2K4YA

Nmr structure of feoa-like protein from clostridium acetobutylicum: northeast structural genomics consortium target car178
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
86
structure length
86
Chain Sequence
MTKGIGLNEVEIKSKVKVIGIVPESKVRRKIMDMGIVRGTEIYIEGKAPMGDPIALRLRGYSLSLRKSEAKDILVEVLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FeoA-like protein
publication title NMR Structure of FeoA-like protein from Clostridium acetobutylicum: Northeast Structural Genomics Consortium Target CaR178
rcsb
source organism Clostridium acetobutylicum
molecule tags Metal transport
total genus 16
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k4yA00
2K5FA 4O5VA 2GCXA 1FX7A 1BI3A 2K5LA 1G3TA 1BI0A 2K4YA 1BI2A 1G3SA 3GLXA 2K5IA 1QVPA 2QQAA 2LX9A 2QQBA 3HRSA 3MHXA 1BYMA 5CVIA 1BI1A 3E19A 1FWZA 3HRTA 1P92A 1QW1A 4O6JA 1G3WA 1U8RA 2H3JA 2QQ9A 3HRUA 1G3YA
chains in the Genus database with same CATH superfamily
3V8LA 1U3OA 4IURA 3A8HB 3P8BB 2F5TX 2V8IA 1I1JA 2QA4T 2QGGA 4A4EA 3G71Q 2OI3A 2CZ1B 4EMGA 1VIEA 2DKGA 4LD6A 1BIAA 2GFUA 4BY6C 3QSUA 2FL7A 2JNGA 1O9SA 2FPEA 2H3JA 1GFCA 1I5LA 5GANd 4DEYA 5LJ5d 5FLXE 3ZBDA 4F7UB 2DILA 2ED0A 2YXYA 1JB0E 1B34A 4J9GA 1Y71A 2KAFA 4C92E 2OTLA 2OAUA 1D1CA 1GXIE 3QIIA 1UGVA 1QVGA 4HVUA 2EIFA 4L59A 4XTXA 1D3BA 1PM3A 4M75D 2DD5A 5HCKA 1YCSB 1W4SA 1X6GA 1X27A 1IHWA 3CC2Q 4ZNXA 2PUOB 2DIGA 4M77B 2VYTA 3H41A 3JCMf 2VGNA 3CBPA 4LDXA 3E9FA 1T3SA 3OSSC 3OMCA 2KI7A 2KVQG 1WIEA 4DBQA 2E12A 3CCMQ 2C0TA 2PNIA 1SSFA 3OY9A 1JJ2S 1EFNA 5EC7A 3A5ZB 3G4ST 2VXEA 3JB9I 2RM4A 2K3XA 3HKSA 4FSSA 4JJNK 2CREA 1X2QA 4KUDK 1J3TA 4AFSC 1RLQC 1UGPB 5KYYA 3I56A 3SWNA 3TREA 3FIFA 3OSVA 1KJWA 3N5BB 5GANe 1ACMB 1I0CA 1YITA 4BI4A 2CH4W 3LWIA 4ATOA 4KULA 2KRSA 2V1QA 4RG2A 3J81E 4RTYA 2LT4A 4M78G 1JEGA 1KQSA 3GNFB 1K73U 3HFNA 1ZLMA 2QEXT 4WTOB 4RKUE 1MNDA 3G6ET 2FZGB 3QBYA 1QCNA 3UT1A 3PMIA 2KNBB 2RI5A 3HPWA 2A0FB 2MPXC 1XNIA 3S3OA 5FU7B 1VQKQ 2BZYA 4LDYA 3ZL7C 2A7YA 2MF2A 2PTKA 3RNJA 3H0IA 2K9GA 2XICA 1Q7YC 2FZCB 1RAFB 1V76A 2DL3A 2DETA 3AT1B 1SHGA 1VQOQ 4RUGA 3ME9A 2P4RA 2GQIA 4FYXB 3VS5A 2K4YA 1PKTA 4V2SA 2RJCA 4F7UG 1ZA1B 3AHUA 4JS5A 1KSWA 5CO7A 1UJ0A 2OTLT 2RK1A 1M3BA 1NEBA 1VQPQ 1M4ZA 2C0IA 2RHIA 4FCYA 1M1KC 2DLPA 1YHQQ 1M30A 1KK7A 2EYZA 4M7DE 6AT1B 1OI1A 4N0AC 3R6NA 5HK0A 2JS0A 4K11A 3NTHA 3L2VA 1D1BA 4M77G 2CT3A 1RUWA 1UHCA 2RB6A 1EZZB 1AD5A 4M75A 3X25B 4M7AC 3EGDA 2KR3A 2ENMA 3O8VA 4ME7A 5CIUA 3TU4K 3EG9A 3BDLA 5D6YA 1Q82U 1LOJA 5KE3A 1UUEA 1U1SA 2XIDA 2XI9A 2M0OA 1N5ZA 4LE9A 1M5Q1 4WF2A 2GTJA 1PD1A 4JUVA 3IQLA 4HVWA 2M1HA 2E65A 3C12A 1Z9QA 4KGXB 4JLIA 2K2MA 1R77A 4J9HA 5CKHA 1BU1A 2LDMA 2JS2A 3G71A 1U1TA 1RADB 3C95A 1VQ5Q 4PJOC 3I56T 1WJQA 1EX4A 1WGSA 1QKWA 4IUVA 4BD3A 4ZTJA 1WA7A 2R5MA 1CKAA 4PLIA 3OW2A 4C8QC 4O6JA 4C0DC 2CP3A 3QJ6A 2I0NA 3S3MA 2RHZA 1YITT 1I4K1 3QXEB 1NG2A 1KC8C 5KE2A 3FEOA 1JXOA 2ZZDA 4R56A 2EYXA 4PJNA 1K0XA 3Q1JA 1F1BB 5LJ3d 1BKBA 5IXBA 4M7AD 2DF6A 1GL5A 2EQUA 1R8OB 3CC2A 2EWNA 2X51A 4HCZA 2QTVA 4M78E 5DLQE 4C92B 3CMAA 2EJGA 4CRIA 3P8DA 2GCXA 2L2PA 3CCQA 4JRKA 1GCQA 3HP9A 4D6WA 1NYGA 3TSZA 5CQXA 3M0QA 3OBYA 1OYXA 2HNIA 3CCMA 4C5HA 2D0QB 4IIMA 2A28A 1RAGB 2J6FA 2C06A 2K79A 2KK4A 2H3EB 3EGUA 3UA7A 2XU8A 4PJOD 2BE7D 1D1AA 2HQHA 3X20B 2X4YA 2JOYA 4C8QD 4OMFB 2LJ1A 3QO3A 2RO0A 3QPHA 2EGEA 4F7UE 2DE0X 5GAOl 2CDTA 1XOVA 3KFVA 4LD9K 3OQ5A 3SFMA 4FU6A 1LNXA 3CCEA 2L0AA 3FJPA 4HT8A 1FYNA 2BZ8A 2EKHA 1T3LA 5I11A 3JCMJ 3SWNB 2QDLA 3CCJQ 1VQ9A 1WI7A 2QQRA 4QVCA 1C1AA 5KYUA 1I07A 1Y0MA 1E6GA 2EFIA 2WSCE 3RMSA 5GAMg 1QVFP 4M77E 2FPFA 4F7UF 4UC4A 3L2QA 1K8AU 2DXTA 3QHSA 3JCMc 1VQ7Q 5GAOn 1VQKA 1Y96B 2FO0A 2M0YA 2DIQA 1H3ZA 3BW1A 3CMEA 3RDVA 1PG5B 2PVGB 5CKFA 2HSEB 3LW5E 3G71T 1VQOA 1N9RA 4RCCA 3A8LB 5GMKj 4M77F 2WSEE 2PVOB 1WHMA 3HFOA 5GMKl 1M90U 2JTEA 3MEWA 4OMMA 1N6AA 1VQPA 5GAN6 2PQWA 2KYBA 1JRIA 5GAMj 5LJ5g 4QKUA 1YHQA 3MKDA 3DB3A 2ZPFB 3OMGA 1Q86U 1VOMA 3OS2A 3I56Q 2H8HA 2DAQA 4L6V5 4C92G 1OU9A 2YUQA 4RTTA 2XMFA 3CC2T 3A1PA 2DD4A 1G3SA 4ESRA 2LCCA 3FC3A 1TWBA 4OB2B 1WHLA 3M54A 4JRPA 3V7RA 1YWPA 1RAAB 5IHNA 4M7AA 1FWZA 3PIOA 3HRTA 4KBMB 3OYAA 4M7DB 1I8FA 4PLLA 3CCMT 1OQKA 4LN2A 1KG1A 3OYHA 2DEQA 5AT1B 4M75B 4J9DA 4QW2A 2RH2A 1Q81R 3QWXX 5IH2A 1PWTA 4EPCA 4CI0C 4EMKB 1SG5A 2RK2A 3M4YA 1ABOA 1QVFA 1YFNA 4JDSA 5LJ5j 4CC3A 1N8RU 1VQ5A 1B7TA 4PJOA 1TTHB 2EPDA 2K5IA 4LNPA 4C0GA 3CCRQ 2BUDA 4C8QA 5IT9E 4Y92A 2EQMA 1MV3A 3G1JA 4C5IA 3CCET 3MPUB 1S72Q 1M8VA 2RI2A 2Y4YA 4BY6B 1M1FA 1ZSZC 1X6BA 4HKEA 2QQSA 4X34A 5CKBA 2YUNA 4MZTA 3U23A 4Z88A 2LQKA 2JMCA 1PRLC 5CAIA 3FLGA 2LVMA 4JZ3A 4J6XA 3MP6A 3QG1A 4A53A 1IREB 1Y07A 1VQKT 2YUOA 3OB9A 4MDWA 1Q82C 3CMET 4BE0A 4M78B 3PMTA 1D09B 2RF0A 1UG1A 2KROA 1VQOT 1PC0A 2QQAA 1YN8A 2VV5A 1NJIU 2DTIA 1DJ7B 1V29B 3M59A 3OYKA 2A37A 4AFQC 1MMAA 2RQRA 3JCMe 4DBFA 5IXFA 1RAHB 5D6WA 3GLXA 2LNVA 1X6OA 1VQPT 4XK8E 3CD6Q 3S3NA 1YHQT 3SHWA 3META 2P0QA 2LNHB 1QQJA 1WLPB 2KT1A 1GBQA 2HKNA 1GRIA 2DEUA 2CGHA 1NLOC 2M02A 1XQHA 3CQTA 3CCJA 2RHXA 1PCXA 3A8GB 2RA2A 3D7SB 5FU6B 1CKBA 1JBMA 2DFUA 4PFOA 2CP7A 3VS2A 4M7DG 3MHXA 1WXTA 4EIKA 1C6VX 2MAMA 4PJLA 1YIJQ 3T9NA 4M75G 1JQQA 2GGRA 2YT6A 2FHDA 2HDAA 1PNJA 3CMAQ 3L2WA 1VQ7A 4ZTFA 1ZSGA 3CCQQ 3OYMA 3EFOB 4OMPA 3CBOA 2NYSA 1JJ2P 2IG0A 4C92F 1BB9A 3E19A 2DRKA 2XDBA 2JM8A 3EGXB 4NS5A 1VQ5T 3CCVQ 1C0MA 2EQIA 3CPWA 4E47A 2ZPEB 3VS0A 2Y90A 3H8ZA 3SD4A 2LJ3A 4E7ZA 1UGSB 4HCKA 2AT1B 4XTVA 3NTIA 4JS4A 1U06A 2HBPA 3G7ZA 4KRTA 1UB4A 3JAME 2O4XA 2KRMA 4JRIA 2RHYA 1YJ9Q 1ABQA 4J9FA 2DERA 3CC4Q 1QKXA 1AHJB 1M2VB 3H9NA 1QP3A 1MUZA 2FRYA 1WPYA 2DM1A 2GQVA 3CCEQ 5LJ3g 2X3WD 1TS9A 3NGPA 1K9MU 2E6NA 3MP8A 1NZ9A 1VQ9Q 2XK0A 4BDZA 4A4FA 1AEYA 1WXUA 1OZ3A 1WZOA 2COWA 1K8AC 2HZYA 5GAMf 2GFAA 3CC7Q 2HQEA 5GAN3 2Y4XA 5KYXA 3L2ZA 3F70A 4MZPA 2HAXA 1I81A 1UJYA 2EJ9A 1NLPC 1OPKA 3M9QA 2HKQB 3OYDA 4B6MA 2A3LA 4QQDA 2V1RA 2ROTA 1MHNA 4XU0A 5FROA 1QWFA 3CMEQ 1VQLQ 4OB1B 2HSPA 4D8KA 3M0TA 2OTJQ 2DNUA 1OX8A 4M77C 4PJJA 5GJWB 2KE9A 1FX7A 1MGQA 2O2OA 1WFWA 2LX7A 3LX7A 1KHCA 1VQNQ 3CCRA 2HL3A 4GLKA 2X4JA 3OBWA 1M90C 1Q82R 2LZ6B 4B9WA 3CXCS 2QQBA 1S72A 5LJ3j 2KMTA 4PJOB 3V8KA 3CCJT 1X2KA 4LDUA 3PFSA 1ZSZA 2A36A 5GJVB 1JJ2A 1ZQ1A 3LLRA 1JU5C 1B07A 4C8QB 4ZGDB 1VA7A 2D1XA 4OB3B 2KXDA 2QK0A 4HT9A 5LJ5f 2ZGWA 2DXCA 4FL6A 3CCSQ 3EH2A 1K9AA 1ZBJA 2W0ZA 2O9SA 3L1AA 2KSSA 4Q5WA 1M27C 2MMPA 3JSCA 1D0XA 3VS3A 1VQ7T 3OYJA 1SHFA 1RAIB 2BZXA 1U8RA 4M75E 2K2VA 4RCBA 1BI1A 5DM7R 1WX6A 2D8JA 3TCJA 4O5VA 4HA8A 1TXQA 3M0UA 1PD0A 2V8JA 4RTWA 4PFPA 4A4KA 2K3YA 4QVZA 4OVAA 1K76A 1HK9A 4WCIA 4BE2A 2E70A 1ZX6A 2PU9B 3R6OA 5I21A 3MEVA 4F16A 1T0JA 2EQJA 4J9IA 1G3WA 1KFZA 4XU2A 4RTVA 1X43A 4M7DF 2IPOB 5FWBA 9ATCB 1RI9A 2J05A 3E1SA 3MEAA 7AT1B 1G2BA 1M2OA 5FU7C 3CD6A 5L23A 1KQ1A 3FDRA 4LDVA 2QYZA 2MI6A 2RI3A 2RPNA 3L2UA 1HJDA 5I2SA 2F2WA 4J6WA 3FJ5A 1VQ6Q 1PHTA 1H92A 1TH7A 2OAWA 1JXMA 3DLMA 3KUFA 1Q81C 5CCAA 3EHRA 3GPLA 2LT1A 2DJZA 3A8OB 4EDUA 2DPPB 4HVVA 2VKNA 2D6FA 1B34B 2MCNA 1YIJA 3VU3C 2XD0A 4KGZB 3EG1A 2MYSA 2COYA 4MDXA 1BCOA 3TVTA 1D3BB 3ASKA 1HYOA 1D0YA 1TUDA 1NBEB 1QWEA 4J6YA 2NUPA 5DY9A 2MWOA 2QGFB 3URGA 2LX9A 1PSEA 3CCVA 4L5GA 1MMNA 1GBRA 2XG8D 1WHGA 1T0HA 4XQ3A 3CCRT 3JRZA 1BIBA 2BE9B 4PJOG 4C0FA 1K8AR 1S72T 4M78F 1WYXA 4PNOA 3PGGA 4AFZC 2DA9A 4PL6A 1V1CA 1YJ9A 4C8QG 4ANJA 2ROLA 3M53A 4DOVA 3CC4A 3LYIA 3JB9D 2CUBA 2RJEA 2JW4A 2ATCB 3VS1A 1X69A 5KYYB 2X35A 2RQTA 2NLUA 2QASA 1WHJA 4BDYA 3DKMA 1RAEB 5GAN5 3OA6A 2EYYA 3EG2A 3JCMV 2FZKB 4J83A 1M90R 3CC7A 2RQUA 3EH1A 3NPFA 3VS7A 5IAYA 3THKA 2K5FA 1N9SA 3RUXA 1OV3A 2K5LA 3RKYA 4ORZA 4X9DA 4JJBA 2J06A 5FRNA 3KXTA 4C92C 3QKJA 5KYXB 1VQLA 2QXFA 3OS0A 5GAOq 2Z0WA 3LGLA 2OTJA 3KBGA 2AZVA 2GTOA 5ECAA 3UWNA 3JCMW 3CD6T 2JTFA 1VQNA 3I9QA 1YCYA 5IHIA 2ED1A 4X1VA 1MMDA 2X4WA 1KQ2A 4A4GA 4J8OA 1M1GA 4IKFA 1OZ2A 3UDCA 3MCAB 4LUEA 3HHTB 8ATCB 1W2BP 2E1HA 2AHJB 2DL8A 2EKOA 2CT4A 1ZA2B 4IUPA 1W2BS 1Q95G 3V7CA 1Q7YU 1VQ4Q 5GANg 1RACB 4XTUA 4KUIA 4F14A 2QI2A 1IB8A 1QP2A 2L89A 3GOXA 1H641 2AK5A 3P8HA 1SKUB 1YIJT 3CCSA 1XJWB 1BI2A 3DB4A 4N0AA 3JCMh 1N8RR 3NMZC 4E7IA 2JMAA 3CMAT 2J7IA 3WVDB 4M7AE 5LJ3f 1K73C 3VKIA 1FXXA 3CCQT 2KXCA 2JT4A 5EG2A 1AT1B 1JO8A 4X9CA 2NUZA 3S6WA 2R58A 4FW2A 2MIOA 3SWNC 4HXJA 2CS7A 2FYKA 1M1KU 2BKDN 2ABLA 1BK2A 3CCVT 1RABB 1KD1U 3CCUQ 3EGDB 3RESA 2XDPA 2P0PA 1UDLA 2CH4A 3GF5A 3EG9B 2CYZB 1TSFA 2KEAA 2HCKA 2R5AA 4ZGEB 2D0NA 4RTXA 2KT8A 4A63B 2M16A 4BB7A 2DYBA 5M9OA 2VC8A 2ZPBB 3JCMd 1YJ9T 4Z89A 1OULA 5GANj 4PJOE 5GMKh 1WQ7A 3CC4T 3QDRB 2OX7A 4N4HA 4M4ZA 3M4GA 3REBB 1WJSA 2MK5A 3CCLQ 2LJ0A 4GY5A 3E9GA 1VQ6A 1W70A 3I5SA 4C8QE 1ZHIA 2HMAA 5J26A 4BI3A 1XTDA 4B9XA 1R0CB 3OYEA 2W10A 4EMHA 4E7LA 2K7AA 4OMOA 3H0HA 2DBMA 2P4TA 2DBKA 1VIFA 1VQ9T 2DTOA 1AOJA 5GAMh 4ELYC 3EFRA 1BI3A 1M3AA 2ZPGB 4TVRA 4D8DA 2EAYA 2J6KA 3G4SA 1QVGS 3ZFJA 3BE3A 8AT1B 3CC7T 4JPBW 3J80E 3PE0A 1Y57A 4AG1C 3LH5A 1YI2Q 4AT1B 1TUCA 2RNAA 2F2XA 2KBTA 3M5AA 3C94A 1KC8U 1VQLT 1ZUKA 4RTZA 1X01A 2OTJT 1ZBXA 2MWPA 2K3BA 1VQMQ 1WJRA 2QTXA 3M58A 1B3QA 5GAMd 4AMCA 1VQNT 4M7DC 3TQ7P 2NUPB 3VV0A 4DQ2A 1QMCA 5GMKi 2E41A 3SEMA 3INZA 4M75C 1H3HA 3MJXA 4IUUA 2GF7A 1BI0A 5LJ5h 5D6XA 4KT0E 1QCFA 1GCPA 5GAOp 2AKLA 4EMKC 1UE9A 2JUFA 3VUBA 4F04B 2F1LA 3QJYA 2RJDA 1FMKA 2QQ9A 3CCST 3SB2A 5I22A 1M3CA 2L3RA 1PSFA 3OYCA 4MMLA 2E64A 4C5GA 4A4HA 1SRLA 1KQSP 5GAN8 4HCBA 4FSXA 3JV3A 2EJFA 3M56A 4ZN3A 3HRSA 5LL6S 4KH1B 1RL2A 3I55Q 1KQSS 2B8AA 5CVIA 1VYTA 3VS4A 2M51A 2K6DA 2DX1A 2E5QA 5KYUB 2F5KA 1VQ8Q 5GMKe 4M7DD 2FRWA 2KGTA 5KYWA 4C92A 2RQVA 2E5KA 2RJFA 1U5SA 4Y91A 3DLLA 3PIPA 2IIMA 1K9MR 2XDDA 3JCMP 3LH0A 2PUKB 4E7HA 5GAMe 4M78C 3MEUA 1K73R 1VQ6T 1K4US 2L5QA 1GCQC 3RKWA 2LQ8A 4JZ4A 3EHQA 2JZ2A 2VASA 4PKCC 2KQWA 5CKDA 4FYVB 3UPUA 2P84A 1KIKA 3VYHB 3GBQA 3QWYA 1VQ4A 3L2RA 4AFUC 2CKKA 1IGQA 1W6XA 2E6ZA 4E2FB 5GAN7 3JB9H 1AWXA 3QYHB 2DZ9A 5L8RE 5C6SA 1LCKA 2DL4A 3J7AF 3LWHA 1G83A 2LQWA 1IZ6A 4IUQA 4NL2A 1NPPA 4J5YA 1UGRB 2V26A 2J6OA 3BFMA 1X75C 4E6RA 2SEMA 2EGCA 3CBMA 4XU3A 4CC2A 2HL5C 3OYYA 2JVVA 1BCMA 1YJNQ 3QUIA 2DZCA 1OPLA 4RG8A 4JRQA 1HD3A 5FU6C 2LCSA 2FEIA 2DTHA 4GBQA 4FT2A 2CZ6B 4M7AB 5LJ5e 3CCUA 1I5OB 3JB9J 2EBPA 2DYIA 5J39A 4YTLA 2BTTA 4FIBA 4M78D 3L42A 2RD1A 2LMJA 3UATA 2YRVA 1YJWQ 2F69A 2KY9A 4OGEA 5DLOA 1HXDA 3GNGA 2JM9A 4II1A 4Z8AA 1NPRA 1SEMA 1Y96A 2V8KA 2KYMA 4DBHA 2XKOC 1TUGB 1K1ZA 3CCLA 4XTYA 3CXCP 2B86A 3X26B 2IVWA 3PVLA 2FB7A 2C0OA 3OW2P 5A2QE 2XHCA 4RTUA 4FW1A 2HD0A 2NWMA 3OW2S 4AG2C 1D0ZA 3OYNA 1TOVA 2QAZA 1Q86C 2YRDA 5I2MA 4J9EA 2YUPA 4C0DB 2PZ1A 1AWOA 2AZSA 1Z9ZA 5GANf 2EYWA 2JTMA 4OB0B 1G8XA 1AWWA 1PRMC 3WVEB 1Y7XA 1NM7A 2VXFA 4JJDA 5CQYA 2YHTA 4QVDA 1YI2A 3M0RA 1ZUUA 2YRCA 5GAOr 2QA4Q 3HRUA 3VS6A 2G6FX 2CSIA 2O9VA 4ELZC 5C0MA 1G3TA 4A54A 2YDLA 1KD1C 1TU0B 3MP1A 1VQMA 2AIRB 1S1NA 1WHKA 4BUGA 2VGMA 4M7DA 1YNZA 2LCLA 1BYMA 3I5RA 4M77D 4OMQA 3OYFA 3LGFA 4J9BA 2LQNA 5KCOA 5FRMA 2DMOA 3VRZA 1IXDA 5GAN4 2RQWA 2RHUA 3TEEA 1K0SA 2NUTA 1N8RC 4OGCA 2DO3A 1O75A 4EMKA 1VQ4T 4M75F 2CZ0B 4LDWA 3X28B 4LUDA 3GIBA 1IGUA 2CP6A 2DJQA 4E7JA 1IRXA 5LJ3h 3VUZA 2WACA 5FW9A 3ZEHA 1A0NB 2OJ2A 3FRNA 2COZA 1PKSA 2DXUA 4NOYA 3OS5A 4CC4B 2L3QA 5GAOm 3I55A 4DOWA 3CXCA 2K57A 3G4SQ 1YWOA 4M7AG 4IUTA 1OEBA 5AYFA 3CPFA 2GBQA 3CCUT 1VQ8A 2EVRA 2YSQA 4DEXA 4J7IA 1OOTA 3REAB 1YP5A 4XU1A 1NEGA 2D9TA 1SF9A 3QZ5B 2LTOA 2L8DA 4Y28E 1NE8A 3EFSA 3ULRB 4QT7A 2EYQA 2EW3A 5KYWB 2YLBA 3PT9A 1LPLA 2PVDB 1NJIC 4VUBA 4XAXB 4M78A 3HL8A 1SRMA 3M57A 3CCLT 4OMNA 3JCMg 1WXBA 2DL7A 3BY7A 2O88A 1RLPC 5KYNA 2EGAA 1QLYA 4P5NA 3TSWA 1M9SA 3SDZA 3M55A 4GLMA 2QEXQ 4QQ6A 3E2UA 1AVZC 2DK3A 2SRCA 3EG3A 4JJCA 3G6EQ 2E3HA 1UHFA 4F17A 3JCMX 2YLCA 2RMOA 2KRNA 2I2LA 2O4XB 3JB9G 2ECZA 4QQGA 4ZGJB 2HBWA 2FG0A 4OF1A 1YI2T 1CSKA 5GMKm 2RN8A 2VB6A 3HTRA 1SPKA 3VJPA 1YJNA 1LJOA 3QYGB 2A08A 4F7UA 5A0LA 3EG0A 3M0SA 2QG9B 1OU8A 2YWWA 3RIRA 1MNEA 2D8HA 2E3IA 2X4XA 1AZEA 3A98A 1TG0A 2E10A 1VQMT 1UEBA 1Q7YR 5A0GA 3QZ9B 1AWJA 2CZ7B 1R0BG 3NTKA 2LC4A 2JN0A 1Q86R 4PJMA 4BE1A 2ZPIB 1YJWA 2DL5A 2OTLQ 2VWFA 2L3SA 3RERA 4MZMA 5CR2A 5LJ3e 3OYBA 3UA6A 5HK3A 4E7SA 4M77A 4C5EA 3OYGA 4MMKA 2O01E 2KDSA 3EFOA 3OYLA 3V7SA 1QVFS 2MOXA 5J3BA 1FMWA 2G3RA 4ZN1A 1VYUA 1M1KR 3EGXA 3NFCA 5IN1A 4N4GA 1WDXA 1QVPA 3A8MB 5CKEA 3RBBB 3PTAA 1KD1R 2HEQA 1E7OA 1QW1A 2QDYB 1UFFA 1EIFA 1KHIA 2DXBA 4BI8B 3I55T 1UGQB 4C0ZA 1IHVA 1ARKA 1GFDA 1ZSZB 5KCHA 1K9MC 3HSBA 1RI0A 1VQ8T 2JXBA 1YBYA 1M2VA 4IIOA 2ZCFB 2QA4A 4DA4A 3ER0A 2LRQA 2X9HA 2P0KA 3C4SA 4C92D 5KH6A 4DBRA 2WSFE 2FPDA 2CP5A 3QDFA 2ESWA 3RMQA 4E7KA 3OYIA 3FB9A 1H8KA 4PK4A 4R55A 1UECA 1YITQ 4PFZA 3O5ZA 2R57A 3X24B 2L3PA 3UF4A 3GP8A 2DVEA 1P92A 3RKXA 1M8MA 1QCOA 4HCCA 2CUDA 3H6ZA 1ZUYA 2LP5A 1SSHA 5FWCA 5HKCA 4XTZA 4M7AF 5A0DA 1BBZA 4KH0B 1OX9A 1KC8R 1UTIA 1FMVA 2EQKA 1AZGB 2NUTB 2CP2A 4FYYB 4Z02A 1LVKA 3RR6A 5CK9A 2CSQA 4R0KA 1NJIR 3OS1A 1YJNT 1QVGP 1VUBA 3JCMQ 3EAEA 3H0FA 3MO8A 3PNWC 4KGVB 1IO6A 4LXCA 4RMOA 5D7UA 2DRMA 3NHNA 3M0PA 1MV0B 4PJOF 1W2BA 2AKKA 3CEYA 1N27A 2M9UA 4FM4B 1WHHA 4C8QF 4J7FA 2F2VA 1YJWT 1HSQA 2CP0A 1Q81U 4CC7A 2ZPHB 1VYVA 2E4HA 2O31A 5HY6A 1MMGA 2BIVA 3BDUA 3PVQA 3JB9F 3I35A 2ZAEA 4OMLA 3CPWP 1WQWA 1WNLA 2GNCA 3C0CA 4FYWB 2DVJA 3CPWS 1W1FA 4NL3A 4JLGA 2QEXA 4OP0A 5GAN2 4N4IA 3V8JA 1G5VA 5GANh 5IHKA 3WXMB 3VYGA 3VRYA 2JJ9A 2FVUA 3G6EA 1E6HA 2HQXA 4FT4A 1NYFA 2X3XD 4BACA 4J9CA 2VUBA 3JCMb 4XTWA 2VVKA 1G3YA
chains in the Genus database with same CATH topology
1Q86U 3DB3A 2ZPFB 3OMGA 3V8LA 3OS2A 4IURA 2XKOC 3A8HB 2DAQA 4L6V5 3P8BB 4C92G 3CCLA 2F5TX 2V8IA 4XTYA 3CC2T 4J6YA 2DD4A 2QA4T 3X26B 1G3SA 2MWOA 2LCCA 5DY9A 4A4EA 4OB2B 3FC3A 3M54A 2CZ1B 4EMGA 1VIEA 3URGA 4JRPA 2IVWA 3V7RA 2FB7A 2DKGA 2LX9A 1PSEA 5A2QE 2XHCA 4LD6A 1BIAA 2GFUA 2HD0A 4BY6C 3CCVA 4L5GA 3QSUA 2FL7A 2JNGA 2XG8D 1O9SA 4M7AA 1FWZA 3PIOA 3OW2S 3HRTA 4KBMB 3OYAA 2H3JA 4XQ3A 3OYNA 3CCRT 1I5LA 4M7DB 1I8FA 5GANd 3JRZA 5LJ5d 1Q86C 5FLXE 3ZBDA 1BIBA 4F7UB 5I2MA 4C0DB 1JB0E 1B34A 4PLLA 4PJOG 3CCMT 4C0FA 1Y71A 2KAFA 1S72T 4M78F 4C92E 3OYHA 2OTLA 1KG1A 2DEQA 4PNOA 3PGGA 2OAUA 5GANf 1GXIE 3QIIA 4M75B 4QW2A 2RH2A 2JTMA 4PL6A 1QVGA 1YJ9A 4OB0B 3WVEB 1Y7XA 4C8QG 2EIFA 4L59A 4XTXA 1D3BA 3M53A 4DOVA 3CC4A 2VXFA 4EPCA 5CQYA 2YHTA 4QVDA 3LYIA 4M75D 4CI0C 1YI2A 4EMKB 2DD5A 1W4SA 2RK2A 3M4YA 3JB9D 5GAOr 2RJEA 3HRUA 1QVFA 2PUOB 4ELZC 2X35A 4JDSA 5LJ5j 5C0MA 1G3TA 4A54A 1N8RU 1VQ5A 2DIGA 4PJOA 2NLUA 4M77B 1KD1C 2VYTA 3MP1A 3JCMf 2VGNA 3CBPA 1VQMA 4LDXA 2K5IA 4BUGA 3E9FA 2VGMA 4C0GA 4M7DA 4BDYA 3DKMA 3OSSC 2LCLA 5GAN5 3OMCA 3OA6A 2KVQG 1BYMA 4M77D 2BUDA 4C8QA 2E12A 5IT9E 2EQMA 3JCMV 3CPWA 4C5IA 3CCET 3OYFA 3LGFA 4J83A 5KCOA 5FRMA 1M8VA 2RI2A 2Y4YA 3CC7A 4BY6B 1M1FA 1SSFA 3OY9A 1JJ2S 5GAN4 5IAYA 2RHUA 2K5FA 3A5ZB 4HKEA 3G4ST 1N9SA 3TEEA 2VXEA 2QQSA 3RUXA 4X34A 3JB9I 2K5LA 3RKYA 2RM4A 1N8RC 5CKBA 2K3XA 4OGCA 2DO3A 1O75A 4X9DA 4EMKA 4MZTA 1VQ4T 5FRNA 3KXTA 3HKSA 4M75F 2CZ0B 4LDWA 3X28B 4JJNK 3GIBA 2LQKA 4C92C 4KUDK 3QKJA 1VQLA 4E7JA 2QXFA 3OS0A 1UGPB 5CAIA 3FLGA 5LJ3h 3LGLA 5GAOq 3VUZA 2OTJA 2LVMA 3KBGA 4J6XA 3I56A 3MP6A 1VQMT 2WACA 3QG1A 3SWNA 3TREA 3UWNA 4A53A 3ZEHA 1Y07A 1IREB 3JCMW 3FIFA 1VQKT 3OB9A 3CD6T 3OSVA 2JTFA 1VQNA 1YCYA 3FRNA 4MDWA 3N5BB 1Q82C 2X4WA 1KQ2A 3CMET 4BE0A 5GANe 4M78B 2DXUA 4A4GA 4J8OA 4NOYA 3PMTA 1YITA 1M1GA 3OS5A 4BI4A 1OZ2A 3UDCA 4IKFA 3LWIA 5GAOm 3MCAB 3I55A 4ATOA 4DOWA 3HHTB 3CXCA 1VQOT 4KULA 2QQAA 4RG2A 2E1HA 2AHJB 2K57A 3J81E 2LT4A 4M78G 2EKOA 1KQSA 3GNFB 4M7AG 2VV5A 4IUPA 4IUTA 5AYFA 3CPFA 3HFNA 1K73U 1NJIU 3CCUT 1W2BS 1VQ8A 3V7CA 2QEXT 1Q7YU 2DTIA 4J7IA 4XTUA 5GANg 4KUIA 4RKUE 1DJ7B 2QI2A 1QP2A 2L89A 4XU1A 1V29B 3G6ET 3QBYA 1H641 3GOXA 3P8HA 3M59A 2D9TA 3UT1A 3OYKA 3PMIA 3QZ5B 1YIJT 2RI5A 2LTOA 3JCMe 3CCSA 3HPWA 1BI2A 2L8DA 3CCUA 4Y28E 3DB4A 3GLXA 5D6WA 4N0AA 2LNVA 1XNIA 3JCMh 1NE8A 3EFSA 1X6OA 1VQPT 4XK8E 4E7IA 3S3OA 3CMAT 2EYQA 5FU7B 4LDYA 3S3NA 1YHQT 3META 2YLBA 2A7YA 3PT9A 2MF2A 3WVDB 2P0QA 4M7AE 5LJ3f 2PVDB 1K73C 4VUBA 4XAXB 2XICA 3VKIA 1NJIC 1FXXA 4M78A 3CCQT 1Q7YC 3HL8A 5EG2A 3M57A 3CCLT 4X9CA 3S6WA 2R58A 3JCMg 2CGHA 3SWNC 1XQHA 3CCJA 2CS7A 2FYKA 3BY7A 2RHXA 3ME9A 1M1KU 3A8GB 2RA2A 2BKDN 5FU6B 4P5NA 1JBMA 2K4YA 1M9SA 3SDZA 3CCVT 3M55A 4V2SA 1KD1U 4M7DG 2RJCA 4QQ6A 4F7UG 2DK3A 3RESA 2XDPA 2P0PA 3MHXA 3AHUA 2MAMA 3GF5A 4JS5A 2CYZB 3JCMX 2R5AA 2YLCA 4ZGEB 5CO7A 4M75G 3T9NA 2OTLT 2I2LA 2M16A 2O4XB 4BB7A 2RK1A 2FHDA 5M9OA 3JB9G 2VC8A 2ZPBB 4QQGA 3JCMd 1M4ZA 2RHIA 1YJ9T 1M1KC 3L2WA 1VQ7A 5GANj 4ZGJB 4PJOE 5GMKh 1WQ7A 3CC4T 3QDRB 4ZTFA 4N4HA 4OF1A 3M4GA 1YI2T 5GMKm 1WJSA 3VJPA 3OYMA 4M7DE 4GY5A 3E9GA 1YJNA 1LJOA 1VQ6A 1OI1A 4C8QE 1ZHIA 3QYGB 4N0AC 5J26A 1XTDA 4BI3A 3CBOA 4B9XA 4F7UA 5A0LA 5HK0A 3NTHA 3OYEA 4EMHA 3L2VA 3RIRA 4E7LA 2IG0A 4M77G 4C92F 3E19A 2XDBA 2X4XA 2RB6A 4NS5A 1VQ5T 2P4TA 1VIFA 1VQ9T 2DTOA 4M75A 3X25B 4E47A 2E10A 2ZPEB 5GAMh 4ME7A 2Y90A 3O8VA 1UEBA 3H8ZA 5CIUA 4ELYC 3EFRA 3QZ9B 5A0GA 3SD4A 1BI3A 3TU4K 2CZ7B 3BDLA 2ZPGB 1UGSB 4TVRA 3NTKA 5D6YA 1LOJA 2LC4A 2EAYA 2JN0A 4XTVA 3NTIA 5KE3A 4JS4A 1Q82U 3G4SA 4BE1A 2HBPA 3ZFJA 1QVGS 2ZPIB 1YJWA 3G7ZA 1UB4A 3JAME 1U1SA 2O4XA 3CC7T 2XIDA 4JRIA 3RERA 4MZMA 2XI9A 2M0OA 2RHYA 3J80E 3CD6A 1M5Q1 4WF2A 5CR2A 5LJ3e 3OYBA 5HK3A 4JUVA 4M77A 4C5EA 2M1HA 2E65A 4MMKA 1AHJB 3C12A 2O01E 2KDSA 4JLIA 3OYLA 3V7SA 1QP3A 1QVFS 3M5AA 5CKHA 3C94A 1KC8U 5J3BA 1WPYA 2LDMA 3G71A 2G3RA 1VQLT 1U1TA 2GQVA 4ZN1A 5LJ3g 1X01A 3C95A 5IN1A 3NFCA 2OTJT 1K9MU 1ZBXA 2E6NA 4PJOC 4N4GA 1WJQA 3I56T 1QVPA 2MWPA 1WGSA 3A8MB 1NZ9A 3MP8A 4IUVA 5CKEA 4BD3A 3PTAA 4ZTJA 2XK0A 1WJRA 2QTXA 3M58A 5GAMd 4BDZA 4A4FA 1VQNT 4M7DC 2R5MA 3VV0A 4DQ2A 4PLIA 3OW2A 1OZ3A 4C8QC 1QW1A 2QDYB 4O6JA 4C0DC 1EIFA 5GMKi 3QJ6A 1K8AC 1KHIA 3S3MA 2E41A 2DXBA 2RHZA 1YITT 4BI8B 1I4K1 3QXEB 5GAMf 3I55T 1UGQB 2GFAA 4C0ZA 4M7AC 3INZA 1KC8C 5KE2A 2HQEA 3FEOA 4M75C 5GAN3 2Y4XA 4IUUA 2GF7A 1BI0A 2ZZDA 3L2ZA 4R56A 5LJ5h 3F70A 5D6XA 4MZPA 3Q1JA 4KT0E 5KCHA 2HAXA 1I81A 2EJ9A 5LJ3d 1K9MC 1BKBA 3HSBA 5GAOp 3M9QA 4EMKC 1RI0A 4M7AD 1VQ8T 2JUFA 1YBYA 2EQUA 3VUBA 3OYDA 1R8OB 3CC2A 2A3LA 2EWNA 4HCZA 2ZCFB 4QQDA 2QA4A 4M78E 5DLQE 4C92B 4DA4A 4XU0A 1MHNA 3QJYA 2RJDA 3ER0A 5FROA 3CMAA 2EJGA 4OB1B 2LRQA 2QQ9A 4CRIA 2P0KA 3C4SA 3CCST 3P8DA 3SB2A 4M77C 2GCXA 4C92D 5KH6A 3CCQA 1FX7A 1MGQA 1PSFA 2L3RA 4JRKA 3OYCA 2WSFE 3HP9A 4D6WA 3LX7A 1KHCA 2E64A 4MMLA 3RMQA 4C5GA 3OYIA 3CCRA 4E7KA 4GLKA 2X4JA 3FB9A 4A4HA 5CQXA 3OBWA 5GAN8 3OBYA 1OYXA 4R55A 4HCBA 4FSXA 2HNIA 1M90C 4B9WA 3CCMA 2EJFA 3M56A 3CXCS 4ZN3A 2QQBA 3HRSA 4C5HA 2D0QB 5LL6S 1RL2A 5LJ3j 2R57A 3X24B 1S72A 2KMTA 4PJOB 3V8KA 1KQSS 2B8AA 5CVIA 3CCJT 3GP8A 2DVEA 4LDUA 3PFSA 2C06A 1P92A 3RKXA 2KK4A 2E5QA 1ZQ1A 2XU8A 1JJ2A 3LLRA 4HCCA 3H6ZA 4PJOD 4C8QB 4ZGDB 2F5KA 4OB3B 5GMKe 5HKCA 3X20B 4XTZA 4M7DD 4M7AF 2X4YA 4HT9A 5A0DA 5LJ5f 2JOYA 4C8QD 2ZGWA 4C92A 4OMFB 2DXCA 3QO3A 2RJFA 2RO0A 3QPHA 3OYGA 4FL6A 2EQKA 4Y91A 4F7UE 3L1AA 2KSSA 4Q5WA 5GAOl 3DLLA 3PIPA 2MMPA 3JSCA 4Z02A 1XOVA 2XDDA 1VQ7T 3OYJA 4LD9K 3OQ5A 3JCMP 3SFMA 5CK9A 4M75E 1U8RA 3LH0A 2PUKB 4E7HA 5GAMe 2K2VA 4RCBA 1BI1A 4FU6A 1LNXA 4M78C 3MEUA 4O5VA 3TCJA 5DM7R 3CCEA 4HA8A 3OS1A 3FJPA 1YJNT 4HT8A 1VQ6T 1VUBA 2L5QA 2V8JA 3JCMJ 1VQ9A 3SWNB 3RKWA 4A4KA 2K3YA 2LQ8A 3JCMQ 3EAEA 2QQRA 4QVZA 3MO8A 3PNWC 2JZ2A 4QVCA 4RMOA 4OVAA 2KQWA 4PKCC 1HK9A 2EFIA 3RMSA 2WSCE 2E70A 5CKDA 4BE2A 3UPUA 3VYHB 5GAMg 2PU9B 1VQ4A 4PJOF 3R6OA 5I21A 3MEVA 2EQJA 4M77E 1W2BA 1G3WA 3L2RA 4XU2A 2CKKA 4M7DF 2E6ZA 3JB9H 5GAN7 3CEYA 4F7UF 3QYHB 4UC4A 1N27A 2DZ9A 3L2QA 1K8AU 2M9UA 4FM4B 5L8RE 4C8QF 4J7FA 5C6SA 1YJWT 1VQKA 3J7AF 3LWHA 3E1SA 1Q81U 3MEAA 1IZ6A 2DXTA 2ZPHB 4IUQA 3QHSA 4NL2A 5FU7C 5HY6A 1NPPA 3JCMc 4J5YA 1Y96B 5GAOn 1KQ1A 1UGRB 3FDRA 4LDVA 2MI6A 2RI3A 3L2UA 2BIVA 3BFMA 1X75C 3BDUA 5I2SA 3JB9F 3CBMA 2DIQA 1H3ZA 3BW1A 3CMEA 4XU3A 2PVGB 5CKFA 3OYYA 2JVVA 4J6WA 3QUIA 1WQWA 2DZCA 3LW5E 4RG8A 1WNLA 3G71T 4JRQA 1N9RA 1VQOA 1TH7A 4RCCA 3A8LB 3DLMA 3CPWS 5FU6C 5GMKj 3KUFA 4NL3A 1Q81C 4JLGA 2DTHA 5CCAA 4FT2A 2CZ6B 4M7AB 5LJ5e 4OP0A 5GAN2 4N4IA 3V8JA 3GPLA 4M77F 2LT1A 2WSEE 2QEXA 3JB9J 2DJZA 5GANh 1G5VA 2PVOB 3A8OB 5J39A 3WXMB 4YTLA 4EDUA 3VYGA 3G6EA 2FVUA 2DPPB 4FIBA 4M78D 3HFOA 5GMKl 2D6FA 1B34B 3L42A 2RD1A 2HQXA 1M90U 1YIJA 2YRVA 2F69A 4FT4A 2KY9A 4OGEA 3VU3C 2XD0A 3MEWA 5DLOA 1HXDA 3GNGA 4MDXA 4II1A 1N6AA 4BACA 1VQPA 5GAN6 2PQWA 5GAMj 1JRIA 2VUBA 1NPRA 5LJ5g 1Y96A 4XTWA 3JCMb 1YHQA 2V8KA 1G3YA 1D3BB 3ASKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5F A;  4O5V A;  2GCX A;  1FX7 A;  1BI3 A;  2K5L A;  1G3T A;  1BI0 A;  2K4Y A;  1BI2 A;  1G3S A;  3GLX A;  2K5I A;  1QVP A;  2QQA A;  2LX9 A;  2QQB A;  3HRS A;  3MHX A;  1BYM A;  5CVI A;  1BI1 A;  3E19 A;  1FWZ A;  3HRT A;  1P92 A;  1QW1 A;  4O6J A;  1G3W A;  1U8R A;  2H3J A;  2QQ9 A;  3HRU A;  1G3Y A; 
#chains in the Genus database with same CATH topology
 3V8L A;  1U3O A;  4IUR A;  3A8H B;  3P8B B;  2F5T X;  2V8I A;  1I1J A;  2QA4 T;  2QGG A;  4A4E A;  3G71 Q;  2OI3 A;  2CZ1 B;  4EMG A;  1VIE A;  2DKG A;  4LD6 A;  1BIA A;  2GFU A;  4BY6 C;  3QSU A;  2FL7 A;  2JNG A;  1O9S A;  2FPE A;  2H3J A;  1GFC A;  1I5L A;  5GAN d;  4DEY A;  5LJ5 d;  5FLX E;  3ZBD A;  4F7U B;  2DIL A;  2ED0 A;  2YXY A;  1JB0 E;  1B34 A;  4J9G A;  1Y71 A;  2KAF A;  4C92 E;  2OTL A;  2OAU A;  1D1C A;  1GXI E;  3QII A;  1UGV A;  1QVG A;  4HVU A;  2EIF A;  4L59 A;  4XTX A;  1D3B A;  1PM3 A;  4M75 D;  2DD5 A;  5HCK A;  1YCS B;  1W4S A;  1X6G A;  1X27 A;  1IHW A;  3CC2 Q;  4ZNX A;  2PUO B;  2DIG A;  4M77 B;  2VYT A;  3H41 A;  3JCM f;  2VGN A;  3CBP A;  4LDX A;  3E9F A;  1T3S A;  3OSS C;  3OMC A;  2KI7 A;  2KVQ G;  1WIE A;  4DBQ A;  2E12 A;  3CCM Q;  2C0T A;  2PNI A;  1SSF A;  3OY9 A;  1JJ2 S;  1EFN A;  5EC7 A;  3A5Z B;  3G4S T;  2VXE A;  3JB9 I;  2RM4 A;  2K3X A;  3HKS A;  4FSS A;  4JJN K;  2CRE A;  1X2Q A;  4KUD K;  1J3T A;  4AFS C;  1RLQ C;  1UGP B;  5KYY A;  3I56 A;  3SWN A;  3TRE A;  3FIF A;  3OSV A;  1KJW A;  3N5B B;  5GAN e;  1ACM B;  1I0C A;  1YIT A;  4BI4 A;  2CH4 W;  3LWI A;  4ATO A;  4KUL A;  2KRS A;  2V1Q A;  4RG2 A;  3J81 E;  4RTY A;  2LT4 A;  4M78 G;  1JEG A;  1KQS A;  3GNF B;  1K73 U;  3HFN A;  1ZLM A;  2QEX T;  4WTO B;  4RKU E;  1MND A;  3G6E T;  2FZG B;  3QBY A;  1QCN A;  3UT1 A;  3PMI A;  2KNB B;  2RI5 A;  3HPW A;  2A0F B;  2MPX C;  1XNI A;  3S3O A;  5FU7 B;  1VQK Q;  2BZY A;  4LDY A;  3ZL7 C;  2A7Y A;  2MF2 A;  2PTK A;  3RNJ A;  3H0I A;  2K9G A;  2XIC A;  1Q7Y C;  2FZC B;  1RAF B;  1V76 A;  2DL3 A;  2DET A;  3AT1 B;  1SHG A;  1VQO Q;  4RUG A;  3ME9 A;  2P4R A;  2GQI A;  4FYX B;  3VS5 A;  2K4Y A;  1PKT A;  4V2S A;  2RJC A;  4F7U G;  1ZA1 B;  3AHU A;  4JS5 A;  1KSW A;  5CO7 A;  1UJ0 A;  2OTL T;  2RK1 A;  1M3B A;  1NEB A;  1VQP Q;  1M4Z A;  2C0I A;  2RHI A;  4FCY A;  1M1K C;  2DLP A;  1YHQ Q;  1M30 A;  1KK7 A;  2EYZ A;  4M7D E;  6AT1 B;  1OI1 A;  4N0A C;  3R6N A;  5HK0 A;  2JS0 A;  4K11 A;  3NTH A;  3L2V A;  1D1B A;  4M77 G;  2CT3 A;  1RUW A;  1UHC A;  2RB6 A;  1EZZ B;  1AD5 A;  4M75 A;  3X25 B;  4M7A C;  3EGD A;  2KR3 A;  2ENM A;  3O8V A;  4ME7 A;  5CIU A;  3TU4 K;  3EG9 A;  3BDL A;  5D6Y A;  1Q82 U;  1LOJ A;  5KE3 A;  1UUE A;  1U1S A;  2XID A;  2XI9 A;  2M0O A;  1N5Z A;  4LE9 A;  1M5Q 1;  4WF2 A;  2GTJ A;  1PD1 A;  4JUV A;  3IQL A;  4HVW A;  2M1H A;  2E65 A;  3C12 A;  1Z9Q A;  4KGX B;  4JLI A;  2K2M A;  1R77 A;  4J9H A;  5CKH A;  1BU1 A;  2LDM A;  2JS2 A;  3G71 A;  1U1T A;  1RAD B;  3C95 A;  1VQ5 Q;  4PJO C;  3I56 T;  1WJQ A;  1EX4 A;  1WGS A;  1QKW A;  4IUV A;  4BD3 A;  4ZTJ A;  1WA7 A;  2R5M A;  1CKA A;  4PLI A;  3OW2 A;  4C8Q C;  4O6J A;  4C0D C;  2CP3 A;  3QJ6 A;  2I0N A;  3S3M A;  2RHZ A;  1YIT T;  1I4K 1;  3QXE B;  1NG2 A;  1KC8 C;  5KE2 A;  3FEO A;  1JXO A;  2ZZD A;  4R56 A;  2EYX A;  4PJN A;  1K0X A;  3Q1J A;  1F1B B;  5LJ3 d;  1BKB A;  5IXB A;  4M7A D;  2DF6 A;  1GL5 A;  2EQU A;  1R8O B;  3CC2 A;  2EWN A;  2X51 A;  4HCZ A;  2QTV A;  4M78 E;  5DLQ E;  4C92 B;  3CMA A;  2EJG A;  4CRI A;  3P8D A;  2GCX A;  2L2P A;  3CCQ A;  4JRK A;  1GCQ A;  3HP9 A;  4D6W A;  1NYG A;  3TSZ A;  5CQX A;  3M0Q A;  3OBY A;  1OYX A;  2HNI A;  3CCM A;  4C5H A;  2D0Q B;  4IIM A;  2A28 A;  1RAG B;  2J6F A;  2C06 A;  2K79 A;  2KK4 A;  2H3E B;  3EGU A;  3UA7 A;  2XU8 A;  4PJO D;  2BE7 D;  1D1A A;  2HQH A;  3X20 B;  2X4Y A;  2JOY A;  4C8Q D;  4OMF B;  2LJ1 A;  3QO3 A;  2RO0 A;  3QPH A;  2EGE A;  4F7U E;  2DE0 X;  5GAO l;  2CDT A;  1XOV A;  3KFV A;  4LD9 K;  3OQ5 A;  3SFM A;  4FU6 A;  1LNX A;  3CCE A;  2L0A A;  3FJP A;  4HT8 A;  1FYN A;  2BZ8 A;  2EKH A;  1T3L A;  5I11 A;  3JCM J;  3SWN B;  2QDL A;  3CCJ Q;  1VQ9 A;  1WI7 A;  2QQR A;  4QVC A;  1C1A A;  5KYU A;  1I07 A;  1Y0M A;  1E6G A;  2EFI A;  2WSC E;  3RMS A;  5GAM g;  1QVF P;  4M77 E;  2FPF A;  4F7U F;  4UC4 A;  3L2Q A;  1K8A U;  2DXT A;  3QHS A;  3JCM c;  1VQ7 Q;  5GAO n;  1VQK A;  1Y96 B;  2FO0 A;  2M0Y A;  2DIQ A;  1H3Z A;  3BW1 A;  3CME A;  3RDV A;  1PG5 B;  2PVG B;  5CKF A;  2HSE B;  3LW5 E;  3G71 T;  1VQO A;  1N9R A;  4RCC A;  3A8L B;  5GMK j;  4M77 F;  2WSE E;  2PVO B;  1WHM A;  3HFO A;  5GMK l;  1M90 U;  2JTE A;  3MEW A;  4OMM A;  1N6A A;  1VQP A;  5GAN 6;  2PQW A;  2KYB A;  1JRI A;  5GAM j;  5LJ5 g;  4QKU A;  1YHQ A;  3MKD A;  3DB3 A;  2ZPF B;  3OMG A;  1Q86 U;  1VOM A;  3OS2 A;  3I56 Q;  2H8H A;  2DAQ A;  4L6V 5;  4C92 G;  1OU9 A;  2YUQ A;  4RTT A;  2XMF A;  3CC2 T;  3A1P A;  2DD4 A;  1G3S A;  4ESR A;  2LCC A;  3FC3 A;  1TWB A;  4OB2 B;  1WHL A;  3M54 A;  4JRP A;  3V7R A;  1YWP A;  1RAA B;  5IHN A;  4M7A A;  1FWZ A;  3PIO A;  3HRT A;  4KBM B;  3OYA A;  4M7D B;  1I8F A;  4PLL A;  3CCM T;  1OQK A;  4LN2 A;  1KG1 A;  3OYH A;  2DEQ A;  5AT1 B;  4M75 B;  4J9D A;  4QW2 A;  2RH2 A;  1Q81 R;  3QWX X;  5IH2 A;  1PWT A;  4EPC A;  4CI0 C;  4EMK B;  1SG5 A;  2RK2 A;  3M4Y A;  1ABO A;  1QVF A;  1YFN A;  4JDS A;  5LJ5 j;  4CC3 A;  1N8R U;  1VQ5 A;  1B7T A;  4PJO A;  1TTH B;  2EPD A;  2K5I A;  4LNP A;  4C0G A;  3CCR Q;  2BUD A;  4C8Q A;  5IT9 E;  4Y92 A;  2EQM A;  1MV3 A;  3G1J A;  4C5I A;  3CCE T;  3MPU B;  1S72 Q;  1M8V A;  2RI2 A;  2Y4Y A;  4BY6 B;  1M1F A;  1ZSZ C;  1X6B A;  4HKE A;  2QQS A;  4X34 A;  5CKB A;  2YUN A;  4MZT A;  3U23 A;  4Z88 A;  2LQK A;  2JMC A;  1PRL C;  5CAI A;  3FLG A;  2LVM A;  4JZ3 A;  4J6X A;  3MP6 A;  3QG1 A;  4A53 A;  1IRE B;  1Y07 A;  1VQK T;  2YUO A;  3OB9 A;  4MDW A;  1Q82 C;  3CME T;  4BE0 A;  4M78 B;  3PMT A;  1D09 B;  2RF0 A;  1UG1 A;  2KRO A;  1VQO T;  1PC0 A;  2QQA A;  1YN8 A;  2VV5 A;  1NJI U;  2DTI A;  1DJ7 B;  1V29 B;  3M59 A;  3OYK A;  2A37 A;  4AFQ C;  1MMA A;  2RQR A;  3JCM e;  4DBF A;  5IXF A;  1RAH B;  5D6W A;  3GLX A;  2LNV A;  1X6O A;  1VQP T;  4XK8 E;  3CD6 Q;  3S3N A;  1YHQ T;  3SHW A;  3MET A;  2P0Q A;  2LNH B;  1QQJ A;  1WLP B;  2KT1 A;  1GBQ A;  2HKN A;  1GRI A;  2DEU A;  2CGH A;  1NLO C;  2M02 A;  1XQH A;  3CQT A;  3CCJ A;  2RHX A;  1PCX A;  3A8G B;  2RA2 A;  3D7S B;  5FU6 B;  1CKB A;  1JBM A;  2DFU A;  4PFO A;  2CP7 A;  3VS2 A;  4M7D G;  3MHX A;  1WXT A;  4EIK A;  1C6V X;  2MAM A;  4PJL A;  1YIJ Q;  3T9N A;  4M75 G;  1JQQ A;  2GGR A;  2YT6 A;  2FHD A;  2HDA A;  1PNJ A;  3CMA Q;  3L2W A;  1VQ7 A;  4ZTF A;  1ZSG A;  3CCQ Q;  3OYM A;  3EFO B;  4OMP A;  3CBO A;  2NYS A;  1JJ2 P;  2IG0 A;  4C92 F;  1BB9 A;  3E19 A;  2DRK A;  2XDB A;  2JM8 A;  3EGX B;  4NS5 A;  1VQ5 T;  3CCV Q;  1C0M A;  2EQI A;  3CPW A;  4E47 A;  2ZPE B;  3VS0 A;  2Y90 A;  3H8Z A;  3SD4 A;  2LJ3 A;  4E7Z A;  1UGS B;  4HCK A;  2AT1 B;  4XTV A;  3NTI A;  4JS4 A;  1U06 A;  2HBP A;  3G7Z A;  4KRT A;  1UB4 A;  3JAM E;  2O4X A;  2KRM A;  4JRI A;  2RHY A;  1YJ9 Q;  1ABQ A;  4J9F A;  2DER A;  3CC4 Q;  1QKX A;  1AHJ B;  1M2V B;  3H9N A;  1QP3 A;  1MUZ A;  2FRY A;  1WPY A;  2DM1 A;  2GQV A;  3CCE Q;  5LJ3 g;  2X3W D;  1TS9 A;  3NGP A;  1K9M U;  2E6N A;  3MP8 A;  1NZ9 A;  1VQ9 Q;  2XK0 A;  4BDZ A;  4A4F A;  1AEY A;  1WXU A;  1OZ3 A;  1WZO A;  2COW A;  1K8A C;  2HZY A;  5GAM f;  2GFA A;  3CC7 Q;  2HQE A;  5GAN 3;  2Y4X A;  5KYX A;  3L2Z A;  3F70 A;  4MZP A;  2HAX A;  1I81 A;  1UJY A;  2EJ9 A;  1NLP C;  1OPK A;  3M9Q A;  2HKQ B;  3OYD A;  4B6M A;  2A3L A;  4QQD A;  2V1R A;  2ROT A;  1MHN A;  4XU0 A;  5FRO A;  1QWF A;  3CME Q;  1VQL Q;  4OB1 B;  2HSP A;  4D8K A;  3M0T A;  2OTJ Q;  2DNU A;  1OX8 A;  4M77 C;  4PJJ A;  5GJW B;  2KE9 A;  1FX7 A;  1MGQ A;  2O2O A;  1WFW A;  2LX7 A;  3LX7 A;  1KHC A;  1VQN Q;  3CCR A;  2HL3 A;  4GLK A;  2X4J A;  3OBW A;  1M90 C;  1Q82 R;  2LZ6 B;  4B9W A;  3CXC S;  2QQB A;  1S72 A;  5LJ3 j;  2KMT A;  4PJO B;  3V8K A;  3CCJ T;  1X2K A;  4LDU A;  3PFS A;  1ZSZ A;  2A36 A;  5GJV B;  1JJ2 A;  1ZQ1 A;  3LLR A;  1JU5 C;  1B07 A;  4C8Q B;  4ZGD B;  1VA7 A;  2D1X A;  4OB3 B;  2KXD A;  2QK0 A;  4HT9 A;  5LJ5 f;  2ZGW A;  2DXC A;  4FL6 A;  3CCS Q;  3EH2 A;  1K9A A;  1ZBJ A;  2W0Z A;  2O9S A;  3L1A A;  2KSS A;  4Q5W A;  1M27 C;  2MMP A;  3JSC A;  1D0X A;  3VS3 A;  1VQ7 T;  3OYJ A;  1SHF A;  1RAI B;  2BZX A;  1U8R A;  4M75 E;  2K2V A;  4RCB A;  1BI1 A;  5DM7 R;  1WX6 A;  2D8J A;  3TCJ A;  4O5V A;  4HA8 A;  1TXQ A;  3M0U A;  1PD0 A;  2V8J A;  4RTW A;  4PFP A;  4A4K A;  2K3Y A;  4QVZ A;  4OVA A;  1K76 A;  1HK9 A;  4WCI A;  4BE2 A;  2E70 A;  1ZX6 A;  2PU9 B;  3R6O A;  5I21 A;  3MEV A;  4F16 A;  1T0J A;  2EQJ A;  4J9I A;  1G3W A;  1KFZ A;  4XU2 A;  4RTV A;  1X43 A;  4M7D F;  2IPO B;  5FWB A;  9ATC B;  1RI9 A;  2J05 A;  3E1S A;  3MEA A;  7AT1 B;  1G2B A;  1M2O A;  5FU7 C;  3CD6 A;  5L23 A;  1KQ1 A;  3FDR A;  4LDV A;  2QYZ A;  2MI6 A;  2RI3 A;  2RPN A;  3L2U A;  1HJD A;  5I2S A;  2F2W A;  4J6W A;  3FJ5 A;  1VQ6 Q;  1PHT A;  1H92 A;  1TH7 A;  2OAW A;  1JXM A;  3DLM A;  3KUF A;  1Q81 C;  5CCA A;  3EHR A;  3GPL A;  2LT1 A;  2DJZ A;  3A8O B;  4EDU A;  2DPP B;  4HVV A;  2VKN A;  2D6F A;  1B34 B;  2MCN A;  1YIJ A;  3VU3 C;  2XD0 A;  4KGZ B;  3EG1 A;  2MYS A;  2COY A;  4MDX A;  1BCO A;  3TVT A;  1D3B B;  3ASK A;  1HYO A;  1D0Y A;  1TUD A;  1NBE B;  1QWE A;  4J6Y A;  2NUP A;  5DY9 A;  2MWO A;  2QGF B;  3URG A;  2LX9 A;  1PSE A;  3CCV A;  4L5G A;  1MMN A;  1GBR A;  2XG8 D;  1WHG A;  1T0H A;  4XQ3 A;  3CCR T;  3JRZ A;  1BIB A;  2BE9 B;  4PJO G;  4C0F A;  1K8A R;  1S72 T;  4M78 F;  1WYX A;  4PNO A;  3PGG A;  4AFZ C;  2DA9 A;  4PL6 A;  1V1C A;  1YJ9 A;  4C8Q G;  4ANJ A;  2ROL A;  3M53 A;  4DOV A;  3CC4 A;  3LYI A;  3JB9 D;  2CUB A;  2RJE A;  2JW4 A;  2ATC B;  3VS1 A;  1X69 A;  5KYY B;  2X35 A;  2RQT A;  2NLU A;  2QAS A;  1WHJ A;  4BDY A;  3DKM A;  1RAE B;  5GAN 5;  3OA6 A;  2EYY A;  3EG2 A;  3JCM V;  2FZK B;  4J83 A;  1M90 R;  3CC7 A;  2RQU A;  3EH1 A;  3NPF A;  3VS7 A;  5IAY A;  3THK A;  2K5F A;  1N9S A;  3RUX A;  1OV3 A;  2K5L A;  3RKY A;  4ORZ A;  4X9D A;  4JJB A;  2J06 A;  5FRN A;  3KXT A;  4C92 C;  3QKJ A;  5KYX B;  1VQL A;  2QXF A;  3OS0 A;  5GAO q;  2Z0W A;  3LGL A;  2OTJ A;  3KBG A;  2AZV A;  2GTO A;  5ECA A;  3UWN A;  3JCM W;  3CD6 T;  2JTF A;  1VQN A;  3I9Q A;  1YCY A;  5IHI A;  2ED1 A;  4X1V A;  1MMD A;  2X4W A;  1KQ2 A;  4A4G A;  4J8O A;  1M1G A;  4IKF A;  1OZ2 A;  3UDC A;  3MCA B;  4LUE A;  3HHT B;  8ATC B;  1W2B P;  2E1H A;  2AHJ B;  2DL8 A;  2EKO A;  2CT4 A;  1ZA2 B;  4IUP A;  1W2B S;  1Q95 G;  3V7C A;  1Q7Y U;  1VQ4 Q;  5GAN g;  1RAC B;  4XTU A;  4KUI A;  4F14 A;  2QI2 A;  1IB8 A;  1QP2 A;  2L89 A;  3GOX A;  1H64 1;  2AK5 A;  3P8H A;  1SKU B;  1YIJ T;  3CCS A;  1XJW B;  1BI2 A;  3DB4 A;  4N0A A;  3JCM h;  1N8R R;  3NMZ C;  4E7I A;  2JMA A;  3CMA T;  2J7I A;  3WVD B;  4M7A E;  5LJ3 f;  1K73 C;  3VKI A;  1FXX A;  3CCQ T;  2KXC A;  2JT4 A;  5EG2 A;  1AT1 B;  1JO8 A;  4X9C A;  2NUZ A;  3S6W A;  2R58 A;  4FW2 A;  2MIO A;  3SWN C;  4HXJ A;  2CS7 A;  2FYK A;  1M1K U;  2BKD N;  2ABL A;  1BK2 A;  3CCV T;  1RAB B;  1KD1 U;  3CCU Q;  3EGD B;  3RES A;  2XDP A;  2P0P A;  1UDL A;  2CH4 A;  3GF5 A;  3EG9 B;  2CYZ B;  1TSF A;  2KEA A;  2HCK A;  2R5A A;  4ZGE B;  2D0N A;  4RTX A;  2KT8 A;  4A63 B;  2M16 A;  4BB7 A;  2DYB A;  5M9O A;  2VC8 A;  2ZPB B;  3JCM d;  1YJ9 T;  4Z89 A;  1OUL A;  5GAN j;  4PJO E;  5GMK h;  1WQ7 A;  3CC4 T;  3QDR B;  2OX7 A;  4N4H A;  4M4Z A;  3M4G A;  3REB B;  1WJS A;  2MK5 A;  3CCL Q;  2LJ0 A;  4GY5 A;  3E9G A;  1VQ6 A;  1W70 A;  3I5S A;  4C8Q E;  1ZHI A;  2HMA A;  5J26 A;  4BI3 A;  1XTD A;  4B9X A;  1R0C B;  3OYE A;  2W10 A;  4EMH A;  4E7L A;  2K7A A;  4OMO A;  3H0H A;  2DBM A;  2P4T A;  2DBK A;  1VIF A;  1VQ9 T;  2DTO A;  1AOJ A;  5GAM h;  4ELY C;  3EFR A;  1BI3 A;  1M3A A;  2ZPG B;  4TVR A;  4D8D A;  2EAY A;  2J6K A;  3G4S A;  1QVG S;  3ZFJ A;  3BE3 A;  8AT1 B;  3CC7 T;  4JPB W;  3J80 E;  3PE0 A;  1Y57 A;  4AG1 C;  3LH5 A;  1YI2 Q;  4AT1 B;  1TUC A;  2RNA A;  2F2X A;  2KBT A;  3M5A A;  3C94 A;  1KC8 U;  1VQL T;  1ZUK A;  4RTZ A;  1X01 A;  2OTJ T;  1ZBX A;  2MWP A;  2K3B A;  1VQM Q;  1WJR A;  2QTX A;  3M58 A;  1B3Q A;  5GAM d;  4AMC A;  1VQN T;  4M7D C;  3TQ7 P;  2NUP B;  3VV0 A;  4DQ2 A;  1QMC A;  5GMK i;  2E41 A;  3SEM A;  3INZ A;  4M75 C;  1H3H A;  3MJX A;  4IUU A;  2GF7 A;  1BI0 A;  5LJ5 h;  5D6X A;  4KT0 E;  1QCF A;  1GCP A;  5GAO p;  2AKL A;  4EMK C;  1UE9 A;  2JUF A;  3VUB A;  4F04 B;  2F1L A;  3QJY A;  2RJD A;  1FMK A;  2QQ9 A;  3CCS T;  3SB2 A;  5I22 A;  1M3C A;  2L3R A;  1PSF A;  3OYC A;  4MML A;  2E64 A;  4C5G A;  4A4H A;  1SRL A;  1KQS P;  5GAN 8;  4HCB A;  4FSX A;  3JV3 A;  2EJF A;  3M56 A;  4ZN3 A;  3HRS A;  5LL6 S;  4KH1 B;  1RL2 A;  3I55 Q;  1KQS S;  2B8A A;  5CVI A;  1VYT A;  3VS4 A;  2M51 A;  2K6D A;  2DX1 A;  2E5Q A;  5KYU B;  2F5K A;  1VQ8 Q;  5GMK e;  4M7D D;  2FRW A;  2KGT A;  5KYW A;  4C92 A;  2RQV A;  2E5K A;  2RJF A;  1U5S A;  4Y91 A;  3DLL A;  3PIP A;  2IIM A;  1K9M R;  2XDD A;  3JCM P;  3LH0 A;  2PUK B;  4E7H A;  5GAM e;  4M78 C;  3MEU A;  1K73 R;  1VQ6 T;  1K4U S;  2L5Q A;  1GCQ C;  3RKW A;  2LQ8 A;  4JZ4 A;  3EHQ A;  2JZ2 A;  2VAS A;  4PKC C;  2KQW A;  5CKD A;  4FYV B;  3UPU A;  2P84 A;  1KIK A;  3VYH B;  3GBQ A;  3QWY A;  1VQ4 A;  3L2R A;  4AFU C;  2CKK A;  1IGQ A;  1W6X A;  2E6Z A;  4E2F B;  5GAN 7;  3JB9 H;  1AWX A;  3QYH B;  2DZ9 A;  5L8R E;  5C6S A;  1LCK A;  2DL4 A;  3J7A F;  3LWH A;  1G83 A;  2LQW A;  1IZ6 A;  4IUQ A;  4NL2 A;  1NPP A;  4J5Y A;  1UGR B;  2V26 A;  2J6O A;  3BFM A;  1X75 C;  4E6R A;  2SEM A;  2EGC A;  3CBM A;  4XU3 A;  4CC2 A;  2HL5 C;  3OYY A;  2JVV A;  1BCM A;  1YJN Q;  3QUI A;  2DZC A;  1OPL A;  4RG8 A;  4JRQ A;  1HD3 A;  5FU6 C;  2LCS A;  2FEI A;  2DTH A;  4GBQ A;  4FT2 A;  2CZ6 B;  4M7A B;  5LJ5 e;  3CCU A;  1I5O B;  3JB9 J;  2EBP A;  2DYI A;  5J39 A;  4YTL A;  2BTT A;  4FIB A;  4M78 D;  3L42 A;  2RD1 A;  2LMJ A;  3UAT A;  2YRV A;  1YJW Q;  2F69 A;  2KY9 A;  4OGE A;  5DLO A;  1HXD A;  3GNG A;  2JM9 A;  4II1 A;  4Z8A A;  1NPR A;  1SEM A;  1Y96 A;  2V8K A;  2KYM A;  4DBH A;  2XKO C;  1TUG B;  1K1Z A;  3CCL A;  4XTY A;  3CXC P;  2B86 A;  3X26 B;  2IVW A;  3PVL A;  2FB7 A;  2C0O A;  3OW2 P;  5A2Q E;  2XHC A;  4RTU A;  4FW1 A;  2HD0 A;  2NWM A;  3OW2 S;  4AG2 C;  1D0Z A;  3OYN A;  1TOV A;  2QAZ A;  1Q86 C;  2YRD A;  5I2M A;  4J9E A;  2YUP A;  4C0D B;  2PZ1 A;  1AWO A;  2AZS A;  1Z9Z A;  5GAN f;  2EYW A;  2JTM A;  4OB0 B;  1G8X A;  1AWW A;  1PRM C;  3WVE B;  1Y7X A;  1NM7 A;  2VXF A;  4JJD A;  5CQY A;  2YHT A;  4QVD A;  1YI2 A;  3M0R A;  1ZUU A;  2YRC A;  5GAO r;  2QA4 Q;  3HRU A;  3VS6 A;  2G6F X;  2CSI A;  2O9V A;  4ELZ C;  5C0M A;  1G3T A;  4A54 A;  2YDL A;  1KD1 C;  1TU0 B;  3MP1 A;  1VQM A;  2AIR B;  1S1N A;  1WHK A;  4BUG A;  2VGM A;  4M7D A;  1YNZ A;  2LCL A;  1BYM A;  3I5R A;  4M77 D;  4OMQ A;  3OYF A;  3LGF A;  4J9B A;  2LQN A;  5KCO A;  5FRM A;  2DMO A;  3VRZ A;  1IXD A;  5GAN 4;  2RQW A;  2RHU A;  3TEE A;  1K0S A;  2NUT A;  1N8R C;  4OGC A;  2DO3 A;  1O75 A;  4EMK A;  1VQ4 T;  4M75 F;  2CZ0 B;  4LDW A;  3X28 B;  4LUD A;  3GIB A;  1IGU A;  2CP6 A;  2DJQ A;  4E7J A;  1IRX A;  5LJ3 h;  3VUZ A;  2WAC A;  5FW9 A;  3ZEH A;  1A0N B;  2OJ2 A;  3FRN A;  2COZ A;  1PKS A;  2DXU A;  4NOY A;  3OS5 A;  4CC4 B;  2L3Q A;  5GAO m;  3I55 A;  4DOW A;  3CXC A;  2K57 A;  3G4S Q;  1YWO A;  4M7A G;  4IUT A;  1OEB A;  5AYF A;  3CPF A;  2GBQ A;  3CCU T;  1VQ8 A;  2EVR A;  2YSQ A;  4DEX A;  4J7I A;  1OOT A;  3REA B;  1YP5 A;  4XU1 A;  1NEG A;  2D9T A;  1SF9 A;  3QZ5 B;  2LTO A;  2L8D A;  4Y28 E;  1NE8 A;  3EFS A;  3ULR B;  4QT7 A;  2EYQ A;  2EW3 A;  5KYW B;  2YLB A;  3PT9 A;  1LPL A;  2PVD B;  1NJI C;  4VUB A;  4XAX B;  4M78 A;  3HL8 A;  1SRM A;  3M57 A;  3CCL T;  4OMN A;  3JCM g;  1WXB A;  2DL7 A;  3BY7 A;  2O88 A;  1RLP C;  5KYN A;  2EGA A;  1QLY A;  4P5N A;  3TSW A;  1M9S A;  3SDZ A;  3M55 A;  4GLM A;  2QEX Q;  4QQ6 A;  3E2U A;  1AVZ C;  2DK3 A;  2SRC A;  3EG3 A;  4JJC A;  3G6E Q;  2E3H A;  1UHF A;  4F17 A;  3JCM X;  2YLC A;  2RMO A;  2KRN A;  2I2L A;  2O4X B;  3JB9 G;  2ECZ A;  4QQG A;  4ZGJ B;  2HBW A;  2FG0 A;  4OF1 A;  1YI2 T;  1CSK A;  5GMK m;  2RN8 A;  2VB6 A;  3HTR A;  1SPK A;  3VJP A;  1YJN A;  1LJO A;  3QYG B;  2A08 A;  4F7U A;  5A0L A;  3EG0 A;  3M0S A;  2QG9 B;  1OU8 A;  2YWW A;  3RIR A;  1MNE A;  2D8H A;  2E3I A;  2X4X A;  1AZE A;  3A98 A;  1TG0 A;  2E10 A;  1VQM T;  1UEB A;  1Q7Y R;  5A0G A;  3QZ9 B;  1AWJ A;  2CZ7 B;  1R0B G;  3NTK A;  2LC4 A;  2JN0 A;  1Q86 R;  4PJM A;  4BE1 A;  2ZPI B;  1YJW A;  2DL5 A;  2OTL Q;  2VWF A;  2L3S A;  3RER A;  4MZM A;  5CR2 A;  5LJ3 e;  3OYB A;  3UA6 A;  5HK3 A;  4E7S A;  4M77 A;  4C5E A;  3OYG A;  4MMK A;  2O01 E;  2KDS A;  3EFO A;  3OYL A;  3V7S A;  1QVF S;  2MOX A;  5J3B A;  1FMW A;  2G3R A;  4ZN1 A;  1VYU A;  1M1K R;  3EGX A;  3NFC A;  5IN1 A;  4N4G A;  1WDX A;  1QVP A;  3A8M B;  5CKE A;  3RBB B;  3PTA A;  1KD1 R;  2HEQ A;  1E7O A;  1QW1 A;  2QDY B;  1UFF A;  1EIF A;  1KHI A;  2DXB A;  4BI8 B;  3I55 T;  1UGQ B;  4C0Z A;  1IHV A;  1ARK A;  1GFD A;  1ZSZ B;  5KCH A;  1K9M C;  3HSB A;  1RI0 A;  1VQ8 T;  2JXB A;  1YBY A;  1M2V A;  4IIO A;  2ZCF B;  2QA4 A;  4DA4 A;  3ER0 A;  2LRQ A;  2X9H A;  2P0K A;  3C4S A;  4C92 D;  5KH6 A;  4DBR A;  2WSF E;  2FPD A;  2CP5 A;  3QDF A;  2ESW A;  3RMQ A;  4E7K A;  3OYI A;  3FB9 A;  1H8K A;  4PK4 A;  4R55 A;  1UEC A;  1YIT Q;  4PFZ A;  3O5Z A;  2R57 A;  3X24 B;  2L3P A;  3UF4 A;  3GP8 A;  2DVE A;  1P92 A;  3RKX A;  1M8M A;  1QCO A;  4HCC A;  2CUD A;  3H6Z A;  1ZUY A;  2LP5 A;  1SSH A;  5FWC A;  5HKC A;  4XTZ A;  4M7A F;  5A0D A;  1BBZ A;  4KH0 B;  1OX9 A;  1KC8 R;  1UTI A;  1FMV A;  2EQK A;  1AZG B;  2NUT B;  2CP2 A;  4FYY B;  4Z02 A;  1LVK A;  3RR6 A;  5CK9 A;  2CSQ A;  4R0K A;  1NJI R;  3OS1 A;  1YJN T;  1QVG P;  1VUB A;  3JCM Q;  3EAE A;  3H0F A;  3MO8 A;  3PNW C;  4KGV B;  1IO6 A;  4LXC A;  4RMO A;  5D7U A;  2DRM A;  3NHN A;  3M0P A;  1MV0 B;  4PJO F;  1W2B A;  2AKK A;  3CEY A;  1N27 A;  2M9U A;  4FM4 B;  1WHH A;  4C8Q F;  4J7F A;  2F2V A;  1YJW T;  1HSQ A;  2CP0 A;  1Q81 U;  4CC7 A;  2ZPH B;  1VYV A;  2E4H A;  2O31 A;  5HY6 A;  1MMG A;  2BIV A;  3BDU A;  3PVQ A;  3JB9 F;  3I35 A;  2ZAE A;  4OML A;  3CPW P;  1WQW A;  1WNL A;  2GNC A;  3C0C A;  4FYW B;  2DVJ A;  3CPW S;  1W1F A;  4NL3 A;  4JLG A;  2QEX A;  4OP0 A;  5GAN 2;  4N4I A;  3V8J A;  1G5V A;  5GAN h;  5IHK A;  3WXM B;  3VYG A;  3VRY A;  2JJ9 A;  2FVU A;  3G6E A;  1E6H A;  2HQX A;  4FT4 A;  1NYF A;  2X3X D;  4BAC A;  4J9C A;  2VUB A;  3JCM b;  4XTW A;  2VVK A;  1G3Y A; 
#chains in the Genus database with same CATH homology
 1Q86 U;  3DB3 A;  2ZPF B;  3OMG A;  3V8L A;  3OS2 A;  4IUR A;  2XKO C;  3A8H B;  2DAQ A;  4L6V 5;  3P8B B;  4C92 G;  3CCL A;  2F5T X;  2V8I A;  4XTY A;  3CC2 T;  4J6Y A;  2DD4 A;  2QA4 T;  3X26 B;  1G3S A;  2MWO A;  2LCC A;  5DY9 A;  4A4E A;  4OB2 B;  3FC3 A;  3M54 A;  2CZ1 B;  4EMG A;  1VIE A;  3URG A;  4JRP A;  2IVW A;  3V7R A;  2FB7 A;  2DKG A;  2LX9 A;  1PSE A;  5A2Q E;  2XHC A;  4LD6 A;  1BIA A;  2GFU A;  2HD0 A;  4BY6 C;  3CCV A;  4L5G A;  3QSU A;  2FL7 A;  2JNG A;  2XG8 D;  1O9S A;  4M7A A;  1FWZ A;  3PIO A;  3OW2 S;  3HRT A;  4KBM B;  3OYA A;  2H3J A;  4XQ3 A;  3OYN A;  3CCR T;  1I5L A;  4M7D B;  1I8F A;  5GAN d;  3JRZ A;  5LJ5 d;  1Q86 C;  5FLX E;  3ZBD A;  1BIB A;  4F7U B;  5I2M A;  4C0D B;  1JB0 E;  1B34 A;  4PLL A;  4PJO G;  3CCM T;  4C0F A;  1Y71 A;  2KAF A;  1S72 T;  4M78 F;  4C92 E;  3OYH A;  2OTL A;  1KG1 A;  2DEQ A;  4PNO A;  3PGG A;  2OAU A;  5GAN f;  1GXI E;  3QII A;  4M75 B;  4QW2 A;  2RH2 A;  2JTM A;  4PL6 A;  1QVG A;  1YJ9 A;  4OB0 B;  3WVE B;  1Y7X A;  4C8Q G;  2EIF A;  4L59 A;  4XTX A;  1D3B A;  3M53 A;  4DOV A;  3CC4 A;  2VXF A;  4EPC A;  5CQY A;  2YHT A;  4QVD A;  3LYI A;  4M75 D;  4CI0 C;  1YI2 A;  4EMK B;  2DD5 A;  1W4S A;  2RK2 A;  3M4Y A;  3JB9 D;  5GAO r;  2RJE A;  3HRU A;  1QVF A;  2PUO B;  4ELZ C;  2X35 A;  4JDS A;  5LJ5 j;  5C0M A;  1G3T A;  4A54 A;  1N8R U;  1VQ5 A;  2DIG A;  4PJO A;  2NLU A;  4M77 B;  1KD1 C;  2VYT A;  3MP1 A;  3JCM f;  2VGN A;  3CBP A;  1VQM A;  4LDX A;  2K5I A;  4BUG A;  3E9F A;  2VGM A;  4C0G A;  4M7D A;  4BDY A;  3DKM A;  3OSS C;  2LCL A;  5GAN 5;  3OMC A;  3OA6 A;  2KVQ G;  1BYM A;  4M77 D;  2BUD A;  4C8Q A;  2E12 A;  5IT9 E;  2EQM A;  3JCM V;  3CPW A;  4C5I A;  3CCE T;  3OYF A;  3LGF A;  4J83 A;  5KCO A;  5FRM A;  1M8V A;  2RI2 A;  2Y4Y A;  3CC7 A;  4BY6 B;  1M1F A;  1SSF A;  3OY9 A;  1JJ2 S;  5GAN 4;  5IAY A;  2RHU A;  2K5F A;  3A5Z B;  4HKE A;  3G4S T;  1N9S A;  3TEE A;  2VXE A;  2QQS A;  3RUX A;  4X34 A;  3JB9 I;  2K5L A;  3RKY A;  2RM4 A;  1N8R C;  5CKB A;  2K3X A;  4OGC A;  2DO3 A;  1O75 A;  4X9D A;  4EMK A;  4MZT A;  1VQ4 T;  5FRN A;  3KXT A;  3HKS A;  4M75 F;  2CZ0 B;  4LDW A;  3X28 B;  4JJN K;  3GIB A;  2LQK A;  4C92 C;  4KUD K;  3QKJ A;  1VQL A;  4E7J A;  2QXF A;  3OS0 A;  1UGP B;  5CAI A;  3FLG A;  5LJ3 h;  3LGL A;  5GAO q;  3VUZ A;  2OTJ A;  2LVM A;  3KBG A;  4J6X A;  3I56 A;  3MP6 A;  1VQM T;  2WAC A;  3QG1 A;  3SWN A;  3TRE A;  3UWN A;  4A53 A;  3ZEH A;  1Y07 A;  1IRE B;  3JCM W;  3FIF A;  1VQK T;  3OB9 A;  3CD6 T;  3OSV A;  2JTF A;  1VQN A;  1YCY A;  3FRN A;  4MDW A;  3N5B B;  1Q82 C;  2X4W A;  1KQ2 A;  3CME T;  4BE0 A;  5GAN e;  4M78 B;  2DXU A;  4A4G A;  4J8O A;  4NOY A;  3PMT A;  1YIT A;  1M1G A;  3OS5 A;  4BI4 A;  1OZ2 A;  3UDC A;  4IKF A;  3LWI A;  5GAO m;  3MCA B;  3I55 A;  4ATO A;  4DOW A;  3HHT B;  3CXC A;  1VQO T;  4KUL A;  2QQA A;  4RG2 A;  2E1H A;  2AHJ B;  2K57 A;  3J81 E;  2LT4 A;  4M78 G;  2EKO A;  1KQS A;  3GNF B;  4M7A G;  2VV5 A;  4IUP A;  4IUT A;  5AYF A;  3CPF A;  3HFN A;  1K73 U;  1NJI U;  3CCU T;  1W2B S;  1VQ8 A;  3V7C A;  2QEX T;  1Q7Y U;  2DTI A;  4J7I A;  4XTU A;  5GAN g;  4KUI A;  4RKU E;  1DJ7 B;  2QI2 A;  1QP2 A;  2L89 A;  4XU1 A;  1V29 B;  3G6E T;  3QBY A;  1H64 1;  3GOX A;  3P8H A;  3M59 A;  2D9T A;  3UT1 A;  3OYK A;  3PMI A;  3QZ5 B;  1YIJ T;  2RI5 A;  2LTO A;  3JCM e;  3CCS A;  3HPW A;  1BI2 A;  2L8D A;  3CCU A;  4Y28 E;  3DB4 A;  3GLX A;  5D6W A;  4N0A A;  2LNV A;  1XNI A;  3JCM h;  1NE8 A;  3EFS A;  1X6O A;  1VQP T;  4XK8 E;  4E7I A;  3S3O A;  3CMA T;  2EYQ A;  5FU7 B;  4LDY A;  3S3N A;  1YHQ T;  3MET A;  2YLB A;  2A7Y A;  3PT9 A;  2MF2 A;  3WVD B;  2P0Q A;  4M7A E;  5LJ3 f;  2PVD B;  1K73 C;  4VUB A;  4XAX B;  2XIC A;  3VKI A;  1NJI C;  1FXX A;  4M78 A;  3CCQ T;  1Q7Y C;  3HL8 A;  5EG2 A;  3M57 A;  3CCL T;  4X9C A;  3S6W A;  2R58 A;  3JCM g;  2CGH A;  3SWN C;  1XQH A;  3CCJ A;  2CS7 A;  2FYK A;  3BY7 A;  2RHX A;  3ME9 A;  1M1K U;  3A8G B;  2RA2 A;  2BKD N;  5FU6 B;  4P5N A;  1JBM A;  2K4Y A;  1M9S A;  3SDZ A;  3CCV T;  3M55 A;  4V2S A;  1KD1 U;  4M7D G;  2RJC A;  4QQ6 A;  4F7U G;  2DK3 A;  3RES A;  2XDP A;  2P0P A;  3MHX A;  3AHU A;  2MAM A;  3GF5 A;  4JS5 A;  2CYZ B;  3JCM X;  2R5A A;  2YLC A;  4ZGE B;  5CO7 A;  4M75 G;  3T9N A;  2OTL T;  2I2L A;  2M16 A;  2O4X B;  4BB7 A;  2RK1 A;  2FHD A;  5M9O A;  3JB9 G;  2VC8 A;  2ZPB B;  4QQG A;  3JCM d;  1M4Z A;  2RHI A;  1YJ9 T;  1M1K C;  3L2W A;  1VQ7 A;  5GAN j;  4ZGJ B;  4PJO E;  5GMK h;  1WQ7 A;  3CC4 T;  3QDR B;  4ZTF A;  4N4H A;  4OF1 A;  3M4G A;  1YI2 T;  5GMK m;  1WJS A;  3VJP A;  3OYM A;  4M7D E;  4GY5 A;  3E9G A;  1YJN A;  1LJO A;  1VQ6 A;  1OI1 A;  4C8Q E;  1ZHI A;  3QYG B;  4N0A C;  5J26 A;  1XTD A;  4BI3 A;  3CBO A;  4B9X A;  4F7U A;  5A0L A;  5HK0 A;  3NTH A;  3OYE A;  4EMH A;  3L2V A;  3RIR A;  4E7L A;  2IG0 A;  4M77 G;  4C92 F;  3E19 A;  2XDB A;  2X4X A;  2RB6 A;  4NS5 A;  1VQ5 T;  2P4T A;  1VIF A;  1VQ9 T;  2DTO A;  4M75 A;  3X25 B;  4E47 A;  2E10 A;  2ZPE B;  5GAM h;  4ME7 A;  2Y90 A;  3O8V A;  1UEB A;  3H8Z A;  5CIU A;  4ELY C;  3EFR A;  3QZ9 B;  5A0G A;  3SD4 A;  1BI3 A;  3TU4 K;  2CZ7 B;  3BDL A;  2ZPG B;  1UGS B;  4TVR A;  3NTK A;  5D6Y A;  1LOJ A;  2LC4 A;  2EAY A;  2JN0 A;  4XTV A;  3NTI A;  5KE3 A;  4JS4 A;  1Q82 U;  3G4S A;  4BE1 A;  2HBP A;  3ZFJ A;  1QVG S;  2ZPI B;  1YJW A;  3G7Z A;  1UB4 A;  3JAM E;  1U1S A;  2O4X A;  3CC7 T;  2XID A;  4JRI A;  3RER A;  4MZM A;  2XI9 A;  2M0O A;  2RHY A;  3J80 E;  3CD6 A;  1M5Q 1;  4WF2 A;  5CR2 A;  5LJ3 e;  3OYB A;  5HK3 A;  4JUV A;  4M77 A;  4C5E A;  2M1H A;  2E65 A;  4MMK A;  1AHJ B;  3C12 A;  2O01 E;  2KDS A;  4JLI A;  3OYL A;  3V7S A;  1QP3 A;  1QVF S;  3M5A A;  5CKH A;  3C94 A;  1KC8 U;  5J3B A;  1WPY A;  2LDM A;  3G71 A;  2G3R A;  1VQL T;  1U1T A;  2GQV A;  4ZN1 A;  5LJ3 g;  1X01 A;  3C95 A;  5IN1 A;  3NFC A;  2OTJ T;  1K9M U;  1ZBX A;  2E6N A;  4PJO C;  4N4G A;  1WJQ A;  3I56 T;  1QVP A;  2MWP A;  1WGS A;  3A8M B;  1NZ9 A;  3MP8 A;  4IUV A;  5CKE A;  4BD3 A;  3PTA A;  4ZTJ A;  2XK0 A;  1WJR A;  2QTX A;  3M58 A;  5GAM d;  4BDZ A;  4A4F A;  1VQN T;  4M7D C;  2R5M A;  3VV0 A;  4DQ2 A;  4PLI A;  3OW2 A;  1OZ3 A;  4C8Q C;  1QW1 A;  2QDY B;  4O6J A;  4C0D C;  1EIF A;  5GMK i;  3QJ6 A;  1K8A C;  1KHI A;  3S3M A;  2E41 A;  2DXB A;  2RHZ A;  1YIT T;  4BI8 B;  1I4K 1;  3QXE B;  5GAM f;  3I55 T;  1UGQ B;  2GFA A;  4C0Z A;  4M7A C;  3INZ A;  1KC8 C;  5KE2 A;  2HQE A;  3FEO A;  4M75 C;  5GAN 3;  2Y4X A;  4IUU A;  2GF7 A;  1BI0 A;  2ZZD A;  3L2Z A;  4R56 A;  5LJ5 h;  3F70 A;  5D6X A;  4MZP A;  3Q1J A;  4KT0 E;  5KCH A;  2HAX A;  1I81 A;  2EJ9 A;  5LJ3 d;  1K9M C;  1BKB A;  3HSB A;  5GAO p;  3M9Q A;  4EMK C;  1RI0 A;  4M7A D;  1VQ8 T;  2JUF A;  1YBY A;  2EQU A;  3VUB A;  3OYD A;  1R8O B;  3CC2 A;  2A3L A;  2EWN A;  4HCZ A;  2ZCF B;  4QQD A;  2QA4 A;  4M78 E;  5DLQ E;  4C92 B;  4DA4 A;  4XU0 A;  1MHN A;  3QJY A;  2RJD A;  3ER0 A;  5FRO A;  3CMA A;  2EJG A;  4OB1 B;  2LRQ A;  2QQ9 A;  4CRI A;  2P0K A;  3C4S A;  3CCS T;  3P8D A;  3SB2 A;  4M77 C;  2GCX A;  4C92 D;  5KH6 A;  3CCQ A;  1FX7 A;  1MGQ A;  1PSF A;  2L3R A;  4JRK A;  3OYC A;  2WSF E;  3HP9 A;  4D6W A;  3LX7 A;  1KHC A;  2E64 A;  4MML A;  3RMQ A;  4C5G A;  3OYI A;  3CCR A;  4E7K A;  4GLK A;  2X4J A;  3FB9 A;  4A4H A;  5CQX A;  3OBW A;  5GAN 8;  3OBY A;  1OYX A;  4R55 A;  4HCB A;  4FSX A;  2HNI A;  1M90 C;  4B9W A;  3CCM A;  2EJF A;  3M56 A;  3CXC S;  4ZN3 A;  2QQB A;  3HRS A;  4C5H A;  2D0Q B;  5LL6 S;  1RL2 A;  5LJ3 j;  2R57 A;  3X24 B;  1S72 A;  2KMT A;  4PJO B;  3V8K A;  1KQS S;  2B8A A;  5CVI A;  3CCJ T;  3GP8 A;  2DVE A;  4LDU A;  3PFS A;  2C06 A;  1P92 A;  3RKX A;  2KK4 A;  2E5Q A;  1ZQ1 A;  2XU8 A;  1JJ2 A;  3LLR A;  4HCC A;  3H6Z A;  4PJO D;  4C8Q B;  4ZGD B;  2F5K A;  4OB3 B;  5GMK e;  5HKC A;  3X20 B;  4XTZ A;  4M7D D;  4M7A F;  2X4Y A;  4HT9 A;  5A0D A;  5LJ5 f;  2JOY A;  4C8Q D;  2ZGW A;  4C92 A;  4OMF B;  2DXC A;  3QO3 A;  2RJF A;  2RO0 A;  3QPH A;  3OYG A;  4FL6 A;  2EQK A;  4Y91 A;  4F7U E;  3L1A A;  2KSS A;  4Q5W A;  5GAO l;  3DLL A;  3PIP A;  2MMP A;  3JSC A;  4Z02 A;  1XOV A;  2XDD A;  1VQ7 T;  3OYJ A;  4LD9 K;  3OQ5 A;  3JCM P;  3SFM A;  5CK9 A;  4M75 E;  1U8R A;  3LH0 A;  2PUK B;  4E7H A;  5GAM e;  2K2V A;  4RCB A;  1BI1 A;  4FU6 A;  1LNX A;  4M78 C;  3MEU A;  4O5V A;  3TCJ A;  5DM7 R;  3CCE A;  4HA8 A;  3OS1 A;  3FJP A;  1YJN T;  4HT8 A;  1VQ6 T;  1VUB A;  2L5Q A;  2V8J A;  3JCM J;  1VQ9 A;  3SWN B;  3RKW A;  4A4K A;  2K3Y A;  2LQ8 A;  3JCM Q;  3EAE A;  2QQR A;  4QVZ A;  3MO8 A;  3PNW C;  2JZ2 A;  4QVC A;  4RMO A;  4OVA A;  2KQW A;  4PKC C;  1HK9 A;  2EFI A;  3RMS A;  2WSC E;  2E70 A;  5CKD A;  4BE2 A;  3UPU A;  3VYH B;  5GAM g;  2PU9 B;  1VQ4 A;  4PJO F;  3R6O A;  5I21 A;  3MEV A;  2EQJ A;  4M77 E;  1W2B A;  1G3W A;  3L2R A;  4XU2 A;  2CKK A;  4M7D F;  2E6Z A;  3JB9 H;  5GAN 7;  3CEY A;  4F7U F;  3QYH B;  4UC4 A;  1N27 A;  2DZ9 A;  3L2Q A;  1K8A U;  2M9U A;  4FM4 B;  5L8R E;  4C8Q F;  4J7F A;  5C6S A;  1YJW T;  1VQK A;  3J7A F;  3LWH A;  3E1S A;  1Q81 U;  3MEA A;  1IZ6 A;  2DXT A;  2ZPH B;  4IUQ A;  3QHS A;  4NL2 A;  5FU7 C;  5HY6 A;  1NPP A;  3JCM c;  4J5Y A;  1Y96 B;  5GAO n;  1KQ1 A;  1UGR B;  3FDR A;  4LDV A;  2MI6 A;  2RI3 A;  3L2U A;  2BIV A;  3BFM A;  1X75 C;  3BDU A;  5I2S A;  3JB9 F;  3CBM A;  2DIQ A;  1H3Z A;  3BW1 A;  3CME A;  4XU3 A;  2PVG B;  5CKF A;  3OYY A;  2JVV A;  4J6W A;  3QUI A;  1WQW A;  2DZC A;  3LW5 E;  4RG8 A;  1WNL A;  3G71 T;  4JRQ A;  1N9R A;  1VQO A;  1TH7 A;  4RCC A;  3A8L B;  3DLM A;  3CPW S;  5FU6 C;  5GMK j;  3KUF A;  4NL3 A;  1Q81 C;  4JLG A;  2DTH A;  5CCA A;  4FT2 A;  2CZ6 B;  4M7A B;  5LJ5 e;  4OP0 A;  5GAN 2;  4N4I A;  3V8J A;  3GPL A;  4M77 F;  2LT1 A;  2WSE E;  2QEX A;  3JB9 J;  2DJZ A;  5GAN h;  1G5V A;  2PVO B;  3A8O B;  5J39 A;  3WXM B;  4YTL A;  4EDU A;  3VYG A;  3G6E A;  2FVU A;  2DPP B;  4FIB A;  4M78 D;  3HFO A;  5GMK l;  2D6F A;  1B34 B;  3L42 A;  2RD1 A;  2HQX A;  1M90 U;  1YIJ A;  2YRV A;  2F69 A;  4FT4 A;  2KY9 A;  4OGE A;  3VU3 C;  2XD0 A;  3MEW A;  5DLO A;  1HXD A;  3GNG A;  4MDX A;  4II1 A;  1N6A A;  4BAC A;  1VQP A;  5GAN 6;  2PQW A;  5GAM j;  1JRI A;  2VUB A;  1NPR A;  5LJ5 g;  1Y96 A;  4XTW A;  3JCM b;  1YHQ A;  2V8K A;  1G3Y A;  1D3B B;  3ASK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...