4M78G

Crystal structure of lsm2-8 complex, space group p21
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
70
Chain Sequence
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 15
structure length 70
sequence length 86
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78G00
4M7DG 4EMKC 1HXDA 4PJOC 4M78G 5GAN5 3JCMh 5LJ5e 4JRKA 3JB9J 5GAN7 5GAN3 4EMKB 4PJOB 4DQ2A 4PJOE 4PJOD 5GAOq 4C8QG 5GANg 3AHUA 1LOJA 4XU2A 2EJ9A 2E1HA 4OP0A 4PJOF 1I8FA 4F7UB 3BDUA 4XU3A 3PGGA 3M4GA 4F7UE 3V8LA 1JRIA 1WNLA 2I2LA 4M75C 2DTIA 4C92G 3RUXA 3JB9F 5LJ5f 2Y90A 2RB6A 5LJ3h 5LJ5g 3HFNA 4M75B 4M77B 4M75E 5GAMh 4M75D 5GAN2 1M5Q1 2QTXA 3BFMA 4M7AC 2YLBA 3RIRA 2DZ9A 2JN0A 4NL2A 4EMGA 4HT9A 1M8VA 4M75F 4M77F 2E65A 1YCYA 4J5YA 2DVEA 5GAOl 4M7AB 2DKGA 4A54A 2VC8A 4X9CA 1Y96A 2EJFA 4XU0A 4M7DC 4EMHA 2EJGA 2E64A 4MMLA 4QVCA 2YLCA 3JCMc 5GANh 3RERA 4M7AF 4M7DB 1B34B 1N9SA 3BW1A 4M7DD 2DTHA 4JRIA 1D3BB 4C8QC 2E41A 3QO3A 4XTXA 1LNXA 2DXTA 4JLIA 4WF2A 1I4K1 5I21A 1MGQA 3JCMQ 1HK9A 2DTOA 4J6WA 4C8QB 4M78F 4EMKA 3JB9D 4PJOA 4C8QE 3JCMe 4M77C 4C8QD 2RD1A 3JCMP 4C92C 3GIBA 1BIAA 5LJ3j 3HFOA 4XTVA 2DJZA 3EFRA 4C8QF 4F7UA 1WPYA 5GAMj 3L1AA 1I5LA 4C92B 4M77E 4XTZA 4M77D 4JUVA 3V7RA 4C92E 4RCCA 4C92D 5GMKm 2EWNA 3SWNC 4M75A 5LJ3d 4C92F 2HNIA 3JCMf 4NL3A 5GAOr 4M7AE 4M7AD 1LJOA 4F7UG 4NOYA 4HA8A 5GMKh 3SWNB 4M78C 3RKYA 5LJ3e 5GANj 2VXFA 3FB9A 3JCMV 5GAMe 5GMKi 1U1SA 3RKXA 2FYKA 4N0AC 4M7AA 4X9DA 3INZA 4M7DE 4M78B 4M78E 4M75G 4M78D 3SB2A 4XU1A 1WQWA 3JCMd 1H641 3EFSA 2RM4A 3JCMX 3V7SA 4M7DA 1B34A 3BY7A 2YHTA 3L2ZA 1U1TA 5CAIA 4Y91A 2VXEA 5LJ3f 1D3BA 5LJ5h 5GANe 3JB9H 1I81A 5GAMf 5GAN6 5LJ3g 2FB7A 1BIBA 4QVDA 5GAMg 4XQ3A 4C8QA 3QHSA 5GAN8 4M7DF 4PJOG 4MMKA 2RA2A 3RESA 4M77A 3QSUA 4C92A 1KQ1A 3JB9G 5GMKj 5GAMd 5GANf 5DY9A 5GAOn 3JCMg 1WQ7A 3V8KA 5GAOp 4RCBA 3RKWA 4V2SA 2CGHA 5GMKl 5GAN4 5GAOm 4XTUA 2EAYA 3FJPA 4M77G 3SWNA 3JCMJ 5GANd 4F7UF 3FIFA 2DEQA 5LJ5j 1TH7A 5GMKe 3HSBA 4J6YA 4M78A 2DZCA 3JB9I 4A53A 3JCMW 1X01A 2K57A 3VU3C 3QUIA 1Y96B 4XTWA 3V8JA 4HT8A 4N0AA 2DXUA 4M7AG 4XTYA 2ZGWA 1JBMA 4J6XA 1KQ2A 1N9RA 4PNOA 3V7CA 3JCMb 2E10A 5LJ5d
chains in the Genus database with same CATH superfamily
4M7DG 4VUBA 1AZGB 1R0BG 2JNGA 4F14A 3CCST 1W2BA 1AHJB 3CCSA 2YRDA 2COWA 1VYTA 3E2UA 2I2LA 1D1BA 3JB9F 5LJ5f 1YI2A 2RB6A 4M75D 1UJ0A 5ECAA 2B86A 1YP5A 1W2BS 4XU0A 5CKDA 1NZ9A 1Y57A 2YLCA 3JCMc 5KE3A 4OMPA 2P0QA 3NGPA 2KXCA 1MGQA 3JB9D 1HK9A 2DTOA 4PJOA 4C8QB 1I5OB 3OYJA 3R6OA 3OYAA 5HK3A 2QGFB 1Z9QA 1CSKA 4J9FA 4FT2A 3JCMf 3PMIA 2A3LA 1VQNT 1VQNA 4C0FA 3VRYA 1WJSA 1OI1A 4PJJA 1B34A 1D3BA 3LGFA 5GAN6 4FYXB 4PL6A 3EGUA 1BB9A 3R6NA 2K4YA 2LJ0A 3NTKA 1FMVA 2AK5A 4N4HA 2EGAA 1OULA 2ED1A 4XTUA 1OV3A 1H3HA 3PIPA 2XICA 3OBYA 3M54A 4M78A 4RKUE 3V8JA 1QQJA 2E6NA 3RBBB 4X1VA 1AVZC 5IT9E 2RI3A 5IHNA 2DL3A 1Y71A 4JRQA 4EMKB 2R5MA 2V8JA 3CPWA 2RQTA 2E1HA 2DAQA 3EGDA 1CKAA 1KFZA 1OEBA 5LJ3h 3HFNA 2NUTA 4EDUA 1YWOA 1RAFB 2JN0A 1TSFA 1G3SA 2GCXA 4X9CA 1PG5B 4LE9A 2EPDA 2X4XA 2XG8D 4M7DB 1N9SA 2LJ3A 3DLMA 1UEBA 5IH2A 4WF2A 2V8KA 5I11A 2GGRA 5IXFA 1VQOQ 2YSQA 4C8QE 2CT4A 4Y28E 4OMFB 1NYFA 4FIBA 3MHXA 4E47A 4JJNK 3UA6A 2IVWA 5KYUA 2ZPIB 1QVGS 3FB9A 4Z89A 5I2MA 2FO0A 3SHWA 3BE3A 1RAIB 2FB7A 1RABB 3M0UA 4O5VA 5GAMg 2DIQA 2COZA 4Z02A 2ZZDA 3OYEA 3HRTA 3DB4A 2NUZA 3CCRA 2GQIA 4N4IA 4JZ4A 5I22A 1QVFP 1KD1C 2LDMA 4K11A 2RQWA 2KE9A 1ZQ1A 2R5AA 1D0ZA 5DLOA 1SEMA 2KMTA 2ED0A 3LWHA 1G5VA 3OQ5A 2F2XA 2XIDA 1JBMA 4RUGA 3JSCA 4FT4A 3FLGA 3OYKA 1M30A 2LQWA 3VS0A 2H3JA 2LTOA 3P8HA 1MNEA 4Q5WA 1YJNA 4FSSA 3M4GA 2AKLA 2RNAA 3G4SQ 1WA7A 3D7SB 2DZ9A 1GFCA 1LCKA 1NEGA 2EYZA 1JQQA 4A54A 5CVIA 2AZSA 1YHQA 4ZN1A 1D1CA 1TOVA 2ZPGB 1LVKA 3CCEQ 4C8QC 3QO3A 3ULRB 2D6FA 1KJWA 3O5ZA 2LQ8A 2LP5A 3DLLA 4AG1C 2IPOB 1NYGA 2K2VA 4RTYA 2LQNA 1YN8A 2CT3A 3MP1A 1VIFA 1NG2A 1ABOA 4M77E 2A37A 1KIKA 2I0NA 1KD1U 2JW4A 2CZ6B 3EGXA 3A98A 1NM7A 2HNIA 4PFOA 5A2QE 1NBEB 1NEBA 4JRPA 1MMAA 1OYXA 3JCMV 1M4ZA 1KSWA 1U1SA 3RKXA 4PFZA 4X9DA 3UPUA 4CC4B 4BE2A 5GANe 2KI7A 2RO0A 4PJMA 3JAME 4CC3A 1VQPT 3VV0A 1VQPA 1EIFA 4PJOG 1U3OA 2D0NA 1AWXA 3M0RA 5GMKj 2JTEA 1LPLA 1VQ5Q 3V8KA 3CCMQ 5J3BA 2DERA 1RAHB 4AMCA 3CEYA 3TQ7P 3CCQA 2GTJA 4BD3A 4F7UF 2V1RA 5LJ5j 1KC8R 4JJBA 3QG1A 1ZUUA 4J7IA 2ZGWA 1VQMQ 1Y7XA 2RI2A 2JT4A 4EMKC 2RF0A 2ZPEB 1G3YA 4JJCA 2SEMA 1C6VX 1TS9A 2HL3A 4DEXA 3G4ST 3E9GA 1ZUKA 1W6XA 2KT1A 4RTZA 2F2VA 2KROA 1NJIC 1IHWA 2RQVA 4N4GA 2C0OA 1JXMA 3E1SA 3OYDA 1X6GA 3TU4K 3CCET 4HT9A 2J6FA 1YCYA 4A4EA 2IG0A 4RTUA 1RAAB 2EJFA 4M7DC 1M2VA 2JMAA 1K8AR 1K4US 1TG0A 5KCHA 4M7AF 4GBQA 3OYFA 2M02A 3ER0A 3VRZA 4QW2A 3KBGA 1R8OB 2DXTA 2E12A 2DYBA 4M77C 2RD1A 1MV3A 2MAMA 3MEAA 3NHNA 2X4JA 2IIMA 3A8OB 4C92D 1T0JA 2BE9B 1W70A 2EWNA 2NYSA 3WXMB 1WHGA 2DLPA 4M7AD 2K2MA 3SWNB 2CP0A 2CSIA 3F70A 3H0FA 2FYKA 2LCLA 2JM9A 4M75G 3QWXX 4C5EA 3SB2A 1OX8A 2JMCA 4LUEA 2YHTA 1I81A 2FEIA 2LNHB 2OTLQ 1VQ5T 3I56A 1W1FA 2R57A 4J9BA 2DM1A 1YWPA 2HQHA 9ATCB 1G3WA 1PD1A 1PSEA 4ZNXA 1QCOA 2A08A 2E5KA 4D8KA 3JB9G 1QVPA 2E3IA 2O88A 4J9GA 1B7TA 3M0SA 1XQHA 2QASA 1UUEA 2Z0WA 3LH0A 2CREA 3A1PA 2YUNA 1M3CA 2DIGA 2VGMA 1QVFS 3FIFA 1BKBA 1TH7A 4L6V5 5FRMA 1YCSB 5HKCA 2EYYA 5EG2A 3KUFA 1JJ2A 1FMWA 4JLGA 4JZ3A 4PJOB 2DF6A 1PNJA 1N8RC 2X4YA 2RH2A 3CXCA 2L3QA 3PGGA 2HMAA 4JDSA 3RUXA 3I55Q 3OMGA 1GL5A 2CP6A 3TCJA 4QKUA 1QMCA 4ZTJA 2OTJT 5CQXA 2DVEA 2K6DA 2JS2A 4E7HA 2OTJA 2VC8A 2F5TX 3VKIA 5GJWB 1VA7A 2F2WA 1B34B 1VYUA 4JRIA 1D3BB 2Y4YA 2OAWA 3G71Q 2MPXC 4JS5A 1BIAA 3GIBA 1SF9A 3HFOA 1ZSGA 2DA9A 5FU6B 1SKUB 3G6EQ 1YIJA 3PMTA 2H8HA 5CQYA 1AWWA 4J83A 1WIEA 3VS6A 1X2QA 2E6ZA 5HCKA 3EHRA 1F1BB 2HBPA 2EVRA 5GAMe 2DK3A 2KBTA 1IO6A 3CC2Q 4M7AA 4M78B 5KYWA 1Q86C 2ABLA 2LCCA 2EGCA 3C12A 3OYYA 4RG8A 5LJ3f 4Y91A 3I5RA 3H6ZA 1K8AU 2Y4XA 3H8ZA 8ATCB 1MNDA 4QVZA 2D9TA 4A63B 2OI3A 3ZFJA 2O31A 5A0DA 3ZBDA 5DM7R 3CCUQ 3EGDB 4KH1B 2KXDA 2HSEB 2RK2A 3X20B 5FROA 5GMKl 4KGVB 2NUTB 5GANd 2VB6A 4MZTA 3HSBA 2JOYA 4J6YA 4TVRA 3JB9I 3CCVQ 5FWBA 4XK8E 5CO7A 4DBRA 2A28A 3L2UA 2PVDB 2DXCA 2EGEA 2QQAA 3M57A 2GF7A 2M0YA 3I55T 1Y07A 2LMJA 4PJOE 3UDCA 5GANg 1SRLA 1UHCA 4JPBW 4OB2B 1CKBA 2LX7A 1WHJA 5KYUB 3RIRA 2RI5A 4M75F 2EW3A 2KAFA 3HRSA 2KT8A 1PCXA 1PM3A 1BCOA 2HEQA 1U8RA 1EFNA 4A4FA 2QA4T 5I21A 2QA4A 5C0MA 3UWNA 2YUOA 4FM4B 4DOWA 2XHCA 2WSCE 4LN2A 5CR2A 3GOXA 2CUBA 2ROLA 2QEXQ 4JUVA 3CBPA 3CC2T 3CC2A 3HKSA 3SWNC 1K9MC 1X43A 1K0XA 4NOYA 2ECZA 2AKKA 4BDZA 4C5IA 4M78E 4JS4A 2DL4A 2XMFA 3UT1A 2RN8A 3Q1JA 3EHQA 1PWTA 3UF4A 3M5AA 4FW1A 1BIBA 3CCUT 4X34A 4HVVA 2L5QA 1HSQA 4Z88A 1MV0B 3CMAT 3CMAA 3MCAB 2EFIA 1O9SA 3PFSA 3M56A 3CCVT 4V2SA 3I35A 3CCVA 2KYBA 5D6XA 3PE0A 3CCJQ 1RI9A 2DXBA 4XTWA 3OB9A 4E7SA 1ABQA 5CIUA 5FU7B 5LJ5d 3H0IA 4PJOC 2O9SA 1M2OA 5D7UA 4XU2A 2EYWA 2FPFA 2KRMA 5C6SA 3P8DA 3EGXB 4AT1B 3ZL7C 5LJ5g 2FRYA 4KUIA 4EMGA 1VQ4Q 3RR6A 2KGTA 2DKGA 1TU0B 2KQWA 3EG1A 5GANh 1GCQA 1BI0A 5FWCA 1KD1R 1VQ8Q 2VV5A 4R56A 4J6WA 1OPLA 4C8QD 5FU6C 1SHGA 2K79A 2LX9A 4JJDA 3V7RA 5GMKm 4RCCA 4XAXB 4C5GA 1WX6A 4M75A 2DETA 1K0SA 3LYIA 2L3PA 3J7AF 2D1XA 4F7UG 5KH6A 4M78C 3RKYA 2L3RA 2DVJA 1WJQA 2QI2A 1PKSA 5IHKA 2PVGB 3H9NA 5KYYA 1QVGA 3M9QA 2F69A 4ELZC 2BUDA 2RM4A 2LT1A 4Y92A 2KNBB 2XDPA 1V76A 2M1HA 1K73C 1ZA2B 1RACB 3QHSA 2PU9B 4ZGDB 1S1NA 3RESA 1R0CB 2YRVA 3CCJT 3CCJA 5GAMd 4Z8AA 5GAOn 3EH2A 3OBWA 2D0QB 2HDAA 1IZ6A 1WXBA 2DBMA 2W0ZA 4GLKA 2KRSA 5KYXA 2QQSA 3VU3C 2P4RA 3M53A 4OB0B 2FZCB 4M7AG 1WI7A 1M2VB 3OS5A 3URGA 3JCMb 4IURA 1YJ9Q 2EQUA 4JRKA 3JB9J 3VS7A 2YRCA 1LOJA 2RQUA 3CPFA 2KRNA 1QKXA 4KUDK 2CH4W 4AG2C 1UG1A 5IN1A 2X4WA 5HY6A 3I5SA 1PD0A 2DFUA 4E7KA 4M77F 1WFWA 1VQ8T 4FSXA 1T3LA 4OGCA 5D6WA 8AT1B 4HCZA 2R58A 4EMHA 4ZGEB 1BI2A 1PSFA 1S72Q 1WYXA 1VQ6Q 3A8HB 1M1KC 2K5FA 2NLUA 1GBQA 1NPRA 1E6HA 1QWFA 2C0IA 1K73U 4M7DD 2DO3A 1VQ9Q 1D1AA 3TSWA 4KRTA 4MZMA 3JCMP 2YUQA 5LJ3j 2FPEA 2JS0A 4A4GA 4M77D 1M90R 1KHIA 7AT1B 2E70A 3E19A 3SDZA 2MK5A 3L2VA 1VQOT 2C06A 1VQOA 2VXFA 2QK0A 3CCLQ 2RHUA 3RMQA 4M7DE 3GNGA 1RUWA 1NJIR 4XU1A 3S3OA 2L0AA 3CD6Q 1T0HA 4RG2A 1M1GA 4QVDA 2DNUA 3RMSA 1IXDA 1ZBJA 3FJ5A 2DD4A 3G1JA 1UECA 4GLMA 2DD5A 1VQKQ 2RA2A 1OZ3A 4AFSC 3SFMA 3VS5A 3QSUA 1KQ1A 2M0OA 3G7ZA 2SRCA 2NUPA 1ACMB 1Q81C 2G6FX 4OMQA 3OYLA 1FYNA 2OAUA 1O75A 4QQGA 1VQ7Q 2EYXA 3THKA 4N0AA 5FU7C 1M1KU 3H41A 1TXQA 3REBB 2QTVA 1H92A 1YFNA 2WSEE 4PNOA 1KQSS 3OYBA 3C4SA 4BACA 1NLPC 1WXUA 3GPLA 2PVOB 3VYGA 1G83A 1R77A 2CP7A 2JTFA 5GAOq 2K9GA 1ZBXA 4C0ZA 2HAXA 3M59A 1I8FA 3BDUA 1VYVA 4QQDA 4LDUA 2RHYA 3SEMA 5GAMh 5GJVB 1M5Q1 4RMOA 4J9CA 4HVWA 3PVLA 1YITQ 1M90C 2DEUA 2CZ0B 2P0KA 3NFCA 4M7AB 2J6OA 5KYWB 2YXYA 2E64A 4MMLA 1QP3A 1U5SA 1VQLQ 1QCFA 4F16A 2YUPA 2DTHA 3G4SA 5AT1B 1Q7YR 1EX4A 2LQKA 3C94A 3JCMQ 4PJNA 2AT1B 1D0XA 5CCAA 1UGSB 1OX9A 3CMEQ 1Z9ZA 1IGQA 3CCLT 1UGVA 2V26A 1Q81U 3QBYA 3CCEA 4OMNA 4C92F 4NL3A 5GAOr 1ZX6A 1FMKA 3LH5A 1N8RR 3MPUB 3E9FA 2CYZB 4ELYC 2FHDA 4LD9K 1U1TA 2VASA 1RLQC 5KYNA 2MWOA 2CUDA 3EG3A 3QPHA 4LD6A 2DPPB 3KFVA 2CH4A 1QLYA 3OY9A 1M90U 2BZ8A 2MMPA 3FJPA 4GY5A 5GMKe 1YJWQ 2K57A 3S6WA 1WHHA 1QVFA 3CCMT 1BI1A 1VQ5A 1Q82R 3CCMA 2XU8A 1NJIU 1X69A 5LJ5e 1RL2A 5J39A 3CC7Q 1K9AA 1NPPA 1ZSZA 3L2QA 3VS1A 2PUKB 1DJ7B 2V1QA 3OS1A 1Q7YC 1VQMT 2AZVA 1W4SA 1VQMA 1Q86R 2MCNA 3TSZA 3FC3A 2VUBA 2CSQA 2DRKA 2QAZA 4BB7A 1VQLT 3U23A 3A8GB 4J5YA 4RTXA 1RI0A 1SG5A 1ZHIA 2KSSA 3CMET 1OOTA 4AFQC 3X26B 3CC4Q 3CMEA 2E41A 1WLPB 2A7YA 4HCKA 4LXCA 3JCMe 2EYQA 4D6WA 2VVKA 1XJWB 4F7UA 3L1AA 2ZCFB 2K3YA 3GF5A 1RAGB 3N5BB 3MEUA 4QT7A 3HRUA 2LJ1A 4PK4A 5IHIA 4LNPA 2VGNA 3QZ5B 3EFOA 1KHCA 5A0LA 2F5KA 2C0TA 2RJCA 2DBKA 3JCMX 2DMOA 2LCSA 3JB9H 2VXEA 1NLOC 3OYNA 2L3SA 2YT6A 3OYCA 2ZPFB 2HKQB 3OYGA 3EH1A 1Q82C 3QJ6A 1Q7YU 4KGXB 4C92A 5GANf 5DY9A 1YJWT 4AFUC 1YJWA 3S3NA 3M0PA 2OTLT 5HK0A 2E4HA 2CGHA 3M55A 2OTLA 4OMLA 3L2RA 3CCSQ 1H3ZA 2XKOC 2DEQA 4CC2A 1NE8A 1TUDA 3CPWP 3QUIA 5M9OA 3CC7T 1E7OA 1P92A 1N8RU 1YI2Q 2BZXA 1K9MR 1M1FA 1PC0A 3UA7A 2PNIA 3OS2A 4PJOD 3AHUA 2EJ9A 3X25B 1SPKA 1WXTA 2WSFE 3MKDA 3QXEB 1I1JA 4M75B 3X28B 1UHFA 2WACA 3HP9A 2JJ9A 5GAN2 1AEYA 3JRZA 4M7AC 1XNIA 3CC4T 1AD5A 3ME9A 5CKBA 4CRIA 1Y96A 5KYYB 2P4TA 3I55A 2KVQG 1VOMA 1Q95G 5AYFA 1Q82U 2LC4A 2QQRA 4M78F 2LVMA 2DE0X 1VQNQ 2GFAA 2EQIA 1I5LA 2F1LA 2CP2A 1JEGA 5LJ3d 3O8VA 1Q86U 3G71T 3G71A 5GMKi 1VIEA 5KYXB 1K1ZA 2O9VA 4M78D 1X75C 4PLLA 1WQWA 1X6OA 5KE2A 3G6ET 1HJDA 1M3BA 3QDFA 3G6EA 3EFSA 4J9HA 1RLPC 3MEWA 3NMZC 4WCIA 5LJ3g 2MWPA 3TVTA 2PTKA 2ATCB 3RDVA 2FZKB 4ORZA 2EBPA 3A5ZB 4HKEA 2QDYB 2XI9A 1WHKA 1VUBA 2AHJB 3RKWA 2HQEA 4M77G 2XDDA 1YI2T 2HCKA 3J81E 4A53A 1KQ2A 4L5GA 1C0MA 4J6XA 1GFDA 4CC7A 2A36A 3CCUA 2LRQA 2L2PA 1WGSA 1WDXA 3T9NA 1KK7A 1D09B 1N6AA 2DL5A 2KK4A 4FYYB 2MF2A 2XD0A 3EG2A 3PVQA 3OS0A 4XU3A 2AIRB 2DTIA 2PQWA 3MO8A 1OU9A 1KQSP 4M75E 3S3MA 3META 1K73R 2YLBA 1G8XA 1M8VA 3OYMA 5CKEA 2P0PA 2JM8A 3M4YA 3LWIA 1IRXA 3M0TA 1GRIA 2QGGA 1XTDA 2EQMA 2M16A 1BK2A 5EC7A 1UGQB 4II1A 1K9MU 2K3XA 3TREA 2CP3A 4XTVA 2DJZA 4C8QF 4OB1B 4XTZA 4IIMA 2W10A 2CP5A 2CDTA 1SRMA 3VUZA 2OX7A 3GLXA 1AZEA 1B07A 2NUPB 2VWFA 3RNJA 4KT0E 4KH0B 4PKCC 4HCBA 2QEXT 3MEVA 1MHNA 3JCMd 2QEXA 3CCRQ 4PJLA 3L2ZA 5CAIA 4D8DA 1X27A 2KYMA 2B8AA 5GAMf 1QCNA 4WTOB 2BIVA 4KGZB 1J3TA 2LNVA 4HVUA 4BI8B 2COYA 1M8MA 3QYHB 1MMNA 4BI3A 3JCMg 4C0DB 1MUZA 1GBRA 1M1KR 4RCBA 4BE0A 4LDXA 4M4ZA 4ESRA 2EQKA 4E7JA 4UC4A 1X01A 1GCQC 3L42A 1YJNQ 2QG9B 3A8MB 4XTYA 2JUFA 1UTIA 2E10A 3CPWS 1HXDA 5GAN5 1WHMA 4C0GA 2K3BA 4RTWA 1N27A 2V8IA 3EG9A 4BE1A 1YHQQ 2HKNA 4B6MA 1JRIA 4M75C 4C92G 2PUOB 3JV3A 4DBFA 2J05A 4M77B 5FRNA 3ASKA 3BFMA 1XOVA 5CKFA 2J6KA 2RJFA 3I9QA 1HYOA 1GXIE 4QVCA 3RERA 3A8LB 3PT9A 1IGUA 3BW1A 3REAB 1IB8A 1X6BA 2J7IA 6AT1B 1ZUYA 1Q81R 4JLIA 2FG0A 2ZAEA 4M7DF 1YNZA 1VQ4T 1VQ4A 1HD3A 4QQ6A 3HTRA 5IAYA 1AWOA 2JXBA 3CCRT 1VQ8A 5L23A 5GMKh 5GANj 3VS2A 1PRLC 4OMOA 2XK0A 1VQPQ 3H0HA 3INZA 4J8OA 3OYHA 2LT4A 2QXFA 2RJDA 2EQJA 3HHTB 4OVAA 2CZ7B 3BY7A 5LJ5h 4R55A 4MDXA 3CCQQ 4XQ3A 4C8QA 2OJ2A 3QDRB 3TEEA 3OYIA 1ZSZB 2O4XB 2FL7A 4E7LA 4E2FB 2A0FB 4BUGA 4ATOA 2KY9A 4DBHA 3VS3A 2ROTA 1YJNT 2X35A 1KG1A 1JJ2P 5I2SA 3VS4A 4A4HA 4OB3B 3HPWA 3UATA 2P84A 2M9UA 2BKDN 4HXJA 1BI3A 3JCMW 4HT8A 1MMGA 3CXCP 2ZPHB 1I0CA 4DEYA 1MMDA 1YHQT 1OU8A 4E7ZA 4CI0C 2VKNA 2L8DA 3JCMh 3OMCA 1KQSA 3QZ9B 4BY6B 4E6RA 4LUDA 2MI6A 4F7UB 3OA6A 4AFZC 1WNLA 2Y90A 2DJQA 1YJ9T 3MJXA 1YJ9A 3LX7A 5FW9A 5CK9A 4NL2A 1QP2A 3EFOB 1AWJA 1YBYA 3MP8A 5A0GA 5GAOl 2E3HA 4C5HA 2DL8A 5DLQE 2QYZA 2FZGB 2XDBA 1AT1B 1PRMC 2EKHA 4A4KA 2DX1A 4B9WA 3LW5E 4EMKA 1JO8A 1ZA1B 3LGLA 4EIKA 3LLRA 3OSVA 3QYGB 4YTLA 4F17A 3EG0A 1S72T 1WPYA 4C92B 1S72A 1WJRA 4IUVA 1VQ6T 2G3RA 2GNCA 1VQ6A 3DB3A 1WZOA 4LDWA 1VQ9T 1B3QA 1VQ9A 3I56Q 1BBZA 5LJ3e 5KCOA 1UJYA 4N0AC 2EKOA 3CCQT 1TUCA 4BDYA 1TTHB 3V7SA 4M7DA 1UFFA 1FWZA 2YWWA 4OGEA 4FCYA 3QJYA 5IXBA 4ME7A 4KULA 4C0DC 1X2KA 3CCLA 1OQKA 4M77A 2HD0A 3CD6T 2JZ2A 3CD6A 4PFPA 1WQ7A 2BZYA 2MIOA 2GFUA 4KBMB 5D6YA 4NS5A 2RHIA 2CS7A 2YDLA 2M51A 2X3XD 2EAYA 3OW2P 2HZYA 4B9XA 2BTTA 1VQKT 4RTTA 1VQKA 1TUGB 4J9EA 1Y96B 2HQXA 2VYTA 1G2BA 1M3AA 4E7IA 3V7CA 1EZZB 2ZPBB 5GAN4 1BCMA 4LDVA 4M78G 2E5QA 1V1CA 1Y0MA 3VUBA 1QWEA 3X24B 4DQ2A 4DBQA 3FEOA 1VQ7T 2OTJQ 2FRWA 4OP0A 1VQ7A 2HSPA 1T3SA 1TWBA 4F7UE 3VJPA 3HL8A 4FW2A 1I07A 1N5ZA 1W2BP 2K7AA 1UB4A 2KR3A 3WVDB 2LZ6B 2QTXA 1UE9A 2K5IA 3C95A 1OZ2A 2D8HA 3PNWC 1PHTA 2E65A 3NPFA 1H8KA 1E6GA 2EJGA 2RQRA 4P5NA 1YIJQ 3SD4A 4ZN3A 2O4XA 1LNXA 2MOXA 4R0KA 1YITT 3OSSC 1YITA 2O01E 1G3TA 4ZTFA 1KC8C 2RHZA 3I56T 5GAMj 3EFRA 2GTOA 5CKHA 4C92E 1VQLA 2QDLA 4FL6A 4FYVB 4M7AE 2J06A 2O2OA 4HA8A 2GQVA 3GNFB 4IKFA 4L59A 5LL6S 2DILA 4EPCA 2PZ1A 1ZLMA 1H641 4IUTA 4IUUA 4FYWB 2CKKA 1ZSZC 3GP8A 2D8JA 1QW1A 1SSFA 2QQ9A 3L2WA 1JB0E 1WHLA 2JVVA 1K8AC 3BDLA 3QKJA 1BU1A 2ENMA 2L89A 2GBQA 2X51A 2FVUA 5GAOm 3MP6A 3M58A 4MDWA 3JCMJ 1ARKA 4F04B 2RHXA 3FDRA 1JJ2S 4IUPA 1UGRB 2DXUA 2DL7A 1N9RA 3ZEHA 2DRMA 2DZCA 3J80E 5L8RE 4BY6C 4DA4A 2RPNA 3CXCS 1SSHA 5GAN7 5GAN3 1KC8U 4LDYA 3GBQA 2KDSA 4C8QG 1U06A 1AOJA 4OMMA 4PJOF 1A0NB 2K5LA 3V8LA 2ESWA 3M0QA 1RAEB 4ANJA 3IQLA 1K76A 2BE7D 3CBMA 3NTHA 4O6JA 3DKMA 5FLXE 1YIJT 2HL5C 2QA4Q 4IUQA 3CC7A 4MZPA 3C0CA 2DYIA 3PTAA 2JTMA 3PIOA 4OF1A 1JXOA 1BYMA 3NTIA 1C1AA 1PKTA 2QQBA 3P8BB 4XTXA 3WVEB 4ZGJB 1I4K1 2NWMA 4C92C 2X3WD 1GCPA 1QVGP 4FU6A 1UGPB 3CC4A 4J9DA 1LJOA 2X9HA 3QIIA 4PLIA 1OPKA 1UDLA 1FXXA 1FX7A 3EAEA 2FPDA 2EIFA 3CMAQ 2HBWA 3CBOA 3VYHB 5J26A 3KXTA 1JU5C 2RK1A 4RTVA 2H3EB 2KEAA 4BI4A 5GAN8 4IIOA 3EG9B 1RADB 4MMKA 1IHVA 1M9SA 3OW2A 1IREB 1V29B 4HCCA 3AT1B 5GAOp 3CQTA 2MYSA 2CZ1B 2RJEA 3FRNA 3SWNA 2RMOA 3QWYA 1M27C 4J9IA 4DOVA 1SHFA 1D0YA 3OW2S 4J7FA 1QKWA
chains in the Genus database with same CATH topology
1JJ2A 4M7DG 1HXDA 5GAN5 3GPLA 4VUBA 2JNGA 2PVOB 4JLGA 3VYGA 3CCST 1W2BA 4C0GA 4PJOB 1AHJB 2JTFA 3CCSA 1N27A 2V8IA 5GAOq 1N8RC 1ZBXA 2X4YA 4C0ZA 2RH2A 3CXCA 4BE1A 2HAXA 3M59A 1I8FA 3BDUA 3PGGA 1JRIA 4JDSA 2I2LA 4M75C 4C92G 2PUOB 3RUXA 3JB9F 5LJ5f 4QQDA 1YI2A 3OMGA 2RB6A 2RHYA 4LDUA 4M77B 5FRNA 3ASKA 5GAMh 4M75D 1M5Q1 4RMOA 3BFMA 3TCJA 1XOVA 5CKFA 4ZTJA 1M90C 2CZ0B 2OTJT 2RJFA 1W2BS 2P0KA 3NFCA 5CQXA 2DVEA 4E7HA 4M7AB 2OTJA 2VC8A 2F5TX 4XU0A 5CKDA 1GXIE 3VKIA 2E64A 4MMLA 1NZ9A 1QP3A 4QVCA 2YLCA 3JCMc 3RERA 3A8LB 3PT9A 5KE3A 1B34B 3BW1A 3G4SA 2DTHA 4JRIA 1D3BB 2P0QA 2Y4YA 2LQKA 4JLIA 3C94A 3JCMQ 1MGQA 3JB9D 1HK9A 2DTOA 4M7DF 4C8QB 4PJOA 1VQ4T 1VQ4A 3OYJA 1BIAA 3R6OA 4JS5A 3GIBA 3OYAA 3HFOA 4QQ6A 5CCAA 1UGSB 5FU6B 5IAYA 5HK3A 1YIJA 3CCLT 3PMTA 1Q81U 5CQYA 3QBYA 4J83A 3CCEA 4C92F 4FT2A 3CCRT 3JCMf 2E6ZA 1VQ8A 4NL3A 5GAOr 3PMIA 5GMKh 5GANj 2HBPA 2A3LA 5GAMe 2DK3A 2XK0A 1VQNT 4M7AA 4J8OA 3INZA 1VQNA 4M78B 4C0FA 2LT4A 3OYHA 2QXFA 1WJSA 2RJDA 3E9FA 2CYZB 1OI1A 4ELYC 1Q86C 2EQJA 2LCCA 3HHTB 4OVAA 1B34A 2CZ7B 2FHDA 3BY7A 1U1TA 3C12A 3OYYA 4RG8A 5LJ3f 1D3BA 4Y91A 5LJ5h 3LGFA 3H6ZA 5GAN6 4R55A 2MWOA 2Y4XA 1K8AU 3H8ZA 4MDXA 4PL6A 3QPHA 4XQ3A 4C8QA 3QDRB 3TEEA 3OYBA 1Q82U 3OYIA 4LD6A 4QVZA 2O4XB 2FL7A 2DPPB 2K4YA 4E7LA 2D9TA 3ZFJA 4BUGA 5A0DA 3NTKA 4ATOA 3ZBDA 2KY9A 4N4HA 5DM7R 1YJNT 2X35A 2RK2A 3X20B 5FROA 5GMKl 3OY9A 1KG1A 1M90U 4XTUA 2MMPA 3FJPA 5I2SA 4A4HA 4OB3B 3HPWA 3PIPA 2XICA 4GY5A 5GANd 3OBYA 4MZTA 3HSBA 2M9UA 3M54A 5GMKe 2BKDN 2JOYA 4J6YA 4M78A 1BI3A 4TVRA 3JB9I 3JCMW 2K57A 4HT8A 4RKUE 3V8JA 3S6WA 2ZPHB 4XK8E 5CO7A 1QVFA 2E6NA 3CCMT 1BI1A 1VQ5A 3L2UA 3CCMA 5IT9E 2RI3A 1YHQT 2PVDB 4CI0C 2XU8A 1NJIU 2DXCA 3M57A 2QQAA 2L8DA 3JCMh 2GF7A 5LJ5e 1Y71A 1RL2A 3I55T 4JRQA 1Y07A 3OMCA 5J39A 1BYMA 4EMKB 1KQSA 1NPPA 2R5MA 2V8JA 3QZ9B 3UDCA 4BY6B 3L2QA 5GANg 3CPWA 4PJOE 2MI6A 2PUKB 1DJ7B 2E1HA 3OS1A 2DAQA 1Q7YC 4F7UB 3OA6A 1VQMT 1WNLA 1W4SA 1VQMA 4OB2B 2Y90A 1YJ9T 5LJ3h 3FC3A 2VUBA 3HFNA 1YJ9A 4EDUA 4BB7A 1VQLT 1VQ6T 3LX7A 3RIRA 5CK9A 4NL2A 1QP2A 2JN0A 1YBYA 2RI5A 3A8GB 3MP8A 4M75F 2KAFA 5A0GA 4J5YA 1G3SA 2GCXA 3HRSA 5GAOl 4X9CA 1RI0A 4C5HA 5DLQE 1ZHIA 2XG8D 2X4XA 2XDBA 4M7DB 1N9SA 2KSSA 1U8RA 3CMET 3DLMA 4A4KA 4A4FA 1UEBA 3X26B 3CMEA 2E41A 2QA4T 5I21A 4WF2A 2V8KA 2A7YA 4B9WA 3LW5E 2QA4A 4EMKA 5C0MA 3LGLA 4FM4B 3LLRA 3UWNA 4C8QE 4DOWA 2XHCA 3OSVA 2EYQA 3QYGB 2WSCE 4Y28E 4YTLA 4D6WA 4OMFB 4F7UA 5CR2A 1S72T 1WPYA 3GOXA 3L1AA 4C92B 4FIBA 2ZCFB 3MHXA 1WJRA 2K3YA 3CBPA 4IUVA 4JUVA 2G3RA 4E47A 4JJNK 1S72A 3CC2A 3GF5A 3DB3A 1VQ6A 3N5BB 3MEUA 4LDWA 3HKSA 3HRUA 3SWNC 1VQ9T 1K9MC 1VQ9A 2IVWA 2VGNA 3QZ5B 4NOYA 5LJ3e 2ZPIB 5KCOA 1KHCA 1QVGS 3FB9A 4N0AC 5A0LA 2EKOA 4BDZA 3CCQT 2F5KA 5I2MA 4C5IA 4M78E 2RJCA 4JS4A 3UT1A 4BDYA 3JCMX 3V7SA 4M7DA 3Q1JA 3JB9H 2VXEA 3OYNA 1FWZA 3OYCA 3M5AA 2FB7A 2ZPFB 1BIBA 3CCUT 4O5VA 5GAMg 4X34A 4OGEA 2L5QA 3QJYA 3OYGA 2DIQA 1Q82C 3QJ6A 4ME7A 1Q7YU 4KULA 4C0DC 4Z02A 3JCMe 2ZZDA 3CCLA 3OYEA 3CMAT 4M77A 2HD0A 3HRTA 4C92A 3DB4A 3CD6T 3CMAA 3MCAB 2EFIA 1O9SA 2JZ2A 3PFSA 4N4IA 5DY9A 5GANf 1WQ7A 3CCRA 1QVGA 1YJWT 3CD6A 3M56A 3CCVT 1YJWA 3S3NA 2OTLT 2GFUA 4KBMB 3M55A 2CGHA 2LDMA 5D6YA 5HK0A 4NS5A 2RHIA 3CCVA 1KD1C 2CS7A 2OTLA 1ZQ1A 2EAYA 2R5AA 5D6XA 5DLOA 2KMTA 3L2RA 1H3ZA 2XKOC 3LWHA 2DEQA 4B9XA 1VQKT 1NE8A 1K73U 1G5VA 3OQ5A 1VQKA 2DXBA 3QUIA 1Y96B 2XIDA 2HQXA 2VYTA 4XTWA 5M9OA 3CC7T 1JBMA 1P92A 3OB9A 3JSCA 4E7IA 1N8RU 4FT4A 3V7CA 2ZPBB 5GAN4 3FLGA 5CIUA 5FU7B 5LJ5d 3OYKA 4PJOC 4LDVA 4M78G 2E5QA 3VUBA 2H3JA 2LTOA 3X24B 1M1FA 3P8HA 4DQ2A 4PJOD 3OS2A 4Q5WA 3FEOA 1VQ7T 3AHUA 4XU2A 2EJ9A 4OP0A 1VQ7A 1YJNA 3X25B 5C6SA 3M4GA 4F7UE 3VJPA 3P8DA 3HL8A 2WSFE 3QXEB 5LJ5g 4M75B 3X28B 1UB4A 2WACA 3HP9A 3WVDB 5GAN2 2QTXA 3JRZA 4KUIA 4M7AC 1XNIA 2DZ9A 2K5IA 4EMGA 3CC4T 3C95A 1OZ2A 3PNWC 2E65A 4V2SA 2DKGA 4A54A 3ME9A 5CKBA 5CVIA 1Y96A 4CRIA 1YHQA 2EJGA 4ZN1A 2KQWA 4P5NA 2ZPGB 5GANh 3SD4A 2P4TA 3I55A 2KVQG 4ZN3A 1BI0A 2O4XA 4C8QC 3QO3A 1LNXA 2D6FA 2VV5A 5AYFA 1YITT 2LQ8A 3OSSC 2LC4A 4J6WA 2QQRA 4M78F 2LVMA 4R56A 2O01E 3DLLA 1YITA 4C8QD 5FU6C 1G3TA 2LX9A 2K2VA 4ZTFA 2RHZA 1KC8C 3I56T 2GFAA 3MP1A 3EFRA 1VIFA 5GAMj 1I5LA 4M77E 5CKHA 3V7RA 4C92E 4RCCA 5GMKm 4XAXB 4C5GA 1KD1U 2CZ6B 1VQLA 4LD9K 4M75A 5LJ3d 2HNIA 3LYIA 4FL6A 5A2QE 3O8VA 3J7AF 4M7AE 1Q86U 5KH6A 4F7UG 4JRPA 1OYXA 4HA8A 4M78C 2GQVA 3GNFB 3RKYA 3G71T 2L3RA 1M4ZA 3JCMV 3G71A 5GMKi 1U1SA 1WJQA 2QI2A 4L59A 3RKXA 4IKFA 4X9DA 1VIEA 5LL6S 3UPUA 4EPCA 2PVGB 4M78D 1X75C 4PLLA 1WQWA 1X6OA 5KE2A 3M9QA 2F69A 4ELZC 2BUDA 1H641 3G6EA 3EFSA 2RM4A 4BE2A 4IUTA 4IUUA 3MEWA 5GANe 2LT1A 5LJ3g 2RO0A 2CKKA 2XDPA 3JAME 2M1HA 2MWPA 1K73C 3GP8A 1VQPT 3QHSA 2PU9B 1QW1A 3VV0A 1VQPA 1EIFA 4PJOG 1SSFA 4ZGDB 2QQ9A 3RESA 3L2WA 2YRVA 3A5ZB 3CCJT 1JB0E 2JVVA 1K8AC 4HKEA 3CCJA 2QDYB 5GMKj 5GAMd 3BDLA 3QKJA 5GAOn 2XI9A 3V8KA 3OBWA 1VUBA 5J3BA 2L89A 3G6ET 2AHJB 3RKWA 2FVUA 2D0QB 5GAOm 3MP6A 2HQEA 3CEYA 3M58A 4M77G 4MDWA 2XDDA 1IZ6A 3CCQA 1YI2T 3JCMJ 4GLKA 4BD3A 4F7UF 5LJ5j 3J81E 2QQSA 4A53A 1KQ2A 2RHXA 3QG1A 3VU3C 3FDRA 3M53A 4IUPA 1UGRB 4L5GA 2DXUA 3OS5A 4OB0B 1JJ2S 4J7IA 4M7AG 3URGA 2ZGWA 4J6XA 3CC2T 1N9RA 1Y7XA 3ZEHA 2LRQA 2RI2A 3CCUA 3JCMb 4IURA 2DZCA 4EMKC 1WGSA 2ZPEB 1G3YA 5L8RE 3J80E 3T9NA 4BY6C 4DA4A 2EQUA 3CXCS 4JRKA 3JB9J 5GAN7 5GAN3 3G4ST 1KC8U 1N6AA 3E9GA 2KK4A 4LDYA 2MF2A 2KDSA 2XD0A 4C8QG 1LOJA 3OS0A 4PJOF 1NJIC 3CPFA 4XU3A 2K5LA 3V8LA 4N4GA 2DTIA 2PQWA 3MO8A 4KUDK 3CBMA 3NTHA 4M75E 4O6JA 3DKMA 5FLXE 3META 3S3MA 3E1SA 1YIJT 5IN1A 2YLBA 3OYDA 2X4WA 4IUQA 5HY6A 3TU4K 3CCET 3CC7A 4HT9A 4E7KA 1M8VA 4M77F 4MZPA 3OYMA 1VQ8T 1YCYA 4FSXA 5CKEA 4A4EA 2P0PA 2IG0A 4OGCA 5D6WA 2EJFA 4M7DC 4HCZA 3M4YA 2R58A 4EMHA 4ZGEB 1BI2A 1PSFA 3PTAA 3LWIA 2JTMA 5KCHA 4M7AF 3A8HB 1M1KC 3PIOA 4OF1A 3OYFA 3ER0A 3NTIA 2K5FA 2NLUA 2QQBA 1NPRA 1XTDA 4QW2A 4M7DD 3KBGA 2EQMA 3P8BB 2M16A 4XTXA 3CPWS 2DO3A 3WVEB 4ZGJB 1R8OB 2DXTA 2E12A 1I4K1 4MZMA 1UGQB 3JCMP 4M77C 2RD1A 4C92C 2MAMA 4II1A 2K3XA 1K9MU 5LJ3j 3MEAA 3TREA 4XTVA 2DJZA 2X4JA 4C8QF 4OB1B 4A4GA 4XTZA 4M77D 3A8OB 4C92D 1KHIA 2EWNA 2E70A 3E19A 4FU6A 3VUZA 3GLXA 1UGPB 3CC4A 3WXMB 3SDZA 4M7AD 3L2VA 1LJOA 1VQOT 2C06A 3QIIA 4KT0E 4PLIA 3SWNB 1VQOA 2VXFA 3F70A 1FXXA 4PKCC 4HCBA 1FX7A 3EAEA 2FYKA 2LCLA 2RHUA 3RMQA 4M7DE 3GNGA 4M75G 4C5EA 2QEXT 3MEVA 2EIFA 4XU1A 3SB2A 3S3OA 1MHNA 3JCMd 2QEXA 3L2ZA 3CBOA 2YHTA 3VYHB 5CAIA 5J26A 4RG2A 1I81A 2B8AA 3KXTA 5GAMf 1M1GA 4QVDA 2BIVA 1VQ5T 3I56A 3RMSA 2R57A 2DD4A 2RK1A 4BI4A 5GAN8 2LNVA 2DD5A 4MMKA 2RA2A 4BI8B 1M9SA 3OW2A 1OZ3A 1G3WA 3SFMA 1PSEA 3QSUA 1IREB 1KQ1A 3JB9G 2M0OA 3QYHB 1QVPA 1V29B 4BI3A 3JCMg 3G7ZA 4C0DB 4HCCA 5GAOp 1XQHA 4RCBA 4BE0A 3LH0A 4LDXA 1Q81C 2CZ1B 2RJEA 3FRNA 2DIGA 2VGMA 3SWNA 3OYLA 2OAUA 2EQKA 1QVFS 4E7JA 3FIFA 1BKBA 1O75A 1TH7A 4UC4A 4L6V5 4QQGA 1X01A 5FRMA 3L42A 3A8MB 4N0AA 5FU7C 4DOVA 5HKCA 4XTYA 1M1KU 3OW2S 4J7FA 2JUFA 2WSEE 4PNOA 5EG2A 1KQSS 2E10A 3KUFA 3C4SA 4BACA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7D G;  4EMK C;  1HXD A;  4PJO C;  4M78 G;  5GAN 5;  3JCM h;  5LJ5 e;  4JRK A;  3JB9 J;  5GAN 7;  5GAN 3;  4EMK B;  4PJO B;  4DQ2 A;  4PJO E;  4PJO D;  5GAO q;  4C8Q G;  5GAN g;  3AHU A;  1LOJ A;  4XU2 A;  2EJ9 A;  2E1H A;  4OP0 A;  4PJO F;  1I8F A;  4F7U B;  3BDU A;  4XU3 A;  3PGG A;  3M4G A;  4F7U E;  3V8L A;  1JRI A;  1WNL A;  2I2L A;  4M75 C;  2DTI A;  4C92 G;  3RUX A;  3JB9 F;  5LJ5 f;  2Y90 A;  2RB6 A;  5LJ3 h;  5LJ5 g;  3HFN A;  4M75 B;  4M77 B;  4M75 E;  5GAM h;  4M75 D;  5GAN 2;  1M5Q 1;  2QTX A;  3BFM A;  4M7A C;  2YLB A;  3RIR A;  2DZ9 A;  2JN0 A;  4NL2 A;  4EMG A;  4HT9 A;  1M8V A;  4M75 F;  4M77 F;  2E65 A;  1YCY A;  4J5Y A;  2DVE A;  5GAO l;  4M7A B;  2DKG A;  4A54 A;  2VC8 A;  4X9C A;  1Y96 A;  2EJF A;  4XU0 A;  4M7D C;  4EMH A;  2EJG A;  2E64 A;  4MML A;  4QVC A;  2YLC A;  3JCM c;  5GAN h;  3RER A;  4M7A F;  4M7D B;  1B34 B;  1N9S A;  3BW1 A;  4M7D D;  2DTH A;  4JRI A;  1D3B B;  4C8Q C;  2E41 A;  3QO3 A;  4XTX A;  1LNX A;  2DXT A;  4JLI A;  4WF2 A;  1I4K 1;  5I21 A;  1MGQ A;  3JCM Q;  1HK9 A;  2DTO A;  4J6W A;  4C8Q B;  4M78 F;  4EMK A;  3JB9 D;  4PJO A;  4C8Q E;  3JCM e;  4M77 C;  4C8Q D;  2RD1 A;  3JCM P;  4C92 C;  3GIB A;  1BIA A;  5LJ3 j;  3HFO A;  4XTV A;  2DJZ A;  3EFR A;  4C8Q F;  4F7U A;  1WPY A;  5GAM j;  3L1A A;  1I5L A;  4C92 B;  4M77 E;  4XTZ A;  4M77 D;  4JUV A;  3V7R A;  4C92 E;  4RCC A;  4C92 D;  5GMK m;  2EWN A;  3SWN C;  4M75 A;  5LJ3 d;  4C92 F;  2HNI A;  3JCM f;  4NL3 A;  5GAO r;  4M7A E;  4M7A D;  1LJO A;  4F7U G;  4NOY A;  4HA8 A;  5GMK h;  3SWN B;  4M78 C;  3RKY A;  5LJ3 e;  5GAN j;  2VXF A;  3FB9 A;  3JCM V;  5GAM e;  5GMK i;  1U1S A;  3RKX A;  2FYK A;  4N0A C;  4M7A A;  4X9D A;  3INZ A;  4M7D E;  4M78 B;  4M78 E;  4M75 G;  4M78 D;  3SB2 A;  4XU1 A;  1WQW A;  3JCM d;  1H64 1;  3EFS A;  2RM4 A;  3JCM X;  3V7S A;  4M7D A;  1B34 A;  3BY7 A;  2YHT A;  3L2Z A;  1U1T A;  5CAI A;  4Y91 A;  2VXE A;  5LJ3 f;  1D3B A;  5LJ5 h;  5GAN e;  3JB9 H;  1I81 A;  5GAM f;  5GAN 6;  5LJ3 g;  2FB7 A;  1BIB A;  4QVD A;  5GAM g;  4XQ3 A;  4C8Q A;  3QHS A;  5GAN 8;  4M7D F;  4PJO G;  4MMK A;  2RA2 A;  3RES A;  4M77 A;  3QSU A;  4C92 A;  1KQ1 A;  3JB9 G;  5GMK j;  5GAM d;  5GAN f;  5DY9 A;  5GAO n;  3JCM g;  1WQ7 A;  3V8K A;  5GAO p;  4RCB A;  3RKW A;  4V2S A;  2CGH A;  5GMK l;  5GAN 4;  5GAO m;  4XTU A;  2EAY A;  3FJP A;  4M77 G;  3SWN A;  3JCM J;  5GAN d;  4F7U F;  3FIF A;  2DEQ A;  5LJ5 j;  1TH7 A;  5GMK e;  3HSB A;  4J6Y A;  4M78 A;  2DZC A;  3JB9 I;  4A53 A;  3JCM W;  1X01 A;  2K57 A;  3VU3 C;  3QUI A;  1Y96 B;  4XTW A;  3V8J A;  4HT8 A;  4N0A A;  2DXU A;  4M7A G;  4XTY A;  2ZGW A;  1JBM A;  4J6X A;  1KQ2 A;  1N9R A;  4PNO A;  3V7C A;  3JCM b;  2E10 A;  5LJ5 d; 
#chains in the Genus database with same CATH topology
 4M7D G;  4VUB A;  1AZG B;  1R0B G;  2JNG A;  4F14 A;  3CCS T;  1W2B A;  1AHJ B;  3CCS A;  2YRD A;  2COW A;  1VYT A;  3E2U A;  2I2L A;  1D1B A;  3JB9 F;  5LJ5 f;  1YI2 A;  2RB6 A;  4M75 D;  1UJ0 A;  5ECA A;  2B86 A;  1YP5 A;  1W2B S;  4XU0 A;  5CKD A;  1NZ9 A;  1Y57 A;  2YLC A;  3JCM c;  5KE3 A;  4OMP A;  2P0Q A;  3NGP A;  2KXC A;  1MGQ A;  3JB9 D;  1HK9 A;  2DTO A;  4PJO A;  4C8Q B;  1I5O B;  3OYJ A;  3R6O A;  3OYA A;  5HK3 A;  2QGF B;  1Z9Q A;  1CSK A;  4J9F A;  4FT2 A;  3JCM f;  3PMI A;  2A3L A;  1VQN T;  1VQN A;  4C0F A;  3VRY A;  1WJS A;  1OI1 A;  4PJJ A;  1B34 A;  1D3B A;  3LGF A;  5GAN 6;  4FYX B;  4PL6 A;  3EGU A;  1BB9 A;  3R6N A;  2K4Y A;  2LJ0 A;  3NTK A;  1FMV A;  2AK5 A;  4N4H A;  2EGA A;  1OUL A;  2ED1 A;  4XTU A;  1OV3 A;  1H3H A;  3PIP A;  2XIC A;  3OBY A;  3M54 A;  4M78 A;  4RKU E;  3V8J A;  1QQJ A;  2E6N A;  3RBB B;  4X1V A;  1AVZ C;  5IT9 E;  2RI3 A;  5IHN A;  2DL3 A;  1Y71 A;  4JRQ A;  4EMK B;  2R5M A;  2V8J A;  3CPW A;  2RQT A;  2E1H A;  2DAQ A;  3EGD A;  1CKA A;  1KFZ A;  1OEB A;  5LJ3 h;  3HFN A;  2NUT A;  4EDU A;  1YWO A;  1RAF B;  2JN0 A;  1TSF A;  1G3S A;  2GCX A;  4X9C A;  1PG5 B;  4LE9 A;  2EPD A;  2X4X A;  2XG8 D;  4M7D B;  1N9S A;  2LJ3 A;  3DLM A;  1UEB A;  5IH2 A;  4WF2 A;  2V8K A;  5I11 A;  2GGR A;  5IXF A;  1VQO Q;  2YSQ A;  4C8Q E;  2CT4 A;  4Y28 E;  4OMF B;  1NYF A;  4FIB A;  3MHX A;  4E47 A;  4JJN K;  3UA6 A;  2IVW A;  5KYU A;  2ZPI B;  1QVG S;  3FB9 A;  4Z89 A;  5I2M A;  2FO0 A;  3SHW A;  3BE3 A;  1RAI B;  2FB7 A;  1RAB B;  3M0U A;  4O5V A;  5GAM g;  2DIQ A;  2COZ A;  4Z02 A;  2ZZD A;  3OYE A;  3HRT A;  3DB4 A;  2NUZ A;  3CCR A;  2GQI A;  4N4I A;  4JZ4 A;  5I22 A;  1QVF P;  1KD1 C;  2LDM A;  4K11 A;  2RQW A;  2KE9 A;  1ZQ1 A;  2R5A A;  1D0Z A;  5DLO A;  1SEM A;  2KMT A;  2ED0 A;  3LWH A;  1G5V A;  3OQ5 A;  2F2X A;  2XID A;  1JBM A;  4RUG A;  3JSC A;  4FT4 A;  3FLG A;  3OYK A;  1M30 A;  2LQW A;  3VS0 A;  2H3J A;  2LTO A;  3P8H A;  1MNE A;  4Q5W A;  1YJN A;  4FSS A;  3M4G A;  2AKL A;  2RNA A;  3G4S Q;  1WA7 A;  3D7S B;  2DZ9 A;  1GFC A;  1LCK A;  1NEG A;  2EYZ A;  1JQQ A;  4A54 A;  5CVI A;  2AZS A;  1YHQ A;  4ZN1 A;  1D1C A;  1TOV A;  2ZPG B;  1LVK A;  3CCE Q;  4C8Q C;  3QO3 A;  3ULR B;  2D6F A;  1KJW A;  3O5Z A;  2LQ8 A;  2LP5 A;  3DLL A;  4AG1 C;  2IPO B;  1NYG A;  2K2V A;  4RTY A;  2LQN A;  1YN8 A;  2CT3 A;  3MP1 A;  1VIF A;  1NG2 A;  1ABO A;  4M77 E;  2A37 A;  1KIK A;  2I0N A;  1KD1 U;  2JW4 A;  2CZ6 B;  3EGX A;  3A98 A;  1NM7 A;  2HNI A;  4PFO A;  5A2Q E;  1NBE B;  1NEB A;  4JRP A;  1MMA A;  1OYX A;  3JCM V;  1M4Z A;  1KSW A;  1U1S A;  3RKX A;  4PFZ A;  4X9D A;  3UPU A;  4CC4 B;  4BE2 A;  5GAN e;  2KI7 A;  2RO0 A;  4PJM A;  3JAM E;  4CC3 A;  1VQP T;  3VV0 A;  1VQP A;  1EIF A;  4PJO G;  1U3O A;  2D0N A;  1AWX A;  3M0R A;  5GMK j;  2JTE A;  1LPL A;  1VQ5 Q;  3V8K A;  3CCM Q;  5J3B A;  2DER A;  1RAH B;  4AMC A;  3CEY A;  3TQ7 P;  3CCQ A;  2GTJ A;  4BD3 A;  4F7U F;  2V1R A;  5LJ5 j;  1KC8 R;  4JJB A;  3QG1 A;  1ZUU A;  4J7I A;  2ZGW A;  1VQM Q;  1Y7X A;  2RI2 A;  2JT4 A;  4EMK C;  2RF0 A;  2ZPE B;  1G3Y A;  4JJC A;  2SEM A;  1C6V X;  1TS9 A;  2HL3 A;  4DEX A;  3G4S T;  3E9G A;  1ZUK A;  1W6X A;  2KT1 A;  4RTZ A;  2F2V A;  2KRO A;  1NJI C;  1IHW A;  2RQV A;  4N4G A;  2C0O A;  1JXM A;  3E1S A;  3OYD A;  1X6G A;  3TU4 K;  3CCE T;  4HT9 A;  2J6F A;  1YCY A;  4A4E A;  2IG0 A;  4RTU A;  1RAA B;  2EJF A;  4M7D C;  1M2V A;  2JMA A;  1K8A R;  1K4U S;  1TG0 A;  5KCH A;  4M7A F;  4GBQ A;  3OYF A;  2M02 A;  3ER0 A;  3VRZ A;  4QW2 A;  3KBG A;  1R8O B;  2DXT A;  2E12 A;  2DYB A;  4M77 C;  2RD1 A;  1MV3 A;  2MAM A;  3MEA A;  3NHN A;  2X4J A;  2IIM A;  3A8O B;  4C92 D;  1T0J A;  2BE9 B;  1W70 A;  2EWN A;  2NYS A;  3WXM B;  1WHG A;  2DLP A;  4M7A D;  2K2M A;  3SWN B;  2CP0 A;  2CSI A;  3F70 A;  3H0F A;  2FYK A;  2LCL A;  2JM9 A;  4M75 G;  3QWX X;  4C5E A;  3SB2 A;  1OX8 A;  2JMC A;  4LUE A;  2YHT A;  1I81 A;  2FEI A;  2LNH B;  2OTL Q;  1VQ5 T;  3I56 A;  1W1F A;  2R57 A;  4J9B A;  2DM1 A;  1YWP A;  2HQH A;  9ATC B;  1G3W A;  1PD1 A;  1PSE A;  4ZNX A;  1QCO A;  2A08 A;  2E5K A;  4D8K A;  3JB9 G;  1QVP A;  2E3I A;  2O88 A;  4J9G A;  1B7T A;  3M0S A;  1XQH A;  2QAS A;  1UUE A;  2Z0W A;  3LH0 A;  2CRE A;  3A1P A;  2YUN A;  1M3C A;  2DIG A;  2VGM A;  1QVF S;  3FIF A;  1BKB A;  1TH7 A;  4L6V 5;  5FRM A;  1YCS B;  5HKC A;  2EYY A;  5EG2 A;  3KUF A;  1JJ2 A;  1FMW A;  4JLG A;  4JZ3 A;  4PJO B;  2DF6 A;  1PNJ A;  1N8R C;  2X4Y A;  2RH2 A;  3CXC A;  2L3Q A;  3PGG A;  2HMA A;  4JDS A;  3RUX A;  3I55 Q;  3OMG A;  1GL5 A;  2CP6 A;  3TCJ A;  4QKU A;  1QMC A;  4ZTJ A;  2OTJ T;  5CQX A;  2DVE A;  2K6D A;  2JS2 A;  4E7H A;  2OTJ A;  2VC8 A;  2F5T X;  3VKI A;  5GJW B;  1VA7 A;  2F2W A;  1B34 B;  1VYU A;  4JRI A;  1D3B B;  2Y4Y A;  2OAW A;  3G71 Q;  2MPX C;  4JS5 A;  1BIA A;  3GIB A;  1SF9 A;  3HFO A;  1ZSG A;  2DA9 A;  5FU6 B;  1SKU B;  3G6E Q;  1YIJ A;  3PMT A;  2H8H A;  5CQY A;  1AWW A;  4J83 A;  1WIE A;  3VS6 A;  1X2Q A;  2E6Z A;  5HCK A;  3EHR A;  1F1B B;  2HBP A;  2EVR A;  5GAM e;  2DK3 A;  2KBT A;  1IO6 A;  3CC2 Q;  4M7A A;  4M78 B;  5KYW A;  1Q86 C;  2ABL A;  2LCC A;  2EGC A;  3C12 A;  3OYY A;  4RG8 A;  5LJ3 f;  4Y91 A;  3I5R A;  3H6Z A;  1K8A U;  2Y4X A;  3H8Z A;  8ATC B;  1MND A;  4QVZ A;  2D9T A;  4A63 B;  2OI3 A;  3ZFJ A;  2O31 A;  5A0D A;  3ZBD A;  5DM7 R;  3CCU Q;  3EGD B;  4KH1 B;  2KXD A;  2HSE B;  2RK2 A;  3X20 B;  5FRO A;  5GMK l;  4KGV B;  2NUT B;  5GAN d;  2VB6 A;  4MZT A;  3HSB A;  2JOY A;  4J6Y A;  4TVR A;  3JB9 I;  3CCV Q;  5FWB A;  4XK8 E;  5CO7 A;  4DBR A;  2A28 A;  3L2U A;  2PVD B;  2DXC A;  2EGE A;  2QQA A;  3M57 A;  2GF7 A;  2M0Y A;  3I55 T;  1Y07 A;  2LMJ A;  4PJO E;  3UDC A;  5GAN g;  1SRL A;  1UHC A;  4JPB W;  4OB2 B;  1CKB A;  2LX7 A;  1WHJ A;  5KYU B;  3RIR A;  2RI5 A;  4M75 F;  2EW3 A;  2KAF A;  3HRS A;  2KT8 A;  1PCX A;  1PM3 A;  1BCO A;  2HEQ A;  1U8R A;  1EFN A;  4A4F A;  2QA4 T;  5I21 A;  2QA4 A;  5C0M A;  3UWN A;  2YUO A;  4FM4 B;  4DOW A;  2XHC A;  2WSC E;  4LN2 A;  5CR2 A;  3GOX A;  2CUB A;  2ROL A;  2QEX Q;  4JUV A;  3CBP A;  3CC2 T;  3CC2 A;  3HKS A;  3SWN C;  1K9M C;  1X43 A;  1K0X A;  4NOY A;  2ECZ A;  2AKK A;  4BDZ A;  4C5I A;  4M78 E;  4JS4 A;  2DL4 A;  2XMF A;  3UT1 A;  2RN8 A;  3Q1J A;  3EHQ A;  1PWT A;  3UF4 A;  3M5A A;  4FW1 A;  1BIB A;  3CCU T;  4X34 A;  4HVV A;  2L5Q A;  1HSQ A;  4Z88 A;  1MV0 B;  3CMA T;  3CMA A;  3MCA B;  2EFI A;  1O9S A;  3PFS A;  3M56 A;  3CCV T;  4V2S A;  3I35 A;  3CCV A;  2KYB A;  5D6X A;  3PE0 A;  3CCJ Q;  1RI9 A;  2DXB A;  4XTW A;  3OB9 A;  4E7S A;  1ABQ A;  5CIU A;  5FU7 B;  5LJ5 d;  3H0I A;  4PJO C;  2O9S A;  1M2O A;  5D7U A;  4XU2 A;  2EYW A;  2FPF A;  2KRM A;  5C6S A;  3P8D A;  3EGX B;  4AT1 B;  3ZL7 C;  5LJ5 g;  2FRY A;  4KUI A;  4EMG A;  1VQ4 Q;  3RR6 A;  2KGT A;  2DKG A;  1TU0 B;  2KQW A;  3EG1 A;  5GAN h;  1GCQ A;  1BI0 A;  5FWC A;  1KD1 R;  1VQ8 Q;  2VV5 A;  4R56 A;  4J6W A;  1OPL A;  4C8Q D;  5FU6 C;  1SHG A;  2K79 A;  2LX9 A;  4JJD A;  3V7R A;  5GMK m;  4RCC A;  4XAX B;  4C5G A;  1WX6 A;  4M75 A;  2DET A;  1K0S A;  3LYI A;  2L3P A;  3J7A F;  2D1X A;  4F7U G;  5KH6 A;  4M78 C;  3RKY A;  2L3R A;  2DVJ A;  1WJQ A;  2QI2 A;  1PKS A;  5IHK A;  2PVG B;  3H9N A;  5KYY A;  1QVG A;  3M9Q A;  2F69 A;  4ELZ C;  2BUD A;  2RM4 A;  2LT1 A;  4Y92 A;  2KNB B;  2XDP A;  1V76 A;  2M1H A;  1K73 C;  1ZA2 B;  1RAC B;  3QHS A;  2PU9 B;  4ZGD B;  1S1N A;  3RES A;  1R0C B;  2YRV A;  3CCJ T;  3CCJ A;  5GAM d;  4Z8A A;  5GAO n;  3EH2 A;  3OBW A;  2D0Q B;  2HDA A;  1IZ6 A;  1WXB A;  2DBM A;  2W0Z A;  4GLK A;  2KRS A;  5KYX A;  2QQS A;  3VU3 C;  2P4R A;  3M53 A;  4OB0 B;  2FZC B;  4M7A G;  1WI7 A;  1M2V B;  3OS5 A;  3URG A;  3JCM b;  4IUR A;  1YJ9 Q;  2EQU A;  4JRK A;  3JB9 J;  3VS7 A;  2YRC A;  1LOJ A;  2RQU A;  3CPF A;  2KRN A;  1QKX A;  4KUD K;  2CH4 W;  4AG2 C;  1UG1 A;  5IN1 A;  2X4W A;  5HY6 A;  3I5S A;  1PD0 A;  2DFU A;  4E7K A;  4M77 F;  1WFW A;  1VQ8 T;  4FSX A;  1T3L A;  4OGC A;  5D6W A;  8AT1 B;  4HCZ A;  2R58 A;  4EMH A;  4ZGE B;  1BI2 A;  1PSF A;  1S72 Q;  1WYX A;  1VQ6 Q;  3A8H B;  1M1K C;  2K5F A;  2NLU A;  1GBQ A;  1NPR A;  1E6H A;  1QWF A;  2C0I A;  1K73 U;  4M7D D;  2DO3 A;  1VQ9 Q;  1D1A A;  3TSW A;  4KRT A;  4MZM A;  3JCM P;  2YUQ A;  5LJ3 j;  2FPE A;  2JS0 A;  4A4G A;  4M77 D;  1M90 R;  1KHI A;  7AT1 B;  2E70 A;  3E19 A;  3SDZ A;  2MK5 A;  3L2V A;  1VQO T;  2C06 A;  1VQO A;  2VXF A;  2QK0 A;  3CCL Q;  2RHU A;  3RMQ A;  4M7D E;  3GNG A;  1RUW A;  1NJI R;  4XU1 A;  3S3O A;  2L0A A;  3CD6 Q;  1T0H A;  4RG2 A;  1M1G A;  4QVD A;  2DNU A;  3RMS A;  1IXD A;  1ZBJ A;  3FJ5 A;  2DD4 A;  3G1J A;  1UEC A;  4GLM A;  2DD5 A;  1VQK Q;  2RA2 A;  1OZ3 A;  4AFS C;  3SFM A;  3VS5 A;  3QSU A;  1KQ1 A;  2M0O A;  3G7Z A;  2SRC A;  2NUP A;  1ACM B;  1Q81 C;  2G6F X;  4OMQ A;  3OYL A;  1FYN A;  2OAU A;  1O75 A;  4QQG A;  1VQ7 Q;  2EYX A;  3THK A;  4N0A A;  5FU7 C;  1M1K U;  3H41 A;  1TXQ A;  3REB B;  2QTV A;  1H92 A;  1YFN A;  2WSE E;  4PNO A;  1KQS S;  3OYB A;  3C4S A;  4BAC A;  1NLP C;  1WXU A;  3GPL A;  2PVO B;  3VYG A;  1G83 A;  1R77 A;  2CP7 A;  2JTF A;  5GAO q;  2K9G A;  1ZBX A;  4C0Z A;  2HAX A;  3M59 A;  1I8F A;  3BDU A;  1VYV A;  4QQD A;  4LDU A;  2RHY A;  3SEM A;  5GAM h;  5GJV B;  1M5Q 1;  4RMO A;  4J9C A;  4HVW A;  3PVL A;  1YIT Q;  1M90 C;  2DEU A;  2CZ0 B;  2P0K A;  3NFC A;  4M7A B;  2J6O A;  5KYW B;  2YXY A;  2E64 A;  4MML A;  1QP3 A;  1U5S A;  1VQL Q;  1QCF A;  4F16 A;  2YUP A;  2DTH A;  3G4S A;  5AT1 B;  1Q7Y R;  1EX4 A;  2LQK A;  3C94 A;  3JCM Q;  4PJN A;  2AT1 B;  1D0X A;  5CCA A;  1UGS B;  1OX9 A;  3CME Q;  1Z9Z A;  1IGQ A;  3CCL T;  1UGV A;  2V26 A;  1Q81 U;  3QBY A;  3CCE A;  4OMN A;  4C92 F;  4NL3 A;  5GAO r;  1ZX6 A;  1FMK A;  3LH5 A;  1N8R R;  3MPU B;  3E9F A;  2CYZ B;  4ELY C;  2FHD A;  4LD9 K;  1U1T A;  2VAS A;  1RLQ C;  5KYN A;  2MWO A;  2CUD A;  3EG3 A;  3QPH A;  4LD6 A;  2DPP B;  3KFV A;  2CH4 A;  1QLY A;  3OY9 A;  1M90 U;  2BZ8 A;  2MMP A;  3FJP A;  4GY5 A;  5GMK e;  1YJW Q;  2K57 A;  3S6W A;  1WHH A;  1QVF A;  3CCM T;  1BI1 A;  1VQ5 A;  1Q82 R;  3CCM A;  2XU8 A;  1NJI U;  1X69 A;  5LJ5 e;  1RL2 A;  5J39 A;  3CC7 Q;  1K9A A;  1NPP A;  1ZSZ A;  3L2Q A;  3VS1 A;  2PUK B;  1DJ7 B;  2V1Q A;  3OS1 A;  1Q7Y C;  1VQM T;  2AZV A;  1W4S A;  1VQM A;  1Q86 R;  2MCN A;  3TSZ A;  3FC3 A;  2VUB A;  2CSQ A;  2DRK A;  2QAZ A;  4BB7 A;  1VQL T;  3U23 A;  3A8G B;  4J5Y A;  4RTX A;  1RI0 A;  1SG5 A;  1ZHI A;  2KSS A;  3CME T;  1OOT A;  4AFQ C;  3X26 B;  3CC4 Q;  3CME A;  2E41 A;  1WLP B;  2A7Y A;  4HCK A;  4LXC A;  3JCM e;  2EYQ A;  4D6W A;  2VVK A;  1XJW B;  4F7U A;  3L1A A;  2ZCF B;  2K3Y A;  3GF5 A;  1RAG B;  3N5B B;  3MEU A;  4QT7 A;  3HRU A;  2LJ1 A;  4PK4 A;  5IHI A;  4LNP A;  2VGN A;  3QZ5 B;  3EFO A;  1KHC A;  5A0L A;  2F5K A;  2C0T A;  2RJC A;  2DBK A;  3JCM X;  2DMO A;  2LCS A;  3JB9 H;  2VXE A;  1NLO C;  3OYN A;  2L3S A;  2YT6 A;  3OYC A;  2ZPF B;  2HKQ B;  3OYG A;  3EH1 A;  1Q82 C;  3QJ6 A;  1Q7Y U;  4KGX B;  4C92 A;  5GAN f;  5DY9 A;  1YJW T;  4AFU C;  1YJW A;  3S3N A;  3M0P A;  2OTL T;  5HK0 A;  2E4H A;  2CGH A;  3M55 A;  2OTL A;  4OML A;  3L2R A;  3CCS Q;  1H3Z A;  2XKO C;  2DEQ A;  4CC2 A;  1NE8 A;  1TUD A;  3CPW P;  3QUI A;  5M9O A;  3CC7 T;  1E7O A;  1P92 A;  1N8R U;  1YI2 Q;  2BZX A;  1K9M R;  1M1F A;  1PC0 A;  3UA7 A;  2PNI A;  3OS2 A;  4PJO D;  3AHU A;  2EJ9 A;  3X25 B;  1SPK A;  1WXT A;  2WSF E;  3MKD A;  3QXE B;  1I1J A;  4M75 B;  3X28 B;  1UHF A;  2WAC A;  3HP9 A;  2JJ9 A;  5GAN 2;  1AEY A;  3JRZ A;  4M7A C;  1XNI A;  3CC4 T;  1AD5 A;  3ME9 A;  5CKB A;  4CRI A;  1Y96 A;  5KYY B;  2P4T A;  3I55 A;  2KVQ G;  1VOM A;  1Q95 G;  5AYF A;  1Q82 U;  2LC4 A;  2QQR A;  4M78 F;  2LVM A;  2DE0 X;  1VQN Q;  2GFA A;  2EQI A;  1I5L A;  2F1L A;  2CP2 A;  1JEG A;  5LJ3 d;  3O8V A;  1Q86 U;  3G71 T;  3G71 A;  5GMK i;  1VIE A;  5KYX B;  1K1Z A;  2O9V A;  4M78 D;  1X75 C;  4PLL A;  1WQW A;  1X6O A;  5KE2 A;  3G6E T;  1HJD A;  1M3B A;  3QDF A;  3G6E A;  3EFS A;  4J9H A;  1RLP C;  3MEW A;  3NMZ C;  4WCI A;  5LJ3 g;  2MWP A;  3TVT A;  2PTK A;  2ATC B;  3RDV A;  2FZK B;  4ORZ A;  2EBP A;  3A5Z B;  4HKE A;  2QDY B;  2XI9 A;  1WHK A;  1VUB A;  2AHJ B;  3RKW A;  2HQE A;  4M77 G;  2XDD A;  1YI2 T;  2HCK A;  3J81 E;  4A53 A;  1KQ2 A;  4L5G A;  1C0M A;  4J6X A;  1GFD A;  4CC7 A;  2A36 A;  3CCU A;  2LRQ A;  2L2P A;  1WGS A;  1WDX A;  3T9N A;  1KK7 A;  1D09 B;  1N6A A;  2DL5 A;  2KK4 A;  4FYY B;  2MF2 A;  2XD0 A;  3EG2 A;  3PVQ A;  3OS0 A;  4XU3 A;  2AIR B;  2DTI A;  2PQW A;  3MO8 A;  1OU9 A;  1KQS P;  4M75 E;  3S3M A;  3MET A;  1K73 R;  2YLB A;  1G8X A;  1M8V A;  3OYM A;  5CKE A;  2P0P A;  2JM8 A;  3M4Y A;  3LWI A;  1IRX A;  3M0T A;  1GRI A;  2QGG A;  1XTD A;  2EQM A;  2M16 A;  1BK2 A;  5EC7 A;  1UGQ B;  4II1 A;  1K9M U;  2K3X A;  3TRE A;  2CP3 A;  4XTV A;  2DJZ A;  4C8Q F;  4OB1 B;  4XTZ A;  4IIM A;  2W10 A;  2CP5 A;  2CDT A;  1SRM A;  3VUZ A;  2OX7 A;  3GLX A;  1AZE A;  1B07 A;  2NUP B;  2VWF A;  3RNJ A;  4KT0 E;  4KH0 B;  4PKC C;  4HCB A;  2QEX T;  3MEV A;  1MHN A;  3JCM d;  2QEX A;  3CCR Q;  4PJL A;  3L2Z A;  5CAI A;  4D8D A;  1X27 A;  2KYM A;  2B8A A;  5GAM f;  1QCN A;  4WTO B;  2BIV A;  4KGZ B;  1J3T A;  2LNV A;  4HVU A;  4BI8 B;  2COY A;  1M8M A;  3QYH B;  1MMN A;  4BI3 A;  3JCM g;  4C0D B;  1MUZ A;  1GBR A;  1M1K R;  4RCB A;  4BE0 A;  4LDX A;  4M4Z A;  4ESR A;  2EQK A;  4E7J A;  4UC4 A;  1X01 A;  1GCQ C;  3L42 A;  1YJN Q;  2QG9 B;  3A8M B;  4XTY A;  2JUF A;  1UTI A;  2E10 A;  3CPW S;  1HXD A;  5GAN 5;  1WHM A;  4C0G A;  2K3B A;  4RTW A;  1N27 A;  2V8I A;  3EG9 A;  4BE1 A;  1YHQ Q;  2HKN A;  4B6M A;  1JRI A;  4M75 C;  4C92 G;  2PUO B;  3JV3 A;  4DBF A;  2J05 A;  4M77 B;  5FRN A;  3ASK A;  3BFM A;  1XOV A;  5CKF A;  2J6K A;  2RJF A;  3I9Q A;  1HYO A;  1GXI E;  4QVC A;  3RER A;  3A8L B;  3PT9 A;  1IGU A;  3BW1 A;  3REA B;  1IB8 A;  1X6B A;  2J7I A;  6AT1 B;  1ZUY A;  1Q81 R;  4JLI A;  2FG0 A;  2ZAE A;  4M7D F;  1YNZ A;  1VQ4 T;  1VQ4 A;  1HD3 A;  4QQ6 A;  3HTR A;  5IAY A;  1AWO A;  2JXB A;  3CCR T;  1VQ8 A;  5L23 A;  5GMK h;  5GAN j;  3VS2 A;  1PRL C;  4OMO A;  2XK0 A;  1VQP Q;  3H0H A;  3INZ A;  4J8O A;  3OYH A;  2LT4 A;  2QXF A;  2RJD A;  2EQJ A;  3HHT B;  4OVA A;  2CZ7 B;  3BY7 A;  5LJ5 h;  4R55 A;  4MDX A;  3CCQ Q;  4XQ3 A;  4C8Q A;  2OJ2 A;  3QDR B;  3TEE A;  3OYI A;  1ZSZ B;  2O4X B;  2FL7 A;  4E7L A;  4E2F B;  2A0F B;  4BUG A;  4ATO A;  2KY9 A;  4DBH A;  3VS3 A;  2ROT A;  1YJN T;  2X35 A;  1KG1 A;  1JJ2 P;  5I2S A;  3VS4 A;  4A4H A;  4OB3 B;  3HPW A;  3UAT A;  2P84 A;  2M9U A;  2BKD N;  4HXJ A;  1BI3 A;  3JCM W;  4HT8 A;  1MMG A;  3CXC P;  2ZPH B;  1I0C A;  4DEY A;  1MMD A;  1YHQ T;  1OU8 A;  4E7Z A;  4CI0 C;  2VKN A;  2L8D A;  3JCM h;  3OMC A;  1KQS A;  3QZ9 B;  4BY6 B;  4E6R A;  4LUD A;  2MI6 A;  4F7U B;  3OA6 A;  4AFZ C;  1WNL A;  2Y90 A;  2DJQ A;  1YJ9 T;  3MJX A;  1YJ9 A;  3LX7 A;  5FW9 A;  5CK9 A;  4NL2 A;  1QP2 A;  3EFO B;  1AWJ A;  1YBY A;  3MP8 A;  5A0G A;  5GAO l;  2E3H A;  4C5H A;  2DL8 A;  5DLQ E;  2QYZ A;  2FZG B;  2XDB A;  1AT1 B;  1PRM C;  2EKH A;  4A4K A;  2DX1 A;  4B9W A;  3LW5 E;  4EMK A;  1JO8 A;  1ZA1 B;  3LGL A;  4EIK A;  3LLR A;  3OSV A;  3QYG B;  4YTL A;  4F17 A;  3EG0 A;  1S72 T;  1WPY A;  4C92 B;  1S72 A;  1WJR A;  4IUV A;  1VQ6 T;  2G3R A;  2GNC A;  1VQ6 A;  3DB3 A;  1WZO A;  4LDW A;  1VQ9 T;  1B3Q A;  1VQ9 A;  3I56 Q;  1BBZ A;  5LJ3 e;  5KCO A;  1UJY A;  4N0A C;  2EKO A;  3CCQ T;  1TUC A;  4BDY A;  1TTH B;  3V7S A;  4M7D A;  1UFF A;  1FWZ A;  2YWW A;  4OGE A;  4FCY A;  3QJY A;  5IXB A;  4ME7 A;  4KUL A;  4C0D C;  1X2K A;  3CCL A;  1OQK A;  4M77 A;  2HD0 A;  3CD6 T;  2JZ2 A;  3CD6 A;  4PFP A;  1WQ7 A;  2BZY A;  2MIO A;  2GFU A;  4KBM B;  5D6Y A;  4NS5 A;  2RHI A;  2CS7 A;  2YDL A;  2M51 A;  2X3X D;  2EAY A;  3OW2 P;  2HZY A;  4B9X A;  2BTT A;  1VQK T;  4RTT A;  1VQK A;  1TUG B;  4J9E A;  1Y96 B;  2HQX A;  2VYT A;  1G2B A;  1M3A A;  4E7I A;  3V7C A;  1EZZ B;  2ZPB B;  5GAN 4;  1BCM A;  4LDV A;  4M78 G;  2E5Q A;  1V1C A;  1Y0M A;  3VUB A;  1QWE A;  3X24 B;  4DQ2 A;  4DBQ A;  3FEO A;  1VQ7 T;  2OTJ Q;  2FRW A;  4OP0 A;  1VQ7 A;  2HSP A;  1T3S A;  1TWB A;  4F7U E;  3VJP A;  3HL8 A;  4FW2 A;  1I07 A;  1N5Z A;  1W2B P;  2K7A A;  1UB4 A;  2KR3 A;  3WVD B;  2LZ6 B;  2QTX A;  1UE9 A;  2K5I A;  3C95 A;  1OZ2 A;  2D8H A;  3PNW C;  1PHT A;  2E65 A;  3NPF A;  1H8K A;  1E6G A;  2EJG A;  2RQR A;  4P5N A;  1YIJ Q;  3SD4 A;  4ZN3 A;  2O4X A;  1LNX A;  2MOX A;  4R0K A;  1YIT T;  3OSS C;  1YIT A;  2O01 E;  1G3T A;  4ZTF A;  1KC8 C;  2RHZ A;  3I56 T;  5GAM j;  3EFR A;  2GTO A;  5CKH A;  4C92 E;  1VQL A;  2QDL A;  4FL6 A;  4FYV B;  4M7A E;  2J06 A;  2O2O A;  4HA8 A;  2GQV A;  3GNF B;  4IKF A;  4L59 A;  5LL6 S;  2DIL A;  4EPC A;  2PZ1 A;  1ZLM A;  1H64 1;  4IUT A;  4IUU A;  4FYW B;  2CKK A;  1ZSZ C;  3GP8 A;  2D8J A;  1QW1 A;  1SSF A;  2QQ9 A;  3L2W A;  1JB0 E;  1WHL A;  2JVV A;  1K8A C;  3BDL A;  3QKJ A;  1BU1 A;  2ENM A;  2L89 A;  2GBQ A;  2X51 A;  2FVU A;  5GAO m;  3MP6 A;  3M58 A;  4MDW A;  3JCM J;  1ARK A;  4F04 B;  2RHX A;  3FDR A;  1JJ2 S;  4IUP A;  1UGR B;  2DXU A;  2DL7 A;  1N9R A;  3ZEH A;  2DRM A;  2DZC A;  3J80 E;  5L8R E;  4BY6 C;  4DA4 A;  2RPN A;  3CXC S;  1SSH A;  5GAN 7;  5GAN 3;  1KC8 U;  4LDY A;  3GBQ A;  2KDS A;  4C8Q G;  1U06 A;  1AOJ A;  4OMM A;  4PJO F;  1A0N B;  2K5L A;  3V8L A;  2ESW A;  3M0Q A;  1RAE B;  4ANJ A;  3IQL A;  1K76 A;  2BE7 D;  3CBM A;  3NTH A;  4O6J A;  3DKM A;  5FLX E;  1YIJ T;  2HL5 C;  2QA4 Q;  4IUQ A;  3CC7 A;  4MZP A;  3C0C A;  2DYI A;  3PTA A;  2JTM A;  3PIO A;  4OF1 A;  1JXO A;  1BYM A;  3NTI A;  1C1A A;  1PKT A;  2QQB A;  3P8B B;  4XTX A;  3WVE B;  4ZGJ B;  1I4K 1;  2NWM A;  4C92 C;  2X3W D;  1GCP A;  1QVG P;  4FU6 A;  1UGP B;  3CC4 A;  4J9D A;  1LJO A;  2X9H A;  3QII A;  4PLI A;  1OPK A;  1UDL A;  1FXX A;  1FX7 A;  3EAE A;  2FPD A;  2EIF A;  3CMA Q;  2HBW A;  3CBO A;  3VYH B;  5J26 A;  3KXT A;  1JU5 C;  2RK1 A;  4RTV A;  2H3E B;  2KEA A;  4BI4 A;  5GAN 8;  4IIO A;  3EG9 B;  1RAD B;  4MMK A;  1IHV A;  1M9S A;  3OW2 A;  1IRE B;  1V29 B;  4HCC A;  3AT1 B;  5GAO p;  3CQT A;  2MYS A;  2CZ1 B;  2RJE A;  3FRN A;  3SWN A;  2RMO A;  3QWY A;  1M27 C;  4J9I A;  4DOV A;  1SHF A;  1D0Y A;  3OW2 S;  4J7F A;  1QKW A; 
#chains in the Genus database with same CATH homology
 1JJ2 A;  4M7D G;  1HXD A;  5GAN 5;  3GPL A;  4VUB A;  2JNG A;  2PVO B;  4JLG A;  3VYG A;  3CCS T;  1W2B A;  4C0G A;  4PJO B;  1AHJ B;  2JTF A;  3CCS A;  1N27 A;  2V8I A;  5GAO q;  1N8R C;  1ZBX A;  2X4Y A;  4C0Z A;  2RH2 A;  3CXC A;  4BE1 A;  2HAX A;  3M59 A;  1I8F A;  3BDU A;  3PGG A;  1JRI A;  4JDS A;  2I2L A;  4M75 C;  4C92 G;  2PUO B;  3RUX A;  3JB9 F;  5LJ5 f;  4QQD A;  1YI2 A;  3OMG A;  2RB6 A;  2RHY A;  4LDU A;  4M77 B;  5FRN A;  3ASK A;  5GAM h;  4M75 D;  1M5Q 1;  4RMO A;  3BFM A;  3TCJ A;  1XOV A;  5CKF A;  4ZTJ A;  1M90 C;  2CZ0 B;  2OTJ T;  2RJF A;  1W2B S;  2P0K A;  3NFC A;  5CQX A;  2DVE A;  4E7H A;  4M7A B;  2OTJ A;  2VC8 A;  2F5T X;  4XU0 A;  5CKD A;  1GXI E;  3VKI A;  2E64 A;  4MML A;  1NZ9 A;  1QP3 A;  4QVC A;  2YLC A;  3JCM c;  3RER A;  3A8L B;  3PT9 A;  5KE3 A;  1B34 B;  3BW1 A;  3G4S A;  2DTH A;  4JRI A;  1D3B B;  2P0Q A;  2Y4Y A;  2LQK A;  4JLI A;  3C94 A;  3JCM Q;  1MGQ A;  3JB9 D;  1HK9 A;  2DTO A;  4M7D F;  4C8Q B;  4PJO A;  1VQ4 T;  1VQ4 A;  3OYJ A;  1BIA A;  3R6O A;  4JS5 A;  3GIB A;  3OYA A;  3HFO A;  4QQ6 A;  5CCA A;  1UGS B;  5FU6 B;  5IAY A;  5HK3 A;  1YIJ A;  3CCL T;  3PMT A;  1Q81 U;  5CQY A;  3QBY A;  4J83 A;  3CCE A;  4C92 F;  4FT2 A;  3CCR T;  3JCM f;  2E6Z A;  1VQ8 A;  4NL3 A;  5GAO r;  3PMI A;  5GMK h;  5GAN j;  2HBP A;  2A3L A;  5GAM e;  2DK3 A;  2XK0 A;  1VQN T;  4M7A A;  4J8O A;  3INZ A;  1VQN A;  4M78 B;  4C0F A;  2LT4 A;  3OYH A;  2QXF A;  1WJS A;  2RJD A;  3E9F A;  2CYZ B;  1OI1 A;  4ELY C;  1Q86 C;  2EQJ A;  2LCC A;  3HHT B;  4OVA A;  1B34 A;  2CZ7 B;  2FHD A;  3BY7 A;  1U1T A;  3C12 A;  3OYY A;  4RG8 A;  5LJ3 f;  1D3B A;  4Y91 A;  5LJ5 h;  3LGF A;  3H6Z A;  5GAN 6;  4R55 A;  2MWO A;  2Y4X A;  1K8A U;  3H8Z A;  4MDX A;  4PL6 A;  3QPH A;  4XQ3 A;  4C8Q A;  3QDR B;  3TEE A;  3OYB A;  1Q82 U;  3OYI A;  4LD6 A;  4QVZ A;  2O4X B;  2FL7 A;  2DPP B;  2K4Y A;  4E7L A;  2D9T A;  3ZFJ A;  4BUG A;  5A0D A;  3NTK A;  4ATO A;  3ZBD A;  2KY9 A;  4N4H A;  5DM7 R;  1YJN T;  2X35 A;  2RK2 A;  3X20 B;  5FRO A;  5GMK l;  3OY9 A;  1KG1 A;  1M90 U;  4XTU A;  2MMP A;  3FJP A;  5I2S A;  4A4H A;  4OB3 B;  3HPW A;  3PIP A;  2XIC A;  4GY5 A;  5GAN d;  3OBY A;  4MZT A;  3HSB A;  2M9U A;  3M54 A;  5GMK e;  2BKD N;  2JOY A;  4J6Y A;  4M78 A;  1BI3 A;  4TVR A;  3JB9 I;  3JCM W;  2K57 A;  4HT8 A;  4RKU E;  3V8J A;  3S6W A;  2ZPH B;  4XK8 E;  5CO7 A;  1QVF A;  2E6N A;  3CCM T;  1BI1 A;  1VQ5 A;  3L2U A;  3CCM A;  5IT9 E;  2RI3 A;  1YHQ T;  2PVD B;  4CI0 C;  2XU8 A;  1NJI U;  2DXC A;  3M57 A;  2QQA A;  2L8D A;  3JCM h;  2GF7 A;  5LJ5 e;  1Y71 A;  1RL2 A;  3I55 T;  4JRQ A;  1Y07 A;  3OMC A;  5J39 A;  1BYM A;  4EMK B;  1KQS A;  1NPP A;  2R5M A;  2V8J A;  3QZ9 B;  3UDC A;  4BY6 B;  3L2Q A;  5GAN g;  3CPW A;  4PJO E;  2MI6 A;  2PUK B;  1DJ7 B;  2E1H A;  3OS1 A;  2DAQ A;  1Q7Y C;  4F7U B;  3OA6 A;  1VQM T;  1WNL A;  1W4S A;  1VQM A;  4OB2 B;  2Y90 A;  1YJ9 T;  5LJ3 h;  3FC3 A;  2VUB A;  3HFN A;  1YJ9 A;  4EDU A;  4BB7 A;  1VQL T;  1VQ6 T;  3LX7 A;  3RIR A;  5CK9 A;  4NL2 A;  1QP2 A;  2JN0 A;  1YBY A;  2RI5 A;  3A8G B;  3MP8 A;  4M75 F;  2KAF A;  5A0G A;  4J5Y A;  1G3S A;  2GCX A;  3HRS A;  5GAO l;  4X9C A;  1RI0 A;  4C5H A;  5DLQ E;  1ZHI A;  2XG8 D;  2X4X A;  2XDB A;  4M7D B;  1N9S A;  2KSS A;  1U8R A;  3CME T;  3DLM A;  4A4K A;  4A4F A;  1UEB A;  3X26 B;  3CME A;  2E41 A;  2QA4 T;  5I21 A;  4WF2 A;  2V8K A;  2A7Y A;  4B9W A;  3LW5 E;  2QA4 A;  4EMK A;  5C0M A;  3LGL A;  4FM4 B;  3LLR A;  3UWN A;  4C8Q E;  4DOW A;  2XHC A;  3OSV A;  2EYQ A;  3QYG B;  2WSC E;  4Y28 E;  4YTL A;  4D6W A;  4OMF B;  4F7U A;  5CR2 A;  1S72 T;  1WPY A;  3GOX A;  3L1A A;  4C92 B;  4FIB A;  2ZCF B;  3MHX A;  1WJR A;  2K3Y A;  3CBP A;  4IUV A;  4JUV A;  2G3R A;  4E47 A;  4JJN K;  1S72 A;  3CC2 A;  3GF5 A;  3DB3 A;  1VQ6 A;  3N5B B;  3MEU A;  4LDW A;  3HKS A;  3HRU A;  3SWN C;  1VQ9 T;  1K9M C;  1VQ9 A;  2IVW A;  2VGN A;  3QZ5 B;  4NOY A;  5LJ3 e;  2ZPI B;  5KCO A;  1KHC A;  1QVG S;  3FB9 A;  4N0A C;  5A0L A;  2EKO A;  4BDZ A;  3CCQ T;  2F5K A;  5I2M A;  4C5I A;  4M78 E;  2RJC A;  4JS4 A;  3UT1 A;  4BDY A;  3JCM X;  3V7S A;  4M7D A;  3Q1J A;  3JB9 H;  2VXE A;  3OYN A;  1FWZ A;  3OYC A;  3M5A A;  2FB7 A;  2ZPF B;  1BIB A;  3CCU T;  4O5V A;  5GAM g;  4X34 A;  4OGE A;  2L5Q A;  3QJY A;  3OYG A;  2DIQ A;  1Q82 C;  3QJ6 A;  4ME7 A;  1Q7Y U;  4KUL A;  4C0D C;  4Z02 A;  3JCM e;  2ZZD A;  3CCL A;  3OYE A;  3CMA T;  4M77 A;  2HD0 A;  3HRT A;  4C92 A;  3DB4 A;  3CD6 T;  3CMA A;  3MCA B;  2EFI A;  1O9S A;  2JZ2 A;  3PFS A;  4N4I A;  5DY9 A;  5GAN f;  1WQ7 A;  3CCR A;  1QVG A;  1YJW T;  3CD6 A;  3M56 A;  3CCV T;  1YJW A;  3S3N A;  2OTL T;  2GFU A;  4KBM B;  3M55 A;  2CGH A;  2LDM A;  5D6Y A;  5HK0 A;  4NS5 A;  2RHI A;  3CCV A;  1KD1 C;  2CS7 A;  2OTL A;  1ZQ1 A;  2EAY A;  2R5A A;  5D6X A;  5DLO A;  2KMT A;  3L2R A;  1H3Z A;  2XKO C;  3LWH A;  2DEQ A;  4B9X A;  1VQK T;  1NE8 A;  1K73 U;  1G5V A;  3OQ5 A;  1VQK A;  2DXB A;  3QUI A;  1Y96 B;  2XID A;  2HQX A;  2VYT A;  4XTW A;  5M9O A;  3CC7 T;  1JBM A;  1P92 A;  3OB9 A;  3JSC A;  4E7I A;  1N8R U;  4FT4 A;  3V7C A;  2ZPB B;  5GAN 4;  3FLG A;  5CIU A;  5FU7 B;  5LJ5 d;  3OYK A;  4PJO C;  4LDV A;  4M78 G;  2E5Q A;  3VUB A;  2H3J A;  2LTO A;  3X24 B;  1M1F A;  3P8H A;  4DQ2 A;  4PJO D;  3OS2 A;  4Q5W A;  3FEO A;  1VQ7 T;  3AHU A;  4XU2 A;  2EJ9 A;  4OP0 A;  1VQ7 A;  1YJN A;  3X25 B;  5C6S A;  3M4G A;  4F7U E;  3VJP A;  3P8D A;  3HL8 A;  2WSF E;  3QXE B;  5LJ5 g;  4M75 B;  3X28 B;  1UB4 A;  2WAC A;  3HP9 A;  3WVD B;  5GAN 2;  2QTX A;  3JRZ A;  4KUI A;  4M7A C;  1XNI A;  2DZ9 A;  2K5I A;  4EMG A;  3CC4 T;  3C95 A;  1OZ2 A;  3PNW C;  2E65 A;  4V2S A;  2DKG A;  4A54 A;  3ME9 A;  5CKB A;  5CVI A;  1Y96 A;  4CRI A;  1YHQ A;  2EJG A;  4ZN1 A;  2KQW A;  4P5N A;  2ZPG B;  5GAN h;  3SD4 A;  2P4T A;  3I55 A;  2KVQ G;  4ZN3 A;  1BI0 A;  2O4X A;  4C8Q C;  3QO3 A;  1LNX A;  2D6F A;  2VV5 A;  5AYF A;  1YIT T;  2LQ8 A;  3OSS C;  2LC4 A;  4J6W A;  2QQR A;  4M78 F;  2LVM A;  4R56 A;  2O01 E;  3DLL A;  1YIT A;  4C8Q D;  5FU6 C;  1G3T A;  2LX9 A;  2K2V A;  4ZTF A;  2RHZ A;  1KC8 C;  3I56 T;  2GFA A;  3MP1 A;  3EFR A;  1VIF A;  5GAM j;  1I5L A;  4M77 E;  5CKH A;  3V7R A;  4C92 E;  4RCC A;  5GMK m;  4XAX B;  4C5G A;  1KD1 U;  2CZ6 B;  1VQL A;  4LD9 K;  4M75 A;  5LJ3 d;  2HNI A;  3LYI A;  4FL6 A;  5A2Q E;  3O8V A;  3J7A F;  4M7A E;  1Q86 U;  5KH6 A;  4F7U G;  4JRP A;  1OYX A;  4HA8 A;  4M78 C;  2GQV A;  3GNF B;  3RKY A;  3G71 T;  2L3R A;  1M4Z A;  3JCM V;  3G71 A;  5GMK i;  1U1S A;  1WJQ A;  2QI2 A;  4L59 A;  3RKX A;  4IKF A;  4X9D A;  1VIE A;  5LL6 S;  3UPU A;  4EPC A;  2PVG B;  4M78 D;  1X75 C;  4PLL A;  1WQW A;  1X6O A;  5KE2 A;  3M9Q A;  2F69 A;  4ELZ C;  2BUD A;  1H64 1;  3G6E A;  3EFS A;  2RM4 A;  4BE2 A;  4IUT A;  4IUU A;  3MEW A;  5GAN e;  2LT1 A;  5LJ3 g;  2RO0 A;  2CKK A;  2XDP A;  3JAM E;  2M1H A;  2MWP A;  1K73 C;  3GP8 A;  1VQP T;  3QHS A;  2PU9 B;  1QW1 A;  3VV0 A;  1VQP A;  1EIF A;  4PJO G;  1SSF A;  4ZGD B;  2QQ9 A;  3RES A;  3L2W A;  2YRV A;  3A5Z B;  3CCJ T;  1JB0 E;  2JVV A;  1K8A C;  4HKE A;  3CCJ A;  2QDY B;  5GMK j;  5GAM d;  3BDL A;  3QKJ A;  5GAO n;  2XI9 A;  3V8K A;  3OBW A;  1VUB A;  5J3B A;  2L89 A;  3G6E T;  2AHJ B;  3RKW A;  2FVU A;  2D0Q B;  5GAO m;  3MP6 A;  2HQE A;  3CEY A;  3M58 A;  4M77 G;  4MDW A;  2XDD A;  1IZ6 A;  3CCQ A;  1YI2 T;  3JCM J;  4GLK A;  4BD3 A;  4F7U F;  5LJ5 j;  3J81 E;  2QQS A;  4A53 A;  1KQ2 A;  2RHX A;  3QG1 A;  3VU3 C;  3FDR A;  3M53 A;  4IUP A;  1UGR B;  4L5G A;  2DXU A;  3OS5 A;  4OB0 B;  1JJ2 S;  4J7I A;  4M7A G;  3URG A;  2ZGW A;  4J6X A;  3CC2 T;  1N9R A;  1Y7X A;  3ZEH A;  2LRQ A;  2RI2 A;  3CCU A;  3JCM b;  4IUR A;  2DZC A;  4EMK C;  1WGS A;  2ZPE B;  1G3Y A;  5L8R E;  3J80 E;  3T9N A;  4BY6 C;  4DA4 A;  2EQU A;  3CXC S;  4JRK A;  3JB9 J;  5GAN 7;  5GAN 3;  3G4S T;  1KC8 U;  1N6A A;  3E9G A;  2KK4 A;  4LDY A;  2MF2 A;  2KDS A;  2XD0 A;  4C8Q G;  1LOJ A;  3OS0 A;  4PJO F;  1NJI C;  3CPF A;  4XU3 A;  2K5L A;  3V8L A;  4N4G A;  2DTI A;  2PQW A;  3MO8 A;  4KUD K;  3CBM A;  3NTH A;  4M75 E;  4O6J A;  3DKM A;  5FLX E;  3MET A;  3S3M A;  3E1S A;  1YIJ T;  5IN1 A;  2YLB A;  3OYD A;  2X4W A;  4IUQ A;  5HY6 A;  3TU4 K;  3CCE T;  3CC7 A;  4HT9 A;  4E7K A;  1M8V A;  4M77 F;  4MZP A;  3OYM A;  1VQ8 T;  1YCY A;  4FSX A;  5CKE A;  4A4E A;  2P0P A;  2IG0 A;  4OGC A;  5D6W A;  2EJF A;  4M7D C;  4HCZ A;  3M4Y A;  2R58 A;  4EMH A;  4ZGE B;  1BI2 A;  1PSF A;  3PTA A;  3LWI A;  2JTM A;  5KCH A;  4M7A F;  3A8H B;  1M1K C;  3PIO A;  4OF1 A;  3OYF A;  3ER0 A;  3NTI A;  2K5F A;  2NLU A;  2QQB A;  1NPR A;  1XTD A;  4QW2 A;  4M7D D;  3KBG A;  2EQM A;  3P8B B;  2M16 A;  4XTX A;  3CPW S;  2DO3 A;  3WVE B;  4ZGJ B;  1R8O B;  2DXT A;  2E12 A;  1I4K 1;  4MZM A;  1UGQ B;  3JCM P;  4M77 C;  2RD1 A;  4C92 C;  2MAM A;  4II1 A;  2K3X A;  1K9M U;  5LJ3 j;  3MEA A;  3TRE A;  4XTV A;  2DJZ A;  2X4J A;  4C8Q F;  4OB1 B;  4A4G A;  4XTZ A;  4M77 D;  3A8O B;  4C92 D;  1KHI A;  2EWN A;  2E70 A;  3E19 A;  4FU6 A;  3VUZ A;  3GLX A;  1UGP B;  3CC4 A;  3WXM B;  3SDZ A;  4M7A D;  3L2V A;  1LJO A;  1VQO T;  2C06 A;  3QII A;  4KT0 E;  4PLI A;  3SWN B;  1VQO A;  2VXF A;  3F70 A;  1FXX A;  4PKC C;  4HCB A;  1FX7 A;  3EAE A;  2FYK A;  2LCL A;  2RHU A;  3RMQ A;  4M7D E;  3GNG A;  4M75 G;  4C5E A;  2QEX T;  3MEV A;  2EIF A;  4XU1 A;  3SB2 A;  3S3O A;  1MHN A;  3JCM d;  2QEX A;  3L2Z A;  3CBO A;  2YHT A;  3VYH B;  5CAI A;  5J26 A;  4RG2 A;  1I81 A;  2B8A A;  3KXT A;  5GAM f;  1M1G A;  4QVD A;  2BIV A;  1VQ5 T;  3I56 A;  3RMS A;  2R57 A;  2DD4 A;  2RK1 A;  4BI4 A;  5GAN 8;  2LNV A;  2DD5 A;  4MMK A;  2RA2 A;  4BI8 B;  1M9S A;  3OW2 A;  1OZ3 A;  1G3W A;  3SFM A;  1PSE A;  3QSU A;  1IRE B;  1KQ1 A;  3JB9 G;  2M0O A;  3QYH B;  1QVP A;  1V29 B;  4BI3 A;  3JCM g;  3G7Z A;  4C0D B;  4HCC A;  5GAO p;  1XQH A;  4RCB A;  4BE0 A;  3LH0 A;  4LDX A;  1Q81 C;  2CZ1 B;  2RJE A;  3FRN A;  2DIG A;  2VGM A;  3SWN A;  3OYL A;  2OAU A;  2EQK A;  1QVF S;  4E7J A;  3FIF A;  1BKB A;  1O75 A;  1TH7 A;  4UC4 A;  4L6V 5;  4QQG A;  1X01 A;  5FRM A;  3L42 A;  3A8M B;  4N0A A;  5FU7 C;  4DOV A;  5HKC A;  4XTY A;  1M1K U;  3OW2 S;  4J7F A;  2JUF A;  2WSE E;  4PNO A;  5EG2 A;  1KQS S;  2E10 A;  3KUF A;  3C4S A;  4BAC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...