4HVWA

Crystal structure of the t98e c-src-sh3 domain mutant in complex with the high affinity peptide vsl12
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
GSHMTFVALYDYESRTEEDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic resolution structures of the c-Src SH3 domain in complex with two high-affinity peptides from classes I and II.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Signaling protein/peptide
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 9
structure length 61
sequence length 61
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4hvwA00
4J9EA 1BB9A 1U06A 1UJYA 4J9IA 2DL3A 1UECA 2F2WA 4HVWA 1HD3A 1S1NA 1M27C 1RI9A 3EHQA 3TSZA 1G2BA 2AZVA 3PVQA 4LN2A 4CC7A 1ZUUA 5I11A 4LUEA 1NEBA 3EG0A 2VKNA 3M0UA 4HXJA 2FPEA 3VS7A 2LNHB 4AG2C 2J05A 2K79A 2D0NA 3VRYA 2ECZA 3REAB 2ED1A 2M51A 1UFFA 1SEMA 2L3PA 2DYBA 1RUWA 2LCSA 2EYWA 3SEMA 1OEBA 2AKKA 1X2QA 1K76A 2D1XA 3QWXX 3H41A 2EYYA 1U5SA 2RQRA 3THKA 4FSSA 2SEMA 3M0RA 2CH4W 1PKTA 3RBBB 2NUZA 4JJBA 4DEXA 2JM9A 1GFDA 2GNCA 2LQWA 4CC2A 5IHNA 2O9VA 1HSQA 1I07A 2YSQA 1K0SA 4LUDA 1X2KA 1K9AA 2A28A 1TG0A 2J6OA 2EKHA 4AFUC 2KROA 4JZ3A 3NGPA 3M0TA 4LE9A 4OMQA 2I0NA 1W1FA 2LP5A 2RQUA 1NYGA 2ENMA 5GJVB 4Z89A 3C0CA 1ZX6A 2DLPA 1EFNA 4KRTA 1K1ZA 4K11A 4ESRA 2X3WD 4F16A 4J9GA 1J3TA 2DMOA 1M3BA 4J9HA 2DBKA 1RLQC 4Z8AA 2G6FX 2KNBB 3GBQA 2MCNA 2DX1A 3A98A 2ABLA 2FPFA 2DE0X 2K9GA 3ULRB 2KYBA 2FEIA 3VS0A 2O88A 1KJWA 2VVKA 4RTXA 1T3LA 1VYVA 1WDXA 2EGAA 2AK5A 3CQTA 1ZBJA 4LNPA 2B86A 1JXMA 2HEQA 1BU1A 2A37A 1E6HA 2RQTA 1M3CA 2DRKA 2YUQA 2CUBA 4ORZA 1WX6A 3VRZA 1MV0B 3ZL7C 1UHCA 1ZUYA 2L3SA 2GGRA 2CT3A 4JZ4A 2BZ8A 1X27A 2JW4A 4RTUA 3NHNA 3PE0A 1NLPC 2F2VA 2W0ZA 3VS3A 2EW3A 2KXCA 2DF6A 1WXBA 2CUDA 4X1VA 1LCKA 4AFSC 5IH2A 1NM7A 1MV3A 3I35A 3EG2A 1CKBA 1YN8A 2PTKA 1VA7A 1GCQA 2E5KA 1SRMA 2DRMA 1Z9ZA 2OI3A 2KE9A 1K0XA 3O5ZA 4ZNXA 4D8DA 4HVUA 1A0NB 1M30A 2D8JA 2ED0A 2LJ3A 3R6NA 2DL5A 1JO8A 1SRLA 4D8KA 4Y92A 1BBZA 2PZ1A 1JU5C 4E6RA 2DVJA 1WXTA 1HJDA 1RLPC 1QCFA 2QDLA 1YWOA 1YP5A 2ROLA 2LMJA 1MUZA 2AKLA 4IIMA 3KFVA 3VS6A 1UHFA 2RNAA 2DL4A 1W6XA 2HSPA 1AVZC 1TUDA 2VWFA 1QWFA 2EYZA 1WLPB 4RTTA 2A08A 4Z88A 5IHIA 5HCKA 3PVLA 1SHFA 1AOJA 2L0AA 3LH5A 1YWPA 1KSWA 1AZGB 1XOVA 2O2OA 2KBTA 4M4ZA 3UF4A 2DJQA 2P4RA 2GTOA 2KEAA 2GQIA 2RN8A 1WXUA 5FWBA 2PNIA 3UA7A 1V1CA 3NMZC 2HCKA 4HVVA 2IIMA 2RQVA 1AWJA 1KIKA 2CDTA 5EC7A 2JMCA 2HDAA 4AFQC 1B3QA 2GTJA 1NYFA 2KT1A 4AFZC 2YUNA 3FJ5A 2RMOA 4IIOA 1E6GA 1T0JA 2M0YA 2KR3A 1WYXA 2DM1A 3EGUA 2CSIA 1T0HA 1E7OA 2FRWA 2LX7A 1N5ZA 1PWTA 2K7AA 4AG1C 5ECAA 4RTZA 3REBB 1GL5A 1SPKA 2J6KA 1I1JA 1QKXA 2DA9A 2JS0A 3TVTA 4OMMA 2ROTA 1KFZA 2ESWA 1UGVA 4JJCA 4OMPA 1OPLA 1QLYA 1ABQA 2DILA 1OOTA 2YUPA 2BZXA 3JV3A 1JQQA 3M0PA 1UTIA 2EYXA 2LJ1A 1IO6A 1YNZA 4R0KA 4F14A 1VYUA 2KYMA 1SSHA 2CH4A 1H3HA 1AEYA 5GJWB 5IXFA 2W10A 2KT8A 1GRIA 2EBPA 4RTWA 1M3AA 2DBMA 3VS5A 2SRCA 2O31A 1WFWA 3SHWA 3U23A 2GBQA 4A63B 1OV3A 2FO0A 3H0IA 4F17A 1AWWA 2L3QA 3I5SA 3VS2A 4GBQA 2A36A 2NWMA 4DEYA 1H8KA 1UUEA 2J06A 2JMAA 5FW9A 4HCKA 4J9DA 1FYNA 1ZSGA 2C0TA 2K6DA 3TSWA 1GFCA 4RTYA 1H92A 1W70A 2LJ0A 2EPDA 1AD5A 1ABOA 4OMOA 2CSQA 2JS2A 1AWXA 1X6BA 2J6FA 3I5RA 2YT6A 2O9SA 1GCQC 1U3OA 4J9CA 2LQNA 2KRMA 2KRSA 4JJDA 2JTEA 1NEGA 2OJ2A 5L23A 2JXBA 4CC4B 1QWEA 4EIKA 1Z9QA 4J9BA 1JEGA 1PKSA 2EGEA 1PRLC 1WA7A 1GCPA 3EHRA 2DL8A 2RQWA 3I9QA 5I22A 3M0QA 2HBWA 1I0CA 2MOXA 3UATA 1NG2A 1UG1A 2FG0A 2JM8A 4JPBW 1X6GA 4WCIA 1ZUKA 2EQIA 4RUGA 1Y57A 1GBRA 1PRMC 1ZLMA 5FWCA 4J9FA 1YCSB 3UA6A 1OPKA 5IXBA 2C0IA 4RTVA 3H0FA 2X3XD 1CSKA 3H0HA 3VS1A 1Y0MA 3VS4A 2EGCA 1AZEA 5IHKA 1X43A 2OAWA 2V1RA 3EG3A 2EVRA 2F2XA 2BTTA 2KXDA 4GLMA 2YUOA 1UE9A 2RPNA 2CREA 2FRYA 4CC3A 1VYTA 1SHGA 2BZYA 2DL7A 2XMFA 1TUCA 4OMLA 1JXOA 1UJ0A 2CT4A 3M0SA 3QWYA 2K2MA 2C0OA 1G83A 2DNUA 1M8MA 4OMNA 2MIOA 2RF0A 2H8HA 1B07A 1PHTA 1T3SA 2AZSA 3RNJA 3NPFA 1FMKA 1X69A 2J7IA 1ARKA 1K4US 3EG1A 1WIEA 2L2PA 2D8HA 4QT7A 2V1QA 1QKWA 3IQLA 1GBQA 2YDLA 1CKAA 1UDLA 1PNJA 1WI7A 1NLOC 2K3BA 1AWOA 2LZ6B 2FPDA 2KGTA 1BK2A 2JT4A 2KRNA
chains in the Genus database with same CATH superfamily
3WVEB 1OU9A 1RAGB 1BI1A 2EJ9A 3EH2A 4HCBA 1ZSZA 1UECA 3CPWA 1YJWA 1JJ2P 4M78A 5GAN7 1HD3A 1M27C 5C0MA 1QCNA 4F7UA 3EG0A 2VKNA 1Y7XA 4PJOD 4M7DA 3VS7A 1N9SA 3LW5E 1SKUB 3MP8A 1G3SA 3REAB 3UT1A 3CCUA 2M51A 1UFFA 3HTRA 2EYWA 1VQMT 1G3TA 5KE3A 1M9SA 2R58A 1K76A 3ZFJA 4JRQA 4LD9K 1BI3A 1K8AC 3H41A 1WJSA 4X9CA 1VQNQ 2DXTA 4CI0C 3M0RA 1PKTA 2LCLA 3J7AF 4RCCA 1OULA 5D6YA 2O9VA 3EFOA 2OTJT 5LJ5f 3JAME 1HSQA 3QZ5B 3CPWS 1VQNT 2A28A 1I4K1 2CZ6B 2OX7A 3L1AA 4BACA 3EAEA 3CMAT 4BE2A 3NGPA 3M54A 5L8RE 3CCET 1WHMA 1ACMB 1IZ6A 2M1HA 1RAEB 5GJVB 2D0QB 5GMKi 3QKJA 4E47A 4LDVA 1QP3A 3CBOA 4K11A 4BDZA 5GAN8 1Q86C 3CCVQ 3CCLQ 2M0OA 4F7UB 4QVZA 1M3BA 5KYYA 1RLQC 2G6FX 3G6EQ 3JCMe 5LJ3h 1QW1A 3FDRA 3N5BB 1H641 4XQ3A 2KYBA 2XDBA 2ZAEA 1Q82C 3GOXA 1KJWA 4RTXA 1YITT 4BD3A 2JOYA 2RHIA 4OGCA 3CC4A 4TVRA 2MWPA 4C0DB 1ZSZB 2YLCA 3QXEB 1WPYA 3CQTA 1TWBA 4LNPA 2B86A 1JXMA 2HEQA 4M77F 2QQRA 3VRZA 1SG5A 3TCJA 4ZGDB 2GGRA 2CT3A 9ATCB 2VASA 2BZ8A 2JW4A 3NHNA 3OYDA 1PM3A 3M4YA 4KULA 2DF6A 5GAN6 2YLBA 5I2MA 4AFSC 3S3NA 5IH2A 1MHNA 3CCEA 1NM7A 3ASKA 1KHCA 4M77D 4PL6A 1M90U 1VA7A 2E5KA 4C92B 1U8RA 2HQXA 2DRMA 2OI3A 5CKDA 1K0XA 3O5ZA 1D0YA 2QTXA 4HVUA 2HAXA 4M7DF 4L6V5 3OYYA 2ED0A 4C92G 2LJ3A 2NUTA 4EDUA 3CC2A 2OTJQ 4MDXA 1SRLA 2V26A 2PZ1A 2DEUA 2V8IA 1M90R 1TXQA 1K8AR 1AVZC 2VWFA 3X20B 3OW2P 1QWFA 2EYZA 4RTTA 3CCLA 2DTIA 2L3RA 3CXCP 4GY5A 1S72Q 3SWNC 3PVLA 2L0AA 3LH5A 3HL8A 4M4ZA 1KC8U 2DFUA 1ZQ1A 1VQ5T 3G6EA 1Q81R 2KEAA 2ZPFB 3MJXA 5FWBA 2PNIA 1VQ7A 1WHJA 4BI4A 3SDZA 3M53A 1V1CA 3NMZC 4C5EA 4R56A 5KYNA 1KIKA 1VQ6A 2CZ1B 2HMAA 2YHTA 2HSEB 3CPFA 4AFQC 1PD0A 4MZPA 1NYFA 4OB0B 2HL5C 4JRIA 1T0JA 2M0YA 1VQ6Q 3SFMA 1M90C 1VQNA 2QQ9A 2CSIA 1E7OA 2FRWA 2K7AA 4AG1C 1WZOA 3REBB 4C0ZA 2LQ8A 5A0DA 1QKXA 3CCUQ 3QHSA 3EFSA 2RJCA 2ROTA 4LDWA 2BKDN 4OP0A 1OPLA 3E9GA 5GAMf 1OOTA 4JLGA 2QQAA 1JQQA 2KAFA 3V8KA 2LJ1A 3SWNB 1VQOA 4M77A 1IO6A 5LL6S 4R0KA 2QA4Q 3VUBA 2XD0A 4PFOA 4GLKA 1AEYA 4WF2A 5GJWB 1YJNA 4J5YA 1GRIA 4DQ2A 2E6ZA 3HFOA 1M3AA 1Y96B 2VV5A 1YJWT 1RL2A 1WFWA 3SHWA 3RKXA 1Q95G 2JTMA 3A8MB 2CZ0B 2GBQA 2FL7A 2MWOA 1OV3A 1I8FA 3G4SA 3UWNA 5A2QE 2OTLQ 3LWIA 2P0QA 2A36A 1H8KA 1UUEA 4HCKA 5IAYA 3TSWA 3TREA 2NUTB 1W70A 2LJ0A 5GANh 4IUTA 4BY6C 2CYZB 2E3HA 2DK3A 1YIJQ 4M75F 5CQXA 2LQNA 4YTLA 5GAMh 2RJDA 2KRSA 4JJDA 2EYQA 2P0PA 2OJ2A 2RHZA 8ATCB 1YITA 4EIKA 4J9BA 3G6ET 2DVEA 4M7DC 5GAOl 1C0MA 3CMAQ 1GCPA 2DL8A 4M7AE 1VQKQ 2EQMA 4OF1A 5CQYA 2MOXA 5CKEA 4JPBW 3OYJA 3RMQA 3EGXA 1W2BP 1BYMA 1PRMC 2F69A 4C92F 5LJ3d 4PJJA 3RUXA 1D09B 1I81A 1LJOA 4RTVA 4FYWB 5GMKh 1ZSZC 4C0DC 2X4JA 3H0FA 2FZKB 2X3XD 3H0HA 4M78E 3H6ZA 2HD0A 2E64A 5CCAA 1PCXA 2EGCA 3FRNA 2OAWA 2K57A 4M77C 2BTTA 2DTHA 5I21A 2YUOA 3OA6A 3L42A 1VYTA 3M9QA 1RABB 2DL7A 1VQ7Q 3CCQT 2EIFA 3G4ST 1Q82R 1RACB 3QWYA 1G83A 4IUUA 1WHHA 2JN0A 4C8QB 1M8MA 2FZGB 5KE2A 6AT1B 3BE3A 2WSCE 1YJNT 2HL3A 1FMKA 2J7IA 3CCUT 4XU0A 2M16A 4LDUA 3JCMJ 2P0KA 5LJ3g 4J6XA 3HP9A 4E7SA 1JBMA 1TTHB 2JNGA 1FMVA 3CCMA 1QVGS 1NLOC 3KBGA 3MP1A 3HRUA 4IURA 2GCXA 3CC7Q 2FPDA 4ZN1A 5LJ5j 3OYLA 1KD1U 1BK2A 1M4ZA 3DB3A 2JT4A 1BB9A 3C95A 4J9IA 1BCMA 2F2WA 2O4XA 3H9NA 1RI9A 1Q7YU 1NEBA 2XDDA 3S3OA 2VUBA 3FJPA 2RHYA 5GMKm 2LNHB 1VIFA 2J05A 2XU8A 2D0NA 3VRYA 4B9WA 1QMCA 4LDXA 4M7AF 4J7FA 3NFCA 2L3PA 2LCSA 1RUWA 1OEBA 2DXUA 4PNOA 2DIGA 2EYYA 5M9OA 5GAMj 3GPLA 3SB2A 4FSSA 2CH4W 1O9SA 2NUZA 4HCZA 4JJBA 3MCAB 1YHQT 3VYGA 4KUDK 1I07A 2YSQA 1JJ2A 2IG0A 4LUDA 5CR2A 5A0LA 3PTAA 5AYFA 1MMAA 4JZ3A 3M0TA 3OYIA 4LE9A 4OMQA 2I0NA 1IHWA 1W1FA 3HKSA 2AHJB 4HKEA 4A54A 1MNEA 1ZX6A 4ELZC 1EFNA 4KRTA 4QVDA 2O01E 1M1FA 4ESRA 1QP2A 3MEWA 4F16A 4J9HA 1N27A 1XQHA 2OTLT 1VQ8Q 1XNIA 5GMKl 2MCNA 3GBQA 2DX1A 1YBYA 3A98A 3FB9A 3HRSA 2FPFA 3DLLA 3ULRB 2H3JA 2QA4A 2PVDB 5CKFA 3CD6A 1P92A 3VJPA 1UB4A 2VVKA 1R0CB 4HCCA 1WDXA 5GANf 3AHUA 3CC7A 4FU6A 2ZPGB 5GAOq 1PD1A 4M75G 2QA4T 2F5TX 3PIOA 1VQOT 1BU1A 2DYIA 2DRKA 4FW2A 1XTDA 2QXFA 1MV0B 1UHCA 4M75B 2BE7D 2L3SA 2PUOB 2DPPB 4E7HA 4ZGEB 2V8JA 2EW3A 4IUPA 2KXCA 4EMKB 1QQJA 1WXBA 1HK9A 2R5MA 2CUDA 4OB2B 4X1VA 3NTHA 3CCSA 1LCKA 3L2ZA 4C8QC 1TSFA 1MV3A 3I35A 2DD4A 1CKBA 2PTKA 3BFMA 2G3RA 2KE9A 1U1TA 5DLOA 1YHQA 1M30A 3OS2A 2D8JA 1VQ9T 2MK5A 3WVDB 2B8AA 5KYXB 4F7UF 1TOVA 4HT8A 1HJDA 1YWOA 1LNXA 4IIMA 3KFVA 2QYZA 1YI2T 2HBPA 1JRIA 2RNAA 2RI2A 1K73C 1W6XA 3C12A 3M57A 4N4HA 1VQLT 5IHIA 5HCKA 1Q7YR 3JCMP 5LJ3e 3ZEHA 4M7DB 1HYOA 3V7CA 1RAHB 2GQIA 4OVAA 1W2BA 2R57A 1WXUA 3C4SA 3UA7A 1EIFA 2VYTA 1G8XA 2RQVA 5GANd 4KH1B 1NJIR 3QYHB 4Z02A 4QW2A 2L8DA 2RB6A 1QVPA 3RIRA 3V7RA 2P84A 2HDAA 4PJOG 2ATCB 4QVCA 4BUGA 2GF7A 1Q81U 1K9MC 3A5ZB 2K5IA 2QQSA 3G71Q 3CMEA 2DM1A 3EGUA 1AT1B 1FX7A 4C5GA 1N5ZA 1LPLA 2JVVA 3FC3A 2E41A 2QTVA 1GL5A 4M7AD 4X9DA 3LGLA 3JCMQ 1M2VB 4Y28E 4A4EA 3QYGB 1KFZA 2ESWA 2KY9A 2QEXQ 2CP7A 1VQ5A 1OZ2A 2MF2A 2YUPA 3TU4K 2RM4A 3JV3A 2E10A 4KGVB 3UPUA 2XG8D 3P8BB 1YNZA 2OAUA 2YXYA 1SSHA 4E7JA 4RCBA 2CP0A 3OSSC 3OS0A 2W10A 2KT8A 3QO3A 3CCRA 3GLXA 3OS1A 4FYVB 2DBMA 4J8OA 3CCVA 2CP5A 3VKIA 2Y4YA 2CP6A 3KXTA 2C06A 4A63B 1YJ9Q 1RAFB 1AWWA 1WJRA 1D1BA 3ME9A 2NWMA 1M1KR 4PFPA 4M7AA 4J9DA 1FYNA 2K6DA 4QQ6A 4RTYA 3CCVT 1AD5A 1ABOA 1OI1A 1K9MR 2CSQA 1X6BA 2J6FA 1LVKA 2YT6A 2O9SA 1U3OA 2CZ7B 1X75C 4A4GA 4V2SA 1QVGA 4M7DG 1JEGA 1Z9QA 2KK4A 1UGQB 4EMKC 3T9NA 2EGEA 3CCRT 5LJ3f 1WNLA 2RQWA 3I9QA 3VYHB 3EG9B 3OQ5A 5CKHA 2PVGB 3UATA 1YI2Q 2CS7A 2FG0A 2EQIA 1Y57A 2PVOB 3QZ9B 3RMSA 1VQPT 1N8RR 1SSFA 1ZLMA 5FWCA 3OB9A 3A1PA 2BIVA 5J39A 2C0IA 4F7UE 3OYMA 2K2VA 3OYAA 1M1GA 3Q1JA 1V76A 3VS4A 2XIDA 1AZEA 5IHKA 3CCST 1X43A 2FZCB 2K5LA 2QASA 2KXDA 5J26A 1UE9A 1BKBA 2IVWA 1OX9A 1B34A 4CC3A 2E12A 2HKQB 1SHGA 2XK0A 4J6YA 3JCMf 4C92C 4OMLA 2RK1A 3I55A 4PJOF 2LQKA 2DZCA 3CEYA 4PFZA 1BIBA 4L59A 3HRTA 2E6NA 2MIOA 2RF0A 4F7UG 2X4WA 2CP3A 1YIJT 3JCMc 5EG2A 1RADB 3L2RA 3RNJA 1X69A 4PJOE 2XHCA 5GMKe 1EZZB 1K4US 2F1LA 1OYXA 2VB6A 1VQKA 4J7IA 4XTVA 2L2PA 1VQLA 3CMAA 2V1QA 3JCMW 1IGQA 4M77G 1QKWA 1OX8A 2O4XB 3LYIA 4M75D 1Q7YC 2DTOA 2K3BA 3M58A 3DKMA 2Z0WA 2KGTA 5CK9A 4C92E 5GANe 2P4TA 5LJ3j 4J9EA 1U06A 1NBEB 1G3YA 4BE1A 4PJOA 2DL3A 2MMPA 5FRNA 2F5KA 4CC7A 3TSZA 1G2BA 3PVQA 4LN2A 1I5OB 5I11A 4LUEA 5KYUB 3P8HA 2EWNA 3EG9A 1UGPB 5FU7B 3RERA 2MPXC 3E9FA 2GQVA 2RA2A 4PJMA 2ED1A 3R6OA 1SEMA 5C6SA 2DJZA 3QBYA 2XDPA 3SEMA 1KK7A 1VQ8T 3RR6A 1X2QA 3QWXX 4DA4A 2K3YA 4ANJA 1U5SA 2X9HA 3G1JA 2SEMA 3TEEA 3RBBB 3PMTA 4DEXA 1GFDA 1WHLA 2DXCA 2LQWA 4CC2A 1GXIE 2LVMA 3OYKA 3QPHA 3OYGA 3ER0A 3QSUA 1K9AA 3DB4A 2XI9A 2EKHA 4FT4A 2YRCA 3MEAA 3OSVA 4C92D 2LP5A 1NYGA 2HKNA 4Z89A 3C0CA 1YI2A 1MMGA 4O6JA 4Q5WA 2DLPA 2LT4A 4XU2A 4E7ZA 4M75E 1K1ZA 3PGGA 2JUFA 2K3XA 4M78F 1Q86R 2X3WD 3SD4A 3VV0A 2FYKA 3CCJT 1J3TA 5CAIA 3CD6T 4Z8AA 3A8LB 2KNBB 5DY9A 5HK0A 2ABLA 2DE0X 2K9GA 1G3WA 2OTJA 3ZBDA 3QDFA 2FEIA 1IXDA 4M77B 4ATOA 3VS0A 2EKOA 4FYXB 5KYUA 2E65A 3MO8A 2E3IA 1VYVA 4RKUE 4A53A 3I56A 2A7YA 3J80E 2AK5A 2Y4XA 1ZA2B 2K5FA 2QI2A 2RQTA 1M3CA 3BDLA 1D1AA 1WX6A 2GFUA 4KUIA 1TH7A 2COZA 4N0AC 3OW2A 3AT1B 2FHDA 4JZ4A 4MZTA 3LWHA 4RTUA 1NPPA 2R5AA 5HKCA 3VUZA 4ZGJB 1PSEA 1UGRB 2LDMA 3OMGA 3OYCA 4C5IA 3QDRB 2AIRB 3JCMb 4JUVA 5DM7R 4M7DE 1VQ9A 1KQ2A 4E7IA 4PLLA 1GCQA 1NZ9A 4BI3A 3TQ7P 2X4XA 3CCEQ 1VQLQ 2RH2A 2IPOB 3X24B 3JB9G 3KUFA 2OTLA 4FM4B 4EMKA 3CMEQ 4PKCC 1JO8A 5GAN4 5GAOp 2EQJA 4Y92A 1BBZA 1D1CA 1JU5C 4JS4A 1RLPC 3P8DA 1YP5A 4KBMB 2VXEA 1MUZA 1IB8A 2AKLA 2EJGA 4AMCA 3JB9D 2PU9B 1MGQA 1FXXA 4NOYA 2A0FB 1F1BB 1BI2A 2I2LA 2QQBA 3QUIA 3I55T 3E19A 4Z88A 4M78B 2DIQA 3CCJA 1AOJA 5KCOA 4PK4A 2WSEE 2MAMA 3OYHA 1W2BS 4B6MA 1KSWA 1XOVA 2O2OA 2KBTA 2ZPEB 3FIFA 2DJQA 4N4IA 4Y91A 3FLGA 2VXFA 2GTOA 4ZTFA 1VQ4A 5A0GA 1UGSB 5CKBA 2RN8A 3V7SA 2RO0A 3EGDB 4DOVA 2HCKA 2MYSA 1WQ7A 2IIMA 1AWJA 3LGFA 2RI5A 4LXCA 2DETA 4M78D 2H3EB 4C8QE 5EC7A 2JMCA 1VIEA 1PC0A 1K73R 2E70A 4XU1A 2YUNA 1R0BG 2LC4A 2RMOA 4IIOA 1N6AA 2KR3A 2QDYB 3V8LA 3J81E 3OYFA 1U1SA 2LX7A 1PWTA 5ECAA 4A4FA 3PMIA 4N0AA 4P5NA 2DA9A 2JS0A 3TVTA 2VGNA 4OMMA 3QJYA 5AT1B 1KC8C 1UGVA 3BY7A 5D7UA 3M55A 1S72T 4QQDA 1QLYA 3QIIA 1ABQA 8AT1B 2BZXA 3BW1A 4C8QG 2QAZA 4MDWA 4M78C 5GAMe 1JJ2S 1VYUA 3QG1A 3OS5A 1H3HA 5IXFA 2EFIA 3L2WA 3GIBA 1KQSP 2L89A 1IGUA 4RTWA 2EQKA 3VS5A 2SRCA 2O31A 4PJOC 2ZGWA 3NTIA 1VQ4T 3DLMA 1B34B 2FO0A 3H0IA 5LJ5d 2YWWA 2L3QA 4PJLA 3VS2A 4RG8A 4GBQA 4B9XA 3G71A 1GFCA 4QKUA 2AT1B 2JZ2A 3C94A 4LD6A 3G7ZA 4PJNA 2EPDA 2A3LA 2VGMA 1YIJA 4OMOA 4M78G 1AWXA 3I5RA 1WQWA 1BIAA 2KRMA 1VQMQ 1M1KU 1NEGA 1X6OA 3EH1A 2JXBA 1QWEA 2DAQA 1PKSA 1PRLC 5FROA 1WHKA 3EHRA 2PQWA 3OYBA 4IUVA 4DBQA 1I0CA 1NG2A 1UG1A 2JM8A 3JRZA 4WCIA 1TUGB 4FT2A 1ZUKA 4RUGA 3LH0A 1QVFS 2VC8A 1K73U 1I5LA 3E2UA 3L2UA 1M1KC 4NL3A 4J9FA 1YCSB 1OPKA 3JB9H 5IXBA 4DOWA 2DZ9A 1Q82U 2BE9B 2LRQA 3OW2S 1IREB 2M9UA 1EX4A 4C8QD 3V8JA 1Y0MA 3CC4Q 3JCMh 2KSSA 3O8VA 2V1RA 3EG3A 2EVRA 2EAYA 2F2XA 5GAMg 5IT9E 3PFSA 4GLMA 2FRYA 4BI8B 2ZZDA 3HFNA 4MZMA 2BZYA 3WXMB 1IRXA 2XMFA 1UJ0A 3M0SA 3GNFB 1PSFA 2C0OA 3RESA 2K2MA 3CPWP 5KCHA 1JB0E 4DBFA 2QEXT 4D6WA 3FEOA 4MMKA 1PHTA 1T3SA 1VQ7T 3CCJQ 2AZSA 1N9RA 3NPFA 4WTOB 1ARKA 3M56A 3JCMV 4M75C 4QT7A 3JB9F 1VOMA 4C92A 1LOJA 3IQLA 2YDLA 5KYXA 1AHJB 1CKAA 1UDLA 4XK8E 1PNJA 1WI7A 3JSCA 2RD1A 5GANj 4OMFB 4IUQA 3CCSQ 2COWA 2ZPHB 5KYWA 2KRNA 1UJYA 2KVQG 4HVWA 1KD1C 1S1NA 4XTWA 4FL6A 3EHQA 2AZVA 4A4KA 1ZUUA 2XKOC 4PLIA 1VQ9Q 3M0UA 1BCOA 4HXJA 4JRPA 1KD1R 2FPEA 5FU7C 4AG2C 4F04B 5D6XA 2K79A 1VQKT 2ECZA 1N8RU 1SF9A 2DYBA 3RKWA 1YCYA 3CXCA 2AKKA 1WGSA 1RAAB 1D3BA 5HY6A 2D1XA 2ZPIB 4E7LA 2DO3A 4HA8A 1YJWQ 4II1A 2RQRA 3H8ZA 3THKA 3X26B 3HSBA 1KQ1A 4M7AC 4N4GA 2EQUA 1D0XA 2GFAA 2JM9A 2LX9A 2RJEA 5D6WA 4FCYA 3OY9A 1N8RC 2GNCA 5GAOn 4DBHA 4JJNK 3NTKA 3S6WA 2LNVA 5IHNA 5FRMA 1K0SA 1RI0A 1X2KA 2RI3A 3OMCA 5LJ5e 5GAN5 3I55Q 3CMET 1TG0A 2J6OA 4KH0B 1OQKA 3I56Q 2X35A 3JCMg 4AFUC 2KROA 2E4HA 1OZ3A 3M59A 4M7AB 1Q86U 2RQUA 1IHVA 2NUPB 4DBRA 2ENMA 1H3ZA 1KG1A 2D9TA 3INZA 1NPRA 1VQPQ 3CBPA 4XTXA 1OU8A 5GMKj 4FYYB 4UC4A 2ZPBB 4M7AG 1Q81C 3CXCS 1M2VA 4J9GA 2DMOA 3MHXA 1VUBA 4IKFA 3GNGA 2DBKA 4E2FB 4E7KA 1M5Q1 1YFNA 5IN1A 4ZN3A 5GAOr 1D3BB 2O88A 3X28B 1T3LA 5LJ5g 1UEBA 2EGAA 1YHQQ 3EGDA 1NJIU 1PG5B 3PNWC 1ZBJA 2A37A 4QQGA 1E6HA 2YRVA 2YUQA 1K8AU 2CUBA 4ORZA 1YJNQ 1XJWB 4R55A 4LDYA 3ZL7C 1ZUYA 4ELYC 2LCCA 1X27A 1MMNA 3X25B 4JLIA 3PE0A 3A8GB 1NLPC 2F2VA 2W0ZA 2BUDA 3VS3A 4FW1A 2CKKA 3M5AA 2WSFE 2HZYA 2JJ9A 2KMTA 4RG2A 3LLRA 1B7TA 3D7SB 3CCMQ 3CCRQ 3EG2A 3UDCA 1YN8A 3MEUA 4EPCA 2DKGA 1C6VX 2K4YA 1YJ9A 1SRMA 1Z9ZA 1NE8A 2KDSA 4XTYA 1VQ4Q 1FWZA 2QGFB 4XTUA 4ZNXA 4D8DA 1ZBXA 2EJFA 1A0NB 3R6NA 2COYA 2DL5A 4D8KA 5FU6C 4E6RA 2NUPA 2DVJA 1WXTA 2CP2A 1VQ6T 1QCFA 2QDLA 2ROLA 2LMJA 2QEXA 1W4SA 3L2QA 3VS6A 1UHFA 2DL4A 2HSPA 1TUDA 2CGHA 2FB7A 1VQPA 1WLPB 1MMDA 2A08A 4RMOA 1NJIC 2FVUA 3CD6Q 4FSXA 1SHFA 3JB9I 3MPUB 4EMGA 4XAXB 2ZCFB 3EGXB 1YWPA 1AZGB 1QCOA 3HPWA 3UF4A 3CCQQ 1S72A 2P4RA 5LJ5h 3RKYA 3EFRA 4OB3B 2WACA 3E1SA 3GF5A 4C0GA 4CRIA 3L2VA 3CC2T 1BI0A 1QVFP 4HVVA 4BY6B 4NS5A 1YITQ 4KGZB 2CDTA 5KH6A 2RHXA 1B3QA 3MEVA 2GTJA 5J3BA 3LX7A 2KT1A 4AFZC 3FJ5A 1E6GA 3CC2Q 1WYXA 1QVFA 1T0HA 5HK3A 1R8OB 3PIPA 4PJOB 2QG9B 3JB9J 1TU0B 4RTZA 3S3MA 1K9MU 2HQHA 4BDYA 1SPKA 2J6KA 1I1JA 2X51A 1ZHIA 2QGGA 2YRDA 4VUBA 3QJ6A 5CIUA 5CO7A 4JJCA 4OMPA 2QK0A 2M02A 5I2SA 3CCQA 1WJQA 2RHUA 2DILA 4JRKA 4J83A 4MMLA 2E1HA 1KC8R 3M0PA 1UTIA 2EYXA 4J6WA 3CBMA 2JTFA 4F14A 1VQOQ 3CCLT 4O5VA 3SWNA 7AT1B 4NL2A 2XICA 5GAMd 1M8VA 2RJFA 2KYMA 4BB7A 3MP6A 2CH4A 4FIBA 3JCMX 3OBWA 2NYSA 2E5QA 2EBPA 1KHIA 2KI7A 3URGA 3I56T 2PUKB 5FU6B 4A4HA 5DLQE 3U23A 4F17A 4HT9A 3I5SA 1MNDA 5CVIA 4DEYA 1DJ7B 2J06A 2JMAA 3CCMT 5FW9A 2Y90A 1ZSGA 2C0TA 3GP8A 1H92A 3A8OB 3OBYA 3F70A 2DXBA 2V8KA 4XU3A 3OYEA 2JS2A 1X01A 1GCQC 4J9CA 4KGXB 2JTEA 3JCMd 5L23A 4CC4B 4EMHA 2RK2A 3MKDA 4OB1B 1WA7A 1O75A 1D0ZA 4M75A 1FMWA 5KYWB 1KQSA 1TS9A 5I22A 3M0QA 2HBWA 3A8HB 1X6GA 1HXDA 1GBRA 4C8QF 4KT0E 1RAIB 3UA6A 2DERA 5KYYB 1WHGA 2HQEA 3VS1A 1CSKA 3CC4T 4XTZA 2LT1A 2DEQA 5GAOm 2MI6A 4M77E 3EFOB 1VQ8A 2RPNA 1VQMA 4C0FA 2CREA 2KQWA 1Y71A 1M2OA 2L5QA 1YJ9T 3HHTB 1VQ5Q 3VU3C 1TUCA 1JXOA 2LTOA 2CT4A 4X34A 1Y96A 1QVGP 2DNUA 1ZA1B 1V29B 2X4YA 4OMNA 1G5VA 2DD5A 2HNIA 2H8HA 1R77A 2NLUA 4C5HA 3META 1B07A 4L5GA 5GAN2 3G4SQ 5GAN3 3EG1A 1WIEA 2D8HA 3OYNA 1Y07A 1GBQA 4ME7A 4ZTJA 3M4GA 4C8QA 5GANg 4BE0A 3G71T 4OGEA 1AWOA 2LZ6B 4JS5A 2D6FA 5FLXE 3CC7T 3RDVA 4JDSA 1KQSS 4AT1B 1C1AA 3PT9A 3BDUA 4M7DD
chains in the Genus database with same CATH topology
4J9EA 1BB9A 1U06A 1UJYA 4J9IA 2DL3A 1UECA 2F2WA 4HVWA 1HD3A 1S1NA 1M27C 1RI9A 3EHQA 3TSZA 1G2BA 2AZVA 3PVQA 4LN2A 4CC7A 1ZUUA 5I11A 4LUEA 1NEBA 3EG0A 2VKNA 3M0UA 4HXJA 2FPEA 3VS7A 2LNHB 4AG2C 2J05A 2K79A 2D0NA 3VRYA 2ECZA 3REAB 2ED1A 2M51A 1UFFA 1SEMA 2L3PA 2DYBA 1RUWA 2LCSA 2EYWA 3SEMA 1OEBA 2AKKA 1X2QA 1K76A 2D1XA 3QWXX 3H41A 2EYYA 1U5SA 2RQRA 3THKA 4FSSA 2SEMA 3M0RA 2CH4W 1PKTA 3RBBB 2NUZA 4JJBA 4DEXA 2JM9A 1GFDA 2GNCA 2LQWA 4CC2A 5IHNA 2O9VA 1HSQA 1I07A 2YSQA 1K0SA 4LUDA 1X2KA 1K9AA 2A28A 1TG0A 2J6OA 2EKHA 4AFUC 2KROA 4JZ3A 3NGPA 3M0TA 4LE9A 4OMQA 2I0NA 1W1FA 2LP5A 2RQUA 1NYGA 2ENMA 5GJVB 4Z89A 3C0CA 1ZX6A 2DLPA 1EFNA 4KRTA 1K1ZA 4K11A 4ESRA 2X3WD 4F16A 4J9GA 1J3TA 2DMOA 1M3BA 4J9HA 2DBKA 1RLQC 4Z8AA 2G6FX 2KNBB 3GBQA 2MCNA 2DX1A 3A98A 2ABLA 2FPFA 2DE0X 2K9GA 3ULRB 2KYBA 2FEIA 3VS0A 2O88A 1KJWA 2VVKA 4RTXA 1T3LA 1VYVA 1WDXA 2EGAA 2AK5A 3CQTA 1ZBJA 4LNPA 2B86A 1JXMA 2HEQA 1BU1A 2A37A 1E6HA 2RQTA 1M3CA 2DRKA 2YUQA 2CUBA 4ORZA 1WX6A 3VRZA 1MV0B 3ZL7C 1UHCA 1ZUYA 2L3SA 2GGRA 2CT3A 4JZ4A 2BZ8A 1X27A 2JW4A 4RTUA 3NHNA 3PE0A 1NLPC 2F2VA 2W0ZA 3VS3A 2EW3A 2KXCA 2DF6A 1WXBA 2CUDA 4X1VA 1LCKA 4AFSC 5IH2A 1NM7A 1MV3A 3I35A 3EG2A 1CKBA 1YN8A 2PTKA 1VA7A 1GCQA 2E5KA 1SRMA 2DRMA 1Z9ZA 2OI3A 2KE9A 1K0XA 3O5ZA 4ZNXA 4D8DA 4HVUA 1A0NB 1M30A 2D8JA 2ED0A 2LJ3A 3R6NA 2DL5A 1JO8A 1SRLA 4D8KA 4Y92A 1BBZA 2PZ1A 1JU5C 4E6RA 2DVJA 1WXTA 1HJDA 1RLPC 1QCFA 2QDLA 1YWOA 1YP5A 2ROLA 2LMJA 1MUZA 2AKLA 4IIMA 3KFVA 3VS6A 1UHFA 2RNAA 2DL4A 1W6XA 2HSPA 1AVZC 1TUDA 2VWFA 1QWFA 2EYZA 1WLPB 4RTTA 2A08A 4Z88A 5IHIA 5HCKA 3PVLA 1SHFA 1AOJA 2L0AA 3LH5A 1YWPA 1KSWA 1AZGB 1XOVA 2O2OA 2KBTA 4M4ZA 3UF4A 2DJQA 2P4RA 2GTOA 2KEAA 2GQIA 2RN8A 1WXUA 5FWBA 2PNIA 3UA7A 1V1CA 3NMZC 2HCKA 4HVVA 2IIMA 2RQVA 1AWJA 1KIKA 2CDTA 5EC7A 2JMCA 2HDAA 4AFQC 1B3QA 2GTJA 1NYFA 2KT1A 4AFZC 2YUNA 3FJ5A 2RMOA 4IIOA 1E6GA 1T0JA 2M0YA 2KR3A 1WYXA 2DM1A 3EGUA 2CSIA 1T0HA 1E7OA 2FRWA 2LX7A 1N5ZA 1PWTA 2K7AA 4AG1C 5ECAA 4RTZA 3REBB 1GL5A 1SPKA 2J6KA 1I1JA 1QKXA 2DA9A 2JS0A 3TVTA 4OMMA 2ROTA 1KFZA 2ESWA 1UGVA 4JJCA 4OMPA 1OPLA 1QLYA 1ABQA 2DILA 1OOTA 2YUPA 2BZXA 3JV3A 1JQQA 3M0PA 1UTIA 2EYXA 2LJ1A 1IO6A 1YNZA 4R0KA 4F14A 1VYUA 2KYMA 1SSHA 2CH4A 1H3HA 1AEYA 5GJWB 5IXFA 2W10A 2KT8A 1GRIA 2EBPA 4RTWA 1M3AA 2DBMA 3VS5A 2SRCA 2O31A 1WFWA 3SHWA 3U23A 2GBQA 4A63B 1OV3A 2FO0A 3H0IA 4F17A 1AWWA 2L3QA 3I5SA 3VS2A 4GBQA 2A36A 2NWMA 4DEYA 1H8KA 1UUEA 2J06A 2JMAA 5FW9A 4HCKA 4J9DA 1FYNA 1ZSGA 2C0TA 2K6DA 3TSWA 1GFCA 4RTYA 1H92A 1W70A 2LJ0A 2EPDA 1AD5A 1ABOA 4OMOA 2CSQA 2JS2A 1AWXA 1X6BA 2J6FA 3I5RA 2YT6A 2O9SA 1GCQC 1U3OA 4J9CA 2LQNA 2KRMA 2KRSA 4JJDA 2JTEA 1NEGA 2OJ2A 5L23A 2JXBA 4CC4B 1QWEA 4EIKA 1Z9QA 4J9BA 1JEGA 1PKSA 2EGEA 1PRLC 1WA7A 1GCPA 3EHRA 2DL8A 2RQWA 3I9QA 5I22A 3M0QA 2HBWA 1I0CA 2MOXA 3UATA 1NG2A 1UG1A 2FG0A 2JM8A 4JPBW 1X6GA 4WCIA 1ZUKA 2EQIA 4RUGA 1Y57A 1GBRA 1PRMC 1ZLMA 5FWCA 4J9FA 1YCSB 3UA6A 1OPKA 5IXBA 2C0IA 4RTVA 3H0FA 2X3XD 1CSKA 3H0HA 3VS1A 1Y0MA 3VS4A 2EGCA 1AZEA 5IHKA 1X43A 2OAWA 2V1RA 3EG3A 2EVRA 2F2XA 2BTTA 2KXDA 4GLMA 2YUOA 1UE9A 2RPNA 2CREA 2FRYA 4CC3A 1VYTA 1SHGA 2BZYA 2DL7A 2XMFA 1TUCA 4OMLA 1JXOA 1UJ0A 2CT4A 3M0SA 3QWYA 2K2MA 2C0OA 1G83A 2DNUA 1M8MA 4OMNA 2MIOA 2RF0A 2H8HA 1B07A 1PHTA 1T3SA 2AZSA 3RNJA 3NPFA 1FMKA 1X69A 2J7IA 1ARKA 1K4US 3EG1A 1WIEA 2L2PA 2D8HA 4QT7A 2V1QA 1QKWA 3IQLA 1GBQA 2YDLA 1CKAA 1UDLA 1PNJA 1WI7A 1NLOC 2K3BA 1AWOA 2LZ6B 2FPDA 2KGTA 1BK2A 2JT4A 2KRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9E A;  1BB9 A;  1U06 A;  1UJY A;  4J9I A;  2DL3 A;  1UEC A;  2F2W A;  4HVW A;  1HD3 A;  1S1N A;  1M27 C;  1RI9 A;  3EHQ A;  3TSZ A;  1G2B A;  2AZV A;  3PVQ A;  4LN2 A;  4CC7 A;  1ZUU A;  5I11 A;  4LUE A;  1NEB A;  3EG0 A;  2VKN A;  3M0U A;  4HXJ A;  2FPE A;  3VS7 A;  2LNH B;  4AG2 C;  2J05 A;  2K79 A;  2D0N A;  3VRY A;  2ECZ A;  3REA B;  2ED1 A;  2M51 A;  1UFF A;  1SEM A;  2L3P A;  2DYB A;  1RUW A;  2LCS A;  2EYW A;  3SEM A;  1OEB A;  2AKK A;  1X2Q A;  1K76 A;  2D1X A;  3QWX X;  3H41 A;  2EYY A;  1U5S A;  2RQR A;  3THK A;  4FSS A;  2SEM A;  3M0R A;  2CH4 W;  1PKT A;  3RBB B;  2NUZ A;  4JJB A;  4DEX A;  2JM9 A;  1GFD A;  2GNC A;  2LQW A;  4CC2 A;  5IHN A;  2O9V A;  1HSQ A;  1I07 A;  2YSQ A;  1K0S A;  4LUD A;  1X2K A;  1K9A A;  2A28 A;  1TG0 A;  2J6O A;  2EKH A;  4AFU C;  2KRO A;  4JZ3 A;  3NGP A;  3M0T A;  4LE9 A;  4OMQ A;  2I0N A;  1W1F A;  2LP5 A;  2RQU A;  1NYG A;  2ENM A;  5GJV B;  4Z89 A;  3C0C A;  1ZX6 A;  2DLP A;  1EFN A;  4KRT A;  1K1Z A;  4K11 A;  4ESR A;  2X3W D;  4F16 A;  4J9G A;  1J3T A;  2DMO A;  1M3B A;  4J9H A;  2DBK A;  1RLQ C;  4Z8A A;  2G6F X;  2KNB B;  3GBQ A;  2MCN A;  2DX1 A;  3A98 A;  2ABL A;  2FPF A;  2DE0 X;  2K9G A;  3ULR B;  2KYB A;  2FEI A;  3VS0 A;  2O88 A;  1KJW A;  2VVK A;  4RTX A;  1T3L A;  1VYV A;  1WDX A;  2EGA A;  2AK5 A;  3CQT A;  1ZBJ A;  4LNP A;  2B86 A;  1JXM A;  2HEQ A;  1BU1 A;  2A37 A;  1E6H A;  2RQT A;  1M3C A;  2DRK A;  2YUQ A;  2CUB A;  4ORZ A;  1WX6 A;  3VRZ A;  1MV0 B;  3ZL7 C;  1UHC A;  1ZUY A;  2L3S A;  2GGR A;  2CT3 A;  4JZ4 A;  2BZ8 A;  1X27 A;  2JW4 A;  4RTU A;  3NHN A;  3PE0 A;  1NLP C;  2F2V A;  2W0Z A;  3VS3 A;  2EW3 A;  2KXC A;  2DF6 A;  1WXB A;  2CUD A;  4X1V A;  1LCK A;  4AFS C;  5IH2 A;  1NM7 A;  1MV3 A;  3I35 A;  3EG2 A;  1CKB A;  1YN8 A;  2PTK A;  1VA7 A;  1GCQ A;  2E5K A;  1SRM A;  2DRM A;  1Z9Z A;  2OI3 A;  2KE9 A;  1K0X A;  3O5Z A;  4ZNX A;  4D8D A;  4HVU A;  1A0N B;  1M30 A;  2D8J A;  2ED0 A;  2LJ3 A;  3R6N A;  2DL5 A;  1JO8 A;  1SRL A;  4D8K A;  4Y92 A;  1BBZ A;  2PZ1 A;  1JU5 C;  4E6R A;  2DVJ A;  1WXT A;  1HJD A;  1RLP C;  1QCF A;  2QDL A;  1YWO A;  1YP5 A;  2ROL A;  2LMJ A;  1MUZ A;  2AKL A;  4IIM A;  3KFV A;  3VS6 A;  1UHF A;  2RNA A;  2DL4 A;  1W6X A;  2HSP A;  1AVZ C;  1TUD A;  2VWF A;  1QWF A;  2EYZ A;  1WLP B;  4RTT A;  2A08 A;  4Z88 A;  5IHI A;  5HCK A;  3PVL A;  1SHF A;  1AOJ A;  2L0A A;  3LH5 A;  1YWP A;  1KSW A;  1AZG B;  1XOV A;  2O2O A;  2KBT A;  4M4Z A;  3UF4 A;  2DJQ A;  2P4R A;  2GTO A;  2KEA A;  2GQI A;  2RN8 A;  1WXU A;  5FWB A;  2PNI A;  3UA7 A;  1V1C A;  3NMZ C;  2HCK A;  4HVV A;  2IIM A;  2RQV A;  1AWJ A;  1KIK A;  2CDT A;  5EC7 A;  2JMC A;  2HDA A;  4AFQ C;  1B3Q A;  2GTJ A;  1NYF A;  2KT1 A;  4AFZ C;  2YUN A;  3FJ5 A;  2RMO A;  4IIO A;  1E6G A;  1T0J A;  2M0Y A;  2KR3 A;  1WYX A;  2DM1 A;  3EGU A;  2CSI A;  1T0H A;  1E7O A;  2FRW A;  2LX7 A;  1N5Z A;  1PWT A;  2K7A A;  4AG1 C;  5ECA A;  4RTZ A;  3REB B;  1GL5 A;  1SPK A;  2J6K A;  1I1J A;  1QKX A;  2DA9 A;  2JS0 A;  3TVT A;  4OMM A;  2ROT A;  1KFZ A;  2ESW A;  1UGV A;  4JJC A;  4OMP A;  1OPL A;  1QLY A;  1ABQ A;  2DIL A;  1OOT A;  2YUP A;  2BZX A;  3JV3 A;  1JQQ A;  3M0P A;  1UTI A;  2EYX A;  2LJ1 A;  1IO6 A;  1YNZ A;  4R0K A;  4F14 A;  1VYU A;  2KYM A;  1SSH A;  2CH4 A;  1H3H A;  1AEY A;  5GJW B;  5IXF A;  2W10 A;  2KT8 A;  1GRI A;  2EBP A;  4RTW A;  1M3A A;  2DBM A;  3VS5 A;  2SRC A;  2O31 A;  1WFW A;  3SHW A;  3U23 A;  2GBQ A;  4A63 B;  1OV3 A;  2FO0 A;  3H0I A;  4F17 A;  1AWW A;  2L3Q A;  3I5S A;  3VS2 A;  4GBQ A;  2A36 A;  2NWM A;  4DEY A;  1H8K A;  1UUE A;  2J06 A;  2JMA A;  5FW9 A;  4HCK A;  4J9D A;  1FYN A;  1ZSG A;  2C0T A;  2K6D A;  3TSW A;  1GFC A;  4RTY A;  1H92 A;  1W70 A;  2LJ0 A;  2EPD A;  1AD5 A;  1ABO A;  4OMO A;  2CSQ A;  2JS2 A;  1AWX A;  1X6B A;  2J6F A;  3I5R A;  2YT6 A;  2O9S A;  1GCQ C;  1U3O A;  4J9C A;  2LQN A;  2KRM A;  2KRS A;  4JJD A;  2JTE A;  1NEG A;  2OJ2 A;  5L23 A;  2JXB A;  4CC4 B;  1QWE A;  4EIK A;  1Z9Q A;  4J9B A;  1JEG A;  1PKS A;  2EGE A;  1PRL C;  1WA7 A;  1GCP A;  3EHR A;  2DL8 A;  2RQW A;  3I9Q A;  5I22 A;  3M0Q A;  2HBW A;  1I0C A;  2MOX A;  3UAT A;  1NG2 A;  1UG1 A;  2FG0 A;  2JM8 A;  4JPB W;  1X6G A;  4WCI A;  1ZUK A;  2EQI A;  4RUG A;  1Y57 A;  1GBR A;  1PRM C;  1ZLM A;  5FWC A;  4J9F A;  1YCS B;  3UA6 A;  1OPK A;  5IXB A;  2C0I A;  4RTV A;  3H0F A;  2X3X D;  1CSK A;  3H0H A;  3VS1 A;  1Y0M A;  3VS4 A;  2EGC A;  1AZE A;  5IHK A;  1X43 A;  2OAW A;  2V1R A;  3EG3 A;  2EVR A;  2F2X A;  2BTT A;  2KXD A;  4GLM A;  2YUO A;  1UE9 A;  2RPN A;  2CRE A;  2FRY A;  4CC3 A;  1VYT A;  1SHG A;  2BZY A;  2DL7 A;  2XMF A;  1TUC A;  4OML A;  1JXO A;  1UJ0 A;  2CT4 A;  3M0S A;  3QWY A;  2K2M A;  2C0O A;  1G83 A;  2DNU A;  1M8M A;  4OMN A;  2MIO A;  2RF0 A;  2H8H A;  1B07 A;  1PHT A;  1T3S A;  2AZS A;  3RNJ A;  3NPF A;  1FMK A;  1X69 A;  2J7I A;  1ARK A;  1K4U S;  3EG1 A;  1WIE A;  2L2P A;  2D8H A;  4QT7 A;  2V1Q A;  1QKW A;  3IQL A;  1GBQ A;  2YDL A;  1CKA A;  1UDL A;  1PNJ A;  1WI7 A;  1NLO C;  2K3B A;  1AWO A;  2LZ6 B;  2FPD A;  2KGT A;  1BK2 A;  2JT4 A;  2KRN A; 
#chains in the Genus database with same CATH topology
 3WVE B;  1OU9 A;  1RAG B;  1BI1 A;  2EJ9 A;  3EH2 A;  4HCB A;  1ZSZ A;  1UEC A;  3CPW A;  1YJW A;  1JJ2 P;  4M78 A;  5GAN 7;  1HD3 A;  1M27 C;  5C0M A;  1QCN A;  4F7U A;  3EG0 A;  2VKN A;  1Y7X A;  4PJO D;  4M7D A;  3VS7 A;  1N9S A;  3LW5 E;  1SKU B;  3MP8 A;  1G3S A;  3REA B;  3UT1 A;  3CCU A;  2M51 A;  1UFF A;  3HTR A;  2EYW A;  1VQM T;  1G3T A;  5KE3 A;  1M9S A;  2R58 A;  1K76 A;  3ZFJ A;  4JRQ A;  4LD9 K;  1BI3 A;  1K8A C;  3H41 A;  1WJS A;  4X9C A;  1VQN Q;  2DXT A;  4CI0 C;  3M0R A;  1PKT A;  2LCL A;  3J7A F;  4RCC A;  1OUL A;  5D6Y A;  2O9V A;  3EFO A;  2OTJ T;  5LJ5 f;  3JAM E;  1HSQ A;  3QZ5 B;  3CPW S;  1VQN T;  2A28 A;  1I4K 1;  2CZ6 B;  2OX7 A;  3L1A A;  4BAC A;  3EAE A;  3CMA T;  4BE2 A;  3NGP A;  3M54 A;  5L8R E;  3CCE T;  1WHM A;  1ACM B;  1IZ6 A;  2M1H A;  1RAE B;  5GJV B;  2D0Q B;  5GMK i;  3QKJ A;  4E47 A;  4LDV A;  1QP3 A;  3CBO A;  4K11 A;  4BDZ A;  5GAN 8;  1Q86 C;  3CCV Q;  3CCL Q;  2M0O A;  4F7U B;  4QVZ A;  1M3B A;  5KYY A;  1RLQ C;  2G6F X;  3G6E Q;  3JCM e;  5LJ3 h;  1QW1 A;  3FDR A;  3N5B B;  1H64 1;  4XQ3 A;  2KYB A;  2XDB A;  2ZAE A;  1Q82 C;  3GOX A;  1KJW A;  4RTX A;  1YIT T;  4BD3 A;  2JOY A;  2RHI A;  4OGC A;  3CC4 A;  4TVR A;  2MWP A;  4C0D B;  1ZSZ B;  2YLC A;  3QXE B;  1WPY A;  3CQT A;  1TWB A;  4LNP A;  2B86 A;  1JXM A;  2HEQ A;  4M77 F;  2QQR A;  3VRZ A;  1SG5 A;  3TCJ A;  4ZGD B;  2GGR A;  2CT3 A;  9ATC B;  2VAS A;  2BZ8 A;  2JW4 A;  3NHN A;  3OYD A;  1PM3 A;  3M4Y A;  4KUL A;  2DF6 A;  5GAN 6;  2YLB A;  5I2M A;  4AFS C;  3S3N A;  5IH2 A;  1MHN A;  3CCE A;  1NM7 A;  3ASK A;  1KHC A;  4M77 D;  4PL6 A;  1M90 U;  1VA7 A;  2E5K A;  4C92 B;  1U8R A;  2HQX A;  2DRM A;  2OI3 A;  5CKD A;  1K0X A;  3O5Z A;  1D0Y A;  2QTX A;  4HVU A;  2HAX A;  4M7D F;  4L6V 5;  3OYY A;  2ED0 A;  4C92 G;  2LJ3 A;  2NUT A;  4EDU A;  3CC2 A;  2OTJ Q;  4MDX A;  1SRL A;  2V26 A;  2PZ1 A;  2DEU A;  2V8I A;  1M90 R;  1TXQ A;  1K8A R;  1AVZ C;  2VWF A;  3X20 B;  3OW2 P;  1QWF A;  2EYZ A;  4RTT A;  3CCL A;  2DTI A;  2L3R A;  3CXC P;  4GY5 A;  1S72 Q;  3SWN C;  3PVL A;  2L0A A;  3LH5 A;  3HL8 A;  4M4Z A;  1KC8 U;  2DFU A;  1ZQ1 A;  1VQ5 T;  3G6E A;  1Q81 R;  2KEA A;  2ZPF B;  3MJX A;  5FWB A;  2PNI A;  1VQ7 A;  1WHJ A;  4BI4 A;  3SDZ A;  3M53 A;  1V1C A;  3NMZ C;  4C5E A;  4R56 A;  5KYN A;  1KIK A;  1VQ6 A;  2CZ1 B;  2HMA A;  2YHT A;  2HSE B;  3CPF A;  4AFQ C;  1PD0 A;  4MZP A;  1NYF A;  4OB0 B;  2HL5 C;  4JRI A;  1T0J A;  2M0Y A;  1VQ6 Q;  3SFM A;  1M90 C;  1VQN A;  2QQ9 A;  2CSI A;  1E7O A;  2FRW A;  2K7A A;  4AG1 C;  1WZO A;  3REB B;  4C0Z A;  2LQ8 A;  5A0D A;  1QKX A;  3CCU Q;  3QHS A;  3EFS A;  2RJC A;  2ROT A;  4LDW A;  2BKD N;  4OP0 A;  1OPL A;  3E9G A;  5GAM f;  1OOT A;  4JLG A;  2QQA A;  1JQQ A;  2KAF A;  3V8K A;  2LJ1 A;  3SWN B;  1VQO A;  4M77 A;  1IO6 A;  5LL6 S;  4R0K A;  2QA4 Q;  3VUB A;  2XD0 A;  4PFO A;  4GLK A;  1AEY A;  4WF2 A;  5GJW B;  1YJN A;  4J5Y A;  1GRI A;  4DQ2 A;  2E6Z A;  3HFO A;  1M3A A;  1Y96 B;  2VV5 A;  1YJW T;  1RL2 A;  1WFW A;  3SHW A;  3RKX A;  1Q95 G;  2JTM A;  3A8M B;  2CZ0 B;  2GBQ A;  2FL7 A;  2MWO A;  1OV3 A;  1I8F A;  3G4S A;  3UWN A;  5A2Q E;  2OTL Q;  3LWI A;  2P0Q A;  2A36 A;  1H8K A;  1UUE A;  4HCK A;  5IAY A;  3TSW A;  3TRE A;  2NUT B;  1W70 A;  2LJ0 A;  5GAN h;  4IUT A;  4BY6 C;  2CYZ B;  2E3H A;  2DK3 A;  1YIJ Q;  4M75 F;  5CQX A;  2LQN A;  4YTL A;  5GAM h;  2RJD A;  2KRS A;  4JJD A;  2EYQ A;  2P0P A;  2OJ2 A;  2RHZ A;  8ATC B;  1YIT A;  4EIK A;  4J9B A;  3G6E T;  2DVE A;  4M7D C;  5GAO l;  1C0M A;  3CMA Q;  1GCP A;  2DL8 A;  4M7A E;  1VQK Q;  2EQM A;  4OF1 A;  5CQY A;  2MOX A;  5CKE A;  4JPB W;  3OYJ A;  3RMQ A;  3EGX A;  1W2B P;  1BYM A;  1PRM C;  2F69 A;  4C92 F;  5LJ3 d;  4PJJ A;  3RUX A;  1D09 B;  1I81 A;  1LJO A;  4RTV A;  4FYW B;  5GMK h;  1ZSZ C;  4C0D C;  2X4J A;  3H0F A;  2FZK B;  2X3X D;  3H0H A;  4M78 E;  3H6Z A;  2HD0 A;  2E64 A;  5CCA A;  1PCX A;  2EGC A;  3FRN A;  2OAW A;  2K57 A;  4M77 C;  2BTT A;  2DTH A;  5I21 A;  2YUO A;  3OA6 A;  3L42 A;  1VYT A;  3M9Q A;  1RAB B;  2DL7 A;  1VQ7 Q;  3CCQ T;  2EIF A;  3G4S T;  1Q82 R;  1RAC B;  3QWY A;  1G83 A;  4IUU A;  1WHH A;  2JN0 A;  4C8Q B;  1M8M A;  2FZG B;  5KE2 A;  6AT1 B;  3BE3 A;  2WSC E;  1YJN T;  2HL3 A;  1FMK A;  2J7I A;  3CCU T;  4XU0 A;  2M16 A;  4LDU A;  3JCM J;  2P0K A;  5LJ3 g;  4J6X A;  3HP9 A;  4E7S A;  1JBM A;  1TTH B;  2JNG A;  1FMV A;  3CCM A;  1QVG S;  1NLO C;  3KBG A;  3MP1 A;  3HRU A;  4IUR A;  2GCX A;  3CC7 Q;  2FPD A;  4ZN1 A;  5LJ5 j;  3OYL A;  1KD1 U;  1BK2 A;  1M4Z A;  3DB3 A;  2JT4 A;  1BB9 A;  3C95 A;  4J9I A;  1BCM A;  2F2W A;  2O4X A;  3H9N A;  1RI9 A;  1Q7Y U;  1NEB A;  2XDD A;  3S3O A;  2VUB A;  3FJP A;  2RHY A;  5GMK m;  2LNH B;  1VIF A;  2J05 A;  2XU8 A;  2D0N A;  3VRY A;  4B9W A;  1QMC A;  4LDX A;  4M7A F;  4J7F A;  3NFC A;  2L3P A;  2LCS A;  1RUW A;  1OEB A;  2DXU A;  4PNO A;  2DIG A;  2EYY A;  5M9O A;  5GAM j;  3GPL A;  3SB2 A;  4FSS A;  2CH4 W;  1O9S A;  2NUZ A;  4HCZ A;  4JJB A;  3MCA B;  1YHQ T;  3VYG A;  4KUD K;  1I07 A;  2YSQ A;  1JJ2 A;  2IG0 A;  4LUD A;  5CR2 A;  5A0L A;  3PTA A;  5AYF A;  1MMA A;  4JZ3 A;  3M0T A;  3OYI A;  4LE9 A;  4OMQ A;  2I0N A;  1IHW A;  1W1F A;  3HKS A;  2AHJ B;  4HKE A;  4A54 A;  1MNE A;  1ZX6 A;  4ELZ C;  1EFN A;  4KRT A;  4QVD A;  2O01 E;  1M1F A;  4ESR A;  1QP2 A;  3MEW A;  4F16 A;  4J9H A;  1N27 A;  1XQH A;  2OTL T;  1VQ8 Q;  1XNI A;  5GMK l;  2MCN A;  3GBQ A;  2DX1 A;  1YBY A;  3A98 A;  3FB9 A;  3HRS A;  2FPF A;  3DLL A;  3ULR B;  2H3J A;  2QA4 A;  2PVD B;  5CKF A;  3CD6 A;  1P92 A;  3VJP A;  1UB4 A;  2VVK A;  1R0C B;  4HCC A;  1WDX A;  5GAN f;  3AHU A;  3CC7 A;  4FU6 A;  2ZPG B;  5GAO q;  1PD1 A;  4M75 G;  2QA4 T;  2F5T X;  3PIO A;  1VQO T;  1BU1 A;  2DYI A;  2DRK A;  4FW2 A;  1XTD A;  2QXF A;  1MV0 B;  1UHC A;  4M75 B;  2BE7 D;  2L3S A;  2PUO B;  2DPP B;  4E7H A;  4ZGE B;  2V8J A;  2EW3 A;  4IUP A;  2KXC A;  4EMK B;  1QQJ A;  1WXB A;  1HK9 A;  2R5M A;  2CUD A;  4OB2 B;  4X1V A;  3NTH A;  3CCS A;  1LCK A;  3L2Z A;  4C8Q C;  1TSF A;  1MV3 A;  3I35 A;  2DD4 A;  1CKB A;  2PTK A;  3BFM A;  2G3R A;  2KE9 A;  1U1T A;  5DLO A;  1YHQ A;  1M30 A;  3OS2 A;  2D8J A;  1VQ9 T;  2MK5 A;  3WVD B;  2B8A A;  5KYX B;  4F7U F;  1TOV A;  4HT8 A;  1HJD A;  1YWO A;  1LNX A;  4IIM A;  3KFV A;  2QYZ A;  1YI2 T;  2HBP A;  1JRI A;  2RNA A;  2RI2 A;  1K73 C;  1W6X A;  3C12 A;  3M57 A;  4N4H A;  1VQL T;  5IHI A;  5HCK A;  1Q7Y R;  3JCM P;  5LJ3 e;  3ZEH A;  4M7D B;  1HYO A;  3V7C A;  1RAH B;  2GQI A;  4OVA A;  1W2B A;  2R57 A;  1WXU A;  3C4S A;  3UA7 A;  1EIF A;  2VYT A;  1G8X A;  2RQV A;  5GAN d;  4KH1 B;  1NJI R;  3QYH B;  4Z02 A;  4QW2 A;  2L8D A;  2RB6 A;  1QVP A;  3RIR A;  3V7R A;  2P84 A;  2HDA A;  4PJO G;  2ATC B;  4QVC A;  4BUG A;  2GF7 A;  1Q81 U;  1K9M C;  3A5Z B;  2K5I A;  2QQS A;  3G71 Q;  3CME A;  2DM1 A;  3EGU A;  1AT1 B;  1FX7 A;  4C5G A;  1N5Z A;  1LPL A;  2JVV A;  3FC3 A;  2E41 A;  2QTV A;  1GL5 A;  4M7A D;  4X9D A;  3LGL A;  3JCM Q;  1M2V B;  4Y28 E;  4A4E A;  3QYG B;  1KFZ A;  2ESW A;  2KY9 A;  2QEX Q;  2CP7 A;  1VQ5 A;  1OZ2 A;  2MF2 A;  2YUP A;  3TU4 K;  2RM4 A;  3JV3 A;  2E10 A;  4KGV B;  3UPU A;  2XG8 D;  3P8B B;  1YNZ A;  2OAU A;  2YXY A;  1SSH A;  4E7J A;  4RCB A;  2CP0 A;  3OSS C;  3OS0 A;  2W10 A;  2KT8 A;  3QO3 A;  3CCR A;  3GLX A;  3OS1 A;  4FYV B;  2DBM A;  4J8O A;  3CCV A;  2CP5 A;  3VKI A;  2Y4Y A;  2CP6 A;  3KXT A;  2C06 A;  4A63 B;  1YJ9 Q;  1RAF B;  1AWW A;  1WJR A;  1D1B A;  3ME9 A;  2NWM A;  1M1K R;  4PFP A;  4M7A A;  4J9D A;  1FYN A;  2K6D A;  4QQ6 A;  4RTY A;  3CCV T;  1AD5 A;  1ABO A;  1OI1 A;  1K9M R;  2CSQ A;  1X6B A;  2J6F A;  1LVK A;  2YT6 A;  2O9S A;  1U3O A;  2CZ7 B;  1X75 C;  4A4G A;  4V2S A;  1QVG A;  4M7D G;  1JEG A;  1Z9Q A;  2KK4 A;  1UGQ B;  4EMK C;  3T9N A;  2EGE A;  3CCR T;  5LJ3 f;  1WNL A;  2RQW A;  3I9Q A;  3VYH B;  3EG9 B;  3OQ5 A;  5CKH A;  2PVG B;  3UAT A;  1YI2 Q;  2CS7 A;  2FG0 A;  2EQI A;  1Y57 A;  2PVO B;  3QZ9 B;  3RMS A;  1VQP T;  1N8R R;  1SSF A;  1ZLM A;  5FWC A;  3OB9 A;  3A1P A;  2BIV A;  5J39 A;  2C0I A;  4F7U E;  3OYM A;  2K2V A;  3OYA A;  1M1G A;  3Q1J A;  1V76 A;  3VS4 A;  2XID A;  1AZE A;  5IHK A;  3CCS T;  1X43 A;  2FZC B;  2K5L A;  2QAS A;  2KXD A;  5J26 A;  1UE9 A;  1BKB A;  2IVW A;  1OX9 A;  1B34 A;  4CC3 A;  2E12 A;  2HKQ B;  1SHG A;  2XK0 A;  4J6Y A;  3JCM f;  4C92 C;  4OML A;  2RK1 A;  3I55 A;  4PJO F;  2LQK A;  2DZC A;  3CEY A;  4PFZ A;  1BIB A;  4L59 A;  3HRT A;  2E6N A;  2MIO A;  2RF0 A;  4F7U G;  2X4W A;  2CP3 A;  1YIJ T;  3JCM c;  5EG2 A;  1RAD B;  3L2R A;  3RNJ A;  1X69 A;  4PJO E;  2XHC A;  5GMK e;  1EZZ B;  1K4U S;  2F1L A;  1OYX A;  2VB6 A;  1VQK A;  4J7I A;  4XTV A;  2L2P A;  1VQL A;  3CMA A;  2V1Q A;  3JCM W;  1IGQ A;  4M77 G;  1QKW A;  1OX8 A;  2O4X B;  3LYI A;  4M75 D;  1Q7Y C;  2DTO A;  2K3B A;  3M58 A;  3DKM A;  2Z0W A;  2KGT A;  5CK9 A;  4C92 E;  5GAN e;  2P4T A;  5LJ3 j;  4J9E A;  1U06 A;  1NBE B;  1G3Y A;  4BE1 A;  4PJO A;  2DL3 A;  2MMP A;  5FRN A;  2F5K A;  4CC7 A;  3TSZ A;  1G2B A;  3PVQ A;  4LN2 A;  1I5O B;  5I11 A;  4LUE A;  5KYU B;  3P8H A;  2EWN A;  3EG9 A;  1UGP B;  5FU7 B;  3RER A;  2MPX C;  3E9F A;  2GQV A;  2RA2 A;  4PJM A;  2ED1 A;  3R6O A;  1SEM A;  5C6S A;  2DJZ A;  3QBY A;  2XDP A;  3SEM A;  1KK7 A;  1VQ8 T;  3RR6 A;  1X2Q A;  3QWX X;  4DA4 A;  2K3Y A;  4ANJ A;  1U5S A;  2X9H A;  3G1J A;  2SEM A;  3TEE A;  3RBB B;  3PMT A;  4DEX A;  1GFD A;  1WHL A;  2DXC A;  2LQW A;  4CC2 A;  1GXI E;  2LVM A;  3OYK A;  3QPH A;  3OYG A;  3ER0 A;  3QSU A;  1K9A A;  3DB4 A;  2XI9 A;  2EKH A;  4FT4 A;  2YRC A;  3MEA A;  3OSV A;  4C92 D;  2LP5 A;  1NYG A;  2HKN A;  4Z89 A;  3C0C A;  1YI2 A;  1MMG A;  4O6J A;  4Q5W A;  2DLP A;  2LT4 A;  4XU2 A;  4E7Z A;  4M75 E;  1K1Z A;  3PGG A;  2JUF A;  2K3X A;  4M78 F;  1Q86 R;  2X3W D;  3SD4 A;  3VV0 A;  2FYK A;  3CCJ T;  1J3T A;  5CAI A;  3CD6 T;  4Z8A A;  3A8L B;  2KNB B;  5DY9 A;  5HK0 A;  2ABL A;  2DE0 X;  2K9G A;  1G3W A;  2OTJ A;  3ZBD A;  3QDF A;  2FEI A;  1IXD A;  4M77 B;  4ATO A;  3VS0 A;  2EKO A;  4FYX B;  5KYU A;  2E65 A;  3MO8 A;  2E3I A;  1VYV A;  4RKU E;  4A53 A;  3I56 A;  2A7Y A;  3J80 E;  2AK5 A;  2Y4X A;  1ZA2 B;  2K5F A;  2QI2 A;  2RQT A;  1M3C A;  3BDL A;  1D1A A;  1WX6 A;  2GFU A;  4KUI A;  1TH7 A;  2COZ A;  4N0A C;  3OW2 A;  3AT1 B;  2FHD A;  4JZ4 A;  4MZT A;  3LWH A;  4RTU A;  1NPP A;  2R5A A;  5HKC A;  3VUZ A;  4ZGJ B;  1PSE A;  1UGR B;  2LDM A;  3OMG A;  3OYC A;  4C5I A;  3QDR B;  2AIR B;  3JCM b;  4JUV A;  5DM7 R;  4M7D E;  1VQ9 A;  1KQ2 A;  4E7I A;  4PLL A;  1GCQ A;  1NZ9 A;  4BI3 A;  3TQ7 P;  2X4X A;  3CCE Q;  1VQL Q;  2RH2 A;  2IPO B;  3X24 B;  3JB9 G;  3KUF A;  2OTL A;  4FM4 B;  4EMK A;  3CME Q;  4PKC C;  1JO8 A;  5GAN 4;  5GAO p;  2EQJ A;  4Y92 A;  1BBZ A;  1D1C A;  1JU5 C;  4JS4 A;  1RLP C;  3P8D A;  1YP5 A;  4KBM B;  2VXE A;  1MUZ A;  1IB8 A;  2AKL A;  2EJG A;  4AMC A;  3JB9 D;  2PU9 B;  1MGQ A;  1FXX A;  4NOY A;  2A0F B;  1F1B B;  1BI2 A;  2I2L A;  2QQB A;  3QUI A;  3I55 T;  3E19 A;  4Z88 A;  4M78 B;  2DIQ A;  3CCJ A;  1AOJ A;  5KCO A;  4PK4 A;  2WSE E;  2MAM A;  3OYH A;  1W2B S;  4B6M A;  1KSW A;  1XOV A;  2O2O A;  2KBT A;  2ZPE B;  3FIF A;  2DJQ A;  4N4I A;  4Y91 A;  3FLG A;  2VXF A;  2GTO A;  4ZTF A;  1VQ4 A;  5A0G A;  1UGS B;  5CKB A;  2RN8 A;  3V7S A;  2RO0 A;  3EGD B;  4DOV A;  2HCK A;  2MYS A;  1WQ7 A;  2IIM A;  1AWJ A;  3LGF A;  2RI5 A;  4LXC A;  2DET A;  4M78 D;  2H3E B;  4C8Q E;  5EC7 A;  2JMC A;  1VIE A;  1PC0 A;  1K73 R;  2E70 A;  4XU1 A;  2YUN A;  1R0B G;  2LC4 A;  2RMO A;  4IIO A;  1N6A A;  2KR3 A;  2QDY B;  3V8L A;  3J81 E;  3OYF A;  1U1S A;  2LX7 A;  1PWT A;  5ECA A;  4A4F A;  3PMI A;  4N0A A;  4P5N A;  2DA9 A;  2JS0 A;  3TVT A;  2VGN A;  4OMM A;  3QJY A;  5AT1 B;  1KC8 C;  1UGV A;  3BY7 A;  5D7U A;  3M55 A;  1S72 T;  4QQD A;  1QLY A;  3QII A;  1ABQ A;  8AT1 B;  2BZX A;  3BW1 A;  4C8Q G;  2QAZ A;  4MDW A;  4M78 C;  5GAM e;  1JJ2 S;  1VYU A;  3QG1 A;  3OS5 A;  1H3H A;  5IXF A;  2EFI A;  3L2W A;  3GIB A;  1KQS P;  2L89 A;  1IGU A;  4RTW A;  2EQK A;  3VS5 A;  2SRC A;  2O31 A;  4PJO C;  2ZGW A;  3NTI A;  1VQ4 T;  3DLM A;  1B34 B;  2FO0 A;  3H0I A;  5LJ5 d;  2YWW A;  2L3Q A;  4PJL A;  3VS2 A;  4RG8 A;  4GBQ A;  4B9X A;  3G71 A;  1GFC A;  4QKU A;  2AT1 B;  2JZ2 A;  3C94 A;  4LD6 A;  3G7Z A;  4PJN A;  2EPD A;  2A3L A;  2VGM A;  1YIJ A;  4OMO A;  4M78 G;  1AWX A;  3I5R A;  1WQW A;  1BIA A;  2KRM A;  1VQM Q;  1M1K U;  1NEG A;  1X6O A;  3EH1 A;  2JXB A;  1QWE A;  2DAQ A;  1PKS A;  1PRL C;  5FRO A;  1WHK A;  3EHR A;  2PQW A;  3OYB A;  4IUV A;  4DBQ A;  1I0C A;  1NG2 A;  1UG1 A;  2JM8 A;  3JRZ A;  4WCI A;  1TUG B;  4FT2 A;  1ZUK A;  4RUG A;  3LH0 A;  1QVF S;  2VC8 A;  1K73 U;  1I5L A;  3E2U A;  3L2U A;  1M1K C;  4NL3 A;  4J9F A;  1YCS B;  1OPK A;  3JB9 H;  5IXB A;  4DOW A;  2DZ9 A;  1Q82 U;  2BE9 B;  2LRQ A;  3OW2 S;  1IRE B;  2M9U A;  1EX4 A;  4C8Q D;  3V8J A;  1Y0M A;  3CC4 Q;  3JCM h;  2KSS A;  3O8V A;  2V1R A;  3EG3 A;  2EVR A;  2EAY A;  2F2X A;  5GAM g;  5IT9 E;  3PFS A;  4GLM A;  2FRY A;  4BI8 B;  2ZZD A;  3HFN A;  4MZM A;  2BZY A;  3WXM B;  1IRX A;  2XMF A;  1UJ0 A;  3M0S A;  3GNF B;  1PSF A;  2C0O A;  3RES A;  2K2M A;  3CPW P;  5KCH A;  1JB0 E;  4DBF A;  2QEX T;  4D6W A;  3FEO A;  4MMK A;  1PHT A;  1T3S A;  1VQ7 T;  3CCJ Q;  2AZS A;  1N9R A;  3NPF A;  4WTO B;  1ARK A;  3M56 A;  3JCM V;  4M75 C;  4QT7 A;  3JB9 F;  1VOM A;  4C92 A;  1LOJ A;  3IQL A;  2YDL A;  5KYX A;  1AHJ B;  1CKA A;  1UDL A;  4XK8 E;  1PNJ A;  1WI7 A;  3JSC A;  2RD1 A;  5GAN j;  4OMF B;  4IUQ A;  3CCS Q;  2COW A;  2ZPH B;  5KYW A;  2KRN A;  1UJY A;  2KVQ G;  4HVW A;  1KD1 C;  1S1N A;  4XTW A;  4FL6 A;  3EHQ A;  2AZV A;  4A4K A;  1ZUU A;  2XKO C;  4PLI A;  1VQ9 Q;  3M0U A;  1BCO A;  4HXJ A;  4JRP A;  1KD1 R;  2FPE A;  5FU7 C;  4AG2 C;  4F04 B;  5D6X A;  2K79 A;  1VQK T;  2ECZ A;  1N8R U;  1SF9 A;  2DYB A;  3RKW A;  1YCY A;  3CXC A;  2AKK A;  1WGS A;  1RAA B;  1D3B A;  5HY6 A;  2D1X A;  2ZPI B;  4E7L A;  2DO3 A;  4HA8 A;  1YJW Q;  4II1 A;  2RQR A;  3H8Z A;  3THK A;  3X26 B;  3HSB A;  1KQ1 A;  4M7A C;  4N4G A;  2EQU A;  1D0X A;  2GFA A;  2JM9 A;  2LX9 A;  2RJE A;  5D6W A;  4FCY A;  3OY9 A;  1N8R C;  2GNC A;  5GAO n;  4DBH A;  4JJN K;  3NTK A;  3S6W A;  2LNV A;  5IHN A;  5FRM A;  1K0S A;  1RI0 A;  1X2K A;  2RI3 A;  3OMC A;  5LJ5 e;  5GAN 5;  3I55 Q;  3CME T;  1TG0 A;  2J6O A;  4KH0 B;  1OQK A;  3I56 Q;  2X35 A;  3JCM g;  4AFU C;  2KRO A;  2E4H A;  1OZ3 A;  3M59 A;  4M7A B;  1Q86 U;  2RQU A;  1IHV A;  2NUP B;  4DBR A;  2ENM A;  1H3Z A;  1KG1 A;  2D9T A;  3INZ A;  1NPR A;  1VQP Q;  3CBP A;  4XTX A;  1OU8 A;  5GMK j;  4FYY B;  4UC4 A;  2ZPB B;  4M7A G;  1Q81 C;  3CXC S;  1M2V A;  4J9G A;  2DMO A;  3MHX A;  1VUB A;  4IKF A;  3GNG A;  2DBK A;  4E2F B;  4E7K A;  1M5Q 1;  1YFN A;  5IN1 A;  4ZN3 A;  5GAO r;  1D3B B;  2O88 A;  3X28 B;  1T3L A;  5LJ5 g;  1UEB A;  2EGA A;  1YHQ Q;  3EGD A;  1NJI U;  1PG5 B;  3PNW C;  1ZBJ A;  2A37 A;  4QQG A;  1E6H A;  2YRV A;  2YUQ A;  1K8A U;  2CUB A;  4ORZ A;  1YJN Q;  1XJW B;  4R55 A;  4LDY A;  3ZL7 C;  1ZUY A;  4ELY C;  2LCC A;  1X27 A;  1MMN A;  3X25 B;  4JLI A;  3PE0 A;  3A8G B;  1NLP C;  2F2V A;  2W0Z A;  2BUD A;  3VS3 A;  4FW1 A;  2CKK A;  3M5A A;  2WSF E;  2HZY A;  2JJ9 A;  2KMT A;  4RG2 A;  3LLR A;  1B7T A;  3D7S B;  3CCM Q;  3CCR Q;  3EG2 A;  3UDC A;  1YN8 A;  3MEU A;  4EPC A;  2DKG A;  1C6V X;  2K4Y A;  1YJ9 A;  1SRM A;  1Z9Z A;  1NE8 A;  2KDS A;  4XTY A;  1VQ4 Q;  1FWZ A;  2QGF B;  4XTU A;  4ZNX A;  4D8D A;  1ZBX A;  2EJF A;  1A0N B;  3R6N A;  2COY A;  2DL5 A;  4D8K A;  5FU6 C;  4E6R A;  2NUP A;  2DVJ A;  1WXT A;  2CP2 A;  1VQ6 T;  1QCF A;  2QDL A;  2ROL A;  2LMJ A;  2QEX A;  1W4S A;  3L2Q A;  3VS6 A;  1UHF A;  2DL4 A;  2HSP A;  1TUD A;  2CGH A;  2FB7 A;  1VQP A;  1WLP B;  1MMD A;  2A08 A;  4RMO A;  1NJI C;  2FVU A;  3CD6 Q;  4FSX A;  1SHF A;  3JB9 I;  3MPU B;  4EMG A;  4XAX B;  2ZCF B;  3EGX B;  1YWP A;  1AZG B;  1QCO A;  3HPW A;  3UF4 A;  3CCQ Q;  1S72 A;  2P4R A;  5LJ5 h;  3RKY A;  3EFR A;  4OB3 B;  2WAC A;  3E1S A;  3GF5 A;  4C0G A;  4CRI A;  3L2V A;  3CC2 T;  1BI0 A;  1QVF P;  4HVV A;  4BY6 B;  4NS5 A;  1YIT Q;  4KGZ B;  2CDT A;  5KH6 A;  2RHX A;  1B3Q A;  3MEV A;  2GTJ A;  5J3B A;  3LX7 A;  2KT1 A;  4AFZ C;  3FJ5 A;  1E6G A;  3CC2 Q;  1WYX A;  1QVF A;  1T0H A;  5HK3 A;  1R8O B;  3PIP A;  4PJO B;  2QG9 B;  3JB9 J;  1TU0 B;  4RTZ A;  3S3M A;  1K9M U;  2HQH A;  4BDY A;  1SPK A;  2J6K A;  1I1J A;  2X51 A;  1ZHI A;  2QGG A;  2YRD A;  4VUB A;  3QJ6 A;  5CIU A;  5CO7 A;  4JJC A;  4OMP A;  2QK0 A;  2M02 A;  5I2S A;  3CCQ A;  1WJQ A;  2RHU A;  2DIL A;  4JRK A;  4J83 A;  4MML A;  2E1H A;  1KC8 R;  3M0P A;  1UTI A;  2EYX A;  4J6W A;  3CBM A;  2JTF A;  4F14 A;  1VQO Q;  3CCL T;  4O5V A;  3SWN A;  7AT1 B;  4NL2 A;  2XIC A;  5GAM d;  1M8V A;  2RJF A;  2KYM A;  4BB7 A;  3MP6 A;  2CH4 A;  4FIB A;  3JCM X;  3OBW A;  2NYS A;  2E5Q A;  2EBP A;  1KHI A;  2KI7 A;  3URG A;  3I56 T;  2PUK B;  5FU6 B;  4A4H A;  5DLQ E;  3U23 A;  4F17 A;  4HT9 A;  3I5S A;  1MND A;  5CVI A;  4DEY A;  1DJ7 B;  2J06 A;  2JMA A;  3CCM T;  5FW9 A;  2Y90 A;  1ZSG A;  2C0T A;  3GP8 A;  1H92 A;  3A8O B;  3OBY A;  3F70 A;  2DXB A;  2V8K A;  4XU3 A;  3OYE A;  2JS2 A;  1X01 A;  1GCQ C;  4J9C A;  4KGX B;  2JTE A;  3JCM d;  5L23 A;  4CC4 B;  4EMH A;  2RK2 A;  3MKD A;  4OB1 B;  1WA7 A;  1O75 A;  1D0Z A;  4M75 A;  1FMW A;  5KYW B;  1KQS A;  1TS9 A;  5I22 A;  3M0Q A;  2HBW A;  3A8H B;  1X6G A;  1HXD A;  1GBR A;  4C8Q F;  4KT0 E;  1RAI B;  3UA6 A;  2DER A;  5KYY B;  1WHG A;  2HQE A;  3VS1 A;  1CSK A;  3CC4 T;  4XTZ A;  2LT1 A;  2DEQ A;  5GAO m;  2MI6 A;  4M77 E;  3EFO B;  1VQ8 A;  2RPN A;  1VQM A;  4C0F A;  2CRE A;  2KQW A;  1Y71 A;  1M2O A;  2L5Q A;  1YJ9 T;  3HHT B;  1VQ5 Q;  3VU3 C;  1TUC A;  1JXO A;  2LTO A;  2CT4 A;  4X34 A;  1Y96 A;  1QVG P;  2DNU A;  1ZA1 B;  1V29 B;  2X4Y A;  4OMN A;  1G5V A;  2DD5 A;  2HNI A;  2H8H A;  1R77 A;  2NLU A;  4C5H A;  3MET A;  1B07 A;  4L5G A;  5GAN 2;  3G4S Q;  5GAN 3;  3EG1 A;  1WIE A;  2D8H A;  3OYN A;  1Y07 A;  1GBQ A;  4ME7 A;  4ZTJ A;  3M4G A;  4C8Q A;  5GAN g;  4BE0 A;  3G71 T;  4OGE A;  1AWO A;  2LZ6 B;  4JS5 A;  2D6F A;  5FLX E;  3CC7 T;  3RDV A;  4JDS A;  1KQS S;  4AT1 B;  1C1A A;  3PT9 A;  3BDU A;  4M7D D; 
#chains in the Genus database with same CATH homology
 4J9E A;  1BB9 A;  1U06 A;  1UJY A;  4J9I A;  2DL3 A;  1UEC A;  2F2W A;  4HVW A;  1HD3 A;  1S1N A;  1M27 C;  1RI9 A;  3EHQ A;  3TSZ A;  1G2B A;  2AZV A;  3PVQ A;  4LN2 A;  4CC7 A;  1ZUU A;  5I11 A;  4LUE A;  1NEB A;  3EG0 A;  2VKN A;  3M0U A;  4HXJ A;  2FPE A;  3VS7 A;  2LNH B;  4AG2 C;  2J05 A;  2K79 A;  2D0N A;  3VRY A;  2ECZ A;  3REA B;  2ED1 A;  2M51 A;  1UFF A;  1SEM A;  2L3P A;  2DYB A;  1RUW A;  2LCS A;  2EYW A;  3SEM A;  1OEB A;  2AKK A;  1X2Q A;  1K76 A;  2D1X A;  3QWX X;  3H41 A;  2EYY A;  1U5S A;  2RQR A;  3THK A;  4FSS A;  2SEM A;  3M0R A;  2CH4 W;  1PKT A;  3RBB B;  2NUZ A;  4JJB A;  4DEX A;  2JM9 A;  1GFD A;  2GNC A;  2LQW A;  4CC2 A;  5IHN A;  2O9V A;  1HSQ A;  1I07 A;  2YSQ A;  1K0S A;  4LUD A;  1X2K A;  1K9A A;  2A28 A;  1TG0 A;  2J6O A;  2EKH A;  4AFU C;  2KRO A;  4JZ3 A;  3NGP A;  3M0T A;  4LE9 A;  4OMQ A;  2I0N A;  1W1F A;  2LP5 A;  2RQU A;  1NYG A;  2ENM A;  5GJV B;  4Z89 A;  3C0C A;  1ZX6 A;  2DLP A;  1EFN A;  4KRT A;  1K1Z A;  4K11 A;  4ESR A;  2X3W D;  4F16 A;  4J9G A;  1J3T A;  2DMO A;  1M3B A;  4J9H A;  2DBK A;  1RLQ C;  4Z8A A;  2G6F X;  2KNB B;  3GBQ A;  2MCN A;  2DX1 A;  3A98 A;  2ABL A;  2FPF A;  2DE0 X;  2K9G A;  3ULR B;  2KYB A;  2FEI A;  3VS0 A;  2O88 A;  1KJW A;  2VVK A;  4RTX A;  1T3L A;  1VYV A;  1WDX A;  2EGA A;  2AK5 A;  3CQT A;  1ZBJ A;  4LNP A;  2B86 A;  1JXM A;  2HEQ A;  1BU1 A;  2A37 A;  1E6H A;  2RQT A;  1M3C A;  2DRK A;  2YUQ A;  2CUB A;  4ORZ A;  1WX6 A;  3VRZ A;  1MV0 B;  3ZL7 C;  1UHC A;  1ZUY A;  2L3S A;  2GGR A;  2CT3 A;  4JZ4 A;  2BZ8 A;  1X27 A;  2JW4 A;  4RTU A;  3NHN A;  3PE0 A;  1NLP C;  2F2V A;  2W0Z A;  3VS3 A;  2EW3 A;  2KXC A;  2DF6 A;  1WXB A;  2CUD A;  4X1V A;  1LCK A;  4AFS C;  5IH2 A;  1NM7 A;  1MV3 A;  3I35 A;  3EG2 A;  1CKB A;  1YN8 A;  2PTK A;  1VA7 A;  1GCQ A;  2E5K A;  1SRM A;  2DRM A;  1Z9Z A;  2OI3 A;  2KE9 A;  1K0X A;  3O5Z A;  4ZNX A;  4D8D A;  4HVU A;  1A0N B;  1M30 A;  2D8J A;  2ED0 A;  2LJ3 A;  3R6N A;  2DL5 A;  1JO8 A;  1SRL A;  4D8K A;  4Y92 A;  1BBZ A;  2PZ1 A;  1JU5 C;  4E6R A;  2DVJ A;  1WXT A;  1HJD A;  1RLP C;  1QCF A;  2QDL A;  1YWO A;  1YP5 A;  2ROL A;  2LMJ A;  1MUZ A;  2AKL A;  4IIM A;  3KFV A;  3VS6 A;  1UHF A;  2RNA A;  2DL4 A;  1W6X A;  2HSP A;  1AVZ C;  1TUD A;  2VWF A;  1QWF A;  2EYZ A;  1WLP B;  4RTT A;  2A08 A;  4Z88 A;  5IHI A;  5HCK A;  3PVL A;  1SHF A;  1AOJ A;  2L0A A;  3LH5 A;  1YWP A;  1KSW A;  1AZG B;  1XOV A;  2O2O A;  2KBT A;  4M4Z A;  3UF4 A;  2DJQ A;  2P4R A;  2GTO A;  2KEA A;  2GQI A;  2RN8 A;  1WXU A;  5FWB A;  2PNI A;  3UA7 A;  1V1C A;  3NMZ C;  2HCK A;  4HVV A;  2IIM A;  2RQV A;  1AWJ A;  1KIK A;  2CDT A;  5EC7 A;  2JMC A;  2HDA A;  4AFQ C;  1B3Q A;  2GTJ A;  1NYF A;  2KT1 A;  4AFZ C;  2YUN A;  3FJ5 A;  2RMO A;  4IIO A;  1E6G A;  1T0J A;  2M0Y A;  2KR3 A;  1WYX A;  2DM1 A;  3EGU A;  2CSI A;  1T0H A;  1E7O A;  2FRW A;  2LX7 A;  1N5Z A;  1PWT A;  2K7A A;  4AG1 C;  5ECA A;  4RTZ A;  3REB B;  1GL5 A;  1SPK A;  2J6K A;  1I1J A;  1QKX A;  2DA9 A;  2JS0 A;  3TVT A;  4OMM A;  2ROT A;  1KFZ A;  2ESW A;  1UGV A;  4JJC A;  4OMP A;  1OPL A;  1QLY A;  1ABQ A;  2DIL A;  1OOT A;  2YUP A;  2BZX A;  3JV3 A;  1JQQ A;  3M0P A;  1UTI A;  2EYX A;  2LJ1 A;  1IO6 A;  1YNZ A;  4R0K A;  4F14 A;  1VYU A;  2KYM A;  1SSH A;  2CH4 A;  1H3H A;  1AEY A;  5GJW B;  5IXF A;  2W10 A;  2KT8 A;  1GRI A;  2EBP A;  4RTW A;  1M3A A;  2DBM A;  3VS5 A;  2SRC A;  2O31 A;  1WFW A;  3SHW A;  3U23 A;  2GBQ A;  4A63 B;  1OV3 A;  2FO0 A;  3H0I A;  4F17 A;  1AWW A;  2L3Q A;  3I5S A;  3VS2 A;  4GBQ A;  2A36 A;  2NWM A;  4DEY A;  1H8K A;  1UUE A;  2J06 A;  2JMA A;  5FW9 A;  4HCK A;  4J9D A;  1FYN A;  1ZSG A;  2C0T A;  2K6D A;  3TSW A;  1GFC A;  4RTY A;  1H92 A;  1W70 A;  2LJ0 A;  2EPD A;  1AD5 A;  1ABO A;  4OMO A;  2CSQ A;  2JS2 A;  1AWX A;  1X6B A;  2J6F A;  3I5R A;  2YT6 A;  2O9S A;  1GCQ C;  1U3O A;  4J9C A;  2LQN A;  2KRM A;  2KRS A;  4JJD A;  2JTE A;  1NEG A;  2OJ2 A;  5L23 A;  2JXB A;  4CC4 B;  1QWE A;  4EIK A;  1Z9Q A;  4J9B A;  1JEG A;  1PKS A;  2EGE A;  1PRL C;  1WA7 A;  1GCP A;  3EHR A;  2DL8 A;  2RQW A;  3I9Q A;  5I22 A;  3M0Q A;  2HBW A;  1I0C A;  2MOX A;  3UAT A;  1NG2 A;  1UG1 A;  2FG0 A;  2JM8 A;  4JPB W;  1X6G A;  4WCI A;  1ZUK A;  2EQI A;  4RUG A;  1Y57 A;  1GBR A;  1PRM C;  1ZLM A;  5FWC A;  4J9F A;  1YCS B;  3UA6 A;  1OPK A;  5IXB A;  2C0I A;  4RTV A;  3H0F A;  2X3X D;  1CSK A;  3H0H A;  3VS1 A;  1Y0M A;  3VS4 A;  2EGC A;  1AZE A;  5IHK A;  1X43 A;  2OAW A;  2V1R A;  3EG3 A;  2EVR A;  2F2X A;  2BTT A;  2KXD A;  4GLM A;  2YUO A;  1UE9 A;  2RPN A;  2CRE A;  2FRY A;  4CC3 A;  1VYT A;  1SHG A;  2BZY A;  2DL7 A;  2XMF A;  1TUC A;  4OML A;  1JXO A;  1UJ0 A;  2CT4 A;  3M0S A;  3QWY A;  2K2M A;  2C0O A;  1G83 A;  2DNU A;  1M8M A;  4OMN A;  2MIO A;  2RF0 A;  2H8H A;  1B07 A;  1PHT A;  1T3S A;  2AZS A;  3RNJ A;  3NPF A;  1FMK A;  1X69 A;  2J7I A;  1ARK A;  1K4U S;  3EG1 A;  1WIE A;  2L2P A;  2D8H A;  4QT7 A;  2V1Q A;  1QKW A;  3IQL A;  1GBQ A;  2YDL A;  1CKA A;  1UDL A;  1PNJ A;  1WI7 A;  1NLO C;  2K3B A;  1AWO A;  2LZ6 B;  2FPD A;  2KGT A;  1BK2 A;  2JT4 A;  2KRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...