5GAMf

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
molecule tags Transcription
molecule keywords U5 snRNA
total genus 8
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamf00
2DXTA 3JB9J 4F7UE 4PJOF 3HSBA 1LNXA 3EFRA 2DEQA 2VXEA 5I21A 4M75F 4M7AF 2DTIA 3JB9H 4M7DG 4C8QF 2E41A 3JCMW 2ZGWA 3JCMe 3V7SA 4M78C 2DZ9A 1N9RA 1WNLA 3RKXA 4J6YA 4NL2A 4C8QC 3HFOA 5GMKh 4M78E 3JCMJ 4XU2A 2RB6A 4JRKA 4PJOA 4M7AD 5GAN6 2YLCA 4F7UA 4M7AB 4F7UG 2DVEA 4A53A 5GAN8 4M7DE 4PJOC 1KQ1A 4M7DD 1BIAA 2E10A 3JCMg 4EMHA 5GAMg 1BIBA 2EJGA 4QVCA 5LJ5f 4HA8A 4M78D 4C92A 4M75D 1KQ2A 4N0AA 4NOYA 2EJ9A 4XTWA 3SWNC 3JCMX 4M7DF 4HT8A 3BDUA 4OP0A 1U1TA 4A54A 5GANe 3JB9I 4PJOD 4XTZA 2CGHA 4JRIA 3V7RA 4EMKC 1I81A 5LJ5d 3SWNA 2YHTA 3QSUA 4C92E 3RKWA 5GMKj 5LJ5h 5LJ3h 4C92F 2DJZA 4JUVA 5GANh 4HT9A 4RCBA 3RIRA 2FB7A 3VU3C 3JB9D 5GMKi 1WQ7A 2YLBA 4M77C 5LJ5j 4M7DB 1H641 3FJPA 4XTXA 4WF2A 2QTXA 5GAOn 4M75B 4F7UF 4N0AC 4MMLA 3RKYA 4RCCA 3V8LA 1LJOA 3QHSA 4X9CA 2EAYA 5GAN2 2DKGA 5GANf 4XTVA 2K57A 3V8KA 4C8QE 4C92G 5LJ3g 1M8VA 5GAOr 4C92C 5GAN3 2DXUA 5LJ3d 3BW1A 4J6XA 3SB2A 1TH7A 4C8QG 3JCMb 4PJOB 3QUIA 4EMKA 4M7AG 4PJOE 4V2SA 4EMKB 4PNOA 3RESA 3JCMf 3QO3A 3GIBA 3JCMP 3L1AA 4M77A 1MGQA 1I4K1 4PJOG 2DZCA 1WPYA 4C8QA 3JCMV 5GMKe 4MMKA 4XQ3A 5LJ3e 5GAOm 5GMKm 2E1HA 5GANg 1B34A 4M78F 1Y96A 2FYKA 1I5LA 1I8FA 1LOJA 4NL3A 3FB9A 4JLIA 3HFNA 5GAOq 4M78B 4M7AC 2VXFA 4M7AE 4XU1A 5GAMf 1YCYA 4J5YA 5GMKl 4Y91A 4C92B 3PGGA 4M75A 4M7DC 1WQWA 4C92D 4M78A 4C8QB 3JB9F 5GAN5 1D3BB 1HK9A 3M4GA 5LJ5g 4M75G 1M5Q1 3L2ZA 5GAN7 5GAOp 2EWNA 4M75C 3EFSA 4M7DA 4M77G 3JCMd 5GAMh 5GAOl 5GANj 5GAN4 2RM4A 4F7UB 3AHUA 4M75E 4X9DA 5LJ3j 2E64A 4M7AA 4XTUA 2I2LA 5DY9A 4EMGA 1U1SA 4M77F 5LJ3f 5CAIA 3JCMQ 2HNIA 2RD1A 4QVDA 3V7CA 2RA2A 4J6WA 1Y96B 5GANd 3JB9G 3JCMh 2DTHA 1JRIA 5LJ5e 3FIFA 5GAMd 1N9SA 4C8QD 2DTOA 4M77D 2VC8A 3BY7A 4M77E 4XTYA 4M77B 1X01A 2EJFA 4XU3A 3RERA 5GAMe 3RUXA 5GAMj 3SWNB 3V8JA 1B34B 3BFMA 1JBMA 1HXDA 2JN0A 2E65A 2Y90A 4M78G 3INZA 4XU0A 3JCMc 1D3BA 4DQ2A
chains in the Genus database with same CATH superfamily
4F7UE 2F5TX 1BYMA 4C8QF 2P0PA 3NTKA 2LDMA 4J6YA 4C8QC 2COWA 4C0DB 4LD6A 9ATCB 2E10A 3OB9A 3TSZA 1W2BP 3OYAA 4PJNA 4WCIA 2BTTA 1W2BA 1KHIA 3MJXA 4MDWA 3CPWA 2O2OA 3PT9A 4J9GA 3TVTA 3M0SA 2EYWA 1JJ2A 2HD0A 1D0YA 1D1CA 4AG1C 4NS5A 3X26B 3FDRA 3JRZA 2QK0A 4AG2C 1KQSS 1KC8U 1AT1B 4C8QE 3OS2A 2HKNA 3D7SB 2K6DA 4FCYA 4VUBA 3WVEB 3JCMf 1YJWQ 1GBQA 2DZCA 1WHLA 2ZPBB 4F04B 1G3SA 5ECAA 3I9QA 3OYMA 3L2VA 4QT7A 1JXMA 2O4XA 3A5ZB 1WQWA 1AZGB 4M78A 2VV5A 5LJ5g 1XOVA 5CKHA 4ORZA 1RLPC 2M9UA 2PVOB 2RM4A 1BKBA 3H41A 3CPWS 2KNBB 1PRMC 3QXEB 1X27A 3Q1JA 1VA7A 5GANd 1G3TA 4J9FA 2FPFA 2OTJT 1ZSZA 4ELYC 2ABLA 5KYXA 3META 3I56Q 1WXUA 3SWNB 3V8JA 5FLXE 1QKXA 2EQKA 4C0ZA 3WXMB 2J06A 3JB9J 2R5AA 3MP8A 5C0MA 1ZSZB 3QJ6A 2KYMA 1PNJA 2KI7A 1EX4A 3QYGB 3MP6A 1K1ZA 3CCLT 1K73U 1BCOA 4M7AD 1WI7A 5GAN6 5KYUB 3CCMA 3JCMg 2AKKA 3I55T 3CCSA 1BIBA 3IQLA 2CUDA 1OX8A 3MP1A 4J9DA 2LC4A 3CMET 2ENMA 1YITA 3JCMX 2YWWA 1VQLA 3OMGA 2LCSA 4M7DG 1BI1A 5GANh 3QBYA 1VIEA 4KULA 5CKBA 2MCNA 2ZZDA 2KMTA 1S72A 1M30A 4FL6A 4LUDA 1YJNT 2JVVA 1K0XA 1TH7A 1PCXA 2C0IA 3TQ7P 1AOJA 1Q7YU 1MGQA 5GMKe 3CCRQ 1T0HA 2E5KA 3S3MA 4ANJA 4M7AE 2QA4A 2DIQA 4OMNA 5IXBA 2VKNA 5J26A 3L2ZA 4LE9A 4LD9K 1WXTA 2MF2A 1ZA2B 2NWMA 1UG1A 4J9BA 2LJ0A 3S3OA 1TS9A 3CCSQ 3QWXX 3EG3A 3CBMA 2RQWA 2MWOA 3I35A 1VQOT 3NGPA 2L3PA 1NJIU 1D1BA 2D0QB 1VQKQ 2DEQA 5KE2A 5HKCA 2QDYB 4HVWA 1OI1A 2DTIA 2MPXC 2L0AA 3LWHA 2YUQA 1VQMA 2GNCA 2EVRA 5DM7R 1X6GA 2A37A 2CZ6B 4PJOA 1FMVA 3X20B 2P0QA 1BIAA 4HVUA 2A0FB 1M1KU 2MAMA 3PE0A 4Z8AA 2RHUA 4C5IA 4JRPA 1U1TA 4D6WA 1OEBA 4XTZA 1KD1C 4EMKC 3QSUA 7AT1B 2QG9B 2R57A 1PSFA 3J80E 1YWPA 4OGCA 1M3AA 5EG2A 3RKYA 4X9CA 1TUGB 2QEXA 2DRKA 1ZSGA 3M4YA 4C92G 2LMJA 1VQ7A 3UWNA 3QUIA 3OYCA 2WSEE 3NFCA 1NG2A 4AMCA 3JCMP 1UGRB 2EYZA 4FT2A 5GMKm 1OV3A 4FM4B 2D9TA 3H6ZA 3VUZA 1I5LA 4J83A 1VQ9T 1WHMA 2XIDA 3CCMT 4E7JA 3THKA 3P8DA 2BKDN 2OTLA 2D1XA 1VQ5A 3J7AF 3M9QA 2M0YA 3NTHA 2XK0A 2H3EB 1JQQA 1M4ZA 2RK1A 4PJJA 1WX6A 5I11A 3HHTB 3QYHB 1EZZB 2CSIA 2EFIA 4BI8B 1KFZA 1VQ4T 2CP7A 1IRXA 4QVDA 4J6WA 1RAAB 1RI0A 4TVRA 1K9MC 3ZBDA 4RG2A 5AYFA 1ZA1B 1BK2A 3CC2Q 2QGGA 3RUXA 2BZYA 2RJDA 2DYBA 2QAZA 4LN2A 3HSBA 2ZPEB 3PIPA 3CXCP 5IN1A 1NEGA 3EH1A 2XI9A 1SRMA 3QPHA 4L5GA 4PJOC 4B9XA 1Q95G 3CC7Q 1VQKT 1OPLA 2O01E 2XKOC 2P84A 4JZ3A 1QVPA 4HA8A 2K3YA 4M78D 4QQGA 1YJNQ 4K11A 1Q7YC 1GRIA 2J05A 4OP0A 4JS4A 2QEXQ 2HMAA 5GMKj 4Y28E 4E7LA 2I0NA 1VQ9A 1LJOA 2X4YA 1M3BA 3TCJA 4A63B 4A4KA 5GANf 2EYYA 4IIOA 4J9HA 1UEBA 3C0CA 3OW2P 2ZCFB 1IGQA 2G6FX 4PJOE 2XDBA 4MZTA 2DBMA 2DAQA 1I0CA 4PJOG 2OAWA 4XQ3A 2F2VA 2LP5A 1Y96A 4KT0E 4J8OA 4JLIA 3HFNA 2RHZA 1RL2A 3CMAQ 4QW2A 5GAMf 4PFOA 4J9EA 3EGDB 3S6WA 4E2FB 1U5SA 3CCJT 4B6MA 1HK9A 4F14A 1ZQ1A 1HD3A 5CAIA 1TU0B 2CT3A 2DL4A 4FIBA 2DK3A 3CC4Q 1C0MA 2LX7A 3A8MB 2HBPA 2ECZA 2COYA 1M1GA 1R8OB 5GAMj 2E65A 3E9FA 4FT4A 4OVAA 4XU0A 5DLQE 4OB1B 1NM7A 1K73C 3URGA 2JUFA 1QVFP 1VQMT 1YITT 1Q81U 4LDUA 2JXBA 3UF4A 3C12A 3OYIA 4UC4A 1WFWA 1Q86R 3M0PA 4LDYA 4BY6C 1NPRA 3VS4A 1YJ9T 1Y7XA 1KHCA 3RNJA 4X1VA 4ZNXA 4M4ZA 4QQDA 1JXOA 3CXCS 1M9SA 1YIJA 1G3WA 1QVGS 4MDXA 2NUPB 3OBWA 3JB9D 1FMKA 5KYXB 3L2WA 2QYZA 4ZN1A 2L2PA 2C0OA 2VUBA 1PKTA 3EGDA 1X2KA 2E3HA 4RUGA 3QIIA 1MMNA 1I5OB 4X34A 4OMFB 2EQJA 4C0DC 3CCJA 5KCHA 4MZPA 2QXFA 5C6SA 4J6XA 4DA4A 1VQNA 1BB9A 2QA4T 3GIBA 1ZUUA 2DD4A 2KE9A 2J6KA 4E47A 2CZ1B 3JCMV 2IVWA 1FX7A 1B34A 1VQ5Q 2IG0A 1W6XA 1N8RC 3FB9A 3EG9A 2FPEA 4N4HA 1BCMA 1C1AA 1WHHA 3OYFA 1B07A 2OAUA 4Y91A 4M75A 4C92D 3ASKA 1D3BB 1YP5A 5GAN7 3DLLA 5KYWA 2E6NA 5FU7B 1K76A 4QKUA 1GXIE 5LJ3j 5A0DA 5FRMA 1GCQA 2QGFB 1MV3A 5M9OA 4OMMA 4C8QD 4OMLA 5GAMe 1SF9A 2CH4A 4JJCA 4BB7A 2F5KA 2CP2A 4BY6B 2V1QA 4BI4A 2X3WD 1WGSA 1JB0E 4FYYB 5LL6S 2G3RA 4M7AF 2ZGWA 4RTWA 2HZYA 3I5RA 5CQXA 4Z89A 2CSQA 3HFOA 1VQPQ 1KJWA 3PVQA 2FVUA 1ARKA 3QDRB 2LCCA 1G3YA 2QQ9A 2PVDB 3CEYA 4L59A 4J7IA 1VQNT 2ATCB 4N0AA 5IH2A 3H8ZA 3TU4K 2M0OA 3V7RA 5LJ5d 1QVFA 1S72T 1WYXA 2YDLA 3VU3C 3CD6A 1NJIR 1KIKA 1I07A 2KAFA 2QTXA 4J7FA 2MYSA 4F7UF 2HQHA 3H0IA 3QHSA 5CVIA 1UJYA 3FEOA 2HKQB 1VQ7Q 3NHNA 2XMFA 2RHYA 4JPBW 2FPDA 3CCUT 2RMOA 3VV0A 3NPFA 2D6FA 2HL3A 3QWYA 1UJ0A 3EG0A 1Q86C 3OA6A 1M90R 4FW2A 1KG1A 1ZSZC 3H0HA 3GPLA 4M7DC 3LX7A 3JB9F 1UFFA 2DL5A 4FU6A 4M75G 2A7YA 1RUWA 4OMQA 1VQLQ 2DYIA 4M7DA 2A08A 2DILA 2KBTA 3EAEA 4IUUA 5GAMh 4D8DA 3ZL7C 2E64A 8ATCB 2EYQA 1Q82C 2HAXA 1SSFA 2CZ7B 2RJFA 1M2OA 2ROTA 3JB9G 1YBYA 3G4ST 2BUDA 1VQ6T 1Y07A 2L3QA 3I56T 1X43A 3EGXB 4XTYA 4M77B 4JJNK 2X4XA 2VGMA 1UGPB 1HSQA 1U8RA 1K9MU 3CCQA 2K2MA 3GLXA 1ZUYA 4FYVB 5CK9A 5KYYB 1Q82U 1ZX6A 1Z9QA 2R5MA 3AT1B 3G7ZA 3A1PA 1OPKA 2YRDA 4RTXA 2KDSA 4DBQA 2RHXA 1UUEA 1RACB 1QWEA 3P8BB 1ZBXA 2BIVA 2KGTA 1M2VB 5GAN8 4F7UG 2L3RA 2SEMA 5GAMg 4Y92A 5I2SA 5L8RE 3H9NA 5IXFA 3M57A 1UDLA 3HKSA 1SG5A 2LQNA 1Q81C 1TSFA 5CKFA 1PSEA 5A0LA 1IO6A 1VQPT 2EQIA 3MKDA 3VS2A 1JJ2S 3GNFB 2JT4A 4KH0B 1YIJT 2JM8A 2K9GA 3RKWA 4BDZA 1VQ5T 2DJZA 2VWFA 2KT1A 2QQSA 4Z02A 1QCOA 2QASA 2HQEA 4ZTFA 2LRQA 5GAOn 1GBRA 1AHJB 2GQVA 2K3BA 2X9HA 1QQJA 2YSQA 5GAOr 3HL8A 1V76A 4EMKA 2AT1B 4O5VA 2GFUA 5LJ3e 1S1NA 1WPYA 2M02A 1LOJA 3QDFA 2RQVA 1WA7A 3CPWP 2K5FA 3FLGA 8AT1B 1W70A 1NZ9A 5IHIA 1UGSB 1IHVA 2EBPA 3UDCA 1AWWA 2RD1A 3VS7A 3CC4A 2RPNA 3E9GA 2DTOA 4M77E 2WSCE 2JW4A 3TREA 4XU3A 4AT1B 3JSCA 3BFMA 1H3HA 2EKHA 1WHKA 1VQOQ 3CCET 1N8RR 3X28B 3CCEQ 1D0ZA 3VKIA 2OTLT 1XQHA 1K8AC 3V7SA 3MHXA 2BZXA 4KUDK 3PFSA 1GFDA 1VQ6A 1PD0A 4PJMA 2OTLQ 4EIKA 1SPKA 3SEMA 2KVQG 4PFPA 4M7AB 3CCLQ 2KK4A 1K9AA 5A2QE 3O8VA 2FZGB 2PNIA 4ATOA 1AD5A 1MNDA 1SEMA 2QQBA 1IXDA 3JB9I 4QVZA 5KH6A 3SHWA 1AEYA 3PIOA 2Z0WA 3JAME 1QVGA 3G6EQ 5KCOA 5KYWB 2D0NA 5D6WA 1KC8C 1R0CB 4E7SA 4J9CA 4KGVB 3QKJA 5GAN2 3UPUA 3QZ9B 3EHRA 3V8KA 1M8VA 3S3NA 1AWJA 1KD1R 4XK8E 1VIFA 1FXXA 4DOWA 3L1AA 4MMKA 2EGCA 3CCQT 1OOTA 3BE3A 4KBMB 2JJ9A 2HBWA 2RJCA 3UA7A 2O9SA 2EYXA 3LH0A 4AFUC 3A8OB 1LVKA 1MV0B 2RN8A 1ABQA 1F1BB 3MEAA 1WJSA 2L5QA 5D6XA 5CIUA 5CQYA 2XDDA 3KBGA 1M1KC 3M0UA 3VS1A 5EC7A 4A4FA 4XTUA 4EMGA 1VYTA 2EGAA 3HTRA 4DEXA 1YITQ 4DEYA 2NLUA 3OS0A 2XD0A 4M77D 1YHQT 1HYOA 2EPDA 2YUNA 3M54A 1JBMA 1OZ2A 2V8JA 1YCSB 4HKEA 3JCMc 2ZPGB 1N8RU 3VS0A 1RAHB 2C0TA 1J3TA 2GTOA 3O5ZA 2ZPIB 4RTYA 2RO0A 2F1LA 1OX9A 3CD6Q 2J6FA 2L8DA 2YLCA 4F7UA 4HCKA 1MMGA 3CD6T 1V1CA 2LT4A 5LJ5f 4JJDA 2HL5C 3LW5E 1GCPA 3P8HA 2CUBA 3J81E 2RQTA 1G2BA 3OYNA 3BDUA 4C5HA 2CH4W 1S72Q 1RAEB 4CC4B 2AZVA 2DM1A 2A28A 2LCLA 5GMKi 1YI2T 3N5BB 1VYUA 4MMLA 4RTZA 3V8LA 5GJVB 2EAYA 1MHNA 3HRTA 1K0SA 2GF7A 5GAN3 1TOVA 3OS5A 4EDUA 1YJ9Q 2E12A 3A98A 3OYYA 1OQKA 1N6AA 4PNOA 1I1JA 4OGEA 1RAIB 3U23A 1BI0A 3SDZA 1UE9A 2E1HA 4DBRA 2FHDA 5GJWB 4NL3A 1T0JA 1UTIA 2MOXA 1TUCA 1VQOA 3CCUQ 5GMKl 3ZFJA 3M0TA 3EG9B 1K9MR 3CCVQ 5GAOp 4HCZA 3CCQQ 2K2VA 1XJWB 4M77G 3G4SA 4KGXB 2AKLA 4M75E 2J6OA 2JMCA 4DBHA 3QJYA 3VYHB 3OYGA 2DXCA 2AHJB 3SFMA 1KSWA 1M3CA 4PL6A 2JN0A 3CQTA 4F17A 2DF6A 1VQNQ 3HRSA 5KE3A 5IT9E 5CKDA 2K5IA 1PWTA 5FU6C 2RK2A 1IGUA 3UATA 1T3LA 2V8KA 2XG8D 1VQ6Q 3JCMW 1NYFA 3JCMe 2K5LA 1WNLA 2W10A 4M78E 1KK7A 1PD1A 4IUVA 1T3SA 2ZPHB 2LX9A 1GCQC 3CC7T 3G6EA 3ULRB 3KXTA 2Y4XA 3GNGA 3DB3A 2MWPA 2SRCA 1YWOA 1XTDA 1YJ9A 1M1FA 3H0FA 2X51A 2DKGA 5LJ3g 1YN8A 4C5EA 4P5NA 2DVJA 3BW1A 5LJ3d 1QLYA 2B86A 1X6OA 1EFNA 2P4TA 3RMSA 2PUOB 2KXCA 5GANg 3VS6A 1RAGB 3CCVA 2HQXA 1OU9A 2YXYA 5IHKA 1TG0A 4JLGA 2DMOA 4M7AC 3GP8A 1U06A 3E19A 1Y71A 2AIRB 4IUPA 2K79A 4C0FA 4LXCA 2FL7A 1VQ7T 2FRYA 3VJPA 3EH2A 5GAN5 2PQWA 4A4GA 3JCMd 2ROLA 1RADB 2V8IA 5HCKA 1U1SA 2RJEA 3A8LB 3CCEA 1NLOC 2HNIA 2VB6A 3REAB 1AWXA 4R55A 2MI6A 4GLKA 6AT1B 2EJFA 3RBBB 3PTAA 1DJ7B 1B34B 3SD4A 1QVFS 2KR3A 2F2WA 2DPPB 3CCJQ 3INZA 2AZSA 2HSPA 2H8HA 1GL5A 1JU5C 1P92A 2EIFA 3EFRA 3M0QA 5I21A 3C4SA 3JB9H 2DL8A 3F70A 2CS7A 3M58A 1NEBA 2LJ3A 3PVLA 3LH5A 2BZ8A 1QKWA 5CR2A 2DFUA 3OYKA 4M7DD 2KRNA 2EJGA 4QVCA 2JS0A 1KQSA 2WACA 4MZMA 1KQ2A 4O6JA 3NTIA 4M7DF 1KQSP 2M51A 3MEUA 5GANe 1YFNA 2YRCA 5LJ5h 3FRNA 5CKEA 3I55Q 5A0GA 1IZ6A 1N27A 2KRMA 1WQ7A 1N5ZA 1D09B 2PU9B 5FWBA 2JTEA 2K57A 4ZGDB 3R6OA 1W1FA 4IUTA 2OTJA 4J9IA 3G6ET 3JCMb 4PJOB 5I2MA 3KUFA 1NBEB 4LDWA 2CDTA 2OJ2A 4KGZB 1MMDA 5GAOm 1B7TA 1Y57A 1I8FA 2F69A 3EG2A 2GBQA 3OSVA 2DBKA 5DLOA 2EKOA 4PJLA 2RF0A 4OMOA 4JZ4A 1K8AR 2DJQA 3CC4T 2E5QA 4Z88A 2RQUA 1AWOA 2A36A 2EWNA 2COZA 3EFSA 2ESWA 5HY6A 3AHUA 4X9DA 4LNPA 4E7HA 1RLQC 3QZ5B 1UECA 2GCXA 5LJ3f 1X75C 2DEUA 2CREA 3V7CA 1UHCA 2RNAA 3FIFA 2IPOB 1VQ4Q 3RERA 3EFOB 1WHGA 2C06A 1UGVA 2X35A 1PC0A 2E6ZA 3I5SA 4M78G 1MNEA 2LTOA 4F7UB 1G83A 1CKBA 2NUTB 2LQ8A 3C94A 1LNXA 2RI5A 3L2QA 4CI0C 3MO8A 3FC3A 5FWCA 2KXDA 4XU2A 3VRYA 1RABB 3DLMA 4E7IA 2EW3A 4M7DE 2X4JA 1KQ1A 4E7ZA 2MIOA 3GF5A 4ZTJA 4C92A 2KEAA 5CCAA 1KD1U 3EGUA 3SWNC 3L42A 3G71Q 4A54A 3OYEA 2DETA 3EFOA 1WHJA 1CKAA 1RI9A 4FW1A 1YIJQ 3RIRA 2FB7A 3L2UA 2YLBA 1NPPA 2CP0A 4ME7A 4IUQA 1YI2Q 1UGQB 3MPUB 1JEGA 1Y0MA 4RTVA 3SB2A 4R0KA 3QG1A 1Z9ZA 3ZEHA 4BE2A 3PMIA 4C8QG 3CCRT 1AZEA 4RMOA 4M7AG 4GLMA 1VQ4A 3MEVA 1I4K1 1PG5B 2DL3A 3L2RA 1ZUKA 3UA6A 2ZAEA 3REBB 2QQRA 2VXFA 1VQ8A 4WTOB 2AK5A 4J5YA 1V29B 2DXBA 1SHFA 2O9VA 1K8AU 3LGLA 2LZ6B 2DLPA 5GAOl 4RTTA 2DA9A 2CP5A 1M1KR 2EQMA 1VOMA 1Y96B 3JCMh 2DTHA 1JRIA 5LJ5e 4Q5WA 2VASA 1TTHB 2JTMA 1VQ8T 2CP6A 4C5GA 5FW9A 1G8XA 3ER0A 2VXEA 4N4IA 1K4US 1SSHA 2K7AA 4M75F 2GGRA 2KQWA 2D8JA 1M2VA 2E41A 2RHIA 2DZ9A 1N9RA 1W4SA 4JRKA 1M90C 1YHQQ 1O75A 2IIMA 2CKKA 3TSWA 1WJQA 2CYZB 1KC8R 3BDLA 1ZHIA 2P0KA 3HPWA 1YI2A 4ELZC 3GOXA 1YJWA 4BD3A 2GQIA 4BI3A 2LNVA 3R6NA 1CSKA 1I81A 1WDXA 3SWNA 1NLPC 2YHTA 5LJ3h 3RR6A 1LPLA 2VGNA 2JMAA 4FSXA 4PK4A 4JS5A 4M77C 4RG8A 3CMEA 5LJ5j 1R0BG 1TUDA 1HJDA 4L6V5 1B3QA 5I22A 1NJIC 1PKSA 1OU8A 4RCCA 1H3ZA 1PM3A 2KT8A 1UHFA 4OB3B 2DXUA 4ESRA 3A8HB 4JDSA 4KUIA 4V2SA 3RDVA 2FZCB 2NUZA 5KYYA 4C8QA 1VQ9Q 1O9SA 3OS1A 2FZKB 4CC3A 2E4HA 3OYJA 2XHCA 2DRMA 2DNUA 2A3LA 1U3OA 3CMAA 4M78B 2O4XB 1H8KA 1QCFA 2O31A 4JJBA 3CC2T 1R77A 2GFAA 1E6HA 4C8QB 2KYBA 2JZ2A 4M75C 4AFSC 5IAYA 5DY9A 1IREB 3X25B 1EIFA 2BE9B 2ED0A 2L3SA 2EQUA 4E6RA 1X69A 3VS3A 4PKCC 2VC8A 3T9NA 1X01A 2W0ZA 1H92A 4BACA 1HXDA 5CO7A 2QQAA 2Y90A 3G71A 3LGFA 1GFCA 2XU8A 2GTJA 3G71T 4PJOF 1WXBA 1TWBA 3LYIA 2DERA 4BE0A 5KYUA 4M78C 3RKXA 4NL2A 4AFQC 4PFZA 1YNZA 4LDVA 2DVEA 4A53A 1Q86U 2JM9A 4EMHA 1ZLMA 1QP2A 4B9WA 3OMCA 4RKUE 2EJ9A 4CRIA 4ZN3A 1ACMB 2CGHA 2LQKA 1ABOA 1Q81R 4JUVA 4HT9A 5L23A 4IKFA 4OF1A 1PRLC 3OYHA 4M7DB 4XTXA 3CMAT 4N0AC 3UT1A 1M8MA 5HK0A 4ZGJB 2YT6A 4CC2A 1W2BS 1FWZA 5D7UA 4C92C 2MMPA 2CZ0B 2KY9A 4EMKB 2LJ1A 5FU7C 4M77A 2JS2A 2BE7D 1VQKA 5IHNA 3VYGA 2PZ1A 2ZPFB 4M78F 1D1AA 1G5VA 3OW2S 5HK3A 2PVGB 5GAOq 2NUTA 3M55A 4LUEA 4OMPA 3PGGA 2OX7A 2XDPA 2OTJQ 1RAFB 4QQ6A 3CPFA 3M5AA 2YUPA 3M4GA 2OI3A 1K73R 1QMCA 2FRWA 2HSEB 4LDXA 2J7IA 2JNGA 1Q82R 2DE0X 2MK5A 4RTUA 2RH2A 4AFZC 4A4EA 2RA2A 3VUBA 2K4YA 4HVVA 1VYVA 1N9SA 2E3IA 2NUPA 1YJNA 2D8HA 2CP3A 1LCKA 2H3JA 3PNWC 2HEQA 3RMQA 3LLRA 4GY5A 4PLIA 1SKUB 3G1JA 3ME9A 3HP9A 4D8KA 2VYTA 4DQ2A 4DOVA 3CCUA 4BUGA 2NYSA 4DBFA 1OYXA 3OQ5A 2LT1A 2P4RA 1AVZC 2RB6A 3I56A 2X3XD 1QVGP 1OULA 2KROA 4FYWB 3OYBA 3C95A 4FSSA 4IURA 3X24B 3CCLA 2WSFE 4NOYA 4XTWA 3E2UA 4E7KA 1D0XA 2QA4Q 2RI2A 3M0RA 3CMEQ 1NYGA 3OY9A 2QEXT 4XAXB 1C6VX 1BI3A 5AT1B 4RCBA 4IIMA 1E7OA 4HCBA 4R56A 3CCMQ 1ZBJA 2FEIA 4WF2A 1JO8A 3VRZA 2EGEA 4C0GA 2JOYA 4YTLA 5FROA 2O88A 1WLPB 1X6BA 3NMZC 3OBYA 4F16A 2DL7A 2KSSA 3EHQA 2M1HA 3RESA 1VQPA 1OZ3A 1Q7YR 3M59A 2CT4A 2FYKA 2KRSA 2RI3A 4II1A 3OYLA 1JJ2P 2K3XA 2E70A 2DX1A 1YCYA 3PMTA 2PUKB 4A4HA 4JRQA 4C92B 2HDAA 1BU1A 3KFVA 5FU6B 4HCCA 2HCKA 3MCAB 1M5Q1 2PTKA 3JV3A 2DIGA 3E1SA 4HXJA 1QP3A 2JTFA 3WVDB 4M7AA 2LNHB 2FO0A 2I2LA 2ED1A 3JCMQ 3I55A 3CCST 1MMAA 3MEWA 1BBZA 2VVKA 2V1RA 3GBQA 1VQLT 3DKMA 2M16A 3CBPA 2L89A 5J3BA 1SHGA 4N4GA 1A0NB 2DXTA 2F2XA 3LWIA 1VQ8Q 5GMKh 1VQMQ 1YHQA 3JCMJ 1NE8A 1QW1A 1MUZA 1QWFA 2DD5A 5KYNA 1E6GA 4M75D 2QTVA 1M90U 4HT8A 1VUBA 4EPCA 4PJOD 4JRIA 4C92E 2FG0A 3OYDA 1WIEA 4C92F 4KRTA 3CXCA 1IB8A 3EGXA 3HRUA 1YJWT 1SRLA 1TXQA 1H641 3FJPA 2LQWA 3EG1A 4M75B 1M27C 4CC7A 3OSSC 1BI2A 4XTVA 2Y4YA 1XNIA 4ZGEB 3A8GB 3OW2A 3CC2A 2YUOA 3QO3A 4FYXB 4KH1B 2QI2A 1X2QA 3CCVT 2LVMA 1FYNA 4OB2B 3FJ5A 1FMWA 1UB4A 2XICA 4PLLA 3M56A 4XU1A 2QDLA 2DO3A 5D6YA 3TEEA 3CC7A 3CBOA 5GANj 5GAN4 2X4WA 4BDYA 3G4SQ 3DB4A 4OB0B 4M77F 2YRVA 1WZOA 2RQRA 4BE1A 3CCRA 5GAMd 1QCNA 5J39A 3BY7A 4GBQA 1WJRA 2V26A 3VS5A 3M53A 2R58A 2B8AA 5FRNA 1IHWA 1PHTA 1D3BA
chains in the Genus database with same CATH topology
4OB1B 4F7UE 3ER0A 1K73C 2F5TX 3URGA 2VXEA 4N4IA 4M75F 1BYMA 2JUFA 2KQWA 2E41A 2RHIA 4C8QF 3CCUA 2P0PA 3NTKA 1VQMT 2DZ9A 1N9RA 2ZPIB 2LDMA 4J6YA 1YITT 1Q81U 2RO0A 4C8QC 4LDUA 1W4SA 4JRKA 4C0DB 1M90C 3C12A 4LD6A 2L8DA 1O75A 2YLCA 4UC4A 4F7UA 3OYIA 2CKKA 2E10A 1WJQA 2CYZB 4LDYA 3OB9A 3CD6T 4BY6C 3BDLA 1NPRA 2LT4A 3OYAA 5LJ5f 1ZHIA 1YJ9T 1Y7XA 1KHCA 3LW5E 2P0KA 3HPWA 3P8HA 4ELZC 3J81E 3GOXA 1YI2A 4QQDA 3OYNA 1YJWA 4BD3A 1W2BA 3BDUA 4BI3A 4C5HA 1KHIA 2LNVA 3CXCS 1M9SA 4MDWA 1I81A 1G3WA 3SWNA 2YHTA 3CPWA 1YIJA 3PT9A 1QVGS 5LJ3h 4MDXA 2VGNA 3OBWA 3JB9D 4FSXA 3L2WA 1JJ2A 2HD0A 2LCLA 5GMKi 4JS5A 4M77C 4RG8A 4NS5A 5LJ5j 3CMEA 3X26B 3FDRA 3N5BB 4ZN1A 1YI2T 3JRZA 4L6V5 2VUBA 1NJIC 4MMLA 3V8LA 4RCCA 1H3ZA 3QIIA 4OMFB 2EAYA 1MHNA 4X34A 1KC8U 2EQJA 4C0DC 3CCJA 5KCHA 1KQSS 4C8QE 3OS2A 3HRTA 4MZPA 2GF7A 2QXFA 5C6SA 4OB3B 4EDUA 3OS5A 5GAN3 2DXUA 4J6XA 2E12A 3A8HB 4DA4A 4JDSA 3OYYA 4KUIA 4V2SA 1N6AA 1VQNA 4VUBA 4PNOA 3WVEB 3JCMf 2DD4A 2QA4T 3GIBA 4OGEA 4C8QA 4E47A 2DZCA 1O9SA 3OS1A 2CZ1B 3JCMV 1BI0A 2IVWA 3SDZA 2E1HA 2ZPBB 1FX7A 1G3SA 1B34A 3OYJA 2IG0A 2XHCA 2FHDA 1N8RC 3OYMA 2A3LA 4NL3A 3FB9A 3L2VA 3CMAA 4M78B 2O4XB 2O4XA 4N4HA 3A5ZB 3CC2T 3OYFA 2OAUA 1VQOA 1N8RU 2GFAA 4Y91A 5GMKl 3ZFJA 4M75A 1WQWA 4C92D 3ASKA 4M78A 4C8QB 2VV5A 1D3BB 2JZ2A 5LJ5g 1XOVA 5CKHA 5GAN7 2E6NA 5FU7B 4HCZA 5GAOp 3DLLA 4M75C 2K2VA 1GXIE 4M77G 3G4SA 2M9UA 2PVOB 2RM4A 1BKBA 4M75E 5A0DA 5LJ3j 3CPWS 5IAYA 5FRMA 5DY9A 3QXEB 1IREB 3X25B 3Q1JA 3QJYA 1EIFA 3VYHB 5GANd 3OYGA 1G3TA 2DXCA 5M9OA 2OTJT 2EQUA 4C8QD 4PKCC 2AHJB 4ELYC 2VC8A 3META 3T9NA 1X01A 3SFMA 5GAMe 3SWNB 3V8JA 4BACA 4PL6A 5FLXE 1HXDA 2JN0A 2F5KA 5CO7A 2QQAA 2Y90A 4BB7A 2EQKA 4C0ZA 3WXMB 3HRSA 5KE3A 3G71A 4BY6B 5CKDA 5IT9E 2K5IA 3LGFA 5FU6C 2RK2A 3JB9J 2R5AA 3MP8A 2XU8A 4BI4A 5C0MA 4PJOF 3G71T 2V8KA 1WGSA 2XG8D 3LYIA 1JB0E 5LL6S 2G3RA 4BE0A 4M7AF 3QJ6A 3JCMW 2ZGWA 3JCMe 4M78C 2K5LA 5CQXA 1WNLA 3RKXA 4NL2A 3QYGB 3HFOA 4M78E 3MP6A 3CCLT 1K73U 2FVUA 4M7AD 4IUVA 3QDRB 4LDVA 5GAN6 2LCCA 2DVEA 4A53A 1Q86U 3CCMA 1G3YA 2ZPHB 3JCMg 2QQ9A 2PVDB 4EMHA 3I55T 3CCSA 1BIBA 3CEYA 4L59A 1QP2A 4J7IA 4B9WA 3MP1A 1VQNT 2LX9A 3CC7T 3OMCA 4N0AA 2LC4A 4RKUE 2EJ9A 3KXTA 3G6EA 2Y4XA 3JCMX 3CMET 1YITA 3GNGA 4CRIA 3H8ZA 3DB3A 4ZN3A 3TU4K 2MWPA 1VQLA 2M0OA 3OMGA 3V7RA 2CGHA 5LJ5d 1QVFA 1S72T 1BI1A 4M7DG 1XTDA 1YJ9A 2LQKA 4JUVA 1M1FA 5GANh 4HT9A 3VU3C 3QBYA 3CD6A 4IKFA 4OF1A 2KAFA 1VIEA 3OYHA 4KULA 4M7DB 4XTXA 3CMAT 2QTXA 4J7FA 5CKBA 4F7UF 4N0AC 2ZZDA 2KMTA 3QHSA 3UT1A 5CVIA 3FEOA 4ZGJB 5HK0A 1S72A 2DKGA 4FL6A 1W2BS 1FWZA 5LJ3g 4C92C 2MMPA 1YJNT 2CZ0B 2JVVA 2RHYA 4P5NA 3BW1A 5LJ3d 4C5EA 1TH7A 2KY9A 1X6OA 4EMKB 2P4TA 3CCUT 5FU7C 4M77A 3RMSA 1Q7YU 1MGQA 2PUOB 1VQKA 5GMKe 3VV0A 5GANg 3VYGA 3CCVA 2D6FA 2HQXA 2ZPFB 4M78F 1G5VA 3OW2S 1Q86C 5HK3A 3S3MA 2PVGB 4JLGA 5GAOq 4M7AC 3OA6A 3GP8A 3E19A 1Y71A 1KG1A 4M7AE 2QA4A 2DIQA 4IUPA 3M55A 3GPLA 4C0FA 3PGGA 4M7DC 2XDPA 2FL7A 3LX7A 4QQ6A 5J26A 3VJPA 3CPFA 1VQ7T 3M5AA 3JB9F 5GAN5 3M4GA 4FU6A 4M75G 2A7YA 2PQWA 3L2ZA 4LD9K 4M7DA 3EAEA 4IUUA 4A4GA 3JCMd 2JNGA 5GAMh 4LDXA 2V8IA 2E64A 2MF2A 1U1SA 2EYQA 2RJEA 1Q82C 2HAXA 1SSFA 2CZ7B 2RH2A 2RJFA 3A8LB 3CCEA 3S3OA 2HNIA 4A4EA 2RA2A 3JB9G 1YBYA 3VUBA 3G4ST 2K4YA 1N9SA 2BUDA 4R55A 2MI6A 1Y07A 3I56T 1YJNA 1VQ6T 3CBMA 4GLKA 4XTYA 4M77B 2EJFA 4JJNK 2X4XA 2H3JA 2MWOA 3PNWC 2VGMA 1UGPB 3LLRA 4GY5A 4PLIA 3RMQA 1VQOT 3PTAA 1U8RA 1DJ7B 1B34B 3ME9A 3HP9A 3SD4A 1QVFS 2VYTA 1K9MU 2DPPB 3CCQA 1NJIU 3GLXA 3INZA 4DQ2A 5CK9A 1Q82U 2D0QB 4DOVA 1P92A 2EIFA 2R5MA 2DEQA 3EFRA 4BUGA 2QDYB 5I21A 3G7ZA 5KE2A 5HKCA 1OI1A 2DTIA 3C4SA 3JB9H 3LWHA 1OYXA 1VQMA 2KDSA 2RHXA 3F70A 2CS7A 2LT1A 3M58A 3OQ5A 5DM7R 3P8BB 2RB6A 2CZ6B 3I56A 1ZBXA 4PJOA 2BIVA 5CR2A 3X20B 2P0QA 5GAN8 4F7UG 3OYKA 4M7DD 2L3RA 1BIAA 5GAMg 5I2SA 2EJGA 3OYBA 5L8RE 4QVCA 1KQSA 3C95A 2WACA 3M57A 1M1KU 4IURA 3X24B 3CCLA 4MZMA 2MAMA 3HKSA 2WSFE 1KQ2A 4O6JA 4NOYA 2RHUA 4XTWA 4C5IA 1Q81C 3NTIA 4E7KA 4M7DF 5CKFA 2RI2A 1PSEA 3MEUA 1U1TA 5A0LA 4JRPA 4D6WA 5GANe 1VQPT 1JJ2S 3GNFB 3OY9A 4XTZA 1KD1C 4EMKC 2QEXT 3QSUA 1YIJT 4XAXB 3RKWA 4BDZA 5LJ5h 1VQ5T 3FRNA 1BI3A 2DJZA 5CKEA 4RCBA 5A0GA 1IZ6A 1N27A 1WQ7A 4HCBA 2QQSA 4Z02A 2R57A 4R56A 2HQEA 1PSFA 2PU9B 3J80E 4ZTFA 2LRQA 4OGCA 4WF2A 5GAOn 5EG2A 1AHJB 2GQVA 3RKYA 4C0GA 2JOYA 4X9CA 2QEXA 4YTLA 5FROA 3M4YA 2K57A 4ZGDB 4C92G 5GAOr 3R6OA 3OBYA 4IUTA 1VQ7A 3UWNA 2OTJA 3G6ET 3JCMb 4PJOB 3QUIA 3HL8A 4EMKA 2KSSA 2WSEE 3NFCA 3KUFA 4LDWA 2M1HA 5I2MA 3RESA 3OYCA 1VQPA 1OZ3A 3JCMP 1UGRB 4O5VA 2GFUA 5LJ3e 3M59A 1WPYA 5GAOm 4FT2A 5GMKm 1I5LA 2FYKA 2D9TA 4FM4B 3H6ZA 1I8FA 1LOJA 2F69A 4J83A 2RI3A 4II1A 3VUZA 1VQ9T 3OYLA 2XIDA 3OSVA 5DLOA 2K3XA 2EKOA 3CCMT 4E7JA 3P8DA 2E70A 1YCYA 2K5FA 2BKDN 3PMTA 2OTLA 1VQ5A 3FLGA 2PUKB 4A4HA 4JRQA 4C92B 4HCCA 3J7AF 3M9QA 5FU6B 3NTHA 3CC4T 2E5QA 2XK0A 1NZ9A 1M5Q1 3MCAB 1M4ZA 2RK1A 2EWNA 1UGSB 3EFSA 2DIGA 3E1SA 1QP3A 5HY6A 3HHTB 2JTFA 3QYHB 3AHUA 4X9DA 3UDCA 3WVDB 4E7HA 4M7AA 3QZ5B 2I2LA 2EFIA 4BI8B 2GCXA 5LJ3f 1X75C 1VQ4T 3JCMQ 3I55A 3CCST 2RD1A 3MEWA 4QVDA 3CC4A 3V7CA 4J6WA 1RI0A 4TVRA 1K9MC 3ZBDA 3E9GA 3FIFA 4RG2A 5AYFA 2DTOA 4M77E 2WSCE 3RERA 3TREA 4XU3A 1VQLT 3DKMA 2M16A 3RUXA 2C06A 3CBPA 2L89A 5J3BA 2X35A 3JSCA 3BFMA 2E6ZA 4M78G 3CCET 2LTOA 4N4GA 4F7UB 2RJDA 2DXTA 2LQ8A 3HSBA 3C94A 1LNXA 2RI5A 2ZPEB 3X28B 3PIPA 3VKIA 3LWIA 3L2QA 5IN1A 4CI0C 3MO8A 2OTLT 1XQHA 1K8AC 3V7SA 3FC3A 3MHXA 4KUDK 2XI9A 5GMKh 3PFSA 1YHQA 3JCMJ 4XU2A 3QPHA 1VQ6A 1NE8A 4L5GA 1QW1A 2KVQG 3DLMA 4M7AB 4PJOC 4E7IA 4M7DE 2X4JA 1KQ1A 4B9XA 1VQKT 2O01E 2XKOC 2DD5A 1QVPA 3GF5A 2KK4A 4ZTJA 4HA8A 2K3YA 4M78D 3O8VA 4QQGA 4C92A 4M75D 5A2QE 1Q7YC 4ATOA 5CCAA 1KD1U 1M90U 2QQBA 3SWNC 3L42A 4HT8A 4OP0A 4JS4A 1VUBA 4EPCA 4A54A 3JB9I 4QVZA 5KH6A 3OYEA 4PJOD 4JRIA 3PIOA 3JAME 4C92E 5GMKj 3OYDA 1QVGA 4Y28E 4C92F 5KCOA 3RIRA 2FB7A 3CXCA 4E7LA 3HRUA 3L2UA 1YJWT 2YLBA 5D6WA 1NPPA 1KC8C 4ME7A 1H641 3FJPA 1VQ9A 4IUQA 4M75B 1LJOA 2X4YA 1UGQB 3QKJA 5GAN2 3TCJA 3QZ9B 4A4KA 3UPUA 5GANf 3OSSC 1BI2A 4XTVA 3V8KA 1M8VA 3S3NA 1UEBA 2Y4YA 1XNIA 4XK8E 2ZCFB 3SB2A 4ZGEB 3QG1A 3ZEHA 3A8GB 4BE2A 3PMIA 4C8QG 3CCRT 1VIFA 3OW2A 4RMOA 3CC2A 4M7AG 4PJOE 1FXXA 2XDBA 3QO3A 4MZTA 4DOWA 3L1AA 2DAQA 3MEVA 1VQ4A 1I4K1 2QI2A 4PJOG 4MMKA 4XQ3A 3L2RA 3CCVT 3CCQT 1Y96A 2LVMA 4KT0E 4OB2B 4J8OA 4KBMB 2RJCA 4JLIA 3HFNA 2RHZA 1UB4A 2QQRA 2VXFA 1RL2A 2XICA 4PLLA 3M56A 3LH0A 4QW2A 4XU1A 1VQ8A 3A8OB 5GAMf 2DO3A 4J5YA 1V29B 5D6YA 2DXBA 1K8AU 3S6WA 3LGLA 3CCJT 3MEAA 1HK9A 1WJSA 2L5QA 5D6XA 5CIUA 3TEEA 5CQYA 2XDDA 3KBGA 3CC7A 1M1KC 3CBOA 5GAOl 1ZQ1A 2X4WA 5GAN4 5GANj 4BDYA 4A4FA 3DB4A 4OB0B 4XTUA 4EMGA 4M77F 5CAIA 2YRVA 4FIBA 4BE1A 2EQMA 1Y96B 3CCRA 3JCMh 2DTHA 1JRIA 2DK3A 5LJ5e 4Q5WA 5GAMd 2NLUA 5J39A 3A8MB 3OS0A 2HBPA 4M77D 1YHQT 2JTMA 3BY7A 1VQ8T 2XD0A 1WJRA 1M1GA 1R8OB 5GAMj 3M53A 2R58A 3M54A 1JBMA 2B8AA 1OZ2A 2E65A 3E9FA 2V8JA 4FT4A 4HKEA 4OVAA 4XU0A 5FRNA 3JCMc 2ZPGB 1D3BA 4C5GA 5DLQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXT A;  3JB9 J;  4F7U E;  4PJO F;  3HSB A;  1LNX A;  3EFR A;  2DEQ A;  2VXE A;  5I21 A;  4M75 F;  4M7A F;  2DTI A;  3JB9 H;  4M7D G;  4C8Q F;  2E41 A;  3JCM W;  2ZGW A;  3JCM e;  3V7S A;  4M78 C;  2DZ9 A;  1N9R A;  1WNL A;  3RKX A;  4J6Y A;  4NL2 A;  4C8Q C;  3HFO A;  5GMK h;  4M78 E;  3JCM J;  4XU2 A;  2RB6 A;  4JRK A;  4PJO A;  4M7A D;  5GAN 6;  2YLC A;  4F7U A;  4M7A B;  4F7U G;  2DVE A;  4A53 A;  5GAN 8;  4M7D E;  4PJO C;  1KQ1 A;  4M7D D;  1BIA A;  2E10 A;  3JCM g;  4EMH A;  5GAM g;  1BIB A;  2EJG A;  4QVC A;  5LJ5 f;  4HA8 A;  4M78 D;  4C92 A;  4M75 D;  1KQ2 A;  4N0A A;  4NOY A;  2EJ9 A;  4XTW A;  3SWN C;  3JCM X;  4M7D F;  4HT8 A;  3BDU A;  4OP0 A;  1U1T A;  4A54 A;  5GAN e;  3JB9 I;  4PJO D;  4XTZ A;  2CGH A;  4JRI A;  3V7R A;  4EMK C;  1I81 A;  5LJ5 d;  3SWN A;  2YHT A;  3QSU A;  4C92 E;  3RKW A;  5GMK j;  5LJ5 h;  5LJ3 h;  4C92 F;  2DJZ A;  4JUV A;  5GAN h;  4HT9 A;  4RCB A;  3RIR A;  2FB7 A;  3VU3 C;  3JB9 D;  5GMK i;  1WQ7 A;  2YLB A;  4M77 C;  5LJ5 j;  4M7D B;  1H64 1;  3FJP A;  4XTX A;  4WF2 A;  2QTX A;  5GAO n;  4M75 B;  4F7U F;  4N0A C;  4MML A;  3RKY A;  4RCC A;  3V8L A;  1LJO A;  3QHS A;  4X9C A;  2EAY A;  5GAN 2;  2DKG A;  5GAN f;  4XTV A;  2K57 A;  3V8K A;  4C8Q E;  4C92 G;  5LJ3 g;  1M8V A;  5GAO r;  4C92 C;  5GAN 3;  2DXU A;  5LJ3 d;  3BW1 A;  4J6X A;  3SB2 A;  1TH7 A;  4C8Q G;  3JCM b;  4PJO B;  3QUI A;  4EMK A;  4M7A G;  4PJO E;  4V2S A;  4EMK B;  4PNO A;  3RES A;  3JCM f;  3QO3 A;  3GIB A;  3JCM P;  3L1A A;  4M77 A;  1MGQ A;  1I4K 1;  4PJO G;  2DZC A;  1WPY A;  4C8Q A;  3JCM V;  5GMK e;  4MMK A;  4XQ3 A;  5LJ3 e;  5GAO m;  5GMK m;  2E1H A;  5GAN g;  1B34 A;  4M78 F;  1Y96 A;  2FYK A;  1I5L A;  1I8F A;  1LOJ A;  4NL3 A;  3FB9 A;  4JLI A;  3HFN A;  5GAO q;  4M78 B;  4M7A C;  2VXF A;  4M7A E;  4XU1 A;  5GAM f;  1YCY A;  4J5Y A;  5GMK l;  4Y91 A;  4C92 B;  3PGG A;  4M75 A;  4M7D C;  1WQW A;  4C92 D;  4M78 A;  4C8Q B;  3JB9 F;  5GAN 5;  1D3B B;  1HK9 A;  3M4G A;  5LJ5 g;  4M75 G;  1M5Q 1;  3L2Z A;  5GAN 7;  5GAO p;  2EWN A;  4M75 C;  3EFS A;  4M7D A;  4M77 G;  3JCM d;  5GAM h;  5GAO l;  5GAN j;  5GAN 4;  2RM4 A;  4F7U B;  3AHU A;  4M75 E;  4X9D A;  5LJ3 j;  2E64 A;  4M7A A;  4XTU A;  2I2L A;  5DY9 A;  4EMG A;  1U1S A;  4M77 F;  5LJ3 f;  5CAI A;  3JCM Q;  2HNI A;  2RD1 A;  4QVD A;  3V7C A;  2RA2 A;  4J6W A;  1Y96 B;  5GAN d;  3JB9 G;  3JCM h;  2DTH A;  1JRI A;  5LJ5 e;  3FIF A;  5GAM d;  1N9S A;  4C8Q D;  2DTO A;  4M77 D;  2VC8 A;  3BY7 A;  4M77 E;  4XTY A;  4M77 B;  1X01 A;  2EJF A;  4XU3 A;  3RER A;  5GAM e;  3RUX A;  5GAM j;  3SWN B;  3V8J A;  1B34 B;  3BFM A;  1JBM A;  1HXD A;  2JN0 A;  2E65 A;  2Y90 A;  4M78 G;  3INZ A;  4XU0 A;  3JCM c;  1D3B A;  4DQ2 A; 
#chains in the Genus database with same CATH topology
 4F7U E;  2F5T X;  1BYM A;  4C8Q F;  2P0P A;  3NTK A;  2LDM A;  4J6Y A;  4C8Q C;  2COW A;  4C0D B;  4LD6 A;  9ATC B;  2E10 A;  3OB9 A;  3TSZ A;  1W2B P;  3OYA A;  4PJN A;  4WCI A;  2BTT A;  1W2B A;  1KHI A;  3MJX A;  4MDW A;  3CPW A;  2O2O A;  3PT9 A;  4J9G A;  3TVT A;  3M0S A;  2EYW A;  1JJ2 A;  2HD0 A;  1D0Y A;  1D1C A;  4AG1 C;  4NS5 A;  3X26 B;  3FDR A;  3JRZ A;  2QK0 A;  4AG2 C;  1KQS S;  1KC8 U;  1AT1 B;  4C8Q E;  3OS2 A;  2HKN A;  3D7S B;  2K6D A;  4FCY A;  4VUB A;  3WVE B;  3JCM f;  1YJW Q;  1GBQ A;  2DZC A;  1WHL A;  2ZPB B;  4F04 B;  1G3S A;  5ECA A;  3I9Q A;  3OYM A;  3L2V A;  4QT7 A;  1JXM A;  2O4X A;  3A5Z B;  1WQW A;  1AZG B;  4M78 A;  2VV5 A;  5LJ5 g;  1XOV A;  5CKH A;  4ORZ A;  1RLP C;  2M9U A;  2PVO B;  2RM4 A;  1BKB A;  3H41 A;  3CPW S;  2KNB B;  1PRM C;  3QXE B;  1X27 A;  3Q1J A;  1VA7 A;  5GAN d;  1G3T A;  4J9F A;  2FPF A;  2OTJ T;  1ZSZ A;  4ELY C;  2ABL A;  5KYX A;  3MET A;  3I56 Q;  1WXU A;  3SWN B;  3V8J A;  5FLX E;  1QKX A;  2EQK A;  4C0Z A;  3WXM B;  2J06 A;  3JB9 J;  2R5A A;  3MP8 A;  5C0M A;  1ZSZ B;  3QJ6 A;  2KYM A;  1PNJ A;  2KI7 A;  1EX4 A;  3QYG B;  3MP6 A;  1K1Z A;  3CCL T;  1K73 U;  1BCO A;  4M7A D;  1WI7 A;  5GAN 6;  5KYU B;  3CCM A;  3JCM g;  2AKK A;  3I55 T;  3CCS A;  1BIB A;  3IQL A;  2CUD A;  1OX8 A;  3MP1 A;  4J9D A;  2LC4 A;  3CME T;  2ENM A;  1YIT A;  3JCM X;  2YWW A;  1VQL A;  3OMG A;  2LCS A;  4M7D G;  1BI1 A;  5GAN h;  3QBY A;  1VIE A;  4KUL A;  5CKB A;  2MCN A;  2ZZD A;  2KMT A;  1S72 A;  1M30 A;  4FL6 A;  4LUD A;  1YJN T;  2JVV A;  1K0X A;  1TH7 A;  1PCX A;  2C0I A;  3TQ7 P;  1AOJ A;  1Q7Y U;  1MGQ A;  5GMK e;  3CCR Q;  1T0H A;  2E5K A;  3S3M A;  4ANJ A;  4M7A E;  2QA4 A;  2DIQ A;  4OMN A;  5IXB A;  2VKN A;  5J26 A;  3L2Z A;  4LE9 A;  4LD9 K;  1WXT A;  2MF2 A;  1ZA2 B;  2NWM A;  1UG1 A;  4J9B A;  2LJ0 A;  3S3O A;  1TS9 A;  3CCS Q;  3QWX X;  3EG3 A;  3CBM A;  2RQW A;  2MWO A;  3I35 A;  1VQO T;  3NGP A;  2L3P A;  1NJI U;  1D1B A;  2D0Q B;  1VQK Q;  2DEQ A;  5KE2 A;  5HKC A;  2QDY B;  4HVW A;  1OI1 A;  2DTI A;  2MPX C;  2L0A A;  3LWH A;  2YUQ A;  1VQM A;  2GNC A;  2EVR A;  5DM7 R;  1X6G A;  2A37 A;  2CZ6 B;  4PJO A;  1FMV A;  3X20 B;  2P0Q A;  1BIA A;  4HVU A;  2A0F B;  1M1K U;  2MAM A;  3PE0 A;  4Z8A A;  2RHU A;  4C5I A;  4JRP A;  1U1T A;  4D6W A;  1OEB A;  4XTZ A;  1KD1 C;  4EMK C;  3QSU A;  7AT1 B;  2QG9 B;  2R57 A;  1PSF A;  3J80 E;  1YWP A;  4OGC A;  1M3A A;  5EG2 A;  3RKY A;  4X9C A;  1TUG B;  2QEX A;  2DRK A;  1ZSG A;  3M4Y A;  4C92 G;  2LMJ A;  1VQ7 A;  3UWN A;  3QUI A;  3OYC A;  2WSE E;  3NFC A;  1NG2 A;  4AMC A;  3JCM P;  1UGR B;  2EYZ A;  4FT2 A;  5GMK m;  1OV3 A;  4FM4 B;  2D9T A;  3H6Z A;  3VUZ A;  1I5L A;  4J83 A;  1VQ9 T;  1WHM A;  2XID A;  3CCM T;  4E7J A;  3THK A;  3P8D A;  2BKD N;  2OTL A;  2D1X A;  1VQ5 A;  3J7A F;  3M9Q A;  2M0Y A;  3NTH A;  2XK0 A;  2H3E B;  1JQQ A;  1M4Z A;  2RK1 A;  4PJJ A;  1WX6 A;  5I11 A;  3HHT B;  3QYH B;  1EZZ B;  2CSI A;  2EFI A;  4BI8 B;  1KFZ A;  1VQ4 T;  2CP7 A;  1IRX A;  4QVD A;  4J6W A;  1RAA B;  1RI0 A;  4TVR A;  1K9M C;  3ZBD A;  4RG2 A;  5AYF A;  1ZA1 B;  1BK2 A;  3CC2 Q;  2QGG A;  3RUX A;  2BZY A;  2RJD A;  2DYB A;  2QAZ A;  4LN2 A;  3HSB A;  2ZPE B;  3PIP A;  3CXC P;  5IN1 A;  1NEG A;  3EH1 A;  2XI9 A;  1SRM A;  3QPH A;  4L5G A;  4PJO C;  4B9X A;  1Q95 G;  3CC7 Q;  1VQK T;  1OPL A;  2O01 E;  2XKO C;  2P84 A;  4JZ3 A;  1QVP A;  4HA8 A;  2K3Y A;  4M78 D;  4QQG A;  1YJN Q;  4K11 A;  1Q7Y C;  1GRI A;  2J05 A;  4OP0 A;  4JS4 A;  2QEX Q;  2HMA A;  5GMK j;  4Y28 E;  4E7L A;  2I0N A;  1VQ9 A;  1LJO A;  2X4Y A;  1M3B A;  3TCJ A;  4A63 B;  4A4K A;  5GAN f;  2EYY A;  4IIO A;  4J9H A;  1UEB A;  3C0C A;  3OW2 P;  2ZCF B;  1IGQ A;  2G6F X;  4PJO E;  2XDB A;  4MZT A;  2DBM A;  2DAQ A;  1I0C A;  4PJO G;  2OAW A;  4XQ3 A;  2F2V A;  2LP5 A;  1Y96 A;  4KT0 E;  4J8O A;  4JLI A;  3HFN A;  2RHZ A;  1RL2 A;  3CMA Q;  4QW2 A;  5GAM f;  4PFO A;  4J9E A;  3EGD B;  3S6W A;  4E2F B;  1U5S A;  3CCJ T;  4B6M A;  1HK9 A;  4F14 A;  1ZQ1 A;  1HD3 A;  5CAI A;  1TU0 B;  2CT3 A;  2DL4 A;  4FIB A;  2DK3 A;  3CC4 Q;  1C0M A;  2LX7 A;  3A8M B;  2HBP A;  2ECZ A;  2COY A;  1M1G A;  1R8O B;  5GAM j;  2E65 A;  3E9F A;  4FT4 A;  4OVA A;  4XU0 A;  5DLQ E;  4OB1 B;  1NM7 A;  1K73 C;  3URG A;  2JUF A;  1QVF P;  1VQM T;  1YIT T;  1Q81 U;  4LDU A;  2JXB A;  3UF4 A;  3C12 A;  3OYI A;  4UC4 A;  1WFW A;  1Q86 R;  3M0P A;  4LDY A;  4BY6 C;  1NPR A;  3VS4 A;  1YJ9 T;  1Y7X A;  1KHC A;  3RNJ A;  4X1V A;  4ZNX A;  4M4Z A;  4QQD A;  1JXO A;  3CXC S;  1M9S A;  1YIJ A;  1G3W A;  1QVG S;  4MDX A;  2NUP B;  3OBW A;  3JB9 D;  1FMK A;  5KYX B;  3L2W A;  2QYZ A;  4ZN1 A;  2L2P A;  2C0O A;  2VUB A;  1PKT A;  3EGD A;  1X2K A;  2E3H A;  4RUG A;  3QII A;  1MMN A;  1I5O B;  4X34 A;  4OMF B;  2EQJ A;  4C0D C;  3CCJ A;  5KCH A;  4MZP A;  2QXF A;  5C6S A;  4J6X A;  4DA4 A;  1VQN A;  1BB9 A;  2QA4 T;  3GIB A;  1ZUU A;  2DD4 A;  2KE9 A;  2J6K A;  4E47 A;  2CZ1 B;  3JCM V;  2IVW A;  1FX7 A;  1B34 A;  1VQ5 Q;  2IG0 A;  1W6X A;  1N8R C;  3FB9 A;  3EG9 A;  2FPE A;  4N4H A;  1BCM A;  1C1A A;  1WHH A;  3OYF A;  1B07 A;  2OAU A;  4Y91 A;  4M75 A;  4C92 D;  3ASK A;  1D3B B;  1YP5 A;  5GAN 7;  3DLL A;  5KYW A;  2E6N A;  5FU7 B;  1K76 A;  4QKU A;  1GXI E;  5LJ3 j;  5A0D A;  5FRM A;  1GCQ A;  2QGF B;  1MV3 A;  5M9O A;  4OMM A;  4C8Q D;  4OML A;  5GAM e;  1SF9 A;  2CH4 A;  4JJC A;  4BB7 A;  2F5K A;  2CP2 A;  4BY6 B;  2V1Q A;  4BI4 A;  2X3W D;  1WGS A;  1JB0 E;  4FYY B;  5LL6 S;  2G3R A;  4M7A F;  2ZGW A;  4RTW A;  2HZY A;  3I5R A;  5CQX A;  4Z89 A;  2CSQ A;  3HFO A;  1VQP Q;  1KJW A;  3PVQ A;  2FVU A;  1ARK A;  3QDR B;  2LCC A;  1G3Y A;  2QQ9 A;  2PVD B;  3CEY A;  4L59 A;  4J7I A;  1VQN T;  2ATC B;  4N0A A;  5IH2 A;  3H8Z A;  3TU4 K;  2M0O A;  3V7R A;  5LJ5 d;  1QVF A;  1S72 T;  1WYX A;  2YDL A;  3VU3 C;  3CD6 A;  1NJI R;  1KIK A;  1I07 A;  2KAF A;  2QTX A;  4J7F A;  2MYS A;  4F7U F;  2HQH A;  3H0I A;  3QHS A;  5CVI A;  1UJY A;  3FEO A;  2HKQ B;  1VQ7 Q;  3NHN A;  2XMF A;  2RHY A;  4JPB W;  2FPD A;  3CCU T;  2RMO A;  3VV0 A;  3NPF A;  2D6F A;  2HL3 A;  3QWY A;  1UJ0 A;  3EG0 A;  1Q86 C;  3OA6 A;  1M90 R;  4FW2 A;  1KG1 A;  1ZSZ C;  3H0H A;  3GPL A;  4M7D C;  3LX7 A;  3JB9 F;  1UFF A;  2DL5 A;  4FU6 A;  4M75 G;  2A7Y A;  1RUW A;  4OMQ A;  1VQL Q;  2DYI A;  4M7D A;  2A08 A;  2DIL A;  2KBT A;  3EAE A;  4IUU A;  5GAM h;  4D8D A;  3ZL7 C;  2E64 A;  8ATC B;  2EYQ A;  1Q82 C;  2HAX A;  1SSF A;  2CZ7 B;  2RJF A;  1M2O A;  2ROT A;  3JB9 G;  1YBY A;  3G4S T;  2BUD A;  1VQ6 T;  1Y07 A;  2L3Q A;  3I56 T;  1X43 A;  3EGX B;  4XTY A;  4M77 B;  4JJN K;  2X4X A;  2VGM A;  1UGP B;  1HSQ A;  1U8R A;  1K9M U;  3CCQ A;  2K2M A;  3GLX A;  1ZUY A;  4FYV B;  5CK9 A;  5KYY B;  1Q82 U;  1ZX6 A;  1Z9Q A;  2R5M A;  3AT1 B;  3G7Z A;  3A1P A;  1OPK A;  2YRD A;  4RTX A;  2KDS A;  4DBQ A;  2RHX A;  1UUE A;  1RAC B;  1QWE A;  3P8B B;  1ZBX A;  2BIV A;  2KGT A;  1M2V B;  5GAN 8;  4F7U G;  2L3R A;  2SEM A;  5GAM g;  4Y92 A;  5I2S A;  5L8R E;  3H9N A;  5IXF A;  3M57 A;  1UDL A;  3HKS A;  1SG5 A;  2LQN A;  1Q81 C;  1TSF A;  5CKF A;  1PSE A;  5A0L A;  1IO6 A;  1VQP T;  2EQI A;  3MKD A;  3VS2 A;  1JJ2 S;  3GNF B;  2JT4 A;  4KH0 B;  1YIJ T;  2JM8 A;  2K9G A;  3RKW A;  4BDZ A;  1VQ5 T;  2DJZ A;  2VWF A;  2KT1 A;  2QQS A;  4Z02 A;  1QCO A;  2QAS A;  2HQE A;  4ZTF A;  2LRQ A;  5GAO n;  1GBR A;  1AHJ B;  2GQV A;  2K3B A;  2X9H A;  1QQJ A;  2YSQ A;  5GAO r;  3HL8 A;  1V76 A;  4EMK A;  2AT1 B;  4O5V A;  2GFU A;  5LJ3 e;  1S1N A;  1WPY A;  2M02 A;  1LOJ A;  3QDF A;  2RQV A;  1WA7 A;  3CPW P;  2K5F A;  3FLG A;  8AT1 B;  1W70 A;  1NZ9 A;  5IHI A;  1UGS B;  1IHV A;  2EBP A;  3UDC A;  1AWW A;  2RD1 A;  3VS7 A;  3CC4 A;  2RPN A;  3E9G A;  2DTO A;  4M77 E;  2WSC E;  2JW4 A;  3TRE A;  4XU3 A;  4AT1 B;  3JSC A;  3BFM A;  1H3H A;  2EKH A;  1WHK A;  1VQO Q;  3CCE T;  1N8R R;  3X28 B;  3CCE Q;  1D0Z A;  3VKI A;  2OTL T;  1XQH A;  1K8A C;  3V7S A;  3MHX A;  2BZX A;  4KUD K;  3PFS A;  1GFD A;  1VQ6 A;  1PD0 A;  4PJM A;  2OTL Q;  4EIK A;  1SPK A;  3SEM A;  2KVQ G;  4PFP A;  4M7A B;  3CCL Q;  2KK4 A;  1K9A A;  5A2Q E;  3O8V A;  2FZG B;  2PNI A;  4ATO A;  1AD5 A;  1MND A;  1SEM A;  2QQB A;  1IXD A;  3JB9 I;  4QVZ A;  5KH6 A;  3SHW A;  1AEY A;  3PIO A;  2Z0W A;  3JAM E;  1QVG A;  3G6E Q;  5KCO A;  5KYW B;  2D0N A;  5D6W A;  1KC8 C;  1R0C B;  4E7S A;  4J9C A;  4KGV B;  3QKJ A;  5GAN 2;  3UPU A;  3QZ9 B;  3EHR A;  3V8K A;  1M8V A;  3S3N A;  1AWJ A;  1KD1 R;  4XK8 E;  1VIF A;  1FXX A;  4DOW A;  3L1A A;  4MMK A;  2EGC A;  3CCQ T;  1OOT A;  3BE3 A;  4KBM B;  2JJ9 A;  2HBW A;  2RJC A;  3UA7 A;  2O9S A;  2EYX A;  3LH0 A;  4AFU C;  3A8O B;  1LVK A;  1MV0 B;  2RN8 A;  1ABQ A;  1F1B B;  3MEA A;  1WJS A;  2L5Q A;  5D6X A;  5CIU A;  5CQY A;  2XDD A;  3KBG A;  1M1K C;  3M0U A;  3VS1 A;  5EC7 A;  4A4F A;  4XTU A;  4EMG A;  1VYT A;  2EGA A;  3HTR A;  4DEX A;  1YIT Q;  4DEY A;  2NLU A;  3OS0 A;  2XD0 A;  4M77 D;  1YHQ T;  1HYO A;  2EPD A;  2YUN A;  3M54 A;  1JBM A;  1OZ2 A;  2V8J A;  1YCS B;  4HKE A;  3JCM c;  2ZPG B;  1N8R U;  3VS0 A;  1RAH B;  2C0T A;  1J3T A;  2GTO A;  3O5Z A;  2ZPI B;  4RTY A;  2RO0 A;  2F1L A;  1OX9 A;  3CD6 Q;  2J6F A;  2L8D A;  2YLC A;  4F7U A;  4HCK A;  1MMG A;  3CD6 T;  1V1C A;  2LT4 A;  5LJ5 f;  4JJD A;  2HL5 C;  3LW5 E;  1GCP A;  3P8H A;  2CUB A;  3J81 E;  2RQT A;  1G2B A;  3OYN A;  3BDU A;  4C5H A;  2CH4 W;  1S72 Q;  1RAE B;  4CC4 B;  2AZV A;  2DM1 A;  2A28 A;  2LCL A;  5GMK i;  1YI2 T;  3N5B B;  1VYU A;  4MML A;  4RTZ A;  3V8L A;  5GJV B;  2EAY A;  1MHN A;  3HRT A;  1K0S A;  2GF7 A;  5GAN 3;  1TOV A;  3OS5 A;  4EDU A;  1YJ9 Q;  2E12 A;  3A98 A;  3OYY A;  1OQK A;  1N6A A;  4PNO A;  1I1J A;  4OGE A;  1RAI B;  3U23 A;  1BI0 A;  3SDZ A;  1UE9 A;  2E1H A;  4DBR A;  2FHD A;  5GJW B;  4NL3 A;  1T0J A;  1UTI A;  2MOX A;  1TUC A;  1VQO A;  3CCU Q;  5GMK l;  3ZFJ A;  3M0T A;  3EG9 B;  1K9M R;  3CCV Q;  5GAO p;  4HCZ A;  3CCQ Q;  2K2V A;  1XJW B;  4M77 G;  3G4S A;  4KGX B;  2AKL A;  4M75 E;  2J6O A;  2JMC A;  4DBH A;  3QJY A;  3VYH B;  3OYG A;  2DXC A;  2AHJ B;  3SFM A;  1KSW A;  1M3C A;  4PL6 A;  2JN0 A;  3CQT A;  4F17 A;  2DF6 A;  1VQN Q;  3HRS A;  5KE3 A;  5IT9 E;  5CKD A;  2K5I A;  1PWT A;  5FU6 C;  2RK2 A;  1IGU A;  3UAT A;  1T3L A;  2V8K A;  2XG8 D;  1VQ6 Q;  3JCM W;  1NYF A;  3JCM e;  2K5L A;  1WNL A;  2W10 A;  4M78 E;  1KK7 A;  1PD1 A;  4IUV A;  1T3S A;  2ZPH B;  2LX9 A;  1GCQ C;  3CC7 T;  3G6E A;  3ULR B;  3KXT A;  2Y4X A;  3GNG A;  3DB3 A;  2MWP A;  2SRC A;  1YWO A;  1XTD A;  1YJ9 A;  1M1F A;  3H0F A;  2X51 A;  2DKG A;  5LJ3 g;  1YN8 A;  4C5E A;  4P5N A;  2DVJ A;  3BW1 A;  5LJ3 d;  1QLY A;  2B86 A;  1X6O A;  1EFN A;  2P4T A;  3RMS A;  2PUO B;  2KXC A;  5GAN g;  3VS6 A;  1RAG B;  3CCV A;  2HQX A;  1OU9 A;  2YXY A;  5IHK A;  1TG0 A;  4JLG A;  2DMO A;  4M7A C;  3GP8 A;  1U06 A;  3E19 A;  1Y71 A;  2AIR B;  4IUP A;  2K79 A;  4C0F A;  4LXC A;  2FL7 A;  1VQ7 T;  2FRY A;  3VJP A;  3EH2 A;  5GAN 5;  2PQW A;  4A4G A;  3JCM d;  2ROL A;  1RAD B;  2V8I A;  5HCK A;  1U1S A;  2RJE A;  3A8L B;  3CCE A;  1NLO C;  2HNI A;  2VB6 A;  3REA B;  1AWX A;  4R55 A;  2MI6 A;  4GLK A;  6AT1 B;  2EJF A;  3RBB B;  3PTA A;  1DJ7 B;  1B34 B;  3SD4 A;  1QVF S;  2KR3 A;  2F2W A;  2DPP B;  3CCJ Q;  3INZ A;  2AZS A;  2HSP A;  2H8H A;  1GL5 A;  1JU5 C;  1P92 A;  2EIF A;  3EFR A;  3M0Q A;  5I21 A;  3C4S A;  3JB9 H;  2DL8 A;  3F70 A;  2CS7 A;  3M58 A;  1NEB A;  2LJ3 A;  3PVL A;  3LH5 A;  2BZ8 A;  1QKW A;  5CR2 A;  2DFU A;  3OYK A;  4M7D D;  2KRN A;  2EJG A;  4QVC A;  2JS0 A;  1KQS A;  2WAC A;  4MZM A;  1KQ2 A;  4O6J A;  3NTI A;  4M7D F;  1KQS P;  2M51 A;  3MEU A;  5GAN e;  1YFN A;  2YRC A;  5LJ5 h;  3FRN A;  5CKE A;  3I55 Q;  5A0G A;  1IZ6 A;  1N27 A;  2KRM A;  1WQ7 A;  1N5Z A;  1D09 B;  2PU9 B;  5FWB A;  2JTE A;  2K57 A;  4ZGD B;  3R6O A;  1W1F A;  4IUT A;  2OTJ A;  4J9I A;  3G6E T;  3JCM b;  4PJO B;  5I2M A;  3KUF A;  1NBE B;  4LDW A;  2CDT A;  2OJ2 A;  4KGZ B;  1MMD A;  5GAO m;  1B7T A;  1Y57 A;  1I8F A;  2F69 A;  3EG2 A;  2GBQ A;  3OSV A;  2DBK A;  5DLO A;  2EKO A;  4PJL A;  2RF0 A;  4OMO A;  4JZ4 A;  1K8A R;  2DJQ A;  3CC4 T;  2E5Q A;  4Z88 A;  2RQU A;  1AWO A;  2A36 A;  2EWN A;  2COZ A;  3EFS A;  2ESW A;  5HY6 A;  3AHU A;  4X9D A;  4LNP A;  4E7H A;  1RLQ C;  3QZ5 B;  1UEC A;  2GCX A;  5LJ3 f;  1X75 C;  2DEU A;  2CRE A;  3V7C A;  1UHC A;  2RNA A;  3FIF A;  2IPO B;  1VQ4 Q;  3RER A;  3EFO B;  1WHG A;  2C06 A;  1UGV A;  2X35 A;  1PC0 A;  2E6Z A;  3I5S A;  4M78 G;  1MNE A;  2LTO A;  4F7U B;  1G83 A;  1CKB A;  2NUT B;  2LQ8 A;  3C94 A;  1LNX A;  2RI5 A;  3L2Q A;  4CI0 C;  3MO8 A;  3FC3 A;  5FWC A;  2KXD A;  4XU2 A;  3VRY A;  1RAB B;  3DLM A;  4E7I A;  2EW3 A;  4M7D E;  2X4J A;  1KQ1 A;  4E7Z A;  2MIO A;  3GF5 A;  4ZTJ A;  4C92 A;  2KEA A;  5CCA A;  1KD1 U;  3EGU A;  3SWN C;  3L42 A;  3G71 Q;  4A54 A;  3OYE A;  2DET A;  3EFO A;  1WHJ A;  1CKA A;  1RI9 A;  4FW1 A;  1YIJ Q;  3RIR A;  2FB7 A;  3L2U A;  2YLB A;  1NPP A;  2CP0 A;  4ME7 A;  4IUQ A;  1YI2 Q;  1UGQ B;  3MPU B;  1JEG A;  1Y0M A;  4RTV A;  3SB2 A;  4R0K A;  3QG1 A;  1Z9Z A;  3ZEH A;  4BE2 A;  3PMI A;  4C8Q G;  3CCR T;  1AZE A;  4RMO A;  4M7A G;  4GLM A;  1VQ4 A;  3MEV A;  1I4K 1;  1PG5 B;  2DL3 A;  3L2R A;  1ZUK A;  3UA6 A;  2ZAE A;  3REB B;  2QQR A;  2VXF A;  1VQ8 A;  4WTO B;  2AK5 A;  4J5Y A;  1V29 B;  2DXB A;  1SHF A;  2O9V A;  1K8A U;  3LGL A;  2LZ6 B;  2DLP A;  5GAO l;  4RTT A;  2DA9 A;  2CP5 A;  1M1K R;  2EQM A;  1VOM A;  1Y96 B;  3JCM h;  2DTH A;  1JRI A;  5LJ5 e;  4Q5W A;  2VAS A;  1TTH B;  2JTM A;  1VQ8 T;  2CP6 A;  4C5G A;  5FW9 A;  1G8X A;  3ER0 A;  2VXE A;  4N4I A;  1K4U S;  1SSH A;  2K7A A;  4M75 F;  2GGR A;  2KQW A;  2D8J A;  1M2V A;  2E41 A;  2RHI A;  2DZ9 A;  1N9R A;  1W4S A;  4JRK A;  1M90 C;  1YHQ Q;  1O75 A;  2IIM A;  2CKK A;  3TSW A;  1WJQ A;  2CYZ B;  1KC8 R;  3BDL A;  1ZHI A;  2P0K A;  3HPW A;  1YI2 A;  4ELZ C;  3GOX A;  1YJW A;  4BD3 A;  2GQI A;  4BI3 A;  2LNV A;  3R6N A;  1CSK A;  1I81 A;  1WDX A;  3SWN A;  1NLP C;  2YHT A;  5LJ3 h;  3RR6 A;  1LPL A;  2VGN A;  2JMA A;  4FSX A;  4PK4 A;  4JS5 A;  4M77 C;  4RG8 A;  3CME A;  5LJ5 j;  1R0B G;  1TUD A;  1HJD A;  4L6V 5;  1B3Q A;  5I22 A;  1NJI C;  1PKS A;  1OU8 A;  4RCC A;  1H3Z A;  1PM3 A;  2KT8 A;  1UHF A;  4OB3 B;  2DXU A;  4ESR A;  3A8H B;  4JDS A;  4KUI A;  4V2S A;  3RDV A;  2FZC B;  2NUZ A;  5KYY A;  4C8Q A;  1VQ9 Q;  1O9S A;  3OS1 A;  2FZK B;  4CC3 A;  2E4H A;  3OYJ A;  2XHC A;  2DRM A;  2DNU A;  2A3L A;  1U3O A;  3CMA A;  4M78 B;  2O4X B;  1H8K A;  1QCF A;  2O31 A;  4JJB A;  3CC2 T;  1R77 A;  2GFA A;  1E6H A;  4C8Q B;  2KYB A;  2JZ2 A;  4M75 C;  4AFS C;  5IAY A;  5DY9 A;  1IRE B;  3X25 B;  1EIF A;  2BE9 B;  2ED0 A;  2L3S A;  2EQU A;  4E6R A;  1X69 A;  3VS3 A;  4PKC C;  2VC8 A;  3T9N A;  1X01 A;  2W0Z A;  1H92 A;  4BAC A;  1HXD A;  5CO7 A;  2QQA A;  2Y90 A;  3G71 A;  3LGF A;  1GFC A;  2XU8 A;  2GTJ A;  3G71 T;  4PJO F;  1WXB A;  1TWB A;  3LYI A;  2DER A;  4BE0 A;  5KYU A;  4M78 C;  3RKX A;  4NL2 A;  4AFQ C;  4PFZ A;  1YNZ A;  4LDV A;  2DVE A;  4A53 A;  1Q86 U;  2JM9 A;  4EMH A;  1ZLM A;  1QP2 A;  4B9W A;  3OMC A;  4RKU E;  2EJ9 A;  4CRI A;  4ZN3 A;  1ACM B;  2CGH A;  2LQK A;  1ABO A;  1Q81 R;  4JUV A;  4HT9 A;  5L23 A;  4IKF A;  4OF1 A;  1PRL C;  3OYH A;  4M7D B;  4XTX A;  3CMA T;  4N0A C;  3UT1 A;  1M8M A;  5HK0 A;  4ZGJ B;  2YT6 A;  4CC2 A;  1W2B S;  1FWZ A;  5D7U A;  4C92 C;  2MMP A;  2CZ0 B;  2KY9 A;  4EMK B;  2LJ1 A;  5FU7 C;  4M77 A;  2JS2 A;  2BE7 D;  1VQK A;  5IHN A;  3VYG A;  2PZ1 A;  2ZPF B;  4M78 F;  1D1A A;  1G5V A;  3OW2 S;  5HK3 A;  2PVG B;  5GAO q;  2NUT A;  3M55 A;  4LUE A;  4OMP A;  3PGG A;  2OX7 A;  2XDP A;  2OTJ Q;  1RAF B;  4QQ6 A;  3CPF A;  3M5A A;  2YUP A;  3M4G A;  2OI3 A;  1K73 R;  1QMC A;  2FRW A;  2HSE B;  4LDX A;  2J7I A;  2JNG A;  1Q82 R;  2DE0 X;  2MK5 A;  4RTU A;  2RH2 A;  4AFZ C;  4A4E A;  2RA2 A;  3VUB A;  2K4Y A;  4HVV A;  1VYV A;  1N9S A;  2E3I A;  2NUP A;  1YJN A;  2D8H A;  2CP3 A;  1LCK A;  2H3J A;  3PNW C;  2HEQ A;  3RMQ A;  3LLR A;  4GY5 A;  4PLI A;  1SKU B;  3G1J A;  3ME9 A;  3HP9 A;  4D8K A;  2VYT A;  4DQ2 A;  4DOV A;  3CCU A;  4BUG A;  2NYS A;  4DBF A;  1OYX A;  3OQ5 A;  2LT1 A;  2P4R A;  1AVZ C;  2RB6 A;  3I56 A;  2X3X D;  1QVG P;  1OUL A;  2KRO A;  4FYW B;  3OYB A;  3C95 A;  4FSS A;  4IUR A;  3X24 B;  3CCL A;  2WSF E;  4NOY A;  4XTW A;  3E2U A;  4E7K A;  1D0X A;  2QA4 Q;  2RI2 A;  3M0R A;  3CME Q;  1NYG A;  3OY9 A;  2QEX T;  4XAX B;  1C6V X;  1BI3 A;  5AT1 B;  4RCB A;  4IIM A;  1E7O A;  4HCB A;  4R56 A;  3CCM Q;  1ZBJ A;  2FEI A;  4WF2 A;  1JO8 A;  3VRZ A;  2EGE A;  4C0G A;  2JOY A;  4YTL A;  5FRO A;  2O88 A;  1WLP B;  1X6B A;  3NMZ C;  3OBY A;  4F16 A;  2DL7 A;  2KSS A;  3EHQ A;  2M1H A;  3RES A;  1VQP A;  1OZ3 A;  1Q7Y R;  3M59 A;  2CT4 A;  2FYK A;  2KRS A;  2RI3 A;  4II1 A;  3OYL A;  1JJ2 P;  2K3X A;  2E70 A;  2DX1 A;  1YCY A;  3PMT A;  2PUK B;  4A4H A;  4JRQ A;  4C92 B;  2HDA A;  1BU1 A;  3KFV A;  5FU6 B;  4HCC A;  2HCK A;  3MCA B;  1M5Q 1;  2PTK A;  3JV3 A;  2DIG A;  3E1S A;  4HXJ A;  1QP3 A;  2JTF A;  3WVD B;  4M7A A;  2LNH B;  2FO0 A;  2I2L A;  2ED1 A;  3JCM Q;  3I55 A;  3CCS T;  1MMA A;  3MEW A;  1BBZ A;  2VVK A;  2V1R A;  3GBQ A;  1VQL T;  3DKM A;  2M16 A;  3CBP A;  2L89 A;  5J3B A;  1SHG A;  4N4G A;  1A0N B;  2DXT A;  2F2X A;  3LWI A;  1VQ8 Q;  5GMK h;  1VQM Q;  1YHQ A;  3JCM J;  1NE8 A;  1QW1 A;  1MUZ A;  1QWF A;  2DD5 A;  5KYN A;  1E6G A;  4M75 D;  2QTV A;  1M90 U;  4HT8 A;  1VUB A;  4EPC A;  4PJO D;  4JRI A;  4C92 E;  2FG0 A;  3OYD A;  1WIE A;  4C92 F;  4KRT A;  3CXC A;  1IB8 A;  3EGX A;  3HRU A;  1YJW T;  1SRL A;  1TXQ A;  1H64 1;  3FJP A;  2LQW A;  3EG1 A;  4M75 B;  1M27 C;  4CC7 A;  3OSS C;  1BI2 A;  4XTV A;  2Y4Y A;  1XNI A;  4ZGE B;  3A8G B;  3OW2 A;  3CC2 A;  2YUO A;  3QO3 A;  4FYX B;  4KH1 B;  2QI2 A;  1X2Q A;  3CCV T;  2LVM A;  1FYN A;  4OB2 B;  3FJ5 A;  1FMW A;  1UB4 A;  2XIC A;  4PLL A;  3M56 A;  4XU1 A;  2QDL A;  2DO3 A;  5D6Y A;  3TEE A;  3CC7 A;  3CBO A;  5GAN j;  5GAN 4;  2X4W A;  4BDY A;  3G4S Q;  3DB4 A;  4OB0 B;  4M77 F;  2YRV A;  1WZO A;  2RQR A;  4BE1 A;  3CCR A;  5GAM d;  1QCN A;  5J39 A;  3BY7 A;  4GBQ A;  1WJR A;  2V26 A;  3VS5 A;  3M53 A;  2R58 A;  2B8A A;  5FRN A;  1IHW A;  1PHT A;  1D3B A; 
#chains in the Genus database with same CATH homology
 4OB1 B;  4F7U E;  3ER0 A;  1K73 C;  2F5T X;  3URG A;  2VXE A;  4N4I A;  4M75 F;  1BYM A;  2JUF A;  2KQW A;  2E41 A;  2RHI A;  4C8Q F;  3CCU A;  2P0P A;  3NTK A;  1VQM T;  2DZ9 A;  1N9R A;  2ZPI B;  2LDM A;  4J6Y A;  1YIT T;  1Q81 U;  2RO0 A;  4C8Q C;  4LDU A;  1W4S A;  4JRK A;  4C0D B;  1M90 C;  3C12 A;  4LD6 A;  2L8D A;  1O75 A;  2YLC A;  4UC4 A;  4F7U A;  3OYI A;  2CKK A;  2E10 A;  1WJQ A;  2CYZ B;  4LDY A;  3OB9 A;  3CD6 T;  4BY6 C;  3BDL A;  1NPR A;  2LT4 A;  3OYA A;  5LJ5 f;  1ZHI A;  1YJ9 T;  1Y7X A;  1KHC A;  3LW5 E;  2P0K A;  3HPW A;  3P8H A;  4ELZ C;  3J81 E;  3GOX A;  1YI2 A;  4QQD A;  3OYN A;  1YJW A;  4BD3 A;  1W2B A;  3BDU A;  4BI3 A;  4C5H A;  1KHI A;  2LNV A;  3CXC S;  1M9S A;  4MDW A;  1I81 A;  1G3W A;  3SWN A;  2YHT A;  3CPW A;  1YIJ A;  3PT9 A;  1QVG S;  5LJ3 h;  4MDX A;  2VGN A;  3OBW A;  3JB9 D;  4FSX A;  3L2W A;  1JJ2 A;  2HD0 A;  2LCL A;  5GMK i;  4JS5 A;  4M77 C;  4RG8 A;  4NS5 A;  5LJ5 j;  3CME A;  3X26 B;  3FDR A;  3N5B B;  4ZN1 A;  1YI2 T;  3JRZ A;  4L6V 5;  2VUB A;  1NJI C;  4MML A;  3V8L A;  4RCC A;  1H3Z A;  3QII A;  4OMF B;  2EAY A;  1MHN A;  4X34 A;  1KC8 U;  2EQJ A;  4C0D C;  3CCJ A;  5KCH A;  1KQS S;  4C8Q E;  3OS2 A;  3HRT A;  4MZP A;  2GF7 A;  2QXF A;  5C6S A;  4OB3 B;  4EDU A;  3OS5 A;  5GAN 3;  2DXU A;  4J6X A;  2E12 A;  3A8H B;  4DA4 A;  4JDS A;  3OYY A;  4KUI A;  4V2S A;  1N6A A;  1VQN A;  4VUB A;  4PNO A;  3WVE B;  3JCM f;  2DD4 A;  2QA4 T;  3GIB A;  4OGE A;  4C8Q A;  4E47 A;  2DZC A;  1O9S A;  3OS1 A;  2CZ1 B;  3JCM V;  1BI0 A;  2IVW A;  3SDZ A;  2E1H A;  2ZPB B;  1FX7 A;  1G3S A;  1B34 A;  3OYJ A;  2IG0 A;  2XHC A;  2FHD A;  1N8R C;  3OYM A;  2A3L A;  4NL3 A;  3FB9 A;  3L2V A;  3CMA A;  4M78 B;  2O4X B;  2O4X A;  4N4H A;  3A5Z B;  3CC2 T;  3OYF A;  2OAU A;  1VQO A;  1N8R U;  2GFA A;  4Y91 A;  5GMK l;  3ZFJ A;  4M75 A;  1WQW A;  4C92 D;  3ASK A;  4M78 A;  4C8Q B;  2VV5 A;  1D3B B;  2JZ2 A;  5LJ5 g;  1XOV A;  5CKH A;  5GAN 7;  2E6N A;  5FU7 B;  4HCZ A;  5GAO p;  3DLL A;  4M75 C;  2K2V A;  1GXI E;  4M77 G;  3G4S A;  2M9U A;  2PVO B;  2RM4 A;  1BKB A;  4M75 E;  5A0D A;  5LJ3 j;  3CPW S;  5IAY A;  5FRM A;  5DY9 A;  3QXE B;  1IRE B;  3X25 B;  3Q1J A;  3QJY A;  1EIF A;  3VYH B;  5GAN d;  3OYG A;  1G3T A;  2DXC A;  5M9O A;  2OTJ T;  2EQU A;  4C8Q D;  4PKC C;  2AHJ B;  4ELY C;  2VC8 A;  3MET A;  3T9N A;  1X01 A;  3SFM A;  5GAM e;  3SWN B;  3V8J A;  4BAC A;  4PL6 A;  5FLX E;  1HXD A;  2JN0 A;  2F5K A;  5CO7 A;  2QQA A;  2Y90 A;  4BB7 A;  2EQK A;  4C0Z A;  3WXM B;  3HRS A;  5KE3 A;  3G71 A;  4BY6 B;  5CKD A;  5IT9 E;  2K5I A;  3LGF A;  5FU6 C;  2RK2 A;  3JB9 J;  2R5A A;  3MP8 A;  2XU8 A;  4BI4 A;  5C0M A;  4PJO F;  3G71 T;  2V8K A;  1WGS A;  2XG8 D;  3LYI A;  1JB0 E;  5LL6 S;  2G3R A;  4BE0 A;  4M7A F;  3QJ6 A;  3JCM W;  2ZGW A;  3JCM e;  4M78 C;  2K5L A;  5CQX A;  1WNL A;  3RKX A;  4NL2 A;  3QYG B;  3HFO A;  4M78 E;  3MP6 A;  3CCL T;  1K73 U;  2FVU A;  4M7A D;  4IUV A;  3QDR B;  4LDV A;  5GAN 6;  2LCC A;  2DVE A;  4A53 A;  1Q86 U;  3CCM A;  1G3Y A;  2ZPH B;  3JCM g;  2QQ9 A;  2PVD B;  4EMH A;  3I55 T;  3CCS A;  1BIB A;  3CEY A;  4L59 A;  1QP2 A;  4J7I A;  4B9W A;  3MP1 A;  1VQN T;  2LX9 A;  3CC7 T;  3OMC A;  4N0A A;  2LC4 A;  4RKU E;  2EJ9 A;  3KXT A;  3G6E A;  2Y4X A;  3JCM X;  3CME T;  1YIT A;  3GNG A;  4CRI A;  3H8Z A;  3DB3 A;  4ZN3 A;  3TU4 K;  2MWP A;  1VQL A;  2M0O A;  3OMG A;  3V7R A;  2CGH A;  5LJ5 d;  1QVF A;  1S72 T;  1BI1 A;  4M7D G;  1XTD A;  1YJ9 A;  2LQK A;  4JUV A;  1M1F A;  5GAN h;  4HT9 A;  3VU3 C;  3QBY A;  3CD6 A;  4IKF A;  4OF1 A;  2KAF A;  1VIE A;  3OYH A;  4KUL A;  4M7D B;  4XTX A;  3CMA T;  2QTX A;  4J7F A;  5CKB A;  4F7U F;  4N0A C;  2ZZD A;  2KMT A;  3QHS A;  3UT1 A;  5CVI A;  3FEO A;  4ZGJ B;  5HK0 A;  1S72 A;  2DKG A;  4FL6 A;  1W2B S;  1FWZ A;  5LJ3 g;  4C92 C;  2MMP A;  1YJN T;  2CZ0 B;  2JVV A;  2RHY A;  4P5N A;  3BW1 A;  5LJ3 d;  4C5E A;  1TH7 A;  2KY9 A;  1X6O A;  4EMK B;  2P4T A;  3CCU T;  5FU7 C;  4M77 A;  3RMS A;  1Q7Y U;  1MGQ A;  2PUO B;  1VQK A;  5GMK e;  3VV0 A;  5GAN g;  3VYG A;  3CCV A;  2D6F A;  2HQX A;  2ZPF B;  4M78 F;  1G5V A;  3OW2 S;  1Q86 C;  5HK3 A;  3S3M A;  2PVG B;  4JLG A;  5GAO q;  4M7A C;  3OA6 A;  3GP8 A;  3E19 A;  1Y71 A;  1KG1 A;  4M7A E;  2QA4 A;  2DIQ A;  4IUP A;  3M55 A;  3GPL A;  4C0F A;  3PGG A;  4M7D C;  2XDP A;  2FL7 A;  3LX7 A;  4QQ6 A;  5J26 A;  3VJP A;  3CPF A;  1VQ7 T;  3M5A A;  3JB9 F;  5GAN 5;  3M4G A;  4FU6 A;  4M75 G;  2A7Y A;  2PQW A;  3L2Z A;  4LD9 K;  4M7D A;  3EAE A;  4IUU A;  4A4G A;  3JCM d;  2JNG A;  5GAM h;  4LDX A;  2V8I A;  2E64 A;  2MF2 A;  1U1S A;  2EYQ A;  2RJE A;  1Q82 C;  2HAX A;  1SSF A;  2CZ7 B;  2RH2 A;  2RJF A;  3A8L B;  3CCE A;  3S3O A;  2HNI A;  4A4E A;  2RA2 A;  3JB9 G;  1YBY A;  3VUB A;  3G4S T;  2K4Y A;  1N9S A;  2BUD A;  4R55 A;  2MI6 A;  1Y07 A;  3I56 T;  1YJN A;  1VQ6 T;  3CBM A;  4GLK A;  4XTY A;  4M77 B;  2EJF A;  4JJN K;  2X4X A;  2H3J A;  2MWO A;  3PNW C;  2VGM A;  1UGP B;  3LLR A;  4GY5 A;  4PLI A;  3RMQ A;  1VQO T;  3PTA A;  1U8R A;  1DJ7 B;  1B34 B;  3ME9 A;  3HP9 A;  3SD4 A;  1QVF S;  2VYT A;  1K9M U;  2DPP B;  3CCQ A;  1NJI U;  3GLX A;  3INZ A;  4DQ2 A;  5CK9 A;  1Q82 U;  2D0Q B;  4DOV A;  1P92 A;  2EIF A;  2R5M A;  2DEQ A;  3EFR A;  4BUG A;  2QDY B;  5I21 A;  3G7Z A;  5KE2 A;  5HKC A;  1OI1 A;  2DTI A;  3C4S A;  3JB9 H;  3LWH A;  1OYX A;  1VQM A;  2KDS A;  2RHX A;  3F70 A;  2CS7 A;  2LT1 A;  3M58 A;  3OQ5 A;  5DM7 R;  3P8B B;  2RB6 A;  2CZ6 B;  3I56 A;  1ZBX A;  4PJO A;  2BIV A;  5CR2 A;  3X20 B;  2P0Q A;  5GAN 8;  4F7U G;  3OYK A;  4M7D D;  2L3R A;  1BIA A;  5GAM g;  5I2S A;  2EJG A;  3OYB A;  5L8R E;  4QVC A;  1KQS A;  3C95 A;  2WAC A;  3M57 A;  1M1K U;  4IUR A;  3X24 B;  3CCL A;  4MZM A;  2MAM A;  3HKS A;  2WSF E;  1KQ2 A;  4O6J A;  4NOY A;  2RHU A;  4XTW A;  4C5I A;  1Q81 C;  3NTI A;  4E7K A;  4M7D F;  5CKF A;  2RI2 A;  1PSE A;  3MEU A;  1U1T A;  5A0L A;  4JRP A;  4D6W A;  5GAN e;  1VQP T;  1JJ2 S;  3GNF B;  3OY9 A;  4XTZ A;  1KD1 C;  4EMK C;  2QEX T;  3QSU A;  1YIJ T;  4XAX B;  3RKW A;  4BDZ A;  5LJ5 h;  1VQ5 T;  3FRN A;  1BI3 A;  2DJZ A;  5CKE A;  4RCB A;  5A0G A;  1IZ6 A;  1N27 A;  1WQ7 A;  4HCB A;  2QQS A;  4Z02 A;  2R57 A;  4R56 A;  2HQE A;  1PSF A;  2PU9 B;  3J80 E;  4ZTF A;  2LRQ A;  4OGC A;  4WF2 A;  5GAO n;  5EG2 A;  1AHJ B;  2GQV A;  3RKY A;  4C0G A;  2JOY A;  4X9C A;  2QEX A;  4YTL A;  5FRO A;  3M4Y A;  2K57 A;  4ZGD B;  4C92 G;  5GAO r;  3R6O A;  3OBY A;  4IUT A;  1VQ7 A;  3UWN A;  2OTJ A;  3G6E T;  3JCM b;  4PJO B;  3QUI A;  3HL8 A;  4EMK A;  2KSS A;  2WSE E;  3NFC A;  3KUF A;  4LDW A;  2M1H A;  5I2M A;  3RES A;  3OYC A;  1VQP A;  1OZ3 A;  3JCM P;  1UGR B;  4O5V A;  2GFU A;  5LJ3 e;  3M59 A;  1WPY A;  5GAO m;  4FT2 A;  5GMK m;  1I5L A;  2FYK A;  2D9T A;  4FM4 B;  3H6Z A;  1I8F A;  1LOJ A;  2F69 A;  4J83 A;  2RI3 A;  4II1 A;  3VUZ A;  1VQ9 T;  3OYL A;  2XID A;  3OSV A;  5DLO A;  2K3X A;  2EKO A;  3CCM T;  4E7J A;  3P8D A;  2E70 A;  1YCY A;  2K5F A;  2BKD N;  3PMT A;  2OTL A;  1VQ5 A;  3FLG A;  2PUK B;  4A4H A;  4JRQ A;  4C92 B;  4HCC A;  3J7A F;  3M9Q A;  5FU6 B;  3NTH A;  3CC4 T;  2E5Q A;  2XK0 A;  1NZ9 A;  1M5Q 1;  3MCA B;  1M4Z A;  2RK1 A;  2EWN A;  1UGS B;  3EFS A;  2DIG A;  3E1S A;  1QP3 A;  5HY6 A;  3HHT B;  2JTF A;  3QYH B;  3AHU A;  4X9D A;  3UDC A;  3WVD B;  4E7H A;  4M7A A;  3QZ5 B;  2I2L A;  2EFI A;  4BI8 B;  2GCX A;  5LJ3 f;  1X75 C;  1VQ4 T;  3JCM Q;  3I55 A;  3CCS T;  2RD1 A;  3MEW A;  4QVD A;  3CC4 A;  3V7C A;  4J6W A;  1RI0 A;  4TVR A;  1K9M C;  3ZBD A;  3E9G A;  3FIF A;  4RG2 A;  5AYF A;  2DTO A;  4M77 E;  2WSC E;  3RER A;  3TRE A;  4XU3 A;  1VQL T;  3DKM A;  2M16 A;  3RUX A;  2C06 A;  3CBP A;  2L89 A;  5J3B A;  2X35 A;  3JSC A;  3BFM A;  2E6Z A;  4M78 G;  3CCE T;  2LTO A;  4N4G A;  4F7U B;  2RJD A;  2DXT A;  2LQ8 A;  3HSB A;  3C94 A;  1LNX A;  2RI5 A;  2ZPE B;  3X28 B;  3PIP A;  3VKI A;  3LWI A;  3L2Q A;  5IN1 A;  4CI0 C;  3MO8 A;  2OTL T;  1XQH A;  1K8A C;  3V7S A;  3FC3 A;  3MHX A;  4KUD K;  2XI9 A;  5GMK h;  3PFS A;  1YHQ A;  3JCM J;  4XU2 A;  3QPH A;  1VQ6 A;  1NE8 A;  4L5G A;  1QW1 A;  2KVQ G;  3DLM A;  4M7A B;  4PJO C;  4E7I A;  4M7D E;  2X4J A;  1KQ1 A;  4B9X A;  1VQK T;  2O01 E;  2XKO C;  2DD5 A;  1QVP A;  3GF5 A;  2KK4 A;  4ZTJ A;  4HA8 A;  2K3Y A;  4M78 D;  3O8V A;  4QQG A;  4C92 A;  4M75 D;  5A2Q E;  1Q7Y C;  4ATO A;  5CCA A;  1KD1 U;  1M90 U;  2QQB A;  3SWN C;  3L42 A;  4HT8 A;  4OP0 A;  4JS4 A;  1VUB A;  4EPC A;  4A54 A;  3JB9 I;  4QVZ A;  5KH6 A;  3OYE A;  4PJO D;  4JRI A;  3PIO A;  3JAM E;  4C92 E;  5GMK j;  3OYD A;  1QVG A;  4Y28 E;  4C92 F;  5KCO A;  3RIR A;  2FB7 A;  3CXC A;  4E7L A;  3HRU A;  3L2U A;  1YJW T;  2YLB A;  5D6W A;  1NPP A;  1KC8 C;  4ME7 A;  1H64 1;  3FJP A;  1VQ9 A;  4IUQ A;  4M75 B;  1LJO A;  2X4Y A;  1UGQ B;  3QKJ A;  5GAN 2;  3TCJ A;  3QZ9 B;  4A4K A;  3UPU A;  5GAN f;  3OSS C;  1BI2 A;  4XTV A;  3V8K A;  1M8V A;  3S3N A;  1UEB A;  2Y4Y A;  1XNI A;  4XK8 E;  2ZCF B;  3SB2 A;  4ZGE B;  3QG1 A;  3ZEH A;  3A8G B;  4BE2 A;  3PMI A;  4C8Q G;  3CCR T;  1VIF A;  3OW2 A;  4RMO A;  3CC2 A;  4M7A G;  4PJO E;  1FXX A;  2XDB A;  3QO3 A;  4MZT A;  4DOW A;  3L1A A;  2DAQ A;  3MEV A;  1VQ4 A;  1I4K 1;  2QI2 A;  4PJO G;  4MMK A;  4XQ3 A;  3L2R A;  3CCV T;  3CCQ T;  1Y96 A;  2LVM A;  4KT0 E;  4OB2 B;  4J8O A;  4KBM B;  2RJC A;  4JLI A;  3HFN A;  2RHZ A;  1UB4 A;  2QQR A;  2VXF A;  1RL2 A;  2XIC A;  4PLL A;  3M56 A;  3LH0 A;  4QW2 A;  4XU1 A;  1VQ8 A;  3A8O B;  5GAM f;  2DO3 A;  4J5Y A;  1V29 B;  5D6Y A;  2DXB A;  1K8A U;  3S6W A;  3LGL A;  3CCJ T;  3MEA A;  1HK9 A;  1WJS A;  2L5Q A;  5D6X A;  5CIU A;  3TEE A;  5CQY A;  2XDD A;  3KBG A;  3CC7 A;  1M1K C;  3CBO A;  5GAO l;  1ZQ1 A;  2X4W A;  5GAN 4;  5GAN j;  4BDY A;  4A4F A;  3DB4 A;  4OB0 B;  4XTU A;  4EMG A;  4M77 F;  5CAI A;  2YRV A;  4FIB A;  4BE1 A;  2EQM A;  1Y96 B;  3CCR A;  3JCM h;  2DTH A;  1JRI A;  2DK3 A;  5LJ5 e;  4Q5W A;  5GAM d;  2NLU A;  5J39 A;  3A8M B;  3OS0 A;  2HBP A;  4M77 D;  1YHQ T;  2JTM A;  3BY7 A;  1VQ8 T;  2XD0 A;  1WJR A;  1M1G A;  1R8O B;  5GAM j;  3M53 A;  2R58 A;  3M54 A;  1JBM A;  2B8A A;  1OZ2 A;  2E65 A;  3E9F A;  2V8J A;  4FT4 A;  4HKE A;  4OVA A;  4XU0 A;  5FRN A;  3JCM c;  2ZPG B;  1D3B A;  4C5G A;  5DLQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...