3ME9A

Crystal structure of sgf29 in complex with h3k4me3 peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
174
structure length
174
Chain Sequence
b'GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAGA-associated factor 29 homolog
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 36
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3me9A02
2R5MA 3C4SA 2RJDA 2QQRA 2BKDN 3E9GA 4A4EA 4GY5A 3FC3A 2QQSA 2O4XB 4IURA 2DIQA 1WJRA 3QBYA 3KUFA 1WGSA 2D9TA 5FRNA 3UWNA 2M0OA 3FLGA 2WACA 3LX7A 2RHZA 4HCZA 3NTKA 2LRQA 5IAYA 2EQUA 2IG0A 3OYMA 2HQXA 2VYTA 2LTOA 3LH0A 2DIGA 2HQEA 3ASKA 4II1A 2O4XA 5D6WA 2E6NA 2RJEA 2MWOA 4PL6A 2RO0A 4IUUA 1OZ2A 1H3ZA 2R58A 2BIVA 3PMTA 5FROA 2EQKA 4QQGA 3OYFA 4C5HA 4NS5A 1OZ3A 3SD4A 4ZTJA 3OMGA 3NTIA 4L59A 4LD6A 3QIIA 2EQJA 3OYNA 2G3RA 3LGLA 3OS1A 1N27A 3LYIA 3M9QA 2GF7A 4N4HA 4RG2A 3OY9A 5C6SA 1G5VA 3DLMA 2XDPA 2X4YA 3OYJA 4IUQA 2L89A 3MEUA 3MP1A 3H6ZA 3O8VA 3CEYA 3OA6A 2LDMA 2EFIA 2RI5A 4N4IA 3MEAA 4BD3A 3P8HA 3S6WA 2L8DA 4C5GA 3S3OA 2GFAA 2RHIA 2MWPA 2X35A 3OMCA 3OS0A 4E7JA 3L42A 4CRIA 2RI2A 4FL6A 4Z02A 4PLIA 5J39A 2P0KA 3MEVA 4UC4A 4B9WA 2YRVA 2RHUA 3OYHA 3MEWA 2LCCA 4E7IA 1WJQA 3OYIA 4IUPA 4QW2A 3GOXA 4E7KA 1XNIA 3L2RA 3EAEA 4BE0A 5FRMA 4BACA 1MHNA 2K3XA 3OYKA 5C0MA 3L2WA 2L3RA 3LLRA 2X4XA 3OYCA 3OB9A 2CKKA 3FDRA 4QQDA 4IUVA 5D6XA 3MP6A 4EDUA 4A4GA 3BDLA 4ZTFA 2EKOA 2NLUA 2RHYA 3MO8A 3OYLA 1WJSA 3QJ6A 2M16A 2X4WA 3S3NA 3DB4A 5KE2A 2JZ2A 3H8ZA 4B9XA 5IN1A 3META 3UT1A 3S3MA 2PQWA 2BUDA 1OI1A 2EQMA 2E5QA 2RJFA 2RJCA 5KCHA 5KE3A 3PFSA 3Q1JA 3PMIA 3L2VA 4BE1A 3MP8A 1OYXA 2R57A 4BDZA 3DB3A 4X34A 4C5EA 3OS2A 3OYBA 3OYDA 2RI3A 3L2QA 2XK0A 4QVZA 2M1HA 3F70A 5CIUA 4IKFA 2R5AA 3OYAA 2F5KA 4A4HA 4A4FA 1SSFA 4Q5WA 4FU6A 4C5IA 3FEOA 3OQ5A 1RI0A 4PLLA 5KCOA 5M9OA 3OYEA 2LVMA 3LGFA 3ME9A 5J26A 5KH6A 2RHXA 3PNWC 4E7LA 3E9FA 4IUTA 5D6YA 2GFUA 4BDYA 2K3YA 3NTHA 2DAQA 2FHDA 3L2UA 4BE2A 2JTFA 1KHCA 3ZEHA 4E7HA 3QKJA 4OVAA 4QQ6A 3P8DA 3OYGA 2B8AA 4N4GA
chains in the Genus database with same CATH superfamily
1KD1U 1S72T 3SWNB 4FCYA 1VQLA 1VIEA 2E41A 3CCSA 2GQVA 4N0AC 1YJ9Q 3FLGA 3M0SA 1X6GA 2XU8A 1N8RU 2EBPA 5ECAA 1YIJT 8ATCB 3NHNA 3CCRA 1PD0A 3CCEA 1JQQA 3NMZC 3CMAQ 3EG3A 3TQ7P 1M2VA 5GMKl 4JRPA 3VYGA 1F1BB 1VQPA 4M7AB 1RAEB 1E7OA 5LL6S 2GNCA 4LUDA 1N27A 1K0SA 2NWMA 4F16A 2DTIA 1NZ9A 1G3SA 1UTIA 1V1CA 3RUXA 5FU6B 4C8QF 1NEGA 1OEBA 2KVQG 2PVOB 3CPFA 1Q86U 2HD0A 1ZSGA 2O88A 2XDDA 4RG8A 1DJ7B 2P4TA 3LH5A 3CC4Q 2JMAA 4J9EA 1VOMA 3VKIA 2VC8A 2L3RA 3HFOA 2JM9A 3I35A 1PD1A 2JT4A 3EGDB 3A8OB 3M0QA 4AMCA 1TG0A 3A8HB 2E5QA 1K4US 2XMFA 1MV0B 2W10A 3CD6A 3M55A 3X24B 5GJWB 6AT1B 4A4FA 4Q5WA 1D0ZA 4FSXA 2E5KA 4NL2A 3LGFA 3X26B 3H9NA 3E9FA 4IUTA 5D6YA 2E3IA 2K3YA 4J83A 2V8KA 3QKJA 4OVAA 5DLQE 4EIKA 2JXBA 4AFQC 1WLPB 2KRSA 4KUDK 2DX1A 4A4EA 5FU7B 2O4XB 1IHVA 2GBQA 2YT6A 4E47A 4OB0B 2DNUA 1CKAA 1YBYA 5GAOp 1XQHA 2WACA 1H3HA 5GAOm 2RMOA 3SFMA 3LH0A 2J7IA 3OW2S 2E6NA 2K6DA 4JJDA 1VQMA 3CC2A 4JLIA 2E70A 3UF4A 2VXFA 3CBPA 1G3TA 2A08A 1FMWA 4KBMB 2D0QB 2C0IA 2DYBA 1Q7YR 3H0FA 4Y92A 3I56Q 2C0OA 4C8QE 2RB6A 4QKUA 1IGQA 2CZ6B 1OPLA 3O8VA 2LDMA 2LZ6B 2Y90A 2COWA 5LJ5f 1UJYA 4JJCA 2RHIA 1QVGS 3IQLA 3GP8A 1U8RA 1O9SA 5CQYA 5I2MA 2DO3A 4M78G 5IHIA 2LCCA 4RTTA 3QJYA 4BE0A 1HK9A 4DOVA 1ZLMA 2BE9B 4MMKA 4OMFB 5GAMe 4A54A 5A0LA 2CKKA 4QQDA 1YJNQ 3LW5E 1D3BA 2NLUA 1JJ2A 3AT1B 3VS7A 2CP2A 3META 3CCMT 1SEMA 2BUDA 1OI1A 1M2OA 1MMGA 4XTZA 2L5QA 4BDZA 1W6XA 3GF5A 1M9SA 3EG2A 4QVZA 2KI7A 4M7AD 2JTMA 2QI2A 4QT7A 5GAMd 2F5KA 3EG9A 3FEOA 5KH6A 3RIRA 1AOJA 1Q82C 5LJ3e 4LXCA 3QUIA 3L2UA 4OMOA 1I5OB 2QEXA 1YCSB 3UPUA 2BTTA 1W70A 4LDXA 4HKEA 4EMKB 2BKDN 2GGRA 4PJJA 1ZUUA 3OBYA 1GRIA 2L3SA 3CXCS 4J9FA 1R77A 3CCUA 2IG0A 5IXFA 5LJ3d 1J3TA 1UGRB 3GPLA 3J80E 3G7ZA 2ZPEB 2DBKA 2QDYB 1BI1A 2L3PA 3MJXA 1QVGP 3FIFA 5GMKm 3QWYA 3A5ZB 1IGUA 1NM7A 2VUBA 3EFSA 3KBGA 4C8QC 4J9BA 2PUKB 3OYNA 4FW1A 1C6VX 1YJ9T 2V8IA 1ZUKA 3RESA 4M77G 3KFVA 3X28B 3JCMb 3CC7A 1GCQC 1BYMA 3MEUA 2HNIA 2J05A 1JJ2P 1QLYA 3CMAT 4RTYA 3OS0A 5L23A 2HKNA 4RCCA 4LDYA 1JRIA 2HQHA 5J39A 4ZGEB 3OYIA 1H641 3VS3A 4OB3B 2EYXA 3EFOA 4F7UG 1D0XA 1YJNA 1PWTA 1JXMA 1TS9A 3MP6A 4ZTFA 1U1TA 2M16A 2WSFE 2X4WA 4M78B 3JRZA 5IT9E 2QGFB 3FJPA 5GMKh 3M4GA 3MP8A 1LCKA 4M4ZA 1QP3A 4HT8A 1TU0B 3M56A 4RUGA 1R0BG 1SF9A 3C0CA 2P0PA 5GAN3 3HP9A 2BZYA 2HMAA 3CCJA 2DAQA 1KHCA 2MIOA 4NL3A 4PJOF 3JB9F 3C4SA 4P5NA 4XTXA 3MPUB 2QQRA 3ER0A 4M7DF 4FYXB 1PKSA 2OTLA 2WSEE 3FC3A 3PVQA 3QZ5B 2X9HA 1YHQA 1HD3A 1ZSZC 2DXTA 1WGSA 3H41A 2DILA 4X9CA 1YI2A 1M2VB 3QDFA 2EIFA 2HQEA 5GAN5 4AFZC 3PTAA 4WCIA 5D6WA 1B34A 2K5LA 3ZBDA 1UGVA 4RTWA 1E6HA 1JEGA 1VQ9Q 4Y91A 3G4SQ 4LD9K 3RKXA 5KYXA 2V1QA 1OZ3A 2DFUA 4E7SA 1TUCA 1BBZA 2KQWA 3D7SB 1SPKA 1UGPB 3JCMg 3V8JA 4DBQA 3HFNA 3PVLA 1KQSA 2LJ1A 1UG1A 2RI5A 2M51A 2L8DA 1M8VA 2X35A 2H3EB 1VA7A 4KGZB 4E7JA 1MV3A 2KROA 4QW2A 3RNJA 2L0AA 2LCLA 2F1LA 1QP2A 3I56T 4FYYB 3VUZA 1ABQA 3WVEB 3A1PA 1VQ4Q 2FPFA 2XG8D 1SG5A 4B9XA 2OTJQ 3TVTA 2P4RA 1I07A 4Z89A 2BZXA 3FB9A 4K11A 3C94A 4ORZA 3MCAB 2VB6A 1MNDA 1RADB 1RI0A 1BKBA 1TUGB 2ZCFB 2CP3A 4HT9A 3J7AF 3MHXA 4HXJA 3PE0A 5GAN6 3NTHA 3JCMf 2JTFA 1FYNA 2JTEA 2F2VA 2KDSA 4QQ6A 1S72A 2YLCA 1SKUB 5CR2A 1H8KA 1WJRA 3UWNA 4C0DC 3CMET 1QVPA 1G3YA 1YIJA 1KC8U 2QA4Q 3RERA 2VYTA 2LTOA 4RTZA 4RKUE 2VKNA 2J6KA 2CH4W 4WTOB 2MWOA 4LN2A 2MI6A 1UFFA 2ECZA 1QW1A 4KRTA 2AKKA 2HSEB 2F69A 4QQGA 1OX9A 2FZKB 3TSWA 1K8AC 2DL8A 2PTKA 1K73C 1NJIU 4HVVA 1GCQA 4LD6A 3J81E 4M7AF 3JCMc 4KH0B 4JJNK 4RG2A 1G5VA 2CDTA 2QDLA 5IHKA 3V7SA 2X4YA 1LJOA 3HTRA 5DLOA 4EPCA 3OA6A 2FVUA 5GAN7 3V7RA 3R6OA 2LJ3A 4F14A 4BY6C 5I2SA 2RI2A 3OSSC 2LJ0A 1M90R 3UA7A 2DJZA 3M4YA 1D3BB 4EMHA 4IUPA 1Q82R 1M1FA 1IZ6A 1C0MA 3L2WA 1VQKQ 2MAMA 2FEIA 2HBWA 2VGMA 2LCSA 2QYZA 2F5TX 1TOVA 2D1XA 1Q81C 1NEBA 3EFRA 3EG9B 5CKDA 3UA6A 1KIKA 3Q1JA 2PZ1A 3L2VA 3DB3A 3L2QA 3THKA 2M9UA 1WFWA 4PJOC 3KXTA 2JS0A 4FU6A 2DEQA 4PLLA 1OULA 4KT0E 2KAFA 5M9OA 1VQ5Q 1AHJB 4M7DC 2K2VA 1WDXA 1WHKA 4D8KA 5A0DA 1QVFP 2DEUA 2EYWA 2YWWA 2RJDA 3I5RA 1ZQ1A 2YUQA 4GY5A 1VYTA 2DXCA 5FRNA 4OMMA 3CBOA 4JRQA 5CVIA 1IHWA 4C92F 3LX7A 1M1GA 2YRDA 3A8LB 5CO7A 2RJEA 2LQNA 3SDZA 4ZNXA 2P84A 1M1KC 4M7AE 3NTIA 4KH1B 1K9MU 2XHCA 3VJPA 2D8JA 4BUGA 2LX9A 1VQOQ 4M75C 2RQWA 2KSSA 3UDCA 1RAHB 3EHQA 1EX4A 5IH2A 1RAIB 3EFOB 3S6WA 1VQ9T 4MZTA 1NE8A 2VV5A 3G4ST 1YNZA 4L5GA 5L8RE 3M0TA 2RHUA 2HZYA 1JB0E 5CKFA 1G83A 1PNJA 2IVWA 1MHNA 1UGQB 3GBQA 2X4XA 4V2SA 2CUDA 1WQ7A 2HL3A 2DERA 3MO8A 4FIBA 2DTOA 1PRMC 3CCMA 1X2KA 3DB4A 2ESWA 2JZ2A 5KYWA 4DQ2A 2EQIA 1U3OA 5EG2A 3PFSA 2HAXA 3JB9I 2YDLA 3JCMJ 3OYBA 1KD1C 2RQTA 2VXEA 5IXBA 4E7ZA 2FYKA 1I0CA 2K2MA 4O5VA 3OYYA 2DBMA 1N8RC 1D1BA 1VQNQ 1VQ4T 2DTHA 1AZEA 2O9VA 4GBQA 2OTJT 2R5MA 1H92A 1YWPA 3OSVA 1BI3A 2YXYA 2ZPIB 1V76A 4C92E 1B34B 2KXCA 2DL3A 2DE0X 3KUFA 5GMKj 3PGGA 5LJ5g 2RM4A 1W2BS 5KYXB 2COYA 2GTJA 3TCJA 2HBPA 2RK1A 1H3ZA 2R58A 4M7AC 3QO3A 4MZMA 3RDVA 1XOVA 3EGXA 1O75A 5FW9A 3HPWA 4ZTJA 2E65A 5GAN4 4L59A 3REAB 1YJ9A 3QIIA 1Q86C 2AZVA 3OW2A 1VQ8Q 2QA4T 4IUQA 2A36A 5EC7A 4X1VA 2DF6A 3G71Q 3CMAA 1TTHB 1N9SA 4BD3A 3P8HA 2GFAA 1VQ7Q 4XTUA 1X75C 5LJ5h 1WHLA 1FMVA 2DJQA 1PRLC 4KULA 1NYGA 3HL8A 2A7YA 4OMLA 1Y07A 1OU9A 2DM1A 2EJ9A 3VUBA 1M27C 1SSHA 2LC4A 3H0IA 1GCPA 3CCVQ 4DBRA 2MYSA 3HHTB 3VS2A 2M0YA 3OYLA 1WJSA 1QVGA 2LQ8A 2RJCA 2X3WD 4J9GA 4PJOA 1M90U 3QYGB 2F2WA 4M78F 2B86A 4XTYA 4M7DA 3CC4A 3WVDB 4C5IA 2H3JA 3OYEA 3TSZA 1BB9A 1VQKT 4FW2A 1Z9ZA 4J7IA 1GXIE 3M5AA 4HCBA 3CCRT 1OQKA 1K8AR 3P8DA 2V8JA 4C92C 1QQJA 5GAOn 2LQKA 3QBYA 4JPBW 2DXUA 4OMNA 2AZSA 3ZL7C 3DKMA 1GBRA 3CMEQ 2EPDA 1YFNA 2K4YA 1G8XA 2CUBA 3CPWS 1I1JA 3OW2P 1VQ5T 2EKHA 2QTXA 2LMJA 4IUUA 1QCNA 4VUBA 4BI3A 4XU1A 2ATCB 2MK5A 3L1AA 4N0AA 3GLXA 4NS5A 2HL5C 4M75A 2EWNA 2G3RA 1Z9QA 3DLMA 5GANg 2JN0A 4GLKA 9ATCB 1RAFB 2WSCE 4D8DA 4PFZA 4C5GA 2GCXA 1NPPA 4CC3A 2NUTA 3CCQQ 2DVEA 4PLIA 4E7IA 3MEWA 1QKWA 2A3LA 4XTVA 3L2RA 3EAEA 3I56A 2EJFA 1NLPC 2XKOC 4C0GA 3FDRA 4M77F 3I55Q 4IUVA 1VQOT 3VU3C 2EKOA 1UE9A 5CQXA 4XU2A 3MKDA 2CP6A 4M78E 1YITQ 2RJFA 2MCNA 2FPDA 1M3BA 2YUOA 2PVDB 1FWZA 4AG1C 3OS2A 1QWFA 4XU0A 3V8KA 5CIUA 4FYWB 4F7UF 4AG2C 3BW1A 1VQ6T 1WXTA 3PIPA 3JCMW 4YTLA 1M1KR 2FG0A 1KJWA 2B8AA 2BE7D 5GANf 1PSFA 2EAYA 3JAME 1G2BA 2MPXC 2XD0A 2M0OA 3SHWA 3CXCP 2ENMA 1UECA 4Z88A 2DIGA 1PKTA 2VASA 1UHFA 4HA8A 2AK5A 3HRTA 2RO0A 2GTOA 1VQNT 2IPOB 2FZGB 1WA7A 1LVKA 3BFMA 3TEEA 1UJ0A 2YUPA 2Y4YA 1AT1B 4OMPA 4ZN3A 3LGLA 1WXBA 2D8HA 3EHRA 4PJOG 5FWBA 4CI0C 3QSUA 5I22A 5CKBA 3G6EQ 1OV3A 2ZPHB 4Z02A 1T3LA 1PCXA 4B9WA 3OYHA 2RN8A 3BE3A 3CCLQ 1Q95G 2QK0A 4M77E 5KYWB 1N8RR 5LJ5d 2ZPBB 2EW3A 2E4HA 2QG9B 5D6XA 1VQ8T 2NUZA 5GAN8 4C8QD 3BDLA 2W0ZA 3QWXX 2JW4A 4M78C 2CS7A 2RPNA 2KYMA 5KE2A 3G71T 1Y57A 2ABLA 3VRYA 1VQ7T 1GFDA 4F7UE 1WHMA 4C5EA 3VS5A 1S1NA 3RKYA 2COZA 1Q7YU 1SSFA 2ED1A 3VS0A 2JMCA 4C0DB 3M59A 4C92A 3CCVT 3PNWC 4DEXA 4RTXA 3E19A 1KQSS 3A98A 5KYYA 2YUNA 4LDWA 1T0HA 4HCKA 4BI8B 4M75G 2DKGA 1G3WA 3JCMh 2RK2A 5GAOq 2DRKA 4JLGA 2K57A 4O6JA 3NPFA 2RHZA 3QG1A 3EGXB 2EQUA 3CQTA 3OYMA 1X6BA 4R0KA 2DYIA 2X51A 4II1A 3TREA 1I81A 1R0CB 2EYYA 2DRMA 4D6WA 1WHJA 4LNPA 4FT2A 4C5HA 3BDUA 1N9RA 1UDLA 4JUVA 4JJBA 4RTUA 4TVRA 1KQ2A 2EQJA 2CREA 1GBQA 5DY9A 5KYNA 1WZOA 2ZGWA 4CC7A 2GQIA 2L3QA 3NFCA 1VQ9A 1QVFA 1CKBA 3G4SA 4MDWA 1B3QA 1YJWQ 4C8QA 2ZZDA 4M77C 1D09B 4E7KA 2KYBA 2J6FA 5CKHA 4IIOA 1KHIA 4MMLA 2K3XA 2CZ0B 3LLRA 3QXEB 2DLPA 1MMAA 4PJOB 4OGEA 4PFOA 5I21A 4M7DB 1WX6A 3EG1A 3QHSA 2EQMA 2IIMA 5KE3A 2A37A 2CZ7B 1VQLQ 3CCQT 2R57A 4X34A 2RI3A 3CCSQ 5LJ5j 2VVKA 3EH1A 5HK3A 5GMKe 3I55T 2RHXA 1HSQA 2EJGA 4E7LA 1VQ4A 3CCRQ 3CCEQ 2KRNA 1KC8C 2OTJA 1N6AA 1NBEB 2YRCA 1EFNA 2SEMA 5I11A 2D0NA 2PUOB 1HYOA 1YITT 1VIFA 2KT8A 1VUBA 1P92A 1VQPQ 3QPHA 4XU3A 5GAMg 2MF2A 3OBWA 2HEQA 2DD4A 3QDRB 2RH2A 2KEAA 1NJIC 3I5SA 1D1AA 4M75B 2QQ9A 1PSEA 1TWBA 3P8BB 1CSKA 1ZSZA 1M3AA 4Y28E 1HJDA 4CC4B 4CC2A 4J6YA 2XICA 2K3BA 3JSCA 3OS1A 2GF7A 2CSIA 2QA4A 2QQBA 2NUTB 5LJ3g 1TH7A 3OYJA 2KBTA 4MDXA 1MMNA 3H6ZA 1E6GA 3VS1A 3CEYA 5FWCA 2EFIA 1UGSB 1UHCA 4J5YA 3VS6A 3CD6Q 2QQAA 1WHHA 3RBBB 2DK3A 1NYFA 3OYKA 5C0MA 4J8OA 3OB9A 1OPKA 5AYFA 2FPEA 2RHYA 1QMCA 5GAMf 2CYZB 3QJ6A 1RAAB 5IN1A 4Z8AA 3AHUA 1T0JA 2OJ2A 3UATA 3PMIA 3I9QA 3G6ET 5LJ3h 4J6XA 4XAXB 3CCLT 3H0HA 4KGXB 1VQKA 3JCMe 4ZGJB 2AIRB 1VQ6Q 1NG2A 3SB2A 5J26A 3M0UA 1VQMQ 2KR3A 4BE2A 2CT3A 2X4JA 3CC2Q 5CK9A 2C0TA 2MMPA 1BIBA 1YN8A 4JS5A 4MZPA 2KT1A 5LJ3f 1K1ZA 3C95A 2CP0A 3JCMV 2E64A 4HVWA 3O5ZA 7AT1B 1BK2A 1B07A 3JCMd 5GANj 2G6FX 1K9MC 1VQ5A 2K79A 3VS4A 4L6V5 2E10A 1T3SA 4C8QG 3SWNC 3JB9D 4PJOD 1B7TA 1OZ2A 5HCKA 4J6WA 2SRCA 4J9CA 2EQKA 3M0PA 4M7DD 3OYFA 1AD5A 2CSQA 3RKWA 2FL7A 1GL5A 4FM4B 1KSWA 2Z0WA 2RQRA 4DOWA 5GAOr 2OAUA 1W2BA 2DMOA 4N4HA 2EGAA 3LYIA 3OY9A 2A28A 4BI4A 4AFSC 2EVRA 2ED0A 1RLPC 4N4IA 4M77A 2ROTA 1IREB 2AT1B 2CH4A 3MEAA 3OMCA 4X9DA 4AT1B 1HXDA 4FL6A 1IRXA 1ZBXA 2P0KA 2EYQA 1UEBA 3A8MB 5CKEA 4PJLA 4BB7A 3VYHB 1JBMA 5FU6C 1VQOA 4LUEA 4F7UA 4A4GA 1LNXA 3QZ9B 4PFPA 2DVJA 3S3NA 3RMSA 2QEXQ 2PQWA 4M75D 1IB8A 1ZX6A 2MOXA 1YJWT 4C92B 1OYXA 1YWOA 5KYYB 2E1HA 2R5AA 3M54A 2VWFA 5KYUA 1RLQC 1ARKA 1VQ6A 1OOTA 3C12A 3CCUQ 1X6OA 4OMQA 5HKCA 4BDYA 2CGHA 1I5LA 1SHGA 1Y96A 2PU9B 1FMKA 2QGGA 4J7FA 2KY9A 4ME7A 2Y4XA 5J3BA 1VQLT 2CZ1B 3JV3A 2V26A 4C0FA 3CCST 5CCAA 1Q82U 1W2BP 3G1JA 2O9SA 2HQXA 2EGEA 3CC7Q 4ELYC 5AT1B 2CP5A 1VQNA 3CCET 1PC0A 3URGA 1RACB 1K73R 4PNOA 1U5SA 5FU7C 1PHTA 1KFZA 2DL4A 1VQPT 2E6ZA 2HKQB 2XIDA 4LDVA 3JB9H 2YHTA 3M9QA 3CPWA 2HDAA 4C8QB 1JO8A 4EMGA 1SHFA 1SRLA 2JS2A 4JZ3A 4A4KA 3OS5A 3LWHA 3FJ5A 1JJ2S 3BY7A 3L42A 3N5BB 1YCYA 1MNEA 1Y7XA 4UC4A 1K76A 2QAZA 4WF2A 1WJQA 3GOXA 5GAN2 2JM8A 3M0RA 3CXCA 1M90C 1KC8R 2DZCA 1Q81R 1MGQA 4PJMA 1VQ8A 2RA2A 3ULRB 1IXDA 3PIOA 3G71A 5CAIA 3CCJQ 2DL5A 4LDUA 2M02A 3H8ZA 4PKCC 4QVCA 2DXBA 1VQ7A 1RL2A 2OTLQ 3OYDA 1NJIR 1M3CA 1ZHIA 1YHQQ 2M1HA 2XDBA 3CD6T 2JOYA 4JZ4A 1YI2Q 2O01E 1TSFA 2O31A 3CBMA 2CP7A 3CCVA 2C06A 2D6FA 4JRIA 2QXFA 2GFUA 2FHDA 5HY6A 1WI7A 2AHJB 1K0XA 3OYGA 5GMKi 5IHNA 4F17A 2JVVA 2QQSA 2JJ9A 3GIBA 2K5FA 5GANh 4DA4A 1NPRA 2JNGA 2NUPA 3HRSA 2X3XD 2OI3A 2ZAEA 3SWNA 1BU1A 5IAYA 1ZSZB 4J9IA 3CPWP 2LQWA 3PT9A 1ZBJA 1QKXA 2O2OA 3EH2A 1VQMT 4EMKC 3R6NA 5HK0A 3PMTA 1PG5B 3CC2T 3RR6A 4R55A 3SD4A 1KQ1A 4B6MA 4JDSA 3V7CA 4HCCA 2YLBA 4C92D 2FRYA 3CMEA 1UUEA 3JB9J 1EZZB 2L89A 4M7AA 4RTVA 1ZA1B 4OGCA 2DETA 1WHGA 2NYSA 2RQVA 2ROLA 3S3OA 1YP5A 1AWOA 4CRIA 2FZCB 2VGNA 1WPYA 2K5IA 2E12A 2RNAA 2YRVA 1RI9A 2L2PA 5FRMA 3GNFB 3CC4T 1V29B 1M5Q1 2KGTA 4EDUA 5LJ5e 1U06A 1TUDA 2A0FB 3VRZA 4J9HA 1BCMA 1WNLA 1R8OB 4JS4A 3JB9G 1QCOA 1S72Q 1KD1R 2JUFA 1WIEA 3CCQA 4M7DG 4GLMA 2RQUA 1D0YA 4BE1A 1K9MR 2DD5A 2KMTA 5GAMj 2XK0A 3F70A 3EGDA 4IKFA 5KCOA 3A8GB 3OQ5A 3I55A 1YIJQ 3L2ZA 1N5ZA 3ME9A 4IIMA 4XK8E 2LT1A 3SEMA 3EG0A 4HVUA 1LOJA 1UB4A 1X69A 1YITA 2QEXT 3E9GA 4IURA 1AVZC 1ABOA 3M58A 4E6RA 4FT4A 4FSSA 4E2FB 4A53A 4HCZA 3NTKA 5LJ3j 2PNIA 3CCUT 1WQWA 2HSPA 2LT4A 2O4XA 2OX7A 1ACMB 3JCMQ 2FB7A 3U23A 3GNGA 1VYUA 5FLXE 2LX7A 4M75F 5A0GA 1ZUYA 1Q86R 4NOYA 1LPLA 4OB1B 4OF1A 1I4K1 3M57A 2P0QA 4M77B 2K7AA 2FO0A 2XDPA 3HRUA 2PVGB 1GFCA 3MP1A 3CC7T 1SRMA 3ZFJA 4DBHA 2LNVA 1K8AU 2E3HA 1K73U 2ZPFB 4F7UB 3MEVA 4ZN1A 1WXUA 1W4SA 4BY6B 3E1SA 3NGPA 3RMQA 3QYHB 1C1AA 2K9GA 2QASA 4RMOA 2EGCA 4DBFA 3OYCA 4PJOE 2XI9A 1YJNT 1A0NB 1Q7YC 1QWEA 5GJVB 4ELZC 4M7DE 1JU5C 3E2UA 4LE9A 4OB2B 5KYUB 3UT1A 3VV0A 2I2LA 3S3MA 2J6OA 4A63B 2YSQA 5KCHA 3G6EA 2BZ8A 2KK4A 4PJNA 3CCLA 1EIFA 2HCKA 4AFUC 1AWJA 4C0ZA 5D7UA 2DA9A 1Y96B 2ZPGB 4FYVB 4A4HA 8AT1B 1Q81U 1X27A 4ANJA 1U1SA 2KXDA 1AZGB 1KQSP 3T9NA 3WXMB 5GANe 3ZEHA 3CCJT 5C6SA 1QVFS 4XTWA 1TXQA 1RUWA 3HSBA 4M78D 2OAWA 2OTLT 1BI0A 2DIQA 1AWXA 1BCOA 2D9TA 2DL7A 5A2QE 1YHQT 4M7AG 1KK7A 2EYZA 2KRMA 1VYVA 4J9DA 2LRQA 1BI2A 1YI2T 4EMKA 3EGUA 5GAOl 4RCBA 3ASKA 5GANd 4PL6A 4M75E 2V1RA 2BIVA 5FROA 2KE9A 3X25B 2LP5A 1AEYA 3OMGA 3DLLA 2DZ9A 3INZA 1PM3A 1Y71A 1X43A 1X2QA 3V8LA 2J06A 1OX8A 1X01A 1OU8A 2CT4A 4KGVB 4F04B 1M1KU 2I0NA 5DM7R 4ZGDB 1XTDA 3CCMQ 2MWPA 1M4ZA 2QTVA 3FRNA 3TU4K 3LWIA 2F2XA 1FX7A 1ZA2B 1D1CA 1Y0MA 1XNIA 1M30A 4ATOA 2RF0A 4PK4A 4BACA 1BIAA 2DPPB 1JXOA 4R56A 4JRKA 1I8FA 2H8HA 1W1FA 1FXXA 3M53A 3X20B 4QVDA 1AWWA 1MMDA 2FRWA 1YJWA 2RD1A 3HKSA 5GAMh 3JCMX 4XQ3A 1KG1A 1IO6A 1XJWB 2AKLA 3REBB 1K9AA 4DEYA 4KUIA 4C92G 4ESRA 3OYAA 2LNHB 4M78A 1M8MA 4M77D 1RABB 4OP0A 1RAGB 2LVMA 1MUZA 1WYXA 2KNBB 3JCMP 2NUPB 4E7HA 1NLOC 1QCFA 4N4GA
chains in the Genus database with same CATH topology
2YLCA 1S72T 3SWNB 5CR2A 1KD1U 4J7FA 2KY9A 5GANf 1VQLA 1PSFA 4ME7A 2Y4XA 1VIEA 2EAYA 5J3BA 1VQLT 2E41A 2CZ1B 3JAME 3CCSA 1WJRA 2GQVA 4C0FA 4N0AC 3CCST 2XD0A 3UWNA 5CCAA 2M0OA 1Q82U 4C0DC 3FLGA 3CMET 1QVPA 1G3YA 2XU8A 1N8RU 1YIJA 1KC8U 2HQXA 3RERA 2VYTA 2LTOA 1YIJT 2DIGA 4RKUE 4ELYC 3CCRA 4HA8A 2MWOA 3CCEA 3HRTA 2RO0A 1VQNA 2MI6A 3CCET 1QW1A 3URGA 1VQNT 4PNOA 5FU7C 2F69A 3BFMA 3TEEA 5GMKl 4QQGA 4JRPA 3VYGA 1VQPA 4M7AB 2Y4YA 1VQPT 1K8AC 2E6ZA 5LL6S 1K73C 1NJIU 2XIDA 4ZN3A 4LDVA 3JB9H 4LD6A 3J81E 4M7AF 2YHTA 3LGLA 3JCMc 1N27A 3M9QA 3CPWA 4JJNK 4RG2A 1G5VA 2DTIA 4C8QB 1NZ9A 3V7SA 1G3SA 2X4YA 4EMGA 1LJOA 3RUXA 5DLOA 5FU6B 4C8QF 4EPCA 3OA6A 4A4KA 2FVUA 4PJOG 4CI0C 3OS5A 3LWHA 3QSUA 5GAN7 1JJ2S 3V7RA 3BY7A 3R6OA 4BY6C 3L42A 5I2SA 2KVQG 2PVOB 2RI2A 3N5BB 3OSSC 2ZPHB 3CPFA 1YCYA 5CKBA 4Z02A 1Y7XA 2DJZA 2HD0A 3M4YA 4UC4A 1Q86U 1D3BB 4B9WA 4WF2A 4EMHA 3OYHA 1WJQA 2XDDA 4IUPA 4RG8A 3GOXA 1DJ7B 5GAN2 1M1FA 2P4TA 1IZ6A 4M77E 3CXCA 1M90C 2DZCA 5LJ5d 1MGQA 2ZPBB 3VKIA 2VC8A 3L2WA 1VQ8A 2L3RA 2MAMA 3HFOA 5D6XA 1VQ8T 2RA2A 5GAN8 4C8QD 3BDLA 2VGMA 4M78C 3PIOA 2CS7A 2F5TX 3G71A 5CAIA 1Q81C 4LDUA 3A8OB 5KE2A 3G71T 3H8ZA 3EFRA 4PKCC 4QVCA 2DXBA 5CKDA 3A8HB 1VQ7A 2E5QA 1RL2A 3Q1JA 1VQ7T 3L2VA 4F7UE 3DB3A 3OYDA 4C5EA 3L2QA 1ZHIA 3CD6A 2M9UA 3RKYA 2M1HA 3M55A 3X24B 2XDBA 3CD6T 4PJOC 2JOYA 3KXTA 1Q7YU 4A4FA 2O01E 1SSFA 4Q5WA 4FU6A 2DEQA 4FSXA 4PLLA 3CBMA 4KT0E 2KAFA 4NL2A 5M9OA 1AHJB 3LGFA 4C0DB 3CCVA 3M59A 4C92A 2K2VA 3CCVT 4JRIA 2C06A 3PNWC 2D6FA 3X26B 3E19A 3E9FA 4IUTA 2QXFA 2GFUA 5D6YA 2K3YA 1KQSS 4J83A 2FHDA 5HY6A 2V8KA 3QKJA 4LDWA 2AHJB 4OVAA 5DLQE 5A0DA 3OYGA 4BI8B 5GMKi 4M75G 2RJDA 2DKGA 1G3WA 4KUDK 3JCMh 1ZQ1A 2RK2A 4A4EA 5FU7B 4GY5A 2JVVA 2QQSA 2O4XB 5GAOq 2DXCA 4JLGA 3GIBA 4E47A 2K57A 2K5FA 4OB0B 5GANh 4DA4A 1NPRA 2JNGA 1YBYA 4O6JA 3CBOA 5GAOp 5CVIA 1XQHA 4C92F 4JRQA 3HRSA 2WACA 3LX7A 2RHZA 3QG1A 3SWNA 5IAYA 2EQUA 5GAOm 3OYMA 3SFMA 3LH0A 4M7DC 1M1GA 3A8LB 4II1A 3OW2S 5CO7A 3PT9A 3TREA 2E6NA 2RJEA 1I81A 1VQMA 3SDZA 3CC2A 1VQMT 4JLIA 4EMKC 2E70A 4D6WA 5HK0A 3PMTA 3CC2T 2VXFA 3CBPA 1G3TA 4R55A 4FT2A 2D0QB 4KBMB 4C5HA 3BDUA 1M1KC 1N9RA 4M7AE 3SD4A 1KQ1A 4JUVA 3NTIA 4TVRA 1K9MU 1KQ2A 1H3ZA 4JDSA 2XHCA 3V7CA 2YLBA 4C92D 4HCCA 3VJPA 3CMEA 2EQJA 4BUGA 2LX9A 5DY9A 2RB6A 4C8QE 3JB9J 4M75C 2KSSA 2L89A 4M7AA 2ZGWA 2CZ6B 3O8VA 4OGCA 3UDCA 2LDMA 2Y90A 5LJ5f 3NFCA 1VQ9A 3S3OA 1QVFA 3S6WA 1VQ9T 2RHIA 1QVGS 4MZTA 3G4SA 4MDWA 1NE8A 4C8QA 2ZZDA 4CRIA 3GP8A 2VGNA 2VV5A 1WPYA 3G4ST 1U8RA 4M77C 1O9SA 4L5GA 2K5IA 2E12A 5CQYA 5L8RE 5I2MA 2DO3A 2YRVA 2RHUA 4M78G 2LCCA 3QJYA 1JB0E 4E7KA 5CKFA 4BE0A 1HK9A 4DOVA 3GNFB 5FRMA 3CC4T 5CKHA 2IVWA 4MMKA 1V29B 1KHIA 4OMFB 1MHNA 1M5Q1 2K3XA 4MMLA 5GAMe 2CZ0B 4A54A 1UGQB 5A0LA 3LLRA 2X4XA 3QXEB 4EDUA 2CKKA 4QQDA 5LJ5e 4PJOB 4V2SA 1WQ7A 3LW5E 1D3BA 2NLUA 1WNLA 4OGEA 1JJ2A 1R8OB 3MO8A 4FIBA 4JS4A 5I21A 4M7DB 2DTOA 3CCMA 3JB9G 3DB4A 2JZ2A 3META 3CCMT 2JUFA 3QHSA 4DQ2A 2BUDA 1OI1A 2EQMA 5EG2A 3CCQA 4M7DG 5KE3A 2CZ7B 3PFSA 2HAXA 4XTZA 3CCQT 4BE1A 3JB9I 2L5QA 2R57A 2DD5A 3GF5A 4X34A 2KMTA 3OYBA 4BDZA 5GAMj 3JCMJ 2RI3A 1M9SA 2XK0A 4QVZA 1KD1C 5LJ5j 2VXEA 3F70A 2FYKA 4M7AD 4IKFA 2JTMA 2QI2A 5GAMd 2F5KA 4O5VA 5KCOA 3A8GB 3FEOA 3OQ5A 5HK3A 3I55A 3L2ZA 3ME9A 5KH6A 5GMKe 3OYYA 3RIRA 3I55T 2RHXA 4XK8E 1Q82C 2EJGA 4E7LA 2LT1A 1VQ4A 5LJ3e 1N8RC 3QUIA 3L2UA 1KC8C 1VQ4T 2OTJA 1LOJA 1UB4A 1N6AA 2DTHA 2QEXA 3UPUA 1YITA 2OTJT 2R5MA 2QEXT 2PUOB 4HKEA 4LDXA 3OSVA 1YITT 1BI3A 1VIFA 1VUBA 2BKDN 1P92A 2ZPIB 4EMKB 3E9GA 4C92E 3QPHA 4IURA 1B34B 4XU3A 3KUFA 5GMKj 5GAMg 3M58A 3OBYA 2MF2A 3PGGA 5LJ5g 4FT4A 5FRNA 2RM4A 3OBWA 4A53A 2DD4A 3QDRB 3NTKA 4HCZA 5LJ3j 3CXCS 1W2BS 2RH2A 3CCUA 2IG0A 1NJIC 3CCUT 1WQWA 2LT4A 5LJ3d 2O4XA 3TCJA 1UGRB 3GPLA 2HBPA 4M75B 3G7ZA 3J80E 2QQ9A 1PSEA 2RK1A 2QDYB 1BI1A 2FB7A 2ZPEB 2R58A 3FIFA 3GNGA 3P8BB 3QO3A 4MZMA 1XOVA 5GMKm 4M7AC 5FLXE 4M75F 1O75A 5A0GA 3A5ZB 4NOYA 4Y28E 3HPWA 4ZTJA 2E65A 4OB1B 2VUBA 4OF1A 1I4K1 3EFSA 3M57A 5GAN4 3KBGA 4J6YA 4L59A 4C8QC 2P0QA 4M77B 2XICA 1YJ9A 3QIIA 3OYNA 2PUKB 1Q86C 3JSCA 3OS1A 2GF7A 1YJ9T 3OW2A 2V8IA 2QA4A 3RESA 2QQBA 2XDPA 4M77G 5LJ3g 1TH7A 3X28B 3JCMb 4IUQA 3OYJA 3HRUA 2PVGB 3CC7A 2QA4T 1BYMA 3MEUA 3MP1A 3H6ZA 3ZFJA 3CC7T 2HNIA 4MDXA 3CEYA 2EFIA 2LNVA 3CMAA 1N9SA 4BD3A 3P8HA 1K8AU 2GFAA 1UGSB 3CMAT 3OS0A 1K73U 4J5YA 2ZPFB 4XTUA 1X75C 5LJ5h 4RCCA 4LDYA 3JCMQ 1JRIA 3MEVA 4F7UB 5J39A 4KULA 4ZN1A 1W4SA 4ZGEB 3HL8A 4BY6B 3OYIA 1H641 3E1SA 2QQAA 2A7YA 4OB3B 4F7UG 1Y07A 2DK3A 3RMQA 3QYHB 3OYKA 5C0MA 2EJ9A 3VUBA 4J8OA 4RMOA 1YJNA 2LC4A 3OB9A 2XI9A 3OYCA 4PJOE 1YJNT 3MP6A 5AYFA 4ZTFA 1Q7YC 2RHYA 3HHTB 1U1TA 4M7DE 4ELZC 3OYLA 1WJSA 5GAMf 1QVGA 2CYZB 2M16A 2WSFE 2X4WA 3QJ6A 4OB2B 5IN1A 3UT1A 3VV0A 2I2LA 2LQ8A 3AHUA 3S3MA 4M78B 2RJCA 3JRZA 5IT9E 5KCHA 3G6EA 3FJPA 5GMKh 4PJOA 3M4GA 1M90U 3PMIA 3QYGB 3G6ET 3MP8A 2KK4A 4M78F 3CCLA 1EIFA 1QP3A 5LJ3h 4J6XA 4XTYA 4HT8A 4M7DA 3M56A 4XAXB 4C0ZA 3CCLT 3CC4A 1Y96B 3WVDB 2ZPGB 2P0PA 4A4HA 5GAN3 1VQKA 4C5IA 2H3JA 3HP9A 4ZGJB 3JCMe 3OYEA 1Q81U 1U1SA 5J26A 3SB2A 1VQKT 4J7IA 3T9NA 1GXIE 3M5AA 3WXMB 5GANe 3CCJA 3CCRT 4HCBA 2DAQA 4BE2A 3ZEHA 1KHCA 2X4JA 4NL3A 4PJOF 3CCJT 3P8DA 2V8JA 5C6SA 4C92C 3JB9F 5CK9A 2MMPA 1BIBA 3C4SA 4P5NA 4XTWA 4XTXA 4JS5A 2QQRA 4MZPA 3ER0A 5LJ3f 1QVFS 4M7DF 5GAOn 2OTLA 2LQKA 4M78D 3HSBA 2WSEE 3FC3A 3C95A 3QZ5B 2OTLT 1YHQA 1BI0A 2DIQA 3QBYA 2DXUA 2DXTA 1WGSA 2D9TA 2E64A 3JCMV 5A2QE 1YHQT 4M7AG 3DKMA 1YI2A 4X9CA 3JCMd 5GANj 2LRQA 1BI2A 1YI2T 1K9MC 2K4YA 4EMKA 1VQ5A 3CPWS 5GAOl 1VQ5T 2EIFA 2HQEA 3ASKA 4L6V5 2E10A 4RCBA 5GANd 2QTXA 5D6WA 1B34A 2K5LA 4C8QG 4PL6A 3ZBDA 4M75E 3SWNC 3JB9D 4PJOD 4IUUA 1OZ2A 4VUBA 4J6WA 2BIVA 4Y91A 5FROA 4BI3A 4XU1A 2EQKA 4M7DD 4LD9K 3RKXA 3L1AA 4N0AA 3X25B 3OYFA 3RKWA 2FL7A 3GLXA 1OZ3A 4NS5A 3OMGA 3DLLA 2DZ9A 4FM4B 3INZA 2KQWA 4M75A 1UGPB 4DOWA 1Y71A 2OAUA 5GAOr 1W2BA 3JCMg 2EWNA 2G3RA 3V8LA 3V8JA 4N4HA 3LYIA 3OY9A 1X01A 3DLMA 4BI4A 3HFNA 5GANg 2JN0A 4GLKA 1KQSA 2WSCE 2RI5A 4N4IA 1M1KU 4M77A 1IREB 5DM7R 4ZGDB 1XTDA 3MEAA 2L8DA 4C5GA 2GCXA 1NPPA 2MWPA 2X35A 3OMCA 4X9DA 1M8VA 4E7JA 1HXDA 4FL6A 1M4ZA 1ZBXA 2DVEA 4PLIA 3FRNA 2P0KA 3TU4K 3LWIA 4E7IA 3MEWA 1FX7A 2A3LA 2EYQA 1UEBA 4QW2A 4XTVA 1XNIA 3A8MB 3L2RA 3EAEA 5CKEA 4ATOA 3I56A 2EJFA 2LCLA 4BACA 1QP2A 1BIAA 2DPPB 3I56T 4BB7A 3VUZA 3VYHB 1JBMA 2XKOC 5FU6C 4C0GA 1VQOA 3FDRA 4M77F 4R56A 4IUVA 4JRKA 4F7UA 1VQOT 3VU3C 1I8FA 4A4GA 1LNXA 2EKOA 3WVEB 3QZ9B 5CQXA 4XU2A 3S3NA 1FXXA 2XG8D 3M53A 3RMSA 3X20B 4B9XA 4QVDA 2PQWA 4M78E 4M75D 1YJWA 2RJFA 2RD1A 3HKSA 5GAMh 3JCMX 1YJWT 2PVDB 1FWZA 4XQ3A 3FB9A 4C92B 1KG1A 1OYXA 3OS2A 3C94A 2E1HA 4XU0A 4KUIA 3V8KA 5CIUA 2R5AA 3M54A 4C92G 4F7UF 3OYAA 3MCAB 1VQ6A 4M78A 4M77D 4OP0A 3C12A 1RI0A 1BKBA 3BW1A 1VQ6T 2LVMA 1X6OA 2ZCFB 3PIPA 5HKCA 3JCMW 4HT9A 4YTLA 3J7AF 3MHXA 4BDYA 2CGHA 5GAN6 3NTHA 3PTAA 3JCMf 1I5LA 2JTFA 2KDSA 3JCMP 4E7HA 1Y96A 4QQ6A 5GAN5 1S72A 2PU9B 2B8AA 4N4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5M A;  3C4S A;  2RJD A;  2QQR A;  2BKD N;  3E9G A;  4A4E A;  4GY5 A;  3FC3 A;  2QQS A;  2O4X B;  4IUR A;  2DIQ A;  1WJR A;  3QBY A;  3KUF A;  1WGS A;  2D9T A;  5FRN A;  3UWN A;  2M0O A;  3FLG A;  2WAC A;  3LX7 A;  2RHZ A;  4HCZ A;  3NTK A;  2LRQ A;  5IAY A;  2EQU A;  2IG0 A;  3OYM A;  2HQX A;  2VYT A;  2LTO A;  3LH0 A;  2DIG A;  2HQE A;  3ASK A;  4II1 A;  2O4X A;  5D6W A;  2E6N A;  2RJE A;  2MWO A;  4PL6 A;  2RO0 A;  4IUU A;  1OZ2 A;  1H3Z A;  2R58 A;  2BIV A;  3PMT A;  5FRO A;  2EQK A;  4QQG A;  3OYF A;  4C5H A;  4NS5 A;  1OZ3 A;  3SD4 A;  4ZTJ A;  3OMG A;  3NTI A;  4L59 A;  4LD6 A;  3QII A;  2EQJ A;  3OYN A;  2G3R A;  3LGL A;  3OS1 A;  1N27 A;  3LYI A;  3M9Q A;  2GF7 A;  4N4H A;  4RG2 A;  3OY9 A;  5C6S A;  1G5V A;  3DLM A;  2XDP A;  2X4Y A;  3OYJ A;  4IUQ A;  2L89 A;  3MEU A;  3MP1 A;  3H6Z A;  3O8V A;  3CEY A;  3OA6 A;  2LDM A;  2EFI A;  2RI5 A;  4N4I A;  3MEA A;  4BD3 A;  3P8H A;  3S6W A;  2L8D A;  4C5G A;  3S3O A;  2GFA A;  2RHI A;  2MWP A;  2X35 A;  3OMC A;  3OS0 A;  4E7J A;  3L42 A;  4CRI A;  2RI2 A;  4FL6 A;  4Z02 A;  4PLI A;  5J39 A;  2P0K A;  3MEV A;  4UC4 A;  4B9W A;  2YRV A;  2RHU A;  3OYH A;  3MEW A;  2LCC A;  4E7I A;  1WJQ A;  3OYI A;  4IUP A;  4QW2 A;  3GOX A;  4E7K A;  1XNI A;  3L2R A;  3EAE A;  4BE0 A;  5FRM A;  4BAC A;  1MHN A;  2K3X A;  3OYK A;  5C0M A;  3L2W A;  2L3R A;  3LLR A;  2X4X A;  3OYC A;  3OB9 A;  2CKK A;  3FDR A;  4QQD A;  4IUV A;  5D6X A;  3MP6 A;  4EDU A;  4A4G A;  3BDL A;  4ZTF A;  2EKO A;  2NLU A;  2RHY A;  3MO8 A;  3OYL A;  1WJS A;  3QJ6 A;  2M16 A;  2X4W A;  3S3N A;  3DB4 A;  5KE2 A;  2JZ2 A;  3H8Z A;  4B9X A;  5IN1 A;  3MET A;  3UT1 A;  3S3M A;  2PQW A;  2BUD A;  1OI1 A;  2EQM A;  2E5Q A;  2RJF A;  2RJC A;  5KCH A;  5KE3 A;  3PFS A;  3Q1J A;  3PMI A;  3L2V A;  4BE1 A;  3MP8 A;  1OYX A;  2R57 A;  4BDZ A;  3DB3 A;  4X34 A;  4C5E A;  3OS2 A;  3OYB A;  3OYD A;  2RI3 A;  3L2Q A;  2XK0 A;  4QVZ A;  2M1H A;  3F70 A;  5CIU A;  4IKF A;  2R5A A;  3OYA A;  2F5K A;  4A4H A;  4A4F A;  1SSF A;  4Q5W A;  4FU6 A;  4C5I A;  3FEO A;  3OQ5 A;  1RI0 A;  4PLL A;  5KCO A;  5M9O A;  3OYE A;  2LVM A;  3LGF A;  3ME9 A;  5J26 A;  5KH6 A;  2RHX A;  3PNW C;  4E7L A;  3E9F A;  4IUT A;  5D6Y A;  2GFU A;  4BDY A;  2K3Y A;  3NTH A;  2DAQ A;  2FHD A;  3L2U A;  4BE2 A;  2JTF A;  1KHC A;  3ZEH A;  4E7H A;  3QKJ A;  4OVA A;  4QQ6 A;  3P8D A;  3OYG A;  2B8A A;  4N4G A; 
#chains in the Genus database with same CATH topology
 1KD1 U;  1S72 T;  3SWN B;  4FCY A;  1VQL A;  1VIE A;  2E41 A;  3CCS A;  2GQV A;  4N0A C;  1YJ9 Q;  3FLG A;  3M0S A;  1X6G A;  2XU8 A;  1N8R U;  2EBP A;  5ECA A;  1YIJ T;  8ATC B;  3NHN A;  3CCR A;  1PD0 A;  3CCE A;  1JQQ A;  3NMZ C;  3CMA Q;  3EG3 A;  3TQ7 P;  1M2V A;  5GMK l;  4JRP A;  3VYG A;  1F1B B;  1VQP A;  4M7A B;  1RAE B;  1E7O A;  5LL6 S;  2GNC A;  4LUD A;  1N27 A;  1K0S A;  2NWM A;  4F16 A;  2DTI A;  1NZ9 A;  1G3S A;  1UTI A;  1V1C A;  3RUX A;  5FU6 B;  4C8Q F;  1NEG A;  1OEB A;  2KVQ G;  2PVO B;  3CPF A;  1Q86 U;  2HD0 A;  1ZSG A;  2O88 A;  2XDD A;  4RG8 A;  1DJ7 B;  2P4T A;  3LH5 A;  3CC4 Q;  2JMA A;  4J9E A;  1VOM A;  3VKI A;  2VC8 A;  2L3R A;  3HFO A;  2JM9 A;  3I35 A;  1PD1 A;  2JT4 A;  3EGD B;  3A8O B;  3M0Q A;  4AMC A;  1TG0 A;  3A8H B;  2E5Q A;  1K4U S;  2XMF A;  1MV0 B;  2W10 A;  3CD6 A;  3M55 A;  3X24 B;  5GJW B;  6AT1 B;  4A4F A;  4Q5W A;  1D0Z A;  4FSX A;  2E5K A;  4NL2 A;  3LGF A;  3X26 B;  3H9N A;  3E9F A;  4IUT A;  5D6Y A;  2E3I A;  2K3Y A;  4J83 A;  2V8K A;  3QKJ A;  4OVA A;  5DLQ E;  4EIK A;  2JXB A;  4AFQ C;  1WLP B;  2KRS A;  4KUD K;  2DX1 A;  4A4E A;  5FU7 B;  2O4X B;  1IHV A;  2GBQ A;  2YT6 A;  4E47 A;  4OB0 B;  2DNU A;  1CKA A;  1YBY A;  5GAO p;  1XQH A;  2WAC A;  1H3H A;  5GAO m;  2RMO A;  3SFM A;  3LH0 A;  2J7I A;  3OW2 S;  2E6N A;  2K6D A;  4JJD A;  1VQM A;  3CC2 A;  4JLI A;  2E70 A;  3UF4 A;  2VXF A;  3CBP A;  1G3T A;  2A08 A;  1FMW A;  4KBM B;  2D0Q B;  2C0I A;  2DYB A;  1Q7Y R;  3H0F A;  4Y92 A;  3I56 Q;  2C0O A;  4C8Q E;  2RB6 A;  4QKU A;  1IGQ A;  2CZ6 B;  1OPL A;  3O8V A;  2LDM A;  2LZ6 B;  2Y90 A;  2COW A;  5LJ5 f;  1UJY A;  4JJC A;  2RHI A;  1QVG S;  3IQL A;  3GP8 A;  1U8R A;  1O9S A;  5CQY A;  5I2M A;  2DO3 A;  4M78 G;  5IHI A;  2LCC A;  4RTT A;  3QJY A;  4BE0 A;  1HK9 A;  4DOV A;  1ZLM A;  2BE9 B;  4MMK A;  4OMF B;  5GAM e;  4A54 A;  5A0L A;  2CKK A;  4QQD A;  1YJN Q;  3LW5 E;  1D3B A;  2NLU A;  1JJ2 A;  3AT1 B;  3VS7 A;  2CP2 A;  3MET A;  3CCM T;  1SEM A;  2BUD A;  1OI1 A;  1M2O A;  1MMG A;  4XTZ A;  2L5Q A;  4BDZ A;  1W6X A;  3GF5 A;  1M9S A;  3EG2 A;  4QVZ A;  2KI7 A;  4M7A D;  2JTM A;  2QI2 A;  4QT7 A;  5GAM d;  2F5K A;  3EG9 A;  3FEO A;  5KH6 A;  3RIR A;  1AOJ A;  1Q82 C;  5LJ3 e;  4LXC A;  3QUI A;  3L2U A;  4OMO A;  1I5O B;  2QEX A;  1YCS B;  3UPU A;  2BTT A;  1W70 A;  4LDX A;  4HKE A;  4EMK B;  2BKD N;  2GGR A;  4PJJ A;  1ZUU A;  3OBY A;  1GRI A;  2L3S A;  3CXC S;  4J9F A;  1R77 A;  3CCU A;  2IG0 A;  5IXF A;  5LJ3 d;  1J3T A;  1UGR B;  3GPL A;  3J80 E;  3G7Z A;  2ZPE B;  2DBK A;  2QDY B;  1BI1 A;  2L3P A;  3MJX A;  1QVG P;  3FIF A;  5GMK m;  3QWY A;  3A5Z B;  1IGU A;  1NM7 A;  2VUB A;  3EFS A;  3KBG A;  4C8Q C;  4J9B A;  2PUK B;  3OYN A;  4FW1 A;  1C6V X;  1YJ9 T;  2V8I A;  1ZUK A;  3RES A;  4M77 G;  3KFV A;  3X28 B;  3JCM b;  3CC7 A;  1GCQ C;  1BYM A;  3MEU A;  2HNI A;  2J05 A;  1JJ2 P;  1QLY A;  3CMA T;  4RTY A;  3OS0 A;  5L23 A;  2HKN A;  4RCC A;  4LDY A;  1JRI A;  2HQH A;  5J39 A;  4ZGE B;  3OYI A;  1H64 1;  3VS3 A;  4OB3 B;  2EYX A;  3EFO A;  4F7U G;  1D0X A;  1YJN A;  1PWT A;  1JXM A;  1TS9 A;  3MP6 A;  4ZTF A;  1U1T A;  2M16 A;  2WSF E;  2X4W A;  4M78 B;  3JRZ A;  5IT9 E;  2QGF B;  3FJP A;  5GMK h;  3M4G A;  3MP8 A;  1LCK A;  4M4Z A;  1QP3 A;  4HT8 A;  1TU0 B;  3M56 A;  4RUG A;  1R0B G;  1SF9 A;  3C0C A;  2P0P A;  5GAN 3;  3HP9 A;  2BZY A;  2HMA A;  3CCJ A;  2DAQ A;  1KHC A;  2MIO A;  4NL3 A;  4PJO F;  3JB9 F;  3C4S A;  4P5N A;  4XTX A;  3MPU B;  2QQR A;  3ER0 A;  4M7D F;  4FYX B;  1PKS A;  2OTL A;  2WSE E;  3FC3 A;  3PVQ A;  3QZ5 B;  2X9H A;  1YHQ A;  1HD3 A;  1ZSZ C;  2DXT A;  1WGS A;  3H41 A;  2DIL A;  4X9C A;  1YI2 A;  1M2V B;  3QDF A;  2EIF A;  2HQE A;  5GAN 5;  4AFZ C;  3PTA A;  4WCI A;  5D6W A;  1B34 A;  2K5L A;  3ZBD A;  1UGV A;  4RTW A;  1E6H A;  1JEG A;  1VQ9 Q;  4Y91 A;  3G4S Q;  4LD9 K;  3RKX A;  5KYX A;  2V1Q A;  1OZ3 A;  2DFU A;  4E7S A;  1TUC A;  1BBZ A;  2KQW A;  3D7S B;  1SPK A;  1UGP B;  3JCM g;  3V8J A;  4DBQ A;  3HFN A;  3PVL A;  1KQS A;  2LJ1 A;  1UG1 A;  2RI5 A;  2M51 A;  2L8D A;  1M8V A;  2X35 A;  2H3E B;  1VA7 A;  4KGZ B;  4E7J A;  1MV3 A;  2KRO A;  4QW2 A;  3RNJ A;  2L0A A;  2LCL A;  2F1L A;  1QP2 A;  3I56 T;  4FYY B;  3VUZ A;  1ABQ A;  3WVE B;  3A1P A;  1VQ4 Q;  2FPF A;  2XG8 D;  1SG5 A;  4B9X A;  2OTJ Q;  3TVT A;  2P4R A;  1I07 A;  4Z89 A;  2BZX A;  3FB9 A;  4K11 A;  3C94 A;  4ORZ A;  3MCA B;  2VB6 A;  1MND A;  1RAD B;  1RI0 A;  1BKB A;  1TUG B;  2ZCF B;  2CP3 A;  4HT9 A;  3J7A F;  3MHX A;  4HXJ A;  3PE0 A;  5GAN 6;  3NTH A;  3JCM f;  2JTF A;  1FYN A;  2JTE A;  2F2V A;  2KDS A;  4QQ6 A;  1S72 A;  2YLC A;  1SKU B;  5CR2 A;  1H8K A;  1WJR A;  3UWN A;  4C0D C;  3CME T;  1QVP A;  1G3Y A;  1YIJ A;  1KC8 U;  2QA4 Q;  3RER A;  2VYT A;  2LTO A;  4RTZ A;  4RKU E;  2VKN A;  2J6K A;  2CH4 W;  4WTO B;  2MWO A;  4LN2 A;  2MI6 A;  1UFF A;  2ECZ A;  1QW1 A;  4KRT A;  2AKK A;  2HSE B;  2F69 A;  4QQG A;  1OX9 A;  2FZK B;  3TSW A;  1K8A C;  2DL8 A;  2PTK A;  1K73 C;  1NJI U;  4HVV A;  1GCQ A;  4LD6 A;  3J81 E;  4M7A F;  3JCM c;  4KH0 B;  4JJN K;  4RG2 A;  1G5V A;  2CDT A;  2QDL A;  5IHK A;  3V7S A;  2X4Y A;  1LJO A;  3HTR A;  5DLO A;  4EPC A;  3OA6 A;  2FVU A;  5GAN 7;  3V7R A;  3R6O A;  2LJ3 A;  4F14 A;  4BY6 C;  5I2S A;  2RI2 A;  3OSS C;  2LJ0 A;  1M90 R;  3UA7 A;  2DJZ A;  3M4Y A;  1D3B B;  4EMH A;  4IUP A;  1Q82 R;  1M1F A;  1IZ6 A;  1C0M A;  3L2W A;  1VQK Q;  2MAM A;  2FEI A;  2HBW A;  2VGM A;  2LCS A;  2QYZ A;  2F5T X;  1TOV A;  2D1X A;  1Q81 C;  1NEB A;  3EFR A;  3EG9 B;  5CKD A;  3UA6 A;  1KIK A;  3Q1J A;  2PZ1 A;  3L2V A;  3DB3 A;  3L2Q A;  3THK A;  2M9U A;  1WFW A;  4PJO C;  3KXT A;  2JS0 A;  4FU6 A;  2DEQ A;  4PLL A;  1OUL A;  4KT0 E;  2KAF A;  5M9O A;  1VQ5 Q;  1AHJ B;  4M7D C;  2K2V A;  1WDX A;  1WHK A;  4D8K A;  5A0D A;  1QVF P;  2DEU A;  2EYW A;  2YWW A;  2RJD A;  3I5R A;  1ZQ1 A;  2YUQ A;  4GY5 A;  1VYT A;  2DXC A;  5FRN A;  4OMM A;  3CBO A;  4JRQ A;  5CVI A;  1IHW A;  4C92 F;  3LX7 A;  1M1G A;  2YRD A;  3A8L B;  5CO7 A;  2RJE A;  2LQN A;  3SDZ A;  4ZNX A;  2P84 A;  1M1K C;  4M7A E;  3NTI A;  4KH1 B;  1K9M U;  2XHC A;  3VJP A;  2D8J A;  4BUG A;  2LX9 A;  1VQO Q;  4M75 C;  2RQW A;  2KSS A;  3UDC A;  1RAH B;  3EHQ A;  1EX4 A;  5IH2 A;  1RAI B;  3EFO B;  3S6W A;  1VQ9 T;  4MZT A;  1NE8 A;  2VV5 A;  3G4S T;  1YNZ A;  4L5G A;  5L8R E;  3M0T A;  2RHU A;  2HZY A;  1JB0 E;  5CKF A;  1G83 A;  1PNJ A;  2IVW A;  1MHN A;  1UGQ B;  3GBQ A;  2X4X A;  4V2S A;  2CUD A;  1WQ7 A;  2HL3 A;  2DER A;  3MO8 A;  4FIB A;  2DTO A;  1PRM C;  3CCM A;  1X2K A;  3DB4 A;  2ESW A;  2JZ2 A;  5KYW A;  4DQ2 A;  2EQI A;  1U3O A;  5EG2 A;  3PFS A;  2HAX A;  3JB9 I;  2YDL A;  3JCM J;  3OYB A;  1KD1 C;  2RQT A;  2VXE A;  5IXB A;  4E7Z A;  2FYK A;  1I0C A;  2K2M A;  4O5V A;  3OYY A;  2DBM A;  1N8R C;  1D1B A;  1VQN Q;  1VQ4 T;  2DTH A;  1AZE A;  2O9V A;  4GBQ A;  2OTJ T;  2R5M A;  1H92 A;  1YWP A;  3OSV A;  1BI3 A;  2YXY A;  2ZPI B;  1V76 A;  4C92 E;  1B34 B;  2KXC A;  2DL3 A;  2DE0 X;  3KUF A;  5GMK j;  3PGG A;  5LJ5 g;  2RM4 A;  1W2B S;  5KYX B;  2COY A;  2GTJ A;  3TCJ A;  2HBP A;  2RK1 A;  1H3Z A;  2R58 A;  4M7A C;  3QO3 A;  4MZM A;  3RDV A;  1XOV A;  3EGX A;  1O75 A;  5FW9 A;  3HPW A;  4ZTJ A;  2E65 A;  5GAN 4;  4L59 A;  3REA B;  1YJ9 A;  3QII A;  1Q86 C;  2AZV A;  3OW2 A;  1VQ8 Q;  2QA4 T;  4IUQ A;  2A36 A;  5EC7 A;  4X1V A;  2DF6 A;  3G71 Q;  3CMA A;  1TTH B;  1N9S A;  4BD3 A;  3P8H A;  2GFA A;  1VQ7 Q;  4XTU A;  1X75 C;  5LJ5 h;  1WHL A;  1FMV A;  2DJQ A;  1PRL C;  4KUL A;  1NYG A;  3HL8 A;  2A7Y A;  4OML A;  1Y07 A;  1OU9 A;  2DM1 A;  2EJ9 A;  3VUB A;  1M27 C;  1SSH A;  2LC4 A;  3H0I A;  1GCP A;  3CCV Q;  4DBR A;  2MYS A;  3HHT B;  3VS2 A;  2M0Y A;  3OYL A;  1WJS A;  1QVG A;  2LQ8 A;  2RJC A;  2X3W D;  4J9G A;  4PJO A;  1M90 U;  3QYG B;  2F2W A;  4M78 F;  2B86 A;  4XTY A;  4M7D A;  3CC4 A;  3WVD B;  4C5I A;  2H3J A;  3OYE A;  3TSZ A;  1BB9 A;  1VQK T;  4FW2 A;  1Z9Z A;  4J7I A;  1GXI E;  3M5A A;  4HCB A;  3CCR T;  1OQK A;  1K8A R;  3P8D A;  2V8J A;  4C92 C;  1QQJ A;  5GAO n;  2LQK A;  3QBY A;  4JPB W;  2DXU A;  4OMN A;  2AZS A;  3ZL7 C;  3DKM A;  1GBR A;  3CME Q;  2EPD A;  1YFN A;  2K4Y A;  1G8X A;  2CUB A;  3CPW S;  1I1J A;  3OW2 P;  1VQ5 T;  2EKH A;  2QTX A;  2LMJ A;  4IUU A;  1QCN A;  4VUB A;  4BI3 A;  4XU1 A;  2ATC B;  2MK5 A;  3L1A A;  4N0A A;  3GLX A;  4NS5 A;  2HL5 C;  4M75 A;  2EWN A;  2G3R A;  1Z9Q A;  3DLM A;  5GAN g;  2JN0 A;  4GLK A;  9ATC B;  1RAF B;  2WSC E;  4D8D A;  4PFZ A;  4C5G A;  2GCX A;  1NPP A;  4CC3 A;  2NUT A;  3CCQ Q;  2DVE A;  4PLI A;  4E7I A;  3MEW A;  1QKW A;  2A3L A;  4XTV A;  3L2R A;  3EAE A;  3I56 A;  2EJF A;  1NLP C;  2XKO C;  4C0G A;  3FDR A;  4M77 F;  3I55 Q;  4IUV A;  1VQO T;  3VU3 C;  2EKO A;  1UE9 A;  5CQX A;  4XU2 A;  3MKD A;  2CP6 A;  4M78 E;  1YIT Q;  2RJF A;  2MCN A;  2FPD A;  1M3B A;  2YUO A;  2PVD B;  1FWZ A;  4AG1 C;  3OS2 A;  1QWF A;  4XU0 A;  3V8K A;  5CIU A;  4FYW B;  4F7U F;  4AG2 C;  3BW1 A;  1VQ6 T;  1WXT A;  3PIP A;  3JCM W;  4YTL A;  1M1K R;  2FG0 A;  1KJW A;  2B8A A;  2BE7 D;  5GAN f;  1PSF A;  2EAY A;  3JAM E;  1G2B A;  2MPX C;  2XD0 A;  2M0O A;  3SHW A;  3CXC P;  2ENM A;  1UEC A;  4Z88 A;  2DIG A;  1PKT A;  2VAS A;  1UHF A;  4HA8 A;  2AK5 A;  3HRT A;  2RO0 A;  2GTO A;  1VQN T;  2IPO B;  2FZG B;  1WA7 A;  1LVK A;  3BFM A;  3TEE A;  1UJ0 A;  2YUP A;  2Y4Y A;  1AT1 B;  4OMP A;  4ZN3 A;  3LGL A;  1WXB A;  2D8H A;  3EHR A;  4PJO G;  5FWB A;  4CI0 C;  3QSU A;  5I22 A;  5CKB A;  3G6E Q;  1OV3 A;  2ZPH B;  4Z02 A;  1T3L A;  1PCX A;  4B9W A;  3OYH A;  2RN8 A;  3BE3 A;  3CCL Q;  1Q95 G;  2QK0 A;  4M77 E;  5KYW B;  1N8R R;  5LJ5 d;  2ZPB B;  2EW3 A;  2E4H A;  2QG9 B;  5D6X A;  1VQ8 T;  2NUZ A;  5GAN 8;  4C8Q D;  3BDL A;  2W0Z A;  3QWX X;  2JW4 A;  4M78 C;  2CS7 A;  2RPN A;  2KYM A;  5KE2 A;  3G71 T;  1Y57 A;  2ABL A;  3VRY A;  1VQ7 T;  1GFD A;  4F7U E;  1WHM A;  4C5E A;  3VS5 A;  1S1N A;  3RKY A;  2COZ A;  1Q7Y U;  1SSF A;  2ED1 A;  3VS0 A;  2JMC A;  4C0D B;  3M59 A;  4C92 A;  3CCV T;  3PNW C;  4DEX A;  4RTX A;  3E19 A;  1KQS S;  3A98 A;  5KYY A;  2YUN A;  4LDW A;  1T0H A;  4HCK A;  4BI8 B;  4M75 G;  2DKG A;  1G3W A;  3JCM h;  2RK2 A;  5GAO q;  2DRK A;  4JLG A;  2K57 A;  4O6J A;  3NPF A;  2RHZ A;  3QG1 A;  3EGX B;  2EQU A;  3CQT A;  3OYM A;  1X6B A;  4R0K A;  2DYI A;  2X51 A;  4II1 A;  3TRE A;  1I81 A;  1R0C B;  2EYY A;  2DRM A;  4D6W A;  1WHJ A;  4LNP A;  4FT2 A;  4C5H A;  3BDU A;  1N9R A;  1UDL A;  4JUV A;  4JJB A;  4RTU A;  4TVR A;  1KQ2 A;  2EQJ A;  2CRE A;  1GBQ A;  5DY9 A;  5KYN A;  1WZO A;  2ZGW A;  4CC7 A;  2GQI A;  2L3Q A;  3NFC A;  1VQ9 A;  1QVF A;  1CKB A;  3G4S A;  4MDW A;  1B3Q A;  1YJW Q;  4C8Q A;  2ZZD A;  4M77 C;  1D09 B;  4E7K A;  2KYB A;  2J6F A;  5CKH A;  4IIO A;  1KHI A;  4MML A;  2K3X A;  2CZ0 B;  3LLR A;  3QXE B;  2DLP A;  1MMA A;  4PJO B;  4OGE A;  4PFO A;  5I21 A;  4M7D B;  1WX6 A;  3EG1 A;  3QHS A;  2EQM A;  2IIM A;  5KE3 A;  2A37 A;  2CZ7 B;  1VQL Q;  3CCQ T;  2R57 A;  4X34 A;  2RI3 A;  3CCS Q;  5LJ5 j;  2VVK A;  3EH1 A;  5HK3 A;  5GMK e;  3I55 T;  2RHX A;  1HSQ A;  2EJG A;  4E7L A;  1VQ4 A;  3CCR Q;  3CCE Q;  2KRN A;  1KC8 C;  2OTJ A;  1N6A A;  1NBE B;  2YRC A;  1EFN A;  2SEM A;  5I11 A;  2D0N A;  2PUO B;  1HYO A;  1YIT T;  1VIF A;  2KT8 A;  1VUB A;  1P92 A;  1VQP Q;  3QPH A;  4XU3 A;  5GAM g;  2MF2 A;  3OBW A;  2HEQ A;  2DD4 A;  3QDR B;  2RH2 A;  2KEA A;  1NJI C;  3I5S A;  1D1A A;  4M75 B;  2QQ9 A;  1PSE A;  1TWB A;  3P8B B;  1CSK A;  1ZSZ A;  1M3A A;  4Y28 E;  1HJD A;  4CC4 B;  4CC2 A;  4J6Y A;  2XIC A;  2K3B A;  3JSC A;  3OS1 A;  2GF7 A;  2CSI A;  2QA4 A;  2QQB A;  2NUT B;  5LJ3 g;  1TH7 A;  3OYJ A;  2KBT A;  4MDX A;  1MMN A;  3H6Z A;  1E6G A;  3VS1 A;  3CEY A;  5FWC A;  2EFI A;  1UGS B;  1UHC A;  4J5Y A;  3VS6 A;  3CD6 Q;  2QQA A;  1WHH A;  3RBB B;  2DK3 A;  1NYF A;  3OYK A;  5C0M A;  4J8O A;  3OB9 A;  1OPK A;  5AYF A;  2FPE A;  2RHY A;  1QMC A;  5GAM f;  2CYZ B;  3QJ6 A;  1RAA B;  5IN1 A;  4Z8A A;  3AHU A;  1T0J A;  2OJ2 A;  3UAT A;  3PMI A;  3I9Q A;  3G6E T;  5LJ3 h;  4J6X A;  4XAX B;  3CCL T;  3H0H A;  4KGX B;  1VQK A;  3JCM e;  4ZGJ B;  2AIR B;  1VQ6 Q;  1NG2 A;  3SB2 A;  5J26 A;  3M0U A;  1VQM Q;  2KR3 A;  4BE2 A;  2CT3 A;  2X4J A;  3CC2 Q;  5CK9 A;  2C0T A;  2MMP A;  1BIB A;  1YN8 A;  4JS5 A;  4MZP A;  2KT1 A;  5LJ3 f;  1K1Z A;  3C95 A;  2CP0 A;  3JCM V;  2E64 A;  4HVW A;  3O5Z A;  7AT1 B;  1BK2 A;  1B07 A;  3JCM d;  5GAN j;  2G6F X;  1K9M C;  1VQ5 A;  2K79 A;  3VS4 A;  4L6V 5;  2E10 A;  1T3S A;  4C8Q G;  3SWN C;  3JB9 D;  4PJO D;  1B7T A;  1OZ2 A;  5HCK A;  4J6W A;  2SRC A;  4J9C A;  2EQK A;  3M0P A;  4M7D D;  3OYF A;  1AD5 A;  2CSQ A;  3RKW A;  2FL7 A;  1GL5 A;  4FM4 B;  1KSW A;  2Z0W A;  2RQR A;  4DOW A;  5GAO r;  2OAU A;  1W2B A;  2DMO A;  4N4H A;  2EGA A;  3LYI A;  3OY9 A;  2A28 A;  4BI4 A;  4AFS C;  2EVR A;  2ED0 A;  1RLP C;  4N4I A;  4M77 A;  2ROT A;  1IRE B;  2AT1 B;  2CH4 A;  3MEA A;  3OMC A;  4X9D A;  4AT1 B;  1HXD A;  4FL6 A;  1IRX A;  1ZBX A;  2P0K A;  2EYQ A;  1UEB A;  3A8M B;  5CKE A;  4PJL A;  4BB7 A;  3VYH B;  1JBM A;  5FU6 C;  1VQO A;  4LUE A;  4F7U A;  4A4G A;  1LNX A;  3QZ9 B;  4PFP A;  2DVJ A;  3S3N A;  3RMS A;  2QEX Q;  2PQW A;  4M75 D;  1IB8 A;  1ZX6 A;  2MOX A;  1YJW T;  4C92 B;  1OYX A;  1YWO A;  5KYY B;  2E1H A;  2R5A A;  3M54 A;  2VWF A;  5KYU A;  1RLQ C;  1ARK A;  1VQ6 A;  1OOT A;  3C12 A;  3CCU Q;  1X6O A;  4OMQ A;  5HKC A;  4BDY A;  2CGH A;  1I5L A;  1SHG A;  1Y96 A;  2PU9 B;  1FMK A;  2QGG A;  4J7F A;  2KY9 A;  4ME7 A;  2Y4X A;  5J3B A;  1VQL T;  2CZ1 B;  3JV3 A;  2V26 A;  4C0F A;  3CCS T;  5CCA A;  1Q82 U;  1W2B P;  3G1J A;  2O9S A;  2HQX A;  2EGE A;  3CC7 Q;  4ELY C;  5AT1 B;  2CP5 A;  1VQN A;  3CCE T;  1PC0 A;  3URG A;  1RAC B;  1K73 R;  4PNO A;  1U5S A;  5FU7 C;  1PHT A;  1KFZ A;  2DL4 A;  1VQP T;  2E6Z A;  2HKQ B;  2XID A;  4LDV A;  3JB9 H;  2YHT A;  3M9Q A;  3CPW A;  2HDA A;  4C8Q B;  1JO8 A;  4EMG A;  1SHF A;  1SRL A;  2JS2 A;  4JZ3 A;  4A4K A;  3OS5 A;  3LWH A;  3FJ5 A;  1JJ2 S;  3BY7 A;  3L42 A;  3N5B B;  1YCY A;  1MNE A;  1Y7X A;  4UC4 A;  1K76 A;  2QAZ A;  4WF2 A;  1WJQ A;  3GOX A;  5GAN 2;  2JM8 A;  3M0R A;  3CXC A;  1M90 C;  1KC8 R;  2DZC A;  1Q81 R;  1MGQ A;  4PJM A;  1VQ8 A;  2RA2 A;  3ULR B;  1IXD A;  3PIO A;  3G71 A;  5CAI A;  3CCJ Q;  2DL5 A;  4LDU A;  2M02 A;  3H8Z A;  4PKC C;  4QVC A;  2DXB A;  1VQ7 A;  1RL2 A;  2OTL Q;  3OYD A;  1NJI R;  1M3C A;  1ZHI A;  1YHQ Q;  2M1H A;  2XDB A;  3CD6 T;  2JOY A;  4JZ4 A;  1YI2 Q;  2O01 E;  1TSF A;  2O31 A;  3CBM A;  2CP7 A;  3CCV A;  2C06 A;  2D6F A;  4JRI A;  2QXF A;  2GFU A;  2FHD A;  5HY6 A;  1WI7 A;  2AHJ B;  1K0X A;  3OYG A;  5GMK i;  5IHN A;  4F17 A;  2JVV A;  2QQS A;  2JJ9 A;  3GIB A;  2K5F A;  5GAN h;  4DA4 A;  1NPR A;  2JNG A;  2NUP A;  3HRS A;  2X3X D;  2OI3 A;  2ZAE A;  3SWN A;  1BU1 A;  5IAY A;  1ZSZ B;  4J9I A;  3CPW P;  2LQW A;  3PT9 A;  1ZBJ A;  1QKX A;  2O2O A;  3EH2 A;  1VQM T;  4EMK C;  3R6N A;  5HK0 A;  3PMT A;  1PG5 B;  3CC2 T;  3RR6 A;  4R55 A;  3SD4 A;  1KQ1 A;  4B6M A;  4JDS A;  3V7C A;  4HCC A;  2YLB A;  4C92 D;  2FRY A;  3CME A;  1UUE A;  3JB9 J;  1EZZ B;  2L89 A;  4M7A A;  4RTV A;  1ZA1 B;  4OGC A;  2DET A;  1WHG A;  2NYS A;  2RQV A;  2ROL A;  3S3O A;  1YP5 A;  1AWO A;  4CRI A;  2FZC B;  2VGN A;  1WPY A;  2K5I A;  2E12 A;  2RNA A;  2YRV A;  1RI9 A;  2L2P A;  5FRM A;  3GNF B;  3CC4 T;  1V29 B;  1M5Q 1;  2KGT A;  4EDU A;  5LJ5 e;  1U06 A;  1TUD A;  2A0F B;  3VRZ A;  4J9H A;  1BCM A;  1WNL A;  1R8O B;  4JS4 A;  3JB9 G;  1QCO A;  1S72 Q;  1KD1 R;  2JUF A;  1WIE A;  3CCQ A;  4M7D G;  4GLM A;  2RQU A;  1D0Y A;  4BE1 A;  1K9M R;  2DD5 A;  2KMT A;  5GAM j;  2XK0 A;  3F70 A;  3EGD A;  4IKF A;  5KCO A;  3A8G B;  3OQ5 A;  3I55 A;  1YIJ Q;  3L2Z A;  1N5Z A;  3ME9 A;  4IIM A;  4XK8 E;  2LT1 A;  3SEM A;  3EG0 A;  4HVU A;  1LOJ A;  1UB4 A;  1X69 A;  1YIT A;  2QEX T;  3E9G A;  4IUR A;  1AVZ C;  1ABO A;  3M58 A;  4E6R A;  4FT4 A;  4FSS A;  4E2F B;  4A53 A;  4HCZ A;  3NTK A;  5LJ3 j;  2PNI A;  3CCU T;  1WQW A;  2HSP A;  2LT4 A;  2O4X A;  2OX7 A;  1ACM B;  3JCM Q;  2FB7 A;  3U23 A;  3GNG A;  1VYU A;  5FLX E;  2LX7 A;  4M75 F;  5A0G A;  1ZUY A;  1Q86 R;  4NOY A;  1LPL A;  4OB1 B;  4OF1 A;  1I4K 1;  3M57 A;  2P0Q A;  4M77 B;  2K7A A;  2FO0 A;  2XDP A;  3HRU A;  2PVG B;  1GFC A;  3MP1 A;  3CC7 T;  1SRM A;  3ZFJ A;  4DBH A;  2LNV A;  1K8A U;  2E3H A;  1K73 U;  2ZPF B;  4F7U B;  3MEV A;  4ZN1 A;  1WXU A;  1W4S A;  4BY6 B;  3E1S A;  3NGP A;  3RMQ A;  3QYH B;  1C1A A;  2K9G A;  2QAS A;  4RMO A;  2EGC A;  4DBF A;  3OYC A;  4PJO E;  2XI9 A;  1YJN T;  1A0N B;  1Q7Y C;  1QWE A;  5GJV B;  4ELZ C;  4M7D E;  1JU5 C;  3E2U A;  4LE9 A;  4OB2 B;  5KYU B;  3UT1 A;  3VV0 A;  2I2L A;  3S3M A;  2J6O A;  4A63 B;  2YSQ A;  5KCH A;  3G6E A;  2BZ8 A;  2KK4 A;  4PJN A;  3CCL A;  1EIF A;  2HCK A;  4AFU C;  1AWJ A;  4C0Z A;  5D7U A;  2DA9 A;  1Y96 B;  2ZPG B;  4FYV B;  4A4H A;  8AT1 B;  1Q81 U;  1X27 A;  4ANJ A;  1U1S A;  2KXD A;  1AZG B;  1KQS P;  3T9N A;  3WXM B;  5GAN e;  3ZEH A;  3CCJ T;  5C6S A;  1QVF S;  4XTW A;  1TXQ A;  1RUW A;  3HSB A;  4M78 D;  2OAW A;  2OTL T;  1BI0 A;  2DIQ A;  1AWX A;  1BCO A;  2D9T A;  2DL7 A;  5A2Q E;  1YHQ T;  4M7A G;  1KK7 A;  2EYZ A;  2KRM A;  1VYV A;  4J9D A;  2LRQ A;  1BI2 A;  1YI2 T;  4EMK A;  3EGU A;  5GAO l;  4RCB A;  3ASK A;  5GAN d;  4PL6 A;  4M75 E;  2V1R A;  2BIV A;  5FRO A;  2KE9 A;  3X25 B;  2LP5 A;  1AEY A;  3OMG A;  3DLL A;  2DZ9 A;  3INZ A;  1PM3 A;  1Y71 A;  1X43 A;  1X2Q A;  3V8L A;  2J06 A;  1OX8 A;  1X01 A;  1OU8 A;  2CT4 A;  4KGV B;  4F04 B;  1M1K U;  2I0N A;  5DM7 R;  4ZGD B;  1XTD A;  3CCM Q;  2MWP A;  1M4Z A;  2QTV A;  3FRN A;  3TU4 K;  3LWI A;  2F2X A;  1FX7 A;  1ZA2 B;  1D1C A;  1Y0M A;  1XNI A;  1M30 A;  4ATO A;  2RF0 A;  4PK4 A;  4BAC A;  1BIA A;  2DPP B;  1JXO A;  4R56 A;  4JRK A;  1I8F A;  2H8H A;  1W1F A;  1FXX A;  3M53 A;  3X20 B;  4QVD A;  1AWW A;  1MMD A;  2FRW A;  1YJW A;  2RD1 A;  3HKS A;  5GAM h;  3JCM X;  4XQ3 A;  1KG1 A;  1IO6 A;  1XJW B;  2AKL A;  3REB B;  1K9A A;  4DEY A;  4KUI A;  4C92 G;  4ESR A;  3OYA A;  2LNH B;  4M78 A;  1M8M A;  4M77 D;  1RAB B;  4OP0 A;  1RAG B;  2LVM A;  1MUZ A;  1WYX A;  2KNB B;  3JCM P;  2NUP B;  4E7H A;  1NLO C;  1QCF A;  4N4G A; 
#chains in the Genus database with same CATH homology
 2YLC A;  1S72 T;  3SWN B;  5CR2 A;  1KD1 U;  4J7F A;  2KY9 A;  5GAN f;  1VQL A;  1PSF A;  4ME7 A;  2Y4X A;  1VIE A;  2EAY A;  5J3B A;  1VQL T;  2E41 A;  2CZ1 B;  3JAM E;  3CCS A;  1WJR A;  2GQV A;  4C0F A;  4N0A C;  3CCS T;  2XD0 A;  3UWN A;  5CCA A;  2M0O A;  1Q82 U;  4C0D C;  3FLG A;  3CME T;  1QVP A;  1G3Y A;  2XU8 A;  1N8R U;  1YIJ A;  1KC8 U;  2HQX A;  3RER A;  2VYT A;  2LTO A;  1YIJ T;  2DIG A;  4RKU E;  4ELY C;  3CCR A;  4HA8 A;  2MWO A;  3CCE A;  3HRT A;  2RO0 A;  1VQN A;  2MI6 A;  3CCE T;  1QW1 A;  3URG A;  1VQN T;  4PNO A;  5FU7 C;  2F69 A;  3BFM A;  3TEE A;  5GMK l;  4QQG A;  4JRP A;  3VYG A;  1VQP A;  4M7A B;  2Y4Y A;  1VQP T;  1K8A C;  2E6Z A;  5LL6 S;  1K73 C;  1NJI U;  2XID A;  4ZN3 A;  4LDV A;  3JB9 H;  4LD6 A;  3J81 E;  4M7A F;  2YHT A;  3LGL A;  3JCM c;  1N27 A;  3M9Q A;  3CPW A;  4JJN K;  4RG2 A;  1G5V A;  2DTI A;  4C8Q B;  1NZ9 A;  3V7S A;  1G3S A;  2X4Y A;  4EMG A;  1LJO A;  3RUX A;  5DLO A;  5FU6 B;  4C8Q F;  4EPC A;  3OA6 A;  4A4K A;  2FVU A;  4PJO G;  4CI0 C;  3OS5 A;  3LWH A;  3QSU A;  5GAN 7;  1JJ2 S;  3V7R A;  3BY7 A;  3R6O A;  4BY6 C;  3L42 A;  5I2S A;  2KVQ G;  2PVO B;  2RI2 A;  3N5B B;  3OSS C;  2ZPH B;  3CPF A;  1YCY A;  5CKB A;  4Z02 A;  1Y7X A;  2DJZ A;  2HD0 A;  3M4Y A;  4UC4 A;  1Q86 U;  1D3B B;  4B9W A;  4WF2 A;  4EMH A;  3OYH A;  1WJQ A;  2XDD A;  4IUP A;  4RG8 A;  3GOX A;  1DJ7 B;  5GAN 2;  1M1F A;  2P4T A;  1IZ6 A;  4M77 E;  3CXC A;  1M90 C;  2DZC A;  5LJ5 d;  1MGQ A;  2ZPB B;  3VKI A;  2VC8 A;  3L2W A;  1VQ8 A;  2L3R A;  2MAM A;  3HFO A;  5D6X A;  1VQ8 T;  2RA2 A;  5GAN 8;  4C8Q D;  3BDL A;  2VGM A;  4M78 C;  3PIO A;  2CS7 A;  2F5T X;  3G71 A;  5CAI A;  1Q81 C;  4LDU A;  3A8O B;  5KE2 A;  3G71 T;  3H8Z A;  3EFR A;  4PKC C;  4QVC A;  2DXB A;  5CKD A;  3A8H B;  1VQ7 A;  2E5Q A;  1RL2 A;  3Q1J A;  1VQ7 T;  3L2V A;  4F7U E;  3DB3 A;  3OYD A;  4C5E A;  3L2Q A;  1ZHI A;  3CD6 A;  2M9U A;  3RKY A;  2M1H A;  3M55 A;  3X24 B;  2XDB A;  3CD6 T;  4PJO C;  2JOY A;  3KXT A;  1Q7Y U;  4A4F A;  2O01 E;  1SSF A;  4Q5W A;  4FU6 A;  2DEQ A;  4FSX A;  4PLL A;  3CBM A;  4KT0 E;  2KAF A;  4NL2 A;  5M9O A;  1AHJ B;  3LGF A;  4C0D B;  3CCV A;  3M59 A;  4C92 A;  2K2V A;  3CCV T;  4JRI A;  2C06 A;  3PNW C;  2D6F A;  3X26 B;  3E19 A;  3E9F A;  4IUT A;  2QXF A;  2GFU A;  5D6Y A;  2K3Y A;  1KQS S;  4J83 A;  2FHD A;  5HY6 A;  2V8K A;  3QKJ A;  4LDW A;  2AHJ B;  4OVA A;  5DLQ E;  5A0D A;  3OYG A;  4BI8 B;  5GMK i;  4M75 G;  2RJD A;  2DKG A;  1G3W A;  4KUD K;  3JCM h;  1ZQ1 A;  2RK2 A;  4A4E A;  5FU7 B;  4GY5 A;  2JVV A;  2QQS A;  2O4X B;  5GAO q;  2DXC A;  4JLG A;  3GIB A;  4E47 A;  2K57 A;  2K5F A;  4OB0 B;  5GAN h;  4DA4 A;  1NPR A;  2JNG A;  1YBY A;  4O6J A;  3CBO A;  5GAO p;  5CVI A;  1XQH A;  4C92 F;  4JRQ A;  3HRS A;  2WAC A;  3LX7 A;  2RHZ A;  3QG1 A;  3SWN A;  5IAY A;  2EQU A;  5GAO m;  3OYM A;  3SFM A;  3LH0 A;  4M7D C;  1M1G A;  3A8L B;  4II1 A;  3OW2 S;  5CO7 A;  3PT9 A;  3TRE A;  2E6N A;  2RJE A;  1I81 A;  1VQM A;  3SDZ A;  3CC2 A;  1VQM T;  4JLI A;  4EMK C;  2E70 A;  4D6W A;  5HK0 A;  3PMT A;  3CC2 T;  2VXF A;  3CBP A;  1G3T A;  4R55 A;  4FT2 A;  2D0Q B;  4KBM B;  4C5H A;  3BDU A;  1M1K C;  1N9R A;  4M7A E;  3SD4 A;  1KQ1 A;  4JUV A;  3NTI A;  4TVR A;  1K9M U;  1KQ2 A;  1H3Z A;  4JDS A;  2XHC A;  3V7C A;  2YLB A;  4C92 D;  4HCC A;  3VJP A;  3CME A;  2EQJ A;  4BUG A;  2LX9 A;  5DY9 A;  2RB6 A;  4C8Q E;  3JB9 J;  4M75 C;  2KSS A;  2L89 A;  4M7A A;  2ZGW A;  2CZ6 B;  3O8V A;  4OGC A;  3UDC A;  2LDM A;  2Y90 A;  5LJ5 f;  3NFC A;  1VQ9 A;  3S3O A;  1QVF A;  3S6W A;  1VQ9 T;  2RHI A;  1QVG S;  4MZT A;  3G4S A;  4MDW A;  1NE8 A;  4C8Q A;  2ZZD A;  4CRI A;  3GP8 A;  2VGN A;  2VV5 A;  1WPY A;  3G4S T;  1U8R A;  4M77 C;  1O9S A;  4L5G A;  2K5I A;  2E12 A;  5CQY A;  5L8R E;  5I2M A;  2DO3 A;  2YRV A;  2RHU A;  4M78 G;  2LCC A;  3QJY A;  1JB0 E;  4E7K A;  5CKF A;  4BE0 A;  1HK9 A;  4DOV A;  3GNF B;  5FRM A;  3CC4 T;  5CKH A;  2IVW A;  4MMK A;  1V29 B;  1KHI A;  4OMF B;  1MHN A;  1M5Q 1;  2K3X A;  4MML A;  5GAM e;  2CZ0 B;  4A54 A;  1UGQ B;  5A0L A;  3LLR A;  2X4X A;  3QXE B;  4EDU A;  2CKK A;  4QQD A;  5LJ5 e;  4PJO B;  4V2S A;  1WQ7 A;  3LW5 E;  1D3B A;  2NLU A;  1WNL A;  4OGE A;  1JJ2 A;  1R8O B;  3MO8 A;  4FIB A;  4JS4 A;  5I21 A;  4M7D B;  2DTO A;  3CCM A;  3JB9 G;  3DB4 A;  2JZ2 A;  3MET A;  3CCM T;  2JUF A;  3QHS A;  4DQ2 A;  2BUD A;  1OI1 A;  2EQM A;  5EG2 A;  3CCQ A;  4M7D G;  5KE3 A;  2CZ7 B;  3PFS A;  2HAX A;  4XTZ A;  3CCQ T;  4BE1 A;  3JB9 I;  2L5Q A;  2R57 A;  2DD5 A;  3GF5 A;  4X34 A;  2KMT A;  3OYB A;  4BDZ A;  5GAM j;  3JCM J;  2RI3 A;  1M9S A;  2XK0 A;  4QVZ A;  1KD1 C;  5LJ5 j;  2VXE A;  3F70 A;  2FYK A;  4M7A D;  4IKF A;  2JTM A;  2QI2 A;  5GAM d;  2F5K A;  4O5V A;  5KCO A;  3A8G B;  3FEO A;  3OQ5 A;  5HK3 A;  3I55 A;  3L2Z A;  3ME9 A;  5KH6 A;  5GMK e;  3OYY A;  3RIR A;  3I55 T;  2RHX A;  4XK8 E;  1Q82 C;  2EJG A;  4E7L A;  2LT1 A;  1VQ4 A;  5LJ3 e;  1N8R C;  3QUI A;  3L2U A;  1KC8 C;  1VQ4 T;  2OTJ A;  1LOJ A;  1UB4 A;  1N6A A;  2DTH A;  2QEX A;  3UPU A;  1YIT A;  2OTJ T;  2R5M A;  2QEX T;  2PUO B;  4HKE A;  4LDX A;  3OSV A;  1YIT T;  1BI3 A;  1VIF A;  1VUB A;  2BKD N;  1P92 A;  2ZPI B;  4EMK B;  3E9G A;  4C92 E;  3QPH A;  4IUR A;  1B34 B;  4XU3 A;  3KUF A;  5GMK j;  5GAM g;  3M58 A;  3OBY A;  2MF2 A;  3PGG A;  5LJ5 g;  4FT4 A;  5FRN A;  2RM4 A;  3OBW A;  4A53 A;  2DD4 A;  3QDR B;  3NTK A;  4HCZ A;  5LJ3 j;  3CXC S;  1W2B S;  2RH2 A;  3CCU A;  2IG0 A;  1NJI C;  3CCU T;  1WQW A;  2LT4 A;  5LJ3 d;  2O4X A;  3TCJ A;  1UGR B;  3GPL A;  2HBP A;  4M75 B;  3G7Z A;  3J80 E;  2QQ9 A;  1PSE A;  2RK1 A;  2QDY B;  1BI1 A;  2FB7 A;  2ZPE B;  2R58 A;  3FIF A;  3GNG A;  3P8B B;  3QO3 A;  4MZM A;  1XOV A;  5GMK m;  4M7A C;  5FLX E;  4M75 F;  1O75 A;  5A0G A;  3A5Z B;  4NOY A;  4Y28 E;  3HPW A;  4ZTJ A;  2E65 A;  4OB1 B;  2VUB A;  4OF1 A;  1I4K 1;  3EFS A;  3M57 A;  5GAN 4;  3KBG A;  4J6Y A;  4L59 A;  4C8Q C;  2P0Q A;  4M77 B;  2XIC A;  1YJ9 A;  3QII A;  3OYN A;  2PUK B;  1Q86 C;  3JSC A;  3OS1 A;  2GF7 A;  1YJ9 T;  3OW2 A;  2V8I A;  2QA4 A;  3RES A;  2QQB A;  2XDP A;  4M77 G;  5LJ3 g;  1TH7 A;  3X28 B;  3JCM b;  4IUQ A;  3OYJ A;  3HRU A;  2PVG B;  3CC7 A;  2QA4 T;  1BYM A;  3MEU A;  3MP1 A;  3H6Z A;  3ZFJ A;  3CC7 T;  2HNI A;  4MDX A;  3CEY A;  2EFI A;  2LNV A;  3CMA A;  1N9S A;  4BD3 A;  3P8H A;  1K8A U;  2GFA A;  1UGS B;  3CMA T;  3OS0 A;  1K73 U;  4J5Y A;  2ZPF B;  4XTU A;  1X75 C;  5LJ5 h;  4RCC A;  4LDY A;  3JCM Q;  1JRI A;  3MEV A;  4F7U B;  5J39 A;  4KUL A;  4ZN1 A;  1W4S A;  4ZGE B;  3HL8 A;  4BY6 B;  3OYI A;  1H64 1;  3E1S A;  2QQA A;  2A7Y A;  4OB3 B;  4F7U G;  1Y07 A;  2DK3 A;  3RMQ A;  3QYH B;  3OYK A;  5C0M A;  2EJ9 A;  3VUB A;  4J8O A;  4RMO A;  1YJN A;  2LC4 A;  3OB9 A;  2XI9 A;  3OYC A;  4PJO E;  1YJN T;  3MP6 A;  5AYF A;  4ZTF A;  1Q7Y C;  2RHY A;  3HHT B;  1U1T A;  4M7D E;  4ELZ C;  3OYL A;  1WJS A;  5GAM f;  1QVG A;  2CYZ B;  2M16 A;  2WSF E;  2X4W A;  3QJ6 A;  4OB2 B;  5IN1 A;  3UT1 A;  3VV0 A;  2I2L A;  2LQ8 A;  3AHU A;  3S3M A;  4M78 B;  2RJC A;  3JRZ A;  5IT9 E;  5KCH A;  3G6E A;  3FJP A;  5GMK h;  4PJO A;  3M4G A;  1M90 U;  3PMI A;  3QYG B;  3G6E T;  3MP8 A;  2KK4 A;  4M78 F;  3CCL A;  1EIF A;  1QP3 A;  5LJ3 h;  4J6X A;  4XTY A;  4HT8 A;  4M7D A;  3M56 A;  4XAX B;  4C0Z A;  3CCL T;  3CC4 A;  1Y96 B;  3WVD B;  2ZPG B;  2P0P A;  4A4H A;  5GAN 3;  1VQK A;  4C5I A;  2H3J A;  3HP9 A;  4ZGJ B;  3JCM e;  3OYE A;  1Q81 U;  1U1S A;  5J26 A;  3SB2 A;  1VQK T;  4J7I A;  3T9N A;  1GXI E;  3M5A A;  3WXM B;  5GAN e;  3CCJ A;  3CCR T;  4HCB A;  2DAQ A;  4BE2 A;  3ZEH A;  1KHC A;  2X4J A;  4NL3 A;  4PJO F;  3CCJ T;  3P8D A;  2V8J A;  5C6S A;  4C92 C;  3JB9 F;  5CK9 A;  2MMP A;  1BIB A;  3C4S A;  4P5N A;  4XTW A;  4XTX A;  4JS5 A;  2QQR A;  4MZP A;  3ER0 A;  5LJ3 f;  1QVF S;  4M7D F;  5GAO n;  2OTL A;  2LQK A;  4M78 D;  3HSB A;  2WSE E;  3FC3 A;  3C95 A;  3QZ5 B;  2OTL T;  1YHQ A;  1BI0 A;  2DIQ A;  3QBY A;  2DXU A;  2DXT A;  1WGS A;  2D9T A;  2E64 A;  3JCM V;  5A2Q E;  1YHQ T;  4M7A G;  3DKM A;  1YI2 A;  4X9C A;  3JCM d;  5GAN j;  2LRQ A;  1BI2 A;  1YI2 T;  1K9M C;  2K4Y A;  4EMK A;  1VQ5 A;  3CPW S;  5GAO l;  1VQ5 T;  2EIF A;  2HQE A;  3ASK A;  4L6V 5;  2E10 A;  4RCB A;  5GAN d;  2QTX A;  5D6W A;  1B34 A;  2K5L A;  4C8Q G;  4PL6 A;  3ZBD A;  4M75 E;  3SWN C;  3JB9 D;  4PJO D;  4IUU A;  1OZ2 A;  4VUB A;  4J6W A;  2BIV A;  4Y91 A;  5FRO A;  4BI3 A;  4XU1 A;  2EQK A;  4M7D D;  4LD9 K;  3RKX A;  3L1A A;  4N0A A;  3X25 B;  3OYF A;  3RKW A;  2FL7 A;  3GLX A;  1OZ3 A;  4NS5 A;  3OMG A;  3DLL A;  2DZ9 A;  4FM4 B;  3INZ A;  2KQW A;  4M75 A;  1UGP B;  4DOW A;  1Y71 A;  2OAU A;  5GAO r;  1W2B A;  3JCM g;  2EWN A;  2G3R A;  3V8L A;  3V8J A;  4N4H A;  3LYI A;  3OY9 A;  1X01 A;  3DLM A;  4BI4 A;  3HFN A;  5GAN g;  2JN0 A;  4GLK A;  1KQS A;  2WSC E;  2RI5 A;  4N4I A;  1M1K U;  4M77 A;  1IRE B;  5DM7 R;  4ZGD B;  1XTD A;  3MEA A;  2L8D A;  4C5G A;  2GCX A;  1NPP A;  2MWP A;  2X35 A;  3OMC A;  4X9D A;  1M8V A;  4E7J A;  1HXD A;  4FL6 A;  1M4Z A;  1ZBX A;  2DVE A;  4PLI A;  3FRN A;  2P0K A;  3TU4 K;  3LWI A;  4E7I A;  3MEW A;  1FX7 A;  2A3L A;  2EYQ A;  1UEB A;  4QW2 A;  4XTV A;  1XNI A;  3A8M B;  3L2R A;  3EAE A;  5CKE A;  4ATO A;  3I56 A;  2EJF A;  2LCL A;  4BAC A;  1QP2 A;  1BIA A;  2DPP B;  3I56 T;  4BB7 A;  3VUZ A;  3VYH B;  1JBM A;  2XKO C;  5FU6 C;  4C0G A;  1VQO A;  3FDR A;  4M77 F;  4R56 A;  4IUV A;  4JRK A;  4F7U A;  1VQO T;  3VU3 C;  1I8F A;  4A4G A;  1LNX A;  2EKO A;  3WVE B;  3QZ9 B;  5CQX A;  4XU2 A;  3S3N A;  1FXX A;  2XG8 D;  3M53 A;  3RMS A;  3X20 B;  4B9X A;  4QVD A;  2PQW A;  4M78 E;  4M75 D;  1YJW A;  2RJF A;  2RD1 A;  3HKS A;  5GAM h;  3JCM X;  1YJW T;  2PVD B;  1FWZ A;  4XQ3 A;  3FB9 A;  4C92 B;  1KG1 A;  1OYX A;  3OS2 A;  3C94 A;  2E1H A;  4XU0 A;  4KUI A;  3V8K A;  5CIU A;  2R5A A;  3M54 A;  4C92 G;  4F7U F;  3OYA A;  3MCA B;  1VQ6 A;  4M78 A;  4M77 D;  4OP0 A;  3C12 A;  1RI0 A;  1BKB A;  3BW1 A;  1VQ6 T;  2LVM A;  1X6O A;  2ZCF B;  3PIP A;  5HKC A;  3JCM W;  4HT9 A;  4YTL A;  3J7A F;  3MHX A;  4BDY A;  2CGH A;  5GAN 6;  3NTH A;  3PTA A;  3JCM f;  1I5L A;  2JTF A;  2KDS A;  3JCM P;  4E7H A;  1Y96 A;  4QQ6 A;  5GAN 5;  1S72 A;  2PU9 B;  2B8A A;  4N4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...