1YN8A

Sh3 domain of yeast nbp2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
GQRAVALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAP1-binding protein 2
publication title Structural analysis of the yeast SH3 domain proteome
rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 11
structure length 59
sequence length 59
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1yn8A00
3KFVA 1GCQC 5GJVB 1E6GA 1NYGA 2LNHB 1BU1A 1A0NB 3REAB 2F2XA 2HEQA 1PRMC 1H92A 3UF4A 2DX1A 4OMOA 1NYFA 1WA7A 2EVRA 1MUZA 2KT8A 4AFUC 2X3WD 1UTIA 2E5KA 2EGEA 3JV3A 1UJYA 1AD5A 1ZX6A 1YP5A 3LH5A 3PVQA 4D8DA 1QKWA 2FRYA 2J6OA 1UDLA 2PZ1A 2G6FX 1E7OA 2K9GA 1YNZA 2EGCA 2K3BA 1PHTA 1M30A 3UATA 1K0XA 2BZYA 1WXTA 1WX6A 1XOVA 2ESWA 2KEAA 3M0QA 1YCSB 1AZEA 1S1NA 4IIMA 4Z8AA 1WIEA 1QCFA 2D0NA 2EYWA 2YT6A 3NGPA 1T0HA 1OEBA 2KNBB 4RTZA 2CSIA 4CC2A 1PRLC 4CC3A 1HD3A 4RUGA 1RI9A 3I5RA 3PVLA 2IIMA 2GBQA 1HSQA 3VS0A 2LMJA 2EBPA 4JJDA 2SRCA 1WFWA 4HVVA 4JZ3A 2DLPA 1EFNA 2ABLA 4CC7A 1T3LA 2O9VA 1JEGA 1M3AA 5HCKA 2HCKA 1GCPA 1WXBA 1IO6A 2DYBA 2DE0X 2BZ8A 1JXMA 2SEMA 3EHRA 3SHWA 2NWMA 2DL4A 3VRYA 3M0UA 4LN2A 1X27A 2DMOA 2D8HA 4HCKA 4RTYA 2EPDA 1SRMA 4K11A 1X6BA 2LJ0A 4LE9A 2ROTA 2EQIA 2K2MA 2J7IA 2X3XD 1U5SA 1QWFA 2FPDA 1Y57A 2JT4A 3EG2A 3I9QA 2W0ZA 3C0CA 2FO0A 2V1QA 2DL7A 1VA7A 4OMMA 5FWBA 3SEMA 2ENMA 2ED0A 3VS7A 1H3HA 3GBQA 2DRKA 2B86A 2LX7A 4KRTA 2L3QA 5IHNA 1I0CA 1GFCA 1J3TA 1LCKA 2DA9A 1M8MA 2RPNA 1HJDA 3O5ZA 2FG0A 3UA7A 1Y0MA 1NLOC 2DILA 2KT1A 2HBWA 2L2PA 1NEBA 2OI3A 2V1RA 4AG1C 4HVWA 5FWCA 1GRIA 1AWJA 1K4US 4E6RA 1WDXA 5IXBA 3EG1A 2GGRA 3TSWA 2BZXA 2RQVA 2J06A 3QWYA 4OMNA 1AWOA 1KSWA 1X43A 1AWWA 1I1JA 1CKAA 4AG2C 4J9HA 2O88A 2EW3A 2YUPA 1NLPC 2O2OA 2FRWA 2DBMA 2EGAA 1V1CA 1WYXA 1ZUKA 4LUDA 1ZLMA 4EIKA 4QT7A 4DEXA 2RN8A 2DVJA 2W10A 3QWXX 2C0IA 2NUZA 2CUDA 5I11A 2YSQA 1TUDA 1GBQA 3FJ5A 3TVTA 2MOXA 2D8JA 2RF0A 1OPLA 2C0OA 1AWXA 1PKSA 1RUWA 1KJWA 1ZSGA 1UECA 3M0PA 3H41A 4ORZA 4J9EA 4F16A 3EG0A 1BK2A 2YUQA 3H0HA 3R6NA 4A63B 1CKBA 2DBKA 1B3QA 1ABOA 1M3BA 1QLYA 2J6KA 2DJQA 2ED1A 2RQTA 3VS4A 1OOTA 1VYUA 1YN8A 2JM8A 1AVZC 1TG0A 1N5ZA 3M0TA 2RQUA 2LP5A 1U3OA 2CH4A 3IQLA 2VVKA 2J6FA 1W70A 2VWFA 2ROLA 5EC7A 3NPFA 1SHFA 4LUEA 3I35A 4F14A 2EYYA 1TUCA 4J9CA 2MIOA 2A08A 3H0FA 2JXBA 1X2KA 3ZL7C 2JS2A 1VYVA 4HVUA 3VS5A 2DL5A 1G83A 3RBBB 1JO8A 2RNAA 4JJCA 5I22A 2FEIA 4WCIA 2M0YA 2L3PA 2AKKA 4RTUA 1ZUYA 1OPKA 2JW4A 2HDAA 1GL5A 2JM9A 1E6HA 2JMAA 1W6XA 1UHFA 1SEMA 3U23A 2KR3A 1B07A 1ZUUA 4D8KA 1SHGA 2CT4A 1GCQA 4RTXA 1WXUA 2OJ2A 2PNIA 2D1XA 2JMCA 4RTTA 1K1ZA 1YWPA 2CT3A 3EG3A 3VS2A 2KRMA 1PNJA 4OMQA 1MV3A 4CC4B 1OV3A 3EGUA 2KRSA 2PTKA 4AFSC 2YDLA 1K0SA 2BTTA 1NG2A 1CSKA 2FPFA 2M51A 4GLMA 3PE0A 4M4ZA 1ZBJA 3A98A 2F2VA 2LCSA 2AZVA 1JU5C 4J9DA 1UG1A 3REBB 3VS6A 2HSPA 2A37A 2XMFA 4HXJA 1FYNA 2GTJA 3EHQA 4ZNXA 4F17A 1VYTA 1UJ0A 2ECZA 2EYXA 2JS0A 2MCNA 1UE9A 2P4RA 1K9AA 2YUNA 4X1VA 1AZGB 2RQWA 3M0RA 1K76A 5IXFA 2OAWA 2GQIA 1KFZA 1JQQA 1PWTA 4DEYA 1GBRA 2EKHA 1H8KA 2DL8A 2QDLA 1NM7A 1SPKA 1X6GA 2DNUA 3M0SA 5ECAA 2H8HA 2KROA 1QWEA 1UGVA 2O31A 4J9FA 4OMLA 2K7AA 1KIKA 3CQTA 1YWOA 1WI7A 2LZ6B 2DL3A 3THKA 3VS1A 1W1FA 3NHNA 2CSQA 1I07A 2A36A 2CH4W 2AZSA 2K79A 3ULRB 5FW9A 1RLQC 2J05A 1ABQA 4OMPA 5L23A 1T3SA 2O9SA 4Y92A 2CREA 2VKNA 1X69A 2L0AA 2LQWA 2A28A 2DF6A 2KBTA 1FMKA 4Z88A 3I5SA 4LNPA 2KE9A 2EYZA 2DRMA 3TSZA 1M3CA 2AKLA 2JTEA 1SSHA 1X2QA 4GBQA 2C0TA 2KYMA 2KRNA 4JPBW 4RTVA 4ESRA 2RQRA 2RMOA 4AFQC 2LJ1A 1BBZA 2DM1A 2LQNA 2YUOA 1GFDA 2KGTA 4J9IA 3VRZA 2AK5A 1BB9A 5IHKA 5IH2A 4JZ4A 5GJWB 1U06A 2KXCA 3UA6A 2CUBA 4AFZC 2KXDA 1SRLA 1AOJA 2FPEA 1UUEA 1QKXA 1UHCA 2L3SA 2GNCA 2I0NA 1M27C 4Z89A 1Z9QA 1UFFA 2K6DA 1NEGA 3RNJA 1RLPC 2F2WA 1MV0B 4J9BA 2GTOA 1AEYA 3NMZC 2KYBA 5IHIA 4IIOA 1WLPB 4RTWA 4JJBA 2CDTA 4J9GA 4R0KA 3VS3A 1Z9ZA 2LJ3A 1JXOA 1PKTA 3H0IA 1G2BA 4FSSA 1T0JA 1ARKA
chains in the Genus database with same CATH superfamily
1K8AU 1GCQC 5GJVB 1QVGS 1NYGA 2LNHB 2DKGA 4LDXA 2XI9A 2COYA 3UF4A 2DX1A 4B6MA 3DLMA 3C95A 1UEBA 2X3WD 4FYWB 2EGEA 4C0DC 4QQDA 2OTJA 4IURA 1UJYA 1PM3A 4ZGEB 5I2SA 3QIIA 3PVQA 4D8DA 3AT1B 5CAIA 2J6OA 2QEXT 1YNZA 3X28B 2LCCA 2M16A 2OTLA 3QZ9B 1K0XA 1WXTA 3SDZA 3GF5A 5KE2A 3DB3A 4FL6A 1WIEA 1W4SA 4PJOE 1QCFA 5GMKe 2YT6A 3E19A 4B9WA 4ELYC 4CC2A 3JCMW 2EQMA 1VQ8T 1OYXA 1MMDA 3PVLA 1MHNA 4J5YA 3FC3A 2DIGA 2PVOB 2GBQA 2X35A 1M9SA 3CCMA 1SKUB 2DLPA 3EAEA 1EFNA 2LQ8A 1YIJQ 1SSFA 1S72T 2DAQA 1OX8A 3ME9A 5J3BA 3OY9A 4MZMA 5L8RE 5KYWB 4X34A 1WXBA 4QVZA 3OW2P 3S3OA 2RHZA 1VQ7Q 3URGA 1PSEA 3OQ5A 2BZ8A 1K9MC 3SHWA 3JB9G 2DL4A 1M2VA 4KGXB 2EPDA 1VIEA 2IVWA 1X6BA 3UPUA 2LJ0A 4M77D 1ZQ1A 2K2MA 2ROTA 1QVFS 1IZ6A 1U5SA 2CYZB 3RERA 4M77A 2F5TX 2KI7A 2QQ9A 1M1KR 2A3LA 2DXTA 3C0CA 5CCAA 2HKNA 2RI2A 1F1BB 2E3IA 1I5LA 3SEMA 2B86A 2KVQG 4KRTA 3CC2A 5IHNA 1Q86R 5CO7A 1I4K1 4ZN3A 4C92F 3UA7A 4BDYA 1NLOC 3M57A 1B34B 5GAN7 1VQ4A 1D1BA 2BUDA 3PMTA 1QQJA 2V1RA 5FWCA 3M54A 3RKYA 3CPFA 1K4US 1RL2A 3E9FA 3FEOA 1WDXA 3NTKA 2HKQB 3PIPA 4NL2A 4MZTA 5FU7B 2YRVA 2D9TA 4RKUE 5GANg 3OYNA 2QEXA 3L2UA 1YJNT 2CZ1B 2EGAA 1VQNQ 4EMKB 3FRNA 2QYZA 3EGXB 4M7DD 2NUZA 5I11A 4BE2A 4M7DA 2R57A 2RF0A 3CC4Q 2DXBA 5D6WA 3C12A 1VQ8A 1PKSA 1KJWA 2QDYB 3CCVT 1UECA 3EH1A 3D7SB 4DOVA 1KC8U 2DPPB 2QASA 3H0HA 4KGVB 1K73C 4FW2A 1S72A 4JRIA 2I2LA 2E6NA 3TREA 3CCRT 5KYNA 1D1CA 1WQ7A 2RI5A 1ABOA 1M3BA 4BDZA 4NS5A 2DJQA 2EYQA 2RQTA 3CXCP 1PC0A 2RO0A 2JJ9A 1KQSP 3CMAT 5GAMf 1Q81C 1N5ZA 3M0TA 4LXCA 1QCNA 1YJNQ 4M75G 1FMVA 1BI1A 3IQLA 1W70A 3MP1A 4QVDA 4P5NA 1JRIA 4F14A 6AT1B 1TUCA 5GAN6 2MIOA 1X2KA 4C92B 3GNFB 1HXDA 8ATCB 2YLBA 3MP8A 4WCIA 3OYCA 5IAYA 4HCZA 1GL5A 4M78D 1IGUA 3TCJA 2JM9A 2K3XA 2JTMA 1E6HA 1SEMA 4M78A 1QP3A 3CCST 3RKXA 3CCLQ 4DA4A 3MHXA 3CC7Q 4J7IA 1W2BP 3VJPA 1SHGA 2O01E 3JCMV 1Q7YC 3META 4OVAA 2ZPEB 2OJ2A 2D1XA 3JAME 1TU0B 3CMAQ 3HRUA 1Y71A 3QG1A 3VS2A 1PNJA 2F1LA 4KH1B 2KRSA 4RCCA 4C5GA 2QXFA 3O8VA 1GXIE 2RJEA 3PT9A 4XQ3A 3OYDA 2D0QB 1WNLA 4J8OA 3GPLA 1CSKA 2GFUA 2MWOA 3OB9A 3PE0A 4GLMA 2LCSA 1D1AA 1UG1A 3JCMh 3VS6A 4J6YA 2XMFA 4LDUA 1M1KC 3CCEQ 3EHQA 4Q5WA 2QQRA 3JCMJ 2ECZA 1U8RA 2EYXA 5CVIA 4MDWA 4BD3A 3JB9D 2YUNA 4X1VA 1AZGB 2LCLA 2K3YA 3CCVA 4FSXA 1UGRB 3HL8A 3M4YA 4PJOF 1Q86C 2MPXC 1YHQQ 1NZ9A 2QQAA 1GBRA 1H8KA 3TEEA 2RB6A 1TXQA 2H8HA 2KROA 4HCCA 1ZSZC 3CCRA 1RACB 4J9FA 5KYWA 1X6OA 3M4GA 3THKA 3JCMP 3TQ7P 2A36A 1TH7A 2AZSA 7AT1B 2VXFA 3ULRB 4OGCA 5FW9A 1RLQC 2JOYA 3CPWS 5L23A 2VKNA 3L2ZA 3CEYA 1FMKA 5CQXA 2DXUA 2RHYA 1D0ZA 1M3CA 1SSHA 1X2QA 3GP8A 4GBQA 2C0TA 2KYMA 3EG9B 1VQ5T 4IUPA 1RAFB 4RTVA 4ESRA 2RQRA 3HP9A 1BBZA 2EQKA 2LQNA 1H641 3X25B 3JB9H 5IH2A 4BACA 2KXCA 4M7AD 4C92E 3I55T 3CCSA 2COZA 4C8QF 1SRLA 1UUEA 2DD5A 3KBGA 4PFZA 2WSEE 1FWZA 2QA4T 2I0NA 4Z89A 3A8OB 4JS4A 3R6OA 1RLPC 4HT8A 1B34A 2QGFB 4M77G 5A0GA 2O4XB 2E5QA 4IIOA 2EJGA 2DTIA 5GANj 4R0KA 2LJ3A 1JXOA 1PKTA 1K9MR 1I8FA 3PGGA 4AT1B 3CCQQ 4PLIA 3KFVA 2L8DA 1E6GA 3MEVA 2F2XA 1H92A 3UWNA 2KDSA 2OTJT 1NYFA 1VQLQ 1UTIA 2E5KA 3DLLA 1D09B 4PJOB 4A4EA 3LH5A 3DB4A 5FRNA 2HQHA 1VOMA 2PZ1A 3PNWC 2G6FX 1E7OA 2CZ0B 2XICA 4EMKA 4JLGA 4OB1B 1M30A 3EGXA 1HK9A 1WX6A 3G6ET 2V26A 3HTRA 1YCSB 4M75D 5GMKj 2FYKA 5GAMh 1TSFA 1IGQA 2JUFA 2EYWA 2F5KA 2HBPA 3L1AA 1T0HA 3VV0A 4II1A 5FRMA 5LJ3g 3CCMT 1HD3A 4RUGA 3I5RA 2LMJA 1WHJA 4JZ3A 5CKDA 1Q82U 2AIRB 1JJ2P 2K5IA 2CP3A 4CC7A 1T3LA 4AMCA 1VQ9T 2OTJQ 2HCKA 2CS7A 4ZN1A 2GQVA 1IO6A 4M7DG 4XU0A 2DYBA 1BI3A 4M75C 1M90C 4BY6C 1MNEA 2OTLQ 5IT9E 1G3YA 2L89A 2DMOA 4C8QB 4BUGA 4E7IA 4RTYA 4LE9A 3L2VA 1N6AA 5J26A 4C92A 1VQ5A 1BIAA 1QWFA 1KD1R 2KQWA 3CD6T 4QW2A 4RG2A 3CBMA 2E65A 2FVUA 2QTVA 2W0ZA 2DL7A 3OYFA 3V8JA 3I55A 2PVGB 3P8BB 3CC2T 2ED0A 3EH2A 2LX7A 2QA4A 3A1PA 1YITT 3H6ZA 2PVDB 5M9OA 1O9SA 5LJ5j 1J3TA 1LCKA 2RPNA 3EFOB 1HJDA 5AYFA 2FG0A 1K73R 2LVMA 3V8KA 4YTLA 3EGDA 2KSSA 2HBWA 1B7TA 1Q81R 4E6RA 3OS2A 4M78G 5DY9A 3LGLA 2JVVA 2RQVA 2J06A 1XNIA 9ATCB 1X43A 3OYLA 2WSFE 4KUIA 4J9HA 3JB9J 4RMOA 3G4ST 2RHXA 1NLPC 2O2OA 1N8RC 2DBMA 2DEUA 1V1CA 3CC2Q 5A2QE 1WYXA 1M1GA 3V7CA 4EIKA 4KH0B 2LT4A 5DLOA 3G6EA 3HPWA 5CIUA 1UGPB 2BE7D 3VYGA 3MEWA 2QK0A 1WHGA 1PD1A 1LPLA 2CUDA 4XTUA 4F04B 1KK7A 1GBQA 3QYHB 3TVTA 1VQ4Q 2QTXA 2MOXA 2MAMA 1OPLA 5CQYA 1Q7YR 2X9HA 1D0XA 3JCMf 1D3BB 1MMGA 4L6V5 2P0QA 5FU6C 3ZFJA 3Q1JA 1XTDA 3EG0A 5DM7R 1RAEB 2YUQA 3HSBA 3SWNB 3CCUT 2RA2A 1LOJA 4PJMA 1CKBA 4R55A 1VQ9A 3QZ5B 2J6KA 4ANJA 2VUBA 1FX7A 1VYUA 1Y07A 3C4SA 2LQKA 5D6XA 2DXCA 2QEXQ 1AVZC 5GAOm 1TG0A 3CBOA 1I81A 4MMLA 2LP5A 2CP5A 3UDCA 2ROLA 3GOXA 2P0KA 3EG9A 4J9CA 2Y90A 2M0OA 2E70A 1VQ8Q 3CD6A 2JXBA 2JS2A 1VYVA 4C8QE 2Z0WA 3I56T 2LT1A 2RNAA 5I22A 1OU8A 2ZPFB 2PUKB 2E10A 3FLGA 2HDAA 1S72Q 2JMAA 1W6XA 1RAGB 1QCOA 4M77C 1YITA 1PCXA 4F7UE 2CT4A 4JRPA 1V76A 2O4XA 1G3SA 3E1SA 1YWPA 2CT3A 1K8AC 4OMQA 3G1JA 2QAZA 4KGZB 1QVGP 4LDYA 3G71A 2MWPA 1BIBA 5I2MA 2PTKA 4AFSC 4M7AG 2YDLA 1K0SA 2DZ9A 4PJOD 2ZPBB 2M51A 4M4ZA 1ZBJA 4OMFB 4PJOA 2FZKB 4R56A 2E3HA 5LJ3j 3FDRA 4J9DA 3G4SA 1C1AA 2HSPA 2YXYA 4HXJA 1KD1C 1V29B 3OS5A 4ZNXA 4BE0A 4HCBA 2MCNA 2QGGA 1K9AA 4KBMB 4FYXB 3BDUA 3QO3A 2RQWA 3M0RA 1K76A 5IXFA 1M1KU 3BE3A 3L42A 4N4HA 1MGQA 2R58A 1VQOT 2EKHA 3VYHB 2DL8A 3CPWA 2DNUA 3M0SA 4XTZA 3CCUA 4M7DC 2LNVA 4IUQA 1VQ6T 4NL3A 1QW1A 2LZ6B 1WI7A 3VS1A 3S6WA 2QQBA 4N0AA 2CSQA 1OU9A 1TUGB 1I07A 5GAN8 4HKEA 1TS9A 3H8ZA 5KE3A 2E64A 5IN1A 1TTHB 4C8QA 2L0AA 4C0ZA 1VQPT 2A28A 3BY7A 3M56A 4IUTA 4BE1A 2EYZA 2DRMA 3TSZA 1QVFP 3AHUA 2WACA 5CKEA 3CCVQ 2KRNA 4JPBW 2WSCE 3I56A 2P0PA 3MPUB 4A4GA 3M59A 2P4TA 4J9IA 3QXEB 2AK5A 1BB9A 4L59A 4QQ6A 4JZ4A 1G3TA 3CCRQ 5GAN4 4J83A 2KMTA 1HYOA 4AFZC 4BI4A 2XKOC 3LLRA 1QKXA 1LNXA 1QVPA 4PFPA 1RI0A 1SF9A 3EFOA 2L3RA 2DETA 2HNIA 1UFFA 3RNJA 1WHKA 2GCXA 4C92G 2KYBA 1BYMA 3EGDB 4JRKA 4JS5A 4C0FA 2OX7A 3H9NA 2M02A 1LVKA 2LC4A 4J9GA 4M78C 4PNOA 3CMET 4C0DB 1M90R 2X4XA 2HMAA 1T0JA 1ARKA 2K57A 3HKSA 1A0NB 3UT1A 3QSUA 2HEQA 1PRMC 4OMOA 3JCMd 4AFUC 2BKDN 4A4KA 3CCSQ 5GAN3 3LH0A 1ZX6A 1YP5A 2FRYA 2LDMA 4A54A 2X4WA 1LJOA 2EAYA 3CCJT 1PHTA 5HK3A 3UATA 5FLXE 2BZYA 3BW1A 2KEAA 2LRQA 3M0QA 4BI3A 1OI1A 1S1NA 4IIMA 5LJ5f 1KC8C 3NGPA 1D3BA 1BKBA 1QMCA 2RD1A 1SG5A 4CC3A 2YWWA 5HY6A 5AT1B 1VQOA 3GIBA 3SWNA 3VS0A 1C6VX 5GMKm 2EBPA 1BCMA 3OW2A 2SRCA 4HVVA 1QP2A 1ZA1B 1VQ6A 2JZ2A 2YLCA 4Z02A 4Y91A 4QQGA 1M3AA 5HCKA 1Y96B 1GCPA 4ZTJA 2NUTA 2COWA 2DZCA 4J6XA 2DE0X 2FL7A 1JXMA 1PD0A 3EHRA 3M5AA 2NWMA 3VRYA 1VQPA 3M0UA 1X27A 2FHDA 1YI2T 1MMAA 1WZOA 1SRMA 1N8RR 2J7IA 2X3XD 4LD6A 3MP6A 1NJIR 3EG2A 1VUBA 4LDVA 3EFSA 4ZGDB 1AT1B 2FO0A 2JNGA 2V1QA 2DK3A 1VA7A 1P92A 5C6SA 4OMMA 2B8AA 5FWBA 3M53A 3OA6A 2ENMA 1H3HA 5HK0A 3GBQA 3OYGA 2DRKA 2RJFA 1N9RA 2H3EB 1GFCA 1M8MA 4XU2A 1VQMT 3VKIA 2CP2A 2DILA 2RK1A 2RH2A 4F7UF 1H3ZA 5CKFA 2MI6A 2KT1A 3JB9I 1IXDA 1UGQB 5EG2A 4EMHA 2X51A 2L2PA 1NEBA 2OI3A 3CMEA 4M7AC 4AG1C 1FMWA 3QYGB 4HVWA 2D6FA 1GRIA 3JCMe 4WF2A 1VQ5Q 2CKKA 3ZBDA 5IXBA 2VC8A 3KXTA 2DEQA 3TSWA 2BZXA 1MNDA 3QWYA 1AWOA 3RKWA 1YJWT 5KYYB 2DD4A 3RIRA 3QJYA 5KCOA 1AWWA 3MO8A 1I1JA 1M1FA 2QQSA 5GANh 3QPHA 3I55Q 4AG2C 3RMSA 2O88A 1C0MA 2ZGWA 2HD0A 3CCJA 2QA4Q 3L2RA 2XK0A 4E2FB 3QDFA 2EFIA 2RN8A 2DVJA 5GAMd 2W10A 3QWXX 2C0IA 4MMKA 3OYHA 1ZA2B 4O5VA 5FU7C 2YSQA 4FCYA 1TUDA 4XTVA 2HL5C 4DBHA 1WJSA 1BCOA 2KY9A 1RUWA 4PJOG 4EMKC 3M0PA 2K2VA 4FT4A 2MMPA 2HQXA 2KK4A 3BFMA 1OQKA 1K8AR 1OZ2A 3CXCA 1UGSB 5GMKh 3EFRA 3LW5E 2DBKA 1QLYA 1KQSA 5KYXB 4XU3A 2XU8A 3VS4A 3OW2S 1N27A 2RHIA 3A8GB 4DOWA 5LJ3f 2ZZDA 3HFOA 2RQUA 3JB9F 1RAHB 3G6EQ 1U3OA 4C92D 1R0CB 2CH4A 1VQKT 1XQHA 1YI2A 1XJWB 1K9MU 5EC7A 4FW1A 3NPFA 3LWHA 1SHFA 3I35A 3QDRB 1EZZB 2MF2A 4ATOA 4OGEA 3PTAA 2XDDA 2A08A 3X20B 1VIFA 3ZL7C 2M1HA 1R0BG 3CCMQ 3VS5A 1G83A 1DJ7B 3RBBB 4F7UB 2JTFA 2YHTA 3VU3C 3RR6A 1OPKA 2VYTA 1YBYA 3ER0A 3LYIA 1VQ9Q 1UHFA 2DO3A 4C8QG 3U23A 3V8LA 1B07A 4C92C 2XIDA 2QI2A 4FYYB 4M77E 4D8KA 1VQMA 1GCQA 1KG1A 4KT0E 5C0MA 1WXUA 1ZBXA 1KQ2A 2DJZA 1N9SA 2JMCA 4OB0B 4RTTA 3OYBA 2RI3A 4E7LA 2KRMA 3G71T 2G3RA 1OV3A 5GMKi 4N4IA 2E12A 4PL6A 5LJ5h 5LJ5d 4E7JA 3CD6Q 1IREB 2BTTA 1KQ1A 2V8JA 1NG2A 1YJWA 3X24B 1YIJT 4M7AF 2DTHA 4CRIA 3A98A 5HKCA 2F2VA 3ZEHA 2AZVA 1JU5C 3REBB 5GAMe 1VQ7T 2A37A 1FYNA 1Y7XA 1YITQ 4HT9A 4C0GA 1NJIC 3JCMg 4F17A 3A8HB 3WVEB 2EJ9A 5J39A 4IUUA 1UE9A 2P4RA 3SFMA 1G3WA 1WJRA 4ZGJB 3OYEA 1IB8A 1KD1U 2CP7A 1ZSZB 3MEAA 3SB2A 2OAWA 2GQIA 1Q82C 3BDLA 3G71Q 1R8OB 5A0DA 1I5OB 2Y4YA 2E1HA 4DEYA 2LTOA 5ECAA 1X6GA 4XTXA 1YJ9A 1QWEA 1UGVA 2O31A 4OMLA 1Y96A 4M7DE 1YWOA 2NUTB 1W1FA 3G4SQ 4EDUA 3S3NA 2R5AA 1K73U 4PJLA 3LX7A 2K79A 1OULA 1X75C 3JSCA 2FB7A 3CXCS 1MMNA 2J05A 3J81E 3HRTA 4OMPA 1T3SA 2O9SA 2CREA 1KQSS 4B9XA 1VQKA 2F69A 2LQWA 4M75F 2KBTA 4LNPA 2KE9A 1Q81U 2FZGB 2AKLA 2JTEA 2QG9B 4JLIA 3A8MB 5CKHA 5KYUB 1WHHA 3M55A 1OZ3A 1NBEB 2LJ1A 2YUOA 2KGTA 3VRZA 5D7UA 2NUPB 2RHUA 2DFUA 4C5IA 3CCUQ 1U06A 3G7ZA 1KC8R 1RADB 3JCMX 2CUBA 2RM4A 1M4ZA 2FPEA 4GY5A 1UHCA 1WJQA 3LGFA 3FB9A 4E7ZA 2GNCA 2NYSA 2EQUA 2BE9B 2F2WA 1W2BS 1RABB 4J9BA 1VQNT 2GTOA 4M7AB 1AEYA 5IHIA 4XU1A 2H3JA 3INZA 2L5QA 5LJ5e 1Q7YU 4X9CA 2EIFA 3CC4T 1Z9ZA 1FXXA 4M78E 2HAXA 1G2BA 4FSSA 4XTYA 4E7KA 3ASKA 3JCMc 2PQWA 1BU1A 3I56Q 4PFOA 3REAB 2RK2A 3OMGA 5KYYA 4QVCA 1YIJA 1WA7A 2EVRA 1MUZA 2KT8A 5GAOp 4E7SA 3JV3A 4FYVB 1VQ7A 1AD5A 1WGSA 1QKWA 3RMQA 1UDLA 2K9GA 2OAUA 4EMGA 2EGCA 1IRXA 2K3BA 2ZAEA 4E7HA 4TVRA 3OYKA 4KULA 1XOVA 2PUOB 2ESWA 3PIOA 4PJOC 1AZEA 4Z8AA 4OB2B 2V8KA 5LJ3d 5LJ3h 2D0NA 5GANf 1D0YA 1OEBA 2KNBB 4RTZA 2CSIA 1PRLC 5GAN2 3A5ZB 4O6JA 5GAMg 3OYJA 1BI0A 1M2OA 3OYYA 1JJ2A 1RI9A 5KH6A 4M75B 1RAAB 2IIMA 1HSQA 4BY6B 3DKMA 4PJNA 3S3MA 4JJDA 1TWBA 1WFWA 1IHVA 1Q86U 3M9QA 2ABLA 5KYXA 1JEGA 2O9VA 5KCHA 2XHCA 1EX4A 4DBRA 4C8QD 3CCLT 3F70A 3CC7T 3OYMA 2SEMA 3P8DA 3HRSA 4LN2A 4OB3B 4QKUA 5GAOn 2D8HA 2KAFA 4DQ2A 4HCKA 4K11A 3J80E 2XD0A 4N0AC 2EQIA 4C5HA 5GAOl 4F7UA 2FPDA 1Y57A 1UB4A 2JT4A 3NTIA 3SD4A 1VQOQ 3I9QA 4C8QC 4MDXA 4DBFA 4FM4B 4BI8B 5CKBA 4FT2A 1Q95G 2CZ7B 1VQ6Q 4A4HA 1X01A 3KUFA 3VS7A 3CCET 5GAN5 5A0LA 2L3QA 1WPYA 1ZHIA 3J7AF 1I0CA 4PJJA 1U1TA 2DA9A 3MEUA 1VQNA 1PG5B 3O5ZA 2M9UA 1Y0MA 4A4FA 4M77F 2V8IA 3RDVA 1VQPQ 4RCBA 1O75A 4XAXB 2XG8D 3OYIA 3CC4A 5LL6S 1NPRA 2ZPHB 4JJNK 1G5VA 4D6WA 4M7AE 4BB7A 4A53A 1AWJA 2K4YA 4GLKA 5GAOq 1YHQT 2DERA 2ZPGB 3EG1A 2GGRA 4C5EA 3JRZA 3OS1A 2ATCB 4OMNA 4XTWA 1KSWA 4MZPA 2XDPA 1NE8A 1CKAA 2LX9A 5LJ5g 5GAOr 2EW3A 2YUPA 4IUVA 2AT1B 2FRWA 3MJXA 4ME7A 2CP0A 1JB0E 1ZUKA 1ZLMA 3FJPA 4LUDA 2BIVA 4QT7A 5LJ3e 1YJNA 4DEXA 2P84A 1WQWA 2VGNA 5FU6B 2HZYA 2MK5A 4FU6A 1ZSZA 3FJ5A 2D8JA 3MKDA 3CMEQ 2C0OA 1AWXA 4HA8A 1ZSGA 3E9GA 3H41A 4ORZA 1KHCA 4J9EA 3OSSC 4F16A 2PU9B 1BK2A 1OX9A 3L2WA 3PFSA 3V7SA 2GF7A 3GNGA 3R6NA 4A63B 2MYSA 1B3QA 1JJ2S 2VV5A 4Y28E 4M75E 3CCLA 2ED1A 2IG0A 3CC7A 4M7DF 1OOTA 1YN8A 3CCJQ 4EPCA 2JM8A 1EIFA 3SWNC 2EJFA 3WVDB 4JRQA 4NOYA 3VUZA 2A0FB 3L2QA 3CMAA 1M90U 2VVKA 2J6FA 1NPPA 1M2VB 2VWFA 2X4YA 5D6YA 4LUEA 3OS0A 3QKJA 2EYYA 5KYUA 3LWIA 3X26B 3H0FA 2X4JA 3CCQT 1JBMA 4HVUA 4M77B 2DL5A 2NUPA 1JO8A 4JJCA 1RAIB 2FEIA 4CI0C 2M0YA 2L3PA 4UC4A 1M8VA 2AKKA 2EQJA 4RTUA 1ZUYA 2CGHA 2JW4A 1VQLT 3A8LB 3OBYA 1YFNA 2FZCB 1Q82R 2KR3A 1G8XA 3RUXA 2VXEA 1ZUUA 2K5FA 3CCEA 2DYIA 2AHJB 3C94A 3RESA 2ZPIB 3WXMB 4M7AA 1BI2A 4V2SA 4RTXA 4PKCC 3TU4K 4J6WA 1KHIA 2PNIA 5DLQE 1QVGA 2XDBA 1K1ZA 1YI2Q 3EG3A 3OMCA 4VUBA 4KUDK 1MV3A 4CC4B 3EGUA 1YHQA 2IPOB 3QJ6A 4M78F 1WHMA 2K5LA 2NLUA 3CBPA 5GANd 1IHWA 3T9NA 4OP0A 2HQEA 2VASA 2FPFA 5GAMj 2DVEA 4PLLA 5CR2A 2CZ6B 1M5Q1 2GTJA 4E47A 2EWNA 1VQMQ 1VYTA 1UJ0A 2RJCA 2OTLT 2JS0A 1R77A 1N8RU 4XK8E 3OSVA 1AHJB 2VGMA 4M7DB 3N5BB 5I21A 2ZCFB 1NJIU 2R5MA 1KFZA 1JQQA 4M75A 4LD9K 1PWTA 4WTOB 4PK4A 4X9DA 1YJ9T 2YRDA 3FIFA 3QUIA 3OBWA 2YRCA 2QDLA 1NM7A 1SPKA 2HSEB 4RG8A 2DTOA 1YJWQ 2EKOA 2K7AA 1YCYA 4DBQA 1KIKA 3CQTA 3CPWP 2DL3A 1WHLA 3NHNA 3M58A 2E6ZA 2CH4W 4IKFA 2C06A 3VUBA 2E41A 3PMIA 1ABQA 5GMKl 1QVFA 4Y92A 1X69A 2CP6A 3E2UA 3GLXA 2DF6A 4Z88A 3I5SA 2Y4XA 4LDWA 2HL3A 5CK9A 4J7FA 3JCMb 3QBYA 3CCQA 4FIBA 2RMOA 2DIQA 2A7YA 4AFQC 2GFAA 2DM1A 1GFDA 1W2BA 2VB6A 5IHKA 1VQLA 1U1SA 5GJWB 3JCMQ 1YJ9Q 2JN0A 3UA6A 4ELZC 8AT1B 2KXDA 3NFCA 1AOJA 3MCAB 4M78B 4JUVA 2E4HA 4ZTFA 2L3SA 1M27C 1TOVA 1Z9QA 2K6DA 1PSFA 1NEGA 3P8HA 4N4GA 1MV0B 5FROA 3NMZC 3NTHA 4JDSA 4F7UG 1ACMB 4L5GA 1VQKQ 1WLPB 3HFNA 3HHTB 4RTWA 4JJBA 2CDTA 1VQ4T 3VS3A 5GANe 3QHSA 4OF1A 3H0IA 3OYAA 2RJDA 3V7RA
chains in the Genus database with same CATH topology
3KFVA 1GCQC 5GJVB 1E6GA 1NYGA 2LNHB 1BU1A 1A0NB 3REAB 2F2XA 2HEQA 1PRMC 1H92A 3UF4A 2DX1A 4OMOA 1NYFA 1WA7A 2EVRA 1MUZA 2KT8A 4AFUC 2X3WD 1UTIA 2E5KA 2EGEA 3JV3A 1UJYA 1AD5A 1ZX6A 1YP5A 3LH5A 3PVQA 4D8DA 1QKWA 2FRYA 2J6OA 1UDLA 2PZ1A 2G6FX 1E7OA 2K9GA 1YNZA 2EGCA 2K3BA 1PHTA 1M30A 3UATA 1K0XA 2BZYA 1WXTA 1WX6A 1XOVA 2ESWA 2KEAA 3M0QA 1YCSB 1AZEA 1S1NA 4IIMA 4Z8AA 1WIEA 1QCFA 2D0NA 2EYWA 2YT6A 3NGPA 1T0HA 1OEBA 2KNBB 4RTZA 2CSIA 4CC2A 1PRLC 4CC3A 1HD3A 4RUGA 1RI9A 3I5RA 3PVLA 2IIMA 2GBQA 1HSQA 3VS0A 2LMJA 2EBPA 4JJDA 2SRCA 1WFWA 4HVVA 4JZ3A 2DLPA 1EFNA 2ABLA 4CC7A 1T3LA 2O9VA 1JEGA 1M3AA 5HCKA 2HCKA 1GCPA 1WXBA 1IO6A 2DYBA 2DE0X 2BZ8A 1JXMA 2SEMA 3EHRA 3SHWA 2NWMA 2DL4A 3VRYA 3M0UA 4LN2A 1X27A 2DMOA 2D8HA 4HCKA 4RTYA 2EPDA 1SRMA 4K11A 1X6BA 2LJ0A 4LE9A 2ROTA 2EQIA 2K2MA 2J7IA 2X3XD 1U5SA 1QWFA 2FPDA 1Y57A 2JT4A 3EG2A 3I9QA 2W0ZA 3C0CA 2FO0A 2V1QA 2DL7A 1VA7A 4OMMA 5FWBA 3SEMA 2ENMA 2ED0A 3VS7A 1H3HA 3GBQA 2DRKA 2B86A 2LX7A 4KRTA 2L3QA 5IHNA 1I0CA 1GFCA 1J3TA 1LCKA 2DA9A 1M8MA 2RPNA 1HJDA 3O5ZA 2FG0A 3UA7A 1Y0MA 1NLOC 2DILA 2KT1A 2HBWA 2L2PA 1NEBA 2OI3A 2V1RA 4AG1C 4HVWA 5FWCA 1GRIA 1AWJA 1K4US 4E6RA 1WDXA 5IXBA 3EG1A 2GGRA 3TSWA 2BZXA 2RQVA 2J06A 3QWYA 4OMNA 1AWOA 1KSWA 1X43A 1AWWA 1I1JA 1CKAA 4AG2C 4J9HA 2O88A 2EW3A 2YUPA 1NLPC 2O2OA 2FRWA 2DBMA 2EGAA 1V1CA 1WYXA 1ZUKA 4LUDA 1ZLMA 4EIKA 4QT7A 4DEXA 2RN8A 2DVJA 2W10A 3QWXX 2C0IA 2NUZA 2CUDA 5I11A 2YSQA 1TUDA 1GBQA 3FJ5A 3TVTA 2MOXA 2D8JA 2RF0A 1OPLA 2C0OA 1AWXA 1PKSA 1RUWA 1KJWA 1ZSGA 1UECA 3M0PA 3H41A 4ORZA 4J9EA 4F16A 3EG0A 1BK2A 2YUQA 3H0HA 3R6NA 4A63B 1CKBA 2DBKA 1B3QA 1ABOA 1M3BA 1QLYA 2J6KA 2DJQA 2ED1A 2RQTA 3VS4A 1OOTA 1VYUA 1YN8A 2JM8A 1AVZC 1TG0A 1N5ZA 3M0TA 2RQUA 2LP5A 1U3OA 2CH4A 3IQLA 2VVKA 2J6FA 1W70A 2VWFA 2ROLA 5EC7A 3NPFA 1SHFA 4LUEA 3I35A 4F14A 2EYYA 1TUCA 4J9CA 2MIOA 2A08A 3H0FA 2JXBA 1X2KA 3ZL7C 2JS2A 1VYVA 4HVUA 3VS5A 2DL5A 1G83A 3RBBB 1JO8A 2RNAA 4JJCA 5I22A 2FEIA 4WCIA 2M0YA 2L3PA 2AKKA 4RTUA 1ZUYA 1OPKA 2JW4A 2HDAA 1GL5A 2JM9A 1E6HA 2JMAA 1W6XA 1UHFA 1SEMA 3U23A 2KR3A 1B07A 1ZUUA 4D8KA 1SHGA 2CT4A 1GCQA 4RTXA 1WXUA 2OJ2A 2PNIA 2D1XA 2JMCA 4RTTA 1K1ZA 1YWPA 2CT3A 3EG3A 3VS2A 2KRMA 1PNJA 4OMQA 1MV3A 4CC4B 1OV3A 3EGUA 2KRSA 2PTKA 4AFSC 2YDLA 1K0SA 2BTTA 1NG2A 1CSKA 2FPFA 2M51A 4GLMA 3PE0A 4M4ZA 1ZBJA 3A98A 2F2VA 2LCSA 2AZVA 1JU5C 4J9DA 1UG1A 3REBB 3VS6A 2HSPA 2A37A 2XMFA 4HXJA 1FYNA 2GTJA 3EHQA 4ZNXA 4F17A 1VYTA 1UJ0A 2ECZA 2EYXA 2JS0A 2MCNA 1UE9A 2P4RA 1K9AA 2YUNA 4X1VA 1AZGB 2RQWA 3M0RA 1K76A 5IXFA 2OAWA 2GQIA 1KFZA 1JQQA 1PWTA 4DEYA 1GBRA 2EKHA 1H8KA 2DL8A 2QDLA 1NM7A 1SPKA 1X6GA 2DNUA 3M0SA 5ECAA 2H8HA 2KROA 1QWEA 1UGVA 2O31A 4J9FA 4OMLA 2K7AA 1KIKA 3CQTA 1YWOA 1WI7A 2LZ6B 2DL3A 3THKA 3VS1A 1W1FA 3NHNA 2CSQA 1I07A 2A36A 2CH4W 2AZSA 2K79A 3ULRB 5FW9A 1RLQC 2J05A 1ABQA 4OMPA 5L23A 1T3SA 2O9SA 4Y92A 2CREA 2VKNA 1X69A 2L0AA 2LQWA 2A28A 2DF6A 2KBTA 1FMKA 4Z88A 3I5SA 4LNPA 2KE9A 2EYZA 2DRMA 3TSZA 1M3CA 2AKLA 2JTEA 1SSHA 1X2QA 4GBQA 2C0TA 2KYMA 2KRNA 4JPBW 4RTVA 4ESRA 2RQRA 2RMOA 4AFQC 2LJ1A 1BBZA 2DM1A 2LQNA 2YUOA 1GFDA 2KGTA 4J9IA 3VRZA 2AK5A 1BB9A 5IHKA 5IH2A 4JZ4A 5GJWB 1U06A 2KXCA 3UA6A 2CUBA 4AFZC 2KXDA 1SRLA 1AOJA 2FPEA 1UUEA 1QKXA 1UHCA 2L3SA 2GNCA 2I0NA 1M27C 4Z89A 1Z9QA 1UFFA 2K6DA 1NEGA 3RNJA 1RLPC 2F2WA 1MV0B 4J9BA 2GTOA 1AEYA 3NMZC 2KYBA 5IHIA 4IIOA 1WLPB 4RTWA 4JJBA 2CDTA 4J9GA 4R0KA 3VS3A 1Z9ZA 2LJ3A 1JXOA 1PKTA 3H0IA 1G2BA 4FSSA 1T0JA 1ARKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KFV A;  1GCQ C;  5GJV B;  1E6G A;  1NYG A;  2LNH B;  1BU1 A;  1A0N B;  3REA B;  2F2X A;  2HEQ A;  1PRM C;  1H92 A;  3UF4 A;  2DX1 A;  4OMO A;  1NYF A;  1WA7 A;  2EVR A;  1MUZ A;  2KT8 A;  4AFU C;  2X3W D;  1UTI A;  2E5K A;  2EGE A;  3JV3 A;  1UJY A;  1AD5 A;  1ZX6 A;  1YP5 A;  3LH5 A;  3PVQ A;  4D8D A;  1QKW A;  2FRY A;  2J6O A;  1UDL A;  2PZ1 A;  2G6F X;  1E7O A;  2K9G A;  1YNZ A;  2EGC A;  2K3B A;  1PHT A;  1M30 A;  3UAT A;  1K0X A;  2BZY A;  1WXT A;  1WX6 A;  1XOV A;  2ESW A;  2KEA A;  3M0Q A;  1YCS B;  1AZE A;  1S1N A;  4IIM A;  4Z8A A;  1WIE A;  1QCF A;  2D0N A;  2EYW A;  2YT6 A;  3NGP A;  1T0H A;  1OEB A;  2KNB B;  4RTZ A;  2CSI A;  4CC2 A;  1PRL C;  4CC3 A;  1HD3 A;  4RUG A;  1RI9 A;  3I5R A;  3PVL A;  2IIM A;  2GBQ A;  1HSQ A;  3VS0 A;  2LMJ A;  2EBP A;  4JJD A;  2SRC A;  1WFW A;  4HVV A;  4JZ3 A;  2DLP A;  1EFN A;  2ABL A;  4CC7 A;  1T3L A;  2O9V A;  1JEG A;  1M3A A;  5HCK A;  2HCK A;  1GCP A;  1WXB A;  1IO6 A;  2DYB A;  2DE0 X;  2BZ8 A;  1JXM A;  2SEM A;  3EHR A;  3SHW A;  2NWM A;  2DL4 A;  3VRY A;  3M0U A;  4LN2 A;  1X27 A;  2DMO A;  2D8H A;  4HCK A;  4RTY A;  2EPD A;  1SRM A;  4K11 A;  1X6B A;  2LJ0 A;  4LE9 A;  2ROT A;  2EQI A;  2K2M A;  2J7I A;  2X3X D;  1U5S A;  1QWF A;  2FPD A;  1Y57 A;  2JT4 A;  3EG2 A;  3I9Q A;  2W0Z A;  3C0C A;  2FO0 A;  2V1Q A;  2DL7 A;  1VA7 A;  4OMM A;  5FWB A;  3SEM A;  2ENM A;  2ED0 A;  3VS7 A;  1H3H A;  3GBQ A;  2DRK A;  2B86 A;  2LX7 A;  4KRT A;  2L3Q A;  5IHN A;  1I0C A;  1GFC A;  1J3T A;  1LCK A;  2DA9 A;  1M8M A;  2RPN A;  1HJD A;  3O5Z A;  2FG0 A;  3UA7 A;  1Y0M A;  1NLO C;  2DIL A;  2KT1 A;  2HBW A;  2L2P A;  1NEB A;  2OI3 A;  2V1R A;  4AG1 C;  4HVW A;  5FWC A;  1GRI A;  1AWJ A;  1K4U S;  4E6R A;  1WDX A;  5IXB A;  3EG1 A;  2GGR A;  3TSW A;  2BZX A;  2RQV A;  2J06 A;  3QWY A;  4OMN A;  1AWO A;  1KSW A;  1X43 A;  1AWW A;  1I1J A;  1CKA A;  4AG2 C;  4J9H A;  2O88 A;  2EW3 A;  2YUP A;  1NLP C;  2O2O A;  2FRW A;  2DBM A;  2EGA A;  1V1C A;  1WYX A;  1ZUK A;  4LUD A;  1ZLM A;  4EIK A;  4QT7 A;  4DEX A;  2RN8 A;  2DVJ A;  2W10 A;  3QWX X;  2C0I A;  2NUZ A;  2CUD A;  5I11 A;  2YSQ A;  1TUD A;  1GBQ A;  3FJ5 A;  3TVT A;  2MOX A;  2D8J A;  2RF0 A;  1OPL A;  2C0O A;  1AWX A;  1PKS A;  1RUW A;  1KJW A;  1ZSG A;  1UEC A;  3M0P A;  3H41 A;  4ORZ A;  4J9E A;  4F16 A;  3EG0 A;  1BK2 A;  2YUQ A;  3H0H A;  3R6N A;  4A63 B;  1CKB A;  2DBK A;  1B3Q A;  1ABO A;  1M3B A;  1QLY A;  2J6K A;  2DJQ A;  2ED1 A;  2RQT A;  3VS4 A;  1OOT A;  1VYU A;  1YN8 A;  2JM8 A;  1AVZ C;  1TG0 A;  1N5Z A;  3M0T A;  2RQU A;  2LP5 A;  1U3O A;  2CH4 A;  3IQL A;  2VVK A;  2J6F A;  1W70 A;  2VWF A;  2ROL A;  5EC7 A;  3NPF A;  1SHF A;  4LUE A;  3I35 A;  4F14 A;  2EYY A;  1TUC A;  4J9C A;  2MIO A;  2A08 A;  3H0F A;  2JXB A;  1X2K A;  3ZL7 C;  2JS2 A;  1VYV A;  4HVU A;  3VS5 A;  2DL5 A;  1G83 A;  3RBB B;  1JO8 A;  2RNA A;  4JJC A;  5I22 A;  2FEI A;  4WCI A;  2M0Y A;  2L3P A;  2AKK A;  4RTU A;  1ZUY A;  1OPK A;  2JW4 A;  2HDA A;  1GL5 A;  2JM9 A;  1E6H A;  2JMA A;  1W6X A;  1UHF A;  1SEM A;  3U23 A;  2KR3 A;  1B07 A;  1ZUU A;  4D8K A;  1SHG A;  2CT4 A;  1GCQ A;  4RTX A;  1WXU A;  2OJ2 A;  2PNI A;  2D1X A;  2JMC A;  4RTT A;  1K1Z A;  1YWP A;  2CT3 A;  3EG3 A;  3VS2 A;  2KRM A;  1PNJ A;  4OMQ A;  1MV3 A;  4CC4 B;  1OV3 A;  3EGU A;  2KRS A;  2PTK A;  4AFS C;  2YDL A;  1K0S A;  2BTT A;  1NG2 A;  1CSK A;  2FPF A;  2M51 A;  4GLM A;  3PE0 A;  4M4Z A;  1ZBJ A;  3A98 A;  2F2V A;  2LCS A;  2AZV A;  1JU5 C;  4J9D A;  1UG1 A;  3REB B;  3VS6 A;  2HSP A;  2A37 A;  2XMF A;  4HXJ A;  1FYN A;  2GTJ A;  3EHQ A;  4ZNX A;  4F17 A;  1VYT A;  1UJ0 A;  2ECZ A;  2EYX A;  2JS0 A;  2MCN A;  1UE9 A;  2P4R A;  1K9A A;  2YUN A;  4X1V A;  1AZG B;  2RQW A;  3M0R A;  1K76 A;  5IXF A;  2OAW A;  2GQI A;  1KFZ A;  1JQQ A;  1PWT A;  4DEY A;  1GBR A;  2EKH A;  1H8K A;  2DL8 A;  2QDL A;  1NM7 A;  1SPK A;  1X6G A;  2DNU A;  3M0S A;  5ECA A;  2H8H A;  2KRO A;  1QWE A;  1UGV A;  2O31 A;  4J9F A;  4OML A;  2K7A A;  1KIK A;  3CQT A;  1YWO A;  1WI7 A;  2LZ6 B;  2DL3 A;  3THK A;  3VS1 A;  1W1F A;  3NHN A;  2CSQ A;  1I07 A;  2A36 A;  2CH4 W;  2AZS A;  2K79 A;  3ULR B;  5FW9 A;  1RLQ C;  2J05 A;  1ABQ A;  4OMP A;  5L23 A;  1T3S A;  2O9S A;  4Y92 A;  2CRE A;  2VKN A;  1X69 A;  2L0A A;  2LQW A;  2A28 A;  2DF6 A;  2KBT A;  1FMK A;  4Z88 A;  3I5S A;  4LNP A;  2KE9 A;  2EYZ A;  2DRM A;  3TSZ A;  1M3C A;  2AKL A;  2JTE A;  1SSH A;  1X2Q A;  4GBQ A;  2C0T A;  2KYM A;  2KRN A;  4JPB W;  4RTV A;  4ESR A;  2RQR A;  2RMO A;  4AFQ C;  2LJ1 A;  1BBZ A;  2DM1 A;  2LQN A;  2YUO A;  1GFD A;  2KGT A;  4J9I A;  3VRZ A;  2AK5 A;  1BB9 A;  5IHK A;  5IH2 A;  4JZ4 A;  5GJW B;  1U06 A;  2KXC A;  3UA6 A;  2CUB A;  4AFZ C;  2KXD A;  1SRL A;  1AOJ A;  2FPE A;  1UUE A;  1QKX A;  1UHC A;  2L3S A;  2GNC A;  2I0N A;  1M27 C;  4Z89 A;  1Z9Q A;  1UFF A;  2K6D A;  1NEG A;  3RNJ A;  1RLP C;  2F2W A;  1MV0 B;  4J9B A;  2GTO A;  1AEY A;  3NMZ C;  2KYB A;  5IHI A;  4IIO A;  1WLP B;  4RTW A;  4JJB A;  2CDT A;  4J9G A;  4R0K A;  3VS3 A;  1Z9Z A;  2LJ3 A;  1JXO A;  1PKT A;  3H0I A;  1G2B A;  4FSS A;  1T0J A;  1ARK A; 
#chains in the Genus database with same CATH topology
 1K8A U;  1GCQ C;  5GJV B;  1QVG S;  1NYG A;  2LNH B;  2DKG A;  4LDX A;  2XI9 A;  2COY A;  3UF4 A;  2DX1 A;  4B6M A;  3DLM A;  3C95 A;  1UEB A;  2X3W D;  4FYW B;  2EGE A;  4C0D C;  4QQD A;  2OTJ A;  4IUR A;  1UJY A;  1PM3 A;  4ZGE B;  5I2S A;  3QII A;  3PVQ A;  4D8D A;  3AT1 B;  5CAI A;  2J6O A;  2QEX T;  1YNZ A;  3X28 B;  2LCC A;  2M16 A;  2OTL A;  3QZ9 B;  1K0X A;  1WXT A;  3SDZ A;  3GF5 A;  5KE2 A;  3DB3 A;  4FL6 A;  1WIE A;  1W4S A;  4PJO E;  1QCF A;  5GMK e;  2YT6 A;  3E19 A;  4B9W A;  4ELY C;  4CC2 A;  3JCM W;  2EQM A;  1VQ8 T;  1OYX A;  1MMD A;  3PVL A;  1MHN A;  4J5Y A;  3FC3 A;  2DIG A;  2PVO B;  2GBQ A;  2X35 A;  1M9S A;  3CCM A;  1SKU B;  2DLP A;  3EAE A;  1EFN A;  2LQ8 A;  1YIJ Q;  1SSF A;  1S72 T;  2DAQ A;  1OX8 A;  3ME9 A;  5J3B A;  3OY9 A;  4MZM A;  5L8R E;  5KYW B;  4X34 A;  1WXB A;  4QVZ A;  3OW2 P;  3S3O A;  2RHZ A;  1VQ7 Q;  3URG A;  1PSE A;  3OQ5 A;  2BZ8 A;  1K9M C;  3SHW A;  3JB9 G;  2DL4 A;  1M2V A;  4KGX B;  2EPD A;  1VIE A;  2IVW A;  1X6B A;  3UPU A;  2LJ0 A;  4M77 D;  1ZQ1 A;  2K2M A;  2ROT A;  1QVF S;  1IZ6 A;  1U5S A;  2CYZ B;  3RER A;  4M77 A;  2F5T X;  2KI7 A;  2QQ9 A;  1M1K R;  2A3L A;  2DXT A;  3C0C A;  5CCA A;  2HKN A;  2RI2 A;  1F1B B;  2E3I A;  1I5L A;  3SEM A;  2B86 A;  2KVQ G;  4KRT A;  3CC2 A;  5IHN A;  1Q86 R;  5CO7 A;  1I4K 1;  4ZN3 A;  4C92 F;  3UA7 A;  4BDY A;  1NLO C;  3M57 A;  1B34 B;  5GAN 7;  1VQ4 A;  1D1B A;  2BUD A;  3PMT A;  1QQJ A;  2V1R A;  5FWC A;  3M54 A;  3RKY A;  3CPF A;  1K4U S;  1RL2 A;  3E9F A;  3FEO A;  1WDX A;  3NTK A;  2HKQ B;  3PIP A;  4NL2 A;  4MZT A;  5FU7 B;  2YRV A;  2D9T A;  4RKU E;  5GAN g;  3OYN A;  2QEX A;  3L2U A;  1YJN T;  2CZ1 B;  2EGA A;  1VQN Q;  4EMK B;  3FRN A;  2QYZ A;  3EGX B;  4M7D D;  2NUZ A;  5I11 A;  4BE2 A;  4M7D A;  2R57 A;  2RF0 A;  3CC4 Q;  2DXB A;  5D6W A;  3C12 A;  1VQ8 A;  1PKS A;  1KJW A;  2QDY B;  3CCV T;  1UEC A;  3EH1 A;  3D7S B;  4DOV A;  1KC8 U;  2DPP B;  2QAS A;  3H0H A;  4KGV B;  1K73 C;  4FW2 A;  1S72 A;  4JRI A;  2I2L A;  2E6N A;  3TRE A;  3CCR T;  5KYN A;  1D1C A;  1WQ7 A;  2RI5 A;  1ABO A;  1M3B A;  4BDZ A;  4NS5 A;  2DJQ A;  2EYQ A;  2RQT A;  3CXC P;  1PC0 A;  2RO0 A;  2JJ9 A;  1KQS P;  3CMA T;  5GAM f;  1Q81 C;  1N5Z A;  3M0T A;  4LXC A;  1QCN A;  1YJN Q;  4M75 G;  1FMV A;  1BI1 A;  3IQL A;  1W70 A;  3MP1 A;  4QVD A;  4P5N A;  1JRI A;  4F14 A;  6AT1 B;  1TUC A;  5GAN 6;  2MIO A;  1X2K A;  4C92 B;  3GNF B;  1HXD A;  8ATC B;  2YLB A;  3MP8 A;  4WCI A;  3OYC A;  5IAY A;  4HCZ A;  1GL5 A;  4M78 D;  1IGU A;  3TCJ A;  2JM9 A;  2K3X A;  2JTM A;  1E6H A;  1SEM A;  4M78 A;  1QP3 A;  3CCS T;  3RKX A;  3CCL Q;  4DA4 A;  3MHX A;  3CC7 Q;  4J7I A;  1W2B P;  3VJP A;  1SHG A;  2O01 E;  3JCM V;  1Q7Y C;  3MET A;  4OVA A;  2ZPE B;  2OJ2 A;  2D1X A;  3JAM E;  1TU0 B;  3CMA Q;  3HRU A;  1Y71 A;  3QG1 A;  3VS2 A;  1PNJ A;  2F1L A;  4KH1 B;  2KRS A;  4RCC A;  4C5G A;  2QXF A;  3O8V A;  1GXI E;  2RJE A;  3PT9 A;  4XQ3 A;  3OYD A;  2D0Q B;  1WNL A;  4J8O A;  3GPL A;  1CSK A;  2GFU A;  2MWO A;  3OB9 A;  3PE0 A;  4GLM A;  2LCS A;  1D1A A;  1UG1 A;  3JCM h;  3VS6 A;  4J6Y A;  2XMF A;  4LDU A;  1M1K C;  3CCE Q;  3EHQ A;  4Q5W A;  2QQR A;  3JCM J;  2ECZ A;  1U8R A;  2EYX A;  5CVI A;  4MDW A;  4BD3 A;  3JB9 D;  2YUN A;  4X1V A;  1AZG B;  2LCL A;  2K3Y A;  3CCV A;  4FSX A;  1UGR B;  3HL8 A;  3M4Y A;  4PJO F;  1Q86 C;  2MPX C;  1YHQ Q;  1NZ9 A;  2QQA A;  1GBR A;  1H8K A;  3TEE A;  2RB6 A;  1TXQ A;  2H8H A;  2KRO A;  4HCC A;  1ZSZ C;  3CCR A;  1RAC B;  4J9F A;  5KYW A;  1X6O A;  3M4G A;  3THK A;  3JCM P;  3TQ7 P;  2A36 A;  1TH7 A;  2AZS A;  7AT1 B;  2VXF A;  3ULR B;  4OGC A;  5FW9 A;  1RLQ C;  2JOY A;  3CPW S;  5L23 A;  2VKN A;  3L2Z A;  3CEY A;  1FMK A;  5CQX A;  2DXU A;  2RHY A;  1D0Z A;  1M3C A;  1SSH A;  1X2Q A;  3GP8 A;  4GBQ A;  2C0T A;  2KYM A;  3EG9 B;  1VQ5 T;  4IUP A;  1RAF B;  4RTV A;  4ESR A;  2RQR A;  3HP9 A;  1BBZ A;  2EQK A;  2LQN A;  1H64 1;  3X25 B;  3JB9 H;  5IH2 A;  4BAC A;  2KXC A;  4M7A D;  4C92 E;  3I55 T;  3CCS A;  2COZ A;  4C8Q F;  1SRL A;  1UUE A;  2DD5 A;  3KBG A;  4PFZ A;  2WSE E;  1FWZ A;  2QA4 T;  2I0N A;  4Z89 A;  3A8O B;  4JS4 A;  3R6O A;  1RLP C;  4HT8 A;  1B34 A;  2QGF B;  4M77 G;  5A0G A;  2O4X B;  2E5Q A;  4IIO A;  2EJG A;  2DTI A;  5GAN j;  4R0K A;  2LJ3 A;  1JXO A;  1PKT A;  1K9M R;  1I8F A;  3PGG A;  4AT1 B;  3CCQ Q;  4PLI A;  3KFV A;  2L8D A;  1E6G A;  3MEV A;  2F2X A;  1H92 A;  3UWN A;  2KDS A;  2OTJ T;  1NYF A;  1VQL Q;  1UTI A;  2E5K A;  3DLL A;  1D09 B;  4PJO B;  4A4E A;  3LH5 A;  3DB4 A;  5FRN A;  2HQH A;  1VOM A;  2PZ1 A;  3PNW C;  2G6F X;  1E7O A;  2CZ0 B;  2XIC A;  4EMK A;  4JLG A;  4OB1 B;  1M30 A;  3EGX A;  1HK9 A;  1WX6 A;  3G6E T;  2V26 A;  3HTR A;  1YCS B;  4M75 D;  5GMK j;  2FYK A;  5GAM h;  1TSF A;  1IGQ A;  2JUF A;  2EYW A;  2F5K A;  2HBP A;  3L1A A;  1T0H A;  3VV0 A;  4II1 A;  5FRM A;  5LJ3 g;  3CCM T;  1HD3 A;  4RUG A;  3I5R A;  2LMJ A;  1WHJ A;  4JZ3 A;  5CKD A;  1Q82 U;  2AIR B;  1JJ2 P;  2K5I A;  2CP3 A;  4CC7 A;  1T3L A;  4AMC A;  1VQ9 T;  2OTJ Q;  2HCK A;  2CS7 A;  4ZN1 A;  2GQV A;  1IO6 A;  4M7D G;  4XU0 A;  2DYB A;  1BI3 A;  4M75 C;  1M90 C;  4BY6 C;  1MNE A;  2OTL Q;  5IT9 E;  1G3Y A;  2L89 A;  2DMO A;  4C8Q B;  4BUG A;  4E7I A;  4RTY A;  4LE9 A;  3L2V A;  1N6A A;  5J26 A;  4C92 A;  1VQ5 A;  1BIA A;  1QWF A;  1KD1 R;  2KQW A;  3CD6 T;  4QW2 A;  4RG2 A;  3CBM A;  2E65 A;  2FVU A;  2QTV A;  2W0Z A;  2DL7 A;  3OYF A;  3V8J A;  3I55 A;  2PVG B;  3P8B B;  3CC2 T;  2ED0 A;  3EH2 A;  2LX7 A;  2QA4 A;  3A1P A;  1YIT T;  3H6Z A;  2PVD B;  5M9O A;  1O9S A;  5LJ5 j;  1J3T A;  1LCK A;  2RPN A;  3EFO B;  1HJD A;  5AYF A;  2FG0 A;  1K73 R;  2LVM A;  3V8K A;  4YTL A;  3EGD A;  2KSS A;  2HBW A;  1B7T A;  1Q81 R;  4E6R A;  3OS2 A;  4M78 G;  5DY9 A;  3LGL A;  2JVV A;  2RQV A;  2J06 A;  1XNI A;  9ATC B;  1X43 A;  3OYL A;  2WSF E;  4KUI A;  4J9H A;  3JB9 J;  4RMO A;  3G4S T;  2RHX A;  1NLP C;  2O2O A;  1N8R C;  2DBM A;  2DEU A;  1V1C A;  3CC2 Q;  5A2Q E;  1WYX A;  1M1G A;  3V7C A;  4EIK A;  4KH0 B;  2LT4 A;  5DLO A;  3G6E A;  3HPW A;  5CIU A;  1UGP B;  2BE7 D;  3VYG A;  3MEW A;  2QK0 A;  1WHG A;  1PD1 A;  1LPL A;  2CUD A;  4XTU A;  4F04 B;  1KK7 A;  1GBQ A;  3QYH B;  3TVT A;  1VQ4 Q;  2QTX A;  2MOX A;  2MAM A;  1OPL A;  5CQY A;  1Q7Y R;  2X9H A;  1D0X A;  3JCM f;  1D3B B;  1MMG A;  4L6V 5;  2P0Q A;  5FU6 C;  3ZFJ A;  3Q1J A;  1XTD A;  3EG0 A;  5DM7 R;  1RAE B;  2YUQ A;  3HSB A;  3SWN B;  3CCU T;  2RA2 A;  1LOJ A;  4PJM A;  1CKB A;  4R55 A;  1VQ9 A;  3QZ5 B;  2J6K A;  4ANJ A;  2VUB A;  1FX7 A;  1VYU A;  1Y07 A;  3C4S A;  2LQK A;  5D6X A;  2DXC A;  2QEX Q;  1AVZ C;  5GAO m;  1TG0 A;  3CBO A;  1I81 A;  4MML A;  2LP5 A;  2CP5 A;  3UDC A;  2ROL A;  3GOX A;  2P0K A;  3EG9 A;  4J9C A;  2Y90 A;  2M0O A;  2E70 A;  1VQ8 Q;  3CD6 A;  2JXB A;  2JS2 A;  1VYV A;  4C8Q E;  2Z0W A;  3I56 T;  2LT1 A;  2RNA A;  5I22 A;  1OU8 A;  2ZPF B;  2PUK B;  2E10 A;  3FLG A;  2HDA A;  1S72 Q;  2JMA A;  1W6X A;  1RAG B;  1QCO A;  4M77 C;  1YIT A;  1PCX A;  4F7U E;  2CT4 A;  4JRP A;  1V76 A;  2O4X A;  1G3S A;  3E1S A;  1YWP A;  2CT3 A;  1K8A C;  4OMQ A;  3G1J A;  2QAZ A;  4KGZ B;  1QVG P;  4LDY A;  3G71 A;  2MWP A;  1BIB A;  5I2M A;  2PTK A;  4AFS C;  4M7A G;  2YDL A;  1K0S A;  2DZ9 A;  4PJO D;  2ZPB B;  2M51 A;  4M4Z A;  1ZBJ A;  4OMF B;  4PJO A;  2FZK B;  4R56 A;  2E3H A;  5LJ3 j;  3FDR A;  4J9D A;  3G4S A;  1C1A A;  2HSP A;  2YXY A;  4HXJ A;  1KD1 C;  1V29 B;  3OS5 A;  4ZNX A;  4BE0 A;  4HCB A;  2MCN A;  2QGG A;  1K9A A;  4KBM B;  4FYX B;  3BDU A;  3QO3 A;  2RQW A;  3M0R A;  1K76 A;  5IXF A;  1M1K U;  3BE3 A;  3L42 A;  4N4H A;  1MGQ A;  2R58 A;  1VQO T;  2EKH A;  3VYH B;  2DL8 A;  3CPW A;  2DNU A;  3M0S A;  4XTZ A;  3CCU A;  4M7D C;  2LNV A;  4IUQ A;  1VQ6 T;  4NL3 A;  1QW1 A;  2LZ6 B;  1WI7 A;  3VS1 A;  3S6W A;  2QQB A;  4N0A A;  2CSQ A;  1OU9 A;  1TUG B;  1I07 A;  5GAN 8;  4HKE A;  1TS9 A;  3H8Z A;  5KE3 A;  2E64 A;  5IN1 A;  1TTH B;  4C8Q A;  2L0A A;  4C0Z A;  1VQP T;  2A28 A;  3BY7 A;  3M56 A;  4IUT A;  4BE1 A;  2EYZ A;  2DRM A;  3TSZ A;  1QVF P;  3AHU A;  2WAC A;  5CKE A;  3CCV Q;  2KRN A;  4JPB W;  2WSC E;  3I56 A;  2P0P A;  3MPU B;  4A4G A;  3M59 A;  2P4T A;  4J9I A;  3QXE B;  2AK5 A;  1BB9 A;  4L59 A;  4QQ6 A;  4JZ4 A;  1G3T A;  3CCR Q;  5GAN 4;  4J83 A;  2KMT A;  1HYO A;  4AFZ C;  4BI4 A;  2XKO C;  3LLR A;  1QKX A;  1LNX A;  1QVP A;  4PFP A;  1RI0 A;  1SF9 A;  3EFO A;  2L3R A;  2DET A;  2HNI A;  1UFF A;  3RNJ A;  1WHK A;  2GCX A;  4C92 G;  2KYB A;  1BYM A;  3EGD B;  4JRK A;  4JS5 A;  4C0F A;  2OX7 A;  3H9N A;  2M02 A;  1LVK A;  2LC4 A;  4J9G A;  4M78 C;  4PNO A;  3CME T;  4C0D B;  1M90 R;  2X4X A;  2HMA A;  1T0J A;  1ARK A;  2K57 A;  3HKS A;  1A0N B;  3UT1 A;  3QSU A;  2HEQ A;  1PRM C;  4OMO A;  3JCM d;  4AFU C;  2BKD N;  4A4K A;  3CCS Q;  5GAN 3;  3LH0 A;  1ZX6 A;  1YP5 A;  2FRY A;  2LDM A;  4A54 A;  2X4W A;  1LJO A;  2EAY A;  3CCJ T;  1PHT A;  5HK3 A;  3UAT A;  5FLX E;  2BZY A;  3BW1 A;  2KEA A;  2LRQ A;  3M0Q A;  4BI3 A;  1OI1 A;  1S1N A;  4IIM A;  5LJ5 f;  1KC8 C;  3NGP A;  1D3B A;  1BKB A;  1QMC A;  2RD1 A;  1SG5 A;  4CC3 A;  2YWW A;  5HY6 A;  5AT1 B;  1VQO A;  3GIB A;  3SWN A;  3VS0 A;  1C6V X;  5GMK m;  2EBP A;  1BCM A;  3OW2 A;  2SRC A;  4HVV A;  1QP2 A;  1ZA1 B;  1VQ6 A;  2JZ2 A;  2YLC A;  4Z02 A;  4Y91 A;  4QQG A;  1M3A A;  5HCK A;  1Y96 B;  1GCP A;  4ZTJ A;  2NUT A;  2COW A;  2DZC A;  4J6X A;  2DE0 X;  2FL7 A;  1JXM A;  1PD0 A;  3EHR A;  3M5A A;  2NWM A;  3VRY A;  1VQP A;  3M0U A;  1X27 A;  2FHD A;  1YI2 T;  1MMA A;  1WZO A;  1SRM A;  1N8R R;  2J7I A;  2X3X D;  4LD6 A;  3MP6 A;  1NJI R;  3EG2 A;  1VUB A;  4LDV A;  3EFS A;  4ZGD B;  1AT1 B;  2FO0 A;  2JNG A;  2V1Q A;  2DK3 A;  1VA7 A;  1P92 A;  5C6S A;  4OMM A;  2B8A A;  5FWB A;  3M53 A;  3OA6 A;  2ENM A;  1H3H A;  5HK0 A;  3GBQ A;  3OYG A;  2DRK A;  2RJF A;  1N9R A;  2H3E B;  1GFC A;  1M8M A;  4XU2 A;  1VQM T;  3VKI A;  2CP2 A;  2DIL A;  2RK1 A;  2RH2 A;  4F7U F;  1H3Z A;  5CKF A;  2MI6 A;  2KT1 A;  3JB9 I;  1IXD A;  1UGQ B;  5EG2 A;  4EMH A;  2X51 A;  2L2P A;  1NEB A;  2OI3 A;  3CME A;  4M7A C;  4AG1 C;  1FMW A;  3QYG B;  4HVW A;  2D6F A;  1GRI A;  3JCM e;  4WF2 A;  1VQ5 Q;  2CKK A;  3ZBD A;  5IXB A;  2VC8 A;  3KXT A;  2DEQ A;  3TSW A;  2BZX A;  1MND A;  3QWY A;  1AWO A;  3RKW A;  1YJW T;  5KYY B;  2DD4 A;  3RIR A;  3QJY A;  5KCO A;  1AWW A;  3MO8 A;  1I1J A;  1M1F A;  2QQS A;  5GAN h;  3QPH A;  3I55 Q;  4AG2 C;  3RMS A;  2O88 A;  1C0M A;  2ZGW A;  2HD0 A;  3CCJ A;  2QA4 Q;  3L2R A;  2XK0 A;  4E2F B;  3QDF A;  2EFI A;  2RN8 A;  2DVJ A;  5GAM d;  2W10 A;  3QWX X;  2C0I A;  4MMK A;  3OYH A;  1ZA2 B;  4O5V A;  5FU7 C;  2YSQ A;  4FCY A;  1TUD A;  4XTV A;  2HL5 C;  4DBH A;  1WJS A;  1BCO A;  2KY9 A;  1RUW A;  4PJO G;  4EMK C;  3M0P A;  2K2V A;  4FT4 A;  2MMP A;  2HQX A;  2KK4 A;  3BFM A;  1OQK A;  1K8A R;  1OZ2 A;  3CXC A;  1UGS B;  5GMK h;  3EFR A;  3LW5 E;  2DBK A;  1QLY A;  1KQS A;  5KYX B;  4XU3 A;  2XU8 A;  3VS4 A;  3OW2 S;  1N27 A;  2RHI A;  3A8G B;  4DOW A;  5LJ3 f;  2ZZD A;  3HFO A;  2RQU A;  3JB9 F;  1RAH B;  3G6E Q;  1U3O A;  4C92 D;  1R0C B;  2CH4 A;  1VQK T;  1XQH A;  1YI2 A;  1XJW B;  1K9M U;  5EC7 A;  4FW1 A;  3NPF A;  3LWH A;  1SHF A;  3I35 A;  3QDR B;  1EZZ B;  2MF2 A;  4ATO A;  4OGE A;  3PTA A;  2XDD A;  2A08 A;  3X20 B;  1VIF A;  3ZL7 C;  2M1H A;  1R0B G;  3CCM Q;  3VS5 A;  1G83 A;  1DJ7 B;  3RBB B;  4F7U B;  2JTF A;  2YHT A;  3VU3 C;  3RR6 A;  1OPK A;  2VYT A;  1YBY A;  3ER0 A;  3LYI A;  1VQ9 Q;  1UHF A;  2DO3 A;  4C8Q G;  3U23 A;  3V8L A;  1B07 A;  4C92 C;  2XID A;  2QI2 A;  4FYY B;  4M77 E;  4D8K A;  1VQM A;  1GCQ A;  1KG1 A;  4KT0 E;  5C0M A;  1WXU A;  1ZBX A;  1KQ2 A;  2DJZ A;  1N9S A;  2JMC A;  4OB0 B;  4RTT A;  3OYB A;  2RI3 A;  4E7L A;  2KRM A;  3G71 T;  2G3R A;  1OV3 A;  5GMK i;  4N4I A;  2E12 A;  4PL6 A;  5LJ5 h;  5LJ5 d;  4E7J A;  3CD6 Q;  1IRE B;  2BTT A;  1KQ1 A;  2V8J A;  1NG2 A;  1YJW A;  3X24 B;  1YIJ T;  4M7A F;  2DTH A;  4CRI A;  3A98 A;  5HKC A;  2F2V A;  3ZEH A;  2AZV A;  1JU5 C;  3REB B;  5GAM e;  1VQ7 T;  2A37 A;  1FYN A;  1Y7X A;  1YIT Q;  4HT9 A;  4C0G A;  1NJI C;  3JCM g;  4F17 A;  3A8H B;  3WVE B;  2EJ9 A;  5J39 A;  4IUU A;  1UE9 A;  2P4R A;  3SFM A;  1G3W A;  1WJR A;  4ZGJ B;  3OYE A;  1IB8 A;  1KD1 U;  2CP7 A;  1ZSZ B;  3MEA A;  3SB2 A;  2OAW A;  2GQI A;  1Q82 C;  3BDL A;  3G71 Q;  1R8O B;  5A0D A;  1I5O B;  2Y4Y A;  2E1H A;  4DEY A;  2LTO A;  5ECA A;  1X6G A;  4XTX A;  1YJ9 A;  1QWE A;  1UGV A;  2O31 A;  4OML A;  1Y96 A;  4M7D E;  1YWO A;  2NUT B;  1W1F A;  3G4S Q;  4EDU A;  3S3N A;  2R5A A;  1K73 U;  4PJL A;  3LX7 A;  2K79 A;  1OUL A;  1X75 C;  3JSC A;  2FB7 A;  3CXC S;  1MMN A;  2J05 A;  3J81 E;  3HRT A;  4OMP A;  1T3S A;  2O9S A;  2CRE A;  1KQS S;  4B9X A;  1VQK A;  2F69 A;  2LQW A;  4M75 F;  2KBT A;  4LNP A;  2KE9 A;  1Q81 U;  2FZG B;  2AKL A;  2JTE A;  2QG9 B;  4JLI A;  3A8M B;  5CKH A;  5KYU B;  1WHH A;  3M55 A;  1OZ3 A;  1NBE B;  2LJ1 A;  2YUO A;  2KGT A;  3VRZ A;  5D7U A;  2NUP B;  2RHU A;  2DFU A;  4C5I A;  3CCU Q;  1U06 A;  3G7Z A;  1KC8 R;  1RAD B;  3JCM X;  2CUB A;  2RM4 A;  1M4Z A;  2FPE A;  4GY5 A;  1UHC A;  1WJQ A;  3LGF A;  3FB9 A;  4E7Z A;  2GNC A;  2NYS A;  2EQU A;  2BE9 B;  2F2W A;  1W2B S;  1RAB B;  4J9B A;  1VQN T;  2GTO A;  4M7A B;  1AEY A;  5IHI A;  4XU1 A;  2H3J A;  3INZ A;  2L5Q A;  5LJ5 e;  1Q7Y U;  4X9C A;  2EIF A;  3CC4 T;  1Z9Z A;  1FXX A;  4M78 E;  2HAX A;  1G2B A;  4FSS A;  4XTY A;  4E7K A;  3ASK A;  3JCM c;  2PQW A;  1BU1 A;  3I56 Q;  4PFO A;  3REA B;  2RK2 A;  3OMG A;  5KYY A;  4QVC A;  1YIJ A;  1WA7 A;  2EVR A;  1MUZ A;  2KT8 A;  5GAO p;  4E7S A;  3JV3 A;  4FYV B;  1VQ7 A;  1AD5 A;  1WGS A;  1QKW A;  3RMQ A;  1UDL A;  2K9G A;  2OAU A;  4EMG A;  2EGC A;  1IRX A;  2K3B A;  2ZAE A;  4E7H A;  4TVR A;  3OYK A;  4KUL A;  1XOV A;  2PUO B;  2ESW A;  3PIO A;  4PJO C;  1AZE A;  4Z8A A;  4OB2 B;  2V8K A;  5LJ3 d;  5LJ3 h;  2D0N A;  5GAN f;  1D0Y A;  1OEB A;  2KNB B;  4RTZ A;  2CSI A;  1PRL C;  5GAN 2;  3A5Z B;  4O6J A;  5GAM g;  3OYJ A;  1BI0 A;  1M2O A;  3OYY A;  1JJ2 A;  1RI9 A;  5KH6 A;  4M75 B;  1RAA B;  2IIM A;  1HSQ A;  4BY6 B;  3DKM A;  4PJN A;  3S3M A;  4JJD A;  1TWB A;  1WFW A;  1IHV A;  1Q86 U;  3M9Q A;  2ABL A;  5KYX A;  1JEG A;  2O9V A;  5KCH A;  2XHC A;  1EX4 A;  4DBR A;  4C8Q D;  3CCL T;  3F70 A;  3CC7 T;  3OYM A;  2SEM A;  3P8D A;  3HRS A;  4LN2 A;  4OB3 B;  4QKU A;  5GAO n;  2D8H A;  2KAF A;  4DQ2 A;  4HCK A;  4K11 A;  3J80 E;  2XD0 A;  4N0A C;  2EQI A;  4C5H A;  5GAO l;  4F7U A;  2FPD A;  1Y57 A;  1UB4 A;  2JT4 A;  3NTI A;  3SD4 A;  1VQO Q;  3I9Q A;  4C8Q C;  4MDX A;  4DBF A;  4FM4 B;  4BI8 B;  5CKB A;  4FT2 A;  1Q95 G;  2CZ7 B;  1VQ6 Q;  4A4H A;  1X01 A;  3KUF A;  3VS7 A;  3CCE T;  5GAN 5;  5A0L A;  2L3Q A;  1WPY A;  1ZHI A;  3J7A F;  1I0C A;  4PJJ A;  1U1T A;  2DA9 A;  3MEU A;  1VQN A;  1PG5 B;  3O5Z A;  2M9U A;  1Y0M A;  4A4F A;  4M77 F;  2V8I A;  3RDV A;  1VQP Q;  4RCB A;  1O75 A;  4XAX B;  2XG8 D;  3OYI A;  3CC4 A;  5LL6 S;  1NPR A;  2ZPH B;  4JJN K;  1G5V A;  4D6W A;  4M7A E;  4BB7 A;  4A53 A;  1AWJ A;  2K4Y A;  4GLK A;  5GAO q;  1YHQ T;  2DER A;  2ZPG B;  3EG1 A;  2GGR A;  4C5E A;  3JRZ A;  3OS1 A;  2ATC B;  4OMN A;  4XTW A;  1KSW A;  4MZP A;  2XDP A;  1NE8 A;  1CKA A;  2LX9 A;  5LJ5 g;  5GAO r;  2EW3 A;  2YUP A;  4IUV A;  2AT1 B;  2FRW A;  3MJX A;  4ME7 A;  2CP0 A;  1JB0 E;  1ZUK A;  1ZLM A;  3FJP A;  4LUD A;  2BIV A;  4QT7 A;  5LJ3 e;  1YJN A;  4DEX A;  2P84 A;  1WQW A;  2VGN A;  5FU6 B;  2HZY A;  2MK5 A;  4FU6 A;  1ZSZ A;  3FJ5 A;  2D8J A;  3MKD A;  3CME Q;  2C0O A;  1AWX A;  4HA8 A;  1ZSG A;  3E9G A;  3H41 A;  4ORZ A;  1KHC A;  4J9E A;  3OSS C;  4F16 A;  2PU9 B;  1BK2 A;  1OX9 A;  3L2W A;  3PFS A;  3V7S A;  2GF7 A;  3GNG A;  3R6N A;  4A63 B;  2MYS A;  1B3Q A;  1JJ2 S;  2VV5 A;  4Y28 E;  4M75 E;  3CCL A;  2ED1 A;  2IG0 A;  3CC7 A;  4M7D F;  1OOT A;  1YN8 A;  3CCJ Q;  4EPC A;  2JM8 A;  1EIF A;  3SWN C;  2EJF A;  3WVD B;  4JRQ A;  4NOY A;  3VUZ A;  2A0F B;  3L2Q A;  3CMA A;  1M90 U;  2VVK A;  2J6F A;  1NPP A;  1M2V B;  2VWF A;  2X4Y A;  5D6Y A;  4LUE A;  3OS0 A;  3QKJ A;  2EYY A;  5KYU A;  3LWI A;  3X26 B;  3H0F A;  2X4J A;  3CCQ T;  1JBM A;  4HVU A;  4M77 B;  2DL5 A;  2NUP A;  1JO8 A;  4JJC A;  1RAI B;  2FEI A;  4CI0 C;  2M0Y A;  2L3P A;  4UC4 A;  1M8V A;  2AKK A;  2EQJ A;  4RTU A;  1ZUY A;  2CGH A;  2JW4 A;  1VQL T;  3A8L B;  3OBY A;  1YFN A;  2FZC B;  1Q82 R;  2KR3 A;  1G8X A;  3RUX A;  2VXE A;  1ZUU A;  2K5F A;  3CCE A;  2DYI A;  2AHJ B;  3C94 A;  3RES A;  2ZPI B;  3WXM B;  4M7A A;  1BI2 A;  4V2S A;  4RTX A;  4PKC C;  3TU4 K;  4J6W A;  1KHI A;  2PNI A;  5DLQ E;  1QVG A;  2XDB A;  1K1Z A;  1YI2 Q;  3EG3 A;  3OMC A;  4VUB A;  4KUD K;  1MV3 A;  4CC4 B;  3EGU A;  1YHQ A;  2IPO B;  3QJ6 A;  4M78 F;  1WHM A;  2K5L A;  2NLU A;  3CBP A;  5GAN d;  1IHW A;  3T9N A;  4OP0 A;  2HQE A;  2VAS A;  2FPF A;  5GAM j;  2DVE A;  4PLL A;  5CR2 A;  2CZ6 B;  1M5Q 1;  2GTJ A;  4E47 A;  2EWN A;  1VQM Q;  1VYT A;  1UJ0 A;  2RJC A;  2OTL T;  2JS0 A;  1R77 A;  1N8R U;  4XK8 E;  3OSV A;  1AHJ B;  2VGM A;  4M7D B;  3N5B B;  5I21 A;  2ZCF B;  1NJI U;  2R5M A;  1KFZ A;  1JQQ A;  4M75 A;  4LD9 K;  1PWT A;  4WTO B;  4PK4 A;  4X9D A;  1YJ9 T;  2YRD A;  3FIF A;  3QUI A;  3OBW A;  2YRC A;  2QDL A;  1NM7 A;  1SPK A;  2HSE B;  4RG8 A;  2DTO A;  1YJW Q;  2EKO A;  2K7A A;  1YCY A;  4DBQ A;  1KIK A;  3CQT A;  3CPW P;  2DL3 A;  1WHL A;  3NHN A;  3M58 A;  2E6Z A;  2CH4 W;  4IKF A;  2C06 A;  3VUB A;  2E41 A;  3PMI A;  1ABQ A;  5GMK l;  1QVF A;  4Y92 A;  1X69 A;  2CP6 A;  3E2U A;  3GLX A;  2DF6 A;  4Z88 A;  3I5S A;  2Y4X A;  4LDW A;  2HL3 A;  5CK9 A;  4J7F A;  3JCM b;  3QBY A;  3CCQ A;  4FIB A;  2RMO A;  2DIQ A;  2A7Y A;  4AFQ C;  2GFA A;  2DM1 A;  1GFD A;  1W2B A;  2VB6 A;  5IHK A;  1VQL A;  1U1S A;  5GJW B;  3JCM Q;  1YJ9 Q;  2JN0 A;  3UA6 A;  4ELZ C;  8AT1 B;  2KXD A;  3NFC A;  1AOJ A;  3MCA B;  4M78 B;  4JUV A;  2E4H A;  4ZTF A;  2L3S A;  1M27 C;  1TOV A;  1Z9Q A;  2K6D A;  1PSF A;  1NEG A;  3P8H A;  4N4G A;  1MV0 B;  5FRO A;  3NMZ C;  3NTH A;  4JDS A;  4F7U G;  1ACM B;  4L5G A;  1VQK Q;  1WLP B;  3HFN A;  3HHT B;  4RTW A;  4JJB A;  2CDT A;  1VQ4 T;  3VS3 A;  5GAN e;  3QHS A;  4OF1 A;  3H0I A;  3OYA A;  2RJD A;  3V7R A; 
#chains in the Genus database with same CATH homology
 3KFV A;  1GCQ C;  5GJV B;  1E6G A;  1NYG A;  2LNH B;  1BU1 A;  1A0N B;  3REA B;  2F2X A;  2HEQ A;  1PRM C;  1H92 A;  3UF4 A;  2DX1 A;  4OMO A;  1NYF A;  1WA7 A;  2EVR A;  1MUZ A;  2KT8 A;  4AFU C;  2X3W D;  1UTI A;  2E5K A;  2EGE A;  3JV3 A;  1UJY A;  1AD5 A;  1ZX6 A;  1YP5 A;  3LH5 A;  3PVQ A;  4D8D A;  1QKW A;  2FRY A;  2J6O A;  1UDL A;  2PZ1 A;  2G6F X;  1E7O A;  2K9G A;  1YNZ A;  2EGC A;  2K3B A;  1PHT A;  1M30 A;  3UAT A;  1K0X A;  2BZY A;  1WXT A;  1WX6 A;  1XOV A;  2ESW A;  2KEA A;  3M0Q A;  1YCS B;  1AZE A;  1S1N A;  4IIM A;  4Z8A A;  1WIE A;  1QCF A;  2D0N A;  2EYW A;  2YT6 A;  3NGP A;  1T0H A;  1OEB A;  2KNB B;  4RTZ A;  2CSI A;  4CC2 A;  1PRL C;  4CC3 A;  1HD3 A;  4RUG A;  1RI9 A;  3I5R A;  3PVL A;  2IIM A;  2GBQ A;  1HSQ A;  3VS0 A;  2LMJ A;  2EBP A;  4JJD A;  2SRC A;  1WFW A;  4HVV A;  4JZ3 A;  2DLP A;  1EFN A;  2ABL A;  4CC7 A;  1T3L A;  2O9V A;  1JEG A;  1M3A A;  5HCK A;  2HCK A;  1GCP A;  1WXB A;  1IO6 A;  2DYB A;  2DE0 X;  2BZ8 A;  1JXM A;  2SEM A;  3EHR A;  3SHW A;  2NWM A;  2DL4 A;  3VRY A;  3M0U A;  4LN2 A;  1X27 A;  2DMO A;  2D8H A;  4HCK A;  4RTY A;  2EPD A;  1SRM A;  4K11 A;  1X6B A;  2LJ0 A;  4LE9 A;  2ROT A;  2EQI A;  2K2M A;  2J7I A;  2X3X D;  1U5S A;  1QWF A;  2FPD A;  1Y57 A;  2JT4 A;  3EG2 A;  3I9Q A;  2W0Z A;  3C0C A;  2FO0 A;  2V1Q A;  2DL7 A;  1VA7 A;  4OMM A;  5FWB A;  3SEM A;  2ENM A;  2ED0 A;  3VS7 A;  1H3H A;  3GBQ A;  2DRK A;  2B86 A;  2LX7 A;  4KRT A;  2L3Q A;  5IHN A;  1I0C A;  1GFC A;  1J3T A;  1LCK A;  2DA9 A;  1M8M A;  2RPN A;  1HJD A;  3O5Z A;  2FG0 A;  3UA7 A;  1Y0M A;  1NLO C;  2DIL A;  2KT1 A;  2HBW A;  2L2P A;  1NEB A;  2OI3 A;  2V1R A;  4AG1 C;  4HVW A;  5FWC A;  1GRI A;  1AWJ A;  1K4U S;  4E6R A;  1WDX A;  5IXB A;  3EG1 A;  2GGR A;  3TSW A;  2BZX A;  2RQV A;  2J06 A;  3QWY A;  4OMN A;  1AWO A;  1KSW A;  1X43 A;  1AWW A;  1I1J A;  1CKA A;  4AG2 C;  4J9H A;  2O88 A;  2EW3 A;  2YUP A;  1NLP C;  2O2O A;  2FRW A;  2DBM A;  2EGA A;  1V1C A;  1WYX A;  1ZUK A;  4LUD A;  1ZLM A;  4EIK A;  4QT7 A;  4DEX A;  2RN8 A;  2DVJ A;  2W10 A;  3QWX X;  2C0I A;  2NUZ A;  2CUD A;  5I11 A;  2YSQ A;  1TUD A;  1GBQ A;  3FJ5 A;  3TVT A;  2MOX A;  2D8J A;  2RF0 A;  1OPL A;  2C0O A;  1AWX A;  1PKS A;  1RUW A;  1KJW A;  1ZSG A;  1UEC A;  3M0P A;  3H41 A;  4ORZ A;  4J9E A;  4F16 A;  3EG0 A;  1BK2 A;  2YUQ A;  3H0H A;  3R6N A;  4A63 B;  1CKB A;  2DBK A;  1B3Q A;  1ABO A;  1M3B A;  1QLY A;  2J6K A;  2DJQ A;  2ED1 A;  2RQT A;  3VS4 A;  1OOT A;  1VYU A;  1YN8 A;  2JM8 A;  1AVZ C;  1TG0 A;  1N5Z A;  3M0T A;  2RQU A;  2LP5 A;  1U3O A;  2CH4 A;  3IQL A;  2VVK A;  2J6F A;  1W70 A;  2VWF A;  2ROL A;  5EC7 A;  3NPF A;  1SHF A;  4LUE A;  3I35 A;  4F14 A;  2EYY A;  1TUC A;  4J9C A;  2MIO A;  2A08 A;  3H0F A;  2JXB A;  1X2K A;  3ZL7 C;  2JS2 A;  1VYV A;  4HVU A;  3VS5 A;  2DL5 A;  1G83 A;  3RBB B;  1JO8 A;  2RNA A;  4JJC A;  5I22 A;  2FEI A;  4WCI A;  2M0Y A;  2L3P A;  2AKK A;  4RTU A;  1ZUY A;  1OPK A;  2JW4 A;  2HDA A;  1GL5 A;  2JM9 A;  1E6H A;  2JMA A;  1W6X A;  1UHF A;  1SEM A;  3U23 A;  2KR3 A;  1B07 A;  1ZUU A;  4D8K A;  1SHG A;  2CT4 A;  1GCQ A;  4RTX A;  1WXU A;  2OJ2 A;  2PNI A;  2D1X A;  2JMC A;  4RTT A;  1K1Z A;  1YWP A;  2CT3 A;  3EG3 A;  3VS2 A;  2KRM A;  1PNJ A;  4OMQ A;  1MV3 A;  4CC4 B;  1OV3 A;  3EGU A;  2KRS A;  2PTK A;  4AFS C;  2YDL A;  1K0S A;  2BTT A;  1NG2 A;  1CSK A;  2FPF A;  2M51 A;  4GLM A;  3PE0 A;  4M4Z A;  1ZBJ A;  3A98 A;  2F2V A;  2LCS A;  2AZV A;  1JU5 C;  4J9D A;  1UG1 A;  3REB B;  3VS6 A;  2HSP A;  2A37 A;  2XMF A;  4HXJ A;  1FYN A;  2GTJ A;  3EHQ A;  4ZNX A;  4F17 A;  1VYT A;  1UJ0 A;  2ECZ A;  2EYX A;  2JS0 A;  2MCN A;  1UE9 A;  2P4R A;  1K9A A;  2YUN A;  4X1V A;  1AZG B;  2RQW A;  3M0R A;  1K76 A;  5IXF A;  2OAW A;  2GQI A;  1KFZ A;  1JQQ A;  1PWT A;  4DEY A;  1GBR A;  2EKH A;  1H8K A;  2DL8 A;  2QDL A;  1NM7 A;  1SPK A;  1X6G A;  2DNU A;  3M0S A;  5ECA A;  2H8H A;  2KRO A;  1QWE A;  1UGV A;  2O31 A;  4J9F A;  4OML A;  2K7A A;  1KIK A;  3CQT A;  1YWO A;  1WI7 A;  2LZ6 B;  2DL3 A;  3THK A;  3VS1 A;  1W1F A;  3NHN A;  2CSQ A;  1I07 A;  2A36 A;  2CH4 W;  2AZS A;  2K79 A;  3ULR B;  5FW9 A;  1RLQ C;  2J05 A;  1ABQ A;  4OMP A;  5L23 A;  1T3S A;  2O9S A;  4Y92 A;  2CRE A;  2VKN A;  1X69 A;  2L0A A;  2LQW A;  2A28 A;  2DF6 A;  2KBT A;  1FMK A;  4Z88 A;  3I5S A;  4LNP A;  2KE9 A;  2EYZ A;  2DRM A;  3TSZ A;  1M3C A;  2AKL A;  2JTE A;  1SSH A;  1X2Q A;  4GBQ A;  2C0T A;  2KYM A;  2KRN A;  4JPB W;  4RTV A;  4ESR A;  2RQR A;  2RMO A;  4AFQ C;  2LJ1 A;  1BBZ A;  2DM1 A;  2LQN A;  2YUO A;  1GFD A;  2KGT A;  4J9I A;  3VRZ A;  2AK5 A;  1BB9 A;  5IHK A;  5IH2 A;  4JZ4 A;  5GJW B;  1U06 A;  2KXC A;  3UA6 A;  2CUB A;  4AFZ C;  2KXD A;  1SRL A;  1AOJ A;  2FPE A;  1UUE A;  1QKX A;  1UHC A;  2L3S A;  2GNC A;  2I0N A;  1M27 C;  4Z89 A;  1Z9Q A;  1UFF A;  2K6D A;  1NEG A;  3RNJ A;  1RLP C;  2F2W A;  1MV0 B;  4J9B A;  2GTO A;  1AEY A;  3NMZ C;  2KYB A;  5IHI A;  4IIO A;  1WLP B;  4RTW A;  4JJB A;  2CDT A;  4J9G A;  4R0K A;  3VS3 A;  1Z9Z A;  2LJ3 A;  1JXO A;  1PKT A;  3H0I A;  1G2B A;  4FSS A;  1T0J A;  1ARK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...