4HVWA

Crystal structure of the t98e c-src-sh3 domain mutant in complex with the high affinity peptide vsl12
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
GSHMTFVALYDYESRTEEDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic resolution structures of the c-Src SH3 domain in complex with two high-affinity peptides from classes I and II.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein/peptide
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 9
structure length 61
sequence length 61
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4hvwA00
4DEXA 4AFUC 1G2BA 1I07A 1G83A 1QWEA 1QWFA 1RUWA 2DL4A 3EG2A 1YNZA 4F16A 4WCIA 1SRMA 2CUBA 4J9BA 2KBTA 1WDXA 2KEAA 2HBWA 2O31A 4LNPA 3VS3A 4ESRA 2HDAA 2HCKA 2BZ8A 1J3TA 2MCNA 5FW9A 1UUEA 2GTOA 3EGUA 5GJVB 1M30A 2KE9A 1X6BA 2RQWA 3M0SA 2MIOA 1BK2A 2DBKA 1K9AA 2JT4A 1GCQA 2BTTA 2VVKA 3THKA 2V1QA 2CREA 1ZUYA 4CC2A 1WXBA 1T3SA 1VA7A 4OMOA 2LJ1A 2K9GA 4RTTA 3VS1A 1ZUUA 2ENMA 2XMFA 2EQIA 3VS7A 1SPKA 1PHTA 1Z9QA 1JXOA 5I22A 2M0YA 1CSKA 1E7OA 3A98A 1IO6A 1OPLA 2DL7A 3PVQA 2EYYA 2K2MA 4CC4B 1JEGA 2GTJA 4J9GA 1U3OA 2KRMA 3UA7A 2G6FX 2NWMA 1M3BA 2A08A 2YUOA 1UECA 2D8HA 1WXTA 4OMQA 4CC7A 1Z9ZA 1X2QA 2J06A 2L3SA 1UJYA 1VYVA 2GGRA 1AZEA 2YSQA 1XOVA 3QWYA 4LUDA 1AOJA 2KYMA 4Z88A 4DEYA 2O9VA 3ZL7C 2K79A 1QCFA 1QLYA 2FRWA 1GFDA 4IIMA 2M51A 4Z8AA 2YT6A 2A36A 4F14A 1OOTA 1RLPC 2KXDA 2KR3A 2KXCA 1SEMA 4RTZA 3M0PA 2RQVA 2YUPA 1ZX6A 1S1NA 3LH5A 1BU1A 5FWBA 2DVJA 1AD5A 3RBBB 2JS0A 3M0TA 4GLMA 1PWTA 4AFSC 2NUZA 4JJBA 2F2WA 4OMPA 3EG0A 1ZSGA 2KGTA 4E6RA 2EGEA 4RTYA 3PVLA 3TSZA 1UTIA 2DE0X 5IXFA 1JO8A 2PZ1A 1NLOC 2RQUA 3JV3A 4LN2A 1PNJA 2JMCA 2EGAA 2ROTA 1W6XA 1VYUA 1YWPA 4J9DA 2C0IA 4F17A 2AK5A 1B07A 3H0HA 1OEBA 1WA7A 4HVUA 2D1XA 2L3QA 2HEQA 2DRMA 4AFZC 1H92A 3SEMA 3UATA 1YWOA 2VKNA 1AZGB 1UDLA 1UG1A 2EBPA 4IIOA 1X2KA 2CUDA 3C0CA 4M4ZA 1UHCA 2ECZA 4J9EA 1M27C 2PTKA 1AWOA 4JZ3A 2K6DA 1CKAA 2SEMA 1KIKA 3H0IA 1JU5C 2AKLA 3UF4A 3FJ5A 1UHFA 1Y0MA 2JXBA 2KT8A 2KT1A 3U23A 3NHNA 1HJDA 2CT4A 2DM1A 1UFFA 5L23A 2LX7A 2GQIA 2KNBB 1W1FA 4D8DA 4A63B 1PRMC 2CT3A 2SRCA 2EKHA 3RNJA 4RUGA 2L3PA 2JW4A 1FMKA 2RQRA 4RTWA 2H8HA 1M8MA 1LCKA 3M0UA 4QT7A 3I5SA 1WX6A 2BZXA 1M3AA 2X3WD 2FPEA 1ZUKA 2ED1A 2PNIA 1Y57A 1T0JA 2EYXA 2JS2A 3VRYA 4J9HA 4OMNA 2LQNA 2DF6A 2DJQA 3NMZC 2L2PA 5FWCA 2DMOA 2ROLA 2FEIA 1UE9A 1NLPC 1RLQC 2CSQA 2EVRA 2F2VA 2DL8A 1TUCA 2GBQA 5IH2A 2W0ZA 1AWJA 2FO0A 2HSPA 3TVTA 2FPFA 2FRYA 2JM9A 1AVZC 2DA9A 2AKKA 2FG0A 4RTUA 1X27A 2A28A 1NEBA 1YCSB 2E5KA 1UJ0A 5ECAA 1ZBJA 1MV0B 1MV3A 2CH4W 2OJ2A 3O5ZA 3EG1A 2EW3A 1X69A 2EPDA 4R0KA 2C0OA 2OAWA 4AG2C 2LMJA 2KROA 4FSSA 1AWXA 3I35A 1CKBA 1AWWA 1PKSA 1SSHA 3VS5A 1KJWA 1NYFA 1TG0A 2O2OA 3REBB 2CH4A 1U5SA 4ORZA 1NYGA 2KRNA 4JZ4A 2JM8A 1WIEA 2DBMA 2FPDA 1EFNA 2P4RA 1VYTA 4J9CA 4Y92A 3TSWA 2EYZA 1H3HA 1KSWA 4KRTA 4AFQC 4JPBW 4HVVA 1GRIA 1SHFA 1M3CA 2AZSA 3EHQA 2DNUA 1MUZA 1NG2A 2CSIA 1YN8A 2J6KA 2RNAA 1RI9A 5EC7A 2C0TA 2JMAA 2RF0A 5IXBA 3QWXX 3VRZA 1WXUA 3PE0A 1GL5A 1NEGA 1FYNA 2GNCA 3EG3A 4HVWA 1B3QA 2J6OA 3NGPA 1ABQA 3SHWA 1WI7A 3ULRB 1OV3A 4JJDA 2LNHB 3H41A 3EHRA 2AZVA 1X6GA 1T3LA 3KFVA 4HCKA 2KYBA 3I9QA 4RTVA 4AG1C 2K7AA 1E6GA 1I0CA 4GBQA 1HSQA 1OPKA 2RN8A 2DL3A 1SHGA 2ABLA 3H0FA 2DILA 4K11A 4X1VA 2DRKA 1ZLMA 3VS2A 1NM7A 1GBQA 2LZ6B 4LUEA 1K4US 1BB9A 2EYWA 4JJCA 2X3XD 4CC3A 1N5ZA 2VWFA 3UA6A 4D8KA 1WYXA 2LP5A 1QKWA 2IIMA 1PRLC 1HD3A 5I11A 1KFZA 1K0XA 2LQWA 1I1JA 5GJWB 2BZYA 1AEYA 1JQQA 3R6NA 3VS6A 2K3BA 2V1RA 2LJ0A 4RTXA 2DYBA 3GBQA 4OMMA 2RMOA 1BBZA 5IHKA 1H8KA 2LCSA 1ARKA 5IHIA 1JXMA 4EIKA 1UGVA 2O88A 3VS4A 1GCPA 1GCQC 3M0QA 1K1ZA 1PKTA 3IQLA 2I0NA 1GBRA 2EGCA 2J7IA 3NPFA 2W10A 2DLPA 2YDLA 1GFCA 2ESWA 2CDTA 4J9IA 2L0AA 2O9SA 1ABOA 4HXJA 2RQTA 4LE9A 1T0HA 2YUNA 3VS0A 1U06A 1X43A 1WLPB 2KRSA 2B86A 2JTEA 3CQTA 4Z89A 2A37A 2J6FA 1K0SA 2F2XA 3M0RA 2LJ3A 2RPNA 2MOXA 2ED0A 5IHNA 1W70A 2D0NA 1QKXA 1WFWA 1A0NB 1TUDA 2DL5A 1E6HA 2OI3A 2YUQA 1YP5A 4OMLA 1SRLA 2D8JA 3REAB 2DX1A 4J9FA 1V1CA 2J05A 3I5RA 5HCKA 1K76A 4ZNXA 2QDLA
chains in the Genus database with same CATH superfamily
4DEXA 1R77A 4M77E 3MEVA 1RUWA 2ATCB 3GNGA 2E64A 4J9BA 3VS3A 2E6ZA 4XU3A 3JSCA 1J3TA 1KC8R 4B9WA 4Q5WA 2FHDA 3EFRA 1VQ4A 4C8QD 2QXFA 5KYYB 4EDUA 1WNLA 1K9AA 5KYYA 2VVKA 1W2BS 2V1QA 1FX7A 5AT1B 4ATOA 1WXBA 1T3SA 4OMOA 2LJ1A 3OMGA 1G3TA 2DTHA 3VS1A 4M7AF 1OYXA 1ZA2B 2DD4A 4JLGA 3OSVA 3VS7A 1M1FA 1Z9QA 1FXXA 1JXOA 4JRPA 1PCXA 2QQSA 3S3NA 2XU8A 1CSKA 3HPWA 2H3JA 1OPLA 1UB4A 2V8IA 3MHXA 2QEXT 4E7HA 4OB2B 4E7KA 4FM4B 3SDZA 2K5IA 1MMGA 5HKCA 1K8AU 2KDSA 3MKDA 1Q7YR 4PFPA 3V8JA 1OULA 2PUOB 1X2QA 2J06A 1D3BA 2X4WA 3BW1A 3CCSA 5LJ3f 1U8RA 3QZ5B 1ZHIA 3S3OA 4FIBA 3OB9A 1PSEA 2M51A 4Z8AA 4C92E 2YT6A 3KXTA 1TXQA 1KD1R 3RKXA 4M7AA 4NS5A 1M1GA 2KR3A 2LX9A 2KXCA 4A53A 4PJOF 3OYAA 4M78C 4J8OA 3M9QA 4MZPA 2EFIA 2RQVA 4JRQA 2YUPA 2WSCE 2P0KA 1S1NA 4C0DB 1VQ5Q 4AFSC 2NUZA 1O75A 2F2WA 3G6EQ 2R5AA 2ZPBB 1ACMB 1ZSGA 2L3RA 4E6RA 2CZ1B 4RTYA 3PVLA 2VGMA 3QZ9B 1UTIA 5IXFA 1JO8A 2YXYA 2RQUA 4C92F 2IG0A 4J5YA 4ZTJA 3OW2A 1VYUA 1YWPA 3MP1A 2RK2A 3CCUT 4DBQA 4HVUA 4OGCA 3LWIA 2EJFA 2BUDA 5GAOq 2GCXA 4C0ZA 3RMSA 1UG1A 5GAMf 3GLXA 2EBPA 2PVGB 4PJOD 2QAZA 1AWOA 4NOYA 4N0AC 3CCQT 3DB4A 3G71A 3R6OA 3SFMA 3I56Q 4E2FB 2DEQA 3CCEA 2JXBA 6AT1B 5FRNA 2KT8A 2KT1A 2BIVA 4QVCA 3NHNA 4M7DB 2XHCA 3P8HA 4M78A 1QCOA 5HK3A 2QG9B 4PJMA 4OP0A 4D8DA 1G5VA 4F7UG 2CT3A 2X35A 4M77B 3RNJA 1Q7YC 4RUGA 2L3PA 2RQRA 3G4SA 2DFUA 4C8QG 3RMQA 1WX6A 2QQBA 4J7FA 3C4SA 1M90U 2E3IA 4XQ3A 3LGFA 1TSFA 1OI1A 4WF2A 3JB9H 2R58A 2VGNA 2Z0WA 2DAQA 4LDWA 3LGLA 3Q1JA 1OQKA 2IVWA 2K2VA 2L2PA 3JB9F 1LJOA 5I21A 3QKJA 2DMOA 2FEIA 2L5QA 2QA4T 5LJ5j 1RLQC 1NPPA 3E19A 3BDUA 2RB6A 4JRKA 1TUCA 2W0ZA 1AWJA 2HSPA 5CQYA 2FPFA 1UGRB 5GANj 2AKKA 2QGFB 3QHSA 1NEBA 2E5KA 4VUBA 5ECAA 1YITT 1ZBJA 5GMKm 1MV3A 2CH4W 2CZ0B 2EW3A 4R0KA 2DO3A 1N9RA 2C0OA 5LJ5g 3PMIA 1I5LA 4FSSA 1AWXA 4M7DF 1QVGP 1ZQ1A 4ORZA 1NYGA 4JZ4A 3FEOA 3TEEA 2JM8A 1WJRA 2A7YA 4HCCA 2P4RA 2XI9A 4QQ6A 3RESA 2EYZA 1KSWA 3LWHA 1VQKT 4JPBW 4HVVA 1GRIA 1YI2T 5A0LA 1MUZA 3G6ET 2J6KA 5CCAA 1MNEA 4C8QB 5GAMd 2C0TA 4BD3A 3QWXX 2GQVA 2BE7D 5LJ3g 1GL5A 1FYNA 1BI3A 2GNCA 2QK0A 2MYSA 3SHWA 3M57A 1BI1A 2NUPA 4JJDA 1HYOA 1X6GA 2AZVA 3WVDB 2QQ9A 4HCKA 4JS4A 1W2BA 2CP2A 3CMAT 1XQHA 3OYGA 4M7DA 5GAN4 3PIOA 3JCMc 1BI0A 4GBQA 3JB9D 4C0DC 2DTOA 5CO7A 4M77F 1VQPQ 3CCVT 2GFAA 2DRKA 3TCJA 3VJPA 4V2SA 1GBQA 1R0CB 4LUEA 2E6NA 1BB9A 1QVFS 4MZMA 2LCLA 4IUUA 4E7LA 1WQWA 3UA6A 4M75D 2LP5A 3CCEQ 1FMVA 1RADB 5GJWB 2BZYA 1AEYA 1JQQA 3ME9A 3SD4A 8AT1B 2DYBA 4BI4A 4JLIA 4UC4A 4EMKB 4M7DE 1ARKA 1TH7A 3VS4A 4IUVA 2M0OA 3HHTB 2I0NA 4HA8A 2J7IA 3HRUA 4YTLA 2F5KA 1VQ4Q 2JJ9A 3CCLT 2QGGA 3JB9G 4A54A 5KCOA 2JTEA 3OYDA 2A37A 2J6FA 2V26A 3V7SA 3CC2T 4QQGA 1Q7YU 5GMKl 2I2LA 3CCMT 4KUDK 4DBHA 4FL6A 2QEXQ 5CIUA 1Q81R 2DZ9A 1WFWA 1A0NB 3VUBA 1D1CA 1VIEA 1E6HA 1FWZA 3PT9A 4JRIA 3CCSQ 2ZPEB 1KQ1A 1YP5A 4XK8E 2CKKA 1SRLA 1TTHB 3EH2A 2D8JA 3FB9A 2AIRB 2J05A 5HCKA 3OYNA 2EQJA 4GLKA 4AFUC 2YLCA 4F16A 4ZGJB 5LJ5e 1KC8C 2KEAA 2HBWA 2OTLA 1V76A 4LNPA 3V8KA 5GMKj 2HCKA 4II1A 1DJ7B 4BE2A 5LL6S 2MCNA 5GJVB 3CBOA 1WHJA 1BK2A 2L89A 4M7DD 2HQXA 1HK9A 1OU9A 2BTTA 2CREA 1S72A 2R5MA 2QA4A 4M77D 1HXDA 1YBYA 4QQDA 1ZUUA 5FROA 1SPKA 1PHTA 1EIFA 5I22A 1NE8A 5A0DA 1H3ZA 5CVIA 1RAGB 2WSEE 1IZ6A 1RAFB 1N27A 3CCVA 1IO6A 2DZCA 3M56A 1UGPB 2DL7A 3EGXB 3PVQA 5KYXA 3GF5A 2K2MA 3UPUA 4FT2A 4CC4B 1MHNA 2GTJA 4J9GA 4E47A 3A8OB 1K9MU 1VQPT 2G6FX 2D9TA 2NWMA 2DXCA 2QA4Q 1UECA 2ZCFB 2RHXA 1Z9ZA 3OYCA 4M7DG 2XG8D 3QUIA 4MMKA 2H3EB 3MEAA 3CCJT 4DEYA 3SWNC 4A4HA 1Q82U 1QCFA 1QLYA 4QW2A 4GY5A 1YI2A 1XNIA 1G8XA 1BI2A 2D0QB 1SEMA 3L1AA 3J81E 1TS9A 2KSSA 3LH5A 4WTOB 1RAAB 1R8OB 3P8BB 2DVJA 1AD5A 3RBBB 3JB9I 2O4XB 1VQMQ 3CMEQ 2WSFE 4JJBA 4MDWA 1MMNA 3V7RA 4B9XA 2KGTA 1RAHB 2EGEA 4ZTFA 4C92A 4R55A 1K73C 1VQLA 2HAXA 2DE0X 1BKBA 4IUTA 1VQOT 2PZ1A 2E3HA 1YI2Q 2ROTA 7AT1B 4OB1B 2QEXA 2JOYA 4F17A 5GAN5 3ZEHA 3I56T 2K5LA 3CCRA 3RDVA 5J3BA 1OEBA 5EG2A 2HEQA 4M75G 4BI8B 1N8RU 1ZBXA 1YWOA 1XTDA 2VKNA 1I8FA 4DBRA 1D0XA 1UDLA 1I81A 1G3WA 1PM3A 3HL8A 2CUDA 2MI6A 5CQXA 2DVEA 2PTKA 2JNGA 1AHJB 2KQWA 2YRDA 1Y96A 3H0IA 4HCZA 3CCLA 3M59A 3L42A 5D6WA 3NTHA 2DM1A 4PJNA 1UFFA 2RI5A 4CRIA 5L23A 1P92A 1B34B 2DK3A 3CCQQ 4M78F 2E10A 4QVDA 2GF7A 1W1FA 3OS2A 3NTIA 4A63B 1PRMC 2SRCA 3OS0A 2JW4A 4RTWA 2H8HA 4XU2A 1VQ8T 5KE3A 2HL5C 3RIRA 1RL2A 3FIFA 3DLLA 2PNIA 1T0JA 3CBPA 2HQEA 1WJSA 2DJQA 3NMZC 1Q86U 2XDDA 1KHCA 2HZYA 3GP8A 4C5EA 5IH2A 2F2VA 2FO0A 3TVTA 5HY6A 4PL6A 2JM9A 2DKGA 1AVZC 4IUPA 1F1BB 5LJ5f 5GAOl 3QJYA 4RTUA 1X27A 2A28A 3EGDB 4JJNK 1D3BB 3O5ZA 1Y71A 2EJ9A 2NUTB 1VQNQ 3JCMb 1YITA 4DOWA 5C6SA 3AHUA 1LOJA 3CCJQ 4FU6A 3I35A 1CKBA 4BACA 2WACA 4XAXB 1QQJA 4JDSA 3OYBA 3DLMA 2O2OA 3REBB 2CH4A 4DBFA 2OTJQ 5CR2A 2RI2A 2JZ2A 3G4ST 3OS1A 3OMCA 1EFNA 2PU9B 3CCUA 1B7TA 1D0ZA 1VYTA 4M77G 2COYA 3QJ6A 4AFQC 2XD0A 4KT0E 1M3CA 1QCNA 2ZZDA 1NG2A 3G1JA 1YN8A 2QI2A 2HSEB 3HTRA 3MEUA 1X75C 2VXFA 3CCET 5J39A 3QG1A 5D6YA 1UGQB 3PE0A 1FMWA 2XICA 4HVWA 4AT1B 1B3QA 2F69A 4N4IA 3QDRB 1QW1A 5FU7C 2EJGA 1WPYA 2LDMA 3KFVA 2LCCA 3X20B 4JS5A 4AG1C 4RTVA 5GAN2 1E6GA 2CS7A 4C92B 4C5GA 3CD6Q 1K9MR 1YIJT 3CC4T 5LJ5h 2VYTA 5LJ3d 1NM7A 4M77A 2EQMA 2EYQA 2R57A 4L6V5 3S3MA 3RKWA 4HKEA 1WYXA 1KFZA 3NFCA 3CPFA 3CCLQ 1I1JA 1K0XA 2LQ8A 4RCBA 3A1PA 5GMKe 3GIBA 2RH2A 4F7UA 3VS6A 4IUQA 2V1RA 2LJ0A 1VQOA 1YJ9T 2YRVA 2Y90A 4OMMA 4JUVA 1NPRA 3JB9J 2RMOA 1M4ZA 1BBZA 5IHKA 3OBWA 1VQ9T 5CK9A 4EIKA 3DKMA 2RJDA 3LLRA 1UGVA 2O88A 3M0QA 3VV0A 3IQLA 3L2RA 4C92G 3X28B 3NPFA 2ZPGB 1VQ7A 2DLPA 2YDLA 4N4HA 2O4XA 2OTLT 3CMAA 2CDTA 4EMKC 1VQ7Q 4HXJA 4LE9A 3VS0A 1C6VX 1Y07A 1M9SA 2B86A 4XU0A 1IREB 4Z89A 1QVGS 1K0SA 3LYIA 2XK0A 2F2XA 1K8AR 3RERA 1D09B 1R0BG 1OX8A 2ED0A 2Y4XA 2KK4A 1D0YA 1VQ4T 4BE1A 1QKXA 1M90R 4F7UF 3N5BB 1TUDA 3QYGB 2EQUA 2YUQA 4OMLA 3FJPA 1C0MA 1WHHA 3UT1A 4J9FA 2KVQG 4TVRA 1M1KR 1G2BA 1I07A 4PLIA 4BUGA 1QWFA 2DL4A 4BI3A 3EG2A 1M2OA 2E12A 1YNZA 5M9OA 4WCIA 4A4KA 2CUBA 2KBTA 3TU4K 1PD1A 1SF9A 5LJ3j 4ESRA 2HDAA 5LJ3h 3OS5A 5LJ3e 3A8GB 5FW9A 1UUEA 2MWOA 3MO8A 1X6BA 2RQWA 3M0SA 1TUGB 2MIOA 3CPWP 2EIFA 1BIAA 2BKDN 2VXEA 1U1SA 3UDCA 1VQKQ 2JT4A 4EMKA 3OW2S 2XDBA 4X9DA 5CAIA 1V29B 1ZUYA 4CC2A 2QQRA 3BE3A 2K9GA 2L8DA 4RTTA 5CKEA 3H6ZA 2ENMA 1YFNA 4PJLA 3EGDA 3CCUQ 2JN0A 1YCYA 2M02A 4FW1A 4KUIA 1YITQ 4PFZA 4RCCA 3CD6A 1N9SA 3CBMA 1YIJA 3A98A 4O5VA 2EYYA 4FYXB 5D6XA 1U3OA 3LX7A 5KYNA 3L2ZA 3PIPA 2KRMA 3CC4Q 1M2VA 4KH1B 1M3BA 2LVMA 3JAME 3VU3C 2YUOA 2D8HA 4CC7A 4BB7A 4RKUE 2L3SA 1UJYA 3JCMX 2HKQB 1VYVA 3CMAQ 1NBEB 3ASKA 1AZEA 3OYHA 2YSQA 2DXUA 1RAIB 4D6WA 3M55A 4Z88A 4KULA 2DJZA 3ZL7C 2K4YA 3JCMP 1S72T 4FYWB 2FRWA 2RO0A 2ZAEA 4M7AB 2M1HA 1OOTA 2PUKB 3A8LB 1Q81U 4RTZA 4HT9A 4O6JA 3M0PA 3M4GA 1QVFP 4OVAA 1ZX6A 1NJIC 5D7UA 5FWBA 4FCYA 3JCMV 2FYKA 2RHYA 3M0TA 4GLMA 1PWTA 3ZFJA 3S6WA 1LNXA 4FW2A 3EG0A 3TSZA 2EAYA 1M1KU 1B34A 3EG9A 3JV3A 4LN2A 1G3YA 3NTKA 3CXCS 2EGAA 2HBPA 1TWBA 2AK5A 4BY6B 4M75B 2EKOA 2E1HA 1B07A 3CMET 3H0HA 4C8QE 4ELYC 4PJOC 1KD1C 2CP0A 4M7AC 4AFZC 1H92A 3OYIA 2JUFA 1AZGB 4FYYB 2CP6A 5GANh 3JCMJ 3META 1Q86C 3C0CA 3QYHB 5IN1A 1M27C 1VQ8Q 3CC7T 3CC2A 2K6DA 1CKAA 3HRTA 1VQ9A 5FU6B 1QVPA 2SEMA 2PVOB 1JU5C 2NUPB 1OX9A 1Y0MA 5I2SA 2PVDB 4F04B 2DETA 2CT4A 3M53A 3CMEA 2QDYB 1VQMA 2CZ7B 2GQIA 2QYZA 2KNBB 1W2BP 5KE2A 3BFMA 4XTYA 4BDZA 2HMAA 4X34A 4KGXB 1JJ2S 1FMKA 4FSXA 1M8MA 3V7CA 1LCKA 3M0UA 2Y4YA 3I5SA 4C5HA 1MGQA 2BZXA 3CCMQ 1M3AA 2FPEA 3I56A 2HQHA 1AT1B 2EYXA 2JS2A 4PFOA 3VRYA 2MWPA 1K73U 3CC7A 1M8VA 4J9HA 1K73R 4OMNA 3G7ZA 2E70A 2DF6A 4N4GA 2LTOA 2MK5A 1QP2A 5DLQE 3J80E 1YJWA 2OX7A 5FU7B 1JB0E 4ZGEB 4C8QA 2ROLA 1NLPC 1NJIU 2CSQA 2EVRA 2DL8A 1TOVA 5A2QE 2VASA 3CD6T 3H8ZA 3L2VA 3A8MB 2FG0A 1C1AA 3G4SQ 1JJ2P 3JCMQ 2YHTA 4IURA 5GMKh 2LT1A 3G6EA 4ZN1A 4N0AA 3BY7A 2E5QA 2OJ2A 4XU1A 3OBYA 3EG1A 3JCMh 2O01E 2E41A 1X69A 2EPDA 3WXMB 3EGXA 1TU0B 5KYXB 2LMJA 1NZ9A 3OW2P 4M75E 2FL7A 1UEBA 1AWWA 3RUXA 1PKSA 1KJWA 1NYFA 1TG0A 3CCQA 5GAN3 4EPCA 5KYWB 4M7AE 1VQ9Q 2ZPIB 1WIEA 2JTFA 2DBMA 2FPDA 4Z02A 4J9CA 3T9NA 4Y92A 1YHQT 1BCMA 2YLBA 3OQ5A 1Q86R 1VQNA 5GAN7 1SHFA 1Q82R 2AZSA 3EHQA 4C92D 5J26A 2CSIA 2D6FA 2RF0A 2AHJB 1WGSA 4IKFA 3VRZA 1WXUA 1G3SA 2CP3A 3P8DA 1OZ3A 3HRSA 3EG3A 2LRQA 2J6OA 1ZSZA 3NGPA 5KH6A 1ABQA 3ULRB 1JJ2A 3F70A 5GANf 1RI0A 2LNHB 3H41A 3EHRA 1WQ7A 4PNOA 1T3LA 2KYBA 3I55A 3HP9A 4E7ZA 2LQKA 3CCST 2A0FB 1I0CA 2E65A 2RN8A 4PJOA 3FC3A 2JTMA 3E9FA 2ABLA 3H0FA 3D7SB 4K11A 4X1VA 3VS2A 1ZLMA 1VQ8A 2KMTA 2LZ6B 1K4US 2EQKA 1VQKA 1NJIR 4JJCA 3CC4A 4KGZB 4P5NA 1KC8U 5AYFA 1N5ZA 4D8KA 1WHKA 4EMHA 1HD3A 2DEUA 2LQWA 4C0GA 4F7UE 4HT8A 4NL2A 4LD9K 3HSBA 2RJCA 2DXTA 2K3BA 4Y91A 1VQ5T 1N8RC 4RTXA 1X6OA 3GBQA 1KD1U 2ZPFB 2G3RA 3GOXA 2LCSA 1JXMA 4BE0A 2NYSA 1YJNQ 3OYLA 2FZGB 4ELZC 3C94A 3E9GA 2DD5A 2P0PA 2K5FA 5GANd 3JCMf 1Y96B 1GBRA 1KHIA 2RHUA 4HCBA 3EH1A 2W10A 3GNFB 2ESWA 3PNWC 2MAMA 2F5TX 1OU8A 3OYEA 4J9IA 3SB2A 2COWA 2O9SA 1QVGA 1YJWQ 1ABOA 2RQTA 1T0HA 2YUNA 1ZSZC 1X43A 2PQWA 4M75F 2KRSA 5KYUB 2RD1A 2E4HA 2RHIA 1Q81C 3OYFA 1VOMA 2LJ3A 5KYWA 1IXDA 4LDUA 3L2UA 4FT4A 2CP5A 5GAOm 1I4K1 1XJWB 2DL5A 1RACB 3MEWA 4J7IA 4LDXA 1VQ6T 3CCJA 2DX1A 3E1SA 1V1CA 3JCMe 2VB6A 2X4JA 3J7AF 1KQSP 2QDLA 1WJQA 2V8KA 1G83A 2K57A 3O8VA 1QWEA 2P84A 9ATCB 1SRMA 2DTIA 4PJOE 3MP6A 1WDXA 2O31A 2C06A 1UGSB 1BYMA 3CC2Q 2DPPB 2QTVA 2BZ8A 1QVFA 4FYVB 2GTOA 3EGUA 1M30A 2KE9A 1VIFA 4B6MA 4M77C 5L8RE 1Q82C 2DBKA 1YHQQ 1GCQA 5GAOn 3THKA 5GMKi 1VQ6A 4M78E 1VA7A 1RABB 5FRMA 5DLOA 2HNIA 1IRXA 4MMLA 2RA2A 3OYKA 1VQLT 1Q95G 3MPUB 1M1KC 2XMFA 2EQIA 2XKOC 3VYHB 1WHGA 2M0YA 4DA4A 5GANe 3OYJA 1E7OA 2HL3A 1MNDA 3QSUA 3M54A 2KAFA 1IGQA 4OGEA 3V8LA 1JBMA 1JEGA 5GAOp 1KQSA 4RMOA 3I55T 3UA7A 1SG5A 4M75A 2A08A 4MZTA 2DIQA 3X25B 3OY9A 3PFSA 2YWWA 3JRZA 1WXTA 4OMQA 1OZ2A 4PKCC 1BIBA 2X4XA 2XDPA 2GGRA 3VUZA 3PGGA 1XOVA 3QWYA 4F7UB 3JCMW 1PG5B 3VYGA 4LUDA 1AOJA 2KYMA 3INZA 2KI7A 2O9VA 2X9HA 2K79A 3CCVQ 1PD0A 4OB0B 3CCRT 1M5Q1 1GFDA 1JRIA 2V8JA 4IIMA 4EMGA 2A36A 4F14A 4C0FA 1KQSS 1RLPC 2KXDA 1KQ2A 3QPHA 4PJJA 3VKIA 5GAMg 4LD6A 3PMTA 3FLGA 2ZGWA 4C8QC 2M16A 1BU1A 4R56A 5HK0A 4A4EA 3TQ7P 2JS0A 2MPXC 4OMPA 2A3LA 4J6YA 4BDYA 1YJ9A 2F1LA 4ANJA 4C5IA 3RR6A 1IGUA 1NLOC 2X51A 3EFSA 1PNJA 5CKDA 2JMCA 3H9NA 5KCHA 2LT4A 1W6XA 4J9DA 2C0IA 4KBMB 2CGHA 5GAN8 2OTLQ 3C12A 1WA7A 1K9MC 2D1XA 3QDFA 4M78G 2L3QA 2RJFA 3EFOB 2DRMA 1MMAA 1EZZB 3SEMA 4Y28E 3UATA 2XIDA 2RM4A 4XTUA 3OSSC 2NLUA 2QQAA 4M75C 5DM7R 2RI3A 1VQ6Q 3UWNA 4NL3A 4IIOA 1X2KA 4E7JA 4M4ZA 1RAEB 1VQNT 1UHCA 2ECZA 4J9EA 3WVEB 1YHQA 1D1BA 3M4YA 4JZ3A 3QO3A 4M7AG 2P4TA 5CKHA 3M58A 3SWNA 4RG8A 1KIKA 3LH0A 1O9SA 2AKLA 1EX4A 3UF4A 5LJ5d 3FJ5A 1UHFA 4L59A 2FVUA 5CKFA 5C0MA 2HKNA 3U23A 5IAYA 1HJDA 2CYZB 2ZPHB 3URGA 2RK1A 1BCOA 2LX7A 4LDYA 3OYMA 2EKHA 3A5ZB 4QT7A 2RHZA 3G71Q 4LXCA 5GAMe 2X3WD 1ZUKA 2ED1A 3EFOA 1Y57A 2MMPA 1WHMA 4XTXA 4ZN3A 2CZ6B 2LQNA 1SKUB 3A8HB 1ZA1B 2K3YA 3CEYA 2OAUA 3CPWS 5FWCA 3JCMg 1UE9A 1QP3A 5FLXE 5IT9E 2GBQA 2LNVA 3FRNA 2B8AA 2FRYA 3AT1B 2DA9A 3TREA 1LVKA 1IHWA 4DOVA 1YCSB 3HFNA 1SSFA 1UJ0A 1MV0B 3OYYA 1LPLA 2NUTA 2QTXA 3HKSA 4E7IA 1WZOA 1W4SA 3CXCA 3MCAB 2OAWA 4AG2C 2YRCA 2KROA 3GPLA 2BE9B 5KYUA 1YJNT 2DERA 5GANg 1SSHA 3VS5A 3CCRQ 5GAOr 1YJ9Q 1U5SA 1GXIE 2HD0A 2AT1B 2KRNA 4XTZA 3JCMd 4C8QF 2GFUA 5A0GA 3SWNB 4PK4A 2DYIA 4M7DC 4DQ2A 3QBYA 5CKBA 2DIGA 4OF1A 4AMCA 4X9CA 3TSWA 1H3HA 2LC4A 4KRTA 4OB3B 1X01A 2DNUA 3LW5E 3X26B 2RNAA 3ER0A 1KK7A 1YJNA 4QVZA 1RI9A 5EC7A 1VQPA 2JMAA 5IXBA 2K3XA 2FB7A 2VC8A 2FZKB 4XTWA 2MF2A 1M2VB 1NEGA 1I5OB 2OTJT 4C92C 2M9UA 1VQMT 1WI7A 3G71T 2EWNA 1OV3A 2JVVA 3L2QA 4PLLA 3I9QA 2K7AA 3PTAA 1VQOQ 1HSQA 4BY6C 1OPKA 4PJOB 2DL3A 3CXCP 1SHGA 2KY9A 4M7AD 4XTVA 2DILA 1S72Q 4OMFB 3CPWA 3EAEA 2VUBA 3HFOA 1PSFA 1M90C 2EYWA 2X3XD 2RJEA 4CC3A 4LDVA 3KBGA 2VWFA 1WHLA 1QKWA 2IIMA 1PRLC 1VQ7T 5I11A 1IHVA 1VQ5A 1YJWT 2IPOB 4KGVB 3C95A 4RG2A 3BDLA 5GAN6 3R6NA 5FU6C 4M78D 1YIJQ 3KUFA 4J6WA 8ATCB 2P0QA 1QMCA 4M78B 4J83A 4QKUA 2CP7A 1IB8A 1H8KA 3EG9B 3QXEB 3E2UA 5IHIA 4E7SA 1GCPA 1VQLQ 1GCQC 3FDRA 1K1ZA 1PKTA 4MDXA 1Y7XA 4PJOG 3DB3A 2EGCA 2DXBA 1GFCA 3M5AA 5GAMj 4KH0B 5GAMh 4ZGDB 2L0AA 5DY9A 1VUBA 3OA6A 2FZCB 1N8RR 1U06A 4J6XA 1N6AA 2OTJA 1WLPB 4ME7A 1H641 3I55Q 3CQTA 3M0RA 2RPNA 2MOXA 5IHNA 1D1AA 1MMDA 3QIIA 5I2MA 1W70A 2QASA 3X24B 4L5GA 2D0NA 3CC7Q 1U1TA 4A4FA 1KG1A 1K8AC 4A4GA 3ZBDA 2COZA 1ZSZB 3CCMA 2OI3A 3MJXA 1PC0A 2VV5A 3L2WA 3REAB 3RKYA 2X4YA 4CI0C 3I5RA 1K76A 4ZNXA 3MP8A
chains in the Genus database with same CATH topology
4DEXA 4AFUC 1G2BA 1I07A 1G83A 1QWEA 1QWFA 1RUWA 2DL4A 3EG2A 1YNZA 4F16A 4WCIA 1SRMA 2CUBA 4J9BA 2KBTA 1WDXA 2KEAA 2HBWA 2O31A 4LNPA 3VS3A 4ESRA 2HDAA 2HCKA 2BZ8A 1J3TA 2MCNA 5FW9A 1UUEA 2GTOA 3EGUA 5GJVB 1M30A 2KE9A 1X6BA 2RQWA 3M0SA 2MIOA 1BK2A 2DBKA 1K9AA 2JT4A 1GCQA 2BTTA 2VVKA 3THKA 2V1QA 2CREA 1ZUYA 4CC2A 1WXBA 1T3SA 1VA7A 4OMOA 2LJ1A 2K9GA 4RTTA 3VS1A 1ZUUA 2ENMA 2XMFA 2EQIA 3VS7A 1SPKA 1PHTA 1Z9QA 1JXOA 5I22A 2M0YA 1CSKA 1E7OA 3A98A 1IO6A 1OPLA 2DL7A 3PVQA 2EYYA 2K2MA 4CC4B 1JEGA 2GTJA 4J9GA 1U3OA 2KRMA 3UA7A 2G6FX 2NWMA 1M3BA 2A08A 2YUOA 1UECA 2D8HA 1WXTA 4OMQA 4CC7A 1Z9ZA 1X2QA 2J06A 2L3SA 1UJYA 1VYVA 2GGRA 1AZEA 2YSQA 1XOVA 3QWYA 4LUDA 1AOJA 2KYMA 4Z88A 4DEYA 2O9VA 3ZL7C 2K79A 1QCFA 1QLYA 2FRWA 1GFDA 4IIMA 2M51A 4Z8AA 2YT6A 2A36A 4F14A 1OOTA 1RLPC 2KXDA 2KR3A 2KXCA 1SEMA 4RTZA 3M0PA 2RQVA 2YUPA 1ZX6A 1S1NA 3LH5A 1BU1A 5FWBA 2DVJA 1AD5A 3RBBB 2JS0A 3M0TA 4GLMA 1PWTA 4AFSC 2NUZA 4JJBA 2F2WA 4OMPA 3EG0A 1ZSGA 2KGTA 4E6RA 2EGEA 4RTYA 3PVLA 3TSZA 1UTIA 2DE0X 5IXFA 1JO8A 2PZ1A 1NLOC 2RQUA 3JV3A 4LN2A 1PNJA 2JMCA 2EGAA 2ROTA 1W6XA 1VYUA 1YWPA 4J9DA 2C0IA 4F17A 2AK5A 1B07A 3H0HA 1OEBA 1WA7A 4HVUA 2D1XA 2L3QA 2HEQA 2DRMA 4AFZC 1H92A 3SEMA 3UATA 1YWOA 2VKNA 1AZGB 1UDLA 1UG1A 2EBPA 4IIOA 1X2KA 2CUDA 3C0CA 4M4ZA 1UHCA 2ECZA 4J9EA 1M27C 2PTKA 1AWOA 4JZ3A 2K6DA 1CKAA 2SEMA 1KIKA 3H0IA 1JU5C 2AKLA 3UF4A 3FJ5A 1UHFA 1Y0MA 2JXBA 2KT8A 2KT1A 3U23A 3NHNA 1HJDA 2CT4A 2DM1A 1UFFA 5L23A 2LX7A 2GQIA 2KNBB 1W1FA 4D8DA 4A63B 1PRMC 2CT3A 2SRCA 2EKHA 3RNJA 4RUGA 2L3PA 2JW4A 1FMKA 2RQRA 4RTWA 2H8HA 1M8MA 1LCKA 3M0UA 4QT7A 3I5SA 1WX6A 2BZXA 1M3AA 2X3WD 2FPEA 1ZUKA 2ED1A 2PNIA 1Y57A 1T0JA 2EYXA 2JS2A 3VRYA 4J9HA 4OMNA 2LQNA 2DF6A 2DJQA 3NMZC 2L2PA 5FWCA 2DMOA 2ROLA 2FEIA 1UE9A 1NLPC 1RLQC 2CSQA 2EVRA 2F2VA 2DL8A 1TUCA 2GBQA 5IH2A 2W0ZA 1AWJA 2FO0A 2HSPA 3TVTA 2FPFA 2FRYA 2JM9A 1AVZC 2DA9A 2AKKA 2FG0A 4RTUA 1X27A 2A28A 1NEBA 1YCSB 2E5KA 1UJ0A 5ECAA 1ZBJA 1MV0B 1MV3A 2CH4W 2OJ2A 3O5ZA 3EG1A 2EW3A 1X69A 2EPDA 4R0KA 2C0OA 2OAWA 4AG2C 2LMJA 2KROA 4FSSA 1AWXA 3I35A 1CKBA 1AWWA 1PKSA 1SSHA 3VS5A 1KJWA 1NYFA 1TG0A 2O2OA 3REBB 2CH4A 1U5SA 4ORZA 1NYGA 2KRNA 4JZ4A 2JM8A 1WIEA 2DBMA 2FPDA 1EFNA 2P4RA 1VYTA 4J9CA 4Y92A 3TSWA 2EYZA 1H3HA 1KSWA 4KRTA 4AFQC 4JPBW 4HVVA 1GRIA 1SHFA 1M3CA 2AZSA 3EHQA 2DNUA 1MUZA 1NG2A 2CSIA 1YN8A 2J6KA 2RNAA 1RI9A 5EC7A 2C0TA 2JMAA 2RF0A 5IXBA 3QWXX 3VRZA 1WXUA 3PE0A 1GL5A 1NEGA 1FYNA 2GNCA 3EG3A 4HVWA 1B3QA 2J6OA 3NGPA 1ABQA 3SHWA 1WI7A 3ULRB 1OV3A 4JJDA 2LNHB 3H41A 3EHRA 2AZVA 1X6GA 1T3LA 3KFVA 4HCKA 2KYBA 3I9QA 4RTVA 4AG1C 2K7AA 1E6GA 1I0CA 4GBQA 1HSQA 1OPKA 2RN8A 2DL3A 1SHGA 2ABLA 3H0FA 2DILA 4K11A 4X1VA 2DRKA 1ZLMA 3VS2A 1NM7A 1GBQA 2LZ6B 4LUEA 1K4US 1BB9A 2EYWA 4JJCA 2X3XD 4CC3A 1N5ZA 2VWFA 3UA6A 4D8KA 1WYXA 2LP5A 1QKWA 2IIMA 1PRLC 1HD3A 5I11A 1KFZA 1K0XA 2LQWA 1I1JA 5GJWB 2BZYA 1AEYA 1JQQA 3R6NA 3VS6A 2K3BA 2V1RA 2LJ0A 4RTXA 2DYBA 3GBQA 4OMMA 2RMOA 1BBZA 5IHKA 1H8KA 2LCSA 1ARKA 5IHIA 1JXMA 4EIKA 1UGVA 2O88A 3VS4A 1GCPA 1GCQC 3M0QA 1K1ZA 1PKTA 3IQLA 2I0NA 1GBRA 2EGCA 2J7IA 3NPFA 2W10A 2DLPA 2YDLA 1GFCA 2ESWA 2CDTA 4J9IA 2L0AA 2O9SA 1ABOA 4HXJA 2RQTA 4LE9A 1T0HA 2YUNA 3VS0A 1U06A 1X43A 1WLPB 2KRSA 2B86A 2JTEA 3CQTA 4Z89A 2A37A 2J6FA 1K0SA 2F2XA 3M0RA 2LJ3A 2RPNA 2MOXA 2ED0A 5IHNA 1W70A 2D0NA 1QKXA 1WFWA 1A0NB 1TUDA 2DL5A 1E6HA 2OI3A 2YUQA 1YP5A 4OMLA 1SRLA 2D8JA 3REAB 2DX1A 4J9FA 1V1CA 2J05A 3I5RA 5HCKA 1K76A 4ZNXA 2QDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DEX A;  4AFU C;  1G2B A;  1I07 A;  1G83 A;  1QWE A;  1QWF A;  1RUW A;  2DL4 A;  3EG2 A;  1YNZ A;  4F16 A;  4WCI A;  1SRM A;  2CUB A;  4J9B A;  2KBT A;  1WDX A;  2KEA A;  2HBW A;  2O31 A;  4LNP A;  3VS3 A;  4ESR A;  2HDA A;  2HCK A;  2BZ8 A;  1J3T A;  2MCN A;  5FW9 A;  1UUE A;  2GTO A;  3EGU A;  5GJV B;  1M30 A;  2KE9 A;  1X6B A;  2RQW A;  3M0S A;  2MIO A;  1BK2 A;  2DBK A;  1K9A A;  2JT4 A;  1GCQ A;  2BTT A;  2VVK A;  3THK A;  2V1Q A;  2CRE A;  1ZUY A;  4CC2 A;  1WXB A;  1T3S A;  1VA7 A;  4OMO A;  2LJ1 A;  2K9G A;  4RTT A;  3VS1 A;  1ZUU A;  2ENM A;  2XMF A;  2EQI A;  3VS7 A;  1SPK A;  1PHT A;  1Z9Q A;  1JXO A;  5I22 A;  2M0Y A;  1CSK A;  1E7O A;  3A98 A;  1IO6 A;  1OPL A;  2DL7 A;  3PVQ A;  2EYY A;  2K2M A;  4CC4 B;  1JEG A;  2GTJ A;  4J9G A;  1U3O A;  2KRM A;  3UA7 A;  2G6F X;  2NWM A;  1M3B A;  2A08 A;  2YUO A;  1UEC A;  2D8H A;  1WXT A;  4OMQ A;  4CC7 A;  1Z9Z A;  1X2Q A;  2J06 A;  2L3S A;  1UJY A;  1VYV A;  2GGR A;  1AZE A;  2YSQ A;  1XOV A;  3QWY A;  4LUD A;  1AOJ A;  2KYM A;  4Z88 A;  4DEY A;  2O9V A;  3ZL7 C;  2K79 A;  1QCF A;  1QLY A;  2FRW A;  1GFD A;  4IIM A;  2M51 A;  4Z8A A;  2YT6 A;  2A36 A;  4F14 A;  1OOT A;  1RLP C;  2KXD A;  2KR3 A;  2KXC A;  1SEM A;  4RTZ A;  3M0P A;  2RQV A;  2YUP A;  1ZX6 A;  1S1N A;  3LH5 A;  1BU1 A;  5FWB A;  2DVJ A;  1AD5 A;  3RBB B;  2JS0 A;  3M0T A;  4GLM A;  1PWT A;  4AFS C;  2NUZ A;  4JJB A;  2F2W A;  4OMP A;  3EG0 A;  1ZSG A;  2KGT A;  4E6R A;  2EGE A;  4RTY A;  3PVL A;  3TSZ A;  1UTI A;  2DE0 X;  5IXF A;  1JO8 A;  2PZ1 A;  1NLO C;  2RQU A;  3JV3 A;  4LN2 A;  1PNJ A;  2JMC A;  2EGA A;  2ROT A;  1W6X A;  1VYU A;  1YWP A;  4J9D A;  2C0I A;  4F17 A;  2AK5 A;  1B07 A;  3H0H A;  1OEB A;  1WA7 A;  4HVU A;  2D1X A;  2L3Q A;  2HEQ A;  2DRM A;  4AFZ C;  1H92 A;  3SEM A;  3UAT A;  1YWO A;  2VKN A;  1AZG B;  1UDL A;  1UG1 A;  2EBP A;  4IIO A;  1X2K A;  2CUD A;  3C0C A;  4M4Z A;  1UHC A;  2ECZ A;  4J9E A;  1M27 C;  2PTK A;  1AWO A;  4JZ3 A;  2K6D A;  1CKA A;  2SEM A;  1KIK A;  3H0I A;  1JU5 C;  2AKL A;  3UF4 A;  3FJ5 A;  1UHF A;  1Y0M A;  2JXB A;  2KT8 A;  2KT1 A;  3U23 A;  3NHN A;  1HJD A;  2CT4 A;  2DM1 A;  1UFF A;  5L23 A;  2LX7 A;  2GQI A;  2KNB B;  1W1F A;  4D8D A;  4A63 B;  1PRM C;  2CT3 A;  2SRC A;  2EKH A;  3RNJ A;  4RUG A;  2L3P A;  2JW4 A;  1FMK A;  2RQR A;  4RTW A;  2H8H A;  1M8M A;  1LCK A;  3M0U A;  4QT7 A;  3I5S A;  1WX6 A;  2BZX A;  1M3A A;  2X3W D;  2FPE A;  1ZUK A;  2ED1 A;  2PNI A;  1Y57 A;  1T0J A;  2EYX A;  2JS2 A;  3VRY A;  4J9H A;  4OMN A;  2LQN A;  2DF6 A;  2DJQ A;  3NMZ C;  2L2P A;  5FWC A;  2DMO A;  2ROL A;  2FEI A;  1UE9 A;  1NLP C;  1RLQ C;  2CSQ A;  2EVR A;  2F2V A;  2DL8 A;  1TUC A;  2GBQ A;  5IH2 A;  2W0Z A;  1AWJ A;  2FO0 A;  2HSP A;  3TVT A;  2FPF A;  2FRY A;  2JM9 A;  1AVZ C;  2DA9 A;  2AKK A;  2FG0 A;  4RTU A;  1X27 A;  2A28 A;  1NEB A;  1YCS B;  2E5K A;  1UJ0 A;  5ECA A;  1ZBJ A;  1MV0 B;  1MV3 A;  2CH4 W;  2OJ2 A;  3O5Z A;  3EG1 A;  2EW3 A;  1X69 A;  2EPD A;  4R0K A;  2C0O A;  2OAW A;  4AG2 C;  2LMJ A;  2KRO A;  4FSS A;  1AWX A;  3I35 A;  1CKB A;  1AWW A;  1PKS A;  1SSH A;  3VS5 A;  1KJW A;  1NYF A;  1TG0 A;  2O2O A;  3REB B;  2CH4 A;  1U5S A;  4ORZ A;  1NYG A;  2KRN A;  4JZ4 A;  2JM8 A;  1WIE A;  2DBM A;  2FPD A;  1EFN A;  2P4R A;  1VYT A;  4J9C A;  4Y92 A;  3TSW A;  2EYZ A;  1H3H A;  1KSW A;  4KRT A;  4AFQ C;  4JPB W;  4HVV A;  1GRI A;  1SHF A;  1M3C A;  2AZS A;  3EHQ A;  2DNU A;  1MUZ A;  1NG2 A;  2CSI A;  1YN8 A;  2J6K A;  2RNA A;  1RI9 A;  5EC7 A;  2C0T A;  2JMA A;  2RF0 A;  5IXB A;  3QWX X;  3VRZ A;  1WXU A;  3PE0 A;  1GL5 A;  1NEG A;  1FYN A;  2GNC A;  3EG3 A;  4HVW A;  1B3Q A;  2J6O A;  3NGP A;  1ABQ A;  3SHW A;  1WI7 A;  3ULR B;  1OV3 A;  4JJD A;  2LNH B;  3H41 A;  3EHR A;  2AZV A;  1X6G A;  1T3L A;  3KFV A;  4HCK A;  2KYB A;  3I9Q A;  4RTV A;  4AG1 C;  2K7A A;  1E6G A;  1I0C A;  4GBQ A;  1HSQ A;  1OPK A;  2RN8 A;  2DL3 A;  1SHG A;  2ABL A;  3H0F A;  2DIL A;  4K11 A;  4X1V A;  2DRK A;  1ZLM A;  3VS2 A;  1NM7 A;  1GBQ A;  2LZ6 B;  4LUE A;  1K4U S;  1BB9 A;  2EYW A;  4JJC A;  2X3X D;  4CC3 A;  1N5Z A;  2VWF A;  3UA6 A;  4D8K A;  1WYX A;  2LP5 A;  1QKW A;  2IIM A;  1PRL C;  1HD3 A;  5I11 A;  1KFZ A;  1K0X A;  2LQW A;  1I1J A;  5GJW B;  2BZY A;  1AEY A;  1JQQ A;  3R6N A;  3VS6 A;  2K3B A;  2V1R A;  2LJ0 A;  4RTX A;  2DYB A;  3GBQ A;  4OMM A;  2RMO A;  1BBZ A;  5IHK A;  1H8K A;  2LCS A;  1ARK A;  5IHI A;  1JXM A;  4EIK A;  1UGV A;  2O88 A;  3VS4 A;  1GCP A;  1GCQ C;  3M0Q A;  1K1Z A;  1PKT A;  3IQL A;  2I0N A;  1GBR A;  2EGC A;  2J7I A;  3NPF A;  2W10 A;  2DLP A;  2YDL A;  1GFC A;  2ESW A;  2CDT A;  4J9I A;  2L0A A;  2O9S A;  1ABO A;  4HXJ A;  2RQT A;  4LE9 A;  1T0H A;  2YUN A;  3VS0 A;  1U06 A;  1X43 A;  1WLP B;  2KRS A;  2B86 A;  2JTE A;  3CQT A;  4Z89 A;  2A37 A;  2J6F A;  1K0S A;  2F2X A;  3M0R A;  2LJ3 A;  2RPN A;  2MOX A;  2ED0 A;  5IHN A;  1W70 A;  2D0N A;  1QKX A;  1WFW A;  1A0N B;  1TUD A;  2DL5 A;  1E6H A;  2OI3 A;  2YUQ A;  1YP5 A;  4OML A;  1SRL A;  2D8J A;  3REA B;  2DX1 A;  4J9F A;  1V1C A;  2J05 A;  3I5R A;  5HCK A;  1K76 A;  4ZNX A;  2QDL A; 
#chains in the Genus database with same CATH topology
 4DEX A;  1R77 A;  4M77 E;  3MEV A;  1RUW A;  2ATC B;  3GNG A;  2E64 A;  4J9B A;  3VS3 A;  2E6Z A;  4XU3 A;  3JSC A;  1J3T A;  1KC8 R;  4B9W A;  4Q5W A;  2FHD A;  3EFR A;  1VQ4 A;  4C8Q D;  2QXF A;  5KYY B;  4EDU A;  1WNL A;  1K9A A;  5KYY A;  2VVK A;  1W2B S;  2V1Q A;  1FX7 A;  5AT1 B;  4ATO A;  1WXB A;  1T3S A;  4OMO A;  2LJ1 A;  3OMG A;  1G3T A;  2DTH A;  3VS1 A;  4M7A F;  1OYX A;  1ZA2 B;  2DD4 A;  4JLG A;  3OSV A;  3VS7 A;  1M1F A;  1Z9Q A;  1FXX A;  1JXO A;  4JRP A;  1PCX A;  2QQS A;  3S3N A;  2XU8 A;  1CSK A;  3HPW A;  2H3J A;  1OPL A;  1UB4 A;  2V8I A;  3MHX A;  2QEX T;  4E7H A;  4OB2 B;  4E7K A;  4FM4 B;  3SDZ A;  2K5I A;  1MMG A;  5HKC A;  1K8A U;  2KDS A;  3MKD A;  1Q7Y R;  4PFP A;  3V8J A;  1OUL A;  2PUO B;  1X2Q A;  2J06 A;  1D3B A;  2X4W A;  3BW1 A;  3CCS A;  5LJ3 f;  1U8R A;  3QZ5 B;  1ZHI A;  3S3O A;  4FIB A;  3OB9 A;  1PSE A;  2M51 A;  4Z8A A;  4C92 E;  2YT6 A;  3KXT A;  1TXQ A;  1KD1 R;  3RKX A;  4M7A A;  4NS5 A;  1M1G A;  2KR3 A;  2LX9 A;  2KXC A;  4A53 A;  4PJO F;  3OYA A;  4M78 C;  4J8O A;  3M9Q A;  4MZP A;  2EFI A;  2RQV A;  4JRQ A;  2YUP A;  2WSC E;  2P0K A;  1S1N A;  4C0D B;  1VQ5 Q;  4AFS C;  2NUZ A;  1O75 A;  2F2W A;  3G6E Q;  2R5A A;  2ZPB B;  1ACM B;  1ZSG A;  2L3R A;  4E6R A;  2CZ1 B;  4RTY A;  3PVL A;  2VGM A;  3QZ9 B;  1UTI A;  5IXF A;  1JO8 A;  2YXY A;  2RQU A;  4C92 F;  2IG0 A;  4J5Y A;  4ZTJ A;  3OW2 A;  1VYU A;  1YWP A;  3MP1 A;  2RK2 A;  3CCU T;  4DBQ A;  4HVU A;  4OGC A;  3LWI A;  2EJF A;  2BUD A;  5GAO q;  2GCX A;  4C0Z A;  3RMS A;  1UG1 A;  5GAM f;  3GLX A;  2EBP A;  2PVG B;  4PJO D;  2QAZ A;  1AWO A;  4NOY A;  4N0A C;  3CCQ T;  3DB4 A;  3G71 A;  3R6O A;  3SFM A;  3I56 Q;  4E2F B;  2DEQ A;  3CCE A;  2JXB A;  6AT1 B;  5FRN A;  2KT8 A;  2KT1 A;  2BIV A;  4QVC A;  3NHN A;  4M7D B;  2XHC A;  3P8H A;  4M78 A;  1QCO A;  5HK3 A;  2QG9 B;  4PJM A;  4OP0 A;  4D8D A;  1G5V A;  4F7U G;  2CT3 A;  2X35 A;  4M77 B;  3RNJ A;  1Q7Y C;  4RUG A;  2L3P A;  2RQR A;  3G4S A;  2DFU A;  4C8Q G;  3RMQ A;  1WX6 A;  2QQB A;  4J7F A;  3C4S A;  1M90 U;  2E3I A;  4XQ3 A;  3LGF A;  1TSF A;  1OI1 A;  4WF2 A;  3JB9 H;  2R58 A;  2VGN A;  2Z0W A;  2DAQ A;  4LDW A;  3LGL A;  3Q1J A;  1OQK A;  2IVW A;  2K2V A;  2L2P A;  3JB9 F;  1LJO A;  5I21 A;  3QKJ A;  2DMO A;  2FEI A;  2L5Q A;  2QA4 T;  5LJ5 j;  1RLQ C;  1NPP A;  3E19 A;  3BDU A;  2RB6 A;  4JRK A;  1TUC A;  2W0Z A;  1AWJ A;  2HSP A;  5CQY A;  2FPF A;  1UGR B;  5GAN j;  2AKK A;  2QGF B;  3QHS A;  1NEB A;  2E5K A;  4VUB A;  5ECA A;  1YIT T;  1ZBJ A;  5GMK m;  1MV3 A;  2CH4 W;  2CZ0 B;  2EW3 A;  4R0K A;  2DO3 A;  1N9R A;  2C0O A;  5LJ5 g;  3PMI A;  1I5L A;  4FSS A;  1AWX A;  4M7D F;  1QVG P;  1ZQ1 A;  4ORZ A;  1NYG A;  4JZ4 A;  3FEO A;  3TEE A;  2JM8 A;  1WJR A;  2A7Y A;  4HCC A;  2P4R A;  2XI9 A;  4QQ6 A;  3RES A;  2EYZ A;  1KSW A;  3LWH A;  1VQK T;  4JPB W;  4HVV A;  1GRI A;  1YI2 T;  5A0L A;  1MUZ A;  3G6E T;  2J6K A;  5CCA A;  1MNE A;  4C8Q B;  5GAM d;  2C0T A;  4BD3 A;  3QWX X;  2GQV A;  2BE7 D;  5LJ3 g;  1GL5 A;  1FYN A;  1BI3 A;  2GNC A;  2QK0 A;  2MYS A;  3SHW A;  3M57 A;  1BI1 A;  2NUP A;  4JJD A;  1HYO A;  1X6G A;  2AZV A;  3WVD B;  2QQ9 A;  4HCK A;  4JS4 A;  1W2B A;  2CP2 A;  3CMA T;  1XQH A;  3OYG A;  4M7D A;  5GAN 4;  3PIO A;  3JCM c;  1BI0 A;  4GBQ A;  3JB9 D;  4C0D C;  2DTO A;  5CO7 A;  4M77 F;  1VQP Q;  3CCV T;  2GFA A;  2DRK A;  3TCJ A;  3VJP A;  4V2S A;  1GBQ A;  1R0C B;  4LUE A;  2E6N A;  1BB9 A;  1QVF S;  4MZM A;  2LCL A;  4IUU A;  4E7L A;  1WQW A;  3UA6 A;  4M75 D;  2LP5 A;  3CCE Q;  1FMV A;  1RAD B;  5GJW B;  2BZY A;  1AEY A;  1JQQ A;  3ME9 A;  3SD4 A;  8AT1 B;  2DYB A;  4BI4 A;  4JLI A;  4UC4 A;  4EMK B;  4M7D E;  1ARK A;  1TH7 A;  3VS4 A;  4IUV A;  2M0O A;  3HHT B;  2I0N A;  4HA8 A;  2J7I A;  3HRU A;  4YTL A;  2F5K A;  1VQ4 Q;  2JJ9 A;  3CCL T;  2QGG A;  3JB9 G;  4A54 A;  5KCO A;  2JTE A;  3OYD A;  2A37 A;  2J6F A;  2V26 A;  3V7S A;  3CC2 T;  4QQG A;  1Q7Y U;  5GMK l;  2I2L A;  3CCM T;  4KUD K;  4DBH A;  4FL6 A;  2QEX Q;  5CIU A;  1Q81 R;  2DZ9 A;  1WFW A;  1A0N B;  3VUB A;  1D1C A;  1VIE A;  1E6H A;  1FWZ A;  3PT9 A;  4JRI A;  3CCS Q;  2ZPE B;  1KQ1 A;  1YP5 A;  4XK8 E;  2CKK A;  1SRL A;  1TTH B;  3EH2 A;  2D8J A;  3FB9 A;  2AIR B;  2J05 A;  5HCK A;  3OYN A;  2EQJ A;  4GLK A;  4AFU C;  2YLC A;  4F16 A;  4ZGJ B;  5LJ5 e;  1KC8 C;  2KEA A;  2HBW A;  2OTL A;  1V76 A;  4LNP A;  3V8K A;  5GMK j;  2HCK A;  4II1 A;  1DJ7 B;  4BE2 A;  5LL6 S;  2MCN A;  5GJV B;  3CBO A;  1WHJ A;  1BK2 A;  2L89 A;  4M7D D;  2HQX A;  1HK9 A;  1OU9 A;  2BTT A;  2CRE A;  1S72 A;  2R5M A;  2QA4 A;  4M77 D;  1HXD A;  1YBY A;  4QQD A;  1ZUU A;  5FRO A;  1SPK A;  1PHT A;  1EIF A;  5I22 A;  1NE8 A;  5A0D A;  1H3Z A;  5CVI A;  1RAG B;  2WSE E;  1IZ6 A;  1RAF B;  1N27 A;  3CCV A;  1IO6 A;  2DZC A;  3M56 A;  1UGP B;  2DL7 A;  3EGX B;  3PVQ A;  5KYX A;  3GF5 A;  2K2M A;  3UPU A;  4FT2 A;  4CC4 B;  1MHN A;  2GTJ A;  4J9G A;  4E47 A;  3A8O B;  1K9M U;  1VQP T;  2G6F X;  2D9T A;  2NWM A;  2DXC A;  2QA4 Q;  1UEC A;  2ZCF B;  2RHX A;  1Z9Z A;  3OYC A;  4M7D G;  2XG8 D;  3QUI A;  4MMK A;  2H3E B;  3MEA A;  3CCJ T;  4DEY A;  3SWN C;  4A4H A;  1Q82 U;  1QCF A;  1QLY A;  4QW2 A;  4GY5 A;  1YI2 A;  1XNI A;  1G8X A;  1BI2 A;  2D0Q B;  1SEM A;  3L1A A;  3J81 E;  1TS9 A;  2KSS A;  3LH5 A;  4WTO B;  1RAA B;  1R8O B;  3P8B B;  2DVJ A;  1AD5 A;  3RBB B;  3JB9 I;  2O4X B;  1VQM Q;  3CME Q;  2WSF E;  4JJB A;  4MDW A;  1MMN A;  3V7R A;  4B9X A;  2KGT A;  1RAH B;  2EGE A;  4ZTF A;  4C92 A;  4R55 A;  1K73 C;  1VQL A;  2HAX A;  2DE0 X;  1BKB A;  4IUT A;  1VQO T;  2PZ1 A;  2E3H A;  1YI2 Q;  2ROT A;  7AT1 B;  4OB1 B;  2QEX A;  2JOY A;  4F17 A;  5GAN 5;  3ZEH A;  3I56 T;  2K5L A;  3CCR A;  3RDV A;  5J3B A;  1OEB A;  5EG2 A;  2HEQ A;  4M75 G;  4BI8 B;  1N8R U;  1ZBX A;  1YWO A;  1XTD A;  2VKN A;  1I8F A;  4DBR A;  1D0X A;  1UDL A;  1I81 A;  1G3W A;  1PM3 A;  3HL8 A;  2CUD A;  2MI6 A;  5CQX A;  2DVE A;  2PTK A;  2JNG A;  1AHJ B;  2KQW A;  2YRD A;  1Y96 A;  3H0I A;  4HCZ A;  3CCL A;  3M59 A;  3L42 A;  5D6W A;  3NTH A;  2DM1 A;  4PJN A;  1UFF A;  2RI5 A;  4CRI A;  5L23 A;  1P92 A;  1B34 B;  2DK3 A;  3CCQ Q;  4M78 F;  2E10 A;  4QVD A;  2GF7 A;  1W1F A;  3OS2 A;  3NTI A;  4A63 B;  1PRM C;  2SRC A;  3OS0 A;  2JW4 A;  4RTW A;  2H8H A;  4XU2 A;  1VQ8 T;  5KE3 A;  2HL5 C;  3RIR A;  1RL2 A;  3FIF A;  3DLL A;  2PNI A;  1T0J A;  3CBP A;  2HQE A;  1WJS A;  2DJQ A;  3NMZ C;  1Q86 U;  2XDD A;  1KHC A;  2HZY A;  3GP8 A;  4C5E A;  5IH2 A;  2F2V A;  2FO0 A;  3TVT A;  5HY6 A;  4PL6 A;  2JM9 A;  2DKG A;  1AVZ C;  4IUP A;  1F1B B;  5LJ5 f;  5GAO l;  3QJY A;  4RTU A;  1X27 A;  2A28 A;  3EGD B;  4JJN K;  1D3B B;  3O5Z A;  1Y71 A;  2EJ9 A;  2NUT B;  1VQN Q;  3JCM b;  1YIT A;  4DOW A;  5C6S A;  3AHU A;  1LOJ A;  3CCJ Q;  4FU6 A;  3I35 A;  1CKB A;  4BAC A;  2WAC A;  4XAX B;  1QQJ A;  4JDS A;  3OYB A;  3DLM A;  2O2O A;  3REB B;  2CH4 A;  4DBF A;  2OTJ Q;  5CR2 A;  2RI2 A;  2JZ2 A;  3G4S T;  3OS1 A;  3OMC A;  1EFN A;  2PU9 B;  3CCU A;  1B7T A;  1D0Z A;  1VYT A;  4M77 G;  2COY A;  3QJ6 A;  4AFQ C;  2XD0 A;  4KT0 E;  1M3C A;  1QCN A;  2ZZD A;  1NG2 A;  3G1J A;  1YN8 A;  2QI2 A;  2HSE B;  3HTR A;  3MEU A;  1X75 C;  2VXF A;  3CCE T;  5J39 A;  3QG1 A;  5D6Y A;  1UGQ B;  3PE0 A;  1FMW A;  2XIC A;  4HVW A;  4AT1 B;  1B3Q A;  2F69 A;  4N4I A;  3QDR B;  1QW1 A;  5FU7 C;  2EJG A;  1WPY A;  2LDM A;  3KFV A;  2LCC A;  3X20 B;  4JS5 A;  4AG1 C;  4RTV A;  5GAN 2;  1E6G A;  2CS7 A;  4C92 B;  4C5G A;  3CD6 Q;  1K9M R;  1YIJ T;  3CC4 T;  5LJ5 h;  2VYT A;  5LJ3 d;  1NM7 A;  4M77 A;  2EQM A;  2EYQ A;  2R57 A;  4L6V 5;  3S3M A;  3RKW A;  4HKE A;  1WYX A;  1KFZ A;  3NFC A;  3CPF A;  3CCL Q;  1I1J A;  1K0X A;  2LQ8 A;  4RCB A;  3A1P A;  5GMK e;  3GIB A;  2RH2 A;  4F7U A;  3VS6 A;  4IUQ A;  2V1R A;  2LJ0 A;  1VQO A;  1YJ9 T;  2YRV A;  2Y90 A;  4OMM A;  4JUV A;  1NPR A;  3JB9 J;  2RMO A;  1M4Z A;  1BBZ A;  5IHK A;  3OBW A;  1VQ9 T;  5CK9 A;  4EIK A;  3DKM A;  2RJD A;  3LLR A;  1UGV A;  2O88 A;  3M0Q A;  3VV0 A;  3IQL A;  3L2R A;  4C92 G;  3X28 B;  3NPF A;  2ZPG B;  1VQ7 A;  2DLP A;  2YDL A;  4N4H A;  2O4X A;  2OTL T;  3CMA A;  2CDT A;  4EMK C;  1VQ7 Q;  4HXJ A;  4LE9 A;  3VS0 A;  1C6V X;  1Y07 A;  1M9S A;  2B86 A;  4XU0 A;  1IRE B;  4Z89 A;  1QVG S;  1K0S A;  3LYI A;  2XK0 A;  2F2X A;  1K8A R;  3RER A;  1D09 B;  1R0B G;  1OX8 A;  2ED0 A;  2Y4X A;  2KK4 A;  1D0Y A;  1VQ4 T;  4BE1 A;  1QKX A;  1M90 R;  4F7U F;  3N5B B;  1TUD A;  3QYG B;  2EQU A;  2YUQ A;  4OML A;  3FJP A;  1C0M A;  1WHH A;  3UT1 A;  4J9F A;  2KVQ G;  4TVR A;  1M1K R;  1G2B A;  1I07 A;  4PLI A;  4BUG A;  1QWF A;  2DL4 A;  4BI3 A;  3EG2 A;  1M2O A;  2E12 A;  1YNZ A;  5M9O A;  4WCI A;  4A4K A;  2CUB A;  2KBT A;  3TU4 K;  1PD1 A;  1SF9 A;  5LJ3 j;  4ESR A;  2HDA A;  5LJ3 h;  3OS5 A;  5LJ3 e;  3A8G B;  5FW9 A;  1UUE A;  2MWO A;  3MO8 A;  1X6B A;  2RQW A;  3M0S A;  1TUG B;  2MIO A;  3CPW P;  2EIF A;  1BIA A;  2BKD N;  2VXE A;  1U1S A;  3UDC A;  1VQK Q;  2JT4 A;  4EMK A;  3OW2 S;  2XDB A;  4X9D A;  5CAI A;  1V29 B;  1ZUY A;  4CC2 A;  2QQR A;  3BE3 A;  2K9G A;  2L8D A;  4RTT A;  5CKE A;  3H6Z A;  2ENM A;  1YFN A;  4PJL A;  3EGD A;  3CCU Q;  2JN0 A;  1YCY A;  2M02 A;  4FW1 A;  4KUI A;  1YIT Q;  4PFZ A;  4RCC A;  3CD6 A;  1N9S A;  3CBM A;  1YIJ A;  3A98 A;  4O5V A;  2EYY A;  4FYX B;  5D6X A;  1U3O A;  3LX7 A;  5KYN A;  3L2Z A;  3PIP A;  2KRM A;  3CC4 Q;  1M2V A;  4KH1 B;  1M3B A;  2LVM A;  3JAM E;  3VU3 C;  2YUO A;  2D8H A;  4CC7 A;  4BB7 A;  4RKU E;  2L3S A;  1UJY A;  3JCM X;  2HKQ B;  1VYV A;  3CMA Q;  1NBE B;  3ASK A;  1AZE A;  3OYH A;  2YSQ A;  2DXU A;  1RAI B;  4D6W A;  3M55 A;  4Z88 A;  4KUL A;  2DJZ A;  3ZL7 C;  2K4Y A;  3JCM P;  1S72 T;  4FYW B;  2FRW A;  2RO0 A;  2ZAE A;  4M7A B;  2M1H A;  1OOT A;  2PUK B;  3A8L B;  1Q81 U;  4RTZ A;  4HT9 A;  4O6J A;  3M0P A;  3M4G A;  1QVF P;  4OVA A;  1ZX6 A;  1NJI C;  5D7U A;  5FWB A;  4FCY A;  3JCM V;  2FYK A;  2RHY A;  3M0T A;  4GLM A;  1PWT A;  3ZFJ A;  3S6W A;  1LNX A;  4FW2 A;  3EG0 A;  3TSZ A;  2EAY A;  1M1K U;  1B34 A;  3EG9 A;  3JV3 A;  4LN2 A;  1G3Y A;  3NTK A;  3CXC S;  2EGA A;  2HBP A;  1TWB A;  2AK5 A;  4BY6 B;  4M75 B;  2EKO A;  2E1H A;  1B07 A;  3CME T;  3H0H A;  4C8Q E;  4ELY C;  4PJO C;  1KD1 C;  2CP0 A;  4M7A C;  4AFZ C;  1H92 A;  3OYI A;  2JUF A;  1AZG B;  4FYY B;  2CP6 A;  5GAN h;  3JCM J;  3MET A;  1Q86 C;  3C0C A;  3QYH B;  5IN1 A;  1M27 C;  1VQ8 Q;  3CC7 T;  3CC2 A;  2K6D A;  1CKA A;  3HRT A;  1VQ9 A;  5FU6 B;  1QVP A;  2SEM A;  2PVO B;  1JU5 C;  2NUP B;  1OX9 A;  1Y0M A;  5I2S A;  2PVD B;  4F04 B;  2DET A;  2CT4 A;  3M53 A;  3CME A;  2QDY B;  1VQM A;  2CZ7 B;  2GQI A;  2QYZ A;  2KNB B;  1W2B P;  5KE2 A;  3BFM A;  4XTY A;  4BDZ A;  2HMA A;  4X34 A;  4KGX B;  1JJ2 S;  1FMK A;  4FSX A;  1M8M A;  3V7C A;  1LCK A;  3M0U A;  2Y4Y A;  3I5S A;  4C5H A;  1MGQ A;  2BZX A;  3CCM Q;  1M3A A;  2FPE A;  3I56 A;  2HQH A;  1AT1 B;  2EYX A;  2JS2 A;  4PFO A;  3VRY A;  2MWP A;  1K73 U;  3CC7 A;  1M8V A;  4J9H A;  1K73 R;  4OMN A;  3G7Z A;  2E70 A;  2DF6 A;  4N4G A;  2LTO A;  2MK5 A;  1QP2 A;  5DLQ E;  3J80 E;  1YJW A;  2OX7 A;  5FU7 B;  1JB0 E;  4ZGE B;  4C8Q A;  2ROL A;  1NLP C;  1NJI U;  2CSQ A;  2EVR A;  2DL8 A;  1TOV A;  5A2Q E;  2VAS A;  3CD6 T;  3H8Z A;  3L2V A;  3A8M B;  2FG0 A;  1C1A A;  3G4S Q;  1JJ2 P;  3JCM Q;  2YHT A;  4IUR A;  5GMK h;  2LT1 A;  3G6E A;  4ZN1 A;  4N0A A;  3BY7 A;  2E5Q A;  2OJ2 A;  4XU1 A;  3OBY A;  3EG1 A;  3JCM h;  2O01 E;  2E41 A;  1X69 A;  2EPD A;  3WXM B;  3EGX A;  1TU0 B;  5KYX B;  2LMJ A;  1NZ9 A;  3OW2 P;  4M75 E;  2FL7 A;  1UEB A;  1AWW A;  3RUX A;  1PKS A;  1KJW A;  1NYF A;  1TG0 A;  3CCQ A;  5GAN 3;  4EPC A;  5KYW B;  4M7A E;  1VQ9 Q;  2ZPI B;  1WIE A;  2JTF A;  2DBM A;  2FPD A;  4Z02 A;  4J9C A;  3T9N A;  4Y92 A;  1YHQ T;  1BCM A;  2YLB A;  3OQ5 A;  1Q86 R;  1VQN A;  5GAN 7;  1SHF A;  1Q82 R;  2AZS A;  3EHQ A;  4C92 D;  5J26 A;  2CSI A;  2D6F A;  2RF0 A;  2AHJ B;  1WGS A;  4IKF A;  3VRZ A;  1WXU A;  1G3S A;  2CP3 A;  3P8D A;  1OZ3 A;  3HRS A;  3EG3 A;  2LRQ A;  2J6O A;  1ZSZ A;  3NGP A;  5KH6 A;  1ABQ A;  3ULR B;  1JJ2 A;  3F70 A;  5GAN f;  1RI0 A;  2LNH B;  3H41 A;  3EHR A;  1WQ7 A;  4PNO A;  1T3L A;  2KYB A;  3I55 A;  3HP9 A;  4E7Z A;  2LQK A;  3CCS T;  2A0F B;  1I0C A;  2E65 A;  2RN8 A;  4PJO A;  3FC3 A;  2JTM A;  3E9F A;  2ABL A;  3H0F A;  3D7S B;  4K11 A;  4X1V A;  3VS2 A;  1ZLM A;  1VQ8 A;  2KMT A;  2LZ6 B;  1K4U S;  2EQK A;  1VQK A;  1NJI R;  4JJC A;  3CC4 A;  4KGZ B;  4P5N A;  1KC8 U;  5AYF A;  1N5Z A;  4D8K A;  1WHK A;  4EMH A;  1HD3 A;  2DEU A;  2LQW A;  4C0G A;  4F7U E;  4HT8 A;  4NL2 A;  4LD9 K;  3HSB A;  2RJC A;  2DXT A;  2K3B A;  4Y91 A;  1VQ5 T;  1N8R C;  4RTX A;  1X6O A;  3GBQ A;  1KD1 U;  2ZPF B;  2G3R A;  3GOX A;  2LCS A;  1JXM A;  4BE0 A;  2NYS A;  1YJN Q;  3OYL A;  2FZG B;  4ELZ C;  3C94 A;  3E9G A;  2DD5 A;  2P0P A;  2K5F A;  5GAN d;  3JCM f;  1Y96 B;  1GBR A;  1KHI A;  2RHU A;  4HCB A;  3EH1 A;  2W10 A;  3GNF B;  2ESW A;  3PNW C;  2MAM A;  2F5T X;  1OU8 A;  3OYE A;  4J9I A;  3SB2 A;  2COW A;  2O9S A;  1QVG A;  1YJW Q;  1ABO A;  2RQT A;  1T0H A;  2YUN A;  1ZSZ C;  1X43 A;  2PQW A;  4M75 F;  2KRS A;  5KYU B;  2RD1 A;  2E4H A;  2RHI A;  1Q81 C;  3OYF A;  1VOM A;  2LJ3 A;  5KYW A;  1IXD A;  4LDU A;  3L2U A;  4FT4 A;  2CP5 A;  5GAO m;  1I4K 1;  1XJW B;  2DL5 A;  1RAC B;  3MEW A;  4J7I A;  4LDX A;  1VQ6 T;  3CCJ A;  2DX1 A;  3E1S A;  1V1C A;  3JCM e;  2VB6 A;  2X4J A;  3J7A F;  1KQS P;  2QDL A;  1WJQ A;  2V8K A;  1G83 A;  2K57 A;  3O8V A;  1QWE A;  2P84 A;  9ATC B;  1SRM A;  2DTI A;  4PJO E;  3MP6 A;  1WDX A;  2O31 A;  2C06 A;  1UGS B;  1BYM A;  3CC2 Q;  2DPP B;  2QTV A;  2BZ8 A;  1QVF A;  4FYV B;  2GTO A;  3EGU A;  1M30 A;  2KE9 A;  1VIF A;  4B6M A;  4M77 C;  5L8R E;  1Q82 C;  2DBK A;  1YHQ Q;  1GCQ A;  5GAO n;  3THK A;  5GMK i;  1VQ6 A;  4M78 E;  1VA7 A;  1RAB B;  5FRM A;  5DLO A;  2HNI A;  1IRX A;  4MML A;  2RA2 A;  3OYK A;  1VQL T;  1Q95 G;  3MPU B;  1M1K C;  2XMF A;  2EQI A;  2XKO C;  3VYH B;  1WHG A;  2M0Y A;  4DA4 A;  5GAN e;  3OYJ A;  1E7O A;  2HL3 A;  1MND A;  3QSU A;  3M54 A;  2KAF A;  1IGQ A;  4OGE A;  3V8L A;  1JBM A;  1JEG A;  5GAO p;  1KQS A;  4RMO A;  3I55 T;  3UA7 A;  1SG5 A;  4M75 A;  2A08 A;  4MZT A;  2DIQ A;  3X25 B;  3OY9 A;  3PFS A;  2YWW A;  3JRZ A;  1WXT A;  4OMQ A;  1OZ2 A;  4PKC C;  1BIB A;  2X4X A;  2XDP A;  2GGR A;  3VUZ A;  3PGG A;  1XOV A;  3QWY A;  4F7U B;  3JCM W;  1PG5 B;  3VYG A;  4LUD A;  1AOJ A;  2KYM A;  3INZ A;  2KI7 A;  2O9V A;  2X9H A;  2K79 A;  3CCV Q;  1PD0 A;  4OB0 B;  3CCR T;  1M5Q 1;  1GFD A;  1JRI A;  2V8J A;  4IIM A;  4EMG A;  2A36 A;  4F14 A;  4C0F A;  1KQS S;  1RLP C;  2KXD A;  1KQ2 A;  3QPH A;  4PJJ A;  3VKI A;  5GAM g;  4LD6 A;  3PMT A;  3FLG A;  2ZGW A;  4C8Q C;  2M16 A;  1BU1 A;  4R56 A;  5HK0 A;  4A4E A;  3TQ7 P;  2JS0 A;  2MPX C;  4OMP A;  2A3L A;  4J6Y A;  4BDY A;  1YJ9 A;  2F1L A;  4ANJ A;  4C5I A;  3RR6 A;  1IGU A;  1NLO C;  2X51 A;  3EFS A;  1PNJ A;  5CKD A;  2JMC A;  3H9N A;  5KCH A;  2LT4 A;  1W6X A;  4J9D A;  2C0I A;  4KBM B;  2CGH A;  5GAN 8;  2OTL Q;  3C12 A;  1WA7 A;  1K9M C;  2D1X A;  3QDF A;  4M78 G;  2L3Q A;  2RJF A;  3EFO B;  2DRM A;  1MMA A;  1EZZ B;  3SEM A;  4Y28 E;  3UAT A;  2XID A;  2RM4 A;  4XTU A;  3OSS C;  2NLU A;  2QQA A;  4M75 C;  5DM7 R;  2RI3 A;  1VQ6 Q;  3UWN A;  4NL3 A;  4IIO A;  1X2K A;  4E7J A;  4M4Z A;  1RAE B;  1VQN T;  1UHC A;  2ECZ A;  4J9E A;  3WVE B;  1YHQ A;  1D1B A;  3M4Y A;  4JZ3 A;  3QO3 A;  4M7A G;  2P4T A;  5CKH A;  3M58 A;  3SWN A;  4RG8 A;  1KIK A;  3LH0 A;  1O9S A;  2AKL A;  1EX4 A;  3UF4 A;  5LJ5 d;  3FJ5 A;  1UHF A;  4L59 A;  2FVU A;  5CKF A;  5C0M A;  2HKN A;  3U23 A;  5IAY A;  1HJD A;  2CYZ B;  2ZPH B;  3URG A;  2RK1 A;  1BCO A;  2LX7 A;  4LDY A;  3OYM A;  2EKH A;  3A5Z B;  4QT7 A;  2RHZ A;  3G71 Q;  4LXC A;  5GAM e;  2X3W D;  1ZUK A;  2ED1 A;  3EFO A;  1Y57 A;  2MMP A;  1WHM A;  4XTX A;  4ZN3 A;  2CZ6 B;  2LQN A;  1SKU B;  3A8H B;  1ZA1 B;  2K3Y A;  3CEY A;  2OAU A;  3CPW S;  5FWC A;  3JCM g;  1UE9 A;  1QP3 A;  5FLX E;  5IT9 E;  2GBQ A;  2LNV A;  3FRN A;  2B8A A;  2FRY A;  3AT1 B;  2DA9 A;  3TRE A;  1LVK A;  1IHW A;  4DOV A;  1YCS B;  3HFN A;  1SSF A;  1UJ0 A;  1MV0 B;  3OYY A;  1LPL A;  2NUT A;  2QTX A;  3HKS A;  4E7I A;  1WZO A;  1W4S A;  3CXC A;  3MCA B;  2OAW A;  4AG2 C;  2YRC A;  2KRO A;  3GPL A;  2BE9 B;  5KYU A;  1YJN T;  2DER A;  5GAN g;  1SSH A;  3VS5 A;  3CCR Q;  5GAO r;  1YJ9 Q;  1U5S A;  1GXI E;  2HD0 A;  2AT1 B;  2KRN A;  4XTZ A;  3JCM d;  4C8Q F;  2GFU A;  5A0G A;  3SWN B;  4PK4 A;  2DYI A;  4M7D C;  4DQ2 A;  3QBY A;  5CKB A;  2DIG A;  4OF1 A;  4AMC A;  4X9C A;  3TSW A;  1H3H A;  2LC4 A;  4KRT A;  4OB3 B;  1X01 A;  2DNU A;  3LW5 E;  3X26 B;  2RNA A;  3ER0 A;  1KK7 A;  1YJN A;  4QVZ A;  1RI9 A;  5EC7 A;  1VQP A;  2JMA A;  5IXB A;  2K3X A;  2FB7 A;  2VC8 A;  2FZK B;  4XTW A;  2MF2 A;  1M2V B;  1NEG A;  1I5O B;  2OTJ T;  4C92 C;  2M9U A;  1VQM T;  1WI7 A;  3G71 T;  2EWN A;  1OV3 A;  2JVV A;  3L2Q A;  4PLL A;  3I9Q A;  2K7A A;  3PTA A;  1VQO Q;  1HSQ A;  4BY6 C;  1OPK A;  4PJO B;  2DL3 A;  3CXC P;  1SHG A;  2KY9 A;  4M7A D;  4XTV A;  2DIL A;  1S72 Q;  4OMF B;  3CPW A;  3EAE A;  2VUB A;  3HFO A;  1PSF A;  1M90 C;  2EYW A;  2X3X D;  2RJE A;  4CC3 A;  4LDV A;  3KBG A;  2VWF A;  1WHL A;  1QKW A;  2IIM A;  1PRL C;  1VQ7 T;  5I11 A;  1IHV A;  1VQ5 A;  1YJW T;  2IPO B;  4KGV B;  3C95 A;  4RG2 A;  3BDL A;  5GAN 6;  3R6N A;  5FU6 C;  4M78 D;  1YIJ Q;  3KUF A;  4J6W A;  8ATC B;  2P0Q A;  1QMC A;  4M78 B;  4J83 A;  4QKU A;  2CP7 A;  1IB8 A;  1H8K A;  3EG9 B;  3QXE B;  3E2U A;  5IHI A;  4E7S A;  1GCP A;  1VQL Q;  1GCQ C;  3FDR A;  1K1Z A;  1PKT A;  4MDX A;  1Y7X A;  4PJO G;  3DB3 A;  2EGC A;  2DXB A;  1GFC A;  3M5A A;  5GAM j;  4KH0 B;  5GAM h;  4ZGD B;  2L0A A;  5DY9 A;  1VUB A;  3OA6 A;  2FZC B;  1N8R R;  1U06 A;  4J6X A;  1N6A A;  2OTJ A;  1WLP B;  4ME7 A;  1H64 1;  3I55 Q;  3CQT A;  3M0R A;  2RPN A;  2MOX A;  5IHN A;  1D1A A;  1MMD A;  3QII A;  5I2M A;  1W70 A;  2QAS A;  3X24 B;  4L5G A;  2D0N A;  3CC7 Q;  1U1T A;  4A4F A;  1KG1 A;  1K8A C;  4A4G A;  3ZBD A;  2COZ A;  1ZSZ B;  3CCM A;  2OI3 A;  3MJX A;  1PC0 A;  2VV5 A;  3L2W A;  3REA B;  3RKY A;  2X4Y A;  4CI0 C;  3I5R A;  1K76 A;  4ZNX A;  3MP8 A; 
#chains in the Genus database with same CATH homology
 4DEX A;  4AFU C;  1G2B A;  1I07 A;  1G83 A;  1QWE A;  1QWF A;  1RUW A;  2DL4 A;  3EG2 A;  1YNZ A;  4F16 A;  4WCI A;  1SRM A;  2CUB A;  4J9B A;  2KBT A;  1WDX A;  2KEA A;  2HBW A;  2O31 A;  4LNP A;  3VS3 A;  4ESR A;  2HDA A;  2HCK A;  2BZ8 A;  1J3T A;  2MCN A;  5FW9 A;  1UUE A;  2GTO A;  3EGU A;  5GJV B;  1M30 A;  2KE9 A;  1X6B A;  2RQW A;  3M0S A;  2MIO A;  1BK2 A;  2DBK A;  1K9A A;  2JT4 A;  1GCQ A;  2BTT A;  2VVK A;  3THK A;  2V1Q A;  2CRE A;  1ZUY A;  4CC2 A;  1WXB A;  1T3S A;  1VA7 A;  4OMO A;  2LJ1 A;  2K9G A;  4RTT A;  3VS1 A;  1ZUU A;  2ENM A;  2XMF A;  2EQI A;  3VS7 A;  1SPK A;  1PHT A;  1Z9Q A;  1JXO A;  5I22 A;  2M0Y A;  1CSK A;  1E7O A;  3A98 A;  1IO6 A;  1OPL A;  2DL7 A;  3PVQ A;  2EYY A;  2K2M A;  4CC4 B;  1JEG A;  2GTJ A;  4J9G A;  1U3O A;  2KRM A;  3UA7 A;  2G6F X;  2NWM A;  1M3B A;  2A08 A;  2YUO A;  1UEC A;  2D8H A;  1WXT A;  4OMQ A;  4CC7 A;  1Z9Z A;  1X2Q A;  2J06 A;  2L3S A;  1UJY A;  1VYV A;  2GGR A;  1AZE A;  2YSQ A;  1XOV A;  3QWY A;  4LUD A;  1AOJ A;  2KYM A;  4Z88 A;  4DEY A;  2O9V A;  3ZL7 C;  2K79 A;  1QCF A;  1QLY A;  2FRW A;  1GFD A;  4IIM A;  2M51 A;  4Z8A A;  2YT6 A;  2A36 A;  4F14 A;  1OOT A;  1RLP C;  2KXD A;  2KR3 A;  2KXC A;  1SEM A;  4RTZ A;  3M0P A;  2RQV A;  2YUP A;  1ZX6 A;  1S1N A;  3LH5 A;  1BU1 A;  5FWB A;  2DVJ A;  1AD5 A;  3RBB B;  2JS0 A;  3M0T A;  4GLM A;  1PWT A;  4AFS C;  2NUZ A;  4JJB A;  2F2W A;  4OMP A;  3EG0 A;  1ZSG A;  2KGT A;  4E6R A;  2EGE A;  4RTY A;  3PVL A;  3TSZ A;  1UTI A;  2DE0 X;  5IXF A;  1JO8 A;  2PZ1 A;  1NLO C;  2RQU A;  3JV3 A;  4LN2 A;  1PNJ A;  2JMC A;  2EGA A;  2ROT A;  1W6X A;  1VYU A;  1YWP A;  4J9D A;  2C0I A;  4F17 A;  2AK5 A;  1B07 A;  3H0H A;  1OEB A;  1WA7 A;  4HVU A;  2D1X A;  2L3Q A;  2HEQ A;  2DRM A;  4AFZ C;  1H92 A;  3SEM A;  3UAT A;  1YWO A;  2VKN A;  1AZG B;  1UDL A;  1UG1 A;  2EBP A;  4IIO A;  1X2K A;  2CUD A;  3C0C A;  4M4Z A;  1UHC A;  2ECZ A;  4J9E A;  1M27 C;  2PTK A;  1AWO A;  4JZ3 A;  2K6D A;  1CKA A;  2SEM A;  1KIK A;  3H0I A;  1JU5 C;  2AKL A;  3UF4 A;  3FJ5 A;  1UHF A;  1Y0M A;  2JXB A;  2KT8 A;  2KT1 A;  3U23 A;  3NHN A;  1HJD A;  2CT4 A;  2DM1 A;  1UFF A;  5L23 A;  2LX7 A;  2GQI A;  2KNB B;  1W1F A;  4D8D A;  4A63 B;  1PRM C;  2CT3 A;  2SRC A;  2EKH A;  3RNJ A;  4RUG A;  2L3P A;  2JW4 A;  1FMK A;  2RQR A;  4RTW A;  2H8H A;  1M8M A;  1LCK A;  3M0U A;  4QT7 A;  3I5S A;  1WX6 A;  2BZX A;  1M3A A;  2X3W D;  2FPE A;  1ZUK A;  2ED1 A;  2PNI A;  1Y57 A;  1T0J A;  2EYX A;  2JS2 A;  3VRY A;  4J9H A;  4OMN A;  2LQN A;  2DF6 A;  2DJQ A;  3NMZ C;  2L2P A;  5FWC A;  2DMO A;  2ROL A;  2FEI A;  1UE9 A;  1NLP C;  1RLQ C;  2CSQ A;  2EVR A;  2F2V A;  2DL8 A;  1TUC A;  2GBQ A;  5IH2 A;  2W0Z A;  1AWJ A;  2FO0 A;  2HSP A;  3TVT A;  2FPF A;  2FRY A;  2JM9 A;  1AVZ C;  2DA9 A;  2AKK A;  2FG0 A;  4RTU A;  1X27 A;  2A28 A;  1NEB A;  1YCS B;  2E5K A;  1UJ0 A;  5ECA A;  1ZBJ A;  1MV0 B;  1MV3 A;  2CH4 W;  2OJ2 A;  3O5Z A;  3EG1 A;  2EW3 A;  1X69 A;  2EPD A;  4R0K A;  2C0O A;  2OAW A;  4AG2 C;  2LMJ A;  2KRO A;  4FSS A;  1AWX A;  3I35 A;  1CKB A;  1AWW A;  1PKS A;  1SSH A;  3VS5 A;  1KJW A;  1NYF A;  1TG0 A;  2O2O A;  3REB B;  2CH4 A;  1U5S A;  4ORZ A;  1NYG A;  2KRN A;  4JZ4 A;  2JM8 A;  1WIE A;  2DBM A;  2FPD A;  1EFN A;  2P4R A;  1VYT A;  4J9C A;  4Y92 A;  3TSW A;  2EYZ A;  1H3H A;  1KSW A;  4KRT A;  4AFQ C;  4JPB W;  4HVV A;  1GRI A;  1SHF A;  1M3C A;  2AZS A;  3EHQ A;  2DNU A;  1MUZ A;  1NG2 A;  2CSI A;  1YN8 A;  2J6K A;  2RNA A;  1RI9 A;  5EC7 A;  2C0T A;  2JMA A;  2RF0 A;  5IXB A;  3QWX X;  3VRZ A;  1WXU A;  3PE0 A;  1GL5 A;  1NEG A;  1FYN A;  2GNC A;  3EG3 A;  4HVW A;  1B3Q A;  2J6O A;  3NGP A;  1ABQ A;  3SHW A;  1WI7 A;  3ULR B;  1OV3 A;  4JJD A;  2LNH B;  3H41 A;  3EHR A;  2AZV A;  1X6G A;  1T3L A;  3KFV A;  4HCK A;  2KYB A;  3I9Q A;  4RTV A;  4AG1 C;  2K7A A;  1E6G A;  1I0C A;  4GBQ A;  1HSQ A;  1OPK A;  2RN8 A;  2DL3 A;  1SHG A;  2ABL A;  3H0F A;  2DIL A;  4K11 A;  4X1V A;  2DRK A;  1ZLM A;  3VS2 A;  1NM7 A;  1GBQ A;  2LZ6 B;  4LUE A;  1K4U S;  1BB9 A;  2EYW A;  4JJC A;  2X3X D;  4CC3 A;  1N5Z A;  2VWF A;  3UA6 A;  4D8K A;  1WYX A;  2LP5 A;  1QKW A;  2IIM A;  1PRL C;  1HD3 A;  5I11 A;  1KFZ A;  1K0X A;  2LQW A;  1I1J A;  5GJW B;  2BZY A;  1AEY A;  1JQQ A;  3R6N A;  3VS6 A;  2K3B A;  2V1R A;  2LJ0 A;  4RTX A;  2DYB A;  3GBQ A;  4OMM A;  2RMO A;  1BBZ A;  5IHK A;  1H8K A;  2LCS A;  1ARK A;  5IHI A;  1JXM A;  4EIK A;  1UGV A;  2O88 A;  3VS4 A;  1GCP A;  1GCQ C;  3M0Q A;  1K1Z A;  1PKT A;  3IQL A;  2I0N A;  1GBR A;  2EGC A;  2J7I A;  3NPF A;  2W10 A;  2DLP A;  2YDL A;  1GFC A;  2ESW A;  2CDT A;  4J9I A;  2L0A A;  2O9S A;  1ABO A;  4HXJ A;  2RQT A;  4LE9 A;  1T0H A;  2YUN A;  3VS0 A;  1U06 A;  1X43 A;  1WLP B;  2KRS A;  2B86 A;  2JTE A;  3CQT A;  4Z89 A;  2A37 A;  2J6F A;  1K0S A;  2F2X A;  3M0R A;  2LJ3 A;  2RPN A;  2MOX A;  2ED0 A;  5IHN A;  1W70 A;  2D0N A;  1QKX A;  1WFW A;  1A0N B;  1TUD A;  2DL5 A;  1E6H A;  2OI3 A;  2YUQ A;  1YP5 A;  4OML A;  1SRL A;  2D8J A;  3REA B;  2DX1 A;  4J9F A;  1V1C A;  2J05 A;  3I5R A;  5HCK A;  1K76 A;  4ZNX A;  2QDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...