Q 3P8BB 1UG1A 3AT1B 2PU9B 3I55A 2RN8A 2YRCA 1VQNA 1VIEA 3BDLA 4LD6A 2DXTA 2DL5A 1SF9A 2QQAA 3A8GB 1HK9A 2IPOB 2LNHB 2FB7A 3HKSA 4MMLA 1SHFA 2VKNA 1PHTA 2JTEA 4IUUA 2OJ2A 1JQQA 2M1HA 3FIFA 1AHJB 2ZZDA 2P4RA 2KK4A 1Q86U 4Y92A 5I22A 3CMAA 1OZ2A 1QMCA 2LNVA 4JUVA 1T0JA 4GY5A 2COYA 1OQKA 2QGFB 3MO8A 1MMAA 2HMAA 3CQTA 1K8AR 1UE9A 2EJ9A 2COWA 2DAQA 3R6NA 5GMKh 4M75E 1YIJQ 2X35A 2RHUA 2CZ1B 5D6XA 4R56A 1OU8A 4F7UG 4IUQA 1Q82R 2KVQG 1HYOA 2B8AA 3SFMA 3MEVA 4M7AC 4AFZC 1G8XA 2SEMA 1E7OA 1AWOA 2DRMA 5FLXE 4FYVB 4FYXB 2ENMA 1M8VA 1PSEA 5IH2A 1WJQA 1IGQA 2NUTB 1BYMA 2CH4A 2KQWA 4M77F 1BIBA 4FT2A 1IZ6A 1VQPT 1NJIU 5AYFA 3I55Q 4JZ4A 1U5SA 2JUFA 1VQNQ 4OGCA 1EX4A 5I11A 1B34B 2EIFA 2EPDA 5L8RE 3INZA 3A8LB 5A0DA 4PK4A 3THKA 3C4SA 1K73U 2GFAA 4PJOC 4FSXA 1NG2A 4OMNA 2RK1A 5CKDA 1GRIA 4QVDA 1D3BB 2YLBA 1UTIA 1VQMA 2DVEA 3TSWA 1VQ5T 1X2QA 4C92G 2MK5A 3CMAQ 1GL5A 1QKWA 1JBMA 4CC2A 4ZTJA 1M3CA 3HRSA 1ZUYA 4C8QD 1D1BA 4RTVA 1K9MC 3M4GA 3FDRA 4DBQA 1YNZA 5GANf 2EVRA 3CCET 3TQ7P 4XU2A 3JCMX 3JB9H 3NTHA 5KYUA 2F5KA 2NUZA 2GFUA 1UHCA 2P0QA 4MDWA 2M16A 2LMJA 2HBWA 4M75F 2VV5A 1MV3A 2RB6A 4PL6A 2AKKA 2O4XA 2KR3A 4DQ2A 3JAME 1Y96B 4OB3B 1UEBA 4C8QB 1QVGP 3OY9A 4F7UA 1I81A 2BZ8A 5GAN6 5CIUA 3J7AF 1NPPA 2H8HA 2H3EB 2RQUA 5KCOA 1YITA 2FZGB 4II1A 2FPEA 2LT4A 5CKFA 1VQ9A 2P0PA 2D1XA 2RJCA 2PVDB 3JB9D 2DBMA 1WZOA 3OSSC 2RI3A 1SSFA 3CCVT 1NEBA 2OX7A 2ZGWA 1PCXA 1M8MA 3QBYA 5LJ3h 2XICA 1UGVA 3H0HA 2DJZA 3HTRA 3V8JA 2ZPFB 3A8HB 5GMKm 1NZ9A 2YSQA 4OGEA 2AZVA 1G3YA 2FZCB 4J7IA 4J9CA 5D7UA 1IB8A 1QWEA 1VQMQ 1WLPB 4J9GA 4LXCA 1MNEA 3M4YA 8ATCB 4M7AD 2QQ9A 5LJ5e 1U3OA 2IIMA 4M4ZA 3RNJA 1W4SA 4BDZA 4ME7A 1RLPC 1RL2A 2HQHA 1NYGA 4C92A 3H8ZA 3BE3A 2AK5A 3LYIA 2DETA 2DBKA 2K3BA 2JM9A 4OMQA 3SB2A 2HKNA 1LPLA 4LDYA 3L42A 1LCKA 3GP8A 4KGXB 1YJWA 3PIOA 3JCMe 4M7AB 4F7UE 4M77B 3FC3A 1KHIA 1KC8C 1VQLA 1YCYA 2FL7A 4PJOD 3EHRA 2X51A 1U8RA 2CH4W 3NMZC 2A08A 3V7CA 3J80E 1WX6A 1W6XA 4M78E 4KUDK 3I56A 4F16A 4M7DC 2W10A 3OMGA 2LX7A 1Y7XA 1YITQ 1VQ6A 2DYBA 1QP3A 5GAMg 4XU3A 1VQ9Q 1MHNA 1IREB 4ZGEB 2E70A 3M58A 4HT9A 3M0RA 1NPRA 4QVCA 3E2UA 2I2LA 5KYWB 1MNDA 1WDXA 1SRLA 4PJOB 2EWNA 1A0NB 5CAIA 1AEYA 2HD0A 3JCMJ 3H9NA 3VYHB 1TG0A 3VUBA 2FYKA 1CKAA 2PQWA 3EFSA 4KT0E 1ZA1B 2W0ZA 3V8KA 2QTXA 4NL3A 2VGMA 4IIMA 3QWYA 2XI9A 3GNFB 4EMKA 3QO3A 4DBRA 4C92E 1VQKA 3OW2S 1M1GA 2V8KA 4V2SA 1QCNA 1BU1A 2RA2A 5CO7A 3MHXA 2A36A 1N9RA 2EQKA 1S72T 2DJQA 3QDFA 2QEXT 1KQSP 4LD9K 1PD0A 1YJWQ 2P0KA 1M4ZA 1G3SA 2X4XA 2RI5A 3E19A 3GOXA 2YUQA 1Y0MA 1VQLQ 2K57A 2P4TA 1VQ4T 4F7UF 2K3YA 1MV0B 3EAEA 2YUNA 3CCJA 1WXUA 3I56Q 1OPKA 1IRXA 1KHCA 2E1HA 4QQ6A 1VQ6Q 3QXEB 1RAFB 1X43A 4M78F 4Z88A 3VYGA 1JJ2P 3EG2A 2D0QB 3QYGB 1C1AA 2FRWA 1X69A 1ACMB 2MIOA 1LVKA 2QGGA 5LJ5j 3I5SA 1M1KR 2GTOA 1M90R 2RHIA 1B7TA 3EHQA 1OEBA 2V1QA 1VYTA 1Q81R 2CZ6B 2QQBA 2XDDA 3JCMf 2OTLT 3OYGA 2DL3A 2QYZA 3M55A 1RACB 3LGLA 1SRMA 1V29B 2VXFA 1B07A 5LJ5d 3CPWA 3HRTA 3JCMQ 1OOTA 3FB9A 1KC8U 5C6SA 4N4HA 2GNCA 1N8RC 1VQKQ 1JXMA 4OF1A 2SRCA 4M7DD 1FXXA 4C92F 2EBPA 4DEXA 4C0DB 3EGDB 4M75G 2J06A 1BI3A 2K5LA 4QVZA 3REBB 3JCMd 1SG5A 5GANh 1I07A 2RJDA 2EQIA 3CCMT 3JSCA 2VYTA 4FYYB 1U06A 4E7SA 2EYQA 3QG1A 3OSVA 3RKWA 2YT6A 1OYXA 3S3MA 3RERA 4E7HA 4RTUA 4RTTA 4M7DB 3CCJQ 1BIAA 1X75C 8AT1B 4RCCA 2RQTA 5CKHA 4LDVA 2LRQA 4PFPA 2AIRB 1G3TA 1XJWB 5IAYA 5AT1B 2LC4A 1TU0B 4TVRA 1U1SA 5HKCA 3OS2A 2QQRA 5KYYA 3OYFA 2WSFE 2HEQA 1TS9A 4C5GA 2BE7D 1W2BS 1SPKA 2KDSA 3S3OA 3JCMW 2E3IA 4FCYA 4N4GA 2QG9B 4IUPA 3VUZA 5IXFA 1AOJA 1JO8A 1K8AC 1RABB 1KJWA 1K4US 2VASA 3LWIA 5J26A 3X20B 3NGPA 6AT1B 4F14A 5KYUB 1IHVA 1FX7A 1PKSA 2EQMA 3MPUB 2ED1A 2KEAA 1Q82C 3VS7A 1GCQC 3I5RA 2CP7A 3X26B 4HCZA 3JCMV 2E12A 4A53A 1KD1U 3BFMA 5IXBA 1VQ5A 1OX9A 2KXDA 2X4WA 3UPUA 5GAMe 1QLYA 3RR6A 4M75A 1UB4A 4E7LA 5KCHA 3EGXB 4PKCC 3ASKA 3CCEA 1MGQA 1X27A 3V7SA 4AFSC 2QTVA 3SHWA 3IQLA 2XMFA 2Y4YA 2MCNA 1NM7A 4J9IA 3TSZA 4JJNK 2QA4T 4C8QC 2J05A 2X4JA 4N4IA 2GF7A 2E10A 1WGSA 1T3SA 2ZPBB 1ZA2B 4KH1B 4N0AA 1YI2T 3PMTA 2RQRA 1QVFS 3UA7A 2F2VA 1SKUB 1Q95G 4DBHA 2MYSA 4A63B 2AKLA 2KYMA 3PVLA 3FEOA 1H92A 3V8LA 2K3XA 1XOVA 1XTDA 2HQXA 3KUFA 2KE9A 2ZAEA 3BDUA 1Q7YC 3VS5A 2JJ9A 3UA6A 2CT4A 1M3AA 2RHXA 2FRYA 1Q86R 2X4YA 2ROTA 4OMMA 3CCVA 2VVKA 5J39A 3CC4T 2DVJA 3M9QA 3OA6A 4JS4A 5GAOn 4RKUE 4BUGA 1VQ7T 3RMQA 1AWJA 2LQKA 4IURA 2FPDA 5DM7R 4JDSA 1LOJA 1VQ5Q 1YCSB 3UT1A 1X2KA 5GJVB 1YBYA 5CQXA 1IO6A 1Y71A 2D0NA 2OAUA 4BE2A 4C5EA 4YTLA 3UWNA 1NEGA 1GCPA 5CKBA 1JB0E 2JMCA 3CCEQ 1K9AA 1JRIA 2DL4A 2HSEB 4M78G 4M77C 3C0CA 1E6GA 5FU7C 2CZ7B 4Y91A 3OYBA 3EGUA 1K0SA 2LDMA 1PSFA 2EYWA 1I0CA 4JLGA 2ZPIB 4A4EA 2VUBA 3AHUA 5KYXA 1VQOT 4CC3A 4LE9A 3HRUA 1AWXA 2F2WA 1YWPA 2MF2A 4NL2A 1AWWA 1K73R 5GAMf 1AVZC 1M30A 4ZN1A 3ME9A 2WSCE 2E3HA 3Q1JA 2DIQA 2QXFA 4ZGJB 4X9CA 1BCOA 4F04B 4J6WA 3CCVQ 4PJMA 2JMAA 5I2SA 3CCUT 5GAMj 1QP2A 1WXBA 4FM4B 3U23A 1TUDA 1QVGA 4QW2A 2CKKA 4JJCA 3VV0A 3A5ZB 1G83A 1D09B 1Q7YR 4OMPA 2LJ0A 3E9FA 2DTOA 2HQEA 3EG9B 5GAMd 3HSBA 3ZEHA 4XQ3A 2EGAA 5HK0A 1B3QA 3A1PA 4C0FA 5ECAA 3OYLA 3LLRA 4QKUA 1KK7A 2DK3A 2QQSA 3OS1A 2DZ9A 5HY6A 3CCST 3SWNC 1BBZA 2DNUA 4Q5WA 1I8FA 4L59A 2QAZA 5FRNA 4HVUA 3OW2P 1S72A 3QPHA 5GAN2 3L2UA 1V76A 3HPWA 3JRZA 3NPFA 1R8OB 4M78A 1VQ8T 4HXJA 4CC4B 3TREA 1VQ4A 2EQJA 4JJBA 3NTKA 2JN0A 3PVQA 4MZMA 1TUGB 1Y07A 3P8HA 2HCKA 3CXCS 1R77A 3M54A 1AD5A 3L2VA 2E64A 4FT4A 1ZSZA 5GMKi 4KRTA 1GFDA 4EPCA 1AT1B 2JS2A 2GBQA 3VS4A 2JVVA 3F70A 2DO3A 2CUBA 2KNBB 4LDWA 2ZPHB 1Z9QA 5GMKe 2DRKA 1JEGA 3UDCA 1WFWA 4JZ3A 4J9BA 1WQ7A 5A0GA 2E6ZA 2E5KA 4M77D 3MCAB 5GAN4 4BY6C 1VA7A 2OTLA 2O9VA 4KBMB 1ZUKA 2L2PA 4Z02A 3ULRB 1NYFA 1C6VX 1YN8A 4C0DC 3QHSA 2PVOB 2J6OA 1K1ZA 5DLOA 1TH7A 3OYYA 1H8KA 1MMGA 2LQNA 3OYMA 1WHLA 3LWHA 2XHCA 3CBOA 1UGQB 2VXEA 5FU7B 1QQJA 4AT1B 5KYYB 2R58A 1M1KC 4HKEA 1M90C 1M2VA 2A7YA 3VU3C 4DOVA 1S72Q 3CCMA 3CCQT 2DZCA 2Y4XA 2JS0A 1Q81C 2Y90A 2DL7A 4A4HA 1FMKA 2K5IA 4K11A 1UJYA 1VQ4Q 3FJPA 1H3HA 2BIVA 1K9MU 1W1FA 2CP6A 3O5ZA 3VS0A 2CYZB 3OYAA 4M75D 5FWCA 4ELZC 3UATA 3L2ZA 1M5Q1 2VC8A 2VGNA 4MZPA 3GPLA 4C0ZA 1KSWA 4L6V5 1O9SA 2JOYA 4OVAA 3VS6A 4FSSA 4D6WA 3C94A 3DLMA 1KQSA 3META 1M3BA 2PTKA 3G4ST 4ANJA 2X3WD 1W70A 1C0MA 1UFFA 2OTLQ 2WSEE 1N5ZA 4FW2A 3FRNA 3M57A 2EYZA 4M75B 4MDXA 1W2BP 4OB0B 2COZA 1ZBJA 4NOYA 4UC4A 1NLOC 5D6YA 3PIPA 2H3JA 5GANg 1MUZA 3OB9A 2BE9B 1BI2A 2E4HA 2PUOB 1JJ2A 1B34A 4A4KA 2GCXA 3EG3A 2KBTA 3M0UA 3SWNB 2EYYA 2KROA 2C0TA 2KMTA 3MP8A 3CD6T 1D3BA 3JCMc 3VS3A 3X25B 3SEMA 3QJ6A 1WYXA 3CCMQ 5LJ3e 3QYHB 5LJ5f 2QDLA 2XIDA 1H641 2OTJT 2KT8A 4Z89A 4RMOA 3G71A 3PNWC 1RUWA 3M53A 3OYIA 4IUVA 2QASA 5FROA 4XAXB 5J3BA 1OI1A 1JU5C 3TCJA 4B6MA 3JB9I 1SSHA 3CC7T 4M7AG 2NUPA 2QA4A 3CMET 1QKXA 2K2VA 2DIGA 4L5GA 3ZBDA 2R5AA 1UDLA 2DEQA 1Y96A 2J6KA 1YI2A 4QQDA 2RJFA 2G3RA 4BY6B 4ZGDB 4C92C 1YHQT 2KSSA 1G5VA 4JS5A 1SHGA 1P92A 3OYNA 4LUDA 1QVFP 5GAN3 1EIFA 5FU6B 1MMDA 3GLXA 4PJOG 1PKTA 3URGA 3CC2T 3RESA 1RAGB 1OZ3A 4HCKA 1U1TA 2LCSA 3TU4K 3H0FA 1ARKA 2BKDN 3CC4A 1UGRB 2V8JA 1OV3A 5GAN5 4RTYA 4C5HA 1I1JA 1VQ7A 2EAYA 2EKOA 5KYXB 1BKBA 4KH0B 4XTUA 3SD4A 2DEUA 1QCFA 1T3LA 2Z0WA 5KYNA 3OS5A 2E5QA 4J9DA 3G71Q 2DM1A 2J7IA 4WF2A 1T0HA 2CP0A 2ABLA 4PNOA 4KUIA 2RHYA 1GXIE 2E6NA 1N6AA 4JRPA 4A4GA 1RAIB 3OYJA 1Q86C 2MI6A 5FW9A 2QA4Q 1EZZB 1V1CA 5GJWB 1D1CA 4EDUA 1E6HA 4ESRA 1HD3A 4CRIA 1UGSB 4HVVA 4C8QE 4DA4A 2CP5A 4EMKC 4M7AA 3RKXA 5KE3A 1YI2Q 1YJNT 2K6DA 4MMKA 2V1RA 1D0XA 2HNIA 1VQPA 4LDXA 4BI8B 3CCRT 1FWZA 1WPYA 3RIRA 4M78D 4EMHA 2ECZA 4D8DA 1PRMC 3G6ET 2CREA 4JRQA 4R55A 2KYBA 2O4XB 1KD1R 4OMFB 3RBBB 5GAOl 4FYWB 4EMGA 3OQ5A 2EJFA 4F7UB 1OULA 4J5YA 3CCUA 3CC4Q 3LH0A 5KYWA 1QVPA 1K76A 4PJOA 3E1SA 1WHHA 1TXQA 1VQ7Q 2XDBA 2JXBA 3C12A 4M78B 2AZSA 5IHNA 5LJ3d 3REAB 1NJIC 2LX9A 2ROLA 3CCLT 3MEAA 1RI9A 3EFOA 3GNGA 5EG2A 3CCJT 1QCOA 1K73C 2M9UA 4E7IA 5HCKA 2FO0A 2LTOA 4C92D 4BDYA 2JTFA 3L1AA 1KIKA 5GAOp 4XTZA 4FIBA 4OMOA 1N8RU 3CCSA 3LX7A 1FMVA 2HL5C 4PLLA 3RMSA 3EH1A 5CVIA 2F1LA 3EFRA 4IIOA 3HFOA 1M27C 2HBPA 2QI2A 4M7AE 1I5OB 3H0IA 1PRLC 4M77E 4M7DG 4XU0A 4RG8A 4PJLA 1VQ8A 1VYUA 2FZKB 2LJ1A 2XKOC 2M0YA 2IVWA 2RK2A 1GBQA 4GLMA 4C92B 2DTHA 2RD1A 4C8QF 3LH5A 3M56A 5GANe 1VQPQ 2ZCFB 2KRMA 2CT3A 4JRKA 4OB2B 1M9SA 3WVEB 3PTAA 3DKMA 2KXCA 2NWMA 5LL6S 3EG0A 2CZ0B 3OBYA 4A54A 3CPWS 3JCMb 3CXCP 2EJGA 1QW1A 4PJOE 3CCUQ 1M2VB 2RQVA 1X01A 3A98A 1YP5A 2DFUA 2DE0X 4KULA 4J9EA 4BACA 3EG1A 3C95A 2VWFA 3VRYA 1RADB 2RHZA 2FHDA 1EFNA 3S3NA 3I9QA 3RKYA 1K8AU 3M0TA 5KE2A 4RTZA 3H6ZA 3JB9F 2P84A 3DLLA 4ORZA 2DXBA 2CP3A 2XU8A 3M5AA 5LJ5h 2DD4A 1S1NA 2LZ6B 3CCSQ 1NJIR 4NS5A 2E41A 1Q82U 3EGDA 2DLPA 1YJ9T 1D1AA 2DKGA 2F5TX 3M59A 3CCQA 5LJ3g 4C0GA 4EMKB 1RAAB 2NYSA 1VQ8Q 1RLQC 4M7AF 2JZ2A 3PMIA 4RG2A 2K7AA 1ABOA 4ELYC 4O6JA 4XTVA 1Z9ZA 3JCMh 3OYHA 1M2OA 2WACA 2L0AA 4M7DA 1I5LA 2HZYA 2A3LA 1X6OA 2LT1A 3KFVA 2GGRA 2L89A 1ZX6A 2RM4A 4FW1A 4C5IA 4Z8AA 2V8IA 2CS7A 3OW2A 2JTMA 2GQVA 2XG8D 2NLUA 3LW5E 4M75C 4DOWA 1YFNA 2K79A 2LCCA 1OPLA 3OYKA 3G4SA 1YWOA 4ATOA 4PJOF 3P8DA 2QDYB 5GAN7 1YIJT 1HXDA 2LP5A 1TOVA 3NHNA 4BE1A 1WHKA 2A0FB 2BZYA 2D9TA 4AG2C 3KXTA 1UHFA 3M0QA 2L3RA 2X3XD 4XK8E 2MPXC 2NUPB 3A8OB 3L2QA 1Q7YU 4N0AC 2YWWA 4BD3A 2QEXA 1VYVA 2KY9A 3CPFA 4GBQA 4LUEA 5GANj 4JRIA 4ZNXA 2IG0A 3CD6A 2DMOA 2JT4A 4XTXA 3FJ5A 1CKBA 2OI3A 2XD0A 2JM8A 2YXYA 4LN2A 1WXTA 4XU1A 1HJDA 3RUXA 2QK0A 3QUIA 2RPNA 2YUOA 3CCQQ 7AT1B 2OTJA 1M1FA 1PC0A 1ZLMA 5DY9A 3M0SA 3VRZA 4ZTFA 4RTXA 2O01E 5GAOm 3I55T 2FEIA 1WNLA 1VQNT 2YLCA 5GANd 4OMLA 4PFZA 5IT9E 4QQGA 4KGVB 1BB9A 2KT1A 2DXUA 2EW3A 3OYDA 3EGXA 3DB4A 4LDUA 4M7DE 2DD5A 2O9SA 1MMNA 1WHJA 1KFZA 3CC7A 1UECA 1K0XA 5DLQE 3OBWA 2L3PA 3NFCA 3CMEA 4R0KA 1IHWA 1WHMA 4E7KA 3CMAT 2O31A 4J6YA 4OP0A
chains in the Genus database with same CATH topology
1NE8A 4RMOA 3G71A 3PNWC 3MEVA 4M7AC 1FX7A 2EQMA 3M53A 3OYIA 4IUVA 5FLXE 5FROA 4XAXB 5FU6C 5J3BA 1M8VA 4PLIA 4X9DA 1Q82C 1PSEA 1OI1A 1YHQA 3TCJA 3X26B 3JB9I 3CC7T 4M7AG 4FU6A 5GAOr 4HCZA 1WJQA 3JCMV 2E12A 4A53A 3OYEA 2QA4A 2KQWA 4M77F 4XTYA 1KD1U 1BYMA 3CMET 3BFMA 3GF5A 1VQ5A 2XK0A 1BIBA 2X4WA 5CQYA 2K2VA 4IKFA 4CI0C 2DIGA 1IZ6A 2EQUA 4FT2A 4L5GA 3ZBDA 1VQPT 1NJIU 3CC2A 5AYFA 4BE0A 3UPUA 4E7JA 2R5AA 2JUFA 2DEQA 5GAMe 4OGCA 1B34B 2EIFA 1Y96A 3DB3A 1YI2A 3GIBA 4M75A 1UB4A 5L8RE 3TEEA 4E7LA 5KCHA 4QQDA 3INZA 3A8LB 5A0DA 2RJFA 4PKCC 2G3RA 3ASKA 4BY6B 3CCEA 3C4SA 1K73U 4ZGDB 1MGQA 2RI2A 2GFAA 3V7SA 1ZQ1A 4C92C 5GAN8 2D6FA 1YHQT 4PJOC 2KSSA 1G5VA 4JS5A 4Y28E 4FSXA 2Y4YA 5CKDA 1P92A 2RK1A 3OYNA 4QVDA 1D3BB 2YLBA 5GAN3 4JJNK 2QA4T 4HCBA 4C8QC 2DPPB 1EIFA 5FU6B 1VQMA 2DVEA 1LJOA 2X4JA 3HP9A 4N4IA 2GF7A 1VQ5T 2E10A 4O5VA 3GLXA 4C92G 4PJOG 1WGSA 5A0LA 3URGA 2F69A 5C0MA 1JBMA 3CC2T 3RESA 2ZPBB 4ZTJA 3HRSA 1OZ3A 4C8QD 1K9MC 1W2BA 2E65A 4C8QG 1U1TA 4N0AA 2CGHA 5I2MA 3TU4K 3M4GA 1YI2T 3FDRA 3PMTA 3MP6A 1QVFS 3R6OA 2BKDN 3CEYA 3CC4A 2MMPA 1UGRB 5GANf 2V8JA 5GAN5 3CCET 3KBGA 4C5HA 5CR2A 4XU2A 3PT9A 3JCMX 1VQ7A 3JB9H 3NTHA 2EAYA 2F5KA 3FEOA 3HHTB 2EKOA 3E9GA 2GFUA 1BKBA 3V8LA 2K3XA 1XOVA 1XTDA 2HQXA 3KUFA 4XTUA 3L2WA 3SD4A 4M7DF 2P0QA 4GLKA 4MDWA 1VQMT 2M16A 3BDUA 3OS5A 4HA8A 1Q7YC 2E5QA 4M75F 2LCLA 2VV5A 5CK9A 2RB6A 4PL6A 3N5BB 2O4XA 2RHXA 4DQ2A 1RI0A 5M9OA 3JAME 2X4YA 1Y96B 3PFSA 4OB3B 1UEBA 4WF2A 3MEWA 1YJNA 3CCVA 4C8QB 5J39A 3OY9A 2BUDA 4PNOA 1I81A 2RHYA 4KUIA 4F7UA 5GAN6 3CC4T 4J83A 3VJPA 5CIUA 3J7AF 1NPPA 2E6NA 3QZ9B 2JNGA 3CCRA 1N6AA 3M9QA 3OA6A 4JRPA 4A4GA 4JS4A 5GAOn 4RKUE 4BUGA 3OYJA 1VQ7T 1Q86C 1WJSA 2L5QA 2MI6A 2LQKA 3RMQA 4IURA 5KCOA 3G6EA 1KQ2A 1YITA 5DM7R 4II1A 2LT4A 4JDSA 1LOJA 1QVGS 2YRVA 3HFNA 5CKFA 1O75A 1VQ9A 4EDUA 2P0PA 2RJCA 3UT1A 1YBYA 5CQXA 1Y71A 2PVDB 2RO0A 1UGSB 4CRIA 2OAUA 3JB9D 4BE2A 4C8QE 4DA4A 3JB9G 3QIIA 3OSSC 4YTLA 3UWNA 4C5EA 4EMKC 4M7AA 4M78C 2RI3A 3RKXA 1SSFA 5KE3A 1YJNT 3CCVT 5CKBA 1JB0E 2ZGWA 4MMKA 3QBYA 5LJ3h 2HNIA 1VQPA 2XICA 3QZ5B 4LDXA 4BI8B 3CCRT 1FWZA 1WPYA 3RIRA 2DJZA 3JCMP 3V8JA 1JRIA 2ZPFB 3A8HB 4M78D 1NZ9A 4BI3A 4EMHA 5GMKm 4M78G 4M77C 4OGEA 4Y91A 5FU7C 2CZ7B 1G3YA 4J7IA 3OYBA 5GMKj 3G6ET 1H3ZA 3A8MB 2DXCA 5GAOq 1YITT 4MZTA 3CCLA 4JRQA 2LDMA 4R55A 1VQ9T 1PSFA 3M4YA 2K5FA 2O4XB 4OMFB 4M7AD 2QQ9A 5LJ5e 5GAOl 4JLGA 2ZPIB 4EMGA 2XDPA 3QKJA 1QVFA 2LQ8A 3OQ5A 4M77G 4A4EA 2EJFA 2VUBA 3AHUA 4F7UB 1W4SA 4J5YA 2FVUA 5IN1A 3J81E 3CCUA 1VQOT 4BDZA 4ME7A 4A4FA 3LH0A 1RL2A 1QVPA 1GXIE 1KQ1A 4C92A 3HRUA 1KD1C 4PJOA 3X24B 2MF2A 3H8ZA 4NL2A 3E1SA 5GAMh 3LYIA 2XDBA 3C12A 1BI0A 4M78B 5GAMf 3SB2A 5LJ3d 4JLIA 4C8QA 3LGFA 1NJIC 2LX9A 4ZN1A 3CCLT 3ME9A 4LDYA 2WSCE 2PUKB 3NTIA 3MEAA 5KH6A 3L42A 3GP8A 1YJWA 3Q1JA 1XQHA 3PIOA 2DIQA 1M90U 3JCMe 1M1KU 4M7AB 2QXFA 2DTIA 3GNGA 4P5NA 4F7UE 5EG2A 4M77B 4ZGJB 3FC3A 3CCJT 4X9CA 3WVDB 2M0OA 1K73C 1KHIA 2PVGB 2M9UA 4J6WA 1YCYA 2FL7A 3V7RA 2ZPGB 4E7IA 4C92D 2LTOA 1VQLA 4PJOD 5I2SA 3SDZA 3CCUT 4BDYA 5GAMj 1QP2A 1Q81U 2JTFA 1UGPB 2MWOA 1U8RA 4FM4B 1N9SA 3V7CA 3L1AA 3J80E 5GAOp 4XTZA 5I21A 4FIBA 4VUBA 4M78E 4KUDK 1N8RU 3CCSA 3LX7A 3I56A 1QVGA 4QW2A 4PLLA 2CKKA 4M7DC 3RMSA 3VV0A 3A5ZB 5CVIA 3OMGA 3EFRA 2LVMA 3HFOA 1Y7XA 3FLGA 1VQ6A 3ER0A 1QP3A 5GAMg 3E9FA 2DTOA 2HBPA 1ZHIA 2HQEA 1BI1A 3QJYA 2QI2A 4XU3A 4BB7A 1MHNA 1IREB 5GAMd 3ZEHA 3HSBA 3VKIA 4M7AE 4XQ3A 4ZGEB 4M77E 2E70A 3M58A 1YJWT 4QVCA 1NPRA 4HT9A 4M7DG 4XU0A 1I4K1 4RG8A 1VQ8A 5HK0A 2I2LA 1VQLT 2XKOC 4C0FA 3JB9J 2IVWA 3LLRA 2RK2A 4C92B 3OYLA 4PJOB 2DTHA 2EWNA 2RD1A 4C8QF 3M56A 5GANe 4HT8A 2R5MA 5CAIA 2HD0A 2ZCFB 3JCMJ 2DK3A 2QQSA 3OS1A 2DZ9A 5HK3A 4JRKA 5HY6A 3CCST 3VYHB 4XTWA 3I56T 4OB2B 5CCAA 1M9SA 3OMCA 3WVEB 3SWNC 2EFIA 3CBPA 3DKMA 4Q5WA 1I8FA 3VUBA 4L59A 3PTAA 2FYKA 2PQWA 4KT0E 3EFSA 5FRNA 1VQ6T 1S72A 2YHTA 3QPHA 5GAN2 4BI4A 1DJ7B 3V8KA 3WXMB 3L2UA 5LL6S 2QTXA 4NL3A 2VGMA 3G7ZA 2CZ0B 2K4YA 3OBYA 2XI9A 3GNFB 4A54A 3HPWA 3JCMb 4E47A 3CPWS 5FRMA 4ZN3A 3JRZA 1R8OB 4EMKA 4M78A 1VQ8T 3QO3A 3OYCA 4J8OA 3TREA 4C92E 2EJGA 1QW1A 1VQ4A 2EQJA 4PJOE 1VQKA 3T9NA 3NTKA 2R57A 2MAMA 1X01A 2JN0A 3BY7A 3OW2S 1M1GA 4MZMA 2V8KA 3OS0A 4KULA 2ZPEB 1Y07A 3P8HA 4BACA 4V2SA 3C95A 4M77A 1VQOA 3MEUA 2RA2A 5CO7A 3CXCS 1YJ9A 3M54A 3MHXA 2E64A 4FT4A 1N9RA 3L2VA 5GMKi 2RHZA 2FHDA 2EQKA 4EPCA 3S3NA 1VUBA 1S72T 5LJ3f 4J6XA 2QEXT 1VIFA 2JVVA 4LD9K 3F70A 2P0KA 4RCBA 1M4ZA 2DO3A 3RKYA 1G3SA 2X4XA 2ZPHB 3PGGA 4LDWA 1K8AU 2RI5A 5GMKe 1WJRA 3E19A 5KE2A 3GOXA 3UDCA 3QDRB 2K57A 2P4TA 3X28B 1VQ4T 3H6ZA 3O8VA 1WQ7A 4IUTA 5A0GA 3DLLA 4F7UF 1VQKT 2DXBA 2K3YA 3JB9F 2E6ZA 2XU8A 3M5AA 5LJ5h 3MCAB 4M77D 2DD4A 2RH2A 3EAEA 5GAN4 4BY6C 5LJ3j 3CCJA 2MWPA 1KQSS 2OTLA 4KBMB 4NS5A 2E41A 1Q82U 1KHCA 4Z02A 1YJ9T 2E1HA 2DKGA 2F5TX 4QQ6A 2KAFA 3QXEB 4M78F 1KG1A 3VYGA 3CBMA 4B9WA 3M59A 3CCQA 4B9XA 2D0QB 3QSUA 3QYGB 4C0GA 5LJ3g 1G3WA 4EMKB 4C0DC 1ZBXA 3QHSA 5LJ5j 5A2QE 2PVOB 3HL8A 4M7AF 2JZ2A 3PMIA 5DLOA 1TH7A 3OYYA 2RHIA 4RG2A 4HCCA 5D6WA 2L8DA 3OYMA 4ELYC 1JJ2S 5GMKl 4O6JA 4XTVA 3JCMh 2CZ6B 3ZFJA 2QQBA 2XHCA 2XDDA 3OYHA 3LWHA 2RJEA 3CBOA 3JCMf 1UGQB 2VXEA 3MP1A 5FU7B 1YIJA 3OYGA 2WACA 2OTLT 4M7DA 1I5LA 1LNXA 3M55A 5LJ5g 2A3LA 3LGLA 3G71T 1V29B 2VXFA 1X6OA 2R58A 2LT1A 1M1KC 3BW1A 4HKEA 5LJ5d 3CPWA 1M90C 2L89A 3VU3C 2A7YA 4DOVA 3HRTA 3JCMQ 2RM4A 3CCMA 3CCQT 2DZCA 2Y4XA 3FB9A 3L2RA 1N27A 2HAXA 1KC8U 4FL6A 1Q81C 2Y90A 4C5IA 5C6SA 2AHJB 2V8IA 3S6WA 4A4HA 2K5IA 4N4HA 2CS7A 3OW2A 2JTMA 2GQVA 2XG8D 2NLUA 3LW5E 4M75C 4OB1B 4DOWA 3FJPA 1N8RC 2LCCA 4OF1A 2BIVA 3OYKA 3G4SA 1K9MU 2C06A 4M7DD 5CKEA 3CXCA 1XNIA 1FXXA 4J7FA 4ATOA 4C92F 4X34A 4PJOF 2CYZB 3P8DA 4C0DB 1WQWA 3OYAA 2QDYB 4M75D 5GAN7 1YIJT 1HXDA 4M75G 3SWNA 3JCMg 4ELZC 3P8BB 1BI3A 2K5LA 4QVZA 3L2ZA 1M5Q1 3JCMd 4BE1A 2VC8A 5GANh 2VGNA 2RJDA 4MZPA 3GPLA 3KXTA 2D9TA 3CCMT 4C0ZA 3JSCA 2L3RA 4XK8E 2PU9B 2VYTA 4L6V5 3I55A 1O9SA 2EYQA 2JOYA 3A8OB 1VIEA 4OVAA 3L2QA 3QG1A 1Q7YU 3OSVA 3RKWA 1VQNA 1OYXA 4N0AC 3BDLA 4LD6A 3S3MA 3RERA 4BD3A 2DXTA 4D6WA 3C94A 3DLMA 4E7HA 1KQSA 2QQAA 3A8GB 2QEXA 3META 1HK9A 3G4ST 2FB7A 3HKSA 4MMLA 2KY9A 3CPFA 4M7DB 1BIAA 1X75C 4IUUA 2WSEE 5GANj 4JRIA 2IG0A 3CD6A 2M1HA 3FIFA 3FRNA 3M57A 4XTXA 1AHJB 4M75B 4RCCA 2XD0A 4MDXA 2ZZDA 2KK4A 4XU1A 5CKHA 3RUXA 1Q86U 4OB0B 3QUIA 3CMAA 4NOYA 4LDVA 4UC4A 1OZ2A 2OTJA 1M1FA 2LNVA 4JUVA 5DY9A 5D6YA 2LRQA 4ZTFA 3PIPA 2H3JA 2O01E 5GANg 5GAOm 3I55T 1WNLA 3OB9A 1G3TA 1BI2A 4GY5A 5IAYA 2LC4A 1VQNT 4TVRA 1U1SA 2YLCA 5HKCA 2QQRA 2PUOB 3MO8A 2WSFE 5GANd 3OS2A 4QQGA 1B34A 3OYFA 5IT9E 1JJ2A 4C5GA 4A4KA 2DXUA 2GCXA 1W2BS 2EJ9A 3OYDA 3DB4A 4LDUA 4M7DE 2KDSA 2OTJT 3S3OA 2DD5A 2DAQA 3JCMW 3CC7A 5GMKh 4M75E 3SWNB 2X35A 2RHUA 2CZ1B 3OBWA 5DLQE 5D6XA 2KMTA 3MP8A 3NFCA 4N4GA 4R56A 3CD6T 4F7UG 4IUPA 3VUZA 1D3BA 3JCMc 3CMEA 3X25B 4IUQA 3QJ6A 1K8AC 2KVQG 1KC8C 4E7KA 2B8AA 5LJ3e 3QYHB 5LJ5f 4J6YA 3CMAT 2XIDA 1H641 3LWIA 5J26A 3X20B 4OP0A 3SFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP1 A;  3PNW C;  3OYJ A;  3OYG A;  2WAC A;  3MEV A;  1WJS A;  3LGL A;  5KCO A;  4IUR A;  2R58 A;  2EQM A;  4II1 A;  3OYI A;  4IUV A;  2L89 A;  2YRV A;  5FRO A;  3LLR A;  3OYL A;  4EDU A;  4PLI A;  2RJC A;  3UT1 A;  1OI1 A;  2R5M A;  3L2R A;  1N27 A;  2QQS A;  4FL6 A;  3OS1 A;  2RO0 A;  4CRI A;  4C5I A;  5C6S A;  4BE2 A;  3QII A;  4FU6 A;  4HCZ A;  3S6W A;  3UWN A;  4A4H A;  4C5E A;  1WJQ A;  3OMC A;  2RI3 A;  4N4H A;  1SSF A;  2EFI A;  4Q5W A;  2NLU A;  5KE3 A;  3OYE A;  4L59 A;  3OA6 A;  2PQW A;  5FRN A;  2LCC A;  2BIV A;  2XK0 A;  3QBY A;  3OYK A;  3L2U A;  2X4W A;  4IKF A;  2DIG A;  2EQU A;  1XNI A;  4X34 A;  4BE0 A;  4E7J A;  2R5A A;  3P8D A;  5FRM A;  3OYA A;  3DB3 A;  3OYB A;  3OYC A;  1H3Z A;  4E7L A;  5KCH A;  2EQJ A;  4QQD A;  4QVZ A;  2RJF A;  3NTK A;  2R57 A;  4BE1 A;  2G3R A;  2LDM A;  3ASK A;  2RJD A;  3C4S A;  2D9T A;  2O4X B;  2RI2 A;  2GFA A;  2L3R A;  1G5V A;  2VYT A;  2XDP A;  3QKJ A;  3OS0 A;  3OQ5 A;  3P8H A;  4A4E A;  3L2Q A;  4BAC A;  4OVA A;  3OYN A;  3MEU A;  1OYX A;  3S3M A;  3BDL A;  4LD6 A;  4BD3 A;  5IN1 A;  3L2V A;  3DLM A;  4BDZ A;  2RHZ A;  2FHD A;  2EQK A;  4A4F A;  4E7H A;  3LH0 A;  2GF7 A;  4N4I A;  3MET A;  3S3N A;  1WGS A;  5C0M A;  3F70 A;  3H8Z A;  2P0K A;  4IUU A;  2X4X A;  4ZTJ A;  3LYI A;  1OZ3 A;  2IG0 A;  2RI5 A;  1WJR A;  2M1H A;  3GOX A;  5KE2 A;  3FDR A;  3LGF A;  3PMT A;  3MP6 A;  2BKD N;  3CEY A;  3H6Z A;  3O8V A;  4IUT A;  3ME9 A;  2K3Y A;  3NTI A;  3MEA A;  5KH6 A;  4UC4 A;  3L42 A;  1OZ2 A;  3EAE A;  4C5H A;  3Q1J A;  4ZTF A;  2DIQ A;  2LRQ A;  2MWP A;  5D6Y A;  3NTH A;  3OB9 A;  2F5K A;  3FEO A;  4GY5 A;  4NS5 A;  2EKO A;  3E9G A;  5IAY A;  3FC3 A;  2GFU A;  2M0O A;  1KHC A;  4Z02 A;  2K3X A;  3KUF A;  2HQX A;  2QQR A;  3MO8 A;  3OS2 A;  3OYF A;  3SD4 A;  2LTO A;  4QQG A;  4QQ6 A;  3L2W A;  4E7I A;  4BDY A;  4C5G A;  2JTF A;  2M16 A;  2MWO A;  4B9W A;  2E5Q A;  3OYD A;  3DB4 A;  3S3O A;  4B9X A;  4PL6 A;  2DAQ A;  2O4X A;  2RHX A;  1RI0 A;  5M9O A;  3LX7 A;  2X4Y A;  3PFS A;  4QW2 A;  2X35 A;  2RHU A;  2CKK A;  4PLL A;  5D6X A;  3MP8 A;  4N4G A;  3MEW A;  3OMG A;  2LVM A;  3FLG A;  4IUP A;  5J39 A;  3OY9 A;  2BUD A;  2JZ2 A;  3PMI A;  2RHY A;  4IUQ A;  3E9F A;  2RHI A;  2HQE A;  4RG2 A;  5CIU A;  3QJ6 A;  5D6W A;  2E6N A;  2L8D A;  3OYM A;  1MHN A;  2B8A A;  4E7K A;  3ZEH A;  3OYH A;  3M9Q A;  5J26 A;  4A4G A;  2RJE A; 
#chains in the Genus database with same CATH topology
 1NE8 A;  1ZSG A;  2LQW A;  4PFO A;  5FU6 C;  3I35 A;  1X6G A;  3G4S Q;  4PLI A;  4X9D A;  1YHQ A;  2OAW A;  2O88 A;  2EGE A;  2CUD A;  1VOM A;  4FU6 A;  5GAO r;  1TWB A;  2GTJ A;  4PJJ A;  2DER A;  4EIK A;  4JJD A;  3OYE A;  4XTY A;  2DF6 A;  3VS2 A;  3GF5 A;  2XK0 A;  5CQY A;  4IKF A;  4CI0 C;  2EQU A;  3CC2 A;  2YDL A;  1AZG B;  4BE0 A;  4E7J A;  3DB3 A;  2M02 A;  3GIB A;  3TEE A;  2HDA A;  2M51 A;  1SEM A;  2HKQ B;  2QEX Q;  2KRN A;  2RI2 A;  2D6F A;  1ZQ1 A;  2V26 A;  5GAN 8;  1WIE A;  4Y28 E;  4QT7 A;  1K9M R;  1IGU A;  3CD6 Q;  3ZL7 C;  4HCB A;  2RF0 A;  2DPP B;  1TSF A;  1LJO A;  3HP9 A;  4O5V A;  5A0L A;  2F69 A;  5C0M A;  2OTJ Q;  2PNI A;  2CDT A;  1W2B A;  2E65 A;  4C8Q G;  1CSK A;  2CGH A;  5I2M A;  3MP6 A;  1R0B G;  2EKH A;  3R6O A;  3CEY A;  2MMP A;  2F2X A;  1WHG A;  2BZX A;  3KBG A;  5CR2 A;  3PT9 A;  4RUG A;  1BK2 A;  2DYI A;  4CC7 A;  3CC7 Q;  3HHT B;  3E9G A;  1UJ0 A;  4M7D F;  3L2W A;  4GLK A;  3CME Q;  1VQM T;  2YRD A;  4HA8 A;  4PJN A;  1J3T A;  2LCL A;  3MKD A;  2AT1 B;  5CK9 A;  3N5B B;  1RI0 A;  5M9O A;  3PFS A;  3MEW A;  1YJN A;  2NUT A;  2BUD A;  4WTO B;  4J83 A;  3VJP A;  2C0I A;  3QZ9 B;  2JNG A;  3CCR A;  1JXO A;  2O2O A;  1YHQ Q;  1FMW A;  3EFO B;  4D8K A;  1G2B A;  1WJS A;  2L5Q A;  3G6E A;  1KQ2 A;  1OX8 A;  1QVG S;  2YRV A;  3HFN A;  1O75 A;  2RNA A;  3M0P A;  3CC2 Q;  1X6B A;  2A28 A;  2RO0 A;  3JB9 G;  3QII A;  2DL8 A;  4M78 C;  5FWB A;  3QZ5 B;  1GCQ A;  3JCM P;  3JV3 A;  4AFQ C;  4BI3 A;  2HSP A;  2L3S A;  1H3Z A;  5GMK j;  3A8M B;  2DXC A;  2D8J A;  5GAO q;  1ZSZ C;  1YIT T;  2CP2 A;  4MZT A;  3CCL A;  3GBQ A;  4KGZ B;  1VQ9 T;  2K5F A;  3EG9 A;  1QVF A;  2XDP A;  3QKJ A;  2LQ8 A;  4M77 G;  2FVU A;  5IN1 A;  3J81 E;  1Y57 A;  4A4F A;  3G1J A;  2EGC A;  1KQ1 A;  4J9H A;  1KD1 C;  2KI7 A;  4LNP A;  2RMO A;  3X24 B;  5IHI A;  3VS1 A;  5GAM h;  1KC8 R;  1BI0 A;  4JLI A;  4C8Q A;  3LGF A;  3RDV A;  3UF4 A;  2PUK B;  3NTI A;  5KH6 A;  2DX1 A;  1M1K U;  1XQH A;  1M90 U;  2DTI A;  4P5N A;  4E2F B;  3WVD B;  2L3Q A;  1WI7 A;  2M0O A;  2PVG B;  3V7R A;  1YJN Q;  2ZPG B;  1Q81 U;  2HL3 A;  3SDZ A;  1UGP B;  2MWO A;  1N9S A;  3TVT A;  3CCR Q;  5I21 A;  1PD1 A;  2KGT A;  4VUB A;  4F17 A;  3G6E Q;  2LVM A;  2GQI A;  3FLG A;  3ER0 A;  3MJX A;  4WCI A;  1ZHI A;  1BI1 A;  3QJY A;  3H41 A;  4BB7 A;  3VKI A;  2G6F X;  1YJW T;  4AMC A;  1ABQ A;  1I4K 1;  1UUE A;  1GFC A;  2ESW A;  4DBF A;  1VQL T;  3JB9 J;  1PG5 B;  3CPW P;  4HT8 A;  2R5M A;  1ZUU A;  5HK3 A;  1GBR A;  2DA9 A;  1WA7 A;  4XTW A;  3I56 T;  1RAH B;  5CCA A;  3OMC A;  9ATC B;  1BCM A;  2A37 A;  2EFI A;  3CBP A;  3D7S B;  1VQ6 T;  3CCL Q;  2YHT A;  4BI4 A;  1DJ7 B;  3WXM B;  4J9F A;  3G7Z A;  2K4Y A;  5FRM A;  4E47 A;  1RAE B;  4ZN3 A;  2BTT A;  1TUC A;  3OYC A;  4J8O A;  3EH2 A;  5L23 A;  3T9N A;  2R57 A;  4E7Z A;  2MAM A;  2J6F A;  3BY7 A;  2VB6 A;  3OS0 A;  2ZPE B;  4DEY A;  4M77 A;  1VQO A;  3MEU A;  1YJ9 A;  4X1V A;  4RTW A;  1NLP C;  2K2M A;  1VUB A;  5LJ3 f;  4J6X A;  1VIF A;  2PZ1 A;  4RCB A;  3PE0 A;  3PGG A;  1WJR A;  1F1B B;  2B86 A;  3QDR B;  3X28 B;  2I0N A;  3O8V A;  4IUT A;  1PWT A;  1VQK T;  2FG0 A;  4JPB W;  2YUP A;  1D0Y A;  2RH2 A;  2MOX A;  5IHK A;  2ATC B;  5LJ3 j;  2ED0 A;  2MWP A;  1KQS S;  2JW4 A;  2KAF A;  1KG1 A;  3CBM A;  4B9W A;  2K9G A;  4B9X A;  3QSU A;  1G3W A;  1ZBX A;  1AZE A;  5A2Q E;  2CSQ A;  5EC7 A;  1R0C B;  3HL8 A;  4E6R A;  4HCC A;  5D6W A;  4AG1 C;  2L8D A;  1JJ2 S;  5GMK l;  3ZFJ A;  1TTH B;  2RJE A;  1D0Z A;  1YIJ A;  3MP1 A;  2DIL A;  1NBE B;  1LNX A;  5LJ5 g;  1PM3 A;  1ZSZ B;  3G71 T;  2EYX A;  1N8R R;  3BW1 A;  1QWF A;  2C0O A;  3L2R A;  1N27 A;  2HAX A;  2RQW A;  1IXD A;  4FL6 A;  1HSQ A;  2X9H A;  2FPF A;  4HVW A;  2AHJ B;  2LJ3 A;  3S6W A;  1FYN A;  1PNJ A;  4OB1 B;  3QWX X;  2D8H A;  2CSI A;  2KRS A;  1OU9 A;  2C06 A;  5CKE A;  3CXC A;  1XNI A;  4J7F A;  4X34 A;  1WQW A;  4AFU C;  1VQO Q;  3SWN A;  3JCM g;  1YJ9 Q;  3P8B B;  1UG1 A;  3AT1 B;  2PU9 B;  3I55 A;  2RN8 A;  2YRC A;  1VQN A;  1VIE A;  3BDL A;  4LD6 A;  2DXT A;  2DL5 A;  1SF9 A;  2QQA A;  3A8G B;  1HK9 A;  2IPO B;  2LNH B;  2FB7 A;  3HKS A;  4MML A;  1SHF A;  2VKN A;  1PHT A;  2JTE A;  4IUU A;  2OJ2 A;  1JQQ A;  2M1H A;  3FIF A;  1AHJ B;  2ZZD A;  2P4R A;  2KK4 A;  1Q86 U;  4Y92 A;  5I22 A;  3CMA A;  1OZ2 A;  1QMC A;  2LNV A;  4JUV A;  1T0J A;  4GY5 A;  2COY A;  1OQK A;  2QGF B;  3MO8 A;  1MMA A;  2HMA A;  3CQT A;  1K8A R;  1UE9 A;  2EJ9 A;  2COW A;  2DAQ A;  3R6N A;  5GMK h;  4M75 E;  1YIJ Q;  2X35 A;  2RHU A;  2CZ1 B;  5D6X A;  4R56 A;  1OU8 A;  4F7U G;  4IUQ A;  1Q82 R;  2KVQ G;  1HYO A;  2B8A A;  3SFM A;  3MEV A;  4M7A C;  4AFZ C;  1G8X A;  2SEM A;  1E7O A;  1AWO A;  2DRM A;  5FLX E;  4FYV B;  4FYX B;  2ENM A;  1M8V A;  1PSE A;  5IH2 A;  1WJQ A;  1IGQ A;  2NUT B;  1BYM A;  2CH4 A;  2KQW A;  4M77 F;  1BIB A;  4FT2 A;  1IZ6 A;  1VQP T;  1NJI U;  5AYF A;  3I55 Q;  4JZ4 A;  1U5S A;  2JUF A;  1VQN Q;  4OGC A;  1EX4 A;  5I11 A;  1B34 B;  2EIF A;  2EPD A;  5L8R E;  3INZ A;  3A8L B;  5A0D A;  4PK4 A;  3THK A;  3C4S A;  1K73 U;  2GFA A;  4PJO C;  4FSX A;  1NG2 A;  4OMN A;  2RK1 A;  5CKD A;  1GRI A;  4QVD A;  1D3B B;  2YLB A;  1UTI A;  1VQM A;  2DVE A;  3TSW A;  1VQ5 T;  1X2Q A;  4C92 G;  2MK5 A;  3CMA Q;  1GL5 A;  1QKW A;  1JBM A;  4CC2 A;  4ZTJ A;  1M3C A;  3HRS A;  1ZUY A;  4C8Q D;  1D1B A;  4RTV A;  1K9M C;  3M4G A;  3FDR A;  4DBQ A;  1YNZ A;  5GAN f;  2EVR A;  3CCE T;  3TQ7 P;  4XU2 A;  3JCM X;  3JB9 H;  3NTH A;  5KYU A;  2F5K A;  2NUZ A;  2GFU A;  1UHC A;  2P0Q A;  4MDW A;  2M16 A;  2LMJ A;  2HBW A;  4M75 F;  2VV5 A;  1MV3 A;  2RB6 A;  4PL6 A;  2AKK A;  2O4X A;  2KR3 A;  4DQ2 A;  3JAM E;  1Y96 B;  4OB3 B;  1UEB A;  4C8Q B;  1QVG P;  3OY9 A;  4F7U A;  1I81 A;  2BZ8 A;  5GAN 6;  5CIU A;  3J7A F;  1NPP A;  2H8H A;  2H3E B;  2RQU A;  5KCO A;  1YIT A;  2FZG B;  4II1 A;  2FPE A;  2LT4 A;  5CKF A;  1VQ9 A;  2P0P A;  2D1X A;  2RJC A;  2PVD B;  3JB9 D;  2DBM A;  1WZO A;  3OSS C;  2RI3 A;  1SSF A;  3CCV T;  1NEB A;  2OX7 A;  2ZGW A;  1PCX A;  1M8M A;  3QBY A;  5LJ3 h;  2XIC A;  1UGV A;  3H0H A;  2DJZ A;  3HTR A;  3V8J A;  2ZPF B;  3A8H B;  5GMK m;  1NZ9 A;  2YSQ A;  4OGE A;  2AZV A;  1G3Y A;  2FZC B;  4J7I A;  4J9C A;  5D7U A;  1IB8 A;  1QWE A;  1VQM Q;  1WLP B;  4J9G A;  4LXC A;  1MNE A;  3M4Y A;  8ATC B;  4M7A D;  2QQ9 A;  5LJ5 e;  1U3O A;  2IIM A;  4M4Z A;  3RNJ A;  1W4S A;  4BDZ A;  4ME7 A;  1RLP C;  1RL2 A;  2HQH A;  1NYG A;  4C92 A;  3H8Z A;  3BE3 A;  2AK5 A;  3LYI A;  2DET A;  2DBK A;  2K3B A;  2JM9 A;  4OMQ A;  3SB2 A;  2HKN A;  1LPL A;  4LDY A;  3L42 A;  1LCK A;  3GP8 A;  4KGX B;  1YJW A;  3PIO A;  3JCM e;  4M7A B;  4F7U E;  4M77 B;  3FC3 A;  1KHI A;  1KC8 C;  1VQL A;  1YCY A;  2FL7 A;  4PJO D;  3EHR A;  2X51 A;  1U8R A;  2CH4 W;  3NMZ C;  2A08 A;  3V7C A;  3J80 E;  1WX6 A;  1W6X A;  4M78 E;  4KUD K;  3I56 A;  4F16 A;  4M7D C;  2W10 A;  3OMG A;  2LX7 A;  1Y7X A;  1YIT Q;  1VQ6 A;  2DYB A;  1QP3 A;  5GAM g;  4XU3 A;  1VQ9 Q;  1MHN A;  1IRE B;  4ZGE B;  2E70 A;  3M58 A;  4HT9 A;  3M0R A;  1NPR A;  4QVC A;  3E2U A;  2I2L A;  5KYW B;  1MND A;  1WDX A;  1SRL A;  4PJO B;  2EWN A;  1A0N B;  5CAI A;  1AEY A;  2HD0 A;  3JCM J;  3H9N A;  3VYH B;  1TG0 A;  3VUB A;  2FYK A;  1CKA A;  2PQW A;  3EFS A;  4KT0 E;  1ZA1 B;  2W0Z A;  3V8K A;  2QTX A;  4NL3 A;  2VGM A;  4IIM A;  3QWY A;  2XI9 A;  3GNF B;  4EMK A;  3QO3 A;  4DBR A;  4C92 E;  1VQK A;  3OW2 S;  1M1G A;  2V8K A;  4V2S A;  1QCN A;  1BU1 A;  2RA2 A;  5CO7 A;  3MHX A;  2A36 A;  1N9R A;  2EQK A;  1S72 T;  2DJQ A;  3QDF A;  2QEX T;  1KQS P;  4LD9 K;  1PD0 A;  1YJW Q;  2P0K A;  1M4Z A;  1G3S A;  2X4X A;  2RI5 A;  3E19 A;  3GOX A;  2YUQ A;  1Y0M A;  1VQL Q;  2K57 A;  2P4T A;  1VQ4 T;  4F7U F;  2K3Y A;  1MV0 B;  3EAE A;  2YUN A;  3CCJ A;  1WXU A;  3I56 Q;  1OPK A;  1IRX A;  1KHC A;  2E1H A;  4QQ6 A;  1VQ6 Q;  3QXE B;  1RAF B;  1X43 A;  4M78 F;  4Z88 A;  3VYG A;  1JJ2 P;  3EG2 A;  2D0Q B;  3QYG B;  1C1A A;  2FRW A;  1X69 A;  1ACM B;  2MIO A;  1LVK A;  2QGG A;  5LJ5 j;  3I5S A;  1M1K R;  2GTO A;  1M90 R;  2RHI A;  1B7T A;  3EHQ A;  1OEB A;  2V1Q A;  1VYT A;  1Q81 R;  2CZ6 B;  2QQB A;  2XDD A;  3JCM f;  2OTL T;  3OYG A;  2DL3 A;  2QYZ A;  3M55 A;  1RAC B;  3LGL A;  1SRM A;  1V29 B;  2VXF A;  1B07 A;  5LJ5 d;  3CPW A;  3HRT A;  3JCM Q;  1OOT A;  3FB9 A;  1KC8 U;  5C6S A;  4N4H A;  2GNC A;  1N8R C;  1VQK Q;  1JXM A;  4OF1 A;  2SRC A;  4M7D D;  1FXX A;  4C92 F;  2EBP A;  4DEX A;  4C0D B;  3EGD B;  4M75 G;  2J06 A;  1BI3 A;  2K5L A;  4QVZ A;  3REB B;  3JCM d;  1SG5 A;  5GAN h;  1I07 A;  2RJD A;  2EQI A;  3CCM T;  3JSC A;  2VYT A;  4FYY B;  1U06 A;  4E7S A;  2EYQ A;  3QG1 A;  3OSV A;  3RKW A;  2YT6 A;  1OYX A;  3S3M A;  3RER A;  4E7H A;  4RTU A;  4RTT A;  4M7D B;  3CCJ Q;  1BIA A;  1X75 C;  8AT1 B;  4RCC A;  2RQT A;  5CKH A;  4LDV A;  2LRQ A;  4PFP A;  2AIR B;  1G3T A;  1XJW B;  5IAY A;  5AT1 B;  2LC4 A;  1TU0 B;  4TVR A;  1U1S A;  5HKC A;  3OS2 A;  2QQR A;  5KYY A;  3OYF A;  2WSF E;  2HEQ A;  1TS9 A;  4C5G A;  2BE7 D;  1W2B S;  1SPK A;  2KDS A;  3S3O A;  3JCM W;  2E3I A;  4FCY A;  4N4G A;  2QG9 B;  4IUP A;  3VUZ A;  5IXF A;  1AOJ A;  1JO8 A;  1K8A C;  1RAB B;  1KJW A;  1K4U S;  2VAS A;  3LWI A;  5J26 A;  3X20 B;  3NGP A;  6AT1 B;  4F14 A;  5KYU B;  1IHV A;  1FX7 A;  1PKS A;  2EQM A;  3MPU B;  2ED1 A;  2KEA A;  1Q82 C;  3VS7 A;  1GCQ C;  3I5R A;  2CP7 A;  3X26 B;  4HCZ A;  3JCM V;  2E12 A;  4A53 A;  1KD1 U;  3BFM A;  5IXB A;  1VQ5 A;  1OX9 A;  2KXD A;  2X4W A;  3UPU A;  5GAM e;  1QLY A;  3RR6 A;  4M75 A;  1UB4 A;  4E7L A;  5KCH A;  3EGX B;  4PKC C;  3ASK A;  3CCE A;  1MGQ A;  1X27 A;  3V7S A;  4AFS C;  2QTV A;  3SHW A;  3IQL A;  2XMF A;  2Y4Y A;  2MCN A;  1NM7 A;  4J9I A;  3TSZ A;  4JJN K;  2QA4 T;  4C8Q C;  2J05 A;  2X4J A;  4N4I A;  2GF7 A;  2E10 A;  1WGS A;  1T3S A;  2ZPB B;  1ZA2 B;  4KH1 B;  4N0A A;  1YI2 T;  3PMT A;  2RQR A;  1QVF S;  3UA7 A;  2F2V A;  1SKU B;  1Q95 G;  4DBH A;  2MYS A;  4A63 B;  2AKL A;  2KYM A;  3PVL A;  3FEO A;  1H92 A;  3V8L A;  2K3X A;  1XOV A;  1XTD A;  2HQX A;  3KUF A;  2KE9 A;  2ZAE A;  3BDU A;  1Q7Y C;  3VS5 A;  2JJ9 A;  3UA6 A;  2CT4 A;  1M3A A;  2RHX A;  2FRY A;  1Q86 R;  2X4Y A;  2ROT A;  4OMM A;  3CCV A;  2VVK A;  5J39 A;  3CC4 T;  2DVJ A;  3M9Q A;  3OA6 A;  4JS4 A;  5GAO n;  4RKU E;  4BUG A;  1VQ7 T;  3RMQ A;  1AWJ A;  2LQK A;  4IUR A;  2FPD A;  5DM7 R;  4JDS A;  1LOJ A;  1VQ5 Q;  1YCS B;  3UT1 A;  1X2K A;  5GJV B;  1YBY A;  5CQX A;  1IO6 A;  1Y71 A;  2D0N A;  2OAU A;  4BE2 A;  4C5E A;  4YTL A;  3UWN A;  1NEG A;  1GCP A;  5CKB A;  1JB0 E;  2JMC A;  3CCE Q;  1K9A A;  1JRI A;  2DL4 A;  2HSE B;  4M78 G;  4M77 C;  3C0C A;  1E6G A;  5FU7 C;  2CZ7 B;  4Y91 A;  3OYB A;  3EGU A;  1K0S A;  2LDM A;  1PSF A;  2EYW A;  1I0C A;  4JLG A;  2ZPI B;  4A4E A;  2VUB A;  3AHU A;  5KYX A;  1VQO T;  4CC3 A;  4LE9 A;  3HRU A;  1AWX A;  2F2W A;  1YWP A;  2MF2 A;  4NL2 A;  1AWW A;  1K73 R;  5GAM f;  1AVZ C;  1M30 A;  4ZN1 A;  3ME9 A;  2WSC E;  2E3H A;  3Q1J A;  2DIQ A;  2QXF A;  4ZGJ B;  4X9C A;  1BCO A;  4F04 B;  4J6W A;  3CCV Q;  4PJM A;  2JMA A;  5I2S A;  3CCU T;  5GAM j;  1QP2 A;  1WXB A;  4FM4 B;  3U23 A;  1TUD A;  1QVG A;  4QW2 A;  2CKK A;  4JJC A;  3VV0 A;  3A5Z B;  1G83 A;  1D09 B;  1Q7Y R;  4OMP A;  2LJ0 A;  3E9F A;  2DTO A;  2HQE A;  3EG9 B;  5GAM d;  3HSB A;  3ZEH A;  4XQ3 A;  2EGA A;  5HK0 A;  1B3Q A;  3A1P A;  4C0F A;  5ECA A;  3OYL A;  3LLR A;  4QKU A;  1KK7 A;  2DK3 A;  2QQS A;  3OS1 A;  2DZ9 A;  5HY6 A;  3CCS T;  3SWN C;  1BBZ A;  2DNU A;  4Q5W A;  1I8F A;  4L59 A;  2QAZ A;  5FRN A;  4HVU A;  3OW2 P;  1S72 A;  3QPH A;  5GAN 2;  3L2U A;  1V76 A;  3HPW A;  3JRZ A;  3NPF A;  1R8O B;  4M78 A;  1VQ8 T;  4HXJ A;  4CC4 B;  3TRE A;  1VQ4 A;  2EQJ A;  4JJB A;  3NTK A;  2JN0 A;  3PVQ A;  4MZM A;  1TUG B;  1Y07 A;  3P8H A;  2HCK A;  3CXC S;  1R77 A;  3M54 A;  1AD5 A;  3L2V A;  2E64 A;  4FT4 A;  1ZSZ A;  5GMK i;  4KRT A;  1GFD A;  4EPC A;  1AT1 B;  2JS2 A;  2GBQ A;  3VS4 A;  2JVV A;  3F70 A;  2DO3 A;  2CUB A;  2KNB B;  4LDW A;  2ZPH B;  1Z9Q A;  5GMK e;  2DRK A;  1JEG A;  3UDC A;  1WFW A;  4JZ3 A;  4J9B A;  1WQ7 A;  5A0G A;  2E6Z A;  2E5K A;  4M77 D;  3MCA B;  5GAN 4;  4BY6 C;  1VA7 A;  2OTL A;  2O9V A;  4KBM B;  1ZUK A;  2L2P A;  4Z02 A;  3ULR B;  1NYF A;  1C6V X;  1YN8 A;  4C0D C;  3QHS A;  2PVO B;  2J6O A;  1K1Z A;  5DLO A;  1TH7 A;  3OYY A;  1H8K A;  1MMG A;  2LQN A;  3OYM A;  1WHL A;  3LWH A;  2XHC A;  3CBO A;  1UGQ B;  2VXE A;  5FU7 B;  1QQJ A;  4AT1 B;  5KYY B;  2R58 A;  1M1K C;  4HKE A;  1M90 C;  1M2V A;  2A7Y A;  3VU3 C;  4DOV A;  1S72 Q;  3CCM A;  3CCQ T;  2DZC A;  2Y4X A;  2JS0 A;  1Q81 C;  2Y90 A;  2DL7 A;  4A4H A;  1FMK A;  2K5I A;  4K11 A;  1UJY A;  1VQ4 Q;  3FJP A;  1H3H A;  2BIV A;  1K9M U;  1W1F A;  2CP6 A;  3O5Z A;  3VS0 A;  2CYZ B;  3OYA A;  4M75 D;  5FWC A;  4ELZ C;  3UAT A;  3L2Z A;  1M5Q 1;  2VC8 A;  2VGN A;  4MZP A;  3GPL A;  4C0Z A;  1KSW A;  4L6V 5;  1O9S A;  2JOY A;  4OVA A;  3VS6 A;  4FSS A;  4D6W A;  3C94 A;  3DLM A;  1KQS A;  3MET A;  1M3B A;  2PTK A;  3G4S T;  4ANJ A;  2X3W D;  1W70 A;  1C0M A;  1UFF A;  2OTL Q;  2WSE E;  1N5Z A;  4FW2 A;  3FRN A;  3M57 A;  2EYZ A;  4M75 B;  4MDX A;  1W2B P;  4OB0 B;  2COZ A;  1ZBJ A;  4NOY A;  4UC4 A;  1NLO C;  5D6Y A;  3PIP A;  2H3J A;  5GAN g;  1MUZ A;  3OB9 A;  2BE9 B;  1BI2 A;  2E4H A;  2PUO B;  1JJ2 A;  1B34 A;  4A4K A;  2GCX A;  3EG3 A;  2KBT A;  3M0U A;  3SWN B;  2EYY A;  2KRO A;  2C0T A;  2KMT A;  3MP8 A;  3CD6 T;  1D3B A;  3JCM c;  3VS3 A;  3X25 B;  3SEM A;  3QJ6 A;  1WYX A;  3CCM Q;  5LJ3 e;  3QYH B;  5LJ5 f;  2QDL A;  2XID A;  1H64 1;  2OTJ T;  2KT8 A;  4Z89 A;  4RMO A;  3G71 A;  3PNW C;  1RUW A;  3M53 A;  3OYI A;  4IUV A;  2QAS A;  5FRO A;  4XAX B;  5J3B A;  1OI1 A;  1JU5 C;  3TCJ A;  4B6M A;  3JB9 I;  1SSH A;  3CC7 T;  4M7A G;  2NUP A;  2QA4 A;  3CME T;  1QKX A;  2K2V A;  2DIG A;  4L5G A;  3ZBD A;  2R5A A;  1UDL A;  2DEQ A;  1Y96 A;  2J6K A;  1YI2 A;  4QQD A;  2RJF A;  2G3R A;  4BY6 B;  4ZGD B;  4C92 C;  1YHQ T;  2KSS A;  1G5V A;  4JS5 A;  1SHG A;  1P92 A;  3OYN A;  4LUD A;  1QVF P;  5GAN 3;  1EIF A;  5FU6 B;  1MMD A;  3GLX A;  4PJO G;  1PKT A;  3URG A;  3CC2 T;  3RES A;  1RAG B;  1OZ3 A;  4HCK A;  1U1T A;  2LCS A;  3TU4 K;  3H0F A;  1ARK A;  2BKD N;  3CC4 A;  1UGR B;  2V8J A;  1OV3 A;  5GAN 5;  4RTY A;  4C5H A;  1I1J A;  1VQ7 A;  2EAY A;  2EKO A;  5KYX B;  1BKB A;  4KH0 B;  4XTU A;  3SD4 A;  2DEU A;  1QCF A;  1T3L A;  2Z0W A;  5KYN A;  3OS5 A;  2E5Q A;  4J9D A;  3G71 Q;  2DM1 A;  2J7I A;  4WF2 A;  1T0H A;  2CP0 A;  2ABL A;  4PNO A;  4KUI A;  2RHY A;  1GXI E;  2E6N A;  1N6A A;  4JRP A;  4A4G A;  1RAI B;  3OYJ A;  1Q86 C;  2MI6 A;  5FW9 A;  2QA4 Q;  1EZZ B;  1V1C A;  5GJW B;  1D1C A;  4EDU A;  1E6H A;  4ESR A;  1HD3 A;  4CRI A;  1UGS B;  4HVV A;  4C8Q E;  4DA4 A;  2CP5 A;  4EMK C;  4M7A A;  3RKX A;  5KE3 A;  1YI2 Q;  1YJN T;  2K6D A;  4MMK A;  2V1R A;  1D0X A;  2HNI A;  1VQP A;  4LDX A;  4BI8 B;  3CCR T;  1FWZ A;  1WPY A;  3RIR A;  4M78 D;  4EMH A;  2ECZ A;  4D8D A;  1PRM C;  3G6E T;  2CRE A;  4JRQ A;  4R55 A;  2KYB A;  2O4X B;  1KD1 R;  4OMF B;  3RBB B;  5GAO l;  4FYW B;  4EMG A;  3OQ5 A;  2EJF A;  4F7U B;  1OUL A;  4J5Y A;  3CCU A;  3CC4 Q;  3LH0 A;  5KYW A;  1QVP A;  1K76 A;  4PJO A;  3E1S A;  1WHH A;  1TXQ A;  1VQ7 Q;  2XDB A;  2JXB A;  3C12 A;  4M78 B;  2AZS A;  5IHN A;  5LJ3 d;  3REA B;  1NJI C;  2LX9 A;  2ROL A;  3CCL T;  3MEA A;  1RI9 A;  3EFO A;  3GNG A;  5EG2 A;  3CCJ T;  1QCO A;  1K73 C;  2M9U A;  4E7I A;  5HCK A;  2FO0 A;  2LTO A;  4C92 D;  4BDY A;  2JTF A;  3L1A A;  1KIK A;  5GAO p;  4XTZ A;  4FIB A;  4OMO A;  1N8R U;  3CCS A;  3LX7 A;  1FMV A;  2HL5 C;  4PLL A;  3RMS A;  3EH1 A;  5CVI A;  2F1L A;  3EFR A;  4IIO A;  3HFO A;  1M27 C;  2HBP A;  2QI2 A;  4M7A E;  1I5O B;  3H0I A;  1PRL C;  4M77 E;  4M7D G;  4XU0 A;  4RG8 A;  4PJL A;  1VQ8 A;  1VYU A;  2FZK B;  2LJ1 A;  2XKO C;  2M0Y A;  2IVW A;  2RK2 A;  1GBQ A;  4GLM A;  4C92 B;  2DTH A;  2RD1 A;  4C8Q F;  3LH5 A;  3M56 A;  5GAN e;  1VQP Q;  2ZCF B;  2KRM A;  2CT3 A;  4JRK A;  4OB2 B;  1M9S A;  3WVE B;  3PTA A;  3DKM A;  2KXC A;  2NWM A;  5LL6 S;  3EG0 A;  2CZ0 B;  3OBY A;  4A54 A;  3CPW S;  3JCM b;  3CXC P;  2EJG A;  1QW1 A;  4PJO E;  3CCU Q;  1M2V B;  2RQV A;  1X01 A;  3A98 A;  1YP5 A;  2DFU A;  2DE0 X;  4KUL A;  4J9E A;  4BAC A;  3EG1 A;  3C95 A;  2VWF A;  3VRY A;  1RAD B;  2RHZ A;  2FHD A;  1EFN A;  3S3N A;  3I9Q A;  3RKY A;  1K8A U;  3M0T A;  5KE2 A;  4RTZ A;  3H6Z A;  3JB9 F;  2P84 A;  3DLL A;  4ORZ A;  2DXB A;  2CP3 A;  2XU8 A;  3M5A A;  5LJ5 h;  2DD4 A;  1S1N A;  2LZ6 B;  3CCS Q;  1NJI R;  4NS5 A;  2E41 A;  1Q82 U;  3EGD A;  2DLP A;  1YJ9 T;  1D1A A;  2DKG A;  2F5T X;  3M59 A;  3CCQ A;  5LJ3 g;  4C0G A;  4EMK B;  1RAA B;  2NYS A;  1VQ8 Q;  1RLQ C;  4M7A F;  2JZ2 A;  3PMI A;  4RG2 A;  2K7A A;  1ABO A;  4ELY C;  4O6J A;  4XTV A;  1Z9Z A;  3JCM h;  3OYH A;  1M2O A;  2WAC A;  2L0A A;  4M7D A;  1I5L A;  2HZY A;  2A3L A;  1X6O A;  2LT1 A;  3KFV A;  2GGR A;  2L89 A;  1ZX6 A;  2RM4 A;  4FW1 A;  4C5I A;  4Z8A A;  2V8I A;  2CS7 A;  3OW2 A;  2JTM A;  2GQV A;  2XG8 D;  2NLU A;  3LW5 E;  4M75 C;  4DOW A;  1YFN A;  2K79 A;  2LCC A;  1OPL A;  3OYK A;  3G4S A;  1YWO A;  4ATO A;  4PJO F;  3P8D A;  2QDY B;  5GAN 7;  1YIJ T;  1HXD A;  2LP5 A;  1TOV A;  3NHN A;  4BE1 A;  1WHK A;  2A0F B;  2BZY A;  2D9T A;  4AG2 C;  3KXT A;  1UHF A;  3M0Q A;  2L3R A;  2X3X D;  4XK8 E;  2MPX C;  2NUP B;  3A8O B;  3L2Q A;  1Q7Y U;  4N0A C;  2YWW A;  4BD3 A;  2QEX A;  1VYV A;  2KY9 A;  3CPF A;  4GBQ A;  4LUE A;  5GAN j;  4JRI A;  4ZNX A;  2IG0 A;  3CD6 A;  2DMO A;  2JT4 A;  4XTX A;  3FJ5 A;  1CKB A;  2OI3 A;  2XD0 A;  2JM8 A;  2YXY A;  4LN2 A;  1WXT A;  4XU1 A;  1HJD A;  3RUX A;  2QK0 A;  3QUI A;  2RPN A;  2YUO A;  3CCQ Q;  7AT1 B;  2OTJ A;  1M1F A;  1PC0 A;  1ZLM A;  5DY9 A;  3M0S A;  3VRZ A;  4ZTF A;  4RTX A;  2O01 E;  5GAO m;  3I55 T;  2FEI A;  1WNL A;  1VQN T;  2YLC A;  5GAN d;  4OML A;  4PFZ A;  5IT9 E;  4QQG A;  4KGV B;  1BB9 A;  2KT1 A;  2DXU A;  2EW3 A;  3OYD A;  3EGX A;  3DB4 A;  4LDU A;  4M7D E;  2DD5 A;  2O9S A;  1MMN A;  1WHJ A;  1KFZ A;  3CC7 A;  1UEC A;  1K0X A;  5DLQ E;  3OBW A;  2L3P A;  3NFC A;  3CME A;  4R0K A;  1IHW A;  1WHM A;  4E7K A;  3CMA T;  2O31 A;  4J6Y A;  4OP0 A; 
#chains in the Genus database with same CATH homology
 1NE8 A;  4RMO A;  3G71 A;  3PNW C;  3MEV A;  4M7A C;  1FX7 A;  2EQM A;  3M53 A;  3OYI A;  4IUV A;  5FLX E;  5FRO A;  4XAX B;  5FU6 C;  5J3B A;  1M8V A;  4PLI A;  4X9D A;  1Q82 C;  1PSE A;  1OI1 A;  1YHQ A;  3TCJ A;  3X26 B;  3JB9 I;  3CC7 T;  4M7A G;  4FU6 A;  5GAO r;  4HCZ A;  1WJQ A;  3JCM V;  2E12 A;  4A53 A;  3OYE A;  2QA4 A;  2KQW A;  4M77 F;  4XTY A;  1KD1 U;  1BYM A;  3CME T;  3BFM A;  3GF5 A;  1VQ5 A;  2XK0 A;  1BIB A;  2X4W A;  5CQY A;  2K2V A;  4IKF A;  4CI0 C;  2DIG A;  1IZ6 A;  2EQU A;  4FT2 A;  4L5G A;  3ZBD A;  1VQP T;  1NJI U;  3CC2 A;  5AYF A;  4BE0 A;  3UPU A;  4E7J A;  2R5A A;  2JUF A;  2DEQ A;  5GAM e;  4OGC A;  1B34 B;  2EIF A;  1Y96 A;  3DB3 A;  1YI2 A;  3GIB A;  4M75 A;  1UB4 A;  5L8R E;  3TEE A;  4E7L A;  5KCH A;  4QQD A;  3INZ A;  3A8L B;  5A0D A;  2RJF A;  4PKC C;  2G3R A;  3ASK A;  4BY6 B;  3CCE A;  3C4S A;  1K73 U;  4ZGD B;  1MGQ A;  2RI2 A;  2GFA A;  3V7S A;  1ZQ1 A;  4C92 C;  5GAN 8;  2D6F A;  1YHQ T;  4PJO C;  2KSS A;  1G5V A;  4JS5 A;  4Y28 E;  4FSX A;  2Y4Y A;  5CKD A;  1P92 A;  2RK1 A;  3OYN A;  4QVD A;  1D3B B;  2YLB A;  5GAN 3;  4JJN K;  2QA4 T;  4HCB A;  4C8Q C;  2DPP B;  1EIF A;  5FU6 B;  1VQM A;  2DVE A;  1LJO A;  2X4J A;  3HP9 A;  4N4I A;  2GF7 A;  1VQ5 T;  2E10 A;  4O5V A;  3GLX A;  4C92 G;  4PJO G;  1WGS A;  5A0L A;  3URG A;  2F69 A;  5C0M A;  1JBM A;  3CC2 T;  3RES A;  2ZPB B;  4ZTJ A;  3HRS A;  1OZ3 A;  4C8Q D;  1K9M C;  1W2B A;  2E65 A;  4C8Q G;  1U1T A;  4N0A A;  2CGH A;  5I2M A;  3TU4 K;  3M4G A;  1YI2 T;  3FDR A;  3PMT A;  3MP6 A;  1QVF S;  3R6O A;  2BKD N;  3CEY A;  3CC4 A;  2MMP A;  1UGR B;  5GAN f;  2V8J A;  5GAN 5;  3CCE T;  3KBG A;  4C5H A;  5CR2 A;  4XU2 A;  3PT9 A;  3JCM X;  1VQ7 A;  3JB9 H;  3NTH A;  2EAY A;  2F5K A;  3FEO A;  3HHT B;  2EKO A;  3E9G A;  2GFU A;  1BKB A;  3V8L A;  2K3X A;  1XOV A;  1XTD A;  2HQX A;  3KUF A;  4XTU A;  3L2W A;  3SD4 A;  4M7D F;  2P0Q A;  4GLK A;  4MDW A;  1VQM T;  2M16 A;  3BDU A;  3OS5 A;  4HA8 A;  1Q7Y C;  2E5Q A;  4M75 F;  2LCL A;  2VV5 A;  5CK9 A;  2RB6 A;  4PL6 A;  3N5B B;  2O4X A;  2RHX A;  4DQ2 A;  1RI0 A;  5M9O A;  3JAM E;  2X4Y A;  1Y96 B;  3PFS A;  4OB3 B;  1UEB A;  4WF2 A;  3MEW A;  1YJN A;  3CCV A;  4C8Q B;  5J39 A;  3OY9 A;  2BUD A;  4PNO A;  1I81 A;  2RHY A;  4KUI A;  4F7U A;  5GAN 6;  3CC4 T;  4J83 A;  3VJP A;  5CIU A;  3J7A F;  1NPP A;  2E6N A;  3QZ9 B;  2JNG A;  3CCR A;  1N6A A;  3M9Q A;  3OA6 A;  4JRP A;  4A4G A;  4JS4 A;  5GAO n;  4RKU E;  4BUG A;  3OYJ A;  1VQ7 T;  1Q86 C;  1WJS A;  2L5Q A;  2MI6 A;  2LQK A;  3RMQ A;  4IUR A;  5KCO A;  3G6E A;  1KQ2 A;  1YIT A;  5DM7 R;  4II1 A;  2LT4 A;  4JDS A;  1LOJ A;  1QVG S;  2YRV A;  3HFN A;  5CKF A;  1O75 A;  1VQ9 A;  4EDU A;  2P0P A;  2RJC A;  3UT1 A;  1YBY A;  5CQX A;  1Y71 A;  2PVD B;  2RO0 A;  1UGS B;  4CRI A;  2OAU A;  3JB9 D;  4BE2 A;  4C8Q E;  4DA4 A;  3JB9 G;  3QII A;  3OSS C;  4YTL A;  3UWN A;  4C5E A;  4EMK C;  4M7A A;  4M78 C;  2RI3 A;  3RKX A;  1SSF A;  5KE3 A;  1YJN T;  3CCV T;  5CKB A;  1JB0 E;  2ZGW A;  4MMK A;  3QBY A;  5LJ3 h;  2HNI A;  1VQP A;  2XIC A;  3QZ5 B;  4LDX A;  4BI8 B;  3CCR T;  1FWZ A;  1WPY A;  3RIR A;  2DJZ A;  3JCM P;  3V8J A;  1JRI A;  2ZPF B;  3A8H B;  4M78 D;  1NZ9 A;  4BI3 A;  4EMH A;  5GMK m;  4M78 G;  4M77 C;  4OGE A;  4Y91 A;  5FU7 C;  2CZ7 B;  1G3Y A;  4J7I A;  3OYB A;  5GMK j;  3G6E T;  1H3Z A;  3A8M B;  2DXC A;  5GAO q;  1YIT T;  4MZT A;  3CCL A;  4JRQ A;  2LDM A;  4R55 A;  1VQ9 T;  1PSF A;  3M4Y A;  2K5F A;  2O4X B;  4OMF B;  4M7A D;  2QQ9 A;  5LJ5 e;  5GAO l;  4JLG A;  2ZPI B;  4EMG A;  2XDP A;  3QKJ A;  1QVF A;  2LQ8 A;  3OQ5 A;  4M77 G;  4A4E A;  2EJF A;  2VUB A;  3AHU A;  4F7U B;  1W4S A;  4J5Y A;  2FVU A;  5IN1 A;  3J81 E;  3CCU A;  1VQO T;  4BDZ A;  4ME7 A;  4A4F A;  3LH0 A;  1RL2 A;  1QVP A;  1GXI E;  1KQ1 A;  4C92 A;  3HRU A;  1KD1 C;  4PJO A;  3X24 B;  2MF2 A;  3H8Z A;  4NL2 A;  3E1S A;  5GAM h;  3LYI A;  2XDB A;  3C12 A;  1BI0 A;  4M78 B;  5GAM f;  3SB2 A;  5LJ3 d;  4JLI A;  4C8Q A;  3LGF A;  1NJI C;  2LX9 A;  4ZN1 A;  3CCL T;  3ME9 A;  4LDY A;  2WSC E;  2PUK B;  3NTI A;  3MEA A;  5KH6 A;  3L42 A;  3GP8 A;  1YJW A;  3Q1J A;  1XQH A;  3PIO A;  2DIQ A;  1M90 U;  3JCM e;  1M1K U;  4M7A B;  2QXF A;  2DTI A;  3GNG A;  4P5N A;  4F7U E;  5EG2 A;  4M77 B;  4ZGJ B;  3FC3 A;  3CCJ T;  4X9C A;  3WVD B;  2M0O A;  1K73 C;  1KHI A;  2PVG B;  2M9U A;  4J6W A;  1YCY A;  2FL7 A;  3V7R A;  2ZPG B;  4E7I A;  4C92 D;  2LTO A;  1VQL A;  4PJO D;  5I2S A;  3SDZ A;  3CCU T;  4BDY A;  5GAM j;  1QP2 A;  1Q81 U;  2JTF A;  1UGP B;  2MWO A;  1U8R A;  4FM4 B;  1N9S A;  3V7C A;  3L1A A;  3J80 E;  5GAO p;  4XTZ A;  5I21 A;  4FIB A;  4VUB A;  4M78 E;  4KUD K;  1N8R U;  3CCS A;  3LX7 A;  3I56 A;  1QVG A;  4QW2 A;  4PLL A;  2CKK A;  4M7D C;  3RMS A;  3VV0 A;  3A5Z B;  5CVI A;  3OMG A;  3EFR A;  2LVM A;  3HFO A;  1Y7X A;  3FLG A;  1VQ6 A;  3ER0 A;  1QP3 A;  5GAM g;  3E9F A;  2DTO A;  2HBP A;  1ZHI A;  2HQE A;  1BI1 A;  3QJY A;  2QI2 A;  4XU3 A;  4BB7 A;  1MHN A;  1IRE B;  5GAM d;  3ZEH A;  3HSB A;  3VKI A;  4M7A E;  4XQ3 A;  4ZGE B;  4M77 E;  2E70 A;  3M58 A;  1YJW T;  4QVC A;  1NPR A;  4HT9 A;  4M7D G;  4XU0 A;  1I4K 1;  4RG8 A;  1VQ8 A;  5HK0 A;  2I2L A;  1VQL T;  2XKO C;  4C0F A;  3JB9 J;  2IVW A;  3LLR A;  2RK2 A;  4C92 B;  3OYL A;  4PJO B;  2DTH A;  2EWN A;  2RD1 A;  4C8Q F;  3M56 A;  5GAN e;  4HT8 A;  2R5M A;  5CAI A;  2HD0 A;  2ZCF B;  3JCM J;  2DK3 A;  2QQS A;  3OS1 A;  2DZ9 A;  5HK3 A;  4JRK A;  5HY6 A;  3CCS T;  3VYH B;  4XTW A;  3I56 T;  4OB2 B;  5CCA A;  1M9S A;  3OMC A;  3WVE B;  3SWN C;  2EFI A;  3CBP A;  3DKM A;  4Q5W A;  1I8F A;  3VUB A;  4L59 A;  3PTA A;  2FYK A;  2PQW A;  4KT0 E;  3EFS A;  5FRN A;  1VQ6 T;  1S72 A;  2YHT A;  3QPH A;  5GAN 2;  4BI4 A;  1DJ7 B;  3V8K A;  3WXM B;  3L2U A;  5LL6 S;  2QTX A;  4NL3 A;  2VGM A;  3G7Z A;  2CZ0 B;  2K4Y A;  3OBY A;  2XI9 A;  3GNF B;  4A54 A;  3HPW A;  3JCM b;  4E47 A;  3CPW S;  5FRM A;  4ZN3 A;  3JRZ A;  1R8O B;  4EMK A;  4M78 A;  1VQ8 T;  3QO3 A;  3OYC A;  4J8O A;  3TRE A;  4C92 E;  2EJG A;  1QW1 A;  1VQ4 A;  2EQJ A;  4PJO E;  1VQK A;  3T9N A;  3NTK A;  2R57 A;  2MAM A;  1X01 A;  2JN0 A;  3BY7 A;  3OW2 S;  1M1G A;  4MZM A;  2V8K A;  3OS0 A;  4KUL A;  2ZPE B;  1Y07 A;  3P8H A;  4BAC A;  4V2S A;  3C95 A;  4M77 A;  1VQO A;  3MEU A;  2RA2 A;  5CO7 A;  3CXC S;  1YJ9 A;  3M54 A;  3MHX A;  2E64 A;  4FT4 A;  1N9R A;  3L2V A;  5GMK i;  2RHZ A;  2FHD A;  2EQK A;  4EPC A;  3S3N A;  1VUB A;  1S72 T;  5LJ3 f;  4J6X A;  2QEX T;  1VIF A;  2JVV A;  4LD9 K;  3F70 A;  2P0K A;  4RCB A;  1M4Z A;  2DO3 A;  3RKY A;  1G3S A;  2X4X A;  2ZPH B;  3PGG A;  4LDW A;  1K8A U;  2RI5 A;  5GMK e;  1WJR A;  3E19 A;  5KE2 A;  3GOX A;  3UDC A;  3QDR B;  2K57 A;  2P4T A;  3X28 B;  1VQ4 T;  3H6Z A;  3O8V A;  1WQ7 A;  4IUT A;  5A0G A;  3DLL A;  4F7U F;  1VQK T;  2DXB A;  2K3Y A;  3JB9 F;  2E6Z A;  2XU8 A;  3M5A A;  5LJ5 h;  3MCA B;  4M77 D;  2DD4 A;  2RH2 A;  3EAE A;  5GAN 4;  4BY6 C;  5LJ3 j;  3CCJ A;  2MWP A;  1KQS S;  2OTL A;  4KBM B;  4NS5 A;  2E41 A;  1Q82 U;  1KHC A;  4Z02 A;  1YJ9 T;  2E1H A;  2DKG A;  2F5T X;  4QQ6 A;  2KAF A;  3QXE B;  4M78 F;  1KG1 A;  3VYG A;  3CBM A;  4B9W A;  3M59 A;  3CCQ A;  4B9X A;  2D0Q B;  3QSU A;  3QYG B;  4C0G A;  5LJ3 g;  1G3W A;  4EMK B;  4C0D C;  1ZBX A;  3QHS A;  5LJ5 j;  5A2Q E;  2PVO B;  3HL8 A;  4M7A F;  2JZ2 A;  3PMI A;  5DLO A;  1TH7 A;  3OYY A;  2RHI A;  4RG2 A;  4HCC A;  5D6W A;  2L8D A;  3OYM A;  4ELY C;  1JJ2 S;  5GMK l;  4O6J A;  4XTV A;  3JCM h;  2CZ6 B;  3ZFJ A;  2QQB A;  2XHC A;  2XDD A;  3OYH A;  3LWH A;  2RJE A;  3CBO A;  3JCM f;  1UGQ B;  2VXE A;  3MP1 A;  5FU7 B;  1YIJ A;  3OYG A;  2WAC A;  2OTL T;  4M7D A;  1I5L A;  1LNX A;  3M55 A;  5LJ5 g;  2A3L A;  3LGL A;  3G71 T;  1V29 B;  2VXF A;  1X6O A;  2R58 A;  2LT1 A;  1M1K C;  3BW1 A;  4HKE A;  5LJ5 d;  3CPW A;  1M90 C;  2L89 A;  3VU3 C;  2A7Y A;  4DOV A;  3HRT A;  3JCM Q;  2RM4 A;  3CCM A;  3CCQ T;  2DZC A;  2Y4X A;  3FB9 A;  3L2R A;  1N27 A;  2HAX A;  1KC8 U;  4FL6 A;  1Q81 C;  2Y90 A;  4C5I A;  5C6S A;  2AHJ B;  2V8I A;  3S6W A;  4A4H A;  2K5I A;  4N4H A;  2CS7 A;  3OW2 A;  2JTM A;  2GQV A;  2XG8 D;  2NLU A;  3LW5 E;  4M75 C;  4OB1 B;  4DOW A;  3FJP A;  1N8R C;  2LCC A;  4OF1 A;  2BIV A;  3OYK A;  3G4S A;  1K9M U;  2C06 A;  4M7D D;  5CKE A;  3CXC A;  1XNI A;  1FXX A;  4J7F A;  4ATO A;  4C92 F;  4X34 A;  4PJO F;  2CYZ B;  3P8D A;  4C0D B;  1WQW A;  3OYA A;  2QDY B;  4M75 D;  5GAN 7;  1YIJ T;  1HXD A;  4M75 G;  3SWN A;  3JCM g;  4ELZ C;  3P8B B;  1BI3 A;  2K5L A;  4QVZ A;  3L2Z A;  1M5Q 1;  3JCM d;  4BE1 A;  2VC8 A;  5GAN h;  2VGN A;  2RJD A;  4MZP A;  3GPL A;  3KXT A;  2D9T A;  3CCM T;  4C0Z A;  3JSC A;  2L3R A;  4XK8 E;  2PU9 B;  2VYT A;  4L6V 5;  3I55 A;  1O9S A;  2EYQ A;  2JOY A;  3A8O B;  1VIE A;  4OVA A;  3L2Q A;  3QG1 A;  1Q7Y U;  3OSV A;  3RKW A;  1VQN A;  1OYX A;  4N0A C;  3BDL A;  4LD6 A;  3S3M A;  3RER A;  4BD3 A;  2DXT A;  4D6W A;  3C94 A;  3DLM A;  4E7H A;  1KQS A;  2QQA A;  3A8G B;  2QEX A;  3MET A;  1HK9 A;  3G4S T;  2FB7 A;  3HKS A;  4MML A;  2KY9 A;  3CPF A;  4M7D B;  1BIA A;  1X75 C;  4IUU A;  2WSE E;  5GAN j;  4JRI A;  2IG0 A;  3CD6 A;  2M1H A;  3FIF A;  3FRN A;  3M57 A;  4XTX A;  1AHJ B;  4M75 B;  4RCC A;  2XD0 A;  4MDX A;  2ZZD A;  2KK4 A;  4XU1 A;  5CKH A;  3RUX A;  1Q86 U;  4OB0 B;  3QUI A;  3CMA A;  4NOY A;  4LDV A;  4UC4 A;  1OZ2 A;  2OTJ A;  1M1F A;  2LNV A;  4JUV A;  5DY9 A;  5D6Y A;  2LRQ A;  4ZTF A;  3PIP A;  2H3J A;  2O01 E;  5GAN g;  5GAO m;  3I55 T;  1WNL A;  3OB9 A;  1G3T A;  1BI2 A;  4GY5 A;  5IAY A;  2LC4 A;  1VQN T;  4TVR A;  1U1S A;  2YLC A;  5HKC A;  2QQR A;  2PUO B;  3MO8 A;  2WSF E;  5GAN d;  3OS2 A;  4QQG A;  1B34 A;  3OYF A;  5IT9 E;  1JJ2 A;  4C5G A;  4A4K A;  2DXU A;  2GCX A;  1W2B S;  2EJ9 A;  3OYD A;  3DB4 A;  4LDU A;  4M7D E;  2KDS A;  2OTJ T;  3S3O A;  2DD5 A;  2DAQ A;  3JCM W;  3CC7 A;  5GMK h;  4M75 E;  3SWN B;  2X35 A;  2RHU A;  2CZ1 B;  3OBW A;  5DLQ E;  5D6X A;  2KMT A;  3MP8 A;  3NFC A;  4N4G A;  4R56 A;  3CD6 T;  4F7U G;  4IUP A;  3VUZ A;  1D3B A;  3JCM c;  3CME A;  3X25 B;  4IUQ A;  3QJ6 A;  1K8A C;  2KVQ G;  1KC8 C;  4E7K A;  2B8A A;  5LJ3 e;  3QYH B;  5LJ5 f;  4J6Y A;  3CMA T;  2XID A;  1H64 1;  3LWI A;  5J26 A;  3X20 B;  4OP0 A;  3SFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...