2K4YA

Nmr structure of feoa-like protein from clostridium acetobutylicum: northeast structural genomics consortium target car178
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
86
structure length
86
Chain Sequence
b'MTKGIGLNEVEIKSKVKVIGIVPESKVRRKIMDMGIVRGTEIYIEGKAPMGDPIALRLRGYSLSLRKSEAKDILVEVLLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FeoA-like protein
publication title NMR Structure of FeoA-like protein from Clostridium acetobutylicum: Northeast Structural Genomics Consortium Target CaR178
rcsb
source organism Clostridium acetobutylicum
molecule tags Metal transport
total genus 16
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04023 FeoA FeoA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.90 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2k4yA00
1G3SA 2LX9A 4O5VA 1G3YA 3MHXA 2GCXA 1G3WA 1BI0A 1QW1A 3HRSA 2K5LA 2K4YA 1FX7A 1FWZA 2QQ9A 1BI1A 3HRUA 1BI2A 1BYMA 2K5FA 2QQBA 2K5IA 3E19A 1BI3A 1G3TA 1QVPA 4O6JA 1U8RA 3GLXA 2H3JA 2QQAA 1P92A 5CVIA 3HRTA
chains in the Genus database with same CATH superfamily
4IURA 2R5MA 1M5Q1 2D0NA 4PJOE 2DXBA 4DBRA 3CCVT 3A8HB 3CCLA 4OP0A 1TS9A 2J6OA 3LYIA 4BE1A 5CK9A 2HL5C 5LJ5f 2RQVA 2DXCA 4C92E 3V8KA 3QZ9B 4KBMB 2LTOA 3CCRT 1TOVA 5CKEA 3CCST 1VQ7Q 4HCCA 3TSWA 3KBGA 1YI2T 1QVFP 3MO8A 2GTOA 4IUVA 1ARKA 1UUEA 3M0SA 5KYXB 3L1AA 1OV3A 1NPRA 3OW2A 1VQ6T 3VV0A 2KYBA 2ROTA 2EVRA 1LJOA 3BFMA 2JXBA 3CCET 2F5KA 4IIMA 3F70A 2L3QA 1VIFA 3M0QA 2OTJT 4FW2A 4Q5WA 2V8KA 4EPCA 2GF7A 3OMCA 1Y96A 1I07A 4F16A 1MMAA 1YITA 2HNIA 2CP6A 2O4XA 1AWOA 4NL3A 1E6HA 2DAQA 3DB4A 4M78D 1Q81R 1TXQA 4FT4A 3CCMQ 2FG0A 2DJQA 2CSIA 4LUDA 3DLMA 3G6ET 4FYXB 2BE7D 1FMVA 2HAXA 4RCBA 3A8MB 1AWWA 2E6NA 3EG1A 2QA4A 3BW1A 3CC2Q 2RD1A 3VS7A 3L2RA 2MIOA 3VYGA 1GXIE 2FRWA 4M77D 3PT9A 1VQLQ 2EYZA 4E7IA 2DBMA 4C0DB 2LNHB 1X75C 1MV3A 4LDWA 3OSVA 3UATA 4B9XA 2CYZB 1K8AU 1PM3A 3OS5A 1B34B 1RAHB 3T9NA 2B86A 1SRMA 4OB0B 2CZ7B 2VXEA 4C0DC 2LZ6B 4A63B 4ELZC 2LJ0A 2QQ9A 1XOVA 1VQOT 1Q7YU 2I2LA 2DVJA 2KXDA 2D8HA 4RTTA 4E6RA 2AZVA 2L2PA 4XK8E 3NMZC 2YSQA 1G3SA 2H3EB 4F7UA 1TUGB 2DRMA 3M4YA 3JB9H 2FO0A 1QW1A 2DTOA 1VQ4T 5GAN8 2RJEA 1TG0A 4QQ6A 2EKOA 4XTYA 3RMSA 1BIAA 4RTUA 4IUTA 1JBMA 3CC2T 3GP8A 4M75B 4ZGDB 5GANh 2E70A 2E3IA 4KH1B 1Y07A 5A0LA 1TH7A 1NPPA 1VQLT 2P84A 1B3QA 1RADB 2F69A 2DZ9A 3LW5E 4E7SA 3THKA 3SB2A 1KQSS 1Q82C 2H8HA 3OYAA 1B7TA 3QKJA 3HRUA 4M75C 1NG2A 3VRYA 4CI0C 5LJ5e 3L42A 3VS3A 3I5RA 4M7AB 2RO0A 3FC3A 1NYGA 1WFWA 4RTYA 4EDUA 2YUPA 3FJ5A 4RUGA 2O01E 1ZX6A 3QG1A 1G3WA 1RAEB 4KGZB 4QKUA 2YLCA 4CC4B 3NFCA 5GAMg 4M7AC 5DLQE 4R55A 3EGDA 1UJYA 1FXXA 4ZN1A 4YTLA 4JDSA 4E7KA 4QT7A 3CCLQ 1MNDA 4OMOA 1OI1A 1ZSZB 4HKEA 2JN0A 3HPWA 4N0AC 1KD1C 2JTFA 4M7DA 4K11A 1PC0A 4JJNK 1N8RR 2XU8A 4LDVA 1ZSZC 4XU0A 4AT1B 1H3HA 3OY9A 3QUIA 1FMWA 1K9AA 5FRMA 5HKCA 4HCZA 2O88A 2C0OA 4X9CA 5IH2A 3JCMh 2FVUA 2L5QA 2FB7A 1MNEA 3MEUA 4AFQC 3OYHA 1YJNA 2NUTB 2RQWA 4PNOA 3LWHA 3MJXA 4M78A 5J3BA 3SEMA 2DK3A 1UHFA 1VQ9Q 4BDZA 2F1LA 3CCLT 1SG5A 2LX7A 2RI3A 1E7OA 3EHRA 4PJNA 3MEWA 5LJ5g 1WHKA 2P0PA 4A54A 2W0ZA 1GFCA 1M9SA 4DBQA 2QA4Q 1UGRB 1YN8A 1WYXA 2LCLA 3BY7A 4JJBA 4EMKA 3M9QA 1Q81C 4C5EA 2Z0WA 2DJZA 3JB9J 4MMLA 2FRYA 4RKUE 3SDZA 1NLOC 8AT1B 1CSKA 4PJOA 1XTDA 2DTIA 3OYYA 4JRQA 1QLYA 2KXCA 3A8OB 1SEMA 4XTUA 3CPWP 4XU1A 3C95A 3QYGB 4ZNXA 2LQKA 2LQ8A 2MF2A 2KYMA 4C92A 2LC4A 2EYWA 3FEOA 3J81E 1V76A 3WVDB 2EJFA 3S3MA 4C8QG 3GPLA 5C0MA 3CPFA 3GOXA 1YITT 2O9VA 2MYSA 3OSSC 4CRIA 5IN1A 2CUDA 5CQYA 2VV5A 4F7UF 2GNCA 4ZGJB 3EGXA 4JLGA 1S1NA 1N27A 4OMMA 2K9GA 3M4GA 5HK3A 3S3NA 2EGCA 1N8RU 1BI0A 2CH4W 4GLMA 2QQRA 3JV3A 4J9IA 1LNXA 1AEYA 3E19A 1WXTA 2BZ8A 1KC8R 2VYTA 4M7AE 3RBBB 4E7LA 4RTVA 3VUBA 2RHYA 2HL3A 3JB9I 4FCYA 2JUFA 3EFOB 1JJ2A 1WI7A 3MKDA 2MPXC 4CC7A 2G6FX 3E2UA 4A4HA 1PKSA 4C92G 3OW2P 1XNIA 4ZTFA 3SWNB 1TTHB 1ABOA 1I5OB 1VQNT 2WACA 1UGVA 2AIRB 3VS1A 3INZA 2DETA 2DX1A 5AT1B 3PIPA 2LX9A 3G4SA 1F1BB 4M77C 2PUKB 4JLIA 1OX8A 3SWNC 2DM1A 5J26A 3JCMb 3CCJA 4MDWA 2YUNA 3CMAT 2CSQA 3PNWC 1PSFA 1VUBA 3L2VA 1OULA 4OGCA 4C0ZA 1ZHIA 4M7DF 2ENMA 3ER0A 3EH1A 1MHNA 4BE2A 2DEUA 1H641 2QQSA 3JB9G 4FL6A 1IHWA 3QWYA 4MZMA 2J7IA 2O2OA 5LJ3g 2K5LA 5KCHA 3TU4K 1PD0A 1JU5C 1B07A 2QTXA 4XU2A 2YRVA 2P4TA 1N8RC 2CP5A 5I2SA 4J8OA 4QVCA 4JUVA 2OX7A 1YJNQ 1N9SA 2M0OA 4ATOA 4AG2C 2KAFA 2A7YA 4MZTA 4L5GA 1HXDA 4M78F 1QVFS 4E47A 3QWXX 3M53A 3OS0A 1U5SA 3U23A 4BE0A 3JCMW 2AKLA 5I2MA 4JS5A 4HVUA 2DNUA 1G8XA 2CZ6B 4QW2A 3D7SB 2E4HA 5KYWB 3LH0A 3KUFA 1JQQA 1GCQA 2QGGA 3CD6T 1M8VA 2EQUA 5GAMj 4HVVA 1X6GA 1WHLA 2ZCFB 3CMET 4M77F 4LD6A 3P8BB 3QDFA 4L59A 1OYXA 2M51A 3OMGA 1QVGA 1KC8U 2V8JA 2ZAEA 1BKBA 1WZOA 4HA8A 3SHWA 4GBQA 1K9MR 2EJGA 4J6YA 3OYMA 1IGQA 1QWFA 4LDXA 3ASKA 2QEXT 2LQNA 1JB0E 1G2BA 2P0KA 1SHFA 1SSFA 1VQMA 2Y4XA 4JRPA 1YJNT 5M9OA 2L0AA 3M57A 1X2KA 3EH2A 2LQWA 2JTMA 3A8LB 2DF6A 2K2MA 2NUPB 2EYXA 3VS0A 2EGAA 4N4IA 3EAEA 1MMNA 1Y57A 4OMPA 2I0NA 2ABLA 1EIFA 3EGUA 1M1GA 5KYNA 4MMKA 1YIJT 4CC3A 2R5AA 3A98A 2GQVA 1RI0A 4RTZA 2HSPA 1WHHA 2CKKA 2YUQA 3UA6A 2M0YA 2DKGA 2YRDA 5GJWB 2ED1A 3QO3A 2HKNA 1I4K1 2WSEE 1OX9A 3HL8A 3OYDA 3I56T 1D09B 5LJ5j 2EKHA 2QGFB 2L8DA 1U1TA 2YT6A 1Q86R 1WJRA 3P8HA 1ZA2B 2GQIA 3C0CA 4JJDA 4M7DD 2M02A 3OB9A 3UDCA 4DA4A 4E7ZA 3JCMd 2CZ0B 4IUPA 3UF4A 1KC8C 4PLLA 4KT0E 3VS2A 1WA7A 4Y28E 2KROA 2KMTA 3PMIA 1PSEA 5GANf 2LT1A 4Z88A 1Z9QA 2JOYA 1BU1A 4FM4B 4OMQA 3G4SQ 2AHJB 2B8AA 2VUBA 2NUZA 1D1BA 2PZ1A 4D8KA 1RAAB 3M58A 3CCJQ 3OS2A 1VOMA 4FSSA 2RA2A 1YJ9A 3MHXA 3X26B 5FLXE 2JMCA 1QKWA 3OYBA 4ZGEB 1K4US 1R0CB 2X4XA 1FWZA 2PQWA 2O31A 1ZA1B 3RR6A 1GBQA 1VQ9A 4V2SA 4IUUA 1Q82U 2XG8D 2EQIA 4DEXA 2XDPA 2DEQA 5HK0A 2K3BA 2FPDA 3QDRB 1K9MU 5GAMh 4J6XA 1UGSB 5IT9E 1UDLA 1R8OB 2VWFA 2KI7A 2ZPHB 5FRNA 1WHGA 1W1FA 1NJIR 2V26A 1C0MA 5GAN6 2GFUA 1TSFA 1YCSB 2JS2A 1VQ7T 1N9RA 2JJ9A 4R56A 2FZGB 2RJCA 2H3JA 3AHUA 4LNPA 3LGLA 4PJOD 2F2VA 1RLPC 2HQHA 4RG2A 2NWMA 3ULRB 1MV0B 3M59A 1KHIA 3OS1A 1Y7XA 2DD4A 2KDSA 3C4SA 3CCJT 2HDAA 2QDYB 5D7UA 4C92D 2E5KA 2LCSA 2QG9B 3JCMV 1KD1U 4HT9A 3G1JA 2ZPIB 2QAZA 2SEMA 3QYHB 2RK2A 1T3LA 1D0ZA 2MK5A 4C5HA 2D8JA 1PRMC 2XHCA 2DTHA 3BDUA 4EIKA 4EMHA 3CCMT 4JJCA 4L6V5 1X01A 2FPEA 2Y4YA 1M27C 3RNJA 3EFSA 5CAIA 4RCCA 4M75G 1Y96B 4C5GA 1OOTA 2D1XA 1H92A 5LJ3j 5LJ5h 8ATCB 2V8IA 1AZEA 1JJ2P 1VQMQ 3JB9D 5CCAA 2O9SA 1QP3A 3VKIA 3HKSA 1K9MC 3JCMJ 2J6FA 4FYYB 3E9GA 2K7AA 4M7AG 2KNBB 2SRCA 4OB3B 1YJWQ 1PWTA 3CPWS 1M2VB 4XU3A 4BACA 1HJDA 4AFUC 2CGHA 1W70A 2J06A 5CKFA 2PNIA 2NUTA 1C1AA 4FYWB 2EYYA 2J6KA 5GANe 1Q81U 2QQBA 4HVWA 3N5BB 1YWOA 3QSUA 1ZBXA 4JRKA 1RLQC 1D3BA 2E6ZA 2HMAA 3OYEA 5GAN2 5I21A 3QJ6A 2RH2A 3TSZA 1NE8A 1IHVA 1X6OA 1ZLMA 1DJ7B 1VQMT 4F7UB 3OYKA 3H0HA 4LDYA 2HEQA 1BIBA 4J9BA 2C0IA 1Q86C 3ME9A 1IREB 3EG9A 1SPKA 2F2XA 2CUBA 2CT4A 1IO6A 3O5ZA 5IXBA 5KE2A 2X9HA 3A5ZB 5GAOn 2QXFA 1I5LA 2PUOB 1OZ2A 3EG3A 5A2QE 1YJ9Q 4C8QA 1G3TA 3RIRA 3OW2S 4XAXB 1U8RA 3O8VA 4KRTA 4OB2B 1WNLA 4E2FB 3MP8A 2K2VA 2JZ2A 2KRNA 2X3XD 1HK9A 2HKQB 3QBYA 1ZBJA 2JW4A 3AT1B 2K5FA 4BI4A 5CKHA 1SHGA 2K5IA 3G7ZA 1XJWB 1QVGP 3SFMA 2KBTA 4BDYA 2MWOA 2PU9B 3JCMc 1X27A 2E64A 3V8JA 2FZCB 3JCMe 1WQWA 4QQGA 1FMKA 1KSWA 2MMPA 5CKDA 3M55A 3CCUA 3P8DA 1NLPC 3CC4A 5KYUA 1OPLA 5LJ3h 1UHCA 1NJIC 5GAOm 4QVDA 5GAOq 4PJLA 4PLIA 1KQSP 4MZPA 4M7DB 3SWNA 2IPOB 2KT8A 3RDVA 1YJ9T 1K0XA 1BI2A 3M56A 1X69A 4M7DC 1VQ9T 2G3RA 2R57A 3FRNA 3ZEHA 5KYYA 2FPFA 3VYHB 3CCRA 2PVDB 1PKTA 4M75E 2JTEA 5CO7A 1YI2A 4KULA 2LMJA 1KHCA 4J9CA 2QASA 5I11A 1CKBA 4Z02A 2PVGB 2QA4T 3URGA 1D1CA 1IGUA 4M78B 3V8LA 1I81A 4PKCC 1AVZC 3CCEA 4J5YA 5J39A 2MAMA 4PK4A 4FW1A 4X9DA 3I5SA 5FW9A 1WGSA 3TCJA 4M78C 2AT1B 4UC4A 2EW3A 2VKNA 2DD5A 3HRSA 3S3OA 3A1PA 4M77G 3CBOA 2DXUA 3REAB 1KG1A 2GFAA 3EG0A 4M77B 3VS5A 3TQ7P 3FIFA 2LJ1A 1MMGA 2JNGA 2FZKB 2KR3A 2E41A 4EMKC 4F14A 3GNGA 4P5NA 1IRXA 4ZN3A 3M0PA 1PNJA 4FSXA 2VGMA 5GAMd 3CEYA 1MMDA 3LGFA 5GMKm 3L2ZA 3RMQA 2FHDA 4PJOC 3IQLA 1KJWA 4F7UE 4C0GA 3C12A 1BBZA 1KQ2A 2MOXA 4J9DA 2FEIA 2A3LA 1UG1A 2JS0A 3FB9A 3ZFJA 2DMOA 3I9QA 3M0TA 1GBRA 3X20B 3LWIA 3BDLA 2CT3A 2EWNA 1OU9A 1VQOA 2OTLA 3EGXB 1OPKA 2COZA 1WX6A 3MEAA 3PGGA 5CR2A 1RL2A 2DYIA 2YHTA 5I22A 3DKMA 2ATCB 5DY9A 3OYLA 3CBPA 4J9FA 3DLLA 4C8QF 2LP5A 1JO8A 2L3PA 1O75A 1Z9ZA 1VQ4A 3OA6A 2DL8A 2ZGWA 2NUPA 4IIOA 4TVRA 1YBYA 3L2QA 3H41A 5D6YA 1ABQA 2KY9A 5DLOA 1BI3A 2LVMA 1WIEA 4M7AD 3REBB 2D6FA 3UA7A 1V1CA 3ZBDA 4AFSC 4WTOB 2X51A 3E9FA 2DPPB 4J9GA 4RMOA 1UTIA 4GLKA 3UWNA 1FX7A 1OU8A 5LL6S 1BI1A 3HHTB 4LDUA 1RABB 4FIBA 1UJ0A 4OVAA 2HD0A 4Y91A 5FROA 5LJ5d 5KE3A 2VGNA 3CXCP 3OYIA 2XIDA 4XQ3A 4PJOF 4WF2A 2EPDA 2KT1A 2RF0A 3CCUQ 1W2BP 5CIUA 3ZL7C 3CC4Q 2GCXA 4NL2A 2K79A 1VQPQ 2DLPA 2DVEA 1Q95G 2XDBA 1NEBA 4C92F 1NBEB 3HTRA 5HCKA 1WXUA 2E3HA 4C5IA 2JT4A 2HBPA 5KYXA 1BCOA 3M5AA 2JVVA 4ZTJA 4QVZA 4M4ZA 1KQSA 3EFRA 1NEGA 4LN2A 2EIFA 2HQXA 2DFUA 1QMCA 3NTHA 3OYGA 1M3CA 1YJWA 1VQKA 3CCRQ 3CCSQ 3OYJA 2D9TA 3A8GB 3GBQA 1YI2Q 4M78E 9ATCB 1ZUUA 2A28A 4J83A 2DBKA 1PG5B 2A36A 4KGVB 1P92A 1K8AR 2V1QA 1VQ6Q 3JB9F 2RMOA 1HYOA 1QCNA 3RERA 2DILA 2DXTA 3RUXA 1M2OA 3CCEQ 5GAN5 3MP6A 4GY5A 3CCUT 2KSSA 1AWJA 1R77A 3PVQA 1T3SA 4M77E 3CC4T 2EQJA 1U1SA 1Q7YR 2GBQA 2RM4A 5GMKe 3FDRA 1JRIA 1UEBA 2BE9B 3JCMP 4Z89A 2DIQA 1VQ5A 1B34A 5A0GA 5GANj 1JJ2S 1QWEA 1NZ9A 1GCQC 2KVQG 1QP2A 3GNFB 3G6EQ 3UT1A 2MWPA 4BUGA 1J3TA 1OEBA 2OJ2A 3LX7A 2XK0A 3X24B 2VASA 4JPBW 3I55A 3GLXA 4DEYA 4OF1A 5CVIA 4A4GA 2DO3A 3V7SA 1G3YA 3FJPA 4JZ3A 4E7JA 3PFSA 4JRIA 5DM7R 1M8MA 4C8QD 2YXYA 4OGEA 5IXFA 1OQKA 2KEAA 1S72A 3GIBA 4OMFB 4IUQA 3G71A 1KK7A 4KH0B 1CKAA 1GFDA 2BZYA 4XTVA 1M4ZA 1TUCA 1VQOQ 1AT1B 4OB1B 2OTLQ 2XI9A 3RKXA 2RN8A 1XQHA 1UGQB 4M75A 1VYVA 5LJ3d 2A37A 2AKKA 2P4RA 1K76A 2EYQA 3LLRA 3CC7A 2HCKA 1WJSA 3Q1JA 1GCPA 3M0UA 3WVEB 1VQ4Q 5EG2A 4N4GA 1M2VA 2EQMA 3PE0A 4M7AA 3G4ST 3HP9A 2L89A 5GAMe 2ZPBB 2YUOA 1PHTA 2CH4A 3VS4A 5GAN3 1GRIA 2C0TA 2HZYA 2V1RA 4WCIA 3JCMf 2WSCE 1M3AA 4N0AA 4R0KA 1LCKA 4J7IA 3PMTA 2A08A 4JS4A 1VQ8A 1ZSZA 2OTLT 2LCCA 1RAGB 1Q86U 1VQNA 2M1HA 1I0CA 1QVGS 3CXCA 1SKUB 1PD1A 2IIMA 3X28B 1M90R 4LD9K 1EFNA 1W2BA 1K73R 3H9NA 4LUEA 2CP7A 2O4XB 3CBMA 4J9EA 3CMAA 2HQEA 1M1FA 3R6NA 2DRKA 2ZPEB 2K6DA 5FU7B 1ZUYA 2QTVA 1Y0MA 1D0XA 5FWBA 2QK0A 2BUDA 3RKWA 1YHQA 4ORZA 4A53A 2DIGA 4AMCA 1VQKQ 4FU6A 1WLPB 4NOYA 5FU7C 5LJ3f 2D0QB 2CREA 1PCXA 1IB8A 2PTKA 4BI8B 4ESRA 2P0QA 3VRZA 3LH5A 3PTAA 4DOVA 4X34A 3QHSA 3TREA 3VU3C 5CKBA 2RPNA 1NJIU 2CP0A 2DL3A 2RJDA 1V29B 3JCMX 2E1HA 4EMGA 1OZ3A 1K8AC 1EX4A 3KXTA 2X35A 4F7UG 4J7FA 3TEEA 2VXFA 2X4WA 1VQ5Q 1T0JA 2LNVA 1WHJA 4Y92A 5L23A 3E1SA 1RAFB 3CCQA 2XMFA 2HBWA 3CD6A 1Q7YC 1Y71A 2EFIA 1O9SA 4HT8A 3CMEA 2X3WD 1YJWT 2WSFE 3I55Q 2EJ9A 4A4EA 1YCYA 4IKFA 2ED0A 1VQKT 4A4KA 1ZUKA 3TVTA 3JSCA 1QVPA 3EG2A 5GAOl 2LRQA 3HFNA 4FT2A 1BK2A 1S72Q 4O5VA 4BB7A 1LOJA 4AG1C 3G71Q 2QEXA 1QVFA 5A0DA 2M9UA 4B9WA 2X4JA 2RB6A 4RTWA 2XDDA 2IG0A 4ELYC 4II1A 1QQJA 1YNZA 5L8RE 4KUIA 1HD3A 1GL5A 2VVKA 4DBFA 2DA9A 4M75F 2RHIA 4C0FA 1M90U 4B6MA 1YITQ 1K73U 5FWCA 3HRTA 4BI3A 2BZXA 3UPUA 3MPUB 2NLUA 3CC7Q 1LPLA 1VQ5T 2OAWA 2L3SA 3EGDB 5KCOA 1UB4A 1UECA 2JM9A 1R0BG 1X43A 2JMAA 4ME7A 3EFOA 1QCFA 1SF9A 5GANg 1KFZA 3KFVA 1YIJA 3MEVA 4M7AF 3MP1A 1WDXA 2KRSA 2ZPFB 1D3BB 2YDLA 3JAME 3BE3A 5GAN7 4M7DG 4M77A 1SRLA 4HCKA 3I55T 1VQPA 2QDLA 1D1AA 2F5TX 3I35A 1FYNA 3CCVA 4VUBA 2DYBA 1WJQA 3I56A 3DB3A 1WHMA 2CP3A 2VC8A 1S72T 2RQTA 5FU6B 3G71T 2LDMA 2LJ3A 3OYFA 2BTTA 2DE0X 5CQXA 1M1KR 1NM7A 1T0HA 3EG9B 1VQ8Q 4OMNA 3CCSA 3PIOA 7AT1B 3L2WA 2AZSA 2F2WA 2CDTA 5LJ3e 5FU6C 1VQNQ 1AZGB 4X1VA 1I1JA 2KQWA 1KQ1A 4C8QB 1WQ7A 3L2UA 1UGPB 4M78G 1UFFA 1I8FA 1VQ6A 4PFOA 3CC7T 2X4YA 4PJMA 5GMKl 1QKXA 4ANJA 2RNAA 1IZ6A 3J80E 4DQ2A 1TU0B 4XTXA 2KGTA 1N6AA 4C8QC 3CMAQ 3R6OA 2OTJA 3CXCS 2ROLA 3C94A 1JXOA 1AHJB 3QXEB 4PFZA 1TUDA 2DERA 2AK5A 4PL6A 3X25B 3RESA 1IXDA 1W2BS 2YRCA 1A0NB 2ZZDA 2E65A 3OQ5A 4F04B 2FL7A 1YP5A 2JM8A 3SD4A 1YHQQ 1M90C 1K73C 3META 1E6GA 5IAYA 1H8KA 1VYTA 4J9HA 4EMKB 3OYCA 4KUDK 1LVKA 4PFPA 4PJOG 3G6EA 1U3OA 2EQKA 3QIIA 3V7RA 3JCMg 1JXMA 1TWBA 4PJOB 2COYA 1AOJA 2K3XA 2RHXA 4JZ4A 3MCAB 5KYWA 3NTIA 5KYUB 4XTWA 4QQDA 1X2QA 2BIVA 1VQ8T 4RTXA 1VQ7A 3V7CA 2ESWA 3H0FA 5GMKj 3EHQA 2RK1A 2W10A 4C92B 2E5QA 3NTKA 4LXCA 1WXBA 2J05A 1VIEA 1QCOA 3FLGA 3NHNA 2EAYA 2RQUA 2Y90A 4C92C 1H3ZA 2K3YA 3H0IA 2PVOB 2RI2A 2CP2A 3JCMQ 5KYYB 3CCQQ 2KK4A 3OBWA 4AFZC 4CC2A 3CD6Q 2XKOC 2DL5A 1KIKA 2EGEA 3CMEQ 1EZZB 2GTJA 1U06A 4M75D 1YHQT 2RHZA 2K57A 3J7AF 1MUZA 4BY6B 2L3RA 3CCMA 5IHNA 5IHKA 2RHUA 5C6SA 2ZPGB 2DL7A 3HSBA 3NPFA 2CZ1B 1G5VA 3VJPA 2BKDN 1M1KU 4BY6C 5GAN4 2QEXQ 1D0YA 2M16A 2YWWA 3PVLA 1NYFA 1W6XA 3CC2A 4DOWA 2VB6A 2A0FB 3H8ZA 1YFNA 5KH6A 1YWPA 1K1ZA 2COWA 1SSHA 1VQLA 3JRZA 1ZQ1A 3GF5A 3NGPA 5HY6A 3VS6A 5GMKi 1C6VX 1M30A 1RACB 3OBYA 1BYMA 1ACMB 2RI5A 2IVWA 4XTZA 5IHIA 1AWXA 1BB9A 4J6WA 1K0SA 4O6JA 2E10A 1ZSGA 2ECZA 2C06A 4N4HA 3CCQT 4OMLA 4M7DE 4D6WA 3CQTA 2OAUA 1YIJQ 2FYKA 3WXMB 2GGRA 2K4YA 1VA7A 5GAMf 1BCMA 2E12A 5GAOr 4MDXA 5GANd 5AYFA 2YLBA 5GAOp 1RAIB 1RUWA 1VYUA 4F17A 3M0RA 2DL4A 3CCVQ 2DZCA 2LT4A 6AT1B 1Q82R 3QZ5B 3I56Q 4D8DA 1G83A 2EBPA 1W4SA 3S6WA 2OI3A 4Z8AA 4C8QE 1WPYA 4LE9A 3QJYA 2XICA 4NS5A 3CPWA 3HFOA 1RI9A 1UE9A 1HSQA 1MGQA 4RG8A 5ECAA 3QPHA 4HXJA 2QQAA 1JEGA 2NYSA 1N5ZA 1X6BA 3RKYA 4A4FA 5D6XA 3VUZA 3OYNA 1M3BA 5GMKh 4HCBA 2HSEB 3M54A 4BD3A 1M1KC 2RJFA 2R58A 3H6ZA 1PRLC 4E7HA 5EC7A 4PJJA 2XD0A 4DBHA 1AD5A 2KE9A 2OTJQ 2KRMA 2MCNA 4KGXB 2MI6A 2QYZA 2CS7A 1KD1R 5D6WA 2RQRA 1VQPT 2QI2A 4FYVB 5GJVB
chains in the Genus database with same CATH topology
4IURA 2R5MA 4LD9K 4BE2A 1M5Q1 1WQWA 1W2BA 4QQGA 1H641 2QQSA 3JB9G 2O4XB 4PJOE 4FL6A 2DXBA 3CBMA 3CCVT 3A8HB 4MZMA 5LJ3g 2MMPA 3CCLA 2K5LA 3M55A 4OP0A 5CKDA 5KCHA 3CMAA 3CCUA 2HQEA 3TU4K 1M1FA 3LYIA 3P8DA 4BE1A 2ZPEB 5CK9A 3CC4A 5FU7B 5LJ5f 2QTXA 2DXCA 4C92E 5LJ3h 3V8KA 1NJIC 5GAOm 3QZ9B 2BUDA 4XU2A 4KBMB 3RKWA 4QVDA 2YRVA 5GAOq 2LTOA 1YHQA 2P4TA 1N8RC 4PLIA 4A53A 5I2SA 2DIGA 4MZPA 4M7DB 4J8OA 4QVCA 3SWNA 4FU6A 4JUVA 3CCRT 3CCST 5CKEA 4NOYA 4HCCA 5FU7C 1YJ9T 3KBGA 5LJ3f 1YI2T 2D0QB 1N9SA 2M0OA 4ATOA 3MO8A 2KAFA 4IUVA 4BI8B 2A7YA 4MZTA 2P0QA 4L5GA 1HXDA 4M78F 3L1AA 1QVFS 1BI2A 3M56A 1NPRA 4E47A 3OW2A 3M53A 3OS0A 3PTAA 4M7DC 1VQ6T 4BE0A 3VV0A 3JCMW 4DOVA 2G3RA 5I2MA 4JS5A 1VQ9T 2CZ6B 4QW2A 2R57A 4X34A 3QHSA 3FRNA 3ZEHA 3TREA 1LJOA 3BFMA 3VU3C 3VYHB 3CCET 3CCRA 2PVDB 2F5KA 4M75E 5CKBA 5CO7A 3F70A 1VIFA 2OTJT 1YI2A 3LH0A 3KUFA 4KULA 1KHCA 4Q5WA 1NJIU 2V8KA 3CD6T 1M8VA 4EPCA 2EQUA 5GAMj 2RJDA 2GF7A 3OMCA 1Y96A 4Z02A 1YITA 1V29B 2PVGB 2HNIA 3JCMX 2E1HA 2ZCFB 3CMET 4M77F 4LD6A 4EMGA 1OZ3A 2O4XA 3P8BB 2QA4T 1K8AC 4NL3A 4L59A 3URGA 3KXTA 2DAQA 1VQLT 2X35A 3DB4A 4M78D 1OYXA 3OMGA 4F7UG 1QVGA 1KC8U 2V8JA 4J7FA 2VXFA 2X4WA 4M78B 3TEEA 3V8LA 1I81A 4PKCC 2LNVA 1BKBA 4FT4A 4HA8A 3CCEA 3E1SA 4J5YA 5J39A 4V2SA 2MAMA 3CCQA 3DLMA 3G6ET 1Q82U 2EJGA 4J6YA 3OYMA 3CD6A 4X9DA 2HAXA 4RCBA 1Y71A 3A8MB 1WGSA 1Q7YC 2E6NA 2EFIA 1O9SA 4M78C 3TCJA 4HT8A 4UC4A 3CMEA 3ASKA 4LDXA 2DD5A 2QEXT 2QA4A 3HRSA 1JB0E 2WSFE 3S3OA 1YJWT 3BW1A 2RD1A 4M77G 2EJ9A 4A4EA 3CBOA 3VYGA 1YCYA 3L2RA 2P0KA 2DXUA 4IKFA 1VQKT 4A4KA 1GXIE 4M77D 1KG1A 3PT9A 2GFAA 4M77B 4E7IA 1SSFA 4C0DB 2Y4XA 1VQMA 1X75C 3JSCA 4JRPA 3FIFA 4LDWA 1YJNT 1QVPA 3OSVA 5M9OA 4B9XA 2CYZB 1K8AU 3OS5A 5GAOl 2JNGA 3M57A 2LRQA 1B34B 3HFNA 3T9NA 2JTMA 4FT2A 3A8LB 4O5VA 4BB7A 1LOJA 4OB0B 4N4IA 2CZ7B 2VXEA 2E41A 3EAEA 4C0DC 4EMKC 5A0DA 2QEXA 1QVFA 2M9UA 4B9WA 3GNGA 4P5NA 2X4JA 2RB6A 4ZN3A 2XDDA 4ELZC 2IG0A 4ELYC 2QQ9A 4II1A 1EIFA 4FSXA 2VGMA 5GAMd 1M1GA 1XOVA 3CEYA 1VQOT 1Q7YU 3LGFA 5GMKm 2I2LA 5L8RE 4KUIA 3L2ZA 3RMQA 2FHDA 4PJOC 4MMKA 4M75F 1YIJT 2RHIA 4C0FA 4F7UE 1M90U 2R5AA 4XK8E 3C12A 4C0GA 1K73U 2GQVA 1RI0A 3HRTA 1G3SA 4BI3A 1KQ2A 2CKKA 4F7UA 2A3LA 3UPUA 2NLUA 1VQ5T 3FB9A 2DKGA 3M4YA 3ZFJA 3JB9H 5KCOA 1UB4A 1QW1A 2DTOA 3X20B 3BDLA 3LWIA 3QO3A 2EWNA 1VQ4T 1I4K1 2RJEA 5GAN8 4ME7A 2WSEE 4QQ6A 2EKOA 1VQOA 2OTLA 3HL8A 3OYDA 3I56T 5LJ5j 4XTYA 3RMSA 1BIAA 5GANg 2L8DA 1YIJA 1U1TA 3MEVA 3MP1A 4M7AF 3MEAA 2ZPFB 3PGGA 1D3BB 4IUTA 3JAME 1JBMA 5GAN7 5CR2A 4M7DG 1WJRA 4M77A 3I55T 1RL2A 2YHTA 3P8HA 3GP8A 4M75B 1VQPA 3CC2T 4ZGDB 5GANh 4M7DD 2E70A 3DKMA 5A0LA 1Y07A 3OB9A 5DY9A 3UDCA 1TH7A 1NPPA 3CBPA 3OYLA 3DLLA 4DA4A 3JCMd 2F5TX 2F69A 2DZ9A 2CZ0B 3LW5E 3CCVA 4IUPA 3SB2A 4C8QF 1KQSS 1O75A 4VUBA 1Q82C 1KC8C 4PLLA 3OA6A 4KT0E 1VQ4A 1WJQA 3OYAA 2ZGWA 3I56A 4Y28E 3DB3A 2KMTA 3QKJA 3PMIA 1PSEA 3HRUA 1YBYA 4TVRA 5GANf 4M75C 2LT1A 3L2QA 2VC8A 1S72T 2JOYA 5D6YA 4CI0C 2KY9A 4FM4B 5DLOA 5FU6B 5LJ5e 3L42A 1BI3A 2AHJB 2LDMA 2LVMA 3G71T 2B8AA 3OYFA 2VUBA 4M7AD 5CQXA 4M7AB 2RO0A 3FC3A 2D6FA 3M58A 4EDUA 3ZBDA 3CCSA 3PIOA 3OS2A 3L2WA 3E9FA 2RA2A 2DPPB 3MHXA 4RMOA 1YJ9A 3X26B 5FLXE 2O01E 5LJ3e 5FU6C 3QG1A 1G3WA 4ZGEB 4GLKA 3OYBA 2KQWA 3UWNA 1KQ1A 2X4XA 4C8QB 1FX7A 1FWZA 2YLCA 4M7AC 3NFCA 5LL6S 2PQWA 1WQ7A 1BI1A 5DLQE 5GAMg 3L2UA 1UGPB 3HHTB 4LDUA 4M78G 4R55A 1I8FA 1VQ6A 1VQ9A 1FXXA 3CC7T 4ZN1A 4FIBA 4IUUA 2X4YA 2HD0A 2XG8D 4OVAA 4YTLA 4Y91A 5FROA 5KE3A 5GMKl 5LJ5d 2XDPA 2DEQA 2VGNA 4JDSA 1IZ6A 5HK0A 3J80E 3QDRB 4DQ2A 4E7KA 1K9MU 4XTXA 5GAMh 1N6AA 4J6XA 3OYIA 2XIDA 4XQ3A 4PJOF 1UGSB 4WF2A 4C8QC 3R6OA 1OI1A 3CXCS 5IT9E 3C94A 1R8OB 2OTJA 3QXEB 1AHJB 5CIUA 2ZPHB 5FRNA 2GCXA 4HKEA 4PL6A 3X25B 4NL2A 3RESA 2JN0A 1W2BS 2ZZDA 2E65A 3HPWA 4N0AC 2JTFA 3OQ5A 5GAN6 1KD1C 4M7DA 2FL7A 2GFUA 2DVEA 4JJNK 3SD4A 1M90C 2XDBA 4C92F 1K73C 3META 5IAYA 2XU8A 1VQ7T 4LDVA 1N9RA 4EMKB 4C5IA 3JCMe 4XU0A 3OYCA 2HBPA 3OY9A 4KUDK 4R56A 3QUIA 3M5AA 2JVVA 2RJCA 4ZTJA 4QVZA 2H3JA 4PJOG 3EFRA 3G6EA 1KQSA 3AHUA 3LGLA 5FRMA 2EQKA 3QIIA 3V7RA 2EIFA 3JCMg 4PJOD 2HQXA 4PJOB 2K3XA 2RHXA 3NTHA 4RG2A 5HKCA 3MCAB 4HCZA 3OYGA 3NTIA 1YJWA 4XTWA 4X9CA 4QQDA 3M59A 1KHIA 2BIVA 3OS1A 1Y7XA 2DD4A 2KDSA 3C4SA 3CCJT 1VQ8T 3JCMh 1VQKA 1VQ7A 3V7CA 2FVUA 3OYJA 2D9TA 2QDYB 3A8GB 2L5QA 2FB7A 4C92D 3MEUA 5GMKj 2RK1A 4M78E 3OYHA 4C92B 3JCMV 1YJNA 1KD1U 2E5QA 4HT9A 3NTKA 4J83A 2ZPIB 3QYHB 4PNOA 1VIEA 1P92A 3LWHA 2RK2A 4M78A 5J3BA 3FLGA 4C5HA 2DK3A 4BDZA 3JB9F 2EAYA 2XHCA 2DTHA 3BDUA 2Y90A 4C92C 3RERA 4EMHA 1H3ZA 2K3YA 2DXTA 2PVOB 3RUXA 3CCLT 5GAN5 2RI2A 3CCMT 3MP6A 4GY5A 3CCUT 3JCMQ 2KSSA 2RI3A 4L6V5 2KK4A 3OBWA 1X01A 4M77E 3CC4T 2Y4YA 2EQJA 3EFSA 1U1SA 2XKOC 3MEWA 5LJ5g 2RM4A 5CAIA 2P0PA 3FDRA 4RCCA 1JRIA 5GMKe 4A54A 4M75G 1UEBA 1M9SA 1UGRB 2LCLA 4M75D 3JCMP 3BY7A 2RHZA 1Y96B 1YHQT 4EMKA 3M9QA 4C5GA 2DIQA 2K57A 1Q81C 4C5EA 1VQ5A 2DJZA 5LJ3j 5LJ5h 4BY6B 4MMLA 3JB9J 3J7AF 2V8IA 3JB9D 2L3RA 4RKUE 5CCAA 1B34A 3SDZA 5A0GA 3CCMA 5GANj 4PJOA 2RHUA 1JJ2S 5C6SA 2ZPGB 2KVQG 1NZ9A 1QP3A 1XTDA 1QP2A 2DTIA 3GNFB 3HKSA 3OYYA 3UT1A 3VKIA 4JRQA 3JCMJ 2MWPA 1K9MC 3HSBA 3A8OB 4BUGA 2CZ1B 3E9GA 1G5VA 4XTUA 4XU1A 3C95A 3LX7A 3QYGB 2LQKA 2BKDN 2LQ8A 2XK0A 3VJPA 3X24B 4BY6C 1M1KU 4M7AG 5GAN4 4OB3B 2M16A 2MF2A 3CPWS 3CC2A 3I55A 4DOWA 4XU3A 3GLXA 4BACA 3H8ZA 5KH6A 4OF1A 5CVIA 4A4GA 2CGHA 4C92A 2DO3A 5CKFA 3V7SA 1VQLA 1G3YA 2LC4A 3JRZA 3FJPA 1ZQ1A 3FEOA 3GF5A 3J81E 3S3MA 3WVDB 2EJFA 5HY6A 4E7JA 5GMKi 3PFSA 4C8QG 3GPLA 5C0MA 3CPFA 4JRIA 3GOXA 5DM7R 4C8QD 1YITT 4OGEA 5GANe 3OSSC 3OBYA 4CRIA 1Q81U 5IN1A 1S72A 3GIBA 4OMFB 1BYMA 5CQYA 2VV5A 2QQBA 2RI5A 4F7UF 2IVWA 4IUQA 4XTZA 3G71A 3N5BB 4J6WA 4O6JA 2E10A 4ZGJB 4XTVA 1M4ZA 4JLGA 3QSUA 2C06A 1ZBXA 4N4HA 4OB1B 4JRKA 3CCQT 1N27A 1D3BA 4M7DE 2XI9A 3RKXA 4D6WA 3M4GA 5HK3A 2OAUA 2E6ZA 3S3NA 1XQHA 1UGQB 3OYEA 4M75A 2FYKA 5GAN2 1N8RU 1BI0A 5LJ3d 3WXMB 5I21A 2K4YA 5GAMf 2E12A 3QJ6A 2QQRA 2RH2A 5GAOr 4MDXA 5GANd 5AYFA 2EYQA 1LNXA 1NE8A 3LLRA 3CC7A 1WJSA 2YLBA 5GAOp 3Q1JA 1X6OA 3E19A 1DJ7B 1VQMT 2DZCA 2LT4A 4F7UB 3OYKA 4LDYA 3WVEB 2VYTA 4M7AE 1BIBA 3QZ5B 4E7LA 5EG2A 3VUBA 2RHYA 4N4GA 3JB9I 2JUFA 2EQMA 1JJ2A 4M7AA 3G4ST 1Q86C 1W4SA 3HP9A 3ME9A 3S6WA 1IREB 2L89A 5GAMe 4C8QE 1WPYA 2ZPBB 5KE2A 4A4HA 3A5ZB 3QJYA 4C92G 2XICA 2QXFA 5GAOn 4NS5A 3CPWA 1I5LA 2PUOB 1XNIA 1OZ2A 3HFOA 5A2QE 4C8QA 1G3TA 3RIRA 3OW2S 4ZTFA 1MGQA 4XAXB 3SWNB 5GAN3 1VQNT 2WACA 1U8RA 4RG8A 3O8VA 3INZA 3QPHA 1WNLA 4OB2B 2QQAA 3RKYA 3MP8A 3JCMf 2K2VA 2WSCE 4A4FA 3PIPA 2LX9A 3G4SA 4N0AA 5D6XA 4M77C 2JZ2A 2PUKB 3VUZA 3OYNA 4JLIA 4J7IA 5GMKh 4HCBA 1HK9A 3QBYA 3PMTA 3M54A 4BD3A 1M1KC 2RJFA 2R58A 3H6ZA 3SWNC 4JS4A 5J26A 3JCMb 4E7HA 3CCJA 1VQ8A 4MDWA 2XD0A 2OTLT 3CMAT 2K5FA 4BI4A 2LCCA 2K5IA 3G7ZA 5CKHA 3PNWC 1Q86U 1PSFA 1VUBA 1VQNA 3SFMA 4OGCA 4C0ZA 3L2VA 1ZHIA 2M1HA 4BDYA 2MWOA 2MI6A 2PU9B 3JCMc 4M7DF 1QVGS 3CXCA 2CS7A 2E64A 5D6WA 3ER0A 3V8JA 3X28B 1VQPT 2QI2A 1MHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G3S A;  2LX9 A;  4O5V A;  1G3Y A;  3MHX A;  2GCX A;  1G3W A;  1BI0 A;  1QW1 A;  3HRS A;  2K5L A;  2K4Y A;  1FX7 A;  1FWZ A;  2QQ9 A;  1BI1 A;  3HRU A;  1BI2 A;  1BYM A;  2K5F A;  2QQB A;  2K5I A;  3E19 A;  1BI3 A;  1G3T A;  1QVP A;  4O6J A;  1U8R A;  3GLX A;  2H3J A;  2QQA A;  1P92 A;  5CVI A;  3HRT A; 
#chains in the Genus database with same CATH topology
 4IUR A;  2R5M A;  1M5Q 1;  2D0N A;  4PJO E;  2DXB A;  4DBR A;  3CCV T;  3A8H B;  3CCL A;  4OP0 A;  1TS9 A;  2J6O A;  3LYI A;  4BE1 A;  5CK9 A;  2HL5 C;  5LJ5 f;  2RQV A;  2DXC A;  4C92 E;  3V8K A;  3QZ9 B;  4KBM B;  2LTO A;  3CCR T;  1TOV A;  5CKE A;  3CCS T;  1VQ7 Q;  4HCC A;  3TSW A;  3KBG A;  1YI2 T;  1QVF P;  3MO8 A;  2GTO A;  4IUV A;  1ARK A;  1UUE A;  3M0S A;  5KYX B;  3L1A A;  1OV3 A;  1NPR A;  3OW2 A;  1VQ6 T;  3VV0 A;  2KYB A;  2ROT A;  2EVR A;  1LJO A;  3BFM A;  2JXB A;  3CCE T;  2F5K A;  4IIM A;  3F70 A;  2L3Q A;  1VIF A;  3M0Q A;  2OTJ T;  4FW2 A;  4Q5W A;  2V8K A;  4EPC A;  2GF7 A;  3OMC A;  1Y96 A;  1I07 A;  4F16 A;  1MMA A;  1YIT A;  2HNI A;  2CP6 A;  2O4X A;  1AWO A;  4NL3 A;  1E6H A;  2DAQ A;  3DB4 A;  4M78 D;  1Q81 R;  1TXQ A;  4FT4 A;  3CCM Q;  2FG0 A;  2DJQ A;  2CSI A;  4LUD A;  3DLM A;  3G6E T;  4FYX B;  2BE7 D;  1FMV A;  2HAX A;  4RCB A;  3A8M B;  1AWW A;  2E6N A;  3EG1 A;  2QA4 A;  3BW1 A;  3CC2 Q;  2RD1 A;  3VS7 A;  3L2R A;  2MIO A;  3VYG A;  1GXI E;  2FRW A;  4M77 D;  3PT9 A;  1VQL Q;  2EYZ A;  4E7I A;  2DBM A;  4C0D B;  2LNH B;  1X75 C;  1MV3 A;  4LDW A;  3OSV A;  3UAT A;  4B9X A;  2CYZ B;  1K8A U;  1PM3 A;  3OS5 A;  1B34 B;  1RAH B;  3T9N A;  2B86 A;  1SRM A;  4OB0 B;  2CZ7 B;  2VXE A;  4C0D C;  2LZ6 B;  4A63 B;  4ELZ C;  2LJ0 A;  2QQ9 A;  1XOV A;  1VQO T;  1Q7Y U;  2I2L A;  2DVJ A;  2KXD A;  2D8H A;  4RTT A;  4E6R A;  2AZV A;  2L2P A;  4XK8 E;  3NMZ C;  2YSQ A;  1G3S A;  2H3E B;  4F7U A;  1TUG B;  2DRM A;  3M4Y A;  3JB9 H;  2FO0 A;  1QW1 A;  2DTO A;  1VQ4 T;  5GAN 8;  2RJE A;  1TG0 A;  4QQ6 A;  2EKO A;  4XTY A;  3RMS A;  1BIA A;  4RTU A;  4IUT A;  1JBM A;  3CC2 T;  3GP8 A;  4M75 B;  4ZGD B;  5GAN h;  2E70 A;  2E3I A;  4KH1 B;  1Y07 A;  5A0L A;  1TH7 A;  1NPP A;  1VQL T;  2P84 A;  1B3Q A;  1RAD B;  2F69 A;  2DZ9 A;  3LW5 E;  4E7S A;  3THK A;  3SB2 A;  1KQS S;  1Q82 C;  2H8H A;  3OYA A;  1B7T A;  3QKJ A;  3HRU A;  4M75 C;  1NG2 A;  3VRY A;  4CI0 C;  5LJ5 e;  3L42 A;  3VS3 A;  3I5R A;  4M7A B;  2RO0 A;  3FC3 A;  1NYG A;  1WFW A;  4RTY A;  4EDU A;  2YUP A;  3FJ5 A;  4RUG A;  2O01 E;  1ZX6 A;  3QG1 A;  1G3W A;  1RAE B;  4KGZ B;  4QKU A;  2YLC A;  4CC4 B;  3NFC A;  5GAM g;  4M7A C;  5DLQ E;  4R55 A;  3EGD A;  1UJY A;  1FXX A;  4ZN1 A;  4YTL A;  4JDS A;  4E7K A;  4QT7 A;  3CCL Q;  1MND A;  4OMO A;  1OI1 A;  1ZSZ B;  4HKE A;  2JN0 A;  3HPW A;  4N0A C;  1KD1 C;  2JTF A;  4M7D A;  4K11 A;  1PC0 A;  4JJN K;  1N8R R;  2XU8 A;  4LDV A;  1ZSZ C;  4XU0 A;  4AT1 B;  1H3H A;  3OY9 A;  3QUI A;  1FMW A;  1K9A A;  5FRM A;  5HKC A;  4HCZ A;  2O88 A;  2C0O A;  4X9C A;  5IH2 A;  3JCM h;  2FVU A;  2L5Q A;  2FB7 A;  1MNE A;  3MEU A;  4AFQ C;  3OYH A;  1YJN A;  2NUT B;  2RQW A;  4PNO A;  3LWH A;  3MJX A;  4M78 A;  5J3B A;  3SEM A;  2DK3 A;  1UHF A;  1VQ9 Q;  4BDZ A;  2F1L A;  3CCL T;  1SG5 A;  2LX7 A;  2RI3 A;  1E7O A;  3EHR A;  4PJN A;  3MEW A;  5LJ5 g;  1WHK A;  2P0P A;  4A54 A;  2W0Z A;  1GFC A;  1M9S A;  4DBQ A;  2QA4 Q;  1UGR B;  1YN8 A;  1WYX A;  2LCL A;  3BY7 A;  4JJB A;  4EMK A;  3M9Q A;  1Q81 C;  4C5E A;  2Z0W A;  2DJZ A;  3JB9 J;  4MML A;  2FRY A;  4RKU E;  3SDZ A;  1NLO C;  8AT1 B;  1CSK A;  4PJO A;  1XTD A;  2DTI A;  3OYY A;  4JRQ A;  1QLY A;  2KXC A;  3A8O B;  1SEM A;  4XTU A;  3CPW P;  4XU1 A;  3C95 A;  3QYG B;  4ZNX A;  2LQK A;  2LQ8 A;  2MF2 A;  2KYM A;  4C92 A;  2LC4 A;  2EYW A;  3FEO A;  3J81 E;  1V76 A;  3WVD B;  2EJF A;  3S3M A;  4C8Q G;  3GPL A;  5C0M A;  3CPF A;  3GOX A;  1YIT T;  2O9V A;  2MYS A;  3OSS C;  4CRI A;  5IN1 A;  2CUD A;  5CQY A;  2VV5 A;  4F7U F;  2GNC A;  4ZGJ B;  3EGX A;  4JLG A;  1S1N A;  1N27 A;  4OMM A;  2K9G A;  3M4G A;  5HK3 A;  3S3N A;  2EGC A;  1N8R U;  1BI0 A;  2CH4 W;  4GLM A;  2QQR A;  3JV3 A;  4J9I A;  1LNX A;  1AEY A;  3E19 A;  1WXT A;  2BZ8 A;  1KC8 R;  2VYT A;  4M7A E;  3RBB B;  4E7L A;  4RTV A;  3VUB A;  2RHY A;  2HL3 A;  3JB9 I;  4FCY A;  2JUF A;  3EFO B;  1JJ2 A;  1WI7 A;  3MKD A;  2MPX C;  4CC7 A;  2G6F X;  3E2U A;  4A4H A;  1PKS A;  4C92 G;  3OW2 P;  1XNI A;  4ZTF A;  3SWN B;  1TTH B;  1ABO A;  1I5O B;  1VQN T;  2WAC A;  1UGV A;  2AIR B;  3VS1 A;  3INZ A;  2DET A;  2DX1 A;  5AT1 B;  3PIP A;  2LX9 A;  3G4S A;  1F1B B;  4M77 C;  2PUK B;  4JLI A;  1OX8 A;  3SWN C;  2DM1 A;  5J26 A;  3JCM b;  3CCJ A;  4MDW A;  2YUN A;  3CMA T;  2CSQ A;  3PNW C;  1PSF A;  1VUB A;  3L2V A;  1OUL A;  4OGC A;  4C0Z A;  1ZHI A;  4M7D F;  2ENM A;  3ER0 A;  3EH1 A;  1MHN A;  4BE2 A;  2DEU A;  1H64 1;  2QQS A;  3JB9 G;  4FL6 A;  1IHW A;  3QWY A;  4MZM A;  2J7I A;  2O2O A;  5LJ3 g;  2K5L A;  5KCH A;  3TU4 K;  1PD0 A;  1JU5 C;  1B07 A;  2QTX A;  4XU2 A;  2YRV A;  2P4T A;  1N8R C;  2CP5 A;  5I2S A;  4J8O A;  4QVC A;  4JUV A;  2OX7 A;  1YJN Q;  1N9S A;  2M0O A;  4ATO A;  4AG2 C;  2KAF A;  2A7Y A;  4MZT A;  4L5G A;  1HXD A;  4M78 F;  1QVF S;  4E47 A;  3QWX X;  3M53 A;  3OS0 A;  1U5S A;  3U23 A;  4BE0 A;  3JCM W;  2AKL A;  5I2M A;  4JS5 A;  4HVU A;  2DNU A;  1G8X A;  2CZ6 B;  4QW2 A;  3D7S B;  2E4H A;  5KYW B;  3LH0 A;  3KUF A;  1JQQ A;  1GCQ A;  2QGG A;  3CD6 T;  1M8V A;  2EQU A;  5GAM j;  4HVV A;  1X6G A;  1WHL A;  2ZCF B;  3CME T;  4M77 F;  4LD6 A;  3P8B B;  3QDF A;  4L59 A;  1OYX A;  2M51 A;  3OMG A;  1QVG A;  1KC8 U;  2V8J A;  2ZAE A;  1BKB A;  1WZO A;  4HA8 A;  3SHW A;  4GBQ A;  1K9M R;  2EJG A;  4J6Y A;  3OYM A;  1IGQ A;  1QWF A;  4LDX A;  3ASK A;  2QEX T;  2LQN A;  1JB0 E;  1G2B A;  2P0K A;  1SHF A;  1SSF A;  1VQM A;  2Y4X A;  4JRP A;  1YJN T;  5M9O A;  2L0A A;  3M57 A;  1X2K A;  3EH2 A;  2LQW A;  2JTM A;  3A8L B;  2DF6 A;  2K2M A;  2NUP B;  2EYX A;  3VS0 A;  2EGA A;  4N4I A;  3EAE A;  1MMN A;  1Y57 A;  4OMP A;  2I0N A;  2ABL A;  1EIF A;  3EGU A;  1M1G A;  5KYN A;  4MMK A;  1YIJ T;  4CC3 A;  2R5A A;  3A98 A;  2GQV A;  1RI0 A;  4RTZ A;  2HSP A;  1WHH A;  2CKK A;  2YUQ A;  3UA6 A;  2M0Y A;  2DKG A;  2YRD A;  5GJW B;  2ED1 A;  3QO3 A;  2HKN A;  1I4K 1;  2WSE E;  1OX9 A;  3HL8 A;  3OYD A;  3I56 T;  1D09 B;  5LJ5 j;  2EKH A;  2QGF B;  2L8D A;  1U1T A;  2YT6 A;  1Q86 R;  1WJR A;  3P8H A;  1ZA2 B;  2GQI A;  3C0C A;  4JJD A;  4M7D D;  2M02 A;  3OB9 A;  3UDC A;  4DA4 A;  4E7Z A;  3JCM d;  2CZ0 B;  4IUP A;  3UF4 A;  1KC8 C;  4PLL A;  4KT0 E;  3VS2 A;  1WA7 A;  4Y28 E;  2KRO A;  2KMT A;  3PMI A;  1PSE A;  5GAN f;  2LT1 A;  4Z88 A;  1Z9Q A;  2JOY A;  1BU1 A;  4FM4 B;  4OMQ A;  3G4S Q;  2AHJ B;  2B8A A;  2VUB A;  2NUZ A;  1D1B A;  2PZ1 A;  4D8K A;  1RAA B;  3M58 A;  3CCJ Q;  3OS2 A;  1VOM A;  4FSS A;  2RA2 A;  1YJ9 A;  3MHX A;  3X26 B;  5FLX E;  2JMC A;  1QKW A;  3OYB A;  4ZGE B;  1K4U S;  1R0C B;  2X4X A;  1FWZ A;  2PQW A;  2O31 A;  1ZA1 B;  3RR6 A;  1GBQ A;  1VQ9 A;  4V2S A;  4IUU A;  1Q82 U;  2XG8 D;  2EQI A;  4DEX A;  2XDP A;  2DEQ A;  5HK0 A;  2K3B A;  2FPD A;  3QDR B;  1K9M U;  5GAM h;  4J6X A;  1UGS B;  5IT9 E;  1UDL A;  1R8O B;  2VWF A;  2KI7 A;  2ZPH B;  5FRN A;  1WHG A;  1W1F A;  1NJI R;  2V26 A;  1C0M A;  5GAN 6;  2GFU A;  1TSF A;  1YCS B;  2JS2 A;  1VQ7 T;  1N9R A;  2JJ9 A;  4R56 A;  2FZG B;  2RJC A;  2H3J A;  3AHU A;  4LNP A;  3LGL A;  4PJO D;  2F2V A;  1RLP C;  2HQH A;  4RG2 A;  2NWM A;  3ULR B;  1MV0 B;  3M59 A;  1KHI A;  3OS1 A;  1Y7X A;  2DD4 A;  2KDS A;  3C4S A;  3CCJ T;  2HDA A;  2QDY B;  5D7U A;  4C92 D;  2E5K A;  2LCS A;  2QG9 B;  3JCM V;  1KD1 U;  4HT9 A;  3G1J A;  2ZPI B;  2QAZ A;  2SEM A;  3QYH B;  2RK2 A;  1T3L A;  1D0Z A;  2MK5 A;  4C5H A;  2D8J A;  1PRM C;  2XHC A;  2DTH A;  3BDU A;  4EIK A;  4EMH A;  3CCM T;  4JJC A;  4L6V 5;  1X01 A;  2FPE A;  2Y4Y A;  1M27 C;  3RNJ A;  3EFS A;  5CAI A;  4RCC A;  4M75 G;  1Y96 B;  4C5G A;  1OOT A;  2D1X A;  1H92 A;  5LJ3 j;  5LJ5 h;  8ATC B;  2V8I A;  1AZE A;  1JJ2 P;  1VQM Q;  3JB9 D;  5CCA A;  2O9S A;  1QP3 A;  3VKI A;  3HKS A;  1K9M C;  3JCM J;  2J6F A;  4FYY B;  3E9G A;  2K7A A;  4M7A G;  2KNB B;  2SRC A;  4OB3 B;  1YJW Q;  1PWT A;  3CPW S;  1M2V B;  4XU3 A;  4BAC A;  1HJD A;  4AFU C;  2CGH A;  1W70 A;  2J06 A;  5CKF A;  2PNI A;  2NUT A;  1C1A A;  4FYW B;  2EYY A;  2J6K A;  5GAN e;  1Q81 U;  2QQB A;  4HVW A;  3N5B B;  1YWO A;  3QSU A;  1ZBX A;  4JRK A;  1RLQ C;  1D3B A;  2E6Z A;  2HMA A;  3OYE A;  5GAN 2;  5I21 A;  3QJ6 A;  2RH2 A;  3TSZ A;  1NE8 A;  1IHV A;  1X6O A;  1ZLM A;  1DJ7 B;  1VQM T;  4F7U B;  3OYK A;  3H0H A;  4LDY A;  2HEQ A;  1BIB A;  4J9B A;  2C0I A;  1Q86 C;  3ME9 A;  1IRE B;  3EG9 A;  1SPK A;  2F2X A;  2CUB A;  2CT4 A;  1IO6 A;  3O5Z A;  5IXB A;  5KE2 A;  2X9H A;  3A5Z B;  5GAO n;  2QXF A;  1I5L A;  2PUO B;  1OZ2 A;  3EG3 A;  5A2Q E;  1YJ9 Q;  4C8Q A;  1G3T A;  3RIR A;  3OW2 S;  4XAX B;  1U8R A;  3O8V A;  4KRT A;  4OB2 B;  1WNL A;  4E2F B;  3MP8 A;  2K2V A;  2JZ2 A;  2KRN A;  2X3X D;  1HK9 A;  2HKQ B;  3QBY A;  1ZBJ A;  2JW4 A;  3AT1 B;  2K5F A;  4BI4 A;  5CKH A;  1SHG A;  2K5I A;  3G7Z A;  1XJW B;  1QVG P;  3SFM A;  2KBT A;  4BDY A;  2MWO A;  2PU9 B;  3JCM c;  1X27 A;  2E64 A;  3V8J A;  2FZC B;  3JCM e;  1WQW A;  4QQG A;  1FMK A;  1KSW A;  2MMP A;  5CKD A;  3M55 A;  3CCU A;  3P8D A;  1NLP C;  3CC4 A;  5KYU A;  1OPL A;  5LJ3 h;  1UHC A;  1NJI C;  5GAO m;  4QVD A;  5GAO q;  4PJL A;  4PLI A;  1KQS P;  4MZP A;  4M7D B;  3SWN A;  2IPO B;  2KT8 A;  3RDV A;  1YJ9 T;  1K0X A;  1BI2 A;  3M56 A;  1X69 A;  4M7D C;  1VQ9 T;  2G3R A;  2R57 A;  3FRN A;  3ZEH A;  5KYY A;  2FPF A;  3VYH B;  3CCR A;  2PVD B;  1PKT A;  4M75 E;  2JTE A;  5CO7 A;  1YI2 A;  4KUL A;  2LMJ A;  1KHC A;  4J9C A;  2QAS A;  5I11 A;  1CKB A;  4Z02 A;  2PVG B;  2QA4 T;  3URG A;  1D1C A;  1IGU A;  4M78 B;  3V8L A;  1I81 A;  4PKC C;  1AVZ C;  3CCE A;  4J5Y A;  5J39 A;  2MAM A;  4PK4 A;  4FW1 A;  4X9D A;  3I5S A;  5FW9 A;  1WGS A;  3TCJ A;  4M78 C;  2AT1 B;  4UC4 A;  2EW3 A;  2VKN A;  2DD5 A;  3HRS A;  3S3O A;  3A1P A;  4M77 G;  3CBO A;  2DXU A;  3REA B;  1KG1 A;  2GFA A;  3EG0 A;  4M77 B;  3VS5 A;  3TQ7 P;  3FIF A;  2LJ1 A;  1MMG A;  2JNG A;  2FZK B;  2KR3 A;  2E41 A;  4EMK C;  4F14 A;  3GNG A;  4P5N A;  1IRX A;  4ZN3 A;  3M0P A;  1PNJ A;  4FSX A;  2VGM A;  5GAM d;  3CEY A;  1MMD A;  3LGF A;  5GMK m;  3L2Z A;  3RMQ A;  2FHD A;  4PJO C;  3IQL A;  1KJW A;  4F7U E;  4C0G A;  3C12 A;  1BBZ A;  1KQ2 A;  2MOX A;  4J9D A;  2FEI A;  2A3L A;  1UG1 A;  2JS0 A;  3FB9 A;  3ZFJ A;  2DMO A;  3I9Q A;  3M0T A;  1GBR A;  3X20 B;  3LWI A;  3BDL A;  2CT3 A;  2EWN A;  1OU9 A;  1VQO A;  2OTL A;  3EGX B;  1OPK A;  2COZ A;  1WX6 A;  3MEA A;  3PGG A;  5CR2 A;  1RL2 A;  2DYI A;  2YHT A;  5I22 A;  3DKM A;  2ATC B;  5DY9 A;  3OYL A;  3CBP A;  4J9F A;  3DLL A;  4C8Q F;  2LP5 A;  1JO8 A;  2L3P A;  1O75 A;  1Z9Z A;  1VQ4 A;  3OA6 A;  2DL8 A;  2ZGW A;  2NUP A;  4IIO A;  4TVR A;  1YBY A;  3L2Q A;  3H41 A;  5D6Y A;  1ABQ A;  2KY9 A;  5DLO A;  1BI3 A;  2LVM A;  1WIE A;  4M7A D;  3REB B;  2D6F A;  3UA7 A;  1V1C A;  3ZBD A;  4AFS C;  4WTO B;  2X51 A;  3E9F A;  2DPP B;  4J9G A;  4RMO A;  1UTI A;  4GLK A;  3UWN A;  1FX7 A;  1OU8 A;  5LL6 S;  1BI1 A;  3HHT B;  4LDU A;  1RAB B;  4FIB A;  1UJ0 A;  4OVA A;  2HD0 A;  4Y91 A;  5FRO A;  5LJ5 d;  5KE3 A;  2VGN A;  3CXC P;  3OYI A;  2XID A;  4XQ3 A;  4PJO F;  4WF2 A;  2EPD A;  2KT1 A;  2RF0 A;  3CCU Q;  1W2B P;  5CIU A;  3ZL7 C;  3CC4 Q;  2GCX A;  4NL2 A;  2K79 A;  1VQP Q;  2DLP A;  2DVE A;  1Q95 G;  2XDB A;  1NEB A;  4C92 F;  1NBE B;  3HTR A;  5HCK A;  1WXU A;  2E3H A;  4C5I A;  2JT4 A;  2HBP A;  5KYX A;  1BCO A;  3M5A A;  2JVV A;  4ZTJ A;  4QVZ A;  4M4Z A;  1KQS A;  3EFR A;  1NEG A;  4LN2 A;  2EIF A;  2HQX A;  2DFU A;  1QMC A;  3NTH A;  3OYG A;  1M3C A;  1YJW A;  1VQK A;  3CCR Q;  3CCS Q;  3OYJ A;  2D9T A;  3A8G B;  3GBQ A;  1YI2 Q;  4M78 E;  9ATC B;  1ZUU A;  2A28 A;  4J83 A;  2DBK A;  1PG5 B;  2A36 A;  4KGV B;  1P92 A;  1K8A R;  2V1Q A;  1VQ6 Q;  3JB9 F;  2RMO A;  1HYO A;  1QCN A;  3RER A;  2DIL A;  2DXT A;  3RUX A;  1M2O A;  3CCE Q;  5GAN 5;  3MP6 A;  4GY5 A;  3CCU T;  2KSS A;  1AWJ A;  1R77 A;  3PVQ A;  1T3S A;  4M77 E;  3CC4 T;  2EQJ A;  1U1S A;  1Q7Y R;  2GBQ A;  2RM4 A;  5GMK e;  3FDR A;  1JRI A;  1UEB A;  2BE9 B;  3JCM P;  4Z89 A;  2DIQ A;  1VQ5 A;  1B34 A;  5A0G A;  5GAN j;  1JJ2 S;  1QWE A;  1NZ9 A;  1GCQ C;  2KVQ G;  1QP2 A;  3GNF B;  3G6E Q;  3UT1 A;  2MWP A;  4BUG A;  1J3T A;  1OEB A;  2OJ2 A;  3LX7 A;  2XK0 A;  3X24 B;  2VAS A;  4JPB W;  3I55 A;  3GLX A;  4DEY A;  4OF1 A;  5CVI A;  4A4G A;  2DO3 A;  3V7S A;  1G3Y A;  3FJP A;  4JZ3 A;  4E7J A;  3PFS A;  4JRI A;  5DM7 R;  1M8M A;  4C8Q D;  2YXY A;  4OGE A;  5IXF A;  1OQK A;  2KEA A;  1S72 A;  3GIB A;  4OMF B;  4IUQ A;  3G71 A;  1KK7 A;  4KH0 B;  1CKA A;  1GFD A;  2BZY A;  4XTV A;  1M4Z A;  1TUC A;  1VQO Q;  1AT1 B;  4OB1 B;  2OTL Q;  2XI9 A;  3RKX A;  2RN8 A;  1XQH A;  1UGQ B;  4M75 A;  1VYV A;  5LJ3 d;  2A37 A;  2AKK A;  2P4R A;  1K76 A;  2EYQ A;  3LLR A;  3CC7 A;  2HCK A;  1WJS A;  3Q1J A;  1GCP A;  3M0U A;  3WVE B;  1VQ4 Q;  5EG2 A;  4N4G A;  1M2V A;  2EQM A;  3PE0 A;  4M7A A;  3G4S T;  3HP9 A;  2L89 A;  5GAM e;  2ZPB B;  2YUO A;  1PHT A;  2CH4 A;  3VS4 A;  5GAN 3;  1GRI A;  2C0T A;  2HZY A;  2V1R A;  4WCI A;  3JCM f;  2WSC E;  1M3A A;  4N0A A;  4R0K A;  1LCK A;  4J7I A;  3PMT A;  2A08 A;  4JS4 A;  1VQ8 A;  1ZSZ A;  2OTL T;  2LCC A;  1RAG B;  1Q86 U;  1VQN A;  2M1H A;  1I0C A;  1QVG S;  3CXC A;  1SKU B;  1PD1 A;  2IIM A;  3X28 B;  1M90 R;  4LD9 K;  1EFN A;  1W2B A;  1K73 R;  3H9N A;  4LUE A;  2CP7 A;  2O4X B;  3CBM A;  4J9E A;  3CMA A;  2HQE A;  1M1F A;  3R6N A;  2DRK A;  2ZPE B;  2K6D A;  5FU7 B;  1ZUY A;  2QTV A;  1Y0M A;  1D0X A;  5FWB A;  2QK0 A;  2BUD A;  3RKW A;  1YHQ A;  4ORZ A;  4A53 A;  2DIG A;  4AMC A;  1VQK Q;  4FU6 A;  1WLP B;  4NOY A;  5FU7 C;  5LJ3 f;  2D0Q B;  2CRE A;  1PCX A;  1IB8 A;  2PTK A;  4BI8 B;  4ESR A;  2P0Q A;  3VRZ A;  3LH5 A;  3PTA A;  4DOV A;  4X34 A;  3QHS A;  3TRE A;  3VU3 C;  5CKB A;  2RPN A;  1NJI U;  2CP0 A;  2DL3 A;  2RJD A;  1V29 B;  3JCM X;  2E1H A;  4EMG A;  1OZ3 A;  1K8A C;  1EX4 A;  3KXT A;  2X35 A;  4F7U G;  4J7F A;  3TEE A;  2VXF A;  2X4W A;  1VQ5 Q;  1T0J A;  2LNV A;  1WHJ A;  4Y92 A;  5L23 A;  3E1S A;  1RAF B;  3CCQ A;  2XMF A;  2HBW A;  3CD6 A;  1Q7Y C;  1Y71 A;  2EFI A;  1O9S A;  4HT8 A;  3CME A;  2X3W D;  1YJW T;  2WSF E;  3I55 Q;  2EJ9 A;  4A4E A;  1YCY A;  4IKF A;  2ED0 A;  1VQK T;  4A4K A;  1ZUK A;  3TVT A;  3JSC A;  1QVP A;  3EG2 A;  5GAO l;  2LRQ A;  3HFN A;  4FT2 A;  1BK2 A;  1S72 Q;  4O5V A;  4BB7 A;  1LOJ A;  4AG1 C;  3G71 Q;  2QEX A;  1QVF A;  5A0D A;  2M9U A;  4B9W A;  2X4J A;  2RB6 A;  4RTW A;  2XDD A;  2IG0 A;  4ELY C;  4II1 A;  1QQJ A;  1YNZ A;  5L8R E;  4KUI A;  1HD3 A;  1GL5 A;  2VVK A;  4DBF A;  2DA9 A;  4M75 F;  2RHI A;  4C0F A;  1M90 U;  4B6M A;  1YIT Q;  1K73 U;  5FWC A;  3HRT A;  4BI3 A;  2BZX A;  3UPU A;  3MPU B;  2NLU A;  3CC7 Q;  1LPL A;  1VQ5 T;  2OAW A;  2L3S A;  3EGD B;  5KCO A;  1UB4 A;  1UEC A;  2JM9 A;  1R0B G;  1X43 A;  2JMA A;  4ME7 A;  3EFO A;  1QCF A;  1SF9 A;  5GAN g;  1KFZ A;  3KFV A;  1YIJ A;  3MEV A;  4M7A F;  3MP1 A;  1WDX A;  2KRS A;  2ZPF B;  1D3B B;  2YDL A;  3JAM E;  3BE3 A;  5GAN 7;  4M7D G;  4M77 A;  1SRL A;  4HCK A;  3I55 T;  1VQP A;  2QDL A;  1D1A A;  2F5T X;  3I35 A;  1FYN A;  3CCV A;  4VUB A;  2DYB A;  1WJQ A;  3I56 A;  3DB3 A;  1WHM A;  2CP3 A;  2VC8 A;  1S72 T;  2RQT A;  5FU6 B;  3G71 T;  2LDM A;  2LJ3 A;  3OYF A;  2BTT A;  2DE0 X;  5CQX A;  1M1K R;  1NM7 A;  1T0H A;  3EG9 B;  1VQ8 Q;  4OMN A;  3CCS A;  3PIO A;  7AT1 B;  3L2W A;  2AZS A;  2F2W A;  2CDT A;  5LJ3 e;  5FU6 C;  1VQN Q;  1AZG B;  4X1V A;  1I1J A;  2KQW A;  1KQ1 A;  4C8Q B;  1WQ7 A;  3L2U A;  1UGP B;  4M78 G;  1UFF A;  1I8F A;  1VQ6 A;  4PFO A;  3CC7 T;  2X4Y A;  4PJM A;  5GMK l;  1QKX A;  4ANJ A;  2RNA A;  1IZ6 A;  3J80 E;  4DQ2 A;  1TU0 B;  4XTX A;  2KGT A;  1N6A A;  4C8Q C;  3CMA Q;  3R6O A;  2OTJ A;  3CXC S;  2ROL A;  3C94 A;  1JXO A;  1AHJ B;  3QXE B;  4PFZ A;  1TUD A;  2DER A;  2AK5 A;  4PL6 A;  3X25 B;  3RES A;  1IXD A;  1W2B S;  2YRC A;  1A0N B;  2ZZD A;  2E65 A;  3OQ5 A;  4F04 B;  2FL7 A;  1YP5 A;  2JM8 A;  3SD4 A;  1YHQ Q;  1M90 C;  1K73 C;  3MET A;  1E6G A;  5IAY A;  1H8K A;  1VYT A;  4J9H A;  4EMK B;  3OYC A;  4KUD K;  1LVK A;  4PFP A;  4PJO G;  3G6E A;  1U3O A;  2EQK A;  3QII A;  3V7R A;  3JCM g;  1JXM A;  1TWB A;  4PJO B;  2COY A;  1AOJ A;  2K3X A;  2RHX A;  4JZ4 A;  3MCA B;  5KYW A;  3NTI A;  5KYU B;  4XTW A;  4QQD A;  1X2Q A;  2BIV A;  1VQ8 T;  4RTX A;  1VQ7 A;  3V7C A;  2ESW A;  3H0F A;  5GMK j;  3EHQ A;  2RK1 A;  2W10 A;  4C92 B;  2E5Q A;  3NTK A;  4LXC A;  1WXB A;  2J05 A;  1VIE A;  1QCO A;  3FLG A;  3NHN A;  2EAY A;  2RQU A;  2Y90 A;  4C92 C;  1H3Z A;  2K3Y A;  3H0I A;  2PVO B;  2RI2 A;  2CP2 A;  3JCM Q;  5KYY B;  3CCQ Q;  2KK4 A;  3OBW A;  4AFZ C;  4CC2 A;  3CD6 Q;  2XKO C;  2DL5 A;  1KIK A;  2EGE A;  3CME Q;  1EZZ B;  2GTJ A;  1U06 A;  4M75 D;  1YHQ T;  2RHZ A;  2K57 A;  3J7A F;  1MUZ A;  4BY6 B;  2L3R A;  3CCM A;  5IHN A;  5IHK A;  2RHU A;  5C6S A;  2ZPG B;  2DL7 A;  3HSB A;  3NPF A;  2CZ1 B;  1G5V A;  3VJP A;  2BKD N;  1M1K U;  4BY6 C;  5GAN 4;  2QEX Q;  1D0Y A;  2M16 A;  2YWW A;  3PVL A;  1NYF A;  1W6X A;  3CC2 A;  4DOW A;  2VB6 A;  2A0F B;  3H8Z A;  1YFN A;  5KH6 A;  1YWP A;  1K1Z A;  2COW A;  1SSH A;  1VQL A;  3JRZ A;  1ZQ1 A;  3GF5 A;  3NGP A;  5HY6 A;  3VS6 A;  5GMK i;  1C6V X;  1M30 A;  1RAC B;  3OBY A;  1BYM A;  1ACM B;  2RI5 A;  2IVW A;  4XTZ A;  5IHI A;  1AWX A;  1BB9 A;  4J6W A;  1K0S A;  4O6J A;  2E10 A;  1ZSG A;  2ECZ A;  2C06 A;  4N4H A;  3CCQ T;  4OML A;  4M7D E;  4D6W A;  3CQT A;  2OAU A;  1YIJ Q;  2FYK A;  3WXM B;  2GGR A;  2K4Y A;  1VA7 A;  5GAM f;  1BCM A;  2E12 A;  5GAO r;  4MDX A;  5GAN d;  5AYF A;  2YLB A;  5GAO p;  1RAI B;  1RUW A;  1VYU A;  4F17 A;  3M0R A;  2DL4 A;  3CCV Q;  2DZC A;  2LT4 A;  6AT1 B;  1Q82 R;  3QZ5 B;  3I56 Q;  4D8D A;  1G83 A;  2EBP A;  1W4S A;  3S6W A;  2OI3 A;  4Z8A A;  4C8Q E;  1WPY A;  4LE9 A;  3QJY A;  2XIC A;  4NS5 A;  3CPW A;  3HFO A;  1RI9 A;  1UE9 A;  1HSQ A;  1MGQ A;  4RG8 A;  5ECA A;  3QPH A;  4HXJ A;  2QQA A;  1JEG A;  2NYS A;  1N5Z A;  1X6B A;  3RKY A;  4A4F A;  5D6X A;  3VUZ A;  3OYN A;  1M3B A;  5GMK h;  4HCB A;  2HSE B;  3M54 A;  4BD3 A;  1M1K C;  2RJF A;  2R58 A;  3H6Z A;  1PRL C;  4E7H A;  5EC7 A;  4PJJ A;  2XD0 A;  4DBH A;  1AD5 A;  2KE9 A;  2OTJ Q;  2KRM A;  2MCN A;  4KGX B;  2MI6 A;  2QYZ A;  2CS7 A;  1KD1 R;  5D6W A;  2RQR A;  1VQP T;  2QI2 A;  4FYV B;  5GJV B; 
#chains in the Genus database with same CATH homology
 4IUR A;  2R5M A;  4LD9 K;  4BE2 A;  1M5Q 1;  1WQW A;  1W2B A;  4QQG A;  1H64 1;  2QQS A;  3JB9 G;  2O4X B;  4PJO E;  4FL6 A;  2DXB A;  3CBM A;  3CCV T;  3A8H B;  4MZM A;  5LJ3 g;  2MMP A;  3CCL A;  2K5L A;  3M55 A;  4OP0 A;  5CKD A;  5KCH A;  3CMA A;  3CCU A;  2HQE A;  3TU4 K;  1M1F A;  3LYI A;  3P8D A;  4BE1 A;  2ZPE B;  5CK9 A;  3CC4 A;  5FU7 B;  5LJ5 f;  2QTX A;  2DXC A;  4C92 E;  5LJ3 h;  3V8K A;  1NJI C;  5GAO m;  3QZ9 B;  2BUD A;  4XU2 A;  4KBM B;  3RKW A;  4QVD A;  2YRV A;  5GAO q;  2LTO A;  1YHQ A;  2P4T A;  1N8R C;  4PLI A;  4A53 A;  5I2S A;  2DIG A;  4MZP A;  4M7D B;  4J8O A;  4QVC A;  3SWN A;  4FU6 A;  4JUV A;  3CCR T;  3CCS T;  5CKE A;  4NOY A;  4HCC A;  5FU7 C;  1YJ9 T;  3KBG A;  5LJ3 f;  1YI2 T;  2D0Q B;  1N9S A;  2M0O A;  4ATO A;  3MO8 A;  2KAF A;  4IUV A;  4BI8 B;  2A7Y A;  4MZT A;  2P0Q A;  4L5G A;  1HXD A;  4M78 F;  3L1A A;  1QVF S;  1BI2 A;  3M56 A;  1NPR A;  4E47 A;  3OW2 A;  3M53 A;  3OS0 A;  3PTA A;  4M7D C;  1VQ6 T;  4BE0 A;  3VV0 A;  3JCM W;  4DOV A;  2G3R A;  5I2M A;  4JS5 A;  1VQ9 T;  2CZ6 B;  4QW2 A;  2R57 A;  4X34 A;  3QHS A;  3FRN A;  3ZEH A;  3TRE A;  1LJO A;  3BFM A;  3VU3 C;  3VYH B;  3CCE T;  3CCR A;  2PVD B;  2F5K A;  4M75 E;  5CKB A;  5CO7 A;  3F70 A;  1VIF A;  2OTJ T;  1YI2 A;  3LH0 A;  3KUF A;  4KUL A;  1KHC A;  4Q5W A;  1NJI U;  2V8K A;  3CD6 T;  1M8V A;  4EPC A;  2EQU A;  5GAM j;  2RJD A;  2GF7 A;  3OMC A;  1Y96 A;  4Z02 A;  1YIT A;  1V29 B;  2PVG B;  2HNI A;  3JCM X;  2E1H A;  2ZCF B;  3CME T;  4M77 F;  4LD6 A;  4EMG A;  1OZ3 A;  2O4X A;  3P8B B;  2QA4 T;  1K8A C;  4NL3 A;  4L59 A;  3URG A;  3KXT A;  2DAQ A;  1VQL T;  2X35 A;  3DB4 A;  4M78 D;  1OYX A;  3OMG A;  4F7U G;  1QVG A;  1KC8 U;  2V8J A;  4J7F A;  2VXF A;  2X4W A;  4M78 B;  3TEE A;  3V8L A;  1I81 A;  4PKC C;  2LNV A;  1BKB A;  4FT4 A;  4HA8 A;  3CCE A;  3E1S A;  4J5Y A;  5J39 A;  4V2S A;  2MAM A;  3CCQ A;  3DLM A;  3G6E T;  1Q82 U;  2EJG A;  4J6Y A;  3OYM A;  3CD6 A;  4X9D A;  2HAX A;  4RCB A;  1Y71 A;  3A8M B;  1WGS A;  1Q7Y C;  2E6N A;  2EFI A;  1O9S A;  4M78 C;  3TCJ A;  4HT8 A;  4UC4 A;  3CME A;  3ASK A;  4LDX A;  2DD5 A;  2QEX T;  2QA4 A;  3HRS A;  1JB0 E;  2WSF E;  3S3O A;  1YJW T;  3BW1 A;  2RD1 A;  4M77 G;  2EJ9 A;  4A4E A;  3CBO A;  3VYG A;  1YCY A;  3L2R A;  2P0K A;  2DXU A;  4IKF A;  1VQK T;  4A4K A;  1GXI E;  4M77 D;  1KG1 A;  3PT9 A;  2GFA A;  4M77 B;  4E7I A;  1SSF A;  4C0D B;  2Y4X A;  1VQM A;  1X75 C;  3JSC A;  4JRP A;  3FIF A;  4LDW A;  1YJN T;  1QVP A;  3OSV A;  5M9O A;  4B9X A;  2CYZ B;  1K8A U;  3OS5 A;  5GAO l;  2JNG A;  3M57 A;  2LRQ A;  1B34 B;  3HFN A;  3T9N A;  2JTM A;  4FT2 A;  3A8L B;  4O5V A;  4BB7 A;  1LOJ A;  4OB0 B;  4N4I A;  2CZ7 B;  2VXE A;  2E41 A;  3EAE A;  4C0D C;  4EMK C;  5A0D A;  2QEX A;  1QVF A;  2M9U A;  4B9W A;  3GNG A;  4P5N A;  2X4J A;  2RB6 A;  4ZN3 A;  2XDD A;  4ELZ C;  2IG0 A;  4ELY C;  2QQ9 A;  4II1 A;  1EIF A;  4FSX A;  2VGM A;  5GAM d;  1M1G A;  1XOV A;  3CEY A;  1VQO T;  1Q7Y U;  3LGF A;  5GMK m;  2I2L A;  5L8R E;  4KUI A;  3L2Z A;  3RMQ A;  2FHD A;  4PJO C;  4MMK A;  4M75 F;  1YIJ T;  2RHI A;  4C0F A;  4F7U E;  1M90 U;  2R5A A;  4XK8 E;  3C12 A;  4C0G A;  1K73 U;  2GQV A;  1RI0 A;  3HRT A;  1G3S A;  4BI3 A;  1KQ2 A;  2CKK A;  4F7U A;  2A3L A;  3UPU A;  2NLU A;  1VQ5 T;  3FB9 A;  2DKG A;  3M4Y A;  3ZFJ A;  3JB9 H;  5KCO A;  1UB4 A;  1QW1 A;  2DTO A;  3X20 B;  3BDL A;  3LWI A;  3QO3 A;  2EWN A;  1VQ4 T;  1I4K 1;  2RJE A;  5GAN 8;  4ME7 A;  2WSE E;  4QQ6 A;  2EKO A;  1VQO A;  2OTL A;  3HL8 A;  3OYD A;  3I56 T;  5LJ5 j;  4XTY A;  3RMS A;  1BIA A;  5GAN g;  2L8D A;  1YIJ A;  1U1T A;  3MEV A;  3MP1 A;  4M7A F;  3MEA A;  2ZPF B;  3PGG A;  1D3B B;  4IUT A;  3JAM E;  1JBM A;  5GAN 7;  5CR2 A;  4M7D G;  1WJR A;  4M77 A;  3I55 T;  1RL2 A;  2YHT A;  3P8H A;  3GP8 A;  4M75 B;  1VQP A;  3CC2 T;  4ZGD B;  5GAN h;  4M7D D;  2E70 A;  3DKM A;  5A0L A;  1Y07 A;  3OB9 A;  5DY9 A;  3UDC A;  1TH7 A;  1NPP A;  3CBP A;  3OYL A;  3DLL A;  4DA4 A;  3JCM d;  2F5T X;  2F69 A;  2DZ9 A;  2CZ0 B;  3LW5 E;  3CCV A;  4IUP A;  3SB2 A;  4C8Q F;  1KQS S;  1O75 A;  4VUB A;  1Q82 C;  1KC8 C;  4PLL A;  3OA6 A;  4KT0 E;  1VQ4 A;  1WJQ A;  3OYA A;  2ZGW A;  3I56 A;  4Y28 E;  3DB3 A;  2KMT A;  3QKJ A;  3PMI A;  1PSE A;  3HRU A;  1YBY A;  4TVR A;  5GAN f;  4M75 C;  2LT1 A;  3L2Q A;  2VC8 A;  1S72 T;  2JOY A;  5D6Y A;  4CI0 C;  2KY9 A;  4FM4 B;  5DLO A;  5FU6 B;  5LJ5 e;  3L42 A;  1BI3 A;  2AHJ B;  2LDM A;  2LVM A;  3G71 T;  2B8A A;  3OYF A;  2VUB A;  4M7A D;  5CQX A;  4M7A B;  2RO0 A;  3FC3 A;  2D6F A;  3M58 A;  4EDU A;  3ZBD A;  3CCS A;  3PIO A;  3OS2 A;  3L2W A;  3E9F A;  2RA2 A;  2DPP B;  3MHX A;  4RMO A;  1YJ9 A;  3X26 B;  5FLX E;  2O01 E;  5LJ3 e;  5FU6 C;  3QG1 A;  1G3W A;  4ZGE B;  4GLK A;  3OYB A;  2KQW A;  3UWN A;  1KQ1 A;  2X4X A;  4C8Q B;  1FX7 A;  1FWZ A;  2YLC A;  4M7A C;  3NFC A;  5LL6 S;  2PQW A;  1WQ7 A;  1BI1 A;  5DLQ E;  5GAM g;  3L2U A;  1UGP B;  3HHT B;  4LDU A;  4M78 G;  4R55 A;  1I8F A;  1VQ6 A;  1VQ9 A;  1FXX A;  3CC7 T;  4ZN1 A;  4FIB A;  4IUU A;  2X4Y A;  2HD0 A;  2XG8 D;  4OVA A;  4YTL A;  4Y91 A;  5FRO A;  5KE3 A;  5GMK l;  5LJ5 d;  2XDP A;  2DEQ A;  2VGN A;  4JDS A;  1IZ6 A;  5HK0 A;  3J80 E;  3QDR B;  4DQ2 A;  4E7K A;  1K9M U;  4XTX A;  5GAM h;  1N6A A;  4J6X A;  3OYI A;  2XID A;  4XQ3 A;  4PJO F;  1UGS B;  4WF2 A;  4C8Q C;  3R6O A;  1OI1 A;  3CXC S;  5IT9 E;  3C94 A;  1R8O B;  2OTJ A;  3QXE B;  1AHJ B;  5CIU A;  2ZPH B;  5FRN A;  2GCX A;  4HKE A;  4PL6 A;  3X25 B;  4NL2 A;  3RES A;  2JN0 A;  1W2B S;  2ZZD A;  2E65 A;  3HPW A;  4N0A C;  2JTF A;  3OQ5 A;  5GAN 6;  1KD1 C;  4M7D A;  2FL7 A;  2GFU A;  2DVE A;  4JJN K;  3SD4 A;  1M90 C;  2XDB A;  4C92 F;  1K73 C;  3MET A;  5IAY A;  2XU8 A;  1VQ7 T;  4LDV A;  1N9R A;  4EMK B;  4C5I A;  3JCM e;  4XU0 A;  3OYC A;  2HBP A;  3OY9 A;  4KUD K;  4R56 A;  3QUI A;  3M5A A;  2JVV A;  2RJC A;  4ZTJ A;  4QVZ A;  2H3J A;  4PJO G;  3EFR A;  3G6E A;  1KQS A;  3AHU A;  3LGL A;  5FRM A;  2EQK A;  3QII A;  3V7R A;  2EIF A;  3JCM g;  4PJO D;  2HQX A;  4PJO B;  2K3X A;  2RHX A;  3NTH A;  4RG2 A;  5HKC A;  3MCA B;  4HCZ A;  3OYG A;  3NTI A;  1YJW A;  4XTW A;  4X9C A;  4QQD A;  3M59 A;  1KHI A;  2BIV A;  3OS1 A;  1Y7X A;  2DD4 A;  2KDS A;  3C4S A;  3CCJ T;  1VQ8 T;  3JCM h;  1VQK A;  1VQ7 A;  3V7C A;  2FVU A;  3OYJ A;  2D9T A;  2QDY B;  3A8G B;  2L5Q A;  2FB7 A;  4C92 D;  3MEU A;  5GMK j;  2RK1 A;  4M78 E;  3OYH A;  4C92 B;  3JCM V;  1YJN A;  1KD1 U;  2E5Q A;  4HT9 A;  3NTK A;  4J83 A;  2ZPI B;  3QYH B;  4PNO A;  1VIE A;  1P92 A;  3LWH A;  2RK2 A;  4M78 A;  5J3B A;  3FLG A;  4C5H A;  2DK3 A;  4BDZ A;  3JB9 F;  2EAY A;  2XHC A;  2DTH A;  3BDU A;  2Y90 A;  4C92 C;  3RER A;  4EMH A;  1H3Z A;  2K3Y A;  2DXT A;  2PVO B;  3RUX A;  3CCL T;  5GAN 5;  2RI2 A;  3CCM T;  3MP6 A;  4GY5 A;  3CCU T;  3JCM Q;  2KSS A;  2RI3 A;  4L6V 5;  2KK4 A;  3OBW A;  1X01 A;  4M77 E;  3CC4 T;  2Y4Y A;  2EQJ A;  3EFS A;  1U1S A;  2XKO C;  3MEW A;  5LJ5 g;  2RM4 A;  5CAI A;  2P0P A;  3FDR A;  4RCC A;  1JRI A;  5GMK e;  4A54 A;  4M75 G;  1UEB A;  1M9S A;  1UGR B;  2LCL A;  4M75 D;  3JCM P;  3BY7 A;  2RHZ A;  1Y96 B;  1YHQ T;  4EMK A;  3M9Q A;  4C5G A;  2DIQ A;  2K57 A;  1Q81 C;  4C5E A;  1VQ5 A;  2DJZ A;  5LJ3 j;  5LJ5 h;  4BY6 B;  4MML A;  3JB9 J;  3J7A F;  2V8I A;  3JB9 D;  2L3R A;  4RKU E;  5CCA A;  1B34 A;  3SDZ A;  5A0G A;  3CCM A;  5GAN j;  4PJO A;  2RHU A;  1JJ2 S;  5C6S A;  2ZPG B;  2KVQ G;  1NZ9 A;  1QP3 A;  1XTD A;  1QP2 A;  2DTI A;  3GNF B;  3HKS A;  3OYY A;  3UT1 A;  3VKI A;  4JRQ A;  3JCM J;  2MWP A;  1K9M C;  3HSB A;  3A8O B;  4BUG A;  2CZ1 B;  3E9G A;  1G5V A;  4XTU A;  4XU1 A;  3C95 A;  3LX7 A;  3QYG B;  2LQK A;  2BKD N;  2LQ8 A;  2XK0 A;  3VJP A;  3X24 B;  4BY6 C;  1M1K U;  4M7A G;  5GAN 4;  4OB3 B;  2M16 A;  2MF2 A;  3CPW S;  3CC2 A;  3I55 A;  4DOW A;  4XU3 A;  3GLX A;  4BAC A;  3H8Z A;  5KH6 A;  4OF1 A;  5CVI A;  4A4G A;  2CGH A;  4C92 A;  2DO3 A;  5CKF A;  3V7S A;  1VQL A;  1G3Y A;  2LC4 A;  3JRZ A;  3FJP A;  1ZQ1 A;  3FEO A;  3GF5 A;  3J81 E;  3S3M A;  3WVD B;  2EJF A;  5HY6 A;  4E7J A;  5GMK i;  3PFS A;  4C8Q G;  3GPL A;  5C0M A;  3CPF A;  4JRI A;  3GOX A;  5DM7 R;  4C8Q D;  1YIT T;  4OGE A;  5GAN e;  3OSS C;  3OBY A;  4CRI A;  1Q81 U;  5IN1 A;  1S72 A;  3GIB A;  4OMF B;  1BYM A;  5CQY A;  2VV5 A;  2QQB A;  2RI5 A;  4F7U F;  2IVW A;  4IUQ A;  4XTZ A;  3G71 A;  3N5B B;  4J6W A;  4O6J A;  2E10 A;  4ZGJ B;  4XTV A;  1M4Z A;  4JLG A;  3QSU A;  2C06 A;  1ZBX A;  4N4H A;  4OB1 B;  4JRK A;  3CCQ T;  1N27 A;  1D3B A;  4M7D E;  2XI9 A;  3RKX A;  4D6W A;  3M4G A;  5HK3 A;  2OAU A;  2E6Z A;  3S3N A;  1XQH A;  1UGQ B;  3OYE A;  4M75 A;  2FYK A;  5GAN 2;  1N8R U;  1BI0 A;  5LJ3 d;  3WXM B;  5I21 A;  2K4Y A;  5GAM f;  2E12 A;  3QJ6 A;  2QQR A;  2RH2 A;  5GAO r;  4MDX A;  5GAN d;  5AYF A;  2EYQ A;  1LNX A;  1NE8 A;  3LLR A;  3CC7 A;  1WJS A;  2YLB A;  5GAO p;  3Q1J A;  1X6O A;  3E19 A;  1DJ7 B;  1VQM T;  2DZC A;  2LT4 A;  4F7U B;  3OYK A;  4LDY A;  3WVE B;  2VYT A;  4M7A E;  1BIB A;  3QZ5 B;  4E7L A;  5EG2 A;  3VUB A;  2RHY A;  4N4G A;  3JB9 I;  2JUF A;  2EQM A;  1JJ2 A;  4M7A A;  3G4S T;  1Q86 C;  1W4S A;  3HP9 A;  3ME9 A;  3S6W A;  1IRE B;  2L89 A;  5GAM e;  4C8Q E;  1WPY A;  2ZPB B;  5KE2 A;  4A4H A;  3A5Z B;  3QJY A;  4C92 G;  2XIC A;  2QXF A;  5GAO n;  4NS5 A;  3CPW A;  1I5L A;  2PUO B;  1XNI A;  1OZ2 A;  3HFO A;  5A2Q E;  4C8Q A;  1G3T A;  3RIR A;  3OW2 S;  4ZTF A;  1MGQ A;  4XAX B;  3SWN B;  5GAN 3;  1VQN T;  2WAC A;  1U8R A;  4RG8 A;  3O8V A;  3INZ A;  3QPH A;  1WNL A;  4OB2 B;  2QQA A;  3RKY A;  3MP8 A;  3JCM f;  2K2V A;  2WSC E;  4A4F A;  3PIP A;  2LX9 A;  3G4S A;  4N0A A;  5D6X A;  4M77 C;  2JZ2 A;  2PUK B;  3VUZ A;  3OYN A;  4JLI A;  4J7I A;  5GMK h;  4HCB A;  1HK9 A;  3QBY A;  3PMT A;  3M54 A;  4BD3 A;  1M1K C;  2RJF A;  2R58 A;  3H6Z A;  3SWN C;  4JS4 A;  5J26 A;  3JCM b;  4E7H A;  3CCJ A;  1VQ8 A;  4MDW A;  2XD0 A;  2OTL T;  3CMA T;  2K5F A;  4BI4 A;  2LCC A;  2K5I A;  3G7Z A;  5CKH A;  3PNW C;  1Q86 U;  1PSF A;  1VUB A;  1VQN A;  3SFM A;  4OGC A;  4C0Z A;  3L2V A;  1ZHI A;  2M1H A;  4BDY A;  2MWO A;  2MI6 A;  2PU9 B;  3JCM c;  4M7D F;  1QVG S;  3CXC A;  2CS7 A;  2E64 A;  5D6W A;  3ER0 A;  3V8J A;  3X28 B;  1VQP T;  2QI2 A;  1MHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...