3ME9A

Crystal structure of sgf29 in complex with h3k4me3 peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
174
structure length
174
Chain Sequence
GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords SAGA-associated factor 29 homolog
total genus 36
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3me9A02
3QKJA 3QIIA 2D9TA 4NS5A 2LCCA 2L3RA 2O4XA 4UC4A 2RHIA 2RI2A 3L2VA 5J26A 2FHDA 3OYCA 2EQKA 2HQEA 2DIGA 4QQDA 3OYJA 3LGLA 2EFIA 1N27A 5IN1A 5FRNA 4C5IA 1WJQA 4ZTJA 3NTKA 2E5QA 1OYXA 2L89A 3O8VA 2BIVA 5KCHA 4E7KA 2R58A 4BD3A 5D6YA 4A4GA 4Q5WA 3UT1A 3QBYA 2RO0A 4II1A 2RJDA 4LD6A 3LH0A 2M1HA 4QQGA 4C5GA 4IURA 4HCZA 2HQXA 3NTIA 3OYAA 2X35A 2IG0A 4BDYA 5M9OA 2BKDN 3LGFA 3OYHA 3GOXA 2R5AA 2G3RA 4FL6A 3QJ6A 4CRIA 2EKOA 3DLMA 3MEAA 3MO8A 5FRMA 5KH6A 3CEYA 5D6XA 5KE2A 2R5MA 4RG2A 3L2RA 4FU6A 4OVAA 3PFSA 2P0KA 3OYIA 2LVMA 3LLRA 2O4XB 4IUUA 3OYLA 1OZ2A 3OB9A 2YRVA 3UWNA 3OS0A 4ZTFA 3PNWC 4GY5A 3OMCA 4IUPA 3S6WA 1KHCA 3OYEA 2K3XA 2DIQA 3ASKA 3PMIA 1G5VA 2GFUA 4IUQA 4C5HA 3H8ZA 3OYBA 3E9GA 4PLLA 2DAQA 5FROA 2EQJA 2JZ2A 3MP8A 3F70A 2RJEA 3DB4A 4A4FA 2LDMA 3S3OA 4IKFA 2LTOA 3OQ5A 4BACA 2RJFA 3PMTA 5KCOA 1OZ3A 4EDUA 4N4IA 2RHYA 3KUFA 3FC3A 4E7JA 4BDZA 3M9QA 2EQMA 3L2QA 2EQUA 2RI3A 3E9FA 3FLGA 4X34A 2XK0A 5J39A 2M0OA 2F5KA 4PLIA 4N4GA 3BDLA 4A4EA 2JTFA 2K3YA 3LX7A 3ME9A 5CIUA 3FDRA 4QW2A 2PQWA 4A4HA 4E7IA 3MEVA 3LYIA 3L2WA 4B9WA 2M16A 3S3MA 3OA6A 4IUTA 2GFAA 3META 4QQ6A 2L8DA 3L42A 2RHUA 2NLUA 4L59A 4B9XA 2QQRA 3OYKA 4C5EA 3OYMA 2E6NA 3OS2A 3S3NA 1H3ZA 3EAEA 1RI0A 3MP1A 3P8HA 3SD4A 1XNIA 4Z02A 5C6SA 5D6WA 1WJSA 2XDPA 2B8AA 3OY9A 3OYGA 2WACA 5KE3A 2VYTA 2RHXA 4BE1A 2MWPA 5IAYA 4BE2A 3OYNA 2BUDA 3H6ZA 4IUVA 2R57A 3L2UA 3ZEHA 1WJRA 2GF7A 4N4HA 3DB3A 1MHNA 2CKKA 2MWOA 2X4WA 3OYDA 3OMGA 3P8DA 1WGSA 3OS1A 4E7HA 2LRQA 4PL6A 1OI1A 2RI5A 2X4YA 3MP6A 2X4XA 2RJCA 3MEUA 2RHZA 4BE0A 3C4SA 1SSFA 3MEWA 4E7LA 3NTHA 2QQSA 5C0MA 4QVZA 3OYFA 3FEOA 3Q1JA
chains in the Genus database with same CATH superfamily
5GJWB 5AT1B 2L3RA 3L2VA 1VQ4Q 2OTJQ 2P4TA 1HSQA 3JCMb 5GANg 4QQDA 1PWTA 4M77C 3SHWA 1NJIU 3IQLA 1NYGA 4C0DB 1SHFA 3CCUT 4XAXB 2K79A 1D0ZA 2VXFA 4C8QG 1W6XA 5IHIA 1SG5A 3CMAQ 4JLGA 1YJWT 2LP5A 3QDRB 2K5LA 1ZQ1A 3VKIA 1EIFA 3QJ6A 1K73C 4FYYB 4M78C 1M1GA 3CCMA 1HK9A 2O4XB 2C0TA 2I2LA 2A37A 1VQLA 2RQVA 1YHQT 2HQHA 1C6VX 3CCVQ 2OTJT 4IIOA 2CZ6B 2RJEA 3HPWA 3S3OA 1NE8A 2CH4A 4EDUA 3FC3A 1ZA2B 3RKXA 1KC8U 2M0OA 3HHTB 2EYQA 5CKBA 3ME9A 4OB1B 3HFNA 2EVRA 4B9WA 2M16A 1YJNT 3OA6A 1M30A 1WXTA 5KYXA 3BY7A 3VS1A 1HJDA 3SD4A 1O75A 1GFCA 1X69A 3HL8A 2HKQB 4KUDK 2EAYA 1VYUA 5GJVB 7AT1B 2EGEA 5LJ5g 1GBRA 2X4WA 3X20B 1KQSP 2EYZA 2EWNA 4P5NA 1OI1A 1VQ6Q 2P0PA 4FT4A 4AT1B 1OOTA 5GMKj 2CUBA 2EJ9A 5EG2A 3EG9A 5GAMj 3H9NA 1BYMA 2D9TA 1MGQA 1IHVA 3CD6T 2ZAEA 2V8IA 1VQ8T 1SHGA 4M7AD 3GNGA 4KGZB 1OV3A 3M0UA 3JB9I 5IN1A 1WYXA 1M3AA 3MPUB 1UGVA 2QTVA 3AHUA 1VIEA 1NM7A 1TG0A 4M7AG 4XU1A 4RKUE 2NUPB 1H3HA 3QZ9B 2COWA 4J9EA 2V1RA 3LH0A 1R8OB 2H3JA 3VS5A 3CC7A 1M90U 1T0JA 2KK4A 3PVLA 2XDDA 1AEYA 1QCNA 2YT6A 3PNWC 3OMCA 1VQNT 1QKWA 3OYEA 2COZA 1KK7A 1ZSZA 4OMLA 3RDVA 4C92B 1VQLQ 1M9SA 1QQJA 5LJ3f 2LDMA 3CCST 1UGQB 3SB2A 1D1AA 1OZ3A 1XTDA 3PT9A 2KY9A 2ROLA 3TVTA 4M78E 2VC8A 3QPHA 1Q81U 1JB0E 2MMPA 1KQSA 4HXJA 3JB9J 2DL5A 3G6EA 1X6OA 4M77F 3CD6A 4M77D 3VS2A 3MP1A 1WLPB 2LQNA 1WJSA 2LJ1A 1ZBXA 2ZPHB 4BE1A 3NFCA 2MPXC 4JJNK 2F1LA 1X2QA 2X4YA 1E6GA 1RAFB 1ZUUA 4Y28E 4KGVB 3VUBA 3J7AF 2DERA 2CSQA 4FCYA 1OQKA 5GAN6 1Q82U 3MEWA 2F2VA 2JTEA 3V7CA 1VQ7T 2L3PA 1QVFA 1NPPA 4FYXB 5J26A 3H41A 5IH2A 4JJBA 2DLPA 2DNUA 3REBB 2J6KA 1S72A 3M58A 2DRMA 1IXDA 2RA2A 3UF4A 2XMFA 3SWNB 1K8AC 2HL5C 3CCVA 4E7SA 2RO0A 3I5RA 1D3BB 4C5GA 4F14A 1RL2A 2NYSA 2X35A 4PJNA 1M2VB 2RQWA 1RLQC 1OX8A 1WZOA 2HBWA 1TOVA 4J9BA 2FPEA 3C95A 4CI0C 3VUZA 5FRMA 2PU9B 4OB3B 4ZN1A 3I55T 3HP9A 4BI8B 4IUPA 2LZ6B 3ASKA 3RKYA 2RNAA 5GANe 2JVVA 1ZX6A 2GBQA 4ANJA 3QJYA 1D0YA 3QSUA 3KUFA 3CCQQ 2EQMA 2EQUA 3FLGA 5LJ5e 1K9MC 3FDRA 2AK5A 3MEVA 1BB9A 2V8JA 4M78A 1IREB 5HKCA 1TS9A 4C5EA 5GAMf 3EGXB 2K6DA 4X9DA 5KYNA 2WACA 2KR3A 5DLQE 2PVGB 5GAN7 3CXCP 1YI2A 3GLXA 1PSEA 3RMSA 2DETA 2MWOA 2QK0A 2DL7A 1AWJA 4JJCA 1ZLMA 2Y4YA 4J6WA 4M7AB 3NPFA 2ZPFB 3CMEQ 2KRNA 2RHZA 1NEGA 1XJWB 4KH0B 1RADB 1WHGA 5GAOq 2BZYA 3JCMf 3ZL7C 2LQKA 4IIMA 1Q86C 2EQKA 1ZBJA 4OB0B 2VKNA 2LX9A 3JCMd 3X25B 4YTLA 5LJ5d 1VQKT 1GCQA 1MUZA 2O01E 4JJDA 1WHLA 1QP2A 4BB7A 1LCKA 3MCAB 4LXCA 1VQLT 3C0CA 3V8LA 1T3LA 2RJDA 2YWWA 3OYAA 4HKEA 2HEQA 3UPUA 2BKDN 4DA4A 3GIBA 4JRQA 3DLMA 4EMKB 1HYOA 3A8GB 1BI3A 3THKA 2DTHA 4A53A 3CMAT 4XTUA 2SEMA 1VQNQ 3E9GA 1G8XA 2DAQA 1QVPA 4BACA 4IKFA 5IHKA 2NUTA 4OMPA 2K57A 2XK0A 2BZ8A 2EGAA 1V29B 4J9IA 2E3HA 2RD1A 1YBYA 1YP5A 4EMHA 2A3LA 2DBMA 1ZHIA 6AT1B 1RI0A 2D8JA 3M56A 4E47A 1PSFA 4M78B 2LNVA 4RTUA 3OW2A 3CMAA 2K7AA 1KHIA 1BI2A 4IUVA 3I56Q 5GAOn 1PRLC 1V76A 3EGDB 3FJ5A 5CVIA 3M0QA 2CDTA 1UHFA 2LRQA 4M77B 1KIKA 3EG0A 4HVVA 1WHKA 1M90R 1YN8A 5LJ3d 3MEUA 3OYFA 2MAMA 2LC4A 3TSZA 1NBEB 3M5AA 1VQMQ 3E1SA 4M4ZA 2HBPA 5GAOp 2EFIA 2HL3A 1N27A 2X4JA 3ZBDA 2XD0A 3P8BB 5IXBA 4RTXA 1WJQA 3SFMA 1PKTA 4OGCA 2DX1A 1OYXA 4LDXA 5KYWA 1X6BA 3NHNA 2K9GA 4Q5WA 3UT1A 3CCLA 1YFNA 3CPFA 1AHJB 4L6V5 4MZMA 1U06A 4BDYA 1K8AR 2XKOC 1TWBA 4EIKA 2MK5A 3L2RA 4FU6A 1I5OB 3LLRA 4J7FA 2OJ2A 1N9SA 3ER0A 3M54A 4BI3A 4WCIA 1VYVA 2K3XA 1NEBA 3V7RA 3VV0A 4DOVA 2EQJA 4JRPA 3JCMc 3A1PA 1BU1A 2LX7A 2DVJA 4OP0A 8AT1B 3PIPA 2FO0A 2ZPEB 3FB9A 5KYYB 3G4SA 2DXCA 5IXFA 1VQ5A 3T9NA 2JTMA 2DILA 2E1HA 2LT1A 2KEAA 5HK3A 2FB7A 2OX7A 3JB9F 2HNIA 1Z9QA 1VQKQ 2JMCA 1QLYA 1YI2T 1JXMA 5I2MA 2C06A 2VWFA 4ME7A 2FPFA 4FW1A 2C0IA 5GAMd 2DXUA 3VS0A 2MIOA 3CQTA 2YLCA 3BFMA 5CQXA 3MP6A 3NMZC 4OMOA 4MMKA 5J3BA 3CMET 4F7UF 4QVDA 3QG1A 4M75B 5C0MA 3VS6A 2LMJA 2HDAA 1E7OA 3HFOA 2P0QA 2DIGA 4JZ4A 2EYYA 2HZYA 2ZPBB 3LGLA 4C5IA 3GNFB 3JB9H 3HRUA 1OU9A 2FPDA 2L89A 1D0XA 1MMGA 2FZKB 2EGCA 2XDBA 2RM4A 1Y96B 4BUGA 1Q7YR 4PJOF 3OW2S 4IURA 4HCZA 2IG0A 1AWWA 1KJWA 1WPYA 5A2QE 1M1KC 1Y07A 1W2BA 1LPLA 3EG9B 3CCJQ 1FMKA 2QYZA 3PFSA 3OYIA 4IUUA 2DPPB 1VA7A 1WHHA 3OB9A 1MV3A 3KFVA 1U1TA 1AWXA 1JXOA 3X26B 1LJOA 1S1NA 1GFDA 3A8LB 3PMIA 1G5VA 1VQKA 2C0OA 1VOMA 4AFQC 3OQ5A 4C92D 5KCOA 1RI9A 1QCFA 3I55Q 3DKMA 1BK2A 2GCXA 5EC7A 3CCJT 3LWIA 4FSXA 1W1FA 4JUVA 4A4EA 3LW5E 4R55A 4PJMA 3I56A 4A4HA 2DK3A 4M77G 4ELZC 2SRCA 3CXCS 1P92A 1S72Q 1G83A 5I11A 3OS2A 2F2XA 3EAEA 4A54A 2K5FA 3PTAA 2JT4A 1NPRA 1M4ZA 2FEIA 2XDPA 1X75C 3OY9A 4KBMB 1I8FA 2ESWA 1M1FA 2VYTA 3GBQA 3HSBA 3WVDB 4GLKA 5FU7B 1YIJQ 1KQ2A 4E7HA 3CC2Q 1KG1A 1RAGB 3G71A 4C8QB 1YJNA 4J9HA 2L3SA 2QA4T 4E7LA 2FYKA 2L3QA 1YJNQ 3JCMW 3Q1JA 4UC4A 4HA8A 2RI2A 1GCQC 1PG5B 5A0DA 2CP0A 4XTVA 2QDYB 1VQOQ 4PKCC 5KYWB 1N8RR 1VQOA 1BKBA 4DBHA 1W70A 1YI2Q 1N5ZA 1Q86U 3G4SQ 5GAOl 1CKAA 3E19A 3O8VA 4LDUA 4E7KA 4DEYA 2DO3A 5D6YA 1I07A 4C8QE 4AFZC 3RIRA 1VQ7A 1PKSA 4LD6A 2LJ0A 3JCMJ 4A63B 2AZSA 4MZTA 3GOXA 1FYNA 1Y96A 4CRIA 1R77A 3CC4T 2CP3A 2QDLA 5D6XA 1VQ6A 2P0KA 2IIMA 1PM3A 2DMOA 3TQ7P 4MDWA 4FW2A 3J81E 2X9HA 3H8ZA 4PLLA 1UJYA 3JCMQ 1MMAA 2JZ2A 4QT7A 2DTOA 1IGUA 1I0CA 4NOYA 1K9MU 2E41A 2E65A 3M57A 2DL3A 3E9FA 1UHCA 1XOVA 9ATCB 5HCKA 1UE9A 2JTFA 2K3YA 1VQ4T 2KRMA 3KXTA 5FU7C 4E7IA 2KQWA 3GP8A 3M0TA 4RTYA 2RHUA 1UB4A 4Z88A 5GMKl 2H3EB 1U3OA 3JAME 5CKEA 3MJXA 2WSEE 2ECZA 1GXIE 2E6ZA 4C92A 3TEEA 1WJRA 3HRTA 1M1KU 2P84A 2DVEA 2VASA 3P8DA 2LNHB 3VRYA 1UTIA 4JLIA 2HD0A 2YDLA 4OMFB 5LJ3g 2MYSA 2DL4A 1K8AU 3EHQA 3CCVT 3EFOB 1I5LA 2JW4A 2HAXA 2A28A 2KNBB 1K76A 3MHXA 2ZPIB 2PNIA 4JRKA 4M7AC 3CC4Q 1VQPQ 1VQPA 4M77E 2R58A 1YJWQ 1Q82C 1U8RA 1X2KA 5L8RE 3CCRT 3I35A 1KFZA 2RF0A 1LVKA 4A4KA 4C92C 2DZCA 5CCAA 4RTTA 4C8QA 4ATOA 3CMEA 3VU3C 5GAMh 2OTJA 3CCUQ 1JJ2A 2FVUA 5A0GA 3MEAA 4E7ZA 5FW9A 1EZZB 2H8HA 4HVUA 2DEQA 3OSVA 2EPDA 4ZTFA 4ZGEB 4CC2A 1BI1A 2EJFA 2E4HA 2GGRA 1RAIB 2CUDA 4A4FA 4E2FB 3G6EQ 4EMKC 2JMAA 2AHJB 1Q81C 3V8JA 3RUXA 1VQPT 1OU8A 4ZGDB 4GBQA 5I22A 1D3BA 2M02A 1YIJT 1M3CA 4WTOB 4Y92A 3QXEB 5LJ3h 2X3WD 1WQWA 1K4US 2GFAA 3META 3R6NA 1YITA 3L42A 3TCJA 2M51A 1WA7A 1KQSS 4JRIA 2O31A 5FU6C 4BI4A 1M90C 2RHXA 2MWPA 3OYNA 2K5IA 2ZCFB 1HD3A 2GF7A 2KE9A 1MHNA 4ZGJB 1TSFA 3JRZA 4ELYC 4J5YA 3CCQT 1AZEA 3VYGA 2QA4Q 3A98A 5CKDA 1UUEA 4NL2A 1QW1A 2NUTB 4F7UA 2CP6A 1WDXA 1NLPC 1WFWA 5KYYA 2QEXT 3UATA 2LQ8A 4DEXA 3JCMg 1AVZC 4JS5A 4PK4A 4QVCA 2GQIA 2DYIA 2V1QA 2P4RA 3X24B 1DJ7B 2IPOB 3OYYA 4LDWA 2K4YA 1VQ9A 1M2OA 2EBPA 3JCMV 2AT1B 4CC3A 2QQ9A 1ZSZB 1YCYA 2G3RA 2XIDA 3PIOA 1QP3A 3CEYA 5KE2A 2RPNA 3QYHB 4O6JA 1OULA 4M7DA 4M75D 2CS7A 4CC7A 2YRVA 4M75F 4BY6C 1O9SA 1RAAB 2XU8A 4JDSA 1I4K1 4DOWA 1SF9A 2WSCE 2K2MA 3QWYA 4N4IA 2HSPA 4D8DA 2RK1A 5J39A 4XQ3A 5GAMg 5KYUA 1KC8C 4DQ2A 2NUPA 1OX9A 3LX7A 3QUIA 2DXBA 2AIRB 3OBWA 4KUIA 4ZN3A 1VQOT 3MKDA 2RMOA 5ECAA 4C8QD 5DM7R 2DE0X 3M0PA 4M7AF 4C8QF 4JPBW 3OYMA 2GNCA 4LN2A 4HT9A 2KT1A 3OSSC 2QQAA 2B8AA 1SSHA 4K11A 1AOJA 3LWHA 3M0SA 4LUDA 3CC2T 3UA6A 1K73U 4N0AA 3OYDA 1IGQA 2YHTA 4CC4B 1WGSA 3JCMX 3UA7A 2QAZA 5I2SA 2IVWA 3H0HA 3EFOA 3G6ET 3I9QA 1TU0B 2J05A 4KT0E 4J83A 4XU0A 2QQSA 1YJWA 3BE3A 2VVKA 3QKJA 3CCRA 4HCKA 3JSCA 2PZ1A 2A08A 4F7UG 3HKSA 1UG1A 2ZZDA 1M8VA 2XHCA 3VJPA 4AG2C 3REAB 5GAOm 4LNPA 2LT4A 2KI7A 3WXMB 4F16A 3G1JA 1K1ZA 4M75G 1RABB 2AKLA 5L23A 4MDXA 2MCNA 1BCMA 2J7IA 3M53A 4J6YA 3CCLQ 2PTKA 5I21A 1B3QA 3MO8A 2ED1A 2VUBA 3CPWP 4C92E 2CT4A 1VYTA 1FMWA 2XICA 1WI7A 4FSSA 1VQMT 4PNOA 3CCUA 2DFUA 3M55A 1D1BA 2A7YA 4V2SA 2KXCA 3F70A 4C0ZA 1M1KR 3PMTA 4E7JA 2CSIA 3RBBB 1QKXA 2EKHA 1TUDA 2M0YA 4DBQA 1G3TA 1JRIA 4C0FA 1WQ7A 4Z89A 2NLUA 3OYKA 3ULRB 1IO6A 3S3NA 4M77A 3M4GA 5HK0A 3CC7Q 1XNIA 5C6SA 4ZNXA 3EGDA 1T0HA 5D6WA 4D6WA 3OYGA 1GCPA 3INZA 3DLLA 1VUBA 3O5ZA 1VQ8Q 2J06A 4PJOG 2FZGB 1PD1A 3JV3A 4FM4B 2V26A 3CC7T 1AWOA 2O88A 3I5SA 2DRKA 1K73R 1WHMA 2YXYA 1U1SA 2DD5A 1VQ9T 3QIIA 4AFUC 4M75C 3FJPA 3CCJA 3TU4K 5GAOr 2CZ7B 5FRNA 1V1CA 4J7IA 2PVOB 1YNZA 4ZTJA 1HXDA 1TXQA 3CPWS 3A8OB 4LD9K 3GF5A 2W10A 2EYWA 4FYWB 1VQ8A 1K9AA 2D8HA 1Y57A 1RUWA 3CCMT 3G71Q 1TUGB 2RH2A 5HY6A 5DY9A 5M9OA 1K0SA 3CC2A 1CSKA 1IB8A 1LOJA 1UDLA 2PUKB 3OS5A 3EFSA 3JB9G 1KQ1A 3LH5A 2NUZA 4RCCA 2R5MA 5GMKi 4OVAA 2K2VA 2D0NA 2LVMA 3OYLA 2QQBA 2O9VA 4HCCA 1UGSB 2BE9B 1KHCA 1WXBA 3JCMP 2GFUA 2FZCB 1EFNA 1VQ5Q 3CCRQ 1JJ2P 2COYA 1I81A 2X3XD 5KYUB 2QASA 2LTOA 1ZSZC 3G7ZA 1IHWA 5GAN5 1QVGP 4F7UE 5GANh 4X34A 2EW3A 2E10A 4PLIA 1ACMB 2ROTA 3BDLA 1A0NB 2E64A 1MMNA 3OW2P 2GTOA 5CKFA 4F17A 2B86A 3SEMA 2YUOA 4RG8A 4PJOC 4QQ6A 4AG1C 3QHSA 2L8DA 2RN8A 1QWFA 4L59A 1NG2A 2CYZB 2CGHA 2PVDB 1H3ZA 3VRZA 4TVRA 1FXXA 4OGEA 1C0MA 1GBQA 5IAYA 4F7UB 3SDZA 3L2UA 4M78D 4B6MA 1NLOC 2LQWA 1PRMC 2QGFB 4E6RA 2DTIA 3A5ZB 4M78F 1QCOA 4PL6A 5IHNA 3JB9D 1Q81R 2A0FB 4M7DE 4MMLA 1YJ9Q 2FRYA 2JUFA 2HSEB 2KAFA 1MV0B 1SSFA 4J9FA 5LJ3j 3FEOA 4DBRA 1G2BA 2RQRA 1M27C 2O4XA 5LJ5j 3VYHB 1PHTA 3R6OA 2BE7D 3OYJA 1PC0A 3BDUA 4OMQA 2CT3A 4C0DC 3QZ5B 2D0QB 3KBGA 1FMVA 2VXEA 2YLBA 2F2WA 1MNEA 4M7DB 5LJ5f 4VUBA 5FU6B 1UGPB 4QQGA 4MZPA 4M7DC 1X27A 2MF2A 4XTYA 4M7AA 4L5GA 3EFRA 3JCMe 1OEBA 2X51A 3CCLT 2HCKA 1YCSB 3UWNA 3AT1B 4JZ3A 2EIFA 3S6WA 2CZ0B 1M8MA 4C5HA 2YSQA 1UECA 4RTVA 3MP8A 3DB4A 2QTXA 4M7DD 3EHRA 1PCXA 3L2QA 1G3SA 2QG9B 2DYBA 1VQ4A 4QW2A 2DBKA 3M4YA 3S3MA 2QI2A 1VQMA 2KXDA 2DF6A 3GPLA 4C8QC 1NYFA 2DJZA 2L0AA 2NWMA 2I0NA 4R56A 2JN0A 3FIFA 2AKKA 2HKNA 4F04B 4FYVB 2RB6A 3X28B 3H0FA 1JO8A 3OMGA 3OS1A 2RI5A 4NL3A 1BCOA 1WNLA 2CP5A 3HRSA 4DBFA 1M5Q1 2CH4W 2EYXA 3NTHA 3L1AA 4QVZA 1SKUB 3V8KA 4C0GA 2DM1A 1D09B 1S72T 2KRSA 4NS5A 1YIJA 1QMCA 3VS4A 1NJIC 1UEBA 3CCSQ 1WX6A 3NTKA 1M2VA 2ABLA 1ZUKA 1ZSGA 2F69A 5KCHA 1KD1C 1BIAA 2L2PA 2KYBA 1ABOA 1U5SA 3PVQA 4II1A 2KROA 5FWCA 2YRCA 3J80E 2HQXA 4XU2A 1K9MR 2L5QA 3CCEA 4J6XA 3OYHA 4JS4A 2R5AA 3RNJA 3SWNA 3CCQA 2YUPA 1B34A 4RUGA 1VIFA 2BZXA 2CP2A 3TSWA 4XK8E 1JEGA 1AZGB 1WHJA 1Q86R 1N9RA 4GY5A 5GAN4 1QVGA 4PJLA 8ATCB 2JOYA 4Z8AA 3OYBA 4LUEA 1PD0A 3VS3A 2JNGA 3CBPA 5CO7A 1BI0A 1YITT 1KD1R 2E12A 3M9QA 2KSSA 3RESA 3QDFA 1SRMA 4N4GA 3I56T 2E70A 3CD6Q 1H641 3PE0A 1KSWA 2KGTA 2K3BA 1VQ9Q 3EG1A 2QA4A 3QWXX 3OBYA 2W0ZA 1E6HA 3CBMA 2E6NA 2DJQA 1VQ6T 2VGMA 2JM8A 3D7SB 2CKKA 2QEXQ 4PJOD 4J9CA 1M3BA 3ZFJA 3CC4A 1GL5A 3RR6A 1BBZA 4ORZA 2RJCA 4OF1A 5CAIA 1YJ9T 4BE0A 1X43A 3QO3A 1N8RC 1N6AA 3QYGB 2RHIA 3EGUA 5GANd 4OB2B 3OYCA 1SEMA 2HQEA 2WSFE 3RMQA 1BIBA 1R0BG 1T3SA 2FG0A 2DD4A 4X1VA 3TREA 2E5QA 3N5BB 3CXCA 1YJ9A 4XTWA 3G71T 4EMKA 1W2BP 1SRLA 2M9UA 4LE9A 1YHQQ 4FT2A 2M1HA 2RQTA 1CKBA 3A8HB 4XU3A 2ENMA 1VQNA 4FL6A 4N0AC 2EKOA 3A8MB 4XTXA 1I1JA 1J3TA 2YUNA 1RAEB 1QVGS 1VQ5T 2AZVA 2DIQA 3CCMQ 1H8KA 1JQQA 4KULA 5A0LA 4PFOA 1YWOA 2RHYA 1NJIR 2RI3A 1FWZA 2EJGA 1Q7YU 1XQHA 5CIUA 5GMKe 1QVFP 2O9SA 1ABQA 2OI3A 3U23A 2E3IA 3L2WA 1RLPC 4KRTA 2YRDA 1WXUA 2QGGA 4J9DA 1SPKA 4EMGA 5GAN3 2RQUA 2OAUA 4B9XA 4HT8A 2KVQG 1WIEA 5CQYA 3BW1A 3P8HA 1C1AA 1UGRB 4RMOA 3CPWA 1ZA1B 5KYXB 5KE3A 2LJ3A 4HCBA 2XI9A 1ZUYA 3PGGA 4BE2A 4EPCA 2BUDA 4M7AE 4KGXB 5GANj 1PNJA 5AYFA 5GAN8 1YITQ 2CREA 2DXTA 2LCSA 1JU5C 3M0RA 4PFZA 5DLOA 3RERA 2VGNA 2GTJA 2JS2A 3EH2A 4HVWA 2E5KA 4M78G 1Q95G 4M75E 2BTTA 1B7TA 2DKGA 1YWPA 5FLXE 4AMCA 1Q82R 4AFSC 4PJOB 4J9GA 2DZ9A 2PUOB 2BIVA 1JBMA 3HTRA 4PJJA 4A4GA 2J6OA 4R0KA 1Y7XA 3QBYA 3I55A 5GMKh 3NTIA 1K0XA 2OTLA 2YUQA 3LGFA 1W4SA 4LDYA 5D7UA 3CBOA 4D8KA 4ESRA 1YHQA 5LJ5h 5KH6A 2KDSA 2Y4XA 2V8KA 4RG2A 5FWBA 4O5VA 4OMMA 1QVFS 2Z0WA 2JJ9A 2DL8A 2LCLA 2ED0A 1D1CA 2EQIA 1ARKA 1G3YA 1F1BB 4IUQA 5CK9A 2OTLT 5FROA 1Y0MA 4PJOA 2HMAA 4M7DF 1Q7YC 3G4ST 1FX7A 1X6GA 5GANf 1UFFA 2FL7A 3NGPA 3WVEB 1MNDA 2KT8A 5CR2A 2DEUA 1Z9ZA 3C12A 2QEXA 1X01A 3URGA 5CKHA 2MI6A 3EH1A 1NZ9A 4J8OA 2VB6A 1OPLA 3FRNA 2CP7A 1TUCA 3E2UA 3CCET 2KYMA 1GRIA 2R57A 1EX4A 1Y71A 3DB3A 2A36A 1G3WA 5LL6S 1TTHB 3EG3A 2KBTA 1W2BS 2ZGWA 2OTLQ 2JXBA 3L2ZA 2LCCA 4QKUA 2FHDA 2QXFA 4XTZA 4GLMA 2JS0A 2JM9A 2Y90A 2CZ1B 4RCBA 2KMTA 3RKWA 4M75A 4OMNA 5GAN2 4LDVA 1RAHB 2D6FA 1B34B 4BD3A 1N8RU 3H0IA 3SWNC 3M59A 1IZ6A 2G6FX 4BY6B 2OAWA 4Y91A 1QWEA 2ZPGB 2VV5A 3V7SA 3EGXA 4C92F 1RACB 1OZ2A 1OPKA 3OS0A 5GAMe 1H92A 5IT9E 2D1XA 4M7DG 4X9CA 4RTZA 2ATCB 2GQVA 1MMDA 2RJFA 4WF2A 1IRXA 4BDZA 5LJ3e 1UJ0A 3JCMh 4PJOE 2XG8D 2F5KA 2J6FA 1AD5A 2PQWA 2F5TX 3LYIA 1AT1B 4RTWA 3UDCA 4IUTA 2DA9A 1VQ7Q 2MOXA 4KH1B 3VS7A 2QQRA 4PFPA 4C92G 3CCSA 5GMKm 4Z02A 1B07A 2RK2A 4FIBA 1KC8R 2O2OA 3C94A 3H6ZA 1JJ2S 3ZEHA 3EG2A 4N4HA 1LNXA 3CCEQ 1TH7A 2X4XA 1R0CB 3C4SA 2FRWA 1KD1U
chains in the Genus database with same CATH topology
1S72T 1YIJA 4NS5A 3M5AA 2L3RA 3L2VA 2QEXT 2P4TA 3E1SA 3JCMb 5GANg 2HBPA 4QQDA 2LQ8A 5GAOp 4M77C 2EFIA 1NJIU 3JCMg 1N27A 2X4JA 3ZBDA 1NJIC 2XD0A 3P8BB 4JS5A 4C0DB 1UEBA 1WJQA 3SFMA 3NTKA 4QVCA 3CCUT 4OGCA 4XAXB 1OYXA 4LDXA 2F69A 5KCHA 2VXFA 4C8QG 1KD1C 1BIAA 3X24B 1DJ7B 3OYYA 4Q5WA 4LDWA 3UT1A 3CCLA 2K4YA 3CPFA 1VQ9A 4II1A 3J80E 4JLGA 1AHJB 3JCMV 1YJWT 2HQXA 3QDRB 4L6V5 4MZMA 4XU2A 4BDYA 2K5LA 2L5QA 1ZQ1A 2XKOC 4J6XA 3CCEA 3VKIA 1EIFA 3OYHA 2QQ9A 2R5AA 4JS4A 1YCYA 2G3RA 3QJ6A 3SWNA 1K73C 2XIDA 3CCQA 3PIOA 1QP3A 4M78C 1B34A 1M1GA 1VIFA 3CEYA 5KE2A 3L2RA 3CCMA 4FU6A 3QYHB 4O6JA 4M7DA 1HK9A 2O4XB 3LLRA 4XK8E 2I2LA 4M75D 4J7FA 2CS7A 1VQLA 2YRVA 1YHQT 1N9SA 3ER0A 1N9RA 3M54A 4GY5A 4M75F 4BI3A 4BY6C 5GAN4 1QVGA 1O9SA 4M7DB 2OTJT 2XU8A 2K3XA 2JOYA 3V7RA 4JDSA 3OYBA 1I4K1 2CZ6B 3VV0A 4DOVA 4DOWA 2EQJA 2JNGA 2RJEA 3HPWA 2WSCE 3S3OA 1NE8A 3CBPA 3JB9G 4JRPA 5CO7A 1BI0A 3JCMc 4EDUA 1YITT 4N4IA 3FC3A 3L2UA 2E12A 3M9QA 2RK1A 3RKXA 4OP0A 2KSSA 3RESA 5J39A 1KC8U 4XQ3A 3PIPA 2M0OA 3HHTB 5GAMg 2ZPEB 3FB9A 4N4GA 3I56T 4DQ2A 1KC8C 2E70A 2EYQA 1H641 3LX7A 3ME9A 2DXBA 3QUIA 4OB1B 3HFNA 3OBWA 4KUIA 4ZN3A 1VQOT 2QA4A 4B9WA 2M16A 3OBYA 1YJNT 3G4SA 2DXCA 3OA6A 4C8QD 5DM7R 1VQ5A 3T9NA 3BY7A 2JTMA 2E1HA 2LT1A 4M7AF 4C8QF 3CBMA 5HK3A 3OYMA 2FB7A 2E6NA 3SD4A 1O75A 3JB9F 2HNIA 3OSSC 1VQ6T 4HT9A 2QQAA 2B8AA 1YI2T 2VGMA 3HL8A 3LWHA 3V8KA 4KUDK 5I2MA 2C06A 2EAYA 4ME7A 3CC2T 5GAMd 2DXUA 5LJ5g 1K73U 2CKKA 2X4WA 3X20B 4N0AA 3OYDA 2EWNA 2YHTA 4PJOD 1WGSA 4P5NA 2YLCA 1OI1A 3BFMA 2P0PA 3ZFJA 3JCMX 3CC4A 5I2SA 2IVWA 5CQXA 3MP6A 4FT4A 2RJCA 4OF1A 4MMKA 5J3BA 3CMET 3G6ET 4F7UF 5CAIA 5GMKj 4KT0E 1YJ9T 4BE0A 2EJ9A 3QO3A 4J83A 4XU0A 4QVDA 2QQSA 3QG1A 4M75B 1N6AA 5EG2A 5C0MA 5GAMj 1YJWA 1N8RC 1BYMA 3QKJA 3QYGB 3CCRA 2D9TA 1MGQA 2RHIA 3JSCA 3CD6T 5GANd 2V8IA 4OB2B 3OYCA 3HFOA 2HQEA 2P0QA 2DIGA 1VQ8T 4M7AD 3GNGA 2ZPBB 3LGLA 4F7UG 3HKSA 2WSFE 2ZZDA 3JB9I 1M8VA 5IN1A 2XHCA 3RMQA 3VJPA 1BIBA 4C5IA 3GNFB 3JB9H 2DD4A 3TREA 3HRUA 2E5QA 3N5BB 3AHUA 5GAOm 1VIEA 3CXCA 1YJ9A 4XTWA 2LT4A 2L89A 4M7AG 3G71T 2XDBA 4XU1A 4EMKA 3WXMB 2RM4A 4RKUE 1Y96B 4BUGA 2M9UA 3QZ9B 4PJOF 4M75G 3LH0A 2M1HA 1R8OB 4FT2A 3OW2S 4IURA 4HCZA 2IG0A 3A8HB 2H3JA 4XU3A 4MDXA 1WPYA 5A2QE 1VQNA 1M1KC 4FL6A 3M53A 4J6YA 4N0AC 1Y07A 2EKOA 5I21A 1W2BA 3A8MB 3MO8A 3CC7A 4XTXA 3PFSA 1M90U 3OYIA 4IUUA 2DPPB 2KK4A 2VUBA 2XDDA 3OB9A 4C92E 2XICA 1QVGS 1U1TA 3X26B 1LJOA 3PNWC 1VQ5T 3OMCA 1VQNT 1VQMT 3OYEA 3A8LB 2DIQA 3PMIA 1G5VA 4PNOA 3CCUA 4C92B 3S3NA 3M55A 2A7YA 1M9SA 1VQKA 4V2SA 3F70A 5LJ3f 2LDMA 3CCST 1VQ6A 4C0ZA 3OQ5A 4C92D 3PMTA 4KULA 1UGQB 3SB2A 5A0LA 5KCOA 1OZ3A 2RHYA 1XTDA 3DKMA 4E7JA 2GCXA 3CCJT 3PT9A 3LWIA 2KY9A 2RI3A 4FSXA 1FWZA 2EJGA 4M78E 1Q7YU 1XQHA 4JUVA 4A4EA 1G3TA 1JRIA 3LW5E 5CIUA 2VC8A 5GMKe 3QPHA 4R55A 1Q81U 1JB0E 3I56A 2MMPA 4C0FA 4A4HA 2DK3A 4M77G 3L2WA 4ELZC 1KQSA 3JB9J 3G6EA 1X6OA 4M77F 1WQ7A 3CXCS 1P92A 4EMGA 5GAN3 3CD6A 2OAUA 4B9XA 2NLUA 3OYKA 2KVQG 4M77D 4HT8A 3OS2A 5CQYA 3BW1A 3EAEA 3P8HA 3M4GA 3MP1A 4M77A 4A54A 1XNIA 2K5FA 1UGRB 5C6SA 5HK0A 4RMOA 1NPRA 3PTAA 3CPWA 1M4ZA 1WJSA 2XDPA 5D6WA 1X75C 3OY9A 4KBMB 4D6WA 1ZBXA 3OYGA 1I8FA 5KE3A 2ZPHB 4HCBA 2XI9A 1M1FA 2VYTA 3INZA 4BE1A 3DLLA 3PGGA 4BE2A 3NFCA 4EPCA 3HSBA 1VUBA 2BUDA 3WVDB 4M7AE 4GLKA 5FU7B 4JJNK 4PJOG 4FM4B 1KQ2A 5GANj 4E7HA 5AYFA 3CC7T 2X4YA 1KG1A 4Y28E 3VUBA 3G71A 4C8QB 5GAN8 3J7AF 2DXTA 1YJNA 5GAN6 1Q82U 2QA4T 4E7LA 2FYKA 3MEWA 3V7CA 5DLOA 1U1SA 3JCMW 2VGNA 2DD5A 3Q1JA 3RERA 1VQ7T 1VQ9T 1QVFA 3QIIA 4UC4A 4M78G 1NPPA 4HA8A 2RI2A 4M75C 5A0DA 5J26A 3FJPA 4XTVA 2QDYB 3CCJA 4M75E 4PKCC 3TU4K 5GAOr 2DKGA 5FLXE 1VQOA 1BKBA 2CZ7B 5FRNA 1S72A 3M58A 4J7IA 5CKBA 2PVOB 4PJOB 1Q86U 4ZTJA 1HXDA 2DZ9A 3CPWS 3A8OB 2RA2A 5GAOl 4LD9K 3GF5A 2PUOB 3E19A 2BIVA 3O8VA 4LDUA 1JBMA 3SWNB 4E7KA 1K8AC 1VQ8A 2DO3A 5D6YA 4A4GA 3CCVA 4C8QE 1Y7XA 3QBYA 3RIRA 2RO0A 1VQ7A 1D3BB 4LD6A 4C5GA 3I55A 5GMKh 3CCMT 3NTIA 1RL2A 2X35A 2OTLA 2RH2A 5HY6A 5DY9A 5M9OA 3JCMJ 3LGFA 1W4SA 4LDYA 3CC2A 4MZTA 3GOXA 1Y96A 4CRIA 1LOJA 2PUKB 3CBOA 3C95A 3OS5A 3EFSA 4CI0C 3VUZA 5LJ5h 3CC4T 2PU9B 1KQ1A 5D6XA 2KDSA 2R5MA 2V8KA 2Y4XA 4RCCA 4OVAA 2K2VA 4OB3B 4RG2A 2P0KA 4O5VA 2LVMA 4ZN1A 5GMKi 3OYLA 2QQBA 3HP9A 3I55T 1QVFS 2LCLA 4HCCA 4MDWA 1UGSB 4IUPA 4BI8B 1KHCA 3J81E 3ASKA 3RKYA 1G3YA 3JCMP 2GFUA 4IUQA 5GANe 3H8ZA 5CK9A 2OTLT 4PLLA 5FROA 2JVVA 3JCMQ 1I81A 2JZ2A 2LTOA 4PJOA 2DTOA 3QJYA 3G7ZA 3QSUA 5GAN5 3KUFA 4F7UE 4NOYA 1K9MU 2E41A 2E65A 4M7DF 3M57A 2EQMA 5GANh 1Q7YC 2EQUA 3E9FA 3FLGA 4X34A 3G4ST 1FX7A 2E10A 5GANf 1XOVA 4PLIA 5LJ5e 2FL7A 3BDLA 2E64A 2JTFA 2K3YA 3WVEB 1VQ4T 1YHQA 1K9MC 3FDRA 3KXTA 5CKFA 5FU7C 4E7IA 2KQWA 3MEVA 2V8JA 3GP8A 4M78A 4RG8A 4PJOC 5CR2A 1IREB 4QQ6A 3C12A 3QHSA 5HKCA 2QEXA 2L8DA 2RHUA 1X01A 4L59A 1UB4A 3URGA 4C5EA 2CYZB 5GAMf 2CGHA 2PVDB 5CKHA 5GMKl 1H3ZA 4TVRA 2MI6A 5FRMA 1NZ9A 1FXXA 4J8OA 3FRNA 4OGEA 4X9DA 2WACA 5DLQE 5CKEA 3JAME 2PVGB 2WSEE 1GXIE 5IAYA 2E6ZA 5GAN7 4C92A 1YI2A 4F7UB 3CCET 3SDZA 3GLXA 1PSEA 2R57A 4M78D 3RMSA 3TEEA 1WJRA 3HRTA 1Y71A 3DB3A 2MWOA 1M1KU 2DTIA 2DVEA 3A5ZB 3P8DA 4M78F 4PL6A 1G3WA 3JB9D 4JLIA 5LL6S 2HD0A 2Y4YA 4J6WA 4M7AB 4M7DE 4MMLA 2JUFA 2ZPFB 4OMFB 2KAFA 5LJ3g 1W2BS 2ZGWA 2RHZA 1SSFA 5LJ3j 5GAOq 3FEOA 3JCMf 1K8AU 3L2ZA 2LCCA 2LQKA 2O4XA 5LJ5j 3CCVT 1I5LA 2FHDA 2QXFA 4XTZA 2EQKA 3R6OA 3VYHB 4OB0B 1Q86C 2HAXA 3OYJA 3BDUA 4C0DC 3MHXA 2ZPIB 2LX9A 2Y90A 2CZ1B 4JRKA 4RCBA 3JCMd 4M7AC 3X25B 2KMTA 3QZ5B 4YTLA 2D0QB 5LJ5d 1VQKT 3KBGA 3RKWA 4M75A 2O01E 5KH6A 1VQPA 5GAN2 4M77E 2VXEA 4LDVA 1QP2A 2R58A 1B34B 2YLBA 4BD3A 4BB7A 1N8RU 2D6FA 1Q82C 3SWNC 1U8RA 3M59A 3MCAB 4VUBA 5FU6B 1IZ6A 5L8RE 3V8LA 5LJ5f 4BY6B 3CCRT 2RJDA 1VQLT 1UGPB 4QQGA 4MZPA 4A4KA 4M7DC 3OYAA 2MF2A 4C92C 2DZCA 4HKEA 4XTYA 5CCAA 4C8QA 4M7AA 4Y91A 4L5GA 4ATOA 3UPUA 2BKDN 3EFRA 4DA4A 3CMEA 3VU3C 3JCMe 5GAMh 3GIBA 2OTJA 1JJ2A 2FVUA 4JRQA 2ZPGB 2VV5A 3DLMA 3MEAA 3V7SA 5A0GA 4EMKB 4C92F 3A8GB 2DEQA 3CCLT 1OZ2A 3OSVA 3UWNA 1BI3A 5GAMe 3OS0A 4ZTFA 5IT9E 2DTHA 4A53A 3CMAT 2EIFA 3S6WA 4XTUA 4ZGEB 2CZ0B 1BI1A 4C5HA 2EJFA 4M7DG 3E9GA 4X9CA 2DAQA 3MP8A 3DB4A 4A4FA 2GQVA 1QVPA 2QTXA 4BACA 4IKFA 2RJFA 4WF2A 4M7DD 4EMKC 4BDZA 2AHJB 1Q81C 5LJ3e 3V8JA 3RUXA 1VQPT 3L2QA 3JCMh 2K57A 2XG8D 4ZGDB 4PJOE 2XK0A 1D3BA 1G3SA 2F5KA 1YIJT 1VQ4A 1V29B 4QW2A 2PQWA 2F5TX 3LYIA 3QXEB 3M4YA 5LJ3h 3S3MA 2RD1A 3UDCA 1WQWA 2QI2A 1YBYA 4IUTA 1VQMA 4EMHA 2A3LA 2GFAA 3META 1YITA 1ZHIA 3L42A 3TCJA 3GPLA 2QQRA 4C92G 4C8QC 3CCSA 5GMKm 1RI0A 4JRIA 1KQSS 2DJZA 4Z02A 3M56A 4E47A 1PSFA 4M78B 4R56A 2LNVA 2JN0A 2RK2A 4FIBA 3OW2A 5FU6C 3FIFA 4QVZA 4BI4A 3CMAA 1M90C 2RHXA 1KHIA 2MWPA 3OYNA 3C94A 1BI2A 2K5IA 2RB6A 2ZCFB 3H6ZA 4IUVA 3ZEHA 1JJ2S 2GF7A 4N4HA 3X28B 1MHNA 4ZGJB 5GAOn 5CVIA 1LNXA 3OMGA 3JRZA 3OS1A 2LRQA 4M77B 2RI5A 4ELYC 4J5YA 1TH7A 4NL3A 1WNLA 3CCQT 3VYGA 2X4XA 3HRSA 5LJ3d 3MEUA 5CKDA 4NL2A 1QW1A 1M5Q1 3C4SA 3NTHA 4F7UA 3L1AA 2MAMA 3OYFA 2LC4A 1KD1U 4C0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QKJ A;  3QII A;  2D9T A;  4NS5 A;  2LCC A;  2L3R A;  2O4X A;  4UC4 A;  2RHI A;  2RI2 A;  3L2V A;  5J26 A;  2FHD A;  3OYC A;  2EQK A;  2HQE A;  2DIG A;  4QQD A;  3OYJ A;  3LGL A;  2EFI A;  1N27 A;  5IN1 A;  5FRN A;  4C5I A;  1WJQ A;  4ZTJ A;  3NTK A;  2E5Q A;  1OYX A;  2L89 A;  3O8V A;  2BIV A;  5KCH A;  4E7K A;  2R58 A;  4BD3 A;  5D6Y A;  4A4G A;  4Q5W A;  3UT1 A;  3QBY A;  2RO0 A;  4II1 A;  2RJD A;  4LD6 A;  3LH0 A;  2M1H A;  4QQG A;  4C5G A;  4IUR A;  4HCZ A;  2HQX A;  3NTI A;  3OYA A;  2X35 A;  2IG0 A;  4BDY A;  5M9O A;  2BKD N;  3LGF A;  3OYH A;  3GOX A;  2R5A A;  2G3R A;  4FL6 A;  3QJ6 A;  4CRI A;  2EKO A;  3DLM A;  3MEA A;  3MO8 A;  5FRM A;  5KH6 A;  3CEY A;  5D6X A;  5KE2 A;  2R5M A;  4RG2 A;  3L2R A;  4FU6 A;  4OVA A;  3PFS A;  2P0K A;  3OYI A;  2LVM A;  3LLR A;  2O4X B;  4IUU A;  3OYL A;  1OZ2 A;  3OB9 A;  2YRV A;  3UWN A;  3OS0 A;  4ZTF A;  3PNW C;  4GY5 A;  3OMC A;  4IUP A;  3S6W A;  1KHC A;  3OYE A;  2K3X A;  2DIQ A;  3ASK A;  3PMI A;  1G5V A;  2GFU A;  4IUQ A;  4C5H A;  3H8Z A;  3OYB A;  3E9G A;  4PLL A;  2DAQ A;  5FRO A;  2EQJ A;  2JZ2 A;  3MP8 A;  3F70 A;  2RJE A;  3DB4 A;  4A4F A;  2LDM A;  3S3O A;  4IKF A;  2LTO A;  3OQ5 A;  4BAC A;  2RJF A;  3PMT A;  5KCO A;  1OZ3 A;  4EDU A;  4N4I A;  2RHY A;  3KUF A;  3FC3 A;  4E7J A;  4BDZ A;  3M9Q A;  2EQM A;  3L2Q A;  2EQU A;  2RI3 A;  3E9F A;  3FLG A;  4X34 A;  2XK0 A;  5J39 A;  2M0O A;  2F5K A;  4PLI A;  4N4G A;  3BDL A;  4A4E A;  2JTF A;  2K3Y A;  3LX7 A;  3ME9 A;  5CIU A;  3FDR A;  4QW2 A;  2PQW A;  4A4H A;  4E7I A;  3MEV A;  3LYI A;  3L2W A;  4B9W A;  2M16 A;  3S3M A;  3OA6 A;  4IUT A;  2GFA A;  3MET A;  4QQ6 A;  2L8D A;  3L42 A;  2RHU A;  2NLU A;  4L59 A;  4B9X A;  2QQR A;  3OYK A;  4C5E A;  3OYM A;  2E6N A;  3OS2 A;  3S3N A;  1H3Z A;  3EAE A;  1RI0 A;  3MP1 A;  3P8H A;  3SD4 A;  1XNI A;  4Z02 A;  5C6S A;  5D6W A;  1WJS A;  2XDP A;  2B8A A;  3OY9 A;  3OYG A;  2WAC A;  5KE3 A;  2VYT A;  2RHX A;  4BE1 A;  2MWP A;  5IAY A;  4BE2 A;  3OYN A;  2BUD A;  3H6Z A;  4IUV A;  2R57 A;  3L2U A;  3ZEH A;  1WJR A;  2GF7 A;  4N4H A;  3DB3 A;  1MHN A;  2CKK A;  2MWO A;  2X4W A;  3OYD A;  3OMG A;  3P8D A;  1WGS A;  3OS1 A;  4E7H A;  2LRQ A;  4PL6 A;  1OI1 A;  2RI5 A;  2X4Y A;  3MP6 A;  2X4X A;  2RJC A;  3MEU A;  2RHZ A;  4BE0 A;  3C4S A;  1SSF A;  3MEW A;  4E7L A;  3NTH A;  2QQS A;  5C0M A;  4QVZ A;  3OYF A;  3FEO A;  3Q1J A; 
#chains in the Genus database with same CATH topology
 5GJW B;  5AT1 B;  2L3R A;  3L2V A;  1VQ4 Q;  2OTJ Q;  2P4T A;  1HSQ A;  3JCM b;  5GAN g;  4QQD A;  1PWT A;  4M77 C;  3SHW A;  1NJI U;  3IQL A;  1NYG A;  4C0D B;  1SHF A;  3CCU T;  4XAX B;  2K79 A;  1D0Z A;  2VXF A;  4C8Q G;  1W6X A;  5IHI A;  1SG5 A;  3CMA Q;  4JLG A;  1YJW T;  2LP5 A;  3QDR B;  2K5L A;  1ZQ1 A;  3VKI A;  1EIF A;  3QJ6 A;  1K73 C;  4FYY B;  4M78 C;  1M1G A;  3CCM A;  1HK9 A;  2O4X B;  2C0T A;  2I2L A;  2A37 A;  1VQL A;  2RQV A;  1YHQ T;  2HQH A;  1C6V X;  3CCV Q;  2OTJ T;  4IIO A;  2CZ6 B;  2RJE A;  3HPW A;  3S3O A;  1NE8 A;  2CH4 A;  4EDU A;  3FC3 A;  1ZA2 B;  3RKX A;  1KC8 U;  2M0O A;  3HHT B;  2EYQ A;  5CKB A;  3ME9 A;  4OB1 B;  3HFN A;  2EVR A;  4B9W A;  2M16 A;  1YJN T;  3OA6 A;  1M30 A;  1WXT A;  5KYX A;  3BY7 A;  3VS1 A;  1HJD A;  3SD4 A;  1O75 A;  1GFC A;  1X69 A;  3HL8 A;  2HKQ B;  4KUD K;  2EAY A;  1VYU A;  5GJV B;  7AT1 B;  2EGE A;  5LJ5 g;  1GBR A;  2X4W A;  3X20 B;  1KQS P;  2EYZ A;  2EWN A;  4P5N A;  1OI1 A;  1VQ6 Q;  2P0P A;  4FT4 A;  4AT1 B;  1OOT A;  5GMK j;  2CUB A;  2EJ9 A;  5EG2 A;  3EG9 A;  5GAM j;  3H9N A;  1BYM A;  2D9T A;  1MGQ A;  1IHV A;  3CD6 T;  2ZAE A;  2V8I A;  1VQ8 T;  1SHG A;  4M7A D;  3GNG A;  4KGZ B;  1OV3 A;  3M0U A;  3JB9 I;  5IN1 A;  1WYX A;  1M3A A;  3MPU B;  1UGV A;  2QTV A;  3AHU A;  1VIE A;  1NM7 A;  1TG0 A;  4M7A G;  4XU1 A;  4RKU E;  2NUP B;  1H3H A;  3QZ9 B;  2COW A;  4J9E A;  2V1R A;  3LH0 A;  1R8O B;  2H3J A;  3VS5 A;  3CC7 A;  1M90 U;  1T0J A;  2KK4 A;  3PVL A;  2XDD A;  1AEY A;  1QCN A;  2YT6 A;  3PNW C;  3OMC A;  1VQN T;  1QKW A;  3OYE A;  2COZ A;  1KK7 A;  1ZSZ A;  4OML A;  3RDV A;  4C92 B;  1VQL Q;  1M9S A;  1QQJ A;  5LJ3 f;  2LDM A;  3CCS T;  1UGQ B;  3SB2 A;  1D1A A;  1OZ3 A;  1XTD A;  3PT9 A;  2KY9 A;  2ROL A;  3TVT A;  4M78 E;  2VC8 A;  3QPH A;  1Q81 U;  1JB0 E;  2MMP A;  1KQS A;  4HXJ A;  3JB9 J;  2DL5 A;  3G6E A;  1X6O A;  4M77 F;  3CD6 A;  4M77 D;  3VS2 A;  3MP1 A;  1WLP B;  2LQN A;  1WJS A;  2LJ1 A;  1ZBX A;  2ZPH B;  4BE1 A;  3NFC A;  2MPX C;  4JJN K;  2F1L A;  1X2Q A;  2X4Y A;  1E6G A;  1RAF B;  1ZUU A;  4Y28 E;  4KGV B;  3VUB A;  3J7A F;  2DER A;  2CSQ A;  4FCY A;  1OQK A;  5GAN 6;  1Q82 U;  3MEW A;  2F2V A;  2JTE A;  3V7C A;  1VQ7 T;  2L3P A;  1QVF A;  1NPP A;  4FYX B;  5J26 A;  3H41 A;  5IH2 A;  4JJB A;  2DLP A;  2DNU A;  3REB B;  2J6K A;  1S72 A;  3M58 A;  2DRM A;  1IXD A;  2RA2 A;  3UF4 A;  2XMF A;  3SWN B;  1K8A C;  2HL5 C;  3CCV A;  4E7S A;  2RO0 A;  3I5R A;  1D3B B;  4C5G A;  4F14 A;  1RL2 A;  2NYS A;  2X35 A;  4PJN A;  1M2V B;  2RQW A;  1RLQ C;  1OX8 A;  1WZO A;  2HBW A;  1TOV A;  4J9B A;  2FPE A;  3C95 A;  4CI0 C;  3VUZ A;  5FRM A;  2PU9 B;  4OB3 B;  4ZN1 A;  3I55 T;  3HP9 A;  4BI8 B;  4IUP A;  2LZ6 B;  3ASK A;  3RKY A;  2RNA A;  5GAN e;  2JVV A;  1ZX6 A;  2GBQ A;  4ANJ A;  3QJY A;  1D0Y A;  3QSU A;  3KUF A;  3CCQ Q;  2EQM A;  2EQU A;  3FLG A;  5LJ5 e;  1K9M C;  3FDR A;  2AK5 A;  3MEV A;  1BB9 A;  2V8J A;  4M78 A;  1IRE B;  5HKC A;  1TS9 A;  4C5E A;  5GAM f;  3EGX B;  2K6D A;  4X9D A;  5KYN A;  2WAC A;  2KR3 A;  5DLQ E;  2PVG B;  5GAN 7;  3CXC P;  1YI2 A;  3GLX A;  1PSE A;  3RMS A;  2DET A;  2MWO A;  2QK0 A;  2DL7 A;  1AWJ A;  4JJC A;  1ZLM A;  2Y4Y A;  4J6W A;  4M7A B;  3NPF A;  2ZPF B;  3CME Q;  2KRN A;  2RHZ A;  1NEG A;  1XJW B;  4KH0 B;  1RAD B;  1WHG A;  5GAO q;  2BZY A;  3JCM f;  3ZL7 C;  2LQK A;  4IIM A;  1Q86 C;  2EQK A;  1ZBJ A;  4OB0 B;  2VKN A;  2LX9 A;  3JCM d;  3X25 B;  4YTL A;  5LJ5 d;  1VQK T;  1GCQ A;  1MUZ A;  2O01 E;  4JJD A;  1WHL A;  1QP2 A;  4BB7 A;  1LCK A;  3MCA B;  4LXC A;  1VQL T;  3C0C A;  3V8L A;  1T3L A;  2RJD A;  2YWW A;  3OYA A;  4HKE A;  2HEQ A;  3UPU A;  2BKD N;  4DA4 A;  3GIB A;  4JRQ A;  3DLM A;  4EMK B;  1HYO A;  3A8G B;  1BI3 A;  3THK A;  2DTH A;  4A53 A;  3CMA T;  4XTU A;  2SEM A;  1VQN Q;  3E9G A;  1G8X A;  2DAQ A;  1QVP A;  4BAC A;  4IKF A;  5IHK A;  2NUT A;  4OMP A;  2K57 A;  2XK0 A;  2BZ8 A;  2EGA A;  1V29 B;  4J9I A;  2E3H A;  2RD1 A;  1YBY A;  1YP5 A;  4EMH A;  2A3L A;  2DBM A;  1ZHI A;  6AT1 B;  1RI0 A;  2D8J A;  3M56 A;  4E47 A;  1PSF A;  4M78 B;  2LNV A;  4RTU A;  3OW2 A;  3CMA A;  2K7A A;  1KHI A;  1BI2 A;  4IUV A;  3I56 Q;  5GAO n;  1PRL C;  1V76 A;  3EGD B;  3FJ5 A;  5CVI A;  3M0Q A;  2CDT A;  1UHF A;  2LRQ A;  4M77 B;  1KIK A;  3EG0 A;  4HVV A;  1WHK A;  1M90 R;  1YN8 A;  5LJ3 d;  3MEU A;  3OYF A;  2MAM A;  2LC4 A;  3TSZ A;  1NBE B;  3M5A A;  1VQM Q;  3E1S A;  4M4Z A;  2HBP A;  5GAO p;  2EFI A;  2HL3 A;  1N27 A;  2X4J A;  3ZBD A;  2XD0 A;  3P8B B;  5IXB A;  4RTX A;  1WJQ A;  3SFM A;  1PKT A;  4OGC A;  2DX1 A;  1OYX A;  4LDX A;  5KYW A;  1X6B A;  3NHN A;  2K9G A;  4Q5W A;  3UT1 A;  3CCL A;  1YFN A;  3CPF A;  1AHJ B;  4L6V 5;  4MZM A;  1U06 A;  4BDY A;  1K8A R;  2XKO C;  1TWB A;  4EIK A;  2MK5 A;  3L2R A;  4FU6 A;  1I5O B;  3LLR A;  4J7F A;  2OJ2 A;  1N9S A;  3ER0 A;  3M54 A;  4BI3 A;  4WCI A;  1VYV A;  2K3X A;  1NEB A;  3V7R A;  3VV0 A;  4DOV A;  2EQJ A;  4JRP A;  3JCM c;  3A1P A;  1BU1 A;  2LX7 A;  2DVJ A;  4OP0 A;  8AT1 B;  3PIP A;  2FO0 A;  2ZPE B;  3FB9 A;  5KYY B;  3G4S A;  2DXC A;  5IXF A;  1VQ5 A;  3T9N A;  2JTM A;  2DIL A;  2E1H A;  2LT1 A;  2KEA A;  5HK3 A;  2FB7 A;  2OX7 A;  3JB9 F;  2HNI A;  1Z9Q A;  1VQK Q;  2JMC A;  1QLY A;  1YI2 T;  1JXM A;  5I2M A;  2C06 A;  2VWF A;  4ME7 A;  2FPF A;  4FW1 A;  2C0I A;  5GAM d;  2DXU A;  3VS0 A;  2MIO A;  3CQT A;  2YLC A;  3BFM A;  5CQX A;  3MP6 A;  3NMZ C;  4OMO A;  4MMK A;  5J3B A;  3CME T;  4F7U F;  4QVD A;  3QG1 A;  4M75 B;  5C0M A;  3VS6 A;  2LMJ A;  2HDA A;  1E7O A;  3HFO A;  2P0Q A;  2DIG A;  4JZ4 A;  2EYY A;  2HZY A;  2ZPB B;  3LGL A;  4C5I A;  3GNF B;  3JB9 H;  3HRU A;  1OU9 A;  2FPD A;  2L89 A;  1D0X A;  1MMG A;  2FZK B;  2EGC A;  2XDB A;  2RM4 A;  1Y96 B;  4BUG A;  1Q7Y R;  4PJO F;  3OW2 S;  4IUR A;  4HCZ A;  2IG0 A;  1AWW A;  1KJW A;  1WPY A;  5A2Q E;  1M1K C;  1Y07 A;  1W2B A;  1LPL A;  3EG9 B;  3CCJ Q;  1FMK A;  2QYZ A;  3PFS A;  3OYI A;  4IUU A;  2DPP B;  1VA7 A;  1WHH A;  3OB9 A;  1MV3 A;  3KFV A;  1U1T A;  1AWX A;  1JXO A;  3X26 B;  1LJO A;  1S1N A;  1GFD A;  3A8L B;  3PMI A;  1G5V A;  1VQK A;  2C0O A;  1VOM A;  4AFQ C;  3OQ5 A;  4C92 D;  5KCO A;  1RI9 A;  1QCF A;  3I55 Q;  3DKM A;  1BK2 A;  2GCX A;  5EC7 A;  3CCJ T;  3LWI A;  4FSX A;  1W1F A;  4JUV A;  4A4E A;  3LW5 E;  4R55 A;  4PJM A;  3I56 A;  4A4H A;  2DK3 A;  4M77 G;  4ELZ C;  2SRC A;  3CXC S;  1P92 A;  1S72 Q;  1G83 A;  5I11 A;  3OS2 A;  2F2X A;  3EAE A;  4A54 A;  2K5F A;  3PTA A;  2JT4 A;  1NPR A;  1M4Z A;  2FEI A;  2XDP A;  1X75 C;  3OY9 A;  4KBM B;  1I8F A;  2ESW A;  1M1F A;  2VYT A;  3GBQ A;  3HSB A;  3WVD B;  4GLK A;  5FU7 B;  1YIJ Q;  1KQ2 A;  4E7H A;  3CC2 Q;  1KG1 A;  1RAG B;  3G71 A;  4C8Q B;  1YJN A;  4J9H A;  2L3S A;  2QA4 T;  4E7L A;  2FYK A;  2L3Q A;  1YJN Q;  3JCM W;  3Q1J A;  4UC4 A;  4HA8 A;  2RI2 A;  1GCQ C;  1PG5 B;  5A0D A;  2CP0 A;  4XTV A;  2QDY B;  1VQO Q;  4PKC C;  5KYW B;  1N8R R;  1VQO A;  1BKB A;  4DBH A;  1W70 A;  1YI2 Q;  1N5Z A;  1Q86 U;  3G4S Q;  5GAO l;  1CKA A;  3E19 A;  3O8V A;  4LDU A;  4E7K A;  4DEY A;  2DO3 A;  5D6Y A;  1I07 A;  4C8Q E;  4AFZ C;  3RIR A;  1VQ7 A;  1PKS A;  4LD6 A;  2LJ0 A;  3JCM J;  4A63 B;  2AZS A;  4MZT A;  3GOX A;  1FYN A;  1Y96 A;  4CRI A;  1R77 A;  3CC4 T;  2CP3 A;  2QDL A;  5D6X A;  1VQ6 A;  2P0K A;  2IIM A;  1PM3 A;  2DMO A;  3TQ7 P;  4MDW A;  4FW2 A;  3J81 E;  2X9H A;  3H8Z A;  4PLL A;  1UJY A;  3JCM Q;  1MMA A;  2JZ2 A;  4QT7 A;  2DTO A;  1IGU A;  1I0C A;  4NOY A;  1K9M U;  2E41 A;  2E65 A;  3M57 A;  2DL3 A;  3E9F A;  1UHC A;  1XOV A;  9ATC B;  5HCK A;  1UE9 A;  2JTF A;  2K3Y A;  1VQ4 T;  2KRM A;  3KXT A;  5FU7 C;  4E7I A;  2KQW A;  3GP8 A;  3M0T A;  4RTY A;  2RHU A;  1UB4 A;  4Z88 A;  5GMK l;  2H3E B;  1U3O A;  3JAM E;  5CKE A;  3MJX A;  2WSE E;  2ECZ A;  1GXI E;  2E6Z A;  4C92 A;  3TEE A;  1WJR A;  3HRT A;  1M1K U;  2P84 A;  2DVE A;  2VAS A;  3P8D A;  2LNH B;  3VRY A;  1UTI A;  4JLI A;  2HD0 A;  2YDL A;  4OMF B;  5LJ3 g;  2MYS A;  2DL4 A;  1K8A U;  3EHQ A;  3CCV T;  3EFO B;  1I5L A;  2JW4 A;  2HAX A;  2A28 A;  2KNB B;  1K76 A;  3MHX A;  2ZPI B;  2PNI A;  4JRK A;  4M7A C;  3CC4 Q;  1VQP Q;  1VQP A;  4M77 E;  2R58 A;  1YJW Q;  1Q82 C;  1U8R A;  1X2K A;  5L8R E;  3CCR T;  3I35 A;  1KFZ A;  2RF0 A;  1LVK A;  4A4K A;  4C92 C;  2DZC A;  5CCA A;  4RTT A;  4C8Q A;  4ATO A;  3CME A;  3VU3 C;  5GAM h;  2OTJ A;  3CCU Q;  1JJ2 A;  2FVU A;  5A0G A;  3MEA A;  4E7Z A;  5FW9 A;  1EZZ B;  2H8H A;  4HVU A;  2DEQ A;  3OSV A;  2EPD A;  4ZTF A;  4ZGE B;  4CC2 A;  1BI1 A;  2EJF A;  2E4H A;  2GGR A;  1RAI B;  2CUD A;  4A4F A;  4E2F B;  3G6E Q;  4EMK C;  2JMA A;  2AHJ B;  1Q81 C;  3V8J A;  3RUX A;  1VQP T;  1OU8 A;  4ZGD B;  4GBQ A;  5I22 A;  1D3B A;  2M02 A;  1YIJ T;  1M3C A;  4WTO B;  4Y92 A;  3QXE B;  5LJ3 h;  2X3W D;  1WQW A;  1K4U S;  2GFA A;  3MET A;  3R6N A;  1YIT A;  3L42 A;  3TCJ A;  2M51 A;  1WA7 A;  1KQS S;  4JRI A;  2O31 A;  5FU6 C;  4BI4 A;  1M90 C;  2RHX A;  2MWP A;  3OYN A;  2K5I A;  2ZCF B;  1HD3 A;  2GF7 A;  2KE9 A;  1MHN A;  4ZGJ B;  1TSF A;  3JRZ A;  4ELY C;  4J5Y A;  3CCQ T;  1AZE A;  3VYG A;  2QA4 Q;  3A98 A;  5CKD A;  1UUE A;  4NL2 A;  1QW1 A;  2NUT B;  4F7U A;  2CP6 A;  1WDX A;  1NLP C;  1WFW A;  5KYY A;  2QEX T;  3UAT A;  2LQ8 A;  4DEX A;  3JCM g;  1AVZ C;  4JS5 A;  4PK4 A;  4QVC A;  2GQI A;  2DYI A;  2V1Q A;  2P4R A;  3X24 B;  1DJ7 B;  2IPO B;  3OYY A;  4LDW A;  2K4Y A;  1VQ9 A;  1M2O A;  2EBP A;  3JCM V;  2AT1 B;  4CC3 A;  2QQ9 A;  1ZSZ B;  1YCY A;  2G3R A;  2XID A;  3PIO A;  1QP3 A;  3CEY A;  5KE2 A;  2RPN A;  3QYH B;  4O6J A;  1OUL A;  4M7D A;  4M75 D;  2CS7 A;  4CC7 A;  2YRV A;  4M75 F;  4BY6 C;  1O9S A;  1RAA B;  2XU8 A;  4JDS A;  1I4K 1;  4DOW A;  1SF9 A;  2WSC E;  2K2M A;  3QWY A;  4N4I A;  2HSP A;  4D8D A;  2RK1 A;  5J39 A;  4XQ3 A;  5GAM g;  5KYU A;  1KC8 C;  4DQ2 A;  2NUP A;  1OX9 A;  3LX7 A;  3QUI A;  2DXB A;  2AIR B;  3OBW A;  4KUI A;  4ZN3 A;  1VQO T;  3MKD A;  2RMO A;  5ECA A;  4C8Q D;  5DM7 R;  2DE0 X;  3M0P A;  4M7A F;  4C8Q F;  4JPB W;  3OYM A;  2GNC A;  4LN2 A;  4HT9 A;  2KT1 A;  3OSS C;  2QQA A;  2B8A A;  1SSH A;  4K11 A;  1AOJ A;  3LWH A;  3M0S A;  4LUD A;  3CC2 T;  3UA6 A;  1K73 U;  4N0A A;  3OYD A;  1IGQ A;  2YHT A;  4CC4 B;  1WGS A;  3JCM X;  3UA7 A;  2QAZ A;  5I2S A;  2IVW A;  3H0H A;  3EFO A;  3G6E T;  3I9Q A;  1TU0 B;  2J05 A;  4KT0 E;  4J83 A;  4XU0 A;  2QQS A;  1YJW A;  3BE3 A;  2VVK A;  3QKJ A;  3CCR A;  4HCK A;  3JSC A;  2PZ1 A;  2A08 A;  4F7U G;  3HKS A;  1UG1 A;  2ZZD A;  1M8V A;  2XHC A;  3VJP A;  4AG2 C;  3REA B;  5GAO m;  4LNP A;  2LT4 A;  2KI7 A;  3WXM B;  4F16 A;  3G1J A;  1K1Z A;  4M75 G;  1RAB B;  2AKL A;  5L23 A;  4MDX A;  2MCN A;  1BCM A;  2J7I A;  3M53 A;  4J6Y A;  3CCL Q;  2PTK A;  5I21 A;  1B3Q A;  3MO8 A;  2ED1 A;  2VUB A;  3CPW P;  4C92 E;  2CT4 A;  1VYT A;  1FMW A;  2XIC A;  1WI7 A;  4FSS A;  1VQM T;  4PNO A;  3CCU A;  2DFU A;  3M55 A;  1D1B A;  2A7Y A;  4V2S A;  2KXC A;  3F70 A;  4C0Z A;  1M1K R;  3PMT A;  4E7J A;  2CSI A;  3RBB B;  1QKX A;  2EKH A;  1TUD A;  2M0Y A;  4DBQ A;  1G3T A;  1JRI A;  4C0F A;  1WQ7 A;  4Z89 A;  2NLU A;  3OYK A;  3ULR B;  1IO6 A;  3S3N A;  4M77 A;  3M4G A;  5HK0 A;  3CC7 Q;  1XNI A;  5C6S A;  4ZNX A;  3EGD A;  1T0H A;  5D6W A;  4D6W A;  3OYG A;  1GCP A;  3INZ A;  3DLL A;  1VUB A;  3O5Z A;  1VQ8 Q;  2J06 A;  4PJO G;  2FZG B;  1PD1 A;  3JV3 A;  4FM4 B;  2V26 A;  3CC7 T;  1AWO A;  2O88 A;  3I5S A;  2DRK A;  1K73 R;  1WHM A;  2YXY A;  1U1S A;  2DD5 A;  1VQ9 T;  3QII A;  4AFU C;  4M75 C;  3FJP A;  3CCJ A;  3TU4 K;  5GAO r;  2CZ7 B;  5FRN A;  1V1C A;  4J7I A;  2PVO B;  1YNZ A;  4ZTJ A;  1HXD A;  1TXQ A;  3CPW S;  3A8O B;  4LD9 K;  3GF5 A;  2W10 A;  2EYW A;  4FYW B;  1VQ8 A;  1K9A A;  2D8H A;  1Y57 A;  1RUW A;  3CCM T;  3G71 Q;  1TUG B;  2RH2 A;  5HY6 A;  5DY9 A;  5M9O A;  1K0S A;  3CC2 A;  1CSK A;  1IB8 A;  1LOJ A;  1UDL A;  2PUK B;  3OS5 A;  3EFS A;  3JB9 G;  1KQ1 A;  3LH5 A;  2NUZ A;  4RCC A;  2R5M A;  5GMK i;  4OVA A;  2K2V A;  2D0N A;  2LVM A;  3OYL A;  2QQB A;  2O9V A;  4HCC A;  1UGS B;  2BE9 B;  1KHC A;  1WXB A;  3JCM P;  2GFU A;  2FZC B;  1EFN A;  1VQ5 Q;  3CCR Q;  1JJ2 P;  2COY A;  1I81 A;  2X3X D;  5KYU B;  2QAS A;  2LTO A;  1ZSZ C;  3G7Z A;  1IHW A;  5GAN 5;  1QVG P;  4F7U E;  5GAN h;  4X34 A;  2EW3 A;  2E10 A;  4PLI A;  1ACM B;  2ROT A;  3BDL A;  1A0N B;  2E64 A;  1MMN A;  3OW2 P;  2GTO A;  5CKF A;  4F17 A;  2B86 A;  3SEM A;  2YUO A;  4RG8 A;  4PJO C;  4QQ6 A;  4AG1 C;  3QHS A;  2L8D A;  2RN8 A;  1QWF A;  4L59 A;  1NG2 A;  2CYZ B;  2CGH A;  2PVD B;  1H3Z A;  3VRZ A;  4TVR A;  1FXX A;  4OGE A;  1C0M A;  1GBQ A;  5IAY A;  4F7U B;  3SDZ A;  3L2U A;  4M78 D;  4B6M A;  1NLO C;  2LQW A;  1PRM C;  2QGF B;  4E6R A;  2DTI A;  3A5Z B;  4M78 F;  1QCO A;  4PL6 A;  5IHN A;  3JB9 D;  1Q81 R;  2A0F B;  4M7D E;  4MML A;  1YJ9 Q;  2FRY A;  2JUF A;  2HSE B;  2KAF A;  1MV0 B;  1SSF A;  4J9F A;  5LJ3 j;  3FEO A;  4DBR A;  1G2B A;  2RQR A;  1M27 C;  2O4X A;  5LJ5 j;  3VYH B;  1PHT A;  3R6O A;  2BE7 D;  3OYJ A;  1PC0 A;  3BDU A;  4OMQ A;  2CT3 A;  4C0D C;  3QZ5 B;  2D0Q B;  3KBG A;  1FMV A;  2VXE A;  2YLB A;  2F2W A;  1MNE A;  4M7D B;  5LJ5 f;  4VUB A;  5FU6 B;  1UGP B;  4QQG A;  4MZP A;  4M7D C;  1X27 A;  2MF2 A;  4XTY A;  4M7A A;  4L5G A;  3EFR A;  3JCM e;  1OEB A;  2X51 A;  3CCL T;  2HCK A;  1YCS B;  3UWN A;  3AT1 B;  4JZ3 A;  2EIF A;  3S6W A;  2CZ0 B;  1M8M A;  4C5H A;  2YSQ A;  1UEC A;  4RTV A;  3MP8 A;  3DB4 A;  2QTX A;  4M7D D;  3EHR A;  1PCX A;  3L2Q A;  1G3S A;  2QG9 B;  2DYB A;  1VQ4 A;  4QW2 A;  2DBK A;  3M4Y A;  3S3M A;  2QI2 A;  1VQM A;  2KXD A;  2DF6 A;  3GPL A;  4C8Q C;  1NYF A;  2DJZ A;  2L0A A;  2NWM A;  2I0N A;  4R56 A;  2JN0 A;  3FIF A;  2AKK A;  2HKN A;  4F04 B;  4FYV B;  2RB6 A;  3X28 B;  3H0F A;  1JO8 A;  3OMG A;  3OS1 A;  2RI5 A;  4NL3 A;  1BCO A;  1WNL A;  2CP5 A;  3HRS A;  4DBF A;  1M5Q 1;  2CH4 W;  2EYX A;  3NTH A;  3L1A A;  4QVZ A;  1SKU B;  3V8K A;  4C0G A;  2DM1 A;  1D09 B;  1S72 T;  2KRS A;  4NS5 A;  1YIJ A;  1QMC A;  3VS4 A;  1NJI C;  1UEB A;  3CCS Q;  1WX6 A;  3NTK A;  1M2V A;  2ABL A;  1ZUK A;  1ZSG A;  2F69 A;  5KCH A;  1KD1 C;  1BIA A;  2L2P A;  2KYB A;  1ABO A;  1U5S A;  3PVQ A;  4II1 A;  2KRO A;  5FWC A;  2YRC A;  3J80 E;  2HQX A;  4XU2 A;  1K9M R;  2L5Q A;  3CCE A;  4J6X A;  3OYH A;  4JS4 A;  2R5A A;  3RNJ A;  3SWN A;  3CCQ A;  2YUP A;  1B34 A;  4RUG A;  1VIF A;  2BZX A;  2CP2 A;  3TSW A;  4XK8 E;  1JEG A;  1AZG B;  1WHJ A;  1Q86 R;  1N9R A;  4GY5 A;  5GAN 4;  1QVG A;  4PJL A;  8ATC B;  2JOY A;  4Z8A A;  3OYB A;  4LUE A;  1PD0 A;  3VS3 A;  2JNG A;  3CBP A;  5CO7 A;  1BI0 A;  1YIT T;  1KD1 R;  2E12 A;  3M9Q A;  2KSS A;  3RES A;  3QDF A;  1SRM A;  4N4G A;  3I56 T;  2E70 A;  3CD6 Q;  1H64 1;  3PE0 A;  1KSW A;  2KGT A;  2K3B A;  1VQ9 Q;  3EG1 A;  2QA4 A;  3QWX X;  3OBY A;  2W0Z A;  1E6H A;  3CBM A;  2E6N A;  2DJQ A;  1VQ6 T;  2VGM A;  2JM8 A;  3D7S B;  2CKK A;  2QEX Q;  4PJO D;  4J9C A;  1M3B A;  3ZFJ A;  3CC4 A;  1GL5 A;  3RR6 A;  1BBZ A;  4ORZ A;  2RJC A;  4OF1 A;  5CAI A;  1YJ9 T;  4BE0 A;  1X43 A;  3QO3 A;  1N8R C;  1N6A A;  3QYG B;  2RHI A;  3EGU A;  5GAN d;  4OB2 B;  3OYC A;  1SEM A;  2HQE A;  2WSF E;  3RMQ A;  1BIB A;  1R0B G;  1T3S A;  2FG0 A;  2DD4 A;  4X1V A;  3TRE A;  2E5Q A;  3N5B B;  3CXC A;  1YJ9 A;  4XTW A;  3G71 T;  4EMK A;  1W2B P;  1SRL A;  2M9U A;  4LE9 A;  1YHQ Q;  4FT2 A;  2M1H A;  2RQT A;  1CKB A;  3A8H B;  4XU3 A;  2ENM A;  1VQN A;  4FL6 A;  4N0A C;  2EKO A;  3A8M B;  4XTX A;  1I1J A;  1J3T A;  2YUN A;  1RAE B;  1QVG S;  1VQ5 T;  2AZV A;  2DIQ A;  3CCM Q;  1H8K A;  1JQQ A;  4KUL A;  5A0L A;  4PFO A;  1YWO A;  2RHY A;  1NJI R;  2RI3 A;  1FWZ A;  2EJG A;  1Q7Y U;  1XQH A;  5CIU A;  5GMK e;  1QVF P;  2O9S A;  1ABQ A;  2OI3 A;  3U23 A;  2E3I A;  3L2W A;  1RLP C;  4KRT A;  2YRD A;  1WXU A;  2QGG A;  4J9D A;  1SPK A;  4EMG A;  5GAN 3;  2RQU A;  2OAU A;  4B9X A;  4HT8 A;  2KVQ G;  1WIE A;  5CQY A;  3BW1 A;  3P8H A;  1C1A A;  1UGR B;  4RMO A;  3CPW A;  1ZA1 B;  5KYX B;  5KE3 A;  2LJ3 A;  4HCB A;  2XI9 A;  1ZUY A;  3PGG A;  4BE2 A;  4EPC A;  2BUD A;  4M7A E;  4KGX B;  5GAN j;  1PNJ A;  5AYF A;  5GAN 8;  1YIT Q;  2CRE A;  2DXT A;  2LCS A;  1JU5 C;  3M0R A;  4PFZ A;  5DLO A;  3RER A;  2VGN A;  2GTJ A;  2JS2 A;  3EH2 A;  4HVW A;  2E5K A;  4M78 G;  1Q95 G;  4M75 E;  2BTT A;  1B7T A;  2DKG A;  1YWP A;  5FLX E;  4AMC A;  1Q82 R;  4AFS C;  4PJO B;  4J9G A;  2DZ9 A;  2PUO B;  2BIV A;  1JBM A;  3HTR A;  4PJJ A;  4A4G A;  2J6O A;  4R0K A;  1Y7X A;  3QBY A;  3I55 A;  5GMK h;  3NTI A;  1K0X A;  2OTL A;  2YUQ A;  3LGF A;  1W4S A;  4LDY A;  5D7U A;  3CBO A;  4D8K A;  4ESR A;  1YHQ A;  5LJ5 h;  5KH6 A;  2KDS A;  2Y4X A;  2V8K A;  4RG2 A;  5FWB A;  4O5V A;  4OMM A;  1QVF S;  2Z0W A;  2JJ9 A;  2DL8 A;  2LCL A;  2ED0 A;  1D1C A;  2EQI A;  1ARK A;  1G3Y A;  1F1B B;  4IUQ A;  5CK9 A;  2OTL T;  5FRO A;  1Y0M A;  4PJO A;  2HMA A;  4M7D F;  1Q7Y C;  3G4S T;  1FX7 A;  1X6G A;  5GAN f;  1UFF A;  2FL7 A;  3NGP A;  3WVE B;  1MND A;  2KT8 A;  5CR2 A;  2DEU A;  1Z9Z A;  3C12 A;  2QEX A;  1X01 A;  3URG A;  5CKH A;  2MI6 A;  3EH1 A;  1NZ9 A;  4J8O A;  2VB6 A;  1OPL A;  3FRN A;  2CP7 A;  1TUC A;  3E2U A;  3CCE T;  2KYM A;  1GRI A;  2R57 A;  1EX4 A;  1Y71 A;  3DB3 A;  2A36 A;  1G3W A;  5LL6 S;  1TTH B;  3EG3 A;  2KBT A;  1W2B S;  2ZGW A;  2OTL Q;  2JXB A;  3L2Z A;  2LCC A;  4QKU A;  2FHD A;  2QXF A;  4XTZ A;  4GLM A;  2JS0 A;  2JM9 A;  2Y90 A;  2CZ1 B;  4RCB A;  2KMT A;  3RKW A;  4M75 A;  4OMN A;  5GAN 2;  4LDV A;  1RAH B;  2D6F A;  1B34 B;  4BD3 A;  1N8R U;  3H0I A;  3SWN C;  3M59 A;  1IZ6 A;  2G6F X;  4BY6 B;  2OAW A;  4Y91 A;  1QWE A;  2ZPG B;  2VV5 A;  3V7S A;  3EGX A;  4C92 F;  1RAC B;  1OZ2 A;  1OPK A;  3OS0 A;  5GAM e;  1H92 A;  5IT9 E;  2D1X A;  4M7D G;  4X9C A;  4RTZ A;  2ATC B;  2GQV A;  1MMD A;  2RJF A;  4WF2 A;  1IRX A;  4BDZ A;  5LJ3 e;  1UJ0 A;  3JCM h;  4PJO E;  2XG8 D;  2F5K A;  2J6F A;  1AD5 A;  2PQW A;  2F5T X;  3LYI A;  1AT1 B;  4RTW A;  3UDC A;  4IUT A;  2DA9 A;  1VQ7 Q;  2MOX A;  4KH1 B;  3VS7 A;  2QQR A;  4PFP A;  4C92 G;  3CCS A;  5GMK m;  4Z02 A;  1B07 A;  2RK2 A;  4FIB A;  1KC8 R;  2O2O A;  3C94 A;  3H6Z A;  1JJ2 S;  3ZEH A;  3EG2 A;  4N4H A;  1LNX A;  3CCE Q;  1TH7 A;  2X4X A;  1R0C B;  3C4S A;  2FRW A;  1KD1 U; 
#chains in the Genus database with same CATH homology
 1S72 T;  1YIJ A;  4NS5 A;  3M5A A;  2L3R A;  3L2V A;  2QEX T;  2P4T A;  3E1S A;  3JCM b;  5GAN g;  2HBP A;  4QQD A;  2LQ8 A;  5GAO p;  4M77 C;  2EFI A;  1NJI U;  3JCM g;  1N27 A;  2X4J A;  3ZBD A;  1NJI C;  2XD0 A;  3P8B B;  4JS5 A;  4C0D B;  1UEB A;  1WJQ A;  3SFM A;  3NTK A;  4QVC A;  3CCU T;  4OGC A;  4XAX B;  1OYX A;  4LDX A;  2F69 A;  5KCH A;  2VXF A;  4C8Q G;  1KD1 C;  1BIA A;  3X24 B;  1DJ7 B;  3OYY A;  4Q5W A;  4LDW A;  3UT1 A;  3CCL A;  2K4Y A;  3CPF A;  1VQ9 A;  4II1 A;  3J80 E;  4JLG A;  1AHJ B;  3JCM V;  1YJW T;  2HQX A;  3QDR B;  4L6V 5;  4MZM A;  4XU2 A;  4BDY A;  2K5L A;  2L5Q A;  1ZQ1 A;  2XKO C;  4J6X A;  3CCE A;  3VKI A;  1EIF A;  3OYH A;  2QQ9 A;  2R5A A;  4JS4 A;  1YCY A;  2G3R A;  3QJ6 A;  3SWN A;  1K73 C;  2XID A;  3CCQ A;  3PIO A;  1QP3 A;  4M78 C;  1B34 A;  1M1G A;  1VIF A;  3CEY A;  5KE2 A;  3L2R A;  3CCM A;  4FU6 A;  3QYH B;  4O6J A;  4M7D A;  1HK9 A;  2O4X B;  3LLR A;  4XK8 E;  2I2L A;  4M75 D;  4J7F A;  2CS7 A;  1VQL A;  2YRV A;  1YHQ T;  1N9S A;  3ER0 A;  1N9R A;  3M54 A;  4GY5 A;  4M75 F;  4BI3 A;  4BY6 C;  5GAN 4;  1QVG A;  1O9S A;  4M7D B;  2OTJ T;  2XU8 A;  2K3X A;  2JOY A;  3V7R A;  4JDS A;  3OYB A;  1I4K 1;  2CZ6 B;  3VV0 A;  4DOV A;  4DOW A;  2EQJ A;  2JNG A;  2RJE A;  3HPW A;  2WSC E;  3S3O A;  1NE8 A;  3CBP A;  3JB9 G;  4JRP A;  5CO7 A;  1BI0 A;  3JCM c;  4EDU A;  1YIT T;  4N4I A;  3FC3 A;  3L2U A;  2E12 A;  3M9Q A;  2RK1 A;  3RKX A;  4OP0 A;  2KSS A;  3RES A;  5J39 A;  1KC8 U;  4XQ3 A;  3PIP A;  2M0O A;  3HHT B;  5GAM g;  2ZPE B;  3FB9 A;  4N4G A;  3I56 T;  4DQ2 A;  1KC8 C;  2E70 A;  2EYQ A;  1H64 1;  3LX7 A;  3ME9 A;  2DXB A;  3QUI A;  4OB1 B;  3HFN A;  3OBW A;  4KUI A;  4ZN3 A;  1VQO T;  2QA4 A;  4B9W A;  2M16 A;  3OBY A;  1YJN T;  3G4S A;  2DXC A;  3OA6 A;  4C8Q D;  5DM7 R;  1VQ5 A;  3T9N A;  3BY7 A;  2JTM A;  2E1H A;  2LT1 A;  4M7A F;  4C8Q F;  3CBM A;  5HK3 A;  3OYM A;  2FB7 A;  2E6N A;  3SD4 A;  1O75 A;  3JB9 F;  2HNI A;  3OSS C;  1VQ6 T;  4HT9 A;  2QQA A;  2B8A A;  1YI2 T;  2VGM A;  3HL8 A;  3LWH A;  3V8K A;  4KUD K;  5I2M A;  2C06 A;  2EAY A;  4ME7 A;  3CC2 T;  5GAM d;  2DXU A;  5LJ5 g;  1K73 U;  2CKK A;  2X4W A;  3X20 B;  4N0A A;  3OYD A;  2EWN A;  2YHT A;  4PJO D;  1WGS A;  4P5N A;  2YLC A;  1OI1 A;  3BFM A;  2P0P A;  3ZFJ A;  3JCM X;  3CC4 A;  5I2S A;  2IVW A;  5CQX A;  3MP6 A;  4FT4 A;  2RJC A;  4OF1 A;  4MMK A;  5J3B A;  3CME T;  3G6E T;  4F7U F;  5CAI A;  5GMK j;  4KT0 E;  1YJ9 T;  4BE0 A;  2EJ9 A;  3QO3 A;  4J83 A;  4XU0 A;  4QVD A;  2QQS A;  3QG1 A;  4M75 B;  1N6A A;  5EG2 A;  5C0M A;  5GAM j;  1YJW A;  1N8R C;  1BYM A;  3QKJ A;  3QYG B;  3CCR A;  2D9T A;  1MGQ A;  2RHI A;  3JSC A;  3CD6 T;  5GAN d;  2V8I A;  4OB2 B;  3OYC A;  3HFO A;  2HQE A;  2P0Q A;  2DIG A;  1VQ8 T;  4M7A D;  3GNG A;  2ZPB B;  3LGL A;  4F7U G;  3HKS A;  2WSF E;  2ZZD A;  3JB9 I;  1M8V A;  5IN1 A;  2XHC A;  3RMQ A;  3VJP A;  1BIB A;  4C5I A;  3GNF B;  3JB9 H;  2DD4 A;  3TRE A;  3HRU A;  2E5Q A;  3N5B B;  3AHU A;  5GAO m;  1VIE A;  3CXC A;  1YJ9 A;  4XTW A;  2LT4 A;  2L89 A;  4M7A G;  3G71 T;  2XDB A;  4XU1 A;  4EMK A;  3WXM B;  2RM4 A;  4RKU E;  1Y96 B;  4BUG A;  2M9U A;  3QZ9 B;  4PJO F;  4M75 G;  3LH0 A;  2M1H A;  1R8O B;  4FT2 A;  3OW2 S;  4IUR A;  4HCZ A;  2IG0 A;  3A8H B;  2H3J A;  4XU3 A;  4MDX A;  1WPY A;  5A2Q E;  1VQN A;  1M1K C;  4FL6 A;  3M53 A;  4J6Y A;  4N0A C;  1Y07 A;  2EKO A;  5I21 A;  1W2B A;  3A8M B;  3MO8 A;  3CC7 A;  4XTX A;  3PFS A;  1M90 U;  3OYI A;  4IUU A;  2DPP B;  2KK4 A;  2VUB A;  2XDD A;  3OB9 A;  4C92 E;  2XIC A;  1QVG S;  1U1T A;  3X26 B;  1LJO A;  3PNW C;  1VQ5 T;  3OMC A;  1VQN T;  1VQM T;  3OYE A;  3A8L B;  2DIQ A;  3PMI A;  1G5V A;  4PNO A;  3CCU A;  4C92 B;  3S3N A;  3M55 A;  2A7Y A;  1M9S A;  1VQK A;  4V2S A;  3F70 A;  5LJ3 f;  2LDM A;  3CCS T;  1VQ6 A;  4C0Z A;  3OQ5 A;  4C92 D;  3PMT A;  4KUL A;  1UGQ B;  3SB2 A;  5A0L A;  5KCO A;  1OZ3 A;  2RHY A;  1XTD A;  3DKM A;  4E7J A;  2GCX A;  3CCJ T;  3PT9 A;  3LWI A;  2KY9 A;  2RI3 A;  4FSX A;  1FWZ A;  2EJG A;  4M78 E;  1Q7Y U;  1XQH A;  4JUV A;  4A4E A;  1G3T A;  1JRI A;  3LW5 E;  5CIU A;  2VC8 A;  5GMK e;  3QPH A;  4R55 A;  1Q81 U;  1JB0 E;  3I56 A;  2MMP A;  4C0F A;  4A4H A;  2DK3 A;  4M77 G;  3L2W A;  4ELZ C;  1KQS A;  3JB9 J;  3G6E A;  1X6O A;  4M77 F;  1WQ7 A;  3CXC S;  1P92 A;  4EMG A;  5GAN 3;  3CD6 A;  2OAU A;  4B9X A;  2NLU A;  3OYK A;  2KVQ G;  4M77 D;  4HT8 A;  3OS2 A;  5CQY A;  3BW1 A;  3EAE A;  3P8H A;  3M4G A;  3MP1 A;  4M77 A;  4A54 A;  1XNI A;  2K5F A;  1UGR B;  5C6S A;  5HK0 A;  4RMO A;  1NPR A;  3PTA A;  3CPW A;  1M4Z A;  1WJS A;  2XDP A;  5D6W A;  1X75 C;  3OY9 A;  4KBM B;  4D6W A;  1ZBX A;  3OYG A;  1I8F A;  5KE3 A;  2ZPH B;  4HCB A;  2XI9 A;  1M1F A;  2VYT A;  3INZ A;  4BE1 A;  3DLL A;  3PGG A;  4BE2 A;  3NFC A;  4EPC A;  3HSB A;  1VUB A;  2BUD A;  3WVD B;  4M7A E;  4GLK A;  5FU7 B;  4JJN K;  4PJO G;  4FM4 B;  1KQ2 A;  5GAN j;  4E7H A;  5AYF A;  3CC7 T;  2X4Y A;  1KG1 A;  4Y28 E;  3VUB A;  3G71 A;  4C8Q B;  5GAN 8;  3J7A F;  2DXT A;  1YJN A;  5GAN 6;  1Q82 U;  2QA4 T;  4E7L A;  2FYK A;  3MEW A;  3V7C A;  5DLO A;  1U1S A;  3JCM W;  2VGN A;  2DD5 A;  3Q1J A;  3RER A;  1VQ7 T;  1VQ9 T;  1QVF A;  3QII A;  4UC4 A;  4M78 G;  1NPP A;  4HA8 A;  2RI2 A;  4M75 C;  5A0D A;  5J26 A;  3FJP A;  4XTV A;  2QDY B;  3CCJ A;  4M75 E;  4PKC C;  3TU4 K;  5GAO r;  2DKG A;  5FLX E;  1VQO A;  1BKB A;  2CZ7 B;  5FRN A;  1S72 A;  3M58 A;  4J7I A;  5CKB A;  2PVO B;  4PJO B;  1Q86 U;  4ZTJ A;  1HXD A;  2DZ9 A;  3CPW S;  3A8O B;  2RA2 A;  5GAO l;  4LD9 K;  3GF5 A;  2PUO B;  3E19 A;  2BIV A;  3O8V A;  4LDU A;  1JBM A;  3SWN B;  4E7K A;  1K8A C;  1VQ8 A;  2DO3 A;  5D6Y A;  4A4G A;  3CCV A;  4C8Q E;  1Y7X A;  3QBY A;  3RIR A;  2RO0 A;  1VQ7 A;  1D3B B;  4LD6 A;  4C5G A;  3I55 A;  5GMK h;  3CCM T;  3NTI A;  1RL2 A;  2X35 A;  2OTL A;  2RH2 A;  5HY6 A;  5DY9 A;  5M9O A;  3JCM J;  3LGF A;  1W4S A;  4LDY A;  3CC2 A;  4MZT A;  3GOX A;  1Y96 A;  4CRI A;  1LOJ A;  2PUK B;  3CBO A;  3C95 A;  3OS5 A;  3EFS A;  4CI0 C;  3VUZ A;  5LJ5 h;  3CC4 T;  2PU9 B;  1KQ1 A;  5D6X A;  2KDS A;  2R5M A;  2V8K A;  2Y4X A;  4RCC A;  4OVA A;  2K2V A;  4OB3 B;  4RG2 A;  2P0K A;  4O5V A;  2LVM A;  4ZN1 A;  5GMK i;  3OYL A;  2QQB A;  3HP9 A;  3I55 T;  1QVF S;  2LCL A;  4HCC A;  4MDW A;  1UGS B;  4IUP A;  4BI8 B;  1KHC A;  3J81 E;  3ASK A;  3RKY A;  1G3Y A;  3JCM P;  2GFU A;  4IUQ A;  5GAN e;  3H8Z A;  5CK9 A;  2OTL T;  4PLL A;  5FRO A;  2JVV A;  3JCM Q;  1I81 A;  2JZ2 A;  2LTO A;  4PJO A;  2DTO A;  3QJY A;  3G7Z A;  3QSU A;  5GAN 5;  3KUF A;  4F7U E;  4NOY A;  1K9M U;  2E41 A;  2E65 A;  4M7D F;  3M57 A;  2EQM A;  5GAN h;  1Q7Y C;  2EQU A;  3E9F A;  3FLG A;  4X34 A;  3G4S T;  1FX7 A;  2E10 A;  5GAN f;  1XOV A;  4PLI A;  5LJ5 e;  2FL7 A;  3BDL A;  2E64 A;  2JTF A;  2K3Y A;  3WVE B;  1VQ4 T;  1YHQ A;  1K9M C;  3FDR A;  3KXT A;  5CKF A;  5FU7 C;  4E7I A;  2KQW A;  3MEV A;  2V8J A;  3GP8 A;  4M78 A;  4RG8 A;  4PJO C;  5CR2 A;  1IRE B;  4QQ6 A;  3C12 A;  3QHS A;  5HKC A;  2QEX A;  2L8D A;  2RHU A;  1X01 A;  4L59 A;  1UB4 A;  3URG A;  4C5E A;  2CYZ B;  5GAM f;  2CGH A;  2PVD B;  5CKH A;  5GMK l;  1H3Z A;  4TVR A;  2MI6 A;  5FRM A;  1NZ9 A;  1FXX A;  4J8O A;  3FRN A;  4OGE A;  4X9D A;  2WAC A;  5DLQ E;  5CKE A;  3JAM E;  2PVG B;  2WSE E;  1GXI E;  5IAY A;  2E6Z A;  5GAN 7;  4C92 A;  1YI2 A;  4F7U B;  3CCE T;  3SDZ A;  3GLX A;  1PSE A;  2R57 A;  4M78 D;  3RMS A;  3TEE A;  1WJR A;  3HRT A;  1Y71 A;  3DB3 A;  2MWO A;  1M1K U;  2DTI A;  2DVE A;  3A5Z B;  3P8D A;  4M78 F;  4PL6 A;  1G3W A;  3JB9 D;  4JLI A;  5LL6 S;  2HD0 A;  2Y4Y A;  4J6W A;  4M7A B;  4M7D E;  4MML A;  2JUF A;  2ZPF B;  4OMF B;  2KAF A;  5LJ3 g;  1W2B S;  2ZGW A;  2RHZ A;  1SSF A;  5LJ3 j;  5GAO q;  3FEO A;  3JCM f;  1K8A U;  3L2Z A;  2LCC A;  2LQK A;  2O4X A;  5LJ5 j;  3CCV T;  1I5L A;  2FHD A;  2QXF A;  4XTZ A;  2EQK A;  3R6O A;  3VYH B;  4OB0 B;  1Q86 C;  2HAX A;  3OYJ A;  3BDU A;  4C0D C;  3MHX A;  2ZPI B;  2LX9 A;  2Y90 A;  2CZ1 B;  4JRK A;  4RCB A;  3JCM d;  4M7A C;  3X25 B;  2KMT A;  3QZ5 B;  4YTL A;  2D0Q B;  5LJ5 d;  1VQK T;  3KBG A;  3RKW A;  4M75 A;  2O01 E;  5KH6 A;  1VQP A;  5GAN 2;  4M77 E;  2VXE A;  4LDV A;  1QP2 A;  2R58 A;  1B34 B;  2YLB A;  4BD3 A;  4BB7 A;  1N8R U;  2D6F A;  1Q82 C;  3SWN C;  1U8R A;  3M59 A;  3MCA B;  4VUB A;  5FU6 B;  1IZ6 A;  5L8R E;  3V8L A;  5LJ5 f;  4BY6 B;  3CCR T;  2RJD A;  1VQL T;  1UGP B;  4QQG A;  4MZP A;  4A4K A;  4M7D C;  3OYA A;  2MF2 A;  4C92 C;  2DZC A;  4HKE A;  4XTY A;  5CCA A;  4C8Q A;  4M7A A;  4Y91 A;  4L5G A;  4ATO A;  3UPU A;  2BKD N;  3EFR A;  4DA4 A;  3CME A;  3VU3 C;  3JCM e;  5GAM h;  3GIB A;  2OTJ A;  1JJ2 A;  2FVU A;  4JRQ A;  2ZPG B;  2VV5 A;  3DLM A;  3MEA A;  3V7S A;  5A0G A;  4EMK B;  4C92 F;  3A8G B;  2DEQ A;  3CCL T;  1OZ2 A;  3OSV A;  3UWN A;  1BI3 A;  5GAM e;  3OS0 A;  4ZTF A;  5IT9 E;  2DTH A;  4A53 A;  3CMA T;  2EIF A;  3S6W A;  4XTU A;  4ZGE B;  2CZ0 B;  1BI1 A;  4C5H A;  2EJF A;  4M7D G;  3E9G A;  4X9C A;  2DAQ A;  3MP8 A;  3DB4 A;  4A4F A;  2GQV A;  1QVP A;  2QTX A;  4BAC A;  4IKF A;  2RJF A;  4WF2 A;  4M7D D;  4EMK C;  4BDZ A;  2AHJ B;  1Q81 C;  5LJ3 e;  3V8J A;  3RUX A;  1VQP T;  3L2Q A;  3JCM h;  2K57 A;  2XG8 D;  4ZGD B;  4PJO E;  2XK0 A;  1D3B A;  1G3S A;  2F5K A;  1YIJ T;  1VQ4 A;  1V29 B;  4QW2 A;  2PQW A;  2F5T X;  3LYI A;  3QXE B;  3M4Y A;  5LJ3 h;  3S3M A;  2RD1 A;  3UDC A;  1WQW A;  2QI2 A;  1YBY A;  4IUT A;  1VQM A;  4EMH A;  2A3L A;  2GFA A;  3MET A;  1YIT A;  1ZHI A;  3L42 A;  3TCJ A;  3GPL A;  2QQR A;  4C92 G;  4C8Q C;  3CCS A;  5GMK m;  1RI0 A;  4JRI A;  1KQS S;  2DJZ A;  4Z02 A;  3M56 A;  4E47 A;  1PSF A;  4M78 B;  4R56 A;  2LNV A;  2JN0 A;  2RK2 A;  4FIB A;  3OW2 A;  5FU6 C;  3FIF A;  4QVZ A;  4BI4 A;  3CMA A;  1M90 C;  2RHX A;  1KHI A;  2MWP A;  3OYN A;  3C94 A;  1BI2 A;  2K5I A;  2RB6 A;  2ZCF B;  3H6Z A;  4IUV A;  3ZEH A;  1JJ2 S;  2GF7 A;  4N4H A;  3X28 B;  1MHN A;  4ZGJ B;  5GAO n;  5CVI A;  1LNX A;  3OMG A;  3JRZ A;  3OS1 A;  2LRQ A;  4M77 B;  2RI5 A;  4ELY C;  4J5Y A;  1TH7 A;  4NL3 A;  1WNL A;  3CCQ T;  3VYG A;  2X4X A;  3HRS A;  5LJ3 d;  3MEU A;  5CKD A;  4NL2 A;  1QW1 A;  1M5Q 1;  3C4S A;  3NTH A;  4F7U A;  3L1A A;  2MAM A;  3OYF A;  2LC4 A;  1KD1 U;  4C0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...