1ZSZB

Crystal structure of a computationally designed sspb heterodimer
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
SSPKRPYLLRSLYDWLVDNSFTPYLVVDATYLGVNVPVEYVKDGQIVLNLSASATGNLQLTNDFIQFNARFKGVSRELYIPMGAALAIYARENGDGAMFEPEEIYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stringent starvation protein B homolog
publication title Specificity versus stability in computational protein design.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags De novo protein
total genus 27
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.220 Mainly Beta Roll SH3 type barrels. SspB-like 1zszB00
2NYSA 1OULA 1ZSZB 2QASA 1OX8A 1OU9A 1YFNA 2QAZA 1ZSZA 1ZSZC 1TWBA 1OU8A 1OX9A
chains in the Genus database with same CATH superfamily
3UPUA 5I11A 5GAN3 1FMWA 4EMHA 1BCMA 2K57A 3MJXA 3JCMV 3VUZA 4MZTA 2ABLA 3JCMg 2VC8A 1TTHB 3RMSA 1G83A 3VUBA 4AG2C 1WNLA 3CCLQ 3CD6Q 1K8AR 1QVPA 2DIGA 3CBMA 4MDXA 2A28A 4M78C 1IGQA 2CP6A 3FDRA 1NEGA 2QK0A 1XNIA 3CXCA 1AZGB 2ESWA 1B3QA 1D0XA 2HD0A 2K79A 2LJ1A 3EGXB 1TS9A 2CH4W 5GAOp 4M7DF 1BK2A 1Y96B 4YTLA 4J6WA 2YXYA 3MP8A 4BD3A 1SHGA 2LCCA 1WLPB 2EW3A 2QQAA 3CXCS 1HK9A 2XG8D 4C8QD 2ZPIB 4M75C 2QDLA 1E7OA 5IN1A 2PQWA 3QXEB 3HFNA 1QCNA 3CCRQ 1A0NB 1K8AC 3QYHB 4E7JA 2OAUA 5GMKi 3VS4A 3UDCA 5GAN4 1K0SA 3VU3C 2EBPA 2X35A 2DZ9A 3LW5E 2QAZA 5KYWA 3VJPA 3EAEA 4PJOF 3CQTA 3A1PA 1EZZB 4RTWA 2OTLT 1C0MA 1W2BP 5KYUA 3REBB 2PNIA 1F1BB 3CCUT 4CC3A 3JCMQ 3ZEHA 3CCSA 2YRDA 5GAN8 1N9SA 3BDLA 2RK2A 2HQEA 4C8QC 3HRSA 4RTYA 2DK3A 4PFOA 1KQ2A 5LJ5h 3TCJA 4QW2A 4M7AD 3H6ZA 2JTEA 1MNEA 2KI7A 3QPHA 1W70A 3JCMh 1RAIB 1VQKA 1P92A 3BW1A 2NWMA 2DKGA 3I5RA 1N27A 2EQJA 4X34A 1NEBA 3G6ET 2KRMA 3OYFA 1KC8U 2MWPA 4M4ZA 4JZ4A 3REAB 2RQUA 4JLIA 3EFOA 4OB1B 2X9HA 2DZCA 2RF0A 4F17A 1RAEB 3M4GA 1FWZA 2YRCA 1YJWT 3C95A 2K3XA 2X4WA 2R5AA 2M16A 3RNJA 4C92G 2K2MA 3UA6A 3EHQA 1ZA2B 1C6VX 3EG9B 4JRKA 3EG0A 1NJIU 1Y07A 1VQPQ 3OB9A 4JDSA 2HKQB 2H8HA 3T9NA 1VQ5Q 3DB4A 3VS3A 2H3EB 2XMFA 4J9IA 3GOXA 1VA7A 1YP5A 4L6V5 3OS1A 2RO0A 1M1KU 3EH1A 4J6YA 1I07A 2V8IA 3M55A 4O5VA 4QQGA 4L5GA 2DXCA 3CC4A 3RKXA 2KBTA 2CP0A 4Q5WA 4JJBA 2H3JA 2MPXC 4M7AG 3HFOA 2YLCA 4C8QF 2DYBA 2XHCA 5GAN2 2D9TA 3S3NA 5GAMf 1OZ3A 2QTVA 3CCJA 1ZHIA 1QVFP 2B86A 2KY9A 3HL8A 4B9XA 5A0DA 4IKFA 5FWCA 3S6WA 1KC8R 1AHJB 1D0YA 2DF6A 1RLPC 3BY7A 3A8GB 4C92B 2GQVA 1Q86U 4J5YA 3QYGB 3VRZA 2LQKA 4V2SA 5KYNA 3CC2T 1W4SA 4KUIA 4E6RA 1TG0A 1JEGA 3PNWC 4M77D 3MP6A 1VQ6T 4JRPA 1TU0B 2PTKA 5FW9A 3CCSQ 1VQLT 1YJNA 2L2PA 3OSVA 1M2OA 3C4SA 2QTXA 2LT1A 2VKNA 5GANe 1G3WA 4ZNXA 2HSPA 1T0JA 5AYFA 1Q7YC 4J9EA 4M7AF 4M7DA 2SEMA 1PG5B 1IGUA 3M57A 2DETA 5GANd 3E19A 1VQKQ 1MMGA 2WSFE 3E9GA 1OULA 4OMMA 1ZUYA 3VKIA 2X51A 1M1KR 4J9CA 2R5MA 4C5IA 4JZ3A 3JCMW 4Y92A 5KE2A 1QW1A 3D7SB 4M77C 1J3TA 3ZBDA 2FRYA 2JS2A 1GRIA 4XTWA 4PFZA 1YIJT 4XK8E 5LJ3h 4JS5A 2XI9A 3ZL7C 1QP3A 1QVFS 4RCCA 3H0IA 2VXEA 1YBYA 4OMNA 5HK3A 4PJOA 4ANJA 5IT9E 1VQ9Q 5FU6B 1KHCA 4MZPA 5KYYB 1Q86R 1Z9ZA 1M27C 4FM4B 3WVDB 1QVGP 1UHFA 1R77A 4C92E 1LCKA 5GMKe 1ZA1B 3CCEA 1H641 3EH2A 3PMIA 2O2OA 2LP5A 2HEQA 3OYYA 3R6OA 3TEEA 4C5EA 3CC7A 1RL2A 3VS5A 2CT4A 1O75A 1RABB 2CS7A 4HT9A 2QASA 3MHXA 1WXUA 2BIVA 3CC4Q 3M5AA 2MK5A 2KNBB 4LDWA 2E5KA 4F04B 4HT8A 1YITT 4O6JA 2QA4A 4XQ3A 2LNVA 4ELZC 1XJWB 2KSSA 3CCJQ 3CCQA 1QCFA 5I21A 2DXBA 1K9AA 1QVGA 3I5SA 2K5LA 2GNCA 2CSQA 1M3CA 1M5Q1 1Q86C 6AT1B 2AKLA 1RACB 3DKMA 4RG8A 3X20B 1WGSA 1WXTA 3HHTB 5GMKh 1NYFA 1Z9QA 4CC4B 4E7SA 1OYXA 1SG5A 2OX7A 4M77F 3HTRA 1RAAB 2JJ9A 4PFPA 3OYAA 2F2WA 3J80E 1VIEA 3M0PA 1LPLA 5FU7C 1YJ9T 1KD1R 1YJNQ 4B9WA 1QVGS 2NLUA 5GAMj 2K9GA 1BI0A 5DY9A 4EMKB 2RHUA 1WHLA 1PC0A 2NUZA 3H9NA 4HKEA 1UHCA 2F69A 4BDYA 1UDLA 4RTUA 4RTTA 3HRTA 2RHYA 2L0AA 4C5GA 2J05A 1X2QA 3ZFJA 4C8QA 2D0QB 5M9OA 3J7AF 3M4YA 1KQSP 2RJCA 1IHWA 1TSFA 1S1NA 2PVGB 2V1QA 2LQNA 2EYZA 2EGCA 4DOVA 3G4SA 3EFSA 2MWOA 3CCLT 3CD6T 3CPWP 4WCIA 1B07A 4OP0A 1D3BA 2W0ZA 3CCVA 1KD1C 3OMCA 3FJPA 3QZ9B 5D6XA 5CR2A 2KXDA 1VQOQ 2FZCB 4ZGEB 2GBQA 4J9HA 4R0KA 3RESA 4LD6A 1UFFA 5CKDA 3KUFA 1AWXA 2PZ1A 4E7HA 3RR6A 2KRNA 3CCEQ 3S3MA 2PUKB 2PVDB 1PM3A 4J7FA 1WPYA 2RD1A 4FW2A 5D7UA 4M7AA 3X28B 2DBKA 4XTZA 5GAOm 1VOMA 4C0DC 3JB9I 3PT9A 2JS0A 2DTOA 4EPCA 3JB9H 8AT1B 2CUBA 2COZA 1WI7A 2DILA 4LNPA 2QA4Q 4M7DC 3VYHB 3CCQQ 3V8LA 4A4EA 1Q82U 1KQSS 2QQRA 3EHRA 5CCAA 4JS4A 2RMOA 1VQ8A 5CO7A 3H0FA 4IUPA 1GXIE 1JXOA 1S72T 2DM1A 1N8RC 2FO0A 1CKBA 1AD5A 3L2RA 1AWWA 2VGMA 2CP3A 2E4HA 2RQWA 3CPWS 1LJOA 1BYMA 4FYWB 3KXTA 4OGCA 3TU4K 3H0HA 1NZ9A 1UTIA 2P0QA 3JAME 1FX7A 2E1HA 3CXCP 2EQIA 2HL5C 3PFSA 1UECA 4IIOA 4IUVA 4E47A 1D1CA 2L3RA 2D1XA 5IAYA 2J7IA 1QCOA 4JJCA 4OB0B 3OYIA 4QKUA 4ZGDB 2IG0A 5KYXA 1NG2A 4FIBA 4JPBW 3AHUA 1BCOA 2O31A 1KJWA 2KT8A 1H92A 1GFCA 4FSSA 3UATA 3ASKA 3G71Q 1OV3A 4KH0B 4KULA 4KRTA 1AWOA 5A0LA 3FLGA 2QG9B 5I2SA 3PE0A 3JRZA 5GAN6 1MUZA 1Y7XA 5GAOq 1CSKA 1DJ7B 1YHQQ 2LT4A 1XQHA 1MNDA 1GCPA 1X27A 4PJMA 3SD4A 3G4SQ 2MIOA 2RHXA 3GLXA 1KSWA 1VQPT 3HKSA 1M1GA 3H8ZA 1ZLMA 1Q82R 5FROA 4R55A 3CCVQ 2DA9A 4EDUA 1M3AA 5GJVB 1VQ5T 2AKKA 2KROA 1U06A 4M77A 2XD0A 4DOWA 2YLBA 3VS1A 3NPFA 4LUEA 3L2ZA 2KRSA 1WA7A 3VRYA 1NPPA 3LH0A 1ZUKA 2DEUA 1KHIA 2BTTA 2NUTB 2DMOA 5LJ5e 2DL3A 1ZBXA 1JRIA 4A4KA 3V7CA 1EFNA 3INZA 4C92D 3CMAQ 3M0UA 1QWFA 2EWNA 2YSQA 3JCMe 1M30A 2EYQA 5LJ5d 1NE8A 3G7ZA 1ABQA 2LDMA 2Z0WA 3NHNA 2VV5A 2DYIA 4FSXA 1IHVA 3OYCA 5HK0A 3JCMd 3X26B 2LTOA 3OYBA 1PWTA 1QP2A 4J8OA 7AT1B 2FYKA 5GAMg 1M3BA 1Q82C 4RKUE 1O9SA 4HA8A 2L3QA 2J06A 2QQBA 5D6WA 1YWOA 1OEBA 1D1AA 4KH1B 3V7RA 3E1SA 3I56Q 3CCUA 2O4XB 3HP9A 1VQ8Q 1LOJA 2HQXA 4C92C 2VUBA 3M0RA 3SB2A 2XKOC 2QGFB 3OS5A 1Q7YU 4JLGA 2KR3A 4OMPA 2ROTA 4JRIA 1GCQC 2XU8A 1D1BA 2LJ3A 1UJ0A 3QWXX 4R56A 2FPDA 4F7UG 1MGQA 5C0MA 4Z88A 1PD0A 2P0KA 4AFSC 3G6EA 1I81A 2MYSA 4NS5A 4BY6B 2CP5A 2HL3A 4OMQA 2HNIA 1VQKT 4QVZA 3RUXA 3VYGA 2FEIA 2K3YA 4DBQA 4HCKA 1YJWA 3UF4A 1G3TA 4ELYC 1ZBJA 3OYMA 4RTZA 4E7ZA 2A0FB 3OMGA 1NLOC 4M7AC 4X1VA 4M78B 4C0GA 2DXTA 2QI2A 1BI2A 1RAGB 1B34B 3GPLA 4LDXA 5FRNA 1ZSZA 4MZMA 2OJ2A 3EGDA 3LX7A 4JJDA 2R57A 4HCZA 1U1SA 1UE9A 2O9SA 3QDRB 3QDFA 1WJRA 1VQ9T 3MCAB 1PRLC 3QJ6A 2YUOA 2RJEA 2GFAA 1Q95G 3MEAA 1FMVA 2GCXA 1WX6A 5CKFA 4AG1C 2RB6A 1WYXA 3L2QA 3E2UA 2L5QA 3DLMA 4KGXB 1K4US 4FU6A 3FIFA 1QKXA 1Q7YR 4M75B 4F7UB 2L3PA 1PSEA 3ER0A 3I55A 2QEXT 4C92F 1ZUUA 3GBQA 2BZ8A 2JW4A 1VQMT 1UGPB 5GANg 3WXMB 1Q81C 1T3SA 2J6FA 4LDYA 4Y91A 2QGGA 2COYA 2RN8A 2Y4YA 1RUWA 4A4HA 1W1FA 3SWNB 2KEAA 3RERA 1E6HA 1VQ4A 3CCJT 2RI5A 4J9DA 2LCLA 5IHKA 2AT1B 2D6FA 5C6SA 1K73R 5GAOr 2C06A 5LJ3e 4BE0A 1D0ZA 2JXBA 4ZTFA 3CC2A 2W10A 1U3OA 3SDZA 3C0CA 5IXBA 2EQUA 3C94A 2M0YA 3PMTA 1VQ6A 2EYWA 5LJ3d 2DL8A 4Z02A 2E64A 3IQLA 1VQLA 4A4FA 1SHFA 1N6AA 3MPUB 4M78E 4PL6A 1I5OB 1WQ7A 2L8DA 3LH5A 3OYDA 1BU1A 3NTKA 2VWFA 1BKBA 2A7YA 2JTMA 2MI6A 1YJNT 2R58A 3TQ7P 5A2QE 4K11A 2EGEA 2X4YA 1EX4A 4JRQA 2MAMA 3FRNA 4KT0E 4BI3A 1M90C 4LDUA 2FZKB 2HCKA 3QWYA 1U5SA 2F2XA 2L3SA 1K73C 4QQ6A 3QHSA 5DM7R 4HVUA 2CH4A 1YIJA 4D6WA 3M54A 3JB9D 1JO8A 4C0FA 2DNUA 1K9MC 2RI2A 5GAOl 2X4XA 4M75E 4F7UE 3OBYA 1QKWA 5GAOn 4J83A 1JB0E 4QT7A 3NTIA 4OF1A 4DQ2A 2JMAA 5CVIA 1X43A 1KD1U 1VQNT 1LNXA 3L2UA 2CZ0B 2FZGB 1M1FA 1VYUA 1UUEA 4XTVA 4HCBA 2E3IA 4OB2B 1SPKA 4VUBA 1VYTA 1RI9A 2HQHA 4BE1A 2VB6A 1Y57A 2FPEA 4IIMA 3JCMc 3QBYA 4P5NA 1G8XA 1VQOT 2OTJT 2K7AA 3VS0A 1JJ2A 4BI8B 3OBWA 4ATOA 5CQYA 1GFDA 3MEUA 2RHIA 3PTAA 4X9DA 3FC3A 5LL6S 5GANf 4KUDK 4LD9K 1HSQA 4N4IA 3CCET 5IHIA 3DB3A 3BE3A 3JCMb 4X9CA 2EKHA 2O01E 2K5IA 1YI2A 3LWHA 2YHTA 3I55Q 2AIRB 2GQIA 1YITA 4EIKA 1TXQA 3EG9A 2C0TA 3M0QA 2ED1A 5HKCA 3QO3A 2ZAEA 1IZ6A 1G2BA 2I2LA 2DRMA 2L89A 2JM9A 1NPRA 1ACMB 5FRMA 2YUNA 2QA4T 1M4ZA 1VQ7A 1NM7A 1VQ4Q 1X75C 3CCQT 3UWNA 1N8RU 4RCBA 5L8RE 3JB9G 3GNFB 2DJZA 1MMAA 2DBMA 3JCMX 1SSFA 4HVWA 1WFWA 1PNJA 2KE9A 4NL3A 2DVJA 2RHZA 4N0AA 3CCMA 4CC2A 2DRKA 5GMKm 1BIBA 3M0TA 1YJ9A 4E7IA 1VQLQ 4FL6A 4A54A 4Y28E 3FEOA 2RQTA 1ZSZC 1R0BG 1RADB 2KGTA 1QQJA 5FWBA 4QVDA 4PK4A 4EMGA 2EJ9A 4NOYA 3QG1A 2NUPA 3OYLA 2K6DA 4ZN3A 1BI1A 3UT1A 2LRQA 9ATCB 2XDBA 4C92A 2AHJB 4A4GA 1WIEA 1YNZA 5J3BA 2DJQA 2DL4A 3L1AA 2E6NA 4B6MA 3JB9F 1YIJQ 3G71T 4JJNK 1NLPC 1PRMC 1GCQA 2DE0X 1X69A 3L2VA 3L2WA 1X01A 5KCOA 1YHQT 1X6BA 2DTIA 4C0ZA 1WHJA 5GAN7 5KYWB 2FVUA 5GJWB 1N8RR 2EYYA 1HYOA 4OMFB 4LE9A 1KG1A 4BUGA 2RNAA 2WSCE 1JXMA 5KYUB 3O8VA 1TWBA 2ZPFB 3VS2A 1G3SA 2KVQG 3CC7Q 2G3RA 2EJGA 5CK9A 1QWEA 3RKYA 1W6XA 2CDTA 1WHHA 2BZXA 1I4K1 3CMAT 3A8OB 5IH2A 1YI2Q 5FLXE 3HPWA 3CCRT 2LQ8A 4IUUA 2X3WD 1YITQ 3MEVA 2ROLA 3S3OA 1KIKA 4J9BA 5KYYA 2KDSA 3CPFA 4AFQC 3EFOB 3HSBA 1VQ7Q 1UGVA 1TUGB 1MMDA 2F1LA 3O5ZA 1SF9A 2E70A 1S72A 4LUDA 2CP7A 2EJFA 3EFRA 3I56T 2J6OA 5GANj 1YN8A 5FU7B 1VQ8T 3CMEA 4OB3B 4XU2A 1ABOA 2PUOB 1PKTA 4MMLA 2DAQA 1JBMA 4HXJA 3CCMQ 2KQWA 4OGEA 1YJ9Q 1KFZA 3EG2A 1SSHA 3THKA 1PKSA 5CKEA 2SRCA 2QQ9A 4CRIA 3P8BB 2MF2A 3J81E 4M78D 3QIIA 1N9RA 3EG3A 4L59A 4IUTA 2QXFA 1R0CB 2JMCA 2DX1A 2QDYB 5EG2A 5DLOA 2DVEA 1KQ1A 2EYXA 3BFMA 2DFUA 1U1TA 2M0OA 2K3BA 3R6NA 1OU9A 5KCHA 4BY6C 3QSUA 5LJ5g 2VXFA 2K4YA 4DBFA 1IO6A 2V1RA 3M0SA 2JT4A 4E2FB 3QJYA 2RQRA 3QZ5B 3I9QA 4ME7A 1VQPA 2YDLA 4FYVB 3OS0A 5GMKj 3PIPA 2LX9A 4M75D 1AVZC 3TVTA 1VQ5A 2JZ2A 2WSEE 1IB8A 4EMKA 2YUPA 1OQKA 2KYBA 3RBBB 4N4GA 2A36A 4PJOG 4WTOB 3H41A 2HDAA 2YRVA 4OMOA 2A08A 3FJ5A 4HVVA 1WXBA 2P4RA 4RMOA 3A8LB 4KGZB 2BUDA 4FT2A 1WJQA 4Z89A 2M02A 3A8MB 4C0DB 4N0AC 3Q1JA 2CZ1B 3GF5A 1Q81U 2X3XD 2KT1A 3FB9A 3N5BB 1KK7A 1OPLA 1WHMA 2VYTA 2GTJA 4IURA 1IXDA 4CC7A 4E7LA 4M7DB 1AOJA 2COWA 3LLRA 5I22A 4M78G 2RPNA 1PCXA 4DBRA 2KXCA 4XTYA 4ZN1A 3E9FA 2BKDN 2OTLA 5CKHA 1XTDA 3JCMJ 2OAWA 4ORZA 1AWJA 2VASA 1G3YA 3SWNC 1WHKA 3CEYA 3NMZC 3MEWA 2DL7A 2AK5A 2EPDA 3TSWA 1S72Q 4ESRA 1T3LA 2PU9B 1OX9A 2IVWA 1V29B 1VIFA 2JTFA 2HAXA 3CCST 2AZSA 3CMEQ 1HXDA 3I35A 1I0CA 3CBPA 5EC7A 4PJOB 2CREA 4TVRA 4M75G 4C5HA 2MOXA 1YFNA 2ZGWA 2NYSA 4UC4A 2ENMA 1M90U 3G1JA 3OYJA 4OMLA 5LJ5f 2RI3A 4M78F 1G5VA 2RQVA 3X25B 2RK1A 1K73U 1M2VA 5GAMe 1FYNA 2QQSA 1PD1A 4PNOA 5KH6A 1ARKA 3JCMf 3JSCA 5DLQE 1K9MU 2ECZA 2LNHB 1AEYA 4PLLA 4FT4A 5GAMd 2F5TX 1Q81R 1W2BA 4IUQA 1GBQA 3TREA 1V76A 1VYVA 4LDVA 5IHNA 4BE2A 2E3HA 2EFIA 1I8FA 2RJDA 4C8QG 2GTOA 2CUDA 4D8KA 4AMCA 3EGUA 2CYZB 2VVKA 4A53A 4J9GA 3AT1B 2Y4XA 3NGPA 4M7DE 2JOYA 2DEQA 3A5ZB 2CP2A 1VQ9A 2ZPHB 2P0PA 2HSEB 4M75F 3QUIA 4F7UF 2YWWA 2JNGA 3RKWA 2EKOA 5FU6C 2KMTA 3SEMA 1W2BS 4ZTJA 5LJ3g 1OX8A 1RAFB 2XDPA 5GAMh 4DA4A 2YT6A 5GMKl 2M1HA 4XAXB 2QEXA 3MP1A 1MHNA 3CC4T 3LYIA 2DERA 3OS2A 1VQMA 2F2VA 1K76A 2FB7A 5HY6A 4PJOE 2LMJA 2D8JA 2RH2A 3JB9J 1M90R 2DLPA 3VV0A 3I55T 2JM8A 2LJ0A 1GBRA 5HCKA 2E6ZA 2BE9B 2DIQA 2DD5A 3TSZA 1YWPA 2C0OA 2CSIA 3WVEB 2XIDA 4OVAA 1K9MR 3EGXA 3VS6A 2NUPB 1UG1A 2PVOB 2FRWA 3PIOA 2OTLQ 1U8RA 4MMKA 4C8QB 1OI1A 3U23A 2KK4A 1VQ4T 2AZVA 3LWIA 3CCUQ 1Y96A 3M58A 2GGRA 1M8MA 1MMNA 4CI0C 2CKKA 1Y71A 2NUTA 2GF7A 2P84A 4WF2A 1D3BB 1NYGA 3V7SA 2JVVA 5D6YA 1NJIR 4PJLA 4N4HA 2XDDA 3SFMA 2D8HA 2IPOB 2FG0A 4E7KA 2GFUA 4FW1A 4RG2A 1JJ2P 1V1CA 4BI4A 2FL7A 3G6EQ 8ATCB 1WJSA 4LN2A 3QKJA 1QVFA 2HMAA 1BBZA 4EMKC 1M8VA 2DTHA 4MDWA 3OYHA 2FPFA 3P8DA 4PJNA 3DLLA 3OSSC 3GIBA 1SEMA 5ECAA 3NTHA 1YJWQ 3OYKA 3EG1A 4AT1B 1KC8C 3C12A 4M7AB 2IIMA 1RLQC 2O4XA 1M9SA 2P4TA 4PJJA 3META 2XICA 2J6KA 2RJFA 2ATCB 1VQNA 1IREB 2F5KA 4RTXA 1WHGA 4XTXA 2ZPBB 5LJ3f 2BZYA 2JN0A 3X24B 2MMPA 3LGLA 1NJIC 2V26A 1ZSGA 3RDVA 1WZOA 1VQOA 2OTJA 2EIFA 4GLMA 5GANh 1I1JA 1PHTA 2RA2A 5LJ5j 2LVMA 2M51A 2RM4A 1CKAA 2G6FX 4FCYA 4C8QE 2ZPGB 4J6XA 4XU0A 2EQKA 3RMQA 1QMCA 2E5QA 3RIRA 4M77G 5J26A 5CIUA 3CC7T 3OQ5A 1M1KC 4AFZC 1B7TA 1T0HA 2M9UA 2DXUA 2QEXQ 3ULRB 2I0NA 1JJ2S 4ZGJB 4GBQA 4M78A 1VQMQ 5CAIA 4XTUA 4F16A 1YI2T 4QQDA 1B34A 2MCNA 1LVKA 1TUDA 2QYZA 5KYXB 2YUQA 2OI3A 2LCSA 2LC4A 2X4JA 3CC2Q 3M53A 4II1A 5AT1B 2E41A 2JUFA 1SRLA 1VQ7T 2HKNA 5L23A 4F14A 4RTVA 1VQ6Q 2ZCFB 1QLYA 2V8JA 4M7AE 1TH7A 1ZX6A 3M59A 4PLIA 1AT1B 5IXFA 1SRMA 2DPPB 4M75A 4F7UA 1YCYA 2C0IA 4XU3A 1UJYA 4BB7A 3CCMT 1TOVA 1UGSB 1BIAA 2VGNA 2DD4A 2HBWA 3M56A 5I2MA 1X6OA 4M77B 1TUCA 3OW2P 3SWNA 3OA6A 1VUBA 3HRUA 1UEBA 3VS7A 1UGQB 3PVQA 1MV3A 2Y90A 3SHWA 5KE3A 1FXXA 2A3LA 4BACA 1MV0B 2EAYA 3JV3A 4DEYA 3G71A 1FMKA 3NFCA 2K5FA 3CCLA 3CD6A 3L42A 2XK0A 1K0XA 2KYMA 2CZ7B 1WDXA 1WQWA 2CGHA 5A0GA 3F70A 2DO3A 3G4ST 1VQNQ 2E10A 1XOVA 1YHQA 1JU5C 2LX7A 1RI0A 1R8OB 2BE7D 3A8HB 4JUVA 4DBHA 4J7IA 4FYYB 3CCVT 1JQQA 4PKCC 1H3ZA 4QVCA 3CBOA 4RUGA 3OW2A 4A63B 3BDUA 4XU1A 2OTJQ 1ZQ1A 2V8KA 1AZEA 3MKDA 2E12A 2KAFA 4M7DD 3PVLA 2ZZDA 4HCCA 3GNGA 4FYXB 3JCMP 1C1AA 4AFUC 3GP8A 3PGGA 2EVRA 1H8KA 3P8HA 2EQMA 2WACA 1KQSA 3KFVA 3CMAA 2LZ6B 3OY9A 1OU8A 3OYNA 2ZPEB 1Y0MA 4GLKA 2HBPA 3CCRA 2D0NA 2E65A 4BDZA 4Z8AA 3OW2S 1X6GA 1EIFA 1K8AU 5LJ3j 1HJDA 3ME9A 1IRXA 3CPWA 3V8KA 5J39A 3KBGA 3UA7A 4M77E 1X2KA 1BI3A 4J9FA 2A37A 1YCSB 4PJOD 2ED0A 5GAN5 4DEXA 1M2VB 1E6GA 4KGVB 2DL5A 3OYGA 3OYEA 1UB4A 3I56A 1OZ2A 3M9QA 1GL5A 4NL2A 1OOTA 2CT3A 3LGFA 2EGAA 2B8AA 2CZ6B 1H3HA 3MO8A 1D09B 1NBEB 1ZSZB 3EGDB 1HD3A 4LXCA 3A98A 3CMET 2O88A 1N5ZA 2FHDA 1OPKA 1PSFA 5CQXA 2O9VA 3URGA 4GY5A 4D8DA 2K2VA 2HZYA 5CKBA 4PJOC 3V8JA 4M7DG 1BB9A 1K1ZA 4KBMB 1I5LA 1UGRB 1SKUB 2LQWA 1RAHB
chains in the Genus database with same CATH topology
2NYSA 1OULA 1ZSZB 2QASA 1OX8A 1OU9A 1YFNA 2QAZA 1ZSZA 1ZSZC 1TWBA 1OU8A 1OX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYS A;  1OUL A;  1ZSZ B;  2QAS A;  1OX8 A;  1OU9 A;  1YFN A;  2QAZ A;  1ZSZ A;  1ZSZ C;  1TWB A;  1OU8 A;  1OX9 A; 
#chains in the Genus database with same CATH topology
 3UPU A;  5I11 A;  5GAN 3;  1FMW A;  4EMH A;  1BCM A;  2K57 A;  3MJX A;  3JCM V;  3VUZ A;  4MZT A;  2ABL A;  3JCM g;  2VC8 A;  1TTH B;  3RMS A;  1G83 A;  3VUB A;  4AG2 C;  1WNL A;  3CCL Q;  3CD6 Q;  1K8A R;  1QVP A;  2DIG A;  3CBM A;  4MDX A;  2A28 A;  4M78 C;  1IGQ A;  2CP6 A;  3FDR A;  1NEG A;  2QK0 A;  1XNI A;  3CXC A;  1AZG B;  2ESW A;  1B3Q A;  1D0X A;  2HD0 A;  2K79 A;  2LJ1 A;  3EGX B;  1TS9 A;  2CH4 W;  5GAO p;  4M7D F;  1BK2 A;  1Y96 B;  4YTL A;  4J6W A;  2YXY A;  3MP8 A;  4BD3 A;  1SHG A;  2LCC A;  1WLP B;  2EW3 A;  2QQA A;  3CXC S;  1HK9 A;  2XG8 D;  4C8Q D;  2ZPI B;  4M75 C;  2QDL A;  1E7O A;  5IN1 A;  2PQW A;  3QXE B;  3HFN A;  1QCN A;  3CCR Q;  1A0N B;  1K8A C;  3QYH B;  4E7J A;  2OAU A;  5GMK i;  3VS4 A;  3UDC A;  5GAN 4;  1K0S A;  3VU3 C;  2EBP A;  2X35 A;  2DZ9 A;  3LW5 E;  2QAZ A;  5KYW A;  3VJP A;  3EAE A;  4PJO F;  3CQT A;  3A1P A;  1EZZ B;  4RTW A;  2OTL T;  1C0M A;  1W2B P;  5KYU A;  3REB B;  2PNI A;  1F1B B;  3CCU T;  4CC3 A;  3JCM Q;  3ZEH A;  3CCS A;  2YRD A;  5GAN 8;  1N9S A;  3BDL A;  2RK2 A;  2HQE A;  4C8Q C;  3HRS A;  4RTY A;  2DK3 A;  4PFO A;  1KQ2 A;  5LJ5 h;  3TCJ A;  4QW2 A;  4M7A D;  3H6Z A;  2JTE A;  1MNE A;  2KI7 A;  3QPH A;  1W70 A;  3JCM h;  1RAI B;  1VQK A;  1P92 A;  3BW1 A;  2NWM A;  2DKG A;  3I5R A;  1N27 A;  2EQJ A;  4X34 A;  1NEB A;  3G6E T;  2KRM A;  3OYF A;  1KC8 U;  2MWP A;  4M4Z A;  4JZ4 A;  3REA B;  2RQU A;  4JLI A;  3EFO A;  4OB1 B;  2X9H A;  2DZC A;  2RF0 A;  4F17 A;  1RAE B;  3M4G A;  1FWZ A;  2YRC A;  1YJW T;  3C95 A;  2K3X A;  2X4W A;  2R5A A;  2M16 A;  3RNJ A;  4C92 G;  2K2M A;  3UA6 A;  3EHQ A;  1ZA2 B;  1C6V X;  3EG9 B;  4JRK A;  3EG0 A;  1NJI U;  1Y07 A;  1VQP Q;  3OB9 A;  4JDS A;  2HKQ B;  2H8H A;  3T9N A;  1VQ5 Q;  3DB4 A;  3VS3 A;  2H3E B;  2XMF A;  4J9I A;  3GOX A;  1VA7 A;  1YP5 A;  4L6V 5;  3OS1 A;  2RO0 A;  1M1K U;  3EH1 A;  4J6Y A;  1I07 A;  2V8I A;  3M55 A;  4O5V A;  4QQG A;  4L5G A;  2DXC A;  3CC4 A;  3RKX A;  2KBT A;  2CP0 A;  4Q5W A;  4JJB A;  2H3J A;  2MPX C;  4M7A G;  3HFO A;  2YLC A;  4C8Q F;  2DYB A;  2XHC A;  5GAN 2;  2D9T A;  3S3N A;  5GAM f;  1OZ3 A;  2QTV A;  3CCJ A;  1ZHI A;  1QVF P;  2B86 A;  2KY9 A;  3HL8 A;  4B9X A;  5A0D A;  4IKF A;  5FWC A;  3S6W A;  1KC8 R;  1AHJ B;  1D0Y A;  2DF6 A;  1RLP C;  3BY7 A;  3A8G B;  4C92 B;  2GQV A;  1Q86 U;  4J5Y A;  3QYG B;  3VRZ A;  2LQK A;  4V2S A;  5KYN A;  3CC2 T;  1W4S A;  4KUI A;  4E6R A;  1TG0 A;  1JEG A;  3PNW C;  4M77 D;  3MP6 A;  1VQ6 T;  4JRP A;  1TU0 B;  2PTK A;  5FW9 A;  3CCS Q;  1VQL T;  1YJN A;  2L2P A;  3OSV A;  1M2O A;  3C4S A;  2QTX A;  2LT1 A;  2VKN A;  5GAN e;  1G3W A;  4ZNX A;  2HSP A;  1T0J A;  5AYF A;  1Q7Y C;  4J9E A;  4M7A F;  4M7D A;  2SEM A;  1PG5 B;  1IGU A;  3M57 A;  2DET A;  5GAN d;  3E19 A;  1VQK Q;  1MMG A;  2WSF E;  3E9G A;  1OUL A;  4OMM A;  1ZUY A;  3VKI A;  2X51 A;  1M1K R;  4J9C A;  2R5M A;  4C5I A;  4JZ3 A;  3JCM W;  4Y92 A;  5KE2 A;  1QW1 A;  3D7S B;  4M77 C;  1J3T A;  3ZBD A;  2FRY A;  2JS2 A;  1GRI A;  4XTW A;  4PFZ A;  1YIJ T;  4XK8 E;  5LJ3 h;  4JS5 A;  2XI9 A;  3ZL7 C;  1QP3 A;  1QVF S;  4RCC A;  3H0I A;  2VXE A;  1YBY A;  4OMN A;  5HK3 A;  4PJO A;  4ANJ A;  5IT9 E;  1VQ9 Q;  5FU6 B;  1KHC A;  4MZP A;  5KYY B;  1Q86 R;  1Z9Z A;  1M27 C;  4FM4 B;  3WVD B;  1QVG P;  1UHF A;  1R77 A;  4C92 E;  1LCK A;  5GMK e;  1ZA1 B;  3CCE A;  1H64 1;  3EH2 A;  3PMI A;  2O2O A;  2LP5 A;  2HEQ A;  3OYY A;  3R6O A;  3TEE A;  4C5E A;  3CC7 A;  1RL2 A;  3VS5 A;  2CT4 A;  1O75 A;  1RAB B;  2CS7 A;  4HT9 A;  2QAS A;  3MHX A;  1WXU A;  2BIV A;  3CC4 Q;  3M5A A;  2MK5 A;  2KNB B;  4LDW A;  2E5K A;  4F04 B;  4HT8 A;  1YIT T;  4O6J A;  2QA4 A;  4XQ3 A;  2LNV A;  4ELZ C;  1XJW B;  2KSS A;  3CCJ Q;  3CCQ A;  1QCF A;  5I21 A;  2DXB A;  1K9A A;  1QVG A;  3I5S A;  2K5L A;  2GNC A;  2CSQ A;  1M3C A;  1M5Q 1;  1Q86 C;  6AT1 B;  2AKL A;  1RAC B;  3DKM A;  4RG8 A;  3X20 B;  1WGS A;  1WXT A;  3HHT B;  5GMK h;  1NYF A;  1Z9Q A;  4CC4 B;  4E7S A;  1OYX A;  1SG5 A;  2OX7 A;  4M77 F;  3HTR A;  1RAA B;  2JJ9 A;  4PFP A;  3OYA A;  2F2W A;  3J80 E;  1VIE A;  3M0P A;  1LPL A;  5FU7 C;  1YJ9 T;  1KD1 R;  1YJN Q;  4B9W A;  1QVG S;  2NLU A;  5GAM j;  2K9G A;  1BI0 A;  5DY9 A;  4EMK B;  2RHU A;  1WHL A;  1PC0 A;  2NUZ A;  3H9N A;  4HKE A;  1UHC A;  2F69 A;  4BDY A;  1UDL A;  4RTU A;  4RTT A;  3HRT A;  2RHY A;  2L0A A;  4C5G A;  2J05 A;  1X2Q A;  3ZFJ A;  4C8Q A;  2D0Q B;  5M9O A;  3J7A F;  3M4Y A;  1KQS P;  2RJC A;  1IHW A;  1TSF A;  1S1N A;  2PVG B;  2V1Q A;  2LQN A;  2EYZ A;  2EGC A;  4DOV A;  3G4S A;  3EFS A;  2MWO A;  3CCL T;  3CD6 T;  3CPW P;  4WCI A;  1B07 A;  4OP0 A;  1D3B A;  2W0Z A;  3CCV A;  1KD1 C;  3OMC A;  3FJP A;  3QZ9 B;  5D6X A;  5CR2 A;  2KXD A;  1VQO Q;  2FZC B;  4ZGE B;  2GBQ A;  4J9H A;  4R0K A;  3RES A;  4LD6 A;  1UFF A;  5CKD A;  3KUF A;  1AWX A;  2PZ1 A;  4E7H A;  3RR6 A;  2KRN A;  3CCE Q;  3S3M A;  2PUK B;  2PVD B;  1PM3 A;  4J7F A;  1WPY A;  2RD1 A;  4FW2 A;  5D7U A;  4M7A A;  3X28 B;  2DBK A;  4XTZ A;  5GAO m;  1VOM A;  4C0D C;  3JB9 I;  3PT9 A;  2JS0 A;  2DTO A;  4EPC A;  3JB9 H;  8AT1 B;  2CUB A;  2COZ A;  1WI7 A;  2DIL A;  4LNP A;  2QA4 Q;  4M7D C;  3VYH B;  3CCQ Q;  3V8L A;  4A4E A;  1Q82 U;  1KQS S;  2QQR A;  3EHR A;  5CCA A;  4JS4 A;  2RMO A;  1VQ8 A;  5CO7 A;  3H0F A;  4IUP A;  1GXI E;  1JXO A;  1S72 T;  2DM1 A;  1N8R C;  2FO0 A;  1CKB A;  1AD5 A;  3L2R A;  1AWW A;  2VGM A;  2CP3 A;  2E4H A;  2RQW A;  3CPW S;  1LJO A;  1BYM A;  4FYW B;  3KXT A;  4OGC A;  3TU4 K;  3H0H A;  1NZ9 A;  1UTI A;  2P0Q A;  3JAM E;  1FX7 A;  2E1H A;  3CXC P;  2EQI A;  2HL5 C;  3PFS A;  1UEC A;  4IIO A;  4IUV A;  4E47 A;  1D1C A;  2L3R A;  2D1X A;  5IAY A;  2J7I A;  1QCO A;  4JJC A;  4OB0 B;  3OYI A;  4QKU A;  4ZGD B;  2IG0 A;  5KYX A;  1NG2 A;  4FIB A;  4JPB W;  3AHU A;  1BCO A;  2O31 A;  1KJW A;  2KT8 A;  1H92 A;  1GFC A;  4FSS A;  3UAT A;  3ASK A;  3G71 Q;  1OV3 A;  4KH0 B;  4KUL A;  4KRT A;  1AWO A;  5A0L A;  3FLG A;  2QG9 B;  5I2S A;  3PE0 A;  3JRZ A;  5GAN 6;  1MUZ A;  1Y7X A;  5GAO q;  1CSK A;  1DJ7 B;  1YHQ Q;  2LT4 A;  1XQH A;  1MND A;  1GCP A;  1X27 A;  4PJM A;  3SD4 A;  3G4S Q;  2MIO A;  2RHX A;  3GLX A;  1KSW A;  1VQP T;  3HKS A;  1M1G A;  3H8Z A;  1ZLM A;  1Q82 R;  5FRO A;  4R55 A;  3CCV Q;  2DA9 A;  4EDU A;  1M3A A;  5GJV B;  1VQ5 T;  2AKK A;  2KRO A;  1U06 A;  4M77 A;  2XD0 A;  4DOW A;  2YLB A;  3VS1 A;  3NPF A;  4LUE A;  3L2Z A;  2KRS A;  1WA7 A;  3VRY A;  1NPP A;  3LH0 A;  1ZUK A;  2DEU A;  1KHI A;  2BTT A;  2NUT B;  2DMO A;  5LJ5 e;  2DL3 A;  1ZBX A;  1JRI A;  4A4K A;  3V7C A;  1EFN A;  3INZ A;  4C92 D;  3CMA Q;  3M0U A;  1QWF A;  2EWN A;  2YSQ A;  3JCM e;  1M30 A;  2EYQ A;  5LJ5 d;  1NE8 A;  3G7Z A;  1ABQ A;  2LDM A;  2Z0W A;  3NHN A;  2VV5 A;  2DYI A;  4FSX A;  1IHV A;  3OYC A;  5HK0 A;  3JCM d;  3X26 B;  2LTO A;  3OYB A;  1PWT A;  1QP2 A;  4J8O A;  7AT1 B;  2FYK A;  5GAM g;  1M3B A;  1Q82 C;  4RKU E;  1O9S A;  4HA8 A;  2L3Q A;  2J06 A;  2QQB A;  5D6W A;  1YWO A;  1OEB A;  1D1A A;  4KH1 B;  3V7R A;  3E1S A;  3I56 Q;  3CCU A;  2O4X B;  3HP9 A;  1VQ8 Q;  1LOJ A;  2HQX A;  4C92 C;  2VUB A;  3M0R A;  3SB2 A;  2XKO C;  2QGF B;  3OS5 A;  1Q7Y U;  4JLG A;  2KR3 A;  4OMP A;  2ROT A;  4JRI A;  1GCQ C;  2XU8 A;  1D1B A;  2LJ3 A;  1UJ0 A;  3QWX X;  4R56 A;  2FPD A;  4F7U G;  1MGQ A;  5C0M A;  4Z88 A;  1PD0 A;  2P0K A;  4AFS C;  3G6E A;  1I81 A;  2MYS A;  4NS5 A;  4BY6 B;  2CP5 A;  2HL3 A;  4OMQ A;  2HNI A;  1VQK T;  4QVZ A;  3RUX A;  3VYG A;  2FEI A;  2K3Y A;  4DBQ A;  4HCK A;  1YJW A;  3UF4 A;  1G3T A;  4ELY C;  1ZBJ A;  3OYM A;  4RTZ A;  4E7Z A;  2A0F B;  3OMG A;  1NLO C;  4M7A C;  4X1V A;  4M78 B;  4C0G A;  2DXT A;  2QI2 A;  1BI2 A;  1RAG B;  1B34 B;  3GPL A;  4LDX A;  5FRN A;  1ZSZ A;  4MZM A;  2OJ2 A;  3EGD A;  3LX7 A;  4JJD A;  2R57 A;  4HCZ A;  1U1S A;  1UE9 A;  2O9S A;  3QDR B;  3QDF A;  1WJR A;  1VQ9 T;  3MCA B;  1PRL C;  3QJ6 A;  2YUO A;  2RJE A;  2GFA A;  1Q95 G;  3MEA A;  1FMV A;  2GCX A;  1WX6 A;  5CKF A;  4AG1 C;  2RB6 A;  1WYX A;  3L2Q A;  3E2U A;  2L5Q A;  3DLM A;  4KGX B;  1K4U S;  4FU6 A;  3FIF A;  1QKX A;  1Q7Y R;  4M75 B;  4F7U B;  2L3P A;  1PSE A;  3ER0 A;  3I55 A;  2QEX T;  4C92 F;  1ZUU A;  3GBQ A;  2BZ8 A;  2JW4 A;  1VQM T;  1UGP B;  5GAN g;  3WXM B;  1Q81 C;  1T3S A;  2J6F A;  4LDY A;  4Y91 A;  2QGG A;  2COY A;  2RN8 A;  2Y4Y A;  1RUW A;  4A4H A;  1W1F A;  3SWN B;  2KEA A;  3RER A;  1E6H A;  1VQ4 A;  3CCJ T;  2RI5 A;  4J9D A;  2LCL A;  5IHK A;  2AT1 B;  2D6F A;  5C6S A;  1K73 R;  5GAO r;  2C06 A;  5LJ3 e;  4BE0 A;  1D0Z A;  2JXB A;  4ZTF A;  3CC2 A;  2W10 A;  1U3O A;  3SDZ A;  3C0C A;  5IXB A;  2EQU A;  3C94 A;  2M0Y A;  3PMT A;  1VQ6 A;  2EYW A;  5LJ3 d;  2DL8 A;  4Z02 A;  2E64 A;  3IQL A;  1VQL A;  4A4F A;  1SHF A;  1N6A A;  3MPU B;  4M78 E;  4PL6 A;  1I5O B;  1WQ7 A;  2L8D A;  3LH5 A;  3OYD A;  1BU1 A;  3NTK A;  2VWF A;  1BKB A;  2A7Y A;  2JTM A;  2MI6 A;  1YJN T;  2R58 A;  3TQ7 P;  5A2Q E;  4K11 A;  2EGE A;  2X4Y A;  1EX4 A;  4JRQ A;  2MAM A;  3FRN A;  4KT0 E;  4BI3 A;  1M90 C;  4LDU A;  2FZK B;  2HCK A;  3QWY A;  1U5S A;  2F2X A;  2L3S A;  1K73 C;  4QQ6 A;  3QHS A;  5DM7 R;  4HVU A;  2CH4 A;  1YIJ A;  4D6W A;  3M54 A;  3JB9 D;  1JO8 A;  4C0F A;  2DNU A;  1K9M C;  2RI2 A;  5GAO l;  2X4X A;  4M75 E;  4F7U E;  3OBY A;  1QKW A;  5GAO n;  4J83 A;  1JB0 E;  4QT7 A;  3NTI A;  4OF1 A;  4DQ2 A;  2JMA A;  5CVI A;  1X43 A;  1KD1 U;  1VQN T;  1LNX A;  3L2U A;  2CZ0 B;  2FZG B;  1M1F A;  1VYU A;  1UUE A;  4XTV A;  4HCB A;  2E3I A;  4OB2 B;  1SPK A;  4VUB A;  1VYT A;  1RI9 A;  2HQH A;  4BE1 A;  2VB6 A;  1Y57 A;  2FPE A;  4IIM A;  3JCM c;  3QBY A;  4P5N A;  1G8X A;  1VQO T;  2OTJ T;  2K7A A;  3VS0 A;  1JJ2 A;  4BI8 B;  3OBW A;  4ATO A;  5CQY A;  1GFD A;  3MEU A;  2RHI A;  3PTA A;  4X9D A;  3FC3 A;  5LL6 S;  5GAN f;  4KUD K;  4LD9 K;  1HSQ A;  4N4I A;  3CCE T;  5IHI A;  3DB3 A;  3BE3 A;  3JCM b;  4X9C A;  2EKH A;  2O01 E;  2K5I A;  1YI2 A;  3LWH A;  2YHT A;  3I55 Q;  2AIR B;  2GQI A;  1YIT A;  4EIK A;  1TXQ A;  3EG9 A;  2C0T A;  3M0Q A;  2ED1 A;  5HKC A;  3QO3 A;  2ZAE A;  1IZ6 A;  1G2B A;  2I2L A;  2DRM A;  2L89 A;  2JM9 A;  1NPR A;  1ACM B;  5FRM A;  2YUN A;  2QA4 T;  1M4Z A;  1VQ7 A;  1NM7 A;  1VQ4 Q;  1X75 C;  3CCQ T;  3UWN A;  1N8R U;  4RCB A;  5L8R E;  3JB9 G;  3GNF B;  2DJZ A;  1MMA A;  2DBM A;  3JCM X;  1SSF A;  4HVW A;  1WFW A;  1PNJ A;  2KE9 A;  4NL3 A;  2DVJ A;  2RHZ A;  4N0A A;  3CCM A;  4CC2 A;  2DRK A;  5GMK m;  1BIB A;  3M0T A;  1YJ9 A;  4E7I A;  1VQL Q;  4FL6 A;  4A54 A;  4Y28 E;  3FEO A;  2RQT A;  1ZSZ C;  1R0B G;  1RAD B;  2KGT A;  1QQJ A;  5FWB A;  4QVD A;  4PK4 A;  4EMG A;  2EJ9 A;  4NOY A;  3QG1 A;  2NUP A;  3OYL A;  2K6D A;  4ZN3 A;  1BI1 A;  3UT1 A;  2LRQ A;  9ATC B;  2XDB A;  4C92 A;  2AHJ B;  4A4G A;  1WIE A;  1YNZ A;  5J3B A;  2DJQ A;  2DL4 A;  3L1A A;  2E6N A;  4B6M A;  3JB9 F;  1YIJ Q;  3G71 T;  4JJN K;  1NLP C;  1PRM C;  1GCQ A;  2DE0 X;  1X69 A;  3L2V A;  3L2W A;  1X01 A;  5KCO A;  1YHQ T;  1X6B A;  2DTI A;  4C0Z A;  1WHJ A;  5GAN 7;  5KYW B;  2FVU A;  5GJW B;  1N8R R;  2EYY A;  1HYO A;  4OMF B;  4LE9 A;  1KG1 A;  4BUG A;  2RNA A;  2WSC E;  1JXM A;  5KYU B;  3O8V A;  1TWB A;  2ZPF B;  3VS2 A;  1G3S A;  2KVQ G;  3CC7 Q;  2G3R A;  2EJG A;  5CK9 A;  1QWE A;  3RKY A;  1W6X A;  2CDT A;  1WHH A;  2BZX A;  1I4K 1;  3CMA T;  3A8O B;  5IH2 A;  1YI2 Q;  5FLX E;  3HPW A;  3CCR T;  2LQ8 A;  4IUU A;  2X3W D;  1YIT Q;  3MEV A;  2ROL A;  3S3O A;  1KIK A;  4J9B A;  5KYY A;  2KDS A;  3CPF A;  4AFQ C;  3EFO B;  3HSB A;  1VQ7 Q;  1UGV A;  1TUG B;  1MMD A;  2F1L A;  3O5Z A;  1SF9 A;  2E70 A;  1S72 A;  4LUD A;  2CP7 A;  2EJF A;  3EFR A;  3I56 T;  2J6O A;  5GAN j;  1YN8 A;  5FU7 B;  1VQ8 T;  3CME A;  4OB3 B;  4XU2 A;  1ABO A;  2PUO B;  1PKT A;  4MML A;  2DAQ A;  1JBM A;  4HXJ A;  3CCM Q;  2KQW A;  4OGE A;  1YJ9 Q;  1KFZ A;  3EG2 A;  1SSH A;  3THK A;  1PKS A;  5CKE A;  2SRC A;  2QQ9 A;  4CRI A;  3P8B B;  2MF2 A;  3J81 E;  4M78 D;  3QII A;  1N9R A;  3EG3 A;  4L59 A;  4IUT A;  2QXF A;  1R0C B;  2JMC A;  2DX1 A;  2QDY B;  5EG2 A;  5DLO A;  2DVE A;  1KQ1 A;  2EYX A;  3BFM A;  2DFU A;  1U1T A;  2M0O A;  2K3B A;  3R6N A;  1OU9 A;  5KCH A;  4BY6 C;  3QSU A;  5LJ5 g;  2VXF A;  2K4Y A;  4DBF A;  1IO6 A;  2V1R A;  3M0S A;  2JT4 A;  4E2F B;  3QJY A;  2RQR A;  3QZ5 B;  3I9Q A;  4ME7 A;  1VQP A;  2YDL A;  4FYV B;  3OS0 A;  5GMK j;  3PIP A;  2LX9 A;  4M75 D;  1AVZ C;  3TVT A;  1VQ5 A;  2JZ2 A;  2WSE E;  1IB8 A;  4EMK A;  2YUP A;  1OQK A;  2KYB A;  3RBB B;  4N4G A;  2A36 A;  4PJO G;  4WTO B;  3H41 A;  2HDA A;  2YRV A;  4OMO A;  2A08 A;  3FJ5 A;  4HVV A;  1WXB A;  2P4R A;  4RMO A;  3A8L B;  4KGZ B;  2BUD A;  4FT2 A;  1WJQ A;  4Z89 A;  2M02 A;  3A8M B;  4C0D B;  4N0A C;  3Q1J A;  2CZ1 B;  3GF5 A;  1Q81 U;  2X3X D;  2KT1 A;  3FB9 A;  3N5B B;  1KK7 A;  1OPL A;  1WHM A;  2VYT A;  2GTJ A;  4IUR A;  1IXD A;  4CC7 A;  4E7L A;  4M7D B;  1AOJ A;  2COW A;  3LLR A;  5I22 A;  4M78 G;  2RPN A;  1PCX A;  4DBR A;  2KXC A;  4XTY A;  4ZN1 A;  3E9F A;  2BKD N;  2OTL A;  5CKH A;  1XTD A;  3JCM J;  2OAW A;  4ORZ A;  1AWJ A;  2VAS A;  1G3Y A;  3SWN C;  1WHK A;  3CEY A;  3NMZ C;  3MEW A;  2DL7 A;  2AK5 A;  2EPD A;  3TSW A;  1S72 Q;  4ESR A;  1T3L A;  2PU9 B;  1OX9 A;  2IVW A;  1V29 B;  1VIF A;  2JTF A;  2HAX A;  3CCS T;  2AZS A;  3CME Q;  1HXD A;  3I35 A;  1I0C A;  3CBP A;  5EC7 A;  4PJO B;  2CRE A;  4TVR A;  4M75 G;  4C5H A;  2MOX A;  1YFN A;  2ZGW A;  2NYS A;  4UC4 A;  2ENM A;  1M90 U;  3G1J A;  3OYJ A;  4OML A;  5LJ5 f;  2RI3 A;  4M78 F;  1G5V A;  2RQV A;  3X25 B;  2RK1 A;  1K73 U;  1M2V A;  5GAM e;  1FYN A;  2QQS A;  1PD1 A;  4PNO A;  5KH6 A;  1ARK A;  3JCM f;  3JSC A;  5DLQ E;  1K9M U;  2ECZ A;  2LNH B;  1AEY A;  4PLL A;  4FT4 A;  5GAM d;  2F5T X;  1Q81 R;  1W2B A;  4IUQ A;  1GBQ A;  3TRE A;  1V76 A;  1VYV A;  4LDV A;  5IHN A;  4BE2 A;  2E3H A;  2EFI A;  1I8F A;  2RJD A;  4C8Q G;  2GTO A;  2CUD A;  4D8K A;  4AMC A;  3EGU A;  2CYZ B;  2VVK A;  4A53 A;  4J9G A;  3AT1 B;  2Y4X A;  3NGP A;  4M7D E;  2JOY A;  2DEQ A;  3A5Z B;  2CP2 A;  1VQ9 A;  2ZPH B;  2P0P A;  2HSE B;  4M75 F;  3QUI A;  4F7U F;  2YWW A;  2JNG A;  3RKW A;  2EKO A;  5FU6 C;  2KMT A;  3SEM A;  1W2B S;  4ZTJ A;  5LJ3 g;  1OX8 A;  1RAF B;  2XDP A;  5GAM h;  4DA4 A;  2YT6 A;  5GMK l;  2M1H A;  4XAX B;  2QEX A;  3MP1 A;  1MHN A;  3CC4 T;  3LYI A;  2DER A;  3OS2 A;  1VQM A;  2F2V A;  1K76 A;  2FB7 A;  5HY6 A;  4PJO E;  2LMJ A;  2D8J A;  2RH2 A;  3JB9 J;  1M90 R;  2DLP A;  3VV0 A;  3I55 T;  2JM8 A;  2LJ0 A;  1GBR A;  5HCK A;  2E6Z A;  2BE9 B;  2DIQ A;  2DD5 A;  3TSZ A;  1YWP A;  2C0O A;  2CSI A;  3WVE B;  2XID A;  4OVA A;  1K9M R;  3EGX A;  3VS6 A;  2NUP B;  1UG1 A;  2PVO B;  2FRW A;  3PIO A;  2OTL Q;  1U8R A;  4MMK A;  4C8Q B;  1OI1 A;  3U23 A;  2KK4 A;  1VQ4 T;  2AZV A;  3LWI A;  3CCU Q;  1Y96 A;  3M58 A;  2GGR A;  1M8M A;  1MMN A;  4CI0 C;  2CKK A;  1Y71 A;  2NUT A;  2GF7 A;  2P84 A;  4WF2 A;  1D3B B;  1NYG A;  3V7S A;  2JVV A;  5D6Y A;  1NJI R;  4PJL A;  4N4H A;  2XDD A;  3SFM A;  2D8H A;  2IPO B;  2FG0 A;  4E7K A;  2GFU A;  4FW1 A;  4RG2 A;  1JJ2 P;  1V1C A;  4BI4 A;  2FL7 A;  3G6E Q;  8ATC B;  1WJS A;  4LN2 A;  3QKJ A;  1QVF A;  2HMA A;  1BBZ A;  4EMK C;  1M8V A;  2DTH A;  4MDW A;  3OYH A;  2FPF A;  3P8D A;  4PJN A;  3DLL A;  3OSS C;  3GIB A;  1SEM A;  5ECA A;  3NTH A;  1YJW Q;  3OYK A;  3EG1 A;  4AT1 B;  1KC8 C;  3C12 A;  4M7A B;  2IIM A;  1RLQ C;  2O4X A;  1M9S A;  2P4T A;  4PJJ A;  3MET A;  2XIC A;  2J6K A;  2RJF A;  2ATC B;  1VQN A;  1IRE B;  2F5K A;  4RTX A;  1WHG A;  4XTX A;  2ZPB B;  5LJ3 f;  2BZY A;  2JN0 A;  3X24 B;  2MMP A;  3LGL A;  1NJI C;  2V26 A;  1ZSG A;  3RDV A;  1WZO A;  1VQO A;  2OTJ A;  2EIF A;  4GLM A;  5GAN h;  1I1J A;  1PHT A;  2RA2 A;  5LJ5 j;  2LVM A;  2M51 A;  2RM4 A;  1CKA A;  2G6F X;  4FCY A;  4C8Q E;  2ZPG B;  4J6X A;  4XU0 A;  2EQK A;  3RMQ A;  1QMC A;  2E5Q A;  3RIR A;  4M77 G;  5J26 A;  5CIU A;  3CC7 T;  3OQ5 A;  1M1K C;  4AFZ C;  1B7T A;  1T0H A;  2M9U A;  2DXU A;  2QEX Q;  3ULR B;  2I0N A;  1JJ2 S;  4ZGJ B;  4GBQ A;  4M78 A;  1VQM Q;  5CAI A;  4XTU A;  4F16 A;  1YI2 T;  4QQD A;  1B34 A;  2MCN A;  1LVK A;  1TUD A;  2QYZ A;  5KYX B;  2YUQ A;  2OI3 A;  2LCS A;  2LC4 A;  2X4J A;  3CC2 Q;  3M53 A;  4II1 A;  5AT1 B;  2E41 A;  2JUF A;  1SRL A;  1VQ7 T;  2HKN A;  5L23 A;  4F14 A;  4RTV A;  1VQ6 Q;  2ZCF B;  1QLY A;  2V8J A;  4M7A E;  1TH7 A;  1ZX6 A;  3M59 A;  4PLI A;  1AT1 B;  5IXF A;  1SRM A;  2DPP B;  4M75 A;  4F7U A;  1YCY A;  2C0I A;  4XU3 A;  1UJY A;  4BB7 A;  3CCM T;  1TOV A;  1UGS B;  1BIA A;  2VGN A;  2DD4 A;  2HBW A;  3M56 A;  5I2M A;  1X6O A;  4M77 B;  1TUC A;  3OW2 P;  3SWN A;  3OA6 A;  1VUB A;  3HRU A;  1UEB A;  3VS7 A;  1UGQ B;  3PVQ A;  1MV3 A;  2Y90 A;  3SHW A;  5KE3 A;  1FXX A;  2A3L A;  4BAC A;  1MV0 B;  2EAY A;  3JV3 A;  4DEY A;  3G71 A;  1FMK A;  3NFC A;  2K5F A;  3CCL A;  3CD6 A;  3L42 A;  2XK0 A;  1K0X A;  2KYM A;  2CZ7 B;  1WDX A;  1WQW A;  2CGH A;  5A0G A;  3F70 A;  2DO3 A;  3G4S T;  1VQN Q;  2E10 A;  1XOV A;  1YHQ A;  1JU5 C;  2LX7 A;  1RI0 A;  1R8O B;  2BE7 D;  3A8H B;  4JUV A;  4DBH A;  4J7I A;  4FYY B;  3CCV T;  1JQQ A;  4PKC C;  1H3Z A;  4QVC A;  3CBO A;  4RUG A;  3OW2 A;  4A63 B;  3BDU A;  4XU1 A;  2OTJ Q;  1ZQ1 A;  2V8K A;  1AZE A;  3MKD A;  2E12 A;  2KAF A;  4M7D D;  3PVL A;  2ZZD A;  4HCC A;  3GNG A;  4FYX B;  3JCM P;  1C1A A;  4AFU C;  3GP8 A;  3PGG A;  2EVR A;  1H8K A;  3P8H A;  2EQM A;  2WAC A;  1KQS A;  3KFV A;  3CMA A;  2LZ6 B;  3OY9 A;  1OU8 A;  3OYN A;  2ZPE B;  1Y0M A;  4GLK A;  2HBP A;  3CCR A;  2D0N A;  2E65 A;  4BDZ A;  4Z8A A;  3OW2 S;  1X6G A;  1EIF A;  1K8A U;  5LJ3 j;  1HJD A;  3ME9 A;  1IRX A;  3CPW A;  3V8K A;  5J39 A;  3KBG A;  3UA7 A;  4M77 E;  1X2K A;  1BI3 A;  4J9F A;  2A37 A;  1YCS B;  4PJO D;  2ED0 A;  5GAN 5;  4DEX A;  1M2V B;  1E6G A;  4KGV B;  2DL5 A;  3OYG A;  3OYE A;  1UB4 A;  3I56 A;  1OZ2 A;  3M9Q A;  1GL5 A;  4NL2 A;  1OOT A;  2CT3 A;  3LGF A;  2EGA A;  2B8A A;  2CZ6 B;  1H3H A;  3MO8 A;  1D09 B;  1NBE B;  1ZSZ B;  3EGD B;  1HD3 A;  4LXC A;  3A98 A;  3CME T;  2O88 A;  1N5Z A;  2FHD A;  1OPK A;  1PSF A;  5CQX A;  2O9V A;  3URG A;  4GY5 A;  4D8D A;  2K2V A;  2HZY A;  5CKB A;  4PJO C;  3V8J A;  4M7D G;  1BB9 A;  1K1Z A;  4KBM B;  1I5L A;  1UGR B;  1SKU B;  2LQW A;  1RAH B; 
#chains in the Genus database with same CATH homology
 2NYS A;  1OUL A;  1ZSZ B;  2QAS A;  1OX8 A;  1OU9 A;  1YFN A;  2QAZ A;  1ZSZ A;  1ZSZ C;  1TWB A;  1OU8 A;  1OX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...