3ME9A

Crystal structure of sgf29 in complex with h3k4me3 peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
174
structure length
174
Chain Sequence
GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAGA-associated factor 29 homolog
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 36
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3me9A02
2K3YA 2B8AA 2E6NA 2RJFA 2RHUA 4QW2A 2RHZA 2R5MA 4UC4A 4B9WA 2P0KA 3MP1A 4BACA 4IUVA 1KHCA 4A4EA 3OYCA 2RI2A 3L42A 1OZ2A 4PL6A 3OYAA 1OI1A 2EKOA 2HQXA 2EQJA 2RJEA 2JZ2A 2LCCA 2IG0A 3MEWA 2JTFA 3OYMA 3GOXA 3O8VA 5D6YA 3FDRA 4IUUA 3OS2A 3PMIA 4A4FA 3OQ5A 4ZTJA 3E9GA 4N4IA 2EQMA 4N4GA 2PQWA 4IUQA 4PLLA 3L2WA 1OYXA 3META 2QQRA 4QVZA 3OYGA 3MEUA 4Z02A 4A4HA 1H3ZA 1MHNA 4C5HA 3NTIA 2BIVA 4IKFA 3QJ6A 4OVAA 3OYLA 3PFSA 3OY9A 5KE2A 2M1HA 3M9QA 2MWOA 3FC3A 4NS5A 3MO8A 2LVMA 2RO0A 2LRQA 4FL6A 4QQ6A 3OS0A 4BE0A 4PLIA 3CEYA 4E7JA 2RHYA 3QIIA 4ZTFA 5KH6A 3L2RA 3S6WA 3LYIA 3ZEHA 3S3MA 1WJRA 5J39A 2FHDA 3H6ZA 3NTKA 4X34A 4LD6A 5IN1A 4BE1A 2X35A 2RI5A 2BKDN 2HQEA 3C4SA 3FEOA 4BD3A 3OYKA 2DAQA 3SD4A 3LH0A 3ASKA 3OA6A 2MWPA 3MP6A 4II1A 2NLUA 3DB3A 2L3RA 3OS1A 3OMGA 2L89A 2RJCA 2L8DA 3BDLA 4BDYA 4B9XA 3LGFA 4E7KA 2RHIA 5M9OA 2E5QA 2EQKA 1G5VA 3EAEA 3S3OA 1XNIA 3MEAA 2O4XB 2X4XA 3LGLA 3OB9A 4FU6A 5IAYA 4A4GA 4E7HA 1WJSA 3S3NA 5FRMA 5D6WA 3OYDA 3FLGA 2WACA 3QBYA 3UT1A 3F70A 2R5AA 3PNWC 2M0OA 3OYNA 5CIUA 3L2VA 2D9TA 2GFAA 1OZ3A 4IUTA 3UWNA 3PMTA 4BE2A 4E7LA 4C5IA 3MEVA 2GF7A 3H8ZA 4N4HA 4CRIA 5C6SA 3OYJA 2QQSA 2RHXA 3LX7A 2VYTA 3MP8A 4IURA 4L59A 2LTOA 2X4YA 3P8HA 4QQDA 5D6XA 3KUFA 2LDMA 3OYBA 4Q5WA 3E9FA 4C5GA 2X4WA 2RJDA 3DB4A 2BUDA 1WGSA 4C5EA 2RI3A 2XDPA 2O4XA 2R58A 4E7IA 2M16A 1N27A 2GFUA 5KCOA 3DLMA 5FRNA 2G3RA 4BDZA 3L2UA 4HCZA 1SSFA 2EQUA 2YRVA 3OMCA 1WJQA 3ME9A 5C0MA 2DIQA 2XK0A 2R57A 3LLRA 2K3XA 2EFIA 5FROA 3OYFA 3OYEA 1RI0A 3NTHA 3P8DA 3QKJA 2CKKA 4IUPA 5KCHA 4GY5A 5KE3A 4QQGA 3OYHA 2DIGA 4EDUA 3OYIA 5J26A 4RG2A 3Q1JA 3L2QA 2F5KA
chains in the Genus database with same CATH superfamily
4QW2A 4V2SA 3SWNB 1VQ9Q 1NYGA 2DL3A 5IT9E 1OPLA 1UE9A 2QA4Q 2EQJA 3HRSA 2JZ2A 2LCCA 8AT1B 1NG2A 1H641 2DVJA 2DLPA 2EQMA 1K4US 4HVWA 5CK9A 4PJOB 2K3BA 3SWNA 3ZBDA 2XIDA 1G3TA 1QW1A 2CP5A 3VYHB 4OMLA 3RBBB 3QHSA 3BY7A 2AZSA 4BE1A 1PHTA 4E7LA 3C4SA 2W0ZA 3TCJA 4BD3A 3HTRA 3QYGB 4PJOA 3JCMW 2L3RA 1K1ZA 3HPWA 3OMGA 2LJ1A 4BDYA 4E7KA 4D8KA 1AWWA 4FYXB 3NMZC 2LQKA 1U1SA 4OMMA 2X4XA 5GJWB 1YP5A 1RACB 1M8VA 5FW9A 5CIUA 5GAMd 1WIEA 3GP8A 1QVFA 5GAN2 2KVQG 2LJ3A 4ME7A 4F14A 2RK2A 3I5RA 4J5YA 2CS7A 5GMKe 2GTOA 1QCFA 4Q5WA 1BIBA 1KQ1A 3A1PA 4ESRA 2DX1A 5GAMj 1LJOA 1YIJT 1HYOA 4J83A 4IIMA 3H0IA 5CVIA 1AT1B 1TXQA 3VU3C 1D3BB 3G4ST 4L6V5 1RAFB 2L5QA 1Q7YU 4RG2A 1B34B 2RJFA 3RR6A 1VQ9A 1UGVA 4LDWA 1M90R 3E2UA 4A4EA 4XU3A 5LJ5d 2EJGA 1Q86C 1EZZB 1QP3A 2KQWA 2CZ0B 5I2SA 1MUZA 1D3BA 1SF9A 5D6YA 1G83A 3RKWA 3HKSA 1VQKQ 4N4GA 4AFZC 4C92F 2M9UA 1QCOA 1B34A 1T3SA 2ZPGB 2XMFA 3PE0A 5HCKA 2A7YA 3GPLA 1NEGA 1VQNQ 4Z02A 3MJXA 1V76A 1BIAA 2J05A 3QJ6A 1OPKA 3M9QA 3HRTA 4YTLA 1K9MU 2H3EB 1VYTA 5CO7A 5GMKm 3PTAA 3JCMV 1T0JA 4JJCA 1NBEB 1WFWA 2XU8A 1OV3A 4II1A 2DD5A 5EC7A 2CZ1B 4HXJA 2DBKA 2KEAA 5LJ3h 4FCYA 1RADB 4LDXA 1WXBA 2D1XA 2WACA 3QBYA 1YITT 4MMLA 1JO8A 4LN2A 3OYNA 4XU2A 4CC2A 1YJNT 1OZ3A 2DJQA 2KRSA 4FT2A 4OMNA 4C8QF 1X43A 3CCQQ 3VRYA 3GBQA 4QQDA 4RCBA 3MKDA 3E9FA 1WXTA 1JXOA 3CXCP 3G6ET 1WGSA 3JRZA 1BCOA 4X9DA 5KCOA 4XTVA 4EMHA 2VXFA 2CDTA 4DQ2A 1VIFA 5HY6A 1WHLA 2OAUA 4EIKA 2YDLA 3UF4A 1IRXA 1D1CA 2WSFE 2DIGA 3VS7A 4HA8A 3CPWP 3G7ZA 2JTEA 2F5TX 3HSBA 2RHZA 2K79A 2KAFA 4FSXA 1I1JA 5IHKA 3OYAA 2EGAA 4HCCA 1ZSGA 4M7AF 4DBHA 3LH5A 1W6XA 5DLOA 2V26A 2DL7A 2P4RA 2YRCA 1ABQA 5GANh 3CMAQ 4JDSA 1QVFS 1W2BA 1VQLT 4C92D 5GAN4 4QVZA 3QJYA 3SFMA 3OYLA 4R55A 2ROLA 4NS5A 1JQQA 5GAOn 3OS0A 1PG5B 4PKCC 3CC2Q 2KRNA 2YUNA 2NYSA 1ABOA 2JM8A 4Z88A 2D6FA 1KSWA 4LDUA 2JVVA 3CCST 2CUBA 5KYYA 2V8JA 5D7UA 1X6OA 4ZNXA 1JRIA 4C92E 1K9MR 3I55T 5LJ3j 1G5VA 1VA7A 2ESWA 2DXCA 2LT4A 3S3NA 4AMCA 4BI4A 1D1AA 2O9SA 3X25B 2DTHA 3CCQA 4WCIA 4C8QD 4LNPA 3CMEA 5D6XA 3EG9B 2ENMA 5GAOp 5FU7C 2OX7A 2X4WA 2QTVA 1GL5A 2R58A 4OMFB 4C92G 1YI2Q 3CCJA 2DE0X 2OI3A 4HCZA 4KRTA 2EQUA 2QASA 4M77F 1YJWQ 1M30A 1JJ2S 1N9RA 2QQ9A 3EG9A 1XOVA 4C8QE 3L2QA 3G1JA 2QAZA 2YRDA 2YLBA 2B8AA 4UC4A 3QWYA 4IUVA 4AG1C 1WYXA 1VQ5T 1DJ7B 1ZBJA 1YHQA 2DXUA 4XU0A 1QVGP 2DL8A 5CR2A 2RJEA 4M7AD 2FRWA 1S72Q 2IG0A 1I5LA 4FT4A 4HT9A 1K76A 4M7DA 3J7AF 2HZYA 3J80E 3CMAA 4OP0A 3RKYA 1F1BB 1LNXA 3OQ5A 2HQHA 1SRMA 1OYXA 1U1TA 5CQXA 1Y96B 4M78C 4C8QG 4OVAA 1NLPC 1ZX6A 3DLLA 9ATCB 4QQ6A 3CC2A 2RHYA 3QIIA 2ZZDA 2GTJA 1RL2A 4M7AE 3HP9A 3CCVA 2FHDA 2RNAA 3OYKA 4LXCA 4XK8E 1BI3A 2LQ8A 2MWPA 2VASA 1GFDA 1Y96A 2D8HA 3A8MB 4BI8B 3S3OA 1KQSA 2OTLT 2FZCB 4A4GA 1MGQA 1WJSA 2Y4XA 4C0ZA 4R56A 3J81E 2GGRA 2C0TA 2AT1B 2J6KA 4DEXA 2OAWA 1UJ0A 4XTZA 4D8DA 3QDFA 4XTXA 2EGCA 1S1NA 1M1KC 3FJPA 2X4JA 4M7AG 5GAN5 1R0BG 3CC7A 2GQVA 4NL2A 1W2BS 5CCAA 1G3YA 4RTZA 4HT8A 2P84A 2IIMA 1E7OA 2K4YA 2DA9A 2YHTA 1M90C 2K57A 4F17A 3RMSA 5IHNA 2DIQA 3CCUA 1HSQA 4M77D 1QP2A 5LJ3f 2YLCA 1RI0A 4JZ4A 3CCRQ 1FYNA 1KG1A 1M8MA 4EDUA 1X75C 1X2KA 1NE8A 5FRMA 3CCLA 4PFPA 4J7IA 1S72A 1RAGB 3EG0A 3V8LA 1VQ7A 3OW2A 1B7TA 2QTXA 2DMOA 3QZ9B 2RK1A 2DYIA 4JLGA 3SDZA 3ULRB 4M77E 3M0TA 2JUFA 1Y71A 3M55A 1WHGA 3URGA 2QQRA 1M3BA 2DO3A 3HFNA 4ORZA 4IKFA 1SHFA 2WSEE 3VS0A 2AKLA 3M56A 1BBZA 4J9DA 5LL6S 2CH4W 2XKOC 3EH2A 3L2RA 4X34A 1OU9A 2K5LA 4LD6A 2VGMA 2FRYA 4BY6B 2FO0A 3OS1A 2HBPA 4KGXB 1Z9QA 3BDLA 1VYVA 2C0IA 5GANf 4M77G 1VQ5A 2HSPA 1NM7A 4KGZB 2J6FA 3LGLA 1PKTA 1A0NB 3OYDA 3F70A 1Q82U 2KSSA 3UA7A 5KYXB 4AG2C 3UWNA 2JN0A 2GF7A 3H8ZA 2QQSA 1Q81U 4B6MA 5FLXE 3PIPA 2JM9A 1IB8A 2J06A 2P0PA 5IXBA 4JUVA 3V7CA 2E3IA 1WNLA 1VQ9T 3KBGA 1G3WA 4XTWA 2M16A 3RESA 2CP6A 1C6VX 3CBPA 4ATOA 1UUEA 1ZUKA 3QG1A 2OTJA 1I8FA 5KYXA 3ME9A 3CCRA 3JB9F 4QKUA 4F04B 3I35A 1JU5C 1YJ9A 1T0HA 4QQGA 3WXMB 1BYMA 1ZSZC 2RHUA 2P0KA 2X3WD 3CCEQ 3M57A 1OZ2A 1QLYA 5GAMh 3WVEB 4JPBW 3NHNA 1KQSS 2VKNA 4RTUA 3VS5A 2RM4A 1OULA 4OMQA 3OS2A 1I4K1 4Y92A 1M27C 2EGEA 3EHRA 4MMKA 2XDDA 1X6BA 1QQJA 3EFRA 4M75G 3MHXA 4IUQA 5LJ3g 1W4SA 1VQ4A 3EGXB 1TSFA 2DRMA 3OYGA 5GAN3 1VQ8Q 1M1GA 4BUGA 3G71A 3V8KA 4JRPA 2MWOA 2L2PA 3CC4A 3JCMh 2ZPIB 1K9MC 4FL6A 4M7DC 2XHCA 4ELZC 1GFCA 1UTIA 2DEUA 3E1SA 2DZCA 4K11A 4AFUC 3FEOA 3WVDB 2DAQA 1JBMA 1VQMQ 3EGXA 1WHJA 3SHWA 2DNUA 2V8IA 4DOVA 4E47A 2CP0A 2RHIA 5FU7B 4OB0B 1K73U 1BI0A 4FW2A 2KNBB 3JCMX 2FG0A 2HEQA 4JRIA 5DM7R 3SEMA 3OW2S 1NJIU 1FMKA 2D8JA 4C5IA 2RQTA 5CAIA 2ED1A 2QXFA 4RTYA 1H92A 3RMQA 5A0GA 3ER0A 2QK0A 3I56Q 2RI3A 3GLXA 2ZPEB 4E7IA 4E7SA 5GANg 4PK4A 3L1AA 1NEBA 5FRNA 3L2UA 4ZN1A 2JS2A 4J9CA 3CXCA 3CCMQ 3QO3A 1Q81R 2P0QA 3X24B 1YBYA 1UGPB 2KYBA 3OYIA 4KT0E 1MNDA 5GANe 3CCEA 1VQPQ 4PL6A 2L0AA 1Y57A 4F7UB 4RTWA 1SG5A 4M78B 2CSQA 4XU1A 1RAHB 4ZGDB 2KT1A 1AWOA 1JXMA 2MF2A 2VGNA 1SEMA 1ZLMA 4C5HA 4LDVA 4F7UA 4M78A 5KE2A 2QA4A 2QDYB 3FJ5A 2I0NA 3AHUA 1SHGA 3S6WA 3LYIA 1KC8R 3CBMA 3LWHA 2ROTA 4O6JA 1TTHB 3INZA 4N0AC 3CCQT 5FWCA 3TSZA 3CMET 5LJ5j 2L89A 2CH4A 5KYWB 2M0YA 2JXBA 1B07A 3M0RA 3UPUA 4HVVA 1U5SA 1TU0B 1AVZC 4XTYA 2BE9B 3R6NA 2YT6A 2M0OA 1KIKA 1D1BA 1I81A 1V1CA 3CCJT 1M4ZA 3C0CA 4BE2A 1IO6A 3CBOA 3CPFA 4KBMB 3V7RA 2DBMA 3LX7A 4L59A 1N6AA 2RMOA 2EKHA 3KUFA 5KYWA 4Z89A 1ZUUA 4C5GA 1PSFA 1NYFA 3DB4A 2ECZA 2MK5A 2DK3A 2K7AA 3X28B 3FIFA 3RIRA 1WZOA 1N27A 1MV3A 1YHQT 1TUGB 2K2VA 3CCMA 2LJ0A 3UDCA 2ABLA 1QCNA 2YRVA 2DF6A 3OMCA 5C0MA 3CMAT 1I0CA 4FIBA 3V7SA 4BY6C 4C0DC 2PVDB 2CP2A 1VQPA 2E6NA 5GAN7 3M58A 5CKDA 4AT1B 4B9WA 4NL3A 4MDWA 1OI1A 1CKAA 2QG9B 2E5KA 3CC2T 3FDRA 4IUUA 3BDUA 4A4FA 4IIOA 4BB7A 3CCVT 2COZA 4PJOF 2RQUA 2HMAA 2PQWA 3P8BB 4PJMA 2ZPHB 2KGTA 1QVFP 2FPFA 4TVRA 4J9EA 1QVPA 4WTOB 2KK4A 4OB1B 3T9NA 2K6DA 3M53A 4X1VA 2ZCFB 3ZL7C 1XJWB 2HKNA 2E6ZA 4DOWA 3S3MA 1M2VB 1VQKA 3QXEB 1Q7YR 4ANJA 1AEYA 5GAMf 2HL5C 2X51A 5GAN6 4C92C 1VQNA 2W10A 2L8DA 5KYYB 3CC7T 3M0UA 3M5AA 4HCKA 1WPYA 3MEAA 5CKBA 4NOYA 2LZ6B 1YITQ 2E65A 1M2VA 2JS0A 1N8RU 3CCUT 2A3LA 2EYWA 1AWJA 3JCMf 2LDMA 1ZQ1A 1WI7A 3G6EQ 1ZSZB 2DEQA 3CCLT 3FRNA 3QUIA 2DERA 3DLMA 1S72T 1M5Q1 5GAOl 1VQ7T 2XK0A 1M3CA 1YWOA 2FYKA 1HK9A 3VS3A 1W70A 2VV5A 3QPHA 3MCAB 3P8DA 2CKKA 4C8QC 4HCBA 2V1QA 2CGHA 3CD6Q 2M02A 1JJ2P 1ZSZA 4OF1A 1PSEA 2FVUA 3VS4A 1AZEA 1OX9A 2K2MA 3MEWA 2WSCE 2NWMA 2JTFA 5IHIA 4M7DB 3M0PA 1NLOC 4GLMA 4XTUA 3JSCA 2HKQB 4PJOD 2DETA 3A8GB 4OMPA 4P5NA 3MEUA 4E2FB 1UB4A 2PZ1A 3TU4K 2YUOA 2KE9A 2LNHB 2RO0A 1R8OB 2L3PA 7AT1B 4M7AC 1IGQA 3RDVA 3TSWA 3H0HA 4QVCA 2GCXA 1WJRA 3H6ZA 3JCMJ 2X35A 2MYSA 2QGFB 2MPXC 3CCSQ 1X27A 3SD4A 3OA6A 3MP6A 3DB3A 4VUBA 4PJOE 2E5QA 2KI7A 3VS2A 1C1AA 3KXTA 4OGEA 2EYXA 5IAYA 3UT1A 2JNGA 2OJ2A 5GMKj 2O9VA 1X2QA 2GFAA 2OTJT 2DJZA 3GIBA 1UGQB 3CCRT 5EG2A 3LW5E 3MEVA 1Q81C 2VYTA 1YWPA 1YJ9T 1O9SA 2L3SA 1WQ7A 5GAMg 1UEBA 1ZUYA 4C5EA 1K9AA 2XDPA 2XG8D 1N8RR 2QDLA 2Y90A 4PJOG 1SSHA 5HK0A 1W2BP 3SB2A 4LE9A 4PFOA 1VOMA 4EMKC 1BKBA 1WJQA 1NPPA 1U8RA 3LLRA 1WA7A 5GAMe 2CZ6B 2F2WA 2YUQA 3OYFA 2QEXQ 3QKJA 3JCMb 2O01E 4JZ3A 3CD6A 1BI2A 3I9QA 1QKXA 1CSKA 2F5KA 5L8RE 4DEYA 1VQ4T 1U06A 3JCMg 2FB7A 4OGCA 2HNIA 3VKIA 2DTIA 5HK3A 4PJNA 3G71T 1TG0A 2O31A 1YI2A 4DBFA 3CC4T 1YJWA 1PD1A 1SPKA 2RQWA 1PC0A 5LJ5g 4JRKA 3EFOB 3JCMe 4N4IA 3O5ZA 2EYZA 4RCCA 1Z9ZA 2MCNA 1KC8C 2IPOB 3HHTB 3JCMP 1KK7A 2LQWA 2RD1A 4PNOA 3JB9J 2M51A 3THKA 2PVGB 2JT4A 2YUPA 1LPLA 5L23A 3OY9A 5FU6C 1ARKA 2VC8A 4BE0A 1NPRA 3CEYA 1UJYA 2E12A 2AK5A 3M0QA 2E3HA 3ZEHA 3EFOA 2LP5A 2RI5A 2E41A 4N0AA 4LUDA 1KFZA 3OBYA 3QDRB 4KUIA 2CYZB 4GLKA 3EG1A 2ZPFB 1NZ9A 3M4YA 3HFOA 1XNIA 2OTLQ 3CQTA 5AYFA 1VQ6Q 1W1FA 1HXDA 4RTTA 4FW1A 1H3ZA 1ZHIA 4IURA 2EWNA 4C0DB 6AT1B 3OYBA 2RQVA 4WF2A 1JEGA 3VS1A 3TQ7P 3CCET 2CREA 1UGRB 2DILA 2J7IA 3R6OA 4M7DF 4M75C 2H3JA 2E1HA 1M9SA 1KHIA 3PVLA 3OS5A 1T3LA 2NUPB 2Y4YA 3X26B 2RA2A 1OOTA 1WHHA 3Q1JA 2VB6A 5GAOm 1EIFA 2RN8A 2H8HA 2RH2A 4FYYB 3UA6A 3IQLA 2P4TA 1YFNA 1KHCA 3V8JA 4J6YA 2FL7A 1Q95G 2QA4T 1VIEA 1AWXA 2PNIA 3O8VA 3PMIA 1KQSP 1MNEA 2NUPA 4ZGEB 3JB9I 2KBTA 4L5GA 1Q7YC 3META 4R0KA 4C92B 1D0XA 4DBRA 2BIVA 2CT4A 1WQWA 4JJDA 2VXEA 4KH0B 5KYUB 2KRMA 4HVUA 3PGGA 3UATA 1GBQA 4CI0C 3NFCA 3ZFJA 1O75A 1M1KU 2B86A 3AT1B 3VS6A 1V29B 1RAIB 2YSQA 4RUGA 4C92A 1IXDA 2DL4A 5M9OA 1VQOQ 1RLPC 2EQKA 3OBWA 1M2OA 3OB9A 1VQ6A 5KYUA 2HDAA 1M90U 2KYMA 1Y0MA 4JRQA 3CCMT 1M1FA 4Y91A 5LJ3e 1K0XA 1D0ZA 2DM1A 1EX4A 1IGUA 2LMJA 2EQIA 4C8QB 5GMKi 3OW2P 2FPDA 5LJ5h 4E6RA 1VQPT 4F16A 3OSVA 4PJJA 5FWBA 3LWIA 4M7DD 3L2ZA 3A8HB 4CC3A 4BDZA 3RUXA 2R57A 4OMOA 4RKUE 4C8QA 4GY5A 5KE3A 2ATCB 2MIOA 4ZGJB 4HKEA 3GF5A 4BACA 3MP1A 1Q82R 2CUDA 2F2XA 2L3QA 4ZN3A 3BFMA 4M7AB 4M7DE 5IH2A 2ZGWA 1VQKT 3JB9D 5CKEA 1FMVA 1BI1A 1X01A 4KULA 4O5VA 1TUCA 4PLLA 3REBB 3L2WA 4J9BA 4JS4A 1VQNT 4A4HA 2EJ9A 1Y07A 4J9FA 3EGUA 4JJNK 4RTVA 1XQHA 3FC3A 1PM3A 3TVTA 2PUKB 4FM4B 2LRQA 3JB9H 3CPWA 4M7AA 1TWBA 2HSEB 1K8AU 1GCQC 2JMCA 1G3SA 3NTKA 5IN1A 1OQKA 2BKDN 3VJPA 2KR3A 4M7DG 1RUWA 4E7ZA 1X6GA 1UGSB 2K9GA 1VQOA 3GNFB 2CZ7B 1VQ8A 3TEEA 2FZGB 1WLPB 1TOVA 3EAEA 1P92A 4GBQA 2PTKA 1BB9A 5D6WA 1KD1U 2BZ8A 2DD4A 1M1KR 2CP7A 3EFSA 4EMKB 2D9TA 2EYYA 4CC7A 1N8RC 3JCMd 3PMTA 2SRCA 1MMGA 5C6SA 2EJFA 3OYJA 1VQMA 3MP8A 2LTOA 2EVRA 4RMOA 1H8KA 1MMAA 1RABB 1FMWA 3GNGA 1IZ6A 2GBQA 3JB9G 1OX8A 1ZA1B 4EMKA 1SSFA 2KMTA 2A0FB 2LX9A 2RPNA 4J8OA 1YCSB 5KCHA 4M77B 4AFSC 1K73R 4MDXA 1WXUA 2BZXA 4PFZA 1PWTA 2VWFA 3I56A 4LDYA 2RI2A 3L42A 1YIJQ 2XDBA 1GXIE 2EKOA 2HQXA 3PVQA 5FU6B 1JJ2A 1LVKA 2HCKA 4C0GA 1NJIR 2C06A 3OYMA 3G4SQ 2DYBA 2O2OA 3EG2A 3VV0A 4M77A 4ZTJA 1YN8A 1WHMA 4Y28E 1R77A 1RI9A 1M3AA 1AD5A 3BW1A 5GJVB 1QKWA 1FXXA 5GAOq 3PFSA 2DZ9A 4A63B 2I2LA 3EH1A 4PLIA 3EHQA 3JCMQ 2AIRB 2Z0WA 2LCLA 3NGPA 1MMNA 1SKUB 3HRUA 1QVGA 3JCMc 3CMEQ 1R0CB 4B9XA 4XAXB 2IVWA 2F69A 2G6FX 2J6OA 1K8AR 1RAEB 1KJWA 4E7HA 3M4GA 4M75B 2R5AA 3FB9A 3CCJQ 3VUZA 1QWFA 5KYNA 4MZMA 3CXCS 2QGGA 1I07A 1H3HA 2X9HA 2A28A 1KQ2A 3CD6T 1KD1R 2LT1A 2VVKA 2DVEA 3RNJA 5I21A 4AFQC 1YHQQ 1UDLA 2KROA 4M75A 2LQNA 2G3RA 1WDXA 1YI2T 1AOJA 2KXDA 1BU1A 5GMKh 4A54A 1YJNQ 3M54A 1YJWT 3OYYA 3PT9A 5FROA 3CPWS 1JB0E 3NTHA 2FEIA 3U23A 2DXBA 3OYHA 2A37A 4OB3B 1MMDA 2DL5A 4F7UF 2R5MA 2LC4A 4M78F 2JJ9A 1YIJA 2XI9A 2QQAA 3OYCA 2EIFA 3M0SA 2CP3A 3BE3A 1CKBA 1Q86U 2C0OA 2AKKA 2QI2A 5LJ3d 3G4SA 2GQIA 3GOXA 5LJ5f 3C95A 3PIOA 3CCVQ 2DKGA 4MZPA 5CKHA 2X3XD 1AHJB 5AT1B 3M59A 3SWNC 5I2MA 5J3BA 1WX6A 4QT7A 3D7SB 1E6HA 1I5OB 1UG1A 1YNZA 2RF0A 2CSIA 3H9NA 4J6XA 2LVMA 1X69A 3A8OB 4A53A 4E7JA 1EFNA 2JMAA 3E19A 5KH6A 4XQ3A 1QWEA 4Z8AA 5GAN8 5DY9A 3LH0A 3ASKA 1HD3A 4RG8A 3JV3A 1VQLQ 4PJOC 2FZKB 4EMGA 2DRKA 3CC7Q 1G2BA 1UHFA 1TS9A 3REAB 2O4XB 4FU6A 2NUTB 2DXTA 3PNWC 3L2VA 2MMPA 5A0DA 1WHKA 3CCUQ 1UFFA 2QEXT 2LNVA 2FPEA 1D09B 1GBRA 1YCYA 4J9GA 5GANd 2BTTA 4FSSA 3VUBA 1FX7A 5A2QE 8ATCB 3HL8A 3I55Q 1XTDA 3CCLQ 2O4XA 2NUTA 1YITA 1Q82C 1YJNA 1VQ7Q 5GANj 2PU9B 3JAME 3A8LB 2K3XA 3H0FA 4ELYC 1ACMB 4EPCA 4IUPA 2HBWA 1IHVA 1OU8A 1PD0A 4PJLA 2D0NA 1RLQC 5ECAA 3G6EA 1LCKA 1QVGS 1VYUA 4M78D 1ZA2B 1N5ZA 3A98A 2YWWA 1SRLA 1OEBA 1PRMC 5I11A 2O88A 1PNJA 3I5SA 1C0MA 4A4KA 3MPUB 5CQYA 2E64A 3RKXA 1Q86R 2V8KA 1MHNA 4M75F 4QVDA 1VQ5Q 2HAXA 3EGDB 4JJBA 1HJDA 4F7UE 4M78E 2VUBA 1VQ6T 4X9CA 4LD9K 4BI3A 4C0FA 2DFUA 1GCQA 4J6WA 2HQEA 2CT3A 4M77C 1VQLA 2MI6A 2YXYA 2JOYA 3A5ZB 2EBPA 2RQRA 4LUEA 3VYGA 2XD0A 3EGDA 1ZBXA 3QZ5B 2E4HA 3H41A 1G8XA 4KH1B 2EW3A 4JLIA 5LJ5e 2COYA 2D0QB 2OTJQ 4FYVB 4F7UG 4M78G 3RERA 2PVOB 2RB6A 3CCSA 4RTXA 2K5IA 2SEMA 4OB2B 4CRIA 1GCPA 2KY9A 2RHXA 1YJ9Q 2QYZA 2MOXA 2MAMA 2BE7D 3I55A 1K73C 2ZAEA 4MZTA 1IREB 1D0YA 2GFUA 2E10A 5DLQE 2F2VA 2KXCA 4JS5A 2BZYA 5GAOr 3OYEA 1NJIC 2LX7A 1VQ4Q 2K3YA 2A08A 4DBQA 3G71Q 3OSSC 3QYHB 2DTOA 1IHWA 3X20B 3CC4Q 3KFVA 3DKMA 4J7FA 2JTMA 4J9HA 2QEXA 3QWXX 3E9GA 1UHCA 5IXFA 1B3QA 2QQBA 3C12A 1TUDA 4FYWB 3TREA 2DPPB 2V1RA 5GMKl 4KUDK 1QMCA 4CC4B 1VQOT 1VQ8T 1J3TA 1UECA 3NTIA 2JW4A 1Y7XA 2HD0A 4M75D 2M1HA 2KT8A 1RAAB 3C94A 3MO8A 3VRZA 2LCSA 2PUOB 4ZTFA 1K8AC 1TH7A 5J39A 2AZVA 2HL3A 4M4ZA 4DA4A 3QSUA 2NUZA 1BCMA 1VQMT 2NLUA 2RJCA 1PRLC 1N9SA 3LGFA 2GNCA 2EYQA 2K5FA 1AZGB 1E6GA 1GRIA 1KD1C 3FLGA 2EPDA 4M75E 1VUBA 1BK2A 2ED0A 2XICA 4IUTA 5CKFA 2KDSA 1U3OA 1FWZA 5A0LA 4D6WA 4N4HA 3NPFA 2X4YA 3P8HA 1K0SA 2ZPBB 2F1LA 5HKCA 1MV0B 2RJDA 3N5BB 2BUDA 2EAYA 3I56T 2OTLA 5I22A 1PCXA 2COWA 1PKSA 2AHJB 1LOJA 2A36A 4KGVB 2EFIA 2E70A 3EG3A 4J9IA 1KC8U 5J26A
chains in the Genus database with same CATH topology
4QW2A 4OF1A 4V2SA 1PSEA 2FVUA 3SWNB 3I56A 3CCLA 4LDYA 2RI2A 3L42A 4J7IA 2XDBA 5IT9E 1GXIE 2EKOA 1S72A 2HQXA 2EQJA 5FU6B 3HRSA 2JZ2A 2LCCA 3MEWA 3V8LA 4C0GA 2WSCE 1JJ2A 1VQ7A 3OW2A 2C06A 2JTFA 2QTXA 3OYMA 3QZ9B 4M7DB 1H641 2RK1A 4XTUA 3VV0A 4M77A 4JLGA 4ZTJA 3SDZA 2EQMA 3JSCA 4Y28E 4PJOD 4M77E 3A8GB 2JUFA 1Y71A 3BW1A 3M55A 5CK9A 3URGA 4PJOB 2QQRA 4P5NA 3MEUA 3SWNA 3ZBDA 2XIDA 1G3TA 2DO3A 1QW1A 3HFNA 1FXXA 5GAOq 4IKFA 2WSEE 3PFSA 1UB4A 2DZ9A 3M56A 3TU4K 3VYHB 5LL6S 2RO0A 2I2LA 3QHSA 1R8OB 3BY7A 4PLIA 4M7AC 3JCMQ 2XKOC 3L2RA 2LCLA 4QVCA 2GCXA 1WJRA 3H6ZA 4X34A 2K5LA 4LD6A 4BE1A 2X35A 3JCMJ 4E7LA 3C4SA 3HRUA 3TCJA 2VGMA 3SD4A 3QYGB 4BD3A 3OA6A 1QVGA 4BY6B 3MP6A 3JCMc 3DB3A 3JCMW 4PJOA 2L3RA 4VUBA 2HBPA 3OS1A 3HPWA 3BDLA 3OMGA 4BDYA 4PJOE 4B9XA 4E7KA 4XAXB 2IVWA 5GANf 4M77G 2F69A 1VQ5A 2E5QA 2LQKA 1U1SA 3KXTA 4OGEA 2X4XA 3LGLA 5IAYA 4E7HA 3M4GA 3OYDA 3UT1A 2JNGA 1M8VA 3F70A 2R5AA 4M75B 1Q82U 2KSSA 5CIUA 3FB9A 5GMKj 5GAMd 3VUZA 2GFAA 3GP8A 2DJZA 1QVFA 2OTJT 3GIBA 3UWNA 5GAN2 1UGQB 2KVQG 2JN0A 4ME7A 3CCRT 2RK2A 3LW5E 2GF7A 3H8ZA 3MEVA 4MZMA 5EG2A 3CXCS 2QQSA 1Q81C 2VYTA 4J5YA 5FLXE 1YJ9T 1Q81U 3PIPA 1KQ2A 1O9SA 2CS7A 5GMKe 3CD6T 1WQ7A 5GAMg 4Q5WA 2P0PA 1UEBA 1BIBA 1KQ1A 4JUVA 3V7CA 1VQ9T 1WNLA 4C5EA 5GAMj 3KBGA 1LJOA 2XDPA 2LT1A 1YIJT 1G3WA 2XG8D 4J83A 2M16A 4XTWA 2DVEA 3RESA 5I21A 4PJOG 2Y90A 5HK0A 3CBPA 3SB2A 5CVIA 4ATOA 4M75A 4EMKC 2G3RA 3QG1A 1YI2T 3VU3C 1I8FA 1D3BB 2OTJA 1BKBA 1NPPA 1WJQA 3ME9A 3G4ST 5GMKh 4A54A 3LLRA 4L6V5 5GAMe 3M54A 3CCRA 1YJWT 2L5QA 3OYYA 3PT9A 5FROA 3CPWS 1JB0E 2CZ6B 3OYFA 3NTHA 3QKJA 3JCMb 1YJ9A 2DXBA 2O01E 3OYHA 4QQGA 1BI2A 3WXMB 3CD6A 1BYMA 4OB3B 1Q7YU 4RG2A 1B34B 2F5KA 5L8RE 2RJFA 2RHUA 1VQ4T 4F7UF 2R5MA 1VQ9A 2LC4A 2P0KA 2FB7A 4M78F 4OGCA 2HNIA 3JCMg 4LDWA 3VKIA 1YIJA 2XI9A 2DTIA 2QQAA 2EIFA 3M57A 4XU3A 1OZ2A 4A4EA 5HK3A 3OYCA 5GAMh 3WVEB 5LJ5d 3G71T 2EJGA 3CXCA 1Q86C 1QP3A 2KQWA 1Q86U 2CZ0B 5I2SA 1YI2A 1D3BA 2QI2A 1KQSS 5LJ3d 3G4SA 3CC4T 2RM4A 3GOXA 1YJWA 5LJ5f 5D6YA 3OS2A 1I4K1 3C95A 3RKWA 3PIOA 2DKGA 3HKSA 4MMKA 4JRKA 5LJ5g 2XDDA 4MZPA 3JCMe 3EFRA 4M75G 4N4IA 4N4GA 5CKHA 4C92F 2M9UA 1B34A 3MHXA 4IUQA 4RCCA 5LJ3g 2ZPGB 1KC8C 1W4SA 3HHTB 3JCMP 1AHJB 1VQ4A 2A7YA 3GPLA 3M59A 2RD1A 3SWNC 4PNOA 3OYGA 4Z02A 5I2MA 5J3BA 5GAN3 3JB9J 1U8RA 1BIAA 1M1GA 4BUGA 2PVGB 3G71A 3QJ6A 3V8KA 3OY9A 4JRPA 3M9QA 5FU6C 2MWOA 3HRTA 2VC8A 4J6XA 2LVMA 2ZPIB 3A8OB 4FL6A 4YTLA 3JCMh 4A53A 4BE0A 1NPRA 3CEYA 1K9MU 4E7JA 2XHCA 4M7DC 4ELZC 5CO7A 3E19A 5KH6A 5GMKm 2E12A 3E1SA 3PTAA 3ZEHA 3JCMV 2DZCA 4XQ3A 2RI5A 5GAN8 2E41A 3FEOA 4N0AA 2DAQA 1JBMA 2XU8A 3ASKA 3LH0A 3OBYA 4RG8A 5DY9A 3QDRB 4KUIA 4PJOC 4II1A 2CYZB 2DD5A 2CZ1B 4GLKA 2V8IA 4DOVA 4EMGA 4E47A 2RHIA 5FU7B 4OB0B 2ZPFB 1NZ9A 1K73U 5LJ3h 3M4YA 3HFOA 1XNIA 1BI0A 2O4XB 4FU6A 4LDXA 2WACA 2DXTA 3QBYA 5AYFA 4MMLA 3JCMX 3PNWC 1YITT 3OYNA 3L2VA 4JRIA 4XU2A 1YJNT 2MMPA 1HXDA 1OZ3A 5A0DA 4FT2A 5DM7R 4C8QF 2LNVA 2QEXT 3OW2S 1NJIU 4C5IA 5CAIA 1H3ZA 1YCYA 1ZHIA 4QQDA 4IURA 4RCBA 5GANd 2EWNA 4C0DB 2QXFA 3VUBA 3OYBA 1FX7A 4WF2A 5A2QE 3E9FA 3G6ET 3RMQA 1WGSA 3HL8A 5A0GA 3CCET 1XTDA 3ER0A 2RI3A 3JRZA 2O4XA 3GLXA 2ZPEB 1UGRB 4E7IA 5GANg 3R6OA 4M7DF 4X9DA 1YITA 5KCOA 3L1AA 2H3JA 4M75C 4XTVA 4EMHA 2E1HA 2VXFA 5FRNA 1Q82C 3L2UA 4ZN1A 1YJNA 5GANj 2PU9B 4DQ2A 1M9SA 1KHIA 1VIFA 3A8LB 3QO3A 2OAUA 5HY6A 3JAME 2P0QA 3OS5A 2K3XA 3X24B 4ELYC 2WSFE 1YBYA 4IUPA 1UGPB 4EPCA 3OYIA 4KT0E 2DIGA 2Y4YA 3X26B 2RA2A 5GANe 4HA8A 3Q1JA 3G7ZA 3G6EA 2F5TX 5GAOm 3CCEA 1QVGS 1EIFA 2RHZA 3HSBA 2RH2A 4M78D 2KAFA 2P4TA 4FSXA 1KHCA 3V8JA 4PL6A 3OYAA 4F7UB 4HCCA 4J6YA 4M78B 4M7AF 2FL7A 4XU1A 2QA4T 5DLOA 4M7AE 1VIEA 4ZGDB 3O8VA 5GANh 3PMIA 4JDSA 1QVFS 4ZGEB 3JB9I 4A4KA 1W2BA 2MF2A 1VQLT 2VGNA 4L5GA 4C92D 1Q7YC 5CQYA 2E64A 3META 3RKXA 5GAN4 4QVZA 4C92B 3QJYA 2V8KA 3SFMA 1MHNA 4C5HA 4LDVA 2BIVA 4M75F 4F7UA 4QVDA 4M78A 3OYLA 1K9MC 2HAXA 5KE2A 1WQWA 4R55A 2VXEA 4F7UE 2QA4A 4M78E 2QDYB 4NS5A 5GAOn 2VUBA 3OS0A 1VQ6T 4X9CA 3WVDB 4PKCC 4LD9K 4BI3A 3AHUA 3PGGA 3S6WA 3LYIA 4C0FA 3CBMA 3LWHA 4J6WA 4O6JA 2D6FA 3INZA 4CI0C 3NFCA 2HQEA 4LDUA 4M77C 1O75A 4N0AC 2JVVA 3ZFJA 3CCQT 3CCST 1M1KU 1VQLA 2MI6A 1V29B 2V8JA 3CMET 2JOYA 5LJ5j 3A5ZB 4C92A 1X6OA 2L89A 5M9OA 1JRIA 4C92E 3I55T 5LJ3j 2EQKA 3OBWA 3VYGA 2XD0A 1G5VA 3UPUA 1ZBXA 2DXCA 2LT4A 3QZ5B 3OB9A 1VQ6A 3S3NA 4JLIA 4XTYA 5LJ5e 1M90U 2M0OA 4BI4A 2D0QB 4JRQA 3X25B 3CCMT 2DTHA 1I81A 1M1FA 4Y91A 4F7UG 5LJ3e 3CCJT 1M4ZA 4M78G 3RERA 4BE2A 3CBOA 3CPFA 2PVOB 3CCQA 2RB6A 4C8QD 3CCSA 4KBMB 3V7RA 2K5IA 4OB2B 4CRIA 2KY9A 2RHXA 3LX7A 3CMEA 4L59A 1N6AA 5D6XA 4C8QB 3KUFA 5GAOp 5FU7C 5GMKi 2MAMA 4C5GA 5LJ5h 3I55A 2X4WA 1VQPT 1PSFA 1K73C 3DB4A 4MZTA 2DK3A 3OSVA 3X28B 1IREB 2R58A 3FIFA 3RIRA 4OMFB 1N27A 2GFUA 3LWIA 2E10A 4C92G 1YHQT 4M7DD 3L2ZA 3A8HB 2K2VA 3CCMA 5DLQE 3UDCA 4BDZA 3CCJA 4HCZA 2EQUA 2YRVA 3OMCA 4JS5A 3RUXA 5C0MA 2R57A 4M77F 5GAOr 3CMAT 4FIBA 1JJ2S 3V7SA 3OYEA 1NJIC 1N9RA 4RKUE 2QQ9A 4BY6C 4C0DC 4C8QA 4GY5A 5KE3A 2PVDB 4ZGJB 1XOVA 4C8QE 3L2QA 1VQPA 4HKEA 2K3YA 2B8AA 2E6NA 2YLBA 3GF5A 5GAN7 4BACA 3M58A 4UC4A 4B9WA 5CKDA 3MP1A 4NL3A 4MDWA 4IUVA 1VQ5T 1DJ7B 1YHQA 3OSSC 2DXUA 1OI1A 4XU0A 3QYHB 2DTOA 5CR2A 2RJEA 4M7AD 3X20B 1I5LA 2IG0A 4ZN3A 4FT4A 4HT9A 3BFMA 4M7DA 3J7AF 3CMAA 3J80E 4OP0A 3CC2T 4M7AB 4M7DE 3FDRA 4IUUA 3DKMA 2ZGWA 2JTMA 4J7FA 3RKYA 3BDUA 2QEXA 4A4FA 1LNXA 3CCVT 4BB7A 3OQ5A 3JB9D 1VQKT 3E9GA 4PJOF 4M7AG 2PQWA 5CKEA 1X01A 1BI1A 3P8BB 4KULA 2QQBA 4O5VA 3C12A 4PLLA 3L2WA 1OYXA 3TREA 1U1TA 2DPPB 2ZPHB 5GMKl 4JS4A 5CQXA 4KUDK 1VQNT 1VQOT 4A4HA 1VQ8T 2EJ9A 3NTIA 1Y96B 1Y07A 1Y7XA 4M78C 4C8QG 4OVAA 2HD0A 4TVRA 4M75D 4JJNK 1QVPA 1XQHA 2M1HA 3DLLA 3FC3A 3C94A 2KK4A 4OB1B 3MO8A 2PUKB 3T9NA 4FM4B 2LRQA 4QQ6A 3JB9H 3M53A 3CC2A 3CPWA 2RHYA 2ZCFB 3QIIA 4M7AA 2ZZDA 2PUOB 4ZTFA 1K8AC 1RL2A 2E6ZA 1K8AU 4DOWA 1TH7A 3S3MA 3HP9A 3CCVA 5J39A 2FHDA 3QXEB 1VQKA 3NTKA 1G3SA 4DA4A 3QSUA 5IN1A 2BKDN 3VJPA 3OYKA 5GAMf 4XK8E 1BI3A 2LQ8A 2MWPA 4M7DG 1VQMT 2NLUA 5GAN6 4C92C 1UGSB 1VQNA 1VQOA 2RJCA 2L8DA 2CZ7B 3GNFB 1N9SA 1VQ8A 3TEEA 3LGFA 3CC7T 1Y96A 2EYQA 3EAEA 1P92A 2K5FA 3A8MB 3M5AA 4BI8B 3S3OA 1KQSA 1WPYA 3MEAA 5CKBA 2OTLT 4NOYA 4A4GA 1MGQA 1WJSA 2Y4XA 5D6WA 4C0ZA 4R56A 2E65A 3FLGA 3J81E 1KD1U 1KD1C 4M75E 2DD4A 1VUBA 3EFSA 4EMKB 2D9TA 1N8RC 2XICA 1N8RU 4IUTA 5CKFA 3JCMd 2KDSA 3PMTA 1FWZA 3CCUT 2A3LA 5A0LA 4XTZA 4D6WA 3JB9F 4XTXA 5C6SA 2EJFA 4N4HA 3OYJA 1VQMA 1M1KC 3MP8A 2LTOA 2X4JA 2X4YA 3FJPA 3P8HA 3JCMf 2LDMA 5GAN5 4RMOA 1ZQ1A 3CC7A 2GQVA 2ZPBB 4NL2A 1W2BS 3GNGA 1IZ6A 5HKCA 5CCAA 1G3YA 2RJDA 3N5BB 2BUDA 2DEQA 2EAYA 3I56T 3JB9G 3CCLT 2OTLA 4HT8A 3FRNA 3QUIA 3DLMA 2K4YA 2YHTA 1S72T 1M90C 4EMKA 2K57A 3CC4A 1M5Q1 1SSFA 3RMSA 5GAOl 1VQ7T 2KMTA 2DIQA 2XK0A 3CCUA 2AHJB 2FYKA 1LOJA 1HK9A 2EFIA 4M77D 1QP2A 2LX9A 5LJ3f 2VV5A 2YLCA 1RI0A 3QPHA 3MCAB 1KG1A 3P8DA 4J8OA 2CKKA 4C8QC 4HCBA 2E70A 4M77B 5KCHA 4EDUA 1X75C 2CGHA 5J26A 1KC8U 4MDXA 1NE8A 5FRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3Y A;  2B8A A;  2E6N A;  2RJF A;  2RHU A;  4QW2 A;  2RHZ A;  2R5M A;  4UC4 A;  4B9W A;  2P0K A;  3MP1 A;  4BAC A;  4IUV A;  1KHC A;  4A4E A;  3OYC A;  2RI2 A;  3L42 A;  1OZ2 A;  4PL6 A;  3OYA A;  1OI1 A;  2EKO A;  2HQX A;  2EQJ A;  2RJE A;  2JZ2 A;  2LCC A;  2IG0 A;  3MEW A;  2JTF A;  3OYM A;  3GOX A;  3O8V A;  5D6Y A;  3FDR A;  4IUU A;  3OS2 A;  3PMI A;  4A4F A;  3OQ5 A;  4ZTJ A;  3E9G A;  4N4I A;  2EQM A;  4N4G A;  2PQW A;  4IUQ A;  4PLL A;  3L2W A;  1OYX A;  3MET A;  2QQR A;  4QVZ A;  3OYG A;  3MEU A;  4Z02 A;  4A4H A;  1H3Z A;  1MHN A;  4C5H A;  3NTI A;  2BIV A;  4IKF A;  3QJ6 A;  4OVA A;  3OYL A;  3PFS A;  3OY9 A;  5KE2 A;  2M1H A;  3M9Q A;  2MWO A;  3FC3 A;  4NS5 A;  3MO8 A;  2LVM A;  2RO0 A;  2LRQ A;  4FL6 A;  4QQ6 A;  3OS0 A;  4BE0 A;  4PLI A;  3CEY A;  4E7J A;  2RHY A;  3QII A;  4ZTF A;  5KH6 A;  3L2R A;  3S6W A;  3LYI A;  3ZEH A;  3S3M A;  1WJR A;  5J39 A;  2FHD A;  3H6Z A;  3NTK A;  4X34 A;  4LD6 A;  5IN1 A;  4BE1 A;  2X35 A;  2RI5 A;  2BKD N;  2HQE A;  3C4S A;  3FEO A;  4BD3 A;  3OYK A;  2DAQ A;  3SD4 A;  3LH0 A;  3ASK A;  3OA6 A;  2MWP A;  3MP6 A;  4II1 A;  2NLU A;  3DB3 A;  2L3R A;  3OS1 A;  3OMG A;  2L89 A;  2RJC A;  2L8D A;  3BDL A;  4BDY A;  4B9X A;  3LGF A;  4E7K A;  2RHI A;  5M9O A;  2E5Q A;  2EQK A;  1G5V A;  3EAE A;  3S3O A;  1XNI A;  3MEA A;  2O4X B;  2X4X A;  3LGL A;  3OB9 A;  4FU6 A;  5IAY A;  4A4G A;  4E7H A;  1WJS A;  3S3N A;  5FRM A;  5D6W A;  3OYD A;  3FLG A;  2WAC A;  3QBY A;  3UT1 A;  3F70 A;  2R5A A;  3PNW C;  2M0O A;  3OYN A;  5CIU A;  3L2V A;  2D9T A;  2GFA A;  1OZ3 A;  4IUT A;  3UWN A;  3PMT A;  4BE2 A;  4E7L A;  4C5I A;  3MEV A;  2GF7 A;  3H8Z A;  4N4H A;  4CRI A;  5C6S A;  3OYJ A;  2QQS A;  2RHX A;  3LX7 A;  2VYT A;  3MP8 A;  4IUR A;  4L59 A;  2LTO A;  2X4Y A;  3P8H A;  4QQD A;  5D6X A;  3KUF A;  2LDM A;  3OYB A;  4Q5W A;  3E9F A;  4C5G A;  2X4W A;  2RJD A;  3DB4 A;  2BUD A;  1WGS A;  4C5E A;  2RI3 A;  2XDP A;  2O4X A;  2R58 A;  4E7I A;  2M16 A;  1N27 A;  2GFU A;  5KCO A;  3DLM A;  5FRN A;  2G3R A;  4BDZ A;  3L2U A;  4HCZ A;  1SSF A;  2EQU A;  2YRV A;  3OMC A;  1WJQ A;  3ME9 A;  5C0M A;  2DIQ A;  2XK0 A;  2R57 A;  3LLR A;  2K3X A;  2EFI A;  5FRO A;  3OYF A;  3OYE A;  1RI0 A;  3NTH A;  3P8D A;  3QKJ A;  2CKK A;  4IUP A;  5KCH A;  4GY5 A;  5KE3 A;  4QQG A;  3OYH A;  2DIG A;  4EDU A;  3OYI A;  5J26 A;  4RG2 A;  3Q1J A;  3L2Q A;  2F5K A; 
#chains in the Genus database with same CATH topology
 4QW2 A;  4V2S A;  3SWN B;  1VQ9 Q;  1NYG A;  2DL3 A;  5IT9 E;  1OPL A;  1UE9 A;  2QA4 Q;  2EQJ A;  3HRS A;  2JZ2 A;  2LCC A;  8AT1 B;  1NG2 A;  1H64 1;  2DVJ A;  2DLP A;  2EQM A;  1K4U S;  4HVW A;  5CK9 A;  4PJO B;  2K3B A;  3SWN A;  3ZBD A;  2XID A;  1G3T A;  1QW1 A;  2CP5 A;  3VYH B;  4OML A;  3RBB B;  3QHS A;  3BY7 A;  2AZS A;  4BE1 A;  1PHT A;  4E7L A;  3C4S A;  2W0Z A;  3TCJ A;  4BD3 A;  3HTR A;  3QYG B;  4PJO A;  3JCM W;  2L3R A;  1K1Z A;  3HPW A;  3OMG A;  2LJ1 A;  4BDY A;  4E7K A;  4D8K A;  1AWW A;  4FYX B;  3NMZ C;  2LQK A;  1U1S A;  4OMM A;  2X4X A;  5GJW B;  1YP5 A;  1RAC B;  1M8V A;  5FW9 A;  5CIU A;  5GAM d;  1WIE A;  3GP8 A;  1QVF A;  5GAN 2;  2KVQ G;  2LJ3 A;  4ME7 A;  4F14 A;  2RK2 A;  3I5R A;  4J5Y A;  2CS7 A;  5GMK e;  2GTO A;  1QCF A;  4Q5W A;  1BIB A;  1KQ1 A;  3A1P A;  4ESR A;  2DX1 A;  5GAM j;  1LJO A;  1YIJ T;  1HYO A;  4J83 A;  4IIM A;  3H0I A;  5CVI A;  1AT1 B;  1TXQ A;  3VU3 C;  1D3B B;  3G4S T;  4L6V 5;  1RAF B;  2L5Q A;  1Q7Y U;  4RG2 A;  1B34 B;  2RJF A;  3RR6 A;  1VQ9 A;  1UGV A;  4LDW A;  1M90 R;  3E2U A;  4A4E A;  4XU3 A;  5LJ5 d;  2EJG A;  1Q86 C;  1EZZ B;  1QP3 A;  2KQW A;  2CZ0 B;  5I2S A;  1MUZ A;  1D3B A;  1SF9 A;  5D6Y A;  1G83 A;  3RKW A;  3HKS A;  1VQK Q;  4N4G A;  4AFZ C;  4C92 F;  2M9U A;  1QCO A;  1B34 A;  1T3S A;  2ZPG B;  2XMF A;  3PE0 A;  5HCK A;  2A7Y A;  3GPL A;  1NEG A;  1VQN Q;  4Z02 A;  3MJX A;  1V76 A;  1BIA A;  2J05 A;  3QJ6 A;  1OPK A;  3M9Q A;  3HRT A;  4YTL A;  1K9M U;  2H3E B;  1VYT A;  5CO7 A;  5GMK m;  3PTA A;  3JCM V;  1T0J A;  4JJC A;  1NBE B;  1WFW A;  2XU8 A;  1OV3 A;  4II1 A;  2DD5 A;  5EC7 A;  2CZ1 B;  4HXJ A;  2DBK A;  2KEA A;  5LJ3 h;  4FCY A;  1RAD B;  4LDX A;  1WXB A;  2D1X A;  2WAC A;  3QBY A;  1YIT T;  4MML A;  1JO8 A;  4LN2 A;  3OYN A;  4XU2 A;  4CC2 A;  1YJN T;  1OZ3 A;  2DJQ A;  2KRS A;  4FT2 A;  4OMN A;  4C8Q F;  1X43 A;  3CCQ Q;  3VRY A;  3GBQ A;  4QQD A;  4RCB A;  3MKD A;  3E9F A;  1WXT A;  1JXO A;  3CXC P;  3G6E T;  1WGS A;  3JRZ A;  1BCO A;  4X9D A;  5KCO A;  4XTV A;  4EMH A;  2VXF A;  2CDT A;  4DQ2 A;  1VIF A;  5HY6 A;  1WHL A;  2OAU A;  4EIK A;  2YDL A;  3UF4 A;  1IRX A;  1D1C A;  2WSF E;  2DIG A;  3VS7 A;  4HA8 A;  3CPW P;  3G7Z A;  2JTE A;  2F5T X;  3HSB A;  2RHZ A;  2K79 A;  2KAF A;  4FSX A;  1I1J A;  5IHK A;  3OYA A;  2EGA A;  4HCC A;  1ZSG A;  4M7A F;  4DBH A;  3LH5 A;  1W6X A;  5DLO A;  2V26 A;  2DL7 A;  2P4R A;  2YRC A;  1ABQ A;  5GAN h;  3CMA Q;  4JDS A;  1QVF S;  1W2B A;  1VQL T;  4C92 D;  5GAN 4;  4QVZ A;  3QJY A;  3SFM A;  3OYL A;  4R55 A;  2ROL A;  4NS5 A;  1JQQ A;  5GAO n;  3OS0 A;  1PG5 B;  4PKC C;  3CC2 Q;  2KRN A;  2YUN A;  2NYS A;  1ABO A;  2JM8 A;  4Z88 A;  2D6F A;  1KSW A;  4LDU A;  2JVV A;  3CCS T;  2CUB A;  5KYY A;  2V8J A;  5D7U A;  1X6O A;  4ZNX A;  1JRI A;  4C92 E;  1K9M R;  3I55 T;  5LJ3 j;  1G5V A;  1VA7 A;  2ESW A;  2DXC A;  2LT4 A;  3S3N A;  4AMC A;  4BI4 A;  1D1A A;  2O9S A;  3X25 B;  2DTH A;  3CCQ A;  4WCI A;  4C8Q D;  4LNP A;  3CME A;  5D6X A;  3EG9 B;  2ENM A;  5GAO p;  5FU7 C;  2OX7 A;  2X4W A;  2QTV A;  1GL5 A;  2R58 A;  4OMF B;  4C92 G;  1YI2 Q;  3CCJ A;  2DE0 X;  2OI3 A;  4HCZ A;  4KRT A;  2EQU A;  2QAS A;  4M77 F;  1YJW Q;  1M30 A;  1JJ2 S;  1N9R A;  2QQ9 A;  3EG9 A;  1XOV A;  4C8Q E;  3L2Q A;  3G1J A;  2QAZ A;  2YRD A;  2YLB A;  2B8A A;  4UC4 A;  3QWY A;  4IUV A;  4AG1 C;  1WYX A;  1VQ5 T;  1DJ7 B;  1ZBJ A;  1YHQ A;  2DXU A;  4XU0 A;  1QVG P;  2DL8 A;  5CR2 A;  2RJE A;  4M7A D;  2FRW A;  1S72 Q;  2IG0 A;  1I5L A;  4FT4 A;  4HT9 A;  1K76 A;  4M7D A;  3J7A F;  2HZY A;  3J80 E;  3CMA A;  4OP0 A;  3RKY A;  1F1B B;  1LNX A;  3OQ5 A;  2HQH A;  1SRM A;  1OYX A;  1U1T A;  5CQX A;  1Y96 B;  4M78 C;  4C8Q G;  4OVA A;  1NLP C;  1ZX6 A;  3DLL A;  9ATC B;  4QQ6 A;  3CC2 A;  2RHY A;  3QII A;  2ZZD A;  2GTJ A;  1RL2 A;  4M7A E;  3HP9 A;  3CCV A;  2FHD A;  2RNA A;  3OYK A;  4LXC A;  4XK8 E;  1BI3 A;  2LQ8 A;  2MWP A;  2VAS A;  1GFD A;  1Y96 A;  2D8H A;  3A8M B;  4BI8 B;  3S3O A;  1KQS A;  2OTL T;  2FZC B;  4A4G A;  1MGQ A;  1WJS A;  2Y4X A;  4C0Z A;  4R56 A;  3J81 E;  2GGR A;  2C0T A;  2AT1 B;  2J6K A;  4DEX A;  2OAW A;  1UJ0 A;  4XTZ A;  4D8D A;  3QDF A;  4XTX A;  2EGC A;  1S1N A;  1M1K C;  3FJP A;  2X4J A;  4M7A G;  5GAN 5;  1R0B G;  3CC7 A;  2GQV A;  4NL2 A;  1W2B S;  5CCA A;  1G3Y A;  4RTZ A;  4HT8 A;  2P84 A;  2IIM A;  1E7O A;  2K4Y A;  2DA9 A;  2YHT A;  1M90 C;  2K57 A;  4F17 A;  3RMS A;  5IHN A;  2DIQ A;  3CCU A;  1HSQ A;  4M77 D;  1QP2 A;  5LJ3 f;  2YLC A;  1RI0 A;  4JZ4 A;  3CCR Q;  1FYN A;  1KG1 A;  1M8M A;  4EDU A;  1X75 C;  1X2K A;  1NE8 A;  5FRM A;  3CCL A;  4PFP A;  4J7I A;  1S72 A;  1RAG B;  3EG0 A;  3V8L A;  1VQ7 A;  3OW2 A;  1B7T A;  2QTX A;  2DMO A;  3QZ9 B;  2RK1 A;  2DYI A;  4JLG A;  3SDZ A;  3ULR B;  4M77 E;  3M0T A;  2JUF A;  1Y71 A;  3M55 A;  1WHG A;  3URG A;  2QQR A;  1M3B A;  2DO3 A;  3HFN A;  4ORZ A;  4IKF A;  1SHF A;  2WSE E;  3VS0 A;  2AKL A;  3M56 A;  1BBZ A;  4J9D A;  5LL6 S;  2CH4 W;  2XKO C;  3EH2 A;  3L2R A;  4X34 A;  1OU9 A;  2K5L A;  4LD6 A;  2VGM A;  2FRY A;  4BY6 B;  2FO0 A;  3OS1 A;  2HBP A;  4KGX B;  1Z9Q A;  3BDL A;  1VYV A;  2C0I A;  5GAN f;  4M77 G;  1VQ5 A;  2HSP A;  1NM7 A;  4KGZ B;  2J6F A;  3LGL A;  1PKT A;  1A0N B;  3OYD A;  3F70 A;  1Q82 U;  2KSS A;  3UA7 A;  5KYX B;  4AG2 C;  3UWN A;  2JN0 A;  2GF7 A;  3H8Z A;  2QQS A;  1Q81 U;  4B6M A;  5FLX E;  3PIP A;  2JM9 A;  1IB8 A;  2J06 A;  2P0P A;  5IXB A;  4JUV A;  3V7C A;  2E3I A;  1WNL A;  1VQ9 T;  3KBG A;  1G3W A;  4XTW A;  2M16 A;  3RES A;  2CP6 A;  1C6V X;  3CBP A;  4ATO A;  1UUE A;  1ZUK A;  3QG1 A;  2OTJ A;  1I8F A;  5KYX A;  3ME9 A;  3CCR A;  3JB9 F;  4QKU A;  4F04 B;  3I35 A;  1JU5 C;  1YJ9 A;  1T0H A;  4QQG A;  3WXM B;  1BYM A;  1ZSZ C;  2RHU A;  2P0K A;  2X3W D;  3CCE Q;  3M57 A;  1OZ2 A;  1QLY A;  5GAM h;  3WVE B;  4JPB W;  3NHN A;  1KQS S;  2VKN A;  4RTU A;  3VS5 A;  2RM4 A;  1OUL A;  4OMQ A;  3OS2 A;  1I4K 1;  4Y92 A;  1M27 C;  2EGE A;  3EHR A;  4MMK A;  2XDD A;  1X6B A;  1QQJ A;  3EFR A;  4M75 G;  3MHX A;  4IUQ A;  5LJ3 g;  1W4S A;  1VQ4 A;  3EGX B;  1TSF A;  2DRM A;  3OYG A;  5GAN 3;  1VQ8 Q;  1M1G A;  4BUG A;  3G71 A;  3V8K A;  4JRP A;  2MWO A;  2L2P A;  3CC4 A;  3JCM h;  2ZPI B;  1K9M C;  4FL6 A;  4M7D C;  2XHC A;  4ELZ C;  1GFC A;  1UTI A;  2DEU A;  3E1S A;  2DZC A;  4K11 A;  4AFU C;  3FEO A;  3WVD B;  2DAQ A;  1JBM A;  1VQM Q;  3EGX A;  1WHJ A;  3SHW A;  2DNU A;  2V8I A;  4DOV A;  4E47 A;  2CP0 A;  2RHI A;  5FU7 B;  4OB0 B;  1K73 U;  1BI0 A;  4FW2 A;  2KNB B;  3JCM X;  2FG0 A;  2HEQ A;  4JRI A;  5DM7 R;  3SEM A;  3OW2 S;  1NJI U;  1FMK A;  2D8J A;  4C5I A;  2RQT A;  5CAI A;  2ED1 A;  2QXF A;  4RTY A;  1H92 A;  3RMQ A;  5A0G A;  3ER0 A;  2QK0 A;  3I56 Q;  2RI3 A;  3GLX A;  2ZPE B;  4E7I A;  4E7S A;  5GAN g;  4PK4 A;  3L1A A;  1NEB A;  5FRN A;  3L2U A;  4ZN1 A;  2JS2 A;  4J9C A;  3CXC A;  3CCM Q;  3QO3 A;  1Q81 R;  2P0Q A;  3X24 B;  1YBY A;  1UGP B;  2KYB A;  3OYI A;  4KT0 E;  1MND A;  5GAN e;  3CCE A;  1VQP Q;  4PL6 A;  2L0A A;  1Y57 A;  4F7U B;  4RTW A;  1SG5 A;  4M78 B;  2CSQ A;  4XU1 A;  1RAH B;  4ZGD B;  2KT1 A;  1AWO A;  1JXM A;  2MF2 A;  2VGN A;  1SEM A;  1ZLM A;  4C5H A;  4LDV A;  4F7U A;  4M78 A;  5KE2 A;  2QA4 A;  2QDY B;  3FJ5 A;  2I0N A;  3AHU A;  1SHG A;  3S6W A;  3LYI A;  1KC8 R;  3CBM A;  3LWH A;  2ROT A;  4O6J A;  1TTH B;  3INZ A;  4N0A C;  3CCQ T;  5FWC A;  3TSZ A;  3CME T;  5LJ5 j;  2L89 A;  2CH4 A;  5KYW B;  2M0Y A;  2JXB A;  1B07 A;  3M0R A;  3UPU A;  4HVV A;  1U5S A;  1TU0 B;  1AVZ C;  4XTY A;  2BE9 B;  3R6N A;  2YT6 A;  2M0O A;  1KIK A;  1D1B A;  1I81 A;  1V1C A;  3CCJ T;  1M4Z A;  3C0C A;  4BE2 A;  1IO6 A;  3CBO A;  3CPF A;  4KBM B;  3V7R A;  2DBM A;  3LX7 A;  4L59 A;  1N6A A;  2RMO A;  2EKH A;  3KUF A;  5KYW A;  4Z89 A;  1ZUU A;  4C5G A;  1PSF A;  1NYF A;  3DB4 A;  2ECZ A;  2MK5 A;  2DK3 A;  2K7A A;  3X28 B;  3FIF A;  3RIR A;  1WZO A;  1N27 A;  1MV3 A;  1YHQ T;  1TUG B;  2K2V A;  3CCM A;  2LJ0 A;  3UDC A;  2ABL A;  1QCN A;  2YRV A;  2DF6 A;  3OMC A;  5C0M A;  3CMA T;  1I0C A;  4FIB A;  3V7S A;  4BY6 C;  4C0D C;  2PVD B;  2CP2 A;  1VQP A;  2E6N A;  5GAN 7;  3M58 A;  5CKD A;  4AT1 B;  4B9W A;  4NL3 A;  4MDW A;  1OI1 A;  1CKA A;  2QG9 B;  2E5K A;  3CC2 T;  3FDR A;  4IUU A;  3BDU A;  4A4F A;  4IIO A;  4BB7 A;  3CCV T;  2COZ A;  4PJO F;  2RQU A;  2HMA A;  2PQW A;  3P8B B;  4PJM A;  2ZPH B;  2KGT A;  1QVF P;  2FPF A;  4TVR A;  4J9E A;  1QVP A;  4WTO B;  2KK4 A;  4OB1 B;  3T9N A;  2K6D A;  3M53 A;  4X1V A;  2ZCF B;  3ZL7 C;  1XJW B;  2HKN A;  2E6Z A;  4DOW A;  3S3M A;  1M2V B;  1VQK A;  3QXE B;  1Q7Y R;  4ANJ A;  1AEY A;  5GAM f;  2HL5 C;  2X51 A;  5GAN 6;  4C92 C;  1VQN A;  2W10 A;  2L8D A;  5KYY B;  3CC7 T;  3M0U A;  3M5A A;  4HCK A;  1WPY A;  3MEA A;  5CKB A;  4NOY A;  2LZ6 B;  1YIT Q;  2E65 A;  1M2V A;  2JS0 A;  1N8R U;  3CCU T;  2A3L A;  2EYW A;  1AWJ A;  3JCM f;  2LDM A;  1ZQ1 A;  1WI7 A;  3G6E Q;  1ZSZ B;  2DEQ A;  3CCL T;  3FRN A;  3QUI A;  2DER A;  3DLM A;  1S72 T;  1M5Q 1;  5GAO l;  1VQ7 T;  2XK0 A;  1M3C A;  1YWO A;  2FYK A;  1HK9 A;  3VS3 A;  1W70 A;  2VV5 A;  3QPH A;  3MCA B;  3P8D A;  2CKK A;  4C8Q C;  4HCB A;  2V1Q A;  2CGH A;  3CD6 Q;  2M02 A;  1JJ2 P;  1ZSZ A;  4OF1 A;  1PSE A;  2FVU A;  3VS4 A;  1AZE A;  1OX9 A;  2K2M A;  3MEW A;  2WSC E;  2NWM A;  2JTF A;  5IHI A;  4M7D B;  3M0P A;  1NLO C;  4GLM A;  4XTU A;  3JSC A;  2HKQ B;  4PJO D;  2DET A;  3A8G B;  4OMP A;  4P5N A;  3MEU A;  4E2F B;  1UB4 A;  2PZ1 A;  3TU4 K;  2YUO A;  2KE9 A;  2LNH B;  2RO0 A;  1R8O B;  2L3P A;  7AT1 B;  4M7A C;  1IGQ A;  3RDV A;  3TSW A;  3H0H A;  4QVC A;  2GCX A;  1WJR A;  3H6Z A;  3JCM J;  2X35 A;  2MYS A;  2QGF B;  2MPX C;  3CCS Q;  1X27 A;  3SD4 A;  3OA6 A;  3MP6 A;  3DB3 A;  4VUB A;  4PJO E;  2E5Q A;  2KI7 A;  3VS2 A;  1C1A A;  3KXT A;  4OGE A;  2EYX A;  5IAY A;  3UT1 A;  2JNG A;  2OJ2 A;  5GMK j;  2O9V A;  1X2Q A;  2GFA A;  2OTJ T;  2DJZ A;  3GIB A;  1UGQ B;  3CCR T;  5EG2 A;  3LW5 E;  3MEV A;  1Q81 C;  2VYT A;  1YWP A;  1YJ9 T;  1O9S A;  2L3S A;  1WQ7 A;  5GAM g;  1UEB A;  1ZUY A;  4C5E A;  1K9A A;  2XDP A;  2XG8 D;  1N8R R;  2QDL A;  2Y90 A;  4PJO G;  1SSH A;  5HK0 A;  1W2B P;  3SB2 A;  4LE9 A;  4PFO A;  1VOM A;  4EMK C;  1BKB A;  1WJQ A;  1NPP A;  1U8R A;  3LLR A;  1WA7 A;  5GAM e;  2CZ6 B;  2F2W A;  2YUQ A;  3OYF A;  2QEX Q;  3QKJ A;  3JCM b;  2O01 E;  4JZ3 A;  3CD6 A;  1BI2 A;  3I9Q A;  1QKX A;  1CSK A;  2F5K A;  5L8R E;  4DEY A;  1VQ4 T;  1U06 A;  3JCM g;  2FB7 A;  4OGC A;  2HNI A;  3VKI A;  2DTI A;  5HK3 A;  4PJN A;  3G71 T;  1TG0 A;  2O31 A;  1YI2 A;  4DBF A;  3CC4 T;  1YJW A;  1PD1 A;  1SPK A;  2RQW A;  1PC0 A;  5LJ5 g;  4JRK A;  3EFO B;  3JCM e;  4N4I A;  3O5Z A;  2EYZ A;  4RCC A;  1Z9Z A;  2MCN A;  1KC8 C;  2IPO B;  3HHT B;  3JCM P;  1KK7 A;  2LQW A;  2RD1 A;  4PNO A;  3JB9 J;  2M51 A;  3THK A;  2PVG B;  2JT4 A;  2YUP A;  1LPL A;  5L23 A;  3OY9 A;  5FU6 C;  1ARK A;  2VC8 A;  4BE0 A;  1NPR A;  3CEY A;  1UJY A;  2E12 A;  2AK5 A;  3M0Q A;  2E3H A;  3ZEH A;  3EFO A;  2LP5 A;  2RI5 A;  2E41 A;  4N0A A;  4LUD A;  1KFZ A;  3OBY A;  3QDR B;  4KUI A;  2CYZ B;  4GLK A;  3EG1 A;  2ZPF B;  1NZ9 A;  3M4Y A;  3HFO A;  1XNI A;  2OTL Q;  3CQT A;  5AYF A;  1VQ6 Q;  1W1F A;  1HXD A;  4RTT A;  4FW1 A;  1H3Z A;  1ZHI A;  4IUR A;  2EWN A;  4C0D B;  6AT1 B;  3OYB A;  2RQV A;  4WF2 A;  1JEG A;  3VS1 A;  3TQ7 P;  3CCE T;  2CRE A;  1UGR B;  2DIL A;  2J7I A;  3R6O A;  4M7D F;  4M75 C;  2H3J A;  2E1H A;  1M9S A;  1KHI A;  3PVL A;  3OS5 A;  1T3L A;  2NUP B;  2Y4Y A;  3X26 B;  2RA2 A;  1OOT A;  1WHH A;  3Q1J A;  2VB6 A;  5GAO m;  1EIF A;  2RN8 A;  2H8H A;  2RH2 A;  4FYY B;  3UA6 A;  3IQL A;  2P4T A;  1YFN A;  1KHC A;  3V8J A;  4J6Y A;  2FL7 A;  1Q95 G;  2QA4 T;  1VIE A;  1AWX A;  2PNI A;  3O8V A;  3PMI A;  1KQS P;  1MNE A;  2NUP A;  4ZGE B;  3JB9 I;  2KBT A;  4L5G A;  1Q7Y C;  3MET A;  4R0K A;  4C92 B;  1D0X A;  4DBR A;  2BIV A;  2CT4 A;  1WQW A;  4JJD A;  2VXE A;  4KH0 B;  5KYU B;  2KRM A;  4HVU A;  3PGG A;  3UAT A;  1GBQ A;  4CI0 C;  3NFC A;  3ZFJ A;  1O75 A;  1M1K U;  2B86 A;  3AT1 B;  3VS6 A;  1V29 B;  1RAI B;  2YSQ A;  4RUG A;  4C92 A;  1IXD A;  2DL4 A;  5M9O A;  1VQO Q;  1RLP C;  2EQK A;  3OBW A;  1M2O A;  3OB9 A;  1VQ6 A;  5KYU A;  2HDA A;  1M90 U;  2KYM A;  1Y0M A;  4JRQ A;  3CCM T;  1M1F A;  4Y91 A;  5LJ3 e;  1K0X A;  1D0Z A;  2DM1 A;  1EX4 A;  1IGU A;  2LMJ A;  2EQI A;  4C8Q B;  5GMK i;  3OW2 P;  2FPD A;  5LJ5 h;  4E6R A;  1VQP T;  4F16 A;  3OSV A;  4PJJ A;  5FWB A;  3LWI A;  4M7D D;  3L2Z A;  3A8H B;  4CC3 A;  4BDZ A;  3RUX A;  2R57 A;  4OMO A;  4RKU E;  4C8Q A;  4GY5 A;  5KE3 A;  2ATC B;  2MIO A;  4ZGJ B;  4HKE A;  3GF5 A;  4BAC A;  3MP1 A;  1Q82 R;  2CUD A;  2F2X A;  2L3Q A;  4ZN3 A;  3BFM A;  4M7A B;  4M7D E;  5IH2 A;  2ZGW A;  1VQK T;  3JB9 D;  5CKE A;  1FMV A;  1BI1 A;  1X01 A;  4KUL A;  4O5V A;  1TUC A;  4PLL A;  3REB B;  3L2W A;  4J9B A;  4JS4 A;  1VQN T;  4A4H A;  2EJ9 A;  1Y07 A;  4J9F A;  3EGU A;  4JJN K;  4RTV A;  1XQH A;  3FC3 A;  1PM3 A;  3TVT A;  2PUK B;  4FM4 B;  2LRQ A;  3JB9 H;  3CPW A;  4M7A A;  1TWB A;  2HSE B;  1K8A U;  1GCQ C;  2JMC A;  1G3S A;  3NTK A;  5IN1 A;  1OQK A;  2BKD N;  3VJP A;  2KR3 A;  4M7D G;  1RUW A;  4E7Z A;  1X6G A;  1UGS B;  2K9G A;  1VQO A;  3GNF B;  2CZ7 B;  1VQ8 A;  3TEE A;  2FZG B;  1WLP B;  1TOV A;  3EAE A;  1P92 A;  4GBQ A;  2PTK A;  1BB9 A;  5D6W A;  1KD1 U;  2BZ8 A;  2DD4 A;  1M1K R;  2CP7 A;  3EFS A;  4EMK B;  2D9T A;  2EYY A;  4CC7 A;  1N8R C;  3JCM d;  3PMT A;  2SRC A;  1MMG A;  5C6S A;  2EJF A;  3OYJ A;  1VQM A;  3MP8 A;  2LTO A;  2EVR A;  4RMO A;  1H8K A;  1MMA A;  1RAB B;  1FMW A;  3GNG A;  1IZ6 A;  2GBQ A;  3JB9 G;  1OX8 A;  1ZA1 B;  4EMK A;  1SSF A;  2KMT A;  2A0F B;  2LX9 A;  2RPN A;  4J8O A;  1YCS B;  5KCH A;  4M77 B;  4AFS C;  1K73 R;  4MDX A;  1WXU A;  2BZX A;  4PFZ A;  1PWT A;  2VWF A;  3I56 A;  4LDY A;  2RI2 A;  3L42 A;  1YIJ Q;  2XDB A;  1GXI E;  2EKO A;  2HQX A;  3PVQ A;  5FU6 B;  1JJ2 A;  1LVK A;  2HCK A;  4C0G A;  1NJI R;  2C06 A;  3OYM A;  3G4S Q;  2DYB A;  2O2O A;  3EG2 A;  3VV0 A;  4M77 A;  4ZTJ A;  1YN8 A;  1WHM A;  4Y28 E;  1R77 A;  1RI9 A;  1M3A A;  1AD5 A;  3BW1 A;  5GJV B;  1QKW A;  1FXX A;  5GAO q;  3PFS A;  2DZ9 A;  4A63 B;  2I2L A;  3EH1 A;  4PLI A;  3EHQ A;  3JCM Q;  2AIR B;  2Z0W A;  2LCL A;  3NGP A;  1MMN A;  1SKU B;  3HRU A;  1QVG A;  3JCM c;  3CME Q;  1R0C B;  4B9X A;  4XAX B;  2IVW A;  2F69 A;  2G6F X;  2J6O A;  1K8A R;  1RAE B;  1KJW A;  4E7H A;  3M4G A;  4M75 B;  2R5A A;  3FB9 A;  3CCJ Q;  3VUZ A;  1QWF A;  5KYN A;  4MZM A;  3CXC S;  2QGG A;  1I07 A;  1H3H A;  2X9H A;  2A28 A;  1KQ2 A;  3CD6 T;  1KD1 R;  2LT1 A;  2VVK A;  2DVE A;  3RNJ A;  5I21 A;  4AFQ C;  1YHQ Q;  1UDL A;  2KRO A;  4M75 A;  2LQN A;  2G3R A;  1WDX A;  1YI2 T;  1AOJ A;  2KXD A;  1BU1 A;  5GMK h;  4A54 A;  1YJN Q;  3M54 A;  1YJW T;  3OYY A;  3PT9 A;  5FRO A;  3CPW S;  1JB0 E;  3NTH A;  2FEI A;  3U23 A;  2DXB A;  3OYH A;  2A37 A;  4OB3 B;  1MMD A;  2DL5 A;  4F7U F;  2R5M A;  2LC4 A;  4M78 F;  2JJ9 A;  1YIJ A;  2XI9 A;  2QQA A;  3OYC A;  2EIF A;  3M0S A;  2CP3 A;  3BE3 A;  1CKB A;  1Q86 U;  2C0O A;  2AKK A;  2QI2 A;  5LJ3 d;  3G4S A;  2GQI A;  3GOX A;  5LJ5 f;  3C95 A;  3PIO A;  3CCV Q;  2DKG A;  4MZP A;  5CKH A;  2X3X D;  1AHJ B;  5AT1 B;  3M59 A;  3SWN C;  5I2M A;  5J3B A;  1WX6 A;  4QT7 A;  3D7S B;  1E6H A;  1I5O B;  1UG1 A;  1YNZ A;  2RF0 A;  2CSI A;  3H9N A;  4J6X A;  2LVM A;  1X69 A;  3A8O B;  4A53 A;  4E7J A;  1EFN A;  2JMA A;  3E19 A;  5KH6 A;  4XQ3 A;  1QWE A;  4Z8A A;  5GAN 8;  5DY9 A;  3LH0 A;  3ASK A;  1HD3 A;  4RG8 A;  3JV3 A;  1VQL Q;  4PJO C;  2FZK B;  4EMG A;  2DRK A;  3CC7 Q;  1G2B A;  1UHF A;  1TS9 A;  3REA B;  2O4X B;  4FU6 A;  2NUT B;  2DXT A;  3PNW C;  3L2V A;  2MMP A;  5A0D A;  1WHK A;  3CCU Q;  1UFF A;  2QEX T;  2LNV A;  2FPE A;  1D09 B;  1GBR A;  1YCY A;  4J9G A;  5GAN d;  2BTT A;  4FSS A;  3VUB A;  1FX7 A;  5A2Q E;  8ATC B;  3HL8 A;  3I55 Q;  1XTD A;  3CCL Q;  2O4X A;  2NUT A;  1YIT A;  1Q82 C;  1YJN A;  1VQ7 Q;  5GAN j;  2PU9 B;  3JAM E;  3A8L B;  2K3X A;  3H0F A;  4ELY C;  1ACM B;  4EPC A;  4IUP A;  2HBW A;  1IHV A;  1OU8 A;  1PD0 A;  4PJL A;  2D0N A;  1RLQ C;  5ECA A;  3G6E A;  1LCK A;  1QVG S;  1VYU A;  4M78 D;  1ZA2 B;  1N5Z A;  3A98 A;  2YWW A;  1SRL A;  1OEB A;  1PRM C;  5I11 A;  2O88 A;  1PNJ A;  3I5S A;  1C0M A;  4A4K A;  3MPU B;  5CQY A;  2E64 A;  3RKX A;  1Q86 R;  2V8K A;  1MHN A;  4M75 F;  4QVD A;  1VQ5 Q;  2HAX A;  3EGD B;  4JJB A;  1HJD A;  4F7U E;  4M78 E;  2VUB A;  1VQ6 T;  4X9C A;  4LD9 K;  4BI3 A;  4C0F A;  2DFU A;  1GCQ A;  4J6W A;  2HQE A;  2CT3 A;  4M77 C;  1VQL A;  2MI6 A;  2YXY A;  2JOY A;  3A5Z B;  2EBP A;  2RQR A;  4LUE A;  3VYG A;  2XD0 A;  3EGD A;  1ZBX A;  3QZ5 B;  2E4H A;  3H41 A;  1G8X A;  4KH1 B;  2EW3 A;  4JLI A;  5LJ5 e;  2COY A;  2D0Q B;  2OTJ Q;  4FYV B;  4F7U G;  4M78 G;  3RER A;  2PVO B;  2RB6 A;  3CCS A;  4RTX A;  2K5I A;  2SEM A;  4OB2 B;  4CRI A;  1GCP A;  2KY9 A;  2RHX A;  1YJ9 Q;  2QYZ A;  2MOX A;  2MAM A;  2BE7 D;  3I55 A;  1K73 C;  2ZAE A;  4MZT A;  1IRE B;  1D0Y A;  2GFU A;  2E10 A;  5DLQ E;  2F2V A;  2KXC A;  4JS5 A;  2BZY A;  5GAO r;  3OYE A;  1NJI C;  2LX7 A;  1VQ4 Q;  2K3Y A;  2A08 A;  4DBQ A;  3G71 Q;  3OSS C;  3QYH B;  2DTO A;  1IHW A;  3X20 B;  3CC4 Q;  3KFV A;  3DKM A;  4J7F A;  2JTM A;  4J9H A;  2QEX A;  3QWX X;  3E9G A;  1UHC A;  5IXF A;  1B3Q A;  2QQB A;  3C12 A;  1TUD A;  4FYW B;  3TRE A;  2DPP B;  2V1R A;  5GMK l;  4KUD K;  1QMC A;  4CC4 B;  1VQO T;  1VQ8 T;  1J3T A;  1UEC A;  3NTI A;  2JW4 A;  1Y7X A;  2HD0 A;  4M75 D;  2M1H A;  2KT8 A;  1RAA B;  3C94 A;  3MO8 A;  3VRZ A;  2LCS A;  2PUO B;  4ZTF A;  1K8A C;  1TH7 A;  5J39 A;  2AZV A;  2HL3 A;  4M4Z A;  4DA4 A;  3QSU A;  2NUZ A;  1BCM A;  1VQM T;  2NLU A;  2RJC A;  1PRL C;  1N9S A;  3LGF A;  2GNC A;  2EYQ A;  2K5F A;  1AZG B;  1E6G A;  1GRI A;  1KD1 C;  3FLG A;  2EPD A;  4M75 E;  1VUB A;  1BK2 A;  2ED0 A;  2XIC A;  4IUT A;  5CKF A;  2KDS A;  1U3O A;  1FWZ A;  5A0L A;  4D6W A;  4N4H A;  3NPF A;  2X4Y A;  3P8H A;  1K0S A;  2ZPB B;  2F1L A;  5HKC A;  1MV0 B;  2RJD A;  3N5B B;  2BUD A;  2EAY A;  3I56 T;  2OTL A;  5I22 A;  1PCX A;  2COW A;  1PKS A;  2AHJ B;  1LOJ A;  2A36 A;  4KGV B;  2EFI A;  2E70 A;  3EG3 A;  4J9I A;  1KC8 U;  5J26 A; 
#chains in the Genus database with same CATH homology
 4QW2 A;  4OF1 A;  4V2S A;  1PSE A;  2FVU A;  3SWN B;  3I56 A;  3CCL A;  4LDY A;  2RI2 A;  3L42 A;  4J7I A;  2XDB A;  5IT9 E;  1GXI E;  2EKO A;  1S72 A;  2HQX A;  2EQJ A;  5FU6 B;  3HRS A;  2JZ2 A;  2LCC A;  3MEW A;  3V8L A;  4C0G A;  2WSC E;  1JJ2 A;  1VQ7 A;  3OW2 A;  2C06 A;  2JTF A;  2QTX A;  3OYM A;  3QZ9 B;  4M7D B;  1H64 1;  2RK1 A;  4XTU A;  3VV0 A;  4M77 A;  4JLG A;  4ZTJ A;  3SDZ A;  2EQM A;  3JSC A;  4Y28 E;  4PJO D;  4M77 E;  3A8G B;  2JUF A;  1Y71 A;  3BW1 A;  3M55 A;  5CK9 A;  3URG A;  4PJO B;  2QQR A;  4P5N A;  3MEU A;  3SWN A;  3ZBD A;  2XID A;  1G3T A;  2DO3 A;  1QW1 A;  3HFN A;  1FXX A;  5GAO q;  4IKF A;  2WSE E;  3PFS A;  1UB4 A;  2DZ9 A;  3M56 A;  3TU4 K;  3VYH B;  5LL6 S;  2RO0 A;  2I2L A;  3QHS A;  1R8O B;  3BY7 A;  4PLI A;  4M7A C;  3JCM Q;  2XKO C;  3L2R A;  2LCL A;  4QVC A;  2GCX A;  1WJR A;  3H6Z A;  4X34 A;  2K5L A;  4LD6 A;  4BE1 A;  2X35 A;  3JCM J;  4E7L A;  3C4S A;  3HRU A;  3TCJ A;  2VGM A;  3SD4 A;  3QYG B;  4BD3 A;  3OA6 A;  1QVG A;  4BY6 B;  3MP6 A;  3JCM c;  3DB3 A;  3JCM W;  4PJO A;  2L3R A;  4VUB A;  2HBP A;  3OS1 A;  3HPW A;  3BDL A;  3OMG A;  4BDY A;  4PJO E;  4B9X A;  4E7K A;  4XAX B;  2IVW A;  5GAN f;  4M77 G;  2F69 A;  1VQ5 A;  2E5Q A;  2LQK A;  1U1S A;  3KXT A;  4OGE A;  2X4X A;  3LGL A;  5IAY A;  4E7H A;  3M4G A;  3OYD A;  3UT1 A;  2JNG A;  1M8V A;  3F70 A;  2R5A A;  4M75 B;  1Q82 U;  2KSS A;  5CIU A;  3FB9 A;  5GMK j;  5GAM d;  3VUZ A;  2GFA A;  3GP8 A;  2DJZ A;  1QVF A;  2OTJ T;  3GIB A;  3UWN A;  5GAN 2;  1UGQ B;  2KVQ G;  2JN0 A;  4ME7 A;  3CCR T;  2RK2 A;  3LW5 E;  2GF7 A;  3H8Z A;  3MEV A;  4MZM A;  5EG2 A;  3CXC S;  2QQS A;  1Q81 C;  2VYT A;  4J5Y A;  5FLX E;  1YJ9 T;  1Q81 U;  3PIP A;  1KQ2 A;  1O9S A;  2CS7 A;  5GMK e;  3CD6 T;  1WQ7 A;  5GAM g;  4Q5W A;  2P0P A;  1UEB A;  1BIB A;  1KQ1 A;  4JUV A;  3V7C A;  1VQ9 T;  1WNL A;  4C5E A;  5GAM j;  3KBG A;  1LJO A;  2XDP A;  2LT1 A;  1YIJ T;  1G3W A;  2XG8 D;  4J83 A;  2M16 A;  4XTW A;  2DVE A;  3RES A;  5I21 A;  4PJO G;  2Y90 A;  5HK0 A;  3CBP A;  3SB2 A;  5CVI A;  4ATO A;  4M75 A;  4EMK C;  2G3R A;  3QG1 A;  1YI2 T;  3VU3 C;  1I8F A;  1D3B B;  2OTJ A;  1BKB A;  1NPP A;  1WJQ A;  3ME9 A;  3G4S T;  5GMK h;  4A54 A;  3LLR A;  4L6V 5;  5GAM e;  3M54 A;  3CCR A;  1YJW T;  2L5Q A;  3OYY A;  3PT9 A;  5FRO A;  3CPW S;  1JB0 E;  2CZ6 B;  3OYF A;  3NTH A;  3QKJ A;  3JCM b;  1YJ9 A;  2DXB A;  2O01 E;  3OYH A;  4QQG A;  1BI2 A;  3WXM B;  3CD6 A;  1BYM A;  4OB3 B;  1Q7Y U;  4RG2 A;  1B34 B;  2F5K A;  5L8R E;  2RJF A;  2RHU A;  1VQ4 T;  4F7U F;  2R5M A;  1VQ9 A;  2LC4 A;  2P0K A;  2FB7 A;  4M78 F;  4OGC A;  2HNI A;  3JCM g;  4LDW A;  3VKI A;  1YIJ A;  2XI9 A;  2DTI A;  2QQA A;  2EIF A;  3M57 A;  4XU3 A;  1OZ2 A;  4A4E A;  5HK3 A;  3OYC A;  5GAM h;  3WVE B;  5LJ5 d;  3G71 T;  2EJG A;  3CXC A;  1Q86 C;  1QP3 A;  2KQW A;  1Q86 U;  2CZ0 B;  5I2S A;  1YI2 A;  1D3B A;  2QI2 A;  1KQS S;  5LJ3 d;  3G4S A;  3CC4 T;  2RM4 A;  3GOX A;  1YJW A;  5LJ5 f;  5D6Y A;  3OS2 A;  1I4K 1;  3C95 A;  3RKW A;  3PIO A;  2DKG A;  3HKS A;  4MMK A;  4JRK A;  5LJ5 g;  2XDD A;  4MZP A;  3JCM e;  3EFR A;  4M75 G;  4N4I A;  4N4G A;  5CKH A;  4C92 F;  2M9U A;  1B34 A;  3MHX A;  4IUQ A;  4RCC A;  5LJ3 g;  2ZPG B;  1KC8 C;  1W4S A;  3HHT B;  3JCM P;  1AHJ B;  1VQ4 A;  2A7Y A;  3GPL A;  3M59 A;  2RD1 A;  3SWN C;  4PNO A;  3OYG A;  4Z02 A;  5I2M A;  5J3B A;  5GAN 3;  3JB9 J;  1U8R A;  1BIA A;  1M1G A;  4BUG A;  2PVG B;  3G71 A;  3QJ6 A;  3V8K A;  3OY9 A;  4JRP A;  3M9Q A;  5FU6 C;  2MWO A;  3HRT A;  2VC8 A;  4J6X A;  2LVM A;  2ZPI B;  3A8O B;  4FL6 A;  4YTL A;  3JCM h;  4A53 A;  4BE0 A;  1NPR A;  3CEY A;  1K9M U;  4E7J A;  2XHC A;  4M7D C;  4ELZ C;  5CO7 A;  3E19 A;  5KH6 A;  5GMK m;  2E12 A;  3E1S A;  3PTA A;  3ZEH A;  3JCM V;  2DZC A;  4XQ3 A;  2RI5 A;  5GAN 8;  2E41 A;  3FEO A;  4N0A A;  2DAQ A;  1JBM A;  2XU8 A;  3ASK A;  3LH0 A;  3OBY A;  4RG8 A;  5DY9 A;  3QDR B;  4KUI A;  4PJO C;  4II1 A;  2CYZ B;  2DD5 A;  2CZ1 B;  4GLK A;  2V8I A;  4DOV A;  4EMG A;  4E47 A;  2RHI A;  5FU7 B;  4OB0 B;  2ZPF B;  1NZ9 A;  1K73 U;  5LJ3 h;  3M4Y A;  3HFO A;  1XNI A;  1BI0 A;  2O4X B;  4FU6 A;  4LDX A;  2WAC A;  2DXT A;  3QBY A;  5AYF A;  4MML A;  3JCM X;  3PNW C;  1YIT T;  3OYN A;  3L2V A;  4JRI A;  4XU2 A;  1YJN T;  2MMP A;  1HXD A;  1OZ3 A;  5A0D A;  4FT2 A;  5DM7 R;  4C8Q F;  2LNV A;  2QEX T;  3OW2 S;  1NJI U;  4C5I A;  5CAI A;  1H3Z A;  1YCY A;  1ZHI A;  4QQD A;  4IUR A;  4RCB A;  5GAN d;  2EWN A;  4C0D B;  2QXF A;  3VUB A;  3OYB A;  1FX7 A;  4WF2 A;  5A2Q E;  3E9F A;  3G6E T;  3RMQ A;  1WGS A;  3HL8 A;  5A0G A;  3CCE T;  1XTD A;  3ER0 A;  2RI3 A;  3JRZ A;  2O4X A;  3GLX A;  2ZPE B;  1UGR B;  4E7I A;  5GAN g;  3R6O A;  4M7D F;  4X9D A;  1YIT A;  5KCO A;  3L1A A;  2H3J A;  4M75 C;  4XTV A;  4EMH A;  2E1H A;  2VXF A;  5FRN A;  1Q82 C;  3L2U A;  4ZN1 A;  1YJN A;  5GAN j;  2PU9 B;  4DQ2 A;  1M9S A;  1KHI A;  1VIF A;  3A8L B;  3QO3 A;  2OAU A;  5HY6 A;  3JAM E;  2P0Q A;  3OS5 A;  2K3X A;  3X24 B;  4ELY C;  2WSF E;  1YBY A;  4IUP A;  1UGP B;  4EPC A;  3OYI A;  4KT0 E;  2DIG A;  2Y4Y A;  3X26 B;  2RA2 A;  5GAN e;  4HA8 A;  3Q1J A;  3G7Z A;  3G6E A;  2F5T X;  5GAO m;  3CCE A;  1QVG S;  1EIF A;  2RHZ A;  3HSB A;  2RH2 A;  4M78 D;  2KAF A;  2P4T A;  4FSX A;  1KHC A;  3V8J A;  4PL6 A;  3OYA A;  4F7U B;  4HCC A;  4J6Y A;  4M78 B;  4M7A F;  2FL7 A;  4XU1 A;  2QA4 T;  5DLO A;  4M7A E;  1VIE A;  4ZGD B;  3O8V A;  5GAN h;  3PMI A;  4JDS A;  1QVF S;  4ZGE B;  3JB9 I;  4A4K A;  1W2B A;  2MF2 A;  1VQL T;  2VGN A;  4L5G A;  4C92 D;  1Q7Y C;  5CQY A;  2E64 A;  3MET A;  3RKX A;  5GAN 4;  4QVZ A;  4C92 B;  3QJY A;  2V8K A;  3SFM A;  1MHN A;  4C5H A;  4LDV A;  2BIV A;  4M75 F;  4F7U A;  4QVD A;  4M78 A;  3OYL A;  1K9M C;  2HAX A;  5KE2 A;  1WQW A;  4R55 A;  2VXE A;  4F7U E;  2QA4 A;  4M78 E;  2QDY B;  4NS5 A;  5GAO n;  2VUB A;  3OS0 A;  1VQ6 T;  4X9C A;  3WVD B;  4PKC C;  4LD9 K;  4BI3 A;  3AHU A;  3PGG A;  3S6W A;  3LYI A;  4C0F A;  3CBM A;  3LWH A;  4J6W A;  4O6J A;  2D6F A;  3INZ A;  4CI0 C;  3NFC A;  2HQE A;  4LDU A;  4M77 C;  1O75 A;  4N0A C;  2JVV A;  3ZFJ A;  3CCQ T;  3CCS T;  1M1K U;  1VQL A;  2MI6 A;  1V29 B;  2V8J A;  3CME T;  2JOY A;  5LJ5 j;  3A5Z B;  4C92 A;  1X6O A;  2L89 A;  5M9O A;  1JRI A;  4C92 E;  3I55 T;  5LJ3 j;  2EQK A;  3OBW A;  3VYG A;  2XD0 A;  1G5V A;  3UPU A;  1ZBX A;  2DXC A;  2LT4 A;  3QZ5 B;  3OB9 A;  1VQ6 A;  3S3N A;  4JLI A;  4XTY A;  5LJ5 e;  1M90 U;  2M0O A;  4BI4 A;  2D0Q B;  4JRQ A;  3X25 B;  3CCM T;  2DTH A;  1I81 A;  1M1F A;  4Y91 A;  4F7U G;  5LJ3 e;  3CCJ T;  1M4Z A;  4M78 G;  3RER A;  4BE2 A;  3CBO A;  3CPF A;  2PVO B;  3CCQ A;  2RB6 A;  4C8Q D;  3CCS A;  4KBM B;  3V7R A;  2K5I A;  4OB2 B;  4CRI A;  2KY9 A;  2RHX A;  3LX7 A;  3CME A;  4L59 A;  1N6A A;  5D6X A;  4C8Q B;  3KUF A;  5GAO p;  5FU7 C;  5GMK i;  2MAM A;  4C5G A;  5LJ5 h;  3I55 A;  2X4W A;  1VQP T;  1PSF A;  1K73 C;  3DB4 A;  4MZT A;  2DK3 A;  3OSV A;  3X28 B;  1IRE B;  2R58 A;  3FIF A;  3RIR A;  4OMF B;  1N27 A;  2GFU A;  3LWI A;  2E10 A;  4C92 G;  1YHQ T;  4M7D D;  3L2Z A;  3A8H B;  2K2V A;  3CCM A;  5DLQ E;  3UDC A;  4BDZ A;  3CCJ A;  4HCZ A;  2EQU A;  2YRV A;  3OMC A;  4JS5 A;  3RUX A;  5C0M A;  2R57 A;  4M77 F;  5GAO r;  3CMA T;  4FIB A;  1JJ2 S;  3V7S A;  3OYE A;  1NJI C;  1N9R A;  4RKU E;  2QQ9 A;  4BY6 C;  4C0D C;  4C8Q A;  4GY5 A;  5KE3 A;  2PVD B;  4ZGJ B;  1XOV A;  4C8Q E;  3L2Q A;  1VQP A;  4HKE A;  2K3Y A;  2B8A A;  2E6N A;  2YLB A;  3GF5 A;  5GAN 7;  4BAC A;  3M58 A;  4UC4 A;  4B9W A;  5CKD A;  3MP1 A;  4NL3 A;  4MDW A;  4IUV A;  1VQ5 T;  1DJ7 B;  1YHQ A;  3OSS C;  2DXU A;  1OI1 A;  4XU0 A;  3QYH B;  2DTO A;  5CR2 A;  2RJE A;  4M7A D;  3X20 B;  1I5L A;  2IG0 A;  4ZN3 A;  4FT4 A;  4HT9 A;  3BFM A;  4M7D A;  3J7A F;  3CMA A;  3J80 E;  4OP0 A;  3CC2 T;  4M7A B;  4M7D E;  3FDR A;  4IUU A;  3DKM A;  2ZGW A;  2JTM A;  4J7F A;  3RKY A;  3BDU A;  2QEX A;  4A4F A;  1LNX A;  3CCV T;  4BB7 A;  3OQ5 A;  3JB9 D;  1VQK T;  3E9G A;  4PJO F;  4M7A G;  2PQW A;  5CKE A;  1X01 A;  1BI1 A;  3P8B B;  4KUL A;  2QQB A;  4O5V A;  3C12 A;  4PLL A;  3L2W A;  1OYX A;  3TRE A;  1U1T A;  2DPP B;  2ZPH B;  5GMK l;  4JS4 A;  5CQX A;  4KUD K;  1VQN T;  1VQO T;  4A4H A;  1VQ8 T;  2EJ9 A;  3NTI A;  1Y96 B;  1Y07 A;  1Y7X A;  4M78 C;  4C8Q G;  4OVA A;  2HD0 A;  4TVR A;  4M75 D;  4JJN K;  1QVP A;  1XQH A;  2M1H A;  3DLL A;  3FC3 A;  3C94 A;  2KK4 A;  4OB1 B;  3MO8 A;  2PUK B;  3T9N A;  4FM4 B;  2LRQ A;  4QQ6 A;  3JB9 H;  3M53 A;  3CC2 A;  3CPW A;  2RHY A;  2ZCF B;  3QII A;  4M7A A;  2ZZD A;  2PUO B;  4ZTF A;  1K8A C;  1RL2 A;  2E6Z A;  1K8A U;  4DOW A;  1TH7 A;  3S3M A;  3HP9 A;  3CCV A;  5J39 A;  2FHD A;  3QXE B;  1VQK A;  3NTK A;  1G3S A;  4DA4 A;  3QSU A;  5IN1 A;  2BKD N;  3VJP A;  3OYK A;  5GAM f;  4XK8 E;  1BI3 A;  2LQ8 A;  2MWP A;  4M7D G;  1VQM T;  2NLU A;  5GAN 6;  4C92 C;  1UGS B;  1VQN A;  1VQO A;  2RJC A;  2L8D A;  2CZ7 B;  3GNF B;  1N9S A;  1VQ8 A;  3TEE A;  3LGF A;  3CC7 T;  1Y96 A;  2EYQ A;  3EAE A;  1P92 A;  2K5F A;  3A8M B;  3M5A A;  4BI8 B;  3S3O A;  1KQS A;  1WPY A;  3MEA A;  5CKB A;  2OTL T;  4NOY A;  4A4G A;  1MGQ A;  1WJS A;  2Y4X A;  5D6W A;  4C0Z A;  4R56 A;  2E65 A;  3FLG A;  3J81 E;  1KD1 U;  1KD1 C;  4M75 E;  2DD4 A;  1VUB A;  3EFS A;  4EMK B;  2D9T A;  1N8R C;  2XIC A;  1N8R U;  4IUT A;  5CKF A;  3JCM d;  2KDS A;  3PMT A;  1FWZ A;  3CCU T;  2A3L A;  5A0L A;  4XTZ A;  4D6W A;  3JB9 F;  4XTX A;  5C6S A;  2EJF A;  4N4H A;  3OYJ A;  1VQM A;  1M1K C;  3MP8 A;  2LTO A;  2X4J A;  2X4Y A;  3FJP A;  3P8H A;  3JCM f;  2LDM A;  5GAN 5;  4RMO A;  1ZQ1 A;  3CC7 A;  2GQV A;  2ZPB B;  4NL2 A;  1W2B S;  3GNG A;  1IZ6 A;  5HKC A;  5CCA A;  1G3Y A;  2RJD A;  3N5B B;  2BUD A;  2DEQ A;  2EAY A;  3I56 T;  3JB9 G;  3CCL T;  2OTL A;  4HT8 A;  3FRN A;  3QUI A;  3DLM A;  2K4Y A;  2YHT A;  1S72 T;  1M90 C;  4EMK A;  2K57 A;  3CC4 A;  1M5Q 1;  1SSF A;  3RMS A;  5GAO l;  1VQ7 T;  2KMT A;  2DIQ A;  2XK0 A;  3CCU A;  2AHJ B;  2FYK A;  1LOJ A;  1HK9 A;  2EFI A;  4M77 D;  1QP2 A;  2LX9 A;  5LJ3 f;  2VV5 A;  2YLC A;  1RI0 A;  3QPH A;  3MCA B;  1KG1 A;  3P8D A;  4J8O A;  2CKK A;  4C8Q C;  4HCB A;  2E70 A;  4M77 B;  5KCH A;  4EDU A;  1X75 C;  2CGH A;  5J26 A;  1KC8 U;  4MDX A;  1NE8 A;  5FRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...