5GAMf

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
molecule tags Transcription
molecule keywords U5 snRNA
total genus 8
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamf00
2HNIA 5LJ3g 4NOYA 5GANf 5GANj 2DTIA 1JRIA 2DEQA 4M77A 5LJ3f 4XU1A 5LJ3j 4C8QB 2DJZA 5GANg 4A54A 5GAN8 4JRKA 1KQ1A 3HSBA 4M7DD 1D3BA 4PJOE 4M78G 3FJPA 3SWNB 4M78D 3JCMQ 3JB9G 4QVDA 5DY9A 4M7AA 1I81A 1TH7A 5GAMh 5I21A 1Y96B 2RD1A 2YLBA 4JLIA 4HA8A 4M78F 3JCMP 4M7AE 4XTVA 4M7DF 2E41A 3PGGA 3JCMX 3EFSA 3L1AA 5GMKh 5LJ5f 5LJ5j 2DVEA 4C8QC 3BFMA 4WF2A 3HFNA 2DTOA 4C92D 4M77E 3RKXA 2QTXA 3JCMf 4J5YA 3V8JA 4C8QE 5GAMd 4M7AG 1B34B 4A53A 2DXTA 4C92B 4MMLA 3BDUA 4M7AB 3SWNA 4F7UE 4M77G 3RIRA 4M75G 5LJ5d 4PJOC 3RUXA 2Y90A 3JCMc 5GAOl 4RCCA 4C92A 4M75E 4EMGA 3JB9J 4X9DA 4MMKA 4V2SA 5GAOm 4EMKA 1N9SA 1WNLA 3HFOA 4PJOB 3L2ZA 3V7CA 1N9RA 4M7AC 5GAMf 5GAMj 1JBMA 3V7RA 5GANe 5GAMg 4M7DC 4EMHA 1I8FA 2DXUA 5LJ3e 5LJ3d 3BY7A 5LJ5g 3JCMh 5GANd 5GMKi 2VXEA 1LOJA 1YCYA 1Y96A 4M75B 1HK9A 4F7UG 3JCMe 4HT8A 4PNOA 4C8QG 4C8QD 1D3BB 2VXFA 4M77D 1U1TA 4M75D 4C92C 3JCMW 3JB9F 2E65A 4HT9A 4M7DB 4N0AC 4C8QA 4C8QF 4F7UF 3RKYA 4RCBA 3SWNC 4XTYA 1B34A 2EJGA 2DZ9A 1M8VA 3QUIA 4M78C 3V8LA 2CGHA 4F7UA 3QHSA 4XU3A 4C92E 2FYKA 5LJ5e 4M78E 4M7AF 1BIAA 1H641 1WQ7A 3V7SA 5GAN6 3QSUA 4M7DE 3V8KA 5GAOr 2RB6A 3JB9H 5CAIA 5GAN5 4M7DA 2RM4A 4M7AD 1BIBA 3JCMb 2DKGA 2EJFA 3BW1A 4OP0A 5GAMe 5GAN3 4M78B 4M75A 3M4GA 5GMKj 5LJ5h 3JCMd 5GANh 3FIFA 4PJOF 5GMKe 1WPYA 3JB9D 1M5Q1 4M77F 2E1HA 4N0AA 4DQ2A 5GAOp 3INZA 4Y91A 2EWNA 4XQ3A 3EFRA 4XTUA 4NL3A 4PJOD 4C92F 1X01A 4J6WA 2FB7A 2YLCA 5GAOq 2DZCA 2EJ9A 2ZGWA 1LJOA 4J6XA 4C92G 3QO3A 4J6YA 4EMKB 5GMKl 4M7DG 2RA2A 1HXDA 2K57A 4JRIA 2JN0A 4JUVA 4F7UB 4XTZA 1WQWA 3RKWA 2DTHA 4M78A 1LNXA 1I4K1 1MGQA 4XU2A 4M77B 2YHTA 3VU3C 3JB9I 1KQ2A 3AHUA 5GAN7 3SB2A 4EMKC 3RESA 5GAN2 5LJ3h 2E10A 2I2LA 3FB9A 4M77C 3JCMg 4PJOA 4QVCA 3JCMV 5GAN4 4X9CA 4XTWA 4XTXA 3RERA 2E64A 3GIBA 4NL2A 2EAYA 4XU0A 4M75F 3JCMJ 4M75C 4PJOG 1U1SA 5GMKm 2VC8A 5GAOn 1I5LA
chains in the Genus database with same CATH superfamily
3EG2A 5LJ3g 3CD6T 1FXXA 1JRIA 2QQ9A 1KC8U 3MKDA 4OMMA 1NG2A 2PUOB 1VQKT 1OYXA 1E6HA 2PTKA 1VQOQ 2OAUA 1N27A 1NZ9A 2O01E 4LDXA 5CR2A 4C8QC 4J9GA 4ELZC 4GBQA 5FRMA 4Z88A 4BI3A 1ZSZA 4E7JA 1XNIA 2RH2A 4M75E 3CCMT 2OX7A 3HHTB 3L2ZA 4IIMA 3V7RA 2O9SA 5GAMg 5D6WA 2L0AA 2CT3A 1VQ7Q 1YCYA 2CZ0B 4PJMA 1IREB 5DM7R 1Q86R 3JSCA 1WLPB 2RQTA 4N4IA 4C92C 4F16A 1AT1B 5KYXB 4C8QF 1RAIB 1OPLA 2AT1B 2E4HA 2LC4A 3QYHB 4M78E 4M7AF 2RI5A 2JMCA 3TU4K 2P4TA 2EYWA 3JCMb 4ANJA 3OY9A 3JAME 3GNFB 1BI2A 3MEAA 1QWEA 1RI0A 1X6BA 2DD5A 2E1HA 2K2MA 4Y91A 3FLGA 1KQSS 3CCLA 2QA4A 3N5BB 2HSEB 3WVDB 4C92G 1NEGA 2LDMA 2ECZA 3EGXB 3S3NA 2KROA 1I0CA 2EQJA 2QQSA 3QWYA 1JQQA 1M90R 4RTYA 1Q82R 3QBYA 4ATOA 2L89A 3BDLA 3G4SA 2MOXA 4JZ3A 3J80E 2LQNA 5KYXA 1TWBA 1G8XA 2D0NA 3HRSA 5CKFA 5C6SA 2RF0A 1WHJA 3MP8A 1WJQA 4C8QB 4A54A 4D8KA 3SWNB 3MCAB 3JCMQ 4M78D 3VV0A 5I2SA 1I81A 4HT9A 3CD6A 1OV3A 2RJCA 2FG0A 1VQNT 5CIUA 3BFMA 3CCUQ 4ZGDB 1N8RU 4J5YA 5KYUB 1EZZB 3VS4A 3A8GB 4CC3A 3HRUA 3CCQA 3CXCS 1RI9A 1Y0MA 2FVUA 3KFVA 2IIMA 4MDXA 1VQPT 4Z8AA 5GAMj 1KHIA 2CS7A 4N4GA 1K8AR 3EG3A 1IRXA 5FWBA 1IB8A 2E70A 3CMET 2LCSA 3VYHB 1LOJA 3NMZC 4BE2A 3DLMA 2F5TX 3R6NA 2ABLA 1YHQQ 2FRWA 3I55A 1VQ6Q 4B9WA 2OTJT 2L3PA 3THKA 1YJNA 4KULA 5L23A 3CCMA 3QXEB 1K76A 5GAN5 1RLPC 2LQKA 1PRLC 3M4YA 1VQ8A 3CEYA 4M75A 2XDBA 4IKFA 4N0AA 4J9EA 2ROLA 2KR3A 1NYFA 2KT8A 3SD4A 3MHXA 4A4GA 1Q7YR 2EJ9A 3PVQA 2A3LA 4DEXA 1YJNQ 1WX6A 3CCMQ 3BE3A 4M77B 2KYBA 2L5QA 4BE0A 1W6XA 3PT9A 2XK0A 1B07A 1QP3A 4HVWA 1QKWA 3CXCA 3UPUA 1JXMA 2AK5A 4OB0B 2XDDA 1ZLMA 1KQ1A 2OI3A 4AFQC 5C0MA 5J39A 4JLIA 2ZPFB 2QGGA 2LX7A 1FMVA 4QVZA 5I11A 3CC4Q 3JCMf 3RR6A 2EYYA 1MMNA 3VKIA 2KQWA 4FT2A 1N9RA 1QCNA 2WSFE 5LJ3e 1VQMA 1H8KA 2VXEA 3OS5A 3CPWA 3EFOB 2CKKA 2RHYA 1LPLA 2LCLA 1PHTA 2O2OA 3P8HA 2CP7A 1S1NA 3C0CA 3KUFA 3DB4A 1YN8A 5GAN6 3QSUA 1VOMA 1JEGA 4IUVA 4UC4A 5CAIA 2KAFA 3FRNA 1BIBA 2DKGA 1IGQA 4KBMB 1MHNA 2KXCA 1JU5C 3OYEA 5CKEA 2PNIA 5CKBA 2HBWA 3M0QA 3PE0A 3EH1A 4XTUA 3EFRA 4C92F 4ZN1A 1WJSA 2ZGWA 4X1VA 1LJOA 4OB3B 2VUBA 2JZ2A 4HCKA 3QZ9B 2JW4A 5FU6B 1VQ8T 3G6ET 3I5RA 3VU3C 3HPWA 3RESA 5CK9A 2JS0A 1M90U 3GIBA 1OZ2A 4XU0A 3JCMJ 2KEAA 2LCCA 4F7UA 3X25B 5LJ5e 4EPCA 5A0GA 1VQ5A 1Z9ZA 3A8HB 3OQ5A 4HCBA 1D3BA 2ATCB 4M78F 4M7AE 4HA8A 4XTVA 3OS2A 2LZ6B 3JRZA 2E41A 2JOYA 1ZQ1A 5LJ5j 3HKSA 2DRMA 4C5EA 1EX4A 2QDLA 4OB2B 1RL2A 1PSEA 4M77G 3M0TA 2H3JA 1N8RC 2SEMA 4RTUA 1U06A 3EG0A 1WNLA 1W4SA 1VA7A 4IUUA 1V29B 3OSSC 1VQ5Q 1K73R 1I8FA 4OMOA 3CD6Q 3I56Q 2YRVA 3DKMA 4Y92A 1SEMA 2FL7A 2ROTA 1GL5A 5FROA 2XI9A 1W2BP 3EH2A 2RJDA 4F7UF 2QA4T 3RKYA 2QAZA 4HVVA 4X34A 2LJ3A 1OZ3A 3M9QA 2WSEE 2F69A 3MPUB 2RB6A 2GTJA 1IHWA 2QG9B 2GBQA 2RM4A 2KBTA 2E12A 4RG8A 2CUDA 3I55T 4M78B 4CC2A 1NLPC 5HK0A 4FW2A 3CCEQ 1Y7XA 1NJIC 2H3EB 4M77F 1UHCA 1ZSZC 2KY9A 4ZGJB 4AG2C 1GXIE 1X01A 1AWWA 3E2UA 3CBOA 1ZUYA 3A8LB 3QPHA 3UATA 8ATCB 3ME9A 2JNGA 4J6YA 1A0NB 2O4XA 3LH0A 2C0OA 4TVRA 4PJJA 2JN0A 2BIVA 5CKHA 2RHIA 1LNXA 2DL5A 2FPDA 3EGUA 4EMKC 4GY5A 5I22A 1OULA 2PUKB 1AVZC 1XJWB 2QTVA 3C12A 4KH1B 3NTIA 1PSFA 3RDVA 2CDTA 2X51A 3CC2T 4PJOE 4OF1A 3CCQT 3CMAT 4NOYA 2J6FA 4CI0C 1M1KR 5LJ3f 2HKQB 1ZA1B 3L2QA 1YI2T 3QZ5B 1OPKA 2CREA 2DYIA 2QA4Q 1SHFA 4JLGA 4LNPA 3CMAA 1X2QA 4RTXA 1ARKA 2VB6A 1IHVA 3PGGA 3M57A 2HCKA 5GMKh 2DTOA 4M77E 3VS6A 5LJ5d 4ZGEB 1VQLQ 1BBZA 3OYYA 2GFAA 1VQPQ 2F2XA 4OMQA 2KT1A 2NWMA 1Q86U 4A4KA 4F14A 5KE2A 3OYMA 2K5IA 4PLIA 5GANd 1NYGA 1N6AA 2KDSA 1VQOT 3LW5E 1I5OB 5IN1A 4M77D 2E65A 1K8AU 2B86A 3I5SA 1SG5A 2DX1A 2VVKA 3QUIA 2OTJQ 2FYKA 3PNWC 1G3TA 1NBEB 5KE3A 3TCJA 2MCNA 1NE8A 2BE7D 3H8ZA 2NUZA 2EPDA 3LWIA 1BYMA 1N8RR 1YWPA 2GNCA 2EKHA 3VS7A 4C5HA 3JB9D 3TQ7P 1M30A 2M0YA 3R6OA 4CC7A 3CCSQ 2CP5A 3TSZA 4GLKA 3CC7Q 1D0XA 1EFNA 1UHFA 1Q95G 1Q7YU 4D6WA 5A0LA 4BY6B 2YXYA 3JCMW 4ME7A 1MGQA 4XU2A 1KG1A 4FSXA 4ESRA 4YTLA 3JCMg 2YUPA 5FU6C 2F2WA 2E64A 1AOJA 2EGCA 2J6OA 2EGEA 3CPFA 4M75F 1QCOA 3EG9A 2HNIA 3REAB 2K3YA 1FWZA 2HZYA 1YI2A 4A4EA 2IG0A 5GAMh 1QVPA 1X69A 5A2QE 3L1AA 2RNAA 1C0MA 4EIKA 3PMIA 5GAMd 1VYUA 4MMLA 3RIRA 4PJOC 4FYYB 1TUGB 2JT4A 4C92A 4RTTA 3OYGA 2DA9A 3EGXA 1M9SA 2K9GA 3CCRQ 1K9MR 3A8OB 3M58A 1IGUA 1YIJA 2VGMA 1X43A 3ZBDA 4KGZB 2GGRA 5A0DA 2RI2A 4E7ZA 2KI7A 3TVTA 4BDYA 2G6FX 1KFZA 2VXFA 4C8QA 2RK2A 4OGEA 2DVJA 1M8VA 4DEYA 3OA6A 3GPLA 4K11A 3VS1A 3CMEQ 3ZL7C 2NUPA 2DJQA 1KIKA 2KRSA 2WSCE 2RJFA 4DOVA 4L5GA 1RAHB 2WACA 3I56A 1K4US 3M4GA 1QCFA 5GMKj 1AWXA 4PJOF 4FW1A 1VQMQ 1PC0A 3IQLA 4DQ2A 5KH6A 3CQTA 2DL8A 1MMGA 3F70A 4OMNA 1R77A 1KD1R 1YHQT 1V1CA 2JS2A 2RJEA 1WZOA 2B8AA 1PKSA 1TOVA 3CBMA 1RUWA 2FRYA 2G3RA 1J3TA 2DTHA 3D7SB 2VKNA 4BACA 4JJDA 8AT1B 1KK7A 3GLXA 2O88A 1D0YA 4BB7A 1WI7A 1VQ6T 3SHWA 5KCHA 3OYCA 2XHCA 2KRMA 4ZTJA 2DTIA 5FLXE 1KHCA 2DJZA 1WXBA 3A1PA 1WHGA 1Y07A 2MYSA 2JTEA 3UDCA 3S3MA 2PU9B 3QYGB 1NEBA 4C92D 3VUZA 3NHNA 2LVMA 1QVGS 4JRQA 2DXTA 4OMLA 3SWNA 2QEXT 2YUOA 1WHHA 2KYMA 2CP2A 2ZPIB 4HVUA 2R57A 2CYZB 2QEXA 1RADB 4KGXB 1T3LA 4LDVA 3PIPA 4BY6C 1JBMA 4WTOB 1BI3A 4PFPA 3EHQA 2EVRA 3G6EA 2ZPBB 2ZPHB 1WHKA 4WCIA 4F7UG 4PNOA 1UFFA 3LYIA 1QVFS 3RBBB 1ZUKA 2DBMA 3V8LA 2KMTA 2CGHA 2HAXA 3QHSA 1GCQA 5KYNA 1K9AA 1NM7A 1BIAA 1WQ7A 5IHIA 1KC8R 1D1BA 3NTHA 1TUCA 1NJIR 2F1LA 2O9VA 5GAMe 3QWXX 3CCLQ 5AYFA 5LJ5h 2J06A 3OYBA 1UDLA 3UF4A 2V8KA 3WVEB 2HEQA 3E19A 1M2OA 1M1KU 4Y28E 1G5VA 1FYNA 3G71A 2GF7A 1AZGB 5GMKl 4C0FA 4D8DA 2DF6A 2K79A 4O5VA 4JUVA 4J9DA 1KQSP 2IPOB 2XKOC 1KQ2A 2YSQA 1VQ7A 3RMSA 2ED0A 1NLOC 2LJ0A 2DMOA 1M27C 3A98A 5GAN4 3CMAQ 4M75C 2D8JA 3EGDB 1JXOA 3OMCA 2FZGB 5D7UA 2DFUA 3H0HA 5GANg 1S72A 4M7DD 2DILA 4M7AA 4ZN3A 3OYLA 2VYTA 5I21A 1Y96B 2YLBA 2ZAEA 2E5QA 1YNZA 1G3SA 2KNBB 3EFSA 2R5MA 3OYAA 1KD1C 2LNVA 2QTXA 4C8QE 2DL7A 4II1A 4MZPA 2QK0A 4KT0E 1AWJA 2X3WD 1YFNA 2FPEA 1QLYA 1BI1A 2D1XA 2FZCB 2JVVA 4VUBA 4MZMA 3O8VA 5DLOA 1VQ9Q 3V7CA 3CPWS 1AD5A 4E7HA 4RG2A 1YITT 2OTJA 5GMKi 4O6JA 2EQUA 1G3YA 2DAQA 2VWFA 4FIBA 3SFMA 2DRKA 3H9NA 3HP9A 3JB9F 4M7DB 1C1AA 2DE0X 2BUDA 2RHZA 1Y71A 2C06A 3META 1W1FA 1JJ2A 1E7OA 3S3OA 1RAGB 1CSKA 1R8OB 4LUEA 1AHJB 2CH4A 2P0QA 1SHGA 3CC7A 2L3QA 3SEMA 5GANh 1ZSZB 1QW1A 3EGDA 4C0GA 4EDUA 3CCVA 4PK4A 4DA4A 4Q5WA 2YUQA 2YT6A 3OYIA 3EG1A 3QJYA 3X20B 1MUZA 1OI1A 4OMPA 5FU7C 5D6YA 5LJ3h 2E10A 5I2MA 1D1AA 4CRIA 3FC3A 2PZ1A 3FB9A 2FHDA 3I55Q 1VQ6A 1GBRA 4AFUC 5GMKm 2K6DA 1LVKA 4A4FA 2VC8A 2GCXA 2D0QB 5GANj 1QMCA 1MMAA 3TSWA 3JB9G 4XAXB 2P4RA 2RD1A 1RAEB 2DD4A 3CCSA 5HCKA 3CCET 3CCRA 1X6GA 2V8IA 1UEBA 1YIJQ 3HFNA 3CCQQ 4C92B 4F7UE 2JMAA 2CUBA 2C0TA 3C4SA 3JCMc 3CXCP 4B6MA 1C6VX 2QQBA 1X6OA 4JJCA 2M0OA 1PKTA 1QKXA 2DXUA 5FWCA 2K2VA 3TEEA 4KUDK 4C8QG 3L2UA 1UG1A 2LJ1A 4IIOA 2DIQA 1YJWA 3LGFA 3VS0A 3GBQA 3QIIA 1WXTA 1W2BA 3C95A 4PL6A 3PVLA 2EYXA 2BZ8A 1Q86C 2CP0A 2EQMA 4MDWA 3OYDA 2E3IA 4HCZA 1FMKA 1BU1A 4C0DB 3CCJT 1Q82C 1PD1A 4PJOD 2R58A 4J8OA 2SRCA 5GJWB 4EMKB 3QDFA 4M7DG 5FRNA 1M1GA 1GCQC 1VUBA 3KXTA 1RLQC 3M0SA 1I4K1 1VQ9T 4LXCA 3AHUA 4GLMA 2COYA 1O9SA 1OEBA 2EQKA 1YJ9A 4BI8B 3PMTA 5KYWB 3X24B 1WA7A 3EFOA 1U5SA 1CKBA 1S72T 2YDLA 2LP5A 1B7TA 3JCMP 1M2VA 2XDPA 5KYWA 1I1JA 3M53A 3QG1A 4E47A 2QEXQ 2CZ6B 4RTVA 4WF2A 1QQJA 1B34B 1VQKA 3UA6A 2EYQA 3LH5A 1NJIU 4RCCA 4QW2A 1VQNQ 1K73U 4J9BA 3VRYA 4EMKA 7AT1B 1N9SA 2EBPA 2LX9A 2OTLA 4FL6A 5KYUA 2DXBA 3I35A 3QDRB 2LNHB 2X4JA 4AMCA 3OMGA 3M54A 2V1RA 2F5KA 4BD3A 1JO8A 1Y96A 3EAEA 1TUDA 2P0KA 2RN8A 4KRTA 1TS9A 3DLLA 4J9HA 4OVAA 5KYYB 5M9OA 4DBQA 4AFZC 4MZTA 1TU0B 4RCBA 1XTDA 4LN2A 2J05A 4M4ZA 1H641 3C94A 1BCOA 5GAOr 2NUTA 1Q7YC 1K1ZA 4IURA 2OTLQ 4A4HA 3BW1A 5GAN3 4B9XA 2J7IA 1K73C 3VS2A 4N4HA 2DBKA 3M59A 4J9FA 5GMKe 1VIEA 3M0PA 3OW2S 3CCRT 1OX9A 2PVDB 2ZPGB 4J6WA 3FEOA 2FB7A 2HQHA 2RQRA 1GFCA 4J6XA 3CC2Q 3PFSA 2RA2A 2DPPB 2Y4YA 1MMDA 1O75A 1GFDA 2VGNA 4DBRA 2AZSA 4J9IA 2EYZA 2CZ7B 2E6NA 1Q81R 2I2LA 2HDAA 2PVOB 4PJOA 4E7SA 4XTWA 1Z9QA 4XTXA 4NL2A 4PJOG 1WYXA 1PM3A 1G2BA 3CC4T 4M77A 4DBFA 4JRKA 2E6ZA 1PWTA 3NTKA 2DYBA 5DY9A 4OB1B 1TH7A 1UB4A 4R55A 4JJNK 1PRMC 2A36A 3MEWA 2A08A 3CC7T 1VQ5T 1SSFA 2DIGA 1WDXA 2Y90A 2BE9B 3GP8A 3OW2P 2QXFA 4LD6A 1VQ4A 2XICA 4MMKA 1TTHB 1N5ZA 3AT1B 3HFOA 2X4WA 2CZ1B 4RUGA 1RAFB 4M7AC 1YP5A 4KH0B 5CKDA 4JS5A 4Z02A 1WHMA 3H41A 2XD0A 4M75B 3OBYA 3GF5A 3VRZA 1U1TA 1MV3A 1R0CB 1YHQA 1KQSA 3QKJA 2DZ9A 2JM9A 3VYGA 2D6FA 4IUTA 2E5KA 3OYHA 3L2VA 1VQ4Q 3T9NA 2H8HA 3V7SA 4M7DE 3V8KA 2V1QA 2MAMA 2IVWA 1RACB 4JJBA 5D6XA 1K0XA 2EKOA 3OYKA 3G71Q 3LGLA 2RHXA 3FIFA 3CCUA 1IXDA 4DOWA 1VQ8Q 2ZPEB 1QP2A 1TG0A 3ER0A 3OYJA 1HSQA 2W10A 2LRQA 2M51A 2R5AA 9ATCB 1ZBXA 2DZCA 4QQ6A 1YBYA 3ULRB 3QJ6A 4OMFB 3RKWA 5IAYA 4M7AG 2BZYA 1HJDA 5GAN7 3OYNA 1TXQA 2KXDA 1YI2Q 3OBWA 2EW3A 3GOXA 3I9QA 4X9DA 1YWOA 5GAOn 2JJ9A 3G4SQ 2O4XB 5GAN8 2ENMA 3HSBA 1W2BS 4M78G 4QVDA 1SSHA 3EG9B 4E7KA 5IH2A 3J7AF 1YCSB 1UGRB 1D1CA 3JV3A 1VQLA 3X28B 2Y4XA 4F17A 2J6KA 1VQPA 1G3WA 3I56T 3VJPA 2DXCA 3RUXA 1VQ9A 3M0RA 2RI3A 2M9UA 2FZKB 3JB9J 2A37A 4KUIA 4V2SA 3OB9A 5GAOm 3L42A 1IO6A 3FDRA 4PJOB 2V26A 3FJ5A 5GANe 1WIEA 2MPXC 5LJ5g 4PFZA 4JRPA 2MWPA 5CQYA 4HT8A 2VASA 1D3BB 2M16A 1G83A 3CMEA 4N0AC 3E9GA 1TSFA 3PTAA 1VQMT 3VUBA 1B34A 5CVIA 2JTFA 2AKKA 1M3AA 2XIDA 3RNJA 3VS3A 1Q81U 2CH4W 1V76A 4JS4A 2FO0A 4OP0A 4C5IA 3A5ZB 1KJWA 3HL8A 2LMJA 2BTTA 4BI4A 3H0FA 1Q82U 1M3CA 4E6RA 3INZA 2EWNA 2K4YA 1NPPA 1RAAB 3MP6A 5HY6A 1KD1U 3CCVT 1T0JA 2COZA 3LLRA 3QO3A 4CC4B 2P84A 1YITQ 2RHUA 4L6V5 1BI0A 3JB9I 1GBQA 2LQWA 3A8MB 4HKEA 2ZCFB 3X26B 3G4ST 1QVGA 3JCMV 4AFSC 3RERA 3H6ZA 3U23A 2C0IA 4XK8E 4E7LA 2DK3A 2DEQA 4KGVB 2HKNA 2CSIA 4XU1A 1UECA 1M4ZA 4BUGA 3TREA 3CCJQ 3DB3A 4C5GA 6AT1B 4ELYC 1YITA 1VQNA 2D8HA 2XG8D 2CT4A 4A53A 1PD0A 4M7AB 3M0UA 2ED1A 1BB9A 5J26A 5GAOl 4BE1A 4ORZA 4FSSA 4R56A 2CSQA 5IXBA 2YUNA 1SF9A 5GAMf 2L2PA 2LT1A 5LL6S 3BY7A 1ZSGA 2COWA 2RQVA 3MP1A 1ZA2B 3MEVA 2QQAA 2NYSA 3M5AA 3Q1JA 4J7FA 2X9HA 1VYTA 3SWNC 4XTYA 2HQXA 2OTLT 2QYZA 4LDYA 3JB9H 2LQ8A 2X4XA 2HMAA 4PKCC 2GTOA 4M7DA 1U8RA 3CPWP 4M7AD 1JJ2P 2HD0A 2EJFA 2X4YA 1P92A 4NS5A 3G7ZA 3NPFA 4C0ZA 5CCAA 4IUQA 1LCKA 2KSSA 5IXFA 3LX7A 2EQIA 3CCEA 3P8DA 4FU6A 4NL3A 1I07A 1UTIA 4QQDA 1HXDA 2K5FA 1Q81C 2HSPA 4XTZA 3URGA 2AKLA 3OS0A 2CP3A 4FYXB 2DNUA 4JZ4A 2RK1A 3OW2A 2L3RA 2HQEA 1Y57A 4M77C 3ASKA 1UGVA 3P8BB 5EG2A 3REBB 1RABB 1SPKA 2PVGB 2E3HA 2V8JA 2GQIA 1VIFA 1I5LA 2DERA 5GANf 4LDWA 3MJXA 5IT9E 3FJPA 2MIOA 4FT4A 1GRIA 1VQKQ 4M7DF 3CC2A 2RPNA 1OQKA 1KSWA 4FCYA 2QQRA 2DVEA 2JTMA 4A63B 2XU8A 2A28A 1BCMA 1XOVA 5HK3A 3BDUA 1VYVA 4HCCA 2NLUA 4JDSA 1PG5B 4F04B 1CKAA 2O31A 1VQLT 4M7DC 1VQ7T 4HXJA 1X2KA 2VV5A 5LJ3d 2K7AA 2DO3A 2FEIA 3JCMh 1UJ0A 2DLPA 4J83A 1HK9A 3RMQA 3NGPA 3JCMe 2PQWA 2F2VA 2GFUA 2MF2A 4E2FB 1T3SA 2DL4A 2EJGA 3MEUA 2CP6A 4PFOA 1S72Q 1D09B 1OU8A 4M78C 1M2VB 4C92E 1WGSA 2AHJB 4C0DC 3ZEHA 3CCVQ 2EGAA 2HL5C 4OGCA 1K0SA 1F1BB 5EC7A 3PIOA 2RO0A 2DM1A 1BKBA 4E7IA 1AZEA 1M1KC 1MNDA 2ZZDA 5GAOp 2K5LA 4PJNA 1ACMB 2MMPA 3CCUT 2QDYB 2BKDN 2K57A 3KBGA 4F7UB 2K3BA 3ZFJA 4RTZA 2YHTA 5CO7A 1MV0B 4PLLA 4QQGA 1U1SA 2KGTA 3S6WA 1H3HA 1OOTA 5AT1B 4LDUA 3VS5A 5HKCA 1UUEA 1E6GA 5KCOA 2MI6A 2X3XD 4RMOA 2BZXA 1HD3A 2RQUA 1FX7A 3JCMX 5LJ5f 1WJRA 2XMFA 2YRCA 3OS1A 5J3BA 2L3SA 3UWNA 4M75G 4JPBW 1FMWA 4Z89A 4EMGA 1EIFA 1X75C 1WFWA 2NUPB 2L8DA 4RTWA 4EMHA 1ABQA 4LD9K 2OJ2A 3UT1A 2A0FB 1GCPA 1UJYA 5FU7B 1QVGP 1KC8C 3O5ZA 3OSVA 2KVQG 1UGSB 1K8AC 4C8QD 3SDZA 5DLQE 1ABOA 1U3OA 3M56A 2RMOA 1OU9A 1MNEA 4XU3A 1QWFA 2DL3A 5IHNA 4FYWB 1WHLA 2DETA 2X35A 4ZNXA 2A7YA 5KYYA 1R0BG 3HTRA 1IZ6A 1M3BA 2EFIA 1QVFA 5FW9A 5IHKA 3JCMd 1QVFP 1ZHIA 2JUFA 3NFCA 1ZBJA 1WPYA 3CBPA 2AZVA 4DBHA 4AG1C 1UGPB 3J81E 1YJNT 1D0ZA 1M1FA 2YLCA 4ZTFA 2ESWA 1B3QA 1OX8A 2AIRB 1YIJT 1UGQB 1SKUB 4FYVB 3CC4A 4R0KA 1PCXA 1WQWA 4M78A 4L59A 3SB2A 3E9FA 4LE9A 4BDZA 2KK4A 4X9CA 3UA7A 3OYFA 3M55A 3L2RA 1K9MC 2EAYA 2Z0WA 1VQ4T 1YJWQ 3G1JA 2M1HA 5LJ3j 1JB0E 2GQVA 1SRMA 4QT7A 1ZX6A 3G71T 2RQWA 1WXUA 3RKXA 3V8JA 2LTOA 2QASA 1JJ2S 2YRDA 2OAWA 3MO8A 1T0HA 5CQXA 1YJ9T 3L2WA 4FM4B 4RKUE 2YWWA 4IUPA 3CCST 2HBPA 2MK5A 3CCJA 4J9CA 3GNGA 2HL3A 2LT4A 3EHRA 2W0ZA 4QKUA 4M75D 1K9MU 1M90C 1PNJA 3HRTA 2I0NA 3LWHA 4P5NA 1ZUUA 1X27A 2M02A 2JM8A 2QI2A 1UE9A 1M8MA 1YJWT 1BK2A 2QGFB 3WXMB 3E1SA 1HYOA 1M5Q1 2FPFA 2KRNA 2JXBA 4XQ3A 3CCLT 2MWOA 4PJLA 2P0PA 1XQHA 5GAOq 1NPRA 1VQOA 4JRIA 1DJ7B 1H3ZA 4AT1B 2KE9A 2D9TA 4LUDA 2NUTB 1SRLA 4J7IA 5ECAA 5L8RE 1YJ9Q 2DEUA 5GAN2 3G6EQ 1AEYA 3H0IA 2EIFA 1AWOA 4QVCA 5GJVB 2K3XA 1H92A 1W70A
chains in the Genus database with same CATH topology
3CCQT 2DK3A 2GCXA 2D0QB 4NOYA 4CI0C 5LJ3g 1FXXA 1JRIA 2DEQA 2QQ9A 4XU1A 5LJ3f 1KC8U 1M4ZA 4BUGA 3TREA 2PUOB 3L2QA 1YI2T 1VQKT 3QZ5B 1OYXA 3JB9G 3DB3A 4XAXB 4C5GA 2RD1A 4JLGA 2DD4A 4ELYC 3CMAA 3CCSA 1YITA 2OAUA 3PGGA 1N27A 1NZ9A 3M57A 3CCET 3CCRA 1VQNA 2O01E 5GMKh 2V8IA 1UEBA 4LDXA 2XG8D 5CR2A 4C8QC 3HFNA 2DTOA 4M77E 4ELZC 4A53A 4C92B 4F7UE 4M7AB 5LJ5d 4ZGEB 5FRMA 4BI3A 3OYYA 3C4SA 5J26A 3JCMc 2GFAA 5GAOl 4E7JA 1XNIA 2RH2A 4M75E 4BE1A 4R56A 3CCMT 1Q86U 3HHTB 2QQBA 1X6OA 3L2ZA 4A4KA 2M0OA 5GAMf 5KE2A 3V7RA 5GAMg 5D6WA 2DXUA 2LT1A 3OYMA 2K5IA 5LL6S 3BY7A 2K2VA 4PLIA 5GANd 3TEEA 4KUDK 1N6AA 2KDSA 1YCYA 2CZ0B 3MP1A 3MEVA 1VQOT 1IREB 2QQAA 5DM7R 3LW5E 3M5AA 3JSCA 4C8QG 3L2UA 5IN1A 4N4IA 4M77D 4C92C 3Q1JA 2E65A 4J7FA 1K8AU 4C8QF 3SWNC 4XTYA 2DIQA 1YJWA 3LGFA 2HQXA 3QUIA 3QIIA 2OTLT 3CC2T 2LC4A 2FYKA 3QYHB 4M78E 1W2BA 3PNWC 4LDYA 1G3TA 5KE3A 4M7AF 2RI5A 3JB9H 3C95A 2LQ8A 4PL6A 2X4XA 3TCJA 1NE8A 3TU4K 3H8ZA 4PKCC 2P4TA 1Q86C 4M7DA 1U8RA 4M7AD 3JCMb 2HD0A 2EJFA 2EQMA 2X4YA 1P92A 3JAME 3OY9A 3LWIA 4NS5A 1BYMA 3G7ZA 3GNFB 1BI2A 4MDWA 4C0ZA 5CCAA 3OYDA 3MEAA 4IUQA 1RI0A 2KSSA 4C5HA 3JB9D 4HCZA 4C0DB 2DD5A 2E1HA 3CCJT 3LX7A 1Q82C 4Y91A 3CCEA 3P8DA 3FLGA 4FU6A 4NL3A 2R58A 4PJOD 1KQSS 4J8OA 3CCLA 2QA4A 3N5BB 3R6OA 3WVDB 4C92G 4GLKA 4EMKB 2LDMA 4M7DG 4QQDA 5FRNA 1HXDA 2K5FA 1Q81C 1M1GA 3S3NA 1Q7YU 4D6WA 5A0LA 4XTZA 4BY6B 2EQJA 3URGA 1VUBA 2QQSA 3OS0A 3KXTA 4ME7A 3JCMW 1I4K1 1MGQA 4XU2A 1VQ9T 1KG1A 4FSXA 3AHUA 2RK1A 3OW2A 3QBYA 4ATOA 4YTLA 2L89A 3BDLA 2EQKA 1O9SA 2L3RA 2HQEA 3G4SA 3JCMg 4M77C 3ASKA 5FU6C 1YJ9A 5EG2A 3P8BB 4BI8B 2PVGB 2E64A 3PMTA 2V8JA 3J80E 3CPFA 4M75F 3X24B 1VIFA 3HRSA 5CKFA 5C6SA 1I5LA 2HNIA 5GANf 3MP8A 4LDWA 2K3YA 1WJQA 4C8QB 4A54A 4PJOE 1FWZA 1YI2A 3SWNB 3FJPA 3MCAB 4M78D 3VV0A 4A4EA 5I2SA 4FT4A 3JCMQ 5IT9E 1S72T 1I81A 2IG0A 5GAMh 4HT9A 3CD6A 3JCMP 2XDPA 2RJCA 4M7DF 1QVPA 1VQNT 5CIUA 3CC2A 5A2QE 3L1AA 3M53A 3QG1A 4E47A 2QQRA 2CZ6B 2DVEA 2JTMA 3BFMA 4WF2A 4ZGDB 2XU8A 3PMIA 5GAMd 1N8RU 4J5YA 1B34B 1VQKA 1XOVA 5HK3A 4MMLA 3BDUA 3A8GB 3RIRA 4HCCA 4PJOC 2EYQA 2NLUA 4JDSA 1NJIU 3HRUA 3CCQA 4RCCA 4C92A 3CXCS 3OYGA 2FVUA 4QW2A 1M9SA 1K73U 3A8OB 4MDXA 3M58A 4EMKA 1VQPT 1N9SA 1YIJA 2LX9A 2VGMA 2OTLA 4FL6A 1VQLT 3ZBDA 5GAMj 1KHIA 2CS7A 2DXBA 4N4GA 5A0DA 4M7DC 3QDRB 2RI2A 2X4JA 1VQ7T 3OMGA 2VV5A 5LJ3d 2E70A 2DO3A 3M54A 3JCMh 3CMET 3VYHB 1LOJA 4BE2A 2F5KA 4BD3A 3DLMA 4BDYA 2F5TX 1Y96A 3EAEA 4J83A 2P0KA 1HK9A 3RMQA 3JCMe 2PQWA 3DLLA 2GFUA 2VXFA 3I55A 4OVAA 4B9WA 2MF2A 5M9OA 2OTJT 4C8QA 4MZTA 4RCBA 1YJNA 2RK2A 2EJGA 3MEUA 4OGEA 1M8VA 1XTDA 4KULA 4M78C 4C92E 3CCMA 1WGSA 3QXEB 3OA6A 1H641 3C94A 3GPLA 2AHJB 4C0DC 5GAOr 1Q7YC 3ZEHA 4IURA 2WSCE 5GAN5 2RJFA 4A4HA 4L5GA 4DOVA 2LQKA 2WACA 3BW1A 4B9XA 5GAN3 3I56A 4OGCA 1K73C 3M4YA 1VQ8A 3CEYA 4M75A 3M4GA 4N4HA 3PIOA 2RO0A 5GMKj 4IKFA 2XDBA 1BKBA 4PJOF 3M59A 4E7IA 5GMKe 1VIEA 1M1KC 4N0AA 4DQ2A 2ZZDA 5KH6A 5GAOp 2K5LA 3CCRT 3OW2S 3F70A 2PVDB 1YHQT 2ZPGB 4J6WA 2MMPA 2RJEA 2FB7A 3FEOA 3MHXA 3SD4A 4A4GA 2EJ9A 4J6XA 2A3LA 2B8AA 3PFSA 3CCUT 2QDYB 2BKDN 2RA2A 2K57A 2DPPB 3KBGA 3CBMA 2Y4YA 4F7UB 2G3RA 1O75A 2DTHA 3ZFJA 2VGNA 4M77B 2L5QA 2YHTA 4BE0A 5CO7A 4BACA 3PT9A 2XK0A 3GLXA 1VQ6T 2CZ7B 2E6NA 4PLLA 1QP3A 4BB7A 2I2LA 4PJOA 2PVOB 4XTWA 4XTXA 5KCHA 3OYCA 4NL2A 2XHCA 4QQGA 4PJOG 1U1SA 3CXCA 4ZTJA 3S6WA 3UPUA 2DTIA 5FLXE 4M77A 1KHCA 3CC4T 4OB0B 2DJZA 4LDUA 2XDDA 4JRKA 1KQ1A 2E6ZA 3NTKA 5HKCA 5DY9A 1Y07A 4OB1B 5KCOA 2MI6A 1TH7A 4RMOA 5C0MA 5J39A 4JLIA 2ZPFB 1UB4A 1FX7A 3UDCA 3S3MA 3JCMX 4R55A 2PU9B 4QVZA 1WJRA 5LJ5f 4JJNK 3QYGB 3OS1A 4C92D 3VUZA 3MEWA 3JCMf 2LVMA 5J3BA 1QVGS 4JRQA 2DXTA 2QEXT 3SWNA 3CC7T 3UWNA 4M75G 1VQ5T 1SSFA 2DIGA 3VKIA 2Y90A 2ZPIB 3GP8A 2QXFA 4LD6A 1VQ4A 2KQWA 2R57A 4EMGA 1EIFA 2CYZB 2XICA 4FT2A 4MMKA 2QEXA 1X75C 3HFOA 2X4WA 2CZ1B 4LDVA 2L8DA 3PIPA 1N9RA 4M7AC 4BY6C 1JBMA 1BI3A 2WSFE 4EMHA 5CKDA 5LJ3e 1VQMA 4JS5A 4LD9K 4Z02A 3UT1A 5FU7B 2VXEA 3OS5A 3G6EA 3CPWA 2ZPBB 2ZPHB 1KC8C 3OSVA 2CKKA 2XD0A 2KVQG 4M75B 3OBYA 4F7UG 2RHYA 3GF5A 4PNOA 1UGSB 1K8AC 4C8QD 3LYIA 1QVFS 1U1TA 2LCLA 3SDZA 1KQSA 5DLQE 1YHQA 3QKJA 2DZ9A 3M56A 3VYGA 3P8HA 4IUTA 2D6FA 3OYHA 3V8LA 2KMTA 2CGHA 3KUFA 3QHSA 4XU3A 3L2VA 2HAXA 3CD6T 3DB4A 3T9NA 1BIAA 1WQ7A 3V7SA 5GAN6 3QSUA 4M7DE 4IUVA 3V8KA 4UC4A 3NTHA 5CAIA 2X35A 2KAFA 3FRNA 2A7YA 2IVWA 2MAMA 1BIBA 2DKGA 1IZ6A 5GAMe 4KBMB 5D6XA 1MHNA 2EKOA 3OYKA 2EFIA 3OYEA 5CKEA 5AYFA 1QVFA 5LJ5h 3JCMd 3LGLA 2RHXA 3FIFA 3OYBA 1ZHIA 2JUFA 3CCUA 2V8KA 3NFCA 5CKBA 1WPYA 1QP2A 2ZPEB 3CBPA 3ER0A 3WVEB 4DOWA 3E19A 3OYJA 1M1KU 2LRQA 4XTUA 3EFRA 4Y28E 1G5VA 3J81E 1UGPB 1YJNT 4C92F 2R5AA 4ZN1A 3G71A 1M1FA 1WJSA 2GF7A 1ZBXA 2YLCA 4ZTFA 2DZCA 4QQ6A 2ZGWA 1LJOA 5GMKl 4OB3B 4C0FA 1YIJT 1UGQB 2VUBA 2JZ2A 1YBYA 3QZ9B 4O5VA 3CC4A 4JUVA 5FU6B 3QJ6A 1VQ8T 1WQWA 3G6ET 4OMFB 3RKWA 2XKOC 4M78A 5IAYA 3VU3C 4M7AG 1KQ2A 3HPWA 1VQ7A 4L59A 3RMSA 3SB2A 5GAN7 3E9FA 3RESA 3OYNA 5CK9A 4BDZA 2KK4A 3OBWA 4X9CA 5GAN4 3OYFA 3L2RA 3M55A 1M90U 1K9MC 3GIBA 1OZ2A 2EAYA 4XU0A 3GOXA 3JCMJ 4M75C 4X9DA 2LCCA 4F7UA 3X25B 5LJ5e 5GAOn 1VQ4T 2M1HA 4EPCA 5A0GA 3OMCA 5LJ3j 1JB0E 5GANg 1VQ5A 2O4XB 3OQ5A 3A8HB 5GAN8 1S72A 4HCBA 3HSBA 2GQVA 4M7DD 1D3BA 1W2BS 4M78G 4M7AA 4QVDA 4ZN3A 3OYLA 2VYTA 5I21A 1Y96B 2YLBA 4M78F 4M7AE 4HA8A 4E7KA 3G71T 4XTVA 3OS2A 3JRZA 2E41A 2E5QA 3J7AF 1G3SA 2JOYA 1ZQ1A 3EFSA 5LJ5j 1UGRB 3HKSA 2R5MA 3OYAA 1KD1C 2LNVA 3RKXA 2QTXA 4C5EA 4C8QE 3V8JA 3X28B 1VQLA 2Y4XA 4OB2B 4II1A 2LTOA 4MZPA 1VQPA 1RL2A 1PSEA 4KT0E 1JJ2S 1G3WA 4M77G 3I56T 3VJPA 2DXCA 3RUXA 2H3JA 1VQ9A 2RI3A 2M9UA 1N8RC 1BI1A 3JB9J 4KUIA 3MO8A 4V2SA 3OB9A 5GAOm 5CQXA 1YJ9T 1WNLA 1W4SA 2JVVA 3L42A 5GANj 3L2WA 4VUBA 4IUUA 1V29B 3FDRA 3O8VA 3OSSC 4MZMA 3V7CA 5DLOA 4PJOB 3CPWS 5GANe 4E7HA 1I8FA 4RG2A 4FM4B 2YRVA 4RKUE 3DKMA 5LJ5g 4IUPA 3CCST 2HBPA 5GMKi 4O6JA 4JRPA 1YITT 3CCJA 2OTJA 3GNGA 2EQUA 2FL7A 2MWPA 2LT4A 5CQYA 1G3YA 5FROA 4HT8A 2DAQA 4FIBA 2XI9A 3SFMA 3HP9A 1D3BB 2M16A 4M75D 1K9MU 3JB9F 1M90C 4M7DB 3CMEA 3HRTA 3E9GA 4N0AC 2RJDA 4P5NA 4F7UF 3LWHA 3PTAA 2QA4T 1VQMT 3RKYA 3VUBA 2BUDA 2RHZA 1Y71A 1B34A 4X34A 2C06A 3META 1JJ2A 5CVIA 1OZ3A 2JTFA 3M9QA 2WSEE 3S3OA 2XIDA 2QI2A 2F69A 1R8OB 2RB6A 1YJWT 1Q81U 4JS4A 1AHJB 2RM4A 2E12A 4OP0A 4RG8A 4C5IA 3A5ZB 3I55T 2P0QA 4M78B 3HL8A 3WXMB 3CC7A 3E1SA 5HK0A 3CMAT 5GANh 1QW1A 1Y7XA 4BI4A 1NJIC 1M5Q1 4M77F 1Q82U 4C0GA 3INZA 4EDUA 3CCVA 2EWNA 4XQ3A 2K4YA 1NPPA 2KY9A 3MP6A 3CCLT 2MWOA 4ZGJB 1GXIE 1X01A 2P0PA 3CBOA 5HY6A 1XQHA 3CCVT 3A8LB 3QPHA 4DA4A 1KD1U 5GAOq 4Q5WA 3ME9A 2JNGA 3LLRA 3QO3A 4J6YA 2O4XA 3OYIA 1NPRA 3LH0A 3QJYA 4TVRA 1VQOA 4JRIA 1DJ7B 3X20B 1H3ZA 2JN0A 2RHUA 2D9TA 2BIVA 4L6V5 1BI0A 1OI1A 5CKHA 2RHIA 3JB9I 1LNXA 4J7IA 4EMKC 4GY5A 5FU7C 5D6YA 5L8RE 5GAN2 5LJ3h 3A8MB 2E10A 2ZCFB 4HKEA 5I2MA 3X26B 4CRIA 2EIFA 3FC3A 2PUKB 3FB9A 2FHDA 3G4ST 1QVGA 1VQ6A 3C12A 3JCMV 3NTIA 4QVCA 3RERA 1PSFA 3H6ZA 2K3XA 5GMKm 4A4FA 2VC8A 4XK8E 4E7LA 4OF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HNI A;  5LJ3 g;  4NOY A;  5GAN f;  5GAN j;  2DTI A;  1JRI A;  2DEQ A;  4M77 A;  5LJ3 f;  4XU1 A;  5LJ3 j;  4C8Q B;  2DJZ A;  5GAN g;  4A54 A;  5GAN 8;  4JRK A;  1KQ1 A;  3HSB A;  4M7D D;  1D3B A;  4PJO E;  4M78 G;  3FJP A;  3SWN B;  4M78 D;  3JCM Q;  3JB9 G;  4QVD A;  5DY9 A;  4M7A A;  1I81 A;  1TH7 A;  5GAM h;  5I21 A;  1Y96 B;  2RD1 A;  2YLB A;  4JLI A;  4HA8 A;  4M78 F;  3JCM P;  4M7A E;  4XTV A;  4M7D F;  2E41 A;  3PGG A;  3JCM X;  3EFS A;  3L1A A;  5GMK h;  5LJ5 f;  5LJ5 j;  2DVE A;  4C8Q C;  3BFM A;  4WF2 A;  3HFN A;  2DTO A;  4C92 D;  4M77 E;  3RKX A;  2QTX A;  3JCM f;  4J5Y A;  3V8J A;  4C8Q E;  5GAM d;  4M7A G;  1B34 B;  4A53 A;  2DXT A;  4C92 B;  4MML A;  3BDU A;  4M7A B;  3SWN A;  4F7U E;  4M77 G;  3RIR A;  4M75 G;  5LJ5 d;  4PJO C;  3RUX A;  2Y90 A;  3JCM c;  5GAO l;  4RCC A;  4C92 A;  4M75 E;  4EMG A;  3JB9 J;  4X9D A;  4MMK A;  4V2S A;  5GAO m;  4EMK A;  1N9S A;  1WNL A;  3HFO A;  4PJO B;  3L2Z A;  3V7C A;  1N9R A;  4M7A C;  5GAM f;  5GAM j;  1JBM A;  3V7R A;  5GAN e;  5GAM g;  4M7D C;  4EMH A;  1I8F A;  2DXU A;  5LJ3 e;  5LJ3 d;  3BY7 A;  5LJ5 g;  3JCM h;  5GAN d;  5GMK i;  2VXE A;  1LOJ A;  1YCY A;  1Y96 A;  4M75 B;  1HK9 A;  4F7U G;  3JCM e;  4HT8 A;  4PNO A;  4C8Q G;  4C8Q D;  1D3B B;  2VXF A;  4M77 D;  1U1T A;  4M75 D;  4C92 C;  3JCM W;  3JB9 F;  2E65 A;  4HT9 A;  4M7D B;  4N0A C;  4C8Q A;  4C8Q F;  4F7U F;  3RKY A;  4RCB A;  3SWN C;  4XTY A;  1B34 A;  2EJG A;  2DZ9 A;  1M8V A;  3QUI A;  4M78 C;  3V8L A;  2CGH A;  4F7U A;  3QHS A;  4XU3 A;  4C92 E;  2FYK A;  5LJ5 e;  4M78 E;  4M7A F;  1BIA A;  1H64 1;  1WQ7 A;  3V7S A;  5GAN 6;  3QSU A;  4M7D E;  3V8K A;  5GAO r;  2RB6 A;  3JB9 H;  5CAI A;  5GAN 5;  4M7D A;  2RM4 A;  4M7A D;  1BIB A;  3JCM b;  2DKG A;  2EJF A;  3BW1 A;  4OP0 A;  5GAM e;  5GAN 3;  4M78 B;  4M75 A;  3M4G A;  5GMK j;  5LJ5 h;  3JCM d;  5GAN h;  3FIF A;  4PJO F;  5GMK e;  1WPY A;  3JB9 D;  1M5Q 1;  4M77 F;  2E1H A;  4N0A A;  4DQ2 A;  5GAO p;  3INZ A;  4Y91 A;  2EWN A;  4XQ3 A;  3EFR A;  4XTU A;  4NL3 A;  4PJO D;  4C92 F;  1X01 A;  4J6W A;  2FB7 A;  2YLC A;  5GAO q;  2DZC A;  2EJ9 A;  2ZGW A;  1LJO A;  4J6X A;  4C92 G;  3QO3 A;  4J6Y A;  4EMK B;  5GMK l;  4M7D G;  2RA2 A;  1HXD A;  2K57 A;  4JRI A;  2JN0 A;  4JUV A;  4F7U B;  4XTZ A;  1WQW A;  3RKW A;  2DTH A;  4M78 A;  1LNX A;  1I4K 1;  1MGQ A;  4XU2 A;  4M77 B;  2YHT A;  3VU3 C;  3JB9 I;  1KQ2 A;  3AHU A;  5GAN 7;  3SB2 A;  4EMK C;  3RES A;  5GAN 2;  5LJ3 h;  2E10 A;  2I2L A;  3FB9 A;  4M77 C;  3JCM g;  4PJO A;  4QVC A;  3JCM V;  5GAN 4;  4X9C A;  4XTW A;  4XTX A;  3RER A;  2E64 A;  3GIB A;  4NL2 A;  2EAY A;  4XU0 A;  4M75 F;  3JCM J;  4M75 C;  4PJO G;  1U1S A;  5GMK m;  2VC8 A;  5GAO n;  1I5L A; 
#chains in the Genus database with same CATH topology
 3EG2 A;  5LJ3 g;  3CD6 T;  1FXX A;  1JRI A;  2QQ9 A;  1KC8 U;  3MKD A;  4OMM A;  1NG2 A;  2PUO B;  1VQK T;  1OYX A;  1E6H A;  2PTK A;  1VQO Q;  2OAU A;  1N27 A;  1NZ9 A;  2O01 E;  4LDX A;  5CR2 A;  4C8Q C;  4J9G A;  4ELZ C;  4GBQ A;  5FRM A;  4Z88 A;  4BI3 A;  1ZSZ A;  4E7J A;  1XNI A;  2RH2 A;  4M75 E;  3CCM T;  2OX7 A;  3HHT B;  3L2Z A;  4IIM A;  3V7R A;  2O9S A;  5GAM g;  5D6W A;  2L0A A;  2CT3 A;  1VQ7 Q;  1YCY A;  2CZ0 B;  4PJM A;  1IRE B;  5DM7 R;  1Q86 R;  3JSC A;  1WLP B;  2RQT A;  4N4I A;  4C92 C;  4F16 A;  1AT1 B;  5KYX B;  4C8Q F;  1RAI B;  1OPL A;  2AT1 B;  2E4H A;  2LC4 A;  3QYH B;  4M78 E;  4M7A F;  2RI5 A;  2JMC A;  3TU4 K;  2P4T A;  2EYW A;  3JCM b;  4ANJ A;  3OY9 A;  3JAM E;  3GNF B;  1BI2 A;  3MEA A;  1QWE A;  1RI0 A;  1X6B A;  2DD5 A;  2E1H A;  2K2M A;  4Y91 A;  3FLG A;  1KQS S;  3CCL A;  2QA4 A;  3N5B B;  2HSE B;  3WVD B;  4C92 G;  1NEG A;  2LDM A;  2ECZ A;  3EGX B;  3S3N A;  2KRO A;  1I0C A;  2EQJ A;  2QQS A;  3QWY A;  1JQQ A;  1M90 R;  4RTY A;  1Q82 R;  3QBY A;  4ATO A;  2L89 A;  3BDL A;  3G4S A;  2MOX A;  4JZ3 A;  3J80 E;  2LQN A;  5KYX A;  1TWB A;  1G8X A;  2D0N A;  3HRS A;  5CKF A;  5C6S A;  2RF0 A;  1WHJ A;  3MP8 A;  1WJQ A;  4C8Q B;  4A54 A;  4D8K A;  3SWN B;  3MCA B;  3JCM Q;  4M78 D;  3VV0 A;  5I2S A;  1I81 A;  4HT9 A;  3CD6 A;  1OV3 A;  2RJC A;  2FG0 A;  1VQN T;  5CIU A;  3BFM A;  3CCU Q;  4ZGD B;  1N8R U;  4J5Y A;  5KYU B;  1EZZ B;  3VS4 A;  3A8G B;  4CC3 A;  3HRU A;  3CCQ A;  3CXC S;  1RI9 A;  1Y0M A;  2FVU A;  3KFV A;  2IIM A;  4MDX A;  1VQP T;  4Z8A A;  5GAM j;  1KHI A;  2CS7 A;  4N4G A;  1K8A R;  3EG3 A;  1IRX A;  5FWB A;  1IB8 A;  2E70 A;  3CME T;  2LCS A;  3VYH B;  1LOJ A;  3NMZ C;  4BE2 A;  3DLM A;  2F5T X;  3R6N A;  2ABL A;  1YHQ Q;  2FRW A;  3I55 A;  1VQ6 Q;  4B9W A;  2OTJ T;  2L3P A;  3THK A;  1YJN A;  4KUL A;  5L23 A;  3CCM A;  3QXE B;  1K76 A;  5GAN 5;  1RLP C;  2LQK A;  1PRL C;  3M4Y A;  1VQ8 A;  3CEY A;  4M75 A;  2XDB A;  4IKF A;  4N0A A;  4J9E A;  2ROL A;  2KR3 A;  1NYF A;  2KT8 A;  3SD4 A;  3MHX A;  4A4G A;  1Q7Y R;  2EJ9 A;  3PVQ A;  2A3L A;  4DEX A;  1YJN Q;  1WX6 A;  3CCM Q;  3BE3 A;  4M77 B;  2KYB A;  2L5Q A;  4BE0 A;  1W6X A;  3PT9 A;  2XK0 A;  1B07 A;  1QP3 A;  4HVW A;  1QKW A;  3CXC A;  3UPU A;  1JXM A;  2AK5 A;  4OB0 B;  2XDD A;  1ZLM A;  1KQ1 A;  2OI3 A;  4AFQ C;  5C0M A;  5J39 A;  4JLI A;  2ZPF B;  2QGG A;  2LX7 A;  1FMV A;  4QVZ A;  5I11 A;  3CC4 Q;  3JCM f;  3RR6 A;  2EYY A;  1MMN A;  3VKI A;  2KQW A;  4FT2 A;  1N9R A;  1QCN A;  2WSF E;  5LJ3 e;  1VQM A;  1H8K A;  2VXE A;  3OS5 A;  3CPW A;  3EFO B;  2CKK A;  2RHY A;  1LPL A;  2LCL A;  1PHT A;  2O2O A;  3P8H A;  2CP7 A;  1S1N A;  3C0C A;  3KUF A;  3DB4 A;  1YN8 A;  5GAN 6;  3QSU A;  1VOM A;  1JEG A;  4IUV A;  4UC4 A;  5CAI A;  2KAF A;  3FRN A;  1BIB A;  2DKG A;  1IGQ A;  4KBM B;  1MHN A;  2KXC A;  1JU5 C;  3OYE A;  5CKE A;  2PNI A;  5CKB A;  2HBW A;  3M0Q A;  3PE0 A;  3EH1 A;  4XTU A;  3EFR A;  4C92 F;  4ZN1 A;  1WJS A;  2ZGW A;  4X1V A;  1LJO A;  4OB3 B;  2VUB A;  2JZ2 A;  4HCK A;  3QZ9 B;  2JW4 A;  5FU6 B;  1VQ8 T;  3G6E T;  3I5R A;  3VU3 C;  3HPW A;  3RES A;  5CK9 A;  2JS0 A;  1M90 U;  3GIB A;  1OZ2 A;  4XU0 A;  3JCM J;  2KEA A;  2LCC A;  4F7U A;  3X25 B;  5LJ5 e;  4EPC A;  5A0G A;  1VQ5 A;  1Z9Z A;  3A8H B;  3OQ5 A;  4HCB A;  1D3B A;  2ATC B;  4M78 F;  4M7A E;  4HA8 A;  4XTV A;  3OS2 A;  2LZ6 B;  3JRZ A;  2E41 A;  2JOY A;  1ZQ1 A;  5LJ5 j;  3HKS A;  2DRM A;  4C5E A;  1EX4 A;  2QDL A;  4OB2 B;  1RL2 A;  1PSE A;  4M77 G;  3M0T A;  2H3J A;  1N8R C;  2SEM A;  4RTU A;  1U06 A;  3EG0 A;  1WNL A;  1W4S A;  1VA7 A;  4IUU A;  1V29 B;  3OSS C;  1VQ5 Q;  1K73 R;  1I8F A;  4OMO A;  3CD6 Q;  3I56 Q;  2YRV A;  3DKM A;  4Y92 A;  1SEM A;  2FL7 A;  2ROT A;  1GL5 A;  5FRO A;  2XI9 A;  1W2B P;  3EH2 A;  2RJD A;  4F7U F;  2QA4 T;  3RKY A;  2QAZ A;  4HVV A;  4X34 A;  2LJ3 A;  1OZ3 A;  3M9Q A;  2WSE E;  2F69 A;  3MPU B;  2RB6 A;  2GTJ A;  1IHW A;  2QG9 B;  2GBQ A;  2RM4 A;  2KBT A;  2E12 A;  4RG8 A;  2CUD A;  3I55 T;  4M78 B;  4CC2 A;  1NLP C;  5HK0 A;  4FW2 A;  3CCE Q;  1Y7X A;  1NJI C;  2H3E B;  4M77 F;  1UHC A;  1ZSZ C;  2KY9 A;  4ZGJ B;  4AG2 C;  1GXI E;  1X01 A;  1AWW A;  3E2U A;  3CBO A;  1ZUY A;  3A8L B;  3QPH A;  3UAT A;  8ATC B;  3ME9 A;  2JNG A;  4J6Y A;  1A0N B;  2O4X A;  3LH0 A;  2C0O A;  4TVR A;  4PJJ A;  2JN0 A;  2BIV A;  5CKH A;  2RHI A;  1LNX A;  2DL5 A;  2FPD A;  3EGU A;  4EMK C;  4GY5 A;  5I22 A;  1OUL A;  2PUK B;  1AVZ C;  1XJW B;  2QTV A;  3C12 A;  4KH1 B;  3NTI A;  1PSF A;  3RDV A;  2CDT A;  2X51 A;  3CC2 T;  4PJO E;  4OF1 A;  3CCQ T;  3CMA T;  4NOY A;  2J6F A;  4CI0 C;  1M1K R;  5LJ3 f;  2HKQ B;  1ZA1 B;  3L2Q A;  1YI2 T;  3QZ5 B;  1OPK A;  2CRE A;  2DYI A;  2QA4 Q;  1SHF A;  4JLG A;  4LNP A;  3CMA A;  1X2Q A;  4RTX A;  1ARK A;  2VB6 A;  1IHV A;  3PGG A;  3M57 A;  2HCK A;  5GMK h;  2DTO A;  4M77 E;  3VS6 A;  5LJ5 d;  4ZGE B;  1VQL Q;  1BBZ A;  3OYY A;  2GFA A;  1VQP Q;  2F2X A;  4OMQ A;  2KT1 A;  2NWM A;  1Q86 U;  4A4K A;  4F14 A;  5KE2 A;  3OYM A;  2K5I A;  4PLI A;  5GAN d;  1NYG A;  1N6A A;  2KDS A;  1VQO T;  3LW5 E;  1I5O B;  5IN1 A;  4M77 D;  2E65 A;  1K8A U;  2B86 A;  3I5S A;  1SG5 A;  2DX1 A;  2VVK A;  3QUI A;  2OTJ Q;  2FYK A;  3PNW C;  1G3T A;  1NBE B;  5KE3 A;  3TCJ A;  2MCN A;  1NE8 A;  2BE7 D;  3H8Z A;  2NUZ A;  2EPD A;  3LWI A;  1BYM A;  1N8R R;  1YWP A;  2GNC A;  2EKH A;  3VS7 A;  4C5H A;  3JB9 D;  3TQ7 P;  1M30 A;  2M0Y A;  3R6O A;  4CC7 A;  3CCS Q;  2CP5 A;  3TSZ A;  4GLK A;  3CC7 Q;  1D0X A;  1EFN A;  1UHF A;  1Q95 G;  1Q7Y U;  4D6W A;  5A0L A;  4BY6 B;  2YXY A;  3JCM W;  4ME7 A;  1MGQ A;  4XU2 A;  1KG1 A;  4FSX A;  4ESR A;  4YTL A;  3JCM g;  2YUP A;  5FU6 C;  2F2W A;  2E64 A;  1AOJ A;  2EGC A;  2J6O A;  2EGE A;  3CPF A;  4M75 F;  1QCO A;  3EG9 A;  2HNI A;  3REA B;  2K3Y A;  1FWZ A;  2HZY A;  1YI2 A;  4A4E A;  2IG0 A;  5GAM h;  1QVP A;  1X69 A;  5A2Q E;  3L1A A;  2RNA A;  1C0M A;  4EIK A;  3PMI A;  5GAM d;  1VYU A;  4MML A;  3RIR A;  4PJO C;  4FYY B;  1TUG B;  2JT4 A;  4C92 A;  4RTT A;  3OYG A;  2DA9 A;  3EGX A;  1M9S A;  2K9G A;  3CCR Q;  1K9M R;  3A8O B;  3M58 A;  1IGU A;  1YIJ A;  2VGM A;  1X43 A;  3ZBD A;  4KGZ B;  2GGR A;  5A0D A;  2RI2 A;  4E7Z A;  2KI7 A;  3TVT A;  4BDY A;  2G6F X;  1KFZ A;  2VXF A;  4C8Q A;  2RK2 A;  4OGE A;  2DVJ A;  1M8V A;  4DEY A;  3OA6 A;  3GPL A;  4K11 A;  3VS1 A;  3CME Q;  3ZL7 C;  2NUP A;  2DJQ A;  1KIK A;  2KRS A;  2WSC E;  2RJF A;  4DOV A;  4L5G A;  1RAH B;  2WAC A;  3I56 A;  1K4U S;  3M4G A;  1QCF A;  5GMK j;  1AWX A;  4PJO F;  4FW1 A;  1VQM Q;  1PC0 A;  3IQL A;  4DQ2 A;  5KH6 A;  3CQT A;  2DL8 A;  1MMG A;  3F70 A;  4OMN A;  1R77 A;  1KD1 R;  1YHQ T;  1V1C A;  2JS2 A;  2RJE A;  1WZO A;  2B8A A;  1PKS A;  1TOV A;  3CBM A;  1RUW A;  2FRY A;  2G3R A;  1J3T A;  2DTH A;  3D7S B;  2VKN A;  4BAC A;  4JJD A;  8AT1 B;  1KK7 A;  3GLX A;  2O88 A;  1D0Y A;  4BB7 A;  1WI7 A;  1VQ6 T;  3SHW A;  5KCH A;  3OYC A;  2XHC A;  2KRM A;  4ZTJ A;  2DTI A;  5FLX E;  1KHC A;  2DJZ A;  1WXB A;  3A1P A;  1WHG A;  1Y07 A;  2MYS A;  2JTE A;  3UDC A;  3S3M A;  2PU9 B;  3QYG B;  1NEB A;  4C92 D;  3VUZ A;  3NHN A;  2LVM A;  1QVG S;  4JRQ A;  2DXT A;  4OML A;  3SWN A;  2QEX T;  2YUO A;  1WHH A;  2KYM A;  2CP2 A;  2ZPI B;  4HVU A;  2R57 A;  2CYZ B;  2QEX A;  1RAD B;  4KGX B;  1T3L A;  4LDV A;  3PIP A;  4BY6 C;  1JBM A;  4WTO B;  1BI3 A;  4PFP A;  3EHQ A;  2EVR A;  3G6E A;  2ZPB B;  2ZPH B;  1WHK A;  4WCI A;  4F7U G;  4PNO A;  1UFF A;  3LYI A;  1QVF S;  3RBB B;  1ZUK A;  2DBM A;  3V8L A;  2KMT A;  2CGH A;  2HAX A;  3QHS A;  1GCQ A;  5KYN A;  1K9A A;  1NM7 A;  1BIA A;  1WQ7 A;  5IHI A;  1KC8 R;  1D1B A;  3NTH A;  1TUC A;  1NJI R;  2F1L A;  2O9V A;  5GAM e;  3QWX X;  3CCL Q;  5AYF A;  5LJ5 h;  2J06 A;  3OYB A;  1UDL A;  3UF4 A;  2V8K A;  3WVE B;  2HEQ A;  3E19 A;  1M2O A;  1M1K U;  4Y28 E;  1G5V A;  1FYN A;  3G71 A;  2GF7 A;  1AZG B;  5GMK l;  4C0F A;  4D8D A;  2DF6 A;  2K79 A;  4O5V A;  4JUV A;  4J9D A;  1KQS P;  2IPO B;  2XKO C;  1KQ2 A;  2YSQ A;  1VQ7 A;  3RMS A;  2ED0 A;  1NLO C;  2LJ0 A;  2DMO A;  1M27 C;  3A98 A;  5GAN 4;  3CMA Q;  4M75 C;  2D8J A;  3EGD B;  1JXO A;  3OMC A;  2FZG B;  5D7U A;  2DFU A;  3H0H A;  5GAN g;  1S72 A;  4M7D D;  2DIL A;  4M7A A;  4ZN3 A;  3OYL A;  2VYT A;  5I21 A;  1Y96 B;  2YLB A;  2ZAE A;  2E5Q A;  1YNZ A;  1G3S A;  2KNB B;  3EFS A;  2R5M A;  3OYA A;  1KD1 C;  2LNV A;  2QTX A;  4C8Q E;  2DL7 A;  4II1 A;  4MZP A;  2QK0 A;  4KT0 E;  1AWJ A;  2X3W D;  1YFN A;  2FPE A;  1QLY A;  1BI1 A;  2D1X A;  2FZC B;  2JVV A;  4VUB A;  4MZM A;  3O8V A;  5DLO A;  1VQ9 Q;  3V7C A;  3CPW S;  1AD5 A;  4E7H A;  4RG2 A;  1YIT T;  2OTJ A;  5GMK i;  4O6J A;  2EQU A;  1G3Y A;  2DAQ A;  2VWF A;  4FIB A;  3SFM A;  2DRK A;  3H9N A;  3HP9 A;  3JB9 F;  4M7D B;  1C1A A;  2DE0 X;  2BUD A;  2RHZ A;  1Y71 A;  2C06 A;  3MET A;  1W1F A;  1JJ2 A;  1E7O A;  3S3O A;  1RAG B;  1CSK A;  1R8O B;  4LUE A;  1AHJ B;  2CH4 A;  2P0Q A;  1SHG A;  3CC7 A;  2L3Q A;  3SEM A;  5GAN h;  1ZSZ B;  1QW1 A;  3EGD A;  4C0G A;  4EDU A;  3CCV A;  4PK4 A;  4DA4 A;  4Q5W A;  2YUQ A;  2YT6 A;  3OYI A;  3EG1 A;  3QJY A;  3X20 B;  1MUZ A;  1OI1 A;  4OMP A;  5FU7 C;  5D6Y A;  5LJ3 h;  2E10 A;  5I2M A;  1D1A A;  4CRI A;  3FC3 A;  2PZ1 A;  3FB9 A;  2FHD A;  3I55 Q;  1VQ6 A;  1GBR A;  4AFU C;  5GMK m;  2K6D A;  1LVK A;  4A4F A;  2VC8 A;  2GCX A;  2D0Q B;  5GAN j;  1QMC A;  1MMA A;  3TSW A;  3JB9 G;  4XAX B;  2P4R A;  2RD1 A;  1RAE B;  2DD4 A;  3CCS A;  5HCK A;  3CCE T;  3CCR A;  1X6G A;  2V8I A;  1UEB A;  1YIJ Q;  3HFN A;  3CCQ Q;  4C92 B;  4F7U E;  2JMA A;  2CUB A;  2C0T A;  3C4S A;  3JCM c;  3CXC P;  4B6M A;  1C6V X;  2QQB A;  1X6O A;  4JJC A;  2M0O A;  1PKT A;  1QKX A;  2DXU A;  5FWC A;  2K2V A;  3TEE A;  4KUD K;  4C8Q G;  3L2U A;  1UG1 A;  2LJ1 A;  4IIO A;  2DIQ A;  1YJW A;  3LGF A;  3VS0 A;  3GBQ A;  3QII A;  1WXT A;  1W2B A;  3C95 A;  4PL6 A;  3PVL A;  2EYX A;  2BZ8 A;  1Q86 C;  2CP0 A;  2EQM A;  4MDW A;  3OYD A;  2E3I A;  4HCZ A;  1FMK A;  1BU1 A;  4C0D B;  3CCJ T;  1Q82 C;  1PD1 A;  4PJO D;  2R58 A;  4J8O A;  2SRC A;  5GJW B;  4EMK B;  3QDF A;  4M7D G;  5FRN A;  1M1G A;  1GCQ C;  1VUB A;  3KXT A;  1RLQ C;  3M0S A;  1I4K 1;  1VQ9 T;  4LXC A;  3AHU A;  4GLM A;  2COY A;  1O9S A;  1OEB A;  2EQK A;  1YJ9 A;  4BI8 B;  3PMT A;  5KYW B;  3X24 B;  1WA7 A;  3EFO A;  1U5S A;  1CKB A;  1S72 T;  2YDL A;  2LP5 A;  1B7T A;  3JCM P;  1M2V A;  2XDP A;  5KYW A;  1I1J A;  3M53 A;  3QG1 A;  4E47 A;  2QEX Q;  2CZ6 B;  4RTV A;  4WF2 A;  1QQJ A;  1B34 B;  1VQK A;  3UA6 A;  2EYQ A;  3LH5 A;  1NJI U;  4RCC A;  4QW2 A;  1VQN Q;  1K73 U;  4J9B A;  3VRY A;  4EMK A;  7AT1 B;  1N9S A;  2EBP A;  2LX9 A;  2OTL A;  4FL6 A;  5KYU A;  2DXB A;  3I35 A;  3QDR B;  2LNH B;  2X4J A;  4AMC A;  3OMG A;  3M54 A;  2V1R A;  2F5K A;  4BD3 A;  1JO8 A;  1Y96 A;  3EAE A;  1TUD A;  2P0K A;  2RN8 A;  4KRT A;  1TS9 A;  3DLL A;  4J9H A;  4OVA A;  5KYY B;  5M9O A;  4DBQ A;  4AFZ C;  4MZT A;  1TU0 B;  4RCB A;  1XTD A;  4LN2 A;  2J05 A;  4M4Z A;  1H64 1;  3C94 A;  1BCO A;  5GAO r;  2NUT A;  1Q7Y C;  1K1Z A;  4IUR A;  2OTL Q;  4A4H A;  3BW1 A;  5GAN 3;  4B9X A;  2J7I A;  1K73 C;  3VS2 A;  4N4H A;  2DBK A;  3M59 A;  4J9F A;  5GMK e;  1VIE A;  3M0P A;  3OW2 S;  3CCR T;  1OX9 A;  2PVD B;  2ZPG B;  4J6W A;  3FEO A;  2FB7 A;  2HQH A;  2RQR A;  1GFC A;  4J6X A;  3CC2 Q;  3PFS A;  2RA2 A;  2DPP B;  2Y4Y A;  1MMD A;  1O75 A;  1GFD A;  2VGN A;  4DBR A;  2AZS A;  4J9I A;  2EYZ A;  2CZ7 B;  2E6N A;  1Q81 R;  2I2L A;  2HDA A;  2PVO B;  4PJO A;  4E7S A;  4XTW A;  1Z9Q A;  4XTX A;  4NL2 A;  4PJO G;  1WYX A;  1PM3 A;  1G2B A;  3CC4 T;  4M77 A;  4DBF A;  4JRK A;  2E6Z A;  1PWT A;  3NTK A;  2DYB A;  5DY9 A;  4OB1 B;  1TH7 A;  1UB4 A;  4R55 A;  4JJN K;  1PRM C;  2A36 A;  3MEW A;  2A08 A;  3CC7 T;  1VQ5 T;  1SSF A;  2DIG A;  1WDX A;  2Y90 A;  2BE9 B;  3GP8 A;  3OW2 P;  2QXF A;  4LD6 A;  1VQ4 A;  2XIC A;  4MMK A;  1TTH B;  1N5Z A;  3AT1 B;  3HFO A;  2X4W A;  2CZ1 B;  4RUG A;  1RAF B;  4M7A C;  1YP5 A;  4KH0 B;  5CKD A;  4JS5 A;  4Z02 A;  1WHM A;  3H41 A;  2XD0 A;  4M75 B;  3OBY A;  3GF5 A;  3VRZ A;  1U1T A;  1MV3 A;  1R0C B;  1YHQ A;  1KQS A;  3QKJ A;  2DZ9 A;  2JM9 A;  3VYG A;  2D6F A;  4IUT A;  2E5K A;  3OYH A;  3L2V A;  1VQ4 Q;  3T9N A;  2H8H A;  3V7S A;  4M7D E;  3V8K A;  2V1Q A;  2MAM A;  2IVW A;  1RAC B;  4JJB A;  5D6X A;  1K0X A;  2EKO A;  3OYK A;  3G71 Q;  3LGL A;  2RHX A;  3FIF A;  3CCU A;  1IXD A;  4DOW A;  1VQ8 Q;  2ZPE B;  1QP2 A;  1TG0 A;  3ER0 A;  3OYJ A;  1HSQ A;  2W10 A;  2LRQ A;  2M51 A;  2R5A A;  9ATC B;  1ZBX A;  2DZC A;  4QQ6 A;  1YBY A;  3ULR B;  3QJ6 A;  4OMF B;  3RKW A;  5IAY A;  4M7A G;  2BZY A;  1HJD A;  5GAN 7;  3OYN A;  1TXQ A;  2KXD A;  1YI2 Q;  3OBW A;  2EW3 A;  3GOX A;  3I9Q A;  4X9D A;  1YWO A;  5GAO n;  2JJ9 A;  3G4S Q;  2O4X B;  5GAN 8;  2ENM A;  3HSB A;  1W2B S;  4M78 G;  4QVD A;  1SSH A;  3EG9 B;  4E7K A;  5IH2 A;  3J7A F;  1YCS B;  1UGR B;  1D1C A;  3JV3 A;  1VQL A;  3X28 B;  2Y4X A;  4F17 A;  2J6K A;  1VQP A;  1G3W A;  3I56 T;  3VJP A;  2DXC A;  3RUX A;  1VQ9 A;  3M0R A;  2RI3 A;  2M9U A;  2FZK B;  3JB9 J;  2A37 A;  4KUI A;  4V2S A;  3OB9 A;  5GAO m;  3L42 A;  1IO6 A;  3FDR A;  4PJO B;  2V26 A;  3FJ5 A;  5GAN e;  1WIE A;  2MPX C;  5LJ5 g;  4PFZ A;  4JRP A;  2MWP A;  5CQY A;  4HT8 A;  2VAS A;  1D3B B;  2M16 A;  1G83 A;  3CME A;  4N0A C;  3E9G A;  1TSF A;  3PTA A;  1VQM T;  3VUB A;  1B34 A;  5CVI A;  2JTF A;  2AKK A;  1M3A A;  2XID A;  3RNJ A;  3VS3 A;  1Q81 U;  2CH4 W;  1V76 A;  4JS4 A;  2FO0 A;  4OP0 A;  4C5I A;  3A5Z B;  1KJW A;  3HL8 A;  2LMJ A;  2BTT A;  4BI4 A;  3H0F A;  1Q82 U;  1M3C A;  4E6R A;  3INZ A;  2EWN A;  2K4Y A;  1NPP A;  1RAA B;  3MP6 A;  5HY6 A;  1KD1 U;  3CCV T;  1T0J A;  2COZ A;  3LLR A;  3QO3 A;  4CC4 B;  2P84 A;  1YIT Q;  2RHU A;  4L6V 5;  1BI0 A;  3JB9 I;  1GBQ A;  2LQW A;  3A8M B;  4HKE A;  2ZCF B;  3X26 B;  3G4S T;  1QVG A;  3JCM V;  4AFS C;  3RER A;  3H6Z A;  3U23 A;  2C0I A;  4XK8 E;  4E7L A;  2DK3 A;  2DEQ A;  4KGV B;  2HKN A;  2CSI A;  4XU1 A;  1UEC A;  1M4Z A;  4BUG A;  3TRE A;  3CCJ Q;  3DB3 A;  4C5G A;  6AT1 B;  4ELY C;  1YIT A;  1VQN A;  2D8H A;  2XG8 D;  2CT4 A;  4A53 A;  1PD0 A;  4M7A B;  3M0U A;  2ED1 A;  1BB9 A;  5J26 A;  5GAO l;  4BE1 A;  4ORZ A;  4FSS A;  4R56 A;  2CSQ A;  5IXB A;  2YUN A;  1SF9 A;  5GAM f;  2L2P A;  2LT1 A;  5LL6 S;  3BY7 A;  1ZSG A;  2COW A;  2RQV A;  3MP1 A;  1ZA2 B;  3MEV A;  2QQA A;  2NYS A;  3M5A A;  3Q1J A;  4J7F A;  2X9H A;  1VYT A;  3SWN C;  4XTY A;  2HQX A;  2OTL T;  2QYZ A;  4LDY A;  3JB9 H;  2LQ8 A;  2X4X A;  2HMA A;  4PKC C;  2GTO A;  4M7D A;  1U8R A;  3CPW P;  4M7A D;  1JJ2 P;  2HD0 A;  2EJF A;  2X4Y A;  1P92 A;  4NS5 A;  3G7Z A;  3NPF A;  4C0Z A;  5CCA A;  4IUQ A;  1LCK A;  2KSS A;  5IXF A;  3LX7 A;  2EQI A;  3CCE A;  3P8D A;  4FU6 A;  4NL3 A;  1I07 A;  1UTI A;  4QQD A;  1HXD A;  2K5F A;  1Q81 C;  2HSP A;  4XTZ A;  3URG A;  2AKL A;  3OS0 A;  2CP3 A;  4FYX B;  2DNU A;  4JZ4 A;  2RK1 A;  3OW2 A;  2L3R A;  2HQE A;  1Y57 A;  4M77 C;  3ASK A;  1UGV A;  3P8B B;  5EG2 A;  3REB B;  1RAB B;  1SPK A;  2PVG B;  2E3H A;  2V8J A;  2GQI A;  1VIF A;  1I5L A;  2DER A;  5GAN f;  4LDW A;  3MJX A;  5IT9 E;  3FJP A;  2MIO A;  4FT4 A;  1GRI A;  1VQK Q;  4M7D F;  3CC2 A;  2RPN A;  1OQK A;  1KSW A;  4FCY A;  2QQR A;  2DVE A;  2JTM A;  4A63 B;  2XU8 A;  2A28 A;  1BCM A;  1XOV A;  5HK3 A;  3BDU A;  1VYV A;  4HCC A;  2NLU A;  4JDS A;  1PG5 B;  4F04 B;  1CKA A;  2O31 A;  1VQL T;  4M7D C;  1VQ7 T;  4HXJ A;  1X2K A;  2VV5 A;  5LJ3 d;  2K7A A;  2DO3 A;  2FEI A;  3JCM h;  1UJ0 A;  2DLP A;  4J83 A;  1HK9 A;  3RMQ A;  3NGP A;  3JCM e;  2PQW A;  2F2V A;  2GFU A;  2MF2 A;  4E2F B;  1T3S A;  2DL4 A;  2EJG A;  3MEU A;  2CP6 A;  4PFO A;  1S72 Q;  1D09 B;  1OU8 A;  4M78 C;  1M2V B;  4C92 E;  1WGS A;  2AHJ B;  4C0D C;  3ZEH A;  3CCV Q;  2EGA A;  2HL5 C;  4OGC A;  1K0S A;  1F1B B;  5EC7 A;  3PIO A;  2RO0 A;  2DM1 A;  1BKB A;  4E7I A;  1AZE A;  1M1K C;  1MND A;  2ZZD A;  5GAO p;  2K5L A;  4PJN A;  1ACM B;  2MMP A;  3CCU T;  2QDY B;  2BKD N;  2K57 A;  3KBG A;  4F7U B;  2K3B A;  3ZFJ A;  4RTZ A;  2YHT A;  5CO7 A;  1MV0 B;  4PLL A;  4QQG A;  1U1S A;  2KGT A;  3S6W A;  1H3H A;  1OOT A;  5AT1 B;  4LDU A;  3VS5 A;  5HKC A;  1UUE A;  1E6G A;  5KCO A;  2MI6 A;  2X3X D;  4RMO A;  2BZX A;  1HD3 A;  2RQU A;  1FX7 A;  3JCM X;  5LJ5 f;  1WJR A;  2XMF A;  2YRC A;  3OS1 A;  5J3B A;  2L3S A;  3UWN A;  4M75 G;  4JPB W;  1FMW A;  4Z89 A;  4EMG A;  1EIF A;  1X75 C;  1WFW A;  2NUP B;  2L8D A;  4RTW A;  4EMH A;  1ABQ A;  4LD9 K;  2OJ2 A;  3UT1 A;  2A0F B;  1GCP A;  1UJY A;  5FU7 B;  1QVG P;  1KC8 C;  3O5Z A;  3OSV A;  2KVQ G;  1UGS B;  1K8A C;  4C8Q D;  3SDZ A;  5DLQ E;  1ABO A;  1U3O A;  3M56 A;  2RMO A;  1OU9 A;  1MNE A;  4XU3 A;  1QWF A;  2DL3 A;  5IHN A;  4FYW B;  1WHL A;  2DET A;  2X35 A;  4ZNX A;  2A7Y A;  5KYY A;  1R0B G;  3HTR A;  1IZ6 A;  1M3B A;  2EFI A;  1QVF A;  5FW9 A;  5IHK A;  3JCM d;  1QVF P;  1ZHI A;  2JUF A;  3NFC A;  1ZBJ A;  1WPY A;  3CBP A;  2AZV A;  4DBH A;  4AG1 C;  1UGP B;  3J81 E;  1YJN T;  1D0Z A;  1M1F A;  2YLC A;  4ZTF A;  2ESW A;  1B3Q A;  1OX8 A;  2AIR B;  1YIJ T;  1UGQ B;  1SKU B;  4FYV B;  3CC4 A;  4R0K A;  1PCX A;  1WQW A;  4M78 A;  4L59 A;  3SB2 A;  3E9F A;  4LE9 A;  4BDZ A;  2KK4 A;  4X9C A;  3UA7 A;  3OYF A;  3M55 A;  3L2R A;  1K9M C;  2EAY A;  2Z0W A;  1VQ4 T;  1YJW Q;  3G1J A;  2M1H A;  5LJ3 j;  1JB0 E;  2GQV A;  1SRM A;  4QT7 A;  1ZX6 A;  3G71 T;  2RQW A;  1WXU A;  3RKX A;  3V8J A;  2LTO A;  2QAS A;  1JJ2 S;  2YRD A;  2OAW A;  3MO8 A;  1T0H A;  5CQX A;  1YJ9 T;  3L2W A;  4FM4 B;  4RKU E;  2YWW A;  4IUP A;  3CCS T;  2HBP A;  2MK5 A;  3CCJ A;  4J9C A;  3GNG A;  2HL3 A;  2LT4 A;  3EHR A;  2W0Z A;  4QKU A;  4M75 D;  1K9M U;  1M90 C;  1PNJ A;  3HRT A;  2I0N A;  3LWH A;  4P5N A;  1ZUU A;  1X27 A;  2M02 A;  2JM8 A;  2QI2 A;  1UE9 A;  1M8M A;  1YJW T;  1BK2 A;  2QGF B;  3WXM B;  3E1S A;  1HYO A;  1M5Q 1;  2FPF A;  2KRN A;  2JXB A;  4XQ3 A;  3CCL T;  2MWO A;  4PJL A;  2P0P A;  1XQH A;  5GAO q;  1NPR A;  1VQO A;  4JRI A;  1DJ7 B;  1H3Z A;  4AT1 B;  2KE9 A;  2D9T A;  4LUD A;  2NUT B;  1SRL A;  4J7I A;  5ECA A;  5L8R E;  1YJ9 Q;  2DEU A;  5GAN 2;  3G6E Q;  1AEY A;  3H0I A;  2EIF A;  1AWO A;  4QVC A;  5GJV B;  2K3X A;  1H92 A;  1W70 A; 
#chains in the Genus database with same CATH homology
 3CCQ T;  2DK3 A;  2GCX A;  2D0Q B;  4NOY A;  4CI0 C;  5LJ3 g;  1FXX A;  1JRI A;  2DEQ A;  2QQ9 A;  4XU1 A;  5LJ3 f;  1KC8 U;  1M4Z A;  4BUG A;  3TRE A;  2PUO B;  3L2Q A;  1YI2 T;  1VQK T;  3QZ5 B;  1OYX A;  3JB9 G;  3DB3 A;  4XAX B;  4C5G A;  2RD1 A;  4JLG A;  2DD4 A;  4ELY C;  3CMA A;  3CCS A;  1YIT A;  2OAU A;  3PGG A;  1N27 A;  1NZ9 A;  3M57 A;  3CCE T;  3CCR A;  1VQN A;  2O01 E;  5GMK h;  2V8I A;  1UEB A;  4LDX A;  2XG8 D;  5CR2 A;  4C8Q C;  3HFN A;  2DTO A;  4M77 E;  4ELZ C;  4A53 A;  4C92 B;  4F7U E;  4M7A B;  5LJ5 d;  4ZGE B;  5FRM A;  4BI3 A;  3OYY A;  3C4S A;  5J26 A;  3JCM c;  2GFA A;  5GAO l;  4E7J A;  1XNI A;  2RH2 A;  4M75 E;  4BE1 A;  4R56 A;  3CCM T;  1Q86 U;  3HHT B;  2QQB A;  1X6O A;  3L2Z A;  4A4K A;  2M0O A;  5GAM f;  5KE2 A;  3V7R A;  5GAM g;  5D6W A;  2DXU A;  2LT1 A;  3OYM A;  2K5I A;  5LL6 S;  3BY7 A;  2K2V A;  4PLI A;  5GAN d;  3TEE A;  4KUD K;  1N6A A;  2KDS A;  1YCY A;  2CZ0 B;  3MP1 A;  3MEV A;  1VQO T;  1IRE B;  2QQA A;  5DM7 R;  3LW5 E;  3M5A A;  3JSC A;  4C8Q G;  3L2U A;  5IN1 A;  4N4I A;  4M77 D;  4C92 C;  3Q1J A;  2E65 A;  4J7F A;  1K8A U;  4C8Q F;  3SWN C;  4XTY A;  2DIQ A;  1YJW A;  3LGF A;  2HQX A;  3QUI A;  3QII A;  2OTL T;  3CC2 T;  2LC4 A;  2FYK A;  3QYH B;  4M78 E;  1W2B A;  3PNW C;  4LDY A;  1G3T A;  5KE3 A;  4M7A F;  2RI5 A;  3JB9 H;  3C95 A;  2LQ8 A;  4PL6 A;  2X4X A;  3TCJ A;  1NE8 A;  3TU4 K;  3H8Z A;  4PKC C;  2P4T A;  1Q86 C;  4M7D A;  1U8R A;  4M7A D;  3JCM b;  2HD0 A;  2EJF A;  2EQM A;  2X4Y A;  1P92 A;  3JAM E;  3OY9 A;  3LWI A;  4NS5 A;  1BYM A;  3G7Z A;  3GNF B;  1BI2 A;  4MDW A;  4C0Z A;  5CCA A;  3OYD A;  3MEA A;  4IUQ A;  1RI0 A;  2KSS A;  4C5H A;  3JB9 D;  4HCZ A;  4C0D B;  2DD5 A;  2E1H A;  3CCJ T;  3LX7 A;  1Q82 C;  4Y91 A;  3CCE A;  3P8D A;  3FLG A;  4FU6 A;  4NL3 A;  2R58 A;  4PJO D;  1KQS S;  4J8O A;  3CCL A;  2QA4 A;  3N5B B;  3R6O A;  3WVD B;  4C92 G;  4GLK A;  4EMK B;  2LDM A;  4M7D G;  4QQD A;  5FRN A;  1HXD A;  2K5F A;  1Q81 C;  1M1G A;  3S3N A;  1Q7Y U;  4D6W A;  5A0L A;  4XTZ A;  4BY6 B;  2EQJ A;  3URG A;  1VUB A;  2QQS A;  3OS0 A;  3KXT A;  4ME7 A;  3JCM W;  1I4K 1;  1MGQ A;  4XU2 A;  1VQ9 T;  1KG1 A;  4FSX A;  3AHU A;  2RK1 A;  3OW2 A;  3QBY A;  4ATO A;  4YTL A;  2L89 A;  3BDL A;  2EQK A;  1O9S A;  2L3R A;  2HQE A;  3G4S A;  3JCM g;  4M77 C;  3ASK A;  5FU6 C;  1YJ9 A;  5EG2 A;  3P8B B;  4BI8 B;  2PVG B;  2E64 A;  3PMT A;  2V8J A;  3J80 E;  3CPF A;  4M75 F;  3X24 B;  1VIF A;  3HRS A;  5CKF A;  5C6S A;  1I5L A;  2HNI A;  5GAN f;  3MP8 A;  4LDW A;  2K3Y A;  1WJQ A;  4C8Q B;  4A54 A;  4PJO E;  1FWZ A;  1YI2 A;  3SWN B;  3FJP A;  3MCA B;  4M78 D;  3VV0 A;  4A4E A;  5I2S A;  4FT4 A;  3JCM Q;  5IT9 E;  1S72 T;  1I81 A;  2IG0 A;  5GAM h;  4HT9 A;  3CD6 A;  3JCM P;  2XDP A;  2RJC A;  4M7D F;  1QVP A;  1VQN T;  5CIU A;  3CC2 A;  5A2Q E;  3L1A A;  3M53 A;  3QG1 A;  4E47 A;  2QQR A;  2CZ6 B;  2DVE A;  2JTM A;  3BFM A;  4WF2 A;  4ZGD B;  2XU8 A;  3PMI A;  5GAM d;  1N8R U;  4J5Y A;  1B34 B;  1VQK A;  1XOV A;  5HK3 A;  4MML A;  3BDU A;  3A8G B;  3RIR A;  4HCC A;  4PJO C;  2EYQ A;  2NLU A;  4JDS A;  1NJI U;  3HRU A;  3CCQ A;  4RCC A;  4C92 A;  3CXC S;  3OYG A;  2FVU A;  4QW2 A;  1M9S A;  1K73 U;  3A8O B;  4MDX A;  3M58 A;  4EMK A;  1VQP T;  1N9S A;  1YIJ A;  2LX9 A;  2VGM A;  2OTL A;  4FL6 A;  1VQL T;  3ZBD A;  5GAM j;  1KHI A;  2CS7 A;  2DXB A;  4N4G A;  5A0D A;  4M7D C;  3QDR B;  2RI2 A;  2X4J A;  1VQ7 T;  3OMG A;  2VV5 A;  5LJ3 d;  2E70 A;  2DO3 A;  3M54 A;  3JCM h;  3CME T;  3VYH B;  1LOJ A;  4BE2 A;  2F5K A;  4BD3 A;  3DLM A;  4BDY A;  2F5T X;  1Y96 A;  3EAE A;  4J83 A;  2P0K A;  1HK9 A;  3RMQ A;  3JCM e;  2PQW A;  3DLL A;  2GFU A;  2VXF A;  3I55 A;  4OVA A;  4B9W A;  2MF2 A;  5M9O A;  2OTJ T;  4C8Q A;  4MZT A;  4RCB A;  1YJN A;  2RK2 A;  2EJG A;  3MEU A;  4OGE A;  1M8V A;  1XTD A;  4KUL A;  4M78 C;  4C92 E;  3CCM A;  1WGS A;  3QXE B;  3OA6 A;  1H64 1;  3C94 A;  3GPL A;  2AHJ B;  4C0D C;  5GAO r;  1Q7Y C;  3ZEH A;  4IUR A;  2WSC E;  5GAN 5;  2RJF A;  4A4H A;  4L5G A;  4DOV A;  2LQK A;  2WAC A;  3BW1 A;  4B9X A;  5GAN 3;  3I56 A;  4OGC A;  1K73 C;  3M4Y A;  1VQ8 A;  3CEY A;  4M75 A;  3M4G A;  4N4H A;  3PIO A;  2RO0 A;  5GMK j;  4IKF A;  2XDB A;  1BKB A;  4PJO F;  3M59 A;  4E7I A;  5GMK e;  1VIE A;  1M1K C;  4N0A A;  4DQ2 A;  2ZZD A;  5KH6 A;  5GAO p;  2K5L A;  3CCR T;  3OW2 S;  3F70 A;  2PVD B;  1YHQ T;  2ZPG B;  4J6W A;  2MMP A;  2RJE A;  2FB7 A;  3FEO A;  3MHX A;  3SD4 A;  4A4G A;  2EJ9 A;  4J6X A;  2A3L A;  2B8A A;  3PFS A;  3CCU T;  2QDY B;  2BKD N;  2RA2 A;  2K57 A;  2DPP B;  3KBG A;  3CBM A;  2Y4Y A;  4F7U B;  2G3R A;  1O75 A;  2DTH A;  3ZFJ A;  2VGN A;  4M77 B;  2L5Q A;  2YHT A;  4BE0 A;  5CO7 A;  4BAC A;  3PT9 A;  2XK0 A;  3GLX A;  1VQ6 T;  2CZ7 B;  2E6N A;  4PLL A;  1QP3 A;  4BB7 A;  2I2L A;  4PJO A;  2PVO B;  4XTW A;  4XTX A;  5KCH A;  3OYC A;  4NL2 A;  2XHC A;  4QQG A;  4PJO G;  1U1S A;  3CXC A;  4ZTJ A;  3S6W A;  3UPU A;  2DTI A;  5FLX E;  4M77 A;  1KHC A;  3CC4 T;  4OB0 B;  2DJZ A;  4LDU A;  2XDD A;  4JRK A;  1KQ1 A;  2E6Z A;  3NTK A;  5HKC A;  5DY9 A;  1Y07 A;  4OB1 B;  5KCO A;  2MI6 A;  1TH7 A;  4RMO A;  5C0M A;  5J39 A;  4JLI A;  2ZPF B;  1UB4 A;  1FX7 A;  3UDC A;  3S3M A;  3JCM X;  4R55 A;  2PU9 B;  4QVZ A;  1WJR A;  5LJ5 f;  4JJN K;  3QYG B;  3OS1 A;  4C92 D;  3VUZ A;  3MEW A;  3JCM f;  2LVM A;  5J3B A;  1QVG S;  4JRQ A;  2DXT A;  2QEX T;  3SWN A;  3CC7 T;  3UWN A;  4M75 G;  1VQ5 T;  1SSF A;  2DIG A;  3VKI A;  2Y90 A;  2ZPI B;  3GP8 A;  2QXF A;  4LD6 A;  1VQ4 A;  2KQW A;  2R57 A;  4EMG A;  1EIF A;  2CYZ B;  2XIC A;  4FT2 A;  4MMK A;  2QEX A;  1X75 C;  3HFO A;  2X4W A;  2CZ1 B;  4LDV A;  2L8D A;  3PIP A;  1N9R A;  4M7A C;  4BY6 C;  1JBM A;  1BI3 A;  2WSF E;  4EMH A;  5CKD A;  5LJ3 e;  1VQM A;  4JS5 A;  4LD9 K;  4Z02 A;  3UT1 A;  5FU7 B;  2VXE A;  3OS5 A;  3G6E A;  3CPW A;  2ZPB B;  2ZPH B;  1KC8 C;  3OSV A;  2CKK A;  2XD0 A;  2KVQ G;  4M75 B;  3OBY A;  4F7U G;  2RHY A;  3GF5 A;  4PNO A;  1UGS B;  1K8A C;  4C8Q D;  3LYI A;  1QVF S;  1U1T A;  2LCL A;  3SDZ A;  1KQS A;  5DLQ E;  1YHQ A;  3QKJ A;  2DZ9 A;  3M56 A;  3VYG A;  3P8H A;  4IUT A;  2D6F A;  3OYH A;  3V8L A;  2KMT A;  2CGH A;  3KUF A;  3QHS A;  4XU3 A;  3L2V A;  2HAX A;  3CD6 T;  3DB4 A;  3T9N A;  1BIA A;  1WQ7 A;  3V7S A;  5GAN 6;  3QSU A;  4M7D E;  4IUV A;  3V8K A;  4UC4 A;  3NTH A;  5CAI A;  2X35 A;  2KAF A;  3FRN A;  2A7Y A;  2IVW A;  2MAM A;  1BIB A;  2DKG A;  1IZ6 A;  5GAM e;  4KBM B;  5D6X A;  1MHN A;  2EKO A;  3OYK A;  2EFI A;  3OYE A;  5CKE A;  5AYF A;  1QVF A;  5LJ5 h;  3JCM d;  3LGL A;  2RHX A;  3FIF A;  3OYB A;  1ZHI A;  2JUF A;  3CCU A;  2V8K A;  3NFC A;  5CKB A;  1WPY A;  1QP2 A;  2ZPE B;  3CBP A;  3ER0 A;  3WVE B;  4DOW A;  3E19 A;  3OYJ A;  1M1K U;  2LRQ A;  4XTU A;  3EFR A;  4Y28 E;  1G5V A;  3J81 E;  1UGP B;  1YJN T;  4C92 F;  2R5A A;  4ZN1 A;  3G71 A;  1M1F A;  1WJS A;  2GF7 A;  1ZBX A;  2YLC A;  4ZTF A;  2DZC A;  4QQ6 A;  2ZGW A;  1LJO A;  5GMK l;  4OB3 B;  4C0F A;  1YIJ T;  1UGQ B;  2VUB A;  2JZ2 A;  1YBY A;  3QZ9 B;  4O5V A;  3CC4 A;  4JUV A;  5FU6 B;  3QJ6 A;  1VQ8 T;  1WQW A;  3G6E T;  4OMF B;  3RKW A;  2XKO C;  4M78 A;  5IAY A;  3VU3 C;  4M7A G;  1KQ2 A;  3HPW A;  1VQ7 A;  4L59 A;  3RMS A;  3SB2 A;  5GAN 7;  3E9F A;  3RES A;  3OYN A;  5CK9 A;  4BDZ A;  2KK4 A;  3OBW A;  4X9C A;  5GAN 4;  3OYF A;  3L2R A;  3M55 A;  1M90 U;  1K9M C;  3GIB A;  1OZ2 A;  2EAY A;  4XU0 A;  3GOX A;  3JCM J;  4M75 C;  4X9D A;  2LCC A;  4F7U A;  3X25 B;  5LJ5 e;  5GAO n;  1VQ4 T;  2M1H A;  4EPC A;  5A0G A;  3OMC A;  5LJ3 j;  1JB0 E;  5GAN g;  1VQ5 A;  2O4X B;  3OQ5 A;  3A8H B;  5GAN 8;  1S72 A;  4HCB A;  3HSB A;  2GQV A;  4M7D D;  1D3B A;  1W2B S;  4M78 G;  4M7A A;  4QVD A;  4ZN3 A;  3OYL A;  2VYT A;  5I21 A;  1Y96 B;  2YLB A;  4M78 F;  4M7A E;  4HA8 A;  4E7K A;  3G71 T;  4XTV A;  3OS2 A;  3JRZ A;  2E41 A;  2E5Q A;  3J7A F;  1G3S A;  2JOY A;  1ZQ1 A;  3EFS A;  5LJ5 j;  1UGR B;  3HKS A;  2R5M A;  3OYA A;  1KD1 C;  2LNV A;  3RKX A;  2QTX A;  4C5E A;  4C8Q E;  3V8J A;  3X28 B;  1VQL A;  2Y4X A;  4OB2 B;  4II1 A;  2LTO A;  4MZP A;  1VQP A;  1RL2 A;  1PSE A;  4KT0 E;  1JJ2 S;  1G3W A;  4M77 G;  3I56 T;  3VJP A;  2DXC A;  3RUX A;  2H3J A;  1VQ9 A;  2RI3 A;  2M9U A;  1N8R C;  1BI1 A;  3JB9 J;  4KUI A;  3MO8 A;  4V2S A;  3OB9 A;  5GAO m;  5CQX A;  1YJ9 T;  1WNL A;  1W4S A;  2JVV A;  3L42 A;  5GAN j;  3L2W A;  4VUB A;  4IUU A;  1V29 B;  3FDR A;  3O8V A;  3OSS C;  4MZM A;  3V7C A;  5DLO A;  4PJO B;  3CPW S;  5GAN e;  4E7H A;  1I8F A;  4RG2 A;  4FM4 B;  2YRV A;  4RKU E;  3DKM A;  5LJ5 g;  4IUP A;  3CCS T;  2HBP A;  5GMK i;  4O6J A;  4JRP A;  1YIT T;  3CCJ A;  2OTJ A;  3GNG A;  2EQU A;  2FL7 A;  2MWP A;  2LT4 A;  5CQY A;  1G3Y A;  5FRO A;  4HT8 A;  2DAQ A;  4FIB A;  2XI9 A;  3SFM A;  3HP9 A;  1D3B B;  2M16 A;  4M75 D;  1K9M U;  3JB9 F;  1M90 C;  4M7D B;  3CME A;  3HRT A;  3E9G A;  4N0A C;  2RJD A;  4P5N A;  4F7U F;  3LWH A;  3PTA A;  2QA4 T;  1VQM T;  3RKY A;  3VUB A;  2BUD A;  2RHZ A;  1Y71 A;  1B34 A;  4X34 A;  2C06 A;  3MET A;  1JJ2 A;  5CVI A;  1OZ3 A;  2JTF A;  3M9Q A;  2WSE E;  3S3O A;  2XID A;  2QI2 A;  2F69 A;  1R8O B;  2RB6 A;  1YJW T;  1Q81 U;  4JS4 A;  1AHJ B;  2RM4 A;  2E12 A;  4OP0 A;  4RG8 A;  4C5I A;  3A5Z B;  3I55 T;  2P0Q A;  4M78 B;  3HL8 A;  3WXM B;  3CC7 A;  3E1S A;  5HK0 A;  3CMA T;  5GAN h;  1QW1 A;  1Y7X A;  4BI4 A;  1NJI C;  1M5Q 1;  4M77 F;  1Q82 U;  4C0G A;  3INZ A;  4EDU A;  3CCV A;  2EWN A;  4XQ3 A;  2K4Y A;  1NPP A;  2KY9 A;  3MP6 A;  3CCL T;  2MWO A;  4ZGJ B;  1GXI E;  1X01 A;  2P0P A;  3CBO A;  5HY6 A;  1XQH A;  3CCV T;  3A8L B;  3QPH A;  4DA4 A;  1KD1 U;  5GAO q;  4Q5W A;  3ME9 A;  2JNG A;  3LLR A;  3QO3 A;  4J6Y A;  2O4X A;  3OYI A;  1NPR A;  3LH0 A;  3QJY A;  4TVR A;  1VQO A;  4JRI A;  1DJ7 B;  3X20 B;  1H3Z A;  2JN0 A;  2RHU A;  2D9T A;  2BIV A;  4L6V 5;  1BI0 A;  1OI1 A;  5CKH A;  2RHI A;  3JB9 I;  1LNX A;  4J7I A;  4EMK C;  4GY5 A;  5FU7 C;  5D6Y A;  5L8R E;  5GAN 2;  5LJ3 h;  3A8M B;  2E10 A;  2ZCF B;  4HKE A;  5I2M A;  3X26 B;  4CRI A;  2EIF A;  3FC3 A;  2PUK B;  3FB9 A;  2FHD A;  3G4S T;  1QVG A;  1VQ6 A;  3C12 A;  3JCM V;  3NTI A;  4QVC A;  3RER A;  1PSF A;  3H6Z A;  2K3X A;  5GMK m;  4A4F A;  2VC8 A;  4XK8 E;  4E7L A;  4OF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...