4C8QD

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
81
Chain Sequence
LPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAIAVKLNEIYIRGTFIKFIKLQDNIIDKVKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
total genus 14
structure length 81
sequence length 91
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qD00
4M75C 4A53A 4V2SA 4M75F 3JB9D 4M77G 3V8KA 2YLBA 4C92E 5I21A 2E64A 2FB7A 4M75D 4J6YA 3RUXA 3JCMP 5GAN4 5GAN5 5GAOl 4M7DC 4J6XA 2JN0A 3HFOA 4M77F 4NL3A 2DXTA 4C8QB 2E1HA 3JB9F 3SWNA 4XTWA 5GMKh 4PJOA 3HSBA 3PGGA 5GAMh 1LOJA 4M77C 4C92C 3BW1A 1X01A 5GAMe 2HNIA 3QSUA 3JCMg 4C8QD 4M7AB 4M78B 4PNOA 4F7UB 5GMKe 1WQWA 4PJOG 5GMKj 5GMKm 3JCMX 3RERA 5LJ3e 3QUIA 1N9RA 1I81A 2DXUA 1MGQA 2E41A 4M77D 5GAMj 4DQ2A 4XU0A 4C92B 5GAMd 5GANf 5DY9A 4M7DD 3BFMA 3QO3A 3V8JA 5GAMg 5LJ3f 3V7CA 2VC8A 4XTVA 3RKYA 2Y90A 1B34B 4M77E 4M78E 5LJ5g 1WNLA 3JB9I 1I8FA 1D3BA 4C8QG 4M7DA 4M7DB 3JCMQ 1U1SA 3AHUA 4N0AA 4EMHA 4QVDA 2FYKA 5LJ3j 2I2LA 4C8QE 3M4GA 4JUVA 3JCMJ 4PJOF 3JCMf 1YCYA 4M7AC 2DVEA 3L1AA 4XQ3A 2DKGA 3SB2A 5GAN3 2QTXA 4M7DG 4M78D 4C92A 1JBMA 1M5Q1 2YLCA 3FB9A 5GANe 3RESA 5LJ5f 2DZ9A 3HFNA 1KQ1A 4X9DA 4PJOD 4M77B 3EFSA 5CAIA 3JB9J 4J5YA 2K57A 4M7DE 4M78C 2CGHA 4PJOE 2DTIA 4XTZA 1LNXA 3JCMV 2VXEA 1D3BB 4C92G 4C8QA 4C8QF 1N9SA 5LJ5e 2E10A 4MMKA 4Y91A 4HT8A 5LJ3g 1WQ7A 3INZA 3FIFA 4M78F 4XTXA 1H641 5LJ3d 4M75B 4EMKA 4M78G 3JCMe 4M7AE 3RIRA 4M7AG 4F7UA 5GAOn 3V7RA 2VXFA 2ZGWA 5GMKi 4NOYA 5GANj 4N0AC 3BY7A 2RD1A 3JCMW 2DTHA 2EJGA 2EJ9A 5GAOm 3JCMb 5GAN8 3V8LA 1Y96B 4JRIA 4M7AA 5GAN6 2EJFA 4QVCA 5LJ5j 5LJ3h 3JCMd 4EMGA 4XU1A 3RKXA 1HK9A 3VU3C 1U1TA 3JB9H 2YHTA 2RM4A 4M75A 4XU3A 4M7AD 3L2ZA 4A54A 1I5LA 4M78A 4C92D 3BDUA 2E65A 3SWNB 5GMKl 3V7SA 4F7UG 4X9CA 5GAN7 4C8QC 3JB9G 3RKWA 4PJOB 4JRKA 4NL2A 3JCMh 4M7AF 4HT9A 4EMKB 3QHSA 1M8VA 4MMLA 5LJ5d 4M75E 3GIBA 4EMKC 5LJ5h 4J6WA 3FJPA 4XTYA 1JRIA 1TH7A 4WF2A 4JLIA 4OP0A 4XU2A 1I4K1 4F7UF 5GAOp 5GAOq 1B34A 4C92F 4XTUA 1WPYA 4RCCA 2DZCA 1Y96A 3SWNC 5GAN2 1KQ2A 2RB6A 4M75G 4PJOC 3JCMc 5GANh 1BIAA 2DEQA 1LJOA 3EFRA 5GAMf 5GANd 1HXDA 4M77A 2DTOA 4RCBA 5GANg 2DJZA 5GAOr 4F7UE 2EAYA 4HA8A 4M7DF 1BIBA 2RA2A 2EWNA
chains in the Genus database with same CATH superfamily
1VQ4A 1C0MA 2D9TA 2KVQG 2CZ0B 2QTVA 1T0HA 2A37A 4FYXB 1RADB 1MMAA 4C8QB 3EG9A 4XTWA 5GMKh 3TSZA 1WA7A 1UGVA 1VQ7T 4M77C 5IXBA 1YITT 3JCMg 3OYGA 2JNGA 1Q86U 2GFUA 1Q82C 1KHIA 1MGQA 2AZSA 4XU0A 1WYXA 1YIJT 1A0NB 2AHJB 1IHVA 2CP6A 3JB9I 1SSHA 3FJ5A 3CCMT 1KD1R 5IN1A 2EIFA 4KGZB 3I56T 4M7AC 2DXBA 3CCUT 2MCNA 4OB2B 3SEMA 1MNEA 2WSFE 3HFNA 2R5AA 1YHQA 1QCNA 3CC4T 1D1BA 4M7AE 4FU6A 2ZPFB 3X28B 5GMKi 3NFCA 5HCKA 1PCXA 4DBFA 1MMDA 1TTHB 2DBKA 2CSQA 2DBMA 3C94A 4LNPA 3CMEA 1XOVA 3QKJA 4AFSC 1RLQC 3GNFB 3OYMA 3V7SA 2JXBA 3E1SA 4JRKA 3CCQA 1YBYA 1UDLA 1OQKA 2GQIA 3OYBA 2CDTA 2PTKA 4JLIA 2K5LA 3VS1A 1WPYA 1VQ7Q 2RB6A 2MMPA 1M9SA 1WHKA 3I55Q 3EFRA 2GBQA 4CI0C 2GTOA 1FMKA 2PVOB 1VQOQ 1VQ6T 4C0ZA 1AZEA 2K79A 2DIGA 2OTJT 2V26A 3KBGA 5KE3A 1IRXA 2HKNA 4FSSA 5A0GA 3KUFA 2DYBA 5CK9A 3VYGA 1AZGB 2KNBB 4L59A 3QZ9B 1GCQA 2MI6A 3M58A 4XAXB 4M7AB 6AT1B 3M0SA 1AWOA 1WHGA 1WQWA 1FXXA 1BI3A 4WTOB 4FW2A 3CMET 1WHJA 1F1BB 4FM4B 1AVZC 3CCVA 4KULA 2O01E 1I8FA 4OMLA 3OYYA 4M7DB 2FYKA 1PG5B 4C8QE 2GTJA 1M1FA 1I07A 1PSFA 3LWIA 2QA4T 3G1JA 3NTIA 3JB9J 4ME7A 4CC3A 4E7JA 5FRNA 4C92G 3JCMV 4WCIA 4E2FB 4PJLA 2PVDB 4ELZC 1VQOT 2PZ1A 3RIRA 1VQ6Q 4BDYA 3O8VA 3X25B 2LTOA 4NOYA 1VQNT 4A4FA 2RD1A 3OW2S 3I55T 1X69A 4M7AA 2K3XA 2WSEE 4EMGA 2ZPGB 4JLGA 3CD6A 1C6VX 4QKUA 3D7SB 3OYDA 1K9AA 2DERA 2YUNA 2O4XB 2KROA 1Y57A 2ED0A 2A3LA 4ORZA 3VS4A 3FJPA 4KT0E 5A2QE 1RAGB 1SKUB 1JQQA 4XU2A 5GAOp 2FL7A 1VQKA 5HKCA 2HBPA 2HBWA 1K76A 2KE9A 1LJOA 4ZGEB 3HP9A 2DTOA 1UGQB 4M7DF 5CR2A 2P84A 1VQPQ 1BI2A 2K7AA 1K1ZA 3OY9A 1QCFA 2FB7A 3ZFJA 1E6HA 1BCOA 1YWOA 1PKSA 5GAN5 1QP3A 4BE2A 1M2VA 5DLOA 5I2MA 3OS0A 2PNIA 3GOXA 2DL7A 1AD5A 3CCRA 1WDXA 3OYAA 3ZL7C 2XICA 3JCMX 1NEBA 1MV3A 2QDLA 3UA6A 2RQWA 1H8KA 2EGAA 1E6GA 2NLUA 3V7CA 3VS0A 4C0DB 2FZKB 1ABQA 1MHNA 2GNCA 2A08A 1S72A 5ECAA 3EG3A 4XQ3A 2QTXA 4M7DG 2XG8D 3QWYA 3RESA 2NYSA 4IKFA 1X6BA 3ULRB 2LJ1A 1OU8A 1GL5A 3M0RA 1K9MU 5CKBA 3CBPA 1M1KU 4M7AG 4UC4A 1K8AU 1G3WA 1V29B 3KXTA 2EJGA 3ER0A 3EH1A 4RG8A 2EJFA 2J6KA 5KYWB 3P8HA 2KXDA 3MP8A 3HPWA 2LQ8A 2ZAEA 2CP3A 4ZN1A 1RABB 2IG0A 3URGA 3SWNB 4BUGA 1YHQT 1RLPC 4E6RA 3JCMh 2ED1A 3OS1A 1N5ZA 1VQ5T 5AT1B 4J6WA 1NJIC 3PE0A 4F7UF 5GAOq 1KQ2A 2DZCA 4ANJA 3CCMA 2L89A 5EC7A 3PVQA 4Z8AA 1SPKA 1G83A 2RA2A 1WHMA 2RK1A 4V2SA 4BDZA 3JB9D 1UB4A 3V8KA 1FMVA 2XDBA 4M75D 4RTVA 3M53A 3VS3A 2JTEA 1TS9A 2EVRA 5HK0A 4PJMA 2AKLA 3H41A 4A4KA 1BI1A 3OYJA 4LDWA 3MCAB 2KAFA 2FG0A 3L2VA 1VQOA 2EQJA 3CCLT 4PNOA 2DPPB 2GCXA 4PJOG 4OMMA 1JB0E 2OTLT 3EG1A 2CUBA 2E5QA 3S3NA 2OI3A 4E47A 1SSFA 2AZVA 5D6WA 2EYWA 5KH6A 4QVDA 2CSIA 4QW2A 3CD6T 1VQPA 1G3YA 4BD3A 2VGMA 5GANe 4QT7A 2PUKB 2WSCE 1WXTA 3J7AF 3EFOA 1X6GA 2XD0A 4CRIA 5L8RE 2FO0A 4CC4B 2FRWA 3INZA 1QKWA 1FWZA 4RTTA 4RTXA 1B7TA 1Q7YC 2LDMA 2XIDA 3LH0A 1YWPA 3V8LA 1E7OA 2P4TA 2QEXQ 2JMAA 4RTUA 1YJWQ 4NS5A 4RG2A 1R77A 3CCEQ 1JXMA 2EFIA 1WHHA 4MZMA 4BI3A 1VQ9Q 1QQJA 4PFOA 4NL2A 3L2WA 2DETA 3O5ZA 1VQ4Q 3EGDB 3QHSA 5LJ5d 1WJSA 1BCMA 4LUEA 2JJ9A 1QWFA 3C95A 3OW2P 4GLKA 1ZUUA 2EGCA 5GAMf 1D1CA 1YI2T 1WHLA 2KY9A 2NWMA 3SD4A 2EAYA 3VUZA 2K5FA 5IAYA 1JEGA 3EH2A 5CQXA 4RTZA 4F04B 1ZA1B 4J6YA 1G8XA 2GQVA 1NEGA 2JN0A 3TSWA 5KYUA 2YRVA 3OSSC 3CC4Q 3GLXA 1X01A 3JSCA 2COWA 3MEWA 2FZGB 1I81A 2LNVA 1M1KC 3NGPA 2QGFB 3M9QA 2OX7A 5GAMd 4IUUA 1YHQQ 2A36A 2YXYA 4KH1B 4R0KA 4JJDA 1YCSB 2BZ8A 2CKKA 1IXDA 2Y4YA 2PQWA 2DD4A 1KJWA 4LDYA 3CCRQ 1UJYA 3H9NA 1YCYA 2D8JA 5IXFA 1YJ9A 4LN2A 2MYSA 4X9DA 1YIJA 4HCKA 4AMCA 1HSQA 2LJ0A 2RHYA 4BACA 3A98A 1RAIB 1LNXA 2SRCA 2IPOB 2RJFA 3EGUA 1XQHA 4N4GA 3CCQQ 4FYYB 1QWEA 2M16A 4BB7A 4N0AC 3VS6A 4AFUC 4E7HA 1TG0A 3OQ5A 2MOXA 3JCMb 1NE8A 2X3XD 1JU5C 3PIPA 5I11A 1OI1A 4XU3A 1VQKT 4C92D 2HEQA 2XMFA 2HMAA 1VQ4T 1KD1C 2DO3A 1JXOA 3GIBA 2V1RA 2VUBA 5D6XA 5KYXA 3G6ET 4LDXA 3MO8A 5GAN2 1MMNA 2DEQA 2RK2A 3PFSA 1VQMT 2RJDA 4OMOA 2JM8A 2DX1A 3CCSQ 1IGQA 1KK7A 2DMOA 2LZ6B 2GGRA 2QQAA 1SRMA 1UGSB 1DJ7B 5CVIA 1WI7A 5J26A 4J83A 3MP1A 3QYHB 4EDUA 3PMTA 3CCVQ 1BK2A 3JB9F 1ARKA 2RF0A 2KRNA 3UF4A 2QA4A 3QIIA 3M59A 2JOYA 2JW4A 4DQ2A 1VQLQ 1SRLA 2G6FX 3CCET 4Q5WA 1M4ZA 2DXCA 3M57A 1D3BA 4QQ6A 3CCLQ 2X9HA 2EPDA 2FPFA 2LX7A 2C0OA 4LDUA 1GRIA 3PTAA 3TCJA 4IIOA 2JUFA 4C0DC 1W2BA 2KXCA 3CC7A 4XTZA 1D3BB 3C0CA 1VYTA 1N9SA 4MMKA 1WQ7A 4Z02A 4M78G 4D8KA 4B6MA 3S6WA 3V7RA 2OTJA 3QDFA 1JJ2S 1OX9A 5HY6A 3VUBA 3CD6Q 4XU1A 4FT4A 1FYNA 4J7FA 2W0ZA 1ZHIA 1OPKA 1VQ8T 3OBYA 5L23A 1KC8U 5CKEA 3EAEA 1M1KR 1VIFA 1VYUA 2E3HA 2L5QA 4XTYA 1TH7A 2VYTA 4AT1B 1I1JA 3G4ST 3FLGA 4XTUA 2C0IA 1YN8A 1HXDA 1AWWA 2QYZA 2BKDN 2QK0A 2RNAA 3J81E 3EHQA 3CCEA 3TEEA 1RL2A 3CXCP 2NUPA 4M77G 2JS0A 3QJ6A 4AFQC 1WZOA 1ZUYA 3FDRA 3OYHA 2RMOA 2XU8A 3A8GB 3GF5A 4HCBA 4E7LA 2FZCB 1RUWA 3A1PA 2ZPHB 3NMZC 1HD3A 4F16A 1M90U 1VQ9A 4F14A 1LOJA 3I56A 3BW1A 4IUVA 2CT3A 2RHXA 5GMKe 2RJEA 3GP8A 1OULA 4KGXB 1IO6A 1VQ5Q 2BIVA 1EFNA 2LP5A 1W2BP 1IREB 1ZBJA 5FROA 3P8DA 2CT4A 2KK4A 3F70A 3JCMQ 2Y4XA 3G6EA 5FU6B 2HL3A 3LGFA 2YSQA 3FB9A 4PJOD 2F2VA 1K0SA 1NYFA 4KUIA 4J5YA 3KFVA 4M78C 2DAQA 5A0DA 1O75A 4J9HA 3GBQA 4HCZA 3JCMe 4F7UA 1O9SA 1R8OB 2B8AA 1IHWA 4C5IA 3H0IA 2KQWA 2LNHB 2RI5A 3JCMd 1B07A 2AKKA 3VU3C 3CCMQ 4FSXA 3THKA 4BE0A 4PJOB 2BTTA 4F7UG 1S1NA 4M7AF 2COZA 1UFFA 3LGLA 5LL6S 3L2QA 2VGNA 1H92A 1YJWT 4ATOA 2VASA 1KHCA 4RCCA 3HRUA 4JS5A 1OZ3A 2XHCA 1VQ8Q 3UATA 1VQ9T 4BE1A 1TUGB 1VQNQ 4RTWA 4JS4A 2HSEB 1BIBA 1UG1A 1Q86R 4ELYC 4M75F 2K4YA 2FRYA 2A7YA 2PU9B 4XK8E 2F2WA 2E64A 5FU6C 2YDLA 4IUPA 1M2OA 3M0UA 2DA9A 1KQSS 2W10A 4MDWA 5I22A 2HNIA 2NUTB 4DBQA 5C6SA 2MAMA 5GMKj 5LJ3e 2LX9A 1RI9A 2XDPA 4R56A 1VQMQ 3CC7T 1WJRA 1YNZA 1UUEA 9ATCB 5CKDA 1ZSGA 4OMFB 1OZ2A 3VYHB 4C8QG 2NUTA 3AHUA 1U3OA 4N0AA 3H8ZA 3R6NA 4RTYA 3CC2A 1AWJA 1AOJA 2DVEA 2ECZA 3L1AA 2EYXA 3N5BB 2KT8A 1M5Q1 2OTLQ 5LJ5f 1WXUA 3EFSA 3M54A 2O88A 2M51A 3PVLA 2LT1A 4PJOE 5C0MA 2EW3A 5LJ5e 5A0LA 5LJ3g 2CREA 2JT4A 4M78F 1T3SA 2K2MA 3FC3A 2L2PA 3C12A 4L6V5 1S72T 3OYFA 2DEUA 2QA4Q 2M02A 3EHRA 4DOVA 1VUBA 4BI8B 4II1A 2MPXC 1PC0A 3JB9H 1G5VA 4X1VA 2NUZA 2RQRA 2V8JA 4M78A 4OGCA 4B9WA 1W1FA 4EMKB 4PL6A 3CCRT 2F2XA 5IT9E 1U5SA 2IIMA 1TOVA 5M9OA 3QPHA 1J3TA 5KE2A 4FL6A 2LCCA 3CPWA 2VV5A 1Y96A 4JJCA 5EG2A 2KYMA 4F17A 3HKSA 5GANg 1AEYA 2G3RA 4J8OA 2K2VA 4ZGDB 4C5GA 2OTJQ 1OX8A 2DRKA 1UHCA 2LJ3A 3DB4A 1VA7A 4DBHA 1KD1U 2EQKA 4Z88A 1BBZA 3DB3A 3JCMP 5GAOl 2QQBA 2EQUA 3CCUQ 2X4JA 2OJ2A 5GAMh 1M3CA 4A4GA 4O6JA 3PNWC 1N9RA 5GANf 4J9GA 3V8JA 5GAMg 1ABOA 4XTVA 1KFZA 1PD1A 3SDZA 2X51A 3G4SQ 2ROTA 3QG1A 4J9FA 2EQMA 1PKTA 5J3BA 1WLPB 1VQNA 5FU7B 1Q82U 1NG2A 2I2LA 4HKEA 4JUVA 4PLIA 2K3BA 4R55A 2D8HA 2LT4A 1R0CB 2EKHA 4RMOA 1QVFP 2CUDA 2VWFA 1KQ1A 5CAIA 2M9UA 4ZNXA 2DTIA 2XKOC 4LUDA 2ROLA 2E10A 3FIFA 3QJYA 3WXMB 2BZXA 4DOWA 2VXFA 1Q82R 1X75C 3M4YA 2RQVA 3OMCA 1MNDA 3SFMA 1U1TA 1X43A 1YFNA 5IH2A 3VJPA 3L2ZA 1KC8C 3MEUA 4HT9A 2C06A 1GBQA 2QG9B 1H3ZA 2BUDA 2DJQA 4QQDA 1IB8A 1JRIA 2ZZDA 4J7IA 1C1AA 2KBTA 5FWBA 3SWNC 1I5OB 1M8MA 2EKOA 2EYZA 5GANh 2KRSA 1VQLT 2CP5A 3QXEB 5IHIA 1Y71A 2D1XA 5GAOr 3H0HA 3RR6A 1X27A 1VQ6A 3H6ZA 1QVGA 1D0XA 2PUOB 2X35A 3RMQA 3OA6A 2LRQA 4J6XA 3HFOA 1M90C 2LVMA 2DXTA 1ZBXA 4A4HA 3HSBA 3CPWS 2V1QA 1QVGS 2HZYA 3HHTB 2WACA 5GMKm 2H3JA 3UPUA 4M77D 2E41A 1NZ9A 3CEYA 2P4RA 4BI4A 5DY9A 3BFMA 2VC8A 2RHUA 3HRTA 3X20B 2F1LA 1K73R 1BYMA 2EQIA 1JO8A 3SHWA 3CMAQ 1VQKQ 1Y0MA 2BE9B 4ESRA 2HQXA 2VXEA 4C8QA 4OMNA 3MKDA 3Q1JA 2O4XA 1YJNA 5J39A 1NJIR 4KBMB 2AT1B 3M0TA 2CP7A 4KGVB 4A63B 2HCKA 1X2QA 1BU1A 5GAN6 3HL8A 1LPLA 2VKNA 1G2BA 3MP6A 4C5HA 3NHNA 1K9MR 4E7KA 2X4WA 3G71T 3VS2A 5GAN7 2LQKA 3MHXA 1Q81C 3RKWA 7AT1B 1K4US 3CBMA 4JZ4A 3A8LB 4EMKC 3QYGB 1TWBA 2OTLA 2E4HA 4HXJA 3A8OB 5FRMA 1MV0B 2DVJA 1XTDA 1BIAA 3OYEA 3TREA 4RCBA 2QQRA 3IQLA 5CCAA 4ZGJB 1PD0A 3OS2A 1TSFA 4A53A 1Y07A 1ZSZB 3CQTA 2ENMA 1TU0B 3VV0A 1GXIE 3JRZA 3OYLA 4NL3A 2CP2A 2E1HA 3SWNA 1EIFA 3G6EQ 4IURA 3X26B 2EYQA 2XK0A 2XDDA 3QUIA 4ZTFA 4KH0B 2J6FA 4M7DD 1UECA 3QO3A 3OYIA 2JZ2A 4DEYA 1VOMA 2HQHA 5LJ5g 4M78E 1P92A 1YITQ 2YWWA 4PJOF 4AG1C 1WXBA 2DYIA 3M56A 2YLCA 5KYWA 2RHZA 3QDRB 1YJ9Q 1AHJB 4IUTA 2Z0WA 1R0BG 1OV3A 2CGHA 4L5GA 3VKIA 5DLQE 1QVPA 4Y91A 3ZBDA 2C0TA 4LD9K 2RN8A 1HJDA 3UA7A 3T9NA 3CXCS 2CZ6B 1WFWA 1VYVA 1Q81R 5GAN8 5CKHA 1Y96B 4BY6B 3WVDB 5LJ3h 4N4HA 2JMCA 2AIRB 2RQUA 1NJIU 1D0ZA 2X3WD 1G3SA 1VQ8A 1QVFS 1ZSZC 1OPLA 3MJXA 2A28A 2RM4A 1SHGA 4M75A 4M7AD 1PWTA 4HVVA 1QMCA 2DFUA 1UHFA 4C8QC 2COYA 4BY6C 4OB0B 2K9GA 5KYYA 3CXCA 2ZPBB 1TUCA 3H0FA 1ZX6A 4WF2A 4N4IA 2KRMA 1M30A 2YRDA 2ESWA 2JTFA 1FMWA 1W70A 4M75G 1GFCA 1PRMC 3DKMA 4PJJA 2FVUA 4MZPA 2KSSA 1S72Q 1Q95G 3OBWA 5CO7A 1KG1A 1ZA2B 4FT2A 2F5TX 2CH4W 4Z89A 2EBPA 4PFPA 1Z9QA 3QBYA 2BZYA 2QQ9A 2FEIA 1YI2Q 3GPLA 3QSUA 4A4EA 3LW5E 2DM1A 3RERA 2JTMA 3CCJQ 1UEBA 3E19A 4DEXA 2EYYA 4J9CA 2D0NA 2R57A 2D0QB 3OS5A 5LJ3f 2Y90A 4PFZA 4J9DA 2KYBA 3G71A 2QEXT 3I35A 3M4GA 2GFAA 3JCMJ 3JCMf 4M4ZA 4FYWB 2KEAA 1Q81U 3M5AA 3CCVT 2K5IA 4M77B 1X2KA 4YTLA 2MK5A 1U06A 1YP5A 4Y28E 1UGPB 1M27C 4GBQA 3TVTA 2RI2A 4XTXA 1RI0A 1AWXA 2ZGWA 2ZPIB 3JCMW 2DTHA 5GAOm 3QWXX 4IUQA 1JJ2A 1KC8R 2ZCFB 1M3BA 3QZ5B 1Q7YU 1YJ9T 1I5LA 2DL8A 3BDUA 3M55A 2RH2A 1YJNQ 1MMGA 3L2UA 4FCYA 3L2RA 1GCPA 1OEBA 3DLMA 4JJNK 4M75E 1K8AR 3ME9A 2ABLA 1MUZA 3TU4K 4KUDK 2QXFA 3MPUB 1YIJQ 2LCSA 2DL3A 3X24B 4D6WA 2EWNA 4M75C 4OVAA 3CCQT 4JZ3A 2P0KA 1NLPC 1RACB 1M90R 1WGSA 5KYNA 3EG0A 4M7DC 3G4SA 5CKFA 3L42A 1LCKA 2HKQB 1AT1B 1ZQ1A 2E5KA 1XJWB 1N27A 1K73U 2CYZB 5GJVB 4OGEA 2DXUA 2VB6A 2KDSA 1W6XA 4AG2C 1FX7A 1G3TA 4M77E 1UGRB 2CZ1B 3CCSA 1SEMA 3LLRA 4AFZC 3REAB 1UTIA 2DK3A 3EGDA 5IHNA 2R5MA 4C92A 2LMJA 2X4YA 3OYKA 2R58A 2L8DA 1D0YA 4OB1B 1JJ2P 1UJ0A 1Q7YR 2OAUA 4PLLA 3I5SA 1N8RU 1YI2A 3CPWP 3CC4A 2DL4A 4EMKA 4M75B 1YITA 4HVWA 4OMPA 1RAAB 3M0QA 1SG5A 4E7SA 5GAOn 4FIBA 2DD5A 2F5KA 5KYYB 1CKAA 4JRIA 5LJ5j 8AT1B 5I2SA 2JS2A 2HAXA 1NLOC 1NBEB 4A54A 2E65A 3NTKA 2V8KA 4CC7A 2BE7D 1NYGA 3MEAA 4PJOC 2RO0A 3G7ZA 3CC7Q 5AYFA 1N8RR 1VQ7A 3CMEQ 2DJZA 3CCLA 1Q86C 3EG9B 4EMHA 5LJ3j 5KYUB 2AK5A 1EZZB 2O9SA 2P0QA 2YLBA 4DBRA 1WJQA 3META 1VQPT 5FU7C 5GAN4 5KYXB 4ZTJA 3C4SA 2LC4A 4C0FA 1ZUKA 3BDLA 2E3IA 1EX4A 1QW1A 1KQSP 3RDVA 3OB9A 1QKXA 1RAHB 5KCOA 1V76A 5CQYA 3LX7A 1OOTA 4OB3B 2KR3A 3U23A 1BKBA 2DF6A 1N6AA 2E12A 2JM9A 2J06A 2KGTA 1B3QA 4P5NA 1PNJA 1PRLC 1M2VB 4M7DA 3RNJA 3AT1B 2RHIA 2P0PA 4JRQA 2F69A 3SB2A 2M1HA 4VUBA 4B9XA 4M78D 2KMTA 2OAWA 2V8IA 1ZSZA 4M7DE 2QASA 2DLPA 4C5EA 1XNIA 1H641 1HYOA 2HQEA 3CCST 5GANj 2K6DA 3CMAT 4PJNA 2E70A 1QCOA 1VQ5A 2RQTA 1VQLA 4GLMA 1HK9A 3CC2T 1M3AA 1BB9A 2L3SA 2X4XA 5GMKl 2A0FB 4X9CA 3UDCA 2CZ7B 4QVZA 3I56Q 1M8VA 2FPEA 1QVGP 3A8MB 3M0PA 2SEMA 4DA4A 4OP0A 1I4K1 4FYVB 1NPRA 2DIQA 1B34A 2VVKA 1QVFA 2XI9A 2J05A 2QDYB 1CSKA 2L0AA 1GFDA 5FLXE 2M0OA 2RI3A 1PSEA 2RPNA 3PIOA 3FRNA 4OF1A 3UT1A 3PT9A 3RUXA 1RAFB 3VRYA 1Y7XA 2KT1A 4EPCA 2E6NA 3FEOA 2JVVA 4PJOA 4CC2A 3CCUA 2L3PA 5GAMe 4J9EA 3E9GA 1LVKA 3UWNA 2J7IA 4M78B 3REBB 2NUPB 2MWPA 4HCCA 2ZPEB 3NPFA 4ZN3A 4C92B 5KCHA 1Z9ZA 4K11A 3RKYA 4LD6A 1B34B 2L3RA 3RBBB 2HD0A 2H8HA 1NPPA 1M1GA 2DKGA 2HSPA 1GCQC 3E2UA 2DZ9A 3ZEHA 3EFOB 2K57A 2O31A 3ASKA 2QI2A 4TVRA 3I55A 2MWOA 2DE0X 4O5VA 4D8DA 5LJ3d 1NM7A 2MIOA 1KQSA 3PMIA 3J80E 5IHKA 1QLYA 1WX6A 3BY7A 5DM7R 4LXCA 2KI7A 2EJ9A 4LDVA 4OMQA 2B86A 5FWCA 2E6ZA 3LWHA 4JJBA 4QVCA 2K3YA 3HTRA 4MDXA 1ZLMA 3OSVA 1I0CA 5D6YA 2DRMA 4HVUA 5GJWB 3VS7A 8ATCB 3MEVA 2M0YA 3R6OA 4JDSA 5FW9A 2L3QA 1WIEA 1PHTA 2GF7A 5LJ5h 4MZTA 3GNGA 1OU9A 4C92F 2LQWA 1V1CA 3E9FA 3JCMc 5CIUA 3BE3A 2CS7A 2IVWA 4M77A 1YJNT 5D7UA 4KRTA 3CPFA 4HA8A 2DILA 1H3HA 1D09B 3LH5A 3NTHA 3CC2Q 2J6OA 2H3EB 2EGEA 1UE9A 2YT6A 2I0NA 3WVEB 4C92E 2YUPA 4GY5A 1SHFA 5I21A 3OYCA 3VRZA 2O9VA 4Y92A 1T0JA 1U8RA 2FHDA 4M77F 1K0XA 2HL5C 1KIKA 1T3LA 1GBRA 3PGGA 2FPDA 1QP2A 2MF2A 4E7IA 4C92C 3JAME 4C8QD 2DNUA 4F7UB 4E7ZA 3CCJA 3OMGA 1BI0A 3TQ7P 4PKCC 4JPBW 3I5RA 5GAMj 1PM3A 1TXQA 1KSWA 1W4SA 3EGXA 4RKUE 2QQSA 3CBOA 2CP0A 2CH4A 1CKBA 2QAZA 3G71Q 1WNLA 4IIMA 1X6OA 1U1SA 4C0GA 1K8AC 4JRPA 4RUGA 4FW1A 2YRCA 5GAN3 1TUDA 4PK4A 3EGXB 3VS5A 1W2BS 1JBMA 2LCLA 3CCJT 1K73C 3CMAA 2O2OA 2YUOA 4QQGA 1N8RC 1IZ6A 4C8QF 4J9IA 4HT8A 1OYXA 4EIKA 1ACMB 2LQNA 1K9MC 3RMSA 2ATCB 3DLLA 2YUQA 4X34A 3OYNA 3S3MA 3A5ZB 3RKXA 2YHTA 3HRSA 3JV3A 2PVGB 1YJWA 4LE9A 3JB9G 3P8BB 2D6FA 4J9BA 4MMLA 1IGUA 1RAEB 3A8HB 1VQMA 3EG2A 2DL5A 3LYIA 1VIEA 2QEXA 2QGGA 1D1AA 5GANd 3S3OA 5HK3A 1SF9A 3OW2A 4F7UE 3I9QA 2HDAA 2RJCA
chains in the Genus database with same CATH topology
4M75C 4J8OA 4OVAA 3VUZA 2K5FA 2K2VA 4ZGDB 3CCQT 4C5GA 1VQ4A 5IAYA 5CQXA 3DB4A 2D9TA 2KVQG 1KD1U 2CZ0B 2P0KA 2EQKA 1WGSA 4J6YA 3DB3A 3JCMP 2GQVA 5GAOl 4M7DC 2JN0A 3G4SA 5CKFA 2QQBA 4C8QB 3L42A 4XTWA 2EQUA 5GMKh 2YRVA 3OSSC 1ZQ1A 2X4JA 3GLXA 1VQ7T 5GAMh 4M77C 4A4GA 1X01A 4O6JA 3JSCA 1YITT 1N27A 3PNWC 2JNGA 3JCMg 3OYGA 1Q86U 2GFUA 1K73U 1Q82C 3MEWA 2CYZB 4OGEA 1N9RA 1I81A 1KHIA 1MGQA 2DXUA 2LNVA 2KDSA 1M1KC 3M9QA 4XU0A 5GAMd 5GANf 4IUUA 1FX7A 3V8JA 5GAMg 4D6WA 4XTVA 1YIJT 3SDZA 1G3TA 2AHJB 3QG1A 4M77E 2EQMA 5J3BA 2CKKA 3JB9I 1UGRB 2CZ1B 2Y4YA 2PQWA 3CCMT 1VQNA 5FU7B 2DD4A 3CCSA 1Q82U 2I2LA 4HKEA 4LDYA 5IN1A 2EIFA 3LLRA 4JUVA 4PLIA 1YCYA 2DK3A 3I56T 4R55A 2DXBA 3CCUT 4M7AC 2LT4A 4OB2B 2R5MA 4C92A 1YJ9A 4RMOA 2X4YA 2WSFE 4X9DA 3HFNA 1KQ1A 3OYKA 2R58A 5CAIA 1YIJA 2L8DA 2R5AA 2RHYA 4OB1B 4BACA 2M9UA 2XKOC 2DTIA 1LNXA 1YHQA 2OAUA 4PLLA 2E10A 3CC4T 2RJFA 1N8RU 1YI2A 1XQHA 3FIFA 4N4GA 3CC4A 3QJYA 3WXMB 4M75B 4DOWA 4EMKA 4M7AE 2M16A 2ZPFB 4FU6A 3X28B 1YITA 5GAOn 2VXFA 4FIBA 5GMKi 4BB7A 4N0AC 4E7HA 3NFCA 3OQ5A 2DD5A 1X75C 3M4YA 3JCMb 2F5KA 1NE8A 3OMCA 4JRIA 5LJ5j 3SFMA 5I2SA 2HAXA 3PIPA 1U1TA 1OI1A 3C94A 3CMEA 4XU3A 1XOVA 3QKJA 3OYMA 3VJPA 3GNFB 3L2ZA 4A54A 1KC8C 1VQKT 4C92D 2E65A 3V7SA 3MEUA 3E1SA 4JRKA 3CCQA 1VQ4T 1YBYA 3NTKA 4HT9A 2V8KA 1KD1C 2DO3A 3OYBA 2C06A 3GIBA 1H3ZA 2BUDA 4QQDA 2VUBA 1JRIA 5D6XA 2ZZDA 4J7IA 4JLIA 2K5LA 3G6ET 4LDXA 1WPYA 3MEAA 3MO8A 3SWNC 5GAN2 4PJOC 2EKOA 2RB6A 2MMPA 2RO0A 5GANh 1M9SA 1VQLT 3G7ZA 2DEQA 2RK2A 3EFRA 5AYFA 3PFSA 1VQMT 1VQ7A 2RJDA 3QXEB 1Y71A 4CI0C 2DJZA 5GAOr 2PVOB 3CCLA 1Q86C 4EMHA 5LJ3j 1VQ6T 4C0ZA 1VQ6A 3H6ZA 1QVGA 2P0QA 2YLBA 2QQAA 2DIGA 2PUOB 2X35A 1UGSB 3RMQA 1DJ7B 5CVIA 1WJQA 3OA6A 2OTJT 5J26A 3KBGA 3META 4J83A 5KE3A 3MP1A 5FU7C 1VQPT 2LRQA 3QYHB 5GAN4 4ZTJA 3C4SA 4EDUA 3PMTA 4J6XA 3HFOA 2LC4A 2LVMA 4C0FA 3KUFA 5A0GA 2DXTA 1M90C 3BDLA 3JB9F 1ZBXA 4A4HA 5CK9A 1QW1A 3VYGA 3HSBA 3OB9A 4L59A 3QZ9B 5KCOA 2MI6A 3CPWS 1QVGS 3HHTB 2WACA 3M58A 4XAXB 5CQYA 4M7AB 2QA4A 1WQWA 3QIIA 3M59A 5GMKm 2H3JA 2JOYA 3LX7A 4OB3B 1FXXA 3UPUA 1BI3A 4M77D 2E41A 3CMET 1NZ9A 3CEYA 1BKBA 4DQ2A 4BI4A 5DY9A 3BFMA 1N6AA 2E12A 4FM4B 2VC8A 3CCVA 4P5NA 3CCET 4Q5WA 1M4ZA 2DXCA 4KULA 2O01E 3M57A 1I8FA 1D3BA 2RHUA 3HRTA 4QQ6A 3OYYA 4M7DA 4M7DB 3X20B 2RHIA 2FYKA 2P0PA 4C8QE 4JRQA 2F69A 1M1FA 3SB2A 1BYMA 2M1HA 4VUBA 4B9XA 4LDUA 4M78D 2KMTA 3PTAA 1PSFA 2V8IA 3TCJA 3LWIA 2QA4T 2JUFA 4C0DC 3NTIA 3JB9J 4ME7A 1W2BA 4M7DE 4E7JA 3CC7A 5FRNA 4XTZA 4C92G 2HQXA 2VXEA 1D3BB 3JCMV 4C5EA 4C8QA 1N9SA 3Q1JA 4MMKA 2O4XA 1YJNA 1WQ7A 1XNIA 5J39A 4Z02A 1H641 2PVDB 4KBMB 4M78G 3RIRA 4ELZC 1VQOT 4BDYA 3O8VA 3X25B 2HQEA 2LTOA 3S6WA 3V7RA 3CCST 4NOYA 5GANj 1VQNT 4A4FA 2OTJA 3CMAT 2E70A 1JJ2S 2RD1A 3OW2S 5HY6A 3VUBA 3I55T 4M7AA 1VQ5A 5GAN6 2K3XA 3HL8A 2WSEE 3MP6A 1VQLA 4EMGA 2ZPGB 4XU1A 4JLGA 1HK9A 3CD6A 4C5HA 3CC2T 3CCLT 4E7KA 4FT4A 3OYDA 2X4WA 4J7FA 3G71T 2X4XA 5GAN7 2LQKA 3MHXA 2O4XB 5GMKl 4X9CA 1Q81C 3RKWA 1ZHIA 2CZ7B 3UDCA 4QVZA 3OBYA 1VQ8T 1KC8U 1M8VA 3EAEA 3CBMA 5CKEA 3A8LB 2A3LA 4EMKC 1VIFA 3QYGB 3A8MB 2L5QA 3FJPA 4KT0E 4XTYA 1TH7A 2VYTA 5A2QE 4DA4A 2OTLA 4OP0A 4XU2A 5GAOp 1I4K1 2FL7A 3A8OB 1NPRA 2DIQA 3FLGA 3G4ST 1VQKA 1B34A 5FRMA 1QVFA 1XTDA 2XI9A 4XTUA 5HKCA 2HBPA 2QDYB 1BIAA 1LJOA 1HXDA 4ZGEB 3HP9A 2BKDN 3TREA 3OYEA 2DTOA 4RCBA 2QQRA 5FLXE 1UGQB 2M0OA 5CCAA 4ZGJB 3J81E 3CCEA 2RI3A 5CR2A 3TEEA 1PSEA 3OS2A 4M7DF 4A53A 1RL2A 1Y07A 1BI2A 3PIOA 3FRNA 4M77G 3OY9A 4OF1A 3UT1A 3PT9A 3QJ6A 2FB7A 3ZFJA 3VV0A 3RUXA 1GXIE 1Y7XA 3FDRA 3OYHA 5GAN5 1QP3A 4BE2A 3JRZA 2XU8A 3A8GB 3GF5A 4EPCA 3OYLA 4NL3A 5DLOA 4E7LA 4HCBA 2E6NA 3FEOA 2E1HA 2JVVA 5I2MA 3OS0A 2ZPHB 3SWNA 3GOXA 4PJOA 1EIFA 1M90U 1VQ9A 3CCUA 1LOJA 3CCRA 3I56A 3BW1A 5GAMe 4IUVA 3OYAA 3E9GA 3UWNA 4IURA 2XICA 4M78B 3JCMX 2RHXA 3X26B 5GMKe 2EYQA 2RJEA 2XK0A 2MWPA 2XDDA 3GP8A 4HCCA 3QUIA 2ZPEB 4ZTFA 4ZN3A 2BIVA 4C92B 2NLUA 4M7DD 3QO3A 3OYIA 1IREB 5KCHA 3V7CA 5FROA 2JZ2A 4LD6A 3RKYA 3P8DA 1B34B 2L3RA 4C0DB 4M78E 2HD0A 2KK4A 5LJ5g 3F70A 1P92A 3JCMQ 1MHNA 1S72A 1NPPA 2Y4XA 4PJOF 1M1GA 3G6EA 5FU6B 4XQ3A 2DKGA 3LGFA 2QTXA 4M7DG 2XG8D 3M56A 2YLCA 3FB9A 2RHZA 3QDRB 3RESA 2DZ9A 4IKFA 3ZEHA 4PJOD 4KUIA 1AHJB 4J5YA 2K57A 4IUTA 3ASKA 4M78C 2CGHA 2DAQA 2QI2A 4L5GA 4TVRA 5A0DA 3I55A 3RERA 2MWOA 3VKIA 1O75A 5DLQE 1QVPA 4O5VA 4Y91A 3ZBDA 1K9MU 5CKBA 3CBPA 4HCZA 5LJ3d 3JCMe 1M1KU 4M7AG 1KQSA 4F7UA 3PMIA 4UC4A 1O9SA 1R8OB 3J80E 4LD9K 1K8AU 1G3WA 1V29B 3T9NA 3KXTA 3BY7A 2CZ6B 3CXCS 2B8AA 5DM7R 2EJGA 2EJ9A 4LDVA 3ER0A 4C5IA 5GAN8 5CKHA 2E6ZA 1Y96B 2KQWA 4BY6B 4RG8A 3LWHA 2EJFA 3WVDB 2K3YA 2RI5A 3P8HA 4N4HA 5LJ3h 3MP8A 4QVCA 3HPWA 3JCMd 4MDXA 2LQ8A 3OSVA 3VU3C 1NJIU 1QVFS 1G3SA 5D6YA 1VQ8A 4ZN1A 2RM4A 4M75A 4M7AD 2IG0A 3MEVA 4FSXA 3URGA 4BE0A 3SWNB 4PJOB 4BUGA 4F7UG 1YHQT 4C8QC 3R6OA 3JCMh 4M7AF 3OS1A 4BY6C 4OB0B 3LGLA 4JDSA 3CXCA 5LL6S 2ZPBB 3L2QA 1VQ5T 2GF7A 5LJ5h 4J6WA 2VGNA 4MZTA 4WF2A 1NJIC 4N4IA 4F7UF 1YJWT 3GNGA 4ATOA 5GAOq 1KHCA 4C92F 1KQ2A 4RCCA 2DZCA 2JTFA 3HRUA 4JS5A 4M75G 3E9FA 1OZ3A 3JCMc 2XHCA 5CIUA 3CCMA 2L89A 2CS7A 2IVWA 1VQ9T 4M77A 4BE1A 3DKMA 1YJNT 2FVUA 4MZPA 2KSSA 3CPFA 4HA8A 4JS4A 1BIBA 2RA2A 3NTHA 3OBWA 2RK1A 5CO7A 4ELYC 4M75F 4V2SA 4BDZA 3JB9D 1UB4A 1KG1A 2K4YA 2A7YA 3V8KA 3WVEB 4C92E 2PU9B 4FT2A 4XK8E 4GY5A 2XDBA 5I21A 2E64A 3OYCA 4M75D 5FU6C 3M53A 2F5TX 4IUPA 5HK0A 1KQSS 1U8RA 4MDWA 4A4KA 2FHDA 1BI1A 4M77F 3OYJA 3QBYA 4LDWA 2QQ9A 3MCAB 3PGGA 2KAFA 1QP2A 2MF2A 4E7IA 4C92C 3JAME 3GPLA 3L2VA 2HNIA 5C6SA 3QSUA 4C8QD 1VQOA 4A4EA 2EQJA 2MAMA 3LW5E 4PNOA 4F7UB 2DPPB 2GCXA 3OMGA 4PJOG 5GMKj 1BI0A 5LJ3e 1JB0E 2LX9A 2JTMA 3CCJA 4PKCC 2OTLT 1UEBA 2XDPA 3E19A 1W4SA 5GAMj 4R56A 3CC7T 1WJRA 2E5QA 2R57A 4RKUE 2QQSA 3CBOA 3S3NA 2D0QB 3OS5A 5LJ3f 5CKDA 2Y90A 4E47A 4OMFB 1SSFA 1WNLA 1OZ2A 3VYHB 1X6OA 4C8QG 5D6WA 3G71A 1U1SA 3AHUA 4C0GA 5KH6A 1K8AC 4N0AA 4JRPA 4QVDA 3H8ZA 4QW2A 2QEXT 3CC2A 3M4GA 2GFAA 3JCMJ 3CD6T 1VQPA 3JCMf 2DVEA 3L1AA 5GAN3 1G3YA 3N5BB 1Q81U 4BD3A 3M5AA 1W2BS 1JBMA 1M5Q1 2LCLA 2VGMA 5GANe 5LJ5f 3CCJT 2PUKB 2WSCE 1K73C 3CCVT 2K5IA 3EFSA 4M77B 3CMAA 3J7AF 3M54A 4YTLA 4QQGA 1N8RC 2XD0A 2LT1A 4CRIA 1IZ6A 4Y28E 5C0MA 4PJOE 1UGPB 5L8RE 4C8QF 4HT8A 5LJ5e 1OYXA 5A0LA 5LJ3g 3INZA 2RI2A 4M78F 1FWZA 4XTXA 1RI0A 1Q7YC 3FC3A 3C12A 4L6V5 2LDMA 2XIDA 3OYFA 2ZGWA 3RMSA 1S72T 1K9MC 2ZPIB 3JCMW 2DTHA 3LH0A 4DOVA 5GAOm 3DLLA 1VUBA 3V8LA 4BI8B 4IUQA 4II1A 4X34A 1JJ2A 3OYNA 2G3RA 3S3MA 2ZCFB 2P4TA 3A5ZB 3RKXA 3JB9H 1G5VA 2YHTA 3HRSA 4NS5A 3QZ5B 1Q7YU 2PVGB 1YJWA 4RG2A 1YJ9T 1I5LA 2V8JA 4M78A 3BDUA 3M55A 2RH2A 4OGCA 2EFIA 4B9WA 4MZMA 3JB9G 4BI3A 3L2UA 3L2WA 3P8BB 4NL2A 2D6FA 4EMKB 4PL6A 3L2RA 3CCRT 3QHSA 3DLMA 4MMLA 5LJ5d 4M75E 4JJNK 1WJSA 3ME9A 5IT9E 3A8HB 5M9OA 3QPHA 1VQMA 3TU4K 4KUDK 2QXFA 5KE2A 4FL6A 2LCCA 3CPWA 2VV5A 3C95A 1Y96A 3LYIA 4GLKA 5EG2A 1VIEA 2QEXA 3X24B 5GAMf 5GANd 3S3OA 1YI2T 3HKSA 5HK3A 5GANg 2KY9A 3SD4A 4F7UE 2EAYA 3OW2A 2RJCA 2EWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 C;  4A53 A;  4V2S A;  4M75 F;  3JB9 D;  4M77 G;  3V8K A;  2YLB A;  4C92 E;  5I21 A;  2E64 A;  2FB7 A;  4M75 D;  4J6Y A;  3RUX A;  3JCM P;  5GAN 4;  5GAN 5;  5GAO l;  4M7D C;  4J6X A;  2JN0 A;  3HFO A;  4M77 F;  4NL3 A;  2DXT A;  4C8Q B;  2E1H A;  3JB9 F;  3SWN A;  4XTW A;  5GMK h;  4PJO A;  3HSB A;  3PGG A;  5GAM h;  1LOJ A;  4M77 C;  4C92 C;  3BW1 A;  1X01 A;  5GAM e;  2HNI A;  3QSU A;  3JCM g;  4C8Q D;  4M7A B;  4M78 B;  4PNO A;  4F7U B;  5GMK e;  1WQW A;  4PJO G;  5GMK j;  5GMK m;  3JCM X;  3RER A;  5LJ3 e;  3QUI A;  1N9R A;  1I81 A;  2DXU A;  1MGQ A;  2E41 A;  4M77 D;  5GAM j;  4DQ2 A;  4XU0 A;  4C92 B;  5GAM d;  5GAN f;  5DY9 A;  4M7D D;  3BFM A;  3QO3 A;  3V8J A;  5GAM g;  5LJ3 f;  3V7C A;  2VC8 A;  4XTV A;  3RKY A;  2Y90 A;  1B34 B;  4M77 E;  4M78 E;  5LJ5 g;  1WNL A;  3JB9 I;  1I8F A;  1D3B A;  4C8Q G;  4M7D A;  4M7D B;  3JCM Q;  1U1S A;  3AHU A;  4N0A A;  4EMH A;  4QVD A;  2FYK A;  5LJ3 j;  2I2L A;  4C8Q E;  3M4G A;  4JUV A;  3JCM J;  4PJO F;  3JCM f;  1YCY A;  4M7A C;  2DVE A;  3L1A A;  4XQ3 A;  2DKG A;  3SB2 A;  5GAN 3;  2QTX A;  4M7D G;  4M78 D;  4C92 A;  1JBM A;  1M5Q 1;  2YLC A;  3FB9 A;  5GAN e;  3RES A;  5LJ5 f;  2DZ9 A;  3HFN A;  1KQ1 A;  4X9D A;  4PJO D;  4M77 B;  3EFS A;  5CAI A;  3JB9 J;  4J5Y A;  2K57 A;  4M7D E;  4M78 C;  2CGH A;  4PJO E;  2DTI A;  4XTZ A;  1LNX A;  3JCM V;  2VXE A;  1D3B B;  4C92 G;  4C8Q A;  4C8Q F;  1N9S A;  5LJ5 e;  2E10 A;  4MMK A;  4Y91 A;  4HT8 A;  5LJ3 g;  1WQ7 A;  3INZ A;  3FIF A;  4M78 F;  4XTX A;  1H64 1;  5LJ3 d;  4M75 B;  4EMK A;  4M78 G;  3JCM e;  4M7A E;  3RIR A;  4M7A G;  4F7U A;  5GAO n;  3V7R A;  2VXF A;  2ZGW A;  5GMK i;  4NOY A;  5GAN j;  4N0A C;  3BY7 A;  2RD1 A;  3JCM W;  2DTH A;  2EJG A;  2EJ9 A;  5GAO m;  3JCM b;  5GAN 8;  3V8L A;  1Y96 B;  4JRI A;  4M7A A;  5GAN 6;  2EJF A;  4QVC A;  5LJ5 j;  5LJ3 h;  3JCM d;  4EMG A;  4XU1 A;  3RKX A;  1HK9 A;  3VU3 C;  1U1T A;  3JB9 H;  2YHT A;  2RM4 A;  4M75 A;  4XU3 A;  4M7A D;  3L2Z A;  4A54 A;  1I5L A;  4M78 A;  4C92 D;  3BDU A;  2E65 A;  3SWN B;  5GMK l;  3V7S A;  4F7U G;  4X9C A;  5GAN 7;  4C8Q C;  3JB9 G;  3RKW A;  4PJO B;  4JRK A;  4NL2 A;  3JCM h;  4M7A F;  4HT9 A;  4EMK B;  3QHS A;  1M8V A;  4MML A;  5LJ5 d;  4M75 E;  3GIB A;  4EMK C;  5LJ5 h;  4J6W A;  3FJP A;  4XTY A;  1JRI A;  1TH7 A;  4WF2 A;  4JLI A;  4OP0 A;  4XU2 A;  1I4K 1;  4F7U F;  5GAO p;  5GAO q;  1B34 A;  4C92 F;  4XTU A;  1WPY A;  4RCC A;  2DZC A;  1Y96 A;  3SWN C;  5GAN 2;  1KQ2 A;  2RB6 A;  4M75 G;  4PJO C;  3JCM c;  5GAN h;  1BIA A;  2DEQ A;  1LJO A;  3EFR A;  5GAM f;  5GAN d;  1HXD A;  4M77 A;  2DTO A;  4RCB A;  5GAN g;  2DJZ A;  5GAO r;  4F7U E;  2EAY A;  4HA8 A;  4M7D F;  1BIB A;  2RA2 A;  2EWN A; 
#chains in the Genus database with same CATH topology
 1VQ4 A;  1C0M A;  2D9T A;  2KVQ G;  2CZ0 B;  2QTV A;  1T0H A;  2A37 A;  4FYX B;  1RAD B;  1MMA A;  4C8Q B;  3EG9 A;  4XTW A;  5GMK h;  3TSZ A;  1WA7 A;  1UGV A;  1VQ7 T;  4M77 C;  5IXB A;  1YIT T;  3JCM g;  3OYG A;  2JNG A;  1Q86 U;  2GFU A;  1Q82 C;  1KHI A;  1MGQ A;  2AZS A;  4XU0 A;  1WYX A;  1YIJ T;  1A0N B;  2AHJ B;  1IHV A;  2CP6 A;  3JB9 I;  1SSH A;  3FJ5 A;  3CCM T;  1KD1 R;  5IN1 A;  2EIF A;  4KGZ B;  3I56 T;  4M7A C;  2DXB A;  3CCU T;  2MCN A;  4OB2 B;  3SEM A;  1MNE A;  2WSF E;  3HFN A;  2R5A A;  1YHQ A;  1QCN A;  3CC4 T;  1D1B A;  4M7A E;  4FU6 A;  2ZPF B;  3X28 B;  5GMK i;  3NFC A;  5HCK A;  1PCX A;  4DBF A;  1MMD A;  1TTH B;  2DBK A;  2CSQ A;  2DBM A;  3C94 A;  4LNP A;  3CME A;  1XOV A;  3QKJ A;  4AFS C;  1RLQ C;  3GNF B;  3OYM A;  3V7S A;  2JXB A;  3E1S A;  4JRK A;  3CCQ A;  1YBY A;  1UDL A;  1OQK A;  2GQI A;  3OYB A;  2CDT A;  2PTK A;  4JLI A;  2K5L A;  3VS1 A;  1WPY A;  1VQ7 Q;  2RB6 A;  2MMP A;  1M9S A;  1WHK A;  3I55 Q;  3EFR A;  2GBQ A;  4CI0 C;  2GTO A;  1FMK A;  2PVO B;  1VQO Q;  1VQ6 T;  4C0Z A;  1AZE A;  2K79 A;  2DIG A;  2OTJ T;  2V26 A;  3KBG A;  5KE3 A;  1IRX A;  2HKN A;  4FSS A;  5A0G A;  3KUF A;  2DYB A;  5CK9 A;  3VYG A;  1AZG B;  2KNB B;  4L59 A;  3QZ9 B;  1GCQ A;  2MI6 A;  3M58 A;  4XAX B;  4M7A B;  6AT1 B;  3M0S A;  1AWO A;  1WHG A;  1WQW A;  1FXX A;  1BI3 A;  4WTO B;  4FW2 A;  3CME T;  1WHJ A;  1F1B B;  4FM4 B;  1AVZ C;  3CCV A;  4KUL A;  2O01 E;  1I8F A;  4OML A;  3OYY A;  4M7D B;  2FYK A;  1PG5 B;  4C8Q E;  2GTJ A;  1M1F A;  1I07 A;  1PSF A;  3LWI A;  2QA4 T;  3G1J A;  3NTI A;  3JB9 J;  4ME7 A;  4CC3 A;  4E7J A;  5FRN A;  4C92 G;  3JCM V;  4WCI A;  4E2F B;  4PJL A;  2PVD B;  4ELZ C;  1VQO T;  2PZ1 A;  3RIR A;  1VQ6 Q;  4BDY A;  3O8V A;  3X25 B;  2LTO A;  4NOY A;  1VQN T;  4A4F A;  2RD1 A;  3OW2 S;  3I55 T;  1X69 A;  4M7A A;  2K3X A;  2WSE E;  4EMG A;  2ZPG B;  4JLG A;  3CD6 A;  1C6V X;  4QKU A;  3D7S B;  3OYD A;  1K9A A;  2DER A;  2YUN A;  2O4X B;  2KRO A;  1Y57 A;  2ED0 A;  2A3L A;  4ORZ A;  3VS4 A;  3FJP A;  4KT0 E;  5A2Q E;  1RAG B;  1SKU B;  1JQQ A;  4XU2 A;  5GAO p;  2FL7 A;  1VQK A;  5HKC A;  2HBP A;  2HBW A;  1K76 A;  2KE9 A;  1LJO A;  4ZGE B;  3HP9 A;  2DTO A;  1UGQ B;  4M7D F;  5CR2 A;  2P84 A;  1VQP Q;  1BI2 A;  2K7A A;  1K1Z A;  3OY9 A;  1QCF A;  2FB7 A;  3ZFJ A;  1E6H A;  1BCO A;  1YWO A;  1PKS A;  5GAN 5;  1QP3 A;  4BE2 A;  1M2V A;  5DLO A;  5I2M A;  3OS0 A;  2PNI A;  3GOX A;  2DL7 A;  1AD5 A;  3CCR A;  1WDX A;  3OYA A;  3ZL7 C;  2XIC A;  3JCM X;  1NEB A;  1MV3 A;  2QDL A;  3UA6 A;  2RQW A;  1H8K A;  2EGA A;  1E6G A;  2NLU A;  3V7C A;  3VS0 A;  4C0D B;  2FZK B;  1ABQ A;  1MHN A;  2GNC A;  2A08 A;  1S72 A;  5ECA A;  3EG3 A;  4XQ3 A;  2QTX A;  4M7D G;  2XG8 D;  3QWY A;  3RES A;  2NYS A;  4IKF A;  1X6B A;  3ULR B;  2LJ1 A;  1OU8 A;  1GL5 A;  3M0R A;  1K9M U;  5CKB A;  3CBP A;  1M1K U;  4M7A G;  4UC4 A;  1K8A U;  1G3W A;  1V29 B;  3KXT A;  2EJG A;  3ER0 A;  3EH1 A;  4RG8 A;  2EJF A;  2J6K A;  5KYW B;  3P8H A;  2KXD A;  3MP8 A;  3HPW A;  2LQ8 A;  2ZAE A;  2CP3 A;  4ZN1 A;  1RAB B;  2IG0 A;  3URG A;  3SWN B;  4BUG A;  1YHQ T;  1RLP C;  4E6R A;  3JCM h;  2ED1 A;  3OS1 A;  1N5Z A;  1VQ5 T;  5AT1 B;  4J6W A;  1NJI C;  3PE0 A;  4F7U F;  5GAO q;  1KQ2 A;  2DZC A;  4ANJ A;  3CCM A;  2L89 A;  5EC7 A;  3PVQ A;  4Z8A A;  1SPK A;  1G83 A;  2RA2 A;  1WHM A;  2RK1 A;  4V2S A;  4BDZ A;  3JB9 D;  1UB4 A;  3V8K A;  1FMV A;  2XDB A;  4M75 D;  4RTV A;  3M53 A;  3VS3 A;  2JTE A;  1TS9 A;  2EVR A;  5HK0 A;  4PJM A;  2AKL A;  3H41 A;  4A4K A;  1BI1 A;  3OYJ A;  4LDW A;  3MCA B;  2KAF A;  2FG0 A;  3L2V A;  1VQO A;  2EQJ A;  3CCL T;  4PNO A;  2DPP B;  2GCX A;  4PJO G;  4OMM A;  1JB0 E;  2OTL T;  3EG1 A;  2CUB A;  2E5Q A;  3S3N A;  2OI3 A;  4E47 A;  1SSF A;  2AZV A;  5D6W A;  2EYW A;  5KH6 A;  4QVD A;  2CSI A;  4QW2 A;  3CD6 T;  1VQP A;  1G3Y A;  4BD3 A;  2VGM A;  5GAN e;  4QT7 A;  2PUK B;  2WSC E;  1WXT A;  3J7A F;  3EFO A;  1X6G A;  2XD0 A;  4CRI A;  5L8R E;  2FO0 A;  4CC4 B;  2FRW A;  3INZ A;  1QKW A;  1FWZ A;  4RTT A;  4RTX A;  1B7T A;  1Q7Y C;  2LDM A;  2XID A;  3LH0 A;  1YWP A;  3V8L A;  1E7O A;  2P4T A;  2QEX Q;  2JMA A;  4RTU A;  1YJW Q;  4NS5 A;  4RG2 A;  1R77 A;  3CCE Q;  1JXM A;  2EFI A;  1WHH A;  4MZM A;  4BI3 A;  1VQ9 Q;  1QQJ A;  4PFO A;  4NL2 A;  3L2W A;  2DET A;  3O5Z A;  1VQ4 Q;  3EGD B;  3QHS A;  5LJ5 d;  1WJS A;  1BCM A;  4LUE A;  2JJ9 A;  1QWF A;  3C95 A;  3OW2 P;  4GLK A;  1ZUU A;  2EGC A;  5GAM f;  1D1C A;  1YI2 T;  1WHL A;  2KY9 A;  2NWM A;  3SD4 A;  2EAY A;  3VUZ A;  2K5F A;  5IAY A;  1JEG A;  3EH2 A;  5CQX A;  4RTZ A;  4F04 B;  1ZA1 B;  4J6Y A;  1G8X A;  2GQV A;  1NEG A;  2JN0 A;  3TSW A;  5KYU A;  2YRV A;  3OSS C;  3CC4 Q;  3GLX A;  1X01 A;  3JSC A;  2COW A;  3MEW A;  2FZG B;  1I81 A;  2LNV A;  1M1K C;  3NGP A;  2QGF B;  3M9Q A;  2OX7 A;  5GAM d;  4IUU A;  1YHQ Q;  2A36 A;  2YXY A;  4KH1 B;  4R0K A;  4JJD A;  1YCS B;  2BZ8 A;  2CKK A;  1IXD A;  2Y4Y A;  2PQW A;  2DD4 A;  1KJW A;  4LDY A;  3CCR Q;  1UJY A;  3H9N A;  1YCY A;  2D8J A;  5IXF A;  1YJ9 A;  4LN2 A;  2MYS A;  4X9D A;  1YIJ A;  4HCK A;  4AMC A;  1HSQ A;  2LJ0 A;  2RHY A;  4BAC A;  3A98 A;  1RAI B;  1LNX A;  2SRC A;  2IPO B;  2RJF A;  3EGU A;  1XQH A;  4N4G A;  3CCQ Q;  4FYY B;  1QWE A;  2M16 A;  4BB7 A;  4N0A C;  3VS6 A;  4AFU C;  4E7H A;  1TG0 A;  3OQ5 A;  2MOX A;  3JCM b;  1NE8 A;  2X3X D;  1JU5 C;  3PIP A;  5I11 A;  1OI1 A;  4XU3 A;  1VQK T;  4C92 D;  2HEQ A;  2XMF A;  2HMA A;  1VQ4 T;  1KD1 C;  2DO3 A;  1JXO A;  3GIB A;  2V1R A;  2VUB A;  5D6X A;  5KYX A;  3G6E T;  4LDX A;  3MO8 A;  5GAN 2;  1MMN A;  2DEQ A;  2RK2 A;  3PFS A;  1VQM T;  2RJD A;  4OMO A;  2JM8 A;  2DX1 A;  3CCS Q;  1IGQ A;  1KK7 A;  2DMO A;  2LZ6 B;  2GGR A;  2QQA A;  1SRM A;  1UGS B;  1DJ7 B;  5CVI A;  1WI7 A;  5J26 A;  4J83 A;  3MP1 A;  3QYH B;  4EDU A;  3PMT A;  3CCV Q;  1BK2 A;  3JB9 F;  1ARK A;  2RF0 A;  2KRN A;  3UF4 A;  2QA4 A;  3QII A;  3M59 A;  2JOY A;  2JW4 A;  4DQ2 A;  1VQL Q;  1SRL A;  2G6F X;  3CCE T;  4Q5W A;  1M4Z A;  2DXC A;  3M57 A;  1D3B A;  4QQ6 A;  3CCL Q;  2X9H A;  2EPD A;  2FPF A;  2LX7 A;  2C0O A;  4LDU A;  1GRI A;  3PTA A;  3TCJ A;  4IIO A;  2JUF A;  4C0D C;  1W2B A;  2KXC A;  3CC7 A;  4XTZ A;  1D3B B;  3C0C A;  1VYT A;  1N9S A;  4MMK A;  1WQ7 A;  4Z02 A;  4M78 G;  4D8K A;  4B6M A;  3S6W A;  3V7R A;  2OTJ A;  3QDF A;  1JJ2 S;  1OX9 A;  5HY6 A;  3VUB A;  3CD6 Q;  4XU1 A;  4FT4 A;  1FYN A;  4J7F A;  2W0Z A;  1ZHI A;  1OPK A;  1VQ8 T;  3OBY A;  5L23 A;  1KC8 U;  5CKE A;  3EAE A;  1M1K R;  1VIF A;  1VYU A;  2E3H A;  2L5Q A;  4XTY A;  1TH7 A;  2VYT A;  4AT1 B;  1I1J A;  3G4S T;  3FLG A;  4XTU A;  2C0I A;  1YN8 A;  1HXD A;  1AWW A;  2QYZ A;  2BKD N;  2QK0 A;  2RNA A;  3J81 E;  3EHQ A;  3CCE A;  3TEE A;  1RL2 A;  3CXC P;  2NUP A;  4M77 G;  2JS0 A;  3QJ6 A;  4AFQ C;  1WZO A;  1ZUY A;  3FDR A;  3OYH A;  2RMO A;  2XU8 A;  3A8G B;  3GF5 A;  4HCB A;  4E7L A;  2FZC B;  1RUW A;  3A1P A;  2ZPH B;  3NMZ C;  1HD3 A;  4F16 A;  1M90 U;  1VQ9 A;  4F14 A;  1LOJ A;  3I56 A;  3BW1 A;  4IUV A;  2CT3 A;  2RHX A;  5GMK e;  2RJE A;  3GP8 A;  1OUL A;  4KGX B;  1IO6 A;  1VQ5 Q;  2BIV A;  1EFN A;  2LP5 A;  1W2B P;  1IRE B;  1ZBJ A;  5FRO A;  3P8D A;  2CT4 A;  2KK4 A;  3F70 A;  3JCM Q;  2Y4X A;  3G6E A;  5FU6 B;  2HL3 A;  3LGF A;  2YSQ A;  3FB9 A;  4PJO D;  2F2V A;  1K0S A;  1NYF A;  4KUI A;  4J5Y A;  3KFV A;  4M78 C;  2DAQ A;  5A0D A;  1O75 A;  4J9H A;  3GBQ A;  4HCZ A;  3JCM e;  4F7U A;  1O9S A;  1R8O B;  2B8A A;  1IHW A;  4C5I A;  3H0I A;  2KQW A;  2LNH B;  2RI5 A;  3JCM d;  1B07 A;  2AKK A;  3VU3 C;  3CCM Q;  4FSX A;  3THK A;  4BE0 A;  4PJO B;  2BTT A;  4F7U G;  1S1N A;  4M7A F;  2COZ A;  1UFF A;  3LGL A;  5LL6 S;  3L2Q A;  2VGN A;  1H92 A;  1YJW T;  4ATO A;  2VAS A;  1KHC A;  4RCC A;  3HRU A;  4JS5 A;  1OZ3 A;  2XHC A;  1VQ8 Q;  3UAT A;  1VQ9 T;  4BE1 A;  1TUG B;  1VQN Q;  4RTW A;  4JS4 A;  2HSE B;  1BIB A;  1UG1 A;  1Q86 R;  4ELY C;  4M75 F;  2K4Y A;  2FRY A;  2A7Y A;  2PU9 B;  4XK8 E;  2F2W A;  2E64 A;  5FU6 C;  2YDL A;  4IUP A;  1M2O A;  3M0U A;  2DA9 A;  1KQS S;  2W10 A;  4MDW A;  5I22 A;  2HNI A;  2NUT B;  4DBQ A;  5C6S A;  2MAM A;  5GMK j;  5LJ3 e;  2LX9 A;  1RI9 A;  2XDP A;  4R56 A;  1VQM Q;  3CC7 T;  1WJR A;  1YNZ A;  1UUE A;  9ATC B;  5CKD A;  1ZSG A;  4OMF B;  1OZ2 A;  3VYH B;  4C8Q G;  2NUT A;  3AHU A;  1U3O A;  4N0A A;  3H8Z A;  3R6N A;  4RTY A;  3CC2 A;  1AWJ A;  1AOJ A;  2DVE A;  2ECZ A;  3L1A A;  2EYX A;  3N5B B;  2KT8 A;  1M5Q 1;  2OTL Q;  5LJ5 f;  1WXU A;  3EFS A;  3M54 A;  2O88 A;  2M51 A;  3PVL A;  2LT1 A;  4PJO E;  5C0M A;  2EW3 A;  5LJ5 e;  5A0L A;  5LJ3 g;  2CRE A;  2JT4 A;  4M78 F;  1T3S A;  2K2M A;  3FC3 A;  2L2P A;  3C12 A;  4L6V 5;  1S72 T;  3OYF A;  2DEU A;  2QA4 Q;  2M02 A;  3EHR A;  4DOV A;  1VUB A;  4BI8 B;  4II1 A;  2MPX C;  1PC0 A;  3JB9 H;  1G5V A;  4X1V A;  2NUZ A;  2RQR A;  2V8J A;  4M78 A;  4OGC A;  4B9W A;  1W1F A;  4EMK B;  4PL6 A;  3CCR T;  2F2X A;  5IT9 E;  1U5S A;  2IIM A;  1TOV A;  5M9O A;  3QPH A;  1J3T A;  5KE2 A;  4FL6 A;  2LCC A;  3CPW A;  2VV5 A;  1Y96 A;  4JJC A;  5EG2 A;  2KYM A;  4F17 A;  3HKS A;  5GAN g;  1AEY A;  2G3R A;  4J8O A;  2K2V A;  4ZGD B;  4C5G A;  2OTJ Q;  1OX8 A;  2DRK A;  1UHC A;  2LJ3 A;  3DB4 A;  1VA7 A;  4DBH A;  1KD1 U;  2EQK A;  4Z88 A;  1BBZ A;  3DB3 A;  3JCM P;  5GAO l;  2QQB A;  2EQU A;  3CCU Q;  2X4J A;  2OJ2 A;  5GAM h;  1M3C A;  4A4G A;  4O6J A;  3PNW C;  1N9R A;  5GAN f;  4J9G A;  3V8J A;  5GAM g;  1ABO A;  4XTV A;  1KFZ A;  1PD1 A;  3SDZ A;  2X51 A;  3G4S Q;  2ROT A;  3QG1 A;  4J9F A;  2EQM A;  1PKT A;  5J3B A;  1WLP B;  1VQN A;  5FU7 B;  1Q82 U;  1NG2 A;  2I2L A;  4HKE A;  4JUV A;  4PLI A;  2K3B A;  4R55 A;  2D8H A;  2LT4 A;  1R0C B;  2EKH A;  4RMO A;  1QVF P;  2CUD A;  2VWF A;  1KQ1 A;  5CAI A;  2M9U A;  4ZNX A;  2DTI A;  2XKO C;  4LUD A;  2ROL A;  2E10 A;  3FIF A;  3QJY A;  3WXM B;  2BZX A;  4DOW A;  2VXF A;  1Q82 R;  1X75 C;  3M4Y A;  2RQV A;  3OMC A;  1MND A;  3SFM A;  1U1T A;  1X43 A;  1YFN A;  5IH2 A;  3VJP A;  3L2Z A;  1KC8 C;  3MEU A;  4HT9 A;  2C06 A;  1GBQ A;  2QG9 B;  1H3Z A;  2BUD A;  2DJQ A;  4QQD A;  1IB8 A;  1JRI A;  2ZZD A;  4J7I A;  1C1A A;  2KBT A;  5FWB A;  3SWN C;  1I5O B;  1M8M A;  2EKO A;  2EYZ A;  5GAN h;  2KRS A;  1VQL T;  2CP5 A;  3QXE B;  5IHI A;  1Y71 A;  2D1X A;  5GAO r;  3H0H A;  3RR6 A;  1X27 A;  1VQ6 A;  3H6Z A;  1QVG A;  1D0X A;  2PUO B;  2X35 A;  3RMQ A;  3OA6 A;  2LRQ A;  4J6X A;  3HFO A;  1M90 C;  2LVM A;  2DXT A;  1ZBX A;  4A4H A;  3HSB A;  3CPW S;  2V1Q A;  1QVG S;  2HZY A;  3HHT B;  2WAC A;  5GMK m;  2H3J A;  3UPU A;  4M77 D;  2E41 A;  1NZ9 A;  3CEY A;  2P4R A;  4BI4 A;  5DY9 A;  3BFM A;  2VC8 A;  2RHU A;  3HRT A;  3X20 B;  2F1L A;  1K73 R;  1BYM A;  2EQI A;  1JO8 A;  3SHW A;  3CMA Q;  1VQK Q;  1Y0M A;  2BE9 B;  4ESR A;  2HQX A;  2VXE A;  4C8Q A;  4OMN A;  3MKD A;  3Q1J A;  2O4X A;  1YJN A;  5J39 A;  1NJI R;  4KBM B;  2AT1 B;  3M0T A;  2CP7 A;  4KGV B;  4A63 B;  2HCK A;  1X2Q A;  1BU1 A;  5GAN 6;  3HL8 A;  1LPL A;  2VKN A;  1G2B A;  3MP6 A;  4C5H A;  3NHN A;  1K9M R;  4E7K A;  2X4W A;  3G71 T;  3VS2 A;  5GAN 7;  2LQK A;  3MHX A;  1Q81 C;  3RKW A;  7AT1 B;  1K4U S;  3CBM A;  4JZ4 A;  3A8L B;  4EMK C;  3QYG B;  1TWB A;  2OTL A;  2E4H A;  4HXJ A;  3A8O B;  5FRM A;  1MV0 B;  2DVJ A;  1XTD A;  1BIA A;  3OYE A;  3TRE A;  4RCB A;  2QQR A;  3IQL A;  5CCA A;  4ZGJ B;  1PD0 A;  3OS2 A;  1TSF A;  4A53 A;  1Y07 A;  1ZSZ B;  3CQT A;  2ENM A;  1TU0 B;  3VV0 A;  1GXI E;  3JRZ A;  3OYL A;  4NL3 A;  2CP2 A;  2E1H A;  3SWN A;  1EIF A;  3G6E Q;  4IUR A;  3X26 B;  2EYQ A;  2XK0 A;  2XDD A;  3QUI A;  4ZTF A;  4KH0 B;  2J6F A;  4M7D D;  1UEC A;  3QO3 A;  3OYI A;  2JZ2 A;  4DEY A;  1VOM A;  2HQH A;  5LJ5 g;  4M78 E;  1P92 A;  1YIT Q;  2YWW A;  4PJO F;  4AG1 C;  1WXB A;  2DYI A;  3M56 A;  2YLC A;  5KYW A;  2RHZ A;  3QDR B;  1YJ9 Q;  1AHJ B;  4IUT A;  2Z0W A;  1R0B G;  1OV3 A;  2CGH A;  4L5G A;  3VKI A;  5DLQ E;  1QVP A;  4Y91 A;  3ZBD A;  2C0T A;  4LD9 K;  2RN8 A;  1HJD A;  3UA7 A;  3T9N A;  3CXC S;  2CZ6 B;  1WFW A;  1VYV A;  1Q81 R;  5GAN 8;  5CKH A;  1Y96 B;  4BY6 B;  3WVD B;  5LJ3 h;  4N4H A;  2JMC A;  2AIR B;  2RQU A;  1NJI U;  1D0Z A;  2X3W D;  1G3S A;  1VQ8 A;  1QVF S;  1ZSZ C;  1OPL A;  3MJX A;  2A28 A;  2RM4 A;  1SHG A;  4M75 A;  4M7A D;  1PWT A;  4HVV A;  1QMC A;  2DFU A;  1UHF A;  4C8Q C;  2COY A;  4BY6 C;  4OB0 B;  2K9G A;  5KYY A;  3CXC A;  2ZPB B;  1TUC A;  3H0F A;  1ZX6 A;  4WF2 A;  4N4I A;  2KRM A;  1M30 A;  2YRD A;  2ESW A;  2JTF A;  1FMW A;  1W70 A;  4M75 G;  1GFC A;  1PRM C;  3DKM A;  4PJJ A;  2FVU A;  4MZP A;  2KSS A;  1S72 Q;  1Q95 G;  3OBW A;  5CO7 A;  1KG1 A;  1ZA2 B;  4FT2 A;  2F5T X;  2CH4 W;  4Z89 A;  2EBP A;  4PFP A;  1Z9Q A;  3QBY A;  2BZY A;  2QQ9 A;  2FEI A;  1YI2 Q;  3GPL A;  3QSU A;  4A4E A;  3LW5 E;  2DM1 A;  3RER A;  2JTM A;  3CCJ Q;  1UEB A;  3E19 A;  4DEX A;  2EYY A;  4J9C A;  2D0N A;  2R57 A;  2D0Q B;  3OS5 A;  5LJ3 f;  2Y90 A;  4PFZ A;  4J9D A;  2KYB A;  3G71 A;  2QEX T;  3I35 A;  3M4G A;  2GFA A;  3JCM J;  3JCM f;  4M4Z A;  4FYW B;  2KEA A;  1Q81 U;  3M5A A;  3CCV T;  2K5I A;  4M77 B;  1X2K A;  4YTL A;  2MK5 A;  1U06 A;  1YP5 A;  4Y28 E;  1UGP B;  1M27 C;  4GBQ A;  3TVT A;  2RI2 A;  4XTX A;  1RI0 A;  1AWX A;  2ZGW A;  2ZPI B;  3JCM W;  2DTH A;  5GAO m;  3QWX X;  4IUQ A;  1JJ2 A;  1KC8 R;  2ZCF B;  1M3B A;  3QZ5 B;  1Q7Y U;  1YJ9 T;  1I5L A;  2DL8 A;  3BDU A;  3M55 A;  2RH2 A;  1YJN Q;  1MMG A;  3L2U A;  4FCY A;  3L2R A;  1GCP A;  1OEB A;  3DLM A;  4JJN K;  4M75 E;  1K8A R;  3ME9 A;  2ABL A;  1MUZ A;  3TU4 K;  4KUD K;  2QXF A;  3MPU B;  1YIJ Q;  2LCS A;  2DL3 A;  3X24 B;  4D6W A;  2EWN A;  4M75 C;  4OVA A;  3CCQ T;  4JZ3 A;  2P0K A;  1NLP C;  1RAC B;  1M90 R;  1WGS A;  5KYN A;  3EG0 A;  4M7D C;  3G4S A;  5CKF A;  3L42 A;  1LCK A;  2HKQ B;  1AT1 B;  1ZQ1 A;  2E5K A;  1XJW B;  1N27 A;  1K73 U;  2CYZ B;  5GJV B;  4OGE A;  2DXU A;  2VB6 A;  2KDS A;  1W6X A;  4AG2 C;  1FX7 A;  1G3T A;  4M77 E;  1UGR B;  2CZ1 B;  3CCS A;  1SEM A;  3LLR A;  4AFZ C;  3REA B;  1UTI A;  2DK3 A;  3EGD A;  5IHN A;  2R5M A;  4C92 A;  2LMJ A;  2X4Y A;  3OYK A;  2R58 A;  2L8D A;  1D0Y A;  4OB1 B;  1JJ2 P;  1UJ0 A;  1Q7Y R;  2OAU A;  4PLL A;  3I5S A;  1N8R U;  1YI2 A;  3CPW P;  3CC4 A;  2DL4 A;  4EMK A;  4M75 B;  1YIT A;  4HVW A;  4OMP A;  1RAA B;  3M0Q A;  1SG5 A;  4E7S A;  5GAO n;  4FIB A;  2DD5 A;  2F5K A;  5KYY B;  1CKA A;  4JRI A;  5LJ5 j;  8AT1 B;  5I2S A;  2JS2 A;  2HAX A;  1NLO C;  1NBE B;  4A54 A;  2E65 A;  3NTK A;  2V8K A;  4CC7 A;  2BE7 D;  1NYG A;  3MEA A;  4PJO C;  2RO0 A;  3G7Z A;  3CC7 Q;  5AYF A;  1N8R R;  1VQ7 A;  3CME Q;  2DJZ A;  3CCL A;  1Q86 C;  3EG9 B;  4EMH A;  5LJ3 j;  5KYU B;  2AK5 A;  1EZZ B;  2O9S A;  2P0Q A;  2YLB A;  4DBR A;  1WJQ A;  3MET A;  1VQP T;  5FU7 C;  5GAN 4;  5KYX B;  4ZTJ A;  3C4S A;  2LC4 A;  4C0F A;  1ZUK A;  3BDL A;  2E3I A;  1EX4 A;  1QW1 A;  1KQS P;  3RDV A;  3OB9 A;  1QKX A;  1RAH B;  5KCO A;  1V76 A;  5CQY A;  3LX7 A;  1OOT A;  4OB3 B;  2KR3 A;  3U23 A;  1BKB A;  2DF6 A;  1N6A A;  2E12 A;  2JM9 A;  2J06 A;  2KGT A;  1B3Q A;  4P5N A;  1PNJ A;  1PRL C;  1M2V B;  4M7D A;  3RNJ A;  3AT1 B;  2RHI A;  2P0P A;  4JRQ A;  2F69 A;  3SB2 A;  2M1H A;  4VUB A;  4B9X A;  4M78 D;  2KMT A;  2OAW A;  2V8I A;  1ZSZ A;  4M7D E;  2QAS A;  2DLP A;  4C5E A;  1XNI A;  1H64 1;  1HYO A;  2HQE A;  3CCS T;  5GAN j;  2K6D A;  3CMA T;  4PJN A;  2E70 A;  1QCO A;  1VQ5 A;  2RQT A;  1VQL A;  4GLM A;  1HK9 A;  3CC2 T;  1M3A A;  1BB9 A;  2L3S A;  2X4X A;  5GMK l;  2A0F B;  4X9C A;  3UDC A;  2CZ7 B;  4QVZ A;  3I56 Q;  1M8V A;  2FPE A;  1QVG P;  3A8M B;  3M0P A;  2SEM A;  4DA4 A;  4OP0 A;  1I4K 1;  4FYV B;  1NPR A;  2DIQ A;  1B34 A;  2VVK A;  1QVF A;  2XI9 A;  2J05 A;  2QDY B;  1CSK A;  2L0A A;  1GFD A;  5FLX E;  2M0O A;  2RI3 A;  1PSE A;  2RPN A;  3PIO A;  3FRN A;  4OF1 A;  3UT1 A;  3PT9 A;  3RUX A;  1RAF B;  3VRY A;  1Y7X A;  2KT1 A;  4EPC A;  2E6N A;  3FEO A;  2JVV A;  4PJO A;  4CC2 A;  3CCU A;  2L3P A;  5GAM e;  4J9E A;  3E9G A;  1LVK A;  3UWN A;  2J7I A;  4M78 B;  3REB B;  2NUP B;  2MWP A;  4HCC A;  2ZPE B;  3NPF A;  4ZN3 A;  4C92 B;  5KCH A;  1Z9Z A;  4K11 A;  3RKY A;  4LD6 A;  1B34 B;  2L3R A;  3RBB B;  2HD0 A;  2H8H A;  1NPP A;  1M1G A;  2DKG A;  2HSP A;  1GCQ C;  3E2U A;  2DZ9 A;  3ZEH A;  3EFO B;  2K57 A;  2O31 A;  3ASK A;  2QI2 A;  4TVR A;  3I55 A;  2MWO A;  2DE0 X;  4O5V A;  4D8D A;  5LJ3 d;  1NM7 A;  2MIO A;  1KQS A;  3PMI A;  3J80 E;  5IHK A;  1QLY A;  1WX6 A;  3BY7 A;  5DM7 R;  4LXC A;  2KI7 A;  2EJ9 A;  4LDV A;  4OMQ A;  2B86 A;  5FWC A;  2E6Z A;  3LWH A;  4JJB A;  4QVC A;  2K3Y A;  3HTR A;  4MDX A;  1ZLM A;  3OSV A;  1I0C A;  5D6Y A;  2DRM A;  4HVU A;  5GJW B;  3VS7 A;  8ATC B;  3MEV A;  2M0Y A;  3R6O A;  4JDS A;  5FW9 A;  2L3Q A;  1WIE A;  1PHT A;  2GF7 A;  5LJ5 h;  4MZT A;  3GNG A;  1OU9 A;  4C92 F;  2LQW A;  1V1C A;  3E9F A;  3JCM c;  5CIU A;  3BE3 A;  2CS7 A;  2IVW A;  4M77 A;  1YJN T;  5D7U A;  4KRT A;  3CPF A;  4HA8 A;  2DIL A;  1H3H A;  1D09 B;  3LH5 A;  3NTH A;  3CC2 Q;  2J6O A;  2H3E B;  2EGE A;  1UE9 A;  2YT6 A;  2I0N A;  3WVE B;  4C92 E;  2YUP A;  4GY5 A;  1SHF A;  5I21 A;  3OYC A;  3VRZ A;  2O9V A;  4Y92 A;  1T0J A;  1U8R A;  2FHD A;  4M77 F;  1K0X A;  2HL5 C;  1KIK A;  1T3L A;  1GBR A;  3PGG A;  2FPD A;  1QP2 A;  2MF2 A;  4E7I A;  4C92 C;  3JAM E;  4C8Q D;  2DNU A;  4F7U B;  4E7Z A;  3CCJ A;  3OMG A;  1BI0 A;  3TQ7 P;  4PKC C;  4JPB W;  3I5R A;  5GAM j;  1PM3 A;  1TXQ A;  1KSW A;  1W4S A;  3EGX A;  4RKU E;  2QQS A;  3CBO A;  2CP0 A;  2CH4 A;  1CKB A;  2QAZ A;  3G71 Q;  1WNL A;  4IIM A;  1X6O A;  1U1S A;  4C0G A;  1K8A C;  4JRP A;  4RUG A;  4FW1 A;  2YRC A;  5GAN 3;  1TUD A;  4PK4 A;  3EGX B;  3VS5 A;  1W2B S;  1JBM A;  2LCL A;  3CCJ T;  1K73 C;  3CMA A;  2O2O A;  2YUO A;  4QQG A;  1N8R C;  1IZ6 A;  4C8Q F;  4J9I A;  4HT8 A;  1OYX A;  4EIK A;  1ACM B;  2LQN A;  1K9M C;  3RMS A;  2ATC B;  3DLL A;  2YUQ A;  4X34 A;  3OYN A;  3S3M A;  3A5Z B;  3RKX A;  2YHT A;  3HRS A;  3JV3 A;  2PVG B;  1YJW A;  4LE9 A;  3JB9 G;  3P8B B;  2D6F A;  4J9B A;  4MML A;  1IGU A;  1RAE B;  3A8H B;  1VQM A;  3EG2 A;  2DL5 A;  3LYI A;  1VIE A;  2QEX A;  2QGG A;  1D1A A;  5GAN d;  3S3O A;  5HK3 A;  1SF9 A;  3OW2 A;  4F7U E;  3I9Q A;  2HDA A;  2RJC A; 
#chains in the Genus database with same CATH homology
 4M75 C;  4J8O A;  4OVA A;  3VUZ A;  2K5F A;  2K2V A;  4ZGD B;  3CCQ T;  4C5G A;  1VQ4 A;  5IAY A;  5CQX A;  3DB4 A;  2D9T A;  2KVQ G;  1KD1 U;  2CZ0 B;  2P0K A;  2EQK A;  1WGS A;  4J6Y A;  3DB3 A;  3JCM P;  2GQV A;  5GAO l;  4M7D C;  2JN0 A;  3G4S A;  5CKF A;  2QQB A;  4C8Q B;  3L42 A;  4XTW A;  2EQU A;  5GMK h;  2YRV A;  3OSS C;  1ZQ1 A;  2X4J A;  3GLX A;  1VQ7 T;  5GAM h;  4M77 C;  4A4G A;  1X01 A;  4O6J A;  3JSC A;  1YIT T;  1N27 A;  3PNW C;  2JNG A;  3JCM g;  3OYG A;  1Q86 U;  2GFU A;  1K73 U;  1Q82 C;  3MEW A;  2CYZ B;  4OGE A;  1N9R A;  1I81 A;  1KHI A;  1MGQ A;  2DXU A;  2LNV A;  2KDS A;  1M1K C;  3M9Q A;  4XU0 A;  5GAM d;  5GAN f;  4IUU A;  1FX7 A;  3V8J A;  5GAM g;  4D6W A;  4XTV A;  1YIJ T;  3SDZ A;  1G3T A;  2AHJ B;  3QG1 A;  4M77 E;  2EQM A;  5J3B A;  2CKK A;  3JB9 I;  1UGR B;  2CZ1 B;  2Y4Y A;  2PQW A;  3CCM T;  1VQN A;  5FU7 B;  2DD4 A;  3CCS A;  1Q82 U;  2I2L A;  4HKE A;  4LDY A;  5IN1 A;  2EIF A;  3LLR A;  4JUV A;  4PLI A;  1YCY A;  2DK3 A;  3I56 T;  4R55 A;  2DXB A;  3CCU T;  4M7A C;  2LT4 A;  4OB2 B;  2R5M A;  4C92 A;  1YJ9 A;  4RMO A;  2X4Y A;  2WSF E;  4X9D A;  3HFN A;  1KQ1 A;  3OYK A;  2R58 A;  5CAI A;  1YIJ A;  2L8D A;  2R5A A;  2RHY A;  4OB1 B;  4BAC A;  2M9U A;  2XKO C;  2DTI A;  1LNX A;  1YHQ A;  2OAU A;  4PLL A;  2E10 A;  3CC4 T;  2RJF A;  1N8R U;  1YI2 A;  1XQH A;  3FIF A;  4N4G A;  3CC4 A;  3QJY A;  3WXM B;  4M75 B;  4DOW A;  4EMK A;  4M7A E;  2M16 A;  2ZPF B;  4FU6 A;  3X28 B;  1YIT A;  5GAO n;  2VXF A;  4FIB A;  5GMK i;  4BB7 A;  4N0A C;  4E7H A;  3NFC A;  3OQ5 A;  2DD5 A;  1X75 C;  3M4Y A;  3JCM b;  2F5K A;  1NE8 A;  3OMC A;  4JRI A;  5LJ5 j;  3SFM A;  5I2S A;  2HAX A;  3PIP A;  1U1T A;  1OI1 A;  3C94 A;  3CME A;  4XU3 A;  1XOV A;  3QKJ A;  3OYM A;  3VJP A;  3GNF B;  3L2Z A;  4A54 A;  1KC8 C;  1VQK T;  4C92 D;  2E65 A;  3V7S A;  3MEU A;  3E1S A;  4JRK A;  3CCQ A;  1VQ4 T;  1YBY A;  3NTK A;  4HT9 A;  2V8K A;  1KD1 C;  2DO3 A;  3OYB A;  2C06 A;  3GIB A;  1H3Z A;  2BUD A;  4QQD A;  2VUB A;  1JRI A;  5D6X A;  2ZZD A;  4J7I A;  4JLI A;  2K5L A;  3G6E T;  4LDX A;  1WPY A;  3MEA A;  3MO8 A;  3SWN C;  5GAN 2;  4PJO C;  2EKO A;  2RB6 A;  2MMP A;  2RO0 A;  5GAN h;  1M9S A;  1VQL T;  3G7Z A;  2DEQ A;  2RK2 A;  3EFR A;  5AYF A;  3PFS A;  1VQM T;  1VQ7 A;  2RJD A;  3QXE B;  1Y71 A;  4CI0 C;  2DJZ A;  5GAO r;  2PVO B;  3CCL A;  1Q86 C;  4EMH A;  5LJ3 j;  1VQ6 T;  4C0Z A;  1VQ6 A;  3H6Z A;  1QVG A;  2P0Q A;  2YLB A;  2QQA A;  2DIG A;  2PUO B;  2X35 A;  1UGS B;  3RMQ A;  1DJ7 B;  5CVI A;  1WJQ A;  3OA6 A;  2OTJ T;  5J26 A;  3KBG A;  3MET A;  4J83 A;  5KE3 A;  3MP1 A;  5FU7 C;  1VQP T;  2LRQ A;  3QYH B;  5GAN 4;  4ZTJ A;  3C4S A;  4EDU A;  3PMT A;  4J6X A;  3HFO A;  2LC4 A;  2LVM A;  4C0F A;  3KUF A;  5A0G A;  2DXT A;  1M90 C;  3BDL A;  3JB9 F;  1ZBX A;  4A4H A;  5CK9 A;  1QW1 A;  3VYG A;  3HSB A;  3OB9 A;  4L59 A;  3QZ9 B;  5KCO A;  2MI6 A;  3CPW S;  1QVG S;  3HHT B;  2WAC A;  3M58 A;  4XAX B;  5CQY A;  4M7A B;  2QA4 A;  1WQW A;  3QII A;  3M59 A;  5GMK m;  2H3J A;  2JOY A;  3LX7 A;  4OB3 B;  1FXX A;  3UPU A;  1BI3 A;  4M77 D;  2E41 A;  3CME T;  1NZ9 A;  3CEY A;  1BKB A;  4DQ2 A;  4BI4 A;  5DY9 A;  3BFM A;  1N6A A;  2E12 A;  4FM4 B;  2VC8 A;  3CCV A;  4P5N A;  3CCE T;  4Q5W A;  1M4Z A;  2DXC A;  4KUL A;  2O01 E;  3M57 A;  1I8F A;  1D3B A;  2RHU A;  3HRT A;  4QQ6 A;  3OYY A;  4M7D A;  4M7D B;  3X20 B;  2RHI A;  2FYK A;  2P0P A;  4C8Q E;  4JRQ A;  2F69 A;  1M1F A;  3SB2 A;  1BYM A;  2M1H A;  4VUB A;  4B9X A;  4LDU A;  4M78 D;  2KMT A;  3PTA A;  1PSF A;  2V8I A;  3TCJ A;  3LWI A;  2QA4 T;  2JUF A;  4C0D C;  3NTI A;  3JB9 J;  4ME7 A;  1W2B A;  4M7D E;  4E7J A;  3CC7 A;  5FRN A;  4XTZ A;  4C92 G;  2HQX A;  2VXE A;  1D3B B;  3JCM V;  4C5E A;  4C8Q A;  1N9S A;  3Q1J A;  4MMK A;  2O4X A;  1YJN A;  1WQ7 A;  1XNI A;  5J39 A;  4Z02 A;  1H64 1;  2PVD B;  4KBM B;  4M78 G;  3RIR A;  4ELZ C;  1VQO T;  4BDY A;  3O8V A;  3X25 B;  2HQE A;  2LTO A;  3S6W A;  3V7R A;  3CCS T;  4NOY A;  5GAN j;  1VQN T;  4A4F A;  2OTJ A;  3CMA T;  2E70 A;  1JJ2 S;  2RD1 A;  3OW2 S;  5HY6 A;  3VUB A;  3I55 T;  4M7A A;  1VQ5 A;  5GAN 6;  2K3X A;  3HL8 A;  2WSE E;  3MP6 A;  1VQL A;  4EMG A;  2ZPG B;  4XU1 A;  4JLG A;  1HK9 A;  3CD6 A;  4C5H A;  3CC2 T;  3CCL T;  4E7K A;  4FT4 A;  3OYD A;  2X4W A;  4J7F A;  3G71 T;  2X4X A;  5GAN 7;  2LQK A;  3MHX A;  2O4X B;  5GMK l;  4X9C A;  1Q81 C;  3RKW A;  1ZHI A;  2CZ7 B;  3UDC A;  4QVZ A;  3OBY A;  1VQ8 T;  1KC8 U;  1M8V A;  3EAE A;  3CBM A;  5CKE A;  3A8L B;  2A3L A;  4EMK C;  1VIF A;  3QYG B;  3A8M B;  2L5Q A;  3FJP A;  4KT0 E;  4XTY A;  1TH7 A;  2VYT A;  5A2Q E;  4DA4 A;  2OTL A;  4OP0 A;  4XU2 A;  5GAO p;  1I4K 1;  2FL7 A;  3A8O B;  1NPR A;  2DIQ A;  3FLG A;  3G4S T;  1VQK A;  1B34 A;  5FRM A;  1QVF A;  1XTD A;  2XI9 A;  4XTU A;  5HKC A;  2HBP A;  2QDY B;  1BIA A;  1LJO A;  1HXD A;  4ZGE B;  3HP9 A;  2BKD N;  3TRE A;  3OYE A;  2DTO A;  4RCB A;  2QQR A;  5FLX E;  1UGQ B;  2M0O A;  5CCA A;  4ZGJ B;  3J81 E;  3CCE A;  2RI3 A;  5CR2 A;  3TEE A;  1PSE A;  3OS2 A;  4M7D F;  4A53 A;  1RL2 A;  1Y07 A;  1BI2 A;  3PIO A;  3FRN A;  4M77 G;  3OY9 A;  4OF1 A;  3UT1 A;  3PT9 A;  3QJ6 A;  2FB7 A;  3ZFJ A;  3VV0 A;  3RUX A;  1GXI E;  1Y7X A;  3FDR A;  3OYH A;  5GAN 5;  1QP3 A;  4BE2 A;  3JRZ A;  2XU8 A;  3A8G B;  3GF5 A;  4EPC A;  3OYL A;  4NL3 A;  5DLO A;  4E7L A;  4HCB A;  2E6N A;  3FEO A;  2E1H A;  2JVV A;  5I2M A;  3OS0 A;  2ZPH B;  3SWN A;  3GOX A;  4PJO A;  1EIF A;  1M90 U;  1VQ9 A;  3CCU A;  1LOJ A;  3CCR A;  3I56 A;  3BW1 A;  5GAM e;  4IUV A;  3OYA A;  3E9G A;  3UWN A;  4IUR A;  2XIC A;  4M78 B;  3JCM X;  2RHX A;  3X26 B;  5GMK e;  2EYQ A;  2RJE A;  2XK0 A;  2MWP A;  2XDD A;  3GP8 A;  4HCC A;  3QUI A;  2ZPE B;  4ZTF A;  4ZN3 A;  2BIV A;  4C92 B;  2NLU A;  4M7D D;  3QO3 A;  3OYI A;  1IRE B;  5KCH A;  3V7C A;  5FRO A;  2JZ2 A;  4LD6 A;  3RKY A;  3P8D A;  1B34 B;  2L3R A;  4C0D B;  4M78 E;  2HD0 A;  2KK4 A;  5LJ5 g;  3F70 A;  1P92 A;  3JCM Q;  1MHN A;  1S72 A;  1NPP A;  2Y4X A;  4PJO F;  1M1G A;  3G6E A;  5FU6 B;  4XQ3 A;  2DKG A;  3LGF A;  2QTX A;  4M7D G;  2XG8 D;  3M56 A;  2YLC A;  3FB9 A;  2RHZ A;  3QDR B;  3RES A;  2DZ9 A;  4IKF A;  3ZEH A;  4PJO D;  4KUI A;  1AHJ B;  4J5Y A;  2K57 A;  4IUT A;  3ASK A;  4M78 C;  2CGH A;  2DAQ A;  2QI2 A;  4L5G A;  4TVR A;  5A0D A;  3I55 A;  3RER A;  2MWO A;  3VKI A;  1O75 A;  5DLQ E;  1QVP A;  4O5V A;  4Y91 A;  3ZBD A;  1K9M U;  5CKB A;  3CBP A;  4HCZ A;  5LJ3 d;  3JCM e;  1M1K U;  4M7A G;  1KQS A;  4F7U A;  3PMI A;  4UC4 A;  1O9S A;  1R8O B;  3J80 E;  4LD9 K;  1K8A U;  1G3W A;  1V29 B;  3T9N A;  3KXT A;  3BY7 A;  2CZ6 B;  3CXC S;  2B8A A;  5DM7 R;  2EJG A;  2EJ9 A;  4LDV A;  3ER0 A;  4C5I A;  5GAN 8;  5CKH A;  2E6Z A;  1Y96 B;  2KQW A;  4BY6 B;  4RG8 A;  3LWH A;  2EJF A;  3WVD B;  2K3Y A;  2RI5 A;  3P8H A;  4N4H A;  5LJ3 h;  3MP8 A;  4QVC A;  3HPW A;  3JCM d;  4MDX A;  2LQ8 A;  3OSV A;  3VU3 C;  1NJI U;  1QVF S;  1G3S A;  5D6Y A;  1VQ8 A;  4ZN1 A;  2RM4 A;  4M75 A;  4M7A D;  2IG0 A;  3MEV A;  4FSX A;  3URG A;  4BE0 A;  3SWN B;  4PJO B;  4BUG A;  4F7U G;  1YHQ T;  4C8Q C;  3R6O A;  3JCM h;  4M7A F;  3OS1 A;  4BY6 C;  4OB0 B;  3LGL A;  4JDS A;  3CXC A;  5LL6 S;  2ZPB B;  3L2Q A;  1VQ5 T;  2GF7 A;  5LJ5 h;  4J6W A;  2VGN A;  4MZT A;  4WF2 A;  1NJI C;  4N4I A;  4F7U F;  1YJW T;  3GNG A;  4ATO A;  5GAO q;  1KHC A;  4C92 F;  1KQ2 A;  4RCC A;  2DZC A;  2JTF A;  3HRU A;  4JS5 A;  4M75 G;  3E9F A;  1OZ3 A;  3JCM c;  2XHC A;  5CIU A;  3CCM A;  2L89 A;  2CS7 A;  2IVW A;  1VQ9 T;  4M77 A;  4BE1 A;  3DKM A;  1YJN T;  2FVU A;  4MZP A;  2KSS A;  3CPF A;  4HA8 A;  4JS4 A;  1BIB A;  2RA2 A;  3NTH A;  3OBW A;  2RK1 A;  5CO7 A;  4ELY C;  4M75 F;  4V2S A;  4BDZ A;  3JB9 D;  1UB4 A;  1KG1 A;  2K4Y A;  2A7Y A;  3V8K A;  3WVE B;  4C92 E;  2PU9 B;  4FT2 A;  4XK8 E;  4GY5 A;  2XDB A;  5I21 A;  2E64 A;  3OYC A;  4M75 D;  5FU6 C;  3M53 A;  2F5T X;  4IUP A;  5HK0 A;  1KQS S;  1U8R A;  4MDW A;  4A4K A;  2FHD A;  1BI1 A;  4M77 F;  3OYJ A;  3QBY A;  4LDW A;  2QQ9 A;  3MCA B;  3PGG A;  2KAF A;  1QP2 A;  2MF2 A;  4E7I A;  4C92 C;  3JAM E;  3GPL A;  3L2V A;  2HNI A;  5C6S A;  3QSU A;  4C8Q D;  1VQO A;  4A4E A;  2EQJ A;  2MAM A;  3LW5 E;  4PNO A;  4F7U B;  2DPP B;  2GCX A;  3OMG A;  4PJO G;  5GMK j;  1BI0 A;  5LJ3 e;  1JB0 E;  2LX9 A;  2JTM A;  3CCJ A;  4PKC C;  2OTL T;  1UEB A;  2XDP A;  3E19 A;  1W4S A;  5GAM j;  4R56 A;  3CC7 T;  1WJR A;  2E5Q A;  2R57 A;  4RKU E;  2QQS A;  3CBO A;  3S3N A;  2D0Q B;  3OS5 A;  5LJ3 f;  5CKD A;  2Y90 A;  4E47 A;  4OMF B;  1SSF A;  1WNL A;  1OZ2 A;  3VYH B;  1X6O A;  4C8Q G;  5D6W A;  3G71 A;  1U1S A;  3AHU A;  4C0G A;  5KH6 A;  1K8A C;  4N0A A;  4JRP A;  4QVD A;  3H8Z A;  4QW2 A;  2QEX T;  3CC2 A;  3M4G A;  2GFA A;  3JCM J;  3CD6 T;  1VQP A;  3JCM f;  2DVE A;  3L1A A;  5GAN 3;  1G3Y A;  3N5B B;  1Q81 U;  4BD3 A;  3M5A A;  1W2B S;  1JBM A;  1M5Q 1;  2LCL A;  2VGM A;  5GAN e;  5LJ5 f;  3CCJ T;  2PUK B;  2WSC E;  1K73 C;  3CCV T;  2K5I A;  3EFS A;  4M77 B;  3CMA A;  3J7A F;  3M54 A;  4YTL A;  4QQG A;  1N8R C;  2XD0 A;  2LT1 A;  4CRI A;  1IZ6 A;  4Y28 E;  5C0M A;  4PJO E;  1UGP B;  5L8R E;  4C8Q F;  4HT8 A;  5LJ5 e;  1OYX A;  5A0L A;  5LJ3 g;  3INZ A;  2RI2 A;  4M78 F;  1FWZ A;  4XTX A;  1RI0 A;  1Q7Y C;  3FC3 A;  3C12 A;  4L6V 5;  2LDM A;  2XID A;  3OYF A;  2ZGW A;  3RMS A;  1S72 T;  1K9M C;  2ZPI B;  3JCM W;  2DTH A;  3LH0 A;  4DOV A;  5GAO m;  3DLL A;  1VUB A;  3V8L A;  4BI8 B;  4IUQ A;  4II1 A;  4X34 A;  1JJ2 A;  3OYN A;  2G3R A;  3S3M A;  2ZCF B;  2P4T A;  3A5Z B;  3RKX A;  3JB9 H;  1G5V A;  2YHT A;  3HRS A;  4NS5 A;  3QZ5 B;  1Q7Y U;  2PVG B;  1YJW A;  4RG2 A;  1YJ9 T;  1I5L A;  2V8J A;  4M78 A;  3BDU A;  3M55 A;  2RH2 A;  4OGC A;  2EFI A;  4B9W A;  4MZM A;  3JB9 G;  4BI3 A;  3L2U A;  3L2W A;  3P8B B;  4NL2 A;  2D6F A;  4EMK B;  4PL6 A;  3L2R A;  3CCR T;  3QHS A;  3DLM A;  4MML A;  5LJ5 d;  4M75 E;  4JJN K;  1WJS A;  3ME9 A;  5IT9 E;  3A8H B;  5M9O A;  3QPH A;  1VQM A;  3TU4 K;  4KUD K;  2QXF A;  5KE2 A;  4FL6 A;  2LCC A;  3CPW A;  2VV5 A;  3C95 A;  1Y96 A;  3LYI A;  4GLK A;  5EG2 A;  1VIE A;  2QEX A;  3X24 B;  5GAM f;  5GAN d;  3S3O A;  1YI2 T;  3HKS A;  5HK3 A;  5GAN g;  2KY9 A;  3SD4 A;  4F7U E;  2EAY A;  3OW2 A;  2RJC A;  2EWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...