1ZSZB

Crystal structure of a computationally designed sspb heterodimer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
SSPKRPYLLRSLYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGAMFEPEEIYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity versus stability in computational protein design.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags De novo protein
molecule keywords Stringent starvation protein B homolog
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1zszB00
2QASA 1ZSZA 1OX9A 2QAZA 1OU9A 1ZSZB 1OX8A 1OU8A 1TWBA 1YFNA 2NYSA 1ZSZC 1OULA
chains in the Genus database with same CATH superfamily
3QJ6A 3RUXA 4FSXA 3NTIA 3J81E 2DBKA 2L89A 3BW1A 4BUGA 1OEBA 3L2VA 2MIOA 1I1JA 5LJ5j 1X6GA 4N0AA 1GL5A 4XTVA 2ZPIB 1AOJA 3M5AA 3OS5A 2BTTA 2DXCA 4J7IA 1M90U 2JNGA 1D3BA 3LLRA 3H6ZA 4ORZA 1VIFA 2RI5A 5CKFA 2KRMA 1WYXA 1RLQC 4HT8A 1K1ZA 1Y57A 1BIAA 1N9SA 4V2SA 3OS2A 1XTDA 3M53A 3JCMX 3CMEA 1X27A 3L2ZA 1FMWA 1VQ6T 2VUBA 4KGVB 2RF0A 2GF7A 1I5LA 2DO3A 1ZSZB 4ELZC 2XHCA 2XK0A 3F70A 1R77A 3CCRT 4AT1B 4OF1A 4QQ6A 5A2QE 2XI9A 1W2BA 3MPUB 3HPWA 2DJQA 4C5IA 4KH1B 1RAAB 1M30A 5HY6A 1TWBA 3QKJA 4O6JA 2JMAA 2FHDA 4AFSC 2LT1A 4M75G 1YHQT 2K5IA 1PSEA 1M1KC 4OMPA 5GANd 3ZBDA 1M27C 1GFDA 4A4HA 3C4SA 3CCVA 3VS4A 4XTYA 5GANe 3KXTA 1Q81U 1N6AA 2M02A 1OI1A 3CCLQ 2ENMA 1Q82C 1PNJA 4N4GA 2KVQG 1BI1A 4L5GA 3SFMA 1PKSA 4HCZA 5GAN5 3EGDA 3I56T 4NL3A 1KQ1A 1NEBA 3CCUA 3M4GA 3EG3A 3PMTA 1SKUB 2CKKA 3PMIA 2VGNA 4M75B 4UC4A 2QK0A 3X25B 1K9MC 1XNIA 4JLGA 2A28A 4CC4B 3H0IA 1AD5A 3VS3A 1ZA2B 5J3BA 2HNIA 1U8RA 1KC8R 2MMPA 5FU6C 2QYZA 1VQPT 3UWNA 2AIRB 2QI2A 4M4ZA 4OMLA 5I22A 1NLOC 4J6WA 2RHYA 5GMKj 2K5LA 2HDAA 1PC0A 1QWEA 2NUTA 1WLPB 3EAEA 1Z9QA 3E2UA 5KYYA 2EPDA 5KYNA 3JSCA 1RUWA 4X34A 1I81A 4NL2A 3MP8A 5CQXA 2HAXA 2MAMA 4M7AF 5KE3A 2HQXA 2DRMA 3GF5A 2O31A 1KQSP 5IH2A 4KGZB 4EMKB 4XU1A 3X24B 3CCQT 3CMAQ 1QVPA 3SDZA 2YUQA 3CCEQ 2E3IA 1G3WA 3CMAT 2L5QA 3UATA 4AG2C 3I5RA 2GTJA 3LWHA 2KMTA 3QJYA 4FSSA 3R6NA 1UGSB 2DPPB 2EW3A 3UDCA 3META 4J9IA 1JBMA 1QVGA 3CPWP 1MUZA 5IHIA 2HBPA 3A1PA 3QZ9B 2L2PA 1VQNQ 2DL5A 5LJ5d 4DBFA 1FX7A 2K3XA 6AT1B 2YUPA 3TU4K 1WHMA 3P8HA 1M1KR 4F04B 2RHZA 2LQNA 4LUDA 4PLLA 3RKYA 2V8IA 4RCBA 5GAOr 1LPLA 4AFUC 1B34A 2MOXA 1RL2A 1Z9ZA 5AYFA 5DY9A 2GCXA 2LNVA 3JB9G 3TSZA 5LJ5h 3I56Q 2HCKA 1BCMA 1RACB 3M0RA 1M1GA 2KRSA 2L3SA 4JPBW 4KULA 4LNPA 4LXCA 3PGGA 2E5QA 4E7LA 1C1AA 3GP8A 4IKFA 3FEOA 3JV3A 4X9CA 1M9SA 4M77D 2F2WA 1I8FA 4Y28E 3CCUT 2HL5C 4KUDK 1JU5C 4M78D 5FW9A 3QHSA 1VQ9Q 4PJOB 2F5TX 2LDMA 2RHXA 3C0CA 3OYGA 4FYWB 2YRVA 3MHXA 4J7FA 3M59A 2OAUA 5FLXE 1WX6A 5DLOA 2LCLA 1HK9A 1JXOA 4DBQA 2FEIA 4FT2A 2YUNA 1VQ7A 2J6FA 5GANj 5GMKl 2M1HA 3P8BB 3EG9B 3CCUQ 3MEWA 4M7DC 3GPLA 1EFNA 3CC4A 3CCMT 2KT1A 5L8RE 4FYVB 5AT1B 4GLMA 1UGPB 1R0CB 3L2WA 2GFUA 1NLPC 4LD6A 4N4IA 1Q81C 2L3QA 1WQ7A 4XU3A 3CQTA 2C06A 4B6MA 1LVKA 4M78B 3JCMg 5FU7C 4Z8AA 1RI9A 1UGQB 1VQLQ 3HRSA 1VQKQ 1SG5A 4M77F 2GGRA 4RG2A 3OW2P 2ZPBB 1K9MU 1AEYA 1ZHIA 3HKSA 4KT0E 4B9WA 4K11A 2CS7A 4FYXB 2X4XA 2QGFB 4FM4B 4ME7A 1YBYA 3M57A 2SRCA 1PKTA 2DX1A 3LX7A 1Q82U 5A0LA 1ARKA 4Y91A 4J9DA 4C0ZA 2QA4A 1KK7A 2Y4XA 4C8QE 2K3YA 3CC7Q 3OYHA 2K2MA 3P8DA 4M77E 2YRCA 4BE1A 1SEMA 4ZGEB 1M4ZA 4PNOA 2GNCA 1MHNA 1QP3A 4M7AB 2KGTA 3QDRB 5J26A 2O9VA 1IRXA 5LJ3j 4F16A 1NYFA 5LJ5g 1ZBXA 5LJ5f 3MEAA 3RMQA 2VKNA 3DB4A 4JJDA 4PJJA 1M90C 3G71T 3SEMA 1YITT 3FB9A 2KT8A 2V8JA 4RUGA 1Y71A 2L3RA 4RG8A 1N9RA 2RJCA 3MEUA 1NPPA 1ZSGA 5I21A 2C0IA 3EFOA 3CEYA 3CC7A 4L59A 1AWOA 4KRTA 2K9GA 3X28B 1JRIA 2VASA 2RI3A 4J8OA 4BB7A 1T0HA 5KYWB 2R5MA 2HD0A 3L42A 2OI3A 1ZSZC 4ZTFA 4GLKA 5CIUA 3CCMQ 2JTFA 1EIFA 3EFSA 2ZCFB 3G6EQ 1BU1A 1Q7YU 5GAN2 5CK9A 1X6BA 1M2VB 3HSBA 2JMCA 4J6YA 3TEEA 2EYWA 4A54A 2G6FX 3OYYA 3VS6A 4D8DA 1W4SA 1WJQA 1X2QA 2EQJA 2O4XB 2BZXA 1NM7A 1B34B 2DA9A 3A8MB 3M9QA 4BY6C 1KD1R 3KUFA 2XKOC 5FWCA 2EVRA 1W2BP 2PVOB 2CSQA 2K2VA 1BKBA 5C0MA 5GMKe 1OV3A 1WXTA 3HFNA 3EHQA 1U3OA 3CXCP 4X1VA 1WGSA 1UJ0A 3M4YA 4IIOA 3C12A 4HA8A 2RQWA 2DZ9A 1FMVA 3E9FA 1OYXA 4JRQA 1GCQA 4P5NA 2K6DA 2KXCA 2CH4W 1Y96B 1UHFA 2YHTA 2QXFA 1T3SA 1YI2T 3CPWS 3CCLT 3CBMA 1YJ9A 4M78E 3C95A 5IHKA 2E4HA 3LH0A 4J5YA 4QVCA 4OVAA 1AWWA 3QZ5B 2AZSA 4QQDA 3V8KA 2F69A 3EGDB 2O88A 3NHNA 2E10A 1WA7A 2HSPA 3CMAA 2DILA 1FYNA 4M7DG 3VS5A 1SRLA 3CCEA 2Y90A 3E1SA 4DBRA 1JO8A 3UT1A 2HEQA 1QVFA 2O9SA 1R0BG 2X3XD 3X26B 4A4KA 4BACA 3A8HB 4RTXA 1ZUUA 2BUDA 4EDUA 5LJ3d 1JJ2P 4C5EA 1X69A 4DBHA 2QEXQ 3E9GA 2NUZA 2DXTA 2GFAA 2HMAA 1VQMQ 4BE0A 1H92A 5GJWB 2DLPA 2A37A 1HYOA 2OJ2A 1VQMT 2HKQB 2KEAA 4JZ4A 3JCMb 4C0DC 4C92G 1TUGB 2D1XA 2OTLA 1PM3A 2QA4Q 2DIQA 1RAGB 1TSFA 5CKEA 2JXBA 2LVMA 1YI2A 1K0XA 3X20B 3G4SQ 3PE0A 2DE0X 5EG2A 1KIKA 4LDVA 2DYBA 1RLPC 3SB2A 2RJDA 1FWZA 2E3HA 2V8KA 3NTKA 3LH5A 2RJFA 2RHUA 1BI3A 5FRNA 4DEYA 1D0XA 3I5SA 2FZKB 2M9UA 1GCPA 3L2RA 1UECA 3ER0A 2LJ0A 1TH7A 1VQNT 1QVFS 3I35A 3LWIA 4DA4A 1NE8A 5GMKi 2AKKA 2VXFA 4M75C 3QIIA 1X43A 2EGEA 2E64A 1Y0MA 1LCKA 2DF6A 5LJ3g 3RNJA 1RAEB 2RQTA 2X4WA 2EKHA 4C5GA 5CAIA 1VQOT 3CC2A 1T0JA 2YWWA 3NPFA 3JCMc 2QGGA 3ME9A 5FU6B 1H3HA 4JRIA 2ED0A 4M7AD 4C92B 2ZPHB 4LN2A 2ZGWA 1BI0A 2OAWA 5GMKm 1OOTA 1VUBA 4OMQA 2XDBA 2HQEA 2WSEE 2KSSA 3OYIA 5M9OA 2DTOA 1WXUA 1X6OA 2ROTA 1KQSS 3JCMe 2X4JA 2KBTA 4RCCA 3JB9D 1QLYA 5GANf 1PRLC 3CCQA 2CZ7B 3CCJT 2K4YA 1M2VA 4B9XA 4CC7A 3FJ5A 4M7AA 2K3BA 2LX7A 1DJ7B 2SEMA 4O5VA 4FW2A 3DB3A 2RQVA 2HL3A 3PTAA 3M0UA 1UFFA 1E6GA 1WPYA 2HQHA 3CMET 4A63B 4OGCA 2E12A 1EZZB 4J6XA 3A98A 3CCSQ 3HL8A 1NPRA 5I11A 1UHCA 1UE9A 2QQ9A 2EFIA 1Q86C 1KG1A 2JN0A 2P4TA 1M3BA 3V8JA 5HK0A 2LCCA 1SHFA 1SSHA 3OY9A 3MP6A 2CP5A 5I2SA 1BYMA 3OW2S 2YLBA 2E1HA 2VC8A 2K7AA 4IUPA 3VYHB 4BI4A 4M7AC 4RTWA 1BB9A 1ZQ1A 2D0NA 3CCQQ 2DBMA 3CCST 2O2OA 2JM9A 4X9DA 2MK5A 5KYUB 2BE7D 4MMKA 4M7DA 3I56A 3IQLA 2K5FA 3EH1A 4CC2A 3S3NA 3CCJA 1N8RC 1G2BA 2D8HA 4M77G 1RAIB 5CKHA 4OMMA 5CVIA 2RJEA 3BDLA 1OQKA 4MZTA 2LQWA 2JTMA 3JCMJ 1TG0A 4PJMA 3G4SA 1VA7A 4PJOG 3H0HA 3I55Q 1GBRA 4OMOA 3FJPA 1YJWT 1V29B 3VKIA 2YDLA 2FRYA 4CRIA 3CC2T 4M7DF 2MWOA 4RKUE 4EIKA 1VQLA 1BCOA 3JB9J 3OB9A 2CT3A 3HRTA 4IUVA 3EHRA 3ZL7C 1Y96A 1AWJA 5HCKA 2IVWA 4R55A 3RR6A 1VQPA 3A8GB 2M16A 4ZGDB 3BY7A 2LRQA 1CKAA 4IUUA 2OTJA 4PJOE 4OB0B 4D8KA 3VRZA 5CR2A 3VUZA 3HTRA 2RI2A 2COYA 2ESWA 2X51A 4F7UF 4XTUA 3OYKA 1JEGA 2QDYB 1QMCA 3CC2Q 3MEVA 2CT4A 3PT9A 2CSIA 2YUOA 1ZX6A 2ECZA 3O5ZA 4A53A 1C6VX 2CP7A 3MCAB 3OYCA 2LP5A 1D0YA 2VV5A 4R0KA 4D6WA 3CXCA 1X2KA 2FG0A 5IAYA 3TREA 5KH6A 5L23A 1MNDA 1Q7YR 1UDLA 2ROLA 3JAME 1B7TA 1NEGA 1KSWA 1MMGA 3A8OB 2LMJA 1UUEA 3OYMA 4PKCC 1ZUKA 1IO6A 4MMLA 1QVGS 2LJ1A 1S1NA 3M0TA 1ZSZA 4C8QG 2PU9B 1AZEA 5GAOm 1NJIU 1D1AA 1I0CA 1HD3A 1OX8A 2EQIA 1K73U 1WHKA 4ATOA 4M75A 2JS2A 2AZVA 3Q1JA 4JJBA 2DTHA 1YHQA 1VQ5Q 2E70A 1AHJB 4AFQC 1IHVA 1VQ4Q 1KC8U 2A08A 2VXEA 3G71A 5A0DA 1SHGA 1YITA 3INZA 5GAOl 1Q82R 4AMCA 2LX9A 3WXMB 1HSQA 3OSSC 2DVEA 3OMCA 2E6NA 2FPDA 1PCXA 4OB3B 4QKUA 1K8AU 1SRMA 4XQ3A 3QDFA 2KY9A 2CP6A 3QPHA 3RDVA 2VB6A 4N4HA 2BE9B 1YP5A 1ZBJA 3CD6Q 1QKWA 2CH4A 1AWXA 2LNHB 3VJPA 5GAN4 1GFCA 3TCJA 2PVGB 1VQ8Q 2D6FA 3PVQA 1KHCA 4RTZA 2HZYA 1YJNT 4JS5A 3EH2A 1VYUA 4RTYA 1AT1B 2I0NA 1JXMA 2QQSA 2RH2A 1M3AA 4ZN1A 2VVKA 4J9FA 4E7HA 4C92C 2DXUA 2P84A 1KFZA 3EG9A 3MP1A 4HVUA 3JB9H 5D7UA 5IT9E 3VS0A 2ZPFB 2ZZDA 3M0PA 4RTUA 5LJ5e 3QSUA 1YJ9Q 5GAOn 1VQLT 1WNLA 1R8OB 5GAN6 2FB7A 2CP3A 4M78A 3CBPA 1E7OA 3REAB 4HXJA 1KHIA 1XQHA 3VUBA 3OYJA 4M78C 2D9TA 3QUIA 3PFSA 3GIBA 4XK8E 2ED1A 3G4ST 3QO3A 3UA6A 2DL8A 2AHJB 2K57A 4F7UB 4LDWA 3JCMd 9ATCB 2KE9A 3JCMh 1GCQC 3FDRA 4Z88A 1TU0B 4OMFB 4WTOB 2X35A 3OA6A 2RPNA 2GQIA 1IREB 2A36A 1K73C 1VYVA 5KYXB 2EYXA 3RBBB 1I4K1 2GBQA 2EGAA 3OMGA 2COZA 3ASKA 4EMKC 4FT4A 4LDYA 4BY6B 4PJOA 2FZCB 1RAFB 2KI7A 1D09B 2LCSA 2J6KA 3BE3A 2PUKB 2DL4A 4J9EA 1TTHB 2X3WD 1J3TA 2IG0A 1HXDA 2J6OA 5GANh 2O01E 4OP0A 1M8VA 1OPKA 4HCBA 4QT7A 2M0YA 4AG1C 3R6OA 2BIVA 4PJOD 1MMNA 4C8QB 4BI8B 2A3LA 2DVJA 1YN8A 2DMOA 5KCHA 4ZGJB 1K8AR 1WHLA 2NLUA 2YRDA 1IHWA 2JVVA 3WVEB 1WXBA 2ZPGB 2COWA 3M56A 1H3ZA 1RAHB 3CC7T 5GAMj 2BZYA 4RTVA 2EKOA 1K9MR 4ZNXA 2MWPA 4WCIA 2DZCA 4F14A 2RNAA 1IB8A 2LJ3A 2CZ0B 3M0QA 4ESRA 3A5ZB 1Y7XA 1M2OA 2J06A 2WSCE 1VQ4A 4XTZA 3CD6A 1X01A 2NWMA 3D7SB 1FMKA 3UA7A 4E7JA 2P4RA 1PD1A 4EMGA 2O4XA 3QYHB 3M54A 3TVTA 3CCLA 3REBB 1S72T 2CUBA 2DEQA 3RKWA 4RMOA 2EGCA 1VQ9T 2EAYA 3FRNA 3JCMV 1QP2A 4E7ZA 3OS0A 2DL7A 2MPXC 5FRMA 3OYAA 1KQSA 4TVRA 2FRWA 2X9HA 1NG2A 4C92F 1TS9A 5KYUA 1WIEA 1VQ8A 1U1SA 1IGUA 1GBQA 4QVZA 2XG8D 1H8KA 2LC4A 3OS1A 4N0AC 3OYBA 2WACA 1QVGP 2DM1A 4FIBA 2L3PA 2RD1A 3G6ET 2A7YA 1IGQA 2JM8A 1C0MA 1VQ8T 3L1AA 3H41A 4C8QA 3GNGA 4HVVA 1TUCA 1YCYA 4R56A 4JDSA 1QQJA 1ABQA 4IIMA 4YTLA 3QWXX 3A8LB 3OBWA 1D3BB 2Y4YA 5KCOA 2RB6A 3AT1B 4EMKA 4F7UG 1Q7YC 2CREA 1SSFA 2LQ8A 5GAN3 3I9QA 4JS4A 2JS0A 1LNXA 1QWFA 2NUPB 2QTXA 2F1LA 4LE9A 4MDWA 5D6WA 1G5VA 3EGXA 4DOWA 5GAMe 3SWNB 2FL7A 1WHJA 3MO8A 4E6RA 5I2MA 5GAN7 3JCMQ 2QQRA 2KYBA 3G1JA 1G8XA 4J9CA 2RM4A 3NFCA 3NMZC 1CSKA 4OGEA 5GMKh 3J80E 1YCSB 4XU0A 3LGLA 1GRIA 1OU8A 1G83A 4DOVA 1MMAA 2PQWA 4J9BA 4F7UA 1LJOA 1JJ2A 1QCOA 1GXIE 4EPCA 3WVDB 4ELYC 1UEBA 5KYYB 2OX7A 1B07A 1BK2A 1X75C 1ZUYA 4EMHA 3CCRA 2RK2A 3VRYA 4PJNA 3G6EA 5KYXA 4NOYA 4HCCA 1G3SA 1K73R 5GJVB 2VYTA 3LYIA 5HKCA 4JLIA 2CZ6B 5CQYA 5KYWA 1OX9A 2EYYA 2AT1B 2CUDA 4A4EA 1M3CA 1UTIA 2KK4A 5LJ3f 3RESA 3KBGA 2P0KA 2H3EB 3GBQA 4QW2A 1MV3A 1CKBA 3LW5E 1XJWB 2J05A 2DTIA 2DKGA 4FCYA 3EG2A 1JB0E 2OTLT 3J7AF 4ZN3A 2RO0A 3PIPA 2YSQA 3N5BB 2D8JA 1D1BA 1PD0A 2P0PA 4WF2A 1WHHA 2PZ1A 2KR3A 1WZOA 1M8MA 5D6XA 3VV0A 1VQ5T 3SD4A 4C8QF 2E6ZA 1N8RR 3NTHA 1ZLMA 4PLIA 2QG9B 4PL6A 5CKDA 2CGHA 3S3OA 1YIJQ 4C0FA 3KFVA 2KNBB 2OTLQ 1QW1A 3M55A 2E41A 2L8DA 1D1CA 2CP0A 2LTOA 1ACMB 5GAOp 1H641 2PVDB 3CCET 3E19A 8AT1B 2XDDA 1W1FA 2V1RA 1M1KU 2GTOA 4VUBA 1VYTA 3V7CA 2B86A 4CI0C 2XICA 3ZFJA 1YJNQ 1YHQQ 1BIBA 3C94A 2FPFA 4KUIA 1G3YA 3ZEHA 2DD5A 1Y07A 1N27A 2QEXA 1M1FA 1YIJT 8ATCB 4PFZA 3VYGA 3OYFA 4A4FA 4DQ2A 1S72Q 1KD1C 3EG1A 5IHNA 5GAN8 3DLLA 4BE2A 4C8QD 3OQ5A 2V1QA 2CZ1B 4M77A 3QYGB 2BKDN 3L2UA 2J7IA 1U1TA 2JW4A 2LT4A 3O8VA 4FL6A 2EQMA 2XIDA 2EYQA 4ZTJA 3M0SA 2PUOB 3ULRB 1NYGA 3HP9A 1QCNA 1MV0B 4XAXB 2E65A 1TXQA 4J83A 5GAMd 1RABB 1T3LA 1YJNA 1AVZC 2CP2A 5DM7R 2DNUA 4C0GA 4IUTA 4J9HA 1I5OB 1TUDA 2G3RA 2VWFA 1VQKA 2DAQA 5C6SA 3CCVQ 4PFOA 1OZ2A 5EC7A 1IZ6A 2FVUA 3EFRA 2MF2A 2PNIA 2LZ6B 2KAFA 4BDZA 2KDSA 1S72A 2MCNA 2NUPA 2R5AA 2W0ZA 1YJWA 2MI6A 1NJIR 3I55T 1M90R 1PHTA 1WDXA 3EGXB 2W10A 1W6XA 2R57A 1UB4A 4Y92A 3MKDA 3CCSA 1UG1A 2L0AA 3OSVA 2A0FB 2RK1A 2YXYA 2QDLA 1K4US 2ABLA 2DK3A 3SHWA 4LUEA 3V7SA 1BI2A 1M5Q1 2M0OA 2X4YA 3CCMA 4BDYA 5CO7A 3OYNA 2JTEA 4PFPA 3U23A 4IUQA 3BDUA 3OYDA 4C92A 2XD0A 1JJ2S 4NS5A 4M78F 1XOVA 1A0NB 3RIRA 2KQWA 2K79A 2BZ8A 2EJGA 2H3JA 2KYMA 1KQ2A 2XMFA 3OBYA 2ZAEA 4L6V5 4JJNK 4M77B 1N8RU 4CC3A 2C0TA 4OB2B 2ATCB 4C0DB 3OW2A 1OPLA 3JB9I 5ECAA 1ZA1B 3THKA 2HKNA 2V26A 4E7KA 3QWYA 2RMOA 2PTKA 4GY5A 2QASA 3CMEQ 2DERA 1Q81R 3L2QA 2IIMA 1YWOA 2RA2A 4M75E 4MDXA 2JUFA 4PJOF 2EQUA 2WSFE 1FXXA 2YLCA 3PNWC 1F1BB 1LOJA 2Z0WA 3S3MA 1YIJA 4E7IA 1VQOA 1NJIC 3H0FA 4ANJA 1Q95G 1VQPQ 2D0QB 2EJFA 4M75F 4HCKA 4FW1A 4OMNA 3BFMA 3CPFA 4IURA 3CC4T 1VOMA 1K0SA 1WJSA 2OTJQ 2QEXT 1QKXA 2F2VA 2JT4A 2RN8A 5CCAA 1B3QA 1UGRB 3S6WA 4M7DB 3FLGA 2DRKA 2FO0A 3CD6T 2B8AA 2EQKA 4A4GA 1KJWA 1VIEA 5IXBA 1VQ4T 3NGPA 3OYEA 4XU2A 1VQ6Q 3EFOB 4M7DE 1PWTA 5GAMh 2F5KA 1O75A 4QVDA 5FU7B 1SF9A 1D0ZA 2QQAA 3G7ZA 3LGFA 1YWPA 2R58A 2JJ9A 2FYKA 3RMSA 2QTVA 1MGQA 1WJRA 3JB9F 3QBYA 3QG1A 1VQOQ 5J39A 4BD3A 3M58A 4HVWA 1PRMC 2P0QA 1P92A 5A0GA 1YI2Q 2RQUA 4LDXA 5GAMf 5GAMg 5IN1A 2VGMA 5HK3A 3HHTB 2IPOB 4Z89A 3SWNC 3SWNA 3VS7A 1G3TA 4C5HA 1AZGB 1V76A 5DLQE 3UPUA 5D6YA 2DFUA 2NYSA 1MMDA 3G71Q 4Z02A 1YITQ 3HRUA 1VQMA 3FIFA 2EWNA 2DD4A 1Q86R 3QXEB 1YJWQ 1NZ9A 2EIFA 1N5ZA 1NBEB 1VQ7Q 3GNFB 4OB1B 1W70A 5FWBA 1E6HA 2YT6A 4JUVA 2RHIA 4E47A 4M7AE 1EX4A 4MZPA 1OU9A 2XU8A 4PK4A 1SPKA 4QQGA 5GAOq 3H8ZA 4M78G 2H8HA 4F17A 5FROA 4HT9A 2FZGB 4C92D 1K9AA 4KH0B 2DETA 1RADB 2F2XA 2CYZB 2E5KA 2HBWA 2M51A 1W2BS 1VQ5A 3RKXA 2XDPA 3AHUA 4II1A 1VQ7T 4M7DD 2NUTB 2DJZA 3CBOA 3CCVT 4KGXB 4Q5WA 3EG0A 3CPWA 3V7RA 1KC8C 2HSEB 1YJ9T 2QQBA 1OULA 2AK5A 4DEXA 1QVFP 1VQNA 1I07A 1ABOA 4M7AG 4XTXA 4C8QC 1PG5B 4F7UE 2RQRA 1YFNA 3VU3C 7AT1B 1VQKT 4HKEA 2QA4T 4JRKA 4E7SA 3FC3A 1OZ3A 2DIGA 3JCMP 2DYIA 3VS2A 3RERA 2ZPEB 3DKMA 1U5SA 3UF4A 4XTWA 4MZMA 3T9NA 1UGVA 5CKBA 5GANg 5LJ3e 4J9GA 4BI3A 4E2FB 2QAZA 3EGUA 3PIOA 2GQVA 2OTJT 2DEUA 1PSFA 2MYSA 1KD1U 3CCRQ 3MJXA 2I2LA 4PJLA 4LD9K 4PJOC 2JZ2A 4JRPA 4RTTA 2DXBA 3PVLA 4FU6A 3TQ7P 1UJYA 4LDUA 3CXCS 3JRZA 4AFZC 5LJ3h 3H9NA 2AKLA 1VQ9A 2CDTA 4M77C 3JCMW 3GOXA 1K8AC 4M75D 1RI0A 3DLMA 3GLXA 1HJDA 1YNZA 2C0OA 1WHGA 2EJ9A 3HFOA 1WI7A 1WFWA 5IXFA 3VS1A 2KRNA 4FYYB 5KE2A 4C92E 2EYZA 1BBZA 2LQKA 5LL6S 4KBMB 1U06A 2DL3A 3CCJQ 4JJCA 3OYLA 1TOVA 3URGA 4JZ3A 1K76A 2KXDA 3CC4Q 3V8LA 1WQWA 2EBPA 1JQQA 1O9SA 3TSWA 2KROA 1Q86U 2JOYA 4GBQA 1MNEA 2FPEA 1V1CA 3JCMf 1VQ6A 1QCFA 3I55A 1IXDA
chains in the Genus database with same CATH topology
2QASA 1ZSZA 1OX9A 2QAZA 1OU9A 1ZSZB 1OX8A 1OU8A 1TWBA 1YFNA 2NYSA 1ZSZC 1OULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAS A;  1ZSZ A;  1OX9 A;  2QAZ A;  1OU9 A;  1ZSZ B;  1OX8 A;  1OU8 A;  1TWB A;  1YFN A;  2NYS A;  1ZSZ C;  1OUL A; 
#chains in the Genus database with same CATH topology
 3QJ6 A;  3RUX A;  4FSX A;  3NTI A;  3J81 E;  2DBK A;  2L89 A;  3BW1 A;  4BUG A;  1OEB A;  3L2V A;  2MIO A;  1I1J A;  5LJ5 j;  1X6G A;  4N0A A;  1GL5 A;  4XTV A;  2ZPI B;  1AOJ A;  3M5A A;  3OS5 A;  2BTT A;  2DXC A;  4J7I A;  1M90 U;  2JNG A;  1D3B A;  3LLR A;  3H6Z A;  4ORZ A;  1VIF A;  2RI5 A;  5CKF A;  2KRM A;  1WYX A;  1RLQ C;  4HT8 A;  1K1Z A;  1Y57 A;  1BIA A;  1N9S A;  4V2S A;  3OS2 A;  1XTD A;  3M53 A;  3JCM X;  3CME A;  1X27 A;  3L2Z A;  1FMW A;  1VQ6 T;  2VUB A;  4KGV B;  2RF0 A;  2GF7 A;  1I5L A;  2DO3 A;  1ZSZ B;  4ELZ C;  2XHC A;  2XK0 A;  3F70 A;  1R77 A;  3CCR T;  4AT1 B;  4OF1 A;  4QQ6 A;  5A2Q E;  2XI9 A;  1W2B A;  3MPU B;  3HPW A;  2DJQ A;  4C5I A;  4KH1 B;  1RAA B;  1M30 A;  5HY6 A;  1TWB A;  3QKJ A;  4O6J A;  2JMA A;  2FHD A;  4AFS C;  2LT1 A;  4M75 G;  1YHQ T;  2K5I A;  1PSE A;  1M1K C;  4OMP A;  5GAN d;  3ZBD A;  1M27 C;  1GFD A;  4A4H A;  3C4S A;  3CCV A;  3VS4 A;  4XTY A;  5GAN e;  3KXT A;  1Q81 U;  1N6A A;  2M02 A;  1OI1 A;  3CCL Q;  2ENM A;  1Q82 C;  1PNJ A;  4N4G A;  2KVQ G;  1BI1 A;  4L5G A;  3SFM A;  1PKS A;  4HCZ A;  5GAN 5;  3EGD A;  3I56 T;  4NL3 A;  1KQ1 A;  1NEB A;  3CCU A;  3M4G A;  3EG3 A;  3PMT A;  1SKU B;  2CKK A;  3PMI A;  2VGN A;  4M75 B;  4UC4 A;  2QK0 A;  3X25 B;  1K9M C;  1XNI A;  4JLG A;  2A28 A;  4CC4 B;  3H0I A;  1AD5 A;  3VS3 A;  1ZA2 B;  5J3B A;  2HNI A;  1U8R A;  1KC8 R;  2MMP A;  5FU6 C;  2QYZ A;  1VQP T;  3UWN A;  2AIR B;  2QI2 A;  4M4Z A;  4OML A;  5I22 A;  1NLO C;  4J6W A;  2RHY A;  5GMK j;  2K5L A;  2HDA A;  1PC0 A;  1QWE A;  2NUT A;  1WLP B;  3EAE A;  1Z9Q A;  3E2U A;  5KYY A;  2EPD A;  5KYN A;  3JSC A;  1RUW A;  4X34 A;  1I81 A;  4NL2 A;  3MP8 A;  5CQX A;  2HAX A;  2MAM A;  4M7A F;  5KE3 A;  2HQX A;  2DRM A;  3GF5 A;  2O31 A;  1KQS P;  5IH2 A;  4KGZ B;  4EMK B;  4XU1 A;  3X24 B;  3CCQ T;  3CMA Q;  1QVP A;  3SDZ A;  2YUQ A;  3CCE Q;  2E3I A;  1G3W A;  3CMA T;  2L5Q A;  3UAT A;  4AG2 C;  3I5R A;  2GTJ A;  3LWH A;  2KMT A;  3QJY A;  4FSS A;  3R6N A;  1UGS B;  2DPP B;  2EW3 A;  3UDC A;  3MET A;  4J9I A;  1JBM A;  1QVG A;  3CPW P;  1MUZ A;  5IHI A;  2HBP A;  3A1P A;  3QZ9 B;  2L2P A;  1VQN Q;  2DL5 A;  5LJ5 d;  4DBF A;  1FX7 A;  2K3X A;  6AT1 B;  2YUP A;  3TU4 K;  1WHM A;  3P8H A;  1M1K R;  4F04 B;  2RHZ A;  2LQN A;  4LUD A;  4PLL A;  3RKY A;  2V8I A;  4RCB A;  5GAO r;  1LPL A;  4AFU C;  1B34 A;  2MOX A;  1RL2 A;  1Z9Z A;  5AYF A;  5DY9 A;  2GCX A;  2LNV A;  3JB9 G;  3TSZ A;  5LJ5 h;  3I56 Q;  2HCK A;  1BCM A;  1RAC B;  3M0R A;  1M1G A;  2KRS A;  2L3S A;  4JPB W;  4KUL A;  4LNP A;  4LXC A;  3PGG A;  2E5Q A;  4E7L A;  1C1A A;  3GP8 A;  4IKF A;  3FEO A;  3JV3 A;  4X9C A;  1M9S A;  4M77 D;  2F2W A;  1I8F A;  4Y28 E;  3CCU T;  2HL5 C;  4KUD K;  1JU5 C;  4M78 D;  5FW9 A;  3QHS A;  1VQ9 Q;  4PJO B;  2F5T X;  2LDM A;  2RHX A;  3C0C A;  3OYG A;  4FYW B;  2YRV A;  3MHX A;  4J7F A;  3M59 A;  2OAU A;  5FLX E;  1WX6 A;  5DLO A;  2LCL A;  1HK9 A;  1JXO A;  4DBQ A;  2FEI A;  4FT2 A;  2YUN A;  1VQ7 A;  2J6F A;  5GAN j;  5GMK l;  2M1H A;  3P8B B;  3EG9 B;  3CCU Q;  3MEW A;  4M7D C;  3GPL A;  1EFN A;  3CC4 A;  3CCM T;  2KT1 A;  5L8R E;  4FYV B;  5AT1 B;  4GLM A;  1UGP B;  1R0C B;  3L2W A;  2GFU A;  1NLP C;  4LD6 A;  4N4I A;  1Q81 C;  2L3Q A;  1WQ7 A;  4XU3 A;  3CQT A;  2C06 A;  4B6M A;  1LVK A;  4M78 B;  3JCM g;  5FU7 C;  4Z8A A;  1RI9 A;  1UGQ B;  1VQL Q;  3HRS A;  1VQK Q;  1SG5 A;  4M77 F;  2GGR A;  4RG2 A;  3OW2 P;  2ZPB B;  1K9M U;  1AEY A;  1ZHI A;  3HKS A;  4KT0 E;  4B9W A;  4K11 A;  2CS7 A;  4FYX B;  2X4X A;  2QGF B;  4FM4 B;  4ME7 A;  1YBY A;  3M57 A;  2SRC A;  1PKT A;  2DX1 A;  3LX7 A;  1Q82 U;  5A0L A;  1ARK A;  4Y91 A;  4J9D A;  4C0Z A;  2QA4 A;  1KK7 A;  2Y4X A;  4C8Q E;  2K3Y A;  3CC7 Q;  3OYH A;  2K2M A;  3P8D A;  4M77 E;  2YRC A;  4BE1 A;  1SEM A;  4ZGE B;  1M4Z A;  4PNO A;  2GNC A;  1MHN A;  1QP3 A;  4M7A B;  2KGT A;  3QDR B;  5J26 A;  2O9V A;  1IRX A;  5LJ3 j;  4F16 A;  1NYF A;  5LJ5 g;  1ZBX A;  5LJ5 f;  3MEA A;  3RMQ A;  2VKN A;  3DB4 A;  4JJD A;  4PJJ A;  1M90 C;  3G71 T;  3SEM A;  1YIT T;  3FB9 A;  2KT8 A;  2V8J A;  4RUG A;  1Y71 A;  2L3R A;  4RG8 A;  1N9R A;  2RJC A;  3MEU A;  1NPP A;  1ZSG A;  5I21 A;  2C0I A;  3EFO A;  3CEY A;  3CC7 A;  4L59 A;  1AWO A;  4KRT A;  2K9G A;  3X28 B;  1JRI A;  2VAS A;  2RI3 A;  4J8O A;  4BB7 A;  1T0H A;  5KYW B;  2R5M A;  2HD0 A;  3L42 A;  2OI3 A;  1ZSZ C;  4ZTF A;  4GLK A;  5CIU A;  3CCM Q;  2JTF A;  1EIF A;  3EFS A;  2ZCF B;  3G6E Q;  1BU1 A;  1Q7Y U;  5GAN 2;  5CK9 A;  1X6B A;  1M2V B;  3HSB A;  2JMC A;  4J6Y A;  3TEE A;  2EYW A;  4A54 A;  2G6F X;  3OYY A;  3VS6 A;  4D8D A;  1W4S A;  1WJQ A;  1X2Q A;  2EQJ A;  2O4X B;  2BZX A;  1NM7 A;  1B34 B;  2DA9 A;  3A8M B;  3M9Q A;  4BY6 C;  1KD1 R;  3KUF A;  2XKO C;  5FWC A;  2EVR A;  1W2B P;  2PVO B;  2CSQ A;  2K2V A;  1BKB A;  5C0M A;  5GMK e;  1OV3 A;  1WXT A;  3HFN A;  3EHQ A;  1U3O A;  3CXC P;  4X1V A;  1WGS A;  1UJ0 A;  3M4Y A;  4IIO A;  3C12 A;  4HA8 A;  2RQW A;  2DZ9 A;  1FMV A;  3E9F A;  1OYX A;  4JRQ A;  1GCQ A;  4P5N A;  2K6D A;  2KXC A;  2CH4 W;  1Y96 B;  1UHF A;  2YHT A;  2QXF A;  1T3S A;  1YI2 T;  3CPW S;  3CCL T;  3CBM A;  1YJ9 A;  4M78 E;  3C95 A;  5IHK A;  2E4H A;  3LH0 A;  4J5Y A;  4QVC A;  4OVA A;  1AWW A;  3QZ5 B;  2AZS A;  4QQD A;  3V8K A;  2F69 A;  3EGD B;  2O88 A;  3NHN A;  2E10 A;  1WA7 A;  2HSP A;  3CMA A;  2DIL A;  1FYN A;  4M7D G;  3VS5 A;  1SRL A;  3CCE A;  2Y90 A;  3E1S A;  4DBR A;  1JO8 A;  3UT1 A;  2HEQ A;  1QVF A;  2O9S A;  1R0B G;  2X3X D;  3X26 B;  4A4K A;  4BAC A;  3A8H B;  4RTX A;  1ZUU A;  2BUD A;  4EDU A;  5LJ3 d;  1JJ2 P;  4C5E A;  1X69 A;  4DBH A;  2QEX Q;  3E9G A;  2NUZ A;  2DXT A;  2GFA A;  2HMA A;  1VQM Q;  4BE0 A;  1H92 A;  5GJW B;  2DLP A;  2A37 A;  1HYO A;  2OJ2 A;  1VQM T;  2HKQ B;  2KEA A;  4JZ4 A;  3JCM b;  4C0D C;  4C92 G;  1TUG B;  2D1X A;  2OTL A;  1PM3 A;  2QA4 Q;  2DIQ A;  1RAG B;  1TSF A;  5CKE A;  2JXB A;  2LVM A;  1YI2 A;  1K0X A;  3X20 B;  3G4S Q;  3PE0 A;  2DE0 X;  5EG2 A;  1KIK A;  4LDV A;  2DYB A;  1RLP C;  3SB2 A;  2RJD A;  1FWZ A;  2E3H A;  2V8K A;  3NTK A;  3LH5 A;  2RJF A;  2RHU A;  1BI3 A;  5FRN A;  4DEY A;  1D0X A;  3I5S A;  2FZK B;  2M9U A;  1GCP A;  3L2R A;  1UEC A;  3ER0 A;  2LJ0 A;  1TH7 A;  1VQN T;  1QVF S;  3I35 A;  3LWI A;  4DA4 A;  1NE8 A;  5GMK i;  2AKK A;  2VXF A;  4M75 C;  3QII A;  1X43 A;  2EGE A;  2E64 A;  1Y0M A;  1LCK A;  2DF6 A;  5LJ3 g;  3RNJ A;  1RAE B;  2RQT A;  2X4W A;  2EKH A;  4C5G A;  5CAI A;  1VQO T;  3CC2 A;  1T0J A;  2YWW A;  3NPF A;  3JCM c;  2QGG A;  3ME9 A;  5FU6 B;  1H3H A;  4JRI A;  2ED0 A;  4M7A D;  4C92 B;  2ZPH B;  4LN2 A;  2ZGW A;  1BI0 A;  2OAW A;  5GMK m;  1OOT A;  1VUB A;  4OMQ A;  2XDB A;  2HQE A;  2WSE E;  2KSS A;  3OYI A;  5M9O A;  2DTO A;  1WXU A;  1X6O A;  2ROT A;  1KQS S;  3JCM e;  2X4J A;  2KBT A;  4RCC A;  3JB9 D;  1QLY A;  5GAN f;  1PRL C;  3CCQ A;  2CZ7 B;  3CCJ T;  2K4Y A;  1M2V A;  4B9X A;  4CC7 A;  3FJ5 A;  4M7A A;  2K3B A;  2LX7 A;  1DJ7 B;  2SEM A;  4O5V A;  4FW2 A;  3DB3 A;  2RQV A;  2HL3 A;  3PTA A;  3M0U A;  1UFF A;  1E6G A;  1WPY A;  2HQH A;  3CME T;  4A63 B;  4OGC A;  2E12 A;  1EZZ B;  4J6X A;  3A98 A;  3CCS Q;  3HL8 A;  1NPR A;  5I11 A;  1UHC A;  1UE9 A;  2QQ9 A;  2EFI A;  1Q86 C;  1KG1 A;  2JN0 A;  2P4T A;  1M3B A;  3V8J A;  5HK0 A;  2LCC A;  1SHF A;  1SSH A;  3OY9 A;  3MP6 A;  2CP5 A;  5I2S A;  1BYM A;  3OW2 S;  2YLB A;  2E1H A;  2VC8 A;  2K7A A;  4IUP A;  3VYH B;  4BI4 A;  4M7A C;  4RTW A;  1BB9 A;  1ZQ1 A;  2D0N A;  3CCQ Q;  2DBM A;  3CCS T;  2O2O A;  2JM9 A;  4X9D A;  2MK5 A;  5KYU B;  2BE7 D;  4MMK A;  4M7D A;  3I56 A;  3IQL A;  2K5F A;  3EH1 A;  4CC2 A;  3S3N A;  3CCJ A;  1N8R C;  1G2B A;  2D8H A;  4M77 G;  1RAI B;  5CKH A;  4OMM A;  5CVI A;  2RJE A;  3BDL A;  1OQK A;  4MZT A;  2LQW A;  2JTM A;  3JCM J;  1TG0 A;  4PJM A;  3G4S A;  1VA7 A;  4PJO G;  3H0H A;  3I55 Q;  1GBR A;  4OMO A;  3FJP A;  1YJW T;  1V29 B;  3VKI A;  2YDL A;  2FRY A;  4CRI A;  3CC2 T;  4M7D F;  2MWO A;  4RKU E;  4EIK A;  1VQL A;  1BCO A;  3JB9 J;  3OB9 A;  2CT3 A;  3HRT A;  4IUV A;  3EHR A;  3ZL7 C;  1Y96 A;  1AWJ A;  5HCK A;  2IVW A;  4R55 A;  3RR6 A;  1VQP A;  3A8G B;  2M16 A;  4ZGD B;  3BY7 A;  2LRQ A;  1CKA A;  4IUU A;  2OTJ A;  4PJO E;  4OB0 B;  4D8K A;  3VRZ A;  5CR2 A;  3VUZ A;  3HTR A;  2RI2 A;  2COY A;  2ESW A;  2X51 A;  4F7U F;  4XTU A;  3OYK A;  1JEG A;  2QDY B;  1QMC A;  3CC2 Q;  3MEV A;  2CT4 A;  3PT9 A;  2CSI A;  2YUO A;  1ZX6 A;  2ECZ A;  3O5Z A;  4A53 A;  1C6V X;  2CP7 A;  3MCA B;  3OYC A;  2LP5 A;  1D0Y A;  2VV5 A;  4R0K A;  4D6W A;  3CXC A;  1X2K A;  2FG0 A;  5IAY A;  3TRE A;  5KH6 A;  5L23 A;  1MND A;  1Q7Y R;  1UDL A;  2ROL A;  3JAM E;  1B7T A;  1NEG A;  1KSW A;  1MMG A;  3A8O B;  2LMJ A;  1UUE A;  3OYM A;  4PKC C;  1ZUK A;  1IO6 A;  4MML A;  1QVG S;  2LJ1 A;  1S1N A;  3M0T A;  1ZSZ A;  4C8Q G;  2PU9 B;  1AZE A;  5GAO m;  1NJI U;  1D1A A;  1I0C A;  1HD3 A;  1OX8 A;  2EQI A;  1K73 U;  1WHK A;  4ATO A;  4M75 A;  2JS2 A;  2AZV A;  3Q1J A;  4JJB A;  2DTH A;  1YHQ A;  1VQ5 Q;  2E70 A;  1AHJ B;  4AFQ C;  1IHV A;  1VQ4 Q;  1KC8 U;  2A08 A;  2VXE A;  3G71 A;  5A0D A;  1SHG A;  1YIT A;  3INZ A;  5GAO l;  1Q82 R;  4AMC A;  2LX9 A;  3WXM B;  1HSQ A;  3OSS C;  2DVE A;  3OMC A;  2E6N A;  2FPD A;  1PCX A;  4OB3 B;  4QKU A;  1K8A U;  1SRM A;  4XQ3 A;  3QDF A;  2KY9 A;  2CP6 A;  3QPH A;  3RDV A;  2VB6 A;  4N4H A;  2BE9 B;  1YP5 A;  1ZBJ A;  3CD6 Q;  1QKW A;  2CH4 A;  1AWX A;  2LNH B;  3VJP A;  5GAN 4;  1GFC A;  3TCJ A;  2PVG B;  1VQ8 Q;  2D6F A;  3PVQ A;  1KHC A;  4RTZ A;  2HZY A;  1YJN T;  4JS5 A;  3EH2 A;  1VYU A;  4RTY A;  1AT1 B;  2I0N A;  1JXM A;  2QQS A;  2RH2 A;  1M3A A;  4ZN1 A;  2VVK A;  4J9F A;  4E7H A;  4C92 C;  2DXU A;  2P84 A;  1KFZ A;  3EG9 A;  3MP1 A;  4HVU A;  3JB9 H;  5D7U A;  5IT9 E;  3VS0 A;  2ZPF B;  2ZZD A;  3M0P A;  4RTU A;  5LJ5 e;  3QSU A;  1YJ9 Q;  5GAO n;  1VQL T;  1WNL A;  1R8O B;  5GAN 6;  2FB7 A;  2CP3 A;  4M78 A;  3CBP A;  1E7O A;  3REA B;  4HXJ A;  1KHI A;  1XQH A;  3VUB A;  3OYJ A;  4M78 C;  2D9T A;  3QUI A;  3PFS A;  3GIB A;  4XK8 E;  2ED1 A;  3G4S T;  3QO3 A;  3UA6 A;  2DL8 A;  2AHJ B;  2K57 A;  4F7U B;  4LDW A;  3JCM d;  9ATC B;  2KE9 A;  3JCM h;  1GCQ C;  3FDR A;  4Z88 A;  1TU0 B;  4OMF B;  4WTO B;  2X35 A;  3OA6 A;  2RPN A;  2GQI A;  1IRE B;  2A36 A;  1K73 C;  1VYV A;  5KYX B;  2EYX A;  3RBB B;  1I4K 1;  2GBQ A;  2EGA A;  3OMG A;  2COZ A;  3ASK A;  4EMK C;  4FT4 A;  4LDY A;  4BY6 B;  4PJO A;  2FZC B;  1RAF B;  2KI7 A;  1D09 B;  2LCS A;  2J6K A;  3BE3 A;  2PUK B;  2DL4 A;  4J9E A;  1TTH B;  2X3W D;  1J3T A;  2IG0 A;  1HXD A;  2J6O A;  5GAN h;  2O01 E;  4OP0 A;  1M8V A;  1OPK A;  4HCB A;  4QT7 A;  2M0Y A;  4AG1 C;  3R6O A;  2BIV A;  4PJO D;  1MMN A;  4C8Q B;  4BI8 B;  2A3L A;  2DVJ A;  1YN8 A;  2DMO A;  5KCH A;  4ZGJ B;  1K8A R;  1WHL A;  2NLU A;  2YRD A;  1IHW A;  2JVV A;  3WVE B;  1WXB A;  2ZPG B;  2COW A;  3M56 A;  1H3Z A;  1RAH B;  3CC7 T;  5GAM j;  2BZY A;  4RTV A;  2EKO A;  1K9M R;  4ZNX A;  2MWP A;  4WCI A;  2DZC A;  4F14 A;  2RNA A;  1IB8 A;  2LJ3 A;  2CZ0 B;  3M0Q A;  4ESR A;  3A5Z B;  1Y7X A;  1M2O A;  2J06 A;  2WSC E;  1VQ4 A;  4XTZ A;  3CD6 A;  1X01 A;  2NWM A;  3D7S B;  1FMK A;  3UA7 A;  4E7J A;  2P4R A;  1PD1 A;  4EMG A;  2O4X A;  3QYH B;  3M54 A;  3TVT A;  3CCL A;  3REB B;  1S72 T;  2CUB A;  2DEQ A;  3RKW A;  4RMO A;  2EGC A;  1VQ9 T;  2EAY A;  3FRN A;  3JCM V;  1QP2 A;  4E7Z A;  3OS0 A;  2DL7 A;  2MPX C;  5FRM A;  3OYA A;  1KQS A;  4TVR A;  2FRW A;  2X9H A;  1NG2 A;  4C92 F;  1TS9 A;  5KYU A;  1WIE A;  1VQ8 A;  1U1S A;  1IGU A;  1GBQ A;  4QVZ A;  2XG8 D;  1H8K A;  2LC4 A;  3OS1 A;  4N0A C;  3OYB A;  2WAC A;  1QVG P;  2DM1 A;  4FIB A;  2L3P A;  2RD1 A;  3G6E T;  2A7Y A;  1IGQ A;  2JM8 A;  1C0M A;  1VQ8 T;  3L1A A;  3H41 A;  4C8Q A;  3GNG A;  4HVV A;  1TUC A;  1YCY A;  4R56 A;  4JDS A;  1QQJ A;  1ABQ A;  4IIM A;  4YTL A;  3QWX X;  3A8L B;  3OBW A;  1D3B B;  2Y4Y A;  5KCO A;  2RB6 A;  3AT1 B;  4EMK A;  4F7U G;  1Q7Y C;  2CRE A;  1SSF A;  2LQ8 A;  5GAN 3;  3I9Q A;  4JS4 A;  2JS0 A;  1LNX A;  1QWF A;  2NUP B;  2QTX A;  2F1L A;  4LE9 A;  4MDW A;  5D6W A;  1G5V A;  3EGX A;  4DOW A;  5GAM e;  3SWN B;  2FL7 A;  1WHJ A;  3MO8 A;  4E6R A;  5I2M A;  5GAN 7;  3JCM Q;  2QQR A;  2KYB A;  3G1J A;  1G8X A;  4J9C A;  2RM4 A;  3NFC A;  3NMZ C;  1CSK A;  4OGE A;  5GMK h;  3J80 E;  1YCS B;  4XU0 A;  3LGL A;  1GRI A;  1OU8 A;  1G83 A;  4DOV A;  1MMA A;  2PQW A;  4J9B A;  4F7U A;  1LJO A;  1JJ2 A;  1QCO A;  1GXI E;  4EPC A;  3WVD B;  4ELY C;  1UEB A;  5KYY B;  2OX7 A;  1B07 A;  1BK2 A;  1X75 C;  1ZUY A;  4EMH A;  3CCR A;  2RK2 A;  3VRY A;  4PJN A;  3G6E A;  5KYX A;  4NOY A;  4HCC A;  1G3S A;  1K73 R;  5GJV B;  2VYT A;  3LYI A;  5HKC A;  4JLI A;  2CZ6 B;  5CQY A;  5KYW A;  1OX9 A;  2EYY A;  2AT1 B;  2CUD A;  4A4E A;  1M3C A;  1UTI A;  2KK4 A;  5LJ3 f;  3RES A;  3KBG A;  2P0K A;  2H3E B;  3GBQ A;  4QW2 A;  1MV3 A;  1CKB A;  3LW5 E;  1XJW B;  2J05 A;  2DTI A;  2DKG A;  4FCY A;  3EG2 A;  1JB0 E;  2OTL T;  3J7A F;  4ZN3 A;  2RO0 A;  3PIP A;  2YSQ A;  3N5B B;  2D8J A;  1D1B A;  1PD0 A;  2P0P A;  4WF2 A;  1WHH A;  2PZ1 A;  2KR3 A;  1WZO A;  1M8M A;  5D6X A;  3VV0 A;  1VQ5 T;  3SD4 A;  4C8Q F;  2E6Z A;  1N8R R;  3NTH A;  1ZLM A;  4PLI A;  2QG9 B;  4PL6 A;  5CKD A;  2CGH A;  3S3O A;  1YIJ Q;  4C0F A;  3KFV A;  2KNB B;  2OTL Q;  1QW1 A;  3M55 A;  2E41 A;  2L8D A;  1D1C A;  2CP0 A;  2LTO A;  1ACM B;  5GAO p;  1H64 1;  2PVD B;  3CCE T;  3E19 A;  8AT1 B;  2XDD A;  1W1F A;  2V1R A;  1M1K U;  2GTO A;  4VUB A;  1VYT A;  3V7C A;  2B86 A;  4CI0 C;  2XIC A;  3ZFJ A;  1YJN Q;  1YHQ Q;  1BIB A;  3C94 A;  2FPF A;  4KUI A;  1G3Y A;  3ZEH A;  2DD5 A;  1Y07 A;  1N27 A;  2QEX A;  1M1F A;  1YIJ T;  8ATC B;  4PFZ A;  3VYG A;  3OYF A;  4A4F A;  4DQ2 A;  1S72 Q;  1KD1 C;  3EG1 A;  5IHN A;  5GAN 8;  3DLL A;  4BE2 A;  4C8Q D;  3OQ5 A;  2V1Q A;  2CZ1 B;  4M77 A;  3QYG B;  2BKD N;  3L2U A;  2J7I A;  1U1T A;  2JW4 A;  2LT4 A;  3O8V A;  4FL6 A;  2EQM A;  2XID A;  2EYQ A;  4ZTJ A;  3M0S A;  2PUO B;  3ULR B;  1NYG A;  3HP9 A;  1QCN A;  1MV0 B;  4XAX B;  2E65 A;  1TXQ A;  4J83 A;  5GAM d;  1RAB B;  1T3L A;  1YJN A;  1AVZ C;  2CP2 A;  5DM7 R;  2DNU A;  4C0G A;  4IUT A;  4J9H A;  1I5O B;  1TUD A;  2G3R A;  2VWF A;  1VQK A;  2DAQ A;  5C6S A;  3CCV Q;  4PFO A;  1OZ2 A;  5EC7 A;  1IZ6 A;  2FVU A;  3EFR A;  2MF2 A;  2PNI A;  2LZ6 B;  2KAF A;  4BDZ A;  2KDS A;  1S72 A;  2MCN A;  2NUP A;  2R5A A;  2W0Z A;  1YJW A;  2MI6 A;  1NJI R;  3I55 T;  1M90 R;  1PHT A;  1WDX A;  3EGX B;  2W10 A;  1W6X A;  2R57 A;  1UB4 A;  4Y92 A;  3MKD A;  3CCS A;  1UG1 A;  2L0A A;  3OSV A;  2A0F B;  2RK1 A;  2YXY A;  2QDL A;  1K4U S;  2ABL A;  2DK3 A;  3SHW A;  4LUE A;  3V7S A;  1BI2 A;  1M5Q 1;  2M0O A;  2X4Y A;  3CCM A;  4BDY A;  5CO7 A;  3OYN A;  2JTE A;  4PFP A;  3U23 A;  4IUQ A;  3BDU A;  3OYD A;  4C92 A;  2XD0 A;  1JJ2 S;  4NS5 A;  4M78 F;  1XOV A;  1A0N B;  3RIR A;  2KQW A;  2K79 A;  2BZ8 A;  2EJG A;  2H3J A;  2KYM A;  1KQ2 A;  2XMF A;  3OBY A;  2ZAE A;  4L6V 5;  4JJN K;  4M77 B;  1N8R U;  4CC3 A;  2C0T A;  4OB2 B;  2ATC B;  4C0D B;  3OW2 A;  1OPL A;  3JB9 I;  5ECA A;  1ZA1 B;  3THK A;  2HKN A;  2V26 A;  4E7K A;  3QWY A;  2RMO A;  2PTK A;  4GY5 A;  2QAS A;  3CME Q;  2DER A;  1Q81 R;  3L2Q A;  2IIM A;  1YWO A;  2RA2 A;  4M75 E;  4MDX A;  2JUF A;  4PJO F;  2EQU A;  2WSF E;  1FXX A;  2YLC A;  3PNW C;  1F1B B;  1LOJ A;  2Z0W A;  3S3M A;  1YIJ A;  4E7I A;  1VQO A;  1NJI C;  3H0F A;  4ANJ A;  1Q95 G;  1VQP Q;  2D0Q B;  2EJF A;  4M75 F;  4HCK A;  4FW1 A;  4OMN A;  3BFM A;  3CPF A;  4IUR A;  3CC4 T;  1VOM A;  1K0S A;  1WJS A;  2OTJ Q;  2QEX T;  1QKX A;  2F2V A;  2JT4 A;  2RN8 A;  5CCA A;  1B3Q A;  1UGR B;  3S6W A;  4M7D B;  3FLG A;  2DRK A;  2FO0 A;  3CD6 T;  2B8A A;  2EQK A;  4A4G A;  1KJW A;  1VIE A;  5IXB A;  1VQ4 T;  3NGP A;  3OYE A;  4XU2 A;  1VQ6 Q;  3EFO B;  4M7D E;  1PWT A;  5GAM h;  2F5K A;  1O75 A;  4QVD A;  5FU7 B;  1SF9 A;  1D0Z A;  2QQA A;  3G7Z A;  3LGF A;  1YWP A;  2R58 A;  2JJ9 A;  2FYK A;  3RMS A;  2QTV A;  1MGQ A;  1WJR A;  3JB9 F;  3QBY A;  3QG1 A;  1VQO Q;  5J39 A;  4BD3 A;  3M58 A;  4HVW A;  1PRM C;  2P0Q A;  1P92 A;  5A0G A;  1YI2 Q;  2RQU A;  4LDX A;  5GAM f;  5GAM g;  5IN1 A;  2VGM A;  5HK3 A;  3HHT B;  2IPO B;  4Z89 A;  3SWN C;  3SWN A;  3VS7 A;  1G3T A;  4C5H A;  1AZG B;  1V76 A;  5DLQ E;  3UPU A;  5D6Y A;  2DFU A;  2NYS A;  1MMD A;  3G71 Q;  4Z02 A;  1YIT Q;  3HRU A;  1VQM A;  3FIF A;  2EWN A;  2DD4 A;  1Q86 R;  3QXE B;  1YJW Q;  1NZ9 A;  2EIF A;  1N5Z A;  1NBE B;  1VQ7 Q;  3GNF B;  4OB1 B;  1W70 A;  5FWB A;  1E6H A;  2YT6 A;  4JUV A;  2RHI A;  4E47 A;  4M7A E;  1EX4 A;  4MZP A;  1OU9 A;  2XU8 A;  4PK4 A;  1SPK A;  4QQG A;  5GAO q;  3H8Z A;  4M78 G;  2H8H A;  4F17 A;  5FRO A;  4HT9 A;  2FZG B;  4C92 D;  1K9A A;  4KH0 B;  2DET A;  1RAD B;  2F2X A;  2CYZ B;  2E5K A;  2HBW A;  2M51 A;  1W2B S;  1VQ5 A;  3RKX A;  2XDP A;  3AHU A;  4II1 A;  1VQ7 T;  4M7D D;  2NUT B;  2DJZ A;  3CBO A;  3CCV T;  4KGX B;  4Q5W A;  3EG0 A;  3CPW A;  3V7R A;  1KC8 C;  2HSE B;  1YJ9 T;  2QQB A;  1OUL A;  2AK5 A;  4DEX A;  1QVF P;  1VQN A;  1I07 A;  1ABO A;  4M7A G;  4XTX A;  4C8Q C;  1PG5 B;  4F7U E;  2RQR A;  1YFN A;  3VU3 C;  7AT1 B;  1VQK T;  4HKE A;  2QA4 T;  4JRK A;  4E7S A;  3FC3 A;  1OZ3 A;  2DIG A;  3JCM P;  2DYI A;  3VS2 A;  3RER A;  2ZPE B;  3DKM A;  1U5S A;  3UF4 A;  4XTW A;  4MZM A;  3T9N A;  1UGV A;  5CKB A;  5GAN g;  5LJ3 e;  4J9G A;  4BI3 A;  4E2F B;  2QAZ A;  3EGU A;  3PIO A;  2GQV A;  2OTJ T;  2DEU A;  1PSF A;  2MYS A;  1KD1 U;  3CCR Q;  3MJX A;  2I2L A;  4PJL A;  4LD9 K;  4PJO C;  2JZ2 A;  4JRP A;  4RTT A;  2DXB A;  3PVL A;  4FU6 A;  3TQ7 P;  1UJY A;  4LDU A;  3CXC S;  3JRZ A;  4AFZ C;  5LJ3 h;  3H9N A;  2AKL A;  1VQ9 A;  2CDT A;  4M77 C;  3JCM W;  3GOX A;  1K8A C;  4M75 D;  1RI0 A;  3DLM A;  3GLX A;  1HJD A;  1YNZ A;  2C0O A;  1WHG A;  2EJ9 A;  3HFO A;  1WI7 A;  1WFW A;  5IXF A;  3VS1 A;  2KRN A;  4FYY B;  5KE2 A;  4C92 E;  2EYZ A;  1BBZ A;  2LQK A;  5LL6 S;  4KBM B;  1U06 A;  2DL3 A;  3CCJ Q;  4JJC A;  3OYL A;  1TOV A;  3URG A;  4JZ3 A;  1K76 A;  2KXD A;  3CC4 Q;  3V8L A;  1WQW A;  2EBP A;  1JQQ A;  1O9S A;  3TSW A;  2KRO A;  1Q86 U;  2JOY A;  4GBQ A;  1MNE A;  2FPE A;  1V1C A;  3JCM f;  1VQ6 A;  1QCF A;  3I55 A;  1IXD A; 
#chains in the Genus database with same CATH homology
 2QAS A;  1ZSZ A;  1OX9 A;  2QAZ A;  1OU9 A;  1ZSZ B;  1OX8 A;  1OU8 A;  1TWB A;  1YFN A;  2NYS A;  1ZSZ C;  1OUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...