1ZSZB

Crystal structure of a computationally designed sspb heterodimer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
SSPKRPYLLRSLYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGAMFEPEEIYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B homolog
publication title Specificity versus stability in computational protein design.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags De novo protein
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1zszB00
1OX8A 2NYSA 1YFNA 1OU8A 1OULA 1TWBA 1ZSZB 1ZSZA 1OX9A 2QAZA 2QASA 1OU9A 1ZSZC
chains in the Genus database with same CATH superfamily
4HCBA 1OEBA 3G6EA 3I56T 4N4HA 2JTFA 1QQJA 3CCJT 4LDVA 1M3BA 3SWNA 4RG8A 1IB8A 3CCQT 3M0RA 3X26B 3HSBA 2GBQA 1JQQA 2CGHA 1IREB 3U23A 3CC7Q 1Q81R 4M78F 1IHWA 3VS3A 4HCCA 4DOWA 3CPWA 4IIMA 4DBRA 2AZVA 3SWNB 2WSEE 1XTDA 1Y7XA 3QSUA 1D0XA 5L23A 1UGVA 1R77A 2F1LA 4M4ZA 3CC4Q 1W70A 2COWA 4BD3A 3CXCA 1D09B 3MEAA 3GIBA 2XHCA 2H3EB 1YI2Q 2DMOA 1QVPA 1YWPA 3CMET 3PT9A 2A7YA 2QQ9A 3M9QA 1OQKA 1WXUA 2OTJT 4RG2A 1G3YA 5FRNA 2FL7A 1ZBJA 1NG2A 4XU3A 1UE9A 2K3YA 5GAOr 3CQTA 2RA2A 2YRDA 4E7IA 3E2UA 3M5AA 2RI5A 5GAOm 2KQWA 1WHGA 3LYIA 2KAFA 2HKQB 2V26A 1X43A 1MMDA 4PFOA 1JU5C 3L2VA 3OS5A 4C8QC 1N5ZA 4ME7A 4Z88A 3UA6A 2I2LA 2MK5A 2OTLQ 5AYFA 1Y71A 1Y57A 2E6ZA 5CKDA 3JCMV 5FRMA 2NUTA 3OS1A 2ED0A 2YWWA 4ZN3A 2DKGA 2IVWA 3LH5A 1BIBA 5KYYA 1VQ9A 1VQ5Q 1VQNA 3VJPA 4QVDA 2ROLA 4Y28E 4XU0A 1WXBA 4A63B 3CPWS 1Y96A 1K8AR 3CCLQ 3QHSA 3EG1A 4MZMA 1WHHA 4LE9A 4M75F 3JCMX 4NL3A 1H3HA 5KYYB 3DKMA 1K9MU 3CXCS 1KJWA 3FJPA 3FB9A 4VUBA 4ANJA 2E3HA 2EQKA 5FROA 1Y96B 2JS2A 3BDLA 4JZ3A 3SEMA 2HD0A 3SDZA 4F17A 2KRMA 1HXDA 4IUTA 2CP5A 3VS5A 3QXEB 5GMKl 1UECA 1PC0A 2W0ZA 5HKCA 1FWZA 2FRWA 3NTKA 4K11A 1ZHIA 3CC7A 4FCYA 4OB1B 2KT1A 3RERA 3JCMW 4IUQA 2AHJB 3G7ZA 1KC8R 4XTUA 3HFNA 2J6OA 3VS1A 2DERA 3WVEB 4HCZA 5LJ5d 2P4TA 2M16A 3OSSC 1BIAA 2M1HA 4LUEA 4Z02A 4XQ3A 1LPLA 3CC4A 1ZUKA 4F7UG 1MMNA 4RTWA 1YI2A 2PQWA 2CYZB 1KQ2A 2K5IA 3V8KA 2DILA 2VB6A 3TCJA 1OPKA 3S3NA 1SKUB 4BI8B 1OI1A 4F16A 3V7RA 3RKYA 2XICA 2L3QA 4RCCA 2WSCE 3OS2A 2QG9B 3RR6A 2MWOA 4FSXA 3TQ7P 1Y07A 1JJ2A 4D8KA 3JB9I 1BYMA 2BIVA 4C8QE 2SEMA 2H8HA 4N4GA 3VS6A 5IT9E 2QGFB 4PJNA 2E5KA 3C95A 1VYTA 2JM9A 1VQOT 1Q7YC 4BI3A 3J80E 2QTVA 4O5VA 2JJ9A 1VQ9T 5GAOp 1VQNT 2RI2A 3GBQA 4C8QG 4CC7A 2W10A 2G3RA 3EH1A 3DLLA 3SB2A 3L2RA 4JPBW 5GANh 3LGLA 2BZ8A 4PFPA 1VQ5A 2FHDA 5A0GA 2EQMA 3EG2A 4E2FB 2GF7A 3OYMA 2LCCA 3TSZA 4RTYA 4BY6C 3CCLA 1VQ8Q 4J9HA 1VYVA 2DXTA 3CC2T 3GLXA 4C8QD 3ER0A 3O5ZA 4JLIA 4M77B 3ME9A 1U5SA 2J7IA 1G2BA 2YUQA 2LQKA 3JCMe 2DETA 1Q7YU 1YCSB 1TUCA 4PLLA 1DJ7B 2FPFA 1YIJQ 3S6WA 3OYLA 1U06A 3CCJQ 1W6XA 2RI3A 2CUDA 3CC7T 2A36A 2H3JA 2EYQA 3CCQQ 2XMFA 3EGDA 1AT1B 4XAXB 5DM7R 4OP0A 3RNJA 3EGUA 4C92E 3PNWC 1NJIC 2DYIA 2C06A 2VV5A 5KCOA 4BI4A 1JJ2S 3H6ZA 2GFAA 1QVGP 3GNFB 3CC4T 3FC3A 1HYOA 3EGDB 4JUVA 1G3SA 5IAYA 2DEUA 5GMKm 3MPUB 1G8XA 1ZLMA 1EIFA 4M7DA 1BCMA 2FRYA 1PG5B 2P0QA 1ZQ1A 4DBQA 5J3BA 5LJ5h 1BU1A 1VQ4Q 1PM3A 1V1CA 3CMEQ 4X9DA 1UG1A 3V7CA 4E7SA 5GAOn 3SWNC 2OTJQ 1W2BP 2DA9A 3X24B 1EZZB 4M7DB 2MYSA 1VIFA 2RQVA 2LX9A 1I81A 2CZ7B 2E1HA 1RUWA 3EGXA 4CI0C 4ZN1A 5GMKh 3CBOA 1HK9A 2DVEA 1NEGA 1PCXA 2OTLT 2MPXC 1H3ZA 4KBMB 2OJ2A 2CREA 4CRIA 1JEGA 3PTAA 5LL6S 2P0KA 1RAEB 2LTOA 3EGXB 3SFMA 1PD0A 1WPYA 5FWBA 2FB7A 4F7UF 4Z89A 1TS9A 1RABB 1E6HA 1H641 2LCLA 5FWCA 3BDUA 3H0FA 3RMSA 3C4SA 1C1AA 1X6GA 2L3SA 1M3AA 4PK4A 2C0IA 2WACA 4IUUA 1H8KA 2BZXA 2DX1A 5LJ5g 2COZA 1MUZA 5FU6C 1VQ8A 2MF2A 3H41A 2KE9A 5CR2A 2LT4A 3PFSA 3L2WA 2YUPA 4C0ZA 2KSSA 1WNLA 2D6FA 3G71A 2KNBB 4J7IA 2XG8D 3Q1JA 4IUPA 3OB9A 1I8FA 3M54A 2DL5A 2HQXA 3E1SA 4AFSC 1C0MA 1WHMA 2AK5A 1YIJA 2FEIA 2KY9A 3CCJA 3VYHB 2ENMA 3CCQA 2M0YA 1HD3A 1K9AA 2L2PA 2HSPA 4ZGDB 1AWWA 5GAN2 1TXQA 4XTZA 4FU6A 1MMGA 4B9XA 3RBBB 3OS0A 5CVIA 4BACA 2EKHA 1MGQA 2CT3A 4LDXA 2F5TX 2EYXA 1WGSA 2R5MA 4X9CA 2CDTA 2CSIA 3THKA 2D0QB 4M78A 3KUFA 4PJMA 1SSFA 4C0GA 4MDXA 1M5Q1 3JB9G 1ACMB 1X2KA 4JLGA 2KBTA 3MEUA 3CCVT 1P92A 5L8RE 4OB0B 1Q7YR 2DL8A 4L6V5 1EX4A 4M7AA 1X01A 4DEXA 3OYCA 1VQ4A 3CMEA 4EPCA 1UGSB 4GLKA 2DZCA 1LVKA 1WZOA 1CKAA 2OTJA 4M78B 4EMHA 1KSWA 2QYZA 4QQDA 1BI3A 3JB9D 4XU2A 2CH4A 1X69A 1PRMC 2EGAA 1JXMA 2EYZA 2LZ6B 3N5BB 2KMTA 4IKFA 4M7AB 1X2QA 3JCMf 3CCST 3QWXX 2XI9A 5GAN4 1XOVA 2LJ1A 3FDRA 4KUIA 2DVJA 2DTHA 2K6DA 4E7KA 2OI3A 1YITT 2NWMA 3UT1A 3OYKA 3C12A 4KRTA 4BE1A 1VQOQ 3VV0A 2PVOB 2QQAA 1JXOA 4R55A 4J8OA 1ZA2B 2JTMA 1G3TA 4FYWB 3HRUA 3LX7A 2CP3A 3NFCA 1VQPQ 1KC8U 4O6JA 2X4WA 2QDYB 4N0AA 2JUFA 3TREA 1VQ8T 5CQYA 1VQKQ 2ZPIB 4DA4A 1ZUYA 1NJIR 2J6KA 4LN2A 1WQWA 2EVRA 2RNAA 2DF6A 2E70A 3E9FA 4HA8A 2M0OA 4LDUA 5EG2A 2LNHB 2RHUA 2K57A 3CC2Q 2F2VA 1BI0A 4ZNXA 1YIJT 3CEYA 1KK7A 2DJZA 2ZPEB 3RESA 2JMAA 2V8IA 1KFZA 2I0NA 2RHIA 2EAYA 3OYBA 1BI1A 3G4SQ 1WHKA 5FU7C 3J81E 4M75A 3R6NA 1YJ9Q 4A54A 2BUDA 3LGFA 3CMAQ 2PTKA 3MEVA 3QJYA 3ULRB 1IZ6A 2O88A 1RAAB 3HKSA 2X9HA 1RI9A 2K5FA 4M77C 3CCMQ 1RL2A 3QKJA 2HL5C 1EFNA 4PL6A 4HKEA 3VS7A 1QLYA 4M7AF 3CCUQ 4M75B 3TU4K 4X1VA 3PVLA 1RAIB 1M30A 3QBYA 2PUOB 4XU1A 1VQ4T 2KI7A 2NUPA 3VUBA 2GCXA 1SF9A 3CD6Q 1VIEA 1SRMA 4OVAA 3I35A 1ABOA 2HQEA 2LMJA 2LJ3A 2A0FB 2VKNA 2DIQA 2QAZA 3QZ9B 1U3OA 2E5QA 3UPUA 2OX7A 5GAMe 2KR3A 4PLIA 1W2BA 2CH4W 3GOXA 3PE0A 4DBFA 4BB7A 4F14A 4XTXA 3ZBDA 2NUPB 1ZX6A 1TH7A 2FZGB 1BB9A 1TUGB 2CP6A 2EQUA 3GPLA 1AWJA 4D8DA 4XK8E 5D6WA 2XKOC 4Q5WA 3SD4A 4J9EA 2DTOA 2EPDA 3EFSA 4JJNK 1S1NA 3VYGA 2VWFA 3VUZA 1M2VA 1D0ZA 4J6WA 2ZPBB 4RMOA 2X3WD 4C5GA 2EKOA 2RO0A 1VQOA 1VQ6T 2IPOB 4RCBA 3JSCA 3ZFJA 5A2QE 3OYHA 1UHFA 4MMKA 3OYAA 3MKDA 5GANe 2K2MA 1H92A 4EMKA 1PSEA 2AZSA 2EFIA 2EYWA 1GFDA 2A37A 1T0JA 2EWNA 3UATA 1Q82C 2K3XA 1VQPA 4LXCA 3RMQA 4HCKA 1M2VB 4JZ4A 3REAB 2NUTB 3HP9A 5CQXA 2K2VA 2ED1A 4JJCA 5GMKi 1SPKA 2RJFA 3EFRA 3M0UA 1YP5A 4AG1C 1JBMA 1OULA 4OF1A 2KROA 1U1SA 4EMKB 3CC2A 1WJQA 1TG0A 3RKWA 2L3RA 3SHWA 1R0CB 4MMLA 1QKWA 1LCKA 2XU8A 3MEWA 1AEYA 3LLRA 2OAWA 3T9NA 2GTJA 1AVZC 2KVQG 4PJOF 1I07A 4AT1B 3LWIA 4OGCA 1UGRB 1MV3A 2BE9B 4BE2A 1YJ9A 3M59A 4CC2A 5KYWA 4M77E 1W2BS 4ZTFA 4C92C 1PNJA 1Q82U 3DLMA 3G1JA 1K76A 3OYJA 3L42A 3CCMA 2X3XD 1UTIA 2QQRA 1TSFA 1R8OB 1M2OA 2LP5A 2DYBA 3C0CA 2QTXA 4M77G 2CS7A 5KYWB 3HL8A 4JDSA 4A4GA 3NPFA 3QUIA 1LOJA 2CKKA 4ZTJA 2DIGA 4EMGA 1UJ0A 4KT0E 2ZPGB 2QA4Q 1J3TA 2HBWA 1ZA1B 3CCVQ 3EG9A 2BKDN 2VXFA 3MP6A 2MI6A 1KG1A 3MCAB 5IN1A 2ECZA 2DE0X 1UJYA 3QG1A 4M77D 4MZPA 3JCMb 4GLMA 3BW1A 3RUXA 2R57A 2PZ1A 4FL6A 2YUNA 1N8RC 5GAN3 3EG9B 1AWOA 4XTYA 4EDUA 3OY9A 1B7TA 4IIOA 4A53A 2CUBA 2X4JA 2JOYA 4RTUA 3MJXA 3M55A 5LJ3d 3CCSQ 2EYYA 2OTLA 1HJDA 2HQHA 5C6SA 4BDZA 5LJ3e 1PD1A 1W4SA 4RKUE 3TVTA 3REBB 4PNOA 4II1A 4JS4A 2C0TA 4M7DE 4FYYB 1GBRA 1YITQ 2HDAA 1FMKA 2L3PA 5C0MA 1VQPT 1N9RA 5KE3A 1YJNQ 1SG5A 1OOTA 1QP2A 4NS5A 4OB3B 1VQKT 1KQ1A 3OBWA 1I5OB 2QEXQ 2DL4A 3EFOA 4J9BA 1A0NB 2RK1A 4J7FA 4B6MA 3ASKA 4HVVA 2HBPA 2GQIA 1VUBA 3JCMc 1D1BA 2YRVA 4F7UA 3OYNA 1N8RU 1QCOA 4FSSA 4L5GA 3JCMd 4RTVA 3CPFA 1M1KC 3EFOB 3G4ST 2EGCA 5CK9A 2MOXA 5GAMj 4XTWA 3LH0A 3UA7A 3I5SA 1YJ9T 1RLPC 5KYXA 2OAUA 1M27C 2CSQA 3CMAT 1CKBA 3OSVA 2A3LA 2PU9B 2K3BA 5GAMf 4F7UB 2DAQA 5D7UA 1M8MA 4LDWA 3CCMT 2RJDA 3CBPA 3NGPA 1AOJA 2RJCA 5HCKA 2XDBA 2ROTA 3CCUT 1U8RA 2DO3A 2HZYA 2IIMA 4LUDA 2FYKA 4C92G 2GNCA 3E19A 1JB0E 2JTEA 4KULA 1K73C 1M9SA 4OMNA 4C8QA 3M56A 3UWNA 4FT2A 3CD6T 5GANj 3JCMP 1M1KU 4QW2A 1OU9A 2HCKA 1QMCA 5GANf 5HY6A 2CT4A 2QA4A 3CCVA 3VRYA 1I1JA 3A5ZB 2YSQA 2DD5A 3NHNA 5GJVB 4C92D 1T0HA 2RHXA 3QYGB 2RPNA 1NJIU 2DRKA 2ATCB 4D6WA 1V76A 4FM4B 5HK3A 3E9GA 4M75C 2QQSA 4J6XA 4AFUC 1Q82R 4E7JA 3RDVA 2LJ0A 2C0OA 2ESWA 1Q86C 3M4YA 4WF2A 4OGEA 3QYHB 4LD9K 4A4EA 3EHQA 2DFUA 2DLPA 2R5AA 1K73U 3HTRA 3V7SA 3VU3C 3CCSA 4M78E 5KYUA 2Y90A 3EAEA 1YITA 5DLOA 5CKFA 4KUDK 1VOMA 2Y4XA 1R0BG 1VQ6Q 3BFMA 4M7AE 3M57A 1YJNA 3M0TA 4R0KA 3UDCA 4Z8AA 1WX6A 1WHJA 4C0DB 1G5VA 2F69A 2DXBA 4E7HA 2DXCA 4KH0B 5I2MA 2PVGB 4AMCA 5KYUB 2KYBA 2VVKA 7AT1B 5KYNA 4RTTA 2LCSA 1Q86U 3NMZC 3JB9J 2RMOA 4JS5A 2E12A 1Q95G 2D8HA 3H9NA 5GJWB 3JAME 1YNZA 4DQ2A 5CKHA 5I2SA 1M4ZA 2RB6A 2V1QA 2CZ1B 3VS4A 5M9OA 4FYVB 3G6EQ 2QK0A 5KH6A 2DM1A 3M0SA 3PMIA 4C8QF 3O8VA 3H0HA 3OQ5A 1S72Q 2YRCA 2E65A 2D9TA 2F2XA 5LJ3j 2D1XA 4IURA 4ZGJB 5J26A 5GAOq 1UGQB 5LJ3g 4MZTA 5I11A 1VQLT 3OW2P 5LJ3f 1BI2A 2XDDA 1N8RR 4AG2C 2ZZDA 2LX7A 4KGZB 1VQ7Q 2QA4T 3JV3A 3RKXA 1NBEB 2ZCFB 1NPRA 1VYUA 3JCMQ 1O75A 2K7AA 1N6AA 2YDLA 2JMCA 3URGA 2L5QA 2LT1A 4BUGA 2L0AA 1AZGB 3LWHA 1MHNA 1OV3A 4FT4A 3HFOA 4M75E 1PSFA 2KRNA 1RAFB 4HXJA 1NLOC 3FRNA 2AIRB 2O9SA 1ZSZA 3HPWA 3VS2A 4Y91A 3JCMg 1KQSP 3KXTA 2FPDA 2EIFA 2DBMA 2GQVA 1F1BB 1B07A 2HNIA 1JRIA 3A1PA 1IRXA 2QI2A 2V8KA 4FYXB 4JJBA 1ZSZB 3FJ5A 1M1KR 3OMGA 4C92F 1QW1A 3M58A 2DTIA 1YJNT 5GAN6 4OB2B 2EJGA 4LNPA 2KEAA 2QEXT 3NTIA 1VQMT 4CC4B 2V8JA 4BY6B 4E7ZA 2SRCA 3CCRT 2DBKA 2BTTA 1VQ6A 1YJWT 5IXFA 1SSHA 3MHXA 4NL2A 4M75D 1WHLA 2IG0A 3JRZA 5J39A 1PRLC 2VXEA 1WI7A 3I9QA 2YHTA 4LD6A 8AT1B 2YXYA 3HHTB 2KXCA 2RK2A 4JRPA 2QDLA 2DXUA 2JS0A 1K73R 1I5LA 1OX9A 2EJFA 2V1RA 2X51A 1RAGB 2O2OA 3OA6A 1QWEA 2DEQA 1XQHA 3PIPA 3KFVA 2X4XA 1YHQT 3JB9H 3CCET 4JRIA 2HEQA 1S72A 2J6FA 4IUVA 1QVGA 3I55T 4XTVA 1MV0B 2AT1B 2J06A 5IXBA 4PJOA 2NYSA 4DBHA 2E6NA 2O4XA 1Q86R 2VGMA 2QQBA 1QVFP 1UEBA 1VQ7A 1QKXA 4OMPA 1YFNA 5FW9A 1M3CA 4E7LA 1Y0MA 4BDYA 1NZ9A 4KH1B 2KGTA 2Z0WA 1RI0A 4PJOB 2VYTA 2JW4A 5GAMd 4JRQA 3INZA 3MO8A 2O4XB 2DL3A 5I22A 1LJOA 1T3SA 4J83A 1I0CA 3TSWA 1SEMA 2PNIA 2EW3A 1X6OA 1TU0B 2ZPFB 1YWOA 1TOVA 1CSKA 2E4HA 1GCPA 3IQLA 2D0NA 1E6GA 1K1ZA 1GXIE 1G3WA 1WDXA 4JJDA 4N4IA 1ZUUA 1IO6A 3S3MA 3OMCA 2R58A 2DNUA 4Y92A 3OBYA 4V2SA 4M7DC 1WFWA 1AHJB 2HSEB 4QQ6A 1K9MC 5GANd 4OMLA 3JB9F 5FU6B 4AFZC 1OZ3A 2RF0A 1AWXA 3P8BB 2FZKB 3M0QA 4YTLA 2D8JA 3EH2A 2M9UA 3S3OA 1JO8A 3UF4A 2QXFA 3H0IA 5CKEA 1VQKA 4CC3A 2O31A 1SHGA 1QVGS 5IHIA 3PIOA 1GCQA 5A0DA 2KK4A 5D6YA 3V8LA 1XJWB 2RQUA 2X4YA 4J9GA 4RTXA 1FXXA 3HRTA 3QWYA 2EGEA 2EQJA 4WCIA 4J9IA 4BE0A 1WIEA 5CCAA 1SRLA 2J05A 3X25B 1M1FA 3G6ET 1ARKA 1UHCA 2KT8A 3MP1A 2XDPA 1WYXA 3G4SA 1OU8A 5EC7A 3KBGA 4C0DC 4ELYC 1FMWA 3FEOA 3QIIA 1S72T 3CMAA 2E64A 1NYGA 1IXDA 2LQ8A 3EHRA 1NLPC 2EJ9A 2XD0A 3A8OB 1K4US 3GNGA 4HT8A 3DB3A 2RJEA 1I4K1 3OYEA 5CIUA 4C5EA 1RADB 1E7OA 1NM7A 2K9GA 2MMPA 4C5HA 1VQ7T 2G6FX 4MDWA 5KCHA 2DJQA 3OYFA 3CCUA 3BY7A 4F7UE 3OW2A 2CP2A 1VQLQ 2ZPHB 4X34A 3QPHA 4OMQA 5GAN5 5AT1B 2JT4A 1YN8A 1UGPB 4PKCC 3AT1B 3CD6A 4J9DA 1M8VA 3A8LB 5LJ5e 1N9SA 2YLBA 4F04B 2HL3A 3BE3A 1C6VX 2CZ6B 2FO0A 5HK0A 2KRSA 2B86A 4PFZA 4ESRA 5GMKe 3VRZA 3P8DA 5GAMh 1QP3A 1KQSA 2RQRA 3A8HB 4KGVB 3EG3A 3M0PA 3A8GB 1D1AA 1Z9QA 2F5KA 5DY9A 4QT7A 1BKBA 1UUEA 2QASA 1IHVA 4M78C 1IGUA 3DB4A 2P84A 1VQMQ 3QDFA 5CKBA 4M7AC 3CCRQ 4M7DG 4FIBA 1M90C 1YJWQ 2VUBA 4M77A 2JVVA 4HVWA 3OYIA 1TWBA 2NUZA 5ECAA 5FU7B 2FVUA 1ZSZC 3OW2S 4AFQC 2WSFE 2DZ9A 2P4RA 3F70A 1Z9ZA 1GBQA 4M7DD 1FMVA 2DL7A 3L2UA 5GAMg 1GRIA 5CAIA 3J7AF 5D6XA 2E41A 3FIFA 4FW2A 4NOYA 3G71Q 5GAN8 3L2QA 2AKLA 1PKTA 3I56Q 1X75C 3WVDB 2RQTA 1YHQQ 1M90U 2GGRA 2JM8A 3CCEQ 2JNGA 2ZGWA 3QJ6A 5KYXB 4ZGEB 1MMAA 4N0AC 1OX8A 2CP0A 1KQSS 1KHIA 3I55Q 4KGXB 1QCNA 4QQGA 3CPWP 1M1GA 1RACB 2RHZA 2K79A 5I21A 8ATCB 2KYMA 2VASA 3HRSA 1KD1C 1UFFA 1VQLA 1BBZA 2YUOA 1QVFA 4RUGA 4QVCA 5GANg 4OMOA 3X28B 1FX7A 2MWPA 3META 1YI2T 3CXCP 4A4HA 3GP8A 2FG0A 1K9MR 1PWTA 2KDSA 4QVZA 3ZEHA 4C8QB 5KE2A 1B3QA 4QKUA 3H8ZA 2QGGA 4E47A 3CBMA 1Q81C 2AKKA 3GF5A 1YBYA 1K0SA 1GFCA 3QDRB 2LRQA 1HSQA 1W1FA 1X27A 1RLQC 3TEEA 4RTZA 1KD1U 1MNDA 4EIKA 4PJOC 4A4FA 4DOVA 2O01E 2COYA 4M77F 2A28A 2PVDB 4DEYA 1WXTA 3QO3A 5DLQE 1MNEA 5A0LA 5LJ3h 2MCNA 1SHFA 4B9WA 1TUDA 2DRMA 2QEXA 1VQMA 1NE8A 4M78G 1IGQA 3CCRA 1VQ5T 1ZSGA 1YJWA 4C92A 3NTHA 3QZ5B 1T3LA 4HVUA 2X35A 1Q81U 2GTOA 2XK0A 2BZYA 2M02A 1NPPA 2CZ0B 4C5IA 4M7AG 3CCLT 2BE7D 1BCOA 5LJ5j 1WLPB 3A8MB 4WTOB 1WQ7A 2HAXA 3R6OA 1QVFS 4M78D 2A08A 5LJ5f 1BK2A 4C92B 4JRKA 1D1CA 4ORZA 3JCMh 4C0FA 1RAHB 5IHNA 5GMKj 4M7AD 4OMFB 4OMMA 2GFUA 3FLGA 2CP7A 2L89A 4J9FA 1B34A 3V8JA 2DPPB 3WXMB 3I56A 2RD1A 1GL5A 1YHQA 1X6BA 2P0PA 4EMKC 1YCYA 4J9CA 3CCEA 9ATCB 2HKNA 2B8AA 3OYGA 2Y4YA 1K8AC 4M7DF 2PUKB 4L59A 1KHCA 4A4KA 2DD4A 2JXBA 3I55A 1N27A 3A98A 1O9SA 4GBQA 4HT9A 2K4YA 2FZCB 2MAMA 2DK3A 3L1AA 1B34B 2XIDA 1GCQC 3PVQA 3P8HA 3VKIA 2M51A 1V29B 2RQWA 3EG0A 2YLCA 4ELZC 1ABQA 3JCMJ 6AT1B 1K0XA 2EBPA 1ZBXA 3M53A 2EQIA 1NEBA 5GAOl 1QCFA 3D7SB 1KIKA 1PKSA 4R56A 2VC8A 2ABLA 2LQNA 2LC4A 2ZAEA 3AHUA 1OZ2A 3RIRA 1M90R 1D0YA 3PGGA 2LNVA 2VGNA 3I5RA 3LW5E 2FPEA 1KC8C 1K8AU 2E10A 4M75G 3VS0A 1JJ2P 4PJOE 4FW1A 2MIOA 4ATOA 2RN8A 1WJRA 5GAN7 1WA7A 1LNXA 2K5LA 3OYDA 1G83A 3L2ZA 2RHYA 4PJJA 5CO7A 1WJSA 5IH2A 1PHTA 2E3IA 2F2WA 2O9VA 1UB4A 4PJOG 3OYYA 2YT6A 4PJLA 1UDLA 2LQWA 3X20B 2RH2A 2RM4A 4GY5A 1VQ9Q 1D3BA 1VQNQ 4UC4A 2JN0A 4J6YA 3ZL7C 1AD5A 2NLUA 4P5NA 1VA7A 2HMAA 2L8DA 2KXDA 4J5YA 5IHKA 4E6RA 4LDYA 1OYXA 4TVRA 1XNIA 3PMTA 3C94A 4PJOD 1QWFA 3MP8A 1FYNA 1U1TA 5FLXE 1NYFA 1OPLA 2LDMA 3M4GA 1KD1R 1D3BB 3G71T 1TTHB 2LVMA 2JZ2A 1AZEA
chains in the Genus database with same CATH topology
1OX8A 2NYSA 1YFNA 1OU8A 1OULA 1TWBA 1ZSZB 1ZSZA 1OX9A 2QAZA 2QASA 1OU9A 1ZSZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OX8 A;  2NYS A;  1YFN A;  1OU8 A;  1OUL A;  1TWB A;  1ZSZ B;  1ZSZ A;  1OX9 A;  2QAZ A;  2QAS A;  1OU9 A;  1ZSZ C; 
#chains in the Genus database with same CATH topology
 4HCB A;  1OEB A;  3G6E A;  3I56 T;  4N4H A;  2JTF A;  1QQJ A;  3CCJ T;  4LDV A;  1M3B A;  3SWN A;  4RG8 A;  1IB8 A;  3CCQ T;  3M0R A;  3X26 B;  3HSB A;  2GBQ A;  1JQQ A;  2CGH A;  1IRE B;  3U23 A;  3CC7 Q;  1Q81 R;  4M78 F;  1IHW A;  3VS3 A;  4HCC A;  4DOW A;  3CPW A;  4IIM A;  4DBR A;  2AZV A;  3SWN B;  2WSE E;  1XTD A;  1Y7X A;  3QSU A;  1D0X A;  5L23 A;  1UGV A;  1R77 A;  2F1L A;  4M4Z A;  3CC4 Q;  1W70 A;  2COW A;  4BD3 A;  3CXC A;  1D09 B;  3MEA A;  3GIB A;  2XHC A;  2H3E B;  1YI2 Q;  2DMO A;  1QVP A;  1YWP A;  3CME T;  3PT9 A;  2A7Y A;  2QQ9 A;  3M9Q A;  1OQK A;  1WXU A;  2OTJ T;  4RG2 A;  1G3Y A;  5FRN A;  2FL7 A;  1ZBJ A;  1NG2 A;  4XU3 A;  1UE9 A;  2K3Y A;  5GAO r;  3CQT A;  2RA2 A;  2YRD A;  4E7I A;  3E2U A;  3M5A A;  2RI5 A;  5GAO m;  2KQW A;  1WHG A;  3LYI A;  2KAF A;  2HKQ B;  2V26 A;  1X43 A;  1MMD A;  4PFO A;  1JU5 C;  3L2V A;  3OS5 A;  4C8Q C;  1N5Z A;  4ME7 A;  4Z88 A;  3UA6 A;  2I2L A;  2MK5 A;  2OTL Q;  5AYF A;  1Y71 A;  1Y57 A;  2E6Z A;  5CKD A;  3JCM V;  5FRM A;  2NUT A;  3OS1 A;  2ED0 A;  2YWW A;  4ZN3 A;  2DKG A;  2IVW A;  3LH5 A;  1BIB A;  5KYY A;  1VQ9 A;  1VQ5 Q;  1VQN A;  3VJP A;  4QVD A;  2ROL A;  4Y28 E;  4XU0 A;  1WXB A;  4A63 B;  3CPW S;  1Y96 A;  1K8A R;  3CCL Q;  3QHS A;  3EG1 A;  4MZM A;  1WHH A;  4LE9 A;  4M75 F;  3JCM X;  4NL3 A;  1H3H A;  5KYY B;  3DKM A;  1K9M U;  3CXC S;  1KJW A;  3FJP A;  3FB9 A;  4VUB A;  4ANJ A;  2E3H A;  2EQK A;  5FRO A;  1Y96 B;  2JS2 A;  3BDL A;  4JZ3 A;  3SEM A;  2HD0 A;  3SDZ A;  4F17 A;  2KRM A;  1HXD A;  4IUT A;  2CP5 A;  3VS5 A;  3QXE B;  5GMK l;  1UEC A;  1PC0 A;  2W0Z A;  5HKC A;  1FWZ A;  2FRW A;  3NTK A;  4K11 A;  1ZHI A;  3CC7 A;  4FCY A;  4OB1 B;  2KT1 A;  3RER A;  3JCM W;  4IUQ A;  2AHJ B;  3G7Z A;  1KC8 R;  4XTU A;  3HFN A;  2J6O A;  3VS1 A;  2DER A;  3WVE B;  4HCZ A;  5LJ5 d;  2P4T A;  2M16 A;  3OSS C;  1BIA A;  2M1H A;  4LUE A;  4Z02 A;  4XQ3 A;  1LPL A;  3CC4 A;  1ZUK A;  4F7U G;  1MMN A;  4RTW A;  1YI2 A;  2PQW A;  2CYZ B;  1KQ2 A;  2K5I A;  3V8K A;  2DIL A;  2VB6 A;  3TCJ A;  1OPK A;  3S3N A;  1SKU B;  4BI8 B;  1OI1 A;  4F16 A;  3V7R A;  3RKY A;  2XIC A;  2L3Q A;  4RCC A;  2WSC E;  3OS2 A;  2QG9 B;  3RR6 A;  2MWO A;  4FSX A;  3TQ7 P;  1Y07 A;  1JJ2 A;  4D8K A;  3JB9 I;  1BYM A;  2BIV A;  4C8Q E;  2SEM A;  2H8H A;  4N4G A;  3VS6 A;  5IT9 E;  2QGF B;  4PJN A;  2E5K A;  3C95 A;  1VYT A;  2JM9 A;  1VQO T;  1Q7Y C;  4BI3 A;  3J80 E;  2QTV A;  4O5V A;  2JJ9 A;  1VQ9 T;  5GAO p;  1VQN T;  2RI2 A;  3GBQ A;  4C8Q G;  4CC7 A;  2W10 A;  2G3R A;  3EH1 A;  3DLL A;  3SB2 A;  3L2R A;  4JPB W;  5GAN h;  3LGL A;  2BZ8 A;  4PFP A;  1VQ5 A;  2FHD A;  5A0G A;  2EQM A;  3EG2 A;  4E2F B;  2GF7 A;  3OYM A;  2LCC A;  3TSZ A;  4RTY A;  4BY6 C;  3CCL A;  1VQ8 Q;  4J9H A;  1VYV A;  2DXT A;  3CC2 T;  3GLX A;  4C8Q D;  3ER0 A;  3O5Z A;  4JLI A;  4M77 B;  3ME9 A;  1U5S A;  2J7I A;  1G2B A;  2YUQ A;  2LQK A;  3JCM e;  2DET A;  1Q7Y U;  1YCS B;  1TUC A;  4PLL A;  1DJ7 B;  2FPF A;  1YIJ Q;  3S6W A;  3OYL A;  1U06 A;  3CCJ Q;  1W6X A;  2RI3 A;  2CUD A;  3CC7 T;  2A36 A;  2H3J A;  2EYQ A;  3CCQ Q;  2XMF A;  3EGD A;  1AT1 B;  4XAX B;  5DM7 R;  4OP0 A;  3RNJ A;  3EGU A;  4C92 E;  3PNW C;  1NJI C;  2DYI A;  2C06 A;  2VV5 A;  5KCO A;  4BI4 A;  1JJ2 S;  3H6Z A;  2GFA A;  1QVG P;  3GNF B;  3CC4 T;  3FC3 A;  1HYO A;  3EGD B;  4JUV A;  1G3S A;  5IAY A;  2DEU A;  5GMK m;  3MPU B;  1G8X A;  1ZLM A;  1EIF A;  4M7D A;  1BCM A;  2FRY A;  1PG5 B;  2P0Q A;  1ZQ1 A;  4DBQ A;  5J3B A;  5LJ5 h;  1BU1 A;  1VQ4 Q;  1PM3 A;  1V1C A;  3CME Q;  4X9D A;  1UG1 A;  3V7C A;  4E7S A;  5GAO n;  3SWN C;  2OTJ Q;  1W2B P;  2DA9 A;  3X24 B;  1EZZ B;  4M7D B;  2MYS A;  1VIF A;  2RQV A;  2LX9 A;  1I81 A;  2CZ7 B;  2E1H A;  1RUW A;  3EGX A;  4CI0 C;  4ZN1 A;  5GMK h;  3CBO A;  1HK9 A;  2DVE A;  1NEG A;  1PCX A;  2OTL T;  2MPX C;  1H3Z A;  4KBM B;  2OJ2 A;  2CRE A;  4CRI A;  1JEG A;  3PTA A;  5LL6 S;  2P0K A;  1RAE B;  2LTO A;  3EGX B;  3SFM A;  1PD0 A;  1WPY A;  5FWB A;  2FB7 A;  4F7U F;  4Z89 A;  1TS9 A;  1RAB B;  1E6H A;  1H64 1;  2LCL A;  5FWC A;  3BDU A;  3H0F A;  3RMS A;  3C4S A;  1C1A A;  1X6G A;  2L3S A;  1M3A A;  4PK4 A;  2C0I A;  2WAC A;  4IUU A;  1H8K A;  2BZX A;  2DX1 A;  5LJ5 g;  2COZ A;  1MUZ A;  5FU6 C;  1VQ8 A;  2MF2 A;  3H41 A;  2KE9 A;  5CR2 A;  2LT4 A;  3PFS A;  3L2W A;  2YUP A;  4C0Z A;  2KSS A;  1WNL A;  2D6F A;  3G71 A;  2KNB B;  4J7I A;  2XG8 D;  3Q1J A;  4IUP A;  3OB9 A;  1I8F A;  3M54 A;  2DL5 A;  2HQX A;  3E1S A;  4AFS C;  1C0M A;  1WHM A;  2AK5 A;  1YIJ A;  2FEI A;  2KY9 A;  3CCJ A;  3VYH B;  2ENM A;  3CCQ A;  2M0Y A;  1HD3 A;  1K9A A;  2L2P A;  2HSP A;  4ZGD B;  1AWW A;  5GAN 2;  1TXQ A;  4XTZ A;  4FU6 A;  1MMG A;  4B9X A;  3RBB B;  3OS0 A;  5CVI A;  4BAC A;  2EKH A;  1MGQ A;  2CT3 A;  4LDX A;  2F5T X;  2EYX A;  1WGS A;  2R5M A;  4X9C A;  2CDT A;  2CSI A;  3THK A;  2D0Q B;  4M78 A;  3KUF A;  4PJM A;  1SSF A;  4C0G A;  4MDX A;  1M5Q 1;  3JB9 G;  1ACM B;  1X2K A;  4JLG A;  2KBT A;  3MEU A;  3CCV T;  1P92 A;  5L8R E;  4OB0 B;  1Q7Y R;  2DL8 A;  4L6V 5;  1EX4 A;  4M7A A;  1X01 A;  4DEX A;  3OYC A;  1VQ4 A;  3CME A;  4EPC A;  1UGS B;  4GLK A;  2DZC A;  1LVK A;  1WZO A;  1CKA A;  2OTJ A;  4M78 B;  4EMH A;  1KSW A;  2QYZ A;  4QQD A;  1BI3 A;  3JB9 D;  4XU2 A;  2CH4 A;  1X69 A;  1PRM C;  2EGA A;  1JXM A;  2EYZ A;  2LZ6 B;  3N5B B;  2KMT A;  4IKF A;  4M7A B;  1X2Q A;  3JCM f;  3CCS T;  3QWX X;  2XI9 A;  5GAN 4;  1XOV A;  2LJ1 A;  3FDR A;  4KUI A;  2DVJ A;  2DTH A;  2K6D A;  4E7K A;  2OI3 A;  1YIT T;  2NWM A;  3UT1 A;  3OYK A;  3C12 A;  4KRT A;  4BE1 A;  1VQO Q;  3VV0 A;  2PVO B;  2QQA A;  1JXO A;  4R55 A;  4J8O A;  1ZA2 B;  2JTM A;  1G3T A;  4FYW B;  3HRU A;  3LX7 A;  2CP3 A;  3NFC A;  1VQP Q;  1KC8 U;  4O6J A;  2X4W A;  2QDY B;  4N0A A;  2JUF A;  3TRE A;  1VQ8 T;  5CQY A;  1VQK Q;  2ZPI B;  4DA4 A;  1ZUY A;  1NJI R;  2J6K A;  4LN2 A;  1WQW A;  2EVR A;  2RNA A;  2DF6 A;  2E70 A;  3E9F A;  4HA8 A;  2M0O A;  4LDU A;  5EG2 A;  2LNH B;  2RHU A;  2K57 A;  3CC2 Q;  2F2V A;  1BI0 A;  4ZNX A;  1YIJ T;  3CEY A;  1KK7 A;  2DJZ A;  2ZPE B;  3RES A;  2JMA A;  2V8I A;  1KFZ A;  2I0N A;  2RHI A;  2EAY A;  3OYB A;  1BI1 A;  3G4S Q;  1WHK A;  5FU7 C;  3J81 E;  4M75 A;  3R6N A;  1YJ9 Q;  4A54 A;  2BUD A;  3LGF A;  3CMA Q;  2PTK A;  3MEV A;  3QJY A;  3ULR B;  1IZ6 A;  2O88 A;  1RAA B;  3HKS A;  2X9H A;  1RI9 A;  2K5F A;  4M77 C;  3CCM Q;  1RL2 A;  3QKJ A;  2HL5 C;  1EFN A;  4PL6 A;  4HKE A;  3VS7 A;  1QLY A;  4M7A F;  3CCU Q;  4M75 B;  3TU4 K;  4X1V A;  3PVL A;  1RAI B;  1M30 A;  3QBY A;  2PUO B;  4XU1 A;  1VQ4 T;  2KI7 A;  2NUP A;  3VUB A;  2GCX A;  1SF9 A;  3CD6 Q;  1VIE A;  1SRM A;  4OVA A;  3I35 A;  1ABO A;  2HQE A;  2LMJ A;  2LJ3 A;  2A0F B;  2VKN A;  2DIQ A;  2QAZ A;  3QZ9 B;  1U3O A;  2E5Q A;  3UPU A;  2OX7 A;  5GAM e;  2KR3 A;  4PLI A;  1W2B A;  2CH4 W;  3GOX A;  3PE0 A;  4DBF A;  4BB7 A;  4F14 A;  4XTX A;  3ZBD A;  2NUP B;  1ZX6 A;  1TH7 A;  2FZG B;  1BB9 A;  1TUG B;  2CP6 A;  2EQU A;  3GPL A;  1AWJ A;  4D8D A;  4XK8 E;  5D6W A;  2XKO C;  4Q5W A;  3SD4 A;  4J9E A;  2DTO A;  2EPD A;  3EFS A;  4JJN K;  1S1N A;  3VYG A;  2VWF A;  3VUZ A;  1M2V A;  1D0Z A;  4J6W A;  2ZPB B;  4RMO A;  2X3W D;  4C5G A;  2EKO A;  2RO0 A;  1VQO A;  1VQ6 T;  2IPO B;  4RCB A;  3JSC A;  3ZFJ A;  5A2Q E;  3OYH A;  1UHF A;  4MMK A;  3OYA A;  3MKD A;  5GAN e;  2K2M A;  1H92 A;  4EMK A;  1PSE A;  2AZS A;  2EFI A;  2EYW A;  1GFD A;  2A37 A;  1T0J A;  2EWN A;  3UAT A;  1Q82 C;  2K3X A;  1VQP A;  4LXC A;  3RMQ A;  4HCK A;  1M2V B;  4JZ4 A;  3REA B;  2NUT B;  3HP9 A;  5CQX A;  2K2V A;  2ED1 A;  4JJC A;  5GMK i;  1SPK A;  2RJF A;  3EFR A;  3M0U A;  1YP5 A;  4AG1 C;  1JBM A;  1OUL A;  4OF1 A;  2KRO A;  1U1S A;  4EMK B;  3CC2 A;  1WJQ A;  1TG0 A;  3RKW A;  2L3R A;  3SHW A;  1R0C B;  4MML A;  1QKW A;  1LCK A;  2XU8 A;  3MEW A;  1AEY A;  3LLR A;  2OAW A;  3T9N A;  2GTJ A;  1AVZ C;  2KVQ G;  4PJO F;  1I07 A;  4AT1 B;  3LWI A;  4OGC A;  1UGR B;  1MV3 A;  2BE9 B;  4BE2 A;  1YJ9 A;  3M59 A;  4CC2 A;  5KYW A;  4M77 E;  1W2B S;  4ZTF A;  4C92 C;  1PNJ A;  1Q82 U;  3DLM A;  3G1J A;  1K76 A;  3OYJ A;  3L42 A;  3CCM A;  2X3X D;  1UTI A;  2QQR A;  1TSF A;  1R8O B;  1M2O A;  2LP5 A;  2DYB A;  3C0C A;  2QTX A;  4M77 G;  2CS7 A;  5KYW B;  3HL8 A;  4JDS A;  4A4G A;  3NPF A;  3QUI A;  1LOJ A;  2CKK A;  4ZTJ A;  2DIG A;  4EMG A;  1UJ0 A;  4KT0 E;  2ZPG B;  2QA4 Q;  1J3T A;  2HBW A;  1ZA1 B;  3CCV Q;  3EG9 A;  2BKD N;  2VXF A;  3MP6 A;  2MI6 A;  1KG1 A;  3MCA B;  5IN1 A;  2ECZ A;  2DE0 X;  1UJY A;  3QG1 A;  4M77 D;  4MZP A;  3JCM b;  4GLM A;  3BW1 A;  3RUX A;  2R57 A;  2PZ1 A;  4FL6 A;  2YUN A;  1N8R C;  5GAN 3;  3EG9 B;  1AWO A;  4XTY A;  4EDU A;  3OY9 A;  1B7T A;  4IIO A;  4A53 A;  2CUB A;  2X4J A;  2JOY A;  4RTU A;  3MJX A;  3M55 A;  5LJ3 d;  3CCS Q;  2EYY A;  2OTL A;  1HJD A;  2HQH A;  5C6S A;  4BDZ A;  5LJ3 e;  1PD1 A;  1W4S A;  4RKU E;  3TVT A;  3REB B;  4PNO A;  4II1 A;  4JS4 A;  2C0T A;  4M7D E;  4FYY B;  1GBR A;  1YIT Q;  2HDA A;  1FMK A;  2L3P A;  5C0M A;  1VQP T;  1N9R A;  5KE3 A;  1YJN Q;  1SG5 A;  1OOT A;  1QP2 A;  4NS5 A;  4OB3 B;  1VQK T;  1KQ1 A;  3OBW A;  1I5O B;  2QEX Q;  2DL4 A;  3EFO A;  4J9B A;  1A0N B;  2RK1 A;  4J7F A;  4B6M A;  3ASK A;  4HVV A;  2HBP A;  2GQI A;  1VUB A;  3JCM c;  1D1B A;  2YRV A;  4F7U A;  3OYN A;  1N8R U;  1QCO A;  4FSS A;  4L5G A;  3JCM d;  4RTV A;  3CPF A;  1M1K C;  3EFO B;  3G4S T;  2EGC A;  5CK9 A;  2MOX A;  5GAM j;  4XTW A;  3LH0 A;  3UA7 A;  3I5S A;  1YJ9 T;  1RLP C;  5KYX A;  2OAU A;  1M27 C;  2CSQ A;  3CMA T;  1CKB A;  3OSV A;  2A3L A;  2PU9 B;  2K3B A;  5GAM f;  4F7U B;  2DAQ A;  5D7U A;  1M8M A;  4LDW A;  3CCM T;  2RJD A;  3CBP A;  3NGP A;  1AOJ A;  2RJC A;  5HCK A;  2XDB A;  2ROT A;  3CCU T;  1U8R A;  2DO3 A;  2HZY A;  2IIM A;  4LUD A;  2FYK A;  4C92 G;  2GNC A;  3E19 A;  1JB0 E;  2JTE A;  4KUL A;  1K73 C;  1M9S A;  4OMN A;  4C8Q A;  3M56 A;  3UWN A;  4FT2 A;  3CD6 T;  5GAN j;  3JCM P;  1M1K U;  4QW2 A;  1OU9 A;  2HCK A;  1QMC A;  5GAN f;  5HY6 A;  2CT4 A;  2QA4 A;  3CCV A;  3VRY A;  1I1J A;  3A5Z B;  2YSQ A;  2DD5 A;  3NHN A;  5GJV B;  4C92 D;  1T0H A;  2RHX A;  3QYG B;  2RPN A;  1NJI U;  2DRK A;  2ATC B;  4D6W A;  1V76 A;  4FM4 B;  5HK3 A;  3E9G A;  4M75 C;  2QQS A;  4J6X A;  4AFU C;  1Q82 R;  4E7J A;  3RDV A;  2LJ0 A;  2C0O A;  2ESW A;  1Q86 C;  3M4Y A;  4WF2 A;  4OGE A;  3QYH B;  4LD9 K;  4A4E A;  3EHQ A;  2DFU A;  2DLP A;  2R5A A;  1K73 U;  3HTR A;  3V7S A;  3VU3 C;  3CCS A;  4M78 E;  5KYU A;  2Y90 A;  3EAE A;  1YIT A;  5DLO A;  5CKF A;  4KUD K;  1VOM A;  2Y4X A;  1R0B G;  1VQ6 Q;  3BFM A;  4M7A E;  3M57 A;  1YJN A;  3M0T A;  4R0K A;  3UDC A;  4Z8A A;  1WX6 A;  1WHJ A;  4C0D B;  1G5V A;  2F69 A;  2DXB A;  4E7H A;  2DXC A;  4KH0 B;  5I2M A;  2PVG B;  4AMC A;  5KYU B;  2KYB A;  2VVK A;  7AT1 B;  5KYN A;  4RTT A;  2LCS A;  1Q86 U;  3NMZ C;  3JB9 J;  2RMO A;  4JS5 A;  2E12 A;  1Q95 G;  2D8H A;  3H9N A;  5GJW B;  3JAM E;  1YNZ A;  4DQ2 A;  5CKH A;  5I2S A;  1M4Z A;  2RB6 A;  2V1Q A;  2CZ1 B;  3VS4 A;  5M9O A;  4FYV B;  3G6E Q;  2QK0 A;  5KH6 A;  2DM1 A;  3M0S A;  3PMI A;  4C8Q F;  3O8V A;  3H0H A;  3OQ5 A;  1S72 Q;  2YRC A;  2E65 A;  2D9T A;  2F2X A;  5LJ3 j;  2D1X A;  4IUR A;  4ZGJ B;  5J26 A;  5GAO q;  1UGQ B;  5LJ3 g;  4MZT A;  5I11 A;  1VQL T;  3OW2 P;  5LJ3 f;  1BI2 A;  2XDD A;  1N8R R;  4AG2 C;  2ZZD A;  2LX7 A;  4KGZ B;  1VQ7 Q;  2QA4 T;  3JV3 A;  3RKX A;  1NBE B;  2ZCF B;  1NPR A;  1VYU A;  3JCM Q;  1O75 A;  2K7A A;  1N6A A;  2YDL A;  2JMC A;  3URG A;  2L5Q A;  2LT1 A;  4BUG A;  2L0A A;  1AZG B;  3LWH A;  1MHN A;  1OV3 A;  4FT4 A;  3HFO A;  4M75 E;  1PSF A;  2KRN A;  1RAF B;  4HXJ A;  1NLO C;  3FRN A;  2AIR B;  2O9S A;  1ZSZ A;  3HPW A;  3VS2 A;  4Y91 A;  3JCM g;  1KQS P;  3KXT A;  2FPD A;  2EIF A;  2DBM A;  2GQV A;  1F1B B;  1B07 A;  2HNI A;  1JRI A;  3A1P A;  1IRX A;  2QI2 A;  2V8K A;  4FYX B;  4JJB A;  1ZSZ B;  3FJ5 A;  1M1K R;  3OMG A;  4C92 F;  1QW1 A;  3M58 A;  2DTI A;  1YJN T;  5GAN 6;  4OB2 B;  2EJG A;  4LNP A;  2KEA A;  2QEX T;  3NTI A;  1VQM T;  4CC4 B;  2V8J A;  4BY6 B;  4E7Z A;  2SRC A;  3CCR T;  2DBK A;  2BTT A;  1VQ6 A;  1YJW T;  5IXF A;  1SSH A;  3MHX A;  4NL2 A;  4M75 D;  1WHL A;  2IG0 A;  3JRZ A;  5J39 A;  1PRL C;  2VXE A;  1WI7 A;  3I9Q A;  2YHT A;  4LD6 A;  8AT1 B;  2YXY A;  3HHT B;  2KXC A;  2RK2 A;  4JRP A;  2QDL A;  2DXU A;  2JS0 A;  1K73 R;  1I5L A;  1OX9 A;  2EJF A;  2V1R A;  2X51 A;  1RAG B;  2O2O A;  3OA6 A;  1QWE A;  2DEQ A;  1XQH A;  3PIP A;  3KFV A;  2X4X A;  1YHQ T;  3JB9 H;  3CCE T;  4JRI A;  2HEQ A;  1S72 A;  2J6F A;  4IUV A;  1QVG A;  3I55 T;  4XTV A;  1MV0 B;  2AT1 B;  2J06 A;  5IXB A;  4PJO A;  2NYS A;  4DBH A;  2E6N A;  2O4X A;  1Q86 R;  2VGM A;  2QQB A;  1QVF P;  1UEB A;  1VQ7 A;  1QKX A;  4OMP A;  1YFN A;  5FW9 A;  1M3C A;  4E7L A;  1Y0M A;  4BDY A;  1NZ9 A;  4KH1 B;  2KGT A;  2Z0W A;  1RI0 A;  4PJO B;  2VYT A;  2JW4 A;  5GAM d;  4JRQ A;  3INZ A;  3MO8 A;  2O4X B;  2DL3 A;  5I22 A;  1LJO A;  1T3S A;  4J83 A;  1I0C A;  3TSW A;  1SEM A;  2PNI A;  2EW3 A;  1X6O A;  1TU0 B;  2ZPF B;  1YWO A;  1TOV A;  1CSK A;  2E4H A;  1GCP A;  3IQL A;  2D0N A;  1E6G A;  1K1Z A;  1GXI E;  1G3W A;  1WDX A;  4JJD A;  4N4I A;  1ZUU A;  1IO6 A;  3S3M A;  3OMC A;  2R58 A;  2DNU A;  4Y92 A;  3OBY A;  4V2S A;  4M7D C;  1WFW A;  1AHJ B;  2HSE B;  4QQ6 A;  1K9M C;  5GAN d;  4OML A;  3JB9 F;  5FU6 B;  4AFZ C;  1OZ3 A;  2RF0 A;  1AWX A;  3P8B B;  2FZK B;  3M0Q A;  4YTL A;  2D8J A;  3EH2 A;  2M9U A;  3S3O A;  1JO8 A;  3UF4 A;  2QXF A;  3H0I A;  5CKE A;  1VQK A;  4CC3 A;  2O31 A;  1SHG A;  1QVG S;  5IHI A;  3PIO A;  1GCQ A;  5A0D A;  2KK4 A;  5D6Y A;  3V8L A;  1XJW B;  2RQU A;  2X4Y A;  4J9G A;  4RTX A;  1FXX A;  3HRT A;  3QWY A;  2EGE A;  2EQJ A;  4WCI A;  4J9I A;  4BE0 A;  1WIE A;  5CCA A;  1SRL A;  2J05 A;  3X25 B;  1M1F A;  3G6E T;  1ARK A;  1UHC A;  2KT8 A;  3MP1 A;  2XDP A;  1WYX A;  3G4S A;  1OU8 A;  5EC7 A;  3KBG A;  4C0D C;  4ELY C;  1FMW A;  3FEO A;  3QII A;  1S72 T;  3CMA A;  2E64 A;  1NYG A;  1IXD A;  2LQ8 A;  3EHR A;  1NLP C;  2EJ9 A;  2XD0 A;  3A8O B;  1K4U S;  3GNG A;  4HT8 A;  3DB3 A;  2RJE A;  1I4K 1;  3OYE A;  5CIU A;  4C5E A;  1RAD B;  1E7O A;  1NM7 A;  2K9G A;  2MMP A;  4C5H A;  1VQ7 T;  2G6F X;  4MDW A;  5KCH A;  2DJQ A;  3OYF A;  3CCU A;  3BY7 A;  4F7U E;  3OW2 A;  2CP2 A;  1VQL Q;  2ZPH B;  4X34 A;  3QPH A;  4OMQ A;  5GAN 5;  5AT1 B;  2JT4 A;  1YN8 A;  1UGP B;  4PKC C;  3AT1 B;  3CD6 A;  4J9D A;  1M8V A;  3A8L B;  5LJ5 e;  1N9S A;  2YLB A;  4F04 B;  2HL3 A;  3BE3 A;  1C6V X;  2CZ6 B;  2FO0 A;  5HK0 A;  2KRS A;  2B86 A;  4PFZ A;  4ESR A;  5GMK e;  3VRZ A;  3P8D A;  5GAM h;  1QP3 A;  1KQS A;  2RQR A;  3A8H B;  4KGV B;  3EG3 A;  3M0P A;  3A8G B;  1D1A A;  1Z9Q A;  2F5K A;  5DY9 A;  4QT7 A;  1BKB A;  1UUE A;  2QAS A;  1IHV A;  4M78 C;  1IGU A;  3DB4 A;  2P84 A;  1VQM Q;  3QDF A;  5CKB A;  4M7A C;  3CCR Q;  4M7D G;  4FIB A;  1M90 C;  1YJW Q;  2VUB A;  4M77 A;  2JVV A;  4HVW A;  3OYI A;  1TWB A;  2NUZ A;  5ECA A;  5FU7 B;  2FVU A;  1ZSZ C;  3OW2 S;  4AFQ C;  2WSF E;  2DZ9 A;  2P4R A;  3F70 A;  1Z9Z A;  1GBQ A;  4M7D D;  1FMV A;  2DL7 A;  3L2U A;  5GAM g;  1GRI A;  5CAI A;  3J7A F;  5D6X A;  2E41 A;  3FIF A;  4FW2 A;  4NOY A;  3G71 Q;  5GAN 8;  3L2Q A;  2AKL A;  1PKT A;  3I56 Q;  1X75 C;  3WVD B;  2RQT A;  1YHQ Q;  1M90 U;  2GGR A;  2JM8 A;  3CCE Q;  2JNG A;  2ZGW A;  3QJ6 A;  5KYX B;  4ZGE B;  1MMA A;  4N0A C;  1OX8 A;  2CP0 A;  1KQS S;  1KHI A;  3I55 Q;  4KGX B;  1QCN A;  4QQG A;  3CPW P;  1M1G A;  1RAC B;  2RHZ A;  2K79 A;  5I21 A;  8ATC B;  2KYM A;  2VAS A;  3HRS A;  1KD1 C;  1UFF A;  1VQL A;  1BBZ A;  2YUO A;  1QVF A;  4RUG A;  4QVC A;  5GAN g;  4OMO A;  3X28 B;  1FX7 A;  2MWP A;  3MET A;  1YI2 T;  3CXC P;  4A4H A;  3GP8 A;  2FG0 A;  1K9M R;  1PWT A;  2KDS A;  4QVZ A;  3ZEH A;  4C8Q B;  5KE2 A;  1B3Q A;  4QKU A;  3H8Z A;  2QGG A;  4E47 A;  3CBM A;  1Q81 C;  2AKK A;  3GF5 A;  1YBY A;  1K0S A;  1GFC A;  3QDR B;  2LRQ A;  1HSQ A;  1W1F A;  1X27 A;  1RLQ C;  3TEE A;  4RTZ A;  1KD1 U;  1MND A;  4EIK A;  4PJO C;  4A4F A;  4DOV A;  2O01 E;  2COY A;  4M77 F;  2A28 A;  2PVD B;  4DEY A;  1WXT A;  3QO3 A;  5DLQ E;  1MNE A;  5A0L A;  5LJ3 h;  2MCN A;  1SHF A;  4B9W A;  1TUD A;  2DRM A;  2QEX A;  1VQM A;  1NE8 A;  4M78 G;  1IGQ A;  3CCR A;  1VQ5 T;  1ZSG A;  1YJW A;  4C92 A;  3NTH A;  3QZ5 B;  1T3L A;  4HVU A;  2X35 A;  1Q81 U;  2GTO A;  2XK0 A;  2BZY A;  2M02 A;  1NPP A;  2CZ0 B;  4C5I A;  4M7A G;  3CCL T;  2BE7 D;  1BCO A;  5LJ5 j;  1WLP B;  3A8M B;  4WTO B;  1WQ7 A;  2HAX A;  3R6O A;  1QVF S;  4M78 D;  2A08 A;  5LJ5 f;  1BK2 A;  4C92 B;  4JRK A;  1D1C A;  4ORZ A;  3JCM h;  4C0F A;  1RAH B;  5IHN A;  5GMK j;  4M7A D;  4OMF B;  4OMM A;  2GFU A;  3FLG A;  2CP7 A;  2L89 A;  4J9F A;  1B34 A;  3V8J A;  2DPP B;  3WXM B;  3I56 A;  2RD1 A;  1GL5 A;  1YHQ A;  1X6B A;  2P0P A;  4EMK C;  1YCY A;  4J9C A;  3CCE A;  9ATC B;  2HKN A;  2B8A A;  3OYG A;  2Y4Y A;  1K8A C;  4M7D F;  2PUK B;  4L59 A;  1KHC A;  4A4K A;  2DD4 A;  2JXB A;  3I55 A;  1N27 A;  3A98 A;  1O9S A;  4GBQ A;  4HT9 A;  2K4Y A;  2FZC B;  2MAM A;  2DK3 A;  3L1A A;  1B34 B;  2XID A;  1GCQ C;  3PVQ A;  3P8H A;  3VKI A;  2M51 A;  1V29 B;  2RQW A;  3EG0 A;  2YLC A;  4ELZ C;  1ABQ A;  3JCM J;  6AT1 B;  1K0X A;  2EBP A;  1ZBX A;  3M53 A;  2EQI A;  1NEB A;  5GAO l;  1QCF A;  3D7S B;  1KIK A;  1PKS A;  4R56 A;  2VC8 A;  2ABL A;  2LQN A;  2LC4 A;  2ZAE A;  3AHU A;  1OZ2 A;  3RIR A;  1M90 R;  1D0Y A;  3PGG A;  2LNV A;  2VGN A;  3I5R A;  3LW5 E;  2FPE A;  1KC8 C;  1K8A U;  2E10 A;  4M75 G;  3VS0 A;  1JJ2 P;  4PJO E;  4FW1 A;  2MIO A;  4ATO A;  2RN8 A;  1WJR A;  5GAN 7;  1WA7 A;  1LNX A;  2K5L A;  3OYD A;  1G83 A;  3L2Z A;  2RHY A;  4PJJ A;  5CO7 A;  1WJS A;  5IH2 A;  1PHT A;  2E3I A;  2F2W A;  2O9V A;  1UB4 A;  4PJO G;  3OYY A;  2YT6 A;  4PJL A;  1UDL A;  2LQW A;  3X20 B;  2RH2 A;  2RM4 A;  4GY5 A;  1VQ9 Q;  1D3B A;  1VQN Q;  4UC4 A;  2JN0 A;  4J6Y A;  3ZL7 C;  1AD5 A;  2NLU A;  4P5N A;  1VA7 A;  2HMA A;  2L8D A;  2KXD A;  4J5Y A;  5IHK A;  4E6R A;  4LDY A;  1OYX A;  4TVR A;  1XNI A;  3PMT A;  3C94 A;  4PJO D;  1QWF A;  3MP8 A;  1FYN A;  1U1T A;  5FLX E;  1NYF A;  1OPL A;  2LDM A;  3M4G A;  1KD1 R;  1D3B B;  3G71 T;  1TTH B;  2LVM A;  2JZ2 A;  1AZE A; 
#chains in the Genus database with same CATH homology
 1OX8 A;  2NYS A;  1YFN A;  1OU8 A;  1OUL A;  1TWB A;  1ZSZ B;  1ZSZ A;  1OX9 A;  2QAZ A;  2QAS A;  1OU9 A;  1ZSZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...