4C8QD

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
81
Chain Sequence
LPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAIAVKLNEIYIRGTFIKFIKLQDNIIDKVKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 81
sequence length 91
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qD00
4M75G 3M4GA 3JCMV 3JB9J 1I81A 4A53A 4X9CA 4M7AE 2DVEA 1WQWA 2YHTA 4C92E 3RERA 4XTVA 1JRIA 3FIFA 4J6WA 3V7RA 5GAMd 5LJ5g 4N0AC 4C8QG 3SWNB 4M78G 4XTYA 5LJ5e 4V2SA 4M7AB 4NOYA 3SWNA 5GMKi 4C92B 5GAN5 1D3BB 1H641 1LOJA 2FB7A 3PGGA 4M77A 4C92A 5GAN6 5LJ3j 4F7UG 5GAN7 1D3BA 4X9DA 3RKYA 3RESA 4PJOF 4XTXA 3AHUA 2RB6A 4DQ2A 4XU0A 4WF2A 1I5LA 4M7DD 2DXUA 5GMKh 1B34B 5LJ5f 4J5YA 3EFSA 4NL2A 2E1HA 5LJ3e 4M78A 5GAN4 1B34A 3JB9H 1BIAA 1KQ1A 4F7UB 4OP0A 5GAN2 4M7AG 1BIBA 2RM4A 5LJ3d 4A54A 1N9SA 4C92G 2DJZA 4F7UA 3JCMb 1WQ7A 3JB9D 3JCMd 3EFRA 4JUVA 4M7DC 2RD1A 4PJOE 1U1TA 4EMKC 2EAYA 2DXTA 3HFOA 4M77D 5LJ3f 5GMKe 4XTWA 5GAMe 1HXDA 3V8JA 4M75D 2DTIA 3BY7A 2E65A 5LJ3h 3SB2A 2YLBA 5GAOr 4PJOB 2DTOA 3VU3C 2VC8A 3HFNA 4M75F 3V8LA 1LNXA 3L1AA 4MMKA 3JCMQ 1Y96B 3BW1A 4PNOA 4C8QD 4M77C 4JRIA 4M78D 5GAOp 1Y96A 4EMGA 4M75C 2E10A 4J6YA 4MMLA 5GAMf 4XTUA 1HK9A 5LJ3g 5GAMh 5GAOm 3JCMg 3JCMX 5GAOl 2EJFA 4XU3A 2VXEA 3JCMe 4XQ3A 4M7DF 1WNLA 4RCBA 2EJ9A 4PJOG 4C8QC 4M78C 4N0AA 2CGHA 4M7DA 4HT9A 4QVDA 3V7CA 3QSUA 3JCMP 2E41A 3JCMJ 2DEQA 3JB9F 5GAMg 4EMHA 4HT8A 1TH7A 2FYKA 2YLCA 4M7AD 1I8FA 2ZGWA 1X01A 3RKWA 2EWNA 4C92D 3JCMf 4HA8A 1M8VA 5GAN3 3RIRA 5GANj 2Y90A 4M77F 4RCCA 3JCMh 4Y91A 4M7DE 3INZA 3BDUA 4PJOA 3QO3A 2I2LA 3SWNC 2DZCA 4J6XA 4M7AC 2QTXA 3FJPA 2E64A 3FB9A 3L2ZA 3QUIA 2VXFA 2DZ9A 4JLIA 4XU1A 4C92C 5GANe 3JCMW 4M7DB 2RA2A 4EMKB 4C8QF 1LJOA 3RUXA 4M78F 1YCYA 5LJ5j 1KQ2A 4XTZA 5GANd 5CAIA 3V7SA 4M77E 4NL3A 2EJGA 4JRKA 4M75E 3BFMA 4F7UF 1I4K1 5DY9A 5GANf 1MGQA 3JB9I 3QHSA 4M77B 5GMKl 5GMKm 5GANh 4M7AA 1JBMA 4M75B 5GAOq 4PJOD 4C8QE 4M7DG 1N9RA 4M78E 4M75A 3JCMc 5LJ5d 3GIBA 1WPYA 2DTHA 5GAOn 3V8KA 4M7AF 4C92F 1U1SA 2K57A 4F7UE 2JN0A 4C8QB 4XU2A 5I21A 5GAN8 4M78B 3RKXA 3JB9G 2DKGA 4QVCA 4PJOC 4C8QA 5GANg 2HNIA 5LJ5h 3HSBA 5GMKj 4M77G 5GAMj 1M5Q1 4EMKA
chains in the Genus database with same CATH superfamily
3CPWS 4FYXB 3CPFA 2DD5A 4ZN1A 3VS4A 1QQJA 4LUDA 3NTIA 1D1BA 4C92B 1VQ7T 3G1JA 3R6OA 4WTOB 1UFFA 4Q5WA 1NJIU 2RB6A 3FEOA 1WXTA 2YRVA 1SSFA 3OA6A 2KSSA 4M78A 1RI0A 4A54A 2M16A 4F7UA 1JJ2S 3CC4A 4AFQC 2QQBA 4M77D 3KBGA 4XTWA 2G3RA 1EZZB 2E65A 4DOWA 5CQYA 2HSEB 4M75C 2E4HA 1YI2Q 1VQ9T 1PRMC 3OYBA 3I55T 2XIDA 1G8XA 2XDBA 2VASA 2O9VA 2PVDB 3NTHA 4L6V5 1PWTA 4R56A 3CPWA 2MWPA 3OW2P 2COZA 5LL6S 2E3HA 2ZGWA 4RTYA 4EIKA 1TUGB 3VJPA 1N8RR 4PJMA 1K0XA 2M02A 4JS4A 1WA7A 4J6XA 2DYBA 1S72A 2RQUA 5LJ5j 2DNUA 4BE1A 3I56T 2RHYA 2JS0A 1G3SA 1PG5B 2RQRA 3TEEA 3RBBB 3J81E 2ROLA 4M75A 2ATCB 5LJ5d 3CCST 1U1SA 2DE0X 2SRCA 4A4KA 3HRSA 3G4ST 2AIRB 1FYNA 3N5BB 3CXCS 5KYXB 1EX4A 1KC8U 3JCMV 4PFZA 3QYGB 1G3WA 2QEXQ 2K5FA 3CC4Q 3M55A 2MK5A 4KRTA 3L2QA 4J9CA 4M7AB 3H0FA 5CO7A 4M77A 2KK4A 2LMJA 4II1A 1AWXA 2P4TA 2GBQA 2DXUA 2RH2A 4BDYA 4ZTJA 3EFSA 4ATOA 1ARKA 5FWCA 1YJNA 1BIBA 1K73C 3HTRA 3M0TA 1ZX6A 1GCPA 4JZ3A 1K9MC 2C0TA 4FCYA 1BI1A 2LTOA 4BY6B 3OYDA 1M2OA 1UUEA 3V8LA 2JTMA 4FYVB 5FW9A 1XTDA 2HL5C 5IXBA 3C95A 5CKEA 1QP3A 1AHJB 2EVRA 3HRUA 2EYZA 4RCBA 4D6WA 1S72Q 1D0XA 3OQ5A 7AT1B 1TH7A 3SEMA 2GTOA 2BZYA 2ECZA 4RCCA 4M7DE 3INZA 2I2LA 1M4ZA 3QUIA 1AD5A 2DYIA 2YWWA 5GANe 2YSQA 1IGUA 2K6DA 1VQ8T 2OAWA 4ME7A 4Z02A 4C5EA 2X4YA 3M0QA 2GNCA 2H3EB 4JRKA 3BFMA 1UHCA 1M90R 1QKXA 4ZN3A 2FPDA 1JBMA 2NUTB 4C8QE 4CRIA 2ZPFB 4AFZC 2JXBA 5CKBA 1TXQA 1KHCA 1UB4A 3CCVA 1C6VX 1NM7A 3HSBA 1YJWT 4QVDA 1UGVA 3EGXA 2O9SA 1TUCA 1N8RU 3E19A 4ZGEB 3PNWC 5C0MA 1YJNQ 4OMOA 1K76A 3EHRA 4J83A 2RQVA 2CT3A 1PSFA 3VS3A 4X9DA 4PJOF 2BE7D 2J7IA 1MMGA 4WF2A 1YWPA 3RMSA 4M7DD 3M0UA 3ASKA 1KSWA 1VYVA 2KE9A 4ZNXA 1VQKA 1ZSZA 1N5ZA 1WXBA 4IUUA 2B86A 2V26A 1NG2A 2OTJA 2NYSA 2NUZA 2Z0WA 2KT8A 1M1KC 3HFNA 5DLQE 4ESRA 2RK2A 4C8QD 1AWWA 1B7TA 4J6YA 2EBPA 2QQAA 1XJWB 3LW5E 1G5VA 2VKNA 2HQEA 1D09B 1D0ZA 2FHDA 1R0BG 1U5SA 2A28A 3M53A 1Q7YC 2PU9B 3CCQA 1KG1A 2P0QA 3C0CA 1QVGS 4RMOA 4IIOA 2YT6A 5KYYB 4J8OA 5KCHA 1Q86C 4LDXA 3O5ZA 4M78F 3CCVQ 1RUWA 3QBYA 5HY6A 1Q82R 4XTZA 1NPPA 2QI2A 1K9AA 4NL3A 4F7UF 3L2WA 1C0MA 3OYMA 4GLMA 2X9HA 1FWZA 1IRXA 1I0CA 3THKA 1LPLA 2C0IA 1BBZA 2K5IA 2IG0A 1RL2A 3WXMB 1QCNA 4OB3B 2K3XA 5LJ5h 1AWOA 1M2VB 4M7DA 4BD3A 2ZPHB 1YHQA 1VQPT 3PIOA 1SRMA 3UT1A 2HCKA 1VQKQ 4JJDA 1RABB 4TVRA 1ZQ1A 3LH5A 3CD6A 4PJLA 2ZCFB 1UHFA 5HK0A 2ZPIB 1QVFS 2OTJQ 5C6SA 2CP7A 2D0QB 5AYFA 2R5MA 2JMCA 1M90U 3QDFA 1B34B 2FPEA 2DO3A 5D7UA 1SHFA 1UGRB 2RD1A 3EH2A 2BKDN 2GF7A 2MOXA 3M0RA 3CCQQ 2CP3A 4PJOB 2XD0A 3TSZA 4M75F 1LNXA 3JRZA 4O6JA 2DBKA 1Y96A 2RN8A 3UA7A 3VYHB 2HDAA 4OVAA 4QQ6A 4ANJA 1YITT 4GBQA 3OSVA 4GLKA 3G6EA 4DBFA 2CUDA 3ER0A 5D6YA 4E47A 1OEBA 2VGNA 4E7ZA 3C4SA 3OYYA 4R55A 2E5KA 1BU1A 2YLCA 4Y92A 3TQ7P 3OYHA 5GAN3 1NEGA 5FRNA 4M77F 1QVFA 2LP5A 1Q95G 2VGMA 4FYYB 2HBPA 2F69A 2PUKB 5A2QE 4BI4A 5KYUA 1KQ2A 4E7IA 3ZBDA 1YHQQ 1E7OA 5HK3A 2OX7A 3ULRB 5KE2A 1T0HA 2EGAA 1N9RA 4KULA 1Q81C 1JEGA 3VV0A 3P8HA 3VKIA 2Y4YA 4M78B 3QKJA 4QVCA 4RG8A 2FL7A 1AZGB 2LVMA 2X3WD 4PKCC 3I56A 4RTZA 4CC4B 4FSSA 2LQWA 5KYWB 4HVWA 3CCET 1I81A 3RERA 4CC7A 4P5NA 5KH6A 8AT1B 4RUGA 4XTYA 3GBQA 4V2SA 4NOYA 3NPFA 3HHTB 4X1VA 5GAN7 1Q82U 3GPLA 4XTXA 2FO0A 3C12A 1MMDA 1V29B 1YJ9T 3MEVA 1TS9A 3VS1A 2L8DA 3WVEB 3JSCA 5GAN2 3OY9A 2DJZA 3G6EQ 3QJ6A 4OGCA 4EMKC 3H9NA 3OYAA 1AVZC 1HXDA 2GTJA 3V8JA 1VQNA 1BKBA 3CCLA 1JXMA 3BW1A 1WJQA 1P92A 4XTUA 1KD1C 5GAOm 2DERA 4OMPA 1G2BA 1W6XA 4VUBA 5IAYA 2I0NA 2J6KA 2JW4A 2F2XA 1ZHIA 2LQ8A 2RJDA 3JCMP 1SEMA 2RJCA 1X69A 1PM3A 1OULA 4RTWA 3UPUA 3CC2T 1ACMB 2RMOA 2RHIA 2NUPA 5AT1B 3I35A 2JM9A 4J9BA 2R58A 2DZ9A 1IHVA 1GL5A 2JS2A 1AOJA 4N4HA 3X25B 1RACB 1TOVA 3A8MB 4M75E 3SFMA 2FZGB 4BI8B 3OYGA 1WIEA 3QG1A 3JB9I 2KEAA 4M77B 2HL3A 2K79A 4J9HA 2LRQA 1U8RA 4E7SA 3V8KA 2JNGA 4PFPA 6AT1B 2QDLA 1UGPB 4IUTA 4OMMA 4XU2A 2JMAA 1E6GA 2V1RA 1X2KA 3LYIA 3EAEA 4X34A 3VS2A 3VS5A 1OQKA 3M9QA 4J6WA 3GOXA 2FPFA 2LJ0A 1BK2A 1Y57A 5L8RE 4C0DC 1D3BB 3OW2S 1VQNQ 2XK0A 4DEXA 5GAN6 1SHGA 4NS5A 1K4US 4RTUA 2EIFA 3CCLQ 2F5KA 4KH0B 1M30A 4NL2A 1BIAA 1UECA 3M57A 2A0FB 2RM4A 4C92G 2KRMA 4Z89A 3PVQA 2EKOA 2DL5A 1ZBJA 1NJIC 3QZ9B 1TSFA 4QW2A 4M75D 2DTIA 2QQ9A 1VQ4A 5I2MA 1M3AA 1W70A 3CMAT 1ZA2B 5FRMA 4Y28E 1SSHA 4HCZA 2QTVA 1PHTA 4IKFA 1MUZA 1UDLA 4FW1A 2XU8A 1K73R 1OZ2A 1KK7A 4M7DF 1VIEA 4GY5A 2RK1A 2KR3A 2YUQA 3NTKA 5A0DA 3OW2A 2DZCA 1O9SA 1R0CB 2QGGA 4MZMA 4C8QF 4PJNA 1KHIA 1RAFB 3EFOB 3M0PA 1VOMA 4PJJA 1TUDA 4PLIA 2GFUA 2PNIA 2X35A 1FMWA 3FDRA 2CZ1B 3EG9A 3CC7T 5EC7A 1VQMA 4J7FA 3MP1A 3NHNA 3GIBA 1YBYA 2DX1A 2K57A 4JRPA 3VS0A 4LDYA 2P84A 2KT1A 4RG2A 2QA4T 5GANg 1WYXA 2RF0A 1ZSZB 1BYMA 4JS5A 3PTAA 3CCJA 3I5SA 3SWNB 1M1FA 2A08A 1JU5C 5LJ3j 3CMET 1VQ4Q 1S1NA 1PSEA 3MP8A 3J7AF 1KIKA 2DXBA 2E1HA 3OB9A 5FU6B 3JB9H 3X28B 2A3LA 4M7AG 5LJ3d 3JB9D 3D7SB 3A8LB 1WQ7A 3LGLA 1OV3A 1U1TA 2CREA 3U23A 1B3QA 2HZYA 1X75C 2FRYA 2O4XA 5GMKe 2YUNA 2XG8D 1Y7XA 4A4HA 5GAOp 3SHWA 3MKDA 2IIMA 3S6WA 1YIJT 2LCLA 5GAMh 2RHXA 4JJCA 3JCMX 2IVWA 5IXFA 4MDXA 2L5QA 3QWXX 1X27A 5IHIA 4O5VA 4OMFB 2L2PA 2OI3A 3A8GB 3CCUT 1VQ6A 2ZAEA 2A37A 4EPCA 2EYXA 1X01A 4ORZA 3VUBA 2LX7A 4LUEA 1XOVA 2V8JA 3JCMh 1VQMQ 4DOVA 2JOYA 2X4JA 2XDDA 3REAB 4C92C 4M7DB 3CCMA 4CI0C 3RUXA 1X6GA 1VQ5A 3ZFJA 4HKEA 1Q7YR 2Y4XA 2ZPBB 1OX8A 2DL8A 1NBEB 4Z88A 3CCJQ 5DLOA 3CCRA 4HVUA 2C0OA 1K73U 2M51A 2D6FA 2DM1A 4C8QB 2KY9A 3URGA 2HNIA 2FVUA 1UEBA 4KBMB 4PFOA 3HL8A 1OPLA 5CCAA 1JO8A 3TCJA 1CSKA 4A53A 3A8OB 2YHTA 4PL6A 1VQOA 1QP2A 3FIFA 5CKDA 3MHXA 2XI9A 2L0AA 2E6ZA 2L3RA 2WSFE 3PMIA 1LOJA 2AZVA 1H8KA 1K0SA 4C92A 3TVTA 3E1SA 3RESA 4ZTFA 1N8RC 3QDRB 5KCOA 2OTLA 1YI2T 2KXCA 4CC3A 3HRTA 4M4ZA 2KGTA 5CQXA 1X6OA 2A7YA 1UE9A 1WDXA 1RAGB 2DD4A 2KQWA 4KGZB 2LQNA 1BI3A 3G71A 5FLXE 5J3BA 3BY7A 3OS1A 5GAOr 1VQ6Q 1EIFA 2LJ3A 2CP5A 2LCCA 4E7HA 5FWBA 3EH1A 1LCKA 2J6FA 3OS2A 4MZTA 1WLPB 5GAMf 5GAOl 2EJFA 2YDLA 3CCMQ 3OYFA 4OB2B 2RQWA 1VQ5Q 1H3ZA 3A8HB 2O88A 4CC2A 4FT4A 4DBRA 4DBQA 3EHQA 3JCMf 1H3HA 3CCRQ 2HKQB 3EGDA 1MNDA 2HAXA 4M7AC 2E64A 3FB9A 4XU1A 5IHNA 1WGSA 1X43A 3X26B 3V7SA 1NYFA 4FM4B 3OYCA 1HJDA 2CZ7B 3TU4K 2QEXT 3MP6A 2HQXA 3H6ZA 5DY9A 3CC4T 2EFIA 5I2SA 3L42A 2D1XA 9ATCB 1VQOQ 2F2VA 3DLLA 3UWNA 2CP0A 1WHHA 1WPYA 4BDZA 1CKAA 5IT9E 4BY6C 2PUOB 4N4IA 3L2UA 2OTLQ 4E2FB 5J26A 1K8AR 4OGEA 3BE3A 2CZ6B 1JB0E 3NGPA 1OU8A 3M4GA 4C5GA 3OS0A 3OYNA 2LNHB 2ZPGB 1OYXA 4RKUE 2JJ9A 4N0AC 1SRLA 1U06A 4AG2C 3WVDB 5GMKi 4IURA 3G71Q 4LDUA 4M7AA 4N4GA 2DIQA 1Q7YU 1IGQA 2DIGA 2MIOA 3DB4A 1MV0B 3HP9A 1JQQA 1T3LA 2ESWA 4K11A 2MPXC 1OU9A 3M59A 2FZCB 1S72T 1N9SA 4OMLA 1MV3A 1V76A 1M90C 1O75A 5LJ3h 2NUPB 3NFCA 1QWEA 4XAXB 1NLOC 1VQLA 4JPBW 1UG1A 1QCOA 2LJ1A 3I5RA 3JCMg 1WXUA 4XQ3A 2NWMA 1PNJA 4PJOG 4N0AA 2D8JA 2CH4W 1X2QA 2HEQA 4DBHA 2FYKA 1VQ7A 3RKWA 2E3IA 5KE3A 4Y91A 3FLGA 3OYJA 4A4EA 4LXCA 1M1GA 1ABOA 2VXFA 3M0SA 4BE0A 3JCMW 1LJOA 5FU7B 5CIUA 2L89A 5CAIA 3LWIA 1YJNT 3AT1B 2DK3A 4JZ4A 1GRIA 2DFUA 2IPOB 1W1FA 2X4WA 2RHUA 3ME9A 1XNIA 1HD3A 4B9WA 2NUTA 2QDYB 4RTTA 3OMGA 5GAN8 3LGFA 1VQ9A 2DKGA 3I55A 2YUOA 5CKHA 1IREB 2EYYA 2RNAA 5DM7R 4AMCA 2LZ6B 4BUGA 1GBRA 3V7RA 4F16A 4RTVA 1D1CA 2ABLA 4M78G 1TTHB 2QGFB 4F7UG 3FJ5A 3CD6Q 3AHUA 2QA4A 1VQLQ 5LJ5f 3CEYA 4J5YA 5GJWB 2E70A 4F7UB 1Q82C 5I11A 1M3CA 1A0NB 3H0HA 3OBWA 2DXTA 2O2OA 5LJ3f 5GAMe 1V1CA 4JRQA 3ZL7C 3CMEA 1JXOA 1K8AU 1VQ7Q 3IQLA 3CCSA 2L3SA 4OMQA 2EYWA 1ZSGA 3G4SA 3ZEHA 2CH4A 2QXFA 4YTLA 1VIFA 3RDVA 2DEUA 3CCVT 2HSPA 5IN1A 1NEBA 3JCMe 5GJVB 3EGUA 1UGSB 2GCXA 1YN8A 2EGEA 2BIVA 4HCBA 3JB9F 2RHZA 2EQIA 3E2UA 4QKUA 4ELYC 4OF1A 5IH2A 2VB6A 3L2ZA 2QQSA 3META 4QQGA 2ENMA 1VQ9Q 3VRYA 3I55Q 2P0KA 2H8HA 3M58A 3SD4A 1VQKT 4F04B 1PKTA 2YRCA 4M75B 2OTJT 1WZOA 3PVLA 4J9GA 1VYTA 4FW2A 2JN0A 4OMNA 1PRLC 4PJOC 2PVGB 3QXEB 2E5QA 2HMAA 4M77G 4EMKA 3I56Q 2K3YA 4XK8E 1KD1U 3QYHB 2M0OA 5LJ5g 2MAMA 3CCQT 1RI9A 5J39A 2DMOA 3REBB 3CCSQ 3A98A 1MHNA 1VQ8A 1FMVA 3G4SQ 1B34A 2F1LA 2RJFA 2W10A 5L23A 3QWYA 1IO6A 4JUVA 2WACA 1QWFA 3JV3A 3GF5A 1WHKA 2XDPA 1WX6A 3JCMQ 5CR2A 2NLUA 2CS7A 1WHLA 1RLPC 4D8DA 1J3TA 1BI0A 1YJWA 3LWHA 2DRKA 3HKSA 3EG3A 3QJYA 2DRMA 2BZ8A 4M78C 2GFAA 1CKBA 1YHQT 4LDVA 4C0ZA 1C1AA 3VRZA 1PKSA 2LQKA 2M0YA 2EWNA 2RI2A 1QKWA 3NMZC 3R6NA 2JZ2A 2MI6A 3GNFB 4B9XA 2EYQA 1QVPA 2X3XD 4LD6A 3E9FA 2L3PA 3L2VA 1WHJA 2AKLA 4HXJA 1W4SA 2ROTA 2QAZA 2DBMA 5A0GA 3X20B 1PD0A 1KQSP 4IUQA 3MEWA 1K9MR 1OPKA 2EQUA 2BTTA 1SKUB 1FMKA 4LDWA 5GMKm 4EDUA 1NPRA 3LLRA 5GAOq 4ZGDB 2EQKA 1VYUA 3QPHA 4JDSA 3VUZA 3S3OA 1OX9A 1IXDA 1UTIA 3Q1JA 3EGXB 3VS6A 1VQ8Q 4JJBA 3G6ET 2QEXA 1F1BB 3JB9J 1G83A 2G6FX 3C94A 1W2BS 5KYWA 4C92E 1Z9QA 4AG1C 2XICA 1FXXA 2LX9A 2VYTA 2RI3A 4HVVA 2RPNA 5LJ5e 2O01E 3SDZA 5GAN5 5HKCA 3P8DA 4XU0A 4IIMA 3L2RA 2JT4A 1G3YA 2V8KA 3MEAA 2O31A 3CBMA 5LJ3e 2CSQA 3CBPA 2WSEE 3VS7A 1YJWQ 3J80E 2V1QA 1SF9A 4KGVB 2EPDA 2CZ0B 2K4YA 2KYMA 3S3MA 3EGDB 1RAEB 4C5HA 2MYSA 4HCCA 1OZ3A 4QVZA 3FC3A 1KC8C 4PNOA 4M77C 2K7AA 4MDWA 3OSSC 2MMPA 2QG9B 1E6HA 2AK5A 3VYGA 4PK4A 2VXEA 2KAFA 4LNPA 1VQPA 3CPWP 1B07A 2E12A 1JJ2A 3QSUA 3G7ZA 3X24B 2XHCA 1W2BA 3MCAB 3CQTA 1QW1A 3PMTA 4C92D 2R5AA 2KYBA 1ZUUA 1UJ0A 3BDUA 2ED1A 4PLLA 1QCFA 2WSCE 2KMTA 2E6NA 1JJ2P 4JJNK 1H92A 4OB1B 2LT4A 1W2BP 2EJGA 3QZ5B 3OYIA 2CSIA 2YXYA 1ZBXA 2DL4A 4KH1B 1M1KR 4J9EA 4M7DG 1VQNT 1N6AA 3EG0A 2QQRA 1OI1A 3M56A 4J9DA 4E6RA 3CCLT 3DKMA 2BE9B 2K2VA 4KUIA 1YITA 1LVKA 2J05A 5GMKj 2M1HA 3DB3A 2BZXA 4ELZC 2K9GA 1R8OB 3E9GA 4X9CA 1MMAA 4M7AE 2DVEA 2H3JA 2EQMA 1KJWA 1UJYA 3F70A 2FZKB 3UF4A 2OAUA 4C8QG 3M54A 2EKHA 3A1PA 1H641 2FB7A 3PFSA 8ATCB 1D3BA 2HKNA 1PC0A 1Q86R 4DQ2A 1X6BA 2PZ1A 1K9MU 1I5LA 1IHWA 4J7IA 4OB0B 4R0KA 5GAN4 1RADB 1HYOA 4C5IA 1KQ1A 3CXCA 3LX7A 3M4YA 1VQPQ 2OJ2A 2CP6A 4WCIA 2RO0A 4QT7A 2EAYA 3GLXA 4DEYA 3PE0A 2YUPA 2D0NA 4MMKA 1Y96B 3T9NA 3RMQA 1GFCA 3MPUB 2E10A 3CXCP 1I5OB 2AKKA 1T0JA 4E7KA 3MEUA 3CCEA 4A63B 1MMNA 3FRNA 2AZSA 2CGHA 3RNJA 1ZSZC 4E7LA 3HPWA 2FRWA 4M7AD 2J6OA 4L5GA 4HA8A 2VUBA 3RIRA 5GANj 2LCSA 3SWNC 2SEMA 4BI3A 4UC4A 2CDTA 3OS5A 2KRNA 4JLIA 4C0FA 4D8KA 1YJ9A 5KYUB 4C0GA 2P0PA 1YITQ 1ZUYA 5GANd 3EFOA 1WFWA 4L59A 1SPKA 1I4K1 1AT1B 4IUPA 5FU6C 2VVKA 1D1AA 3H8ZA 4B6MA 2ZZDA 3UATA 2W0ZA 1ZLMA 1VQ4T 2XKOC 3H0IA 5A0LA 2KNBB 4Z8AA 3EG2A 1AZEA 1VA7A 2P4RA 2JVVA 2ED0A 2RI5A 5HCKA 1TG0A 1WQWA 1M9SA 2F2WA 1JRIA 3UA6A 3CC2A 5D6WA 4FL6A 5D6XA 3SWNA 2D8HA 1T3SA 4LE9A 2DETA 3KUFA 1Y71A 4RTXA 2HBWA 2EQJA 1PD1A 1M1KU 4J9IA 4OP0A 1RAIB 3OYKA 1YWOA 1RAHB 3EFRA 5KYXA 3CCEQ 4M7DC 3OBYA 1YP5A 4FSXA 3HFOA 1AEYA 1TWBA 2VV5A 2EGCA 1Q81R 3CBOA 2DTOA 3VU3C 2JM8A 1VQMT 2BUDA 2CKKA 1Y0MA 2RQTA 2CYZB 4MMLA 3MO8A 1ZA1B 1EFNA 1YJ9Q 4LN2A 1WNLA 4IUVA 4C8QC 1D0YA 1WHGA 3CCJT 1Q86U 1BCOA 3JCMJ 5GAMg 3A5ZB 4EMHA 1HSQA 2CUBA 5M9OA 2CT4A 1I07A 4FYWB 1YFNA 3FJPA 5I22A 3DLMA 4EMKB 3LH0A 1KFZA 1RLQC 2J06A 2MCNA 2X51A 3S3NA 2B8AA 1MGQA 5GMKl 1QVGA 3CC2Q 2XMFA 3CMAA 3BDLA 3JCMc 1WJSA 2DTHA 2RJEA 1UGQB 1N27A 1KD1R 2D9TA 4C8QA 2MWOA 3TSWA 1NE8A 4F14A 5CKFA 1QVGP 3UDCA 3OYEA 3PIPA 1VQ6T 2YRDA 1RAAB 3RKYA 3EG1A 3MJXA 1QMCA 2VWFA 4HCKA 5GMKh 3PT9A 3QIIA 3CCMT 4LD9K 1VQ5T 3JCMb 4PJOE 5ECAA 4MZPA 3CC7A 5EG2A 4A4FA 1M3BA 3SB2A 3KXTA 3CCRT 2FEIA 2DAQA 2HQHA 4JRIA 2KDSA 1HK9A 3P8BB 1Z9ZA 1BI2A 1K8AC 1OOTA 2DA9A 4C0DB 4HT9A 2JTEA 3OMCA 1VQOT 2K5LA 2DEQA 2GQIA 1QVFP 1GCQC 1GXIE 1I8FA 2ZPEB 2AT1B 1M8VA 2JTFA 2Y90A 3QO3A 3CMAQ 2V8IA 2DLPA 2QTXA 3GP8A 2DJQA 2KRSA 2OTLT 2M9UA 2DF6A 1Y07A 4AT1B 1QLYA 2PVOB 1I1JA 1Q81U 2K3BA 1YCSB 2LDMA 2K2MA 1NJIR 5IHKA 3H41A 1WI7A 2C06A 2DVJA 3EG9B 1U3OA 1PCXA 2L3QA 4QQDA 5GANh 3G71T 1DJ7B 4PJOD 4BE2A 4M78E 1R77A 5GAOn 4C92F 4ZGJB 5KYYA 2KI7A 4F7UE 1GFDA 1YIJA 5I21A 1WJRA 3I9QA 2FG0A 1TU0B 2DXCA 1BB9A 4AFUC 5GAMj 4M75G 1GCQA 2QK0A 3TREA 5KYNA 4JLGA 2LT1A 5CVIA 3CCUA 4XTVA 2JUFA 5CK9A 4BACA 4E7JA 2DPPB 2PTKA 1ZUKA 3CC7Q 5GAMd 3PGGA 1VUBA 2DL3A 1IB8A 1XQHA 4A4GA 2GQVA 2LNVA 2MF2A 2QA4Q 3O8VA 3GNGA 4AFSC 1G3TA 1M27C 1M2VA 3JCMd 2O4XB 2KVQG 5FU7C 2R57A 4HT8A 1KQSS 4FU6A 2YLBA 3RR6A 1FX7A 2VC8A 3L1AA 1WHMA 3CMEQ 4M78D 2QYZA 4EMGA 1MNEA 2F5TX 5LJ3g 4XU3A 4FT2A 2EJ9A 1BCMA 3KFVA 3V7CA 4KGXB 2E41A 1NLPC 2EW3A 4FIBA 2PQWA 1KC8R 2CP2A 2KXDA 1AWJA 3M5AA 5FROA 4PJOA 2KROA 1YI2A 3OYLA 2DILA 1YIJQ 2RA2A 4F17A 1SG5A 2A36A 4BB7A 1YCYA 1GBQA 4M77E 1NZ9A 2HD0A 2COWA 2X4XA 2COYA 1ABQA 1M8MA 5GANf 3CCUQ 1YNZA 3QHSA 4KT0E 2AHJB 1KQSA 4J9FA 1K1ZA 2LC4A 3CD6T 2KBTA 4M7AF 1IZ6A 4DA4A 1VQLT 3JB9G 3RKXA 4KUDK 2QASA 3JAME 2GGRA 1NYGA 1M5Q1 2DL7A
chains in the Genus database with same CATH topology
1JB0E 4C5GA 3M4GA 1R8OB 3E9GA 3CCET 3OS0A 1I81A 4X9CA 4M7AE 3OYNA 2DVEA 2ZPGB 2H3JA 2EQMA 3RERA 3CPWS 3F70A 1OYXA 3CPFA 4P5NA 5KH6A 2DD5A 4RKUE 2OAUA 4N0AC 4C8QG 4ZN1A 4XTYA 4V2SA 3M54A 3NTIA 4NOYA 3WVDB 5GMKi 4IURA 4C92B 1VQ7T 3HHTB 1H641 3R6OA 2FB7A 3PFSA 4LDUA 5GAN7 4N4GA 1Q82U 4M7AA 2DIQA 1D3BA 3GPLA 1Q7YU 4Q5WA 4XTXA 1NJIU 2RB6A 2DIGA 3C12A 4DQ2A 3FEOA 1V29B 1K9MU 3DB4A 2YRVA 1SSFA 1I5LA 3OA6A 3HP9A 4J7IA 4OB0B 2KSSA 5GAN4 4M78A 3TU4K 1YJ9T 4C5IA 3MEVA 1KQ1A 2L8DA 3LX7A 3CXCA 3WVEB 3JSCA 5GAN2 3M59A 1RI0A 3M4YA 4A54A 1N9SA 3OY9A 2DJZA 2M16A 4F7UA 1S72T 1JJ2S 3QJ6A 4OGCA 3CC4A 4EMKC 2RO0A 3OYAA 2QQBA 2EAYA 4M77D 3GLXA 1M90C 3KBGA 4XTWA 1HXDA 3V8JA 1O75A 2G3RA 1VQNA 5LJ3h 2E65A 3NFCA 1BKBA 4DOWA 4XAXB 5CQYA 4MMKA 1Y96B 3CCLA 1VQLA 3BW1A 3T9NA 3RMQA 4M75C 2E10A 1WJQA 1P92A 4XTUA 1VQ9T 1KD1C 5GAOm 3JCMg 3OYBA 3I55T 2XIDA 4E7KA 4VUBA 4XQ3A 3MEUA 5IAYA 3CCEA 2XDBA 4PJOG 3FRNA 4N0AA 2CGHA 2PVDB 3NTHA 4L6V5 1ZHIA 2LQ8A 2RJDA 3JCMP 4R56A 2RJCA 3CPWA 4E7LA 2MWPA 3HPWA 5LL6S 2FYKA 3UPUA 1VQ7A 3CC2T 4M7AD 2ZGWA 3RKWA 5KE3A 4L5GA 4HA8A 2VUBA 3VJPA 3RIRA 5GANj 4Y91A 3FLGA 2RHIA 3OYJA 4A4EA 1M1GA 3CCUA 3SWNC 4JS4A 4J6XA 4BI3A 4UC4A 2R58A 3OS5A 4JLIA 4C0FA 2VXFA 2DZ9A 4BE0A 3JCMW 1YJ9A 4C0GA 1LJOA 5FU7B 2P0PA 4N4HA 3X25B 1S72A 5LJ5j 5GANd 5CIUA 2L89A 5CAIA 3LWIA 4BE1A 3I56T 1YJNT 3A8MB 4M75E 4L59A 2RHYA 2DK3A 3SFMA 1I4K1 1G3SA 4BI8B 4IUPA 3OYGA 5FU6C 3QG1A 3JB9I 4M77B 2X4WA 2RHUA 3H8ZA 3ME9A 3TEEA 2ZZDA 3J81E 1XNIA 2LRQA 2XKOC 4M75A 4B9WA 5LJ5d 1VQ4T 1U8RA 2QDYB 3V8KA 5A0LA 3CCST 2JNGA 1U1SA 3OMGA 5GAN8 4XU2A 1UGPB 3LGFA 4IUTA 4A4KA 1VQ9A 2DKGA 3HRSA 3G4ST 3I55A 3LYIA 3EAEA 5CKHA 1IREB 4X34A 2JVVA 3N5BB 2RI5A 3CXCS 1KC8U 5DM7R 3JCMV 4BUGA 1WQWA 1M9SA 3QYGB 1JRIA 1G3WA 3M9QA 4J6WA 3V7RA 3GOXA 3CC2A 2K5FA 5D6WA 3M55A 4FL6A 4M78G 5D6XA 3L2QA 4M7AB 3SWNA 5CO7A 5L8RE 4C0DC 1D3BB 4M77A 3OW2S 2KK4A 2XK0A 5GAN6 4F7UG 4II1A 2QA4A 4NS5A 3AHUA 3KUFA 1Y71A 2EIFA 2P4TA 2F5KA 2DXUA 2RH2A 4BDYA 5LJ5f 3CEYA 3EFSA 4J5YA 4NL2A 4ZTJA 2EQJA 4ATOA 2E70A 1M1KU 1BIAA 1YJNA 4F7UB 3M57A 4OP0A 3OYKA 1BIBA 2RM4A 4C92G 1K73C 1Q82C 3EFRA 4M7DC 3OBYA 2EKOA 1NJIC 3QZ9B 4FSXA 3OBWA 3HFOA 2DXTA 1K9MC 5LJ3f 4QW2A 5GAMe 1BI1A 2LTOA 2DTIA 2QQ9A 2VV5A 4M75D 4BY6B 3OYDA 3CBOA 5I2MA 3CMEA 2DTOA 4JRQA 3VU3C 1VQ4A 1VQMT 1K8AU 2BUDA 3CCSA 2CKKA 2JTMA 3V8LA 3CMAT 5FRMA 4Y28E 1XTDA 4HCZA 2CYZB 3G4SA 4IKFA 4MMLA 3MO8A 3ZEHA 2QXFA 3C95A 4YTLA 1VIFA 5CKEA 2XU8A 3CCVT 5IN1A 1OZ2A 1QP3A 1AHJB 3JCMe 4M7DF 1WNLA 3HRUA 4IUVA 1VIEA 4GY5A 4RCBA 4C8QC 4D6WA 1UGSB 2GCXA 2RK1A 3CCJT 1Q86U 3OQ5A 2BIVA 3JCMJ 4HCBA 5GAMg 3A5ZB 2RHZA 1TH7A 4EMHA 3JB9F 5M9OA 3NTKA 5A0DA 4RCCA 4M7DE 3OW2A 3INZA 4ELYC 2I2LA 4OF1A 1M4ZA 2DZCA 1O9SA 3FJPA 3L2ZA 3QUIA 2QQSA 3META 5GANe 3DLMA 4QQGA 4MZMA 4EMKB 3LH0A 4C8QF 1VQ8T 1KHIA 4ME7A 4Z02A 4C5EA 2X4YA 2P0KA 3M58A 4JRKA 2GFUA 3BFMA 4PLIA 3SD4A 2X35A 1VQKT 3S3NA 3FDRA 2B8AA 1MGQA 5GMKl 4ZN3A 1QVGA 2CZ1B 1JBMA 4M75B 1VQMA 3CC7T 4J7FA 4C8QE 3MP1A 3CMAA 4CRIA 2OTJT 3BDLA 3JCMc 3GIBA 1WJSA 1YBYA 2DTHA 2ZPFB 2RJEA 1UGQB 2K57A 1N27A 4JRPA 5CKBA 2JN0A 4LDYA 1VQOA 2D9TA 4PJOC 1KHCA 4RG2A 4C8QA 5GANg 2MWOA 2QA4T 1UB4A 3CCVA 1NE8A 2PVGB 3QXEB 2E5QA 3HSBA 4M77G 1BYMA 4JS5A 1YJWT 4QVDA 4EMKA 5CKFA 1N8RU 3E19A 4ZGEB 3PNWC 5C0MA 3UDCA 3PTAA 3CCJA 2K3YA 4XK8E 1KD1U 3QYHB 2M0OA 5LJ5g 3OYEA 4J83A 3SWNB 3PIPA 1M1FA 2MAMA 3CCQT 1VQ6T 5J39A 1PSFA 5LJ3j 3CMET 4X9DA 3RKYA 4PJOF 1PSEA 4WF2A 3MP8A 1MHNA 3RMSA 3J7AF 4M7DD 5GMKh 1VQ8A 2DXBA 2E1HA 3OB9A 3PT9A 3QIIA 5FU6B 1B34A 3CCMT 4LD9K 3ASKA 3JB9H 2RJFA 3X28B 2A3LA 4M7AG 5LJ3d 3JCMb 3JB9D 1VQ5T 3A8LB 1VQKA 1WQ7A 3LGLA 4JUVA 2WACA 4PJOE 1U1TA 4MZPA 1X75C 2O4XA 5GMKe 3CC7A 5EG2A 4IUUA 4A4FA 3KXTA 3SB2A 2OTJA 3CCRT 3GF5A 1M1KC 2XG8D 2XDPA 3HFNA 1Y7XA 5DLQE 4A4HA 3JCMQ 2DAQA 5CR2A 2RK2A 4C8QD 2NLUA 2CS7A 4JRIA 5GAOp 2KDSA 4J6YA 3S6WA 2QQAA 1YIJT 1HK9A 1BI0A 2LCLA 3LW5E 3P8BB 5GAMh 2RHXA 3JCMX 1YJWA 3LWHA 1G5VA 3HKSA 2IVWA 3QJYA 2HQEA 1BI2A 4MDXA 1K8AC 2L5QA 2GFAA 2FHDA 4M78C 1YHQT 1W2BS 4C0DB 4LDVA 4C0ZA 4HT9A 3M53A 3OMCA 4O5VA 2PU9B 4OMFB 1Q7YC 3A8GB 3CCUT 3CCQA 2K5LA 2DEQA 2P0QA 1VQOT 1KG1A 1QVGS 1VQ6A 4EPCA 1GXIE 2LQKA 4RMOA 1I8FA 1X01A 2ZPEB 2EWNA 1M8VA 3VUBA 2JTFA 2RI2A 1XOVA 2V8JA 2Y90A 3JCMh 4J8OA 2JZ2A 4DOVA 3QO3A 2V8IA 2MI6A 2JOYA 3GNFB 4OGEA 2X4JA 4B9XA 2EYQA 1QVPA 4LD6A 2XDDA 2QTXA 3E9FA 3GP8A 4C92C 5KCHA 3L2VA 1Q86C 2OTLT 2M9UA 3CCMA 4LDXA 4CI0C 4M7DB 1Y07A 3RUXA 4M78F 2PVOB 1VQ5A 3ZFJA 1W4SA 3QBYA 5HY6A 4HKEA 1Q81U 4XTZA 1NPPA 5A0GA 2LDMA 2QI2A 3X20B 2Y4XA 2ZPBB 4NL3A 4F7UF 3L2WA 4IUQA 3MEWA 3OYMA 2C06A 2EQUA 1FWZA 4LDWA 5DLOA 5GMKm 4EDUA 1NPRA 3CCRA 4QQDA 5GANh 3G71T 4PJOD 1DJ7B 3LLRA 4ZGDB 5GAOq 2EQKA 4M78E 3QPHA 4BE2A 1K73U 2K5IA 2IG0A 4JDSA 5GAOn 1RL2A 4C92F 4ZGJB 2D6FA 4F7UE 3VUZA 3S3OA 3WXMB 4C8QB 5I21A 1YIJA 2KY9A 1WJRA 4OB3B 3URGA 3Q1JA 2DXCA 2HNIA 2K3XA 2FVUA 5LJ5h 1UEBA 4KBMB 3HL8A 5CCAA 5GAMj 4M7DA 4BD3A 3TCJA 2ZPHB 4M75G 3G6ET 1VQPT 1YHQA 2QEXA 3PIOA 3TREA 3JB9J 4A53A 4JLGA 3UT1A 2LT1A 3A8OB 2YHTA 3C94A 4PL6A 5CVIA 4XTVA 1QP2A 3FIFA 2JUFA 2XICA 4C92E 3MHXA 5CK9A 1FXXA 5CKDA 2LX9A 4BACA 4E7JA 2DPPB 2VYTA 2XI9A 4TVRA 2RI3A 1ZQ1A 5LJ5e 2E6ZA 2L3RA 2O01E 3CD6A 2WSFE 3PMIA 2ZCFB 5HK0A 3SDZA 5GAN5 1LOJA 2ZPIB 1VUBA 3PGGA 5GAMd 1QVFS 4C92A 5HKCA 5C6SA 2D0QB 3E1SA 1XQHA 3RESA 4ZTFA 5AYFA 4A4GA 3QDRB 1N8RC 3P8DA 2GQVA 2R5MA 4XU0A 2LNVA 5KCOA 3L2RA 2OTLA 2MF2A 1YI2T 3HRTA 1G3YA 2V8KA 1M90U 3MEAA 1B34B 3CBMA 5LJ3e 3O8VA 5CQXA 3CBPA 2DO3A 3GNGA 2WSEE 1G3TA 1X6OA 3J80E 2A7YA 1UGRB 3JCMd 2RD1A 2DD4A 2KQWA 2BKDN 2O4XB 2KVQG 1BI3A 5FU7C 2R57A 4HT8A 2CZ0B 2GF7A 3G71A 2K4YA 1KQSS 5FLXE 5J3BA 3BY7A 4FU6A 2YLBA 3OS1A 4C5HA 3S3MA 5GAOr 4PJOB 1FX7A 2VC8A 2XD0A 4M75F 1EIFA 4HCCA 1LNXA 3L1AA 2LCCA 1OZ3A 4QVZA 4E7HA 3FC3A 3JRZA 1KC8C 4PNOA 4M77C 4O6JA 4M78D 4MDWA 1Y96A 4MZTA 3OSSC 2MMPA 4EMGA 3OS2A 3VYHB 2F5TX 5GAMf 5LJ3g 4OVAA 4QQ6A 5GAOl 1YITT 3OSVA 2EJFA 4GLKA 2VXEA 2KAFA 4XU3A 3VYGA 3G6EA 1VQPA 3OYFA 4FT2A 2EJ9A 4OB2B 2E12A 3ER0A 5D6YA 1JJ2A 1H3ZA 3A8HB 4E47A 3V7CA 3I56A 3G7ZA 3X24B 3QSUA 2VGNA 2XHCA 2E41A 1W2BA 3MCAB 4FT4A 3C4SA 3OYYA 4R55A 1QW1A 4FIBA 2PQWA 2YLCA 3PMTA 4C92D 2R5AA 3JCMf 3OYHA 5GAN3 5FRNA 4M77F 3M5AA 1QVFA 5FROA 3BDUA 4PJOA 1YI2A 4PLLA 2HAXA 4M7AC 3OYLA 2E64A 3FB9A 4XU1A 2WSCE 2VGMA 5A2QE 1WGSA 2F69A 2HBPA 2PUKB 2RA2A 2KMTA 2E6NA 4BI4A 4JJNK 4BB7A 4OB1B 1YCYA 3X26B 2LT4A 1KQ2A 3V7SA 4M77E 4E7IA 4FM4B 1NZ9A 2EJGA 3ZBDA 3OYCA 2HD0A 2CZ7B 3QZ5B 2QEXT 2X4XA 2HQXA 3H6ZA 3MP6A 5DY9A 2EFIA 5I2SA 3OYIA 5HK3A 3CC4T 5GANf 1ZBXA 3L42A 3QHSA 4KT0E 2AHJB 1KQSA 5KE2A 3DLLA 4M7DG 3UWNA 1N9RA 1N6AA 1VQNT 2LC4A 4KULA 1WPYA 4BDZA 1Q81C 3VV0A 3CD6T 4M7AF 5IT9E 1IZ6A 2QQRA 1OI1A 4DA4A 3M56A 3P8HA 3VKIA 4BY6C 3DKMA 3CCLT 2Y4YA 4M78B 3RKXA 3JB9G 1VQLT 3QKJA 4QVCA 2PUOB 2K2VA 4KUIA 4N4IA 2FL7A 2LVMA 4RG8A 3L2UA 1YITA 4KUDK 4PKCC 5J26A 3JAME 5GMKj 2M1HA 3DB3A 4ELZC 1M5Q1 2CZ6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 G;  3M4G A;  3JCM V;  3JB9 J;  1I81 A;  4A53 A;  4X9C A;  4M7A E;  2DVE A;  1WQW A;  2YHT A;  4C92 E;  3RER A;  4XTV A;  1JRI A;  3FIF A;  4J6W A;  3V7R A;  5GAM d;  5LJ5 g;  4N0A C;  4C8Q G;  3SWN B;  4M78 G;  4XTY A;  5LJ5 e;  4V2S A;  4M7A B;  4NOY A;  3SWN A;  5GMK i;  4C92 B;  5GAN 5;  1D3B B;  1H64 1;  1LOJ A;  2FB7 A;  3PGG A;  4M77 A;  4C92 A;  5GAN 6;  5LJ3 j;  4F7U G;  5GAN 7;  1D3B A;  4X9D A;  3RKY A;  3RES A;  4PJO F;  4XTX A;  3AHU A;  2RB6 A;  4DQ2 A;  4XU0 A;  4WF2 A;  1I5L A;  4M7D D;  2DXU A;  5GMK h;  1B34 B;  5LJ5 f;  4J5Y A;  3EFS A;  4NL2 A;  2E1H A;  5LJ3 e;  4M78 A;  5GAN 4;  1B34 A;  3JB9 H;  1BIA A;  1KQ1 A;  4F7U B;  4OP0 A;  5GAN 2;  4M7A G;  1BIB A;  2RM4 A;  5LJ3 d;  4A54 A;  1N9S A;  4C92 G;  2DJZ A;  4F7U A;  3JCM b;  1WQ7 A;  3JB9 D;  3JCM d;  3EFR A;  4JUV A;  4M7D C;  2RD1 A;  4PJO E;  1U1T A;  4EMK C;  2EAY A;  2DXT A;  3HFO A;  4M77 D;  5LJ3 f;  5GMK e;  4XTW A;  5GAM e;  1HXD A;  3V8J A;  4M75 D;  2DTI A;  3BY7 A;  2E65 A;  5LJ3 h;  3SB2 A;  2YLB A;  5GAO r;  4PJO B;  2DTO A;  3VU3 C;  2VC8 A;  3HFN A;  4M75 F;  3V8L A;  1LNX A;  3L1A A;  4MMK A;  3JCM Q;  1Y96 B;  3BW1 A;  4PNO A;  4C8Q D;  4M77 C;  4JRI A;  4M78 D;  5GAO p;  1Y96 A;  4EMG A;  4M75 C;  2E10 A;  4J6Y A;  4MML A;  5GAM f;  4XTU A;  1HK9 A;  5LJ3 g;  5GAM h;  5GAO m;  3JCM g;  3JCM X;  5GAO l;  2EJF A;  4XU3 A;  2VXE A;  3JCM e;  4XQ3 A;  4M7D F;  1WNL A;  4RCB A;  2EJ9 A;  4PJO G;  4C8Q C;  4M78 C;  4N0A A;  2CGH A;  4M7D A;  4HT9 A;  4QVD A;  3V7C A;  3QSU A;  3JCM P;  2E41 A;  3JCM J;  2DEQ A;  3JB9 F;  5GAM g;  4EMH A;  4HT8 A;  1TH7 A;  2FYK A;  2YLC A;  4M7A D;  1I8F A;  2ZGW A;  1X01 A;  3RKW A;  2EWN A;  4C92 D;  3JCM f;  4HA8 A;  1M8V A;  5GAN 3;  3RIR A;  5GAN j;  2Y90 A;  4M77 F;  4RCC A;  3JCM h;  4Y91 A;  4M7D E;  3INZ A;  3BDU A;  4PJO A;  3QO3 A;  2I2L A;  3SWN C;  2DZC A;  4J6X A;  4M7A C;  2QTX A;  3FJP A;  2E64 A;  3FB9 A;  3L2Z A;  3QUI A;  2VXF A;  2DZ9 A;  4JLI A;  4XU1 A;  4C92 C;  5GAN e;  3JCM W;  4M7D B;  2RA2 A;  4EMK B;  4C8Q F;  1LJO A;  3RUX A;  4M78 F;  1YCY A;  5LJ5 j;  1KQ2 A;  4XTZ A;  5GAN d;  5CAI A;  3V7S A;  4M77 E;  4NL3 A;  2EJG A;  4JRK A;  4M75 E;  3BFM A;  4F7U F;  1I4K 1;  5DY9 A;  5GAN f;  1MGQ A;  3JB9 I;  3QHS A;  4M77 B;  5GMK l;  5GMK m;  5GAN h;  4M7A A;  1JBM A;  4M75 B;  5GAO q;  4PJO D;  4C8Q E;  4M7D G;  1N9R A;  4M78 E;  4M75 A;  3JCM c;  5LJ5 d;  3GIB A;  1WPY A;  2DTH A;  5GAO n;  3V8K A;  4M7A F;  4C92 F;  1U1S A;  2K57 A;  4F7U E;  2JN0 A;  4C8Q B;  4XU2 A;  5I21 A;  5GAN 8;  4M78 B;  3RKX A;  3JB9 G;  2DKG A;  4QVC A;  4PJO C;  4C8Q A;  5GAN g;  2HNI A;  5LJ5 h;  3HSB A;  5GMK j;  4M77 G;  5GAM j;  1M5Q 1;  4EMK A; 
#chains in the Genus database with same CATH topology
 3CPW S;  4FYX B;  3CPF A;  2DD5 A;  4ZN1 A;  3VS4 A;  1QQJ A;  4LUD A;  3NTI A;  1D1B A;  4C92 B;  1VQ7 T;  3G1J A;  3R6O A;  4WTO B;  1UFF A;  4Q5W A;  1NJI U;  2RB6 A;  3FEO A;  1WXT A;  2YRV A;  1SSF A;  3OA6 A;  2KSS A;  4M78 A;  1RI0 A;  4A54 A;  2M16 A;  4F7U A;  1JJ2 S;  3CC4 A;  4AFQ C;  2QQB A;  4M77 D;  3KBG A;  4XTW A;  2G3R A;  1EZZ B;  2E65 A;  4DOW A;  5CQY A;  2HSE B;  4M75 C;  2E4H A;  1YI2 Q;  1VQ9 T;  1PRM C;  3OYB A;  3I55 T;  2XID A;  1G8X A;  2XDB A;  2VAS A;  2O9V A;  2PVD B;  3NTH A;  4L6V 5;  1PWT A;  4R56 A;  3CPW A;  2MWP A;  3OW2 P;  2COZ A;  5LL6 S;  2E3H A;  2ZGW A;  4RTY A;  4EIK A;  1TUG B;  3VJP A;  1N8R R;  4PJM A;  1K0X A;  2M02 A;  4JS4 A;  1WA7 A;  4J6X A;  2DYB A;  1S72 A;  2RQU A;  5LJ5 j;  2DNU A;  4BE1 A;  3I56 T;  2RHY A;  2JS0 A;  1G3S A;  1PG5 B;  2RQR A;  3TEE A;  3RBB B;  3J81 E;  2ROL A;  4M75 A;  2ATC B;  5LJ5 d;  3CCS T;  1U1S A;  2DE0 X;  2SRC A;  4A4K A;  3HRS A;  3G4S T;  2AIR B;  1FYN A;  3N5B B;  3CXC S;  5KYX B;  1EX4 A;  1KC8 U;  3JCM V;  4PFZ A;  3QYG B;  1G3W A;  2QEX Q;  2K5F A;  3CC4 Q;  3M55 A;  2MK5 A;  4KRT A;  3L2Q A;  4J9C A;  4M7A B;  3H0F A;  5CO7 A;  4M77 A;  2KK4 A;  2LMJ A;  4II1 A;  1AWX A;  2P4T A;  2GBQ A;  2DXU A;  2RH2 A;  4BDY A;  4ZTJ A;  3EFS A;  4ATO A;  1ARK A;  5FWC A;  1YJN A;  1BIB A;  1K73 C;  3HTR A;  3M0T A;  1ZX6 A;  1GCP A;  4JZ3 A;  1K9M C;  2C0T A;  4FCY A;  1BI1 A;  2LTO A;  4BY6 B;  3OYD A;  1M2O A;  1UUE A;  3V8L A;  2JTM A;  4FYV B;  5FW9 A;  1XTD A;  2HL5 C;  5IXB A;  3C95 A;  5CKE A;  1QP3 A;  1AHJ B;  2EVR A;  3HRU A;  2EYZ A;  4RCB A;  4D6W A;  1S72 Q;  1D0X A;  3OQ5 A;  7AT1 B;  1TH7 A;  3SEM A;  2GTO A;  2BZY A;  2ECZ A;  4RCC A;  4M7D E;  3INZ A;  2I2L A;  1M4Z A;  3QUI A;  1AD5 A;  2DYI A;  2YWW A;  5GAN e;  2YSQ A;  1IGU A;  2K6D A;  1VQ8 T;  2OAW A;  4ME7 A;  4Z02 A;  4C5E A;  2X4Y A;  3M0Q A;  2GNC A;  2H3E B;  4JRK A;  3BFM A;  1UHC A;  1M90 R;  1QKX A;  4ZN3 A;  2FPD A;  1JBM A;  2NUT B;  4C8Q E;  4CRI A;  2ZPF B;  4AFZ C;  2JXB A;  5CKB A;  1TXQ A;  1KHC A;  1UB4 A;  3CCV A;  1C6V X;  1NM7 A;  3HSB A;  1YJW T;  4QVD A;  1UGV A;  3EGX A;  2O9S A;  1TUC A;  1N8R U;  3E19 A;  4ZGE B;  3PNW C;  5C0M A;  1YJN Q;  4OMO A;  1K76 A;  3EHR A;  4J83 A;  2RQV A;  2CT3 A;  1PSF A;  3VS3 A;  4X9D A;  4PJO F;  2BE7 D;  2J7I A;  1MMG A;  4WF2 A;  1YWP A;  3RMS A;  4M7D D;  3M0U A;  3ASK A;  1KSW A;  1VYV A;  2KE9 A;  4ZNX A;  1VQK A;  1ZSZ A;  1N5Z A;  1WXB A;  4IUU A;  2B86 A;  2V26 A;  1NG2 A;  2OTJ A;  2NYS A;  2NUZ A;  2Z0W A;  2KT8 A;  1M1K C;  3HFN A;  5DLQ E;  4ESR A;  2RK2 A;  4C8Q D;  1AWW A;  1B7T A;  4J6Y A;  2EBP A;  2QQA A;  1XJW B;  3LW5 E;  1G5V A;  2VKN A;  2HQE A;  1D09 B;  1D0Z A;  2FHD A;  1R0B G;  1U5S A;  2A28 A;  3M53 A;  1Q7Y C;  2PU9 B;  3CCQ A;  1KG1 A;  2P0Q A;  3C0C A;  1QVG S;  4RMO A;  4IIO A;  2YT6 A;  5KYY B;  4J8O A;  5KCH A;  1Q86 C;  4LDX A;  3O5Z A;  4M78 F;  3CCV Q;  1RUW A;  3QBY A;  5HY6 A;  1Q82 R;  4XTZ A;  1NPP A;  2QI2 A;  1K9A A;  4NL3 A;  4F7U F;  3L2W A;  1C0M A;  3OYM A;  4GLM A;  2X9H A;  1FWZ A;  1IRX A;  1I0C A;  3THK A;  1LPL A;  2C0I A;  1BBZ A;  2K5I A;  2IG0 A;  1RL2 A;  3WXM B;  1QCN A;  4OB3 B;  2K3X A;  5LJ5 h;  1AWO A;  1M2V B;  4M7D A;  4BD3 A;  2ZPH B;  1YHQ A;  1VQP T;  3PIO A;  1SRM A;  3UT1 A;  2HCK A;  1VQK Q;  4JJD A;  1RAB B;  4TVR A;  1ZQ1 A;  3LH5 A;  3CD6 A;  4PJL A;  2ZCF B;  1UHF A;  5HK0 A;  2ZPI B;  1QVF S;  2OTJ Q;  5C6S A;  2CP7 A;  2D0Q B;  5AYF A;  2R5M A;  2JMC A;  1M90 U;  3QDF A;  1B34 B;  2FPE A;  2DO3 A;  5D7U A;  1SHF A;  1UGR B;  2RD1 A;  3EH2 A;  2BKD N;  2GF7 A;  2MOX A;  3M0R A;  3CCQ Q;  2CP3 A;  4PJO B;  2XD0 A;  3TSZ A;  4M75 F;  1LNX A;  3JRZ A;  4O6J A;  2DBK A;  1Y96 A;  2RN8 A;  3UA7 A;  3VYH B;  2HDA A;  4OVA A;  4QQ6 A;  4ANJ A;  1YIT T;  4GBQ A;  3OSV A;  4GLK A;  3G6E A;  4DBF A;  2CUD A;  3ER0 A;  5D6Y A;  4E47 A;  1OEB A;  2VGN A;  4E7Z A;  3C4S A;  3OYY A;  4R55 A;  2E5K A;  1BU1 A;  2YLC A;  4Y92 A;  3TQ7 P;  3OYH A;  5GAN 3;  1NEG A;  5FRN A;  4M77 F;  1QVF A;  2LP5 A;  1Q95 G;  2VGM A;  4FYY B;  2HBP A;  2F69 A;  2PUK B;  5A2Q E;  4BI4 A;  5KYU A;  1KQ2 A;  4E7I A;  3ZBD A;  1YHQ Q;  1E7O A;  5HK3 A;  2OX7 A;  3ULR B;  5KE2 A;  1T0H A;  2EGA A;  1N9R A;  4KUL A;  1Q81 C;  1JEG A;  3VV0 A;  3P8H A;  3VKI A;  2Y4Y A;  4M78 B;  3QKJ A;  4QVC A;  4RG8 A;  2FL7 A;  1AZG B;  2LVM A;  2X3W D;  4PKC C;  3I56 A;  4RTZ A;  4CC4 B;  4FSS A;  2LQW A;  5KYW B;  4HVW A;  3CCE T;  1I81 A;  3RER A;  4CC7 A;  4P5N A;  5KH6 A;  8AT1 B;  4RUG A;  4XTY A;  3GBQ A;  4V2S A;  4NOY A;  3NPF A;  3HHT B;  4X1V A;  5GAN 7;  1Q82 U;  3GPL A;  4XTX A;  2FO0 A;  3C12 A;  1MMD A;  1V29 B;  1YJ9 T;  3MEV A;  1TS9 A;  3VS1 A;  2L8D A;  3WVE B;  3JSC A;  5GAN 2;  3OY9 A;  2DJZ A;  3G6E Q;  3QJ6 A;  4OGC A;  4EMK C;  3H9N A;  3OYA A;  1AVZ C;  1HXD A;  2GTJ A;  3V8J A;  1VQN A;  1BKB A;  3CCL A;  1JXM A;  3BW1 A;  1WJQ A;  1P92 A;  4XTU A;  1KD1 C;  5GAO m;  2DER A;  4OMP A;  1G2B A;  1W6X A;  4VUB A;  5IAY A;  2I0N A;  2J6K A;  2JW4 A;  2F2X A;  1ZHI A;  2LQ8 A;  2RJD A;  3JCM P;  1SEM A;  2RJC A;  1X69 A;  1PM3 A;  1OUL A;  4RTW A;  3UPU A;  3CC2 T;  1ACM B;  2RMO A;  2RHI A;  2NUP A;  5AT1 B;  3I35 A;  2JM9 A;  4J9B A;  2R58 A;  2DZ9 A;  1IHV A;  1GL5 A;  2JS2 A;  1AOJ A;  4N4H A;  3X25 B;  1RAC B;  1TOV A;  3A8M B;  4M75 E;  3SFM A;  2FZG B;  4BI8 B;  3OYG A;  1WIE A;  3QG1 A;  3JB9 I;  2KEA A;  4M77 B;  2HL3 A;  2K79 A;  4J9H A;  2LRQ A;  1U8R A;  4E7S A;  3V8K A;  2JNG A;  4PFP A;  6AT1 B;  2QDL A;  1UGP B;  4IUT A;  4OMM A;  4XU2 A;  2JMA A;  1E6G A;  2V1R A;  1X2K A;  3LYI A;  3EAE A;  4X34 A;  3VS2 A;  3VS5 A;  1OQK A;  3M9Q A;  4J6W A;  3GOX A;  2FPF A;  2LJ0 A;  1BK2 A;  1Y57 A;  5L8R E;  4C0D C;  1D3B B;  3OW2 S;  1VQN Q;  2XK0 A;  4DEX A;  5GAN 6;  1SHG A;  4NS5 A;  1K4U S;  4RTU A;  2EIF A;  3CCL Q;  2F5K A;  4KH0 B;  1M30 A;  4NL2 A;  1BIA A;  1UEC A;  3M57 A;  2A0F B;  2RM4 A;  4C92 G;  2KRM A;  4Z89 A;  3PVQ A;  2EKO A;  2DL5 A;  1ZBJ A;  1NJI C;  3QZ9 B;  1TSF A;  4QW2 A;  4M75 D;  2DTI A;  2QQ9 A;  1VQ4 A;  5I2M A;  1M3A A;  1W70 A;  3CMA T;  1ZA2 B;  5FRM A;  4Y28 E;  1SSH A;  4HCZ A;  2QTV A;  1PHT A;  4IKF A;  1MUZ A;  1UDL A;  4FW1 A;  2XU8 A;  1K73 R;  1OZ2 A;  1KK7 A;  4M7D F;  1VIE A;  4GY5 A;  2RK1 A;  2KR3 A;  2YUQ A;  3NTK A;  5A0D A;  3OW2 A;  2DZC A;  1O9S A;  1R0C B;  2QGG A;  4MZM A;  4C8Q F;  4PJN A;  1KHI A;  1RAF B;  3EFO B;  3M0P A;  1VOM A;  4PJJ A;  1TUD A;  4PLI A;  2GFU A;  2PNI A;  2X35 A;  1FMW A;  3FDR A;  2CZ1 B;  3EG9 A;  3CC7 T;  5EC7 A;  1VQM A;  4J7F A;  3MP1 A;  3NHN A;  3GIB A;  1YBY A;  2DX1 A;  2K57 A;  4JRP A;  3VS0 A;  4LDY A;  2P84 A;  2KT1 A;  4RG2 A;  2QA4 T;  5GAN g;  1WYX A;  2RF0 A;  1ZSZ B;  1BYM A;  4JS5 A;  3PTA A;  3CCJ A;  3I5S A;  3SWN B;  1M1F A;  2A08 A;  1JU5 C;  5LJ3 j;  3CME T;  1VQ4 Q;  1S1N A;  1PSE A;  3MP8 A;  3J7A F;  1KIK A;  2DXB A;  2E1H A;  3OB9 A;  5FU6 B;  3JB9 H;  3X28 B;  2A3L A;  4M7A G;  5LJ3 d;  3JB9 D;  3D7S B;  3A8L B;  1WQ7 A;  3LGL A;  1OV3 A;  1U1T A;  2CRE A;  3U23 A;  1B3Q A;  2HZY A;  1X75 C;  2FRY A;  2O4X A;  5GMK e;  2YUN A;  2XG8 D;  1Y7X A;  4A4H A;  5GAO p;  3SHW A;  3MKD A;  2IIM A;  3S6W A;  1YIJ T;  2LCL A;  5GAM h;  2RHX A;  4JJC A;  3JCM X;  2IVW A;  5IXF A;  4MDX A;  2L5Q A;  3QWX X;  1X27 A;  5IHI A;  4O5V A;  4OMF B;  2L2P A;  2OI3 A;  3A8G B;  3CCU T;  1VQ6 A;  2ZAE A;  2A37 A;  4EPC A;  2EYX A;  1X01 A;  4ORZ A;  3VUB A;  2LX7 A;  4LUE A;  1XOV A;  2V8J A;  3JCM h;  1VQM Q;  4DOV A;  2JOY A;  2X4J A;  2XDD A;  3REA B;  4C92 C;  4M7D B;  3CCM A;  4CI0 C;  3RUX A;  1X6G A;  1VQ5 A;  3ZFJ A;  4HKE A;  1Q7Y R;  2Y4X A;  2ZPB B;  1OX8 A;  2DL8 A;  1NBE B;  4Z88 A;  3CCJ Q;  5DLO A;  3CCR A;  4HVU A;  2C0O A;  1K73 U;  2M51 A;  2D6F A;  2DM1 A;  4C8Q B;  2KY9 A;  3URG A;  2HNI A;  2FVU A;  1UEB A;  4KBM B;  4PFO A;  3HL8 A;  1OPL A;  5CCA A;  1JO8 A;  3TCJ A;  1CSK A;  4A53 A;  3A8O B;  2YHT A;  4PL6 A;  1VQO A;  1QP2 A;  3FIF A;  5CKD A;  3MHX A;  2XI9 A;  2L0A A;  2E6Z A;  2L3R A;  2WSF E;  3PMI A;  1LOJ A;  2AZV A;  1H8K A;  1K0S A;  4C92 A;  3TVT A;  3E1S A;  3RES A;  4ZTF A;  1N8R C;  3QDR B;  5KCO A;  2OTL A;  1YI2 T;  2KXC A;  4CC3 A;  3HRT A;  4M4Z A;  2KGT A;  5CQX A;  1X6O A;  2A7Y A;  1UE9 A;  1WDX A;  1RAG B;  2DD4 A;  2KQW A;  4KGZ B;  2LQN A;  1BI3 A;  3G71 A;  5FLX E;  5J3B A;  3BY7 A;  3OS1 A;  5GAO r;  1VQ6 Q;  1EIF A;  2LJ3 A;  2CP5 A;  2LCC A;  4E7H A;  5FWB A;  3EH1 A;  1LCK A;  2J6F A;  3OS2 A;  4MZT A;  1WLP B;  5GAM f;  5GAO l;  2EJF A;  2YDL A;  3CCM Q;  3OYF A;  4OB2 B;  2RQW A;  1VQ5 Q;  1H3Z A;  3A8H B;  2O88 A;  4CC2 A;  4FT4 A;  4DBR A;  4DBQ A;  3EHQ A;  3JCM f;  1H3H A;  3CCR Q;  2HKQ B;  3EGD A;  1MND A;  2HAX A;  4M7A C;  2E64 A;  3FB9 A;  4XU1 A;  5IHN A;  1WGS A;  1X43 A;  3X26 B;  3V7S A;  1NYF A;  4FM4 B;  3OYC A;  1HJD A;  2CZ7 B;  3TU4 K;  2QEX T;  3MP6 A;  2HQX A;  3H6Z A;  5DY9 A;  3CC4 T;  2EFI A;  5I2S A;  3L42 A;  2D1X A;  9ATC B;  1VQO Q;  2F2V A;  3DLL A;  3UWN A;  2CP0 A;  1WHH A;  1WPY A;  4BDZ A;  1CKA A;  5IT9 E;  4BY6 C;  2PUO B;  4N4I A;  3L2U A;  2OTL Q;  4E2F B;  5J26 A;  1K8A R;  4OGE A;  3BE3 A;  2CZ6 B;  1JB0 E;  3NGP A;  1OU8 A;  3M4G A;  4C5G A;  3OS0 A;  3OYN A;  2LNH B;  2ZPG B;  1OYX A;  4RKU E;  2JJ9 A;  4N0A C;  1SRL A;  1U06 A;  4AG2 C;  3WVD B;  5GMK i;  4IUR A;  3G71 Q;  4LDU A;  4M7A A;  4N4G A;  2DIQ A;  1Q7Y U;  1IGQ A;  2DIG A;  2MIO A;  3DB4 A;  1MV0 B;  3HP9 A;  1JQQ A;  1T3L A;  2ESW A;  4K11 A;  2MPX C;  1OU9 A;  3M59 A;  2FZC B;  1S72 T;  1N9S A;  4OML A;  1MV3 A;  1V76 A;  1M90 C;  1O75 A;  5LJ3 h;  2NUP B;  3NFC A;  1QWE A;  4XAX B;  1NLO C;  1VQL A;  4JPB W;  1UG1 A;  1QCO A;  2LJ1 A;  3I5R A;  3JCM g;  1WXU A;  4XQ3 A;  2NWM A;  1PNJ A;  4PJO G;  4N0A A;  2D8J A;  2CH4 W;  1X2Q A;  2HEQ A;  4DBH A;  2FYK A;  1VQ7 A;  3RKW A;  2E3I A;  5KE3 A;  4Y91 A;  3FLG A;  3OYJ A;  4A4E A;  4LXC A;  1M1G A;  1ABO A;  2VXF A;  3M0S A;  4BE0 A;  3JCM W;  1LJO A;  5FU7 B;  5CIU A;  2L89 A;  5CAI A;  3LWI A;  1YJN T;  3AT1 B;  2DK3 A;  4JZ4 A;  1GRI A;  2DFU A;  2IPO B;  1W1F A;  2X4W A;  2RHU A;  3ME9 A;  1XNI A;  1HD3 A;  4B9W A;  2NUT A;  2QDY B;  4RTT A;  3OMG A;  5GAN 8;  3LGF A;  1VQ9 A;  2DKG A;  3I55 A;  2YUO A;  5CKH A;  1IRE B;  2EYY A;  2RNA A;  5DM7 R;  4AMC A;  2LZ6 B;  4BUG A;  1GBR A;  3V7R A;  4F16 A;  4RTV A;  1D1C A;  2ABL A;  4M78 G;  1TTH B;  2QGF B;  4F7U G;  3FJ5 A;  3CD6 Q;  3AHU A;  2QA4 A;  1VQL Q;  5LJ5 f;  3CEY A;  4J5Y A;  5GJW B;  2E70 A;  4F7U B;  1Q82 C;  5I11 A;  1M3C A;  1A0N B;  3H0H A;  3OBW A;  2DXT A;  2O2O A;  5LJ3 f;  5GAM e;  1V1C A;  4JRQ A;  3ZL7 C;  3CME A;  1JXO A;  1K8A U;  1VQ7 Q;  3IQL A;  3CCS A;  2L3S A;  4OMQ A;  2EYW A;  1ZSG A;  3G4S A;  3ZEH A;  2CH4 A;  2QXF A;  4YTL A;  1VIF A;  3RDV A;  2DEU A;  3CCV T;  2HSP A;  5IN1 A;  1NEB A;  3JCM e;  5GJV B;  3EGU A;  1UGS B;  2GCX A;  1YN8 A;  2EGE A;  2BIV A;  4HCB A;  3JB9 F;  2RHZ A;  2EQI A;  3E2U A;  4QKU A;  4ELY C;  4OF1 A;  5IH2 A;  2VB6 A;  3L2Z A;  2QQS A;  3MET A;  4QQG A;  2ENM A;  1VQ9 Q;  3VRY A;  3I55 Q;  2P0K A;  2H8H A;  3M58 A;  3SD4 A;  1VQK T;  4F04 B;  1PKT A;  2YRC A;  4M75 B;  2OTJ T;  1WZO A;  3PVL A;  4J9G A;  1VYT A;  4FW2 A;  2JN0 A;  4OMN A;  1PRL C;  4PJO C;  2PVG B;  3QXE B;  2E5Q A;  2HMA A;  4M77 G;  4EMK A;  3I56 Q;  2K3Y A;  4XK8 E;  1KD1 U;  3QYH B;  2M0O A;  5LJ5 g;  2MAM A;  3CCQ T;  1RI9 A;  5J39 A;  2DMO A;  3REB B;  3CCS Q;  3A98 A;  1MHN A;  1VQ8 A;  1FMV A;  3G4S Q;  1B34 A;  2F1L A;  2RJF A;  2W10 A;  5L23 A;  3QWY A;  1IO6 A;  4JUV A;  2WAC A;  1QWF A;  3JV3 A;  3GF5 A;  1WHK A;  2XDP A;  1WX6 A;  3JCM Q;  5CR2 A;  2NLU A;  2CS7 A;  1WHL A;  1RLP C;  4D8D A;  1J3T A;  1BI0 A;  1YJW A;  3LWH A;  2DRK A;  3HKS A;  3EG3 A;  3QJY A;  2DRM A;  2BZ8 A;  4M78 C;  2GFA A;  1CKB A;  1YHQ T;  4LDV A;  4C0Z A;  1C1A A;  3VRZ A;  1PKS A;  2LQK A;  2M0Y A;  2EWN A;  2RI2 A;  1QKW A;  3NMZ C;  3R6N A;  2JZ2 A;  2MI6 A;  3GNF B;  4B9X A;  2EYQ A;  1QVP A;  2X3X D;  4LD6 A;  3E9F A;  2L3P A;  3L2V A;  1WHJ A;  2AKL A;  4HXJ A;  1W4S A;  2ROT A;  2QAZ A;  2DBM A;  5A0G A;  3X20 B;  1PD0 A;  1KQS P;  4IUQ A;  3MEW A;  1K9M R;  1OPK A;  2EQU A;  2BTT A;  1SKU B;  1FMK A;  4LDW A;  5GMK m;  4EDU A;  1NPR A;  3LLR A;  5GAO q;  4ZGD B;  2EQK A;  1VYU A;  3QPH A;  4JDS A;  3VUZ A;  3S3O A;  1OX9 A;  1IXD A;  1UTI A;  3Q1J A;  3EGX B;  3VS6 A;  1VQ8 Q;  4JJB A;  3G6E T;  2QEX A;  1F1B B;  3JB9 J;  1G83 A;  2G6F X;  3C94 A;  1W2B S;  5KYW A;  4C92 E;  1Z9Q A;  4AG1 C;  2XIC A;  1FXX A;  2LX9 A;  2VYT A;  2RI3 A;  4HVV A;  2RPN A;  5LJ5 e;  2O01 E;  3SDZ A;  5GAN 5;  5HKC A;  3P8D A;  4XU0 A;  4IIM A;  3L2R A;  2JT4 A;  1G3Y A;  2V8K A;  3MEA A;  2O31 A;  3CBM A;  5LJ3 e;  2CSQ A;  3CBP A;  2WSE E;  3VS7 A;  1YJW Q;  3J80 E;  2V1Q A;  1SF9 A;  4KGV B;  2EPD A;  2CZ0 B;  2K4Y A;  2KYM A;  3S3M A;  3EGD B;  1RAE B;  4C5H A;  2MYS A;  4HCC A;  1OZ3 A;  4QVZ A;  3FC3 A;  1KC8 C;  4PNO A;  4M77 C;  2K7A A;  4MDW A;  3OSS C;  2MMP A;  2QG9 B;  1E6H A;  2AK5 A;  3VYG A;  4PK4 A;  2VXE A;  2KAF A;  4LNP A;  1VQP A;  3CPW P;  1B07 A;  2E12 A;  1JJ2 A;  3QSU A;  3G7Z A;  3X24 B;  2XHC A;  1W2B A;  3MCA B;  3CQT A;  1QW1 A;  3PMT A;  4C92 D;  2R5A A;  2KYB A;  1ZUU A;  1UJ0 A;  3BDU A;  2ED1 A;  4PLL A;  1QCF A;  2WSC E;  2KMT A;  2E6N A;  1JJ2 P;  4JJN K;  1H92 A;  4OB1 B;  2LT4 A;  1W2B P;  2EJG A;  3QZ5 B;  3OYI A;  2CSI A;  2YXY A;  1ZBX A;  2DL4 A;  4KH1 B;  1M1K R;  4J9E A;  4M7D G;  1VQN T;  1N6A A;  3EG0 A;  2QQR A;  1OI1 A;  3M56 A;  4J9D A;  4E6R A;  3CCL T;  3DKM A;  2BE9 B;  2K2V A;  4KUI A;  1YIT A;  1LVK A;  2J05 A;  5GMK j;  2M1H A;  3DB3 A;  2BZX A;  4ELZ C;  2K9G A;  1R8O B;  3E9G A;  4X9C A;  1MMA A;  4M7A E;  2DVE A;  2H3J A;  2EQM A;  1KJW A;  1UJY A;  3F70 A;  2FZK B;  3UF4 A;  2OAU A;  4C8Q G;  3M54 A;  2EKH A;  3A1P A;  1H64 1;  2FB7 A;  3PFS A;  8ATC B;  1D3B A;  2HKN A;  1PC0 A;  1Q86 R;  4DQ2 A;  1X6B A;  2PZ1 A;  1K9M U;  1I5L A;  1IHW A;  4J7I A;  4OB0 B;  4R0K A;  5GAN 4;  1RAD B;  1HYO A;  4C5I A;  1KQ1 A;  3CXC A;  3LX7 A;  3M4Y A;  1VQP Q;  2OJ2 A;  2CP6 A;  4WCI A;  2RO0 A;  4QT7 A;  2EAY A;  3GLX A;  4DEY A;  3PE0 A;  2YUP A;  2D0N A;  4MMK A;  1Y96 B;  3T9N A;  3RMQ A;  1GFC A;  3MPU B;  2E10 A;  3CXC P;  1I5O B;  2AKK A;  1T0J A;  4E7K A;  3MEU A;  3CCE A;  4A63 B;  1MMN A;  3FRN A;  2AZS A;  2CGH A;  3RNJ A;  1ZSZ C;  4E7L A;  3HPW A;  2FRW A;  4M7A D;  2J6O A;  4L5G A;  4HA8 A;  2VUB A;  3RIR A;  5GAN j;  2LCS A;  3SWN C;  2SEM A;  4BI3 A;  4UC4 A;  2CDT A;  3OS5 A;  2KRN A;  4JLI A;  4C0F A;  4D8K A;  1YJ9 A;  5KYU B;  4C0G A;  2P0P A;  1YIT Q;  1ZUY A;  5GAN d;  3EFO A;  1WFW A;  4L59 A;  1SPK A;  1I4K 1;  1AT1 B;  4IUP A;  5FU6 C;  2VVK A;  1D1A A;  3H8Z A;  4B6M A;  2ZZD A;  3UAT A;  2W0Z A;  1ZLM A;  1VQ4 T;  2XKO C;  3H0I A;  5A0L A;  2KNB B;  4Z8A A;  3EG2 A;  1AZE A;  1VA7 A;  2P4R A;  2JVV A;  2ED0 A;  2RI5 A;  5HCK A;  1TG0 A;  1WQW A;  1M9S A;  2F2W A;  1JRI A;  3UA6 A;  3CC2 A;  5D6W A;  4FL6 A;  5D6X A;  3SWN A;  2D8H A;  1T3S A;  4LE9 A;  2DET A;  3KUF A;  1Y71 A;  4RTX A;  2HBW A;  2EQJ A;  1PD1 A;  1M1K U;  4J9I A;  4OP0 A;  1RAI B;  3OYK A;  1YWO A;  1RAH B;  3EFR A;  5KYX A;  3CCE Q;  4M7D C;  3OBY A;  1YP5 A;  4FSX A;  3HFO A;  1AEY A;  1TWB A;  2VV5 A;  2EGC A;  1Q81 R;  3CBO A;  2DTO A;  3VU3 C;  2JM8 A;  1VQM T;  2BUD A;  2CKK A;  1Y0M A;  2RQT A;  2CYZ B;  4MML A;  3MO8 A;  1ZA1 B;  1EFN A;  1YJ9 Q;  4LN2 A;  1WNL A;  4IUV A;  4C8Q C;  1D0Y A;  1WHG A;  3CCJ T;  1Q86 U;  1BCO A;  3JCM J;  5GAM g;  3A5Z B;  4EMH A;  1HSQ A;  2CUB A;  5M9O A;  2CT4 A;  1I07 A;  4FYW B;  1YFN A;  3FJP A;  5I22 A;  3DLM A;  4EMK B;  3LH0 A;  1KFZ A;  1RLQ C;  2J06 A;  2MCN A;  2X51 A;  3S3N A;  2B8A A;  1MGQ A;  5GMK l;  1QVG A;  3CC2 Q;  2XMF A;  3CMA A;  3BDL A;  3JCM c;  1WJS A;  2DTH A;  2RJE A;  1UGQ B;  1N27 A;  1KD1 R;  2D9T A;  4C8Q A;  2MWO A;  3TSW A;  1NE8 A;  4F14 A;  5CKF A;  1QVG P;  3UDC A;  3OYE A;  3PIP A;  1VQ6 T;  2YRD A;  1RAA B;  3RKY A;  3EG1 A;  3MJX A;  1QMC A;  2VWF A;  4HCK A;  5GMK h;  3PT9 A;  3QII A;  3CCM T;  4LD9 K;  1VQ5 T;  3JCM b;  4PJO E;  5ECA A;  4MZP A;  3CC7 A;  5EG2 A;  4A4F A;  1M3B A;  3SB2 A;  3KXT A;  3CCR T;  2FEI A;  2DAQ A;  2HQH A;  4JRI A;  2KDS A;  1HK9 A;  3P8B B;  1Z9Z A;  1BI2 A;  1K8A C;  1OOT A;  2DA9 A;  4C0D B;  4HT9 A;  2JTE A;  3OMC A;  1VQO T;  2K5L A;  2DEQ A;  2GQI A;  1QVF P;  1GCQ C;  1GXI E;  1I8F A;  2ZPE B;  2AT1 B;  1M8V A;  2JTF A;  2Y90 A;  3QO3 A;  3CMA Q;  2V8I A;  2DLP A;  2QTX A;  3GP8 A;  2DJQ A;  2KRS A;  2OTL T;  2M9U A;  2DF6 A;  1Y07 A;  4AT1 B;  1QLY A;  2PVO B;  1I1J A;  1Q81 U;  2K3B A;  1YCS B;  2LDM A;  2K2M A;  1NJI R;  5IHK A;  3H41 A;  1WI7 A;  2C06 A;  2DVJ A;  3EG9 B;  1U3O A;  1PCX A;  2L3Q A;  4QQD A;  5GAN h;  3G71 T;  1DJ7 B;  4PJO D;  4BE2 A;  4M78 E;  1R77 A;  5GAO n;  4C92 F;  4ZGJ B;  5KYY A;  2KI7 A;  4F7U E;  1GFD A;  1YIJ A;  5I21 A;  1WJR A;  3I9Q A;  2FG0 A;  1TU0 B;  2DXC A;  1BB9 A;  4AFU C;  5GAM j;  4M75 G;  1GCQ A;  2QK0 A;  3TRE A;  5KYN A;  4JLG A;  2LT1 A;  5CVI A;  3CCU A;  4XTV A;  2JUF A;  5CK9 A;  4BAC A;  4E7J A;  2DPP B;  2PTK A;  1ZUK A;  3CC7 Q;  5GAM d;  3PGG A;  1VUB A;  2DL3 A;  1IB8 A;  1XQH A;  4A4G A;  2GQV A;  2LNV A;  2MF2 A;  2QA4 Q;  3O8V A;  3GNG A;  4AFS C;  1G3T A;  1M27 C;  1M2V A;  3JCM d;  2O4X B;  2KVQ G;  5FU7 C;  2R57 A;  4HT8 A;  1KQS S;  4FU6 A;  2YLB A;  3RR6 A;  1FX7 A;  2VC8 A;  3L1A A;  1WHM A;  3CME Q;  4M78 D;  2QYZ A;  4EMG A;  1MNE A;  2F5T X;  5LJ3 g;  4XU3 A;  4FT2 A;  2EJ9 A;  1BCM A;  3KFV A;  3V7C A;  4KGX B;  2E41 A;  1NLP C;  2EW3 A;  4FIB A;  2PQW A;  1KC8 R;  2CP2 A;  2KXD A;  1AWJ A;  3M5A A;  5FRO A;  4PJO A;  2KRO A;  1YI2 A;  3OYL A;  2DIL A;  1YIJ Q;  2RA2 A;  4F17 A;  1SG5 A;  2A36 A;  4BB7 A;  1YCY A;  1GBQ A;  4M77 E;  1NZ9 A;  2HD0 A;  2COW A;  2X4X A;  2COY A;  1ABQ A;  1M8M A;  5GAN f;  3CCU Q;  1YNZ A;  3QHS A;  4KT0 E;  2AHJ B;  1KQS A;  4J9F A;  1K1Z A;  2LC4 A;  3CD6 T;  2KBT A;  4M7A F;  1IZ6 A;  4DA4 A;  1VQL T;  3JB9 G;  3RKX A;  4KUD K;  2QAS A;  3JAM E;  2GGR A;  1NYG A;  1M5Q 1;  2DL7 A; 
#chains in the Genus database with same CATH homology
 1JB0 E;  4C5G A;  3M4G A;  1R8O B;  3E9G A;  3CCE T;  3OS0 A;  1I81 A;  4X9C A;  4M7A E;  3OYN A;  2DVE A;  2ZPG B;  2H3J A;  2EQM A;  3RER A;  3CPW S;  3F70 A;  1OYX A;  3CPF A;  4P5N A;  5KH6 A;  2DD5 A;  4RKU E;  2OAU A;  4N0A C;  4C8Q G;  4ZN1 A;  4XTY A;  4V2S A;  3M54 A;  3NTI A;  4NOY A;  3WVD B;  5GMK i;  4IUR A;  4C92 B;  1VQ7 T;  3HHT B;  1H64 1;  3R6O A;  2FB7 A;  3PFS A;  4LDU A;  5GAN 7;  4N4G A;  1Q82 U;  4M7A A;  2DIQ A;  1D3B A;  3GPL A;  1Q7Y U;  4Q5W A;  4XTX A;  1NJI U;  2RB6 A;  2DIG A;  3C12 A;  4DQ2 A;  3FEO A;  1V29 B;  1K9M U;  3DB4 A;  2YRV A;  1SSF A;  1I5L A;  3OA6 A;  3HP9 A;  4J7I A;  4OB0 B;  2KSS A;  5GAN 4;  4M78 A;  3TU4 K;  1YJ9 T;  4C5I A;  3MEV A;  1KQ1 A;  2L8D A;  3LX7 A;  3CXC A;  3WVE B;  3JSC A;  5GAN 2;  3M59 A;  1RI0 A;  3M4Y A;  4A54 A;  1N9S A;  3OY9 A;  2DJZ A;  2M16 A;  4F7U A;  1S72 T;  1JJ2 S;  3QJ6 A;  4OGC A;  3CC4 A;  4EMK C;  2RO0 A;  3OYA A;  2QQB A;  2EAY A;  4M77 D;  3GLX A;  1M90 C;  3KBG A;  4XTW A;  1HXD A;  3V8J A;  1O75 A;  2G3R A;  1VQN A;  5LJ3 h;  2E65 A;  3NFC A;  1BKB A;  4DOW A;  4XAX B;  5CQY A;  4MMK A;  1Y96 B;  3CCL A;  1VQL A;  3BW1 A;  3T9N A;  3RMQ A;  4M75 C;  2E10 A;  1WJQ A;  1P92 A;  4XTU A;  1VQ9 T;  1KD1 C;  5GAO m;  3JCM g;  3OYB A;  3I55 T;  2XID A;  4E7K A;  4VUB A;  4XQ3 A;  3MEU A;  5IAY A;  3CCE A;  2XDB A;  4PJO G;  3FRN A;  4N0A A;  2CGH A;  2PVD B;  3NTH A;  4L6V 5;  1ZHI A;  2LQ8 A;  2RJD A;  3JCM P;  4R56 A;  2RJC A;  3CPW A;  4E7L A;  2MWP A;  3HPW A;  5LL6 S;  2FYK A;  3UPU A;  1VQ7 A;  3CC2 T;  4M7A D;  2ZGW A;  3RKW A;  5KE3 A;  4L5G A;  4HA8 A;  2VUB A;  3VJP A;  3RIR A;  5GAN j;  4Y91 A;  3FLG A;  2RHI A;  3OYJ A;  4A4E A;  1M1G A;  3CCU A;  3SWN C;  4JS4 A;  4J6X A;  4BI3 A;  4UC4 A;  2R58 A;  3OS5 A;  4JLI A;  4C0F A;  2VXF A;  2DZ9 A;  4BE0 A;  3JCM W;  1YJ9 A;  4C0G A;  1LJO A;  5FU7 B;  2P0P A;  4N4H A;  3X25 B;  1S72 A;  5LJ5 j;  5GAN d;  5CIU A;  2L89 A;  5CAI A;  3LWI A;  4BE1 A;  3I56 T;  1YJN T;  3A8M B;  4M75 E;  4L59 A;  2RHY A;  2DK3 A;  3SFM A;  1I4K 1;  1G3S A;  4BI8 B;  4IUP A;  3OYG A;  5FU6 C;  3QG1 A;  3JB9 I;  4M77 B;  2X4W A;  2RHU A;  3H8Z A;  3ME9 A;  3TEE A;  2ZZD A;  3J81 E;  1XNI A;  2LRQ A;  2XKO C;  4M75 A;  4B9W A;  5LJ5 d;  1VQ4 T;  1U8R A;  2QDY B;  3V8K A;  5A0L A;  3CCS T;  2JNG A;  1U1S A;  3OMG A;  5GAN 8;  4XU2 A;  1UGP B;  3LGF A;  4IUT A;  4A4K A;  1VQ9 A;  2DKG A;  3HRS A;  3G4S T;  3I55 A;  3LYI A;  3EAE A;  5CKH A;  1IRE B;  4X34 A;  2JVV A;  3N5B B;  2RI5 A;  3CXC S;  1KC8 U;  5DM7 R;  3JCM V;  4BUG A;  1WQW A;  1M9S A;  3QYG B;  1JRI A;  1G3W A;  3M9Q A;  4J6W A;  3V7R A;  3GOX A;  3CC2 A;  2K5F A;  5D6W A;  3M55 A;  4FL6 A;  4M78 G;  5D6X A;  3L2Q A;  4M7A B;  3SWN A;  5CO7 A;  5L8R E;  4C0D C;  1D3B B;  4M77 A;  3OW2 S;  2KK4 A;  2XK0 A;  5GAN 6;  4F7U G;  4II1 A;  2QA4 A;  4NS5 A;  3AHU A;  3KUF A;  1Y71 A;  2EIF A;  2P4T A;  2F5K A;  2DXU A;  2RH2 A;  4BDY A;  5LJ5 f;  3CEY A;  3EFS A;  4J5Y A;  4NL2 A;  4ZTJ A;  2EQJ A;  4ATO A;  2E70 A;  1M1K U;  1BIA A;  1YJN A;  4F7U B;  3M57 A;  4OP0 A;  3OYK A;  1BIB A;  2RM4 A;  4C92 G;  1K73 C;  1Q82 C;  3EFR A;  4M7D C;  3OBY A;  2EKO A;  1NJI C;  3QZ9 B;  4FSX A;  3OBW A;  3HFO A;  2DXT A;  1K9M C;  5LJ3 f;  4QW2 A;  5GAM e;  1BI1 A;  2LTO A;  2DTI A;  2QQ9 A;  2VV5 A;  4M75 D;  4BY6 B;  3OYD A;  3CBO A;  5I2M A;  3CME A;  2DTO A;  4JRQ A;  3VU3 C;  1VQ4 A;  1VQM T;  1K8A U;  2BUD A;  3CCS A;  2CKK A;  2JTM A;  3V8L A;  3CMA T;  5FRM A;  4Y28 E;  1XTD A;  4HCZ A;  2CYZ B;  3G4S A;  4IKF A;  4MML A;  3MO8 A;  3ZEH A;  2QXF A;  3C95 A;  4YTL A;  1VIF A;  5CKE A;  2XU8 A;  3CCV T;  5IN1 A;  1OZ2 A;  1QP3 A;  1AHJ B;  3JCM e;  4M7D F;  1WNL A;  3HRU A;  4IUV A;  1VIE A;  4GY5 A;  4RCB A;  4C8Q C;  4D6W A;  1UGS B;  2GCX A;  2RK1 A;  3CCJ T;  1Q86 U;  3OQ5 A;  2BIV A;  3JCM J;  4HCB A;  5GAM g;  3A5Z B;  2RHZ A;  1TH7 A;  4EMH A;  3JB9 F;  5M9O A;  3NTK A;  5A0D A;  4RCC A;  4M7D E;  3OW2 A;  3INZ A;  4ELY C;  2I2L A;  4OF1 A;  1M4Z A;  2DZC A;  1O9S A;  3FJP A;  3L2Z A;  3QUI A;  2QQS A;  3MET A;  5GAN e;  3DLM A;  4QQG A;  4MZM A;  4EMK B;  3LH0 A;  4C8Q F;  1VQ8 T;  1KHI A;  4ME7 A;  4Z02 A;  4C5E A;  2X4Y A;  2P0K A;  3M58 A;  4JRK A;  2GFU A;  3BFM A;  4PLI A;  3SD4 A;  2X35 A;  1VQK T;  3S3N A;  3FDR A;  2B8A A;  1MGQ A;  5GMK l;  4ZN3 A;  1QVG A;  2CZ1 B;  1JBM A;  4M75 B;  1VQM A;  3CC7 T;  4J7F A;  4C8Q E;  3MP1 A;  3CMA A;  4CRI A;  2OTJ T;  3BDL A;  3JCM c;  3GIB A;  1WJS A;  1YBY A;  2DTH A;  2ZPF B;  2RJE A;  1UGQ B;  2K57 A;  1N27 A;  4JRP A;  5CKB A;  2JN0 A;  4LDY A;  1VQO A;  2D9T A;  4PJO C;  1KHC A;  4RG2 A;  4C8Q A;  5GAN g;  2MWO A;  2QA4 T;  1UB4 A;  3CCV A;  1NE8 A;  2PVG B;  3QXE B;  2E5Q A;  3HSB A;  4M77 G;  1BYM A;  4JS5 A;  1YJW T;  4QVD A;  4EMK A;  5CKF A;  1N8R U;  3E19 A;  4ZGE B;  3PNW C;  5C0M A;  3UDC A;  3PTA A;  3CCJ A;  2K3Y A;  4XK8 E;  1KD1 U;  3QYH B;  2M0O A;  5LJ5 g;  3OYE A;  4J83 A;  3SWN B;  3PIP A;  1M1F A;  2MAM A;  3CCQ T;  1VQ6 T;  5J39 A;  1PSF A;  5LJ3 j;  3CME T;  4X9D A;  3RKY A;  4PJO F;  1PSE A;  4WF2 A;  3MP8 A;  1MHN A;  3RMS A;  3J7A F;  4M7D D;  5GMK h;  1VQ8 A;  2DXB A;  2E1H A;  3OB9 A;  3PT9 A;  3QII A;  5FU6 B;  1B34 A;  3CCM T;  4LD9 K;  3ASK A;  3JB9 H;  2RJF A;  3X28 B;  2A3L A;  4M7A G;  5LJ3 d;  3JCM b;  3JB9 D;  1VQ5 T;  3A8L B;  1VQK A;  1WQ7 A;  3LGL A;  4JUV A;  2WAC A;  4PJO E;  1U1T A;  4MZP A;  1X75 C;  2O4X A;  5GMK e;  3CC7 A;  5EG2 A;  4IUU A;  4A4F A;  3KXT A;  3SB2 A;  2OTJ A;  3CCR T;  3GF5 A;  1M1K C;  2XG8 D;  2XDP A;  3HFN A;  1Y7X A;  5DLQ E;  4A4H A;  3JCM Q;  2DAQ A;  5CR2 A;  2RK2 A;  4C8Q D;  2NLU A;  2CS7 A;  4JRI A;  5GAO p;  2KDS A;  4J6Y A;  3S6W A;  2QQA A;  1YIJ T;  1HK9 A;  1BI0 A;  2LCL A;  3LW5 E;  3P8B B;  5GAM h;  2RHX A;  3JCM X;  1YJW A;  3LWH A;  1G5V A;  3HKS A;  2IVW A;  3QJY A;  2HQE A;  1BI2 A;  4MDX A;  1K8A C;  2L5Q A;  2GFA A;  2FHD A;  4M78 C;  1YHQ T;  1W2B S;  4C0D B;  4LDV A;  4C0Z A;  4HT9 A;  3M53 A;  3OMC A;  4O5V A;  2PU9 B;  4OMF B;  1Q7Y C;  3A8G B;  3CCU T;  3CCQ A;  2K5L A;  2DEQ A;  2P0Q A;  1VQO T;  1KG1 A;  1QVG S;  1VQ6 A;  4EPC A;  1GXI E;  2LQK A;  4RMO A;  1I8F A;  1X01 A;  2ZPE B;  2EWN A;  1M8V A;  3VUB A;  2JTF A;  2RI2 A;  1XOV A;  2V8J A;  2Y90 A;  3JCM h;  4J8O A;  2JZ2 A;  4DOV A;  3QO3 A;  2V8I A;  2MI6 A;  2JOY A;  3GNF B;  4OGE A;  2X4J A;  4B9X A;  2EYQ A;  1QVP A;  4LD6 A;  2XDD A;  2QTX A;  3E9F A;  3GP8 A;  4C92 C;  5KCH A;  3L2V A;  1Q86 C;  2OTL T;  2M9U A;  3CCM A;  4LDX A;  4CI0 C;  4M7D B;  1Y07 A;  3RUX A;  4M78 F;  2PVO B;  1VQ5 A;  3ZFJ A;  1W4S A;  3QBY A;  5HY6 A;  4HKE A;  1Q81 U;  4XTZ A;  1NPP A;  5A0G A;  2LDM A;  2QI2 A;  3X20 B;  2Y4X A;  2ZPB B;  4NL3 A;  4F7U F;  3L2W A;  4IUQ A;  3MEW A;  3OYM A;  2C06 A;  2EQU A;  1FWZ A;  4LDW A;  5DLO A;  5GMK m;  4EDU A;  1NPR A;  3CCR A;  4QQD A;  5GAN h;  3G71 T;  4PJO D;  1DJ7 B;  3LLR A;  4ZGD B;  5GAO q;  2EQK A;  4M78 E;  3QPH A;  4BE2 A;  1K73 U;  2K5I A;  2IG0 A;  4JDS A;  5GAO n;  1RL2 A;  4C92 F;  4ZGJ B;  2D6F A;  4F7U E;  3VUZ A;  3S3O A;  3WXM B;  4C8Q B;  5I21 A;  1YIJ A;  2KY9 A;  1WJR A;  4OB3 B;  3URG A;  3Q1J A;  2DXC A;  2HNI A;  2K3X A;  2FVU A;  5LJ5 h;  1UEB A;  4KBM B;  3HL8 A;  5CCA A;  5GAM j;  4M7D A;  4BD3 A;  3TCJ A;  2ZPH B;  4M75 G;  3G6E T;  1VQP T;  1YHQ A;  2QEX A;  3PIO A;  3TRE A;  3JB9 J;  4A53 A;  4JLG A;  3UT1 A;  2LT1 A;  3A8O B;  2YHT A;  3C94 A;  4PL6 A;  5CVI A;  4XTV A;  1QP2 A;  3FIF A;  2JUF A;  2XIC A;  4C92 E;  3MHX A;  5CK9 A;  1FXX A;  5CKD A;  2LX9 A;  4BAC A;  4E7J A;  2DPP B;  2VYT A;  2XI9 A;  4TVR A;  2RI3 A;  1ZQ1 A;  5LJ5 e;  2E6Z A;  2L3R A;  2O01 E;  3CD6 A;  2WSF E;  3PMI A;  2ZCF B;  5HK0 A;  3SDZ A;  5GAN 5;  1LOJ A;  2ZPI B;  1VUB A;  3PGG A;  5GAM d;  1QVF S;  4C92 A;  5HKC A;  5C6S A;  2D0Q B;  3E1S A;  1XQH A;  3RES A;  4ZTF A;  5AYF A;  4A4G A;  3QDR B;  1N8R C;  3P8D A;  2GQV A;  2R5M A;  4XU0 A;  2LNV A;  5KCO A;  3L2R A;  2OTL A;  2MF2 A;  1YI2 T;  3HRT A;  1G3Y A;  2V8K A;  1M90 U;  3MEA A;  1B34 B;  3CBM A;  5LJ3 e;  3O8V A;  5CQX A;  3CBP A;  2DO3 A;  3GNG A;  2WSE E;  1G3T A;  1X6O A;  3J80 E;  2A7Y A;  1UGR B;  3JCM d;  2RD1 A;  2DD4 A;  2KQW A;  2BKD N;  2O4X B;  2KVQ G;  1BI3 A;  5FU7 C;  2R57 A;  4HT8 A;  2CZ0 B;  2GF7 A;  3G71 A;  2K4Y A;  1KQS S;  5FLX E;  5J3B A;  3BY7 A;  4FU6 A;  2YLB A;  3OS1 A;  4C5H A;  3S3M A;  5GAO r;  4PJO B;  1FX7 A;  2VC8 A;  2XD0 A;  4M75 F;  1EIF A;  4HCC A;  1LNX A;  3L1A A;  2LCC A;  1OZ3 A;  4QVZ A;  4E7H A;  3FC3 A;  3JRZ A;  1KC8 C;  4PNO A;  4M77 C;  4O6J A;  4M78 D;  4MDW A;  1Y96 A;  4MZT A;  3OSS C;  2MMP A;  4EMG A;  3OS2 A;  3VYH B;  2F5T X;  5GAM f;  5LJ3 g;  4OVA A;  4QQ6 A;  5GAO l;  1YIT T;  3OSV A;  2EJF A;  4GLK A;  2VXE A;  2KAF A;  4XU3 A;  3VYG A;  3G6E A;  1VQP A;  3OYF A;  4FT2 A;  2EJ9 A;  4OB2 B;  2E12 A;  3ER0 A;  5D6Y A;  1JJ2 A;  1H3Z A;  3A8H B;  4E47 A;  3V7C A;  3I56 A;  3G7Z A;  3X24 B;  3QSU A;  2VGN A;  2XHC A;  2E41 A;  1W2B A;  3MCA B;  4FT4 A;  3C4S A;  3OYY A;  4R55 A;  1QW1 A;  4FIB A;  2PQW A;  2YLC A;  3PMT A;  4C92 D;  2R5A A;  3JCM f;  3OYH A;  5GAN 3;  5FRN A;  4M77 F;  3M5A A;  1QVF A;  5FRO A;  3BDU A;  4PJO A;  1YI2 A;  4PLL A;  2HAX A;  4M7A C;  3OYL A;  2E64 A;  3FB9 A;  4XU1 A;  2WSC E;  2VGM A;  5A2Q E;  1WGS A;  2F69 A;  2HBP A;  2PUK B;  2RA2 A;  2KMT A;  2E6N A;  4BI4 A;  4JJN K;  4BB7 A;  4OB1 B;  1YCY A;  3X26 B;  2LT4 A;  1KQ2 A;  3V7S A;  4M77 E;  4E7I A;  4FM4 B;  1NZ9 A;  2EJG A;  3ZBD A;  3OYC A;  2HD0 A;  2CZ7 B;  3QZ5 B;  2QEX T;  2X4X A;  2HQX A;  3H6Z A;  3MP6 A;  5DY9 A;  2EFI A;  5I2S A;  3OYI A;  5HK3 A;  3CC4 T;  5GAN f;  1ZBX A;  3L42 A;  3QHS A;  4KT0 E;  2AHJ B;  1KQS A;  5KE2 A;  3DLL A;  4M7D G;  3UWN A;  1N9R A;  1N6A A;  1VQN T;  2LC4 A;  4KUL A;  1WPY A;  4BDZ A;  1Q81 C;  3VV0 A;  3CD6 T;  4M7A F;  5IT9 E;  1IZ6 A;  2QQR A;  1OI1 A;  4DA4 A;  3M56 A;  3P8H A;  3VKI A;  4BY6 C;  3DKM A;  3CCL T;  2Y4Y A;  4M78 B;  3RKX A;  3JB9 G;  1VQL T;  3QKJ A;  4QVC A;  2PUO B;  2K2V A;  4KUI A;  4N4I A;  2FL7 A;  2LVM A;  4RG8 A;  3L2U A;  1YIT A;  4KUD K;  4PKC C;  5J26 A;  3JAM E;  5GMK j;  2M1H A;  3DB3 A;  4ELZ C;  1M5Q 1;  2CZ6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...