4HVWA

Crystal structure of the t98e c-src-sh3 domain mutant in complex with the high affinity peptide vsl12
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
GSHMTFVALYDYESRTEEDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Atomic resolution structures of the c-Src SH3 domain in complex with two high-affinity peptides from classes I and II.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein/peptide
total genus 9
structure length 61
sequence length 61
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4hvwA00
4M4ZA 1ZUYA 4CC2A 5I11A 2K7AA 2DL4A 1RUWA 2J7IA 4D8KA 2F2XA 1T3SA 2BZXA 2L3PA 4Z8AA 5ECAA 2ENMA 4QT7A 3VS1A 2AKLA 2JS2A 1OOTA 1T0JA 4K11A 1TUCA 1LCKA 4OMNA 1YN8A 1AWOA 2O9SA 4J9BA 3UA6A 1BK2A 1W1FA 2EQIA 2KNBB 4LUEA 1UE9A 2ECZA 2KYBA 1I1JA 2GBQA 2P4RA 3TVTA 4RTUA 2DX1A 2DNUA 2EVRA 3VRZA 3I9QA 4J9DA 1KIKA 2YUPA 3GBQA 2O88A 3PVQA 1K0SA 5IHNA 2ED1A 2CREA 1T0HA 2AK5A 2FPDA 1AZEA 4X1VA 1PRMC 3M0UA 2D1XA 1UJ0A 1J3TA 2C0TA 4GBQA 2X3WD 2YSQA 1PRLC 2F2VA 1VYUA 1WX6A 2L2PA 4F17A 2ESWA 1SRMA 4J9GA 2MOXA 1GBRA 2GNCA 2JMAA 3RBBB 1ABOA 2HEQA 2W0ZA 3M0TA 1UUEA 3M0PA 3UA7A 2EW3A 2A36A 2SRCA 2L3SA 1IO6A 1QKWA 2LQWA 2LX7A 1QLYA 1HD3A 3O5ZA 1WXTA 1FYNA 2CUBA 2V1QA 2CT3A 2ROLA 2L0AA 5IHIA 4HVUA 5FWBA 1MUZA 1I07A 1Y57A 2OI3A 2J6KA 1BU1A 1H92A 3UATA 1JU5C 2LQNA 1BBZA 1AOJA 2EPDA 2PTKA 2KRNA 1SHFA 1UDLA 2DL5A 3NGPA 2CDTA 2FRYA 2DF6A 1E6GA 2YT6A 4HVWA 4AG2C 2DJQA 2EBPA 1YCSB 1UG1A 4F14A 1AZGB 4OMQA 1ZBJA 3EG1A 4R0KA 1NLPC 2GGRA 4OMLA 2JM8A 4J9IA 2OAWA 2DRKA 5GJWB 1W70A 1UHFA 2BZ8A 2O31A 4EIKA 2RQVA 2KEAA 1K1ZA 2FEIA 1E7OA 5L23A 3QWYA 1PNJA 2F2WA 4KRTA 2CSQA 1PKSA 1E6HA 2KT8A 5FWCA 1NYGA 2RF0A 3H0FA 1WYXA 1K76A 1X6BA 1GCPA 2JS0A 2LJ1A 4RTVA 1GCQC 3I35A 3M0SA 2EGCA 2DMOA 1HSQA 1Z9ZA 3EG0A 4RTZA 4ORZA 3EGUA 3M0RA 1JXMA 2ABLA 2XMFA 1RI9A 4Z88A 3RNJA 2J05A 1H8KA 3C0CA 2C0OA 2RNAA 3ZL7C 3QWXX 2K79A 1Y0MA 3EG2A 4HVVA 2MCNA 2RN8A 4DEYA 2KR3A 1X2QA 2LJ3A 2DILA 4J9FA 2J6FA 3VS2A 4JZ4A 3CQTA 2DL3A 3H0HA 4F16A 2EYYA 4AG1C 2BTTA 3REAB 1QCFA 2EYXA 1YNZA 1AWJA 1M30A 2EYWA 1QKXA 2AZSA 4JJBA 1K0XA 2CSIA 4HXJA 1GFDA 1AVZC 5FW9A 1KSWA 2YUQA 1GL5A 1OEBA 3EHRA 1XOVA 4IIOA 1SHGA 1JQQA 1NEGA 2OJ2A 2GTJA 2LP5A 1K4US 2MIOA 1NM7A 2AKKA 2DVJA 3KFVA 1SPKA 4DEXA 2A28A 2PZ1A 1WFWA 2HDAA 2D8JA 2JXBA 5IXFA 1ABQA 2CH4A 3R6NA 1ARKA 1GFCA 2EYZA 1ZX6A 3VS3A 2DRMA 2CH4W 4RTYA 1ZSGA 1X69A 4J9EA 3ULRB 1UHCA 4E6RA 3LH5A 2VKNA 1ZLMA 2GQIA 3UF4A 2KE9A 3EG3A 1PHTA 1WXUA 5I22A 2JTEA 1SRLA 1U06A 4RUGA 4LUDA 2FG0A 2JMCA 2AZVA 2BZYA 4LN2A 1NYFA 1X2KA 5IHKA 2M51A 1CKAA 1ZUUA 2X3XD 1MV0B 2VWFA 2DM1A 2ROTA 2EGEA 3REBB 4AFUC 2NWMA 1QWFA 4AFSC 1GBQA 1K9AA 2FO0A 4OMPA 3IQLA 2KXDA 2A37A 3NHNA 3VS4A 3PE0A 1JXOA 3SHWA 4Z89A 4OMMA 4CC4B 2ED0A 2K2MA 1UTIA 1X43A 3NPFA 1UGVA 1A0NB 2RQTA 2NUZA 1GCQA 1WDXA 1SSHA 4RTXA 4LE9A 1U5SA 1G2BA 4ZNXA 1AWWA 1NG2A 2YUNA 1OPKA 2RQUA 1RLQC 2RMOA 5IH2A 4FSSA 1AWXA 1OV3A 4J9CA 1WA7A 2O2OA 5HCKA 3VS7A 4AFZC 4A63B 3JV3A 1YP5A 4JPBW 1HJDA 4CC3A 2HSPA 2KT1A 1JO8A 1WXBA 1V1CA 1UFFA 2GTOA 1G83A 2B86A 2HCKA 4ESRA 2CUDA 3SEMA 3EHQA 4CC7A 1KFZA 2LJ0A 1T3LA 1X27A 1U3OA 1MV3A 3NMZC 2K9GA 2EGAA 1FMKA 5EC7A 2KGTA 2LCSA 3U23A 2FRWA 4JZ3A 3TSWA 2KRSA 3TSZA 2I0NA 4WCIA 1S1NA 2FPEA 2KROA 3VRYA 4IIMA 4GLMA 2KBTA 3M0QA 2K3BA 2LNHB 2H8HA 2KYMA 1RLPC 3A98A 2L3QA 1TG0A 1KJWA 2K6DA 2DLPA 2EKHA 1EFNA 1AD5A 1B3QA 2RPNA 3THKA 2HBWA 2KRMA 3FJ5A 1VA7A 3PVLA 1B07A 4JJDA 4LNPA 2DL8A 2DA9A 1W6XA 1YWOA 2YUOA 1ZUKA 2DL7A 2CT4A 1UJYA 1YWPA 2D8HA 2RQWA 3I5SA 2G6FX 2JW4A 1M3CA 3H0IA 1I0CA 1M8MA 1SEMA 1NLOC 2KXCA 2QDLA 2DYBA 2E5KA 1CSKA 2JT4A 1AEYA 2DBKA 1QWEA 1H3HA 2A08A 1GRIA 4JJCA 4HCKA 3VS5A 2LZ6B 3H41A 2LMJA 1WI7A 1Z9QA 1PKTA 1CKBA 4OMOA 4D8DA 2C0IA 2O9VA 2SEMA 3VS0A 3VS6A 4AFQC 5GJVB 2VVKA 3I5RA 5IXBA 2RQRA 1VYVA 1VYTA 1UECA 2DBMA 1JEGA 2W10A 1N5ZA 4RTTA 2V1RA 2M0YA 2FPFA 2PNIA 4J9HA 1WLPB 2DE0X 2IIMA 2YDLA 4RTWA 1OPLA 2JM9A 1M3AA 1BB9A 1TUDA 1PWTA 2D0NA 2J6OA 1X6GA 1M27C 1WIEA 1M3BA 2J06A 1NEBA 4Y92A
chains in the Genus database with same CATH superfamily
4PL6A 3MCAB 1G5VA 3V8LA 5CKBA 2J7IA 4D8KA 3JB9G 3CCRA 2F2XA 2KVQG 5KYYB 1JJ2S 4JRKA 5A0GA 1PM3A 2AKLA 3VS1A 4EMGA 4IUQA 1TUCA 1LCKA 4OMNA 2FZCB 1YI2Q 1S72A 1Q82C 4M78B 1UEBA 2DTIA 3HRTA 4RTUA 5EG2A 4JS5A 5LJ5h 4PJLA 4M75F 2DX1A 5CQXA 2LT1A 4J9DA 1BKBA 2YUPA 1W2BS 3PVQA 4M78C 5C0MA 5IHNA 2ED1A 2CREA 1QVFA 1PCXA 4X1VA 2QQAA 2A3LA 1UJ0A 2C0TA 4GBQA 2YSQA 1LNXA 3SB2A 2PQWA 3CCST 2RJDA 3QZ9B 4KULA 1TWBA 2GNCA 2OTJT 1MMGA 3OB9A 1X6OA 3M0PA 1FMVA 3CCJT 2FHDA 2SRCA 4M75D 1IZ6A 3OSSC 3VYHB 1QKWA 2DXTA 3CBOA 1QLYA 4B6MA 3O5ZA 2CUBA 3CMEQ 3CCVQ 4LXCA 3CPFA 4N0AC 1Q95G 3LX7A 1N27A 3HRSA 3QPHA 4PK4A 1M1KC 1WJSA 2L89A 1JB0E 2EJ9A 2E1HA 2RJEA 2HNIA 5CKHA 1H92A 2LQNA 2PTKA 2WSCE 2FRYA 2DF6A 5FRMA 2EBPA 4B9WA 1V76A 1KC8U 1G3WA 4HCCA 1AZGB 1ZBJA 3EG1A 2C06A 8AT1B 4J9IA 4LDVA 2P0QA 2VUBA 1MMNA 4M77B 2O31A 4R55A 1H3ZA 1HK9A 5I21A 2FEIA 1E7OA 1XTDA 2F2WA 2LCCA 2KY9A 1C1AA 2KT8A 2EIFA 2RF0A 1WYXA 1X6BA 2JS0A 1WHMA 4M77C 2CP6A 1BYMA 3CCLA 3I35A 1UGSB 2ZPFB 3M0SA 4M7AG 1SG5A 4HCBA 3CCEQ 1HSQA 1N8RR 3EG0A 2E6ZA 4ORZA 2QXFA 2ABLA 5GAN8 3CCLQ 3JCMP 2XMFA 1RI9A 4DBQA 4CRIA 1K8AU 3FIFA 4VUBA 3Q1JA 1OX8A 3UDCA 1D1CA 1FWZA 3V7SA 1Y0MA 4HVVA 4DEYA 2RN8A 3LLRA 5KYYA 3CC7A 4OGEA 2DILA 1VQKQ 4J9FA 2OTLT 3OYAA 1Q7YC 1U1TA 4M7DA 2RD1A 2LTOA 4F16A 4J6WA 2HQEA 3CC7Q 3QDFA 4LD9K 1YIJQ 2HL5C 1YNZA 3MHXA 1M30A 2EYWA 1QKXA 4JJBA 1VQOA 3CCMT 4OVAA 1YHQQ 2FVUA 5GAOq 5FW9A 5KH6A 2YUQA 3TCJA 1GL5A 4Y91A 1WHLA 1OEBA 2KK4A 3EHRA 3PIPA 1JQQA 1VQ6A 3WVEB 4GLKA 3HHTB 3I55A 1GXIE 2LP5A 1K4US 4RCCA 2AKKA 3KFVA 2XDDA 1VQPT 2JXBA 4DBFA 1VQ6Q 2CZ0B 4PFZA 2QTVA 1OQKA 1GFCA 2MI6A 5GAOm 1BI1A 2DRMA 1K8AC 4F7UF 3CC4T 2CZ7B 4N0AA 4E6RA 2VKNA 2BIVA 4OB0B 1M4ZA 2KE9A 3OYNA 3MP1A 3VYGA 3T9NA 1SRLA 2F5TX 4QQGA 3E1SA 4RG2A 2QDYB 1C6VX 2ZCFB 4E7SA 5IHKA 5KYXA 2X3XD 1P92A 3BDLA 2OAUA 4FT4A 2DM1A 2ROTA 3F70A 4IURA 5J3BA 3X26B 4JLGA 2DVEA 3PMTA 4AFSC 1GBQA 4C92E 1IRXA 1K9AA 4OMPA 3QIIA 3JCMe 1C0MA 2JTMA 4X34A 1Q81R 1G3YA 2EQMA 4UC4A 2DZ9A 3GNFB 3NTHA 2MMPA 1X43A 3EGXA 3M58A 1WJRA 1Q86U 2NUZA 1FXXA 1KQSP 1AT1B 1RL2A 4M77A 1SSHA 4RTXA 2DZCA 1SSFA 2RMOA 3RR6A 3JB9I 3C4SA 3RERA 1TH7A 1YITA 1OV3A 4J9CA 4OB3B 5HCKA 2DK3A 3E9FA 5GANj 3H9NA 1YP5A 4JPBW 1YITQ 1HJDA 4CC3A 5CKEA 1XJWB 1JO8A 1VQ8T 2B86A 5GMKe 2YLBA 4ZGDB 5GANh 2DKGA 4BY6B 2RHZA 1T3LA 1X27A 5LL6S 1MV3A 4JUVA 4C0DB 2K9GA 4ME7A 1RAEB 2KGTA 2FRWA 2JTFA 4D6WA 1HYOA 4PLIA 1YI2T 1VQNQ 4WCIA 5CAIA 1S1NA 2FPEA 2KROA 3M55A 3JCMg 3N5BB 3RMQA 4BY6C 4IIMA 1JJ2P 4C0DC 4DBHA 3GPLA 2MYSA 2L3QA 3O8VA 3CMAA 2QEXQ 1Y96B 2HKQB 4PKCC 5GAN7 1Y07A 3TREA 2E41A 1EFNA 2E12A 1VOMA 3THKA 5CO7A 5DLOA 5GANf 2HBWA 1MNEA 2FL7A 1YWOA 1ZUKA 1W2BP 2CT4A 2COYA 1UJYA 3S3NA 3EFRA 2G6FX 2JW4A 5LJ3e 3H0IA 2X4JA 1ZBXA 1SEMA 1UGPB 3DB4A 1TXQA 2KXCA 5FU6B 1VQMQ 2DYBA 4C0FA 3HL8A 2DBKA 1QWEA 2A08A 3BY7A 3LYIA 4M75A 3CD6T 5CVIA 2V8JA 2BUDA 3H41A 3CMET 3CC2A 4PJOB 3M4YA 4C8QD 4M7DF 5FU6C 4OMOA 1AHJB 4M78F 4FW2A 2C0IA 2O9VA 5GAOl 3CC2Q 5GAN6 3VS6A 5GJVB 2VVKA 5IXBA 2RQRA 4KBMB 1VQ4A 5FLXE 5D6WA 3MKDA 1TU0B 4O5VA 4F04B 1X75C 2DBMA 3VJPA 4PJOC 2W10A 1N5ZA 3G7ZA 4PFPA 1IGUA 3QO3A 3A1PA 1VQ4Q 5KCHA 4XK8E 3J80E 2DE0X 3G6EA 1OPLA 3SDZA 5GAN3 1M3AA 4AT1B 1TSFA 1TUDA 1ACMB 1PWTA 2EQKA 3MJXA 2J6OA 1M27C 3G6EQ 2ZZDA 2ZPGB 2J06A 1NEBA 4M4ZA 5I11A 2K7AA 4M78D 4C5IA 2G3RA 3TEEA 5LJ3g 1RAAB 1T3SA 2BZXA 4DQ2A 3PNWC 4Z8AA 2H3EB 1T0JA 3TQ7P 3P8DA 1M2VB 3SWNA 2GFAA 1Q86R 3CCET 2NUPB 3JCMd 4J9BA 1VUBA 1BK2A 1LPLA 1UE9A 2ECZA 3MP8A 1X01A 1I1JA 2GBQA 2P4RA 8ATCB 3QG1A 3CCMA 3NFCA 5D6XA 4BB7A 3OYYA 2DNUA 1QVGP 1VQ9T 1KIKA 2EQJA 4B9XA 5IN1A 2K3YA 3RUXA 2QQSA 2AK5A 4KUDK 1HXDA 1QP2A 1VQKT 1I8FA 5FRNA 4DA4A 1PRLC 2L2PA 3V8JA 1YIJT 2K5FA 2MOXA 4J83A 2HZYA 4NOYA 2D9TA 3QJ6A 4M77F 1YHQT 3G1JA 1VIEA 2HEQA 2W0ZA 3M0TA 1UUEA 3PFSA 3UA7A 1PC0A 3OYBA 1RAHB 2R5AA 2XK0A 4YTLA 1IO6A 2LRQA 4J7IA 1TOVA 1WPYA 1WXTA 2MK5A 3X28B 1YJNT 2CT3A 5GAMg 1N9RA 5IHIA 3MEAA 2M16A 5FWBA 1MUZA 2FB7A 1Y57A 1KQSS 4EMKB 2BE9B 4WF2A 2OI3A 2J6KA 4NL3A 4C92G 2VGMA 4JDSA 1XQHA 1Q82U 3UATA 1JU5C 1RACB 4JRQA 1AOJA 2EPDA 3M56A 2KRNA 1SHFA 3VUBA 4PNOA 1E6GA 2MF2A 4EMKC 5LJ5e 1UG1A 2E3IA 3QUIA 2MAMA 4PJOA 4C8QB 1NLPC 2PVOB 1YJWA 1KHCA 2JM8A 4PFOA 3JCMW 2YLCA 4FM4B 2PUKB 2QTXA 2OAWA 2DRKA 5GAOp 1UHFA 3OYLA 2BZ8A 4C5HA 3ZFJA 2RQVA 4AMCA 2RK1A 2QQBA 2VGNA 1U8RA 5L23A 2E4HA 1PNJA 2RHYA 4C8QC 1YJ9A 2CSQA 5FWCA 4JRPA 4F7UA 4RG8A 4FYXB 1WZOA 1BIAA 1GCQC 1YJ9Q 2DEQA 4KUIA 2DMOA 4XAXB 3HFNA 1Z9ZA 3EGUA 3M0RA 1JXMA 2YRVA 2WSEE 1OYXA 1EIFA 5KE2A 1OZ2A 3CCRQ 4QVZA 1JJ2A 1M5Q1 3EH2A 2O4XA 4IUPA 2JVVA 2DTOA 2CP7A 1VIFA 1S72Q 2KR3A 1M1KU 2M0OA 4KH0B 4JZ4A 2LQ8A 3OYDA 1M2VA 1WHGA 3CQTA 2DL3A 3H0HA 3G4SA 3A5ZB 2EYYA 5LJ5g 1OU9A 3VKIA 1WQ7A 2ZPBB 3EG9B 3G4SQ 4N4HA 1K73U 1K0XA 4ZGEB 1NJIR 1GFDA 1KSWA 1QVFS 2HQXA 2A7YA 4IIOA 1SHGA 1NEGA 3OMCA 1OX9A 2OJ2A 4FIBA 2RI5A 4A53A 1NM7A 2DVJA 5GAMd 4DEXA 1OU8A 1VQNT 2YHTA 4ZN3A 1WFWA 2D8JA 2EJGA 5IXFA 2E64A 3OS1A 5DY9A 3OW2P 4IUVA 4NL2A 1ARKA 1MMDA 4P5NA 2XD0A 1ZX6A 1VQLA 1OZ3A 1X69A 4J9EA 4M7DE 2QEXT 4ZTFA 3RDVA 3LH5A 3CD6A 3OA6A 1ZLMA 1BCMA 2BKDN 2YXYA 5I22A 1D0XA 4FL6A 4HT8A 2FG0A 2JMCA 3V7RA 2QI2A 2RO0A 2BZYA 3OYFA 3TU4K 2X35A 2HKNA 4QKUA 5M9OA 3EGDA 1K73C 1MV0B 2VWFA 3JB9D 5A0LA 5KYWB 5J26A 1Q7YU 1VQ5A 1TS9A 2EGEA 3ASKA 4MMKA 3G71T 1QWFA 3JCMb 3CCUA 4E7ZA 2FO0A 4J5YA 2EAYA 5FROA 3FEOA 3NHNA 3CCQT 3FLGA 4OMFB 1JXOA 2CKKA 4C8QA 4EMHA 4Y28E 4CC4B 4FW1A 4LD6A 1A0NB 1Q82R 5GMKm 1GCQA 2VYTA 3CBMA 3UPUA 2P0PA 1QVGS 1G2BA 2AHJB 1OPKA 5CCAA 2Y4YA 2RQUA 1RLQC 4KH1B 1AWXA 2V26A 4BDZA 4HA8A 1RI0A 1IXDA 5GAOr 3VS7A 4BI4A 3JV3A 2R58A 2QA4T 5LJ5d 1VQ7A 2EFIA 2KI7A 1WHKA 4OF1A 2V8KA 1Q81C 2GTOA 3LW5E 1G83A 2HCKA 4ESRA 1VQ9A 3X24B 5AT1B 1K9MR 3SEMA 1VQ7Q 4M78A 4EPCA 2HSEB 1KFZA 1I5LA 2RI2A 1KD1U 2RJCA 1WJQA 1ZSZB 2LCSA 4M77E 5CKFA 3U23A 4ANJA 2IG0A 2ZAEA 4E7HA 2I0NA 9ATCB 4PJOF 3BE3A 1FX7A 3EAEA 2X4WA 1VQOQ 3M4GA 3VRYA 2E10A 3QKJA 2NLUA 2XU8A 2O01E 1R0BG 2K3BA 2LNHB 1D3BB 2H8HA 2B8AA 2KYMA 1M90U 1ZSZC 2DFUA 3I55Q 2K6DA 4JLIA 4J7FA 5A2QE 4Q5WA 2DLPA 1YJNA 3S3MA 4C92B 3I56T 1B3QA 5C6SA 1B07A 4LNPA 4II1A 1W6XA 3OYKA 3JCMV 3CXCS 1ZA2B 4E7IA 5FU7B 2D8HA 3JSCA 3GIBA 3HSBA 2RM4A 3RESA 2JJ9A 2CP0A 1M3CA 3LWHA 4PJOD 4XTUA 1M8MA 4C92C 3MO8A 1NLOC 3PTAA 2ZGWA 1CSKA 4KGXB 2JT4A 1AEYA 3ME9A 1KD1C 2E3HA 5GAOn 2DIGA 1GRIA 3GNGA 1WHJA 4HCKA 5I2SA 3BW1A 3CEYA 3QZ5B 5FU7C 3OS5A 3GP8A 2DXBA 1Z9QA 1PKTA 1CKBA 1N6AA 1Y7XA 2PVDB 2SEMA 3VS0A 4L5GA 1M90C 5KYWA 4O6JA 3OYEA 1JEGA 1FMWA 3CCQA 4FCYA 1SF9A 1QP3A 4RTWA 2K3XA 1PG5B 2K57A 1PD1A 1KC8R 1X6GA 4M75E 3OY9A 1WIEA 4Y92A 4CC2A 1BCOA 1ZUYA 4X9DA 3KUFA 2DL4A 1LOJA 2COWA 2JS2A 2GFUA 2VXFA 4K11A 1YN8A 4XTYA 3OW2S 2KNBB 4LUEA 2KYBA 1JRIA 5GMKl 2RHIA 4QVDA 2E70A 3CCRT 2YWWA 2MPXC 2X4YA 2EVRA 3CCSA 3I9QA 3V7CA 3GBQA 1K8AR 2O88A 1YFNA 1IREB 1K0SA 2OTJA 1AZEA 2FPDA 4DOWA 3CCJA 4JRIA 1D0ZA 4XTXA 1J3TA 3OBYA 2EKOA 2F2VA 3ZBDA 3M57A 3QYGB 4C8QF 4F17A 4M7DG 4J6XA 3A8HB 3HTRA 3EFOB 3CMAQ 1GBRA 2HD0A 2ZPHB 2JMAA 2JNGA 4LDXA 1ZA1B 4XU0A 2A36A 2MWPA 3X25B 2QASA 1G3SA 2LQWA 2GQVA 2LX7A 2DO3A 3FDRA 4A4HA 1FYNA 1YCYA 2V1QA 5GMKj 2ROLA 3PMIA 1B34B 4HVUA 4FYWB 1QVFP 1R0CB 3LWIA 2E65A 4QQDA 5I2MA 1MHNA 3CCVT 1M2OA 1BU1A 3BFMA 1BBZA 1UDLA 2DL5A 3NGPA 2R5MA 4AG2C 2YT6A 4JJNK 2DJQA 3S3OA 4PLLA 4M7AB 4F14A 3RKWA 4IUTA 1PD0A 4OMQA 4E7JA 1IB8A 4R0KA 2GGRA 4OMLA 1NPPA 5GJWB 4A4GA 4EIKA 3RKXA 2KEAA 4OGCA 4M7AC 3QBYA 3JCMJ 1M8VA 2QGGA 3QWYA 1PKSA 1E6HA 1NYGA 3HRUA 5LJ3j 3H0FA 3SD4A 1K76A 1GCPA 3VU3C 3JB9J 5GAMe 4RTZA 4XU3A 2OTLA 1NBEB 1UB4A 2IVWA 2P0KA 4Z88A 5LJ3h 2J05A 3URGA 1H8KA 3C0CA 4M77G 2C0OA 2RNAA 3QWXX 2CS7A 2K79A 3L2VA 3CCLT 4RCBA 5L8RE 3R6OA 1OI1A 3GOXA 2LJ3A 2J6FA 3L42A 2RB6A 3L2WA 3CCMQ 5KYUB 5GMKi 3P8BB 3WVDB 1QCFA 2EYXA 4F7UE 3E2UA 1KHIA 1U1SA 1AWJA 5GAN5 2E5QA 1VQPA 2AZSA 2CGHA 2DXUA 3A8MB 3CC7T 4MMLA 3OYMA 2WACA 3CC4A 2DERA 5LJ3f 4XTZA 3JRZA 2WSFE 2PUOB 3OSVA 2Y90A 4LDWA 1Y96A 2GF7A 2RHUA 1ABQA 3R6NA 4N4IA 2CH4W 1ZSGA 1WNLA 3ULRB 1VQ6T 3I55T 2GQIA 2D0QB 3UF4A 1PHTA 1WXUA 2MWOA 2QQRA 1NJIC 3OYCA 2JTEA 5KE3A 1DJ7B 3PGGA 3PIOA 1U06A 4RUGA 1G8XA 2K4YA 1KQSA 2AZVA 3KBGA 1B34A 2YRCA 3L1AA 5KCOA 4ATOA 4A4FA 2VXEA 2EYQA 3QSUA 2D6FA 1D09B 2NWMA 3CXCP 2RI3A 4R56A 3MEWA 1R77A 3CPWS 3V8KA 3IQLA 1YJWQ 2KXDA 4OB1B 5J39A 2A37A 3GLXA 4M7AA 3A8GB 4M75G 3FRNA 3PE0A 2H3JA 3HP9A 2ED0A 1I81A 2K2MA 1UTIA 1UGVA 4C5EA 4XU2A 3FJPA 3HPWA 5HK3A 2JUFA 3A8LB 1VQ8A 2LNVA 3DLMA 3FB9A 2QYZA 2O2OA 4MZMA 4WTOB 4N4GA 2VV5A 2AT1B 4C92F 3JB9H 1KQ1A 4A63B 2XDBA 1ZHIA 4BI8B 4XU1A 3PT9A 2ATCB 2XDPA 4PJJA 1WXBA 1V1CA 3MEUA 1YI2A 5LJ5j 4IKFA 3E19A 2CUDA 1YITT 4CI0C 2JN0A 4M7DB 2FZKB 2NUPA 3EHQA 4C8QE 4C0ZA 4CC7A 2LJ0A 2K2VA 1U3OA 4OP0A 3NMZC 2EGAA 1W2BA 4ELZC 5EC7A 2KAFA 2HMAA 4KGZB 1N8RC 2LDMA 3TSWA 2KRSA 2JOYA 3TSZA 3MPUB 2XHCA 5KYUA 1IHVA 4XQ3A 4M7DC 4C92D 4FYYB 4GLMA 3M0QA 4BUGA 3A98A 1TG0A 1WHHA 5CIUA 2Y4XA 3JB9F 3C94A 4XTWA 3H6ZA 1K9MC 3NTIA 2KRMA 3FJ5A 3OYGA 2EWNA 3PVLA 4JJDA 4MDWA 4M78E 2YUOA 1VQLQ 2XICA 3CMEA 3CMAT 2NUTB 3INZA 2RQWA 2DD4A 3I5SA 5LJ5f 3CCVA 5CKDA 2CZ1B 3CD6Q 1I0CA 2CYZB 2QDLA 2DEUA 2COZA 1H3HA 4EMKA 5KYXB 3VS5A 1Q81U 2LMJA 4ZTJA 1VQMT 2RHXA 4HKEA 1LVKA 1D1BA 2RJFA 1VQ5Q 3H8ZA 2XG8D 4BI3A 1I4K1 3I5RA 2LX9A 4FSXA 3CCUQ 1UGQB 5CQYA 1Y71A 4A54A 3CC2T 2F1LA 4E47A 4RTTA 1IHWA 2V1RA 7AT1B 2M0YA 4X9CA 3EGXB 4OB2B 4J9HA 1W4SA 4ZN1A 2EJFA 5IT9E 1NZ9A 3OBWA 2EQUA 2HL3A 2HBPA 2DPPB 2E6NA 2D0NA 4PJOG 1ZQ1A 1VQ4T 1QVGA 2FZGB 4BE0A 3RKYA 3CCEA 1F1BB 3FC3A 2IPOB 2LVMA 2V8IA 3G6ET 4BACA 1RUWA 4FU6A 2L3PA 3EFSA 2DXCA 5ECAA 2ENMA 4QT7A 1EZZB 1D0YA 4TVRA 4F7UG 1OOTA 1QQJA 1XNIA 2HAXA 1AWOA 2O9SA 3UA6A 1VQKA 1W1FA 2EQIA 1VQ9Q 3X20B 2HQHA 3JCMX 3TVTA 2F5KA 4E7LA 1EX4A 4KT0E 1V29B 1KC8C 3GF5A 1YIJA 3VRZA 1YHQA 1LJOA 3AHUA 1T0HA 3EG9A 1PRMC 1NE8A 3M0UA 4FT2A 2D1XA 1BI3A 4A4KA 4M7AF 2X3WD 5AYFA 1VYUA 1M1KR 1WX6A 4DBRA 2AIRB 2ESWA 1SRMA 5GAN4 4J9GA 2YRDA 3RBBB 1ABOA 1YJNQ 2EW3A 2P84A 2L3SA 1K73R 3J7AF 1HD3A 3WXMB 2X9HA 4BE2A 3MEVA 3QDRB 1TTHB 3CXCA 4L6V5 2L0AA 5HK0A 4GY5A 1I07A 2NUTA 4M7AD 4M75B 4MZTA 5D6YA 2QG9B 5GANe 1RAGB 2CDTA 2DIQA 4HVWA 1M1FA 3M59A 2XKOC 1YCSB 4M75C 3OYHA 2XIDA 3C95A 3RMSA 5HY6A 4BDYA 2RA2A 1W70A 1UGRB 3LH0A 3CCQQ 1K1ZA 1RABB 4A4EA 3M54A 4RKUE 4KRTA 1Q7YR 3BDUA 1N9SA 3QXEB 1YJWT 5IAYA 2LJ1A 4RTVA 5KYNA 1NPRA 2R57A 2EGCA 4C8QG 4FYVB 3CPWP 4LDYA 3SFMA 2X4XA 3M5AA 1YJ9T 3RNJA 1WQWA 2QAZA 2CP5A 3SWNB 3ZL7C 3JAME 3EG2A 1R8OB 4E2FB 2MCNA 3DLLA 5GANg 3OW2A 1X2QA 3J81E 1BIBA 3VS2A 2LC4A 6AT1B 4QQ6A 2KQWA 2PVGB 2KMTA 2LT4A 4AG1C 2BTTA 3REAB 3SWNC 1S72T 3AT1B 1KQ2A 4JS4A 4J6YA 4L59A 1ZSZA 5DLQE 3CCSQ 1VQNA 3JCMh 4PJNA 2CP2A 4NS5A 2OTJQ 2CSIA 4HXJA 1H641 1AVZC 2M02A 3CCJQ 4HCZA 3KXTA 4M78G 1XOVA 3G4ST 1Q86C 3DB3A 2QEXA 1WGSA 1D3BA 4LDUA 2GTJA 1KD1R 4HT9A 2MIOA 1IGQA 4RMOA 1SPKA 2A28A 2PZ1A 1MMAA 2HDAA 4KGVB 2CH4A 4DOVA 1QCNA 4C92A 1O75A 2EYZA 3L2RA 2QK0A 3VS3A 5GAN2 4RTYA 3L2QA 4XTVA 1BI2A 3M9QA 3ZEHA 4QVCA 1QW1A 1UHCA 1M90R 2FYKA 3JCMf 2KDSA 3EG3A 1VQMA 2DTHA 1RAFB 3G71A 3QJYA 4LUDA 5GMKh 1VQLT 3META 1QMCA 2VASA 4LN2A 3QYHB 1NYFA 1X2KA 2M51A 3G71Q 1CKAA 1ZUUA 2M1HA 4BD3A 1OULA 5CK9A 1PSEA 2BE7D 3REBB 4AFUC 3JCMQ 2GCXA 1RADB 2CP3A 3EH1A 1BI0A 3VS4A 4Z89A 3SHWA 4OMMA 2PU9B 1QCOA 3NPFA 1VQ5T 2CZ6B 3D7SB 4C0GA 4F7UB 2RQTA 1G3TA 2Z0WA 2QA4A 1WDXA 3CCUT 4LE9A 1U5SA 1AWWA 4ZNXA 1NG2A 2YUNA 3OYIA 5IH2A 4FSSA 2VC8A 2QA4Q 1M9SA 5GANd 3NTKA 2X51A 3P8HA 1WA7A 4AFZC 4M7DD 4PJOE 4BE1A 2OTLQ 2QQ9A 2L8DA 2ZPIB 2O4XB 3M53A 2HSPA 1TUGB 2KT1A 2L3RA 3OS0A 4J8OA 1NJIU 1UFFA 3RIRA 2DYIA 4M7AE 2OX7A 2RK2A 2LQKA 3OS2A 3VV0A 3HFOA 3MP6A 2RH2A 2M9UA 1FMKA 1VQ7T 4JZ3A 1B7TA 4MDXA 2I2LA 2L5QA 5DM7R 4Z02A 3I56A 1VQPQ 1KK7A 3L2ZA 2F69A 2K5IA 1SKUB 1YBYA 2KBTA 3OQ5A 1RLPC 3I56Q 3CC4Q 1KJWA 5HKCA 1VQOT 5GAMj 3VUZA 3S6WA 2KSSA 3EFOA 4V2SA 2EKHA 3UT1A 1AD5A 2RPNA 3L2UA 1VA7A 3OMGA 4ELYC 2DL8A 1O9SA 2DA9A 2XI9A 2DL7A 1YWPA 5GAMh 3ER0A 1RAIB 3E9GA 2E5KA 3UWNA 1I5OB 1JBMA 1M1GA 1D1AA 4JJCA 2LZ6B 3EGDB 5CR2A 4MZPA 2DJZA 1WI7A 3QHSA 2ZPEB 2LCLA 4ZGJB 2NYSA 3LGLA 3C12A 4D8DA 2A0FB 2JZ2A 4M77D 2K5LA 4AFQC 2QGFB 1N8RU 3DKMA 1VYVA 2DETA 5GAMf 3JCMc 1VYTA 1UECA 3CPWA 3LGFA 1KG1A 3HKSA 5A0DA 3OYJA 2FPFA 1QVPA 2PNIA 3CBPA 1MGQA 1WLPB 2YDLA 2IIMA 3A8OB 4PJMA 4C5GA 1MNDA 2DAQA 2JM9A 2DD5A 2VB6A 4IUUA 1BB9A 2P4TA 4E7KA 5D7UA 5LJ3d 4EDUA 4QW2A 1K9MU 1M3BA 1VQ8Q 1PSFA
chains in the Genus database with same CATH topology
4M4ZA 1ZUYA 4CC2A 5I11A 2K7AA 2DL4A 1RUWA 2J7IA 4D8KA 2F2XA 1T3SA 2BZXA 2L3PA 4Z8AA 5ECAA 2ENMA 4QT7A 3VS1A 2AKLA 2JS2A 1OOTA 1T0JA 4K11A 1TUCA 1LCKA 4OMNA 1YN8A 1AWOA 2O9SA 4J9BA 3UA6A 1BK2A 1W1FA 2EQIA 2KNBB 4LUEA 1UE9A 2ECZA 2KYBA 1I1JA 2GBQA 2P4RA 3TVTA 4RTUA 2DX1A 2DNUA 2EVRA 3VRZA 3I9QA 4J9DA 1KIKA 2YUPA 3GBQA 2O88A 3PVQA 1K0SA 5IHNA 2ED1A 2CREA 1T0HA 2AK5A 2FPDA 1AZEA 4X1VA 1PRMC 3M0UA 2D1XA 1UJ0A 1J3TA 2C0TA 4GBQA 2X3WD 2YSQA 1PRLC 2F2VA 1VYUA 1WX6A 2L2PA 4F17A 2ESWA 1SRMA 4J9GA 2MOXA 1GBRA 2GNCA 2JMAA 3RBBB 1ABOA 2HEQA 2W0ZA 3M0TA 1UUEA 3M0PA 3UA7A 2EW3A 2A36A 2SRCA 2L3SA 1IO6A 1QKWA 2LQWA 2LX7A 1QLYA 1HD3A 3O5ZA 1WXTA 1FYNA 2CUBA 2V1QA 2CT3A 2ROLA 2L0AA 5IHIA 4HVUA 5FWBA 1MUZA 1I07A 1Y57A 2OI3A 2J6KA 1BU1A 1H92A 3UATA 1JU5C 2LQNA 1BBZA 1AOJA 2EPDA 2PTKA 2KRNA 1SHFA 1UDLA 2DL5A 3NGPA 2CDTA 2FRYA 2DF6A 1E6GA 2YT6A 4HVWA 4AG2C 2DJQA 2EBPA 1YCSB 1UG1A 4F14A 1AZGB 4OMQA 1ZBJA 3EG1A 4R0KA 1NLPC 2GGRA 4OMLA 2JM8A 4J9IA 2OAWA 2DRKA 5GJWB 1W70A 1UHFA 2BZ8A 2O31A 4EIKA 2RQVA 2KEAA 1K1ZA 2FEIA 1E7OA 5L23A 3QWYA 1PNJA 2F2WA 4KRTA 2CSQA 1PKSA 1E6HA 2KT8A 5FWCA 1NYGA 2RF0A 3H0FA 1WYXA 1K76A 1X6BA 1GCPA 2JS0A 2LJ1A 4RTVA 1GCQC 3I35A 3M0SA 2EGCA 2DMOA 1HSQA 1Z9ZA 3EG0A 4RTZA 4ORZA 3EGUA 3M0RA 1JXMA 2ABLA 2XMFA 1RI9A 4Z88A 3RNJA 2J05A 1H8KA 3C0CA 2C0OA 2RNAA 3ZL7C 3QWXX 2K79A 1Y0MA 3EG2A 4HVVA 2MCNA 2RN8A 4DEYA 2KR3A 1X2QA 2LJ3A 2DILA 4J9FA 2J6FA 3VS2A 4JZ4A 3CQTA 2DL3A 3H0HA 4F16A 2EYYA 4AG1C 2BTTA 3REAB 1QCFA 2EYXA 1YNZA 1AWJA 1M30A 2EYWA 1QKXA 2AZSA 4JJBA 1K0XA 2CSIA 4HXJA 1GFDA 1AVZC 5FW9A 1KSWA 2YUQA 1GL5A 1OEBA 3EHRA 1XOVA 4IIOA 1SHGA 1JQQA 1NEGA 2OJ2A 2GTJA 2LP5A 1K4US 2MIOA 1NM7A 2AKKA 2DVJA 3KFVA 1SPKA 4DEXA 2A28A 2PZ1A 1WFWA 2HDAA 2D8JA 2JXBA 5IXFA 1ABQA 2CH4A 3R6NA 1ARKA 1GFCA 2EYZA 1ZX6A 3VS3A 2DRMA 2CH4W 4RTYA 1ZSGA 1X69A 4J9EA 3ULRB 1UHCA 4E6RA 3LH5A 2VKNA 1ZLMA 2GQIA 3UF4A 2KE9A 3EG3A 1PHTA 1WXUA 5I22A 2JTEA 1SRLA 1U06A 4RUGA 4LUDA 2FG0A 2JMCA 2AZVA 2BZYA 4LN2A 1NYFA 1X2KA 5IHKA 2M51A 1CKAA 1ZUUA 2X3XD 1MV0B 2VWFA 2DM1A 2ROTA 2EGEA 3REBB 4AFUC 2NWMA 1QWFA 4AFSC 1GBQA 1K9AA 2FO0A 4OMPA 3IQLA 2KXDA 2A37A 3NHNA 3VS4A 3PE0A 1JXOA 3SHWA 4Z89A 4OMMA 4CC4B 2ED0A 2K2MA 1UTIA 1X43A 3NPFA 1UGVA 1A0NB 2RQTA 2NUZA 1GCQA 1WDXA 1SSHA 4RTXA 4LE9A 1U5SA 1G2BA 4ZNXA 1AWWA 1NG2A 2YUNA 1OPKA 2RQUA 1RLQC 2RMOA 5IH2A 4FSSA 1AWXA 1OV3A 4J9CA 1WA7A 2O2OA 5HCKA 3VS7A 4AFZC 4A63B 3JV3A 1YP5A 4JPBW 1HJDA 4CC3A 2HSPA 2KT1A 1JO8A 1WXBA 1V1CA 1UFFA 2GTOA 1G83A 2B86A 2HCKA 4ESRA 2CUDA 3SEMA 3EHQA 4CC7A 1KFZA 2LJ0A 1T3LA 1X27A 1U3OA 1MV3A 3NMZC 2K9GA 2EGAA 1FMKA 5EC7A 2KGTA 2LCSA 3U23A 2FRWA 4JZ3A 3TSWA 2KRSA 3TSZA 2I0NA 4WCIA 1S1NA 2FPEA 2KROA 3VRYA 4IIMA 4GLMA 2KBTA 3M0QA 2K3BA 2LNHB 2H8HA 2KYMA 1RLPC 3A98A 2L3QA 1TG0A 1KJWA 2K6DA 2DLPA 2EKHA 1EFNA 1AD5A 1B3QA 2RPNA 3THKA 2HBWA 2KRMA 3FJ5A 1VA7A 3PVLA 1B07A 4JJDA 4LNPA 2DL8A 2DA9A 1W6XA 1YWOA 2YUOA 1ZUKA 2DL7A 2CT4A 1UJYA 1YWPA 2D8HA 2RQWA 3I5SA 2G6FX 2JW4A 1M3CA 3H0IA 1I0CA 1M8MA 1SEMA 1NLOC 2KXCA 2QDLA 2DYBA 2E5KA 1CSKA 2JT4A 1AEYA 2DBKA 1QWEA 1H3HA 2A08A 1GRIA 4JJCA 4HCKA 3VS5A 2LZ6B 3H41A 2LMJA 1WI7A 1Z9QA 1PKTA 1CKBA 4OMOA 4D8DA 2C0IA 2O9VA 2SEMA 3VS0A 3VS6A 4AFQC 5GJVB 2VVKA 3I5RA 5IXBA 2RQRA 1VYVA 1VYTA 1UECA 2DBMA 1JEGA 2W10A 1N5ZA 4RTTA 2V1RA 2M0YA 2FPFA 2PNIA 4J9HA 1WLPB 2DE0X 2IIMA 2YDLA 4RTWA 1OPLA 2JM9A 1M3AA 1BB9A 1TUDA 1PWTA 2D0NA 2J6OA 1X6GA 1M27C 1WIEA 1M3BA 2J06A 1NEBA 4Y92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M4Z A;  1ZUY A;  4CC2 A;  5I11 A;  2K7A A;  2DL4 A;  1RUW A;  2J7I A;  4D8K A;  2F2X A;  1T3S A;  2BZX A;  2L3P A;  4Z8A A;  5ECA A;  2ENM A;  4QT7 A;  3VS1 A;  2AKL A;  2JS2 A;  1OOT A;  1T0J A;  4K11 A;  1TUC A;  1LCK A;  4OMN A;  1YN8 A;  1AWO A;  2O9S A;  4J9B A;  3UA6 A;  1BK2 A;  1W1F A;  2EQI A;  2KNB B;  4LUE A;  1UE9 A;  2ECZ A;  2KYB A;  1I1J A;  2GBQ A;  2P4R A;  3TVT A;  4RTU A;  2DX1 A;  2DNU A;  2EVR A;  3VRZ A;  3I9Q A;  4J9D A;  1KIK A;  2YUP A;  3GBQ A;  2O88 A;  3PVQ A;  1K0S A;  5IHN A;  2ED1 A;  2CRE A;  1T0H A;  2AK5 A;  2FPD A;  1AZE A;  4X1V A;  1PRM C;  3M0U A;  2D1X A;  1UJ0 A;  1J3T A;  2C0T A;  4GBQ A;  2X3W D;  2YSQ A;  1PRL C;  2F2V A;  1VYU A;  1WX6 A;  2L2P A;  4F17 A;  2ESW A;  1SRM A;  4J9G A;  2MOX A;  1GBR A;  2GNC A;  2JMA A;  3RBB B;  1ABO A;  2HEQ A;  2W0Z A;  3M0T A;  1UUE A;  3M0P A;  3UA7 A;  2EW3 A;  2A36 A;  2SRC A;  2L3S A;  1IO6 A;  1QKW A;  2LQW A;  2LX7 A;  1QLY A;  1HD3 A;  3O5Z A;  1WXT A;  1FYN A;  2CUB A;  2V1Q A;  2CT3 A;  2ROL A;  2L0A A;  5IHI A;  4HVU A;  5FWB A;  1MUZ A;  1I07 A;  1Y57 A;  2OI3 A;  2J6K A;  1BU1 A;  1H92 A;  3UAT A;  1JU5 C;  2LQN A;  1BBZ A;  1AOJ A;  2EPD A;  2PTK A;  2KRN A;  1SHF A;  1UDL A;  2DL5 A;  3NGP A;  2CDT A;  2FRY A;  2DF6 A;  1E6G A;  2YT6 A;  4HVW A;  4AG2 C;  2DJQ A;  2EBP A;  1YCS B;  1UG1 A;  4F14 A;  1AZG B;  4OMQ A;  1ZBJ A;  3EG1 A;  4R0K A;  1NLP C;  2GGR A;  4OML A;  2JM8 A;  4J9I A;  2OAW A;  2DRK A;  5GJW B;  1W70 A;  1UHF A;  2BZ8 A;  2O31 A;  4EIK A;  2RQV A;  2KEA A;  1K1Z A;  2FEI A;  1E7O A;  5L23 A;  3QWY A;  1PNJ A;  2F2W A;  4KRT A;  2CSQ A;  1PKS A;  1E6H A;  2KT8 A;  5FWC A;  1NYG A;  2RF0 A;  3H0F A;  1WYX A;  1K76 A;  1X6B A;  1GCP A;  2JS0 A;  2LJ1 A;  4RTV A;  1GCQ C;  3I35 A;  3M0S A;  2EGC A;  2DMO A;  1HSQ A;  1Z9Z A;  3EG0 A;  4RTZ A;  4ORZ A;  3EGU A;  3M0R A;  1JXM A;  2ABL A;  2XMF A;  1RI9 A;  4Z88 A;  3RNJ A;  2J05 A;  1H8K A;  3C0C A;  2C0O A;  2RNA A;  3ZL7 C;  3QWX X;  2K79 A;  1Y0M A;  3EG2 A;  4HVV A;  2MCN A;  2RN8 A;  4DEY A;  2KR3 A;  1X2Q A;  2LJ3 A;  2DIL A;  4J9F A;  2J6F A;  3VS2 A;  4JZ4 A;  3CQT A;  2DL3 A;  3H0H A;  4F16 A;  2EYY A;  4AG1 C;  2BTT A;  3REA B;  1QCF A;  2EYX A;  1YNZ A;  1AWJ A;  1M30 A;  2EYW A;  1QKX A;  2AZS A;  4JJB A;  1K0X A;  2CSI A;  4HXJ A;  1GFD A;  1AVZ C;  5FW9 A;  1KSW A;  2YUQ A;  1GL5 A;  1OEB A;  3EHR A;  1XOV A;  4IIO A;  1SHG A;  1JQQ A;  1NEG A;  2OJ2 A;  2GTJ A;  2LP5 A;  1K4U S;  2MIO A;  1NM7 A;  2AKK A;  2DVJ A;  3KFV A;  1SPK A;  4DEX A;  2A28 A;  2PZ1 A;  1WFW A;  2HDA A;  2D8J A;  2JXB A;  5IXF A;  1ABQ A;  2CH4 A;  3R6N A;  1ARK A;  1GFC A;  2EYZ A;  1ZX6 A;  3VS3 A;  2DRM A;  2CH4 W;  4RTY A;  1ZSG A;  1X69 A;  4J9E A;  3ULR B;  1UHC A;  4E6R A;  3LH5 A;  2VKN A;  1ZLM A;  2GQI A;  3UF4 A;  2KE9 A;  3EG3 A;  1PHT A;  1WXU A;  5I22 A;  2JTE A;  1SRL A;  1U06 A;  4RUG A;  4LUD A;  2FG0 A;  2JMC A;  2AZV A;  2BZY A;  4LN2 A;  1NYF A;  1X2K A;  5IHK A;  2M51 A;  1CKA A;  1ZUU A;  2X3X D;  1MV0 B;  2VWF A;  2DM1 A;  2ROT A;  2EGE A;  3REB B;  4AFU C;  2NWM A;  1QWF A;  4AFS C;  1GBQ A;  1K9A A;  2FO0 A;  4OMP A;  3IQL A;  2KXD A;  2A37 A;  3NHN A;  3VS4 A;  3PE0 A;  1JXO A;  3SHW A;  4Z89 A;  4OMM A;  4CC4 B;  2ED0 A;  2K2M A;  1UTI A;  1X43 A;  3NPF A;  1UGV A;  1A0N B;  2RQT A;  2NUZ A;  1GCQ A;  1WDX A;  1SSH A;  4RTX A;  4LE9 A;  1U5S A;  1G2B A;  4ZNX A;  1AWW A;  1NG2 A;  2YUN A;  1OPK A;  2RQU A;  1RLQ C;  2RMO A;  5IH2 A;  4FSS A;  1AWX A;  1OV3 A;  4J9C A;  1WA7 A;  2O2O A;  5HCK A;  3VS7 A;  4AFZ C;  4A63 B;  3JV3 A;  1YP5 A;  4JPB W;  1HJD A;  4CC3 A;  2HSP A;  2KT1 A;  1JO8 A;  1WXB A;  1V1C A;  1UFF A;  2GTO A;  1G83 A;  2B86 A;  2HCK A;  4ESR A;  2CUD A;  3SEM A;  3EHQ A;  4CC7 A;  1KFZ A;  2LJ0 A;  1T3L A;  1X27 A;  1U3O A;  1MV3 A;  3NMZ C;  2K9G A;  2EGA A;  1FMK A;  5EC7 A;  2KGT A;  2LCS A;  3U23 A;  2FRW A;  4JZ3 A;  3TSW A;  2KRS A;  3TSZ A;  2I0N A;  4WCI A;  1S1N A;  2FPE A;  2KRO A;  3VRY A;  4IIM A;  4GLM A;  2KBT A;  3M0Q A;  2K3B A;  2LNH B;  2H8H A;  2KYM A;  1RLP C;  3A98 A;  2L3Q A;  1TG0 A;  1KJW A;  2K6D A;  2DLP A;  2EKH A;  1EFN A;  1AD5 A;  1B3Q A;  2RPN A;  3THK A;  2HBW A;  2KRM A;  3FJ5 A;  1VA7 A;  3PVL A;  1B07 A;  4JJD A;  4LNP A;  2DL8 A;  2DA9 A;  1W6X A;  1YWO A;  2YUO A;  1ZUK A;  2DL7 A;  2CT4 A;  1UJY A;  1YWP A;  2D8H A;  2RQW A;  3I5S A;  2G6F X;  2JW4 A;  1M3C A;  3H0I A;  1I0C A;  1M8M A;  1SEM A;  1NLO C;  2KXC A;  2QDL A;  2DYB A;  2E5K A;  1CSK A;  2JT4 A;  1AEY A;  2DBK A;  1QWE A;  1H3H A;  2A08 A;  1GRI A;  4JJC A;  4HCK A;  3VS5 A;  2LZ6 B;  3H41 A;  2LMJ A;  1WI7 A;  1Z9Q A;  1PKT A;  1CKB A;  4OMO A;  4D8D A;  2C0I A;  2O9V A;  2SEM A;  3VS0 A;  3VS6 A;  4AFQ C;  5GJV B;  2VVK A;  3I5R A;  5IXB A;  2RQR A;  1VYV A;  1VYT A;  1UEC A;  2DBM A;  1JEG A;  2W10 A;  1N5Z A;  4RTT A;  2V1R A;  2M0Y A;  2FPF A;  2PNI A;  4J9H A;  1WLP B;  2DE0 X;  2IIM A;  2YDL A;  4RTW A;  1OPL A;  2JM9 A;  1M3A A;  1BB9 A;  1TUD A;  1PWT A;  2D0N A;  2J6O A;  1X6G A;  1M27 C;  1WIE A;  1M3B A;  2J06 A;  1NEB A;  4Y92 A; 
#chains in the Genus database with same CATH topology
 4PL6 A;  3MCA B;  1G5V A;  3V8L A;  5CKB A;  2J7I A;  4D8K A;  3JB9 G;  3CCR A;  2F2X A;  2KVQ G;  5KYY B;  1JJ2 S;  4JRK A;  5A0G A;  1PM3 A;  2AKL A;  3VS1 A;  4EMG A;  4IUQ A;  1TUC A;  1LCK A;  4OMN A;  2FZC B;  1YI2 Q;  1S72 A;  1Q82 C;  4M78 B;  1UEB A;  2DTI A;  3HRT A;  4RTU A;  5EG2 A;  4JS5 A;  5LJ5 h;  4PJL A;  4M75 F;  2DX1 A;  5CQX A;  2LT1 A;  4J9D A;  1BKB A;  2YUP A;  1W2B S;  3PVQ A;  4M78 C;  5C0M A;  5IHN A;  2ED1 A;  2CRE A;  1QVF A;  1PCX A;  4X1V A;  2QQA A;  2A3L A;  1UJ0 A;  2C0T A;  4GBQ A;  2YSQ A;  1LNX A;  3SB2 A;  2PQW A;  3CCS T;  2RJD A;  3QZ9 B;  4KUL A;  1TWB A;  2GNC A;  2OTJ T;  1MMG A;  3OB9 A;  1X6O A;  3M0P A;  1FMV A;  3CCJ T;  2FHD A;  2SRC A;  4M75 D;  1IZ6 A;  3OSS C;  3VYH B;  1QKW A;  2DXT A;  3CBO A;  1QLY A;  4B6M A;  3O5Z A;  2CUB A;  3CME Q;  3CCV Q;  4LXC A;  3CPF A;  4N0A C;  1Q95 G;  3LX7 A;  1N27 A;  3HRS A;  3QPH A;  4PK4 A;  1M1K C;  1WJS A;  2L89 A;  1JB0 E;  2EJ9 A;  2E1H A;  2RJE A;  2HNI A;  5CKH A;  1H92 A;  2LQN A;  2PTK A;  2WSC E;  2FRY A;  2DF6 A;  5FRM A;  2EBP A;  4B9W A;  1V76 A;  1KC8 U;  1G3W A;  4HCC A;  1AZG B;  1ZBJ A;  3EG1 A;  2C06 A;  8AT1 B;  4J9I A;  4LDV A;  2P0Q A;  2VUB A;  1MMN A;  4M77 B;  2O31 A;  4R55 A;  1H3Z A;  1HK9 A;  5I21 A;  2FEI A;  1E7O A;  1XTD A;  2F2W A;  2LCC A;  2KY9 A;  1C1A A;  2KT8 A;  2EIF A;  2RF0 A;  1WYX A;  1X6B A;  2JS0 A;  1WHM A;  4M77 C;  2CP6 A;  1BYM A;  3CCL A;  3I35 A;  1UGS B;  2ZPF B;  3M0S A;  4M7A G;  1SG5 A;  4HCB A;  3CCE Q;  1HSQ A;  1N8R R;  3EG0 A;  2E6Z A;  4ORZ A;  2QXF A;  2ABL A;  5GAN 8;  3CCL Q;  3JCM P;  2XMF A;  1RI9 A;  4DBQ A;  4CRI A;  1K8A U;  3FIF A;  4VUB A;  3Q1J A;  1OX8 A;  3UDC A;  1D1C A;  1FWZ A;  3V7S A;  1Y0M A;  4HVV A;  4DEY A;  2RN8 A;  3LLR A;  5KYY A;  3CC7 A;  4OGE A;  2DIL A;  1VQK Q;  4J9F A;  2OTL T;  3OYA A;  1Q7Y C;  1U1T A;  4M7D A;  2RD1 A;  2LTO A;  4F16 A;  4J6W A;  2HQE A;  3CC7 Q;  3QDF A;  4LD9 K;  1YIJ Q;  2HL5 C;  1YNZ A;  3MHX A;  1M30 A;  2EYW A;  1QKX A;  4JJB A;  1VQO A;  3CCM T;  4OVA A;  1YHQ Q;  2FVU A;  5GAO q;  5FW9 A;  5KH6 A;  2YUQ A;  3TCJ A;  1GL5 A;  4Y91 A;  1WHL A;  1OEB A;  2KK4 A;  3EHR A;  3PIP A;  1JQQ A;  1VQ6 A;  3WVE B;  4GLK A;  3HHT B;  3I55 A;  1GXI E;  2LP5 A;  1K4U S;  4RCC A;  2AKK A;  3KFV A;  2XDD A;  1VQP T;  2JXB A;  4DBF A;  1VQ6 Q;  2CZ0 B;  4PFZ A;  2QTV A;  1OQK A;  1GFC A;  2MI6 A;  5GAO m;  1BI1 A;  2DRM A;  1K8A C;  4F7U F;  3CC4 T;  2CZ7 B;  4N0A A;  4E6R A;  2VKN A;  2BIV A;  4OB0 B;  1M4Z A;  2KE9 A;  3OYN A;  3MP1 A;  3VYG A;  3T9N A;  1SRL A;  2F5T X;  4QQG A;  3E1S A;  4RG2 A;  2QDY B;  1C6V X;  2ZCF B;  4E7S A;  5IHK A;  5KYX A;  2X3X D;  1P92 A;  3BDL A;  2OAU A;  4FT4 A;  2DM1 A;  2ROT A;  3F70 A;  4IUR A;  5J3B A;  3X26 B;  4JLG A;  2DVE A;  3PMT A;  4AFS C;  1GBQ A;  4C92 E;  1IRX A;  1K9A A;  4OMP A;  3QII A;  3JCM e;  1C0M A;  2JTM A;  4X34 A;  1Q81 R;  1G3Y A;  2EQM A;  4UC4 A;  2DZ9 A;  3GNF B;  3NTH A;  2MMP A;  1X43 A;  3EGX A;  3M58 A;  1WJR A;  1Q86 U;  2NUZ A;  1FXX A;  1KQS P;  1AT1 B;  1RL2 A;  4M77 A;  1SSH A;  4RTX A;  2DZC A;  1SSF A;  2RMO A;  3RR6 A;  3JB9 I;  3C4S A;  3RER A;  1TH7 A;  1YIT A;  1OV3 A;  4J9C A;  4OB3 B;  5HCK A;  2DK3 A;  3E9F A;  5GAN j;  3H9N A;  1YP5 A;  4JPB W;  1YIT Q;  1HJD A;  4CC3 A;  5CKE A;  1XJW B;  1JO8 A;  1VQ8 T;  2B86 A;  5GMK e;  2YLB A;  4ZGD B;  5GAN h;  2DKG A;  4BY6 B;  2RHZ A;  1T3L A;  1X27 A;  5LL6 S;  1MV3 A;  4JUV A;  4C0D B;  2K9G A;  4ME7 A;  1RAE B;  2KGT A;  2FRW A;  2JTF A;  4D6W A;  1HYO A;  4PLI A;  1YI2 T;  1VQN Q;  4WCI A;  5CAI A;  1S1N A;  2FPE A;  2KRO A;  3M55 A;  3JCM g;  3N5B B;  3RMQ A;  4BY6 C;  4IIM A;  1JJ2 P;  4C0D C;  4DBH A;  3GPL A;  2MYS A;  2L3Q A;  3O8V A;  3CMA A;  2QEX Q;  1Y96 B;  2HKQ B;  4PKC C;  5GAN 7;  1Y07 A;  3TRE A;  2E41 A;  1EFN A;  2E12 A;  1VOM A;  3THK A;  5CO7 A;  5DLO A;  5GAN f;  2HBW A;  1MNE A;  2FL7 A;  1YWO A;  1ZUK A;  1W2B P;  2CT4 A;  2COY A;  1UJY A;  3S3N A;  3EFR A;  2G6F X;  2JW4 A;  5LJ3 e;  3H0I A;  2X4J A;  1ZBX A;  1SEM A;  1UGP B;  3DB4 A;  1TXQ A;  2KXC A;  5FU6 B;  1VQM Q;  2DYB A;  4C0F A;  3HL8 A;  2DBK A;  1QWE A;  2A08 A;  3BY7 A;  3LYI A;  4M75 A;  3CD6 T;  5CVI A;  2V8J A;  2BUD A;  3H41 A;  3CME T;  3CC2 A;  4PJO B;  3M4Y A;  4C8Q D;  4M7D F;  5FU6 C;  4OMO A;  1AHJ B;  4M78 F;  4FW2 A;  2C0I A;  2O9V A;  5GAO l;  3CC2 Q;  5GAN 6;  3VS6 A;  5GJV B;  2VVK A;  5IXB A;  2RQR A;  4KBM B;  1VQ4 A;  5FLX E;  5D6W A;  3MKD A;  1TU0 B;  4O5V A;  4F04 B;  1X75 C;  2DBM A;  3VJP A;  4PJO C;  2W10 A;  1N5Z A;  3G7Z A;  4PFP A;  1IGU A;  3QO3 A;  3A1P A;  1VQ4 Q;  5KCH A;  4XK8 E;  3J80 E;  2DE0 X;  3G6E A;  1OPL A;  3SDZ A;  5GAN 3;  1M3A A;  4AT1 B;  1TSF A;  1TUD A;  1ACM B;  1PWT A;  2EQK A;  3MJX A;  2J6O A;  1M27 C;  3G6E Q;  2ZZD A;  2ZPG B;  2J06 A;  1NEB A;  4M4Z A;  5I11 A;  2K7A A;  4M78 D;  4C5I A;  2G3R A;  3TEE A;  5LJ3 g;  1RAA B;  1T3S A;  2BZX A;  4DQ2 A;  3PNW C;  4Z8A A;  2H3E B;  1T0J A;  3TQ7 P;  3P8D A;  1M2V B;  3SWN A;  2GFA A;  1Q86 R;  3CCE T;  2NUP B;  3JCM d;  4J9B A;  1VUB A;  1BK2 A;  1LPL A;  1UE9 A;  2ECZ A;  3MP8 A;  1X01 A;  1I1J A;  2GBQ A;  2P4R A;  8ATC B;  3QG1 A;  3CCM A;  3NFC A;  5D6X A;  4BB7 A;  3OYY A;  2DNU A;  1QVG P;  1VQ9 T;  1KIK A;  2EQJ A;  4B9X A;  5IN1 A;  2K3Y A;  3RUX A;  2QQS A;  2AK5 A;  4KUD K;  1HXD A;  1QP2 A;  1VQK T;  1I8F A;  5FRN A;  4DA4 A;  1PRL C;  2L2P A;  3V8J A;  1YIJ T;  2K5F A;  2MOX A;  4J83 A;  2HZY A;  4NOY A;  2D9T A;  3QJ6 A;  4M77 F;  1YHQ T;  3G1J A;  1VIE A;  2HEQ A;  2W0Z A;  3M0T A;  1UUE A;  3PFS A;  3UA7 A;  1PC0 A;  3OYB A;  1RAH B;  2R5A A;  2XK0 A;  4YTL A;  1IO6 A;  2LRQ A;  4J7I A;  1TOV A;  1WPY A;  1WXT A;  2MK5 A;  3X28 B;  1YJN T;  2CT3 A;  5GAM g;  1N9R A;  5IHI A;  3MEA A;  2M16 A;  5FWB A;  1MUZ A;  2FB7 A;  1Y57 A;  1KQS S;  4EMK B;  2BE9 B;  4WF2 A;  2OI3 A;  2J6K A;  4NL3 A;  4C92 G;  2VGM A;  4JDS A;  1XQH A;  1Q82 U;  3UAT A;  1JU5 C;  1RAC B;  4JRQ A;  1AOJ A;  2EPD A;  3M56 A;  2KRN A;  1SHF A;  3VUB A;  4PNO A;  1E6G A;  2MF2 A;  4EMK C;  5LJ5 e;  1UG1 A;  2E3I A;  3QUI A;  2MAM A;  4PJO A;  4C8Q B;  1NLP C;  2PVO B;  1YJW A;  1KHC A;  2JM8 A;  4PFO A;  3JCM W;  2YLC A;  4FM4 B;  2PUK B;  2QTX A;  2OAW A;  2DRK A;  5GAO p;  1UHF A;  3OYL A;  2BZ8 A;  4C5H A;  3ZFJ A;  2RQV A;  4AMC A;  2RK1 A;  2QQB A;  2VGN A;  1U8R A;  5L23 A;  2E4H A;  1PNJ A;  2RHY A;  4C8Q C;  1YJ9 A;  2CSQ A;  5FWC A;  4JRP A;  4F7U A;  4RG8 A;  4FYX B;  1WZO A;  1BIA A;  1GCQ C;  1YJ9 Q;  2DEQ A;  4KUI A;  2DMO A;  4XAX B;  3HFN A;  1Z9Z A;  3EGU A;  3M0R A;  1JXM A;  2YRV A;  2WSE E;  1OYX A;  1EIF A;  5KE2 A;  1OZ2 A;  3CCR Q;  4QVZ A;  1JJ2 A;  1M5Q 1;  3EH2 A;  2O4X A;  4IUP A;  2JVV A;  2DTO A;  2CP7 A;  1VIF A;  1S72 Q;  2KR3 A;  1M1K U;  2M0O A;  4KH0 B;  4JZ4 A;  2LQ8 A;  3OYD A;  1M2V A;  1WHG A;  3CQT A;  2DL3 A;  3H0H A;  3G4S A;  3A5Z B;  2EYY A;  5LJ5 g;  1OU9 A;  3VKI A;  1WQ7 A;  2ZPB B;  3EG9 B;  3G4S Q;  4N4H A;  1K73 U;  1K0X A;  4ZGE B;  1NJI R;  1GFD A;  1KSW A;  1QVF S;  2HQX A;  2A7Y A;  4IIO A;  1SHG A;  1NEG A;  3OMC A;  1OX9 A;  2OJ2 A;  4FIB A;  2RI5 A;  4A53 A;  1NM7 A;  2DVJ A;  5GAM d;  4DEX A;  1OU8 A;  1VQN T;  2YHT A;  4ZN3 A;  1WFW A;  2D8J A;  2EJG A;  5IXF A;  2E64 A;  3OS1 A;  5DY9 A;  3OW2 P;  4IUV A;  4NL2 A;  1ARK A;  1MMD A;  4P5N A;  2XD0 A;  1ZX6 A;  1VQL A;  1OZ3 A;  1X69 A;  4J9E A;  4M7D E;  2QEX T;  4ZTF A;  3RDV A;  3LH5 A;  3CD6 A;  3OA6 A;  1ZLM A;  1BCM A;  2BKD N;  2YXY A;  5I22 A;  1D0X A;  4FL6 A;  4HT8 A;  2FG0 A;  2JMC A;  3V7R A;  2QI2 A;  2RO0 A;  2BZY A;  3OYF A;  3TU4 K;  2X35 A;  2HKN A;  4QKU A;  5M9O A;  3EGD A;  1K73 C;  1MV0 B;  2VWF A;  3JB9 D;  5A0L A;  5KYW B;  5J26 A;  1Q7Y U;  1VQ5 A;  1TS9 A;  2EGE A;  3ASK A;  4MMK A;  3G71 T;  1QWF A;  3JCM b;  3CCU A;  4E7Z A;  2FO0 A;  4J5Y A;  2EAY A;  5FRO A;  3FEO A;  3NHN A;  3CCQ T;  3FLG A;  4OMF B;  1JXO A;  2CKK A;  4C8Q A;  4EMH A;  4Y28 E;  4CC4 B;  4FW1 A;  4LD6 A;  1A0N B;  1Q82 R;  5GMK m;  1GCQ A;  2VYT A;  3CBM A;  3UPU A;  2P0P A;  1QVG S;  1G2B A;  2AHJ B;  1OPK A;  5CCA A;  2Y4Y A;  2RQU A;  1RLQ C;  4KH1 B;  1AWX A;  2V26 A;  4BDZ A;  4HA8 A;  1RI0 A;  1IXD A;  5GAO r;  3VS7 A;  4BI4 A;  3JV3 A;  2R58 A;  2QA4 T;  5LJ5 d;  1VQ7 A;  2EFI A;  2KI7 A;  1WHK A;  4OF1 A;  2V8K A;  1Q81 C;  2GTO A;  3LW5 E;  1G83 A;  2HCK A;  4ESR A;  1VQ9 A;  3X24 B;  5AT1 B;  1K9M R;  3SEM A;  1VQ7 Q;  4M78 A;  4EPC A;  2HSE B;  1KFZ A;  1I5L A;  2RI2 A;  1KD1 U;  2RJC A;  1WJQ A;  1ZSZ B;  2LCS A;  4M77 E;  5CKF A;  3U23 A;  4ANJ A;  2IG0 A;  2ZAE A;  4E7H A;  2I0N A;  9ATC B;  4PJO F;  3BE3 A;  1FX7 A;  3EAE A;  2X4W A;  1VQO Q;  3M4G A;  3VRY A;  2E10 A;  3QKJ A;  2NLU A;  2XU8 A;  2O01 E;  1R0B G;  2K3B A;  2LNH B;  1D3B B;  2H8H A;  2B8A A;  2KYM A;  1M90 U;  1ZSZ C;  2DFU A;  3I55 Q;  2K6D A;  4JLI A;  4J7F A;  5A2Q E;  4Q5W A;  2DLP A;  1YJN A;  3S3M A;  4C92 B;  3I56 T;  1B3Q A;  5C6S A;  1B07 A;  4LNP A;  4II1 A;  1W6X A;  3OYK A;  3JCM V;  3CXC S;  1ZA2 B;  4E7I A;  5FU7 B;  2D8H A;  3JSC A;  3GIB A;  3HSB A;  2RM4 A;  3RES A;  2JJ9 A;  2CP0 A;  1M3C A;  3LWH A;  4PJO D;  4XTU A;  1M8M A;  4C92 C;  3MO8 A;  1NLO C;  3PTA A;  2ZGW A;  1CSK A;  4KGX B;  2JT4 A;  1AEY A;  3ME9 A;  1KD1 C;  2E3H A;  5GAO n;  2DIG A;  1GRI A;  3GNG A;  1WHJ A;  4HCK A;  5I2S A;  3BW1 A;  3CEY A;  3QZ5 B;  5FU7 C;  3OS5 A;  3GP8 A;  2DXB A;  1Z9Q A;  1PKT A;  1CKB A;  1N6A A;  1Y7X A;  2PVD B;  2SEM A;  3VS0 A;  4L5G A;  1M90 C;  5KYW A;  4O6J A;  3OYE A;  1JEG A;  1FMW A;  3CCQ A;  4FCY A;  1SF9 A;  1QP3 A;  4RTW A;  2K3X A;  1PG5 B;  2K57 A;  1PD1 A;  1KC8 R;  1X6G A;  4M75 E;  3OY9 A;  1WIE A;  4Y92 A;  4CC2 A;  1BCO A;  1ZUY A;  4X9D A;  3KUF A;  2DL4 A;  1LOJ A;  2COW A;  2JS2 A;  2GFU A;  2VXF A;  4K11 A;  1YN8 A;  4XTY A;  3OW2 S;  2KNB B;  4LUE A;  2KYB A;  1JRI A;  5GMK l;  2RHI A;  4QVD A;  2E70 A;  3CCR T;  2YWW A;  2MPX C;  2X4Y A;  2EVR A;  3CCS A;  3I9Q A;  3V7C A;  3GBQ A;  1K8A R;  2O88 A;  1YFN A;  1IRE B;  1K0S A;  2OTJ A;  1AZE A;  2FPD A;  4DOW A;  3CCJ A;  4JRI A;  1D0Z A;  4XTX A;  1J3T A;  3OBY A;  2EKO A;  2F2V A;  3ZBD A;  3M57 A;  3QYG B;  4C8Q F;  4F17 A;  4M7D G;  4J6X A;  3A8H B;  3HTR A;  3EFO B;  3CMA Q;  1GBR A;  2HD0 A;  2ZPH B;  2JMA A;  2JNG A;  4LDX A;  1ZA1 B;  4XU0 A;  2A36 A;  2MWP A;  3X25 B;  2QAS A;  1G3S A;  2LQW A;  2GQV A;  2LX7 A;  2DO3 A;  3FDR A;  4A4H A;  1FYN A;  1YCY A;  2V1Q A;  5GMK j;  2ROL A;  3PMI A;  1B34 B;  4HVU A;  4FYW B;  1QVF P;  1R0C B;  3LWI A;  2E65 A;  4QQD A;  5I2M A;  1MHN A;  3CCV T;  1M2O A;  1BU1 A;  3BFM A;  1BBZ A;  1UDL A;  2DL5 A;  3NGP A;  2R5M A;  4AG2 C;  2YT6 A;  4JJN K;  2DJQ A;  3S3O A;  4PLL A;  4M7A B;  4F14 A;  3RKW A;  4IUT A;  1PD0 A;  4OMQ A;  4E7J A;  1IB8 A;  4R0K A;  2GGR A;  4OML A;  1NPP A;  5GJW B;  4A4G A;  4EIK A;  3RKX A;  2KEA A;  4OGC A;  4M7A C;  3QBY A;  3JCM J;  1M8V A;  2QGG A;  3QWY A;  1PKS A;  1E6H A;  1NYG A;  3HRU A;  5LJ3 j;  3H0F A;  3SD4 A;  1K76 A;  1GCP A;  3VU3 C;  3JB9 J;  5GAM e;  4RTZ A;  4XU3 A;  2OTL A;  1NBE B;  1UB4 A;  2IVW A;  2P0K A;  4Z88 A;  5LJ3 h;  2J05 A;  3URG A;  1H8K A;  3C0C A;  4M77 G;  2C0O A;  2RNA A;  3QWX X;  2CS7 A;  2K79 A;  3L2V A;  3CCL T;  4RCB A;  5L8R E;  3R6O A;  1OI1 A;  3GOX A;  2LJ3 A;  2J6F A;  3L42 A;  2RB6 A;  3L2W A;  3CCM Q;  5KYU B;  5GMK i;  3P8B B;  3WVD B;  1QCF A;  2EYX A;  4F7U E;  3E2U A;  1KHI A;  1U1S A;  1AWJ A;  5GAN 5;  2E5Q A;  1VQP A;  2AZS A;  2CGH A;  2DXU A;  3A8M B;  3CC7 T;  4MML A;  3OYM A;  2WAC A;  3CC4 A;  2DER A;  5LJ3 f;  4XTZ A;  3JRZ A;  2WSF E;  2PUO B;  3OSV A;  2Y90 A;  4LDW A;  1Y96 A;  2GF7 A;  2RHU A;  1ABQ A;  3R6N A;  4N4I A;  2CH4 W;  1ZSG A;  1WNL A;  3ULR B;  1VQ6 T;  3I55 T;  2GQI A;  2D0Q B;  3UF4 A;  1PHT A;  1WXU A;  2MWO A;  2QQR A;  1NJI C;  3OYC A;  2JTE A;  5KE3 A;  1DJ7 B;  3PGG A;  3PIO A;  1U06 A;  4RUG A;  1G8X A;  2K4Y A;  1KQS A;  2AZV A;  3KBG A;  1B34 A;  2YRC A;  3L1A A;  5KCO A;  4ATO A;  4A4F A;  2VXE A;  2EYQ A;  3QSU A;  2D6F A;  1D09 B;  2NWM A;  3CXC P;  2RI3 A;  4R56 A;  3MEW A;  1R77 A;  3CPW S;  3V8K A;  3IQL A;  1YJW Q;  2KXD A;  4OB1 B;  5J39 A;  2A37 A;  3GLX A;  4M7A A;  3A8G B;  4M75 G;  3FRN A;  3PE0 A;  2H3J A;  3HP9 A;  2ED0 A;  1I81 A;  2K2M A;  1UTI A;  1UGV A;  4C5E A;  4XU2 A;  3FJP A;  3HPW A;  5HK3 A;  2JUF A;  3A8L B;  1VQ8 A;  2LNV A;  3DLM A;  3FB9 A;  2QYZ A;  2O2O A;  4MZM A;  4WTO B;  4N4G A;  2VV5 A;  2AT1 B;  4C92 F;  3JB9 H;  1KQ1 A;  4A63 B;  2XDB A;  1ZHI A;  4BI8 B;  4XU1 A;  3PT9 A;  2ATC B;  2XDP A;  4PJJ A;  1WXB A;  1V1C A;  3MEU A;  1YI2 A;  5LJ5 j;  4IKF A;  3E19 A;  2CUD A;  1YIT T;  4CI0 C;  2JN0 A;  4M7D B;  2FZK B;  2NUP A;  3EHQ A;  4C8Q E;  4C0Z A;  4CC7 A;  2LJ0 A;  2K2V A;  1U3O A;  4OP0 A;  3NMZ C;  2EGA A;  1W2B A;  4ELZ C;  5EC7 A;  2KAF A;  2HMA A;  4KGZ B;  1N8R C;  2LDM A;  3TSW A;  2KRS A;  2JOY A;  3TSZ A;  3MPU B;  2XHC A;  5KYU A;  1IHV A;  4XQ3 A;  4M7D C;  4C92 D;  4FYY B;  4GLM A;  3M0Q A;  4BUG A;  3A98 A;  1TG0 A;  1WHH A;  5CIU A;  2Y4X A;  3JB9 F;  3C94 A;  4XTW A;  3H6Z A;  1K9M C;  3NTI A;  2KRM A;  3FJ5 A;  3OYG A;  2EWN A;  3PVL A;  4JJD A;  4MDW A;  4M78 E;  2YUO A;  1VQL Q;  2XIC A;  3CME A;  3CMA T;  2NUT B;  3INZ A;  2RQW A;  2DD4 A;  3I5S A;  5LJ5 f;  3CCV A;  5CKD A;  2CZ1 B;  3CD6 Q;  1I0C A;  2CYZ B;  2QDL A;  2DEU A;  2COZ A;  1H3H A;  4EMK A;  5KYX B;  3VS5 A;  1Q81 U;  2LMJ A;  4ZTJ A;  1VQM T;  2RHX A;  4HKE A;  1LVK A;  1D1B A;  2RJF A;  1VQ5 Q;  3H8Z A;  2XG8 D;  4BI3 A;  1I4K 1;  3I5R A;  2LX9 A;  4FSX A;  3CCU Q;  1UGQ B;  5CQY A;  1Y71 A;  4A54 A;  3CC2 T;  2F1L A;  4E47 A;  4RTT A;  1IHW A;  2V1R A;  7AT1 B;  2M0Y A;  4X9C A;  3EGX B;  4OB2 B;  4J9H A;  1W4S A;  4ZN1 A;  2EJF A;  5IT9 E;  1NZ9 A;  3OBW A;  2EQU A;  2HL3 A;  2HBP A;  2DPP B;  2E6N A;  2D0N A;  4PJO G;  1ZQ1 A;  1VQ4 T;  1QVG A;  2FZG B;  4BE0 A;  3RKY A;  3CCE A;  1F1B B;  3FC3 A;  2IPO B;  2LVM A;  2V8I A;  3G6E T;  4BAC A;  1RUW A;  4FU6 A;  2L3P A;  3EFS A;  2DXC A;  5ECA A;  2ENM A;  4QT7 A;  1EZZ B;  1D0Y A;  4TVR A;  4F7U G;  1OOT A;  1QQJ A;  1XNI A;  2HAX A;  1AWO A;  2O9S A;  3UA6 A;  1VQK A;  1W1F A;  2EQI A;  1VQ9 Q;  3X20 B;  2HQH A;  3JCM X;  3TVT A;  2F5K A;  4E7L A;  1EX4 A;  4KT0 E;  1V29 B;  1KC8 C;  3GF5 A;  1YIJ A;  3VRZ A;  1YHQ A;  1LJO A;  3AHU A;  1T0H A;  3EG9 A;  1PRM C;  1NE8 A;  3M0U A;  4FT2 A;  2D1X A;  1BI3 A;  4A4K A;  4M7A F;  2X3W D;  5AYF A;  1VYU A;  1M1K R;  1WX6 A;  4DBR A;  2AIR B;  2ESW A;  1SRM A;  5GAN 4;  4J9G A;  2YRD A;  3RBB B;  1ABO A;  1YJN Q;  2EW3 A;  2P84 A;  2L3S A;  1K73 R;  3J7A F;  1HD3 A;  3WXM B;  2X9H A;  4BE2 A;  3MEV A;  3QDR B;  1TTH B;  3CXC A;  4L6V 5;  2L0A A;  5HK0 A;  4GY5 A;  1I07 A;  2NUT A;  4M7A D;  4M75 B;  4MZT A;  5D6Y A;  2QG9 B;  5GAN e;  1RAG B;  2CDT A;  2DIQ A;  4HVW A;  1M1F A;  3M59 A;  2XKO C;  1YCS B;  4M75 C;  3OYH A;  2XID A;  3C95 A;  3RMS A;  5HY6 A;  4BDY A;  2RA2 A;  1W70 A;  1UGR B;  3LH0 A;  3CCQ Q;  1K1Z A;  1RAB B;  4A4E A;  3M54 A;  4RKU E;  4KRT A;  1Q7Y R;  3BDU A;  1N9S A;  3QXE B;  1YJW T;  5IAY A;  2LJ1 A;  4RTV A;  5KYN A;  1NPR A;  2R57 A;  2EGC A;  4C8Q G;  4FYV B;  3CPW P;  4LDY A;  3SFM A;  2X4X A;  3M5A A;  1YJ9 T;  3RNJ A;  1WQW A;  2QAZ A;  2CP5 A;  3SWN B;  3ZL7 C;  3JAM E;  3EG2 A;  1R8O B;  4E2F B;  2MCN A;  3DLL A;  5GAN g;  3OW2 A;  1X2Q A;  3J81 E;  1BIB A;  3VS2 A;  2LC4 A;  6AT1 B;  4QQ6 A;  2KQW A;  2PVG B;  2KMT A;  2LT4 A;  4AG1 C;  2BTT A;  3REA B;  3SWN C;  1S72 T;  3AT1 B;  1KQ2 A;  4JS4 A;  4J6Y A;  4L59 A;  1ZSZ A;  5DLQ E;  3CCS Q;  1VQN A;  3JCM h;  4PJN A;  2CP2 A;  4NS5 A;  2OTJ Q;  2CSI A;  4HXJ A;  1H64 1;  1AVZ C;  2M02 A;  3CCJ Q;  4HCZ A;  3KXT A;  4M78 G;  1XOV A;  3G4S T;  1Q86 C;  3DB3 A;  2QEX A;  1WGS A;  1D3B A;  4LDU A;  2GTJ A;  1KD1 R;  4HT9 A;  2MIO A;  1IGQ A;  4RMO A;  1SPK A;  2A28 A;  2PZ1 A;  1MMA A;  2HDA A;  4KGV B;  2CH4 A;  4DOV A;  1QCN A;  4C92 A;  1O75 A;  2EYZ A;  3L2R A;  2QK0 A;  3VS3 A;  5GAN 2;  4RTY A;  3L2Q A;  4XTV A;  1BI2 A;  3M9Q A;  3ZEH A;  4QVC A;  1QW1 A;  1UHC A;  1M90 R;  2FYK A;  3JCM f;  2KDS A;  3EG3 A;  1VQM A;  2DTH A;  1RAF B;  3G71 A;  3QJY A;  4LUD A;  5GMK h;  1VQL T;  3MET A;  1QMC A;  2VAS A;  4LN2 A;  3QYH B;  1NYF A;  1X2K A;  2M51 A;  3G71 Q;  1CKA A;  1ZUU A;  2M1H A;  4BD3 A;  1OUL A;  5CK9 A;  1PSE A;  2BE7 D;  3REB B;  4AFU C;  3JCM Q;  2GCX A;  1RAD B;  2CP3 A;  3EH1 A;  1BI0 A;  3VS4 A;  4Z89 A;  3SHW A;  4OMM A;  2PU9 B;  1QCO A;  3NPF A;  1VQ5 T;  2CZ6 B;  3D7S B;  4C0G A;  4F7U B;  2RQT A;  1G3T A;  2Z0W A;  2QA4 A;  1WDX A;  3CCU T;  4LE9 A;  1U5S A;  1AWW A;  4ZNX A;  1NG2 A;  2YUN A;  3OYI A;  5IH2 A;  4FSS A;  2VC8 A;  2QA4 Q;  1M9S A;  5GAN d;  3NTK A;  2X51 A;  3P8H A;  1WA7 A;  4AFZ C;  4M7D D;  4PJO E;  4BE1 A;  2OTL Q;  2QQ9 A;  2L8D A;  2ZPI B;  2O4X B;  3M53 A;  2HSP A;  1TUG B;  2KT1 A;  2L3R A;  3OS0 A;  4J8O A;  1NJI U;  1UFF A;  3RIR A;  2DYI A;  4M7A E;  2OX7 A;  2RK2 A;  2LQK A;  3OS2 A;  3VV0 A;  3HFO A;  3MP6 A;  2RH2 A;  2M9U A;  1FMK A;  1VQ7 T;  4JZ3 A;  1B7T A;  4MDX A;  2I2L A;  2L5Q A;  5DM7 R;  4Z02 A;  3I56 A;  1VQP Q;  1KK7 A;  3L2Z A;  2F69 A;  2K5I A;  1SKU B;  1YBY A;  2KBT A;  3OQ5 A;  1RLP C;  3I56 Q;  3CC4 Q;  1KJW A;  5HKC A;  1VQO T;  5GAM j;  3VUZ A;  3S6W A;  2KSS A;  3EFO A;  4V2S A;  2EKH A;  3UT1 A;  1AD5 A;  2RPN A;  3L2U A;  1VA7 A;  3OMG A;  4ELY C;  2DL8 A;  1O9S A;  2DA9 A;  2XI9 A;  2DL7 A;  1YWP A;  5GAM h;  3ER0 A;  1RAI B;  3E9G A;  2E5K A;  3UWN A;  1I5O B;  1JBM A;  1M1G A;  1D1A A;  4JJC A;  2LZ6 B;  3EGD B;  5CR2 A;  4MZP A;  2DJZ A;  1WI7 A;  3QHS A;  2ZPE B;  2LCL A;  4ZGJ B;  2NYS A;  3LGL A;  3C12 A;  4D8D A;  2A0F B;  2JZ2 A;  4M77 D;  2K5L A;  4AFQ C;  2QGF B;  1N8R U;  3DKM A;  1VYV A;  2DET A;  5GAM f;  3JCM c;  1VYT A;  1UEC A;  3CPW A;  3LGF A;  1KG1 A;  3HKS A;  5A0D A;  3OYJ A;  2FPF A;  1QVP A;  2PNI A;  3CBP A;  1MGQ A;  1WLP B;  2YDL A;  2IIM A;  3A8O B;  4PJM A;  4C5G A;  1MND A;  2DAQ A;  2JM9 A;  2DD5 A;  2VB6 A;  4IUU A;  1BB9 A;  2P4T A;  4E7K A;  5D7U A;  5LJ3 d;  4EDU A;  4QW2 A;  1K9M U;  1M3B A;  1VQ8 Q;  1PSF A; 
#chains in the Genus database with same CATH homology
 4M4Z A;  1ZUY A;  4CC2 A;  5I11 A;  2K7A A;  2DL4 A;  1RUW A;  2J7I A;  4D8K A;  2F2X A;  1T3S A;  2BZX A;  2L3P A;  4Z8A A;  5ECA A;  2ENM A;  4QT7 A;  3VS1 A;  2AKL A;  2JS2 A;  1OOT A;  1T0J A;  4K11 A;  1TUC A;  1LCK A;  4OMN A;  1YN8 A;  1AWO A;  2O9S A;  4J9B A;  3UA6 A;  1BK2 A;  1W1F A;  2EQI A;  2KNB B;  4LUE A;  1UE9 A;  2ECZ A;  2KYB A;  1I1J A;  2GBQ A;  2P4R A;  3TVT A;  4RTU A;  2DX1 A;  2DNU A;  2EVR A;  3VRZ A;  3I9Q A;  4J9D A;  1KIK A;  2YUP A;  3GBQ A;  2O88 A;  3PVQ A;  1K0S A;  5IHN A;  2ED1 A;  2CRE A;  1T0H A;  2AK5 A;  2FPD A;  1AZE A;  4X1V A;  1PRM C;  3M0U A;  2D1X A;  1UJ0 A;  1J3T A;  2C0T A;  4GBQ A;  2X3W D;  2YSQ A;  1PRL C;  2F2V A;  1VYU A;  1WX6 A;  2L2P A;  4F17 A;  2ESW A;  1SRM A;  4J9G A;  2MOX A;  1GBR A;  2GNC A;  2JMA A;  3RBB B;  1ABO A;  2HEQ A;  2W0Z A;  3M0T A;  1UUE A;  3M0P A;  3UA7 A;  2EW3 A;  2A36 A;  2SRC A;  2L3S A;  1IO6 A;  1QKW A;  2LQW A;  2LX7 A;  1QLY A;  1HD3 A;  3O5Z A;  1WXT A;  1FYN A;  2CUB A;  2V1Q A;  2CT3 A;  2ROL A;  2L0A A;  5IHI A;  4HVU A;  5FWB A;  1MUZ A;  1I07 A;  1Y57 A;  2OI3 A;  2J6K A;  1BU1 A;  1H92 A;  3UAT A;  1JU5 C;  2LQN A;  1BBZ A;  1AOJ A;  2EPD A;  2PTK A;  2KRN A;  1SHF A;  1UDL A;  2DL5 A;  3NGP A;  2CDT A;  2FRY A;  2DF6 A;  1E6G A;  2YT6 A;  4HVW A;  4AG2 C;  2DJQ A;  2EBP A;  1YCS B;  1UG1 A;  4F14 A;  1AZG B;  4OMQ A;  1ZBJ A;  3EG1 A;  4R0K A;  1NLP C;  2GGR A;  4OML A;  2JM8 A;  4J9I A;  2OAW A;  2DRK A;  5GJW B;  1W70 A;  1UHF A;  2BZ8 A;  2O31 A;  4EIK A;  2RQV A;  2KEA A;  1K1Z A;  2FEI A;  1E7O A;  5L23 A;  3QWY A;  1PNJ A;  2F2W A;  4KRT A;  2CSQ A;  1PKS A;  1E6H A;  2KT8 A;  5FWC A;  1NYG A;  2RF0 A;  3H0F A;  1WYX A;  1K76 A;  1X6B A;  1GCP A;  2JS0 A;  2LJ1 A;  4RTV A;  1GCQ C;  3I35 A;  3M0S A;  2EGC A;  2DMO A;  1HSQ A;  1Z9Z A;  3EG0 A;  4RTZ A;  4ORZ A;  3EGU A;  3M0R A;  1JXM A;  2ABL A;  2XMF A;  1RI9 A;  4Z88 A;  3RNJ A;  2J05 A;  1H8K A;  3C0C A;  2C0O A;  2RNA A;  3ZL7 C;  3QWX X;  2K79 A;  1Y0M A;  3EG2 A;  4HVV A;  2MCN A;  2RN8 A;  4DEY A;  2KR3 A;  1X2Q A;  2LJ3 A;  2DIL A;  4J9F A;  2J6F A;  3VS2 A;  4JZ4 A;  3CQT A;  2DL3 A;  3H0H A;  4F16 A;  2EYY A;  4AG1 C;  2BTT A;  3REA B;  1QCF A;  2EYX A;  1YNZ A;  1AWJ A;  1M30 A;  2EYW A;  1QKX A;  2AZS A;  4JJB A;  1K0X A;  2CSI A;  4HXJ A;  1GFD A;  1AVZ C;  5FW9 A;  1KSW A;  2YUQ A;  1GL5 A;  1OEB A;  3EHR A;  1XOV A;  4IIO A;  1SHG A;  1JQQ A;  1NEG A;  2OJ2 A;  2GTJ A;  2LP5 A;  1K4U S;  2MIO A;  1NM7 A;  2AKK A;  2DVJ A;  3KFV A;  1SPK A;  4DEX A;  2A28 A;  2PZ1 A;  1WFW A;  2HDA A;  2D8J A;  2JXB A;  5IXF A;  1ABQ A;  2CH4 A;  3R6N A;  1ARK A;  1GFC A;  2EYZ A;  1ZX6 A;  3VS3 A;  2DRM A;  2CH4 W;  4RTY A;  1ZSG A;  1X69 A;  4J9E A;  3ULR B;  1UHC A;  4E6R A;  3LH5 A;  2VKN A;  1ZLM A;  2GQI A;  3UF4 A;  2KE9 A;  3EG3 A;  1PHT A;  1WXU A;  5I22 A;  2JTE A;  1SRL A;  1U06 A;  4RUG A;  4LUD A;  2FG0 A;  2JMC A;  2AZV A;  2BZY A;  4LN2 A;  1NYF A;  1X2K A;  5IHK A;  2M51 A;  1CKA A;  1ZUU A;  2X3X D;  1MV0 B;  2VWF A;  2DM1 A;  2ROT A;  2EGE A;  3REB B;  4AFU C;  2NWM A;  1QWF A;  4AFS C;  1GBQ A;  1K9A A;  2FO0 A;  4OMP A;  3IQL A;  2KXD A;  2A37 A;  3NHN A;  3VS4 A;  3PE0 A;  1JXO A;  3SHW A;  4Z89 A;  4OMM A;  4CC4 B;  2ED0 A;  2K2M A;  1UTI A;  1X43 A;  3NPF A;  1UGV A;  1A0N B;  2RQT A;  2NUZ A;  1GCQ A;  1WDX A;  1SSH A;  4RTX A;  4LE9 A;  1U5S A;  1G2B A;  4ZNX A;  1AWW A;  1NG2 A;  2YUN A;  1OPK A;  2RQU A;  1RLQ C;  2RMO A;  5IH2 A;  4FSS A;  1AWX A;  1OV3 A;  4J9C A;  1WA7 A;  2O2O A;  5HCK A;  3VS7 A;  4AFZ C;  4A63 B;  3JV3 A;  1YP5 A;  4JPB W;  1HJD A;  4CC3 A;  2HSP A;  2KT1 A;  1JO8 A;  1WXB A;  1V1C A;  1UFF A;  2GTO A;  1G83 A;  2B86 A;  2HCK A;  4ESR A;  2CUD A;  3SEM A;  3EHQ A;  4CC7 A;  1KFZ A;  2LJ0 A;  1T3L A;  1X27 A;  1U3O A;  1MV3 A;  3NMZ C;  2K9G A;  2EGA A;  1FMK A;  5EC7 A;  2KGT A;  2LCS A;  3U23 A;  2FRW A;  4JZ3 A;  3TSW A;  2KRS A;  3TSZ A;  2I0N A;  4WCI A;  1S1N A;  2FPE A;  2KRO A;  3VRY A;  4IIM A;  4GLM A;  2KBT A;  3M0Q A;  2K3B A;  2LNH B;  2H8H A;  2KYM A;  1RLP C;  3A98 A;  2L3Q A;  1TG0 A;  1KJW A;  2K6D A;  2DLP A;  2EKH A;  1EFN A;  1AD5 A;  1B3Q A;  2RPN A;  3THK A;  2HBW A;  2KRM A;  3FJ5 A;  1VA7 A;  3PVL A;  1B07 A;  4JJD A;  4LNP A;  2DL8 A;  2DA9 A;  1W6X A;  1YWO A;  2YUO A;  1ZUK A;  2DL7 A;  2CT4 A;  1UJY A;  1YWP A;  2D8H A;  2RQW A;  3I5S A;  2G6F X;  2JW4 A;  1M3C A;  3H0I A;  1I0C A;  1M8M A;  1SEM A;  1NLO C;  2KXC A;  2QDL A;  2DYB A;  2E5K A;  1CSK A;  2JT4 A;  1AEY A;  2DBK A;  1QWE A;  1H3H A;  2A08 A;  1GRI A;  4JJC A;  4HCK A;  3VS5 A;  2LZ6 B;  3H41 A;  2LMJ A;  1WI7 A;  1Z9Q A;  1PKT A;  1CKB A;  4OMO A;  4D8D A;  2C0I A;  2O9V A;  2SEM A;  3VS0 A;  3VS6 A;  4AFQ C;  5GJV B;  2VVK A;  3I5R A;  5IXB A;  2RQR A;  1VYV A;  1VYT A;  1UEC A;  2DBM A;  1JEG A;  2W10 A;  1N5Z A;  4RTT A;  2V1R A;  2M0Y A;  2FPF A;  2PNI A;  4J9H A;  1WLP B;  2DE0 X;  2IIM A;  2YDL A;  4RTW A;  1OPL A;  2JM9 A;  1M3A A;  1BB9 A;  1TUD A;  1PWT A;  2D0N A;  2J6O A;  1X6G A;  1M27 C;  1WIE A;  1M3B A;  2J06 A;  1NEB A;  4Y92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...