5GAMf

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
b'PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA
molecule tags Transcription
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
total genus 8
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamf00
2YHTA 3HSBA 4J6WA 4F7UB 1I5LA 4M75F 3QSUA 3RKXA 4C8QB 4JRKA 1I81A 3QO3A 3JCMW 3EFSA 5LJ5g 4PJOF 4C92B 3JCMb 2DTIA 4NL3A 3BFMA 4MMKA 2DEQA 4PNOA 3JCMd 2E1HA 1TH7A 2CGHA 2E65A 4RCCA 5LJ3j 2Y90A 1JBMA 4EMHA 2DZ9A 4EMKB 5LJ5j 5GANg 4M77A 3RESA 5GAN7 4EMKA 4EMGA 1BIAA 1WQ7A 1M8VA 2DXTA 3JCMh 5GAOq 2I2LA 3L2ZA 3JCMV 3JCMX 5GAMd 4DQ2A 1Y96A 4J5YA 4NOYA 4XTXA 3V8JA 4C8QD 4F7UA 3INZA 3V7CA 4M7DG 1LNXA 1YCYA 4M7AB 5GMKl 3JB9J 2RD1A 2DJZA 3EFRA 4C92F 5GAMg 4PJOB 1M5Q1 1U1TA 4M78D 2RB6A 4QVCA 2VC8A 5LJ3e 4HT8A 1I8FA 5LJ3f 5GANd 2E64A 2HNIA 4PJOE 3RKWA 5LJ3d 4F7UG 1WNLA 5GANf 4M78G 4M75C 5GAMf 3GIBA 4HA8A 4M7AD 3JCMQ 3JB9H 2E10A 2QTXA 5GAMj 4C92D 4XTZA 3RERA 5GMKe 2EJGA 1I4K1 4EMKC 4M77C 2DKGA 5GAOn 5GANj 3HFNA 4M78A 5GMKm 3AHUA 5DY9A 2YLBA 4C92E 4M7DD 1MGQA 3SWNC 4C8QE 4V2SA 1N9SA 3JCMg 4C8QA 4OP0A 4XTYA 4PJOG 5LJ3h 3SWNB 4JRIA 1KQ2A 3RUXA 3JCMf 4X9DA 4XU1A 5GMKh 4NL2A 4M78B 5GAN6 1U1SA 4M7DE 3V8LA 4XQ3A 3JCMe 4M77G 4F7UF 2VXFA 4M78F 4JLIA 4M7DF 5GAN3 1X01A 4JUVA 4C92A 4C8QC 2E41A 1HXDA 2RA2A 5LJ5h 4C8QF 1BIBA 1D3BB 3SWNA 5GMKi 1WPYA 2EAYA 5GAOm 3JB9F 4M7AA 1D3BA 2EJ9A 1LOJA 1B34A 4MMLA 3PGGA 4M78C 3V8KA 3JB9I 4HT9A 3QHSA 2VXEA 3V7RA 4M7AF 4PJOC 1JRIA 4RCBA 4M75D 2FYKA 3FB9A 1HK9A 5I21A 3L1AA 3VU3C 2FB7A 1Y96B 4A53A 5GAN5 4M75G 4M7DA 2JN0A 4M75A 4N0AC 4XU2A 2DVEA 4M77E 4M75E 1H641 4M75B 4M77B 3JB9D 5LJ3g 5LJ5d 5GAN8 4N0AA 4Y91A 4M77F 3RKYA 4M7DC 3V7SA 5GANh 4J6XA 4M7AE 5GMKj 2EJFA 3SB2A 5GAMe 4C8QG 2DZCA 5CAIA 3RIRA 5LJ5e 4XTVA 4A54A 4WF2A 4C92G 4PJOA 5GANe 2DTHA 3FIFA 4XTUA 1B34B 4QVDA 3JCMP 3BW1A 4M7AC 1LJOA 1N9RA 2DXUA 2K57A 5GAOl 1WQWA 3HFOA 3QUIA 5GAN2 3JCMc 4C92C 2ZGWA 2RM4A 4XU0A 3BDUA 4J6YA 3FJPA 3JB9G 5GAN4 3BY7A 4XTWA 3M4GA 2YLCA 4F7UE 5GAOp 4M77D 3JCMJ 4M78E 1KQ1A 2DTOA 5GAMh 4M7AG 4M7DB 2EWNA 5GAOr 4X9CA 5LJ5f 4PJOD 4XU3A
chains in the Genus database with same CATH superfamily
2MOXA 2JS2A 3HP9A 2X9HA 2A3LA 3I5SA 3MEVA 1ZSZB 2CGHA 5LJ3j 2DZ9A 2K3XA 3S3OA 3MO8A 4N4HA 4L6V5 3OS0A 2GNCA 3TSZA 1X43A 2RJEA 2VC8A 2VGMA 3HTRA 2RQRA 4OMQA 3VRZA 1YIJT 1M27C 4DBQA 1AVZC 5IAYA 3H0HA 2L3SA 1Q82C 1NM7A 4ATOA 1ZSGA 1R0CB 2VWFA 2K5FA 4CC2A 2XKOC 3ULRB 4JZ4A 4NL2A 2XDDA 1M1FA 1NPRA 4CC7A 5CKDA 3JCMe 2KT8A 3VS3A 3EGXB 1EIFA 2QXFA 1BIBA 4MMLA 1D1CA 1G83A 3PGGA 3EHQA 2CSIA 3L2QA 5DLOA 1YCSB 4M75D 1TU0B 1X27A 5GAN5 2O88A 4M75E 1K73R 3VUZA 1X6OA 5LJ3g 3QYHB 3EG9A 1B7TA 1WFWA 2E5QA 4J9BA 5GAMe 4HVVA 1KJWA 2JTEA 2E5KA 3A5ZB 3OYFA 1YITA 3BW1A 2KSSA 3M57A 3R6OA 1KC8R 4C0FA 4E7KA 1VQOQ 4L59A 1FYNA 2EPDA 2J6FA 2HD0A 2Y4XA 3CC2T 5FWBA 3CCUT 2IPOB 1PCXA 3R6NA 4F16A 3CCVQ 5AT1B 1YJ9T 3OYCA 5GANj 3JCMd 3CCJQ 2M0OA 3PNWC 3LX7A 2K5LA 1BIAA 3JCMh 2RHZA 3V8JA 4F7UA 1X2KA 3G7ZA 4OGCA 1IXDA 1I8FA 2RHIA 4R55A 4KH1B 1VQ7Q 2VB6A 5GAMj 3RERA 3KXTA 1VQ7A 4AT1B 2SEMA 1WYXA 1UEBA 2NUZA 5KYUA 4RTUA 1NE8A 1SEMA 4II1A 1W2BS 2MK5A 4GLKA 1FWZA 2DBKA 5KH6A 2J6KA 4X9DA 2RH2A 2KYBA 3UDCA 4XQ3A 5FU7B 4M7DF 3RR6A 4C92A 1VYUA 3EFOA 1WPYA 2JM8A 4B6MA 1ZA1B 3CCMT 1VYVA 1M30A 3RNJA 3J7AF 3VU3C 2QK0A 4KULA 1Y57A 2WACA 2FO0A 1R77A 1PD0A 1NG2A 2FRWA 3GF5A 4XAXB 3QDRB 1BB9A 2M16A 1YI2Q 2DETA 2DL3A 4OB0B 2D1XA 5IT9E 1UGRB 1GFDA 4J9DA 1PNJA 2X35A 4BY6B 4J9GA 2OTJA 3O8VA 2KI7A 3QZ9B 8ATCB 4F7UB 3QSUA 3CCJA 3CCRT 4FW1A 1TH7A 2MI6A 2XDPA 2RJFA 3CCST 1SPKA 2C0TA 4PJNA 2FPEA 2CZ7B 3QXEB 3CC4T 1Y96A 5FW9A 2EGCA 1K9MC 1RAGB 3MHXA 1XTDA 1GCQC 4A63B 2QYZA 4OMNA 1WNLA 1W4SA 4F7UG 5GAMf 5J26A 1D0ZA 3JCMQ 1WHMA 3CMAQ 2QTXA 4C92D 4E7JA 1RABB 2A0FB 1UJYA 2O4XB 4LDUA 3GP8A 3DB3A 3D7SB 4C92E 3GLXA 3NTKA 4JRIA 2CT3A 3CC2A 1WHLA 3CMAA 4Y92A 2DX1A 2LX9A 4JUVA 1K76A 2K5IA 2A7YA 3SWNA 1D3BB 1KC8U 3CMEA 2LRQA 1M3CA 1OZ3A 1I1JA 4A4FA 1QVFA 2ROLA 2J05A 1QVGA 2IVWA 2OI3A 2DLPA 1IREB 4KGZB 1YJWA 2DMOA 1PC0A 5CKHA 5KYYB 4D8DA 3MEAA 2O2OA 2L3PA 1K9AA 3RDVA 3OS1A 1UECA 5D7UA 2V1RA 3Q1JA 4YTLA 4D6WA 1VYTA 1WHGA 5GAMh 4M7AG 1JJ2A 4IIMA 1N8RU 2M0YA 2JMCA 3I56T 4ESRA 4PNOA 4QQ6A 1PRLC 1W2BA 2E65A 2MYSA 3M0TA 5GAN7 2C0IA 1VQ6Q 2RK2A 4Z89A 1K0SA 4NOYA 4XTXA 4OVAA 4M7AB 3G6EA 2K2MA 1FMKA 5LJ3e 1VQ8Q 4E7SA 1D1AA 3SDZA 4M78G 4HA8A 4Y28E 3TSWA 1VQPT 5HY6A 1NYGA 1PKTA 3G71Q 4DBHA 2JVVA 3VS4A 1PD1A 3NTIA 3SWNB 1ZA2B 4MDWA 2CP5A 4XU1A 2HCKA 4M78B 2YRCA 1AOJA 4QVZA 1M90R 1G3TA 3URGA 1VQ5Q 3A8GB 4RG8A 2GFUA 9ATCB 3TQ7P 2C06A 1U06A 2E41A 2F69A 2RA2A 1AWJA 4MZTA 3JB9F 3J81E 1U3OA 1VIFA 2RJCA 3V7RA 2DVJA 5CKFA 2AZSA 2GCXA 2AHJB 1Q7YU 5GJWB 4M75G 6AT1B 1YP5A 4C0GA 4AMCA 2PUKB 1MMAA 3OYAA 4O6JA 4LXCA 5GANh 1J3TA 3WVDB 3SB2A 2LX7A 3DKMA 1U5SA 1HSQA 4C92G 2DYBA 3FIFA 3HPWA 1B34B 4HXJA 3CD6Q 2CP0A 3CEYA 2DXUA 2EIFA 2X3XD 4BE0A 3DB4A 3REBB 1AWOA 2ZCFB 2F5TX 3QG1A 4DBFA 2DPPB 4PLIA 1CKAA 2YDLA 4RTYA 1EX4A 4RTZA 4OMPA 3J80E 2QA4Q 1JJ2P 1W70A 4C5EA 4NL3A 2MIOA 3OS2A 3VS1A 1YI2T 4C5HA 4O5VA 2FRYA 4E7HA 2HBWA 1UDLA 2FPFA 3OYIA 2CSQA 3OMGA 2KVQG 3M0SA 3X25B 1YCYA 1OPKA 2PVOB 3FDRA 1U1TA 2RB6A 4N4IA 5FRNA 3RKWA 1S72A 2CZ0B 1D0YA 2CZ1B 3CCMQ 1K9MU 1MV0B 1K0XA 1Y0MA 3CXCS 2HEQA 3C95A 2NYSA 5KYNA 1I4K1 1QVGP 2AKLA 2ZPHB 1Y07A 2ABLA 2KXCA 4FL6A 2LJ1A 3VS7A 4C8QA 4KGXB 3VYHB 4RUGA 4OMFB 1H92A 4RTXA 3OYNA 2RQWA 1B07A 4F04B 1K73C 1NEGA 1MMNA 2HMAA 2LCCA 1VQ4A 2RNAA 1R8OB 2B86A 4C8QC 3OQ5A 5GMKi 2CUBA 2D0QB 2KR3A 4BD3A 2VXEA 1BI2A 1QVPA 4CC4B 1QCFA 1VQ7T 1UHFA 3L1AA 1HJDA 2DVEA 4EDUA 3JB9D 1WHJA 1U8RA 4E2FB 4C0DB 4M77F 4M7DC 3M55A 1BCMA 4CC3A 2GTJA 1RAEB 1QMCA 2EJFA 2XU8A 2YUPA 3BDLA 1YJ9Q 5HKCA 3JCMP 3CCVT 1VQLQ 2HAXA 5L23A 2CP2A 3QUIA 3UA7A 2DE0X 3BDUA 3CCEA 4QT7A 2JT4A 2K6DA 2YUQA 3N5BB 1NPPA 1IZ6A 2RN8A 2D9TA 2VUBA 4OF1A 4P5NA 3SHWA 1M1KR 4KGVB 4C8QB 3VRYA 4PJOF 2BZYA 1TUGB 3QZ5B 2Y90A 4JLGA 3MKDA 2BZ8A 2P0KA 4EMKA 3OW2P 3I56A 1M8VA 1RL2A 1ZBJA 1K4US 1C0MA 1K8AR 1QKXA 3NTHA 4BI8B 2R58A 3OBWA 2COYA 3UPUA 2COWA 3UT1A 1WI7A 1MMDA 4FM4B 2KBTA 2XD0A 2WSEE 2FPDA 4PK4A 2EYXA 1WIEA 3CCQT 1BBZA 2DYIA 3CC7A 4ZN1A 5DLQE 3A8OB 5M9OA 1MGQA 3A8LB 3RBBB 2BIVA 4ZNXA 3FC3A 1JEGA 3TREA 3OSSC 1VQKA 3PMIA 3S3NA 1PRMC 1PM3A 1A0NB 1G5VA 4D8KA 5IXBA 2A37A 2YUOA 1XOVA 4C5GA 2E6ZA 2BUDA 2DXBA 2HL5C 1YIJQ 3CD6T 2X4JA 4TVRA 1EZZB 1SHFA 3OYKA 1ZUYA 2YXYA 4M77B 4N0AA 4Y91A 1IGQA 4Z88A 3EAEA 3QBYA 3MEUA 5IHKA 1OULA 2CP6A 1VQMT 2DZCA 3JRZA 4WF2A 2LCSA 1LJOA 1XJWB 3X28B 3VS2A 1HD3A 3M0RA 1K9MR 2K2VA 2NWMA 1H3ZA 2VKNA 2CZ6B 3CXCA 2QGFB 4X9CA 4PJOD 4AG1C 3CC7T 2C0OA 2IG0A 1QCNA 2FZCB 2MPXC 4IUPA 1JBMA 1RADB 1E6HA 1WQ7A 1KSWA 1UTIA 4DEXA 2I2LA 5GAOq 5A0GA 4BDYA 1ACMB 2NUPB 2DEUA 3MP6A 4M7DG 1OZ2A 2R5AA 3INZA 1KC8C 2KK4A 4ZN3A 2FHDA 2QQAA 2V1QA 3OYMA 3H9NA 4A4GA 3OYBA 1NZ9A 1SG5A 3E9GA 3JB9H 2KRMA 3CCLQ 4J8OA 1VQ8T 3HKSA 3CMET 1VQKQ 3UF4A 5GAOn 3E19A 3OYHA 2QEXQ 1BI0A 3HFNA 4A4EA 1Q7YC 2YLBA 2FG0A 1VQ6T 2B8AA 4Z02A 5KE2A 3GNFB 1NYFA 3G6EQ 2ECZA 3RUXA 3QDFA 1GFCA 1XQHA 4NS5A 1QWEA 4AG2C 5C6SA 4KT0E 4FCYA 4DA4A 5HCKA 2VV5A 3P8DA 2EAYA 2KDSA 3T9NA 1YBYA 2E6NA 1IHWA 3M59A 4KBMB 2F1LA 1AHJB 2ZAEA 3EG3A 3E2UA 1VQ9T 1BCOA 2LC4A 1XNIA 1KK7A 1M3AA 4M77E 1N5ZA 2AIRB 4M75B 1AD5A 2JM9A 5LJ5d 1VQNT 3RKYA 3CPFA 2P4RA 1LVKA 4HCCA 3CCSA 3OW2A 5J39A 4HCKA 2ROTA 1Q81U 4XTVA 2K4YA 1RAAB 2DTHA 1KFZA 4QVDA 2KT1A 4E7IA 1X6BA 3UATA 2PU9B 2LQ8A 2RM4A 2FZKB 3A1PA 5CCAA 2CH4W 4J9EA 2PZ1A 3X24B 5GAOr 2NUPA 1PHTA 3RKXA 1I81A 4JJCA 3OMCA 2E3IA 2X4WA 4KRTA 1WJRA 3BFMA 2ED0A 3CC4A 2VVKA 2W10A 4EMGA 4LDWA 3CPWS 2EQUA 3DLMA 2EKHA 5IN1A 5KYWA 4C8QD 4UC4A 2LZ6B 2KXDA 2DJZA 1Z9ZA 4C92F 5FU7C 3LW5E 2RI2A 2XHCA 4OGEA 4M75C 5KCOA 1BK2A 3VKIA 2QQRA 5ECAA 1WJQA 2M9UA 1QLYA 4GLMA 5D6WA 2QEXA 3X26B 1MV3A 2DA9A 4FIBA 5DY9A 4M7DD 1D09B 2OTJQ 2GTOA 4C8QE 3JCMg 2RQUA 3CCSQ 1M1KC 1QVGS 2QGGA 3CCRQ 1T0HA 4OMOA 5KYXA 5FRMA 1QP2A 1WHHA 2E4HA 4OB3B 2HQXA 1VQ4Q 3M0PA 2ENMA 4DBRA 4HT9A 2ZPBB 4M78C 1ZUKA 2RHYA 1VOMA 2V8IA 4FU6A 3EGDB 5DM7R 3LWIA 1MNDA 3NGPA 4M7DA 1MNEA 2JOYA 3EH2A 1JB0E 1TUCA 4QKUA 1UHCA 4Z8AA 4WCIA 2XMFA 3GPLA 5KYWB 4F17A 4CRIA 4IURA 1I5OB 2QA4T 1UB4A 1OV3A 1H8KA 4XK8E 4JS4A 2ZGWA 4Q5WA 3BY7A 1ZLMA 3VS5A 4JRQA 2YLCA 3LYIA 3JCMJ 4FYVB 2EKOA 1VQ4T 3SEMA 2QASA 3KUFA 4MDXA 2YHTA 2MWPA 2DXCA 2GBQA 2L89A 3L2RA 1YI2A 4EMKB 2Z0WA 2P0PA 1OU8A 4JPBW 1Q86U 2CP7A 4J83A 2PQWA 2F2VA 1VA7A 4LDYA 2NUTA 5GAMd 3MCAB 1G3YA 1ZSZA 1QP3A 3V7CA 3A8HB 2HSPA 1N8RR 2RD1A 1BI1A 1UGPB 3EH1A 3CCUA 4PJOE 1YWPA 4BI3A 2EYQA 4OB1B 2E10A 3VS6A 2QA4A 2D8JA 2JJ9A 2EVRA 2ZZDA 2K3BA 2MCNA 1M2OA 2L8DA 1WJSA 1Q82U 3CXCP 2DM1A 4OP0A 5I2SA 2EGEA 2PTKA 1TXQA 2ZPEB 2J06A 4ZGJB 1NBEB 2V8JA 3QWXX 3V8LA 1SSHA 3EGDA 1PWTA 4M78F 2EGAA 2GFAA 5CK9A 3C0CA 2HQEA 5GAOm 2H3JA 2YT6A 2E12A 3OYGA 1VQPQ 4JDSA 4RCBA 1YN8A 2EBPA 1ABOA 3FB9A 4RTTA 1QVFS 2QQBA 4FW2A 3NHNA 5FU6C 3OBYA 2I0NA 3OB9A 3NPFA 1MHNA 1NLOC 1VQNQ 2CYZB 3V7SA 5LL6S 1SSFA 2BKDN 3I56Q 1OQKA 3CQTA 1W2BP 3KBGA 2D6FA 2HKQB 1N9RA 3JV3A 3TCJA 2SRCA 2F2WA 5GAN2 3I35A 4C92C 4B9WA 3CBMA 2YUNA 4FYYB 4M78E 1KQ1A 3P8HA 1TTHB 1YJNA 5LJ5f 3HSBA 3M5AA 5CVIA 2WSFE 2D0NA 2QQSA 2DRKA 3EFSA 2X4XA 4BE2A 4MMKA 2DEQA 4A4HA 2KEAA 1FX7A 3JSCA 4E7ZA 1VQ8A 4OB2B 2LQWA 3L2ZA 3JCMV 4C0ZA 3JCMX 2LTOA 4RG2A 2QEXT 5D6XA 3UA6A 1VQKT 3CMEQ 4HT8A 2OAWA 1KD1R 2PVDB 4HKEA 3CCLT 2XDBA 1TUDA 3OYEA 4CI0C 4LD9K 4M7AD 2DFUA 1FXXA 1R0BG 3CPWP 4DOVA 1ZX6A 2MMPA 2KRNA 4M4ZA 4R0KA 4IUUA 2KY9A 1WA7A 1PSEA 1D0XA 1RI9A 5KYYA 2XG8D 4PJOG 1PKSA 1BI3A 2A36A 2AT1B 4RTVA 1GBQA 4L5GA 3H41A 3CC7Q 2O31A 1VUBA 5GMKh 3H6ZA 5KYUB 2RJDA 2DERA 4A4KA 5FROA 2G6FX 5GAN3 3I55T 8AT1B 1GXIE 2JS0A 2QDLA 2K79A 3CCEQ 4BI4A 3JB9I 2YRDA 1YJWQ 2LNVA 1HYOA 1UUEA 3HRSA 4N4GA 3C12A 3NFCA 2FYKA 1HK9A 1OPLA 1YJ9A 4PFZA 3LH5A 1VQMQ 4M75A 4XU2A 5I2MA 1W6XA 1UGVA 3E1SA 1RACB 2OTLA 3PIOA 1EFNA 1LCKA 4LNPA 4BACA 4PFOA 1VQ9A 3RIRA 4E47A 4A54A 1X69A 2RQTA 4BDZA 2HZYA 2LJ3A 2V26A 4LD6A 3C4SA 3FJPA 2O9SA 2W0ZA 1BU1A 3L2VA 1VQPA 2EQJA 2JZ2A 2FEIA 2GGRA 2L3QA 4XU3A 4FSSA 3IQLA 1M2VA 4JRKA 1ZBXA 2OX7A 1BYMA 2HKNA 3JCMb 3PVLA 3QJ6A 1RAHB 1SHGA 1MUZA 1NJIU 3G1JA 2CS7A 5D6YA 3CCQQ 2A08A 1NEBA 3EHRA 2K7AA 4M78D 2DL5A 1FMWA 5LJ3f 5GANd 2HNIA 4J9FA 2QQ9A 4IIOA 2LJ0A 3QIIA 4KH0B 1ZSZC 2LP5A 4XTZA 5GMKe 4ELZC 4ZGEB 1YHQA 1F1BB 2QI2A 3LGFA 2YSQA 2RO0A 2F2XA 2RI5A 2ZPGB 2JTFA 1N27A 4V2SA 4OMMA 2AKKA 3HL8A 5IHIA 3OYJA 1G3WA 1AWWA 1U1SA 2HBPA 2L2PA 1RAFB 3C94A 2H3EB 1VQ6A 1P92A 1N8RC 4C8QF 3WXMB 3JAME 3PIPA 1CSKA 3QHSA 5J3BA 1TWBA 1YNZA 1VQLT 2X51A 2QDYB 1C1AA 2LNHB 1LPLA 2L3RA 4WTOB 1RUWA 1VQ5A 1JXMA 1AWXA 4BY6C 5GAN8 5IXFA 4FSXA 2KROA 5GMKj 3F70A 4ELYC 3VYGA 5CAIA 5LJ5e 3H8ZA 1OOTA 1KD1C 3QWYA 2L5QA 1D1BA 3G4ST 1O9SA 3CCUQ 4KUDK 2J7IA 2JMAA 2YRVA 1K8AU 3M4GA 1YITQ 2EYYA 2DTOA 2BE7D 4HVWA 5L8RE 2EYZA 3VUBA 3ASKA 3QPHA 3EG9B 1AEYA 2FZGB 3G4SQ 2KMTA 2M02A 3EG0A 3QO3A 1M1KU 3MP1A 4BE1A 2YWWA 2KYMA 2LT1A 1OEBA 4ZTFA 2FVUA 2DXTA 5A0LA 3OYLA 1JQQA 2EQMA 1W1FA 4J5YA 1IRXA 2A28A 2DO3A 1S72T 3PFSA 3EFRA 2QAZA 1ZQ1A 4J9IA 1M9SA 4AFSC 2OJ2A 5IHNA 2AK5A 2CDTA 2LT4A 5C0MA 4M77C 1UGQB 1M4ZA 4M78A 1CKBA 1ZHIA 3VJPA 1Q86R 1VQOA 3RMQA 1M1GA 2VASA 3TVTA 5EG2A 4J7IA 3EGUA 4M7DE 1OX8A 1RI0A 4ANJA 3HRTA 1GBRA 2VXFA 4JZ3A 5CQYA 3PE0A 1Z9QA 2KE9A 2ZPIB 1M3BA 3NMZC 4GY5A 2XIDA 3TU4K 2COZA 1QKWA 4M7AF 2L0AA 1B3QA 2LDMA 2PNIA 2FB7A 3OA6A 2JTMA 2DL7A 4PFPA 2RHUA 5KE3A 1H641 2RI3A 2CREA 4VUBA 1QVFP 2JXBA 1WDXA 4J6XA 2ED1A 3FEOA 4X1VA 2LCLA 3EFOB 5IH2A 1T3SA 5CO7A 2KAFA 1VIEA 4LDVA 3H0IA 5CIUA 2IIMA 2DJQA 2NLUA 1WQWA 3GOXA 1TOVA 3QJYA 3OW2S 3JB9G 1Q81C 2DIQA 2XI9A 2BE9B 4M7DB 3ER0A 1SF9A 1VQNA 1PG5B 3OSVA 3CCLA 4ME7A 1V1CA 1IB8A 4J6WA 1VQ5T 3QKJA 2LVMA 4FT4A 1I5LA 2DILA 1Q95G 2QTVA 3SFMA 4RCCA 5LJ5j 4OMLA 3SD4A 3ZEHA 1JO8A 2PUOB 4JS5A 2BZXA 1JXOA 1QCOA 3G71T 5GMKl 1O75A 3L2UA 4MZMA 4JJDA 2DNUA 2KRSA 3QYGB 4RTWA 3OYYA 4AFZC 2JW4A 3PVQA 3CCET 2X3WD 4IUVA 2EJGA 1YHQT 2DKGA 1OI1A 3I55Q 5GMKm 2BTTA 4JJNK 3ME9A 2OAUA 1KQ2A 2MWOA 2P0QA 1X6GA 5GAN6 4JLIA 1WXTA 5GJVB 1WHKA 1X01A 5FWCA 4DOWA 4M7AA 1PSFA 1WXBA 3CBOA 4PJOC 1N6AA 2NUTB 4ORZA 4PL6A 1Q82R 1YIJA 2EYWA 3WVEB 2J6OA 4QQGA 4N0AC 3U23A 1KIKA 3PTAA 2O01E 1TSFA 2DBMA 2DK3A 4HVUA 3M4YA 1X75C 4EPCA 4XTUA 5KCHA 2Y4YA 1VQMA 1SRMA 3E9FA 2EW3A 4PJMA 3UWNA 4JRPA 1UG1A 1E6GA 2M51A 3M9QA 1K1ZA 1KHCA 3MJXA 1BKBA 5I22A 3JCMW 2KNBB 5LJ5g 4C92B 3I9QA 2E1HA 5CKBA 4PKCC 2P84A 5HK0A 1ARKA 1KQSS 1RLQC 2OTLQ 1C6VX 3OY9A 3M53A 2E70A 3M58A 4QQDA 4ZGDB 3JB9J 4QVCA 1YFNA 2WSCE 5I11A 3CMAT 2P4TA 5LJ3d 5GANf 1S1NA 1WZOA 2DAQA 4KUIA 4AFQC 1OYXA 4HCBA 1KQSA 5CQXA 2KGTA 4X34A 3CC4Q 3AHUA 4DEYA 1N9SA 3M0QA 4XTYA 2RPNA 3ZBDA 1UJ0A 3AT1B 3EG2A 2QG9B 1GRIA 1K8AC 1SRLA 3EGXA 2CH4A 1HXDA 2HDAA 3S6WA 1MMGA 2X4YA 5LJ5h 4MZPA 2K9GA 3V8KA 1Y7XA 2O9VA 1OU9A 4IUQA 1UE9A 5I21A 4J7FA 1Y96B 4K11A 1YJNT 2DRMA 1ZUUA 2JN0A 3VV0A 3CPWA 1AZGB 3FRNA 2M1HA 4HCZA 5CR2A 1I07A 1V76A 4PLLA 1GL5A 2O4XA 1QWFA 1RLPC 2MF2A 5GANe 4C5IA 2K57A 1JJ2S 2F5KA 2DL4A 1GCPA 4XTWA 5GAOp 4M77D 2PVGB 3S3MA 2KQWA 3META 3G4SA 1QQJA 5GANg 5KYXB 2RHXA 3RESA 3CCRA 2EFIA 1TS9A 1Y71A 1IGUA 5EC7A 2HSEB 2V8KA 1Q81R 1AT1B 1LNXA 3MEWA 3PMTA 5GAMg 1M5Q1 1YJNQ 3P8BB 2E64A 3I5RA 4FYXB 1Q7YR 1VQLA 3FLGA 2LQNA 3MPUB 1KHIA 1T0JA 1S72Q 3O5ZA 2FL7A 4FT2A 5CKEA 3SWNC 3LH0A 5LJ3h 2LQKA 3RMSA 3JCMf 3CCJT 3OYDA 1I0CA 1ABQA 4JJBA 3M54A 3MP8A 4F7UF 2OTJT 3BE3A 2VYTA 4GBQA 1M2VB 3CC2Q 3KFVA 3CCMA 3LLRA 1YITT 1TG0A 1WLPB 1VQOT 2EJ9A 1LOJA 1T3LA 1KQSP 1JRIA 2EQKA 2MAMA 1Q86C 4EIKA 2GQVA 2R57A 3A98A 2RMOA 1QW1A 2R5MA 1GCQA 2OTLT 1E7OA 3GBQA 4M7AE 2K3YA 7AT1B 1G2BA 1IO6A 3FJ5A 4C8QG 2XICA 1AZEA 4IUTA 2E3HA 5GAOl 3JCMc 2CUDA 2LMJA 4J6YA 4BUGA 5A2QE 5FLXE 4F7UE 5A0DA 4FYWB 1UGSB 2EWNA 3EG1A 4R56A 2DD4A 4M75F 4C0DC 1M8MA 2DTIA 2DIGA 3HHTB 1RAIB 4EMHA 1SKUB 1YWOA 4M77A 4E7LA 4LDXA 4RMOA 4DQ2A 3CCQA 1G3SA 3M0UA 2RK1A 1X2QA 1KG1A 2GF7A 4LUEA 1KD1U 4PJOB 4J9HA 3VS0A 1V29B 1WX6A 1VQ9Q 2DF6A 1FMVA 3G71A 1M90C 3GIBA 3DLLA 4AFUC 3CD6A 5FU6B 1WXUA 4ZTJA 4F14A 1H3HA 4EMKC 5HK3A 3ZL7C 1K73U 3PT9A 4LN2A 2CKKA 1NLPC 4E6RA 4PJJA 3GNGA 2AZVA 4B9XA 3HRUA 3G6ET 1DJ7B 2H8HA 4M77G 3X20B 5AYFA 3L42A 1IHVA 2RQVA 2XK0A 2VGNA 1YHQQ 2ATCB 1JU5C 1D3BA 1B34A 3REAB 4LUDA 2HQHA 3CCVA 2JNGA 4A53A 4LE9A 1M90U 3I55A 3TEEA 2EQIA 2GQIA 4BB7A 3LGLA 2DD5A 1NJIR 2ESWA 2ZPFB 2G3RA 3M56A 4QW2A 2CT4A 4PJOA 2RF0A 3L2WA 2JUFA 4M7AC 4PJLA 1NJIC 3HFOA 3LWHA 2CP3A 4IKFA 3THKA 1WGSA 1OX9A 4XU0A 1YJWT 1G8XA 5GAN4 4J9CA 3A8MB 1UFFA 2DL8A 4RKUE 3ZFJA 3H0FA 2D8HA 3OS5A 3CBPA 2HL3A
chains in the Genus database with same CATH topology
2YHTA 1VQ5T 2MWPA 4J6WA 3QKJA 3HP9A 2LVMA 3J80E 4FT4A 1I5LA 2A3LA 3MEVA 2DXCA 4C5EA 4NL3A 3SFMA 3OS2A 2L89A 2CGHA 4RCCA 4O5VA 4C5HA 5LJ3j 5LJ5j 3L2RA 1YI2T 1YI2A 2DZ9A 4EMKB 2K3XA 4E7HA 3S3OA 2P0PA 3SD4A 1Q86U 3ZEHA 4J83A 3MO8A 2PQWA 3OYIA 4LDYA 4N4HA 5GAMd 2PUOB 3MCAB 3OMGA 4L6V5 3OS0A 2KVQG 1G3YA 4JS5A 1QP3A 3V7CA 3A8HB 3G71T 3X25B 1YCYA 5GMKl 2RD1A 1O75A 3L2UA 4MZMA 1BI1A 1UGPB 1U1TA 2PVOB 2RB6A 2RJEA 2VC8A 3FDRA 4N4IA 2VGMA 3QYGB 3CCUA 5FRNA 3RKWA 4PJOE 1S72A 2CZ0B 4BI3A 2EYQA 3OYYA 1YIJT 4OB1B 2CZ1B 1K9MU 2E10A 5IAYA 3CCET 3CXCS 2QA4A 3C95A 4IUVA 2EJGA 1YHQT 1I4K1 2ZZDA 2DKGA 1OI1A 2L8DA 1WJSA 5GMKm 1Q82U 2ZPHB 1Y07A 1Q82C 4FL6A 4C8QA 4JJNK 3VYHB 3ME9A 4OP0A 5I2SA 4ATOA 2OAUA 1KQ2A 2K5FA 4OMFB 2MWOA 2XKOC 3OYNA 2P0QA 2ZPEB 4NL2A 5GAN6 1K73C 4ZGJB 2V8JA 2XDDA 1M1FA 1NPRA 3V8LA 5CKDA 3JCMe 2LCCA 4M78F 1VQ4A 4JLIA 1EIFA 2GFAA 2QXFA 1R8OB 5CK9A 1X01A 4C8QC 3OQ5A 4DOWA 1BIBA 2HQEA 5GMKi 2H3JA 5GAOm 4M7AA 1PSFA 4MMLA 2E12A 3OYGA 2D0QB 3PGGA 3CBOA 4BD3A 2VXEA 1BI2A 1QVPA 4PJOC 1N6AA 3L2QA 5DLOA 4JDSA 4RCBA 4PL6A 4M75D 1VQ7T 3FB9A 1YIJA 1QVFS 3L1AA 2QQBA 3WVEB 5GAN5 5FU6C 4QQGA 4N0AC 3OBYA 2DVEA 4M75E 4EDUA 3OB9A 3VUZA 3JB9D 1X6OA 5LJ3g 1U8RA 1MHNA 4C0DB 3QYHB 4M77F 3PTAA 4M7DC 2CYZB 3M55A 3V7SA 2O01E 5LL6S 1SSFA 2DK3A 2EJFA 2XU8A 2E5QA 3M4YA 5GAMe 2BKDN 3CCLA 3BDLA 1X75C 4EPCA 5HKCA 4XTUA 3JCMP 3A5ZB 3OYFA 3CCVT 3KBGA 1YITA 2HAXA 3BW1A 2D6FA 1N9RA 5KCHA 3TCJA 2KSSA 3M57A 3QUIA 2Y4YA 3R6OA 5GAN2 4C92C 1VQMA 4B9WA 3E9FA 3BDUA 4C0FA 3CCEA 4E7KA 3UWNA 3CBMA 4JRPA 4L59A 4M78E 1KQ1A 3N5BB 1NPPA 3P8HA 2HD0A 2Y4XA 1IZ6A 1YJNA 3CC2T 2D9TA 3CCUT 5LJ5f 3M9QA 3HSBA 2VUBA 3M5AA 4OF1A 4P5NA 1KHCA 5CVIA 1BKBA 2WSFE 2QQSA 4C8QB 3JCMW 3EFSA 5LJ5g 4PJOF 2X4XA 4C92B 4BE2A 1YJ9T 3OYCA 4MMKA 5GANj 2DEQA 4A4HA 3JCMd 2E1HA 3QZ5B 2Y90A 1FX7A 2M0OA 3JSCA 3PNWC 5CKBA 4JLGA 3LX7A 2P0KA 4PKCC 4EMKA 2K5LA 1BIAA 3I56A 1M8VA 3JCMh 1RL2A 5HK0A 4OB2B 1VQ8A 2RHZA 3L2ZA 3JCMV 4C0ZA 3JCMX 1KQSS 2LTOA 4RG2A 3NTHA 3V8JA 4F7UA 3OY9A 2QEXT 3M53A 5D6XA 2E70A 3M58A 4QQDA 4BI8B 4ZGDB 3JB9J 1VQKT 2R58A 4QVCA 4HT8A 3G7ZA 4OGCA 4MDXA 3OBWA 1I8FA 2RHIA 4R55A 2PVDB 2WSCE 4HKEA 3CCLT 3UPUA 2P4TA 5LJ3d 5GANf 3UT1A 3OYEA 4CI0C 3CMAT 4LD9K 2DAQA 4M7AD 4KUIA 4FM4B 2XD0A 1OYXA 2WSEE 5GAMj 1FXXA 4HCBA 3RERA 4DOVA 2MMPA 3KXTA 3CCQT 1KQSA 1VQ7A 4IUUA 2KY9A 5CQXA 1UEBA 4ZN1A 3CC7A 4X34A 1PSEA 5DLQE 3AHUA 3A8OB 1NE8A 5M9OA 1MGQA 4II1A 1W2BS 1N9SA 3A8LB 2XG8D 4XTYA 2BIVA 4PJOG 1BI3A 4GLKA 1FWZA 3ZBDA 5KH6A 3FC3A 4L5GA 4X9DA 1VUBA 2RH2A 5GMKh 3H6ZA 3TREA 3OSSC 1VQKA 3PMIA 3UDCA 2RJDA 4XQ3A 3S3NA 4A4KA 5FU7B 1K8AC 5FROA 4M7DF 5GAN3 3I55T 4C92A 1GXIE 1HXDA 3S6WA 2X4YA 5LJ5h 1G5VA 1WPYA 4MZPA 4BI4A 3JB9I 3V8KA 1Y7XA 4IUQA 1XOVA 4C5GA 2LNVA 2E6ZA 2BUDA 2DXBA 3HRSA 3CCMT 4N4GA 3J7AF 3C12A 3NFCA 2FYKA 5I21A 1HK9A 3CD6T 3VU3C 2X4JA 4J7FA 1Y96B 4TVRA 1YJ9A 4KULA 3OYKA 1YJNT 2JN0A 2WACA 3KUFA 4M75A 4XU2A 5I2MA 3VV0A 4M77B 3CPWA 3E1SA 3GF5A 2OTLA 4XAXB 4N0AA 4Y91A 3QDRB 3EAEA 3FRNA 3PIOA 2M1HA 3QBYA 2M16A 3MEUA 4HCZA 5CR2A 4BACA 1VQMT 2DZCA 4OB0B 3JRZA 4PLLA 2O4XA 3RIRA 4E47A 4A54A 4WF2A 1VQ9A 5GANe 2MF2A 4C5IA 5IT9E 1UGRB 4BDZA 1LJOA 2K57A 1JJ2S 2F5KA 4LD6A 3X28B 2X35A 3C4SA 3FJPA 4BY6B 2K2VA 4XTWA 5GAOp 4M77D 3L2VA 1VQPA 2PVGB 2OTJA 2EQJA 3O8VA 2JZ2A 1H3ZA 2CZ6B 3CXCA 4X9CA 4PJOD 4XU3A 3S3MA 3QZ9B 2KQWA 4F7UB 3META 3QSUA 3G4SA 4JRKA 3CCJA 1ZBXA 1BYMA 3CCRT 3JCMb 3CC7T 2IG0A 1TH7A 2MI6A 2XDPA 3QJ6A 4IUPA 1JBMA 5GANg 2RJFA 2RHXA 3RESA 3CCST 3CCRA 2EFIA 1WQ7A 1Y71A 5GAOq 2I2LA 5A0GA 2CZ7B 3QXEB 3CC4T 1Y96A 2V8KA 4BDYA 1NJIU 3MP6A 2CS7A 1OZ2A 2R5AA 3INZA 5D6YA 1LNXA 3MHXA 1KC8C 3MEWA 3PMTA 1K9MC 2KK4A 4ZN3A 5GAMg 2FHDA 1M5Q1 2QQAA 4M78D 1XTDA 3OYMA 3P8BB 5LJ3f 5GANd 2E64A 2HNIA 4F7UG 1WNLA 1W4SA 4A4GA 5GAMf 5J26A 2QQ9A 3OYBA 1NZ9A 1VQLA 3E9GA 3JCMQ 3JB9H 3FLGA 3QIIA 1KHIA 2QTXA 4J8OA 1VQ8T 3HKSA 4C92D 4XTZA 4E7JA 2O4XB 4ELZC 4ZGEB 5GMKe 3CMET 4LDUA 2FL7A 3GP8A 3DB3A 4FT2A 1YHQA 2QI2A 3LGFA 3E19A 5GAOn 3OYHA 1BI0A 2RO0A 3HFNA 2RI5A 2ZPGB 2JTFA 4A4EA 2YLBA 3GLXA 5CKEA 4C92E 1Q7YC 1VQ6T 2B8AA 3SWNC 4Z02A 1N27A 3LH0A 5KE2A 4V2SA 3GNFB 3NTKA 3HL8A 5LJ3h 2LQKA 4JRIA 3RUXA 3CC2A 3RMSA 3JCMf 3CCJT 3OYJA 3CMAA 1G3WA 1U1SA 3OYDA 1XQHA 4NS5A 5C6SA 2HBPA 3M54A 4M7DG 3MP8A 4KT0E 4F7UF 4DA4A 2OTJT 2VYTA 3C94A 2LX9A 2VV5A 1VQ6A 1P92A 4JUVA 2K5IA 3CCMA 1N8RC 2A7YA 3LLRA 3P8DA 1D3BB 3SWNA 4C8QF 3WXMB 2EAYA 2KDSA 3JAME 3T9NA 1YBYA 2EJ9A 1LOJA 3PIPA 1VQOT 1KC8U 3CMEA 2LRQA 3QHSA 2E6NA 1OZ3A 3M59A 1JRIA 4KBMB 5J3BA 2EQKA 4A4FA 2MAMA 1Q86C 1QVFA 1AHJB 1VQLT 1VQ9T 2QDYB 2GQVA 1QVGA 2LC4A 1XNIA 2IVWA 2L3RA 2R57A 4M77E 4M75B 1VQ5A 1IREB 1QW1A 2R5MA 1YITT 5LJ5d 2OTLT 4BY6C 5GAN8 1YJWA 1VQNT 3RKYA 5CKHA 3CPFA 4FSXA 4M7AE 5GMKj 3F70A 4ELYC 3VYGA 4HCCA 3CCSA 2K3YA 5J39A 3OW2A 4C8QG 5CAIA 1Q81U 3MEAA 2XICA 5LJ5e 3H8ZA 4XTVA 2K4YA 1KD1C 2DTHA 4IUTA 2L5QA 4QVDA 4E7IA 3OS1A 3G4ST 5GAOl 1O9SA 2PU9B 2LQ8A 4KUDK 3JCMc 2RM4A 3Q1JA 4J6YA 4BUGA 2YRVA 5CCAA 5A2QE 4YTLA 1K8AU 3M4GA 5FLXE 4D6WA 4F7UE 5A0DA 2DTOA 5L8RE 5GAMh 4M7AG 1JJ2A 1UGSB 2EWNA 4R56A 3VUBA 3ASKA 3QPHA 3X24B 5GAOr 1N8RU 2KMTA 2DD4A 4M75F 3RKXA 1I81A 3QO3A 3I56T 4LDXA 1M1KU 3OMCA 3MP1A 2DTIA 2X4WA 4C0DC 2DIGA 1WJRA 3BFMA 4PNOA 3HHTB 4QQ6A 4BE1A 2E65A 1W2BA 3CC4A 4EMHA 2LT1A 4M77A 4E7LA 5GAN7 4ZTFA 4EMGA 2FVUA 4LDWA 2DXTA 5A0LA 3OYLA 4RMOA 2RK2A 2EQUA 2EQMA 3DLMA 3CPWS 5IN1A 4DQ2A 3CCQA 4J5YA 4NOYA 1G3SA 4XTXA 4C8QD 2RK1A 2DO3A 4OVAA 4UC4A 1S72T 2GF7A 4M7AB 1KG1A 3PFSA 3G6EA 2DJZA 3EFRA 4C92F 1KD1U 4PJOB 5FU7C 5LJ3e 3LW5E 1V29B 1ZQ1A 1M9SA 2RI2A 3G71A 2XHCA 3SDZA 1M90C 4M78G 4M75C 4OGEA 5KCOA 3DLLA 3GIBA 4HA8A 2QQRA 3VKIA 4Y28E 3CD6A 5FU6B 1VQPT 4ZTJA 1WJQA 2M9UA 5HY6A 2LT4A 5D6WA 2QEXA 5C0MA 4EMKC 3X26B 4M77C 4FIBA 1UGQB 1M4ZA 2JVVA 4M78A 1ZHIA 5DY9A 3VJPA 5HK3A 1K73U 4M7DD 3PT9A 4C8QE 3JCMg 1M1KC 3NTIA 1VQOA 1QVGS 3RMQA 3SWNB 1M1GA 2CKKA 3GNGA 4MDWA 5EG2A 4J7IA 4XU1A 4B9XA 4M78B 3HRUA 4M7DE 3G6ET 1RI0A 1DJ7B 4QVZA 1G3TA 3HRTA 3URGA 3A8GB 4M77G 2VXFA 5FRMA 4RG8A 5CQYA 3X20B 2GFUA 5AYFA 3L42A 1QP2A 4OB3B 2C06A 2HQXA 2ZPIB 2XK0A 2E41A 2F69A 2RA2A 2VGNA 4GY5A 2XIDA 4MZTA 3J81E 3JB9F 3TU4K 1D3BA 1B34A 4HT9A 2ZPBB 4M78C 1VIFA 2RJCA 3V7RA 2RHYA 4M7AF 5CKFA 2V8IA 3CCVA 2GCXA 4FU6A 2LDMA 5DM7R 2AHJB 2JNGA 2FB7A 1Q7YU 3OA6A 3LWIA 2JTMA 4A53A 4M75G 4M7DA 1M90U 3I55A 4C0GA 3TEEA 2PUKB 2RHUA 5KE3A 1H641 2JOYA 3OYAA 4O6JA 2RI3A 4BB7A 3LGLA 1JB0E 4VUBA 2DD5A 5GANh 2ZPFB 4J6XA 2G3RA 3FEOA 3GPLA 3WVDB 2LCLA 3SB2A 4CRIA 3M56A 3DKMA 4IURA 4QW2A 5CO7A 4PJOA 2KAFA 4C92G 1VIEA 3FIFA 4LDVA 3HPWA 1B34B 2QA4T 1UB4A 3CEYA 5CIUA 3L2WA 2JUFA 4M7AC 2DXUA 2EIFA 1NJIC 2NLUA 1WQWA 4XK8E 3GOXA 3HFOA 4BE0A 3QJYA 3LWHA 2XDBA 4JS4A 3OW2S 4IKFA 2ZGWA 1WGSA 3DB4A 4Q5WA 4XU0A 1YJWT 3JB9G 1Q81C 2DIQA 2XI9A 2ZCFB 5GAN4 3BY7A 4JRQA 2YLCA 2F5TX 3LYIA 3ER0A 3QG1A 3JCMJ 2DPPB 4PLIA 4M7DB 3A8MB 1VQ4T 2EKOA 1VQNA 3ZFJA 4RKUE 3OSVA 3OS5A 3CBPA 4ME7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YHT A;  3HSB A;  4J6W A;  4F7U B;  1I5L A;  4M75 F;  3QSU A;  3RKX A;  4C8Q B;  4JRK A;  1I81 A;  3QO3 A;  3JCM W;  3EFS A;  5LJ5 g;  4PJO F;  4C92 B;  3JCM b;  2DTI A;  4NL3 A;  3BFM A;  4MMK A;  2DEQ A;  4PNO A;  3JCM d;  2E1H A;  1TH7 A;  2CGH A;  2E65 A;  4RCC A;  5LJ3 j;  2Y90 A;  1JBM A;  4EMH A;  2DZ9 A;  4EMK B;  5LJ5 j;  5GAN g;  4M77 A;  3RES A;  5GAN 7;  4EMK A;  4EMG A;  1BIA A;  1WQ7 A;  1M8V A;  2DXT A;  3JCM h;  5GAO q;  2I2L A;  3L2Z A;  3JCM V;  3JCM X;  5GAM d;  4DQ2 A;  1Y96 A;  4J5Y A;  4NOY A;  4XTX A;  3V8J A;  4C8Q D;  4F7U A;  3INZ A;  3V7C A;  4M7D G;  1LNX A;  1YCY A;  4M7A B;  5GMK l;  3JB9 J;  2RD1 A;  2DJZ A;  3EFR A;  4C92 F;  5GAM g;  4PJO B;  1M5Q 1;  1U1T A;  4M78 D;  2RB6 A;  4QVC A;  2VC8 A;  5LJ3 e;  4HT8 A;  1I8F A;  5LJ3 f;  5GAN d;  2E64 A;  2HNI A;  4PJO E;  3RKW A;  5LJ3 d;  4F7U G;  1WNL A;  5GAN f;  4M78 G;  4M75 C;  5GAM f;  3GIB A;  4HA8 A;  4M7A D;  3JCM Q;  3JB9 H;  2E10 A;  2QTX A;  5GAM j;  4C92 D;  4XTZ A;  3RER A;  5GMK e;  2EJG A;  1I4K 1;  4EMK C;  4M77 C;  2DKG A;  5GAO n;  5GAN j;  3HFN A;  4M78 A;  5GMK m;  3AHU A;  5DY9 A;  2YLB A;  4C92 E;  4M7D D;  1MGQ A;  3SWN C;  4C8Q E;  4V2S A;  1N9S A;  3JCM g;  4C8Q A;  4OP0 A;  4XTY A;  4PJO G;  5LJ3 h;  3SWN B;  4JRI A;  1KQ2 A;  3RUX A;  3JCM f;  4X9D A;  4XU1 A;  5GMK h;  4NL2 A;  4M78 B;  5GAN 6;  1U1S A;  4M7D E;  3V8L A;  4XQ3 A;  3JCM e;  4M77 G;  4F7U F;  2VXF A;  4M78 F;  4JLI A;  4M7D F;  5GAN 3;  1X01 A;  4JUV A;  4C92 A;  4C8Q C;  2E41 A;  1HXD A;  2RA2 A;  5LJ5 h;  4C8Q F;  1BIB A;  1D3B B;  3SWN A;  5GMK i;  1WPY A;  2EAY A;  5GAO m;  3JB9 F;  4M7A A;  1D3B A;  2EJ9 A;  1LOJ A;  1B34 A;  4MML A;  3PGG A;  4M78 C;  3V8K A;  3JB9 I;  4HT9 A;  3QHS A;  2VXE A;  3V7R A;  4M7A F;  4PJO C;  1JRI A;  4RCB A;  4M75 D;  2FYK A;  3FB9 A;  1HK9 A;  5I21 A;  3L1A A;  3VU3 C;  2FB7 A;  1Y96 B;  4A53 A;  5GAN 5;  4M75 G;  4M7D A;  2JN0 A;  4M75 A;  4N0A C;  4XU2 A;  2DVE A;  4M77 E;  4M75 E;  1H64 1;  4M75 B;  4M77 B;  3JB9 D;  5LJ3 g;  5LJ5 d;  5GAN 8;  4N0A A;  4Y91 A;  4M77 F;  3RKY A;  4M7D C;  3V7S A;  5GAN h;  4J6X A;  4M7A E;  5GMK j;  2EJF A;  3SB2 A;  5GAM e;  4C8Q G;  2DZC A;  5CAI A;  3RIR A;  5LJ5 e;  4XTV A;  4A54 A;  4WF2 A;  4C92 G;  4PJO A;  5GAN e;  2DTH A;  3FIF A;  4XTU A;  1B34 B;  4QVD A;  3JCM P;  3BW1 A;  4M7A C;  1LJO A;  1N9R A;  2DXU A;  2K57 A;  5GAO l;  1WQW A;  3HFO A;  3QUI A;  5GAN 2;  3JCM c;  4C92 C;  2ZGW A;  2RM4 A;  4XU0 A;  3BDU A;  4J6Y A;  3FJP A;  3JB9 G;  5GAN 4;  3BY7 A;  4XTW A;  3M4G A;  2YLC A;  4F7U E;  5GAO p;  4M77 D;  3JCM J;  4M78 E;  1KQ1 A;  2DTO A;  5GAM h;  4M7A G;  4M7D B;  2EWN A;  5GAO r;  4X9C A;  5LJ5 f;  4PJO D;  4XU3 A; 
#chains in the Genus database with same CATH topology
 2MOX A;  2JS2 A;  3HP9 A;  2X9H A;  2A3L A;  3I5S A;  3MEV A;  1ZSZ B;  2CGH A;  5LJ3 j;  2DZ9 A;  2K3X A;  3S3O A;  3MO8 A;  4N4H A;  4L6V 5;  3OS0 A;  2GNC A;  3TSZ A;  1X43 A;  2RJE A;  2VC8 A;  2VGM A;  3HTR A;  2RQR A;  4OMQ A;  3VRZ A;  1YIJ T;  1M27 C;  4DBQ A;  1AVZ C;  5IAY A;  3H0H A;  2L3S A;  1Q82 C;  1NM7 A;  4ATO A;  1ZSG A;  1R0C B;  2VWF A;  2K5F A;  4CC2 A;  2XKO C;  3ULR B;  4JZ4 A;  4NL2 A;  2XDD A;  1M1F A;  1NPR A;  4CC7 A;  5CKD A;  3JCM e;  2KT8 A;  3VS3 A;  3EGX B;  1EIF A;  2QXF A;  1BIB A;  4MML A;  1D1C A;  1G83 A;  3PGG A;  3EHQ A;  2CSI A;  3L2Q A;  5DLO A;  1YCS B;  4M75 D;  1TU0 B;  1X27 A;  5GAN 5;  2O88 A;  4M75 E;  1K73 R;  3VUZ A;  1X6O A;  5LJ3 g;  3QYH B;  3EG9 A;  1B7T A;  1WFW A;  2E5Q A;  4J9B A;  5GAM e;  4HVV A;  1KJW A;  2JTE A;  2E5K A;  3A5Z B;  3OYF A;  1YIT A;  3BW1 A;  2KSS A;  3M57 A;  3R6O A;  1KC8 R;  4C0F A;  4E7K A;  1VQO Q;  4L59 A;  1FYN A;  2EPD A;  2J6F A;  2HD0 A;  2Y4X A;  3CC2 T;  5FWB A;  3CCU T;  2IPO B;  1PCX A;  3R6N A;  4F16 A;  3CCV Q;  5AT1 B;  1YJ9 T;  3OYC A;  5GAN j;  3JCM d;  3CCJ Q;  2M0O A;  3PNW C;  3LX7 A;  2K5L A;  1BIA A;  3JCM h;  2RHZ A;  3V8J A;  4F7U A;  1X2K A;  3G7Z A;  4OGC A;  1IXD A;  1I8F A;  2RHI A;  4R55 A;  4KH1 B;  1VQ7 Q;  2VB6 A;  5GAM j;  3RER A;  3KXT A;  1VQ7 A;  4AT1 B;  2SEM A;  1WYX A;  1UEB A;  2NUZ A;  5KYU A;  4RTU A;  1NE8 A;  1SEM A;  4II1 A;  1W2B S;  2MK5 A;  4GLK A;  1FWZ A;  2DBK A;  5KH6 A;  2J6K A;  4X9D A;  2RH2 A;  2KYB A;  3UDC A;  4XQ3 A;  5FU7 B;  4M7D F;  3RR6 A;  4C92 A;  1VYU A;  3EFO A;  1WPY A;  2JM8 A;  4B6M A;  1ZA1 B;  3CCM T;  1VYV A;  1M30 A;  3RNJ A;  3J7A F;  3VU3 C;  2QK0 A;  4KUL A;  1Y57 A;  2WAC A;  2FO0 A;  1R77 A;  1PD0 A;  1NG2 A;  2FRW A;  3GF5 A;  4XAX B;  3QDR B;  1BB9 A;  2M16 A;  1YI2 Q;  2DET A;  2DL3 A;  4OB0 B;  2D1X A;  5IT9 E;  1UGR B;  1GFD A;  4J9D A;  1PNJ A;  2X35 A;  4BY6 B;  4J9G A;  2OTJ A;  3O8V A;  2KI7 A;  3QZ9 B;  8ATC B;  4F7U B;  3QSU A;  3CCJ A;  3CCR T;  4FW1 A;  1TH7 A;  2MI6 A;  2XDP A;  2RJF A;  3CCS T;  1SPK A;  2C0T A;  4PJN A;  2FPE A;  2CZ7 B;  3QXE B;  3CC4 T;  1Y96 A;  5FW9 A;  2EGC A;  1K9M C;  1RAG B;  3MHX A;  1XTD A;  1GCQ C;  4A63 B;  2QYZ A;  4OMN A;  1WNL A;  1W4S A;  4F7U G;  5GAM f;  5J26 A;  1D0Z A;  3JCM Q;  1WHM A;  3CMA Q;  2QTX A;  4C92 D;  4E7J A;  1RAB B;  2A0F B;  1UJY A;  2O4X B;  4LDU A;  3GP8 A;  3DB3 A;  3D7S B;  4C92 E;  3GLX A;  3NTK A;  4JRI A;  2CT3 A;  3CC2 A;  1WHL A;  3CMA A;  4Y92 A;  2DX1 A;  2LX9 A;  4JUV A;  1K76 A;  2K5I A;  2A7Y A;  3SWN A;  1D3B B;  1KC8 U;  3CME A;  2LRQ A;  1M3C A;  1OZ3 A;  1I1J A;  4A4F A;  1QVF A;  2ROL A;  2J05 A;  1QVG A;  2IVW A;  2OI3 A;  2DLP A;  1IRE B;  4KGZ B;  1YJW A;  2DMO A;  1PC0 A;  5CKH A;  5KYY B;  4D8D A;  3MEA A;  2O2O A;  2L3P A;  1K9A A;  3RDV A;  3OS1 A;  1UEC A;  5D7U A;  2V1R A;  3Q1J A;  4YTL A;  4D6W A;  1VYT A;  1WHG A;  5GAM h;  4M7A G;  1JJ2 A;  4IIM A;  1N8R U;  2M0Y A;  2JMC A;  3I56 T;  4ESR A;  4PNO A;  4QQ6 A;  1PRL C;  1W2B A;  2E65 A;  2MYS A;  3M0T A;  5GAN 7;  2C0I A;  1VQ6 Q;  2RK2 A;  4Z89 A;  1K0S A;  4NOY A;  4XTX A;  4OVA A;  4M7A B;  3G6E A;  2K2M A;  1FMK A;  5LJ3 e;  1VQ8 Q;  4E7S A;  1D1A A;  3SDZ A;  4M78 G;  4HA8 A;  4Y28 E;  3TSW A;  1VQP T;  5HY6 A;  1NYG A;  1PKT A;  3G71 Q;  4DBH A;  2JVV A;  3VS4 A;  1PD1 A;  3NTI A;  3SWN B;  1ZA2 B;  4MDW A;  2CP5 A;  4XU1 A;  2HCK A;  4M78 B;  2YRC A;  1AOJ A;  4QVZ A;  1M90 R;  1G3T A;  3URG A;  1VQ5 Q;  3A8G B;  4RG8 A;  2GFU A;  9ATC B;  3TQ7 P;  2C06 A;  1U06 A;  2E41 A;  2F69 A;  2RA2 A;  1AWJ A;  4MZT A;  3JB9 F;  3J81 E;  1U3O A;  1VIF A;  2RJC A;  3V7R A;  2DVJ A;  5CKF A;  2AZS A;  2GCX A;  2AHJ B;  1Q7Y U;  5GJW B;  4M75 G;  6AT1 B;  1YP5 A;  4C0G A;  4AMC A;  2PUK B;  1MMA A;  3OYA A;  4O6J A;  4LXC A;  5GAN h;  1J3T A;  3WVD B;  3SB2 A;  2LX7 A;  3DKM A;  1U5S A;  1HSQ A;  4C92 G;  2DYB A;  3FIF A;  3HPW A;  1B34 B;  4HXJ A;  3CD6 Q;  2CP0 A;  3CEY A;  2DXU A;  2EIF A;  2X3X D;  4BE0 A;  3DB4 A;  3REB B;  1AWO A;  2ZCF B;  2F5T X;  3QG1 A;  4DBF A;  2DPP B;  4PLI A;  1CKA A;  2YDL A;  4RTY A;  1EX4 A;  4RTZ A;  4OMP A;  3J80 E;  2QA4 Q;  1JJ2 P;  1W70 A;  4C5E A;  4NL3 A;  2MIO A;  3OS2 A;  3VS1 A;  1YI2 T;  4C5H A;  4O5V A;  2FRY A;  4E7H A;  2HBW A;  1UDL A;  2FPF A;  3OYI A;  2CSQ A;  3OMG A;  2KVQ G;  3M0S A;  3X25 B;  1YCY A;  1OPK A;  2PVO B;  3FDR A;  1U1T A;  2RB6 A;  4N4I A;  5FRN A;  3RKW A;  1S72 A;  2CZ0 B;  1D0Y A;  2CZ1 B;  3CCM Q;  1K9M U;  1MV0 B;  1K0X A;  1Y0M A;  3CXC S;  2HEQ A;  3C95 A;  2NYS A;  5KYN A;  1I4K 1;  1QVG P;  2AKL A;  2ZPH B;  1Y07 A;  2ABL A;  2KXC A;  4FL6 A;  2LJ1 A;  3VS7 A;  4C8Q A;  4KGX B;  3VYH B;  4RUG A;  4OMF B;  1H92 A;  4RTX A;  3OYN A;  2RQW A;  1B07 A;  4F04 B;  1K73 C;  1NEG A;  1MMN A;  2HMA A;  2LCC A;  1VQ4 A;  2RNA A;  1R8O B;  2B86 A;  4C8Q C;  3OQ5 A;  5GMK i;  2CUB A;  2D0Q B;  2KR3 A;  4BD3 A;  2VXE A;  1BI2 A;  1QVP A;  4CC4 B;  1QCF A;  1VQ7 T;  1UHF A;  3L1A A;  1HJD A;  2DVE A;  4EDU A;  3JB9 D;  1WHJ A;  1U8R A;  4E2F B;  4C0D B;  4M77 F;  4M7D C;  3M55 A;  1BCM A;  4CC3 A;  2GTJ A;  1RAE B;  1QMC A;  2EJF A;  2XU8 A;  2YUP A;  3BDL A;  1YJ9 Q;  5HKC A;  3JCM P;  3CCV T;  1VQL Q;  2HAX A;  5L23 A;  2CP2 A;  3QUI A;  3UA7 A;  2DE0 X;  3BDU A;  3CCE A;  4QT7 A;  2JT4 A;  2K6D A;  2YUQ A;  3N5B B;  1NPP A;  1IZ6 A;  2RN8 A;  2D9T A;  2VUB A;  4OF1 A;  4P5N A;  3SHW A;  1M1K R;  4KGV B;  4C8Q B;  3VRY A;  4PJO F;  2BZY A;  1TUG B;  3QZ5 B;  2Y90 A;  4JLG A;  3MKD A;  2BZ8 A;  2P0K A;  4EMK A;  3OW2 P;  3I56 A;  1M8V A;  1RL2 A;  1ZBJ A;  1K4U S;  1C0M A;  1K8A R;  1QKX A;  3NTH A;  4BI8 B;  2R58 A;  3OBW A;  2COY A;  3UPU A;  2COW A;  3UT1 A;  1WI7 A;  1MMD A;  4FM4 B;  2KBT A;  2XD0 A;  2WSE E;  2FPD A;  4PK4 A;  2EYX A;  1WIE A;  3CCQ T;  1BBZ A;  2DYI A;  3CC7 A;  4ZN1 A;  5DLQ E;  3A8O B;  5M9O A;  1MGQ A;  3A8L B;  3RBB B;  2BIV A;  4ZNX A;  3FC3 A;  1JEG A;  3TRE A;  3OSS C;  1VQK A;  3PMI A;  3S3N A;  1PRM C;  1PM3 A;  1A0N B;  1G5V A;  4D8K A;  5IXB A;  2A37 A;  2YUO A;  1XOV A;  4C5G A;  2E6Z A;  2BUD A;  2DXB A;  2HL5 C;  1YIJ Q;  3CD6 T;  2X4J A;  4TVR A;  1EZZ B;  1SHF A;  3OYK A;  1ZUY A;  2YXY A;  4M77 B;  4N0A A;  4Y91 A;  1IGQ A;  4Z88 A;  3EAE A;  3QBY A;  3MEU A;  5IHK A;  1OUL A;  2CP6 A;  1VQM T;  2DZC A;  3JRZ A;  4WF2 A;  2LCS A;  1LJO A;  1XJW B;  3X28 B;  3VS2 A;  1HD3 A;  3M0R A;  1K9M R;  2K2V A;  2NWM A;  1H3Z A;  2VKN A;  2CZ6 B;  3CXC A;  2QGF B;  4X9C A;  4PJO D;  4AG1 C;  3CC7 T;  2C0O A;  2IG0 A;  1QCN A;  2FZC B;  2MPX C;  4IUP A;  1JBM A;  1RAD B;  1E6H A;  1WQ7 A;  1KSW A;  1UTI A;  4DEX A;  2I2L A;  5GAO q;  5A0G A;  4BDY A;  1ACM B;  2NUP B;  2DEU A;  3MP6 A;  4M7D G;  1OZ2 A;  2R5A A;  3INZ A;  1KC8 C;  2KK4 A;  4ZN3 A;  2FHD A;  2QQA A;  2V1Q A;  3OYM A;  3H9N A;  4A4G A;  3OYB A;  1NZ9 A;  1SG5 A;  3E9G A;  3JB9 H;  2KRM A;  3CCL Q;  4J8O A;  1VQ8 T;  3HKS A;  3CME T;  1VQK Q;  3UF4 A;  5GAO n;  3E19 A;  3OYH A;  2QEX Q;  1BI0 A;  3HFN A;  4A4E A;  1Q7Y C;  2YLB A;  2FG0 A;  1VQ6 T;  2B8A A;  4Z02 A;  5KE2 A;  3GNF B;  1NYF A;  3G6E Q;  2ECZ A;  3RUX A;  3QDF A;  1GFC A;  1XQH A;  4NS5 A;  1QWE A;  4AG2 C;  5C6S A;  4KT0 E;  4FCY A;  4DA4 A;  5HCK A;  2VV5 A;  3P8D A;  2EAY A;  2KDS A;  3T9N A;  1YBY A;  2E6N A;  1IHW A;  3M59 A;  4KBM B;  2F1L A;  1AHJ B;  2ZAE A;  3EG3 A;  3E2U A;  1VQ9 T;  1BCO A;  2LC4 A;  1XNI A;  1KK7 A;  1M3A A;  4M77 E;  1N5Z A;  2AIR B;  4M75 B;  1AD5 A;  2JM9 A;  5LJ5 d;  1VQN T;  3RKY A;  3CPF A;  2P4R A;  1LVK A;  4HCC A;  3CCS A;  3OW2 A;  5J39 A;  4HCK A;  2ROT A;  1Q81 U;  4XTV A;  2K4Y A;  1RAA B;  2DTH A;  1KFZ A;  4QVD A;  2KT1 A;  4E7I A;  1X6B A;  3UAT A;  2PU9 B;  2LQ8 A;  2RM4 A;  2FZK B;  3A1P A;  5CCA A;  2CH4 W;  4J9E A;  2PZ1 A;  3X24 B;  5GAO r;  2NUP A;  1PHT A;  3RKX A;  1I81 A;  4JJC A;  3OMC A;  2E3I A;  2X4W A;  4KRT A;  1WJR A;  3BFM A;  2ED0 A;  3CC4 A;  2VVK A;  2W10 A;  4EMG A;  4LDW A;  3CPW S;  2EQU A;  3DLM A;  2EKH A;  5IN1 A;  5KYW A;  4C8Q D;  4UC4 A;  2LZ6 B;  2KXD A;  2DJZ A;  1Z9Z A;  4C92 F;  5FU7 C;  3LW5 E;  2RI2 A;  2XHC A;  4OGE A;  4M75 C;  5KCO A;  1BK2 A;  3VKI A;  2QQR A;  5ECA A;  1WJQ A;  2M9U A;  1QLY A;  4GLM A;  5D6W A;  2QEX A;  3X26 B;  1MV3 A;  2DA9 A;  4FIB A;  5DY9 A;  4M7D D;  1D09 B;  2OTJ Q;  2GTO A;  4C8Q E;  3JCM g;  2RQU A;  3CCS Q;  1M1K C;  1QVG S;  2QGG A;  3CCR Q;  1T0H A;  4OMO A;  5KYX A;  5FRM A;  1QP2 A;  1WHH A;  2E4H A;  4OB3 B;  2HQX A;  1VQ4 Q;  3M0P A;  2ENM A;  4DBR A;  4HT9 A;  2ZPB B;  4M78 C;  1ZUK A;  2RHY A;  1VOM A;  2V8I A;  4FU6 A;  3EGD B;  5DM7 R;  3LWI A;  1MND A;  3NGP A;  4M7D A;  1MNE A;  2JOY A;  3EH2 A;  1JB0 E;  1TUC A;  4QKU A;  1UHC A;  4Z8A A;  4WCI A;  2XMF A;  3GPL A;  5KYW B;  4F17 A;  4CRI A;  4IUR A;  1I5O B;  2QA4 T;  1UB4 A;  1OV3 A;  1H8K A;  4XK8 E;  4JS4 A;  2ZGW A;  4Q5W A;  3BY7 A;  1ZLM A;  3VS5 A;  4JRQ A;  2YLC A;  3LYI A;  3JCM J;  4FYV B;  2EKO A;  1VQ4 T;  3SEM A;  2QAS A;  3KUF A;  4MDX A;  2YHT A;  2MWP A;  2DXC A;  2GBQ A;  2L89 A;  3L2R A;  1YI2 A;  4EMK B;  2Z0W A;  2P0P A;  1OU8 A;  4JPB W;  1Q86 U;  2CP7 A;  4J83 A;  2PQW A;  2F2V A;  1VA7 A;  4LDY A;  2NUT A;  5GAM d;  3MCA B;  1G3Y A;  1ZSZ A;  1QP3 A;  3V7C A;  3A8H B;  2HSP A;  1N8R R;  2RD1 A;  1BI1 A;  1UGP B;  3EH1 A;  3CCU A;  4PJO E;  1YWP A;  4BI3 A;  2EYQ A;  4OB1 B;  2E10 A;  3VS6 A;  2QA4 A;  2D8J A;  2JJ9 A;  2EVR A;  2ZZD A;  2K3B A;  2MCN A;  1M2O A;  2L8D A;  1WJS A;  1Q82 U;  3CXC P;  2DM1 A;  4OP0 A;  5I2S A;  2EGE A;  2PTK A;  1TXQ A;  2ZPE B;  2J06 A;  4ZGJ B;  1NBE B;  2V8J A;  3QWX X;  3V8L A;  1SSH A;  3EGD A;  1PWT A;  4M78 F;  2EGA A;  2GFA A;  5CK9 A;  3C0C A;  2HQE A;  5GAO m;  2H3J A;  2YT6 A;  2E12 A;  3OYG A;  1VQP Q;  4JDS A;  4RCB A;  1YN8 A;  2EBP A;  1ABO A;  3FB9 A;  4RTT A;  1QVF S;  2QQB A;  4FW2 A;  3NHN A;  5FU6 C;  3OBY A;  2I0N A;  3OB9 A;  3NPF A;  1MHN A;  1NLO C;  1VQN Q;  2CYZ B;  3V7S A;  5LL6 S;  1SSF A;  2BKD N;  3I56 Q;  1OQK A;  3CQT A;  1W2B P;  3KBG A;  2D6F A;  2HKQ B;  1N9R A;  3JV3 A;  3TCJ A;  2SRC A;  2F2W A;  5GAN 2;  3I35 A;  4C92 C;  4B9W A;  3CBM A;  2YUN A;  4FYY B;  4M78 E;  1KQ1 A;  3P8H A;  1TTH B;  1YJN A;  5LJ5 f;  3HSB A;  3M5A A;  5CVI A;  2WSF E;  2D0N A;  2QQS A;  2DRK A;  3EFS A;  2X4X A;  4BE2 A;  4MMK A;  2DEQ A;  4A4H A;  2KEA A;  1FX7 A;  3JSC A;  4E7Z A;  1VQ8 A;  4OB2 B;  2LQW A;  3L2Z A;  3JCM V;  4C0Z A;  3JCM X;  2LTO A;  4RG2 A;  2QEX T;  5D6X A;  3UA6 A;  1VQK T;  3CME Q;  4HT8 A;  2OAW A;  1KD1 R;  2PVD B;  4HKE A;  3CCL T;  2XDB A;  1TUD A;  3OYE A;  4CI0 C;  4LD9 K;  4M7A D;  2DFU A;  1FXX A;  1R0B G;  3CPW P;  4DOV A;  1ZX6 A;  2MMP A;  2KRN A;  4M4Z A;  4R0K A;  4IUU A;  2KY9 A;  1WA7 A;  1PSE A;  1D0X A;  1RI9 A;  5KYY A;  2XG8 D;  4PJO G;  1PKS A;  1BI3 A;  2A36 A;  2AT1 B;  4RTV A;  1GBQ A;  4L5G A;  3H41 A;  3CC7 Q;  2O31 A;  1VUB A;  5GMK h;  3H6Z A;  5KYU B;  2RJD A;  2DER A;  4A4K A;  5FRO A;  2G6F X;  5GAN 3;  3I55 T;  8AT1 B;  1GXI E;  2JS0 A;  2QDL A;  2K79 A;  3CCE Q;  4BI4 A;  3JB9 I;  2YRD A;  1YJW Q;  2LNV A;  1HYO A;  1UUE A;  3HRS A;  4N4G A;  3C12 A;  3NFC A;  2FYK A;  1HK9 A;  1OPL A;  1YJ9 A;  4PFZ A;  3LH5 A;  1VQM Q;  4M75 A;  4XU2 A;  5I2M A;  1W6X A;  1UGV A;  3E1S A;  1RAC B;  2OTL A;  3PIO A;  1EFN A;  1LCK A;  4LNP A;  4BAC A;  4PFO A;  1VQ9 A;  3RIR A;  4E47 A;  4A54 A;  1X69 A;  2RQT A;  4BDZ A;  2HZY A;  2LJ3 A;  2V26 A;  4LD6 A;  3C4S A;  3FJP A;  2O9S A;  2W0Z A;  1BU1 A;  3L2V A;  1VQP A;  2EQJ A;  2JZ2 A;  2FEI A;  2GGR A;  2L3Q A;  4XU3 A;  4FSS A;  3IQL A;  1M2V A;  4JRK A;  1ZBX A;  2OX7 A;  1BYM A;  2HKN A;  3JCM b;  3PVL A;  3QJ6 A;  1RAH B;  1SHG A;  1MUZ A;  1NJI U;  3G1J A;  2CS7 A;  5D6Y A;  3CCQ Q;  2A08 A;  1NEB A;  3EHR A;  2K7A A;  4M78 D;  2DL5 A;  1FMW A;  5LJ3 f;  5GAN d;  2HNI A;  4J9F A;  2QQ9 A;  4IIO A;  2LJ0 A;  3QII A;  4KH0 B;  1ZSZ C;  2LP5 A;  4XTZ A;  5GMK e;  4ELZ C;  4ZGE B;  1YHQ A;  1F1B B;  2QI2 A;  3LGF A;  2YSQ A;  2RO0 A;  2F2X A;  2RI5 A;  2ZPG B;  2JTF A;  1N27 A;  4V2S A;  4OMM A;  2AKK A;  3HL8 A;  5IHI A;  3OYJ A;  1G3W A;  1AWW A;  1U1S A;  2HBP A;  2L2P A;  1RAF B;  3C94 A;  2H3E B;  1VQ6 A;  1P92 A;  1N8R C;  4C8Q F;  3WXM B;  3JAM E;  3PIP A;  1CSK A;  3QHS A;  5J3B A;  1TWB A;  1YNZ A;  1VQL T;  2X51 A;  2QDY B;  1C1A A;  2LNH B;  1LPL A;  2L3R A;  4WTO B;  1RUW A;  1VQ5 A;  1JXM A;  1AWX A;  4BY6 C;  5GAN 8;  5IXF A;  4FSX A;  2KRO A;  5GMK j;  3F70 A;  4ELY C;  3VYG A;  5CAI A;  5LJ5 e;  3H8Z A;  1OOT A;  1KD1 C;  3QWY A;  2L5Q A;  1D1B A;  3G4S T;  1O9S A;  3CCU Q;  4KUD K;  2J7I A;  2JMA A;  2YRV A;  1K8A U;  3M4G A;  1YIT Q;  2EYY A;  2DTO A;  2BE7 D;  4HVW A;  5L8R E;  2EYZ A;  3VUB A;  3ASK A;  3QPH A;  3EG9 B;  1AEY A;  2FZG B;  3G4S Q;  2KMT A;  2M02 A;  3EG0 A;  3QO3 A;  1M1K U;  3MP1 A;  4BE1 A;  2YWW A;  2KYM A;  2LT1 A;  1OEB A;  4ZTF A;  2FVU A;  2DXT A;  5A0L A;  3OYL A;  1JQQ A;  2EQM A;  1W1F A;  4J5Y A;  1IRX A;  2A28 A;  2DO3 A;  1S72 T;  3PFS A;  3EFR A;  2QAZ A;  1ZQ1 A;  4J9I A;  1M9S A;  4AFS C;  2OJ2 A;  5IHN A;  2AK5 A;  2CDT A;  2LT4 A;  5C0M A;  4M77 C;  1UGQ B;  1M4Z A;  4M78 A;  1CKB A;  1ZHI A;  3VJP A;  1Q86 R;  1VQO A;  3RMQ A;  1M1G A;  2VAS A;  3TVT A;  5EG2 A;  4J7I A;  3EGU A;  4M7D E;  1OX8 A;  1RI0 A;  4ANJ A;  3HRT A;  1GBR A;  2VXF A;  4JZ3 A;  5CQY A;  3PE0 A;  1Z9Q A;  2KE9 A;  2ZPI B;  1M3B A;  3NMZ C;  4GY5 A;  2XID A;  3TU4 K;  2COZ A;  1QKW A;  4M7A F;  2L0A A;  1B3Q A;  2LDM A;  2PNI A;  2FB7 A;  3OA6 A;  2JTM A;  2DL7 A;  4PFP A;  2RHU A;  5KE3 A;  1H64 1;  2RI3 A;  2CRE A;  4VUB A;  1QVF P;  2JXB A;  1WDX A;  4J6X A;  2ED1 A;  3FEO A;  4X1V A;  2LCL A;  3EFO B;  5IH2 A;  1T3S A;  5CO7 A;  2KAF A;  1VIE A;  4LDV A;  3H0I A;  5CIU A;  2IIM A;  2DJQ A;  2NLU A;  1WQW A;  3GOX A;  1TOV A;  3QJY A;  3OW2 S;  3JB9 G;  1Q81 C;  2DIQ A;  2XI9 A;  2BE9 B;  4M7D B;  3ER0 A;  1SF9 A;  1VQN A;  1PG5 B;  3OSV A;  3CCL A;  4ME7 A;  1V1C A;  1IB8 A;  4J6W A;  1VQ5 T;  3QKJ A;  2LVM A;  4FT4 A;  1I5L A;  2DIL A;  1Q95 G;  2QTV A;  3SFM A;  4RCC A;  5LJ5 j;  4OML A;  3SD4 A;  3ZEH A;  1JO8 A;  2PUO B;  4JS5 A;  2BZX A;  1JXO A;  1QCO A;  3G71 T;  5GMK l;  1O75 A;  3L2U A;  4MZM A;  4JJD A;  2DNU A;  2KRS A;  3QYG B;  4RTW A;  3OYY A;  4AFZ C;  2JW4 A;  3PVQ A;  3CCE T;  2X3W D;  4IUV A;  2EJG A;  1YHQ T;  2DKG A;  1OI1 A;  3I55 Q;  5GMK m;  2BTT A;  4JJN K;  3ME9 A;  2OAU A;  1KQ2 A;  2MWO A;  2P0Q A;  1X6G A;  5GAN 6;  4JLI A;  1WXT A;  5GJV B;  1WHK A;  1X01 A;  5FWC A;  4DOW A;  4M7A A;  1PSF A;  1WXB A;  3CBO A;  4PJO C;  1N6A A;  2NUT B;  4ORZ A;  4PL6 A;  1Q82 R;  1YIJ A;  2EYW A;  3WVE B;  2J6O A;  4QQG A;  4N0A C;  3U23 A;  1KIK A;  3PTA A;  2O01 E;  1TSF A;  2DBM A;  2DK3 A;  4HVU A;  3M4Y A;  1X75 C;  4EPC A;  4XTU A;  5KCH A;  2Y4Y A;  1VQM A;  1SRM A;  3E9F A;  2EW3 A;  4PJM A;  3UWN A;  4JRP A;  1UG1 A;  1E6G A;  2M51 A;  3M9Q A;  1K1Z A;  1KHC A;  3MJX A;  1BKB A;  5I22 A;  3JCM W;  2KNB B;  5LJ5 g;  4C92 B;  3I9Q A;  2E1H A;  5CKB A;  4PKC C;  2P84 A;  5HK0 A;  1ARK A;  1KQS S;  1RLQ C;  2OTL Q;  1C6V X;  3OY9 A;  3M53 A;  2E70 A;  3M58 A;  4QQD A;  4ZGD B;  3JB9 J;  4QVC A;  1YFN A;  2WSC E;  5I11 A;  3CMA T;  2P4T A;  5LJ3 d;  5GAN f;  1S1N A;  1WZO A;  2DAQ A;  4KUI A;  4AFQ C;  1OYX A;  4HCB A;  1KQS A;  5CQX A;  2KGT A;  4X34 A;  3CC4 Q;  3AHU A;  4DEY A;  1N9S A;  3M0Q A;  4XTY A;  2RPN A;  3ZBD A;  1UJ0 A;  3AT1 B;  3EG2 A;  2QG9 B;  1GRI A;  1K8A C;  1SRL A;  3EGX A;  2CH4 A;  1HXD A;  2HDA A;  3S6W A;  1MMG A;  2X4Y A;  5LJ5 h;  4MZP A;  2K9G A;  3V8K A;  1Y7X A;  2O9V A;  1OU9 A;  4IUQ A;  1UE9 A;  5I21 A;  4J7F A;  1Y96 B;  4K11 A;  1YJN T;  2DRM A;  1ZUU A;  2JN0 A;  3VV0 A;  3CPW A;  1AZG B;  3FRN A;  2M1H A;  4HCZ A;  5CR2 A;  1I07 A;  1V76 A;  4PLL A;  1GL5 A;  2O4X A;  1QWF A;  1RLP C;  2MF2 A;  5GAN e;  4C5I A;  2K57 A;  1JJ2 S;  2F5K A;  2DL4 A;  1GCP A;  4XTW A;  5GAO p;  4M77 D;  2PVG B;  3S3M A;  2KQW A;  3MET A;  3G4S A;  1QQJ A;  5GAN g;  5KYX B;  2RHX A;  3RES A;  3CCR A;  2EFI A;  1TS9 A;  1Y71 A;  1IGU A;  5EC7 A;  2HSE B;  2V8K A;  1Q81 R;  1AT1 B;  1LNX A;  3MEW A;  3PMT A;  5GAM g;  1M5Q 1;  1YJN Q;  3P8B B;  2E64 A;  3I5R A;  4FYX B;  1Q7Y R;  1VQL A;  3FLG A;  2LQN A;  3MPU B;  1KHI A;  1T0J A;  1S72 Q;  3O5Z A;  2FL7 A;  4FT2 A;  5CKE A;  3SWN C;  3LH0 A;  5LJ3 h;  2LQK A;  3RMS A;  3JCM f;  3CCJ T;  3OYD A;  1I0C A;  1ABQ A;  4JJB A;  3M54 A;  3MP8 A;  4F7U F;  2OTJ T;  3BE3 A;  2VYT A;  4GBQ A;  1M2V B;  3CC2 Q;  3KFV A;  3CCM A;  3LLR A;  1YIT T;  1TG0 A;  1WLP B;  1VQO T;  2EJ9 A;  1LOJ A;  1T3L A;  1KQS P;  1JRI A;  2EQK A;  2MAM A;  1Q86 C;  4EIK A;  2GQV A;  2R57 A;  3A98 A;  2RMO A;  1QW1 A;  2R5M A;  1GCQ A;  2OTL T;  1E7O A;  3GBQ A;  4M7A E;  2K3Y A;  7AT1 B;  1G2B A;  1IO6 A;  3FJ5 A;  4C8Q G;  2XIC A;  1AZE A;  4IUT A;  2E3H A;  5GAO l;  3JCM c;  2CUD A;  2LMJ A;  4J6Y A;  4BUG A;  5A2Q E;  5FLX E;  4F7U E;  5A0D A;  4FYW B;  1UGS B;  2EWN A;  3EG1 A;  4R56 A;  2DD4 A;  4M75 F;  4C0D C;  1M8M A;  2DTI A;  2DIG A;  3HHT B;  1RAI B;  4EMH A;  1SKU B;  1YWO A;  4M77 A;  4E7L A;  4LDX A;  4RMO A;  4DQ2 A;  3CCQ A;  1G3S A;  3M0U A;  2RK1 A;  1X2Q A;  1KG1 A;  2GF7 A;  4LUE A;  1KD1 U;  4PJO B;  4J9H A;  3VS0 A;  1V29 B;  1WX6 A;  1VQ9 Q;  2DF6 A;  1FMV A;  3G71 A;  1M90 C;  3GIB A;  3DLL A;  4AFU C;  3CD6 A;  5FU6 B;  1WXU A;  4ZTJ A;  4F14 A;  1H3H A;  4EMK C;  5HK3 A;  3ZL7 C;  1K73 U;  3PT9 A;  4LN2 A;  2CKK A;  1NLP C;  4E6R A;  4PJJ A;  3GNG A;  2AZV A;  4B9X A;  3HRU A;  3G6E T;  1DJ7 B;  2H8H A;  4M77 G;  3X20 B;  5AYF A;  3L42 A;  1IHV A;  2RQV A;  2XK0 A;  2VGN A;  1YHQ Q;  2ATC B;  1JU5 C;  1D3B A;  1B34 A;  3REA B;  4LUD A;  2HQH A;  3CCV A;  2JNG A;  4A53 A;  4LE9 A;  1M90 U;  3I55 A;  3TEE A;  2EQI A;  2GQI A;  4BB7 A;  3LGL A;  2DD5 A;  1NJI R;  2ESW A;  2ZPF B;  2G3R A;  3M56 A;  4QW2 A;  2CT4 A;  4PJO A;  2RF0 A;  3L2W A;  2JUF A;  4M7A C;  4PJL A;  1NJI C;  3HFO A;  3LWH A;  2CP3 A;  4IKF A;  3THK A;  1WGS A;  1OX9 A;  4XU0 A;  1YJW T;  1G8X A;  5GAN 4;  4J9C A;  3A8M B;  1UFF A;  2DL8 A;  4RKU E;  3ZFJ A;  3H0F A;  2D8H A;  3OS5 A;  3CBP A;  2HL3 A; 
#chains in the Genus database with same CATH homology
 2YHT A;  1VQ5 T;  2MWP A;  4J6W A;  3QKJ A;  3HP9 A;  2LVM A;  3J80 E;  4FT4 A;  1I5L A;  2A3L A;  3MEV A;  2DXC A;  4C5E A;  4NL3 A;  3SFM A;  3OS2 A;  2L89 A;  2CGH A;  4RCC A;  4O5V A;  4C5H A;  5LJ3 j;  5LJ5 j;  3L2R A;  1YI2 T;  1YI2 A;  2DZ9 A;  4EMK B;  2K3X A;  4E7H A;  3S3O A;  2P0P A;  3SD4 A;  1Q86 U;  3ZEH A;  4J83 A;  3MO8 A;  2PQW A;  3OYI A;  4LDY A;  4N4H A;  5GAM d;  2PUO B;  3MCA B;  3OMG A;  4L6V 5;  3OS0 A;  2KVQ G;  1G3Y A;  4JS5 A;  1QP3 A;  3V7C A;  3A8H B;  3G71 T;  3X25 B;  1YCY A;  5GMK l;  2RD1 A;  1O75 A;  3L2U A;  4MZM A;  1BI1 A;  1UGP B;  1U1T A;  2PVO B;  2RB6 A;  2RJE A;  2VC8 A;  3FDR A;  4N4I A;  2VGM A;  3QYG B;  3CCU A;  5FRN A;  3RKW A;  4PJO E;  1S72 A;  2CZ0 B;  4BI3 A;  2EYQ A;  3OYY A;  1YIJ T;  4OB1 B;  2CZ1 B;  1K9M U;  2E10 A;  5IAY A;  3CCE T;  3CXC S;  2QA4 A;  3C95 A;  4IUV A;  2EJG A;  1YHQ T;  1I4K 1;  2ZZD A;  2DKG A;  1OI1 A;  2L8D A;  1WJS A;  5GMK m;  1Q82 U;  2ZPH B;  1Y07 A;  1Q82 C;  4FL6 A;  4C8Q A;  4JJN K;  3VYH B;  3ME9 A;  4OP0 A;  5I2S A;  4ATO A;  2OAU A;  1KQ2 A;  2K5F A;  4OMF B;  2MWO A;  2XKO C;  3OYN A;  2P0Q A;  2ZPE B;  4NL2 A;  5GAN 6;  1K73 C;  4ZGJ B;  2V8J A;  2XDD A;  1M1F A;  1NPR A;  3V8L A;  5CKD A;  3JCM e;  2LCC A;  4M78 F;  1VQ4 A;  4JLI A;  1EIF A;  2GFA A;  2QXF A;  1R8O B;  5CK9 A;  1X01 A;  4C8Q C;  3OQ5 A;  4DOW A;  1BIB A;  2HQE A;  5GMK i;  2H3J A;  5GAO m;  4M7A A;  1PSF A;  4MML A;  2E12 A;  3OYG A;  2D0Q B;  3PGG A;  3CBO A;  4BD3 A;  2VXE A;  1BI2 A;  1QVP A;  4PJO C;  1N6A A;  3L2Q A;  5DLO A;  4JDS A;  4RCB A;  4PL6 A;  4M75 D;  1VQ7 T;  3FB9 A;  1YIJ A;  1QVF S;  3L1A A;  2QQB A;  3WVE B;  5GAN 5;  5FU6 C;  4QQG A;  4N0A C;  3OBY A;  2DVE A;  4M75 E;  4EDU A;  3OB9 A;  3VUZ A;  3JB9 D;  1X6O A;  5LJ3 g;  1U8R A;  1MHN A;  4C0D B;  3QYH B;  4M77 F;  3PTA A;  4M7D C;  2CYZ B;  3M55 A;  3V7S A;  2O01 E;  5LL6 S;  1SSF A;  2DK3 A;  2EJF A;  2XU8 A;  2E5Q A;  3M4Y A;  5GAM e;  2BKD N;  3CCL A;  3BDL A;  1X75 C;  4EPC A;  5HKC A;  4XTU A;  3JCM P;  3A5Z B;  3OYF A;  3CCV T;  3KBG A;  1YIT A;  2HAX A;  3BW1 A;  2D6F A;  1N9R A;  5KCH A;  3TCJ A;  2KSS A;  3M57 A;  3QUI A;  2Y4Y A;  3R6O A;  5GAN 2;  4C92 C;  1VQM A;  4B9W A;  3E9F A;  3BDU A;  4C0F A;  3CCE A;  4E7K A;  3UWN A;  3CBM A;  4JRP A;  4L59 A;  4M78 E;  1KQ1 A;  3N5B B;  1NPP A;  3P8H A;  2HD0 A;  2Y4X A;  1IZ6 A;  1YJN A;  3CC2 T;  2D9T A;  3CCU T;  5LJ5 f;  3M9Q A;  3HSB A;  2VUB A;  3M5A A;  4OF1 A;  4P5N A;  1KHC A;  5CVI A;  1BKB A;  2WSF E;  2QQS A;  4C8Q B;  3JCM W;  3EFS A;  5LJ5 g;  4PJO F;  2X4X A;  4C92 B;  4BE2 A;  1YJ9 T;  3OYC A;  4MMK A;  5GAN j;  2DEQ A;  4A4H A;  3JCM d;  2E1H A;  3QZ5 B;  2Y90 A;  1FX7 A;  2M0O A;  3JSC A;  3PNW C;  5CKB A;  4JLG A;  3LX7 A;  2P0K A;  4PKC C;  4EMK A;  2K5L A;  1BIA A;  3I56 A;  1M8V A;  3JCM h;  1RL2 A;  5HK0 A;  4OB2 B;  1VQ8 A;  2RHZ A;  3L2Z A;  3JCM V;  4C0Z A;  3JCM X;  1KQS S;  2LTO A;  4RG2 A;  3NTH A;  3V8J A;  4F7U A;  3OY9 A;  2QEX T;  3M53 A;  5D6X A;  2E70 A;  3M58 A;  4QQD A;  4BI8 B;  4ZGD B;  3JB9 J;  1VQK T;  2R58 A;  4QVC A;  4HT8 A;  3G7Z A;  4OGC A;  4MDX A;  3OBW A;  1I8F A;  2RHI A;  4R55 A;  2PVD B;  2WSC E;  4HKE A;  3CCL T;  3UPU A;  2P4T A;  5LJ3 d;  5GAN f;  3UT1 A;  3OYE A;  4CI0 C;  3CMA T;  4LD9 K;  2DAQ A;  4M7A D;  4KUI A;  4FM4 B;  2XD0 A;  1OYX A;  2WSE E;  5GAM j;  1FXX A;  4HCB A;  3RER A;  4DOV A;  2MMP A;  3KXT A;  3CCQ T;  1KQS A;  1VQ7 A;  4IUU A;  2KY9 A;  5CQX A;  1UEB A;  4ZN1 A;  3CC7 A;  4X34 A;  1PSE A;  5DLQ E;  3AHU A;  3A8O B;  1NE8 A;  5M9O A;  1MGQ A;  4II1 A;  1W2B S;  1N9S A;  3A8L B;  2XG8 D;  4XTY A;  2BIV A;  4PJO G;  1BI3 A;  4GLK A;  1FWZ A;  3ZBD A;  5KH6 A;  3FC3 A;  4L5G A;  4X9D A;  1VUB A;  2RH2 A;  5GMK h;  3H6Z A;  3TRE A;  3OSS C;  1VQK A;  3PMI A;  3UDC A;  2RJD A;  4XQ3 A;  3S3N A;  4A4K A;  5FU7 B;  1K8A C;  5FRO A;  4M7D F;  5GAN 3;  3I55 T;  4C92 A;  1GXI E;  1HXD A;  3S6W A;  2X4Y A;  5LJ5 h;  1G5V A;  1WPY A;  4MZP A;  4BI4 A;  3JB9 I;  3V8K A;  1Y7X A;  4IUQ A;  1XOV A;  4C5G A;  2LNV A;  2E6Z A;  2BUD A;  2DXB A;  3HRS A;  3CCM T;  4N4G A;  3J7A F;  3C12 A;  3NFC A;  2FYK A;  5I21 A;  1HK9 A;  3CD6 T;  3VU3 C;  2X4J A;  4J7F A;  1Y96 B;  4TVR A;  1YJ9 A;  4KUL A;  3OYK A;  1YJN T;  2JN0 A;  2WAC A;  3KUF A;  4M75 A;  4XU2 A;  5I2M A;  3VV0 A;  4M77 B;  3CPW A;  3E1S A;  3GF5 A;  2OTL A;  4XAX B;  4N0A A;  4Y91 A;  3QDR B;  3EAE A;  3FRN A;  3PIO A;  2M1H A;  3QBY A;  2M16 A;  3MEU A;  4HCZ A;  5CR2 A;  4BAC A;  1VQM T;  2DZC A;  4OB0 B;  3JRZ A;  4PLL A;  2O4X A;  3RIR A;  4E47 A;  4A54 A;  4WF2 A;  1VQ9 A;  5GAN e;  2MF2 A;  4C5I A;  5IT9 E;  1UGR B;  4BDZ A;  1LJO A;  2K57 A;  1JJ2 S;  2F5K A;  4LD6 A;  3X28 B;  2X35 A;  3C4S A;  3FJP A;  4BY6 B;  2K2V A;  4XTW A;  5GAO p;  4M77 D;  3L2V A;  1VQP A;  2PVG B;  2OTJ A;  2EQJ A;  3O8V A;  2JZ2 A;  1H3Z A;  2CZ6 B;  3CXC A;  4X9C A;  4PJO D;  4XU3 A;  3S3M A;  3QZ9 B;  2KQW A;  4F7U B;  3MET A;  3QSU A;  3G4S A;  4JRK A;  3CCJ A;  1ZBX A;  1BYM A;  3CCR T;  3JCM b;  3CC7 T;  2IG0 A;  1TH7 A;  2MI6 A;  2XDP A;  3QJ6 A;  4IUP A;  1JBM A;  5GAN g;  2RJF A;  2RHX A;  3RES A;  3CCS T;  3CCR A;  2EFI A;  1WQ7 A;  1Y71 A;  5GAO q;  2I2L A;  5A0G A;  2CZ7 B;  3QXE B;  3CC4 T;  1Y96 A;  2V8K A;  4BDY A;  1NJI U;  3MP6 A;  2CS7 A;  1OZ2 A;  2R5A A;  3INZ A;  5D6Y A;  1LNX A;  3MHX A;  1KC8 C;  3MEW A;  3PMT A;  1K9M C;  2KK4 A;  4ZN3 A;  5GAM g;  2FHD A;  1M5Q 1;  2QQA A;  4M78 D;  1XTD A;  3OYM A;  3P8B B;  5LJ3 f;  5GAN d;  2E64 A;  2HNI A;  4F7U G;  1WNL A;  1W4S A;  4A4G A;  5GAM f;  5J26 A;  2QQ9 A;  3OYB A;  1NZ9 A;  1VQL A;  3E9G A;  3JCM Q;  3JB9 H;  3FLG A;  3QII A;  1KHI A;  2QTX A;  4J8O A;  1VQ8 T;  3HKS A;  4C92 D;  4XTZ A;  4E7J A;  2O4X B;  4ELZ C;  4ZGE B;  5GMK e;  3CME T;  4LDU A;  2FL7 A;  3GP8 A;  3DB3 A;  4FT2 A;  1YHQ A;  2QI2 A;  3LGF A;  3E19 A;  5GAO n;  3OYH A;  1BI0 A;  2RO0 A;  3HFN A;  2RI5 A;  2ZPG B;  2JTF A;  4A4E A;  2YLB A;  3GLX A;  5CKE A;  4C92 E;  1Q7Y C;  1VQ6 T;  2B8A A;  3SWN C;  4Z02 A;  1N27 A;  3LH0 A;  5KE2 A;  4V2S A;  3GNF B;  3NTK A;  3HL8 A;  5LJ3 h;  2LQK A;  4JRI A;  3RUX A;  3CC2 A;  3RMS A;  3JCM f;  3CCJ T;  3OYJ A;  3CMA A;  1G3W A;  1U1S A;  3OYD A;  1XQH A;  4NS5 A;  5C6S A;  2HBP A;  3M54 A;  4M7D G;  3MP8 A;  4KT0 E;  4F7U F;  4DA4 A;  2OTJ T;  2VYT A;  3C94 A;  2LX9 A;  2VV5 A;  1VQ6 A;  1P92 A;  4JUV A;  2K5I A;  3CCM A;  1N8R C;  2A7Y A;  3LLR A;  3P8D A;  1D3B B;  3SWN A;  4C8Q F;  3WXM B;  2EAY A;  2KDS A;  3JAM E;  3T9N A;  1YBY A;  2EJ9 A;  1LOJ A;  3PIP A;  1VQO T;  1KC8 U;  3CME A;  2LRQ A;  3QHS A;  2E6N A;  1OZ3 A;  3M59 A;  1JRI A;  4KBM B;  5J3B A;  2EQK A;  4A4F A;  2MAM A;  1Q86 C;  1QVF A;  1AHJ B;  1VQL T;  1VQ9 T;  2QDY B;  2GQV A;  1QVG A;  2LC4 A;  1XNI A;  2IVW A;  2L3R A;  2R57 A;  4M77 E;  4M75 B;  1VQ5 A;  1IRE B;  1QW1 A;  2R5M A;  1YIT T;  5LJ5 d;  2OTL T;  4BY6 C;  5GAN 8;  1YJW A;  1VQN T;  3RKY A;  5CKH A;  3CPF A;  4FSX A;  4M7A E;  5GMK j;  3F70 A;  4ELY C;  3VYG A;  4HCC A;  3CCS A;  2K3Y A;  5J39 A;  3OW2 A;  4C8Q G;  5CAI A;  1Q81 U;  3MEA A;  2XIC A;  5LJ5 e;  3H8Z A;  4XTV A;  2K4Y A;  1KD1 C;  2DTH A;  4IUT A;  2L5Q A;  4QVD A;  4E7I A;  3OS1 A;  3G4S T;  5GAO l;  1O9S A;  2PU9 B;  2LQ8 A;  4KUD K;  3JCM c;  2RM4 A;  3Q1J A;  4J6Y A;  4BUG A;  2YRV A;  5CCA A;  5A2Q E;  4YTL A;  1K8A U;  3M4G A;  5FLX E;  4D6W A;  4F7U E;  5A0D A;  2DTO A;  5L8R E;  5GAM h;  4M7A G;  1JJ2 A;  1UGS B;  2EWN A;  4R56 A;  3VUB A;  3ASK A;  3QPH A;  3X24 B;  5GAO r;  1N8R U;  2KMT A;  2DD4 A;  4M75 F;  3RKX A;  1I81 A;  3QO3 A;  3I56 T;  4LDX A;  1M1K U;  3OMC A;  3MP1 A;  2DTI A;  2X4W A;  4C0D C;  2DIG A;  1WJR A;  3BFM A;  4PNO A;  3HHT B;  4QQ6 A;  4BE1 A;  2E65 A;  1W2B A;  3CC4 A;  4EMH A;  2LT1 A;  4M77 A;  4E7L A;  5GAN 7;  4ZTF A;  4EMG A;  2FVU A;  4LDW A;  2DXT A;  5A0L A;  3OYL A;  4RMO A;  2RK2 A;  2EQU A;  2EQM A;  3DLM A;  3CPW S;  5IN1 A;  4DQ2 A;  3CCQ A;  4J5Y A;  4NOY A;  1G3S A;  4XTX A;  4C8Q D;  2RK1 A;  2DO3 A;  4OVA A;  4UC4 A;  1S72 T;  2GF7 A;  4M7A B;  1KG1 A;  3PFS A;  3G6E A;  2DJZ A;  3EFR A;  4C92 F;  1KD1 U;  4PJO B;  5FU7 C;  5LJ3 e;  3LW5 E;  1V29 B;  1ZQ1 A;  1M9S A;  2RI2 A;  3G71 A;  2XHC A;  3SDZ A;  1M90 C;  4M78 G;  4M75 C;  4OGE A;  5KCO A;  3DLL A;  3GIB A;  4HA8 A;  2QQR A;  3VKI A;  4Y28 E;  3CD6 A;  5FU6 B;  1VQP T;  4ZTJ A;  1WJQ A;  2M9U A;  5HY6 A;  2LT4 A;  5D6W A;  2QEX A;  5C0M A;  4EMK C;  3X26 B;  4M77 C;  4FIB A;  1UGQ B;  1M4Z A;  2JVV A;  4M78 A;  1ZHI A;  5DY9 A;  3VJP A;  5HK3 A;  1K73 U;  4M7D D;  3PT9 A;  4C8Q E;  3JCM g;  1M1K C;  3NTI A;  1VQO A;  1QVG S;  3RMQ A;  3SWN B;  1M1G A;  2CKK A;  3GNG A;  4MDW A;  5EG2 A;  4J7I A;  4XU1 A;  4B9X A;  4M78 B;  3HRU A;  4M7D E;  3G6E T;  1RI0 A;  1DJ7 B;  4QVZ A;  1G3T A;  3HRT A;  3URG A;  3A8G B;  4M77 G;  2VXF A;  5FRM A;  4RG8 A;  5CQY A;  3X20 B;  2GFU A;  5AYF A;  3L42 A;  1QP2 A;  4OB3 B;  2C06 A;  2HQX A;  2ZPI B;  2XK0 A;  2E41 A;  2F69 A;  2RA2 A;  2VGN A;  4GY5 A;  2XID A;  4MZT A;  3J81 E;  3JB9 F;  3TU4 K;  1D3B A;  1B34 A;  4HT9 A;  2ZPB B;  4M78 C;  1VIF A;  2RJC A;  3V7R A;  2RHY A;  4M7A F;  5CKF A;  2V8I A;  3CCV A;  2GCX A;  4FU6 A;  2LDM A;  5DM7 R;  2AHJ B;  2JNG A;  2FB7 A;  1Q7Y U;  3OA6 A;  3LWI A;  2JTM A;  4A53 A;  4M75 G;  4M7D A;  1M90 U;  3I55 A;  4C0G A;  3TEE A;  2PUK B;  2RHU A;  5KE3 A;  1H64 1;  2JOY A;  3OYA A;  4O6J A;  2RI3 A;  4BB7 A;  3LGL A;  1JB0 E;  4VUB A;  2DD5 A;  5GAN h;  2ZPF B;  4J6X A;  2G3R A;  3FEO A;  3GPL A;  3WVD B;  2LCL A;  3SB2 A;  4CRI A;  3M56 A;  3DKM A;  4IUR A;  4QW2 A;  5CO7 A;  4PJO A;  2KAF A;  4C92 G;  1VIE A;  3FIF A;  4LDV A;  3HPW A;  1B34 B;  2QA4 T;  1UB4 A;  3CEY A;  5CIU A;  3L2W A;  2JUF A;  4M7A C;  2DXU A;  2EIF A;  1NJI C;  2NLU A;  1WQW A;  4XK8 E;  3GOX A;  3HFO A;  4BE0 A;  3QJY A;  3LWH A;  2XDB A;  4JS4 A;  3OW2 S;  4IKF A;  2ZGW A;  1WGS A;  3DB4 A;  4Q5W A;  4XU0 A;  1YJW T;  3JB9 G;  1Q81 C;  2DIQ A;  2XI9 A;  2ZCF B;  5GAN 4;  3BY7 A;  4JRQ A;  2YLC A;  2F5T X;  3LYI A;  3ER0 A;  3QG1 A;  3JCM J;  2DPP B;  4PLI A;  4M7D B;  3A8M B;  1VQ4 T;  2EKO A;  1VQN A;  3ZFJ A;  4RKU E;  3OSV A;  3OS5 A;  3CBP A;  4ME7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...