3ASKA

Structure of uhrf1 in complex with histone tail
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
223
structure length
213
Chain Sequence
b'SLYKVNEYVDARDTNMGAWFEAQVVRVTRKAEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDKQLMCDECDMAFHIYCPPLSSVPSEDEWYCPECR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Recognition of modification status on a histone H3 tail by linked histone reader modules of the epigenetic regulator UHRF1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/dna binding protein
total genus 35
structure length 213
sequence length 223
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3askA01
2.30.30.1150 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3askA02
4A4HA 2GFAA 3L42A 4N4HA 2R5MA 4A4EA 5J39A 2HQEA 4IUQA 3PMTA 4QW2A 2BKDN 3UWNA 2RJFA 5KCHA 2LRQA 2DIGA 3OYJA 4FU6A 3OS0A 4IUPA 1OZ3A 3OYBA 2R5AA 4OVAA 3PFSA 1WJQA 4NS5A 4II1A 5KH6A 4C5IA 3E9GA 3SD4A 3MO8A 3OYLA 2E6NA 2K3YA 4A4GA 2X4WA 3NTKA 4BDYA 1OI1A 2PQWA 3M9QA 3MP8A 5CIUA 5C0MA 5FRNA 2RHIA 3F70A 1OYXA 3CEYA 3OMCA 3OYFA 1N27A 5KE2A 2EQJA 2M1HA 3GOXA 3QJ6A 3DB4A 4C5GA 4ZTJA 2VYTA 3OYMA 4UC4A 3ZEHA 4PLLA 2RJEA 2CKKA 2L89A 3E9FA 2L8DA 5J26A 4IURA 5M9OA 4BDZA 3OQ5A 3OYIA 3OYCA 4Z02A 2RJDA 2FHDA 1XNIA 2JZ2A 2NLUA 3MEAA 3PMIA 5KCOA 3DB3A 3META 2R57A 4QQGA 3OS1A 2BUDA 2YRVA 2RI5A 2QQRA 3H6ZA 3OA6A 4E7JA 3ASKA 3MEVA 2RO0A 2L3RA 3OYEA 3FC3A 4BD3A 2RHYA 5C6SA 5IAYA 2M16A 2QQSA 2RI3A 3MP1A 3OYKA 3DLMA 4C5EA 1MHNA 2XK0A 1KHCA 2GF7A 3OB9A 4QQDA 3EAEA 3FEOA 3OS2A 3LLRA 4E7IA 2D9TA 2DAQA 4IUTA 4E7LA 3PNWC 2RHXA 3QBYA 2X4YA 2MWOA 2XDPA 4IUVA 3FLGA 3OMGA 1WJRA 5KE3A 4ZTFA 2RI2A 4IUUA 4B9XA 3S6WA 2DIQA 3OY9A 3LH0A 3Q1JA 2EQMA 4N4IA 2X35A 4GY5A 3LGFA 2B8AA 1WGSA 3LX7A 5IN1A 5D6XA 3UT1A 4EDUA 3LGLA 3OYDA 2MWPA 3H8ZA 2P0KA 4E7HA 3OYNA 4E7KA 3MEUA 2O4XB 3O8VA 2E5QA 2RJCA 4BACA 2LCCA 3S3MA 4CRIA 1OZ2A 3FDRA 4RG2A 4L59A 3L2UA 3LYIA 2F5KA 2G3RA 3OYGA 4IKFA 2EQUA 5FROA 2GFUA 2EKOA 2IG0A 4N4GA 3BDLA 4PL6A 4QVZA 3OYAA 3L2VA 3ME9A 2O4XA 2K3XA 4BE2A 3NTIA 3P8HA 3S3NA 3QKJA 4BE0A 2EFIA 5D6YA 3MP6A 3MEWA 2EQKA 2X4XA 4X34A 2R58A 3L2RA 1G5VA 2JTFA 4PLIA 2RHZA 3NTHA 4B9WA 2HQXA 3OYHA 5D6WA 4LD6A 2LVMA 3L2QA 4QQ6A 2WACA 3C4SA 1H3ZA 2LDMA 4C5HA 5FRMA 2RHUA 3L2WA 3QIIA 2BIVA 4Q5WA 1SSFA 4HCZA 3P8DA 1WJSA 3KUFA 4FL6A 1RI0A 4A4FA 2M0OA 2LTOA 3S3OA 4BE1A
chains in the Genus database with same CATH superfamily
1KFZA 2EYYA 2L3SA 2O9VA 4V2SA 4IUPA 2ATCB 3X28B 3TEEA 1VQNT 3BDUA 4MZTA 5CKDA 4A4GA 5KYWB 2VGMA 3MP8A 3GP8A 3M4GA 1KQSA 5LJ3j 3G71Q 2M1HA 2LNVA 1BBZA 3FB9A 2VYTA 4M77D 3TREA 4YTLA 1N8RR 2L89A 2LC4A 4C92E 4E6RA 2PUKB 4Z02A 3EFOB 2W10A 1ZHIA 2K57A 4PJOG 3NHNA 1UGSB 1XTDA 1QWFA 4ZGDB 2QTVA 1W70A 1N8RU 1X2QA 1JO8A 1E6GA 5CQXA 3T9NA 1QCNA 1RAHB 3VS4A 1TUDA 4ESRA 3OW2S 2X3XD 1WLPB 2EGAA 3LGFA 2JJ9A 1PG5B 4HCBA 3CMEQ 2YXYA 2ZAEA 3UT1A 3LGLA 3EG3A 2Y4XA 1U1SA 1TG0A 1VQ8A 1PNJA 4CC4B 1ZUYA 3HSBA 3CCMT 2KT8A 3CCQQ 5CAIA 1M1KC 1BKBA 5HY6A 1R0BG 3CD6Q 1W1FA 1UGQB 1I4K1 3R6NA 4QQ6A 1B34A 4RMOA 1YJWQ 1B7TA 3U23A 3UF4A 4M4ZA 4FYVB 2KQWA 4IIOA 4JJNK 4PFPA 1ZQ1A 3CCJA 2HBWA 4PJMA 2AIRB 4PFZA 3QYHB 4C5IA 5GMKe 1D09B 4X9CA 5FW9A 3HRUA 4BDYA 1JEGA 1AZEA 1MNEA 1VYVA 9ATCB 3RKXA 2JVVA 2RK2A 2DK3A 3G4SQ 4F7UE 4XQ3A 2AZSA 3OYIA 2CT4A 5CKEA 2NLUA 2OTJQ 3X25B 1QMCA 2VASA 2RI5A 5DY9A 3H6ZA 2P84A 3OA6A 5FU7B 4E7JA 2FB7A 2FPDA 4J9CA 4RTUA 4Y92A 4M7DA 2RHYA 2DRMA 2FRYA 1OX8A 1HD3A 1VQKQ 2MYSA 4LDVA 1AZGB 1K4US 3QBYA 3J80E 4C0DB 5I22A 2GQIA 2F2WA 4A54A 3SWNA 2DIQA 2VV5A 5GAMf 3NGPA 2K3BA 2X35A 5GANd 2JOYA 5GAOq 1NPRA 3NMZC 1VQMA 2JUFA 1YJ9A 2E3IA 1K9MU 2EJGA 3OYGA 5I11A 1K8AC 2AZVA 5GJVB 1X27A 3S3NA 3D7SB 1VQLT 1CSKA 4X34A 3EHQA 2JMAA 1G2BA 4PLIA 1YITA 2DKGA 1NZ9A 2CP7A 4B9WA 3JCMb 1VQ7A 4PJOA 1A0NB 3RKYA 3CXCP 2JTEA 3CCUT 5ECAA 2VB6A 2L3PA 3E2UA 2BE7D 1RI0A 1MGQA 1K9MC 5IT9E 3QJYA 2JM8A 1ZSZA 3PGGA 2KE9A 4J6YA 2HDAA 1VYUA 4LN2A 5CVIA 4BI3A 4J9EA 2E6NA 2K3YA 1QQJA 1MUZA 3A1PA 1GCPA 3OMCA 2QGFB 1Y7XA 1MMAA 4Z88A 2FZKB 2A08A 3OQ5A 5KCOA 2DEUA 1VQ8Q 3REBB 1SHGA 2ZPHB 3M56A 3HFOA 4JRIA 2L3RA 3CBOA 3G6EA 3JCMd 3CCSA 4OB2B 3CCEA 2ESWA 1JXMA 1BI3A 7AT1B 2H3JA 3FEOA 3OSVA 5KYUB 2DETA 2DM1A 2H3EB 2CUBA 2YLCA 2DRKA 4M78C 3OY9A 2KAFA 1WHLA 2KT1A 4CC7A 4N4IA 3RKWA 1VQ4A 2M0YA 3VS1A 3A5ZB 1I5OB 2W0ZA 4PJOD 3CCJQ 3DLLA 4JS5A 1PHTA 1C6VX 2NYSA 4ZNXA 5FWBA 2QQ9A 5FU6C 4QVDA 5L23A 4M75C 4DA4A 1GL5A 4BE2A 3QDFA 2VVKA 1G5VA 2RHZA 4FCYA 2MIOA 3PIOA 3CC7T 1GRIA 3EG9A 3QIIA 1BCOA 1PM3A 3JCMQ 2KRMA 2COWA 1Y0MA 3KUFA 5GANh 2RQTA 3E19A 1QKWA 3JB9F 4BB7A 1NEBA 1KC8U 2DILA 3VS6A 5KCHA 2JNGA 4O5VA 1D0ZA 2LX9A 2KXCA 2X3WD 1AHJB 2QYZA 4C8QE 1Q7YR 4N0AA 3SD4A 1WX6A 1OU8A 2KRNA 5A0LA 5GMKi 3QDRB 2O2OA 1N5ZA 4M75F 2EQJA 2LJ1A 4HT9A 1KJWA 1RAIB 4C5GA 1YHQT 1KC8C 3FRNA 1P92A 1OEBA 3THKA 3G71T 1TS9A 3E9FA 3URGA 2KI7A 1G3YA 2RJDA 1VQMQ 4O6JA 1Q7YU 3DB3A 1YJ9Q 3A98A 5LJ5d 2QQRA 2RK1A 4RG8A 2FG0A 3HP9A 4J9HA 2BZXA 5IHKA 2E41A 3JB9G 1KIKA 2KSSA 1T0JA 5GMKl 3JSCA 1N9SA 3M53A 2M16A 4M78G 4OMPA 5GANe 1YITQ 4A53A 2V1RA 1VQ7Q 1V29B 2QAZA 3OSSC 2GTOA 2KNBB 2LX7A 4M77B 3OMGA 1OPKA 2QK0A 2CZ0B 4IUUA 5GJWB 4M75G 2HAXA 2DD5A 4QKUA 3EG0A 3H8ZA 1VQ5A 2RJCA 3JCMh 3FDRA 3CMET 3PT9A 2EKHA 2NUTB 1ABQA 2KGTA 2E64A 3AT1B 2BZYA 2RF0A 3M0UA 2RA2A 4J7IA 1ARKA 3EH2A 4DEXA 3GNFB 3M58A 3QKJA 3CCQT 1MNDA 1C1AA 1SEMA 2DBKA 1ZSGA 3CD6T 4C5HA 4F7UG 3CPWS 1Q86C 4AG2C 4BY6C 1YI2A 3GNGA 1PSEA 1WQWA 4JUVA 5GAOr 1I5LA 1YJWT 4XU3A 1KQ1A 3EGXB 1OV3A 1UJ0A 5GAMd 3A8LB 1B3QA 3OYJA 3G6EQ 1UG1A 5DLQE 3CCSQ 3CCEQ 5GAMj 3BW1A 1NG2A 3MO8A 3I55T 1OI1A 2G6FX 3OW2P 1N27A 1RL2A 4KH1B 3OYMA 4PLLA 3JCMe 2RH2A 1NJIC 1VQ4Q 1AT1B 1QVFS 4DBRA 3G4ST 1M9SA 2LT1A 1Q82C 4HCKA 3OS1A 4LDWA 2OTJT 2SEMA 1PCXA 2P0PA 4A4KA 3I5RA 1SF9A 2K2MA 2KXDA 2GF7A 3OB9A 3E1SA 3EAEA 1KK7A 1I81A 1W2BA 3GF5A 1TUCA 2CP6A 2X4YA 2MWOA 4EMGA 3OYYA 1VQKT 3NPFA 3QZ5B 2SRCA 2I2LA 2D1XA 3CBMA 5LJ5h 1WA7A 3V8KA 1Y07A 3JRZA 2CUDA 3QWYA 4CRIA 5KYYB 2EYXA 4M7DF 1OX9A 1H92A 3TSWA 1TUGB 1Z9ZA 3QXEB 3CCLA 3G7ZA 1D1CA 2DVEA 2CZ1B 4WTOB 3DKMA 4R55A 3JCMW 2HCKA 4C8QC 2EIFA 4OMNA 2RHUA 2EVRA 2CREA 2BZ8A 4M78A 4BE1A 2CP0A 4N4HA 2FVUA 4A4EA 2O01E 2HQEA 4E7SA 4JRKA 3PMTA 4M7AE 1F1BB 2JMCA 1X6OA 1B34B 1TXQA 2R5AA 1IO6A 1YWPA 5A0GA 1WI7A 3CCVA 2ENMA 3FJ5A 1NM7A 2KBTA 3EGXA 4FM4B 3NTKA 4LDUA 2E10A 4M75A 4RKUE 3X20B 2F2VA 3ZL7C 4PJOF 1SRMA 5KE2A 3SDZA 1GFCA 3DB4A 3V7SA 4F04B 5LJ5e 3I5SA 1ZBXA 4C0FA 1SKUB 1RAFB 2M51A 1VQ5Q 3M4YA 2YRDA 5J3BA 5GAMh 3MHXA 3RNJA 3JAME 1X43A 1D1AA 3EFSA 2CZ6B 5LJ3d 3MEVA 1FWZA 2OI3A 4F7UA 1M3CA 2RI3A 2EYWA 5GAOp 2RPNA 4JJDA 2DJQA 2DA9A 3CBPA 5HK0A 4XTZA 2VXFA 2RHXA 3A8HB 2JS2A 8ATCB 2DL7A 1N6AA 1YI2Q 4M7DB 2M02A 4LE9A 4OMLA 1CKBA 1W6XA 2A0FB 1VA7A 4AG1C 4AFSC 4BI4A 2A7YA 5D6XA 3RUXA 2DX1A 4C8QG 3JB9D 2LP5A 3OW2A 3KXTA 2CT3A 3CCJT 3SWNB 4M78D 4ZN1A 2D6FA 3ME9A 1CKAA 2DMOA 1M30A 5KYYA 2EYZA 1Q95G 1YCYA 3TSZA 2X4XA 1MMGA 2A36A 2EQIA 3C4SA 5FRMA 2Y4YA 4Q5WA 4MDWA 2DXTA 3CC4T 2F69A 1M1GA 4M75D 4A4HA 4M77E 2QXFA 4LD9K 2OTLA 1WDXA 3M59A 6AT1B 1N8RC 4PJOB 3QWXX 1OZ3A 3GBQA 2HSPA 4QVCA 3M5AA 5GAOm 4DBQA 1S72T 2QA4A 3CMAA 3E9GA 1VQNA 1U5SA 1MMNA 2X4WA 3MJXA 1ZSZB 1RADB 1EZZB 5KYNA 5C0MA 4RTVA 2ROTA 1H641 2K5FA 2EWNA 2XG8D 4RUGA 1AWOA 2ZPGB 4HVWA 2DERA 3MEAA 1OULA 4XTWA 5GANg 2F5TX 4FT2A 4ORZA 3UATA 2LQWA 3M0RA 4DOVA 3CCLQ 1YJ9T 1VQ6A 1NBEB 3PVQA 4JJCA 4C5EA 1GBRA 4BI8B 2AT1B 2QTXA 2E1HA 2CS7A 1QCOA 4EMKC 4A63B 3RR6A 3BE3A 5GAOl 1YWOA 1YITT 1PRLC 3FLGA 1VQ7T 2PUOB 1JBMA 3HPWA 1PD1A 1YP5A 2Z0WA 3LX7A 3QSUA 4ZGEB 2DLPA 1U06A 3V8LA 5LJ3h 2D0QB 2E5QA 2JW4A 2ZPFB 3CCVQ 1AOJA 3A8MB 3LYIA 2IIMA 4RTWA 4XK8E 4DBHA 2ZPBB 4FYXB 4ME7A 3I9QA 3L2ZA 4C0ZA 1QLYA 2K3XA 4J8OA 1LVKA 5D7UA 1QVGS 1UFFA 3PIPA 1WIEA 2DEQA 1LCKA 3M0SA 3P8DA 3M54A 1JRIA 1YJNA 1RAAB 1IZ6A 4HXJA 1M8MA 1SPKA 1QCFA 2KRSA 3EHRA 2A37A 5DM7R 3RBBB 2QDLA 4OVAA 2F1LA 3EG9B 2J6KA 1K1ZA 3G6ET 3SEMA 3CCST 3JCMg 3QHSA 2O31A 2IVWA 4HVUA 4NL2A 1D0YA 1OQKA 1Q81R 3V7CA 2AKLA 4UC4A 4C8QA 4L5GA 2HZYA 2K9GA 1MMDA 4IURA 4BDZA 3VUZA 1D0XA 2JZ2A 3RDVA 4FSXA 2JN0A 1HJDA 4QQGA 4EMHA 1VQ4T 2LQKA 2LMJA 3KFVA 3VS2A 3I35A 4XTVA 3L1AA 4C92C 4AMCA 2PVOB 4J9DA 2MCNA 2MPXC 2DTOA 4BD3A 1UUEA 5HCKA 3M57A 5CCAA 2PZ1A 3VRZA 5GAN4 1Q81U 2FRWA 4PJLA 3OS2A 4OF1A 4M7DD 4FW1A 1GCQC 2D9TA 5KYXA 2WSEE 1BB9A 2E5KA 2ZPEB 1AVZC 1K73R 3RERA 2LCSA 1UTIA 2OTLQ 5FWCA 2XDDA 3OYDA 1FXXA 1WNLA 3JCMX 2YUOA 1H8KA 2O4XB 2FZGB 2QA4Q 1JB0E 2KDSA 3CMAQ 1WXBA 1VYTA 4XTXA 2L3QA 2CP3A 1JJ2S 5DLOA 4QVZA 3SB2A 2DVJA 2LJ3A 5A2QE 2QI2A 2XIDA 1VIFA 5IHNA 2R58A 1EX4A 4D8KA 2HNIA 3CCRA 3FIFA 2LDMA 2OJ2A 2GQVA 1IGQA 1V1CA 3CCUA 1I8FA 4CC3A 2M0OA 4JZ3A 1UECA 1TSFA 2RD1A 1ZBJA 2RJFA 2V26A 1BIBA 2GTJA 4XU0A 1VQ6Q 5LJ5g 4II1A 3EGUA 2PNIA 4JZ4A 2ZZDA 2B86A 4MMKA 1TH7A 4IIMA 1AEYA 2FO0A 1NLPC 4C92G 1VQPA 1H3HA 5GMKm 4ZTJA 1W2BP 1KD1R 3I56T 2K79A 4RTYA 2L5QA 2NUPB 4M78F 2CKKA 4CI0C 2L8DA 3J81E 2RQVA 2XHCA 2DXUA 4XAXB 1XNIA 1BI0A 3JV3A 2KR3A 5GAOn 2GGRA 5IH2A 2GBQA 1NPPA 2MMPA 4LXCA 2DYIA 2QQSA 4PJOE 1KG1A 2QQBA 1IRXA 4HT8A 1KD1U 2FYKA 3LLRA 3BY7A 3VS7A 2XMFA 5I2MA 3PNWC 4OGCA 5GAN7 4X1VA 1YJNQ 1RAEB 4OMOA 3S6WA 1M90R 1YI2T 4D6WA 1FMWA 4ZGJB 4BACA 1SHFA 3EH1A 4FIBA 1OZ2A 4RG2A 4F7UF 5HKCA 1WHGA 1OPLA 1D3BB 4JS4A 4FW2A 2DD4A 1FMKA 2XI9A 2HKNA 3MPUB 4KGXB 1G3WA 2O4XA 1YNZA 8AT1B 3NFCA 2QQAA 1Q7YC 2EPDA 2YUNA 3G1JA 5D6YA 3MP6A 3MEWA 1ZUUA 4J5YA 3WVDB 2A28A 1M90U 5D6WA 4MMLA 4PK4A 4EMKA 1SG5A 2YRCA 4F17A 3V8JA 1M2VA 1WJSA 1RI9A 1NLOC 5EC7A 3H41A 2GFAA 2R5MA 5J39A 1QWEA 1KQ2A 4OMQA 2QGGA 1HXDA 4KULA 3CPWA 3CXCS 4B6MA 1OU9A 4Z8AA 2ED0A 3CQTA 2Y90A 2V8KA 4M78B 3OYLA 1RACB 5CK9A 5CIUA 1X6BA 3CEYA 2KY9A 4D8DA 1HSQA 2DL4A 1MV0B 2BTTA 1Z9QA 1YHQA 1YIJA 3R6OA 2E3HA 4OB0B 5J26A 1QP2A 5FU6B 2RQRA 4M75B 5LL6S 3PTAA 2COYA 3V7RA 4LNPA 3EGDB 2NUPA 1VOMA 1J3TA 4C0GA 2DE0X 1QVFA 5GAN6 1MHNA 3CCLT 2JS0A 3CCRQ 1W4SA 2MAMA 3CCUQ 2X4JA 4F7UB 1RLPC 5GAN5 2RI2A 1QVPA 2OAWA 4XTUA 1K9AA 3FJPA 1PKSA 3LWIA 2JM9A 2B8AA 1MV3A 1RAGB 2LJ0A 3O8VA 4NL3A 2X9HA 4C92A 2CSIA 4HA8A 4RCCA 2GFUA 2AHJB 2K5LA 2P0QA 4GLKA 1ZX6A 2VWFA 3L2VA 4J9GA 3NTIA 3O5ZA 2KMTA 1VQPQ 1D3BA 2EFIA 2MF2A 1I07A 3NTHA 4LD6A 1H3ZA 2WACA 1EIFA 1R77A 2PTKA 2RN8A 4FT4A 1M3BA 4HCZA 2K4YA 2QASA 1LJOA 4JRPA 2LTOA 3S3OA 5GANf 3P8BB 4IUQA 3IQLA 2EAYA 4QW2A 2L0AA 2HBPA 1QP3A 1YJWA 1JQQA 4DEYA 5GMKj 1PC0A 4AFZC 4AFQC 3PVLA 1SRLA 4K11A 2J05A 5KH6A 2JXBA 1GXIE 1XJWB 3UA6A 1KSWA 4DBFA 3WVEB 3VS0A 3I55A 2AKKA 2RHIA 4AFUC 3M0TA 1X69A 3JB9H 1FMVA 1Y71A 3HRTA 5M9OA 4NOYA 3OYCA 2J7IA 2DTHA 2QEXA 2ABLA 3META 2BUDA 2A3LA 2MOXA 1BYMA 3HFNA 1XOVA 1T3LA 4PJJA 1ZA2B 2F2XA 1B07A 3AHUA 4BY6B 2CP5A 3EGDA 4E7IA 4IUTA 4OMMA 4C92D 2JTMA 4C8QF 3MCAB 4FSSA 1O9SA 4J6XA 3UA7A 4QT7A 4JJBA 1WJRA 3VKIA 3RIRA 2CDTA 3A8OB 1VQ8T 2COZA 3OYNA 4E7KA 4TVRA 2OTLT 1WPYA 3VV0A 3C0CA 1BI2A 1DJ7B 2G3RA 4WCIA 3JCMf 4VUBA 3A8GB 1VQ9A 4PKCC 4FYWB 3OS5A 4N4GA 2QA4T 3CMAT 2HL3A 1JXOA 3CC2A 2RM4A 5IXBA 3GLXA 1VUBA 2HQXA 5FU7C 3OYHA 3QUIA 1YIJQ 1YHQQ 3EG2A 1BIAA 2ZGWA 3L2WA 2RQUA 1BK2A 3C94A 2WSCE 4J9FA 1VQOA 5FLXE 4XU1A 1WFWA 3CPFA 2KK4A 2DIGA 2DL8A 1KQSS 1M1KR 2LCLA 3OS0A 4C0DC 2E65A 5CQYA 1XQHA 1M8VA 1U8RA 1M4ZA 2H8HA 1VQ6T 5GAMe 3M9QA 2NUZA 5CO7A 5FRNA 2DO3A 3GOXA 2C0IA 5GAN2 5I2SA 4MZPA 5CKFA 2HEQA 4F14A 5GMKh 1M1KU 2EBPA 4E2FB 2YRVA 1JJ2P 4ATOA 1S1NA 4C8QB 1GFDA 4WF2A 4LUEA 4L6V5 4N0AC 2ROLA 2NWMA 2BE9B 2DAQA 4E7LA 4M78E 2XKOC 3HTRA 2V8IA 3N5BB 4GLMA 1QW1A 1WHHA 1TTHB 4B9XA 2FZCB 1OOTA 1QKXA 1IHVA 3Q1JA 3UPUA 3VS3A 4OP0A 1Y57A 2IPOB 1VQMT 1YJNT 2CGHA 2MWPA 4E7HA 5KYXB 5LJ5f 3GPLA 2LCCA 4M75E 2DFUA 1JU5C 2WSFE 2V1QA 2DXBA 2D0NA 3I55Q 2KVQG 2XICA 4GBQA 2ECZA 3M55A 3L2QA 2PU9B 3QZ9B 4PJNA 1SSFA 5I21A 1UGPB 4ANJA 1C0MA 4PL6A 3JCMJ 4ELZC 1WXTA 4HKEA 2QEXQ 3CC4A 4EPCA 5KYWA 2HSEB 4FYYB 1QVGA 3UWNA 4JLGA 2PVGB 1WYXA 2LRQA 1K8AR 4DQ2A 3TCJA 4FU6A 2LZ6B 3OYBA 4BUGA 3CCMA 2P4RA 1U1TA 2CZ7B 1ACMB 2RQWA 4M7AC 1S72A 2JT4A 1M27C 3SHWA 3EFOA 1OYXA 2GNCA 3HKSA 4KRTA 2YUQA 1K9MR 1LPLA 1UGVA 4J83A 2KROA 2RJEA 2CP2A 2J6FA 3EG1A 1K8AU 2CH4A 2EGCA 2EJFA 1ZUKA 2R57A 2M9UA 1AWJA 3X24B 1RLQC 1VQ9Q 3CCET 1WXUA 3OYEA 3FC3A 4OGEA 5GANj 1E7OA 2QG9B 3C95A 3MP1A 3H0HA 1I1JA 1M3AA 3X26B 3CC2Q 4QQDA 4JPBW 5LJ3e 4M7AF 3H0IA 1M1FA 3INZA 3CCRT 2YT6A 1VQOQ 1YFNA 1K0SA 3M0PA 3VYGA 1UHFA 3S3MA 4CC2A 1LNXA 3CPWP 2F5KA 2MK5A 2E70A 2EQUA 2K2VA 4OMFB 5FROA 2DJZA 1G3TA 4F16A 5IXFA 3MKDA 2EW3A 1I0CA 2XD0A 2EQKA 1M2OA 1ZA1B 2DF6A 1NYGA 2EGEA 4HVVA 1VQPT 2J06A 3OBYA 1JJ2A 1PD0A 4A4FA 4M7AG 1R8OB 3L42A 4MZMA 1Q81C 1EFNA 1VQNQ 2DL5A 2VXEA 4C92F 2XDBA 1ABOA 2MI6A 2VGNA 4RCBA 4EMKB 1UDLA 1IREB 4M77C 1X6GA 3PFSA 4E7ZA 1WJQA 1M2VB 3LWHA 1E6HA 4R56A 2ED1A 1VIEA 1K73U 1QVFP 4MDXA 1VQLA 5CKBA 3LH5A 2PQWA 4J6WA 3F70A 3VYHB 1K0XA 3OYFA 1UB4A 3QJ6A 3ZBDA 1IHWA 5A0DA 1PSFA 3VU3C 4ZN3A 4M7DE 1NYFA 3C12A 4ELYC 4C8QD 2KYBA 1FX7A 5AYFA 4M7AB 1K73C 4PNOA 2E12A 3ER0A 1PRMC 2RO0A 1UJYA 3QPHA 2GCXA 2OAUA 3BFMA 4M77F 3QYGB 1KC8R 3M0QA 1KHCA 2DPPB 2LQ8A 2VUBA 3LW5E 1HYOA 2KEAA 5L8RE 3RESA 1T0HA 3CC4Q 5KE3A 1X75C 2K6DA 3JCMV 1UHCA 1Y96B 5IN1A 1VQ5T 1X2KA 4RTXA 1WHKA 2P0KA 3CCMQ 1YBYA 5LJ3f 3VUBA 3L2UA 4KBMB 4PFOA 1K76A 1S72Q 1X01A 1O75A 3BDLA 3OYAA 3TVTA 2LQNA 2AK5A 3P8HA 2C0OA 1T3SA 3OBWA 2X51A 2FL7A 3KBGA 4C92B 1IB8A 4M77G 2E4HA 1WHJA 2D8HA 2BIVA 1IXDA 4KGZB 4FL6A 1BCMA 2HKQB 1YIJT 5IHIA 2QDYB 2J6OA 1KD1C 2XU8A 2BKDN 5GAMg 1BU1A 2YLBA 4KT0E 2ZCFB 4Y91A 3ZFJA 4NS5A 1HK9A 2OX7A 4OB3B 4E47A 5LJ5j 5CR2A 2ZPIB 1RUWA 1WHMA 1PWTA 4LDYA 1Q86R 2HL5C 3CC7A 3CXCA 1NE8A 3H0FA 3I56A 1GBQA 1UE9A 1LOJA 4X9DA 1UEBA 3PMIA 3EFRA 1TU0B 1FYNA 2D8JA 4LDXA 1D1BA 1M90C 5KYUA 2DYBA 1IGUA 4R0KA 4HCCA 3QO3A 1Q86U 5C6SA 3OYKA 4M7AA 2XK0A 4EIKA 1KHIA 4AT1B 3ULRB 3VS5A 4LUDA 1NJIR 2O9SA 3HL8A 3G71A 4IUVA 2LNHB 1Q82R 2FPFA 3REAB 1KQSP 1YN8A 1G8XA 2DNUA 3VJPA 2C06A 2YSQA 4J7FA 4EDUA 4JLIA 3RMQA 2DL3A 2L2PA 4L59A 5EG2A 1UGRB 3HHTB 4IKFA 1Y96A 1VQLQ 2EKOA 1ZLMA 1NJIU 2IG0A 2P4TA 4Y28E 4XU2A 4J9BA 5GAN3 4XTYA 1YCSB 1Q82U 1AD5A 4P5NA 2RNAA 2YHTA 4J9IA 4KUIA 2RMOA 2O88A 2HQHA 3QG1A 2YWWA 2LT4A 4KH0B 3GIBA 2I0NA 3CMEA 2QEXT 3CCVT 4RTZA 3TQ7P 1G83A 5CKHA 3VRYA 3RMSA 4M7DC 2K5IA 4JDSA 1GCQA 2CSQA 1RABB 3CCQA 1AWWA 3CD6A 3ZEHA 3SWNC 4M7AD 4KGVB 5AT1B 2FPEA 2K7AA 2FHDA 3JB9I 1BI1A 5LJ3g 3PE0A 3J7AF 1W2BS 1AWXA 3ASKA 4M77A 5IAYA 3UDCA 2PVDB 3DLMA 1VQ9T 1U3OA 1WQ7A 2DXCA 5HK3A 2HD0A 1M5Q1 4Z89A 5GAN8 1G3SA 4PJOC 4JRQA 2KYMA 2DBMA 2EJ9A 3WXMB 4OB1B 2FEIA 3CC2T 3H9NA 2XDPA 4KUDK 2VKNA 2VC8A 3JB9J 2RB6A 4ZTFA 3HRSA 3G4SA 2NUTA 2DTIA 3LH0A 2C0TA 2EQMA 1ZSZC 4GY5A 1WGSA 2CYZB 1TOVA 2YDLA 1N9RA 2YUPA 1QVGP 1VQOT 3MEUA 2OTJA 3JCMP 4RTTA 1R0CB 1PKTA 1V76A 2DZ9A 2V8JA 1TWBA 3SFMA 3JCMc 2EYQA 3CC7Q 4BE0A 3L2RA 2JTFA 1SSHA 1VQKA 2CH4W 2LVMA 2DZCA 1NEGA 4DOWA 3TU4K 3I56Q 4M7DG 2E6ZA 2HMAA 1WZOA
chains in the Genus database with same CATH topology
4EPCA 1WQWA 4JUVA 5GAOr 1QVGA 1YJWT 1I5LA 2RD1A 4XU3A 3UWNA 1KQ1A 2RJFA 4JLGA 2PVGB 2LRQA 5GAMd 4V2SA 4DQ2A 3A8LB 3TCJA 3OYJA 1BIBA 4FU6A 4IUPA 5DLQE 3OYBA 4XU0A 4BUGA 3CCMA 3X28B 3TEEA 1U1TA 5LJ5g 2CZ7B 1VQNT 3BDUA 3BW1A 4II1A 5GAMj 4MZTA 4M7AC 3MO8A 5CKDA 4A4GA 3I55T 1S72A 1OI1A 2VGMA 2ZZDA 3MP8A 3GP8A 3M4GA 4MMKA 1TH7A 1OYXA 1KQSA 1N27A 1RL2A 5LJ3j 2M1HA 2LNVA 3HKSA 3FB9A 4C92G 1VQPA 5GMKm 4ZTJA 2VYTA 4M77D 3TREA 3OYMA 4J83A 4PLLA 3I56T 4YTLA 2L5QA 4M78F 2RH2A 2RJEA 2CKKA 2L89A 3JCMe 4CI0C 2L8DA 1NJIC 2LC4A 3J81E 1K8AU 4C92E 2XHCA 1QVFS 2DXUA 2PUKB 4XAXB 4Z02A 3G4ST 3CC4A 1M9SA 1BI0A 1XNIA 2EJFA 1ZHIA 2K57A 2LT1A 1Q82C 3OS1A 2R57A 5GAOn 4PJOG 2M9UA 3X24B 1NPPA 2MMPA 4LDWA 2OTJT 1UGSB 3CCET 1XTDA 3OYEA 3FC3A 2P0PA 4OGEA 5GANj 4M7AE 2QQSA 3C95A 4PJOE 1KG1A 3MP1A 2QQBA 4A4KA 4HT8A 3X26B 1KD1U 4ZGDB 2GF7A 3OB9A 3E1SA 4QQDA 3EAEA 2FYKA 5LJ3e 4M7AF 3LLRA 3BY7A 1I81A 1W2BA 5I2MA 3GF5A 1N8RU 3PNWC 4OGCA 2X4YA 2MWOA 4PJOA 4EMGA 1M1FA 5GAN7 5CQXA 3INZA 3T9NA 3OYYA 1VQKT 3CCRT 3QZ5B 3S6WA 3OW2S 2I2LA 3LGFA 3CBMA 1YI2T 4HCBA 3UT1A 3VYGA 5LJ5h 3LGLA 4D6WA 4ZGJB 4BACA 2Y4XA 3V8KA 1U1SA 1Y07A 3JRZA 4FIBA 4CRIA 3S3MA 1OZ2A 4RG2A 4F7UF 5HKCA 1VQ8A 1LNXA 1D3BB 2F5KA 4M7DF 2E70A 2EQUA 2K2VA 4OMFB 5FROA 4JS4A 3HSBA 2DD4A 2XI9A 3QXEB 3CCMT 3CCLA 2DJZA 3G7ZA 1G3TA 4PL6A 5CAIA 1G3WA 2O4XA 1M1KC 1BKBA 5HY6A 3NFCA 2QQAA 2DVEA 1Q7YC 2XD0A 5D6YA 3MP6A 3MEWA 2EQKA 2CZ1B 4J5YA 3DKMA 4R55A 3WVDB 1UGQB 1I4K1 1M90U 5D6WA 4MMLA 4EMKA 3JCMW 4QQ6A 4C8QC 2EIFA 1B34A 1VQPT 2RHUA 3OBYA 4RMOA 1JJ2A 3V8JA 1WJSA 4A4FA 4M7AG 4M78A 4BE1A 1R8OB 2GFAA 2FVUA 3L42A 4MZMA 2R5MA 4N4HA 2O01E 2HQEA 4A4EA 4JRKA 5J39A 1Q81C 2KQWA 3PMTA 1KQ2A 2VXEA 4C92F 1HXDA 4RCBA 2MI6A 2VGNA 4KULA 4JJNK 1YITA 4EMKB 3CPWA 2XDBA 1X6OA 1B34B 1IREB 2R5AA 1ZQ1A 4M77C 3CXCS 3CCJA 5A0GA 3PFSA 3CCVA 1WJQA 3QYHB 2Y90A 4C5IA 2V8KA 3LWHA 5GMKe 4FM4B 4M78B 1VIEA 3HRUA 4X9CA 5CK9A 3NTKA 4R56A 4LDUA 5CKBA 3OYLA 4BDYA 1VQLA 2PQWA 2E10A 4J6WA 4M75A 4RKUE 5CIUA 3F70A 3X20B 3CEYA 4PJOF 3VYHB 3OYFA 1UB4A 5KE2A 2KY9A 3SDZA 3QJ6A 3DB4A 3V7SA 3ZBDA 5LJ5e 3RKXA 5A0DA 2JVVA 2RK2A 1PSFA 2DK3A 1YHQA 3VU3C 4ZN3A 1ZBXA 3R6OA 4F7UE 1YIJA 4M7DE 4OB0B 5J26A 4XQ3A 4C0FA 1QP2A 3C12A 5CKEA 5FU6B 4ELYC 3OYIA 4M75B 3M4YA 4C8QD 2NLUA 5LL6S 3PTAA 3X25B 1FX7A 5J3BA 5GAMh 3MHXA 3V7RA 3JAME 5AYFA 4M7AB 2RI5A 5DY9A 1K73C 3H6ZA 3EFSA 2CZ6B 4PNOA 2E12A 3OA6A 5FU7B 5LJ3d 3ER0A 2FB7A 4E7JA 3MEVA 2RO0A 4C0GA 1FWZA 3QPHA 2GCXA 2OAUA 4F7UA 1QVFA 4M7DA 2RHYA 3BFMA 2RI3A 4M77F 5GAOp 3QYGB 5GAN6 1MHNA 3CCLT 1KHCA 2DPPB 3CBPA 5HK0A 2LQ8A 2VUBA 4XTZA 3LW5E 2VXFA 4LDVA 1K9MC 2RHXA 3A8HB 3QBYA 3J80E 1W4SA 2MAMA 5L8RE 4C0DB 3RESA 1N6AA 2X4JA 4F7UB 4M7DB 5KE3A 5GAN5 2RI2A 1X75C 1QVPA 4XTUA 3SWNA 4A54A 3JCMV 2DIQA 2VV5A 5GAMf 3FJPA 3LWIA 2X35A 5GANd 1Y96B 2B8AA 5IN1A 4BI4A 2JOYA 5GAOq 2A7YA 1NPRA 5D6XA 1VQ5T 2P0KA 1VQMA 3RUXA 2JUFA 3O8VA 1YJ9A 1YBYA 5LJ3f 4NL3A 3VUBA 4C92A 4C8QG 3JB9D 4HA8A 3L2UA 1K9MU 4KBMB 2EJGA 3OYGA 4RCCA 3OW2A 1X01A 2GFUA 2AHJB 3KXTA 3SWNB 3CCJT 4M78D 2K5LA 1O75A 2P0QA 4ZN1A 1K8AC 3BDLA 4GLKA 3OYAA 2D6FA 3L2VA 3ME9A 3S3NA 3NTIA 3P8HA 1VQLT 2KMTA 1YCYA 1D3BA 2EFIA 2MF2A 3OBWA 4X34A 2X4XA 4JS5A 2FL7A 3KBGA 2DKGA 1NZ9A 3NTHA 4PLIA 4B9WA 4LD6A 4C92B 3JCMb 3RKYA 1VQ7A 2WACA 3C4SA 4M77G 3CCUT 5FRMA 1H3ZA 2Y4YA 1EIFA 2BIVA 4Q5WA 2DXTA 4MDWA 4FT4A 3CC4T 2F69A 4HCZA 2K4YA 4FL6A 1LJOA 1M1GA 1RI0A 4JRPA 1YIJT 1MGQA 2LTOA 4M75D 2QDYB 4A4HA 5GANf 5IT9E 3P8BB 3QJYA 3S3OA 4M77E 1KD1C 2QXFA 4IUQA 4LD9K 2EAYA 2XU8A 4QW2A 2BKDN 3PGGA 5GAMg 2OTLA 3M59A 4J6YA 2HBPA 1N8RC 2YLBA 1QP3A 4PJOB 1YJWA 4KT0E 2ZCFB 1OZ3A 5GMKj 4QVCA 3M5AA 4Y91A 5GAOm 3ZFJA 1S72T 4NS5A 2QA4A 5KH6A 1HK9A 3CMAA 5CVIA 3E9GA 4BI3A 1VQNA 1GXIE 2E6NA 2K3YA 2X4WA 3WVEB 4OB3B 4E47A 5C0MA 5LJ5j 2RHIA 5CR2A 2ZPIB 3I55A 3OMCA 1Y7XA 4LDYA 3CC7A 3CXCA 1NE8A 1H641 2K5FA 2EWNA 2XG8D 3JB9H 1Y71A 3I56A 3HRTA 5M9OA 3OQ5A 1LOJA 2ZPGB 4NOYA 4X9DA 3OYCA 1UEBA 4ELZC 2DTHA 3MEAA 3PMIA 5KCOA 3EFRA 2QEXA 3META 4XTWA 2ZPHB 4LDXA 2BUDA 2A3LA 2F5TX 3M56A 4FT2A 5GANg 1BYMA 1M90C 3HFNA 1XOVA 3HFOA 4JRIA 4DOVA 4HCCA 1YJ9T 2L3RA 3CBOA 3G6EA 3QO3A 3JCMd 1Q86U 3CCSA 4OB2B 5C6SA 3CCEA 1VQ6A 1BI3A 3AHUA 3OYKA 4BY6B 4M7AA 4C5EA 2H3JA 2XK0A 4BI8B 1KHIA 2QTXA 3FEOA 3OSVA 2E1HA 4E7IA 2CS7A 4IUTA 4C92D 2JTMA 4EMKC 4C8QF 3HL8A 3MCAB 3G71A 5GAOl 4IUVA 1YITT 1O9SA 3FLGA 1VQ7T 2YLCA 4J6XA 1WJRA 3VKIA 2PUOB 1JBMA 3HPWA 4M78C 3RIRA 3VJPA 2KAFA 3OY9A 2C06A 4N4IA 3RKWA 4MDXA 3LX7A 1VQ4A 4J7FA 3QSUA 4EDUA 4ZGEB 3A5ZB 3A8OB 1VQ8T 4JLIA 3V8LA 3OYNA 3RMQA 2D0QB 5LJ3h 4E7KA 4PJOD 3DLLA 2E5QA 4TVRA 2OTLT 1WPYA 2ZPFB 3VV0A 4L59A 1BI2A 1UGRB 3A8MB 1DJ7B 2G3RA 3HHTB 3LYIA 5EG2A 1Y96A 3JCMf 4XK8E 4IKFA 4VUBA 3A8GB 1VQ9A 2ZPBB 2EKOA 4PKCC 2QQ9A 2IG0A 4ME7A 1NJIU 3OS5A 4N4GA 2P4TA 3L2ZA 4Y28E 5FU6C 4QVDA 4C0ZA 2QA4T 4M75C 3CMAT 4DA4A 4XU2A 2K3XA 4BE2A 5GAN3 4XTYA 4J8OA 1Q82U 3CC2A 2RM4A 4P5NA 1QVGS 1G5VA 2RHZA 3GLXA 1VUBA 2HQXA 5FU7C 3OYHA 3QUIA 3PIPA 1BIAA 2ZGWA 2YHTA 3PIOA 3CC7T 3L2WA 3QIIA 4KUIA 2DEQA 3JCMQ 3P8DA 3KUFA 5GANh 3E19A 3C94A 3M54A 3JB9F 1JRIA 1YJNA 1IZ6A 4BB7A 1KC8U 3QG1A 2WSCE 1VQOA 2LT4A 5FLXE 4XU1A 3GIBA 3CPFA 5KCHA 2JNGA 3CMEA 2KK4A 2DIGA 2QEXT 1KQSS 3CCVT 4O5VA 2LCLA 2LX9A 4C0DC 3OS0A 2E65A 5DM7R 4OVAA 5CKHA 1AHJB 5CQYA 4C8QE 3RMSA 4M7DC 4N0AA 1XQHA 1M8VA 2K5IA 3G6ET 3SD4A 1U8RA 4JDSA 3CCST 1M4ZA 3JCMg 1VQ6T 5GAMe 3M9QA 3QHSA 5CO7A 2IVWA 3CCQA 5FRNA 5A0LA 5GMKi 3QDRB 4HT9A 2DO3A 2EQJA 4M75F 4NL2A 3GOXA 3CD6A 4C5GA 1YHQT 1KC8C 3V7CA 3FRNA 1P92A 4UC4A 3ZEHA 4C8QA 5I2SA 5GAN2 4L5GA 3G71T 4MZPA 5CKFA 3SWNC 4M7AD 3E9FA 3URGA 4IURA 4BDZA 1G3YA 5GMKh 1M1KU 2RJDA 3VUZA 2FHDA 4O6JA 2JZ2A 3JB9I 4FSXA 2JN0A 1Q7YU 3DB3A 1BI1A 4QQGA 2YRVA 4EMHA 1VQ4T 2LQKA 5LJ5d 2QQRA 2RK1A 5LJ3g 4XTVA 3L1AA 4RG8A 4C92C 4ATOA 3HP9A 3J7AF 2PVOB 1W2BS 3ASKA 4C8QB 3JB9G 2E41A 4M77A 2KSSA 2DTOA 4WF2A 4BD3A 3JSCA 5GMKl 1N9SA 3M53A 2M16A 5IAYA 3UDCA 3M57A 4M78G 2PVDB 5CCAA 4L6V5 3DLMA 1VQ9T 2DXCA 1WQ7A 4N0AC 5HK3A 5GAN4 5GANe 1Q81U 3OS2A 2HD0A 1M5Q1 4OF1A 4A53A 4M7DD 1V29B 2D9TA 2DAQA 5GAN8 1G3SA 4E7LA 4PJOC 2WSEE 4M78E 4JRQA 2EJ9A 2XKOC 3WXMB 4OB1B 3OSSC 3CC2T 2V8IA 3N5BB 2XDPA 4KUDK 4M77B 3OMGA 2VC8A 1QW1A 3JB9J 2RB6A 2ZPEB 4ZTFA 3RERA 2CZ0B 4IUUA 4B9XA 3HRSA 3G4SA 2DTIA 3LH0A 3Q1JA 3UPUA 2EQMA 4GY5A 4M75G 4OP0A 2DD5A 2HAXA 1WGSA 1VQMT 2CYZB 1K73U 1YJNT 2XDDA 2CGHA 3OYDA 1FXXA 2MWPA 1N9RA 1WNLA 3H8ZA 3JCMX 4E7HA 1VQ5A 5LJ5f 1VQOT 3MEUA 2OTJA 2O4XB 2RJCA 3GPLA 2LCCA 3JCMP 3JCMh 3FDRA 4M75E 3PT9A 1JB0E 3CMET 2KDSA 4XTXA 2WSFE 2DZ9A 2DXBA 2E64A 1JJ2S 5DLOA 4QVZA 2V8JA 3SB2A 3SFMA 2RA2A 4J7IA 3JCMc 5A2QE 2EYQA 2QI2A 3GNFB 2XIDA 3M58A 3QKJA 2KVQG 4BE0A 2XICA 1VIFA 3CCQT 2R58A 3L2RA 2JTFA 1VQKA 3M55A 2LVMA 2HNIA 3L2QA 3CCRA 3FIFA 3CD6T 2DZCA 2LDMA 4C5HA 2GQVA 4DOWA 4F7UG 2PU9B 3QZ9B 3CPWS 3TU4K 1SSFA 4M7DG 5I21A 1UGPB 1Q86C 3CCUA 1I8FA 2E6ZA 4BY6C 1YI2A 3GNGA 2M0OA 3JCMJ 1PSEA 4HKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4H A;  2GFA A;  3L42 A;  4N4H A;  2R5M A;  4A4E A;  5J39 A;  2HQE A;  4IUQ A;  3PMT A;  4QW2 A;  2BKD N;  3UWN A;  2RJF A;  5KCH A;  2LRQ A;  2DIG A;  3OYJ A;  4FU6 A;  3OS0 A;  4IUP A;  1OZ3 A;  3OYB A;  2R5A A;  4OVA A;  3PFS A;  1WJQ A;  4NS5 A;  4II1 A;  5KH6 A;  4C5I A;  3E9G A;  3SD4 A;  3MO8 A;  3OYL A;  2E6N A;  2K3Y A;  4A4G A;  2X4W A;  3NTK A;  4BDY A;  1OI1 A;  2PQW A;  3M9Q A;  3MP8 A;  5CIU A;  5C0M A;  5FRN A;  2RHI A;  3F70 A;  1OYX A;  3CEY A;  3OMC A;  3OYF A;  1N27 A;  5KE2 A;  2EQJ A;  2M1H A;  3GOX A;  3QJ6 A;  3DB4 A;  4C5G A;  4ZTJ A;  2VYT A;  3OYM A;  4UC4 A;  3ZEH A;  4PLL A;  2RJE A;  2CKK A;  2L89 A;  3E9F A;  2L8D A;  5J26 A;  4IUR A;  5M9O A;  4BDZ A;  3OQ5 A;  3OYI A;  3OYC A;  4Z02 A;  2RJD A;  2FHD A;  1XNI A;  2JZ2 A;  2NLU A;  3MEA A;  3PMI A;  5KCO A;  3DB3 A;  3MET A;  2R57 A;  4QQG A;  3OS1 A;  2BUD A;  2YRV A;  2RI5 A;  2QQR A;  3H6Z A;  3OA6 A;  4E7J A;  3ASK A;  3MEV A;  2RO0 A;  2L3R A;  3OYE A;  3FC3 A;  4BD3 A;  2RHY A;  5C6S A;  5IAY A;  2M16 A;  2QQS A;  2RI3 A;  3MP1 A;  3OYK A;  3DLM A;  4C5E A;  1MHN A;  2XK0 A;  1KHC A;  2GF7 A;  3OB9 A;  4QQD A;  3EAE A;  3FEO A;  3OS2 A;  3LLR A;  4E7I A;  2D9T A;  2DAQ A;  4IUT A;  4E7L A;  3PNW C;  2RHX A;  3QBY A;  2X4Y A;  2MWO A;  2XDP A;  4IUV A;  3FLG A;  3OMG A;  1WJR A;  5KE3 A;  4ZTF A;  2RI2 A;  4IUU A;  4B9X A;  3S6W A;  2DIQ A;  3OY9 A;  3LH0 A;  3Q1J A;  2EQM A;  4N4I A;  2X35 A;  4GY5 A;  3LGF A;  2B8A A;  1WGS A;  3LX7 A;  5IN1 A;  5D6X A;  3UT1 A;  4EDU A;  3LGL A;  3OYD A;  2MWP A;  3H8Z A;  2P0K A;  4E7H A;  3OYN A;  4E7K A;  3MEU A;  2O4X B;  3O8V A;  2E5Q A;  2RJC A;  4BAC A;  2LCC A;  3S3M A;  4CRI A;  1OZ2 A;  3FDR A;  4RG2 A;  4L59 A;  3L2U A;  3LYI A;  2F5K A;  2G3R A;  3OYG A;  4IKF A;  2EQU A;  5FRO A;  2GFU A;  2EKO A;  2IG0 A;  4N4G A;  3BDL A;  4PL6 A;  4QVZ A;  3OYA A;  3L2V A;  3ME9 A;  2O4X A;  2K3X A;  4BE2 A;  3NTI A;  3P8H A;  3S3N A;  3QKJ A;  4BE0 A;  2EFI A;  5D6Y A;  3MP6 A;  3MEW A;  2EQK A;  2X4X A;  4X34 A;  2R58 A;  3L2R A;  1G5V A;  2JTF A;  4PLI A;  2RHZ A;  3NTH A;  4B9W A;  2HQX A;  3OYH A;  5D6W A;  4LD6 A;  2LVM A;  3L2Q A;  4QQ6 A;  2WAC A;  3C4S A;  1H3Z A;  2LDM A;  4C5H A;  5FRM A;  2RHU A;  3L2W A;  3QII A;  2BIV A;  4Q5W A;  1SSF A;  4HCZ A;  3P8D A;  1WJS A;  3KUF A;  4FL6 A;  1RI0 A;  4A4F A;  2M0O A;  2LTO A;  3S3O A;  4BE1 A; 
#chains in the Genus database with same CATH topology
 1KFZ A;  2EYY A;  2L3S A;  2O9V A;  4V2S A;  4IUP A;  2ATC B;  3X28 B;  3TEE A;  1VQN T;  3BDU A;  4MZT A;  5CKD A;  4A4G A;  5KYW B;  2VGM A;  3MP8 A;  3GP8 A;  3M4G A;  1KQS A;  5LJ3 j;  3G71 Q;  2M1H A;  2LNV A;  1BBZ A;  3FB9 A;  2VYT A;  4M77 D;  3TRE A;  4YTL A;  1N8R R;  2L89 A;  2LC4 A;  4C92 E;  4E6R A;  2PUK B;  4Z02 A;  3EFO B;  2W10 A;  1ZHI A;  2K57 A;  4PJO G;  3NHN A;  1UGS B;  1XTD A;  1QWF A;  4ZGD B;  2QTV A;  1W70 A;  1N8R U;  1X2Q A;  1JO8 A;  1E6G A;  5CQX A;  3T9N A;  1QCN A;  1RAH B;  3VS4 A;  1TUD A;  4ESR A;  3OW2 S;  2X3X D;  1WLP B;  2EGA A;  3LGF A;  2JJ9 A;  1PG5 B;  4HCB A;  3CME Q;  2YXY A;  2ZAE A;  3UT1 A;  3LGL A;  3EG3 A;  2Y4X A;  1U1S A;  1TG0 A;  1VQ8 A;  1PNJ A;  4CC4 B;  1ZUY A;  3HSB A;  3CCM T;  2KT8 A;  3CCQ Q;  5CAI A;  1M1K C;  1BKB A;  5HY6 A;  1R0B G;  3CD6 Q;  1W1F A;  1UGQ B;  1I4K 1;  3R6N A;  4QQ6 A;  1B34 A;  4RMO A;  1YJW Q;  1B7T A;  3U23 A;  3UF4 A;  4M4Z A;  4FYV B;  2KQW A;  4IIO A;  4JJN K;  4PFP A;  1ZQ1 A;  3CCJ A;  2HBW A;  4PJM A;  2AIR B;  4PFZ A;  3QYH B;  4C5I A;  5GMK e;  1D09 B;  4X9C A;  5FW9 A;  3HRU A;  4BDY A;  1JEG A;  1AZE A;  1MNE A;  1VYV A;  9ATC B;  3RKX A;  2JVV A;  2RK2 A;  2DK3 A;  3G4S Q;  4F7U E;  4XQ3 A;  2AZS A;  3OYI A;  2CT4 A;  5CKE A;  2NLU A;  2OTJ Q;  3X25 B;  1QMC A;  2VAS A;  2RI5 A;  5DY9 A;  3H6Z A;  2P84 A;  3OA6 A;  5FU7 B;  4E7J A;  2FB7 A;  2FPD A;  4J9C A;  4RTU A;  4Y92 A;  4M7D A;  2RHY A;  2DRM A;  2FRY A;  1OX8 A;  1HD3 A;  1VQK Q;  2MYS A;  4LDV A;  1AZG B;  1K4U S;  3QBY A;  3J80 E;  4C0D B;  5I22 A;  2GQI A;  2F2W A;  4A54 A;  3SWN A;  2DIQ A;  2VV5 A;  5GAM f;  3NGP A;  2K3B A;  2X35 A;  5GAN d;  2JOY A;  5GAO q;  1NPR A;  3NMZ C;  1VQM A;  2JUF A;  1YJ9 A;  2E3I A;  1K9M U;  2EJG A;  3OYG A;  5I11 A;  1K8A C;  2AZV A;  5GJV B;  1X27 A;  3S3N A;  3D7S B;  1VQL T;  1CSK A;  4X34 A;  3EHQ A;  2JMA A;  1G2B A;  4PLI A;  1YIT A;  2DKG A;  1NZ9 A;  2CP7 A;  4B9W A;  3JCM b;  1VQ7 A;  4PJO A;  1A0N B;  3RKY A;  3CXC P;  2JTE A;  3CCU T;  5ECA A;  2VB6 A;  2L3P A;  3E2U A;  2BE7 D;  1RI0 A;  1MGQ A;  1K9M C;  5IT9 E;  3QJY A;  2JM8 A;  1ZSZ A;  3PGG A;  2KE9 A;  4J6Y A;  2HDA A;  1VYU A;  4LN2 A;  5CVI A;  4BI3 A;  4J9E A;  2E6N A;  2K3Y A;  1QQJ A;  1MUZ A;  3A1P A;  1GCP A;  3OMC A;  2QGF B;  1Y7X A;  1MMA A;  4Z88 A;  2FZK B;  2A08 A;  3OQ5 A;  5KCO A;  2DEU A;  1VQ8 Q;  3REB B;  1SHG A;  2ZPH B;  3M56 A;  3HFO A;  4JRI A;  2L3R A;  3CBO A;  3G6E A;  3JCM d;  3CCS A;  4OB2 B;  3CCE A;  2ESW A;  1JXM A;  1BI3 A;  7AT1 B;  2H3J A;  3FEO A;  3OSV A;  5KYU B;  2DET A;  2DM1 A;  2H3E B;  2CUB A;  2YLC A;  2DRK A;  4M78 C;  3OY9 A;  2KAF A;  1WHL A;  2KT1 A;  4CC7 A;  4N4I A;  3RKW A;  1VQ4 A;  2M0Y A;  3VS1 A;  3A5Z B;  1I5O B;  2W0Z A;  4PJO D;  3CCJ Q;  3DLL A;  4JS5 A;  1PHT A;  1C6V X;  2NYS A;  4ZNX A;  5FWB A;  2QQ9 A;  5FU6 C;  4QVD A;  5L23 A;  4M75 C;  4DA4 A;  1GL5 A;  4BE2 A;  3QDF A;  2VVK A;  1G5V A;  2RHZ A;  4FCY A;  2MIO A;  3PIO A;  3CC7 T;  1GRI A;  3EG9 A;  3QII A;  1BCO A;  1PM3 A;  3JCM Q;  2KRM A;  2COW A;  1Y0M A;  3KUF A;  5GAN h;  2RQT A;  3E19 A;  1QKW A;  3JB9 F;  4BB7 A;  1NEB A;  1KC8 U;  2DIL A;  3VS6 A;  5KCH A;  2JNG A;  4O5V A;  1D0Z A;  2LX9 A;  2KXC A;  2X3W D;  1AHJ B;  2QYZ A;  4C8Q E;  1Q7Y R;  4N0A A;  3SD4 A;  1WX6 A;  1OU8 A;  2KRN A;  5A0L A;  5GMK i;  3QDR B;  2O2O A;  1N5Z A;  4M75 F;  2EQJ A;  2LJ1 A;  4HT9 A;  1KJW A;  1RAI B;  4C5G A;  1YHQ T;  1KC8 C;  3FRN A;  1P92 A;  1OEB A;  3THK A;  3G71 T;  1TS9 A;  3E9F A;  3URG A;  2KI7 A;  1G3Y A;  2RJD A;  1VQM Q;  4O6J A;  1Q7Y U;  3DB3 A;  1YJ9 Q;  3A98 A;  5LJ5 d;  2QQR A;  2RK1 A;  4RG8 A;  2FG0 A;  3HP9 A;  4J9H A;  2BZX A;  5IHK A;  2E41 A;  3JB9 G;  1KIK A;  2KSS A;  1T0J A;  5GMK l;  3JSC A;  1N9S A;  3M53 A;  2M16 A;  4M78 G;  4OMP A;  5GAN e;  1YIT Q;  4A53 A;  2V1R A;  1VQ7 Q;  1V29 B;  2QAZ A;  3OSS C;  2GTO A;  2KNB B;  2LX7 A;  4M77 B;  3OMG A;  1OPK A;  2QK0 A;  2CZ0 B;  4IUU A;  5GJW B;  4M75 G;  2HAX A;  2DD5 A;  4QKU A;  3EG0 A;  3H8Z A;  1VQ5 A;  2RJC A;  3JCM h;  3FDR A;  3CME T;  3PT9 A;  2EKH A;  2NUT B;  1ABQ A;  2KGT A;  2E64 A;  3AT1 B;  2BZY A;  2RF0 A;  3M0U A;  2RA2 A;  4J7I A;  1ARK A;  3EH2 A;  4DEX A;  3GNF B;  3M58 A;  3QKJ A;  3CCQ T;  1MND A;  1C1A A;  1SEM A;  2DBK A;  1ZSG A;  3CD6 T;  4C5H A;  4F7U G;  3CPW S;  1Q86 C;  4AG2 C;  4BY6 C;  1YI2 A;  3GNG A;  1PSE A;  1WQW A;  4JUV A;  5GAO r;  1I5L A;  1YJW T;  4XU3 A;  1KQ1 A;  3EGX B;  1OV3 A;  1UJ0 A;  5GAM d;  3A8L B;  1B3Q A;  3OYJ A;  3G6E Q;  1UG1 A;  5DLQ E;  3CCS Q;  3CCE Q;  5GAM j;  3BW1 A;  1NG2 A;  3MO8 A;  3I55 T;  1OI1 A;  2G6F X;  3OW2 P;  1N27 A;  1RL2 A;  4KH1 B;  3OYM A;  4PLL A;  3JCM e;  2RH2 A;  1NJI C;  1VQ4 Q;  1AT1 B;  1QVF S;  4DBR A;  3G4S T;  1M9S A;  2LT1 A;  1Q82 C;  4HCK A;  3OS1 A;  4LDW A;  2OTJ T;  2SEM A;  1PCX A;  2P0P A;  4A4K A;  3I5R A;  1SF9 A;  2K2M A;  2KXD A;  2GF7 A;  3OB9 A;  3E1S A;  3EAE A;  1KK7 A;  1I81 A;  1W2B A;  3GF5 A;  1TUC A;  2CP6 A;  2X4Y A;  2MWO A;  4EMG A;  3OYY A;  1VQK T;  3NPF A;  3QZ5 B;  2SRC A;  2I2L A;  2D1X A;  3CBM A;  5LJ5 h;  1WA7 A;  3V8K A;  1Y07 A;  3JRZ A;  2CUD A;  3QWY A;  4CRI A;  5KYY B;  2EYX A;  4M7D F;  1OX9 A;  1H92 A;  3TSW A;  1TUG B;  1Z9Z A;  3QXE B;  3CCL A;  3G7Z A;  1D1C A;  2DVE A;  2CZ1 B;  4WTO B;  3DKM A;  4R55 A;  3JCM W;  2HCK A;  4C8Q C;  2EIF A;  4OMN A;  2RHU A;  2EVR A;  2CRE A;  2BZ8 A;  4M78 A;  4BE1 A;  2CP0 A;  4N4H A;  2FVU A;  4A4E A;  2O01 E;  2HQE A;  4E7S A;  4JRK A;  3PMT A;  4M7A E;  1F1B B;  2JMC A;  1X6O A;  1B34 B;  1TXQ A;  2R5A A;  1IO6 A;  1YWP A;  5A0G A;  1WI7 A;  3CCV A;  2ENM A;  3FJ5 A;  1NM7 A;  2KBT A;  3EGX A;  4FM4 B;  3NTK A;  4LDU A;  2E10 A;  4M75 A;  4RKU E;  3X20 B;  2F2V A;  3ZL7 C;  4PJO F;  1SRM A;  5KE2 A;  3SDZ A;  1GFC A;  3DB4 A;  3V7S A;  4F04 B;  5LJ5 e;  3I5S A;  1ZBX A;  4C0F A;  1SKU B;  1RAF B;  2M51 A;  1VQ5 Q;  3M4Y A;  2YRD A;  5J3B A;  5GAM h;  3MHX A;  3RNJ A;  3JAM E;  1X43 A;  1D1A A;  3EFS A;  2CZ6 B;  5LJ3 d;  3MEV A;  1FWZ A;  2OI3 A;  4F7U A;  1M3C A;  2RI3 A;  2EYW A;  5GAO p;  2RPN A;  4JJD A;  2DJQ A;  2DA9 A;  3CBP A;  5HK0 A;  4XTZ A;  2VXF A;  2RHX A;  3A8H B;  2JS2 A;  8ATC B;  2DL7 A;  1N6A A;  1YI2 Q;  4M7D B;  2M02 A;  4LE9 A;  4OML A;  1CKB A;  1W6X A;  2A0F B;  1VA7 A;  4AG1 C;  4AFS C;  4BI4 A;  2A7Y A;  5D6X A;  3RUX A;  2DX1 A;  4C8Q G;  3JB9 D;  2LP5 A;  3OW2 A;  3KXT A;  2CT3 A;  3CCJ T;  3SWN B;  4M78 D;  4ZN1 A;  2D6F A;  3ME9 A;  1CKA A;  2DMO A;  1M30 A;  5KYY A;  2EYZ A;  1Q95 G;  1YCY A;  3TSZ A;  2X4X A;  1MMG A;  2A36 A;  2EQI A;  3C4S A;  5FRM A;  2Y4Y A;  4Q5W A;  4MDW A;  2DXT A;  3CC4 T;  2F69 A;  1M1G A;  4M75 D;  4A4H A;  4M77 E;  2QXF A;  4LD9 K;  2OTL A;  1WDX A;  3M59 A;  6AT1 B;  1N8R C;  4PJO B;  3QWX X;  1OZ3 A;  3GBQ A;  2HSP A;  4QVC A;  3M5A A;  5GAO m;  4DBQ A;  1S72 T;  2QA4 A;  3CMA A;  3E9G A;  1VQN A;  1U5S A;  1MMN A;  2X4W A;  3MJX A;  1ZSZ B;  1RAD B;  1EZZ B;  5KYN A;  5C0M A;  4RTV A;  2ROT A;  1H64 1;  2K5F A;  2EWN A;  2XG8 D;  4RUG A;  1AWO A;  2ZPG B;  4HVW A;  2DER A;  3MEA A;  1OUL A;  4XTW A;  5GAN g;  2F5T X;  4FT2 A;  4ORZ A;  3UAT A;  2LQW A;  3M0R A;  4DOV A;  3CCL Q;  1YJ9 T;  1VQ6 A;  1NBE B;  3PVQ A;  4JJC A;  4C5E A;  1GBR A;  4BI8 B;  2AT1 B;  2QTX A;  2E1H A;  2CS7 A;  1QCO A;  4EMK C;  4A63 B;  3RR6 A;  3BE3 A;  5GAO l;  1YWO A;  1YIT T;  1PRL C;  3FLG A;  1VQ7 T;  2PUO B;  1JBM A;  3HPW A;  1PD1 A;  1YP5 A;  2Z0W A;  3LX7 A;  3QSU A;  4ZGE B;  2DLP A;  1U06 A;  3V8L A;  5LJ3 h;  2D0Q B;  2E5Q A;  2JW4 A;  2ZPF B;  3CCV Q;  1AOJ A;  3A8M B;  3LYI A;  2IIM A;  4RTW A;  4XK8 E;  4DBH A;  2ZPB B;  4FYX B;  4ME7 A;  3I9Q A;  3L2Z A;  4C0Z A;  1QLY A;  2K3X A;  4J8O A;  1LVK A;  5D7U A;  1QVG S;  1UFF A;  3PIP A;  1WIE A;  2DEQ A;  1LCK A;  3M0S A;  3P8D A;  3M54 A;  1JRI A;  1YJN A;  1RAA B;  1IZ6 A;  4HXJ A;  1M8M A;  1SPK A;  1QCF A;  2KRS A;  3EHR A;  2A37 A;  5DM7 R;  3RBB B;  2QDL A;  4OVA A;  2F1L A;  3EG9 B;  2J6K A;  1K1Z A;  3G6E T;  3SEM A;  3CCS T;  3JCM g;  3QHS A;  2O31 A;  2IVW A;  4HVU A;  4NL2 A;  1D0Y A;  1OQK A;  1Q81 R;  3V7C A;  2AKL A;  4UC4 A;  4C8Q A;  4L5G A;  2HZY A;  2K9G A;  1MMD A;  4IUR A;  4BDZ A;  3VUZ A;  1D0X A;  2JZ2 A;  3RDV A;  4FSX A;  2JN0 A;  1HJD A;  4QQG A;  4EMH A;  1VQ4 T;  2LQK A;  2LMJ A;  3KFV A;  3VS2 A;  3I35 A;  4XTV A;  3L1A A;  4C92 C;  4AMC A;  2PVO B;  4J9D A;  2MCN A;  2MPX C;  2DTO A;  4BD3 A;  1UUE A;  5HCK A;  3M57 A;  5CCA A;  2PZ1 A;  3VRZ A;  5GAN 4;  1Q81 U;  2FRW A;  4PJL A;  3OS2 A;  4OF1 A;  4M7D D;  4FW1 A;  1GCQ C;  2D9T A;  5KYX A;  2WSE E;  1BB9 A;  2E5K A;  2ZPE B;  1AVZ C;  1K73 R;  3RER A;  2LCS A;  1UTI A;  2OTL Q;  5FWC A;  2XDD A;  3OYD A;  1FXX A;  1WNL A;  3JCM X;  2YUO A;  1H8K A;  2O4X B;  2FZG B;  2QA4 Q;  1JB0 E;  2KDS A;  3CMA Q;  1WXB A;  1VYT A;  4XTX A;  2L3Q A;  2CP3 A;  1JJ2 S;  5DLO A;  4QVZ A;  3SB2 A;  2DVJ A;  2LJ3 A;  5A2Q E;  2QI2 A;  2XID A;  1VIF A;  5IHN A;  2R58 A;  1EX4 A;  4D8K A;  2HNI A;  3CCR A;  3FIF A;  2LDM A;  2OJ2 A;  2GQV A;  1IGQ A;  1V1C A;  3CCU A;  1I8F A;  4CC3 A;  2M0O A;  4JZ3 A;  1UEC A;  1TSF A;  2RD1 A;  1ZBJ A;  2RJF A;  2V26 A;  1BIB A;  2GTJ A;  4XU0 A;  1VQ6 Q;  5LJ5 g;  4II1 A;  3EGU A;  2PNI A;  4JZ4 A;  2ZZD A;  2B86 A;  4MMK A;  1TH7 A;  4IIM A;  1AEY A;  2FO0 A;  1NLP C;  4C92 G;  1VQP A;  1H3H A;  5GMK m;  4ZTJ A;  1W2B P;  1KD1 R;  3I56 T;  2K79 A;  4RTY A;  2L5Q A;  2NUP B;  4M78 F;  2CKK A;  4CI0 C;  2L8D A;  3J81 E;  2RQV A;  2XHC A;  2DXU A;  4XAX B;  1XNI A;  1BI0 A;  3JV3 A;  2KR3 A;  5GAO n;  2GGR A;  5IH2 A;  2GBQ A;  1NPP A;  2MMP A;  4LXC A;  2DYI A;  2QQS A;  4PJO E;  1KG1 A;  2QQB A;  1IRX A;  4HT8 A;  1KD1 U;  2FYK A;  3LLR A;  3BY7 A;  3VS7 A;  2XMF A;  5I2M A;  3PNW C;  4OGC A;  5GAN 7;  4X1V A;  1YJN Q;  1RAE B;  4OMO A;  3S6W A;  1M90 R;  1YI2 T;  4D6W A;  1FMW A;  4ZGJ B;  4BAC A;  1SHF A;  3EH1 A;  4FIB A;  1OZ2 A;  4RG2 A;  4F7U F;  5HKC A;  1WHG A;  1OPL A;  1D3B B;  4JS4 A;  4FW2 A;  2DD4 A;  1FMK A;  2XI9 A;  2HKN A;  3MPU B;  4KGX B;  1G3W A;  2O4X A;  1YNZ A;  8AT1 B;  3NFC A;  2QQA A;  1Q7Y C;  2EPD A;  2YUN A;  3G1J A;  5D6Y A;  3MP6 A;  3MEW A;  1ZUU A;  4J5Y A;  3WVD B;  2A28 A;  1M90 U;  5D6W A;  4MML A;  4PK4 A;  4EMK A;  1SG5 A;  2YRC A;  4F17 A;  3V8J A;  1M2V A;  1WJS A;  1RI9 A;  1NLO C;  5EC7 A;  3H41 A;  2GFA A;  2R5M A;  5J39 A;  1QWE A;  1KQ2 A;  4OMQ A;  2QGG A;  1HXD A;  4KUL A;  3CPW A;  3CXC S;  4B6M A;  1OU9 A;  4Z8A A;  2ED0 A;  3CQT A;  2Y90 A;  2V8K A;  4M78 B;  3OYL A;  1RAC B;  5CK9 A;  5CIU A;  1X6B A;  3CEY A;  2KY9 A;  4D8D A;  1HSQ A;  2DL4 A;  1MV0 B;  2BTT A;  1Z9Q A;  1YHQ A;  1YIJ A;  3R6O A;  2E3H A;  4OB0 B;  5J26 A;  1QP2 A;  5FU6 B;  2RQR A;  4M75 B;  5LL6 S;  3PTA A;  2COY A;  3V7R A;  4LNP A;  3EGD B;  2NUP A;  1VOM A;  1J3T A;  4C0G A;  2DE0 X;  1QVF A;  5GAN 6;  1MHN A;  3CCL T;  2JS0 A;  3CCR Q;  1W4S A;  2MAM A;  3CCU Q;  2X4J A;  4F7U B;  1RLP C;  5GAN 5;  2RI2 A;  1QVP A;  2OAW A;  4XTU A;  1K9A A;  3FJP A;  1PKS A;  3LWI A;  2JM9 A;  2B8A A;  1MV3 A;  1RAG B;  2LJ0 A;  3O8V A;  4NL3 A;  2X9H A;  4C92 A;  2CSI A;  4HA8 A;  4RCC A;  2GFU A;  2AHJ B;  2K5L A;  2P0Q A;  4GLK A;  1ZX6 A;  2VWF A;  3L2V A;  4J9G A;  3NTI A;  3O5Z A;  2KMT A;  1VQP Q;  1D3B A;  2EFI A;  2MF2 A;  1I07 A;  3NTH A;  4LD6 A;  1H3Z A;  2WAC A;  1EIF A;  1R77 A;  2PTK A;  2RN8 A;  4FT4 A;  1M3B A;  4HCZ A;  2K4Y A;  2QAS A;  1LJO A;  4JRP A;  2LTO A;  3S3O A;  5GAN f;  3P8B B;  4IUQ A;  3IQL A;  2EAY A;  4QW2 A;  2L0A A;  2HBP A;  1QP3 A;  1YJW A;  1JQQ A;  4DEY A;  5GMK j;  1PC0 A;  4AFZ C;  4AFQ C;  3PVL A;  1SRL A;  4K11 A;  2J05 A;  5KH6 A;  2JXB A;  1GXI E;  1XJW B;  3UA6 A;  1KSW A;  4DBF A;  3WVE B;  3VS0 A;  3I55 A;  2AKK A;  2RHI A;  4AFU C;  3M0T A;  1X69 A;  3JB9 H;  1FMV A;  1Y71 A;  3HRT A;  5M9O A;  4NOY A;  3OYC A;  2J7I A;  2DTH A;  2QEX A;  2ABL A;  3MET A;  2BUD A;  2A3L A;  2MOX A;  1BYM A;  3HFN A;  1XOV A;  1T3L A;  4PJJ A;  1ZA2 B;  2F2X A;  1B07 A;  3AHU A;  4BY6 B;  2CP5 A;  3EGD A;  4E7I A;  4IUT A;  4OMM A;  4C92 D;  2JTM A;  4C8Q F;  3MCA B;  4FSS A;  1O9S A;  4J6X A;  3UA7 A;  4QT7 A;  4JJB A;  1WJR A;  3VKI A;  3RIR A;  2CDT A;  3A8O B;  1VQ8 T;  2COZ A;  3OYN A;  4E7K A;  4TVR A;  2OTL T;  1WPY A;  3VV0 A;  3C0C A;  1BI2 A;  1DJ7 B;  2G3R A;  4WCI A;  3JCM f;  4VUB A;  3A8G B;  1VQ9 A;  4PKC C;  4FYW B;  3OS5 A;  4N4G A;  2QA4 T;  3CMA T;  2HL3 A;  1JXO A;  3CC2 A;  2RM4 A;  5IXB A;  3GLX A;  1VUB A;  2HQX A;  5FU7 C;  3OYH A;  3QUI A;  1YIJ Q;  1YHQ Q;  3EG2 A;  1BIA A;  2ZGW A;  3L2W A;  2RQU A;  1BK2 A;  3C94 A;  2WSC E;  4J9F A;  1VQO A;  5FLX E;  4XU1 A;  1WFW A;  3CPF A;  2KK4 A;  2DIG A;  2DL8 A;  1KQS S;  1M1K R;  2LCL A;  3OS0 A;  4C0D C;  2E65 A;  5CQY A;  1XQH A;  1M8V A;  1U8R A;  1M4Z A;  2H8H A;  1VQ6 T;  5GAM e;  3M9Q A;  2NUZ A;  5CO7 A;  5FRN A;  2DO3 A;  3GOX A;  2C0I A;  5GAN 2;  5I2S A;  4MZP A;  5CKF A;  2HEQ A;  4F14 A;  5GMK h;  1M1K U;  2EBP A;  4E2F B;  2YRV A;  1JJ2 P;  4ATO A;  1S1N A;  4C8Q B;  1GFD A;  4WF2 A;  4LUE A;  4L6V 5;  4N0A C;  2ROL A;  2NWM A;  2BE9 B;  2DAQ A;  4E7L A;  4M78 E;  2XKO C;  3HTR A;  2V8I A;  3N5B B;  4GLM A;  1QW1 A;  1WHH A;  1TTH B;  4B9X A;  2FZC B;  1OOT A;  1QKX A;  1IHV A;  3Q1J A;  3UPU A;  3VS3 A;  4OP0 A;  1Y57 A;  2IPO B;  1VQM T;  1YJN T;  2CGH A;  2MWP A;  4E7H A;  5KYX B;  5LJ5 f;  3GPL A;  2LCC A;  4M75 E;  2DFU A;  1JU5 C;  2WSF E;  2V1Q A;  2DXB A;  2D0N A;  3I55 Q;  2KVQ G;  2XIC A;  4GBQ A;  2ECZ A;  3M55 A;  3L2Q A;  2PU9 B;  3QZ9 B;  4PJN A;  1SSF A;  5I21 A;  1UGP B;  4ANJ A;  1C0M A;  4PL6 A;  3JCM J;  4ELZ C;  1WXT A;  4HKE A;  2QEX Q;  3CC4 A;  4EPC A;  5KYW A;  2HSE B;  4FYY B;  1QVG A;  3UWN A;  4JLG A;  2PVG B;  1WYX A;  2LRQ A;  1K8A R;  4DQ2 A;  3TCJ A;  4FU6 A;  2LZ6 B;  3OYB A;  4BUG A;  3CCM A;  2P4R A;  1U1T A;  2CZ7 B;  1ACM B;  2RQW A;  4M7A C;  1S72 A;  2JT4 A;  1M27 C;  3SHW A;  3EFO A;  1OYX A;  2GNC A;  3HKS A;  4KRT A;  2YUQ A;  1K9M R;  1LPL A;  1UGV A;  4J83 A;  2KRO A;  2RJE A;  2CP2 A;  2J6F A;  3EG1 A;  1K8A U;  2CH4 A;  2EGC A;  2EJF A;  1ZUK A;  2R57 A;  2M9U A;  1AWJ A;  3X24 B;  1RLQ C;  1VQ9 Q;  3CCE T;  1WXU A;  3OYE A;  3FC3 A;  4OGE A;  5GAN j;  1E7O A;  2QG9 B;  3C95 A;  3MP1 A;  3H0H A;  1I1J A;  1M3A A;  3X26 B;  3CC2 Q;  4QQD A;  4JPB W;  5LJ3 e;  4M7A F;  3H0I A;  1M1F A;  3INZ A;  3CCR T;  2YT6 A;  1VQO Q;  1YFN A;  1K0S A;  3M0P A;  3VYG A;  1UHF A;  3S3M A;  4CC2 A;  1LNX A;  3CPW P;  2F5K A;  2MK5 A;  2E70 A;  2EQU A;  2K2V A;  4OMF B;  5FRO A;  2DJZ A;  1G3T A;  4F16 A;  5IXF A;  3MKD A;  2EW3 A;  1I0C A;  2XD0 A;  2EQK A;  1M2O A;  1ZA1 B;  2DF6 A;  1NYG A;  2EGE A;  4HVV A;  1VQP T;  2J06 A;  3OBY A;  1JJ2 A;  1PD0 A;  4A4F A;  4M7A G;  1R8O B;  3L42 A;  4MZM A;  1Q81 C;  1EFN A;  1VQN Q;  2DL5 A;  2VXE A;  4C92 F;  2XDB A;  1ABO A;  2MI6 A;  2VGN A;  4RCB A;  4EMK B;  1UDL A;  1IRE B;  4M77 C;  1X6G A;  3PFS A;  4E7Z A;  1WJQ A;  1M2V B;  3LWH A;  1E6H A;  4R56 A;  2ED1 A;  1VIE A;  1K73 U;  1QVF P;  4MDX A;  1VQL A;  5CKB A;  3LH5 A;  2PQW A;  4J6W A;  3F70 A;  3VYH B;  1K0X A;  3OYF A;  1UB4 A;  3QJ6 A;  3ZBD A;  1IHW A;  5A0D A;  1PSF A;  3VU3 C;  4ZN3 A;  4M7D E;  1NYF A;  3C12 A;  4ELY C;  4C8Q D;  2KYB A;  1FX7 A;  5AYF A;  4M7A B;  1K73 C;  4PNO A;  2E12 A;  3ER0 A;  1PRM C;  2RO0 A;  1UJY A;  3QPH A;  2GCX A;  2OAU A;  3BFM A;  4M77 F;  3QYG B;  1KC8 R;  3M0Q A;  1KHC A;  2DPP B;  2LQ8 A;  2VUB A;  3LW5 E;  1HYO A;  2KEA A;  5L8R E;  3RES A;  1T0H A;  3CC4 Q;  5KE3 A;  1X75 C;  2K6D A;  3JCM V;  1UHC A;  1Y96 B;  5IN1 A;  1VQ5 T;  1X2K A;  4RTX A;  1WHK A;  2P0K A;  3CCM Q;  1YBY A;  5LJ3 f;  3VUB A;  3L2U A;  4KBM B;  4PFO A;  1K76 A;  1S72 Q;  1X01 A;  1O75 A;  3BDL A;  3OYA A;  3TVT A;  2LQN A;  2AK5 A;  3P8H A;  2C0O A;  1T3S A;  3OBW A;  2X51 A;  2FL7 A;  3KBG A;  4C92 B;  1IB8 A;  4M77 G;  2E4H A;  1WHJ A;  2D8H A;  2BIV A;  1IXD A;  4KGZ B;  4FL6 A;  1BCM A;  2HKQ B;  1YIJ T;  5IHI A;  2QDY B;  2J6O A;  1KD1 C;  2XU8 A;  2BKD N;  5GAM g;  1BU1 A;  2YLB A;  4KT0 E;  2ZCF B;  4Y91 A;  3ZFJ A;  4NS5 A;  1HK9 A;  2OX7 A;  4OB3 B;  4E47 A;  5LJ5 j;  5CR2 A;  2ZPI B;  1RUW A;  1WHM A;  1PWT A;  4LDY A;  1Q86 R;  2HL5 C;  3CC7 A;  3CXC A;  1NE8 A;  3H0F A;  3I56 A;  1GBQ A;  1UE9 A;  1LOJ A;  4X9D A;  1UEB A;  3PMI A;  3EFR A;  1TU0 B;  1FYN A;  2D8J A;  4LDX A;  1D1B A;  1M90 C;  5KYU A;  2DYB A;  1IGU A;  4R0K A;  4HCC A;  3QO3 A;  1Q86 U;  5C6S A;  3OYK A;  4M7A A;  2XK0 A;  4EIK A;  1KHI A;  4AT1 B;  3ULR B;  3VS5 A;  4LUD A;  1NJI R;  2O9S A;  3HL8 A;  3G71 A;  4IUV A;  2LNH B;  1Q82 R;  2FPF A;  3REA B;  1KQS P;  1YN8 A;  1G8X A;  2DNU A;  3VJP A;  2C06 A;  2YSQ A;  4J7F A;  4EDU A;  4JLI A;  3RMQ A;  2DL3 A;  2L2P A;  4L59 A;  5EG2 A;  1UGR B;  3HHT B;  4IKF A;  1Y96 A;  1VQL Q;  2EKO A;  1ZLM A;  1NJI U;  2IG0 A;  2P4T A;  4Y28 E;  4XU2 A;  4J9B A;  5GAN 3;  4XTY A;  1YCS B;  1Q82 U;  1AD5 A;  4P5N A;  2RNA A;  2YHT A;  4J9I A;  4KUI A;  2RMO A;  2O88 A;  2HQH A;  3QG1 A;  2YWW A;  2LT4 A;  4KH0 B;  3GIB A;  2I0N A;  3CME A;  2QEX T;  3CCV T;  4RTZ A;  3TQ7 P;  1G83 A;  5CKH A;  3VRY A;  3RMS A;  4M7D C;  2K5I A;  4JDS A;  1GCQ A;  2CSQ A;  1RAB B;  3CCQ A;  1AWW A;  3CD6 A;  3ZEH A;  3SWN C;  4M7A D;  4KGV B;  5AT1 B;  2FPE A;  2K7A A;  2FHD A;  3JB9 I;  1BI1 A;  5LJ3 g;  3PE0 A;  3J7A F;  1W2B S;  1AWX A;  3ASK A;  4M77 A;  5IAY A;  3UDC A;  2PVD B;  3DLM A;  1VQ9 T;  1U3O A;  1WQ7 A;  2DXC A;  5HK3 A;  2HD0 A;  1M5Q 1;  4Z89 A;  5GAN 8;  1G3S A;  4PJO C;  4JRQ A;  2KYM A;  2DBM A;  2EJ9 A;  3WXM B;  4OB1 B;  2FEI A;  3CC2 T;  3H9N A;  2XDP A;  4KUD K;  2VKN A;  2VC8 A;  3JB9 J;  2RB6 A;  4ZTF A;  3HRS A;  3G4S A;  2NUT A;  2DTI A;  3LH0 A;  2C0T A;  2EQM A;  1ZSZ C;  4GY5 A;  1WGS A;  2CYZ B;  1TOV A;  2YDL A;  1N9R A;  2YUP A;  1QVG P;  1VQO T;  3MEU A;  2OTJ A;  3JCM P;  4RTT A;  1R0C B;  1PKT A;  1V76 A;  2DZ9 A;  2V8J A;  1TWB A;  3SFM A;  3JCM c;  2EYQ A;  3CC7 Q;  4BE0 A;  3L2R A;  2JTF A;  1SSH A;  1VQK A;  2CH4 W;  2LVM A;  2DZC A;  1NEG A;  4DOW A;  3TU4 K;  3I56 Q;  4M7D G;  2E6Z A;  2HMA A;  1WZO A; 
#chains in the Genus database with same CATH homology
 4EPC A;  1WQW A;  4JUV A;  5GAO r;  1QVG A;  1YJW T;  1I5L A;  2RD1 A;  4XU3 A;  3UWN A;  1KQ1 A;  2RJF A;  4JLG A;  2PVG B;  2LRQ A;  5GAM d;  4V2S A;  4DQ2 A;  3A8L B;  3TCJ A;  3OYJ A;  1BIB A;  4FU6 A;  4IUP A;  5DLQ E;  3OYB A;  4XU0 A;  4BUG A;  3CCM A;  3X28 B;  3TEE A;  1U1T A;  5LJ5 g;  2CZ7 B;  1VQN T;  3BDU A;  3BW1 A;  4II1 A;  5GAM j;  4MZT A;  4M7A C;  3MO8 A;  5CKD A;  4A4G A;  3I55 T;  1S72 A;  1OI1 A;  2VGM A;  2ZZD A;  3MP8 A;  3GP8 A;  3M4G A;  4MMK A;  1TH7 A;  1OYX A;  1KQS A;  1N27 A;  1RL2 A;  5LJ3 j;  2M1H A;  2LNV A;  3HKS A;  3FB9 A;  4C92 G;  1VQP A;  5GMK m;  4ZTJ A;  2VYT A;  4M77 D;  3TRE A;  3OYM A;  4J83 A;  4PLL A;  3I56 T;  4YTL A;  2L5Q A;  4M78 F;  2RH2 A;  2RJE A;  2CKK A;  2L89 A;  3JCM e;  4CI0 C;  2L8D A;  1NJI C;  2LC4 A;  3J81 E;  1K8A U;  4C92 E;  2XHC A;  1QVF S;  2DXU A;  2PUK B;  4XAX B;  4Z02 A;  3G4S T;  3CC4 A;  1M9S A;  1BI0 A;  1XNI A;  2EJF A;  1ZHI A;  2K57 A;  2LT1 A;  1Q82 C;  3OS1 A;  2R57 A;  5GAO n;  4PJO G;  2M9U A;  3X24 B;  1NPP A;  2MMP A;  4LDW A;  2OTJ T;  1UGS B;  3CCE T;  1XTD A;  3OYE A;  3FC3 A;  2P0P A;  4OGE A;  5GAN j;  4M7A E;  2QQS A;  3C95 A;  4PJO E;  1KG1 A;  3MP1 A;  2QQB A;  4A4K A;  4HT8 A;  3X26 B;  1KD1 U;  4ZGD B;  2GF7 A;  3OB9 A;  3E1S A;  4QQD A;  3EAE A;  2FYK A;  5LJ3 e;  4M7A F;  3LLR A;  3BY7 A;  1I81 A;  1W2B A;  5I2M A;  3GF5 A;  1N8R U;  3PNW C;  4OGC A;  2X4Y A;  2MWO A;  4PJO A;  4EMG A;  1M1F A;  5GAN 7;  5CQX A;  3INZ A;  3T9N A;  3OYY A;  1VQK T;  3CCR T;  3QZ5 B;  3S6W A;  3OW2 S;  2I2L A;  3LGF A;  3CBM A;  1YI2 T;  4HCB A;  3UT1 A;  3VYG A;  5LJ5 h;  3LGL A;  4D6W A;  4ZGJ B;  4BAC A;  2Y4X A;  3V8K A;  1U1S A;  1Y07 A;  3JRZ A;  4FIB A;  4CRI A;  3S3M A;  1OZ2 A;  4RG2 A;  4F7U F;  5HKC A;  1VQ8 A;  1LNX A;  1D3B B;  2F5K A;  4M7D F;  2E70 A;  2EQU A;  2K2V A;  4OMF B;  5FRO A;  4JS4 A;  3HSB A;  2DD4 A;  2XI9 A;  3QXE B;  3CCM T;  3CCL A;  2DJZ A;  3G7Z A;  1G3T A;  4PL6 A;  5CAI A;  1G3W A;  2O4X A;  1M1K C;  1BKB A;  5HY6 A;  3NFC A;  2QQA A;  2DVE A;  1Q7Y C;  2XD0 A;  5D6Y A;  3MP6 A;  3MEW A;  2EQK A;  2CZ1 B;  4J5Y A;  3DKM A;  4R55 A;  3WVD B;  1UGQ B;  1I4K 1;  1M90 U;  5D6W A;  4MML A;  4EMK A;  3JCM W;  4QQ6 A;  4C8Q C;  2EIF A;  1B34 A;  1VQP T;  2RHU A;  3OBY A;  4RMO A;  1JJ2 A;  3V8J A;  1WJS A;  4A4F A;  4M7A G;  4M78 A;  4BE1 A;  1R8O B;  2GFA A;  2FVU A;  3L42 A;  4MZM A;  2R5M A;  4N4H A;  2O01 E;  2HQE A;  4A4E A;  4JRK A;  5J39 A;  1Q81 C;  2KQW A;  3PMT A;  1KQ2 A;  2VXE A;  4C92 F;  1HXD A;  4RCB A;  2MI6 A;  2VGN A;  4KUL A;  4JJN K;  1YIT A;  4EMK B;  3CPW A;  2XDB A;  1X6O A;  1B34 B;  1IRE B;  2R5A A;  1ZQ1 A;  4M77 C;  3CXC S;  3CCJ A;  5A0G A;  3PFS A;  3CCV A;  1WJQ A;  3QYH B;  2Y90 A;  4C5I A;  2V8K A;  3LWH A;  5GMK e;  4FM4 B;  4M78 B;  1VIE A;  3HRU A;  4X9C A;  5CK9 A;  3NTK A;  4R56 A;  4LDU A;  5CKB A;  3OYL A;  4BDY A;  1VQL A;  2PQW A;  2E10 A;  4J6W A;  4M75 A;  4RKU E;  5CIU A;  3F70 A;  3X20 B;  3CEY A;  4PJO F;  3VYH B;  3OYF A;  1UB4 A;  5KE2 A;  2KY9 A;  3SDZ A;  3QJ6 A;  3DB4 A;  3V7S A;  3ZBD A;  5LJ5 e;  3RKX A;  5A0D A;  2JVV A;  2RK2 A;  1PSF A;  2DK3 A;  1YHQ A;  3VU3 C;  4ZN3 A;  1ZBX A;  3R6O A;  4F7U E;  1YIJ A;  4M7D E;  4OB0 B;  5J26 A;  4XQ3 A;  4C0F A;  1QP2 A;  3C12 A;  5CKE A;  5FU6 B;  4ELY C;  3OYI A;  4M75 B;  3M4Y A;  4C8Q D;  2NLU A;  5LL6 S;  3PTA A;  3X25 B;  1FX7 A;  5J3B A;  5GAM h;  3MHX A;  3V7R A;  3JAM E;  5AYF A;  4M7A B;  2RI5 A;  5DY9 A;  1K73 C;  3H6Z A;  3EFS A;  2CZ6 B;  4PNO A;  2E12 A;  3OA6 A;  5FU7 B;  5LJ3 d;  3ER0 A;  2FB7 A;  4E7J A;  3MEV A;  2RO0 A;  4C0G A;  1FWZ A;  3QPH A;  2GCX A;  2OAU A;  4F7U A;  1QVF A;  4M7D A;  2RHY A;  3BFM A;  2RI3 A;  4M77 F;  5GAO p;  3QYG B;  5GAN 6;  1MHN A;  3CCL T;  1KHC A;  2DPP B;  3CBP A;  5HK0 A;  2LQ8 A;  2VUB A;  4XTZ A;  3LW5 E;  2VXF A;  4LDV A;  1K9M C;  2RHX A;  3A8H B;  3QBY A;  3J80 E;  1W4S A;  2MAM A;  5L8R E;  4C0D B;  3RES A;  1N6A A;  2X4J A;  4F7U B;  4M7D B;  5KE3 A;  5GAN 5;  2RI2 A;  1X75 C;  1QVP A;  4XTU A;  3SWN A;  4A54 A;  3JCM V;  2DIQ A;  2VV5 A;  5GAM f;  3FJP A;  3LWI A;  2X35 A;  5GAN d;  1Y96 B;  2B8A A;  5IN1 A;  4BI4 A;  2JOY A;  5GAO q;  2A7Y A;  1NPR A;  5D6X A;  1VQ5 T;  2P0K A;  1VQM A;  3RUX A;  2JUF A;  3O8V A;  1YJ9 A;  1YBY A;  5LJ3 f;  4NL3 A;  3VUB A;  4C92 A;  4C8Q G;  3JB9 D;  4HA8 A;  3L2U A;  1K9M U;  4KBM B;  2EJG A;  3OYG A;  4RCC A;  3OW2 A;  1X01 A;  2GFU A;  2AHJ B;  3KXT A;  3SWN B;  3CCJ T;  4M78 D;  2K5L A;  1O75 A;  2P0Q A;  4ZN1 A;  1K8A C;  3BDL A;  4GLK A;  3OYA A;  2D6F A;  3L2V A;  3ME9 A;  3S3N A;  3NTI A;  3P8H A;  1VQL T;  2KMT A;  1YCY A;  1D3B A;  2EFI A;  2MF2 A;  3OBW A;  4X34 A;  2X4X A;  4JS5 A;  2FL7 A;  3KBG A;  2DKG A;  1NZ9 A;  3NTH A;  4PLI A;  4B9W A;  4LD6 A;  4C92 B;  3JCM b;  3RKY A;  1VQ7 A;  2WAC A;  3C4S A;  4M77 G;  3CCU T;  5FRM A;  1H3Z A;  2Y4Y A;  1EIF A;  2BIV A;  4Q5W A;  2DXT A;  4MDW A;  4FT4 A;  3CC4 T;  2F69 A;  4HCZ A;  2K4Y A;  4FL6 A;  1LJO A;  1M1G A;  1RI0 A;  4JRP A;  1YIJ T;  1MGQ A;  2LTO A;  4M75 D;  2QDY B;  4A4H A;  5GAN f;  5IT9 E;  3P8B B;  3QJY A;  3S3O A;  4M77 E;  1KD1 C;  2QXF A;  4IUQ A;  4LD9 K;  2EAY A;  2XU8 A;  4QW2 A;  2BKD N;  3PGG A;  5GAM g;  2OTL A;  3M59 A;  4J6Y A;  2HBP A;  1N8R C;  2YLB A;  1QP3 A;  4PJO B;  1YJW A;  4KT0 E;  2ZCF B;  1OZ3 A;  5GMK j;  4QVC A;  3M5A A;  4Y91 A;  5GAO m;  3ZFJ A;  1S72 T;  4NS5 A;  2QA4 A;  5KH6 A;  1HK9 A;  3CMA A;  5CVI A;  3E9G A;  4BI3 A;  1VQN A;  1GXI E;  2E6N A;  2K3Y A;  2X4W A;  3WVE B;  4OB3 B;  4E47 A;  5C0M A;  5LJ5 j;  2RHI A;  5CR2 A;  2ZPI B;  3I55 A;  3OMC A;  1Y7X A;  4LDY A;  3CC7 A;  3CXC A;  1NE8 A;  1H64 1;  2K5F A;  2EWN A;  2XG8 D;  3JB9 H;  1Y71 A;  3I56 A;  3HRT A;  5M9O A;  3OQ5 A;  1LOJ A;  2ZPG B;  4NOY A;  4X9D A;  3OYC A;  1UEB A;  4ELZ C;  2DTH A;  3MEA A;  3PMI A;  5KCO A;  3EFR A;  2QEX A;  3MET A;  4XTW A;  2ZPH B;  4LDX A;  2BUD A;  2A3L A;  2F5T X;  3M56 A;  4FT2 A;  5GAN g;  1BYM A;  1M90 C;  3HFN A;  1XOV A;  3HFO A;  4JRI A;  4DOV A;  4HCC A;  1YJ9 T;  2L3R A;  3CBO A;  3G6E A;  3QO3 A;  3JCM d;  1Q86 U;  3CCS A;  4OB2 B;  5C6S A;  3CCE A;  1VQ6 A;  1BI3 A;  3AHU A;  3OYK A;  4BY6 B;  4M7A A;  4C5E A;  2H3J A;  2XK0 A;  4BI8 B;  1KHI A;  2QTX A;  3FEO A;  3OSV A;  2E1H A;  4E7I A;  2CS7 A;  4IUT A;  4C92 D;  2JTM A;  4EMK C;  4C8Q F;  3HL8 A;  3MCA B;  3G71 A;  5GAO l;  4IUV A;  1YIT T;  1O9S A;  3FLG A;  1VQ7 T;  2YLC A;  4J6X A;  1WJR A;  3VKI A;  2PUO B;  1JBM A;  3HPW A;  4M78 C;  3RIR A;  3VJP A;  2KAF A;  3OY9 A;  2C06 A;  4N4I A;  3RKW A;  4MDX A;  3LX7 A;  1VQ4 A;  4J7F A;  3QSU A;  4EDU A;  4ZGE B;  3A5Z B;  3A8O B;  1VQ8 T;  4JLI A;  3V8L A;  3OYN A;  3RMQ A;  2D0Q B;  5LJ3 h;  4E7K A;  4PJO D;  3DLL A;  2E5Q A;  4TVR A;  2OTL T;  1WPY A;  2ZPF B;  3VV0 A;  4L59 A;  1BI2 A;  1UGR B;  3A8M B;  1DJ7 B;  2G3R A;  3HHT B;  3LYI A;  5EG2 A;  1Y96 A;  3JCM f;  4XK8 E;  4IKF A;  4VUB A;  3A8G B;  1VQ9 A;  2ZPB B;  2EKO A;  4PKC C;  2QQ9 A;  2IG0 A;  4ME7 A;  1NJI U;  3OS5 A;  4N4G A;  2P4T A;  3L2Z A;  4Y28 E;  5FU6 C;  4QVD A;  4C0Z A;  2QA4 T;  4M75 C;  3CMA T;  4DA4 A;  4XU2 A;  2K3X A;  4BE2 A;  5GAN 3;  4XTY A;  4J8O A;  1Q82 U;  3CC2 A;  2RM4 A;  4P5N A;  1QVG S;  1G5V A;  2RHZ A;  3GLX A;  1VUB A;  2HQX A;  5FU7 C;  3OYH A;  3QUI A;  3PIP A;  1BIA A;  2ZGW A;  2YHT A;  3PIO A;  3CC7 T;  3L2W A;  3QII A;  4KUI A;  2DEQ A;  3JCM Q;  3P8D A;  3KUF A;  5GAN h;  3E19 A;  3C94 A;  3M54 A;  3JB9 F;  1JRI A;  1YJN A;  1IZ6 A;  4BB7 A;  1KC8 U;  3QG1 A;  2WSC E;  1VQO A;  2LT4 A;  5FLX E;  4XU1 A;  3GIB A;  3CPF A;  5KCH A;  2JNG A;  3CME A;  2KK4 A;  2DIG A;  2QEX T;  1KQS S;  3CCV T;  4O5V A;  2LCL A;  2LX9 A;  4C0D C;  3OS0 A;  2E65 A;  5DM7 R;  4OVA A;  5CKH A;  1AHJ B;  5CQY A;  4C8Q E;  3RMS A;  4M7D C;  4N0A A;  1XQH A;  1M8V A;  2K5I A;  3G6E T;  3SD4 A;  1U8R A;  4JDS A;  3CCS T;  1M4Z A;  3JCM g;  1VQ6 T;  5GAM e;  3M9Q A;  3QHS A;  5CO7 A;  2IVW A;  3CCQ A;  5FRN A;  5A0L A;  5GMK i;  3QDR B;  4HT9 A;  2DO3 A;  2EQJ A;  4M75 F;  4NL2 A;  3GOX A;  3CD6 A;  4C5G A;  1YHQ T;  1KC8 C;  3V7C A;  3FRN A;  1P92 A;  4UC4 A;  3ZEH A;  4C8Q A;  5I2S A;  5GAN 2;  4L5G A;  3G71 T;  4MZP A;  5CKF A;  3SWN C;  4M7A D;  3E9F A;  3URG A;  4IUR A;  4BDZ A;  1G3Y A;  5GMK h;  1M1K U;  2RJD A;  3VUZ A;  2FHD A;  4O6J A;  2JZ2 A;  3JB9 I;  4FSX A;  2JN0 A;  1Q7Y U;  3DB3 A;  1BI1 A;  4QQG A;  2YRV A;  4EMH A;  1VQ4 T;  2LQK A;  5LJ5 d;  2QQR A;  2RK1 A;  5LJ3 g;  4XTV A;  3L1A A;  4RG8 A;  4C92 C;  4ATO A;  3HP9 A;  3J7A F;  2PVO B;  1W2B S;  3ASK A;  4C8Q B;  3JB9 G;  2E41 A;  4M77 A;  2KSS A;  2DTO A;  4WF2 A;  4BD3 A;  3JSC A;  5GMK l;  1N9S A;  3M53 A;  2M16 A;  5IAY A;  3UDC A;  3M57 A;  4M78 G;  2PVD B;  5CCA A;  4L6V 5;  3DLM A;  1VQ9 T;  2DXC A;  1WQ7 A;  4N0A C;  5HK3 A;  5GAN 4;  5GAN e;  1Q81 U;  3OS2 A;  2HD0 A;  1M5Q 1;  4OF1 A;  4A53 A;  4M7D D;  1V29 B;  2D9T A;  2DAQ A;  5GAN 8;  1G3S A;  4E7L A;  4PJO C;  2WSE E;  4M78 E;  4JRQ A;  2EJ9 A;  2XKO C;  3WXM B;  4OB1 B;  3OSS C;  3CC2 T;  2V8I A;  3N5B B;  2XDP A;  4KUD K;  4M77 B;  3OMG A;  2VC8 A;  1QW1 A;  3JB9 J;  2RB6 A;  2ZPE B;  4ZTF A;  3RER A;  2CZ0 B;  4IUU A;  4B9X A;  3HRS A;  3G4S A;  2DTI A;  3LH0 A;  3Q1J A;  3UPU A;  2EQM A;  4GY5 A;  4M75 G;  4OP0 A;  2DD5 A;  2HAX A;  1WGS A;  1VQM T;  2CYZ B;  1K73 U;  1YJN T;  2XDD A;  2CGH A;  3OYD A;  1FXX A;  2MWP A;  1N9R A;  1WNL A;  3H8Z A;  3JCM X;  4E7H A;  1VQ5 A;  5LJ5 f;  1VQO T;  3MEU A;  2OTJ A;  2O4X B;  2RJC A;  3GPL A;  2LCC A;  3JCM P;  3JCM h;  3FDR A;  4M75 E;  3PT9 A;  1JB0 E;  3CME T;  2KDS A;  4XTX A;  2WSF E;  2DZ9 A;  2DXB A;  2E64 A;  1JJ2 S;  5DLO A;  4QVZ A;  2V8J A;  3SB2 A;  3SFM A;  2RA2 A;  4J7I A;  3JCM c;  5A2Q E;  2EYQ A;  2QI2 A;  3GNF B;  2XID A;  3M58 A;  3QKJ A;  2KVQ G;  4BE0 A;  2XIC A;  1VIF A;  3CCQ T;  2R58 A;  3L2R A;  2JTF A;  1VQK A;  3M55 A;  2LVM A;  2HNI A;  3L2Q A;  3CCR A;  3FIF A;  3CD6 T;  2DZC A;  2LDM A;  4C5H A;  2GQV A;  4DOW A;  4F7U G;  2PU9 B;  3QZ9 B;  3CPW S;  3TU4 K;  1SSF A;  4M7D G;  5I21 A;  1UGP B;  1Q86 C;  3CCU A;  1I8F A;  2E6Z A;  4BY6 C;  1YI2 A;  3GNG A;  2M0O A;  3JCM J;  1PSE A;  4HKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...