1YN8A

Sh3 domain of yeast nbp2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
59
structure length
59
Chain Sequence
GQRAVALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAP1-binding protein 2
publication title Structural analysis of the yeast SH3 domain proteome
rcsb
source organism Saccharomyces cerevisiae
molecule tags Unknown function
total genus 11
structure length 59
sequence length 59
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1yn8A00
1PHTA 1KFZA 1PRMC 1GCPA 1AWJA 1TG0A 2X3XD 3EHRA 1M30A 2MCNA 4RTVA 1PKSA 1YWOA 2RF0A 4Z89A 2LP5A 1AWWA 2AKLA 1AZGB 2DBKA 3M0RA 1MUZA 1ZLMA 1YCSB 2FRYA 2KXDA 1K76A 2DX1A 2G6FX 3UF4A 3EG3A 4J9CA 2H8HA 5IXFA 1V1CA 2LJ1A 2AZVA 2K2MA 1UTIA 4OMQA 3KFVA 3I5SA 2YUQA 1WLPB 2CT3A 1JXOA 3ZL7C 1HJDA 2A36A 2GQIA 1FMKA 1KJWA 1NYFA 2YUOA 4OMNA 1GFDA 4RUGA 1K0SA 1T0JA 2HBWA 1AWOA 3NPFA 3QWYA 4J9BA 4OMMA 2D8JA 1JU5C 3EG2A 2O2OA 2YT6A 1X69A 2BZYA 4CC4B 4F14A 2JT4A 2W0ZA 1VA7A 4AFSC 2DL7A 2ED1A 1AWXA 2EYYA 2GTOA 1J3TA 1MV3A 4ORZA 1I0CA 4ESRA 1UGVA 2KNBB 5IHNA 1UG1A 2CH4W 3SHWA 1UECA 2ROLA 2KBTA 2RPNA 2DL3A 2JW4A 3NHNA 1U06A 4JZ3A 2KXCA 5EC7A 1AZEA 1JO8A 2LMJA 4F17A 1NLPC 2YUPA 1W1FA 2DNUA 1RI9A 2MOXA 2GGRA 1ZUKA 3VS7A 1KIKA 3PVQA 2RQVA 1Y57A 2GTJA 3VS4A 4IIMA 1WYXA 1OPKA 4J9DA 1PKTA 1OPLA 2NUZA 1YN8A 2LNHB 1WA7A 4HXJA 1B3QA 4JJCA 3LH5A 4JZ4A 3VS2A 2XMFA 1SHFA 4GLMA 3EHQA 2EGEA 5IHIA 1SRLA 1X6GA 2RMOA 2JMAA 2EYZA 3PE0A 2YDLA 1PWTA 2K79A 1WXUA 2V1RA 5I11A 2ENMA 1X43A 2J05A 4M4ZA 2LZ6B 1Y0MA 5GJWB 1OV3A 2P4RA 4HVWA 2J06A 1X6BA 2KT8A 2D8HA 4K11A 3M0TA 1M3CA 3TSZA 2BZ8A 3JV3A 3RBBB 1M27C 4Z8AA 3ULRB 2IIMA 1VYUA 1YNZA 4QT7A 4LUDA 2EYXA 1TUCA 3M0PA 1IO6A 2V1QA 4J9FA 2SEMA 3M0QA 2FPDA 2YUNA 2J7IA 4RTXA 2JXBA 4Z88A 1ZUUA 1W70A 5IH2A 2HCKA 1S1NA 1BBZA 1UFFA 4ZNXA 2OAWA 2EPDA 1QKWA 2D1XA 3H0IA 3VS0A 3EGUA 3RNJA 4LE9A 2C0TA 2ABLA 2KE9A 2QDLA 3H0FA 5GJVB 3UA7A 2GBQA 3EG0A 2DVJA 1SEMA 4GBQA 1U5SA 2LCSA 3PVLA 4OMPA 3VS6A 1WIEA 2EBPA 1E6HA 1QWEA 1Z9QA 1U3OA 2J6KA 4AG2C 1PRLC 4LNPA 4OMOA 1N5ZA 1T3SA 1X2QA 1SSHA 1GRIA 1XOVA 1NEGA 4JPBW 2OJ2A 2VKNA 2AK5A 4OMLA 4IIOA 4AG1C 2KRNA 1CKBA 4AFZC 1BK2A 2EKHA 4WCIA 3REBB 3U23A 1RLQC 2L0AA 5HCKA 1NM7A 4D8KA 3CQTA 3REAB 2VWFA 2L3SA 1HSQA 4DEXA 2DRKA 2FO0A 1H3HA 1KSWA 2L3QA 1B07A 1NG2A 3EG1A 2KRMA 1GL5A 1JQQA 1UE9A 1NLOC 1PNJA 2K6DA 2HEQA 3VRYA 4EIKA 2CUDA 3H41A 2B86A 4J9IA 1E6GA 1AD5A 1LCKA 2X3WD 4HVUA 2NWMA 2LQNA 2SRCA 1K0XA 4CC3A 2DYBA 1I1JA 1UUEA 2OI3A 5FWCA 4DEYA 1UJYA 3UATA 1ZX6A 2CT4A 2LQWA 3I5RA 4LUEA 2K7AA 2KRSA 2DBMA 4F16A 4D8DA 2RNAA 4CC2A 1RUWA 2W10A 1AEYA 2D0NA 1E7OA 1JXMA 2A37A 1FYNA 2C0IA 1WXBA 2RQUA 2KR3A 1W6XA 1BU1A 2F2XA 2GNCA 1OOTA 1JEGA 5ECAA 3R6NA 4HCKA 2DL5A 1I07A 1QKXA 4AFUC 2C0OA 1G83A 1M3BA 3VS5A 2M0YA 1CKAA 2ECZA 1A0NB 4JJBA 4A63B 2DL4A 1WI7A 1CSKA 2EW3A 4RTZA 1Z9ZA 1X2KA 2EYWA 2PTKA 2K9GA 1ZUYA 1WXTA 2DE0X 2FG0A 1GFCA 1M8MA 4LN2A 2RN8A 2JM8A 4J9HA 3NMZC 2DL8A 1NYGA 2L2PA 2BTTA 2DF6A 3UA6A 2M51A 1GBQA 3THKA 2KGTA 2KT1A 1WFWA 2LJ0A 3O5ZA 4RTWA 2PNIA 3M0SA 4Y92A 4J9EA 1H92A 1M3AA 1VYTA 1QCFA 2EQIA 2DRMA 1ARKA 4FSSA 3H0HA 1NEBA 3VS1A 2ED0A 3TSWA 1X27A 2MIOA 2DLPA 2JM9A 2EGCA 2I0NA 1OEBA 2CH4A 3I9QA 2F2WA 4CC7A 2JS0A 1K1ZA 2VVKA 4RTUA 3M0UA 1SRMA 1HD3A 2KYBA 5FWBA 2KROA 1K9AA 4RTYA 1VYVA 3I35A 5I22A 4X1VA 4KRTA 1GCQA 1QWFA 2EGAA 2CSIA 3SEMA 1EFNA 2LJ3A 2ROTA 1GBRA 2AZSA 3IQLA 2A28A 1BB9A 2RQTA 3TVTA 5FW9A 2FPEA 1YWPA 1ZBJA 1G2BA 2J6OA 3FJ5A 3VS3A 3VRZA 1ZSGA 2RQRA 1YP5A 4HVVA 2KEAA 1TUDA 2LX7A 2YSQA 2O31A 2J6FA 4RTTA 1SHGA 1WX6A 1T0HA 4E6RA 5IXBA 2JMCA 1AOJA 4AFQC 4J9GA 4R0KA 2HDAA 3GBQA 2F2VA 3A98A 5L23A 1ABOA 2PZ1A 1MV0B 1RLPC 2ESWA 1QLYA 5IHKA 2DM1A 2L3PA 1T3LA 2DILA 2A08A 2O9VA 1H8KA 2O9SA 1GCQC 2DMOA 1UHFA 1UHCA 2FPFA 2BZXA 4JJDA 3NGPA 2JS2A 2FEIA 2CREA 3QWXX 1WDXA 2EVRA 2O88A 2E5KA 2HSPA 2CSQA 2DA9A 1AVZC 1UDLA 2CDTA 1UJ0A 2K3BA 2RQWA 2AKKA 2JTEA 2KYMA 2CUBA 1SPKA 2FRWA 1ABQA 3C0CA 1K4US 2DJQA
chains in the Genus database with same CATH superfamily
1GCPA 1WHMA 6AT1B 4DBQA 5GAMf 3EHRA 2MCNA 3CBOA 4RTVA 1YWOA 2RF0A 5A0GA 4Z89A 1OZ3A 5GANf 4M75G 3M0RA 5GAN4 1Q82U 5FU7B 2E1HA 5LJ5d 2FRYA 5M9OA 4QQ6A 5LJ5e 3CMET 2G6FX 1VQKT 4BE2A 4E7SA 2HQEA 2K2MA 3OS1A 3KFVA 2YUQA 1OX8A 1WLPB 2CT3A 4RMOA 3ZL7C 2WSEE 1HJDA 4BI4A 2F1LA 2HZYA 4HCCA 3A8HB 3CPFA 3BW1A 1T0JA 5KYUA 3S6WA 2K5LA 4BDYA 3OBYA 3L2QA 2VV5A 4MMLA 3NPFA 4J9BA 5D6XA 4OMMA 4C92E 3S3NA 1BI1A 1ZA2B 2O2OA 2RHUA 2VYTA 4B6MA 4DBHA 2QQSA 4J6YA 4CC4B 3GPLA 3X20B 1BI2A 2D6FA 3A8MB 4BY6B 4N0AA 4E7HA 2EYYA 5L8RE 1I0CA 3VUZA 4XTWA 3M5AA 4FYXB 4PJNA 1QVFS 1UGVA 3JB9F 1UG1A 3HRSA 3SHWA 1O75A 1UECA 3JSCA 2JW4A 1U06A 4ATOA 3E19A 4AT1B 2IVWA 1RI9A 1I5LA 4M7AC 5CQXA 1KIKA 1Y57A 4IIMA 3DLLA 1Q81U 4J9DA 4C92A 1WA7A 4HXJA 3PT9A 2EYQA 3I56Q 3T9NA 3EHQA 3CPWS 3CCJT 4PL6A 4HA8A 5IHIA 1XJWB 2YDLA 1PWTA 2ENMA 2J05A 1S72Q 1X75C 1Y0MA 4MDXA 4OB0B 1R0CB 1OV3A 3CCEA 1OI1A 2KT8A 5J3BA 1IHVA 1Y96A 1YITA 3UWNA 2CGHA 4M77F 3CCUT 5GAOr 4J6XA 4LDVA 3QG1A 1LNXA 2QASA 1KC8U 3DB4A 4LUDA 3FEOA 1TUCA 3M0PA 4ZGDB 4M7AB 2HL3A 1R0BG 3M0QA 3RDVA 1BIBA 2Y90A 2RI3A 1Q82C 1ZUUA 2DO3A 3M54A 4KGZB 4NOYA 1W70A 1H3ZA 1JJ2A 4NS5A 1QP3A 2QA4T 1QVGS 2FYKA 4ZNXA 3EGDA 1XNIA 4KGXB 1F1BB 4M78C 3KBGA 4DQ2A 4C0FA 4XU0A 3CC2T 3H0FA 3OW2S 3Q1JA 1TWBA 4PLLA 2KAFA 1V76A 2XU8A 1XQHA 3VS6A 1PG5B 1U3OA 1D1AA 3PFSA 5LJ3d 5GMKl 4OGEA 5GAN7 2QEXA 1XOVA 1IZ6A 1M1KC 1VQMA 1HYOA 2DAQA 1CKBA 1M90U 4AFZC 1VQ6Q 1BK2A 2CP3A 2B8AA 4M7DG 2DEQA 3G6EA 1ZSZC 4J6WA 2BE7D 5LL6S 3DLMA 2RHXA 3JAME 2LC4A 3RUXA 2K5IA 4FIBA 1YI2T 4QQDA 1KSWA 2L3QA 3EG1A 1JQQA 1KQSP 4KUIA 4EIKA 2CUDA 3PTAA 1VQLT 2LQNA 2SRCA 3CCLQ 3FB9A 2GFAA 3FC3A 3OYCA 2DYBA 1UUEA 1Q81C 2OTJA 1U8RA 2RA2A 2CZ0B 5HY6A 1YIJQ 4PFPA 2KK4A 2CT4A 2LQWA 1RAGB 3I5RA 4KT0E 2E3IA 1VQNT 1YJ9T 2DBMA 2LT1A 2HQXA 1N9SA 2RNAA 4C8QD 4LD6A 4EMKA 1K73C 2LCCA 3QJ6A 3CCVT 1MMGA 3EFOB 2F2XA 3R6OA 1QP2A 5A2QE 4Y28E 2KDSA 1NJIU 2DPPB 3GP8A 2JJ9A 1CKAA 3HRUA 2CZ6B 1D3BB 1A0NB 1SSFA 2ATCB 3C4SA 4F7UA 1X01A 3JRZA 1JJ2P 1WI7A 1CSKA 3AHUA 3CCSA 2QAZA 1Z9ZA 1KC8R 1X2KA 2OTLQ 2QQRA 2EYWA 1X6OA 5GAOp 3HFOA 3OS0A 4M75D 2E41A 1Q7YC 3QBYA 3PIPA 3QUIA 3BE3A 4J9HA 3MEAA 5GAMd 1YJWT 9ATCB 2L2PA 3CXCA 3CMAA 5GAMe 1YHQQ 2KT1A 3F70A 2NUPB 1M4ZA 5GANd 5GANe 2DRMA 1ARKA 2LVMA 4A54A 1YJNA 2QTXA 2L8DA 3ASKA 4PJOB 1PC0A 4PKCC 2X4YA 2JM9A 3CCET 3CC4Q 2DERA 1NBEB 2FZKB 2RJDA 2RD1A 2JTFA 4DOWA 2MYSA 2MK5A 2EWNA 4F04B 2KYBA 1D1CA 1EIFA 1N9RA 2KROA 4RTYA 1VYVA 4KRTA 3SFMA 1UEBA 3SEMA 3TREA 3OA6A 1GBRA 1YFNA 3CCRT 1W4SA 2A28A 1BB9A 2VXFA 3TVTA 4E7IA 1TSFA 4OB3B 4XAXB 1G2BA 2BIVA 2COZA 4RCBA 4XU2A 2QXFA 3KXTA 2QTVA 2QDYB 4PJLA 3CMEA 1VQKA 2J6FA 1VQ7A 4FL6A 4E6RA 2WSFE 4M7AF 5I2SA 4B9XA 2COWA 4ZN1A 2HDAA 4PLIA 3N5BB 2MF2A 2NUTB 5L23A 2PZ1A 1MV0B 2DVEA 2M16A 4M78A 2ESWA 1QLYA 2OAUA 3C94A 3EH2A 2DILA 1GCQC 2DJZA 2LX9A 3CD6T 2A3LA 5CR2A 2BKDN 4JJDA 3CCMQ 2JS2A 2PUOB 1OU8A 1SF9A 2O88A 3NTIA 2E5KA 2G3RA 1ZA1B 1KD1R 1U1TA 1UDLA 4GY5A 1UJ0A 2K3BA 5KCHA 2JTEA 3SD4A 5CIUA 2FRWA 1WHLA 5AT1B 3C0CA 1K4US 2RO0A 4LDXA 4II1A 1PRMC 2JN0A 3CXCP 1TG0A 4GLKA 4C8QC 4BI8B 1NPRA 1AWWA 5FU6B 4A4KA 5A0LA 2DIQA 1AZGB 5KYYA 4JS5A 1M8VA 3LW5E 1B34A 1M2VA 2DX1A 5GMKm 3EG3A 2YLBA 2YRVA 4LDYA 2AZVA 5C0MA 3OS2A 4OMQA 3JB9G 1JXOA 2X4WA 1FMKA 4M78F 3CCJA 1GFDA 3HRTA 1O9SA 1PM3A 4M7AD 4M75C 1AWOA 3CCQT 1FMVA 2O4XA 4E47A 2ZPFB 3EG2A 2BZYA 3JCMQ 2JT4A 2W0ZA 4FT2A 3LLRA 4AFSC 3CCUA 1VOMA 2A0FB 1RABB 2DK3A 1J3TA 4ORZA 4J83A 5IHNA 3PMIA 1SKUB 2RM4A 3SWNC 2BUDA 5DY9A 5C6SA 2EJFA 4TVRA 2RJCA 1UGPB 4JZ3A 5EC7A 1AZEA 2RJEA 1JO8A 2LMJA 2XDDA 2FZCB 2XKOC 2GGRA 3OB9A 2QA4A 2GTJA 5LJ3j 3VS4A 3EAEA 3CC7Q 5CKFA 1OPKA 3RR6A 3CC2A 2NUZA 4JJCA 5GAN5 3VJPA 2MWOA 3OBWA 2RI5A 4GLMA 5I21A 2CKKA 5CKEA 3LGLA 1X6GA 2RMOA 2EYZA 1WXUA 2V1RA 3CEYA 3OMGA 1N8RC 2YXYA 5CCAA 5GJWB 3MP6A 4HVWA 3G4ST 1X6BA 4R55A 2PVGB 2DKGA 5HK3A 4C92G 1VIEA 3SWNB 3JV3A 4LXCA 2V8KA 4WTOB 1YNZA 4X34A 2LTOA 3OYNA 5GAN6 2ZZDA 4BY6C 1VIFA 4M77E 3MJXA 3M56A 3L2WA 4PNOA 2FPDA 3M55A 1YI2A 2E70A 2J7IA 4A4GA 2JXBA 2MPXC 3TEEA 2AIRB 2RK2A 1VQ7T 2DZCA 1VQ5Q 3QYGB 1VQLA 1UFFA 2V8JA 5GMKe 3G71T 4C5IA 1QKWA 4OB1B 2D1XA 4FU6A 4LE9A 2EKOA 2C0TA 2QDLA 2D0QB 2DXCA 5GJVB 3UA7A 3QDFA 1HXDA 1VQNA 1I8FA 1SEMA 2DD4A 1YJ9A 4FCYA 1WIEA 1FX7A 2EBPA 1Z9QA 3URGA 4AG2C 4DA4A 2K3XA 4OMOA 1T3SA 3JCMh 1VQ9T 1Q86R 5KE2A 4ZGEB 1SSHA 3QKJA 3CPWA 4JPBW 3CCVA 1VQOT 4X9DA 2JVVA 4AG1C 1BI3A 2KRNA 4M77A 1VQPQ 1ZQ1A 1YCYA 2EKHA 4MZTA 2X35A 4E7LA 1G5VA 5LJ3h 2RB6A 2LT4A 4C5HA 2L0AA 1JBMA 3J80E 2HBPA 4D8KA 3GLXA 1TXQA 2VWFA 1SG5A 5HK0A 2L3SA 4QVZA 1HSQA 4DEXA 4FW1A 2FO0A 2QK0A 1B07A 1M5Q1 4L5GA 1UE9A 4PJOD 1NLOC 2K6DA 1MHNA 5FRMA 4IUVA 3V7SA 1VQ8T 1KQSA 1YJWA 4M7DC 4DBFA 5GAN2 4A4FA 2KY9A 3LWIA 1QVGA 3QDRB 1ZX6A 4IKFA 2R57A 2HL5C 4L59A 3OYFA 4LUEA 2H3JA 3OYMA 3BDLA 2K7AA 3MEWA 2M1HA 3GNGA 4D8DA 4WF2A 1E7OA 1JXMA 5CK9A 4J7FA 2JOYA 2A37A 3NTHA 2C0IA 2KR3A 4JRIA 1Y71A 1BU1A 3HP9A 3JCMc 2COYA 1OOTA 2XD0A 3LH0A 2C0OA 1G83A 1M3BA 3JB9H 1PSFA 3A8OB 1QVFP 4JJBA 3NFCA 4A63B 5D6YA 1VQ4T 4M7DB 4LDUA 3CCRA 2PTKA 5EG2A 2E6NA 2VGNA 1WXTA 2ZPHB 2FG0A 1M8MA 2RN8A 5D7UA 5KE3A 1IHWA 5KCOA 4C8QF 4RKUE 3RKXA 1QVPA 1GBQA 3THKA 2KGTA 2LJ0A 1UGRB 1WFWA 2E64A 2HKQB 3M0SA 4Y92A 1M3AA 4F7UG 2P84A 3JCMg 1C6VX 5GAMh 4IUQA 2VB6A 4C5EA 3H0HA 3CPWP 1NEBA 3JCMX 3CCLA 2AHJB 2ED0A 3A1PA 4EMHA 1HK9A 1JB0E 5GANh 1X27A 2XICA 1TH7A 2EGCA 4LD9K 1YITQ 2F2WA 4BE0A 2GF7A 3L42A 3CD6A 5CKBA 5FWBA 3C95A 1K9AA 2EQMA 2FL7A 4M75F 5I22A 3X28B 1NE8A 1RL2A 3ZFJA 3H9NA 5I2MA 5CKDA 3EG9A 3HHTB 2E10A 3FIFA 1KQ2A 2FPEA 4FYYB 3M59A 4AMCA 1ZBJA 2F69A 4F7UE 5GAN8 3H8ZA 2J6OA 1QVGP 3VRZA 1MMNA 2HSEB 4C0ZA 3M57A 1K8AU 3LGFA 2F5KA 3OW2P 2O31A 1SHGA 5KYXB 4KUDK 3TCJA 1QCOA 3UT1A 3X26B 2QEXQ 3V7RA 1B7TA 5DM7R 3I56T 5IHKA 5CAIA 1VQMQ 4JLIA 1KD1U 2PUKB 4PJOC 4M7AE 2O9SA 2HKNA 3G6EQ 3CCQA 1KC8C 2FPFA 3HKSA 1S72T 2XIDA 1TS9A 2WACA 2RJFA 1WDXA 2EVRA 2NLUA 2JZ2A 2AKKA 2R5MA 1D09B 3MEUA 4XU1A 4ZTJA 5KYYB 3OYHA 4M78G 3V7CA 3MPUB 4A53A 1AWJA 1K73R 4C0DB 8ATCB 1PKSA 3X24B 2AKLA 4N4IA 4PJMA 2E4HA 3CBMA 2F5TX 1ZLMA 1YCSB 1RACB 3RIRA 2LCLA 1K76A 4J9CA 2H8HA 5IXFA 4P5NA 1K9MR 2LJ1A 4M7AA 1UTIA 3QXEB 2O4XB 3I5SA 4RG8A 2JUFA 3UDCA 2A36A 2DYIA 1KJWA 2YUOA 4OMNA 3OYGA 2V8IA 4CRIA 1Q7YR 1M90C 2HMAA 1Y7XA 4IUUA 4ELYC 3QO3A 2D8JA 2Y4YA 2YT6A 2EAYA 3VYGA 3G4SA 4M78E 4A4HA 3D7SB 2C06A 1VA7A 5LJ5j 1EZZB 4VUBA 4JRKA 1VQ6T 3CCSQ 2HD0A 5CKHA 4ELZC 2P4TA 4KH0B 4B9WA 4ESRA 1WGSA 2KNBB 2CH4W 2XHCA 1BIAA 2WSCE 4JJNK 2KBTA 1W2BS 3CMAQ 2R58A 2KXCA 2E5QA 3OYJA 4F17A 1NLPC 3ZBDA 2DNUA 5FU6C 3VS7A 1YJNQ 4OB2B 3G71A 3CCLT 1IGUA 3C12A 1WYXA 1UB4A 2HAXA 1TU0B 1PKTA 1OPLA 1K8AR 1YN8A 2LNHB 1B3QA 3LH5A 1YIJT 4M7DF 1SHFA 1QW1A 1KD1C 1SRLA 1WQWA 3PE0A 2K79A 4RCCA 5I11A 2XI9A 1NJIC 2LZ6B 1VQ9A 2DXTA 2P4RA 2VC8A 2J06A 2D8HA 1VQOA 4K11A 3M0TA 1FXXA 2ZCFB 3EFRA 1IB8A 2MWPA 3OYBA 1KHCA 1M27C 4Z8AA 3ULRB 2IIMA 1LVKA 4HKEA 3EH1A 1VYUA 1VUBA 4QT7A 2EYXA 1IO6A 1ZSZA 3A8GB 2YUNA 1RAHB 3EFOA 4J7IA 2OTLT 1IXDA 3QYHB 4Z88A 3CMEQ 1VQKQ 5IH2A 2E65A 1AT1B 5KYUB 3M53A 1BBZA 4C92C 1VQ8A 1D3BA 2OAWA 2CYZB 2EPDA 5GMKi 1C1AA 5LJ5h 3S3MA 3JCMf 1GXIE 3H0IA 1YHQT 1Q86U 2KE9A 2GBQA 3EG0A 3OY9A 4M77B 4GBQA 1U5SA 3PVLA 4OMPA 1E6HA 2RHYA 4XTVA 1WHGA 3VU3C 2CZ7B 4LNPA 3RMQA 1N5ZA 1X2QA 2CP5A 4E7JA 2M02A 1GRIA 4M7DD 1NEGA 3CC4T 1KG1A 2NUPA 4OMLA 3VYHB 1IREB 4WCIA 5IN1A 3LX7A 1RLQC 3P8DA 3A5ZB 4PJOA 1OYXA 1NM7A 5CVIA 3J7AF 3CQTA 1AHJB 1PD1A 4C92B 1VQ4A 2DRKA 3KUFA 2LQ8A 1NG2A 2K3YA 2GQVA 4M77G 4IUTA 2YRCA 4LDWA 1PNJA 1M1FA 2HEQA 3VRYA 3H41A 2B86A 1LCKA 4HVUA 1OX9A 2NWMA 3A8LB 1K0XA 4QKUA 1WNLA 5FWCA 4N4HA 4DEYA 1H641 4NL3A 1Y96B 3UATA 1ZBXA 1M1GA 5FROA 3CCJQ 1LOJA 4RG2A 4F16A 7AT1B 1RUWA 2DIGA 1AEYA 2MAMA 3WVEB 1FYNA 2RQUA 5FLXE 4ZN3A 1W6XA 3MEVA 1UGQB 3OYAA 3CCUQ 1I5OB 3OYDA 5KYWA 2R5AA 2LNVA 3AT1B 5ECAA 3OYYA 3R6NA 4HCKA 3RESA 2DL5A 1I07A 4PJOF 3EGXA 4QQGA 3CCMT 4O5VA 2M0YA 2PQWA 4XTYA 1WJSA 2CZ1B 5GAOm 3EGDB 1YBYA 2NUTA 4DBRA 1N8RR 1JRIA 5DLQE 3OS5A 1QVFA 2VXEA 3WVDB 4KBMB 2EJGA 5LJ5g 1ZUYA 3L2VA 4DOVA 2QA4Q 1G3WA 4C0GA 2JM8A 3WXMB 1WHHA 5CO7A 3NMZC 2DL8A 4Y91A 3QJYA 1R77A 4IUPA 3I55Q 2P0KA 2DF6A 1BKBA 3CC2Q 2M0OA 1Q86C 3L2UA 4O6JA 2PNIA 1H92A 4J9EA 4HT8A 1QCFA 2EQIA 4FYWB 4BE1A 3OYKA 4OP0A 3FDRA 4FSSA 4EMKC 4XTUA 2X51A 3VS1A 4C8QE 4PFOA 2M9UA 1QMCA 2MIOA 3E2UA 8AT1B 2DLPA 4E2FB 2I0NA 4L6V5 3I56A 3I9QA 4CC7A 1RAEB 2JS0A 2VVKA 3OYIA 3PIOA 3MHXA 3EG9B 3MKDA 1LJOA 2RH2A 3RKYA 1S72A 5GAMj 4A4EA 3BY7A 1GCQA 1QWFA 2EGAA 2CSIA 1EFNA 1M1KU 2LJ3A 5GANj 3QHSA 4NL2A 1YI2Q 4IURA 2O01E 3OSVA 2AZSA 3QSUA 3IQLA 2MI6A 2VASA 2RQTA 1ACMB 4M75E 2E6ZA 1YWPA 1VQLQ 4QW2A 3PGGA 3JCMJ 4E7KA 3FJ5A 4C8QA 2RQRA 4EMKB 1YP5A 1FWZA 1G3SA 2KSSA 2KEAA 1TUDA 4QVCA 1VQNQ 2NYSA 2YHTA 1UGSB 1YJ9Q 4RTTA 1T0HA 2E12A 3OW2A 3CC7T 2EIFA 4J9GA 4R0KA 2K57A 2QQBA 3NTKA 3CCVQ 1ABOA 4F7UB 2XK0A 2ZPBB 3DKMA 2DM1A 1T3LA 3S3OA 2KMTA 1UHCA 2EQJA 3ER0A 4XK8E 4M75A 2FEIA 5A0DA 1K73U 3QWXX 4XQ3A 2HSPA 2CSQA 4N4GA 2DA9A 3HPWA 1AVZC 3QZ9B 3V8JA 1VQ6A 1ABQA 2AT1B 2ZPIB 2DJQA 1PHTA 4ME7A 1KFZA 2ZPEB 3CBPA 3MO8A 2LQKA 3E9FA 4JS4A 2X3XD 1M30A 1G8XA 2GCXA 3META 4BACA 3P8BB 1YJWQ 2LP5A 2A7YA 1WJQA 1K9MU 2E3HA 2DBKA 2QQAA 1KQSS 1MUZA 2XG8D 1OULA 3SWNA 4MZMA 2KXDA 1MGQA 4ZTFA 4BUGA 1I4K1 3PMTA 3UF4A 3JB9D 5GAOq 1VQ5T 3G7ZA 3M4YA 3M9QA 1Q7YU 1V1CA 3TU4K 5KYNA 1I81A 4C92F 3I55T 1Q82R 3CCEQ 5LJ3g 3P8HA 2GQIA 3X25B 1YIJA 2CP0A 3JCMd 1NYFA 3JCMe 3BFMA 1TUGB 4RUGA 4J8OA 4JRPA 1K0SA 2HBWA 2DXBA 4EPCA 1EX4A 3QWYA 1JU5C 1BI0A 3JCMV 2BE9B 1X69A 4M7AG 2D9TA 5LJ3e 1KHIA 4F14A 2YWWA 1RAFB 2DL7A 1OZ2A 2ED1A 1VQPT 1PSEA 1TTHB 4FSXA 1AWXA 2K4YA 1QQJA 2GTOA 3CCRQ 4PK4A 2K5FA 1MV3A 3M58A 1MMAA 5CQYA 1M1KR 1WZOA 4OMFB 2ROLA 1JJ2S 2FVUA 5IT9E 1Y07A 2V26A 2RPNA 4PJJA 2ZAEA 2DL3A 4M77D 5IAYA 3OYEA 1WHJA 3NHNA 5D6WA 3OYLA 4C0DC 2OTLA 5AYFA 4M78B 1PD0A 4JLGA 2YUPA 1W1FA 2MOXA 2L89A 1ZUKA 3PVQA 2RQVA 3JB9J 4ZGJB 2QGFB 4MMKA 5DLOA 2YLCA 1YHQA 4BB7A 4JZ4A 3VS2A 2XMFA 2RHIA 2L5QA 2EGEA 5J39A 4OGCA 2JMAA 2Y4XA 4PFZA 3JCMb 1NZ9A 1KQ1A 2EJ9A 1X43A 4M4ZA 2OX7A 1Q81R 3CD6Q 1MMDA 1WHKA 2DTIA 4C92D 3RMSA 1IGQA 1PCXA 3VUBA 1ZSZB 2LDMA 4M7DE 3CC4A 3GF5A 4FM4B 1N27A 1M3CA 2Z0WA 3ME9A 3TSZA 1DJ7B 2BZ8A 3RBBB 1B34B 1M2VB 3LYIA 2MMPA 2DZ9A 3GNFB 2V1QA 4FW2A 4J9FA 2SEMA 4MZPA 3HTRA 5LJ5f 1K9MC 5GAMg 3HL8A 4CI0C 3VKIA 2CP6A 2OTJQ 4RTXA 4KH1B 5GAOl 1WJRA 5GANg 2IG0A 3EFSA 2DETA 2PVOB 3RKWA 3JCMW 1RAIB 2HCKA 1W2BA 1S1NA 3GOXA 1D0ZA 4FT4A 2LRQA 1D0XA 3L2ZA 3VS0A 3EGUA 4J5YA 3RNJA 2ABLA 2KQWA 2QQ9A 4JUVA 4M7DA 2DVJA 2EQKA 2DFUA 2LCSA 4BD3A 4X9CA 2RI2A 1BCMA 1QWEA 2J6KA 3CCQQ 1PRLC 3L2RA 2OJ2A 2VKNA 2AK5A 4Z02A 4IIOA 1YITT 3MCAB 2FZGB 3TQ7P 1G3TA 3REBB 3U23A 5GMKj 5HCKA 3CCMA 5GAN3 2GFUA 2JTMA 3MP1A 3REAB 2RHZA 2VGMA 1LPLA 4XTXA 4F7UF 1M90R 4JRQA 4Q5WA 3FLGA 1H3HA 3E9GA 3CXCS 1K8AC 2KRMA 1GL5A 1FMWA 1QCNA 1ZHIA 4J9IA 1E6GA 3INZA 1AD5A 2X3WD 2VUBA 3GIBA 1V29B 1WPYA 2P0PA 2X4XA 1NPPA 4PJOG 2EQUA 3ZEHA 3QZ5B 4CC3A 1I1JA 2DD5A 2OI3A 5FRNA 4KGVB 1UJYA 4BDZA 4OF1A 4MDWA 3DB3A 2X9HA 3JB9I 5KYWB 2H3EB 2KRSA 2K2VA 4QVDA 2XDBA 1R8OB 3EGXB 4CC2A 2W10A 2D0NA 2PVDB 4M77C 3FJPA 3G4SQ 2QEXT 4N0AC 1WXBA 1MNEA 2KI7A 1KK7A 1VQMT 2QI2A 2GNCA 5GAOn 5KYXA 1JEGA 1N8RU 1QKXA 2FHDA 3G6ET 4AFUC 3VS5A 2IPOB 2ECZA 4D6WA 2CP2A 1U1SA 4OVAA 2DTOA 2DL4A 4XU3A 2EW3A 4RTZA 1W2BP 2RK1A 2HQHA 3RERA 1NJIR 4PJOE 5KH6A 1N6AA 1D0YA 2K9GA 2I2LA 2CS7A 1VQ7Q 3L1AA 2DE0X 1GFCA 4LN2A 3O8VA 3G71Q 1C0MA 3E1SA 1NYGA 1BCOA 2BTTA 1M2OA 1IRXA 3UA6A 2M51A 3O5ZA 2OTJT 4HCZA 4RTWA 5GMKh 1VYTA 3M4GA 5LJ3f 3UPUA 1RADB 2FB7A 4KULA 3CC7A 2EFIA 3OMCA 3SB2A 3QPHA 3TSWA 1VQ9Q 3OSSC 4E7ZA 3MP8A 3H6ZA 1OU9A 1VQOQ 1OEBA 2CH4A 3V8LA 2JNGA 3J81E 3HSBA 2YRDA 1K1ZA 2DEUA 4RTUA 1D1BA 3M0UA 1SRMA 1HD3A 1Q95G 1BYMA 3QIIA 4HT9A 3I35A 4X1VA 5HKCA 5J26A 4UC4A 2HNIA 4C8QB 2DTHA 3FRNA 3LWHA 2ROTA 4YTLA 3CCST 2QYZA 4BI3A 2QGGA 1M9SA 4JDSA 4XTZA 2ZPGB 5FW9A 2P0QA 1VQ8Q 3VS3A 1ZSGA 4EMGA 3CMAT 4HCBA 2KVQG 4HVVA 3PNWC 1RI0A 2LX7A 2YSQA 4C5GA 3HFNA 3VV0A 1XTDA 3G1JA 2CP7A 2L3RA 1TOVA 1WX6A 1VQ5A 1YJNT 3OQ5A 5IXBA 2JMCA 3SDZA 1AOJA 4AFQC 1G3YA 4FYVB 5FU7C 3I55A 4M75B 3GBQA 1RAAB 2F2VA 3A98A 3V8KA 4C8QG 1RLPC 1WQ7A 1MNDA 2L3PA 2ZGWA 4ANJA 2A08A 2XDPA 3JCMP 2O9VA 1H8KA 2DMOA 1UHFA 2BZXA 2DXUA 1P92A 3NGPA 4EDUA 4V2SA 2CREA 2QG9B 4M78D 2CDTA 2RQWA 1VQ4Q 1VQPA 2KYMA 1OQKA 2CUBA 1SPKA 2PU9B 4R56A 3BDUA 2X4JA
chains in the Genus database with same CATH topology
1PHTA 1KFZA 1PRMC 1GCPA 1AWJA 1TG0A 2X3XD 3EHRA 1M30A 2MCNA 4RTVA 1PKSA 1YWOA 2RF0A 4Z89A 2LP5A 1AWWA 2AKLA 1AZGB 2DBKA 3M0RA 1MUZA 1ZLMA 1YCSB 2FRYA 2KXDA 1K76A 2DX1A 2G6FX 3UF4A 3EG3A 4J9CA 2H8HA 5IXFA 1V1CA 2LJ1A 2AZVA 2K2MA 1UTIA 4OMQA 3KFVA 3I5SA 2YUQA 1WLPB 2CT3A 1JXOA 3ZL7C 1HJDA 2A36A 2GQIA 1FMKA 1KJWA 1NYFA 2YUOA 4OMNA 1GFDA 4RUGA 1K0SA 1T0JA 2HBWA 1AWOA 3NPFA 3QWYA 4J9BA 4OMMA 2D8JA 1JU5C 3EG2A 2O2OA 2YT6A 1X69A 2BZYA 4CC4B 4F14A 2JT4A 2W0ZA 1VA7A 4AFSC 2DL7A 2ED1A 1AWXA 2EYYA 2GTOA 1J3TA 1MV3A 4ORZA 1I0CA 4ESRA 1UGVA 2KNBB 5IHNA 1UG1A 2CH4W 3SHWA 1UECA 2ROLA 2KBTA 2RPNA 2DL3A 2JW4A 3NHNA 1U06A 4JZ3A 2KXCA 5EC7A 1AZEA 1JO8A 2LMJA 4F17A 1NLPC 2YUPA 1W1FA 2DNUA 1RI9A 2MOXA 2GGRA 1ZUKA 3VS7A 1KIKA 3PVQA 2RQVA 1Y57A 2GTJA 3VS4A 4IIMA 1WYXA 1OPKA 4J9DA 1PKTA 1OPLA 2NUZA 1YN8A 2LNHB 1WA7A 4HXJA 1B3QA 4JJCA 3LH5A 4JZ4A 3VS2A 2XMFA 1SHFA 4GLMA 3EHQA 2EGEA 5IHIA 1SRLA 1X6GA 2RMOA 2JMAA 2EYZA 3PE0A 2YDLA 1PWTA 2K79A 1WXUA 2V1RA 5I11A 2ENMA 1X43A 2J05A 4M4ZA 2LZ6B 1Y0MA 5GJWB 1OV3A 2P4RA 4HVWA 2J06A 1X6BA 2KT8A 2D8HA 4K11A 3M0TA 1M3CA 3TSZA 2BZ8A 3JV3A 3RBBB 1M27C 4Z8AA 3ULRB 2IIMA 1VYUA 1YNZA 4QT7A 4LUDA 2EYXA 1TUCA 3M0PA 1IO6A 2V1QA 4J9FA 2SEMA 3M0QA 2FPDA 2YUNA 2J7IA 4RTXA 2JXBA 4Z88A 1ZUUA 1W70A 5IH2A 2HCKA 1S1NA 1BBZA 1UFFA 4ZNXA 2OAWA 2EPDA 1QKWA 2D1XA 3H0IA 3VS0A 3EGUA 3RNJA 4LE9A 2C0TA 2ABLA 2KE9A 2QDLA 3H0FA 5GJVB 3UA7A 2GBQA 3EG0A 2DVJA 1SEMA 4GBQA 1U5SA 2LCSA 3PVLA 4OMPA 3VS6A 1WIEA 2EBPA 1E6HA 1QWEA 1Z9QA 1U3OA 2J6KA 4AG2C 1PRLC 4LNPA 4OMOA 1N5ZA 1T3SA 1X2QA 1SSHA 1GRIA 1XOVA 1NEGA 4JPBW 2OJ2A 2VKNA 2AK5A 4OMLA 4IIOA 4AG1C 2KRNA 1CKBA 4AFZC 1BK2A 2EKHA 4WCIA 3REBB 3U23A 1RLQC 2L0AA 5HCKA 1NM7A 4D8KA 3CQTA 3REAB 2VWFA 2L3SA 1HSQA 4DEXA 2DRKA 2FO0A 1H3HA 1KSWA 2L3QA 1B07A 1NG2A 3EG1A 2KRMA 1GL5A 1JQQA 1UE9A 1NLOC 1PNJA 2K6DA 2HEQA 3VRYA 4EIKA 2CUDA 3H41A 2B86A 4J9IA 1E6GA 1AD5A 1LCKA 2X3WD 4HVUA 2NWMA 2LQNA 2SRCA 1K0XA 4CC3A 2DYBA 1I1JA 1UUEA 2OI3A 5FWCA 4DEYA 1UJYA 3UATA 1ZX6A 2CT4A 2LQWA 3I5RA 4LUEA 2K7AA 2KRSA 2DBMA 4F16A 4D8DA 2RNAA 4CC2A 1RUWA 2W10A 1AEYA 2D0NA 1E7OA 1JXMA 2A37A 1FYNA 2C0IA 1WXBA 2RQUA 2KR3A 1W6XA 1BU1A 2F2XA 2GNCA 1OOTA 1JEGA 5ECAA 3R6NA 4HCKA 2DL5A 1I07A 1QKXA 4AFUC 2C0OA 1G83A 1M3BA 3VS5A 2M0YA 1CKAA 2ECZA 1A0NB 4JJBA 4A63B 2DL4A 1WI7A 1CSKA 2EW3A 4RTZA 1Z9ZA 1X2KA 2EYWA 2PTKA 2K9GA 1ZUYA 1WXTA 2DE0X 2FG0A 1GFCA 1M8MA 4LN2A 2RN8A 2JM8A 4J9HA 3NMZC 2DL8A 1NYGA 2L2PA 2BTTA 2DF6A 3UA6A 2M51A 1GBQA 3THKA 2KGTA 2KT1A 1WFWA 2LJ0A 3O5ZA 4RTWA 2PNIA 3M0SA 4Y92A 4J9EA 1H92A 1M3AA 1VYTA 1QCFA 2EQIA 2DRMA 1ARKA 4FSSA 3H0HA 1NEBA 3VS1A 2ED0A 3TSWA 1X27A 2MIOA 2DLPA 2JM9A 2EGCA 2I0NA 1OEBA 2CH4A 3I9QA 2F2WA 4CC7A 2JS0A 1K1ZA 2VVKA 4RTUA 3M0UA 1SRMA 1HD3A 2KYBA 5FWBA 2KROA 1K9AA 4RTYA 1VYVA 3I35A 5I22A 4X1VA 4KRTA 1GCQA 1QWFA 2EGAA 2CSIA 3SEMA 1EFNA 2LJ3A 2ROTA 1GBRA 2AZSA 3IQLA 2A28A 1BB9A 2RQTA 3TVTA 5FW9A 2FPEA 1YWPA 1ZBJA 1G2BA 2J6OA 3FJ5A 3VS3A 3VRZA 1ZSGA 2RQRA 1YP5A 4HVVA 2KEAA 1TUDA 2LX7A 2YSQA 2O31A 2J6FA 4RTTA 1SHGA 1WX6A 1T0HA 4E6RA 5IXBA 2JMCA 1AOJA 4AFQC 4J9GA 4R0KA 2HDAA 3GBQA 2F2VA 3A98A 5L23A 1ABOA 2PZ1A 1MV0B 1RLPC 2ESWA 1QLYA 5IHKA 2DM1A 2L3PA 1T3LA 2DILA 2A08A 2O9VA 1H8KA 2O9SA 1GCQC 2DMOA 1UHFA 1UHCA 2FPFA 2BZXA 4JJDA 3NGPA 2JS2A 2FEIA 2CREA 3QWXX 1WDXA 2EVRA 2O88A 2E5KA 2HSPA 2CSQA 2DA9A 1AVZC 1UDLA 2CDTA 1UJ0A 2K3BA 2RQWA 2AKKA 2JTEA 2KYMA 2CUBA 1SPKA 2FRWA 1ABQA 3C0CA 1K4US 2DJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PHT A;  1KFZ A;  1PRM C;  1GCP A;  1AWJ A;  1TG0 A;  2X3X D;  3EHR A;  1M30 A;  2MCN A;  4RTV A;  1PKS A;  1YWO A;  2RF0 A;  4Z89 A;  2LP5 A;  1AWW A;  2AKL A;  1AZG B;  2DBK A;  3M0R A;  1MUZ A;  1ZLM A;  1YCS B;  2FRY A;  2KXD A;  1K76 A;  2DX1 A;  2G6F X;  3UF4 A;  3EG3 A;  4J9C A;  2H8H A;  5IXF A;  1V1C A;  2LJ1 A;  2AZV A;  2K2M A;  1UTI A;  4OMQ A;  3KFV A;  3I5S A;  2YUQ A;  1WLP B;  2CT3 A;  1JXO A;  3ZL7 C;  1HJD A;  2A36 A;  2GQI A;  1FMK A;  1KJW A;  1NYF A;  2YUO A;  4OMN A;  1GFD A;  4RUG A;  1K0S A;  1T0J A;  2HBW A;  1AWO A;  3NPF A;  3QWY A;  4J9B A;  4OMM A;  2D8J A;  1JU5 C;  3EG2 A;  2O2O A;  2YT6 A;  1X69 A;  2BZY A;  4CC4 B;  4F14 A;  2JT4 A;  2W0Z A;  1VA7 A;  4AFS C;  2DL7 A;  2ED1 A;  1AWX A;  2EYY A;  2GTO A;  1J3T A;  1MV3 A;  4ORZ A;  1I0C A;  4ESR A;  1UGV A;  2KNB B;  5IHN A;  1UG1 A;  2CH4 W;  3SHW A;  1UEC A;  2ROL A;  2KBT A;  2RPN A;  2DL3 A;  2JW4 A;  3NHN A;  1U06 A;  4JZ3 A;  2KXC A;  5EC7 A;  1AZE A;  1JO8 A;  2LMJ A;  4F17 A;  1NLP C;  2YUP A;  1W1F A;  2DNU A;  1RI9 A;  2MOX A;  2GGR A;  1ZUK A;  3VS7 A;  1KIK A;  3PVQ A;  2RQV A;  1Y57 A;  2GTJ A;  3VS4 A;  4IIM A;  1WYX A;  1OPK A;  4J9D A;  1PKT A;  1OPL A;  2NUZ A;  1YN8 A;  2LNH B;  1WA7 A;  4HXJ A;  1B3Q A;  4JJC A;  3LH5 A;  4JZ4 A;  3VS2 A;  2XMF A;  1SHF A;  4GLM A;  3EHQ A;  2EGE A;  5IHI A;  1SRL A;  1X6G A;  2RMO A;  2JMA A;  2EYZ A;  3PE0 A;  2YDL A;  1PWT A;  2K79 A;  1WXU A;  2V1R A;  5I11 A;  2ENM A;  1X43 A;  2J05 A;  4M4Z A;  2LZ6 B;  1Y0M A;  5GJW B;  1OV3 A;  2P4R A;  4HVW A;  2J06 A;  1X6B A;  2KT8 A;  2D8H A;  4K11 A;  3M0T A;  1M3C A;  3TSZ A;  2BZ8 A;  3JV3 A;  3RBB B;  1M27 C;  4Z8A A;  3ULR B;  2IIM A;  1VYU A;  1YNZ A;  4QT7 A;  4LUD A;  2EYX A;  1TUC A;  3M0P A;  1IO6 A;  2V1Q A;  4J9F A;  2SEM A;  3M0Q A;  2FPD A;  2YUN A;  2J7I A;  4RTX A;  2JXB A;  4Z88 A;  1ZUU A;  1W70 A;  5IH2 A;  2HCK A;  1S1N A;  1BBZ A;  1UFF A;  4ZNX A;  2OAW A;  2EPD A;  1QKW A;  2D1X A;  3H0I A;  3VS0 A;  3EGU A;  3RNJ A;  4LE9 A;  2C0T A;  2ABL A;  2KE9 A;  2QDL A;  3H0F A;  5GJV B;  3UA7 A;  2GBQ A;  3EG0 A;  2DVJ A;  1SEM A;  4GBQ A;  1U5S A;  2LCS A;  3PVL A;  4OMP A;  3VS6 A;  1WIE A;  2EBP A;  1E6H A;  1QWE A;  1Z9Q A;  1U3O A;  2J6K A;  4AG2 C;  1PRL C;  4LNP A;  4OMO A;  1N5Z A;  1T3S A;  1X2Q A;  1SSH A;  1GRI A;  1XOV A;  1NEG A;  4JPB W;  2OJ2 A;  2VKN A;  2AK5 A;  4OML A;  4IIO A;  4AG1 C;  2KRN A;  1CKB A;  4AFZ C;  1BK2 A;  2EKH A;  4WCI A;  3REB B;  3U23 A;  1RLQ C;  2L0A A;  5HCK A;  1NM7 A;  4D8K A;  3CQT A;  3REA B;  2VWF A;  2L3S A;  1HSQ A;  4DEX A;  2DRK A;  2FO0 A;  1H3H A;  1KSW A;  2L3Q A;  1B07 A;  1NG2 A;  3EG1 A;  2KRM A;  1GL5 A;  1JQQ A;  1UE9 A;  1NLO C;  1PNJ A;  2K6D A;  2HEQ A;  3VRY A;  4EIK A;  2CUD A;  3H41 A;  2B86 A;  4J9I A;  1E6G A;  1AD5 A;  1LCK A;  2X3W D;  4HVU A;  2NWM A;  2LQN A;  2SRC A;  1K0X A;  4CC3 A;  2DYB A;  1I1J A;  1UUE A;  2OI3 A;  5FWC A;  4DEY A;  1UJY A;  3UAT A;  1ZX6 A;  2CT4 A;  2LQW A;  3I5R A;  4LUE A;  2K7A A;  2KRS A;  2DBM A;  4F16 A;  4D8D A;  2RNA A;  4CC2 A;  1RUW A;  2W10 A;  1AEY A;  2D0N A;  1E7O A;  1JXM A;  2A37 A;  1FYN A;  2C0I A;  1WXB A;  2RQU A;  2KR3 A;  1W6X A;  1BU1 A;  2F2X A;  2GNC A;  1OOT A;  1JEG A;  5ECA A;  3R6N A;  4HCK A;  2DL5 A;  1I07 A;  1QKX A;  4AFU C;  2C0O A;  1G83 A;  1M3B A;  3VS5 A;  2M0Y A;  1CKA A;  2ECZ A;  1A0N B;  4JJB A;  4A63 B;  2DL4 A;  1WI7 A;  1CSK A;  2EW3 A;  4RTZ A;  1Z9Z A;  1X2K A;  2EYW A;  2PTK A;  2K9G A;  1ZUY A;  1WXT A;  2DE0 X;  2FG0 A;  1GFC A;  1M8M A;  4LN2 A;  2RN8 A;  2JM8 A;  4J9H A;  3NMZ C;  2DL8 A;  1NYG A;  2L2P A;  2BTT A;  2DF6 A;  3UA6 A;  2M51 A;  1GBQ A;  3THK A;  2KGT A;  2KT1 A;  1WFW A;  2LJ0 A;  3O5Z A;  4RTW A;  2PNI A;  3M0S A;  4Y92 A;  4J9E A;  1H92 A;  1M3A A;  1VYT A;  1QCF A;  2EQI A;  2DRM A;  1ARK A;  4FSS A;  3H0H A;  1NEB A;  3VS1 A;  2ED0 A;  3TSW A;  1X27 A;  2MIO A;  2DLP A;  2JM9 A;  2EGC A;  2I0N A;  1OEB A;  2CH4 A;  3I9Q A;  2F2W A;  4CC7 A;  2JS0 A;  1K1Z A;  2VVK A;  4RTU A;  3M0U A;  1SRM A;  1HD3 A;  2KYB A;  5FWB A;  2KRO A;  1K9A A;  4RTY A;  1VYV A;  3I35 A;  5I22 A;  4X1V A;  4KRT A;  1GCQ A;  1QWF A;  2EGA A;  2CSI A;  3SEM A;  1EFN A;  2LJ3 A;  2ROT A;  1GBR A;  2AZS A;  3IQL A;  2A28 A;  1BB9 A;  2RQT A;  3TVT A;  5FW9 A;  2FPE A;  1YWP A;  1ZBJ A;  1G2B A;  2J6O A;  3FJ5 A;  3VS3 A;  3VRZ A;  1ZSG A;  2RQR A;  1YP5 A;  4HVV A;  2KEA A;  1TUD A;  2LX7 A;  2YSQ A;  2O31 A;  2J6F A;  4RTT A;  1SHG A;  1WX6 A;  1T0H A;  4E6R A;  5IXB A;  2JMC A;  1AOJ A;  4AFQ C;  4J9G A;  4R0K A;  2HDA A;  3GBQ A;  2F2V A;  3A98 A;  5L23 A;  1ABO A;  2PZ1 A;  1MV0 B;  1RLP C;  2ESW A;  1QLY A;  5IHK A;  2DM1 A;  2L3P A;  1T3L A;  2DIL A;  2A08 A;  2O9V A;  1H8K A;  2O9S A;  1GCQ C;  2DMO A;  1UHF A;  1UHC A;  2FPF A;  2BZX A;  4JJD A;  3NGP A;  2JS2 A;  2FEI A;  2CRE A;  3QWX X;  1WDX A;  2EVR A;  2O88 A;  2E5K A;  2HSP A;  2CSQ A;  2DA9 A;  1AVZ C;  1UDL A;  2CDT A;  1UJ0 A;  2K3B A;  2RQW A;  2AKK A;  2JTE A;  2KYM A;  2CUB A;  1SPK A;  2FRW A;  1ABQ A;  3C0C A;  1K4U S;  2DJQ A; 
#chains in the Genus database with same CATH topology
 1GCP A;  1WHM A;  6AT1 B;  4DBQ A;  5GAM f;  3EHR A;  2MCN A;  3CBO A;  4RTV A;  1YWO A;  2RF0 A;  5A0G A;  4Z89 A;  1OZ3 A;  5GAN f;  4M75 G;  3M0R A;  5GAN 4;  1Q82 U;  5FU7 B;  2E1H A;  5LJ5 d;  2FRY A;  5M9O A;  4QQ6 A;  5LJ5 e;  3CME T;  2G6F X;  1VQK T;  4BE2 A;  4E7S A;  2HQE A;  2K2M A;  3OS1 A;  3KFV A;  2YUQ A;  1OX8 A;  1WLP B;  2CT3 A;  4RMO A;  3ZL7 C;  2WSE E;  1HJD A;  4BI4 A;  2F1L A;  2HZY A;  4HCC A;  3A8H B;  3CPF A;  3BW1 A;  1T0J A;  5KYU A;  3S6W A;  2K5L A;  4BDY A;  3OBY A;  3L2Q A;  2VV5 A;  4MML A;  3NPF A;  4J9B A;  5D6X A;  4OMM A;  4C92 E;  3S3N A;  1BI1 A;  1ZA2 B;  2O2O A;  2RHU A;  2VYT A;  4B6M A;  4DBH A;  2QQS A;  4J6Y A;  4CC4 B;  3GPL A;  3X20 B;  1BI2 A;  2D6F A;  3A8M B;  4BY6 B;  4N0A A;  4E7H A;  2EYY A;  5L8R E;  1I0C A;  3VUZ A;  4XTW A;  3M5A A;  4FYX B;  4PJN A;  1QVF S;  1UGV A;  3JB9 F;  1UG1 A;  3HRS A;  3SHW A;  1O75 A;  1UEC A;  3JSC A;  2JW4 A;  1U06 A;  4ATO A;  3E19 A;  4AT1 B;  2IVW A;  1RI9 A;  1I5L A;  4M7A C;  5CQX A;  1KIK A;  1Y57 A;  4IIM A;  3DLL A;  1Q81 U;  4J9D A;  4C92 A;  1WA7 A;  4HXJ A;  3PT9 A;  2EYQ A;  3I56 Q;  3T9N A;  3EHQ A;  3CPW S;  3CCJ T;  4PL6 A;  4HA8 A;  5IHI A;  1XJW B;  2YDL A;  1PWT A;  2ENM A;  2J05 A;  1S72 Q;  1X75 C;  1Y0M A;  4MDX A;  4OB0 B;  1R0C B;  1OV3 A;  3CCE A;  1OI1 A;  2KT8 A;  5J3B A;  1IHV A;  1Y96 A;  1YIT A;  3UWN A;  2CGH A;  4M77 F;  3CCU T;  5GAO r;  4J6X A;  4LDV A;  3QG1 A;  1LNX A;  2QAS A;  1KC8 U;  3DB4 A;  4LUD A;  3FEO A;  1TUC A;  3M0P A;  4ZGD B;  4M7A B;  2HL3 A;  1R0B G;  3M0Q A;  3RDV A;  1BIB A;  2Y90 A;  2RI3 A;  1Q82 C;  1ZUU A;  2DO3 A;  3M54 A;  4KGZ B;  4NOY A;  1W70 A;  1H3Z A;  1JJ2 A;  4NS5 A;  1QP3 A;  2QA4 T;  1QVG S;  2FYK A;  4ZNX A;  3EGD A;  1XNI A;  4KGX B;  1F1B B;  4M78 C;  3KBG A;  4DQ2 A;  4C0F A;  4XU0 A;  3CC2 T;  3H0F A;  3OW2 S;  3Q1J A;  1TWB A;  4PLL A;  2KAF A;  1V76 A;  2XU8 A;  1XQH A;  3VS6 A;  1PG5 B;  1U3O A;  1D1A A;  3PFS A;  5LJ3 d;  5GMK l;  4OGE A;  5GAN 7;  2QEX A;  1XOV A;  1IZ6 A;  1M1K C;  1VQM A;  1HYO A;  2DAQ A;  1CKB A;  1M90 U;  4AFZ C;  1VQ6 Q;  1BK2 A;  2CP3 A;  2B8A A;  4M7D G;  2DEQ A;  3G6E A;  1ZSZ C;  4J6W A;  2BE7 D;  5LL6 S;  3DLM A;  2RHX A;  3JAM E;  2LC4 A;  3RUX A;  2K5I A;  4FIB A;  1YI2 T;  4QQD A;  1KSW A;  2L3Q A;  3EG1 A;  1JQQ A;  1KQS P;  4KUI A;  4EIK A;  2CUD A;  3PTA A;  1VQL T;  2LQN A;  2SRC A;  3CCL Q;  3FB9 A;  2GFA A;  3FC3 A;  3OYC A;  2DYB A;  1UUE A;  1Q81 C;  2OTJ A;  1U8R A;  2RA2 A;  2CZ0 B;  5HY6 A;  1YIJ Q;  4PFP A;  2KK4 A;  2CT4 A;  2LQW A;  1RAG B;  3I5R A;  4KT0 E;  2E3I A;  1VQN T;  1YJ9 T;  2DBM A;  2LT1 A;  2HQX A;  1N9S A;  2RNA A;  4C8Q D;  4LD6 A;  4EMK A;  1K73 C;  2LCC A;  3QJ6 A;  3CCV T;  1MMG A;  3EFO B;  2F2X A;  3R6O A;  1QP2 A;  5A2Q E;  4Y28 E;  2KDS A;  1NJI U;  2DPP B;  3GP8 A;  2JJ9 A;  1CKA A;  3HRU A;  2CZ6 B;  1D3B B;  1A0N B;  1SSF A;  2ATC B;  3C4S A;  4F7U A;  1X01 A;  3JRZ A;  1JJ2 P;  1WI7 A;  1CSK A;  3AHU A;  3CCS A;  2QAZ A;  1Z9Z A;  1KC8 R;  1X2K A;  2OTL Q;  2QQR A;  2EYW A;  1X6O A;  5GAO p;  3HFO A;  3OS0 A;  4M75 D;  2E41 A;  1Q7Y C;  3QBY A;  3PIP A;  3QUI A;  3BE3 A;  4J9H A;  3MEA A;  5GAM d;  1YJW T;  9ATC B;  2L2P A;  3CXC A;  3CMA A;  5GAM e;  1YHQ Q;  2KT1 A;  3F70 A;  2NUP B;  1M4Z A;  5GAN d;  5GAN e;  2DRM A;  1ARK A;  2LVM A;  4A54 A;  1YJN A;  2QTX A;  2L8D A;  3ASK A;  4PJO B;  1PC0 A;  4PKC C;  2X4Y A;  2JM9 A;  3CCE T;  3CC4 Q;  2DER A;  1NBE B;  2FZK B;  2RJD A;  2RD1 A;  2JTF A;  4DOW A;  2MYS A;  2MK5 A;  2EWN A;  4F04 B;  2KYB A;  1D1C A;  1EIF A;  1N9R A;  2KRO A;  4RTY A;  1VYV A;  4KRT A;  3SFM A;  1UEB A;  3SEM A;  3TRE A;  3OA6 A;  1GBR A;  1YFN A;  3CCR T;  1W4S A;  2A28 A;  1BB9 A;  2VXF A;  3TVT A;  4E7I A;  1TSF A;  4OB3 B;  4XAX B;  1G2B A;  2BIV A;  2COZ A;  4RCB A;  4XU2 A;  2QXF A;  3KXT A;  2QTV A;  2QDY B;  4PJL A;  3CME A;  1VQK A;  2J6F A;  1VQ7 A;  4FL6 A;  4E6R A;  2WSF E;  4M7A F;  5I2S A;  4B9X A;  2COW A;  4ZN1 A;  2HDA A;  4PLI A;  3N5B B;  2MF2 A;  2NUT B;  5L23 A;  2PZ1 A;  1MV0 B;  2DVE A;  2M16 A;  4M78 A;  2ESW A;  1QLY A;  2OAU A;  3C94 A;  3EH2 A;  2DIL A;  1GCQ C;  2DJZ A;  2LX9 A;  3CD6 T;  2A3L A;  5CR2 A;  2BKD N;  4JJD A;  3CCM Q;  2JS2 A;  2PUO B;  1OU8 A;  1SF9 A;  2O88 A;  3NTI A;  2E5K A;  2G3R A;  1ZA1 B;  1KD1 R;  1U1T A;  1UDL A;  4GY5 A;  1UJ0 A;  2K3B A;  5KCH A;  2JTE A;  3SD4 A;  5CIU A;  2FRW A;  1WHL A;  5AT1 B;  3C0C A;  1K4U S;  2RO0 A;  4LDX A;  4II1 A;  1PRM C;  2JN0 A;  3CXC P;  1TG0 A;  4GLK A;  4C8Q C;  4BI8 B;  1NPR A;  1AWW A;  5FU6 B;  4A4K A;  5A0L A;  2DIQ A;  1AZG B;  5KYY A;  4JS5 A;  1M8V A;  3LW5 E;  1B34 A;  1M2V A;  2DX1 A;  5GMK m;  3EG3 A;  2YLB A;  2YRV A;  4LDY A;  2AZV A;  5C0M A;  3OS2 A;  4OMQ A;  3JB9 G;  1JXO A;  2X4W A;  1FMK A;  4M78 F;  3CCJ A;  1GFD A;  3HRT A;  1O9S A;  1PM3 A;  4M7A D;  4M75 C;  1AWO A;  3CCQ T;  1FMV A;  2O4X A;  4E47 A;  2ZPF B;  3EG2 A;  2BZY A;  3JCM Q;  2JT4 A;  2W0Z A;  4FT2 A;  3LLR A;  4AFS C;  3CCU A;  1VOM A;  2A0F B;  1RAB B;  2DK3 A;  1J3T A;  4ORZ A;  4J83 A;  5IHN A;  3PMI A;  1SKU B;  2RM4 A;  3SWN C;  2BUD A;  5DY9 A;  5C6S A;  2EJF A;  4TVR A;  2RJC A;  1UGP B;  4JZ3 A;  5EC7 A;  1AZE A;  2RJE A;  1JO8 A;  2LMJ A;  2XDD A;  2FZC B;  2XKO C;  2GGR A;  3OB9 A;  2QA4 A;  2GTJ A;  5LJ3 j;  3VS4 A;  3EAE A;  3CC7 Q;  5CKF A;  1OPK A;  3RR6 A;  3CC2 A;  2NUZ A;  4JJC A;  5GAN 5;  3VJP A;  2MWO A;  3OBW A;  2RI5 A;  4GLM A;  5I21 A;  2CKK A;  5CKE A;  3LGL A;  1X6G A;  2RMO A;  2EYZ A;  1WXU A;  2V1R A;  3CEY A;  3OMG A;  1N8R C;  2YXY A;  5CCA A;  5GJW B;  3MP6 A;  4HVW A;  3G4S T;  1X6B A;  4R55 A;  2PVG B;  2DKG A;  5HK3 A;  4C92 G;  1VIE A;  3SWN B;  3JV3 A;  4LXC A;  2V8K A;  4WTO B;  1YNZ A;  4X34 A;  2LTO A;  3OYN A;  5GAN 6;  2ZZD A;  4BY6 C;  1VIF A;  4M77 E;  3MJX A;  3M56 A;  3L2W A;  4PNO A;  2FPD A;  3M55 A;  1YI2 A;  2E70 A;  2J7I A;  4A4G A;  2JXB A;  2MPX C;  3TEE A;  2AIR B;  2RK2 A;  1VQ7 T;  2DZC A;  1VQ5 Q;  3QYG B;  1VQL A;  1UFF A;  2V8J A;  5GMK e;  3G71 T;  4C5I A;  1QKW A;  4OB1 B;  2D1X A;  4FU6 A;  4LE9 A;  2EKO A;  2C0T A;  2QDL A;  2D0Q B;  2DXC A;  5GJV B;  3UA7 A;  3QDF A;  1HXD A;  1VQN A;  1I8F A;  1SEM A;  2DD4 A;  1YJ9 A;  4FCY A;  1WIE A;  1FX7 A;  2EBP A;  1Z9Q A;  3URG A;  4AG2 C;  4DA4 A;  2K3X A;  4OMO A;  1T3S A;  3JCM h;  1VQ9 T;  1Q86 R;  5KE2 A;  4ZGE B;  1SSH A;  3QKJ A;  3CPW A;  4JPB W;  3CCV A;  1VQO T;  4X9D A;  2JVV A;  4AG1 C;  1BI3 A;  2KRN A;  4M77 A;  1VQP Q;  1ZQ1 A;  1YCY A;  2EKH A;  4MZT A;  2X35 A;  4E7L A;  1G5V A;  5LJ3 h;  2RB6 A;  2LT4 A;  4C5H A;  2L0A A;  1JBM A;  3J80 E;  2HBP A;  4D8K A;  3GLX A;  1TXQ A;  2VWF A;  1SG5 A;  5HK0 A;  2L3S A;  4QVZ A;  1HSQ A;  4DEX A;  4FW1 A;  2FO0 A;  2QK0 A;  1B07 A;  1M5Q 1;  4L5G A;  1UE9 A;  4PJO D;  1NLO C;  2K6D A;  1MHN A;  5FRM A;  4IUV A;  3V7S A;  1VQ8 T;  1KQS A;  1YJW A;  4M7D C;  4DBF A;  5GAN 2;  4A4F A;  2KY9 A;  3LWI A;  1QVG A;  3QDR B;  1ZX6 A;  4IKF A;  2R57 A;  2HL5 C;  4L59 A;  3OYF A;  4LUE A;  2H3J A;  3OYM A;  3BDL A;  2K7A A;  3MEW A;  2M1H A;  3GNG A;  4D8D A;  4WF2 A;  1E7O A;  1JXM A;  5CK9 A;  4J7F A;  2JOY A;  2A37 A;  3NTH A;  2C0I A;  2KR3 A;  4JRI A;  1Y71 A;  1BU1 A;  3HP9 A;  3JCM c;  2COY A;  1OOT A;  2XD0 A;  3LH0 A;  2C0O A;  1G83 A;  1M3B A;  3JB9 H;  1PSF A;  3A8O B;  1QVF P;  4JJB A;  3NFC A;  4A63 B;  5D6Y A;  1VQ4 T;  4M7D B;  4LDU A;  3CCR A;  2PTK A;  5EG2 A;  2E6N A;  2VGN A;  1WXT A;  2ZPH B;  2FG0 A;  1M8M A;  2RN8 A;  5D7U A;  5KE3 A;  1IHW A;  5KCO A;  4C8Q F;  4RKU E;  3RKX A;  1QVP A;  1GBQ A;  3THK A;  2KGT A;  2LJ0 A;  1UGR B;  1WFW A;  2E64 A;  2HKQ B;  3M0S A;  4Y92 A;  1M3A A;  4F7U G;  2P84 A;  3JCM g;  1C6V X;  5GAM h;  4IUQ A;  2VB6 A;  4C5E A;  3H0H A;  3CPW P;  1NEB A;  3JCM X;  3CCL A;  2AHJ B;  2ED0 A;  3A1P A;  4EMH A;  1HK9 A;  1JB0 E;  5GAN h;  1X27 A;  2XIC A;  1TH7 A;  2EGC A;  4LD9 K;  1YIT Q;  2F2W A;  4BE0 A;  2GF7 A;  3L42 A;  3CD6 A;  5CKB A;  5FWB A;  3C95 A;  1K9A A;  2EQM A;  2FL7 A;  4M75 F;  5I22 A;  3X28 B;  1NE8 A;  1RL2 A;  3ZFJ A;  3H9N A;  5I2M A;  5CKD A;  3EG9 A;  3HHT B;  2E10 A;  3FIF A;  1KQ2 A;  2FPE A;  4FYY B;  3M59 A;  4AMC A;  1ZBJ A;  2F69 A;  4F7U E;  5GAN 8;  3H8Z A;  2J6O A;  1QVG P;  3VRZ A;  1MMN A;  2HSE B;  4C0Z A;  3M57 A;  1K8A U;  3LGF A;  2F5K A;  3OW2 P;  2O31 A;  1SHG A;  5KYX B;  4KUD K;  3TCJ A;  1QCO A;  3UT1 A;  3X26 B;  2QEX Q;  3V7R A;  1B7T A;  5DM7 R;  3I56 T;  5IHK A;  5CAI A;  1VQM Q;  4JLI A;  1KD1 U;  2PUK B;  4PJO C;  4M7A E;  2O9S A;  2HKN A;  3G6E Q;  3CCQ A;  1KC8 C;  2FPF A;  3HKS A;  1S72 T;  2XID A;  1TS9 A;  2WAC A;  2RJF A;  1WDX A;  2EVR A;  2NLU A;  2JZ2 A;  2AKK A;  2R5M A;  1D09 B;  3MEU A;  4XU1 A;  4ZTJ A;  5KYY B;  3OYH A;  4M78 G;  3V7C A;  3MPU B;  4A53 A;  1AWJ A;  1K73 R;  4C0D B;  8ATC B;  1PKS A;  3X24 B;  2AKL A;  4N4I A;  4PJM A;  2E4H A;  3CBM A;  2F5T X;  1ZLM A;  1YCS B;  1RAC B;  3RIR A;  2LCL A;  1K76 A;  4J9C A;  2H8H A;  5IXF A;  4P5N A;  1K9M R;  2LJ1 A;  4M7A A;  1UTI A;  3QXE B;  2O4X B;  3I5S A;  4RG8 A;  2JUF A;  3UDC A;  2A36 A;  2DYI A;  1KJW A;  2YUO A;  4OMN A;  3OYG A;  2V8I A;  4CRI A;  1Q7Y R;  1M90 C;  2HMA A;  1Y7X A;  4IUU A;  4ELY C;  3QO3 A;  2D8J A;  2Y4Y A;  2YT6 A;  2EAY A;  3VYG A;  3G4S A;  4M78 E;  4A4H A;  3D7S B;  2C06 A;  1VA7 A;  5LJ5 j;  1EZZ B;  4VUB A;  4JRK A;  1VQ6 T;  3CCS Q;  2HD0 A;  5CKH A;  4ELZ C;  2P4T A;  4KH0 B;  4B9W A;  4ESR A;  1WGS A;  2KNB B;  2CH4 W;  2XHC A;  1BIA A;  2WSC E;  4JJN K;  2KBT A;  1W2B S;  3CMA Q;  2R58 A;  2KXC A;  2E5Q A;  3OYJ A;  4F17 A;  1NLP C;  3ZBD A;  2DNU A;  5FU6 C;  3VS7 A;  1YJN Q;  4OB2 B;  3G71 A;  3CCL T;  1IGU A;  3C12 A;  1WYX A;  1UB4 A;  2HAX A;  1TU0 B;  1PKT A;  1OPL A;  1K8A R;  1YN8 A;  2LNH B;  1B3Q A;  3LH5 A;  1YIJ T;  4M7D F;  1SHF A;  1QW1 A;  1KD1 C;  1SRL A;  1WQW A;  3PE0 A;  2K79 A;  4RCC A;  5I11 A;  2XI9 A;  1NJI C;  2LZ6 B;  1VQ9 A;  2DXT A;  2P4R A;  2VC8 A;  2J06 A;  2D8H A;  1VQO A;  4K11 A;  3M0T A;  1FXX A;  2ZCF B;  3EFR A;  1IB8 A;  2MWP A;  3OYB A;  1KHC A;  1M27 C;  4Z8A A;  3ULR B;  2IIM A;  1LVK A;  4HKE A;  3EH1 A;  1VYU A;  1VUB A;  4QT7 A;  2EYX A;  1IO6 A;  1ZSZ A;  3A8G B;  2YUN A;  1RAH B;  3EFO A;  4J7I A;  2OTL T;  1IXD A;  3QYH B;  4Z88 A;  3CME Q;  1VQK Q;  5IH2 A;  2E65 A;  1AT1 B;  5KYU B;  3M53 A;  1BBZ A;  4C92 C;  1VQ8 A;  1D3B A;  2OAW A;  2CYZ B;  2EPD A;  5GMK i;  1C1A A;  5LJ5 h;  3S3M A;  3JCM f;  1GXI E;  3H0I A;  1YHQ T;  1Q86 U;  2KE9 A;  2GBQ A;  3EG0 A;  3OY9 A;  4M77 B;  4GBQ A;  1U5S A;  3PVL A;  4OMP A;  1E6H A;  2RHY A;  4XTV A;  1WHG A;  3VU3 C;  2CZ7 B;  4LNP A;  3RMQ A;  1N5Z A;  1X2Q A;  2CP5 A;  4E7J A;  2M02 A;  1GRI A;  4M7D D;  1NEG A;  3CC4 T;  1KG1 A;  2NUP A;  4OML A;  3VYH B;  1IRE B;  4WCI A;  5IN1 A;  3LX7 A;  1RLQ C;  3P8D A;  3A5Z B;  4PJO A;  1OYX A;  1NM7 A;  5CVI A;  3J7A F;  3CQT A;  1AHJ B;  1PD1 A;  4C92 B;  1VQ4 A;  2DRK A;  3KUF A;  2LQ8 A;  1NG2 A;  2K3Y A;  2GQV A;  4M77 G;  4IUT A;  2YRC A;  4LDW A;  1PNJ A;  1M1F A;  2HEQ A;  3VRY A;  3H41 A;  2B86 A;  1LCK A;  4HVU A;  1OX9 A;  2NWM A;  3A8L B;  1K0X A;  4QKU A;  1WNL A;  5FWC A;  4N4H A;  4DEY A;  1H64 1;  4NL3 A;  1Y96 B;  3UAT A;  1ZBX A;  1M1G A;  5FRO A;  3CCJ Q;  1LOJ A;  4RG2 A;  4F16 A;  7AT1 B;  1RUW A;  2DIG A;  1AEY A;  2MAM A;  3WVE B;  1FYN A;  2RQU A;  5FLX E;  4ZN3 A;  1W6X A;  3MEV A;  1UGQ B;  3OYA A;  3CCU Q;  1I5O B;  3OYD A;  5KYW A;  2R5A A;  2LNV A;  3AT1 B;  5ECA A;  3OYY A;  3R6N A;  4HCK A;  3RES A;  2DL5 A;  1I07 A;  4PJO F;  3EGX A;  4QQG A;  3CCM T;  4O5V A;  2M0Y A;  2PQW A;  4XTY A;  1WJS A;  2CZ1 B;  5GAO m;  3EGD B;  1YBY A;  2NUT A;  4DBR A;  1N8R R;  1JRI A;  5DLQ E;  3OS5 A;  1QVF A;  2VXE A;  3WVD B;  4KBM B;  2EJG A;  5LJ5 g;  1ZUY A;  3L2V A;  4DOV A;  2QA4 Q;  1G3W A;  4C0G A;  2JM8 A;  3WXM B;  1WHH A;  5CO7 A;  3NMZ C;  2DL8 A;  4Y91 A;  3QJY A;  1R77 A;  4IUP A;  3I55 Q;  2P0K A;  2DF6 A;  1BKB A;  3CC2 Q;  2M0O A;  1Q86 C;  3L2U A;  4O6J A;  2PNI A;  1H92 A;  4J9E A;  4HT8 A;  1QCF A;  2EQI A;  4FYW B;  4BE1 A;  3OYK A;  4OP0 A;  3FDR A;  4FSS A;  4EMK C;  4XTU A;  2X51 A;  3VS1 A;  4C8Q E;  4PFO A;  2M9U A;  1QMC A;  2MIO A;  3E2U A;  8AT1 B;  2DLP A;  4E2F B;  2I0N A;  4L6V 5;  3I56 A;  3I9Q A;  4CC7 A;  1RAE B;  2JS0 A;  2VVK A;  3OYI A;  3PIO A;  3MHX A;  3EG9 B;  3MKD A;  1LJO A;  2RH2 A;  3RKY A;  1S72 A;  5GAM j;  4A4E A;  3BY7 A;  1GCQ A;  1QWF A;  2EGA A;  2CSI A;  1EFN A;  1M1K U;  2LJ3 A;  5GAN j;  3QHS A;  4NL2 A;  1YI2 Q;  4IUR A;  2O01 E;  3OSV A;  2AZS A;  3QSU A;  3IQL A;  2MI6 A;  2VAS A;  2RQT A;  1ACM B;  4M75 E;  2E6Z A;  1YWP A;  1VQL Q;  4QW2 A;  3PGG A;  3JCM J;  4E7K A;  3FJ5 A;  4C8Q A;  2RQR A;  4EMK B;  1YP5 A;  1FWZ A;  1G3S A;  2KSS A;  2KEA A;  1TUD A;  4QVC A;  1VQN Q;  2NYS A;  2YHT A;  1UGS B;  1YJ9 Q;  4RTT A;  1T0H A;  2E12 A;  3OW2 A;  3CC7 T;  2EIF A;  4J9G A;  4R0K A;  2K57 A;  2QQB A;  3NTK A;  3CCV Q;  1ABO A;  4F7U B;  2XK0 A;  2ZPB B;  3DKM A;  2DM1 A;  1T3L A;  3S3O A;  2KMT A;  1UHC A;  2EQJ A;  3ER0 A;  4XK8 E;  4M75 A;  2FEI A;  5A0D A;  1K73 U;  3QWX X;  4XQ3 A;  2HSP A;  2CSQ A;  4N4G A;  2DA9 A;  3HPW A;  1AVZ C;  3QZ9 B;  3V8J A;  1VQ6 A;  1ABQ A;  2AT1 B;  2ZPI B;  2DJQ A;  1PHT A;  4ME7 A;  1KFZ A;  2ZPE B;  3CBP A;  3MO8 A;  2LQK A;  3E9F A;  4JS4 A;  2X3X D;  1M30 A;  1G8X A;  2GCX A;  3MET A;  4BAC A;  3P8B B;  1YJW Q;  2LP5 A;  2A7Y A;  1WJQ A;  1K9M U;  2E3H A;  2DBK A;  2QQA A;  1KQS S;  1MUZ A;  2XG8 D;  1OUL A;  3SWN A;  4MZM A;  2KXD A;  1MGQ A;  4ZTF A;  4BUG A;  1I4K 1;  3PMT A;  3UF4 A;  3JB9 D;  5GAO q;  1VQ5 T;  3G7Z A;  3M4Y A;  3M9Q A;  1Q7Y U;  1V1C A;  3TU4 K;  5KYN A;  1I81 A;  4C92 F;  3I55 T;  1Q82 R;  3CCE Q;  5LJ3 g;  3P8H A;  2GQI A;  3X25 B;  1YIJ A;  2CP0 A;  3JCM d;  1NYF A;  3JCM e;  3BFM A;  1TUG B;  4RUG A;  4J8O A;  4JRP A;  1K0S A;  2HBW A;  2DXB A;  4EPC A;  1EX4 A;  3QWY A;  1JU5 C;  1BI0 A;  3JCM V;  2BE9 B;  1X69 A;  4M7A G;  2D9T A;  5LJ3 e;  1KHI A;  4F14 A;  2YWW A;  1RAF B;  2DL7 A;  1OZ2 A;  2ED1 A;  1VQP T;  1PSE A;  1TTH B;  4FSX A;  1AWX A;  2K4Y A;  1QQJ A;  2GTO A;  3CCR Q;  4PK4 A;  2K5F A;  1MV3 A;  3M58 A;  1MMA A;  5CQY A;  1M1K R;  1WZO A;  4OMF B;  2ROL A;  1JJ2 S;  2FVU A;  5IT9 E;  1Y07 A;  2V26 A;  2RPN A;  4PJJ A;  2ZAE A;  2DL3 A;  4M77 D;  5IAY A;  3OYE A;  1WHJ A;  3NHN A;  5D6W A;  3OYL A;  4C0D C;  2OTL A;  5AYF A;  4M78 B;  1PD0 A;  4JLG A;  2YUP A;  1W1F A;  2MOX A;  2L89 A;  1ZUK A;  3PVQ A;  2RQV A;  3JB9 J;  4ZGJ B;  2QGF B;  4MMK A;  5DLO A;  2YLC A;  1YHQ A;  4BB7 A;  4JZ4 A;  3VS2 A;  2XMF A;  2RHI A;  2L5Q A;  2EGE A;  5J39 A;  4OGC A;  2JMA A;  2Y4X A;  4PFZ A;  3JCM b;  1NZ9 A;  1KQ1 A;  2EJ9 A;  1X43 A;  4M4Z A;  2OX7 A;  1Q81 R;  3CD6 Q;  1MMD A;  1WHK A;  2DTI A;  4C92 D;  3RMS A;  1IGQ A;  1PCX A;  3VUB A;  1ZSZ B;  2LDM A;  4M7D E;  3CC4 A;  3GF5 A;  4FM4 B;  1N27 A;  1M3C A;  2Z0W A;  3ME9 A;  3TSZ A;  1DJ7 B;  2BZ8 A;  3RBB B;  1B34 B;  1M2V B;  3LYI A;  2MMP A;  2DZ9 A;  3GNF B;  2V1Q A;  4FW2 A;  4J9F A;  2SEM A;  4MZP A;  3HTR A;  5LJ5 f;  1K9M C;  5GAM g;  3HL8 A;  4CI0 C;  3VKI A;  2CP6 A;  2OTJ Q;  4RTX A;  4KH1 B;  5GAO l;  1WJR A;  5GAN g;  2IG0 A;  3EFS A;  2DET A;  2PVO B;  3RKW A;  3JCM W;  1RAI B;  2HCK A;  1W2B A;  1S1N A;  3GOX A;  1D0Z A;  4FT4 A;  2LRQ A;  1D0X A;  3L2Z A;  3VS0 A;  3EGU A;  4J5Y A;  3RNJ A;  2ABL A;  2KQW A;  2QQ9 A;  4JUV A;  4M7D A;  2DVJ A;  2EQK A;  2DFU A;  2LCS A;  4BD3 A;  4X9C A;  2RI2 A;  1BCM A;  1QWE A;  2J6K A;  3CCQ Q;  1PRL C;  3L2R A;  2OJ2 A;  2VKN A;  2AK5 A;  4Z02 A;  4IIO A;  1YIT T;  3MCA B;  2FZG B;  3TQ7 P;  1G3T A;  3REB B;  3U23 A;  5GMK j;  5HCK A;  3CCM A;  5GAN 3;  2GFU A;  2JTM A;  3MP1 A;  3REA B;  2RHZ A;  2VGM A;  1LPL A;  4XTX A;  4F7U F;  1M90 R;  4JRQ A;  4Q5W A;  3FLG A;  1H3H A;  3E9G A;  3CXC S;  1K8A C;  2KRM A;  1GL5 A;  1FMW A;  1QCN A;  1ZHI A;  4J9I A;  1E6G A;  3INZ A;  1AD5 A;  2X3W D;  2VUB A;  3GIB A;  1V29 B;  1WPY A;  2P0P A;  2X4X A;  1NPP A;  4PJO G;  2EQU A;  3ZEH A;  3QZ5 B;  4CC3 A;  1I1J A;  2DD5 A;  2OI3 A;  5FRN A;  4KGV B;  1UJY A;  4BDZ A;  4OF1 A;  4MDW A;  3DB3 A;  2X9H A;  3JB9 I;  5KYW B;  2H3E B;  2KRS A;  2K2V A;  4QVD A;  2XDB A;  1R8O B;  3EGX B;  4CC2 A;  2W10 A;  2D0N A;  2PVD B;  4M77 C;  3FJP A;  3G4S Q;  2QEX T;  4N0A C;  1WXB A;  1MNE A;  2KI7 A;  1KK7 A;  1VQM T;  2QI2 A;  2GNC A;  5GAO n;  5KYX A;  1JEG A;  1N8R U;  1QKX A;  2FHD A;  3G6E T;  4AFU C;  3VS5 A;  2IPO B;  2ECZ A;  4D6W A;  2CP2 A;  1U1S A;  4OVA A;  2DTO A;  2DL4 A;  4XU3 A;  2EW3 A;  4RTZ A;  1W2B P;  2RK1 A;  2HQH A;  3RER A;  1NJI R;  4PJO E;  5KH6 A;  1N6A A;  1D0Y A;  2K9G A;  2I2L A;  2CS7 A;  1VQ7 Q;  3L1A A;  2DE0 X;  1GFC A;  4LN2 A;  3O8V A;  3G71 Q;  1C0M A;  3E1S A;  1NYG A;  1BCO A;  2BTT A;  1M2O A;  1IRX A;  3UA6 A;  2M51 A;  3O5Z A;  2OTJ T;  4HCZ A;  4RTW A;  5GMK h;  1VYT A;  3M4G A;  5LJ3 f;  3UPU A;  1RAD B;  2FB7 A;  4KUL A;  3CC7 A;  2EFI A;  3OMC A;  3SB2 A;  3QPH A;  3TSW A;  1VQ9 Q;  3OSS C;  4E7Z A;  3MP8 A;  3H6Z A;  1OU9 A;  1VQO Q;  1OEB A;  2CH4 A;  3V8L A;  2JNG A;  3J81 E;  3HSB A;  2YRD A;  1K1Z A;  2DEU A;  4RTU A;  1D1B A;  3M0U A;  1SRM A;  1HD3 A;  1Q95 G;  1BYM A;  3QII A;  4HT9 A;  3I35 A;  4X1V A;  5HKC A;  5J26 A;  4UC4 A;  2HNI A;  4C8Q B;  2DTH A;  3FRN A;  3LWH A;  2ROT A;  4YTL A;  3CCS T;  2QYZ A;  4BI3 A;  2QGG A;  1M9S A;  4JDS A;  4XTZ A;  2ZPG B;  5FW9 A;  2P0Q A;  1VQ8 Q;  3VS3 A;  1ZSG A;  4EMG A;  3CMA T;  4HCB A;  2KVQ G;  4HVV A;  3PNW C;  1RI0 A;  2LX7 A;  2YSQ A;  4C5G A;  3HFN A;  3VV0 A;  1XTD A;  3G1J A;  2CP7 A;  2L3R A;  1TOV A;  1WX6 A;  1VQ5 A;  1YJN T;  3OQ5 A;  5IXB A;  2JMC A;  3SDZ A;  1AOJ A;  4AFQ C;  1G3Y A;  4FYV B;  5FU7 C;  3I55 A;  4M75 B;  3GBQ A;  1RAA B;  2F2V A;  3A98 A;  3V8K A;  4C8Q G;  1RLP C;  1WQ7 A;  1MND A;  2L3P A;  2ZGW A;  4ANJ A;  2A08 A;  2XDP A;  3JCM P;  2O9V A;  1H8K A;  2DMO A;  1UHF A;  2BZX A;  2DXU A;  1P92 A;  3NGP A;  4EDU A;  4V2S A;  2CRE A;  2QG9 B;  4M78 D;  2CDT A;  2RQW A;  1VQ4 Q;  1VQP A;  2KYM A;  1OQK A;  2CUB A;  1SPK A;  2PU9 B;  4R56 A;  3BDU A;  2X4J A; 
#chains in the Genus database with same CATH homology
 1PHT A;  1KFZ A;  1PRM C;  1GCP A;  1AWJ A;  1TG0 A;  2X3X D;  3EHR A;  1M30 A;  2MCN A;  4RTV A;  1PKS A;  1YWO A;  2RF0 A;  4Z89 A;  2LP5 A;  1AWW A;  2AKL A;  1AZG B;  2DBK A;  3M0R A;  1MUZ A;  1ZLM A;  1YCS B;  2FRY A;  2KXD A;  1K76 A;  2DX1 A;  2G6F X;  3UF4 A;  3EG3 A;  4J9C A;  2H8H A;  5IXF A;  1V1C A;  2LJ1 A;  2AZV A;  2K2M A;  1UTI A;  4OMQ A;  3KFV A;  3I5S A;  2YUQ A;  1WLP B;  2CT3 A;  1JXO A;  3ZL7 C;  1HJD A;  2A36 A;  2GQI A;  1FMK A;  1KJW A;  1NYF A;  2YUO A;  4OMN A;  1GFD A;  4RUG A;  1K0S A;  1T0J A;  2HBW A;  1AWO A;  3NPF A;  3QWY A;  4J9B A;  4OMM A;  2D8J A;  1JU5 C;  3EG2 A;  2O2O A;  2YT6 A;  1X69 A;  2BZY A;  4CC4 B;  4F14 A;  2JT4 A;  2W0Z A;  1VA7 A;  4AFS C;  2DL7 A;  2ED1 A;  1AWX A;  2EYY A;  2GTO A;  1J3T A;  1MV3 A;  4ORZ A;  1I0C A;  4ESR A;  1UGV A;  2KNB B;  5IHN A;  1UG1 A;  2CH4 W;  3SHW A;  1UEC A;  2ROL A;  2KBT A;  2RPN A;  2DL3 A;  2JW4 A;  3NHN A;  1U06 A;  4JZ3 A;  2KXC A;  5EC7 A;  1AZE A;  1JO8 A;  2LMJ A;  4F17 A;  1NLP C;  2YUP A;  1W1F A;  2DNU A;  1RI9 A;  2MOX A;  2GGR A;  1ZUK A;  3VS7 A;  1KIK A;  3PVQ A;  2RQV A;  1Y57 A;  2GTJ A;  3VS4 A;  4IIM A;  1WYX A;  1OPK A;  4J9D A;  1PKT A;  1OPL A;  2NUZ A;  1YN8 A;  2LNH B;  1WA7 A;  4HXJ A;  1B3Q A;  4JJC A;  3LH5 A;  4JZ4 A;  3VS2 A;  2XMF A;  1SHF A;  4GLM A;  3EHQ A;  2EGE A;  5IHI A;  1SRL A;  1X6G A;  2RMO A;  2JMA A;  2EYZ A;  3PE0 A;  2YDL A;  1PWT A;  2K79 A;  1WXU A;  2V1R A;  5I11 A;  2ENM A;  1X43 A;  2J05 A;  4M4Z A;  2LZ6 B;  1Y0M A;  5GJW B;  1OV3 A;  2P4R A;  4HVW A;  2J06 A;  1X6B A;  2KT8 A;  2D8H A;  4K11 A;  3M0T A;  1M3C A;  3TSZ A;  2BZ8 A;  3JV3 A;  3RBB B;  1M27 C;  4Z8A A;  3ULR B;  2IIM A;  1VYU A;  1YNZ A;  4QT7 A;  4LUD A;  2EYX A;  1TUC A;  3M0P A;  1IO6 A;  2V1Q A;  4J9F A;  2SEM A;  3M0Q A;  2FPD A;  2YUN A;  2J7I A;  4RTX A;  2JXB A;  4Z88 A;  1ZUU A;  1W70 A;  5IH2 A;  2HCK A;  1S1N A;  1BBZ A;  1UFF A;  4ZNX A;  2OAW A;  2EPD A;  1QKW A;  2D1X A;  3H0I A;  3VS0 A;  3EGU A;  3RNJ A;  4LE9 A;  2C0T A;  2ABL A;  2KE9 A;  2QDL A;  3H0F A;  5GJV B;  3UA7 A;  2GBQ A;  3EG0 A;  2DVJ A;  1SEM A;  4GBQ A;  1U5S A;  2LCS A;  3PVL A;  4OMP A;  3VS6 A;  1WIE A;  2EBP A;  1E6H A;  1QWE A;  1Z9Q A;  1U3O A;  2J6K A;  4AG2 C;  1PRL C;  4LNP A;  4OMO A;  1N5Z A;  1T3S A;  1X2Q A;  1SSH A;  1GRI A;  1XOV A;  1NEG A;  4JPB W;  2OJ2 A;  2VKN A;  2AK5 A;  4OML A;  4IIO A;  4AG1 C;  2KRN A;  1CKB A;  4AFZ C;  1BK2 A;  2EKH A;  4WCI A;  3REB B;  3U23 A;  1RLQ C;  2L0A A;  5HCK A;  1NM7 A;  4D8K A;  3CQT A;  3REA B;  2VWF A;  2L3S A;  1HSQ A;  4DEX A;  2DRK A;  2FO0 A;  1H3H A;  1KSW A;  2L3Q A;  1B07 A;  1NG2 A;  3EG1 A;  2KRM A;  1GL5 A;  1JQQ A;  1UE9 A;  1NLO C;  1PNJ A;  2K6D A;  2HEQ A;  3VRY A;  4EIK A;  2CUD A;  3H41 A;  2B86 A;  4J9I A;  1E6G A;  1AD5 A;  1LCK A;  2X3W D;  4HVU A;  2NWM A;  2LQN A;  2SRC A;  1K0X A;  4CC3 A;  2DYB A;  1I1J A;  1UUE A;  2OI3 A;  5FWC A;  4DEY A;  1UJY A;  3UAT A;  1ZX6 A;  2CT4 A;  2LQW A;  3I5R A;  4LUE A;  2K7A A;  2KRS A;  2DBM A;  4F16 A;  4D8D A;  2RNA A;  4CC2 A;  1RUW A;  2W10 A;  1AEY A;  2D0N A;  1E7O A;  1JXM A;  2A37 A;  1FYN A;  2C0I A;  1WXB A;  2RQU A;  2KR3 A;  1W6X A;  1BU1 A;  2F2X A;  2GNC A;  1OOT A;  1JEG A;  5ECA A;  3R6N A;  4HCK A;  2DL5 A;  1I07 A;  1QKX A;  4AFU C;  2C0O A;  1G83 A;  1M3B A;  3VS5 A;  2M0Y A;  1CKA A;  2ECZ A;  1A0N B;  4JJB A;  4A63 B;  2DL4 A;  1WI7 A;  1CSK A;  2EW3 A;  4RTZ A;  1Z9Z A;  1X2K A;  2EYW A;  2PTK A;  2K9G A;  1ZUY A;  1WXT A;  2DE0 X;  2FG0 A;  1GFC A;  1M8M A;  4LN2 A;  2RN8 A;  2JM8 A;  4J9H A;  3NMZ C;  2DL8 A;  1NYG A;  2L2P A;  2BTT A;  2DF6 A;  3UA6 A;  2M51 A;  1GBQ A;  3THK A;  2KGT A;  2KT1 A;  1WFW A;  2LJ0 A;  3O5Z A;  4RTW A;  2PNI A;  3M0S A;  4Y92 A;  4J9E A;  1H92 A;  1M3A A;  1VYT A;  1QCF A;  2EQI A;  2DRM A;  1ARK A;  4FSS A;  3H0H A;  1NEB A;  3VS1 A;  2ED0 A;  3TSW A;  1X27 A;  2MIO A;  2DLP A;  2JM9 A;  2EGC A;  2I0N A;  1OEB A;  2CH4 A;  3I9Q A;  2F2W A;  4CC7 A;  2JS0 A;  1K1Z A;  2VVK A;  4RTU A;  3M0U A;  1SRM A;  1HD3 A;  2KYB A;  5FWB A;  2KRO A;  1K9A A;  4RTY A;  1VYV A;  3I35 A;  5I22 A;  4X1V A;  4KRT A;  1GCQ A;  1QWF A;  2EGA A;  2CSI A;  3SEM A;  1EFN A;  2LJ3 A;  2ROT A;  1GBR A;  2AZS A;  3IQL A;  2A28 A;  1BB9 A;  2RQT A;  3TVT A;  5FW9 A;  2FPE A;  1YWP A;  1ZBJ A;  1G2B A;  2J6O A;  3FJ5 A;  3VS3 A;  3VRZ A;  1ZSG A;  2RQR A;  1YP5 A;  4HVV A;  2KEA A;  1TUD A;  2LX7 A;  2YSQ A;  2O31 A;  2J6F A;  4RTT A;  1SHG A;  1WX6 A;  1T0H A;  4E6R A;  5IXB A;  2JMC A;  1AOJ A;  4AFQ C;  4J9G A;  4R0K A;  2HDA A;  3GBQ A;  2F2V A;  3A98 A;  5L23 A;  1ABO A;  2PZ1 A;  1MV0 B;  1RLP C;  2ESW A;  1QLY A;  5IHK A;  2DM1 A;  2L3P A;  1T3L A;  2DIL A;  2A08 A;  2O9V A;  1H8K A;  2O9S A;  1GCQ C;  2DMO A;  1UHF A;  1UHC A;  2FPF A;  2BZX A;  4JJD A;  3NGP A;  2JS2 A;  2FEI A;  2CRE A;  3QWX X;  1WDX A;  2EVR A;  2O88 A;  2E5K A;  2HSP A;  2CSQ A;  2DA9 A;  1AVZ C;  1UDL A;  2CDT A;  1UJ0 A;  2K3B A;  2RQW A;  2AKK A;  2JTE A;  2KYM A;  2CUB A;  1SPK A;  2FRW A;  1ABQ A;  3C0C A;  1K4U S;  2DJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...