4C8QD

Crystal structure of the yeast lsm1-7-pat1 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
91
structure length
81
Chain Sequence
b'LPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSEESAIAVKLNEIYIRGTFIKFIKLQDNIIDKVKQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 81
sequence length 91
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c8qD00
2E1HA 3JCMQ 1Y96A 4M78D 4XU0A 4DQ2A 5LJ5j 4M7AC 3JCMf 5GAMe 1WQWA 4EMHA 4EMKB 1TH7A 3V7SA 2YHTA 5GMKj 2I2LA 2RM4A 4J6WA 4XTYA 1MGQA 1WPYA 3V7RA 5GAOr 4C8QE 3FIFA 3JCMd 1I5LA 4C8QG 5LJ3e 4M75A 3RKXA 4HT9A 5DY9A 4XTWA 4C92E 5GAN2 4M78B 4C92G 3V8LA 5GAN8 2EJFA 4JLIA 4MMLA 4N0AC 1X01A 5GAMj 4X9CA 2RA2A 5GAN3 4PJOA 4F7UF 5GANe 1HK9A 4MMKA 3SWNB 5GAN7 4NOYA 2VXEA 4M78F 2E65A 3JCMh 2FYKA 2YLBA 1U1TA 3M4GA 1I4K1 1LJOA 1KQ1A 4J6XA 4XU1A 3V8KA 5LJ3j 5GAOl 4XTUA 3QSUA 4M75E 4EMKC 3FB9A 5GMKl 4N0AA 3PGGA 5GAOq 2DTIA 3JCMP 3JCMJ 2EAYA 3BW1A 4M7DA 5GANj 4XTVA 3JB9I 3HSBA 3GIBA 3HFNA 4PNOA 4C8QB 4M77A 4PJOE 3RERA 3L2ZA 3V8JA 4PJOG 3BDUA 4JUVA 5GMKi 3JB9G 3JB9H 3JCMb 2ZGWA 4C92B 4M78C 2E10A 2DTHA 4M7AA 1H641 4JRIA 1YCYA 1U1SA 1LNXA 2DXUA 4HA8A 4C8QF 3AHUA 3JCMe 1Y96B 5GAN5 3RIRA 4QVCA 2FB7A 4A54A 3SWNC 4F7UA 5GAN4 5GAOp 3RKWA 1D3BA 5LJ5g 1HXDA 4J6YA 3BFMA 4RCBA 4OP0A 5LJ3f 4C8QD 4M7DE 4XU2A 4M7DG 4M77E 5GAOn 2VXFA 4M77G 4C92D 4M75B 4QVDA 2EJ9A 5LJ5f 4M7AB 3L1AA 4M7AE 4M75G 3QO3A 4C8QC 4M7AG 4XTZA 1N9RA 4RCCA 2CGHA 5LJ5d 4PJOB 1M8VA 2VC8A 2DKGA 4M7DD 5GAMg 4C92C 2DEQA 3JCMW 2EWNA 1JBMA 2EJGA 1B34A 4HT8A 4EMKA 4M75D 5CAIA 1WNLA 1JRIA 4M7AD 5GAMf 5LJ3g 2JN0A 3INZA 3QUIA 2RB6A 1LOJA 4J5YA 5LJ5h 4M7DB 3V7CA 2RD1A 4C92F 5GAMd 3SB2A 3JCMV 4WF2A 3JB9D 4PJOD 3QHSA 1N9SA 4M77B 1WQ7A 3EFSA 5GMKh 4M75C 5GANg 4M78A 2DZCA 1B34B 4XU3A 3BY7A 2DJZA 5LJ3d 4M7DF 2DZ9A 2DTOA 4X9DA 4M77F 3SWNA 5GANf 3RKYA 4PJOC 5GAN6 5GAOm 4NL2A 4XTXA 3RUXA 2QTXA 1M5Q1 3EFRA 1I81A 3HFOA 4F7UB 4M75F 1D3BB 2K57A 5GMKm 5GAMh 1KQ2A 5GANd 4F7UE 4M77D 1BIAA 4M7AF 3VU3C 4F7UG 4JRKA 2DVEA 4Y91A 5LJ5e 4M78E 3FJPA 2Y90A 4NL3A 3JCMX 4XQ3A 3JB9J 5LJ3h 4PJOF 2E64A 4M78G 3JB9F 5GMKe 4C8QA 1BIBA 2HNIA 4M7DC 4A53A 2DXTA 2YLCA 4M77C 5I21A 3RESA 2E41A 3JCMg 4C92A 4V2SA 3JCMc 4EMGA 5GANh 1I8FA
chains in the Genus database with same CATH superfamily
1XOVA 2GFAA 1TU0B 2I2LA 1QVGA 1YWPA 1VQ9A 1QVFA 2RQRA 3H9NA 4ELZC 4PLLA 5I11A 1UEBA 4A4KA 1D0YA 4PJNA 3HRSA 1NPPA 3NHNA 1UUEA 3OS1A 3CCLT 2BUDA 2K6DA 4L5GA 2VXEA 1NBEB 2FYKA 3M4GA 3CC4T 2JXBA 5GAOl 4J9BA 1WIEA 1NJIR 4JRPA 2P0QA 3OW2P 4F14A 2YUPA 1ABQA 3NTIA 1BI3A 2QQ9A 3KXTA 2RHXA 3CC4A 2K5IA 1B07A 3O5ZA 3JCMb 3TCJA 1KG1A 2DXUA 4BACA 3VS1A 4AFUC 1QCNA 3R6OA 2ZCFB 3SWNC 4QW2A 1D3BA 4J6YA 2GBQA 4RCBA 3M9QA 1Q81C 1SHGA 5LJ5f 3VJPA 2RPNA 1IO6A 2BE7D 5CKEA 2EIFA 3MO8A 1ZBJA 5CQXA 4HKEA 3UPUA 4N4IA 3GF5A 4J5YA 1AOJA 2EFIA 2MMPA 3VRZA 1QVGP 1QVFP 4LN2A 3M56A 4RTXA 1KQ2A 4HCCA 4B9WA 2X3XD 1ZUKA 5D6WA 3CCMA 1VQ5A 4FL6A 3CCUQ 2QK0A 4PFZA 3CCEQ 3JCMc 4EMGA 2CP7A 1Y96A 3JCMf 3CCRQ 1K76A 4F16A 1QCOA 2M0YA 4FW2A 4DBHA 2HEQA 3QZ9B 2E70A 5HCKA 3OA6A 1ZX6A 4D8KA 4JLIA 2JMCA 1BU1A 4X9CA 2NYSA 2Z0WA 3HTRA 2EBPA 5LJ3j 4R55A 2KK4A 4XTUA 2AZVA 2DJQA 2X4WA 3HRTA 5KYXA 2J05A 2D0NA 2E3HA 1UJ0A 2KE9A 1X27A 3TREA 4JRIA 5AT1B 1LNXA 4C8QF 1OPLA 2DXBA 3RKWA 4XU2A 1YN8A 5GAOn 1YI2Q 1N27A 4Z8AA 1Q7YU 2DYBA 3CPFA 4M75G 3TEEA 2BE9B 8AT1B 2QEXA 5IAYA 5GAMg 2VGMA 4KRTA 2X4XA 2LNVA 2LCSA 2KRMA 3E1SA 2FO0A 1TG0A 2MF2A 2LQ8A 5LJ5h 4KUDK 3MP1A 3QYHB 1UGRB 1N9SA 2LJ3A 2RN8A 2RF0A 3F70A 2RHYA 3OYBA 4RUGA 3SFMA 4PJOC 3SWNA 3RDVA 4C0ZA 4F7UB 1Z9QA 3NGPA 4FT2A 2XI9A 1G3YA 3VU3C 4HCKA 1VQPQ 1YJNQ 3PMIA 4XQ3A 3MCAB 4PJOF 3CMAQ 4VUBA 3A8MB 3G6EQ 2H3JA 1WHGA 4UC4A 1H3HA 2PNIA 2XICA 4J9FA 1D1CA 2CP5A 4EDUA 1YWOA 2EGAA 2JUFA 2OTLA 5GMKj 4IUUA 1GL5A 4RMOA 4AG1C 3PTAA 1V29B 5FLXE 1T0JA 4C5GA 1ZA1B 3PIOA 3DLLA 2EGCA 1QWEA 5I2SA 4JLGA 3H0FA 4XAXB 2P4RA 4MMKA 2A7YA 3RMQA 1X43A 2XU8A 3PIPA 3JCMh 2CP0A 2MAMA 4EMKC 3JCMP 3CQTA 1O75A 4IURA 4NS5A 1RL2A 5GMKi 3JB9G 1VIEA 5A0DA 3JB9H 2RI3A 1Q86C 2YUNA 1WHKA 2E10A 2XKOC 2DE0X 2JMAA 4B9XA 2K5LA 2CZ0B 4KH1B 5KYYA 4OB3B 4OP0A 3VS4A 2JTFA 2LX9A 4M7AG 1K1ZA 1NYFA 2CGHA 2ZZDA 1B7TA 3E9GA 2P0PA 1H8KA 2HQXA 1YP5A 3CCSA 2RI2A 3QPHA 2V26A 1WNLA 1M90C 1E6HA 3KBGA 2RD1A 3JCMV 3S6WA 1KSWA 1BI0A 3OMGA 4KGZB 5J39A 2DZ9A 3Q1JA 4D6WA 3LYIA 1Q7YR 2BZ8A 1N8RU 3EGUA 1V1CA 3HFOA 1WHMA 5GANd 1WA7A 2ED0A 3OYGA 2L2PA 4AG2C 5KYWA 4Y91A 2E64A 1GBQA 3MP6A 5FU6C 3CPWS 3CCJA 2QA4T 1X2QA 4BUGA 3VS5A 1UGSB 2W10A 2CUBA 4DEXA 2NUPB 4M4ZA 1NEGA 3N5BB 1YHQA 2CZ7B 1VQ8T 5M9OA 2XIDA 5A0GA 3CCVT 1JO8A 1N5ZA 2L0AA 2LT4A 4JS5A 3E9FA 1PSEA 3LWIA 1X01A 3ER0A 1VQNQ 4PJOA 1YHQQ 1M3AA 2OTJT 2YLBA 1QQJA 2KROA 2COYA 1PRMC 2RJEA 2VKNA 2KY9A 4ZTJA 1W6XA 1T0HA 2BZYA 4ZNXA 1UDLA 4F04B 3TSWA 3GIBA 3J7AF 4BDZA 1Y7XA 1M1KR 1VQLQ 4M78C 2DD4A 4LUDA 5FWBA 1RUWA 5FU7C 3M4YA 4MDWA 4LE9A 1G2BA 2QGGA 4LDXA 3UWNA 5LJ3f 1BCMA 3EG3A 1BI1A 3I9QA 2XMFA 3C4SA 1W2BA 2LJ0A 2MWPA 3S3NA 2IPOB 4XK8E 4N4GA 1ARKA 2BKDN 1SSHA 3OYYA 4XTZA 4DOWA 4C92C 3CXCS 4E7KA 1NYGA 3OS0A 4EMKA 1JXOA 2E6NA 5CAIA 1WHHA 3C94A 1D09B 2GCXA 4LXCA 4C92F 1PG5B 1S72T 1WQ7A 3EFSA 1OU9A 2R58A 1RLPC 2FPFA 2R5MA 2DJZA 1D0ZA 1VQOQ 3I56T 2DEUA 5GAOm 3G4ST 3MEWA 1U5SA 2QTXA 1RLQC 4F7UE 4J9EA 3I55A 1HSQA 4FT4A 3RMSA 4KT0E 3I56A 3ZBDA 3CD6T 4KGVB 4M7DC 2DBMA 3WVDB 1NEBA 4A4HA 2LRQA 1I1JA 3V7SA 3OSSC 3HKSA 1ZQ1A 2D1XA 1YITA 5IH2A 1RI0A 2DPPB 3REBB 5D6YA 5GAN3 2ZPEB 2QAZA 1KD1C 1VQ6Q 1R0CB 3FLGA 4KULA 2EYZA 1X75C 4J6XA 3QSUA 1W2BP 3EFOA 4EIKA 2CZ1B 4O5VA 2PUOB 1JXMA 2V8JA 4C0FA 5IHKA 3L2VA 5J3BA 4CRIA 3OBWA 4CC2A 8ATCB 1AWWA 5GANj 3O8VA 4QQGA 1PNJA 4XTVA 1VQMT 2HSEB 1KQSA 3ASKA 4AT1B 2AHJB 4FM4B 2RHZA 1VYUA 1NPRA 2DRMA 4ATOA 1TOVA 1YNZA 2KT8A 1YCYA 4E7IA 4ANJA 1KFZA 4HVWA 5FU6B 3AT1B 2KAFA 5LJ5g 3OS5A 3VKIA 1RAHB 2HL3A 1M1KC 4O6JA 4PKCC 4C0DB 1UB4A 2MI6A 2JOYA 1Z9ZA 4LDYA 2FZGB 5L23A 5KH6A 4X1VA 1K9MC 2XG8D 3JV3A 2XK0A 3EG9A 3PE0A 2NWMA 1ZSZB 2KBTA 1X6OA 4JZ3A 2I0NA 2VV5A 5GAMd 3JB9D 4OMMA 4M78A 5CQYA 3GOXA 4PJLA 5CR2A 2CH4A 4EPCA 2QDYB 2FRYA 3RUXA 1WXBA 5KYUB 1QVPA 4R56A 4YTLA 5I22A 2LTOA 5IT9E 2E5KA 2E12A 5FU7B 2AT1B 3G7ZA 2F5KA 3NMZC 1A0NB 3VS6A 3GLXA 4M77C 2DL5A 3JCMg 4C92A 4E2FB 2F5TX 2HQEA 3JCMW 2CSIA 2K3YA 4KBMB 1KQSP 2YHTA 3M0QA 2RM4A 4DBFA 1SPKA 3LX7A 4KUIA 4PK4A 2RNAA 1XQHA 4XTWA 4JJDA 5FRNA 1UHFA 1KC8C 2YDLA 3CC7Q 2EYWA 2O2OA 2EYXA 2KRSA 2IVWA 1R0BG 2ROLA 2O88A 2DETA 2E5QA 4M7DA 1IB8A 2HBWA 2AKLA 3DKMA 4TVRA 3HSBA 1JQQA 4PJOE 3L2ZA 4JUVA 2OJ2A 3A98A 3CMEQ 1VQ7A 2DA9A 1U1SA 1OX9A 1Q86U 3META 4A54A 3EHQA 4JS4A 3UA7A 4BI8B 2HKQB 2OAUA 5CKBA 1VQ9Q 3H0HA 1WJQA 1ZLMA 2MK5A 3CCLA 1DJ7B 2DXCA 2D9TA 3UA6A 4OMLA 2KT1A 1AHJB 2RO0A 3QUIA 3OW2S 2R57A 1H3ZA 3VUZA 3JAME 1K73U 2F2XA 1KHIA 1WLPB 3SB2A 1MV0B 1X6BA 4ORZA 4M75C 1IGUA 3FC3A 2DAQA 3CC4Q 1RAIB 2CT3A 3CBMA 4FW1A 3M0PA 3OY9A 1M30A 2M9UA 4M75F 1D3BB 1OULA 3EH1A 4BB7A 2DVEA 3BDLA 1X69A 4NL3A 4KGXB 3PNWC 4LDVA 2CS7A 2W0ZA 2LNHB 2WSFE 2E41A 5DM7R 2WSCE 2FRWA 1EX4A 4RG8A 2L8DA 2K7AA 4J6WA 4J83A 3EGXA 5GAOr 5LJ3e 3EGDA 2MYSA 4BI3A 2AZSA 3ZL7C 1QVGS 3S3MA 5GAMj 3PVQA 4JRQA 2RHIA 2YWWA 1QLYA 3CCRT 4MZTA 2GF7A 2HL5C 5CCAA 3X20B 2YRVA 2KQWA 4M77A 3CCMQ 1VQ5Q 2DTHA 2EVRA 2DNUA 1Y96B 1ZBXA 4QVZA 4IUVA 3H41A 2ZPBB 2NUTA 5GAN4 1HXDA 3VS7A 5IXBA 4HCBA 3DB3A 4BE1A 2VXFA 2HD0A 4RTVA 2EJ9A 4E7JA 1NZ9A 3G71T 4C8QC 1HD3A 1K8AU 2VC8A 1NE8A 3OYJA 1SRMA 1Q82U 2HSPA 1PRLC 2MIOA 2DFUA 2ENMA 3G71A 1NJIC 2VGNA 2RB6A 2MWOA 3PVLA 1NG2A 5KYXB 4C0GA 2CP6A 3SEMA 1M1FA 5HK3A 4XU3A 1AD5A 2DTOA 1TTHB 3A8OB 3P8BB 4XTXA 2ZPIB 4M7AF 4OF1A 4F7UG 1VOMA 4JRKA 4M78E 2Y90A 3JCMX 3JB9J 4CI0C 1ZA2B 5GMKe 1QKXA 4FYYB 2DXTA 3PT9A 2DK3A 2JZ2A 4CC4B 2QEXQ 1K73R 1I8FA 3JCMQ 4M78D 2VUBA 2PVDB 1UJYA 3SDZA 3DB4A 1VQPT 4E6RA 1YJNT 4HVVA 4GBQA 4OMPA 4M75A 4LD6A 4HT9A 4C92E 3CMAT 3RNJA 1UE9A 2FHDA 3LGFA 4OB2B 3SWNB 5KYNA 4NOYA 2LT1A 3OQ5A 3KUFA 4N0AA 3OSVA 3C0CA 5FWCA 3HFNA 2O31A 4AFZC 2QQAA 1YFNA 2YSQA 3MEVA 4ESRA 1RAGB 3OYLA 5C6SA 2V8IA 2FB7A 2LMJA 5EG2A 1JEGA 3GNGA 5IN1A 4M7DE 2DIGA 3MP8A 2OTLQ 1PC0A 4OB0B 5FROA 1BKBA 2DBKA 5LJ5d 3DLMA 2X51A 4M7DD 2KNBB 2JJ9A 4RG2A 2J6OA 3OYHA 1IHWA 3OYDA 2DD5A 3OYKA 1K9MU 4GY5A 5CKHA 2AKKA 2EQIA 2F2WA 2J6FA 1U06A 2G3RA 1VQ4T 2VVKA 1BK2A 3BY7A 3REAB 1UGPB 1SHFA 1MUZA 3QIIA 1SEMA 4P5NA 2F1LA 1I81A 5HKCA 1VQ4A 5KYYB 1C1AA 1Q82R 1G5VA 4C8QA 2XDBA 3OYEA 4JJCA 3TQ7P 2E4HA 4QQ6A 1PSFA 2ZPHB 2CSQA 2F69A 1IHVA 2A36A 3TSZA 2AIRB 3UDCA 4OMOA 3CCSQ 3I35A 1WPYA 3JCMd 2O01E 2PVGB 4II1A 2KXCA 3V8LA 2EPDA 1N6AA 2DX1A 2X4YA 3UF4A 3V8JA 1Y0MA 2CH4W 5FW9A 5GJWB 3A8GB 3QDFA 5KYWB 3M0SA 2QA4A 3JB9I 2DLPA 4PNOA 2KGTA 4PJOG 1E7OA 3VYHB 3CCJQ 1VQNT 3VYGA 3QBYA 1VQ8A 4QVCA 3CCVA 1M8MA 4M77E 3CEYA 1JB0E 3NPFA 2GTJA 1JJ2A 2JS2A 3X25B 1VQLT 2EYYA 4RTTA 4PJOB 2XD0A 5L8RE 2HCKA 2OTJA 4ZGDB 4J9CA 1U8RA 1BI2A 4KH0B 2M16A 3INZA 1BBZA 3LGLA 1QP3A 1LOJA 1KK7A 4C5EA 3QHSA 4OB1B 3S3OA 1BB9A 1M2OA 1Q81U 4X9DA 2LDMA 3I5SA 2RJFA 1LPLA 3FJ5A 2RJDA 3X28B 3OB9A 3M5AA 2ED1A 1T3SA 2RQVA 4Y28E 1VQKT 5I21A 4V2SA 1VQOT 4E7SA 4OGEA 1HJDA 2KMTA 1AZEA 2K2VA 2E1HA 5LJ5j 3OYIA 1WI7A 1AZGB 2EQJA 1U3OA 4EMKB 1TH7A 4ME7A 1K0SA 3X26B 1VQKA 3G1JA 1S72A 1W70A 2A0FB 5J26A 3RKXA 2E3IA 1H92A 3GNFB 1EIFA 3E2UA 2RHUA 1YIJT 2L89A 2KRNA 2RA2A 5GANe 2DIQA 1AVZC 2D8JA 3G4SA 3T9NA 1Q7YC 3CC2T 1OU8A 1AWXA 3V8KA 1AWOA 1JJ2P 4M75E 3FB9A 5GMKl 4X34A 2DILA 4WTOB 5GAOq 2DTIA 1M27C 3I55Q 3QDRB 1MNEA 3CD6A 3CC2A 1YJWT 4RKUE 3I56Q 2DRKA 1N8RR 1VQ6T 1TUCA 1YJWA 2O4XA 1YJ9T 2RJCA 2DL4A 4JZ4A 1YITQ 1M2VA 2JNGA 2K3XA 4RTZA 4F17A 1YJ9A 3L2WA 1KJWA 1W2BS 3EFOB 1JRIA 3ZFJA 2YRCA 1VQMA 1NJIU 4IUQA 2ATCB 2JM8A 2DZCA 2QG9B 4A4EA 2C06A 3UATA 2HDAA 2ZAEA 1G83A 2EKHA 2D8HA 1M5Q1 1ZSGA 3X24B 1VA7A 1AT1B 1UGVA 2ROTA 2QQSA 3C95A 5LJ3h 2KI7A 4DOVA 4M78G 1HYOA 2HNIA 1K0XA 1FXXA 5IHIA 2YLCA 1EFNA 5I2MA 3UT1A 1GRIA 2E6ZA 2FZCB 4DQ2A 1K4US 3EG9B 2PUKB 2VYTA 1PKSA 3M53A 4BI4A 1SSFA 4J8OA 1Q81R 4C8QE 3FIFA 2XDDA 1YBYA 5CO7A 3VS2A 3L2RA 1W1FA 4D8DA 2K79A 5KE2A 2COWA 4M78B 4C92G 3QG1A 4FYVB 3QWYA 2B86A 1M4ZA 2E65A 4XU1A 4J9IA 2L3QA 2A3LA 3PGGA 3QWXX 7AT1B 1S1NA 1RAFB 1TXQA 1PM3A 6AT1B 1C6VX 3CCQT 2H8HA 3VS0A 1PCXA 2MOXA 1VYVA 4C92B 2EQKA 3M0RA 1MMAA 4RTWA 4ZGJB 1D1AA 3MEAA 4LDWA 1KQSS 1WXUA 2DF6A 3CCQA 2YUOA 2D0QB 4DBRA 3BFMA 4M7DG 3LW5E 1WGSA 3M54A 2C0TA 3CMET 3A5ZB 1OI1A 2LX7A 4K11A 4AFSC 2B8AA 1ZUYA 5CK9A 1OOTA 2EWNA 3VUBA 2HKNA 4AFQC 3SD4A 4FSSA 4QT7A 2V1QA 1OEBA 1VQ9T 1BCOA 3V7CA 4M7DB 4PJOD 1PWTA 5GMKh 1UHCA 1GCQA 3CBPA 1G3WA 3M0TA 3RKYA 4ELYC 4ZN3A 1MV3A 2PQWA 1VQ7Q 4PFPA 1SKUB 4NL2A 2V8KA 3EFRA 2QGFB 4IIMA 1RADB 2Y4YA 2P4TA 1G3SA 3WVEB 4E7ZA 2L3PA 2KSSA 1BIBA 1TUGB 2O9VA 2C0IA 4A53A 2WACA 2LQWA 2HBPA 3LH5A 1M90U 2RH2A 2QQRA 3CCLQ 2DMOA 1WHJA 5GAMe 1WQWA 2GGRA 4L59A 3GPLA 2QXFA 1IRXA 5IXFA 1M9SA 2K2MA 1D0XA 3A1PA 4RTUA 5C0MA 2A28A 2XDPA 1RAAB 4N0AC 4F7UF 3WXMB 3ME9A 2LQNA 1VIFA 1U1TA 2KDSA 4C5IA 1SRLA 2COZA 3H6ZA 3JCMJ 1ZHIA 1TUDA 1VYTA 3RERA 2ZGWA 2L3SA 3QJYA 3CCUT 3ZEHA 3CCET 3RR6A 2YXYA 1QVFS 5A0LA 2RMOA 2Y4XA 2FG0A 3EGXB 1FWZA 3CCUA 3HL8A 4M77G 3QKJA 3EGDB 1O9SA 2EGEA 3NTHA 3CCEA 1IREB 2X4JA 3CCMT 1VQ5T 1OQKA 1RACB 4IUTA 3KFVA 3CCRA 4A4FA 3R6NA 3P8HA 3FRNA 1OYXA 3L42A 2LCLA 2KYBA 3GP8A 1Y07A 2EQMA 4M77B 2K5FA 2BZXA 2BIVA 2P84A 3RBBB 4DEYA 5GANf 3FDRA 3URGA 4QKUA 1G3TA 2VWFA 1SG5A 2NUTB 2DL7A 2K57A 1GCPA 1AEYA 3H0IA 3FJPA 3MJXA 3JB9F 3MKDA 1YI2T 3RESA 1Q86R 2RQWA 3MEUA 1GFCA 5DLQE 3OS2A 4M7AC 2LP5A 1QMCA 2DL8A 1R8OB 5KCHA 2NUZA 4XTYA 1YI2A 2OI3A 1WFWA 5DLOA 3G71Q 2GQIA 1QKWA 2EYQA 3U23A 2M51A 2QYZA 1ZUUA 5GAN2 3QJ6A 3EG1A 1OV3A 2HQHA 2L5QA 2QEXT 2CDTA 1KHCA 4B6MA 4GLMA 3HHTB 1XNIA 2K9GA 4CC7A 2FEIA 1M90R 4LNPA 3SHWA 1LCKA 4RTYA 1IGQA 2XHCA 2PZ1A 2EKOA 3TU4K 3BDUA 2ZPGB 3L2QA 4LD9K 2KYMA 1PHTA 3RIRA 3G6ET 2QI2A 4F7UA 1UFFA 1VQPA 1YJNA 1KD1U 4C92D 3CMAA 4M75B 3A8LB 3G6EA 3MHXA 1I5OB 2ABLA 3EH2A 1G8XA 4HCZA 2CT4A 2DEQA 2LVMA 4E7LA 2FZKB 3NFCA 4BE2A 3EG2A 1FYNA 4JPBW 2R5AA 2LC4A 5LJ3g 1UTIA 2OTLT 2RK2A 4FU6A 3A8HB 1WX6A 2YT6A 3FEOA 3M55A 2FL7A 2JTEA 1M1KU 2A08A 2G6FX 3D7SB 3CPWA 2A37A 5GMKm 4FIBA 3NTKA 2O9SA 1BIAA 2VASA 5ECAA 4OMFB 4OMQA 2ESWA 5KCOA 1F1BB 4CC3A 2CP2A 4OVAA 2QDLA 1K9AA 5GANh 4A4GA 1W4SA 2CUDA 2DO3A 4WCIA 1Y57A 1MGQA 3THKA 2KVQG 2PU9B 1NM7A 1I0CA 1Y71A 4C8QG 2SEMA 1K8AR 1GFDA 2YUQA 1JU5C 4HXJA 5GJVB 4PLIA 5LL6S 5GAN7 4Z88A 2HAXA 3M58A 1LVKA 3HPWA 3CCST 4J7IA 1VQ4Q 1QW1A 2J6KA 2LZ6B 1I07A 4C8QB 3M0UA 2V1RA 1J3TA 3HRUA 4M7AA 1H641 2KXDA 2QASA 1K73C 3AHUA 4HA8A 5KE3A 3OBYA 5GAN5 1KIKA 4IKFA 4DA4A 1UECA 3QXEB 1P92A 4JJNK 1FMKA 3CXCA 1KC8U 1NLOC 2BTTA 4MZPA 4M7AB 3L1AA 3OYNA 4BDYA 3CPWP 2CZ6B 2K3BA 1OPKA 3CCJT 2J7IA 2WSEE 2DKGA 3IQLA 2NUPA 4E7HA 2DVJA 2LJ1A 1YHQT 4IUPA 3CBOA 5GAMf 2JN0A 4JDSA 4J9GA 4MZMA 1YCSB 4J7FA 1B3QA 3J81E 1EZZB 5CKDA 3C12A 4WF2A 1PKTA 2QA4Q 1VQNA 4C0DC 1MNDA 4GLKA 4Y92A 3ULRB 1KD1R 1FMWA 1VUBA 2FVUA 4Z89A 1ACMB 5FRMA 1VQ8Q 4M77D 2L3RA 3CCVQ 4MDXA 5LJ5e 2DM1A 1ZSZC 1OZ2A 1XJWB 1D1BA 1M1GA 1VQLA 1RABB 2IIMA 5HK0A 1WHLA 4BD3A 1C0MA 2X35A 1T3LA 1X2KA 4XU0A 1ABOA 4BY6C 2OTJQ 4ZTFA 1TWBA 2JW4A 3V7RA 3VS3A 1MMNA 1UGQB 4A63B 1QP2A 1CKBA 4MMLA 2QTVA 1M3CA 1XTDA 3P8DA 1K9MR 4M78F 3CXCP 1I4K1 2LQKA 1K8AC 5CKFA 1Q82C 3BW1A 2MPXC 2H3EB 3QYGB 4FCYA 2KEAA 2EW3A 1VQOA 2KR3A 3QZ5B 4ZN1A 4PJMA 4DBQA 3JCMe 2OAWA 3TVTA 2JS0A 5GAOp 3E19A 3I55T 1VQKQ 4QVDA 2QQBA 2DERA 4AMCA 1S72Q 4Z02A 1YIJA 3OYMA 2P0KA 1N9RA 4RCCA 1M8VA 1NLPC 1OX8A 1OZ3A 2RQUA 3LLRA 2AK5A 1QCFA 1B34A 4FYXB 1JJ2S 3G4SQ 4HT8A 2RQTA 4M75D 1BYMA 4J9DA 2JVVA 1GCQC 2HMAA 1GXIE 2F2VA 1X6GA 2PVOB 4N4HA 1YIJQ 4HVUA 1WJRA 4QQDA 1YITT 3CD6Q 3LWHA 3CC2Q 1B34B 1VQ6A 1QWFA 2K4YA 4M7DF 1KC8R 5EC7A 5IHNA 2ZPFB 3MPUB 1WJSA 5GAMh 2O4XB 2M1HA 1YJWQ 2EQUA 4JJBA 2JTMA 1E6GA 4E47A 2FPEA 2X3WD 3I5RA 3H8ZA 1M2VB 2FPDA 5HY6A 1TSFA 3EAEA 2SRCA 1AWJA 1YJ9Q 4EMHA 1MMDA 1Q95G 5CIUA 4FYWB 2MCNA 1I5LA 1FX7A 3PFSA 1IZ6A 2RI5A 3OYFA 5DY9A 1VQMQ 2M0OA 2GTOA 1UG1A 1WDXA 5GAN8 4IIOA 2EJFA 2D6FA 3OYAA 2GNCA 2YRDA 3JSCA 1HK9A 4LDUA 2LCCA 1CSKA 4L6V5 1LJOA 1KQ1A 1M3BA 3EG0A 1CKAA 2M02A 1ZSZA 4PFOA 1MMGA 5AYFA 1MHNA 2ECZA 2OX7A 2EAYA 5D6XA 1PD0A 1V76A 4OMNA 2JT4A 3JRZA 3PMTA 4OGCA 3VV0A 3LH0A 3L2UA 4BE0A 1FMVA 4C5HA 5A2QE 2DYIA 2GQVA 1WXTA 2JM9A 3VRYA 5KYUA 1WZOA 5D7UA 4Q5WA 4C8QD 3M59A 1R77A 3HP9A 4LUEA 2C0OA 3GBQA 4BY6B 3OMCA 4M7AE 3QO3A 4R0KA 1RI9A 4J9HA 2CREA 3OW2A 4ZGEB 1GBRA 1JBMA 2EJGA 4FSXA 2VB6A 2CKKA 2HZYA 4M7AD 2NLUA 3CC7T 4PL6A 2DL3A 5GANg 3EHRA 1RAEB 2GFUA 2J06A 5LJ3d 1N8RC 3OYCA 3CC7A 2CP3A 4M77F 1SF9A 5GAN6 3M57A 1TS9A 1IXDA 4PJJA 2IG0A 2X9HA 3BE3A 3CCQQ 2CYZB 1WYXA 9ATCB 3J80E 5CVIA 3CMEA 1PD1A 2RK1A 2PTKA 1VQ7T
chains in the Genus database with same CATH topology
5DLQE 3OS2A 4M7AC 1XOVA 2GFAA 2LRQA 3UDCA 3OSSC 3V7SA 2I2LA 1QVGA 1R8OB 5KCHA 4XTYA 1YI2A 1WPYA 1VQ9A 3HKSA 1ZQ1A 1QVFA 5DLOA 3JCMd 2O01E 1YITA 2EYQA 2PVGB 4PLLA 4ELZC 4II1A 1UEBA 4A4KA 5GAN2 1RI0A 2DPPB 3V8LA 3QJ6A 3HRSA 1N6AA 5D6YA 2L5QA 5GAN3 2ZPEB 2X4YA 2QEXT 1NPPA 3OS1A 3CCLT 1KHCA 1KD1C 2BUDA 3FLGA 4KULA 2VXEA 4L5GA 3V8JA 2FYKA 3M4GA 1X75C 4J6XA 3CC4T 3QSUA 5GAOl 3A8GB 3HHTB 2CZ1B 1XNIA 4O5VA 2PUOB 2V8JA 4C0FA 3L2VA 4JRPA 5J3BA 4CRIA 3OBWA 2P0QA 5GANj 3O8VA 4QQGA 4XTVA 3JB9I 3NTIA 2QA4A 1BI3A 2QQ9A 4PNOA 2XHCA 2RHXA 3KXTA 1KQSA 3CC4A 2EKOA 3ASKA 4PJOG 3BDUA 2K5IA 3TU4K 3VYHB 3JCMb 2ZPGB 3L2QA 2AHJB 1VQNT 4FM4B 2RHZA 3TCJA 1NPRA 4ATOA 4LD9K 3VYGA 1KG1A 1YCYA 2DXUA 4BACA 4E7IA 3QBYA 1VQ8A 3R6OA 3RIRA 4QVCA 3G6ET 2ZCFB 5FU6B 3SWNC 2KAFA 2QI2A 4QW2A 4F7UA 5LJ5g 1D3BA 3CCVA 4J6YA 1VQPA 4RCBA 1YJNA 3OS5A 3VKIA 3M9QA 4M77E 1Q81C 3CEYA 1JB0E 1KD1U 1M1KC 4O6JA 4C92D 4M75B 4PKCC 3CMAA 4C0DB 3A8LB 5LJ5f 3VJPA 1UB4A 1JJ2A 3G6EA 3MHXA 3X25B 1VQLT 2MI6A 2JOYA 4PJOB 2XD0A 5L8RE 4HCZA 2OTJA 4LDYA 5CKEA 2DEQA 2LVMA 5KH6A 4ZGDB 4E7LA 1K9MC 3NFCA 2EIFA 2XG8D 3MO8A 1U8RA 2XK0A 4BE2A 1BI2A 5CQXA 2R5AA 2LC4A 4HKEA 3UPUA 2M16A 5LJ3g 3INZA 2OTLT 3LGLA 4N4IA 1QP3A 1X6OA 1LOJA 2RK2A 3GF5A 4FU6A 4J5YA 2VV5A 3A8HB 5GAMd 3JB9D 4C5EA 3QHSA 4OB1B 2EFIA 2MMPA 3FEOA 4M78A 5CQYA 3GOXA 3S3OA 3M55A 5CR2A 2FL7A 1Q81U 4X9DA 1M1KU 2LDMA 4EPCA 2QDYB 2RJFA 3RUXA 3CPWA 3M56A 3X28B 1QVPA 2RJDA 4FIBA 3NTKA 5GMKm 4R56A 1KQ2A 1BIAA 3OB9A 4YTLA 2LTOA 4OMFB 5IT9E 3M5AA 4B9WA 5KCOA 4HCCA 2E12A 5FU7B 5D6WA 3G7ZA 3CCMA 2F5KA 4FL6A 1VQ5A 4Y28E 1VQKT 3GLXA 4M77C 5I21A 4OVAA 3JCMg 4C92A 4V2SA 3JCMc 4EMGA 1VQOT 2F5TX 4OGEA 2HQEA 5GANh 2KMTA 4A4GA 3JCMW 2K2VA 2E1HA 1Y96A 1W4SA 5LJ5j 3OYIA 2K3YA 4KBMB 2EQJA 3JCMf 4EMKB 2DO3A 1TH7A 4ME7A 2YHTA 2RM4A 3X26B 1VQKA 1MGQA 2KVQG 2PU9B 3LX7A 1Y71A 4KUIA 4C8QG 1S72A 3RKXA 5J26A 1XQHA 4XTWA 3GNFB 1EIFA 3QZ9B 2E70A 3OA6A 2RHUA 4JLIA 2L89A 1YIJT 4X9CA 2RA2A 5GANe 5FRNA 2DIQA 4PLIA 5LL6S 3G4SA 1KC8C 5GAN7 3T9NA 1Q7YC 3CC2T 5LJ3j 2HAXA 3V8KA 3M58A 2IVWA 4R55A 2KK4A 4XTUA 3HPWA 3CCST 4M75E 3FB9A 5GMKl 4X34A 4J7IA 5GAOq 2DTIA 2X4WA 3HRTA 1QW1A 2E5QA 4M7DA 3QDRB 3CD6A 3DKMA 4TVRA 3HSBA 4C8QB 1YJWT 3CC2A 4PJOE 3L2ZA 4JUVA 4RKUE 1VQ7A 3TREA 3HRUA 4M7AA 1H641 4JRIA 1VQ6T 1U1SA 1K73C 1LNXA 3AHUA 4HA8A 4C8QF 5KE3A 1Q86U 3OBYA 5GAN5 3META 4A54A 4JS4A 4IKFA 4DA4A 1YJWA 2DXBA 2O4XA 3QXEB 3RKWA 1P92A 4BI8B 4XU2A 2RJCA 4JJNK 1YJ9T 2OAUA 5GAOn 5CKBA 3CXCA 1KC8U 1N27A 1Q7YU 4MZPA 4M7AB 3L1AA 3OYNA 1WJQA 3CPFA 4BDYA 4M75G 2CZ6B 3TEEA 2QEXA 3CCJT 2K3XA 2JNGA 3CCLA 5IAYA 1DJ7B 2WSEE 2DKGA 1YJ9A 2DXCA 3L2WA 5GAMg 2D9TA 2VGMA 4E7HA 2X4XA 1W2BS 2LNVA 1YHQT 1AHJB 1JRIA 4IUPA 2RO0A 3CBOA 2JN0A 4JDSA 3E1SA 3QUIA 3ZFJA 4MZMA 5GAMf 3OW2S 2R57A 1H3ZA 4J7FA 3VUZA 3JAME 3J81E 1VQMA 2MF2A 1NJIU 2LQ8A 5LJ5h 1K73U 4KUDK 1KHIA 3MP1A 3C12A 4IUQA 4WF2A 3SB2A 5CKDA 1UGRB 1N9SA 3QYHB 4M75C 1VQNA 4C0DC 2DZCA 4GLKA 3F70A 2RHYA 3OYBA 3FC3A 2DAQA 4A4EA 2C06A 1VUBA 3SFMA 4PJOC 3SWNA 2FVUA 3CBMA 4C0ZA 3OY9A 1M5Q1 2M9UA 3X24B 4F7UB 4M75F 1D3BB 5FRMA 4FT2A 4M77D 2XI9A 4BB7A 2L3RA 1G3YA 3VU3C 4MDXA 2DVEA 5LJ5e 2QQSA 3BDLA 3C95A 1OZ2A 3PMIA 4XQ3A 3MCAB 3PNWC 4LDVA 4M78G 4PJOF 5LJ3h 2CS7A 4DOVA 1M1GA 1VQLA 2HNIA 1FXXA 2WSFE 2YLCA 4VUBA 5HK0A 3A8MB 2E41A 2H3JA 5DM7R 5I2MA 4BD3A 3UT1A 2E6ZA 2X35A 2WSCE 4UC4A 4XU0A 4BY6C 2XICA 4RG8A 4DQ2A 4ZTFA 4EDUA 2JUFA 2L8DA 2PUKB 2VYTA 4IUUA 5GMKj 4J6WA 4RMOA 2OTLA 3M53A 4BI4A 1SSFA 4J83A 4J8OA 3V7RA 5GAOr 4C8QE 3FIFA 2XDDA 1UGQB 1V29B 1YBYA 5LJ3e 3PTAA 5CO7A 3L2RA 5FLXE 1QP2A 4C5GA 5KE2A 4BI3A 4M78B 4C92G 3PIOA 3DLLA 1QVGS 3S3MA 3QG1A 5GAMj 4MMLA 5I2SA 4JLGA 4XAXB 4MMKA 4JRQA 2A7YA 1M4ZA 3RMQA 2RHIA 1XTDA 2XU8A 3P8DA 3PIPA 4M78F 3JCMh 2E65A 1I4K1 4XU1A 3CCRT 2MAMA 2LQKA 4MZTA 1K8AC 4EMKC 5CKFA 2A3LA 3PGGA 3JCMP 2GF7A 1Q82C 1O75A 3BW1A 5CCAA 3X20B 4IURA 2YRVA 3CCQT 4NS5A 2KQWA 3QYGB 4M77A 1RL2A 5GMKi 3JB9G 1VIEA 5A0DA 1VQOA 2RI3A 3JB9H 3QZ5B 4C92B 1Q86C 2E10A 2XKOC 4ZN1A 2EQKA 2DTHA 4ZGJB 3MEAA 1Y96B 4B9XA 1ZBXA 2K5LA 2CZ0B 4LDWA 4QVZA 3JCMe 1KQSS 3CCQA 4IUVA 5GAOp 2ZPBB 5GAN4 2D0QB 1HXDA 3BFMA 4HCBA 4OB3B 4OP0A 3E19A 3DB3A 4BE1A 4M7DG 3LW5E 3I55T 2VXFA 2HD0A 4QVDA 1WGSA 2QQBA 2EJ9A 3M54A 4E7JA 1NZ9A 3G71T 4Z02A 2JTFA 3OYMA 3CMET 1YIJA 3A5ZB 2LX9A 4C8QC 1OI1A 4M7AG 2P0KA 1N9RA 4RCCA 2CGHA 2ZZDA 1OZ3A 1K8AU 2VC8A 1M8VA 3LLRA 3E9GA 2P0PA 2B8AA 1NE8A 5CK9A 3OYJA 1Q82U 2EWNA 3VUBA 2HQXA 4HT8A 1B34A 3CCSA 1JJ2S 2RI2A 3QPHA 4M75D 1BYMA 3SD4A 1WNLA 3G71A 1NJIC 2JVVA 1M90C 2VGNA 2RB6A 3KBGA 2MWOA 1GXIE 1VQ9T 4M7DB 2PVOB 2RD1A 4N4HA 3V7CA 4C0GA 3JCMV 4PJOD 1WJRA 4QQDA 3S6WA 1YITT 5GMKh 1M1FA 3LWHA 5HK3A 1B34B 1VQ6A 1BI0A 4XU3A 2K4YA 3CBPA 3OMGA 4M7DF 1G3WA 5J39A 2DZ9A 2DTOA 3Q1JA 4D6WA 3LYIA 3A8OB 3RKYA 4ELYC 4ZN3A 2PQWA 2ZPFB 3P8BB 1N8RU 4NL2A 4XTXA 1WJSA 2V8KA 3EFRA 2ZPIB 3HFOA 2O4XB 5GAMh 4M7AF 4OF1A 5GANd 2Y4YA 2P4TA 1G3SA 2M1HA 3OYGA 4F7UG 2EQUA 3WVEB 4JRKA 4Y91A 4M78E 2JTMA 2Y90A 3JCMX 3JB9J 4E47A 2E64A 4CI0C 5GMKe 5FU6C 2KSSA 1BIBA 3MP6A 3H8ZA 3CPWS 3CCJA 4A53A 2DXTA 2QA4T 4BUGA 3PT9A 2WACA 1UGSB 2DK3A 2JZ2A 2HBPA 5HY6A 1M90U 2RH2A 3EAEA 2QQRA 1I8FA 3JCMQ 3N5BB 4M78D 1YHQA 2CZ7B 5GAMe 1WQWA 2VUBA 4EMHA 1VQ8T 2PVDB 4L59A 3GPLA 2QXFA 5M9OA 3SDZA 2XIDA 1M9SA 5CIUA 5A0GA 3CCVT 1I5LA 3DB4A 1FX7A 3PFSA 1YJNT 1VQPT 1IZ6A 2RI5A 2LT4A 5C0MA 3OYFA 4M75A 4LD6A 4JS5A 5DY9A 4HT9A 3E9FA 2M0OA 4C92E 2XDPA 3CMAT 1PSEA 2FHDA 3LWIA 3LGFA 5GAN8 2EJFA 4N0AC 1X01A 4OB2B 3ER0A 2D6FA 3OYAA 4PJOA 4F7UF 3JSCA 1HK9A 3WXMB 3SWNB 4LDUA 2OTJT 3ME9A 4NOYA 2LCCA 4L6V5 1VIFA 1U1TA 2KDSA 1LJOA 2LT1A 1KQ1A 2RJEA 2YLBA 4C5IA 3OQ5A 2KY9A 3KUFA 4ZTJA 4N0AA 3OSVA 5AYFA 1MHNA 3H6ZA 3JCMJ 2EAYA 5D6XA 3GIBA 3HFNA 1ZHIA 3J7AF 3RERA 4BDZA 2QQAA 1Y7XA 3JRZA 2ZGWA 3PMTA 3MEVA 4M78C 3QJYA 2DD4A 4OGCA 3CCUT 3VV0A 3OYLA 3LH0A 3ZEHA 3L2UA 4BE0A 5C6SA 5FU7C 4C5HA 3CCET 2V8IA 5A2QE 3M4YA 4MDWA 2FB7A 2GQVA 5EG2A 3GNGA 1QVFS 5IN1A 5A0LA 4LDXA 4Q5WA 3UWNA 4M7DE 2Y4XA 2DIGA 3M59A 3MP8A 5LJ3f 4C8QD 3HP9A 1FWZA 1BI1A 4OB0B 3CCUA 5FROA 3HL8A 4M77G 1BKBA 3QKJA 1O9SA 3C4SA 1W2BA 3NTHA 4BY6B 2MWPA 3OMCA 3CCEA 3S3NA 1IREB 4M7AE 2X4JA 4XK8E 3CCMT 1VQ5T 3QO3A 4N4GA 2BKDN 3OYYA 4XTZA 4DOWA 5LJ5d 3DLMA 4M7DD 3OW2A 4ZGEB 4C92C 4IUTA 3CXCS 4RG2A 4E7KA 3CCRA 3OS0A 4A4FA 1JBMA 3OYHA 2EJGA 4FSXA 3P8HA 3OYDA 2DD5A 2CKKA 4EMKA 3OYKA 3FRNA 2E6NA 5CAIA 1K9MU 4M7AD 4GY5A 2NLUA 3CC7T 5CKHA 4PL6A 4NL3A 1VQMT 1OYXA 3L42A 2LCLA 3GP8A 3C94A 2GCXA 4C92F 1Y07A 2EQMA 4M77B 2K5FA 1WQ7A 2G3RA 3EFSA 1S72T 5GANg 1VQ4T 2R58A 2GFUA 2BIVA 2R5MA 3BY7A 2DJZA 5LJ3d 1UGPB 1N8RC 3OYCA 3CC7A 4M77F 5GANf 3I56T 5GAN6 3FDRA 3QIIA 3M57A 3URGA 5GAOm 3G4ST 3MEWA 1G3TA 4P5NA 2QTXA 1I81A 2IG0A 5HKCA 2K57A 1VQ4A 4F7UE 3I55A 2CYZB 4FT4A 3RMSA 1G5VA 3FJPA 4KT0E 3J80E 3JB9F 3I56A 5CVIA 3CMEA 4C8QA 3ZBDA 2XDBA 3CD6T 4M7DC 3OYEA 1YI2T 2RK1A 4QQ6A 3RESA 1PSFA 3WVDB 2ZPHB 3MEUA 4A4HA 2F69A 1VQ7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1H A;  3JCM Q;  1Y96 A;  4M78 D;  4XU0 A;  4DQ2 A;  5LJ5 j;  4M7A C;  3JCM f;  5GAM e;  1WQW A;  4EMH A;  4EMK B;  1TH7 A;  3V7S A;  2YHT A;  5GMK j;  2I2L A;  2RM4 A;  4J6W A;  4XTY A;  1MGQ A;  1WPY A;  3V7R A;  5GAO r;  4C8Q E;  3FIF A;  3JCM d;  1I5L A;  4C8Q G;  5LJ3 e;  4M75 A;  3RKX A;  4HT9 A;  5DY9 A;  4XTW A;  4C92 E;  5GAN 2;  4M78 B;  4C92 G;  3V8L A;  5GAN 8;  2EJF A;  4JLI A;  4MML A;  4N0A C;  1X01 A;  5GAM j;  4X9C A;  2RA2 A;  5GAN 3;  4PJO A;  4F7U F;  5GAN e;  1HK9 A;  4MMK A;  3SWN B;  5GAN 7;  4NOY A;  2VXE A;  4M78 F;  2E65 A;  3JCM h;  2FYK A;  2YLB A;  1U1T A;  3M4G A;  1I4K 1;  1LJO A;  1KQ1 A;  4J6X A;  4XU1 A;  3V8K A;  5LJ3 j;  5GAO l;  4XTU A;  3QSU A;  4M75 E;  4EMK C;  3FB9 A;  5GMK l;  4N0A A;  3PGG A;  5GAO q;  2DTI A;  3JCM P;  3JCM J;  2EAY A;  3BW1 A;  4M7D A;  5GAN j;  4XTV A;  3JB9 I;  3HSB A;  3GIB A;  3HFN A;  4PNO A;  4C8Q B;  4M77 A;  4PJO E;  3RER A;  3L2Z A;  3V8J A;  4PJO G;  3BDU A;  4JUV A;  5GMK i;  3JB9 G;  3JB9 H;  3JCM b;  2ZGW A;  4C92 B;  4M78 C;  2E10 A;  2DTH A;  4M7A A;  1H64 1;  4JRI A;  1YCY A;  1U1S A;  1LNX A;  2DXU A;  4HA8 A;  4C8Q F;  3AHU A;  3JCM e;  1Y96 B;  5GAN 5;  3RIR A;  4QVC A;  2FB7 A;  4A54 A;  3SWN C;  4F7U A;  5GAN 4;  5GAO p;  3RKW A;  1D3B A;  5LJ5 g;  1HXD A;  4J6Y A;  3BFM A;  4RCB A;  4OP0 A;  5LJ3 f;  4C8Q D;  4M7D E;  4XU2 A;  4M7D G;  4M77 E;  5GAO n;  2VXF A;  4M77 G;  4C92 D;  4M75 B;  4QVD A;  2EJ9 A;  5LJ5 f;  4M7A B;  3L1A A;  4M7A E;  4M75 G;  3QO3 A;  4C8Q C;  4M7A G;  4XTZ A;  1N9R A;  4RCC A;  2CGH A;  5LJ5 d;  4PJO B;  1M8V A;  2VC8 A;  2DKG A;  4M7D D;  5GAM g;  4C92 C;  2DEQ A;  3JCM W;  2EWN A;  1JBM A;  2EJG A;  1B34 A;  4HT8 A;  4EMK A;  4M75 D;  5CAI A;  1WNL A;  1JRI A;  4M7A D;  5GAM f;  5LJ3 g;  2JN0 A;  3INZ A;  3QUI A;  2RB6 A;  1LOJ A;  4J5Y A;  5LJ5 h;  4M7D B;  3V7C A;  2RD1 A;  4C92 F;  5GAM d;  3SB2 A;  3JCM V;  4WF2 A;  3JB9 D;  4PJO D;  3QHS A;  1N9S A;  4M77 B;  1WQ7 A;  3EFS A;  5GMK h;  4M75 C;  5GAN g;  4M78 A;  2DZC A;  1B34 B;  4XU3 A;  3BY7 A;  2DJZ A;  5LJ3 d;  4M7D F;  2DZ9 A;  2DTO A;  4X9D A;  4M77 F;  3SWN A;  5GAN f;  3RKY A;  4PJO C;  5GAN 6;  5GAO m;  4NL2 A;  4XTX A;  3RUX A;  2QTX A;  1M5Q 1;  3EFR A;  1I81 A;  3HFO A;  4F7U B;  4M75 F;  1D3B B;  2K57 A;  5GMK m;  5GAM h;  1KQ2 A;  5GAN d;  4F7U E;  4M77 D;  1BIA A;  4M7A F;  3VU3 C;  4F7U G;  4JRK A;  2DVE A;  4Y91 A;  5LJ5 e;  4M78 E;  3FJP A;  2Y90 A;  4NL3 A;  3JCM X;  4XQ3 A;  3JB9 J;  5LJ3 h;  4PJO F;  2E64 A;  4M78 G;  3JB9 F;  5GMK e;  4C8Q A;  1BIB A;  2HNI A;  4M7D C;  4A53 A;  2DXT A;  2YLC A;  4M77 C;  5I21 A;  3RES A;  2E41 A;  3JCM g;  4C92 A;  4V2S A;  3JCM c;  4EMG A;  5GAN h;  1I8F A; 
#chains in the Genus database with same CATH topology
 1XOV A;  2GFA A;  1TU0 B;  2I2L A;  1QVG A;  1YWP A;  1VQ9 A;  1QVF A;  2RQR A;  3H9N A;  4ELZ C;  4PLL A;  5I11 A;  1UEB A;  4A4K A;  1D0Y A;  4PJN A;  3HRS A;  1NPP A;  3NHN A;  1UUE A;  3OS1 A;  3CCL T;  2BUD A;  2K6D A;  4L5G A;  2VXE A;  1NBE B;  2FYK A;  3M4G A;  3CC4 T;  2JXB A;  5GAO l;  4J9B A;  1WIE A;  1NJI R;  4JRP A;  2P0Q A;  3OW2 P;  4F14 A;  2YUP A;  1ABQ A;  3NTI A;  1BI3 A;  2QQ9 A;  3KXT A;  2RHX A;  3CC4 A;  2K5I A;  1B07 A;  3O5Z A;  3JCM b;  3TCJ A;  1KG1 A;  2DXU A;  4BAC A;  3VS1 A;  4AFU C;  1QCN A;  3R6O A;  2ZCF B;  3SWN C;  4QW2 A;  1D3B A;  4J6Y A;  2GBQ A;  4RCB A;  3M9Q A;  1Q81 C;  1SHG A;  5LJ5 f;  3VJP A;  2RPN A;  1IO6 A;  2BE7 D;  5CKE A;  2EIF A;  3MO8 A;  1ZBJ A;  5CQX A;  4HKE A;  3UPU A;  4N4I A;  3GF5 A;  4J5Y A;  1AOJ A;  2EFI A;  2MMP A;  3VRZ A;  1QVG P;  1QVF P;  4LN2 A;  3M56 A;  4RTX A;  1KQ2 A;  4HCC A;  4B9W A;  2X3X D;  1ZUK A;  5D6W A;  3CCM A;  1VQ5 A;  4FL6 A;  3CCU Q;  2QK0 A;  4PFZ A;  3CCE Q;  3JCM c;  4EMG A;  2CP7 A;  1Y96 A;  3JCM f;  3CCR Q;  1K76 A;  4F16 A;  1QCO A;  2M0Y A;  4FW2 A;  4DBH A;  2HEQ A;  3QZ9 B;  2E70 A;  5HCK A;  3OA6 A;  1ZX6 A;  4D8K A;  4JLI A;  2JMC A;  1BU1 A;  4X9C A;  2NYS A;  2Z0W A;  3HTR A;  2EBP A;  5LJ3 j;  4R55 A;  2KK4 A;  4XTU A;  2AZV A;  2DJQ A;  2X4W A;  3HRT A;  5KYX A;  2J05 A;  2D0N A;  2E3H A;  1UJ0 A;  2KE9 A;  1X27 A;  3TRE A;  4JRI A;  5AT1 B;  1LNX A;  4C8Q F;  1OPL A;  2DXB A;  3RKW A;  4XU2 A;  1YN8 A;  5GAO n;  1YI2 Q;  1N27 A;  4Z8A A;  1Q7Y U;  2DYB A;  3CPF A;  4M75 G;  3TEE A;  2BE9 B;  8AT1 B;  2QEX A;  5IAY A;  5GAM g;  2VGM A;  4KRT A;  2X4X A;  2LNV A;  2LCS A;  2KRM A;  3E1S A;  2FO0 A;  1TG0 A;  2MF2 A;  2LQ8 A;  5LJ5 h;  4KUD K;  3MP1 A;  3QYH B;  1UGR B;  1N9S A;  2LJ3 A;  2RN8 A;  2RF0 A;  3F70 A;  2RHY A;  3OYB A;  4RUG A;  3SFM A;  4PJO C;  3SWN A;  3RDV A;  4C0Z A;  4F7U B;  1Z9Q A;  3NGP A;  4FT2 A;  2XI9 A;  1G3Y A;  3VU3 C;  4HCK A;  1VQP Q;  1YJN Q;  3PMI A;  4XQ3 A;  3MCA B;  4PJO F;  3CMA Q;  4VUB A;  3A8M B;  3G6E Q;  2H3J A;  1WHG A;  4UC4 A;  1H3H A;  2PNI A;  2XIC A;  4J9F A;  1D1C A;  2CP5 A;  4EDU A;  1YWO A;  2EGA A;  2JUF A;  2OTL A;  5GMK j;  4IUU A;  1GL5 A;  4RMO A;  4AG1 C;  3PTA A;  1V29 B;  5FLX E;  1T0J A;  4C5G A;  1ZA1 B;  3PIO A;  3DLL A;  2EGC A;  1QWE A;  5I2S A;  4JLG A;  3H0F A;  4XAX B;  2P4R A;  4MMK A;  2A7Y A;  3RMQ A;  1X43 A;  2XU8 A;  3PIP A;  3JCM h;  2CP0 A;  2MAM A;  4EMK C;  3JCM P;  3CQT A;  1O75 A;  4IUR A;  4NS5 A;  1RL2 A;  5GMK i;  3JB9 G;  1VIE A;  5A0D A;  3JB9 H;  2RI3 A;  1Q86 C;  2YUN A;  1WHK A;  2E10 A;  2XKO C;  2DE0 X;  2JMA A;  4B9X A;  2K5L A;  2CZ0 B;  4KH1 B;  5KYY A;  4OB3 B;  4OP0 A;  3VS4 A;  2JTF A;  2LX9 A;  4M7A G;  1K1Z A;  1NYF A;  2CGH A;  2ZZD A;  1B7T A;  3E9G A;  2P0P A;  1H8K A;  2HQX A;  1YP5 A;  3CCS A;  2RI2 A;  3QPH A;  2V26 A;  1WNL A;  1M90 C;  1E6H A;  3KBG A;  2RD1 A;  3JCM V;  3S6W A;  1KSW A;  1BI0 A;  3OMG A;  4KGZ B;  5J39 A;  2DZ9 A;  3Q1J A;  4D6W A;  3LYI A;  1Q7Y R;  2BZ8 A;  1N8R U;  3EGU A;  1V1C A;  3HFO A;  1WHM A;  5GAN d;  1WA7 A;  2ED0 A;  3OYG A;  2L2P A;  4AG2 C;  5KYW A;  4Y91 A;  2E64 A;  1GBQ A;  3MP6 A;  5FU6 C;  3CPW S;  3CCJ A;  2QA4 T;  1X2Q A;  4BUG A;  3VS5 A;  1UGS B;  2W10 A;  2CUB A;  4DEX A;  2NUP B;  4M4Z A;  1NEG A;  3N5B B;  1YHQ A;  2CZ7 B;  1VQ8 T;  5M9O A;  2XID A;  5A0G A;  3CCV T;  1JO8 A;  1N5Z A;  2L0A A;  2LT4 A;  4JS5 A;  3E9F A;  1PSE A;  3LWI A;  1X01 A;  3ER0 A;  1VQN Q;  4PJO A;  1YHQ Q;  1M3A A;  2OTJ T;  2YLB A;  1QQJ A;  2KRO A;  2COY A;  1PRM C;  2RJE A;  2VKN A;  2KY9 A;  4ZTJ A;  1W6X A;  1T0H A;  2BZY A;  4ZNX A;  1UDL A;  4F04 B;  3TSW A;  3GIB A;  3J7A F;  4BDZ A;  1Y7X A;  1M1K R;  1VQL Q;  4M78 C;  2DD4 A;  4LUD A;  5FWB A;  1RUW A;  5FU7 C;  3M4Y A;  4MDW A;  4LE9 A;  1G2B A;  2QGG A;  4LDX A;  3UWN A;  5LJ3 f;  1BCM A;  3EG3 A;  1BI1 A;  3I9Q A;  2XMF A;  3C4S A;  1W2B A;  2LJ0 A;  2MWP A;  3S3N A;  2IPO B;  4XK8 E;  4N4G A;  1ARK A;  2BKD N;  1SSH A;  3OYY A;  4XTZ A;  4DOW A;  4C92 C;  3CXC S;  4E7K A;  1NYG A;  3OS0 A;  4EMK A;  1JXO A;  2E6N A;  5CAI A;  1WHH A;  3C94 A;  1D09 B;  2GCX A;  4LXC A;  4C92 F;  1PG5 B;  1S72 T;  1WQ7 A;  3EFS A;  1OU9 A;  2R58 A;  1RLP C;  2FPF A;  2R5M A;  2DJZ A;  1D0Z A;  1VQO Q;  3I56 T;  2DEU A;  5GAO m;  3G4S T;  3MEW A;  1U5S A;  2QTX A;  1RLQ C;  4F7U E;  4J9E A;  3I55 A;  1HSQ A;  4FT4 A;  3RMS A;  4KT0 E;  3I56 A;  3ZBD A;  3CD6 T;  4KGV B;  4M7D C;  2DBM A;  3WVD B;  1NEB A;  4A4H A;  2LRQ A;  1I1J A;  3V7S A;  3OSS C;  3HKS A;  1ZQ1 A;  2D1X A;  1YIT A;  5IH2 A;  1RI0 A;  2DPP B;  3REB B;  5D6Y A;  5GAN 3;  2ZPE B;  2QAZ A;  1KD1 C;  1VQ6 Q;  1R0C B;  3FLG A;  4KUL A;  2EYZ A;  1X75 C;  4J6X A;  3QSU A;  1W2B P;  3EFO A;  4EIK A;  2CZ1 B;  4O5V A;  2PUO B;  1JXM A;  2V8J A;  4C0F A;  5IHK A;  3L2V A;  5J3B A;  4CRI A;  3OBW A;  4CC2 A;  8ATC B;  1AWW A;  5GAN j;  3O8V A;  4QQG A;  1PNJ A;  4XTV A;  1VQM T;  2HSE B;  1KQS A;  3ASK A;  4AT1 B;  2AHJ B;  4FM4 B;  2RHZ A;  1VYU A;  1NPR A;  2DRM A;  4ATO A;  1TOV A;  1YNZ A;  2KT8 A;  1YCY A;  4E7I A;  4ANJ A;  1KFZ A;  4HVW A;  5FU6 B;  3AT1 B;  2KAF A;  5LJ5 g;  3OS5 A;  3VKI A;  1RAH B;  2HL3 A;  1M1K C;  4O6J A;  4PKC C;  4C0D B;  1UB4 A;  2MI6 A;  2JOY A;  1Z9Z A;  4LDY A;  2FZG B;  5L23 A;  5KH6 A;  4X1V A;  1K9M C;  2XG8 D;  3JV3 A;  2XK0 A;  3EG9 A;  3PE0 A;  2NWM A;  1ZSZ B;  2KBT A;  1X6O A;  4JZ3 A;  2I0N A;  2VV5 A;  5GAM d;  3JB9 D;  4OMM A;  4M78 A;  5CQY A;  3GOX A;  4PJL A;  5CR2 A;  2CH4 A;  4EPC A;  2QDY B;  2FRY A;  3RUX A;  1WXB A;  5KYU B;  1QVP A;  4R56 A;  4YTL A;  5I22 A;  2LTO A;  5IT9 E;  2E5K A;  2E12 A;  5FU7 B;  2AT1 B;  3G7Z A;  2F5K A;  3NMZ C;  1A0N B;  3VS6 A;  3GLX A;  4M77 C;  2DL5 A;  3JCM g;  4C92 A;  4E2F B;  2F5T X;  2HQE A;  3JCM W;  2CSI A;  2K3Y A;  4KBM B;  1KQS P;  2YHT A;  3M0Q A;  2RM4 A;  4DBF A;  1SPK A;  3LX7 A;  4KUI A;  4PK4 A;  2RNA A;  1XQH A;  4XTW A;  4JJD A;  5FRN A;  1UHF A;  1KC8 C;  2YDL A;  3CC7 Q;  2EYW A;  2O2O A;  2EYX A;  2KRS A;  2IVW A;  1R0B G;  2ROL A;  2O88 A;  2DET A;  2E5Q A;  4M7D A;  1IB8 A;  2HBW A;  2AKL A;  3DKM A;  4TVR A;  3HSB A;  1JQQ A;  4PJO E;  3L2Z A;  4JUV A;  2OJ2 A;  3A98 A;  3CME Q;  1VQ7 A;  2DA9 A;  1U1S A;  1OX9 A;  1Q86 U;  3MET A;  4A54 A;  3EHQ A;  4JS4 A;  3UA7 A;  4BI8 B;  2HKQ B;  2OAU A;  5CKB A;  1VQ9 Q;  3H0H A;  1WJQ A;  1ZLM A;  2MK5 A;  3CCL A;  1DJ7 B;  2DXC A;  2D9T A;  3UA6 A;  4OML A;  2KT1 A;  1AHJ B;  2RO0 A;  3QUI A;  3OW2 S;  2R57 A;  1H3Z A;  3VUZ A;  3JAM E;  1K73 U;  2F2X A;  1KHI A;  1WLP B;  3SB2 A;  1MV0 B;  1X6B A;  4ORZ A;  4M75 C;  1IGU A;  3FC3 A;  2DAQ A;  3CC4 Q;  1RAI B;  2CT3 A;  3CBM A;  4FW1 A;  3M0P A;  3OY9 A;  1M30 A;  2M9U A;  4M75 F;  1D3B B;  1OUL A;  3EH1 A;  4BB7 A;  2DVE A;  3BDL A;  1X69 A;  4NL3 A;  4KGX B;  3PNW C;  4LDV A;  2CS7 A;  2W0Z A;  2LNH B;  2WSF E;  2E41 A;  5DM7 R;  2WSC E;  2FRW A;  1EX4 A;  4RG8 A;  2L8D A;  2K7A A;  4J6W A;  4J83 A;  3EGX A;  5GAO r;  5LJ3 e;  3EGD A;  2MYS A;  4BI3 A;  2AZS A;  3ZL7 C;  1QVG S;  3S3M A;  5GAM j;  3PVQ A;  4JRQ A;  2RHI A;  2YWW A;  1QLY A;  3CCR T;  4MZT A;  2GF7 A;  2HL5 C;  5CCA A;  3X20 B;  2YRV A;  2KQW A;  4M77 A;  3CCM Q;  1VQ5 Q;  2DTH A;  2EVR A;  2DNU A;  1Y96 B;  1ZBX A;  4QVZ A;  4IUV A;  3H41 A;  2ZPB B;  2NUT A;  5GAN 4;  1HXD A;  3VS7 A;  5IXB A;  4HCB A;  3DB3 A;  4BE1 A;  2VXF A;  2HD0 A;  4RTV A;  2EJ9 A;  4E7J A;  1NZ9 A;  3G71 T;  4C8Q C;  1HD3 A;  1K8A U;  2VC8 A;  1NE8 A;  3OYJ A;  1SRM A;  1Q82 U;  2HSP A;  1PRL C;  2MIO A;  2DFU A;  2ENM A;  3G71 A;  1NJI C;  2VGN A;  2RB6 A;  2MWO A;  3PVL A;  1NG2 A;  5KYX B;  4C0G A;  2CP6 A;  3SEM A;  1M1F A;  5HK3 A;  4XU3 A;  1AD5 A;  2DTO A;  1TTH B;  3A8O B;  3P8B B;  4XTX A;  2ZPI B;  4M7A F;  4OF1 A;  4F7U G;  1VOM A;  4JRK A;  4M78 E;  2Y90 A;  3JCM X;  3JB9 J;  4CI0 C;  1ZA2 B;  5GMK e;  1QKX A;  4FYY B;  2DXT A;  3PT9 A;  2DK3 A;  2JZ2 A;  4CC4 B;  2QEX Q;  1K73 R;  1I8F A;  3JCM Q;  4M78 D;  2VUB A;  2PVD B;  1UJY A;  3SDZ A;  3DB4 A;  1VQP T;  4E6R A;  1YJN T;  4HVV A;  4GBQ A;  4OMP A;  4M75 A;  4LD6 A;  4HT9 A;  4C92 E;  3CMA T;  3RNJ A;  1UE9 A;  2FHD A;  3LGF A;  4OB2 B;  3SWN B;  5KYN A;  4NOY A;  2LT1 A;  3OQ5 A;  3KUF A;  4N0A A;  3OSV A;  3C0C A;  5FWC A;  3HFN A;  2O31 A;  4AFZ C;  2QQA A;  1YFN A;  2YSQ A;  3MEV A;  4ESR A;  1RAG B;  3OYL A;  5C6S A;  2V8I A;  2FB7 A;  2LMJ A;  5EG2 A;  1JEG A;  3GNG A;  5IN1 A;  4M7D E;  2DIG A;  3MP8 A;  2OTL Q;  1PC0 A;  4OB0 B;  5FRO A;  1BKB A;  2DBK A;  5LJ5 d;  3DLM A;  2X51 A;  4M7D D;  2KNB B;  2JJ9 A;  4RG2 A;  2J6O A;  3OYH A;  1IHW A;  3OYD A;  2DD5 A;  3OYK A;  1K9M U;  4GY5 A;  5CKH A;  2AKK A;  2EQI A;  2F2W A;  2J6F A;  1U06 A;  2G3R A;  1VQ4 T;  2VVK A;  1BK2 A;  3BY7 A;  3REA B;  1UGP B;  1SHF A;  1MUZ A;  3QII A;  1SEM A;  4P5N A;  2F1L A;  1I81 A;  5HKC A;  1VQ4 A;  5KYY B;  1C1A A;  1Q82 R;  1G5V A;  4C8Q A;  2XDB A;  3OYE A;  4JJC A;  3TQ7 P;  2E4H A;  4QQ6 A;  1PSF A;  2ZPH B;  2CSQ A;  2F69 A;  1IHV A;  2A36 A;  3TSZ A;  2AIR B;  3UDC A;  4OMO A;  3CCS Q;  3I35 A;  1WPY A;  3JCM d;  2O01 E;  2PVG B;  4II1 A;  2KXC A;  3V8L A;  2EPD A;  1N6A A;  2DX1 A;  2X4Y A;  3UF4 A;  3V8J A;  1Y0M A;  2CH4 W;  5FW9 A;  5GJW B;  3A8G B;  3QDF A;  5KYW B;  3M0S A;  2QA4 A;  3JB9 I;  2DLP A;  4PNO A;  2KGT A;  4PJO G;  1E7O A;  3VYH B;  3CCJ Q;  1VQN T;  3VYG A;  3QBY A;  1VQ8 A;  4QVC A;  3CCV A;  1M8M A;  4M77 E;  3CEY A;  1JB0 E;  3NPF A;  2GTJ A;  1JJ2 A;  2JS2 A;  3X25 B;  1VQL T;  2EYY A;  4RTT A;  4PJO B;  2XD0 A;  5L8R E;  2HCK A;  2OTJ A;  4ZGD B;  4J9C A;  1U8R A;  1BI2 A;  4KH0 B;  2M16 A;  3INZ A;  1BBZ A;  3LGL A;  1QP3 A;  1LOJ A;  1KK7 A;  4C5E A;  3QHS A;  4OB1 B;  3S3O A;  1BB9 A;  1M2O A;  1Q81 U;  4X9D A;  2LDM A;  3I5S A;  2RJF A;  1LPL A;  3FJ5 A;  2RJD A;  3X28 B;  3OB9 A;  3M5A A;  2ED1 A;  1T3S A;  2RQV A;  4Y28 E;  1VQK T;  5I21 A;  4V2S A;  1VQO T;  4E7S A;  4OGE A;  1HJD A;  2KMT A;  1AZE A;  2K2V A;  2E1H A;  5LJ5 j;  3OYI A;  1WI7 A;  1AZG B;  2EQJ A;  1U3O A;  4EMK B;  1TH7 A;  4ME7 A;  1K0S A;  3X26 B;  1VQK A;  3G1J A;  1S72 A;  1W70 A;  2A0F B;  5J26 A;  3RKX A;  2E3I A;  1H92 A;  3GNF B;  1EIF A;  3E2U A;  2RHU A;  1YIJ T;  2L89 A;  2KRN A;  2RA2 A;  5GAN e;  2DIQ A;  1AVZ C;  2D8J A;  3G4S A;  3T9N A;  1Q7Y C;  3CC2 T;  1OU8 A;  1AWX A;  3V8K A;  1AWO A;  1JJ2 P;  4M75 E;  3FB9 A;  5GMK l;  4X34 A;  2DIL A;  4WTO B;  5GAO q;  2DTI A;  1M27 C;  3I55 Q;  3QDR B;  1MNE A;  3CD6 A;  3CC2 A;  1YJW T;  4RKU E;  3I56 Q;  2DRK A;  1N8R R;  1VQ6 T;  1TUC A;  1YJW A;  2O4X A;  1YJ9 T;  2RJC A;  2DL4 A;  4JZ4 A;  1YIT Q;  1M2V A;  2JNG A;  2K3X A;  4RTZ A;  4F17 A;  1YJ9 A;  3L2W A;  1KJW A;  1W2B S;  3EFO B;  1JRI A;  3ZFJ A;  2YRC A;  1VQM A;  1NJI U;  4IUQ A;  2ATC B;  2JM8 A;  2DZC A;  2QG9 B;  4A4E A;  2C06 A;  3UAT A;  2HDA A;  2ZAE A;  1G83 A;  2EKH A;  2D8H A;  1M5Q 1;  1ZSG A;  3X24 B;  1VA7 A;  1AT1 B;  1UGV A;  2ROT A;  2QQS A;  3C95 A;  5LJ3 h;  2KI7 A;  4DOV A;  4M78 G;  1HYO A;  2HNI A;  1K0X A;  1FXX A;  5IHI A;  2YLC A;  1EFN A;  5I2M A;  3UT1 A;  1GRI A;  2E6Z A;  2FZC B;  4DQ2 A;  1K4U S;  3EG9 B;  2PUK B;  2VYT A;  1PKS A;  3M53 A;  4BI4 A;  1SSF A;  4J8O A;  1Q81 R;  4C8Q E;  3FIF A;  2XDD A;  1YBY A;  5CO7 A;  3VS2 A;  3L2R A;  1W1F A;  4D8D A;  2K79 A;  5KE2 A;  2COW A;  4M78 B;  4C92 G;  3QG1 A;  4FYV B;  3QWY A;  2B86 A;  1M4Z A;  2E65 A;  4XU1 A;  4J9I A;  2L3Q A;  2A3L A;  3PGG A;  3QWX X;  7AT1 B;  1S1N A;  1RAF B;  1TXQ A;  1PM3 A;  6AT1 B;  1C6V X;  3CCQ T;  2H8H A;  3VS0 A;  1PCX A;  2MOX A;  1VYV A;  4C92 B;  2EQK A;  3M0R A;  1MMA A;  4RTW A;  4ZGJ B;  1D1A A;  3MEA A;  4LDW A;  1KQS S;  1WXU A;  2DF6 A;  3CCQ A;  2YUO A;  2D0Q B;  4DBR A;  3BFM A;  4M7D G;  3LW5 E;  1WGS A;  3M54 A;  2C0T A;  3CME T;  3A5Z B;  1OI1 A;  2LX7 A;  4K11 A;  4AFS C;  2B8A A;  1ZUY A;  5CK9 A;  1OOT A;  2EWN A;  3VUB A;  2HKN A;  4AFQ C;  3SD4 A;  4FSS A;  4QT7 A;  2V1Q A;  1OEB A;  1VQ9 T;  1BCO A;  3V7C A;  4M7D B;  4PJO D;  1PWT A;  5GMK h;  1UHC A;  1GCQ A;  3CBP A;  1G3W A;  3M0T A;  3RKY A;  4ELY C;  4ZN3 A;  1MV3 A;  2PQW A;  1VQ7 Q;  4PFP A;  1SKU B;  4NL2 A;  2V8K A;  3EFR A;  2QGF B;  4IIM A;  1RAD B;  2Y4Y A;  2P4T A;  1G3S A;  3WVE B;  4E7Z A;  2L3P A;  2KSS A;  1BIB A;  1TUG B;  2O9V A;  2C0I A;  4A53 A;  2WAC A;  2LQW A;  2HBP A;  3LH5 A;  1M90 U;  2RH2 A;  2QQR A;  3CCL Q;  2DMO A;  1WHJ A;  5GAM e;  1WQW A;  2GGR A;  4L59 A;  3GPL A;  2QXF A;  1IRX A;  5IXF A;  1M9S A;  2K2M A;  1D0X A;  3A1P A;  4RTU A;  5C0M A;  2A28 A;  2XDP A;  1RAA B;  4N0A C;  4F7U F;  3WXM B;  3ME9 A;  2LQN A;  1VIF A;  1U1T A;  2KDS A;  4C5I A;  1SRL A;  2COZ A;  3H6Z A;  3JCM J;  1ZHI A;  1TUD A;  1VYT A;  3RER A;  2ZGW A;  2L3S A;  3QJY A;  3CCU T;  3ZEH A;  3CCE T;  3RR6 A;  2YXY A;  1QVF S;  5A0L A;  2RMO A;  2Y4X A;  2FG0 A;  3EGX B;  1FWZ A;  3CCU A;  3HL8 A;  4M77 G;  3QKJ A;  3EGD B;  1O9S A;  2EGE A;  3NTH A;  3CCE A;  1IRE B;  2X4J A;  3CCM T;  1VQ5 T;  1OQK A;  1RAC B;  4IUT A;  3KFV A;  3CCR A;  4A4F A;  3R6N A;  3P8H A;  3FRN A;  1OYX A;  3L42 A;  2LCL A;  2KYB A;  3GP8 A;  1Y07 A;  2EQM A;  4M77 B;  2K5F A;  2BZX A;  2BIV A;  2P84 A;  3RBB B;  4DEY A;  5GAN f;  3FDR A;  3URG A;  4QKU A;  1G3T A;  2VWF A;  1SG5 A;  2NUT B;  2DL7 A;  2K57 A;  1GCP A;  1AEY A;  3H0I A;  3FJP A;  3MJX A;  3JB9 F;  3MKD A;  1YI2 T;  3RES A;  1Q86 R;  2RQW A;  3MEU A;  1GFC A;  5DLQ E;  3OS2 A;  4M7A C;  2LP5 A;  1QMC A;  2DL8 A;  1R8O B;  5KCH A;  2NUZ A;  4XTY A;  1YI2 A;  2OI3 A;  1WFW A;  5DLO A;  3G71 Q;  2GQI A;  1QKW A;  2EYQ A;  3U23 A;  2M51 A;  2QYZ A;  1ZUU A;  5GAN 2;  3QJ6 A;  3EG1 A;  1OV3 A;  2HQH A;  2L5Q A;  2QEX T;  2CDT A;  1KHC A;  4B6M A;  4GLM A;  3HHT B;  1XNI A;  2K9G A;  4CC7 A;  2FEI A;  1M90 R;  4LNP A;  3SHW A;  1LCK A;  4RTY A;  1IGQ A;  2XHC A;  2PZ1 A;  2EKO A;  3TU4 K;  3BDU A;  2ZPG B;  3L2Q A;  4LD9 K;  2KYM A;  1PHT A;  3RIR A;  3G6E T;  2QI2 A;  4F7U A;  1UFF A;  1VQP A;  1YJN A;  1KD1 U;  4C92 D;  3CMA A;  4M75 B;  3A8L B;  3G6E A;  3MHX A;  1I5O B;  2ABL A;  3EH2 A;  1G8X A;  4HCZ A;  2CT4 A;  2DEQ A;  2LVM A;  4E7L A;  2FZK B;  3NFC A;  4BE2 A;  3EG2 A;  1FYN A;  4JPB W;  2R5A A;  2LC4 A;  5LJ3 g;  1UTI A;  2OTL T;  2RK2 A;  4FU6 A;  3A8H B;  1WX6 A;  2YT6 A;  3FEO A;  3M55 A;  2FL7 A;  2JTE A;  1M1K U;  2A08 A;  2G6F X;  3D7S B;  3CPW A;  2A37 A;  5GMK m;  4FIB A;  3NTK A;  2O9S A;  1BIA A;  2VAS A;  5ECA A;  4OMF B;  4OMQ A;  2ESW A;  5KCO A;  1F1B B;  4CC3 A;  2CP2 A;  4OVA A;  2QDL A;  1K9A A;  5GAN h;  4A4G A;  1W4S A;  2CUD A;  2DO3 A;  4WCI A;  1Y57 A;  1MGQ A;  3THK A;  2KVQ G;  2PU9 B;  1NM7 A;  1I0C A;  1Y71 A;  4C8Q G;  2SEM A;  1K8A R;  1GFD A;  2YUQ A;  1JU5 C;  4HXJ A;  5GJV B;  4PLI A;  5LL6 S;  5GAN 7;  4Z88 A;  2HAX A;  3M58 A;  1LVK A;  3HPW A;  3CCS T;  4J7I A;  1VQ4 Q;  1QW1 A;  2J6K A;  2LZ6 B;  1I07 A;  4C8Q B;  3M0U A;  2V1R A;  1J3T A;  3HRU A;  4M7A A;  1H64 1;  2KXD A;  2QAS A;  1K73 C;  3AHU A;  4HA8 A;  5KE3 A;  3OBY A;  5GAN 5;  1KIK A;  4IKF A;  4DA4 A;  1UEC A;  3QXE B;  1P92 A;  4JJN K;  1FMK A;  3CXC A;  1KC8 U;  1NLO C;  2BTT A;  4MZP A;  4M7A B;  3L1A A;  3OYN A;  4BDY A;  3CPW P;  2CZ6 B;  2K3B A;  1OPK A;  3CCJ T;  2J7I A;  2WSE E;  2DKG A;  3IQL A;  2NUP A;  4E7H A;  2DVJ A;  2LJ1 A;  1YHQ T;  4IUP A;  3CBO A;  5GAM f;  2JN0 A;  4JDS A;  4J9G A;  4MZM A;  1YCS B;  4J7F A;  1B3Q A;  3J81 E;  1EZZ B;  5CKD A;  3C12 A;  4WF2 A;  1PKT A;  2QA4 Q;  1VQN A;  4C0D C;  1MND A;  4GLK A;  4Y92 A;  3ULR B;  1KD1 R;  1FMW A;  1VUB A;  2FVU A;  4Z89 A;  1ACM B;  5FRM A;  1VQ8 Q;  4M77 D;  2L3R A;  3CCV Q;  4MDX A;  5LJ5 e;  2DM1 A;  1ZSZ C;  1OZ2 A;  1XJW B;  1D1B A;  1M1G A;  1VQL A;  1RAB B;  2IIM A;  5HK0 A;  1WHL A;  4BD3 A;  1C0M A;  2X35 A;  1T3L A;  1X2K A;  4XU0 A;  1ABO A;  4BY6 C;  2OTJ Q;  4ZTF A;  1TWB A;  2JW4 A;  3V7R A;  3VS3 A;  1MMN A;  1UGQ B;  4A63 B;  1QP2 A;  1CKB A;  4MML A;  2QTV A;  1M3C A;  1XTD A;  3P8D A;  1K9M R;  4M78 F;  3CXC P;  1I4K 1;  2LQK A;  1K8A C;  5CKF A;  1Q82 C;  3BW1 A;  2MPX C;  2H3E B;  3QYG B;  4FCY A;  2KEA A;  2EW3 A;  1VQO A;  2KR3 A;  3QZ5 B;  4ZN1 A;  4PJM A;  4DBQ A;  3JCM e;  2OAW A;  3TVT A;  2JS0 A;  5GAO p;  3E19 A;  3I55 T;  1VQK Q;  4QVD A;  2QQB A;  2DER A;  4AMC A;  1S72 Q;  4Z02 A;  1YIJ A;  3OYM A;  2P0K A;  1N9R A;  4RCC A;  1M8V A;  1NLP C;  1OX8 A;  1OZ3 A;  2RQU A;  3LLR A;  2AK5 A;  1QCF A;  1B34 A;  4FYX B;  1JJ2 S;  3G4S Q;  4HT8 A;  2RQT A;  4M75 D;  1BYM A;  4J9D A;  2JVV A;  1GCQ C;  2HMA A;  1GXI E;  2F2V A;  1X6G A;  2PVO B;  4N4H A;  1YIJ Q;  4HVU A;  1WJR A;  4QQD A;  1YIT T;  3CD6 Q;  3LWH A;  3CC2 Q;  1B34 B;  1VQ6 A;  1QWF A;  2K4Y A;  4M7D F;  1KC8 R;  5EC7 A;  5IHN A;  2ZPF B;  3MPU B;  1WJS A;  5GAM h;  2O4X B;  2M1H A;  1YJW Q;  2EQU A;  4JJB A;  2JTM A;  1E6G A;  4E47 A;  2FPE A;  2X3W D;  3I5R A;  3H8Z A;  1M2V B;  2FPD A;  5HY6 A;  1TSF A;  3EAE A;  2SRC A;  1AWJ A;  1YJ9 Q;  4EMH A;  1MMD A;  1Q95 G;  5CIU A;  4FYW B;  2MCN A;  1I5L A;  1FX7 A;  3PFS A;  1IZ6 A;  2RI5 A;  3OYF A;  5DY9 A;  1VQM Q;  2M0O A;  2GTO A;  1UG1 A;  1WDX A;  5GAN 8;  4IIO A;  2EJF A;  2D6F A;  3OYA A;  2GNC A;  2YRD A;  3JSC A;  1HK9 A;  4LDU A;  2LCC A;  1CSK A;  4L6V 5;  1LJO A;  1KQ1 A;  1M3B A;  3EG0 A;  1CKA A;  2M02 A;  1ZSZ A;  4PFO A;  1MMG A;  5AYF A;  1MHN A;  2ECZ A;  2OX7 A;  2EAY A;  5D6X A;  1PD0 A;  1V76 A;  4OMN A;  2JT4 A;  3JRZ A;  3PMT A;  4OGC A;  3VV0 A;  3LH0 A;  3L2U A;  4BE0 A;  1FMV A;  4C5H A;  5A2Q E;  2DYI A;  2GQV A;  1WXT A;  2JM9 A;  3VRY A;  5KYU A;  1WZO A;  5D7U A;  4Q5W A;  4C8Q D;  3M59 A;  1R77 A;  3HP9 A;  4LUE A;  2C0O A;  3GBQ A;  4BY6 B;  3OMC A;  4M7A E;  3QO3 A;  4R0K A;  1RI9 A;  4J9H A;  2CRE A;  3OW2 A;  4ZGE B;  1GBR A;  1JBM A;  2EJG A;  4FSX A;  2VB6 A;  2CKK A;  2HZY A;  4M7A D;  2NLU A;  3CC7 T;  4PL6 A;  2DL3 A;  5GAN g;  3EHR A;  1RAE B;  2GFU A;  2J06 A;  5LJ3 d;  1N8R C;  3OYC A;  3CC7 A;  2CP3 A;  4M77 F;  1SF9 A;  5GAN 6;  3M57 A;  1TS9 A;  1IXD A;  4PJJ A;  2IG0 A;  2X9H A;  3BE3 A;  3CCQ Q;  2CYZ B;  1WYX A;  9ATC B;  3J80 E;  5CVI A;  3CME A;  1PD1 A;  2RK1 A;  2PTK A;  1VQ7 T; 
#chains in the Genus database with same CATH homology
 5DLQ E;  3OS2 A;  4M7A C;  1XOV A;  2GFA A;  2LRQ A;  3UDC A;  3OSS C;  3V7S A;  2I2L A;  1QVG A;  1R8O B;  5KCH A;  4XTY A;  1YI2 A;  1WPY A;  1VQ9 A;  3HKS A;  1ZQ1 A;  1QVF A;  5DLO A;  3JCM d;  2O01 E;  1YIT A;  2EYQ A;  2PVG B;  4PLL A;  4ELZ C;  4II1 A;  1UEB A;  4A4K A;  5GAN 2;  1RI0 A;  2DPP B;  3V8L A;  3QJ6 A;  3HRS A;  1N6A A;  5D6Y A;  2L5Q A;  5GAN 3;  2ZPE B;  2X4Y A;  2QEX T;  1NPP A;  3OS1 A;  3CCL T;  1KHC A;  1KD1 C;  2BUD A;  3FLG A;  4KUL A;  2VXE A;  4L5G A;  3V8J A;  2FYK A;  3M4G A;  1X75 C;  4J6X A;  3CC4 T;  3QSU A;  5GAO l;  3A8G B;  3HHT B;  2CZ1 B;  1XNI A;  4O5V A;  2PUO B;  2V8J A;  4C0F A;  3L2V A;  4JRP A;  5J3B A;  4CRI A;  3OBW A;  2P0Q A;  5GAN j;  3O8V A;  4QQG A;  4XTV A;  3JB9 I;  3NTI A;  2QA4 A;  1BI3 A;  2QQ9 A;  4PNO A;  2XHC A;  2RHX A;  3KXT A;  1KQS A;  3CC4 A;  2EKO A;  3ASK A;  4PJO G;  3BDU A;  2K5I A;  3TU4 K;  3VYH B;  3JCM b;  2ZPG B;  3L2Q A;  2AHJ B;  1VQN T;  4FM4 B;  2RHZ A;  3TCJ A;  1NPR A;  4ATO A;  4LD9 K;  3VYG A;  1KG1 A;  1YCY A;  2DXU A;  4BAC A;  4E7I A;  3QBY A;  1VQ8 A;  3R6O A;  3RIR A;  4QVC A;  3G6E T;  2ZCF B;  5FU6 B;  3SWN C;  2KAF A;  2QI2 A;  4QW2 A;  4F7U A;  5LJ5 g;  1D3B A;  3CCV A;  4J6Y A;  1VQP A;  4RCB A;  1YJN A;  3OS5 A;  3VKI A;  3M9Q A;  4M77 E;  1Q81 C;  3CEY A;  1JB0 E;  1KD1 U;  1M1K C;  4O6J A;  4C92 D;  4M75 B;  4PKC C;  3CMA A;  4C0D B;  3A8L B;  5LJ5 f;  3VJP A;  1UB4 A;  1JJ2 A;  3G6E A;  3MHX A;  3X25 B;  1VQL T;  2MI6 A;  2JOY A;  4PJO B;  2XD0 A;  5L8R E;  4HCZ A;  2OTJ A;  4LDY A;  5CKE A;  2DEQ A;  2LVM A;  5KH6 A;  4ZGD B;  4E7L A;  1K9M C;  3NFC A;  2EIF A;  2XG8 D;  3MO8 A;  1U8R A;  2XK0 A;  4BE2 A;  1BI2 A;  5CQX A;  2R5A A;  2LC4 A;  4HKE A;  3UPU A;  2M16 A;  5LJ3 g;  3INZ A;  2OTL T;  3LGL A;  4N4I A;  1QP3 A;  1X6O A;  1LOJ A;  2RK2 A;  3GF5 A;  4FU6 A;  4J5Y A;  2VV5 A;  3A8H B;  5GAM d;  3JB9 D;  4C5E A;  3QHS A;  4OB1 B;  2EFI A;  2MMP A;  3FEO A;  4M78 A;  5CQY A;  3GOX A;  3S3O A;  3M55 A;  5CR2 A;  2FL7 A;  1Q81 U;  4X9D A;  1M1K U;  2LDM A;  4EPC A;  2QDY B;  2RJF A;  3RUX A;  3CPW A;  3M56 A;  3X28 B;  1QVP A;  2RJD A;  4FIB A;  3NTK A;  5GMK m;  4R56 A;  1KQ2 A;  1BIA A;  3OB9 A;  4YTL A;  2LTO A;  4OMF B;  5IT9 E;  3M5A A;  4B9W A;  5KCO A;  4HCC A;  2E12 A;  5FU7 B;  5D6W A;  3G7Z A;  3CCM A;  2F5K A;  4FL6 A;  1VQ5 A;  4Y28 E;  1VQK T;  3GLX A;  4M77 C;  5I21 A;  4OVA A;  3JCM g;  4C92 A;  4V2S A;  3JCM c;  4EMG A;  1VQO T;  2F5T X;  4OGE A;  2HQE A;  5GAN h;  2KMT A;  4A4G A;  3JCM W;  2K2V A;  2E1H A;  1Y96 A;  1W4S A;  5LJ5 j;  3OYI A;  2K3Y A;  4KBM B;  2EQJ A;  3JCM f;  4EMK B;  2DO3 A;  1TH7 A;  4ME7 A;  2YHT A;  2RM4 A;  3X26 B;  1VQK A;  1MGQ A;  2KVQ G;  2PU9 B;  3LX7 A;  1Y71 A;  4KUI A;  4C8Q G;  1S72 A;  3RKX A;  5J26 A;  1XQH A;  4XTW A;  3GNF B;  1EIF A;  3QZ9 B;  2E70 A;  3OA6 A;  2RHU A;  4JLI A;  2L89 A;  1YIJ T;  4X9C A;  2RA2 A;  5GAN e;  5FRN A;  2DIQ A;  4PLI A;  5LL6 S;  3G4S A;  1KC8 C;  5GAN 7;  3T9N A;  1Q7Y C;  3CC2 T;  5LJ3 j;  2HAX A;  3V8K A;  3M58 A;  2IVW A;  4R55 A;  2KK4 A;  4XTU A;  3HPW A;  3CCS T;  4M75 E;  3FB9 A;  5GMK l;  4X34 A;  4J7I A;  5GAO q;  2DTI A;  2X4W A;  3HRT A;  1QW1 A;  2E5Q A;  4M7D A;  3QDR B;  3CD6 A;  3DKM A;  4TVR A;  3HSB A;  4C8Q B;  1YJW T;  3CC2 A;  4PJO E;  3L2Z A;  4JUV A;  4RKU E;  1VQ7 A;  3TRE A;  3HRU A;  4M7A A;  1H64 1;  4JRI A;  1VQ6 T;  1U1S A;  1K73 C;  1LNX A;  3AHU A;  4HA8 A;  4C8Q F;  5KE3 A;  1Q86 U;  3OBY A;  5GAN 5;  3MET A;  4A54 A;  4JS4 A;  4IKF A;  4DA4 A;  1YJW A;  2DXB A;  2O4X A;  3QXE B;  3RKW A;  1P92 A;  4BI8 B;  4XU2 A;  2RJC A;  4JJN K;  1YJ9 T;  2OAU A;  5GAO n;  5CKB A;  3CXC A;  1KC8 U;  1N27 A;  1Q7Y U;  4MZP A;  4M7A B;  3L1A A;  3OYN A;  1WJQ A;  3CPF A;  4BDY A;  4M75 G;  2CZ6 B;  3TEE A;  2QEX A;  3CCJ T;  2K3X A;  2JNG A;  3CCL A;  5IAY A;  1DJ7 B;  2WSE E;  2DKG A;  1YJ9 A;  2DXC A;  3L2W A;  5GAM g;  2D9T A;  2VGM A;  4E7H A;  2X4X A;  1W2B S;  2LNV A;  1YHQ T;  1AHJ B;  1JRI A;  4IUP A;  2RO0 A;  3CBO A;  2JN0 A;  4JDS A;  3E1S A;  3QUI A;  3ZFJ A;  4MZM A;  5GAM f;  3OW2 S;  2R57 A;  1H3Z A;  4J7F A;  3VUZ A;  3JAM E;  3J81 E;  1VQM A;  2MF2 A;  1NJI U;  2LQ8 A;  5LJ5 h;  1K73 U;  4KUD K;  1KHI A;  3MP1 A;  3C12 A;  4IUQ A;  4WF2 A;  3SB2 A;  5CKD A;  1UGR B;  1N9S A;  3QYH B;  4M75 C;  1VQN A;  4C0D C;  2DZC A;  4GLK A;  3F70 A;  2RHY A;  3OYB A;  3FC3 A;  2DAQ A;  4A4E A;  2C06 A;  1VUB A;  3SFM A;  4PJO C;  3SWN A;  2FVU A;  3CBM A;  4C0Z A;  3OY9 A;  1M5Q 1;  2M9U A;  3X24 B;  4F7U B;  4M75 F;  1D3B B;  5FRM A;  4FT2 A;  4M77 D;  2XI9 A;  4BB7 A;  2L3R A;  1G3Y A;  3VU3 C;  4MDX A;  2DVE A;  5LJ5 e;  2QQS A;  3BDL A;  3C95 A;  1OZ2 A;  3PMI A;  4XQ3 A;  3MCA B;  3PNW C;  4LDV A;  4M78 G;  4PJO F;  5LJ3 h;  2CS7 A;  4DOV A;  1M1G A;  1VQL A;  2HNI A;  1FXX A;  2WSF E;  2YLC A;  4VUB A;  5HK0 A;  3A8M B;  2E41 A;  2H3J A;  5DM7 R;  5I2M A;  4BD3 A;  3UT1 A;  2E6Z A;  2X35 A;  2WSC E;  4UC4 A;  4XU0 A;  4BY6 C;  2XIC A;  4RG8 A;  4DQ2 A;  4ZTF A;  4EDU A;  2JUF A;  2L8D A;  2PUK B;  2VYT A;  4IUU A;  5GMK j;  4J6W A;  4RMO A;  2OTL A;  3M53 A;  4BI4 A;  1SSF A;  4J83 A;  4J8O A;  3V7R A;  5GAO r;  4C8Q E;  3FIF A;  2XDD A;  1UGQ B;  1V29 B;  1YBY A;  5LJ3 e;  3PTA A;  5CO7 A;  3L2R A;  5FLX E;  1QP2 A;  4C5G A;  5KE2 A;  4BI3 A;  4M78 B;  4C92 G;  3PIO A;  3DLL A;  1QVG S;  3S3M A;  3QG1 A;  5GAM j;  4MML A;  5I2S A;  4JLG A;  4XAX B;  4MMK A;  4JRQ A;  2A7Y A;  1M4Z A;  3RMQ A;  2RHI A;  1XTD A;  2XU8 A;  3P8D A;  3PIP A;  4M78 F;  3JCM h;  2E65 A;  1I4K 1;  4XU1 A;  3CCR T;  2MAM A;  2LQK A;  4MZT A;  1K8A C;  4EMK C;  5CKF A;  2A3L A;  3PGG A;  3JCM P;  2GF7 A;  1Q82 C;  1O75 A;  3BW1 A;  5CCA A;  3X20 B;  4IUR A;  2YRV A;  3CCQ T;  4NS5 A;  2KQW A;  3QYG B;  4M77 A;  1RL2 A;  5GMK i;  3JB9 G;  1VIE A;  5A0D A;  1VQO A;  2RI3 A;  3JB9 H;  3QZ5 B;  4C92 B;  1Q86 C;  2E10 A;  2XKO C;  4ZN1 A;  2EQK A;  2DTH A;  4ZGJ B;  3MEA A;  1Y96 B;  4B9X A;  1ZBX A;  2K5L A;  2CZ0 B;  4LDW A;  4QVZ A;  3JCM e;  1KQS S;  3CCQ A;  4IUV A;  5GAO p;  2ZPB B;  5GAN 4;  2D0Q B;  1HXD A;  3BFM A;  4HCB A;  4OB3 B;  4OP0 A;  3E19 A;  3DB3 A;  4BE1 A;  4M7D G;  3LW5 E;  3I55 T;  2VXF A;  2HD0 A;  4QVD A;  1WGS A;  2QQB A;  2EJ9 A;  3M54 A;  4E7J A;  1NZ9 A;  3G71 T;  4Z02 A;  2JTF A;  3OYM A;  3CME T;  1YIJ A;  3A5Z B;  2LX9 A;  4C8Q C;  1OI1 A;  4M7A G;  2P0K A;  1N9R A;  4RCC A;  2CGH A;  2ZZD A;  1OZ3 A;  1K8A U;  2VC8 A;  1M8V A;  3LLR A;  3E9G A;  2P0P A;  2B8A A;  1NE8 A;  5CK9 A;  3OYJ A;  1Q82 U;  2EWN A;  3VUB A;  2HQX A;  4HT8 A;  1B34 A;  3CCS A;  1JJ2 S;  2RI2 A;  3QPH A;  4M75 D;  1BYM A;  3SD4 A;  1WNL A;  3G71 A;  1NJI C;  2JVV A;  1M90 C;  2VGN A;  2RB6 A;  3KBG A;  2MWO A;  1GXI E;  1VQ9 T;  4M7D B;  2PVO B;  2RD1 A;  4N4H A;  3V7C A;  4C0G A;  3JCM V;  4PJO D;  1WJR A;  4QQD A;  3S6W A;  1YIT T;  5GMK h;  1M1F A;  3LWH A;  5HK3 A;  1B34 B;  1VQ6 A;  1BI0 A;  4XU3 A;  2K4Y A;  3CBP A;  3OMG A;  4M7D F;  1G3W A;  5J39 A;  2DZ9 A;  2DTO A;  3Q1J A;  4D6W A;  3LYI A;  3A8O B;  3RKY A;  4ELY C;  4ZN3 A;  2PQW A;  2ZPF B;  3P8B B;  1N8R U;  4NL2 A;  4XTX A;  1WJS A;  2V8K A;  3EFR A;  2ZPI B;  3HFO A;  2O4X B;  5GAM h;  4M7A F;  4OF1 A;  5GAN d;  2Y4Y A;  2P4T A;  1G3S A;  2M1H A;  3OYG A;  4F7U G;  2EQU A;  3WVE B;  4JRK A;  4Y91 A;  4M78 E;  2JTM A;  2Y90 A;  3JCM X;  3JB9 J;  4E47 A;  2E64 A;  4CI0 C;  5GMK e;  5FU6 C;  2KSS A;  1BIB A;  3MP6 A;  3H8Z A;  3CPW S;  3CCJ A;  4A53 A;  2DXT A;  2QA4 T;  4BUG A;  3PT9 A;  2WAC A;  1UGS B;  2DK3 A;  2JZ2 A;  2HBP A;  5HY6 A;  1M90 U;  2RH2 A;  3EAE A;  2QQR A;  1I8F A;  3JCM Q;  3N5B B;  4M78 D;  1YHQ A;  2CZ7 B;  5GAM e;  1WQW A;  2VUB A;  4EMH A;  1VQ8 T;  2PVD B;  4L59 A;  3GPL A;  2QXF A;  5M9O A;  3SDZ A;  2XID A;  1M9S A;  5CIU A;  5A0G A;  3CCV T;  1I5L A;  3DB4 A;  1FX7 A;  3PFS A;  1YJN T;  1VQP T;  1IZ6 A;  2RI5 A;  2LT4 A;  5C0M A;  3OYF A;  4M75 A;  4LD6 A;  4JS5 A;  5DY9 A;  4HT9 A;  3E9F A;  2M0O A;  4C92 E;  2XDP A;  3CMA T;  1PSE A;  2FHD A;  3LWI A;  3LGF A;  5GAN 8;  2EJF A;  4N0A C;  1X01 A;  4OB2 B;  3ER0 A;  2D6F A;  3OYA A;  4PJO A;  4F7U F;  3JSC A;  1HK9 A;  3WXM B;  3SWN B;  4LDU A;  2OTJ T;  3ME9 A;  4NOY A;  2LCC A;  4L6V 5;  1VIF A;  1U1T A;  2KDS A;  1LJO A;  2LT1 A;  1KQ1 A;  2RJE A;  2YLB A;  4C5I A;  3OQ5 A;  2KY9 A;  3KUF A;  4ZTJ A;  4N0A A;  3OSV A;  5AYF A;  1MHN A;  3H6Z A;  3JCM J;  2EAY A;  5D6X A;  3GIB A;  3HFN A;  1ZHI A;  3J7A F;  3RER A;  4BDZ A;  2QQA A;  1Y7X A;  3JRZ A;  2ZGW A;  3PMT A;  3MEV A;  4M78 C;  3QJY A;  2DD4 A;  4OGC A;  3CCU T;  3VV0 A;  3OYL A;  3LH0 A;  3ZEH A;  3L2U A;  4BE0 A;  5C6S A;  5FU7 C;  4C5H A;  3CCE T;  2V8I A;  5A2Q E;  3M4Y A;  4MDW A;  2FB7 A;  2GQV A;  5EG2 A;  3GNG A;  1QVF S;  5IN1 A;  5A0L A;  4LDX A;  4Q5W A;  3UWN A;  4M7D E;  2Y4X A;  2DIG A;  3M59 A;  3MP8 A;  5LJ3 f;  4C8Q D;  3HP9 A;  1FWZ A;  1BI1 A;  4OB0 B;  3CCU A;  5FRO A;  3HL8 A;  4M77 G;  1BKB A;  3QKJ A;  1O9S A;  3C4S A;  1W2B A;  3NTH A;  4BY6 B;  2MWP A;  3OMC A;  3CCE A;  3S3N A;  1IRE B;  4M7A E;  2X4J A;  4XK8 E;  3CCM T;  1VQ5 T;  3QO3 A;  4N4G A;  2BKD N;  3OYY A;  4XTZ A;  4DOW A;  5LJ5 d;  3DLM A;  4M7D D;  3OW2 A;  4ZGE B;  4C92 C;  4IUT A;  3CXC S;  4RG2 A;  4E7K A;  3CCR A;  3OS0 A;  4A4F A;  1JBM A;  3OYH A;  2EJG A;  4FSX A;  3P8H A;  3OYD A;  2DD5 A;  2CKK A;  4EMK A;  3OYK A;  3FRN A;  2E6N A;  5CAI A;  1K9M U;  4M7A D;  4GY5 A;  2NLU A;  3CC7 T;  5CKH A;  4PL6 A;  4NL3 A;  1VQM T;  1OYX A;  3L42 A;  2LCL A;  3GP8 A;  3C94 A;  2GCX A;  4C92 F;  1Y07 A;  2EQM A;  4M77 B;  2K5F A;  1WQ7 A;  2G3R A;  3EFS A;  1S72 T;  5GAN g;  1VQ4 T;  2R58 A;  2GFU A;  2BIV A;  2R5M A;  3BY7 A;  2DJZ A;  5LJ3 d;  1UGP B;  1N8R C;  3OYC A;  3CC7 A;  4M77 F;  5GAN f;  3I56 T;  5GAN 6;  3FDR A;  3QII A;  3M57 A;  3URG A;  5GAO m;  3G4S T;  3MEW A;  1G3T A;  4P5N A;  2QTX A;  1I81 A;  2IG0 A;  5HKC A;  2K57 A;  1VQ4 A;  4F7U E;  3I55 A;  2CYZ B;  4FT4 A;  3RMS A;  1G5V A;  3FJP A;  4KT0 E;  3J80 E;  3JB9 F;  3I56 A;  5CVI A;  3CME A;  4C8Q A;  3ZBD A;  2XDB A;  3CD6 T;  4M7D C;  3OYE A;  1YI2 T;  2RK1 A;  4QQ6 A;  3RES A;  1PSF A;  3WVD B;  2ZPH B;  3MEU A;  4A4H A;  2F69 A;  1VQ7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...