1ZSZB

Crystal structure of a computationally designed sspb heterodimer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
SSPKRPYLLRSLYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGAMFEPEEIYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity versus stability in computational protein design.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags De novo protein
molecule keywords Stringent starvation protein B homolog
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1zszB00
1OULA 1OU8A 1OX9A 2NYSA 2QAZA 1OX8A 2QASA 1YFNA 1OU9A 1ZSZA 1ZSZC 1ZSZB 1TWBA
chains in the Genus database with same CATH superfamily
3OYFA 3CC4Q 1BCMA 2KMTA 1UJYA 2K3XA 3HL8A 3OYIA 3VS6A 3V7RA 4J9CA 4ZN3A 2MWOA 1V76A 2F2XA 1KQSA 1C1AA 1NYGA 2EJGA 3THKA 2PUOB 5FRNA 2XDPA 2YUNA 2K4YA 3H8ZA 4FL6A 5HK0A 2LQWA 2ZAEA 1M9SA 2DIGA 1UGVA 4OGCA 1AT1B 1KD1R 2MPXC 5C0MA 2KXCA 1U1TA 4OGEA 4ANJA 3QSUA 4FW1A 2KAFA 3QPHA 4ZGJB 1VQ6A 1VQKA 1NZ9A 4C5IA 3URGA 2J6FA 1UDLA 4WCIA 1JJ2P 3H6ZA 1PKSA 4M75B 3JCMP 1ZBXA 4C8QD 1D0XA 3M55A 1BBZA 1YITA 3CCQA 4JZ3A 3AHUA 1BI0A 1IREB 3MCAB 3VYHB 2CP0A 3EGXB 4LDXA 1M30A 4FT4A 2CREA 5GMKh 4B6MA 1GCPA 1LOJA 3I55Q 1M1KU 3TVTA 3LWHA 2XU8A 2CT3A 1YIJT 2A36A 4J5YA 3OYNA 1AWOA 2K2MA 2O88A 3CCMT 2NYSA 2EKOA 4FYVB 1WXTA 2CP5A 2V8JA 4JJCA 2X3XD 3EG2A 1W2BS 2NUPA 2DO3A 2KVQG 3TSWA 2QEXT 4JRKA 3OBYA 2GGRA 2ABLA 4HKEA 3VKIA 2AKLA 2CSQA 4F7UG 4C8QE 1WX6A 1S72Q 2F5TX 4C5GA 3L1AA 4RTZA 1WXUA 4A4HA 2DKGA 1IZ6A 4JS5A 3FRNA 2RD1A 2RQTA 3NFCA 5GAMj 3OS5A 1WPYA 4NL3A 2RJDA 5GAN5 1RL2A 4PJOD 1UFFA 3OS0A 1WQ7A 3KXTA 1XQHA 5FWBA 2DETA 3LGLA 2CYZB 2LX9A 1N8RC 3A5ZB 2HSEB 2YRCA 1WXBA 1FXXA 2G3RA 5I2SA 3ME9A 1NG2A 3RDVA 2M1HA 2LJ3A 4DBQA 2F1LA 4A63B 1X01A 5IHNA 3MEVA 3M0UA 1OU9A 3JCMd 2KE9A 2WSCE 3HTRA 1CKBA 1S72T 1WNLA 1NLPC 5A0GA 4BI4A 2QA4T 3BE3A 2QTXA 3FLGA 3BFMA 3PGGA 4L5GA 1PNJA 4N0AA 5L8RE 2CP7A 3KUFA 1VQ8T 1I1JA 2DE0X 3QYGB 2RQVA 3OYBA 1PD1A 3MP8A 3EHRA 1RABB 4ATOA 3RESA 3ULRB 2RHIA 3G6EA 3FJ5A 1UGQB 2VGNA 3CCVT 3ZEHA 1VOMA 2RJFA 3QIIA 4R56A 2QDLA 2P84A 3A8HB 3I5SA 5KCOA 1OV3A 2KYBA 2I0NA 2QQRA 2ZPIB 4IUVA 2E6NA 2GQVA 2RQWA 4JRIA 2YUQA 3CMAA 1M1KC 2CSIA 1WZOA 2DM1A 1G3TA 3GPLA 4OVAA 2DF6A 3SHWA 1OOTA 1Q86R 2FL7A 2E65A 1OEBA 4EPCA 2FO0A 2M02A 1IGQA 1W1FA 5KE2A 3ZBDA 2G6FX 5GMKe 2VKNA 2A28A 2CKKA 1TH7A 2WACA 4M78A 2F69A 5GMKm 3RMQA 2QGFB 4E7HA 1KQ1A 3CCRA 3JAME 1ABQA 3UA6A 2ZPEB 4YTLA 4A4FA 3CCJA 2LDMA 2ZPHB 3M53A 1XTDA 2HQXA 3G1JA 3QUIA 2J06A 2K79A 2LC4A 1YJWT 5GAMh 2M16A 4FU6A 4PK4A 3ASKA 2CZ1B 3QWYA 4D8KA 1H641 2QEXQ 4C92A 3L42A 2FYKA 3G71T 2QTVA 2LZ6B 4E7LA 1LJOA 3S3OA 2OJ2A 3M57A 3QBYA 3MJXA 3CBOA 2DVEA 4LDVA 1QW1A 4JLGA 3I35A 3GF5A 1RAFB 3JB9F 3LH5A 2VYTA 1YIJQ 4Z8AA 5FU6B 4KGZB 1TXQA 1VQOQ 2FHDA 3L2VA 1Q82U 1YP5A 4M77D 5KH6A 1YCSB 4J83A 3L2WA 1YI2T 4M77B 3SWNA 3SEMA 2HEQA 1QVGA 2F2WA 4MDXA 1Y7XA 3E9FA 2DPPB 3VS0A 1KHCA 2EVRA 3H0FA 2K5FA 4JJBA 3H41A 1RI9A 3NTKA 4OMNA 2MCNA 2GTOA 4RTVA 5LL6S 4HVWA 4F7UA 5HKCA 5GAMe 4P5NA 5GAN2 1M2OA 2KEAA 1SF9A 5LJ5f 3PVLA 5M9OA 4NS5A 1PHTA 2D1XA 1M5Q1 3P8BB 4JLIA 5GAMf 4JDSA 4OMFB 2OTLT 2EGAA 2WSFE 3QZ5B 3CC7Q 5D6WA 3QWXX 1M1GA 2EYYA 1U5SA 1QVGP 1VQ8A 1SHGA 2O9SA 4Q5WA 1GCQC 2R57A 1OZ3A 1T3LA 1BI3A 4QVZA 1AWXA 1K4US 1BIBA 2KR3A 1VQ4A 4HCBA 1VQ6Q 3LYIA 1RAHB 3CXCA 4EMKA 3CCRQ 2BZXA 4KRTA 3VS1A 1B3QA 3HHTB 3CXCS 3MP6A 3OYHA 2LJ1A 5ECAA 1BU1A 2O2OA 2KT8A 2IVWA 1A0NB 1V29B 5LJ5g 3PMIA 4GLMA 1K8AC 1JXMA 4GLKA 4AMCA 1G8XA 4N4IA 5C6SA 2OI3A 1UGRB 2E70A 2KROA 2J6OA 1X43A 3OS2A 3UF4A 2DMOA 1VQ9A 4C0DC 4XU0A 1JO8A 4A54A 1VQLQ 1NJIR 3EGDB 3E2UA 3JV3A 1VQLA 4NL2A 1VQ5T 4QQ6A 1U8RA 2YRDA 2BZYA 4HT8A 3PT9A 2JJ9A 5LJ3j 2DTIA 1T0HA 4RG2A 3CD6A 1Y96B 5GMKj 3NTIA 5GANe 2HNIA 1UHCA 4UC4A 4HXJA 1QVGS 2K5LA 2CUBA 4WTOB 1OULA 3M5AA 1Q82C 2XIDA 4QVCA 1NPPA 3TEEA 2C0TA 5KYXB 2AZVA 3GNGA 5FU6C 3CCMA 2HZYA 1VQNA 4EIKA 1FMWA 2JVVA 2YUPA 1JRIA 1UE9A 2W10A 3CC2A 3OYMA 2JTEA 1WQWA 1JXOA 1YHQT 4J9IA 4PLIA 4M7AE 3QKJA 1X2QA 3OYYA 1WGSA 1PC0A 2JZ2A 2D9TA 2QG9B 2RHXA 5EG2A 2MIOA 2PQWA 4BDYA 3C4SA 1M2VB 3VRZA 4KBMB 4RG8A 3JCMX 1WIEA 2ZPBB 1QP2A 3RERA 1QCNA 1G3WA 3PNWC 4J9FA 2JM8A 3CC4T 1FMVA 1K9MR 2E41A 2GFAA 8ATCB 3TREA 1YI2A 2CZ7B 3UPUA 4OB0B 4PJNA 5IHIA 3Q1JA 1QMCA 2PNIA 1V1CA 4TVRA 2L3QA 4BE2A 2J7IA 3RKWA 2AZSA 4F17A 4M78D 3JCMe 2HL5C 2KRSA 3PMTA 1M90U 4HCCA 1AZEA 1GRIA 3M0SA 4QKUA 3H0IA 4J6WA 1IRXA 1K9AA 3CC7T 5GAMg 4OMPA 2KI7A 4FSSA 4OP0A 3UT1A 1VQ5Q 1TUCA 2M9UA 3REBB 3J81E 3O8VA 1BYMA 4MZMA 2HDAA 1CKAA 4XTUA 3JCMg 4ELZC 1TG0A 3CMEA 5HY6A 3CCJT 1KIKA 3EGDA 4M7AC 2E3IA 4J7FA 1W2BA 4XTWA 3CMEQ 1M8VA 4BE1A 4AFUC 3CCRT 2L89A 3JSCA 1K73R 2ENMA 1HSQA 3OSSC 2QA4Q 3NMZC 5CKBA 3H0HA 1OYXA 4JUVA 1NPRA 3EG9B 1O9SA 1X2KA 1W6XA 2P0PA 2EKHA 5IN1A 4J9GA 1VQ7A 2HL3A 1XOVA 4AT1B 3M59A 4XAXB 2FB7A 1B07A 1Q81U 1Q7YC 1PWTA 3CBMA 3VS2A 2LQKA 5KYXA 4RTWA 3JCMb 3NHNA 2VC8A 1UHFA 3CC2T 1H8KA 3JCMc 4KGVB 2KNBB 2V8IA 2HQEA 1D1BA 1SSFA 4QQDA 5IXFA 1TOVA 1J3TA 4C8QF 1OU8A 1IHVA 4HA8A 1SPKA 1TSFA 4FYXB 1WI7A 4PFOA 3MO8A 1JJ2S 1G3YA 1JB0E 2VWFA 7AT1B 4JJNK 2NUTB 4F16A 2BUDA 4MZTA 3CCJQ 1NYFA 2PVOB 4QVDA 1LNXA 3X20B 1N6AA 2YWWA 5CR2A 2SRCA 1RAEB 4R55A 3HSBA 4XTVA 2DJQA 4DOWA 1UECA 4KT0E 2MWPA 2ROLA 4LUDA 1VQ9T 2DL7A 5GANd 2EQUA 5DLQE 1KD1U 4PJLA 2XG8D 1G83A 2GQIA 2EBPA 1QCOA 1ZQ1A 2C0IA 3H9NA 2EYZA 2FPDA 4A4EA 3PVQA 1S72A 1YJ9Q 3QHSA 3U23A 2DERA 1KJWA 1QVFA 1YWOA 3C94A 4C8QA 4X34A 2W0ZA 3RNJA 4OMLA 4CC7A 1RAAB 2MAMA 3TQ7P 2FVUA 4FT2A 1RAGB 1JQQA 2PVDB 3LH0A 2EWNA 2AHJB 1MNEA 4XTYA 1OX9A 1VA7A 4LDUA 3MEUA 4PKCC 4C0DB 1VIEA 2HD0A 3GIBA 2VGMA 1G5VA 3SDZA 1ABOA 5AYFA 4A53A 2O4XA 1WHGA 4RUGA 2K3BA 2L3RA 4C92G 1HXDA 3OA6A 1M90R 2O01E 1WHKA 1WJRA 3OMGA 1YN8A 4L6V5 3P8HA 4EMHA 5FLXE 4XQ3A 4PL6A 4A4GA 2GCXA 4M7DC 4KUIA 1Q81C 2KY9A 1Q7YU 1VQPQ 5A2QE 3A8OB 2YLBA 4PFZA 1Y57A 3M56A 4ZGDB 3BDLA 1K0SA 2L3PA 4AG2C 4RKUE 1R0CB 4LE9A 1N27A 3VS3A 3HRUA 4D8DA 3HKSA 3M0RA 4EMKC 5IT9E 2RQUA 2YDLA 1M27C 3UA7A 2E5KA 4M7AA 2CS7A 3HFNA 2EQMA 1QCFA 1M3AA 4BACA 1RAIB 1Y07A 1UGSB 3FDRA 3LGFA 4AFZC 2K7AA 1T3SA 1IO6A 1HJDA 2R58A 1OPLA 1QVFP 3LX7A 3L2ZA 1YITT 1TS9A 2V26A 4X9CA 2Y4YA 1AOJA 5CO7A 4JS4A 2A37A 2X4WA 2NUZA 1SHFA 1GFDA 2JW4A 3CPWA 1ACMB 2DL4A 2KDSA 2HAXA 2DLPA 4LD9K 2Z0WA 3ZFJA 2EQKA 1AEYA 2MOXA 3EFRA 1VQKQ 2KQWA 3META 4HVVA 1YJNQ 1ARKA 1RUWA 1PKTA 2D6FA 2OX7A 2QGGA 3GLXA 1FX7A 2AIRB 5GAN8 1FYNA 1PSEA 3UDCA 2KK4A 1K9MU 3M0PA 1UB4A 1KFZA 5GAN7 4VUBA 4KGXB 4L59A 2DXTA 2ED0A 3L2RA 2FPEA 4M7DD 2A08A 3X24B 2P0QA 1JEGA 1QKXA 4M7DF 2VB6A 1YHQQ 1TUGB 5LJ3g 5HK3A 2VUBA 5KYNA 1PM3A 3SB2A 4PNOA 2M0YA 4PFPA 4C92E 1U1SA 2RI3A 2GFUA 4F14A 2X35A 5FWCA 1YWPA 2FG0A 2ZPFB 4C5EA 1SSHA 3MPUB 2HSPA 4RCCA 1ZA2B 2JTFA 2K2VA 2E1HA 5GMKi 3RKXA 2L8DA 2LVMA 4RTTA 1VQMT 3VS4A 2C06A 2PTKA 1BI1A 2RJEA 4M75A 2ZGWA 5CAIA 2KSSA 3NPFA 3X25B 1N8RR 1NE8A 3QZ9B 2CDTA 1UEBA 1BCOA 1VQNT 4E47A 2CZ6B 5AT1B 1JBMA 4OB3B 1H3HA 3GBQA 1WHMA 5CKEA 1PG5B 1U06A 4DEXA 1HK9A 1VQ4T 3O5ZA 1B34B 4IIOA 1M1FA 2EPDA 2RA2A 4Z88A 3CD6T 2COWA 3T9NA 2DYIA 4RTYA 2CP6A 1RLPC 1VQ5A 3JCMh 4AFQC 2OAUA 3EGXA 1GCQA 1QKWA 2LT4A 4MMKA 1Q82R 2XHCA 2Y4XA 3M0TA 4N4HA 2IIMA 1BKBA 2DBMA 2XK0A 4OB2B 2I2LA 3VS7A 4BI8B 3REAB 2LCCA 2HQHA 2JXBA 2LCLA 1ZSGA 3OYEA 3L2UA 3RUXA 2A7YA 2R5AA 4EMGA 5FRMA 3J7AF 3OYCA 1VQMA 1YNZA 1ZUKA 3V7SA 2L5QA 4FYWB 5D6YA 1VYTA 2JTMA 1VQ7T 2X4XA 4E6RA 4M78G 3UATA 2VXFA 3HFOA 4KULA 2QK0A 2X51A 3CPWS 4IUTA 3PTAA 1S1NA 3MP1A 1K9MC 4CRIA 4Y92A 5GANf 1QP3A 2ZPGB 1D0YA 3CMET 1WFWA 3A8MB 4O5VA 4RTUA 1K8AU 1UJ0A 1IGUA 5GAOr 4C5HA 4DOVA 1ZSZB 1R77A 1MUZA 3OYLA 8AT1B 1VQ6T 1LVKA 2EYQA 2E4HA 3WVEB 1GBRA 1FMKA 5CIUA 4BY6B 3HPWA 1MGQA 1YJWQ 3E9GA 4X9DA 3NTHA 4E7IA 1W4SA 2QASA 5J3BA 2RI2A 3C95A 4BE0A 3TCJA 1NBEB 2OTLA 2KYMA 4C0GA 3G71A 3CBPA 2OTLQ 1K1ZA 2COYA 5IXBA 1E6HA 2JT4A 2XICA 1UTIA 2A3LA 1PRLC 3I56A 1D1CA 2PUKB 4GY5A 3CCMQ 2PU9B 1NM7A 1PD0A 1KG1A 3CCQT 3CC4A 1OPKA 6AT1B 5KYUB 4KH1B 2O9VA 2ZCFB 4MDWA 3HRSA 1RADB 2XI9A 2SEMA 4MMLA 1HD3A 3QXEB 1B7TA 4ZTFA 2EYXA 3DLMA 4PJMA 3JB9I 5GAOl 3A8LB 2DJZA 1KQSS 2LRQA 4Y28E 1K8AR 2EAYA 1FWZA 3PIPA 5CKDA 1SRMA 3X26B 1YHQA 4J9BA 1B34A 2DL3A 2LQ8A 3INZA 4J8OA 2ESWA 4BY6C 2DRMA 3OSVA 3QJYA 5D7UA 2OTJQ 1XJWB 5LJ5d 1X6GA 2DZCA 3G7ZA 5LJ3f 2COZA 3KBGA 3OB9A 1ZLMA 3EFOA 3S6WA 4B9WA 2DTHA 3M54A 4B9XA 2LT1A 2LQNA 3VU3C 3C0CA 3OYGA 4J6XA 3RKYA 3CCVQ 4HCZA 4DA4A 1N5ZA 3EFSA 1OI1A 1WJQA 1O75A 4FIBA 3CCVA 4II1A 1IXDA 3OYJA 3G6EQ 2AK5A 1R0BG 3JRZA 3EHQA 4ORZA 2XDBA 3TSZA 1KC8R 1RLQC 2LTOA 2E12A 2DD4A 2H3JA 3CCEQ 1VIFA 3UWNA 3OQ5A 2FZGB 3VS5A 3VUZA 4HCKA 3QDRB 3VRYA 4FSXA 5FROA 2X9HA 4FYYB 2DX1A 5GAMd 2QXFA 3DLLA 1BK2A 2D0QB 2O4XB 3SFMA 1K0XA 2BKDN 3CMAQ 1MMGA 1IB8A 2KRMA 1VQPT 4DBRA 1KHIA 4JZ4A 4M7DG 2FZKB 1Q86C 1G3SA 1MV3A 4FW2A 2CT4A 4ELYC 1AD5A 3OW2S 1X75C 4IUPA 1NLOC 2B8AA 2BE7D 2V8KA 1MMDA 2J05A 1D3BB 1KK7A 5CVIA 3F70A 1D3BA 1D0ZA 5CQYA 2P4RA 2DEUA 3OMCA 2LX7A 3JB9G 3OW2A 3VJPA 1BI2A 2JMCA 2NUTA 5CKHA 1TWBA 2K9GA 1KQ2A 1NEBA 2CZ0B 1Z9QA 4E7SA 1YITQ 1X6BA 2JS0A 2RB6A 4N4GA 2QEXA 2O31A 4X1VA 2DXUA 1Q81R 5A0DA 4RMOA 2EIFA 3FIFA 2DIQA 3LLRA 2QQ9A 4J6YA 4F7UB 3EG3A 2XD0A 2YRVA 3V8KA 1QQJA 1YIJA 1KD1C 3P8DA 1RACB 2EGEA 2EGCA 2L2PA 4LN2A 2PVGB 1UUEA 4GBQA 4PLLA 1I07A 2RO0A 3G71Q 3HP9A 3R6OA 5I2MA 4BD3A 1ZX6A 3CXCP 4LUEA 5LJ3d 3C12A 2V1RA 2F5KA 2Y90A 5GJWB 4OF1A 3GP8A 3I9QA 1NJIU 2CUDA 3I5RA 2RF0A 4J9HA 1VYUA 3D7SB 3ER0A 3FB9A 4LD6A 4JRQA 3RMSA 1ZBJA 3L2QA 1UG1A 5LJ3h 3JCMV 2GNCA 1UGPB 2HBWA 4PJOF 3X28B 1OQKA 4DBFA 3EGUA 4CC4B 3CCSQ 5CQXA 3JB9H 1ZSZA 5I11A 1RI0A 2YHTA 1GFCA 3CC7A 2E5QA 2FRWA 2RHUA 4M7DE 3LWIA 5HCKA 2RHYA 1SG5A 3IQLA 4AFSC 2CP2A 1YCYA 2DILA 3PFSA 3JB9J 1MV0B 4PJOE 3M9QA 1PSFA 3EG9A 4N0AC 1Q86U 3SWNB 1QWEA 1KSWA 2MI6A 4FM4B 3PE0A 5KYYB 4M4ZA 4JJDA 2XKOC 2EQIA 3CQTA 1M1KR 5EC7A 1OX8A 1YBYA 1Q95G 3MKDA 2FEIA 2E64A 1VQ4Q 4IIMA 2DNUA 3NGPA 2ECZA 2L0AA 1EZZB 4RCBA 5CKFA 2LP5A 2HBPA 5IH2A 1QVFS 3QYHB 5GAN6 5KCHA 3CMAT 4BUGA 5GAOq 4HT9A 2X3WD 2QDYB 4QQGA 3S3MA 1MHNA 3A8GB 3OS1A 4BB7A 2YUOA 2EQJA 2VV5A 1VQKT 2XMFA 1M4ZA 2R5MA 1M2VA 3QG1A 1AVZC 2L3SA 2YLCA 3MEWA 2ROTA 3I55A 3JCMJ 4ZTJA 2JM9A 4ZGEB 2EJ9A 3M58A 3M0QA 2E3HA 3ZL7C 1YJ9A 4M75C 2GTJA 4ZN1A 3I56T 1F1BB 3V8JA 4D6WA 2QA4A 1WHJA 4NOYA 4ESRA 2OTJT 5J26A 2MYSA 4M78C 1C6VX 4CI0C 2QQAA 4KH0B 1ZUYA 1Z9ZA 4IUQA 5CCAA 1WJSA 5GMKl 4EMKB 2NWMA 5IHKA 1VQLT 5GANj 2D8HA 3J80E 1MMNA 1JU5C 1QLYA 2KXDA 5KYWB 2DK3A 4M7DA 2E6ZA 4R0KA 4F04B 5GAOm 2JNGA 3VV0A 5FU7B 3EG1A 1TU0B 4M7AG 2FPFA 2QQBA 5LJ5j 3CPWP 4ZNXA 4PJOA 1D1AA 2HCKA 1T0JA 4M77C 2EW3A 2QQSA 5GAN3 4CC3A 2YXYA 2M51A 3JCMQ 1N8RU 2CGHA 1VQ8Q 1PCXA 4C92B 2LNHB 3EAEA 3QO3A 2DL8A 2DAQA 4OMOA 4M75F 3VYGA 1YI2Q 2BZ8A 2RQRA 1AZGB 4M75D 4M78F 1E6GA 2DBKA 4WF2A 4XTXA 1K76A 1VQOA 2LCSA 4M78E 2AT1B 4PJOC 2LNVA 2RPNA 2K5IA 1HYOA 1WA7A 1YJNT 3OYKA 2M0OA 3G4SQ 3V8LA 1QWFA 1WHHA 2RHZA 2RK2A 4M75G 1WLPB 1EFNA 3FC3A 4DEYA 2KT1A 2IPOB 4C8QG 2BE9B 1M3CA 2HMAA 1K73C 1I8FA 2C0OA 5DY9A 4PJJA 2VVKA 1BB9A 2NUPB 5LJ3e 3I55T 1ZSZC 2CP3A 3OW2P 4FCYA 2MMPA 3RIRA 4QW2A 3N5BB 2RNAA 2VXEA 4M75E 3VUBA 2KBTA 3OBWA 4QT7A 3CCET 1W70A 1VQPA 1AHJB 2H3EB 1MMAA 1YFNA 3G4ST 4PJOB 2NLUA 4LNPA 5J39A 4HVUA 3WXMB 4K11A 1H3ZA 5KE3A 3EH2A 4C92C 4M7DB 4Z02A 3SD4A 4C0ZA 1JJ2A 4C92D 2DXCA 3HRTA 1YJWA 1R8OB 2ZZDA 1Y71A 4LDYA 2EFIA 1NEGA 2JUFA 3BW1A 1YJ9T 3LW5E 2A0FB 3QDFA 2K6DA 5DLOA 1XNIA 3WVDB 3CCST 2X4JA 2WSEE 2QYZA 4PJOG 3EG0A 1KC8C 5GAOn 2QAZA 1AWWA 4JRPA 2AKKA 3M4GA 1MNDA 4IURA 1EIFA 3CEYA 4ME7A 3E1SA 4EDUA 1SRLA 2DYBA 3CCUQ 2DA9A 1Y0MA 2MK5A 2EYWA 4DQ2A 3CCLQ 2FRYA 4XK8E 2XDDA 3CCUA 4M77F 3S3NA 4OMMA 3G4SA 3CCLA 3CCUT 3KFVA 4M77A 1GL5A 3PIOA 2DXBA 2K57A 1I81A 2DZ9A 2RI5A 1VQNQ 1WHLA 1CSKA 2KRNA 4M7AB 3CPFA 4F7UE 5LJ5h 3CC2Q 1N9RA 2DFUA 4E7ZA 1W2BP 2H8HA 4IUUA 4J9EA 4F7UF 2PZ1A 3CCSA 3M4YA 1VUBA 3G6ET 3EH1A 1VYVA 2P4TA 5GANg 5L23A 3EFOB 3MHXA 5GJVB 2ATCB 1K73U 1I4K1 4XTZA 2JS2A 5GAN4 1H92A 1LPLA 2GBQA 1VQMQ 4CC2A 3QJ6A 3TU4K 3GNFB 1AWJA 1IHWA 1WDXA 4LDWA 3OY9A 1I5OB 4M78B 3AT1B 4C8QB 4Z89A 2YT6A 4E2FB 5A0LA 1M8MA 2ED1A 3A98A 1ZHIA 3MEAA 2CH4W 2D8JA 1D09B 4Y91A 1BIAA 1P92A 1ZUUA 2JMAA 4J7IA 2BTTA 1SKUB 1QVPA 2FZCB 1VQOT 4DBHA 3CCEA 4IKFA 1OZ2A 2RM4A 1EX4A 2OAWA 5I21A 2RN8A 3RR6A 3RBBB 2X4YA 1N9SA 5GANh 2IG0A 5KYWA 2DTOA 5CK9A 2E10A 3GOXA 3BY7A 4XU1A 4BI3A 5FU7C 4AG1C 1DJ7B 4XU2A 4J9DA 1KQSP 2DEQA 2BIVA 3OYAA 2D0NA 5KYYA 1VQ9Q 1ZA1B 2RH2A 3E19A 2KGTA 2MF2A 1G2BA 1WYXA 3JCMW 5FW9A 1LCKA 2DVJA 1X6OA 3I56Q 1KC8U 4MZPA 2EJFA 2LJ0A 1VQ7Q 5KYUA 3OYDA 4V2SA 1GBQA 5IAYA 1Y96A 2DD5A 4E7KA 3CD6Q 2HKNA 4OB1B 2CH4A 1PRMC 1GXIE 3R6NA 2VASA 1YJNA 4M7AD 2F2VA 3JCMf 1X69A 5DM7R 4M7AF 2QI2A 2J6KA 4C0FA 2JOYA 3CCQQ 2V1QA 4RTXA 5GAOp 2K3YA 1C0MA 1TUDA 5LJ5e 1U3OA 4E7JA 2P0KA 2OTJA 4C92F 1M3BA 5I22A 4LXCA 1SEMA 4JPBW 2RK1A 2RMOA 3DB3A 2LMJA 3DKMA 4XU3A 4BDZA 2HKQB 3CCLT 4M77E 3FEOA 3JB9D 3DB4A 4OMQA 2GF7A 2DRKA 3A1PA 4O6JA 2DL5A 4C8QC 3SWNC 2YSQA 1Q7YR 1I5LA 1X27A 1TTHB 2JN0A 3V7CA 4KUDK 4A4KA 3BDUA 5D6XA 2B86A 1I0CA 9ATCB 3FJPA 1E7OA 1NJIC 1M90C 4M77G 2RJCA
chains in the Genus database with same CATH topology
1OULA 1OU8A 1OX9A 2NYSA 2QAZA 1OX8A 2QASA 1YFNA 1OU9A 1ZSZA 1ZSZC 1ZSZB 1TWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OUL A;  1OU8 A;  1OX9 A;  2NYS A;  2QAZ A;  1OX8 A;  2QAS A;  1YFN A;  1OU9 A;  1ZSZ A;  1ZSZ C;  1ZSZ B;  1TWB A; 
#chains in the Genus database with same CATH topology
 3OYF A;  3CC4 Q;  1BCM A;  2KMT A;  1UJY A;  2K3X A;  3HL8 A;  3OYI A;  3VS6 A;  3V7R A;  4J9C A;  4ZN3 A;  2MWO A;  1V76 A;  2F2X A;  1KQS A;  1C1A A;  1NYG A;  2EJG A;  3THK A;  2PUO B;  5FRN A;  2XDP A;  2YUN A;  2K4Y A;  3H8Z A;  4FL6 A;  5HK0 A;  2LQW A;  2ZAE A;  1M9S A;  2DIG A;  1UGV A;  4OGC A;  1AT1 B;  1KD1 R;  2MPX C;  5C0M A;  2KXC A;  1U1T A;  4OGE A;  4ANJ A;  3QSU A;  4FW1 A;  2KAF A;  3QPH A;  4ZGJ B;  1VQ6 A;  1VQK A;  1NZ9 A;  4C5I A;  3URG A;  2J6F A;  1UDL A;  4WCI A;  1JJ2 P;  3H6Z A;  1PKS A;  4M75 B;  3JCM P;  1ZBX A;  4C8Q D;  1D0X A;  3M55 A;  1BBZ A;  1YIT A;  3CCQ A;  4JZ3 A;  3AHU A;  1BI0 A;  1IRE B;  3MCA B;  3VYH B;  2CP0 A;  3EGX B;  4LDX A;  1M30 A;  4FT4 A;  2CRE A;  5GMK h;  4B6M A;  1GCP A;  1LOJ A;  3I55 Q;  1M1K U;  3TVT A;  3LWH A;  2XU8 A;  2CT3 A;  1YIJ T;  2A36 A;  4J5Y A;  3OYN A;  1AWO A;  2K2M A;  2O88 A;  3CCM T;  2NYS A;  2EKO A;  4FYV B;  1WXT A;  2CP5 A;  2V8J A;  4JJC A;  2X3X D;  3EG2 A;  1W2B S;  2NUP A;  2DO3 A;  2KVQ G;  3TSW A;  2QEX T;  4JRK A;  3OBY A;  2GGR A;  2ABL A;  4HKE A;  3VKI A;  2AKL A;  2CSQ A;  4F7U G;  4C8Q E;  1WX6 A;  1S72 Q;  2F5T X;  4C5G A;  3L1A A;  4RTZ A;  1WXU A;  4A4H A;  2DKG A;  1IZ6 A;  4JS5 A;  3FRN A;  2RD1 A;  2RQT A;  3NFC A;  5GAM j;  3OS5 A;  1WPY A;  4NL3 A;  2RJD A;  5GAN 5;  1RL2 A;  4PJO D;  1UFF A;  3OS0 A;  1WQ7 A;  3KXT A;  1XQH A;  5FWB A;  2DET A;  3LGL A;  2CYZ B;  2LX9 A;  1N8R C;  3A5Z B;  2HSE B;  2YRC A;  1WXB A;  1FXX A;  2G3R A;  5I2S A;  3ME9 A;  1NG2 A;  3RDV A;  2M1H A;  2LJ3 A;  4DBQ A;  2F1L A;  4A63 B;  1X01 A;  5IHN A;  3MEV A;  3M0U A;  1OU9 A;  3JCM d;  2KE9 A;  2WSC E;  3HTR A;  1CKB A;  1S72 T;  1WNL A;  1NLP C;  5A0G A;  4BI4 A;  2QA4 T;  3BE3 A;  2QTX A;  3FLG A;  3BFM A;  3PGG A;  4L5G A;  1PNJ A;  4N0A A;  5L8R E;  2CP7 A;  3KUF A;  1VQ8 T;  1I1J A;  2DE0 X;  3QYG B;  2RQV A;  3OYB A;  1PD1 A;  3MP8 A;  3EHR A;  1RAB B;  4ATO A;  3RES A;  3ULR B;  2RHI A;  3G6E A;  3FJ5 A;  1UGQ B;  2VGN A;  3CCV T;  3ZEH A;  1VOM A;  2RJF A;  3QII A;  4R56 A;  2QDL A;  2P84 A;  3A8H B;  3I5S A;  5KCO A;  1OV3 A;  2KYB A;  2I0N A;  2QQR A;  2ZPI B;  4IUV A;  2E6N A;  2GQV A;  2RQW A;  4JRI A;  2YUQ A;  3CMA A;  1M1K C;  2CSI A;  1WZO A;  2DM1 A;  1G3T A;  3GPL A;  4OVA A;  2DF6 A;  3SHW A;  1OOT A;  1Q86 R;  2FL7 A;  2E65 A;  1OEB A;  4EPC A;  2FO0 A;  2M02 A;  1IGQ A;  1W1F A;  5KE2 A;  3ZBD A;  2G6F X;  5GMK e;  2VKN A;  2A28 A;  2CKK A;  1TH7 A;  2WAC A;  4M78 A;  2F69 A;  5GMK m;  3RMQ A;  2QGF B;  4E7H A;  1KQ1 A;  3CCR A;  3JAM E;  1ABQ A;  3UA6 A;  2ZPE B;  4YTL A;  4A4F A;  3CCJ A;  2LDM A;  2ZPH B;  3M53 A;  1XTD A;  2HQX A;  3G1J A;  3QUI A;  2J06 A;  2K79 A;  2LC4 A;  1YJW T;  5GAM h;  2M16 A;  4FU6 A;  4PK4 A;  3ASK A;  2CZ1 B;  3QWY A;  4D8K A;  1H64 1;  2QEX Q;  4C92 A;  3L42 A;  2FYK A;  3G71 T;  2QTV A;  2LZ6 B;  4E7L A;  1LJO A;  3S3O A;  2OJ2 A;  3M57 A;  3QBY A;  3MJX A;  3CBO A;  2DVE A;  4LDV A;  1QW1 A;  4JLG A;  3I35 A;  3GF5 A;  1RAF B;  3JB9 F;  3LH5 A;  2VYT A;  1YIJ Q;  4Z8A A;  5FU6 B;  4KGZ B;  1TXQ A;  1VQO Q;  2FHD A;  3L2V A;  1Q82 U;  1YP5 A;  4M77 D;  5KH6 A;  1YCS B;  4J83 A;  3L2W A;  1YI2 T;  4M77 B;  3SWN A;  3SEM A;  2HEQ A;  1QVG A;  2F2W A;  4MDX A;  1Y7X A;  3E9F A;  2DPP B;  3VS0 A;  1KHC A;  2EVR A;  3H0F A;  2K5F A;  4JJB A;  3H41 A;  1RI9 A;  3NTK A;  4OMN A;  2MCN A;  2GTO A;  4RTV A;  5LL6 S;  4HVW A;  4F7U A;  5HKC A;  5GAM e;  4P5N A;  5GAN 2;  1M2O A;  2KEA A;  1SF9 A;  5LJ5 f;  3PVL A;  5M9O A;  4NS5 A;  1PHT A;  2D1X A;  1M5Q 1;  3P8B B;  4JLI A;  5GAM f;  4JDS A;  4OMF B;  2OTL T;  2EGA A;  2WSF E;  3QZ5 B;  3CC7 Q;  5D6W A;  3QWX X;  1M1G A;  2EYY A;  1U5S A;  1QVG P;  1VQ8 A;  1SHG A;  2O9S A;  4Q5W A;  1GCQ C;  2R57 A;  1OZ3 A;  1T3L A;  1BI3 A;  4QVZ A;  1AWX A;  1K4U S;  1BIB A;  2KR3 A;  1VQ4 A;  4HCB A;  1VQ6 Q;  3LYI A;  1RAH B;  3CXC A;  4EMK A;  3CCR Q;  2BZX A;  4KRT A;  3VS1 A;  1B3Q A;  3HHT B;  3CXC S;  3MP6 A;  3OYH A;  2LJ1 A;  5ECA A;  1BU1 A;  2O2O A;  2KT8 A;  2IVW A;  1A0N B;  1V29 B;  5LJ5 g;  3PMI A;  4GLM A;  1K8A C;  1JXM A;  4GLK A;  4AMC A;  1G8X A;  4N4I A;  5C6S A;  2OI3 A;  1UGR B;  2E70 A;  2KRO A;  2J6O A;  1X43 A;  3OS2 A;  3UF4 A;  2DMO A;  1VQ9 A;  4C0D C;  4XU0 A;  1JO8 A;  4A54 A;  1VQL Q;  1NJI R;  3EGD B;  3E2U A;  3JV3 A;  1VQL A;  4NL2 A;  1VQ5 T;  4QQ6 A;  1U8R A;  2YRD A;  2BZY A;  4HT8 A;  3PT9 A;  2JJ9 A;  5LJ3 j;  2DTI A;  1T0H A;  4RG2 A;  3CD6 A;  1Y96 B;  5GMK j;  3NTI A;  5GAN e;  2HNI A;  1UHC A;  4UC4 A;  4HXJ A;  1QVG S;  2K5L A;  2CUB A;  4WTO B;  1OUL A;  3M5A A;  1Q82 C;  2XID A;  4QVC A;  1NPP A;  3TEE A;  2C0T A;  5KYX B;  2AZV A;  3GNG A;  5FU6 C;  3CCM A;  2HZY A;  1VQN A;  4EIK A;  1FMW A;  2JVV A;  2YUP A;  1JRI A;  1UE9 A;  2W10 A;  3CC2 A;  3OYM A;  2JTE A;  1WQW A;  1JXO A;  1YHQ T;  4J9I A;  4PLI A;  4M7A E;  3QKJ A;  1X2Q A;  3OYY A;  1WGS A;  1PC0 A;  2JZ2 A;  2D9T A;  2QG9 B;  2RHX A;  5EG2 A;  2MIO A;  2PQW A;  4BDY A;  3C4S A;  1M2V B;  3VRZ A;  4KBM B;  4RG8 A;  3JCM X;  1WIE A;  2ZPB B;  1QP2 A;  3RER A;  1QCN A;  1G3W A;  3PNW C;  4J9F A;  2JM8 A;  3CC4 T;  1FMV A;  1K9M R;  2E41 A;  2GFA A;  8ATC B;  3TRE A;  1YI2 A;  2CZ7 B;  3UPU A;  4OB0 B;  4PJN A;  5IHI A;  3Q1J A;  1QMC A;  2PNI A;  1V1C A;  4TVR A;  2L3Q A;  4BE2 A;  2J7I A;  3RKW A;  2AZS A;  4F17 A;  4M78 D;  3JCM e;  2HL5 C;  2KRS A;  3PMT A;  1M90 U;  4HCC A;  1AZE A;  1GRI A;  3M0S A;  4QKU A;  3H0I A;  4J6W A;  1IRX A;  1K9A A;  3CC7 T;  5GAM g;  4OMP A;  2KI7 A;  4FSS A;  4OP0 A;  3UT1 A;  1VQ5 Q;  1TUC A;  2M9U A;  3REB B;  3J81 E;  3O8V A;  1BYM A;  4MZM A;  2HDA A;  1CKA A;  4XTU A;  3JCM g;  4ELZ C;  1TG0 A;  3CME A;  5HY6 A;  3CCJ T;  1KIK A;  3EGD A;  4M7A C;  2E3I A;  4J7F A;  1W2B A;  4XTW A;  3CME Q;  1M8V A;  4BE1 A;  4AFU C;  3CCR T;  2L89 A;  3JSC A;  1K73 R;  2ENM A;  1HSQ A;  3OSS C;  2QA4 Q;  3NMZ C;  5CKB A;  3H0H A;  1OYX A;  4JUV A;  1NPR A;  3EG9 B;  1O9S A;  1X2K A;  1W6X A;  2P0P A;  2EKH A;  5IN1 A;  4J9G A;  1VQ7 A;  2HL3 A;  1XOV A;  4AT1 B;  3M59 A;  4XAX B;  2FB7 A;  1B07 A;  1Q81 U;  1Q7Y C;  1PWT A;  3CBM A;  3VS2 A;  2LQK A;  5KYX A;  4RTW A;  3JCM b;  3NHN A;  2VC8 A;  1UHF A;  3CC2 T;  1H8K A;  3JCM c;  4KGV B;  2KNB B;  2V8I A;  2HQE A;  1D1B A;  1SSF A;  4QQD A;  5IXF A;  1TOV A;  1J3T A;  4C8Q F;  1OU8 A;  1IHV A;  4HA8 A;  1SPK A;  1TSF A;  4FYX B;  1WI7 A;  4PFO A;  3MO8 A;  1JJ2 S;  1G3Y A;  1JB0 E;  2VWF A;  7AT1 B;  4JJN K;  2NUT B;  4F16 A;  2BUD A;  4MZT A;  3CCJ Q;  1NYF A;  2PVO B;  4QVD A;  1LNX A;  3X20 B;  1N6A A;  2YWW A;  5CR2 A;  2SRC A;  1RAE B;  4R55 A;  3HSB A;  4XTV A;  2DJQ A;  4DOW A;  1UEC A;  4KT0 E;  2MWP A;  2ROL A;  4LUD A;  1VQ9 T;  2DL7 A;  5GAN d;  2EQU A;  5DLQ E;  1KD1 U;  4PJL A;  2XG8 D;  1G83 A;  2GQI A;  2EBP A;  1QCO A;  1ZQ1 A;  2C0I A;  3H9N A;  2EYZ A;  2FPD A;  4A4E A;  3PVQ A;  1S72 A;  1YJ9 Q;  3QHS A;  3U23 A;  2DER A;  1KJW A;  1QVF A;  1YWO A;  3C94 A;  4C8Q A;  4X34 A;  2W0Z A;  3RNJ A;  4OML A;  4CC7 A;  1RAA B;  2MAM A;  3TQ7 P;  2FVU A;  4FT2 A;  1RAG B;  1JQQ A;  2PVD B;  3LH0 A;  2EWN A;  2AHJ B;  1MNE A;  4XTY A;  1OX9 A;  1VA7 A;  4LDU A;  3MEU A;  4PKC C;  4C0D B;  1VIE A;  2HD0 A;  3GIB A;  2VGM A;  1G5V A;  3SDZ A;  1ABO A;  5AYF A;  4A53 A;  2O4X A;  1WHG A;  4RUG A;  2K3B A;  2L3R A;  4C92 G;  1HXD A;  3OA6 A;  1M90 R;  2O01 E;  1WHK A;  1WJR A;  3OMG A;  1YN8 A;  4L6V 5;  3P8H A;  4EMH A;  5FLX E;  4XQ3 A;  4PL6 A;  4A4G A;  2GCX A;  4M7D C;  4KUI A;  1Q81 C;  2KY9 A;  1Q7Y U;  1VQP Q;  5A2Q E;  3A8O B;  2YLB A;  4PFZ A;  1Y57 A;  3M56 A;  4ZGD B;  3BDL A;  1K0S A;  2L3P A;  4AG2 C;  4RKU E;  1R0C B;  4LE9 A;  1N27 A;  3VS3 A;  3HRU A;  4D8D A;  3HKS A;  3M0R A;  4EMK C;  5IT9 E;  2RQU A;  2YDL A;  1M27 C;  3UA7 A;  2E5K A;  4M7A A;  2CS7 A;  3HFN A;  2EQM A;  1QCF A;  1M3A A;  4BAC A;  1RAI B;  1Y07 A;  1UGS B;  3FDR A;  3LGF A;  4AFZ C;  2K7A A;  1T3S A;  1IO6 A;  1HJD A;  2R58 A;  1OPL A;  1QVF P;  3LX7 A;  3L2Z A;  1YIT T;  1TS9 A;  2V26 A;  4X9C A;  2Y4Y A;  1AOJ A;  5CO7 A;  4JS4 A;  2A37 A;  2X4W A;  2NUZ A;  1SHF A;  1GFD A;  2JW4 A;  3CPW A;  1ACM B;  2DL4 A;  2KDS A;  2HAX A;  2DLP A;  4LD9 K;  2Z0W A;  3ZFJ A;  2EQK A;  1AEY A;  2MOX A;  3EFR A;  1VQK Q;  2KQW A;  3MET A;  4HVV A;  1YJN Q;  1ARK A;  1RUW A;  1PKT A;  2D6F A;  2OX7 A;  2QGG A;  3GLX A;  1FX7 A;  2AIR B;  5GAN 8;  1FYN A;  1PSE A;  3UDC A;  2KK4 A;  1K9M U;  3M0P A;  1UB4 A;  1KFZ A;  5GAN 7;  4VUB A;  4KGX B;  4L59 A;  2DXT A;  2ED0 A;  3L2R A;  2FPE A;  4M7D D;  2A08 A;  3X24 B;  2P0Q A;  1JEG A;  1QKX A;  4M7D F;  2VB6 A;  1YHQ Q;  1TUG B;  5LJ3 g;  5HK3 A;  2VUB A;  5KYN A;  1PM3 A;  3SB2 A;  4PNO A;  2M0Y A;  4PFP A;  4C92 E;  1U1S A;  2RI3 A;  2GFU A;  4F14 A;  2X35 A;  5FWC A;  1YWP A;  2FG0 A;  2ZPF B;  4C5E A;  1SSH A;  3MPU B;  2HSP A;  4RCC A;  1ZA2 B;  2JTF A;  2K2V A;  2E1H A;  5GMK i;  3RKX A;  2L8D A;  2LVM A;  4RTT A;  1VQM T;  3VS4 A;  2C06 A;  2PTK A;  1BI1 A;  2RJE A;  4M75 A;  2ZGW A;  5CAI A;  2KSS A;  3NPF A;  3X25 B;  1N8R R;  1NE8 A;  3QZ9 B;  2CDT A;  1UEB A;  1BCO A;  1VQN T;  4E47 A;  2CZ6 B;  5AT1 B;  1JBM A;  4OB3 B;  1H3H A;  3GBQ A;  1WHM A;  5CKE A;  1PG5 B;  1U06 A;  4DEX A;  1HK9 A;  1VQ4 T;  3O5Z A;  1B34 B;  4IIO A;  1M1F A;  2EPD A;  2RA2 A;  4Z88 A;  3CD6 T;  2COW A;  3T9N A;  2DYI A;  4RTY A;  2CP6 A;  1RLP C;  1VQ5 A;  3JCM h;  4AFQ C;  2OAU A;  3EGX A;  1GCQ A;  1QKW A;  2LT4 A;  4MMK A;  1Q82 R;  2XHC A;  2Y4X A;  3M0T A;  4N4H A;  2IIM A;  1BKB A;  2DBM A;  2XK0 A;  4OB2 B;  2I2L A;  3VS7 A;  4BI8 B;  3REA B;  2LCC A;  2HQH A;  2JXB A;  2LCL A;  1ZSG A;  3OYE A;  3L2U A;  3RUX A;  2A7Y A;  2R5A A;  4EMG A;  5FRM A;  3J7A F;  3OYC A;  1VQM A;  1YNZ A;  1ZUK A;  3V7S A;  2L5Q A;  4FYW B;  5D6Y A;  1VYT A;  2JTM A;  1VQ7 T;  2X4X A;  4E6R A;  4M78 G;  3UAT A;  2VXF A;  3HFO A;  4KUL A;  2QK0 A;  2X51 A;  3CPW S;  4IUT A;  3PTA A;  1S1N A;  3MP1 A;  1K9M C;  4CRI A;  4Y92 A;  5GAN f;  1QP3 A;  2ZPG B;  1D0Y A;  3CME T;  1WFW A;  3A8M B;  4O5V A;  4RTU A;  1K8A U;  1UJ0 A;  1IGU A;  5GAO r;  4C5H A;  4DOV A;  1ZSZ B;  1R77 A;  1MUZ A;  3OYL A;  8AT1 B;  1VQ6 T;  1LVK A;  2EYQ A;  2E4H A;  3WVE B;  1GBR A;  1FMK A;  5CIU A;  4BY6 B;  3HPW A;  1MGQ A;  1YJW Q;  3E9G A;  4X9D A;  3NTH A;  4E7I A;  1W4S A;  2QAS A;  5J3B A;  2RI2 A;  3C95 A;  4BE0 A;  3TCJ A;  1NBE B;  2OTL A;  2KYM A;  4C0G A;  3G71 A;  3CBP A;  2OTL Q;  1K1Z A;  2COY A;  5IXB A;  1E6H A;  2JT4 A;  2XIC A;  1UTI A;  2A3L A;  1PRL C;  3I56 A;  1D1C A;  2PUK B;  4GY5 A;  3CCM Q;  2PU9 B;  1NM7 A;  1PD0 A;  1KG1 A;  3CCQ T;  3CC4 A;  1OPK A;  6AT1 B;  5KYU B;  4KH1 B;  2O9V A;  2ZCF B;  4MDW A;  3HRS A;  1RAD B;  2XI9 A;  2SEM A;  4MML A;  1HD3 A;  3QXE B;  1B7T A;  4ZTF A;  2EYX A;  3DLM A;  4PJM A;  3JB9 I;  5GAO l;  3A8L B;  2DJZ A;  1KQS S;  2LRQ A;  4Y28 E;  1K8A R;  2EAY A;  1FWZ A;  3PIP A;  5CKD A;  1SRM A;  3X26 B;  1YHQ A;  4J9B A;  1B34 A;  2DL3 A;  2LQ8 A;  3INZ A;  4J8O A;  2ESW A;  4BY6 C;  2DRM A;  3OSV A;  3QJY A;  5D7U A;  2OTJ Q;  1XJW B;  5LJ5 d;  1X6G A;  2DZC A;  3G7Z A;  5LJ3 f;  2COZ A;  3KBG A;  3OB9 A;  1ZLM A;  3EFO A;  3S6W A;  4B9W A;  2DTH A;  3M54 A;  4B9X A;  2LT1 A;  2LQN A;  3VU3 C;  3C0C A;  3OYG A;  4J6X A;  3RKY A;  3CCV Q;  4HCZ A;  4DA4 A;  1N5Z A;  3EFS A;  1OI1 A;  1WJQ A;  1O75 A;  4FIB A;  3CCV A;  4II1 A;  1IXD A;  3OYJ A;  3G6E Q;  2AK5 A;  1R0B G;  3JRZ A;  3EHQ A;  4ORZ A;  2XDB A;  3TSZ A;  1KC8 R;  1RLQ C;  2LTO A;  2E12 A;  2DD4 A;  2H3J A;  3CCE Q;  1VIF A;  3UWN A;  3OQ5 A;  2FZG B;  3VS5 A;  3VUZ A;  4HCK A;  3QDR B;  3VRY A;  4FSX A;  5FRO A;  2X9H A;  4FYY B;  2DX1 A;  5GAM d;  2QXF A;  3DLL A;  1BK2 A;  2D0Q B;  2O4X B;  3SFM A;  1K0X A;  2BKD N;  3CMA Q;  1MMG A;  1IB8 A;  2KRM A;  1VQP T;  4DBR A;  1KHI A;  4JZ4 A;  4M7D G;  2FZK B;  1Q86 C;  1G3S A;  1MV3 A;  4FW2 A;  2CT4 A;  4ELY C;  1AD5 A;  3OW2 S;  1X75 C;  4IUP A;  1NLO C;  2B8A A;  2BE7 D;  2V8K A;  1MMD A;  2J05 A;  1D3B B;  1KK7 A;  5CVI A;  3F70 A;  1D3B A;  1D0Z A;  5CQY A;  2P4R A;  2DEU A;  3OMC A;  2LX7 A;  3JB9 G;  3OW2 A;  3VJP A;  1BI2 A;  2JMC A;  2NUT A;  5CKH A;  1TWB A;  2K9G A;  1KQ2 A;  1NEB A;  2CZ0 B;  1Z9Q A;  4E7S A;  1YIT Q;  1X6B A;  2JS0 A;  2RB6 A;  4N4G A;  2QEX A;  2O31 A;  4X1V A;  2DXU A;  1Q81 R;  5A0D A;  4RMO A;  2EIF A;  3FIF A;  2DIQ A;  3LLR A;  2QQ9 A;  4J6Y A;  4F7U B;  3EG3 A;  2XD0 A;  2YRV A;  3V8K A;  1QQJ A;  1YIJ A;  1KD1 C;  3P8D A;  1RAC B;  2EGE A;  2EGC A;  2L2P A;  4LN2 A;  2PVG B;  1UUE A;  4GBQ A;  4PLL A;  1I07 A;  2RO0 A;  3G71 Q;  3HP9 A;  3R6O A;  5I2M A;  4BD3 A;  1ZX6 A;  3CXC P;  4LUE A;  5LJ3 d;  3C12 A;  2V1R A;  2F5K A;  2Y90 A;  5GJW B;  4OF1 A;  3GP8 A;  3I9Q A;  1NJI U;  2CUD A;  3I5R A;  2RF0 A;  4J9H A;  1VYU A;  3D7S B;  3ER0 A;  3FB9 A;  4LD6 A;  4JRQ A;  3RMS A;  1ZBJ A;  3L2Q A;  1UG1 A;  5LJ3 h;  3JCM V;  2GNC A;  1UGP B;  2HBW A;  4PJO F;  3X28 B;  1OQK A;  4DBF A;  3EGU A;  4CC4 B;  3CCS Q;  5CQX A;  3JB9 H;  1ZSZ A;  5I11 A;  1RI0 A;  2YHT A;  1GFC A;  3CC7 A;  2E5Q A;  2FRW A;  2RHU A;  4M7D E;  3LWI A;  5HCK A;  2RHY A;  1SG5 A;  3IQL A;  4AFS C;  2CP2 A;  1YCY A;  2DIL A;  3PFS A;  3JB9 J;  1MV0 B;  4PJO E;  3M9Q A;  1PSF A;  3EG9 A;  4N0A C;  1Q86 U;  3SWN B;  1QWE A;  1KSW A;  2MI6 A;  4FM4 B;  3PE0 A;  5KYY B;  4M4Z A;  4JJD A;  2XKO C;  2EQI A;  3CQT A;  1M1K R;  5EC7 A;  1OX8 A;  1YBY A;  1Q95 G;  3MKD A;  2FEI A;  2E64 A;  1VQ4 Q;  4IIM A;  2DNU A;  3NGP A;  2ECZ A;  2L0A A;  1EZZ B;  4RCB A;  5CKF A;  2LP5 A;  2HBP A;  5IH2 A;  1QVF S;  3QYH B;  5GAN 6;  5KCH A;  3CMA T;  4BUG A;  5GAO q;  4HT9 A;  2X3W D;  2QDY B;  4QQG A;  3S3M A;  1MHN A;  3A8G B;  3OS1 A;  4BB7 A;  2YUO A;  2EQJ A;  2VV5 A;  1VQK T;  2XMF A;  1M4Z A;  2R5M A;  1M2V A;  3QG1 A;  1AVZ C;  2L3S A;  2YLC A;  3MEW A;  2ROT A;  3I55 A;  3JCM J;  4ZTJ A;  2JM9 A;  4ZGE B;  2EJ9 A;  3M58 A;  3M0Q A;  2E3H A;  3ZL7 C;  1YJ9 A;  4M75 C;  2GTJ A;  4ZN1 A;  3I56 T;  1F1B B;  3V8J A;  4D6W A;  2QA4 A;  1WHJ A;  4NOY A;  4ESR A;  2OTJ T;  5J26 A;  2MYS A;  4M78 C;  1C6V X;  4CI0 C;  2QQA A;  4KH0 B;  1ZUY A;  1Z9Z A;  4IUQ A;  5CCA A;  1WJS A;  5GMK l;  4EMK B;  2NWM A;  5IHK A;  1VQL T;  5GAN j;  2D8H A;  3J80 E;  1MMN A;  1JU5 C;  1QLY A;  2KXD A;  5KYW B;  2DK3 A;  4M7D A;  2E6Z A;  4R0K A;  4F04 B;  5GAO m;  2JNG A;  3VV0 A;  5FU7 B;  3EG1 A;  1TU0 B;  4M7A G;  2FPF A;  2QQB A;  5LJ5 j;  3CPW P;  4ZNX A;  4PJO A;  1D1A A;  2HCK A;  1T0J A;  4M77 C;  2EW3 A;  2QQS A;  5GAN 3;  4CC3 A;  2YXY A;  2M51 A;  3JCM Q;  1N8R U;  2CGH A;  1VQ8 Q;  1PCX A;  4C92 B;  2LNH B;  3EAE A;  3QO3 A;  2DL8 A;  2DAQ A;  4OMO A;  4M75 F;  3VYG A;  1YI2 Q;  2BZ8 A;  2RQR A;  1AZG B;  4M75 D;  4M78 F;  1E6G A;  2DBK A;  4WF2 A;  4XTX A;  1K76 A;  1VQO A;  2LCS A;  4M78 E;  2AT1 B;  4PJO C;  2LNV A;  2RPN A;  2K5I A;  1HYO A;  1WA7 A;  1YJN T;  3OYK A;  2M0O A;  3G4S Q;  3V8L A;  1QWF A;  1WHH A;  2RHZ A;  2RK2 A;  4M75 G;  1WLP B;  1EFN A;  3FC3 A;  4DEY A;  2KT1 A;  2IPO B;  4C8Q G;  2BE9 B;  1M3C A;  2HMA A;  1K73 C;  1I8F A;  2C0O A;  5DY9 A;  4PJJ A;  2VVK A;  1BB9 A;  2NUP B;  5LJ3 e;  3I55 T;  1ZSZ C;  2CP3 A;  3OW2 P;  4FCY A;  2MMP A;  3RIR A;  4QW2 A;  3N5B B;  2RNA A;  2VXE A;  4M75 E;  3VUB A;  2KBT A;  3OBW A;  4QT7 A;  3CCE T;  1W70 A;  1VQP A;  1AHJ B;  2H3E B;  1MMA A;  1YFN A;  3G4S T;  4PJO B;  2NLU A;  4LNP A;  5J39 A;  4HVU A;  3WXM B;  4K11 A;  1H3Z A;  5KE3 A;  3EH2 A;  4C92 C;  4M7D B;  4Z02 A;  3SD4 A;  4C0Z A;  1JJ2 A;  4C92 D;  2DXC A;  3HRT A;  1YJW A;  1R8O B;  2ZZD A;  1Y71 A;  4LDY A;  2EFI A;  1NEG A;  2JUF A;  3BW1 A;  1YJ9 T;  3LW5 E;  2A0F B;  3QDF A;  2K6D A;  5DLO A;  1XNI A;  3WVD B;  3CCS T;  2X4J A;  2WSE E;  2QYZ A;  4PJO G;  3EG0 A;  1KC8 C;  5GAO n;  2QAZ A;  1AWW A;  4JRP A;  2AKK A;  3M4G A;  1MND A;  4IUR A;  1EIF A;  3CEY A;  4ME7 A;  3E1S A;  4EDU A;  1SRL A;  2DYB A;  3CCU Q;  2DA9 A;  1Y0M A;  2MK5 A;  2EYW A;  4DQ2 A;  3CCL Q;  2FRY A;  4XK8 E;  2XDD A;  3CCU A;  4M77 F;  3S3N A;  4OMM A;  3G4S A;  3CCL A;  3CCU T;  3KFV A;  4M77 A;  1GL5 A;  3PIO A;  2DXB A;  2K57 A;  1I81 A;  2DZ9 A;  2RI5 A;  1VQN Q;  1WHL A;  1CSK A;  2KRN A;  4M7A B;  3CPF A;  4F7U E;  5LJ5 h;  3CC2 Q;  1N9R A;  2DFU A;  4E7Z A;  1W2B P;  2H8H A;  4IUU A;  4J9E A;  4F7U F;  2PZ1 A;  3CCS A;  3M4Y A;  1VUB A;  3G6E T;  3EH1 A;  1VYV A;  2P4T A;  5GAN g;  5L23 A;  3EFO B;  3MHX A;  5GJV B;  2ATC B;  1K73 U;  1I4K 1;  4XTZ A;  2JS2 A;  5GAN 4;  1H92 A;  1LPL A;  2GBQ A;  1VQM Q;  4CC2 A;  3QJ6 A;  3TU4 K;  3GNF B;  1AWJ A;  1IHW A;  1WDX A;  4LDW A;  3OY9 A;  1I5O B;  4M78 B;  3AT1 B;  4C8Q B;  4Z89 A;  2YT6 A;  4E2F B;  5A0L A;  1M8M A;  2ED1 A;  3A98 A;  1ZHI A;  3MEA A;  2CH4 W;  2D8J A;  1D09 B;  4Y91 A;  1BIA A;  1P92 A;  1ZUU A;  2JMA A;  4J7I A;  2BTT A;  1SKU B;  1QVP A;  2FZC B;  1VQO T;  4DBH A;  3CCE A;  4IKF A;  1OZ2 A;  2RM4 A;  1EX4 A;  2OAW A;  5I21 A;  2RN8 A;  3RR6 A;  3RBB B;  2X4Y A;  1N9S A;  5GAN h;  2IG0 A;  5KYW A;  2DTO A;  5CK9 A;  2E10 A;  3GOX A;  3BY7 A;  4XU1 A;  4BI3 A;  5FU7 C;  4AG1 C;  1DJ7 B;  4XU2 A;  4J9D A;  1KQS P;  2DEQ A;  2BIV A;  3OYA A;  2D0N A;  5KYY A;  1VQ9 Q;  1ZA1 B;  2RH2 A;  3E19 A;  2KGT A;  2MF2 A;  1G2B A;  1WYX A;  3JCM W;  5FW9 A;  1LCK A;  2DVJ A;  1X6O A;  3I56 Q;  1KC8 U;  4MZP A;  2EJF A;  2LJ0 A;  1VQ7 Q;  5KYU A;  3OYD A;  4V2S A;  1GBQ A;  5IAY A;  1Y96 A;  2DD5 A;  4E7K A;  3CD6 Q;  2HKN A;  4OB1 B;  2CH4 A;  1PRM C;  1GXI E;  3R6N A;  2VAS A;  1YJN A;  4M7A D;  2F2V A;  3JCM f;  1X69 A;  5DM7 R;  4M7A F;  2QI2 A;  2J6K A;  4C0F A;  2JOY A;  3CCQ Q;  2V1Q A;  4RTX A;  5GAO p;  2K3Y A;  1C0M A;  1TUD A;  5LJ5 e;  1U3O A;  4E7J A;  2P0K A;  2OTJ A;  4C92 F;  1M3B A;  5I22 A;  4LXC A;  1SEM A;  4JPB W;  2RK1 A;  2RMO A;  3DB3 A;  2LMJ A;  3DKM A;  4XU3 A;  4BDZ A;  2HKQ B;  3CCL T;  4M77 E;  3FEO A;  3JB9 D;  3DB4 A;  4OMQ A;  2GF7 A;  2DRK A;  3A1P A;  4O6J A;  2DL5 A;  4C8Q C;  3SWN C;  2YSQ A;  1Q7Y R;  1I5L A;  1X27 A;  1TTH B;  2JN0 A;  3V7C A;  4KUD K;  4A4K A;  3BDU A;  5D6X A;  2B86 A;  1I0C A;  9ATC B;  3FJP A;  1E7O A;  1NJI C;  1M90 C;  4M77 G;  2RJC A; 
#chains in the Genus database with same CATH homology
 1OUL A;  1OU8 A;  1OX9 A;  2NYS A;  2QAZ A;  1OX8 A;  2QAS A;  1YFN A;  1OU9 A;  1ZSZ A;  1ZSZ C;  1ZSZ B;  1TWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...