3ME9A

Crystal structure of sgf29 in complex with h3k4me3 peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
174
structure length
174
Chain Sequence
GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SAGA-associated factor 29 homolog
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3me9A02
2HQXA 2RHIA 2X4XA 2MWPA 1OI1A 2X4YA 4A4GA 2R5MA 2DIGA 2X4WA 3H8ZA 3OY9A 4RG2A 4BE1A 3OYAA 4GY5A 2O4XB 2G3RA 2QQSA 3DB4A 3FEOA 4OVAA 5D6WA 4IUQA 3KUFA 4IUTA 2GFAA 2RHYA 3MP8A 4ZTFA 3M9QA 4N4HA 3OS2A 4Q5WA 3QJ6A 5M9OA 5FRMA 2EQKA 2R5AA 3E9FA 2L3RA 2P0KA 4BE0A 3MEUA 3S3MA 2B8AA 2XDPA 3MO8A 5KH6A 2VYTA 3F70A 3OYHA 3MEAA 2LVMA 2JTFA 3H6ZA 3OMGA 4IURA 3L2QA 3S6WA 3L2RA 3NTHA 2NLUA 4ZTJA 1WJQA 2FHDA 3LX7A 5J39A 5KCHA 2M0OA 3DB3A 3P8HA 5IAYA 4BE2A 2RO0A 4LD6A 1G5VA 2LDMA 2EQUA 1WGSA 1N27A 3LH0A 3OA6A 4BACA 4IUPA 2MWOA 2LRQA 4E7HA 3QKJA 3OYMA 3S3OA 4BD3A 3QBYA 3FDRA 4IUVA 3NTKA 3EAEA 5KE3A 2E6NA 4CRIA 3OMCA 4B9WA 3PMIA 3OS0A 2M16A 2RI2A 3C4SA 1KHCA 4EDUA 3OS1A 3ME9A 2BKDN 5C6SA 2RI3A 3BDLA 3FLGA 1WJRA 4X34A 4E7LA 4L59A 5FRNA 3L42A 2D9TA 2RHUA 3LGLA 4QQGA 2QQRA 5KE2A 3PMTA 5IN1A 2JZ2A 2K3YA 2R57A 4C5EA 3GOXA 3LGFA 4E7IA 2RJEA 4A4HA 1RI0A 2RJFA 3PNWC 4NS5A 2BUDA 3S3NA 4N4IA 3OYBA 3P8DA 2HQEA 4IUUA 3PFSA 3MP6A 4IKFA 3DLMA 3OYCA 3UWNA 3OYIA 3L2WA 3ASKA 2RHZA 3MEWA 4II1A 4PLIA 3OYGA 2LCCA 3MEVA 2BIVA 2RI5A 2RJDA 5C0MA 1SSFA 3OQ5A 4UC4A 2RJCA 5D6YA 3OYFA 3MP1A 4FU6A 5CIUA 4E7KA 4FL6A 4PLLA 3OYKA 4N4GA 2PQWA 5J26A 4QQDA 2EQMA 2O4XA 2YRVA 2GFUA 3OYDA 4PL6A 3OYNA 3NTIA 4E7JA 2WACA 2L8DA 2K3XA 1XNIA 2X35A 4C5GA 2R58A 3OYJA 5D6XA 3E9GA 2EQJA 2RHXA 3QIIA 4Z02A 3ZEHA 3Q1JA 5FROA 4A4EA 4QVZA 2EKOA 2IG0A 3OYEA 2E5QA 1H3ZA 4HCZA 2F5KA 3L2VA 3LYIA 3O8VA 2GF7A 2XK0A 3OB9A 4QW2A 3SD4A 3L2UA 2L89A 2EFIA 4C5IA 1OYXA 4QQ6A 3META 2CKKA 3OYLA 2LTOA 2DAQA 1MHNA 1OZ3A 2M1HA 4C5HA 5KCOA 3UT1A 4B9XA 3FC3A 3CEYA 3LLRA 1WJSA 4BDZA 4A4FA 1OZ2A 4BDYA 2DIQA
chains in the Genus database with same CATH superfamily
2OAUA 2SRCA 1LNXA 2BZXA 2KNBB 1FX7A 1X6BA 4PKCC 1MV0B 2ZPFB 1VQPQ 1YJWT 5HK0A 3WXMB 3JV3A 3GP8A 4RUGA 5KH6A 1W1FA 3TREA 3F70A 2OTLA 4DA4A 5EC7A 2CP2A 1MGQA 1UJ0A 4IIMA 4BE2A 5IAYA 2RMOA 2HZYA 2QA4Q 1WGSA 2DL7A 3A8OB 3AT1B 1EZZB 2GTOA 4IUVA 4M78G 3HRSA 4E2FB 1T3SA 4D8KA 5IXFA 3BY7A 1UG1A 3ME9A 2XU8A 3G71Q 1WJRA 4X34A 4DEYA 1SKUB 1Q7YR 5KYWA 2PUOB 3URGA 1AT1B 3JCMV 2CP3A 2DA9A 3VS6A 5IHKA 1RAHB 3I55A 1OX9A 4JJDA 2EKHA 1RUWA 1UJYA 4MZMA 4OP0A 3TEEA 1MMNA 5I22A 4CC7A 1VQNQ 1M1KR 1BI0A 5J26A 2PQWA 4M75C 4PL6A 4C92D 2LCLA 3OYNA 1W2BS 4NL3A 2K3XA 2PVGB 2RK1A 2Y4YA 1D3BB 2RHXA 4M7DC 3I55T 2GF7A 5A0GA 3M0QA 4C92B 4QQ6A 1U5SA 2CKKA 1MHNA 1XTDA 3LLRA 3META 1QVFA 1OZ2A 1P92A 1OPKA 1WLPB 5CKHA 1KK7A 2XDDA 5GAN7 2QDYB 1KHIA 3IQLA 2F2XA 1VQ9T 1K73C 2F2WA 4Q5WA 4PJOC 4C92F 4J6XA 2HKQB 2X9HA 1D1BA 2KAFA 1UGPB 2E65A 2AT1B 2EJGA 1K8AC 1I5OB 1VQ8Q 3M5AA 1GRIA 2EYYA 1TG0A 2DMOA 2LZ6B 3WVEB 2MWOA 5EG2A 3VUZA 2VWFA 4N0AC 4A54A 4YTLA 1B7TA 4OMMA 3QHSA 3TU4K 3RBBB 1X43A 2E6NA 3PVLA 2AHJB 3CMAQ 2K5FA 3GNFB 3A98A 2JW4A 1K9MR 4RTYA 1KD1C 2KYMA 1N5ZA 2LNVA 2HBWA 5LJ5g 5GAMd 5ECAA 3H0HA 1OQKA 1UGQB 4E7IA 4C8QA 2J7IA 3PNWC 4N4IA 1JU5C 1YHQA 1BK2A 3PFSA 3EG3A 3V8KA 1W2BP 4IKFA 3UATA 1VYVA 3CPFA 1D0ZA 1M2VA 2KXCA 1GCQA 4HKEA 4LUDA 1WQWA 3OW2S 2RB6A 3JCMb 4A63B 1V1CA 3R6NA 4C0FA 3DKMA 3BFMA 2FPEA 2CSIA 4M75B 3PIOA 3X20B 1BKBA 2FG0A 3D7SB 2BTTA 1H3ZA 4M7DB 5CAIA 3O8VA 2L0AA 2DXTA 2LTOA 4O6JA 4AFZC 3UT1A 3L42A 1YWPA 4M77E 3O5ZA 2EVRA 4M75F 1VQ5Q 1M1KU 5GAN6 1K1ZA 1YNZA 2H8HA 3EG2A 4HCBA 4V2SA 2AK5A 4M7DF 2AKLA 1WHGA 5GAOm 3QJ6A 5M9OA 4FSXA 1Q86C 1Y7XA 2ROLA 2XDPA 4PJOB 2OTJA 4PJMA 1K76A 3LWHA 2RO0A 4EIKA 2LDMA 2KROA 3OSSC 3OA6A 1K73R 1PC0A 5GMKm 2F69A 3M4YA 4PFPA 5CKEA 2X3WD 4KH0B 1X27A 1FMVA 1M9SA 3PMIA 4PJOF 3VYHB 4LDVA 3C4SA 1K8AR 2KI7A 2VASA 3V7CA 1QP2A 3FIFA 1VQ7T 2JOYA 3CCJQ 3OW2P 4ZN3A 1G2BA 5CQYA 2OTJT 4J6YA 3OYBA 3EGUA 3OYYA 4J9IA 2CZ1B 4RTXA 2EJFA 3EGXB 1N9SA 1VQ6T 4HVUA 5IHNA 3QG1A 1Y07A 4M78D 1U1SA 3NMZC 2QK0A 5D6YA 2LJ1A 3MP1A 2DTOA 5CKFA 1N6AA 1QLYA 3CD6Q 4OMPA 5I2MA 3MJXA 2QQBA 2CH4A 1B34A 3G4SA 3CCUA 3TCJA 3X26B 1UHCA 5GMKi 3HPWA 1BB9A 1SHGA 4M7AC 2MCNA 2E41A 4OB3B 3L2UA 3OB9A 4WCIA 4EMGA 6AT1B 2KT1A 2DYBA 2V26A 1YIJA 1HK9A 3MKDA 3H8ZA 1JXMA 3JCMc 3OYAA 1G3WA 4MMKA 4IUQA 1VQMQ 2KSSA 3RESA 1M5Q1 5HCKA 4KUDK 1Z9QA 3CCUT 3G4ST 5KYYA 2YDLA 1XOVA 3CC2A 1TUDA 2YRDA 2DF6A 1MMGA 5CO7A 3EHQA 1ZBXA 2DJZA 4NL2A 2RN8A 5GAOl 1BI2A 1TSFA 2EYXA 3NTHA 1XJWB 4AT1B 3LWIA 4LNPA 4Z89A 4O5VA 3LH0A 4JZ3A 1YIJT 2IPOB 4C92E 2QA4A 1JJ2A 1PM3A 1Q86R 2DL8A 1Q82C 2RH2A 2C06A 5DY9A 1WHJA 2W10A 1VQPT 1QMCA 2LJ3A 1TU0B 2YUNA 3A8HB 1J3TA 4RMOA 4OB1B 3X25B 1FMWA 2HDAA 1TXQA 4JS5A 4QQGA 3JB9F 1IRXA 4HA8A 4LXCA 2P4TA 3UPUA 1YFNA 5GJWB 5GAOr 1R0BG 2EYZA 1H3HA 3UWNA 2QA4T 1VA7A 4DOWA 2YT6A 1K73U 3FB9A 1NLPC 1VQNA 1SSFA 2A28A 3C94A 4J7IA 4AMCA 2RQTA 4C92G 1AWJA 5GANf 4BI8B 3OYDA 4DBRA 3GPLA 2COWA 2E6ZA 4FYVB 2VVKA 1K8AU 4HXJA 3G71T 1MNEA 3HTRA 2EQJA 1TH7A 4EMKA 1S1NA 3OYEA 2F5KA 4L5GA 4M7AB 2GQVA 3VKIA 4FYWB 2DBMA 2L2PA 3M0SA 2PVDB 4C5HA 2MYSA 1RAIB 4XTXA 5GAN2 3EFOB 2MPXC 2KQWA 2DIQA 1ZSZA 1VQNT 4KGVB 3A8GB 4QVCA 1AZEA 4M77A 2IIMA 2HCKA 4FT4A 4ELZC 3HFOA 3G6ET 4M7AF 2M0YA 2DYIA 2DXCA 1JB0E 3MEAA 4RCBA 3CBMA 5KYNA 2D1XA 1R77A 1M27C 4J9DA 4E47A 3P8HA 5LJ3f 4M7DE 4AG2C 5AT1B 4KULA 5LL6S 2LRQA 1TTHB 5LJ5h 2QGFB 4BD3A 1PSEA 2RF0A 1IGQA 1DJ7B 2SEMA 3CBPA 1R8OB 1PD1A 3CMAA 1BBZA 2MAMA 4F14A 4J9EA 2DD5A 5C6SA 1ZX6A 3FLGA 1IREB 1QVFS 1M3CA 2QQRA 2DKGA 1QVGS 5GAMf 3M55A 2A37A 1YJ9Q 3S3NA 1Q82R 1K4US 1D09B 1VQ8T 2QXFA 4FW2A 4M75G 3MP6A 3CPWA 1I8FA 4CI0C 3DLMA 1HXDA 3QPHA 1KSWA 3ASKA 2EGCA 2JS2A 4RTZA 3OYGA 1JRIA 4M7DG 4PK4A 1UUEA 3RMSA 1Q86U 3ZL7C 1WDXA 2COYA 1VQLQ 1X69A 2BZYA 2ZAEA 2ZZDA 4QQDA 3CMAT 1VQOQ 2JM9A 1AZGB 1YITT 1AWXA 3CXCA 2JNGA 2JTMA 1BIAA 3PGGA 3Q1JA 2V1RA 4K11A 3QJYA 1YBYA 2EQIA 4MDWA 2E70A 1I0CA 1ZQ1A 2DK3A 4PJOG 5DM7R 4A4GA 2X4YA 3CCQQ 3J7AF 2W0ZA 4NOYA 3C12A 3JCMW 1VQ5A 3LW5E 1KQSS 4FIBA 3SB2A 2EQKA 4ZGDB 4Z8AA 4FYXB 3VU3C 3OYHA 4MZTA 4M78E 3HSBA 3LX7A 1ZBJA 4HVWA 5CQXA 1RAEB 2EQUA 1QVFP 1I81A 3OYMA 1QVGP 1F1BB 2EWNA 1YN8A 3V7RA 4C92A 1VQ5T 3CC2Q 3QZ5B 2K2VA 4XTWA 1E6GA 2DTHA 2KBTA 3VS4A 2OI3A 2GNCA 3CQTA 3NFCA 3CCJA 2K3YA 1MNDA 2OX7A 2WSEE 3I56Q 2ZPHB 2YXYA 2BUDA 3QYHB 5KYUB 5FU6C 1GXIE 1OV3A 2K5LA 3TQ7P 1NBEB 4II1A 4ORZA 2HAXA 3EHRA 1BIBA 2XMFA 2K7AA 2ZPGB 4XU0A 3TVTA 7AT1B 1VQ4A 4N4GA 1Y57A 2FZKB 4CC3A 4EPCA 2OTLT 1WNLA 2WACA 3CD6A 3CCJT 4XU2A 1O75A 5LJ5j 1NPPA 2FYKA 1KQSP 3KFVA 5IT9E 1Q82U 3CEYA 4HT8A 3JCMQ 2XIDA 5GANd 2EGEA 1ARKA 2DBKA 3OY9A 1NPRA 3RMQA 2O4XB 3QDFA 1VQKQ 2QGGA 1YI2Q 2CS7A 3CCEQ 3JB9G 1XQHA 2BZ8A 1UFFA 1VQMA 3CD6T 5FRMA 3L1AA 4OMLA 4J5YA 2D6FA 4BE0A 3S3MA 4A53A 1ZUYA 1OEBA 5A0DA 4IURA 3CCVQ 1ZSGA 2H3JA 2K2MA 3HRUA 3GNGA 2M0OA 2A0FB 5DLOA 1WPYA 1G5VA 2KK4A 4M7AE 1N27A 4JUVA 1IXDA 2QQ9A 4E7SA 1OU9A 4XU3A 2Y4XA 5KYXA 3QBYA 5GAOn 1MV3A 3VS7A 2K9GA 1VQMT 1AOJA 3OS1A 3RDVA 1PG5B 2KYBA 2ZPIB 3I35A 2D9TA 5LJ3d 2KRMA 2DEUA 1B07A 2X51A 3DLLA 3HFNA 5FU6B 3A5ZB 3V8LA 2RQVA 3OBWA 4F7UB 2VXFA 4PLIA 3U23A 4DQ2A 2EIFA 2MF2A 4M7AG 5GAN4 1WA7A 2VKNA 1E7OA 3M4GA 2DFUA 2GFUA 4JRKA 3TSWA 1BI3A 4GBQA 5KYWB 2L8DA 4J9FA 2ZCFB 4C8QC 2FVUA 3QIIA 1JJ2S 4PJJA 5FROA 4F7UF 4HCZA 3L2VA 1B3QA 3SD4A 4DBHA 4M75D 5GMKh 4MDXA 3CC7Q 1GCQC 3FC3A 3JCMd 3QDRB 4BDZA 4A4FA 5IHIA 4M7DD 5FWBA 3RIRA 1YJNQ 1NJIC 2OAWA 1WZOA 1M4ZA 1SEMA 1UE9A 2EGAA 3TSZA 1T3LA 3FEOA 5D6WA 1ZUKA 2PVOB 4DBQA 2RM4A 5GAMh 2L5QA 2DILA 1YHQT 2DETA 3MEUA 3MO8A 2ED1A 3ER0A 1V76A 2O31A 5LJ5e 1W70A 3QZ9B 2X3XD 2D8HA 4M78A 3X28B 4PJOD 4J9BA 4IUPA 2ZPEB 4J9CA 3VV0A 2DM1A 2P0PA 5GAN8 2I2LA 1PHTA 3HRTA 3GBQA 3H0IA 4C0ZA 2DVJA 1YCSB 1K0SA 3LGFA 1M30A 2YHTA 1V29B 2HQEA 1U8RA 3KXTA 1YJ9A 3C0CA 3OYIA 3JSCA 2NUPA 4JJNK 1JJ2P 1WHMA 4JRQA 4AFSC 1VIFA 4KH1B 5I21A 4FL6A 1JBMA 2YLBA 1U06A 1T0JA 1VQLA 4D6WA 3VS2A 3EG1A 1VQOA 1WFWA 4F17A 2X35A 1H8KA 2P84A 3OYJA 1CKAA 1GBRA 4RTVA 4C8QB 2EJ9A 4XTVA 4OGEA 1PKTA 1PSFA 2EFIA 1YJ9T 2K57A 1TS9A 1KD1R 3H41A 2RQUA 2JN0A 2KEAA 1VQ4Q 1M2VB 2ABLA 1ABOA 4JDSA 1W2BA 1QWFA 2KGTA 4GY5A 2KE9A 2G3RA 3CCQA 1VQLT 4C8QF 3QO3A 1QKXA 2RD1A 2JXBA 1VQOT 1C1AA 4N4HA 5L23A 1WXBA 2R5AA 1LJOA 2J06A 4QT7A 1VOMA 4FW1A 2LVMA 1RAGB 1BCMA 4ELYC 2LX9A 1NJIR 3EGDA 3M53A 1NM7A 2DL5A 2FO0A 2DX1A 3M0RA 1PKSA 3HP9A 1M3BA 4J6WA 5GJVB 2MI6A 3CXCS 1KG1A 2FPFA 3VS3A 2LMJA 3OBYA 3QUIA 1GFDA 1H641 2CUDA 1HYOA 2BE7D 2EAYA 2L3QA 4B9WA 3JB9D 1SPKA 5GMKj 2K79A 4DOVA 3A8MB 2RI3A 1M1GA 2WSFE 1VQ9Q 4L59A 1WXUA 1WHHA 2JZ2A 2R57A 1OULA 4ZGEB 4A4HA 3I56A 4Y28E 4X1VA 1Q81C 2P0QA 3OYCA 2DZ9A 3CCSQ 2E3IA 1GCPA 2VGNA 2X4JA 1QCNA 3CC2T 2NYSA 5A0LA 4L6V5 3PT9A 5GAOp 4BY6C 1GL5A 4OB0B 3GLXA 5I2SA 3H0FA 2CZ7B 5GANg 2F2VA 4X9CA 4C5GA 5CK9A 3I56T 3NGPA 3VS0A 2G6FX 4J83A 2JMAA 1MUZA 1OZ3A 1NZ9A 2CGHA 4A4KA 1WJSA 4BI3A 2HQXA 4M7AD 3M0TA 4OMQA 4F7UE 1Y96B 2DJQA 1AHJB 4E7ZA 1VQKA 2RHYA 1M8MA 1B34B 4C0DC 1YI2A 2IVWA 1MMAA 4EMKC 2DD4A 3CXCP 3CCEA 3RKWA 2KRNA 3PIPA 4F04B 2QG9B 2DRKA 4ZTJA 3CCVA 2NUTA 1ZSZC 2KY9A 5I11A 4LD6A 1KD1U 1QWEA 4GLKA 1KQ2A 4M77C 3JCMJ 2EYQA 2CP5A 1UHFA 4RTWA 1IO6A 1SF9A 4JRPA 3OMCA 1VQKT 2Z0WA 5KYYB 4JLIA 5GAN5 1KHCA 3EG9A 4F7UG 4M75E 2J6FA 3QWYA 1AWOA 1IHVA 3RERA 2JM8A 4GLMA 2QTXA 2XG8D 4JPBW 3CCVT 3RNJA 3M0PA 5GAMg 1NJIU 4LN2A 1KFZA 4Y91A 2YSQA 2E5KA 1QP3A 2A7YA 4OB2B 4KT0E 3SWNA 2K3BA 4OMFB 1IHWA 2P4RA 4KGZB 1NYGA 2CUBA 4BUGA 1QVPA 1SRLA 3GF5A 4BY6B 1QKWA 2LJ0A 5GMKe 1KJWA 4PJOE 1HSQA 3M57A 4PFOA 2XI9A 4Z88A 2M02A 4MZPA 1VQ7Q 1PD0A 5CKBA 3LYIA 2OJ2A 3CMEQ 3OYLA 4AFUC 3PVQA 3M59A 3CCRQ 4B9XA 2HNIA 3JCMf 3CC7A 3X24B 3CCLQ 1PWTA 4WTOB 1Q7YC 4HCKA 1VQ6Q 2HL3A 2E10A 4RKUE 5GAMe 3CCMQ 3JRZA 1M90C 2J6OA 1YJNA 4PNOA 2GGRA 4OVAA 2PUKB 3A1PA 3M58A 3RR6A 4IUTA 3MP8A 4ZTFA 3RKXA 4PFZA 3M9QA 3OS2A 1Y71A 2AZSA 1AWWA 3VRYA 4EMKB 2O9VA 1X2QA 4OGCA 2DZCA 2LNHB 2V1QA 3L2RA 2LP5A 1WHKA 2YWWA 2XD0A 2FHDA 2LC4A 4C8QE 3QXEB 3DB3A 3QSUA 2GBQA 2KMTA 2HD0A 1ZSZB 3E19A 3H9NA 1ACMB 3CC4Q 2KDSA 4M77B 1Q95G 3NTKA 1YJNT 4HCCA 2JJ9A 9ATCB 4LUEA 2JUFA 3OS0A 2M16A 2VXEA 2FZCB 2FB7A 4X9DA 1IGUA 1K9AA 3SEMA 3BE3A 2YUQA 2ZGWA 1A0NB 3WVDB 4J9GA 2H3EB 2EYWA 5FRNA 1D3BA 1YP5A 4C5EA 3LH5A 1RADB 2J6KA 1JO8A 3INZA 1K0XA 2QTVA 4M77F 4IUUA 1X2KA 1C6VX 2HSPA 1FYNA 2K5IA 3NPFA 4C92C 3UA7A 3MEWA 4C8QG 2LCCA 2ESWA 4UC4A 2RJCA 2VC8A 3PE0A 2DTIA 1U1TA 4E7KA 2HQHA 2CP6A 1BU1A 1ZA1B 5IH2A 1RABB 2R58A 5CCAA 3JB9H 4J7FA 2DVEA 4QVZA 5GAOq 3SHWA 1WX6A 2AKKA 2GCXA 2XK0A 2HEQA 8ATCB 1NEGA 1K9MC 2X4XA 3HHTB 2MWPA 2E1HA 3L2ZA 2DIGA 4RG2A 3BW1A 1IZ6A 1WQ7A 1PRMC 1AD5A 3DB4A 4F7UA 1I07A 2FPDA 2RA2A 1D0XA 4EMHA 2GTJA 1ZLMA 5FU7C 1M8VA 2QYZA 1BI1A 5HY6A 3VS5A 2VYTA 1Q81U 3OMGA 2MIOA 3EG0A 2NLUA 1CKBA 1JXOA 1M90R 2DL3A 4C0GA 1VQ4T 2CDTA 2YRCA 5HK3A 3SFMA 2YLCA 1KQ1A 2DNUA 3EAEA 4FYYB 1FMKA 1E6HA 1ZUUA 4J9HA 1UB4A 2D0NA 4XTZA 4M75A 2DEQA 3G6EQ 2RHUA 5KE2A 3PMTA 1VQ9A 1N9RA 4JRIA 2RJEA 2RJFA 4NS5A 2Y90A 2CZ6B 4M7DA 5D7UA 5GANh 2FEIA 1H92A 1W4SA 2ENMA 3NHNA 2LQKA 2BIVA 3THKA 3VRZA 2RJDA 3CCSA 5C0MA 1EX4A 1IB8A 4RCCA 4XU1A 3OYFA 4B6MA 4PLLA 1QVGA 4ANJA 2VB6A 2F1LA 1I5LA 3MHXA 4FSSA 1RACB 3QYGB 5CKDA 2WSCE 2EKOA 2O01E 2GQIA 2QDLA 1RLPC 4PJOA 1PRLC 3VJPA 2DAQA 2E12A 2KXDA 3VS1A 1S72Q 4BDYA 2NUZA 3CCST 1OX8A 2R5MA 5HKCA 2ROTA 5CVIA 4N0AA 4LDYA 1VIEA 1RAFB 3REAB 2RQRA 1U3OA 1QCFA 1UGVA 1HJDA 5LJ3h 3E9FA 5FU7B 2AZVA 2CZ0B 2VV5A 1YITQ 2DO3A 3CBOA 2JTFA 2JS0A 3L2QA 1GFCA 2PTKA 2LCSA 4KBMB 4OMOA 1G3TA 2HL5C 2QEXQ 2LQNA 1KQSA 4DEXA 3EGXA 3VYGA 5L8RE 3M54A 3FDRA 5KE3A 2HMAA 3I5RA 1VYTA 4R55A 2RI2A 5LJ5f 3R6OA 2QQAA 2K4YA 1UDLA 4DBFA 1GBQA 1CSKA 5IN1A 1UECA 4M78C 3MPUB 3FJ5A 3JCMh 1D1CA 1LOJA 1Q7YU 1M90U 5KYXB 5FWCA 4D8DA 4XTYA 3MEVA 1OPLA 1W6XA 4HT9A 4RTUA 2LX7A 4FU6A 2DXBA 1YJWQ 1BCOA 1OOTA 2EQMA 3FJPA 4TVRA 4CC2A 3NTIA 4XTUA 1VYUA 1XNIA 1TUGB 2CT3A 1LCKA 2IG0A 2E5QA 2XDBA 2L89A 1VQ7A 4AFQC 2FL7A 1TUCA 1NE8A 3CMEA 4C8QD 3ZBDA 1JQQA 3CCRA 4ESRA 1OI1A 1YWOA 1PNJA 3CCLA 2PZ1A 2K6DA 1UGRB 4ZN1A 1NLOC 1VQ6A 2PU9B 3CCMA 2O9SA 2GFAA 1NYFA 1X6GA 5GANj 2L3RA 4M77G 2B86A 3EFRA 4XAXB 5DLQE 1KC8C 2OTLQ 1SHFA 3H6ZA 4KUIA 2RK2A 2EW3A 2D8JA 2VGMA 3G1JA 1D0YA 5KCHA 3CMET 2RQWA 1N8RC 4BACA 3CCRT 2KVQG 4E7HA 3JB9J 3CCLT 4BB7A 2HSEB 3JCMP 3CC4A 3CPWS 3CCMT 1EIFA 2RNAA 3JCMX 4OMNA 4EDUA 3BDUA 2DL4A 3UA6A 2DLPA 1Y96A 3ULRB 1AVZC 3JAME 4LD9K 2FRWA 3I55Q 4FCYA 3GOXA 3AHUA 4M78B 1K9MU 4QKUA 3P8DA 1G3SA 1X6OA 4M7AA 3REBB 4XK8E 3N5BB 2LT4A 3L2WA 3CCQT 4JZ4A 2RHZA 5LJ3j 3EFOA 3CC4T 2C0TA 3QWXX 5GAN3 3OYKA 4RG8A 4XQ3A 2HBPA 2A36A 3SDZA 4M78F 5D6XA 2JTEA 2QI2A 3E9GA 1VQPA 4A4EA 1I4K1 4BI4A 2ZPBB 4C5IA 2JT4A 2KT8A 2ECZA 1OYXA 4PJNA 1EFNA 4LDXA 5GAMj 2NUPB 3RUXA 3J81E 3J80E 5IXBA 4JJBA 4BE1A 2COZA 1Y0MA 2V8KA 1RI9A 1FXXA 1C0MA 2QQSA 4E6RA 3KUFA 2ED0A 2I0NA 4P5NA 1LVKA 1SG5A 5GMKl 3MCAB 3HKSA 3EFSA 2F5TX 2XKOC 3OW2A 4ZGJB 2MMPA 2KRSA 3CPWP 1MMDA 3S6WA 1QCOA 1WJQA 1KIKA 3G71A 3HL8A 1X01A 4R56A 4ME7A 2YUOA 4WF2A 4LE9A 8AT1B 2E3HA 4JJCA 1OU8A 2V8IA 1KC8R 2DPPB 4FM4B 2FRYA 3PTAA 2D0QB 1RLQC 2XHCA 2BKDN 2L3SA 1RAAB 3BDLA 2LT1A 3UF4A 1N8RR 1AEYA 2YUPA 3LGLA 2O2OA 5GANe 3KBGA 2DE0X 3EGDB 4M4ZA 3G6EA 1YHQQ 1UEBA 2XICA 5LJ3g 1I1JA 3M56A 3JB9I 3UDCA 2CP0A 2CREA 3I5SA 1NG2A 2E4HA 1R0CB 2RI5A 4ZNXA 1YI2T 1D1AA 3OQ5A 4PJLA 2O88A 5LJ5d 3OSVA 3CCET 4F16A 5J3BA 3G7ZA 2CYZB 2CT4A 2YRVA 1O9SA 2DXUA 2E64A 4E7JA 3V8JA 1M3AA 3A8LB 2L3PA 1FWZA 2LQWA 2V8JA 5FLXE 5AYFA 3V7SA 3T9NA 2CH4W 2A3LA 1SRMA 4AG1C 1QQJA 2C0OA 4IIOA 2FZGB 4JLGA 2LQ8A 1YCYA 3SWNC 3FRNA 1WHLA 5KCOA 1UGSB 4RTTA 1ABQA 4R0KA 4KGXB 1UTIA 2RHIA 1S72A 3P8BB 1VQ8A 2X4WA 3JCMg 3EH2A 3I9QA 4FT2A 1Z9ZA 5LJ3e 1SSHA 1ZHIA 2EBPA 2JMCA 1Q81R 4ATOA 2BE9B 2PNIA 2CSQA 4LDWA 2MK5A 1TOVA 3ZFJA 2C0IA 1LPLA 3E1SA 2P0KA 1M2OA 2B8AA 3RKYA 2A08A 2OTJQ 1YITA 2KR3A 3OS5A 5J39A 5KYUA 3E2UA 4KRTA 1M1FA 1S72T 1T0HA 3QKJA 2QEXA 3S3OA 4OF1A 4CC4B 2NWMA 1G3YA 4J8OA 4C0DB 1JEGA 1WYXA 2ATCB 2QAZA 2JVVA 4M77D 1M1KC 3GIBA 1G83A 4E7LA 2DRMA 3JCMe 5CR2A 3CC7T 1RI0A 2NUTB 2EPDA 1NEBA 4JS4A 1X75C 4QVDA 4MMLA 4LDUA 5FW9A 2CP7A 2QEXT 1G8XA 1ZA2B 2J05A 1WI7A 2MOXA 1TWBA 2HKNA 5A2QE 5CIUA 2QASA 3EG9B 1KC8U 2M9UA 2VUBA 2DERA 1VUBA 2O4XA 1YJWA 4VUBA 4Y92A 3CCUQ 3G4SQ 1QW1A 3VUBA 2RPNA 3EH1A 4Z02A 3ZEHA 1N8RU 2AIRB 4HVVA 1WXTA 4QW2A 1WIEA 1HD3A 3C95A 1PCXA 3SWNB 1BYMA 2M1HA 1RL2A 2M51A 3M0UA 1YIJQ 4CRIA
chains in the Genus database with same CATH topology
3CCST 2OAUA 4JDSA 1VQNT 1LNXA 1W2BA 3A8GB 2R5MA 5HKCA 1FX7A 4QVCA 5GAN2 4PKCC 4GY5A 2ZPFB 4M77A 5CVIA 4N0AA 4FT4A 2G3RA 3CCQA 1YJWT 4LDYA 5HK0A 3WXMB 4C8QF 1VQLT 3QO3A 4ELZC 2RD1A 1VIEA 3HFOA 1VQOT 3G6ET 3GP8A 4N4HA 4M7AF 5LJ3h 2R5AA 3E9FA 5FU7B 1LJOA 2DXCA 1JB0E 2CZ0B 2VV5A 5KH6A 3TREA 2DO3A 3CBOA 3F70A 2LVMA 2JTFA 3MEAA 4RCBA 3L2QA 4ELYC 2LX9A 2OTLA 4DA4A 3CBMA 4E47A 1MGQA 3M53A 4KBMB 3P8HA 5IAYA 4BE2A 5LJ3f 4M7DE 4KULA 1G3TA 1WGSA 5LL6S 2LRQA 1KQSA 3HP9A 3A8OB 4J6WA 5LJ5h 2MI6A 3CXCS 1KG1A 3VYGA 4BDYA 4BD3A 1PSEA 3QUIA 3M54A 3OBYA 5L8RE 3FDRA 4IUVA 4M78G 5KE3A 1H641 3HRSA 2EAYA 4B9WA 1DJ7B 3JB9D 4R55A 3CBPA 2RI2A 1R8OB 5GMKj 2MAMA 3BY7A 4DOVA 3CMAA 5LJ5f 2DD5A 3ME9A 2XU8A 5C6SA 3A8MB 2RI3A 3R6OA 3FLGA 1IREB 1WJRA 1M1GA 2WSFE 4X34A 1QVFS 2QQAA 2K4YA 4L59A 2PUOB 3URGA 2QQRA 2DKGA 3JCMV 1QVGS 5GAMf 5IN1A 2JZ2A 2R57A 3M55A 4M78C 4ZGEB 4A4HA 3I55A 3S3NA 3I56A 3JCMh 1VQ8T 1LOJA 2QXFA 4Y28E 1Q7YU 4M75G 3MP6A 3CPWA 4OP0A 4MZMA 3TEEA 1M90U 1I8FA 4CI0C 1Q81C 2P0QA 1HXDA 3DLMA 2DZ9A 3QPHA 3OYCA 3ASKA 4XTYA 3OYGA 2VGNA 3MEVA 1JRIA 4M7DG 1BI0A 2X4JA 4HT9A 3RMSA 1Q86U 4FU6A 3CC2T 2DXBA 5A0LA 5J26A 2PQWA 2ZZDA 3CMAT 4L6V5 4QQDA 3PT9A 2EQMA 3FJPA 4TVRA 4BY6C 4M75C 4OB0B 3GLXA 4PL6A 4C92D 2LCLA 3NTIA 4XTUA 5I2SA 3OYNA 1YITT 1W2BS 2CZ7B 4NL3A 5GANg 2K3XA 1XNIA 2PVGB 2RK1A 2Y4YA 4X9CA 4C5GA 2JNGA 3CXCA 2JTMA 1BIAA 1D3BB 2RHXA 3PGGA 5CK9A 3Q1JA 4M7DC 3QJYA 2IG0A 2E5QA 3I55T 3I56T 1YBYA 2GF7A 2XDBA 5A0GA 2L89A 1VQ7A 4MDWA 2E70A 2FL7A 4J83A 4QQ6A 4C92B 2CKKA 1MHNA 1OZ3A 1XTDA 1NE8A 1NZ9A 2CGHA 3CMEA 4C8QD 4A4KA 3LLRA 1ZQ1A 1WJSA 2DK3A 3META 3ZBDA 1OZ2A 4BI3A 1P92A 4PJOG 1QVFA 3CCRA 5DM7R 5CKHA 2HQXA 2XDDA 5GAN7 4M7AD 1OI1A 2QDYB 2X4YA 4A4GA 3CCLA 1KHIA 4F7UE 1Y96B 3J7AF 4NOYA 1UGRB 4ZN1A 3C12A 3JCMW 1VQ5A 1VQ6A 1AHJB 2PU9B 3CCMA 3LW5E 1KQSS 2GFAA 1VQ9T 1K73C 1VQKA 2RHYA 1B34B 4C0DC 4FIBA 1YI2A 3SB2A 2IVWA 4Q5WA 5GAOp 4EMKC 2EQKA 4ZGDB 2DD4A 3CCEA 5GANj 2L3RA 3RKWA 4PJOC 4M77G 4C92F 3EFRA 4J6XA 4XAXB 5DLQE 3PIPA 1KC8C 3VU3C 3OYHA 3H6ZA 4KUIA 2KAFA 4MZTA 1UGPB 2E65A 2RK2A 4M78E 4ZTJA 3HSBA 3CCVA 2EJGA 2VGMA 1K8AC 3LX7A 3M5AA 5KCHA 3CMET 5CQXA 2KY9A 4LD6A 1N8RC 2EQUA 4BACA 3WVEB 3CCRT 1KD1U 2KVQG 2MWOA 4E7HA 4GLKA 5EG2A 3JB9J 3VUZA 1KQ2A 3CCLT 4M77C 3JCMJ 4N0AC 1I81A 4A54A 4BB7A 3OYMA 3CD6T 4YTLA 2EYQA 2EWNA 3JCMP 3V7RA 4C92A 3CC4A 3QHSA 3TU4K 1VQ5T 3QZ5B 3CPWS 2E6NA 2K2VA 3CCMT 4JRPA 1EIFA 2AHJB 3OMCA 3JCMX 4XTWA 2K5FA 1VQKT 3GNFB 4JLIA 5GAN5 1KHCA 4F7UG 2DTHA 4M75E 4EDUA 3BDUA 1KD1C 1Y96A 4LD9K 3JAME 3RERA 2LNVA 5LJ5g 2QTXA 2XG8D 3NFCA 5GAMd 3CCJA 2K3YA 3GOXA 2WSEE 3AHUA 3CCVT 1UGQB 4E7IA 2ZPHB 4C8QA 4M78B 3PNWC 1K9MU 2BUDA 3QYHB 4N4IA 3P8DA 5FU6C 1YHQA 5GAMg 1GXIE 1G3SA 1X6OA 3PFSA 3V8KA 1NJIU 4M7AA 4Y91A 2K5LA 4IKFA 4XK8E 3N5BB 2LT4A 1QP3A 2A7YA 4OB2B 3L2WA 3CCQT 4KT0E 3CPFA 2RHZA 4II1A 3SWNA 2HAXA 4OMFB 1BIBA 5LJ3j 4HKEA 3CC4T 1WQWA 3OW2S 2RB6A 4BUGA 3JCMb 2ZPGB 4XU0A 5GAN3 1QVPA 1VQ4A 4C0FA 3OYKA 4N4GA 4RG8A 3DKMA 3BFMA 3GF5A 4XQ3A 2HBPA 4EPCA 4BY6B 3SDZA 4M75B 1WNLA 4M78F 2OTLT 2WACA 3PIOA 3CD6A 3X20B 1BKBA 5GMKe 5D6XA 3E9GA 2QI2A 3CCJT 1VQPA 4PJOE 3M57A 1O75A 4XU2A 4A4EA 1I4K1 5LJ5j 2XI9A 4BI4A 1NPPA 1H3ZA 2FYKA 4MZPA 4M7DB 2ZPBB 5CAIA 5CKBA 3LYIA 3O8VA 4C5IA 1OYXA 4LDXA 5IT9E 2DXTA 5GAMj 1Q82U 3OYLA 2LTOA 4O6JA 3M59A 3UT1A 4B9XA 3CEYA 4HT8A 2HNIA 3RUXA 3JCMf 3J81E 3L42A 3X24B 3J80E 3CC7A 3JCMQ 2XIDA 5GANd 4M77E 4BE1A 4M75F 1Q7YC 3OY9A 1NPRA 1M1KU 5GAN6 2E10A 4RKUE 5GAMe 3JRZA 3RMQA 1M90C 2V8KA 2O4XB 1YJNA 1FXXA 2QQSA 4OVAA 4PNOA 4HCBA 4V2SA 2PUKB 3KUFA 3M58A 2CS7A 4P5NA 4IUTA 3MP8A 4ZTFA 3RKXA 4M7DF 3JB9G 1XQHA 3M9QA 3OS2A 1Y71A 5GMKl 3QJ6A 3L1AA 5M9OA 5GAOm 1VQMA 5FRMA 3MCAB 3HKSA 4J5YA 4FSXA 4EMKB 4BE0A 1Q86C 3S3MA 1Y7XA 2F5TX 2XKOC 3EFSA 2XDPA 4A53A 4ZGJB 3OW2A 4PJOB 2MMPA 4OGCA 2DZCA 5A0DA 4IURA 3L2RA 3S6WA 2H3JA 1WJQA 2XD0A 2OTJA 3HRUA 2FHDA 2LC4A 4C8QE 3G71A 3GNGA 3HL8A 2M0OA 3DB3A 1X01A 3QXEB 5DLOA 2KMTA 3LWHA 3QSUA 4R56A 2HD0A 2RO0A 1WPYA 2LDMA 1G5VA 2KK4A 4ME7A 4M7AE 1N27A 4JUVA 3OSSC 3OA6A 4WF2A 3E19A 5GMKm 2F69A 3M4YA 2QQ9A 2KDSA 4XU3A 2Y4XA 4M77B 3QBYA 5CKEA 5GAOn 2V8IA 3NTKA 1YJNT 4HCCA 1M9SA 2DPPB 2JUFA 3PMIA 4FM4B 4PJOF 2M16A 3VYHB 4LDVA 3OS0A 2VXEA 3C4SA 3PTAA 2FB7A 2D0QB 1VQMT 4X9DA 2XHCA 3OS1A 2BKDN 3V7CA 2ZGWA 1QP2A 2LT1A 3BDLA 3FIFA 1VQ7T 2JOYA 3WVDB 2ZPIB 5FRNA 4ZN3A 2D9TA 3LGLA 5CQYA 5LJ3d 5GANe 1D3BA 3KBGA 4C5EA 3G6EA 2OTJT 1UEBA 4J6YA 3INZA 3DLLA 3OYBA 2XICA 3HFNA 4IUUA 4M77F 5LJ3g 5FU6B 3A5ZB 3V8LA 3OYYA 2CZ1B 3M56A 3UDCA 3JB9I 2EJFA 2K5IA 3OBWA 1N9SA 4F7UB 2VXFA 1VQ6T 4C92C 3MEWA 3QG1A 4PLIA 4C8QG 2LCCA 1Y07A 4M78D 4DQ2A 2EIFA 2RI5A 1U1SA 2MF2A 1YI2T 3OQ5A 4M7AG 4UC4A 2RJCA 2VC8A 5D6YA 5LJ5d 5GAN4 3OSVA 3MP1A 3CCET 2DTIA 1U1TA 5J3BA 4E7KA 3G7ZA 2DTOA 5CKFA 2CYZB 1N6AA 2YRVA 1O9SA 3M4GA 2GFUA 4JRKA 2DXUA 2E64A 1BI3A 4E7JA 5I2MA 3V8JA 2L8DA 2QQBA 3A8LB 3RIRA 1FWZA 1B34A 2V8JA 5FLXE 2R58A 2ZCFB 5AYFA 3TCJA 3X26B 4C8QC 5CCAA 2FVUA 3QIIA 3V7SA 3T9NA 3JB9H 5GMKi 3HPWA 4J7FA 2DVEA 4QVZA 5FROA 5GAOq 1JJ2S 4F7UF 2A3LA 4M7AC 2E41A 4HCZA 4OB3B 3L2VA 3SD4A 2GCXA 2XK0A 3OB9A 3L2UA 4M75D 4JLGA 2LQ8A 5GMKh 1YCYA 3SWNC 4EMGA 4MDXA 3FRNA 5KCOA 3FC3A 1UGSB 3JCMd 3QDRB 4BDZA 4A4FA 2D6FA 4M7DD 1YIJA 1K9MC 1HK9A 2RHIA 2X4XA 2MWPA 3HHTB 2E1HA 3P8BB 2X4WA 2DIGA 3H8ZA 3L2ZA 1NJIC 3JCMg 1VQ8A 4RG2A 3BW1A 3JCMc 3OYAA 1IZ6A 1WQ7A 1G3WA 1M4ZA 4FT2A 5LJ3e 1ZHIA 4MMKA 3DB4A 3FEOA 5D6WA 4F7UA 4IUQA 2KSSA 2RA2A 3RESA 2PVOB 4ATOA 1M5Q1 2RM4A 4EMHA 4LDWA 4KUDK 3CCUT 3G4ST 5FU7C 5GAMh 3ZFJA 1M8VA 1XOVA 2L5QA 3E1SA 1YHQT 2P0KA 3CC2A 3MEUA 2B8AA 1BI1A 3MO8A 5HY6A 3RKYA 2VYTA 5CO7A 1Q81U 4NL2A 1ZBXA 2DJZA 3ER0A 3OMGA 5GAOl 1YITA 1BI2A 3CCUA 3NTHA 3OS5A 2NLUA 3LWIA 5LJ5e 3QZ9B 5J39A 4M78A 4O5VA 3X28B 4PJOD 3LH0A 4IUPA 1M1FA 4C0GA 1VQ4T 1YIJT 2ZPEB 1S72T 4C92E 2QA4A 1JJ2A 5HK3A 3SFMA 3QKJA 2QEXA 3S3OA 4OF1A 2YLCA 3VV0A 1KQ1A 2P0PA 5GAN8 3EAEA 2I2LA 1Q82C 1G3YA 2RH2A 4J8OA 2C06A 5DY9A 4C0DB 1VQPT 3HRTA 4C0ZA 2JVVA 3A8HB 4M77D 1M1KC 1UB4A 4RMOA 3GIBA 4E7LA 4OB1B 4XTZA 3X25B 3JCMe 4M75A 2DEQA 4JS5A 2RHUA 5KE2A 4QQGA 5CR2A 3PMTA 1VQ9A 1N9RA 3JB9F 3LGFA 4JRIA 3CC7T 2RJEA 1S72A 1RI0A 2YHTA 2RJFA 4HA8A 2Y90A 4NS5A 3UPUA 2P4TA 1V29B 2CZ6B 5GAOr 2HQEA 4M7DA 1U8RA 3KXTA 1YJ9A 4JS4A 5GANh 1X75C 4QVDA 1W4SA 3UWNA 3OYIA 3JSCA 2QA4T 4MMLA 4LDUA 4DOWA 2QEXT 2LQKA 4JJNK 1K73U 2BIVA 2RJDA 3FB9A 5C0MA 3CCSA 1VQNA 1SSFA 4JRQA 1VIFA 3C94A 4RCCA 4J7IA 4XU1A 5I21A 3OYFA 5A2QE 5CIUA 3G4SA 4FL6A 4C92G 4PLLA 1KC8U 1QVGA 2M9UA 5GANf 2VUBA 1JBMA 1VUBA 2O4XA 2YLBA 4BI8B 1YJWA 1VQLA 4VUBA 3OYDA 1I5LA 3GPLA 2E6ZA 1QW1A 4D6WA 3MHXA 1VQOA 1K8AU 2X35A 3OYJA 3G71T 3VUBA 2EQJA 3QYGB 4Z02A 5CKDA 3ZEHA 4C8QB 2WSCE 1TH7A 1N8RU 2EKOA 4EMKA 2O01E 3OYEA 4PJOA 2F5KA 2EJ9A 4L5GA 4QW2A 4M7AB 4XTVA 3VJPA 2GQVA 4OGEA 3VKIA 1PSFA 2EFIA 1YJ9T 2K57A 3C95A 2DAQA 2E12A 3SWNB 2JN0A 2M1HA 2PVDB 1RL2A 4C5HA 1BYMA 4XTXA 4CRIA 2KQWA 2DIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQX A;  2RHI A;  2X4X A;  2MWP A;  1OI1 A;  2X4Y A;  4A4G A;  2R5M A;  2DIG A;  2X4W A;  3H8Z A;  3OY9 A;  4RG2 A;  4BE1 A;  3OYA A;  4GY5 A;  2O4X B;  2G3R A;  2QQS A;  3DB4 A;  3FEO A;  4OVA A;  5D6W A;  4IUQ A;  3KUF A;  4IUT A;  2GFA A;  2RHY A;  3MP8 A;  4ZTF A;  3M9Q A;  4N4H A;  3OS2 A;  4Q5W A;  3QJ6 A;  5M9O A;  5FRM A;  2EQK A;  2R5A A;  3E9F A;  2L3R A;  2P0K A;  4BE0 A;  3MEU A;  3S3M A;  2B8A A;  2XDP A;  3MO8 A;  5KH6 A;  2VYT A;  3F70 A;  3OYH A;  3MEA A;  2LVM A;  2JTF A;  3H6Z A;  3OMG A;  4IUR A;  3L2Q A;  3S6W A;  3L2R A;  3NTH A;  2NLU A;  4ZTJ A;  1WJQ A;  2FHD A;  3LX7 A;  5J39 A;  5KCH A;  2M0O A;  3DB3 A;  3P8H A;  5IAY A;  4BE2 A;  2RO0 A;  4LD6 A;  1G5V A;  2LDM A;  2EQU A;  1WGS A;  1N27 A;  3LH0 A;  3OA6 A;  4BAC A;  4IUP A;  2MWO A;  2LRQ A;  4E7H A;  3QKJ A;  3OYM A;  3S3O A;  4BD3 A;  3QBY A;  3FDR A;  4IUV A;  3NTK A;  3EAE A;  5KE3 A;  2E6N A;  4CRI A;  3OMC A;  4B9W A;  3PMI A;  3OS0 A;  2M16 A;  2RI2 A;  3C4S A;  1KHC A;  4EDU A;  3OS1 A;  3ME9 A;  2BKD N;  5C6S A;  2RI3 A;  3BDL A;  3FLG A;  1WJR A;  4X34 A;  4E7L A;  4L59 A;  5FRN A;  3L42 A;  2D9T A;  2RHU A;  3LGL A;  4QQG A;  2QQR A;  5KE2 A;  3PMT A;  5IN1 A;  2JZ2 A;  2K3Y A;  2R57 A;  4C5E A;  3GOX A;  3LGF A;  4E7I A;  2RJE A;  4A4H A;  1RI0 A;  2RJF A;  3PNW C;  4NS5 A;  2BUD A;  3S3N A;  4N4I A;  3OYB A;  3P8D A;  2HQE A;  4IUU A;  3PFS A;  3MP6 A;  4IKF A;  3DLM A;  3OYC A;  3UWN A;  3OYI A;  3L2W A;  3ASK A;  2RHZ A;  3MEW A;  4II1 A;  4PLI A;  3OYG A;  2LCC A;  3MEV A;  2BIV A;  2RI5 A;  2RJD A;  5C0M A;  1SSF A;  3OQ5 A;  4UC4 A;  2RJC A;  5D6Y A;  3OYF A;  3MP1 A;  4FU6 A;  5CIU A;  4E7K A;  4FL6 A;  4PLL A;  3OYK A;  4N4G A;  2PQW A;  5J26 A;  4QQD A;  2EQM A;  2O4X A;  2YRV A;  2GFU A;  3OYD A;  4PL6 A;  3OYN A;  3NTI A;  4E7J A;  2WAC A;  2L8D A;  2K3X A;  1XNI A;  2X35 A;  4C5G A;  2R58 A;  3OYJ A;  5D6X A;  3E9G A;  2EQJ A;  2RHX A;  3QII A;  4Z02 A;  3ZEH A;  3Q1J A;  5FRO A;  4A4E A;  4QVZ A;  2EKO A;  2IG0 A;  3OYE A;  2E5Q A;  1H3Z A;  4HCZ A;  2F5K A;  3L2V A;  3LYI A;  3O8V A;  2GF7 A;  2XK0 A;  3OB9 A;  4QW2 A;  3SD4 A;  3L2U A;  2L89 A;  2EFI A;  4C5I A;  1OYX A;  4QQ6 A;  3MET A;  2CKK A;  3OYL A;  2LTO A;  2DAQ A;  1MHN A;  1OZ3 A;  2M1H A;  4C5H A;  5KCO A;  3UT1 A;  4B9X A;  3FC3 A;  3CEY A;  3LLR A;  1WJS A;  4BDZ A;  4A4F A;  1OZ2 A;  4BDY A;  2DIQ A; 
#chains in the Genus database with same CATH topology
 2OAU A;  2SRC A;  1LNX A;  2BZX A;  2KNB B;  1FX7 A;  1X6B A;  4PKC C;  1MV0 B;  2ZPF B;  1VQP Q;  1YJW T;  5HK0 A;  3WXM B;  3JV3 A;  3GP8 A;  4RUG A;  5KH6 A;  1W1F A;  3TRE A;  3F70 A;  2OTL A;  4DA4 A;  5EC7 A;  2CP2 A;  1MGQ A;  1UJ0 A;  4IIM A;  4BE2 A;  5IAY A;  2RMO A;  2HZY A;  2QA4 Q;  1WGS A;  2DL7 A;  3A8O B;  3AT1 B;  1EZZ B;  2GTO A;  4IUV A;  4M78 G;  3HRS A;  4E2F B;  1T3S A;  4D8K A;  5IXF A;  3BY7 A;  1UG1 A;  3ME9 A;  2XU8 A;  3G71 Q;  1WJR A;  4X34 A;  4DEY A;  1SKU B;  1Q7Y R;  5KYW A;  2PUO B;  3URG A;  1AT1 B;  3JCM V;  2CP3 A;  2DA9 A;  3VS6 A;  5IHK A;  1RAH B;  3I55 A;  1OX9 A;  4JJD A;  2EKH A;  1RUW A;  1UJY A;  4MZM A;  4OP0 A;  3TEE A;  1MMN A;  5I22 A;  4CC7 A;  1VQN Q;  1M1K R;  1BI0 A;  5J26 A;  2PQW A;  4M75 C;  4PL6 A;  4C92 D;  2LCL A;  3OYN A;  1W2B S;  4NL3 A;  2K3X A;  2PVG B;  2RK1 A;  2Y4Y A;  1D3B B;  2RHX A;  4M7D C;  3I55 T;  2GF7 A;  5A0G A;  3M0Q A;  4C92 B;  4QQ6 A;  1U5S A;  2CKK A;  1MHN A;  1XTD A;  3LLR A;  3MET A;  1QVF A;  1OZ2 A;  1P92 A;  1OPK A;  1WLP B;  5CKH A;  1KK7 A;  2XDD A;  5GAN 7;  2QDY B;  1KHI A;  3IQL A;  2F2X A;  1VQ9 T;  1K73 C;  2F2W A;  4Q5W A;  4PJO C;  4C92 F;  4J6X A;  2HKQ B;  2X9H A;  1D1B A;  2KAF A;  1UGP B;  2E65 A;  2AT1 B;  2EJG A;  1K8A C;  1I5O B;  1VQ8 Q;  3M5A A;  1GRI A;  2EYY A;  1TG0 A;  2DMO A;  2LZ6 B;  3WVE B;  2MWO A;  5EG2 A;  3VUZ A;  2VWF A;  4N0A C;  4A54 A;  4YTL A;  1B7T A;  4OMM A;  3QHS A;  3TU4 K;  3RBB B;  1X43 A;  2E6N A;  3PVL A;  2AHJ B;  3CMA Q;  2K5F A;  3GNF B;  3A98 A;  2JW4 A;  1K9M R;  4RTY A;  1KD1 C;  2KYM A;  1N5Z A;  2LNV A;  2HBW A;  5LJ5 g;  5GAM d;  5ECA A;  3H0H A;  1OQK A;  1UGQ B;  4E7I A;  4C8Q A;  2J7I A;  3PNW C;  4N4I A;  1JU5 C;  1YHQ A;  1BK2 A;  3PFS A;  3EG3 A;  3V8K A;  1W2B P;  4IKF A;  3UAT A;  1VYV A;  3CPF A;  1D0Z A;  1M2V A;  2KXC A;  1GCQ A;  4HKE A;  4LUD A;  1WQW A;  3OW2 S;  2RB6 A;  3JCM b;  4A63 B;  1V1C A;  3R6N A;  4C0F A;  3DKM A;  3BFM A;  2FPE A;  2CSI A;  4M75 B;  3PIO A;  3X20 B;  1BKB A;  2FG0 A;  3D7S B;  2BTT A;  1H3Z A;  4M7D B;  5CAI A;  3O8V A;  2L0A A;  2DXT A;  2LTO A;  4O6J A;  4AFZ C;  3UT1 A;  3L42 A;  1YWP A;  4M77 E;  3O5Z A;  2EVR A;  4M75 F;  1VQ5 Q;  1M1K U;  5GAN 6;  1K1Z A;  1YNZ A;  2H8H A;  3EG2 A;  4HCB A;  4V2S A;  2AK5 A;  4M7D F;  2AKL A;  1WHG A;  5GAO m;  3QJ6 A;  5M9O A;  4FSX A;  1Q86 C;  1Y7X A;  2ROL A;  2XDP A;  4PJO B;  2OTJ A;  4PJM A;  1K76 A;  3LWH A;  2RO0 A;  4EIK A;  2LDM A;  2KRO A;  3OSS C;  3OA6 A;  1K73 R;  1PC0 A;  5GMK m;  2F69 A;  3M4Y A;  4PFP A;  5CKE A;  2X3W D;  4KH0 B;  1X27 A;  1FMV A;  1M9S A;  3PMI A;  4PJO F;  3VYH B;  4LDV A;  3C4S A;  1K8A R;  2KI7 A;  2VAS A;  3V7C A;  1QP2 A;  3FIF A;  1VQ7 T;  2JOY A;  3CCJ Q;  3OW2 P;  4ZN3 A;  1G2B A;  5CQY A;  2OTJ T;  4J6Y A;  3OYB A;  3EGU A;  3OYY A;  4J9I A;  2CZ1 B;  4RTX A;  2EJF A;  3EGX B;  1N9S A;  1VQ6 T;  4HVU A;  5IHN A;  3QG1 A;  1Y07 A;  4M78 D;  1U1S A;  3NMZ C;  2QK0 A;  5D6Y A;  2LJ1 A;  3MP1 A;  2DTO A;  5CKF A;  1N6A A;  1QLY A;  3CD6 Q;  4OMP A;  5I2M A;  3MJX A;  2QQB A;  2CH4 A;  1B34 A;  3G4S A;  3CCU A;  3TCJ A;  3X26 B;  1UHC A;  5GMK i;  3HPW A;  1BB9 A;  1SHG A;  4M7A C;  2MCN A;  2E41 A;  4OB3 B;  3L2U A;  3OB9 A;  4WCI A;  4EMG A;  6AT1 B;  2KT1 A;  2DYB A;  2V26 A;  1YIJ A;  1HK9 A;  3MKD A;  3H8Z A;  1JXM A;  3JCM c;  3OYA A;  1G3W A;  4MMK A;  4IUQ A;  1VQM Q;  2KSS A;  3RES A;  1M5Q 1;  5HCK A;  4KUD K;  1Z9Q A;  3CCU T;  3G4S T;  5KYY A;  2YDL A;  1XOV A;  3CC2 A;  1TUD A;  2YRD A;  2DF6 A;  1MMG A;  5CO7 A;  3EHQ A;  1ZBX A;  2DJZ A;  4NL2 A;  2RN8 A;  5GAO l;  1BI2 A;  1TSF A;  2EYX A;  3NTH A;  1XJW B;  4AT1 B;  3LWI A;  4LNP A;  4Z89 A;  4O5V A;  3LH0 A;  4JZ3 A;  1YIJ T;  2IPO B;  4C92 E;  2QA4 A;  1JJ2 A;  1PM3 A;  1Q86 R;  2DL8 A;  1Q82 C;  2RH2 A;  2C06 A;  5DY9 A;  1WHJ A;  2W10 A;  1VQP T;  1QMC A;  2LJ3 A;  1TU0 B;  2YUN A;  3A8H B;  1J3T A;  4RMO A;  4OB1 B;  3X25 B;  1FMW A;  2HDA A;  1TXQ A;  4JS5 A;  4QQG A;  3JB9 F;  1IRX A;  4HA8 A;  4LXC A;  2P4T A;  3UPU A;  1YFN A;  5GJW B;  5GAO r;  1R0B G;  2EYZ A;  1H3H A;  3UWN A;  2QA4 T;  1VA7 A;  4DOW A;  2YT6 A;  1K73 U;  3FB9 A;  1NLP C;  1VQN A;  1SSF A;  2A28 A;  3C94 A;  4J7I A;  4AMC A;  2RQT A;  4C92 G;  1AWJ A;  5GAN f;  4BI8 B;  3OYD A;  4DBR A;  3GPL A;  2COW A;  2E6Z A;  4FYV B;  2VVK A;  1K8A U;  4HXJ A;  3G71 T;  1MNE A;  3HTR A;  2EQJ A;  1TH7 A;  4EMK A;  1S1N A;  3OYE A;  2F5K A;  4L5G A;  4M7A B;  2GQV A;  3VKI A;  4FYW B;  2DBM A;  2L2P A;  3M0S A;  2PVD B;  4C5H A;  2MYS A;  1RAI B;  4XTX A;  5GAN 2;  3EFO B;  2MPX C;  2KQW A;  2DIQ A;  1ZSZ A;  1VQN T;  4KGV B;  3A8G B;  4QVC A;  1AZE A;  4M77 A;  2IIM A;  2HCK A;  4FT4 A;  4ELZ C;  3HFO A;  3G6E T;  4M7A F;  2M0Y A;  2DYI A;  2DXC A;  1JB0 E;  3MEA A;  4RCB A;  3CBM A;  5KYN A;  2D1X A;  1R77 A;  1M27 C;  4J9D A;  4E47 A;  3P8H A;  5LJ3 f;  4M7D E;  4AG2 C;  5AT1 B;  4KUL A;  5LL6 S;  2LRQ A;  1TTH B;  5LJ5 h;  2QGF B;  4BD3 A;  1PSE A;  2RF0 A;  1IGQ A;  1DJ7 B;  2SEM A;  3CBP A;  1R8O B;  1PD1 A;  3CMA A;  1BBZ A;  2MAM A;  4F14 A;  4J9E A;  2DD5 A;  5C6S A;  1ZX6 A;  3FLG A;  1IRE B;  1QVF S;  1M3C A;  2QQR A;  2DKG A;  1QVG S;  5GAM f;  3M55 A;  2A37 A;  1YJ9 Q;  3S3N A;  1Q82 R;  1K4U S;  1D09 B;  1VQ8 T;  2QXF A;  4FW2 A;  4M75 G;  3MP6 A;  3CPW A;  1I8F A;  4CI0 C;  3DLM A;  1HXD A;  3QPH A;  1KSW A;  3ASK A;  2EGC A;  2JS2 A;  4RTZ A;  3OYG A;  1JRI A;  4M7D G;  4PK4 A;  1UUE A;  3RMS A;  1Q86 U;  3ZL7 C;  1WDX A;  2COY A;  1VQL Q;  1X69 A;  2BZY A;  2ZAE A;  2ZZD A;  4QQD A;  3CMA T;  1VQO Q;  2JM9 A;  1AZG B;  1YIT T;  1AWX A;  3CXC A;  2JNG A;  2JTM A;  1BIA A;  3PGG A;  3Q1J A;  2V1R A;  4K11 A;  3QJY A;  1YBY A;  2EQI A;  4MDW A;  2E70 A;  1I0C A;  1ZQ1 A;  2DK3 A;  4PJO G;  5DM7 R;  4A4G A;  2X4Y A;  3CCQ Q;  3J7A F;  2W0Z A;  4NOY A;  3C12 A;  3JCM W;  1VQ5 A;  3LW5 E;  1KQS S;  4FIB A;  3SB2 A;  2EQK A;  4ZGD B;  4Z8A A;  4FYX B;  3VU3 C;  3OYH A;  4MZT A;  4M78 E;  3HSB A;  3LX7 A;  1ZBJ A;  4HVW A;  5CQX A;  1RAE B;  2EQU A;  1QVF P;  1I81 A;  3OYM A;  1QVG P;  1F1B B;  2EWN A;  1YN8 A;  3V7R A;  4C92 A;  1VQ5 T;  3CC2 Q;  3QZ5 B;  2K2V A;  4XTW A;  1E6G A;  2DTH A;  2KBT A;  3VS4 A;  2OI3 A;  2GNC A;  3CQT A;  3NFC A;  3CCJ A;  2K3Y A;  1MND A;  2OX7 A;  2WSE E;  3I56 Q;  2ZPH B;  2YXY A;  2BUD A;  3QYH B;  5KYU B;  5FU6 C;  1GXI E;  1OV3 A;  2K5L A;  3TQ7 P;  1NBE B;  4II1 A;  4ORZ A;  2HAX A;  3EHR A;  1BIB A;  2XMF A;  2K7A A;  2ZPG B;  4XU0 A;  3TVT A;  7AT1 B;  1VQ4 A;  4N4G A;  1Y57 A;  2FZK B;  4CC3 A;  4EPC A;  2OTL T;  1WNL A;  2WAC A;  3CD6 A;  3CCJ T;  4XU2 A;  1O75 A;  5LJ5 j;  1NPP A;  2FYK A;  1KQS P;  3KFV A;  5IT9 E;  1Q82 U;  3CEY A;  4HT8 A;  3JCM Q;  2XID A;  5GAN d;  2EGE A;  1ARK A;  2DBK A;  3OY9 A;  1NPR A;  3RMQ A;  2O4X B;  3QDF A;  1VQK Q;  2QGG A;  1YI2 Q;  2CS7 A;  3CCE Q;  3JB9 G;  1XQH A;  2BZ8 A;  1UFF A;  1VQM A;  3CD6 T;  5FRM A;  3L1A A;  4OML A;  4J5Y A;  2D6F A;  4BE0 A;  3S3M A;  4A53 A;  1ZUY A;  1OEB A;  5A0D A;  4IUR A;  3CCV Q;  1ZSG A;  2H3J A;  2K2M A;  3HRU A;  3GNG A;  2M0O A;  2A0F B;  5DLO A;  1WPY A;  1G5V A;  2KK4 A;  4M7A E;  1N27 A;  4JUV A;  1IXD A;  2QQ9 A;  4E7S A;  1OU9 A;  4XU3 A;  2Y4X A;  5KYX A;  3QBY A;  5GAO n;  1MV3 A;  3VS7 A;  2K9G A;  1VQM T;  1AOJ A;  3OS1 A;  3RDV A;  1PG5 B;  2KYB A;  2ZPI B;  3I35 A;  2D9T A;  5LJ3 d;  2KRM A;  2DEU A;  1B07 A;  2X51 A;  3DLL A;  3HFN A;  5FU6 B;  3A5Z B;  3V8L A;  2RQV A;  3OBW A;  4F7U B;  2VXF A;  4PLI A;  3U23 A;  4DQ2 A;  2EIF A;  2MF2 A;  4M7A G;  5GAN 4;  1WA7 A;  2VKN A;  1E7O A;  3M4G A;  2DFU A;  2GFU A;  4JRK A;  3TSW A;  1BI3 A;  4GBQ A;  5KYW B;  2L8D A;  4J9F A;  2ZCF B;  4C8Q C;  2FVU A;  3QII A;  1JJ2 S;  4PJJ A;  5FRO A;  4F7U F;  4HCZ A;  3L2V A;  1B3Q A;  3SD4 A;  4DBH A;  4M75 D;  5GMK h;  4MDX A;  3CC7 Q;  1GCQ C;  3FC3 A;  3JCM d;  3QDR B;  4BDZ A;  4A4F A;  5IHI A;  4M7D D;  5FWB A;  3RIR A;  1YJN Q;  1NJI C;  2OAW A;  1WZO A;  1M4Z A;  1SEM A;  1UE9 A;  2EGA A;  3TSZ A;  1T3L A;  3FEO A;  5D6W A;  1ZUK A;  2PVO B;  4DBQ A;  2RM4 A;  5GAM h;  2L5Q A;  2DIL A;  1YHQ T;  2DET A;  3MEU A;  3MO8 A;  2ED1 A;  3ER0 A;  1V76 A;  2O31 A;  5LJ5 e;  1W70 A;  3QZ9 B;  2X3X D;  2D8H A;  4M78 A;  3X28 B;  4PJO D;  4J9B A;  4IUP A;  2ZPE B;  4J9C A;  3VV0 A;  2DM1 A;  2P0P A;  5GAN 8;  2I2L A;  1PHT A;  3HRT A;  3GBQ A;  3H0I A;  4C0Z A;  2DVJ A;  1YCS B;  1K0S A;  3LGF A;  1M30 A;  2YHT A;  1V29 B;  2HQE A;  1U8R A;  3KXT A;  1YJ9 A;  3C0C A;  3OYI A;  3JSC A;  2NUP A;  4JJN K;  1JJ2 P;  1WHM A;  4JRQ A;  4AFS C;  1VIF A;  4KH1 B;  5I21 A;  4FL6 A;  1JBM A;  2YLB A;  1U06 A;  1T0J A;  1VQL A;  4D6W A;  3VS2 A;  3EG1 A;  1VQO A;  1WFW A;  4F17 A;  2X35 A;  1H8K A;  2P84 A;  3OYJ A;  1CKA A;  1GBR A;  4RTV A;  4C8Q B;  2EJ9 A;  4XTV A;  4OGE A;  1PKT A;  1PSF A;  2EFI A;  1YJ9 T;  2K57 A;  1TS9 A;  1KD1 R;  3H41 A;  2RQU A;  2JN0 A;  2KEA A;  1VQ4 Q;  1M2V B;  2ABL A;  1ABO A;  4JDS A;  1W2B A;  1QWF A;  2KGT A;  4GY5 A;  2KE9 A;  2G3R A;  3CCQ A;  1VQL T;  4C8Q F;  3QO3 A;  1QKX A;  2RD1 A;  2JXB A;  1VQO T;  1C1A A;  4N4H A;  5L23 A;  1WXB A;  2R5A A;  1LJO A;  2J06 A;  4QT7 A;  1VOM A;  4FW1 A;  2LVM A;  1RAG B;  1BCM A;  4ELY C;  2LX9 A;  1NJI R;  3EGD A;  3M53 A;  1NM7 A;  2DL5 A;  2FO0 A;  2DX1 A;  3M0R A;  1PKS A;  3HP9 A;  1M3B A;  4J6W A;  5GJV B;  2MI6 A;  3CXC S;  1KG1 A;  2FPF A;  3VS3 A;  2LMJ A;  3OBY A;  3QUI A;  1GFD A;  1H64 1;  2CUD A;  1HYO A;  2BE7 D;  2EAY A;  2L3Q A;  4B9W A;  3JB9 D;  1SPK A;  5GMK j;  2K79 A;  4DOV A;  3A8M B;  2RI3 A;  1M1G A;  2WSF E;  1VQ9 Q;  4L59 A;  1WXU A;  1WHH A;  2JZ2 A;  2R57 A;  1OUL A;  4ZGE B;  4A4H A;  3I56 A;  4Y28 E;  4X1V A;  1Q81 C;  2P0Q A;  3OYC A;  2DZ9 A;  3CCS Q;  2E3I A;  1GCP A;  2VGN A;  2X4J A;  1QCN A;  3CC2 T;  2NYS A;  5A0L A;  4L6V 5;  3PT9 A;  5GAO p;  4BY6 C;  1GL5 A;  4OB0 B;  3GLX A;  5I2S A;  3H0F A;  2CZ7 B;  5GAN g;  2F2V A;  4X9C A;  4C5G A;  5CK9 A;  3I56 T;  3NGP A;  3VS0 A;  2G6F X;  4J83 A;  2JMA A;  1MUZ A;  1OZ3 A;  1NZ9 A;  2CGH A;  4A4K A;  1WJS A;  4BI3 A;  2HQX A;  4M7A D;  3M0T A;  4OMQ A;  4F7U E;  1Y96 B;  2DJQ A;  1AHJ B;  4E7Z A;  1VQK A;  2RHY A;  1M8M A;  1B34 B;  4C0D C;  1YI2 A;  2IVW A;  1MMA A;  4EMK C;  2DD4 A;  3CXC P;  3CCE A;  3RKW A;  2KRN A;  3PIP A;  4F04 B;  2QG9 B;  2DRK A;  4ZTJ A;  3CCV A;  2NUT A;  1ZSZ C;  2KY9 A;  5I11 A;  4LD6 A;  1KD1 U;  1QWE A;  4GLK A;  1KQ2 A;  4M77 C;  3JCM J;  2EYQ A;  2CP5 A;  1UHF A;  4RTW A;  1IO6 A;  1SF9 A;  4JRP A;  3OMC A;  1VQK T;  2Z0W A;  5KYY B;  4JLI A;  5GAN 5;  1KHC A;  3EG9 A;  4F7U G;  4M75 E;  2J6F A;  3QWY A;  1AWO A;  1IHV A;  3RER A;  2JM8 A;  4GLM A;  2QTX A;  2XG8 D;  4JPB W;  3CCV T;  3RNJ A;  3M0P A;  5GAM g;  1NJI U;  4LN2 A;  1KFZ A;  4Y91 A;  2YSQ A;  2E5K A;  1QP3 A;  2A7Y A;  4OB2 B;  4KT0 E;  3SWN A;  2K3B A;  4OMF B;  1IHW A;  2P4R A;  4KGZ B;  1NYG A;  2CUB A;  4BUG A;  1QVP A;  1SRL A;  3GF5 A;  4BY6 B;  1QKW A;  2LJ0 A;  5GMK e;  1KJW A;  4PJO E;  1HSQ A;  3M57 A;  4PFO A;  2XI9 A;  4Z88 A;  2M02 A;  4MZP A;  1VQ7 Q;  1PD0 A;  5CKB A;  3LYI A;  2OJ2 A;  3CME Q;  3OYL A;  4AFU C;  3PVQ A;  3M59 A;  3CCR Q;  4B9X A;  2HNI A;  3JCM f;  3CC7 A;  3X24 B;  3CCL Q;  1PWT A;  4WTO B;  1Q7Y C;  4HCK A;  1VQ6 Q;  2HL3 A;  2E10 A;  4RKU E;  5GAM e;  3CCM Q;  3JRZ A;  1M90 C;  2J6O A;  1YJN A;  4PNO A;  2GGR A;  4OVA A;  2PUK B;  3A1P A;  3M58 A;  3RR6 A;  4IUT A;  3MP8 A;  4ZTF A;  3RKX A;  4PFZ A;  3M9Q A;  3OS2 A;  1Y71 A;  2AZS A;  1AWW A;  3VRY A;  4EMK B;  2O9V A;  1X2Q A;  4OGC A;  2DZC A;  2LNH B;  2V1Q A;  3L2R A;  2LP5 A;  1WHK A;  2YWW A;  2XD0 A;  2FHD A;  2LC4 A;  4C8Q E;  3QXE B;  3DB3 A;  3QSU A;  2GBQ A;  2KMT A;  2HD0 A;  1ZSZ B;  3E19 A;  3H9N A;  1ACM B;  3CC4 Q;  2KDS A;  4M77 B;  1Q95 G;  3NTK A;  1YJN T;  4HCC A;  2JJ9 A;  9ATC B;  4LUE A;  2JUF A;  3OS0 A;  2M16 A;  2VXE A;  2FZC B;  2FB7 A;  4X9D A;  1IGU A;  1K9A A;  3SEM A;  3BE3 A;  2YUQ A;  2ZGW A;  1A0N B;  3WVD B;  4J9G A;  2H3E B;  2EYW A;  5FRN A;  1D3B A;  1YP5 A;  4C5E A;  3LH5 A;  1RAD B;  2J6K A;  1JO8 A;  3INZ A;  1K0X A;  2QTV A;  4M77 F;  4IUU A;  1X2K A;  1C6V X;  2HSP A;  1FYN A;  2K5I A;  3NPF A;  4C92 C;  3UA7 A;  3MEW A;  4C8Q G;  2LCC A;  2ESW A;  4UC4 A;  2RJC A;  2VC8 A;  3PE0 A;  2DTI A;  1U1T A;  4E7K A;  2HQH A;  2CP6 A;  1BU1 A;  1ZA1 B;  5IH2 A;  1RAB B;  2R58 A;  5CCA A;  3JB9 H;  4J7F A;  2DVE A;  4QVZ A;  5GAO q;  3SHW A;  1WX6 A;  2AKK A;  2GCX A;  2XK0 A;  2HEQ A;  8ATC B;  1NEG A;  1K9M C;  2X4X A;  3HHT B;  2MWP A;  2E1H A;  3L2Z A;  2DIG A;  4RG2 A;  3BW1 A;  1IZ6 A;  1WQ7 A;  1PRM C;  1AD5 A;  3DB4 A;  4F7U A;  1I07 A;  2FPD A;  2RA2 A;  1D0X A;  4EMH A;  2GTJ A;  1ZLM A;  5FU7 C;  1M8V A;  2QYZ A;  1BI1 A;  5HY6 A;  3VS5 A;  2VYT A;  1Q81 U;  3OMG A;  2MIO A;  3EG0 A;  2NLU A;  1CKB A;  1JXO A;  1M90 R;  2DL3 A;  4C0G A;  1VQ4 T;  2CDT A;  2YRC A;  5HK3 A;  3SFM A;  2YLC A;  1KQ1 A;  2DNU A;  3EAE A;  4FYY B;  1FMK A;  1E6H A;  1ZUU A;  4J9H A;  1UB4 A;  2D0N A;  4XTZ A;  4M75 A;  2DEQ A;  3G6E Q;  2RHU A;  5KE2 A;  3PMT A;  1VQ9 A;  1N9R A;  4JRI A;  2RJE A;  2RJF A;  4NS5 A;  2Y90 A;  2CZ6 B;  4M7D A;  5D7U A;  5GAN h;  2FEI A;  1H92 A;  1W4S A;  2ENM A;  3NHN A;  2LQK A;  2BIV A;  3THK A;  3VRZ A;  2RJD A;  3CCS A;  5C0M A;  1EX4 A;  1IB8 A;  4RCC A;  4XU1 A;  3OYF A;  4B6M A;  4PLL A;  1QVG A;  4ANJ A;  2VB6 A;  2F1L A;  1I5L A;  3MHX A;  4FSS A;  1RAC B;  3QYG B;  5CKD A;  2WSC E;  2EKO A;  2O01 E;  2GQI A;  2QDL A;  1RLP C;  4PJO A;  1PRL C;  3VJP A;  2DAQ A;  2E12 A;  2KXD A;  3VS1 A;  1S72 Q;  4BDY A;  2NUZ A;  3CCS T;  1OX8 A;  2R5M A;  5HKC A;  2ROT A;  5CVI A;  4N0A A;  4LDY A;  1VIE A;  1RAF B;  3REA B;  2RQR A;  1U3O A;  1QCF A;  1UGV A;  1HJD A;  5LJ3 h;  3E9F A;  5FU7 B;  2AZV A;  2CZ0 B;  2VV5 A;  1YIT Q;  2DO3 A;  3CBO A;  2JTF A;  2JS0 A;  3L2Q A;  1GFC A;  2PTK A;  2LCS A;  4KBM B;  4OMO A;  1G3T A;  2HL5 C;  2QEX Q;  2LQN A;  1KQS A;  4DEX A;  3EGX A;  3VYG A;  5L8R E;  3M54 A;  3FDR A;  5KE3 A;  2HMA A;  3I5R A;  1VYT A;  4R55 A;  2RI2 A;  5LJ5 f;  3R6O A;  2QQA A;  2K4Y A;  1UDL A;  4DBF A;  1GBQ A;  1CSK A;  5IN1 A;  1UEC A;  4M78 C;  3MPU B;  3FJ5 A;  3JCM h;  1D1C A;  1LOJ A;  1Q7Y U;  1M90 U;  5KYX B;  5FWC A;  4D8D A;  4XTY A;  3MEV A;  1OPL A;  1W6X A;  4HT9 A;  4RTU A;  2LX7 A;  4FU6 A;  2DXB A;  1YJW Q;  1BCO A;  1OOT A;  2EQM A;  3FJP A;  4TVR A;  4CC2 A;  3NTI A;  4XTU A;  1VYU A;  1XNI A;  1TUG B;  2CT3 A;  1LCK A;  2IG0 A;  2E5Q A;  2XDB A;  2L89 A;  1VQ7 A;  4AFQ C;  2FL7 A;  1TUC A;  1NE8 A;  3CME A;  4C8Q D;  3ZBD A;  1JQQ A;  3CCR A;  4ESR A;  1OI1 A;  1YWO A;  1PNJ A;  3CCL A;  2PZ1 A;  2K6D A;  1UGR B;  4ZN1 A;  1NLO C;  1VQ6 A;  2PU9 B;  3CCM A;  2O9S A;  2GFA A;  1NYF A;  1X6G A;  5GAN j;  2L3R A;  4M77 G;  2B86 A;  3EFR A;  4XAX B;  5DLQ E;  1KC8 C;  2OTL Q;  1SHF A;  3H6Z A;  4KUI A;  2RK2 A;  2EW3 A;  2D8J A;  2VGM A;  3G1J A;  1D0Y A;  5KCH A;  3CME T;  2RQW A;  1N8R C;  4BAC A;  3CCR T;  2KVQ G;  4E7H A;  3JB9 J;  3CCL T;  4BB7 A;  2HSE B;  3JCM P;  3CC4 A;  3CPW S;  3CCM T;  1EIF A;  2RNA A;  3JCM X;  4OMN A;  4EDU A;  3BDU A;  2DL4 A;  3UA6 A;  2DLP A;  1Y96 A;  3ULR B;  1AVZ C;  3JAM E;  4LD9 K;  2FRW A;  3I55 Q;  4FCY A;  3GOX A;  3AHU A;  4M78 B;  1K9M U;  4QKU A;  3P8D A;  1G3S A;  1X6O A;  4M7A A;  3REB B;  4XK8 E;  3N5B B;  2LT4 A;  3L2W A;  3CCQ T;  4JZ4 A;  2RHZ A;  5LJ3 j;  3EFO A;  3CC4 T;  2C0T A;  3QWX X;  5GAN 3;  3OYK A;  4RG8 A;  4XQ3 A;  2HBP A;  2A36 A;  3SDZ A;  4M78 F;  5D6X A;  2JTE A;  2QI2 A;  3E9G A;  1VQP A;  4A4E A;  1I4K 1;  4BI4 A;  2ZPB B;  4C5I A;  2JT4 A;  2KT8 A;  2ECZ A;  1OYX A;  4PJN A;  1EFN A;  4LDX A;  5GAM j;  2NUP B;  3RUX A;  3J81 E;  3J80 E;  5IXB A;  4JJB A;  4BE1 A;  2COZ A;  1Y0M A;  2V8K A;  1RI9 A;  1FXX A;  1C0M A;  2QQS A;  4E6R A;  3KUF A;  2ED0 A;  2I0N A;  4P5N A;  1LVK A;  1SG5 A;  5GMK l;  3MCA B;  3HKS A;  3EFS A;  2F5T X;  2XKO C;  3OW2 A;  4ZGJ B;  2MMP A;  2KRS A;  3CPW P;  1MMD A;  3S6W A;  1QCO A;  1WJQ A;  1KIK A;  3G71 A;  3HL8 A;  1X01 A;  4R56 A;  4ME7 A;  2YUO A;  4WF2 A;  4LE9 A;  8AT1 B;  2E3H A;  4JJC A;  1OU8 A;  2V8I A;  1KC8 R;  2DPP B;  4FM4 B;  2FRY A;  3PTA A;  2D0Q B;  1RLQ C;  2XHC A;  2BKD N;  2L3S A;  1RAA B;  3BDL A;  2LT1 A;  3UF4 A;  1N8R R;  1AEY A;  2YUP A;  3LGL A;  2O2O A;  5GAN e;  3KBG A;  2DE0 X;  3EGD B;  4M4Z A;  3G6E A;  1YHQ Q;  1UEB A;  2XIC A;  5LJ3 g;  1I1J A;  3M56 A;  3JB9 I;  3UDC A;  2CP0 A;  2CRE A;  3I5S A;  1NG2 A;  2E4H A;  1R0C B;  2RI5 A;  4ZNX A;  1YI2 T;  1D1A A;  3OQ5 A;  4PJL A;  2O88 A;  5LJ5 d;  3OSV A;  3CCE T;  4F16 A;  5J3B A;  3G7Z A;  2CYZ B;  2CT4 A;  2YRV A;  1O9S A;  2DXU A;  2E64 A;  4E7J A;  3V8J A;  1M3A A;  3A8L B;  2L3P A;  1FWZ A;  2LQW A;  2V8J A;  5FLX E;  5AYF A;  3V7S A;  3T9N A;  2CH4 W;  2A3L A;  1SRM A;  4AG1 C;  1QQJ A;  2C0O A;  4IIO A;  2FZG B;  4JLG A;  2LQ8 A;  1YCY A;  3SWN C;  3FRN A;  1WHL A;  5KCO A;  1UGS B;  4RTT A;  1ABQ A;  4R0K A;  4KGX B;  1UTI A;  2RHI A;  1S72 A;  3P8B B;  1VQ8 A;  2X4W A;  3JCM g;  3EH2 A;  3I9Q A;  4FT2 A;  1Z9Z A;  5LJ3 e;  1SSH A;  1ZHI A;  2EBP A;  2JMC A;  1Q81 R;  4ATO A;  2BE9 B;  2PNI A;  2CSQ A;  4LDW A;  2MK5 A;  1TOV A;  3ZFJ A;  2C0I A;  1LPL A;  3E1S A;  2P0K A;  1M2O A;  2B8A A;  3RKY A;  2A08 A;  2OTJ Q;  1YIT A;  2KR3 A;  3OS5 A;  5J39 A;  5KYU A;  3E2U A;  4KRT A;  1M1F A;  1S72 T;  1T0H A;  3QKJ A;  2QEX A;  3S3O A;  4OF1 A;  4CC4 B;  2NWM A;  1G3Y A;  4J8O A;  4C0D B;  1JEG A;  1WYX A;  2ATC B;  2QAZ A;  2JVV A;  4M77 D;  1M1K C;  3GIB A;  1G83 A;  4E7L A;  2DRM A;  3JCM e;  5CR2 A;  3CC7 T;  1RI0 A;  2NUT B;  2EPD A;  1NEB A;  4JS4 A;  1X75 C;  4QVD A;  4MML A;  4LDU A;  5FW9 A;  2CP7 A;  2QEX T;  1G8X A;  1ZA2 B;  2J05 A;  1WI7 A;  2MOX A;  1TWB A;  2HKN A;  5A2Q E;  5CIU A;  2QAS A;  3EG9 B;  1KC8 U;  2M9U A;  2VUB A;  2DER A;  1VUB A;  2O4X A;  1YJW A;  4VUB A;  4Y92 A;  3CCU Q;  3G4S Q;  1QW1 A;  3VUB A;  2RPN A;  3EH1 A;  4Z02 A;  3ZEH A;  1N8R U;  2AIR B;  4HVV A;  1WXT A;  4QW2 A;  1WIE A;  1HD3 A;  3C95 A;  1PCX A;  3SWN B;  1BYM A;  2M1H A;  1RL2 A;  2M51 A;  3M0U A;  1YIJ Q;  4CRI A; 
#chains in the Genus database with same CATH homology
 3CCS T;  2OAU A;  4JDS A;  1VQN T;  1LNX A;  1W2B A;  3A8G B;  2R5M A;  5HKC A;  1FX7 A;  4QVC A;  5GAN 2;  4PKC C;  4GY5 A;  2ZPF B;  4M77 A;  5CVI A;  4N0A A;  4FT4 A;  2G3R A;  3CCQ A;  1YJW T;  4LDY A;  5HK0 A;  3WXM B;  4C8Q F;  1VQL T;  3QO3 A;  4ELZ C;  2RD1 A;  1VIE A;  3HFO A;  1VQO T;  3G6E T;  3GP8 A;  4N4H A;  4M7A F;  5LJ3 h;  2R5A A;  3E9F A;  5FU7 B;  1LJO A;  2DXC A;  1JB0 E;  2CZ0 B;  2VV5 A;  5KH6 A;  3TRE A;  2DO3 A;  3CBO A;  3F70 A;  2LVM A;  2JTF A;  3MEA A;  4RCB A;  3L2Q A;  4ELY C;  2LX9 A;  2OTL A;  4DA4 A;  3CBM A;  4E47 A;  1MGQ A;  3M53 A;  4KBM B;  3P8H A;  5IAY A;  4BE2 A;  5LJ3 f;  4M7D E;  4KUL A;  1G3T A;  1WGS A;  5LL6 S;  2LRQ A;  1KQS A;  3HP9 A;  3A8O B;  4J6W A;  5LJ5 h;  2MI6 A;  3CXC S;  1KG1 A;  3VYG A;  4BDY A;  4BD3 A;  1PSE A;  3QUI A;  3M54 A;  3OBY A;  5L8R E;  3FDR A;  4IUV A;  4M78 G;  5KE3 A;  1H64 1;  3HRS A;  2EAY A;  4B9W A;  1DJ7 B;  3JB9 D;  4R55 A;  3CBP A;  2RI2 A;  1R8O B;  5GMK j;  2MAM A;  3BY7 A;  4DOV A;  3CMA A;  5LJ5 f;  2DD5 A;  3ME9 A;  2XU8 A;  5C6S A;  3A8M B;  2RI3 A;  3R6O A;  3FLG A;  1IRE B;  1WJR A;  1M1G A;  2WSF E;  4X34 A;  1QVF S;  2QQA A;  2K4Y A;  4L59 A;  2PUO B;  3URG A;  2QQR A;  2DKG A;  3JCM V;  1QVG S;  5GAM f;  5IN1 A;  2JZ2 A;  2R57 A;  3M55 A;  4M78 C;  4ZGE B;  4A4H A;  3I55 A;  3S3N A;  3I56 A;  3JCM h;  1VQ8 T;  1LOJ A;  2QXF A;  4Y28 E;  1Q7Y U;  4M75 G;  3MP6 A;  3CPW A;  4OP0 A;  4MZM A;  3TEE A;  1M90 U;  1I8F A;  4CI0 C;  1Q81 C;  2P0Q A;  1HXD A;  3DLM A;  2DZ9 A;  3QPH A;  3OYC A;  3ASK A;  4XTY A;  3OYG A;  2VGN A;  3MEV A;  1JRI A;  4M7D G;  1BI0 A;  2X4J A;  4HT9 A;  3RMS A;  1Q86 U;  4FU6 A;  3CC2 T;  2DXB A;  5A0L A;  5J26 A;  2PQW A;  2ZZD A;  3CMA T;  4L6V 5;  4QQD A;  3PT9 A;  2EQM A;  3FJP A;  4TVR A;  4BY6 C;  4M75 C;  4OB0 B;  3GLX A;  4PL6 A;  4C92 D;  2LCL A;  3NTI A;  4XTU A;  5I2S A;  3OYN A;  1YIT T;  1W2B S;  2CZ7 B;  4NL3 A;  5GAN g;  2K3X A;  1XNI A;  2PVG B;  2RK1 A;  2Y4Y A;  4X9C A;  4C5G A;  2JNG A;  3CXC A;  2JTM A;  1BIA A;  1D3B B;  2RHX A;  3PGG A;  5CK9 A;  3Q1J A;  4M7D C;  3QJY A;  2IG0 A;  2E5Q A;  3I55 T;  3I56 T;  1YBY A;  2GF7 A;  2XDB A;  5A0G A;  2L89 A;  1VQ7 A;  4MDW A;  2E70 A;  2FL7 A;  4J83 A;  4QQ6 A;  4C92 B;  2CKK A;  1MHN A;  1OZ3 A;  1XTD A;  1NE8 A;  1NZ9 A;  2CGH A;  3CME A;  4C8Q D;  4A4K A;  3LLR A;  1ZQ1 A;  1WJS A;  2DK3 A;  3MET A;  3ZBD A;  1OZ2 A;  4BI3 A;  1P92 A;  4PJO G;  1QVF A;  3CCR A;  5DM7 R;  5CKH A;  2HQX A;  2XDD A;  5GAN 7;  4M7A D;  1OI1 A;  2QDY B;  2X4Y A;  4A4G A;  3CCL A;  1KHI A;  4F7U E;  1Y96 B;  3J7A F;  4NOY A;  1UGR B;  4ZN1 A;  3C12 A;  3JCM W;  1VQ5 A;  1VQ6 A;  1AHJ B;  2PU9 B;  3CCM A;  3LW5 E;  1KQS S;  2GFA A;  1VQ9 T;  1K73 C;  1VQK A;  2RHY A;  1B34 B;  4C0D C;  4FIB A;  1YI2 A;  3SB2 A;  2IVW A;  4Q5W A;  5GAO p;  4EMK C;  2EQK A;  4ZGD B;  2DD4 A;  3CCE A;  5GAN j;  2L3R A;  3RKW A;  4PJO C;  4M77 G;  4C92 F;  3EFR A;  4J6X A;  4XAX B;  5DLQ E;  3PIP A;  1KC8 C;  3VU3 C;  3OYH A;  3H6Z A;  4KUI A;  2KAF A;  4MZT A;  1UGP B;  2E65 A;  2RK2 A;  4M78 E;  4ZTJ A;  3HSB A;  3CCV A;  2EJG A;  2VGM A;  1K8A C;  3LX7 A;  3M5A A;  5KCH A;  3CME T;  5CQX A;  2KY9 A;  4LD6 A;  1N8R C;  2EQU A;  4BAC A;  3WVE B;  3CCR T;  1KD1 U;  2KVQ G;  2MWO A;  4E7H A;  4GLK A;  5EG2 A;  3JB9 J;  3VUZ A;  1KQ2 A;  3CCL T;  4M77 C;  3JCM J;  4N0A C;  1I81 A;  4A54 A;  4BB7 A;  3OYM A;  3CD6 T;  4YTL A;  2EYQ A;  2EWN A;  3JCM P;  3V7R A;  4C92 A;  3CC4 A;  3QHS A;  3TU4 K;  1VQ5 T;  3QZ5 B;  3CPW S;  2E6N A;  2K2V A;  3CCM T;  4JRP A;  1EIF A;  2AHJ B;  3OMC A;  3JCM X;  4XTW A;  2K5F A;  1VQK T;  3GNF B;  4JLI A;  5GAN 5;  1KHC A;  4F7U G;  2DTH A;  4M75 E;  4EDU A;  3BDU A;  1KD1 C;  1Y96 A;  4LD9 K;  3JAM E;  3RER A;  2LNV A;  5LJ5 g;  2QTX A;  2XG8 D;  3NFC A;  5GAM d;  3CCJ A;  2K3Y A;  3GOX A;  2WSE E;  3AHU A;  3CCV T;  1UGQ B;  4E7I A;  2ZPH B;  4C8Q A;  4M78 B;  3PNW C;  1K9M U;  2BUD A;  3QYH B;  4N4I A;  3P8D A;  5FU6 C;  1YHQ A;  5GAM g;  1GXI E;  1G3S A;  1X6O A;  3PFS A;  3V8K A;  1NJI U;  4M7A A;  4Y91 A;  2K5L A;  4IKF A;  4XK8 E;  3N5B B;  2LT4 A;  1QP3 A;  2A7Y A;  4OB2 B;  3L2W A;  3CCQ T;  4KT0 E;  3CPF A;  2RHZ A;  4II1 A;  3SWN A;  2HAX A;  4OMF B;  1BIB A;  5LJ3 j;  4HKE A;  3CC4 T;  1WQW A;  3OW2 S;  2RB6 A;  4BUG A;  3JCM b;  2ZPG B;  4XU0 A;  5GAN 3;  1QVP A;  1VQ4 A;  4C0F A;  3OYK A;  4N4G A;  4RG8 A;  3DKM A;  3BFM A;  3GF5 A;  4XQ3 A;  2HBP A;  4EPC A;  4BY6 B;  3SDZ A;  4M75 B;  1WNL A;  4M78 F;  2OTL T;  2WAC A;  3PIO A;  3CD6 A;  3X20 B;  1BKB A;  5GMK e;  5D6X A;  3E9G A;  2QI2 A;  3CCJ T;  1VQP A;  4PJO E;  3M57 A;  1O75 A;  4XU2 A;  4A4E A;  1I4K 1;  5LJ5 j;  2XI9 A;  4BI4 A;  1NPP A;  1H3Z A;  2FYK A;  4MZP A;  4M7D B;  2ZPB B;  5CAI A;  5CKB A;  3LYI A;  3O8V A;  4C5I A;  1OYX A;  4LDX A;  5IT9 E;  2DXT A;  5GAM j;  1Q82 U;  3OYL A;  2LTO A;  4O6J A;  3M59 A;  3UT1 A;  4B9X A;  3CEY A;  4HT8 A;  2HNI A;  3RUX A;  3JCM f;  3J81 E;  3L42 A;  3X24 B;  3J80 E;  3CC7 A;  3JCM Q;  2XID A;  5GAN d;  4M77 E;  4BE1 A;  4M75 F;  1Q7Y C;  3OY9 A;  1NPR A;  1M1K U;  5GAN 6;  2E10 A;  4RKU E;  5GAM e;  3JRZ A;  3RMQ A;  1M90 C;  2V8K A;  2O4X B;  1YJN A;  1FXX A;  2QQS A;  4OVA A;  4PNO A;  4HCB A;  4V2S A;  2PUK B;  3KUF A;  3M58 A;  2CS7 A;  4P5N A;  4IUT A;  3MP8 A;  4ZTF A;  3RKX A;  4M7D F;  3JB9 G;  1XQH A;  3M9Q A;  3OS2 A;  1Y71 A;  5GMK l;  3QJ6 A;  3L1A A;  5M9O A;  5GAO m;  1VQM A;  5FRM A;  3MCA B;  3HKS A;  4J5Y A;  4FSX A;  4EMK B;  4BE0 A;  1Q86 C;  3S3M A;  1Y7X A;  2F5T X;  2XKO C;  3EFS A;  2XDP A;  4A53 A;  4ZGJ B;  3OW2 A;  4PJO B;  2MMP A;  4OGC A;  2DZC A;  5A0D A;  4IUR A;  3L2R A;  3S6W A;  2H3J A;  1WJQ A;  2XD0 A;  2OTJ A;  3HRU A;  2FHD A;  2LC4 A;  4C8Q E;  3G71 A;  3GNG A;  3HL8 A;  2M0O A;  3DB3 A;  1X01 A;  3QXE B;  5DLO A;  2KMT A;  3LWH A;  3QSU A;  4R56 A;  2HD0 A;  2RO0 A;  1WPY A;  2LDM A;  1G5V A;  2KK4 A;  4ME7 A;  4M7A E;  1N27 A;  4JUV A;  3OSS C;  3OA6 A;  4WF2 A;  3E19 A;  5GMK m;  2F69 A;  3M4Y A;  2QQ9 A;  2KDS A;  4XU3 A;  2Y4X A;  4M77 B;  3QBY A;  5CKE A;  5GAO n;  2V8I A;  3NTK A;  1YJN T;  4HCC A;  1M9S A;  2DPP B;  2JUF A;  3PMI A;  4FM4 B;  4PJO F;  2M16 A;  3VYH B;  4LDV A;  3OS0 A;  2VXE A;  3C4S A;  3PTA A;  2FB7 A;  2D0Q B;  1VQM T;  4X9D A;  2XHC A;  3OS1 A;  2BKD N;  3V7C A;  2ZGW A;  1QP2 A;  2LT1 A;  3BDL A;  3FIF A;  1VQ7 T;  2JOY A;  3WVD B;  2ZPI B;  5FRN A;  4ZN3 A;  2D9T A;  3LGL A;  5CQY A;  5LJ3 d;  5GAN e;  1D3B A;  3KBG A;  4C5E A;  3G6E A;  2OTJ T;  1UEB A;  4J6Y A;  3INZ A;  3DLL A;  3OYB A;  2XIC A;  3HFN A;  4IUU A;  4M77 F;  5LJ3 g;  5FU6 B;  3A5Z B;  3V8L A;  3OYY A;  2CZ1 B;  3M56 A;  3UDC A;  3JB9 I;  2EJF A;  2K5I A;  3OBW A;  1N9S A;  4F7U B;  2VXF A;  1VQ6 T;  4C92 C;  3MEW A;  3QG1 A;  4PLI A;  4C8Q G;  2LCC A;  1Y07 A;  4M78 D;  4DQ2 A;  2EIF A;  2RI5 A;  1U1S A;  2MF2 A;  1YI2 T;  3OQ5 A;  4M7A G;  4UC4 A;  2RJC A;  2VC8 A;  5D6Y A;  5LJ5 d;  5GAN 4;  3OSV A;  3MP1 A;  3CCE T;  2DTI A;  1U1T A;  5J3B A;  4E7K A;  3G7Z A;  2DTO A;  5CKF A;  2CYZ B;  1N6A A;  2YRV A;  1O9S A;  3M4G A;  2GFU A;  4JRK A;  2DXU A;  2E64 A;  1BI3 A;  4E7J A;  5I2M A;  3V8J A;  2L8D A;  2QQB A;  3A8L B;  3RIR A;  1FWZ A;  1B34 A;  2V8J A;  5FLX E;  2R58 A;  2ZCF B;  5AYF A;  3TCJ A;  3X26 B;  4C8Q C;  5CCA A;  2FVU A;  3QII A;  3V7S A;  3T9N A;  3JB9 H;  5GMK i;  3HPW A;  4J7F A;  2DVE A;  4QVZ A;  5FRO A;  5GAO q;  1JJ2 S;  4F7U F;  2A3L A;  4M7A C;  2E41 A;  4HCZ A;  4OB3 B;  3L2V A;  3SD4 A;  2GCX A;  2XK0 A;  3OB9 A;  3L2U A;  4M75 D;  4JLG A;  2LQ8 A;  5GMK h;  1YCY A;  3SWN C;  4EMG A;  4MDX A;  3FRN A;  5KCO A;  3FC3 A;  1UGS B;  3JCM d;  3QDR B;  4BDZ A;  4A4F A;  2D6F A;  4M7D D;  1YIJ A;  1K9M C;  1HK9 A;  2RHI A;  2X4X A;  2MWP A;  3HHT B;  2E1H A;  3P8B B;  2X4W A;  2DIG A;  3H8Z A;  3L2Z A;  1NJI C;  3JCM g;  1VQ8 A;  4RG2 A;  3BW1 A;  3JCM c;  3OYA A;  1IZ6 A;  1WQ7 A;  1G3W A;  1M4Z A;  4FT2 A;  5LJ3 e;  1ZHI A;  4MMK A;  3DB4 A;  3FEO A;  5D6W A;  4F7U A;  4IUQ A;  2KSS A;  2RA2 A;  3RES A;  2PVO B;  4ATO A;  1M5Q 1;  2RM4 A;  4EMH A;  4LDW A;  4KUD K;  3CCU T;  3G4S T;  5FU7 C;  5GAM h;  3ZFJ A;  1M8V A;  1XOV A;  2L5Q A;  3E1S A;  1YHQ T;  2P0K A;  3CC2 A;  3MEU A;  2B8A A;  1BI1 A;  3MO8 A;  5HY6 A;  3RKY A;  2VYT A;  5CO7 A;  1Q81 U;  4NL2 A;  1ZBX A;  2DJZ A;  3ER0 A;  3OMG A;  5GAO l;  1YIT A;  1BI2 A;  3CCU A;  3NTH A;  3OS5 A;  2NLU A;  3LWI A;  5LJ5 e;  3QZ9 B;  5J39 A;  4M78 A;  4O5V A;  3X28 B;  4PJO D;  3LH0 A;  4IUP A;  1M1F A;  4C0G A;  1VQ4 T;  1YIJ T;  2ZPE B;  1S72 T;  4C92 E;  2QA4 A;  1JJ2 A;  5HK3 A;  3SFM A;  3QKJ A;  2QEX A;  3S3O A;  4OF1 A;  2YLC A;  3VV0 A;  1KQ1 A;  2P0P A;  5GAN 8;  3EAE A;  2I2L A;  1Q82 C;  1G3Y A;  2RH2 A;  4J8O A;  2C06 A;  5DY9 A;  4C0D B;  1VQP T;  3HRT A;  4C0Z A;  2JVV A;  3A8H B;  4M77 D;  1M1K C;  1UB4 A;  4RMO A;  3GIB A;  4E7L A;  4OB1 B;  4XTZ A;  3X25 B;  3JCM e;  4M75 A;  2DEQ A;  4JS5 A;  2RHU A;  5KE2 A;  4QQG A;  5CR2 A;  3PMT A;  1VQ9 A;  1N9R A;  3JB9 F;  3LGF A;  4JRI A;  3CC7 T;  2RJE A;  1S72 A;  1RI0 A;  2YHT A;  2RJF A;  4HA8 A;  2Y90 A;  4NS5 A;  3UPU A;  2P4T A;  1V29 B;  2CZ6 B;  5GAO r;  2HQE A;  4M7D A;  1U8R A;  3KXT A;  1YJ9 A;  4JS4 A;  5GAN h;  1X75 C;  4QVD A;  1W4S A;  3UWN A;  3OYI A;  3JSC A;  2QA4 T;  4MML A;  4LDU A;  4DOW A;  2QEX T;  2LQK A;  4JJN K;  1K73 U;  2BIV A;  2RJD A;  3FB9 A;  5C0M A;  3CCS A;  1VQN A;  1SSF A;  4JRQ A;  1VIF A;  3C94 A;  4RCC A;  4J7I A;  4XU1 A;  5I21 A;  3OYF A;  5A2Q E;  5CIU A;  3G4S A;  4FL6 A;  4C92 G;  4PLL A;  1KC8 U;  1QVG A;  2M9U A;  5GAN f;  2VUB A;  1JBM A;  1VUB A;  2O4X A;  2YLB A;  4BI8 B;  1YJW A;  1VQL A;  4VUB A;  3OYD A;  1I5L A;  3GPL A;  2E6Z A;  1QW1 A;  4D6W A;  3MHX A;  1VQO A;  1K8A U;  2X35 A;  3OYJ A;  3G71 T;  3VUB A;  2EQJ A;  3QYG B;  4Z02 A;  5CKD A;  3ZEH A;  4C8Q B;  2WSC E;  1TH7 A;  1N8R U;  2EKO A;  4EMK A;  2O01 E;  3OYE A;  4PJO A;  2F5K A;  2EJ9 A;  4L5G A;  4QW2 A;  4M7A B;  4XTV A;  3VJP A;  2GQV A;  4OGE A;  3VKI A;  1PSF A;  2EFI A;  1YJ9 T;  2K57 A;  3C95 A;  2DAQ A;  2E12 A;  3SWN B;  2JN0 A;  2M1H A;  2PVD B;  1RL2 A;  4C5H A;  1BYM A;  4XTX A;  4CRI A;  2KQW A;  2DIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...