4M78G

Crystal structure of lsm2-8 complex, space group p21
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
70
Chain Sequence
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 15
structure length 70
sequence length 86
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78G00
4PJOF 5GMKj 4M7DA 2DKGA 3QHSA 4XU0A 4EMKC 3JCMb 1U1TA 1B34A 4F7UA 3RIRA 1TH7A 1I4K1 3JCMJ 2RM4A 3RKYA 5GANf 4XU1A 4XTVA 3JB9H 3BDUA 2DZ9A 1D3BB 5GAMd 5GAMf 5LJ3g 3JB9I 4V2SA 1M8VA 2E65A 3L2ZA 2EJFA 4M7AA 4J5YA 3JCMQ 4C92C 2DVEA 4A53A 4C8QC 4PJOE 4N0AC 2DTIA 4QVDA 4XTZA 3HFNA 4M78C 4MMLA 3JCMP 4HT8A 3HSBA 5GMKi 1JBMA 4XTYA 4M7DD 5GANd 2DXTA 2FYKA 4XU3A 5GANe 4RCBA 3RESA 4C8QD 4C92D 5GAOq 3VU3C 1KQ2A 1HXDA 3JCMd 3JB9G 3RERA 4M78F 5GANh 3V7RA 4M78D 1N9RA 1Y96A 3SWNC 4M7AG 4PNOA 4PJOB 3BFMA 4M77A 3EFRA 2YHTA 1KQ1A 4M77E 4M7AC 5LJ3d 1B34B 1U1SA 4RCCA 1M5Q1 2DZCA 2QTXA 3BW1A 4M78A 2EJ9A 4XTXA 4PJOG 4M7DB 2RB6A 1BIBA 5GANg 4M78E 5GMKm 3V8KA 4OP0A 4M7DG 1WNLA 3QUIA 4X9DA 1I5LA 3JCMf 2EAYA 5GANj 3JB9J 4M7DF 3JCMV 1LJOA 5I21A 4M7AD 1MGQA 5GAOl 4M78B 4M7DC 1HK9A 4M75G 3JCMh 4M7AB 3V7SA 3JB9D 3BY7A 1YCYA 5GMKh 4JLIA 1I8FA 4M77F 4NL3A 3V7CA 3GIBA 1X01A 4Y91A 5GMKe 5GAOn 5GAOr 4M77C 2RD1A 4XU2A 4PJOA 5GAN3 3JCMg 2E41A 2DJZA 2DTHA 3QO3A 5LJ5g 1H641 4J6YA 4M77G 2FB7A 2DTOA 5GAN6 5GAOp 1I81A 4M77D 4F7UG 4J6WA 3JCMX 1LOJA 3M4GA 4HT9A 4M7AE 5LJ3h 2VXEA 4C8QB 4C92B 4XQ3A 4XTUA 4M75C 2VC8A 5LJ3e 1LNXA 3QSUA 2Y90A 4XTWA 5GAN5 5LJ3j 3JCMe 4NOYA 4A54A 1JRIA 3FIFA 5LJ5d 3SWNA 2I2LA 4C8QA 4C92A 3RKWA 3V8JA 5GAN2 3JB9F 4M77B 4M75F 4M75D 2E1HA 1BIAA 4JRKA 3EFSA 4M7AF 4EMKB 5LJ5h 4JUVA 4F7UB 4M7DE 4WF2A 2ZGWA 4N0AA 5LJ5e 2DEQA 3FJPA 5GAMj 3RUXA 4M75A 2HNIA 3SB2A 4F7UF 5GAN7 4HA8A 5LJ3f 3RKXA 2YLBA 4C92F 4M75E 4J6XA 3JCMc 4C8QF 4EMKA 5GAMg 4PJOD 3FB9A 4DQ2A 4NL2A 2K57A 3HFOA 5DY9A 5CAIA 1N9SA 5GAN8 4JRIA 2YLCA 5GAN4 2E10A 3SWNB 4QVCA 5GMKl 1WPYA 4X9CA 4EMGA 4M78G 4F7UE 3AHUA 3V8LA 3PGGA 2E64A 1D3BA 2EJGA 4C8QE 4C92E 5LJ5f 5GAMh 5GAOm 3JCMW 4PJOC 2VXFA 2CGHA 5GAMe 1WQWA 1WQ7A 1Y96B 2RA2A 4MMKA 4C8QG 3INZA 4M75B 4C92G 5LJ5j 2JN0A 2DXUA 3L1AA 4EMHA 2EWNA
chains in the Genus database with same CATH superfamily
2V8IA 3CXCA 3JCMJ 2DXCA 1VQ6Q 5FW9A 3VKIA 2DERA 4GLKA 2P0PA 4BACA 3OW2A 1ZHIA 1MMAA 4IUQA 3M58A 1DJ7B 1TG0A 1QCNA 2P0KA 1YI2T 4JZ3A 2GFAA 2D1XA 5GANd 3I55Q 2ABLA 2RMOA 1TS9A 1ZLMA 1Y96A 4PJOB 1I1JA 1U1SA 3EGXA 3VS2A 2A3LA 3DLLA 1SF9A 2LQ8A 3CBPA 3QUIA 1VQPQ 2ZPHB 3A8GB 3JCMV 1RLQC 4DBRA 1IHWA 1PM3A 2DL8A 1Q82R 3FC3A 2MAMA 1NYFA 4A4KA 1UE9A 3OYJA 1KC8R 1Y71A 2J6KA 3CEYA 3I9QA 2CS7A 3CCUA 3GLXA 4F17A 3UF4A 4Z02A 2XDBA 1AVZC 2ENMA 1K0XA 1OEBA 2OAWA 2MCNA 4N4HA 2LJ0A 2VKNA 1XQHA 4CC4B 4M7DE 3PT9A 1XOVA 4AFSC 2XKOC 2X4JA 3CCMQ 5CAIA 2FPEA 4OMFB 2VGMA 3PGGA 2F2XA 3CC4Q 2OTLT 2VXFA 2KROA 1WQWA 2FPFA 1NPRA 3CD6A 3LH5A 1YP5A 3HHTB 3UA6A 3META 5ECAA 4EMHA 5IT9E 5CKBA 4EMKC 1KQSP 3CCSA 2YWWA 2DA9A 1QVFP 1VQOA 1VQNT 2E6NA 3FJ5A 3JB9I 5GAMf 3QG1A 4KUDK 1X2QA 1Q82U 1M30A 2E3IA 5D6WA 5GMKi 1YCSB 1JBMA 7AT1B 2YRCA 4C92D 5C0MA 2O9VA 1R0BG 3GOXA 4IIOA 3P8HA 4LDXA 3PNWC 3V8KA 1D1AA 2O4XA 1SG5A 2EGCA 3FRNA 3EG0A 3OBYA 4QVZA 2QYZA 2LZ6B 3RMQA 1UGRB 1QVFS 3CCRA 2KR3A 1O9SA 2HSEB 1B07A 2K2VA 4QQ6A 1BBZA 1G8XA 4Y92A 3CCJA 1IB8A 5FU7B 2GBQA 3OB9A 3E2UA 2QDYB 4KGXB 2JTMA 5LJ3h 5AYFA 4RTXA 3QYHB 1NJIU 2ZPFB 2L3PA 5LJ5d 1XJWB 2I2LA 4MZPA 3VS5A 2RHUA 4E7LA 1D09B 2ATCB 3RR6A 4LD9K 2YUPA 5J3BA 2L2PA 2MK5A 3MKDA 1R8OB 2LJ1A 2FO0A 3FB9A 2VYTA 5J26A 2JM8A 1KG1A 3ZEHA 2E10A 4HVWA 1UECA 3A98A 4M78G 1GCPA 5KYYB 3EG1A 3M4YA 4D8DA 4PJOC 3OYGA 3I56T 1BI2A 2FEIA 4Z88A 3TU4K 4JPBW 3A1PA 3WVEB 3S3OA 1VQMT 1WGSA 1NLOC 1N5ZA 1NLPC 2YUNA 2ZAEA 1ABQA 2ESWA 2GGRA 1Q81R 1VA7A 2VWFA 1ZSZB 4J9CA 2E65A 4A4FA 1P92A 4RG2A 3MPUB 1Y7XA 2LCCA 3MP6A 4C8QC 5CCAA 1YHQQ 4FYYB 1VQ4Q 2M51A 2COYA 2XDDA 1IHVA 4BI4A 3QJYA 5IAYA 5AT1B 4ZGEB 5GANh 2OTJQ 2DEUA 3REBB 4CI0C 1ZBXA 3LGFA 2A08A 3E9FA 1U8RA 4WTOB 3M0PA 5FU6B 3VS6A 4M7DD 1GCQA 4GY5A 2D8JA 4PJMA 1TTHB 1I5LA 1RI0A 4PK4A 5KCHA 2D6FA 1M3CA 1PNJA 1RUWA 5KYXB 1KQSA 2CT3A 1WXBA 1VQ9A 4IIMA 4M77C 3LW5E 1Y07A 1QCOA 1ZBJA 2KXDA 2YRDA 1R0CB 1RI9A 3OS5A 3CMAQ 2MOXA 1I81A 3CCVA 4C0DC 1OQKA 2JTEA 1EFNA 2CP0A 3U23A 4ELZC 2OTLA 4N4IA 3P8DA 1WHGA 2AT1B 2O9SA 2Y90A 1YI2Q 1KQSS 2PUKB 4NOYA 3P8BB 2RJFA 3H0IA 5CKEA 4C5IA 3REAB 2H3JA 4RTUA 5LJ5h 4FL6A 4ORZA 1IZ6A 1QVGS 2DEQA 2CUDA 4JJCA 1E6GA 1M90C 3ZFJA 1BK2A 5C6SA 1M1KR 1N8RU 4QVCA 1WPYA 4X9CA 1VQOQ 1VQ8A 1YJ9A 2RK1A 4C8QE 1SKUB 2HZYA 3DB3A 3VS7A 1G3SA 4O5VA 3UPUA 3QPHA 3G6ET 5D6YA 4XTVA 4PJOF 2HEQA 1VQLQ 4E7IA 1SSFA 3PMTA 2NUTB 4GBQA 3RIRA 1KD1U 1VQMA 1AWOA 4F16A 3OYCA 1QVGP 4AG1C 4QVDA 4FM4B 2ZPBB 2JZ2A 3J7AF 2JMCA 1ZX6A 1RLPC 1W70A 2BUDA 2F5TX 2LTOA 2D8HA 2ROLA 5GANg 1ZUKA 3CC4T 2DBKA 3BDLA 1V29B 2LRQA 4NL3A 4JJNK 3V7CA 1ZSZC 2O88A 2DXBA 1UB4A 1VQKT 2JT4A 3G71T 4RTTA 2FB7A 5HK0A 1SHGA 1ZA1B 1GFDA 4KULA 1VQ6T 2CP7A 2BZXA 4J9GA 1KSWA 4M75D 2F2WA 4M7AF 1VQ4A 3HL8A 2L3SA 2VV5A 4J9BA 2RO0A 4F7UF 4C92F 2DL5A 1G5VA 1WXUA 3THKA 4JRIA 3SWNB 3QWYA 2R57A 2OAUA 3V8LA 1WYXA 5KYUB 1JJ2A 2J05A 1WQ7A 3TQ7P 1Q86R 4FW2A 2FL7A 3M0SA 4MDXA 1B34A 1H8KA 2ZPGB 3H0FA 3NMZC 2DM1A 1UEBA 2F69A 1I4K1 2KDSA 1YI2A 4JJBA 4EIKA 1SSHA 2KNBB 1I07A 1GBRA 3HRUA 2L89A 3CC2T 4DOWA 1ZUYA 1M2VB 4R0KA 1NEGA 1VQ5T 1SEMA 2DXTA 3QZ5B 5IHNA 3VYGA 2M9UA 3C95A 4M4ZA 1UJ0A 2XDPA 1K1ZA 3CCVT 3RUXA 4M7DB 1M5Q1 3QYGB 1ARKA 3CBOA 3M53A 4LUDA 3UDCA 2DNUA 1AZGB 4MDWA 4E7HA 3JB9D 2PNIA 2OTLQ 3L2QA 2G3RA 2DIGA 3JCMg 3CCMT 3TEEA 1UJYA 2E12A 3JCMX 5I11A 4F14A 1U3OA 3FEOA 2RNAA 2QTVA 1KHIA 4C8QA 5L8RE 3JV3A 4FCYA 3EG2A 1YIJT 3OW2S 6AT1B 4BY6B 4BD3A 2JOYA 2KE9A 3HTRA 2I0NA 2DO3A 4KUIA 4ZGDB 2LNVA 3OYAA 2IIMA 3OS1A 2WSEE 2HSPA 3D7SB 5FRNA 1VUBA 3KUFA 1ZSZA 1KK7A 4OMMA 3MEAA 4PL6A 5I22A 3L1AA 1PWTA 2BE9B 2SRCA 2EWNA 4X34A 2KQWA 2OX7A 3CMEQ 3M0TA 2O31A 1D3BB 2NWMA 2K3YA 1LVKA 2KRMA 5IXBA 3OYBA 1WJQA 2DVEA 2KVQG 4BDYA 1YJNA 4M78C 1M3AA 3EG3A 1I5OB 3IQLA 2RPNA 3G4SQ 4XU3A 4C5HA 2DE0X 4E7SA 1K4US 1RAIB 2O01E 4LDVA 4LNPA 3FDRA 3N5BB 1RABB 1YN8A 2DL7A 2QG9B 1BCOA 1LJOA 3L2VA 2AIRB 2CDTA 2RJEA 3F70A 3I56Q 2PVGB 5KYYA 1BU1A 2RD1A 1VQMQ 4N4GA 1YWPA 1W2BS 1WXTA 1IO6A 1PKTA 4KBMB 1K8AR 5EG2A 4PFOA 3MEUA 1M3BA 2K4YA 4C8QB 1G3TA 2RQWA 2QEXT 2BZ8A 1D0XA 2GCXA 3O5ZA 4PLIA 3X24B 3CCUT 1IREB 2XK0A 2J6FA 5FWCA 1NBEB 2QQRA 4CC3A 3JSCA 1YJWT 1Z9ZA 3CPWA 2K6DA 5GJWB 1YJ9T 1RACB 4KGZB 4M75E 4J9EA 2JM9A 4NL2A 5GAN8 5GAN4 2JNGA 5HK3A 2RI2A 1VQ6A 2M0YA 5GAOm 3A8MB 3RBBB 4C0GA 2V8KA 3CC7T 2L0AA 2GQVA 2DKGA 3MO8A 2WSCE 1GXIE 5FRMA 1PKSA 2DL4A 5GANf 3VS0A 2LMJA 4MZMA 2DMOA 3CCST 4A53A 4ME7A 3JCMP 5FROA 2KYMA 2EYQA 4EPCA 1VQPA 3L2WA 3M0QA 2EKOA 4XTYA 1SHFA 2V26A 3BE3A 5CIUA 2EBPA 2LDMA 4M78D 4II1A 3C4SA 2VVKA 4ZN3A 1C0MA 4KRTA 1VQ7A 3LGLA 4HKEA 3OYEA 4C5GA 1EIFA 2RB6A 4KH0B 4C0ZA 3JCMf 3NPFA 4FW1A 4BY6C 1Q7YU 4M7AD 1X6OA 3OYIA 4KH1B 4M7AB 3V7SA 1S1NA 3LWIA 5D7UA 1XNIA 2QXFA 1CKBA 2E41A 3VS1A 3PVLA 3S3MA 3CD6Q 3DB4A 3CCQQ 2HD0A 4ZGJB 1S72A 2VXEA 4O6JA 4M75C 1QCFA 1H92A 4K11A 4OVAA 1TUDA 4M75F 4BI8B 4JRKA 1OOTA 2A28A 4L59A 1QP2A 4WF2A 4FT4A 1PHTA 1E7OA 1OPKA 5GMKl 2E64A 4LUEA 2EW3A 5LJ5f 2L8DA 4AMCA 4CC7A 1OX9A 2QA4T 1X6GA 2A36A 2MI6A 2X35A 4M75B 2XICA 1WFWA 1VQ8T 1FX7A 1M1FA 3MEWA 2PTKA 3JCMb 1NM7A 3NTHA 3T9NA 3TSWA 2J06A 1VQKQ 3PFSA 3G71Q 4V2SA 3ULRB 4JDSA 2DIQA 4NS5A 5KH6A 3HFNA 2CZ1B 2MYSA 2AKKA 1H3ZA 3OYFA 3ZBDA 3M0RA 2NUZA 3ZL7C 1X43A 4PFPA 2KY9A 1N27A 4JLGA 2NUPB 3LH0A 4L6V5 2O2OA 1B34B 3TVTA 4D8KA 2JMAA 1VQNQ 3VUZA 1A0NB 3CQTA 4A63B 1B7TA 1VQ9T 4KGVB 4A4GA 4OGCA 1M90R 1PRMC 1H3HA 5GMKh 1I8FA 1IGUA 3GNFB 4WCIA 3QJ6A 2MF2A 1IRXA 4PJOA 4LN2A 2LVMA 5FWBA 4HCKA 1K76A 1ABOA 4M77D 4BE2A 3ASKA 2ZZDA 1QVPA 3G1JA 4OMLA 1YNZA 4JJDA 1M27C 3J80E 3UATA 4M77B 2HQHA 1HYOA 2HKNA 1PC0A 4JUVA 4EDUA 3GF5A 1BB9A 5LL6S 3OYHA 2HNIA 1UUEA 3QWXX 2RQVA 2A7YA 2L3RA 3JCMc 3QZ9B 2CP6A 2FG0A 3CC2Q 3CCLA 2QQBA 4Z89A 3A8HB 1VIEA 4UC4A 1TU0B 2PZ1A 1YHQA 1O75A 5IN1A 4XU0A 3CCVQ 2DVJA 4FYWB 1WLPB 1TUGB 4C5EA 5A0DA 2QDLA 2IG0A 3OYNA 2LJ3A 3CMAA 1OX8A 1Q95G 2DF6A 2K2MA 3JRZA 3X26B 2NLUA 1WA7A 2J7IA 1HD3A 5DLOA 2QK0A 5I2SA 1V76A 2X51A 4M7AG 4M77A 4J83A 1MV3A 5KYWB 2HQEA 4Z8AA 2Z0WA 5KE2A 3WXMB 2D0NA 4M78B 4JS4A 2C0OA 3H0HA 2OTJA 4JLIA 1VQ4T 2C0TA 1KD1C 3X25B 5J39A 4ZNXA 1JB0E 5CKDA 2CZ6B 3OYMA 1WHKA 4AFUC 2DJZA 1LCKA 1GCQC 3M0UA 1PD1A 3H41A 3I35A 1UTIA 5GAOp 3CMET 1JXOA 2P4TA 2EQJA 4J6WA 1K8AC 4XQ3A 2VASA 2DL3A 3G71A 5FU7C 5LJ3j 2Y4YA 3FIFA 2JJ9A 4GLMA 2E1HA 1U06A 2F1LA 4LDYA 1YITT 3I5RA 2BKDN 2NUTA 3RNJA 1UG1A 1VQNA 2AK5A 2ED0A 2RQRA 5LJ3f 1RAEB 1YITA 8ATCB 1N9SA 2CH4W 3OQ5A 1ZUUA 1N6AA 4HVUA 2LCSA 3MJXA 2YXYA 4LDWA 3G4ST 1G3YA 1Y96B 4C8QG 1QP3A 4ATOA 3CCET 5GMKj 2M02A 2RQTA 3KBGA 2IPOB 2PVOB 3HKSA 4F7UA 2V1QA 2CZ7B 4DOVA 2HDAA 3JB9H 2PVDB 1WJSA 2DYBA 3JCMQ 1KC8C 2MPXC 1WIEA 3CCLT 1KFZA 2FYKA 4OMPA 4RCBA 3RESA 4RTVA 1VQKA 4M78F 2DD4A 2XI9A 4C0FA 1GBQA 1Z9QA 4PNOA 1PSEA 1TOVA 2IVWA 3BFMA 1G2BA 1KQ1A 1SRMA 2FZKB 4M7AC 1YJ9Q 1FYNA 3TCJA 3PE0A 1AT1B 1FWZA 4J7IA 3CCUQ 2EAYA 3VUBA 3R6NA 4DBFA 5I21A 3UA7A 1RL2A 3A5ZB 3OS2A 1VQ8Q 1YCYA 5A0LA 4PLLA 3CC7Q 4Y91A 5GMKe 1WHLA 2A0FB 3GPLA 1CKAA 1VQLA 2JS2A 4Q5WA 2DX1A 1QWFA 3CCMA 1Q81C 4XTWA 3L42A 2K5LA 3MEVA 3SWNA 1AWXA 4FT2A 1NPPA 2DLPA 1K9MR 4F7UB 2PUOB 1MMDA 2DD5A 2YT6A 4OB0B 2KXCA 3QDFA 4J9HA 4J9FA 1OULA 4FSXA 4M75A 2QQSA 2M0OA 1M1KC 2WSFE 4J6XA 1QMCA 3HFOA 2CH4A 3CCSQ 1Y57A 2KK4A 2DK3A 4BE0A 1TXQA 3DKMA 2JVVA 2LP5A 2VGNA 2CGHA 1M9SA 2COZA 1T0JA 5GAMe 5GAMd 4AFQC 2PQWA 2A37A 1OI1A 2QAZA 1U5SA 1YFNA 3C12A 2MMPA 1T0HA 3CD6T 2CP3A 1M4ZA 3RKYA 3VRYA 3CCQT 5LJ3g 2RH2A 3J81E 1VQPT 2K7AA 2BZYA 3OMCA 1Q86C 3HSBA 4A4EA 4OB3B 5L23A 3WVDB 5GAOq 1F1BB 1HXDA 2EYWA 2LX7A 1WHJA 2KYBA 2ZCFB 2X4XA 1RAAB 4JS5A 1PD0A 5IHIA 2HBWA 2GF7A 1KHCA 1VYUA 2CT4A 1BIBA 3QXEB 3JAME 2DPPB 4HXJA 4X9DA 2M16A 4RUGA 4P5NA 4M75G 2EYZA 2JW4A 1OZ2A 1W2BA 3CC2A 2FHDA 4E6RA 3CMEA 2QQAA 2EGAA 2F2VA 5LJ5g 1E6HA 5DM7R 3QBYA 3LLRA 3SEMA 2MIOA 3EH2A 4XTUA 4B9WA 4BUGA 2KEAA 3CCJT 5GAN5 1QKXA 4F04B 2QA4Q 1YJWA 2QASA 3HPWA 2EVRA 2DETA 3OS0A 4C92A 5IHKA 2K9GA 2HKQB 1BIAA 1MUZA 5CQYA 1G83A 1NJIC 2R5AA 2CP2A 4ZTFA 8AT1B 2K3BA 1RADB 3SB2A 3I5SA 3NHNA 2G6FX 4RTZA 5GAN7 4EMKA 2ECZA 3RDVA 5DY9A 2HCKA 1OPLA 4F7UE 2EQMA 1UGQB 1D3BA 4IUTA 1BKBA 4RMOA 4OGEA 4ZN1A 3JCMW 3S6WA 1HSQA 1TUCA 3EG9B 4MMKA 3VS4A 1YJNQ 1V1CA 4C0DB 4CC2A 2AKLA 2NUPA 2EGEA 1M2OA 3A8OB 4LE9A 4IUPA 1U1TA 3GP8A 3O8VA 3G7ZA 4XAXB 1G3WA 2GTOA 4E7KA 2LT1A 4PJOE 3EGDB 4N0AC 1OU9A 4DBQA 2P0QA 1Q82C 1UGPB 1WHHA 4C8QD 3VU3C 2OI3A 4HCBA 1N9RA 3R6OA 3PIPA 2HL3A 2ZPIB 3EHQA 2LNHB 2DFUA 4RCCA 3EAEA 1AWJA 2KRSA 2YSQA 2FZGB 5GANj 4E7JA 4M7DC 2KRNA 3L2RA 3A8LB 4Y28E 3MHXA 2EPDA 2DRKA 1RAGB 3ME9A 5KYXA 3RMSA 4ELYC 2CYZB 2EKHA 2YRVA 1WHMA 2F5KA 2DTOA 5GAN6 4M7AE 4HT9A 3VS3A 2HAXA 4C92B 1MNDA 2B86A 4L5GA 3QSUA 3X20B 1Q86U 5HKCA 2QQ9A 4FIBA 1W4SA 5GAN2 3JB9F 4LXCA 4BE1A 2D0QB 2WACA 1JEGA 2EYXA 1NEBA 2KT8A 3MCAB 3Q1JA 3RKXA 2YLBA 1GL5A 3OY9A 2CKKA 1SPKA 2LC4A 2YUQA 3NFCA 1VQ7Q 2R58A 1EX4A 3CCRQ 3AHUA 2SEMA 4KT0E 1OZ3A 2RN8A 2DBMA 2EYYA 2GQIA 2RK2A 2RJDA 3I56A 5KCOA 4VUBA 2JTFA 1WI7A 2COWA 2EFIA 1SRLA 3CC4A 3BDUA 1M8VA 3CPWP 3M57A 2LQNA 2K5IA 2L3QA 4C92C 1OV3A 2CSQA 4MMLA 2O4XB 2E4HA 4HT8A 3M56A 3E9GA 5GANe 3PIOA 1M1GA 2CREA 1X69A 1X27A 2E3HA 2D9TA 5CKFA 1KIKA 1D1CA 1KD1R 2GNCA 3EFRA 1BCMA 3M9QA 5KYNA 4M78A 2EJ9A 4BI3A 3OYDA 1AWWA 3EGDA 4OMNA 4M7DG 1S72Q 3JB9J 2LCLA 1MGQA 1FMVA 3EGXB 2FRYA 4DA4A 2DAQA 2RQUA 1JQQA 1Q7YR 1JXMA 4RG8A 2XD0A 3HP9A 4R56A 3NGPA 4OB2B 1WX6A 2MWPA 3I55T 4FYXB 2DYIA 1JJ2S 4M77G 5KE3A 2FZCB 1LOJA 3M4GA 1FMWA 2RI5A 4E2FB 1YIJA 1ZQ1A 4A4HA 4FYVB 3CC7A 3OSSC 2P84A 5HY6A 2H3EB 5HCKA 3G6EQ 2X3XD 4XK8E 3CCLQ 1ACMB 9ATCB 2XU8A 3MP8A 3M59A 2ZGWA 5LJ5e 3M54A 2LQWA 3OYYA 1Q7YC 5FLXE 4MZTA 4PJOD 4QW2A 2QI2A 2QA4A 1LPLA 2H8HA 3GBQA 1NZ9A 1X75C 4QKUA 3NTIA 4J9IA 4C92E 5CO7A 1MMGA 1QLYA 2X9HA 4OB1B 5LJ5j 1M8MA 1MMNA 3CCQA 2AZVA 3LX7A 3E1SA 4J8OA 4M7DA 3QHSA 1UHCA 2K79A 3E19A 5CVIA 1TH7A 4AG2C 2QGGA 3LYIA 5A0GA 4XU1A 4J7FA 2DZ9A 3EGUA 2MWOA 4PJJA 3QKJA 1VQ5A 3VRZA 2EJFA 2HL5C 4IURA 1D1BA 2Y4XA 3EG9A 4ZTJA 4X1VA 3EHRA 3QDRB 4XTZA 1I0CA 2FPDA 4LD6A 3L2UA 4AFZC 1K73R 3JB9G 3RERA 1VYVA 2E5QA 3PMIA 3KXTA 2QTXA 3BW1A 3CPFA 2V8JA 1PCXA 1WNLA 2OJ2A 2LT4A 2AHJB 1MNEA 3LWHA 1YJNT 3BY7A 1ZA2B 5A2QE 4M77F 2DRMA 1ZSGA 1K9MC 1X01A 4B6MA 2FVUA 4XU2A 5GAN3 4TVRA 2BE7D 1QKWA 3QO3A 2HQXA 3C0CA 4DBHA 1Q81U 1IGQA 1OU8A 3M55A 1KC8U 1PRLC 4CRIA 1C1AA 3SFMA 1VQ9Q 1JRIA 4HVVA 4IUVA 2JUFA 2X4WA 4IUUA 3CCEA 4JRPA 1YBYA 3QIIA 2W10A 2RHXA 3OYLA 3OMGA 4HCCA 3PTAA 1K0SA 3I55A 4HA8A 4C8QF 2RI3A 1VOMA 1QWEA 4DQ2A 1R77A 2K57A 4AT1B 1HJDA 1B3QA 4JZ4A 3OSVA 1BYMA 4EMGA 2ZPEB 1JU5C 4QQDA 2GTJA 2QEXA 1VQ5Q 1XTDA 2X3WD 3OA6A 1T3LA 1NJIR 2RHYA 1X6BA 1AD5A 2W0ZA 2RHIA 3M5AA 4PFZA 4FSSA 2EQKA 3H8ZA 4DEXA 1TWBA 2NYSA 1NYGA 2E70A 2BTTA 4RTWA 1UGVA 3L2ZA 4J5YA 2AZSA 2YDLA 1N8RC 1JO8A 2P4RA 2RJCA 2ROTA 2CUBA 3VYHB 2LX9A 3UT1A 2DJQA 1KQ2A 2XHCA 2RF0A 2E6ZA 4JRQA 1PSFA 2YHTA 2EQUA 4PJOG 2DZCA 1MHNA 3CCRT 1RAHB 4M78E 5GMKm 4OP0A 1M2VA 3CCJQ 2K5FA 5CQXA 3OYKA 4RTYA 5GAOl 1YIJQ 1IXDA 2XIDA 3JCMh 2DILA 2XMFA 3GIBA 3TSZA 1NE8A 5GAOn 3NTKA 2C0IA 3AT1B 4OMOA 1M1KU 1AZEA 2DTHA 3GNGA 4J6YA 2KI7A 2VUBA 4PJNA 4BDZA 4M7DF 4F7UG 2YUOA 3HRTA 2VC8A 3JCMe 4HCZA 4A54A 2KMTA 3EFOB 5CK9A 3V8JA 1QVGA 1UHFA 5CKHA 1VIFA 3EFSA 2OTJT 4EMKB 1UGSB 5I2MA 4IKFA 4N0AA 3FJPA 2C06A 1Y0MA 1BI1A 1QVFA 1RAFB 4ANJA 1WZOA 4YTLA 5EC7A 3PVQA 1X2KA 2YLCA 4R55A 1S72T 2HMAA 5DLQE 1K73C 3KFVA 2RHZA 1J3TA 5GJVB 2B8AA 2GFUA 1K9AA 2KAFA 2HBPA 1D0YA 4C92G 1NG2A 3INZA 1GFCA 2DXUA 1C6VX 1YITQ 1AEYA 3CMAT 3H6ZA 1EZZB 3C94A 4BB7A 2J6OA 3X28B 2V1RA 1VYTA 2RM4A 1FXXA 4RKUE 2KBTA 1KJWA 3CPWS 2ED1A 4M7AA 2DTIA 3H9NA 4D6WA 2E5KA 3DLMA 2CZ0B 2KT1A 1TSFA 3JCMd 4OMQA 4QT7A 2EQIA 3V7RA 5IXFA 1K73U 1QQJA 1OYXA 1UDLA 3SWNC 3G6EA 3CCEQ 1WDXA 3S3NA 1W1FA 4J9DA 1BI3A 4M77E 2JXBA 5LJ3d 5LJ3e 4XTXA 2R5MA 4FU6A 3SDZA 1VQOT 2QEXQ 1W2BP 3ER0A 1HK9A 2PU9B 3CBMA 4E47A 1WJRA 3OBWA 5IH2A 2M1HA 2QGFB 1YJWQ 3FLGA 1VQLT 4QQGA 2L5QA 3URGA 2CSIA 2K3XA 2XG8D 1UFFA 4E7ZA 1H641 1PG5B 2BIVA 1JJ2P 2VB6A 3MP1A 2KSSA 1VQ7T 2FRWA 5KYUA 4PJLA 3EFOA 1AHJB 1W6XA 1K9MU 1LNXA 2LQKA 3G4SA 3SHWA 5KYWA 1K8AU 1T3SA 1YHQT 2EIFA 2X4YA 3RKWA 2CP5A 2JS0A 5CR2A 3OW2P 1QW1A 5M9OA 4LDUA 1GRIA 2KGTA 3EH1A 5GAMj 3HRSA 5D6XA 3TREA 5GAMg 4DEYA 4B9XA 4OF1A 3CXCP 1BI0A 4PKCC 3VV0A 3UWNA 1AOJA 5FU6C 1D0ZA 3SD4A 3VJPA 1FMKA 5GAMh 2EJGA 3CXCS 2RA2A 1M90U 1MV0B 1CSKA 1YWOA 2JN0A 4ESRA 1N8RR 5GAOr
chains in the Genus database with same CATH topology
2FL7A 1O75A 2V8IA 3CXCA 4MDXA 5IN1A 4XU0A 3I56A 5KCOA 1B34A 2JTFA 4VUBA 2ZPGB 4C5EA 1UEBA 2F69A 1I4K1 2KDSA 2DXCA 2EFIA 5A0DA 3JCMJ 1YI2A 3CC4A 3BDUA 1M8VA 2IG0A 3M57A 3VKIA 3OYNA 4GLKA 2K5IA 2P0PA 4BACA 3HRUA 3CMAA 2L89A 4C92C 3OW2A 1ZHIA 3JRZA 3X26B 4IUQA 3M58A 1DJ7B 2NLUA 2O4XB 2P0KA 4MMLA 4DOWA 1YI2T 3CC2T 4HT8A 5DLOA 2GFAA 3M56A 1VQ5T 3E9GA 2DXTA 5GANe 5I2SA 5GANd 3QZ5B 3PIOA 1M1GA 5CKFA 2D9TA 3VYGA 2M9UA 3C95A 1Y96A 4M7AG 4PJOB 4M77A 3EFRA 2XDPA 4J83A 3CCVT 3M9QA 1U1SA 3RUXA 1M5Q1 4M78A 4M7DB 3QYGB 2EJ9A 4BI3A 3OYDA 2HQEA 2A3LA 4M7DG 3DLLA 2LQ8A 3CBOA 3CBPA 3M53A 3QUIA 5KE2A 2ZPHB 3A8GB 3UDCA 3JB9J 3JCMV 2LCLA 1MGQA 3WXMB 4MDWA 4M78B 4JS4A 4E7HA 4DA4A 2DAQA 3JB9D 2OTJA 4JLIA 1VQ4T 3L2QA 1KD1C 3X25B 4RG8A 5J39A 3FC3A 2XD0A 2G3RA 2MAMA 3HP9A 4A4KA 4R56A 2DIGA 4OB2B 3OYJA 1JB0E 5CKDA 1Y71A 3CEYA 2CZ6B 2MWPA 3JCMg 3OYMA 2CS7A 2DJZA 3I55T 3CCMT 3TEEA 1JJ2S 4M77G 3CCUA 5KE3A 5GAOp 3CMET 2E12A 2P4TA 2EQJA 1LOJA 3M4GA 4J6WA 3JCMX 1K8AC 2RI5A 3GLXA 1YIJA 4XQ3A 1ZQ1A 4Z02A 2XDBA 4A4HA 3G71A 5FU7C 5LJ3j 2Y4YA 3FEOA 3CC7A 3OSSC 4N4HA 3FIFA 1KHIA 4C8QA 5HY6A 5L8RE 1XQHA 1YIJT 4XK8E 2E1HA 3OW2S 4M7DE 2XU8A 3MP8A 4LDYA 4BY6B 1YITT 3M59A 2JOYA 4BD3A 2BKDN 3HSBA 3PT9A 1XOVA 2ZGWA 2DO3A 3M54A 5LJ5e 2XKOC 3OYYA 1VQNA 2X4JA 4KUIA 4ZGDB 1Q7YC 5LJ3f 5FLXE 2LNVA 4MZTA 4PJOD 4QW2A 2QI2A 2QA4A 1YITA 5CAIA 1N9SA 3OYAA 1NZ9A 2WSEE 4OMFB 3OS1A 1X75C 2VGMA 3OQ5A 3PGGA 3NTIA 1N6AA 4C92E 5FRNA 2OTLT 5CO7A 4LDWA 1VUBA 3KUFA 3G4ST 1G3YA 2VXFA 3MEAA 4OB1B 1WQWA 1Y96B 1NPRA 4PL6A 4C8QG 5LJ5j 1QP3A 3CD6A 3HHTB 3META 3L1AA 3CCQA 4ATOA 3CCET 4EMHA 2EWNA 3E1SA 3LX7A 4J8OA 5GMKj 5IT9E 4M7DA 5CKBA 3KBGA 3QHSA 4EMKC 4X34A 2PVOB 3HKSA 4F7UA 3CCSA 2CZ7B 3E19A 5CVIA 4DOVA 2KQWA 1VQOA 1TH7A 1VQNT 3LYIA 5A0GA 2E6NA 4XU1A 3JB9H 4J7FA 2DZ9A 1D3BB 3JB9I 2K3YA 2MWOA 3QG1A 5GAMf 4KUDK 3QKJA 1VQ5A 2PVDB 2EJFA 4IURA 3OYBA 1WJSA 3JCMQ 2Y4XA 1WJQA 1KC8C 2DVEA 2KVQG 4BDYA 4ZTJA 1YJNA 1Q82U 4XTZA 3QDRB 4M78C 5D6WA 5GMKi 3CCLT 4LD6A 3L2UA 1JBMA 2FYKA 4XU3A 4RCBA 3RESA 4C5HA 4C92D 5C0MA 1VQKA 3JB9G 2O01E 4M78F 4LDVA 3RERA 2DD4A 3GOXA 2XI9A 2E5QA 4C0FA 3FDRA 4PNOA 1PSEA 3BFMA 2IVWA 3PMIA 3P8HA 3KXTA 1KQ1A 4M7AC 3TCJA 3N5BB 2QTXA 3BW1A 1FWZA 4LDXA 4J7IA 3CPFA 2V8JA 3PNWC 3V8KA 2O4XA 1WNLA 2LT4A 2EAYA 3FRNA 3VUBA 3OBYA 1LJOA 2AHJB 5I21A 3L2VA 4QVZA 1RL2A 3A5ZB 3OS2A 3RMQA 3LWHA 1UGRB 1YJNT 3BY7A 1YCYA 2RJEA 3F70A 5A2QE 4M77F 3CCRA 1QVFS 5A0LA 1K9MC 4PLLA 2PVGB 1X01A 4Y91A 5GMKe 1O9SA 2RD1A 2FVUA 4XU2A 5GAN3 4N4GA 1W2BS 4TVRA 2K2VA 4QQ6A 3QO3A 3GPLA 2HQXA 3CCJA 4KBMB 3OB9A 5FU7B 5EG2A 1Q81U 2QDYB 1VQLA 2JTMA 4Q5WA 3M55A 3MEUA 5LJ3h 2K4YA 4C8QB 5AYFA 1G3TA 4CRIA 1KC8U 2QEXT 3CCMA 1Q81C 3QYHB 4XTWA 2GCXA 3SFMA 3L42A 3X24B 2K5LA 3MEVA 4PLIA 1IREB 2ZPFB 1JRIA 3CCUT 2XK0A 1NJIU 5LJ5d 3SWNA 2I2LA 4MZPA 2QQRA 4IUVA 2JUFA 2X4WA 4FT2A 4IUUA 1NPPA 3CCEA 2RHUA 4JRPA 1YBYA 3JSCA 3QIIA 4E7LA 2RHXA 3OYLA 4LD9K 3OMGA 4F7UB 2PUOB 1YJWT 3PTAA 4HCCA 3CPWA 5J3BA 2DD5A 4OB0B 4FSXA 4M75A 1YJ9T 1R8OB 3I55A 2QQSA 4HA8A 4C8QF 2RI3A 2M0OA 4M75E 2WSFE 4J6XA 1M1KC 3FB9A 4DQ2A 2VYTA 4NL2A 2K57A 3HFOA 5J26A 5GAN8 3ZEHA 1KG1A 5GAN4 2JNGA 2E10A 3OSVA 1BYMA 2KK4A 4EMGA 2DK3A 4M78G 2ZPEB 4BE0A 3DKMA 5HK3A 2RI2A 3M4YA 1VQ6A 4QQDA 4PJOC 5GAOm 3A8MB 2JVVA 4C0GA 2VGNA 3OYGA 2V8KA 3I56T 1XTDA 2QEXA 2CGHA 1M9SA 3OA6A 1BI2A 3TU4K 3CC7T 5GAMe 5GAMd 2RHYA 3WVEB 3S3OA 1VQMT 2GQVA 1WGSA 2PQWA 2RHIA 1OI1A 3M5AA 2DKGA 3MO8A 2EQKA 3H8ZA 3C12A 2WSCE 2MMPA 1GXIE 5FRMA 3CD6T 1M4ZA 3RKYA 5GANf 2E70A 3CCQT 5LJ3g 2RH2A 3J81E 1VQPT 4MZMA 2E65A 3L2ZA 4A4FA 1P92A 4J5YA 4RG2A 3CCST 1Y7XA 2LCCA 3MP6A 4A53A 4ME7A 3OMCA 4C8QC 5CCAA 2RJCA 1N8RC 3VYHB 3JCMP 5FROA 1Q86C 2XDDA 4BI4A 2EYQA 2LX9A 3UT1A 4OB3B 4A4EA 3QJYA 4EPCA 3L2WA 1VQPA 2EKOA 4XTYA 5IAYA 3WVDB 5GAOq 1KQ2A 5CIUA 4ZGEB 2XHCA 1HXDA 2LDMA 2E6ZA 5GANh 4JRQA 4M78D 2ZCFB 4II1A 3C4SA 2X4XA 4JS5A 1PSFA 1ZBXA 3LGFA 4ZN3A 3E9FA 4CI0C 1U8RA 1VQ7A 2YHTA 2EQUA 2GF7A 3LGLA 4HKEA 5FU6B 4M7DD 4PJOG 3OYEA 2DZCA 1KHCA 4GY5A 4C5GA 1EIFA 1MHNA 2RB6A 3CCRT 1BIBA 3QXEB 4M78E 4C0ZA 5GMKm 4OP0A 3JAME 2DPPB 2K5FA 1RI0A 4X9DA 5CQXA 2M16A 3JCMf 3OYKA 1I5LA 5KCHA 4BY6C 1Q7YU 4P5NA 2D6FA 4M7AD 1X6OA 5GAOl 3OYIA 4M75G 2XIDA 3JCMh 4M7AB 3V7SA 1OZ2A 1KQSA 1W2BA 3CC2A 3LWIA 3GIBA 1VQ9A 2FHDA 1NE8A 3CMEA 5GAOn 1XNIA 3LW5E 3NTKA 4M77C 1Y07A 2QQAA 2QXFA 1M1KU 2E41A 2DTHA 3S3MA 5LJ5g 5DM7R 3DB4A 3GNGA 4J6YA 2HD0A 3OS5A 4ZGJB 1S72A 3QBYA 2VUBA 4BDZA 4M7DF 1I81A 4F7UG 3LLRA 3CCVA 3HRTA 2VXEA 4O6JA 4C0DC 4XTUA 4B9WA 4M75C 4BUGA 2VC8A 4ELZC 2OTLA 4N4IA 3P8DA 1KQSS 3CCJT 2Y90A 5GAN5 1YJWA 2PUKB 3JCMe 3HPWA 4HCZA 4NOYA 4OVAA 3P8BB 2KMTA 4A54A 3OS0A 2RJFA 5CKEA 4C92A 4C5IA 3V8JA 5CK9A 1QVGA 4M75F 1VIFA 2H3JA 4JRKA 1BIAA 5CKHA 4BI8B 3EFSA 2OTJT 4EMKB 4FL6A 4L59A 5CQYA 5LJ5h 1NJIC 1QP2A 2R5AA 1UGSB 5I2MA 1IZ6A 4ZTFA 4WF2A 1QVGS 4IKFA 4FT4A 4N0AA 2DEQA 3FJPA 2C06A 1BI1A 3SB2A 1M90C 5GAN7 1QVFA 4EMKA 4YTLA 3ZFJA 5C6SA 5DY9A 1S72T 2YLCA 4R55A 1N8RU 5GMKl 4QVCA 1WPYA 4X9CA 5DLQE 1K73C 1VQ8A 4F7UE 1YJ9A 2RHZA 2E64A 2EQMA 2RK1A 1UGQB 1D3BA 4IUTA 1BKBA 2B8AA 2L8DA 2GFUA 4C8QE 4OGEA 3DB3A 4ZN1A 4RMOA 2QA4T 3JCMW 2KAFA 2HBPA 2MI6A 3S6WA 2X35A 4C92G 4MMKA 3INZA 2XICA 1G3SA 4M75B 4O5VA 3UPUA 1VQ8T 2DXUA 4C0DB 3QPHA 1FX7A 3G6ET 5D6YA 1M1FA 4XTVA 4PJOF 3A8OB 3MEWA 4E7IA 4IUPA 3JCMb 1U1TA 1SSFA 3GP8A 3NTHA 3PMTA 3T9NA 3CMAT 3H6ZA 3C94A 4BB7A 3RIRA 1KD1U 3X28B 2RM4A 3O8VA 3PFSA 3G7ZA 4XAXB 1G3WA 1FXXA 1VQMA 4V2SA 4RKUE 4JDSA 3CPWS 4E7KA 4M7AA 3OYCA 2LT1A 2DIQA 4NS5A 5KH6A 4PJOE 4N0AC 2DTIA 4QVDA 3HFNA 4FM4B 4D6WA 2ZPBB 3DLMA 2CZ1B 2CZ0B 1H3ZA 3OYFA 2P0QA 2JZ2A 3ZBDA 3J7AF 1Q82C 1UGPB 4C8QD 3VU3C 3JCMd 3V7RA 2KY9A 1N27A 1K73U 1N9RA 1OYXA 3R6OA 3SWNC 3G6EA 4HCBA 3PIPA 3S3NA 2ZPIB 2BUDA 2F5TX 4JLGA 3LH0A 5LJ5f 1BI3A 4L6V5 4M77E 2LTOA 5LJ3d 1B34B 5LJ3e 4RCCA 4XTXA 2R5MA 4FU6A 3EAEA 3SDZA 1VQOT 3VUZA 5GANg 3CC4T 1VQ9T 4A4GA 5GANj 4OGCA 3ER0A 3BDLA 4E7JA 1HK9A 4M7DC 2PU9B 3CBMA 1V29B 4E47A 1WJRA 2LRQA 5GMKh 3OBWA 1I8FA 4NL3A 4JJNK 3GNFB 2M1HA 3V7CA 3L2RA 3A8LB 3FLGA 3MHXA 4Y28E 4QQGA 3QJ6A 1VQLT 2L5QA 2MF2A 3URGA 4PJOA 2DXBA 3ME9A 1UB4A 2K3XA 2XG8D 2LVMA 1VQKT 3RMSA 4ELYC 2CYZB 3G71T 1H641 2BIVA 2YRVA 2FB7A 2F5KA 5HK0A 2DTOA 5GAN6 4M7AE 3MP1A 2KSSA 4M77D 4BE2A 1VQ7T 4HT9A 3ASKA 2HAXA 4C92B 2ZZDA 1AHJB 4KULA 1K9MU 1VQ6T 1QVPA 4L5GA 1LNXA 2LQKA 3G4SA 3QSUA 3X20B 1Q86U 5HKCA 2QQ9A 1K8AU 3J80E 4FIBA 1W4SA 1YHQT 2EIFA 2X4YA 3RKWA 5GAN2 3JB9F 4M77B 5CR2A 4M75D 1QW1A 4M7AF 4JUVA 4BE1A 5M9OA 4EDUA 4LDUA 2D0QB 1VQ4A 3GF5A 3HL8A 2VV5A 2WACA 5LL6S 5GAMj 3HRSA 3OYHA 2HNIA 5D6XA 2RO0A 4F7UF 3MCAB 3Q1JA 3RKXA 3TREA 2A7YA 2YLBA 4C92F 2L3RA 3JCMc 5GAMg 1G5VA 4B9XA 3QZ9B 4OF1A 2CKKA 3OY9A 4JRIA 1BI0A 2LC4A 3NFCA 4PKCC 3SWNB 3UWNA 3VV0A 2R57A 2OAUA 2R58A 5FU6C 3AHUA 3V8LA 4KT0E 3CCLA 3SD4A 2QQBA 3VJPA 5GAMh 2EJGA 3A8HB 1OZ3A 1JJ2A 1VIEA 4UC4A 3CXCS 2RA2A 1WQ7A 1M90U 2RK2A 1YHQA 2JN0A 2RJDA 5GAOr
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJO F;  5GMK j;  4M7D A;  2DKG A;  3QHS A;  4XU0 A;  4EMK C;  3JCM b;  1U1T A;  1B34 A;  4F7U A;  3RIR A;  1TH7 A;  1I4K 1;  3JCM J;  2RM4 A;  3RKY A;  5GAN f;  4XU1 A;  4XTV A;  3JB9 H;  3BDU A;  2DZ9 A;  1D3B B;  5GAM d;  5GAM f;  5LJ3 g;  3JB9 I;  4V2S A;  1M8V A;  2E65 A;  3L2Z A;  2EJF A;  4M7A A;  4J5Y A;  3JCM Q;  4C92 C;  2DVE A;  4A53 A;  4C8Q C;  4PJO E;  4N0A C;  2DTI A;  4QVD A;  4XTZ A;  3HFN A;  4M78 C;  4MML A;  3JCM P;  4HT8 A;  3HSB A;  5GMK i;  1JBM A;  4XTY A;  4M7D D;  5GAN d;  2DXT A;  2FYK A;  4XU3 A;  5GAN e;  4RCB A;  3RES A;  4C8Q D;  4C92 D;  5GAO q;  3VU3 C;  1KQ2 A;  1HXD A;  3JCM d;  3JB9 G;  3RER A;  4M78 F;  5GAN h;  3V7R A;  4M78 D;  1N9R A;  1Y96 A;  3SWN C;  4M7A G;  4PNO A;  4PJO B;  3BFM A;  4M77 A;  3EFR A;  2YHT A;  1KQ1 A;  4M77 E;  4M7A C;  5LJ3 d;  1B34 B;  1U1S A;  4RCC A;  1M5Q 1;  2DZC A;  2QTX A;  3BW1 A;  4M78 A;  2EJ9 A;  4XTX A;  4PJO G;  4M7D B;  2RB6 A;  1BIB A;  5GAN g;  4M78 E;  5GMK m;  3V8K A;  4OP0 A;  4M7D G;  1WNL A;  3QUI A;  4X9D A;  1I5L A;  3JCM f;  2EAY A;  5GAN j;  3JB9 J;  4M7D F;  3JCM V;  1LJO A;  5I21 A;  4M7A D;  1MGQ A;  5GAO l;  4M78 B;  4M7D C;  1HK9 A;  4M75 G;  3JCM h;  4M7A B;  3V7S A;  3JB9 D;  3BY7 A;  1YCY A;  5GMK h;  4JLI A;  1I8F A;  4M77 F;  4NL3 A;  3V7C A;  3GIB A;  1X01 A;  4Y91 A;  5GMK e;  5GAO n;  5GAO r;  4M77 C;  2RD1 A;  4XU2 A;  4PJO A;  5GAN 3;  3JCM g;  2E41 A;  2DJZ A;  2DTH A;  3QO3 A;  5LJ5 g;  1H64 1;  4J6Y A;  4M77 G;  2FB7 A;  2DTO A;  5GAN 6;  5GAO p;  1I81 A;  4M77 D;  4F7U G;  4J6W A;  3JCM X;  1LOJ A;  3M4G A;  4HT9 A;  4M7A E;  5LJ3 h;  2VXE A;  4C8Q B;  4C92 B;  4XQ3 A;  4XTU A;  4M75 C;  2VC8 A;  5LJ3 e;  1LNX A;  3QSU A;  2Y90 A;  4XTW A;  5GAN 5;  5LJ3 j;  3JCM e;  4NOY A;  4A54 A;  1JRI A;  3FIF A;  5LJ5 d;  3SWN A;  2I2L A;  4C8Q A;  4C92 A;  3RKW A;  3V8J A;  5GAN 2;  3JB9 F;  4M77 B;  4M75 F;  4M75 D;  2E1H A;  1BIA A;  4JRK A;  3EFS A;  4M7A F;  4EMK B;  5LJ5 h;  4JUV A;  4F7U B;  4M7D E;  4WF2 A;  2ZGW A;  4N0A A;  5LJ5 e;  2DEQ A;  3FJP A;  5GAM j;  3RUX A;  4M75 A;  2HNI A;  3SB2 A;  4F7U F;  5GAN 7;  4HA8 A;  5LJ3 f;  3RKX A;  2YLB A;  4C92 F;  4M75 E;  4J6X A;  3JCM c;  4C8Q F;  4EMK A;  5GAM g;  4PJO D;  3FB9 A;  4DQ2 A;  4NL2 A;  2K57 A;  3HFO A;  5DY9 A;  5CAI A;  1N9S A;  5GAN 8;  4JRI A;  2YLC A;  5GAN 4;  2E10 A;  3SWN B;  4QVC A;  5GMK l;  1WPY A;  4X9C A;  4EMG A;  4M78 G;  4F7U E;  3AHU A;  3V8L A;  3PGG A;  2E64 A;  1D3B A;  2EJG A;  4C8Q E;  4C92 E;  5LJ5 f;  5GAM h;  5GAO m;  3JCM W;  4PJO C;  2VXF A;  2CGH A;  5GAM e;  1WQW A;  1WQ7 A;  1Y96 B;  2RA2 A;  4MMK A;  4C8Q G;  3INZ A;  4M75 B;  4C92 G;  5LJ5 j;  2JN0 A;  2DXU A;  3L1A A;  4EMH A;  2EWN A; 
#chains in the Genus database with same CATH topology
 2V8I A;  3CXC A;  3JCM J;  2DXC A;  1VQ6 Q;  5FW9 A;  3VKI A;  2DER A;  4GLK A;  2P0P A;  4BAC A;  3OW2 A;  1ZHI A;  1MMA A;  4IUQ A;  3M58 A;  1DJ7 B;  1TG0 A;  1QCN A;  2P0K A;  1YI2 T;  4JZ3 A;  2GFA A;  2D1X A;  5GAN d;  3I55 Q;  2ABL A;  2RMO A;  1TS9 A;  1ZLM A;  1Y96 A;  4PJO B;  1I1J A;  1U1S A;  3EGX A;  3VS2 A;  2A3L A;  3DLL A;  1SF9 A;  2LQ8 A;  3CBP A;  3QUI A;  1VQP Q;  2ZPH B;  3A8G B;  3JCM V;  1RLQ C;  4DBR A;  1IHW A;  1PM3 A;  2DL8 A;  1Q82 R;  3FC3 A;  2MAM A;  1NYF A;  4A4K A;  1UE9 A;  3OYJ A;  1KC8 R;  1Y71 A;  2J6K A;  3CEY A;  3I9Q A;  2CS7 A;  3CCU A;  3GLX A;  4F17 A;  3UF4 A;  4Z02 A;  2XDB A;  1AVZ C;  2ENM A;  1K0X A;  1OEB A;  2OAW A;  2MCN A;  4N4H A;  2LJ0 A;  2VKN A;  1XQH A;  4CC4 B;  4M7D E;  3PT9 A;  1XOV A;  4AFS C;  2XKO C;  2X4J A;  3CCM Q;  5CAI A;  2FPE A;  4OMF B;  2VGM A;  3PGG A;  2F2X A;  3CC4 Q;  2OTL T;  2VXF A;  2KRO A;  1WQW A;  2FPF A;  1NPR A;  3CD6 A;  3LH5 A;  1YP5 A;  3HHT B;  3UA6 A;  3MET A;  5ECA A;  4EMH A;  5IT9 E;  5CKB A;  4EMK C;  1KQS P;  3CCS A;  2YWW A;  2DA9 A;  1QVF P;  1VQO A;  1VQN T;  2E6N A;  3FJ5 A;  3JB9 I;  5GAM f;  3QG1 A;  4KUD K;  1X2Q A;  1Q82 U;  1M30 A;  2E3I A;  5D6W A;  5GMK i;  1YCS B;  1JBM A;  7AT1 B;  2YRC A;  4C92 D;  5C0M A;  2O9V A;  1R0B G;  3GOX A;  4IIO A;  3P8H A;  4LDX A;  3PNW C;  3V8K A;  1D1A A;  2O4X A;  1SG5 A;  2EGC A;  3FRN A;  3EG0 A;  3OBY A;  4QVZ A;  2QYZ A;  2LZ6 B;  3RMQ A;  1UGR B;  1QVF S;  3CCR A;  2KR3 A;  1O9S A;  2HSE B;  1B07 A;  2K2V A;  4QQ6 A;  1BBZ A;  1G8X A;  4Y92 A;  3CCJ A;  1IB8 A;  5FU7 B;  2GBQ A;  3OB9 A;  3E2U A;  2QDY B;  4KGX B;  2JTM A;  5LJ3 h;  5AYF A;  4RTX A;  3QYH B;  1NJI U;  2ZPF B;  2L3P A;  5LJ5 d;  1XJW B;  2I2L A;  4MZP A;  3VS5 A;  2RHU A;  4E7L A;  1D09 B;  2ATC B;  3RR6 A;  4LD9 K;  2YUP A;  5J3B A;  2L2P A;  2MK5 A;  3MKD A;  1R8O B;  2LJ1 A;  2FO0 A;  3FB9 A;  2VYT A;  5J26 A;  2JM8 A;  1KG1 A;  3ZEH A;  2E10 A;  4HVW A;  1UEC A;  3A98 A;  4M78 G;  1GCP A;  5KYY B;  3EG1 A;  3M4Y A;  4D8D A;  4PJO C;  3OYG A;  3I56 T;  1BI2 A;  2FEI A;  4Z88 A;  3TU4 K;  4JPB W;  3A1P A;  3WVE B;  3S3O A;  1VQM T;  1WGS A;  1NLO C;  1N5Z A;  1NLP C;  2YUN A;  2ZAE A;  1ABQ A;  2ESW A;  2GGR A;  1Q81 R;  1VA7 A;  2VWF A;  1ZSZ B;  4J9C A;  2E65 A;  4A4F A;  1P92 A;  4RG2 A;  3MPU B;  1Y7X A;  2LCC A;  3MP6 A;  4C8Q C;  5CCA A;  1YHQ Q;  4FYY B;  1VQ4 Q;  2M51 A;  2COY A;  2XDD A;  1IHV A;  4BI4 A;  3QJY A;  5IAY A;  5AT1 B;  4ZGE B;  5GAN h;  2OTJ Q;  2DEU A;  3REB B;  4CI0 C;  1ZBX A;  3LGF A;  2A08 A;  3E9F A;  1U8R A;  4WTO B;  3M0P A;  5FU6 B;  3VS6 A;  4M7D D;  1GCQ A;  4GY5 A;  2D8J A;  4PJM A;  1TTH B;  1I5L A;  1RI0 A;  4PK4 A;  5KCH A;  2D6F A;  1M3C A;  1PNJ A;  1RUW A;  5KYX B;  1KQS A;  2CT3 A;  1WXB A;  1VQ9 A;  4IIM A;  4M77 C;  3LW5 E;  1Y07 A;  1QCO A;  1ZBJ A;  2KXD A;  2YRD A;  1R0C B;  1RI9 A;  3OS5 A;  3CMA Q;  2MOX A;  1I81 A;  3CCV A;  4C0D C;  1OQK A;  2JTE A;  1EFN A;  2CP0 A;  3U23 A;  4ELZ C;  2OTL A;  4N4I A;  3P8D A;  1WHG A;  2AT1 B;  2O9S A;  2Y90 A;  1YI2 Q;  1KQS S;  2PUK B;  4NOY A;  3P8B B;  2RJF A;  3H0I A;  5CKE A;  4C5I A;  3REA B;  2H3J A;  4RTU A;  5LJ5 h;  4FL6 A;  4ORZ A;  1IZ6 A;  1QVG S;  2DEQ A;  2CUD A;  4JJC A;  1E6G A;  1M90 C;  3ZFJ A;  1BK2 A;  5C6S A;  1M1K R;  1N8R U;  4QVC A;  1WPY A;  4X9C A;  1VQO Q;  1VQ8 A;  1YJ9 A;  2RK1 A;  4C8Q E;  1SKU B;  2HZY A;  3DB3 A;  3VS7 A;  1G3S A;  4O5V A;  3UPU A;  3QPH A;  3G6E T;  5D6Y A;  4XTV A;  4PJO F;  2HEQ A;  1VQL Q;  4E7I A;  1SSF A;  3PMT A;  2NUT B;  4GBQ A;  3RIR A;  1KD1 U;  1VQM A;  1AWO A;  4F16 A;  3OYC A;  1QVG P;  4AG1 C;  4QVD A;  4FM4 B;  2ZPB B;  2JZ2 A;  3J7A F;  2JMC A;  1ZX6 A;  1RLP C;  1W70 A;  2BUD A;  2F5T X;  2LTO A;  2D8H A;  2ROL A;  5GAN g;  1ZUK A;  3CC4 T;  2DBK A;  3BDL A;  1V29 B;  2LRQ A;  4NL3 A;  4JJN K;  3V7C A;  1ZSZ C;  2O88 A;  2DXB A;  1UB4 A;  1VQK T;  2JT4 A;  3G71 T;  4RTT A;  2FB7 A;  5HK0 A;  1SHG A;  1ZA1 B;  1GFD A;  4KUL A;  1VQ6 T;  2CP7 A;  2BZX A;  4J9G A;  1KSW A;  4M75 D;  2F2W A;  4M7A F;  1VQ4 A;  3HL8 A;  2L3S A;  2VV5 A;  4J9B A;  2RO0 A;  4F7U F;  4C92 F;  2DL5 A;  1G5V A;  1WXU A;  3THK A;  4JRI A;  3SWN B;  3QWY A;  2R57 A;  2OAU A;  3V8L A;  1WYX A;  5KYU B;  1JJ2 A;  2J05 A;  1WQ7 A;  3TQ7 P;  1Q86 R;  4FW2 A;  2FL7 A;  3M0S A;  4MDX A;  1B34 A;  1H8K A;  2ZPG B;  3H0F A;  3NMZ C;  2DM1 A;  1UEB A;  2F69 A;  1I4K 1;  2KDS A;  1YI2 A;  4JJB A;  4EIK A;  1SSH A;  2KNB B;  1I07 A;  1GBR A;  3HRU A;  2L89 A;  3CC2 T;  4DOW A;  1ZUY A;  1M2V B;  4R0K A;  1NEG A;  1VQ5 T;  1SEM A;  2DXT A;  3QZ5 B;  5IHN A;  3VYG A;  2M9U A;  3C95 A;  4M4Z A;  1UJ0 A;  2XDP A;  1K1Z A;  3CCV T;  3RUX A;  4M7D B;  1M5Q 1;  3QYG B;  1ARK A;  3CBO A;  3M53 A;  4LUD A;  3UDC A;  2DNU A;  1AZG B;  4MDW A;  4E7H A;  3JB9 D;  2PNI A;  2OTL Q;  3L2Q A;  2G3R A;  2DIG A;  3JCM g;  3CCM T;  3TEE A;  1UJY A;  2E12 A;  3JCM X;  5I11 A;  4F14 A;  1U3O A;  3FEO A;  2RNA A;  2QTV A;  1KHI A;  4C8Q A;  5L8R E;  3JV3 A;  4FCY A;  3EG2 A;  1YIJ T;  3OW2 S;  6AT1 B;  4BY6 B;  4BD3 A;  2JOY A;  2KE9 A;  3HTR A;  2I0N A;  2DO3 A;  4KUI A;  4ZGD B;  2LNV A;  3OYA A;  2IIM A;  3OS1 A;  2WSE E;  2HSP A;  3D7S B;  5FRN A;  1VUB A;  3KUF A;  1ZSZ A;  1KK7 A;  4OMM A;  3MEA A;  4PL6 A;  5I22 A;  3L1A A;  1PWT A;  2BE9 B;  2SRC A;  2EWN A;  4X34 A;  2KQW A;  2OX7 A;  3CME Q;  3M0T A;  2O31 A;  1D3B B;  2NWM A;  2K3Y A;  1LVK A;  2KRM A;  5IXB A;  3OYB A;  1WJQ A;  2DVE A;  2KVQ G;  4BDY A;  1YJN A;  4M78 C;  1M3A A;  3EG3 A;  1I5O B;  3IQL A;  2RPN A;  3G4S Q;  4XU3 A;  4C5H A;  2DE0 X;  4E7S A;  1K4U S;  1RAI B;  2O01 E;  4LDV A;  4LNP A;  3FDR A;  3N5B B;  1RAB B;  1YN8 A;  2DL7 A;  2QG9 B;  1BCO A;  1LJO A;  3L2V A;  2AIR B;  2CDT A;  2RJE A;  3F70 A;  3I56 Q;  2PVG B;  5KYY A;  1BU1 A;  2RD1 A;  1VQM Q;  4N4G A;  1YWP A;  1W2B S;  1WXT A;  1IO6 A;  1PKT A;  4KBM B;  1K8A R;  5EG2 A;  4PFO A;  3MEU A;  1M3B A;  2K4Y A;  4C8Q B;  1G3T A;  2RQW A;  2QEX T;  2BZ8 A;  1D0X A;  2GCX A;  3O5Z A;  4PLI A;  3X24 B;  3CCU T;  1IRE B;  2XK0 A;  2J6F A;  5FWC A;  1NBE B;  2QQR A;  4CC3 A;  3JSC A;  1YJW T;  1Z9Z A;  3CPW A;  2K6D A;  5GJW B;  1YJ9 T;  1RAC B;  4KGZ B;  4M75 E;  4J9E A;  2JM9 A;  4NL2 A;  5GAN 8;  5GAN 4;  2JNG A;  5HK3 A;  2RI2 A;  1VQ6 A;  2M0Y A;  5GAO m;  3A8M B;  3RBB B;  4C0G A;  2V8K A;  3CC7 T;  2L0A A;  2GQV A;  2DKG A;  3MO8 A;  2WSC E;  1GXI E;  5FRM A;  1PKS A;  2DL4 A;  5GAN f;  3VS0 A;  2LMJ A;  4MZM A;  2DMO A;  3CCS T;  4A53 A;  4ME7 A;  3JCM P;  5FRO A;  2KYM A;  2EYQ A;  4EPC A;  1VQP A;  3L2W A;  3M0Q A;  2EKO A;  4XTY A;  1SHF A;  2V26 A;  3BE3 A;  5CIU A;  2EBP A;  2LDM A;  4M78 D;  4II1 A;  3C4S A;  2VVK A;  4ZN3 A;  1C0M A;  4KRT A;  1VQ7 A;  3LGL A;  4HKE A;  3OYE A;  4C5G A;  1EIF A;  2RB6 A;  4KH0 B;  4C0Z A;  3JCM f;  3NPF A;  4FW1 A;  4BY6 C;  1Q7Y U;  4M7A D;  1X6O A;  3OYI A;  4KH1 B;  4M7A B;  3V7S A;  1S1N A;  3LWI A;  5D7U A;  1XNI A;  2QXF A;  1CKB A;  2E41 A;  3VS1 A;  3PVL A;  3S3M A;  3CD6 Q;  3DB4 A;  3CCQ Q;  2HD0 A;  4ZGJ B;  1S72 A;  2VXE A;  4O6J A;  4M75 C;  1QCF A;  1H92 A;  4K11 A;  4OVA A;  1TUD A;  4M75 F;  4BI8 B;  4JRK A;  1OOT A;  2A28 A;  4L59 A;  1QP2 A;  4WF2 A;  4FT4 A;  1PHT A;  1E7O A;  1OPK A;  5GMK l;  2E64 A;  4LUE A;  2EW3 A;  5LJ5 f;  2L8D A;  4AMC A;  4CC7 A;  1OX9 A;  2QA4 T;  1X6G A;  2A36 A;  2MI6 A;  2X35 A;  4M75 B;  2XIC A;  1WFW A;  1VQ8 T;  1FX7 A;  1M1F A;  3MEW A;  2PTK A;  3JCM b;  1NM7 A;  3NTH A;  3T9N A;  3TSW A;  2J06 A;  1VQK Q;  3PFS A;  3G71 Q;  4V2S A;  3ULR B;  4JDS A;  2DIQ A;  4NS5 A;  5KH6 A;  3HFN A;  2CZ1 B;  2MYS A;  2AKK A;  1H3Z A;  3OYF A;  3ZBD A;  3M0R A;  2NUZ A;  3ZL7 C;  1X43 A;  4PFP A;  2KY9 A;  1N27 A;  4JLG A;  2NUP B;  3LH0 A;  4L6V 5;  2O2O A;  1B34 B;  3TVT A;  4D8K A;  2JMA A;  1VQN Q;  3VUZ A;  1A0N B;  3CQT A;  4A63 B;  1B7T A;  1VQ9 T;  4KGV B;  4A4G A;  4OGC A;  1M90 R;  1PRM C;  1H3H A;  5GMK h;  1I8F A;  1IGU A;  3GNF B;  4WCI A;  3QJ6 A;  2MF2 A;  1IRX A;  4PJO A;  4LN2 A;  2LVM A;  5FWB A;  4HCK A;  1K76 A;  1ABO A;  4M77 D;  4BE2 A;  3ASK A;  2ZZD A;  1QVP A;  3G1J A;  4OML A;  1YNZ A;  4JJD A;  1M27 C;  3J80 E;  3UAT A;  4M77 B;  2HQH A;  1HYO A;  2HKN A;  1PC0 A;  4JUV A;  4EDU A;  3GF5 A;  1BB9 A;  5LL6 S;  3OYH A;  2HNI A;  1UUE A;  3QWX X;  2RQV A;  2A7Y A;  2L3R A;  3JCM c;  3QZ9 B;  2CP6 A;  2FG0 A;  3CC2 Q;  3CCL A;  2QQB A;  4Z89 A;  3A8H B;  1VIE A;  4UC4 A;  1TU0 B;  2PZ1 A;  1YHQ A;  1O75 A;  5IN1 A;  4XU0 A;  3CCV Q;  2DVJ A;  4FYW B;  1WLP B;  1TUG B;  4C5E A;  5A0D A;  2QDL A;  2IG0 A;  3OYN A;  2LJ3 A;  3CMA A;  1OX8 A;  1Q95 G;  2DF6 A;  2K2M A;  3JRZ A;  3X26 B;  2NLU A;  1WA7 A;  2J7I A;  1HD3 A;  5DLO A;  2QK0 A;  5I2S A;  1V76 A;  2X51 A;  4M7A G;  4M77 A;  4J83 A;  1MV3 A;  5KYW B;  2HQE A;  4Z8A A;  2Z0W A;  5KE2 A;  3WXM B;  2D0N A;  4M78 B;  4JS4 A;  2C0O A;  3H0H A;  2OTJ A;  4JLI A;  1VQ4 T;  2C0T A;  1KD1 C;  3X25 B;  5J39 A;  4ZNX A;  1JB0 E;  5CKD A;  2CZ6 B;  3OYM A;  1WHK A;  4AFU C;  2DJZ A;  1LCK A;  1GCQ C;  3M0U A;  1PD1 A;  3H41 A;  3I35 A;  1UTI A;  5GAO p;  3CME T;  1JXO A;  2P4T A;  2EQJ A;  4J6W A;  1K8A C;  4XQ3 A;  2VAS A;  2DL3 A;  3G71 A;  5FU7 C;  5LJ3 j;  2Y4Y A;  3FIF A;  2JJ9 A;  4GLM A;  2E1H A;  1U06 A;  2F1L A;  4LDY A;  1YIT T;  3I5R A;  2BKD N;  2NUT A;  3RNJ A;  1UG1 A;  1VQN A;  2AK5 A;  2ED0 A;  2RQR A;  5LJ3 f;  1RAE B;  1YIT A;  8ATC B;  1N9S A;  2CH4 W;  3OQ5 A;  1ZUU A;  1N6A A;  4HVU A;  2LCS A;  3MJX A;  2YXY A;  4LDW A;  3G4S T;  1G3Y A;  1Y96 B;  4C8Q G;  1QP3 A;  4ATO A;  3CCE T;  5GMK j;  2M02 A;  2RQT A;  3KBG A;  2IPO B;  2PVO B;  3HKS A;  4F7U A;  2V1Q A;  2CZ7 B;  4DOV A;  2HDA A;  3JB9 H;  2PVD B;  1WJS A;  2DYB A;  3JCM Q;  1KC8 C;  2MPX C;  1WIE A;  3CCL T;  1KFZ A;  2FYK A;  4OMP A;  4RCB A;  3RES A;  4RTV A;  1VQK A;  4M78 F;  2DD4 A;  2XI9 A;  4C0F A;  1GBQ A;  1Z9Q A;  4PNO A;  1PSE A;  1TOV A;  2IVW A;  3BFM A;  1G2B A;  1KQ1 A;  1SRM A;  2FZK B;  4M7A C;  1YJ9 Q;  1FYN A;  3TCJ A;  3PE0 A;  1AT1 B;  1FWZ A;  4J7I A;  3CCU Q;  2EAY A;  3VUB A;  3R6N A;  4DBF A;  5I21 A;  3UA7 A;  1RL2 A;  3A5Z B;  3OS2 A;  1VQ8 Q;  1YCY A;  5A0L A;  4PLL A;  3CC7 Q;  4Y91 A;  5GMK e;  1WHL A;  2A0F B;  3GPL A;  1CKA A;  1VQL A;  2JS2 A;  4Q5W A;  2DX1 A;  1QWF A;  3CCM A;  1Q81 C;  4XTW A;  3L42 A;  2K5L A;  3MEV A;  3SWN A;  1AWX A;  4FT2 A;  1NPP A;  2DLP A;  1K9M R;  4F7U B;  2PUO B;  1MMD A;  2DD5 A;  2YT6 A;  4OB0 B;  2KXC A;  3QDF A;  4J9H A;  4J9F A;  1OUL A;  4FSX A;  4M75 A;  2QQS A;  2M0O A;  1M1K C;  2WSF E;  4J6X A;  1QMC A;  3HFO A;  2CH4 A;  3CCS Q;  1Y57 A;  2KK4 A;  2DK3 A;  4BE0 A;  1TXQ A;  3DKM A;  2JVV A;  2LP5 A;  2VGN A;  2CGH A;  1M9S A;  2COZ A;  1T0J A;  5GAM e;  5GAM d;  4AFQ C;  2PQW A;  2A37 A;  1OI1 A;  2QAZ A;  1U5S A;  1YFN A;  3C12 A;  2MMP A;  1T0H A;  3CD6 T;  2CP3 A;  1M4Z A;  3RKY A;  3VRY A;  3CCQ T;  5LJ3 g;  2RH2 A;  3J81 E;  1VQP T;  2K7A A;  2BZY A;  3OMC A;  1Q86 C;  3HSB A;  4A4E A;  4OB3 B;  5L23 A;  3WVD B;  5GAO q;  1F1B B;  1HXD A;  2EYW A;  2LX7 A;  1WHJ A;  2KYB A;  2ZCF B;  2X4X A;  1RAA B;  4JS5 A;  1PD0 A;  5IHI A;  2HBW A;  2GF7 A;  1KHC A;  1VYU A;  2CT4 A;  1BIB A;  3QXE B;  3JAM E;  2DPP B;  4HXJ A;  4X9D A;  2M16 A;  4RUG A;  4P5N A;  4M75 G;  2EYZ A;  2JW4 A;  1OZ2 A;  1W2B A;  3CC2 A;  2FHD A;  4E6R A;  3CME A;  2QQA A;  2EGA A;  2F2V A;  5LJ5 g;  1E6H A;  5DM7 R;  3QBY A;  3LLR A;  3SEM A;  2MIO A;  3EH2 A;  4XTU A;  4B9W A;  4BUG A;  2KEA A;  3CCJ T;  5GAN 5;  1QKX A;  4F04 B;  2QA4 Q;  1YJW A;  2QAS A;  3HPW A;  2EVR A;  2DET A;  3OS0 A;  4C92 A;  5IHK A;  2K9G A;  2HKQ B;  1BIA A;  1MUZ A;  5CQY A;  1G83 A;  1NJI C;  2R5A A;  2CP2 A;  4ZTF A;  8AT1 B;  2K3B A;  1RAD B;  3SB2 A;  3I5S A;  3NHN A;  2G6F X;  4RTZ A;  5GAN 7;  4EMK A;  2ECZ A;  3RDV A;  5DY9 A;  2HCK A;  1OPL A;  4F7U E;  2EQM A;  1UGQ B;  1D3B A;  4IUT A;  1BKB A;  4RMO A;  4OGE A;  4ZN1 A;  3JCM W;  3S6W A;  1HSQ A;  1TUC A;  3EG9 B;  4MMK A;  3VS4 A;  1YJN Q;  1V1C A;  4C0D B;  4CC2 A;  2AKL A;  2NUP A;  2EGE A;  1M2O A;  3A8O B;  4LE9 A;  4IUP A;  1U1T A;  3GP8 A;  3O8V A;  3G7Z A;  4XAX B;  1G3W A;  2GTO A;  4E7K A;  2LT1 A;  4PJO E;  3EGD B;  4N0A C;  1OU9 A;  4DBQ A;  2P0Q A;  1Q82 C;  1UGP B;  1WHH A;  4C8Q D;  3VU3 C;  2OI3 A;  4HCB A;  1N9R A;  3R6O A;  3PIP A;  2HL3 A;  2ZPI B;  3EHQ A;  2LNH B;  2DFU A;  4RCC A;  3EAE A;  1AWJ A;  2KRS A;  2YSQ A;  2FZG B;  5GAN j;  4E7J A;  4M7D C;  2KRN A;  3L2R A;  3A8L B;  4Y28 E;  3MHX A;  2EPD A;  2DRK A;  1RAG B;  3ME9 A;  5KYX A;  3RMS A;  4ELY C;  2CYZ B;  2EKH A;  2YRV A;  1WHM A;  2F5K A;  2DTO A;  5GAN 6;  4M7A E;  4HT9 A;  3VS3 A;  2HAX A;  4C92 B;  1MND A;  2B86 A;  4L5G A;  3QSU A;  3X20 B;  1Q86 U;  5HKC A;  2QQ9 A;  4FIB A;  1W4S A;  5GAN 2;  3JB9 F;  4LXC A;  4BE1 A;  2D0Q B;  2WAC A;  1JEG A;  2EYX A;  1NEB A;  2KT8 A;  3MCA B;  3Q1J A;  3RKX A;  2YLB A;  1GL5 A;  3OY9 A;  2CKK A;  1SPK A;  2LC4 A;  2YUQ A;  3NFC A;  1VQ7 Q;  2R58 A;  1EX4 A;  3CCR Q;  3AHU A;  2SEM A;  4KT0 E;  1OZ3 A;  2RN8 A;  2DBM A;  2EYY A;  2GQI A;  2RK2 A;  2RJD A;  3I56 A;  5KCO A;  4VUB A;  2JTF A;  1WI7 A;  2COW A;  2EFI A;  1SRL A;  3CC4 A;  3BDU A;  1M8V A;  3CPW P;  3M57 A;  2LQN A;  2K5I A;  2L3Q A;  4C92 C;  1OV3 A;  2CSQ A;  4MML A;  2O4X B;  2E4H A;  4HT8 A;  3M56 A;  3E9G A;  5GAN e;  3PIO A;  1M1G A;  2CRE A;  1X69 A;  1X27 A;  2E3H A;  2D9T A;  5CKF A;  1KIK A;  1D1C A;  1KD1 R;  2GNC A;  3EFR A;  1BCM A;  3M9Q A;  5KYN A;  4M78 A;  2EJ9 A;  4BI3 A;  3OYD A;  1AWW A;  3EGD A;  4OMN A;  4M7D G;  1S72 Q;  3JB9 J;  2LCL A;  1MGQ A;  1FMV A;  3EGX B;  2FRY A;  4DA4 A;  2DAQ A;  2RQU A;  1JQQ A;  1Q7Y R;  1JXM A;  4RG8 A;  2XD0 A;  3HP9 A;  4R56 A;  3NGP A;  4OB2 B;  1WX6 A;  2MWP A;  3I55 T;  4FYX B;  2DYI A;  1JJ2 S;  4M77 G;  5KE3 A;  2FZC B;  1LOJ A;  3M4G A;  1FMW A;  2RI5 A;  4E2F B;  1YIJ A;  1ZQ1 A;  4A4H A;  4FYV B;  3CC7 A;  3OSS C;  2P84 A;  5HY6 A;  2H3E B;  5HCK A;  3G6E Q;  2X3X D;  4XK8 E;  3CCL Q;  1ACM B;  9ATC B;  2XU8 A;  3MP8 A;  3M59 A;  2ZGW A;  5LJ5 e;  3M54 A;  2LQW A;  3OYY A;  1Q7Y C;  5FLX E;  4MZT A;  4PJO D;  4QW2 A;  2QI2 A;  2QA4 A;  1LPL A;  2H8H A;  3GBQ A;  1NZ9 A;  1X75 C;  4QKU A;  3NTI A;  4J9I A;  4C92 E;  5CO7 A;  1MMG A;  1QLY A;  2X9H A;  4OB1 B;  5LJ5 j;  1M8M A;  1MMN A;  3CCQ A;  2AZV A;  3LX7 A;  3E1S A;  4J8O A;  4M7D A;  3QHS A;  1UHC A;  2K79 A;  3E19 A;  5CVI A;  1TH7 A;  4AG2 C;  2QGG A;  3LYI A;  5A0G A;  4XU1 A;  4J7F A;  2DZ9 A;  3EGU A;  2MWO A;  4PJJ A;  3QKJ A;  1VQ5 A;  3VRZ A;  2EJF A;  2HL5 C;  4IUR A;  1D1B A;  2Y4X A;  3EG9 A;  4ZTJ A;  4X1V A;  3EHR A;  3QDR B;  4XTZ A;  1I0C A;  2FPD A;  4LD6 A;  3L2U A;  4AFZ C;  1K73 R;  3JB9 G;  3RER A;  1VYV A;  2E5Q A;  3PMI A;  3KXT A;  2QTX A;  3BW1 A;  3CPF A;  2V8J A;  1PCX A;  1WNL A;  2OJ2 A;  2LT4 A;  2AHJ B;  1MNE A;  3LWH A;  1YJN T;  3BY7 A;  1ZA2 B;  5A2Q E;  4M77 F;  2DRM A;  1ZSG A;  1K9M C;  1X01 A;  4B6M A;  2FVU A;  4XU2 A;  5GAN 3;  4TVR A;  2BE7 D;  1QKW A;  3QO3 A;  2HQX A;  3C0C A;  4DBH A;  1Q81 U;  1IGQ A;  1OU8 A;  3M55 A;  1KC8 U;  1PRL C;  4CRI A;  1C1A A;  3SFM A;  1VQ9 Q;  1JRI A;  4HVV A;  4IUV A;  2JUF A;  2X4W A;  4IUU A;  3CCE A;  4JRP A;  1YBY A;  3QII A;  2W10 A;  2RHX A;  3OYL A;  3OMG A;  4HCC A;  3PTA A;  1K0S A;  3I55 A;  4HA8 A;  4C8Q F;  2RI3 A;  1VOM A;  1QWE A;  4DQ2 A;  1R77 A;  2K57 A;  4AT1 B;  1HJD A;  1B3Q A;  4JZ4 A;  3OSV A;  1BYM A;  4EMG A;  2ZPE B;  1JU5 C;  4QQD A;  2GTJ A;  2QEX A;  1VQ5 Q;  1XTD A;  2X3W D;  3OA6 A;  1T3L A;  1NJI R;  2RHY A;  1X6B A;  1AD5 A;  2W0Z A;  2RHI A;  3M5A A;  4PFZ A;  4FSS A;  2EQK A;  3H8Z A;  4DEX A;  1TWB A;  2NYS A;  1NYG A;  2E70 A;  2BTT A;  4RTW A;  1UGV A;  3L2Z A;  4J5Y A;  2AZS A;  2YDL A;  1N8R C;  1JO8 A;  2P4R A;  2RJC A;  2ROT A;  2CUB A;  3VYH B;  2LX9 A;  3UT1 A;  2DJQ A;  1KQ2 A;  2XHC A;  2RF0 A;  2E6Z A;  4JRQ A;  1PSF A;  2YHT A;  2EQU A;  4PJO G;  2DZC A;  1MHN A;  3CCR T;  1RAH B;  4M78 E;  5GMK m;  4OP0 A;  1M2V A;  3CCJ Q;  2K5F A;  5CQX A;  3OYK A;  4RTY A;  5GAO l;  1YIJ Q;  1IXD A;  2XID A;  3JCM h;  2DIL A;  2XMF A;  3GIB A;  3TSZ A;  1NE8 A;  5GAO n;  3NTK A;  2C0I A;  3AT1 B;  4OMO A;  1M1K U;  1AZE A;  2DTH A;  3GNG A;  4J6Y A;  2KI7 A;  2VUB A;  4PJN A;  4BDZ A;  4M7D F;  4F7U G;  2YUO A;  3HRT A;  2VC8 A;  3JCM e;  4HCZ A;  4A54 A;  2KMT A;  3EFO B;  5CK9 A;  3V8J A;  1QVG A;  1UHF A;  5CKH A;  1VIF A;  3EFS A;  2OTJ T;  4EMK B;  1UGS B;  5I2M A;  4IKF A;  4N0A A;  3FJP A;  2C06 A;  1Y0M A;  1BI1 A;  1QVF A;  1RAF B;  4ANJ A;  1WZO A;  4YTL A;  5EC7 A;  3PVQ A;  1X2K A;  2YLC A;  4R55 A;  1S72 T;  2HMA A;  5DLQ E;  1K73 C;  3KFV A;  2RHZ A;  1J3T A;  5GJV B;  2B8A A;  2GFU A;  1K9A A;  2KAF A;  2HBP A;  1D0Y A;  4C92 G;  1NG2 A;  3INZ A;  1GFC A;  2DXU A;  1C6V X;  1YIT Q;  1AEY A;  3CMA T;  3H6Z A;  1EZZ B;  3C94 A;  4BB7 A;  2J6O A;  3X28 B;  2V1R A;  1VYT A;  2RM4 A;  1FXX A;  4RKU E;  2KBT A;  1KJW A;  3CPW S;  2ED1 A;  4M7A A;  2DTI A;  3H9N A;  4D6W A;  2E5K A;  3DLM A;  2CZ0 B;  2KT1 A;  1TSF A;  3JCM d;  4OMQ A;  4QT7 A;  2EQI A;  3V7R A;  5IXF A;  1K73 U;  1QQJ A;  1OYX A;  1UDL A;  3SWN C;  3G6E A;  3CCE Q;  1WDX A;  3S3N A;  1W1F A;  4J9D A;  1BI3 A;  4M77 E;  2JXB A;  5LJ3 d;  5LJ3 e;  4XTX A;  2R5M A;  4FU6 A;  3SDZ A;  1VQO T;  2QEX Q;  1W2B P;  3ER0 A;  1HK9 A;  2PU9 B;  3CBM A;  4E47 A;  1WJR A;  3OBW A;  5IH2 A;  2M1H A;  2QGF B;  1YJW Q;  3FLG A;  1VQL T;  4QQG A;  2L5Q A;  3URG A;  2CSI A;  2K3X A;  2XG8 D;  1UFF A;  4E7Z A;  1H64 1;  1PG5 B;  2BIV A;  1JJ2 P;  2VB6 A;  3MP1 A;  2KSS A;  1VQ7 T;  2FRW A;  5KYU A;  4PJL A;  3EFO A;  1AHJ B;  1W6X A;  1K9M U;  1LNX A;  2LQK A;  3G4S A;  3SHW A;  5KYW A;  1K8A U;  1T3S A;  1YHQ T;  2EIF A;  2X4Y A;  3RKW A;  2CP5 A;  2JS0 A;  5CR2 A;  3OW2 P;  1QW1 A;  5M9O A;  4LDU A;  1GRI A;  2KGT A;  3EH1 A;  5GAM j;  3HRS A;  5D6X A;  3TRE A;  5GAM g;  4DEY A;  4B9X A;  4OF1 A;  3CXC P;  1BI0 A;  4PKC C;  3VV0 A;  3UWN A;  1AOJ A;  5FU6 C;  1D0Z A;  3SD4 A;  3VJP A;  1FMK A;  5GAM h;  2EJG A;  3CXC S;  2RA2 A;  1M90 U;  1MV0 B;  1CSK A;  1YWO A;  2JN0 A;  4ESR A;  1N8R R;  5GAO r; 
#chains in the Genus database with same CATH homology
 2FL7 A;  1O75 A;  2V8I A;  3CXC A;  4MDX A;  5IN1 A;  4XU0 A;  3I56 A;  5KCO A;  1B34 A;  2JTF A;  4VUB A;  2ZPG B;  4C5E A;  1UEB A;  2F69 A;  1I4K 1;  2KDS A;  2DXC A;  2EFI A;  5A0D A;  3JCM J;  1YI2 A;  3CC4 A;  3BDU A;  1M8V A;  2IG0 A;  3M57 A;  3VKI A;  3OYN A;  4GLK A;  2K5I A;  2P0P A;  4BAC A;  3HRU A;  3CMA A;  2L89 A;  4C92 C;  3OW2 A;  1ZHI A;  3JRZ A;  3X26 B;  4IUQ A;  3M58 A;  1DJ7 B;  2NLU A;  2O4X B;  2P0K A;  4MML A;  4DOW A;  1YI2 T;  3CC2 T;  4HT8 A;  5DLO A;  2GFA A;  3M56 A;  1VQ5 T;  3E9G A;  2DXT A;  5GAN e;  5I2S A;  5GAN d;  3QZ5 B;  3PIO A;  1M1G A;  5CKF A;  2D9T A;  3VYG A;  2M9U A;  3C95 A;  1Y96 A;  4M7A G;  4PJO B;  4M77 A;  3EFR A;  2XDP A;  4J83 A;  3CCV T;  3M9Q A;  1U1S A;  3RUX A;  1M5Q 1;  4M78 A;  4M7D B;  3QYG B;  2EJ9 A;  4BI3 A;  3OYD A;  2HQE A;  2A3L A;  4M7D G;  3DLL A;  2LQ8 A;  3CBO A;  3CBP A;  3M53 A;  3QUI A;  5KE2 A;  2ZPH B;  3A8G B;  3UDC A;  3JB9 J;  3JCM V;  2LCL A;  1MGQ A;  3WXM B;  4MDW A;  4M78 B;  4JS4 A;  4E7H A;  4DA4 A;  2DAQ A;  3JB9 D;  2OTJ A;  4JLI A;  1VQ4 T;  3L2Q A;  1KD1 C;  3X25 B;  4RG8 A;  5J39 A;  3FC3 A;  2XD0 A;  2G3R A;  2MAM A;  3HP9 A;  4A4K A;  4R56 A;  2DIG A;  4OB2 B;  3OYJ A;  1JB0 E;  5CKD A;  1Y71 A;  3CEY A;  2CZ6 B;  2MWP A;  3JCM g;  3OYM A;  2CS7 A;  2DJZ A;  3I55 T;  3CCM T;  3TEE A;  1JJ2 S;  4M77 G;  3CCU A;  5KE3 A;  5GAO p;  3CME T;  2E12 A;  2P4T A;  2EQJ A;  1LOJ A;  3M4G A;  4J6W A;  3JCM X;  1K8A C;  2RI5 A;  3GLX A;  1YIJ A;  4XQ3 A;  1ZQ1 A;  4Z02 A;  2XDB A;  4A4H A;  3G71 A;  5FU7 C;  5LJ3 j;  2Y4Y A;  3FEO A;  3CC7 A;  3OSS C;  4N4H A;  3FIF A;  1KHI A;  4C8Q A;  5HY6 A;  5L8R E;  1XQH A;  1YIJ T;  4XK8 E;  2E1H A;  3OW2 S;  4M7D E;  2XU8 A;  3MP8 A;  4LDY A;  4BY6 B;  1YIT T;  3M59 A;  2JOY A;  4BD3 A;  2BKD N;  3HSB A;  3PT9 A;  1XOV A;  2ZGW A;  2DO3 A;  3M54 A;  5LJ5 e;  2XKO C;  3OYY A;  1VQN A;  2X4J A;  4KUI A;  4ZGD B;  1Q7Y C;  5LJ3 f;  5FLX E;  2LNV A;  4MZT A;  4PJO D;  4QW2 A;  2QI2 A;  2QA4 A;  1YIT A;  5CAI A;  1N9S A;  3OYA A;  1NZ9 A;  2WSE E;  4OMF B;  3OS1 A;  1X75 C;  2VGM A;  3OQ5 A;  3PGG A;  3NTI A;  1N6A A;  4C92 E;  5FRN A;  2OTL T;  5CO7 A;  4LDW A;  1VUB A;  3KUF A;  3G4S T;  1G3Y A;  2VXF A;  3MEA A;  4OB1 B;  1WQW A;  1Y96 B;  1NPR A;  4PL6 A;  4C8Q G;  5LJ5 j;  1QP3 A;  3CD6 A;  3HHT B;  3MET A;  3L1A A;  3CCQ A;  4ATO A;  3CCE T;  4EMH A;  2EWN A;  3E1S A;  3LX7 A;  4J8O A;  5GMK j;  5IT9 E;  4M7D A;  5CKB A;  3KBG A;  3QHS A;  4EMK C;  4X34 A;  2PVO B;  3HKS A;  4F7U A;  3CCS A;  2CZ7 B;  3E19 A;  5CVI A;  4DOV A;  2KQW A;  1VQO A;  1TH7 A;  1VQN T;  3LYI A;  5A0G A;  2E6N A;  4XU1 A;  3JB9 H;  4J7F A;  2DZ9 A;  1D3B B;  3JB9 I;  2K3Y A;  2MWO A;  3QG1 A;  5GAM f;  4KUD K;  3QKJ A;  1VQ5 A;  2PVD B;  2EJF A;  4IUR A;  3OYB A;  1WJS A;  3JCM Q;  2Y4X A;  1WJQ A;  1KC8 C;  2DVE A;  2KVQ G;  4BDY A;  4ZTJ A;  1YJN A;  1Q82 U;  4XTZ A;  3QDR B;  4M78 C;  5D6W A;  5GMK i;  3CCL T;  4LD6 A;  3L2U A;  1JBM A;  2FYK A;  4XU3 A;  4RCB A;  3RES A;  4C5H A;  4C92 D;  5C0M A;  1VQK A;  3JB9 G;  2O01 E;  4M78 F;  4LDV A;  3RER A;  2DD4 A;  3GOX A;  2XI9 A;  2E5Q A;  4C0F A;  3FDR A;  4PNO A;  1PSE A;  3BFM A;  2IVW A;  3PMI A;  3P8H A;  3KXT A;  1KQ1 A;  4M7A C;  3TCJ A;  3N5B B;  2QTX A;  3BW1 A;  1FWZ A;  4LDX A;  4J7I A;  3CPF A;  2V8J A;  3PNW C;  3V8K A;  2O4X A;  1WNL A;  2LT4 A;  2EAY A;  3FRN A;  3VUB A;  3OBY A;  1LJO A;  2AHJ B;  5I21 A;  3L2V A;  4QVZ A;  1RL2 A;  3A5Z B;  3OS2 A;  3RMQ A;  3LWH A;  1UGR B;  1YJN T;  3BY7 A;  1YCY A;  2RJE A;  3F70 A;  5A2Q E;  4M77 F;  3CCR A;  1QVF S;  5A0L A;  1K9M C;  4PLL A;  2PVG B;  1X01 A;  4Y91 A;  5GMK e;  1O9S A;  2RD1 A;  2FVU A;  4XU2 A;  5GAN 3;  4N4G A;  1W2B S;  4TVR A;  2K2V A;  4QQ6 A;  3QO3 A;  3GPL A;  2HQX A;  3CCJ A;  4KBM B;  3OB9 A;  5FU7 B;  5EG2 A;  1Q81 U;  2QDY B;  1VQL A;  2JTM A;  4Q5W A;  3M55 A;  3MEU A;  5LJ3 h;  2K4Y A;  4C8Q B;  5AYF A;  1G3T A;  4CRI A;  1KC8 U;  2QEX T;  3CCM A;  1Q81 C;  3QYH B;  4XTW A;  2GCX A;  3SFM A;  3L42 A;  3X24 B;  2K5L A;  3MEV A;  4PLI A;  1IRE B;  2ZPF B;  1JRI A;  3CCU T;  2XK0 A;  1NJI U;  5LJ5 d;  3SWN A;  2I2L A;  4MZP A;  2QQR A;  4IUV A;  2JUF A;  2X4W A;  4FT2 A;  4IUU A;  1NPP A;  3CCE A;  2RHU A;  4JRP A;  1YBY A;  3JSC A;  3QII A;  4E7L A;  2RHX A;  3OYL A;  4LD9 K;  3OMG A;  4F7U B;  2PUO B;  1YJW T;  3PTA A;  4HCC A;  3CPW A;  5J3B A;  2DD5 A;  4OB0 B;  4FSX A;  4M75 A;  1YJ9 T;  1R8O B;  3I55 A;  2QQS A;  4HA8 A;  4C8Q F;  2RI3 A;  2M0O A;  4M75 E;  2WSF E;  4J6X A;  1M1K C;  3FB9 A;  4DQ2 A;  2VYT A;  4NL2 A;  2K57 A;  3HFO A;  5J26 A;  5GAN 8;  3ZEH A;  1KG1 A;  5GAN 4;  2JNG A;  2E10 A;  3OSV A;  1BYM A;  2KK4 A;  4EMG A;  2DK3 A;  4M78 G;  2ZPE B;  4BE0 A;  3DKM A;  5HK3 A;  2RI2 A;  3M4Y A;  1VQ6 A;  4QQD A;  4PJO C;  5GAO m;  3A8M B;  2JVV A;  4C0G A;  2VGN A;  3OYG A;  2V8K A;  3I56 T;  1XTD A;  2QEX A;  2CGH A;  1M9S A;  3OA6 A;  1BI2 A;  3TU4 K;  3CC7 T;  5GAM e;  5GAM d;  2RHY A;  3WVE B;  3S3O A;  1VQM T;  2GQV A;  1WGS A;  2PQW A;  2RHI A;  1OI1 A;  3M5A A;  2DKG A;  3MO8 A;  2EQK A;  3H8Z A;  3C12 A;  2WSC E;  2MMP A;  1GXI E;  5FRM A;  3CD6 T;  1M4Z A;  3RKY A;  5GAN f;  2E70 A;  3CCQ T;  5LJ3 g;  2RH2 A;  3J81 E;  1VQP T;  4MZM A;  2E65 A;  3L2Z A;  4A4F A;  1P92 A;  4J5Y A;  4RG2 A;  3CCS T;  1Y7X A;  2LCC A;  3MP6 A;  4A53 A;  4ME7 A;  3OMC A;  4C8Q C;  5CCA A;  2RJC A;  1N8R C;  3VYH B;  3JCM P;  5FRO A;  1Q86 C;  2XDD A;  4BI4 A;  2EYQ A;  2LX9 A;  3UT1 A;  4OB3 B;  4A4E A;  3QJY A;  4EPC A;  3L2W A;  1VQP A;  2EKO A;  4XTY A;  5IAY A;  3WVD B;  5GAO q;  1KQ2 A;  5CIU A;  4ZGE B;  2XHC A;  1HXD A;  2LDM A;  2E6Z A;  5GAN h;  4JRQ A;  4M78 D;  2ZCF B;  4II1 A;  3C4S A;  2X4X A;  4JS5 A;  1PSF A;  1ZBX A;  3LGF A;  4ZN3 A;  3E9F A;  4CI0 C;  1U8R A;  1VQ7 A;  2YHT A;  2EQU A;  2GF7 A;  3LGL A;  4HKE A;  5FU6 B;  4M7D D;  4PJO G;  3OYE A;  2DZC A;  1KHC A;  4GY5 A;  4C5G A;  1EIF A;  1MHN A;  2RB6 A;  3CCR T;  1BIB A;  3QXE B;  4M78 E;  4C0Z A;  5GMK m;  4OP0 A;  3JAM E;  2DPP B;  2K5F A;  1RI0 A;  4X9D A;  5CQX A;  2M16 A;  3JCM f;  3OYK A;  1I5L A;  5KCH A;  4BY6 C;  1Q7Y U;  4P5N A;  2D6F A;  4M7A D;  1X6O A;  5GAO l;  3OYI A;  4M75 G;  2XID A;  3JCM h;  4M7A B;  3V7S A;  1OZ2 A;  1KQS A;  1W2B A;  3CC2 A;  3LWI A;  3GIB A;  1VQ9 A;  2FHD A;  1NE8 A;  3CME A;  5GAO n;  1XNI A;  3LW5 E;  3NTK A;  4M77 C;  1Y07 A;  2QQA A;  2QXF A;  1M1K U;  2E41 A;  2DTH A;  3S3M A;  5LJ5 g;  5DM7 R;  3DB4 A;  3GNG A;  4J6Y A;  2HD0 A;  3OS5 A;  4ZGJ B;  1S72 A;  3QBY A;  2VUB A;  4BDZ A;  4M7D F;  1I81 A;  4F7U G;  3LLR A;  3CCV A;  3HRT A;  2VXE A;  4O6J A;  4C0D C;  4XTU A;  4B9W A;  4M75 C;  4BUG A;  2VC8 A;  4ELZ C;  2OTL A;  4N4I A;  3P8D A;  1KQS S;  3CCJ T;  2Y90 A;  5GAN 5;  1YJW A;  2PUK B;  3JCM e;  3HPW A;  4HCZ A;  4NOY A;  4OVA A;  3P8B B;  2KMT A;  4A54 A;  3OS0 A;  2RJF A;  5CKE A;  4C92 A;  4C5I A;  3V8J A;  5CK9 A;  1QVG A;  4M75 F;  1VIF A;  2H3J A;  4JRK A;  1BIA A;  5CKH A;  4BI8 B;  3EFS A;  2OTJ T;  4EMK B;  4FL6 A;  4L59 A;  5CQY A;  5LJ5 h;  1NJI C;  1QP2 A;  2R5A A;  1UGS B;  5I2M A;  1IZ6 A;  4ZTF A;  4WF2 A;  1QVG S;  4IKF A;  4FT4 A;  4N0A A;  2DEQ A;  3FJP A;  2C06 A;  1BI1 A;  3SB2 A;  1M90 C;  5GAN 7;  1QVF A;  4EMK A;  4YTL A;  3ZFJ A;  5C6S A;  5DY9 A;  1S72 T;  2YLC A;  4R55 A;  1N8R U;  5GMK l;  4QVC A;  1WPY A;  4X9C A;  5DLQ E;  1K73 C;  1VQ8 A;  4F7U E;  1YJ9 A;  2RHZ A;  2E64 A;  2EQM A;  2RK1 A;  1UGQ B;  1D3B A;  4IUT A;  1BKB A;  2B8A A;  2L8D A;  2GFU A;  4C8Q E;  4OGE A;  3DB3 A;  4ZN1 A;  4RMO A;  2QA4 T;  3JCM W;  2KAF A;  2HBP A;  2MI6 A;  3S6W A;  2X35 A;  4C92 G;  4MMK A;  3INZ A;  2XIC A;  1G3S A;  4M75 B;  4O5V A;  3UPU A;  1VQ8 T;  2DXU A;  4C0D B;  3QPH A;  1FX7 A;  3G6E T;  5D6Y A;  1M1F A;  4XTV A;  4PJO F;  3A8O B;  3MEW A;  4E7I A;  4IUP A;  3JCM b;  1U1T A;  1SSF A;  3GP8 A;  3NTH A;  3PMT A;  3T9N A;  3CMA T;  3H6Z A;  3C94 A;  4BB7 A;  3RIR A;  1KD1 U;  3X28 B;  2RM4 A;  3O8V A;  3PFS A;  3G7Z A;  4XAX B;  1G3W A;  1FXX A;  1VQM A;  4V2S A;  4RKU E;  4JDS A;  3CPW S;  4E7K A;  4M7A A;  3OYC A;  2LT1 A;  2DIQ A;  4NS5 A;  5KH6 A;  4PJO E;  4N0A C;  2DTI A;  4QVD A;  3HFN A;  4FM4 B;  4D6W A;  2ZPB B;  3DLM A;  2CZ1 B;  2CZ0 B;  1H3Z A;  3OYF A;  2P0Q A;  2JZ2 A;  3ZBD A;  3J7A F;  1Q82 C;  1UGP B;  4C8Q D;  3VU3 C;  3JCM d;  3V7R A;  2KY9 A;  1N27 A;  1K73 U;  1N9R A;  1OYX A;  3R6O A;  3SWN C;  3G6E A;  4HCB A;  3PIP A;  3S3N A;  2ZPI B;  2BUD A;  2F5T X;  4JLG A;  3LH0 A;  5LJ5 f;  1BI3 A;  4L6V 5;  4M77 E;  2LTO A;  5LJ3 d;  1B34 B;  5LJ3 e;  4RCC A;  4XTX A;  2R5M A;  4FU6 A;  3EAE A;  3SDZ A;  1VQO T;  3VUZ A;  5GAN g;  3CC4 T;  1VQ9 T;  4A4G A;  5GAN j;  4OGC A;  3ER0 A;  3BDL A;  4E7J A;  1HK9 A;  4M7D C;  2PU9 B;  3CBM A;  1V29 B;  4E47 A;  1WJR A;  2LRQ A;  5GMK h;  3OBW A;  1I8F A;  4NL3 A;  4JJN K;  3GNF B;  2M1H A;  3V7C A;  3L2R A;  3A8L B;  3FLG A;  3MHX A;  4Y28 E;  4QQG A;  3QJ6 A;  1VQL T;  2L5Q A;  2MF2 A;  3URG A;  4PJO A;  2DXB A;  3ME9 A;  1UB4 A;  2K3X A;  2XG8 D;  2LVM A;  1VQK T;  3RMS A;  4ELY C;  2CYZ B;  3G71 T;  1H64 1;  2BIV A;  2YRV A;  2FB7 A;  2F5K A;  5HK0 A;  2DTO A;  5GAN 6;  4M7A E;  3MP1 A;  2KSS A;  4M77 D;  4BE2 A;  1VQ7 T;  4HT9 A;  3ASK A;  2HAX A;  4C92 B;  2ZZD A;  1AHJ B;  4KUL A;  1K9M U;  1VQ6 T;  1QVP A;  4L5G A;  1LNX A;  2LQK A;  3G4S A;  3QSU A;  3X20 B;  1Q86 U;  5HKC A;  2QQ9 A;  1K8A U;  3J80 E;  4FIB A;  1W4S A;  1YHQ T;  2EIF A;  2X4Y A;  3RKW A;  5GAN 2;  3JB9 F;  4M77 B;  5CR2 A;  4M75 D;  1QW1 A;  4M7A F;  4JUV A;  4BE1 A;  5M9O A;  4EDU A;  4LDU A;  2D0Q B;  1VQ4 A;  3GF5 A;  3HL8 A;  2VV5 A;  2WAC A;  5LL6 S;  5GAM j;  3HRS A;  3OYH A;  2HNI A;  5D6X A;  2RO0 A;  4F7U F;  3MCA B;  3Q1J A;  3RKX A;  3TRE A;  2A7Y A;  2YLB A;  4C92 F;  2L3R A;  3JCM c;  5GAM g;  1G5V A;  4B9X A;  3QZ9 B;  4OF1 A;  2CKK A;  3OY9 A;  4JRI A;  1BI0 A;  2LC4 A;  3NFC A;  4PKC C;  3SWN B;  3UWN A;  3VV0 A;  2R57 A;  2OAU A;  2R58 A;  5FU6 C;  3AHU A;  3V8L A;  4KT0 E;  3CCL A;  3SD4 A;  2QQB A;  3VJP A;  5GAM h;  2EJG A;  3A8H B;  1OZ3 A;  1JJ2 A;  1VIE A;  4UC4 A;  3CXC S;  2RA2 A;  1WQ7 A;  1M90 U;  2RK2 A;  1YHQ A;  2JN0 A;  2RJD A;  5GAO r; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...