4M78G

Crystal structure of lsm2-8 complex, space group p21
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
70
Chain Sequence
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKLNEIYIRGTFIKFIKLQDNII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 70
sequence length 86
chains with identical sequence N
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78G00
1I8FA 4XTUA 5GAMj 4M78C 1HXDA 3EFRA 1M5Q1 3RESA 4QVCA 4M7AG 4XTXA 5GAMd 3PGGA 4M7DA 3JB9F 4PJOA 4V2SA 2DXUA 4XTYA 2JN0A 4M77D 4C8QA 3JCMf 2E41A 5GMKe 4NOYA 4C8QF 1HK9A 3M4GA 4WF2A 1I5LA 4M75C 2CGHA 4M78B 2DTIA 4M78G 5GMKm 2DJZA 4M77E 3SWNC 4XTVA 1Y96A 3FJPA 4C92E 4J5YA 5CAIA 4M75B 5LJ5e 4M7DD 2EJGA 3RKXA 5DY9A 3V7RA 4PJOD 4M75G 3V7CA 1B34A 4RCCA 5GANh 5GAN2 1MGQA 1WNLA 3RUXA 4JLIA 3SWNB 4JRKA 4M77A 4J6WA 2Y90A 4EMKA 4M77F 4XU3A 3JCMc 4F7UG 5LJ5g 4C92A 2YLCA 3JCMV 4EMHA 4J6XA 5LJ3e 2VXEA 5LJ5d 1X01A 4XU0A 4HA8A 2YHTA 3BW1A 3V8JA 4OP0A 3QO3A 2E10A 1N9SA 5GANg 1N9RA 3VU3C 2RA2A 4M7AE 5GAOq 1YCYA 2DVEA 3JCMh 5LJ3g 4PJOF 4XU2A 4M7DF 3BDUA 4C8QC 4C92D 1U1SA 4RCBA 2DEQA 2DTHA 4M78E 3RKWA 3RKYA 4M7AA 3JCMW 4M7DB 2DZ9A 1LOJA 5GAMf 4M7AF 3JB9G 4PJOB 5GMKj 2DKGA 3JCMg 4C8QB 2HNIA 4N0AC 3HFOA 5GAN3 4C8QG 4MMLA 2DZCA 4M75E 3FB9A 1WQWA 3BFMA 1BIBA 2FB7A 4MMKA 1KQ1A 1WQ7A 2EJ9A 5GANe 3V7SA 5I21A 5GAOm 4NL3A 4M77C 5LJ5j 1Y96B 3BY7A 4F7UE 4M7AD 4JUVA 4EMKC 5GAOp 4C92F 5GMKl 2E64A 3L1AA 3AHUA 1B34B 3V8LA 3SB2A 3JCMJ 4HT9A 4XTWA 1D3BA 3L2ZA 4M77B 2YLBA 4EMKB 5GANd 4M77G 1LNXA 4C92B 4M78D 4F7UA 4A54A 5LJ3j 5GAOn 4M7DC 3JB9J 4PJOC 3JCMe 2E1HA 1LJOA 4X9DA 3INZA 1WPYA 5LJ3d 4XQ3A 4EMGA 1I81A 5LJ5f 5GAMh 3GIBA 3JCMP 4M75D 3QHSA 4XTZA 3QUIA 2DXTA 4Y91A 4PJOG 4M7AC 4M7DG 1U1TA 5GAN4 2VC8A 3FIFA 2RD1A 5LJ3f 2VXFA 3JCMd 3QSUA 3JB9I 4M78A 4XU1A 4JRIA 4M7AB 3RIRA 5GAMg 5GAN8 4M78F 3HSBA 1JRIA 4J6YA 5GMKh 4QVDA 4C92C 2E65A 3JCMX 2EJFA 4M75A 4M75F 4NL2A 2QTXA 5GANj 1KQ2A 4X9CA 2ZGWA 3RERA 3SWNA 2I2LA 2RB6A 5GAN6 5LJ5h 4F7UF 4N0AA 4C92G 1JBMA 2EWNA 2FYKA 2EAYA 4A53A 5GAOl 3JB9D 1M8VA 1D3BB 3JB9H 2RM4A 4PNOA 4DQ2A 4C8QD 2K57A 1TH7A 1BIAA 2DTOA 5GAMe 5GANf 4F7UB 3HFNA 5GAOr 4M7DE 4PJOE 5LJ3h 5GAN7 1H641 4C8QE 5GMKi 3JCMQ 3EFSA 5GAN5 3V8KA 4HT8A 1I4K1 3JCMb
chains in the Genus database with same CATH superfamily
3CBOA 1RABB 3REBB 5DM7R 2QK0A 4FSSA 2DVJA 3VS4A 4DBRA 4HCZA 3SWNC 1TUDA 4JJNK 1VQMQ 2X3WD 1G3TA 4M7DD 4PJOD 4QQDA 2OTLA 3SWNB 2M0YA 4JRPA 4DBQA 4KRTA 3VKIA 1TOVA 1ZQ1A 1TWBA 1RI0A 2LTOA 3X26B 3MJXA 1QMCA 2RO0A 1VQ5T 4JJCA 3EH2A 2KEAA 4EDUA 3VS0A 5GMKj 3CCLQ 2LC4A 1GFCA 3HKSA 3MO8A 3I56T 3HFOA 3CCMA 4F17A 1Q86C 1WDXA 2DF6A 3CMET 4XAXB 2GQIA 2EJ9A 5GAOm 1F1BB 4M77C 3CCJQ 3CMAQ 1QCNA 1UB4A 2D8JA 3OS5A 5DLOA 2FPDA 3VS5A 4M77B 2VB6A 1CKBA 3JCMe 4L6V5 2NUPB 1IGUA 1PM3A 1QQJA 3M0PA 4BY6C 3EFOA 4BI3A 4R55A 1BI1A 2JOYA 3NMZC 3VUBA 4QVDA 2YRDA 2E65A 2EGAA 1BB9A 1D1AA 3PIOA 1WJRA 2RJCA 4B9XA 1M8VA 3VS6A 1C0MA 2AZSA 5C0MA 3A8MB 3OW2P 1M30A 2E70A 5J26A 3I56A 2DL7A 1U06A 2KQWA 3OBWA 1NZ9A 1N8RU 5D6WA 4WF2A 1I5LA 1CKAA 1O75A 4HVWA 1WHHA 2O4XB 4L5GA 1QCOA 1W6XA 4E7JA 2RQUA 4XU3A 2WSCE 2QA4Q 2K9GA 3QO3A 4FW1A 1M1GA 3M0QA 1Q82R 2QEXT 3FLGA 1UGPB 3JRZA 2C06A 1D1CA 2EQIA 3H41A 3ZBDA 4LDVA 3GLXA 2DKGA 2K5IA 4MMLA 2JM9A 4HKEA 4F7UE 4EMKC 4GY5A 1VYTA 1MNEA 3E2UA 3MP6A 1SHGA 4EMKB 2RH2A 4M77G 4C92B 4M7DC 4PJOC 2EKOA 4HCKA 5LJ5f 3P8DA 2CUBA 3E9FA 4DBFA 4NS5A 1PSFA 3URGA 3NHNA 1ACMB 1IO6A 2KROA 2MK5A 2YT6A 4D8KA 4J6YA 2ENMA 1VQ7A 2EJFA 1R0BG 4IIMA 4OMMA 2QTXA 2D0NA 2E12A 1OU8A 2EWNA 1B7TA 5FROA 4AFSC 3JB9H 2RM4A 4BE2A 2EQKA 2DE0X 3DB4A 2R57A 5LJ3h 1BKBA 1IHWA 3OYNA 2MF2A 2R5AA 2EGCA 2M16A 1YJWQ 1RUWA 1IHVA 2RPNA 1W4SA 1PKSA 2DXUA 1K8AC 1VQ4T 4BDYA 1VQ8T 4E6RA 1WHGA 2AKLA 3I35A 3FJPA 3CCUT 2ZPBB 1RAAB 1YN8A 5DY9A 1PD0A 2CYZB 3QYHB 1M2OA 2GBQA 3JCMc 2XDBA 3JCMV 5IXFA 1ABOA 2DMOA 4KGXB 4E7KA 4XU0A 1MMGA 2RMOA 4PLLA 4M7AE 2B86A 1H3HA 4XU2A 3HP9A 1RADB 2KT8A 5EC7A 3ZFJA 3OSSC 3QKJA 4D8DA 2DL5A 3CC2T 1UGRB 3NFCA 1AD5A 2D8HA 5KYWA 1B34B 2F2XA 1I0CA 4A54A 1MUZA 4DA4A 4QVZA 1K0XA 3A8GB 2PVGB 2FRWA 2YWWA 5KCOA 1JJ2P 4OMFB 1M3CA 5IHNA 1Q7YR 2HD0A 3WVDB 1VQ4A 4PJOG 4M7DG 1ZUKA 2OAWA 3CC4T 5KYUB 5HK3A 2EYZA 3RIRA 1N27A 5KCHA 1JRIA 4KBMB 3HRUA 5CCAA 1BI2A 2BKDN 1UECA 4QQGA 2DIQA 1XJWB 2GFAA 3SWNA 2V1RA 1K0SA 5KYNA 3JB9D 1DJ7B 1VYUA 1D3BB 1OPKA 3A5ZB 2E6ZA 2R58A 3HL8A 3OY9A 1B3QA 4PLIA 2K5FA 3REAB 1PC0A 2QASA 1NPRA 1QLYA 2GTOA 3V8KA 3DB3A 1VQLA 5GAOn 1YI2A 1I8FA 4IIOA 1FXXA 2RF0A 4XTXA 3CEYA 1QP3A 1OQKA 1M27C 2CGHA 2JT4A 2DTIA 1PWTA 4PJLA 3QPHA 3FEOA 2DFUA 4M77A 1M1KU 4M77F 5LJ5g 3C95A 2KYBA 2LMJA 1G83A 2K6DA 4HA8A 3R6NA 2NUPA 5D6XA 4OMLA 2A37A 3JCMh 1UFFA 3CXCA 1VQPA 1U1SA 1YHQA 4JDSA 1VQNA 1YIJA 3CCQA 2HNIA 3HPWA 5GAN3 1KHCA 1AVZC 1M90U 3LYIA 3BFMA 1MMAA 5I21A 1NLPC 1YBYA 1U5SA 3QXEB 5AYFA 4XTWA 2CDTA 1UUEA 3L2ZA 4ZGDB 1VYVA 1Q81R 1M3AA 1ZBJA 3G4SQ 2RI5A 3CCRA 2ROTA 1I81A 1SPKA 4B6MA 3OSVA 4M75D 3E1SA 4XTZA 2HCKA 3CCVQ 4A4EA 3DLLA 2O01E 2VUBA 4J9EA 1M3BA 3CQTA 1NLOC 3I55Q 4CRIA 2ZPEB 3E19A 1IGQA 4C0GA 2O4XA 4X9CA 3CCSA 2X4XA 2FPFA 2RB6A 3U23A 4BACA 3PVQA 3NTHA 2EAYA 2K7AA 1IXDA 3VRZA 3RNJA 4FSXA 3G71Q 2RI3A 1T0JA 1H641 1KSWA 2VKNA 3MHXA 1VQMT 1QVFA 1N8RC 4HCCA 1KC8R 5GJWB 5CQXA 4RTTA 1HK9A 2DBKA 1XNIA 5HY6A 2VV5A 4ME7A 4LUDA 2J05A 1EZZB 5CO7A 3RKXA 1S72A 2HDAA 3GF5A 1VQ6A 1EX4A 4EMKA 1VQ9T 4C92A 2DM1A 2DRMA 3MKDA 4DOWA 4BB7A 3CCLT 2QQAA 4PJOF 4M7DF 2DYBA 3TSZA 4OF1A 2K3XA 3PTAA 2X4WA 3CC7Q 3EGXB 3CMAT 3PIPA 4Z8AA 2F69A 1OI1A 1X6OA 3L42A 2LP5A 3FRNA 3FB9A 1BI0A 1VQOQ 3M58A 4CI0C 1VQKQ 3CD6A 1H92A 3QZ9B 2V8JA 3V7SA 2XDDA 2DPPB 1WJQA 4JUVA 4OB0B 2XD0A 3M4YA 3V8LA 2CSQA 1VIFA 2PNIA 2E6NA 3J81E 1RI9A 1Y07A 2VVKA 3R6OA 3D7SB 1VIEA 1WJSA 3CCRQ 5KE3A 1IB8A 1ZBXA 1BK2A 2JTMA 1X43A 2XI9A 4IUUA 2KVQG 2F2WA 3QDFA 1QVGA 3HSBA 2L3SA 2QDYB 2QAZA 2CH4A 2KT1A 3QIIA 2DL4A 4C5GA 2LDMA 1VQ9A 2YRCA 2L0AA 4ORZA 2VYTA 4N0AA 1LPLA 1OOTA 3NTIA 4C8QD 1OU9A 1TH7A 5GAMe 2CP6A 4E7SA 1X2QA 3OB9A 4J8OA 2RHIA 3UATA 1OX8A 2LCLA 3LH0A 3H6ZA 4GLKA 4ELZC 4N4GA 3UPUA 2K3BA 3G6EQ 1ZX6A 2CS7A 4M75C 5FRMA 2IG0A 4O6JA 1IRXA 2DJZA 4J9BA 4PFPA 4RKUE 4XTVA 1XQHA 1UTIA 1TS9A 3M55A 2QA4T 2OTJQ 4M75B 3MP8A 1JB0E 1K73C 2DYIA 1B34A 3J7AF 1SSHA 1OZ2A 3I5RA 3H9NA 2DAQA 1YJ9T 3CCEQ 1AZEA 4L59A 5CQYA 2M0OA 5CR2A 3CXCS 1FMWA 2GNCA 3OYCA 3BDUA 5CKEA 4C92D 2O9SA 2H3EB 5KYUA 4RTWA 2CZ0B 4GBQA 5L23A 4LDXA 2VWFA 3JB9G 4J9FA 3JCMg 1HJDA 2KR3A 5IH2A 3LX7A 2FO0A 2KXDA 3BY7A 4AG1C 3IQLA 2HKQB 1UGQB 4ZGEB 9ATCB 1D3BA 3GNFB 2ZZDA 4ZTFA 5CKDA 1XOVA 4M78D 1WZOA 2I0NA 3QWYA 5LJ3j 1X75C 3WVEB 3EG0A 4MZPA 2EVRA 5A0LA 3TQ7P 2ED1A 1YJNA 4E7HA 2COZA 1NJIR 2QQ9A 4AFQC 1K1ZA 1PRMC 4FW2A 4PFZA 3PT9A 1T0HA 1Q82U 2GTJA 3JCMd 1JXOA 1WXBA 3JCMX 4J9IA 2ATCB 1FMVA 1KQ2A 2JZ2A 5D7UA 3CPFA 3TREA 1MMDA 2QI2A 2DNUA 1JBMA 1YJWT 4IUVA 3PMTA 3LLRA 2CT3A 3M53A 4M7DE 4PJOE 1QVFS 1AT1B 2DL8A 1NEBA 3H8ZA 5GAMj 2H3JA 4V2SA 4XTYA 4Z02A 1M4ZA 3UDCA 5EG2A 1KJWA 5GMKm 3E9GA 3F70A 1QWFA 1VA7A 4M75G 4Y92A 4FL6A 1WNLA 3RUXA 1M1KC 1VQ5A 4J6WA 3M0RA 2LQNA 3CBMA 2CP2A 4LUEA 1WHKA 5I22A 3V8JA 1TTHB 1S1NA 2RA2A 4Y28E 2OI3A 3CMEA 1YITT 4J83A 4C8QC 1Y0MA 1XTDA 3L2RA 2OJ2A 1KD1R 1AWOA 2NLUA 1KQSS 4C8QB 1M90C 5CIUA 2LX7A 2ZAEA 3RDVA 2OTLQ 1QKXA 4C5HA 4MMKA 2KI7A 4MDWA 2WSEE 2A7YA 2KNBB 3JCMJ 8AT1B 3EAEA 4UC4A 2KY9A 2C0OA 3RMQA 1Z9ZA 3JB9J 2DJQA 2HL5C 2HQHA 4EMGA 5KE2A 2CP7A 1YJNQ 3JCMP 1X27A 4VUBA 1QVGS 2QQSA 2LQWA 1WHJA 2LT4A 3QBYA 3CCMQ 1JQQA 5A2QE 2DILA 2MAMA 2IVWA 3L2QA 3EHQA 5C6SA 2E3HA 1BCMA 2FZKB 4KGVB 2MPXC 2XU8A 3L2WA 2XKOC 4C92C 2NWMA 4D6WA 1WHLA 2A08A 2HSEB 3VV0A 1NPPA 2NUZA 4PNOA 3UA7A 1YITA 4BD3A 2KRMA 4OMNA 5GAN7 2O2OA 2E5QA 1N5ZA 1T3SA 4BUGA 3QHSA 1BCOA 3NGPA 1ABQA 1PD1A 4M78C 3MEUA 3RESA 4QVCA 3EGXA 3PGGA 1Q7YU 3JB9F 1B07A 1TG0A 4M78B 5A0DA 1D0YA 3A8HB 4OMPA 1MV3A 4KULA 4OB2B 1CSKA 4JRQA 1E6GA 4J5YA 2QEXA 4Z88A 5J39A 4RCCA 1C6VX 1TUCA 2RK1A 1VQ5Q 1V1CA 1AOJA 2ED0A 1WX6A 4FM4B 1PG5B 2Y4XA 1YNZA 2VXEA 3CPWS 5CKFA 3I56Q 2KDSA 1G8XA 1OV3A 4LD9K 1UDLA 1ZSZC 3OYJA 2HAXA 4OB3B 4CC3A 1V29B 2RJEA 1G3SA 1ZSZB 2J06A 1W2BA 2IPOB 4RTYA 4N0AC 3QJ6A 4C8QG 1E7OA 3SD4A 1WQWA 1WQ7A 5GANe 5ECAA 1NG2A 3EGDB 3G4ST 5LL6S 4IUPA 3CCVT 2RQRA 3OYAA 4FU6A 3GP8A 2YLBA 2K3YA 4CC4B 2JUFA 3HRSA 3MCAB 1MV0B 2C0TA 3X24B 1BYMA 5GAMh 3FIFA 3FC3A 5LJ3f 4DOVA 2P0PA 4ESRA 2WACA 3META 4KT0E 1SEMA 4M75A 4M75F 4NL2A 3G71T 3QWXX 3GPLA 1M1FA 4AMCA 4RMOA 4C92G 3TEEA 4A53A 1SKUB 5GAOl 1J3TA 4PKCC 1VQ8A 4F7UB 1WHMA 4KUIA 2CREA 5GMKi 3JCMQ 1Q81U 1AWWA 2E5KA 2FG0A 3CCUA 2YUQA 1JO8A 1HXDA 2IIMA 2CT4A 1KK7A 1VQ7Q 2DO3A 2JN0A 1FYNA 4NOYA 2YXYA 3UT1A 1E6HA 2YUNA 4M78G 2XICA 3KUFA 2HEQA 3TU4K 3RBBB 4KUDK 2RQTA 5FRNA 4N4HA 2M1HA 2X3XD 1NYGA 4J9DA 1PHTA 3V7CA 3RMSA 1TSFA 3VYHB 5GAN2 2HMAA 2HQXA 1BU1A 4OB1B 2DEUA 1Z9QA 4EMHA 4J6XA 3MEAA 2ZPIB 1YWOA 3X25B 3CC7T 1PSEA 3CXCP 1UHFA 2VASA 1VOMA 3CC2A 4JPBW 2RI2A 4HXJA 1VQKT 3S3OA 1WLPB 2SRCA 3RKYA 1OX9A 1HSQA 4PL6A 2DRKA 2HQEA 2DZCA 1KC8U 2BZXA 4LDUA 2RHXA 1M2VB 2LQKA 2KMTA 4O5VA 1PRLC 3GBQA 1SRLA 3VJPA 1G5VA 3P8HA 3CC4A 2LVMA 2XIDA 1K4US 1LVKA 2ZPHB 1EFNA 1D0ZA 3EG1A 4ZGJB 8ATCB 3PVLA 2X51A 3C0CA 1UHCA 2EW3A 5KYXB 1SRMA 1X6GA 4RTUA 4M7AC 1Y7XA 1Q82C 5GAN4 1PKTA 1MMNA 3VS3A 4EPCA 2Y4YA 3LGLA 4ANJA 4M7AB 2EKHA 3VUZA 2EQUA 6AT1B 2MYSA 1K9AA 2I2LA 1JU5C 2HL3A 3C4SA 2LCCA 2CZ7B 1V76A 2K57A 1WYXA 1VQ4Q 2EGEA 3G6ET 3EG9B 5IN1A 1QVFP 3EFSA 2F5TX 5HK0A 1KIKA 1GCQA 3OQ5A 3OYDA 3A8LB 4JJBA 1I07A 2OTJT 4WCIA 1X2KA 4C8QA 1Q86R 3JCMf 4C8QF 1X6BA 2QG9B 3EG3A 1NE8A 2DD4A 3HHTB 1RAIB 3EH1A 5LJ5e 2AZVA 3LH5A 4E7IA 3S3NA 1R0CB 4JLIA 5KH6A 3ASKA 4FCYA 2DLPA 2KSSA 2L3QA 1MNDA 1K9MU 1VQLQ 1YI2Q 2C0IA 3ULRB 3VU3C 2EIFA 1SG5A 3NTKA 2J7IA 4GLMA 5LJ3g 1OEBA 1W2BS 1JXMA 2VGNA 4B9WA 2LJ1A 1YP5A 3JCMW 2DZ9A 4OVAA 3I9QA 4KGZB 1IREB 2QTVA 5L8RE 2A0FB 3OYBA 1OPLA 1IZ6A 4M75E 1D09B 2FB7A 2DL3A 2EYYA 2JMCA 2JS0A 4C92F 5IHKA 2D6FA 3WXMB 2YRVA 2LZ6B 3HRTA 1Q95G 3OYKA 1I5OB 2JMAA 4K11A 3NPFA 4X9DA 5LJ3d 1VQPQ 1YHQQ 3SFMA 3VS7A 3CCJT 1YIJQ 1VQNQ 3QUIA 1QVGP 3CCQQ 4F04B 2BE7D 4RTVA 3JB9I 4FT2A 1WXTA 1KQSA 4M78A 4XU1A 1K76A 5GAMg 4M78F 7AT1B 5FU6C 2RHZA 4MZTA 3ME9A 2L5QA 4CC2A 2L3PA 2ZGWA 3RERA 5FU6B 5KYYB 1VQMA 2CZ1B 2JTFA 2ZPFB 5HCKA 2L8DA 3X28B 1GCPA 2LRQA 1Q7YC 2RN8A 1ZSZA 3EFRA 2P4TA 3OYYA 5GAMd 1NJIU 5GMKe 2QQBA 1PNJA 1WIEA 1K9MR 2CP3A 3CCSQ 2FL7A 4R0KA 2ROLA 4M77E 2XG8D 4JS5A 3EGDA 2KBTA 2EBPA 3CCLA 2KGTA 3OMGA 5GANh 3A8OB 1QWEA 4PK4A 2GGRA 4JRKA 1ZHIA 2E4HA 1PCXA 1QCFA 4FYXB 3CMAA 3A1PA 2YHTA 2V26A 2QGGA 1N9RA 3QZ5B 2PZ1A 5D6YA 2JTEA 4FIBA 5FWCA 1N6AA 4OMOA 2KXCA 1TXQA 5FU7C 4KH0B 2OTLT 2FPEA 1RLPC 2DTHA 2ECZA 3RKWA 4PJNA 5FU7B 1LOJA 2ZCFB 1OYXA 2D9TA 2NUTB 2AHJB 2P0QA 1S72Q 2P84A 4C0FA 1VQ6Q 3G1JA 2MWPA 3KXTA 2HKNA 4AFZC 3AHUA 2V8IA 2PUOB 2O31A 1YCSB 3QJYA 3CCMT 4F7UA 3CPWA 2HZYA 2DBMA 3GIBA 1K8AR 2DXTA 4QQ6A 4RTZA 2XK0A 2RD1A 4JS4A 3CD6Q 2GF7A 1AWJA 2K79A 2PVDB 1KD1U 1UJ0A 1UGSB 2LX9A 3UWNA 4PJMA 1I1JA 1NYFA 3TCJA 5IXBA 3OYEA 1TUGB 1SSFA 2COYA 3JV3A 4N4IA 4ZNXA 1BIAA 1KG1A 1Q81C 1D1BA 1GBQA 3VS2A 4HT8A 2QA4A 2K2MA 2L89A 3OYFA 2PU9B 1RAFB 3M4GA 1AHJB 2Z0WA 4X1VA 1YJ9A 1VQ9Q 4IKFA 3M59A 1G2BA 2MOXA 1WGSA 2EQJA 2F5KA 2RJDA 1M2VA 4C92E 1OZ3A 5CAIA 1FWZA 2MCNA 4A4KA 2KK4A 4RG2A 1VUBA 2CZ6B 2BTTA 4LDYA 4F16A 1A0NB 4OP0A 2E10A 1N9SA 5KYXA 1YCYA 2DVEA 2AK5A 3M5AA 3SDZA 1ZSGA 2FRYA 4A4HA 4M78E 4DBHA 4M7AA 2DK3A 5DLQE 4M7AF 2LNVA 1YFNA 3S3MA 1KC8C 4J9GA 4IURA 3AT1B 4BE0A 3EG2A 2E3IA 4BY6B 4J9CA 4C5IA 1GCQC 3LGFA 3M0UA 3M57A 4FYVB 3C12A 2QQRA 3EG9A 5FW9A 3TSWA 1UE9A 2F1LA 5M9OA 2RNAA 3A98A 2M02A 1YJWA 2BUDA 4JZ3A 2D1XA 3QYGB 3SHWA 4A4GA 3S6WA 2BIVA 5A0GA 2P4RA 1W1FA 5LJ5h 4E47A 3OYGA 4BDZA 2LQ8A 2FZGB 3Q1JA 1VQ7T 3G7ZA 4LD6A 1H8KA 4RG8A 2V1QA 4RTXA 1ZUUA 3OW2A 4JZ4A 5CKBA 2KRSA 1UGVA 2LT1A 2E41A 2BE9B 3DKMA 1YJ9Q 4OGEA 1D0XA 1BBZA 2M9UA 2XMFA 4P5NA 1G3WA 4HVVA 2LJ3A 3DLMA 3PMIA 2CP0A 1K9MC 2A3LA 2YDLA 3P8BB 4LN2A 2H8HA 4LNPA 5GANg 2J6FA 5HKCA 2GQVA 3HTRA 4LDWA 2J6OA 1RL2A 4A4FA 3GOXA 1OULA 4E2FB 3M0SA 1W2BP 4RCBA 1M9SA 4M7DB 4PJOB 2DA9A 4CC7A 3LWIA 1W70A 3OS1A 1GL5A 2CH4W 2X9HA 4IUTA 1BIBA 4NL3A 5KYYA 4FT4A 1Y96B 4M7AD 1BI3A 2P0KA 2W10A 2JS2A 4DEXA 5GANd 1LNXA 3CMEQ 3THKA 1JEGA 1RAHB 1M8MA 2BZYA 1N8RR 2V8KA 2KYMA 2KE9A 1NEGA 5GMKh 3L2VA 2ABLA 4MZMA 4Z89A 1T3LA 1WI7A 5GAN6 2X4JA 1R8OB 3KFVA 2JXBA 1ARKA 2VGMA 4ATOA 1U8RA 4DEYA 3I55T 1K73U 2QYZA 2PQWA 1WFWA 4FYWB 4M4ZA 2DIGA 2HBPA 1AEYA 2EPDA 1M5Q1 1NJIC 5IAYA 1FX7A 1MHNA 3ZL7C 2NUTA 2G3RA 4J7FA 4BI8B 2KRNA 1UEBA 1VQLT 1P92A 1HD3A 2RHYA 4BI4A 1YI2T 5CKHA 2MWOA 1YITQ 1MGQA 2Y90A 2YLCA 2OAUA 2LJ0A 3JSCA 3OYLA 3G4SA 2DEQA 2JVVA 2DETA 3VS1A 5GAMf 3CCVA 2D0QB 4LE9A 4OMQA 4WTOB 1RAEB 2QEXQ 4Q5WA 1Q86U 2JM8A 5I2SA 1VQPT 3I55A 1YHQT 3MEVA 3PNWC 5GMKl 2YSQA 2RHUA 3BDLA 1VQNT 1YIJT 2JJ9A 3LW5E 3CCQT 2DX1A 2NYSA 1KHIA 1VQOT 4XQ3A 3UF4A 3G71A 2L2PA 1QW1A 2RQVA 1JJ2A 3OS0A 2VC8A 2VXFA 1NM7A 4A63B 2K2VA 4JRIA 4YTLA 4R56A 1KD1C 2KAFA 4J9HA 3CCRT 1KFZA 1K73R 3FJ5A 5GANj 1GFDA 4RUGA 3OBYA 3KBGA 2CSIA 2PTKA 3OYHA 3H0HA 4F14A 2X4YA 3HFNA 4QW2A 3OW2S 1RACB 3CCST 1I4K1 4QKUA 4E7LA 2FHDA 2MI6A 2RJFA 2CP5A 2X35A 3EFOB 3CBPA 2G6FX 2CKKA 2JNGA 4FYYB 2SEMA 3CC7A 2OX7A 4C5EA 2DD5A 4BE1A 3QG1A 2A36A 2EJGA 2MMPA 2AT1B 1VQOA 1VQKA 1VQ8Q 3O8VA 1TU0B 4XK8E 4F7UG 1HYOA 4KH1B 2B8AA 2BZ8A 5LJ5d 3VRYA 3CCUQ 1ZA2B 2DXCA 2W0ZA 3BW1A 3OMCA 2LCSA 2PUKB 1S72T 4X34A 4AFUC 3M0TA 1VQ6T 2LNHB 4PJJA 3CCET 1YWPA 2K4YA 1QP2A 2EYXA 3OYMA 3OA6A 1AWXA 3OS2A 4AG2C 1SHFA 1R77A 1NBEB 3L1AA 4HT9A 3M56A 1RAGB 1QVPA 2MIOA 1WXUA 3CC2Q 2EFIA 3CD6T 1WPYA 4AT1B 1H3ZA 1G3YA 5I11A 3I5SA 1KQSP 5CK9A 3VYGA 4II1A 3L2UA 1RLQC 4E7ZA 2K5LA 4ZTJA 3TVTA 4QT7A 5FWBA 3G6EA 2EYQA 4ELYC 1M1KR 4LXCA 3CC4Q 2FZCB 2WSFE 1UJYA 2OTJA 2FYKA 2L3RA 4OGCA 5I2MA 2O88A 1FMKA 3UA6A 2DTOA 3RR6A 1LCKA 3CCEA 5GAN5 4PFOA 2GCXA 3JCMb 4XTUA 4HCBA 4M7AG 1M90R 3T9NA 4M7DA 4PJOA 5IHIA 2XHCA 4M77D 1ZLMA 1AZGB 1K8AU 3M9QA 3O5ZA 3ZEHA 4ZN1A 2O9VA 4JJDA 2YUPA 1EIFA 3C94A 1Y96A 2RQWA 3V7RA 1ZA1B 1GXIE 4JLGA 4ZN3A 1SF9A 2CUDA 3MEWA 4J7IA 5LJ3e 1X01A 5GAOq 1UG1A 2F2VA 2HSPA 3OYIA 2AKKA 2DERA 2J6KA 3J80E 2R5MA 1U3OA 2M51A 3MPUB 1GBRA 2DXBA 2RK2A 4EIKA 4C0DC 5GJVB 2A28A 2HBWA 2EYWA 3GNGA 2EQMA 1KQ1A 4C0DB 3M54A 4HVUA 5LJ5j 3PE0A 5GAOp 3CCJA 2E64A 3SB2A 3JAME 3CPWP 2FVUA 2PVOB 2XDPA 4TVRA 3H0IA 1QKWA 5IT9E 5FLXE 4IUQA 2JW4A 2E1HA 1LJOA 3BE3A 1JJ2S 3INZA 3X20B 2ZPGB 2GFUA 3ER0A 3MP1A 1Y71A 4C0ZA 4Y91A 4MDXA 1U1TA 3PFSA 3QSUA 1C1AA 1Y57A 3LWHA 5GAN8 2COWA 5AT1B 2QDLA 1YJNT 3H0FA 3EHRA 1WA7A 3N5BB 2QGFB 1ZUYA 4F7UF 3EGUA 5KYWB 2ESWA 4DQ2A 2YUOA 5CVIA 5GANf 5GAOr 3SEMA 2QXFA 1GRIA 1X69A 4C8QE 3FDRA 3QDRB 5J3BA 2FEIA 1O9SA 2AIRB
chains in the Genus database with same CATH topology
3CBOA 1VQMT 1QVFA 1HXDA 3OW2A 1N8RC 4HCCA 5CKBA 2DO3A 5CQXA 2JN0A 5DM7R 2LT1A 2E41A 4NOYA 1HK9A 3DKMA 3UT1A 4OGEA 1XNIA 4M78G 2XICA 5HY6A 3KUFA 2VV5A 4HCZA 3SWNC 3TU4K 2M9UA 4ME7A 4JJNK 4KUDK 4P5NA 5CO7A 5FRNA 4N4HA 1G3TA 2M1HA 3RKXA 4M7DD 4PJOD 3V7CA 1G3WA 3RMSA 1S72A 4QQDA 3VYHB 2OTLA 5GAN2 3SWNB 3DLMA 3GF5A 3PMIA 2HQXA 1VQ6A 4OB1B 1K9MC 4EMKA 4JRPA 2A3LA 4C92A 1VQ9T 4EMHA 4J6XA 3VKIA 1ZQ1A 3MEAA 3P8BB 2ZPIB 4DOWA 3X25B 3CC7T 1PSEA 4BB7A 5GANg 5HKCA 1RI0A 2GQVA 3CCLT 2LTOA 2QQAA 4LDWA 1RL2A 4A4FA 3GOXA 4PJOF 3X26B 3CC2A 4M7DF 2RI2A 2RO0A 3S3OA 1VQKT 4OF1A 2K3XA 4RCBA 1VQ5T 3PTAA 1M9SA 2X4WA 3RKYA 4EDUA 4M7DB 4PJOB 3CMAT 4PL6A 5GMKj 3PIPA 2LC4A 3HKSA 2HQEA 3MO8A 2F69A 3HFOA 1OI1A 3I56T 3LWIA 3CCMA 1X6OA 3L42A 3OS1A 1Q86C 2DZCA 3FRNA 1KC8U 3FB9A 4IUTA 1BI0A 3CD6A 3M58A 1BIBA 4LDUA 4CI0C 4XAXB 2RHXA 2EJ9A 3QZ9B 2V8JA 3V7SA 5GAOm 4NL3A 4FT4A 2XDDA 2DPPB 4M77C 1Y96B 1WJQA 4JUVA 4M7AD 2LQKA 1BI3A 2KMTA 4O5VA 4OB0B 2P0KA 2XD0A 3M4YA 1UB4A 3V8LA 3VJPA 3OS5A 5DLOA 1G5VA 3P8HA 1VIFA 4M77B 2E6NA 3J81E 3CC4A 2LVMA 2XIDA 5GANd 1LNXA 1Y07A 3R6OA 2ZPHB 1VIEA 4ZGJB 3JCMe 1WJSA 4L6V5 5KE3A 1ZBXA 2V8KA 4M7AC 2JTMA 1Y7XA 1Q82C 4BY6C 5GAN4 2XI9A 4BI3A 4IUUA 2KVQG 4EPCA 2Y4YA 4R55A 1BI1A 2JOYA 3LGLA 1QVGA 4M7AB 3VUBA 3HSBA 2QDYB 3QIIA 5GMKh 4QVDA 4C5GA 3VUZA 2E65A 2LDMA 3L2VA 2EQUA 3PIOA 1VQ9A 4MZMA 1WJRA 2I2LA 5GAN6 2VYTA 2X4JA 1R8OB 2RJCA 4N0AA 3C4SA 2LCCA 2CZ7B 4B9XA 1M8VA 2VGMA 4ATOA 1U8RA 3NTIA 4C8QD 3I55T 2K57A 1TH7A 1K73U 5GAMe 2PQWA 3G6ET 5C0MA 3A8MB 3OB9A 5IN1A 4J8OA 3EFSA 2F5TX 5HK0A 2RHIA 2E70A 3OQ5A 5J26A 3I56A 2LCLA 3LH0A 2DIGA 2HBPA 3A8LB 3H6ZA 4GLKA 3OYDA 1M5Q1 4ELZC 2KQWA 4N4GA 1NJIC 2OTJT 3OBWA 5IAYA 1NZ9A 3UPUA 1FX7A 1N8RU 1MHNA 4C8QA 3JCMf 4C8QF 2CS7A 4WF2A 5D6WA 1I5LA 4M75C 5FRMA 1NE8A 2IG0A 2G3RA 4J7FA 4O6JA 4BI8B 2DJZA 2DD4A 4XTVA 4RKUE 3HHTB 1UEBA 1XQHA 1O75A 3M55A 1VQLT 2QA4T 1P92A 4M75B 2RHYA 2O4XB 4BI4A 5CKHA 3MP8A 1JB0E 5LJ5e 1YI2T 1K73C 4E7IA 1B34A 2MWOA 3S3NA 3J7AF 4L5GA 1MGQA 4JLIA 5KH6A 3ASKA 2KSSA 2Y90A 4E7JA 1OZ2A 4XU3A 2YLCA 2DAQA 1YJ9T 1K9MU 2WSCE 4L59A 2OAUA 5CQYA 2M0OA 5CR2A 3CXCS 3QO3A 1M1GA 3VU3C 2EIFA 3JSCA 3NTKA 3OYCA 2QEXT 3OYLA 5LJ3g 1W2BS 2VGNA 4B9WA 3G4SA 3BDUA 3FLGA 5CKEA 1UGPB 4C92D 2DEQA 2JVVA 3JRZA 2C06A 2CZ0B 4LDXA 3ZBDA 3JCMW 2DZ9A 4OVAA 2D0QB 4LDVA 5GAMf 3GLXA 3CCVA 3JB9G 1IREB 2DKGA 2K5IA 5L8RE 3JCMg 3OYBA 1IZ6A 4MMLA 4HKEA 4M75E 4Q5WA 1Q86U 2FB7A 3LX7A 5I2SA 1VQPT 4F7UE 3BY7A 3I55A 1YHQT 4EMKC 4C92F 3MEVA 3PNWC 5GMKl 1UGQB 4GY5A 2D6FA 4ZGEB 2RHUA 3BDLA 3WXMB 1D3BA 1YIJT 1VQNT 3GNFB 2YRVA 3LW5E 3MP6A 2ZZDA 3CCQT 4ZTFA 5CKDA 1XOVA 2RH2A 3HRTA 4M77G 4EMKB 4C92B 1KHIA 4M78D 5LJ3j 2EKOA 4M7DC 3OYKA 1X75C 3WVEB 4PJOC 1VQOT 4MZPA 4X9DA 5LJ3d 5LJ5f 3P8DA 4XQ3A 5A0LA 3E9FA 1YJNA 4E7HA 3SFMA 4NS5A 1PSFA 2QQ9A 3CCJT 3G71A 3QUIA 3URGA 1QW1A 1JJ2A 3OS0A 2VC8A 3PT9A 1Q82U 2VXFA 3JCMd 3JB9I 4FT2A 1KQSA 4M78A 2K2VA 4JRIA 4XU1A 4YTLA 5GAMg 4M78F 4R56A 1KD1C 2KAFA 3CCRT 4J6YA 5FU6C 2RHZA 1VQ7A 4MZTA 3ME9A 3JCMX 2L5QA 2EJFA 2QTXA 5GANj 1KQ2A 2ZGWA 2JZ2A 3RERA 5FU6B 3CPFA 3TREA 3OBYA 2E12A 3KBGA 1VQMA 2QI2A 1JBMA 1YJWT 2EWNA 2CZ1B 4IUVA 5FROA 3OYHA 3JB9H 2RM4A 3PMTA 4BE2A 2JTFA 2EQKA 3LLRA 2ZPFB 3DB4A 2X4YA 2R57A 3HFNA 3M53A 4QW2A 5LJ3h 1QVFS 3OW2S 1BKBA 2L8DA 4M7DE 4PJOE 3OYNA 3X28B 2MF2A 2R5AA 3CCST 2M16A 1I4K1 4E7LA 2LRQA 3H8ZA 2FHDA 5GAMj 2MI6A 2RJFA 2H3JA 3EFRA 1W4SA 1Q7YC 3OYAA 2P4TA 3OYYA 5GAMd 2X35A 4V2SA 2DXUA 4XTYA 3GP8A 1NJIU 3CBPA 1K8AC 5GMKe 2QQBA 1VQ4T 4Z02A 4BDYA 1M4ZA 1VQ8T 2CKKA 3UDCA 5EG2A 2FL7A 2JNGA 5GMKm 3E9GA 3F70A 2XG8D 4M77E 3CC7A 4C5EA 2DD5A 4JS5A 3FJPA 3CCLA 3CCUT 2ZPBB 4BE1A 3QG1A 2EJGA 5DY9A 2MMPA 3OMGA 4M75G 1Q81U 5GANh 2CYZB 3A8OB 4FL6A 1WNLA 3QYHB 3RUXA 1VQOA 1M1KC 1VQKA 4JRKA 3O8VA 4J6WA 1VQ5A 4XK8E 1ZHIA 3JCMc 4F7UG 2XDBA 3JCMV 3CBMA 2B8AA 3CMAA 5LJ5d 4E7KA 4XU0A 2YHTA 2DXCA 3BW1A 3V8JA 3QZ5B 1N9RA 4PLLA 2RA2A 5D6YA 4M7AE 4FIBA 4Y28E 3OMCA 1N6AA 3CMEA 2PUKB 4XU2A 3HP9A 5FU7C 4X34A 1S72T 1YITT 2OTLT 4J83A 4C8QC 1VQ6T 1XTDA 2DTHA 3L2RA 3CCET 3RKWA 2NLUA 5FU7B 1LOJA 2K4YA 1KQSS 1QP2A 2ZCFB 4C8QB 3OYMA 3OA6A 1OYXA 5CIUA 3ZFJA 3OSSC 2D9TA 1M90C 2AHJB 2P0QA 3QKJA 3OS2A 4C0FA 4C5HA 4MMKA 3CC2T 4MDWA 1UGRB 2MWPA 2WSEE 3NFCA 3KXTA 2A7YA 3L1AA 3AHUA 1B34B 2V8IA 3M56A 3JCMJ 4HT9A 1QVPA 2PUOB 3EAEA 4UC4A 2KY9A 3QJYA 3CCMT 3RMQA 4F7UA 4A54A 4DA4A 3JB9J 3CPWA 2EFIA 4QVZA 3A8GB 4EMGA 1WPYA 3CD6T 2PVGB 5KCOA 4OMFB 5KE2A 3GIBA 3JCMP 1H3ZA 1G3YA 2HD0A 4VUBA 3WVDB 1VQ4A 2QQSA 1QVGS 2DXTA 4PJOG 4M7DG 4QQ6A 2LT4A 3QBYA 5CK9A 2XK0A 3VYGA 2RD1A 5A2QE 4JS4A 2MAMA 4II1A 3CC4T 2IVWA 3L2QA 3L2UA 5HK3A 3RIRA 2GF7A 2K5LA 1N27A 5C6SA 4ZTJA 5KCHA 3L2WA 1JRIA 2XU8A 2XKOC 4KBMB 2PVDB 3HRUA 4C92C 1BI2A 5CCAA 1KD1U 2BKDN 3G6EA 2EYQA 4QQGA 4ELYC 4D6WA 2DIQA 1UGSB 2LX9A 3UWNA 2GFAA 3SWNA 3VV0A 3TCJA 2WSFE 1NPPA 2OTJA 3OYEA 2FYKA 3JB9D 2L3RA 1DJ7B 3A5ZB 1D3BB 1SSFA 4OGCA 4PNOA 5I2MA 2E6ZA 4N4IA 2R58A 4BD3A 1YITA 3HL8A 3OY9A 1BIAA 2DTOA 4PLIA 2K5FA 1KG1A 5GAN7 2E5QA 1Q81C 3CCEA 5GAN5 1NPRA 3V8KA 4BUGA 2GCXA 4HT8A 3QHSA 3DB3A 1VQLA 2QA4A 3JCMb 5GAOn 1YI2A 1I8FA 2L89A 4XTUA 4HCBA 3OYFA 4M78C 4M7AG 3MEUA 1FXXA 3RESA 3T9NA 4QVCA 4XTXA 4M7DA 3PGGA 3CEYA 1Q7YU 1QP3A 2XHCA 2PU9B 3JB9F 4PJOA 4M77D 3M4GA 1K8AU 3M9QA 1AHJB 1YJ9A 2CGHA 4M78B 5A0DA 3ZEHA 4ZN1A 4IKFA 2DTIA 3M59A 3A8HB 1WGSA 4KULA 2EQJA 4OB2B 3QPHA 2F5KA 2RJDA 1EIFA 3C94A 1Y96A 4C92E 4JRQA 1OZ3A 4J5YA 5CAIA 2QEXA 1FWZA 3V7RA 5J39A 4A4KA 4RCCA 2KK4A 1GXIE 3FEOA 4JLGA 2RK1A 4RG2A 1VUBA 4ZN3A 2CZ6B 4M77A 1M1KU 4M77F 5LJ5g 3MEWA 3C95A 4FM4B 2Y4XA 4J7IA 4LDYA 5LJ3e 2VXEA 1X01A 4HA8A 5GAOq 4OP0A 5CKFA 2E10A 1N9SA 2KDSA 3CPWS 5D6XA 3OYIA 4LD9K 1YCYA 2DVEA 3OYJA 3JCMh 2HAXA 3M5AA 3SDZA 3CXCA 4OB3B 3J80E 2R5MA 1VQPA 1V29B 2RJEA 1G3SA 1U1SA 1YHQA 4A4HA 4JDSA 4M78E 4M7AA 1W2BA 2DK3A 5DLQE 1YIJA 1VQNA 2DXBA 4M7AF 2RK2A 2LNVA 3CCQA 4C0DC 2HNIA 4N0AC 3HPWA 3QJ6A 3S3MA 5GAN3 4C8QG 1KC8C 1KHCA 1M90U 4IURA 3LYIA 3SD4A 1WQWA 3BFMA 3GNGA 4BE0A 2EQMA 1KQ1A 1WQ7A 5GANe 4C0DB 5I21A 3M54A 4BY6B 3G4ST 5LJ5j 1YBYA 5LL6S 5GAOp 3CCJA 2E64A 3QXEB 3SB2A 3JAME 4IUPA 4XTWA 5AYFA 4C5IA 3CCVT 3L2ZA 3LGFA 3M57A 4ZGDB 3C12A 2QQRA 2FVUA 4FU6A 2PVOB 2XDPA 2K3YA 2YLBA 2JUFA 3HRSA 4TVRA 3MCAB 5IT9E 5FLXE 4IUQA 2E1HA 1LJOA 2RI5A 3INZA 3CCRA 1JJ2S 3X20B 1I81A 2ZPGB 2GFUA 3ER0A 3MP1A 3X24B 1BYMA 1Y71A 5GAMh 3OSVA 4M75D 3E1SA 4XTZA 4C0ZA 4Y91A 4MDXA 4A4EA 3DLLA 2O01E 1U1TA 3FIFA 3FC3A 3PFSA 5LJ3f 5M9OA 2VUBA 3QSUA 4DOVA 1YJWA 2P0PA 3LWHA 5GAN8 2BUDA 2WACA 4CRIA 2ZPEB 3E19A 3META 3QYGB 4KT0E 4C0GA 1YJNT 4M75A 2O4XA 4M75F 4NL2A 3G71T 3N5BB 4A4GA 4X9CA 3S6WA 2BIVA 2X4XA 3CCSA 5A0GA 3CMET 2RB6A 3GPLA 1M1FA 5LJ5h 4RMOA 4F7UF 4C92G 3TEEA 4E47A 4A53A 3NTHA 2EAYA 3OYGA 5GAOl 4BACA 2LQ8A 4BDZA 4PKCC 4DQ2A 3Q1JA 1VQ7T 1VQ8A 4FSXA 5CVIA 5GANf 2RI3A 3G7ZA 4F7UB 5GAOr 4KUIA 1H641 2QXFA 4C8QE 5GMKi 3JCMQ 3FDRA 3QDRB 5J3BA 3MHXA 1O9SA 4LD6A 3CCUA 4RG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I8F A;  4XTU A;  5GAM j;  4M78 C;  1HXD A;  3EFR A;  1M5Q 1;  3RES A;  4QVC A;  4M7A G;  4XTX A;  5GAM d;  3PGG A;  4M7D A;  3JB9 F;  4PJO A;  4V2S A;  2DXU A;  4XTY A;  2JN0 A;  4M77 D;  4C8Q A;  3JCM f;  2E41 A;  5GMK e;  4NOY A;  4C8Q F;  1HK9 A;  3M4G A;  4WF2 A;  1I5L A;  4M75 C;  2CGH A;  4M78 B;  2DTI A;  4M78 G;  5GMK m;  2DJZ A;  4M77 E;  3SWN C;  4XTV A;  1Y96 A;  3FJP A;  4C92 E;  4J5Y A;  5CAI A;  4M75 B;  5LJ5 e;  4M7D D;  2EJG A;  3RKX A;  5DY9 A;  3V7R A;  4PJO D;  4M75 G;  3V7C A;  1B34 A;  4RCC A;  5GAN h;  5GAN 2;  1MGQ A;  1WNL A;  3RUX A;  4JLI A;  3SWN B;  4JRK A;  4M77 A;  4J6W A;  2Y90 A;  4EMK A;  4M77 F;  4XU3 A;  3JCM c;  4F7U G;  5LJ5 g;  4C92 A;  2YLC A;  3JCM V;  4EMH A;  4J6X A;  5LJ3 e;  2VXE A;  5LJ5 d;  1X01 A;  4XU0 A;  4HA8 A;  2YHT A;  3BW1 A;  3V8J A;  4OP0 A;  3QO3 A;  2E10 A;  1N9S A;  5GAN g;  1N9R A;  3VU3 C;  2RA2 A;  4M7A E;  5GAO q;  1YCY A;  2DVE A;  3JCM h;  5LJ3 g;  4PJO F;  4XU2 A;  4M7D F;  3BDU A;  4C8Q C;  4C92 D;  1U1S A;  4RCB A;  2DEQ A;  2DTH A;  4M78 E;  3RKW A;  3RKY A;  4M7A A;  3JCM W;  4M7D B;  2DZ9 A;  1LOJ A;  5GAM f;  4M7A F;  3JB9 G;  4PJO B;  5GMK j;  2DKG A;  3JCM g;  4C8Q B;  2HNI A;  4N0A C;  3HFO A;  5GAN 3;  4C8Q G;  4MML A;  2DZC A;  4M75 E;  3FB9 A;  1WQW A;  3BFM A;  1BIB A;  2FB7 A;  4MMK A;  1KQ1 A;  1WQ7 A;  2EJ9 A;  5GAN e;  3V7S A;  5I21 A;  5GAO m;  4NL3 A;  4M77 C;  5LJ5 j;  1Y96 B;  3BY7 A;  4F7U E;  4M7A D;  4JUV A;  4EMK C;  5GAO p;  4C92 F;  5GMK l;  2E64 A;  3L1A A;  3AHU A;  1B34 B;  3V8L A;  3SB2 A;  3JCM J;  4HT9 A;  4XTW A;  1D3B A;  3L2Z A;  4M77 B;  2YLB A;  4EMK B;  5GAN d;  4M77 G;  1LNX A;  4C92 B;  4M78 D;  4F7U A;  4A54 A;  5LJ3 j;  5GAO n;  4M7D C;  3JB9 J;  4PJO C;  3JCM e;  2E1H A;  1LJO A;  4X9D A;  3INZ A;  1WPY A;  5LJ3 d;  4XQ3 A;  4EMG A;  1I81 A;  5LJ5 f;  5GAM h;  3GIB A;  3JCM P;  4M75 D;  3QHS A;  4XTZ A;  3QUI A;  2DXT A;  4Y91 A;  4PJO G;  4M7A C;  4M7D G;  1U1T A;  5GAN 4;  2VC8 A;  3FIF A;  2RD1 A;  5LJ3 f;  2VXF A;  3JCM d;  3QSU A;  3JB9 I;  4M78 A;  4XU1 A;  4JRI A;  4M7A B;  3RIR A;  5GAM g;  5GAN 8;  4M78 F;  3HSB A;  1JRI A;  4J6Y A;  5GMK h;  4QVD A;  4C92 C;  2E65 A;  3JCM X;  2EJF A;  4M75 A;  4M75 F;  4NL2 A;  2QTX A;  5GAN j;  1KQ2 A;  4X9C A;  2ZGW A;  3RER A;  3SWN A;  2I2L A;  2RB6 A;  5GAN 6;  5LJ5 h;  4F7U F;  4N0A A;  4C92 G;  1JBM A;  2EWN A;  2FYK A;  2EAY A;  4A53 A;  5GAO l;  3JB9 D;  1M8V A;  1D3B B;  3JB9 H;  2RM4 A;  4PNO A;  4DQ2 A;  4C8Q D;  2K57 A;  1TH7 A;  1BIA A;  2DTO A;  5GAM e;  5GAN f;  4F7U B;  3HFN A;  5GAO r;  4M7D E;  4PJO E;  5LJ3 h;  5GAN 7;  1H64 1;  4C8Q E;  5GMK i;  3JCM Q;  3EFS A;  5GAN 5;  3V8K A;  4HT8 A;  1I4K 1;  3JCM b; 
#chains in the Genus database with same CATH topology
 3CBO A;  1RAB B;  3REB B;  5DM7 R;  2QK0 A;  4FSS A;  2DVJ A;  3VS4 A;  4DBR A;  4HCZ A;  3SWN C;  1TUD A;  4JJN K;  1VQM Q;  2X3W D;  1G3T A;  4M7D D;  4PJO D;  4QQD A;  2OTL A;  3SWN B;  2M0Y A;  4JRP A;  4DBQ A;  4KRT A;  3VKI A;  1TOV A;  1ZQ1 A;  1TWB A;  1RI0 A;  2LTO A;  3X26 B;  3MJX A;  1QMC A;  2RO0 A;  1VQ5 T;  4JJC A;  3EH2 A;  2KEA A;  4EDU A;  3VS0 A;  5GMK j;  3CCL Q;  2LC4 A;  1GFC A;  3HKS A;  3MO8 A;  3I56 T;  3HFO A;  3CCM A;  4F17 A;  1Q86 C;  1WDX A;  2DF6 A;  3CME T;  4XAX B;  2GQI A;  2EJ9 A;  5GAO m;  1F1B B;  4M77 C;  3CCJ Q;  3CMA Q;  1QCN A;  1UB4 A;  2D8J A;  3OS5 A;  5DLO A;  2FPD A;  3VS5 A;  4M77 B;  2VB6 A;  1CKB A;  3JCM e;  4L6V 5;  2NUP B;  1IGU A;  1PM3 A;  1QQJ A;  3M0P A;  4BY6 C;  3EFO A;  4BI3 A;  4R55 A;  1BI1 A;  2JOY A;  3NMZ C;  3VUB A;  4QVD A;  2YRD A;  2E65 A;  2EGA A;  1BB9 A;  1D1A A;  3PIO A;  1WJR A;  2RJC A;  4B9X A;  1M8V A;  3VS6 A;  1C0M A;  2AZS A;  5C0M A;  3A8M B;  3OW2 P;  1M30 A;  2E70 A;  5J26 A;  3I56 A;  2DL7 A;  1U06 A;  2KQW A;  3OBW A;  1NZ9 A;  1N8R U;  5D6W A;  4WF2 A;  1I5L A;  1CKA A;  1O75 A;  4HVW A;  1WHH A;  2O4X B;  4L5G A;  1QCO A;  1W6X A;  4E7J A;  2RQU A;  4XU3 A;  2WSC E;  2QA4 Q;  2K9G A;  3QO3 A;  4FW1 A;  1M1G A;  3M0Q A;  1Q82 R;  2QEX T;  3FLG A;  1UGP B;  3JRZ A;  2C06 A;  1D1C A;  2EQI A;  3H41 A;  3ZBD A;  4LDV A;  3GLX A;  2DKG A;  2K5I A;  4MML A;  2JM9 A;  4HKE A;  4F7U E;  4EMK C;  4GY5 A;  1VYT A;  1MNE A;  3E2U A;  3MP6 A;  1SHG A;  4EMK B;  2RH2 A;  4M77 G;  4C92 B;  4M7D C;  4PJO C;  2EKO A;  4HCK A;  5LJ5 f;  3P8D A;  2CUB A;  3E9F A;  4DBF A;  4NS5 A;  1PSF A;  3URG A;  3NHN A;  1ACM B;  1IO6 A;  2KRO A;  2MK5 A;  2YT6 A;  4D8K A;  4J6Y A;  2ENM A;  1VQ7 A;  2EJF A;  1R0B G;  4IIM A;  4OMM A;  2QTX A;  2D0N A;  2E12 A;  1OU8 A;  2EWN A;  1B7T A;  5FRO A;  4AFS C;  3JB9 H;  2RM4 A;  4BE2 A;  2EQK A;  2DE0 X;  3DB4 A;  2R57 A;  5LJ3 h;  1BKB A;  1IHW A;  3OYN A;  2MF2 A;  2R5A A;  2EGC A;  2M16 A;  1YJW Q;  1RUW A;  1IHV A;  2RPN A;  1W4S A;  1PKS A;  2DXU A;  1K8A C;  1VQ4 T;  4BDY A;  1VQ8 T;  4E6R A;  1WHG A;  2AKL A;  3I35 A;  3FJP A;  3CCU T;  2ZPB B;  1RAA B;  1YN8 A;  5DY9 A;  1PD0 A;  2CYZ B;  3QYH B;  1M2O A;  2GBQ A;  3JCM c;  2XDB A;  3JCM V;  5IXF A;  1ABO A;  2DMO A;  4KGX B;  4E7K A;  4XU0 A;  1MMG A;  2RMO A;  4PLL A;  4M7A E;  2B86 A;  1H3H A;  4XU2 A;  3HP9 A;  1RAD B;  2KT8 A;  5EC7 A;  3ZFJ A;  3OSS C;  3QKJ A;  4D8D A;  2DL5 A;  3CC2 T;  1UGR B;  3NFC A;  1AD5 A;  2D8H A;  5KYW A;  1B34 B;  2F2X A;  1I0C A;  4A54 A;  1MUZ A;  4DA4 A;  4QVZ A;  1K0X A;  3A8G B;  2PVG B;  2FRW A;  2YWW A;  5KCO A;  1JJ2 P;  4OMF B;  1M3C A;  5IHN A;  1Q7Y R;  2HD0 A;  3WVD B;  1VQ4 A;  4PJO G;  4M7D G;  1ZUK A;  2OAW A;  3CC4 T;  5KYU B;  5HK3 A;  2EYZ A;  3RIR A;  1N27 A;  5KCH A;  1JRI A;  4KBM B;  3HRU A;  5CCA A;  1BI2 A;  2BKD N;  1UEC A;  4QQG A;  2DIQ A;  1XJW B;  2GFA A;  3SWN A;  2V1R A;  1K0S A;  5KYN A;  3JB9 D;  1DJ7 B;  1VYU A;  1D3B B;  1OPK A;  3A5Z B;  2E6Z A;  2R58 A;  3HL8 A;  3OY9 A;  1B3Q A;  4PLI A;  2K5F A;  3REA B;  1PC0 A;  2QAS A;  1NPR A;  1QLY A;  2GTO A;  3V8K A;  3DB3 A;  1VQL A;  5GAO n;  1YI2 A;  1I8F A;  4IIO A;  1FXX A;  2RF0 A;  4XTX A;  3CEY A;  1QP3 A;  1OQK A;  1M27 C;  2CGH A;  2JT4 A;  2DTI A;  1PWT A;  4PJL A;  3QPH A;  3FEO A;  2DFU A;  4M77 A;  1M1K U;  4M77 F;  5LJ5 g;  3C95 A;  2KYB A;  2LMJ A;  1G83 A;  2K6D A;  4HA8 A;  3R6N A;  2NUP A;  5D6X A;  4OML A;  2A37 A;  3JCM h;  1UFF A;  3CXC A;  1VQP A;  1U1S A;  1YHQ A;  4JDS A;  1VQN A;  1YIJ A;  3CCQ A;  2HNI A;  3HPW A;  5GAN 3;  1KHC A;  1AVZ C;  1M90 U;  3LYI A;  3BFM A;  1MMA A;  5I21 A;  1NLP C;  1YBY A;  1U5S A;  3QXE B;  5AYF A;  4XTW A;  2CDT A;  1UUE A;  3L2Z A;  4ZGD B;  1VYV A;  1Q81 R;  1M3A A;  1ZBJ A;  3G4S Q;  2RI5 A;  3CCR A;  2ROT A;  1I81 A;  1SPK A;  4B6M A;  3OSV A;  4M75 D;  3E1S A;  4XTZ A;  2HCK A;  3CCV Q;  4A4E A;  3DLL A;  2O01 E;  2VUB A;  4J9E A;  1M3B A;  3CQT A;  1NLO C;  3I55 Q;  4CRI A;  2ZPE B;  3E19 A;  1IGQ A;  4C0G A;  2O4X A;  4X9C A;  3CCS A;  2X4X A;  2FPF A;  2RB6 A;  3U23 A;  4BAC A;  3PVQ A;  3NTH A;  2EAY A;  2K7A A;  1IXD A;  3VRZ A;  3RNJ A;  4FSX A;  3G71 Q;  2RI3 A;  1T0J A;  1H64 1;  1KSW A;  2VKN A;  3MHX A;  1VQM T;  1QVF A;  1N8R C;  4HCC A;  1KC8 R;  5GJW B;  5CQX A;  4RTT A;  1HK9 A;  2DBK A;  1XNI A;  5HY6 A;  2VV5 A;  4ME7 A;  4LUD A;  2J05 A;  1EZZ B;  5CO7 A;  3RKX A;  1S72 A;  2HDA A;  3GF5 A;  1VQ6 A;  1EX4 A;  4EMK A;  1VQ9 T;  4C92 A;  2DM1 A;  2DRM A;  3MKD A;  4DOW A;  4BB7 A;  3CCL T;  2QQA A;  4PJO F;  4M7D F;  2DYB A;  3TSZ A;  4OF1 A;  2K3X A;  3PTA A;  2X4W A;  3CC7 Q;  3EGX B;  3CMA T;  3PIP A;  4Z8A A;  2F69 A;  1OI1 A;  1X6O A;  3L42 A;  2LP5 A;  3FRN A;  3FB9 A;  1BI0 A;  1VQO Q;  3M58 A;  4CI0 C;  1VQK Q;  3CD6 A;  1H92 A;  3QZ9 B;  2V8J A;  3V7S A;  2XDD A;  2DPP B;  1WJQ A;  4JUV A;  4OB0 B;  2XD0 A;  3M4Y A;  3V8L A;  2CSQ A;  1VIF A;  2PNI A;  2E6N A;  3J81 E;  1RI9 A;  1Y07 A;  2VVK A;  3R6O A;  3D7S B;  1VIE A;  1WJS A;  3CCR Q;  5KE3 A;  1IB8 A;  1ZBX A;  1BK2 A;  2JTM A;  1X43 A;  2XI9 A;  4IUU A;  2KVQ G;  2F2W A;  3QDF A;  1QVG A;  3HSB A;  2L3S A;  2QDY B;  2QAZ A;  2CH4 A;  2KT1 A;  3QII A;  2DL4 A;  4C5G A;  2LDM A;  1VQ9 A;  2YRC A;  2L0A A;  4ORZ A;  2VYT A;  4N0A A;  1LPL A;  1OOT A;  3NTI A;  4C8Q D;  1OU9 A;  1TH7 A;  5GAM e;  2CP6 A;  4E7S A;  1X2Q A;  3OB9 A;  4J8O A;  2RHI A;  3UAT A;  1OX8 A;  2LCL A;  3LH0 A;  3H6Z A;  4GLK A;  4ELZ C;  4N4G A;  3UPU A;  2K3B A;  3G6E Q;  1ZX6 A;  2CS7 A;  4M75 C;  5FRM A;  2IG0 A;  4O6J A;  1IRX A;  2DJZ A;  4J9B A;  4PFP A;  4RKU E;  4XTV A;  1XQH A;  1UTI A;  1TS9 A;  3M55 A;  2QA4 T;  2OTJ Q;  4M75 B;  3MP8 A;  1JB0 E;  1K73 C;  2DYI A;  1B34 A;  3J7A F;  1SSH A;  1OZ2 A;  3I5R A;  3H9N A;  2DAQ A;  1YJ9 T;  3CCE Q;  1AZE A;  4L59 A;  5CQY A;  2M0O A;  5CR2 A;  3CXC S;  1FMW A;  2GNC A;  3OYC A;  3BDU A;  5CKE A;  4C92 D;  2O9S A;  2H3E B;  5KYU A;  4RTW A;  2CZ0 B;  4GBQ A;  5L23 A;  4LDX A;  2VWF A;  3JB9 G;  4J9F A;  3JCM g;  1HJD A;  2KR3 A;  5IH2 A;  3LX7 A;  2FO0 A;  2KXD A;  3BY7 A;  4AG1 C;  3IQL A;  2HKQ B;  1UGQ B;  4ZGE B;  9ATC B;  1D3B A;  3GNF B;  2ZZD A;  4ZTF A;  5CKD A;  1XOV A;  4M78 D;  1WZO A;  2I0N A;  3QWY A;  5LJ3 j;  1X75 C;  3WVE B;  3EG0 A;  4MZP A;  2EVR A;  5A0L A;  3TQ7 P;  2ED1 A;  1YJN A;  4E7H A;  2COZ A;  1NJI R;  2QQ9 A;  4AFQ C;  1K1Z A;  1PRM C;  4FW2 A;  4PFZ A;  3PT9 A;  1T0H A;  1Q82 U;  2GTJ A;  3JCM d;  1JXO A;  1WXB A;  3JCM X;  4J9I A;  2ATC B;  1FMV A;  1KQ2 A;  2JZ2 A;  5D7U A;  3CPF A;  3TRE A;  1MMD A;  2QI2 A;  2DNU A;  1JBM A;  1YJW T;  4IUV A;  3PMT A;  3LLR A;  2CT3 A;  3M53 A;  4M7D E;  4PJO E;  1QVF S;  1AT1 B;  2DL8 A;  1NEB A;  3H8Z A;  5GAM j;  2H3J A;  4V2S A;  4XTY A;  4Z02 A;  1M4Z A;  3UDC A;  5EG2 A;  1KJW A;  5GMK m;  3E9G A;  3F70 A;  1QWF A;  1VA7 A;  4M75 G;  4Y92 A;  4FL6 A;  1WNL A;  3RUX A;  1M1K C;  1VQ5 A;  4J6W A;  3M0R A;  2LQN A;  3CBM A;  2CP2 A;  4LUE A;  1WHK A;  5I22 A;  3V8J A;  1TTH B;  1S1N A;  2RA2 A;  4Y28 E;  2OI3 A;  3CME A;  1YIT T;  4J83 A;  4C8Q C;  1Y0M A;  1XTD A;  3L2R A;  2OJ2 A;  1KD1 R;  1AWO A;  2NLU A;  1KQS S;  4C8Q B;  1M90 C;  5CIU A;  2LX7 A;  2ZAE A;  3RDV A;  2OTL Q;  1QKX A;  4C5H A;  4MMK A;  2KI7 A;  4MDW A;  2WSE E;  2A7Y A;  2KNB B;  3JCM J;  8AT1 B;  3EAE A;  4UC4 A;  2KY9 A;  2C0O A;  3RMQ A;  1Z9Z A;  3JB9 J;  2DJQ A;  2HL5 C;  2HQH A;  4EMG A;  5KE2 A;  2CP7 A;  1YJN Q;  3JCM P;  1X27 A;  4VUB A;  1QVG S;  2QQS A;  2LQW A;  1WHJ A;  2LT4 A;  3QBY A;  3CCM Q;  1JQQ A;  5A2Q E;  2DIL A;  2MAM A;  2IVW A;  3L2Q A;  3EHQ A;  5C6S A;  2E3H A;  1BCM A;  2FZK B;  4KGV B;  2MPX C;  2XU8 A;  3L2W A;  2XKO C;  4C92 C;  2NWM A;  4D6W A;  1WHL A;  2A08 A;  2HSE B;  3VV0 A;  1NPP A;  2NUZ A;  4PNO A;  3UA7 A;  1YIT A;  4BD3 A;  2KRM A;  4OMN A;  5GAN 7;  2O2O A;  2E5Q A;  1N5Z A;  1T3S A;  4BUG A;  3QHS A;  1BCO A;  3NGP A;  1ABQ A;  1PD1 A;  4M78 C;  3MEU A;  3RES A;  4QVC A;  3EGX A;  3PGG A;  1Q7Y U;  3JB9 F;  1B07 A;  1TG0 A;  4M78 B;  5A0D A;  1D0Y A;  3A8H B;  4OMP A;  1MV3 A;  4KUL A;  4OB2 B;  1CSK A;  4JRQ A;  1E6G A;  4J5Y A;  2QEX A;  4Z88 A;  5J39 A;  4RCC A;  1C6V X;  1TUC A;  2RK1 A;  1VQ5 Q;  1V1C A;  1AOJ A;  2ED0 A;  1WX6 A;  4FM4 B;  1PG5 B;  2Y4X A;  1YNZ A;  2VXE A;  3CPW S;  5CKF A;  3I56 Q;  2KDS A;  1G8X A;  1OV3 A;  4LD9 K;  1UDL A;  1ZSZ C;  3OYJ A;  2HAX A;  4OB3 B;  4CC3 A;  1V29 B;  2RJE A;  1G3S A;  1ZSZ B;  2J06 A;  1W2B A;  2IPO B;  4RTY A;  4N0A C;  3QJ6 A;  4C8Q G;  1E7O A;  3SD4 A;  1WQW A;  1WQ7 A;  5GAN e;  5ECA A;  1NG2 A;  3EGD B;  3G4S T;  5LL6 S;  4IUP A;  3CCV T;  2RQR A;  3OYA A;  4FU6 A;  3GP8 A;  2YLB A;  2K3Y A;  4CC4 B;  2JUF A;  3HRS A;  3MCA B;  1MV0 B;  2C0T A;  3X24 B;  1BYM A;  5GAM h;  3FIF A;  3FC3 A;  5LJ3 f;  4DOV A;  2P0P A;  4ESR A;  2WAC A;  3MET A;  4KT0 E;  1SEM A;  4M75 A;  4M75 F;  4NL2 A;  3G71 T;  3QWX X;  3GPL A;  1M1F A;  4AMC A;  4RMO A;  4C92 G;  3TEE A;  4A53 A;  1SKU B;  5GAO l;  1J3T A;  4PKC C;  1VQ8 A;  4F7U B;  1WHM A;  4KUI A;  2CRE A;  5GMK i;  3JCM Q;  1Q81 U;  1AWW A;  2E5K A;  2FG0 A;  3CCU A;  2YUQ A;  1JO8 A;  1HXD A;  2IIM A;  2CT4 A;  1KK7 A;  1VQ7 Q;  2DO3 A;  2JN0 A;  1FYN A;  4NOY A;  2YXY A;  3UT1 A;  1E6H A;  2YUN A;  4M78 G;  2XIC A;  3KUF A;  2HEQ A;  3TU4 K;  3RBB B;  4KUD K;  2RQT A;  5FRN A;  4N4H A;  2M1H A;  2X3X D;  1NYG A;  4J9D A;  1PHT A;  3V7C A;  3RMS A;  1TSF A;  3VYH B;  5GAN 2;  2HMA A;  2HQX A;  1BU1 A;  4OB1 B;  2DEU A;  1Z9Q A;  4EMH A;  4J6X A;  3MEA A;  2ZPI B;  1YWO A;  3X25 B;  3CC7 T;  1PSE A;  3CXC P;  1UHF A;  2VAS A;  1VOM A;  3CC2 A;  4JPB W;  2RI2 A;  4HXJ A;  1VQK T;  3S3O A;  1WLP B;  2SRC A;  3RKY A;  1OX9 A;  1HSQ A;  4PL6 A;  2DRK A;  2HQE A;  2DZC A;  1KC8 U;  2BZX A;  4LDU A;  2RHX A;  1M2V B;  2LQK A;  2KMT A;  4O5V A;  1PRL C;  3GBQ A;  1SRL A;  3VJP A;  1G5V A;  3P8H A;  3CC4 A;  2LVM A;  2XID A;  1K4U S;  1LVK A;  2ZPH B;  1EFN A;  1D0Z A;  3EG1 A;  4ZGJ B;  8ATC B;  3PVL A;  2X51 A;  3C0C A;  1UHC A;  2EW3 A;  5KYX B;  1SRM A;  1X6G A;  4RTU A;  4M7A C;  1Y7X A;  1Q82 C;  5GAN 4;  1PKT A;  1MMN A;  3VS3 A;  4EPC A;  2Y4Y A;  3LGL A;  4ANJ A;  4M7A B;  2EKH A;  3VUZ A;  2EQU A;  6AT1 B;  2MYS A;  1K9A A;  2I2L A;  1JU5 C;  2HL3 A;  3C4S A;  2LCC A;  2CZ7 B;  1V76 A;  2K57 A;  1WYX A;  1VQ4 Q;  2EGE A;  3G6E T;  3EG9 B;  5IN1 A;  1QVF P;  3EFS A;  2F5T X;  5HK0 A;  1KIK A;  1GCQ A;  3OQ5 A;  3OYD A;  3A8L B;  4JJB A;  1I07 A;  2OTJ T;  4WCI A;  1X2K A;  4C8Q A;  1Q86 R;  3JCM f;  4C8Q F;  1X6B A;  2QG9 B;  3EG3 A;  1NE8 A;  2DD4 A;  3HHT B;  1RAI B;  3EH1 A;  5LJ5 e;  2AZV A;  3LH5 A;  4E7I A;  3S3N A;  1R0C B;  4JLI A;  5KH6 A;  3ASK A;  4FCY A;  2DLP A;  2KSS A;  2L3Q A;  1MND A;  1K9M U;  1VQL Q;  1YI2 Q;  2C0I A;  3ULR B;  3VU3 C;  2EIF A;  1SG5 A;  3NTK A;  2J7I A;  4GLM A;  5LJ3 g;  1OEB A;  1W2B S;  1JXM A;  2VGN A;  4B9W A;  2LJ1 A;  1YP5 A;  3JCM W;  2DZ9 A;  4OVA A;  3I9Q A;  4KGZ B;  1IRE B;  2QTV A;  5L8R E;  2A0F B;  3OYB A;  1OPL A;  1IZ6 A;  4M75 E;  1D09 B;  2FB7 A;  2DL3 A;  2EYY A;  2JMC A;  2JS0 A;  4C92 F;  5IHK A;  2D6F A;  3WXM B;  2YRV A;  2LZ6 B;  3HRT A;  1Q95 G;  3OYK A;  1I5O B;  2JMA A;  4K11 A;  3NPF A;  4X9D A;  5LJ3 d;  1VQP Q;  1YHQ Q;  3SFM A;  3VS7 A;  3CCJ T;  1YIJ Q;  1VQN Q;  3QUI A;  1QVG P;  3CCQ Q;  4F04 B;  2BE7 D;  4RTV A;  3JB9 I;  4FT2 A;  1WXT A;  1KQS A;  4M78 A;  4XU1 A;  1K76 A;  5GAM g;  4M78 F;  7AT1 B;  5FU6 C;  2RHZ A;  4MZT A;  3ME9 A;  2L5Q A;  4CC2 A;  2L3P A;  2ZGW A;  3RER A;  5FU6 B;  5KYY B;  1VQM A;  2CZ1 B;  2JTF A;  2ZPF B;  5HCK A;  2L8D A;  3X28 B;  1GCP A;  2LRQ A;  1Q7Y C;  2RN8 A;  1ZSZ A;  3EFR A;  2P4T A;  3OYY A;  5GAM d;  1NJI U;  5GMK e;  2QQB A;  1PNJ A;  1WIE A;  1K9M R;  2CP3 A;  3CCS Q;  2FL7 A;  4R0K A;  2ROL A;  4M77 E;  2XG8 D;  4JS5 A;  3EGD A;  2KBT A;  2EBP A;  3CCL A;  2KGT A;  3OMG A;  5GAN h;  3A8O B;  1QWE A;  4PK4 A;  2GGR A;  4JRK A;  1ZHI A;  2E4H A;  1PCX A;  1QCF A;  4FYX B;  3CMA A;  3A1P A;  2YHT A;  2V26 A;  2QGG A;  1N9R A;  3QZ5 B;  2PZ1 A;  5D6Y A;  2JTE A;  4FIB A;  5FWC A;  1N6A A;  4OMO A;  2KXC A;  1TXQ A;  5FU7 C;  4KH0 B;  2OTL T;  2FPE A;  1RLP C;  2DTH A;  2ECZ A;  3RKW A;  4PJN A;  5FU7 B;  1LOJ A;  2ZCF B;  1OYX A;  2D9T A;  2NUT B;  2AHJ B;  2P0Q A;  1S72 Q;  2P84 A;  4C0F A;  1VQ6 Q;  3G1J A;  2MWP A;  3KXT A;  2HKN A;  4AFZ C;  3AHU A;  2V8I A;  2PUO B;  2O31 A;  1YCS B;  3QJY A;  3CCM T;  4F7U A;  3CPW A;  2HZY A;  2DBM A;  3GIB A;  1K8A R;  2DXT A;  4QQ6 A;  4RTZ A;  2XK0 A;  2RD1 A;  4JS4 A;  3CD6 Q;  2GF7 A;  1AWJ A;  2K79 A;  2PVD B;  1KD1 U;  1UJ0 A;  1UGS B;  2LX9 A;  3UWN A;  4PJM A;  1I1J A;  1NYF A;  3TCJ A;  5IXB A;  3OYE A;  1TUG B;  1SSF A;  2COY A;  3JV3 A;  4N4I A;  4ZNX A;  1BIA A;  1KG1 A;  1Q81 C;  1D1B A;  1GBQ A;  3VS2 A;  4HT8 A;  2QA4 A;  2K2M A;  2L89 A;  3OYF A;  2PU9 B;  1RAF B;  3M4G A;  1AHJ B;  2Z0W A;  4X1V A;  1YJ9 A;  1VQ9 Q;  4IKF A;  3M59 A;  1G2B A;  2MOX A;  1WGS A;  2EQJ A;  2F5K A;  2RJD A;  1M2V A;  4C92 E;  1OZ3 A;  5CAI A;  1FWZ A;  2MCN A;  4A4K A;  2KK4 A;  4RG2 A;  1VUB A;  2CZ6 B;  2BTT A;  4LDY A;  4F16 A;  1A0N B;  4OP0 A;  2E10 A;  1N9S A;  5KYX A;  1YCY A;  2DVE A;  2AK5 A;  3M5A A;  3SDZ A;  1ZSG A;  2FRY A;  4A4H A;  4M78 E;  4DBH A;  4M7A A;  2DK3 A;  5DLQ E;  4M7A F;  2LNV A;  1YFN A;  3S3M A;  1KC8 C;  4J9G A;  4IUR A;  3AT1 B;  4BE0 A;  3EG2 A;  2E3I A;  4BY6 B;  4J9C A;  4C5I A;  1GCQ C;  3LGF A;  3M0U A;  3M57 A;  4FYV B;  3C12 A;  2QQR A;  3EG9 A;  5FW9 A;  3TSW A;  1UE9 A;  2F1L A;  5M9O A;  2RNA A;  3A98 A;  2M02 A;  1YJW A;  2BUD A;  4JZ3 A;  2D1X A;  3QYG B;  3SHW A;  4A4G A;  3S6W A;  2BIV A;  5A0G A;  2P4R A;  1W1F A;  5LJ5 h;  4E47 A;  3OYG A;  4BDZ A;  2LQ8 A;  2FZG B;  3Q1J A;  1VQ7 T;  3G7Z A;  4LD6 A;  1H8K A;  4RG8 A;  2V1Q A;  4RTX A;  1ZUU A;  3OW2 A;  4JZ4 A;  5CKB A;  2KRS A;  1UGV A;  2LT1 A;  2E41 A;  2BE9 B;  3DKM A;  1YJ9 Q;  4OGE A;  1D0X A;  1BBZ A;  2M9U A;  2XMF A;  4P5N A;  1G3W A;  4HVV A;  2LJ3 A;  3DLM A;  3PMI A;  2CP0 A;  1K9M C;  2A3L A;  2YDL A;  3P8B B;  4LN2 A;  2H8H A;  4LNP A;  5GAN g;  2J6F A;  5HKC A;  2GQV A;  3HTR A;  4LDW A;  2J6O A;  1RL2 A;  4A4F A;  3GOX A;  1OUL A;  4E2F B;  3M0S A;  1W2B P;  4RCB A;  1M9S A;  4M7D B;  4PJO B;  2DA9 A;  4CC7 A;  3LWI A;  1W70 A;  3OS1 A;  1GL5 A;  2CH4 W;  2X9H A;  4IUT A;  1BIB A;  4NL3 A;  5KYY A;  4FT4 A;  1Y96 B;  4M7A D;  1BI3 A;  2P0K A;  2W10 A;  2JS2 A;  4DEX A;  5GAN d;  1LNX A;  3CME Q;  3THK A;  1JEG A;  1RAH B;  1M8M A;  2BZY A;  1N8R R;  2V8K A;  2KYM A;  2KE9 A;  1NEG A;  5GMK h;  3L2V A;  2ABL A;  4MZM A;  4Z89 A;  1T3L A;  1WI7 A;  5GAN 6;  2X4J A;  1R8O B;  3KFV A;  2JXB A;  1ARK A;  2VGM A;  4ATO A;  1U8R A;  4DEY A;  3I55 T;  1K73 U;  2QYZ A;  2PQW A;  1WFW A;  4FYW B;  4M4Z A;  2DIG A;  2HBP A;  1AEY A;  2EPD A;  1M5Q 1;  1NJI C;  5IAY A;  1FX7 A;  1MHN A;  3ZL7 C;  2NUT A;  2G3R A;  4J7F A;  4BI8 B;  2KRN A;  1UEB A;  1VQL T;  1P92 A;  1HD3 A;  2RHY A;  4BI4 A;  1YI2 T;  5CKH A;  2MWO A;  1YIT Q;  1MGQ A;  2Y90 A;  2YLC A;  2OAU A;  2LJ0 A;  3JSC A;  3OYL A;  3G4S A;  2DEQ A;  2JVV A;  2DET A;  3VS1 A;  5GAM f;  3CCV A;  2D0Q B;  4LE9 A;  4OMQ A;  4WTO B;  1RAE B;  2QEX Q;  4Q5W A;  1Q86 U;  2JM8 A;  5I2S A;  1VQP T;  3I55 A;  1YHQ T;  3MEV A;  3PNW C;  5GMK l;  2YSQ A;  2RHU A;  3BDL A;  1VQN T;  1YIJ T;  2JJ9 A;  3LW5 E;  3CCQ T;  2DX1 A;  2NYS A;  1KHI A;  1VQO T;  4XQ3 A;  3UF4 A;  3G71 A;  2L2P A;  1QW1 A;  2RQV A;  1JJ2 A;  3OS0 A;  2VC8 A;  2VXF A;  1NM7 A;  4A63 B;  2K2V A;  4JRI A;  4YTL A;  4R56 A;  1KD1 C;  2KAF A;  4J9H A;  3CCR T;  1KFZ A;  1K73 R;  3FJ5 A;  5GAN j;  1GFD A;  4RUG A;  3OBY A;  3KBG A;  2CSI A;  2PTK A;  3OYH A;  3H0H A;  4F14 A;  2X4Y A;  3HFN A;  4QW2 A;  3OW2 S;  1RAC B;  3CCS T;  1I4K 1;  4QKU A;  4E7L A;  2FHD A;  2MI6 A;  2RJF A;  2CP5 A;  2X35 A;  3EFO B;  3CBP A;  2G6F X;  2CKK A;  2JNG A;  4FYY B;  2SEM A;  3CC7 A;  2OX7 A;  4C5E A;  2DD5 A;  4BE1 A;  3QG1 A;  2A36 A;  2EJG A;  2MMP A;  2AT1 B;  1VQO A;  1VQK A;  1VQ8 Q;  3O8V A;  1TU0 B;  4XK8 E;  4F7U G;  1HYO A;  4KH1 B;  2B8A A;  2BZ8 A;  5LJ5 d;  3VRY A;  3CCU Q;  1ZA2 B;  2DXC A;  2W0Z A;  3BW1 A;  3OMC A;  2LCS A;  2PUK B;  1S72 T;  4X34 A;  4AFU C;  3M0T A;  1VQ6 T;  2LNH B;  4PJJ A;  3CCE T;  1YWP A;  2K4Y A;  1QP2 A;  2EYX A;  3OYM A;  3OA6 A;  1AWX A;  3OS2 A;  4AG2 C;  1SHF A;  1R77 A;  1NBE B;  3L1A A;  4HT9 A;  3M56 A;  1RAG B;  1QVP A;  2MIO A;  1WXU A;  3CC2 Q;  2EFI A;  3CD6 T;  1WPY A;  4AT1 B;  1H3Z A;  1G3Y A;  5I11 A;  3I5S A;  1KQS P;  5CK9 A;  3VYG A;  4II1 A;  3L2U A;  1RLQ C;  4E7Z A;  2K5L A;  4ZTJ A;  3TVT A;  4QT7 A;  5FWB A;  3G6E A;  2EYQ A;  4ELY C;  1M1K R;  4LXC A;  3CC4 Q;  2FZC B;  2WSF E;  1UJY A;  2OTJ A;  2FYK A;  2L3R A;  4OGC A;  5I2M A;  2O88 A;  1FMK A;  3UA6 A;  2DTO A;  3RR6 A;  1LCK A;  3CCE A;  5GAN 5;  4PFO A;  2GCX A;  3JCM b;  4XTU A;  4HCB A;  4M7A G;  1M90 R;  3T9N A;  4M7D A;  4PJO A;  5IHI A;  2XHC A;  4M77 D;  1ZLM A;  1AZG B;  1K8A U;  3M9Q A;  3O5Z A;  3ZEH A;  4ZN1 A;  2O9V A;  4JJD A;  2YUP A;  1EIF A;  3C94 A;  1Y96 A;  2RQW A;  3V7R A;  1ZA1 B;  1GXI E;  4JLG A;  4ZN3 A;  1SF9 A;  2CUD A;  3MEW A;  4J7I A;  5LJ3 e;  1X01 A;  5GAO q;  1UG1 A;  2F2V A;  2HSP A;  3OYI A;  2AKK A;  2DER A;  2J6K A;  3J80 E;  2R5M A;  1U3O A;  2M51 A;  3MPU B;  1GBR A;  2DXB A;  2RK2 A;  4EIK A;  4C0D C;  5GJV B;  2A28 A;  2HBW A;  2EYW A;  3GNG A;  2EQM A;  1KQ1 A;  4C0D B;  3M54 A;  4HVU A;  5LJ5 j;  3PE0 A;  5GAO p;  3CCJ A;  2E64 A;  3SB2 A;  3JAM E;  3CPW P;  2FVU A;  2PVO B;  2XDP A;  4TVR A;  3H0I A;  1QKW A;  5IT9 E;  5FLX E;  4IUQ A;  2JW4 A;  2E1H A;  1LJO A;  3BE3 A;  1JJ2 S;  3INZ A;  3X20 B;  2ZPG B;  2GFU A;  3ER0 A;  3MP1 A;  1Y71 A;  4C0Z A;  4Y91 A;  4MDX A;  1U1T A;  3PFS A;  3QSU A;  1C1A A;  1Y57 A;  3LWH A;  5GAN 8;  2COW A;  5AT1 B;  2QDL A;  1YJN T;  3H0F A;  3EHR A;  1WA7 A;  3N5B B;  2QGF B;  1ZUY A;  4F7U F;  3EGU A;  5KYW B;  2ESW A;  4DQ2 A;  2YUO A;  5CVI A;  5GAN f;  5GAO r;  3SEM A;  2QXF A;  1GRI A;  1X69 A;  4C8Q E;  3FDR A;  3QDR B;  5J3B A;  2FEI A;  1O9S A;  2AIR B; 
#chains in the Genus database with same CATH homology
 3CBO A;  1VQM T;  1QVF A;  1HXD A;  3OW2 A;  1N8R C;  4HCC A;  5CKB A;  2DO3 A;  5CQX A;  2JN0 A;  5DM7 R;  2LT1 A;  2E41 A;  4NOY A;  1HK9 A;  3DKM A;  3UT1 A;  4OGE A;  1XNI A;  4M78 G;  2XIC A;  5HY6 A;  3KUF A;  2VV5 A;  4HCZ A;  3SWN C;  3TU4 K;  2M9U A;  4ME7 A;  4JJN K;  4KUD K;  4P5N A;  5CO7 A;  5FRN A;  4N4H A;  1G3T A;  2M1H A;  3RKX A;  4M7D D;  4PJO D;  3V7C A;  1G3W A;  3RMS A;  1S72 A;  4QQD A;  3VYH B;  2OTL A;  5GAN 2;  3SWN B;  3DLM A;  3GF5 A;  3PMI A;  2HQX A;  1VQ6 A;  4OB1 B;  1K9M C;  4EMK A;  4JRP A;  2A3L A;  4C92 A;  1VQ9 T;  4EMH A;  4J6X A;  3VKI A;  1ZQ1 A;  3MEA A;  3P8B B;  2ZPI B;  4DOW A;  3X25 B;  3CC7 T;  1PSE A;  4BB7 A;  5GAN g;  5HKC A;  1RI0 A;  2GQV A;  3CCL T;  2LTO A;  2QQA A;  4LDW A;  1RL2 A;  4A4F A;  3GOX A;  4PJO F;  3X26 B;  3CC2 A;  4M7D F;  2RI2 A;  2RO0 A;  3S3O A;  1VQK T;  4OF1 A;  2K3X A;  4RCB A;  1VQ5 T;  3PTA A;  1M9S A;  2X4W A;  3RKY A;  4EDU A;  4M7D B;  4PJO B;  3CMA T;  4PL6 A;  5GMK j;  3PIP A;  2LC4 A;  3HKS A;  2HQE A;  3MO8 A;  2F69 A;  3HFO A;  1OI1 A;  3I56 T;  3LWI A;  3CCM A;  1X6O A;  3L42 A;  3OS1 A;  1Q86 C;  2DZC A;  3FRN A;  1KC8 U;  3FB9 A;  4IUT A;  1BI0 A;  3CD6 A;  3M58 A;  1BIB A;  4LDU A;  4CI0 C;  4XAX B;  2RHX A;  2EJ9 A;  3QZ9 B;  2V8J A;  3V7S A;  5GAO m;  4NL3 A;  4FT4 A;  2XDD A;  2DPP B;  4M77 C;  1Y96 B;  1WJQ A;  4JUV A;  4M7A D;  2LQK A;  1BI3 A;  2KMT A;  4O5V A;  4OB0 B;  2P0K A;  2XD0 A;  3M4Y A;  1UB4 A;  3V8L A;  3VJP A;  3OS5 A;  5DLO A;  1G5V A;  3P8H A;  1VIF A;  4M77 B;  2E6N A;  3J81 E;  3CC4 A;  2LVM A;  2XID A;  5GAN d;  1LNX A;  1Y07 A;  3R6O A;  2ZPH B;  1VIE A;  4ZGJ B;  3JCM e;  1WJS A;  4L6V 5;  5KE3 A;  1ZBX A;  2V8K A;  4M7A C;  2JTM A;  1Y7X A;  1Q82 C;  4BY6 C;  5GAN 4;  2XI9 A;  4BI3 A;  4IUU A;  2KVQ G;  4EPC A;  2Y4Y A;  4R55 A;  1BI1 A;  2JOY A;  3LGL A;  1QVG A;  4M7A B;  3VUB A;  3HSB A;  2QDY B;  3QII A;  5GMK h;  4QVD A;  4C5G A;  3VUZ A;  2E65 A;  2LDM A;  3L2V A;  2EQU A;  3PIO A;  1VQ9 A;  4MZM A;  1WJR A;  2I2L A;  5GAN 6;  2VYT A;  2X4J A;  1R8O B;  2RJC A;  4N0A A;  3C4S A;  2LCC A;  2CZ7 B;  4B9X A;  1M8V A;  2VGM A;  4ATO A;  1U8R A;  3NTI A;  4C8Q D;  3I55 T;  2K57 A;  1TH7 A;  1K73 U;  5GAM e;  2PQW A;  3G6E T;  5C0M A;  3A8M B;  3OB9 A;  5IN1 A;  4J8O A;  3EFS A;  2F5T X;  5HK0 A;  2RHI A;  2E70 A;  3OQ5 A;  5J26 A;  3I56 A;  2LCL A;  3LH0 A;  2DIG A;  2HBP A;  3A8L B;  3H6Z A;  4GLK A;  3OYD A;  1M5Q 1;  4ELZ C;  2KQW A;  4N4G A;  1NJI C;  2OTJ T;  3OBW A;  5IAY A;  1NZ9 A;  3UPU A;  1FX7 A;  1N8R U;  1MHN A;  4C8Q A;  3JCM f;  4C8Q F;  2CS7 A;  4WF2 A;  5D6W A;  1I5L A;  4M75 C;  5FRM A;  1NE8 A;  2IG0 A;  2G3R A;  4J7F A;  4O6J A;  4BI8 B;  2DJZ A;  2DD4 A;  4XTV A;  4RKU E;  3HHT B;  1UEB A;  1XQH A;  1O75 A;  3M55 A;  1VQL T;  2QA4 T;  1P92 A;  4M75 B;  2RHY A;  2O4X B;  4BI4 A;  5CKH A;  3MP8 A;  1JB0 E;  5LJ5 e;  1YI2 T;  1K73 C;  4E7I A;  1B34 A;  2MWO A;  3S3N A;  3J7A F;  4L5G A;  1MGQ A;  4JLI A;  5KH6 A;  3ASK A;  2KSS A;  2Y90 A;  4E7J A;  1OZ2 A;  4XU3 A;  2YLC A;  2DAQ A;  1YJ9 T;  1K9M U;  2WSC E;  4L59 A;  2OAU A;  5CQY A;  2M0O A;  5CR2 A;  3CXC S;  3QO3 A;  1M1G A;  3VU3 C;  2EIF A;  3JSC A;  3NTK A;  3OYC A;  2QEX T;  3OYL A;  5LJ3 g;  1W2B S;  2VGN A;  4B9W A;  3G4S A;  3BDU A;  3FLG A;  5CKE A;  1UGP B;  4C92 D;  2DEQ A;  2JVV A;  3JRZ A;  2C06 A;  2CZ0 B;  4LDX A;  3ZBD A;  3JCM W;  2DZ9 A;  4OVA A;  2D0Q B;  4LDV A;  5GAM f;  3GLX A;  3CCV A;  3JB9 G;  1IRE B;  2DKG A;  2K5I A;  5L8R E;  3JCM g;  3OYB A;  1IZ6 A;  4MML A;  4HKE A;  4M75 E;  4Q5W A;  1Q86 U;  2FB7 A;  3LX7 A;  5I2S A;  1VQP T;  4F7U E;  3BY7 A;  3I55 A;  1YHQ T;  4EMK C;  4C92 F;  3MEV A;  3PNW C;  5GMK l;  1UGQ B;  4GY5 A;  2D6F A;  4ZGE B;  2RHU A;  3BDL A;  3WXM B;  1D3B A;  1YIJ T;  1VQN T;  3GNF B;  2YRV A;  3LW5 E;  3MP6 A;  2ZZD A;  3CCQ T;  4ZTF A;  5CKD A;  1XOV A;  2RH2 A;  3HRT A;  4M77 G;  4EMK B;  4C92 B;  1KHI A;  4M78 D;  5LJ3 j;  2EKO A;  4M7D C;  3OYK A;  1X75 C;  3WVE B;  4PJO C;  1VQO T;  4MZP A;  4X9D A;  5LJ3 d;  5LJ5 f;  3P8D A;  4XQ3 A;  5A0L A;  3E9F A;  1YJN A;  4E7H A;  3SFM A;  4NS5 A;  1PSF A;  2QQ9 A;  3CCJ T;  3G71 A;  3QUI A;  3URG A;  1QW1 A;  1JJ2 A;  3OS0 A;  2VC8 A;  3PT9 A;  1Q82 U;  2VXF A;  3JCM d;  3JB9 I;  4FT2 A;  1KQS A;  4M78 A;  2K2V A;  4JRI A;  4XU1 A;  4YTL A;  5GAM g;  4M78 F;  4R56 A;  1KD1 C;  2KAF A;  3CCR T;  4J6Y A;  5FU6 C;  2RHZ A;  1VQ7 A;  4MZT A;  3ME9 A;  3JCM X;  2L5Q A;  2EJF A;  2QTX A;  5GAN j;  1KQ2 A;  2ZGW A;  2JZ2 A;  3RER A;  5FU6 B;  3CPF A;  3TRE A;  3OBY A;  2E12 A;  3KBG A;  1VQM A;  2QI2 A;  1JBM A;  1YJW T;  2EWN A;  2CZ1 B;  4IUV A;  5FRO A;  3OYH A;  3JB9 H;  2RM4 A;  3PMT A;  4BE2 A;  2JTF A;  2EQK A;  3LLR A;  2ZPF B;  3DB4 A;  2X4Y A;  2R57 A;  3HFN A;  3M53 A;  4QW2 A;  5LJ3 h;  1QVF S;  3OW2 S;  1BKB A;  2L8D A;  4M7D E;  4PJO E;  3OYN A;  3X28 B;  2MF2 A;  2R5A A;  3CCS T;  2M16 A;  1I4K 1;  4E7L A;  2LRQ A;  3H8Z A;  2FHD A;  5GAM j;  2MI6 A;  2RJF A;  2H3J A;  3EFR A;  1W4S A;  1Q7Y C;  3OYA A;  2P4T A;  3OYY A;  5GAM d;  2X35 A;  4V2S A;  2DXU A;  4XTY A;  3GP8 A;  1NJI U;  3CBP A;  1K8A C;  5GMK e;  2QQB A;  1VQ4 T;  4Z02 A;  4BDY A;  1M4Z A;  1VQ8 T;  2CKK A;  3UDC A;  5EG2 A;  2FL7 A;  2JNG A;  5GMK m;  3E9G A;  3F70 A;  2XG8 D;  4M77 E;  3CC7 A;  4C5E A;  2DD5 A;  4JS5 A;  3FJP A;  3CCL A;  3CCU T;  2ZPB B;  4BE1 A;  3QG1 A;  2EJG A;  5DY9 A;  2MMP A;  3OMG A;  4M75 G;  1Q81 U;  5GAN h;  2CYZ B;  3A8O B;  4FL6 A;  1WNL A;  3QYH B;  3RUX A;  1VQO A;  1M1K C;  1VQK A;  4JRK A;  3O8V A;  4J6W A;  1VQ5 A;  4XK8 E;  1ZHI A;  3JCM c;  4F7U G;  2XDB A;  3JCM V;  3CBM A;  2B8A A;  3CMA A;  5LJ5 d;  4E7K A;  4XU0 A;  2YHT A;  2DXC A;  3BW1 A;  3V8J A;  3QZ5 B;  1N9R A;  4PLL A;  2RA2 A;  5D6Y A;  4M7A E;  4FIB A;  4Y28 E;  3OMC A;  1N6A A;  3CME A;  2PUK B;  4XU2 A;  3HP9 A;  5FU7 C;  4X34 A;  1S72 T;  1YIT T;  2OTL T;  4J83 A;  4C8Q C;  1VQ6 T;  1XTD A;  2DTH A;  3L2R A;  3CCE T;  3RKW A;  2NLU A;  5FU7 B;  1LOJ A;  2K4Y A;  1KQS S;  1QP2 A;  2ZCF B;  4C8Q B;  3OYM A;  3OA6 A;  1OYX A;  5CIU A;  3ZFJ A;  3OSS C;  2D9T A;  1M90 C;  2AHJ B;  2P0Q A;  3QKJ A;  3OS2 A;  4C0F A;  4C5H A;  4MMK A;  3CC2 T;  4MDW A;  1UGR B;  2MWP A;  2WSE E;  3NFC A;  3KXT A;  2A7Y A;  3L1A A;  3AHU A;  1B34 B;  2V8I A;  3M56 A;  3JCM J;  4HT9 A;  1QVP A;  2PUO B;  3EAE A;  4UC4 A;  2KY9 A;  3QJY A;  3CCM T;  3RMQ A;  4F7U A;  4A54 A;  4DA4 A;  3JB9 J;  3CPW A;  2EFI A;  4QVZ A;  3A8G B;  4EMG A;  1WPY A;  3CD6 T;  2PVG B;  5KCO A;  4OMF B;  5KE2 A;  3GIB A;  3JCM P;  1H3Z A;  1G3Y A;  2HD0 A;  4VUB A;  3WVD B;  1VQ4 A;  2QQS A;  1QVG S;  2DXT A;  4PJO G;  4M7D G;  4QQ6 A;  2LT4 A;  3QBY A;  5CK9 A;  2XK0 A;  3VYG A;  2RD1 A;  5A2Q E;  4JS4 A;  2MAM A;  4II1 A;  3CC4 T;  2IVW A;  3L2Q A;  3L2U A;  5HK3 A;  3RIR A;  2GF7 A;  2K5L A;  1N27 A;  5C6S A;  4ZTJ A;  5KCH A;  3L2W A;  1JRI A;  2XU8 A;  2XKO C;  4KBM B;  2PVD B;  3HRU A;  4C92 C;  1BI2 A;  5CCA A;  1KD1 U;  2BKD N;  3G6E A;  2EYQ A;  4QQG A;  4ELY C;  4D6W A;  2DIQ A;  1UGS B;  2LX9 A;  3UWN A;  2GFA A;  3SWN A;  3VV0 A;  3TCJ A;  2WSF E;  1NPP A;  2OTJ A;  3OYE A;  2FYK A;  3JB9 D;  2L3R A;  1DJ7 B;  3A5Z B;  1D3B B;  1SSF A;  4OGC A;  4PNO A;  5I2M A;  2E6Z A;  4N4I A;  2R58 A;  4BD3 A;  1YIT A;  3HL8 A;  3OY9 A;  1BIA A;  2DTO A;  4PLI A;  2K5F A;  1KG1 A;  5GAN 7;  2E5Q A;  1Q81 C;  3CCE A;  5GAN 5;  1NPR A;  3V8K A;  4BUG A;  2GCX A;  4HT8 A;  3QHS A;  3DB3 A;  1VQL A;  2QA4 A;  3JCM b;  5GAO n;  1YI2 A;  1I8F A;  2L89 A;  4XTU A;  4HCB A;  3OYF A;  4M78 C;  4M7A G;  3MEU A;  1FXX A;  3RES A;  3T9N A;  4QVC A;  4XTX A;  4M7D A;  3PGG A;  3CEY A;  1Q7Y U;  1QP3 A;  2XHC A;  2PU9 B;  3JB9 F;  4PJO A;  4M77 D;  3M4G A;  1K8A U;  3M9Q A;  1AHJ B;  1YJ9 A;  2CGH A;  4M78 B;  5A0D A;  3ZEH A;  4ZN1 A;  4IKF A;  2DTI A;  3M59 A;  3A8H B;  1WGS A;  4KUL A;  2EQJ A;  4OB2 B;  3QPH A;  2F5K A;  2RJD A;  1EIF A;  3C94 A;  1Y96 A;  4C92 E;  4JRQ A;  1OZ3 A;  4J5Y A;  5CAI A;  2QEX A;  1FWZ A;  3V7R A;  5J39 A;  4A4K A;  4RCC A;  2KK4 A;  1GXI E;  3FEO A;  4JLG A;  2RK1 A;  4RG2 A;  1VUB A;  4ZN3 A;  2CZ6 B;  4M77 A;  1M1K U;  4M77 F;  5LJ5 g;  3MEW A;  3C95 A;  4FM4 B;  2Y4X A;  4J7I A;  4LDY A;  5LJ3 e;  2VXE A;  1X01 A;  4HA8 A;  5GAO q;  4OP0 A;  5CKF A;  2E10 A;  1N9S A;  2KDS A;  3CPW S;  5D6X A;  3OYI A;  4LD9 K;  1YCY A;  2DVE A;  3OYJ A;  3JCM h;  2HAX A;  3M5A A;  3SDZ A;  3CXC A;  4OB3 B;  3J80 E;  2R5M A;  1VQP A;  1V29 B;  2RJE A;  1G3S A;  1U1S A;  1YHQ A;  4A4H A;  4JDS A;  4M78 E;  4M7A A;  1W2B A;  2DK3 A;  5DLQ E;  1YIJ A;  1VQN A;  2DXB A;  4M7A F;  2RK2 A;  2LNV A;  3CCQ A;  4C0D C;  2HNI A;  4N0A C;  3HPW A;  3QJ6 A;  3S3M A;  5GAN 3;  4C8Q G;  1KC8 C;  1KHC A;  1M90 U;  4IUR A;  3LYI A;  3SD4 A;  1WQW A;  3BFM A;  3GNG A;  4BE0 A;  2EQM A;  1KQ1 A;  1WQ7 A;  5GAN e;  4C0D B;  5I21 A;  3M54 A;  4BY6 B;  3G4S T;  5LJ5 j;  1YBY A;  5LL6 S;  5GAO p;  3CCJ A;  2E64 A;  3QXE B;  3SB2 A;  3JAM E;  4IUP A;  4XTW A;  5AYF A;  4C5I A;  3CCV T;  3L2Z A;  3LGF A;  3M57 A;  4ZGD B;  3C12 A;  2QQR A;  2FVU A;  4FU6 A;  2PVO B;  2XDP A;  2K3Y A;  2YLB A;  2JUF A;  3HRS A;  4TVR A;  3MCA B;  5IT9 E;  5FLX E;  4IUQ A;  2E1H A;  1LJO A;  2RI5 A;  3INZ A;  3CCR A;  1JJ2 S;  3X20 B;  1I81 A;  2ZPG B;  2GFU A;  3ER0 A;  3MP1 A;  3X24 B;  1BYM A;  1Y71 A;  5GAM h;  3OSV A;  4M75 D;  3E1S A;  4XTZ A;  4C0Z A;  4Y91 A;  4MDX A;  4A4E A;  3DLL A;  2O01 E;  1U1T A;  3FIF A;  3FC3 A;  3PFS A;  5LJ3 f;  5M9O A;  2VUB A;  3QSU A;  4DOV A;  1YJW A;  2P0P A;  3LWH A;  5GAN 8;  2BUD A;  2WAC A;  4CRI A;  2ZPE B;  3E19 A;  3MET A;  3QYG B;  4KT0 E;  4C0G A;  1YJN T;  4M75 A;  2O4X A;  4M75 F;  4NL2 A;  3G71 T;  3N5B B;  4A4G A;  4X9C A;  3S6W A;  2BIV A;  2X4X A;  3CCS A;  5A0G A;  3CME T;  2RB6 A;  3GPL A;  1M1F A;  5LJ5 h;  4RMO A;  4F7U F;  4C92 G;  3TEE A;  4E47 A;  4A53 A;  3NTH A;  2EAY A;  3OYG A;  5GAO l;  4BAC A;  2LQ8 A;  4BDZ A;  4PKC C;  4DQ2 A;  3Q1J A;  1VQ7 T;  1VQ8 A;  4FSX A;  5CVI A;  5GAN f;  2RI3 A;  3G7Z A;  4F7U B;  5GAO r;  4KUI A;  1H64 1;  2QXF A;  4C8Q E;  5GMK i;  3JCM Q;  3FDR A;  3QDR B;  5J3B A;  3MHX A;  1O9S A;  4LD6 A;  3CCU A;  4RG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...