4M78G

Crystal structure of lsm2-8 complex, space group p21
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
70
Chain Sequence
b'MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
molecule tags Rna binding protein
source organism Saccharomyces cerevisiae
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
total genus 15
structure length 70
sequence length 86
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78G00
4M75C 4DQ2A 4J5YA 4M7DD 3GIBA 4MMKA 1D3BA 3JCMb 3JCMd 3PGGA 2I2LA 5GAMh 4EMKA 5GANf 5LJ3f 2QTXA 3V8KA 4HT9A 2DXTA 2DZCA 2YLBA 4M77E 4XU1A 5LJ3j 3FJPA 4NL3A 3SWNC 2E65A 5GANd 4M78G 5GANj 5GAOl 4M7AB 1I5LA 3FB9A 4F7UG 4RCBA 4C92G 4M7AF 5LJ5e 2DEQA 4M7AE 4M75F 4M7DA 4C8QA 2HNIA 5GAMf 1U1TA 4N0AC 4NOYA 1LOJA 2DTHA 4J6YA 4M7AA 3INZA 3SWNB 5LJ3e 4C92C 3HSBA 5CAIA 2ZGWA 4M7DF 4PJOC 4XTVA 4EMGA 4M7AC 2VXEA 5GANg 3BW1A 4JLIA 3HFOA 1HXDA 4M75E 4XTYA 1Y96B 1HK9A 2DTOA 2K57A 5GAN2 1MGQA 4M78D 3RIRA 4F7UA 3AHUA 4Y91A 2EWNA 4M78A 5GAOn 4NL2A 4PJOF 1KQ2A 5GMKm 3JCMf 1N9RA 4PJOE 5DY9A 3HFNA 4M77F 3L2ZA 4F7UE 1M8VA 3V8LA 3JCMg 1H641 5LJ3h 5LJ5h 5GAN8 5LJ5j 1M5Q1 2E10A 1Y96A 1X01A 1WNLA 4J6WA 4M78E 4M78F 4RCCA 5GAN5 2FYKA 3JB9H 2DZ9A 4XU2A 3SB2A 4XTUA 1I8FA 4JRIA 4C92F 4M7DC 2RM4A 2EJGA 1BIAA 3V8JA 3SWNA 5GAN7 1WQWA 3BY7A 4XU3A 3RKXA 5GAOm 3JB9F 3V7SA 3FIFA 3BFMA 5GAOq 3RESA 2DJZA 2YHTA 5I21A 3JB9J 4C92B 3JCMh 5LJ5g 4HA8A 3RUXA 5GAMd 5GAN3 5GMKh 4A54A 3VU3C 4C8QB 1B34A 1BIBA 3EFRA 4A53A 5GAN4 1B34B 1D3BB 1JBMA 3JCMW 2FB7A 3L1AA 5GAMj 4PJOD 1I4K1 4EMHA 4F7UF 4QVCA 3JCMQ 2RB6A 1LJOA 3QO3A 4M78C 4C8QF 4M7AG 4M77A 3QSUA 4C8QE 3RKWA 1I81A 5GMKi 3JB9G 4XQ3A 1YCYA 4M77D 4QVDA 4C92E 4XTWA 1U1SA 4X9CA 4J6XA 4M75D 4C8QG 4EMKB 2CGHA 3JCMX 4OP0A 4XTZA 4M7DE 4C92A 3M4GA 2EJ9A 4X9DA 4WF2A 5LJ5f 4M7AD 4M78B 2E64A 1TH7A 4M75B 4MMLA 3JCMc 2DVEA 4F7UB 5GAMe 5GMKl 3QUIA 3JCMe 3RERA 4PJOB 4HT8A 4PNOA 4PJOA 3JCMP 4M7DG 3EFSA 4M75A 1WPYA 2VXFA 3JB9D 4JRKA 4M77G 5GAOp 1WQ7A 3JCMJ 2E1HA 1LNXA 5GANe 2Y90A 5GMKj 4M75G 3JB9I 3RKYA 4V2SA 2E41A 2DTIA 1N9SA 2JN0A 4PJOG 4EMKC 2RA2A 5GMKe 2RD1A 5GANh 2VC8A 2EAYA 5LJ3d 5LJ5d 1JRIA 5GAMg 4M7DB 3QHSA 2DKGA 4C8QC 5LJ3g 2DXUA 4C92D 5GAOr 3V7RA 3JCMV 2YLCA 4JUVA 1KQ1A 4N0AA 2EJFA 5GAN6 4C8QD 4XTXA 4XU0A 3V7CA 4M77C 3BDUA 4M77B
chains in the Genus database with same CATH superfamily
2JOYA 1D0ZA 1VQLT 2QK0A 1NZ9A 2CP7A 3JCMd 3L2RA 1AZGB 3CCJQ 3KXTA 1YJNQ 2KYMA 4OB2B 1VQPQ 2QQSA 2BUDA 2ZAEA 5IXFA 4J9FA 2P4TA 5GANj 2B86A 2JJ9A 2KROA 3CCSA 4C5IA 2X9HA 1WXBA 3FB9A 2DL5A 3AT1B 2KXCA 3QYGB 1YJWT 2J05A 2DD4A 4M7DA 3QBYA 1KQSP 4N0AC 4PJMA 1BU1A 3OYMA 3CD6T 2R5MA 2KRSA 1K8AC 3GF5A 4RTZA 1Y96B 3JV3A 4M78D 1SG5A 3VS3A 4DOVA 4ME7A 1M8MA 2ABLA 4PJOF 3CBOA 4PJOE 1W70A 2KRMA 3JCMg 2L8DA 3A1PA 3CCET 1I8FA 5AT1B 2RM4A 1VQOT 2X4YA 1VQMT 4KBMB 7AT1B 3O8VA 5FU6B 4MDXA 4AFSC 2M0OA 1UHFA 1JO8A 3URGA 5FLXE 3NPFA 1KIKA 3E1SA 4C0ZA 4EMHA 2RB6A 1DJ7B 2CH4A 3QSUA 5HY6A 5GMKi 1JQQA 1C0MA 5IN1A 2EYWA 2FRWA 3NTKA 2DL7A 3G4SQ 2KGTA 2LCCA 2RN8A 2QA4T 3H41A 1GRIA 4BE0A 4M78B 3DLLA 3CXCP 4RTXA 5EG2A 3PMIA 2RQTA 2XMFA 4QKUA 2AKLA 3PIOA 1WHLA 1NYFA 2DRKA 1T0JA 1VQ8T 1WQ7A 3JCMJ 5GANe 1VQ7T 2O88A 3M0UA 1N9SA 2JN0A 2RK2A 3EG0A 1M2OA 2MCNA 3QYHB 1QVGP 4QQDA 5FWBA 1M3CA 2DAQA 1UUEA 4DQ2A 5DLQE 5KYNA 4AMCA 3GIBA 4R55A 2BKDN 1WDXA 1ZSGA 2RHUA 5GANf 4FT2A 3EG9B 4DA4A 3SWNC 1W6XA 5GANd 1PSFA 2K3YA 2VGMA 4OGEA 1ZX6A 4DEYA 2XDBA 4LN2A 2HNIA 3NFCA 4JJNK 3QKJA 1F1BB 2LCLA 1VUBA 1NYGA 1K1ZA 1M90R 3G1JA 2K5FA 3AHUA 5HK0A 4LUDA 3CC7A 1WI7A 2GFAA 1MMNA 1M30A 2EVRA 3OYFA 5L8RE 1KHCA 3REAB 1D0XA 1GCQC 2GQIA 2EQUA 4UC4A 1Q81U 4C5GA 1X2QA 2XDDA 1WHJA 2QI2A 3MP8A 1B34A 1X43A 3LYIA 1VYUA 1K4US 1WHKA 4QQGA 1NJIC 1YCYA 4LUEA 4X9CA 2PUKB 4M75D 4N4GA 3OS0A 1X27A 1G8XA 3UA6A 2FEIA 1BYMA 1VQ6T 3BDLA 2C06A 2NUTB 1IHVA 2P0QA 1TH7A 2DK3A 3HHTB 3H9NA 3QXEB 5FU7B 2PQWA 4M7DG 4M77G 1QCNA 2L89A 2EFIA 2DXCA 2VC8A 5GAMg 4M7DB 3RR6A 4ZTFA 3N5BB 1GXIE 4C92D 1NJIR 1UB4A 3OYBA 5KE3A 2EGAA 3UPUA 4MMKA 2LQKA 1CKAA 3A98A 2MWOA 2BZXA 5FRMA 3EG9A 5CVIA 3EGXB 1PRMC 2XHCA 1ZA2B 3I56A 3CCJA 4FL6A 2W0ZA 2X3XD 2DD5A 2EQJA 3CC4T 3INZA 3CCEA 2DL3A 3P8HA 4XTVA 2K2MA 4X34A 2D0QB 1K73U 1QCFA 4FM4B 2QDYB 2YUQA 2ZPHB 3OW2P 1NPRA 2LJ3A 2C0OA 2OAWA 1JJ2P 2E10A 4M78F 5IAYA 1M27C 2V1QA 1VQ6A 3E19A 1WJSA 3X25B 1Q81C 3KBGA 3HRUA 3JB9J 3CCUQ 4C8QB 1IB8A 4BI4A 2RI5A 3NTHA 3OYHA 2KQWA 4BI3A 2EGEA 1I81A 2L3SA 2K5LA 4FW1A 2HL3A 1VQ7Q 4ATOA 5CKBA 3P8DA 2NLUA 2COYA 2QEXQ 4PNOA 2DO3A 2JZ2A 3JB9D 3EG2A 2HSPA 1AOJA 4M75G 5GJVB 4TVRA 5GMKe 3OYDA 1XNIA 3MP6A 3G4ST 5CR2A 2G6FX 3EGDA 2DKGA 2AZVA 4N0AA 5GAN6 4IKFA 4FSXA 2HKQB 1TG0A 5FWCA 1NLOC 2YUOA 6AT1B 3QDFA 3VS4A 1G3SA 4PFZA 4HT9A 2DZCA 3L42A 3OYCA 4XU1A 1V76A 1BCOA 1X2KA 1OI1A 2ESWA 1BBZA 2LC4A 1YJNA 1WGSA 1M2VA 3I5RA 1AWJA 3PT9A 1NEGA 4C8QA 3R6OA 1X6GA 2RMOA 4JZ4A 1KC8R 3HSBA 5CIUA 1K73C 1SHFA 5GANg 4RTTA 3A5ZB 2ZZDA 4F7UA 3PTAA 1CKBA 1TS9A 2RNAA 1KD1U 4F7UE 4BUGA 2ZPBB 1VIFA 2AZSA 2XK0A 1QVFP 2RQWA 4LDXA 2PVOB 3BY7A 1I5OB 3FIFA 1YJNT 2EYQA 4Y28E 4CI0C 1HYOA 3CCJT 3CCST 3GP8A 2E6NA 1J3TA 2KDSA 1VQLQ 2MI6A 3MPUB 3OMCA 4XK8E 2WSFE 1EX4A 1KQSS 1BB9A 3D7SB 1JU5C 1Z9QA 4XTWA 1K9MU 3PE0A 1Y07A 1T3SA 5DM7R 2EJ9A 4E47A 5C6SA 4MDWA 1QLYA 2X35A 5D6XA 1E6HA 3DLMA 2QQRA 4L59A 1OPKA 1U06A 1M9SA 2VXFA 2VWFA 2PU9B 2HDAA 2PUOB 3OYGA 2EAYA 3CMAA 1PM3A 4C5HA 2H3EB 1YITT 3HTRA 4KGVB 5KYXA 2QYZA 1I07A 4KH1B 3PFSA 1XOVA 3VYHB 2DL8A 4E7ZA 3KFVA 3EG1A 4AT1B 1FMWA 4RTWA 2E5QA 1OOTA 3UDCA 4RTUA 3PGGA 2I2LA 3CMEQ 1UDLA 1K9MC 2CZ1B 3G71T 2L0AA 1N27A 2EYXA 3OSVA 3FEOA 2HBWA 3HP9A 4E7LA 1QP2A 2F2VA 1M1KC 3M53A 1G83A 3RIRA 2ZCFB 4IIOA 3JCMf 2FG0A 1N9RA 1GCPA 2O4XB 4M77F 3RNJA 1X01A 2AKKA 4JS4A 2GBQA 2EJGA 2RHIA 2F5KA 3GNGA 3UWNA 2E70A 1VQKT 2YHTA 3C12A 1UJ0A 3PNWC 2E4HA 2DILA 3I56Q 1Y0MA 1WYXA 2RJFA 2GFUA 4M78C 3RDVA 4C8QE 3JB9G 5IT9E 2EQMA 4J6XA 3M59A 2V8KA 3JCMX 3MHXA 5CO7A 3M0SA 2DBMA 2A0FB 1HJDA 1W2BP 4OB1B 2QGFB 1VQ4A 1ZUYA 3M0PA 4OF1A 2FZKB 1Y57A 5FU6C 3OYEA 3M54A 3QHSA 2DRMA 4C0GA 1M1KR 4M77B 3EH1A 2HEQA 1OZ3A 2DJQA 4J5YA 4ZNXA 1YJWA 1GFCA 1YHQA 1D3BA 4RTVA 3PVQA 4EMKA 2HMAA 5CKDA 3H0HA 3EG3A 1R0BG 2ECZA 1U8RA 2E65A 5J26A 3F70A 2JTEA 5HKCA 4CC4B 2DERA 2VVKA 2O01E 2LJ1A 4A4FA 1QVFS 1VQKQ 2A3LA 1Z9ZA 2HQXA 4PJOC 4BY6C 4EMGA 2DTOA 2CP2A 1MGQA 2RO0A 1TXQA 2HQHA 1JEGA 2O4XA 1G2BA 2LT4A 4HCZA 4LDUA 3REBB 4J7IA 1OPLA 3TU4K 5LJ3h 4M7AD 1W1FA 4X1VA 5GAN5 1YI2T 1BI2A 1MUZA 2DNUA 1RI9A 2RPNA 1TSFA 1TUDA 3PIPA 3JCMh 4A54A 1UG1A 2SRCA 1IGUA 2IPOB 2XDPA 1H3ZA 1VQLA 2EW3A 3FJ5A 4F04B 4OP0A 1G3YA 1NE8A 3OY9A 2K3XA 4K11A 1PHTA 4Z02A 2DBKA 1NM7A 4C0DB 4GY5A 1VQ8A 2RQUA 4NS5A 3X28B 3OS1A 4JRKA 5GAOp 2DETA 2K3BA 4LD6A 4DOWA 4PJOG 1K76A 1PNJA 2CKKA 4C8QC 1VQNT 2G3RA 2K79A 3JCMV 1KQ1A 3OW2A 4L6V5 3MEVA 2M51A 1PSEA 4OMQA 2JW4A 1HSQA 5CCAA 2ED1A 1YI2Q 3G6EQ 3I55T 5LJ5e 2X3WD 4ZGJB 1OX8A 4FCYA 3IQLA 2CH4W 3G6EA 1Y71A 1EIFA 1R77A 3CCSQ 2DYBA 2ZGWA 4RG2A 3VS6A 4QT7A 1T3LA 1GL5A 3LGLA 2L3QA 5D7UA 3OYKA 1KQ2A 1ABOA 2FO0A 2GF7A 1M8VA 1X6BA 2H3JA 3V8LA 4R0KA 2GCXA 1VYTA 2LMJA 1Q81R 3JB9H 2DZ9A 3A8GB 4XU2A 2EQIA 3A8HB 1FMKA 3OS5A 2J7IA 2MK5A 4KGZB 4BY6B 5GAMd 3VJPA 5GMKh 3L2WA 4DBHA 3VRZA 2VASA 3HKSA 3FDRA 3CCMQ 2FB7A 5KYWB 2NUPB 2DM1A 2DXBA 2LQ8A 2XIDA 1TTHB 4D6WA 2K6DA 3MEUA 2YT6A 1X6OA 1QVGA 2LDMA 4LXCA 2HQEA 2YUNA 3S6WA 1RAGB 2HBPA 1SSHA 1ZA1B 4MMLA 3G4SA 1C6VX 4HT8A 2BIVA 2JMAA 3HPWA 1VQ4T 3LW5E 1WHMA 2DFUA 1M1KU 1UFFA 2RI2A 2CSQA 1BKBA 2CT3A 3GLXA 3CBMA 4PFPA 3QZ9B 1PG5B 2DXUA 1W2BA 2RHZA 1ZSZB 3V7RA 4ZN1A 1YFNA 2V26A 2EJFA 2EYYA 3JAME 2QEXT 4M7AB 2Y4YA 1OU8A 4OMNA 1UGSB 2YXYA 4JJCA 2BTTA 3I56T 4M7DD 3CCVT 2DIQA 5GAMh 3J7AF 1XJWB 4PKCC 2JVVA 3LLRA 4RUGA 3FC3A 2BZYA 5LJ3j 1N8RR 3OSSC 3EHRA 1WLPB 1UTIA 5KYUA 2DLPA 2E12A 3OQ5A 3VRYA 1VQOA 4OMOA 1VQMA 5KYYA 5C0MA 1K73R 1H3HA 4N4IA 1OU9A 2RJEA 1YJ9T 1K8AU 4EIKA 3ULRB 4JLIA 2A36A 3HFOA 4XTYA 3QWYA 2OTJT 1ZHIA 2WSCE 3OB9A 3HFNA 3EFOA 2D9TA 1PKTA 5GAN8 4M78E 2OTLA 3M9QA 1AD5A 2WSEE 1MHNA 1BIAA 4ZGEB 2CP3A 4OMLA 3CMET 4QVZA 2PZ1A 4A4HA 2YRVA 2FHDA 4A53A 2W10A 4J8OA 2QGGA 3EGXA 1FMVA 2C0TA 3CXCA 2COWA 4QVDA 1GCQA 4OMFB 1YITQ 3I9QA 1QKXA 2QG9B 1GBRA 1YI2A 5A2QE 1TWBA 5I22A 3J81E 2IVWA 2FRYA 2LNVA 3RERA 3OA6A 1H8KA 1QVGS 1N6AA 2M9UA 4PJOA 2ROLA 3T9NA 1AHJB 2FPEA 2COZA 3BE3A 2X4JA 1LNXA 2E5KA 2Y90A 4JS5A 1B07A 3M57A 3M5AA 2QASA 4R56A 1SEMA 4J9HA 2HL5C 3GNFB 2P0PA 5ECAA 1VOMA 4AG1C 4CRIA 1LPLA 3CCLT 4XTXA 3EAEA 2HSEB 2J6KA 1IREB 1VQ6Q 2FPDA 5KYYB 1M90C 5CQXA 4O6JA 2OJ2A 4M77E 1QVFA 3A8MB 3H8ZA 2ZPEB 5KE2A 4RCBA 2B8AA 1OX9A 4KGXB 4IUVA 2JM9A 3R6NA 1OYXA 1U1TA 2FZCB 1TUCA 4FU6A 4C92C 1KHIA 1VQ7A 3CMAT 3BW1A 1HXDA 2MYSA 4PJJA 2AT1B 3EGDB 4M75E 3SD4A 1BCMA 4Y91A 1G3TA 5GMKm 5CKHA 5DY9A 2A08A 2KEAA 5DLOA 2PNIA 3LH5A 3OBYA 1OULA 3M0QA 1M2VB 2V8IA 4A4KA 3VUBA 3OYLA 2BE9B 2LTOA 3RKXA 2CZ6B 3I55A 1YP5A 1M3AA 5GAOq 1SHGA 3RUXA 2P0KA 4HKEA 1NG2A 4J9GA 4FYYB 3JCMW 5FROA 5IHKA 3TQ7P 2R58A 1V29B 3TCJA 4IURA 2K5IA 4J83A 3WXMB 2L2PA 2PVGB 3HRTA 1K9MR 2YRCA 3CXCS 4M75B 2M02A 5GMKl 1SPKA 2NUZA 1QCOA 3TSZA 2D1XA 4Z89A 3JCMP 2L3PA 4ZTJA 3JB9I 1SSFA 2DE0X 1FWZA 1YJ9A 4JZ3A 1QWFA 2D8HA 2KK4A 1VQ8Q 2XD0A 2YSQA 4J9DA 1YN8A 3C95A 4Z88A 4C5EA 3SDZA 3QJYA 3S3MA 4C8QD 2LRQA 4RTYA 1Q95G 3CCQA 1VQ5A 3UF4A 1QVPA 2CP6A 2ENMA 4KRTA 1WIEA 2CYZB 2QQ9A 3CCUT 1PCXA 3EGUA 1BK2A 2JS0A 2D0NA 5GAOl 3CC2T 3CCVA 1IO6A 4OGCA 2CUBA 4M7AF 4Y92A 4O5VA 2XICA 3CCLA 1UECA 1OV3A 5GAMf 2R5AA 3H6ZA 2LZ6B 1O75A 1VQMQ 1VQOQ 4A63B 3MP1A 4HVUA 3CCEQ 3QDRB 4OMMA 3H0FA 1JXMA 4E2FB 1AT1B 1WNLA 3SB2A 2CZ7B 4B6MA 2QQAA 2NUTA 2QTVA 5GAOm 3CMAQ 2MIOA 1G5VA 3THKA 3QJ6A 2FZGB 5GAN4 3C0CA 3C4SA 1JBMA 1SRMA 3CCUA 1YJWQ 1S1NA 1LJOA 2WACA 4C8QF 3LX7A 3M56A 1VQPT 4FYWB 1RL2A 2LQWA 3NGPA 2HAXA 3VYGA 3CCQT 1VQ5T 3M0RA 3FLGA 4PJLA 4PJNA 2RHYA 4XAXB 2K2VA 2DVEA 1RAFB 1ARKA 3CCLQ 2DVJA 2OTJA 1IGQA 3CCQQ 1VQ5Q 3WVDB 4FSSA 3O5ZA 1W4SA 3PVLA 2D8JA 2YWWA 2MOXA 4XU0A 3V7CA 3ER0A 4ZGDB 1IXDA 2JTFA 1EZZB 2ATCB 4PK4A 1A0NB 1VQ9A 1AVZC 4RG8A 1VQ9Q 2F69A 2KNBB 3LWHA 2EBPA 1I5LA 2CT4A 3H0IA 2RHXA 1ACMB 2OAUA 4HVVA 4BD3A 3M55A 3ME9A 4OB0B 2RQRA 4BDZA 1TOVA 3ZFJA 2EGCA 1QP3A 9ATCB 2F2WA 3ZEHA 2Z0WA 2KYBA 1NPPA 5HCKA 1UGRB 4GBQA 1KFZA 3MO8A 3CC2Q 3OS2A 1RAHB 3JB9F 2JS2A 1R0CB 1T0HA 1YJ9Q 5I21A 2OTLQ 2RJCA 5GAN3 1C1AA 4HA8A 2OI3A 2QDLA 1D3BB 1Q86U 5KYUB 1ZQ1A 2I0NA 2C0IA 4M7AG 4M77A 4XQ3A 3WVEB 1NJIU 2A37A 1UGQB 2LT1A 1MNDA 1RAAB 3CCVQ 2MF2A 1KG1A 2ED0A 4QQ6A 2K7AA 2PTKA 2GTOA 1QWEA 2FVUA 1X69A 2A7YA 2O31A 4JJBA 1UHCA 4EPCA 4M75A 2M16A 1M1GA 4DBRA 2QA4Q 1S72T 4EDUA 4E6RA 4FIBA 2RA2A 2RD1A 2HZYA 2EKHA 3C94A 3CQTA 1VQ4Q 3META 2YLCA 4Z8AA 4PFOA 4M7AC 5I2SA 4M75C 2JTMA 2CP5A 1E6GA 2JMCA 1ZUUA 3CCRT 4HXJA 1KQSA 1KK7A 2KVQG 5LJ3f 1NLPC 2DXTA 4DBQA 1KSWA 4NL3A 2V8JA 4FW2A 4F7UG 4BB7A 2KI7A 1XQHA 3GOXA 4DEXA 3CCMA 2DX1A 4E7IA 1RLQC 1PD0A 2DTHA 1WHHA 2CS7A 5CAIA 4HCBA 4KULA 4ANJA 1WJRA 4E7KA 1Q82U 2DA9A 3CD6Q 4MZPA 1Q7YU 4NL2A 3I35A 1V1CA 1PKSA 3QWXX 1KD1C 1M5Q1 1RI0A 2L5QA 4JRIA 4M7DC 2NWMA 1SKUB 1VQPA 1N5ZA 1NBEB 2DJZA 5J39A 4C92B 1UGPB 4CC3A 1Q86C 5CQYA 5A0LA 3VKIA 4FYVB 2O2OA 1I0CA 1U3OA 5FU7C 5AYFA 3X24B 3I55Q 1G3WA 1FYNA 2VB6A 1ZLMA 4F14A 2O9VA 4C8QG 3MEAA 2CGHA 2NYSA 3CEYA 1BI1A 2KBTA 4WCIA 1HD3A 3M4GA 1FXXA 1YITA 4WF2A 4E7SA 2JXBA 3OMGA 2E64A 4KH0B 5IHIA 3CPWP 2KT1A 1RACB 3EFOB 1YBYA 3HL8A 2E6ZA 4LD9K 4KUIA 5FRNA 1Q86R 3RKYA 3E2UA 3VS2A 2E41A 3VUZA 5IXBA 5LJ3d 1YWOA 2EYZA 1U5SA 3L2QA 1D1BA 5GAOr 1Y7XA 1KC8U 1WA7A 2IIMA 1YIJT 4C0DC 3CPWS 3MKDA 4HCKA 1EFNA 3JCMb 2RI3A 2XG8D 3CC2A 4QW2A 2ZPIB 2QTXA 5M9OA 1QKWA 1RUWA 4D8KA 3U23A 8ATCB 2CSIA 1RADB 2E3HA 4E7JA 1SRLA 2LX9A 5I2MA 1YHQT 4M7AE 3VS5A 2YUPA 4ESRA 4PL6A 5EC7A 2MAMA 1YIJA 4WTOB 1W2BS 2OTJQ 1LOJA 2DIGA 2LQNA 4J6YA 4M7AA 2KE9A 3SWNB 1Q82C 1ZBJA 3LH0A 1K9AA 2OX7A 1HK9A 2DPPB 4KT0E 3M0TA 5GAN2 1MMAA 5D6WA 2EWNA 2KR3A 3MJXA 3QIIA 1WXTA 1GFDA 1E7OA 4RCCA 1ZSZC 4J6WA 2QAZA 2XKOC 5GAN7 3V8JA 4N4HA 3VS1A 5IHNA 3V7SA 4OB3B 3P8BB 3RESA 5LJ5g 3OBWA 3JSCA 5FW9A 5CKFA 3EHQA 3OYNA 1B34B 2H8HA 2Y4XA 5GAMj 1I4K1 3NTIA 4F7UF 4QVCA 3JCMQ 3QPHA 1Q82R 3RKWA 2NUPA 4J9BA 3CMEA 1PD1A 2RF0A 2FPFA 4EMKB 1VQKA 1LVKA 2EPDA 5GJWB 4XTZA 4M7DE 3ZBDA 2ROTA 3CC7Q 5CK9A 2YRDA 2QXFA 3VS7A 2AHJB 3JCMc 5LL6S 4C0FA 2X51A 2VUBA 2RJDA 2AIRB 2LX7A 2JNGA 5GMKj 1RAIB 2DTIA 3DB3A 3I5SA 4F16A 2VKNA 3SEMA 4B9XA 2BE7D 4BE2A 4E7HA 1XTDA 4M77C 3EH2A 3QZ5B 1AWXA 3CCMT 1M90U 3QG1A 4PLLA 3G71A 2CDTA 1SF9A 3V8KA 1D09B 1GBQA 3TREA 2JUFA 2YLBA 3MCAB 3FJPA 1WHGA 2JM8A 4AFUC 3RBBB 1UGVA 4IUQA 2CP0A 1ABQA 3RMSA 4IIMA 4M75F 1RLPC 4BI8B 3S3OA 2QEXA 1YCSB 4HVWA 2E3IA 1D0YA 2F2XA 4Q5WA 2MPXC 5LJ3e 4M7DF 1Q7YR 2VXEA 1WXUA 2KT8A 1Q7YC 3DKMA 2P4RA 2D6FA 4M78A 3M4YA 3L2ZA 1M4ZA 5LJ5h 1H641 8AT1B 1Y96A 3G6ET 2FYKA 5A0GA 2M1HA 4XTUA 3OW2S 2YDLA 1OZ2A 3SWNA 2DEUA 2ZPGB 1VIEA 2KMTA 4XU3A 4OMPA 5A0DA 2F5TX 2VYTA 2P84A 2CREA 3EFRA 4M4ZA 4PJOD 3FRNA 1YHQQ 3PMTA 1IZ6A 3G71Q 1VQNQ 4AG2C 4VUBA 4BE1A 2VGNA 5CKEA 3X26B 1UEBA 4CC7A 4X9DA 1X75C 4JRPA 1D1CA 2CUDA 1YWPA 1YIJQ 3RMQA 3QUIA 3VV0A 1D1AA 2X4WA 3CBPA 1MNEA 3GPLA 2K9GA 4ELZC 5L23A 4II1A 1WZOA 3E9GA 3ZL7C 1OEBA 2J06A 3OYAA 2LNHB 3TEEA 2DYIA 1BI0A 3NHNA 2L3RA 4KUDK 4OVAA 4YTLA 1JJ2S 1B3QA 1B7TA 2SEMA 4J9CA 5IH2A 4FT4A 3OYJA 1KJWA 1KC8C 2IG0A 4RKUE 4FYXB 4J7FA 2FL7A 1IHWA 4A4EA 4AFQC 1AEYA 3TSWA 1TU0B 3L2VA 4LDVA 1VA7A 3CCRA 2KXDA 3OYYA 1FX7A 1PRLC 5HK3A 2DEQA 2M0YA 5KYXB 1UJYA 1YNZA 1K0SA 2PVDB 2GQVA 2J6OA 4MZTA 4NOYA 1JXOA 4GLMA 3S3NA 3UATA 2ZPFB 2K57A 2KRNA 4J9EA 2AK5A 4A4GA 4LDWA 2DL4A 1AWOA 4BDYA 2RQVA 4C92F 4MZMA 1JB0E 3MEWA 5D6YA 3BFMA 3SHWA 2A28A 3JRZA 3A8LB 3VU3C 1H92A 1BIBA 1UE9A 1WX6A 1MV3A 3L1AA 4PLIA 1WFWA 5KH6A 3LGFA 1WJQA 2EQKA 1U1SA 1O9SA 3TVTA 4JJDA 4CC2A 2RH2A 3CCRQ 4D8DA 1NEBA 5LJ5f 2LJ0A 5J3BA 3DB4A 4F7UB 3G7ZA 1QW1A 1PC0A 2DMOA 2GNCA 2J6FA 1S72A 3CC7T 2E1HA 1IRXA 3L2UA 4JDSA 4EMKC 2F1LA 5GANh 1S72Q 1JRIA 2QA4A 1RAEB 4JRQA 2GTJA 4JUVA 3NMZC 2MMPA 2VV5A 2DF6A 4IUUA 1MMDA 2HKNA 5I11A 1N8RU 4IUTA 1QMCA 1ZUKA 1K0XA 1RABB 1ZBXA 3VS0A 1KD1R 1OQKA 4RMOA 2GGRA 2EIFA 4F17A 4M78G 4LNPA 4C92G 5KYWA 5KCOA 4B9WA 1ZSZA 1MV0B 2RK1A 1M1FA 1VQNA 2HCKA 2KSSA 4AFZC 3J80E 5KCHA 1JJ2A 1BI3A 2OTLT 3ASKA 4HCCA 3GBQA 1VYVA 1PWTA 2KY9A 2XI9A 2R57A 1I1JA 3UA7A 2BZ8A 5GAOn 1LCKA 3OYIA 2X4XA 3LWIA 5LJ5j 3CPFA 4P5NA 3CC4A 3CPWA 4IUPA 1WQWA 3E9FA 2O9SA 3CC4Q 3A8OB 1AWWA 1QQJA 4LE9A 2LP5A 1TUGB 2HD0A 2KAFA 1M3BA 3QO3A 4ORZA 3M58A 4GLKA 1MMGA 4M77D 4C92E 3SFMA 1VQ9T 2EKOA 4L5GA 3Q1JA 3X20B 3UT1A 4C92A 2XU8A 2CZ0B 1P92A 1R8OB 2QQBA 4JLGA 1CSKA 5GAMe 3JCMe 2V1RA 4LDYA 2LVMA 4J9IA 4PJOB 2K4YA 3EFSA 1AZEA 4ELYC 1WPYA 2LCSA 4ZN3A 2JT4A 4V2SA 3HRSA 3CD6A 5LJ5d 5LJ3g 4DBFA 3KUFA 1K8AR 2MWPA 3BDUA 4BACA 4JPBW 1N8RC
chains in the Genus database with same CATH topology
2JOYA 1IREB 2E5QA 1VQLT 3UDCA 1M90C 3JCMb 1NZ9A 3JCMd 2RI3A 2I2LA 2XG8D 3PGGA 5CQXA 3L2RA 4QW2A 2ZPIB 3CC2A 2QTXA 5M9OA 3KXTA 4O6JA 4OB2B 1K9MC 2QQSA 4M77E 1QVFA 2BUDA 2P4TA 5GANj 2CZ1B 3A8MB 4E7JA 3CCSA 3H8ZA 3FB9A 2LX9A 4C5IA 2ZPEB 3G71T 5I2MA 4RCBA 5KE2A 2B8AA 1YHQT 1N27A 3QYGB 1YJWT 4M7AE 2DD4A 3OSVA 4IUVA 4M7DA 3FEOA 3QBYA 4PL6A 1OYXA 1U1TA 2MAMA 1YIJA 4N0AC 1W2BS 1LOJA 2DIGA 3HP9A 4FU6A 4J6YA 2R5MA 3OYMA 3CD6T 4M7AA 3SWNB 4C92C 4E7LA 1KHIA 1QP2A 1VQ7A 3CMAT 1Q82C 3BW1A 1K8AC 1HXDA 3GF5A 3LH0A 1M1KC 4M75E 3M53A 1Y96B 1HK9A 2DPPB 4KT0E 5GAN2 3SD4A 4M78D 3RIRA 2ZCFB 4Y91A 5D6WA 2EWNA 4ME7A 4DOVA 1G3TA 1VQOT 4PJOF 3QIIA 5GMKm 3JCMf 5CKHA 3CBOA 1N9RA 4PJOE 2O4XB 4M77F 5DY9A 3JCMg 2L8DA 5DLOA 3OBYA 4RCCA 1X01A 4J6WA 2XKOC 2V8IA 4A4KA 3CCET 3VUBA 3OYLA 4JS4A 1I8FA 2RM4A 2EJGA 2X4YA 2LTOA 2RHIA 2F5KA 3GNGA 4N4HA 3RKXA 3V8JA 3UWNA 2CZ6B 3I55A 4KBMB 3V7SA 4OB3B 3P8BB 2E70A 3O8VA 5FU6B 3RESA 5GAOq 2YHTA 3C12A 2M0OA 1VQKT 4MDXA 3PNWC 3OBWA 3RUXA 5LJ5g 2P0KA 3JSCA 4HKEA 3URGA 5FLXE 5CKFA 3OYNA 3JCMW 1B34B 3E1SA 5FROA 4C0ZA 2Y4XA 5GAMj 1I4K1 3NTIA 4EMHA 4F7UF 4QVCA 3JCMQ 2RJFA 2R58A 2RB6A 1DJ7B 1V29B 2GFUA 3QPHA 4M78C 3TCJA 4C8QE 5HY6A 3RKWA 5GMKi 3JB9G 3QSUA 4IURA 5IN1A 2K5IA 5IT9E 3CMEA 2EQMA 3NTKA 4J83A 4J6XA 3WXMB 4EMKB 2LCCA 1VQKA 3M59A 2V8KA 3JCMX 3MHXA 4XTZA 4M7DE 3ZBDA 5CO7A 2PVGB 2QA4T 3HRTA 4BE0A 5CK9A 4M78B 2QXFA 3DLLA 2AHJB 3CXCS 4M75B 3JCMc 5LL6S 5GMKl 5EG2A 3PMIA 4C0FA 4OB1B 3PIOA 3JCMP 1VQ4A 2VUBA 2RJDA 1VQ8T 1WQ7A 3JCMJ 5GANe 2JNGA 5GMKj 4OF1A 3JB9I 4ZTJA 1SSFA 1VQ7T 5FU6C 1FWZA 2DTIA 1N9SA 2JN0A 2RK2A 3DB3A 1YJ9A 4B9XA 3OYEA 2KK4A 2XD0A 3M54A 3QHSA 4BE2A 3QYHB 3C95A 4C5EA 4C0GA 3SDZA 4E7HA 3QJYA 3S3MA 4C8QD 1XTDA 2LRQA 4QQDA 4M77C 4M77B 3CCQA 1VQ5A 2DAQA 3QZ5B 3CCMT 1M90U 3QG1A 4PLLA 3G71A 4DQ2A 5DLQE 1OZ3A 1QVPA 4J5YA 1YJWA 3GIBA 1YHQA 2CYZB 4R55A 1D3BA 2BKDN 2QQ9A 4EMKA 2RHUA 5GANf 3CCUT 4FT2A 3V8KA 5CKDA 3TREA 1U8RA 2JUFA 2YLBA 3MCAB 3FJPA 4DA4A 3SWNC 2E65A 5GANd 5GAOl 4IUQA 1PSFA 3CC2T 5J26A 2K3YA 3CCVA 2VGMA 3F70A 4OGCA 4OGEA 3RMSA 4M7AF 4M75F 2XICA 4O5VA 5HKCA 3CCLA 4BI8B 3S3OA 2XDBA 2HNIA 5GAMf 2R5AA 3NFCA 2QEXA 3H6ZA 4JJNK 3QKJA 2O01E 4A4FA 4Q5WA 1QVFS 2A3LA 5LJ3e 2HQXA 2LCLA 4PJOC 4M7DF 1VUBA 4BY6C 4EMGA 1O75A 2VXEA 3MP1A 2DTOA 1Q7YC 2K5FA 1MGQA 2RO0A 3DKMA 3QDRB 5HK0A 3AHUA 2D6FA 2O4XA 4M78A 3CC7A 2LT4A 3M4YA 2GFAA 4HCZA 4LDUA 3L2ZA 4J7IA 1M4ZA 5LJ5h 1H641 5LJ3h 3TU4K 4M7AD 3OYFA 1Y96A 5L8RE 1WNLA 1KHCA 5GAN5 3G6ET 1YI2T 2FYKA 5A0GA 1BI2A 2M1HA 4XTUA 2CZ7B 3SB2A 3OW2S 1OZ2A 3SWNA 1VIEA 2KMTA 2QQAA 2ZPGB 4XU3A 5GAOm 2EQUA 4UC4A 5A0DA 1Q81U 4C5GA 3PIPA 2XDDA 3JCMh 1G5VA 2F5TX 3MP8A 2QI2A 2VYTA 3QJ6A 4A54A 1B34A 3EFRA 5GAN4 3C4SA 3LYIA 1JBMA 4PJOD 3CCUA 3FRNA 1LJOA 2WACA 4C8QF 3PMTA 1IZ6A 3LX7A 4QQGA 1NJIC 1YCYA 2XDPA 3M56A 1H3ZA 4X9CA 2PUKB 4M75D 1VQPT 1VQLA 4VUBA 1RL2A 4BE1A 2VGNA 5CKEA 2HAXA 4N4GA 3X26B 4OP0A 3VYGA 3OS0A 1G3YA 1NE8A 3OY9A 3CCQT 2K3XA 1VQ5T 3FLGA 1BYMA 1UEBA 4X9DA 1VQ6T 2RHYA 1X75C 3BDLA 4XAXB 4Z02A 2C06A 4JRPA 2P0QA 1TH7A 2DK3A 3HHTB 2K2VA 2DVEA 3QXEB 4GY5A 5FU7B 3QUIA 3RMQA 3VV0A 4C0DB 1VQ8A 2PQWA 2X4WA 3CBPA 4NS5A 3X28B 3OS1A 4M7DG 4JRKA 1VQMT 4M77G 5GAOp 5A2QE 3GPLA 4ELZC 2L89A 2OTJA 4II1A 3E9GA 4LD6A 2EFIA 4DOWA 3OYAA 4PJOG 3TEEA 2DXCA 1BI0A 3WVDB 2CKKA 2VC8A 2L3RA 5GAMg 4KUDK 4M7DB 4OVAA 4YTLA 4ZTFA 4C8QC 1W4SA 1VQNT 3N5BB 1JJ2S 2G3RA 1GXIE 4C92D 3JCMV 1KQ1A 4FT4A 4XU0A 3OYJA 3V7CA 1UB4A 3OYBA 1KC8C 3ER0A 4ZGDB 4L6V5 3OW2A 2IG0A 2JTFA 4RKUE 5KE3A 3MEVA 1VQ9A 4J7FA 3UPUA 2FL7A 4MMKA 4A4EA 2LQKA 4RG8A 1PSEA 3L2VA 2MWOA 5CCAA 4LDVA 2F69A 3LWHA 3CCRA 5FRMA 5CVIA 3OYYA 1I5LA 2XHCA 3I55T 1FX7A 3I56A 5LJ5e 5HK3A 2DEQA 4ZGJB 3CCJA 4FL6A 2PVDB 2GQVA 2RHXA 4MZTA 5GAN7 2OAUA 4BD3A 3G6EA 1Y71A 4NOYA 1EIFA 3M55A 2DD5A 2EQJA 3CC4T 3INZA 3CCEA 3ME9A 4OB0B 2ZGWA 3P8HA 4RG2A 4XTVA 3S3NA 4BDZA 4X34A 2ZPFB 2D0QB 1K73U 3ZFJA 2K57A 3LGLA 4FM4B 2QDYB 1QP3A 2ZPHB 3ZEHA 4A4GA 1NPRA 4LDWA 3OYKA 1KQ2A 1NPPA 2GF7A 1M8VA 1UGRB 2H3JA 3V8LA 3MO8A 2GCXA 2E10A 4BDYA 4M78F 5IAYA 3OS2A 3JB9H 2DZ9A 3A8GB 4XU2A 4C92F 1VQ6A 3A8HB 3E19A 1WJSA 3OS5A 3X25B 4MZMA 1Q81C 3JB9F 1JB0E 3MEWA 5D6YA 3BFMA 3KBGA 3HRUA 4BY6B 5I21A 3JB9J 2RJCA 5GAMd 5GAN3 4HA8A 3JRZA 3VJPA 5GMKh 3A8LB 4C8QB 3VU3C 4BI4A 3L2WA 1BIBA 2RI5A 3NTHA 3OYHA 2KQWA 1D3BB 3HKSA 3FDRA 1Q86U 4BI3A 2FB7A 3L1AA 4PLIA 5KH6A 3LGFA 1ZQ1A 2DXBA 2LQ8A 2XIDA 1WJQA 4M7AG 4M77A 4D6WA 1I81A 3MEUA 1X6OA 4XQ3A 2EQKA 2LDMA 3WVEB 1QVGA 2K5LA 1U1SA 1NJIU 1O9SA 2HQEA 1UGQB 2LT1A 3S6WA 4ATOA 2MF2A 2RH2A 1KG1A 5CKBA 5LJ5f 4QQ6A 2HBPA 5J3BA 3P8DA 2NLUA 3DB4A 2FVUA 4MMLA 2A7YA 4F7UB 3G7ZA 1QW1A 3G4SA 4HT8A 2BIVA 2DO3A 4PNOA 3HPWA 4EPCA 1VQ4T 2JZ2A 2M16A 1M1GA 4M75A 3JB9D 1S72A 3LW5E 3CC7T 2E1HA 1S72T 4M75G 4EDUA 3L2UA 1M1KU 4FIBA 4TVRA 4JDSA 2RI2A 4EMKC 5GMKe 3OYDA 2RA2A 1BKBA 1XNIA 3MP6A 2RD1A 5GANh 3G4ST 5CR2A 1JRIA 3GLXA 3CBMA 2QA4A 3C94A 2DKGA 3QZ9B 1W2BA 2DXUA 4JRQA 2RHZA 3META 3V7RA 2YLCA 4JUVA 4N0AA 5GAN6 2EJFA 4ZN1A 4IKFA 2MMPA 3JAME 2VV5A 4M7AB 2QEXT 4M7AC 5I2SA 4IUUA 4M75C 2JTMA 4FSXA 2Y4YA 1UGSB 3I56T 3CCRT 1N8RU 4IUTA 4M7DD 3CCVT 1KQSA 2DIQA 5GAMh 3J7AF 1G3SA 2KVQG 5LJ3f 4PKCC 1ZBXA 2JVVA 4HT9A 2DXTA 3LLRA 2DZCA 3L42A 4RMOA 3OYCA 3FC3A 4XU1A 5LJ3j 4NL3A 2EIFA 3OSSC 2V8JA 1OI1A 4M78G 2LC4A 4C92G 4F7UG 1WGSA 4B9WA 4BB7A 5KCOA 1YJNA 1XQHA 2E12A 2RK1A 3PT9A 3GOXA 3OQ5A 1VQMA 1VQOA 3CCMA 4C8QA 1M1FA 3R6OA 5C0MA 4E7IA 1VQNA 2KSSA 3J80E 5KCHA 1JJ2A 1BI3A 2DTHA 4N4IA 2OTLT 3ASKA 2RJEA 1YJ9T 1K8AU 2CS7A 3HSBA 5CIUA 5CAIA 1K73C 4HCCA 5GANg 4JLIA 3HFOA 2KY9A 4XTYA 4HCBA 4KULA 2XI9A 1WJRA 3A5ZB 2ZZDA 4F7UA 4E7KA 3PTAA 1Q82U 2R57A 4MZPA 2OTJT 1ZHIA 5GAOn 1Q7YU 2WSCE 4NL2A 3OYIA 1KD1U 3OB9A 3HFNA 4F7UE 4BUGA 2D9TA 2X4XA 3LWIA 2ZPBB 5LJ5j 1M5Q1 1RI0A 1VIFA 4M78E 5GAN8 1KD1C 2OTLA 2XK0A 3CPFA 3M9QA 4P5NA 3CC4A 2L5QA 2WSEE 2PVOB 4JRIA 3CPWA 1MHNA 4LDXA 1BIAA 4M7DC 4IUPA 4ZGEB 1WQWA 3BY7A 1VQPA 3E9FA 3FIFA 1YJNT 2EYQA 2DJZA 4Y28E 5J39A 4CI0C 3CMET 4C92B 1UGPB 4QVZA 3CCJT 3CCST 4A4HA 3A8OB 3GP8A 1Q86C 2E6NA 5CQYA 5A0LA 3VKIA 2YRVA 2FHDA 2KDSA 4A53A 4J8OA 2MI6A 3OMCA 4XK8E 2HD0A 2WSFE 5FU7C 5AYFA 3X24B 1KQSS 2KAFA 1G3WA 3QO3A 3CXCA 3M58A 4GLKA 4M77D 4QVDA 4C92E 4OMFB 4XTWA 3SFMA 4C8QG 1VQ9T 1K9MU 3MEAA 1Y07A 2CGHA 3CEYA 1BI1A 2EKOA 4L5GA 3Q1JA 5DM7R 3X20B 1YI2A 3UT1A 3M4GA 1FXXA 2XU8A 2CZ0B 1P92A 2EJ9A 4C92A 4E47A 4WF2A 5C6SA 1YITA 4MDWA 1R8OB 3OMGA 2QQBA 2E64A 2X35A 3J81E 4JLGA 2IVWA 2LNVA 5D6XA 5GAMe 3RERA 3JCMe 3OA6A 3DLMA 4LDYA 4PJOB 2LVMA 2QQRA 4L59A 1QVGS 1N6AA 2M9UA 4PJOA 2K4YA 3T9NA 3EFSA 4ELYC 1AHJB 1M9SA 1WPYA 1YBYA 2VXFA 2E6ZA 3HL8A 4LD9K 4KUIA 4ZN3A 2PU9B 2X4JA 1LNXA 5FRNA 2Y90A 4JS5A 3RKYA 4V2SA 2E41A 2PUOB 3VUZA 3M57A 3M5AA 4R56A 3HRSA 3OYGA 3CD6A 2EAYA 5LJ3d 3GNFB 5LJ5d 4C5HA 3CMAA 1YITT 3L2QA 2P0PA 5LJ3g 3KUFA 3PFSA 1XOVA 3VYHB 4CRIA 5GAOr 1Y7XA 1KC8U 3CCLT 2MWPA 4XTXA 3EAEA 1YIJT 3BDUA 4BACA 1N8RC 4C0DC 3CPWS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 C;  4DQ2 A;  4J5Y A;  4M7D D;  3GIB A;  4MMK A;  1D3B A;  3JCM b;  3JCM d;  3PGG A;  2I2L A;  5GAM h;  4EMK A;  5GAN f;  5LJ3 f;  2QTX A;  3V8K A;  4HT9 A;  2DXT A;  2DZC A;  2YLB A;  4M77 E;  4XU1 A;  5LJ3 j;  3FJP A;  4NL3 A;  3SWN C;  2E65 A;  5GAN d;  4M78 G;  5GAN j;  5GAO l;  4M7A B;  1I5L A;  3FB9 A;  4F7U G;  4RCB A;  4C92 G;  4M7A F;  5LJ5 e;  2DEQ A;  4M7A E;  4M75 F;  4M7D A;  4C8Q A;  2HNI A;  5GAM f;  1U1T A;  4N0A C;  4NOY A;  1LOJ A;  2DTH A;  4J6Y A;  4M7A A;  3INZ A;  3SWN B;  5LJ3 e;  4C92 C;  3HSB A;  5CAI A;  2ZGW A;  4M7D F;  4PJO C;  4XTV A;  4EMG A;  4M7A C;  2VXE A;  5GAN g;  3BW1 A;  4JLI A;  3HFO A;  1HXD A;  4M75 E;  4XTY A;  1Y96 B;  1HK9 A;  2DTO A;  2K57 A;  5GAN 2;  1MGQ A;  4M78 D;  3RIR A;  4F7U A;  3AHU A;  4Y91 A;  2EWN A;  4M78 A;  5GAO n;  4NL2 A;  4PJO F;  1KQ2 A;  5GMK m;  3JCM f;  1N9R A;  4PJO E;  5DY9 A;  3HFN A;  4M77 F;  3L2Z A;  4F7U E;  1M8V A;  3V8L A;  3JCM g;  1H64 1;  5LJ3 h;  5LJ5 h;  5GAN 8;  5LJ5 j;  1M5Q 1;  2E10 A;  1Y96 A;  1X01 A;  1WNL A;  4J6W A;  4M78 E;  4M78 F;  4RCC A;  5GAN 5;  2FYK A;  3JB9 H;  2DZ9 A;  4XU2 A;  3SB2 A;  4XTU A;  1I8F A;  4JRI A;  4C92 F;  4M7D C;  2RM4 A;  2EJG A;  1BIA A;  3V8J A;  3SWN A;  5GAN 7;  1WQW A;  3BY7 A;  4XU3 A;  3RKX A;  5GAO m;  3JB9 F;  3V7S A;  3FIF A;  3BFM A;  5GAO q;  3RES A;  2DJZ A;  2YHT A;  5I21 A;  3JB9 J;  4C92 B;  3JCM h;  5LJ5 g;  4HA8 A;  3RUX A;  5GAM d;  5GAN 3;  5GMK h;  4A54 A;  3VU3 C;  4C8Q B;  1B34 A;  1BIB A;  3EFR A;  4A53 A;  5GAN 4;  1B34 B;  1D3B B;  1JBM A;  3JCM W;  2FB7 A;  3L1A A;  5GAM j;  4PJO D;  1I4K 1;  4EMH A;  4F7U F;  4QVC A;  3JCM Q;  2RB6 A;  1LJO A;  3QO3 A;  4M78 C;  4C8Q F;  4M7A G;  4M77 A;  3QSU A;  4C8Q E;  3RKW A;  1I81 A;  5GMK i;  3JB9 G;  4XQ3 A;  1YCY A;  4M77 D;  4QVD A;  4C92 E;  4XTW A;  1U1S A;  4X9C A;  4J6X A;  4M75 D;  4C8Q G;  4EMK B;  2CGH A;  3JCM X;  4OP0 A;  4XTZ A;  4M7D E;  4C92 A;  3M4G A;  2EJ9 A;  4X9D A;  4WF2 A;  5LJ5 f;  4M7A D;  4M78 B;  2E64 A;  1TH7 A;  4M75 B;  4MML A;  3JCM c;  2DVE A;  4F7U B;  5GAM e;  5GMK l;  3QUI A;  3JCM e;  3RER A;  4PJO B;  4HT8 A;  4PNO A;  4PJO A;  3JCM P;  4M7D G;  3EFS A;  4M75 A;  1WPY A;  2VXF A;  3JB9 D;  4JRK A;  4M77 G;  5GAO p;  1WQ7 A;  3JCM J;  2E1H A;  1LNX A;  5GAN e;  2Y90 A;  5GMK j;  4M75 G;  3JB9 I;  3RKY A;  4V2S A;  2E41 A;  2DTI A;  1N9S A;  2JN0 A;  4PJO G;  4EMK C;  2RA2 A;  5GMK e;  2RD1 A;  5GAN h;  2VC8 A;  2EAY A;  5LJ3 d;  5LJ5 d;  1JRI A;  5GAM g;  4M7D B;  3QHS A;  2DKG A;  4C8Q C;  5LJ3 g;  2DXU A;  4C92 D;  5GAO r;  3V7R A;  3JCM V;  2YLC A;  4JUV A;  1KQ1 A;  4N0A A;  2EJF A;  5GAN 6;  4C8Q D;  4XTX A;  4XU0 A;  3V7C A;  4M77 C;  3BDU A;  4M77 B; 
#chains in the Genus database with same CATH topology
 2JOY A;  1D0Z A;  1VQL T;  2QK0 A;  1NZ9 A;  2CP7 A;  3JCM d;  3L2R A;  1AZG B;  3CCJ Q;  3KXT A;  1YJN Q;  2KYM A;  4OB2 B;  1VQP Q;  2QQS A;  2BUD A;  2ZAE A;  5IXF A;  4J9F A;  2P4T A;  5GAN j;  2B86 A;  2JJ9 A;  2KRO A;  3CCS A;  4C5I A;  2X9H A;  1WXB A;  3FB9 A;  2DL5 A;  3AT1 B;  2KXC A;  3QYG B;  1YJW T;  2J05 A;  2DD4 A;  4M7D A;  3QBY A;  1KQS P;  4N0A C;  4PJM A;  1BU1 A;  3OYM A;  3CD6 T;  2R5M A;  2KRS A;  1K8A C;  3GF5 A;  4RTZ A;  1Y96 B;  3JV3 A;  4M78 D;  1SG5 A;  3VS3 A;  4DOV A;  4ME7 A;  1M8M A;  2ABL A;  4PJO F;  3CBO A;  4PJO E;  1W70 A;  2KRM A;  3JCM g;  2L8D A;  3A1P A;  3CCE T;  1I8F A;  5AT1 B;  2RM4 A;  1VQO T;  2X4Y A;  1VQM T;  4KBM B;  7AT1 B;  3O8V A;  5FU6 B;  4MDX A;  4AFS C;  2M0O A;  1UHF A;  1JO8 A;  3URG A;  5FLX E;  3NPF A;  1KIK A;  3E1S A;  4C0Z A;  4EMH A;  2RB6 A;  1DJ7 B;  2CH4 A;  3QSU A;  5HY6 A;  5GMK i;  1JQQ A;  1C0M A;  5IN1 A;  2EYW A;  2FRW A;  3NTK A;  2DL7 A;  3G4S Q;  2KGT A;  2LCC A;  2RN8 A;  2QA4 T;  3H41 A;  1GRI A;  4BE0 A;  4M78 B;  3DLL A;  3CXC P;  4RTX A;  5EG2 A;  3PMI A;  2RQT A;  2XMF A;  4QKU A;  2AKL A;  3PIO A;  1WHL A;  1NYF A;  2DRK A;  1T0J A;  1VQ8 T;  1WQ7 A;  3JCM J;  5GAN e;  1VQ7 T;  2O88 A;  3M0U A;  1N9S A;  2JN0 A;  2RK2 A;  3EG0 A;  1M2O A;  2MCN A;  3QYH B;  1QVG P;  4QQD A;  5FWB A;  1M3C A;  2DAQ A;  1UUE A;  4DQ2 A;  5DLQ E;  5KYN A;  4AMC A;  3GIB A;  4R55 A;  2BKD N;  1WDX A;  1ZSG A;  2RHU A;  5GAN f;  4FT2 A;  3EG9 B;  4DA4 A;  3SWN C;  1W6X A;  5GAN d;  1PSF A;  2K3Y A;  2VGM A;  4OGE A;  1ZX6 A;  4DEY A;  2XDB A;  4LN2 A;  2HNI A;  3NFC A;  4JJN K;  3QKJ A;  1F1B B;  2LCL A;  1VUB A;  1NYG A;  1K1Z A;  1M90 R;  3G1J A;  2K5F A;  3AHU A;  5HK0 A;  4LUD A;  3CC7 A;  1WI7 A;  2GFA A;  1MMN A;  1M30 A;  2EVR A;  3OYF A;  5L8R E;  1KHC A;  3REA B;  1D0X A;  1GCQ C;  2GQI A;  2EQU A;  4UC4 A;  1Q81 U;  4C5G A;  1X2Q A;  2XDD A;  1WHJ A;  2QI2 A;  3MP8 A;  1B34 A;  1X43 A;  3LYI A;  1VYU A;  1K4U S;  1WHK A;  4QQG A;  1NJI C;  1YCY A;  4LUE A;  4X9C A;  2PUK B;  4M75 D;  4N4G A;  3OS0 A;  1X27 A;  1G8X A;  3UA6 A;  2FEI A;  1BYM A;  1VQ6 T;  3BDL A;  2C06 A;  2NUT B;  1IHV A;  2P0Q A;  1TH7 A;  2DK3 A;  3HHT B;  3H9N A;  3QXE B;  5FU7 B;  2PQW A;  4M7D G;  4M77 G;  1QCN A;  2L89 A;  2EFI A;  2DXC A;  2VC8 A;  5GAM g;  4M7D B;  3RR6 A;  4ZTF A;  3N5B B;  1GXI E;  4C92 D;  1NJI R;  1UB4 A;  3OYB A;  5KE3 A;  2EGA A;  3UPU A;  4MMK A;  2LQK A;  1CKA A;  3A98 A;  2MWO A;  2BZX A;  5FRM A;  3EG9 A;  5CVI A;  3EGX B;  1PRM C;  2XHC A;  1ZA2 B;  3I56 A;  3CCJ A;  4FL6 A;  2W0Z A;  2X3X D;  2DD5 A;  2EQJ A;  3CC4 T;  3INZ A;  3CCE A;  2DL3 A;  3P8H A;  4XTV A;  2K2M A;  4X34 A;  2D0Q B;  1K73 U;  1QCF A;  4FM4 B;  2QDY B;  2YUQ A;  2ZPH B;  3OW2 P;  1NPR A;  2LJ3 A;  2C0O A;  2OAW A;  1JJ2 P;  2E10 A;  4M78 F;  5IAY A;  1M27 C;  2V1Q A;  1VQ6 A;  3E19 A;  1WJS A;  3X25 B;  1Q81 C;  3KBG A;  3HRU A;  3JB9 J;  3CCU Q;  4C8Q B;  1IB8 A;  4BI4 A;  2RI5 A;  3NTH A;  3OYH A;  2KQW A;  4BI3 A;  2EGE A;  1I81 A;  2L3S A;  2K5L A;  4FW1 A;  2HL3 A;  1VQ7 Q;  4ATO A;  5CKB A;  3P8D A;  2NLU A;  2COY A;  2QEX Q;  4PNO A;  2DO3 A;  2JZ2 A;  3JB9 D;  3EG2 A;  2HSP A;  1AOJ A;  4M75 G;  5GJV B;  4TVR A;  5GMK e;  3OYD A;  1XNI A;  3MP6 A;  3G4S T;  5CR2 A;  2G6F X;  3EGD A;  2DKG A;  2AZV A;  4N0A A;  5GAN 6;  4IKF A;  4FSX A;  2HKQ B;  1TG0 A;  5FWC A;  1NLO C;  2YUO A;  6AT1 B;  3QDF A;  3VS4 A;  1G3S A;  4PFZ A;  4HT9 A;  2DZC A;  3L42 A;  3OYC A;  4XU1 A;  1V76 A;  1BCO A;  1X2K A;  1OI1 A;  2ESW A;  1BBZ A;  2LC4 A;  1YJN A;  1WGS A;  1M2V A;  3I5R A;  1AWJ A;  3PT9 A;  1NEG A;  4C8Q A;  3R6O A;  1X6G A;  2RMO A;  4JZ4 A;  1KC8 R;  3HSB A;  5CIU A;  1K73 C;  1SHF A;  5GAN g;  4RTT A;  3A5Z B;  2ZZD A;  4F7U A;  3PTA A;  1CKB A;  1TS9 A;  2RNA A;  1KD1 U;  4F7U E;  4BUG A;  2ZPB B;  1VIF A;  2AZS A;  2XK0 A;  1QVF P;  2RQW A;  4LDX A;  2PVO B;  3BY7 A;  1I5O B;  3FIF A;  1YJN T;  2EYQ A;  4Y28 E;  4CI0 C;  1HYO A;  3CCJ T;  3CCS T;  3GP8 A;  2E6N A;  1J3T A;  2KDS A;  1VQL Q;  2MI6 A;  3MPU B;  3OMC A;  4XK8 E;  2WSF E;  1EX4 A;  1KQS S;  1BB9 A;  3D7S B;  1JU5 C;  1Z9Q A;  4XTW A;  1K9M U;  3PE0 A;  1Y07 A;  1T3S A;  5DM7 R;  2EJ9 A;  4E47 A;  5C6S A;  4MDW A;  1QLY A;  2X35 A;  5D6X A;  1E6H A;  3DLM A;  2QQR A;  4L59 A;  1OPK A;  1U06 A;  1M9S A;  2VXF A;  2VWF A;  2PU9 B;  2HDA A;  2PUO B;  3OYG A;  2EAY A;  3CMA A;  1PM3 A;  4C5H A;  2H3E B;  1YIT T;  3HTR A;  4KGV B;  5KYX A;  2QYZ A;  1I07 A;  4KH1 B;  3PFS A;  1XOV A;  3VYH B;  2DL8 A;  4E7Z A;  3KFV A;  3EG1 A;  4AT1 B;  1FMW A;  4RTW A;  2E5Q A;  1OOT A;  3UDC A;  4RTU A;  3PGG A;  2I2L A;  3CME Q;  1UDL A;  1K9M C;  2CZ1 B;  3G71 T;  2L0A A;  1N27 A;  2EYX A;  3OSV A;  3FEO A;  2HBW A;  3HP9 A;  4E7L A;  1QP2 A;  2F2V A;  1M1K C;  3M53 A;  1G83 A;  3RIR A;  2ZCF B;  4IIO A;  3JCM f;  2FG0 A;  1N9R A;  1GCP A;  2O4X B;  4M77 F;  3RNJ A;  1X01 A;  2AKK A;  4JS4 A;  2GBQ A;  2EJG A;  2RHI A;  2F5K A;  3GNG A;  3UWN A;  2E70 A;  1VQK T;  2YHT A;  3C12 A;  1UJ0 A;  3PNW C;  2E4H A;  2DIL A;  3I56 Q;  1Y0M A;  1WYX A;  2RJF A;  2GFU A;  4M78 C;  3RDV A;  4C8Q E;  3JB9 G;  5IT9 E;  2EQM A;  4J6X A;  3M59 A;  2V8K A;  3JCM X;  3MHX A;  5CO7 A;  3M0S A;  2DBM A;  2A0F B;  1HJD A;  1W2B P;  4OB1 B;  2QGF B;  1VQ4 A;  1ZUY A;  3M0P A;  4OF1 A;  2FZK B;  1Y57 A;  5FU6 C;  3OYE A;  3M54 A;  3QHS A;  2DRM A;  4C0G A;  1M1K R;  4M77 B;  3EH1 A;  2HEQ A;  1OZ3 A;  2DJQ A;  4J5Y A;  4ZNX A;  1YJW A;  1GFC A;  1YHQ A;  1D3B A;  4RTV A;  3PVQ A;  4EMK A;  2HMA A;  5CKD A;  3H0H A;  3EG3 A;  1R0B G;  2ECZ A;  1U8R A;  2E65 A;  5J26 A;  3F70 A;  2JTE A;  5HKC A;  4CC4 B;  2DER A;  2VVK A;  2O01 E;  2LJ1 A;  4A4F A;  1QVF S;  1VQK Q;  2A3L A;  1Z9Z A;  2HQX A;  4PJO C;  4BY6 C;  4EMG A;  2DTO A;  2CP2 A;  1MGQ A;  2RO0 A;  1TXQ A;  2HQH A;  1JEG A;  2O4X A;  1G2B A;  2LT4 A;  4HCZ A;  4LDU A;  3REB B;  4J7I A;  1OPL A;  3TU4 K;  5LJ3 h;  4M7A D;  1W1F A;  4X1V A;  5GAN 5;  1YI2 T;  1BI2 A;  1MUZ A;  2DNU A;  1RI9 A;  2RPN A;  1TSF A;  1TUD A;  3PIP A;  3JCM h;  4A54 A;  1UG1 A;  2SRC A;  1IGU A;  2IPO B;  2XDP A;  1H3Z A;  1VQL A;  2EW3 A;  3FJ5 A;  4F04 B;  4OP0 A;  1G3Y A;  1NE8 A;  3OY9 A;  2K3X A;  4K11 A;  1PHT A;  4Z02 A;  2DBK A;  1NM7 A;  4C0D B;  4GY5 A;  1VQ8 A;  2RQU A;  4NS5 A;  3X28 B;  3OS1 A;  4JRK A;  5GAO p;  2DET A;  2K3B A;  4LD6 A;  4DOW A;  4PJO G;  1K76 A;  1PNJ A;  2CKK A;  4C8Q C;  1VQN T;  2G3R A;  2K79 A;  3JCM V;  1KQ1 A;  3OW2 A;  4L6V 5;  3MEV A;  2M51 A;  1PSE A;  4OMQ A;  2JW4 A;  1HSQ A;  5CCA A;  2ED1 A;  1YI2 Q;  3G6E Q;  3I55 T;  5LJ5 e;  2X3W D;  4ZGJ B;  1OX8 A;  4FCY A;  3IQL A;  2CH4 W;  3G6E A;  1Y71 A;  1EIF A;  1R77 A;  3CCS Q;  2DYB A;  2ZGW A;  4RG2 A;  3VS6 A;  4QT7 A;  1T3L A;  1GL5 A;  3LGL A;  2L3Q A;  5D7U A;  3OYK A;  1KQ2 A;  1ABO A;  2FO0 A;  2GF7 A;  1M8V A;  1X6B A;  2H3J A;  3V8L A;  4R0K A;  2GCX A;  1VYT A;  2LMJ A;  1Q81 R;  3JB9 H;  2DZ9 A;  3A8G B;  4XU2 A;  2EQI A;  3A8H B;  1FMK A;  3OS5 A;  2J7I A;  2MK5 A;  4KGZ B;  4BY6 B;  5GAM d;  3VJP A;  5GMK h;  3L2W A;  4DBH A;  3VRZ A;  2VAS A;  3HKS A;  3FDR A;  3CCM Q;  2FB7 A;  5KYW B;  2NUP B;  2DM1 A;  2DXB A;  2LQ8 A;  2XID A;  1TTH B;  4D6W A;  2K6D A;  3MEU A;  2YT6 A;  1X6O A;  1QVG A;  2LDM A;  4LXC A;  2HQE A;  2YUN A;  3S6W A;  1RAG B;  2HBP A;  1SSH A;  1ZA1 B;  4MML A;  3G4S A;  1C6V X;  4HT8 A;  2BIV A;  2JMA A;  3HPW A;  1VQ4 T;  3LW5 E;  1WHM A;  2DFU A;  1M1K U;  1UFF A;  2RI2 A;  2CSQ A;  1BKB A;  2CT3 A;  3GLX A;  3CBM A;  4PFP A;  3QZ9 B;  1PG5 B;  2DXU A;  1W2B A;  2RHZ A;  1ZSZ B;  3V7R A;  4ZN1 A;  1YFN A;  2V26 A;  2EJF A;  2EYY A;  3JAM E;  2QEX T;  4M7A B;  2Y4Y A;  1OU8 A;  4OMN A;  1UGS B;  2YXY A;  4JJC A;  2BTT A;  3I56 T;  4M7D D;  3CCV T;  2DIQ A;  5GAM h;  3J7A F;  1XJW B;  4PKC C;  2JVV A;  3LLR A;  4RUG A;  3FC3 A;  2BZY A;  5LJ3 j;  1N8R R;  3OSS C;  3EHR A;  1WLP B;  1UTI A;  5KYU A;  2DLP A;  2E12 A;  3OQ5 A;  3VRY A;  1VQO A;  4OMO A;  1VQM A;  5KYY A;  5C0M A;  1K73 R;  1H3H A;  4N4I A;  1OU9 A;  2RJE A;  1YJ9 T;  1K8A U;  4EIK A;  3ULR B;  4JLI A;  2A36 A;  3HFO A;  4XTY A;  3QWY A;  2OTJ T;  1ZHI A;  2WSC E;  3OB9 A;  3HFN A;  3EFO A;  2D9T A;  1PKT A;  5GAN 8;  4M78 E;  2OTL A;  3M9Q A;  1AD5 A;  2WSE E;  1MHN A;  1BIA A;  4ZGE B;  2CP3 A;  4OML A;  3CME T;  4QVZ A;  2PZ1 A;  4A4H A;  2YRV A;  2FHD A;  4A53 A;  2W10 A;  4J8O A;  2QGG A;  3EGX A;  1FMV A;  2C0T A;  3CXC A;  2COW A;  4QVD A;  1GCQ A;  4OMF B;  1YIT Q;  3I9Q A;  1QKX A;  2QG9 B;  1GBR A;  1YI2 A;  5A2Q E;  1TWB A;  5I22 A;  3J81 E;  2IVW A;  2FRY A;  2LNV A;  3RER A;  3OA6 A;  1H8K A;  1QVG S;  1N6A A;  2M9U A;  4PJO A;  2ROL A;  3T9N A;  1AHJ B;  2FPE A;  2COZ A;  3BE3 A;  2X4J A;  1LNX A;  2E5K A;  2Y90 A;  4JS5 A;  1B07 A;  3M57 A;  3M5A A;  2QAS A;  4R56 A;  1SEM A;  4J9H A;  2HL5 C;  3GNF B;  2P0P A;  5ECA A;  1VOM A;  4AG1 C;  4CRI A;  1LPL A;  3CCL T;  4XTX A;  3EAE A;  2HSE B;  2J6K A;  1IRE B;  1VQ6 Q;  2FPD A;  5KYY B;  1M90 C;  5CQX A;  4O6J A;  2OJ2 A;  4M77 E;  1QVF A;  3A8M B;  3H8Z A;  2ZPE B;  5KE2 A;  4RCB A;  2B8A A;  1OX9 A;  4KGX B;  4IUV A;  2JM9 A;  3R6N A;  1OYX A;  1U1T A;  2FZC B;  1TUC A;  4FU6 A;  4C92 C;  1KHI A;  1VQ7 A;  3CMA T;  3BW1 A;  1HXD A;  2MYS A;  4PJJ A;  2AT1 B;  3EGD B;  4M75 E;  3SD4 A;  1BCM A;  4Y91 A;  1G3T A;  5GMK m;  5CKH A;  5DY9 A;  2A08 A;  2KEA A;  5DLO A;  2PNI A;  3LH5 A;  3OBY A;  1OUL A;  3M0Q A;  1M2V B;  2V8I A;  4A4K A;  3VUB A;  3OYL A;  2BE9 B;  2LTO A;  3RKX A;  2CZ6 B;  3I55 A;  1YP5 A;  1M3A A;  5GAO q;  1SHG A;  3RUX A;  2P0K A;  4HKE A;  1NG2 A;  4J9G A;  4FYY B;  3JCM W;  5FRO A;  5IHK A;  3TQ7 P;  2R58 A;  1V29 B;  3TCJ A;  4IUR A;  2K5I A;  4J83 A;  3WXM B;  2L2P A;  2PVG B;  3HRT A;  1K9M R;  2YRC A;  3CXC S;  4M75 B;  2M02 A;  5GMK l;  1SPK A;  2NUZ A;  1QCO A;  3TSZ A;  2D1X A;  4Z89 A;  3JCM P;  2L3P A;  4ZTJ A;  3JB9 I;  1SSF A;  2DE0 X;  1FWZ A;  1YJ9 A;  4JZ3 A;  1QWF A;  2D8H A;  2KK4 A;  1VQ8 Q;  2XD0 A;  2YSQ A;  4J9D A;  1YN8 A;  3C95 A;  4Z88 A;  4C5E A;  3SDZ A;  3QJY A;  3S3M A;  4C8Q D;  2LRQ A;  4RTY A;  1Q95 G;  3CCQ A;  1VQ5 A;  3UF4 A;  1QVP A;  2CP6 A;  2ENM A;  4KRT A;  1WIE A;  2CYZ B;  2QQ9 A;  3CCU T;  1PCX A;  3EGU A;  1BK2 A;  2JS0 A;  2D0N A;  5GAO l;  3CC2 T;  3CCV A;  1IO6 A;  4OGC A;  2CUB A;  4M7A F;  4Y92 A;  4O5V A;  2XIC A;  3CCL A;  1UEC A;  1OV3 A;  5GAM f;  2R5A A;  3H6Z A;  2LZ6 B;  1O75 A;  1VQM Q;  1VQO Q;  4A63 B;  3MP1 A;  4HVU A;  3CCE Q;  3QDR B;  4OMM A;  3H0F A;  1JXM A;  4E2F B;  1AT1 B;  1WNL A;  3SB2 A;  2CZ7 B;  4B6M A;  2QQA A;  2NUT A;  2QTV A;  5GAO m;  3CMA Q;  2MIO A;  1G5V A;  3THK A;  3QJ6 A;  2FZG B;  5GAN 4;  3C0C A;  3C4S A;  1JBM A;  1SRM A;  3CCU A;  1YJW Q;  1S1N A;  1LJO A;  2WAC A;  4C8Q F;  3LX7 A;  3M56 A;  1VQP T;  4FYW B;  1RL2 A;  2LQW A;  3NGP A;  2HAX A;  3VYG A;  3CCQ T;  1VQ5 T;  3M0R A;  3FLG A;  4PJL A;  4PJN A;  2RHY A;  4XAX B;  2K2V A;  2DVE A;  1RAF B;  1ARK A;  3CCL Q;  2DVJ A;  2OTJ A;  1IGQ A;  3CCQ Q;  1VQ5 Q;  3WVD B;  4FSS A;  3O5Z A;  1W4S A;  3PVL A;  2D8J A;  2YWW A;  2MOX A;  4XU0 A;  3V7C A;  3ER0 A;  4ZGD B;  1IXD A;  2JTF A;  1EZZ B;  2ATC B;  4PK4 A;  1A0N B;  1VQ9 A;  1AVZ C;  4RG8 A;  1VQ9 Q;  2F69 A;  2KNB B;  3LWH A;  2EBP A;  1I5L A;  2CT4 A;  3H0I A;  2RHX A;  1ACM B;  2OAU A;  4HVV A;  4BD3 A;  3M55 A;  3ME9 A;  4OB0 B;  2RQR A;  4BDZ A;  1TOV A;  3ZFJ A;  2EGC A;  1QP3 A;  9ATC B;  2F2W A;  3ZEH A;  2Z0W A;  2KYB A;  1NPP A;  5HCK A;  1UGR B;  4GBQ A;  1KFZ A;  3MO8 A;  3CC2 Q;  3OS2 A;  1RAH B;  3JB9 F;  2JS2 A;  1R0C B;  1T0H A;  1YJ9 Q;  5I21 A;  2OTL Q;  2RJC A;  5GAN 3;  1C1A A;  4HA8 A;  2OI3 A;  2QDL A;  1D3B B;  1Q86 U;  5KYU B;  1ZQ1 A;  2I0N A;  2C0I A;  4M7A G;  4M77 A;  4XQ3 A;  3WVE B;  1NJI U;  2A37 A;  1UGQ B;  2LT1 A;  1MND A;  1RAA B;  3CCV Q;  2MF2 A;  1KG1 A;  2ED0 A;  4QQ6 A;  2K7A A;  2PTK A;  2GTO A;  1QWE A;  2FVU A;  1X69 A;  2A7Y A;  2O31 A;  4JJB A;  1UHC A;  4EPC A;  4M75 A;  2M16 A;  1M1G A;  4DBR A;  2QA4 Q;  1S72 T;  4EDU A;  4E6R A;  4FIB A;  2RA2 A;  2RD1 A;  2HZY A;  2EKH A;  3C94 A;  3CQT A;  1VQ4 Q;  3MET A;  2YLC A;  4Z8A A;  4PFO A;  4M7A C;  5I2S A;  4M75 C;  2JTM A;  2CP5 A;  1E6G A;  2JMC A;  1ZUU A;  3CCR T;  4HXJ A;  1KQS A;  1KK7 A;  2KVQ G;  5LJ3 f;  1NLP C;  2DXT A;  4DBQ A;  1KSW A;  4NL3 A;  2V8J A;  4FW2 A;  4F7U G;  4BB7 A;  2KI7 A;  1XQH A;  3GOX A;  4DEX A;  3CCM A;  2DX1 A;  4E7I A;  1RLQ C;  1PD0 A;  2DTH A;  1WHH A;  2CS7 A;  5CAI A;  4HCB A;  4KUL A;  4ANJ A;  1WJR A;  4E7K A;  1Q82 U;  2DA9 A;  3CD6 Q;  4MZP A;  1Q7Y U;  4NL2 A;  3I35 A;  1V1C A;  1PKS A;  3QWX X;  1KD1 C;  1M5Q 1;  1RI0 A;  2L5Q A;  4JRI A;  4M7D C;  2NWM A;  1SKU B;  1VQP A;  1N5Z A;  1NBE B;  2DJZ A;  5J39 A;  4C92 B;  1UGP B;  4CC3 A;  1Q86 C;  5CQY A;  5A0L A;  3VKI A;  4FYV B;  2O2O A;  1I0C A;  1U3O A;  5FU7 C;  5AYF A;  3X24 B;  3I55 Q;  1G3W A;  1FYN A;  2VB6 A;  1ZLM A;  4F14 A;  2O9V A;  4C8Q G;  3MEA A;  2CGH A;  2NYS A;  3CEY A;  1BI1 A;  2KBT A;  4WCI A;  1HD3 A;  3M4G A;  1FXX A;  1YIT A;  4WF2 A;  4E7S A;  2JXB A;  3OMG A;  2E64 A;  4KH0 B;  5IHI A;  3CPW P;  2KT1 A;  1RAC B;  3EFO B;  1YBY A;  3HL8 A;  2E6Z A;  4LD9 K;  4KUI A;  5FRN A;  1Q86 R;  3RKY A;  3E2U A;  3VS2 A;  2E41 A;  3VUZ A;  5IXB A;  5LJ3 d;  1YWO A;  2EYZ A;  1U5S A;  3L2Q A;  1D1B A;  5GAO r;  1Y7X A;  1KC8 U;  1WA7 A;  2IIM A;  1YIJ T;  4C0D C;  3CPW S;  3MKD A;  4HCK A;  1EFN A;  3JCM b;  2RI3 A;  2XG8 D;  3CC2 A;  4QW2 A;  2ZPI B;  2QTX A;  5M9O A;  1QKW A;  1RUW A;  4D8K A;  3U23 A;  8ATC B;  2CSI A;  1RAD B;  2E3H A;  4E7J A;  1SRL A;  2LX9 A;  5I2M A;  1YHQ T;  4M7A E;  3VS5 A;  2YUP A;  4ESR A;  4PL6 A;  5EC7 A;  2MAM A;  1YIJ A;  4WTO B;  1W2B S;  2OTJ Q;  1LOJ A;  2DIG A;  2LQN A;  4J6Y A;  4M7A A;  2KE9 A;  3SWN B;  1Q82 C;  1ZBJ A;  3LH0 A;  1K9A A;  2OX7 A;  1HK9 A;  2DPP B;  4KT0 E;  3M0T A;  5GAN 2;  1MMA A;  5D6W A;  2EWN A;  2KR3 A;  3MJX A;  3QII A;  1WXT A;  1GFD A;  1E7O A;  4RCC A;  1ZSZ C;  4J6W A;  2QAZ A;  2XKO C;  5GAN 7;  3V8J A;  4N4H A;  3VS1 A;  5IHN A;  3V7S A;  4OB3 B;  3P8B B;  3RES A;  5LJ5 g;  3OBW A;  3JSC A;  5FW9 A;  5CKF A;  3EHQ A;  3OYN A;  1B34 B;  2H8H A;  2Y4X A;  5GAM j;  1I4K 1;  3NTI A;  4F7U F;  4QVC A;  3JCM Q;  3QPH A;  1Q82 R;  3RKW A;  2NUP A;  4J9B A;  3CME A;  1PD1 A;  2RF0 A;  2FPF A;  4EMK B;  1VQK A;  1LVK A;  2EPD A;  5GJW B;  4XTZ A;  4M7D E;  3ZBD A;  2ROT A;  3CC7 Q;  5CK9 A;  2YRD A;  2QXF A;  3VS7 A;  2AHJ B;  3JCM c;  5LL6 S;  4C0F A;  2X51 A;  2VUB A;  2RJD A;  2AIR B;  2LX7 A;  2JNG A;  5GMK j;  1RAI B;  2DTI A;  3DB3 A;  3I5S A;  4F16 A;  2VKN A;  3SEM A;  4B9X A;  2BE7 D;  4BE2 A;  4E7H A;  1XTD A;  4M77 C;  3EH2 A;  3QZ5 B;  1AWX A;  3CCM T;  1M90 U;  3QG1 A;  4PLL A;  3G71 A;  2CDT A;  1SF9 A;  3V8K A;  1D09 B;  1GBQ A;  3TRE A;  2JUF A;  2YLB A;  3MCA B;  3FJP A;  1WHG A;  2JM8 A;  4AFU C;  3RBB B;  1UGV A;  4IUQ A;  2CP0 A;  1ABQ A;  3RMS A;  4IIM A;  4M75 F;  1RLP C;  4BI8 B;  3S3O A;  2QEX A;  1YCS B;  4HVW A;  2E3I A;  1D0Y A;  2F2X A;  4Q5W A;  2MPX C;  5LJ3 e;  4M7D F;  1Q7Y R;  2VXE A;  1WXU A;  2KT8 A;  1Q7Y C;  3DKM A;  2P4R A;  2D6F A;  4M78 A;  3M4Y A;  3L2Z A;  1M4Z A;  5LJ5 h;  1H64 1;  8AT1 B;  1Y96 A;  3G6E T;  2FYK A;  5A0G A;  2M1H A;  4XTU A;  3OW2 S;  2YDL A;  1OZ2 A;  3SWN A;  2DEU A;  2ZPG B;  1VIE A;  2KMT A;  4XU3 A;  4OMP A;  5A0D A;  2F5T X;  2VYT A;  2P84 A;  2CRE A;  3EFR A;  4M4Z A;  4PJO D;  3FRN A;  1YHQ Q;  3PMT A;  1IZ6 A;  3G71 Q;  1VQN Q;  4AG2 C;  4VUB A;  4BE1 A;  2VGN A;  5CKE A;  3X26 B;  1UEB A;  4CC7 A;  4X9D A;  1X75 C;  4JRP A;  1D1C A;  2CUD A;  1YWP A;  1YIJ Q;  3RMQ A;  3QUI A;  3VV0 A;  1D1A A;  2X4W A;  3CBP A;  1MNE A;  3GPL A;  2K9G A;  4ELZ C;  5L23 A;  4II1 A;  1WZO A;  3E9G A;  3ZL7 C;  1OEB A;  2J06 A;  3OYA A;  2LNH B;  3TEE A;  2DYI A;  1BI0 A;  3NHN A;  2L3R A;  4KUD K;  4OVA A;  4YTL A;  1JJ2 S;  1B3Q A;  1B7T A;  2SEM A;  4J9C A;  5IH2 A;  4FT4 A;  3OYJ A;  1KJW A;  1KC8 C;  2IG0 A;  4RKU E;  4FYX B;  4J7F A;  2FL7 A;  1IHW A;  4A4E A;  4AFQ C;  1AEY A;  3TSW A;  1TU0 B;  3L2V A;  4LDV A;  1VA7 A;  3CCR A;  2KXD A;  3OYY A;  1FX7 A;  1PRL C;  5HK3 A;  2DEQ A;  2M0Y A;  5KYX B;  1UJY A;  1YNZ A;  1K0S A;  2PVD B;  2GQV A;  2J6O A;  4MZT A;  4NOY A;  1JXO A;  4GLM A;  3S3N A;  3UAT A;  2ZPF B;  2K57 A;  2KRN A;  4J9E A;  2AK5 A;  4A4G A;  4LDW A;  2DL4 A;  1AWO A;  4BDY A;  2RQV A;  4C92 F;  4MZM A;  1JB0 E;  3MEW A;  5D6Y A;  3BFM A;  3SHW A;  2A28 A;  3JRZ A;  3A8L B;  3VU3 C;  1H92 A;  1BIB A;  1UE9 A;  1WX6 A;  1MV3 A;  3L1A A;  4PLI A;  1WFW A;  5KH6 A;  3LGF A;  1WJQ A;  2EQK A;  1U1S A;  1O9S A;  3TVT A;  4JJD A;  4CC2 A;  2RH2 A;  3CCR Q;  4D8D A;  1NEB A;  5LJ5 f;  2LJ0 A;  5J3B A;  3DB4 A;  4F7U B;  3G7Z A;  1QW1 A;  1PC0 A;  2DMO A;  2GNC A;  2J6F A;  1S72 A;  3CC7 T;  2E1H A;  1IRX A;  3L2U A;  4JDS A;  4EMK C;  2F1L A;  5GAN h;  1S72 Q;  1JRI A;  2QA4 A;  1RAE B;  4JRQ A;  2GTJ A;  4JUV A;  3NMZ C;  2MMP A;  2VV5 A;  2DF6 A;  4IUU A;  1MMD A;  2HKN A;  5I11 A;  1N8R U;  4IUT A;  1QMC A;  1ZUK A;  1K0X A;  1RAB B;  1ZBX A;  3VS0 A;  1KD1 R;  1OQK A;  4RMO A;  2GGR A;  2EIF A;  4F17 A;  4M78 G;  4LNP A;  4C92 G;  5KYW A;  5KCO A;  4B9W A;  1ZSZ A;  1MV0 B;  2RK1 A;  1M1F A;  1VQN A;  2HCK A;  2KSS A;  4AFZ C;  3J80 E;  5KCH A;  1JJ2 A;  1BI3 A;  2OTL T;  3ASK A;  4HCC A;  3GBQ A;  1VYV A;  1PWT A;  2KY9 A;  2XI9 A;  2R57 A;  1I1J A;  3UA7 A;  2BZ8 A;  5GAO n;  1LCK A;  3OYI A;  2X4X A;  3LWI A;  5LJ5 j;  3CPF A;  4P5N A;  3CC4 A;  3CPW A;  4IUP A;  1WQW A;  3E9F A;  2O9S A;  3CC4 Q;  3A8O B;  1AWW A;  1QQJ A;  4LE9 A;  2LP5 A;  1TUG B;  2HD0 A;  2KAF A;  1M3B A;  3QO3 A;  4ORZ A;  3M58 A;  4GLK A;  1MMG A;  4M77 D;  4C92 E;  3SFM A;  1VQ9 T;  2EKO A;  4L5G A;  3Q1J A;  3X20 B;  3UT1 A;  4C92 A;  2XU8 A;  2CZ0 B;  1P92 A;  1R8O B;  2QQB A;  4JLG A;  1CSK A;  5GAM e;  3JCM e;  2V1R A;  4LDY A;  2LVM A;  4J9I A;  4PJO B;  2K4Y A;  3EFS A;  1AZE A;  4ELY C;  1WPY A;  2LCS A;  4ZN3 A;  2JT4 A;  4V2S A;  3HRS A;  3CD6 A;  5LJ5 d;  5LJ3 g;  4DBF A;  3KUF A;  1K8A R;  2MWP A;  3BDU A;  4BAC A;  4JPB W;  1N8R C; 
#chains in the Genus database with same CATH homology
 2JOY A;  1IRE B;  2E5Q A;  1VQL T;  3UDC A;  1M90 C;  3JCM b;  1NZ9 A;  3JCM d;  2RI3 A;  2I2L A;  2XG8 D;  3PGG A;  5CQX A;  3L2R A;  4QW2 A;  2ZPI B;  3CC2 A;  2QTX A;  5M9O A;  3KXT A;  4O6J A;  4OB2 B;  1K9M C;  2QQS A;  4M77 E;  1QVF A;  2BUD A;  2P4T A;  5GAN j;  2CZ1 B;  3A8M B;  4E7J A;  3CCS A;  3H8Z A;  3FB9 A;  2LX9 A;  4C5I A;  2ZPE B;  3G71 T;  5I2M A;  4RCB A;  5KE2 A;  2B8A A;  1YHQ T;  1N27 A;  3QYG B;  1YJW T;  4M7A E;  2DD4 A;  3OSV A;  4IUV A;  4M7D A;  3FEO A;  3QBY A;  4PL6 A;  1OYX A;  1U1T A;  2MAM A;  1YIJ A;  4N0A C;  1W2B S;  1LOJ A;  2DIG A;  3HP9 A;  4FU6 A;  4J6Y A;  2R5M A;  3OYM A;  3CD6 T;  4M7A A;  3SWN B;  4C92 C;  4E7L A;  1KHI A;  1QP2 A;  1VQ7 A;  3CMA T;  1Q82 C;  3BW1 A;  1K8A C;  1HXD A;  3GF5 A;  3LH0 A;  1M1K C;  4M75 E;  3M53 A;  1Y96 B;  1HK9 A;  2DPP B;  4KT0 E;  5GAN 2;  3SD4 A;  4M78 D;  3RIR A;  2ZCF B;  4Y91 A;  5D6W A;  2EWN A;  4ME7 A;  4DOV A;  1G3T A;  1VQO T;  4PJO F;  3QII A;  5GMK m;  3JCM f;  5CKH A;  3CBO A;  1N9R A;  4PJO E;  2O4X B;  4M77 F;  5DY9 A;  3JCM g;  2L8D A;  5DLO A;  3OBY A;  4RCC A;  1X01 A;  4J6W A;  2XKO C;  2V8I A;  4A4K A;  3CCE T;  3VUB A;  3OYL A;  4JS4 A;  1I8F A;  2RM4 A;  2EJG A;  2X4Y A;  2LTO A;  2RHI A;  2F5K A;  3GNG A;  4N4H A;  3RKX A;  3V8J A;  3UWN A;  2CZ6 B;  3I55 A;  4KBM B;  3V7S A;  4OB3 B;  3P8B B;  2E70 A;  3O8V A;  5FU6 B;  3RES A;  5GAO q;  2YHT A;  3C12 A;  2M0O A;  1VQK T;  4MDX A;  3PNW C;  3OBW A;  3RUX A;  5LJ5 g;  2P0K A;  3JSC A;  4HKE A;  3URG A;  5FLX E;  5CKF A;  3OYN A;  3JCM W;  1B34 B;  3E1S A;  5FRO A;  4C0Z A;  2Y4X A;  5GAM j;  1I4K 1;  3NTI A;  4EMH A;  4F7U F;  4QVC A;  3JCM Q;  2RJF A;  2R58 A;  2RB6 A;  1DJ7 B;  1V29 B;  2GFU A;  3QPH A;  4M78 C;  3TCJ A;  4C8Q E;  5HY6 A;  3RKW A;  5GMK i;  3JB9 G;  3QSU A;  4IUR A;  5IN1 A;  2K5I A;  5IT9 E;  3CME A;  2EQM A;  3NTK A;  4J83 A;  4J6X A;  3WXM B;  4EMK B;  2LCC A;  1VQK A;  3M59 A;  2V8K A;  3JCM X;  3MHX A;  4XTZ A;  4M7D E;  3ZBD A;  5CO7 A;  2PVG B;  2QA4 T;  3HRT A;  4BE0 A;  5CK9 A;  4M78 B;  2QXF A;  3DLL A;  2AHJ B;  3CXC S;  4M75 B;  3JCM c;  5LL6 S;  5GMK l;  5EG2 A;  3PMI A;  4C0F A;  4OB1 B;  3PIO A;  3JCM P;  1VQ4 A;  2VUB A;  2RJD A;  1VQ8 T;  1WQ7 A;  3JCM J;  5GAN e;  2JNG A;  5GMK j;  4OF1 A;  3JB9 I;  4ZTJ A;  1SSF A;  1VQ7 T;  5FU6 C;  1FWZ A;  2DTI A;  1N9S A;  2JN0 A;  2RK2 A;  3DB3 A;  1YJ9 A;  4B9X A;  3OYE A;  2KK4 A;  2XD0 A;  3M54 A;  3QHS A;  4BE2 A;  3QYH B;  3C95 A;  4C5E A;  4C0G A;  3SDZ A;  4E7H A;  3QJY A;  3S3M A;  4C8Q D;  1XTD A;  2LRQ A;  4QQD A;  4M77 C;  4M77 B;  3CCQ A;  1VQ5 A;  2DAQ A;  3QZ5 B;  3CCM T;  1M90 U;  3QG1 A;  4PLL A;  3G71 A;  4DQ2 A;  5DLQ E;  1OZ3 A;  1QVP A;  4J5Y A;  1YJW A;  3GIB A;  1YHQ A;  2CYZ B;  4R55 A;  1D3B A;  2BKD N;  2QQ9 A;  4EMK A;  2RHU A;  5GAN f;  3CCU T;  4FT2 A;  3V8K A;  5CKD A;  3TRE A;  1U8R A;  2JUF A;  2YLB A;  3MCA B;  3FJP A;  4DA4 A;  3SWN C;  2E65 A;  5GAN d;  5GAO l;  4IUQ A;  1PSF A;  3CC2 T;  5J26 A;  2K3Y A;  3CCV A;  2VGM A;  3F70 A;  4OGC A;  4OGE A;  3RMS A;  4M7A F;  4M75 F;  2XIC A;  4O5V A;  5HKC A;  3CCL A;  4BI8 B;  3S3O A;  2XDB A;  2HNI A;  5GAM f;  2R5A A;  3NFC A;  2QEX A;  3H6Z A;  4JJN K;  3QKJ A;  2O01 E;  4A4F A;  4Q5W A;  1QVF S;  2A3L A;  5LJ3 e;  2HQX A;  2LCL A;  4PJO C;  4M7D F;  1VUB A;  4BY6 C;  4EMG A;  1O75 A;  2VXE A;  3MP1 A;  2DTO A;  1Q7Y C;  2K5F A;  1MGQ A;  2RO0 A;  3DKM A;  3QDR B;  5HK0 A;  3AHU A;  2D6F A;  2O4X A;  4M78 A;  3CC7 A;  2LT4 A;  3M4Y A;  2GFA A;  4HCZ A;  4LDU A;  3L2Z A;  4J7I A;  1M4Z A;  5LJ5 h;  1H64 1;  5LJ3 h;  3TU4 K;  4M7A D;  3OYF A;  1Y96 A;  5L8R E;  1WNL A;  1KHC A;  5GAN 5;  3G6E T;  1YI2 T;  2FYK A;  5A0G A;  1BI2 A;  2M1H A;  4XTU A;  2CZ7 B;  3SB2 A;  3OW2 S;  1OZ2 A;  3SWN A;  1VIE A;  2KMT A;  2QQA A;  2ZPG B;  4XU3 A;  5GAO m;  2EQU A;  4UC4 A;  5A0D A;  1Q81 U;  4C5G A;  3PIP A;  2XDD A;  3JCM h;  1G5V A;  2F5T X;  3MP8 A;  2QI2 A;  2VYT A;  3QJ6 A;  4A54 A;  1B34 A;  3EFR A;  5GAN 4;  3C4S A;  3LYI A;  1JBM A;  4PJO D;  3CCU A;  3FRN A;  1LJO A;  2WAC A;  4C8Q F;  3PMT A;  1IZ6 A;  3LX7 A;  4QQG A;  1NJI C;  1YCY A;  2XDP A;  3M56 A;  1H3Z A;  4X9C A;  2PUK B;  4M75 D;  1VQP T;  1VQL A;  4VUB A;  1RL2 A;  4BE1 A;  2VGN A;  5CKE A;  2HAX A;  4N4G A;  3X26 B;  4OP0 A;  3VYG A;  3OS0 A;  1G3Y A;  1NE8 A;  3OY9 A;  3CCQ T;  2K3X A;  1VQ5 T;  3FLG A;  1BYM A;  1UEB A;  4X9D A;  1VQ6 T;  2RHY A;  1X75 C;  3BDL A;  4XAX B;  4Z02 A;  2C06 A;  4JRP A;  2P0Q A;  1TH7 A;  2DK3 A;  3HHT B;  2K2V A;  2DVE A;  3QXE B;  4GY5 A;  5FU7 B;  3QUI A;  3RMQ A;  3VV0 A;  4C0D B;  1VQ8 A;  2PQW A;  2X4W A;  3CBP A;  4NS5 A;  3X28 B;  3OS1 A;  4M7D G;  4JRK A;  1VQM T;  4M77 G;  5GAO p;  5A2Q E;  3GPL A;  4ELZ C;  2L89 A;  2OTJ A;  4II1 A;  3E9G A;  4LD6 A;  2EFI A;  4DOW A;  3OYA A;  4PJO G;  3TEE A;  2DXC A;  1BI0 A;  3WVD B;  2CKK A;  2VC8 A;  2L3R A;  5GAM g;  4KUD K;  4M7D B;  4OVA A;  4YTL A;  4ZTF A;  4C8Q C;  1W4S A;  1VQN T;  3N5B B;  1JJ2 S;  2G3R A;  1GXI E;  4C92 D;  3JCM V;  1KQ1 A;  4FT4 A;  4XU0 A;  3OYJ A;  3V7C A;  1UB4 A;  3OYB A;  1KC8 C;  3ER0 A;  4ZGD B;  4L6V 5;  3OW2 A;  2IG0 A;  2JTF A;  4RKU E;  5KE3 A;  3MEV A;  1VQ9 A;  4J7F A;  3UPU A;  2FL7 A;  4MMK A;  4A4E A;  2LQK A;  4RG8 A;  1PSE A;  3L2V A;  2MWO A;  5CCA A;  4LDV A;  2F69 A;  3LWH A;  3CCR A;  5FRM A;  5CVI A;  3OYY A;  1I5L A;  2XHC A;  3I55 T;  1FX7 A;  3I56 A;  5LJ5 e;  5HK3 A;  2DEQ A;  4ZGJ B;  3CCJ A;  4FL6 A;  2PVD B;  2GQV A;  2RHX A;  4MZT A;  5GAN 7;  2OAU A;  4BD3 A;  3G6E A;  1Y71 A;  4NOY A;  1EIF A;  3M55 A;  2DD5 A;  2EQJ A;  3CC4 T;  3INZ A;  3CCE A;  3ME9 A;  4OB0 B;  2ZGW A;  3P8H A;  4RG2 A;  4XTV A;  3S3N A;  4BDZ A;  4X34 A;  2ZPF B;  2D0Q B;  1K73 U;  3ZFJ A;  2K57 A;  3LGL A;  4FM4 B;  2QDY B;  1QP3 A;  2ZPH B;  3ZEH A;  4A4G A;  1NPR A;  4LDW A;  3OYK A;  1KQ2 A;  1NPP A;  2GF7 A;  1M8V A;  1UGR B;  2H3J A;  3V8L A;  3MO8 A;  2GCX A;  2E10 A;  4BDY A;  4M78 F;  5IAY A;  3OS2 A;  3JB9 H;  2DZ9 A;  3A8G B;  4XU2 A;  4C92 F;  1VQ6 A;  3A8H B;  3E19 A;  1WJS A;  3OS5 A;  3X25 B;  4MZM A;  1Q81 C;  3JB9 F;  1JB0 E;  3MEW A;  5D6Y A;  3BFM A;  3KBG A;  3HRU A;  4BY6 B;  5I21 A;  3JB9 J;  2RJC A;  5GAM d;  5GAN 3;  4HA8 A;  3JRZ A;  3VJP A;  5GMK h;  3A8L B;  4C8Q B;  3VU3 C;  4BI4 A;  3L2W A;  1BIB A;  2RI5 A;  3NTH A;  3OYH A;  2KQW A;  1D3B B;  3HKS A;  3FDR A;  1Q86 U;  4BI3 A;  2FB7 A;  3L1A A;  4PLI A;  5KH6 A;  3LGF A;  1ZQ1 A;  2DXB A;  2LQ8 A;  2XID A;  1WJQ A;  4M7A G;  4M77 A;  4D6W A;  1I81 A;  3MEU A;  1X6O A;  4XQ3 A;  2EQK A;  2LDM A;  3WVE B;  1QVG A;  2K5L A;  1U1S A;  1NJI U;  1O9S A;  2HQE A;  1UGQ B;  2LT1 A;  3S6W A;  4ATO A;  2MF2 A;  2RH2 A;  1KG1 A;  5CKB A;  5LJ5 f;  4QQ6 A;  2HBP A;  5J3B A;  3P8D A;  2NLU A;  3DB4 A;  2FVU A;  4MML A;  2A7Y A;  4F7U B;  3G7Z A;  1QW1 A;  3G4S A;  4HT8 A;  2BIV A;  2DO3 A;  4PNO A;  3HPW A;  4EPC A;  1VQ4 T;  2JZ2 A;  2M16 A;  1M1G A;  4M75 A;  3JB9 D;  1S72 A;  3LW5 E;  3CC7 T;  2E1H A;  1S72 T;  4M75 G;  4EDU A;  3L2U A;  1M1K U;  4FIB A;  4TVR A;  4JDS A;  2RI2 A;  4EMK C;  5GMK e;  3OYD A;  2RA2 A;  1BKB A;  1XNI A;  3MP6 A;  2RD1 A;  5GAN h;  3G4S T;  5CR2 A;  1JRI A;  3GLX A;  3CBM A;  2QA4 A;  3C94 A;  2DKG A;  3QZ9 B;  1W2B A;  2DXU A;  4JRQ A;  2RHZ A;  3MET A;  3V7R A;  2YLC A;  4JUV A;  4N0A A;  5GAN 6;  2EJF A;  4ZN1 A;  4IKF A;  2MMP A;  3JAM E;  2VV5 A;  4M7A B;  2QEX T;  4M7A C;  5I2S A;  4IUU A;  4M75 C;  2JTM A;  4FSX A;  2Y4Y A;  1UGS B;  3I56 T;  3CCR T;  1N8R U;  4IUT A;  4M7D D;  3CCV T;  1KQS A;  2DIQ A;  5GAM h;  3J7A F;  1G3S A;  2KVQ G;  5LJ3 f;  4PKC C;  1ZBX A;  2JVV A;  4HT9 A;  2DXT A;  3LLR A;  2DZC A;  3L42 A;  4RMO A;  3OYC A;  3FC3 A;  4XU1 A;  5LJ3 j;  4NL3 A;  2EIF A;  3OSS C;  2V8J A;  1OI1 A;  4M78 G;  2LC4 A;  4C92 G;  4F7U G;  1WGS A;  4B9W A;  4BB7 A;  5KCO A;  1YJN A;  1XQH A;  2E12 A;  2RK1 A;  3PT9 A;  3GOX A;  3OQ5 A;  1VQM A;  1VQO A;  3CCM A;  4C8Q A;  1M1F A;  3R6O A;  5C0M A;  4E7I A;  1VQN A;  2KSS A;  3J80 E;  5KCH A;  1JJ2 A;  1BI3 A;  2DTH A;  4N4I A;  2OTL T;  3ASK A;  2RJE A;  1YJ9 T;  1K8A U;  2CS7 A;  3HSB A;  5CIU A;  5CAI A;  1K73 C;  4HCC A;  5GAN g;  4JLI A;  3HFO A;  2KY9 A;  4XTY A;  4HCB A;  4KUL A;  2XI9 A;  1WJR A;  3A5Z B;  2ZZD A;  4F7U A;  4E7K A;  3PTA A;  1Q82 U;  2R57 A;  4MZP A;  2OTJ T;  1ZHI A;  5GAO n;  1Q7Y U;  2WSC E;  4NL2 A;  3OYI A;  1KD1 U;  3OB9 A;  3HFN A;  4F7U E;  4BUG A;  2D9T A;  2X4X A;  3LWI A;  2ZPB B;  5LJ5 j;  1M5Q 1;  1RI0 A;  1VIF A;  4M78 E;  5GAN 8;  1KD1 C;  2OTL A;  2XK0 A;  3CPF A;  3M9Q A;  4P5N A;  3CC4 A;  2L5Q A;  2WSE E;  2PVO B;  4JRI A;  3CPW A;  1MHN A;  4LDX A;  1BIA A;  4M7D C;  4IUP A;  4ZGE B;  1WQW A;  3BY7 A;  1VQP A;  3E9F A;  3FIF A;  1YJN T;  2EYQ A;  2DJZ A;  4Y28 E;  5J39 A;  4CI0 C;  3CME T;  4C92 B;  1UGP B;  4QVZ A;  3CCJ T;  3CCS T;  4A4H A;  3A8O B;  3GP8 A;  1Q86 C;  2E6N A;  5CQY A;  5A0L A;  3VKI A;  2YRV A;  2FHD A;  2KDS A;  4A53 A;  4J8O A;  2MI6 A;  3OMC A;  4XK8 E;  2HD0 A;  2WSF E;  5FU7 C;  5AYF A;  3X24 B;  1KQS S;  2KAF A;  1G3W A;  3QO3 A;  3CXC A;  3M58 A;  4GLK A;  4M77 D;  4QVD A;  4C92 E;  4OMF B;  4XTW A;  3SFM A;  4C8Q G;  1VQ9 T;  1K9M U;  3MEA A;  1Y07 A;  2CGH A;  3CEY A;  1BI1 A;  2EKO A;  4L5G A;  3Q1J A;  5DM7 R;  3X20 B;  1YI2 A;  3UT1 A;  3M4G A;  1FXX A;  2XU8 A;  2CZ0 B;  1P92 A;  2EJ9 A;  4C92 A;  4E47 A;  4WF2 A;  5C6S A;  1YIT A;  4MDW A;  1R8O B;  3OMG A;  2QQB A;  2E64 A;  2X35 A;  3J81 E;  4JLG A;  2IVW A;  2LNV A;  5D6X A;  5GAM e;  3RER A;  3JCM e;  3OA6 A;  3DLM A;  4LDY A;  4PJO B;  2LVM A;  2QQR A;  4L59 A;  1QVG S;  1N6A A;  2M9U A;  4PJO A;  2K4Y A;  3T9N A;  3EFS A;  4ELY C;  1AHJ B;  1M9S A;  1WPY A;  1YBY A;  2VXF A;  2E6Z A;  3HL8 A;  4LD9 K;  4KUI A;  4ZN3 A;  2PU9 B;  2X4J A;  1LNX A;  5FRN A;  2Y90 A;  4JS5 A;  3RKY A;  4V2S A;  2E41 A;  2PUO B;  3VUZ A;  3M57 A;  3M5A A;  4R56 A;  3HRS A;  3OYG A;  3CD6 A;  2EAY A;  5LJ3 d;  3GNF B;  5LJ5 d;  4C5H A;  3CMA A;  1YIT T;  3L2Q A;  2P0P A;  5LJ3 g;  3KUF A;  3PFS A;  1XOV A;  3VYH B;  4CRI A;  5GAO r;  1Y7X A;  1KC8 U;  3CCL T;  2MWP A;  4XTX A;  3EAE A;  1YIJ T;  3BDU A;  4BAC A;  1N8R C;  4C0D C;  3CPW S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...