1YN8A

Sh3 domain of yeast nbp2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
GQRAVALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords NAP1-binding protein 2
publication title Structural analysis of the yeast SH3 domain proteome
rcsb
source organism Saccharomyces cerevisiae
total genus 11
structure length 59
sequence length 59
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1yn8A00
3REAB 1ABQA 2A36A 2YSQA 3RBBB 4FSSA 2EPDA 3REBB 1TG0A 2FPEA 2L0AA 1RLPC 5I22A 3EGUA 1T3SA 2JM8A 2LJ1A 3SHWA 1QWFA 2CT4A 2CSIA 2LCSA 2M0YA 2EYYA 1AZGB 2W0ZA 2CUBA 2O31A 2RPNA 2O9VA 3CQTA 4HXJA 4OMQA 1ZBJA 2W10A 1E7OA 1ZSGA 3ULRB 1NLPC 2RMOA 2MOXA 2BZXA 2DYBA 4QT7A 1JEGA 2ABLA 2CH4A 2ROLA 1YN8A 1I07A 3EHRA 1AWJA 1WI7A 2KT1A 2LP5A 5EC7A 2KXDA 2DRKA 4AFUC 1TUDA 2KRNA 1V1CA 1GBQA 2KRSA 2JXBA 2FPFA 2A08A 3VS7A 2NWMA 2EYZA 2C0IA 2K2MA 1U5SA 2KRMA 4CC7A 1KIKA 1WYXA 1YP5A 2M51A 1K9AA 3THKA 4J9DA 1K0SA 2YUPA 4OMLA 3NMZC 2KYBA 1X2KA 2JMCA 2K9GA 1A0NB 2EKHA 1VYUA 4Y92A 1UDLA 1H8KA 2J6OA 4LN2A 3VS0A 2ED1A 2EQIA 2DILA 3ZL7C 4RTXA 1T3LA 1MUZA 2H8HA 1OPLA 1B3QA 2KYMA 2A37A 3VS1A 3QWXX 5IHNA 3VS5A 4OMMA 4J9GA 2IIMA 3RNJA 1GCPA 2KNBB 2LQNA 1SRLA 1ABOA 2E5KA 4AFZC 2O88A 5FWBA 2ROTA 3JV3A 2ED0A 2GTJA 3UF4A 1PWTA 4F17A 1RLQC 1CKAA 2YDLA 3SEMA 1YNZA 1MV3A 2JTEA 3EG3A 1E6HA 1UE9A 2GBQA 2K7AA 2G6FX 1WDXA 2CUDA 1PNJA 4Z89A 1SHGA 3U23A 1M8MA 2JM9A 4ESRA 2ENMA 1GL5A 1Y57A 2EGCA 2DF6A 1UJ0A 2F2VA 1PKTA 1GCQA 1VYVA 2JT4A 1AWWA 2ESWA 1T0JA 1X6GA 3VS4A 2DBKA 4LNPA 2EGEA 1NEBA 2OAWA 1YCSB 4JJCA 4LUDA 1Y0MA 2LQWA 2BZ8A 3NPFA 2GGRA 2L3PA 4AG1C 3H0IA 4JZ3A 1X6BA 2K79A 3GBQA 1BBZA 1TUCA 1RI9A 1UHFA 2PTKA 3M0UA 1WA7A 4Z88A 1WXTA 1ARKA 4JPBW 3VRYA 2FG0A 4M4ZA 4X1VA 2X3XD 1SSHA 2CREA 2HDAA 2GNCA 2CSQA 4OMPA 4RTTA 4RTVA 4AG2C 2DL8A 1Z9QA 1QCFA 1UJYA 1WXUA 2FPDA 1B07A 3EG2A 1GCQC 4AFSC 1ZX6A 2EYWA 2RQTA 3M0PA 2YUQA 4ORZA 2D8JA 2X3WD 1AD5A 1BB9A 1KFZA 2C0OA 4J9FA 1UG1A 2J6FA 1HD3A 3UA7A 2PNIA 1J3TA 1VYTA 5FW9A 2RQRA 1WLPB 2J7IA 2AKKA 1UECA 5GJWB 4LE9A 2DJQA 4HVUA 1CKBA 2FRYA 2V1QA 3KFVA 1X27A 1NG2A 1K0XA 4J9CA 1QWEA 1JXMA 1MV0B 4E6RA 1WX6A 3M0SA 1GFDA 2KXCA 1G2BA 1ZUKA 4RTWA 1IO6A 3LH5A 3FJ5A 2KEAA 1KSWA 4K11A 1SHFA 2L3SA 4HVVA 1UGVA 2LJ0A 2DLPA 2RQWA 5IHKA 1AZEA 2F2XA 1WXBA 1PRMC 1QKXA 4IIMA 2O2OA 3EG1A 1AWXA 1UFFA 1XOVA 2DM1A 2L2PA 1LCKA 2BZYA 1X69A 1SRMA 3NGPA 2ECZA 1HSQA 4R0KA 4Z8AA 1JXOA 5FWCA 2YUOA 1SPKA 4D8DA 3PVLA 4WCIA 4RTUA 2FRWA 2VVKA 1ZUUA 2A28A 2DBMA 3TVTA 2BTTA 1U3OA 2K6DA 2XMFA 1I0CA 2EW3A 2VKNA 2MCNA 1UUEA 3PVQA 2EYXA 2OI3A 2EVRA 1H3HA 2HSPA 3TSWA 3UATA 2DL5A 4J9BA 2LJ3A 1ZUYA 3H0FA 4J9IA 3EHQA 2QDLA 4RTZA 1K76A 1PKSA 1OOTA 1S1NA 4HCKA 5IXBA 1WFWA 4EIKA 2RQUA 3VS2A 2DE0X 3H41A 2SRCA 5GJVB 2AZSA 3I35A 1NLOC 4J9HA 2KBTA 1OPKA 1I1JA 2DRMA 1NYFA 3M0RA 1AWOA 2D8HA 2DL7A 1K4US 5HCKA 3VRZA 4JJBA 4OMOA 3I5RA 2VWFA 4RUGA 2DNUA 2L3QA 2DVJA 4DEXA 1M3AA 2EBPA 2LMJA 2GQIA 4GLMA 1NEGA 1W6XA 4A63B 1H92A 2J6KA 4ZNXA 4CC3A 1GRIA 1FMKA 3UA6A 4CC4B 5IHIA 1AOJA 1WIEA 4J9EA 1BK2A 1M3CA 2AZVA 5ECAA 2K3BA 3C0CA 2AK5A 1FYNA 2LZ6B 4OMNA 1U06A 2CH4W 4RTYA 2GTOA 2D1XA 1JO8A 2JS2A 2RNAA 1W1FA 2D0NA 2MIOA 1GFCA 2O9SA 2CDTA 1G83A 1QLYA 3NHNA 2YT6A 3O5ZA 1Z9ZA 5I11A 1ZLMA 2JMAA 2RN8A 1HJDA 2JW4A 3M0TA 2F2WA 1KJWA 2HBWA 1QKWA 2B86A 5IH2A 2PZ1A 1N5ZA 3A98A 1PRLC 2DA9A 1AEYA 4CC2A 4IIOA 4F14A 2RF0A 3M0QA 2JS0A 1W70A 3I9QA 1OV3A 2HEQA 2CT3A 3TSZA 2RQVA 2FEIA 4D8KA 2YUNA 2FO0A 1X2QA 2EGAA 2LX7A 2DL4A 4F16A 5IXFA 4JZ4A 2P4RA 1K1ZA 2OJ2A 1GBRA 1BU1A 4LUEA 3H0HA 1E6GA 4HVWA 4DEYA 3VS3A 2DX1A 1SEMA 2NUZA 3EG0A 3VS6A 1NYGA 2AKLA 3QWYA 1YWPA 1JU5C 1VA7A 1M30A 1YWOA 4GBQA 1UHCA 1NM7A 1M27C 1PHTA 3I5SA 1T0HA 3IQLA 1X43A 2KE9A 1M3BA 5L23A 3PE0A 1OEBA 2KGTA 4JJDA 1JQQA 2SEMA 1UTIA 1RUWA 2J06A 2KR3A 2J05A 3R6NA 2DL3A 1CSKA 4KRTA 2C0TA 2KT8A 2DMOA 4AFQC 2V1RA 1EFNA 2HCKA 2I0NA 2KROA 1AVZC 2LNHB
chains in the Genus database with same CATH superfamily
3L2WA 3CC7Q 4C0DC 4M7DA 3QPHA 4PJOE 3L2RA 1WJRA 4HKEA 1RLPC 5I22A 3G71T 3CCJT 3G1JA 1G3TA 4M7DE 2EYYA 3CCSQ 3OS5A 2W0ZA 4HXJA 4BI3A 4BY6B 4MMLA 2W10A 1ZSGA 1JJ2P 3M55A 2RMOA 2DYBA 3HRSA 5IN1A 4C0DB 1I8FA 4QT7A 4GY5A 4Z02A 3EHRA 8AT1B 1WI7A 4M75C 1GBQA 2A08A 3D7SB 2NWMA 1IXDA 2K2MA 4CC7A 1KIKA 1K9AA 1BI2A 2YUPA 4OMLA 3NMZC 2QQ9A 4MZTA 3ASKA 2JMCA 2WSEE 5D6WA 4Y92A 2O4XA 4LN2A 2ED1A 4RTXA 1OPLA 2KYMA 1VIFA 4FW1A 2KI7A 3FLGA 4J9GA 3RNJA 4A4KA 1OULA 1ABOA 1OU9A 2A0FB 2G3RA 2QA4T 1WPYA 2O88A 5CIUA 2XDDA 2IVWA 5IAYA 2ROTA 3CCJQ 1N8RC 3FIFA 3BFMA 5C6SA 4N4HA 2K4YA 1WQ7A 2COWA 1MV3A 2K7AA 3I55A 3CCVT 2NUTB 5A0GA 3T9NA 3CXCP 1SHGA 2DIGA 2LCLA 1XTDA 1GXIE 1QW1A 3V7CA 2ENMA 2AIRB 2MK5A 1KK7A 2VB6A 3SD4A 2DEUA 4E7HA 2EGCA 5GAN3 1N8RR 1QVGS 3JB9H 3CC2A 1GCQA 3META 2RA2A 1X6GA 1QVFP 4M75G 1NEBA 2OAWA 1R0BG 2K2VA 1KD1U 2LQWA 3QJYA 4KGXB 2BZ8A 3NPFA 3ER0A 3H0IA 3M58A 4JRQA 4X9DA 1RI9A 1EX4A 2GQVA 3V8JA 1VQ7T 2FVUA 3QJ6A 3A8GB 5GANe 3QIIA 4C92G 2QQBA 2A3LA 4X1VA 2DEQA 3E9FA 2X3XD 3HPWA 1SSHA 5CKEA 2GNCA 1BI1A 2RK1A 2CSQA 2V8IA 4RTTA 3M56A 4B9XA 1RAGB 4JLIA 4XTUA 1QCFA 2VXEA 3FRNA 1UJYA 3CC4A 4QVCA 2XICA 4JRIA 2X51A 1Q7YC 2D8JA 3JB9J 1BB9A 3M53A 3MJXA 2C0OA 1H641 2VGMA 2PNIA 1VYTA 5FW9A 4OB2B 4XU1A 3FEOA 4LE9A 2DJQA 4N4GA 2FRYA 3KFVA 3S3MA 3QHSA 3JRZA 4PKCC 4J9CA 5HK3A 1QWEA 1JXMA 4AT1B 1MV0B 2RI3A 3EG9B 3M0SA 1GFDA 2KXCA 4L59A 4A4FA 1TWBA 3OS1A 4EPCA 3LH5A 2EIFA 3FJ5A 1M2OA 1K8AC 1AZEA 5IHKA 3CC2Q 2COYA 5LJ3g 1UGRB 4IIMA 1VQLT 1QVGA 1R0CB 1VQ5A 1UB4A 2RK2A 4L6V5 2BZYA 1N9RA 1VQ7Q 4FYVB 5CQXA 4OP0A 1K8AR 1SPKA 1RAEB 3PVLA 1Q86C 2FRWA 4PJOG 2CP3A 2DXBA 4DOWA 1AHJB 1UUEA 2EKOA 3CC4Q 1H3HA 3UATA 2DL5A 4M77A 4J9BA 2LJ3A 2I2LA 2JN0A 1RAIB 2LX9A 4RTZA 3JCMf 1EIFA 4JJNK 2X9HA 1U8RA 1Q86R 1LVKA 1X01A 4NL3A 1TXQA 1BI3A 2QQSA 3MEAA 4M77E 2QYZA 5A0LA 1D09B 2IPOB 2SRCA 4KH1B 3I35A 4J9HA 3JSCA 4PJLA 2DXCA 1I1JA 1NYFA 1O9SA 3WVDB 2DL7A 1D0YA 5HCKA 4E47A 3OW2S 3VRZA 4XTXA 3TCJA 3A8LB 1R77A 2QTXA 1VQNT 1M5Q1 1YHQT 1F1BB 4JRKA 1YI2A 1VQLQ 3RERA 4YTLA 4DEXA 3CD6T 4M7AD 2DFUA 3H8ZA 4RCCA 1NEGA 1H92A 2J6KA 2WACA 5GMKl 3OYKA 4QQ6A 3UA6A 1LOJA 1YIJT 1YJ9T 1AOJA 2KDSA 1WHJA 2RHIA 3HRTA 2AZVA 4FSXA 1VQ4A 2AK5A 2V26A 4RTYA 2ZCFB 3JCMd 2D1XA 1WHMA 1W1FA 3O5ZA 2RHXA 5I11A 2YT6A 1Z9ZA 2VGNA 2JMAA 4J8OA 2EWNA 3CCEA 5GMKj 4IUVA 2B86A 1VQ9T 1W2BS 2QG9B 1N5ZA 5D7UA 2RF0A 2HKQB 4EMKC 2QEXA 1M1KU 1W70A 3I9QA 4RKUE 1ZSZB 3TSZA 2RQVA 2QGFB 3QUIA 2JZ2A 2M1HA 4E7SA 1KG1A 4FM4B 2LX7A 1RAHB 1WNLA 1ZA2B 4F16A 5KCOA 4JZ4A 2MPXC 2DTHA 2P4RA 1VQKT 1K1ZA 3OMGA 5LJ3e 2OJ2A 1BU1A 4GLKA 4JDSA 2PUKB 5FU6C 1NBEB 3QZ9B 3HRUA 2NUZA 3EG0A 1YBYA 3QWYA 1M30A 1UHCA 1C0MA 1NM7A 1VQNQ 2X4JA 4EMKB 3OW2A 4R55A 4LDWA 5KYUB 2LQKA 1SG5A 1C6VX 2E6NA 5L23A 2OTLA 4JJDA 1YJ9Q 1UTIA 3RUXA 2J06A 2J05A 4PLLA 3R6NA 2X4YA 3VUBA 1CSKA 2KT8A 2DMOA 4AFQC 1VQ4Q 1SF9A 5FU6B 2EJFA 5GAN8 5LJ5f 2GF7A 2K3YA 1ABQA 3FC3A 2A36A 2EPDA 2OAUA 3E1SA 1VQMT 5LJ5j 4DBHA 3URGA 3EGUA 4M78D 2DKGA 2O01E 4FCYA 1JB0E 2XHCA 2LJ1A 3SHWA 4E7IA 2CT4A 2M0YA 1K73R 4M75E 1Y96B 2RPNA 2QEXQ 1W2BA 4J83A 3ULRB 2NUTA 3I56A 2BZXA 2CP7A 1JEGA 2CH4A 3CMAT 5HY6A 4OB3B 1I07A 2MYSA 3PMIA 1IB8A 4RMOA 2KT1A 2LP5A 3HP9A 3CC7A 3M4YA 2KXDA 2KRNA 4ELZC 1IRXA 2KRSA 2FPFA 3MP8A 3RIRA 2MF2A 5CQYA 4FL6A 3JCMP 5LJ5d 4XU0A 3QSUA 3M4GA 4J9DA 3P8HA 3L2ZA 1TTHB 3CCSA 4HCZA 4O5VA 4XK8E 1VYUA 2OX7A 1KQSS 2J6OA 1NPPA 2H3JA 2DILA 4E7KA 3ZL7C 3V8KA 3OYLA 5LJ5g 5KH6A 5L8RE 1IZ6A 4P5NA 1MUZA 2H8HA 3VV0A 1K73U 2A37A 4PL6A 5LJ3h 3VS5A 3H6ZA 2F5TX 5GAMf 2IIMA 1WHKA 4LD9K 3PGGA 2LQNA 3GIBA 4BD3A 1QP2A 3RKXA 2E5KA 4AFZC 1RADB 2LC4A 3GNFB 2WSCE 4IKFA 2RM4A 3G7ZA 3S3OA 3UF4A 4F17A 2D6FA 4JLGA 4BDYA 3SEMA 2IG0A 4PLIA 2QDYB 3EG3A 6AT1B 1KHIA 2GBQA 1BCMA 2XIDA 1PNJA 4M7AF 4Z89A 4QQGA 2HKNA 2LRQA 2DTIA 3NTIA 3I56Q 4IUUA 4OMFB 1GL5A 2FB7A 3CMAQ 3EG9A 2P0PA 3CCRA 1VYVA 2PVGB 4KUIA 1T0JA 3VS4A 7AT1B 1FMWA 1BIAA 4MZMA 3RMSA 3G71A 4HA8A 4AG1C 3CCJA 4PJMA 4JZ3A 3PMTA 3JCMW 5GAMd 5FRNA 1JJ2S 3VRYA 2FG0A 3HHTB 2L3RA 4M4ZA 1VQPT 2LTOA 3QXEB 3SFMA 2CREA 3AT1B 3P8DA 2E64A 4RTVA 2D0QB 5GAMg 4XTYA 3VJPA 1Z9QA 5CKHA 4DBRA 3LLRA 2FPDA 1KQSA 1RAFB 4AFSC 1K9MC 2CP5A 1ZX6A 2EYWA 2RQTA 3M0PA 3JCMc 2YUQA 4J6XA 1KQ2A 4JRPA 3QYGB 1KFZA 4FU6A 2KVQG 1HD3A 5J26A 3UA7A 2LNVA 2R5MA 3OQ5A 1YJNT 2B8AA 2AKKA 4N0AC 1UECA 1NE8A 3M9QA 4HVUA 3DLLA 2ZPGB 1X27A 5A0DA 3FJPA 1K9MR 2X4XA 3CMET 4E6RA 3OYHA 1WX6A 4C0ZA 1NJIC 1OX9A 3CPFA 3L42A 1IO6A 2FZKB 1KSWA 1V29B 1YITT 1D1AA 1BKBA 1DJ7B 4HVVA 2P0QA 5D6XA 3CCMT 2RQWA 3CCRQ 2YRCA 1PRMC 1LPLA 2QA4A 3CCQT 3G71Q 3JCMQ 1XOVA 4L5GA 1PD1A 1I5OB 4M78F 4A54A 1LCKA 3CXCS 1IHWA 1SRMA 2CP0A 2YLCA 4EDUA 4C8QD 4R0KA 3EFSA 1VQPQ 3X28B 3CCVA 2M0OA 1JJ2A 2CS7A 1ZUUA 2Y4YA 3PNWC 2DBMA 4NS5A 3EGXB 1QVFS 2K6DA 1U3OA 3TREA 2DAQA 1I0CA 2EW3A 2VKNA 1RI0A 2EYXA 2QTVA 2KQWA 3J80E 4ZN1A 4O6JA 5AT1B 1WHGA 4ME7A 1K9MU 3E2UA 2DJZA 1PKSA 1S1NA 4HCKA 1YJNQ 5IXBA 1TH7A 4WF2A 4XU3A 4E7ZA 2DE0X 1VQ7A 4QQDA 1ZSZA 2AZSA 2PUOB 1QVPA 5GMKh 2LDMA 4M7AC 4C5HA 1FWZA 1OPKA 4ZGJB 4A53A 3OYFA 4KGVB 4PK4A 1YITQ 3CCMQ 4FT2A 2QQAA 4HCBA 3HSBA 4FT4A 3A8MB 4OMOA 2JOYA 1TS9A 4TVRA 2DNUA 4J5YA 3CCUT 2QA4Q 3VUZA 3CCQQ 2LMJA 3FDRA 4C5IA 4J7FA 1M4ZA 4GLMA 3CPWP 4EMKA 2H3EB 1FMKA 5KYUA 1N8RU 4HCCA 4M7AB 4J9EA 1BK2A 4XU2A 5GAMe 1KQ1A 3M57A 3C0CA 1FYNA 3CCVQ 3CXCA 1UGPB 4F7UF 2RJCA 1Q7YR 1GFCA 3NHNA 2R57A 2VV5A 1VUBA 5KCHA 2RN8A 1HJDA 2F2WA 3X24B 1QVFA 9ATCB 2RJFA 1ZHIA 1NPRA 2PZ1A 2NYSA 2ZZDA 3V7SA 3EFOB 1VQLA 4BI8B 4F14A 2DIQA 2JS0A 1OV3A 1Y96A 5LJ5h 1BCOA 5GAN7 2CKKA 1XJWB 2Y4XA 2E10A 2LCCA 3MO8A 4BE1A 2K5FA 3ZEHA 1Y07A 4M7AG 5IXFA 2KY9A 4XTVA 4NOYA 1H3ZA 2DETA 4DEYA 3VS3A 3VS6A 1NYGA 2AKLA 1JU5C 1VA7A 4GBQA 4QVDA 1OU8A 5DM7R 1M27C 3OMCA 3I5SA 3NTHA 3PIOA 1T0HA 3OYEA 3OYNA 3CCUQ 2DK3A 2MAMA 5LL6S 5CK9A 1MMDA 1X43A 1Q7YU 4JS5A 2BE7D 1M3BA 4M78C 1JQQA 2SEMA 1RUWA 2P0KA 1M1FA 4QKUA 2OTJT 4FIBA 2DL3A 3LGLA 2FZCB 2ZPIB 4RG2A 4BUGA 1EFNA 2HCKA 1AVZC 4C5EA 1Q82C 2EJGA 4PJNA 1IGUA 3LWIA 2L0AA 3LH0A 2EQKA 2E41A 2JM8A 5EG2A 1QWFA 1K8AU 1VQNA 1YHQA 2PVDB 4X9CA 4M78B 3CD6A 3C4SA 2VXFA 2O31A 2O9VA 4OMQA 3HTRA 2X4WA 5GAMh 1YIJA 1YJ9A 3H9NA 1MNDA 3QDFA 2ABLA 1MMNA 1ZSZC 1YCYA 2K3XA 4C8QF 1M9SA 5GAN4 5EC7A 1PCXA 2DD5A 2DRKA 4AFUC 2ZGWA 1Q86U 1TSFA 1QQJA 3OBYA 2EYZA 1M90C 2CZ6B 3EAEA 2M51A 4C0GA 3F70A 3L1AA 1VQ9A 3JCMg 2E3IA 2KYBA 4MZPA 5GMKi 1O75A 4M78G 4M7DD 1A0NB 2YHTA 1TU0B 2EKHA 2P4TA 3N5BB 1UDLA 1VQOT 1H8KA 1OZ3A 2OTJQ 2QK0A 3QG1A 1WZOA 1MMAA 3RR6A 3QWXX 1M90R 1I81A 3LX7A 1VQKA 1GCPA 2KNBB 4AMCA 1SRLA 4Q5WA 1TOVA 5FWBA 3JV3A 4QW2A 2ED0A 3VU3C 2EYQA 1AT1B 1YHQQ 1YNZA 3JCMb 3CD6Q 5DLOA 2PQWA 4ZGEB 4ZN3A 2ZPHB 1VQ6T 2E6ZA 1YJWT 1WDXA 3X20B 4WTOB 3U23A 1YIJQ 1M8MA 2RD1A 2JM9A 5CR2A 3QKJA 4V2SA 2HQEA 4F7UB 2F2VA 1PKTA 4BI4A 5GAOm 2JT4A 1Y71A 1AWWA 1I5LA 2DBKA 1WGSA 1RAAB 2EGEA 1YCSB 3BY7A 4LUDA 1Y0MA 1D3BB 3BW1A 1VQMA 2A7YA 5CKDA 1D0ZA 2GGRA 1Q95G 1Q81C 3S3NA 4BACA 4N0AA 3WXMB 1M90U 2K79A 5CVIA 1BBZA 1UHFA 1VQ9Q 5J39A 5KYXB 3M0UA 4Z88A 1ARKA 4JPBW 2DD4A 3V7RA 1PG5B 2YWWA 4XTZA 2F5KA 5M9OA 1D0XA 3CCLT 1HXDA 2BUDA 1B34A 3GNGA 5I2SA 2E1HA 3EGXA 3CMAA 1Q81R 1VQKQ 3E9GA 1BI0A 4B6MA 2X3WD 2DZ9A 2QGGA 4C92F 3JAME 2XKOC 3HFNA 2BE9B 1WLPB 2J7IA 4X34A 3OYDA 5GJWB 1V76A 1CKBA 3DB3A 5FLXE 2V1QA 2R58A 3L2UA 1K0XA 5GANf 5CAIA 5CCAA 3P8BB 2M9UA 1G2BA 1ZUKA 3SWNB 1VQ8T 5GANj 2L3SA 2FZGB 1UGVA 2LJ0A 3JB9D 1S72T 4FYXB 4C8QC 1LJOA 1FMVA 2FHDA 4XTWA 3JCMe 1ZQ1A 4C5GA 1VQMQ 2CZ1B 3G6EA 3G6ET 2F69A 3MHXA 1AWXA 2E70A 1UFFA 3DLMA 2DM1A 2L2PA 3OYYA 5I21A 1X69A 1OI1A 2ECZA 2VUBA 1JXOA 4IURA 3PIPA 2AT1B 4M7AA 5FU7C 4WCIA 4RTUA 4Y91A 2A28A 3TVTA 4ZGDB 5KYYB 2E12A 2HQXA 4C8QB 5KYWB 2RI2A 2BTTA 3X25B 2XMFA 3M54A 3UWNA 4KH0B 2MCNA 3PVQA 3PT9A 3MEVA 1MGQA 2EVRA 3G4SA 3G4ST 3TSWA 2CP2A 2RI5A 4M7AE 2EJ9A 3EGDB 1ZUYA 5GANd 1EZZB 4J9IA 1M2VB 3EHQA 4OB1B 2HSEB 3JCMV 1K76A 3EFOA 3S6WA 4PJOF 2RQUA 3VS2A 1FX7A 5FU7B 4BE0A 5GANg 4LD6A 4CI0C 1VQPA 1U1TA 2KBTA 4RG8A 4M7DF 4PNOA 2NUPB 5GMKe 2DRMA 3C95A 4F04B 1VQ8Q 4IUPA 2D8HA 1K4US 2HL5C 1MHNA 1S72Q 3KUFA 3RESA 4C8QG 1KC8C 3OYMA 2MWOA 1WJQA 2RO0A 3JCMJ 1X6OA 2GFAA 4RUGA 2L3QA 4A4HA 4PFOA 4E7JA 3G6EQ 1VOMA 2LQ8A 3KXTA 1W6XA 2L5QA 4ZNXA 4ELYC 4CC3A 2RB6A 1YJNA 1GRIA 3C94A 1G8XA 2RHZA 1WIEA 3CBPA 5HK0A 3NFCA 1KHCA 5ECAA 2K3BA 2DERA 4KBMB 4M77D 2LZ6B 4OMNA 4EMGA 1KC8R 2QASA 3CMEA 2JS2A 1JO8A 2RNAA 1KD1C 3L2QA 1B7TA 3OYIA 3ME9A 8ATCB 3QDRB 3G4SQ 1YITA 2JW4A 2X35A 3CCMA 3M0TA 2HNIA 4N4IA 3TQ7P 3JCMh 2NLUA 1QKWA 3A98A 4FW2A 2HD0A 3M5AA 2DA9A 1IREB 4CC2A 4IIOA 2ZAEA 4RCBA 5CKBA 4C92C 1PD0A 3M0QA 1Y7XA 3CCQA 2LVMA 4J7IA 2HEQA 4M78A 2CT3A 2DO3A 3RDVA 1KD1R 2FEIA 4D8KA 2YUNA 4DQ2A 2FO0A 1X2QA 3HL8A 1NJIR 5LJ5e 2C06A 4M75B 2EGAA 2DYIA 2DL4A 1BYMA 2QI2A 2F1LA 4M78E 1I4K1 3UDCA 1B34B 3BE3A 3WVEB 4KUDK 3DKMA 1E6GA 1SEMA 2E3HA 5C0MA 2RH2A 1YWOA 3VYHB 3RKYA 2EAYA 3Q1JA 4C92B 1KC8U 3AHUA 3LWHA 4OVAA 3GOXA 2DTOA 4J6WA 5KE2A 1PSEA 4A4EA 4KGZB 2HBPA 2CZ7B 3I55T 3PE0A 1OEBA 4PFPA 2KGTA 2KK4A 2K57A 5GAOn 1UGQB 2KR3A 4MDXA 3DB4A 2RJEA 2C0TA 2V1RA 2KROA 3CC2T 2LNHB 3REAB 3CMEQ 2YSQA 3RBBB 4FSSA 4DA4A 5FROA 3REBB 5LJ3f 1G3WA 1TG0A 2FPEA 1QVGP 1T3SA 4LDVA 1X75C 1NJIU 3CPWS 1HYOA 5LJ3j 2GFUA 1HK9A 1G5VA 3JB9F 2CSIA 2KSSA 2LCSA 3GP8A 3V8LA 1QP3A 2YRDA 3OB9A 3CCUA 1AZGB 2HL3A 2CUBA 3CQTA 4OGCA 2M16A 1ZBXA 1UGSB 1QMCA 1ZBJA 4UC4A 4IUTA 2XDBA 1E7OA 4PJOC 4FYWB 3L2VA 1NLPC 3LGFA 2K5LA 2MOXA 1WJSA 2LT1A 4DBQA 3CC4T 1UEBA 2ROLA 3ZFJA 3MEWA 1YN8A 1AWJA 5A2QE 4M7DC 2E65A 2FL7A 4F7UA 3QO3A 1TUDA 1V1CA 2JXBA 2MI6A 2XG8D 3VS7A 3A5ZB 2C0IA 1U5SA 2KRMA 1WYXA 2EFIA 5GAOl 1YP5A 1D3BA 5HKCA 5KYNA 1D1BA 3THKA 2JTFA 4F7UE 2ZPEB 1K0SA 3I55Q 5CKFA 2BIVA 4PJOB 1X2KA 2K9GA 5LJ3d 5FRMA 4DBFA 5KYXA 2HZYA 1W4SA 4M75D 2V8KA 1XQHA 3VS0A 2EQIA 1U1SA 2YLBA 1T3LA 4M7DB 4KT0E 3EH2A 3OYCA 1B3QA 2DVEA 3BDLA 3VS1A 5IHNA 3MP6A 4OMMA 1N9SA 2QQRA 2E5QA 2XDPA 4C92D 4R56A 1VQ5T 4A4GA 4ZTJA 2GTJA 1P92A 1PWTA 4PJJA 3PFSA 1RLQC 1CKAA 2AHJB 2YDLA 1SSFA 4II1A 2ZPBB 3O8VA 1FXXA 1RABB 3A8OB 2JTEA 3CPWA 1E6HA 1UE9A 3M59A 2G6FX 1N6AA 2CUDA 2XI9A 2GCXA 2D9TA 3VKIA 2K5IA 2CZ0B 4ESRA 4LDUA 1D1CA 2OTJA 4XAXB 2RHYA 1Y57A 1OYXA 2DF6A 1UJ0A 2CYZB 3OY9A 3SWNA 2ZPFB 4M7DG 3OS0A 3CEYA 4M77F 2ESWA 2L8DA 5D6YA 2E4HA 4LNPA 2CP6A 1QCOA 4JJCA 1M1KC 3EFRA 3TEEA 4E7LA 1JBMA 2L3PA 2MMPA 1X6BA 5CO7A 3GBQA 5GANh 1TUCA 2PTKA 1WA7A 1WXTA 2O4XB 4PFZA 2R5AA 4MMKA 2DXTA 2JNGA 2JUFA 1RACB 3HFOA 3MP1A 2HDAA 1Q82R 2KAFA 1M1KR 4OMPA 1NZ9A 5AYFA 2LT4A 4AG2C 2DL8A 2JJ9A 1WXUA 1B07A 5KYWA 5KYYA 3EG2A 1GCQC 4C8QA 1ACMB 4NL2A 1PM3A 1YI2T 4LDXA 4ORZA 1AD5A 3OW2P 2JTMA 4LDYA 1LNXA 4Y28E 3RMQA 1VQ5Q 1RL2A 1TUGB 4J9FA 1UG1A 2J6FA 3EGDA 1J3TA 2RQRA 1M2VA 4C8QE 4PJOD 4JUVA 2EQJA 4IUQA 2XD0A 5KE3A 3UPUA 1OZ2A 5GAN6 3OYJA 1VQ4T 2Z0WA 2HMAA 3GF5A 4BB7A 1NG2A 3OYGA 3QYHB 4LXCA 1VQOA 1IGQA 4RTWA 4K11A 2KEAA 1SHFA 2NUPA 4BDZA 4XQ3A 2DLPA 3CCET 3UT1A 2F2XA 1WXBA 4E2FB 3C12A 1QKXA 3OYBA 1Q82U 3NTKA 2O2OA 3EH1A 4ANJA 3EG1A 5I2MA 2QEXT 4KULA 1OX8A 3OS2A 1W2BP 2WSFE 3OBWA 2CGHA 3MKDA 3J7AF 5GAOr 5GAN2 1C1AA 4MDWA 2PVOB 3NGPA 1MNEA 3QBYA 1HSQA 4Z8AA 1SKUB 1VQ6A 2RJDA 5FWCA 2YUOA 4D8DA 1YJWA 1VIEA 1PSFA 3LYIA 2VVKA 5GAOp 2COZA 2P84A 4OF1A 2YXYA 3GPLA 2OI3A 1XNIA 3KBGA 1YFNA 2HSPA 2ATCB 1OQKA 3INZA 1YI2Q 2DXUA 2EQMA 3H0FA 2YRVA 3A8HB 4VUBA 3ZBDA 2QDLA 2MWPA 3VYGA 1MMGA 2DZCA 3TU4K 2OTLT 1OOTA 3A1PA 3JB9G 1WFWA 4EIKA 1ZA1B 2QXFA 4OGEA 1K73C 3H41A 3J81E 5GJVB 5DLQE 5DY9A 1WQWA 2KMTA 1NLOC 2FYKA 1QCNA 1VQOQ 4M75A 3CCLA 3M0RA 1AWOA 4M75F 3PTAA 1G3SA 4B9WA 3CCEQ 2DPPB 4JJBA 2VC8A 3X26B 3OA6A 3I5RA 4M77C 2VWFA 3SWNC 4F7UG 2DVJA 1M3AA 3FB9A 2BKDN 2V8JA 4CRIA 2JVVA 2EBPA 4C92A 2GQIA 4A63B 2M02A 3CBMA 4CC4B 5IHIA 3I56T 1M3CA 1G3YA 2L89A 3RKWA 3LW5E 1VQ6Q 4C92E 3JB9I 1YJWQ 1U06A 2CH4W 4J6YA 2GTOA 3CC7T 1BIBA 4FYYB 3JCMX 4HT9A 2D0NA 2MIOA 2O9SA 2CDTA 1G83A 1QLYA 4QVZA 1ZLMA 4M77B 1WHLA 1VQ8A 5GAN5 4OB0B 3E19A 2Y90A 2PU9B 1S72A 1KJWA 2HBWA 2XU8A 1M1GA 5IH2A 3CBOA 1PRLC 1AEYA 3MCAB 3CCST 1WHHA 2OTLQ 3HKSA 3MEUA 5IT9E 1PC0A 3BDUA 3OSVA 3OYAA 4ATOA 2XK0A 1Q81U 1M8VA 4DOVA 5J3BA 1KQSP 4C0FA 4D6WA 3CCLQ 1GBRA 3OSSC 4HT8A 4LUEA 3H0HA 5GAMj 4HVWA 3SB2A 2DX1A 4EMHA 4ZTFA 2RHUA 1YWPA 5GMKm 1R8OB 1PHTA 4M77G 4BE2A 4JS4A 1N27A 3MPUB 3IQLA 2KE9A 3QZ5B 3GLXA 5GAOq 2VYTA 2VASA 2QAZA 4PJOA 2HAXA 1IHVA 4BY6C 4KRTA 2HQHA 3R6OA 3SDZA 1JRIA 2I0NA 3CCRT 2EQUA
chains in the Genus database with same CATH topology
3REAB 1ABQA 2A36A 2YSQA 3RBBB 4FSSA 2EPDA 3REBB 1TG0A 2FPEA 2L0AA 1RLPC 5I22A 3EGUA 1T3SA 2JM8A 2LJ1A 3SHWA 1QWFA 2CT4A 2CSIA 2LCSA 2M0YA 2EYYA 1AZGB 2W0ZA 2CUBA 2O31A 2RPNA 2O9VA 3CQTA 4HXJA 4OMQA 1ZBJA 2W10A 1E7OA 1ZSGA 3ULRB 1NLPC 2RMOA 2MOXA 2BZXA 2DYBA 4QT7A 1JEGA 2ABLA 2CH4A 2ROLA 1YN8A 1I07A 3EHRA 1AWJA 1WI7A 2KT1A 2LP5A 5EC7A 2KXDA 2DRKA 4AFUC 1TUDA 2KRNA 1V1CA 1GBQA 2KRSA 2JXBA 2FPFA 2A08A 3VS7A 2NWMA 2EYZA 2C0IA 2K2MA 1U5SA 2KRMA 4CC7A 1KIKA 1WYXA 1YP5A 2M51A 1K9AA 3THKA 4J9DA 1K0SA 2YUPA 4OMLA 3NMZC 2KYBA 1X2KA 2JMCA 2K9GA 1A0NB 2EKHA 1VYUA 4Y92A 1UDLA 1H8KA 2J6OA 4LN2A 3VS0A 2ED1A 2EQIA 2DILA 3ZL7C 4RTXA 1T3LA 1MUZA 2H8HA 1OPLA 1B3QA 2KYMA 2A37A 3VS1A 3QWXX 5IHNA 3VS5A 4OMMA 4J9GA 2IIMA 3RNJA 1GCPA 2KNBB 2LQNA 1SRLA 1ABOA 2E5KA 4AFZC 2O88A 5FWBA 2ROTA 3JV3A 2ED0A 2GTJA 3UF4A 1PWTA 4F17A 1RLQC 1CKAA 2YDLA 3SEMA 1YNZA 1MV3A 2JTEA 3EG3A 1E6HA 1UE9A 2GBQA 2K7AA 2G6FX 1WDXA 2CUDA 1PNJA 4Z89A 1SHGA 3U23A 1M8MA 2JM9A 4ESRA 2ENMA 1GL5A 1Y57A 2EGCA 2DF6A 1UJ0A 2F2VA 1PKTA 1GCQA 1VYVA 2JT4A 1AWWA 2ESWA 1T0JA 1X6GA 3VS4A 2DBKA 4LNPA 2EGEA 1NEBA 2OAWA 1YCSB 4JJCA 4LUDA 1Y0MA 2LQWA 2BZ8A 3NPFA 2GGRA 2L3PA 4AG1C 3H0IA 4JZ3A 1X6BA 2K79A 3GBQA 1BBZA 1TUCA 1RI9A 1UHFA 2PTKA 3M0UA 1WA7A 4Z88A 1WXTA 1ARKA 4JPBW 3VRYA 2FG0A 4M4ZA 4X1VA 2X3XD 1SSHA 2CREA 2HDAA 2GNCA 2CSQA 4OMPA 4RTTA 4RTVA 4AG2C 2DL8A 1Z9QA 1QCFA 1UJYA 1WXUA 2FPDA 1B07A 3EG2A 1GCQC 4AFSC 1ZX6A 2EYWA 2RQTA 3M0PA 2YUQA 4ORZA 2D8JA 2X3WD 1AD5A 1BB9A 1KFZA 2C0OA 4J9FA 1UG1A 2J6FA 1HD3A 3UA7A 2PNIA 1J3TA 1VYTA 5FW9A 2RQRA 1WLPB 2J7IA 2AKKA 1UECA 5GJWB 4LE9A 2DJQA 4HVUA 1CKBA 2FRYA 2V1QA 3KFVA 1X27A 1NG2A 1K0XA 4J9CA 1QWEA 1JXMA 1MV0B 4E6RA 1WX6A 3M0SA 1GFDA 2KXCA 1G2BA 1ZUKA 4RTWA 1IO6A 3LH5A 3FJ5A 2KEAA 1KSWA 4K11A 1SHFA 2L3SA 4HVVA 1UGVA 2LJ0A 2DLPA 2RQWA 5IHKA 1AZEA 2F2XA 1WXBA 1PRMC 1QKXA 4IIMA 2O2OA 3EG1A 1AWXA 1UFFA 1XOVA 2DM1A 2L2PA 1LCKA 2BZYA 1X69A 1SRMA 3NGPA 2ECZA 1HSQA 4R0KA 4Z8AA 1JXOA 5FWCA 2YUOA 1SPKA 4D8DA 3PVLA 4WCIA 4RTUA 2FRWA 2VVKA 1ZUUA 2A28A 2DBMA 3TVTA 2BTTA 1U3OA 2K6DA 2XMFA 1I0CA 2EW3A 2VKNA 2MCNA 1UUEA 3PVQA 2EYXA 2OI3A 2EVRA 1H3HA 2HSPA 3TSWA 3UATA 2DL5A 4J9BA 2LJ3A 1ZUYA 3H0FA 4J9IA 3EHQA 2QDLA 4RTZA 1K76A 1PKSA 1OOTA 1S1NA 4HCKA 5IXBA 1WFWA 4EIKA 2RQUA 3VS2A 2DE0X 3H41A 2SRCA 5GJVB 2AZSA 3I35A 1NLOC 4J9HA 2KBTA 1OPKA 1I1JA 2DRMA 1NYFA 3M0RA 1AWOA 2D8HA 2DL7A 1K4US 5HCKA 3VRZA 4JJBA 4OMOA 3I5RA 2VWFA 4RUGA 2DNUA 2L3QA 2DVJA 4DEXA 1M3AA 2EBPA 2LMJA 2GQIA 4GLMA 1NEGA 1W6XA 4A63B 1H92A 2J6KA 4ZNXA 4CC3A 1GRIA 1FMKA 3UA6A 4CC4B 5IHIA 1AOJA 1WIEA 4J9EA 1BK2A 1M3CA 2AZVA 5ECAA 2K3BA 3C0CA 2AK5A 1FYNA 2LZ6B 4OMNA 1U06A 2CH4W 4RTYA 2GTOA 2D1XA 1JO8A 2JS2A 2RNAA 1W1FA 2D0NA 2MIOA 1GFCA 2O9SA 2CDTA 1G83A 1QLYA 3NHNA 2YT6A 3O5ZA 1Z9ZA 5I11A 1ZLMA 2JMAA 2RN8A 1HJDA 2JW4A 3M0TA 2F2WA 1KJWA 2HBWA 1QKWA 2B86A 5IH2A 2PZ1A 1N5ZA 3A98A 1PRLC 2DA9A 1AEYA 4CC2A 4IIOA 4F14A 2RF0A 3M0QA 2JS0A 1W70A 3I9QA 1OV3A 2HEQA 2CT3A 3TSZA 2RQVA 2FEIA 4D8KA 2YUNA 2FO0A 1X2QA 2EGAA 2LX7A 2DL4A 4F16A 5IXFA 4JZ4A 2P4RA 1K1ZA 2OJ2A 1GBRA 1BU1A 4LUEA 3H0HA 1E6GA 4HVWA 4DEYA 3VS3A 2DX1A 1SEMA 2NUZA 3EG0A 3VS6A 1NYGA 2AKLA 3QWYA 1YWPA 1JU5C 1VA7A 1M30A 1YWOA 4GBQA 1UHCA 1NM7A 1M27C 1PHTA 3I5SA 1T0HA 3IQLA 1X43A 2KE9A 1M3BA 5L23A 3PE0A 1OEBA 2KGTA 4JJDA 1JQQA 2SEMA 1UTIA 1RUWA 2J06A 2KR3A 2J05A 3R6NA 2DL3A 1CSKA 4KRTA 2C0TA 2KT8A 2DMOA 4AFQC 2V1RA 1EFNA 2HCKA 2I0NA 2KROA 1AVZC 2LNHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3REA B;  1ABQ A;  2A36 A;  2YSQ A;  3RBB B;  4FSS A;  2EPD A;  3REB B;  1TG0 A;  2FPE A;  2L0A A;  1RLP C;  5I22 A;  3EGU A;  1T3S A;  2JM8 A;  2LJ1 A;  3SHW A;  1QWF A;  2CT4 A;  2CSI A;  2LCS A;  2M0Y A;  2EYY A;  1AZG B;  2W0Z A;  2CUB A;  2O31 A;  2RPN A;  2O9V A;  3CQT A;  4HXJ A;  4OMQ A;  1ZBJ A;  2W10 A;  1E7O A;  1ZSG A;  3ULR B;  1NLP C;  2RMO A;  2MOX A;  2BZX A;  2DYB A;  4QT7 A;  1JEG A;  2ABL A;  2CH4 A;  2ROL A;  1YN8 A;  1I07 A;  3EHR A;  1AWJ A;  1WI7 A;  2KT1 A;  2LP5 A;  5EC7 A;  2KXD A;  2DRK A;  4AFU C;  1TUD A;  2KRN A;  1V1C A;  1GBQ A;  2KRS A;  2JXB A;  2FPF A;  2A08 A;  3VS7 A;  2NWM A;  2EYZ A;  2C0I A;  2K2M A;  1U5S A;  2KRM A;  4CC7 A;  1KIK A;  1WYX A;  1YP5 A;  2M51 A;  1K9A A;  3THK A;  4J9D A;  1K0S A;  2YUP A;  4OML A;  3NMZ C;  2KYB A;  1X2K A;  2JMC A;  2K9G A;  1A0N B;  2EKH A;  1VYU A;  4Y92 A;  1UDL A;  1H8K A;  2J6O A;  4LN2 A;  3VS0 A;  2ED1 A;  2EQI A;  2DIL A;  3ZL7 C;  4RTX A;  1T3L A;  1MUZ A;  2H8H A;  1OPL A;  1B3Q A;  2KYM A;  2A37 A;  3VS1 A;  3QWX X;  5IHN A;  3VS5 A;  4OMM A;  4J9G A;  2IIM A;  3RNJ A;  1GCP A;  2KNB B;  2LQN A;  1SRL A;  1ABO A;  2E5K A;  4AFZ C;  2O88 A;  5FWB A;  2ROT A;  3JV3 A;  2ED0 A;  2GTJ A;  3UF4 A;  1PWT A;  4F17 A;  1RLQ C;  1CKA A;  2YDL A;  3SEM A;  1YNZ A;  1MV3 A;  2JTE A;  3EG3 A;  1E6H A;  1UE9 A;  2GBQ A;  2K7A A;  2G6F X;  1WDX A;  2CUD A;  1PNJ A;  4Z89 A;  1SHG A;  3U23 A;  1M8M A;  2JM9 A;  4ESR A;  2ENM A;  1GL5 A;  1Y57 A;  2EGC A;  2DF6 A;  1UJ0 A;  2F2V A;  1PKT A;  1GCQ A;  1VYV A;  2JT4 A;  1AWW A;  2ESW A;  1T0J A;  1X6G A;  3VS4 A;  2DBK A;  4LNP A;  2EGE A;  1NEB A;  2OAW A;  1YCS B;  4JJC A;  4LUD A;  1Y0M A;  2LQW A;  2BZ8 A;  3NPF A;  2GGR A;  2L3P A;  4AG1 C;  3H0I A;  4JZ3 A;  1X6B A;  2K79 A;  3GBQ A;  1BBZ A;  1TUC A;  1RI9 A;  1UHF A;  2PTK A;  3M0U A;  1WA7 A;  4Z88 A;  1WXT A;  1ARK A;  4JPB W;  3VRY A;  2FG0 A;  4M4Z A;  4X1V A;  2X3X D;  1SSH A;  2CRE A;  2HDA A;  2GNC A;  2CSQ A;  4OMP A;  4RTT A;  4RTV A;  4AG2 C;  2DL8 A;  1Z9Q A;  1QCF A;  1UJY A;  1WXU A;  2FPD A;  1B07 A;  3EG2 A;  1GCQ C;  4AFS C;  1ZX6 A;  2EYW A;  2RQT A;  3M0P A;  2YUQ A;  4ORZ A;  2D8J A;  2X3W D;  1AD5 A;  1BB9 A;  1KFZ A;  2C0O A;  4J9F A;  1UG1 A;  2J6F A;  1HD3 A;  3UA7 A;  2PNI A;  1J3T A;  1VYT A;  5FW9 A;  2RQR A;  1WLP B;  2J7I A;  2AKK A;  1UEC A;  5GJW B;  4LE9 A;  2DJQ A;  4HVU A;  1CKB A;  2FRY A;  2V1Q A;  3KFV A;  1X27 A;  1NG2 A;  1K0X A;  4J9C A;  1QWE A;  1JXM A;  1MV0 B;  4E6R A;  1WX6 A;  3M0S A;  1GFD A;  2KXC A;  1G2B A;  1ZUK A;  4RTW A;  1IO6 A;  3LH5 A;  3FJ5 A;  2KEA A;  1KSW A;  4K11 A;  1SHF A;  2L3S A;  4HVV A;  1UGV A;  2LJ0 A;  2DLP A;  2RQW A;  5IHK A;  1AZE A;  2F2X A;  1WXB A;  1PRM C;  1QKX A;  4IIM A;  2O2O A;  3EG1 A;  1AWX A;  1UFF A;  1XOV A;  2DM1 A;  2L2P A;  1LCK A;  2BZY A;  1X69 A;  1SRM A;  3NGP A;  2ECZ A;  1HSQ A;  4R0K A;  4Z8A A;  1JXO A;  5FWC A;  2YUO A;  1SPK A;  4D8D A;  3PVL A;  4WCI A;  4RTU A;  2FRW A;  2VVK A;  1ZUU A;  2A28 A;  2DBM A;  3TVT A;  2BTT A;  1U3O A;  2K6D A;  2XMF A;  1I0C A;  2EW3 A;  2VKN A;  2MCN A;  1UUE A;  3PVQ A;  2EYX A;  2OI3 A;  2EVR A;  1H3H A;  2HSP A;  3TSW A;  3UAT A;  2DL5 A;  4J9B A;  2LJ3 A;  1ZUY A;  3H0F A;  4J9I A;  3EHQ A;  2QDL A;  4RTZ A;  1K76 A;  1PKS A;  1OOT A;  1S1N A;  4HCK A;  5IXB A;  1WFW A;  4EIK A;  2RQU A;  3VS2 A;  2DE0 X;  3H41 A;  2SRC A;  5GJV B;  2AZS A;  3I35 A;  1NLO C;  4J9H A;  2KBT A;  1OPK A;  1I1J A;  2DRM A;  1NYF A;  3M0R A;  1AWO A;  2D8H A;  2DL7 A;  1K4U S;  5HCK A;  3VRZ A;  4JJB A;  4OMO A;  3I5R A;  2VWF A;  4RUG A;  2DNU A;  2L3Q A;  2DVJ A;  4DEX A;  1M3A A;  2EBP A;  2LMJ A;  2GQI A;  4GLM A;  1NEG A;  1W6X A;  4A63 B;  1H92 A;  2J6K A;  4ZNX A;  4CC3 A;  1GRI A;  1FMK A;  3UA6 A;  4CC4 B;  5IHI A;  1AOJ A;  1WIE A;  4J9E A;  1BK2 A;  1M3C A;  2AZV A;  5ECA A;  2K3B A;  3C0C A;  2AK5 A;  1FYN A;  2LZ6 B;  4OMN A;  1U06 A;  2CH4 W;  4RTY A;  2GTO A;  2D1X A;  1JO8 A;  2JS2 A;  2RNA A;  1W1F A;  2D0N A;  2MIO A;  1GFC A;  2O9S A;  2CDT A;  1G83 A;  1QLY A;  3NHN A;  2YT6 A;  3O5Z A;  1Z9Z A;  5I11 A;  1ZLM A;  2JMA A;  2RN8 A;  1HJD A;  2JW4 A;  3M0T A;  2F2W A;  1KJW A;  2HBW A;  1QKW A;  2B86 A;  5IH2 A;  2PZ1 A;  1N5Z A;  3A98 A;  1PRL C;  2DA9 A;  1AEY A;  4CC2 A;  4IIO A;  4F14 A;  2RF0 A;  3M0Q A;  2JS0 A;  1W70 A;  3I9Q A;  1OV3 A;  2HEQ A;  2CT3 A;  3TSZ A;  2RQV A;  2FEI A;  4D8K A;  2YUN A;  2FO0 A;  1X2Q A;  2EGA A;  2LX7 A;  2DL4 A;  4F16 A;  5IXF A;  4JZ4 A;  2P4R A;  1K1Z A;  2OJ2 A;  1GBR A;  1BU1 A;  4LUE A;  3H0H A;  1E6G A;  4HVW A;  4DEY A;  3VS3 A;  2DX1 A;  1SEM A;  2NUZ A;  3EG0 A;  3VS6 A;  1NYG A;  2AKL A;  3QWY A;  1YWP A;  1JU5 C;  1VA7 A;  1M30 A;  1YWO A;  4GBQ A;  1UHC A;  1NM7 A;  1M27 C;  1PHT A;  3I5S A;  1T0H A;  3IQL A;  1X43 A;  2KE9 A;  1M3B A;  5L23 A;  3PE0 A;  1OEB A;  2KGT A;  4JJD A;  1JQQ A;  2SEM A;  1UTI A;  1RUW A;  2J06 A;  2KR3 A;  2J05 A;  3R6N A;  2DL3 A;  1CSK A;  4KRT A;  2C0T A;  2KT8 A;  2DMO A;  4AFQ C;  2V1R A;  1EFN A;  2HCK A;  2I0N A;  2KRO A;  1AVZ C;  2LNH B; 
#chains in the Genus database with same CATH topology
 3L2W A;  3CC7 Q;  4C0D C;  4M7D A;  3QPH A;  4PJO E;  3L2R A;  1WJR A;  4HKE A;  1RLP C;  5I22 A;  3G71 T;  3CCJ T;  3G1J A;  1G3T A;  4M7D E;  2EYY A;  3CCS Q;  3OS5 A;  2W0Z A;  4HXJ A;  4BI3 A;  4BY6 B;  4MML A;  2W10 A;  1ZSG A;  1JJ2 P;  3M55 A;  2RMO A;  2DYB A;  3HRS A;  5IN1 A;  4C0D B;  1I8F A;  4QT7 A;  4GY5 A;  4Z02 A;  3EHR A;  8AT1 B;  1WI7 A;  4M75 C;  1GBQ A;  2A08 A;  3D7S B;  2NWM A;  1IXD A;  2K2M A;  4CC7 A;  1KIK A;  1K9A A;  1BI2 A;  2YUP A;  4OML A;  3NMZ C;  2QQ9 A;  4MZT A;  3ASK A;  2JMC A;  2WSE E;  5D6W A;  4Y92 A;  2O4X A;  4LN2 A;  2ED1 A;  4RTX A;  1OPL A;  2KYM A;  1VIF A;  4FW1 A;  2KI7 A;  3FLG A;  4J9G A;  3RNJ A;  4A4K A;  1OUL A;  1ABO A;  1OU9 A;  2A0F B;  2G3R A;  2QA4 T;  1WPY A;  2O88 A;  5CIU A;  2XDD A;  2IVW A;  5IAY A;  2ROT A;  3CCJ Q;  1N8R C;  3FIF A;  3BFM A;  5C6S A;  4N4H A;  2K4Y A;  1WQ7 A;  2COW A;  1MV3 A;  2K7A A;  3I55 A;  3CCV T;  2NUT B;  5A0G A;  3T9N A;  3CXC P;  1SHG A;  2DIG A;  2LCL A;  1XTD A;  1GXI E;  1QW1 A;  3V7C A;  2ENM A;  2AIR B;  2MK5 A;  1KK7 A;  2VB6 A;  3SD4 A;  2DEU A;  4E7H A;  2EGC A;  5GAN 3;  1N8R R;  1QVG S;  3JB9 H;  3CC2 A;  1GCQ A;  3MET A;  2RA2 A;  1X6G A;  1QVF P;  4M75 G;  1NEB A;  2OAW A;  1R0B G;  2K2V A;  1KD1 U;  2LQW A;  3QJY A;  4KGX B;  2BZ8 A;  3NPF A;  3ER0 A;  3H0I A;  3M58 A;  4JRQ A;  4X9D A;  1RI9 A;  1EX4 A;  2GQV A;  3V8J A;  1VQ7 T;  2FVU A;  3QJ6 A;  3A8G B;  5GAN e;  3QII A;  4C92 G;  2QQB A;  2A3L A;  4X1V A;  2DEQ A;  3E9F A;  2X3X D;  3HPW A;  1SSH A;  5CKE A;  2GNC A;  1BI1 A;  2RK1 A;  2CSQ A;  2V8I A;  4RTT A;  3M56 A;  4B9X A;  1RAG B;  4JLI A;  4XTU A;  1QCF A;  2VXE A;  3FRN A;  1UJY A;  3CC4 A;  4QVC A;  2XIC A;  4JRI A;  2X51 A;  1Q7Y C;  2D8J A;  3JB9 J;  1BB9 A;  3M53 A;  3MJX A;  2C0O A;  1H64 1;  2VGM A;  2PNI A;  1VYT A;  5FW9 A;  4OB2 B;  4XU1 A;  3FEO A;  4LE9 A;  2DJQ A;  4N4G A;  2FRY A;  3KFV A;  3S3M A;  3QHS A;  3JRZ A;  4PKC C;  4J9C A;  5HK3 A;  1QWE A;  1JXM A;  4AT1 B;  1MV0 B;  2RI3 A;  3EG9 B;  3M0S A;  1GFD A;  2KXC A;  4L59 A;  4A4F A;  1TWB A;  3OS1 A;  4EPC A;  3LH5 A;  2EIF A;  3FJ5 A;  1M2O A;  1K8A C;  1AZE A;  5IHK A;  3CC2 Q;  2COY A;  5LJ3 g;  1UGR B;  4IIM A;  1VQL T;  1QVG A;  1R0C B;  1VQ5 A;  1UB4 A;  2RK2 A;  4L6V 5;  2BZY A;  1N9R A;  1VQ7 Q;  4FYV B;  5CQX A;  4OP0 A;  1K8A R;  1SPK A;  1RAE B;  3PVL A;  1Q86 C;  2FRW A;  4PJO G;  2CP3 A;  2DXB A;  4DOW A;  1AHJ B;  1UUE A;  2EKO A;  3CC4 Q;  1H3H A;  3UAT A;  2DL5 A;  4M77 A;  4J9B A;  2LJ3 A;  2I2L A;  2JN0 A;  1RAI B;  2LX9 A;  4RTZ A;  3JCM f;  1EIF A;  4JJN K;  2X9H A;  1U8R A;  1Q86 R;  1LVK A;  1X01 A;  4NL3 A;  1TXQ A;  1BI3 A;  2QQS A;  3MEA A;  4M77 E;  2QYZ A;  5A0L A;  1D09 B;  2IPO B;  2SRC A;  4KH1 B;  3I35 A;  4J9H A;  3JSC A;  4PJL A;  2DXC A;  1I1J A;  1NYF A;  1O9S A;  3WVD B;  2DL7 A;  1D0Y A;  5HCK A;  4E47 A;  3OW2 S;  3VRZ A;  4XTX A;  3TCJ A;  3A8L B;  1R77 A;  2QTX A;  1VQN T;  1M5Q 1;  1YHQ T;  1F1B B;  4JRK A;  1YI2 A;  1VQL Q;  3RER A;  4YTL A;  4DEX A;  3CD6 T;  4M7A D;  2DFU A;  3H8Z A;  4RCC A;  1NEG A;  1H92 A;  2J6K A;  2WAC A;  5GMK l;  3OYK A;  4QQ6 A;  3UA6 A;  1LOJ A;  1YIJ T;  1YJ9 T;  1AOJ A;  2KDS A;  1WHJ A;  2RHI A;  3HRT A;  2AZV A;  4FSX A;  1VQ4 A;  2AK5 A;  2V26 A;  4RTY A;  2ZCF B;  3JCM d;  2D1X A;  1WHM A;  1W1F A;  3O5Z A;  2RHX A;  5I11 A;  2YT6 A;  1Z9Z A;  2VGN A;  2JMA A;  4J8O A;  2EWN A;  3CCE A;  5GMK j;  4IUV A;  2B86 A;  1VQ9 T;  1W2B S;  2QG9 B;  1N5Z A;  5D7U A;  2RF0 A;  2HKQ B;  4EMK C;  2QEX A;  1M1K U;  1W70 A;  3I9Q A;  4RKU E;  1ZSZ B;  3TSZ A;  2RQV A;  2QGF B;  3QUI A;  2JZ2 A;  2M1H A;  4E7S A;  1KG1 A;  4FM4 B;  2LX7 A;  1RAH B;  1WNL A;  1ZA2 B;  4F16 A;  5KCO A;  4JZ4 A;  2MPX C;  2DTH A;  2P4R A;  1VQK T;  1K1Z A;  3OMG A;  5LJ3 e;  2OJ2 A;  1BU1 A;  4GLK A;  4JDS A;  2PUK B;  5FU6 C;  1NBE B;  3QZ9 B;  3HRU A;  2NUZ A;  3EG0 A;  1YBY A;  3QWY A;  1M30 A;  1UHC A;  1C0M A;  1NM7 A;  1VQN Q;  2X4J A;  4EMK B;  3OW2 A;  4R55 A;  4LDW A;  5KYU B;  2LQK A;  1SG5 A;  1C6V X;  2E6N A;  5L23 A;  2OTL A;  4JJD A;  1YJ9 Q;  1UTI A;  3RUX A;  2J06 A;  2J05 A;  4PLL A;  3R6N A;  2X4Y A;  3VUB A;  1CSK A;  2KT8 A;  2DMO A;  4AFQ C;  1VQ4 Q;  1SF9 A;  5FU6 B;  2EJF A;  5GAN 8;  5LJ5 f;  2GF7 A;  2K3Y A;  1ABQ A;  3FC3 A;  2A36 A;  2EPD A;  2OAU A;  3E1S A;  1VQM T;  5LJ5 j;  4DBH A;  3URG A;  3EGU A;  4M78 D;  2DKG A;  2O01 E;  4FCY A;  1JB0 E;  2XHC A;  2LJ1 A;  3SHW A;  4E7I A;  2CT4 A;  2M0Y A;  1K73 R;  4M75 E;  1Y96 B;  2RPN A;  2QEX Q;  1W2B A;  4J83 A;  3ULR B;  2NUT A;  3I56 A;  2BZX A;  2CP7 A;  1JEG A;  2CH4 A;  3CMA T;  5HY6 A;  4OB3 B;  1I07 A;  2MYS A;  3PMI A;  1IB8 A;  4RMO A;  2KT1 A;  2LP5 A;  3HP9 A;  3CC7 A;  3M4Y A;  2KXD A;  2KRN A;  4ELZ C;  1IRX A;  2KRS A;  2FPF A;  3MP8 A;  3RIR A;  2MF2 A;  5CQY A;  4FL6 A;  3JCM P;  5LJ5 d;  4XU0 A;  3QSU A;  3M4G A;  4J9D A;  3P8H A;  3L2Z A;  1TTH B;  3CCS A;  4HCZ A;  4O5V A;  4XK8 E;  1VYU A;  2OX7 A;  1KQS S;  2J6O A;  1NPP A;  2H3J A;  2DIL A;  4E7K A;  3ZL7 C;  3V8K A;  3OYL A;  5LJ5 g;  5KH6 A;  5L8R E;  1IZ6 A;  4P5N A;  1MUZ A;  2H8H A;  3VV0 A;  1K73 U;  2A37 A;  4PL6 A;  5LJ3 h;  3VS5 A;  3H6Z A;  2F5T X;  5GAM f;  2IIM A;  1WHK A;  4LD9 K;  3PGG A;  2LQN A;  3GIB A;  4BD3 A;  1QP2 A;  3RKX A;  2E5K A;  4AFZ C;  1RAD B;  2LC4 A;  3GNF B;  2WSC E;  4IKF A;  2RM4 A;  3G7Z A;  3S3O A;  3UF4 A;  4F17 A;  2D6F A;  4JLG A;  4BDY A;  3SEM A;  2IG0 A;  4PLI A;  2QDY B;  3EG3 A;  6AT1 B;  1KHI A;  2GBQ A;  1BCM A;  2XID A;  1PNJ A;  4M7A F;  4Z89 A;  4QQG A;  2HKN A;  2LRQ A;  2DTI A;  3NTI A;  3I56 Q;  4IUU A;  4OMF B;  1GL5 A;  2FB7 A;  3CMA Q;  3EG9 A;  2P0P A;  3CCR A;  1VYV A;  2PVG B;  4KUI A;  1T0J A;  3VS4 A;  7AT1 B;  1FMW A;  1BIA A;  4MZM A;  3RMS A;  3G71 A;  4HA8 A;  4AG1 C;  3CCJ A;  4PJM A;  4JZ3 A;  3PMT A;  3JCM W;  5GAM d;  5FRN A;  1JJ2 S;  3VRY A;  2FG0 A;  3HHT B;  2L3R A;  4M4Z A;  1VQP T;  2LTO A;  3QXE B;  3SFM A;  2CRE A;  3AT1 B;  3P8D A;  2E64 A;  4RTV A;  2D0Q B;  5GAM g;  4XTY A;  3VJP A;  1Z9Q A;  5CKH A;  4DBR A;  3LLR A;  2FPD A;  1KQS A;  1RAF B;  4AFS C;  1K9M C;  2CP5 A;  1ZX6 A;  2EYW A;  2RQT A;  3M0P A;  3JCM c;  2YUQ A;  4J6X A;  1KQ2 A;  4JRP A;  3QYG B;  1KFZ A;  4FU6 A;  2KVQ G;  1HD3 A;  5J26 A;  3UA7 A;  2LNV A;  2R5M A;  3OQ5 A;  1YJN T;  2B8A A;  2AKK A;  4N0A C;  1UEC A;  1NE8 A;  3M9Q A;  4HVU A;  3DLL A;  2ZPG B;  1X27 A;  5A0D A;  3FJP A;  1K9M R;  2X4X A;  3CME T;  4E6R A;  3OYH A;  1WX6 A;  4C0Z A;  1NJI C;  1OX9 A;  3CPF A;  3L42 A;  1IO6 A;  2FZK B;  1KSW A;  1V29 B;  1YIT T;  1D1A A;  1BKB A;  1DJ7 B;  4HVV A;  2P0Q A;  5D6X A;  3CCM T;  2RQW A;  3CCR Q;  2YRC A;  1PRM C;  1LPL A;  2QA4 A;  3CCQ T;  3G71 Q;  3JCM Q;  1XOV A;  4L5G A;  1PD1 A;  1I5O B;  4M78 F;  4A54 A;  1LCK A;  3CXC S;  1IHW A;  1SRM A;  2CP0 A;  2YLC A;  4EDU A;  4C8Q D;  4R0K A;  3EFS A;  1VQP Q;  3X28 B;  3CCV A;  2M0O A;  1JJ2 A;  2CS7 A;  1ZUU A;  2Y4Y A;  3PNW C;  2DBM A;  4NS5 A;  3EGX B;  1QVF S;  2K6D A;  1U3O A;  3TRE A;  2DAQ A;  1I0C A;  2EW3 A;  2VKN A;  1RI0 A;  2EYX A;  2QTV A;  2KQW A;  3J80 E;  4ZN1 A;  4O6J A;  5AT1 B;  1WHG A;  4ME7 A;  1K9M U;  3E2U A;  2DJZ A;  1PKS A;  1S1N A;  4HCK A;  1YJN Q;  5IXB A;  1TH7 A;  4WF2 A;  4XU3 A;  4E7Z A;  2DE0 X;  1VQ7 A;  4QQD A;  1ZSZ A;  2AZS A;  2PUO B;  1QVP A;  5GMK h;  2LDM A;  4M7A C;  4C5H A;  1FWZ A;  1OPK A;  4ZGJ B;  4A53 A;  3OYF A;  4KGV B;  4PK4 A;  1YIT Q;  3CCM Q;  4FT2 A;  2QQA A;  4HCB A;  3HSB A;  4FT4 A;  3A8M B;  4OMO A;  2JOY A;  1TS9 A;  4TVR A;  2DNU A;  4J5Y A;  3CCU T;  2QA4 Q;  3VUZ A;  3CCQ Q;  2LMJ A;  3FDR A;  4C5I A;  4J7F A;  1M4Z A;  4GLM A;  3CPW P;  4EMK A;  2H3E B;  1FMK A;  5KYU A;  1N8R U;  4HCC A;  4M7A B;  4J9E A;  1BK2 A;  4XU2 A;  5GAM e;  1KQ1 A;  3M57 A;  3C0C A;  1FYN A;  3CCV Q;  3CXC A;  1UGP B;  4F7U F;  2RJC A;  1Q7Y R;  1GFC A;  3NHN A;  2R57 A;  2VV5 A;  1VUB A;  5KCH A;  2RN8 A;  1HJD A;  2F2W A;  3X24 B;  1QVF A;  9ATC B;  2RJF A;  1ZHI A;  1NPR A;  2PZ1 A;  2NYS A;  2ZZD A;  3V7S A;  3EFO B;  1VQL A;  4BI8 B;  4F14 A;  2DIQ A;  2JS0 A;  1OV3 A;  1Y96 A;  5LJ5 h;  1BCO A;  5GAN 7;  2CKK A;  1XJW B;  2Y4X A;  2E10 A;  2LCC A;  3MO8 A;  4BE1 A;  2K5F A;  3ZEH A;  1Y07 A;  4M7A G;  5IXF A;  2KY9 A;  4XTV A;  4NOY A;  1H3Z A;  2DET A;  4DEY A;  3VS3 A;  3VS6 A;  1NYG A;  2AKL A;  1JU5 C;  1VA7 A;  4GBQ A;  4QVD A;  1OU8 A;  5DM7 R;  1M27 C;  3OMC A;  3I5S A;  3NTH A;  3PIO A;  1T0H A;  3OYE A;  3OYN A;  3CCU Q;  2DK3 A;  2MAM A;  5LL6 S;  5CK9 A;  1MMD A;  1X43 A;  1Q7Y U;  4JS5 A;  2BE7 D;  1M3B A;  4M78 C;  1JQQ A;  2SEM A;  1RUW A;  2P0K A;  1M1F A;  4QKU A;  2OTJ T;  4FIB A;  2DL3 A;  3LGL A;  2FZC B;  2ZPI B;  4RG2 A;  4BUG A;  1EFN A;  2HCK A;  1AVZ C;  4C5E A;  1Q82 C;  2EJG A;  4PJN A;  1IGU A;  3LWI A;  2L0A A;  3LH0 A;  2EQK A;  2E41 A;  2JM8 A;  5EG2 A;  1QWF A;  1K8A U;  1VQN A;  1YHQ A;  2PVD B;  4X9C A;  4M78 B;  3CD6 A;  3C4S A;  2VXF A;  2O31 A;  2O9V A;  4OMQ A;  3HTR A;  2X4W A;  5GAM h;  1YIJ A;  1YJ9 A;  3H9N A;  1MND A;  3QDF A;  2ABL A;  1MMN A;  1ZSZ C;  1YCY A;  2K3X A;  4C8Q F;  1M9S A;  5GAN 4;  5EC7 A;  1PCX A;  2DD5 A;  2DRK A;  4AFU C;  2ZGW A;  1Q86 U;  1TSF A;  1QQJ A;  3OBY A;  2EYZ A;  1M90 C;  2CZ6 B;  3EAE A;  2M51 A;  4C0G A;  3F70 A;  3L1A A;  1VQ9 A;  3JCM g;  2E3I A;  2KYB A;  4MZP A;  5GMK i;  1O75 A;  4M78 G;  4M7D D;  1A0N B;  2YHT A;  1TU0 B;  2EKH A;  2P4T A;  3N5B B;  1UDL A;  1VQO T;  1H8K A;  1OZ3 A;  2OTJ Q;  2QK0 A;  3QG1 A;  1WZO A;  1MMA A;  3RR6 A;  3QWX X;  1M90 R;  1I81 A;  3LX7 A;  1VQK A;  1GCP A;  2KNB B;  4AMC A;  1SRL A;  4Q5W A;  1TOV A;  5FWB A;  3JV3 A;  4QW2 A;  2ED0 A;  3VU3 C;  2EYQ A;  1AT1 B;  1YHQ Q;  1YNZ A;  3JCM b;  3CD6 Q;  5DLO A;  2PQW A;  4ZGE B;  4ZN3 A;  2ZPH B;  1VQ6 T;  2E6Z A;  1YJW T;  1WDX A;  3X20 B;  4WTO B;  3U23 A;  1YIJ Q;  1M8M A;  2RD1 A;  2JM9 A;  5CR2 A;  3QKJ A;  4V2S A;  2HQE A;  4F7U B;  2F2V A;  1PKT A;  4BI4 A;  5GAO m;  2JT4 A;  1Y71 A;  1AWW A;  1I5L A;  2DBK A;  1WGS A;  1RAA B;  2EGE A;  1YCS B;  3BY7 A;  4LUD A;  1Y0M A;  1D3B B;  3BW1 A;  1VQM A;  2A7Y A;  5CKD A;  1D0Z A;  2GGR A;  1Q95 G;  1Q81 C;  3S3N A;  4BAC A;  4N0A A;  3WXM B;  1M90 U;  2K79 A;  5CVI A;  1BBZ A;  1UHF A;  1VQ9 Q;  5J39 A;  5KYX B;  3M0U A;  4Z88 A;  1ARK A;  4JPB W;  2DD4 A;  3V7R A;  1PG5 B;  2YWW A;  4XTZ A;  2F5K A;  5M9O A;  1D0X A;  3CCL T;  1HXD A;  2BUD A;  1B34 A;  3GNG A;  5I2S A;  2E1H A;  3EGX A;  3CMA A;  1Q81 R;  1VQK Q;  3E9G A;  1BI0 A;  4B6M A;  2X3W D;  2DZ9 A;  2QGG A;  4C92 F;  3JAM E;  2XKO C;  3HFN A;  2BE9 B;  1WLP B;  2J7I A;  4X34 A;  3OYD A;  5GJW B;  1V76 A;  1CKB A;  3DB3 A;  5FLX E;  2V1Q A;  2R58 A;  3L2U A;  1K0X A;  5GAN f;  5CAI A;  5CCA A;  3P8B B;  2M9U A;  1G2B A;  1ZUK A;  3SWN B;  1VQ8 T;  5GAN j;  2L3S A;  2FZG B;  1UGV A;  2LJ0 A;  3JB9 D;  1S72 T;  4FYX B;  4C8Q C;  1LJO A;  1FMV A;  2FHD A;  4XTW A;  3JCM e;  1ZQ1 A;  4C5G A;  1VQM Q;  2CZ1 B;  3G6E A;  3G6E T;  2F69 A;  3MHX A;  1AWX A;  2E70 A;  1UFF A;  3DLM A;  2DM1 A;  2L2P A;  3OYY A;  5I21 A;  1X69 A;  1OI1 A;  2ECZ A;  2VUB A;  1JXO A;  4IUR A;  3PIP A;  2AT1 B;  4M7A A;  5FU7 C;  4WCI A;  4RTU A;  4Y91 A;  2A28 A;  3TVT A;  4ZGD B;  5KYY B;  2E12 A;  2HQX A;  4C8Q B;  5KYW B;  2RI2 A;  2BTT A;  3X25 B;  2XMF A;  3M54 A;  3UWN A;  4KH0 B;  2MCN A;  3PVQ A;  3PT9 A;  3MEV A;  1MGQ A;  2EVR A;  3G4S A;  3G4S T;  3TSW A;  2CP2 A;  2RI5 A;  4M7A E;  2EJ9 A;  3EGD B;  1ZUY A;  5GAN d;  1EZZ B;  4J9I A;  1M2V B;  3EHQ A;  4OB1 B;  2HSE B;  3JCM V;  1K76 A;  3EFO A;  3S6W A;  4PJO F;  2RQU A;  3VS2 A;  1FX7 A;  5FU7 B;  4BE0 A;  5GAN g;  4LD6 A;  4CI0 C;  1VQP A;  1U1T A;  2KBT A;  4RG8 A;  4M7D F;  4PNO A;  2NUP B;  5GMK e;  2DRM A;  3C95 A;  4F04 B;  1VQ8 Q;  4IUP A;  2D8H A;  1K4U S;  2HL5 C;  1MHN A;  1S72 Q;  3KUF A;  3RES A;  4C8Q G;  1KC8 C;  3OYM A;  2MWO A;  1WJQ A;  2RO0 A;  3JCM J;  1X6O A;  2GFA A;  4RUG A;  2L3Q A;  4A4H A;  4PFO A;  4E7J A;  3G6E Q;  1VOM A;  2LQ8 A;  3KXT A;  1W6X A;  2L5Q A;  4ZNX A;  4ELY C;  4CC3 A;  2RB6 A;  1YJN A;  1GRI A;  3C94 A;  1G8X A;  2RHZ A;  1WIE A;  3CBP A;  5HK0 A;  3NFC A;  1KHC A;  5ECA A;  2K3B A;  2DER A;  4KBM B;  4M77 D;  2LZ6 B;  4OMN A;  4EMG A;  1KC8 R;  2QAS A;  3CME A;  2JS2 A;  1JO8 A;  2RNA A;  1KD1 C;  3L2Q A;  1B7T A;  3OYI A;  3ME9 A;  8ATC B;  3QDR B;  3G4S Q;  1YIT A;  2JW4 A;  2X35 A;  3CCM A;  3M0T A;  2HNI A;  4N4I A;  3TQ7 P;  3JCM h;  2NLU A;  1QKW A;  3A98 A;  4FW2 A;  2HD0 A;  3M5A A;  2DA9 A;  1IRE B;  4CC2 A;  4IIO A;  2ZAE A;  4RCB A;  5CKB A;  4C92 C;  1PD0 A;  3M0Q A;  1Y7X A;  3CCQ A;  2LVM A;  4J7I A;  2HEQ A;  4M78 A;  2CT3 A;  2DO3 A;  3RDV A;  1KD1 R;  2FEI A;  4D8K A;  2YUN A;  4DQ2 A;  2FO0 A;  1X2Q A;  3HL8 A;  1NJI R;  5LJ5 e;  2C06 A;  4M75 B;  2EGA A;  2DYI A;  2DL4 A;  1BYM A;  2QI2 A;  2F1L A;  4M78 E;  1I4K 1;  3UDC A;  1B34 B;  3BE3 A;  3WVE B;  4KUD K;  3DKM A;  1E6G A;  1SEM A;  2E3H A;  5C0M A;  2RH2 A;  1YWO A;  3VYH B;  3RKY A;  2EAY A;  3Q1J A;  4C92 B;  1KC8 U;  3AHU A;  3LWH A;  4OVA A;  3GOX A;  2DTO A;  4J6W A;  5KE2 A;  1PSE A;  4A4E A;  4KGZ B;  2HBP A;  2CZ7 B;  3I55 T;  3PE0 A;  1OEB A;  4PFP A;  2KGT A;  2KK4 A;  2K57 A;  5GAO n;  1UGQ B;  2KR3 A;  4MDX A;  3DB4 A;  2RJE A;  2C0T A;  2V1R A;  2KRO A;  3CC2 T;  2LNH B;  3REA B;  3CME Q;  2YSQ A;  3RBB B;  4FSS A;  4DA4 A;  5FRO A;  3REB B;  5LJ3 f;  1G3W A;  1TG0 A;  2FPE A;  1QVG P;  1T3S A;  4LDV A;  1X75 C;  1NJI U;  3CPW S;  1HYO A;  5LJ3 j;  2GFU A;  1HK9 A;  1G5V A;  3JB9 F;  2CSI A;  2KSS A;  2LCS A;  3GP8 A;  3V8L A;  1QP3 A;  2YRD A;  3OB9 A;  3CCU A;  1AZG B;  2HL3 A;  2CUB A;  3CQT A;  4OGC A;  2M16 A;  1ZBX A;  1UGS B;  1QMC A;  1ZBJ A;  4UC4 A;  4IUT A;  2XDB A;  1E7O A;  4PJO C;  4FYW B;  3L2V A;  1NLP C;  3LGF A;  2K5L A;  2MOX A;  1WJS A;  2LT1 A;  4DBQ A;  3CC4 T;  1UEB A;  2ROL A;  3ZFJ A;  3MEW A;  1YN8 A;  1AWJ A;  5A2Q E;  4M7D C;  2E65 A;  2FL7 A;  4F7U A;  3QO3 A;  1TUD A;  1V1C A;  2JXB A;  2MI6 A;  2XG8 D;  3VS7 A;  3A5Z B;  2C0I A;  1U5S A;  2KRM A;  1WYX A;  2EFI A;  5GAO l;  1YP5 A;  1D3B A;  5HKC A;  5KYN A;  1D1B A;  3THK A;  2JTF A;  4F7U E;  2ZPE B;  1K0S A;  3I55 Q;  5CKF A;  2BIV A;  4PJO B;  1X2K A;  2K9G A;  5LJ3 d;  5FRM A;  4DBF A;  5KYX A;  2HZY A;  1W4S A;  4M75 D;  2V8K A;  1XQH A;  3VS0 A;  2EQI A;  1U1S A;  2YLB A;  1T3L A;  4M7D B;  4KT0 E;  3EH2 A;  3OYC A;  1B3Q A;  2DVE A;  3BDL A;  3VS1 A;  5IHN A;  3MP6 A;  4OMM A;  1N9S A;  2QQR A;  2E5Q A;  2XDP A;  4C92 D;  4R56 A;  1VQ5 T;  4A4G A;  4ZTJ A;  2GTJ A;  1P92 A;  1PWT A;  4PJJ A;  3PFS A;  1RLQ C;  1CKA A;  2AHJ B;  2YDL A;  1SSF A;  4II1 A;  2ZPB B;  3O8V A;  1FXX A;  1RAB B;  3A8O B;  2JTE A;  3CPW A;  1E6H A;  1UE9 A;  3M59 A;  2G6F X;  1N6A A;  2CUD A;  2XI9 A;  2GCX A;  2D9T A;  3VKI A;  2K5I A;  2CZ0 B;  4ESR A;  4LDU A;  1D1C A;  2OTJ A;  4XAX B;  2RHY A;  1Y57 A;  1OYX A;  2DF6 A;  1UJ0 A;  2CYZ B;  3OY9 A;  3SWN A;  2ZPF B;  4M7D G;  3OS0 A;  3CEY A;  4M77 F;  2ESW A;  2L8D A;  5D6Y A;  2E4H A;  4LNP A;  2CP6 A;  1QCO A;  4JJC A;  1M1K C;  3EFR A;  3TEE A;  4E7L A;  1JBM A;  2L3P A;  2MMP A;  1X6B A;  5CO7 A;  3GBQ A;  5GAN h;  1TUC A;  2PTK A;  1WA7 A;  1WXT A;  2O4X B;  4PFZ A;  2R5A A;  4MMK A;  2DXT A;  2JNG A;  2JUF A;  1RAC B;  3HFO A;  3MP1 A;  2HDA A;  1Q82 R;  2KAF A;  1M1K R;  4OMP A;  1NZ9 A;  5AYF A;  2LT4 A;  4AG2 C;  2DL8 A;  2JJ9 A;  1WXU A;  1B07 A;  5KYW A;  5KYY A;  3EG2 A;  1GCQ C;  4C8Q A;  1ACM B;  4NL2 A;  1PM3 A;  1YI2 T;  4LDX A;  4ORZ A;  1AD5 A;  3OW2 P;  2JTM A;  4LDY A;  1LNX A;  4Y28 E;  3RMQ A;  1VQ5 Q;  1RL2 A;  1TUG B;  4J9F A;  1UG1 A;  2J6F A;  3EGD A;  1J3T A;  2RQR A;  1M2V A;  4C8Q E;  4PJO D;  4JUV A;  2EQJ A;  4IUQ A;  2XD0 A;  5KE3 A;  3UPU A;  1OZ2 A;  5GAN 6;  3OYJ A;  1VQ4 T;  2Z0W A;  2HMA A;  3GF5 A;  4BB7 A;  1NG2 A;  3OYG A;  3QYH B;  4LXC A;  1VQO A;  1IGQ A;  4RTW A;  4K11 A;  2KEA A;  1SHF A;  2NUP A;  4BDZ A;  4XQ3 A;  2DLP A;  3CCE T;  3UT1 A;  2F2X A;  1WXB A;  4E2F B;  3C12 A;  1QKX A;  3OYB A;  1Q82 U;  3NTK A;  2O2O A;  3EH1 A;  4ANJ A;  3EG1 A;  5I2M A;  2QEX T;  4KUL A;  1OX8 A;  3OS2 A;  1W2B P;  2WSF E;  3OBW A;  2CGH A;  3MKD A;  3J7A F;  5GAO r;  5GAN 2;  1C1A A;  4MDW A;  2PVO B;  3NGP A;  1MNE A;  3QBY A;  1HSQ A;  4Z8A A;  1SKU B;  1VQ6 A;  2RJD A;  5FWC A;  2YUO A;  4D8D A;  1YJW A;  1VIE A;  1PSF A;  3LYI A;  2VVK A;  5GAO p;  2COZ A;  2P84 A;  4OF1 A;  2YXY A;  3GPL A;  2OI3 A;  1XNI A;  3KBG A;  1YFN A;  2HSP A;  2ATC B;  1OQK A;  3INZ A;  1YI2 Q;  2DXU A;  2EQM A;  3H0F A;  2YRV A;  3A8H B;  4VUB A;  3ZBD A;  2QDL A;  2MWP A;  3VYG A;  1MMG A;  2DZC A;  3TU4 K;  2OTL T;  1OOT A;  3A1P A;  3JB9 G;  1WFW A;  4EIK A;  1ZA1 B;  2QXF A;  4OGE A;  1K73 C;  3H41 A;  3J81 E;  5GJV B;  5DLQ E;  5DY9 A;  1WQW A;  2KMT A;  1NLO C;  2FYK A;  1QCN A;  1VQO Q;  4M75 A;  3CCL A;  3M0R A;  1AWO A;  4M75 F;  3PTA A;  1G3S A;  4B9W A;  3CCE Q;  2DPP B;  4JJB A;  2VC8 A;  3X26 B;  3OA6 A;  3I5R A;  4M77 C;  2VWF A;  3SWN C;  4F7U G;  2DVJ A;  1M3A A;  3FB9 A;  2BKD N;  2V8J A;  4CRI A;  2JVV A;  2EBP A;  4C92 A;  2GQI A;  4A63 B;  2M02 A;  3CBM A;  4CC4 B;  5IHI A;  3I56 T;  1M3C A;  1G3Y A;  2L89 A;  3RKW A;  3LW5 E;  1VQ6 Q;  4C92 E;  3JB9 I;  1YJW Q;  1U06 A;  2CH4 W;  4J6Y A;  2GTO A;  3CC7 T;  1BIB A;  4FYY B;  3JCM X;  4HT9 A;  2D0N A;  2MIO A;  2O9S A;  2CDT A;  1G83 A;  1QLY A;  4QVZ A;  1ZLM A;  4M77 B;  1WHL A;  1VQ8 A;  5GAN 5;  4OB0 B;  3E19 A;  2Y90 A;  2PU9 B;  1S72 A;  1KJW A;  2HBW A;  2XU8 A;  1M1G A;  5IH2 A;  3CBO A;  1PRL C;  1AEY A;  3MCA B;  3CCS T;  1WHH A;  2OTL Q;  3HKS A;  3MEU A;  5IT9 E;  1PC0 A;  3BDU A;  3OSV A;  3OYA A;  4ATO A;  2XK0 A;  1Q81 U;  1M8V A;  4DOV A;  5J3B A;  1KQS P;  4C0F A;  4D6W A;  3CCL Q;  1GBR A;  3OSS C;  4HT8 A;  4LUE A;  3H0H A;  5GAM j;  4HVW A;  3SB2 A;  2DX1 A;  4EMH A;  4ZTF A;  2RHU A;  1YWP A;  5GMK m;  1R8O B;  1PHT A;  4M77 G;  4BE2 A;  4JS4 A;  1N27 A;  3MPU B;  3IQL A;  2KE9 A;  3QZ5 B;  3GLX A;  5GAO q;  2VYT A;  2VAS A;  2QAZ A;  4PJO A;  2HAX A;  1IHV A;  4BY6 C;  4KRT A;  2HQH A;  3R6O A;  3SDZ A;  1JRI A;  2I0N A;  3CCR T;  2EQU A; 
#chains in the Genus database with same CATH homology
 3REA B;  1ABQ A;  2A36 A;  2YSQ A;  3RBB B;  4FSS A;  2EPD A;  3REB B;  1TG0 A;  2FPE A;  2L0A A;  1RLP C;  5I22 A;  3EGU A;  1T3S A;  2JM8 A;  2LJ1 A;  3SHW A;  1QWF A;  2CT4 A;  2CSI A;  2LCS A;  2M0Y A;  2EYY A;  1AZG B;  2W0Z A;  2CUB A;  2O31 A;  2RPN A;  2O9V A;  3CQT A;  4HXJ A;  4OMQ A;  1ZBJ A;  2W10 A;  1E7O A;  1ZSG A;  3ULR B;  1NLP C;  2RMO A;  2MOX A;  2BZX A;  2DYB A;  4QT7 A;  1JEG A;  2ABL A;  2CH4 A;  2ROL A;  1YN8 A;  1I07 A;  3EHR A;  1AWJ A;  1WI7 A;  2KT1 A;  2LP5 A;  5EC7 A;  2KXD A;  2DRK A;  4AFU C;  1TUD A;  2KRN A;  1V1C A;  1GBQ A;  2KRS A;  2JXB A;  2FPF A;  2A08 A;  3VS7 A;  2NWM A;  2EYZ A;  2C0I A;  2K2M A;  1U5S A;  2KRM A;  4CC7 A;  1KIK A;  1WYX A;  1YP5 A;  2M51 A;  1K9A A;  3THK A;  4J9D A;  1K0S A;  2YUP A;  4OML A;  3NMZ C;  2KYB A;  1X2K A;  2JMC A;  2K9G A;  1A0N B;  2EKH A;  1VYU A;  4Y92 A;  1UDL A;  1H8K A;  2J6O A;  4LN2 A;  3VS0 A;  2ED1 A;  2EQI A;  2DIL A;  3ZL7 C;  4RTX A;  1T3L A;  1MUZ A;  2H8H A;  1OPL A;  1B3Q A;  2KYM A;  2A37 A;  3VS1 A;  3QWX X;  5IHN A;  3VS5 A;  4OMM A;  4J9G A;  2IIM A;  3RNJ A;  1GCP A;  2KNB B;  2LQN A;  1SRL A;  1ABO A;  2E5K A;  4AFZ C;  2O88 A;  5FWB A;  2ROT A;  3JV3 A;  2ED0 A;  2GTJ A;  3UF4 A;  1PWT A;  4F17 A;  1RLQ C;  1CKA A;  2YDL A;  3SEM A;  1YNZ A;  1MV3 A;  2JTE A;  3EG3 A;  1E6H A;  1UE9 A;  2GBQ A;  2K7A A;  2G6F X;  1WDX A;  2CUD A;  1PNJ A;  4Z89 A;  1SHG A;  3U23 A;  1M8M A;  2JM9 A;  4ESR A;  2ENM A;  1GL5 A;  1Y57 A;  2EGC A;  2DF6 A;  1UJ0 A;  2F2V A;  1PKT A;  1GCQ A;  1VYV A;  2JT4 A;  1AWW A;  2ESW A;  1T0J A;  1X6G A;  3VS4 A;  2DBK A;  4LNP A;  2EGE A;  1NEB A;  2OAW A;  1YCS B;  4JJC A;  4LUD A;  1Y0M A;  2LQW A;  2BZ8 A;  3NPF A;  2GGR A;  2L3P A;  4AG1 C;  3H0I A;  4JZ3 A;  1X6B A;  2K79 A;  3GBQ A;  1BBZ A;  1TUC A;  1RI9 A;  1UHF A;  2PTK A;  3M0U A;  1WA7 A;  4Z88 A;  1WXT A;  1ARK A;  4JPB W;  3VRY A;  2FG0 A;  4M4Z A;  4X1V A;  2X3X D;  1SSH A;  2CRE A;  2HDA A;  2GNC A;  2CSQ A;  4OMP A;  4RTT A;  4RTV A;  4AG2 C;  2DL8 A;  1Z9Q A;  1QCF A;  1UJY A;  1WXU A;  2FPD A;  1B07 A;  3EG2 A;  1GCQ C;  4AFS C;  1ZX6 A;  2EYW A;  2RQT A;  3M0P A;  2YUQ A;  4ORZ A;  2D8J A;  2X3W D;  1AD5 A;  1BB9 A;  1KFZ A;  2C0O A;  4J9F A;  1UG1 A;  2J6F A;  1HD3 A;  3UA7 A;  2PNI A;  1J3T A;  1VYT A;  5FW9 A;  2RQR A;  1WLP B;  2J7I A;  2AKK A;  1UEC A;  5GJW B;  4LE9 A;  2DJQ A;  4HVU A;  1CKB A;  2FRY A;  2V1Q A;  3KFV A;  1X27 A;  1NG2 A;  1K0X A;  4J9C A;  1QWE A;  1JXM A;  1MV0 B;  4E6R A;  1WX6 A;  3M0S A;  1GFD A;  2KXC A;  1G2B A;  1ZUK A;  4RTW A;  1IO6 A;  3LH5 A;  3FJ5 A;  2KEA A;  1KSW A;  4K11 A;  1SHF A;  2L3S A;  4HVV A;  1UGV A;  2LJ0 A;  2DLP A;  2RQW A;  5IHK A;  1AZE A;  2F2X A;  1WXB A;  1PRM C;  1QKX A;  4IIM A;  2O2O A;  3EG1 A;  1AWX A;  1UFF A;  1XOV A;  2DM1 A;  2L2P A;  1LCK A;  2BZY A;  1X69 A;  1SRM A;  3NGP A;  2ECZ A;  1HSQ A;  4R0K A;  4Z8A A;  1JXO A;  5FWC A;  2YUO A;  1SPK A;  4D8D A;  3PVL A;  4WCI A;  4RTU A;  2FRW A;  2VVK A;  1ZUU A;  2A28 A;  2DBM A;  3TVT A;  2BTT A;  1U3O A;  2K6D A;  2XMF A;  1I0C A;  2EW3 A;  2VKN A;  2MCN A;  1UUE A;  3PVQ A;  2EYX A;  2OI3 A;  2EVR A;  1H3H A;  2HSP A;  3TSW A;  3UAT A;  2DL5 A;  4J9B A;  2LJ3 A;  1ZUY A;  3H0F A;  4J9I A;  3EHQ A;  2QDL A;  4RTZ A;  1K76 A;  1PKS A;  1OOT A;  1S1N A;  4HCK A;  5IXB A;  1WFW A;  4EIK A;  2RQU A;  3VS2 A;  2DE0 X;  3H41 A;  2SRC A;  5GJV B;  2AZS A;  3I35 A;  1NLO C;  4J9H A;  2KBT A;  1OPK A;  1I1J A;  2DRM A;  1NYF A;  3M0R A;  1AWO A;  2D8H A;  2DL7 A;  1K4U S;  5HCK A;  3VRZ A;  4JJB A;  4OMO A;  3I5R A;  2VWF A;  4RUG A;  2DNU A;  2L3Q A;  2DVJ A;  4DEX A;  1M3A A;  2EBP A;  2LMJ A;  2GQI A;  4GLM A;  1NEG A;  1W6X A;  4A63 B;  1H92 A;  2J6K A;  4ZNX A;  4CC3 A;  1GRI A;  1FMK A;  3UA6 A;  4CC4 B;  5IHI A;  1AOJ A;  1WIE A;  4J9E A;  1BK2 A;  1M3C A;  2AZV A;  5ECA A;  2K3B A;  3C0C A;  2AK5 A;  1FYN A;  2LZ6 B;  4OMN A;  1U06 A;  2CH4 W;  4RTY A;  2GTO A;  2D1X A;  1JO8 A;  2JS2 A;  2RNA A;  1W1F A;  2D0N A;  2MIO A;  1GFC A;  2O9S A;  2CDT A;  1G83 A;  1QLY A;  3NHN A;  2YT6 A;  3O5Z A;  1Z9Z A;  5I11 A;  1ZLM A;  2JMA A;  2RN8 A;  1HJD A;  2JW4 A;  3M0T A;  2F2W A;  1KJW A;  2HBW A;  1QKW A;  2B86 A;  5IH2 A;  2PZ1 A;  1N5Z A;  3A98 A;  1PRL C;  2DA9 A;  1AEY A;  4CC2 A;  4IIO A;  4F14 A;  2RF0 A;  3M0Q A;  2JS0 A;  1W70 A;  3I9Q A;  1OV3 A;  2HEQ A;  2CT3 A;  3TSZ A;  2RQV A;  2FEI A;  4D8K A;  2YUN A;  2FO0 A;  1X2Q A;  2EGA A;  2LX7 A;  2DL4 A;  4F16 A;  5IXF A;  4JZ4 A;  2P4R A;  1K1Z A;  2OJ2 A;  1GBR A;  1BU1 A;  4LUE A;  3H0H A;  1E6G A;  4HVW A;  4DEY A;  3VS3 A;  2DX1 A;  1SEM A;  2NUZ A;  3EG0 A;  3VS6 A;  1NYG A;  2AKL A;  3QWY A;  1YWP A;  1JU5 C;  1VA7 A;  1M30 A;  1YWO A;  4GBQ A;  1UHC A;  1NM7 A;  1M27 C;  1PHT A;  3I5S A;  1T0H A;  3IQL A;  1X43 A;  2KE9 A;  1M3B A;  5L23 A;  3PE0 A;  1OEB A;  2KGT A;  4JJD A;  1JQQ A;  2SEM A;  1UTI A;  1RUW A;  2J06 A;  2KR3 A;  2J05 A;  3R6N A;  2DL3 A;  1CSK A;  4KRT A;  2C0T A;  2KT8 A;  2DMO A;  4AFQ C;  2V1R A;  1EFN A;  2HCK A;  2I0N A;  2KRO A;  1AVZ C;  2LNH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...