3ASKA

Structure of uhrf1 in complex with histone tail
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
223
structure length
213
Chain Sequence
SLYKVNEYVDARDTNMGAWFEAQVVRVTRKAEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDKQLMCDECDMAFHIYCPPLSSVPSEDEWYCPECR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/dna binding protein
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Recognition of modification status on a histone H3 tail by linked histone reader modules of the epigenetic regulator UHRF1
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 213
sequence length 223
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3askA01
2.30.30.1150 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3askA02
4C5HA 4OVAA 2O4XB 3L42A 4PLLA 4IUUA 3QBYA 4UC4A 5J39A 3CEYA 4BD3A 2XDPA 3PMIA 2HQXA 3FC3A 2LTOA 2LCCA 2O4XA 4B9XA 4A4EA 4ZTFA 2D9TA 3QJ6A 2RJEA 4Q5WA 4RG2A 2CKKA 2R57A 4Z02A 2L89A 2VYTA 3H8ZA 3L2VA 4C5GA 2EQUA 4QVZA 3QIIA 5FRMA 4HCZA 4A4FA 1H3ZA 2BIVA 3L2QA 2LDMA 3OQ5A 3OS0A 4BE2A 2BKDN 5IN1A 3MEAA 4IUTA 3OS2A 4B9WA 3O8VA 3MP1A 4E7HA 3LGLA 2MWOA 4NS5A 2RHIA 4N4HA 2WACA 3ZEHA 4BDYA 2JZ2A 2M0OA 2RI3A 4FL6A 5C0MA 4EDUA 3OYEA 5C6SA 3MO8A 4ZTJA 2EFIA 3QKJA 4QQ6A 5KH6A 1OI1A 2X35A 3LYIA 3M9QA 1WJRA 5KE2A 3OYIA 4LD6A 2NLUA 5KCHA 3LX7A 1MHNA 3PFSA 4GY5A 2LVMA 4N4IA 3OB9A 3F70A 3PNWC 4BACA 3UT1A 3OYGA 3OA6A 2F5KA 2X4WA 3OS1A 2FHDA 3MEUA 3LLRA 5KE3A 3ASKA 4E7IA 3NTIA 5D6XA 3L2RA 4E7JA 5KCOA 3DLMA 4IURA 3OYAA 2R5MA 4PLIA 3S6WA 5IAYA 3L2WA 1OYXA 2L3RA 5FROA 3UWNA 2GF7A 2RO0A 3OYDA 4C5IA 3S3OA 2EQKA 4L59A 4BE1A 3MP8A 2RI5A 3OYKA 4QQDA 3MP6A 3FLGA 2XK0A 4FU6A 4CRIA 3L2UA 2DIGA 3Q1JA 3MEVA 4PL6A 1OZ3A 1KHCA 2MWPA 3DB4A 3E9FA 2RI2A 3FDRA 3H6ZA 3LH0A 2B8AA 2QQSA 3P8HA 5D6WA 3OYCA 4E7KA 3ME9A 2RHXA 3OMGA 2R58A 2DAQA 2QQRA 4X34A 2LRQA 3PMTA 3OYBA 3LGFA 3NTKA 3E9GA 2M16A 5J26A 3MEWA 2PQWA 2GFAA 2DIQA 4QQGA 3FEOA 2E5QA 2G3RA 2RJFA 4BE0A 4N4GA 4A4GA 3NTHA 2IG0A 3OYMA 3OMCA 3S3NA 2K3XA 4IUPA 2L8DA 4II1A 2RHUA 1N27A 1WJSA 4E7LA 2X4YA 2GFUA 2BUDA 2R5AA 5D6YA 1WJQA 3P8DA 1XNIA 3SD4A 2E6NA 2JTFA 3OYFA 1OZ2A 3GOXA 2K3YA 2P0KA 3OYJA 2M1HA 2X4XA 3OYNA 3OYLA 2EKOA 1WGSA 3C4SA 5CIUA 4BDZA 2RJCA 1SSFA 2EQJA 2RHYA 1RI0A 4IUVA 2YRVA 2RJDA 3EAEA 3KUFA 2EQMA 4IUQA 4C5EA 3OY9A 3OYHA 4IKFA 5M9OA 5FRNA 3META 4QW2A 4A4HA 2RHZA 2HQEA 3S3MA 3DB3A 1G5VA 3BDLA
chains in the Genus database with same CATH superfamily
1K73R 1M3CA 1TH7A 4Y91A 1NYFA 3JCMd 1WHMA 2PVDB 1I5OB 2VB6A 2LJ3A 3G6ET 3E1SA 3H8ZA 3HRSA 4A4FA 2LNVA 2OAUA 2ED1A 3MP1A 4E7HA 1O9SA 3V7CA 4Z88A 3SWNA 2QG9B 3FRNA 2PZ1A 3AT1B 4LDWA 1M90C 1GXIE 4C92E 5AT1B 2DYBA 4EMKA 3QDFA 2L0AA 5GAN4 4M75E 4OMLA 2A28A 2JMCA 3I55A 4E7IA 3L2RA 2AZVA 3PIOA 1BIAA 4KGVB 1PWTA 3CMET 1W6XA 1GBQA 3GNFB 3OYKA 4QQDA 3LH5A 3L1AA 1KHCA 2CUDA 4C92F 3HPWA 2RHXA 3ER0A 2FZGB 2DAQA 2MOXA 1AWWA 2VKNA 4M75F 1QQJA 5DM7R 2DIQA 2YUNA 3VS4A 4F7UA 1YJ9T 3WVEB 1IHVA 4BI3A 1YIJT 5HK0A 4JZ3A 2CT4A 4PJOG 2KEAA 1Y0MA 1MUZA 2RHUA 3VS0A 4MMLA 1Q86R 3G6EQ 1UECA 2EYZA 3MHXA 5IXFA 3NHNA 4NL2A 1M1KC 3M56A 2DL3A 1BK2A 1M2OA 1NYGA 1QCFA 3A98A 2EVRA 2DERA 2EKHA 1JRIA 3VS5A 2DL5A 4LUEA 4JDSA 2VUBA 2Y4XA 2PNIA 1K9MC 3G71A 2RQTA 1I5LA 1D0XA 4M77A 2XDBA 3JCMV 5LJ5d 1G3TA 4JS4A 2LX7A 2MMPA 3CEYA 4BD3A 3FJ5A 3GBQA 1CKBA 3EH2A 2D9TA 2PUOB 1Z9ZA 2YT6A 3JCMP 2IIMA 3EFOA 4C5GA 4RMOA 1H3ZA 1Q7YC 3HFOA 1B7TA 5GJWB 1VQLT 2MWOA 4BDYA 1B3QA 1OOTA 5GANg 3VRYA 3G71Q 2V1RA 3MPUB 2KXCA 1YIJQ 3PFSA 4GY5A 2DL8A 1VQNT 3ZFJA 3CXCP 1H8KA 1QWEA 4KULA 1WZOA 2DZ9A 4DBRA 1QW1A 1X6OA 2VC8A 2ZPFB 1E6GA 2L3PA 1ACMB 2M9UA 4FU6A 4AMCA 4ORZA 4QVCA 3CCRA 4HA8A 4PL6A 2DJQA 1N5ZA 1KIKA 2E5KA 4AG2C 1NJIU 4X34A 2LRQA 4J9IA 4A63B 3LGFA 2JM8A 1NEBA 3JSCA 4D8DA 1AWOA 4F04B 1B34A 1AZGB 2FZKB 3SWNC 3R6OA 1Y57A 2COYA 2L8DA 4XTYA 4Z8AA 4DOVA 2GFUA 5FW9A 2HBWA 2EYYA 2LNHB 4GLKA 2DVEA 4EMKC 2XU8A 2RF0A 3G1JA 1BCOA 1VQLQ 2RJCA 3H0FA 2KXDA 1H641 1VQ8T 2RJDA 2CSQA 3NFCA 3CCMT 2CGHA 5IHNA 3CCRQ 3TSZA 1RAFB 1YNZA 2K5FA 1VQNQ 4IUUA 5J39A 2KE9A 1YJWA 2JW4A 1M1KR 1V29B 1VQ9T 4CI0C 1K4US 4XTUA 5GMKj 4PJOE 2Y90A 4M7AG 1OV3A 1ZA2B 1W1FA 1K76A 1K9MR 3QYGB 1WDXA 1KK7A 4AG1C 4IUTA 2FVUA 3QUIA 3LGLA 3SWNB 4NS5A 3CC2A 2GBQA 1WXBA 1EFNA 3HFNA 1K0SA 2EFIA 2HKQB 4PJOF 1VQ9A 5CQYA 5GANj 2YWWA 2EYWA 1MHNA 4OMPA 1M3AA 1UDLA 3A8OB 4M77C 4JJCA 1LVKA 1WPYA 3OS5A 4E47A 6AT1B 1Q7YR 2EJFA 5GAMd 3CCQA 1PRLC 3C12A 5KYXA 1Y96A 1HJDA 5FROA 1D1BA 1D0ZA 3G4ST 1VQ8Q 2KY9A 2C0OA 3CCMQ 4M7DB 1VQ5A 3O5ZA 1SPKA 4M78G 4F7UB 1NJIC 1WFWA 1WQ7A 1ZUYA 2YLCA 1TUGB 3I5SA 2DXUA 2CDTA 5IT9E 1VQ9Q 1KG1A 1TS9A 4VUBA 2A36A 1OPKA 4R0KA 2E12A 1RUWA 4J9DA 2OTLT 2CREA 1PKTA 2X3XD 2I0NA 4IIOA 2LQWA 4M77B 1EIFA 2ZPEB 4C8QD 2C0TA 3EGXA 1M2VA 1VQ5Q 3JCMg 3JB9J 2K7AA 4A4HA 3ULRB 2QGFB 4LDUA 2H3JA 4XAXB 3BFMA 1SRMA 2FYKA 2KGTA 1SHGA 3EFOB 1R0CB 4J6XA 4OMNA 2LCCA 2CS7A 1RAEB 4A4EA 3M4GA 1I1JA 1JXMA 2YSQA 3PVQA 1HSQA 3C94A 1FMWA 4DBFA 1BKBA 2COZA 1KC8U 4M7AC 4N0AA 2LJ1A 3JRZA 3EG2A 2QDYB 4HT8A 3PT9A 1VYVA 4V2SA 3ZEHA 4RUGA 3CCEA 1YJNA 3MKDA 2MK5A 3GPLA 1EX4A 1MMAA 2QYZA 2G6FX 2KYMA 2GQVA 2E70A 4BACA 1YI2A 1WXUA 2DL7A 1OU9A 2JXBA 4C0FA 1O75A 3NTIA 4PFZA 3DLMA 1RAHB 5I11A 3NMZC 2K57A 2DX1A 2QTXA 4BE1A 5D7UA 4QKUA 5D6WA 1QVPA 4JJNK 4E7ZA 5LJ3h 1U3OA 1B34B 1I07A 3GIBA 2W0ZA 4PJJA 2E4HA 1BIBA 3V8LA 3H9NA 2XDDA 3H0HA 1W70A 4BE0A 4N4GA 1XTDA 1IO6A 4HCCA 4E7LA 1WJSA 4E6RA 4J9BA 2R5AA 5LJ3j 2O2OA 3D7SB 2GTOA 3OYJA 2DMOA 5LJ5g 5GMKm 1SSHA 2K2MA 1NJIR 3WVDB 5A0DA 4BDZA 3RKXA 4DBQA 2O9SA 4A53A 5DY9A 5GMKi 1X6GA 3EG0A 3X25B 3RESA 4C5EA 3META 1GBRA 3UA7A 3X28B 2GGRA 4JLGA 2DXTA 3BDLA 1D09B 3A8MB 7AT1B 1OULA 1GFDA 1VQ4T 5KYNA 2DXBA 4M75A 2E65A 4UC4A 1N8RU 4GBQA 2QA4A 3H41A 1YCSB 3EG3A 1FXXA 4J9EA 1IRXA 3JCMJ 3THKA 2O01E 1RACB 1CKAA 1I4K1 5A0LA 2D6FA 3FJPA 2VYTA 1NEGA 4PKCC 3VKIA 5FRMA 1Y7XA 2EPDA 1KC8C 1AZEA 1C1AA 2DTIA 2KK4A 1G3SA 2DBMA 2RHIA 1YHQA 4RTUA 2KSSA 4C92G 4X9CA 4ZTJA 5KH6A 3AHUA 3A8HB 2LVMA 4N4IA 2JNGA 4KRTA 1Y96B 5KYYA 2PTKA 1U8RA 2A3LA 2EJ9A 3RMQA 3HTRA 2KBTA 3X26B 3I9QA 2IPOB 2QQAA 3M53A 1UB4A 2DRMA 2R5MA 2ZCFB 1K1ZA 1BI1A 4FT2A 2WSFE 2XMFA 5A0GA 3H6ZA 4C0DC 5GAN6 4N0AC 2OAWA 1VQ4Q 4HCKA 3CC4A 3PMTA 3E9GA 3NPFA 2PQWA 1AEYA 1VQPT 2AT1B 1T3LA 2F2WA 1SEMA 1LJOA 1HXDA 3TSWA 5CKDA 1XNIA 2EQIA 2K3YA 3EGXB 1M2VB 4C0GA 1UGQB 2HD0A 3VS6A 5LJ5j 4IUVA 3EAEA 1M8VA 4XTVA 3OY9A 1IREB 3X24B 2PVGB 1G5VA 2M02A 2ZPBB 4RTTA 3CC4Q 4FT4A 1N8RC 1N9SA 1VQ6A 3SFMA 4AT1B 4C8QE 2HL3A 1WHJA 1MMDA 4C0DB 3V7SA 3RNJA 4JZ4A 4PFPA 3KXTA 2BE7D 2XD0A 3SDZA 2YLBA 2BIVA 3L2QA 1BBZA 2CH4W 5CCAA 4HKEA 2P4RA 4N4HA 1YWOA 4RCBA 2NUPA 4C8QF 4FL6A 5GAMg 1BI3A 3REBB 2RK1A 3EG1A 1WJRA 1VQPQ 2DL4A 4C92C 3OW2S 3F70A 5CKBA 4RG8A 4J9CA 1PHTA 1W4SA 2V8JA 1R77A 1KC8R 3H0IA 4M75C 5GANf 3I55T 3QYHB 1G3WA 1YITA 2FPDA 3HHTB 4XU2A 2RI5A 4ZGDB 2EYXA 2DEUA 1X01A 1X6BA 3Q1JA 3VYGA 3DB4A 1UTIA 3KFVA 4M4ZA 1S1NA 2K9GA 2QQRA 1MMNA 3NTKA 4PJOA 4RTVA 2QI2A 4MZPA 4M7DD 5IXBA 3FEOA 1M27C 4IUPA 2C0IA 5I21A 4XTWA 1N6AA 1BU1A 4ANJA 2AKLA 4XU1A 3P8DA 2EGEA 4OMFB 2P0KA 4CC2A 2KT8A 2F2XA 3CPFA 3CXCA 1M3BA 5FRNA 3RDVA 3G71T 2EJGA 5AYFA 2DE0X 2RHZA 2VGMA 3JCMQ 3V8JA 3CCLA 1PCXA 1K9AA 4C5HA 1QCNA 4JRIA 5I2MA 1KQSS 2EBPA 1UJ0A 2J6KA 4XTZA 2O9VA 3I55Q 4ELZC 1VQ7A 3J7AF 4RG2A 2XG8D 1MNDA 2EQUA 1MV0B 2RA2A 1RAGB 1ZLMA 2DK3A 2BKDN 5IN1A 3PE0A 1AWXA 5CR2A 5LL6S 1N8RR 2M0OA 1IHWA 2X35A 3MJXA 2LQ8A 1S72A 5GAMj 2LT4A 3CD6A 1M9SA 1RI9A 2ED0A 2YRDA 2F5KA 2COWA 3ZBDA 3JV3A 4M7DG 3JB9H 4LN2A 5CQXA 2F5TX 2KRMA 1P92A 4PLIA 2L3RA 1QCOA 3REAB 2CSIA 3CPWS 2O88A 4AFUC 1UHCA 3EGDA 3MP6A 3CCRT 1OZ3A 1NBEB 3FDRA 1EZZB 1VIEA 3PGGA 3OMGA 3VYHB 4JS5A 3J81E 2MAMA 1S72Q 2CP7A 1E7OA 4YTLA 4JPBW 2YRCA 1WX6A 4HT9A 2CT3A 3RKWA 2OTJA 1ABOA 4DA4A 3VS7A 5LJ3f 5GAN5 3OSVA 5GAOp 4IUQA 3OYHA 1WHLA 2WSEE 1X69A 1JEGA 3ME9A 5IH2A 3EFSA 2BZYA 2L5QA 3FIFA 5IHIA 2LMJA 5GAN8 4PLLA 2E64A 2NUTA 1YJWT 5A2QE 1Y07A 3M0QA 4M7AA 2FB7A 2D0QB 2J6OA 4PJOC 3JCMf 3BW1A 1YFNA 4ZTFA 2JUFA 3MCAB 5CKHA 2CKKA 2CP0A 5LJ3e 1XJWB 5GAOn 1AOJA 1PD1A 3VS2A 1ZBXA 5I22A 2NUPB 1Q95G 2XKOC 2BZXA 2DEQA 5GMKh 3M57A 2OTJQ 1VQKT 2JT4A 3CC2T 2VVKA 2EW3A 3M0RA 3EH1A 4EDUA 2RQUA 1KQ2A 2DZCA 2RNAA 3G7ZA 2ATCB 1G83A 2OJ2A 5GANh 3CCQT 5D6XA 3I5RA 4NL3A 3OW2A 2MCNA 1VQKA 2FEIA 1H92A 4M78A 2ESWA 5J3BA 5HY6A 2AK5A 1VQ5T 1JJ2S 4PJOB 1C0MA 4EMKB 2C06A 1GL5A 2DKGA 4OGCA 1YJWQ 2M16A 4AFQC 4BI4A 2IG0A 3S3NA 4D6WA 2J06A 1NPRA 4II1A 4BUGA 4FIBA 3CMAA 1A0NB 1OPLA 1LCKA 4XU0A 3E19A 4FYVB 4M7DE 1X75C 4E2FB 2ROTA 1VQKQ 3A1PA 3CC2Q 3L2ZA 2E10A 4IKFA 8AT1B 1X27A 1BI2A 3S3MA 1RAAB 3BE3A 2KNBB 3HRUA 3L42A 5LJ5f 5I2SA 3QJYA 3QO3A 4M7DF 1X2KA 3NGPA 4Y28E 3CCQQ 2JS0A 3JCMc 4Z02A 1WYXA 1GRIA 4RTWA 3JAME 5GAN3 1QP2A 4AFSC 2EWNA 2RM4A 1VYUA 3O8VA 2MI6A 1WXTA 3CCET 2QAZA 2W10A 1VQMA 3OW2P 1YJNT 1SRLA 4ESRA 2X3WD 5HCKA 3CC7A 2DJZA 3M58A 3OBYA 2DM1A 1CSKA 3DLLA 2NLUA 5FLXE 2KAFA 2YHTA 1YI2T 1PSEA 3OB9A 5KYWA 2GTJA 2DETA 3TQ7P 4KGZB 1TXQA 2DVJA 2FO0A 2LT1A 3M0UA 2HKNA 2CZ0B 1MMGA 3EHRA 1ARKA 3EGDB 2VXFA 1NE8A 2NYSA 2CZ6B 2RO0A 3S3OA 1E6HA 2DD4A 4XQ3A 4L59A 3GF5A 2JMAA 3UDCA 2DIGA 3MEVA 2O31A 2MWPA 3HP9A 1VQMQ 5GAOr 2NWMA 3CPWA 3UF4A 3CCSA 3CC7Q 4QQGA 1JB0E 2G3RA 2BTTA 2RJFA 4RKUE 2K3XA 2E6ZA 2V26A 2JVVA 2BUDA 2IVWA 3HL8A 3TVTA 4KUDK 1MGQA 1PG5B 3JB9I 1ZUKA 2FZCB 1HK9A 2GCXA 3CCEQ 2F1LA 2EYQA 2EQMA 3LWIA 1F1BB 4L6V5 1YJNQ 4MZMA 1ZSGA 2NUTB 3M54A 2ENMA 3QPHA 4M78C 3QG1A 4C8QG 4M7AB 1KQSP 2J7IA 3QWXX 2QASA 1YI2Q 5EC7A 3CCSQ 2QA4T 4R55A 2RN8A 1OX9A 1D1AA 1U5SA 4XTXA 2DRKA 1VQOA 2H3EB 1OX8A 3RBBB 3JCMh 3TEEA 4WTOB 3QJ6A 3UATA 3BY7A 2FRYA 1LPLA 2XIDA 2P84A 2E3HA 2V1QA 3OS0A 4BE2A 2LP5A 4C92A 2CP3A 1YHQT 2CZ1B 2RH2A 2L3QA 1LOJA 1C6VX 2KI7A 3M55A 1QKWA 3OYEA 1TTHB 1M8MA 1UE9A 2VGNA 3LX7A 1KJWA 1RLQC 3C95A 4RTYA 1AWJA 1W2BS 3TCJA 3OA6A 3CPWP 4M78B 1VQOQ 1M5Q1 5KE3A 1PM3A 5GAMf 4E7JA 3JB9D 3L2WA 1ZUUA 3VJPA 2GNCA 3OYDA 2QQ9A 2E41A 3M0PA 2K5LA 2XK0A 4F16A 1OQKA 1Q81U 2VWFA 1TU0B 2XICA 3CC4T 2RB6A 2QA4Q 5KYXB 1SF9A 4DBHA 1JJ2A 1AD5A 1NM7A 3PVLA 2JOYA 4MDWA 5D6YA 1R8OB 2JJ9A 2HNIA 3LWHA 1AHJB 2QDLA 4ATOA 4FW1A 2MF2A 1YWPA 3OYNA 1YHQQ 5CKEA 1NLOC 2QEXA 4PK4A 4A54A 2YUPA 3QSUA 1B07A 1WQWA 3NTHA 1D0YA 2A37A 3CBMA 4FYYB 4XK8E 4KT0E 5LJ5h 9ATCB 1VQ6T 4HVVA 3VV0A 5EG2A 4C8QC 3PMIA 1ZQ1A 1UGRB 1GCQA 3EGUA 2PUKB 3PIPA 4JUVA 1M90U 1XOVA 3CCJA 3L2VA 4AFZC 4E7SA 2DTHA 1UG1A 3A8LB 1UEBA 4X9DA 4LDYA 4J9FA 2QEXQ 4MDXA 2KRNA 2CH4A 1WIEA 4OMOA 5CK9A 3IQLA 4OB1B 5KYWB 3JB9G 5CAIA 3EG9A 1KFZA 1OI1A 8ATCB 3VUBA 2L2PA 4JRKA 3OSSC 3C0CA 1WHGA 3RKYA 2QK0A 2LCLA 3P8BB 2I2LA 3HRTA 3CCJQ 1JJ2P 4Z89A 1YITT 1NPPA 2RMOA 2OX7A 3WXMB 5ECAA 1M1KU 2EAYA 1Q81C 2K79A 3E9FA 2RI2A 2FG0A 2K3BA 1VQ6Q 2HDAA 3DKMA 4CC7A 4D8KA 4HVWA 3V7RA 1K8AU 2JTEA 4FSSA 4A4GA 2Z0WA 5GMKe 1VYTA 2CUBA 2RQWA 1R0BG 1WJQA 2Y4YA 3A5ZB 1UFFA 1UGVA 1WGSA 1YBYA 2X9HA 1PRMC 1I81A 2ABLA 5M9OA 1Q7YU 2QQBA 5FWBA 5GANe 3DB3A 3CCLT 4GLMA 1WA7A 5GAN7 4KH0B 2SRCA 2HQXA 2ZGWA 4FCYA 1VQ7T 2AZSA 2O4XA 1UGSB 3I35A 2HSEB 2X4JA 4C92B 1YITQ 4PJLA 2YUOA 3G6EA 3QIIA 4HCZA 1SG5A 4FM4B 4CC3A 4M75B 4PFOA 3CCVT 2LX9A 2KROA 4XU3A 4M77D 2JZ2A 1AT1B 1IXDA 4O6JA 2ZZDA 3JCMW 2DF6A 3OYIA 1S72T 3CD6T 1V76A 2HMAA 3UA6A 3M59A 2J6FA 2RD1A 4M7DA 1NZ9A 1U1TA 3OYGA 3OS1A 4J5YA 5FU6C 5GAMh 4J83A 2YUQA 3CCVA 2D8HA 1OYXA 1KSWA 1GCQC 1W2BA 3CMEA 2EQKA 4DEYA 5GMKl 5KYYB 2DO3A 1TWBA 3CCLQ 2KMTA 3P8HA 4E7KA 1T0HA 4LE9A 4JLIA 4EIKA 4PJNA 3OYBA 2RK2A 1QWFA 1K8AC 2V8IA 1UGPB 2HSPA 5KYUA 2MIOA 1VQ7Q 1YJ9A 5GAOm 3E2UA 3OYMA 2AKKA 3VU3C 1YIJA 1ZA1B 2DNUA 1YN8A 3EHQA 4F7UG 4JRPA 3HKSA 3SD4A 2A08A 1QVGS 1OZ2A 3GOXA 1Q81R 2VV5A 3CCVQ 3URGA 2E3IA 2OTJT 2H8HA 2MYSA 3JB9F 1FYNA 1IB8A 3CMEQ 2A0FB 2YRVA 4BB7A 3QZ9B 4QW2A 1M1FA 5FU6B 3LW5E 3RERA 3CD6Q 1WI7A 2V8KA 1WLPB 4OVAA 2P0QA 4ZGEB 2KRSA 4KH1B 1I8FA 4M77G 1JXOA 1YJ9Q 4M7AD 2LQKA 4B9XA 4ME7A 3OBWA 1BCMA 1OU8A 2RJEA 2R57A 2LJ0A 1VIFA 4J7FA 4BI8B 2ZPGB 4F14A 2LZ6B 1KD1U 4F17A 1HD3A 2LDMA 3EG9B 2LQNA 1VQLA 1Q82U 4OB0B 1OEBA 4IIMA 1RLPC 4P5NA 1DJ7B 3RUXA 1W2BP 4KGXB 5C6SA 3QKJA 1M90R 2AHJB 3QDRB 4MMKA 1QVFS 1TOVA 1UJYA 1VQNA 2HCKA 3QZ5B 1RL2A 5DLOA 2X4WA 3LLRA 1KHIA 2QTVA 2JN0A 4ELYC 2K4YA 4FYXB 3OYAA 5IAYA 2DYIA 1MV3A 5CO7A 5GAN2 1BI0A 4FW2A 4M78D 3T9NA 1JQQA 3FLGA 4CRIA 3HSBA 4MZTA 1VUBA 2B8AA 1UHFA 4J6YA 3SB2A 3JCMe 2HQHA 4C0ZA 2LC4A 1JU5C 4NOYA 3TU4K 3ZL7C 1PSFA 3CBOA 3U23A 4O5VA 3GNGA 3CMAT 2A7YA 2CP5A 2DLPA 2CP6A 4EPCA 4M7DC 2E6NA 2X51A 4HXJA 5CVIA 1D3BA 1M30A 4KBMB 1PD0A 2M1HA 2KVQG 2X4XA 3OYLA 5CIUA 4LXCA 3VS1A 1SSFA 1K0XA 1VQ8A 3J80E 1K8AR 2D0NA 3CCMA 5FU7C 1G8XA 1G2BA 1FX7A 2O4XB 3FB9A 3QBYA 1NLPC 3X20B 2XDPA 3CBPA 3FC3A 2LTOA 5HKCA 3VRZA 3JCMb 1IGUA 4F7UE 1KD1C 5IHKA 1Q82C 4EMHA 2CZ7B 3SEMA 1D1CA 3M0TA 1VQMT 2HL5C 4WF2A 3CC7T 2XHCA 3LYIA 1H3HA 4LD6A 4F7UF 2D8JA 4K11A 2B86A 1ZSZA 4L5GA 3CMAQ 1YP5A 4TVRA 3UT1A 4M77E 2L3SA 5FU7B 1KQSA 2AIRB 4OGEA 2M51A 5LJ3g 1QKXA 1AVZC 5KCOA 4OF1A 4IURA 4FYWB 1JBMA 5LJ5e 3G4SA 4RTXA 5FWCA 1FMKA 2LCSA 1GFCA 1RADB 3LH0A 2NUZA 4DQ2A 1ZHIA 5KYUB 1TUDA 3OYCA 4ZNXA 4M77F 1WHKA 2K2VA 4PNOA 4FSXA 4KUIA 3CCST 3VS3A 2K6DA 3MEWA 1PKSA 3GP8A 1RAIB 3JCMX 3M4YA 1ABQA 3VUZA 4J9HA 1FMVA 4HVUA 2KDSA 2SEMA 2CP2A 2YXYA 1K73U 2F2VA 2VXEA 2FL7A 1NG2A 1MNEA 3OYFA 2KR3A 2DTOA 4J8OA 3CCUT 2OTLA 2EKOA 1I0CA 3C4SA 3KBGA 3SHWA 2EQJA 4C8QA 3G4SQ 1RI0A 3KUFA 2YDLA 4JRQA 2EIFA 1QVGA 1PNJA 4EMGA 2HQEA 1YCYA 2BZ8A 2PVOB 2DXCA 3GLXA 3RR6A 1RABB 3I56T 2RQRA 2J05A 1LNXA 4ZN3A 1VQOT 1IGQA 3CCUA 2ECZA 4Q5WA 1BYMA 1WHHA 2L89A 5GAOl 4PJMA 4OB2B 4OB3B 2OTLQ 2CYZB 3MEAA 4M7AE 3OS2A 4C92D 2QXFA 3UPUA 2WACA 2P4TA 5DLQE 5C0MA 3I56A 4M75D 4RTZA 1J3TA 2ZAEA 3PTAA 2ZPHB 5CKFA 3PNWC 4DOWA 3QWYA 1KD1R 1FWZA 4QT7A 2FHDA 1VOMA 5GANd 4M7AF 2M0YA 3ASKA 4J9GA 1SKUB 1Q82R 3CCUQ 2E1HA 1QVFA 4CC4B 3S6WA 3CXCS 2DFUA 5GJVB 3UWNA 1T0JA 4C5IA 1SHFA 1Q86U 2DILA 4R56A 1X2QA 3MP8A 4LDVA 4LUDA 5HK3A 1KQ1A 4OMQA 3V8KA 2K5IA 4OMMA 2OI3A 4ZN1A 3TREA 4A4KA 2R58A 3I56Q 1BB9A 1G3YA 4M78E 2E5QA 1QVGP 3OMCA 2GQIA 1D3BB 1WNLA 2HZYA 1K73C 2PU9B 3RIRA 2EGAA 1ZSZC 2DPPB 2HAXA 2JTFA 2JS2A 4LDXA 4J6WA 1UUEA 2ZPIB 3M5AA 4LNPA 4X1VA 2XI9A 2QEXT 2WSCE 1Y71A 2DD5A 4M78F 1U1SA 4Y92A 4BY6C 1JO8A 2RPNA 2VASA 3QXEB 5L8RE 5GAMe 2FPEA 3RMSA 1HYOA 2KYBA 1VQ4A 1QMCA 2ROLA 2DBKA 4QVDA 4M75G 3CCJT 3INZA 3EFRA 4QVZA 2JTMA 3OQ5A 4RCCA 2F69A 5L23A 4B9WA 2FPFA 1QVFP 2RI3A 2FRWA 1ZSZB 3N5BB 4OP0A 4WCIA 3MO8A 1X43A 1VA7A 4QQ6A 3M9QA 5KE2A 2DA9A 3BDUA 5KCHA 1ZX6A 1XQHA 2HBPA 1QP3A 2BE9B 1TSFA 1QLYA 3MEUA 4BY6B 3CQTA 4HCBA 1TUCA 4B6MA 4JJDA 1Q86C 2GF7A 2KQWA 2EGCA 1V1CA 2JM9A 3OYYA 3L2UA 2QQSA 2QGGA 1TG0A 4ZGJB 4J7IA 5J26A 3R6NA 2GFAA 2P0PA 1GCPA 1VQPA 4LD9K 2KT1A 1N27A 2X4YA 1T3SA 3M0SA 1IZ6A 4C8QB 1M4ZA 2MPXC 1U06A 1M1GA 2D1XA 3A8GB 4JJBA 1PC0A 5LJ3d 2RHYA 1N9RA 1Z9QA 5GAOq 4PJOD 2HEQA 2RQVA 1K9MU 1ZBJA 3QHSA 4DEXA
chains in the Genus database with same CATH topology
3A8MB 2V8KA 1VQ4T 3HRUA 3L42A 4OVAA 2P0QA 4ZGEB 5I2SA 5LJ5f 2DXBA 4M75A 2E65A 4UC4A 1N8RU 3QJYA 2QA4A 1TH7A 3QO3A 1I8FA 4M77G 4M7DF 4Y91A 4M7AD 1FXXA 4Y28E 3JCMJ 3JCMd 2LQKA 4B9XA 4ME7A 3OBWA 2O01E 1I4K1 2PVDB 2RJEA 5A0LA 3JCMc 4Z02A 2R57A 1VIFA 4J7FA 4BI8B 2ZPGB 3JAME 3FJPA 2VYTA 3E1SA 3H8ZA 3HRSA 5GAN3 3G6ET 2D6FA 4PKCC 3VKIA 1QP2A 5FRMA 1KD1U 4A4FA 1Y7XA 2EWNA 1KC8C 2RM4A 2LNVA 2OAUA 2LDMA 2DTIA 2KK4A 1G3SA 1VQLA 3O8VA 3MP1A 4E7HA 1Q82U 4OB0B 2MI6A 2RHIA 4P5NA 1YHQA 1O9SA 3V7CA 3CCET 3RERA 1VQMA 2KSSA 1DJ7B 4C92G 1YJNT 4X9CA 3RUXA 5C6SA 4ZTJA 3QKJA 2DJZA 5KH6A 3M58A 3SWNA 3CC7A 3OBYA 3FRNA 3DLLA 2AHJB 2NLUA 3QDRB 5FLXE 3AHUA 2KAFA 2YHTA 3A8HB 4LDWA 1PSEA 2LVMA 3OB9A 4MMKA 4N4IA 1YI2T 1M90C 4C92E 1QVFS 1GXIE 1VQNA 2JNGA 1Y96B 3QZ5B 1RL2A 2LT1A 4EMKA 2A3LA 2EJ9A 3RMQA 5DLOA 1U8RA 2X4WA 2CZ0B 5GAN4 3X26B 3LLRA 1KHIA 4M75E 3I55A 4E7IA 2QQAA 2JN0A 4ELYC 3L2RA 2K4YA 2VXFA 1NE8A 3M53A 3OYAA 1UB4A 2R5MA 5IAYA 3PIOA 2ZCFB 1BIAA 5CO7A 2CZ6B 3CMET 1BI1A 2RO0A 3S3OA 2DD4A 1BI0A 4L59A 4XQ3A 4M78D 5GAN2 3T9NA 3GF5A 3GNFB 3OYKA 4QQDA 4FT2A 3FLGA 3L1AA 3UDCA 4CRIA 3HSBA 2DIGA 2WSFE 3MEVA 4MZTA 5A0GA 1KHCA 3H6ZA 2MWPA 3HP9A 1VUBA 4C0DC 4C92F 2B8AA 3SB2A 4J6YA 5GAN6 3JCMe 3HPWA 4N0AC 2RHXA 3ER0A 4C0ZA 2LC4A 5GAOr 2DAQA 3CC4A 3PMTA 3CPWA 3E9GA 3CCSA 4NOYA 4M75F 3TU4K 2PQWA 5DM7R 2DIQA 4QQGA 1PSFA 4F7UA 1JB0E 2G3RA 2RJFA 3CBOA 4RKUE 3WVEB 1YIJT 4BI3A 1YJ9T 1VQPT 5HK0A 4PJOG 2K3XA 3GNGA 2E6ZA 4O5VA 2RHUA 3CMAT 1LJOA 4MMLA 2A7YA 1HXDA 2JVVA 2BUDA 5CKDA 3MHXA 2IVWA 4EPCA 1XNIA 4NL2A 1M1KC 2E6NA 4M7DC 3HL8A 3M56A 5CVIA 4KUDK 1D3BA 2K3YA 1MGQA 4KBMB 3JB9I 2M1HA 2KVQG 4C0GA 2X4XA 3OYLA 1UGQB 5CIUA 1HK9A 1JRIA 2HD0A 1SSFA 2GCXA 4JDSA 2EYQA 4IUVA 3EAEA 5LJ5j 1VQ8A 2EQMA 2VUBA 4XTVA 3J80E 4L6V5 3LWIA 3OY9A 1M8VA 2Y4XA 1IREB 4MZMA 3M54A 3CCMA 5FU7C 3X24B 3QPHA 4M78C 1K9MC 3G71A 2PVGB 3QG1A 4C8QG 4M7AB 1I5LA 4M77A 1G5VA 2XDBA 1FX7A 2ZPBB 3JCMV 5LJ5d 2O4XB 3FB9A 4FT4A 1N8RC 1N9SA 1G3TA 3QBYA 4JS4A 2QA4T 2MMPA 3CEYA 4R55A 3SFMA 2XDPA 3X20B 4BD3A 3CBPA 1VQ6A 4C8QE 4XTXA 3FC3A 2LTOA 1VQOA 5HKCA 4C0DB 3JCMh 3TEEA 2D9TA 2PUOB 3QJ6A 3V7SA 3JCMb 3KXTA 4F7UE 3BY7A 3JCMP 2XD0A 1KD1C 3SDZA 2YLBA 4C5GA 4RMOA 1H3ZA 2XIDA 1Q7YC 2BIVA 3L2QA 3OS0A 3HFOA 4BE2A 4C92A 1Q82C 1VQLT 5CCAA 4EMHA 4HKEA 2CZ7B 2MWOA 1YHQT 2CZ1B 4N4HA 2RH2A 4BDYA 1VQMT 4RCBA 1LOJA 4C8QF 4FL6A 5GANg 3M55A 4WF2A 3OYEA 5GAMg 2XHCA 1BI3A 3CC7T 2RK1A 3LYIA 1WJRA 2VGNA 4LD6A 4F7UF 3LX7A 3PFSA 4GY5A 4C92C 3OW2S 3F70A 3C95A 5CKBA 4L5GA 1VQNT 4RG8A 1W2BS 4TVRA 1W4SA 3TCJA 4M77E 3UT1A 3ZFJA 2V8JA 3OA6A 5FU7B 1KQSA 4M75C 4M78B 4KULA 1M5Q1 5KE3A 4OGEA 5GANf 3I55T 5GAMf 2DZ9A 5LJ3g 4E7JA 5KCOA 4OF1A 3QYHB 4IURA 1QW1A 3JB9D 1X6OA 1G3WA 3L2WA 1YITA 3VJPA 1JBMA 2VC8A 5LJ5e 3G4SA 3OYDA 2ZPFB 3HHTB 2QQ9A 4XU2A 2RI5A 2E41A 2K5LA 4ZGDB 2M9UA 1X01A 2XK0A 4FU6A 3Q1JA 3VYGA 4HA8A 4PL6A 4QVCA 4DQ2A 3DB4A 3LH0A 3CCRA 1Q81U 1ZHIA 3OYCA 2XICA 3CC4T 4M77F 1NJIU 2RB6A 2QQRA 2K2VA 4X34A 2LRQA 4PNOA 3LGFA 3NTKA 4FSXA 4KUIA 3CCST 2QI2A 4PJOA 4MZPA 3JSCA 4M7DD 3MEWA 3GP8A 1JJ2A 3FEOA 3JCMX 3M4YA 3VUZA 1B34A 2KDSA 3SWNC 3R6OA 4IUPA 2L8DA 4XTYA 5I21A 4DOVA 1K73U 4XTWA 1N6AA 2GFUA 2VXEA 2JOYA 2FL7A 4MDWA 1R8OB 3P8DA 2HNIA 4XU1A 5D6YA 3LWHA 1AHJB 4ATOA 4OMFB 4GLKA 3OYFA 2DVEA 2DTOA 4EMKC 2XU8A 2P0KA 4J8OA 2MF2A 3CCUT 3OYNA 2OTLA 2EKOA 3C4SA 3KBGA 3CPFA 2RJCA 5CKEA 2EQJA 4C8QA 2QEXA 1RI0A 3CXCA 1H641 1VQ8T 2RJDA 3KUFA 4JRQA 2EIFA 3NFCA 3CCMT 2CGHA 5FRNA 1QVGA 3G71T 2EJGA 4A54A 4EMGA 5AYFA 2RHZA 2HQEA 3QSUA 1WQWA 2PVOB 1YCYA 2VGMA 3CBMA 3NTHA 4XK8E 3V8JA 2DXCA 3JCMQ 3GLXA 3CCLA 4KT0E 2K5FA 4C5HA 4JRIA 5LJ5h 4IUUA 3I56T 1VQ6T 5J39A 3VV0A 1YJWA 5EG2A 1LNXA 5I2MA 4C8QC 3PMIA 1KQSS 1ZQ1A 1V29B 1VQ9T 4XTZA 1UGRB 4ZN3A 1VQOT 4CI0C 4ELZC 4XTUA 1VQ7A 5GMKj 4PJOE 2Y90A 2PUKB 3PIPA 4JUVA 3CCUA 1M90U 4M7AG 1XOVA 4Q5WA 3CCJA 3J7AF 4RG2A 1BYMA 2XG8D 2L89A 5GAOl 3L2VA 2EQUA 4OB2B 2RA2A 2DTHA 2DK3A 3QYGB 3A8LB 2BKDN 4OB3B 5IN1A 1UEBA 2CYZB 3MEAA 4X9DA 4M7AE 4LDYA 4IUTA 3OS2A 2FVUA 5CR2A 3QUIA 2QXFA 3LGLA 5LL6S 4NS5A 3SWNB 4C92D 4MDXA 3UPUA 2WACA 3CC2A 2P4TA 2M0OA 5CK9A 4OB1B 5DLQE 5C0MA 3I56A 3JB9G 3HFNA 5CAIA 4M75D 2EFIA 4PJOF 1OI1A 2X35A 1VQ9A 5CQYA 5GANj 2LQ8A 1S72A 3VUBA 2LT4A 5GAMj 1MHNA 3CD6A 1M9SA 3PTAA 2ZPHB 4JRKA 3PNWC 5CKFA 4DOWA 3A8OB 3OSSC 4M77C 1FWZA 1WPYA 3OS5A 4E47A 2F5KA 3RKYA 2EJFA 2FHDA 5GANd 4M7AF 3ASKA 3ZBDA 2LCLA 5GAMd 3CCQA 3P8BB 3JB9H 4M7DG 2I2LA 5CQXA 3HRTA 3C12A 2E1HA 2F5TX 1Y96A 1QVFA 1P92A 1NPPA 4PLIA 3S6WA 1YITT 3CXCS 2L3RA 5FROA 3UWNA 3G4ST 3CPWS 2KY9A 3WXMB 4C5IA 1Q86U 4R56A 3MP8A 4LDVA 1M1KU 3MP6A 4M7DB 3CCRT 1VQ5A 5HK3A 1KQ1A 2EAYA 1Q81C 1OZ3A 3E9FA 4M78G 2K5IA 3FDRA 2RI2A 3V8KA 4F7UB 3TREA 4ZN1A 1NJIC 1WQ7A 2YLCA 4A4KA 1VIEA 3PGGA 3OMGA 2R58A 3VYHB 2DXUA 3DKMA 4JS5A 3J81E 5IT9E 3V7RA 2MAMA 1K8AU 1G3YA 4M78E 1KG1A 2E5QA 4A4GA 5GMKe 3OMCA 1D3BB 1WNLA 4YTLA 1K73C 2PU9B 3RIRA 4VUBA 1WJQA 2Y4YA 3A5ZB 2DPPB 2HAXA 2JTFA 2E12A 4LDXA 4J6WA 4HT9A 2OTLT 2ZPIB 1WGSA 1YBYA 3M5AA 3RKWA 2OTJA 2XI9A 2QEXT 4M77B 4DA4A 5LJ3f 1EIFA 1I81A 5GAN5 2ZPEB 2WSCE 3OSVA 4C8QD 5GAOp 4IUQA 1Y71A 2DD5A 4M78F 5M9OA 3OYHA 1U1SA 1Q7YU 3JCMg 2WSEE 3JB9J 4A4HA 2QQBA 4BY6C 3QXEB 5GANe 3DB3A 3ME9A 4LDUA 3EFSA 2L5QA 3FIFA 5L8RE 3CCLT 2H3JA 5GAMe 3RMSA 5GAN7 4XAXB 5GAN8 4PLLA 1VQ4A 3BFMA 2E64A 1YJWT 2FYKA 5A2QE 1Y07A 4M7AA 2FB7A 2D0QB 2HQXA 4J6XA 2ZGWA 4PJOC 4QVDA 1VQ7T 2LCCA 2O4XA 3BW1A 2CS7A 4M75G 3JCMf 1UGSB 4A4EA 4ZTFA 2JUFA 3MCAB 3CCJT 3M4GA 2X4JA 5CKHA 4C92B 3INZA 2CKKA 3EFRA 5LJ3e 5GAOn 3G6EA 4QVZA 3QIIA 3C94A 4FM4B 1ZBXA 4HCZA 1BKBA 2XKOC 2JTMA 4M75B 3OQ5A 4RCCA 2F69A 1KC8U 4N0AA 4M7AC 2DEQA 3CCVT 3JRZA 5GMKh 3M57A 4B9WA 1VQKT 2QDYB 2LX9A 3CC2T 4XU3A 4HT8A 3PT9A 4V2SA 3ZEHA 4M77D 2JZ2A 3CCEA 5FU6B 2RI3A 4O6JA 1YJNA 3N5BB 2ZZDA 4OP0A 4EDUA 3GPLA 3MO8A 3JCMW 4QQ6A 3M9QA 5KE2A 3OYIA 3BDUA 2GQVA 1S72T 3CD6T 5KCHA 1XQHA 2E70A 2HBPA 4BACA 1YI2A 3M59A 1KQ2A 1QP3A 2RD1A 4M7DA 1NZ9A 1U1TA 2DZCA 3OYGA 3G7ZA 3OS1A 3MEUA 4C0FA 4J5YA 4BY6B 5GANh 1O75A 3NTIA 3CCQT 4HCBA 5D6XA 5FU6C 5GAMh 4J83A 4NL3A 3CCVA 3DLMA 3OW2A 1VQKA 1OYXA 1W2BA 4M78A 1Q86C 2GF7A 2K57A 2KQWA 5J3BA 3CMEA 2EQKA 2QTXA 5HY6A 5GMKl 4BE1A 1VQ5T 1JJ2S 4PJOB 3OYYA 2DO3A 3L2UA 4EMKB 2KMTA 3P8HA 5D6WA 1QVPA 2QQSA 4JJNK 4E7KA 2C06A 2DKGA 5LJ3h 4OGCA 4JLIA 1B34B 4ZGJB 4J7IA 3OYBA 3GIBA 2M16A 2RK2A 3V8LA 1BIBA 2V8IA 5J26A 1K8AC 1UGPB 2GFAA 2P0PA 2XDDA 4BI4A 4BE0A 4N4GA 1YJ9A 5GAOm 1VQPA 2IG0A 3OYMA 1XTDA 3VU3C 3S3NA 4D6WA 1YIJA 1NPRA 4HCCA 4LD9K 4II1A 4E7LA 1N27A 1WJSA 4BUGA 2X4YA 4FIBA 4F7UG 3CMAA 4JRPA 3HKSA 2R5AA 5LJ3j 1IZ6A 4C8QB 4XU0A 3SD4A 1M4ZA 3E19A 1QVGS 1OZ2A 3GOXA 4M7DE 1X75C 2VV5A 1M1GA 3OYJA 3URGA 5LJ5g 5GMKm 3A8GB 2OTJT 3WVDB 5A0DA 4BDZA 3JB9F 3RKXA 3L2ZA 4A53A 5DY9A 5LJ3d 5GMKi 2RHYA 2YRVA 4BB7A 1N9RA 3RESA 3X25B 2E10A 4C5EA 3QZ9B 4IKFA 3META 4QW2A 3X28B 5GAOq 4PJOD 4JLGA 2DXTA 1M1FA 1BI2A 3LW5E 3S3MA 3QHSA 1K9MU 3BDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5H A;  4OVA A;  2O4X B;  3L42 A;  4PLL A;  4IUU A;  3QBY A;  4UC4 A;  5J39 A;  3CEY A;  4BD3 A;  2XDP A;  3PMI A;  2HQX A;  3FC3 A;  2LTO A;  2LCC A;  2O4X A;  4B9X A;  4A4E A;  4ZTF A;  2D9T A;  3QJ6 A;  2RJE A;  4Q5W A;  4RG2 A;  2CKK A;  2R57 A;  4Z02 A;  2L89 A;  2VYT A;  3H8Z A;  3L2V A;  4C5G A;  2EQU A;  4QVZ A;  3QII A;  5FRM A;  4HCZ A;  4A4F A;  1H3Z A;  2BIV A;  3L2Q A;  2LDM A;  3OQ5 A;  3OS0 A;  4BE2 A;  2BKD N;  5IN1 A;  3MEA A;  4IUT A;  3OS2 A;  4B9W A;  3O8V A;  3MP1 A;  4E7H A;  3LGL A;  2MWO A;  4NS5 A;  2RHI A;  4N4H A;  2WAC A;  3ZEH A;  4BDY A;  2JZ2 A;  2M0O A;  2RI3 A;  4FL6 A;  5C0M A;  4EDU A;  3OYE A;  5C6S A;  3MO8 A;  4ZTJ A;  2EFI A;  3QKJ A;  4QQ6 A;  5KH6 A;  1OI1 A;  2X35 A;  3LYI A;  3M9Q A;  1WJR A;  5KE2 A;  3OYI A;  4LD6 A;  2NLU A;  5KCH A;  3LX7 A;  1MHN A;  3PFS A;  4GY5 A;  2LVM A;  4N4I A;  3OB9 A;  3F70 A;  3PNW C;  4BAC A;  3UT1 A;  3OYG A;  3OA6 A;  2F5K A;  2X4W A;  3OS1 A;  2FHD A;  3MEU A;  3LLR A;  5KE3 A;  3ASK A;  4E7I A;  3NTI A;  5D6X A;  3L2R A;  4E7J A;  5KCO A;  3DLM A;  4IUR A;  3OYA A;  2R5M A;  4PLI A;  3S6W A;  5IAY A;  3L2W A;  1OYX A;  2L3R A;  5FRO A;  3UWN A;  2GF7 A;  2RO0 A;  3OYD A;  4C5I A;  3S3O A;  2EQK A;  4L59 A;  4BE1 A;  3MP8 A;  2RI5 A;  3OYK A;  4QQD A;  3MP6 A;  3FLG A;  2XK0 A;  4FU6 A;  4CRI A;  3L2U A;  2DIG A;  3Q1J A;  3MEV A;  4PL6 A;  1OZ3 A;  1KHC A;  2MWP A;  3DB4 A;  3E9F A;  2RI2 A;  3FDR A;  3H6Z A;  3LH0 A;  2B8A A;  2QQS A;  3P8H A;  5D6W A;  3OYC A;  4E7K A;  3ME9 A;  2RHX A;  3OMG A;  2R58 A;  2DAQ A;  2QQR A;  4X34 A;  2LRQ A;  3PMT A;  3OYB A;  3LGF A;  3NTK A;  3E9G A;  2M16 A;  5J26 A;  3MEW A;  2PQW A;  2GFA A;  2DIQ A;  4QQG A;  3FEO A;  2E5Q A;  2G3R A;  2RJF A;  4BE0 A;  4N4G A;  4A4G A;  3NTH A;  2IG0 A;  3OYM A;  3OMC A;  3S3N A;  2K3X A;  4IUP A;  2L8D A;  4II1 A;  2RHU A;  1N27 A;  1WJS A;  4E7L A;  2X4Y A;  2GFU A;  2BUD A;  2R5A A;  5D6Y A;  1WJQ A;  3P8D A;  1XNI A;  3SD4 A;  2E6N A;  2JTF A;  3OYF A;  1OZ2 A;  3GOX A;  2K3Y A;  2P0K A;  3OYJ A;  2M1H A;  2X4X A;  3OYN A;  3OYL A;  2EKO A;  1WGS A;  3C4S A;  5CIU A;  4BDZ A;  2RJC A;  1SSF A;  2EQJ A;  2RHY A;  1RI0 A;  4IUV A;  2YRV A;  2RJD A;  3EAE A;  3KUF A;  2EQM A;  4IUQ A;  4C5E A;  3OY9 A;  3OYH A;  4IKF A;  5M9O A;  5FRN A;  3MET A;  4QW2 A;  4A4H A;  2RHZ A;  2HQE A;  3S3M A;  3DB3 A;  1G5V A;  3BDL A; 
#chains in the Genus database with same CATH topology
 1K73 R;  1M3C A;  1TH7 A;  4Y91 A;  1NYF A;  3JCM d;  1WHM A;  2PVD B;  1I5O B;  2VB6 A;  2LJ3 A;  3G6E T;  3E1S A;  3H8Z A;  3HRS A;  4A4F A;  2LNV A;  2OAU A;  2ED1 A;  3MP1 A;  4E7H A;  1O9S A;  3V7C A;  4Z88 A;  3SWN A;  2QG9 B;  3FRN A;  2PZ1 A;  3AT1 B;  4LDW A;  1M90 C;  1GXI E;  4C92 E;  5AT1 B;  2DYB A;  4EMK A;  3QDF A;  2L0A A;  5GAN 4;  4M75 E;  4OML A;  2A28 A;  2JMC A;  3I55 A;  4E7I A;  3L2R A;  2AZV A;  3PIO A;  1BIA A;  4KGV B;  1PWT A;  3CME T;  1W6X A;  1GBQ A;  3GNF B;  3OYK A;  4QQD A;  3LH5 A;  3L1A A;  1KHC A;  2CUD A;  4C92 F;  3HPW A;  2RHX A;  3ER0 A;  2FZG B;  2DAQ A;  2MOX A;  1AWW A;  2VKN A;  4M75 F;  1QQJ A;  5DM7 R;  2DIQ A;  2YUN A;  3VS4 A;  4F7U A;  1YJ9 T;  3WVE B;  1IHV A;  4BI3 A;  1YIJ T;  5HK0 A;  4JZ3 A;  2CT4 A;  4PJO G;  2KEA A;  1Y0M A;  1MUZ A;  2RHU A;  3VS0 A;  4MML A;  1Q86 R;  3G6E Q;  1UEC A;  2EYZ A;  3MHX A;  5IXF A;  3NHN A;  4NL2 A;  1M1K C;  3M56 A;  2DL3 A;  1BK2 A;  1M2O A;  1NYG A;  1QCF A;  3A98 A;  2EVR A;  2DER A;  2EKH A;  1JRI A;  3VS5 A;  2DL5 A;  4LUE A;  4JDS A;  2VUB A;  2Y4X A;  2PNI A;  1K9M C;  3G71 A;  2RQT A;  1I5L A;  1D0X A;  4M77 A;  2XDB A;  3JCM V;  5LJ5 d;  1G3T A;  4JS4 A;  2LX7 A;  2MMP A;  3CEY A;  4BD3 A;  3FJ5 A;  3GBQ A;  1CKB A;  3EH2 A;  2D9T A;  2PUO B;  1Z9Z A;  2YT6 A;  3JCM P;  2IIM A;  3EFO A;  4C5G A;  4RMO A;  1H3Z A;  1Q7Y C;  3HFO A;  1B7T A;  5GJW B;  1VQL T;  2MWO A;  4BDY A;  1B3Q A;  1OOT A;  5GAN g;  3VRY A;  3G71 Q;  2V1R A;  3MPU B;  2KXC A;  1YIJ Q;  3PFS A;  4GY5 A;  2DL8 A;  1VQN T;  3ZFJ A;  3CXC P;  1H8K A;  1QWE A;  4KUL A;  1WZO A;  2DZ9 A;  4DBR A;  1QW1 A;  1X6O A;  2VC8 A;  2ZPF B;  1E6G A;  2L3P A;  1ACM B;  2M9U A;  4FU6 A;  4AMC A;  4ORZ A;  4QVC A;  3CCR A;  4HA8 A;  4PL6 A;  2DJQ A;  1N5Z A;  1KIK A;  2E5K A;  4AG2 C;  1NJI U;  4X34 A;  2LRQ A;  4J9I A;  4A63 B;  3LGF A;  2JM8 A;  1NEB A;  3JSC A;  4D8D A;  1AWO A;  4F04 B;  1B34 A;  1AZG B;  2FZK B;  3SWN C;  3R6O A;  1Y57 A;  2COY A;  2L8D A;  4XTY A;  4Z8A A;  4DOV A;  2GFU A;  5FW9 A;  2HBW A;  2EYY A;  2LNH B;  4GLK A;  2DVE A;  4EMK C;  2XU8 A;  2RF0 A;  3G1J A;  1BCO A;  1VQL Q;  2RJC A;  3H0F A;  2KXD A;  1H64 1;  1VQ8 T;  2RJD A;  2CSQ A;  3NFC A;  3CCM T;  2CGH A;  5IHN A;  3CCR Q;  3TSZ A;  1RAF B;  1YNZ A;  2K5F A;  1VQN Q;  4IUU A;  5J39 A;  2KE9 A;  1YJW A;  2JW4 A;  1M1K R;  1V29 B;  1VQ9 T;  4CI0 C;  1K4U S;  4XTU A;  5GMK j;  4PJO E;  2Y90 A;  4M7A G;  1OV3 A;  1ZA2 B;  1W1F A;  1K76 A;  1K9M R;  3QYG B;  1WDX A;  1KK7 A;  4AG1 C;  4IUT A;  2FVU A;  3QUI A;  3LGL A;  3SWN B;  4NS5 A;  3CC2 A;  2GBQ A;  1WXB A;  1EFN A;  3HFN A;  1K0S A;  2EFI A;  2HKQ B;  4PJO F;  1VQ9 A;  5CQY A;  5GAN j;  2YWW A;  2EYW A;  1MHN A;  4OMP A;  1M3A A;  1UDL A;  3A8O B;  4M77 C;  4JJC A;  1LVK A;  1WPY A;  3OS5 A;  4E47 A;  6AT1 B;  1Q7Y R;  2EJF A;  5GAM d;  3CCQ A;  1PRL C;  3C12 A;  5KYX A;  1Y96 A;  1HJD A;  5FRO A;  1D1B A;  1D0Z A;  3G4S T;  1VQ8 Q;  2KY9 A;  2C0O A;  3CCM Q;  4M7D B;  1VQ5 A;  3O5Z A;  1SPK A;  4M78 G;  4F7U B;  1NJI C;  1WFW A;  1WQ7 A;  1ZUY A;  2YLC A;  1TUG B;  3I5S A;  2DXU A;  2CDT A;  5IT9 E;  1VQ9 Q;  1KG1 A;  1TS9 A;  4VUB A;  2A36 A;  1OPK A;  4R0K A;  2E12 A;  1RUW A;  4J9D A;  2OTL T;  2CRE A;  1PKT A;  2X3X D;  2I0N A;  4IIO A;  2LQW A;  4M77 B;  1EIF A;  2ZPE B;  4C8Q D;  2C0T A;  3EGX A;  1M2V A;  1VQ5 Q;  3JCM g;  3JB9 J;  2K7A A;  4A4H A;  3ULR B;  2QGF B;  4LDU A;  2H3J A;  4XAX B;  3BFM A;  1SRM A;  2FYK A;  2KGT A;  1SHG A;  3EFO B;  1R0C B;  4J6X A;  4OMN A;  2LCC A;  2CS7 A;  1RAE B;  4A4E A;  3M4G A;  1I1J A;  1JXM A;  2YSQ A;  3PVQ A;  1HSQ A;  3C94 A;  1FMW A;  4DBF A;  1BKB A;  2COZ A;  1KC8 U;  4M7A C;  4N0A A;  2LJ1 A;  3JRZ A;  3EG2 A;  2QDY B;  4HT8 A;  3PT9 A;  1VYV A;  4V2S A;  3ZEH A;  4RUG A;  3CCE A;  1YJN A;  3MKD A;  2MK5 A;  3GPL A;  1EX4 A;  1MMA A;  2QYZ A;  2G6F X;  2KYM A;  2GQV A;  2E70 A;  4BAC A;  1YI2 A;  1WXU A;  2DL7 A;  1OU9 A;  2JXB A;  4C0F A;  1O75 A;  3NTI A;  4PFZ A;  3DLM A;  1RAH B;  5I11 A;  3NMZ C;  2K57 A;  2DX1 A;  2QTX A;  4BE1 A;  5D7U A;  4QKU A;  5D6W A;  1QVP A;  4JJN K;  4E7Z A;  5LJ3 h;  1U3O A;  1B34 B;  1I07 A;  3GIB A;  2W0Z A;  4PJJ A;  2E4H A;  1BIB A;  3V8L A;  3H9N A;  2XDD A;  3H0H A;  1W70 A;  4BE0 A;  4N4G A;  1XTD A;  1IO6 A;  4HCC A;  4E7L A;  1WJS A;  4E6R A;  4J9B A;  2R5A A;  5LJ3 j;  2O2O A;  3D7S B;  2GTO A;  3OYJ A;  2DMO A;  5LJ5 g;  5GMK m;  1SSH A;  2K2M A;  1NJI R;  3WVD B;  5A0D A;  4BDZ A;  3RKX A;  4DBQ A;  2O9S A;  4A53 A;  5DY9 A;  5GMK i;  1X6G A;  3EG0 A;  3X25 B;  3RES A;  4C5E A;  3MET A;  1GBR A;  3UA7 A;  3X28 B;  2GGR A;  4JLG A;  2DXT A;  3BDL A;  1D09 B;  3A8M B;  7AT1 B;  1OUL A;  1GFD A;  1VQ4 T;  5KYN A;  2DXB A;  4M75 A;  2E65 A;  4UC4 A;  1N8R U;  4GBQ A;  2QA4 A;  3H41 A;  1YCS B;  3EG3 A;  1FXX A;  4J9E A;  1IRX A;  3JCM J;  3THK A;  2O01 E;  1RAC B;  1CKA A;  1I4K 1;  5A0L A;  2D6F A;  3FJP A;  2VYT A;  1NEG A;  4PKC C;  3VKI A;  5FRM A;  1Y7X A;  2EPD A;  1KC8 C;  1AZE A;  1C1A A;  2DTI A;  2KK4 A;  1G3S A;  2DBM A;  2RHI A;  1YHQ A;  4RTU A;  2KSS A;  4C92 G;  4X9C A;  4ZTJ A;  5KH6 A;  3AHU A;  3A8H B;  2LVM A;  4N4I A;  2JNG A;  4KRT A;  1Y96 B;  5KYY A;  2PTK A;  1U8R A;  2A3L A;  2EJ9 A;  3RMQ A;  3HTR A;  2KBT A;  3X26 B;  3I9Q A;  2IPO B;  2QQA A;  3M53 A;  1UB4 A;  2DRM A;  2R5M A;  2ZCF B;  1K1Z A;  1BI1 A;  4FT2 A;  2WSF E;  2XMF A;  5A0G A;  3H6Z A;  4C0D C;  5GAN 6;  4N0A C;  2OAW A;  1VQ4 Q;  4HCK A;  3CC4 A;  3PMT A;  3E9G A;  3NPF A;  2PQW A;  1AEY A;  1VQP T;  2AT1 B;  1T3L A;  2F2W A;  1SEM A;  1LJO A;  1HXD A;  3TSW A;  5CKD A;  1XNI A;  2EQI A;  2K3Y A;  3EGX B;  1M2V B;  4C0G A;  1UGQ B;  2HD0 A;  3VS6 A;  5LJ5 j;  4IUV A;  3EAE A;  1M8V A;  4XTV A;  3OY9 A;  1IRE B;  3X24 B;  2PVG B;  1G5V A;  2M02 A;  2ZPB B;  4RTT A;  3CC4 Q;  4FT4 A;  1N8R C;  1N9S A;  1VQ6 A;  3SFM A;  4AT1 B;  4C8Q E;  2HL3 A;  1WHJ A;  1MMD A;  4C0D B;  3V7S A;  3RNJ A;  4JZ4 A;  4PFP A;  3KXT A;  2BE7 D;  2XD0 A;  3SDZ A;  2YLB A;  2BIV A;  3L2Q A;  1BBZ A;  2CH4 W;  5CCA A;  4HKE A;  2P4R A;  4N4H A;  1YWO A;  4RCB A;  2NUP A;  4C8Q F;  4FL6 A;  5GAM g;  1BI3 A;  3REB B;  2RK1 A;  3EG1 A;  1WJR A;  1VQP Q;  2DL4 A;  4C92 C;  3OW2 S;  3F70 A;  5CKB A;  4RG8 A;  4J9C A;  1PHT A;  1W4S A;  2V8J A;  1R77 A;  1KC8 R;  3H0I A;  4M75 C;  5GAN f;  3I55 T;  3QYH B;  1G3W A;  1YIT A;  2FPD A;  3HHT B;  4XU2 A;  2RI5 A;  4ZGD B;  2EYX A;  2DEU A;  1X01 A;  1X6B A;  3Q1J A;  3VYG A;  3DB4 A;  1UTI A;  3KFV A;  4M4Z A;  1S1N A;  2K9G A;  2QQR A;  1MMN A;  3NTK A;  4PJO A;  4RTV A;  2QI2 A;  4MZP A;  4M7D D;  5IXB A;  3FEO A;  1M27 C;  4IUP A;  2C0I A;  5I21 A;  4XTW A;  1N6A A;  1BU1 A;  4ANJ A;  2AKL A;  4XU1 A;  3P8D A;  2EGE A;  4OMF B;  2P0K A;  4CC2 A;  2KT8 A;  2F2X A;  3CPF A;  3CXC A;  1M3B A;  5FRN A;  3RDV A;  3G71 T;  2EJG A;  5AYF A;  2DE0 X;  2RHZ A;  2VGM A;  3JCM Q;  3V8J A;  3CCL A;  1PCX A;  1K9A A;  4C5H A;  1QCN A;  4JRI A;  5I2M A;  1KQS S;  2EBP A;  1UJ0 A;  2J6K A;  4XTZ A;  2O9V A;  3I55 Q;  4ELZ C;  1VQ7 A;  3J7A F;  4RG2 A;  2XG8 D;  1MND A;  2EQU A;  1MV0 B;  2RA2 A;  1RAG B;  1ZLM A;  2DK3 A;  2BKD N;  5IN1 A;  3PE0 A;  1AWX A;  5CR2 A;  5LL6 S;  1N8R R;  2M0O A;  1IHW A;  2X35 A;  3MJX A;  2LQ8 A;  1S72 A;  5GAM j;  2LT4 A;  3CD6 A;  1M9S A;  1RI9 A;  2ED0 A;  2YRD A;  2F5K A;  2COW A;  3ZBD A;  3JV3 A;  4M7D G;  3JB9 H;  4LN2 A;  5CQX A;  2F5T X;  2KRM A;  1P92 A;  4PLI A;  2L3R A;  1QCO A;  3REA B;  2CSI A;  3CPW S;  2O88 A;  4AFU C;  1UHC A;  3EGD A;  3MP6 A;  3CCR T;  1OZ3 A;  1NBE B;  3FDR A;  1EZZ B;  1VIE A;  3PGG A;  3OMG A;  3VYH B;  4JS5 A;  3J81 E;  2MAM A;  1S72 Q;  2CP7 A;  1E7O A;  4YTL A;  4JPB W;  2YRC A;  1WX6 A;  4HT9 A;  2CT3 A;  3RKW A;  2OTJ A;  1ABO A;  4DA4 A;  3VS7 A;  5LJ3 f;  5GAN 5;  3OSV A;  5GAO p;  4IUQ A;  3OYH A;  1WHL A;  2WSE E;  1X69 A;  1JEG A;  3ME9 A;  5IH2 A;  3EFS A;  2BZY A;  2L5Q A;  3FIF A;  5IHI A;  2LMJ A;  5GAN 8;  4PLL A;  2E64 A;  2NUT A;  1YJW T;  5A2Q E;  1Y07 A;  3M0Q A;  4M7A A;  2FB7 A;  2D0Q B;  2J6O A;  4PJO C;  3JCM f;  3BW1 A;  1YFN A;  4ZTF A;  2JUF A;  3MCA B;  5CKH A;  2CKK A;  2CP0 A;  5LJ3 e;  1XJW B;  5GAO n;  1AOJ A;  1PD1 A;  3VS2 A;  1ZBX A;  5I22 A;  2NUP B;  1Q95 G;  2XKO C;  2BZX A;  2DEQ A;  5GMK h;  3M57 A;  2OTJ Q;  1VQK T;  2JT4 A;  3CC2 T;  2VVK A;  2EW3 A;  3M0R A;  3EH1 A;  4EDU A;  2RQU A;  1KQ2 A;  2DZC A;  2RNA A;  3G7Z A;  2ATC B;  1G83 A;  2OJ2 A;  5GAN h;  3CCQ T;  5D6X A;  3I5R A;  4NL3 A;  3OW2 A;  2MCN A;  1VQK A;  2FEI A;  1H92 A;  4M78 A;  2ESW A;  5J3B A;  5HY6 A;  2AK5 A;  1VQ5 T;  1JJ2 S;  4PJO B;  1C0M A;  4EMK B;  2C06 A;  1GL5 A;  2DKG A;  4OGC A;  1YJW Q;  2M16 A;  4AFQ C;  4BI4 A;  2IG0 A;  3S3N A;  4D6W A;  2J06 A;  1NPR A;  4II1 A;  4BUG A;  4FIB A;  3CMA A;  1A0N B;  1OPL A;  1LCK A;  4XU0 A;  3E19 A;  4FYV B;  4M7D E;  1X75 C;  4E2F B;  2ROT A;  1VQK Q;  3A1P A;  3CC2 Q;  3L2Z A;  2E10 A;  4IKF A;  8AT1 B;  1X27 A;  1BI2 A;  3S3M A;  1RAA B;  3BE3 A;  2KNB B;  3HRU A;  3L42 A;  5LJ5 f;  5I2S A;  3QJY A;  3QO3 A;  4M7D F;  1X2K A;  3NGP A;  4Y28 E;  3CCQ Q;  2JS0 A;  3JCM c;  4Z02 A;  1WYX A;  1GRI A;  4RTW A;  3JAM E;  5GAN 3;  1QP2 A;  4AFS C;  2EWN A;  2RM4 A;  1VYU A;  3O8V A;  2MI6 A;  1WXT A;  3CCE T;  2QAZ A;  2W10 A;  1VQM A;  3OW2 P;  1YJN T;  1SRL A;  4ESR A;  2X3W D;  5HCK A;  3CC7 A;  2DJZ A;  3M58 A;  3OBY A;  2DM1 A;  1CSK A;  3DLL A;  2NLU A;  5FLX E;  2KAF A;  2YHT A;  1YI2 T;  1PSE A;  3OB9 A;  5KYW A;  2GTJ A;  2DET A;  3TQ7 P;  4KGZ B;  1TXQ A;  2DVJ A;  2FO0 A;  2LT1 A;  3M0U A;  2HKN A;  2CZ0 B;  1MMG A;  3EHR A;  1ARK A;  3EGD B;  2VXF A;  1NE8 A;  2NYS A;  2CZ6 B;  2RO0 A;  3S3O A;  1E6H A;  2DD4 A;  4XQ3 A;  4L59 A;  3GF5 A;  2JMA A;  3UDC A;  2DIG A;  3MEV A;  2O31 A;  2MWP A;  3HP9 A;  1VQM Q;  5GAO r;  2NWM A;  3CPW A;  3UF4 A;  3CCS A;  3CC7 Q;  4QQG A;  1JB0 E;  2G3R A;  2BTT A;  2RJF A;  4RKU E;  2K3X A;  2E6Z A;  2V26 A;  2JVV A;  2BUD A;  2IVW A;  3HL8 A;  3TVT A;  4KUD K;  1MGQ A;  1PG5 B;  3JB9 I;  1ZUK A;  2FZC B;  1HK9 A;  2GCX A;  3CCE Q;  2F1L A;  2EYQ A;  2EQM A;  3LWI A;  1F1B B;  4L6V 5;  1YJN Q;  4MZM A;  1ZSG A;  2NUT B;  3M54 A;  2ENM A;  3QPH A;  4M78 C;  3QG1 A;  4C8Q G;  4M7A B;  1KQS P;  2J7I A;  3QWX X;  2QAS A;  1YI2 Q;  5EC7 A;  3CCS Q;  2QA4 T;  4R55 A;  2RN8 A;  1OX9 A;  1D1A A;  1U5S A;  4XTX A;  2DRK A;  1VQO A;  2H3E B;  1OX8 A;  3RBB B;  3JCM h;  3TEE A;  4WTO B;  3QJ6 A;  3UAT A;  3BY7 A;  2FRY A;  1LPL A;  2XID A;  2P84 A;  2E3H A;  2V1Q A;  3OS0 A;  4BE2 A;  2LP5 A;  4C92 A;  2CP3 A;  1YHQ T;  2CZ1 B;  2RH2 A;  2L3Q A;  1LOJ A;  1C6V X;  2KI7 A;  3M55 A;  1QKW A;  3OYE A;  1TTH B;  1M8M A;  1UE9 A;  2VGN A;  3LX7 A;  1KJW A;  1RLQ C;  3C95 A;  4RTY A;  1AWJ A;  1W2B S;  3TCJ A;  3OA6 A;  3CPW P;  4M78 B;  1VQO Q;  1M5Q 1;  5KE3 A;  1PM3 A;  5GAM f;  4E7J A;  3JB9 D;  3L2W A;  1ZUU A;  3VJP A;  2GNC A;  3OYD A;  2QQ9 A;  2E41 A;  3M0P A;  2K5L A;  2XK0 A;  4F16 A;  1OQK A;  1Q81 U;  2VWF A;  1TU0 B;  2XIC A;  3CC4 T;  2RB6 A;  2QA4 Q;  5KYX B;  1SF9 A;  4DBH A;  1JJ2 A;  1AD5 A;  1NM7 A;  3PVL A;  2JOY A;  4MDW A;  5D6Y A;  1R8O B;  2JJ9 A;  2HNI A;  3LWH A;  1AHJ B;  2QDL A;  4ATO A;  4FW1 A;  2MF2 A;  1YWP A;  3OYN A;  1YHQ Q;  5CKE A;  1NLO C;  2QEX A;  4PK4 A;  4A54 A;  2YUP A;  3QSU A;  1B07 A;  1WQW A;  3NTH A;  1D0Y A;  2A37 A;  3CBM A;  4FYY B;  4XK8 E;  4KT0 E;  5LJ5 h;  9ATC B;  1VQ6 T;  4HVV A;  3VV0 A;  5EG2 A;  4C8Q C;  3PMI A;  1ZQ1 A;  1UGR B;  1GCQ A;  3EGU A;  2PUK B;  3PIP A;  4JUV A;  1M90 U;  1XOV A;  3CCJ A;  3L2V A;  4AFZ C;  4E7S A;  2DTH A;  1UG1 A;  3A8L B;  1UEB A;  4X9D A;  4LDY A;  4J9F A;  2QEX Q;  4MDX A;  2KRN A;  2CH4 A;  1WIE A;  4OMO A;  5CK9 A;  3IQL A;  4OB1 B;  5KYW B;  3JB9 G;  5CAI A;  3EG9 A;  1KFZ A;  1OI1 A;  8ATC B;  3VUB A;  2L2P A;  4JRK A;  3OSS C;  3C0C A;  1WHG A;  3RKY A;  2QK0 A;  2LCL A;  3P8B B;  2I2L A;  3HRT A;  3CCJ Q;  1JJ2 P;  4Z89 A;  1YIT T;  1NPP A;  2RMO A;  2OX7 A;  3WXM B;  5ECA A;  1M1K U;  2EAY A;  1Q81 C;  2K79 A;  3E9F A;  2RI2 A;  2FG0 A;  2K3B A;  1VQ6 Q;  2HDA A;  3DKM A;  4CC7 A;  4D8K A;  4HVW A;  3V7R A;  1K8A U;  2JTE A;  4FSS A;  4A4G A;  2Z0W A;  5GMK e;  1VYT A;  2CUB A;  2RQW A;  1R0B G;  1WJQ A;  2Y4Y A;  3A5Z B;  1UFF A;  1UGV A;  1WGS A;  1YBY A;  2X9H A;  1PRM C;  1I81 A;  2ABL A;  5M9O A;  1Q7Y U;  2QQB A;  5FWB A;  5GAN e;  3DB3 A;  3CCL T;  4GLM A;  1WA7 A;  5GAN 7;  4KH0 B;  2SRC A;  2HQX A;  2ZGW A;  4FCY A;  1VQ7 T;  2AZS A;  2O4X A;  1UGS B;  3I35 A;  2HSE B;  2X4J A;  4C92 B;  1YIT Q;  4PJL A;  2YUO A;  3G6E A;  3QII A;  4HCZ A;  1SG5 A;  4FM4 B;  4CC3 A;  4M75 B;  4PFO A;  3CCV T;  2LX9 A;  2KRO A;  4XU3 A;  4M77 D;  2JZ2 A;  1AT1 B;  1IXD A;  4O6J A;  2ZZD A;  3JCM W;  2DF6 A;  3OYI A;  1S72 T;  3CD6 T;  1V76 A;  2HMA A;  3UA6 A;  3M59 A;  2J6F A;  2RD1 A;  4M7D A;  1NZ9 A;  1U1T A;  3OYG A;  3OS1 A;  4J5Y A;  5FU6 C;  5GAM h;  4J83 A;  2YUQ A;  3CCV A;  2D8H A;  1OYX A;  1KSW A;  1GCQ C;  1W2B A;  3CME A;  2EQK A;  4DEY A;  5GMK l;  5KYY B;  2DO3 A;  1TWB A;  3CCL Q;  2KMT A;  3P8H A;  4E7K A;  1T0H A;  4LE9 A;  4JLI A;  4EIK A;  4PJN A;  3OYB A;  2RK2 A;  1QWF A;  1K8A C;  2V8I A;  1UGP B;  2HSP A;  5KYU A;  2MIO A;  1VQ7 Q;  1YJ9 A;  5GAO m;  3E2U A;  3OYM A;  2AKK A;  3VU3 C;  1YIJ A;  1ZA1 B;  2DNU A;  1YN8 A;  3EHQ A;  4F7U G;  4JRP A;  3HKS A;  3SD4 A;  2A08 A;  1QVG S;  1OZ2 A;  3GOX A;  1Q81 R;  2VV5 A;  3CCV Q;  3URG A;  2E3I A;  2OTJ T;  2H8H A;  2MYS A;  3JB9 F;  1FYN A;  1IB8 A;  3CME Q;  2A0F B;  2YRV A;  4BB7 A;  3QZ9 B;  4QW2 A;  1M1F A;  5FU6 B;  3LW5 E;  3RER A;  3CD6 Q;  1WI7 A;  2V8K A;  1WLP B;  4OVA A;  2P0Q A;  4ZGE B;  2KRS A;  4KH1 B;  1I8F A;  4M77 G;  1JXO A;  1YJ9 Q;  4M7A D;  2LQK A;  4B9X A;  4ME7 A;  3OBW A;  1BCM A;  1OU8 A;  2RJE A;  2R57 A;  2LJ0 A;  1VIF A;  4J7F A;  4BI8 B;  2ZPG B;  4F14 A;  2LZ6 B;  1KD1 U;  4F17 A;  1HD3 A;  2LDM A;  3EG9 B;  2LQN A;  1VQL A;  1Q82 U;  4OB0 B;  1OEB A;  4IIM A;  1RLP C;  4P5N A;  1DJ7 B;  3RUX A;  1W2B P;  4KGX B;  5C6S A;  3QKJ A;  1M90 R;  2AHJ B;  3QDR B;  4MMK A;  1QVF S;  1TOV A;  1UJY A;  1VQN A;  2HCK A;  3QZ5 B;  1RL2 A;  5DLO A;  2X4W A;  3LLR A;  1KHI A;  2QTV A;  2JN0 A;  4ELY C;  2K4Y A;  4FYX B;  3OYA A;  5IAY A;  2DYI A;  1MV3 A;  5CO7 A;  5GAN 2;  1BI0 A;  4FW2 A;  4M78 D;  3T9N A;  1JQQ A;  3FLG A;  4CRI A;  3HSB A;  4MZT A;  1VUB A;  2B8A A;  1UHF A;  4J6Y A;  3SB2 A;  3JCM e;  2HQH A;  4C0Z A;  2LC4 A;  1JU5 C;  4NOY A;  3TU4 K;  3ZL7 C;  1PSF A;  3CBO A;  3U23 A;  4O5V A;  3GNG A;  3CMA T;  2A7Y A;  2CP5 A;  2DLP A;  2CP6 A;  4EPC A;  4M7D C;  2E6N A;  2X51 A;  4HXJ A;  5CVI A;  1D3B A;  1M30 A;  4KBM B;  1PD0 A;  2M1H A;  2KVQ G;  2X4X A;  3OYL A;  5CIU A;  4LXC A;  3VS1 A;  1SSF A;  1K0X A;  1VQ8 A;  3J80 E;  1K8A R;  2D0N A;  3CCM A;  5FU7 C;  1G8X A;  1G2B A;  1FX7 A;  2O4X B;  3FB9 A;  3QBY A;  1NLP C;  3X20 B;  2XDP A;  3CBP A;  3FC3 A;  2LTO A;  5HKC A;  3VRZ A;  3JCM b;  1IGU A;  4F7U E;  1KD1 C;  5IHK A;  1Q82 C;  4EMH A;  2CZ7 B;  3SEM A;  1D1C A;  3M0T A;  1VQM T;  2HL5 C;  4WF2 A;  3CC7 T;  2XHC A;  3LYI A;  1H3H A;  4LD6 A;  4F7U F;  2D8J A;  4K11 A;  2B86 A;  1ZSZ A;  4L5G A;  3CMA Q;  1YP5 A;  4TVR A;  3UT1 A;  4M77 E;  2L3S A;  5FU7 B;  1KQS A;  2AIR B;  4OGE A;  2M51 A;  5LJ3 g;  1QKX A;  1AVZ C;  5KCO A;  4OF1 A;  4IUR A;  4FYW B;  1JBM A;  5LJ5 e;  3G4S A;  4RTX A;  5FWC A;  1FMK A;  2LCS A;  1GFC A;  1RAD B;  3LH0 A;  2NUZ A;  4DQ2 A;  1ZHI A;  5KYU B;  1TUD A;  3OYC A;  4ZNX A;  4M77 F;  1WHK A;  2K2V A;  4PNO A;  4FSX A;  4KUI A;  3CCS T;  3VS3 A;  2K6D A;  3MEW A;  1PKS A;  3GP8 A;  1RAI B;  3JCM X;  3M4Y A;  1ABQ A;  3VUZ A;  4J9H A;  1FMV A;  4HVU A;  2KDS A;  2SEM A;  2CP2 A;  2YXY A;  1K73 U;  2F2V A;  2VXE A;  2FL7 A;  1NG2 A;  1MNE A;  3OYF A;  2KR3 A;  2DTO A;  4J8O A;  3CCU T;  2OTL A;  2EKO A;  1I0C A;  3C4S A;  3KBG A;  3SHW A;  2EQJ A;  4C8Q A;  3G4S Q;  1RI0 A;  3KUF A;  2YDL A;  4JRQ A;  2EIF A;  1QVG A;  1PNJ A;  4EMG A;  2HQE A;  1YCY A;  2BZ8 A;  2PVO B;  2DXC A;  3GLX A;  3RR6 A;  1RAB B;  3I56 T;  2RQR A;  2J05 A;  1LNX A;  4ZN3 A;  1VQO T;  1IGQ A;  3CCU A;  2ECZ A;  4Q5W A;  1BYM A;  1WHH A;  2L89 A;  5GAO l;  4PJM A;  4OB2 B;  4OB3 B;  2OTL Q;  2CYZ B;  3MEA A;  4M7A E;  3OS2 A;  4C92 D;  2QXF A;  3UPU A;  2WAC A;  2P4T A;  5DLQ E;  5C0M A;  3I56 A;  4M75 D;  4RTZ A;  1J3T A;  2ZAE A;  3PTA A;  2ZPH B;  5CKF A;  3PNW C;  4DOW A;  3QWY A;  1KD1 R;  1FWZ A;  4QT7 A;  2FHD A;  1VOM A;  5GAN d;  4M7A F;  2M0Y A;  3ASK A;  4J9G A;  1SKU B;  1Q82 R;  3CCU Q;  2E1H A;  1QVF A;  4CC4 B;  3S6W A;  3CXC S;  2DFU A;  5GJV B;  3UWN A;  1T0J A;  4C5I A;  1SHF A;  1Q86 U;  2DIL A;  4R56 A;  1X2Q A;  3MP8 A;  4LDV A;  4LUD A;  5HK3 A;  1KQ1 A;  4OMQ A;  3V8K A;  2K5I A;  4OMM A;  2OI3 A;  4ZN1 A;  3TRE A;  4A4K A;  2R58 A;  3I56 Q;  1BB9 A;  1G3Y A;  4M78 E;  2E5Q A;  1QVG P;  3OMC A;  2GQI A;  1D3B B;  1WNL A;  2HZY A;  1K73 C;  2PU9 B;  3RIR A;  2EGA A;  1ZSZ C;  2DPP B;  2HAX A;  2JTF A;  2JS2 A;  4LDX A;  4J6W A;  1UUE A;  2ZPI B;  3M5A A;  4LNP A;  4X1V A;  2XI9 A;  2QEX T;  2WSC E;  1Y71 A;  2DD5 A;  4M78 F;  1U1S A;  4Y92 A;  4BY6 C;  1JO8 A;  2RPN A;  2VAS A;  3QXE B;  5L8R E;  5GAM e;  2FPE A;  3RMS A;  1HYO A;  2KYB A;  1VQ4 A;  1QMC A;  2ROL A;  2DBK A;  4QVD A;  4M75 G;  3CCJ T;  3INZ A;  3EFR A;  4QVZ A;  2JTM A;  3OQ5 A;  4RCC A;  2F69 A;  5L23 A;  4B9W A;  2FPF A;  1QVF P;  2RI3 A;  2FRW A;  1ZSZ B;  3N5B B;  4OP0 A;  4WCI A;  3MO8 A;  1X43 A;  1VA7 A;  4QQ6 A;  3M9Q A;  5KE2 A;  2DA9 A;  3BDU A;  5KCH A;  1ZX6 A;  1XQH A;  2HBP A;  1QP3 A;  2BE9 B;  1TSF A;  1QLY A;  3MEU A;  4BY6 B;  3CQT A;  4HCB A;  1TUC A;  4B6M A;  4JJD A;  1Q86 C;  2GF7 A;  2KQW A;  2EGC A;  1V1C A;  2JM9 A;  3OYY A;  3L2U A;  2QQS A;  2QGG A;  1TG0 A;  4ZGJ B;  4J7I A;  5J26 A;  3R6N A;  2GFA A;  2P0P A;  1GCP A;  1VQP A;  4LD9 K;  2KT1 A;  1N27 A;  2X4Y A;  1T3S A;  3M0S A;  1IZ6 A;  4C8Q B;  1M4Z A;  2MPX C;  1U06 A;  1M1G A;  2D1X A;  3A8G B;  4JJB A;  1PC0 A;  5LJ3 d;  2RHY A;  1N9R A;  1Z9Q A;  5GAO q;  4PJO D;  2HEQ A;  2RQV A;  1K9M U;  1ZBJ A;  3QHS A;  4DEX A; 
#chains in the Genus database with same CATH homology
 3A8M B;  2V8K A;  1VQ4 T;  3HRU A;  3L42 A;  4OVA A;  2P0Q A;  4ZGE B;  5I2S A;  5LJ5 f;  2DXB A;  4M75 A;  2E65 A;  4UC4 A;  1N8R U;  3QJY A;  2QA4 A;  1TH7 A;  3QO3 A;  1I8F A;  4M77 G;  4M7D F;  4Y91 A;  4M7A D;  1FXX A;  4Y28 E;  3JCM J;  3JCM d;  2LQK A;  4B9X A;  4ME7 A;  3OBW A;  2O01 E;  1I4K 1;  2PVD B;  2RJE A;  5A0L A;  3JCM c;  4Z02 A;  2R57 A;  1VIF A;  4J7F A;  4BI8 B;  2ZPG B;  3JAM E;  3FJP A;  2VYT A;  3E1S A;  3H8Z A;  3HRS A;  5GAN 3;  3G6E T;  2D6F A;  4PKC C;  3VKI A;  1QP2 A;  5FRM A;  1KD1 U;  4A4F A;  1Y7X A;  2EWN A;  1KC8 C;  2RM4 A;  2LNV A;  2OAU A;  2LDM A;  2DTI A;  2KK4 A;  1G3S A;  1VQL A;  3O8V A;  3MP1 A;  4E7H A;  1Q82 U;  4OB0 B;  2MI6 A;  2RHI A;  4P5N A;  1YHQ A;  1O9S A;  3V7C A;  3CCE T;  3RER A;  1VQM A;  2KSS A;  1DJ7 B;  4C92 G;  1YJN T;  4X9C A;  3RUX A;  5C6S A;  4ZTJ A;  3QKJ A;  2DJZ A;  5KH6 A;  3M58 A;  3SWN A;  3CC7 A;  3OBY A;  3FRN A;  3DLL A;  2AHJ B;  2NLU A;  3QDR B;  5FLX E;  3AHU A;  2KAF A;  2YHT A;  3A8H B;  4LDW A;  1PSE A;  2LVM A;  3OB9 A;  4MMK A;  4N4I A;  1YI2 T;  1M90 C;  4C92 E;  1QVF S;  1GXI E;  1VQN A;  2JNG A;  1Y96 B;  3QZ5 B;  1RL2 A;  2LT1 A;  4EMK A;  2A3L A;  2EJ9 A;  3RMQ A;  5DLO A;  1U8R A;  2X4W A;  2CZ0 B;  5GAN 4;  3X26 B;  3LLR A;  1KHI A;  4M75 E;  3I55 A;  4E7I A;  2QQA A;  2JN0 A;  4ELY C;  3L2R A;  2K4Y A;  2VXF A;  1NE8 A;  3M53 A;  3OYA A;  1UB4 A;  2R5M A;  5IAY A;  3PIO A;  2ZCF B;  1BIA A;  5CO7 A;  2CZ6 B;  3CME T;  1BI1 A;  2RO0 A;  3S3O A;  2DD4 A;  1BI0 A;  4L59 A;  4XQ3 A;  4M78 D;  5GAN 2;  3T9N A;  3GF5 A;  3GNF B;  3OYK A;  4QQD A;  4FT2 A;  3FLG A;  3L1A A;  3UDC A;  4CRI A;  3HSB A;  2DIG A;  2WSF E;  3MEV A;  4MZT A;  5A0G A;  1KHC A;  3H6Z A;  2MWP A;  3HP9 A;  1VUB A;  4C0D C;  4C92 F;  2B8A A;  3SB2 A;  4J6Y A;  5GAN 6;  3JCM e;  3HPW A;  4N0A C;  2RHX A;  3ER0 A;  4C0Z A;  2LC4 A;  5GAO r;  2DAQ A;  3CC4 A;  3PMT A;  3CPW A;  3E9G A;  3CCS A;  4NOY A;  4M75 F;  3TU4 K;  2PQW A;  5DM7 R;  2DIQ A;  4QQG A;  1PSF A;  4F7U A;  1JB0 E;  2G3R A;  2RJF A;  3CBO A;  4RKU E;  3WVE B;  1YIJ T;  4BI3 A;  1YJ9 T;  1VQP T;  5HK0 A;  4PJO G;  2K3X A;  3GNG A;  2E6Z A;  4O5V A;  2RHU A;  3CMA T;  1LJO A;  4MML A;  2A7Y A;  1HXD A;  2JVV A;  2BUD A;  5CKD A;  3MHX A;  2IVW A;  4EPC A;  1XNI A;  4NL2 A;  1M1K C;  2E6N A;  4M7D C;  3HL8 A;  3M56 A;  5CVI A;  4KUD K;  1D3B A;  2K3Y A;  1MGQ A;  4KBM B;  3JB9 I;  2M1H A;  2KVQ G;  4C0G A;  2X4X A;  3OYL A;  1UGQ B;  5CIU A;  1HK9 A;  1JRI A;  2HD0 A;  1SSF A;  2GCX A;  4JDS A;  2EYQ A;  4IUV A;  3EAE A;  5LJ5 j;  1VQ8 A;  2EQM A;  2VUB A;  4XTV A;  3J80 E;  4L6V 5;  3LWI A;  3OY9 A;  1M8V A;  2Y4X A;  1IRE B;  4MZM A;  3M54 A;  3CCM A;  5FU7 C;  3X24 B;  3QPH A;  4M78 C;  1K9M C;  3G71 A;  2PVG B;  3QG1 A;  4C8Q G;  4M7A B;  1I5L A;  4M77 A;  1G5V A;  2XDB A;  1FX7 A;  2ZPB B;  3JCM V;  5LJ5 d;  2O4X B;  3FB9 A;  4FT4 A;  1N8R C;  1N9S A;  1G3T A;  3QBY A;  4JS4 A;  2QA4 T;  2MMP A;  3CEY A;  4R55 A;  3SFM A;  2XDP A;  3X20 B;  4BD3 A;  3CBP A;  1VQ6 A;  4C8Q E;  4XTX A;  3FC3 A;  2LTO A;  1VQO A;  5HKC A;  4C0D B;  3JCM h;  3TEE A;  2D9T A;  2PUO B;  3QJ6 A;  3V7S A;  3JCM b;  3KXT A;  4F7U E;  3BY7 A;  3JCM P;  2XD0 A;  1KD1 C;  3SDZ A;  2YLB A;  4C5G A;  4RMO A;  1H3Z A;  2XID A;  1Q7Y C;  2BIV A;  3L2Q A;  3OS0 A;  3HFO A;  4BE2 A;  4C92 A;  1Q82 C;  1VQL T;  5CCA A;  4EMH A;  4HKE A;  2CZ7 B;  2MWO A;  1YHQ T;  2CZ1 B;  4N4H A;  2RH2 A;  4BDY A;  1VQM T;  4RCB A;  1LOJ A;  4C8Q F;  4FL6 A;  5GAN g;  3M55 A;  4WF2 A;  3OYE A;  5GAM g;  2XHC A;  1BI3 A;  3CC7 T;  2RK1 A;  3LYI A;  1WJR A;  2VGN A;  4LD6 A;  4F7U F;  3LX7 A;  3PFS A;  4GY5 A;  4C92 C;  3OW2 S;  3F70 A;  3C95 A;  5CKB A;  4L5G A;  1VQN T;  4RG8 A;  1W2B S;  4TVR A;  1W4S A;  3TCJ A;  4M77 E;  3UT1 A;  3ZFJ A;  2V8J A;  3OA6 A;  5FU7 B;  1KQS A;  4M75 C;  4M78 B;  4KUL A;  1M5Q 1;  5KE3 A;  4OGE A;  5GAN f;  3I55 T;  5GAM f;  2DZ9 A;  5LJ3 g;  4E7J A;  5KCO A;  4OF1 A;  3QYH B;  4IUR A;  1QW1 A;  3JB9 D;  1X6O A;  1G3W A;  3L2W A;  1YIT A;  3VJP A;  1JBM A;  2VC8 A;  5LJ5 e;  3G4S A;  3OYD A;  2ZPF B;  3HHT B;  2QQ9 A;  4XU2 A;  2RI5 A;  2E41 A;  2K5L A;  4ZGD B;  2M9U A;  1X01 A;  2XK0 A;  4FU6 A;  3Q1J A;  3VYG A;  4HA8 A;  4PL6 A;  4QVC A;  4DQ2 A;  3DB4 A;  3LH0 A;  3CCR A;  1Q81 U;  1ZHI A;  3OYC A;  2XIC A;  3CC4 T;  4M77 F;  1NJI U;  2RB6 A;  2QQR A;  2K2V A;  4X34 A;  2LRQ A;  4PNO A;  3LGF A;  3NTK A;  4FSX A;  4KUI A;  3CCS T;  2QI2 A;  4PJO A;  4MZP A;  3JSC A;  4M7D D;  3MEW A;  3GP8 A;  1JJ2 A;  3FEO A;  3JCM X;  3M4Y A;  3VUZ A;  1B34 A;  2KDS A;  3SWN C;  3R6O A;  4IUP A;  2L8D A;  4XTY A;  5I21 A;  4DOV A;  1K73 U;  4XTW A;  1N6A A;  2GFU A;  2VXE A;  2JOY A;  2FL7 A;  4MDW A;  1R8O B;  3P8D A;  2HNI A;  4XU1 A;  5D6Y A;  3LWH A;  1AHJ B;  4ATO A;  4OMF B;  4GLK A;  3OYF A;  2DVE A;  2DTO A;  4EMK C;  2XU8 A;  2P0K A;  4J8O A;  2MF2 A;  3CCU T;  3OYN A;  2OTL A;  2EKO A;  3C4S A;  3KBG A;  3CPF A;  2RJC A;  5CKE A;  2EQJ A;  4C8Q A;  2QEX A;  1RI0 A;  3CXC A;  1H64 1;  1VQ8 T;  2RJD A;  3KUF A;  4JRQ A;  2EIF A;  3NFC A;  3CCM T;  2CGH A;  5FRN A;  1QVG A;  3G71 T;  2EJG A;  4A54 A;  4EMG A;  5AYF A;  2RHZ A;  2HQE A;  3QSU A;  1WQW A;  2PVO B;  1YCY A;  2VGM A;  3CBM A;  3NTH A;  4XK8 E;  3V8J A;  2DXC A;  3JCM Q;  3GLX A;  3CCL A;  4KT0 E;  2K5F A;  4C5H A;  4JRI A;  5LJ5 h;  4IUU A;  3I56 T;  1VQ6 T;  5J39 A;  3VV0 A;  1YJW A;  5EG2 A;  1LNX A;  5I2M A;  4C8Q C;  3PMI A;  1KQS S;  1ZQ1 A;  1V29 B;  1VQ9 T;  4XTZ A;  1UGR B;  4ZN3 A;  1VQO T;  4CI0 C;  4ELZ C;  4XTU A;  1VQ7 A;  5GMK j;  4PJO E;  2Y90 A;  2PUK B;  3PIP A;  4JUV A;  3CCU A;  1M90 U;  4M7A G;  1XOV A;  4Q5W A;  3CCJ A;  3J7A F;  4RG2 A;  1BYM A;  2XG8 D;  2L89 A;  5GAO l;  3L2V A;  2EQU A;  4OB2 B;  2RA2 A;  2DTH A;  2DK3 A;  3QYG B;  3A8L B;  2BKD N;  4OB3 B;  5IN1 A;  1UEB A;  2CYZ B;  3MEA A;  4X9D A;  4M7A E;  4LDY A;  4IUT A;  3OS2 A;  2FVU A;  5CR2 A;  3QUI A;  2QXF A;  3LGL A;  5LL6 S;  4NS5 A;  3SWN B;  4C92 D;  4MDX A;  3UPU A;  2WAC A;  3CC2 A;  2P4T A;  2M0O A;  5CK9 A;  4OB1 B;  5DLQ E;  5C0M A;  3I56 A;  3JB9 G;  3HFN A;  5CAI A;  4M75 D;  2EFI A;  4PJO F;  1OI1 A;  2X35 A;  1VQ9 A;  5CQY A;  5GAN j;  2LQ8 A;  1S72 A;  3VUB A;  2LT4 A;  5GAM j;  1MHN A;  3CD6 A;  1M9S A;  3PTA A;  2ZPH B;  4JRK A;  3PNW C;  5CKF A;  4DOW A;  3A8O B;  3OSS C;  4M77 C;  1FWZ A;  1WPY A;  3OS5 A;  4E47 A;  2F5K A;  3RKY A;  2EJF A;  2FHD A;  5GAN d;  4M7A F;  3ASK A;  3ZBD A;  2LCL A;  5GAM d;  3CCQ A;  3P8B B;  3JB9 H;  4M7D G;  2I2L A;  5CQX A;  3HRT A;  3C12 A;  2E1H A;  2F5T X;  1Y96 A;  1QVF A;  1P92 A;  1NPP A;  4PLI A;  3S6W A;  1YIT T;  3CXC S;  2L3R A;  5FRO A;  3UWN A;  3G4S T;  3CPW S;  2KY9 A;  3WXM B;  4C5I A;  1Q86 U;  4R56 A;  3MP8 A;  4LDV A;  1M1K U;  3MP6 A;  4M7D B;  3CCR T;  1VQ5 A;  5HK3 A;  1KQ1 A;  2EAY A;  1Q81 C;  1OZ3 A;  3E9F A;  4M78 G;  2K5I A;  3FDR A;  2RI2 A;  3V8K A;  4F7U B;  3TRE A;  4ZN1 A;  1NJI C;  1WQ7 A;  2YLC A;  4A4K A;  1VIE A;  3PGG A;  3OMG A;  2R58 A;  3VYH B;  2DXU A;  3DKM A;  4JS5 A;  3J81 E;  5IT9 E;  3V7R A;  2MAM A;  1K8A U;  1G3Y A;  4M78 E;  1KG1 A;  2E5Q A;  4A4G A;  5GMK e;  3OMC A;  1D3B B;  1WNL A;  4YTL A;  1K73 C;  2PU9 B;  3RIR A;  4VUB A;  1WJQ A;  2Y4Y A;  3A5Z B;  2DPP B;  2HAX A;  2JTF A;  2E12 A;  4LDX A;  4J6W A;  4HT9 A;  2OTL T;  2ZPI B;  1WGS A;  1YBY A;  3M5A A;  3RKW A;  2OTJ A;  2XI9 A;  2QEX T;  4M77 B;  4DA4 A;  5LJ3 f;  1EIF A;  1I81 A;  5GAN 5;  2ZPE B;  2WSC E;  3OSV A;  4C8Q D;  5GAO p;  4IUQ A;  1Y71 A;  2DD5 A;  4M78 F;  5M9O A;  3OYH A;  1U1S A;  1Q7Y U;  3JCM g;  2WSE E;  3JB9 J;  4A4H A;  2QQB A;  4BY6 C;  3QXE B;  5GAN e;  3DB3 A;  3ME9 A;  4LDU A;  3EFS A;  2L5Q A;  3FIF A;  5L8R E;  3CCL T;  2H3J A;  5GAM e;  3RMS A;  5GAN 7;  4XAX B;  5GAN 8;  4PLL A;  1VQ4 A;  3BFM A;  2E64 A;  1YJW T;  2FYK A;  5A2Q E;  1Y07 A;  4M7A A;  2FB7 A;  2D0Q B;  2HQX A;  4J6X A;  2ZGW A;  4PJO C;  4QVD A;  1VQ7 T;  2LCC A;  2O4X A;  3BW1 A;  2CS7 A;  4M75 G;  3JCM f;  1UGS B;  4A4E A;  4ZTF A;  2JUF A;  3MCA B;  3CCJ T;  3M4G A;  2X4J A;  5CKH A;  4C92 B;  3INZ A;  2CKK A;  3EFR A;  5LJ3 e;  5GAO n;  3G6E A;  4QVZ A;  3QII A;  3C94 A;  4FM4 B;  1ZBX A;  4HCZ A;  1BKB A;  2XKO C;  2JTM A;  4M75 B;  3OQ5 A;  4RCC A;  2F69 A;  1KC8 U;  4N0A A;  4M7A C;  2DEQ A;  3CCV T;  3JRZ A;  5GMK h;  3M57 A;  4B9W A;  1VQK T;  2QDY B;  2LX9 A;  3CC2 T;  4XU3 A;  4HT8 A;  3PT9 A;  4V2S A;  3ZEH A;  4M77 D;  2JZ2 A;  3CCE A;  5FU6 B;  2RI3 A;  4O6J A;  1YJN A;  3N5B B;  2ZZD A;  4OP0 A;  4EDU A;  3GPL A;  3MO8 A;  3JCM W;  4QQ6 A;  3M9Q A;  5KE2 A;  3OYI A;  3BDU A;  2GQV A;  1S72 T;  3CD6 T;  5KCH A;  1XQH A;  2E70 A;  2HBP A;  4BAC A;  1YI2 A;  3M59 A;  1KQ2 A;  1QP3 A;  2RD1 A;  4M7D A;  1NZ9 A;  1U1T A;  2DZC A;  3OYG A;  3G7Z A;  3OS1 A;  3MEU A;  4C0F A;  4J5Y A;  4BY6 B;  5GAN h;  1O75 A;  3NTI A;  3CCQ T;  4HCB A;  5D6X A;  5FU6 C;  5GAM h;  4J83 A;  4NL3 A;  3CCV A;  3DLM A;  3OW2 A;  1VQK A;  1OYX A;  1W2B A;  4M78 A;  1Q86 C;  2GF7 A;  2K57 A;  2KQW A;  5J3B A;  3CME A;  2EQK A;  2QTX A;  5HY6 A;  5GMK l;  4BE1 A;  1VQ5 T;  1JJ2 S;  4PJO B;  3OYY A;  2DO3 A;  3L2U A;  4EMK B;  2KMT A;  3P8H A;  5D6W A;  1QVP A;  2QQS A;  4JJN K;  4E7K A;  2C06 A;  2DKG A;  5LJ3 h;  4OGC A;  4JLI A;  1B34 B;  4ZGJ B;  4J7I A;  3OYB A;  3GIB A;  2M16 A;  2RK2 A;  3V8L A;  1BIB A;  2V8I A;  5J26 A;  1K8A C;  1UGP B;  2GFA A;  2P0P A;  2XDD A;  4BI4 A;  4BE0 A;  4N4G A;  1YJ9 A;  5GAO m;  1VQP A;  2IG0 A;  3OYM A;  1XTD A;  3VU3 C;  3S3N A;  4D6W A;  1YIJ A;  1NPR A;  4HCC A;  4LD9 K;  4II1 A;  4E7L A;  1N27 A;  1WJS A;  4BUG A;  2X4Y A;  4FIB A;  4F7U G;  3CMA A;  4JRP A;  3HKS A;  2R5A A;  5LJ3 j;  1IZ6 A;  4C8Q B;  4XU0 A;  3SD4 A;  1M4Z A;  3E19 A;  1QVG S;  1OZ2 A;  3GOX A;  4M7D E;  1X75 C;  2VV5 A;  1M1G A;  3OYJ A;  3URG A;  5LJ5 g;  5GMK m;  3A8G B;  2OTJ T;  3WVD B;  5A0D A;  4BDZ A;  3JB9 F;  3RKX A;  3L2Z A;  4A53 A;  5DY9 A;  5LJ3 d;  5GMK i;  2RHY A;  2YRV A;  4BB7 A;  1N9R A;  3RES A;  3X25 B;  2E10 A;  4C5E A;  3QZ9 B;  4IKF A;  3MET A;  4QW2 A;  3X28 B;  5GAO q;  4PJO D;  4JLG A;  2DXT A;  1M1F A;  1BI2 A;  3LW5 E;  3S3M A;  3QHS A;  1K9M U;  3BDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...