4C8QD

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
81
Chain Sequence
LPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAIAVKLNEIYIRGTFIKFIKLQDNIIDKVKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 81
sequence length 91
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qD00
1BIAA 2DTIA 4M7DD 2DZ9A 1JRIA 4M7AE 2CGHA 5GANj 5GAMe 3QSUA 4C92D 3JB9J 4M78E 3V7RA 3JCMJ 4J5YA 5GMKj 5GAMh 5GAOl 2FYKA 2VC8A 4EMKA 4HT8A 4XU0A 4QVDA 1HXDA 4N0AC 5LJ3e 1D3BA 1LNXA 4XTXA 3RKWA 1I5LA 3V8LA 5LJ3h 4C8QE 2DXTA 4NOYA 5GAOr 3JB9D 4M7AC 2HNIA 4MMLA 3PGGA 1BIBA 5GAN8 2VXEA 4HA8A 2DTHA 2EJGA 3L1AA 1I81A 2YLBA 4M78C 4M77B 4C8QG 2DVEA 5GMKm 1X01A 5GAMg 4PJOC 2E65A 3SB2A 4F7UB 5GANf 4XTUA 5GAOp 3JCMh 5LJ3g 3SWNA 4C8QC 3AHUA 4XTWA 3FB9A 1WQWA 3HFOA 4MMKA 1WQ7A 4M75F 2EJFA 2RA2A 5I21A 4HT9A 5LJ5f 1B34A 3V8JA 5GAN2 4C8QA 3BW1A 4M7DF 4PJOE 2DXUA 4M7AG 5GAN7 2QTXA 4M75B 3HFNA 3RUXA 1WNLA 1MGQA 5LJ5d 5GAN3 4XTZA 3JCMg 3BFMA 5GAMd 1M8VA 4M78G 4M7DB 2EWNA 4PJOG 5GMKi 4XTVA 4XTYA 4M77F 5GMKe 2RB6A 3JCMW 4JUVA 4C8QD 4EMGA 4DQ2A 2YHTA 3RESA 4EMHA 4F7UF 4N0AA 3JCMP 4M75E 3JB9F 1KQ1A 2I2LA 4JRIA 4OP0A 4V2SA 1WPYA 5GAMj 1LJOA 4J6YA 5GAN5 4NL2A 4X9DA 4M7AA 4M7DE 3QO3A 2E10A 4RCCA 3EFRA 4WF2A 4XU2A 3BY7A 4X9CA 5GAN6 1N9RA 4M78A 3JCMX 5LJ3j 4PJOA 4J6WA 1KQ2A 1Y96A 3RKXA 3JCMd 3FIFA 4M77E 4RCBA 4EMKB 1U1SA 4M75C 4JLIA 1D3BB 3V7SA 2FB7A 4M7AD 3V7CA 4F7UE 2DZCA 4M7DC 5GAMf 3EFSA 4M77G 4NL3A 2Y90A 4C92F 4M78D 5LJ5j 4PJOD 1I4K1 4F7UG 3HSBA 5GANe 4XQ3A 2RM4A 3JCMb 1M5Q1 5LJ3f 1JBMA 2DEQA 5GANh 2ZGWA 4C92B 2DTOA 4M77C 3JB9I 2DKGA 5GMKh 3INZA 5LJ3d 3JCMV 3SWNB 3QUIA 1I8FA 3JB9H 1N9SA 4M77A 2DJZA 3BDUA 3RIRA 3JCMc 4M75G 2EJ9A 5GAOm 4C92E 3JCMf 4EMKC 1B34B 4F7UA 4QVCA 4C8QB 5GMKl 5LJ5e 5GANg 4M7DG 2E41A 2RD1A 3FJPA 5LJ5h 4PNOA 3V8KA 4A54A 5DY9A 4C92G 5GAOn 4XU3A 4JRKA 4M77D 3JCMQ 3RERA 1LOJA 4A53A 1H641 4M7AF 2YLCA 4C92C 5CAIA 4M75A 2E1HA 2JN0A 3JB9G 4M78F 2E64A 3M4GA 4J6XA 3QHSA 4XU1A 4PJOF 3L2ZA 5LJ5g 3SWNC 4M7AB 1HK9A 2K57A 2VXFA 4M7DA 1YCYA 5GAN4 4Y91A 4C92A 3JCMe 5GANd 3VU3C 4M78B 3RKYA 1TH7A 3GIBA 2EAYA 4PJOB 4C8QF 1U1TA 5GAOq 4M75D 1Y96B
chains in the Genus database with same CATH superfamily
1H3HA 3X24B 4BE1A 1TS9A 1JRIA 2ZPIB 4C92D 1VYVA 4QKUA 1G3YA 2JM8A 1HXDA 3E9GA 1I5LA 1PRLC 3FEOA 2EGAA 1MHNA 2DX1A 2WSEE 1Q82R 3QIIA 2KDSA 5CK9A 1D0YA 3JCMh 1RUWA 4M75F 5DLOA 1OX8A 4OMQA 1WXTA 5IT9E 1S72Q 1X6GA 1JO8A 4PL6A 3JCMg 5GAMd 4M7DB 1UECA 4XAXB 4N4IA 2L3PA 4UC4A 2CS7A 3THKA 4C8QD 1QW1A 1W70A 2C0TA 2QI2A 4KBMB 2DJQA 4JJDA 1K73C 3M4YA 2XICA 4PJOA 2EQMA 2MF2A 3M0PA 1VQ6A 4JRPA 5CVIA 4EMKB 2FRWA 4AFSC 1FMVA 3UA7A 3CCQT 1PG5B 2EYZA 3EFSA 2EQKA 2RI5A 2JT4A 3DLMA 2SRCA 2DEQA 2ZGWA 1BB9A 1VQLT 2VKNA 2HMAA 8ATCB 2EW3A 5D6WA 3CC2A 4PFZA 4FW2A 4RUGA 3RIRA 3EG9B 1UHCA 2DPPB 5GAOm 1VQ8A 1QWEA 1YHQT 1RLPC 1V29B 2K2MA 1BCOA 2NUPB 1WX6A 2DRKA 2LC4A 1WI7A 4E2FB 1ZA1B 4J6XA 1CKBA 1ZBJA 1V1CA 3QBYA 1YCYA 2BE9B 3L2UA 2KRNA 3C0CA 3PIPA 4L5GA 3OA6A 4CRIA 1BIAA 1D1CA 4AFQC 4M7AE 1KSWA 3TREA 1C0MA 1QLYA 2WSCE 2RHUA 2FYKA 2QQAA 3SFMA 1FXXA 4HT8A 4N0AC 4OVAA 2C06A 2OTJA 2YUOA 4A4KA 3NMZC 4V2SA 2MI6A 3ULRB 3CC7Q 5HKCA 1WHJA 2FL7A 2JW4A 1M2VB 2QQSA 1LVKA 3JSCA 3EFOA 1WQWA 4PLLA 2QTVA 4LDYA 2RK1A 1YIJT 2YT6A 1Y0MA 4PJOE 2ENMA 3GOXA 4KH0B 5GMKi 1UHFA 4LDUA 2LNHB 2OX7A 4M77F 3I5RA 4KUDK 5DLQE 1VQ4T 3H0IA 3OYJA 4EMHA 4F7UF 2BZYA 4OP0A 4FT4A 4AG2C 2PTKA 1LJOA 4J6YA 1AD5A 2EGEA 1M90R 5KYUA 2J6KA 2EKHA 3L2RA 4X9CA 1VQ9A 1WGSA 2KVQG 1T0JA 2P0QA 2DXCA 3OYYA 2QQ9A 1Y71A 2FB7A 2HQEA 3V7CA 2X4XA 1KHCA 2ZZDA 2IVWA 4M78D 1D0ZA 3DB4A 2X9HA 4EIKA 4PFOA 1W4SA 1YJ9A 3CCRQ 1RAEB 5A0GA 4KGZB 3KUFA 3BDUA 1ZUUA 1PM3A 1QCOA 1YJWQ 4WTOB 1NYFA 1SHGA 3HPWA 2COYA 6AT1B 3UDCA 3NTHA 2HDAA 2ZPBB 3GLXA 1D1AA 3WVEB 1NJIR 2L89A 4PJOB 3D7SB 5HY6A 5GAOq 2DL5A 4M7DD 1Y7XA 1RAAB 2LT4A 3CC4A 4J9BA 2MWOA 1VQ6T 2M0YA 2QGFB 4LD9K 5GJVB 3A8GB 1TOVA 2VXEA 4OMNA 4M78C 4N4GA 3MEUA 1LCKA 4KUIA 2V8JA 2K5LA 5GAOp 1Q81U 5KYXA 2X4WA 2PUKB 2A28A 1UFFA 3I35A 3S3NA 5I21A 2MWPA 3CC2T 2RQTA 2D8JA 4RTXA 1WFWA 2RHZA 1GBRA 1VQ8T 1WJSA 1ZQ1A 2JTMA 3QJ6A 4JUVA 1FWZA 2YHTA 1PKSA 1GCQA 2HL5C 4ZGJB 5I11A 3CXCP 3FRNA 3TCJA 3J80E 5D6XA 2RI3A 2DAQA 1K76A 4BDZA 2LP5A 4RTUA 2E4HA 3E19A 2A0FB 1U1SA 2XK0A 3LH0A 1YN8A 4MZPA 4M7DC 2RPNA 3DB3A 1M8MA 4XQ3A 1CSKA 1TXQA 2GGRA 2HBWA 3INZA 2DLPA 3WVDB 3EFOB 2CKKA 2HL3A 2OTJT 2DYBA 4EMKC 1Q81C 1VQMQ 2KRSA 3M5AA 1KG1A 4C92G 4CC2A 1S72A 4AG1C 3SD4A 4A53A 1A0NB 4Y28E 4CC3A 1SEMA 4N4HA 2QAZA 1IHWA 1PSEA 2E1HA 4BY6B 5KYUB 3QDFA 3G6EQ 4J83A 3EHQA 1WHGA 5FWCA 1UEBA 4JRQA 4E7SA 3OMGA 4X1VA 2RHIA 2F1LA 1KC8U 2DMOA 1AWOA 5GMKj 2KRMA 4A4FA 5IHIA 1VQ9T 3CCMQ 4R56A 1WJQA 3TSWA 1UB4A 4J9FA 4MMLA 1KHIA 2G6FX 4XK8E 4C8QG 1HD3A 2DVEA 2DL8A 2MPXC 3A5ZB 1AWXA 1IRXA 1YJ9T 2LT1A 3QG1A 3FB9A 3HFOA 3URGA 2EYQA 5CO7A 2EJFA 2RA2A 5GAN2 3LWIA 2RHYA 3META 1WNLA 3H0HA 1M8VA 2HBPA 1R8OB 4E7HA 2LQKA 2F69A 3PT9A 1IGQA 3JCMP 3M54A 3PVLA 4FL6A 1JEGA 4M75E 1X43A 1EIFA 3CCSQ 2LJ0A 1I5OB 1OZ2A 3J81E 2CZ1B 2NWMA 3GBQA 3KBGA 3OYGA 3GP8A 4E7JA 4GLMA 1KC8C 2LRQA 3S3MA 1OPKA 4PJOD 2HEQA 1VQNQ 1QVFP 4RTWA 2QQRA 1JBMA 3CC4T 2AZSA 4C92B 4IKFA 3CC7A 2OAWA 2KNBB 4FYYB 5KYXB 2JMCA 4M77A 3OBYA 2FPEA 4F7UA 4JS5A 1K1ZA 2O88A 1TUCA 2E41A 3EGUA 1VYUA 4BE2A 3H41A 3QKJA 2DM1A 2V26A 1N8RU 1UUEA 4OGCA 5GANd 2CP5A 1RACB 2QDLA 2GFUA 2CSIA 4F14A 2EYWA 3C4SA 1MMDA 1OV3A 2M0OA 3X26B 1BU1A 4DOWA 2EQJA 2FRYA 3R6OA 2DYIA 3TU4K 2COWA 1B07A 2D8HA 3CCRA 1I81A 4IUPA 4PJOC 3A8OB 4XTUA 1O75A 3REBB 1WQ7A 4JDSA 1YJWA 1JB0E 2O4XA 3OYFA 2DXUA 3M57A 2C0IA 3HFNA 4A4GA 3MP6A 4M78G 2EWNA 2X4JA 4XTYA 1KK7A 1S72T 1N8RC 1SHFA 3E9FA 4JRIA 1OZ3A 1WPYA 2CP2A 1AT1B 5GAMj 3EFRA 2OI3A 4ATOA 4J8OA 4GLKA 4DBQA 3L2WA 4M77E 1Q7YR 4C0FA 4F7UE 2DZCA 4OB1B 3OB9A 4NL3A 2ZAEA 4DEYA 2GQIA 1M1KU 3G4SQ 1MMAA 5D6YA 3VS4A 2A7YA 1W2BP 1AVZC 5C0MA 2AKKA 3JCMV 2GTOA 1K9MU 3CCLQ 2QEXQ 4HVUA 3CEYA 3FDRA 1TSFA 1J3TA 2XMFA 2PZ1A 3SHWA 4J9IA 4HVWA 3QXEB 2DE0X 3M0SA 4M7DG 2R57A 4J9DA 1GFCA 3RDVA 4A54A 2RNAA 4B9XA 2Z0WA 5A0DA 2C0OA 3ASKA 1LOJA 2RQUA 1WHMA 1M1FA 1YBYA 2KAFA 3L2ZA 4JJCA 2LQNA 4DBRA 2DTIA 2EGCA 1PD1A 3MEVA 5GAMe 1VQOQ 4R55A 2E3HA 1FYNA 3P8DA 1DJ7B 3QJYA 4RTTA 1UGQB 4HCCA 1YI2Q 3H6ZA 2DEUA 4M77B 4F7UB 1K73U 1JJ2A 1BYMA 1K9MC 4A4HA 3CC7T 1VQMA 3I9QA 1B34A 2DRMA 3NFCA 2LJ3A 4X34A 2LCSA 4OMPA 2HQXA 3BDLA 5J39A 1M1GA 4J7FA 4CI0C 5IXFA 3HRSA 3G6EA 1UDLA 2DBMA 3UPUA 1PCXA 4M7AA 1T3LA 1VUBA 4ANJA 1ZSZA 4E7IA 3VUZA 4E47A 3OS1A 3CCMA 2JTEA 4A63B 4RTVA 1BI0A 2KBTA 2QDYB 2ZPGB 3JCMb 1M5Q1 4OF1A 1WYXA 2CP6A 1I8FA 4JS4A 5HK0A 3TVTA 3CCRT 1OI1A 3LGFA 2O4XB 2RD1A 4MZMA 1KD1U 4JRKA 4IURA 2QQBA 2E5QA 4OMLA 5IH2A 1AWWA 1PRMC 2J6OA 5I2MA 1AZGB 2F2XA 4C92C 1YJWT 1MMNA 2DNUA 3CPWS 1UTIA 4F04B 3CCSA 3RKYA 1TH7A 3CCUQ 4TVRA 4PJMA 2LVMA 1K8AU 3QDRB 1QWFA 4J5YA 1B7TA 3CPWA 2VYTA 1VQNA 3JB9D 2DXTA 4NOYA 2F5KA 4EDUA 4KRTA 1BIBA 4KGXB 4ELZC 1UGVA 2KE9A 3ME9A 4QQGA 1S1NA 4C8QC 1M3BA 2BUDA 4HXJA 4M4ZA 4LDXA 1RI0A 1KD1C 2QYZA 4ZTFA 2BKDN 4PJOG 1M30A 3L42A 3C95A 2PUOB 2KEAA 2YUNA 2CP0A 2DFUA 1M3AA 1X27A 1AZEA 2DD5A 2RQWA 4QQDA 1N9RA 2GQVA 1IO6A 4C0GA 3FIFA 5FROA 1K8AC 1K0XA 1YWPA 1BCMA 3KXTA 2ESWA 5IAYA 2K7AA 5GAMf 1PHTA 2EKOA 2ROLA 2DTOA 1YP5A 3QWYA 1EFNA 4FYWB 3MP1A 1N9SA 4O6JA 2RJEA 1B34B 1GRIA 5GAOn 3LYIA 2PQWA 4L59A 4M77D 1R0CB 1VQMT 2VB6A 4BDYA 5A0LA 4M78F 2E64A 4ESRA 3A8HB 4XU1A 4M7AB 3OW2P 1PC0A 3RMQA 2K3XA 3JCMe 1YJNT 1X2KA 1ZSZB 1ZA2B 2CH4W 3C12A 5FU6B 2QG9B 4VUBA 1MUZA 4BI3A 4LXCA 4C5EA 3G6ET 2M51A 4YTLA 2CGHA 3CMEQ 4KGVB 2ECZA 4CC4B 3G4SA 4IUTA 4Z88A 1QVFS 3CCJQ 3CD6Q 2MCNA 3RKWA 1H92A 4HCKA 2DIQA 5GAN8 3CCMT 1HJDA 2JZ2A 1ZHIA 4HA8A 5LJ5j 1H8KA 2VWFA 3CCLA 5GMKm 5DM7R 2QEXA 3MJXA 1K4US 3QYGB 3SWNA 2P4RA 1OU9A 3M55A 2QA4Q 2LCLA 2CT3A 1Q86R 3V8JA 4M7DF 4C0DB 1OEBA 4P5NA 4XTZA 3PIOA 3VV0A 1Y07A 4B6MA 2X35A 1H3ZA 3EH2A 2M16A 2YRCA 2IIMA 5CKHA 4IUQA 4MZTA 1M1KR 3JRZA 4XU2A 2FZGB 1I0CA 4Z02A 2K4YA 1VQOA 2JVVA 3JCMd 3OYIA 3CCST 3HRUA 2XD0A 1M2OA 3OYAA 5CIUA 2F2WA 4FYVB 1G3WA 1YI2A 3PNWC 1QKWA 1JQQA 1WLPB 2JOYA 2FHDA 1WXBA 5GMKh 1VQNT 9ATCB 1G8XA 4LNPA 1TU0B 3PE0A 1NLOC 5LJ5e 2EBPA 1OULA 4QVZA 3LW5E 1VOMA 3M0UA 2GNCA 2VASA 3S3OA 2YRDA 2XI9A 5CAIA 2DBKA 3F70A 4M75A 3UA6A 3M4GA 3O8VA 2X4YA 3HL8A 3OYHA 5KYYA 2R5AA 1ZUKA 3L2VA 2J7IA 1KQSS 3I56Q 2HKNA 5FU7B 1NEGA 2L5QA 4BE0A 5GANj 1GCPA 2CUDA 1QP2A 1Q82U 5LL6S 3CMAQ 1K73R 3A1PA 1X75C 1TG0A 1NE8A 3CBOA 3VS1A 2XKOC 5FRMA 3FC3A 3E2UA 2DETA 1YJNQ 2DF6A 3NTKA 4DOVA 1KQSA 3OS5A 2OAUA 1VQPQ 2O9SA 1QVPA 4J7IA 2CZ6B 3VJPA 2GFAA 4Q5WA 1NPRA 2RH2A 2E6NA 2JMAA 2ED1A 1M4ZA 2QTXA 3P8HA 5LJ5d 1AHJB 4HKEA 1GL5A 2AK5A 2WSFE 3VS5A 1FMKA 2L2PA 4J9EA 3TEEA 3A98A 3JCMW 2X3XD 4BACA 1VQ7Q 3PMTA 4HCZA 4BB7A 3CCUA 2FZCB 2EPDA 3NGPA 4LUEA 3JAME 3BY7A 1G5VA 1OU8A 2J05A 2WACA 5AT1B 1Y96A 4JLGA 4OMMA 4HCBA 1PWTA 5I22A 4M7AD 2VV5A 2CDTA 2NUTA 2KY9A 1Q82C 2CT4A 1UJ0A 1I4K1 2P0PA 5GANe 2D6FA 3E1SA 1KFZA 4BI4A 3G4ST 3SWNB 2YUQA 1TUDA 2AKLA 2LQ8A 3CCVQ 5GMKl 1X6OA 3PMIA 1IHVA 2EYXA 3CCLT 2QEXT 2CP7A 2KXDA 5J3BA 3OYMA 3ZEHA 2RJCA 2XDPA 4OB2B 4PLIA 4PJJA 3JB9G 4PJOF 1WJRA 3UT1A 2KK4A 4F17A 3M0RA 1ACMB 2BZXA 4GY5A 1GXIE 2VVKA 4BUGA 5CCAA 2P4TA 1TUGB 4A4EA 3JB9J 3MEWA 5GAMh 4HVVA 2VC8A 3X28B 1RAGB 1D3BA 3ZL7C 2KI7A 1VQOT 1ZBXA 2YSQA 4M7AC 2DL3A 1AWJA 1ZSZC 2EJGA 3JB9I 4RTZA 3OYEA 5GAMg 5FU6C 1X01A 3H8ZA 1YI2T 1AEYA 3QZ9B 2ZCFB 4RMOA 1E6HA 2EQIA 1M9SA 1RABB 1NBEB 3GF5A 3OYLA 5LJ5f 2DIGA 2RK2A 1NZ9A 4GBQA 2HSEB 4M75B 1M90U 5GAN3 2X51A 4AT1B 3EG1A 3P8BB 3EGXA 1B3QA 2JUFA 1XTDA 1XJWB 4DBHA 5CQXA 2E10A 3CMEA 1C1AA 4C0DC 3CQTA 2OTLQ 5FRNA 3CCJA 1NLPC 3CD6A 4M77G 2PNIA 4D8KA 4F7UG 2XDDA 2D0NA 2KSSA 5IHKA 2HZYA 4JJBA 2DL7A 2JJ9A 3QUIA 1E7OA 3RNJA 3JCMc 1U3OA 2QA4A 3OQ5A 2H3JA 2PVOB 1EZZB 1NJIU 2DERA 3JCMQ 1NPPA 2EFIA 2KMTA 3LH5A 1M90C 2LX9A 4LDVA 1VQKQ 5L23A 2JN0A 4QT7A 1X2QA 1UGSB 2LTOA 2PVDB 5GAN4 4JZ3A 1RL2A 2ZPFB 3KFVA 1G2BA 3GIBA 1QCNA 1Y96B 2NLUA 1U5SA 3CCUT 2NUTB 2LZ6B 4M78E 4DA4A 2FVUA 2OJ2A 4RTYA 1LNXA 4XTXA 2E3IA 5GAOr 4OMFB 2HNIA 3PGGA 2M1HA 1ARKA 4II1A 2GF7A 3L1AA 5GANf 3CBPA 1O9SA 3M59A 1R77A 8AT1B 1G3SA 1FMWA 2AT1B 2HAXA 1OYXA 1KJWA 5FU7C 2B86A 3M9QA 4FSXA 4XTWA 1Q95G 1NEBA 1XQHA 1RLQC 2MAMA 3UF4A 5GAN7 1NJIC 4AFZC 1T3SA 2RJDA 2XU8A 4L6V5 4BY6C 1Q81R 1VQ5Q 1ZLMA 2RB6A 4RG2A 2I0NA 1GBQA 4EMGA 4WCIA 4CC7A 4M7DE 2IG0A 2FPFA 3I56A 4DEXA 5GAN6 2QXFA 2DVJA 5LJ3j 1BI1A 3M53A 3OSSC 4B9WA 2RO0A 1D3BB 2V1RA 3CMAA 3HP9A 2D0QB 4C92F 5KH6A 1YITQ 3LX7A 1YJNA 3HSBA 4AMCA 4E7LA 3MEAA 2DXBA 1VQPA 1U06A 1SF9A 1V76A 2V8IA 2H3EB 2DJZA 3J7AF 5ECAA 5M9OA 1YWOA 1T0HA 2G3RA 3FJPA 4FW1A 2YRVA 1TWBA 3EGXB 4F16A 2O31A 2CH4A 2YLCA 1Z9ZA 2HSPA 1VQ7A 3I55Q 4LDWA 3SWNC 5A2QE 4C5HA 2A36A 1NYGA 3GNFB 4C8QF 4M75D 3NPFA 2M02A 3VUBA 2DO3A 2HQHA 5IXBA 4XU0A 5LJ3e 1F1BB 3VS7A 3CMET 1NM7A 4K11A 1HSQA 4C0ZA 2L3SA 1BI2A 1JU5C 3OYCA 2W0ZA 1IGUA 5EC7A 3ZBDA 3CCJT 3CD6T 3RR6A 1KC8R 1VIFA 2E65A 3CXCS 3EAEA 3CCVA 1ABOA 2EVRA 4JPBW 4EPCA 1WIEA 4MMKA 3BW1A 3EG0A 3G71Q 4M7AG 2QA4T 1MGQA 2Y4XA 1WXUA 3CXCA 3BFMA 1VA7A 2CREA 1GCQC 2FO0A 1YFNA 3VS2A 3JB9F 1OPLA 3CCET 2I2LA 2FPDA 1I07A 2BZ8A 3MO8A 3QYHB 4QW2A 4FM4B 3UATA 3JCMX 2FEIA 3I5SA 4M75C 3MCAB 3MKDA 2J6FA 1QP3A 2NUZA 4KT0E 4PKCC 3HTRA 5LJ3d 5CKEA 4ZGEB 4OMOA 2RF0A 1MV3A 2O2OA 2MIOA 4IUVA 5LJ5h 4DBFA 2L3RA 5IN1A 2BTTA 2QK0A 3PVQA 4ORZA 2K2VA 3OBWA 3MHXA 1K9AA 3REAB 1Y57A 3VS0A 5LJ5g 4FYXB 2J06A 2ABLA 3M0QA 4LN2A 4OB0B 3M58A 1N8RR 2DZ9A 2OTLA 1QKXA 1N27A 3VS6A 3I56T 2HKQB 1BK2A 2K5IA 3V8LA 3LLRA 3CMAT 3H9NA 4FSSA 2JS2A 1TTHB 1WHHA 1WHKA 4AFUC 2E6ZA 2VGMA 3DLLA 2B8AA 1VIEA 1VQPT 3AHUA 1OX9A 2XHCA 3A8LB 1QVGP 3LWHA 3VYGA 2AIRB 3OS0A 4ZN3A 1YNZA 2EQUA 1JJ2P 3RUXA 3M0TA 1VQKA 5L8RE 3R6NA 1LPLA 3Q1JA 3EH1A 1Q7YU 5CR2A 4QQ6A 2F5TX 3QO3A 4WF2A 4BI8B 3OY9A 1VQ7T 1P92A 1VYTA 3FLGA 1WZOA 5CQYA 3CCQQ 5J26A 1QVFA 4IIOA 4J6WA 2K5FA 3VRYA 1UJYA 2GBQA 2HD0A 1RAHB 1VQLQ 2NYSA 2GTJA 2Y90A 4J9GA 1SSFA 3CCEQ 1G3TA 5LJ3f 4MDWA 5GANh 4M77C 5AYFA 3OSVA 1SG5A 3IQLA 2CYZB 2LNVA 3HRTA 1M3CA 4R0KA 3C94A 7AT1B 1YHQQ 3OYKA 3G1JA 5GANg 2FZKB 3SDZA 4PNOA 1IREB 1JXOA 3V8KA 3CCVT 1K9MR 1EX4A 2H8HA 2YUPA 1VQ5A 3TQ7P 4ZN1A 1U8RA 3VYHB 1WA7A 3QHSA 4JZ4A 1HK9A 2VXFA 2ZPHB 4C92A 2W10A 3LGLA 2LCCA 2EAYA 1Q7YC 3RBBB 2YWWA 2R5MA 2YDLA 3S6WA 3RMSA 2QASA 1WHLA 3JCMJ 1MNEA 4FU6A 5GAOl 3OYBA 2L3QA 2MYSA 1YITA 4LD6A 3OS2A 4QVDA 5HK3A 2BE7D 2LX7A 2E12A 3H0FA 2JM9A 1JXMA 1UGRB 2GCXA 3M56A 2YLBA 1BI3A 2D9TA 3CPWP 4LE9A 3SB2A 2DA9A 2EIFA 1YIJQ 1G83A 2DK3A 2CUBA 4PK4A 4C8QA 5I2SA 2RJFA 2A08A 1VQ4Q 1HYOA 2COZA 3CBMA 1W2BS 3I55A 1XOVA 1MV0B 4JJNK 4DQ2A 3RESA 2JNGA 4N0AA 2JXBA 4ELYC 4NL2A 4RCCA 1QMCA 2VUBA 2DL4A 1PSFA 5FW9A 1R0BG 1W2BA 1KQ2A 3QPHA 1QCFA 2KGTA 4Z89A 4IIMA 4PJNA 3GPLA 4J9HA 3WXMB 2JS0A 1SRMA 2BIVA 2RHXA 5D7UA 3QZ5B 2AZVA 2OTLT 3HHTB 2DKGA 2RMOA 3NHNA 2AHJB 4IUUA 4O5VA 4PJLA 3OYNA 3JB9H 2PU9B 2SEMA 2K9GA 4M75G 2EJ9A 3EHRA 3SEMA 3JCMf 4C92E 3X20B 3G71A 5HCKA 2RI2A 5KYWA 2LJ1A 2ATCB 3MPUB 1M27C 1OOTA 3JV3A 3TSZA 4LUDA 1ABQA 1OQKA 1UGPB 2QGGA 4C5GA 4M7AF 5KCHA 2L0AA 2K79A 3EGDA 2L8DA 3CPFA 2VGNA 2X3WD 2K57A 1K0SA 5FLXE 2O01E 1KD1R 1VQKT 1RAFB 2JTFA 1BBZA 1D0XA 3X25B 1X6BA 5C6SA 3L2QA 4OB3B 1VQ6Q 3VS3A 3V7RA 1GFDA 2PVGB 3MP8A 4ME7A 4C8QE 1K8AR 2DD4A 1MNDA 3QWXX 3GNGA 2LMJA 2E5KA 3CC2Q 2V1QA 5CKBA 3VKIA 1VQ8Q 1E6GA 1PNJA 4HT9A 2RQVA 4ZGDB 1FX7A 2M9UA 1AOJA 2P0KA 4FIBA 2R58A 3T9NA 2KR3A 4XTVA 5GMKe 4KH1B 2CSQA 1Z9QA 2CP3A 2K3YA 1XNIA 1KQ1A 4ZTJA 1VQ5T 4X9DA 2ED0A 4M78A 2KXCA 1SPKA 2LDMA 2KT8A 2Y4YA 2KQWA 2KYMA 3RKXA 4RCBA 5KE3A 4NS5A 4JLIA 3V7SA 1ZX6A 3OMCA 3ZFJA 2A37A 1IXDA 2K6DA 1YITT 2OTJQ 1QQJA 4BD3A 2CZ7B 5KYYB 1MMGA 4KULA 1UG1A 2CZ0B 4C5IA 1NG2A 5GJWB 1WDXA 4QVCA 4C8QB 2KROA 2MMPA 4PFPA 2YXYA 2A3LA 2EYYA 1H641 3N5BB 2E70A 4M7DA 3U23A 4Y91A 1C6VX 1PD0A 3PFSA 3I55T 3CCQA 2FG0A 3G7ZA 1RI9A 3NTIA 1VQ9Q 5IHNA 1IZ6A 1VQLA 2K3BA 4OGEA 4EMKA 4E6RA 4ZNXA 2DILA 3CCEA 2ROTA 5LJ3h 2P84A 2LQWA 4D6WA 4Y92A 5FWBA 5KE2A 2D1XA 2DTHA 1Q86U 1YJ9Q 3DKMA 1N6AA 1X69A 1YHQA 1N5ZA 1SSHA 1D1BA 5LJ3g 2RQRA 3O5ZA 5KYWB 1KQSP 4D8DA 1UE9A 1CKAA 3EG9A 5KCOA 5CKDA 2ZPEB 2V8KA 4E7KA 3EGDB 2NUPA 2MOXA 4Z8AA 3EG2A 3G71T 1D09B 1W6XA 5CKFA 4J9CA 4RKUE 3UWNA 3AT1B 5GAN5 1ZSGA 1SKUB 1SRLA 4MDXA 1KIKA 3VRZA 3OYDA 3CC4Q 3EG3A 1RADB 5EG2A 4RG8A 1YCSB 2RM4A 1I1JA 2RN8A 3OW2S 2KT1A 4FT2A 1ZUYA 1Q86C 2KYBA 3PTAA 1YIJA 2IPOB 1BKBA 1PKTA 1QVGS 2MK5A 2XG8D 1M2VA 4FCYA 5DY9A 1JJ2S 3FJ5A 4XU3A 3OW2A 1VQ4A 3RERA 1RAIB 1M1KC 2F2VA 3A8MB 1QVGA 3QSUA 5KYNA 3ER0A 4E7ZA 2XIDA 3HKSA 2O9VA 3VU3C 1W1FA 4M78B 1IB8A 3BE3A 2HCKA 1U1TA 2XDBA
chains in the Genus database with same CATH topology
3C4SA 3L2VA 4OB0B 3X24B 4BE1A 1KQSS 3M58A 4BE0A 5FU7B 2DZ9A 1JRIA 2L5QA 2M0OA 2ZPIB 3X26B 5GANj 4C92D 4DOWA 2OTLA 2EQJA 1QP2A 1Q82U 1N27A 1G3YA 3I56T 3R6OA 5LL6S 3TU4K 1X75C 1HXDA 1NE8A 3CBOA 3E9GA 1I5LA 2K5IA 3V8LA 2XKOC 5FRMA 3FC3A 3FEOA 3LLRA 3CMAT 3CCRA 3NTKA 4DOVA 1MHNA 1KQSA 1I81A 3OS5A 2OAUA 4IUPA 2WSEE 4PJOC 3A8OB 3QIIA 2E6ZA 2KDSA 5CK9A 4XTUA 2VGMA 1QVPA 4J7IA 2CZ6B 3JCMh 2B8AA 3DLLA 1VIEA 1O75A 1VQPT 3VJPA 3AHUA 2GFAA 2XHCA 3A8LB 1WQ7A 4M75F 4JDSA 4Q5WA 3VYGA 1NPRA 5DLOA 2RH2A 4ZN3A 3OS0A 1YJWA 2E6NA 3LWHA 2EQUA 1JB0E 2O4XA 3OYFA 2DXUA 1M4ZA 5IT9E 3M57A 2QTXA 3P8HA 3HFNA 3RUXA 4A4GA 5LJ5d 1AHJB 4HKEA 4PL6A 3JCMg 5GAMd 2WSFE 1VQKA 3MP6A 4M78G 2EWNA 5L8RE 2X4JA 4XTYA 4M7DB 4XAXB 4N4IA 3TEEA 1S72T 3JCMW 4UC4A 2CS7A 3Q1JA 4C8QD 1N8RC 4BACA 1QW1A 3PMTA 3E9FA 4HCZA 4JRIA 1OZ3A 4BB7A 3CCUA 1WPYA 5GAMj 1Q7YU 5CR2A 4QQ6A 2F5TX 2QI2A 3QO3A 4KBMB 3JAME 3EFRA 4WF2A 3BY7A 4BI8B 3OY9A 1K73C 1P92A 3M4YA 1VQ7T 4ATOA 3FLGA 5CQYA 2XICA 4PJOA 2WACA 2EQMA 2MF2A 5J26A 1QVFA 4J8OA 4GLKA 4J6WA 2K5FA 5CVIA 4JRPA 1Y96A 4JLGA 3L2WA 4EMKB 4M77E 4HCBA 3CCQT 2VV5A 4C0FA 2DZCA 2HD0A 4OB1B 3OB9A 4F7UE 4M7AD 2KY9A 3EFSA 4NL3A 2Y90A 1Q82C 1M1KU 2EQKA 2RI5A 1I4K1 1SSFA 5D6YA 2P0PA 2A7YA 5GANe 2D6FA 1VQ6A 1G3TA 3DLMA 5LJ3f 2DEQA 3E1SA 2ZGWA 4MDWA 4M77C 5GANh 5C0MA 5AYFA 4BI4A 1VQLT 3OSVA 3G4ST 2CYZB 3JCMV 2LNVA 3HRTA 1K9MU 3SWNB 5D6WA 3CC2A 3C94A 3CEYA 3FDRA 2LQ8A 3RIRA 2DPPB 5GAOm 5GMKl 1X6OA 3OYKA 1VQ8A 3PMIA 3QXEB 5GANg 3CCLT 4M7DG 2R57A 2QEXT 3SDZA 4PNOA 1YHQT 1IREB 3V8KA 5J3BA 4A54A 3OYMA 3CCVT 1V29B 3ZEHA 4B9XA 5A0DA 3ASKA 1LOJA 2RJCA 1VQ5A 2XDPA 2LC4A 4ZN1A 1U8RA 4OB2B 4PLIA 3VYHB 1M1FA 3JB9G 1YBYA 2KAFA 4J6XA 3QHSA 4PJOF 3L2ZA 1WJRA 3UT1A 3QBYA 1HK9A 2VXFA 1YCYA 2ZPHB 4C92A 2KK4A 3LGLA 2LCCA 3L2UA 2EAYA 1Q7YC 4GY5A 3PIPA 4L5GA 1GXIE 2R5MA 3OA6A 4BUGA 4CRIA 5CCAA 1BIAA 4HT8A 2DTIA 3S6WA 2P4TA 4M7AE 3RMSA 3TREA 3MEVA 5GAMe 4A4EA 3JB9J 3JCMJ 4FU6A 3MEWA 5GAMh 5GAOl 2WSCE 4R55A 2RHUA 3OYBA 1YITA 4LD6A 2FYKA 2QQAA 2VC8A 1FXXA 3SFMA 3P8DA 4N0AC 3X28B 1DJ7B 1D3BA 4QVDA 4OVAA 5HK3A 1VQOT 3QJYA 1ZBXA 2C06A 1UGQB 4HCCA 4M7AC 2E12A 2OTJA 1UGRB 2GCXA 3M56A 4A4KA 3H6ZA 2EJGA 3JB9I 4V2SA 2YLBA 3OYEA 4M77B 1BI3A 5FU6C 1X01A 2D9TA 2MI6A 3H8ZA 3SB2A 5GAMg 5HKCA 4F7UB 2FL7A 1YI2T 1K73U 1JJ2A 1BYMA 1K9MC 2EIFA 3QZ9B 2ZCFB 4A4HA 4RMOA 2QQSA 3JSCA 3CC7T 1WQWA 1VQMA 1M9SA 2DK3A 3GF5A 4PLLA 3OYLA 4LDYA 2RK1A 1B34A 3NFCA 5LJ5f 4C8QA 1YIJT 2DIGA 2RK2A 1NZ9A 5I2SA 4PJOE 2RJFA 4M75B 4X34A 1M90U 5GAN3 3GOXA 2HQXA 3BDLA 3CBMA 5J39A 5GMKi 1M1GA 4J7FA 1W2BS 4LDUA 3I55A 4M77F 3P8BB 4CI0C 4KUDK 1XOVA 3HRSA 5DLQE 3G6EA 1VQ4T 4JJNK 3OYJA 4EMHA 4F7UF 4DQ2A 3RESA 2JNGA 2JUFA 4N0AA 4OP0A 4FT4A 4ELYC 3UPUA 1XTDA 1LJOA 4J6YA 4NL2A 4M7AA 1VUBA 5CQXA 2E10A 4RCCA 2VUBA 3L2RA 4X9CA 1PSFA 1VQ9A 4E7IA 1WGSA 2KVQG 3VUZA 3CMEA 2P0QA 1W2BA 2DXCA 3OYYA 3QPHA 4E47A 1KQ2A 3OS1A 4C0DC 2QQ9A 1Y71A 2FB7A 2HQEA 3CCMA 3V7CA 2X4XA 5FRNA 1KHCA 3GPLA 3CCJA 3CD6A 4M77G 3WXMB 1BI0A 2ZZDA 2IVWA 2BIVA 2QDYB 2RHXA 4M78D 2ZPGB 4F7UG 2XDDA 3DB4A 3QZ5B 3JCMb 2KSSA 2OTLT 1M5Q1 3HHTB 1W4SA 1YJ9A 2DKGA 4OF1A 2AHJB 4IUUA 4O5VA 3OYNA 3QUIA 1I8FA 5A0GA 4JS4A 3JB9H 2PU9B 5HK0A 3KUFA 3BDUA 3CCRT 3JCMc 4M75G 2EJ9A 3OQ5A 2QA4A 1OI1A 3JCMf 4C92E 2H3JA 1G5VA 3LGFA 2O4XB 3X20B 2RD1A 3G71A 2PVOB 2RI2A 4MZMA 1KD1U 4JRKA 1NJIU 4IURA 3JCMQ 2QQBA 2E5QA 1NPPA 2EFIA 2KMTA 4C5GA 1UGPB 4M7AF 5I2MA 3HPWA 5KCHA 4C92C 1M90C 2LX9A 4LDVA 1YJWT 3UDCA 2JN0A 2L8DA 3NTHA 3CPFA 2VGNA 1UGSB 2LTOA 2K57A 2ZPBB 3CPWS 3GLXA 2O01E 2PVDB 5FLXE 5GAN4 1RL2A 3WVEB 1VQKT 2L89A 2ZPFB 3CCSA 3RKYA 1TH7A 3GIBA 4PJOB 4TVRA 5HY6A 2JTFA 1Y96B 5GAOq 2NLUA 3X25B 5C6SA 2LVMA 1K8AU 4M7DD 3CCUT 3QDRB 3L2QA 4OB3B 1Y7XA 2LT4A 4M78E 3V7RA 4DA4A 4J5YA 2FVUA 3CC4A 2PVGB 3MP8A 4ME7A 3CPWA 2VYTA 1VQNA 2MWOA 1VQ6T 1LNXA 4XTXA 4C8QE 2DXTA 4NOYA 5GAOr 3JB9D 2F5KA 2HNIA 4OMFB 4EDUA 4LD9K 3PGGA 2DD4A 2M1HA 1BIBA 3A8GB 4ELZC 2VXEA 4II1A 2GF7A 3L1AA 3ME9A 4M78C 5GANf 3GNGA 3CBPA 4N4GA 3MEUA 4QQGA 1O9SA 3M59A 4KUIA 1G3SA 2HAXA 1OYXA 2V8JA 2K5LA 5FU7C 5GAOp 3M9QA 4FSXA 5CKBA 4C8QC 4XTWA 2X4WA 1Q81U 2BUDA 2PUKB 3VKIA 3S3NA 5I21A 4HT9A 2MWPA 3CC2T 1XQHA 1FX7A 4ZGDB 2MAMA 2M9UA 4LDXA 2P0KA 5GAN7 2RHZA 1RI0A 1KD1C 4FIBA 2R58A 1NJIC 4ZTFA 1WJSA 1VQ8T 3T9NA 2BKDN 2RJDA 1ZQ1A 2XU8A 4L6V5 2JTMA 4XTVA 4PJOG 4BY6C 5GMKe 3L42A 3QJ6A 2RB6A 3C95A 4RG2A 2PUOB 4JUVA 1FWZA 4EMGA 2YHTA 2K3YA 1XNIA 2XDBA 1KQ1A 4ZTJA 4ZGJB 1VQ5T 4X9DA 4M7DE 2IG0A 2DD5A 3FRNA 3I56A 3TCJA 4QQDA 5D6XA 2RI3A 3J80E 5GAN6 1N9RA 4M78A 2QXFA 2GQVA 2DAQA 5LJ3j 1BI1A 2LDMA 3M53A 4C0GA 3OSSC 4BDZA 2Y4YA 2KQWA 3RKXA 4B9WA 3FIFA 5FROA 3E19A 2RO0A 4RCBA 1U1SA 4NS5A 5KE3A 4JLIA 1D3BB 2XK0A 3LH0A 3V7SA 3KXTA 3CMAA 3HP9A 5IAYA 3OMCA 4MZPA 5GAMf 4M7DC 2D0QB 3DB3A 3ZFJA 2EKOA 4C92F 5KH6A 3LX7A 1YJNA 3HSBA 4XQ3A 4E7LA 3MEAA 2DXBA 2DTOA 1VQPA 1YITT 4BD3A 2CZ7B 3INZA 4KULA 3WVDB 2V8IA 2CZ0B 4C5IA 2CKKA 1N9SA 3MP1A 2DJZA 3J7AF 2OTJT 4O6JA 5M9OA 4EMKC 2RJEA 1B34B 4QVCA 2G3RA 4C8QB 1Q81C 2MMPA 3FJPA 3M5AA 2YRVA 1KG1A 4C92G 5GAOn 1S72A 3LYIA 2PQWA 4L59A 2A3LA 3SD4A 4M77D 4A53A 1H641 4Y28E 4N4HA 4BDYA 1VQMT 2YLCA 3N5BB 5A0LA 1PSEA 2E1HA 4M78F 4BY6B 2E64A 3OS2A 1VQ7A 3A8HB 4LDWA 4XU1A 2E70A 4M7DA 3SWNC 4M7AB 5A2QE 4J83A 4Y91A 3RMQA 2K3XA 4C5HA 3JCMe 1YJNT 3PFSA 3C12A 5FU6B 3GNFB 4C8QF 1UEBA 3I55T 4VUBA 3CCQA 4M75D 4JRQA 4BI3A 4C5EA 3G6ET 4YTLA 3G7ZA 3NTIA 2CGHA 3OMGA 3VUBA 2DO3A 2RHIA 1IZ6A 1KC8U 5GMKj 4A4FA 1VQLA 4OGEA 3G4SA 4EMKA 4IUTA 1VQ9T 4XU0A 4R56A 5LJ3e 1WJQA 1QVFS 3CMET 3CCEA 3RKWA 1UB4A 5LJ3h 4C0ZA 4D6WA 1BI2A 4MMLA 3OYCA 1KHIA 2DIQA 5KE2A 5GAN8 3CCMT 2JZ2A 1ZHIA 4HA8A 2DTHA 3ZBDA 5LJ5j 3CCJT 1Q86U 4XK8E 4C8QG 3CD6T 2DVEA 1VIFA 5GMKm 5DM7R 2QEXA 2E65A 3DKMA 3CCLA 3CXCS 1N6AA 1YHQA 3A5ZB 3EAEA 3CCVA 3QYGB 5LJ3g 3SWNA 1YJ9T 2LT1A 3QG1A 3FB9A 4EPCA 3HFOA 3M55A 4MMKA 3URGA 2EYQA 5CO7A 2LCLA 2EJFA 2RA2A 5KCOA 5GAN2 3V8JA 3LWIA 4M7DF 3BW1A 5CKDA 2RHYA 2ZPEB 4C0DB 4M7AG 2V8KA 3META 2QA4T 4P5NA 4E7KA 1WNLA 1MGQA 2Y4XA 4XTZA 3CXCA 3BFMA 3VV0A 3PIOA 2HBPA 1M8VA 1Y07A 1R8OB 4E7HA 3G71T 2LQKA 2F69A 2X35A 3PT9A 1H3ZA 2M16A 3M54A 4FL6A 5CKFA 3JCMP 3JB9F 4RKUE 3UWNA 3CCET 4M75E 2I2LA 5CKHA 5GAN5 1EIFA 4IUQA 4MZTA 3MO8A 3QYHB 4QW2A 3JRZA 4XU2A 4FM4B 3JCMX 1OZ2A 4MDXA 4Z02A 2K4YA 3J81E 1VQOA 2JVVA 3OYDA 3JCMd 2CZ1B 3OYGA 3KBGA 3OYIA 3CCST 4M75C 3HRUA 2XD0A 3GP8A 3OYAA 3MCAB 5CIUA 4E7JA 1KC8C 2LRQA 5EG2A 3S3MA 4PJOD 1G3WA 4RG8A 1YI2A 2RM4A 3PNWC 2QQRA 2JOYA 1JBMA 3CC4T 1QP3A 4C92B 4IKFA 3OW2S 4KT0E 2FHDA 3CC7A 5GMKh 4PKCC 5LJ3d 1VQNT 4FT2A 5CKEA 4ZGEB 1Q86C 3PTAA 4M77A 1YIJA 3OBYA 1BKBA 1QVGS 4F7UA 5LJ5e 4JS5A 4IUVA 2XG8D 2E41A 4QVZA 5LJ5h 3LW5E 5DY9A 1JJ2S 4XU3A 3OW2A 1VQ4A 2L3RA 5IN1A 4BE2A 3RERA 3S3OA 2K2VA 3OBWA 2XI9A 3MHXA 3QKJA 1M1KC 5CAIA 3F70A 4M75A 1N8RU 3A8MB 1QVGA 3QSUA 3M4GA 5LJ5g 3ER0A 3O8VA 2XIDA 4OGCA 3HKSA 5GANd 2X4YA 3HL8A 4M78B 3VU3C 3OYHA 2GFUA 1U1TA 1K8AC 2R5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIA A;  2DTI A;  4M7D D;  2DZ9 A;  1JRI A;  4M7A E;  2CGH A;  5GAN j;  5GAM e;  3QSU A;  4C92 D;  3JB9 J;  4M78 E;  3V7R A;  3JCM J;  4J5Y A;  5GMK j;  5GAM h;  5GAO l;  2FYK A;  2VC8 A;  4EMK A;  4HT8 A;  4XU0 A;  4QVD A;  1HXD A;  4N0A C;  5LJ3 e;  1D3B A;  1LNX A;  4XTX A;  3RKW A;  1I5L A;  3V8L A;  5LJ3 h;  4C8Q E;  2DXT A;  4NOY A;  5GAO r;  3JB9 D;  4M7A C;  2HNI A;  4MML A;  3PGG A;  1BIB A;  5GAN 8;  2VXE A;  4HA8 A;  2DTH A;  2EJG A;  3L1A A;  1I81 A;  2YLB A;  4M78 C;  4M77 B;  4C8Q G;  2DVE A;  5GMK m;  1X01 A;  5GAM g;  4PJO C;  2E65 A;  3SB2 A;  4F7U B;  5GAN f;  4XTU A;  5GAO p;  3JCM h;  5LJ3 g;  3SWN A;  4C8Q C;  3AHU A;  4XTW A;  3FB9 A;  1WQW A;  3HFO A;  4MMK A;  1WQ7 A;  4M75 F;  2EJF A;  2RA2 A;  5I21 A;  4HT9 A;  5LJ5 f;  1B34 A;  3V8J A;  5GAN 2;  4C8Q A;  3BW1 A;  4M7D F;  4PJO E;  2DXU A;  4M7A G;  5GAN 7;  2QTX A;  4M75 B;  3HFN A;  3RUX A;  1WNL A;  1MGQ A;  5LJ5 d;  5GAN 3;  4XTZ A;  3JCM g;  3BFM A;  5GAM d;  1M8V A;  4M78 G;  4M7D B;  2EWN A;  4PJO G;  5GMK i;  4XTV A;  4XTY A;  4M77 F;  5GMK e;  2RB6 A;  3JCM W;  4JUV A;  4C8Q D;  4EMG A;  4DQ2 A;  2YHT A;  3RES A;  4EMH A;  4F7U F;  4N0A A;  3JCM P;  4M75 E;  3JB9 F;  1KQ1 A;  2I2L A;  4JRI A;  4OP0 A;  4V2S A;  1WPY A;  5GAM j;  1LJO A;  4J6Y A;  5GAN 5;  4NL2 A;  4X9D A;  4M7A A;  4M7D E;  3QO3 A;  2E10 A;  4RCC A;  3EFR A;  4WF2 A;  4XU2 A;  3BY7 A;  4X9C A;  5GAN 6;  1N9R A;  4M78 A;  3JCM X;  5LJ3 j;  4PJO A;  4J6W A;  1KQ2 A;  1Y96 A;  3RKX A;  3JCM d;  3FIF A;  4M77 E;  4RCB A;  4EMK B;  1U1S A;  4M75 C;  4JLI A;  1D3B B;  3V7S A;  2FB7 A;  4M7A D;  3V7C A;  4F7U E;  2DZC A;  4M7D C;  5GAM f;  3EFS A;  4M77 G;  4NL3 A;  2Y90 A;  4C92 F;  4M78 D;  5LJ5 j;  4PJO D;  1I4K 1;  4F7U G;  3HSB A;  5GAN e;  4XQ3 A;  2RM4 A;  3JCM b;  1M5Q 1;  5LJ3 f;  1JBM A;  2DEQ A;  5GAN h;  2ZGW A;  4C92 B;  2DTO A;  4M77 C;  3JB9 I;  2DKG A;  5GMK h;  3INZ A;  5LJ3 d;  3JCM V;  3SWN B;  3QUI A;  1I8F A;  3JB9 H;  1N9S A;  4M77 A;  2DJZ A;  3BDU A;  3RIR A;  3JCM c;  4M75 G;  2EJ9 A;  5GAO m;  4C92 E;  3JCM f;  4EMK C;  1B34 B;  4F7U A;  4QVC A;  4C8Q B;  5GMK l;  5LJ5 e;  5GAN g;  4M7D G;  2E41 A;  2RD1 A;  3FJP A;  5LJ5 h;  4PNO A;  3V8K A;  4A54 A;  5DY9 A;  4C92 G;  5GAO n;  4XU3 A;  4JRK A;  4M77 D;  3JCM Q;  3RER A;  1LOJ A;  4A53 A;  1H64 1;  4M7A F;  2YLC A;  4C92 C;  5CAI A;  4M75 A;  2E1H A;  2JN0 A;  3JB9 G;  4M78 F;  2E64 A;  3M4G A;  4J6X A;  3QHS A;  4XU1 A;  4PJO F;  3L2Z A;  5LJ5 g;  3SWN C;  4M7A B;  1HK9 A;  2K57 A;  2VXF A;  4M7D A;  1YCY A;  5GAN 4;  4Y91 A;  4C92 A;  3JCM e;  5GAN d;  3VU3 C;  4M78 B;  3RKY A;  1TH7 A;  3GIB A;  2EAY A;  4PJO B;  4C8Q F;  1U1T A;  5GAO q;  4M75 D;  1Y96 B; 
#chains in the Genus database with same CATH topology
 1H3H A;  3X24 B;  4BE1 A;  1TS9 A;  1JRI A;  2ZPI B;  4C92 D;  1VYV A;  4QKU A;  1G3Y A;  2JM8 A;  1HXD A;  3E9G A;  1I5L A;  1PRL C;  3FEO A;  2EGA A;  1MHN A;  2DX1 A;  2WSE E;  1Q82 R;  3QII A;  2KDS A;  5CK9 A;  1D0Y A;  3JCM h;  1RUW A;  4M75 F;  5DLO A;  1OX8 A;  4OMQ A;  1WXT A;  5IT9 E;  1S72 Q;  1X6G A;  1JO8 A;  4PL6 A;  3JCM g;  5GAM d;  4M7D B;  1UEC A;  4XAX B;  4N4I A;  2L3P A;  4UC4 A;  2CS7 A;  3THK A;  4C8Q D;  1QW1 A;  1W70 A;  2C0T A;  2QI2 A;  4KBM B;  2DJQ A;  4JJD A;  1K73 C;  3M4Y A;  2XIC A;  4PJO A;  2EQM A;  2MF2 A;  3M0P A;  1VQ6 A;  4JRP A;  5CVI A;  4EMK B;  2FRW A;  4AFS C;  1FMV A;  3UA7 A;  3CCQ T;  1PG5 B;  2EYZ A;  3EFS A;  2EQK A;  2RI5 A;  2JT4 A;  3DLM A;  2SRC A;  2DEQ A;  2ZGW A;  1BB9 A;  1VQL T;  2VKN A;  2HMA A;  8ATC B;  2EW3 A;  5D6W A;  3CC2 A;  4PFZ A;  4FW2 A;  4RUG A;  3RIR A;  3EG9 B;  1UHC A;  2DPP B;  5GAO m;  1VQ8 A;  1QWE A;  1YHQ T;  1RLP C;  1V29 B;  2K2M A;  1BCO A;  2NUP B;  1WX6 A;  2DRK A;  2LC4 A;  1WI7 A;  4E2F B;  1ZA1 B;  4J6X A;  1CKB A;  1ZBJ A;  1V1C A;  3QBY A;  1YCY A;  2BE9 B;  3L2U A;  2KRN A;  3C0C A;  3PIP A;  4L5G A;  3OA6 A;  4CRI A;  1BIA A;  1D1C A;  4AFQ C;  4M7A E;  1KSW A;  3TRE A;  1C0M A;  1QLY A;  2WSC E;  2RHU A;  2FYK A;  2QQA A;  3SFM A;  1FXX A;  4HT8 A;  4N0A C;  4OVA A;  2C06 A;  2OTJ A;  2YUO A;  4A4K A;  3NMZ C;  4V2S A;  2MI6 A;  3ULR B;  3CC7 Q;  5HKC A;  1WHJ A;  2FL7 A;  2JW4 A;  1M2V B;  2QQS A;  1LVK A;  3JSC A;  3EFO A;  1WQW A;  4PLL A;  2QTV A;  4LDY A;  2RK1 A;  1YIJ T;  2YT6 A;  1Y0M A;  4PJO E;  2ENM A;  3GOX A;  4KH0 B;  5GMK i;  1UHF A;  4LDU A;  2LNH B;  2OX7 A;  4M77 F;  3I5R A;  4KUD K;  5DLQ E;  1VQ4 T;  3H0I A;  3OYJ A;  4EMH A;  4F7U F;  2BZY A;  4OP0 A;  4FT4 A;  4AG2 C;  2PTK A;  1LJO A;  4J6Y A;  1AD5 A;  2EGE A;  1M90 R;  5KYU A;  2J6K A;  2EKH A;  3L2R A;  4X9C A;  1VQ9 A;  1WGS A;  2KVQ G;  1T0J A;  2P0Q A;  2DXC A;  3OYY A;  2QQ9 A;  1Y71 A;  2FB7 A;  2HQE A;  3V7C A;  2X4X A;  1KHC A;  2ZZD A;  2IVW A;  4M78 D;  1D0Z A;  3DB4 A;  2X9H A;  4EIK A;  4PFO A;  1W4S A;  1YJ9 A;  3CCR Q;  1RAE B;  5A0G A;  4KGZ B;  3KUF A;  3BDU A;  1ZUU A;  1PM3 A;  1QCO A;  1YJW Q;  4WTO B;  1NYF A;  1SHG A;  3HPW A;  2COY A;  6AT1 B;  3UDC A;  3NTH A;  2HDA A;  2ZPB B;  3GLX A;  1D1A A;  3WVE B;  1NJI R;  2L89 A;  4PJO B;  3D7S B;  5HY6 A;  5GAO q;  2DL5 A;  4M7D D;  1Y7X A;  1RAA B;  2LT4 A;  3CC4 A;  4J9B A;  2MWO A;  1VQ6 T;  2M0Y A;  2QGF B;  4LD9 K;  5GJV B;  3A8G B;  1TOV A;  2VXE A;  4OMN A;  4M78 C;  4N4G A;  3MEU A;  1LCK A;  4KUI A;  2V8J A;  2K5L A;  5GAO p;  1Q81 U;  5KYX A;  2X4W A;  2PUK B;  2A28 A;  1UFF A;  3I35 A;  3S3N A;  5I21 A;  2MWP A;  3CC2 T;  2RQT A;  2D8J A;  4RTX A;  1WFW A;  2RHZ A;  1GBR A;  1VQ8 T;  1WJS A;  1ZQ1 A;  2JTM A;  3QJ6 A;  4JUV A;  1FWZ A;  2YHT A;  1PKS A;  1GCQ A;  2HL5 C;  4ZGJ B;  5I11 A;  3CXC P;  3FRN A;  3TCJ A;  3J80 E;  5D6X A;  2RI3 A;  2DAQ A;  1K76 A;  4BDZ A;  2LP5 A;  4RTU A;  2E4H A;  3E19 A;  2A0F B;  1U1S A;  2XK0 A;  3LH0 A;  1YN8 A;  4MZP A;  4M7D C;  2RPN A;  3DB3 A;  1M8M A;  4XQ3 A;  1CSK A;  1TXQ A;  2GGR A;  2HBW A;  3INZ A;  2DLP A;  3WVD B;  3EFO B;  2CKK A;  2HL3 A;  2OTJ T;  2DYB A;  4EMK C;  1Q81 C;  1VQM Q;  2KRS A;  3M5A A;  1KG1 A;  4C92 G;  4CC2 A;  1S72 A;  4AG1 C;  3SD4 A;  4A53 A;  1A0N B;  4Y28 E;  4CC3 A;  1SEM A;  4N4H A;  2QAZ A;  1IHW A;  1PSE A;  2E1H A;  4BY6 B;  5KYU B;  3QDF A;  3G6E Q;  4J83 A;  3EHQ A;  1WHG A;  5FWC A;  1UEB A;  4JRQ A;  4E7S A;  3OMG A;  4X1V A;  2RHI A;  2F1L A;  1KC8 U;  2DMO A;  1AWO A;  5GMK j;  2KRM A;  4A4F A;  5IHI A;  1VQ9 T;  3CCM Q;  4R56 A;  1WJQ A;  3TSW A;  1UB4 A;  4J9F A;  4MML A;  1KHI A;  2G6F X;  4XK8 E;  4C8Q G;  1HD3 A;  2DVE A;  2DL8 A;  2MPX C;  3A5Z B;  1AWX A;  1IRX A;  1YJ9 T;  2LT1 A;  3QG1 A;  3FB9 A;  3HFO A;  3URG A;  2EYQ A;  5CO7 A;  2EJF A;  2RA2 A;  5GAN 2;  3LWI A;  2RHY A;  3MET A;  1WNL A;  3H0H A;  1M8V A;  2HBP A;  1R8O B;  4E7H A;  2LQK A;  2F69 A;  3PT9 A;  1IGQ A;  3JCM P;  3M54 A;  3PVL A;  4FL6 A;  1JEG A;  4M75 E;  1X43 A;  1EIF A;  3CCS Q;  2LJ0 A;  1I5O B;  1OZ2 A;  3J81 E;  2CZ1 B;  2NWM A;  3GBQ A;  3KBG A;  3OYG A;  3GP8 A;  4E7J A;  4GLM A;  1KC8 C;  2LRQ A;  3S3M A;  1OPK A;  4PJO D;  2HEQ A;  1VQN Q;  1QVF P;  4RTW A;  2QQR A;  1JBM A;  3CC4 T;  2AZS A;  4C92 B;  4IKF A;  3CC7 A;  2OAW A;  2KNB B;  4FYY B;  5KYX B;  2JMC A;  4M77 A;  3OBY A;  2FPE A;  4F7U A;  4JS5 A;  1K1Z A;  2O88 A;  1TUC A;  2E41 A;  3EGU A;  1VYU A;  4BE2 A;  3H41 A;  3QKJ A;  2DM1 A;  2V26 A;  1N8R U;  1UUE A;  4OGC A;  5GAN d;  2CP5 A;  1RAC B;  2QDL A;  2GFU A;  2CSI A;  4F14 A;  2EYW A;  3C4S A;  1MMD A;  1OV3 A;  2M0O A;  3X26 B;  1BU1 A;  4DOW A;  2EQJ A;  2FRY A;  3R6O A;  2DYI A;  3TU4 K;  2COW A;  1B07 A;  2D8H A;  3CCR A;  1I81 A;  4IUP A;  4PJO C;  3A8O B;  4XTU A;  1O75 A;  3REB B;  1WQ7 A;  4JDS A;  1YJW A;  1JB0 E;  2O4X A;  3OYF A;  2DXU A;  3M57 A;  2C0I A;  3HFN A;  4A4G A;  3MP6 A;  4M78 G;  2EWN A;  2X4J A;  4XTY A;  1KK7 A;  1S72 T;  1N8R C;  1SHF A;  3E9F A;  4JRI A;  1OZ3 A;  1WPY A;  2CP2 A;  1AT1 B;  5GAM j;  3EFR A;  2OI3 A;  4ATO A;  4J8O A;  4GLK A;  4DBQ A;  3L2W A;  4M77 E;  1Q7Y R;  4C0F A;  4F7U E;  2DZC A;  4OB1 B;  3OB9 A;  4NL3 A;  2ZAE A;  4DEY A;  2GQI A;  1M1K U;  3G4S Q;  1MMA A;  5D6Y A;  3VS4 A;  2A7Y A;  1W2B P;  1AVZ C;  5C0M A;  2AKK A;  3JCM V;  2GTO A;  1K9M U;  3CCL Q;  2QEX Q;  4HVU A;  3CEY A;  3FDR A;  1TSF A;  1J3T A;  2XMF A;  2PZ1 A;  3SHW A;  4J9I A;  4HVW A;  3QXE B;  2DE0 X;  3M0S A;  4M7D G;  2R57 A;  4J9D A;  1GFC A;  3RDV A;  4A54 A;  2RNA A;  4B9X A;  2Z0W A;  5A0D A;  2C0O A;  3ASK A;  1LOJ A;  2RQU A;  1WHM A;  1M1F A;  1YBY A;  2KAF A;  3L2Z A;  4JJC A;  2LQN A;  4DBR A;  2DTI A;  2EGC A;  1PD1 A;  3MEV A;  5GAM e;  1VQO Q;  4R55 A;  2E3H A;  1FYN A;  3P8D A;  1DJ7 B;  3QJY A;  4RTT A;  1UGQ B;  4HCC A;  1YI2 Q;  3H6Z A;  2DEU A;  4M77 B;  4F7U B;  1K73 U;  1JJ2 A;  1BYM A;  1K9M C;  4A4H A;  3CC7 T;  1VQM A;  3I9Q A;  1B34 A;  2DRM A;  3NFC A;  2LJ3 A;  4X34 A;  2LCS A;  4OMP A;  2HQX A;  3BDL A;  5J39 A;  1M1G A;  4J7F A;  4CI0 C;  5IXF A;  3HRS A;  3G6E A;  1UDL A;  2DBM A;  3UPU A;  1PCX A;  4M7A A;  1T3L A;  1VUB A;  4ANJ A;  1ZSZ A;  4E7I A;  3VUZ A;  4E47 A;  3OS1 A;  3CCM A;  2JTE A;  4A63 B;  4RTV A;  1BI0 A;  2KBT A;  2QDY B;  2ZPG B;  3JCM b;  1M5Q 1;  4OF1 A;  1WYX A;  2CP6 A;  1I8F A;  4JS4 A;  5HK0 A;  3TVT A;  3CCR T;  1OI1 A;  3LGF A;  2O4X B;  2RD1 A;  4MZM A;  1KD1 U;  4JRK A;  4IUR A;  2QQB A;  2E5Q A;  4OML A;  5IH2 A;  1AWW A;  1PRM C;  2J6O A;  5I2M A;  1AZG B;  2F2X A;  4C92 C;  1YJW T;  1MMN A;  2DNU A;  3CPW S;  1UTI A;  4F04 B;  3CCS A;  3RKY A;  1TH7 A;  3CCU Q;  4TVR A;  4PJM A;  2LVM A;  1K8A U;  3QDR B;  1QWF A;  4J5Y A;  1B7T A;  3CPW A;  2VYT A;  1VQN A;  3JB9 D;  2DXT A;  4NOY A;  2F5K A;  4EDU A;  4KRT A;  1BIB A;  4KGX B;  4ELZ C;  1UGV A;  2KE9 A;  3ME9 A;  4QQG A;  1S1N A;  4C8Q C;  1M3B A;  2BUD A;  4HXJ A;  4M4Z A;  4LDX A;  1RI0 A;  1KD1 C;  2QYZ A;  4ZTF A;  2BKD N;  4PJO G;  1M30 A;  3L42 A;  3C95 A;  2PUO B;  2KEA A;  2YUN A;  2CP0 A;  2DFU A;  1M3A A;  1X27 A;  1AZE A;  2DD5 A;  2RQW A;  4QQD A;  1N9R A;  2GQV A;  1IO6 A;  4C0G A;  3FIF A;  5FRO A;  1K8A C;  1K0X A;  1YWP A;  1BCM A;  3KXT A;  2ESW A;  5IAY A;  2K7A A;  5GAM f;  1PHT A;  2EKO A;  2ROL A;  2DTO A;  1YP5 A;  3QWY A;  1EFN A;  4FYW B;  3MP1 A;  1N9S A;  4O6J A;  2RJE A;  1B34 B;  1GRI A;  5GAO n;  3LYI A;  2PQW A;  4L59 A;  4M77 D;  1R0C B;  1VQM T;  2VB6 A;  4BDY A;  5A0L A;  4M78 F;  2E64 A;  4ESR A;  3A8H B;  4XU1 A;  4M7A B;  3OW2 P;  1PC0 A;  3RMQ A;  2K3X A;  3JCM e;  1YJN T;  1X2K A;  1ZSZ B;  1ZA2 B;  2CH4 W;  3C12 A;  5FU6 B;  2QG9 B;  4VUB A;  1MUZ A;  4BI3 A;  4LXC A;  4C5E A;  3G6E T;  2M51 A;  4YTL A;  2CGH A;  3CME Q;  4KGV B;  2ECZ A;  4CC4 B;  3G4S A;  4IUT A;  4Z88 A;  1QVF S;  3CCJ Q;  3CD6 Q;  2MCN A;  3RKW A;  1H92 A;  4HCK A;  2DIQ A;  5GAN 8;  3CCM T;  1HJD A;  2JZ2 A;  1ZHI A;  4HA8 A;  5LJ5 j;  1H8K A;  2VWF A;  3CCL A;  5GMK m;  5DM7 R;  2QEX A;  3MJX A;  1K4U S;  3QYG B;  3SWN A;  2P4R A;  1OU9 A;  3M55 A;  2QA4 Q;  2LCL A;  2CT3 A;  1Q86 R;  3V8J A;  4M7D F;  4C0D B;  1OEB A;  4P5N A;  4XTZ A;  3PIO A;  3VV0 A;  1Y07 A;  4B6M A;  2X35 A;  1H3Z A;  3EH2 A;  2M16 A;  2YRC A;  2IIM A;  5CKH A;  4IUQ A;  4MZT A;  1M1K R;  3JRZ A;  4XU2 A;  2FZG B;  1I0C A;  4Z02 A;  2K4Y A;  1VQO A;  2JVV A;  3JCM d;  3OYI A;  3CCS T;  3HRU A;  2XD0 A;  1M2O A;  3OYA A;  5CIU A;  2F2W A;  4FYV B;  1G3W A;  1YI2 A;  3PNW C;  1QKW A;  1JQQ A;  1WLP B;  2JOY A;  2FHD A;  1WXB A;  5GMK h;  1VQN T;  9ATC B;  1G8X A;  4LNP A;  1TU0 B;  3PE0 A;  1NLO C;  5LJ5 e;  2EBP A;  1OUL A;  4QVZ A;  3LW5 E;  1VOM A;  3M0U A;  2GNC A;  2VAS A;  3S3O A;  2YRD A;  2XI9 A;  5CAI A;  2DBK A;  3F70 A;  4M75 A;  3UA6 A;  3M4G A;  3O8V A;  2X4Y A;  3HL8 A;  3OYH A;  5KYY A;  2R5A A;  1ZUK A;  3L2V A;  2J7I A;  1KQS S;  3I56 Q;  2HKN A;  5FU7 B;  1NEG A;  2L5Q A;  4BE0 A;  5GAN j;  1GCP A;  2CUD A;  1QP2 A;  1Q82 U;  5LL6 S;  3CMA Q;  1K73 R;  3A1P A;  1X75 C;  1TG0 A;  1NE8 A;  3CBO A;  3VS1 A;  2XKO C;  5FRM A;  3FC3 A;  3E2U A;  2DET A;  1YJN Q;  2DF6 A;  3NTK A;  4DOV A;  1KQS A;  3OS5 A;  2OAU A;  1VQP Q;  2O9S A;  1QVP A;  4J7I A;  2CZ6 B;  3VJP A;  2GFA A;  4Q5W A;  1NPR A;  2RH2 A;  2E6N A;  2JMA A;  2ED1 A;  1M4Z A;  2QTX A;  3P8H A;  5LJ5 d;  1AHJ B;  4HKE A;  1GL5 A;  2AK5 A;  2WSF E;  3VS5 A;  1FMK A;  2L2P A;  4J9E A;  3TEE A;  3A98 A;  3JCM W;  2X3X D;  4BAC A;  1VQ7 Q;  3PMT A;  4HCZ A;  4BB7 A;  3CCU A;  2FZC B;  2EPD A;  3NGP A;  4LUE A;  3JAM E;  3BY7 A;  1G5V A;  1OU8 A;  2J05 A;  2WAC A;  5AT1 B;  1Y96 A;  4JLG A;  4OMM A;  4HCB A;  1PWT A;  5I22 A;  4M7A D;  2VV5 A;  2CDT A;  2NUT A;  2KY9 A;  1Q82 C;  2CT4 A;  1UJ0 A;  1I4K 1;  2P0P A;  5GAN e;  2D6F A;  3E1S A;  1KFZ A;  4BI4 A;  3G4S T;  3SWN B;  2YUQ A;  1TUD A;  2AKL A;  2LQ8 A;  3CCV Q;  5GMK l;  1X6O A;  3PMI A;  1IHV A;  2EYX A;  3CCL T;  2QEX T;  2CP7 A;  2KXD A;  5J3B A;  3OYM A;  3ZEH A;  2RJC A;  2XDP A;  4OB2 B;  4PLI A;  4PJJ A;  3JB9 G;  4PJO F;  1WJR A;  3UT1 A;  2KK4 A;  4F17 A;  3M0R A;  1ACM B;  2BZX A;  4GY5 A;  1GXI E;  2VVK A;  4BUG A;  5CCA A;  2P4T A;  1TUG B;  4A4E A;  3JB9 J;  3MEW A;  5GAM h;  4HVV A;  2VC8 A;  3X28 B;  1RAG B;  1D3B A;  3ZL7 C;  2KI7 A;  1VQO T;  1ZBX A;  2YSQ A;  4M7A C;  2DL3 A;  1AWJ A;  1ZSZ C;  2EJG A;  3JB9 I;  4RTZ A;  3OYE A;  5GAM g;  5FU6 C;  1X01 A;  3H8Z A;  1YI2 T;  1AEY A;  3QZ9 B;  2ZCF B;  4RMO A;  1E6H A;  2EQI A;  1M9S A;  1RAB B;  1NBE B;  3GF5 A;  3OYL A;  5LJ5 f;  2DIG A;  2RK2 A;  1NZ9 A;  4GBQ A;  2HSE B;  4M75 B;  1M90 U;  5GAN 3;  2X51 A;  4AT1 B;  3EG1 A;  3P8B B;  3EGX A;  1B3Q A;  2JUF A;  1XTD A;  1XJW B;  4DBH A;  5CQX A;  2E10 A;  3CME A;  1C1A A;  4C0D C;  3CQT A;  2OTL Q;  5FRN A;  3CCJ A;  1NLP C;  3CD6 A;  4M77 G;  2PNI A;  4D8K A;  4F7U G;  2XDD A;  2D0N A;  2KSS A;  5IHK A;  2HZY A;  4JJB A;  2DL7 A;  2JJ9 A;  3QUI A;  1E7O A;  3RNJ A;  3JCM c;  1U3O A;  2QA4 A;  3OQ5 A;  2H3J A;  2PVO B;  1EZZ B;  1NJI U;  2DER A;  3JCM Q;  1NPP A;  2EFI A;  2KMT A;  3LH5 A;  1M90 C;  2LX9 A;  4LDV A;  1VQK Q;  5L23 A;  2JN0 A;  4QT7 A;  1X2Q A;  1UGS B;  2LTO A;  2PVD B;  5GAN 4;  4JZ3 A;  1RL2 A;  2ZPF B;  3KFV A;  1G2B A;  3GIB A;  1QCN A;  1Y96 B;  2NLU A;  1U5S A;  3CCU T;  2NUT B;  2LZ6 B;  4M78 E;  4DA4 A;  2FVU A;  2OJ2 A;  4RTY A;  1LNX A;  4XTX A;  2E3I A;  5GAO r;  4OMF B;  2HNI A;  3PGG A;  2M1H A;  1ARK A;  4II1 A;  2GF7 A;  3L1A A;  5GAN f;  3CBP A;  1O9S A;  3M59 A;  1R77 A;  8AT1 B;  1G3S A;  1FMW A;  2AT1 B;  2HAX A;  1OYX A;  1KJW A;  5FU7 C;  2B86 A;  3M9Q A;  4FSX A;  4XTW A;  1Q95 G;  1NEB A;  1XQH A;  1RLQ C;  2MAM A;  3UF4 A;  5GAN 7;  1NJI C;  4AFZ C;  1T3S A;  2RJD A;  2XU8 A;  4L6V 5;  4BY6 C;  1Q81 R;  1VQ5 Q;  1ZLM A;  2RB6 A;  4RG2 A;  2I0N A;  1GBQ A;  4EMG A;  4WCI A;  4CC7 A;  4M7D E;  2IG0 A;  2FPF A;  3I56 A;  4DEX A;  5GAN 6;  2QXF A;  2DVJ A;  5LJ3 j;  1BI1 A;  3M53 A;  3OSS C;  4B9W A;  2RO0 A;  1D3B B;  2V1R A;  3CMA A;  3HP9 A;  2D0Q B;  4C92 F;  5KH6 A;  1YIT Q;  3LX7 A;  1YJN A;  3HSB A;  4AMC A;  4E7L A;  3MEA A;  2DXB A;  1VQP A;  1U06 A;  1SF9 A;  1V76 A;  2V8I A;  2H3E B;  2DJZ A;  3J7A F;  5ECA A;  5M9O A;  1YWO A;  1T0H A;  2G3R A;  3FJP A;  4FW1 A;  2YRV A;  1TWB A;  3EGX B;  4F16 A;  2O31 A;  2CH4 A;  2YLC A;  1Z9Z A;  2HSP A;  1VQ7 A;  3I55 Q;  4LDW A;  3SWN C;  5A2Q E;  4C5H A;  2A36 A;  1NYG A;  3GNF B;  4C8Q F;  4M75 D;  3NPF A;  2M02 A;  3VUB A;  2DO3 A;  2HQH A;  5IXB A;  4XU0 A;  5LJ3 e;  1F1B B;  3VS7 A;  3CME T;  1NM7 A;  4K11 A;  1HSQ A;  4C0Z A;  2L3S A;  1BI2 A;  1JU5 C;  3OYC A;  2W0Z A;  1IGU A;  5EC7 A;  3ZBD A;  3CCJ T;  3CD6 T;  3RR6 A;  1KC8 R;  1VIF A;  2E65 A;  3CXC S;  3EAE A;  3CCV A;  1ABO A;  2EVR A;  4JPB W;  4EPC A;  1WIE A;  4MMK A;  3BW1 A;  3EG0 A;  3G71 Q;  4M7A G;  2QA4 T;  1MGQ A;  2Y4X A;  1WXU A;  3CXC A;  3BFM A;  1VA7 A;  2CRE A;  1GCQ C;  2FO0 A;  1YFN A;  3VS2 A;  3JB9 F;  1OPL A;  3CCE T;  2I2L A;  2FPD A;  1I07 A;  2BZ8 A;  3MO8 A;  3QYH B;  4QW2 A;  4FM4 B;  3UAT A;  3JCM X;  2FEI A;  3I5S A;  4M75 C;  3MCA B;  3MKD A;  2J6F A;  1QP3 A;  2NUZ A;  4KT0 E;  4PKC C;  3HTR A;  5LJ3 d;  5CKE A;  4ZGE B;  4OMO A;  2RF0 A;  1MV3 A;  2O2O A;  2MIO A;  4IUV A;  5LJ5 h;  4DBF A;  2L3R A;  5IN1 A;  2BTT A;  2QK0 A;  3PVQ A;  4ORZ A;  2K2V A;  3OBW A;  3MHX A;  1K9A A;  3REA B;  1Y57 A;  3VS0 A;  5LJ5 g;  4FYX B;  2J06 A;  2ABL A;  3M0Q A;  4LN2 A;  4OB0 B;  3M58 A;  1N8R R;  2DZ9 A;  2OTL A;  1QKX A;  1N27 A;  3VS6 A;  3I56 T;  2HKQ B;  1BK2 A;  2K5I A;  3V8L A;  3LLR A;  3CMA T;  3H9N A;  4FSS A;  2JS2 A;  1TTH B;  1WHH A;  1WHK A;  4AFU C;  2E6Z A;  2VGM A;  3DLL A;  2B8A A;  1VIE A;  1VQP T;  3AHU A;  1OX9 A;  2XHC A;  3A8L B;  1QVG P;  3LWH A;  3VYG A;  2AIR B;  3OS0 A;  4ZN3 A;  1YNZ A;  2EQU A;  1JJ2 P;  3RUX A;  3M0T A;  1VQK A;  5L8R E;  3R6N A;  1LPL A;  3Q1J A;  3EH1 A;  1Q7Y U;  5CR2 A;  4QQ6 A;  2F5T X;  3QO3 A;  4WF2 A;  4BI8 B;  3OY9 A;  1VQ7 T;  1P92 A;  1VYT A;  3FLG A;  1WZO A;  5CQY A;  3CCQ Q;  5J26 A;  1QVF A;  4IIO A;  4J6W A;  2K5F A;  3VRY A;  1UJY A;  2GBQ A;  2HD0 A;  1RAH B;  1VQL Q;  2NYS A;  2GTJ A;  2Y90 A;  4J9G A;  1SSF A;  3CCE Q;  1G3T A;  5LJ3 f;  4MDW A;  5GAN h;  4M77 C;  5AYF A;  3OSV A;  1SG5 A;  3IQL A;  2CYZ B;  2LNV A;  3HRT A;  1M3C A;  4R0K A;  3C94 A;  7AT1 B;  1YHQ Q;  3OYK A;  3G1J A;  5GAN g;  2FZK B;  3SDZ A;  4PNO A;  1IRE B;  1JXO A;  3V8K A;  3CCV T;  1K9M R;  1EX4 A;  2H8H A;  2YUP A;  1VQ5 A;  3TQ7 P;  4ZN1 A;  1U8R A;  3VYH B;  1WA7 A;  3QHS A;  4JZ4 A;  1HK9 A;  2VXF A;  2ZPH B;  4C92 A;  2W10 A;  3LGL A;  2LCC A;  2EAY A;  1Q7Y C;  3RBB B;  2YWW A;  2R5M A;  2YDL A;  3S6W A;  3RMS A;  2QAS A;  1WHL A;  3JCM J;  1MNE A;  4FU6 A;  5GAO l;  3OYB A;  2L3Q A;  2MYS A;  1YIT A;  4LD6 A;  3OS2 A;  4QVD A;  5HK3 A;  2BE7 D;  2LX7 A;  2E12 A;  3H0F A;  2JM9 A;  1JXM A;  1UGR B;  2GCX A;  3M56 A;  2YLB A;  1BI3 A;  2D9T A;  3CPW P;  4LE9 A;  3SB2 A;  2DA9 A;  2EIF A;  1YIJ Q;  1G83 A;  2DK3 A;  2CUB A;  4PK4 A;  4C8Q A;  5I2S A;  2RJF A;  2A08 A;  1VQ4 Q;  1HYO A;  2COZ A;  3CBM A;  1W2B S;  3I55 A;  1XOV A;  1MV0 B;  4JJN K;  4DQ2 A;  3RES A;  2JNG A;  4N0A A;  2JXB A;  4ELY C;  4NL2 A;  4RCC A;  1QMC A;  2VUB A;  2DL4 A;  1PSF A;  5FW9 A;  1R0B G;  1W2B A;  1KQ2 A;  3QPH A;  1QCF A;  2KGT A;  4Z89 A;  4IIM A;  4PJN A;  3GPL A;  4J9H A;  3WXM B;  2JS0 A;  1SRM A;  2BIV A;  2RHX A;  5D7U A;  3QZ5 B;  2AZV A;  2OTL T;  3HHT B;  2DKG A;  2RMO A;  3NHN A;  2AHJ B;  4IUU A;  4O5V A;  4PJL A;  3OYN A;  3JB9 H;  2PU9 B;  2SEM A;  2K9G A;  4M75 G;  2EJ9 A;  3EHR A;  3SEM A;  3JCM f;  4C92 E;  3X20 B;  3G71 A;  5HCK A;  2RI2 A;  5KYW A;  2LJ1 A;  2ATC B;  3MPU B;  1M27 C;  1OOT A;  3JV3 A;  3TSZ A;  4LUD A;  1ABQ A;  1OQK A;  1UGP B;  2QGG A;  4C5G A;  4M7A F;  5KCH A;  2L0A A;  2K79 A;  3EGD A;  2L8D A;  3CPF A;  2VGN A;  2X3W D;  2K57 A;  1K0S A;  5FLX E;  2O01 E;  1KD1 R;  1VQK T;  1RAF B;  2JTF A;  1BBZ A;  1D0X A;  3X25 B;  1X6B A;  5C6S A;  3L2Q A;  4OB3 B;  1VQ6 Q;  3VS3 A;  3V7R A;  1GFD A;  2PVG B;  3MP8 A;  4ME7 A;  4C8Q E;  1K8A R;  2DD4 A;  1MND A;  3QWX X;  3GNG A;  2LMJ A;  2E5K A;  3CC2 Q;  2V1Q A;  5CKB A;  3VKI A;  1VQ8 Q;  1E6G A;  1PNJ A;  4HT9 A;  2RQV A;  4ZGD B;  1FX7 A;  2M9U A;  1AOJ A;  2P0K A;  4FIB A;  2R58 A;  3T9N A;  2KR3 A;  4XTV A;  5GMK e;  4KH1 B;  2CSQ A;  1Z9Q A;  2CP3 A;  2K3Y A;  1XNI A;  1KQ1 A;  4ZTJ A;  1VQ5 T;  4X9D A;  2ED0 A;  4M78 A;  2KXC A;  1SPK A;  2LDM A;  2KT8 A;  2Y4Y A;  2KQW A;  2KYM A;  3RKX A;  4RCB A;  5KE3 A;  4NS5 A;  4JLI A;  3V7S A;  1ZX6 A;  3OMC A;  3ZFJ A;  2A37 A;  1IXD A;  2K6D A;  1YIT T;  2OTJ Q;  1QQJ A;  4BD3 A;  2CZ7 B;  5KYY B;  1MMG A;  4KUL A;  1UG1 A;  2CZ0 B;  4C5I A;  1NG2 A;  5GJW B;  1WDX A;  4QVC A;  4C8Q B;  2KRO A;  2MMP A;  4PFP A;  2YXY A;  2A3L A;  2EYY A;  1H64 1;  3N5B B;  2E70 A;  4M7D A;  3U23 A;  4Y91 A;  1C6V X;  1PD0 A;  3PFS A;  3I55 T;  3CCQ A;  2FG0 A;  3G7Z A;  1RI9 A;  3NTI A;  1VQ9 Q;  5IHN A;  1IZ6 A;  1VQL A;  2K3B A;  4OGE A;  4EMK A;  4E6R A;  4ZNX A;  2DIL A;  3CCE A;  2ROT A;  5LJ3 h;  2P84 A;  2LQW A;  4D6W A;  4Y92 A;  5FWB A;  5KE2 A;  2D1X A;  2DTH A;  1Q86 U;  1YJ9 Q;  3DKM A;  1N6A A;  1X69 A;  1YHQ A;  1N5Z A;  1SSH A;  1D1B A;  5LJ3 g;  2RQR A;  3O5Z A;  5KYW B;  1KQS P;  4D8D A;  1UE9 A;  1CKA A;  3EG9 A;  5KCO A;  5CKD A;  2ZPE B;  2V8K A;  4E7K A;  3EGD B;  2NUP A;  2MOX A;  4Z8A A;  3EG2 A;  3G71 T;  1D09 B;  1W6X A;  5CKF A;  4J9C A;  4RKU E;  3UWN A;  3AT1 B;  5GAN 5;  1ZSG A;  1SKU B;  1SRL A;  4MDX A;  1KIK A;  3VRZ A;  3OYD A;  3CC4 Q;  3EG3 A;  1RAD B;  5EG2 A;  4RG8 A;  1YCS B;  2RM4 A;  1I1J A;  2RN8 A;  3OW2 S;  2KT1 A;  4FT2 A;  1ZUY A;  1Q86 C;  2KYB A;  3PTA A;  1YIJ A;  2IPO B;  1BKB A;  1PKT A;  1QVG S;  2MK5 A;  2XG8 D;  1M2V A;  4FCY A;  5DY9 A;  1JJ2 S;  3FJ5 A;  4XU3 A;  3OW2 A;  1VQ4 A;  3RER A;  1RAI B;  1M1K C;  2F2V A;  3A8M B;  1QVG A;  3QSU A;  5KYN A;  3ER0 A;  4E7Z A;  2XID A;  3HKS A;  2O9V A;  3VU3 C;  1W1F A;  4M78 B;  1IB8 A;  3BE3 A;  2HCK A;  1U1T A;  2XDB A; 
#chains in the Genus database with same CATH homology
 3C4S A;  3L2V A;  4OB0 B;  3X24 B;  4BE1 A;  1KQS S;  3M58 A;  4BE0 A;  5FU7 B;  2DZ9 A;  1JRI A;  2L5Q A;  2M0O A;  2ZPI B;  3X26 B;  5GAN j;  4C92 D;  4DOW A;  2OTL A;  2EQJ A;  1QP2 A;  1Q82 U;  1N27 A;  1G3Y A;  3I56 T;  3R6O A;  5LL6 S;  3TU4 K;  1X75 C;  1HXD A;  1NE8 A;  3CBO A;  3E9G A;  1I5L A;  2K5I A;  3V8L A;  2XKO C;  5FRM A;  3FC3 A;  3FEO A;  3LLR A;  3CMA T;  3CCR A;  3NTK A;  4DOV A;  1MHN A;  1KQS A;  1I81 A;  3OS5 A;  2OAU A;  4IUP A;  2WSE E;  4PJO C;  3A8O B;  3QII A;  2E6Z A;  2KDS A;  5CK9 A;  4XTU A;  2VGM A;  1QVP A;  4J7I A;  2CZ6 B;  3JCM h;  2B8A A;  3DLL A;  1VIE A;  1O75 A;  1VQP T;  3VJP A;  3AHU A;  2GFA A;  2XHC A;  3A8L B;  1WQ7 A;  4M75 F;  4JDS A;  4Q5W A;  3VYG A;  1NPR A;  5DLO A;  2RH2 A;  4ZN3 A;  3OS0 A;  1YJW A;  2E6N A;  3LWH A;  2EQU A;  1JB0 E;  2O4X A;  3OYF A;  2DXU A;  1M4Z A;  5IT9 E;  3M57 A;  2QTX A;  3P8H A;  3HFN A;  3RUX A;  4A4G A;  5LJ5 d;  1AHJ B;  4HKE A;  4PL6 A;  3JCM g;  5GAM d;  2WSF E;  1VQK A;  3MP6 A;  4M78 G;  2EWN A;  5L8R E;  2X4J A;  4XTY A;  4M7D B;  4XAX B;  4N4I A;  3TEE A;  1S72 T;  3JCM W;  4UC4 A;  2CS7 A;  3Q1J A;  4C8Q D;  1N8R C;  4BAC A;  1QW1 A;  3PMT A;  3E9F A;  4HCZ A;  4JRI A;  1OZ3 A;  4BB7 A;  3CCU A;  1WPY A;  5GAM j;  1Q7Y U;  5CR2 A;  4QQ6 A;  2F5T X;  2QI2 A;  3QO3 A;  4KBM B;  3JAM E;  3EFR A;  4WF2 A;  3BY7 A;  4BI8 B;  3OY9 A;  1K73 C;  1P92 A;  3M4Y A;  1VQ7 T;  4ATO A;  3FLG A;  5CQY A;  2XIC A;  4PJO A;  2WAC A;  2EQM A;  2MF2 A;  5J26 A;  1QVF A;  4J8O A;  4GLK A;  4J6W A;  2K5F A;  5CVI A;  4JRP A;  1Y96 A;  4JLG A;  3L2W A;  4EMK B;  4M77 E;  4HCB A;  3CCQ T;  2VV5 A;  4C0F A;  2DZC A;  2HD0 A;  4OB1 B;  3OB9 A;  4F7U E;  4M7A D;  2KY9 A;  3EFS A;  4NL3 A;  2Y90 A;  1Q82 C;  1M1K U;  2EQK A;  2RI5 A;  1I4K 1;  1SSF A;  5D6Y A;  2P0P A;  2A7Y A;  5GAN e;  2D6F A;  1VQ6 A;  1G3T A;  3DLM A;  5LJ3 f;  2DEQ A;  3E1S A;  2ZGW A;  4MDW A;  4M77 C;  5GAN h;  5C0M A;  5AYF A;  4BI4 A;  1VQL T;  3OSV A;  3G4S T;  2CYZ B;  3JCM V;  2LNV A;  3HRT A;  1K9M U;  3SWN B;  5D6W A;  3CC2 A;  3C94 A;  3CEY A;  3FDR A;  2LQ8 A;  3RIR A;  2DPP B;  5GAO m;  5GMK l;  1X6O A;  3OYK A;  1VQ8 A;  3PMI A;  3QXE B;  5GAN g;  3CCL T;  4M7D G;  2R57 A;  2QEX T;  3SDZ A;  4PNO A;  1YHQ T;  1IRE B;  3V8K A;  5J3B A;  4A54 A;  3OYM A;  3CCV T;  1V29 B;  3ZEH A;  4B9X A;  5A0D A;  3ASK A;  1LOJ A;  2RJC A;  1VQ5 A;  2XDP A;  2LC4 A;  4ZN1 A;  1U8R A;  4OB2 B;  4PLI A;  3VYH B;  1M1F A;  3JB9 G;  1YBY A;  2KAF A;  4J6X A;  3QHS A;  4PJO F;  3L2Z A;  1WJR A;  3UT1 A;  3QBY A;  1HK9 A;  2VXF A;  1YCY A;  2ZPH B;  4C92 A;  2KK4 A;  3LGL A;  2LCC A;  3L2U A;  2EAY A;  1Q7Y C;  4GY5 A;  3PIP A;  4L5G A;  1GXI E;  2R5M A;  3OA6 A;  4BUG A;  4CRI A;  5CCA A;  1BIA A;  4HT8 A;  2DTI A;  3S6W A;  2P4T A;  4M7A E;  3RMS A;  3TRE A;  3MEV A;  5GAM e;  4A4E A;  3JB9 J;  3JCM J;  4FU6 A;  3MEW A;  5GAM h;  5GAO l;  2WSC E;  4R55 A;  2RHU A;  3OYB A;  1YIT A;  4LD6 A;  2FYK A;  2QQA A;  2VC8 A;  1FXX A;  3SFM A;  3P8D A;  4N0A C;  3X28 B;  1DJ7 B;  1D3B A;  4QVD A;  4OVA A;  5HK3 A;  1VQO T;  3QJY A;  1ZBX A;  2C06 A;  1UGQ B;  4HCC A;  4M7A C;  2E12 A;  2OTJ A;  1UGR B;  2GCX A;  3M56 A;  4A4K A;  3H6Z A;  2EJG A;  3JB9 I;  4V2S A;  2YLB A;  3OYE A;  4M77 B;  1BI3 A;  5FU6 C;  1X01 A;  2D9T A;  2MI6 A;  3H8Z A;  3SB2 A;  5GAM g;  5HKC A;  4F7U B;  2FL7 A;  1YI2 T;  1K73 U;  1JJ2 A;  1BYM A;  1K9M C;  2EIF A;  3QZ9 B;  2ZCF B;  4A4H A;  4RMO A;  2QQS A;  3JSC A;  3CC7 T;  1WQW A;  1VQM A;  1M9S A;  2DK3 A;  3GF5 A;  4PLL A;  3OYL A;  4LDY A;  2RK1 A;  1B34 A;  3NFC A;  5LJ5 f;  4C8Q A;  1YIJ T;  2DIG A;  2RK2 A;  1NZ9 A;  5I2S A;  4PJO E;  2RJF A;  4M75 B;  4X34 A;  1M90 U;  5GAN 3;  3GOX A;  2HQX A;  3BDL A;  3CBM A;  5J39 A;  5GMK i;  1M1G A;  4J7F A;  1W2B S;  4LDU A;  3I55 A;  4M77 F;  3P8B B;  4CI0 C;  4KUD K;  1XOV A;  3HRS A;  5DLQ E;  3G6E A;  1VQ4 T;  4JJN K;  3OYJ A;  4EMH A;  4F7U F;  4DQ2 A;  3RES A;  2JNG A;  2JUF A;  4N0A A;  4OP0 A;  4FT4 A;  4ELY C;  3UPU A;  1XTD A;  1LJO A;  4J6Y A;  4NL2 A;  4M7A A;  1VUB A;  5CQX A;  2E10 A;  4RCC A;  2VUB A;  3L2R A;  4X9C A;  1PSF A;  1VQ9 A;  4E7I A;  1WGS A;  2KVQ G;  3VUZ A;  3CME A;  2P0Q A;  1W2B A;  2DXC A;  3OYY A;  3QPH A;  4E47 A;  1KQ2 A;  3OS1 A;  4C0D C;  2QQ9 A;  1Y71 A;  2FB7 A;  2HQE A;  3CCM A;  3V7C A;  2X4X A;  5FRN A;  1KHC A;  3GPL A;  3CCJ A;  3CD6 A;  4M77 G;  3WXM B;  1BI0 A;  2ZZD A;  2IVW A;  2BIV A;  2QDY B;  2RHX A;  4M78 D;  2ZPG B;  4F7U G;  2XDD A;  3DB4 A;  3QZ5 B;  3JCM b;  2KSS A;  2OTL T;  1M5Q 1;  3HHT B;  1W4S A;  1YJ9 A;  2DKG A;  4OF1 A;  2AHJ B;  4IUU A;  4O5V A;  3OYN A;  3QUI A;  1I8F A;  5A0G A;  4JS4 A;  3JB9 H;  2PU9 B;  5HK0 A;  3KUF A;  3BDU A;  3CCR T;  3JCM c;  4M75 G;  2EJ9 A;  3OQ5 A;  2QA4 A;  1OI1 A;  3JCM f;  4C92 E;  2H3J A;  1G5V A;  3LGF A;  2O4X B;  3X20 B;  2RD1 A;  3G71 A;  2PVO B;  2RI2 A;  4MZM A;  1KD1 U;  4JRK A;  1NJI U;  4IUR A;  3JCM Q;  2QQB A;  2E5Q A;  1NPP A;  2EFI A;  2KMT A;  4C5G A;  1UGP B;  4M7A F;  5I2M A;  3HPW A;  5KCH A;  4C92 C;  1M90 C;  2LX9 A;  4LDV A;  1YJW T;  3UDC A;  2JN0 A;  2L8D A;  3NTH A;  3CPF A;  2VGN A;  1UGS B;  2LTO A;  2K57 A;  2ZPB B;  3CPW S;  3GLX A;  2O01 E;  2PVD B;  5FLX E;  5GAN 4;  1RL2 A;  3WVE B;  1VQK T;  2L89 A;  2ZPF B;  3CCS A;  3RKY A;  1TH7 A;  3GIB A;  4PJO B;  4TVR A;  5HY6 A;  2JTF A;  1Y96 B;  5GAO q;  2NLU A;  3X25 B;  5C6S A;  2LVM A;  1K8A U;  4M7D D;  3CCU T;  3QDR B;  3L2Q A;  4OB3 B;  1Y7X A;  2LT4 A;  4M78 E;  3V7R A;  4DA4 A;  4J5Y A;  2FVU A;  3CC4 A;  2PVG B;  3MP8 A;  4ME7 A;  3CPW A;  2VYT A;  1VQN A;  2MWO A;  1VQ6 T;  1LNX A;  4XTX A;  4C8Q E;  2DXT A;  4NOY A;  5GAO r;  3JB9 D;  2F5K A;  2HNI A;  4OMF B;  4EDU A;  4LD9 K;  3PGG A;  2DD4 A;  2M1H A;  1BIB A;  3A8G B;  4ELZ C;  2VXE A;  4II1 A;  2GF7 A;  3L1A A;  3ME9 A;  4M78 C;  5GAN f;  3GNG A;  3CBP A;  4N4G A;  3MEU A;  4QQG A;  1O9S A;  3M59 A;  4KUI A;  1G3S A;  2HAX A;  1OYX A;  2V8J A;  2K5L A;  5FU7 C;  5GAO p;  3M9Q A;  4FSX A;  5CKB A;  4C8Q C;  4XTW A;  2X4W A;  1Q81 U;  2BUD A;  2PUK B;  3VKI A;  3S3N A;  5I21 A;  4HT9 A;  2MWP A;  3CC2 T;  1XQH A;  1FX7 A;  4ZGD B;  2MAM A;  2M9U A;  4LDX A;  2P0K A;  5GAN 7;  2RHZ A;  1RI0 A;  1KD1 C;  4FIB A;  2R58 A;  1NJI C;  4ZTF A;  1WJS A;  1VQ8 T;  3T9N A;  2BKD N;  2RJD A;  1ZQ1 A;  2XU8 A;  4L6V 5;  2JTM A;  4XTV A;  4PJO G;  4BY6 C;  5GMK e;  3L42 A;  3QJ6 A;  2RB6 A;  3C95 A;  4RG2 A;  2PUO B;  4JUV A;  1FWZ A;  4EMG A;  2YHT A;  2K3Y A;  1XNI A;  2XDB A;  1KQ1 A;  4ZTJ A;  4ZGJ B;  1VQ5 T;  4X9D A;  4M7D E;  2IG0 A;  2DD5 A;  3FRN A;  3I56 A;  3TCJ A;  4QQD A;  5D6X A;  2RI3 A;  3J80 E;  5GAN 6;  1N9R A;  4M78 A;  2QXF A;  2GQV A;  2DAQ A;  5LJ3 j;  1BI1 A;  2LDM A;  3M53 A;  4C0G A;  3OSS C;  4BDZ A;  2Y4Y A;  2KQW A;  3RKX A;  4B9W A;  3FIF A;  5FRO A;  3E19 A;  2RO0 A;  4RCB A;  1U1S A;  4NS5 A;  5KE3 A;  4JLI A;  1D3B B;  2XK0 A;  3LH0 A;  3V7S A;  3KXT A;  3CMA A;  3HP9 A;  5IAY A;  3OMC A;  4MZP A;  5GAM f;  4M7D C;  2D0Q B;  3DB3 A;  3ZFJ A;  2EKO A;  4C92 F;  5KH6 A;  3LX7 A;  1YJN A;  3HSB A;  4XQ3 A;  4E7L A;  3MEA A;  2DXB A;  2DTO A;  1VQP A;  1YIT T;  4BD3 A;  2CZ7 B;  3INZ A;  4KUL A;  3WVD B;  2V8I A;  2CZ0 B;  4C5I A;  2CKK A;  1N9S A;  3MP1 A;  2DJZ A;  3J7A F;  2OTJ T;  4O6J A;  5M9O A;  4EMK C;  2RJE A;  1B34 B;  4QVC A;  2G3R A;  4C8Q B;  1Q81 C;  2MMP A;  3FJP A;  3M5A A;  2YRV A;  1KG1 A;  4C92 G;  5GAO n;  1S72 A;  3LYI A;  2PQW A;  4L59 A;  2A3L A;  3SD4 A;  4M77 D;  4A53 A;  1H64 1;  4Y28 E;  4N4H A;  4BDY A;  1VQM T;  2YLC A;  3N5B B;  5A0L A;  1PSE A;  2E1H A;  4M78 F;  4BY6 B;  2E64 A;  3OS2 A;  1VQ7 A;  3A8H B;  4LDW A;  4XU1 A;  2E70 A;  4M7D A;  3SWN C;  4M7A B;  5A2Q E;  4J83 A;  4Y91 A;  3RMQ A;  2K3X A;  4C5H A;  3JCM e;  1YJN T;  3PFS A;  3C12 A;  5FU6 B;  3GNF B;  4C8Q F;  1UEB A;  3I55 T;  4VUB A;  3CCQ A;  4M75 D;  4JRQ A;  4BI3 A;  4C5E A;  3G6E T;  4YTL A;  3G7Z A;  3NTI A;  2CGH A;  3OMG A;  3VUB A;  2DO3 A;  2RHI A;  1IZ6 A;  1KC8 U;  5GMK j;  4A4F A;  1VQL A;  4OGE A;  3G4S A;  4EMK A;  4IUT A;  1VQ9 T;  4XU0 A;  4R56 A;  5LJ3 e;  1WJQ A;  1QVF S;  3CME T;  3CCE A;  3RKW A;  1UB4 A;  5LJ3 h;  4C0Z A;  4D6W A;  1BI2 A;  4MML A;  3OYC A;  1KHI A;  2DIQ A;  5KE2 A;  5GAN 8;  3CCM T;  2JZ2 A;  1ZHI A;  4HA8 A;  2DTH A;  3ZBD A;  5LJ5 j;  3CCJ T;  1Q86 U;  4XK8 E;  4C8Q G;  3CD6 T;  2DVE A;  1VIF A;  5GMK m;  5DM7 R;  2QEX A;  2E65 A;  3DKM A;  3CCL A;  3CXC S;  1N6A A;  1YHQ A;  3A5Z B;  3EAE A;  3CCV A;  3QYG B;  5LJ3 g;  3SWN A;  1YJ9 T;  2LT1 A;  3QG1 A;  3FB9 A;  4EPC A;  3HFO A;  3M55 A;  4MMK A;  3URG A;  2EYQ A;  5CO7 A;  2LCL A;  2EJF A;  2RA2 A;  5KCO A;  5GAN 2;  3V8J A;  3LWI A;  4M7D F;  3BW1 A;  5CKD A;  2RHY A;  2ZPE B;  4C0D B;  4M7A G;  2V8K A;  3MET A;  2QA4 T;  4P5N A;  4E7K A;  1WNL A;  1MGQ A;  2Y4X A;  4XTZ A;  3CXC A;  3BFM A;  3VV0 A;  3PIO A;  2HBP A;  1M8V A;  1Y07 A;  1R8O B;  4E7H A;  3G71 T;  2LQK A;  2F69 A;  2X35 A;  3PT9 A;  1H3Z A;  2M16 A;  3M54 A;  4FL6 A;  5CKF A;  3JCM P;  3JB9 F;  4RKU E;  3UWN A;  3CCE T;  4M75 E;  2I2L A;  5CKH A;  5GAN 5;  1EIF A;  4IUQ A;  4MZT A;  3MO8 A;  3QYH B;  4QW2 A;  3JRZ A;  4XU2 A;  4FM4 B;  3JCM X;  1OZ2 A;  4MDX A;  4Z02 A;  2K4Y A;  3J81 E;  1VQO A;  2JVV A;  3OYD A;  3JCM d;  2CZ1 B;  3OYG A;  3KBG A;  3OYI A;  3CCS T;  4M75 C;  3HRU A;  2XD0 A;  3GP8 A;  3OYA A;  3MCA B;  5CIU A;  4E7J A;  1KC8 C;  2LRQ A;  5EG2 A;  3S3M A;  4PJO D;  1G3W A;  4RG8 A;  1YI2 A;  2RM4 A;  3PNW C;  2QQR A;  2JOY A;  1JBM A;  3CC4 T;  1QP3 A;  4C92 B;  4IKF A;  3OW2 S;  4KT0 E;  2FHD A;  3CC7 A;  5GMK h;  4PKC C;  5LJ3 d;  1VQN T;  4FT2 A;  5CKE A;  4ZGE B;  1Q86 C;  3PTA A;  4M77 A;  1YIJ A;  3OBY A;  1BKB A;  1QVG S;  4F7U A;  5LJ5 e;  4JS5 A;  4IUV A;  2XG8 D;  2E41 A;  4QVZ A;  5LJ5 h;  3LW5 E;  5DY9 A;  1JJ2 S;  4XU3 A;  3OW2 A;  1VQ4 A;  2L3R A;  5IN1 A;  4BE2 A;  3RER A;  3S3O A;  2K2V A;  3OBW A;  2XI9 A;  3MHX A;  3QKJ A;  1M1K C;  5CAI A;  3F70 A;  4M75 A;  1N8R U;  3A8M B;  1QVG A;  3QSU A;  3M4G A;  5LJ5 g;  3ER0 A;  3O8V A;  2XID A;  4OGC A;  3HKS A;  5GAN d;  2X4Y A;  3HL8 A;  4M78 B;  3VU3 C;  3OYH A;  2GFU A;  1U1T A;  1K8A C;  2R5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...