2K4YA

Nmr structure of feoa-like protein from clostridium acetobutylicum: northeast structural genomics consortium target car178
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
86
structure length
86
Chain Sequence
MTKGIGLNEVEIKSKVKVIGIVPESKVRRKIMDMGIVRGTEIYIEGKAPMGDPIALRLRGYSLSLRKSEAKDILVEVLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords FeoA-like protein
publication title NMR Structure of FeoA-like protein from Clostridium acetobutylicum: Northeast Structural Genomics Consortium Target CaR178
rcsb
source organism Clostridium acetobutylicum
total genus 16
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k4yA00
1BYMA 1FWZA 2LX9A 2QQ9A 1BI2A 2H3JA 2GCXA 2K5LA 1FX7A 3E19A 4O6JA 2QQAA 1QW1A 3HRTA 3GLXA 1BI0A 5CVIA 1G3SA 1U8RA 1QVPA 1BI1A 1G3YA 3HRUA 1P92A 1BI3A 2K5FA 2QQBA 1G3WA 4O5VA 1G3TA 3HRSA 3MHXA 2K5IA 2K4YA
chains in the Genus database with same CATH superfamily
2K2VA 3QYHB 2DXTA 2AIRB 1VQKA 4Z89A 2QEXT 2K3XA 3E9GA 5IT9E 2RQWA 4RMOA 4B9XA 5GMKj 2VWFA 1QKWA 3QKJA 1HSQA 3EG9B 2DM1A 4DBQA 1BK2A 2CH4W 3OW2S 1K73C 2A28A 1Q7YU 2RO0A 4IIMA 3HPWA 3CCST 4M77C 3OYDA 1VQ6T 3FB9A 3GBQA 1YITA 1BB9A 1X43A 4HVUA 2F2VA 5CKDA 4M7DC 1UE9A 4OB0B 3X25B 1C6VX 1Y71A 4JPBW 1W2BA 5HCKA 3CC2T 5IHKA 1O9SA 3LW5E 2ZPGB 3M0QA 4RTVA 3OY9A 1U5SA 3CCLQ 3V7SA 2WACA 3OYNA 2JVVA 2BZYA 1AOJA 3OBYA 5CR2A 1QVGS 1VYUA 2OJ2A 1QQJA 1YJWA 2OTLQ 4A63B 3P8DA 1Q81R 1I4K1 3M4GA 1IGUA 4N4HA 5C6SA 3A5ZB 2DBKA 2LNHB 1YJNT 3PVLA 2CSQA 2VGMA 1Y07A 3JCMe 1QWFA 5CQYA 1IO6A 4XTXA 2QEXA 2KXDA 3CC7Q 1S72T 2Y4YA 3CMAQ 4F16A 1RAFB 1HXDA 3CC4Q 3OS5A 1RAHB 2RPNA 1K4US 3RKWA 4A4GA 3PFSA 2GGRA 3X24B 1TG0A 1ZSZC 3L1AA 3OMCA 4QQGA 2XDBA 4DA4A 5HK3A 2I0NA 2KI7A 3I55Q 1BBZA 4M75D 2K2MA 2MYSA 3OYAA 1N27A 2RQVA 1AD5A 1VQNT 3JCMW 5D6XA 1M2VA 5GAMf 2CZ6B 2PVDB 1M4ZA 2RF0A 3SEMA 3CCUT 1Y57A 2RD1A 3LX7A 3C94A 5LJ5h 4M75F 4J6XA 2HKNA 4KULA 3G4SQ 3CEYA 3G6ET 4RCCA 4RTYA 2EBPA 1UECA 1ZSZA 2CT4A 5A0LA 1OQKA 1G8XA 1KFZA 3RKYA 2X4YA 2VUBA 1YJNA 3G71Q 3CD6A 4C8QA 1WIEA 1W6XA 3A8LB 5KYXA 4RUGA 4RKUE 3J7AF 2ZPEB 4E6RA 2RJCA 1X6BA 5AYFA 4Y28E 1UHCA 1OU8A 1N8RR 3QDFA 4JJNK 2E1HA 1X69A 1TUDA 2FPFA 1OPLA 2L8DA 2DD4A 2K9GA 5KH6A 5CIUA 3FJ5A 1KQ2A 2W0ZA 3LH5A 3CMEA 1BKBA 3M54A 3CCMQ 4BUGA 4IURA 2BUDA 3MEAA 5I21A 1Q86R 2BTTA 3ME9A 4J7FA 2LCSA 1LOJA 2LQKA 1WJSA 2KROA 1SHGA 2RB6A 3VUBA 3ZL7C 2CH4A 5AT1B 1KK7A 1PD1A 3OYEA 1YCSB 2NUTA 3CCUA 2PVGB 1A0NB 1Q7YR 1VQ8Q 1T0HA 3UA7A 4DOWA 2V1RA 1G3TA 2DXCA 2DYBA 3G6EA 2EWNA 4M7AA 1GCPA 2MWPA 4ESRA 1X75C 2KY9A 2RQTA 1NJIC 2M0YA 1SKUB 2KQWA 3CCVT 8ATCB 5J3BA 3IQLA 1JXMA 4BE2A 1N5ZA 1RADB 4C92C 2YHTA 1PKTA 3REBB 1LPLA 1MMAA 3JCMh 1N6AA 1K9MU 4KUDK 3SWNC 3Q1JA 3CCLT 4OGCA 4ZNXA 3CCQA 4LXCA 4FSSA 4M75E 4PKCC 4FW2A 2HD0A 2KGTA 2X3XD 1VQLQ 2MF2A 1XTDA 3M57A 1KC8R 2RHZA 2OTLT 3MJXA 3WXMB 4EMKA 3OYMA 2E41A 1AWOA 3A8OB 1JQQA 3EGDB 1WFWA 2OX7A 2H8HA 4OF1A 5ECAA 4XAXB 4B6MA 3CC7T 1X27A 3GF5A 3LGLA 3A8HB 3CMAT 4EPCA 3OYFA 1M1GA 4AT1B 1SHFA 4BB7A 3CC4T 2L3RA 3EGXB 3A8GB 2JN0A 3FDRA 1VQOQ 1U1SA 1NPPA 4JRQA 3ASKA 3CCVA 3VUZA 5IHIA 3X26B 2ZPFB 4HVVA 1GRIA 1MHNA 1B07A 1QVFA 1QLYA 3I55T 1TOVA 2X4JA 1SSHA 3FRNA 4LDUA 2RH2A 1X2KA 3DLMA 1YWOA 2PUOB 1VQKQ 1UFFA 3A8MB 3H9NA 3CCLA 3CBPA 4EMHA 2VYTA 1VYTA 4O5VA 3MEVA 2ATCB 5LJ5f 2GTJA 5LJ3e 4NL3A 4ME7A 2ECZA 2KR3A 1VQ5A 3G4ST 2I2LA 4ZTJA 1QCOA 3L2UA 3NTIA 5GAN5 2QQRA 1AHJB 2RI2A 4JJBA 2RM4A 4XK8E 4ELYC 5GMKh 2E5QA 1YITQ 4M78A 2BIVA 5FWCA 4N0AA 2V8JA 1HYOA 1ZSGA 3G71T 4NL2A 1TWBA 1NG2A 2M0OA 1YI2Q 3PNWC 2C06A 1H8KA 1WYXA 1Z9QA 2L0AA 3MP6A 4PJLA 5GJWB 1ZUYA 1ZBJA 1IREB 1WHMA 3CCJA 3L2VA 2FL7A 3CPWP 3CC4A 3META 1KSWA 4LE9A 2LCCA 5IAYA 2J6FA 1KD1U 2COZA 2XU8A 4LDXA 2K79A 4D8KA 1UGSB 1YJWQ 3CCMT 2LP5A 1U3OA 5DLQE 3I5SA 4Z88A 1T0JA 1FMKA 2IG0A 2DYIA 3VS2A 1R0CB 1UB4A 3JB9H 1VUBA 2DERA 3FC3A 1S1NA 3T9NA 1TH7A 3PT9A 1VQ8T 5KE2A 2R5AA 1TXQA 5GAN4 2EPDA 4K11A 4KGZB 2VB6A 4M77D 1CKBA 2XDDA 1WGSA 2OTJA 1PC0A 3QG1A 4IUPA 4M7DD 1M2VB 2HBPA 2M51A 4F7UA 2AKKA 4OB1B 2XK0A 1V1CA 1K9MR 4AFZC 4MZPA 4ZN3A 1Q81C 3TVTA 4LUEA 2FRYA 2QA4A 4M77F 1ZSZB 2HSEB 3M0TA 2B8AA 1CKAA 1VQLT 2KYMA 1IGQA 3OMGA 4C8QB 2D1XA 4RG2A 4E7HA 1CSKA 2Y4XA 4M75G 1Y7XA 4ZGDB 2J6OA 2FO0A 5A0DA 3VS1A 1JXOA 2RQUA 3SHWA 3NGPA 1AT1B 3P8BB 1YJNQ 2RHYA 2QXFA 3CD6Q 1IHVA 2ROLA 4XTYA 4JJCA 2YXYA 2ZPBB 1UDLA 2KDSA 3X28B 3VS6A 4J9EA 4HXJA 1G2BA 4KH1B 3JB9D 2ZZDA 2GFAA 1VQOT 2K3BA 4J9IA 4ELZC 5LJ3h 1NBEB 5CKFA 1R0BG 3CMEQ 4IUQA 4PJOC 4XU3A 1WHKA 2LRQA 1QKXA 5D6WA 5KYYA 2HSPA 4V2SA 3DKMA 2QQSA 3OYCA 3RR6A 4PFOA 2QK0A 3OS1A 2YLCA 1U8RA 2DTIA 1VQKT 4A4KA 1X01A 2RHXA 4C8QD 2LCLA 3OYJA 4M7AB 1M90U 3FIFA 2GTOA 2O4XA 5DY9A 3HFOA 2AT1B 3FEOA 2X3WD 2Z0WA 2QTVA 2KK4A 1VQPA 1XQHA 1WX6A 1N8RC 4PJOA 2EGAA 1M9SA 1YITT 9ATCB 1QMCA 5GAN8 3GIBA 2DLPA 1RAAB 3C12A 1YI2T 2MI6A 5LJ5d 3PTAA 2DL5A 1TUGB 3JCMX 5GAN2 1UGVA 2EQMA 1Q86C 4M7DE 4JRPA 1DJ7B 4EMKB 3JB9J 5GAN3 3CCQQ 3HRTA 1I5LA 1KD1R 4BD3A 1VQOA 2M9UA 1RACB 1TUCA 2BE9B 2KEAA 1YJWT 5LL6S 5D7UA 4IUUA 1WQWA 4KBMB 1WHJA 4M7AD 1T3LA 4N4GA 1Q7YC 1OYXA 1OI1A 2JUFA 1Q86U 2L3QA 1ACMB 1PHTA 2H3JA 2QQAA 1ZX6A 1WA7A 3ZEHA 1WNLA 2HCKA 1AWWA 1MV3A 3M53A 5J26A 3L2RA 2JMCA 1I1JA 1I07A 1KG1A 2F5KA 4II1A 3CCEA 2L89A 2COYA 1D1CA 4ANJA 3N5BB 1M2OA 2E12A 2P84A 1M8MA 2PQWA 1W4SA 4WF2A 4RTXA 2GCXA 3CCVQ 3E19A 3KFVA 2E10A 1KQ1A 4QW2A 3OSSC 3JCMQ 1YI2A 4C92D 1W70A 5M9OA 1KQSA 3SB2A 5GAOn 2CREA 2IPOB 4OMPA 4LN2A 2ED0A 3HTRA 3VYGA 2E3IA 1C1AA 2PNIA 1I81A 4M78B 2VKNA 4C92F 1PKSA 1VQ5Q 4HT8A 2F2XA 2HQEA 4C8QE 3O5ZA 1VOMA 1XNIA 2DMOA 1KC8U 2FEIA 1Q95G 3SFMA 2RNAA 4C0GA 3M0UA 2QYZA 1WHLA 3CD6T 3CPWS 3TCJA 3FJPA 4WCIA 1JRIA 4JZ4A 2DK3A 4PJJA 1IXDA 2F5TX 1G3SA 4AG1C 2EQJA 1EFNA 4DEYA 3CCJQ 5LJ3f 1ZQ1A 3LWIA 1YCYA 2X4WA 4OB2B 5IXFA 2DTOA 2DIQA 3CMET 2EYQA 3MCAB 3JCMP 1QVFP 1PM3A 4JDSA 2CT3A 2NWMA 4RTZA 2L2PA 4M78D 2RI3A 4XTWA 2CP7A 2O9VA 3OS2A 1Q82U 1MMDA 4LDYA 1M90R 4C8QC 1NYFA 2RA2A 4M7AE 1JJ2A 5D6YA 2QQBA 5GMKl 4XTZA 3KXTA 2DKGA 3EFRA 4JUVA 2J6KA 3OYHA 4MDXA 3EGUA 1UTIA 4MMLA 2Y90A 3REAB 4HVWA 2EW3A 1KJWA 4HCBA 5CKBA 3SDZA 1W2BS 4F7UB 1WHHA 5GAMg 4FCYA 4QVCA 2KRNA 4LDVA 1FXXA 2OTJQ 5CAIA 4OVAA 3JCMJ 1YBYA 3OBWA 3OYGA 2CZ1B 2QGGA 2L5QA 1VIEA 1Y96A 5HKCA 3BDUA 4GY5A 1RLPC 5KCOA 1J3TA 3RKXA 3HKSA 3OQ5A 2GNCA 2QA4Q 1BI2A 2AK5A 3H41A 4GLKA 3CCQT 1WJRA 2YRVA 4C92E 1ZBXA 2WSFE 4M77G 5GANf 2VXFA 3TU4K 3CXCA 2D8JA 4X34A 4EDUA 4M7DG 5GMKe 2X9HA 1IB8A 1OZ3A 3E9FA 4M7AC 2FZGB 2F2WA 1GBRA 4BACA 3EG2A 4F04B 1JEGA 3VS3A 2O2OA 3QO3A 4KGXB 2M16A 1H3ZA 4JRIA 2KBTA 2DX1A 2CP3A 3MKDA 3VV0A 2EYWA 2EAYA 2RK1A 3BE3A 2DE0X 4CC4B 1TU0B 1K9MC 5GAMj 5KYYB 4R56A 2ZPIB 3M56A 2DL4A 1AVZC 1M1FA 3BY7A 4EMKC 1E6HA 1M3AA 2O4XB 3BW1A 1PSEA 1X2QA 4QKUA 3LLRA 3EHQA 2DXBA 1E7OA 3JB9G 4E7JA 2LJ0A 3PE0A 1QP3A 4LD9K 3QWYA 1UJYA 4PJOB 2ZPHB 4M78E 1FWZA 4KRTA 2CGHA 1YN8A 1VQ5T 4QQDA 3GLXA 2A36A 2PTKA 1UG1A 5I22A 1VQPQ 5FRMA 5GANj 2DNUA 2ESWA 1C0MA 3ZFJA 4L6V5 1QP2A 3HHTB 3VRYA 4C8QG 2J7IA 3JV3A 3C95A 4FM4B 1VQMA 3P8HA 3M9QA 3J80E 3OYBA 3PMIA 4IKFA 1I5OB 5HY6A 3CCJT 3I56A 2EJFA 4J8OA 1SF9A 5J39A 5C0MA 2LQNA 4OMOA 2LVMA 1PCXA 2VGNA 1AEYA 1B3QA 3EH1A 2VC8A 2RJDA 1D09B 4BI8B 4OMMA 4C5EA 4PJOD 2YUQA 4J9CA 1UGQB 3OYKA 1VQ4Q 4M78C 1Q82R 2JXBA 4N0AC 2E64A 4E47A 5CKHA 5GMKi 3VS4A 2CS7A 4B9WA 5KYNA 4OMLA 4Q5WA 2MMPA 3DB3A 3MPUB 1M5Q1 2QDYB 4F7UE 2HKQB 4M7AG 3F70A 3CCEQ 4KGVB 3KUFA 2E65A 1YJ9A 2HEQA 5LJ5g 1QW1A 1RI9A 4OB3B 2V26A 2OTJT 2A0FB 3G7ZA 3V8KA 1KD1C 1IRXA 2FG0A 2K7AA 5GAMd 3NHNA 4BY6B 2LJ3A 2P4RA 2DEQA 1LCKA 2DJZA 3RUXA 1MGQA 3EAEA 2QA4T 2CP0A 3HP9A 2D0QB 3PVQA 4PLIA 2FVUA 1WXBA 2MWOA 5GAOm 4M75A 2GBQA 3R6OA 1QVPA 2YWWA 4AFQC 5FROA 5HK0A 2V1QA 4XU0A 2ENMA 4C92G 4NS5A 4LD6A 2QDLA 2EIFA 4BI4A 4PLLA 5IXBA 1H3HA 3L2QA 3URGA 3VS5A 1EX4A 4JZ3A 1H641 5FW9A 3TQ7P 3QJ6A 4DBHA 2VASA 5GANd 4IUTA 3H8ZA 3UWNA 1HJDA 2CZ7B 5I2SA 3RMSA 4ZTFA 2XD0A 3H0HA 1ABQA 1QVFS 4L5GA 4FT4A 2K5IA 5LJ5j 1U1TA 4F17A 3GPLA 4AFUC 3QPHA 2DF6A 1IZ6A 2KT1A 1W2BP 4CC7A 1KQSP 2E4HA 1WXTA 2E5KA 4YTLA 3JCMf 1WZOA 2OAUA 1GFCA 1YNZA 4CI0C 2QASA 1VYVA 1F1BB 4JS5A 4PJOE 3V8LA 3JCMg 4FW1A 4M7DF 3CPFA 2KNBB 1R8OB 3QIIA 2VXEA 1Y96B 2DL8A 3NMZC 2RI5A 3UPUA 1VQPT 1BIAA 3E2UA 4M78G 1OPKA 2C0IA 2MCNA 4XU1A 2K5FA 4XQ3A 2ABLA 3VJPA 3GP8A 4UC4A 1ZUKA 1X6OA 2FYKA 4E7SA 3QZ5B 2PVOB 2MAMA 2VVKA 2ZAEA 1GFDA 3R6NA 2KYBA 2XDPA 4HA8A 1NLPC 3QBYA 5GAOr 2GQVA 2RQRA 2QAZA 1N9SA 4E7LA 1M90C 3QDRB 2KE9A 3JCMb 2XI9A 5GAOp 1VQ4T 2KAFA 5CVIA 3JB9F 3MO8A 4HT9A 3QUIA 1M1KU 5CCAA 1VQ9A 2PZ1A 4KH0B 4PL6A 2YDLA 1OZ2A 2LQWA 1GL5A 1KHCA 5KE3A 1V29B 2DILA 4CC2A 2FZCB 4A4EA 3CCET 3GNFB 1PD0A 3OW2A 4EIKA 3I9QA 1B34A 2DZCA 4FT2A 2HBWA 4C0ZA 2DL3A 4FYVB 4ZGJB 4C8QF 3M58A 1SRLA 1GBQA 1UEBA 3HFNA 4F7UG 2CUDA 1WJQA 1XOVA 2JTMA 4D8DA 2XIDA 3OYLA 3MEWA 2QGFB 4FSXA 2K4YA 4FYWB 4DOVA 1WHGA 2H3EB 1G5VA 2DIGA 1KHIA 3M59A 1QWEA 1BI0A 2CSIA 3UF4A 1MNEA 2L3SA 3OYYA 1QVGA 1KIKA 3UT1A 4J6WA 1D1AA 3V7CA 4QQ6A 1SPKA 5KYUA 2LJ1A 3AT1B 5FRNA 1YIJQ 1I0CA 1VQ4A 3RIRA 4BE0A 2HMAA 4JS4A 1QCNA 1ABOA 4OP0A 2JT4A 4P5NA 1AZEA 1VQMQ 4JJDA 4M7AF 2XKOC 2JMAA 1K8AU 5CK9A 2JM8A 1SRMA 2PU9B 3I56Q 1M8VA 1MMGA 4BY6C 2O31A 2LDMA 1K9AA 2YUOA 2M1HA 4E2FB 1N9RA 3UA6A 8AT1B 2HAXA 3I35A 2J06A 2KRSA 1VQ7A 2EJGA 4VUBA 3HRUA 1KC8C 2E3HA 4F14A 2R5MA 2K57A 1JU5C 1YP5A 3LYIA 1RAIB 1B7TA 1G83A 2PUKB 2RK2A 2QQ9A 2LT4A 4PK4A 4R55A 3EH2A 2EKOA 4A4HA 4FL6A 3CCRA 1TSFA 1RAEB 4PJOG 1YJ9Q 5KCHA 3JCMd 1LNXA 3S3OA 2J05A 3TEEA 1P92A 3RESA 1K73U 4J9DA 2YUPA 2KT8A 2FPEA 2IIMA 2P4TA 4M75B 2GQIA 2DL7A 1YHQA 4M77A 4J5YA 2EKHA 2FPDA 3M0SA 1MUZA 4M7DA 2DJQA 2DA9A 4OMFB 1Q82C 2OAWA 4IIOA 4OMQA 2DVJA 3RERA 1RLQC 1JBMA 4E7IA 3NTHA 3AHUA 2FZKB 5LJ3g 1ZLMA 3OA6A 1JO8A 2EVRA 2FHDA 5CKEA 5CO7A 2ZGWA 3MP8A 5FWBA 1VIFA 1M1KR 1RAGB 3CCSA 4A54A 4XU2A 1VQ6A 2IVWA 4CRIA 3HRSA 1RI0A 1EZZB 4RTTA 1HK9A 4FYYB 1OULA 5A0GA 4M78F 4QVZA 3UDCA 4GBQA 3HSBA 3CC2A 2KXCA 1PG5B 1KQSS 2NYSA 2LMJA 2D8HA 2O88A 3OB9A 4PJNA 5FLXE 2NUPA 2DAQA 5I11A 2JTEA 3JRZA 4X9CA 2MK5A 4PNOA 5FU6B 3M55A 4LUDA 2YUNA 4DBFA 2AKLA 2LZ6B 2WSEE 1E6GA 3NPFA 4C0DB 3INZA 3JCMc 2W10A 3MP1A 1WXUA 3M4YA 4QVDA 2ZCFB 4C0FA 2XICA 4M4ZA 3ULRB 2F69A 3EFOA 3DB4A 4AMCA 1ZA2B 4Z8AA 1BI1A 2F1LA 3VS0A 2EGEA 5LJ3j 1OU9A 3NTKA 4J9FA 5L23A 4RTUA 5IN1A 1S72A 1YIJT 4L59A 1PRMC 4FU6A 5GANg 1EIFA 2D6FA 3LGFA 2D9TA 2G3RA 4JLGA 2LNVA 3RMQA 1VQMT 1OEBA 4WTOB 1K8AR 3JSCA 4X1VA 3EFSA 3I56T 4J9HA 1TTHB 2CYZB 5IHNA 4IUVA 3QXEB 3TSZA 3J81E 5FU7B 5A2QE 3D7SB 2QTXA 4F7UF 1FYNA 4J83A 4KUIA 4XTUA 4XTVA 1JJ2S 1VQNA 2E6ZA 3H0IA 3RBBB 2WSCE 1OOTA 3QYGB 1WPYA 4FYXB 3G1JA 2X51A 2XG8D 4E7ZA 1PSFA 1B34B 4PFZA 3MHXA 3CQTA 5KYWA 1VQ9Q 2LQ8A 2MPXC 2LX9A 2B86A 4MMKA 2K5LA 2HL3A 4AFSC 4ZGEB 1OV3A 2VV5A 2GF7A 2LC4A 3OYIA 1D0ZA 5I2MA 1YJ9T 1K73R 2KRMA 1YIJA 2KSSA 2ED1A 4HCZA 1NJIU 1BYMA 2EQIA 4OGEA 3VKIA 1UGPB 3CXCS 3SD4A 1AWXA 1YWPA 3HL8A 2CZ0B 4C5IA 3A1PA 2DVEA 4ORZA 2EJ9A 4X9DA 4E7KA 1D3BA 2KMTA 5KYUB 4C92A 2A37A 4J9BA 2A3LA 2EYYA 1MV0B 4C5HA 1UGRB 3SWNA 2EYZA 2EFIA 1ZUUA 2XHCA 5GAOq 4HCKA 2O01E 1M27C 2BKDN 3TREA 1D1BA 1BCMA 2ROTA 3GNGA 2YRCA 1SG5A 5LJ3d 1M3CA 4J6YA 3PIOA 2DBMA 3RDVA 2AZVA 1X6GA 3L2WA 4HCCA 1BI3A 3U23A 5GAN7 2RJFA 3EHRA 1NLOC 3EG9A 2K3YA 4PJOF 3OW2P 2C0OA 1GCQC 1GXIE 4ATOA 2YSQA 2CDTA 4M75C 1D0XA 1MNDA 1YFNA 2SRCA 1H92A 4LDWA 3C0CA 2EQKA 3PMTA 2FRWA 2DPPB 3VS7A 1T3SA 2JTFA 1ZHIA 2DRMA 1U06A 4PFPA 1G3WA 2P0KA 1VQ7Q 2RN8A 2DXUA 4RTWA 1Z9ZA 4A4FA 1AZGB 5IH2A 1VA7A 1NM7A 4JLIA 1PNJA 2OTLA 2CP2A 4BI3A 1I8FA 1GCQA 2M02A 1QVGP 2BZXA 2G6FX 2EQUA 3CCRQ 2JM9A 3CC7A 1AWJA 3CMAA 1O75A 3JCMV 3QSUA 4M77B 2R58A 3A98A 4EMGA 3VU3C 4C5GA 4ZN1A 2RJEA 3EG0A 5GAMe 2NUZA 4M7DB 1W1FA 1JB0E 2JZ2A 1RUWA 3H0FA 1HD3A 4MDWA 1MMNA 2HZYA 1YHQQ 2X4XA 2LX7A 3OS0A 2SEMA 2L3PA 2P0QA 4R0KA 5L8RE 2DRKA 1OX8A 4CC3A 5FU6C 1K0XA 1LJOA 4KT0E 3QHSA 3I55A 2JNGA 5GJVB 4C0DC 3DLLA 2K6DA 4LNPA 2RMOA 2DD5A 2AHJB 2QEXQ 3M5AA 1ZA1B 2MIOA 1LVKA 1WDXA 2GFUA 2DTHA 2MOXA 1IHWA 2YLBA 3X20B 1K76A 3ZBDA 4Y92A 2HDAA 1NEGA 3G4SA 5GANe 2LT1A 2JOYA 3BFMA 3O8VA 3QZ9B 2E6NA 1VQ9T 3CCSQ 4BDZA 1TS9A 4GLMA 1VQ6Q 1UHFA 4MZMA 2NUPB 4Y91A 1D0YA 3G71A 5DLOA 2CKKA 2CP5A 4QT7A 3JB9I 3CC2Q 1M3BA 1FMWA 2V8KA 4Z02A 2RHIA 3H6ZA 1NZ9A 3S3NA 3PGGA 1NJIR 3NFCA 2JS0A 1BU1A 5FU7C 3PIPA 3EFOB 2RHUA 3L2ZA 1PRLC 2FB7A 3V7RA 1BCOA 2YT6A 2DEUA 5KYXB 3CCMA 1NPRA 2C0TA 4D6WA 4NOYA 2R57A 2EGCA 4DEXA 1UJ0A 3THKA 1Q81U 1M1KC 1WI7A 4J9GA 2V8IA 1RL2A 1SSFA 1RABB 1S72Q 1FX7A 1NEBA 5DM7R 5GAOl 1BIBA 2X35A 3QWXX 1QCFA 4PJMA 1VQ8A 4BE1A 1NE8A 1JJ2P 1Y0MA 1ARKA 4HKEA 4RG8A 3TSWA 2QI2A 2O9SA 4TVRA 2HQXA 1WLPB 2DETA 2QG9B 4OMNA 2CUBA 4J7IA 3GOXA 3V8JA 1K1ZA 2NUTB 2D0NA 4O6JA 3WVDB 1V76A 6AT1B 3OSVA 1R77A 3C4SA 2DZ9A 4FIBA 3MEUA 3M0RA 2P0PA 2JW4A 2LTOA 4RCBA 2JS2A 3LWHA 3KBGA 1NYGA 1VQNQ 2KVQG 2XMFA 2COWA 2A08A 2EYXA 5KYWB 1VQ7T 2AZSA 5GAMh 1UUEA 2OI3A 3EG3A 1M30A 3CCUQ 2HQHA 3CBOA 3JAME 1VQLA 1OX9A 3I5RA 5CQXA 3CBMA 3EG1A 2A7YA 3G6EQ 2NLUA 3FLGA 2CP6A 3UATA 3CXCP 4A53A 2HL5C 2YRDA 2JJ9A 4DBRA 2DFUA 3CCRT 2BZ8A 3S3MA 1K8AC 3VRZA 2HNIA 1FMVA 4JRKA 4M77E 3EGDA 3ER0A 1WQ7A 2E70A 3QJYA 1D3BB 5LJ5e 1PWTA 3RNJA 1N8RU 1XJWB 3CPWA 4C92B 3LH0A 1YHQT 2DO3A 5GAN6 4N4IA 3E1SA 2BE7D 3VYHB 4MZTA 5GANh 4BDYA 1G3YA 1SEMA 4DQ2A 3M0PA 7AT1B 5GMKm 3SWNB 4AG2C 3L42A 3WVEB 5EC7A 3EGXA 1K0SA 3S6WA 3BDLA 5EG2A
chains in the Genus database with same CATH topology
2VC8A 2K2VA 3MP1A 2RJDA 3QYHB 2DXTA 3M4YA 4BI8B 4QVDA 1VQKA 4C5EA 4PJOD 2ZCFB 1VQLT 4C0FA 1UGQB 2XICA 3OYKA 4M78C 2QEXT 2K3XA 3E9GA 5IT9E 4N0AC 3OMGA 4RMOA 2F69A 4C8QB 2E64A 3DB4A 4RG2A 4B9XA 5GMKj 4E7HA 4E47A 2Y4XA 1BI1A 5CKHA 5GMKi 4M75G 3QKJA 1Y7XA 2CS7A 4ZGDB 5LJ3j 3NTKA 4B9WA 5A0DA 3OW2S 1K73C 5IN1A 4Q5WA 1S72A 1YIJT 2MMPA 2RO0A 3P8BB 4FU6A 3DB3A 4L59A 5GANg 1Q7YU 3HPWA 2RHYA 2QXFA 3CCST 1M5Q1 1EIFA 2QDYB 4M77C 4F7UE 3OYDA 1VQ6T 4XTYA 2D6FA 4M7AG 3F70A 3FB9A 2ZPBB 3LGFA 1YITA 5CKDA 2D9TA 2G3RA 2KDSA 3KUFA 3X28B 2E65A 3X25B 4OB0B 4M7DC 1YJ9A 4JLGA 1QW1A 1Y71A 2LNVA 4OB3B 3RMQA 5LJ5g 1VQMT 1W2BA 2OTJT 3CC2T 1O9SA 3G7ZA 3V8KA 3JB9D 1KD1C 2ZZDA 3LW5E 2GFAA 1VQOT 3JSCA 4ELZC 5LJ3h 5GAMd 3EFSA 4BY6B 3I56T 2CYZB 2ZPGB 2DEQA 5CKFA 3OY9A 4IUVA 3QXEB 3V7SA 2WACA 2DJZA 3RUXA 3J81E 5FU7B 5A2QE 3OYNA 2JVVA 2QTXA 1MGQA 3EAEA 4F7UF 4J83A 3OBYA 4IUQA 4XU3A 4KUIA 5CR2A 2QA4T 3HP9A 4XTUA 4PJOC 1QVGS 2LRQA 2D0QB 4PLIA 4XTVA 2FVUA 5D6WA 2MWOA 5GAOm 1JJ2S 4V2SA 3DKMA 2QQSA 3OYCA 1VQNA 2E6ZA 4M75A 1YJWA 3R6OA 2YLCA 3OS1A 2DTIA 1U8RA 1VQKT 4A4KA 1QVPA 1X01A 2RHXA 2WSCE 4C8QD 3P8DA 2LCLA 1I4K1 3M4GA 3QYGB 1WPYA 4M7AB 5FROA 3OYJA 1M90U 5HK0A 3FIFA 4N4HA 2O4XA 2XG8D 5DY9A 5C6SA 3A5ZB 3HFOA 4XU0A 1PSFA 4C92G 1YJNT 1B34B 4NS5A 4LD6A 3FEOA 3MHXA 2VGMA 3JCMe 1Y07A 2EIFA 5CQYA 4PLLA 4BI4A 4XTXA 2QEXA 3L2QA 2LQ8A 3URGA 2LX9A 1S72T 2KK4A 2Y4YA 1H641 3QSUA 4MMKA 1VQPA 2K5LA 1XQHA 4ZGEB 2VV5A 1N8RC 4PJOA 3QJ6A 1M9SA 1YITT 1HXDA 2GF7A 2LC4A 5GANd 3OYIA 5I2MA 4IUTA 3H8ZA 1YJ9T 5GAN8 3OS5A 3UWNA 2CZ7B 3GIBA 5I2SA 1YIJA 3RMSA 4ZTFA 3C12A 1YI2T 2XD0A 2MI6A 2KSSA 3RKWA 4A4GA 5LJ5d 1QVFS 3PFSA 4L5GA 4HCZA 3X24B 3PTAA 3JCMX 3L1AA 4FT4A 2K5IA 5GAN2 5LJ5j 1U1TA 2EQMA 3GPLA 1NJIU 1BYMA 4OGEA 1Q86C 3OMCA 4QQGA 3VKIA 4JRPA 4DA4A 3QPHA 2XDBA 5HK3A 4M7DE 1DJ7B 4EMKB 3JB9J 5GAN3 1UGPB 3CXCS 4M75D 3SD4A 1IZ6A 3HRTA 3OYAA 3HL8A 2CZ0B 4C5IA 1I5LA 4BD3A 2DVEA 1N27A 1VQOA 2EJ9A 2M9UA 4X9DA 4E7KA 1D3BA 2KMTA 1VQNT 4YTLA 3JCMf 4C92A 5D6XA 5LL6S 5GAMf 3JCMW 1YJWT 2CZ6B 4IUUA 2OAUA 1WQWA 4KBMB 2PVDB 4M7AD 1M4ZA 2A3LA 4CI0C 3CCUT 4N4GA 2RD1A 4C5HA 3LX7A 3C94A 5LJ5h 1UGRB 4JS5A 1OYXA 1OI1A 2JUFA 4M75F 3SWNA 4J6XA 4KULA 3JCMg 3V8LA 1Q86U 3CEYA 2EFIA 3G6ET 4M7DF 4RCCA 3CPFA 2XHCA 5GAOq 2H3JA 2QQAA 2O01E 5A0LA 1R8OB 2BKDN 3QIIA 3TREA 2VXEA 1Y96B 3RKYA 3ZEHA 3GNGA 2RI5A 3UPUA 1VQPT 1WNLA 1BIAA 5LJ3d 4J6YA 3PIOA 2X4YA 2VUBA 3M53A 4M78G 5J26A 1YJNA 3L2RA 3CD6A 3L2WA 4HCCA 1BI3A 4C8QA 4XU1A 2K5FA 1KG1A 3A8LB 5GAN7 2F5KA 4II1A 4XQ3A 2L89A 3CCEA 2RJFA 3VJPA 3GP8A 4UC4A 4RKUE 2K3YA 4PJOF 3J7AF 1X6OA 2ZPEB 3N5BB 2RJCA 2E12A 1GXIE 4ATOA 5AYFA 4Y28E 2FYKA 2PQWA 1W4SA 4M75C 4WF2A 3QZ5B 2GCXA 2PVOB 2MAMA 3E19A 4JJNK 2E10A 2E1HA 1KQ1A 4LDWA 4QW2A 3OSSC 3JCMQ 2EQKA 2XDPA 1YI2A 2L8DA 3PMTA 4C92D 4HA8A 2DD4A 3QBYA 5KH6A 5GAOr 5CIUA 2DPPB 2GQVA 5M9OA 1KQ2A 1KQSA 3SB2A 5GAOn 1N9SA 2JTFA 3CMEA 1ZHIA 4E7LA 1M90C 1BKBA 1G3WA 3M54A 3QDRB 4BUGA 4IURA 2BUDA 2P0KA 2DXUA 3MEAA 5I21A 3VYGA 4A4FA 3ME9A 4J7FA 3JCMb 1LOJA 2LQKA 1WJSA 1I81A 4JLIA 2XI9A 2OTLA 2RB6A 4M78B 5GAOp 3VUBA 1VQ4T 4BI3A 4C92F 1I8FA 4HT8A 2HQEA 2KAFA 5CVIA 4C8QE 3JB9F 3OYEA 3MO8A 1XNIA 4HT9A 2EQUA 1KC8U 3QUIA 3CCUA 2PVGB 1M1KU 5CCAA 1VQ9A 3CC7A 4PL6A 3SFMA 4C0GA 4DOWA 1OZ2A 1O75A 1G3TA 2DXCA 3CMAA 3JCMV 1KHCA 3G6EA 5KE3A 2EWNA 2R58A 4M77B 2MWPA 4EMGA 1V29B 3CD6T 1X75C 4M7AA 2KY9A 3VU3C 4C5GA 4ZN1A 2RJEA 3TCJA 3CPWS 5GAMe 3FJPA 4A4EA 1NJIC 3CCET 3GNFB 3OW2A 4M7DB 2KQWA 3CCVT 1JRIA 1JB0E 1B34A 2JZ2A 2DK3A 2DZCA 4FT2A 5J3BA 4C0ZA 4MDWA 2F5TX 4ZGJB 4BE2A 4C8QF 1G3SA 3M58A 2EQJA 4C92C 1UEBA 3HFNA 2X4XA 5LJ3f 3CCLT 3OS0A 2YHTA 4F7UG 1ZQ1A 3LWIA 1WJQA 1XOVA 1YCYA 2X4WA 2JTMA 3JCMh 1N6AA 2P0QA 4OB2B 1K9MU 5L8RE 4KUDK 3SWNC 3Q1JA 2XIDA 5FU6C 4OGCA 1LJOA 2DTOA 3OYLA 4KT0E 3QHSA 3I55A 2JNGA 3MEWA 2DIQA 4FSXA 3CCQA 3CMET 2K4YA 2EYQA 3MCAB 4DOVA 3JCMP 4C0DC 3DLLA 4M75E 4JDSA 4PKCC 1G5VA 2HD0A 2DIGA 1KHIA 2DD5A 3M59A 2MF2A 2AHJB 4M78D 1XTDA 3M5AA 1BI0A 3M57A 2OTLT 2RHZA 2RI3A 4XTWA 3OS2A 1Q82U 3OYYA 3WXMB 2GFUA 2DTHA 2E41A 4LDYA 4EMKA 3OYMA 4C8QC 3UT1A 1QVGA 2RA2A 3A8OB 4J6WA 4M7AE 2YLBA 3X20B 1JJ2A 3V7CA 5D6YA 3ZBDA 4QQ6A 2QQBA 5GMKl 3G4SA 4XTZA 4OF1A 5GANe 3KXTA 2DKGA 2LT1A 3EFRA 4JUVA 3OYHA 2JOYA 3BFMA 3O8VA 4MDXA 5FRNA 4MMLA 3QZ9B 2Y90A 1VQ4A 2E6NA 1VQ9T 3RIRA 4XAXB 3CC7T 4HCBA 5CKBA 3GF5A 3SDZA 4BDZA 4BE0A 4F7UB 3LGLA 3A8HB 1W2BS 5GAMg 3CMAT 4MZMA 4JS4A 4M7AF 4QVCA 4EPCA 3OYFA 1M1GA 4OP0A 4Y91A 4P5NA 4BB7A 3G71A 4LDVA 5DLOA 1FXXA 3CC4T 2L3RA 2CKKA 3JB9I 5CAIA 4OVAA 3A8GB 2V8KA 2XKOC 4Z02A 3JCMJ 2JN0A 2RHIA 1YBYA 3OBWA 3OYGA 5CK9A 1K8AU 3FDRA 3H6ZA 2CZ1B 1U1SA 2L5QA 1NZ9A 1VIEA 1Y96A 3S3NA 1NPPA 2PU9B 4JRQA 1M8VA 5HKCA 4BY6C 3BDUA 3PGGA 3ASKA 3NFCA 2LDMA 4GY5A 3VUZA 5KCOA 3CCVA 3RKXA 3HKSA 3X26B 3OQ5A 5FU7C 2M1HA 2ZPFB 1N9RA 3PIPA 1MHNA 1QVFA 2RHUA 3I55T 1BI2A 2HAXA 2X4JA 4GLKA 3CCQT 1WJRA 3L2ZA 2FB7A 3FRNA 2YRVA 4LDUA 3V7RA 4C92E 2RH2A 1ZBXA 3DLMA 2WSFE 3CCMA 4M77G 2PUOB 1NPRA 5GANf 2VXFA 1VQ7A 2EJGA 3TU4K 4D6WA 4VUBA 4NOYA 2R57A 3HRUA 4X34A 3CXCA 3A8MB 4EDUA 4M7DG 1KC8C 3CCLA 3CBPA 5GMKe 4EMHA 1Q81U 2VYTA 1OZ3A 3E9FA 1M1KC 4O5VA 2R5MA 4M7AC 3MEVA 2K57A 5LJ5f 4BACA 5LJ3e 4NL3A 4ME7A 2V8IA 3LYIA 3G4ST 1VQ5A 2I2LA 1RL2A 2PUKB 4ZTJA 2RK2A 3L2UA 1SSFA 3NTIA 3QO3A 2QQ9A 2LT4A 5GAN5 2M16A 2QQRA 4R55A 1AHJB 1FX7A 2RI2A 5DM7R 2EKOA 4A4HA 5GAOl 1H3ZA 4FL6A 4JRIA 3CCRA 2RM4A 4XK8E 1BIBA 4ELYC 5GMKh 2E5QA 2X35A 4M78A 2BIVA 1VQ8A 4PJOG 4BE1A 1NE8A 4N0AA 5KCHA 2V8JA 3VV0A 3JCMd 3G71T 1LNXA 3S3OA 2EAYA 4NL2A 3TEEA 2RK1A 1P92A 3RESA 1K73U 2M0OA 3PNWC 4HKEA 4RG8A 2QI2A 4TVRA 1K9MC 2HQXA 5GAMj 2P4TA 2C06A 4R56A 2ZPIB 3MP6A 4J7IA 3GOXA 4M75B 3M56A 1IREB 3V8JA 1YHQA 3CCJA 3L2VA 2FL7A 3CC4A 4M77A 1M1FA 3META 4J5YA 3BY7A 4O6JA 4EMKC 3WVDB 3OSVA 2LCCA 4M7DA 3C4SA 2O4XB 5IAYA 2DZ9A 4FIBA 3BW1A 4OMFB 1Q82C 1KD1U 2XU8A 3MEUA 4LDXA 2P0PA 1PSEA 2LTOA 4RCBA 1UGSB 3LWHA 3KBGA 2KVQG 3RERA 3CCMT 1VQ7T 1JBMA 4E7IA 3LLRA 5GAMh 3NTHA 2DXBA 3AHUA 5DLQE 3JB9G 3CBOA 3JAME 4E7JA 1VQLA 1QP3A 4LD9K 5LJ3g 5CQXA 4PJOB 4PJOE 2ZPHB 3CBMA 4M78E 1FWZA 2IG0A 2A7YA 3OA6A 2CGHA 2FHDA 2NLUA 1VQ5T 4QQDA 3FLGA 5CKEA 5CO7A 1UB4A 3GLXA 3JB9H 2ZGWA 3MP8A 1VIFA 1VUBA 3FC3A 5FRMA 4A53A 3T9NA 5GANj 1TH7A 3CCRT 3PT9A 3S3MA 3CCSA 1K8AC 4A54A 4XU2A 3ZFJA 2HNIA 1VQ8T 4L6V5 5KE2A 1QP2A 3HHTB 1VQ6A 2IVWA 2R5AA 4CRIA 4JRKA 4M77E 4C8QG 5GAN4 3HRSA 1RI0A 3ER0A 1WQ7A 3C95A 1HK9A 2E70A 4FM4B 1VQMA 4M77D 4M78F 4QVZA 3UDCA 5A0GA 3QJYA 3P8HA 2XDDA 3M9QA 1WGSA 1D3BB 3HSBA 5LJ5e 2OTJA 3CC2A 3J80E 3QG1A 1N8RU 4IUPA 4M7DD 3OYBA 3PMIA 3CPWA 4C92B 1KQSS 2HBPA 3LH0A 4F7UA 1YHQT 2DO3A 4IKFA 5HY6A 5GAN6 4OB1B 3CCJT 4N4IA 3E1SA 1Q7YC 2XK0A 3I56A 3VYHB 3OB9A 4MZTA 5FLXE 1G3YA 5GANh 4BDYA 2EJFA 2DAQA 4J8OA 4DQ2A 5J39A 5GMKm 3JRZA 4MZPA 4X9CA 3L42A 4PNOA 5FU6B 3M55A 3SWNB 3WVEB 4ZN3A 5C0MA 2LVMA 1Q81C 2QA4A 2WSEE 2VGNA 4M77F 3S6WA 4C0DB 3INZA 3JCMc 3BDLA 2B8AA 5EG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BYM A;  1FWZ A;  2LX9 A;  2QQ9 A;  1BI2 A;  2H3J A;  2GCX A;  2K5L A;  1FX7 A;  3E19 A;  4O6J A;  2QQA A;  1QW1 A;  3HRT A;  3GLX A;  1BI0 A;  5CVI A;  1G3S A;  1U8R A;  1QVP A;  1BI1 A;  1G3Y A;  3HRU A;  1P92 A;  1BI3 A;  2K5F A;  2QQB A;  1G3W A;  4O5V A;  1G3T A;  3HRS A;  3MHX A;  2K5I A;  2K4Y A; 
#chains in the Genus database with same CATH topology
 2K2V A;  3QYH B;  2DXT A;  2AIR B;  1VQK A;  4Z89 A;  2QEX T;  2K3X A;  3E9G A;  5IT9 E;  2RQW A;  4RMO A;  4B9X A;  5GMK j;  2VWF A;  1QKW A;  3QKJ A;  1HSQ A;  3EG9 B;  2DM1 A;  4DBQ A;  1BK2 A;  2CH4 W;  3OW2 S;  1K73 C;  2A28 A;  1Q7Y U;  2RO0 A;  4IIM A;  3HPW A;  3CCS T;  4M77 C;  3OYD A;  1VQ6 T;  3FB9 A;  3GBQ A;  1YIT A;  1BB9 A;  1X43 A;  4HVU A;  2F2V A;  5CKD A;  4M7D C;  1UE9 A;  4OB0 B;  3X25 B;  1C6V X;  1Y71 A;  4JPB W;  1W2B A;  5HCK A;  3CC2 T;  5IHK A;  1O9S A;  3LW5 E;  2ZPG B;  3M0Q A;  4RTV A;  3OY9 A;  1U5S A;  3CCL Q;  3V7S A;  2WAC A;  3OYN A;  2JVV A;  2BZY A;  1AOJ A;  3OBY A;  5CR2 A;  1QVG S;  1VYU A;  2OJ2 A;  1QQJ A;  1YJW A;  2OTL Q;  4A63 B;  3P8D A;  1Q81 R;  1I4K 1;  3M4G A;  1IGU A;  4N4H A;  5C6S A;  3A5Z B;  2DBK A;  2LNH B;  1YJN T;  3PVL A;  2CSQ A;  2VGM A;  1Y07 A;  3JCM e;  1QWF A;  5CQY A;  1IO6 A;  4XTX A;  2QEX A;  2KXD A;  3CC7 Q;  1S72 T;  2Y4Y A;  3CMA Q;  4F16 A;  1RAF B;  1HXD A;  3CC4 Q;  3OS5 A;  1RAH B;  2RPN A;  1K4U S;  3RKW A;  4A4G A;  3PFS A;  2GGR A;  3X24 B;  1TG0 A;  1ZSZ C;  3L1A A;  3OMC A;  4QQG A;  2XDB A;  4DA4 A;  5HK3 A;  2I0N A;  2KI7 A;  3I55 Q;  1BBZ A;  4M75 D;  2K2M A;  2MYS A;  3OYA A;  1N27 A;  2RQV A;  1AD5 A;  1VQN T;  3JCM W;  5D6X A;  1M2V A;  5GAM f;  2CZ6 B;  2PVD B;  1M4Z A;  2RF0 A;  3SEM A;  3CCU T;  1Y57 A;  2RD1 A;  3LX7 A;  3C94 A;  5LJ5 h;  4M75 F;  4J6X A;  2HKN A;  4KUL A;  3G4S Q;  3CEY A;  3G6E T;  4RCC A;  4RTY A;  2EBP A;  1UEC A;  1ZSZ A;  2CT4 A;  5A0L A;  1OQK A;  1G8X A;  1KFZ A;  3RKY A;  2X4Y A;  2VUB A;  1YJN A;  3G71 Q;  3CD6 A;  4C8Q A;  1WIE A;  1W6X A;  3A8L B;  5KYX A;  4RUG A;  4RKU E;  3J7A F;  2ZPE B;  4E6R A;  2RJC A;  1X6B A;  5AYF A;  4Y28 E;  1UHC A;  1OU8 A;  1N8R R;  3QDF A;  4JJN K;  2E1H A;  1X69 A;  1TUD A;  2FPF A;  1OPL A;  2L8D A;  2DD4 A;  2K9G A;  5KH6 A;  5CIU A;  3FJ5 A;  1KQ2 A;  2W0Z A;  3LH5 A;  3CME A;  1BKB A;  3M54 A;  3CCM Q;  4BUG A;  4IUR A;  2BUD A;  3MEA A;  5I21 A;  1Q86 R;  2BTT A;  3ME9 A;  4J7F A;  2LCS A;  1LOJ A;  2LQK A;  1WJS A;  2KRO A;  1SHG A;  2RB6 A;  3VUB A;  3ZL7 C;  2CH4 A;  5AT1 B;  1KK7 A;  1PD1 A;  3OYE A;  1YCS B;  2NUT A;  3CCU A;  2PVG B;  1A0N B;  1Q7Y R;  1VQ8 Q;  1T0H A;  3UA7 A;  4DOW A;  2V1R A;  1G3T A;  2DXC A;  2DYB A;  3G6E A;  2EWN A;  4M7A A;  1GCP A;  2MWP A;  4ESR A;  1X75 C;  2KY9 A;  2RQT A;  1NJI C;  2M0Y A;  1SKU B;  2KQW A;  3CCV T;  8ATC B;  5J3B A;  3IQL A;  1JXM A;  4BE2 A;  1N5Z A;  1RAD B;  4C92 C;  2YHT A;  1PKT A;  3REB B;  1LPL A;  1MMA A;  3JCM h;  1N6A A;  1K9M U;  4KUD K;  3SWN C;  3Q1J A;  3CCL T;  4OGC A;  4ZNX A;  3CCQ A;  4LXC A;  4FSS A;  4M75 E;  4PKC C;  4FW2 A;  2HD0 A;  2KGT A;  2X3X D;  1VQL Q;  2MF2 A;  1XTD A;  3M57 A;  1KC8 R;  2RHZ A;  2OTL T;  3MJX A;  3WXM B;  4EMK A;  3OYM A;  2E41 A;  1AWO A;  3A8O B;  1JQQ A;  3EGD B;  1WFW A;  2OX7 A;  2H8H A;  4OF1 A;  5ECA A;  4XAX B;  4B6M A;  3CC7 T;  1X27 A;  3GF5 A;  3LGL A;  3A8H B;  3CMA T;  4EPC A;  3OYF A;  1M1G A;  4AT1 B;  1SHF A;  4BB7 A;  3CC4 T;  2L3R A;  3EGX B;  3A8G B;  2JN0 A;  3FDR A;  1VQO Q;  1U1S A;  1NPP A;  4JRQ A;  3ASK A;  3CCV A;  3VUZ A;  5IHI A;  3X26 B;  2ZPF B;  4HVV A;  1GRI A;  1MHN A;  1B07 A;  1QVF A;  1QLY A;  3I55 T;  1TOV A;  2X4J A;  1SSH A;  3FRN A;  4LDU A;  2RH2 A;  1X2K A;  3DLM A;  1YWO A;  2PUO B;  1VQK Q;  1UFF A;  3A8M B;  3H9N A;  3CCL A;  3CBP A;  4EMH A;  2VYT A;  1VYT A;  4O5V A;  3MEV A;  2ATC B;  5LJ5 f;  2GTJ A;  5LJ3 e;  4NL3 A;  4ME7 A;  2ECZ A;  2KR3 A;  1VQ5 A;  3G4S T;  2I2L A;  4ZTJ A;  1QCO A;  3L2U A;  3NTI A;  5GAN 5;  2QQR A;  1AHJ B;  2RI2 A;  4JJB A;  2RM4 A;  4XK8 E;  4ELY C;  5GMK h;  2E5Q A;  1YIT Q;  4M78 A;  2BIV A;  5FWC A;  4N0A A;  2V8J A;  1HYO A;  1ZSG A;  3G71 T;  4NL2 A;  1TWB A;  1NG2 A;  2M0O A;  1YI2 Q;  3PNW C;  2C06 A;  1H8K A;  1WYX A;  1Z9Q A;  2L0A A;  3MP6 A;  4PJL A;  5GJW B;  1ZUY A;  1ZBJ A;  1IRE B;  1WHM A;  3CCJ A;  3L2V A;  2FL7 A;  3CPW P;  3CC4 A;  3MET A;  1KSW A;  4LE9 A;  2LCC A;  5IAY A;  2J6F A;  1KD1 U;  2COZ A;  2XU8 A;  4LDX A;  2K79 A;  4D8K A;  1UGS B;  1YJW Q;  3CCM T;  2LP5 A;  1U3O A;  5DLQ E;  3I5S A;  4Z88 A;  1T0J A;  1FMK A;  2IG0 A;  2DYI A;  3VS2 A;  1R0C B;  1UB4 A;  3JB9 H;  1VUB A;  2DER A;  3FC3 A;  1S1N A;  3T9N A;  1TH7 A;  3PT9 A;  1VQ8 T;  5KE2 A;  2R5A A;  1TXQ A;  5GAN 4;  2EPD A;  4K11 A;  4KGZ B;  2VB6 A;  4M77 D;  1CKB A;  2XDD A;  1WGS A;  2OTJ A;  1PC0 A;  3QG1 A;  4IUP A;  4M7D D;  1M2V B;  2HBP A;  2M51 A;  4F7U A;  2AKK A;  4OB1 B;  2XK0 A;  1V1C A;  1K9M R;  4AFZ C;  4MZP A;  4ZN3 A;  1Q81 C;  3TVT A;  4LUE A;  2FRY A;  2QA4 A;  4M77 F;  1ZSZ B;  2HSE B;  3M0T A;  2B8A A;  1CKA A;  1VQL T;  2KYM A;  1IGQ A;  3OMG A;  4C8Q B;  2D1X A;  4RG2 A;  4E7H A;  1CSK A;  2Y4X A;  4M75 G;  1Y7X A;  4ZGD B;  2J6O A;  2FO0 A;  5A0D A;  3VS1 A;  1JXO A;  2RQU A;  3SHW A;  3NGP A;  1AT1 B;  3P8B B;  1YJN Q;  2RHY A;  2QXF A;  3CD6 Q;  1IHV A;  2ROL A;  4XTY A;  4JJC A;  2YXY A;  2ZPB B;  1UDL A;  2KDS A;  3X28 B;  3VS6 A;  4J9E A;  4HXJ A;  1G2B A;  4KH1 B;  3JB9 D;  2ZZD A;  2GFA A;  1VQO T;  2K3B A;  4J9I A;  4ELZ C;  5LJ3 h;  1NBE B;  5CKF A;  1R0B G;  3CME Q;  4IUQ A;  4PJO C;  4XU3 A;  1WHK A;  2LRQ A;  1QKX A;  5D6W A;  5KYY A;  2HSP A;  4V2S A;  3DKM A;  2QQS A;  3OYC A;  3RR6 A;  4PFO A;  2QK0 A;  3OS1 A;  2YLC A;  1U8R A;  2DTI A;  1VQK T;  4A4K A;  1X01 A;  2RHX A;  4C8Q D;  2LCL A;  3OYJ A;  4M7A B;  1M90 U;  3FIF A;  2GTO A;  2O4X A;  5DY9 A;  3HFO A;  2AT1 B;  3FEO A;  2X3W D;  2Z0W A;  2QTV A;  2KK4 A;  1VQP A;  1XQH A;  1WX6 A;  1N8R C;  4PJO A;  2EGA A;  1M9S A;  1YIT T;  9ATC B;  1QMC A;  5GAN 8;  3GIB A;  2DLP A;  1RAA B;  3C12 A;  1YI2 T;  2MI6 A;  5LJ5 d;  3PTA A;  2DL5 A;  1TUG B;  3JCM X;  5GAN 2;  1UGV A;  2EQM A;  1Q86 C;  4M7D E;  4JRP A;  1DJ7 B;  4EMK B;  3JB9 J;  5GAN 3;  3CCQ Q;  3HRT A;  1I5L A;  1KD1 R;  4BD3 A;  1VQO A;  2M9U A;  1RAC B;  1TUC A;  2BE9 B;  2KEA A;  1YJW T;  5LL6 S;  5D7U A;  4IUU A;  1WQW A;  4KBM B;  1WHJ A;  4M7A D;  1T3L A;  4N4G A;  1Q7Y C;  1OYX A;  1OI1 A;  2JUF A;  1Q86 U;  2L3Q A;  1ACM B;  1PHT A;  2H3J A;  2QQA A;  1ZX6 A;  1WA7 A;  3ZEH A;  1WNL A;  2HCK A;  1AWW A;  1MV3 A;  3M53 A;  5J26 A;  3L2R A;  2JMC A;  1I1J A;  1I07 A;  1KG1 A;  2F5K A;  4II1 A;  3CCE A;  2L89 A;  2COY A;  1D1C A;  4ANJ A;  3N5B B;  1M2O A;  2E12 A;  2P84 A;  1M8M A;  2PQW A;  1W4S A;  4WF2 A;  4RTX A;  2GCX A;  3CCV Q;  3E19 A;  3KFV A;  2E10 A;  1KQ1 A;  4QW2 A;  3OSS C;  3JCM Q;  1YI2 A;  4C92 D;  1W70 A;  5M9O A;  1KQS A;  3SB2 A;  5GAO n;  2CRE A;  2IPO B;  4OMP A;  4LN2 A;  2ED0 A;  3HTR A;  3VYG A;  2E3I A;  1C1A A;  2PNI A;  1I81 A;  4M78 B;  2VKN A;  4C92 F;  1PKS A;  1VQ5 Q;  4HT8 A;  2F2X A;  2HQE A;  4C8Q E;  3O5Z A;  1VOM A;  1XNI A;  2DMO A;  1KC8 U;  2FEI A;  1Q95 G;  3SFM A;  2RNA A;  4C0G A;  3M0U A;  2QYZ A;  1WHL A;  3CD6 T;  3CPW S;  3TCJ A;  3FJP A;  4WCI A;  1JRI A;  4JZ4 A;  2DK3 A;  4PJJ A;  1IXD A;  2F5T X;  1G3S A;  4AG1 C;  2EQJ A;  1EFN A;  4DEY A;  3CCJ Q;  5LJ3 f;  1ZQ1 A;  3LWI A;  1YCY A;  2X4W A;  4OB2 B;  5IXF A;  2DTO A;  2DIQ A;  3CME T;  2EYQ A;  3MCA B;  3JCM P;  1QVF P;  1PM3 A;  4JDS A;  2CT3 A;  2NWM A;  4RTZ A;  2L2P A;  4M78 D;  2RI3 A;  4XTW A;  2CP7 A;  2O9V A;  3OS2 A;  1Q82 U;  1MMD A;  4LDY A;  1M90 R;  4C8Q C;  1NYF A;  2RA2 A;  4M7A E;  1JJ2 A;  5D6Y A;  2QQB A;  5GMK l;  4XTZ A;  3KXT A;  2DKG A;  3EFR A;  4JUV A;  2J6K A;  3OYH A;  4MDX A;  3EGU A;  1UTI A;  4MML A;  2Y90 A;  3REA B;  4HVW A;  2EW3 A;  1KJW A;  4HCB A;  5CKB A;  3SDZ A;  1W2B S;  4F7U B;  1WHH A;  5GAM g;  4FCY A;  4QVC A;  2KRN A;  4LDV A;  1FXX A;  2OTJ Q;  5CAI A;  4OVA A;  3JCM J;  1YBY A;  3OBW A;  3OYG A;  2CZ1 B;  2QGG A;  2L5Q A;  1VIE A;  1Y96 A;  5HKC A;  3BDU A;  4GY5 A;  1RLP C;  5KCO A;  1J3T A;  3RKX A;  3HKS A;  3OQ5 A;  2GNC A;  2QA4 Q;  1BI2 A;  2AK5 A;  3H41 A;  4GLK A;  3CCQ T;  1WJR A;  2YRV A;  4C92 E;  1ZBX A;  2WSF E;  4M77 G;  5GAN f;  2VXF A;  3TU4 K;  3CXC A;  2D8J A;  4X34 A;  4EDU A;  4M7D G;  5GMK e;  2X9H A;  1IB8 A;  1OZ3 A;  3E9F A;  4M7A C;  2FZG B;  2F2W A;  1GBR A;  4BAC A;  3EG2 A;  4F04 B;  1JEG A;  3VS3 A;  2O2O A;  3QO3 A;  4KGX B;  2M16 A;  1H3Z A;  4JRI A;  2KBT A;  2DX1 A;  2CP3 A;  3MKD A;  3VV0 A;  2EYW A;  2EAY A;  2RK1 A;  3BE3 A;  2DE0 X;  4CC4 B;  1TU0 B;  1K9M C;  5GAM j;  5KYY B;  4R56 A;  2ZPI B;  3M56 A;  2DL4 A;  1AVZ C;  1M1F A;  3BY7 A;  4EMK C;  1E6H A;  1M3A A;  2O4X B;  3BW1 A;  1PSE A;  1X2Q A;  4QKU A;  3LLR A;  3EHQ A;  2DXB A;  1E7O A;  3JB9 G;  4E7J A;  2LJ0 A;  3PE0 A;  1QP3 A;  4LD9 K;  3QWY A;  1UJY A;  4PJO B;  2ZPH B;  4M78 E;  1FWZ A;  4KRT A;  2CGH A;  1YN8 A;  1VQ5 T;  4QQD A;  3GLX A;  2A36 A;  2PTK A;  1UG1 A;  5I22 A;  1VQP Q;  5FRM A;  5GAN j;  2DNU A;  2ESW A;  1C0M A;  3ZFJ A;  4L6V 5;  1QP2 A;  3HHT B;  3VRY A;  4C8Q G;  2J7I A;  3JV3 A;  3C95 A;  4FM4 B;  1VQM A;  3P8H A;  3M9Q A;  3J80 E;  3OYB A;  3PMI A;  4IKF A;  1I5O B;  5HY6 A;  3CCJ T;  3I56 A;  2EJF A;  4J8O A;  1SF9 A;  5J39 A;  5C0M A;  2LQN A;  4OMO A;  2LVM A;  1PCX A;  2VGN A;  1AEY A;  1B3Q A;  3EH1 A;  2VC8 A;  2RJD A;  1D09 B;  4BI8 B;  4OMM A;  4C5E A;  4PJO D;  2YUQ A;  4J9C A;  1UGQ B;  3OYK A;  1VQ4 Q;  4M78 C;  1Q82 R;  2JXB A;  4N0A C;  2E64 A;  4E47 A;  5CKH A;  5GMK i;  3VS4 A;  2CS7 A;  4B9W A;  5KYN A;  4OML A;  4Q5W A;  2MMP A;  3DB3 A;  3MPU B;  1M5Q 1;  2QDY B;  4F7U E;  2HKQ B;  4M7A G;  3F70 A;  3CCE Q;  4KGV B;  3KUF A;  2E65 A;  1YJ9 A;  2HEQ A;  5LJ5 g;  1QW1 A;  1RI9 A;  4OB3 B;  2V26 A;  2OTJ T;  2A0F B;  3G7Z A;  3V8K A;  1KD1 C;  1IRX A;  2FG0 A;  2K7A A;  5GAM d;  3NHN A;  4BY6 B;  2LJ3 A;  2P4R A;  2DEQ A;  1LCK A;  2DJZ A;  3RUX A;  1MGQ A;  3EAE A;  2QA4 T;  2CP0 A;  3HP9 A;  2D0Q B;  3PVQ A;  4PLI A;  2FVU A;  1WXB A;  2MWO A;  5GAO m;  4M75 A;  2GBQ A;  3R6O A;  1QVP A;  2YWW A;  4AFQ C;  5FRO A;  5HK0 A;  2V1Q A;  4XU0 A;  2ENM A;  4C92 G;  4NS5 A;  4LD6 A;  2QDL A;  2EIF A;  4BI4 A;  4PLL A;  5IXB A;  1H3H A;  3L2Q A;  3URG A;  3VS5 A;  1EX4 A;  4JZ3 A;  1H64 1;  5FW9 A;  3TQ7 P;  3QJ6 A;  4DBH A;  2VAS A;  5GAN d;  4IUT A;  3H8Z A;  3UWN A;  1HJD A;  2CZ7 B;  5I2S A;  3RMS A;  4ZTF A;  2XD0 A;  3H0H A;  1ABQ A;  1QVF S;  4L5G A;  4FT4 A;  2K5I A;  5LJ5 j;  1U1T A;  4F17 A;  3GPL A;  4AFU C;  3QPH A;  2DF6 A;  1IZ6 A;  2KT1 A;  1W2B P;  4CC7 A;  1KQS P;  2E4H A;  1WXT A;  2E5K A;  4YTL A;  3JCM f;  1WZO A;  2OAU A;  1GFC A;  1YNZ A;  4CI0 C;  2QAS A;  1VYV A;  1F1B B;  4JS5 A;  4PJO E;  3V8L A;  3JCM g;  4FW1 A;  4M7D F;  3CPF A;  2KNB B;  1R8O B;  3QII A;  2VXE A;  1Y96 B;  2DL8 A;  3NMZ C;  2RI5 A;  3UPU A;  1VQP T;  1BIA A;  3E2U A;  4M78 G;  1OPK A;  2C0I A;  2MCN A;  4XU1 A;  2K5F A;  4XQ3 A;  2ABL A;  3VJP A;  3GP8 A;  4UC4 A;  1ZUK A;  1X6O A;  2FYK A;  4E7S A;  3QZ5 B;  2PVO B;  2MAM A;  2VVK A;  2ZAE A;  1GFD A;  3R6N A;  2KYB A;  2XDP A;  4HA8 A;  1NLP C;  3QBY A;  5GAO r;  2GQV A;  2RQR A;  2QAZ A;  1N9S A;  4E7L A;  1M90 C;  3QDR B;  2KE9 A;  3JCM b;  2XI9 A;  5GAO p;  1VQ4 T;  2KAF A;  5CVI A;  3JB9 F;  3MO8 A;  4HT9 A;  3QUI A;  1M1K U;  5CCA A;  1VQ9 A;  2PZ1 A;  4KH0 B;  4PL6 A;  2YDL A;  1OZ2 A;  2LQW A;  1GL5 A;  1KHC A;  5KE3 A;  1V29 B;  2DIL A;  4CC2 A;  2FZC B;  4A4E A;  3CCE T;  3GNF B;  1PD0 A;  3OW2 A;  4EIK A;  3I9Q A;  1B34 A;  2DZC A;  4FT2 A;  2HBW A;  4C0Z A;  2DL3 A;  4FYV B;  4ZGJ B;  4C8Q F;  3M58 A;  1SRL A;  1GBQ A;  1UEB A;  3HFN A;  4F7U G;  2CUD A;  1WJQ A;  1XOV A;  2JTM A;  4D8D A;  2XID A;  3OYL A;  3MEW A;  2QGF B;  4FSX A;  2K4Y A;  4FYW B;  4DOV A;  1WHG A;  2H3E B;  1G5V A;  2DIG A;  1KHI A;  3M59 A;  1QWE A;  1BI0 A;  2CSI A;  3UF4 A;  1MNE A;  2L3S A;  3OYY A;  1QVG A;  1KIK A;  3UT1 A;  4J6W A;  1D1A A;  3V7C A;  4QQ6 A;  1SPK A;  5KYU A;  2LJ1 A;  3AT1 B;  5FRN A;  1YIJ Q;  1I0C A;  1VQ4 A;  3RIR A;  4BE0 A;  2HMA A;  4JS4 A;  1QCN A;  1ABO A;  4OP0 A;  2JT4 A;  4P5N A;  1AZE A;  1VQM Q;  4JJD A;  4M7A F;  2XKO C;  2JMA A;  1K8A U;  5CK9 A;  2JM8 A;  1SRM A;  2PU9 B;  3I56 Q;  1M8V A;  1MMG A;  4BY6 C;  2O31 A;  2LDM A;  1K9A A;  2YUO A;  2M1H A;  4E2F B;  1N9R A;  3UA6 A;  8AT1 B;  2HAX A;  3I35 A;  2J06 A;  2KRS A;  1VQ7 A;  2EJG A;  4VUB A;  3HRU A;  1KC8 C;  2E3H A;  4F14 A;  2R5M A;  2K57 A;  1JU5 C;  1YP5 A;  3LYI A;  1RAI B;  1B7T A;  1G83 A;  2PUK B;  2RK2 A;  2QQ9 A;  2LT4 A;  4PK4 A;  4R55 A;  3EH2 A;  2EKO A;  4A4H A;  4FL6 A;  3CCR A;  1TSF A;  1RAE B;  4PJO G;  1YJ9 Q;  5KCH A;  3JCM d;  1LNX A;  3S3O A;  2J05 A;  3TEE A;  1P92 A;  3RES A;  1K73 U;  4J9D A;  2YUP A;  2KT8 A;  2FPE A;  2IIM A;  2P4T A;  4M75 B;  2GQI A;  2DL7 A;  1YHQ A;  4M77 A;  4J5Y A;  2EKH A;  2FPD A;  3M0S A;  1MUZ A;  4M7D A;  2DJQ A;  2DA9 A;  4OMF B;  1Q82 C;  2OAW A;  4IIO A;  4OMQ A;  2DVJ A;  3RER A;  1RLQ C;  1JBM A;  4E7I A;  3NTH A;  3AHU A;  2FZK B;  5LJ3 g;  1ZLM A;  3OA6 A;  1JO8 A;  2EVR A;  2FHD A;  5CKE A;  5CO7 A;  2ZGW A;  3MP8 A;  5FWB A;  1VIF A;  1M1K R;  1RAG B;  3CCS A;  4A54 A;  4XU2 A;  1VQ6 A;  2IVW A;  4CRI A;  3HRS A;  1RI0 A;  1EZZ B;  4RTT A;  1HK9 A;  4FYY B;  1OUL A;  5A0G A;  4M78 F;  4QVZ A;  3UDC A;  4GBQ A;  3HSB A;  3CC2 A;  2KXC A;  1PG5 B;  1KQS S;  2NYS A;  2LMJ A;  2D8H A;  2O88 A;  3OB9 A;  4PJN A;  5FLX E;  2NUP A;  2DAQ A;  5I11 A;  2JTE A;  3JRZ A;  4X9C A;  2MK5 A;  4PNO A;  5FU6 B;  3M55 A;  4LUD A;  2YUN A;  4DBF A;  2AKL A;  2LZ6 B;  2WSE E;  1E6G A;  3NPF A;  4C0D B;  3INZ A;  3JCM c;  2W10 A;  3MP1 A;  1WXU A;  3M4Y A;  4QVD A;  2ZCF B;  4C0F A;  2XIC A;  4M4Z A;  3ULR B;  2F69 A;  3EFO A;  3DB4 A;  4AMC A;  1ZA2 B;  4Z8A A;  1BI1 A;  2F1L A;  3VS0 A;  2EGE A;  5LJ3 j;  1OU9 A;  3NTK A;  4J9F A;  5L23 A;  4RTU A;  5IN1 A;  1S72 A;  1YIJ T;  4L59 A;  1PRM C;  4FU6 A;  5GAN g;  1EIF A;  2D6F A;  3LGF A;  2D9T A;  2G3R A;  4JLG A;  2LNV A;  3RMQ A;  1VQM T;  1OEB A;  4WTO B;  1K8A R;  3JSC A;  4X1V A;  3EFS A;  3I56 T;  4J9H A;  1TTH B;  2CYZ B;  5IHN A;  4IUV A;  3QXE B;  3TSZ A;  3J81 E;  5FU7 B;  5A2Q E;  3D7S B;  2QTX A;  4F7U F;  1FYN A;  4J83 A;  4KUI A;  4XTU A;  4XTV A;  1JJ2 S;  1VQN A;  2E6Z A;  3H0I A;  3RBB B;  2WSC E;  1OOT A;  3QYG B;  1WPY A;  4FYX B;  3G1J A;  2X51 A;  2XG8 D;  4E7Z A;  1PSF A;  1B34 B;  4PFZ A;  3MHX A;  3CQT A;  5KYW A;  1VQ9 Q;  2LQ8 A;  2MPX C;  2LX9 A;  2B86 A;  4MMK A;  2K5L A;  2HL3 A;  4AFS C;  4ZGE B;  1OV3 A;  2VV5 A;  2GF7 A;  2LC4 A;  3OYI A;  1D0Z A;  5I2M A;  1YJ9 T;  1K73 R;  2KRM A;  1YIJ A;  2KSS A;  2ED1 A;  4HCZ A;  1NJI U;  1BYM A;  2EQI A;  4OGE A;  3VKI A;  1UGP B;  3CXC S;  3SD4 A;  1AWX A;  1YWP A;  3HL8 A;  2CZ0 B;  4C5I A;  3A1P A;  2DVE A;  4ORZ A;  2EJ9 A;  4X9D A;  4E7K A;  1D3B A;  2KMT A;  5KYU B;  4C92 A;  2A37 A;  4J9B A;  2A3L A;  2EYY A;  1MV0 B;  4C5H A;  1UGR B;  3SWN A;  2EYZ A;  2EFI A;  1ZUU A;  2XHC A;  5GAO q;  4HCK A;  2O01 E;  1M27 C;  2BKD N;  3TRE A;  1D1B A;  1BCM A;  2ROT A;  3GNG A;  2YRC A;  1SG5 A;  5LJ3 d;  1M3C A;  4J6Y A;  3PIO A;  2DBM A;  3RDV A;  2AZV A;  1X6G A;  3L2W A;  4HCC A;  1BI3 A;  3U23 A;  5GAN 7;  2RJF A;  3EHR A;  1NLO C;  3EG9 A;  2K3Y A;  4PJO F;  3OW2 P;  2C0O A;  1GCQ C;  1GXI E;  4ATO A;  2YSQ A;  2CDT A;  4M75 C;  1D0X A;  1MND A;  1YFN A;  2SRC A;  1H92 A;  4LDW A;  3C0C A;  2EQK A;  3PMT A;  2FRW A;  2DPP B;  3VS7 A;  1T3S A;  2JTF A;  1ZHI A;  2DRM A;  1U06 A;  4PFP A;  1G3W A;  2P0K A;  1VQ7 Q;  2RN8 A;  2DXU A;  4RTW A;  1Z9Z A;  4A4F A;  1AZG B;  5IH2 A;  1VA7 A;  1NM7 A;  4JLI A;  1PNJ A;  2OTL A;  2CP2 A;  4BI3 A;  1I8F A;  1GCQ A;  2M02 A;  1QVG P;  2BZX A;  2G6F X;  2EQU A;  3CCR Q;  2JM9 A;  3CC7 A;  1AWJ A;  3CMA A;  1O75 A;  3JCM V;  3QSU A;  4M77 B;  2R58 A;  3A98 A;  4EMG A;  3VU3 C;  4C5G A;  4ZN1 A;  2RJE A;  3EG0 A;  5GAM e;  2NUZ A;  4M7D B;  1W1F A;  1JB0 E;  2JZ2 A;  1RUW A;  3H0F A;  1HD3 A;  4MDW A;  1MMN A;  2HZY A;  1YHQ Q;  2X4X A;  2LX7 A;  3OS0 A;  2SEM A;  2L3P A;  2P0Q A;  4R0K A;  5L8R E;  2DRK A;  1OX8 A;  4CC3 A;  5FU6 C;  1K0X A;  1LJO A;  4KT0 E;  3QHS A;  3I55 A;  2JNG A;  5GJV B;  4C0D C;  3DLL A;  2K6D A;  4LNP A;  2RMO A;  2DD5 A;  2AHJ B;  2QEX Q;  3M5A A;  1ZA1 B;  2MIO A;  1LVK A;  1WDX A;  2GFU A;  2DTH A;  2MOX A;  1IHW A;  2YLB A;  3X20 B;  1K76 A;  3ZBD A;  4Y92 A;  2HDA A;  1NEG A;  3G4S A;  5GAN e;  2LT1 A;  2JOY A;  3BFM A;  3O8V A;  3QZ9 B;  2E6N A;  1VQ9 T;  3CCS Q;  4BDZ A;  1TS9 A;  4GLM A;  1VQ6 Q;  1UHF A;  4MZM A;  2NUP B;  4Y91 A;  1D0Y A;  3G71 A;  5DLO A;  2CKK A;  2CP5 A;  4QT7 A;  3JB9 I;  3CC2 Q;  1M3B A;  1FMW A;  2V8K A;  4Z02 A;  2RHI A;  3H6Z A;  1NZ9 A;  3S3N A;  3PGG A;  1NJI R;  3NFC A;  2JS0 A;  1BU1 A;  5FU7 C;  3PIP A;  3EFO B;  2RHU A;  3L2Z A;  1PRL C;  2FB7 A;  3V7R A;  1BCO A;  2YT6 A;  2DEU A;  5KYX B;  3CCM A;  1NPR A;  2C0T A;  4D6W A;  4NOY A;  2R57 A;  2EGC A;  4DEX A;  1UJ0 A;  3THK A;  1Q81 U;  1M1K C;  1WI7 A;  4J9G A;  2V8I A;  1RL2 A;  1SSF A;  1RAB B;  1S72 Q;  1FX7 A;  1NEB A;  5DM7 R;  5GAO l;  1BIB A;  2X35 A;  3QWX X;  1QCF A;  4PJM A;  1VQ8 A;  4BE1 A;  1NE8 A;  1JJ2 P;  1Y0M A;  1ARK A;  4HKE A;  4RG8 A;  3TSW A;  2QI2 A;  2O9S A;  4TVR A;  2HQX A;  1WLP B;  2DET A;  2QG9 B;  4OMN A;  2CUB A;  4J7I A;  3GOX A;  3V8J A;  1K1Z A;  2NUT B;  2D0N A;  4O6J A;  3WVD B;  1V76 A;  6AT1 B;  3OSV A;  1R77 A;  3C4S A;  2DZ9 A;  4FIB A;  3MEU A;  3M0R A;  2P0P A;  2JW4 A;  2LTO A;  4RCB A;  2JS2 A;  3LWH A;  3KBG A;  1NYG A;  1VQN Q;  2KVQ G;  2XMF A;  2COW A;  2A08 A;  2EYX A;  5KYW B;  1VQ7 T;  2AZS A;  5GAM h;  1UUE A;  2OI3 A;  3EG3 A;  1M30 A;  3CCU Q;  2HQH A;  3CBO A;  3JAM E;  1VQL A;  1OX9 A;  3I5R A;  5CQX A;  3CBM A;  3EG1 A;  2A7Y A;  3G6E Q;  2NLU A;  3FLG A;  2CP6 A;  3UAT A;  3CXC P;  4A53 A;  2HL5 C;  2YRD A;  2JJ9 A;  4DBR A;  2DFU A;  3CCR T;  2BZ8 A;  3S3M A;  1K8A C;  3VRZ A;  2HNI A;  1FMV A;  4JRK A;  4M77 E;  3EGD A;  3ER0 A;  1WQ7 A;  2E70 A;  3QJY A;  1D3B B;  5LJ5 e;  1PWT A;  3RNJ A;  1N8R U;  1XJW B;  3CPW A;  4C92 B;  3LH0 A;  1YHQ T;  2DO3 A;  5GAN 6;  4N4I A;  3E1S A;  2BE7 D;  3VYH B;  4MZT A;  5GAN h;  4BDY A;  1G3Y A;  1SEM A;  4DQ2 A;  3M0P A;  7AT1 B;  5GMK m;  3SWN B;  4AG2 C;  3L42 A;  3WVE B;  5EC7 A;  3EGX A;  1K0S A;  3S6W A;  3BDL A;  5EG2 A; 
#chains in the Genus database with same CATH homology
 2VC8 A;  2K2V A;  3MP1 A;  2RJD A;  3QYH B;  2DXT A;  3M4Y A;  4BI8 B;  4QVD A;  1VQK A;  4C5E A;  4PJO D;  2ZCF B;  1VQL T;  4C0F A;  1UGQ B;  2XIC A;  3OYK A;  4M78 C;  2QEX T;  2K3X A;  3E9G A;  5IT9 E;  4N0A C;  3OMG A;  4RMO A;  2F69 A;  4C8Q B;  2E64 A;  3DB4 A;  4RG2 A;  4B9X A;  5GMK j;  4E7H A;  4E47 A;  2Y4X A;  1BI1 A;  5CKH A;  5GMK i;  4M75 G;  3QKJ A;  1Y7X A;  2CS7 A;  4ZGD B;  5LJ3 j;  3NTK A;  4B9W A;  5A0D A;  3OW2 S;  1K73 C;  5IN1 A;  4Q5W A;  1S72 A;  1YIJ T;  2MMP A;  2RO0 A;  3P8B B;  4FU6 A;  3DB3 A;  4L59 A;  5GAN g;  1Q7Y U;  3HPW A;  2RHY A;  2QXF A;  3CCS T;  1M5Q 1;  1EIF A;  2QDY B;  4M77 C;  4F7U E;  3OYD A;  1VQ6 T;  4XTY A;  2D6F A;  4M7A G;  3F70 A;  3FB9 A;  2ZPB B;  3LGF A;  1YIT A;  5CKD A;  2D9T A;  2G3R A;  2KDS A;  3KUF A;  3X28 B;  2E65 A;  3X25 B;  4OB0 B;  4M7D C;  1YJ9 A;  4JLG A;  1QW1 A;  1Y71 A;  2LNV A;  4OB3 B;  3RMQ A;  5LJ5 g;  1VQM T;  1W2B A;  2OTJ T;  3CC2 T;  1O9S A;  3G7Z A;  3V8K A;  3JB9 D;  1KD1 C;  2ZZD A;  3LW5 E;  2GFA A;  1VQO T;  3JSC A;  4ELZ C;  5LJ3 h;  5GAM d;  3EFS A;  4BY6 B;  3I56 T;  2CYZ B;  2ZPG B;  2DEQ A;  5CKF A;  3OY9 A;  4IUV A;  3QXE B;  3V7S A;  2WAC A;  2DJZ A;  3RUX A;  3J81 E;  5FU7 B;  5A2Q E;  3OYN A;  2JVV A;  2QTX A;  1MGQ A;  3EAE A;  4F7U F;  4J83 A;  3OBY A;  4IUQ A;  4XU3 A;  4KUI A;  5CR2 A;  2QA4 T;  3HP9 A;  4XTU A;  4PJO C;  1QVG S;  2LRQ A;  2D0Q B;  4PLI A;  4XTV A;  2FVU A;  5D6W A;  2MWO A;  5GAO m;  1JJ2 S;  4V2S A;  3DKM A;  2QQS A;  3OYC A;  1VQN A;  2E6Z A;  4M75 A;  1YJW A;  3R6O A;  2YLC A;  3OS1 A;  2DTI A;  1U8R A;  1VQK T;  4A4K A;  1QVP A;  1X01 A;  2RHX A;  2WSC E;  4C8Q D;  3P8D A;  2LCL A;  1I4K 1;  3M4G A;  3QYG B;  1WPY A;  4M7A B;  5FRO A;  3OYJ A;  1M90 U;  5HK0 A;  3FIF A;  4N4H A;  2O4X A;  2XG8 D;  5DY9 A;  5C6S A;  3A5Z B;  3HFO A;  4XU0 A;  1PSF A;  4C92 G;  1YJN T;  1B34 B;  4NS5 A;  4LD6 A;  3FEO A;  3MHX A;  2VGM A;  3JCM e;  1Y07 A;  2EIF A;  5CQY A;  4PLL A;  4BI4 A;  4XTX A;  2QEX A;  3L2Q A;  2LQ8 A;  3URG A;  2LX9 A;  1S72 T;  2KK4 A;  2Y4Y A;  1H64 1;  3QSU A;  4MMK A;  1VQP A;  2K5L A;  1XQH A;  4ZGE B;  2VV5 A;  1N8R C;  4PJO A;  3QJ6 A;  1M9S A;  1YIT T;  1HXD A;  2GF7 A;  2LC4 A;  5GAN d;  3OYI A;  5I2M A;  4IUT A;  3H8Z A;  1YJ9 T;  5GAN 8;  3OS5 A;  3UWN A;  2CZ7 B;  3GIB A;  5I2S A;  1YIJ A;  3RMS A;  4ZTF A;  3C12 A;  1YI2 T;  2XD0 A;  2MI6 A;  2KSS A;  3RKW A;  4A4G A;  5LJ5 d;  1QVF S;  3PFS A;  4L5G A;  4HCZ A;  3X24 B;  3PTA A;  3JCM X;  3L1A A;  4FT4 A;  2K5I A;  5GAN 2;  5LJ5 j;  1U1T A;  2EQM A;  3GPL A;  1NJI U;  1BYM A;  4OGE A;  1Q86 C;  3OMC A;  4QQG A;  3VKI A;  4JRP A;  4DA4 A;  3QPH A;  2XDB A;  5HK3 A;  4M7D E;  1DJ7 B;  4EMK B;  3JB9 J;  5GAN 3;  1UGP B;  3CXC S;  4M75 D;  3SD4 A;  1IZ6 A;  3HRT A;  3OYA A;  3HL8 A;  2CZ0 B;  4C5I A;  1I5L A;  4BD3 A;  2DVE A;  1N27 A;  1VQO A;  2EJ9 A;  2M9U A;  4X9D A;  4E7K A;  1D3B A;  2KMT A;  1VQN T;  4YTL A;  3JCM f;  4C92 A;  5D6X A;  5LL6 S;  5GAM f;  3JCM W;  1YJW T;  2CZ6 B;  4IUU A;  2OAU A;  1WQW A;  4KBM B;  2PVD B;  4M7A D;  1M4Z A;  2A3L A;  4CI0 C;  3CCU T;  4N4G A;  2RD1 A;  4C5H A;  3LX7 A;  3C94 A;  5LJ5 h;  1UGR B;  4JS5 A;  1OYX A;  1OI1 A;  2JUF A;  4M75 F;  3SWN A;  4J6X A;  4KUL A;  3JCM g;  3V8L A;  1Q86 U;  3CEY A;  2EFI A;  3G6E T;  4M7D F;  4RCC A;  3CPF A;  2XHC A;  5GAO q;  2H3J A;  2QQA A;  2O01 E;  5A0L A;  1R8O B;  2BKD N;  3QII A;  3TRE A;  2VXE A;  1Y96 B;  3RKY A;  3ZEH A;  3GNG A;  2RI5 A;  3UPU A;  1VQP T;  1WNL A;  1BIA A;  5LJ3 d;  4J6Y A;  3PIO A;  2X4Y A;  2VUB A;  3M53 A;  4M78 G;  5J26 A;  1YJN A;  3L2R A;  3CD6 A;  3L2W A;  4HCC A;  1BI3 A;  4C8Q A;  4XU1 A;  2K5F A;  1KG1 A;  3A8L B;  5GAN 7;  2F5K A;  4II1 A;  4XQ3 A;  2L89 A;  3CCE A;  2RJF A;  3VJP A;  3GP8 A;  4UC4 A;  4RKU E;  2K3Y A;  4PJO F;  3J7A F;  1X6O A;  2ZPE B;  3N5B B;  2RJC A;  2E12 A;  1GXI E;  4ATO A;  5AYF A;  4Y28 E;  2FYK A;  2PQW A;  1W4S A;  4M75 C;  4WF2 A;  3QZ5 B;  2GCX A;  2PVO B;  2MAM A;  3E19 A;  4JJN K;  2E10 A;  2E1H A;  1KQ1 A;  4LDW A;  4QW2 A;  3OSS C;  3JCM Q;  2EQK A;  2XDP A;  1YI2 A;  2L8D A;  3PMT A;  4C92 D;  4HA8 A;  2DD4 A;  3QBY A;  5KH6 A;  5GAO r;  5CIU A;  2DPP B;  2GQV A;  5M9O A;  1KQ2 A;  1KQS A;  3SB2 A;  5GAO n;  1N9S A;  2JTF A;  3CME A;  1ZHI A;  4E7L A;  1M90 C;  1BKB A;  1G3W A;  3M54 A;  3QDR B;  4BUG A;  4IUR A;  2BUD A;  2P0K A;  2DXU A;  3MEA A;  5I21 A;  3VYG A;  4A4F A;  3ME9 A;  4J7F A;  3JCM b;  1LOJ A;  2LQK A;  1WJS A;  1I81 A;  4JLI A;  2XI9 A;  2OTL A;  2RB6 A;  4M78 B;  5GAO p;  3VUB A;  1VQ4 T;  4BI3 A;  4C92 F;  1I8F A;  4HT8 A;  2HQE A;  2KAF A;  5CVI A;  4C8Q E;  3JB9 F;  3OYE A;  3MO8 A;  1XNI A;  4HT9 A;  2EQU A;  1KC8 U;  3QUI A;  3CCU A;  2PVG B;  1M1K U;  5CCA A;  1VQ9 A;  3CC7 A;  4PL6 A;  3SFM A;  4C0G A;  4DOW A;  1OZ2 A;  1O75 A;  1G3T A;  2DXC A;  3CMA A;  3JCM V;  1KHC A;  3G6E A;  5KE3 A;  2EWN A;  2R58 A;  4M77 B;  2MWP A;  4EMG A;  1V29 B;  3CD6 T;  1X75 C;  4M7A A;  2KY9 A;  3VU3 C;  4C5G A;  4ZN1 A;  2RJE A;  3TCJ A;  3CPW S;  5GAM e;  3FJP A;  4A4E A;  1NJI C;  3CCE T;  3GNF B;  3OW2 A;  4M7D B;  2KQW A;  3CCV T;  1JRI A;  1JB0 E;  1B34 A;  2JZ2 A;  2DK3 A;  2DZC A;  4FT2 A;  5J3B A;  4C0Z A;  4MDW A;  2F5T X;  4ZGJ B;  4BE2 A;  4C8Q F;  1G3S A;  3M58 A;  2EQJ A;  4C92 C;  1UEB A;  3HFN A;  2X4X A;  5LJ3 f;  3CCL T;  3OS0 A;  2YHT A;  4F7U G;  1ZQ1 A;  3LWI A;  1WJQ A;  1XOV A;  1YCY A;  2X4W A;  2JTM A;  3JCM h;  1N6A A;  2P0Q A;  4OB2 B;  1K9M U;  5L8R E;  4KUD K;  3SWN C;  3Q1J A;  2XID A;  5FU6 C;  4OGC A;  1LJO A;  2DTO A;  3OYL A;  4KT0 E;  3QHS A;  3I55 A;  2JNG A;  3MEW A;  2DIQ A;  4FSX A;  3CCQ A;  3CME T;  2K4Y A;  2EYQ A;  3MCA B;  4DOV A;  3JCM P;  4C0D C;  3DLL A;  4M75 E;  4JDS A;  4PKC C;  1G5V A;  2HD0 A;  2DIG A;  1KHI A;  2DD5 A;  3M59 A;  2MF2 A;  2AHJ B;  4M78 D;  1XTD A;  3M5A A;  1BI0 A;  3M57 A;  2OTL T;  2RHZ A;  2RI3 A;  4XTW A;  3OS2 A;  1Q82 U;  3OYY A;  3WXM B;  2GFU A;  2DTH A;  2E41 A;  4LDY A;  4EMK A;  3OYM A;  4C8Q C;  3UT1 A;  1QVG A;  2RA2 A;  3A8O B;  4J6W A;  4M7A E;  2YLB A;  3X20 B;  1JJ2 A;  3V7C A;  5D6Y A;  3ZBD A;  4QQ6 A;  2QQB A;  5GMK l;  3G4S A;  4XTZ A;  4OF1 A;  5GAN e;  3KXT A;  2DKG A;  2LT1 A;  3EFR A;  4JUV A;  3OYH A;  2JOY A;  3BFM A;  3O8V A;  4MDX A;  5FRN A;  4MML A;  3QZ9 B;  2Y90 A;  1VQ4 A;  2E6N A;  1VQ9 T;  3RIR A;  4XAX B;  3CC7 T;  4HCB A;  5CKB A;  3GF5 A;  3SDZ A;  4BDZ A;  4BE0 A;  4F7U B;  3LGL A;  3A8H B;  1W2B S;  5GAM g;  3CMA T;  4MZM A;  4JS4 A;  4M7A F;  4QVC A;  4EPC A;  3OYF A;  1M1G A;  4OP0 A;  4Y91 A;  4P5N A;  4BB7 A;  3G71 A;  4LDV A;  5DLO A;  1FXX A;  3CC4 T;  2L3R A;  2CKK A;  3JB9 I;  5CAI A;  4OVA A;  3A8G B;  2V8K A;  2XKO C;  4Z02 A;  3JCM J;  2JN0 A;  2RHI A;  1YBY A;  3OBW A;  3OYG A;  5CK9 A;  1K8A U;  3FDR A;  3H6Z A;  2CZ1 B;  1U1S A;  2L5Q A;  1NZ9 A;  1VIE A;  1Y96 A;  3S3N A;  1NPP A;  2PU9 B;  4JRQ A;  1M8V A;  5HKC A;  4BY6 C;  3BDU A;  3PGG A;  3ASK A;  3NFC A;  2LDM A;  4GY5 A;  3VUZ A;  5KCO A;  3CCV A;  3RKX A;  3HKS A;  3X26 B;  3OQ5 A;  5FU7 C;  2M1H A;  2ZPF B;  1N9R A;  3PIP A;  1MHN A;  1QVF A;  2RHU A;  3I55 T;  1BI2 A;  2HAX A;  2X4J A;  4GLK A;  3CCQ T;  1WJR A;  3L2Z A;  2FB7 A;  3FRN A;  2YRV A;  4LDU A;  3V7R A;  4C92 E;  2RH2 A;  1ZBX A;  3DLM A;  2WSF E;  3CCM A;  4M77 G;  2PUO B;  1NPR A;  5GAN f;  2VXF A;  1VQ7 A;  2EJG A;  3TU4 K;  4D6W A;  4VUB A;  4NOY A;  2R57 A;  3HRU A;  4X34 A;  3CXC A;  3A8M B;  4EDU A;  4M7D G;  1KC8 C;  3CCL A;  3CBP A;  5GMK e;  4EMH A;  1Q81 U;  2VYT A;  1OZ3 A;  3E9F A;  1M1K C;  4O5V A;  2R5M A;  4M7A C;  3MEV A;  2K57 A;  5LJ5 f;  4BAC A;  5LJ3 e;  4NL3 A;  4ME7 A;  2V8I A;  3LYI A;  3G4S T;  1VQ5 A;  2I2L A;  1RL2 A;  2PUK B;  4ZTJ A;  2RK2 A;  3L2U A;  1SSF A;  3NTI A;  3QO3 A;  2QQ9 A;  2LT4 A;  5GAN 5;  2M16 A;  2QQR A;  4R55 A;  1AHJ B;  1FX7 A;  2RI2 A;  5DM7 R;  2EKO A;  4A4H A;  5GAO l;  1H3Z A;  4FL6 A;  4JRI A;  3CCR A;  2RM4 A;  4XK8 E;  1BIB A;  4ELY C;  5GMK h;  2E5Q A;  2X35 A;  4M78 A;  2BIV A;  1VQ8 A;  4PJO G;  4BE1 A;  1NE8 A;  4N0A A;  5KCH A;  2V8J A;  3VV0 A;  3JCM d;  3G71 T;  1LNX A;  3S3O A;  2EAY A;  4NL2 A;  3TEE A;  2RK1 A;  1P92 A;  3RES A;  1K73 U;  2M0O A;  3PNW C;  4HKE A;  4RG8 A;  2QI2 A;  4TVR A;  1K9M C;  2HQX A;  5GAM j;  2P4T A;  2C06 A;  4R56 A;  2ZPI B;  3MP6 A;  4J7I A;  3GOX A;  4M75 B;  3M56 A;  1IRE B;  3V8J A;  1YHQ A;  3CCJ A;  3L2V A;  2FL7 A;  3CC4 A;  4M77 A;  1M1F A;  3MET A;  4J5Y A;  3BY7 A;  4O6J A;  4EMK C;  3WVD B;  3OSV A;  2LCC A;  4M7D A;  3C4S A;  2O4X B;  5IAY A;  2DZ9 A;  4FIB A;  3BW1 A;  4OMF B;  1Q82 C;  1KD1 U;  2XU8 A;  3MEU A;  4LDX A;  2P0P A;  1PSE A;  2LTO A;  4RCB A;  1UGS B;  3LWH A;  3KBG A;  2KVQ G;  3RER A;  3CCM T;  1VQ7 T;  1JBM A;  4E7I A;  3LLR A;  5GAM h;  3NTH A;  2DXB A;  3AHU A;  5DLQ E;  3JB9 G;  3CBO A;  3JAM E;  4E7J A;  1VQL A;  1QP3 A;  4LD9 K;  5LJ3 g;  5CQX A;  4PJO B;  4PJO E;  2ZPH B;  3CBM A;  4M78 E;  1FWZ A;  2IG0 A;  2A7Y A;  3OA6 A;  2CGH A;  2FHD A;  2NLU A;  1VQ5 T;  4QQD A;  3FLG A;  5CKE A;  5CO7 A;  1UB4 A;  3GLX A;  3JB9 H;  2ZGW A;  3MP8 A;  1VIF A;  1VUB A;  3FC3 A;  5FRM A;  4A53 A;  3T9N A;  5GAN j;  1TH7 A;  3CCR T;  3PT9 A;  3S3M A;  3CCS A;  1K8A C;  4A54 A;  4XU2 A;  3ZFJ A;  2HNI A;  1VQ8 T;  4L6V 5;  5KE2 A;  1QP2 A;  3HHT B;  1VQ6 A;  2IVW A;  2R5A A;  4CRI A;  4JRK A;  4M77 E;  4C8Q G;  5GAN 4;  3HRS A;  1RI0 A;  3ER0 A;  1WQ7 A;  3C95 A;  1HK9 A;  2E70 A;  4FM4 B;  1VQM A;  4M77 D;  4M78 F;  4QVZ A;  3UDC A;  5A0G A;  3QJY A;  3P8H A;  2XDD A;  3M9Q A;  1WGS A;  1D3B B;  3HSB A;  5LJ5 e;  2OTJ A;  3CC2 A;  3J80 E;  3QG1 A;  1N8R U;  4IUP A;  4M7D D;  3OYB A;  3PMI A;  3CPW A;  4C92 B;  1KQS S;  2HBP A;  3LH0 A;  4F7U A;  1YHQ T;  2DO3 A;  4IKF A;  5HY6 A;  5GAN 6;  4OB1 B;  3CCJ T;  4N4I A;  3E1S A;  1Q7Y C;  2XK0 A;  3I56 A;  3VYH B;  3OB9 A;  4MZT A;  5FLX E;  1G3Y A;  5GAN h;  4BDY A;  2EJF A;  2DAQ A;  4J8O A;  4DQ2 A;  5J39 A;  5GMK m;  3JRZ A;  4MZP A;  4X9C A;  3L42 A;  4PNO A;  5FU6 B;  3M55 A;  3SWN B;  3WVE B;  4ZN3 A;  5C0M A;  2LVM A;  1Q81 C;  2QA4 A;  2WSE E;  2VGN A;  4M77 F;  3S6W A;  4C0D B;  3INZ A;  3JCM c;  3BDL A;  2B8A A;  5EG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...