5GAMf

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
total genus 8
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamf00
1BIAA 1WQ7A 2EWNA 3RKYA 4XQ3A 4J6YA 5GMKi 2RA2A 5GMKl 4M75C 3JCMd 5LJ5e 2CGHA 5GANd 1N9RA 1X01A 1D3BB 1N9SA 4M77C 4N0AC 4M75B 3RKWA 2DTHA 5GAOn 2DXTA 4XTWA 4HT8A 4M7AF 5GAMg 2E65A 4C92B 4XTXA 3QUIA 4PJOE 4PJOD 3JCMJ 1H641 1WQWA 1YCYA 4M77B 4C8QE 4DQ2A 4M75D 1M5Q1 4JRIA 4Y91A 4PJOA 5GAMe 3PGGA 1I4K1 1LNXA 4XU1A 2ZGWA 4M77D 3JCMf 3JCMc 4C8QA 5GMKe 5GMKm 3V7CA 3JB9I 3JCMQ 3EFRA 3HFOA 4PNOA 4WF2A 4XTYA 3RKXA 3JCMh 3JCMX 5GANh 4M7DD 4M7AC 4JLIA 2DJZA 4M78F 5LJ5g 1BIBA 3SB2A 4M7DF 2DZ9A 4M7AB 4RCCA 2YLCA 4XTVA 4EMKA 2DVEA 4X9DA 1WNLA 3BDUA 3JB9G 1B34B 4F7UF 3JCMb 3V8LA 4A54A 3JB9H 4XU2A 5GAN6 5GAN8 4M7AD 2EJ9A 2E41A 4J6XA 1LJOA 3QHSA 4C92C 5GAN2 4M75G 5CAIA 5LJ5f 3JB9D 4V2SA 5DY9A 5LJ5j 4M78C 4C92G 4NL3A 4M7DC 3VU3C 3JB9J 4NOYA 4J5YA 4M77G 2QTXA 3FB9A 2DKGA 4M78G 2YLBA 4M78B 4XU0A 4M7DB 1WPYA 5I21A 4C92D 2RM4A 1Y96B 5GAOl 4OP0A 2FYKA 5LJ3g 1KQ1A 4XTZA 4M78D 4MMLA 4X9CA 4F7UB 4F7UG 3BY7A 5GAMf 3SWNA 5LJ5d 2DEQA 2DTIA 1I81A 2Y90A 5GAMj 2EAYA 5GMKj 2E1HA 2RB6A 4J6WA 4M75E 4PJOF 4EMHA 5GMKh 1JRIA 5LJ3e 4M7AG 4C8QF 1D3BA 1LOJA 2VXFA 3RIRA 4C92E 1I5LA 3EFSA 5GANg 4M75A 4M77E 2DZCA 4NL2A 2DTOA 2DXUA 1HXDA 3FJPA 4RCBA 5GAMd 3BW1A 4M77A 4N0AA 5GAOr 3JCMe 5GANe 3AHUA 3L1AA 2K57A 1U1TA 4F7UE 4PJOC 5LJ5h 3HSBA 1I8FA 1U1SA 3M4GA 4C8QC 5GAN7 1M8VA 3BFMA 4M7DG 4PJOB 4XU3A 5LJ3d 5GAN4 4EMGA 4C8QG 3SWNC 4C8QB 5GAN3 4M7AE 3QSUA 2YHTA 5GAOp 4M7AA 4JUVA 3SWNB 3V7SA 3GIBA 4MMKA 1KQ2A 4HA8A 1MGQA 4C8QD 4EMKC 4QVCA 5GAMh 1B34A 3L2ZA 2VXEA 3QO3A 3RUXA 4EMKB 2HNIA 1HK9A 3JCMg 3V8JA 1TH7A 2JN0A 5LJ3f 2RD1A 2I2LA 4JRKA 3FIFA 3JCMV 4M78E 4C92A 5LJ3j 5GAOm 3JCMP 4M7DE 3JB9F 5LJ3h 1JBMA 3V8KA 3HFNA 3INZA 4HT9A 4M78A 4M7DA 3JCMW 2E10A 4M75F 4XTUA 2VC8A 1Y96A 5GANf 2FB7A 2EJGA 5GANj 4C92F 2EJFA 4A53A 5GAN5 4PJOG 4F7UA 4M77F 5GAOq 3RESA 3V7RA 3RERA 4QVDA 2E64A
chains in the Genus database with same CATH superfamily
1YJNT 2JNGA 2RA2A 5LJ5e 2F2WA 2CH4A 1Q82U 3CCUQ 2K79A 4XTXA 1JO8A 4R55A 2LQ8A 2ZAEA 1I4K1 1NE8A 2GBQA 4KULA 3JCMQ 4OMOA 3VUBA 4JLIA 2IVWA 3CCMT 1YWOA 4M7DF 1V29B 4HVVA 5IHNA 4RKUE 5M9OA 3X28B 4IUQA 1HJDA 1QP3A 1WNLA 2K3XA 1TS9A 4FL6A 1WZOA 1VQOT 2KRSA 2EFIA 1CKAA 4ZGJB 1K8AC 1KHCA 1FYNA 2XIDA 1WX6A 4XU0A 1W2BS 1O9SA 1S72Q 3C94A 2V1RA 3VS3A 1YIJT 3PFSA 1T0HA 2JTEA 2PTKA 3EFOB 5LJ3g 5LJ5d 4BE1A 2B86A 3BY7A 5GAMj 2F2XA 1G2BA 2XG8D 3L2RA 1D3BA 1YWPA 4R0KA 2NUTA 7AT1B 2GFAA 3E9GA 2QXFA 1KG1A 4N0AA 1QVFP 4B9WA 1UB4A 4HXJA 1FX7A 3M4GA 1U06A 1FMVA 2HAXA 1RLPC 1KJWA 1MGQA 4DOWA 4FYYB 5KYXB 3VS7A 2VXEA 2VYTA 2P0PA 5EC7A 3RUXA 2M16A 1VQ6T 3J80E 1YHQQ 3OYLA 2CP7A 2ENMA 4M78A 3VS1A 1KIKA 4LDVA 1M9SA 2CS7A 2V8IA 2EIFA 4M75F 2KMTA 4LDXA 2KDSA 3EG9B 2LJ0A 1JEGA 1ZQ1A 4XQ3A 3UATA 1PSEA 4J6YA 2C0TA 5GMKl 2WSEE 3R6NA 5A0LA 2KR3A 1M1KU 2RK1A 1KQSP 1N9SA 3QBYA 4HT8A 4XK8E 2BZYA 1OU8A 1WYXA 2COYA 1WQWA 4M77B 4C8QE 2KSSA 4LXCA 4FT2A 4ELYC 4ZN3A 3HFOA 1Q81C 2DYBA 3PNWC 1M4ZA 2RQVA 4ELZC 3OYCA 4XTVA 3A98A 1LCKA 1UHCA 1VQ5T 1UUEA 3JB9D 1EX4A 4KBMB 2C06A 3CCLA 4Z88A 5I22A 2LT4A 2RJDA 2GF7A 1QVGS 4D8DA 1NLPC 1WXUA 1W2BA 1G83A 3LX7A 5FWBA 4M78D 1XNIA 2NLUA 1WJQA 2JT4A 2R5AA 1I5OB 3CMAT 4OVAA 3LLRA 2LP5A 4C8QC 1U1SA 2EYQA 3I55A 3TEEA 2L3PA 4JJDA 3DLLA 3CCEA 1RAHB 5GAN3 3CCRQ 2RJFA 2ZPIB 3G6ET 1I0CA 2HSEB 1TUGB 2NWMA 3KXTA 1VYUA 2FPEA 3L2UA 4KH0B 4QKUA 1H3ZA 2H3EB 2GGRA 2RHZA 3QO3A 2HNIA 3JCMg 1TH7A 2QA4T 1NG2A 2RQRA 2BE7D 5FWCA 3HFNA 1GL5A 2YUOA 2E10A 5GANf 2XICA 2YUQA 2L5QA 1PD0A 2XK0A 3VUZA 3CMEA 4WCIA 4LN2A 1YITQ 1YCSB 5CVIA 2GQVA 5C0MA 4KUDK 3CXCS 2P0QA 3MEVA 3MKDA 2LQNA 4MZTA 4RMOA 4RTUA 3PTAA 4C0ZA 1M2VB 1KC8R 3JCMJ 1W4SA 1TXQA 1S1NA 2K3YA 4OGCA 2X3WD 4EIKA 1VOMA 2YRDA 2ZGWA 1UGRB 3REAB 4DA4A 3RKXA 1NPRA 2DIGA 1Q82R 2ZPHB 3TQ7P 4J9IA 2EYYA 2QQAA 2DXBA 3I56Q 1M90U 2QDYB 1BI2A 4F7UF 5IT9E 1NM7A 4D6WA 5GAN2 3HTRA 4AFSC 1XOVA 2IIMA 2L2PA 4EPCA 3S3MA 3QZ5B 1C1AA 1QVGA 3REBB 2K9GA 3CCVT 5GAMf 1S72A 2XKOC 3VYGA 1MV0B 2J05A 3I9QA 4PJOF 4MDXA 1IXDA 1JRIA 2QEXQ 1UDLA 1I5LA 4C0DC 3JAME 4FSSA 2LCCA 2GTJA 2K57A 2DF6A 3X26B 5DLOA 1PCXA 1X6OA 4M7DG 4R56A 2OTJA 4XU3A 3G71Q 1W70A 2CYZB 3OBYA 2KY9A 2ZPFB 1VQNT 2DO3A 2X3XD 3L2ZA 3CCST 1PHTA 3SD4A 4M7DE 3JB9F 2M0YA 4M4ZA 3V8KA 2XDPA 2RI2A 1YHQA 2BZXA 3QYGB 4LE9A 2AK5A 1JB0E 4A53A 3V7RA 3E9FA 3OS5A 4JRPA 2R5MA 1K9MU 2K2MA 1D3BB 2NUTB 5KCHA 3CXCA 2RQWA 3X24B 4JS5A 3P8HA 3QUIA 3VKIA 1DJ7B 1GCQA 4ZN1A 1VQKT 4E7JA 2YRCA 2K3BA 4LUDA 5IN1A 3JCMc 3OW2P 3CC2Q 1Q86R 4PNOA 4WF2A 4ZNXA 3VYHB 4QQGA 1YJNQ 4FM4B 3MP6A 3HL8A 3CCQQ 3LH0A 1FMKA 4X9DA 5EG2A 1M3BA 4QQ6A 3TU4K 3HRTA 1OZ3A 4M75G 4RG2A 1G3WA 3QDRB 4M7DC 1OPKA 3PT9A 1K76A 2XDDA 1Y71A 3MPUB 5IXBA 3C95A 4M78B 3VS0A 4A4GA 2AKKA 1YNZA 1UJYA 3MJXA 2FO0A 2DL5A 2RB6A 3C4SA 4M75E 2AZSA 3A8MB 5AYFA 2RQUA 3SHWA 2F5TX 1PC0A 1VQOQ 3META 2X4WA 3A1PA 4E7SA 1N5ZA 4PJJA 2SRCA 3EG9A 3SWNC 1YIJQ 4M7AA 1SKUB 3CCRA 1Q82C 2DL8A 3UDCA 1D0ZA 2XU8A 2D8JA 1XJWB 2RD1A 4C5HA 2HCKA 4OB3B 3X20B 3JCMW 2VV5A 3DB3A 1ZUUA 3LW5E 4FW1A 1ACMB 1H3HA 1TU0B 5GAN5 3EH2A 5FU6B 1VA7A 3RKYA 1ZA1B 1I1JA 1WJSA 1YITA 4M75C 1X01A 5IHKA 3CCJQ 3RKWA 2O4XB 4XTWA 1BCMA 5I2MA 2M51A 3M58A 4PK4A 2KXCA 2KYMA 1HD3A 1LNXA 5D6WA 3BE3A 3EG1A 3QDFA 1NYGA 2FL7A 1AOJA 1WHHA 3ME9A 1Q95G 4CC3A 1TWBA 2DL4A 3V8LA 3LYIA 3M0QA 3I56A 1K73U 4M7AD 4C92C 2CZ7B 3PVLA 1HSQA 4O5VA 3VS2A 3G4SQ 2D1XA 2QTXA 3CEYA 2VGNA 2P4RA 1WPYA 8ATCB 3UT1A 1OI1A 1YP5A 1B3QA 2X9HA 2JM9A 1SRLA 4F14A 3NFCA 4NL2A 4B6MA 2QEXA 2BIVA 2A28A 2QDLA 2ESWA 1Z9QA 2KAFA 1GCPA 1P92A 1U1TA 3VS5A 3QZ9B 2VKNA 3EGDA 1ZLMA 4FYWB 3QWYA 3G71A 4JUVA 3V7SA 2EGCA 4KUIA 3GP8A 2P0KA 1M1KC 2IG0A 3CD6Q 1UJ0A 5FU7C 2PNIA 3DB4A 1HK9A 3V8JA 2L89A 2FPFA 1QKXA 2CUBA 4HT9A 4PKCC 2J06A 4ZTFA 2AIRB 2MYSA 2O2OA 4X34A 4PJOG 2LX9A 3CPWS 1NJIR 1RAEB 2RPNA 5HCKA 4AFUC 2DILA 4PJLA 3D7SB 4CC2A 4ME7A 4PJOE 1D1BA 5CQXA 2YRVA 4Y91A 2C0OA 2FPDA 2JXBA 1KC8U 5CKEA 1WDXA 1YI2Q 1ZUYA 5GANh 3CC2A 3KUFA 4RCCA 1YJ9T 3T9NA 5CQYA 3JB9G 2DERA 4RTYA 3CCQA 2EJ9A 4J6XA 1MHNA 4FU6A 4ZGEB 2LDMA 1VQ7T 4NL3A 3ER0A 1M1FA 1TG0A 4M78G 5HK0A 3CC4Q 2JOYA 1VQ4T 1EZZB 2JJ9A 1Z9ZA 2EAYA 3SDZA 1UTIA 4ZGDB 2QASA 3M57A 4IIOA 2VGMA 2LT1A 4OMQA 4ESRA 3GOXA 3I35A 5GAOr 4N4HA 1K4US 2O9SA 3HP9A 2XI9A 4PJOC 3HHTB 2QGGA 2LQKA 1M8VA 1A0NB 3JRZA 1TOVA 4OB1B 5GAN4 2NUPA 4BDYA 4OMPA 4HVWA 5D6YA 3CPFA 1M3AA 2YHTA 1AHJB 1YIJA 4TVRA 5GAMh 3VV0A 4UC4A 3CBOA 2I2LA 1RI9A 5AT1B 2HKQB 1G3YA 4KRTA 2E4HA 5FLXE 1JBMA 1D0XA 2JS2A 4A4KA 2I0NA 1ZSZC 2RJCA 2KVQG 3MEUA 3S6WA 2GFUA 2JTMA 4M77F 3BDLA 3CPWA 2RN8A 2ZPBB 1VQ9T 1Q7YC 1PD1A 1M90C 2E5QA 4E2FB 2CP6A 4KGVB 5L23A 1SRMA 3GNGA 1PWTA 2A08A 2DTHA 2E65A 3OYIA 4P5NA 3CCJA 4LUEA 1GXIE 5KYWA 4BY6B 2K7AA 4A4FA 2CZ6B 1PKTA 2FRYA 2DJZA 4FYXB 4M7AB 1IGUA 1ZBXA 1UFFA 4OMFB 9ATCB 1Q86U 1JJ2S 1QKWA 1F1BB 5L8RE 2DAQA 2EKHA 1G3TA 4PJMA 2OAWA 3QHSA 3SEMA 5KYUB 3OSSC 5DY9A 3NTKA 4IUPA 3OYBA 2KT8A 2OAUA 3M59A 3CXCP 4OMLA 4PLLA 2YLBA 3G4SA 1VQKQ 2JMAA 1VQMT 4JDSA 2E3IA 3M0UA 1K9AA 3PVQA 1IREB 1I81A 5GJWB 3G1JA 3A8HB 5GMKj 1K73R 1K0XA 5GMKh 1SSHA 3RIRA 1YJWQ 3A8GB 1OZ2A 1VYVA 3M56A 4PLIA 5GANe 2BKDN 1KD1R 1I8FA 5GAN7 1MMDA 1QQJA 3M53A 5CKDA 1K0SA 3Q1JA 2RO0A 3CC7A 1OYXA 4QVCA 1K9MC 3I5RA 2ED0A 3CCLT 3CD6A 2O4XA 5HK3A 1WHGA 4IUUA 2WACA 4GY5A 2KEAA 1I07A 2FB7A 3MHXA 5GAOq 6AT1B 1QVFS 3R6OA 1G5VA 1TTHB 3L2WA 1IHWA 5GANd 3JV3A 1QWEA 2LNVA 1T3LA 2V26A 3I55T 3ULRB 4C92B 2LNHB 3H8ZA 1PKSA 3CCET 1UGVA 1H641 1WXBA 3UPUA 2OTLQ 1KHIA 1G3SA 3RMQA 3VJPA 5GAMe 5FRMA 4C8QA 3JB9I 1SHGA 4AFQC 3EGDB 4Y92A 1C6VX 4BI8B 2KI7A 5LJ5g 1BIBA 1YI2A 1R0BG 3P8DA 1ZSGA 2VVKA 5KCOA 1IRXA 5GAN8 4AT1B 4HCZA 4C5GA 1M3CA 5CAIA 4C5EA 3M9QA 4OMNA 2RHYA 3CMET 3CCUA 4J5YA 3TCJA 1E7OA 2JW4A 1K8AU 1WHKA 2M02A 3QYHB 1KQSS 4XTZA 4X9CA 3M0SA 3CC4A 3KFVA 2K6DA 1NPPA 2X4YA 3VRZA 2YDLA 4RTWA 2EW3A 4D8KA 1PM3A 3CBMA 4GLMA 4OB2B 2IPOB 1WJRA 5GAMd 4ATOA 3PMIA 1AD5A 1NLOC 2Y4XA 2G6FX 1X6BA 3ZFJA 2HSPA 3OS1A 2KQWA 1IHVA 3QXEB 2MAMA 2DETA 2CP3A 4C8QD 2AHJB 4EMKC 1W6XA 2ABLA 4DEYA 2K5FA 4E7LA 2HL3A 1R0CB 5CCAA 1ABQA 5LJ3j 1RAFB 5LJ3h 1BB9A 5CKBA 3EHRA 1AT1B 2DLPA 3A8OB 1S72T 2LZ6B 3LWIA 2X4XA 4GLKA 3OMGA 3PMTA 4AG2C 2QQSA 1OX9A 1QVFA 4LD9K 4JPBW 2PQWA 1NJIU 4BE0A 2AT1B 1FXXA 1WXTA 2OTJT 1YCYA 3OS2A 4E7IA 2JTFA 1MNDA 2CDTA 1BYMA 4PFZA 3EG2A 3LGFA 2MWOA 3EFRA 2RI3A 3OYHA 1N8RR 1WLPB 2NUPB 2X35A 4M78F 4BB7A 2RK2A 2WSCE 2M9UA 2SEMA 4A54A 3HKSA 2GNCA 4A4EA 3EAEA 4J9FA 1IO6A 4LDWA 1VQLT 4M77G 2KE9A 1WHMA 5FROA 3GF5A 1ABOA 2F69A 4MDWA 2RM4A 2DX1A 3FJ5A 3M4YA 4OP0A 2J6FA 1VQKA 2YSQA 3QPHA 1GRIA 4OGEA 2ROTA 2EYWA 4X1VA 1UE9A 2VXFA 4J83A 1JXMA 5GANg 4M77E 2DTOA 3FJPA 4E7ZA 2DK3A 1YJWA 3L1AA 1VQ7Q 3U23A 1U8RA 3O8VA 5KYWB 1RAIB 3BFMA 2KYBA 1ZSZB 1VQ4Q 1RL2A 1SF9A 2LJ3A 4F17A 4MMKA 4BI4A 2X4JA 4LDUA 3CCMQ 4FCYA 2L8DA 1AEYA 2JN0A 3OYFA 3SFMA 4DBQA 2MPXC 3INZA 1AZEA 2J7IA 4M7DA 2V8KA 4QQDA 1KC8C 3AT1B 5FW9A 1H92A 4QVDA 4KH1B 4RG8A 4PFOA 1OX8A 4E6RA 5IHIA 3OYGA 4JS4A 1MV3A 4Z02A 2L3QA 2CZ0B 3LWHA 3E2UA 1BI3A 4M77C 5KYUA 2D9TA 3X25B 3OYJA 5GAMg 1PSFA 1ZBJA 2XDBA 1X2QA 4JRIA 3S3OA 3CCRT 2DL3A 2OTLA 2EVRA 3JCMh 2PUOB 4J9CA 1VQ9Q 2DZ9A 1J3TA 3M55A 3JB9H 4FT4A 2R58A 4A4HA 5LJ5j 2W0ZA 1AZGB 1VQ6Q 3UA7A 2F5KA 1UHFA 2M0OA 2RH2A 3ASKA 1UEBA 2P4TA 1YITT 5CK9A 1V76A 2CP2A 2OJ2A 1OPLA 4M7DD 1M27C 2A37A 3GBQA 5DLQE 1UGQB 3OYEA 4M75A 1QCFA 3FDRA 3MP1A 1X43A 3OW2S 4KGZB 1K8AR 2CREA 2VB6A 3PIOA 2XHCA 2GTOA 3HSBA 1Y0MA 4OF1A 1AWWA 2VWFA 2QYZA 4EDUA 3A8LB 5LJ3d 2LTOA 4C8QB 1VQMQ 2COZA 4F16A 5KYYB 2DD5A 4PFPA 1KD1U 1KQ2A 2E6NA 4N4IA 2COWA 3HRUA 1BI1A 1OEBA 5J39A 2A7YA 1WA7A 2RHUA 5LJ3f 4JRKA 2G3RA 4C92A 1VQ5Q 2DXCA 2CKKA 2DIQA 3RNJA 1VQ8T 4XAXB 2QEXT 4E7KA 1Q86C 2DMOA 3DLMA 2EPDA 1W2BP 2QAZA 1ZX6A 2DA9A 3CMAQ 2MOXA 1OQKA 4M75D 1VQPT 2L3SA 5CO7A 1PRLC 1QVPA 5GMKm 3H0IA 3V7CA 1BKBA 1X75C 2KRMA 1SHFA 3JCMX 2E12A 3VRYA 4Z89A 3WVDB 2ED1A 3G6EQ 2JVVA 2O01E 1WFWA 3L42A 2D0NA 2E41A 3UA6A 1ARKA 1RAAB 1MNEA 3I55Q 4DEXA 2QA4Q 2EQJA 1RI0A 3DKMA 3EHQA 4C92D 1RADB 1N27A 5C6SA 1U5SA 5HKCA 3N5BB 3H41A 2KK4A 2LJ1A 1D1CA 4EMHA 2F1LA 1LOJA 2RI5A 2BTTA 3PE0A 4IURA 3EFSA 3FLGA 1E6GA 5CKFA 1YJNA 4RCBA 3OW2A 1H8KA 3JCMe 3VS6A 1SG5A 4JJCA 1SPKA 4C0DB 2EKOA 4IUTA 3CC2T 1M1GA 1MMNA 2HMAA 1QP2A 5D7UA 1VQ7A 1SSFA 2RNAA 3EGXA 3GPLA 3QSUA 3CCQT 1AWOA 1VQ4A 3TVTA 2MI6A 1QCNA 2OX7A 3OYYA 2EGEA 4WTOB 1Y57A 3CCMA 3QWXX 3JCMP 4M78E 1IZ6A 1WHLA 3H0FA 4RTTA 3ZBDA 2MF2A 4L5GA 1VQOA 2VC8A 4J8OA 3KBGA 2RF0A 2EGAA 2EJFA 3MO8A 4F7UA 5KYNA 3OQ5A 5IAYA 1OU9A 2HDAA 3CCVQ 2D6FA 3MP8A 3CBPA 1QVGP 2HEQA 3EG0A 5GMKi 3JCMd 5FRNA 2CGHA 1MUZA 1SEMA 2K5IA 4N0AC 2V8JA 2DXTA 4M7AF 2YUPA 4ZTJA 1QLYA 4ORZA 1Y7XA 4HVUA 3OYDA 4HCCA 2XD0A 3M0PA 4PJOA 3PGGA 4BE2A 3JCMf 8AT1B 1AWJA 4C0GA 4XTYA 2ZPEB 1KK7A 3NPFA 2JMCA 4IIMA 1B7TA 4B9XA 4CC7A 3SB2A 2YLCA 1VQNQ 1MMGA 4PJNA 2AZVA 2E6ZA 3BDUA 1N8RU 1VQ9A 4MZPA 2E3HA 5GAN6 1EFNA 4J7IA 3CCSQ 5LJ5f 2LCLA 4M78C 2OTJQ 3JB9J 2FZCB 4M7DB 1VQ6A 1ZSZA 4RTXA 5I21A 2NYSA 2HBPA 2CP5A 1QCOA 1O75A 1YBYA 4IKFA 2Y90A 4RUGA 3OYKA 3EGUA 3CCJT 3MEWA 4OB0B 4RTVA 2F2VA 4KT0E 4NS5A 3H6ZA 2HKNA 1VQLQ 2KNBB 4J9BA 3NMZC 1U3OA 3THKA 1C0MA 4C8QG 2W10A 3MCAB 2RHIA 4CRIA 5GAOp 4PJOD 3SWNB 1VQMA 4HA8A 2GCXA 4HCKA 3I5SA 1NJIC 1VYTA 2CSQA 2GQIA 2H3JA 2FRWA 3E1SA 3G4ST 5GAOm 2DFUA 1OV3A 2EQUA 2BUDA 2HBWA 2DM1A 1VQ5A 4C92F 2CSIA 1RABB 5FU6C 4OMMA 2CT3A 1M30A 4GBQA 4L6V5 1X6GA 1GBQA 2AKLA 3L2VA 5ECAA 2XMFA 3OS0A 1N9RA 2BE9B 5KE2A 4M75B 5GAOn 1BBZA 1NEGA 5CKHA 2JS0A 4J9HA 1TUDA 3CQTA 3CMAA 3CC7T 2P84A 1BI0A 3FRNA 3M0RA 1R8OB 4CC4B 5HY6A 1TSFA 3WXMB 1XQHA 3CD6T 2KROA 1D0YA 3LH5A 2DVEA 5J26A 3G6EA 3EG3A 2FEIA 2PVOB 2MWPA 4HCBA 2FZGB 4V2SA 3OYAA 1JXOA 4F04B 3ZL7C 2O31A 2DKGA 2QA4A 2CH4W 5KYYA 2EYXA 2C0IA 3P8BB 2KXDA 2LMJA 3OYMA 2A3LA 2EQKA 2EQMA 1IGQA 2DBMA 5D6XA 2YXYA 1CSKA 2DZCA 1PNJA 1JJ2A 2D8HA 2QQRA 1WGSA 4BDZA 3OMCA 3AHUA 2CZ1B 2LVMA 2ZZDA 1QMCA 1UECA 1YI2T 2R57A 3OYNA 1XTDA 2PU9B 3GIBA 3RBBB 3C12A 1B34A 1NBEB 2CUDA 1NYFA 3CCUT 5A2QE 2L0AA 2X51A 1QWFA 3C0CA 5FU7B 3JCMV 3QG1A 2KBTA 1R77A 3HPWA 4C5IA 3CC4T 2JZ2A 1Y96A 4BI3A 1RAGB 5I2SA 5A0GA 1OOTA 4AG1C 2E64A 2ATCB 1Q7YU 2ECZA 4LNPA 4QT7A 3CCVA 2QQBA 3MEAA 2JM8A 3FC3A 4O6JA 5J3BA 4AFZC 2QGFB 4DQ2A 4XU1A 5GMKe 3GLXA 4HKEA 1VQ8Q 4JZ4A 3EGXB 4IUVA 4EMKA 3A5ZB 4E7HA 1K73C 3JCMb 2RJEA 4XU2A 2DNUA 1VQNA 1V1CA 2LC4A 2QQ9A 3RDVA 3IQLA 3OY9A 3VU3C 3CCSA 3FB9A 1VUBA 3UWNA 1EIFA 1VQPQ 5GAOl 1KD1C 2FZKB 4F7UB 4MMLA 4JRQA 2HQHA 2DEQA 3J7AF 1Q81U 3VS4A 1FMWA 3NTHA 4AMCA 1JQQA 4M7AG 1G8XA 3H0HA 2M1HA 1AVZC 1YFNA 3UF4A 1YHQT 2Y4YA 1GCQC 1D09B 1RACB 5IH2A 2QK0A 2DEUA 1T3SA 4PJOB 1VQLA 3M0TA 4M7AE 4DOVA 2PUKB 3TSZA 1KQSA 2E5KA 2HQXA 1LVKA 2LCSA 1X2KA 5I11A 2LQWA 3H9NA 4DBHA 1YJ9Q 2MMPA 3F70A 3FEOA 3L2QA 3NHNA 2PVGB 2EQIA 2LX7A 1IB8A 1M8MA 3RMSA 2E70A 1GBRA 1N6AA 2VUBA 3EFOA 1CKBA 4FSXA 3M5AA 4BD3A 1M1KR 2H8HA 1BU1A 4A63B 3RESA 5CIUA 4FYVB 1BIAA 4VUBA 2DPPB 5A0DA 2HZYA 1YJWT 4LDYA 2HQEA 1LPLA 4J9GA 2VASA 4BY6C 3WVEB 5KE3A 3OA6A 1VIEA 5KH6A 4M7AC 2YT6A 5KYXA 2NUZA 4JJNK 4L59A 1GFCA 2EYZA 3OBWA 4FW2A 1LJOA 4BUGA 2QI2A 2HD0A 4C92G 4NOYA 2ROLA 2ZPGB 1ZUKA 2V1QA 2DYIA 2J6OA 1KQ1A 4JJBA 3J81E 2K4YA 3SWNA 2Z0WA 1UGSB 2A0FB 1QW1A 2E1HA 5LJ3e 2PZ1A 1AWXA 4QW2A 4C8QF 4C92E 2EBPA 4PL6A 1KFZA 1HYOA 3CPWP 2DXUA 4RTZA 1WHJA 4YTLA 3BW1A 4M77A 3NTIA 1FWZA 2DBKA 2OTLT 1BK2A 5LJ5h 2YWWA 2MK5A 3E19A 2JUFA 4EMGA 2K5LA 1PG5B 3JSCA 4Q5WA 2CP0A 1GFDA 1B07A 4JLGA 2K2VA 3O5ZA 2ZCFB 4XTUA 2QTVA 4DBFA 1VIFA 4J9EA 2EJGA 4J9DA 3QIIA 3G7ZA 1NEBA 2B8AA 4DBRA 3NGPA 3S3NA 2DRMA 2DRKA 3RERA 1D1AA 2FHDA 1WQ7A 3I56T 2EWNA 1N8RC 4N4GA 2RQTA 2A36A 4FIBA 1WIEA 4J7FA 2D0QB 1W1FA 3QJ6A 1M5Q1 4LD6A 4C0FA 3ZEHA 3QJYA 4KGXB 4M77D 1Q7YR 1M90R 2DVJA 5LL6S 2MCNA 2KGTA 1M2OA 1VQ8A 3TREA 3M54A 1NZ9A 1B34B 2RHXA 3CCLQ 4CI0C 2KT1A 3RR6A 1TUCA 1JU5C 3QKJA 4ANJA 2OI3A 2DJQA 5IXFA 1UG1A 3G71T 1YN8A 3CC7Q 1Y96B 4BACA 2O9VA 1VQPA 2FYKA 4QVZA 4F7UG 2DTIA 2PVDB 4K11A 4JZ3A 4J6WA 3EH1A 2RMOA 5CR2A 3URGA 2HL5C 3OB9A 3PIPA 1PRMC 1M2VA 2DD4A 1HXDA 2BZ8A 2FVUA 1T0JA 1WI7A 1UGPB 4E47A 2J6KA 2MIOA 1E6HA 2L3RA 4F7UE 3CCEQ 1ZHIA 3LGLA 1Q81R 1X27A 2O88A 2YUNA 2LRQA 3TSWA 1RUWA 3OSVA 2KRNA 1MMAA 4Z8AA 1K1ZA 1OULA 5GJVB 2WSFE 4EMKB 1KSWA 1Y07A 3FIFA 1YJ9A 2FG0A 1BCOA 5DM7R 1RLQC 4II1A 3CMEQ 1JJ2P 2DE0X 2DL7A 4MZMA 5GANj 2CT4A 2QG9B 1X69A 1K9MR 1ZA2B 3GNFB 4Y28E 3HRSA
chains in the Genus database with same CATH topology
1YJNT 2QQSA 5FU6B 4L6V5 2JNGA 3RKYA 1QVFA 4LD9K 1WJSA 1YITA 3L2VA 2RA2A 4M75C 5LJ5e 3OS0A 1N9RA 1X01A 5KE2A 1Q82U 2PQWA 1NJIU 4BE0A 3RKWA 4M75B 2O4XB 5GAOn 4XTWA 1FXXA 5CKHA 2OTJT 4XTXA 5I2MA 1YCYA 4R55A 3OS2A 4E7IA 3M58A 2LQ8A 2JTFA 3CMAA 3CC7T 1BYMA 1BI0A 1I4K1 1LNXA 3LGFA 1NE8A 5D6WA 3FRNA 2MWOA 4KULA 3JCMQ 3EFRA 1R8OB 2RI3A 5HY6A 3VUBA 3OYHA 3WXMB 1XQHA 4JLIA 2IVWA 2X35A 3CCMT 2FL7A 4M78F 3CD6T 4M7DF 1V29B 4BB7A 3ME9A 4RKUE 2RK2A 5M9OA 3X28B 4IUQA 2DVEA 1QP3A 1WNLA 5J26A 3G6EA 2WSCE 2M9UA 3V8LA 4A54A 3LYIA 2K3XA 2PVOB 4FL6A 3HKSA 3I56A 4C92C 2MWPA 1K73U 4M7AD 1VQOT 4HCBA 4A4EA 4V2SA 2EFIA 3EAEA 3OYAA 2CZ7B 4O5VA 4ZGJB 1K8AC 4LDWA 1VQLT 1KHCA 2QTXA 4M77G 3CEYA 2XIDA 1VQKT 2VGNA 2DKGA 5FROA 3GF5A 4XU0A 2QA4A 2F69A 1WPYA 1O9SA 1W2BS 4MDWA 2RM4A 3C94A 1YIJT 3PFSA 3M4YA 1OI1A 4OP0A 3UT1A 5LJ3g 1VQKA 5LJ5d 3P8BB 3OYMA 4BE1A 3BY7A 3QPHA 5GAMj 2A3LA 2EQKA 4OGEA 2EQMA 2XG8D 3L2RA 1D3BA 5D6XA 2GFAA 2VXFA 4J83A 5GANg 3E9GA 4M77E 2DZCA 3NFCA 4NL2A 2QXFA 2DTOA 2QEXA 1JJ2A 2QQRA 2BIVA 1WGSA 3FJPA 4BDZA 1KG1A 4N0AA 2DK3A 1YJWA 3OMCA 4B9WA 1UB4A 1FX7A 2KAFA 3AHUA 3L1AA 2CZ1B 1P92A 1U1TA 2LVMA 2ZZDA 1U8RA 3M4GA 3O8VA 1YI2T 2R57A 3BFMA 3QZ9B 3OYNA 1XTDA 1RL2A 2PU9B 2HAXA 3G71A 4JUVA 3GIBA 3V7SA 4MMKA 4KUIA 3GP8A 1MGQA 2P0KA 3C12A 4BI4A 4DOWA 1M1KC 2X4JA 2IG0A 1B34A 4LDUA 2L8DA 5FU7C 2VXEA 2VYTA 2P0PA 3RUXA 3CCUT 3DB4A 1HK9A 3V8JA 5A2QE 2JN0A 2L89A 5FU7B 2M16A 3JCMV 3OYFA 3SFMA 3J80E 3QG1A 1VQ6T 3OYLA 3HPWA 3INZA 4HT9A 4PKCC 4M78A 4C5IA 4ZTFA 4M7DA 4LDVA 3CC4T 1M9SA 2V8KA 2CS7A 2V8IA 2EIFA 4M75F 2JZ2A 4QQDA 1Y96A 1KC8C 4BI3A 2KMTA 4LDXA 4QVDA 4X34A 4RG8A 4PJOG 2LX9A 5A0GA 5I2SA 3CPWS 2KDSA 2E64A 3OYGA 4JS4A 1Q7YU 1ZQ1A 4XQ3A 1PSEA 4J6YA 4Z02A 5FRMA 5GMKl 3CCVA 2CZ0B 2WSEE 1M1KU 2QQBA 3MEAA 5A0LA 2RK1A 3LWHA 3FC3A 1N9SA 1BI3A 3QBYA 4O6JA 4M77C 5J3BA 2D9TA 3X25B 4HT8A 4XK8E 3OYJA 5GAMg 4ME7A 4PJOE 1PSFA 1WQWA 4M77B 4DQ2A 4C8QE 2XDBA 4JRIA 2YRVA 5CQXA 2KSSA 4Y91A 3S3OA 4FT2A 4XU1A 5GMKe 3CCRT 4ELYC 1KC8U 4ZN3A 5CKEA 3GLXA 2OTLA 3HFOA 3JCMh 1Q81C 4HKEA 5GANh 2PUOB 3PNWC 1M4ZA 3CC2A 3KUFA 4ELZC 2DZ9A 3OYCA 4RCCA 1YJ9T 4XTVA 4IUVA 3T9NA 3A5ZB 4EMKA 5CQYA 4E7HA 3JB9G 1K73C 3JCMb 2RJEA 3M55A 3JB9H 4XU2A 3CCQA 2EJ9A 4FT4A 4J6XA 1MHNA 4FU6A 1VQ5T 1VQNA 4ZGEB 2R58A 4A4HA 2LC4A 2QQ9A 2LDMA 3JB9D 5LJ5j 4KBMB 1VQ7T 2C06A 3CCLA 4NL3A 3OY9A 3VU3C 3CCSA 2LT4A 2RJDA 2GF7A 3ER0A 1M1FA 3FB9A 1VUBA 3UWNA 1QVGS 1EIFA 2F5KA 4M78G 2M0OA 5HK0A 2RH2A 2JOYA 1VQ4T 3ASKA 1W2BA 5GAOl 1UEBA 2P4TA 1YITT 5CK9A 3LX7A 1KD1C 4M78D 4MMLA 4F7UB 4JRQA 4M7DD 2DEQA 3J7AF 1XNIA 2NLUA 1Q81U 2EAYA 3SDZA 4ZGDB 3NTHA 1WJQA 2R5AA 5DLQE 4M7AG 1UGQB 3OYEA 4M75A 3M57A 3FDRA 3MP1A 2VGMA 2LT1A 2M1HA 3OW2S 3GOXA 3CMAT 1YHQT 2Y4YA 3PIOA 5GAOr 4N4HA 2XHCA 4OVAA 3HP9A 2XI9A 4PJOC 3HHTB 3LLRA 3HSBA 4OF1A 2LQKA 1U1SA 2EYQA 4C8QC 3JRZA 3I55A 3TEEA 1M8VA 4EDUA 3A8LB 3DLLA 4PJOB 5LJ3d 4OB1B 5GAN4 1VQLA 3CCEA 2LTOA 4C8QB 5GAN3 5D6YA 4DOVA 4BDYA 4M7AE 2RJFA 2DD5A 2PUKB 2ZPIB 3G6ET 3CPFA 1KQSA 1KD1U 2YHTA 1AHJB 2HQXA 3KXTA 1YIJA 4TVRA 1KQ2A 2E6NA 4N4IA 5GAMh 3L2UA 3HRUA 1H3ZA 2RHZA 1BI1A 3QO3A 2MMPA 2A7YA 5J39A 3VV0A 2HNIA 3F70A 3FEOA 2RHUA 4UC4A 3JCMg 3L2QA 1TH7A 2PVGB 3CBOA 5LJ3f 2I2LA 2G3RA 4JRKA 2QA4T 4C92A 1G3YA 5FLXE 1JBMA 2DXCA 4A4KA 3HFNA 3RMSA 2CKKA 2E70A 2E10A 2RJCA 2KVQG 5GANf 1N6AA 2DIQA 2VUBA 2XICA 3MEUA 3S6WA 4FSXA 2L5QA 3VUZA 2XK0A 2GFUA 3M5AA 2JTMA 4M77F 3BDLA 4BD3A 3CMEA 1VQ8T 3RESA 3CPWA 5CIUA 2ZPBB 1VQ9T 1Q7YC 1M90C 4XAXB 1BIAA 5CVIA 4VUBA 2QEXT 4E7KA 1Q86C 2E5QA 2DPPB 2GQVA 3DLMA 5A0DA 5C0MA 1YJWT 4KUDK 3CXCS 2P0QA 3MEVA 3GNGA 4LDYA 4RMOA 4MZTA 2HQEA 3PTAA 4C0ZA 2DTHA 2E65A 4BY6C 3OYIA 4P5NA 3CCJA 3JCMJ 3WVEB 1GXIE 1W4SA 4M75D 2K3YA 4OGCA 5KE3A 3OA6A 1VQPT 4BY6B 5CO7A 1VIEA 1QVPA 5GMKm 2ZGWA 3V7CA 1UGRB 1BKBA 1X75C 4A4FA 2CZ6B 5KH6A 3JCMX 2E12A 3RKXA 4DA4A 4M7AC 1NPRA 2DIGA 2ZPHB 2DJZA 3WVDB 2QQAA 2JVVA 1ZBXA 2DXBA 4OMFB 4M7AB 4JJNK 4L59A 1M90U 1Q86U 2QDYB 2O01E 1BI2A 1JJ2S 4F7UF 5L8RE 5IT9E 2DAQA 1G3TA 3L42A 3OBWA 4D6WA 5GAN2 2E41A 1LJOA 3QHSA 4BUGA 2QI2A 2HD0A 3OSSC 5DY9A 3NTKA 1XOVA 4IUPA 4C92G 4NOYA 4EPCA 3OYBA 3S3MA 2OAUA 2EQJA 1RI0A 3M59A 3QZ5B 4PLLA 2YLBA 2ZPGB 3DKMA 3G4SA 1QVGA 4C92D 1VQMT 4JDSA 1N27A 5C6SA 3CCVT 5HKCA 1KQ1A 3N5BB 5GAMf 2K4YA 3J81E 1S72A 3SWNA 2KK4A 1IREB 1UGSB 1I81A 2XKOC 3A8HB 3VYGA 5GMKj 1QW1A 2E1HA 4PJOF 5GMKh 4EMHA 4MDXA 5LJ3e 1JRIA 4QW2A 4C8QF 1LOJA 2RI5A 4PL6A 3RIRA 4C92E 4IURA 3EFSA 1I5LA 3FLGA 5CKFA 1YJNA 2DXUA 3A8GB 4RCBA 1OZ2A 3OW2A 4YTLA 4C0DC 3JAME 3M56A 3BW1A 4M77A 2LCCA 4PLIA 3JCMe 5GANe 3NTIA 1FWZA 2OTLT 2K57A 2BKDN 3X26B 4C0DB 2EKOA 5LJ5h 5DLOA 4IUTA 1I8FA 5GAN7 3CC2T 1M1GA 1X6OA 1QP2A 3M53A 1VQ7A 3E19A 4M7DG 4R56A 2OTJA 1SSFA 2JUFA 4XU3A 4EMGA 2K5LA 5CKDA 3Q1JA 2CYZB 3OBYA 3GPLA 3JSCA 2RO0A 3QSUA 3CCQT 2KY9A 3CC7A 1VQ4A 2ZPFB 1VQNT 1OYXA 4Q5WA 2DO3A 4QVCA 1K9MC 2MI6A 3L2ZA 3CCLT 3OYYA 3CCST 3CCMA 3CD6A 2O4XA 5HK3A 3SD4A 3JCMP 4M78E 4M7DE 1IZ6A 3JB9F 4JLGA 2K2VA 3V8KA 4IUUA 2XDPA 2WACA 4GY5A 3ZBDA 2RI2A 2MF2A 1YHQA 2ZCFB 4L5GA 3QYGB 2VC8A 1VIFA 3KBGA 4J8OA 4XTUA 1VQOA 2FB7A 2EJGA 1JB0E 2EJFA 4A53A 3MO8A 3QIIA 3G7ZA 2B8AA 4F7UA 3OQ5A 5IAYA 3MHXA 5GAOq 3S3NA 3V7RA 3RERA 2FHDA 1QVFS 2D6FA 3E9FA 3CBPA 3MP8A 1WQ7A 3I56T 2EWNA 3R6OA 1N8RC 1G5VA 3OS5A 4N4GA 5GMKi 3L2WA 4JRPA 3JCMd 5FRNA 2CGHA 2R5MA 5GANd 1K9MU 1D3BB 2LNVA 5KCHA 3CXCA 2K5IA 4N0AC 2V8JA 3I55T 2DXTA 4FIBA 3X24B 4JS5A 4M7AF 3P8HA 4J7FA 4C92B 3H8ZA 3QUIA 3VKIA 2D0QB 1DJ7B 1H641 4ZTJA 3CCET 1Y7XA 3QJ6A 3OYDA 4HCCA 2XD0A 1M5Q1 4ZN1A 4LD6A 4C0FA 3UPUA 1KHIA 1G3SA 3RMQA 3VJPA 5GAMe 4E7JA 3PGGA 3ZEHA 4BE2A 3QJYA 4PJOA 3JCMf 5IN1A 3JCMc 4M77D 4C8QA 3JB9I 4C0GA 4PNOA 2ZPEB 4WF2A 4XTYA 5LL6S 3VYHB 4BI8B 4B9XA 5LJ5g 1BIBA 3SB2A 4QQGA 1YI2A 4FM4B 2YLCA 3HL8A 3MP6A 3P8DA 3TREA 1VQ8A 3LH0A 3M54A 4X9DA 1NZ9A 2E6ZA 3BDUA 1B34B 5EG2A 4QQ6A 5KCOA 3TU4K 1N8RU 2RHXA 1VQ9A 4MZPA 5GAN6 5GAN8 3HRTA 4CI0C 4HCZA 4J7IA 3QKJA 4C5GA 1OZ3A 4M75G 5CAIA 5LJ5f 2LCLA 3M9QA 4C5EA 4RG2A 1G3WA 3QDRB 4M78C 4M7DC 2RHYA 3CMET 3PT9A 3CCUA 4J5YA 3TCJA 3JB9J 2XDDA 1K8AU 1Y71A 3C95A 4M78B 3QYHB 4M7DB 1VQ6A 4A4GA 3G71T 5I21A 1Y96B 2HBPA 4BACA 1KQSS 1VQPA 2FYKA 4QVZA 1O75A 4XTZA 1YBYA 4X9CA 4F7UG 3CC4A 4IKFA 2DTIA 2Y90A 2PVDB 1NPPA 3OYKA 2RB6A 3C4SA 4J6WA 4M75E 2X4YA 3A8MB 5AYFA 3URGA 5CR2A 3CCJT 3OB9A 3MEWA 4OB0B 3PIPA 3CBMA 2F5TX 2DD4A 1HXDA 4OB2B 1WJRA 5GAMd 4KT0E 2FVUA 4NS5A 1UGPB 3PMIA 4E47A 4ATOA 3META 3H6ZA 2X4WA 2L3RA 4F7UE 2Y4XA 1ZHIA 3LGLA 3ZFJA 3OS1A 4C8QG 3SWNC 2KQWA 3MCAB 2LRQA 2RHIA 4CRIA 3OSVA 3QXEB 5GAOp 4M7AA 4PJOD 2MAMA 3SWNB 1VQMA 4HA8A 2GCXA 2AHJB 4C8QD 4EMKC 3CCRA 1Q82C 3UDCA 1NJIC 2XU8A 2WSFE 4EMKB 2K5FA 4E7LA 1Y07A 2H3JA 5CCAA 2RD1A 3E1SA 4C5HA 3G4ST 3FIFA 5LJ3j 1YJ9A 5GAOm 5LJ3h 4OB3B 5CKBA 5DM7R 3X20B 2EQUA 3A8OB 4II1A 2VV5A 3DB3A 3LW5E 3JCMW 1S72T 2BUDA 3LWIA 1VQ5A 4MZMA 5GANj 4C92F 5GAN5 2X4XA 4GLKA 5FU6C 3OMGA 3PMTA 3GNFB 4Y28E 3HRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIA A;  1WQ7 A;  2EWN A;  3RKY A;  4XQ3 A;  4J6Y A;  5GMK i;  2RA2 A;  5GMK l;  4M75 C;  3JCM d;  5LJ5 e;  2CGH A;  5GAN d;  1N9R A;  1X01 A;  1D3B B;  1N9S A;  4M77 C;  4N0A C;  4M75 B;  3RKW A;  2DTH A;  5GAO n;  2DXT A;  4XTW A;  4HT8 A;  4M7A F;  5GAM g;  2E65 A;  4C92 B;  4XTX A;  3QUI A;  4PJO E;  4PJO D;  3JCM J;  1H64 1;  1WQW A;  1YCY A;  4M77 B;  4C8Q E;  4DQ2 A;  4M75 D;  1M5Q 1;  4JRI A;  4Y91 A;  4PJO A;  5GAM e;  3PGG A;  1I4K 1;  1LNX A;  4XU1 A;  2ZGW A;  4M77 D;  3JCM f;  3JCM c;  4C8Q A;  5GMK e;  5GMK m;  3V7C A;  3JB9 I;  3JCM Q;  3EFR A;  3HFO A;  4PNO A;  4WF2 A;  4XTY A;  3RKX A;  3JCM h;  3JCM X;  5GAN h;  4M7D D;  4M7A C;  4JLI A;  2DJZ A;  4M78 F;  5LJ5 g;  1BIB A;  3SB2 A;  4M7D F;  2DZ9 A;  4M7A B;  4RCC A;  2YLC A;  4XTV A;  4EMK A;  2DVE A;  4X9D A;  1WNL A;  3BDU A;  3JB9 G;  1B34 B;  4F7U F;  3JCM b;  3V8L A;  4A54 A;  3JB9 H;  4XU2 A;  5GAN 6;  5GAN 8;  4M7A D;  2EJ9 A;  2E41 A;  4J6X A;  1LJO A;  3QHS A;  4C92 C;  5GAN 2;  4M75 G;  5CAI A;  5LJ5 f;  3JB9 D;  4V2S A;  5DY9 A;  5LJ5 j;  4M78 C;  4C92 G;  4NL3 A;  4M7D C;  3VU3 C;  3JB9 J;  4NOY A;  4J5Y A;  4M77 G;  2QTX A;  3FB9 A;  2DKG A;  4M78 G;  2YLB A;  4M78 B;  4XU0 A;  4M7D B;  1WPY A;  5I21 A;  4C92 D;  2RM4 A;  1Y96 B;  5GAO l;  4OP0 A;  2FYK A;  5LJ3 g;  1KQ1 A;  4XTZ A;  4M78 D;  4MML A;  4X9C A;  4F7U B;  4F7U G;  3BY7 A;  5GAM f;  3SWN A;  5LJ5 d;  2DEQ A;  2DTI A;  1I81 A;  2Y90 A;  5GAM j;  2EAY A;  5GMK j;  2E1H A;  2RB6 A;  4J6W A;  4M75 E;  4PJO F;  4EMH A;  5GMK h;  1JRI A;  5LJ3 e;  4M7A G;  4C8Q F;  1D3B A;  1LOJ A;  2VXF A;  3RIR A;  4C92 E;  1I5L A;  3EFS A;  5GAN g;  4M75 A;  4M77 E;  2DZC A;  4NL2 A;  2DTO A;  2DXU A;  1HXD A;  3FJP A;  4RCB A;  5GAM d;  3BW1 A;  4M77 A;  4N0A A;  5GAO r;  3JCM e;  5GAN e;  3AHU A;  3L1A A;  2K57 A;  1U1T A;  4F7U E;  4PJO C;  5LJ5 h;  3HSB A;  1I8F A;  1U1S A;  3M4G A;  4C8Q C;  5GAN 7;  1M8V A;  3BFM A;  4M7D G;  4PJO B;  4XU3 A;  5LJ3 d;  5GAN 4;  4EMG A;  4C8Q G;  3SWN C;  4C8Q B;  5GAN 3;  4M7A E;  3QSU A;  2YHT A;  5GAO p;  4M7A A;  4JUV A;  3SWN B;  3V7S A;  3GIB A;  4MMK A;  1KQ2 A;  4HA8 A;  1MGQ A;  4C8Q D;  4EMK C;  4QVC A;  5GAM h;  1B34 A;  3L2Z A;  2VXE A;  3QO3 A;  3RUX A;  4EMK B;  2HNI A;  1HK9 A;  3JCM g;  3V8J A;  1TH7 A;  2JN0 A;  5LJ3 f;  2RD1 A;  2I2L A;  4JRK A;  3FIF A;  3JCM V;  4M78 E;  4C92 A;  5LJ3 j;  5GAO m;  3JCM P;  4M7D E;  3JB9 F;  5LJ3 h;  1JBM A;  3V8K A;  3HFN A;  3INZ A;  4HT9 A;  4M78 A;  4M7D A;  3JCM W;  2E10 A;  4M75 F;  4XTU A;  2VC8 A;  1Y96 A;  5GAN f;  2FB7 A;  2EJG A;  5GAN j;  4C92 F;  2EJF A;  4A53 A;  5GAN 5;  4PJO G;  4F7U A;  4M77 F;  5GAO q;  3RES A;  3V7R A;  3RER A;  4QVD A;  2E64 A; 
#chains in the Genus database with same CATH topology
 1YJN T;  2JNG A;  2RA2 A;  5LJ5 e;  2F2W A;  2CH4 A;  1Q82 U;  3CCU Q;  2K79 A;  4XTX A;  1JO8 A;  4R55 A;  2LQ8 A;  2ZAE A;  1I4K 1;  1NE8 A;  2GBQ A;  4KUL A;  3JCM Q;  4OMO A;  3VUB A;  4JLI A;  2IVW A;  3CCM T;  1YWO A;  4M7D F;  1V29 B;  4HVV A;  5IHN A;  4RKU E;  5M9O A;  3X28 B;  4IUQ A;  1HJD A;  1QP3 A;  1WNL A;  2K3X A;  1TS9 A;  4FL6 A;  1WZO A;  1VQO T;  2KRS A;  2EFI A;  1CKA A;  4ZGJ B;  1K8A C;  1KHC A;  1FYN A;  2XID A;  1WX6 A;  4XU0 A;  1W2B S;  1O9S A;  1S72 Q;  3C94 A;  2V1R A;  3VS3 A;  1YIJ T;  3PFS A;  1T0H A;  2JTE A;  2PTK A;  3EFO B;  5LJ3 g;  5LJ5 d;  4BE1 A;  2B86 A;  3BY7 A;  5GAM j;  2F2X A;  1G2B A;  2XG8 D;  3L2R A;  1D3B A;  1YWP A;  4R0K A;  2NUT A;  7AT1 B;  2GFA A;  3E9G A;  2QXF A;  1KG1 A;  4N0A A;  1QVF P;  4B9W A;  1UB4 A;  4HXJ A;  1FX7 A;  3M4G A;  1U06 A;  1FMV A;  2HAX A;  1RLP C;  1KJW A;  1MGQ A;  4DOW A;  4FYY B;  5KYX B;  3VS7 A;  2VXE A;  2VYT A;  2P0P A;  5EC7 A;  3RUX A;  2M16 A;  1VQ6 T;  3J80 E;  1YHQ Q;  3OYL A;  2CP7 A;  2ENM A;  4M78 A;  3VS1 A;  1KIK A;  4LDV A;  1M9S A;  2CS7 A;  2V8I A;  2EIF A;  4M75 F;  2KMT A;  4LDX A;  2KDS A;  3EG9 B;  2LJ0 A;  1JEG A;  1ZQ1 A;  4XQ3 A;  3UAT A;  1PSE A;  4J6Y A;  2C0T A;  5GMK l;  2WSE E;  3R6N A;  5A0L A;  2KR3 A;  1M1K U;  2RK1 A;  1KQS P;  1N9S A;  3QBY A;  4HT8 A;  4XK8 E;  2BZY A;  1OU8 A;  1WYX A;  2COY A;  1WQW A;  4M77 B;  4C8Q E;  2KSS A;  4LXC A;  4FT2 A;  4ELY C;  4ZN3 A;  3HFO A;  1Q81 C;  2DYB A;  3PNW C;  1M4Z A;  2RQV A;  4ELZ C;  3OYC A;  4XTV A;  3A98 A;  1LCK A;  1UHC A;  1VQ5 T;  1UUE A;  3JB9 D;  1EX4 A;  4KBM B;  2C06 A;  3CCL A;  4Z88 A;  5I22 A;  2LT4 A;  2RJD A;  2GF7 A;  1QVG S;  4D8D A;  1NLP C;  1WXU A;  1W2B A;  1G83 A;  3LX7 A;  5FWB A;  4M78 D;  1XNI A;  2NLU A;  1WJQ A;  2JT4 A;  2R5A A;  1I5O B;  3CMA T;  4OVA A;  3LLR A;  2LP5 A;  4C8Q C;  1U1S A;  2EYQ A;  3I55 A;  3TEE A;  2L3P A;  4JJD A;  3DLL A;  3CCE A;  1RAH B;  5GAN 3;  3CCR Q;  2RJF A;  2ZPI B;  3G6E T;  1I0C A;  2HSE B;  1TUG B;  2NWM A;  3KXT A;  1VYU A;  2FPE A;  3L2U A;  4KH0 B;  4QKU A;  1H3Z A;  2H3E B;  2GGR A;  2RHZ A;  3QO3 A;  2HNI A;  3JCM g;  1TH7 A;  2QA4 T;  1NG2 A;  2RQR A;  2BE7 D;  5FWC A;  3HFN A;  1GL5 A;  2YUO A;  2E10 A;  5GAN f;  2XIC A;  2YUQ A;  2L5Q A;  1PD0 A;  2XK0 A;  3VUZ A;  3CME A;  4WCI A;  4LN2 A;  1YIT Q;  1YCS B;  5CVI A;  2GQV A;  5C0M A;  4KUD K;  3CXC S;  2P0Q A;  3MEV A;  3MKD A;  2LQN A;  4MZT A;  4RMO A;  4RTU A;  3PTA A;  4C0Z A;  1M2V B;  1KC8 R;  3JCM J;  1W4S A;  1TXQ A;  1S1N A;  2K3Y A;  4OGC A;  2X3W D;  4EIK A;  1VOM A;  2YRD A;  2ZGW A;  1UGR B;  3REA B;  4DA4 A;  3RKX A;  1NPR A;  2DIG A;  1Q82 R;  2ZPH B;  3TQ7 P;  4J9I A;  2EYY A;  2QQA A;  2DXB A;  3I56 Q;  1M90 U;  2QDY B;  1BI2 A;  4F7U F;  5IT9 E;  1NM7 A;  4D6W A;  5GAN 2;  3HTR A;  4AFS C;  1XOV A;  2IIM A;  2L2P A;  4EPC A;  3S3M A;  3QZ5 B;  1C1A A;  1QVG A;  3REB B;  2K9G A;  3CCV T;  5GAM f;  1S72 A;  2XKO C;  3VYG A;  1MV0 B;  2J05 A;  3I9Q A;  4PJO F;  4MDX A;  1IXD A;  1JRI A;  2QEX Q;  1UDL A;  1I5L A;  4C0D C;  3JAM E;  4FSS A;  2LCC A;  2GTJ A;  2K57 A;  2DF6 A;  3X26 B;  5DLO A;  1PCX A;  1X6O A;  4M7D G;  4R56 A;  2OTJ A;  4XU3 A;  3G71 Q;  1W70 A;  2CYZ B;  3OBY A;  2KY9 A;  2ZPF B;  1VQN T;  2DO3 A;  2X3X D;  3L2Z A;  3CCS T;  1PHT A;  3SD4 A;  4M7D E;  3JB9 F;  2M0Y A;  4M4Z A;  3V8K A;  2XDP A;  2RI2 A;  1YHQ A;  2BZX A;  3QYG B;  4LE9 A;  2AK5 A;  1JB0 E;  4A53 A;  3V7R A;  3E9F A;  3OS5 A;  4JRP A;  2R5M A;  1K9M U;  2K2M A;  1D3B B;  2NUT B;  5KCH A;  3CXC A;  2RQW A;  3X24 B;  4JS5 A;  3P8H A;  3QUI A;  3VKI A;  1DJ7 B;  1GCQ A;  4ZN1 A;  1VQK T;  4E7J A;  2YRC A;  2K3B A;  4LUD A;  5IN1 A;  3JCM c;  3OW2 P;  3CC2 Q;  1Q86 R;  4PNO A;  4WF2 A;  4ZNX A;  3VYH B;  4QQG A;  1YJN Q;  4FM4 B;  3MP6 A;  3HL8 A;  3CCQ Q;  3LH0 A;  1FMK A;  4X9D A;  5EG2 A;  1M3B A;  4QQ6 A;  3TU4 K;  3HRT A;  1OZ3 A;  4M75 G;  4RG2 A;  1G3W A;  3QDR B;  4M7D C;  1OPK A;  3PT9 A;  1K76 A;  2XDD A;  1Y71 A;  3MPU B;  5IXB A;  3C95 A;  4M78 B;  3VS0 A;  4A4G A;  2AKK A;  1YNZ A;  1UJY A;  3MJX A;  2FO0 A;  2DL5 A;  2RB6 A;  3C4S A;  4M75 E;  2AZS A;  3A8M B;  5AYF A;  2RQU A;  3SHW A;  2F5T X;  1PC0 A;  1VQO Q;  3MET A;  2X4W A;  3A1P A;  4E7S A;  1N5Z A;  4PJJ A;  2SRC A;  3EG9 A;  3SWN C;  1YIJ Q;  4M7A A;  1SKU B;  3CCR A;  1Q82 C;  2DL8 A;  3UDC A;  1D0Z A;  2XU8 A;  2D8J A;  1XJW B;  2RD1 A;  4C5H A;  2HCK A;  4OB3 B;  3X20 B;  3JCM W;  2VV5 A;  3DB3 A;  1ZUU A;  3LW5 E;  4FW1 A;  1ACM B;  1H3H A;  1TU0 B;  5GAN 5;  3EH2 A;  5FU6 B;  1VA7 A;  3RKY A;  1ZA1 B;  1I1J A;  1WJS A;  1YIT A;  4M75 C;  1X01 A;  5IHK A;  3CCJ Q;  3RKW A;  2O4X B;  4XTW A;  1BCM A;  5I2M A;  2M51 A;  3M58 A;  4PK4 A;  2KXC A;  2KYM A;  1HD3 A;  1LNX A;  5D6W A;  3BE3 A;  3EG1 A;  3QDF A;  1NYG A;  2FL7 A;  1AOJ A;  1WHH A;  3ME9 A;  1Q95 G;  4CC3 A;  1TWB A;  2DL4 A;  3V8L A;  3LYI A;  3M0Q A;  3I56 A;  1K73 U;  4M7A D;  4C92 C;  2CZ7 B;  3PVL A;  1HSQ A;  4O5V A;  3VS2 A;  3G4S Q;  2D1X A;  2QTX A;  3CEY A;  2VGN A;  2P4R A;  1WPY A;  8ATC B;  3UT1 A;  1OI1 A;  1YP5 A;  1B3Q A;  2X9H A;  2JM9 A;  1SRL A;  4F14 A;  3NFC A;  4NL2 A;  4B6M A;  2QEX A;  2BIV A;  2A28 A;  2QDL A;  2ESW A;  1Z9Q A;  2KAF A;  1GCP A;  1P92 A;  1U1T A;  3VS5 A;  3QZ9 B;  2VKN A;  3EGD A;  1ZLM A;  4FYW B;  3QWY A;  3G71 A;  4JUV A;  3V7S A;  2EGC A;  4KUI A;  3GP8 A;  2P0K A;  1M1K C;  2IG0 A;  3CD6 Q;  1UJ0 A;  5FU7 C;  2PNI A;  3DB4 A;  1HK9 A;  3V8J A;  2L89 A;  2FPF A;  1QKX A;  2CUB A;  4HT9 A;  4PKC C;  2J06 A;  4ZTF A;  2AIR B;  2MYS A;  2O2O A;  4X34 A;  4PJO G;  2LX9 A;  3CPW S;  1NJI R;  1RAE B;  2RPN A;  5HCK A;  4AFU C;  2DIL A;  4PJL A;  3D7S B;  4CC2 A;  4ME7 A;  4PJO E;  1D1B A;  5CQX A;  2YRV A;  4Y91 A;  2C0O A;  2FPD A;  2JXB A;  1KC8 U;  5CKE A;  1WDX A;  1YI2 Q;  1ZUY A;  5GAN h;  3CC2 A;  3KUF A;  4RCC A;  1YJ9 T;  3T9N A;  5CQY A;  3JB9 G;  2DER A;  4RTY A;  3CCQ A;  2EJ9 A;  4J6X A;  1MHN A;  4FU6 A;  4ZGE B;  2LDM A;  1VQ7 T;  4NL3 A;  3ER0 A;  1M1F A;  1TG0 A;  4M78 G;  5HK0 A;  3CC4 Q;  2JOY A;  1VQ4 T;  1EZZ B;  2JJ9 A;  1Z9Z A;  2EAY A;  3SDZ A;  1UTI A;  4ZGD B;  2QAS A;  3M57 A;  4IIO A;  2VGM A;  2LT1 A;  4OMQ A;  4ESR A;  3GOX A;  3I35 A;  5GAO r;  4N4H A;  1K4U S;  2O9S A;  3HP9 A;  2XI9 A;  4PJO C;  3HHT B;  2QGG A;  2LQK A;  1M8V A;  1A0N B;  3JRZ A;  1TOV A;  4OB1 B;  5GAN 4;  2NUP A;  4BDY A;  4OMP A;  4HVW A;  5D6Y A;  3CPF A;  1M3A A;  2YHT A;  1AHJ B;  1YIJ A;  4TVR A;  5GAM h;  3VV0 A;  4UC4 A;  3CBO A;  2I2L A;  1RI9 A;  5AT1 B;  2HKQ B;  1G3Y A;  4KRT A;  2E4H A;  5FLX E;  1JBM A;  1D0X A;  2JS2 A;  4A4K A;  2I0N A;  1ZSZ C;  2RJC A;  2KVQ G;  3MEU A;  3S6W A;  2GFU A;  2JTM A;  4M77 F;  3BDL A;  3CPW A;  2RN8 A;  2ZPB B;  1VQ9 T;  1Q7Y C;  1PD1 A;  1M90 C;  2E5Q A;  4E2F B;  2CP6 A;  4KGV B;  5L23 A;  1SRM A;  3GNG A;  1PWT A;  2A08 A;  2DTH A;  2E65 A;  3OYI A;  4P5N A;  3CCJ A;  4LUE A;  1GXI E;  5KYW A;  4BY6 B;  2K7A A;  4A4F A;  2CZ6 B;  1PKT A;  2FRY A;  2DJZ A;  4FYX B;  4M7A B;  1IGU A;  1ZBX A;  1UFF A;  4OMF B;  9ATC B;  1Q86 U;  1JJ2 S;  1QKW A;  1F1B B;  5L8R E;  2DAQ A;  2EKH A;  1G3T A;  4PJM A;  2OAW A;  3QHS A;  3SEM A;  5KYU B;  3OSS C;  5DY9 A;  3NTK A;  4IUP A;  3OYB A;  2KT8 A;  2OAU A;  3M59 A;  3CXC P;  4OML A;  4PLL A;  2YLB A;  3G4S A;  1VQK Q;  2JMA A;  1VQM T;  4JDS A;  2E3I A;  3M0U A;  1K9A A;  3PVQ A;  1IRE B;  1I81 A;  5GJW B;  3G1J A;  3A8H B;  5GMK j;  1K73 R;  1K0X A;  5GMK h;  1SSH A;  3RIR A;  1YJW Q;  3A8G B;  1OZ2 A;  1VYV A;  3M56 A;  4PLI A;  5GAN e;  2BKD N;  1KD1 R;  1I8F A;  5GAN 7;  1MMD A;  1QQJ A;  3M53 A;  5CKD A;  1K0S A;  3Q1J A;  2RO0 A;  3CC7 A;  1OYX A;  4QVC A;  1K9M C;  3I5R A;  2ED0 A;  3CCL T;  3CD6 A;  2O4X A;  5HK3 A;  1WHG A;  4IUU A;  2WAC A;  4GY5 A;  2KEA A;  1I07 A;  2FB7 A;  3MHX A;  5GAO q;  6AT1 B;  1QVF S;  3R6O A;  1G5V A;  1TTH B;  3L2W A;  1IHW A;  5GAN d;  3JV3 A;  1QWE A;  2LNV A;  1T3L A;  2V26 A;  3I55 T;  3ULR B;  4C92 B;  2LNH B;  3H8Z A;  1PKS A;  3CCE T;  1UGV A;  1H64 1;  1WXB A;  3UPU A;  2OTL Q;  1KHI A;  1G3S A;  3RMQ A;  3VJP A;  5GAM e;  5FRM A;  4C8Q A;  3JB9 I;  1SHG A;  4AFQ C;  3EGD B;  4Y92 A;  1C6V X;  4BI8 B;  2KI7 A;  5LJ5 g;  1BIB A;  1YI2 A;  1R0B G;  3P8D A;  1ZSG A;  2VVK A;  5KCO A;  1IRX A;  5GAN 8;  4AT1 B;  4HCZ A;  4C5G A;  1M3C A;  5CAI A;  4C5E A;  3M9Q A;  4OMN A;  2RHY A;  3CME T;  3CCU A;  4J5Y A;  3TCJ A;  1E7O A;  2JW4 A;  1K8A U;  1WHK A;  2M02 A;  3QYH B;  1KQS S;  4XTZ A;  4X9C A;  3M0S A;  3CC4 A;  3KFV A;  2K6D A;  1NPP A;  2X4Y A;  3VRZ A;  2YDL A;  4RTW A;  2EW3 A;  4D8K A;  1PM3 A;  3CBM A;  4GLM A;  4OB2 B;  2IPO B;  1WJR A;  5GAM d;  4ATO A;  3PMI A;  1AD5 A;  1NLO C;  2Y4X A;  2G6F X;  1X6B A;  3ZFJ A;  2HSP A;  3OS1 A;  2KQW A;  1IHV A;  3QXE B;  2MAM A;  2DET A;  2CP3 A;  4C8Q D;  2AHJ B;  4EMK C;  1W6X A;  2ABL A;  4DEY A;  2K5F A;  4E7L A;  2HL3 A;  1R0C B;  5CCA A;  1ABQ A;  5LJ3 j;  1RAF B;  5LJ3 h;  1BB9 A;  5CKB A;  3EHR A;  1AT1 B;  2DLP A;  3A8O B;  1S72 T;  2LZ6 B;  3LWI A;  2X4X A;  4GLK A;  3OMG A;  3PMT A;  4AG2 C;  2QQS A;  1OX9 A;  1QVF A;  4LD9 K;  4JPB W;  2PQW A;  1NJI U;  4BE0 A;  2AT1 B;  1FXX A;  1WXT A;  2OTJ T;  1YCY A;  3OS2 A;  4E7I A;  2JTF A;  1MND A;  2CDT A;  1BYM A;  4PFZ A;  3EG2 A;  3LGF A;  2MWO A;  3EFR A;  2RI3 A;  3OYH A;  1N8R R;  1WLP B;  2NUP B;  2X35 A;  4M78 F;  4BB7 A;  2RK2 A;  2WSC E;  2M9U A;  2SEM A;  4A54 A;  3HKS A;  2GNC A;  4A4E A;  3EAE A;  4J9F A;  1IO6 A;  4LDW A;  1VQL T;  4M77 G;  2KE9 A;  1WHM A;  5FRO A;  3GF5 A;  1ABO A;  2F69 A;  4MDW A;  2RM4 A;  2DX1 A;  3FJ5 A;  3M4Y A;  4OP0 A;  2J6F A;  1VQK A;  2YSQ A;  3QPH A;  1GRI A;  4OGE A;  2ROT A;  2EYW A;  4X1V A;  1UE9 A;  2VXF A;  4J83 A;  1JXM A;  5GAN g;  4M77 E;  2DTO A;  3FJP A;  4E7Z A;  2DK3 A;  1YJW A;  3L1A A;  1VQ7 Q;  3U23 A;  1U8R A;  3O8V A;  5KYW B;  1RAI B;  3BFM A;  2KYB A;  1ZSZ B;  1VQ4 Q;  1RL2 A;  1SF9 A;  2LJ3 A;  4F17 A;  4MMK A;  4BI4 A;  2X4J A;  4LDU A;  3CCM Q;  4FCY A;  2L8D A;  1AEY A;  2JN0 A;  3OYF A;  3SFM A;  4DBQ A;  2MPX C;  3INZ A;  1AZE A;  2J7I A;  4M7D A;  2V8K A;  4QQD A;  1KC8 C;  3AT1 B;  5FW9 A;  1H92 A;  4QVD A;  4KH1 B;  4RG8 A;  4PFO A;  1OX8 A;  4E6R A;  5IHI A;  3OYG A;  4JS4 A;  1MV3 A;  4Z02 A;  2L3Q A;  2CZ0 B;  3LWH A;  3E2U A;  1BI3 A;  4M77 C;  5KYU A;  2D9T A;  3X25 B;  3OYJ A;  5GAM g;  1PSF A;  1ZBJ A;  2XDB A;  1X2Q A;  4JRI A;  3S3O A;  3CCR T;  2DL3 A;  2OTL A;  2EVR A;  3JCM h;  2PUO B;  4J9C A;  1VQ9 Q;  2DZ9 A;  1J3T A;  3M55 A;  3JB9 H;  4FT4 A;  2R58 A;  4A4H A;  5LJ5 j;  2W0Z A;  1AZG B;  1VQ6 Q;  3UA7 A;  2F5K A;  1UHF A;  2M0O A;  2RH2 A;  3ASK A;  1UEB A;  2P4T A;  1YIT T;  5CK9 A;  1V76 A;  2CP2 A;  2OJ2 A;  1OPL A;  4M7D D;  1M27 C;  2A37 A;  3GBQ A;  5DLQ E;  1UGQ B;  3OYE A;  4M75 A;  1QCF A;  3FDR A;  3MP1 A;  1X43 A;  3OW2 S;  4KGZ B;  1K8A R;  2CRE A;  2VB6 A;  3PIO A;  2XHC A;  2GTO A;  3HSB A;  1Y0M A;  4OF1 A;  1AWW A;  2VWF A;  2QYZ A;  4EDU A;  3A8L B;  5LJ3 d;  2LTO A;  4C8Q B;  1VQM Q;  2COZ A;  4F16 A;  5KYY B;  2DD5 A;  4PFP A;  1KD1 U;  1KQ2 A;  2E6N A;  4N4I A;  2COW A;  3HRU A;  1BI1 A;  1OEB A;  5J39 A;  2A7Y A;  1WA7 A;  2RHU A;  5LJ3 f;  4JRK A;  2G3R A;  4C92 A;  1VQ5 Q;  2DXC A;  2CKK A;  2DIQ A;  3RNJ A;  1VQ8 T;  4XAX B;  2QEX T;  4E7K A;  1Q86 C;  2DMO A;  3DLM A;  2EPD A;  1W2B P;  2QAZ A;  1ZX6 A;  2DA9 A;  3CMA Q;  2MOX A;  1OQK A;  4M75 D;  1VQP T;  2L3S A;  5CO7 A;  1PRL C;  1QVP A;  5GMK m;  3H0I A;  3V7C A;  1BKB A;  1X75 C;  2KRM A;  1SHF A;  3JCM X;  2E12 A;  3VRY A;  4Z89 A;  3WVD B;  2ED1 A;  3G6E Q;  2JVV A;  2O01 E;  1WFW A;  3L42 A;  2D0N A;  2E41 A;  3UA6 A;  1ARK A;  1RAA B;  1MNE A;  3I55 Q;  4DEX A;  2QA4 Q;  2EQJ A;  1RI0 A;  3DKM A;  3EHQ A;  4C92 D;  1RAD B;  1N27 A;  5C6S A;  1U5S A;  5HKC A;  3N5B B;  3H41 A;  2KK4 A;  2LJ1 A;  1D1C A;  4EMH A;  2F1L A;  1LOJ A;  2RI5 A;  2BTT A;  3PE0 A;  4IUR A;  3EFS A;  3FLG A;  1E6G A;  5CKF A;  1YJN A;  4RCB A;  3OW2 A;  1H8K A;  3JCM e;  3VS6 A;  1SG5 A;  4JJC A;  1SPK A;  4C0D B;  2EKO A;  4IUT A;  3CC2 T;  1M1G A;  1MMN A;  2HMA A;  1QP2 A;  5D7U A;  1VQ7 A;  1SSF A;  2RNA A;  3EGX A;  3GPL A;  3QSU A;  3CCQ T;  1AWO A;  1VQ4 A;  3TVT A;  2MI6 A;  1QCN A;  2OX7 A;  3OYY A;  2EGE A;  4WTO B;  1Y57 A;  3CCM A;  3QWX X;  3JCM P;  4M78 E;  1IZ6 A;  1WHL A;  3H0F A;  4RTT A;  3ZBD A;  2MF2 A;  4L5G A;  1VQO A;  2VC8 A;  4J8O A;  3KBG A;  2RF0 A;  2EGA A;  2EJF A;  3MO8 A;  4F7U A;  5KYN A;  3OQ5 A;  5IAY A;  1OU9 A;  2HDA A;  3CCV Q;  2D6F A;  3MP8 A;  3CBP A;  1QVG P;  2HEQ A;  3EG0 A;  5GMK i;  3JCM d;  5FRN A;  2CGH A;  1MUZ A;  1SEM A;  2K5I A;  4N0A C;  2V8J A;  2DXT A;  4M7A F;  2YUP A;  4ZTJ A;  1QLY A;  4ORZ A;  1Y7X A;  4HVU A;  3OYD A;  4HCC A;  2XD0 A;  3M0P A;  4PJO A;  3PGG A;  4BE2 A;  3JCM f;  8AT1 B;  1AWJ A;  4C0G A;  4XTY A;  2ZPE B;  1KK7 A;  3NPF A;  2JMC A;  4IIM A;  1B7T A;  4B9X A;  4CC7 A;  3SB2 A;  2YLC A;  1VQN Q;  1MMG A;  4PJN A;  2AZV A;  2E6Z A;  3BDU A;  1N8R U;  1VQ9 A;  4MZP A;  2E3H A;  5GAN 6;  1EFN A;  4J7I A;  3CCS Q;  5LJ5 f;  2LCL A;  4M78 C;  2OTJ Q;  3JB9 J;  2FZC B;  4M7D B;  1VQ6 A;  1ZSZ A;  4RTX A;  5I21 A;  2NYS A;  2HBP A;  2CP5 A;  1QCO A;  1O75 A;  1YBY A;  4IKF A;  2Y90 A;  4RUG A;  3OYK A;  3EGU A;  3CCJ T;  3MEW A;  4OB0 B;  4RTV A;  2F2V A;  4KT0 E;  4NS5 A;  3H6Z A;  2HKN A;  1VQL Q;  2KNB B;  4J9B A;  3NMZ C;  1U3O A;  3THK A;  1C0M A;  4C8Q G;  2W10 A;  3MCA B;  2RHI A;  4CRI A;  5GAO p;  4PJO D;  3SWN B;  1VQM A;  4HA8 A;  2GCX A;  4HCK A;  3I5S A;  1NJI C;  1VYT A;  2CSQ A;  2GQI A;  2H3J A;  2FRW A;  3E1S A;  3G4S T;  5GAO m;  2DFU A;  1OV3 A;  2EQU A;  2BUD A;  2HBW A;  2DM1 A;  1VQ5 A;  4C92 F;  2CSI A;  1RAB B;  5FU6 C;  4OMM A;  2CT3 A;  1M30 A;  4GBQ A;  4L6V 5;  1X6G A;  1GBQ A;  2AKL A;  3L2V A;  5ECA A;  2XMF A;  3OS0 A;  1N9R A;  2BE9 B;  5KE2 A;  4M75 B;  5GAO n;  1BBZ A;  1NEG A;  5CKH A;  2JS0 A;  4J9H A;  1TUD A;  3CQT A;  3CMA A;  3CC7 T;  2P84 A;  1BI0 A;  3FRN A;  3M0R A;  1R8O B;  4CC4 B;  5HY6 A;  1TSF A;  3WXM B;  1XQH A;  3CD6 T;  2KRO A;  1D0Y A;  3LH5 A;  2DVE A;  5J26 A;  3G6E A;  3EG3 A;  2FEI A;  2PVO B;  2MWP A;  4HCB A;  2FZG B;  4V2S A;  3OYA A;  1JXO A;  4F04 B;  3ZL7 C;  2O31 A;  2DKG A;  2QA4 A;  2CH4 W;  5KYY A;  2EYX A;  2C0I A;  3P8B B;  2KXD A;  2LMJ A;  3OYM A;  2A3L A;  2EQK A;  2EQM A;  1IGQ A;  2DBM A;  5D6X A;  2YXY A;  1CSK A;  2DZC A;  1PNJ A;  1JJ2 A;  2D8H A;  2QQR A;  1WGS A;  4BDZ A;  3OMC A;  3AHU A;  2CZ1 B;  2LVM A;  2ZZD A;  1QMC A;  1UEC A;  1YI2 T;  2R57 A;  3OYN A;  1XTD A;  2PU9 B;  3GIB A;  3RBB B;  3C12 A;  1B34 A;  1NBE B;  2CUD A;  1NYF A;  3CCU T;  5A2Q E;  2L0A A;  2X51 A;  1QWF A;  3C0C A;  5FU7 B;  3JCM V;  3QG1 A;  2KBT A;  1R77 A;  3HPW A;  4C5I A;  3CC4 T;  2JZ2 A;  1Y96 A;  4BI3 A;  1RAG B;  5I2S A;  5A0G A;  1OOT A;  4AG1 C;  2E64 A;  2ATC B;  1Q7Y U;  2ECZ A;  4LNP A;  4QT7 A;  3CCV A;  2QQB A;  3MEA A;  2JM8 A;  3FC3 A;  4O6J A;  5J3B A;  4AFZ C;  2QGF B;  4DQ2 A;  4XU1 A;  5GMK e;  3GLX A;  4HKE A;  1VQ8 Q;  4JZ4 A;  3EGX B;  4IUV A;  4EMK A;  3A5Z B;  4E7H A;  1K73 C;  3JCM b;  2RJE A;  4XU2 A;  2DNU A;  1VQN A;  1V1C A;  2LC4 A;  2QQ9 A;  3RDV A;  3IQL A;  3OY9 A;  3VU3 C;  3CCS A;  3FB9 A;  1VUB A;  3UWN A;  1EIF A;  1VQP Q;  5GAO l;  1KD1 C;  2FZK B;  4F7U B;  4MML A;  4JRQ A;  2HQH A;  2DEQ A;  3J7A F;  1Q81 U;  3VS4 A;  1FMW A;  3NTH A;  4AMC A;  1JQQ A;  4M7A G;  1G8X A;  3H0H A;  2M1H A;  1AVZ C;  1YFN A;  3UF4 A;  1YHQ T;  2Y4Y A;  1GCQ C;  1D09 B;  1RAC B;  5IH2 A;  2QK0 A;  2DEU A;  1T3S A;  4PJO B;  1VQL A;  3M0T A;  4M7A E;  4DOV A;  2PUK B;  3TSZ A;  1KQS A;  2E5K A;  2HQX A;  1LVK A;  2LCS A;  1X2K A;  5I11 A;  2LQW A;  3H9N A;  4DBH A;  1YJ9 Q;  2MMP A;  3F70 A;  3FEO A;  3L2Q A;  3NHN A;  2PVG B;  2EQI A;  2LX7 A;  1IB8 A;  1M8M A;  3RMS A;  2E70 A;  1GBR A;  1N6A A;  2VUB A;  3EFO A;  1CKB A;  4FSX A;  3M5A A;  4BD3 A;  1M1K R;  2H8H A;  1BU1 A;  4A63 B;  3RES A;  5CIU A;  4FYV B;  1BIA A;  4VUB A;  2DPP B;  5A0D A;  2HZY A;  1YJW T;  4LDY A;  2HQE A;  1LPL A;  4J9G A;  2VAS A;  4BY6 C;  3WVE B;  5KE3 A;  3OA6 A;  1VIE A;  5KH6 A;  4M7A C;  2YT6 A;  5KYX A;  2NUZ A;  4JJN K;  4L59 A;  1GFC A;  2EYZ A;  3OBW A;  4FW2 A;  1LJO A;  4BUG A;  2QI2 A;  2HD0 A;  4C92 G;  4NOY A;  2ROL A;  2ZPG B;  1ZUK A;  2V1Q A;  2DYI A;  2J6O A;  1KQ1 A;  4JJB A;  3J81 E;  2K4Y A;  3SWN A;  2Z0W A;  1UGS B;  2A0F B;  1QW1 A;  2E1H A;  5LJ3 e;  2PZ1 A;  1AWX A;  4QW2 A;  4C8Q F;  4C92 E;  2EBP A;  4PL6 A;  1KFZ A;  1HYO A;  3CPW P;  2DXU A;  4RTZ A;  1WHJ A;  4YTL A;  3BW1 A;  4M77 A;  3NTI A;  1FWZ A;  2DBK A;  2OTL T;  1BK2 A;  5LJ5 h;  2YWW A;  2MK5 A;  3E19 A;  2JUF A;  4EMG A;  2K5L A;  1PG5 B;  3JSC A;  4Q5W A;  2CP0 A;  1GFD A;  1B07 A;  4JLG A;  2K2V A;  3O5Z A;  2ZCF B;  4XTU A;  2QTV A;  4DBF A;  1VIF A;  4J9E A;  2EJG A;  4J9D A;  3QII A;  3G7Z A;  1NEB A;  2B8A A;  4DBR A;  3NGP A;  3S3N A;  2DRM A;  2DRK A;  3RER A;  1D1A A;  2FHD A;  1WQ7 A;  3I56 T;  2EWN A;  1N8R C;  4N4G A;  2RQT A;  2A36 A;  4FIB A;  1WIE A;  4J7F A;  2D0Q B;  1W1F A;  3QJ6 A;  1M5Q 1;  4LD6 A;  4C0F A;  3ZEH A;  3QJY A;  4KGX B;  4M77 D;  1Q7Y R;  1M90 R;  2DVJ A;  5LL6 S;  2MCN A;  2KGT A;  1M2O A;  1VQ8 A;  3TRE A;  3M54 A;  1NZ9 A;  1B34 B;  2RHX A;  3CCL Q;  4CI0 C;  2KT1 A;  3RR6 A;  1TUC A;  1JU5 C;  3QKJ A;  4ANJ A;  2OI3 A;  2DJQ A;  5IXF A;  1UG1 A;  3G71 T;  1YN8 A;  3CC7 Q;  1Y96 B;  4BAC A;  2O9V A;  1VQP A;  2FYK A;  4QVZ A;  4F7U G;  2DTI A;  2PVD B;  4K11 A;  4JZ3 A;  4J6W A;  3EH1 A;  2RMO A;  5CR2 A;  3URG A;  2HL5 C;  3OB9 A;  3PIP A;  1PRM C;  1M2V A;  2DD4 A;  1HXD A;  2BZ8 A;  2FVU A;  1T0J A;  1WI7 A;  1UGP B;  4E47 A;  2J6K A;  2MIO A;  1E6H A;  2L3R A;  4F7U E;  3CCE Q;  1ZHI A;  3LGL A;  1Q81 R;  1X27 A;  2O88 A;  2YUN A;  2LRQ A;  3TSW A;  1RUW A;  3OSV A;  2KRN A;  1MMA A;  4Z8A A;  1K1Z A;  1OUL A;  5GJV B;  2WSF E;  4EMK B;  1KSW A;  1Y07 A;  3FIF A;  1YJ9 A;  2FG0 A;  1BCO A;  5DM7 R;  1RLQ C;  4II1 A;  3CME Q;  1JJ2 P;  2DE0 X;  2DL7 A;  4MZM A;  5GAN j;  2CT4 A;  2QG9 B;  1X69 A;  1K9M R;  1ZA2 B;  3GNF B;  4Y28 E;  3HRS A; 
#chains in the Genus database with same CATH homology
 1YJN T;  2QQS A;  5FU6 B;  4L6V 5;  2JNG A;  3RKY A;  1QVF A;  4LD9 K;  1WJS A;  1YIT A;  3L2V A;  2RA2 A;  4M75 C;  5LJ5 e;  3OS0 A;  1N9R A;  1X01 A;  5KE2 A;  1Q82 U;  2PQW A;  1NJI U;  4BE0 A;  3RKW A;  4M75 B;  2O4X B;  5GAO n;  4XTW A;  1FXX A;  5CKH A;  2OTJ T;  4XTX A;  5I2M A;  1YCY A;  4R55 A;  3OS2 A;  4E7I A;  3M58 A;  2LQ8 A;  2JTF A;  3CMA A;  3CC7 T;  1BYM A;  1BI0 A;  1I4K 1;  1LNX A;  3LGF A;  1NE8 A;  5D6W A;  3FRN A;  2MWO A;  4KUL A;  3JCM Q;  3EFR A;  1R8O B;  2RI3 A;  5HY6 A;  3VUB A;  3OYH A;  3WXM B;  1XQH A;  4JLI A;  2IVW A;  2X35 A;  3CCM T;  2FL7 A;  4M78 F;  3CD6 T;  4M7D F;  1V29 B;  4BB7 A;  3ME9 A;  4RKU E;  2RK2 A;  5M9O A;  3X28 B;  4IUQ A;  2DVE A;  1QP3 A;  1WNL A;  5J26 A;  3G6E A;  2WSC E;  2M9U A;  3V8L A;  4A54 A;  3LYI A;  2K3X A;  2PVO B;  4FL6 A;  3HKS A;  3I56 A;  4C92 C;  2MWP A;  1K73 U;  4M7A D;  1VQO T;  4HCB A;  4A4E A;  4V2S A;  2EFI A;  3EAE A;  3OYA A;  2CZ7 B;  4O5V A;  4ZGJ B;  1K8A C;  4LDW A;  1VQL T;  1KHC A;  2QTX A;  4M77 G;  3CEY A;  2XID A;  1VQK T;  2VGN A;  2DKG A;  5FRO A;  3GF5 A;  4XU0 A;  2QA4 A;  2F69 A;  1WPY A;  1O9S A;  1W2B S;  4MDW A;  2RM4 A;  3C94 A;  1YIJ T;  3PFS A;  3M4Y A;  1OI1 A;  4OP0 A;  3UT1 A;  5LJ3 g;  1VQK A;  5LJ5 d;  3P8B B;  3OYM A;  4BE1 A;  3BY7 A;  3QPH A;  5GAM j;  2A3L A;  2EQK A;  4OGE A;  2EQM A;  2XG8 D;  3L2R A;  1D3B A;  5D6X A;  2GFA A;  2VXF A;  4J83 A;  5GAN g;  3E9G A;  4M77 E;  2DZC A;  3NFC A;  4NL2 A;  2QXF A;  2DTO A;  2QEX A;  1JJ2 A;  2QQR A;  2BIV A;  1WGS A;  3FJP A;  4BDZ A;  1KG1 A;  4N0A A;  2DK3 A;  1YJW A;  3OMC A;  4B9W A;  1UB4 A;  1FX7 A;  2KAF A;  3AHU A;  3L1A A;  2CZ1 B;  1P92 A;  1U1T A;  2LVM A;  2ZZD A;  1U8R A;  3M4G A;  3O8V A;  1YI2 T;  2R57 A;  3BFM A;  3QZ9 B;  3OYN A;  1XTD A;  1RL2 A;  2PU9 B;  2HAX A;  3G71 A;  4JUV A;  3GIB A;  3V7S A;  4MMK A;  4KUI A;  3GP8 A;  1MGQ A;  2P0K A;  3C12 A;  4BI4 A;  4DOW A;  1M1K C;  2X4J A;  2IG0 A;  1B34 A;  4LDU A;  2L8D A;  5FU7 C;  2VXE A;  2VYT A;  2P0P A;  3RUX A;  3CCU T;  3DB4 A;  1HK9 A;  3V8J A;  5A2Q E;  2JN0 A;  2L89 A;  5FU7 B;  2M16 A;  3JCM V;  3OYF A;  3SFM A;  3J80 E;  3QG1 A;  1VQ6 T;  3OYL A;  3HPW A;  3INZ A;  4HT9 A;  4PKC C;  4M78 A;  4C5I A;  4ZTF A;  4M7D A;  4LDV A;  3CC4 T;  1M9S A;  2V8K A;  2CS7 A;  2V8I A;  2EIF A;  4M75 F;  2JZ2 A;  4QQD A;  1Y96 A;  1KC8 C;  4BI3 A;  2KMT A;  4LDX A;  4QVD A;  4X34 A;  4RG8 A;  4PJO G;  2LX9 A;  5A0G A;  5I2S A;  3CPW S;  2KDS A;  2E64 A;  3OYG A;  4JS4 A;  1Q7Y U;  1ZQ1 A;  4XQ3 A;  1PSE A;  4J6Y A;  4Z02 A;  5FRM A;  5GMK l;  3CCV A;  2CZ0 B;  2WSE E;  1M1K U;  2QQB A;  3MEA A;  5A0L A;  2RK1 A;  3LWH A;  3FC3 A;  1N9S A;  1BI3 A;  3QBY A;  4O6J A;  4M77 C;  5J3B A;  2D9T A;  3X25 B;  4HT8 A;  4XK8 E;  3OYJ A;  5GAM g;  4ME7 A;  4PJO E;  1PSF A;  1WQW A;  4M77 B;  4DQ2 A;  4C8Q E;  2XDB A;  4JRI A;  2YRV A;  5CQX A;  2KSS A;  4Y91 A;  3S3O A;  4FT2 A;  4XU1 A;  5GMK e;  3CCR T;  4ELY C;  1KC8 U;  4ZN3 A;  5CKE A;  3GLX A;  2OTL A;  3HFO A;  3JCM h;  1Q81 C;  4HKE A;  5GAN h;  2PUO B;  3PNW C;  1M4Z A;  3CC2 A;  3KUF A;  4ELZ C;  2DZ9 A;  3OYC A;  4RCC A;  1YJ9 T;  4XTV A;  4IUV A;  3T9N A;  3A5Z B;  4EMK A;  5CQY A;  4E7H A;  3JB9 G;  1K73 C;  3JCM b;  2RJE A;  3M55 A;  3JB9 H;  4XU2 A;  3CCQ A;  2EJ9 A;  4FT4 A;  4J6X A;  1MHN A;  4FU6 A;  1VQ5 T;  1VQN A;  4ZGE B;  2R58 A;  4A4H A;  2LC4 A;  2QQ9 A;  2LDM A;  3JB9 D;  5LJ5 j;  4KBM B;  1VQ7 T;  2C06 A;  3CCL A;  4NL3 A;  3OY9 A;  3VU3 C;  3CCS A;  2LT4 A;  2RJD A;  2GF7 A;  3ER0 A;  1M1F A;  3FB9 A;  1VUB A;  3UWN A;  1QVG S;  1EIF A;  2F5K A;  4M78 G;  2M0O A;  5HK0 A;  2RH2 A;  2JOY A;  1VQ4 T;  3ASK A;  1W2B A;  5GAO l;  1UEB A;  2P4T A;  1YIT T;  5CK9 A;  3LX7 A;  1KD1 C;  4M78 D;  4MML A;  4F7U B;  4JRQ A;  4M7D D;  2DEQ A;  3J7A F;  1XNI A;  2NLU A;  1Q81 U;  2EAY A;  3SDZ A;  4ZGD B;  3NTH A;  1WJQ A;  2R5A A;  5DLQ E;  4M7A G;  1UGQ B;  3OYE A;  4M75 A;  3M57 A;  3FDR A;  3MP1 A;  2VGM A;  2LT1 A;  2M1H A;  3OW2 S;  3GOX A;  3CMA T;  1YHQ T;  2Y4Y A;  3PIO A;  5GAO r;  4N4H A;  2XHC A;  4OVA A;  3HP9 A;  2XI9 A;  4PJO C;  3HHT B;  3LLR A;  3HSB A;  4OF1 A;  2LQK A;  1U1S A;  2EYQ A;  4C8Q C;  3JRZ A;  3I55 A;  3TEE A;  1M8V A;  4EDU A;  3A8L B;  3DLL A;  4PJO B;  5LJ3 d;  4OB1 B;  5GAN 4;  1VQL A;  3CCE A;  2LTO A;  4C8Q B;  5GAN 3;  5D6Y A;  4DOV A;  4BDY A;  4M7A E;  2RJF A;  2DD5 A;  2PUK B;  2ZPI B;  3G6E T;  3CPF A;  1KQS A;  1KD1 U;  2YHT A;  1AHJ B;  2HQX A;  3KXT A;  1YIJ A;  4TVR A;  1KQ2 A;  2E6N A;  4N4I A;  5GAM h;  3L2U A;  3HRU A;  1H3Z A;  2RHZ A;  1BI1 A;  3QO3 A;  2MMP A;  2A7Y A;  5J39 A;  3VV0 A;  2HNI A;  3F70 A;  3FEO A;  2RHU A;  4UC4 A;  3JCM g;  3L2Q A;  1TH7 A;  2PVG B;  3CBO A;  5LJ3 f;  2I2L A;  2G3R A;  4JRK A;  2QA4 T;  4C92 A;  1G3Y A;  5FLX E;  1JBM A;  2DXC A;  4A4K A;  3HFN A;  3RMS A;  2CKK A;  2E70 A;  2E10 A;  2RJC A;  2KVQ G;  5GAN f;  1N6A A;  2DIQ A;  2VUB A;  2XIC A;  3MEU A;  3S6W A;  4FSX A;  2L5Q A;  3VUZ A;  2XK0 A;  2GFU A;  3M5A A;  2JTM A;  4M77 F;  3BDL A;  4BD3 A;  3CME A;  1VQ8 T;  3RES A;  3CPW A;  5CIU A;  2ZPB B;  1VQ9 T;  1Q7Y C;  1M90 C;  4XAX B;  1BIA A;  5CVI A;  4VUB A;  2QEX T;  4E7K A;  1Q86 C;  2E5Q A;  2DPP B;  2GQV A;  3DLM A;  5A0D A;  5C0M A;  1YJW T;  4KUD K;  3CXC S;  2P0Q A;  3MEV A;  3GNG A;  4LDY A;  4RMO A;  4MZT A;  2HQE A;  3PTA A;  4C0Z A;  2DTH A;  2E65 A;  4BY6 C;  3OYI A;  4P5N A;  3CCJ A;  3JCM J;  3WVE B;  1GXI E;  1W4S A;  4M75 D;  2K3Y A;  4OGC A;  5KE3 A;  3OA6 A;  1VQP T;  4BY6 B;  5CO7 A;  1VIE A;  1QVP A;  5GMK m;  2ZGW A;  3V7C A;  1UGR B;  1BKB A;  1X75 C;  4A4F A;  2CZ6 B;  5KH6 A;  3JCM X;  2E12 A;  3RKX A;  4DA4 A;  4M7A C;  1NPR A;  2DIG A;  2ZPH B;  2DJZ A;  3WVD B;  2QQA A;  2JVV A;  1ZBX A;  2DXB A;  4OMF B;  4M7A B;  4JJN K;  4L59 A;  1M90 U;  1Q86 U;  2QDY B;  2O01 E;  1BI2 A;  1JJ2 S;  4F7U F;  5L8R E;  5IT9 E;  2DAQ A;  1G3T A;  3L42 A;  3OBW A;  4D6W A;  5GAN 2;  2E41 A;  1LJO A;  3QHS A;  4BUG A;  2QI2 A;  2HD0 A;  3OSS C;  5DY9 A;  3NTK A;  1XOV A;  4IUP A;  4C92 G;  4NOY A;  4EPC A;  3OYB A;  3S3M A;  2OAU A;  2EQJ A;  1RI0 A;  3M59 A;  3QZ5 B;  4PLL A;  2YLB A;  2ZPG B;  3DKM A;  3G4S A;  1QVG A;  4C92 D;  1VQM T;  4JDS A;  1N27 A;  5C6S A;  3CCV T;  5HKC A;  1KQ1 A;  3N5B B;  5GAM f;  2K4Y A;  3J81 E;  1S72 A;  3SWN A;  2KK4 A;  1IRE B;  1UGS B;  1I81 A;  2XKO C;  3A8H B;  3VYG A;  5GMK j;  1QW1 A;  2E1H A;  4PJO F;  5GMK h;  4EMH A;  4MDX A;  5LJ3 e;  1JRI A;  4QW2 A;  4C8Q F;  1LOJ A;  2RI5 A;  4PL6 A;  3RIR A;  4C92 E;  4IUR A;  3EFS A;  1I5L A;  3FLG A;  5CKF A;  1YJN A;  2DXU A;  3A8G B;  4RCB A;  1OZ2 A;  3OW2 A;  4YTL A;  4C0D C;  3JAM E;  3M56 A;  3BW1 A;  4M77 A;  2LCC A;  4PLI A;  3JCM e;  5GAN e;  3NTI A;  1FWZ A;  2OTL T;  2K57 A;  2BKD N;  3X26 B;  4C0D B;  2EKO A;  5LJ5 h;  5DLO A;  4IUT A;  1I8F A;  5GAN 7;  3CC2 T;  1M1G A;  1X6O A;  1QP2 A;  3M53 A;  1VQ7 A;  3E19 A;  4M7D G;  4R56 A;  2OTJ A;  1SSF A;  2JUF A;  4XU3 A;  4EMG A;  2K5L A;  5CKD A;  3Q1J A;  2CYZ B;  3OBY A;  3GPL A;  3JSC A;  2RO0 A;  3QSU A;  3CCQ T;  2KY9 A;  3CC7 A;  1VQ4 A;  2ZPF B;  1VQN T;  1OYX A;  4Q5W A;  2DO3 A;  4QVC A;  1K9M C;  2MI6 A;  3L2Z A;  3CCL T;  3OYY A;  3CCS T;  3CCM A;  3CD6 A;  2O4X A;  5HK3 A;  3SD4 A;  3JCM P;  4M78 E;  4M7D E;  1IZ6 A;  3JB9 F;  4JLG A;  2K2V A;  3V8K A;  4IUU A;  2XDP A;  2WAC A;  4GY5 A;  3ZBD A;  2RI2 A;  2MF2 A;  1YHQ A;  2ZCF B;  4L5G A;  3QYG B;  2VC8 A;  1VIF A;  3KBG A;  4J8O A;  4XTU A;  1VQO A;  2FB7 A;  2EJG A;  1JB0 E;  2EJF A;  4A53 A;  3MO8 A;  3QII A;  3G7Z A;  2B8A A;  4F7U A;  3OQ5 A;  5IAY A;  3MHX A;  5GAO q;  3S3N A;  3V7R A;  3RER A;  2FHD A;  1QVF S;  2D6F A;  3E9F A;  3CBP A;  3MP8 A;  1WQ7 A;  3I56 T;  2EWN A;  3R6O A;  1N8R C;  1G5V A;  3OS5 A;  4N4G A;  5GMK i;  3L2W A;  4JRP A;  3JCM d;  5FRN A;  2CGH A;  2R5M A;  5GAN d;  1K9M U;  1D3B B;  2LNV A;  5KCH A;  3CXC A;  2K5I A;  4N0A C;  2V8J A;  3I55 T;  2DXT A;  4FIB A;  3X24 B;  4JS5 A;  4M7A F;  3P8H A;  4J7F A;  4C92 B;  3H8Z A;  3QUI A;  3VKI A;  2D0Q B;  1DJ7 B;  1H64 1;  4ZTJ A;  3CCE T;  1Y7X A;  3QJ6 A;  3OYD A;  4HCC A;  2XD0 A;  1M5Q 1;  4ZN1 A;  4LD6 A;  4C0F A;  3UPU A;  1KHI A;  1G3S A;  3RMQ A;  3VJP A;  5GAM e;  4E7J A;  3PGG A;  3ZEH A;  4BE2 A;  3QJY A;  4PJO A;  3JCM f;  5IN1 A;  3JCM c;  4M77 D;  4C8Q A;  3JB9 I;  4C0G A;  4PNO A;  2ZPE B;  4WF2 A;  4XTY A;  5LL6 S;  3VYH B;  4BI8 B;  4B9X A;  5LJ5 g;  1BIB A;  3SB2 A;  4QQG A;  1YI2 A;  4FM4 B;  2YLC A;  3HL8 A;  3MP6 A;  3P8D A;  3TRE A;  1VQ8 A;  3LH0 A;  3M54 A;  4X9D A;  1NZ9 A;  2E6Z A;  3BDU A;  1B34 B;  5EG2 A;  4QQ6 A;  5KCO A;  3TU4 K;  1N8R U;  2RHX A;  1VQ9 A;  4MZP A;  5GAN 6;  5GAN 8;  3HRT A;  4CI0 C;  4HCZ A;  4J7I A;  3QKJ A;  4C5G A;  1OZ3 A;  4M75 G;  5CAI A;  5LJ5 f;  2LCL A;  3M9Q A;  4C5E A;  4RG2 A;  1G3W A;  3QDR B;  4M78 C;  4M7D C;  2RHY A;  3CME T;  3PT9 A;  3CCU A;  4J5Y A;  3TCJ A;  3JB9 J;  2XDD A;  1K8A U;  1Y71 A;  3C95 A;  4M78 B;  3QYH B;  4M7D B;  1VQ6 A;  4A4G A;  3G71 T;  5I21 A;  1Y96 B;  2HBP A;  4BAC A;  1KQS S;  1VQP A;  2FYK A;  4QVZ A;  1O75 A;  4XTZ A;  1YBY A;  4X9C A;  4F7U G;  3CC4 A;  4IKF A;  2DTI A;  2Y90 A;  2PVD B;  1NPP A;  3OYK A;  2RB6 A;  3C4S A;  4J6W A;  4M75 E;  2X4Y A;  3A8M B;  5AYF A;  3URG A;  5CR2 A;  3CCJ T;  3OB9 A;  3MEW A;  4OB0 B;  3PIP A;  3CBM A;  2F5T X;  2DD4 A;  1HXD A;  4OB2 B;  1WJR A;  5GAM d;  4KT0 E;  2FVU A;  4NS5 A;  1UGP B;  3PMI A;  4E47 A;  4ATO A;  3MET A;  3H6Z A;  2X4W A;  2L3R A;  4F7U E;  2Y4X A;  1ZHI A;  3LGL A;  3ZFJ A;  3OS1 A;  4C8Q G;  3SWN C;  2KQW A;  3MCA B;  2LRQ A;  2RHI A;  4CRI A;  3OSV A;  3QXE B;  5GAO p;  4M7A A;  4PJO D;  2MAM A;  3SWN B;  1VQM A;  4HA8 A;  2GCX A;  2AHJ B;  4C8Q D;  4EMK C;  3CCR A;  1Q82 C;  3UDC A;  1NJI C;  2XU8 A;  2WSF E;  4EMK B;  2K5F A;  4E7L A;  1Y07 A;  2H3J A;  5CCA A;  2RD1 A;  3E1S A;  4C5H A;  3G4S T;  3FIF A;  5LJ3 j;  1YJ9 A;  5GAO m;  5LJ3 h;  4OB3 B;  5CKB A;  5DM7 R;  3X20 B;  2EQU A;  3A8O B;  4II1 A;  2VV5 A;  3DB3 A;  3LW5 E;  3JCM W;  1S72 T;  2BUD A;  3LWI A;  1VQ5 A;  4MZM A;  5GAN j;  4C92 F;  5GAN 5;  2X4X A;  4GLK A;  5FU6 C;  3OMG A;  3PMT A;  3GNF B;  4Y28 E;  3HRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...