4M78G

Crystal structure of lsm2-8 complex, space group p21
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
70
Chain Sequence
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 15
structure length 70
sequence length 86
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78G00
4M75A 2EAYA 4A53A 2E41A 3JCMe 1TH7A 1WQWA 5GAN4 3SWNA 4A54A 5GAN6 5GAMh 4NL3A 4M75E 2EJ9A 2CGHA 3V7SA 4XU3A 3QSUA 2DJZA 4PJOD 3JB9I 4M77G 3SB2A 4M7DB 4M77C 4M77F 4C8QD 5GAMf 5GAOl 4EMKC 2FB7A 1LNXA 2YHTA 5DY9A 5LJ3h 3BY7A 2DZ9A 4C92G 3JCMd 4C92C 4C92F 1KQ1A 2DZCA 5GMKm 4C8QE 2I2LA 5GANh 5LJ3f 5I21A 4M7DA 1B34A 4XTVA 2DKGA 4M78E 4JUVA 4XTYA 5GANf 4HT8A 5CAIA 1KQ2A 4F7UE 5LJ5j 3FIFA 2VXEA 5GMKh 3GIBA 3RESA 3SWNB 3PGGA 4XTZA 4XTWA 3BFMA 4XTUA 1M5Q1 3M4GA 5GAOn 4PJOB 1N9RA 3HFNA 4N0AC 4X9DA 4M7AF 4M7AD 3L2ZA 3VU3C 1WQ7A 5LJ5g 4C8QB 3HFOA 3V8JA 2RD1A 3JCMJ 4XQ3A 1U1TA 3BDUA 4MMKA 3JCMW 3QHSA 4M78B 3JCMV 4PJOA 4QVDA 1B34B 4J6YA 4EMHA 4M77D 3FB9A 4XU0A 4C8QA 4F7UB 5GAOm 4NOYA 1X01A 3JCMX 5GAOr 4PJOE 5GMKi 1JRIA 2JN0A 4C92D 3JCMQ 4M77E 3RKWA 4M78A 3INZA 2QTXA 5GAMe 4F7UA 3JCMP 3AHUA 3FJPA 4C92E 1JBMA 1I4K1 5LJ5h 3JB9H 4HT9A 4M75G 3QUIA 4M75F 4M75C 3JCMg 4QVCA 2Y90A 5LJ3e 5LJ5f 3SWNC 2EJFA 3RIRA 2HNIA 1MGQA 4HA8A 5GANe 5GAMd 2DTIA 3BW1A 1YCYA 1Y96A 2VC8A 2EJGA 2YLCA 1BIAA 2RB6A 4J5YA 4M77B 3V8LA 4EMKB 3JCMb 3JB9J 3EFSA 4M7AE 4JRIA 3V7CA 4C92B 1H641 2RM4A 5GMKe 5GAOq 2DXTA 4M7DG 5GMKl 4F7UG 4XU2A 4M7DC 3EFRA 2E65A 1N9SA 1D3BB 4M77A 4F7UF 5GANd 5GAOp 1HK9A 2DVEA 4EMKA 5GAN8 3JCMh 4J6XA 1HXDA 4XTXA 5GAN7 3JB9F 1U1SA 2RA2A 4C92A 1I5LA 1I8FA 3JCMf 5GAN5 2K57A 2VXFA 1D3BA 4V2SA 4OP0A 2FYKA 1LJOA 1WPYA 3V8KA 4M7AB 1Y96B 4M75D 4PNOA 4PJOG 5GAN2 2E1HA 4PJOC 4PJOF 4Y91A 2DTOA 4N0AA 3V7RA 5GAMj 4M7AA 4C8QG 4EMGA 3HSBA 4C8QC 4C8QF 5LJ5e 3QO3A 2DXUA 1M8VA 1BIBA 5LJ3d 3JCMc 4NL2A 4M78G 5LJ3j 4M78C 4M78F 4M78D 4DQ2A 5GAMg 4XU1A 1WNLA 1LOJA 2E10A 3JB9G 4M7DD 4M7DF 4RCBA 3JB9D 1I81A 2DEQA 4MMLA 5GANj 4X9CA 5LJ5d 5LJ3g 4M75B 3RERA 4M7DE 2EWNA 2ZGWA 3RKYA 2YLBA 3L1AA 2E64A 4RCCA 5GAN3 5GMKj 4WF2A 5GANg 4JRKA 3RUXA 4J6WA 3RKXA 4JLIA 4M7AG 4M7AC 2DTHA
chains in the Genus database with same CATH superfamily
1KC8C 1WQWA 2EJ9A 3V7SA 1JXMA 2DIQA 1D0YA 3CEYA 5GAMf 4EMKC 1TTHB 2YHTA 3CC4T 2C0IA 1OOTA 5D6YA 2QI2A 2I2LA 5I21A 3PIPA 1B34A 4XTVA 4M78E 3EG1A 4BUGA 2X35A 4XTYA 1M90U 1TUGB 1OPKA 4HVUA 4A4EA 1M5Q1 1ZBXA 2JT4A 5GAOn 1SKUB 3OYJA 1YNZA 2K79A 1JJ2A 1NJIU 4BY6B 1YHQQ 1VQKQ 1SSFA 5FU6C 3RKWA 5FLXE 1SEMA 3QZ5B 3S3NA 1IGUA 1JBMA 1ZUYA 4FYXB 3M54A 5I22A 1YI2Q 3JB9H 3UA7A 2JMCA 3QUIA 4RTZA 2JTMA 1RAIB 2A0FB 1UGVA 1I1JA 3SWNC 3E2UA 5HY6A 5GANe 1AWJA 4HXJA 2PNIA 3JB9J 2KEAA 2NLUA 2FZGB 1VQ8T 1IXDA 1YWPA 2BTTA 4IURA 1UGPB 4JZ3A 1W4SA 2JNGA 1M2VA 1N8RC 1VYTA 5FRNA 1TWBA 4OB1B 1M3CA 3N5BB 4R0KA 3C95A 2GTJA 5GAMj 1JB0E 3HKSA 2KBTA 4D8KA 1QMCA 3LWHA 1H3HA 2HQXA 1NPPA 1I07A 3THKA 5A2QE 2C0OA 3E19A 3RKXA 2DBMA 3RMQA 5AT1B 4M75A 2VKNA 1X75C 2EAYA 3CXCS 1XNIA 2FPDA 4PK4A 4JRQA 4E7SA 2VASA 4XU3A 4OMOA 1S72Q 5KYXA 3SB2A 3VS4A 2EW3A 4C8QD 3I55T 3META 2O31A 5DY9A 4C5IA 5GMKm 4Z02A 4M7DA 1AD5A 2VWFA 3VS5A 2OTJA 2YSQA 1WXTA 1HJDA 1X6BA 4EIKA 2E5QA 3CPWA 4E7JA 1YIJQ 2O9VA 1GFCA 3P8HA 1M8MA 2DYBA 3L2ZA 3G1JA 4C8QB 1M9SA 3RR6A 3G6ET 1RAGB 1OZ3A 1YJ9T 2LQKA 4XAXB 2HQEA 3CCRQ 4FT2A 2K9GA 4J9EA 3OSVA 2NUTB 3NMZC 3FJPA 2MK5A 4FCYA 2B86A 2CT3A 1KIKA 4M75G 2HBWA 1PRMC 3FEOA 2DMOA 3RIRA 4RTWA 3CMET 4AT1B 1Q81C 4QQGA 1K9MR 3OYCA 5GAOq 2VGNA 4M7DG 1MMNA 2D0NA 1HK9A 1RI9A 2DD4A 4C92A 1QKWA 1UGRB 2HDAA 4V2SA 4FYYB 3HRSA 2L3PA 1GL5A 4LD9K 2EQUA 4NS5A 2IPOB 2DTOA 4BI3A 3OW2S 4M7AA 2R58A 3EG9B 3QO3A 4L6V5 3VRZA 5LJ3d 1M1FA 1RAFB 1JEGA 4M78C 4M78D 2DBKA 3EG0A 5CK9A 1BI3A 4MMLA 3QWYA 1Q7YR 2D8HA 2OX7A 2DVJA 4M4ZA 2DRKA 1TXQA 5GMKj 4JRKA 3NGPA 8ATCB 3H0IA 2MMPA 4L5GA 4YTLA 4NL3A 3VYGA 4M75E 2CGHA 3FDRA 3EFOA 4DEXA 1VQPA 1GBQA 3QJ6A 4M77F 1VQ4T 4QT7A 1WX6A 2DZ9A 4C92G 1KQ1A 3CCVT 4LD6A 2CYZB 3VJPA 2X3WD 1KFZA 3D7SB 3UATA 5CKDA 2J7IA 3TSWA 3CCUA 4EPCA 3UDCA 4PJJA 1RACB 4FSSA 1JXOA 1OU9A 3CC4Q 1PHTA 4QVDA 1N6AA 3OYKA 1D1AA 1JRIA 2OTJQ 3JCMQ 2FZCB 1EIFA 2QTXA 3VUZA 1OPLA 2X3XD 5IHKA 2KRMA 4TVRA 5C6SA 2E12A 2DTIA 2YLCA 2ZPHB 4FYWB 2XI9A 3G7ZA 4BACA 1YJNA 2KI7A 1WA7A 2ENMA 2EGEA 3L2WA 2YDLA 3JB9F 4EMKA 4IIMA 2DL5A 3WVDB 5FROA 1UE9A 4FW2A 1U1SA 3M4YA 3JCMf 1KD1R 2ZPEB 5GAN5 3PT9A 2SRCA 4BB7A 1QVFS 4LDUA 2P0KA 3MP6A 1VQ8Q 3VUBA 1VIEA 2EGAA 1QVGP 1M1KR 2EVRA 3QYGB 1ZHIA 5GAMg 1WNLA 4QKUA 2YRCA 2DL7A 2CKKA 2QEXA 4JDSA 4E6RA 1SRMA 2FPEA 5J3BA 3RKYA 2MWPA 4IUQA 4CC7A 1WDXA 4LDWA 1K4US 2DXBA 1RL2A 3A8GB 1AVZC 3NTIA 5CO7A 1BYMA 3VV0A 3SWNA 2GCXA 3HTRA 4RTVA 1KQSA 3CC2T 4OB0B 4DBFA 2MYSA 4JJBA 1VQ4A 4R56A 1UB4A 4A4FA 3TREA 4LUEA 3H0HA 4E7KA 2XMFA 3LW5E 2DLPA 2XKOC 1AEYA 2HQHA 4XTZA 4XTWA 3OYMA 4JS5A 1VQPQ 1WQ7A 2DILA 2LZ6B 4GBQA 3JCMJ 3BDUA 3I55Q 3H9NA 2YRDA 1X6GA 4LDXA 2BUDA 1EFNA 4AFUC 1LVKA 2EQKA 2CSIA 2Y4XA 5GMKi 2A28A 3R6OA 4JZ4A 2QQBA 2RK1A 2HSPA 1YFNA 2J6KA 2DK3A 3NTKA 1UHFA 2QA4T 4ZGJB 1PSEA 1CKAA 2CP6A 3EG2A 5KCHA 3G6EQ 4BE2A 4LDYA 1YJ9Q 3OS2A 4WTOB 4OB3B 1M2VB 1S1NA 1ABOA 2V26A 1QP3A 3MP8A 4DEYA 3I5RA 4FM4B 4OVAA 4CC2A 1FYNA 3M0TA 3GP8A 4M75D 2F2VA 2E3HA 4JJNK 3CMEQ 1YITT 4X1VA 2FRWA 4DBHA 1ZSZA 3QYHB 4FL6A 2E4HA 5IHNA 1BIBA 2VUBA 1IB8A 4A63B 2L3QA 4OF1A 4M7DD 2L8DA 1KHCA 2DX1A 4M75B 3LWIA 2CH4A 5A0LA 4JLIA 5KYXB 5DM7R 3VS7A 4PLLA 3OYNA 2R5AA 3QSUA 3DKMA 1K73R 4M7DB 3EG3A 2A08A 3CCET 2QEXQ 1Q86R 2DZCA 3MKDA 1Y7XA 5CQYA 4J7IA 2DKGA 3M0SA 4A4KA 1MNDA 1IRXA 2EYWA 2JW4A 2DO3A 3LX7A 4Y28E 1SF9A 3ME9A 3R6NA 1VQ4Q 1U1TA 2AK5A 1K8AR 1OULA 3QKJA 4J6YA 1Y07A 3CCVQ 2YRVA 1G3YA 4C92D 1OZ2A 1MMDA 4M77E 1WLPB 4M78A 1AZEA 2CZ1B 7AT1B 1B07A 1MMAA 2PUKB 2ATCB 2FHDA 1NYGA 4DOWA 1PD0A 1E6HA 2RN8A 2EPDA 4DBQA 3L42A 1N27A 4C92B 1H641 3M57A 4PFZA 4RMOA 4F7UG 3REBB 4AFSC 4Y92A 5GAN8 3H8ZA 4CC3A 2FRYA 2EQIA 4E7LA 2RNAA 2JTFA 2GGRA 3QPHA 1I5LA 2LJ1A 4OP0A 1NPRA 1IHWA 4M7AB 2G6FX 1Q82C 4PJOF 2EQJA 3OYIA 2YWWA 1IREB 2K7AA 1VQOA 1FMVA 4M78G 5I2MA 2NUPA 4XU1A 1GXIE 3CXCP 2QQRA 3ZFJA 4FU6A 1QWEA 1ZQ1A 1W2BA 5CQXA 3RERA 1WJRA 4KULA 2DE0X 2GFAA 5GAN3 4Z88A 2E3IA 3EFOB 1MHNA 3MPUB 1U5SA 5A0GA 4XTXA 3CBPA 2V8KA 2C0TA 3OYHA 2RHZA 1ZBJA 2LQWA 3S3MA 2JOYA 2LQNA 4LUDA 5IXBA 1IZ6A 5GAMh 3KUFA 2DF6A 3JB9I 4B9XA 2DIGA 2QGGA 3VKIA 4A4HA 4B9WA 4PJLA 3FJ5A 1KC8R 5LJ3f 4CI0C 4BI4A 4OB2B 3CMAA 5IH2A 2QDLA 2CP2A 1B3QA 2O01E 5CAIA 4F7UE 2CP5A 1K76A 2X4XA 3GBQA 2F2XA 4X9DA 2L2PA 3CC2Q 4JPBW 2KSSA 1V1CA 1OYXA 3A8HB 2CH4W 2KAFA 3JCMX 3QG1A 2YXYA 5KYNA 3P8DA 2HBPA 2OTJT 5LL6S 1M30A 2DFUA 2CUDA 5M9OA 2RH2A 3JCMg 5LJ5f 1KJWA 4JJCA 1VQLA 1Y96A 1O9SA 3JCMb 1TG0A 4EMKB 1PRLC 3MP1A 4IIOA 2CS7A 2LNHB 1NM7A 4AFQC 3H41A 3OYYA 2KYBA 3UWNA 3OW2P 1JJ2S 1W6XA 2VXFA 4LNPA 5I11A 2DERA 4FYVB 2QA4Q 4KGVB 2DEUA 4X34A 5D6WA 3TVTA 5GJWB 4J9FA 1OEBA 1RLPC 4ZN1A 2PUOB 3OSSC 4KGXB 1N8RR 1W1FA 3FC3A 1NG2A 1K1ZA 1WXUA 5FU6B 5LJ3j 4WCIA 3I56A 1K9MU 1G5VA 1KSWA 3HRTA 3GNFB 3KBGA 2KNBB 3CPFA 5KYYA 1YITQ 3M56A 5EG2A 1TUDA 2I0NA 2MWOA 1VQ6A 2A37A 1VQOQ 1C6VX 1UHCA 4J9CA 2K2MA 3OYDA 2RI2A 3OYAA 4M77C 5KE3A 1Z9QA 1VQMA 3EAEA 3OYFA 2JJ9A 3VS0A 2DL4A 4RG2A 2RHIA 2RHUA 1NEBA 4JUVA 1KG1A 5LJ5j 4KT0E 5GMKh 1NLPC 2EQMA 4PFOA 3MO8A 1Q7YU 3OMGA 3V8JA 3G71A 1VQPT 4ZGDB 3CCEQ 3PFSA 4MDWA 3C0CA 3JRZA 3CMAQ 2J05A 3OMCA 1U06A 2MOXA 3QDFA 2GFUA 4OMMA 3VS2A 2CZ7B 3CCLA 2X4JA 3CCUT 1ARKA 3U23A 4IUVA 3CPWS 4L59A 4JRIA 2BE9B 2XICA 2EKOA 4PLIA 3NHNA 1QVFP 1SHGA 4OMNA 3C12A 1Q81R 3M58A 3FLGA 4D6WA 1N5ZA 1ZSZB 3T9NA 1RI0A 2O88A 1NYFA 2WACA 2LDMA 1M90C 3GNGA 4OMQA 4PL6A 2AHJB 2FEIA 4F04B 3V7RA 2LT4A 1AZGB 1IHVA 1YJNT 4MZPA 5KCOA 2KXDA 1ACMB 1NJIC 2FO0A 2VB6A 2IVWA 2CP7A 1AWWA 3CBOA 2ECZA 3JV3A 2P84A 3O5ZA 2K5FA 1R8OB 2KQWA 1BI2A 3CD6A 2KROA 4PFPA 2F69A 2ZAEA 1WHKA 2E41A 2SEMA 8AT1B 1KD1U 1TH7A 2P0PA 3ULRB 3LH5A 3VS6A 2LX7A 2X51A 1XTDA 2NWMA 2LVMA 4ESRA 4KH1B 2QEXT 5CKBA 2RJEA 1ZUUA 1M1KU 3BE3A 5GANf 4QVZA 1UECA 3SD4A 2GTOA 2D0QB 2QGFB 4HCZA 1VOMA 5D6XA 2YUOA 2K6DA 4M78B 4EMHA 1UUEA 1QCOA 2RQTA 4C5EA 2PZ1A 2GQVA 1FWZA 1D0ZA 2HNIA 5GAMd 2HZYA 2RI5A 4RTTA 2RB6A 3I35A 1GRIA 3EFSA 3MJXA 2DD5A 1MMGA 1GFDA 4OMLA 2E65A 2KRNA 3CCSA 5GAOr 3JCMh 2K5LA 1YCSB 2KT8A 1GCPA 3G4SA 3PE0A 3KFVA 2ZPGB 1WPYA 2KYMA 3V8KA 5C0MA 2CZ0B 2BZXA 1M3BA 1PKSA 2JM8A 2P4TA 1D09B 2EIFA 2E1HA 2NUPB 4MDXA 1WHGA 4ME7A 4EMGA 4O6JA 1VQNA 4C8QF 2A3LA 5CKHA 1BI1A 1QLYA 2A36A 3JCMc 2ZCFB 2DRMA 1QCNA 1Z9ZA 1CKBA 1RAEB 5GANj 2L3SA 3E9GA 1X2QA 3OY9A 4C5HA 2M02A 4JJDA 5LJ3g 1BKBA 4HKEA 1WYXA 1VUBA 2M51A 3UT1A 5HKCA 4N4GA 4FSXA 3M5AA 2RJCA 2OTLA 3TSZA 1RUWA 4LE9A 4IKFA 3A8LB 3CD6Q 2K4YA 4RTUA 2RJDA 5LJ5g 2ESWA 4MZTA 1VQ5A 5L8RE 2LMJA 4Z89A 3L2VA 1B34B 1X6OA 3CC7A 3LGFA 3OYGA 3TEEA 2JVVA 1K73U 1FXXA 2H8HA 1KQSS 4HT9A 3RMSA 3URGA 5L23A 1Q86U 4LXCA 2FG0A 2XD0A 2KMTA 5HCKA 1OI1A 2EJGA 2DA9A 2EBPA 2ED0A 2RM4A 2BZYA 2DXTA 1VQ9A 3MEWA 4M77A 4KRTA 1HXDA 1R77A 1K8AU 3LGLA 5FWCA 4KGZB 3EGDA 1Y71A 2RQRA 3CCUQ 1AOJA 1PC0A 1NE8A 2RJFA 1G83A 2RQUA 4PJOC 2F5KA 2YUQA 1SHFA 3SHWA 4OMFB 4KH0B 2DJQA 1UEBA 5IAYA 2EYYA 3VS1A 4C0GA 3CCMA 1UJ0A 1AWOA 3M9QA 5KYYB 4X9CA 2V1RA 3QIIA 1JO8A 5KYUA 1UGQB 2E64A 2YT6A 4RCCA 5CCAA 1TU0B 5GJVB 2QQSA 1VQNQ 2V1QA 1TSFA 2AKKA 2CSQA 2ZPIB 1YJNQ 2CUBA 4M77G 1OV3A 1VQOT 2Y4YA 4BE0A 4F16A 2QG9B 3FRNA 2DNUA 2YUNA 5J26A 2ROLA 5J39A 1WGSA 1VYUA 1UJYA 1XJWB 2O4XA 3BFMA 1UDLA 3HL8A 2NUTA 3HFNA 1PKTA 2J06A 4FIBA 4J8OA 1X27A 3OBWA 1MV3A 5HK3A 2OTLQ 1M3AA 1M27C 2M1HA 2XDPA 1ZX6A 3CMAT 5GAMe 3PMIA 4F7UA 3LH0A 1Y57A 1C1AA 3HPWA 3RDVA 2CREA 1AHJB 3CCQT 1DJ7B 1KC8U 2KK4A 3A8OB 2NUZA 1T0HA 1JJ2P 4AFZC 4ZN3A 2LP5A 3QDRB 1KK7A 1QKXA 4LDVA 4QQ6A 3OB9A 5GMKl 1QVGA 2EYXA 4A4GA 3EG9A 3JB9G 1UTIA 2MPXC 2DXCA 1D1BA 1I8FA 1Y0MA 1D3BA 1VIFA 1LJOA 3EHRA 3LYIA 2XDDA 3DLLA 3CCJT 2JXBA 1RLQC 1ZLMA 1ZSGA 2RHYA 5CR2A 2K5IA 1VQLT 1ZA1B 3OA6A 2QDYB 2RQWA 2O2OA 1VQ7A 2KR3A 2VV5A 1AT1B 1T3SA 4NL2A 1YJWA 2JMAA 4BD3A 4DQ2A 5AYFA 1K0XA 2L0AA 4MZMA 4E7ZA 1YHQA 1Q82R 2XK0A 5FU7C 1VQKA 1NEGA 3OYLA 1YBYA 3PNWC 4RG8A 1K8AC 2YLBA 3P8BB 2ZZDA 5GANg 1YI2A 4M7AC 2M0YA 4R55A 2K3BA 3EGXA 2V8IA 2PVGB 3REAB 2DYIA 5GAOl 5LJ3h 3JCMd 2DPPB 4C8QE 2F5TX 4CRIA 4J9IA 3I56T 1N8RU 2CDTA 3GIBA 3X20B 2ABLA 4J9GA 1VQ6T 2LCCA 4N4HA 2OAUA 3VU3C 1W2BS 3PTAA 1G2BA 3GLXA 4HCCA 3FB9A 1VQMT 4E47A 1FMKA 2EYZA 3JCMP 1PCXA 3AHUA 3CPWP 5LJ5h 1I4K1 3A98A 1A0NB 4QQDA 2XIDA 3KXTA 2HKNA 4M75F 3CCQA 2LT1A 1WHJA 1WHMA 1D1CA 3G71T 2M9UA 2HSEB 1FMWA 2DAQA 2PVOB 2GF7A 5GMKe 1PNJA 1S72A 2K3XA 3H6ZA 4M7DF 1N9SA 2HL5C 4JLGA 2QQAA 5CKEA 4BI8B 4O5VA 1WHHA 3CCLT 4C0DB 2WSEE 3H0FA 1YIJA 3CCJA 2QTVA 1GBRA 2AZVA 2WSCE 5DLOA 1JQQA 2A7YA 1M8VA 2BIVA 2KT1A 1FX7A 4BY6C 2B8AA 4ZGEB 2ZPFB 2GNCA 2COYA 3CCRA 4LN2A 1F1BB 4BDYA 1K9AA 3L1AA 4WF2A 2FZKB 1V76A 4J6WA 3GPLA 2IIMA 5EC7A 3GF5A 1LCKA 2LQ8A 3C94A 1Q81U 1VQ7Q 4GLKA 5GAN6 1YJWQ 2HL3A 2GQIA 4HCKA 4C92F 4DBRA 1SRLA 4JRPA 2XHCA 3CD6T 3SWNB 2KDSA 3M4GA 1N9RA 4FW1A 4N0AC 4M7AF 2X4YA 2AKLA 2RD1A 2RI3A 1WI7A 2VGMA 3M0PA 4PJOA 1K0SA 1CSKA 4M77D 4XU0A 2EFIA 2JUFA 1SSHA 3UPUA 2LTOA 4C0ZA 4IUUA 3OS0A 1E6GA 1T0JA 4VUBA 4ANJA 4PKCC 5KYWA 1MGQA 3HP9A 3BW1A 2D1XA 2D6FA 4M77B 1X2KA 2MF2A 1YWOA 2AIRB 1H8KA 4ZNXA 4KBMB 4RTXA 1BBZA 2QAZA 3EGDB 5FW9A 4GLMA 2C06A 1BCMA 2DVEA 5GAN7 2XDBA 3CXCA 1WXBA 4QW2A 3QWXX 1I5OB 2COWA 3CCQQ 3NPFA 1O75A 2GBQA 4PJOG 5GAN2 3RBBB 4C8QC 4J9DA 2DXUA 2WSFE 1M90R 2KRSA 3CC4A 2HD0A 2NYSA 3CCST 5KYUB 1T3LA 4PJNA 2E10A 3JB9D 3TCJA 3G4ST 4ELZC 1I0CA 2ZGWA 2VYTA 2JM9A 3CCJQ 5CIUA 1ZSZC 1U3OA 2G3RA 1NJIR 3ZEHA 3QZ9B 4FT4A 2DTHA 1VQLQ 3JCMe 4F17A 4DA4A 1VQNT 2JS0A 3HHTB 2ROTA 3OBYA 1LNXA 3BY7A 2COZA 5GANh 2MCNA 2O4XB 2D9TA 1GCQC 5CVIA 3ZBDA 1NBEB 1W70A 1X69A 2FL7A 3MEVA 4Q5WA 3FIFA 1PM3A 3ZL7C 3RESA 1M4ZA 3NTHA 1UFFA 3VYHB 2F2WA 2JS2A 3OYEA 1UG1A 3OS5A 2LC4A 1G3WA 3EHQA 3CQTA 1KQSP 4C5GA 4MMKA 3JCMV 1VQ8A 4F7UB 5GAOm 3O8VA 2OTLT 4PJOE 2VVKA 2P4RA 3I56Q 1U8RA 4HCBA 2MAMA 2BE7D 3OW2A 4XK8E 3C4SA 3TQ7P 1K9MC 1VQ6Q 2QQ9A 3OS1A 3I9QA 2EJFA 3A8MB 2HKQB 1IO6A 2F1LA 3MEAA 3SFMA 3X26B 1BU1A 1YCYA 3V8LA 1QWFA 3JAME 1VQ5T 1VQMQ 3J81E 1SG5A 3VS3A 3CC7T 3IQLA 6AT1B 5GAOp 1D3BB 1WFWA 4J6XA 2K3YA 1BK2A 1YP5A 2KY9A 3RNJA 1HSQA 1RADB 1P92A 3G71Q 1Q7YC 3ER0A 1MNEA 1PWTA 2LJ0A 5CKFA 2ED1A 3I55A 1VQ9T 1C0MA 1OX8A 2RF0A 1OX9A 2DEQA 5LJ5d 4M7DE 3CCLQ 3EGXB 4M7AG 3MHXA 5A0DA 2HAXA 5ECAA 3S3OA 4A53A 1WJSA 1R0CB 1ZUKA 2HEQA 5KH6A 2FPFA 1UGSB 1ABQA 1NZ9A 2OI3A 3G6EA 2DETA 2X9HA 2X4WA 4ORZA 4C0FA 1YJ9A 1WZOA 4RTYA 2Z0WA 3CCMT 3CBMA 2DL8A 2J6FA 2KVQG 1OU8A 2RO0A 3F70A 3PGGA 1H92A 4EDUA 2AZSA 3HFOA 3CMEA 3X28B 2O9SA 3JCMW 3QHSA 2EKHA 1QW1A 2MIOA 3M53A 3OQ5A 4NOYA 1X01A 2KGTA 2J6OA 1QVFA 4J83A 5DLQE 3M0RA 3MCAB 5KE2A 4C92E 2Y90A 2KE9A 2PTKA 4F14A 1EZZB 1R0BG 2OJ2A 2VC8A 4J9BA 1KD1C 4D8DA 4M7AE 1TS9A 1HD3A 4B6MA 4F7UF 4J7FA 2IG0A 2EYQA 2R57A 3OYBA 1E7OA 3M59A 4CC4B 4KUDK 4AMCA 1M1KC 1Y96B 4ATOA 5I2SA 2QASA 4Y91A 4N0AA 1MUZA 2LRQA 1BB9A 2V8JA 1LPLA 5IT9E 3PVLA 1G3TA 4ZTJA 4M78F 5FRMA 3CCVA 1HYOA 2P0QA 3EH1A 3M55A 4J9HA 3L2QA 2EWNA 1QCFA 3VRYA 2PU9B 2L89A 1B7TA 3PMTA 2LX9A 2PVDB 4K11A 3RUXA 4E2FB 2JZ2A 1VA7A 4A54A 2L3RA 2FVUA 3HRUA 4PJOD 4N4IA 1VQ7T 2RPNA 3M0QA 2JTEA 1X43A 3NFCA 3CCSQ 2FB7A 1YJWT 2DM1A 3G4SQ 3EGUA 1ZA2B 1YHQT 1W2BP 1VQKT 2AT1B 4BDZA 2KXCA 1XQHA 4HT8A 2OAWA 5FWBA 1YI2T 4XTUA 1Q82U 2LNVA 1YN8A 3PVQA 4PJOB 2BKDN 5D7UA 3PIOA 2PQWA 4XQ3A 1KHIA 1J3TA 1PG5B 3E9FA 2QYZA 4C8QA 1PD1A 2CP3A 4DOVA 2E5KA 2LCLA 4Z8AA 5KYWB 3INZA 2CP0A 2XG8D 1NLOC 2HMAA 2M0OA 2CT4A 4M75C 4QVCA 5LJ3e 3X25B 1QVPA 3QXEB 4HA8A 1QQJA 3E1SA 3S6WA 2E6ZA 4J5YA 1BIAA 3V7CA 2ZPBB 4E7IA 4XU2A 4M7DC 3EFRA 5GANd 2LJ3A 4AG1C 2E70A 2RA2A 1WJQA 4ELYC 1GCQA 2XU8A 4E7HA 4HVVA 3LLRA 1VQ5Q 4IUTA 4C8QG 4RUGA 2D8JA 5LJ5e 3CC2A 3CC7Q 1S72T 1RAAB 3L2RA 1TOVA 1M1GA 4JS4A 1WIEA 4BE1A 1IGQA 3SDZA 1G8XA 3J7AF 4RKUE 1SPKA 4KUIA 1OQKA 1K73C 4ZTFA 2W0ZA 1QVGS 1YIJT 1Q86C 1PSFA 3X24B 5HK0A 5IHIA 1EX4A 5GAN4 2BZ8A 3UA6A 2DJZA 1VQ9Q 3QJYA 1XOVA 5IXFA 4C92C 4AG2C 3JSCA 3CCRT 3DB4A 2RK2A 1KQ2A 5IN1A 2VXEA 1Q95G 3ASKA 1G3SA 3EH2A 4OGCA 4IUPA 1AWXA 2QA4A 2YUPA 4M7AD 2H3EB 4HVWA 1TUCA 4OGEA 3WXMB 4P5NA 1BCOA 3CCMQ 2K2VA 3L2UA 3DLMA 1VYVA 5FU7B 3A5ZB 2JN0A 2LCSA 3GOXA 2RMOA 1YITA 3DB3A 1QP2A 3BDLA 3SEMA 2QXFA 2HCKA 1RAHB 2EGCA 4PJMA 1D0XA 3AT1B 1JU5C 3J80E 2L5QA 2QK0A 2RHXA 3M0UA 1M2OA 3UF4A 2MI6A 9ATCB 2K57A 2FYKA 3A1PA 4OMPA 4PNOA 4UC4A 3HSBA 2CZ6B 3MEUA 3WVEB 3QBYA 1WHLA 3CCEA 3Q1JA 4II1A 1H3ZA 1LOJA 3I5SA 4RCBA 2W10A 1MV0B 1I81A 1V29B 4GY5A 2R5MA 2M16A 2RQVA 1RABB 1BI0A 2E6NA 3TU4K 2DL3A 2H3JA 4C0DC
chains in the Genus database with same CATH topology
3JCMe 4PLLA 3UT1A 1KC8C 1WQWA 3OYNA 2R5AA 5HKCA 2EJ9A 4N4GA 3V7SA 4DA4A 3DKMA 1VQNT 3QSUA 2DIQA 3HHTB 3CEYA 3OBYA 4M7DB 4FSXA 5GAMf 3M5AA 4EMKC 1LNXA 2YHTA 3CC4T 3CCET 2RJCA 3BY7A 2OTLA 5D6YA 2DZCA 2QI2A 2I2LA 5GANh 5I21A 1Y7XA 2O4XB 1B34A 2D9TA 4XTVA 5CQYA 5CVIA 4J7IA 3ZBDA 2DKGA 4A4KA 4IKFA 3A8LB 4M78E 4BUGA 2X35A 2FL7A 4XTYA 1M90U 3MEVA 4Q5WA 3FIFA 2DO3A 3LX7A 3RESA 4A4EA 1M4ZA 3NTHA 3VYHB 2K4YA 1M5Q1 1ZBXA 4Y28E 5GAOn 3OYEA 2RJDA 5LJ5g 3OYJA 3OS5A 2LC4A 1G3WA 3ME9A 4MZTA 1JJ2A 1U1TA 4C5GA 4MMKA 5L8RE 1VQ5A 3JCMV 1NJIU 1VQ8A 3QKJA 3L2VA 1B34B 4J6YA 4BY6B 1Y07A 4F7UB 5GAOm 3O8VA 1X6OA 2YRVA 3CC7A 2OTLT 1G3YA 4PJOE 3LGFA 3OYGA 1SSFA 4C92D 1OZ2A 5FU6C 4M77E 3TEEA 3RKWA 4M78A 5FLXE 1U8RA 2JVVA 2CZ1B 1K73U 4HCBA 1FXXA 2MAMA 3QZ5B 3OW2A 3S3NA 1JBMA 4XK8E 1KQSS 3M54A 3JB9H 4HT9A 3C4SA 3RMSA 3URGA 1Q86U 3QUIA 1K9MC 2PUKB 2JTMA 2QQ9A 3SWNC 3OS1A 2EJFA 2FHDA 3A8MB 5HY6A 3SFMA 3MEAA 2KMTA 3X26B 4DOWA 5GANe 2XD0A 1YCYA 1OI1A 3V8LA 2EJGA 3L42A 3JB9J 2NLUA 3JAME 1VQ5T 1N27A 1VQ8T 3J81E 4C92B 1H641 2RM4A 3M57A 4RMOA 2DXTA 3CC7T 4F7UG 1VQ9A 5GAOp 3MEWA 4M77A 1D3BB 5GAN8 3H8ZA 4IURA 1UGPB 4J6XA 1HXDA 2K3YA 4E7LA 1K8AU 1W4SA 2JNGA 2JTFA 3LGLA 3QPHA 1I5LA 2KY9A 1Y71A 4OP0A 1N8RC 1NPRA 4M7AB 5FRNA 1P92A 4OB1B 3N5BB 1NE8A 3C95A 2RJFA 1Q82C 4PJOC 4PJOF 2EQJA 2F5KA 3OYIA 1Q7YC 3ER0A 5GAMj 1JB0E 3HKSA 1IREB 4OMFB 5CKFA 1VQOA 3I55A 1UEBA 5IAYA 4M78G 1VQ9T 5I2MA 4XU1A 4C0GA 3LWHA 3CCMA 1GXIE 2QQRA 3ZFJA 4FU6A 3M9QA 2DEQA 2HQXA 1ZQ1A 1W2BA 1NPPA 4X9CA 5CQXA 3QIIA 5LJ5d 3RERA 4M7DE 1WJRA 4KULA 2GFAA 1UGQB 2E64A 4RCCA 5CCAA 5GAN3 5A2QE 3E19A 3RKXA 1MHNA 4M7AG 3MHXA 5A0DA 5A0GA 3RMQA 4XTXA 2HAXA 2QQSA 4M75A 3CBPA 2V8KA 1X75C 2EAYA 4A53A 1WJSA 2RHZA 3OYHA 3CXCS 1XNIA 3S3MA 2JOYA 5KH6A 1IZ6A 2ZPIB 5GAMh 4JRQA 3KUFA 4XU3A 1UGSB 3JB9I 1NZ9A 4M77G 3SB2A 3G6EA 1VQOT 4B9XA 4C8QD 2DIGA 3I55T 2X4WA 3META 2Y4YA 4C0FA 5DY9A 4BE0A 3VKIA 1YJ9A 4C5IA 4A4HA 5GMKm 3CCMT 4B9WA 5LJ3f 3CBMA 2KVQG 3FRNA 4Z02A 4BI4A 4CI0C 4M7DA 4OB2B 3CMAA 5J26A 2OTJA 5J39A 2O01E 1WGSA 5CAIA 4F7UE 3CPWA 2E5QA 4E7JA 2RO0A 3F70A 3PGGA 2O4XA 3BFMA 3HL8A 2X4XA 3HFNA 4FIBA 4J8OA 4X9DA 3P8HA 3L2ZA 4C8QB 4EDUA 3HFOA 3CMEA 3X28B 1M9SA 3JCMW 3OBWA 3QHSA 5HK3A 3G6ET 1OZ3A 1QW1A 2KSSA 1OYXA 3A8HB 3M53A 1YJ9T 2KAFA 3OQ5A 1X01A 3QG1A 2M1HA 2LQKA 2XDPA 4NOYA 4XAXB 2HQEA 3JCMX 4FT2A 1QVFA 3P8DA 2HBPA 4J83A 5DLQE 5GAMe 3CMAT 3OSVA 3PMIA 4F7UA 5LL6S 3LH0A 3FJPA 3MCAB 4C92E 5KE2A 2OTJT 3HPWA 4M75G 2RH2A 5M9OA 1AHJB 3JCMg 3CCQT 3FEOA 2Y90A 1DJ7B 1KC8U 5LJ5f 2KK4A 3A8OB 3RIRA 3CMET 1VQLA 1Y96A 1O9SA 2VC8A 3JCMb 4EMKB 1Q81C 4ZN3A 1KD1C 3QDRB 4M7AE 4QQGA 3MP1A 4LDVA 4QQ6A 3OB9A 3OYCA 5GAOq 2VGNA 2CS7A 5GMKl 1QVGA 4A4GA 4M7DG 4F7UF 3JB9G 1HK9A 2DXCA 2DD4A 4J7FA 2IG0A 2EYQA 2R57A 3OYYA 4C92A 3UWNA 1JJ2S 3OYBA 1I8FA 1UGRB 4V2SA 2VXFA 1D3BA 1VIFA 3M59A 3HRSA 4KUDK 1LJOA 3LYIA 1M1KC 1Y96B 4ATOA 2XDDA 3DLLA 5I2SA 3CCJT 4LD9K 2EQUA 2RHYA 4X34A 5D6WA 4NS5A 2K5IA 5CR2A 1VQLT 4Y91A 2DTOA 4N0AA 4BI3A 2LRQA 4ZN1A 2PUOB 2R58A 3OSSC 2V8JA 3OA6A 2QDYB 3OW2S 5IT9E 1VQ7A 3QO3A 4L6V5 2VV5A 5LJ3d 3FC3A 1G3TA 4NL2A 1M1FA 5FU6B 4ZTJA 5LJ3j 4M78C 4M78F 4BD3A 4M78D 5AYFA 4DQ2A 1YJWA 5FRMA 4MZMA 5CK9A 3CCVA 1BI3A 1YHQA 2P0QA 4MMLA 2XK0A 5FU7C 1VQKA 3OYLA 1YBYA 3M55A 3I56A 1K9MU 1G5VA 3PNWC 2EWNA 4RG8A 3L2QA 1K8AC 3HRTA 2YLBA 3GNFB 3P8BB 2ZZDA 2PU9B 5GMKj 2L89A 3KBGA 3PMTA 2LX9A 2PVDB 4JRKA 3CPFA 3RUXA 5GANg 1YI2A 2MMPA 2JZ2A 3M56A 4M7AC 5EG2A 2MWOA 1VQ6A 4L5GA 4R55A 4YTLA 2V8IA 4A54A 2L3RA 2FVUA 3HRUA 4M75E 3VYGA 4NL3A 2CGHA 3FDRA 4N4IA 1VQPA 4PJOD 1VQ7T 2PVGB 3OYDA 2RI2A 3OYAA 3QJ6A 4M77F 4M77C 1VQ4T 3NFCA 5GAOl 5KE3A 2FB7A 5LJ3h 1YJWT 1VQMA 4C92G 2DZ9A 3EAEA 3JCMd 3OYFA 1KQ1A 2DPPB 4C8QE 2F5TX 4LD6A 4CRIA 2CYZB 3CCVT 1YHQT 4RG2A 3VJPA 1VQKT 2RHIA 5CKDA 3I56T 4BDZA 1N8RU 2RHUA 4JUVA 1KG1A 1XQHA 4HT8A 5LJ5j 4KT0E 5GMKh 2EQMA 1YI2T 3GIBA 3X20B 4XTUA 1Q82U 2LNVA 4PJOB 1VQ6T 2BKDN 3MO8A 3PIPA 2LCCA 3OMGA 3CCUA 1Q7YU 4EPCA 4N4HA 2OAUA 2PQWA 3UDCA 3VU3C 3PIOA 1W2BS 3V8JA 3G71A 4XQ3A 1VQPT 1KHIA 3PTAA 4ZGDB 4QVDA 1N6AA 3PFSA 3GLXA 3E9FA 4MDWA 4HCCA 3FB9A 3OYKA 4C8QA 1VQMT 3JRZA 4E47A 1JRIA 4DOVA 3JCMQ 2LCLA 3OMCA 3INZA 1EIFA 2XG8D 2QTXA 3JCMP 2GFUA 3VUZA 3AHUA 5LJ5h 1I4K1 2M0OA 4QQDA 2XIDA 3KXTA 4M75C 4M75F 2CZ7B 4QVCA 5LJ3e 3CCLA 2X4JA 3X25B 1QVPA 4TVRA 3CCQA 2LT1A 3QXEB 5C6SA 2E12A 3CCUT 4HA8A 2DTIA 3E1SA 3S6WA 2E6ZA 2YLCA 2ZPHB 2M9UA 1BIAA 2XI9A 4J5YA 3G71T 2DAQA 3G7ZA 4IUVA 4BACA 2PVOB 3CPWS 4L59A 1YJNA 2GF7A 4JRIA 3V7CA 5GMKe 1S72A 2ZPBB 2K3XA 2XICA 3L2WA 4XU2A 4E7IA 3EFRA 3H6ZA 1N9SA 5GANd 2EKOA 4PLIA 4M7DC 4JLGA 3JB9F 4M7DF 4EMKA 3WVDB 2E70A 5FROA 2QQAA 1U1SA 2RA2A 3M4YA 3C12A 1WJQA 5CKEA 3JCMf 3M58A 3FLGA 4BI8B 2ZPEB 4D6WA 4ELYC 5GAN5 3T9NA 4O5VA 1RI0A 3PT9A 3CCLT 2WACA 1M90C 2LDMA 2XU8A 4C0DB 2WSEE 3GNGA 4BB7A 4PL6A 4E7HA 1YIJA 3CCJA 2AHJB 1QVFS 4LDUA 2P0KA 3MP6A 3LLRA 3V7RA 4IUTA 3VUBA 2LT4A 1VIEA 4C8QG 5LJ5e 2WSCE 5DLOA 4MZPA 1YJNT 2A7YA 3CC2A 5KCOA 1S72T 1M8VA 2BIVA 3L2RA 3QYGB 1FX7A 1M1GA 1ZHIA 5GAMg 4JS4A 1NJIC 1WNLA 4BY6C 2B8AA 4ZGEB 4BE1A 2IVWA 2ZPFB 3CBOA 2CKKA 2QEXA 4JDSA 3CCRA 3SDZA 2K5FA 3J7AF 4RKUE 5J3BA 4BDYA 1R8OB 2KQWA 4KUIA 2MWPA 4IUQA 3RKYA 3L1AA 1K73C 4LDWA 4ZTFA 4WF2A 1BI2A 3CD6A 4J6WA 1QVGS 2DXBA 1RL2A 2F69A 3A8GB 3GPLA 3NTIA 1PSFA 3GF5A 2LQ8A 5CO7A 3X24B 1YIJT 1Q86C 3C94A 2E41A 5HK0A 1Q81U 1BYMA 1KD1U 1TH7A 3VV0A 2P0PA 4GLKA 3SWNA 5GAN6 5GAN4 2GCXA 2DJZA 1KQSA 3CC2T 4OB0B 3QJYA 1VQ4A 1XOVA 1XTDA 2LVMA 4C92C 4C92F 4R56A 1UB4A 4A4FA 3JSCA 3TREA 2QEXT 3CCRT 5CKBA 3DB4A 2RJEA 4JRPA 1M1KU 5GANf 2RK2A 1KQ2A 5IN1A 4QVZA 4E7KA 2XHCA 2VXEA 3LW5E 2XKOC 3CD6T 3ASKA 3SWNB 1G3SA 4XTZA 4XTWA 3SD4A 2KDSA 2D0QB 3M4GA 4OGCA 4IUPA 1N9RA 4HCZA 4N0AC 3OYMA 4JS5A 4M7AF 2QA4A 4M7AD 1WQ7A 2X4YA 2RD1A 5D6XA 3JCMJ 2RI3A 3BDUA 4OGEA 2VGMA 4M78B 4PJOA 3WXMB 4P5NA 4EMHA 2BUDA 4LDXA 4M77D 4XU0A 2K2VA 2EFIA 2EQKA 3L2UA 3DLMA 2Y4XA 5GMKi 5FU7B 2JUFA 3A5ZB 4C5EA 2JN0A 3R6OA 3UPUA 2LTOA 4C0ZA 4IUUA 2QQBA 2RK1A 3OS0A 4VUBA 4PKCC 3NTKA 2DK3A 3GOXA 2GQVA 1FWZA 2QA4T 1YITA 2HNIA 1MGQA 5GAMd 4ZGJB 1PSEA 3DB3A 3BW1A 2RI5A 3HP9A 5KCHA 2D6FA 4M7AA 4M77B 2RB6A 2MF2A 4BE2A 1QP2A 4LDYA 5DM7R 3BDLA 2QXFA 3EFSA 2DD5A 3OS2A 4KBMB 4OB3B 2E65A 3CCSA 2C06A 3J80E 5GAOr 1QP3A 2DVEA 2L5QA 3MP8A 2RHXA 3JCMh 2K5LA 5GAN7 3CXCA 2XDBA 4QW2A 3G4SA 2MI6A 4FM4B 4OVAA 2K57A 2ZPGB 2FYKA 1WPYA 3GP8A 3V8KA 5C0MA 2CZ0B 1O75A 4M75D 2P4TA 4JJNK 2EIFA 4PNOA 4UC4A 1YITT 4PJOG 5GAN2 3QYHB 2E1HA 4FL6A 4MDXA 4ME7A 4EMGA 4O6JA 1VQNA 4C8QC 4C8QF 3HSBA 2CZ6B 2A3LA 3MEUA 2DXUA 5CKHA 1BI1A 3QBYA 2WSFE 1BIBA 3WVEB 3JCMc 2VUBA 3CC4A 2HD0A 2ZCFB 3CCEA 3Q1JA 4II1A 3CCST 1H3ZA 1LOJA 2E10A 4OF1A 4M7DD 4RCBA 3JB9D 1I81A 3TCJA 1V29B 4GY5A 3G4ST 3E9GA 5GANj 3OY9A 2R5MA 4C5HA 4ELZC 2L8DA 5LJ3g 1KHCA 4M75B 3S3OA 2M16A 1BKBA 3LWIA 2ZGWA 1BI0A 2E6NA 4HKEA 3TU4K 2VYTA 5A0LA 5CIUA 2G3RA 1VUBA 4JLIA 3ZEHA 3QZ9B 2H3JA 4FT4A 2DTHA 4C0DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 A;  2EAY A;  4A53 A;  2E41 A;  3JCM e;  1TH7 A;  1WQW A;  5GAN 4;  3SWN A;  4A54 A;  5GAN 6;  5GAM h;  4NL3 A;  4M75 E;  2EJ9 A;  2CGH A;  3V7S A;  4XU3 A;  3QSU A;  2DJZ A;  4PJO D;  3JB9 I;  4M77 G;  3SB2 A;  4M7D B;  4M77 C;  4M77 F;  4C8Q D;  5GAM f;  5GAO l;  4EMK C;  2FB7 A;  1LNX A;  2YHT A;  5DY9 A;  5LJ3 h;  3BY7 A;  2DZ9 A;  4C92 G;  3JCM d;  4C92 C;  4C92 F;  1KQ1 A;  2DZC A;  5GMK m;  4C8Q E;  2I2L A;  5GAN h;  5LJ3 f;  5I21 A;  4M7D A;  1B34 A;  4XTV A;  2DKG A;  4M78 E;  4JUV A;  4XTY A;  5GAN f;  4HT8 A;  5CAI A;  1KQ2 A;  4F7U E;  5LJ5 j;  3FIF A;  2VXE A;  5GMK h;  3GIB A;  3RES A;  3SWN B;  3PGG A;  4XTZ A;  4XTW A;  3BFM A;  4XTU A;  1M5Q 1;  3M4G A;  5GAO n;  4PJO B;  1N9R A;  3HFN A;  4N0A C;  4X9D A;  4M7A F;  4M7A D;  3L2Z A;  3VU3 C;  1WQ7 A;  5LJ5 g;  4C8Q B;  3HFO A;  3V8J A;  2RD1 A;  3JCM J;  4XQ3 A;  1U1T A;  3BDU A;  4MMK A;  3JCM W;  3QHS A;  4M78 B;  3JCM V;  4PJO A;  4QVD A;  1B34 B;  4J6Y A;  4EMH A;  4M77 D;  3FB9 A;  4XU0 A;  4C8Q A;  4F7U B;  5GAO m;  4NOY A;  1X01 A;  3JCM X;  5GAO r;  4PJO E;  5GMK i;  1JRI A;  2JN0 A;  4C92 D;  3JCM Q;  4M77 E;  3RKW A;  4M78 A;  3INZ A;  2QTX A;  5GAM e;  4F7U A;  3JCM P;  3AHU A;  3FJP A;  4C92 E;  1JBM A;  1I4K 1;  5LJ5 h;  3JB9 H;  4HT9 A;  4M75 G;  3QUI A;  4M75 F;  4M75 C;  3JCM g;  4QVC A;  2Y90 A;  5LJ3 e;  5LJ5 f;  3SWN C;  2EJF A;  3RIR A;  2HNI A;  1MGQ A;  4HA8 A;  5GAN e;  5GAM d;  2DTI A;  3BW1 A;  1YCY A;  1Y96 A;  2VC8 A;  2EJG A;  2YLC A;  1BIA A;  2RB6 A;  4J5Y A;  4M77 B;  3V8L A;  4EMK B;  3JCM b;  3JB9 J;  3EFS A;  4M7A E;  4JRI A;  3V7C A;  4C92 B;  1H64 1;  2RM4 A;  5GMK e;  5GAO q;  2DXT A;  4M7D G;  5GMK l;  4F7U G;  4XU2 A;  4M7D C;  3EFR A;  2E65 A;  1N9S A;  1D3B B;  4M77 A;  4F7U F;  5GAN d;  5GAO p;  1HK9 A;  2DVE A;  4EMK A;  5GAN 8;  3JCM h;  4J6X A;  1HXD A;  4XTX A;  5GAN 7;  3JB9 F;  1U1S A;  2RA2 A;  4C92 A;  1I5L A;  1I8F A;  3JCM f;  5GAN 5;  2K57 A;  2VXF A;  1D3B A;  4V2S A;  4OP0 A;  2FYK A;  1LJO A;  1WPY A;  3V8K A;  4M7A B;  1Y96 B;  4M75 D;  4PNO A;  4PJO G;  5GAN 2;  2E1H A;  4PJO C;  4PJO F;  4Y91 A;  2DTO A;  4N0A A;  3V7R A;  5GAM j;  4M7A A;  4C8Q G;  4EMG A;  3HSB A;  4C8Q C;  4C8Q F;  5LJ5 e;  3QO3 A;  2DXU A;  1M8V A;  1BIB A;  5LJ3 d;  3JCM c;  4NL2 A;  4M78 G;  5LJ3 j;  4M78 C;  4M78 F;  4M78 D;  4DQ2 A;  5GAM g;  4XU1 A;  1WNL A;  1LOJ A;  2E10 A;  3JB9 G;  4M7D D;  4M7D F;  4RCB A;  3JB9 D;  1I81 A;  2DEQ A;  4MML A;  5GAN j;  4X9C A;  5LJ5 d;  5LJ3 g;  4M75 B;  3RER A;  4M7D E;  2EWN A;  2ZGW A;  3RKY A;  2YLB A;  3L1A A;  2E64 A;  4RCC A;  5GAN 3;  5GMK j;  4WF2 A;  5GAN g;  4JRK A;  3RUX A;  4J6W A;  3RKX A;  4JLI A;  4M7A G;  4M7A C;  2DTH A; 
#chains in the Genus database with same CATH topology
 1KC8 C;  1WQW A;  2EJ9 A;  3V7S A;  1JXM A;  2DIQ A;  1D0Y A;  3CEY A;  5GAM f;  4EMK C;  1TTH B;  2YHT A;  3CC4 T;  2C0I A;  1OOT A;  5D6Y A;  2QI2 A;  2I2L A;  5I21 A;  3PIP A;  1B34 A;  4XTV A;  4M78 E;  3EG1 A;  4BUG A;  2X35 A;  4XTY A;  1M90 U;  1TUG B;  1OPK A;  4HVU A;  4A4E A;  1M5Q 1;  1ZBX A;  2JT4 A;  5GAO n;  1SKU B;  3OYJ A;  1YNZ A;  2K79 A;  1JJ2 A;  1NJI U;  4BY6 B;  1YHQ Q;  1VQK Q;  1SSF A;  5FU6 C;  3RKW A;  5FLX E;  1SEM A;  3QZ5 B;  3S3N A;  1IGU A;  1JBM A;  1ZUY A;  4FYX B;  3M54 A;  5I22 A;  1YI2 Q;  3JB9 H;  3UA7 A;  2JMC A;  3QUI A;  4RTZ A;  2JTM A;  1RAI B;  2A0F B;  1UGV A;  1I1J A;  3SWN C;  3E2U A;  5HY6 A;  5GAN e;  1AWJ A;  4HXJ A;  2PNI A;  3JB9 J;  2KEA A;  2NLU A;  2FZG B;  1VQ8 T;  1IXD A;  1YWP A;  2BTT A;  4IUR A;  1UGP B;  4JZ3 A;  1W4S A;  2JNG A;  1M2V A;  1N8R C;  1VYT A;  5FRN A;  1TWB A;  4OB1 B;  1M3C A;  3N5B B;  4R0K A;  3C95 A;  2GTJ A;  5GAM j;  1JB0 E;  3HKS A;  2KBT A;  4D8K A;  1QMC A;  3LWH A;  1H3H A;  2HQX A;  1NPP A;  1I07 A;  3THK A;  5A2Q E;  2C0O A;  3E19 A;  3RKX A;  2DBM A;  3RMQ A;  5AT1 B;  4M75 A;  2VKN A;  1X75 C;  2EAY A;  3CXC S;  1XNI A;  2FPD A;  4PK4 A;  4JRQ A;  4E7S A;  2VAS A;  4XU3 A;  4OMO A;  1S72 Q;  5KYX A;  3SB2 A;  3VS4 A;  2EW3 A;  4C8Q D;  3I55 T;  3MET A;  2O31 A;  5DY9 A;  4C5I A;  5GMK m;  4Z02 A;  4M7D A;  1AD5 A;  2VWF A;  3VS5 A;  2OTJ A;  2YSQ A;  1WXT A;  1HJD A;  1X6B A;  4EIK A;  2E5Q A;  3CPW A;  4E7J A;  1YIJ Q;  2O9V A;  1GFC A;  3P8H A;  1M8M A;  2DYB A;  3L2Z A;  3G1J A;  4C8Q B;  1M9S A;  3RR6 A;  3G6E T;  1RAG B;  1OZ3 A;  1YJ9 T;  2LQK A;  4XAX B;  2HQE A;  3CCR Q;  4FT2 A;  2K9G A;  4J9E A;  3OSV A;  2NUT B;  3NMZ C;  3FJP A;  2MK5 A;  4FCY A;  2B86 A;  2CT3 A;  1KIK A;  4M75 G;  2HBW A;  1PRM C;  3FEO A;  2DMO A;  3RIR A;  4RTW A;  3CME T;  4AT1 B;  1Q81 C;  4QQG A;  1K9M R;  3OYC A;  5GAO q;  2VGN A;  4M7D G;  1MMN A;  2D0N A;  1HK9 A;  1RI9 A;  2DD4 A;  4C92 A;  1QKW A;  1UGR B;  2HDA A;  4V2S A;  4FYY B;  3HRS A;  2L3P A;  1GL5 A;  4LD9 K;  2EQU A;  4NS5 A;  2IPO B;  2DTO A;  4BI3 A;  3OW2 S;  4M7A A;  2R58 A;  3EG9 B;  3QO3 A;  4L6V 5;  3VRZ A;  5LJ3 d;  1M1F A;  1RAF B;  1JEG A;  4M78 C;  4M78 D;  2DBK A;  3EG0 A;  5CK9 A;  1BI3 A;  4MML A;  3QWY A;  1Q7Y R;  2D8H A;  2OX7 A;  2DVJ A;  4M4Z A;  2DRK A;  1TXQ A;  5GMK j;  4JRK A;  3NGP A;  8ATC B;  3H0I A;  2MMP A;  4L5G A;  4YTL A;  4NL3 A;  3VYG A;  4M75 E;  2CGH A;  3FDR A;  3EFO A;  4DEX A;  1VQP A;  1GBQ A;  3QJ6 A;  4M77 F;  1VQ4 T;  4QT7 A;  1WX6 A;  2DZ9 A;  4C92 G;  1KQ1 A;  3CCV T;  4LD6 A;  2CYZ B;  3VJP A;  2X3W D;  1KFZ A;  3D7S B;  3UAT A;  5CKD A;  2J7I A;  3TSW A;  3CCU A;  4EPC A;  3UDC A;  4PJJ A;  1RAC B;  4FSS A;  1JXO A;  1OU9 A;  3CC4 Q;  1PHT A;  4QVD A;  1N6A A;  3OYK A;  1D1A A;  1JRI A;  2OTJ Q;  3JCM Q;  2FZC B;  1EIF A;  2QTX A;  3VUZ A;  1OPL A;  2X3X D;  5IHK A;  2KRM A;  4TVR A;  5C6S A;  2E12 A;  2DTI A;  2YLC A;  2ZPH B;  4FYW B;  2XI9 A;  3G7Z A;  4BAC A;  1YJN A;  2KI7 A;  1WA7 A;  2ENM A;  2EGE A;  3L2W A;  2YDL A;  3JB9 F;  4EMK A;  4IIM A;  2DL5 A;  3WVD B;  5FRO A;  1UE9 A;  4FW2 A;  1U1S A;  3M4Y A;  3JCM f;  1KD1 R;  2ZPE B;  5GAN 5;  3PT9 A;  2SRC A;  4BB7 A;  1QVF S;  4LDU A;  2P0K A;  3MP6 A;  1VQ8 Q;  3VUB A;  1VIE A;  2EGA A;  1QVG P;  1M1K R;  2EVR A;  3QYG B;  1ZHI A;  5GAM g;  1WNL A;  4QKU A;  2YRC A;  2DL7 A;  2CKK A;  2QEX A;  4JDS A;  4E6R A;  1SRM A;  2FPE A;  5J3B A;  3RKY A;  2MWP A;  4IUQ A;  4CC7 A;  1WDX A;  4LDW A;  1K4U S;  2DXB A;  1RL2 A;  3A8G B;  1AVZ C;  3NTI A;  5CO7 A;  1BYM A;  3VV0 A;  3SWN A;  2GCX A;  3HTR A;  4RTV A;  1KQS A;  3CC2 T;  4OB0 B;  4DBF A;  2MYS A;  4JJB A;  1VQ4 A;  4R56 A;  1UB4 A;  4A4F A;  3TRE A;  4LUE A;  3H0H A;  4E7K A;  2XMF A;  3LW5 E;  2DLP A;  2XKO C;  1AEY A;  2HQH A;  4XTZ A;  4XTW A;  3OYM A;  4JS5 A;  1VQP Q;  1WQ7 A;  2DIL A;  2LZ6 B;  4GBQ A;  3JCM J;  3BDU A;  3I55 Q;  3H9N A;  2YRD A;  1X6G A;  4LDX A;  2BUD A;  1EFN A;  4AFU C;  1LVK A;  2EQK A;  2CSI A;  2Y4X A;  5GMK i;  2A28 A;  3R6O A;  4JZ4 A;  2QQB A;  2RK1 A;  2HSP A;  1YFN A;  2J6K A;  2DK3 A;  3NTK A;  1UHF A;  2QA4 T;  4ZGJ B;  1PSE A;  1CKA A;  2CP6 A;  3EG2 A;  5KCH A;  3G6E Q;  4BE2 A;  4LDY A;  1YJ9 Q;  3OS2 A;  4WTO B;  4OB3 B;  1M2V B;  1S1N A;  1ABO A;  2V26 A;  1QP3 A;  3MP8 A;  4DEY A;  3I5R A;  4FM4 B;  4OVA A;  4CC2 A;  1FYN A;  3M0T A;  3GP8 A;  4M75 D;  2F2V A;  2E3H A;  4JJN K;  3CME Q;  1YIT T;  4X1V A;  2FRW A;  4DBH A;  1ZSZ A;  3QYH B;  4FL6 A;  2E4H A;  5IHN A;  1BIB A;  2VUB A;  1IB8 A;  4A63 B;  2L3Q A;  4OF1 A;  4M7D D;  2L8D A;  1KHC A;  2DX1 A;  4M75 B;  3LWI A;  2CH4 A;  5A0L A;  4JLI A;  5KYX B;  5DM7 R;  3VS7 A;  4PLL A;  3OYN A;  2R5A A;  3QSU A;  3DKM A;  1K73 R;  4M7D B;  3EG3 A;  2A08 A;  3CCE T;  2QEX Q;  1Q86 R;  2DZC A;  3MKD A;  1Y7X A;  5CQY A;  4J7I A;  2DKG A;  3M0S A;  4A4K A;  1MND A;  1IRX A;  2EYW A;  2JW4 A;  2DO3 A;  3LX7 A;  4Y28 E;  1SF9 A;  3ME9 A;  3R6N A;  1VQ4 Q;  1U1T A;  2AK5 A;  1K8A R;  1OUL A;  3QKJ A;  4J6Y A;  1Y07 A;  3CCV Q;  2YRV A;  1G3Y A;  4C92 D;  1OZ2 A;  1MMD A;  4M77 E;  1WLP B;  4M78 A;  1AZE A;  2CZ1 B;  7AT1 B;  1B07 A;  1MMA A;  2PUK B;  2ATC B;  2FHD A;  1NYG A;  4DOW A;  1PD0 A;  1E6H A;  2RN8 A;  2EPD A;  4DBQ A;  3L42 A;  1N27 A;  4C92 B;  1H64 1;  3M57 A;  4PFZ A;  4RMO A;  4F7U G;  3REB B;  4AFS C;  4Y92 A;  5GAN 8;  3H8Z A;  4CC3 A;  2FRY A;  2EQI A;  4E7L A;  2RNA A;  2JTF A;  2GGR A;  3QPH A;  1I5L A;  2LJ1 A;  4OP0 A;  1NPR A;  1IHW A;  4M7A B;  2G6F X;  1Q82 C;  4PJO F;  2EQJ A;  3OYI A;  2YWW A;  1IRE B;  2K7A A;  1VQO A;  1FMV A;  4M78 G;  5I2M A;  2NUP A;  4XU1 A;  1GXI E;  3CXC P;  2QQR A;  3ZFJ A;  4FU6 A;  1QWE A;  1ZQ1 A;  1W2B A;  5CQX A;  3RER A;  1WJR A;  4KUL A;  2DE0 X;  2GFA A;  5GAN 3;  4Z88 A;  2E3I A;  3EFO B;  1MHN A;  3MPU B;  1U5S A;  5A0G A;  4XTX A;  3CBP A;  2V8K A;  2C0T A;  3OYH A;  2RHZ A;  1ZBJ A;  2LQW A;  3S3M A;  2JOY A;  2LQN A;  4LUD A;  5IXB A;  1IZ6 A;  5GAM h;  3KUF A;  2DF6 A;  3JB9 I;  4B9X A;  2DIG A;  2QGG A;  3VKI A;  4A4H A;  4B9W A;  4PJL A;  3FJ5 A;  1KC8 R;  5LJ3 f;  4CI0 C;  4BI4 A;  4OB2 B;  3CMA A;  5IH2 A;  2QDL A;  2CP2 A;  1B3Q A;  2O01 E;  5CAI A;  4F7U E;  2CP5 A;  1K76 A;  2X4X A;  3GBQ A;  2F2X A;  4X9D A;  2L2P A;  3CC2 Q;  4JPB W;  2KSS A;  1V1C A;  1OYX A;  3A8H B;  2CH4 W;  2KAF A;  3JCM X;  3QG1 A;  2YXY A;  5KYN A;  3P8D A;  2HBP A;  2OTJ T;  5LL6 S;  1M30 A;  2DFU A;  2CUD A;  5M9O A;  2RH2 A;  3JCM g;  5LJ5 f;  1KJW A;  4JJC A;  1VQL A;  1Y96 A;  1O9S A;  3JCM b;  1TG0 A;  4EMK B;  1PRL C;  3MP1 A;  4IIO A;  2CS7 A;  2LNH B;  1NM7 A;  4AFQ C;  3H41 A;  3OYY A;  2KYB A;  3UWN A;  3OW2 P;  1JJ2 S;  1W6X A;  2VXF A;  4LNP A;  5I11 A;  2DER A;  4FYV B;  2QA4 Q;  4KGV B;  2DEU A;  4X34 A;  5D6W A;  3TVT A;  5GJW B;  4J9F A;  1OEB A;  1RLP C;  4ZN1 A;  2PUO B;  3OSS C;  4KGX B;  1N8R R;  1W1F A;  3FC3 A;  1NG2 A;  1K1Z A;  1WXU A;  5FU6 B;  5LJ3 j;  4WCI A;  3I56 A;  1K9M U;  1G5V A;  1KSW A;  3HRT A;  3GNF B;  3KBG A;  2KNB B;  3CPF A;  5KYY A;  1YIT Q;  3M56 A;  5EG2 A;  1TUD A;  2I0N A;  2MWO A;  1VQ6 A;  2A37 A;  1VQO Q;  1C6V X;  1UHC A;  4J9C A;  2K2M A;  3OYD A;  2RI2 A;  3OYA A;  4M77 C;  5KE3 A;  1Z9Q A;  1VQM A;  3EAE A;  3OYF A;  2JJ9 A;  3VS0 A;  2DL4 A;  4RG2 A;  2RHI A;  2RHU A;  1NEB A;  4JUV A;  1KG1 A;  5LJ5 j;  4KT0 E;  5GMK h;  1NLP C;  2EQM A;  4PFO A;  3MO8 A;  1Q7Y U;  3OMG A;  3V8J A;  3G71 A;  1VQP T;  4ZGD B;  3CCE Q;  3PFS A;  4MDW A;  3C0C A;  3JRZ A;  3CMA Q;  2J05 A;  3OMC A;  1U06 A;  2MOX A;  3QDF A;  2GFU A;  4OMM A;  3VS2 A;  2CZ7 B;  3CCL A;  2X4J A;  3CCU T;  1ARK A;  3U23 A;  4IUV A;  3CPW S;  4L59 A;  4JRI A;  2BE9 B;  2XIC A;  2EKO A;  4PLI A;  3NHN A;  1QVF P;  1SHG A;  4OMN A;  3C12 A;  1Q81 R;  3M58 A;  3FLG A;  4D6W A;  1N5Z A;  1ZSZ B;  3T9N A;  1RI0 A;  2O88 A;  1NYF A;  2WAC A;  2LDM A;  1M90 C;  3GNG A;  4OMQ A;  4PL6 A;  2AHJ B;  2FEI A;  4F04 B;  3V7R A;  2LT4 A;  1AZG B;  1IHV A;  1YJN T;  4MZP A;  5KCO A;  2KXD A;  1ACM B;  1NJI C;  2FO0 A;  2VB6 A;  2IVW A;  2CP7 A;  1AWW A;  3CBO A;  2ECZ A;  3JV3 A;  2P84 A;  3O5Z A;  2K5F A;  1R8O B;  2KQW A;  1BI2 A;  3CD6 A;  2KRO A;  4PFP A;  2F69 A;  2ZAE A;  1WHK A;  2E41 A;  2SEM A;  8AT1 B;  1KD1 U;  1TH7 A;  2P0P A;  3ULR B;  3LH5 A;  3VS6 A;  2LX7 A;  2X51 A;  1XTD A;  2NWM A;  2LVM A;  4ESR A;  4KH1 B;  2QEX T;  5CKB A;  2RJE A;  1ZUU A;  1M1K U;  3BE3 A;  5GAN f;  4QVZ A;  1UEC A;  3SD4 A;  2GTO A;  2D0Q B;  2QGF B;  4HCZ A;  1VOM A;  5D6X A;  2YUO A;  2K6D A;  4M78 B;  4EMH A;  1UUE A;  1QCO A;  2RQT A;  4C5E A;  2PZ1 A;  2GQV A;  1FWZ A;  1D0Z A;  2HNI A;  5GAM d;  2HZY A;  2RI5 A;  4RTT A;  2RB6 A;  3I35 A;  1GRI A;  3EFS A;  3MJX A;  2DD5 A;  1MMG A;  1GFD A;  4OML A;  2E65 A;  2KRN A;  3CCS A;  5GAO r;  3JCM h;  2K5L A;  1YCS B;  2KT8 A;  1GCP A;  3G4S A;  3PE0 A;  3KFV A;  2ZPG B;  1WPY A;  2KYM A;  3V8K A;  5C0M A;  2CZ0 B;  2BZX A;  1M3B A;  1PKS A;  2JM8 A;  2P4T A;  1D09 B;  2EIF A;  2E1H A;  2NUP B;  4MDX A;  1WHG A;  4ME7 A;  4EMG A;  4O6J A;  1VQN A;  4C8Q F;  2A3L A;  5CKH A;  1BI1 A;  1QLY A;  2A36 A;  3JCM c;  2ZCF B;  2DRM A;  1QCN A;  1Z9Z A;  1CKB A;  1RAE B;  5GAN j;  2L3S A;  3E9G A;  1X2Q A;  3OY9 A;  4C5H A;  2M02 A;  4JJD A;  5LJ3 g;  1BKB A;  4HKE A;  1WYX A;  1VUB A;  2M51 A;  3UT1 A;  5HKC A;  4N4G A;  4FSX A;  3M5A A;  2RJC A;  2OTL A;  3TSZ A;  1RUW A;  4LE9 A;  4IKF A;  3A8L B;  3CD6 Q;  2K4Y A;  4RTU A;  2RJD A;  5LJ5 g;  2ESW A;  4MZT A;  1VQ5 A;  5L8R E;  2LMJ A;  4Z89 A;  3L2V A;  1B34 B;  1X6O A;  3CC7 A;  3LGF A;  3OYG A;  3TEE A;  2JVV A;  1K73 U;  1FXX A;  2H8H A;  1KQS S;  4HT9 A;  3RMS A;  3URG A;  5L23 A;  1Q86 U;  4LXC A;  2FG0 A;  2XD0 A;  2KMT A;  5HCK A;  1OI1 A;  2EJG A;  2DA9 A;  2EBP A;  2ED0 A;  2RM4 A;  2BZY A;  2DXT A;  1VQ9 A;  3MEW A;  4M77 A;  4KRT A;  1HXD A;  1R77 A;  1K8A U;  3LGL A;  5FWC A;  4KGZ B;  3EGD A;  1Y71 A;  2RQR A;  3CCU Q;  1AOJ A;  1PC0 A;  1NE8 A;  2RJF A;  1G83 A;  2RQU A;  4PJO C;  2F5K A;  2YUQ A;  1SHF A;  3SHW A;  4OMF B;  4KH0 B;  2DJQ A;  1UEB A;  5IAY A;  2EYY A;  3VS1 A;  4C0G A;  3CCM A;  1UJ0 A;  1AWO A;  3M9Q A;  5KYY B;  4X9C A;  2V1R A;  3QII A;  1JO8 A;  5KYU A;  1UGQ B;  2E64 A;  2YT6 A;  4RCC A;  5CCA A;  1TU0 B;  5GJV B;  2QQS A;  1VQN Q;  2V1Q A;  1TSF A;  2AKK A;  2CSQ A;  2ZPI B;  1YJN Q;  2CUB A;  4M77 G;  1OV3 A;  1VQO T;  2Y4Y A;  4BE0 A;  4F16 A;  2QG9 B;  3FRN A;  2DNU A;  2YUN A;  5J26 A;  2ROL A;  5J39 A;  1WGS A;  1VYU A;  1UJY A;  1XJW B;  2O4X A;  3BFM A;  1UDL A;  3HL8 A;  2NUT A;  3HFN A;  1PKT A;  2J06 A;  4FIB A;  4J8O A;  1X27 A;  3OBW A;  1MV3 A;  5HK3 A;  2OTL Q;  1M3A A;  1M27 C;  2M1H A;  2XDP A;  1ZX6 A;  3CMA T;  5GAM e;  3PMI A;  4F7U A;  3LH0 A;  1Y57 A;  1C1A A;  3HPW A;  3RDV A;  2CRE A;  1AHJ B;  3CCQ T;  1DJ7 B;  1KC8 U;  2KK4 A;  3A8O B;  2NUZ A;  1T0H A;  1JJ2 P;  4AFZ C;  4ZN3 A;  2LP5 A;  3QDR B;  1KK7 A;  1QKX A;  4LDV A;  4QQ6 A;  3OB9 A;  5GMK l;  1QVG A;  2EYX A;  4A4G A;  3EG9 A;  3JB9 G;  1UTI A;  2MPX C;  2DXC A;  1D1B A;  1I8F A;  1Y0M A;  1D3B A;  1VIF A;  1LJO A;  3EHR A;  3LYI A;  2XDD A;  3DLL A;  3CCJ T;  2JXB A;  1RLQ C;  1ZLM A;  1ZSG A;  2RHY A;  5CR2 A;  2K5I A;  1VQL T;  1ZA1 B;  3OA6 A;  2QDY B;  2RQW A;  2O2O A;  1VQ7 A;  2KR3 A;  2VV5 A;  1AT1 B;  1T3S A;  4NL2 A;  1YJW A;  2JMA A;  4BD3 A;  4DQ2 A;  5AYF A;  1K0X A;  2L0A A;  4MZM A;  4E7Z A;  1YHQ A;  1Q82 R;  2XK0 A;  5FU7 C;  1VQK A;  1NEG A;  3OYL A;  1YBY A;  3PNW C;  4RG8 A;  1K8A C;  2YLB A;  3P8B B;  2ZZD A;  5GAN g;  1YI2 A;  4M7A C;  2M0Y A;  4R55 A;  2K3B A;  3EGX A;  2V8I A;  2PVG B;  3REA B;  2DYI A;  5GAO l;  5LJ3 h;  3JCM d;  2DPP B;  4C8Q E;  2F5T X;  4CRI A;  4J9I A;  3I56 T;  1N8R U;  2CDT A;  3GIB A;  3X20 B;  2ABL A;  4J9G A;  1VQ6 T;  2LCC A;  4N4H A;  2OAU A;  3VU3 C;  1W2B S;  3PTA A;  1G2B A;  3GLX A;  4HCC A;  3FB9 A;  1VQM T;  4E47 A;  1FMK A;  2EYZ A;  3JCM P;  1PCX A;  3AHU A;  3CPW P;  5LJ5 h;  1I4K 1;  3A98 A;  1A0N B;  4QQD A;  2XID A;  3KXT A;  2HKN A;  4M75 F;  3CCQ A;  2LT1 A;  1WHJ A;  1WHM A;  1D1C A;  3G71 T;  2M9U A;  2HSE B;  1FMW A;  2DAQ A;  2PVO B;  2GF7 A;  5GMK e;  1PNJ A;  1S72 A;  2K3X A;  3H6Z A;  4M7D F;  1N9S A;  2HL5 C;  4JLG A;  2QQA A;  5CKE A;  4BI8 B;  4O5V A;  1WHH A;  3CCL T;  4C0D B;  2WSE E;  3H0F A;  1YIJ A;  3CCJ A;  2QTV A;  1GBR A;  2AZV A;  2WSC E;  5DLO A;  1JQQ A;  2A7Y A;  1M8V A;  2BIV A;  2KT1 A;  1FX7 A;  4BY6 C;  2B8A A;  4ZGE B;  2ZPF B;  2GNC A;  2COY A;  3CCR A;  4LN2 A;  1F1B B;  4BDY A;  1K9A A;  3L1A A;  4WF2 A;  2FZK B;  1V76 A;  4J6W A;  3GPL A;  2IIM A;  5EC7 A;  3GF5 A;  1LCK A;  2LQ8 A;  3C94 A;  1Q81 U;  1VQ7 Q;  4GLK A;  5GAN 6;  1YJW Q;  2HL3 A;  2GQI A;  4HCK A;  4C92 F;  4DBR A;  1SRL A;  4JRP A;  2XHC A;  3CD6 T;  3SWN B;  2KDS A;  3M4G A;  1N9R A;  4FW1 A;  4N0A C;  4M7A F;  2X4Y A;  2AKL A;  2RD1 A;  2RI3 A;  1WI7 A;  2VGM A;  3M0P A;  4PJO A;  1K0S A;  1CSK A;  4M77 D;  4XU0 A;  2EFI A;  2JUF A;  1SSH A;  3UPU A;  2LTO A;  4C0Z A;  4IUU A;  3OS0 A;  1E6G A;  1T0J A;  4VUB A;  4ANJ A;  4PKC C;  5KYW A;  1MGQ A;  3HP9 A;  3BW1 A;  2D1X A;  2D6F A;  4M77 B;  1X2K A;  2MF2 A;  1YWO A;  2AIR B;  1H8K A;  4ZNX A;  4KBM B;  4RTX A;  1BBZ A;  2QAZ A;  3EGD B;  5FW9 A;  4GLM A;  2C06 A;  1BCM A;  2DVE A;  5GAN 7;  2XDB A;  3CXC A;  1WXB A;  4QW2 A;  3QWX X;  1I5O B;  2COW A;  3CCQ Q;  3NPF A;  1O75 A;  2GBQ A;  4PJO G;  5GAN 2;  3RBB B;  4C8Q C;  4J9D A;  2DXU A;  2WSF E;  1M90 R;  2KRS A;  3CC4 A;  2HD0 A;  2NYS A;  3CCS T;  5KYU B;  1T3L A;  4PJN A;  2E10 A;  3JB9 D;  3TCJ A;  3G4S T;  4ELZ C;  1I0C A;  2ZGW A;  2VYT A;  2JM9 A;  3CCJ Q;  5CIU A;  1ZSZ C;  1U3O A;  2G3R A;  1NJI R;  3ZEH A;  3QZ9 B;  4FT4 A;  2DTH A;  1VQL Q;  3JCM e;  4F17 A;  4DA4 A;  1VQN T;  2JS0 A;  3HHT B;  2ROT A;  3OBY A;  1LNX A;  3BY7 A;  2COZ A;  5GAN h;  2MCN A;  2O4X B;  2D9T A;  1GCQ C;  5CVI A;  3ZBD A;  1NBE B;  1W70 A;  1X69 A;  2FL7 A;  3MEV A;  4Q5W A;  3FIF A;  1PM3 A;  3ZL7 C;  3RES A;  1M4Z A;  3NTH A;  1UFF A;  3VYH B;  2F2W A;  2JS2 A;  3OYE A;  1UG1 A;  3OS5 A;  2LC4 A;  1G3W A;  3EHQ A;  3CQT A;  1KQS P;  4C5G A;  4MMK A;  3JCM V;  1VQ8 A;  4F7U B;  5GAO m;  3O8V A;  2OTL T;  4PJO E;  2VVK A;  2P4R A;  3I56 Q;  1U8R A;  4HCB A;  2MAM A;  2BE7 D;  3OW2 A;  4XK8 E;  3C4S A;  3TQ7 P;  1K9M C;  1VQ6 Q;  2QQ9 A;  3OS1 A;  3I9Q A;  2EJF A;  3A8M B;  2HKQ B;  1IO6 A;  2F1L A;  3MEA A;  3SFM A;  3X26 B;  1BU1 A;  1YCY A;  3V8L A;  1QWF A;  3JAM E;  1VQ5 T;  1VQM Q;  3J81 E;  1SG5 A;  3VS3 A;  3CC7 T;  3IQL A;  6AT1 B;  5GAO p;  1D3B B;  1WFW A;  4J6X A;  2K3Y A;  1BK2 A;  1YP5 A;  2KY9 A;  3RNJ A;  1HSQ A;  1RAD B;  1P92 A;  3G71 Q;  1Q7Y C;  3ER0 A;  1MNE A;  1PWT A;  2LJ0 A;  5CKF A;  2ED1 A;  3I55 A;  1VQ9 T;  1C0M A;  1OX8 A;  2RF0 A;  1OX9 A;  2DEQ A;  5LJ5 d;  4M7D E;  3CCL Q;  3EGX B;  4M7A G;  3MHX A;  5A0D A;  2HAX A;  5ECA A;  3S3O A;  4A53 A;  1WJS A;  1R0C B;  1ZUK A;  2HEQ A;  5KH6 A;  2FPF A;  1UGS B;  1ABQ A;  1NZ9 A;  2OI3 A;  3G6E A;  2DET A;  2X9H A;  2X4W A;  4ORZ A;  4C0F A;  1YJ9 A;  1WZO A;  4RTY A;  2Z0W A;  3CCM T;  3CBM A;  2DL8 A;  2J6F A;  2KVQ G;  1OU8 A;  2RO0 A;  3F70 A;  3PGG A;  1H92 A;  4EDU A;  2AZS A;  3HFO A;  3CME A;  3X28 B;  2O9S A;  3JCM W;  3QHS A;  2EKH A;  1QW1 A;  2MIO A;  3M53 A;  3OQ5 A;  4NOY A;  1X01 A;  2KGT A;  2J6O A;  1QVF A;  4J83 A;  5DLQ E;  3M0R A;  3MCA B;  5KE2 A;  4C92 E;  2Y90 A;  2KE9 A;  2PTK A;  4F14 A;  1EZZ B;  1R0B G;  2OJ2 A;  2VC8 A;  4J9B A;  1KD1 C;  4D8D A;  4M7A E;  1TS9 A;  1HD3 A;  4B6M A;  4F7U F;  4J7F A;  2IG0 A;  2EYQ A;  2R57 A;  3OYB A;  1E7O A;  3M59 A;  4CC4 B;  4KUD K;  4AMC A;  1M1K C;  1Y96 B;  4ATO A;  5I2S A;  2QAS A;  4Y91 A;  4N0A A;  1MUZ A;  2LRQ A;  1BB9 A;  2V8J A;  1LPL A;  5IT9 E;  3PVL A;  1G3T A;  4ZTJ A;  4M78 F;  5FRM A;  3CCV A;  1HYO A;  2P0Q A;  3EH1 A;  3M55 A;  4J9H A;  3L2Q A;  2EWN A;  1QCF A;  3VRY A;  2PU9 B;  2L89 A;  1B7T A;  3PMT A;  2LX9 A;  2PVD B;  4K11 A;  3RUX A;  4E2F B;  2JZ2 A;  1VA7 A;  4A54 A;  2L3R A;  2FVU A;  3HRU A;  4PJO D;  4N4I A;  1VQ7 T;  2RPN A;  3M0Q A;  2JTE A;  1X43 A;  3NFC A;  3CCS Q;  2FB7 A;  1YJW T;  2DM1 A;  3G4S Q;  3EGU A;  1ZA2 B;  1YHQ T;  1W2B P;  1VQK T;  2AT1 B;  4BDZ A;  2KXC A;  1XQH A;  4HT8 A;  2OAW A;  5FWB A;  1YI2 T;  4XTU A;  1Q82 U;  2LNV A;  1YN8 A;  3PVQ A;  4PJO B;  2BKD N;  5D7U A;  3PIO A;  2PQW A;  4XQ3 A;  1KHI A;  1J3T A;  1PG5 B;  3E9F A;  2QYZ A;  4C8Q A;  1PD1 A;  2CP3 A;  4DOV A;  2E5K A;  2LCL A;  4Z8A A;  5KYW B;  3INZ A;  2CP0 A;  2XG8 D;  1NLO C;  2HMA A;  2M0O A;  2CT4 A;  4M75 C;  4QVC A;  5LJ3 e;  3X25 B;  1QVP A;  3QXE B;  4HA8 A;  1QQJ A;  3E1S A;  3S6W A;  2E6Z A;  4J5Y A;  1BIA A;  3V7C A;  2ZPB B;  4E7I A;  4XU2 A;  4M7D C;  3EFR A;  5GAN d;  2LJ3 A;  4AG1 C;  2E70 A;  2RA2 A;  1WJQ A;  4ELY C;  1GCQ A;  2XU8 A;  4E7H A;  4HVV A;  3LLR A;  1VQ5 Q;  4IUT A;  4C8Q G;  4RUG A;  2D8J A;  5LJ5 e;  3CC2 A;  3CC7 Q;  1S72 T;  1RAA B;  3L2R A;  1TOV A;  1M1G A;  4JS4 A;  1WIE A;  4BE1 A;  1IGQ A;  3SDZ A;  1G8X A;  3J7A F;  4RKU E;  1SPK A;  4KUI A;  1OQK A;  1K73 C;  4ZTF A;  2W0Z A;  1QVG S;  1YIJ T;  1Q86 C;  1PSF A;  3X24 B;  5HK0 A;  5IHI A;  1EX4 A;  5GAN 4;  2BZ8 A;  3UA6 A;  2DJZ A;  1VQ9 Q;  3QJY A;  1XOV A;  5IXF A;  4C92 C;  4AG2 C;  3JSC A;  3CCR T;  3DB4 A;  2RK2 A;  1KQ2 A;  5IN1 A;  2VXE A;  1Q95 G;  3ASK A;  1G3S A;  3EH2 A;  4OGC A;  4IUP A;  1AWX A;  2QA4 A;  2YUP A;  4M7A D;  2H3E B;  4HVW A;  1TUC A;  4OGE A;  3WXM B;  4P5N A;  1BCO A;  3CCM Q;  2K2V A;  3L2U A;  3DLM A;  1VYV A;  5FU7 B;  3A5Z B;  2JN0 A;  2LCS A;  3GOX A;  2RMO A;  1YIT A;  3DB3 A;  1QP2 A;  3BDL A;  3SEM A;  2QXF A;  2HCK A;  1RAH B;  2EGC A;  4PJM A;  1D0X A;  3AT1 B;  1JU5 C;  3J80 E;  2L5Q A;  2QK0 A;  2RHX A;  3M0U A;  1M2O A;  3UF4 A;  2MI6 A;  9ATC B;  2K57 A;  2FYK A;  3A1P A;  4OMP A;  4PNO A;  4UC4 A;  3HSB A;  2CZ6 B;  3MEU A;  3WVE B;  3QBY A;  1WHL A;  3CCE A;  3Q1J A;  4II1 A;  1H3Z A;  1LOJ A;  3I5S A;  4RCB A;  2W10 A;  1MV0 B;  1I81 A;  1V29 B;  4GY5 A;  2R5M A;  2M16 A;  2RQV A;  1RAB B;  1BI0 A;  2E6N A;  3TU4 K;  2DL3 A;  2H3J A;  4C0D C; 
#chains in the Genus database with same CATH homology
 3JCM e;  4PLL A;  3UT1 A;  1KC8 C;  1WQW A;  3OYN A;  2R5A A;  5HKC A;  2EJ9 A;  4N4G A;  3V7S A;  4DA4 A;  3DKM A;  1VQN T;  3QSU A;  2DIQ A;  3HHT B;  3CEY A;  3OBY A;  4M7D B;  4FSX A;  5GAM f;  3M5A A;  4EMK C;  1LNX A;  2YHT A;  3CC4 T;  3CCE T;  2RJC A;  3BY7 A;  2OTL A;  5D6Y A;  2DZC A;  2QI2 A;  2I2L A;  5GAN h;  5I21 A;  1Y7X A;  2O4X B;  1B34 A;  2D9T A;  4XTV A;  5CQY A;  5CVI A;  4J7I A;  3ZBD A;  2DKG A;  4A4K A;  4IKF A;  3A8L B;  4M78 E;  4BUG A;  2X35 A;  2FL7 A;  4XTY A;  1M90 U;  3MEV A;  4Q5W A;  3FIF A;  2DO3 A;  3LX7 A;  3RES A;  4A4E A;  1M4Z A;  3NTH A;  3VYH B;  2K4Y A;  1M5Q 1;  1ZBX A;  4Y28 E;  5GAO n;  3OYE A;  2RJD A;  5LJ5 g;  3OYJ A;  3OS5 A;  2LC4 A;  1G3W A;  3ME9 A;  4MZT A;  1JJ2 A;  1U1T A;  4C5G A;  4MMK A;  5L8R E;  1VQ5 A;  3JCM V;  1NJI U;  1VQ8 A;  3QKJ A;  3L2V A;  1B34 B;  4J6Y A;  4BY6 B;  1Y07 A;  4F7U B;  5GAO m;  3O8V A;  1X6O A;  2YRV A;  3CC7 A;  2OTL T;  1G3Y A;  4PJO E;  3LGF A;  3OYG A;  1SSF A;  4C92 D;  1OZ2 A;  5FU6 C;  4M77 E;  3TEE A;  3RKW A;  4M78 A;  5FLX E;  1U8R A;  2JVV A;  2CZ1 B;  1K73 U;  4HCB A;  1FXX A;  2MAM A;  3QZ5 B;  3OW2 A;  3S3N A;  1JBM A;  4XK8 E;  1KQS S;  3M54 A;  3JB9 H;  4HT9 A;  3C4S A;  3RMS A;  3URG A;  1Q86 U;  3QUI A;  1K9M C;  2PUK B;  2JTM A;  2QQ9 A;  3SWN C;  3OS1 A;  2EJF A;  2FHD A;  3A8M B;  5HY6 A;  3SFM A;  3MEA A;  2KMT A;  3X26 B;  4DOW A;  5GAN e;  2XD0 A;  1YCY A;  1OI1 A;  3V8L A;  2EJG A;  3L42 A;  3JB9 J;  2NLU A;  3JAM E;  1VQ5 T;  1N27 A;  1VQ8 T;  3J81 E;  4C92 B;  1H64 1;  2RM4 A;  3M57 A;  4RMO A;  2DXT A;  3CC7 T;  4F7U G;  1VQ9 A;  5GAO p;  3MEW A;  4M77 A;  1D3B B;  5GAN 8;  3H8Z A;  4IUR A;  1UGP B;  4J6X A;  1HXD A;  2K3Y A;  4E7L A;  1K8A U;  1W4S A;  2JNG A;  2JTF A;  3LGL A;  3QPH A;  1I5L A;  2KY9 A;  1Y71 A;  4OP0 A;  1N8R C;  1NPR A;  4M7A B;  5FRN A;  1P92 A;  4OB1 B;  3N5B B;  1NE8 A;  3C95 A;  2RJF A;  1Q82 C;  4PJO C;  4PJO F;  2EQJ A;  2F5K A;  3OYI A;  1Q7Y C;  3ER0 A;  5GAM j;  1JB0 E;  3HKS A;  1IRE B;  4OMF B;  5CKF A;  1VQO A;  3I55 A;  1UEB A;  5IAY A;  4M78 G;  1VQ9 T;  5I2M A;  4XU1 A;  4C0G A;  3LWH A;  3CCM A;  1GXI E;  2QQR A;  3ZFJ A;  4FU6 A;  3M9Q A;  2DEQ A;  2HQX A;  1ZQ1 A;  1W2B A;  1NPP A;  4X9C A;  5CQX A;  3QII A;  5LJ5 d;  3RER A;  4M7D E;  1WJR A;  4KUL A;  2GFA A;  1UGQ B;  2E64 A;  4RCC A;  5CCA A;  5GAN 3;  5A2Q E;  3E19 A;  3RKX A;  1MHN A;  4M7A G;  3MHX A;  5A0D A;  5A0G A;  3RMQ A;  4XTX A;  2HAX A;  2QQS A;  4M75 A;  3CBP A;  2V8K A;  1X75 C;  2EAY A;  4A53 A;  1WJS A;  2RHZ A;  3OYH A;  3CXC S;  1XNI A;  3S3M A;  2JOY A;  5KH6 A;  1IZ6 A;  2ZPI B;  5GAM h;  4JRQ A;  3KUF A;  4XU3 A;  1UGS B;  3JB9 I;  1NZ9 A;  4M77 G;  3SB2 A;  3G6E A;  1VQO T;  4B9X A;  4C8Q D;  2DIG A;  3I55 T;  2X4W A;  3MET A;  2Y4Y A;  4C0F A;  5DY9 A;  4BE0 A;  3VKI A;  1YJ9 A;  4C5I A;  4A4H A;  5GMK m;  3CCM T;  4B9W A;  5LJ3 f;  3CBM A;  2KVQ G;  3FRN A;  4Z02 A;  4BI4 A;  4CI0 C;  4M7D A;  4OB2 B;  3CMA A;  5J26 A;  2OTJ A;  5J39 A;  2O01 E;  1WGS A;  5CAI A;  4F7U E;  3CPW A;  2E5Q A;  4E7J A;  2RO0 A;  3F70 A;  3PGG A;  2O4X A;  3BFM A;  3HL8 A;  2X4X A;  3HFN A;  4FIB A;  4J8O A;  4X9D A;  3P8H A;  3L2Z A;  4C8Q B;  4EDU A;  3HFO A;  3CME A;  3X28 B;  1M9S A;  3JCM W;  3OBW A;  3QHS A;  5HK3 A;  3G6E T;  1OZ3 A;  1QW1 A;  2KSS A;  1OYX A;  3A8H B;  3M53 A;  1YJ9 T;  2KAF A;  3OQ5 A;  1X01 A;  3QG1 A;  2M1H A;  2LQK A;  2XDP A;  4NOY A;  4XAX B;  2HQE A;  3JCM X;  4FT2 A;  1QVF A;  3P8D A;  2HBP A;  4J83 A;  5DLQ E;  5GAM e;  3CMA T;  3OSV A;  3PMI A;  4F7U A;  5LL6 S;  3LH0 A;  3FJP A;  3MCA B;  4C92 E;  5KE2 A;  2OTJ T;  3HPW A;  4M75 G;  2RH2 A;  5M9O A;  1AHJ B;  3JCM g;  3CCQ T;  3FEO A;  2Y90 A;  1DJ7 B;  1KC8 U;  5LJ5 f;  2KK4 A;  3A8O B;  3RIR A;  3CME T;  1VQL A;  1Y96 A;  1O9S A;  2VC8 A;  3JCM b;  4EMK B;  1Q81 C;  4ZN3 A;  1KD1 C;  3QDR B;  4M7A E;  4QQG A;  3MP1 A;  4LDV A;  4QQ6 A;  3OB9 A;  3OYC A;  5GAO q;  2VGN A;  2CS7 A;  5GMK l;  1QVG A;  4A4G A;  4M7D G;  4F7U F;  3JB9 G;  1HK9 A;  2DXC A;  2DD4 A;  4J7F A;  2IG0 A;  2EYQ A;  2R57 A;  3OYY A;  4C92 A;  3UWN A;  1JJ2 S;  3OYB A;  1I8F A;  1UGR B;  4V2S A;  2VXF A;  1D3B A;  1VIF A;  3M59 A;  3HRS A;  4KUD K;  1LJO A;  3LYI A;  1M1K C;  1Y96 B;  4ATO A;  2XDD A;  3DLL A;  5I2S A;  3CCJ T;  4LD9 K;  2EQU A;  2RHY A;  4X34 A;  5D6W A;  4NS5 A;  2K5I A;  5CR2 A;  1VQL T;  4Y91 A;  2DTO A;  4N0A A;  4BI3 A;  2LRQ A;  4ZN1 A;  2PUO B;  2R58 A;  3OSS C;  2V8J A;  3OA6 A;  2QDY B;  3OW2 S;  5IT9 E;  1VQ7 A;  3QO3 A;  4L6V 5;  2VV5 A;  5LJ3 d;  3FC3 A;  1G3T A;  4NL2 A;  1M1F A;  5FU6 B;  4ZTJ A;  5LJ3 j;  4M78 C;  4M78 F;  4BD3 A;  4M78 D;  5AYF A;  4DQ2 A;  1YJW A;  5FRM A;  4MZM A;  5CK9 A;  3CCV A;  1BI3 A;  1YHQ A;  2P0Q A;  4MML A;  2XK0 A;  5FU7 C;  1VQK A;  3OYL A;  1YBY A;  3M55 A;  3I56 A;  1K9M U;  1G5V A;  3PNW C;  2EWN A;  4RG8 A;  3L2Q A;  1K8A C;  3HRT A;  2YLB A;  3GNF B;  3P8B B;  2ZZD A;  2PU9 B;  5GMK j;  2L89 A;  3KBG A;  3PMT A;  2LX9 A;  2PVD B;  4JRK A;  3CPF A;  3RUX A;  5GAN g;  1YI2 A;  2MMP A;  2JZ2 A;  3M56 A;  4M7A C;  5EG2 A;  2MWO A;  1VQ6 A;  4L5G A;  4R55 A;  4YTL A;  2V8I A;  4A54 A;  2L3R A;  2FVU A;  3HRU A;  4M75 E;  3VYG A;  4NL3 A;  2CGH A;  3FDR A;  4N4I A;  1VQP A;  4PJO D;  1VQ7 T;  2PVG B;  3OYD A;  2RI2 A;  3OYA A;  3QJ6 A;  4M77 F;  4M77 C;  1VQ4 T;  3NFC A;  5GAO l;  5KE3 A;  2FB7 A;  5LJ3 h;  1YJW T;  1VQM A;  4C92 G;  2DZ9 A;  3EAE A;  3JCM d;  3OYF A;  1KQ1 A;  2DPP B;  4C8Q E;  2F5T X;  4LD6 A;  4CRI A;  2CYZ B;  3CCV T;  1YHQ T;  4RG2 A;  3VJP A;  1VQK T;  2RHI A;  5CKD A;  3I56 T;  4BDZ A;  1N8R U;  2RHU A;  4JUV A;  1KG1 A;  1XQH A;  4HT8 A;  5LJ5 j;  4KT0 E;  5GMK h;  2EQM A;  1YI2 T;  3GIB A;  3X20 B;  4XTU A;  1Q82 U;  2LNV A;  4PJO B;  1VQ6 T;  2BKD N;  3MO8 A;  3PIP A;  2LCC A;  3OMG A;  3CCU A;  1Q7Y U;  4EPC A;  4N4H A;  2OAU A;  2PQW A;  3UDC A;  3VU3 C;  3PIO A;  1W2B S;  3V8J A;  3G71 A;  4XQ3 A;  1VQP T;  1KHI A;  3PTA A;  4ZGD B;  4QVD A;  1N6A A;  3PFS A;  3GLX A;  3E9F A;  4MDW A;  4HCC A;  3FB9 A;  3OYK A;  4C8Q A;  1VQM T;  3JRZ A;  4E47 A;  1JRI A;  4DOV A;  3JCM Q;  2LCL A;  3OMC A;  3INZ A;  1EIF A;  2XG8 D;  2QTX A;  3JCM P;  2GFU A;  3VUZ A;  3AHU A;  5LJ5 h;  1I4K 1;  2M0O A;  4QQD A;  2XID A;  3KXT A;  4M75 C;  4M75 F;  2CZ7 B;  4QVC A;  5LJ3 e;  3CCL A;  2X4J A;  3X25 B;  1QVP A;  4TVR A;  3CCQ A;  2LT1 A;  3QXE B;  5C6S A;  2E12 A;  3CCU T;  4HA8 A;  2DTI A;  3E1S A;  3S6W A;  2E6Z A;  2YLC A;  2ZPH B;  2M9U A;  1BIA A;  2XI9 A;  4J5Y A;  3G71 T;  2DAQ A;  3G7Z A;  4IUV A;  4BAC A;  2PVO B;  3CPW S;  4L59 A;  1YJN A;  2GF7 A;  4JRI A;  3V7C A;  5GMK e;  1S72 A;  2ZPB B;  2K3X A;  2XIC A;  3L2W A;  4XU2 A;  4E7I A;  3EFR A;  3H6Z A;  1N9S A;  5GAN d;  2EKO A;  4PLI A;  4M7D C;  4JLG A;  3JB9 F;  4M7D F;  4EMK A;  3WVD B;  2E70 A;  5FRO A;  2QQA A;  1U1S A;  2RA2 A;  3M4Y A;  3C12 A;  1WJQ A;  5CKE A;  3JCM f;  3M58 A;  3FLG A;  4BI8 B;  2ZPE B;  4D6W A;  4ELY C;  5GAN 5;  3T9N A;  4O5V A;  1RI0 A;  3PT9 A;  3CCL T;  2WAC A;  1M90 C;  2LDM A;  2XU8 A;  4C0D B;  2WSE E;  3GNG A;  4BB7 A;  4PL6 A;  4E7H A;  1YIJ A;  3CCJ A;  2AHJ B;  1QVF S;  4LDU A;  2P0K A;  3MP6 A;  3LLR A;  3V7R A;  4IUT A;  3VUB A;  2LT4 A;  1VIE A;  4C8Q G;  5LJ5 e;  2WSC E;  5DLO A;  4MZP A;  1YJN T;  2A7Y A;  3CC2 A;  5KCO A;  1S72 T;  1M8V A;  2BIV A;  3L2R A;  3QYG B;  1FX7 A;  1M1G A;  1ZHI A;  5GAM g;  4JS4 A;  1NJI C;  1WNL A;  4BY6 C;  2B8A A;  4ZGE B;  4BE1 A;  2IVW A;  2ZPF B;  3CBO A;  2CKK A;  2QEX A;  4JDS A;  3CCR A;  3SDZ A;  2K5F A;  3J7A F;  4RKU E;  5J3B A;  4BDY A;  1R8O B;  2KQW A;  4KUI A;  2MWP A;  4IUQ A;  3RKY A;  3L1A A;  1K73 C;  4LDW A;  4ZTF A;  4WF2 A;  1BI2 A;  3CD6 A;  4J6W A;  1QVG S;  2DXB A;  1RL2 A;  2F69 A;  3A8G B;  3GPL A;  3NTI A;  1PSF A;  3GF5 A;  2LQ8 A;  5CO7 A;  3X24 B;  1YIJ T;  1Q86 C;  3C94 A;  2E41 A;  5HK0 A;  1Q81 U;  1BYM A;  1KD1 U;  1TH7 A;  3VV0 A;  2P0P A;  4GLK A;  3SWN A;  5GAN 6;  5GAN 4;  2GCX A;  2DJZ A;  1KQS A;  3CC2 T;  4OB0 B;  3QJY A;  1VQ4 A;  1XOV A;  1XTD A;  2LVM A;  4C92 C;  4C92 F;  4R56 A;  1UB4 A;  4A4F A;  3JSC A;  3TRE A;  2QEX T;  3CCR T;  5CKB A;  3DB4 A;  2RJE A;  4JRP A;  1M1K U;  5GAN f;  2RK2 A;  1KQ2 A;  5IN1 A;  4QVZ A;  4E7K A;  2XHC A;  2VXE A;  3LW5 E;  2XKO C;  3CD6 T;  3ASK A;  3SWN B;  1G3S A;  4XTZ A;  4XTW A;  3SD4 A;  2KDS A;  2D0Q B;  3M4G A;  4OGC A;  4IUP A;  1N9R A;  4HCZ A;  4N0A C;  3OYM A;  4JS5 A;  4M7A F;  2QA4 A;  4M7A D;  1WQ7 A;  2X4Y A;  2RD1 A;  5D6X A;  3JCM J;  2RI3 A;  3BDU A;  4OGE A;  2VGM A;  4M78 B;  4PJO A;  3WXM B;  4P5N A;  4EMH A;  2BUD A;  4LDX A;  4M77 D;  4XU0 A;  2K2V A;  2EFI A;  2EQK A;  3L2U A;  3DLM A;  2Y4X A;  5GMK i;  5FU7 B;  2JUF A;  3A5Z B;  4C5E A;  2JN0 A;  3R6O A;  3UPU A;  2LTO A;  4C0Z A;  4IUU A;  2QQB A;  2RK1 A;  3OS0 A;  4VUB A;  4PKC C;  3NTK A;  2DK3 A;  3GOX A;  2GQV A;  1FWZ A;  2QA4 T;  1YIT A;  2HNI A;  1MGQ A;  5GAM d;  4ZGJ B;  1PSE A;  3DB3 A;  3BW1 A;  2RI5 A;  3HP9 A;  5KCH A;  2D6F A;  4M7A A;  4M77 B;  2RB6 A;  2MF2 A;  4BE2 A;  1QP2 A;  4LDY A;  5DM7 R;  3BDL A;  2QXF A;  3EFS A;  2DD5 A;  3OS2 A;  4KBM B;  4OB3 B;  2E65 A;  3CCS A;  2C06 A;  3J80 E;  5GAO r;  1QP3 A;  2DVE A;  2L5Q A;  3MP8 A;  2RHX A;  3JCM h;  2K5L A;  5GAN 7;  3CXC A;  2XDB A;  4QW2 A;  3G4S A;  2MI6 A;  4FM4 B;  4OVA A;  2K57 A;  2ZPG B;  2FYK A;  1WPY A;  3GP8 A;  3V8K A;  5C0M A;  2CZ0 B;  1O75 A;  4M75 D;  2P4T A;  4JJN K;  2EIF A;  4PNO A;  4UC4 A;  1YIT T;  4PJO G;  5GAN 2;  3QYH B;  2E1H A;  4FL6 A;  4MDX A;  4ME7 A;  4EMG A;  4O6J A;  1VQN A;  4C8Q C;  4C8Q F;  3HSB A;  2CZ6 B;  2A3L A;  3MEU A;  2DXU A;  5CKH A;  1BI1 A;  3QBY A;  2WSF E;  1BIB A;  3WVE B;  3JCM c;  2VUB A;  3CC4 A;  2HD0 A;  2ZCF B;  3CCE A;  3Q1J A;  4II1 A;  3CCS T;  1H3Z A;  1LOJ A;  2E10 A;  4OF1 A;  4M7D D;  4RCB A;  3JB9 D;  1I81 A;  3TCJ A;  1V29 B;  4GY5 A;  3G4S T;  3E9G A;  5GAN j;  3OY9 A;  2R5M A;  4C5H A;  4ELZ C;  2L8D A;  5LJ3 g;  1KHC A;  4M75 B;  3S3O A;  2M16 A;  1BKB A;  3LWI A;  2ZGW A;  1BI0 A;  2E6N A;  4HKE A;  3TU4 K;  2VYT A;  5A0L A;  5CIU A;  2G3R A;  1VUB A;  4JLI A;  3ZEH A;  3QZ9 B;  2H3J A;  4FT4 A;  2DTH A;  4C0D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...