1ZSZB

Crystal structure of a computationally designed sspb heterodimer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
SSPKRPYLLRSLYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGAMFEPEEIYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Stringent starvation protein B homolog
publication title Specificity versus stability in computational protein design.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1zszB00
1ZSZB 2QASA 1TWBA 1YFNA 1ZSZA 1OU9A 2NYSA 1ZSZC 1OU8A 1OULA 1OX8A 2QAZA 1OX9A
chains in the Genus database with same CATH superfamily
4HCZA 2WSEE 3CQTA 2RB6A 1X2KA 4BE0A 1MUZA 4WCIA 2QDYB 1RLQC 2XK0A 4F7UA 3CCVA 2RJEA 2QGFB 4M4ZA 4M7DB 1XNIA 2E64A 3SWNC 1Y7XA 2V8IA 5GAMf 4L59A 1VQMA 2QI2A 5LJ3g 3CCSA 2YUOA 2DETA 4A63B 2L0AA 4A54A 3OYYA 3CXCA 5FWCA 1WGSA 1ZA2B 2OAUA 4LN2A 2HL3A 1JJ2A 2HAXA 2X51A 3EGXB 4ZGDB 2PVOB 1VQ4T 2DBKA 2A37A 2EAYA 2E65A 1JQQA 2LJ0A 4QT7A 2RJCA 3MP8A 4C92C 3VS6A 3VUZA 2JZ2A 3OS0A 1TU0B 1NEGA 1WXUA 4OMMA 2YXYA 3D7SB 3L2QA 1OU9A 2H8HA 3RDVA 5GAN3 3CCUT 1OPKA 2FVUA 2QQRA 2CUBA 4Q5WA 3URGA 2WACA 4ZNXA 4IUVA 2DL5A 1N6AA 3TQ7P 3U23A 4B9WA 4JRPA 1YJNT 3QO3A 4F17A 2K2VA 4PJNA 3UA7A 1UGPB 2GF7A 4A4FA 3L2WA 4E7KA 1OI1A 5FW9A 1UTIA 1VQOA 4ZN1A 4F7UE 1VQ7A 2QA4A 1EZZB 2FG0A 2MWPA 2DO3A 1X69A 3CBOA 4JS5A 2E3HA 4KGZB 3JB9I 2OI3A 3FDRA 2F2VA 2DL4A 4F7UG 3QKJA 3OYGA 1X75C 4X34A 5GANg 1YCSB 4GY5A 2QGGA 2HKQB 5KYNA 4V2SA 2DKGA 4O5VA 2D8HA 3X25B 3CCVT 4Z89A 1M2VA 1M5Q1 1RI9A 2FEIA 1Y57A 2A3LA 1D0XA 5CKEA 1TTHB 2XU8A 4PFPA 4FYYB 2M9UA 5IHNA 1VQMT 4C8QF 3RMSA 2RQVA 3CMEA 1WFWA 1U8RA 1Q7YU 1B34B 2V1QA 2RK1A 3CXCP 4J6WA 3OB9A 1AD5A 3L2VA 2FZCB 4BI3A 4C92G 3WVEB 2E1HA 2JM9A 1YP5A 5I11A 3H0HA 2RI2A 3EFOB 2M16A 2EBPA 2YDLA 5IN1A 4A4HA 3L42A 4M75F 3JCMg 2XDDA 2W0ZA 3R6NA 4RCCA 2EYYA 3CCRA 5GAMd 4M77D 1YWOA 1OQKA 2L3SA 1HJDA 4JS4A 5FU6B 1IHWA 3EHRA 2JM8A 1IZ6A 4JDSA 1I8FA 2J7IA 1OZ3A 2XDPA 2SRCA 3KXTA 1MGQA 4F14A 5LJ3j 2VVKA 3JCMc 2LTOA 3LH5A 3GIBA 1VQ9A 2WSCE 1M4ZA 5FWBA 2XICA 1XQHA 4BY6B 1BI2A 2GGRA 4FSSA 5GAN2 4M7DD 1QCNA 3CBMA 1T3LA 1VQOT 5FU7C 1FYNA 2HMAA 4ZN3A 8AT1B 2QA4T 1J3TA 5HK0A 1SSFA 3QZ5B 2RM4A 1WLPB 3CCLA 3OW2A 2LVMA 3TREA 2DERA 1YWPA 5KH6A 3G71A 2DMOA 3I5RA 3UF4A 2BUDA 4NOYA 1VQPT 1QVGS 1G3WA 2ZAEA 1KJWA 1YJWT 1YBYA 2DAQA 2A0FB 4LE9A 1VQNQ 1XOVA 2YRDA 3CMET 4BB7A 2O31A 3CPWS 2K2MA 3AT1B 3VU3C 3E2UA 1LOJA 1JXMA 2EQMA 1PSFA 4N4GA 1JU5C 3J81E 4M78B 1B34A 4ZGJB 1PD1A 1Q86R 3L2UA 1UHCA 4QW2A 1QVGP 3E9FA 4MZPA 1OV3A 4QQ6A 3RKYA 4LDYA 2QDLA 3EFOA 4MZMA 5GANj 5KE3A 2RPNA 3MEUA 3PMIA 4A4EA 3JCMP 3M0TA 4F7UF 1X27A 5LJ3f 2KI7A 1VQ5T 2LQWA 3QJYA 4HCKA 3A1PA 1M90R 3CCJT 4FCYA 3CPWP 2EGAA 1UGQB 2DL7A 4JJNK 3E1SA 3LWIA 4PJOB 3JSCA 1QCFA 3LYIA 4CC7A 2E41A 2QYZA 2BTTA 1BB9A 2DPPB 2D1XA 3CD6A 1RAEB 3S3NA 1VQ9T 3VRYA 2I2LA 1H3ZA 3OYMA 3GP8A 4NL3A 5GAN5 1OYXA 2X3WD 4Z8AA 1U5SA 2J6KA 3VS0A 5FLXE 1D3BA 1WDXA 5CR2A 1VYVA 3OQ5A 3CCET 2VWFA 2NWMA 1KQSA 4E47A 1BBZA 3CC2Q 2OTLA 2Y4XA 2ENMA 5KYUA 4EMHA 2VKNA 5GAMg 1YJ9Q 2B8AA 3A8MB 3CCLT 4GLMA 5DLOA 2MK5A 3HL8A 1JBMA 4AFUC 2DBMA 4CI0C 2EJGA 4C5EA 4RG2A 3G71T 1WIEA 5IXBA 1AWOA 3V8JA 2QQ9A 3M0UA 3M53A 1K4US 3FJ5A 1SRLA 1U06A 4FM4B 5CCAA 3KBGA 1PD0A 2OAWA 4GBQA 1MV0B 2DF6A 1K73U 1M1KU 5D6WA 2F2WA 3EG9B 2K79A 3G6ET 2CS7A 1KHIA 4OMLA 2P0PA 3QHSA 1W2BS 1NYFA 1GRIA 1AVZC 4D8DA 3CCJQ 4ATOA 1WHJA 3CC7Q 1PKTA 1B7TA 3RNJA 3M0QA 3JB9F 2JJ9A 2FPDA 3TEEA 1BIBA 1RABB 2DYIA 3WXMB 2BE7D 1GXIE 5GANf 3RIRA 3CCMT 4C0DB 3LW5E 4DQ2A 1NJIU 4ZTJA 3L2ZA 4A4GA 4EMKB 2LCLA 4M78A 1N8RC 1YHQA 4J9FA 4IUTA 2V8JA 4L6V5 3P8DA 2K7AA 3QXEB 4KUDK 1S72A 3GBQA 1N5ZA 5GAOp 3I35A 1W2BP 4KRTA 3MKDA 3O5ZA 5KYWA 2VXFA 1VOMA 1NG2A 1PM3A 3QDFA 2RJFA 1RAIB 4QQGA 3EH2A 2HSPA 5GMKh 1YN8A 5CKDA 3VS4A 4DBRA 4PJOA 2VASA 3H6ZA 3QDRB 3CCQQ 3ZL7C 4E6RA 1KK7A 4C0GA 2EQJA 5EG2A 4C8QC 3PMTA 2G6FX 4DEYA 1QVFA 1KQSP 3RESA 1BI1A 3C12A 1KFZA 1HD3A 2JS0A 3C95A 1UJ0A 4KH1B 2RMOA 3MO8A 4M75C 4PL6A 1UEBA 3M59A 2D8JA 2FPEA 2IPOB 2DNUA 1D1AA 4KUIA 2KNBB 5DY9A 3HSBA 4HT9A 3J80E 5CIUA 2J05A 2CH4W 3HFNA 2DTOA 3Q1JA 4M78E 1NEBA 2CKKA 2EIFA 1AHJB 5CQYA 4UC4A 4JJBA 3EG9A 3RERA 1UG1A 3I56A 4P5NA 3ZFJA 3UPUA 2GQIA 4J83A 4M78G 5IH2A 1V1CA 2F69A 4PJOD 1PKSA 3G7ZA 2A7YA 5GAMj 4LDWA 5KYYA 5CAIA 4KH0B 4LD6A 1M3BA 4HVWA 3SWNB 2EWNA 3EGDB 3DB4A 1YHQT 1VQKT 2K3BA 1WYXA 4PJOE 3OYLA 5KCHA 1YI2Q 2DFUA 2C06A 2RI5A 2K5LA 2JMCA 2FL7A 2DRMA 1S72T 1KQ2A 3SEMA 3HFOA 4O6JA 4E7ZA 3HKSA 2DILA 4ZTFA 4IKFA 1G2BA 4JJCA 3NFCA 1MMGA 1YIJT 4ELZC 2E10A 1QLYA 3ZEHA 3GOXA 4XAXB 4AFSC 2YHTA 1G8XA 3BFMA 3ZBDA 2NUPB 4OVAA 4C8QG 1VYUA 3M4YA 2ED0A 1OU8A 1MMDA 1AOJA 1E6HA 1KC8C 2GQVA 1S1NA 4XTZA 2KYBA 3OYDA 2AT1B 3RBBB 4OF1A 3GPLA 1YITT 4OB3B 2LCSA 1VQ6Q 5GAN4 1H92A 1I81A 1M27C 3G4ST 3CMAT 2CP2A 3VUBA 4N4HA 1KIKA 3VV0A 2JTFA 2LT1A 4N0AC 2DX1A 3BDLA 1B3QA 4E7LA 2ROLA 2L8DA 2CZ6B 2DJQA 2RK2A 5CVIA 1VQKQ 1KSWA 1X2QA 4M7AD 4QQDA 5GMKi 2VC8A 2NUTB 3BE3A 4PJMA 1Q82C 1TUDA 5AYFA 2FHDA 1ARKA 3I56T 1IRXA 1UGSB 2DXCA 4PK4A 1YIJQ 3MEVA 1TG0A 1GFDA 2L3PA 3V7CA 1WHLA 5LJ5h 1GCPA 2LQ8A 2QTVA 3EG2A 3UA6A 1W1FA 4LDXA 4J9BA 3H0IA 2Z0WA 2PUKB 1KD1C 2RHUA 1M1GA 4X1VA 1XTDA 2Y90A 1TH7A 3V7SA 1VQLA 2JTMA 1PCXA 2O2OA 3VS5A 1C1AA 2CDTA 3G4SQ 4CC3A 2EKHA 2K4YA 3P8HA 2JUFA 3EGUA 1UFFA 1QW1A 1KQ1A 1EIFA 1GBQA 3TSWA 2LZ6B 4KULA 2D0QB 1RAFB 4LDVA 4EMGA 1K8AC 2EJ9A 3OYHA 3O8VA 2MCNA 4C5IA 4XTXA 5LJ5e 1KHCA 2R58A 1Y0MA 5GAN6 4BD3A 2K5FA 1LVKA 1K9MC 4M78F 2DTHA 2DM1A 4AT1B 1YNZA 1AWWA 2KE9A 2E3IA 5A2QE 3M58A 4DA4A 3H41A 5I22A 3C4SA 4M77A 4R0KA 5GJWB 2HL5C 1WPYA 5LJ5d 1Y96A 4ME7A 2EKOA 1EX4A 2P0QA 2RQTA 3OMCA 1QWFA 1WHGA 1WA7A 2DE0X 3H8ZA 1VQ4Q 1WJQA 2ZPBB 4DOWA 4ESRA 1V29B 4J6XA 3H0FA 4PJOF 1SF9A 4RUGA 1M9SA 1ZSZB 1UECA 2MAMA 3REAB 2CSQA 5CK9A 2RH2A 4E7JA 1M30A 4FL6A 2KXDA 1YFNA 2NUTA 3CCST 3CCUQ 4WF2A 1RAAB 4M7DA 4XU2A 3NTKA 1V76A 1Q86U 2A28A 2BZYA 3DB3A 2X4XA 1N8RR 1QVGA 1AWXA 5GJVB 1YJNQ 2W10A 4FU6A 2PUOB 3OSSC 1ZBJA 2LNHB 2JT4A 2YWWA 3HTRA 3EGXA 1R0CB 1VQ8A 4EIKA 4IIOA 3OS2A 4IUPA 1VQLT 3VYHB 5CKBA 2RHXA 2C0OA 2ED1A 1M90U 2VYTA 2IVWA 1D1BA 4CC2A 2X3XD 2DXTA 3CPWA 2GBQA 2Y4YA 4FYWB 3GF5A 4M77E 4BE2A 3ER0A 9ATCB 2KEAA 5FRNA 1RUWA 2MWOA 4M77G 3JB9G 1I1JA 3CCVQ 3L2RA 5KYXB 2HBPA 2XHCA 4MZTA 3CC7A 3VS7A 2L5QA 1VQMQ 2M0YA 3MCAB 3H9NA 1VQ7T 2QEXA 2CT4A 2ZCFB 2OTJA 3PT9A 2P84A 4M7DE 2XIDA 2LRQA 2HKNA 1HYOA 2K9GA 4M7DG 1W70A 2COYA 2RF0A 1ZSZA 2F5TX 1FWZA 2CREA 2EJFA 2A36A 1FMVA 2XDBA 2X4WA 4RTUA 3S3MA 1Y07A 4CRIA 3IQLA 4HT8A 3M5AA 3EHQA 3I55A 1HXDA 2VGNA 3EG0A 2HBWA 4RTTA 2F5KA 3HP9A 4QKUA 4HCCA 2P4TA 2AZVA 1K9AA 2KAFA 2YT6A 3M54A 1M2OA 3DLLA 4JZ3A 3HHTB 5L23A 1VQ8T 2CP6A 4LD9K 2CUDA 2KY9A 2HCKA 1WJSA 3CCRT 2LQNA 1VQOQ 5GAN8 3CC4A 3SB2A 2QA4Q 3A5ZB 5A0GA 1W2BA 1GBRA 1MV3A 1E6GA 1MMAA 2FRYA 4JUVA 4AFQC 1GCQA 2OX7A 2YLBA 2PVDB 1E7OA 2EQKA 2CT3A 1VQPQ 3LX7A 4II1A 2DK3A 3NTHA 1KC8R 2CZ1B 1K0SA 1YJWQ 2PNIA 4DBHA 1ZUUA 1O75A 4J7IA 4BY6C 3OW2S 2E5QA 1UUEA 1NZ9A 3MEWA 1CKBA 3JB9H 4VUBA 5KYXA 3CMEQ 3UT1A 2QEXT 2OTJT 4RG8A 2LQKA 3RUXA 1PRLC 2RI3A 3V7RA 1BK2A 1HSQA 2K6DA 1W6XA 1X01A 3JCMX 1FX7A 4OMPA 4OB2B 1RI0A 1YI2A 3EH1A 2PQWA 3M0SA 1Q82R 1NBEB 3NPFA 2M0OA 1EFNA 2DA9A 2YUNA 1AT1B 3OBYA 2E4HA 1VQ5Q 3LH0A 4X9DA 4AFZC 1SSHA 1M3AA 4HXJA 4D8KA 2RJDA 2AZSA 4M77F 3I55T 1UB4A 4WTOB 1VQ9Q 1KD1R 1ZUKA 1K76A 4M78C 5LJ3h 3OYCA 2GTJA 4M7AB 1Q81C 2KROA 2VB6A 3M4GA 5I2MA 5KE2A 2G3RA 5IHKA 4XK8E 5D7UA 3CCEQ 3RKWA 3CC4T 3REBB 2KBTA 2ZPEB 2MF2A 1LNXA 3VS3A 3PIOA 4KT0E 2BIVA 3CCLQ 2E6ZA 1K8AR 2CP0A 3QG1A 2EFIA 3G71Q 4M7DF 5I21A 2E70A 4PJOC 3CD6T 1BIAA 1RAHB 2RHIA 1K9MR 1DJ7B 3X20B 2LMJA 3CEYA 2GFUA 5LJ5j 3M0PA 1FXXA 1QQJA 3G6EQ 5IXFA 2QASA 5HCKA 1ZLMA 5LJ3e 2R5AA 2OTLT 4AG2C 2MOXA 1WI7A 1JB0E 3C0CA 3FB9A 4LUDA 1N9SA 1SHFA 3OYIA 1W4SA 1WZOA 4HA8A 2BZ8A 4RTWA 1C0MA 4Z88A 1T0JA 2CGHA 2O4XB 5A0LA 3EG3A 3CCMQ 2JN0A 2X4JA 3HRSA 3PNWC 3E19A 1M8MA 1TUCA 2D9TA 4XU0A 2DYBA 5GMKe 1ABQA 2JS2A 1AWJA 2DVJA 1BI3A 2QQBA 3M57A 3OY9A 2EVRA 2J6OA 4OP0A 3FC3A 4C5GA 4J9IA 3X28B 4DEXA 5GANh 3HRTA 4F16A 4DBFA 2DTIA 4J9EA 2JXBA 2HEQA 1WHHA 3UATA 1MNEA 2VGMA 3A8OB 1BCOA 4FYVB 2MMPA 2AKKA 3GNFB 3V8KA 4LXCA 2DL3A 5C0MA 4M7AA 4EMKA 1PG5B 1WX6A 3AHUA 4EPCA 3ULRB 4BUGA 4PJOG 3OBWA 3I5SA 4RKUE 5J26A 3JCMh 4KGVB 3OYEA 1Q7YC 1X6OA 2RQWA 3LGFA 1VQ4A 2EGEA 4C92B 2X35A 1PWTA 1OX9A 1X6GA 5LJ5f 5GANe 4RTZA 1ZQ1A 1WQWA 4E7SA 1QVFS 4KBMB 1TOVA 4RMOA 4JLGA 4TVRA 4J8OA 2GNCA 1HK9A 1OX8A 2RNAA 3CCUA 4XTYA 2PU9B 3FIFA 4JJDA 4M75D 1PNJA 1GFCA 3ASKA 2I0NA 2V1RA 3KUFA 1UE9A 4R55A 1G3SA 3A98A 1Z9ZA 3C94A 2L3QA 4DBQA 2ZPHB 4PLIA 1VIEA 4PNOA 3J7AF 4OMNA 1U3OA 1D0YA 5CQXA 1FMWA 3JV3A 3PGGA 1NLOC 1T0HA 3JCMe 2NLUA 4EDUA 1YHQQ 5EC7A 2O4XA 1WNLA 4RTXA 4IUUA 3TSZA 2KGTA 3BW1A 4PKCC 2ZPGB 2C0IA 3OYFA 2LDMA 3RR6A 1S72Q 2M1HA 3QYGB 2WSFE 3MJXA 3I9QA 1I5LA 1IHVA 1VYTA 2EQUA 3JCMd 4M7AE 1NYGA 5C6SA 1SHGA 4Z02A 1M2VB 2FPFA 4IUQA 2YRVA 2K3YA 3S3OA 1N8RU 3PTAA 3RKXA 4M7AG 1TSFA 2QK0A 4XU1A 1D1CA 1BCMA 3L1AA 3MP6A 2RO0A 1PRMC 3UWNA 3SWNA 4FW2A 1YITQ 3EGDA 3PVQA 4QVCA 3BY7A 1JXOA 3CMAQ 3QIIA 2QTXA 2EYQA 5DM7R 2MPXC 1I4K1 2RHZA 2ESWA 3JB9J 6AT1B 2K57A 2LNVA 3TVTA 3FRNA 3QBYA 3TU4K 1AEYA 1IXDA 3A8HB 4FSXA 4C92A 5IT9E 3PVLA 1Z9QA 1RAGB 2KXCA 2QQAA 5GAN7 1M8VA 4MDXA 4OB1B 1VQNA 4PLLA 2KVQG 2HDAA 1YCYA 3LLRA 5IAYA 1AZEA 2HQHA 2NUPA 2KK4A 1XJWB 1G3TA 3JRZA 1SG5A 3CBPA 5LL6S 4M77C 4RTYA 3I56Q 1TUGB 3NTIA 2EYWA 2HSEB 1IGUA 1QCOA 4MDWA 4MMLA 2NUZA 1BKBA 4GLKA 1I5OB 2QQSA 1VUBA 4J9HA 4N4IA 3WVDB 3M55A 4J7FA 3ME9A 3JAME 1UGVA 2PTKA 5FU7B 1MNDA 5GAMh 4FT2A 4X9CA 2J6FA 2DXUA 3OYJA 4XTVA 3CXCS 3JCMJ 2YSQA 4M7DC 1JJ2S 1VQPA 2CP3A 4HVVA 1NPRA 5GAOm 3MP1A 1G3YA 4A4KA 2KMTA 4C92D 1GL5A 1YJWA 3EAEA 2E12A 2MIOA 2CSIA 5M9OA 1Q81R 2ROTA 4F04B 1TXQA 2R5MA 1ZA1B 5AT1B 1QVPA 3OS5A 2HNIA 5DLQE 5GMKl 3CC2A 4C92E 2GFAA 1K73C 2DD4A 1M1KC 3SDZA 2DD5A 3FEOA 1YJ9A 3RMQA 1NE8A 2RHYA 3E9GA 2EYZA 5GAMe 3FLGA 3QWYA 1U1TA 3VRZA 1K1ZA 1JJ2P 1QP3A 2X9HA 4BACA 4BDZA 2LT4A 3R6OA 2P4RA 2HQXA 2KR3A 7AT1B 1KC8U 1MHNA 2F2XA 2KT1A 2K5IA 3JB9D 1R77A 3UDCA 4FT4A 1VQNT 1NJIC 1LJOA 4B9XA 4JLIA 1VQ5A 4JZ4A 1K0XA 4L5GA 4OMFB 3CCJA 4PFOA 3OSVA 3JCMb 1NLPC 2EW3A 5D6YA 2E6NA 4M7AF 3CCSQ 2M51A 2DRKA 2HD0A 2EQIA 1D3BB 2AHJB 4BDYA 2ATCB 1UJYA 1NM7A 3X26B 4J6YA 3QWXX 5KYUB 3JCMW 1CKAA 4QVZA 1Q82U 2R57A 3CCEA 3THKA 1ZBXA 4XTWA 3G1JA 2DZ9A 2GCXA 1ZUYA 2L2PA 1ZSZC 3GNGA 1Y71A 4OGCA 1VQLQ 1SEMA 4JRKA 2RQRA 1IGQA 5GMKj 2CP5A 2KRNA 3MHXA 4A53A 1BI0A 2O01E 5GAOq 2KT8A 1ZSGA 2DZCA 3T9NA 2MYSA 2CZ0B 1BYMA 4IURA 4OB0B 3DKMA 1I07A 1ZHIA 4YTLA 4BI8B 1KD1U 2CZ7B 4BI4A 4Y28E 2M02A 3CCQA 5LJ5g 3G6EA 2DVEA 3QPHA 4HVUA 3QYHB 3CC2T 3META 2YLCA 2DLPA 1YJ9T 1QWEA 3SFMA 3X24B 3OYAA 3FJPA 1Q7YR 1VQ7Q 4JPBW 2ECZA 2P0KA 2EYXA 1GCQC 5FU6C 1A0NB 1WXBA 1K8AU 4FYXB 1WXTA 1SRMA 2VXEA 1OOTA 1N9RA 3JCMV 3CCMA 4AMCA 3OYKA 4OMOA 2CYZB 1NPPA 1RLPC 1K9MU 2F1LA 3OYNA 1H3HA 3A8LB 5KYWB 2VV5A 1RL2A 2HZYA 8ATCB 2LP5A 5I2SA 3M56A 3OMGA 2IG0A 1LPLA 4C0ZA 4BE1A 3MEAA 1UGRB 2DIQA 3CC7T 3EG1A 3N5BB 2RQUA 4LUEA 4OMQA 2DJZA 1F1BB 2KDSA 4JRIA 5FROA 4R56A 2XD0A 2V8KA 1ZX6A 2BZXA 3HPWA 4C8QB 4ELYC 1OULA 2RD1A 4D6WA 3F70A 2D0NA 2LX9A 4C92F 1VQ8Q 2J06A 2K3XA 2GTOA 2LCCA 3CCRQ 3JCMQ 3TCJA 4JRQA 3OW2P 3HRUA 2XG8D 4CC4B 4M75B 2QAZA 2DXBA 1PHTA 2KSSA 1B07A 2EPDA 2JMAA 1TS9A 5A0DA 2CP7A 3VJPA 3NGPA 2MI6A 3CPFA 3P8BB 2A08A 4RTVA 2JW4A 3CCQT 1CSKA 2L89A 3QSUA 4C5HA 1PC0A 1VQ6A 2B86A 3PFSA 1MMNA 4ORZA 3VKIA 5KYYB 5J3BA 1WQ7A 2LC4A 2QEXQ 2OTJQ 1ABOA 4K11A 2KQWA 4ANJA 1N27A 1WHMA 3NHNA 1QP2A 1QMCA 1M1FA 2AKLA 3QUIA 1VQKA 5CKFA 5D6XA 2ZPFB 4B6MA 3OS1A 2DEQA 2VUBA 4FW1A 1KQSS 4AG1C 5J39A 4XTUA 3GLXA 5ECAA 3S6WA 2FZKB 2LX7A 1G5VA 2FZGB 2DEUA 1T3SA 2LJ3A 3KFVA 2FB7A 5GAOl 3PIPA 1YIJA 5HKCA 2CH4A 2E5KA 3DLMA 5FRMA 1D09B 2ZZDA 1VIFA 2COZA 1BU1A 4FIBA 5GMKm 3I55Q 3JCMf 3SD4A 3PE0A 1M3CA 1JO8A 1U1SA 3MPUB 2KRMA 4XQ3A 2DIGA 1YI2T 4RCBA 5LJ3d 1TWBA 2XKOC 1YITA 4C8QA 4E7HA 2RN8A 2O9VA 1LCKA 2D6FA 2LJ1A 4NS5A 4IIMA 3G4SA 3CMAA 1UDLA 2EGCA 5CO7A 3CC4Q 2PVGB 2JOYA 4J9CA 3V8LA 1QKXA 2RA2A 2XMFA 4M78D 4MMKA 1P92A 1IB8A 2BKDN 4PJLA 1UHFA 1SKUB 4M75A 1WJRA 1R0BG 2H3JA 2YUQA 4F7UB 3VS1A 4PFZA 1AZGB 1C6VX 2COWA 3CD6Q 2IIMA 1OEBA 1Q81U 4PJJA 3BDUA 4Y92A 4LNPA 1R8OB 1K73R 1M1KR 1FMKA 5KCOA 1X43A 5GAOr 4C0DC 1VQ6T 4M7AC 2QG9B 4EMKC 2PZ1A 5GAOn 3EFSA 2XI9A 2OTLQ 4KGXB 4J5YA 1JEGA 2X4YA 1RACB 4NL2A 4QVDA 5HK3A 2FRWA 2YUPA 4XU3A 5IHIA 2L3RA 1O9SA 1Q86C 4C8QD 1VA7A 1NJIR 2ZGWA 3OYBA 1KG1A 2YRCA 1D0ZA 5CKHA 4ZGEB 2DL8A 1PSEA 1IREB 3NMZC 1Q95G 1OPLA 4C8QE 2OJ2A 2BE9B 3M9QA 5GANd 1M90C 1WHKA 2KYMA 2C0TA 4Y91A 4C0FA 4J9DA 4LDUA 3INZA 1G83A 3M0RA 3EFRA 2NYSA 2ZPIB 5L8RE 2AK5A 1YJNA 1I0CA 2JNGA 4M75E 2FO0A 4E7IA 2FYKA 1JRIA 2SEMA 2O9SA 2QXFA 4M77B 1QKWA 3SHWA 2HQEA 1H641 1QVFP 1Y96B 3VYGA 5HY6A 2V26A 2ABLA 2O88A 3QJ6A 4M75G 2KRSA 1SPKA 2JVVA 1ACMB 1RADB 1IO6A 3LGLA 4OGEA 3OA6A 1OZ2A 2H3EB 3LWHA 4E2FB 2JTEA 2AIRB 3QZ9B 4N0AA 4DOVA 4HCBA 4J9GA 4HKEA 1X6BA 1H8KA 3A8GB 3VS2A
chains in the Genus database with same CATH topology
1ZSZB 2QASA 1TWBA 1YFNA 1ZSZA 1OU9A 2NYSA 1ZSZC 1OU8A 1OULA 1OX8A 2QAZA 1OX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZSZ B;  2QAS A;  1TWB A;  1YFN A;  1ZSZ A;  1OU9 A;  2NYS A;  1ZSZ C;  1OU8 A;  1OUL A;  1OX8 A;  2QAZ A;  1OX9 A; 
#chains in the Genus database with same CATH topology
 4HCZ A;  2WSE E;  3CQT A;  2RB6 A;  1X2K A;  4BE0 A;  1MUZ A;  4WCI A;  2QDY B;  1RLQ C;  2XK0 A;  4F7U A;  3CCV A;  2RJE A;  2QGF B;  4M4Z A;  4M7D B;  1XNI A;  2E64 A;  3SWN C;  1Y7X A;  2V8I A;  5GAM f;  4L59 A;  1VQM A;  2QI2 A;  5LJ3 g;  3CCS A;  2YUO A;  2DET A;  4A63 B;  2L0A A;  4A54 A;  3OYY A;  3CXC A;  5FWC A;  1WGS A;  1ZA2 B;  2OAU A;  4LN2 A;  2HL3 A;  1JJ2 A;  2HAX A;  2X51 A;  3EGX B;  4ZGD B;  2PVO B;  1VQ4 T;  2DBK A;  2A37 A;  2EAY A;  2E65 A;  1JQQ A;  2LJ0 A;  4QT7 A;  2RJC A;  3MP8 A;  4C92 C;  3VS6 A;  3VUZ A;  2JZ2 A;  3OS0 A;  1TU0 B;  1NEG A;  1WXU A;  4OMM A;  2YXY A;  3D7S B;  3L2Q A;  1OU9 A;  2H8H A;  3RDV A;  5GAN 3;  3CCU T;  1OPK A;  2FVU A;  2QQR A;  2CUB A;  4Q5W A;  3URG A;  2WAC A;  4ZNX A;  4IUV A;  2DL5 A;  1N6A A;  3TQ7 P;  3U23 A;  4B9W A;  4JRP A;  1YJN T;  3QO3 A;  4F17 A;  2K2V A;  4PJN A;  3UA7 A;  1UGP B;  2GF7 A;  4A4F A;  3L2W A;  4E7K A;  1OI1 A;  5FW9 A;  1UTI A;  1VQO A;  4ZN1 A;  4F7U E;  1VQ7 A;  2QA4 A;  1EZZ B;  2FG0 A;  2MWP A;  2DO3 A;  1X69 A;  3CBO A;  4JS5 A;  2E3H A;  4KGZ B;  3JB9 I;  2OI3 A;  3FDR A;  2F2V A;  2DL4 A;  4F7U G;  3QKJ A;  3OYG A;  1X75 C;  4X34 A;  5GAN g;  1YCS B;  4GY5 A;  2QGG A;  2HKQ B;  5KYN A;  4V2S A;  2DKG A;  4O5V A;  2D8H A;  3X25 B;  3CCV T;  4Z89 A;  1M2V A;  1M5Q 1;  1RI9 A;  2FEI A;  1Y57 A;  2A3L A;  1D0X A;  5CKE A;  1TTH B;  2XU8 A;  4PFP A;  4FYY B;  2M9U A;  5IHN A;  1VQM T;  4C8Q F;  3RMS A;  2RQV A;  3CME A;  1WFW A;  1U8R A;  1Q7Y U;  1B34 B;  2V1Q A;  2RK1 A;  3CXC P;  4J6W A;  3OB9 A;  1AD5 A;  3L2V A;  2FZC B;  4BI3 A;  4C92 G;  3WVE B;  2E1H A;  2JM9 A;  1YP5 A;  5I11 A;  3H0H A;  2RI2 A;  3EFO B;  2M16 A;  2EBP A;  2YDL A;  5IN1 A;  4A4H A;  3L42 A;  4M75 F;  3JCM g;  2XDD A;  2W0Z A;  3R6N A;  4RCC A;  2EYY A;  3CCR A;  5GAM d;  4M77 D;  1YWO A;  1OQK A;  2L3S A;  1HJD A;  4JS4 A;  5FU6 B;  1IHW A;  3EHR A;  2JM8 A;  1IZ6 A;  4JDS A;  1I8F A;  2J7I A;  1OZ3 A;  2XDP A;  2SRC A;  3KXT A;  1MGQ A;  4F14 A;  5LJ3 j;  2VVK A;  3JCM c;  2LTO A;  3LH5 A;  3GIB A;  1VQ9 A;  2WSC E;  1M4Z A;  5FWB A;  2XIC A;  1XQH A;  4BY6 B;  1BI2 A;  2GGR A;  4FSS A;  5GAN 2;  4M7D D;  1QCN A;  3CBM A;  1T3L A;  1VQO T;  5FU7 C;  1FYN A;  2HMA A;  4ZN3 A;  8AT1 B;  2QA4 T;  1J3T A;  5HK0 A;  1SSF A;  3QZ5 B;  2RM4 A;  1WLP B;  3CCL A;  3OW2 A;  2LVM A;  3TRE A;  2DER A;  1YWP A;  5KH6 A;  3G71 A;  2DMO A;  3I5R A;  3UF4 A;  2BUD A;  4NOY A;  1VQP T;  1QVG S;  1G3W A;  2ZAE A;  1KJW A;  1YJW T;  1YBY A;  2DAQ A;  2A0F B;  4LE9 A;  1VQN Q;  1XOV A;  2YRD A;  3CME T;  4BB7 A;  2O31 A;  3CPW S;  2K2M A;  3AT1 B;  3VU3 C;  3E2U A;  1LOJ A;  1JXM A;  2EQM A;  1PSF A;  4N4G A;  1JU5 C;  3J81 E;  4M78 B;  1B34 A;  4ZGJ B;  1PD1 A;  1Q86 R;  3L2U A;  1UHC A;  4QW2 A;  1QVG P;  3E9F A;  4MZP A;  1OV3 A;  4QQ6 A;  3RKY A;  4LDY A;  2QDL A;  3EFO A;  4MZM A;  5GAN j;  5KE3 A;  2RPN A;  3MEU A;  3PMI A;  4A4E A;  3JCM P;  3M0T A;  4F7U F;  1X27 A;  5LJ3 f;  2KI7 A;  1VQ5 T;  2LQW A;  3QJY A;  4HCK A;  3A1P A;  1M90 R;  3CCJ T;  4FCY A;  3CPW P;  2EGA A;  1UGQ B;  2DL7 A;  4JJN K;  3E1S A;  3LWI A;  4PJO B;  3JSC A;  1QCF A;  3LYI A;  4CC7 A;  2E41 A;  2QYZ A;  2BTT A;  1BB9 A;  2DPP B;  2D1X A;  3CD6 A;  1RAE B;  3S3N A;  1VQ9 T;  3VRY A;  2I2L A;  1H3Z A;  3OYM A;  3GP8 A;  4NL3 A;  5GAN 5;  1OYX A;  2X3W D;  4Z8A A;  1U5S A;  2J6K A;  3VS0 A;  5FLX E;  1D3B A;  1WDX A;  5CR2 A;  1VYV A;  3OQ5 A;  3CCE T;  2VWF A;  2NWM A;  1KQS A;  4E47 A;  1BBZ A;  3CC2 Q;  2OTL A;  2Y4X A;  2ENM A;  5KYU A;  4EMH A;  2VKN A;  5GAM g;  1YJ9 Q;  2B8A A;  3A8M B;  3CCL T;  4GLM A;  5DLO A;  2MK5 A;  3HL8 A;  1JBM A;  4AFU C;  2DBM A;  4CI0 C;  2EJG A;  4C5E A;  4RG2 A;  3G71 T;  1WIE A;  5IXB A;  1AWO A;  3V8J A;  2QQ9 A;  3M0U A;  3M53 A;  1K4U S;  3FJ5 A;  1SRL A;  1U06 A;  4FM4 B;  5CCA A;  3KBG A;  1PD0 A;  2OAW A;  4GBQ A;  1MV0 B;  2DF6 A;  1K73 U;  1M1K U;  5D6W A;  2F2W A;  3EG9 B;  2K79 A;  3G6E T;  2CS7 A;  1KHI A;  4OML A;  2P0P A;  3QHS A;  1W2B S;  1NYF A;  1GRI A;  1AVZ C;  4D8D A;  3CCJ Q;  4ATO A;  1WHJ A;  3CC7 Q;  1PKT A;  1B7T A;  3RNJ A;  3M0Q A;  3JB9 F;  2JJ9 A;  2FPD A;  3TEE A;  1BIB A;  1RAB B;  2DYI A;  3WXM B;  2BE7 D;  1GXI E;  5GAN f;  3RIR A;  3CCM T;  4C0D B;  3LW5 E;  4DQ2 A;  1NJI U;  4ZTJ A;  3L2Z A;  4A4G A;  4EMK B;  2LCL A;  4M78 A;  1N8R C;  1YHQ A;  4J9F A;  4IUT A;  2V8J A;  4L6V 5;  3P8D A;  2K7A A;  3QXE B;  4KUD K;  1S72 A;  3GBQ A;  1N5Z A;  5GAO p;  3I35 A;  1W2B P;  4KRT A;  3MKD A;  3O5Z A;  5KYW A;  2VXF A;  1VOM A;  1NG2 A;  1PM3 A;  3QDF A;  2RJF A;  1RAI B;  4QQG A;  3EH2 A;  2HSP A;  5GMK h;  1YN8 A;  5CKD A;  3VS4 A;  4DBR A;  4PJO A;  2VAS A;  3H6Z A;  3QDR B;  3CCQ Q;  3ZL7 C;  4E6R A;  1KK7 A;  4C0G A;  2EQJ A;  5EG2 A;  4C8Q C;  3PMT A;  2G6F X;  4DEY A;  1QVF A;  1KQS P;  3RES A;  1BI1 A;  3C12 A;  1KFZ A;  1HD3 A;  2JS0 A;  3C95 A;  1UJ0 A;  4KH1 B;  2RMO A;  3MO8 A;  4M75 C;  4PL6 A;  1UEB A;  3M59 A;  2D8J A;  2FPE A;  2IPO B;  2DNU A;  1D1A A;  4KUI A;  2KNB B;  5DY9 A;  3HSB A;  4HT9 A;  3J80 E;  5CIU A;  2J05 A;  2CH4 W;  3HFN A;  2DTO A;  3Q1J A;  4M78 E;  1NEB A;  2CKK A;  2EIF A;  1AHJ B;  5CQY A;  4UC4 A;  4JJB A;  3EG9 A;  3RER A;  1UG1 A;  3I56 A;  4P5N A;  3ZFJ A;  3UPU A;  2GQI A;  4J83 A;  4M78 G;  5IH2 A;  1V1C A;  2F69 A;  4PJO D;  1PKS A;  3G7Z A;  2A7Y A;  5GAM j;  4LDW A;  5KYY A;  5CAI A;  4KH0 B;  4LD6 A;  1M3B A;  4HVW A;  3SWN B;  2EWN A;  3EGD B;  3DB4 A;  1YHQ T;  1VQK T;  2K3B A;  1WYX A;  4PJO E;  3OYL A;  5KCH A;  1YI2 Q;  2DFU A;  2C06 A;  2RI5 A;  2K5L A;  2JMC A;  2FL7 A;  2DRM A;  1S72 T;  1KQ2 A;  3SEM A;  3HFO A;  4O6J A;  4E7Z A;  3HKS A;  2DIL A;  4ZTF A;  4IKF A;  1G2B A;  4JJC A;  3NFC A;  1MMG A;  1YIJ T;  4ELZ C;  2E10 A;  1QLY A;  3ZEH A;  3GOX A;  4XAX B;  4AFS C;  2YHT A;  1G8X A;  3BFM A;  3ZBD A;  2NUP B;  4OVA A;  4C8Q G;  1VYU A;  3M4Y A;  2ED0 A;  1OU8 A;  1MMD A;  1AOJ A;  1E6H A;  1KC8 C;  2GQV A;  1S1N A;  4XTZ A;  2KYB A;  3OYD A;  2AT1 B;  3RBB B;  4OF1 A;  3GPL A;  1YIT T;  4OB3 B;  2LCS A;  1VQ6 Q;  5GAN 4;  1H92 A;  1I81 A;  1M27 C;  3G4S T;  3CMA T;  2CP2 A;  3VUB A;  4N4H A;  1KIK A;  3VV0 A;  2JTF A;  2LT1 A;  4N0A C;  2DX1 A;  3BDL A;  1B3Q A;  4E7L A;  2ROL A;  2L8D A;  2CZ6 B;  2DJQ A;  2RK2 A;  5CVI A;  1VQK Q;  1KSW A;  1X2Q A;  4M7A D;  4QQD A;  5GMK i;  2VC8 A;  2NUT B;  3BE3 A;  4PJM A;  1Q82 C;  1TUD A;  5AYF A;  2FHD A;  1ARK A;  3I56 T;  1IRX A;  1UGS B;  2DXC A;  4PK4 A;  1YIJ Q;  3MEV A;  1TG0 A;  1GFD A;  2L3P A;  3V7C A;  1WHL A;  5LJ5 h;  1GCP A;  2LQ8 A;  2QTV A;  3EG2 A;  3UA6 A;  1W1F A;  4LDX A;  4J9B A;  3H0I A;  2Z0W A;  2PUK B;  1KD1 C;  2RHU A;  1M1G A;  4X1V A;  1XTD A;  2Y90 A;  1TH7 A;  3V7S A;  1VQL A;  2JTM A;  1PCX A;  2O2O A;  3VS5 A;  1C1A A;  2CDT A;  3G4S Q;  4CC3 A;  2EKH A;  2K4Y A;  3P8H A;  2JUF A;  3EGU A;  1UFF A;  1QW1 A;  1KQ1 A;  1EIF A;  1GBQ A;  3TSW A;  2LZ6 B;  4KUL A;  2D0Q B;  1RAF B;  4LDV A;  4EMG A;  1K8A C;  2EJ9 A;  3OYH A;  3O8V A;  2MCN A;  4C5I A;  4XTX A;  5LJ5 e;  1KHC A;  2R58 A;  1Y0M A;  5GAN 6;  4BD3 A;  2K5F A;  1LVK A;  1K9M C;  4M78 F;  2DTH A;  2DM1 A;  4AT1 B;  1YNZ A;  1AWW A;  2KE9 A;  2E3I A;  5A2Q E;  3M58 A;  4DA4 A;  3H41 A;  5I22 A;  3C4S A;  4M77 A;  4R0K A;  5GJW B;  2HL5 C;  1WPY A;  5LJ5 d;  1Y96 A;  4ME7 A;  2EKO A;  1EX4 A;  2P0Q A;  2RQT A;  3OMC A;  1QWF A;  1WHG A;  1WA7 A;  2DE0 X;  3H8Z A;  1VQ4 Q;  1WJQ A;  2ZPB B;  4DOW A;  4ESR A;  1V29 B;  4J6X A;  3H0F A;  4PJO F;  1SF9 A;  4RUG A;  1M9S A;  1ZSZ B;  1UEC A;  2MAM A;  3REA B;  2CSQ A;  5CK9 A;  2RH2 A;  4E7J A;  1M30 A;  4FL6 A;  2KXD A;  1YFN A;  2NUT A;  3CCS T;  3CCU Q;  4WF2 A;  1RAA B;  4M7D A;  4XU2 A;  3NTK A;  1V76 A;  1Q86 U;  2A28 A;  2BZY A;  3DB3 A;  2X4X A;  1N8R R;  1QVG A;  1AWX A;  5GJV B;  1YJN Q;  2W10 A;  4FU6 A;  2PUO B;  3OSS C;  1ZBJ A;  2LNH B;  2JT4 A;  2YWW A;  3HTR A;  3EGX A;  1R0C B;  1VQ8 A;  4EIK A;  4IIO A;  3OS2 A;  4IUP A;  1VQL T;  3VYH B;  5CKB A;  2RHX A;  2C0O A;  2ED1 A;  1M90 U;  2VYT A;  2IVW A;  1D1B A;  4CC2 A;  2X3X D;  2DXT A;  3CPW A;  2GBQ A;  2Y4Y A;  4FYW B;  3GF5 A;  4M77 E;  4BE2 A;  3ER0 A;  9ATC B;  2KEA A;  5FRN A;  1RUW A;  2MWO A;  4M77 G;  3JB9 G;  1I1J A;  3CCV Q;  3L2R A;  5KYX B;  2HBP A;  2XHC A;  4MZT A;  3CC7 A;  3VS7 A;  2L5Q A;  1VQM Q;  2M0Y A;  3MCA B;  3H9N A;  1VQ7 T;  2QEX A;  2CT4 A;  2ZCF B;  2OTJ A;  3PT9 A;  2P84 A;  4M7D E;  2XID A;  2LRQ A;  2HKN A;  1HYO A;  2K9G A;  4M7D G;  1W70 A;  2COY A;  2RF0 A;  1ZSZ A;  2F5T X;  1FWZ A;  2CRE A;  2EJF A;  2A36 A;  1FMV A;  2XDB A;  2X4W A;  4RTU A;  3S3M A;  1Y07 A;  4CRI A;  3IQL A;  4HT8 A;  3M5A A;  3EHQ A;  3I55 A;  1HXD A;  2VGN A;  3EG0 A;  2HBW A;  4RTT A;  2F5K A;  3HP9 A;  4QKU A;  4HCC A;  2P4T A;  2AZV A;  1K9A A;  2KAF A;  2YT6 A;  3M54 A;  1M2O A;  3DLL A;  4JZ3 A;  3HHT B;  5L23 A;  1VQ8 T;  2CP6 A;  4LD9 K;  2CUD A;  2KY9 A;  2HCK A;  1WJS A;  3CCR T;  2LQN A;  1VQO Q;  5GAN 8;  3CC4 A;  3SB2 A;  2QA4 Q;  3A5Z B;  5A0G A;  1W2B A;  1GBR A;  1MV3 A;  1E6G A;  1MMA A;  2FRY A;  4JUV A;  4AFQ C;  1GCQ A;  2OX7 A;  2YLB A;  2PVD B;  1E7O A;  2EQK A;  2CT3 A;  1VQP Q;  3LX7 A;  4II1 A;  2DK3 A;  3NTH A;  1KC8 R;  2CZ1 B;  1K0S A;  1YJW Q;  2PNI A;  4DBH A;  1ZUU A;  1O75 A;  4J7I A;  4BY6 C;  3OW2 S;  2E5Q A;  1UUE A;  1NZ9 A;  3MEW A;  1CKB A;  3JB9 H;  4VUB A;  5KYX A;  3CME Q;  3UT1 A;  2QEX T;  2OTJ T;  4RG8 A;  2LQK A;  3RUX A;  1PRL C;  2RI3 A;  3V7R A;  1BK2 A;  1HSQ A;  2K6D A;  1W6X A;  1X01 A;  3JCM X;  1FX7 A;  4OMP A;  4OB2 B;  1RI0 A;  1YI2 A;  3EH1 A;  2PQW A;  3M0S A;  1Q82 R;  1NBE B;  3NPF A;  2M0O A;  1EFN A;  2DA9 A;  2YUN A;  1AT1 B;  3OBY A;  2E4H A;  1VQ5 Q;  3LH0 A;  4X9D A;  4AFZ C;  1SSH A;  1M3A A;  4HXJ A;  4D8K A;  2RJD A;  2AZS A;  4M77 F;  3I55 T;  1UB4 A;  4WTO B;  1VQ9 Q;  1KD1 R;  1ZUK A;  1K76 A;  4M78 C;  5LJ3 h;  3OYC A;  2GTJ A;  4M7A B;  1Q81 C;  2KRO A;  2VB6 A;  3M4G A;  5I2M A;  5KE2 A;  2G3R A;  5IHK A;  4XK8 E;  5D7U A;  3CCE Q;  3RKW A;  3CC4 T;  3REB B;  2KBT A;  2ZPE B;  2MF2 A;  1LNX A;  3VS3 A;  3PIO A;  4KT0 E;  2BIV A;  3CCL Q;  2E6Z A;  1K8A R;  2CP0 A;  3QG1 A;  2EFI A;  3G71 Q;  4M7D F;  5I21 A;  2E70 A;  4PJO C;  3CD6 T;  1BIA A;  1RAH B;  2RHI A;  1K9M R;  1DJ7 B;  3X20 B;  2LMJ A;  3CEY A;  2GFU A;  5LJ5 j;  3M0P A;  1FXX A;  1QQJ A;  3G6E Q;  5IXF A;  2QAS A;  5HCK A;  1ZLM A;  5LJ3 e;  2R5A A;  2OTL T;  4AG2 C;  2MOX A;  1WI7 A;  1JB0 E;  3C0C A;  3FB9 A;  4LUD A;  1N9S A;  1SHF A;  3OYI A;  1W4S A;  1WZO A;  4HA8 A;  2BZ8 A;  4RTW A;  1C0M A;  4Z88 A;  1T0J A;  2CGH A;  2O4X B;  5A0L A;  3EG3 A;  3CCM Q;  2JN0 A;  2X4J A;  3HRS A;  3PNW C;  3E19 A;  1M8M A;  1TUC A;  2D9T A;  4XU0 A;  2DYB A;  5GMK e;  1ABQ A;  2JS2 A;  1AWJ A;  2DVJ A;  1BI3 A;  2QQB A;  3M57 A;  3OY9 A;  2EVR A;  2J6O A;  4OP0 A;  3FC3 A;  4C5G A;  4J9I A;  3X28 B;  4DEX A;  5GAN h;  3HRT A;  4F16 A;  4DBF A;  2DTI A;  4J9E A;  2JXB A;  2HEQ A;  1WHH A;  3UAT A;  1MNE A;  2VGM A;  3A8O B;  1BCO A;  4FYV B;  2MMP A;  2AKK A;  3GNF B;  3V8K A;  4LXC A;  2DL3 A;  5C0M A;  4M7A A;  4EMK A;  1PG5 B;  1WX6 A;  3AHU A;  4EPC A;  3ULR B;  4BUG A;  4PJO G;  3OBW A;  3I5S A;  4RKU E;  5J26 A;  3JCM h;  4KGV B;  3OYE A;  1Q7Y C;  1X6O A;  2RQW A;  3LGF A;  1VQ4 A;  2EGE A;  4C92 B;  2X35 A;  1PWT A;  1OX9 A;  1X6G A;  5LJ5 f;  5GAN e;  4RTZ A;  1ZQ1 A;  1WQW A;  4E7S A;  1QVF S;  4KBM B;  1TOV A;  4RMO A;  4JLG A;  4TVR A;  4J8O A;  2GNC A;  1HK9 A;  1OX8 A;  2RNA A;  3CCU A;  4XTY A;  2PU9 B;  3FIF A;  4JJD A;  4M75 D;  1PNJ A;  1GFC A;  3ASK A;  2I0N A;  2V1R A;  3KUF A;  1UE9 A;  4R55 A;  1G3S A;  3A98 A;  1Z9Z A;  3C94 A;  2L3Q A;  4DBQ A;  2ZPH B;  4PLI A;  1VIE A;  4PNO A;  3J7A F;  4OMN A;  1U3O A;  1D0Y A;  5CQX A;  1FMW A;  3JV3 A;  3PGG A;  1NLO C;  1T0H A;  3JCM e;  2NLU A;  4EDU A;  1YHQ Q;  5EC7 A;  2O4X A;  1WNL A;  4RTX A;  4IUU A;  3TSZ A;  2KGT A;  3BW1 A;  4PKC C;  2ZPG B;  2C0I A;  3OYF A;  2LDM A;  3RR6 A;  1S72 Q;  2M1H A;  3QYG B;  2WSF E;  3MJX A;  3I9Q A;  1I5L A;  1IHV A;  1VYT A;  2EQU A;  3JCM d;  4M7A E;  1NYG A;  5C6S A;  1SHG A;  4Z02 A;  1M2V B;  2FPF A;  4IUQ A;  2YRV A;  2K3Y A;  3S3O A;  1N8R U;  3PTA A;  3RKX A;  4M7A G;  1TSF A;  2QK0 A;  4XU1 A;  1D1C A;  1BCM A;  3L1A A;  3MP6 A;  2RO0 A;  1PRM C;  3UWN A;  3SWN A;  4FW2 A;  1YIT Q;  3EGD A;  3PVQ A;  4QVC A;  3BY7 A;  1JXO A;  3CMA Q;  3QII A;  2QTX A;  2EYQ A;  5DM7 R;  2MPX C;  1I4K 1;  2RHZ A;  2ESW A;  3JB9 J;  6AT1 B;  2K57 A;  2LNV A;  3TVT A;  3FRN A;  3QBY A;  3TU4 K;  1AEY A;  1IXD A;  3A8H B;  4FSX A;  4C92 A;  5IT9 E;  3PVL A;  1Z9Q A;  1RAG B;  2KXC A;  2QQA A;  5GAN 7;  1M8V A;  4MDX A;  4OB1 B;  1VQN A;  4PLL A;  2KVQ G;  2HDA A;  1YCY A;  3LLR A;  5IAY A;  1AZE A;  2HQH A;  2NUP A;  2KK4 A;  1XJW B;  1G3T A;  3JRZ A;  1SG5 A;  3CBP A;  5LL6 S;  4M77 C;  4RTY A;  3I56 Q;  1TUG B;  3NTI A;  2EYW A;  2HSE B;  1IGU A;  1QCO A;  4MDW A;  4MML A;  2NUZ A;  1BKB A;  4GLK A;  1I5O B;  2QQS A;  1VUB A;  4J9H A;  4N4I A;  3WVD B;  3M55 A;  4J7F A;  3ME9 A;  3JAM E;  1UGV A;  2PTK A;  5FU7 B;  1MND A;  5GAM h;  4FT2 A;  4X9C A;  2J6F A;  2DXU A;  3OYJ A;  4XTV A;  3CXC S;  3JCM J;  2YSQ A;  4M7D C;  1JJ2 S;  1VQP A;  2CP3 A;  4HVV A;  1NPR A;  5GAO m;  3MP1 A;  1G3Y A;  4A4K A;  2KMT A;  4C92 D;  1GL5 A;  1YJW A;  3EAE A;  2E12 A;  2MIO A;  2CSI A;  5M9O A;  1Q81 R;  2ROT A;  4F04 B;  1TXQ A;  2R5M A;  1ZA1 B;  5AT1 B;  1QVP A;  3OS5 A;  2HNI A;  5DLQ E;  5GMK l;  3CC2 A;  4C92 E;  2GFA A;  1K73 C;  2DD4 A;  1M1K C;  3SDZ A;  2DD5 A;  3FEO A;  1YJ9 A;  3RMQ A;  1NE8 A;  2RHY A;  3E9G A;  2EYZ A;  5GAM e;  3FLG A;  3QWY A;  1U1T A;  3VRZ A;  1K1Z A;  1JJ2 P;  1QP3 A;  2X9H A;  4BAC A;  4BDZ A;  2LT4 A;  3R6O A;  2P4R A;  2HQX A;  2KR3 A;  7AT1 B;  1KC8 U;  1MHN A;  2F2X A;  2KT1 A;  2K5I A;  3JB9 D;  1R77 A;  3UDC A;  4FT4 A;  1VQN T;  1NJI C;  1LJO A;  4B9X A;  4JLI A;  1VQ5 A;  4JZ4 A;  1K0X A;  4L5G A;  4OMF B;  3CCJ A;  4PFO A;  3OSV A;  3JCM b;  1NLP C;  2EW3 A;  5D6Y A;  2E6N A;  4M7A F;  3CCS Q;  2M51 A;  2DRK A;  2HD0 A;  2EQI A;  1D3B B;  2AHJ B;  4BDY A;  2ATC B;  1UJY A;  1NM7 A;  3X26 B;  4J6Y A;  3QWX X;  5KYU B;  3JCM W;  1CKA A;  4QVZ A;  1Q82 U;  2R57 A;  3CCE A;  3THK A;  1ZBX A;  4XTW A;  3G1J A;  2DZ9 A;  2GCX A;  1ZUY A;  2L2P A;  1ZSZ C;  3GNG A;  1Y71 A;  4OGC A;  1VQL Q;  1SEM A;  4JRK A;  2RQR A;  1IGQ A;  5GMK j;  2CP5 A;  2KRN A;  3MHX A;  4A53 A;  1BI0 A;  2O01 E;  5GAO q;  2KT8 A;  1ZSG A;  2DZC A;  3T9N A;  2MYS A;  2CZ0 B;  1BYM A;  4IUR A;  4OB0 B;  3DKM A;  1I07 A;  1ZHI A;  4YTL A;  4BI8 B;  1KD1 U;  2CZ7 B;  4BI4 A;  4Y28 E;  2M02 A;  3CCQ A;  5LJ5 g;  3G6E A;  2DVE A;  3QPH A;  4HVU A;  3QYH B;  3CC2 T;  3MET A;  2YLC A;  2DLP A;  1YJ9 T;  1QWE A;  3SFM A;  3X24 B;  3OYA A;  3FJP A;  1Q7Y R;  1VQ7 Q;  4JPB W;  2ECZ A;  2P0K A;  2EYX A;  1GCQ C;  5FU6 C;  1A0N B;  1WXB A;  1K8A U;  4FYX B;  1WXT A;  1SRM A;  2VXE A;  1OOT A;  1N9R A;  3JCM V;  3CCM A;  4AMC A;  3OYK A;  4OMO A;  2CYZ B;  1NPP A;  1RLP C;  1K9M U;  2F1L A;  3OYN A;  1H3H A;  3A8L B;  5KYW B;  2VV5 A;  1RL2 A;  2HZY A;  8ATC B;  2LP5 A;  5I2S A;  3M56 A;  3OMG A;  2IG0 A;  1LPL A;  4C0Z A;  4BE1 A;  3MEA A;  1UGR B;  2DIQ A;  3CC7 T;  3EG1 A;  3N5B B;  2RQU A;  4LUE A;  4OMQ A;  2DJZ A;  1F1B B;  2KDS A;  4JRI A;  5FRO A;  4R56 A;  2XD0 A;  2V8K A;  1ZX6 A;  2BZX A;  3HPW A;  4C8Q B;  4ELY C;  1OUL A;  2RD1 A;  4D6W A;  3F70 A;  2D0N A;  2LX9 A;  4C92 F;  1VQ8 Q;  2J06 A;  2K3X A;  2GTO A;  2LCC A;  3CCR Q;  3JCM Q;  3TCJ A;  4JRQ A;  3OW2 P;  3HRU A;  2XG8 D;  4CC4 B;  4M75 B;  2QAZ A;  2DXB A;  1PHT A;  2KSS A;  1B07 A;  2EPD A;  2JMA A;  1TS9 A;  5A0D A;  2CP7 A;  3VJP A;  3NGP A;  2MI6 A;  3CPF A;  3P8B B;  2A08 A;  4RTV A;  2JW4 A;  3CCQ T;  1CSK A;  2L89 A;  3QSU A;  4C5H A;  1PC0 A;  1VQ6 A;  2B86 A;  3PFS A;  1MMN A;  4ORZ A;  3VKI A;  5KYY B;  5J3B A;  1WQ7 A;  2LC4 A;  2QEX Q;  2OTJ Q;  1ABO A;  4K11 A;  2KQW A;  4ANJ A;  1N27 A;  1WHM A;  3NHN A;  1QP2 A;  1QMC A;  1M1F A;  2AKL A;  3QUI A;  1VQK A;  5CKF A;  5D6X A;  2ZPF B;  4B6M A;  3OS1 A;  2DEQ A;  2VUB A;  4FW1 A;  1KQS S;  4AG1 C;  5J39 A;  4XTU A;  3GLX A;  5ECA A;  3S6W A;  2FZK B;  2LX7 A;  1G5V A;  2FZG B;  2DEU A;  1T3S A;  2LJ3 A;  3KFV A;  2FB7 A;  5GAO l;  3PIP A;  1YIJ A;  5HKC A;  2CH4 A;  2E5K A;  3DLM A;  5FRM A;  1D09 B;  2ZZD A;  1VIF A;  2COZ A;  1BU1 A;  4FIB A;  5GMK m;  3I55 Q;  3JCM f;  3SD4 A;  3PE0 A;  1M3C A;  1JO8 A;  1U1S A;  3MPU B;  2KRM A;  4XQ3 A;  2DIG A;  1YI2 T;  4RCB A;  5LJ3 d;  1TWB A;  2XKO C;  1YIT A;  4C8Q A;  4E7H A;  2RN8 A;  2O9V A;  1LCK A;  2D6F A;  2LJ1 A;  4NS5 A;  4IIM A;  3G4S A;  3CMA A;  1UDL A;  2EGC A;  5CO7 A;  3CC4 Q;  2PVG B;  2JOY A;  4J9C A;  3V8L A;  1QKX A;  2RA2 A;  2XMF A;  4M78 D;  4MMK A;  1P92 A;  1IB8 A;  2BKD N;  4PJL A;  1UHF A;  1SKU B;  4M75 A;  1WJR A;  1R0B G;  2H3J A;  2YUQ A;  4F7U B;  3VS1 A;  4PFZ A;  1AZG B;  1C6V X;  2COW A;  3CD6 Q;  2IIM A;  1OEB A;  1Q81 U;  4PJJ A;  3BDU A;  4Y92 A;  4LNP A;  1R8O B;  1K73 R;  1M1K R;  1FMK A;  5KCO A;  1X43 A;  5GAO r;  4C0D C;  1VQ6 T;  4M7A C;  2QG9 B;  4EMK C;  2PZ1 A;  5GAO n;  3EFS A;  2XI9 A;  2OTL Q;  4KGX B;  4J5Y A;  1JEG A;  2X4Y A;  1RAC B;  4NL2 A;  4QVD A;  5HK3 A;  2FRW A;  2YUP A;  4XU3 A;  5IHI A;  2L3R A;  1O9S A;  1Q86 C;  4C8Q D;  1VA7 A;  1NJI R;  2ZGW A;  3OYB A;  1KG1 A;  2YRC A;  1D0Z A;  5CKH A;  4ZGE B;  2DL8 A;  1PSE A;  1IRE B;  3NMZ C;  1Q95 G;  1OPL A;  4C8Q E;  2OJ2 A;  2BE9 B;  3M9Q A;  5GAN d;  1M90 C;  1WHK A;  2KYM A;  2C0T A;  4Y91 A;  4C0F A;  4J9D A;  4LDU A;  3INZ A;  1G83 A;  3M0R A;  3EFR A;  2NYS A;  2ZPI B;  5L8R E;  2AK5 A;  1YJN A;  1I0C A;  2JNG A;  4M75 E;  2FO0 A;  4E7I A;  2FYK A;  1JRI A;  2SEM A;  2O9S A;  2QXF A;  4M77 B;  1QKW A;  3SHW A;  2HQE A;  1H64 1;  1QVF P;  1Y96 B;  3VYG A;  5HY6 A;  2V26 A;  2ABL A;  2O88 A;  3QJ6 A;  4M75 G;  2KRS A;  1SPK A;  2JVV A;  1ACM B;  1RAD B;  1IO6 A;  3LGL A;  4OGE A;  3OA6 A;  1OZ2 A;  2H3E B;  3LWH A;  4E2F B;  2JTE A;  2AIR B;  3QZ9 B;  4N0A A;  4DOV A;  4HCB A;  4J9G A;  4HKE A;  1X6B A;  1H8K A;  3A8G B;  3VS2 A; 
#chains in the Genus database with same CATH homology
 1ZSZ B;  2QAS A;  1TWB A;  1YFN A;  1ZSZ A;  1OU9 A;  2NYS A;  1ZSZ C;  1OU8 A;  1OUL A;  1OX8 A;  2QAZ A;  1OX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...