5GAMf

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
b'PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
molecule tags Transcription
total genus 8
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamf00
2VXFA 5GAMf 4PJOD 4QVDA 5LJ3e 5LJ5j 3V7RA 3PGGA 5GANj 2DZ9A 4XTWA 4DQ2A 3JB9F 2RA2A 5GAN4 2K57A 1U1TA 2ZGWA 2E1HA 4M7DA 4OP0A 3BW1A 4XQ3A 3JCMh 5CAIA 4M7AB 4C92A 5GAOr 2FYKA 4PNOA 3JCMQ 5GMKj 1M8VA 4M78C 2DTOA 4M7AF 4C8QF 4M75D 4M77C 2RD1A 3HSBA 4A53A 3JCMP 2Y90A 2JN0A 4N0AA 3SWNA 4C8QA 4C8QE 5GAMh 4J6YA 3SB2A 4PJOA 4EMHA 3JCMd 5GAN2 1I5LA 4RCCA 1D3BA 1KQ1A 3FB9A 3JB9D 2RB6A 5LJ3g 3M4GA 5GMKi 3JCMJ 1I4K1 1HXDA 4M78G 4HT8A 4JLIA 2EAYA 4M77G 4XTXA 1I81A 4JUVA 3L1AA 5GAN6 4M75E 4M75A 1B34A 5GANf 4HT9A 1LOJA 4XTVA 4C8QD 1WQ7A 4XU3A 4XU1A 3AHUA 3JCMe 2FB7A 3FJPA 1WNLA 2VC8A 3RUXA 1TH7A 1I8FA 4M78B 5GAMe 1Y96B 4EMKB 4M77B 5GAOp 2CGHA 3JB9G 4F7UB 3V8JA 4M7DG 4EMKC 3JCMX 5GAN3 5GANh 4C92G 4F7UF 4M7AA 4M7AE 5GAOm 2EJFA 2DVEA 5LJ3j 3QSUA 3EFSA 4PJOG 3JCMc 2EWNA 4XTUA 1BIAA 3V8LA 4C8QG 3JB9H 5LJ5d 1M5Q1 4XTZA 2RM4A 3V8KA 3JCMg 5GMKh 5GANd 1MGQA 1H641 4M7DB 1JRIA 1JBMA 1WQWA 5GAMj 5LJ5f 1N9RA 4C92B 4Y91A 1N9SA 1HK9A 4MMLA 4WF2A 2DXUA 4X9CA 5GAMg 5GAOq 1YCYA 2DXTA 4M7DC 2QTXA 4M7AD 4NL2A 2EJGA 4C92C 4HA8A 4PJOB 4M75G 3HFNA 2DTHA 3V7CA 3V7SA 5LJ5e 3BDUA 4N0AC 1BIBA 4XU2A 3SWNC 4C8QC 5GANe 4PJOC 3RKXA 2DTIA 5GAN5 2YLCA 4JRKA 5GAOl 4M78F 5GMKm 3JB9I 4XU0A 4M77F 5LJ5h 4M78E 4MMKA 2YLBA 4M77E 5LJ3f 1U1SA 2YHTA 2VXEA 4M75B 1B34B 5GMKe 4J6XA 3BY7A 4NOYA 4F7UA 4F7UE 4JRIA 4X9DA 4M7AG 4M75C 3L2ZA 4XTYA 2DJZA 2HNIA 2E65A 2DKGA 3RESA 3QO3A 3QHSA 2I2LA 3JCMV 3QUIA 5LJ5g 1LJOA 4M78D 3EFRA 3RIRA 4M7DF 5GANg 4M77D 5GAN7 4M7DE 5LJ3h 4C92F 3SWNB 2DZCA 4C8QB 4C92E 3INZA 5GMKl 3GIBA 4V2SA 1KQ2A 4PJOF 3RKYA 1D3BB 1LNXA 4J6WA 5GAN8 2E64A 4A54A 4M7AC 2EJ9A 4EMGA 3RKWA 4PJOE 5DY9A 5LJ3d 3FIFA 3JCMb 4RCBA 4M78A 3RERA 2E41A 1Y96A 3BFMA 4M77A 4EMKA 3HFOA 3JB9J 4M7DD 3JCMf 4QVCA 5GAMd 2E10A 1X01A 3VU3C 4C92D 4NL3A 5I21A 4J5YA 4M75F 3JCMW 1WPYA 2DEQA 5GAOn 4F7UG
chains in the Genus database with same CATH superfamily
3QIIA 1NM7A 4PJOD 1JXOA 7AT1B 3CCMA 4ZGDB 1MMGA 4XTWA 2SRCA 3EFOB 1YCSB 1M1GA 4A4EA 4WCIA 4OP0A 1OULA 4N0AA 1UEBA 3EG1A 4EMHA 2VASA 2C0TA 1IB8A 2EQUA 1AOJA 5LJ3g 4BE0A 4ORZA 1VQ8A 4M75A 3G4SA 4C8QD 2ZZDA 3HL8A 1WNLA 1XNIA 2RI5A 2J7IA 4PJNA 2I0NA 2L5QA 3JSCA 1ACMB 4DOVA 5GAOp 2RI3A 1VQMA 1NPPA 3V8JA 3WVEB 5IN1A 1ZSZA 3GNFB 4LDWA 2A08A 2DD4A 1IXDA 1OZ3A 1QVFA 4BE2A 4WF2A 3IQLA 1Q82R 2L3SA 1HJDA 1ZBXA 4FCYA 4NS5A 1WHLA 3QXEB 1UGPB 3RMQA 3CCRQ 2GBQA 2FPFA 2RF0A 4BDYA 5GJVB 3X25B 1D1BA 3CEYA 1YWOA 3EG9B 3CMEA 4X9DA 2KAFA 1IHVA 1N6AA 1PCXA 2P4TA 1BCOA 1OOTA 2DF6A 3CCLQ 1NYFA 1Z9QA 4V2SA 2V1QA 5LJ3d 1TU0B 3RERA 4KT0E 4O6JA 2EYWA 3CCRT 4DBRA 2DAQA 3JB9F 2GQIA 1SEMA 4N4HA 2GFUA 3PNWC 2M0YA 5IHKA 1WHJA 2BUDA 3C4SA 3CCLT 3M4GA 2DBKA 4BUGA 4OB0B 3X26B 4JUVA 3L1AA 4F04B 1QKXA 1I07A 4HKEA 3JCMe 2X9HA 2K4YA 4LDXA 3ZEHA 1U3OA 4M78B 4ATOA 1M2VA 4MDXA 1AHJB 1Q86R 2LT1A 3UPUA 1VQPQ 4BY6B 4ZGJB 5GAN3 4M7AE 3L2WA 1IGQA 1QVGS 2OTLA 4A63B 5EC7A 3UDCA 2EQIA 2RM4A 2DXBA 5GMKh 3QBYA 5L23A 5GAMj 3LGFA 1G3TA 2DJQA 1VQLA 2DIGA 1N9SA 1M1KC 1WHHA 4X9CA 2GFAA 1UB4A 1Z9ZA 2LDMA 2J6KA 3DB4A 2LRQA 2R57A 1X27A 2L3QA 1Y7XA 4PJOC 1JU5C 3PE0A 2KK4A 1K1ZA 2LP5A 4D8DA 2RMOA 2DJZA 4E7KA 1VQPT 2ED0A 4KRTA 3NFCA 1KD1R 3X24B 3G6EA 3LGLA 4J83A 2KDSA 5DY9A 5KCOA 1Q81R 3CPWA 1UGVA 3CCJA 4Z02A 1OX8A 2CP3A 4C92D 4J5YA 1K73R 3NTIA 1UECA 4QVDA 4C5EA 5GANj 1YJNQ 1BB9A 3X20B 4AFUC 1YIJA 4CC7A 1Q95G 4A4FA 2ZGWA 3M55A 1OU8A 3JRZA 4MZPA 4M7AF 4A53A 1J3TA 2PQWA 2KVQG 5IAYA 1WGSA 1ZUKA 3LW5E 2RB6A 1C1AA 1VQNQ 3EGDB 2D6FA 3VJPA 2A7YA 2CP2A 1OPLA 5KE3A 1IRXA 2RHXA 1PM3A 1MMDA 1WJSA 3ZBDA 4AG1C 2XICA 2PVGB 2XMFA 3I56A 2LJ1A 2MMPA 2LQNA 3M0RA 4F16A 3UA7A 2IG0A 1TWBA 2M02A 2VGMA 4M7AA 2NLUA 4J9DA 1YJNT 2DVEA 1ZA1B 4IIOA 2EGCA 2CS7A 2M0OA 3O5ZA 3OYYA 3OMCA 1V1CA 4KGXB 1QQJA 4BI3A 2P84A 3H0FA 4MZTA 3OW2S 4M75G 4RKUE 1VQNT 4MZMA 3SWNC 4XU2A 1YJ9A 2X4XA 3PIPA 4JRKA 1VQ4Q 4FYXB 2RH2A 3QZ5B 3FRNA 3CCEQ 1MUZA 4OMFB 1VYTA 2QDYB 2EGEA 1VQ5A 2PUKB 2QI2A 5LJ5g 1IHWA 1B07A 2FL7A 2G3RA 2DFUA 3G1JA 4OGCA 3CCUA 3MKDA 5IT9E 3QJYA 5KYWA 4HVVA 2RHZA 3KFVA 2RO0A 5HY6A 4PJOE 5A0DA 1BI3A 5CK9A 2FRYA 4PLIA 1RI9A 3JCMb 1W4SA 1BK2A 4EMKA 1RADB 2E10A 2JMCA 4NL3A 4FYWB 1D1AA 4JS5A 4B9WA 2DRMA 1VQ4T 1Y71A 4RTZA 4HCKA 3CCET 3JCMh 4M7AB 1A0NB 2EYYA 4FYVB 2KGTA 3PMIA 1YITQ 2X3XD 1OI1A 2Y90A 3EGUA 4C8QE 3VS2A 5I22A 1AWWA 1EZZB 4RCCA 3R6OA 1K9MR 1BYMA 2MYSA 2OX7A 1HD3A 2LTOA 2DYIA 1MMAA 4XTXA 5IXFA 2E5KA 1G3YA 3TQ7P 2KXDA 2XIDA 2JTMA 2CZ7B 2VC8A 2JVVA 3VS3A 3MP6A 3L2RA 3RDVA 1KC8U 2X51A 1Y96B 4FM4B 2C0IA 2D8HA 1K8AU 1KG1A 2EKHA 2QQ9A 5LJ3j 1RUWA 5LJ5d 2ZPEB 3RR6A 2DERA 1T0HA 1JBMA 5LJ5f 1YITT 1Q86C 3CC2Q 2AKKA 4MMLA 5GAMg 5D6YA 2QYZA 4C92C 2D8JA 1MHNA 5HK0A 3V7SA 2BIVA 5GANe 4PJLA 3UATA 3CD6Q 3GLXA 1NG2A 1NPRA 4M77F 2EFIA 1AZEA 2DRKA 1OX9A 3OYLA 1BI0A 2P0PA 2LVMA 1SHFA 2RQTA 3QHSA 3C94A 1UFFA 4M7DF 5IHIA 4X1VA 1AZGB 1E7OA 3FIFA 1NJIC 1G5VA 1OZ2A 3CC2T 2KBTA 4M77A 4C0ZA 1VQ9Q 3A8MB 1GCQA 3HP9A 5GAOn 4J9GA 2DILA 4IURA 1C0MA 2MAMA 3QJ6A 3CD6T 4HXJA 1KQSP 1K0SA 3CCLA 1U1TA 1Q81C 4M7DA 2ATCB 1UGQB 5FRMA 4IUVA 1G8XA 3CQTA 2KI7A 5FU6B 3KXTA 2KYMA 3S6WA 1N27A 2JMAA 2JN0A 4C8QA 4LNPA 2HSEB 3SB2A 1ZBJA 1D3BA 1KQ1A 3FB9A 4FT2A 3CC7A 2LJ0A 4C0FA 4HT8A 2HQEA 2CUDA 1KHIA 2XG8D 5GAN6 2FRWA 3L2QA 1UJYA 1QVGP 4OB2B 2E3IA 4J9FA 4BI8B 1VQ9T 1NEBA 2XHCA 1SPKA 1E6HA 1BI1A 2L89A 4BB7A 2YUOA 2QGGA 2KT1A 1UDLA 1R8OB 1UJ0A 1FYNA 1JEGA 5A0GA 4F17A 5GAOq 4Y92A 3WXMB 2GTJA 4PJOB 4RUGA 4RG2A 4LE9A 3MEVA 3PIOA 4IIMA 1IO6A 1ZHIA 3EFOA 3FDRA 4PJJA 1V29B 1ZA2B 3MEWA 1U5SA 1U1SA 2YHTA 2X3WD 4F7UE 4M7AG 3CPFA 3ULRB 1VQ6Q 4HVUA 2LX7A 1Y0MA 2YT6A 3EHRA 3REBB 3VYHB 2HKQB 1UHCA 2RI2A 3E9GA 4C8QB 4C92E 3CCQQ 2DE0X 3DB3A 1KQ2A 2K79A 1D3BB 4J6WA 3M54A 1RAHB 1K9AA 2A3LA 4DBFA 1H3HA 1JB0E 3J7AF 3VS6A 1YJWA 5J3BA 2RPNA 3CCVQ 4C5IA 4J9EA 1CKBA 1O9SA 1IGUA 4JJBA 3FLGA 5LJ3e 2WSCE 5D6WA 2GTOA 2JM8A 1VQOA 1AWJA 3BW1A 4J9CA 5CKBA 2DD5A 3RNJA 1VQ6T 1KSWA 3TEEA 3BE3A 4RTUA 3OYEA 3X28B 3EH2A 5GAN2 1M30A 4N4IA 4AT1B 4C0DB 1PRLC 3H8ZA 1LVKA 1VYVA 2QQSA 1QMCA 3CCQT 4DOWA 2C06A 3I55T 2ENMA 3EG9A 1LPLA 4KULA 2XI9A 1JJ2P 1VQKQ 1WZOA 3RUXA 2GQVA 1VUBA 2DL7A 2EPDA 2W0ZA 1NLOC 2EYQA 3CCVT 2ESWA 4ZN1A 2QG9B 3JCMX 1U06A 5GANh 4F7UF 5GAOm 1SSHA 3OW2P 1S72Q 1YHQA 2OTJQ 2B86A 3JCMc 1VQNA 2HL3A 1WDXA 3V8KA 3KBGA 4II1A 1T0JA 5FU7C 3QYGB 2EYZA 1N9RA 2CDTA 2FZGB 1YI2Q 2CH4W 2QTXA 2EJGA 1W70A 4LD6A 4FL6A 5I11A 4M78F 1R77A 1VQKT 4MMKA 2YLBA 1B34B 4XK8E 2HDAA 2ROTA 4F7UA 2LC4A 4KUDK 2ECZA 2K2VA 1W2BS 5A2QE 3OYFA 2K7AA 3G7ZA 1V76A 1S72T 2CP0A 2DO3A 1ABOA 4Y28E 1VYUA 3INZA 1P92A 2V8IA 3RKYA 2E64A 2EJ9A 1VQ4A 4FW2A 1IZ6A 3MP1A 4M78A 1YI2T 2Y4XA 1M90R 4E7ZA 9ATCB 3VU3C 1M2OA 3A8GB 2RN8A 4E7LA 2BZ8A 5LJ5j 3NPFA 3V7RA 4OB3B 2KR3A 4OVAA 5GAN4 1RLQC 2JS2A 1WJQA 2LNVA 3GNGA 2E70A 2RD1A 2HSPA 1RAAB 2O9VA 2CH4A 4E6RA 2O9SA 1PD1A 3NTKA 5A0LA 2EAYA 4J9BA 4M77G 1MV3A 3L2VA 4XTVA 3LYIA 1Y57A 3M53A 1X43A 1NE8A 1RAIB 4FU6A 2JXBA 1N8RU 3MEUA 4F7UB 1YITA 4M7DG 3H41A 1SF9A 2OI3A 4ME7A 2DMOA 1KQSS 3EFSA 2ZAEA 4C8QG 4BD3A 3V8LA 2YSQA 3SEMA 5LL6S 2KNBB 4JJDA 1MNDA 4C92B 4E7HA 1N8RC 1O75A 2GCXA 3OYBA 3V7CA 1QLYA 3DKMA 5KYUB 3OYHA 1M1KU 2LCCA 2YRVA 4KH1B 1GFDA 3EAEA 1QKWA 1UHFA 3M59A 3J80E 1UE9A 4NOYA 1Q7YC 2MOXA 3QO3A 1K4US 1NZ9A 3QUIA 3CC2A 2JTFA 4J9HA 3EGDA 4AG2C 4CRIA 1WHMA 5LJ3h 4PK4A 3EG3A 2DL4A 4X34A 1MMNA 3LH5A 3P8BB 4YTLA 3LWIA 3C12A 1IREB 1QCNA 5GAN8 1CSKA 4L59A 4JJNK 5D7UA 1D0YA 2JNGA 1PHTA 1K8AR 4RCBA 3OBWA 2DNUA 2MK5A 1ZSGA 2ED1A 3A98A 1RAGB 2HBWA 2RJEA 4J7IA 3VS1A 1I5LA 2KY9A 2E6ZA 2AHJB 2F1LA 2JOYA 3OYAA 5CAIA 2FYKA 3JCMQ 1AT1B 1ZUUA 4M75D 4M77C 1NYGA 2X35A 1WYXA 3OYNA 5M9OA 2QEXQ 2MWPA 1VQ9A 3EGXA 2KXCA 4OMLA 4JLIA 4RG8A 3CBMA 2W10A 4LDVA 4OF1A 3ME9A 4JJCA 5ECAA 1QCOA 2XDBA 4PFPA 1TS9A 2HD0A 5CR2A 2DYBA 1DJ7B 2VUBA 2K3XA 2EJFA 3JB9H 2NUTB 3TREA 3M5AA 1WHKA 1MGQA 1X2QA 3EHQA 2YUPA 3EG2A 1WQWA 3QWXX 2BKDN 2DA9A 3M0TA 2QEXT 2P4RA 5LJ5e 2LQKA 3G71Q 2DK3A 3OYDA 1JJ2S 2VB6A 2J05A 1HYOA 3CCSA 1BU1A 2LCSA 1VQ8Q 3URGA 2AIRB 3TSWA 3G4SQ 2J6FA 1M1FA 3EFRA 3RIRA 1Q82U 2FZCB 2PZ1A 1GCPA 2HMAA 4BDZA 2M51A 4AFZC 1VQMQ 2COWA 5GMKl 1I5OB 2PU9B 3EGXB 3M58A 3OSSC 3AT1B 1BCMA 3TU4K 1Y96A 2Z0WA 3SHWA 3JCMf 2KRSA 1Q82C 2VGNA 3M0PA 2L0AA 2ABLA 4F7UG 1HSQA 1VQ6A 3G71T 5HKCA 3CCQA 1VOMA 1PSFA 5CIUA 5L8RE 1M90C 4IKFA 1WX6A 3I55A 1WA7A 1VQ8T 3G4ST 3HPWA 3CBOA 3UT1A 3CMEQ 3JB9D 3M0UA 3CCVA 3PTAA 4M78G 1VQMT 3ZL7C 4L5GA 2QDLA 3GOXA 1XJWB 1X2KA 1B3QA 1I8FA 3I5SA 3OS0A 1KJWA 2IIMA 5GAMe 3RMSA 3J81E 4QW2A 4M4ZA 2HKNA 2EWNA 4RTXA 1TUDA 2ZPIB 1XOVA 3WVDB 1H641 4BACA 2EQMA 5KCHA 2F69A 2DXUA 1E6GA 1YCYA 2Y4YA 3Q1JA 3CPWS 3HFNA 4JZ3A 3TCJA 4FT4A 3CMET 1Q86U 2QASA 3BDUA 4N0AC 2YLCA 1W2BP 4XU0A 4CC4B 2M16A 2QGFB 4JRIA 4M75C 1WHGA 2QK0A 3ZFJA 2ZPFB 4QKUA 3BDLA 1RAFB 2PVDB 1YI2A 1LJOA 2QA4Q 5CKEA 4KUIA 1PWTA 4PJOF 1ZSZC 2ZPBB 3QWYA 4B9XA 3LWHA 2A36A 2D0NA 2COYA 2OTLQ 1YFNA 2XD0A 5AT1B 2BZXA 2K6DA 3JV3A 2FPEA 4QVCA 4GBQA 5I21A 1QCFA 1WPYA 1NJIU 4Q5WA 3OS5A 5FLXE 1VQLQ 4PL6A 1RACB 4LDYA 5CVIA 1XTDA 5FROA 2RA2A 3C95A 2K57A 1AD5A 2E1HA 2PUOB 4PNOA 3FEOA 4M78C 4C8QF 3JCMP 1Q81U 1ZLMA 3CCRA 5CO7A 4PJOA 4KH0B 3S3NA 1M3AA 4KGZB 4BY6C 2RHUA 3VRYA 2QA4T 1R0BG 2FEIA 1KD1C 2DIQA 2F5KA 1RLPC 2DBMA 2XK0A 1WQ7A 4CI0C 3OYGA 2OTLT 2HQHA 2OJ2A 4HCBA 3NHNA 3G6EQ 1SKUB 5KYYB 1U8RA 1BBZA 2RQVA 2M1HA 3A8HB 3GP8A 1VQLT 1FMWA 1OYXA 1K73C 4WTOB 2OAUA 4LXCA 1SHGA 3REAB 2O4XA 2ZPGB 5CKDA 2E3HA 3O8VA 4XAXB 4E2FB 1YIJQ 1UGRB 3UWNA 4P5NA 1GL5A 2JZ2A 4NL2A 1D0XA 4ZTFA 6AT1B 3E9FA 1WJRA 2DTIA 4C5GA 2QQAA 3CMAQ 2EVRA 2DM1A 1UG1A 2J06A 4GLMA 3S3OA 2K5LA 1R0CB 3G6ET 4C0GA 1D09B 3META 4A4HA 2DLPA 2L3RA 2K5IA 1LCKA 2MI6A 2CT4A 4CC3A 2PVOB 1RL2A 3QDFA 4OMQA 4QVZA 4F14A 1T3LA 2KQWA 3M9QA 1PD0A 1G3WA 3CBPA 1VQPA 1PNJA 3OMGA 3PT9A 2JJ9A 1YIJT 3HFOA 3JAME 2KYBA 1QP2A 3CC4Q 1H3ZA 4VUBA 4C5HA 2VXFA 2GF7A 1WXBA 3CMAT 1QVFP 2QQRA 3I35A 2NYSA 1JXMA 1YJ9Q 1M1KR 2NUZA 1VA7A 2O4XB 3SWNA 5GAMh 1YBYA 3MHXA 4ELYC 2KMTA 1T3SA 5FWBA 2SEMA 2LQWA 3JCMJ 4J7FA 4RTYA 1VQ5Q 2DVJA 4ELZC 1B34A 4QQGA 5GANf 1QW1A 1VQ7Q 2AZVA 4PFOA 1TOVA 1BKBA 1XQHA 3C0CA 1FX7A 3CC4T 4D6WA 2FG0A 3OYIA 4LN2A 2CP7A 2COZA 3H0IA 1AWXA 1BIAA 2QXFA 4XTZA 2CUBA 3KUFA 2BE7D 4J8OA 1FMKA 4RTTA 5CQXA 1YJ9T 4ANJA 4KBMB 3VS0A 1KQSA 1YJNA 4OB1B 5IHNA 2RK2A 1G83A 1TG0A 1K9MC 2EYXA 1VQ7T 3SD4A 3BY7A 3QPHA 3MPUB 3NTHA 2V1RA 1TUCA 4JS4A 4GLKA 2DKGA 2E65A 2WSEE 3MO8A 8AT1B 2G6FX 2KRMA 1QVGA 3QDRB 1QP3A 4M77D 1ZX6A 3OYCA 4C92F 3OS1A 3CXCS 2PNIA 3SWNB 4JRQA 2LMJA 3S3MA 3GIBA 4M7AC 1LNXA 4L6V5 3G71A 3OSVA 1X6GA 2E41A 1UTIA 4M7DD 1KFZA 2NUPB 2DL8A 4E47A 4BE1A 2DL3A 1OQKA 3PGGA 3VS4A 5J26A 2VWFA 1OU9A 1RI0A 2OTJT 2JW4A 3TSZA 3VUZA 4CC2A 4C92A 5GAOr 4IUTA 1S1NA 3MP8A 2VKNA 5KYUA 5HK3A 2RJCA 1X6OA 1X75C 2A28A 5DLOA 1PKTA 3CCEA 2MWOA 5GMKi 4RTVA 2O88A 2F2XA 5KH6A 1I81A 3PVLA 1PG5B 4HT9A 1LOJA 4KGVB 1GBRA 4XU1A 2CP6A 4ZN3A 5IXBA 2D1XA 2DEUA 3PMTA 3P8DA 2EQKA 2ZPHB 4ESRA 2ROLA 2X4YA 2R5MA 2EIFA 2CGHA 1KHCA 1F1BB 2QQBA 2YUNA 3E2UA 2HCKA 4EMKC 2FPDA 2E6NA 2CT3A 1VIFA 2J6OA 1I1JA 4GY5A 4PJOG 3CPWP 3QKJA 1KK7A 4J9IA 4DEXA 2CP5A 2RQWA 5CKFA 4HA8A 2DXCA 1M27C 2DTHA 2NWMA 4LUDA 4EDUA 2HBPA 4DEYA 1NBEB 2D9TA 4IUUA 1EX4A 5GAN5 4QT7A 2V8JA 2EQJA 3OBYA 2KRNA 5LJ3f 4R55A 2VXEA 4M75B 3CC7Q 3UF4A 4Z88A 2RK1A 5DLQE 3TVTA 2K5FA 3PVQA 5GJWB 1JJ2A 3JCMV 5I2SA 1Q7YU 4Z89A 1ZSZB 2BZYA 2V26A 1RAEB 2X4WA 2L3PA 3R6NA 3MJXA 2O2OA 1OEBA 5FU6C 3T9NA 2XDPA 3QG1A 3OW2A 2VVKA 3VRZA 3JB9J 3EG0A 3NGPA 1PKSA 3H9NA 4HVWA 5CQYA 1RABB 1SSFA 2YXYA 1TUGB 3EH1A 2NUTA 2C0OA 1TXQA 2QA4A 2MPXC 3CC7T 3GBQA 3SFMA 1KC8R 1QVPA 3NMZC 1FMVA 4J6YA 3CD6A 8ATCB 5CCAA 3L42A 3OY9A 1G2BA 3OQ5A 2CSQA 3M4YA 1I4K1 1HXDA 5KYXA 2IVWA 3A5ZB 3E19A 5C6SA 3FJPA 3OB9A 4JRPA 3H0HA 1YNZA 2L2PA 2LNHB 2X4JA 1YP5A 1GCQC 1TSFA 3HRUA 1QVFS 1YJWQ 5J39A 2XKOC 1N5ZA 2HEQA 1EFNA 2CKKA 3JCMg 1NJIR 3GPLA 1HK9A 1WXUA 4M7DC 2VYTA 5EG2A 2KROA 1VQOQ 3F70A 2RHIA 1JQQA 1WFWA 2CZ0B 5HCKA 1OV3A 4E7JA 3N5BB 4C8QC 1I0CA 4TVRA 3JB9I 4J6XA 1M4ZA 4R56A 3L2ZA 2JUFA 3GF5A 2QTVA 1M2VB 2RNAA 3CCMQ 1AVZC 5D6XA 4M78D 1UGSB 4JLGA 1EIFA 5GAN7 3E1SA 1YJWT 2DZCA 2EKOA 5C0MA 1W6XA 3VS5A 3CMAA 1M3CA 3MCAB 4QQ6A 5KYXB 1YHQQ 1Y07A 3FJ5A 1VQOT 3H6ZA 1NEGA 3QYHB 1C6VX 1X01A 4QQDA 4C0DC 2VV5A 2K3BA 3HRSA 2WSFE 4DQ2A 3P8HA 5FWCA 2JTEA 3LLRA 3VV0A 4XQ3A 4HCCA 1UUEA 2DTOA 1FWZA 3LH0A 5DM7R 3JCMd 3CCMT 1M90U 4OMPA 2O31A 3CC4A 3M57A 3OYKA 4ZTJA 3AHUA 3QZ9B 2FB7A 2PTKA 1YHQT 4PKCC 1TH7A 2M9UA 1GRIA 1W1FA 4FSSA 1ZUYA 3U23A 1PC0A 5KE2A 4C92G 1G3SA 2EBPA 4XTUA 1GXIE 2CYZB 4MDWA 3ASKA 2JT4A 4BI4A 1VQ7A 1CKAA 4Z8AA 2DXTA 4AMCA 4HCZA 3OA6A 2P0QA 2XU8A 2B8AA 1TTHB 4PLLA 2EGAA 2R5AA 2HL5C 2H3JA 4M77E 2YRCA 2WACA 3CXCP 4JZ4A 2O01E 4D8KA 1GFCA 5FU7B 3ER0A 4XTYA 1D0ZA 3LX7A 4LD9K 2I2LA 1VQKA 2K2MA 4LDUA 4M7DE 1M9SA 1SRLA 2AZSA 3RBBB 4A54A 1D1CA 4RMOA 4EMGA 3RKWA 1WXTA 1JO8A 4E7SA 1WLPB 2HZYA 3BFMA 5KYYA 1S72A 2OTJA 2R58A 3HKSA 2LQ8A 2JM9A 1K0XA 2DEQA 2DPPB 2DETA 2YRDA 2DZ9A 2FVUA 5AYFA 2BTTA 5GMKj 1M8VA 3HSBA 4EIKA 2GNCA 4IUPA 2RQUA 3M56A 4K11A 4O5VA 2EW3A 1ARKA 1KC8C 5KYWB 1H8KA 4A4KA 1PRMC 1KD1U 1K8AC 1B7TA 2H8HA 3HHTB 4EMKB 2KSSA 4OMNA 3JB9G 2LT4A 4AFQC 2LJ3A 5CKHA 1M5Q1 2AKLA 3DLMA 2F2VA 1K73U 2ZCFB 2E12A 1GBQA 1JRIA 3I5RA 2QAZA 1QWFA 4JPBW 4OMMA 2RQRA 4Y91A 2E4HA 4M7AD 5IH2A 4IUQA 2LZ6B 2A37A 4E7IA 1X6BA 4FSXA 5GAOl 2OAWA 2FO0A 4A4GA 5GMKm 4OMOA 3VKIA 5LJ5h 4ZNXA 2CZ1B 3CCJQ 2MCNA 3M0QA 2RHYA 2E5QA 2HNIA 3RESA 1ABQA 3M0SA 2HQXA 5GANg 2RJFA 2CSIA 2F2WA 3THKA 2L8DA 1H92A 3A1PA 2CZ6B 2GGRA 4AFSC 3CXCA 3VUBA 3OYJA 5KYNA 2DL5A 3I9QA 5GAMd 1K76A 1WIEA 4B6MA 3JCMW 3UA6A 1KIKA 5GAMf 3DLLA 1YWPA 3FC3A 1VIEA 2H3EB 4ZGEB 3I56Q 3CCJT 4FYYB 4FIBA 2MIOA 2K9GA 1WI7A 1W2BA 1N8RR 1OPKA 5I2MA 2RJDA 2P0KA 1AWOA 4DA4A 1M3BA 3CCSQ 1AEYA 3A8OB 2XDDA 2FHDA 4M75E 1MNEA 4XU3A 2LX9A 1Q7YR 2FZKB 4JDSA 2YWWA 2BE9B 2YUQA 3HRTA 4FW1A 2CREA 4RTWA 4M77B 1M8MA 2KT8A 5FRNA 2KE9A 2JS0A 3QSUA 4OGEA 2D0QB 1NLPC 3I56T 3MEAA 3VS7A 3VYGA 4DBQA 5GANd 1MV0B 4M7DB 3OS2A 2F5TX 1ZQ1A 2A0FB 2NUPA 1BI2A 1X69A 1SG5A 3CCUQ 3CCST 3I55Q 1BIBA 3RKXA 1QWEA 3SDZA 2K3YA 3A8LB 4M78E 4PJMA 2IPOB 1SRMA 2DX1A 5GMKe 1K9MU 4N4GA 2QEXA 4LUEA 2AK5A 3D7SB 2V8KA 3HTRA 3OYMA 2AT1B 1PSEA 4DBHA 1FXXA 3L2UA 2YDLA 1YN8A 4PFZA 2KEAA 4R0KA 4UC4A 1VQ5T 4EPCA 2MF2A 2LCLA 5FW9A 3CCUT 4M75F 3PFSA 2HAXA
chains in the Genus database with same CATH topology
3QIIA 4PJOD 4IURA 1SSFA 2MAMA 3G71T 3QJ6A 4ZGDB 4XTWA 3CCMA 3CD6T 1M1GA 1U1TA 1Q81C 3CCLA 4A4EA 2QA4A 5HKCA 4OP0A 4M7DA 3CC7T 1UGQB 3CCQA 5FRMA 4IUVA 3SFMA 1PSFA 5CIUA 5FU6B 5L8RE 1QVPA 3KXTA 1M90C 3I55A 4IKFA 1VQ8T 3S6WA 1N27A 2JN0A 4N0AA 1UEBA 3CBOA 3HPWA 4C8QA 4J6YA 3SB2A 3G4ST 3CD6A 4EMHA 5CCAA 3L42A 1D3BA 3UT1A 3OY9A 1KQ1A 2EQUA 3FB9A 4FT2A 5LJ3g 3OQ5A 3CC7A 3JB9D 3M4YA 3PTAA 3CCVA 1I4K1 1HXDA 4M78G 4C0FA 2HQEA 4BE0A 1VQMT 4HT8A 1KHIA 2IVWA 4L5GA 1VQ8A 2XG8D 5GAN6 4M75A 3L2QA 3A5ZB 3G4SA 3E19A 4C8QD 5C6SA 3GOXA 4OB2B 2ZZDA 3FJPA 3HL8A 1WNLA 1XNIA 2RI5A 4BI8B 2L5QA 3OB9A 1I8FA 3OS0A 3JSCA 4DOVA 4JRPA 5GAMe 3RMSA 2RI3A 5GAOp 1VQ9T 1VQMA 2XHCA 1NPPA 3V8JA 3WVEB 3J81E 2L89A 1BI1A 2X4JA 5IN1A 4BB7A 4QW2A 3HRUA 3GNFB 1QVFS 5J39A 4LDWA 2EWNA 1R8OB 2XKOC 2ZPIB 1XOVA 2CKKA 3JCMg 3WVDB 1H641 4BACA 2DD4A 2EQMA 3GPLA 5KCHA 2F69A 1OZ3A 1QVFA 4BE2A 1HK9A 5A0GA 4WF2A 2DXUA 2VYTA 5EG2A 5GAOq 1YCYA 3WXMB 4M7DC 2Y4YA 3Q1JA 3F70A 4PJOB 2RHIA 3HFNA 3CPWS 4RG2A 1ZBXA 4FT4A 4NS5A 3MEVA 3TCJA 2CZ0B 3PIOA 3CMET 1VQ4A 1Q86U 3BDUA 4N0AC 4E7JA 3N5BB 4C8QC 3QXEB 1UGPB 1ZHIA 2YLCA 3RMQA 3FDRA 4TVRA 1V29B 3JB9I 4XU0A 3MEWA 4BDYA 3X25B 3CEYA 1U1SA 2M16A 2YHTA 4J6XA 4F7UE 1M4ZA 4JRIA 3CMEA 4X9DA 4M7AG 4R56A 4M75C 3CPFA 3L2ZA 2JUFA 3ZFJA 3GF5A 1VQ6A 2ZPFB 3BDLA 2KAFA 2PVDB 1N6AA 1VQLT 1YI2A 5D6XA 1LJOA 4M78D 1UGSB 2P4TA 4JLGA 3VYHB 1EIFA 5GAN7 2RI2A 3E1SA 5CKEA 1YJWT 3E9GA 4KUIA 2DZCA 4C8QB 4RMOA 4C92E 2EKOA 3DB3A 4V2SA 1KQ2A 4PJOF 1D3BB 4J6WA 3M54A 5C0MA 2ZPBB 5LJ3d 3CMAA 4B9XA 2A3LA 3LWHA 3MCAB 4QQ6A 2XD0A 1JB0E 3RERA 1Y07A 3J7AF 1VQOT 3H6ZA 1YJWA 5J3BA 4KT0E 4QVCA 3QYHB 4QQDA 1X01A 4C0DC 4C5IA 5I21A 2VV5A 1WPYA 1NJIU 1O9SA 4Q5WA 4O6JA 3OS5A 5FLXE 3FLGA 5LJ3e 3CCRT 3HRSA 4PL6A 4LDYA 2WSFE 5CVIA 4DQ2A 1XTDA 2DAQA 3JB9F 5FROA 2RA2A 3C95A 2WSCE 2K57A 3LLRA 3P8HA 2PUOB 2E1HA 5D6WA 1VQOA 3BW1A 3VV0A 4XQ3A 4N4HA 2GFUA 5CKBA 4HCCA 4PNOA 3PNWC 2DD5A 3FEOA 4M78C 2DTOA 4C8QF 1FWZA 3JCMP 1Q81U 3CCRA 3TEEA 3LH0A 5CO7A 1VQ6T 2BUDA 3C4SA 5DM7R 3OYEA 3X28B 4BY6C 3JCMd 3S3NA 5GAN2 3CCMT 2RHUA 1M90U 4N4IA 4C0DB 3H8ZA 3CCLT 2QA4T 3M4GA 2QQSA 3CC4A 4BUGA 3M57A 3CCQT 4OB0B 3OYKA 3X26B 1KD1C 4JUVA 4DOWA 2C06A 2DIQA 2F5KA 3L1AA 3I55T 4ZTJA 4KULA 2XI9A 2XK0A 1WQ7A 4HKEA 3AHUA 3QZ9B 3JCMe 4CI0C 2FB7A 3OYGA 1YHQT 2OTLT 2K4YA 3RUXA 2GQVA 1VUBA 4PKCC 1TH7A 4LDXA 3ZEHA 4HCBA 4M78B 4ATOA 2M9UA 1U8RA 1AHJB 4MDXA 2EYQA 2LT1A 3CCVT 3UPUA 4ZN1A 2M1HA 3A8HB 4BY6B 3GP8A 4ZGJB 5KE2A 3JCMX 5GAN3 1OYXA 4C92G 4F7UF 5GANh 3L2WA 1QVGS 1K73C 4M7AE 5GAOm 2OAUA 1YHQA 2OTLA 1G3SA 2O4XA 3JCMc 2ZPGB 4XTUA 1VQNA 1GXIE 2CYZB 4MDWA 3ASKA 3UDCA 2RM4A 2DXBA 3V8KA 3KBGA 5GMKh 3QBYA 4II1A 5CKDA 5FU7C 4PJOA 3QYGB 4BI4A 3LGFA 5GAMj 1G3TA 1N9RA 3O8VA 4XAXB 1VQLA 2DIGA 1N9SA 1M1KC 1UGRB 3UWNA 4P5NA 1VQ7A 4X9CA 2GFAA 2DXTA 2JZ2A 1UB4A 2QTXA 4HCZA 4NL2A 2EJGA 2LDMA 2P0QA 3OA6A 4ZTFA 3DB4A 2LRQA 2R57A 2XU8A 3E9FA 2B8AA 4LD6A 4PJOC 1WJRA 1Y7XA 4FL6A 4PLLA 2DTIA 4C5GA 4M78F 2R5AA 2QQAA 2KK4A 2H3JA 1VQKT 4MMKA 2YLBA 4M77E 1B34B 2WACA 4XK8E 4F7UA 3S3OA 2O01E 2K5LA 5FU7B 3ER0A 4XTYA 2DJZA 2LC4A 3LX7A 3G6ET 4E7KA 4KUDK 4LD9K 4C0GA 2K2VA 1W2BS 5A2QE 3META 2I2LA 4A4HA 3OYFA 1VQPT 3G7ZA 1VQKA 2L3RA 3NFCA 2K5IA 2MI6A 4LDUA 4M7DE 2PVOB 1S72T 1RL2A 3X24B 2DO3A 4QVZA 1M9SA 4Y28E 3INZA 1P92A 2KQWA 2V8IA 3G6EA 3M9QA 3RKYA 2E64A 4A54A 3LGLA 2EJ9A 4EMGA 4J83A 3RKWA 1G3WA 2KDSA 3CBPA 5DY9A 3OMGA 5KCOA 1VQPA 1IZ6A 3PT9A 3MP1A 4M78A 1YI2T 1YIJT 3CPWA 3CCJA 2Y4XA 3BFMA 4Z02A 3HFOA 1S72A 3JAME 2OTJA 2R58A 3HKSA 1QP2A 2LQ8A 1H3ZA 4VUBA 3VU3C 4C92D 4J5YA 4PJOE 4C5HA 2DPPB 2DEQA 3A8GB 3NTIA 2VXFA 4E7LA 2GF7A 4QVDA 5LJ5j 3V7RA 4OB3B 4C5EA 5GANj 2DZ9A 3CMAT 3X20B 1YIJA 2FVUA 4OVAA 4A4FA 5GAN4 2ZGWA 2QQRA 3M55A 1WJQA 2LNVA 3JRZA 3GNGA 5AYFA 2E70A 4MZPA 5GMKj 1M8VA 4M7AF 2O4XB 2RD1A 4A53A 3HSBA 3SWNA 5GAMh 2PQWA 4IUPA 2KVQG 3M56A 1YBYA 5IAYA 3MHXA 1WGSA 3LW5E 4ELYC 2KMTA 2RB6A 2D6FA 4O5VA 3NTKA 4J7FA 5A0LA 3JCMJ 3VJPA 2A7YA 2EAYA 4M77G 5KE3A 1KC8C 4ELZC 1B34A 2RHXA 4QQGA 4XTVA 1QW1A 5GANf 3L2VA 4A4KA 3LYIA 3M53A 1WJSA 3ZBDA 2XICA 2PVGB 1NE8A 3I56A 2MMPA 1KD1U 1K8AC 1BKBA 1XQHA 4FU6A 3HHTB 4EMKB 1FX7A 3CC4T 2KSSA 1N8RU 4D6WA 2IG0A 3OYIA 3MEUA 2LT4A 4F7UB 3JB9G 1YITA 4M7DG 2VGMA 4M7AA 4ME7A 2NLUA 1YJNT 2DVEA 1KQSS 3EFSA 4C8QG 2CS7A 1BIAA 2M0OA 3V8LA 4BD3A 5CKHA 2QXFA 1M5Q1 3DLMA 4XTZA 3OYYA 5LL6S 3KUFA 4J8OA 5CQXA 2ZCFB 1K73U 3OMCA 2E12A 1YJ9T 1JRIA 4KBMB 4C92B 4Y91A 4E7HA 4BI3A 1KQSA 4M7AD 4MZTA 1N8RC 4IUQA 1YJNA 4OB1B 3OW2S 1O75A 2GCXA 4M75G 3OYBA 4RKUE 4E7IA 3V7CA 3DKMA 2RK2A 1VQNT 4MZMA 3SWNC 4XU2A 3OYHA 1M1KU 1K9MC 1YJ9A 2X4XA 2LCCA 4FSXA 2YRVA 4JRKA 5GAOl 3PIPA 4A4GA 5GMKm 3EAEA 3VKIA 5LJ5h 2RH2A 3M59A 2CZ1B 3FRNA 3QZ5B 3J80E 1VQ7T 3SD4A 3BY7A 4NOYA 3QPHA 4OMFB 1Q7YC 2QDYB 3NTHA 2RHYA 4JS4A 2E5QA 4GLKA 2HNIA 2DKGA 2E65A 2WSEE 3MO8A 3QO3A 3RESA 1NZ9A 1VQ5A 2PUKB 1QVGA 2QI2A 3QDRB 3QUIA 3CC2A 5LJ5g 2JTFA 4CRIA 2HQXA 1QP3A 4M77D 2FL7A 5GANg 2G3RA 2RJFA 5LJ3h 4C92F 4OGCA 3OS1A 3OYCA 3CXCS 3SWNB 3CCUA 4JRQA 4X34A 5IT9E 3S3MA 3QJYA 2L8DA 3P8BB 3GIBA 4YTLA 3LWIA 3C12A 2RHZA 1IREB 1LNXA 2RO0A 4L6V5 5HY6A 5GAN8 4M7AC 4L59A 1BI3A 5A0DA 2CZ6B 3G71A 5CK9A 4JJNK 4PLIA 2JNGA 3OSVA 3JCMb 3CXCA 4RCBA 3VUBA 3OYJA 1W4SA 2E41A 4EMKA 3OBWA 4M7DD 5GAMd 2E10A 4NL3A 3JCMW 2RJEA 4E47A 4BE1A 4J7IA 4JS5A 1I5LA 2KY9A 2E6ZA 5GAMf 4B9WA 2AHJB 3FC3A 1VIEA 3DLLA 1VQ4T 3PGGA 1Y71A 2JOYA 5J26A 3OYAA 4ZGEB 3CCJT 1RI0A 4FIBA 3CCET 2OTJT 3JCMh 3VUZA 4M7AB 5CAIA 4C92A 5GAOr 2FYKA 4IUTA 3JCMQ 3PMIA 1W2BA 4M75D 4M77C 1OI1A 2Y90A 5I2MA 2RJDA 4C8QE 2P0KA 2X35A 3MP8A 5HK3A 2RJCA 4DA4A 4RCCA 1X6OA 1X75C 3R6OA 5DLOA 3OYNA 5M9OA 1BYMA 2MWPA 1VQ9A 3CCEA 2MWOA 5GMKi 2LTOA 4JLIA 5KH6A 4RG8A 3A8OB 1I81A 2FHDA 4XTXA 2XDDA 1G3YA 4M75E 4HT9A 3CBMA 1LOJA 2XIDA 2JTMA 4XU3A 2LX9A 4XU1A 4ZN3A 4LDVA 2CZ7B 2VC8A 2JVVA 3ME9A 4OF1A 3PMTA 3MP6A 3P8DA 2EQKA 4JDSA 2ZPHB 3L2RA 1KC8U 3HRTA 2X4YA 1Y96B 2R5MA 2EIFA 4M77B 2CGHA 1KHCA 2XDBA 2QQBA 2HD0A 5CR2A 1DJ7B 4EMKC 4FM4B 1K8AU 2VUBA 2E6NA 2K3XA 5FRNA 1KG1A 2EJFA 1VIFA 2QQ9A 4GY5A 5LJ3j 4OGEA 3QSUA 4PJOG 2D0QB 3JB9H 3I56T 3QKJA 3MEAA 5LJ5d 3TREA 3VYGA 3M5AA 5GANd 1MGQA 4M7DB 2ZPEB 3OS2A 2F5TX 1JBMA 1WQWA 5LJ5f 1YITT 1Q86C 1ZQ1A 5CKFA 4MMLA 5GAMg 2BKDN 1BI2A 5D6YA 4C92C 4HA8A 2DXCA 1MHNA 2DTHA 5HK0A 2QEXT 3V7SA 4EDUA 5LJ5e 3CCST 2HBPA 2LQKA 1BIBA 2D9TA 2BIVA 5GANe 4IUUA 3RKXA 3SDZA 5GAN5 2K3YA 3A8LB 3GLXA 4M77F 1NPRA 2DK3A 2V8JA 4M78E 3OYDA 1JJ2S 2EFIA 2EQJA 3OBYA 5LJ3f 4R55A 2VXEA 4M75B 5GMKe 3OYLA 1K9MU 1BI0A 2P0PA 2LVMA 4N4GA 2QEXA 3CCSA 2RK1A 5DLQE 3URGA 2K5FA 1JJ2A 3QHSA 3C94A 2V8KA 3JCMV 1M1FA 5I2SA 1Q7YU 3OYMA 3EFRA 3RIRA 1Q82U 4M7DF 4BDZA 1PSEA 1FXXA 5GMKl 3L2UA 2X4WA 2PU9B 4UC4A 5FU6C 3T9NA 3M58A 3OSSC 2XDPA 3QG1A 3FIFA 3OW2A 1NJIC 1VQ5T 1G5VA 4EPCA 1OZ2A 3CC2T 3TU4K 1Y96A 3JB9J 4M77A 4C0ZA 2MF2A 2LCLA 3JCMf 3A8MB 3HP9A 3CCUT 1Q82C 4M75F 2VGNA 5CQYA 3PFSA 5GAOn 2HAXA 4F7UG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXF A;  5GAM f;  4PJO D;  4QVD A;  5LJ3 e;  5LJ5 j;  3V7R A;  3PGG A;  5GAN j;  2DZ9 A;  4XTW A;  4DQ2 A;  3JB9 F;  2RA2 A;  5GAN 4;  2K57 A;  1U1T A;  2ZGW A;  2E1H A;  4M7D A;  4OP0 A;  3BW1 A;  4XQ3 A;  3JCM h;  5CAI A;  4M7A B;  4C92 A;  5GAO r;  2FYK A;  4PNO A;  3JCM Q;  5GMK j;  1M8V A;  4M78 C;  2DTO A;  4M7A F;  4C8Q F;  4M75 D;  4M77 C;  2RD1 A;  3HSB A;  4A53 A;  3JCM P;  2Y90 A;  2JN0 A;  4N0A A;  3SWN A;  4C8Q A;  4C8Q E;  5GAM h;  4J6Y A;  3SB2 A;  4PJO A;  4EMH A;  3JCM d;  5GAN 2;  1I5L A;  4RCC A;  1D3B A;  1KQ1 A;  3FB9 A;  3JB9 D;  2RB6 A;  5LJ3 g;  3M4G A;  5GMK i;  3JCM J;  1I4K 1;  1HXD A;  4M78 G;  4HT8 A;  4JLI A;  2EAY A;  4M77 G;  4XTX A;  1I81 A;  4JUV A;  3L1A A;  5GAN 6;  4M75 E;  4M75 A;  1B34 A;  5GAN f;  4HT9 A;  1LOJ A;  4XTV A;  4C8Q D;  1WQ7 A;  4XU3 A;  4XU1 A;  3AHU A;  3JCM e;  2FB7 A;  3FJP A;  1WNL A;  2VC8 A;  3RUX A;  1TH7 A;  1I8F A;  4M78 B;  5GAM e;  1Y96 B;  4EMK B;  4M77 B;  5GAO p;  2CGH A;  3JB9 G;  4F7U B;  3V8J A;  4M7D G;  4EMK C;  3JCM X;  5GAN 3;  5GAN h;  4C92 G;  4F7U F;  4M7A A;  4M7A E;  5GAO m;  2EJF A;  2DVE A;  5LJ3 j;  3QSU A;  3EFS A;  4PJO G;  3JCM c;  2EWN A;  4XTU A;  1BIA A;  3V8L A;  4C8Q G;  3JB9 H;  5LJ5 d;  1M5Q 1;  4XTZ A;  2RM4 A;  3V8K A;  3JCM g;  5GMK h;  5GAN d;  1MGQ A;  1H64 1;  4M7D B;  1JRI A;  1JBM A;  1WQW A;  5GAM j;  5LJ5 f;  1N9R A;  4C92 B;  4Y91 A;  1N9S A;  1HK9 A;  4MML A;  4WF2 A;  2DXU A;  4X9C A;  5GAM g;  5GAO q;  1YCY A;  2DXT A;  4M7D C;  2QTX A;  4M7A D;  4NL2 A;  2EJG A;  4C92 C;  4HA8 A;  4PJO B;  4M75 G;  3HFN A;  2DTH A;  3V7C A;  3V7S A;  5LJ5 e;  3BDU A;  4N0A C;  1BIB A;  4XU2 A;  3SWN C;  4C8Q C;  5GAN e;  4PJO C;  3RKX A;  2DTI A;  5GAN 5;  2YLC A;  4JRK A;  5GAO l;  4M78 F;  5GMK m;  3JB9 I;  4XU0 A;  4M77 F;  5LJ5 h;  4M78 E;  4MMK A;  2YLB A;  4M77 E;  5LJ3 f;  1U1S A;  2YHT A;  2VXE A;  4M75 B;  1B34 B;  5GMK e;  4J6X A;  3BY7 A;  4NOY A;  4F7U A;  4F7U E;  4JRI A;  4X9D A;  4M7A G;  4M75 C;  3L2Z A;  4XTY A;  2DJZ A;  2HNI A;  2E65 A;  2DKG A;  3RES A;  3QO3 A;  3QHS A;  2I2L A;  3JCM V;  3QUI A;  5LJ5 g;  1LJO A;  4M78 D;  3EFR A;  3RIR A;  4M7D F;  5GAN g;  4M77 D;  5GAN 7;  4M7D E;  5LJ3 h;  4C92 F;  3SWN B;  2DZC A;  4C8Q B;  4C92 E;  3INZ A;  5GMK l;  3GIB A;  4V2S A;  1KQ2 A;  4PJO F;  3RKY A;  1D3B B;  1LNX A;  4J6W A;  5GAN 8;  2E64 A;  4A54 A;  4M7A C;  2EJ9 A;  4EMG A;  3RKW A;  4PJO E;  5DY9 A;  5LJ3 d;  3FIF A;  3JCM b;  4RCB A;  4M78 A;  3RER A;  2E41 A;  1Y96 A;  3BFM A;  4M77 A;  4EMK A;  3HFO A;  3JB9 J;  4M7D D;  3JCM f;  4QVC A;  5GAM d;  2E10 A;  1X01 A;  3VU3 C;  4C92 D;  4NL3 A;  5I21 A;  4J5Y A;  4M75 F;  3JCM W;  1WPY A;  2DEQ A;  5GAO n;  4F7U G; 
#chains in the Genus database with same CATH topology
 3QII A;  1NM7 A;  4PJO D;  1JXO A;  7AT1 B;  3CCM A;  4ZGD B;  1MMG A;  4XTW A;  2SRC A;  3EFO B;  1YCS B;  1M1G A;  4A4E A;  4WCI A;  4OP0 A;  1OUL A;  4N0A A;  1UEB A;  3EG1 A;  4EMH A;  2VAS A;  2C0T A;  1IB8 A;  2EQU A;  1AOJ A;  5LJ3 g;  4BE0 A;  4ORZ A;  1VQ8 A;  4M75 A;  3G4S A;  4C8Q D;  2ZZD A;  3HL8 A;  1WNL A;  1XNI A;  2RI5 A;  2J7I A;  4PJN A;  2I0N A;  2L5Q A;  3JSC A;  1ACM B;  4DOV A;  5GAO p;  2RI3 A;  1VQM A;  1NPP A;  3V8J A;  3WVE B;  5IN1 A;  1ZSZ A;  3GNF B;  4LDW A;  2A08 A;  2DD4 A;  1IXD A;  1OZ3 A;  1QVF A;  4BE2 A;  4WF2 A;  3IQL A;  1Q82 R;  2L3S A;  1HJD A;  1ZBX A;  4FCY A;  4NS5 A;  1WHL A;  3QXE B;  1UGP B;  3RMQ A;  3CCR Q;  2GBQ A;  2FPF A;  2RF0 A;  4BDY A;  5GJV B;  3X25 B;  1D1B A;  3CEY A;  1YWO A;  3EG9 B;  3CME A;  4X9D A;  2KAF A;  1IHV A;  1N6A A;  1PCX A;  2P4T A;  1BCO A;  1OOT A;  2DF6 A;  3CCL Q;  1NYF A;  1Z9Q A;  4V2S A;  2V1Q A;  5LJ3 d;  1TU0 B;  3RER A;  4KT0 E;  4O6J A;  2EYW A;  3CCR T;  4DBR A;  2DAQ A;  3JB9 F;  2GQI A;  1SEM A;  4N4H A;  2GFU A;  3PNW C;  2M0Y A;  5IHK A;  1WHJ A;  2BUD A;  3C4S A;  3CCL T;  3M4G A;  2DBK A;  4BUG A;  4OB0 B;  3X26 B;  4JUV A;  3L1A A;  4F04 B;  1QKX A;  1I07 A;  4HKE A;  3JCM e;  2X9H A;  2K4Y A;  4LDX A;  3ZEH A;  1U3O A;  4M78 B;  4ATO A;  1M2V A;  4MDX A;  1AHJ B;  1Q86 R;  2LT1 A;  3UPU A;  1VQP Q;  4BY6 B;  4ZGJ B;  5GAN 3;  4M7A E;  3L2W A;  1IGQ A;  1QVG S;  2OTL A;  4A63 B;  5EC7 A;  3UDC A;  2EQI A;  2RM4 A;  2DXB A;  5GMK h;  3QBY A;  5L23 A;  5GAM j;  3LGF A;  1G3T A;  2DJQ A;  1VQL A;  2DIG A;  1N9S A;  1M1K C;  1WHH A;  4X9C A;  2GFA A;  1UB4 A;  1Z9Z A;  2LDM A;  2J6K A;  3DB4 A;  2LRQ A;  2R57 A;  1X27 A;  2L3Q A;  1Y7X A;  4PJO C;  1JU5 C;  3PE0 A;  2KK4 A;  1K1Z A;  2LP5 A;  4D8D A;  2RMO A;  2DJZ A;  4E7K A;  1VQP T;  2ED0 A;  4KRT A;  3NFC A;  1KD1 R;  3X24 B;  3G6E A;  3LGL A;  4J83 A;  2KDS A;  5DY9 A;  5KCO A;  1Q81 R;  3CPW A;  1UGV A;  3CCJ A;  4Z02 A;  1OX8 A;  2CP3 A;  4C92 D;  4J5Y A;  1K73 R;  3NTI A;  1UEC A;  4QVD A;  4C5E A;  5GAN j;  1YJN Q;  1BB9 A;  3X20 B;  4AFU C;  1YIJ A;  4CC7 A;  1Q95 G;  4A4F A;  2ZGW A;  3M55 A;  1OU8 A;  3JRZ A;  4MZP A;  4M7A F;  4A53 A;  1J3T A;  2PQW A;  2KVQ G;  5IAY A;  1WGS A;  1ZUK A;  3LW5 E;  2RB6 A;  1C1A A;  1VQN Q;  3EGD B;  2D6F A;  3VJP A;  2A7Y A;  2CP2 A;  1OPL A;  5KE3 A;  1IRX A;  2RHX A;  1PM3 A;  1MMD A;  1WJS A;  3ZBD A;  4AG1 C;  2XIC A;  2PVG B;  2XMF A;  3I56 A;  2LJ1 A;  2MMP A;  2LQN A;  3M0R A;  4F16 A;  3UA7 A;  2IG0 A;  1TWB A;  2M02 A;  2VGM A;  4M7A A;  2NLU A;  4J9D A;  1YJN T;  2DVE A;  1ZA1 B;  4IIO A;  2EGC A;  2CS7 A;  2M0O A;  3O5Z A;  3OYY A;  3OMC A;  1V1C A;  4KGX B;  1QQJ A;  4BI3 A;  2P84 A;  3H0F A;  4MZT A;  3OW2 S;  4M75 G;  4RKU E;  1VQN T;  4MZM A;  3SWN C;  4XU2 A;  1YJ9 A;  2X4X A;  3PIP A;  4JRK A;  1VQ4 Q;  4FYX B;  2RH2 A;  3QZ5 B;  3FRN A;  3CCE Q;  1MUZ A;  4OMF B;  1VYT A;  2QDY B;  2EGE A;  1VQ5 A;  2PUK B;  2QI2 A;  5LJ5 g;  1IHW A;  1B07 A;  2FL7 A;  2G3R A;  2DFU A;  3G1J A;  4OGC A;  3CCU A;  3MKD A;  5IT9 E;  3QJY A;  5KYW A;  4HVV A;  2RHZ A;  3KFV A;  2RO0 A;  5HY6 A;  4PJO E;  5A0D A;  1BI3 A;  5CK9 A;  2FRY A;  4PLI A;  1RI9 A;  3JCM b;  1W4S A;  1BK2 A;  4EMK A;  1RAD B;  2E10 A;  2JMC A;  4NL3 A;  4FYW B;  1D1A A;  4JS5 A;  4B9W A;  2DRM A;  1VQ4 T;  1Y71 A;  4RTZ A;  4HCK A;  3CCE T;  3JCM h;  4M7A B;  1A0N B;  2EYY A;  4FYV B;  2KGT A;  3PMI A;  1YIT Q;  2X3X D;  1OI1 A;  2Y90 A;  3EGU A;  4C8Q E;  3VS2 A;  5I22 A;  1AWW A;  1EZZ B;  4RCC A;  3R6O A;  1K9M R;  1BYM A;  2MYS A;  2OX7 A;  1HD3 A;  2LTO A;  2DYI A;  1MMA A;  4XTX A;  5IXF A;  2E5K A;  1G3Y A;  3TQ7 P;  2KXD A;  2XID A;  2JTM A;  2CZ7 B;  2VC8 A;  2JVV A;  3VS3 A;  3MP6 A;  3L2R A;  3RDV A;  1KC8 U;  2X51 A;  1Y96 B;  4FM4 B;  2C0I A;  2D8H A;  1K8A U;  1KG1 A;  2EKH A;  2QQ9 A;  5LJ3 j;  1RUW A;  5LJ5 d;  2ZPE B;  3RR6 A;  2DER A;  1T0H A;  1JBM A;  5LJ5 f;  1YIT T;  1Q86 C;  3CC2 Q;  2AKK A;  4MML A;  5GAM g;  5D6Y A;  2QYZ A;  4C92 C;  2D8J A;  1MHN A;  5HK0 A;  3V7S A;  2BIV A;  5GAN e;  4PJL A;  3UAT A;  3CD6 Q;  3GLX A;  1NG2 A;  1NPR A;  4M77 F;  2EFI A;  1AZE A;  2DRK A;  1OX9 A;  3OYL A;  1BI0 A;  2P0P A;  2LVM A;  1SHF A;  2RQT A;  3QHS A;  3C94 A;  1UFF A;  4M7D F;  5IHI A;  4X1V A;  1AZG B;  1E7O A;  3FIF A;  1NJI C;  1G5V A;  1OZ2 A;  3CC2 T;  2KBT A;  4M77 A;  4C0Z A;  1VQ9 Q;  3A8M B;  1GCQ A;  3HP9 A;  5GAO n;  4J9G A;  2DIL A;  4IUR A;  1C0M A;  2MAM A;  3QJ6 A;  3CD6 T;  4HXJ A;  1KQS P;  1K0S A;  3CCL A;  1U1T A;  1Q81 C;  4M7D A;  2ATC B;  1UGQ B;  5FRM A;  4IUV A;  1G8X A;  3CQT A;  2KI7 A;  5FU6 B;  3KXT A;  2KYM A;  3S6W A;  1N27 A;  2JMA A;  2JN0 A;  4C8Q A;  4LNP A;  2HSE B;  3SB2 A;  1ZBJ A;  1D3B A;  1KQ1 A;  3FB9 A;  4FT2 A;  3CC7 A;  2LJ0 A;  4C0F A;  4HT8 A;  2HQE A;  2CUD A;  1KHI A;  2XG8 D;  5GAN 6;  2FRW A;  3L2Q A;  1UJY A;  1QVG P;  4OB2 B;  2E3I A;  4J9F A;  4BI8 B;  1VQ9 T;  1NEB A;  2XHC A;  1SPK A;  1E6H A;  1BI1 A;  2L89 A;  4BB7 A;  2YUO A;  2QGG A;  2KT1 A;  1UDL A;  1R8O B;  1UJ0 A;  1FYN A;  1JEG A;  5A0G A;  4F17 A;  5GAO q;  4Y92 A;  3WXM B;  2GTJ A;  4PJO B;  4RUG A;  4RG2 A;  4LE9 A;  3MEV A;  3PIO A;  4IIM A;  1IO6 A;  1ZHI A;  3EFO A;  3FDR A;  4PJJ A;  1V29 B;  1ZA2 B;  3MEW A;  1U5S A;  1U1S A;  2YHT A;  2X3W D;  4F7U E;  4M7A G;  3CPF A;  3ULR B;  1VQ6 Q;  4HVU A;  2LX7 A;  1Y0M A;  2YT6 A;  3EHR A;  3REB B;  3VYH B;  2HKQ B;  1UHC A;  2RI2 A;  3E9G A;  4C8Q B;  4C92 E;  3CCQ Q;  2DE0 X;  3DB3 A;  1KQ2 A;  2K79 A;  1D3B B;  4J6W A;  3M54 A;  1RAH B;  1K9A A;  2A3L A;  4DBF A;  1H3H A;  1JB0 E;  3J7A F;  3VS6 A;  1YJW A;  5J3B A;  2RPN A;  3CCV Q;  4C5I A;  4J9E A;  1CKB A;  1O9S A;  1IGU A;  4JJB A;  3FLG A;  5LJ3 e;  2WSC E;  5D6W A;  2GTO A;  2JM8 A;  1VQO A;  1AWJ A;  3BW1 A;  4J9C A;  5CKB A;  2DD5 A;  3RNJ A;  1VQ6 T;  1KSW A;  3TEE A;  3BE3 A;  4RTU A;  3OYE A;  3X28 B;  3EH2 A;  5GAN 2;  1M30 A;  4N4I A;  4AT1 B;  4C0D B;  1PRL C;  3H8Z A;  1LVK A;  1VYV A;  2QQS A;  1QMC A;  3CCQ T;  4DOW A;  2C06 A;  3I55 T;  2ENM A;  3EG9 A;  1LPL A;  4KUL A;  2XI9 A;  1JJ2 P;  1VQK Q;  1WZO A;  3RUX A;  2GQV A;  1VUB A;  2DL7 A;  2EPD A;  2W0Z A;  1NLO C;  2EYQ A;  3CCV T;  2ESW A;  4ZN1 A;  2QG9 B;  3JCM X;  1U06 A;  5GAN h;  4F7U F;  5GAO m;  1SSH A;  3OW2 P;  1S72 Q;  1YHQ A;  2OTJ Q;  2B86 A;  3JCM c;  1VQN A;  2HL3 A;  1WDX A;  3V8K A;  3KBG A;  4II1 A;  1T0J A;  5FU7 C;  3QYG B;  2EYZ A;  1N9R A;  2CDT A;  2FZG B;  1YI2 Q;  2CH4 W;  2QTX A;  2EJG A;  1W70 A;  4LD6 A;  4FL6 A;  5I11 A;  4M78 F;  1R77 A;  1VQK T;  4MMK A;  2YLB A;  1B34 B;  4XK8 E;  2HDA A;  2ROT A;  4F7U A;  2LC4 A;  4KUD K;  2ECZ A;  2K2V A;  1W2B S;  5A2Q E;  3OYF A;  2K7A A;  3G7Z A;  1V76 A;  1S72 T;  2CP0 A;  2DO3 A;  1ABO A;  4Y28 E;  1VYU A;  3INZ A;  1P92 A;  2V8I A;  3RKY A;  2E64 A;  2EJ9 A;  1VQ4 A;  4FW2 A;  1IZ6 A;  3MP1 A;  4M78 A;  1YI2 T;  2Y4X A;  1M90 R;  4E7Z A;  9ATC B;  3VU3 C;  1M2O A;  3A8G B;  2RN8 A;  4E7L A;  2BZ8 A;  5LJ5 j;  3NPF A;  3V7R A;  4OB3 B;  2KR3 A;  4OVA A;  5GAN 4;  1RLQ C;  2JS2 A;  1WJQ A;  2LNV A;  3GNG A;  2E70 A;  2RD1 A;  2HSP A;  1RAA B;  2O9V A;  2CH4 A;  4E6R A;  2O9S A;  1PD1 A;  3NTK A;  5A0L A;  2EAY A;  4J9B A;  4M77 G;  1MV3 A;  3L2V A;  4XTV A;  3LYI A;  1Y57 A;  3M53 A;  1X43 A;  1NE8 A;  1RAI B;  4FU6 A;  2JXB A;  1N8R U;  3MEU A;  4F7U B;  1YIT A;  4M7D G;  3H41 A;  1SF9 A;  2OI3 A;  4ME7 A;  2DMO A;  1KQS S;  3EFS A;  2ZAE A;  4C8Q G;  4BD3 A;  3V8L A;  2YSQ A;  3SEM A;  5LL6 S;  2KNB B;  4JJD A;  1MND A;  4C92 B;  4E7H A;  1N8R C;  1O75 A;  2GCX A;  3OYB A;  3V7C A;  1QLY A;  3DKM A;  5KYU B;  3OYH A;  1M1K U;  2LCC A;  2YRV A;  4KH1 B;  1GFD A;  3EAE A;  1QKW A;  1UHF A;  3M59 A;  3J80 E;  1UE9 A;  4NOY A;  1Q7Y C;  2MOX A;  3QO3 A;  1K4U S;  1NZ9 A;  3QUI A;  3CC2 A;  2JTF A;  4J9H A;  3EGD A;  4AG2 C;  4CRI A;  1WHM A;  5LJ3 h;  4PK4 A;  3EG3 A;  2DL4 A;  4X34 A;  1MMN A;  3LH5 A;  3P8B B;  4YTL A;  3LWI A;  3C12 A;  1IRE B;  1QCN A;  5GAN 8;  1CSK A;  4L59 A;  4JJN K;  5D7U A;  1D0Y A;  2JNG A;  1PHT A;  1K8A R;  4RCB A;  3OBW A;  2DNU A;  2MK5 A;  1ZSG A;  2ED1 A;  3A98 A;  1RAG B;  2HBW A;  2RJE A;  4J7I A;  3VS1 A;  1I5L A;  2KY9 A;  2E6Z A;  2AHJ B;  2F1L A;  2JOY A;  3OYA A;  5CAI A;  2FYK A;  3JCM Q;  1AT1 B;  1ZUU A;  4M75 D;  4M77 C;  1NYG A;  2X35 A;  1WYX A;  3OYN A;  5M9O A;  2QEX Q;  2MWP A;  1VQ9 A;  3EGX A;  2KXC A;  4OML A;  4JLI A;  4RG8 A;  3CBM A;  2W10 A;  4LDV A;  4OF1 A;  3ME9 A;  4JJC A;  5ECA A;  1QCO A;  2XDB A;  4PFP A;  1TS9 A;  2HD0 A;  5CR2 A;  2DYB A;  1DJ7 B;  2VUB A;  2K3X A;  2EJF A;  3JB9 H;  2NUT B;  3TRE A;  3M5A A;  1WHK A;  1MGQ A;  1X2Q A;  3EHQ A;  2YUP A;  3EG2 A;  1WQW A;  3QWX X;  2BKD N;  2DA9 A;  3M0T A;  2QEX T;  2P4R A;  5LJ5 e;  2LQK A;  3G71 Q;  2DK3 A;  3OYD A;  1JJ2 S;  2VB6 A;  2J05 A;  1HYO A;  3CCS A;  1BU1 A;  2LCS A;  1VQ8 Q;  3URG A;  2AIR B;  3TSW A;  3G4S Q;  2J6F A;  1M1F A;  3EFR A;  3RIR A;  1Q82 U;  2FZC B;  2PZ1 A;  1GCP A;  2HMA A;  4BDZ A;  2M51 A;  4AFZ C;  1VQM Q;  2COW A;  5GMK l;  1I5O B;  2PU9 B;  3EGX B;  3M58 A;  3OSS C;  3AT1 B;  1BCM A;  3TU4 K;  1Y96 A;  2Z0W A;  3SHW A;  3JCM f;  2KRS A;  1Q82 C;  2VGN A;  3M0P A;  2L0A A;  2ABL A;  4F7U G;  1HSQ A;  1VQ6 A;  3G71 T;  5HKC A;  3CCQ A;  1VOM A;  1PSF A;  5CIU A;  5L8R E;  1M90 C;  4IKF A;  1WX6 A;  3I55 A;  1WA7 A;  1VQ8 T;  3G4S T;  3HPW A;  3CBO A;  3UT1 A;  3CME Q;  3JB9 D;  3M0U A;  3CCV A;  3PTA A;  4M78 G;  1VQM T;  3ZL7 C;  4L5G A;  2QDL A;  3GOX A;  1XJW B;  1X2K A;  1B3Q A;  1I8F A;  3I5S A;  3OS0 A;  1KJW A;  2IIM A;  5GAM e;  3RMS A;  3J81 E;  4QW2 A;  4M4Z A;  2HKN A;  2EWN A;  4RTX A;  1TUD A;  2ZPI B;  1XOV A;  3WVD B;  1H64 1;  4BAC A;  2EQM A;  5KCH A;  2F69 A;  2DXU A;  1E6G A;  1YCY A;  2Y4Y A;  3Q1J A;  3CPW S;  3HFN A;  4JZ3 A;  3TCJ A;  4FT4 A;  3CME T;  1Q86 U;  2QAS A;  3BDU A;  4N0A C;  2YLC A;  1W2B P;  4XU0 A;  4CC4 B;  2M16 A;  2QGF B;  4JRI A;  4M75 C;  1WHG A;  2QK0 A;  3ZFJ A;  2ZPF B;  4QKU A;  3BDL A;  1RAF B;  2PVD B;  1YI2 A;  1LJO A;  2QA4 Q;  5CKE A;  4KUI A;  1PWT A;  4PJO F;  1ZSZ C;  2ZPB B;  3QWY A;  4B9X A;  3LWH A;  2A36 A;  2D0N A;  2COY A;  2OTL Q;  1YFN A;  2XD0 A;  5AT1 B;  2BZX A;  2K6D A;  3JV3 A;  2FPE A;  4QVC A;  4GBQ A;  5I21 A;  1QCF A;  1WPY A;  1NJI U;  4Q5W A;  3OS5 A;  5FLX E;  1VQL Q;  4PL6 A;  1RAC B;  4LDY A;  5CVI A;  1XTD A;  5FRO A;  2RA2 A;  3C95 A;  2K57 A;  1AD5 A;  2E1H A;  2PUO B;  4PNO A;  3FEO A;  4M78 C;  4C8Q F;  3JCM P;  1Q81 U;  1ZLM A;  3CCR A;  5CO7 A;  4PJO A;  4KH0 B;  3S3N A;  1M3A A;  4KGZ B;  4BY6 C;  2RHU A;  3VRY A;  2QA4 T;  1R0B G;  2FEI A;  1KD1 C;  2DIQ A;  2F5K A;  1RLP C;  2DBM A;  2XK0 A;  1WQ7 A;  4CI0 C;  3OYG A;  2OTL T;  2HQH A;  2OJ2 A;  4HCB A;  3NHN A;  3G6E Q;  1SKU B;  5KYY B;  1U8R A;  1BBZ A;  2RQV A;  2M1H A;  3A8H B;  3GP8 A;  1VQL T;  1FMW A;  1OYX A;  1K73 C;  4WTO B;  2OAU A;  4LXC A;  1SHG A;  3REA B;  2O4X A;  2ZPG B;  5CKD A;  2E3H A;  3O8V A;  4XAX B;  4E2F B;  1YIJ Q;  1UGR B;  3UWN A;  4P5N A;  1GL5 A;  2JZ2 A;  4NL2 A;  1D0X A;  4ZTF A;  6AT1 B;  3E9F A;  1WJR A;  2DTI A;  4C5G A;  2QQA A;  3CMA Q;  2EVR A;  2DM1 A;  1UG1 A;  2J06 A;  4GLM A;  3S3O A;  2K5L A;  1R0C B;  3G6E T;  4C0G A;  1D09 B;  3MET A;  4A4H A;  2DLP A;  2L3R A;  2K5I A;  1LCK A;  2MI6 A;  2CT4 A;  4CC3 A;  2PVO B;  1RL2 A;  3QDF A;  4OMQ A;  4QVZ A;  4F14 A;  1T3L A;  2KQW A;  3M9Q A;  1PD0 A;  1G3W A;  3CBP A;  1VQP A;  1PNJ A;  3OMG A;  3PT9 A;  2JJ9 A;  1YIJ T;  3HFO A;  3JAM E;  2KYB A;  1QP2 A;  3CC4 Q;  1H3Z A;  4VUB A;  4C5H A;  2VXF A;  2GF7 A;  1WXB A;  3CMA T;  1QVF P;  2QQR A;  3I35 A;  2NYS A;  1JXM A;  1YJ9 Q;  1M1K R;  2NUZ A;  1VA7 A;  2O4X B;  3SWN A;  5GAM h;  1YBY A;  3MHX A;  4ELY C;  2KMT A;  1T3S A;  5FWB A;  2SEM A;  2LQW A;  3JCM J;  4J7F A;  4RTY A;  1VQ5 Q;  2DVJ A;  4ELZ C;  1B34 A;  4QQG A;  5GAN f;  1QW1 A;  1VQ7 Q;  2AZV A;  4PFO A;  1TOV A;  1BKB A;  1XQH A;  3C0C A;  1FX7 A;  3CC4 T;  4D6W A;  2FG0 A;  3OYI A;  4LN2 A;  2CP7 A;  2COZ A;  3H0I A;  1AWX A;  1BIA A;  2QXF A;  4XTZ A;  2CUB A;  3KUF A;  2BE7 D;  4J8O A;  1FMK A;  4RTT A;  5CQX A;  1YJ9 T;  4ANJ A;  4KBM B;  3VS0 A;  1KQS A;  1YJN A;  4OB1 B;  5IHN A;  2RK2 A;  1G83 A;  1TG0 A;  1K9M C;  2EYX A;  1VQ7 T;  3SD4 A;  3BY7 A;  3QPH A;  3MPU B;  3NTH A;  2V1R A;  1TUC A;  4JS4 A;  4GLK A;  2DKG A;  2E65 A;  2WSE E;  3MO8 A;  8AT1 B;  2G6F X;  2KRM A;  1QVG A;  3QDR B;  1QP3 A;  4M77 D;  1ZX6 A;  3OYC A;  4C92 F;  3OS1 A;  3CXC S;  2PNI A;  3SWN B;  4JRQ A;  2LMJ A;  3S3M A;  3GIB A;  4M7A C;  1LNX A;  4L6V 5;  3G71 A;  3OSV A;  1X6G A;  2E41 A;  1UTI A;  4M7D D;  1KFZ A;  2NUP B;  2DL8 A;  4E47 A;  4BE1 A;  2DL3 A;  1OQK A;  3PGG A;  3VS4 A;  5J26 A;  2VWF A;  1OU9 A;  1RI0 A;  2OTJ T;  2JW4 A;  3TSZ A;  3VUZ A;  4CC2 A;  4C92 A;  5GAO r;  4IUT A;  1S1N A;  3MP8 A;  2VKN A;  5KYU A;  5HK3 A;  2RJC A;  1X6O A;  1X75 C;  2A28 A;  5DLO A;  1PKT A;  3CCE A;  2MWO A;  5GMK i;  4RTV A;  2O88 A;  2F2X A;  5KH6 A;  1I81 A;  3PVL A;  1PG5 B;  4HT9 A;  1LOJ A;  4KGV B;  1GBR A;  4XU1 A;  2CP6 A;  4ZN3 A;  5IXB A;  2D1X A;  2DEU A;  3PMT A;  3P8D A;  2EQK A;  2ZPH B;  4ESR A;  2ROL A;  2X4Y A;  2R5M A;  2EIF A;  2CGH A;  1KHC A;  1F1B B;  2QQB A;  2YUN A;  3E2U A;  2HCK A;  4EMK C;  2FPD A;  2E6N A;  2CT3 A;  1VIF A;  2J6O A;  1I1J A;  4GY5 A;  4PJO G;  3CPW P;  3QKJ A;  1KK7 A;  4J9I A;  4DEX A;  2CP5 A;  2RQW A;  5CKF A;  4HA8 A;  2DXC A;  1M27 C;  2DTH A;  2NWM A;  4LUD A;  4EDU A;  2HBP A;  4DEY A;  1NBE B;  2D9T A;  4IUU A;  1EX4 A;  5GAN 5;  4QT7 A;  2V8J A;  2EQJ A;  3OBY A;  2KRN A;  5LJ3 f;  4R55 A;  2VXE A;  4M75 B;  3CC7 Q;  3UF4 A;  4Z88 A;  2RK1 A;  5DLQ E;  3TVT A;  2K5F A;  3PVQ A;  5GJW B;  1JJ2 A;  3JCM V;  5I2S A;  1Q7Y U;  4Z89 A;  1ZSZ B;  2BZY A;  2V26 A;  1RAE B;  2X4W A;  2L3P A;  3R6N A;  3MJX A;  2O2O A;  1OEB A;  5FU6 C;  3T9N A;  2XDP A;  3QG1 A;  3OW2 A;  2VVK A;  3VRZ A;  3JB9 J;  3EG0 A;  3NGP A;  1PKS A;  3H9N A;  4HVW A;  5CQY A;  1RAB B;  1SSF A;  2YXY A;  1TUG B;  3EH1 A;  2NUT A;  2C0O A;  1TXQ A;  2QA4 A;  2MPX C;  3CC7 T;  3GBQ A;  3SFM A;  1KC8 R;  1QVP A;  3NMZ C;  1FMV A;  4J6Y A;  3CD6 A;  8ATC B;  5CCA A;  3L42 A;  3OY9 A;  1G2B A;  3OQ5 A;  2CSQ A;  3M4Y A;  1I4K 1;  1HXD A;  5KYX A;  2IVW A;  3A5Z B;  3E19 A;  5C6S A;  3FJP A;  3OB9 A;  4JRP A;  3H0H A;  1YNZ A;  2L2P A;  2LNH B;  2X4J A;  1YP5 A;  1GCQ C;  1TSF A;  3HRU A;  1QVF S;  1YJW Q;  5J39 A;  2XKO C;  1N5Z A;  2HEQ A;  1EFN A;  2CKK A;  3JCM g;  1NJI R;  3GPL A;  1HK9 A;  1WXU A;  4M7D C;  2VYT A;  5EG2 A;  2KRO A;  1VQO Q;  3F70 A;  2RHI A;  1JQQ A;  1WFW A;  2CZ0 B;  5HCK A;  1OV3 A;  4E7J A;  3N5B B;  4C8Q C;  1I0C A;  4TVR A;  3JB9 I;  4J6X A;  1M4Z A;  4R56 A;  3L2Z A;  2JUF A;  3GF5 A;  2QTV A;  1M2V B;  2RNA A;  3CCM Q;  1AVZ C;  5D6X A;  4M78 D;  1UGS B;  4JLG A;  1EIF A;  5GAN 7;  3E1S A;  1YJW T;  2DZC A;  2EKO A;  5C0M A;  1W6X A;  3VS5 A;  3CMA A;  1M3C A;  3MCA B;  4QQ6 A;  5KYX B;  1YHQ Q;  1Y07 A;  3FJ5 A;  1VQO T;  3H6Z A;  1NEG A;  3QYH B;  1C6V X;  1X01 A;  4QQD A;  4C0D C;  2VV5 A;  2K3B A;  3HRS A;  2WSF E;  4DQ2 A;  3P8H A;  5FWC A;  2JTE A;  3LLR A;  3VV0 A;  4XQ3 A;  4HCC A;  1UUE A;  2DTO A;  1FWZ A;  3LH0 A;  5DM7 R;  3JCM d;  3CCM T;  1M90 U;  4OMP A;  2O31 A;  3CC4 A;  3M57 A;  3OYK A;  4ZTJ A;  3AHU A;  3QZ9 B;  2FB7 A;  2PTK A;  1YHQ T;  4PKC C;  1TH7 A;  2M9U A;  1GRI A;  1W1F A;  4FSS A;  1ZUY A;  3U23 A;  1PC0 A;  5KE2 A;  4C92 G;  1G3S A;  2EBP A;  4XTU A;  1GXI E;  2CYZ B;  4MDW A;  3ASK A;  2JT4 A;  4BI4 A;  1VQ7 A;  1CKA A;  4Z8A A;  2DXT A;  4AMC A;  4HCZ A;  3OA6 A;  2P0Q A;  2XU8 A;  2B8A A;  1TTH B;  4PLL A;  2EGA A;  2R5A A;  2HL5 C;  2H3J A;  4M77 E;  2YRC A;  2WAC A;  3CXC P;  4JZ4 A;  2O01 E;  4D8K A;  1GFC A;  5FU7 B;  3ER0 A;  4XTY A;  1D0Z A;  3LX7 A;  4LD9 K;  2I2L A;  1VQK A;  2K2M A;  4LDU A;  4M7D E;  1M9S A;  1SRL A;  2AZS A;  3RBB B;  4A54 A;  1D1C A;  4RMO A;  4EMG A;  3RKW A;  1WXT A;  1JO8 A;  4E7S A;  1WLP B;  2HZY A;  3BFM A;  5KYY A;  1S72 A;  2OTJ A;  2R58 A;  3HKS A;  2LQ8 A;  2JM9 A;  1K0X A;  2DEQ A;  2DPP B;  2DET A;  2YRD A;  2DZ9 A;  2FVU A;  5AYF A;  2BTT A;  5GMK j;  1M8V A;  3HSB A;  4EIK A;  2GNC A;  4IUP A;  2RQU A;  3M56 A;  4K11 A;  4O5V A;  2EW3 A;  1ARK A;  1KC8 C;  5KYW B;  1H8K A;  4A4K A;  1PRM C;  1KD1 U;  1K8A C;  1B7T A;  2H8H A;  3HHT B;  4EMK B;  2KSS A;  4OMN A;  3JB9 G;  2LT4 A;  4AFQ C;  2LJ3 A;  5CKH A;  1M5Q 1;  2AKL A;  3DLM A;  2F2V A;  1K73 U;  2ZCF B;  2E12 A;  1GBQ A;  1JRI A;  3I5R A;  2QAZ A;  1QWF A;  4JPB W;  4OMM A;  2RQR A;  4Y91 A;  2E4H A;  4M7A D;  5IH2 A;  4IUQ A;  2LZ6 B;  2A37 A;  4E7I A;  1X6B A;  4FSX A;  5GAO l;  2OAW A;  2FO0 A;  4A4G A;  5GMK m;  4OMO A;  3VKI A;  5LJ5 h;  4ZNX A;  2CZ1 B;  3CCJ Q;  2MCN A;  3M0Q A;  2RHY A;  2E5Q A;  2HNI A;  3RES A;  1ABQ A;  3M0S A;  2HQX A;  5GAN g;  2RJF A;  2CSI A;  2F2W A;  3THK A;  2L8D A;  1H92 A;  3A1P A;  2CZ6 B;  2GGR A;  4AFS C;  3CXC A;  3VUB A;  3OYJ A;  5KYN A;  2DL5 A;  3I9Q A;  5GAM d;  1K76 A;  1WIE A;  4B6M A;  3JCM W;  3UA6 A;  1KIK A;  5GAM f;  3DLL A;  1YWP A;  3FC3 A;  1VIE A;  2H3E B;  4ZGE B;  3I56 Q;  3CCJ T;  4FYY B;  4FIB A;  2MIO A;  2K9G A;  1WI7 A;  1W2B A;  1N8R R;  1OPK A;  5I2M A;  2RJD A;  2P0K A;  1AWO A;  4DA4 A;  1M3B A;  3CCS Q;  1AEY A;  3A8O B;  2XDD A;  2FHD A;  4M75 E;  1MNE A;  4XU3 A;  2LX9 A;  1Q7Y R;  2FZK B;  4JDS A;  2YWW A;  2BE9 B;  2YUQ A;  3HRT A;  4FW1 A;  2CRE A;  4RTW A;  4M77 B;  1M8M A;  2KT8 A;  5FRN A;  2KE9 A;  2JS0 A;  3QSU A;  4OGE A;  2D0Q B;  1NLP C;  3I56 T;  3MEA A;  3VS7 A;  3VYG A;  4DBQ A;  5GAN d;  1MV0 B;  4M7D B;  3OS2 A;  2F5T X;  1ZQ1 A;  2A0F B;  2NUP A;  1BI2 A;  1X69 A;  1SG5 A;  3CCU Q;  3CCS T;  3I55 Q;  1BIB A;  3RKX A;  1QWE A;  3SDZ A;  2K3Y A;  3A8L B;  4M78 E;  4PJM A;  2IPO B;  1SRM A;  2DX1 A;  5GMK e;  1K9M U;  4N4G A;  2QEX A;  4LUE A;  2AK5 A;  3D7S B;  2V8K A;  3HTR A;  3OYM A;  2AT1 B;  1PSE A;  4DBH A;  1FXX A;  3L2U A;  2YDL A;  1YN8 A;  4PFZ A;  2KEA A;  4R0K A;  4UC4 A;  1VQ5 T;  4EPC A;  2MF2 A;  2LCL A;  5FW9 A;  3CCU T;  4M75 F;  3PFS A;  2HAX A; 
#chains in the Genus database with same CATH homology
 3QII A;  4PJO D;  4IUR A;  1SSF A;  2MAM A;  3G71 T;  3QJ6 A;  4ZGD B;  4XTW A;  3CCM A;  3CD6 T;  1M1G A;  1U1T A;  1Q81 C;  3CCL A;  4A4E A;  2QA4 A;  5HKC A;  4OP0 A;  4M7D A;  3CC7 T;  1UGQ B;  3CCQ A;  5FRM A;  4IUV A;  3SFM A;  1PSF A;  5CIU A;  5FU6 B;  5L8R E;  1QVP A;  3KXT A;  1M90 C;  3I55 A;  4IKF A;  1VQ8 T;  3S6W A;  1N27 A;  2JN0 A;  4N0A A;  1UEB A;  3CBO A;  3HPW A;  4C8Q A;  4J6Y A;  3SB2 A;  3G4S T;  3CD6 A;  4EMH A;  5CCA A;  3L42 A;  1D3B A;  3UT1 A;  3OY9 A;  1KQ1 A;  2EQU A;  3FB9 A;  4FT2 A;  5LJ3 g;  3OQ5 A;  3CC7 A;  3JB9 D;  3M4Y A;  3PTA A;  3CCV A;  1I4K 1;  1HXD A;  4M78 G;  4C0F A;  2HQE A;  4BE0 A;  1VQM T;  4HT8 A;  1KHI A;  2IVW A;  4L5G A;  1VQ8 A;  2XG8 D;  5GAN 6;  4M75 A;  3L2Q A;  3A5Z B;  3G4S A;  3E19 A;  4C8Q D;  5C6S A;  3GOX A;  4OB2 B;  2ZZD A;  3FJP A;  3HL8 A;  1WNL A;  1XNI A;  2RI5 A;  4BI8 B;  2L5Q A;  3OB9 A;  1I8F A;  3OS0 A;  3JSC A;  4DOV A;  4JRP A;  5GAM e;  3RMS A;  2RI3 A;  5GAO p;  1VQ9 T;  1VQM A;  2XHC A;  1NPP A;  3V8J A;  3WVE B;  3J81 E;  2L89 A;  1BI1 A;  2X4J A;  5IN1 A;  4BB7 A;  4QW2 A;  3HRU A;  3GNF B;  1QVF S;  5J39 A;  4LDW A;  2EWN A;  1R8O B;  2XKO C;  2ZPI B;  1XOV A;  2CKK A;  3JCM g;  3WVD B;  1H64 1;  4BAC A;  2DD4 A;  2EQM A;  3GPL A;  5KCH A;  2F69 A;  1OZ3 A;  1QVF A;  4BE2 A;  1HK9 A;  5A0G A;  4WF2 A;  2DXU A;  2VYT A;  5EG2 A;  5GAO q;  1YCY A;  3WXM B;  4M7D C;  2Y4Y A;  3Q1J A;  3F70 A;  4PJO B;  2RHI A;  3HFN A;  3CPW S;  4RG2 A;  1ZBX A;  4FT4 A;  4NS5 A;  3MEV A;  3TCJ A;  2CZ0 B;  3PIO A;  3CME T;  1VQ4 A;  1Q86 U;  3BDU A;  4N0A C;  4E7J A;  3N5B B;  4C8Q C;  3QXE B;  1UGP B;  1ZHI A;  2YLC A;  3RMQ A;  3FDR A;  4TVR A;  1V29 B;  3JB9 I;  4XU0 A;  3MEW A;  4BDY A;  3X25 B;  3CEY A;  1U1S A;  2M16 A;  2YHT A;  4J6X A;  4F7U E;  1M4Z A;  4JRI A;  3CME A;  4X9D A;  4M7A G;  4R56 A;  4M75 C;  3CPF A;  3L2Z A;  2JUF A;  3ZFJ A;  3GF5 A;  1VQ6 A;  2ZPF B;  3BDL A;  2KAF A;  2PVD B;  1N6A A;  1VQL T;  1YI2 A;  5D6X A;  1LJO A;  4M78 D;  1UGS B;  2P4T A;  4JLG A;  3VYH B;  1EIF A;  5GAN 7;  2RI2 A;  3E1S A;  5CKE A;  1YJW T;  3E9G A;  4KUI A;  2DZC A;  4C8Q B;  4RMO A;  4C92 E;  2EKO A;  3DB3 A;  4V2S A;  1KQ2 A;  4PJO F;  1D3B B;  4J6W A;  3M54 A;  5C0M A;  2ZPB B;  5LJ3 d;  3CMA A;  4B9X A;  2A3L A;  3LWH A;  3MCA B;  4QQ6 A;  2XD0 A;  1JB0 E;  3RER A;  1Y07 A;  3J7A F;  1VQO T;  3H6Z A;  1YJW A;  5J3B A;  4KT0 E;  4QVC A;  3QYH B;  4QQD A;  1X01 A;  4C0D C;  4C5I A;  5I21 A;  2VV5 A;  1WPY A;  1NJI U;  1O9S A;  4Q5W A;  4O6J A;  3OS5 A;  5FLX E;  3FLG A;  5LJ3 e;  3CCR T;  3HRS A;  4PL6 A;  4LDY A;  2WSF E;  5CVI A;  4DQ2 A;  1XTD A;  2DAQ A;  3JB9 F;  5FRO A;  2RA2 A;  3C95 A;  2WSC E;  2K57 A;  3LLR A;  3P8H A;  2PUO B;  2E1H A;  5D6W A;  1VQO A;  3BW1 A;  3VV0 A;  4XQ3 A;  4N4H A;  2GFU A;  5CKB A;  4HCC A;  4PNO A;  3PNW C;  2DD5 A;  3FEO A;  4M78 C;  2DTO A;  4C8Q F;  1FWZ A;  3JCM P;  1Q81 U;  3CCR A;  3TEE A;  3LH0 A;  5CO7 A;  1VQ6 T;  2BUD A;  3C4S A;  5DM7 R;  3OYE A;  3X28 B;  4BY6 C;  3JCM d;  3S3N A;  5GAN 2;  3CCM T;  2RHU A;  1M90 U;  4N4I A;  4C0D B;  3H8Z A;  3CCL T;  2QA4 T;  3M4G A;  2QQS A;  3CC4 A;  4BUG A;  3M57 A;  3CCQ T;  4OB0 B;  3OYK A;  3X26 B;  1KD1 C;  4JUV A;  4DOW A;  2C06 A;  2DIQ A;  2F5K A;  3L1A A;  3I55 T;  4ZTJ A;  4KUL A;  2XI9 A;  2XK0 A;  1WQ7 A;  4HKE A;  3AHU A;  3QZ9 B;  3JCM e;  4CI0 C;  2FB7 A;  3OYG A;  1YHQ T;  2OTL T;  2K4Y A;  3RUX A;  2GQV A;  1VUB A;  4PKC C;  1TH7 A;  4LDX A;  3ZEH A;  4HCB A;  4M78 B;  4ATO A;  2M9U A;  1U8R A;  1AHJ B;  4MDX A;  2EYQ A;  2LT1 A;  3CCV T;  3UPU A;  4ZN1 A;  2M1H A;  3A8H B;  4BY6 B;  3GP8 A;  4ZGJ B;  5KE2 A;  3JCM X;  5GAN 3;  1OYX A;  4C92 G;  4F7U F;  5GAN h;  3L2W A;  1QVG S;  1K73 C;  4M7A E;  5GAO m;  2OAU A;  1YHQ A;  2OTL A;  1G3S A;  2O4X A;  3JCM c;  2ZPG B;  4XTU A;  1VQN A;  1GXI E;  2CYZ B;  4MDW A;  3ASK A;  3UDC A;  2RM4 A;  2DXB A;  3V8K A;  3KBG A;  5GMK h;  3QBY A;  4II1 A;  5CKD A;  5FU7 C;  4PJO A;  3QYG B;  4BI4 A;  3LGF A;  5GAM j;  1G3T A;  1N9R A;  3O8V A;  4XAX B;  1VQL A;  2DIG A;  1N9S A;  1M1K C;  1UGR B;  3UWN A;  4P5N A;  1VQ7 A;  4X9C A;  2GFA A;  2DXT A;  2JZ2 A;  1UB4 A;  2QTX A;  4HCZ A;  4NL2 A;  2EJG A;  2LDM A;  2P0Q A;  3OA6 A;  4ZTF A;  3DB4 A;  2LRQ A;  2R57 A;  2XU8 A;  3E9F A;  2B8A A;  4LD6 A;  4PJO C;  1WJR A;  1Y7X A;  4FL6 A;  4PLL A;  2DTI A;  4C5G A;  4M78 F;  2R5A A;  2QQA A;  2KK4 A;  2H3J A;  1VQK T;  4MMK A;  2YLB A;  4M77 E;  1B34 B;  2WAC A;  4XK8 E;  4F7U A;  3S3O A;  2O01 E;  2K5L A;  5FU7 B;  3ER0 A;  4XTY A;  2DJZ A;  2LC4 A;  3LX7 A;  3G6E T;  4E7K A;  4KUD K;  4LD9 K;  4C0G A;  2K2V A;  1W2B S;  5A2Q E;  3MET A;  2I2L A;  4A4H A;  3OYF A;  1VQP T;  3G7Z A;  1VQK A;  2L3R A;  3NFC A;  2K5I A;  2MI6 A;  4LDU A;  4M7D E;  2PVO B;  1S72 T;  1RL2 A;  3X24 B;  2DO3 A;  4QVZ A;  1M9S A;  4Y28 E;  3INZ A;  1P92 A;  2KQW A;  2V8I A;  3G6E A;  3M9Q A;  3RKY A;  2E64 A;  4A54 A;  3LGL A;  2EJ9 A;  4EMG A;  4J83 A;  3RKW A;  1G3W A;  2KDS A;  3CBP A;  5DY9 A;  3OMG A;  5KCO A;  1VQP A;  1IZ6 A;  3PT9 A;  3MP1 A;  4M78 A;  1YI2 T;  1YIJ T;  3CPW A;  3CCJ A;  2Y4X A;  3BFM A;  4Z02 A;  3HFO A;  1S72 A;  3JAM E;  2OTJ A;  2R58 A;  3HKS A;  1QP2 A;  2LQ8 A;  1H3Z A;  4VUB A;  3VU3 C;  4C92 D;  4J5Y A;  4PJO E;  4C5H A;  2DPP B;  2DEQ A;  3A8G B;  3NTI A;  2VXF A;  4E7L A;  2GF7 A;  4QVD A;  5LJ5 j;  3V7R A;  4OB3 B;  4C5E A;  5GAN j;  2DZ9 A;  3CMA T;  3X20 B;  1YIJ A;  2FVU A;  4OVA A;  4A4F A;  5GAN 4;  2ZGW A;  2QQR A;  3M55 A;  1WJQ A;  2LNV A;  3JRZ A;  3GNG A;  5AYF A;  2E70 A;  4MZP A;  5GMK j;  1M8V A;  4M7A F;  2O4X B;  2RD1 A;  4A53 A;  3HSB A;  3SWN A;  5GAM h;  2PQW A;  4IUP A;  2KVQ G;  3M56 A;  1YBY A;  5IAY A;  3MHX A;  1WGS A;  3LW5 E;  4ELY C;  2KMT A;  2RB6 A;  2D6F A;  4O5V A;  3NTK A;  4J7F A;  5A0L A;  3JCM J;  3VJP A;  2A7Y A;  2EAY A;  4M77 G;  5KE3 A;  1KC8 C;  4ELZ C;  1B34 A;  2RHX A;  4QQG A;  4XTV A;  1QW1 A;  5GAN f;  3L2V A;  4A4K A;  3LYI A;  3M53 A;  1WJS A;  3ZBD A;  2XIC A;  2PVG B;  1NE8 A;  3I56 A;  2MMP A;  1KD1 U;  1K8A C;  1BKB A;  1XQH A;  4FU6 A;  3HHT B;  4EMK B;  1FX7 A;  3CC4 T;  2KSS A;  1N8R U;  4D6W A;  2IG0 A;  3OYI A;  3MEU A;  2LT4 A;  4F7U B;  3JB9 G;  1YIT A;  4M7D G;  2VGM A;  4M7A A;  4ME7 A;  2NLU A;  1YJN T;  2DVE A;  1KQS S;  3EFS A;  4C8Q G;  2CS7 A;  1BIA A;  2M0O A;  3V8L A;  4BD3 A;  5CKH A;  2QXF A;  1M5Q 1;  3DLM A;  4XTZ A;  3OYY A;  5LL6 S;  3KUF A;  4J8O A;  5CQX A;  2ZCF B;  1K73 U;  3OMC A;  2E12 A;  1YJ9 T;  1JRI A;  4KBM B;  4C92 B;  4Y91 A;  4E7H A;  4BI3 A;  1KQS A;  4M7A D;  4MZT A;  1N8R C;  4IUQ A;  1YJN A;  4OB1 B;  3OW2 S;  1O75 A;  2GCX A;  4M75 G;  3OYB A;  4RKU E;  4E7I A;  3V7C A;  3DKM A;  2RK2 A;  1VQN T;  4MZM A;  3SWN C;  4XU2 A;  3OYH A;  1M1K U;  1K9M C;  1YJ9 A;  2X4X A;  2LCC A;  4FSX A;  2YRV A;  4JRK A;  5GAO l;  3PIP A;  4A4G A;  5GMK m;  3EAE A;  3VKI A;  5LJ5 h;  2RH2 A;  3M59 A;  2CZ1 B;  3FRN A;  3QZ5 B;  3J80 E;  1VQ7 T;  3SD4 A;  3BY7 A;  4NOY A;  3QPH A;  4OMF B;  1Q7Y C;  2QDY B;  3NTH A;  2RHY A;  4JS4 A;  2E5Q A;  4GLK A;  2HNI A;  2DKG A;  2E65 A;  2WSE E;  3MO8 A;  3QO3 A;  3RES A;  1NZ9 A;  1VQ5 A;  2PUK B;  1QVG A;  2QI2 A;  3QDR B;  3QUI A;  3CC2 A;  5LJ5 g;  2JTF A;  4CRI A;  2HQX A;  1QP3 A;  4M77 D;  2FL7 A;  5GAN g;  2G3R A;  2RJF A;  5LJ3 h;  4C92 F;  4OGC A;  3OS1 A;  3OYC A;  3CXC S;  3SWN B;  3CCU A;  4JRQ A;  4X34 A;  5IT9 E;  3S3M A;  3QJY A;  2L8D A;  3P8B B;  3GIB A;  4YTL A;  3LWI A;  3C12 A;  2RHZ A;  1IRE B;  1LNX A;  2RO0 A;  4L6V 5;  5HY6 A;  5GAN 8;  4M7A C;  4L59 A;  1BI3 A;  5A0D A;  2CZ6 B;  3G71 A;  5CK9 A;  4JJN K;  4PLI A;  2JNG A;  3OSV A;  3JCM b;  3CXC A;  4RCB A;  3VUB A;  3OYJ A;  1W4S A;  2E41 A;  4EMK A;  3OBW A;  4M7D D;  5GAM d;  2E10 A;  4NL3 A;  3JCM W;  2RJE A;  4E47 A;  4BE1 A;  4J7I A;  4JS5 A;  1I5L A;  2KY9 A;  2E6Z A;  5GAM f;  4B9W A;  2AHJ B;  3FC3 A;  1VIE A;  3DLL A;  1VQ4 T;  3PGG A;  1Y71 A;  2JOY A;  5J26 A;  3OYA A;  4ZGE B;  3CCJ T;  1RI0 A;  4FIB A;  3CCE T;  2OTJ T;  3JCM h;  3VUZ A;  4M7A B;  5CAI A;  4C92 A;  5GAO r;  2FYK A;  4IUT A;  3JCM Q;  3PMI A;  1W2B A;  4M75 D;  4M77 C;  1OI1 A;  2Y90 A;  5I2M A;  2RJD A;  4C8Q E;  2P0K A;  2X35 A;  3MP8 A;  5HK3 A;  2RJC A;  4DA4 A;  4RCC A;  1X6O A;  1X75 C;  3R6O A;  5DLO A;  3OYN A;  5M9O A;  1BYM A;  2MWP A;  1VQ9 A;  3CCE A;  2MWO A;  5GMK i;  2LTO A;  4JLI A;  5KH6 A;  4RG8 A;  3A8O B;  1I81 A;  2FHD A;  4XTX A;  2XDD A;  1G3Y A;  4M75 E;  4HT9 A;  3CBM A;  1LOJ A;  2XID A;  2JTM A;  4XU3 A;  2LX9 A;  4XU1 A;  4ZN3 A;  4LDV A;  2CZ7 B;  2VC8 A;  2JVV A;  3ME9 A;  4OF1 A;  3PMT A;  3MP6 A;  3P8D A;  2EQK A;  4JDS A;  2ZPH B;  3L2R A;  1KC8 U;  3HRT A;  2X4Y A;  1Y96 B;  2R5M A;  2EIF A;  4M77 B;  2CGH A;  1KHC A;  2XDB A;  2QQB A;  2HD0 A;  5CR2 A;  1DJ7 B;  4EMK C;  4FM4 B;  1K8A U;  2VUB A;  2E6N A;  2K3X A;  5FRN A;  1KG1 A;  2EJF A;  1VIF A;  2QQ9 A;  4GY5 A;  5LJ3 j;  4OGE A;  3QSU A;  4PJO G;  2D0Q B;  3JB9 H;  3I56 T;  3QKJ A;  3MEA A;  5LJ5 d;  3TRE A;  3VYG A;  3M5A A;  5GAN d;  1MGQ A;  4M7D B;  2ZPE B;  3OS2 A;  2F5T X;  1JBM A;  1WQW A;  5LJ5 f;  1YIT T;  1Q86 C;  1ZQ1 A;  5CKF A;  4MML A;  5GAM g;  2BKD N;  1BI2 A;  5D6Y A;  4C92 C;  4HA8 A;  2DXC A;  1MHN A;  2DTH A;  5HK0 A;  2QEX T;  3V7S A;  4EDU A;  5LJ5 e;  3CCS T;  2HBP A;  2LQK A;  1BIB A;  2D9T A;  2BIV A;  5GAN e;  4IUU A;  3RKX A;  3SDZ A;  5GAN 5;  2K3Y A;  3A8L B;  3GLX A;  4M77 F;  1NPR A;  2DK3 A;  2V8J A;  4M78 E;  3OYD A;  1JJ2 S;  2EFI A;  2EQJ A;  3OBY A;  5LJ3 f;  4R55 A;  2VXE A;  4M75 B;  5GMK e;  3OYL A;  1K9M U;  1BI0 A;  2P0P A;  2LVM A;  4N4G A;  2QEX A;  3CCS A;  2RK1 A;  5DLQ E;  3URG A;  2K5F A;  1JJ2 A;  3QHS A;  3C94 A;  2V8K A;  3JCM V;  1M1F A;  5I2S A;  1Q7Y U;  3OYM A;  3EFR A;  3RIR A;  1Q82 U;  4M7D F;  4BDZ A;  1PSE A;  1FXX A;  5GMK l;  3L2U A;  2X4W A;  2PU9 B;  4UC4 A;  5FU6 C;  3T9N A;  3M58 A;  3OSS C;  2XDP A;  3QG1 A;  3FIF A;  3OW2 A;  1NJI C;  1VQ5 T;  1G5V A;  4EPC A;  1OZ2 A;  3CC2 T;  3TU4 K;  1Y96 A;  3JB9 J;  4M77 A;  4C0Z A;  2MF2 A;  2LCL A;  3JCM f;  3A8M B;  3HP9 A;  3CCU T;  1Q82 C;  4M75 F;  2VGN A;  5CQY A;  3PFS A;  5GAO n;  2HAX A;  4F7U G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...