4HVWA

Crystal structure of the t98e c-src-sh3 domain mutant in complex with the high affinity peptide vsl12
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
GSHMTFVALYDYESRTEEDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/peptide
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Atomic resolution structures of the c-Src SH3 domain in complex with two high-affinity peptides from classes I and II.
pubmed doi rcsb
source organism Gallus gallus
total genus 9
structure length 61
sequence length 61
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4hvwA00
2KEAA 1G83A 1AOJA 4Z88A 4CC2A 1CKBA 1WXTA 2EVRA 4IIOA 2X3XD 3EHRA 3QWYA 1HD3A 1W70A 1GCQA 1BBZA 1OOTA 1M3AA 1AVZC 2RQUA 2L3PA 2L2PA 2EYZA 1UUEA 2EGEA 2JM8A 1Y57A 4J9IA 1I1JA 2EKHA 2LNHB 1GCPA 4IIMA 1X43A 1UGVA 2O31A 1U3OA 3M0TA 4OMPA 2KBTA 1UG1A 4R0KA 2F2VA 2DBKA 1T3LA 1NEBA 4OMLA 2DRKA 3M0QA 2E5KA 1XOVA 1GL5A 4A63B 2L0AA 1GRIA 5GJWB 2BZXA 1SPKA 2ROLA 4Z89A 1ZSGA 1GFDA 1YNZA 3R6NA 3JV3A 2D8JA 1KJWA 2J6FA 4HCKA 1T0HA 1UECA 4KRTA 3CQTA 1UE9A 1IO6A 2CREA 4AG2C 2LZ6B 1HJDA 5L23A 2F2XA 3THKA 2VKNA 4RTVA 2V1QA 2KGTA 3VRZA 1X6BA 2FEIA 5IXBA 2HBWA 1AEYA 2JM9A 1I0CA 1RI9A 4CC4B 2LCSA 2JW4A 2EYWA 3LH5A 1NM7A 1LCKA 3M0UA 5IXFA 5FWBA 2PNIA 4J9DA 4LUDA 1M3BA 5IHIA 1Z9ZA 2HEQA 1X69A 2CSIA 4E6RA 2KE9A 1PRLC 2DF6A 2AKLA 2KT1A 2LQWA 1Y0MA 1PWTA 1NEGA 3QWXX 4CC7A 4DEYA 2L3QA 2K3BA 1T3SA 2RPNA 5I22A 2GBQA 1W6XA 2DYBA 3ULRB 2CT4A 3SEMA 2DJQA 3EHQA 4RTZA 1KIKA 2ED1A 2FPEA 2C0IA 2DE0X 2GNCA 5EC7A 2ROTA 1M30A 2KXDA 2YUQA 1U5SA 4JJCA 2I0NA 1OEBA 2KRSA 2LJ3A 4LNPA 1QWFA 4HXJA 1RLPC 3VS7A 1FYNA 4JZ4A 2RNAA 1UFFA 1ARKA 4J9BA 2RQWA 1ZUYA 2FRWA 2J06A 1PHTA 1WA7A 1AD5A 2EPDA 1VYUA 1KSWA 1TUCA 3EG2A 1QKXA 1B07A 2JTEA 1M3CA 1JXMA 2O9VA 3VS5A 1K1ZA 2KYBA 2YSQA 3REAB 2HSPA 2JMAA 3NMZC 3PVLA 1M27C 3REBB 2YUPA 3RBBB 5FWCA 3M0PA 2XMFA 3UA6A 1K9AA 3VS4A 1BU1A 1UHCA 1OPKA 1QKWA 4ESRA 1GFCA 1PRMC 5GJVB 2YUNA 1E7OA 2C0OA 3NGPA 1G2BA 2D1XA 4JPBW 2KROA 2JMCA 1WLPB 1YP5A 1VA7A 2DL3A 2W0ZA 2EYYA 4LE9A 3H41A 2J6KA 2K9GA 1T0JA 2DBMA 4J9FA 3VS1A 1WX6A 4DEXA 3I35A 2FPFA 1ZUUA 1I07A 2LJ1A 2MIOA 1SRLA 4X1VA 2FRYA 1QCFA 1VYVA 1N5ZA 1X2QA 1AZEA 4EIKA 3VS3A 1MV3A 4RUGA 2DL8A 3I9QA 3TSZA 4JZ3A 2DX1A 2KRNA 1UHFA 4AFSC 2DILA 1YN8A 1MUZA 2A36A 2AZVA 3NPFA 1YWPA 2EGAA 3H0FA 5IH2A 4RTXA 2RQVA 1NLPC 1Z9QA 2VVKA 2JS0A 1FMKA 2ABLA 2F2WA 2K7AA 2PTKA 2MOXA 1PKTA 2GGRA 2JXBA 2EYXA 3I5RA 2ECZA 2JT4A 3EG1A 2LX7A 2EGCA 2PZ1A 4GBQA 1UJYA 1ABOA 4Z8AA 5IHKA 1ZUKA 1NYGA 2KNBB 2KT8A 2YT6A 4AG1C 1WIEA 2J7IA 2H8HA 3FJ5A 1OV3A 3A98A 1QWEA 1K0SA 1SSHA 1GCQC 4OMNA 2O2OA 1UJ0A 1GBQA 1AWOA 2BZ8A 5FW9A 3VS2A 1H8KA 2RN8A 4ZNXA 1MV0B 1X2KA 1WXUA 1KFZA 4RTTA 4Y92A 2CH4W 1UDLA 2FO0A 1QLYA 3I5SA 4JJBA 4LUEA 3TVTA 3PVQA 2RQRA 4AFUC 2ED0A 1NLOC 3ZL7C 2ESWA 1NG2A 2DA9A 2O9SA 2W10A 3H0IA 3IQLA 3UA7A 4HVUA 3KFVA 2GTOA 4LN2A 1J3TA 1K76A 4GLMA 5I11A 1WI7A 3VRYA 1WYXA 1ABQA 4RTWA 4RTYA 1SRMA 2KRMA 1SHFA 2D0NA 1W1FA 4F14A 4QT7A 2FPDA 2DM1A 2DL4A 3GBQA 2GQIA 2DNUA 1BK2A 4D8DA 1JQQA 2RMOA 1GBRA 2OJ2A 1JXOA 2NUZA 1E6GA 2JS2A 3EGUA 1H3HA 2RQTA 2AK5A 3NHNA 3EG0A 3PE0A 2A37A 2NWMA 3U23A 2A08A 1ZLMA 2FG0A 1S1NA 4J9GA 2J6OA 1K0XA 3O5ZA 1OPLA 2HDAA 2M51A 2CSQA 1K4US 2BZYA 3M0SA 2MCNA 1JO8A 2QDLA 1WFWA 2DMOA 1NYFA 5IHNA 2CH4A 1AWWA 3SHWA 5ECAA 3UF4A 1TG0A 2KXCA 1EFNA 4AFQC 1JEGA 4J9EA 2K79A 4OMOA 1SHGA 1UTIA 1CKAA 1AWJA 1TUDA 2CUBA 2BTTA 4RTUA 1AWXA 3UATA 1CSKA 1B3QA 1ZBJA 2GTJA 2KR3A 2X3WD 4F16A 2YDLA 2AZSA 4CC3A 1SEMA 2AKKA 3M0RA 1WXBA 2K6DA 2DL5A 1H92A 4D8KA 2LP5A 2LMJA 1VYTA 4ORZA 1YWOA 3EG3A 3RNJA 1PKSA 1BB9A 2RF0A 2O88A 2SEMA 2OI3A 1WDXA 3VS6A 4M4ZA 2CT3A 1RUWA 1V1CA 4OMMA 4FSSA 2ENMA 2A28A 1U06A 2VWFA 2D8HA 4OMQA 4AFZC 1HSQA 2CUDA 4F17A 1PNJA 2V1RA 1JU5C 4J9CA 2B86A 2LQNA 2K2MA 2G6FX 2DL7A 2KYMA 4JJDA 2EQIA 2P4RA 2IIMA 2DLPA 1M8MA 5HCKA 4HVWA 2YUOA 1X27A 1RLQC 4HVVA 1AZGB 2J05A 2L3SA 2OAWA 2M0YA 1YCSB 2LJ0A 2DRMA 4K11A 2CDTA 3VS0A 4J9HA 2C0TA 1A0NB 2EBPA 1X6GA 3TSWA 3H0HA 1ZX6A 3C0CA 4WCIA 1E6HA 2HCKA 2DVJA 2EW3A 2SRCA
chains in the Genus database with same CATH superfamily
1G83A 4A4GA 4BY6C 2K2VA 5C0MA 4DA4A 2CP3A 3QWYA 1JJ2S 1HD3A 2E64A 1OOTA 1Y07A 1AVZC 3CD6Q 2L2PA 5D6YA 5J3BA 4PK4A 1Q82U 4XU0A 4FW1A 1OX8A 1VQ7Q 3QJYA 1YIJQ 1W2BS 3J7AF 1U3OA 2KBTA 5FU7C 5FU6C 4A4EA 2F2VA 1M4ZA 4F04B 4L6V5 4RKUE 4OMLA 1RADB 2E5KA 1XOVA 4M75B 4ZTJA 2L0AA 1YJWQ 2H3JA 1SPKA 1YNZA 3CCST 4N4GA 3MPUB 2NLUA 3QZ5B 5GAOl 3CBOA 1YCYA 3GOXA 2YLCA 1IO6A 3VYGA 2GQVA 2EQKA 4M78G 2QASA 3JCMX 3FB9A 9ATCB 3OYIA 1VQKQ 1PG5B 2QA4A 1IGUA 2BE7D 1AEYA 2JM9A 5D7UA 1I0CA 2LCCA 5EG2A 3A8LB 3DB3A 3CMAA 3JCMW 3CCLT 1D3BA 2EYWA 5GAN6 1LCKA 4J9DA 5CK9A 3FC3A 3SWNA 3MP6A 1X69A 1PCXA 1XTDA 5LJ3j 4QW2A 3G71T 2AKLA 1Y0MA 4M75F 2K4YA 1RACB 1PWTA 1VQPT 2KQWA 1NEGA 5HK3A 4MZTA 1T3SA 1VQLQ 2JOYA 2A3LA 1W6XA 4BB7A 2CT4A 3EHQA 2DXCA 4RTZA 5KYNA 2CP6A 1KIKA 2GNCA 1FWZA 2VB6A 4B9XA 2ROTA 2XDBA 1Q82R 1M30A 2KXDA 3EFSA 3OYJA 4X9DA 3CCUA 1YFNA 2YUQA 3OMGA 4IUTA 3OW2A 1H3ZA 4C0FA 4C8QG 4XTYA 2EAYA 4E7ZA 5GAN4 4LNPA 3L2WA 3JCMb 3V7RA 4HXJA 1N9SA 1RLPC 3VJPA 3CMEA 4PJOB 4WTOB 1UFFA 4LXCA 1ARKA 2RQWA 4ZTFA 4C0GA 1NPRA 1ZA2B 3OS1A 5GAN7 2FRWA 1D1CA 1WA7A 4JLIA 3QHSA 1KSWA 3HSBA 3AHUA 2QEXQ 1JXMA 2O9VA 3VS5A 3HKSA 2JMAA 3NMZC 3PVLA 5GAMj 2CP0A 3UA6A 1K9AA 2KMTA 3EG9A 3VS4A 3SB2A 4ZGDB 3EFOA 3OYAA 2DPPB 2RI2A 4DBRA 1LNXA 5GJVB 1UGSB 1E7OA 3DLLA 4A54A 4XU2A 2VC8A 4O5VA 1G2BA 4BI3A 3I56T 1YP5A 2DL3A 3EGXA 3CCRQ 3H41A 1VQ7A 2K9GA 3OY9A 4J6XA 4PJOF 1YIJA 3VS1A 3FJPA 4FM4B 4M7DA 1WX6A 2FPFA 1I07A 1JBMA 2XDDA 2YXYA 3CC7Q 1NE8A 4XQ3A 3HRSA 3SWNC 1YI2T 1VYVA 2HAXA 1N5ZA 1YJWA 1X2QA 3H9NA 3OW2P 3I9QA 5GMKi 2HL3A 3TEEA 2DFUA 4XTXA 3RKWA 3CC4Q 4M77F 1S72Q 1UHFA 4AFSC 2VUBA 2A36A 5KYUA 2AZVA 1KQ1A 1K9MU 2RJEA 5IH2A 3QZ9B 1F1BB 2QG9B 1NLPC 1R8OB 2VVKA 1G5VA 4DQ2A 2JS0A 2IVWA 4AT1B 1QVGA 4O6JA 4BDZA 1FMKA 2CP5A 3C12A 2F2WA 4C92E 4XTVA 4M77C 3A8GB 2GGRA 3MKDA 2JXBA 2EYXA 2AIRB 4BI8B 5GAN5 4ZN3A 2OTJQ 2YHTA 3EG1A 2EYQA 3R6OA 5A2QE 1ABOA 1XQHA 4FW2A 1YJNQ 3H6ZA 1NYGA 3I55Q 2XIDA 1VUBA 2LNVA 4AG1C 4OB1B 4M7AD 2J7IA 2XI9A 1U8RA 3M53A 1OV3A 2EJFA 2M9UA 1K0SA 1VQLA 3M54A 4DBHA 1VQMT 1UJ0A 1O75A 6AT1B 1H8KA 4TVRA 4ZNXA 1X2KA 1IRXA 2OTLQ 2JN0A 2ZPIB 3JCMJ 3V8KA 3JB9H 4JJBA 1TTHB 2DEQA 4Q5WA 4QKUA 1VIEA 1PSFA 2RQRA 4AFUC 5GMKj 2XICA 1ZSZB 2W10A 3IQLA 3WVEB 3JCMg 3CBMA 3KFVA 3S3MA 4LN2A 1J3TA 4ZGEB 4RTWA 2O4XB 3LLRA 4M75D 4PJJA 5GANj 5CVIA 4M7AE 1SHFA 4B9WA 2D6FA 3CCET 2JUFA 3DKMA 5IN1A 4EMKC 2GQIA 3HL8A 2DEUA 2DAQA 2QEXA 1X01A 4FCYA 3G6EQ 1D0XA 1K9MR 1QVGP 3LX7A 2JS2A 3EGUA 4IURA 4LD9K 3NHNA 3PIPA 5GAMh 3U23A 2NYSA 1YITT 5GAOq 2FG0A 4KT0E 1KC8C 1S1NA 4J83A 3QXEB 2HBPA 1VQOA 3CCRA 2DMOA 2VASA 2YLBA 3SHWA 3G4SQ 4RMOA 1KQ2A 4A4FA 3LYIA 1JEGA 4OMOA 1UTIA 3OS5A 3CC7A 1CKAA 1PC0A 2BTTA 4RTUA 2ZPGB 1CSKA 2GTJA 2K3YA 2KR3A 5GMKm 1NJIU 2YDLA 1RABB 4CC3A 4A53A 4F7UF 1QVFS 3CXCS 1WXBA 2K6DA 3JCMe 1Y71A 1ZSZC 2M0OA 3INZA 1YWOA 3CC4A 3CCVQ 3RNJA 1S72A 3RDVA 1KK7A 5L8RE 1QP2A 2B8AA 3LWHA 4IKFA 2V8JA 3PT9A 3VS6A 1RUWA 2NUTB 4OMMA 3S3NA 2ENMA 4J8OA 2AHJB 1U06A 2VWFA 4AFZC 2CUDA 4F17A 1JU5C 4PJOD 2G6FX 2DL7A 2KYMA 2EQIA 2IIMA 4LDVA 1M8MA 1D1BA 1X27A 1SF9A 3OSSC 3DB4A 4M78B 1G8XA 2OTJA 3OYLA 1ACMB 3OYKA 2E41A 5LL6S 2I2LA 3M59A 2L3SA 1YJNA 2M0YA 2LJ0A 2LQ8A 1C0MA 5LJ5g 1FX7A 3TQ7P 2E6NA 2MWPA 1PD0A 1NJIC 2P0QA 3C0CA 2EW3A 1WJQA 3BFMA 1N8RU 4WF2A 1I8FA 2ZPBB 4A4KA 1AOJA 2OTLA 4CC2A 1WXTA 4LDUA 4IIOA 2JTMA 2LCLA 2X3XD 2R5AA 5GAN8 1W70A 1BBZA 2DD4A 4M7DG 2EYZA 3L42A 2EGEA 2JM8A 2OX7A 2EKHA 2IG0A 2LNHB 3OYYA 1M1GA 1GCPA 4IIMA 1X43A 1UGVA 4E7HA 2HQHA 4M78F 2DBKA 2E3HA 1QVPA 1T3LA 3JCMf 1OX9A 2DTHA 4DOWA 3FRNA 1GRIA 1VQNT 2E4HA 3JSCA 3WVDB 1BI2A 3CPWA 3G6EA 2QA4Q 1ZA1B 2HMAA 5KYXA 1VQ8Q 3NTKA 3R6NA 1LVKA 3CMAQ 1FMWA 3P8DA 3ZBDA 2YWWA 2P4TA 4KRTA 1YJ9T 2E6ZA 3HP9A 2CREA 2EJ9A 1N8RC 3QUIA 5L23A 2F2XA 1OZ2A 2VKNA 3PFSA 2LC4A 2M02A 2HBWA 3OBYA 4CC4B 2E10A 2QK0A 4FSXA 3M4GA 2KAFA 3CCQA 3G4SA 2PNIA 3E9GA 1M3BA 2BE9B 2KDSA 5FU7B 5FU6B 1Z9ZA 2HEQA 3HFNA 5KYYA 3C95A 4OMFB 2VV5A 3OYFA 1LJOA 1PRLC 4C8QF 2KT1A 5A0DA 3CCJQ 1DJ7B 1N8RR 4KGXB 4DEYA 4E2FB 5I22A 2GBQA 2ZPFB 2DYBA 2CZ6B 3JB9G 3M55A 2L5QA 3CCVA 1BCMA 2P0PA 1IHVA 2FPEA 2C0IA 2WACA 1P92A 4C8QC 3VYHB 1BCOA 1U5SA 1QP3A 4M7AA 1MNEA 2RM4A 1OEBA 2LJ3A 2HKQB 5CO7A 3VS7A 5CKBA 1V29B 3JCMV 5LJ3g 1KHIA 3CPWP 2PUKB 3OA6A 4EDUA 4MDXA 4HCBA 1ZUYA 3CC2T 3CD6T 4PLIA 1WHMA 1OI1A 4MMKA 2YRDA 4FIBA 1TUCA 1WQ7A 3MCAB 1YIJT 3M57A 1R0BG 3Q1JA 2YSQA 3REAB 2RI5A 5LJ5f 1M27C 1I4K1 3RBBB 3M0PA 3VUBA 3BDLA 4M75A 1ZBXA 2KI7A 2F5KA 3OYEA 1YBYA 1OPKA 1QKWA 4C92C 5HKCA 1GFCA 4BD3A 1PRMC 3RR6A 3ZEHA 2C0OA 1M2VB 4A4HA 4X34A 2D1XA 4JPBW 2KROA 1OULA 1WLPB 1K73C 2FL7A 3JCMd 4LE9A 3UPUA 2QQSA 1T0JA 3ZFJA 3LH0A 1VQKT 4HT8A 2QTXA 2MIOA 1Q86C 1KD1C 2X4JA 8AT1B 3M4YA 2PU9B 3OYHA 1D0YA 2DXTA 4QVZA 1TU0B 1WHHA 4EPCA 1UGRB 1OU9A 1RAIB 2RK1A 5LJ3e 2K5LA 1QVGS 5CAIA 1BYMA 3L2RA 1VQ8A 5D6WA 2KRNA 4PJNA 3X20B 2DILA 1YN8A 4RCCA 1M2OA 2COWA 2EGAA 1B7TA 1VQLT 4AMCA 2LT4A 2V8IA 2XU8A 2QGGA 3J81E 1Z9QA 1WHGA 2JNGA 4XU3A 5I2SA 4LDXA 2EQUA 4JS5A 4M78D 3VV0A 4C0DC 2PTKA 2RB6A 1PKTA 2DKGA 1IHWA 3OSVA 4GBQA 1UJYA 1D3BB 1OQKA 4Z8AA 1YHQT 1ZUKA 3CCLQ 4E7IA 2WSCE 4DBFA 1WIEA 3CCJA 3SWNB 3RKXA 1WJSA 2H8HA 3A98A 2DZ9A 4Y91A 1OYXA 5AT1B 1SSHA 4OMNA 3OYGA 2RHXA 1PM3A 1GBQA 4OVAA 1VQPQ 3VS2A 2HL5C 3GP8A 2EKOA 1UB4A 1MV0B 4RG2A 1G3WA 2L3RA 1KFZA 2NUPB 3JB9J 2RD1A 2JZ2A 3QJ6A 4LDYA 4KBMB 2RJFA 1IB8A 5HY6A 2MF2A 3TVTA 2ZZDA 1FMVA 1NLOC 1NG2A 2O9SA 4M77B 3UA7A 3NTIA 2GTOA 2CGHA 4C8QD 1K76A 4GLMA 1WI7A 2GF7A 3VRYA 4V2SA 1SRMA 4J6WA 1VQ6A 4F14A 4QT7A 4II1A 5LJ3f 4FL6A 5LJ5d 3MP1A 3RMQA 2PQWA 2K5FA 3QIIA 4D8DA 4J7IA 4C92G 3CCMA 1X6OA 5DM7R 1GBRA 1VQOQ 1NZ9A 2F1LA 3NTHA 1H3HA 3EG0A 2A37A 4JRPA 1JJ2A 3EG9B 4FYYB 4CRIA 5KCHA 3ASKA 4BE0A 1VQ5T 1K4US 5GANg 2MCNA 2L8DA 4PL6A 2QDLA 2QAZA 1WFWA 4LDWA 1NYFA 2MPXC 3J80E 2CH4A 1AWWA 1I81A 4ELZC 2Y4YA 1TG0A 5CQXA 3EGXB 5M9OA 4XTUA 1UEBA 2YRVA 4J9EA 2K79A 5GAN3 4GLKA 1AWJA 1TUDA 4M7DB 3UATA 1X75C 4EMKB 3M0RA 4FYWB 5J39A 2DL5A 3L1AA 4D8KA 1VYTA 3I55T 5GAMf 4M7AG 3LGLA 2DYIA 1PKSA 1BB9A 2RF0A 4M4ZA 4FSSA 2K3XA 2D8HA 1HSQA 1VQ4T 1PNJA 4JS4A 4J9CA 4JDSA 2K2MA 5KCOA 1WQWA 3RERA 1QQJA 2YUOA 2Y90A 5GMKe 4KUIA 1KC8U 2OAWA 3CCLA 3WXMB 2F5TX 1R0CB 4E7KA 4M7DF 3QBYA 2C0TA 2CZ7B 1JJ2P 4C5HA 4QQ6A 3OYBA 2DK3A 3G71A 4X9CA 1U1SA 1ZX6A 4WCIA 2HCKA 1MMAA 2RI3A 1VQPA 4J5YA 2SRCA 1KQSA 2KEAA 2QXFA 2HNIA 4Z88A 2D0QB 5KH6A 3OYNA 4M7DC 4DBQA 2EWNA 3PIOA 3EHRA 4MMLA 4F7UB 1GCQA 2V8KA 3P8HA 1M3AA 4GY5A 3KXTA 1MMNA 1UUEA 3QSUA 1TOVA 1QW1A 5LJ3d 2K5IA 3CPWS 1I1JA 2DVEA 1HYOA 3A8HB 5HK0A 1UG1A 1NEBA 2DRKA 3M0QA 1GL5A 2QTVA 4XU1A 3LWIA 2DZCA 1PD1A 1BKBA 3MO8A 3SDZA 3CCEQ 4ZN1A 2MWOA 3X24B 2E5QA 2R5MA 3ER0A 4M75E 3HFOA 4Z89A 3HHTB 3JV3A 1KJWA 2X9HA 3HTRA 2J6FA 4HCKA 2M1HA 4PJLA 1T0HA 3CCQQ 2KVQG 4KULA 4KH1B 4E47A 3OS2A 1HJDA 2DETA 2L89A 4RTVA 3MJXA 1EX4A 2HSEB 5GAN2 1Q7YU 3VRZA 5FLXE 5I2MA 1YITQ 3FIFA 4RCBA 1KC8R 3JB9F 4RG8A 1RI9A 3QO3A 2JTFA 2LCSA 2NUTA 3LH5A 3FDRA 4MDWA 3I56A 4L5GA 5IXFA 5GANf 4JLGA 5IHIA 4BE1A 5KE3A 1M1KC 1KQSP 5GAOm 2ZPHB 1VQ9T 1Y96A 4E6RA 2KE9A 2RH2A 2VXEA 2LQWA 1IXDA 5C6SA 2CZ1B 1QCNA 3QWXX 4CC7A 4CI0C 3E9FA 4M78A 2L3QA 4N0AA 2K3BA 2RPNA 1K8AU 4QQGA 2BIVA 1YI2A 3SEMA 2DJQA 2ED1A 4PJMA 2DE0X 3A1PA 3UWNA 3RKYA 1FXXA 2I0NA 5A0GA 4FU6A 3HRUA 2E1HA 4M77D 2XDPA 1QWFA 8ATCB 4E7SA 5IT9E 3BDUA 1Q7YC 1FYNA 4JZ4A 2RNAA 1WHKA 4ATOA 4J9BA 1RAEB 3RESA 1Q81U 4IUUA 3KBGA 2J06A 4PJOE 1M5Q1 2DO3A 4JRQA 1TS9A 1AD5A 3VKIA 1Y7XA 3EG2A 1B07A 2JTEA 1M3CA 2HSPA 1GXIE 1I5LA 4C5GA 4PFOA 4YTLA 3A8OB 5FWCA 2XMFA 1K8AC 2QDYB 1G3TA 5J26A 1NJIR 1NBEB 2CP7A 4EMGA 4NS5A 1UHCA 4ESRA 4M77E 3UDCA 1ZQ1A 4C8QB 2QA4T 2XKOC 2YUNA 1M90U 1WNLA 3D7SB 1JRIA 3NGPA 4N4HA 3CMAT 4P5NA 4QVCA 2JMCA 2X4WA 2W0ZA 4OF1A 2CP2A 2J6KA 3P8BB 4OGEA 3E2UA 2DBMA 4J9FA 2ZCFB 4DEXA 1Q95G 4M7DD 3I35A 2H3EB 3ME9A 5AYFA 1MNDA 5LJ5e 2X4YA 4BE2A 1Q81C 3EGDA 1QCFA 3CCEA 1AZEA 3M5AA 2RO0A 5CQYA 4RUGA 2DL8A 3TSZA 2FZGB 5KYWB 1D0ZA 1VQNQ 3CCUT 3OYDA 3MHXA 3AT1B 2QQ9A 1YWPA 4C92B 4RTXA 2RQVA 1YJ9Q 3CMET 2LQKA 4FT2A 5GANd 3OW2S 5CKDA 1YITA 1M90C 4PLLA 3JCMP 1TXQA 4D6WA 3TU4K 1BI3A 2HQEA 2LX7A 2PZ1A 1IGQA 5IAYA 3GNFB 2YT6A 1QVFA 3CXCA 4OB2B 1K73U 2FZCB 3OQ5A 5KYYB 3MEAA 2CZ0B 3FJ5A 3OS0A 1QWEA 1N27A 3EAEA 1AWOA 2BZ8A 5FW9A 4XTWA 1Q86U 1KD1U 2RN8A 2MK5A 4RTTA 4Y92A 1LOJA 1VQ6Q 1UDLA 5FRMA 1B34B 1QLYA 3I5SA 4C92F 1RI0A 4LUEA 3JCMh 1VQ7T 2QGFB 1HXDA 2MYSA 3CCMQ 1N6AA 3PVQA 2DTOA 2ESWA 4C0DB 1MGQA 4XTZA 2E12A 5I11A 2IPOB 4BDYA 2DIGA 1WYXA 4RTYA 2KRMA 2D0NA 1M2VA 1W1FA 1YJWT 1WHLA 2K57A 3CEYA 4IUPA 3GBQA 4FYVB 3META 3CC2Q 2COYA 1M1FA 3E1SA 2RMOA 1JXOA 4F7UE 1MHNA 3L2QA 4OB3B 4PFPA 2AK5A 1M8VA 5GMKl 3PE0A 4PNOA 4HCZA 2A08A 4E7JA 2LRQA 2FVUA 3O5ZA 5CIUA 1I5OB 2HDAA 5GAMg 2BZYA 4HCCA 1RAGB 3M0SA 3CXCP 1QVFP 1UGQB 1JO8A 2AT1B 3OMCA 4M7AF 5ECAA 2KXCA 1K73R 3VUZA 1EFNA 4AFQC 2F69A 1SHGA 3CCSQ 2ATCB 4R56A 1ZBJA 3QG1A 1Q86R 3X25B 1KD1R 2AKKA 4M7AC 4OB0B 2LVMA 2CS7A 2LP5A 2LMJA 1W4SA 1VQNA 3L2UA 2P84A 1Q82C 2O88A 2SEMA 2PUOB 1WDXA 1WZOA 2WSEE 2RHIA 1RAAB 3SD4A 2A28A 1YJ9A 3TREA 4PJOA 2B86A 2LQNA 3LGFA 4C5EA 4JJDA 3GPLA 2Z0WA 3GIBA 3G71Q 2NUPA 1D1AA 2CYZB 3V8JA 2EQJA 1KQSS 5LJ5h 2G3RA 4PKCC 2ZPEB 1V76A 2QEXT 1YCSB 4M75C 2DRMA 5D6XA 2MAMA 3T9NA 5GAMe 4K11A 4M78E 2ZGWA 4J9HA 1OZ3A 4M77A 1YHQQ 2ZAEA 4HA8A 3MEUA 1X6GA 3H0HA 2DXBA 2QQRA 1E6HA 4N4IA 1KG1A 2PVGB 4QVDA 7AT1B 4KGZB 1HK9A 4EMHA 5CCAA 3UT1A 4QQDA 2FZKB 1CKBA 1BIAA 2EVRA 2R58A 1VIFA 1VQOT 3RMSA 3CBPA 3CCRT 4IUVA 1WJRA 2RQUA 2L3PA 4E7LA 2D9TA 4XK8E 1C6VX 1Y57A 4J9IA 3OBWA 3PTAA 3CC7T 1ZHIA 2O31A 4ANJA 3M0TA 4OMPA 3HPWA 4R0KA 1IREB 2R57A 2FB7A 4A63B 3EFOB 1TWBA 3CD6A 3EH1A 3EH2A 3CC2A 5GJWB 3FEOA 3CC4T 2BZXA 2ROLA 1S72T 4C8QE 3URGA 1EZZB 4XAXB 1ZSGA 2A0FB 1GFDA 1W2BA 4VUBA 2D8JA 3TCJA 3I56Q 1UECA 4C92D 3CQTA 4FYXB 5FRNA 1UE9A 2BUDA 4AG2C 5DY9A 1BI0A 4EMKA 2LZ6B 2COZA 2E70A 3THKA 4OGCA 4DOVA 2V1QA 2KGTA 3DLMA 1X6BA 2FEIA 2OTJT 5IXBA 4PJOC 2HKNA 1YI2Q 1YJNT 2JW4A 1VQ5Q 1NM7A 2BKDN 3M0UA 3PMIA 5FWBA 4LUDA 5CR2A 3CCSA 3RUXA 1VQKA 2CSIA 2DF6A 5KYUB 4B6MA 1UGPB 1G3YA 1WPYA 2OTLT 3ULRB 3PGGA 3S3OA 1EIFA 3OB9A 5EC7A 1XNIA 1RAHB 2VYTA 4JJCA 2RJDA 5GANe 5LJ3h 3JCMQ 4HT9A 1ZSZA 3JCMc 2KRSA 4M75G 3RIRA 4OP0A 1SG5A 1JB0E 4HKEA 3PNWC 1VQ4Q 2RA2A 2O4XA 3V7CA 3MEVA 1N9RA 2DJZA 2LX9A 2QYZA 1W2BP 1VQMQ 4F7UA 1PSEA 3H8ZA 1PHTA 2OAUA 3JRZA 3NFCA 1TH7A 3G6ET 2EPDA 1VYUA 4KUDK 2DIQA 2M16A 1QKXA 1K9MC 1QMCA 1YHQA 4KH0B 1K1ZA 2KYBA 5I21A 2DERA 2X35A 3REBB 2YUPA 2LT1A 2RJCA 3FLGA 1M1KU 2JVVA 1BU1A 2O01E 4ZGJB 2QI2A 4PFZA 1QCOA 3X26B 2KSSA 1H641 3QDFA 3CPFA 3CCQT 3G4ST 1VA7A 1G3SA 1VOMA 2EYYA 2MMPA 2JJ9A 2PVOB 2WSFE 3M58A 1ZUUA 2V26A 4MZMA 2LJ1A 1SRLA 4X1VA 3QKJA 4NL3A 2HQXA 5A0LA 2EJGA 2PVDB 2FRYA 1MMDA 5KE2A 4R55A 3CCVT 4EIKA 3VS3A 1MV3A 3QPHA 4JZ3A 2DX1A 3O8VA 3BW1A 4JRKA 3KUFA 4J6YA 2GFAA 4PJOG 1M9SA 4IUQA 3X28B 2C06A 1MUZA 3NPFA 3HRTA 5DLQE 3H0FA 1SKUB 4BI4A 1AT1B 2YRCA 5GAMd 2QQBA 4C5IA 3BY7A 2ABLA 1LPLA 4JRIA 2K7AA 1BI1A 2GCXA 2MOXA 1VQ5A 3I5RA 2ECZA 4LD6A 2JT4A 3L2VA 2EGCA 4M77G 3G1JA 5IHKA 2DD5A 2RHZA 4J7FA 3S6WA 2KNBB 3BE3A 2KT8A 2P0KA 4MZPA 1M1KR 1TSFA 1Y96B 2LTOA 1VQ9Q 2RK2A 1GCQC 2O2OA 5DLOA 1WXUA 2E65A 1U1TA 2RHYA 3I55A 3M56A 2CH4W 2FO0A 1WHJA 3A5ZB 5FROA 3V7SA 4ELYC 2VXFA 2EFIA 3N5BB 2ED0A 3ZL7C 2DXUA 2DA9A 3H0IA 1VQ4A 1RAFB 5CKEA 2MI6A 4HVUA 2Y4XA 4BACA 3E19A 4C8QA 3QYGB 5GAOn 2RHUA 1ABQA 1Q7YR 1VQMA 3QDRB 2FPDA 2DM1A 1AHJB 3MP8A 2DL4A 2QQAA 2DNUA 1BK2A 1VQ8T 1JQQA 1NPPA 4NL2A 3SFMA 2OJ2A 3MEWA 2NUZA 5GMKh 1E6GA 5CKHA 2RQTA 2X51A 3F70A 3V8LA 2GFUA 2NWMA 2CKKA 4KGVB 2HD0A 5GANh 1ZLMA 1K8AR 1TUGB 1XJWB 2A7YA 2HZYA 2J6OA 4J9GA 1K0XA 2FHDA 4BUGA 2XHCA 5KYWA 1OPLA 2M51A 2X4XA 5GAOp 2CSQA 4FT4A 3A8MB 3LW5E 3G7ZA 5IHNA 4M78C 4N0AC 3C94A 3UF4A 4C92A 3JB9I 1SSFA 1MMGA 3CCJT 4BY6B 5KYXB 3JAME 3VU3C 2CUBA 2XD0A 1AWXA 1B3QA 5GAOr 2XK0A 2X3WD 4F16A 2LDMA 2AZSA 3OYCA 1IZ6A 1SEMA 4JJNK 3C4SA 2VGMA 1Q81R 3EGDB 2DTIA 4M7DE 2EQMA 1H92A 4ORZA 4L59A 3EG3A 3GNGA 1D09B 5LJ5j 1O9SA 4NOYA 1KHCA 2OI3A 4Z02A 1RL2A 2CT3A 1V1CA 2EIFA 2FYKA 3CCUQ 3QYHB 4OMQA 2V1RA 4C0ZA 2E3IA 2KY9A 4F7UG 3PMTA 2P4RA 2DLPA 3CMEQ 5HCKA 4HVWA 2XG8D 1VQ6T 2VGNA 1M90R 5CKFA 1RLQC 4JUVA 1B34A 1AZGB 3EFRA 4HVVA 2J05A 1OU8A 3CCMT 3L2ZA 4ME7A 4UC4A 2KK4A 2CDTA 3JB9D 3VS0A 1WGSA 1C1AA 4Y28E 3GF5A 3GLXA 3M9QA 1R77A 1A0NB 2EBPA 3TSWA 1VQ9A 4M7AB 1BIBA 3OYMA 2DVJA
chains in the Genus database with same CATH topology
2KEAA 1G83A 1AOJA 4Z88A 4CC2A 1CKBA 1WXTA 2EVRA 4IIOA 2X3XD 3EHRA 3QWYA 1HD3A 1W70A 1GCQA 1BBZA 1OOTA 1M3AA 1AVZC 2RQUA 2L3PA 2L2PA 2EYZA 1UUEA 2EGEA 2JM8A 1Y57A 4J9IA 1I1JA 2EKHA 2LNHB 1GCPA 4IIMA 1X43A 1UGVA 2O31A 1U3OA 3M0TA 4OMPA 2KBTA 1UG1A 4R0KA 2F2VA 2DBKA 1T3LA 1NEBA 4OMLA 2DRKA 3M0QA 2E5KA 1XOVA 1GL5A 4A63B 2L0AA 1GRIA 5GJWB 2BZXA 1SPKA 2ROLA 4Z89A 1ZSGA 1GFDA 1YNZA 3R6NA 3JV3A 2D8JA 1KJWA 2J6FA 4HCKA 1T0HA 1UECA 4KRTA 3CQTA 1UE9A 1IO6A 2CREA 4AG2C 2LZ6B 1HJDA 5L23A 2F2XA 3THKA 2VKNA 4RTVA 2V1QA 2KGTA 3VRZA 1X6BA 2FEIA 5IXBA 2HBWA 1AEYA 2JM9A 1I0CA 1RI9A 4CC4B 2LCSA 2JW4A 2EYWA 3LH5A 1NM7A 1LCKA 3M0UA 5IXFA 5FWBA 2PNIA 4J9DA 4LUDA 1M3BA 5IHIA 1Z9ZA 2HEQA 1X69A 2CSIA 4E6RA 2KE9A 1PRLC 2DF6A 2AKLA 2KT1A 2LQWA 1Y0MA 1PWTA 1NEGA 3QWXX 4CC7A 4DEYA 2L3QA 2K3BA 1T3SA 2RPNA 5I22A 2GBQA 1W6XA 2DYBA 3ULRB 2CT4A 3SEMA 2DJQA 3EHQA 4RTZA 1KIKA 2ED1A 2FPEA 2C0IA 2DE0X 2GNCA 5EC7A 2ROTA 1M30A 2KXDA 2YUQA 1U5SA 4JJCA 2I0NA 1OEBA 2KRSA 2LJ3A 4LNPA 1QWFA 4HXJA 1RLPC 3VS7A 1FYNA 4JZ4A 2RNAA 1UFFA 1ARKA 4J9BA 2RQWA 1ZUYA 2FRWA 2J06A 1PHTA 1WA7A 1AD5A 2EPDA 1VYUA 1KSWA 1TUCA 3EG2A 1QKXA 1B07A 2JTEA 1M3CA 1JXMA 2O9VA 3VS5A 1K1ZA 2KYBA 2YSQA 3REAB 2HSPA 2JMAA 3NMZC 3PVLA 1M27C 3REBB 2YUPA 3RBBB 5FWCA 3M0PA 2XMFA 3UA6A 1K9AA 3VS4A 1BU1A 1UHCA 1OPKA 1QKWA 4ESRA 1GFCA 1PRMC 5GJVB 2YUNA 1E7OA 2C0OA 3NGPA 1G2BA 2D1XA 4JPBW 2KROA 2JMCA 1WLPB 1YP5A 1VA7A 2DL3A 2W0ZA 2EYYA 4LE9A 3H41A 2J6KA 2K9GA 1T0JA 2DBMA 4J9FA 3VS1A 1WX6A 4DEXA 3I35A 2FPFA 1ZUUA 1I07A 2LJ1A 2MIOA 1SRLA 4X1VA 2FRYA 1QCFA 1VYVA 1N5ZA 1X2QA 1AZEA 4EIKA 3VS3A 1MV3A 4RUGA 2DL8A 3I9QA 3TSZA 4JZ3A 2DX1A 2KRNA 1UHFA 4AFSC 2DILA 1YN8A 1MUZA 2A36A 2AZVA 3NPFA 1YWPA 2EGAA 3H0FA 5IH2A 4RTXA 2RQVA 1NLPC 1Z9QA 2VVKA 2JS0A 1FMKA 2ABLA 2F2WA 2K7AA 2PTKA 2MOXA 1PKTA 2GGRA 2JXBA 2EYXA 3I5RA 2ECZA 2JT4A 3EG1A 2LX7A 2EGCA 2PZ1A 4GBQA 1UJYA 1ABOA 4Z8AA 5IHKA 1ZUKA 1NYGA 2KNBB 2KT8A 2YT6A 4AG1C 1WIEA 2J7IA 2H8HA 3FJ5A 1OV3A 3A98A 1QWEA 1K0SA 1SSHA 1GCQC 4OMNA 2O2OA 1UJ0A 1GBQA 1AWOA 2BZ8A 5FW9A 3VS2A 1H8KA 2RN8A 4ZNXA 1MV0B 1X2KA 1WXUA 1KFZA 4RTTA 4Y92A 2CH4W 1UDLA 2FO0A 1QLYA 3I5SA 4JJBA 4LUEA 3TVTA 3PVQA 2RQRA 4AFUC 2ED0A 1NLOC 3ZL7C 2ESWA 1NG2A 2DA9A 2O9SA 2W10A 3H0IA 3IQLA 3UA7A 4HVUA 3KFVA 2GTOA 4LN2A 1J3TA 1K76A 4GLMA 5I11A 1WI7A 3VRYA 1WYXA 1ABQA 4RTWA 4RTYA 1SRMA 2KRMA 1SHFA 2D0NA 1W1FA 4F14A 4QT7A 2FPDA 2DM1A 2DL4A 3GBQA 2GQIA 2DNUA 1BK2A 4D8DA 1JQQA 2RMOA 1GBRA 2OJ2A 1JXOA 2NUZA 1E6GA 2JS2A 3EGUA 1H3HA 2RQTA 2AK5A 3NHNA 3EG0A 3PE0A 2A37A 2NWMA 3U23A 2A08A 1ZLMA 2FG0A 1S1NA 4J9GA 2J6OA 1K0XA 3O5ZA 1OPLA 2HDAA 2M51A 2CSQA 1K4US 2BZYA 3M0SA 2MCNA 1JO8A 2QDLA 1WFWA 2DMOA 1NYFA 5IHNA 2CH4A 1AWWA 3SHWA 5ECAA 3UF4A 1TG0A 2KXCA 1EFNA 4AFQC 1JEGA 4J9EA 2K79A 4OMOA 1SHGA 1UTIA 1CKAA 1AWJA 1TUDA 2CUBA 2BTTA 4RTUA 1AWXA 3UATA 1CSKA 1B3QA 1ZBJA 2GTJA 2KR3A 2X3WD 4F16A 2YDLA 2AZSA 4CC3A 1SEMA 2AKKA 3M0RA 1WXBA 2K6DA 2DL5A 1H92A 4D8KA 2LP5A 2LMJA 1VYTA 4ORZA 1YWOA 3EG3A 3RNJA 1PKSA 1BB9A 2RF0A 2O88A 2SEMA 2OI3A 1WDXA 3VS6A 4M4ZA 2CT3A 1RUWA 1V1CA 4OMMA 4FSSA 2ENMA 2A28A 1U06A 2VWFA 2D8HA 4OMQA 4AFZC 1HSQA 2CUDA 4F17A 1PNJA 2V1RA 1JU5C 4J9CA 2B86A 2LQNA 2K2MA 2G6FX 2DL7A 2KYMA 4JJDA 2EQIA 2P4RA 2IIMA 2DLPA 1M8MA 5HCKA 4HVWA 2YUOA 1X27A 1RLQC 4HVVA 1AZGB 2J05A 2L3SA 2OAWA 2M0YA 1YCSB 2LJ0A 2DRMA 4K11A 2CDTA 3VS0A 4J9HA 2C0TA 1A0NB 2EBPA 1X6GA 3TSWA 3H0HA 1ZX6A 3C0CA 4WCIA 1E6HA 2HCKA 2DVJA 2EW3A 2SRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEA A;  1G83 A;  1AOJ A;  4Z88 A;  4CC2 A;  1CKB A;  1WXT A;  2EVR A;  4IIO A;  2X3X D;  3EHR A;  3QWY A;  1HD3 A;  1W70 A;  1GCQ A;  1BBZ A;  1OOT A;  1M3A A;  1AVZ C;  2RQU A;  2L3P A;  2L2P A;  2EYZ A;  1UUE A;  2EGE A;  2JM8 A;  1Y57 A;  4J9I A;  1I1J A;  2EKH A;  2LNH B;  1GCP A;  4IIM A;  1X43 A;  1UGV A;  2O31 A;  1U3O A;  3M0T A;  4OMP A;  2KBT A;  1UG1 A;  4R0K A;  2F2V A;  2DBK A;  1T3L A;  1NEB A;  4OML A;  2DRK A;  3M0Q A;  2E5K A;  1XOV A;  1GL5 A;  4A63 B;  2L0A A;  1GRI A;  5GJW B;  2BZX A;  1SPK A;  2ROL A;  4Z89 A;  1ZSG A;  1GFD A;  1YNZ A;  3R6N A;  3JV3 A;  2D8J A;  1KJW A;  2J6F A;  4HCK A;  1T0H A;  1UEC A;  4KRT A;  3CQT A;  1UE9 A;  1IO6 A;  2CRE A;  4AG2 C;  2LZ6 B;  1HJD A;  5L23 A;  2F2X A;  3THK A;  2VKN A;  4RTV A;  2V1Q A;  2KGT A;  3VRZ A;  1X6B A;  2FEI A;  5IXB A;  2HBW A;  1AEY A;  2JM9 A;  1I0C A;  1RI9 A;  4CC4 B;  2LCS A;  2JW4 A;  2EYW A;  3LH5 A;  1NM7 A;  1LCK A;  3M0U A;  5IXF A;  5FWB A;  2PNI A;  4J9D A;  4LUD A;  1M3B A;  5IHI A;  1Z9Z A;  2HEQ A;  1X69 A;  2CSI A;  4E6R A;  2KE9 A;  1PRL C;  2DF6 A;  2AKL A;  2KT1 A;  2LQW A;  1Y0M A;  1PWT A;  1NEG A;  3QWX X;  4CC7 A;  4DEY A;  2L3Q A;  2K3B A;  1T3S A;  2RPN A;  5I22 A;  2GBQ A;  1W6X A;  2DYB A;  3ULR B;  2CT4 A;  3SEM A;  2DJQ A;  3EHQ A;  4RTZ A;  1KIK A;  2ED1 A;  2FPE A;  2C0I A;  2DE0 X;  2GNC A;  5EC7 A;  2ROT A;  1M30 A;  2KXD A;  2YUQ A;  1U5S A;  4JJC A;  2I0N A;  1OEB A;  2KRS A;  2LJ3 A;  4LNP A;  1QWF A;  4HXJ A;  1RLP C;  3VS7 A;  1FYN A;  4JZ4 A;  2RNA A;  1UFF A;  1ARK A;  4J9B A;  2RQW A;  1ZUY A;  2FRW A;  2J06 A;  1PHT A;  1WA7 A;  1AD5 A;  2EPD A;  1VYU A;  1KSW A;  1TUC A;  3EG2 A;  1QKX A;  1B07 A;  2JTE A;  1M3C A;  1JXM A;  2O9V A;  3VS5 A;  1K1Z A;  2KYB A;  2YSQ A;  3REA B;  2HSP A;  2JMA A;  3NMZ C;  3PVL A;  1M27 C;  3REB B;  2YUP A;  3RBB B;  5FWC A;  3M0P A;  2XMF A;  3UA6 A;  1K9A A;  3VS4 A;  1BU1 A;  1UHC A;  1OPK A;  1QKW A;  4ESR A;  1GFC A;  1PRM C;  5GJV B;  2YUN A;  1E7O A;  2C0O A;  3NGP A;  1G2B A;  2D1X A;  4JPB W;  2KRO A;  2JMC A;  1WLP B;  1YP5 A;  1VA7 A;  2DL3 A;  2W0Z A;  2EYY A;  4LE9 A;  3H41 A;  2J6K A;  2K9G A;  1T0J A;  2DBM A;  4J9F A;  3VS1 A;  1WX6 A;  4DEX A;  3I35 A;  2FPF A;  1ZUU A;  1I07 A;  2LJ1 A;  2MIO A;  1SRL A;  4X1V A;  2FRY A;  1QCF A;  1VYV A;  1N5Z A;  1X2Q A;  1AZE A;  4EIK A;  3VS3 A;  1MV3 A;  4RUG A;  2DL8 A;  3I9Q A;  3TSZ A;  4JZ3 A;  2DX1 A;  2KRN A;  1UHF A;  4AFS C;  2DIL A;  1YN8 A;  1MUZ A;  2A36 A;  2AZV A;  3NPF A;  1YWP A;  2EGA A;  3H0F A;  5IH2 A;  4RTX A;  2RQV A;  1NLP C;  1Z9Q A;  2VVK A;  2JS0 A;  1FMK A;  2ABL A;  2F2W A;  2K7A A;  2PTK A;  2MOX A;  1PKT A;  2GGR A;  2JXB A;  2EYX A;  3I5R A;  2ECZ A;  2JT4 A;  3EG1 A;  2LX7 A;  2EGC A;  2PZ1 A;  4GBQ A;  1UJY A;  1ABO A;  4Z8A A;  5IHK A;  1ZUK A;  1NYG A;  2KNB B;  2KT8 A;  2YT6 A;  4AG1 C;  1WIE A;  2J7I A;  2H8H A;  3FJ5 A;  1OV3 A;  3A98 A;  1QWE A;  1K0S A;  1SSH A;  1GCQ C;  4OMN A;  2O2O A;  1UJ0 A;  1GBQ A;  1AWO A;  2BZ8 A;  5FW9 A;  3VS2 A;  1H8K A;  2RN8 A;  4ZNX A;  1MV0 B;  1X2K A;  1WXU A;  1KFZ A;  4RTT A;  4Y92 A;  2CH4 W;  1UDL A;  2FO0 A;  1QLY A;  3I5S A;  4JJB A;  4LUE A;  3TVT A;  3PVQ A;  2RQR A;  4AFU C;  2ED0 A;  1NLO C;  3ZL7 C;  2ESW A;  1NG2 A;  2DA9 A;  2O9S A;  2W10 A;  3H0I A;  3IQL A;  3UA7 A;  4HVU A;  3KFV A;  2GTO A;  4LN2 A;  1J3T A;  1K76 A;  4GLM A;  5I11 A;  1WI7 A;  3VRY A;  1WYX A;  1ABQ A;  4RTW A;  4RTY A;  1SRM A;  2KRM A;  1SHF A;  2D0N A;  1W1F A;  4F14 A;  4QT7 A;  2FPD A;  2DM1 A;  2DL4 A;  3GBQ A;  2GQI A;  2DNU A;  1BK2 A;  4D8D A;  1JQQ A;  2RMO A;  1GBR A;  2OJ2 A;  1JXO A;  2NUZ A;  1E6G A;  2JS2 A;  3EGU A;  1H3H A;  2RQT A;  2AK5 A;  3NHN A;  3EG0 A;  3PE0 A;  2A37 A;  2NWM A;  3U23 A;  2A08 A;  1ZLM A;  2FG0 A;  1S1N A;  4J9G A;  2J6O A;  1K0X A;  3O5Z A;  1OPL A;  2HDA A;  2M51 A;  2CSQ A;  1K4U S;  2BZY A;  3M0S A;  2MCN A;  1JO8 A;  2QDL A;  1WFW A;  2DMO A;  1NYF A;  5IHN A;  2CH4 A;  1AWW A;  3SHW A;  5ECA A;  3UF4 A;  1TG0 A;  2KXC A;  1EFN A;  4AFQ C;  1JEG A;  4J9E A;  2K79 A;  4OMO A;  1SHG A;  1UTI A;  1CKA A;  1AWJ A;  1TUD A;  2CUB A;  2BTT A;  4RTU A;  1AWX A;  3UAT A;  1CSK A;  1B3Q A;  1ZBJ A;  2GTJ A;  2KR3 A;  2X3W D;  4F16 A;  2YDL A;  2AZS A;  4CC3 A;  1SEM A;  2AKK A;  3M0R A;  1WXB A;  2K6D A;  2DL5 A;  1H92 A;  4D8K A;  2LP5 A;  2LMJ A;  1VYT A;  4ORZ A;  1YWO A;  3EG3 A;  3RNJ A;  1PKS A;  1BB9 A;  2RF0 A;  2O88 A;  2SEM A;  2OI3 A;  1WDX A;  3VS6 A;  4M4Z A;  2CT3 A;  1RUW A;  1V1C A;  4OMM A;  4FSS A;  2ENM A;  2A28 A;  1U06 A;  2VWF A;  2D8H A;  4OMQ A;  4AFZ C;  1HSQ A;  2CUD A;  4F17 A;  1PNJ A;  2V1R A;  1JU5 C;  4J9C A;  2B86 A;  2LQN A;  2K2M A;  2G6F X;  2DL7 A;  2KYM A;  4JJD A;  2EQI A;  2P4R A;  2IIM A;  2DLP A;  1M8M A;  5HCK A;  4HVW A;  2YUO A;  1X27 A;  1RLQ C;  4HVV A;  1AZG B;  2J05 A;  2L3S A;  2OAW A;  2M0Y A;  1YCS B;  2LJ0 A;  2DRM A;  4K11 A;  2CDT A;  3VS0 A;  4J9H A;  2C0T A;  1A0N B;  2EBP A;  1X6G A;  3TSW A;  3H0H A;  1ZX6 A;  3C0C A;  4WCI A;  1E6H A;  2HCK A;  2DVJ A;  2EW3 A;  2SRC A; 
#chains in the Genus database with same CATH topology
 1G83 A;  4A4G A;  4BY6 C;  2K2V A;  5C0M A;  4DA4 A;  2CP3 A;  3QWY A;  1JJ2 S;  1HD3 A;  2E64 A;  1OOT A;  1Y07 A;  1AVZ C;  3CD6 Q;  2L2P A;  5D6Y A;  5J3B A;  4PK4 A;  1Q82 U;  4XU0 A;  4FW1 A;  1OX8 A;  1VQ7 Q;  3QJY A;  1YIJ Q;  1W2B S;  3J7A F;  1U3O A;  2KBT A;  5FU7 C;  5FU6 C;  4A4E A;  2F2V A;  1M4Z A;  4F04 B;  4L6V 5;  4RKU E;  4OML A;  1RAD B;  2E5K A;  1XOV A;  4M75 B;  4ZTJ A;  2L0A A;  1YJW Q;  2H3J A;  1SPK A;  1YNZ A;  3CCS T;  4N4G A;  3MPU B;  2NLU A;  3QZ5 B;  5GAO l;  3CBO A;  1YCY A;  3GOX A;  2YLC A;  1IO6 A;  3VYG A;  2GQV A;  2EQK A;  4M78 G;  2QAS A;  3JCM X;  3FB9 A;  9ATC B;  3OYI A;  1VQK Q;  1PG5 B;  2QA4 A;  1IGU A;  2BE7 D;  1AEY A;  2JM9 A;  5D7U A;  1I0C A;  2LCC A;  5EG2 A;  3A8L B;  3DB3 A;  3CMA A;  3JCM W;  3CCL T;  1D3B A;  2EYW A;  5GAN 6;  1LCK A;  4J9D A;  5CK9 A;  3FC3 A;  3SWN A;  3MP6 A;  1X69 A;  1PCX A;  1XTD A;  5LJ3 j;  4QW2 A;  3G71 T;  2AKL A;  1Y0M A;  4M75 F;  2K4Y A;  1RAC B;  1PWT A;  1VQP T;  2KQW A;  1NEG A;  5HK3 A;  4MZT A;  1T3S A;  1VQL Q;  2JOY A;  2A3L A;  1W6X A;  4BB7 A;  2CT4 A;  3EHQ A;  2DXC A;  4RTZ A;  5KYN A;  2CP6 A;  1KIK A;  2GNC A;  1FWZ A;  2VB6 A;  4B9X A;  2ROT A;  2XDB A;  1Q82 R;  1M30 A;  2KXD A;  3EFS A;  3OYJ A;  4X9D A;  3CCU A;  1YFN A;  2YUQ A;  3OMG A;  4IUT A;  3OW2 A;  1H3Z A;  4C0F A;  4C8Q G;  4XTY A;  2EAY A;  4E7Z A;  5GAN 4;  4LNP A;  3L2W A;  3JCM b;  3V7R A;  4HXJ A;  1N9S A;  1RLP C;  3VJP A;  3CME A;  4PJO B;  4WTO B;  1UFF A;  4LXC A;  1ARK A;  2RQW A;  4ZTF A;  4C0G A;  1NPR A;  1ZA2 B;  3OS1 A;  5GAN 7;  2FRW A;  1D1C A;  1WA7 A;  4JLI A;  3QHS A;  1KSW A;  3HSB A;  3AHU A;  2QEX Q;  1JXM A;  2O9V A;  3VS5 A;  3HKS A;  2JMA A;  3NMZ C;  3PVL A;  5GAM j;  2CP0 A;  3UA6 A;  1K9A A;  2KMT A;  3EG9 A;  3VS4 A;  3SB2 A;  4ZGD B;  3EFO A;  3OYA A;  2DPP B;  2RI2 A;  4DBR A;  1LNX A;  5GJV B;  1UGS B;  1E7O A;  3DLL A;  4A54 A;  4XU2 A;  2VC8 A;  4O5V A;  1G2B A;  4BI3 A;  3I56 T;  1YP5 A;  2DL3 A;  3EGX A;  3CCR Q;  3H41 A;  1VQ7 A;  2K9G A;  3OY9 A;  4J6X A;  4PJO F;  1YIJ A;  3VS1 A;  3FJP A;  4FM4 B;  4M7D A;  1WX6 A;  2FPF A;  1I07 A;  1JBM A;  2XDD A;  2YXY A;  3CC7 Q;  1NE8 A;  4XQ3 A;  3HRS A;  3SWN C;  1YI2 T;  1VYV A;  2HAX A;  1N5Z A;  1YJW A;  1X2Q A;  3H9N A;  3OW2 P;  3I9Q A;  5GMK i;  2HL3 A;  3TEE A;  2DFU A;  4XTX A;  3RKW A;  3CC4 Q;  4M77 F;  1S72 Q;  1UHF A;  4AFS C;  2VUB A;  2A36 A;  5KYU A;  2AZV A;  1KQ1 A;  1K9M U;  2RJE A;  5IH2 A;  3QZ9 B;  1F1B B;  2QG9 B;  1NLP C;  1R8O B;  2VVK A;  1G5V A;  4DQ2 A;  2JS0 A;  2IVW A;  4AT1 B;  1QVG A;  4O6J A;  4BDZ A;  1FMK A;  2CP5 A;  3C12 A;  2F2W A;  4C92 E;  4XTV A;  4M77 C;  3A8G B;  2GGR A;  3MKD A;  2JXB A;  2EYX A;  2AIR B;  4BI8 B;  5GAN 5;  4ZN3 A;  2OTJ Q;  2YHT A;  3EG1 A;  2EYQ A;  3R6O A;  5A2Q E;  1ABO A;  1XQH A;  4FW2 A;  1YJN Q;  3H6Z A;  1NYG A;  3I55 Q;  2XID A;  1VUB A;  2LNV A;  4AG1 C;  4OB1 B;  4M7A D;  2J7I A;  2XI9 A;  1U8R A;  3M53 A;  1OV3 A;  2EJF A;  2M9U A;  1K0S A;  1VQL A;  3M54 A;  4DBH A;  1VQM T;  1UJ0 A;  1O75 A;  6AT1 B;  1H8K A;  4TVR A;  4ZNX A;  1X2K A;  1IRX A;  2OTL Q;  2JN0 A;  2ZPI B;  3JCM J;  3V8K A;  3JB9 H;  4JJB A;  1TTH B;  2DEQ A;  4Q5W A;  4QKU A;  1VIE A;  1PSF A;  2RQR A;  4AFU C;  5GMK j;  2XIC A;  1ZSZ B;  2W10 A;  3IQL A;  3WVE B;  3JCM g;  3CBM A;  3KFV A;  3S3M A;  4LN2 A;  1J3T A;  4ZGE B;  4RTW A;  2O4X B;  3LLR A;  4M75 D;  4PJJ A;  5GAN j;  5CVI A;  4M7A E;  1SHF A;  4B9W A;  2D6F A;  3CCE T;  2JUF A;  3DKM A;  5IN1 A;  4EMK C;  2GQI A;  3HL8 A;  2DEU A;  2DAQ A;  2QEX A;  1X01 A;  4FCY A;  3G6E Q;  1D0X A;  1K9M R;  1QVG P;  3LX7 A;  2JS2 A;  3EGU A;  4IUR A;  4LD9 K;  3NHN A;  3PIP A;  5GAM h;  3U23 A;  2NYS A;  1YIT T;  5GAO q;  2FG0 A;  4KT0 E;  1KC8 C;  1S1N A;  4J83 A;  3QXE B;  2HBP A;  1VQO A;  3CCR A;  2DMO A;  2VAS A;  2YLB A;  3SHW A;  3G4S Q;  4RMO A;  1KQ2 A;  4A4F A;  3LYI A;  1JEG A;  4OMO A;  1UTI A;  3OS5 A;  3CC7 A;  1CKA A;  1PC0 A;  2BTT A;  4RTU A;  2ZPG B;  1CSK A;  2GTJ A;  2K3Y A;  2KR3 A;  5GMK m;  1NJI U;  2YDL A;  1RAB B;  4CC3 A;  4A53 A;  4F7U F;  1QVF S;  3CXC S;  1WXB A;  2K6D A;  3JCM e;  1Y71 A;  1ZSZ C;  2M0O A;  3INZ A;  1YWO A;  3CC4 A;  3CCV Q;  3RNJ A;  1S72 A;  3RDV A;  1KK7 A;  5L8R E;  1QP2 A;  2B8A A;  3LWH A;  4IKF A;  2V8J A;  3PT9 A;  3VS6 A;  1RUW A;  2NUT B;  4OMM A;  3S3N A;  2ENM A;  4J8O A;  2AHJ B;  1U06 A;  2VWF A;  4AFZ C;  2CUD A;  4F17 A;  1JU5 C;  4PJO D;  2G6F X;  2DL7 A;  2KYM A;  2EQI A;  2IIM A;  4LDV A;  1M8M A;  1D1B A;  1X27 A;  1SF9 A;  3OSS C;  3DB4 A;  4M78 B;  1G8X A;  2OTJ A;  3OYL A;  1ACM B;  3OYK A;  2E41 A;  5LL6 S;  2I2L A;  3M59 A;  2L3S A;  1YJN A;  2M0Y A;  2LJ0 A;  2LQ8 A;  1C0M A;  5LJ5 g;  1FX7 A;  3TQ7 P;  2E6N A;  2MWP A;  1PD0 A;  1NJI C;  2P0Q A;  3C0C A;  2EW3 A;  1WJQ A;  3BFM A;  1N8R U;  4WF2 A;  1I8F A;  2ZPB B;  4A4K A;  1AOJ A;  2OTL A;  4CC2 A;  1WXT A;  4LDU A;  4IIO A;  2JTM A;  2LCL A;  2X3X D;  2R5A A;  5GAN 8;  1W70 A;  1BBZ A;  2DD4 A;  4M7D G;  2EYZ A;  3L42 A;  2EGE A;  2JM8 A;  2OX7 A;  2EKH A;  2IG0 A;  2LNH B;  3OYY A;  1M1G A;  1GCP A;  4IIM A;  1X43 A;  1UGV A;  4E7H A;  2HQH A;  4M78 F;  2DBK A;  2E3H A;  1QVP A;  1T3L A;  3JCM f;  1OX9 A;  2DTH A;  4DOW A;  3FRN A;  1GRI A;  1VQN T;  2E4H A;  3JSC A;  3WVD B;  1BI2 A;  3CPW A;  3G6E A;  2QA4 Q;  1ZA1 B;  2HMA A;  5KYX A;  1VQ8 Q;  3NTK A;  3R6N A;  1LVK A;  3CMA Q;  1FMW A;  3P8D A;  3ZBD A;  2YWW A;  2P4T A;  4KRT A;  1YJ9 T;  2E6Z A;  3HP9 A;  2CRE A;  2EJ9 A;  1N8R C;  3QUI A;  5L23 A;  2F2X A;  1OZ2 A;  2VKN A;  3PFS A;  2LC4 A;  2M02 A;  2HBW A;  3OBY A;  4CC4 B;  2E10 A;  2QK0 A;  4FSX A;  3M4G A;  2KAF A;  3CCQ A;  3G4S A;  2PNI A;  3E9G A;  1M3B A;  2BE9 B;  2KDS A;  5FU7 B;  5FU6 B;  1Z9Z A;  2HEQ A;  3HFN A;  5KYY A;  3C95 A;  4OMF B;  2VV5 A;  3OYF A;  1LJO A;  1PRL C;  4C8Q F;  2KT1 A;  5A0D A;  3CCJ Q;  1DJ7 B;  1N8R R;  4KGX B;  4DEY A;  4E2F B;  5I22 A;  2GBQ A;  2ZPF B;  2DYB A;  2CZ6 B;  3JB9 G;  3M55 A;  2L5Q A;  3CCV A;  1BCM A;  2P0P A;  1IHV A;  2FPE A;  2C0I A;  2WAC A;  1P92 A;  4C8Q C;  3VYH B;  1BCO A;  1U5S A;  1QP3 A;  4M7A A;  1MNE A;  2RM4 A;  1OEB A;  2LJ3 A;  2HKQ B;  5CO7 A;  3VS7 A;  5CKB A;  1V29 B;  3JCM V;  5LJ3 g;  1KHI A;  3CPW P;  2PUK B;  3OA6 A;  4EDU A;  4MDX A;  4HCB A;  1ZUY A;  3CC2 T;  3CD6 T;  4PLI A;  1WHM A;  1OI1 A;  4MMK A;  2YRD A;  4FIB A;  1TUC A;  1WQ7 A;  3MCA B;  1YIJ T;  3M57 A;  1R0B G;  3Q1J A;  2YSQ A;  3REA B;  2RI5 A;  5LJ5 f;  1M27 C;  1I4K 1;  3RBB B;  3M0P A;  3VUB A;  3BDL A;  4M75 A;  1ZBX A;  2KI7 A;  2F5K A;  3OYE A;  1YBY A;  1OPK A;  1QKW A;  4C92 C;  5HKC A;  1GFC A;  4BD3 A;  1PRM C;  3RR6 A;  3ZEH A;  2C0O A;  1M2V B;  4A4H A;  4X34 A;  2D1X A;  4JPB W;  2KRO A;  1OUL A;  1WLP B;  1K73 C;  2FL7 A;  3JCM d;  4LE9 A;  3UPU A;  2QQS A;  1T0J A;  3ZFJ A;  3LH0 A;  1VQK T;  4HT8 A;  2QTX A;  2MIO A;  1Q86 C;  1KD1 C;  2X4J A;  8AT1 B;  3M4Y A;  2PU9 B;  3OYH A;  1D0Y A;  2DXT A;  4QVZ A;  1TU0 B;  1WHH A;  4EPC A;  1UGR B;  1OU9 A;  1RAI B;  2RK1 A;  5LJ3 e;  2K5L A;  1QVG S;  5CAI A;  1BYM A;  3L2R A;  1VQ8 A;  5D6W A;  2KRN A;  4PJN A;  3X20 B;  2DIL A;  1YN8 A;  4RCC A;  1M2O A;  2COW A;  2EGA A;  1B7T A;  1VQL T;  4AMC A;  2LT4 A;  2V8I A;  2XU8 A;  2QGG A;  3J81 E;  1Z9Q A;  1WHG A;  2JNG A;  4XU3 A;  5I2S A;  4LDX A;  2EQU A;  4JS5 A;  4M78 D;  3VV0 A;  4C0D C;  2PTK A;  2RB6 A;  1PKT A;  2DKG A;  1IHW A;  3OSV A;  4GBQ A;  1UJY A;  1D3B B;  1OQK A;  4Z8A A;  1YHQ T;  1ZUK A;  3CCL Q;  4E7I A;  2WSC E;  4DBF A;  1WIE A;  3CCJ A;  3SWN B;  3RKX A;  1WJS A;  2H8H A;  3A98 A;  2DZ9 A;  4Y91 A;  1OYX A;  5AT1 B;  1SSH A;  4OMN A;  3OYG A;  2RHX A;  1PM3 A;  1GBQ A;  4OVA A;  1VQP Q;  3VS2 A;  2HL5 C;  3GP8 A;  2EKO A;  1UB4 A;  1MV0 B;  4RG2 A;  1G3W A;  2L3R A;  1KFZ A;  2NUP B;  3JB9 J;  2RD1 A;  2JZ2 A;  3QJ6 A;  4LDY A;  4KBM B;  2RJF A;  1IB8 A;  5HY6 A;  2MF2 A;  3TVT A;  2ZZD A;  1FMV A;  1NLO C;  1NG2 A;  2O9S A;  4M77 B;  3UA7 A;  3NTI A;  2GTO A;  2CGH A;  4C8Q D;  1K76 A;  4GLM A;  1WI7 A;  2GF7 A;  3VRY A;  4V2S A;  1SRM A;  4J6W A;  1VQ6 A;  4F14 A;  4QT7 A;  4II1 A;  5LJ3 f;  4FL6 A;  5LJ5 d;  3MP1 A;  3RMQ A;  2PQW A;  2K5F A;  3QII A;  4D8D A;  4J7I A;  4C92 G;  3CCM A;  1X6O A;  5DM7 R;  1GBR A;  1VQO Q;  1NZ9 A;  2F1L A;  3NTH A;  1H3H A;  3EG0 A;  2A37 A;  4JRP A;  1JJ2 A;  3EG9 B;  4FYY B;  4CRI A;  5KCH A;  3ASK A;  4BE0 A;  1VQ5 T;  1K4U S;  5GAN g;  2MCN A;  2L8D A;  4PL6 A;  2QDL A;  2QAZ A;  1WFW A;  4LDW A;  1NYF A;  2MPX C;  3J80 E;  2CH4 A;  1AWW A;  1I81 A;  4ELZ C;  2Y4Y A;  1TG0 A;  5CQX A;  3EGX B;  5M9O A;  4XTU A;  1UEB A;  2YRV A;  4J9E A;  2K79 A;  5GAN 3;  4GLK A;  1AWJ A;  1TUD A;  4M7D B;  3UAT A;  1X75 C;  4EMK B;  3M0R A;  4FYW B;  5J39 A;  2DL5 A;  3L1A A;  4D8K A;  1VYT A;  3I55 T;  5GAM f;  4M7A G;  3LGL A;  2DYI A;  1PKS A;  1BB9 A;  2RF0 A;  4M4Z A;  4FSS A;  2K3X A;  2D8H A;  1HSQ A;  1VQ4 T;  1PNJ A;  4JS4 A;  4J9C A;  4JDS A;  2K2M A;  5KCO A;  1WQW A;  3RER A;  1QQJ A;  2YUO A;  2Y90 A;  5GMK e;  4KUI A;  1KC8 U;  2OAW A;  3CCL A;  3WXM B;  2F5T X;  1R0C B;  4E7K A;  4M7D F;  3QBY A;  2C0T A;  2CZ7 B;  1JJ2 P;  4C5H A;  4QQ6 A;  3OYB A;  2DK3 A;  3G71 A;  4X9C A;  1U1S A;  1ZX6 A;  4WCI A;  2HCK A;  1MMA A;  2RI3 A;  1VQP A;  4J5Y A;  2SRC A;  1KQS A;  2KEA A;  2QXF A;  2HNI A;  4Z88 A;  2D0Q B;  5KH6 A;  3OYN A;  4M7D C;  4DBQ A;  2EWN A;  3PIO A;  3EHR A;  4MML A;  4F7U B;  1GCQ A;  2V8K A;  3P8H A;  1M3A A;  4GY5 A;  3KXT A;  1MMN A;  1UUE A;  3QSU A;  1TOV A;  1QW1 A;  5LJ3 d;  2K5I A;  3CPW S;  1I1J A;  2DVE A;  1HYO A;  3A8H B;  5HK0 A;  1UG1 A;  1NEB A;  2DRK A;  3M0Q A;  1GL5 A;  2QTV A;  4XU1 A;  3LWI A;  2DZC A;  1PD1 A;  1BKB A;  3MO8 A;  3SDZ A;  3CCE Q;  4ZN1 A;  2MWO A;  3X24 B;  2E5Q A;  2R5M A;  3ER0 A;  4M75 E;  3HFO A;  4Z89 A;  3HHT B;  3JV3 A;  1KJW A;  2X9H A;  3HTR A;  2J6F A;  4HCK A;  2M1H A;  4PJL A;  1T0H A;  3CCQ Q;  2KVQ G;  4KUL A;  4KH1 B;  4E47 A;  3OS2 A;  1HJD A;  2DET A;  2L89 A;  4RTV A;  3MJX A;  1EX4 A;  2HSE B;  5GAN 2;  1Q7Y U;  3VRZ A;  5FLX E;  5I2M A;  1YIT Q;  3FIF A;  4RCB A;  1KC8 R;  3JB9 F;  4RG8 A;  1RI9 A;  3QO3 A;  2JTF A;  2LCS A;  2NUT A;  3LH5 A;  3FDR A;  4MDW A;  3I56 A;  4L5G A;  5IXF A;  5GAN f;  4JLG A;  5IHI A;  4BE1 A;  5KE3 A;  1M1K C;  1KQS P;  5GAO m;  2ZPH B;  1VQ9 T;  1Y96 A;  4E6R A;  2KE9 A;  2RH2 A;  2VXE A;  2LQW A;  1IXD A;  5C6S A;  2CZ1 B;  1QCN A;  3QWX X;  4CC7 A;  4CI0 C;  3E9F A;  4M78 A;  2L3Q A;  4N0A A;  2K3B A;  2RPN A;  1K8A U;  4QQG A;  2BIV A;  1YI2 A;  3SEM A;  2DJQ A;  2ED1 A;  4PJM A;  2DE0 X;  3A1P A;  3UWN A;  3RKY A;  1FXX A;  2I0N A;  5A0G A;  4FU6 A;  3HRU A;  2E1H A;  4M77 D;  2XDP A;  1QWF A;  8ATC B;  4E7S A;  5IT9 E;  3BDU A;  1Q7Y C;  1FYN A;  4JZ4 A;  2RNA A;  1WHK A;  4ATO A;  4J9B A;  1RAE B;  3RES A;  1Q81 U;  4IUU A;  3KBG A;  2J06 A;  4PJO E;  1M5Q 1;  2DO3 A;  4JRQ A;  1TS9 A;  1AD5 A;  3VKI A;  1Y7X A;  3EG2 A;  1B07 A;  2JTE A;  1M3C A;  2HSP A;  1GXI E;  1I5L A;  4C5G A;  4PFO A;  4YTL A;  3A8O B;  5FWC A;  2XMF A;  1K8A C;  2QDY B;  1G3T A;  5J26 A;  1NJI R;  1NBE B;  2CP7 A;  4EMG A;  4NS5 A;  1UHC A;  4ESR A;  4M77 E;  3UDC A;  1ZQ1 A;  4C8Q B;  2QA4 T;  2XKO C;  2YUN A;  1M90 U;  1WNL A;  3D7S B;  1JRI A;  3NGP A;  4N4H A;  3CMA T;  4P5N A;  4QVC A;  2JMC A;  2X4W A;  2W0Z A;  4OF1 A;  2CP2 A;  2J6K A;  3P8B B;  4OGE A;  3E2U A;  2DBM A;  4J9F A;  2ZCF B;  4DEX A;  1Q95 G;  4M7D D;  3I35 A;  2H3E B;  3ME9 A;  5AYF A;  1MND A;  5LJ5 e;  2X4Y A;  4BE2 A;  1Q81 C;  3EGD A;  1QCF A;  3CCE A;  1AZE A;  3M5A A;  2RO0 A;  5CQY A;  4RUG A;  2DL8 A;  3TSZ A;  2FZG B;  5KYW B;  1D0Z A;  1VQN Q;  3CCU T;  3OYD A;  3MHX A;  3AT1 B;  2QQ9 A;  1YWP A;  4C92 B;  4RTX A;  2RQV A;  1YJ9 Q;  3CME T;  2LQK A;  4FT2 A;  5GAN d;  3OW2 S;  5CKD A;  1YIT A;  1M90 C;  4PLL A;  3JCM P;  1TXQ A;  4D6W A;  3TU4 K;  1BI3 A;  2HQE A;  2LX7 A;  2PZ1 A;  1IGQ A;  5IAY A;  3GNF B;  2YT6 A;  1QVF A;  3CXC A;  4OB2 B;  1K73 U;  2FZC B;  3OQ5 A;  5KYY B;  3MEA A;  2CZ0 B;  3FJ5 A;  3OS0 A;  1QWE A;  1N27 A;  3EAE A;  1AWO A;  2BZ8 A;  5FW9 A;  4XTW A;  1Q86 U;  1KD1 U;  2RN8 A;  2MK5 A;  4RTT A;  4Y92 A;  1LOJ A;  1VQ6 Q;  1UDL A;  5FRM A;  1B34 B;  1QLY A;  3I5S A;  4C92 F;  1RI0 A;  4LUE A;  3JCM h;  1VQ7 T;  2QGF B;  1HXD A;  2MYS A;  3CCM Q;  1N6A A;  3PVQ A;  2DTO A;  2ESW A;  4C0D B;  1MGQ A;  4XTZ A;  2E12 A;  5I11 A;  2IPO B;  4BDY A;  2DIG A;  1WYX A;  4RTY A;  2KRM A;  2D0N A;  1M2V A;  1W1F A;  1YJW T;  1WHL A;  2K57 A;  3CEY A;  4IUP A;  3GBQ A;  4FYV B;  3MET A;  3CC2 Q;  2COY A;  1M1F A;  3E1S A;  2RMO A;  1JXO A;  4F7U E;  1MHN A;  3L2Q A;  4OB3 B;  4PFP A;  2AK5 A;  1M8V A;  5GMK l;  3PE0 A;  4PNO A;  4HCZ A;  2A08 A;  4E7J A;  2LRQ A;  2FVU A;  3O5Z A;  5CIU A;  1I5O B;  2HDA A;  5GAM g;  2BZY A;  4HCC A;  1RAG B;  3M0S A;  3CXC P;  1QVF P;  1UGQ B;  1JO8 A;  2AT1 B;  3OMC A;  4M7A F;  5ECA A;  2KXC A;  1K73 R;  3VUZ A;  1EFN A;  4AFQ C;  2F69 A;  1SHG A;  3CCS Q;  2ATC B;  4R56 A;  1ZBJ A;  3QG1 A;  1Q86 R;  3X25 B;  1KD1 R;  2AKK A;  4M7A C;  4OB0 B;  2LVM A;  2CS7 A;  2LP5 A;  2LMJ A;  1W4S A;  1VQN A;  3L2U A;  2P84 A;  1Q82 C;  2O88 A;  2SEM A;  2PUO B;  1WDX A;  1WZO A;  2WSE E;  2RHI A;  1RAA B;  3SD4 A;  2A28 A;  1YJ9 A;  3TRE A;  4PJO A;  2B86 A;  2LQN A;  3LGF A;  4C5E A;  4JJD A;  3GPL A;  2Z0W A;  3GIB A;  3G71 Q;  2NUP A;  1D1A A;  2CYZ B;  3V8J A;  2EQJ A;  1KQS S;  5LJ5 h;  2G3R A;  4PKC C;  2ZPE B;  1V76 A;  2QEX T;  1YCS B;  4M75 C;  2DRM A;  5D6X A;  2MAM A;  3T9N A;  5GAM e;  4K11 A;  4M78 E;  2ZGW A;  4J9H A;  1OZ3 A;  4M77 A;  1YHQ Q;  2ZAE A;  4HA8 A;  3MEU A;  1X6G A;  3H0H A;  2DXB A;  2QQR A;  1E6H A;  4N4I A;  1KG1 A;  2PVG B;  4QVD A;  7AT1 B;  4KGZ B;  1HK9 A;  4EMH A;  5CCA A;  3UT1 A;  4QQD A;  2FZK B;  1CKB A;  1BIA A;  2EVR A;  2R58 A;  1VIF A;  1VQO T;  3RMS A;  3CBP A;  3CCR T;  4IUV A;  1WJR A;  2RQU A;  2L3P A;  4E7L A;  2D9T A;  4XK8 E;  1C6V X;  1Y57 A;  4J9I A;  3OBW A;  3PTA A;  3CC7 T;  1ZHI A;  2O31 A;  4ANJ A;  3M0T A;  4OMP A;  3HPW A;  4R0K A;  1IRE B;  2R57 A;  2FB7 A;  4A63 B;  3EFO B;  1TWB A;  3CD6 A;  3EH1 A;  3EH2 A;  3CC2 A;  5GJW B;  3FEO A;  3CC4 T;  2BZX A;  2ROL A;  1S72 T;  4C8Q E;  3URG A;  1EZZ B;  4XAX B;  1ZSG A;  2A0F B;  1GFD A;  1W2B A;  4VUB A;  2D8J A;  3TCJ A;  3I56 Q;  1UEC A;  4C92 D;  3CQT A;  4FYX B;  5FRN A;  1UE9 A;  2BUD A;  4AG2 C;  5DY9 A;  1BI0 A;  4EMK A;  2LZ6 B;  2COZ A;  2E70 A;  3THK A;  4OGC A;  4DOV A;  2V1Q A;  2KGT A;  3DLM A;  1X6B A;  2FEI A;  2OTJ T;  5IXB A;  4PJO C;  2HKN A;  1YI2 Q;  1YJN T;  2JW4 A;  1VQ5 Q;  1NM7 A;  2BKD N;  3M0U A;  3PMI A;  5FWB A;  4LUD A;  5CR2 A;  3CCS A;  3RUX A;  1VQK A;  2CSI A;  2DF6 A;  5KYU B;  4B6M A;  1UGP B;  1G3Y A;  1WPY A;  2OTL T;  3ULR B;  3PGG A;  3S3O A;  1EIF A;  3OB9 A;  5EC7 A;  1XNI A;  1RAH B;  2VYT A;  4JJC A;  2RJD A;  5GAN e;  5LJ3 h;  3JCM Q;  4HT9 A;  1ZSZ A;  3JCM c;  2KRS A;  4M75 G;  3RIR A;  4OP0 A;  1SG5 A;  1JB0 E;  4HKE A;  3PNW C;  1VQ4 Q;  2RA2 A;  2O4X A;  3V7C A;  3MEV A;  1N9R A;  2DJZ A;  2LX9 A;  2QYZ A;  1W2B P;  1VQM Q;  4F7U A;  1PSE A;  3H8Z A;  1PHT A;  2OAU A;  3JRZ A;  3NFC A;  1TH7 A;  3G6E T;  2EPD A;  1VYU A;  4KUD K;  2DIQ A;  2M16 A;  1QKX A;  1K9M C;  1QMC A;  1YHQ A;  4KH0 B;  1K1Z A;  2KYB A;  5I21 A;  2DER A;  2X35 A;  3REB B;  2YUP A;  2LT1 A;  2RJC A;  3FLG A;  1M1K U;  2JVV A;  1BU1 A;  2O01 E;  4ZGJ B;  2QI2 A;  4PFZ A;  1QCO A;  3X26 B;  2KSS A;  1H64 1;  3QDF A;  3CPF A;  3CCQ T;  3G4S T;  1VA7 A;  1G3S A;  1VOM A;  2EYY A;  2MMP A;  2JJ9 A;  2PVO B;  2WSF E;  3M58 A;  1ZUU A;  2V26 A;  4MZM A;  2LJ1 A;  1SRL A;  4X1V A;  3QKJ A;  4NL3 A;  2HQX A;  5A0L A;  2EJG A;  2PVD B;  2FRY A;  1MMD A;  5KE2 A;  4R55 A;  3CCV T;  4EIK A;  3VS3 A;  1MV3 A;  3QPH A;  4JZ3 A;  2DX1 A;  3O8V A;  3BW1 A;  4JRK A;  3KUF A;  4J6Y A;  2GFA A;  4PJO G;  1M9S A;  4IUQ A;  3X28 B;  2C06 A;  1MUZ A;  3NPF A;  3HRT A;  5DLQ E;  3H0F A;  1SKU B;  4BI4 A;  1AT1 B;  2YRC A;  5GAM d;  2QQB A;  4C5I A;  3BY7 A;  2ABL A;  1LPL A;  4JRI A;  2K7A A;  1BI1 A;  2GCX A;  2MOX A;  1VQ5 A;  3I5R A;  2ECZ A;  4LD6 A;  2JT4 A;  3L2V A;  2EGC A;  4M77 G;  3G1J A;  5IHK A;  2DD5 A;  2RHZ A;  4J7F A;  3S6W A;  2KNB B;  3BE3 A;  2KT8 A;  2P0K A;  4MZP A;  1M1K R;  1TSF A;  1Y96 B;  2LTO A;  1VQ9 Q;  2RK2 A;  1GCQ C;  2O2O A;  5DLO A;  1WXU A;  2E65 A;  1U1T A;  2RHY A;  3I55 A;  3M56 A;  2CH4 W;  2FO0 A;  1WHJ A;  3A5Z B;  5FRO A;  3V7S A;  4ELY C;  2VXF A;  2EFI A;  3N5B B;  2ED0 A;  3ZL7 C;  2DXU A;  2DA9 A;  3H0I A;  1VQ4 A;  1RAF B;  5CKE A;  2MI6 A;  4HVU A;  2Y4X A;  4BAC A;  3E19 A;  4C8Q A;  3QYG B;  5GAO n;  2RHU A;  1ABQ A;  1Q7Y R;  1VQM A;  3QDR B;  2FPD A;  2DM1 A;  1AHJ B;  3MP8 A;  2DL4 A;  2QQA A;  2DNU A;  1BK2 A;  1VQ8 T;  1JQQ A;  1NPP A;  4NL2 A;  3SFM A;  2OJ2 A;  3MEW A;  2NUZ A;  5GMK h;  1E6G A;  5CKH A;  2RQT A;  2X51 A;  3F70 A;  3V8L A;  2GFU A;  2NWM A;  2CKK A;  4KGV B;  2HD0 A;  5GAN h;  1ZLM A;  1K8A R;  1TUG B;  1XJW B;  2A7Y A;  2HZY A;  2J6O A;  4J9G A;  1K0X A;  2FHD A;  4BUG A;  2XHC A;  5KYW A;  1OPL A;  2M51 A;  2X4X A;  5GAO p;  2CSQ A;  4FT4 A;  3A8M B;  3LW5 E;  3G7Z A;  5IHN A;  4M78 C;  4N0A C;  3C94 A;  3UF4 A;  4C92 A;  3JB9 I;  1SSF A;  1MMG A;  3CCJ T;  4BY6 B;  5KYX B;  3JAM E;  3VU3 C;  2CUB A;  2XD0 A;  1AWX A;  1B3Q A;  5GAO r;  2XK0 A;  2X3W D;  4F16 A;  2LDM A;  2AZS A;  3OYC A;  1IZ6 A;  1SEM A;  4JJN K;  3C4S A;  2VGM A;  1Q81 R;  3EGD B;  2DTI A;  4M7D E;  2EQM A;  1H92 A;  4ORZ A;  4L59 A;  3EG3 A;  3GNG A;  1D09 B;  5LJ5 j;  1O9S A;  4NOY A;  1KHC A;  2OI3 A;  4Z02 A;  1RL2 A;  2CT3 A;  1V1C A;  2EIF A;  2FYK A;  3CCU Q;  3QYH B;  4OMQ A;  2V1R A;  4C0Z A;  2E3I A;  2KY9 A;  4F7U G;  3PMT A;  2P4R A;  2DLP A;  3CME Q;  5HCK A;  4HVW A;  2XG8 D;  1VQ6 T;  2VGN A;  1M90 R;  5CKF A;  1RLQ C;  4JUV A;  1B34 A;  1AZG B;  3EFR A;  4HVV A;  2J05 A;  1OU8 A;  3CCM T;  3L2Z A;  4ME7 A;  4UC4 A;  2KK4 A;  2CDT A;  3JB9 D;  3VS0 A;  1WGS A;  1C1A A;  4Y28 E;  3GF5 A;  3GLX A;  3M9Q A;  1R77 A;  1A0N B;  2EBP A;  3TSW A;  1VQ9 A;  4M7A B;  1BIB A;  3OYM A;  2DVJ A; 
#chains in the Genus database with same CATH homology
 2KEA A;  1G83 A;  1AOJ A;  4Z88 A;  4CC2 A;  1CKB A;  1WXT A;  2EVR A;  4IIO A;  2X3X D;  3EHR A;  3QWY A;  1HD3 A;  1W70 A;  1GCQ A;  1BBZ A;  1OOT A;  1M3A A;  1AVZ C;  2RQU A;  2L3P A;  2L2P A;  2EYZ A;  1UUE A;  2EGE A;  2JM8 A;  1Y57 A;  4J9I A;  1I1J A;  2EKH A;  2LNH B;  1GCP A;  4IIM A;  1X43 A;  1UGV A;  2O31 A;  1U3O A;  3M0T A;  4OMP A;  2KBT A;  1UG1 A;  4R0K A;  2F2V A;  2DBK A;  1T3L A;  1NEB A;  4OML A;  2DRK A;  3M0Q A;  2E5K A;  1XOV A;  1GL5 A;  4A63 B;  2L0A A;  1GRI A;  5GJW B;  2BZX A;  1SPK A;  2ROL A;  4Z89 A;  1ZSG A;  1GFD A;  1YNZ A;  3R6N A;  3JV3 A;  2D8J A;  1KJW A;  2J6F A;  4HCK A;  1T0H A;  1UEC A;  4KRT A;  3CQT A;  1UE9 A;  1IO6 A;  2CRE A;  4AG2 C;  2LZ6 B;  1HJD A;  5L23 A;  2F2X A;  3THK A;  2VKN A;  4RTV A;  2V1Q A;  2KGT A;  3VRZ A;  1X6B A;  2FEI A;  5IXB A;  2HBW A;  1AEY A;  2JM9 A;  1I0C A;  1RI9 A;  4CC4 B;  2LCS A;  2JW4 A;  2EYW A;  3LH5 A;  1NM7 A;  1LCK A;  3M0U A;  5IXF A;  5FWB A;  2PNI A;  4J9D A;  4LUD A;  1M3B A;  5IHI A;  1Z9Z A;  2HEQ A;  1X69 A;  2CSI A;  4E6R A;  2KE9 A;  1PRL C;  2DF6 A;  2AKL A;  2KT1 A;  2LQW A;  1Y0M A;  1PWT A;  1NEG A;  3QWX X;  4CC7 A;  4DEY A;  2L3Q A;  2K3B A;  1T3S A;  2RPN A;  5I22 A;  2GBQ A;  1W6X A;  2DYB A;  3ULR B;  2CT4 A;  3SEM A;  2DJQ A;  3EHQ A;  4RTZ A;  1KIK A;  2ED1 A;  2FPE A;  2C0I A;  2DE0 X;  2GNC A;  5EC7 A;  2ROT A;  1M30 A;  2KXD A;  2YUQ A;  1U5S A;  4JJC A;  2I0N A;  1OEB A;  2KRS A;  2LJ3 A;  4LNP A;  1QWF A;  4HXJ A;  1RLP C;  3VS7 A;  1FYN A;  4JZ4 A;  2RNA A;  1UFF A;  1ARK A;  4J9B A;  2RQW A;  1ZUY A;  2FRW A;  2J06 A;  1PHT A;  1WA7 A;  1AD5 A;  2EPD A;  1VYU A;  1KSW A;  1TUC A;  3EG2 A;  1QKX A;  1B07 A;  2JTE A;  1M3C A;  1JXM A;  2O9V A;  3VS5 A;  1K1Z A;  2KYB A;  2YSQ A;  3REA B;  2HSP A;  2JMA A;  3NMZ C;  3PVL A;  1M27 C;  3REB B;  2YUP A;  3RBB B;  5FWC A;  3M0P A;  2XMF A;  3UA6 A;  1K9A A;  3VS4 A;  1BU1 A;  1UHC A;  1OPK A;  1QKW A;  4ESR A;  1GFC A;  1PRM C;  5GJV B;  2YUN A;  1E7O A;  2C0O A;  3NGP A;  1G2B A;  2D1X A;  4JPB W;  2KRO A;  2JMC A;  1WLP B;  1YP5 A;  1VA7 A;  2DL3 A;  2W0Z A;  2EYY A;  4LE9 A;  3H41 A;  2J6K A;  2K9G A;  1T0J A;  2DBM A;  4J9F A;  3VS1 A;  1WX6 A;  4DEX A;  3I35 A;  2FPF A;  1ZUU A;  1I07 A;  2LJ1 A;  2MIO A;  1SRL A;  4X1V A;  2FRY A;  1QCF A;  1VYV A;  1N5Z A;  1X2Q A;  1AZE A;  4EIK A;  3VS3 A;  1MV3 A;  4RUG A;  2DL8 A;  3I9Q A;  3TSZ A;  4JZ3 A;  2DX1 A;  2KRN A;  1UHF A;  4AFS C;  2DIL A;  1YN8 A;  1MUZ A;  2A36 A;  2AZV A;  3NPF A;  1YWP A;  2EGA A;  3H0F A;  5IH2 A;  4RTX A;  2RQV A;  1NLP C;  1Z9Q A;  2VVK A;  2JS0 A;  1FMK A;  2ABL A;  2F2W A;  2K7A A;  2PTK A;  2MOX A;  1PKT A;  2GGR A;  2JXB A;  2EYX A;  3I5R A;  2ECZ A;  2JT4 A;  3EG1 A;  2LX7 A;  2EGC A;  2PZ1 A;  4GBQ A;  1UJY A;  1ABO A;  4Z8A A;  5IHK A;  1ZUK A;  1NYG A;  2KNB B;  2KT8 A;  2YT6 A;  4AG1 C;  1WIE A;  2J7I A;  2H8H A;  3FJ5 A;  1OV3 A;  3A98 A;  1QWE A;  1K0S A;  1SSH A;  1GCQ C;  4OMN A;  2O2O A;  1UJ0 A;  1GBQ A;  1AWO A;  2BZ8 A;  5FW9 A;  3VS2 A;  1H8K A;  2RN8 A;  4ZNX A;  1MV0 B;  1X2K A;  1WXU A;  1KFZ A;  4RTT A;  4Y92 A;  2CH4 W;  1UDL A;  2FO0 A;  1QLY A;  3I5S A;  4JJB A;  4LUE A;  3TVT A;  3PVQ A;  2RQR A;  4AFU C;  2ED0 A;  1NLO C;  3ZL7 C;  2ESW A;  1NG2 A;  2DA9 A;  2O9S A;  2W10 A;  3H0I A;  3IQL A;  3UA7 A;  4HVU A;  3KFV A;  2GTO A;  4LN2 A;  1J3T A;  1K76 A;  4GLM A;  5I11 A;  1WI7 A;  3VRY A;  1WYX A;  1ABQ A;  4RTW A;  4RTY A;  1SRM A;  2KRM A;  1SHF A;  2D0N A;  1W1F A;  4F14 A;  4QT7 A;  2FPD A;  2DM1 A;  2DL4 A;  3GBQ A;  2GQI A;  2DNU A;  1BK2 A;  4D8D A;  1JQQ A;  2RMO A;  1GBR A;  2OJ2 A;  1JXO A;  2NUZ A;  1E6G A;  2JS2 A;  3EGU A;  1H3H A;  2RQT A;  2AK5 A;  3NHN A;  3EG0 A;  3PE0 A;  2A37 A;  2NWM A;  3U23 A;  2A08 A;  1ZLM A;  2FG0 A;  1S1N A;  4J9G A;  2J6O A;  1K0X A;  3O5Z A;  1OPL A;  2HDA A;  2M51 A;  2CSQ A;  1K4U S;  2BZY A;  3M0S A;  2MCN A;  1JO8 A;  2QDL A;  1WFW A;  2DMO A;  1NYF A;  5IHN A;  2CH4 A;  1AWW A;  3SHW A;  5ECA A;  3UF4 A;  1TG0 A;  2KXC A;  1EFN A;  4AFQ C;  1JEG A;  4J9E A;  2K79 A;  4OMO A;  1SHG A;  1UTI A;  1CKA A;  1AWJ A;  1TUD A;  2CUB A;  2BTT A;  4RTU A;  1AWX A;  3UAT A;  1CSK A;  1B3Q A;  1ZBJ A;  2GTJ A;  2KR3 A;  2X3W D;  4F16 A;  2YDL A;  2AZS A;  4CC3 A;  1SEM A;  2AKK A;  3M0R A;  1WXB A;  2K6D A;  2DL5 A;  1H92 A;  4D8K A;  2LP5 A;  2LMJ A;  1VYT A;  4ORZ A;  1YWO A;  3EG3 A;  3RNJ A;  1PKS A;  1BB9 A;  2RF0 A;  2O88 A;  2SEM A;  2OI3 A;  1WDX A;  3VS6 A;  4M4Z A;  2CT3 A;  1RUW A;  1V1C A;  4OMM A;  4FSS A;  2ENM A;  2A28 A;  1U06 A;  2VWF A;  2D8H A;  4OMQ A;  4AFZ C;  1HSQ A;  2CUD A;  4F17 A;  1PNJ A;  2V1R A;  1JU5 C;  4J9C A;  2B86 A;  2LQN A;  2K2M A;  2G6F X;  2DL7 A;  2KYM A;  4JJD A;  2EQI A;  2P4R A;  2IIM A;  2DLP A;  1M8M A;  5HCK A;  4HVW A;  2YUO A;  1X27 A;  1RLQ C;  4HVV A;  1AZG B;  2J05 A;  2L3S A;  2OAW A;  2M0Y A;  1YCS B;  2LJ0 A;  2DRM A;  4K11 A;  2CDT A;  3VS0 A;  4J9H A;  2C0T A;  1A0N B;  2EBP A;  1X6G A;  3TSW A;  3H0H A;  1ZX6 A;  3C0C A;  4WCI A;  1E6H A;  2HCK A;  2DVJ A;  2EW3 A;  2SRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...