5GAMf

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
molecule tags Transcription
total genus 8
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamf00
1JBMA 3FJPA 3PGGA 3JCMc 4HT8A 4M7AC 4EMKA 1TH7A 2E41A 5LJ5g 4M77E 3JCMd 4M7DG 5GAOl 4Y91A 4PJOA 2K57A 2EAYA 3V7SA 2YLCA 3RERA 4F7UA 5GAN3 4X9DA 3V8LA 3JCMJ 5GAN8 2DZCA 4A54A 1HK9A 4F7UG 2YHTA 4M7AF 5LJ3f 4M78A 4EMGA 4EMHA 5GMKm 5GAMj 4M7DC 3SWNA 3V7RA 2JN0A 5LJ3j 1WQWA 4M75A 3FB9A 5I21A 2E65A 5CAIA 2YLBA 2ZGWA 4HA8A 3BW1A 4PNOA 3JB9J 5DY9A 4EMKC 5GAMe 3AHUA 5GAN6 4PJOC 3QUIA 4M77B 5LJ5e 1N9SA 5GMKl 2CGHA 4XQ3A 4M7DF 4RCBA 4NL2A 4C8QB 3V7CA 1BIBA 3RKXA 3RUXA 4M77A 2E1HA 1U1SA 3HFNA 4J6WA 2E64A 3JB9I 4A53A 4C8QE 4XTYA 4M78C 4PJOF 4C92E 3JCMe 3V8KA 4M77D 1M5Q1 1LOJA 5GMKh 5GANh 2VXEA 3JCMb 4M77G 4F7UF 2EJGA 3BFMA 3SWNC 5GAMf 5LJ5f 4J6XA 3JCMP 1M8VA 1BIAA 4M75C 4C8QD 3RKWA 1U1TA 3JCMX 1YCYA 4C8QG 3QO3A 4OP0A 5LJ5j 2RD1A 5GANd 1WNLA 2VXFA 4M78F 4MMKA 5GAN2 3JCMW 3JCMf 4DQ2A 5GAN7 5GAOp 4M7AB 1I5LA 4WF2A 3RKYA 4XU0A 3EFSA 1N9RA 2EWNA 1LJOA 3JB9D 3FIFA 2DEQA 4M75F 4N0AA 5LJ3g 2DTOA 4M77C 1D3BB 3JB9G 4M7AE 2RB6A 1WPYA 2DXTA 1Y96B 5GANg 2Y90A 4J5YA 4C92B 5GAOr 1KQ2A 4XTUA 1D3BA 4M7AD 5GAMh 1JRIA 1Y96A 2I2LA 3M4GA 5LJ3h 4M7AG 3INZA 3BY7A 4J6YA 4RCCA 1I81A 3BDUA 3L2ZA 4XU1A 4C8QA 2DZ9A 4M77F 4C92A 4QVDA 3L1AA 5LJ3e 4XTWA 2DTIA 2DVEA 4QVCA 5GAOq 5GAN5 4C92D 4JRKA 4C8QF 4V2SA 4M7DE 3V8JA 5LJ3d 4C92G 4NOYA 2DKGA 3VU3C 1H641 4PJOB 4XU2A 1B34B 3HFOA 3SB2A 3JCMV 4N0AC 2EJ9A 1X01A 2HNIA 2EJFA 4PJOE 2DJZA 2RM4A 1I4K1 2DTHA 1KQ1A 1WQ7A 1LNXA 5GMKe 5GANe 5GAMg 1B34A 3JB9F 4F7UE 5GAOn 2DXUA 1HXDA 5GMKi 4M7AA 4PJOD 4M78B 1I8FA 4JRIA 4C8QC 4PJOG 3QSUA 4C92C 5GAN4 3JCMg 3SWNB 4HT9A 3RIRA 4M78E 1MGQA 2RA2A 4M75B 4X9CA 5LJ5h 2FYKA 3HSBA 2E10A 4JLIA 5GANf 3GIBA 4M7DB 4M75E 4JUVA 4M78D 4XTZA 3JCMQ 3EFRA 2QTXA 5GMKj 4XU3A 4MMLA 4M78G 5GAOm 3JCMh 5GAMd 4XTXA 4C92F 5LJ5d 5GANj 2VC8A 4M7DA 4EMKB 3JB9H 4M75D 3QHSA 4XTVA 2FB7A 4M75G 4F7UB 4NL3A 3RESA 4M7DD
chains in the Genus database with same CATH superfamily
3FJPA 4HT8A 2K3XA 2J6KA 3G4SQ 2CS7A 2P4TA 1WYXA 4OGEA 1OPKA 2EYYA 5CKBA 2DD4A 2KRNA 2DZCA 2K4YA 4KT0E 2FG0A 2RHZA 3CCVT 1YITQ 1GFDA 4LDYA 4OF1A 3LH5A 3FRNA 4VUBA 3I5RA 2RI2A 4HA8A 5DY9A 4P5NA 4C5HA 3OY9A 2O2OA 1UEBA 1A0NB 3EG3A 1X2KA 1D0ZA 1RACB 3OS5A 1JU5C 1LOJA 2RHUA 1WGSA 1T3SA 3SWNC 2ABLA 1TS9A 4A63B 1M2OA 2DA9A 3JCMX 1D0YA 1C6VX 3LWHA 4BDYA 3G4SA 3CC4Q 4MZPA 3JCMf 4E7JA 1M1GA 1N9RA 1AWOA 1G5VA 4M77C 5M9OA 1D3BB 3G71Q 5A2QE 4RKUE 2LX9A 1YITA 1H8KA 1KQ2A 1O9SA 4GLKA 4KUIA 1IRXA 3VS7A 4M7AG 2COZA 1YJNA 4M77F 2PNIA 4QVCA 2JXBA 4KUDK 2KYMA 4V2SA 4NOYA 4IUQA 4X34A 4JPBW 4XU2A 3SB2A 2QEXQ 4ZGJB 3MP8A 1KQSP 4KH1B 2NUPA 3CCEQ 2QI2A 1BKBA 4KRTA 2CT3A 1D1CA 1TUGB 3EGUA 2KXCA 3SWNB 2DL3A 4D6WA 3CC4A 2GQVA 1NBEB 3VUZA 1RAGB 2D8JA 2GCXA 2EPDA 3G71A 2RNAA 4EMKB 1KQSA 4J9HA 3TU4K 2FB7A 2AK5A 2YWWA 3R6OA 2OJ2A 2Y4XA 3GLXA 4M7DG 2LP5A 3I55Q 3CMAT 3VS0A 3URGA 4OB0B 3HP9A 3KFVA 2QEXA 2ZPBB 3A8GB 1MNEA 3M57A 4EMHA 2XHCA 2LNHB 1GCQC 3CCEA 3HL8A 1W70A 3BW1A 4R56A 2LX7A 4PJOC 3UA7A 1V1CA 5KH6A 2GQIA 3G4ST 3RUXA 1ABOA 2XKOC 2M51A 4PJOF 1JEGA 5KE3A 4F7UF 1B3QA 5LJ5f 2CSQA 3H6ZA 1YITT 4B9WA 1KQSS 2X3WD 2KRMA 1SEMA 2RK2A 3M59A 2JUFA 2YRCA 1UDLA 2JZ2A 1WPYA 3UPUA 2LT1A 4C0ZA 1NLOC 1R0BG 1UHCA 1IB8A 4UC4A 3M0SA 4F17A 3BY7A 3RMSA 4RCCA 3BDUA 1JXOA 2D9TA 1K4US 4ZN1A 4BD3A 4C8QF 1VIFA 3CCLQ 4OMFB 4QKUA 1AWJA 4PJOB 4N0AC 3CC4T 2EJFA 1WQ7A 3U23A 5GANe 2L3RA 2QGFB 1IREB 4KH0B 4BUGA 2DL5A 3Q1JA 3OYLA 3F70A 1SF9A 4C92C 5GAN4 3OYKA 2RA2A 2DLPA 1Y0MA 4EIKA 3EH2A 1WJRA 2VB6A 4IIMA 4M78D 4ORZA 2H8HA 3IQLA 5GMKj 4XU3A 4C92F 2KR3A 2E3IA 4N4IA 4AFQC 1EIFA 1QKWA 1TH7A 2L3SA 4E2FB 5I11A 2L2PA 3CCET 1MMGA 2EAYA 2QQBA 5IXFA 1QKXA 4BDZA 4X9DA 3CCLA 2J06A 4HVVA 2C0TA 1VOMA 1OU9A 3SWNA 2EFIA 2P0PA 3H0HA 3NHNA 3RBBB 2DAQA 1Q81R 4PNOA 1WXTA 4GY5A 3AHUA 2KQWA 1NEGA 5J3BA 4JLGA 2KDSA 3QDRB 3RKXA 4OMMA 4M77A 1WDXA 3I55T 1QVGS 2CT4A 1NM7A 1M5Q1 4IURA 1KIKA 1YJWA 3FLGA 3HPWA 3LLRA 5FWCA 2VXFA 4MMKA 4ESRA 1N8RU 4HCZA 1VQ6A 2EWNA 1ZBXA 3OB9A 2K5FA 4FT2A 4BY6B 2RB6A 2EBPA 3I9QA 1MHNA 4C0FA 1MUZA 2G3RA 3OYNA 1VQ4Q 1I81A 2BIVA 5FU6C 3L2UA 1BI1A 1WIEA 4RTWA 3M55A 2VYTA 4LN2A 2V8IA 3ZFJA 4HCBA 3EGDB 1BI0A 4J9GA 3QBYA 1RL2A 1M3AA 4M78E 1VQMA 4J8OA 2X35A 2CSIA 2MK5A 1TTHB 2DO3A 3VJPA 1RAHB 3CXCP 3CCLT 1GCQA 2DD5A 3CCMA 4M75G 1E6GA 3J7AF 1Y71A 1W4SA 3PGGA 4M7AC 2C0OA 4PJOA 2K7AA 1VQ4A 4F7UA 2MI6A 2XICA 2E6NA 4J9FA 5FU6B 3MEAA 1OPLA 5KYNA 3PVLA 4M7AF 4JDSA 2CZ1B 2FVUA 3CXCA 2YXYA 5GAMj 3MKDA 5I21A 1UG1A 3X25B 2XDBA 4QT7A 1YJ9Q 1RLQC 3EG2A 2VUBA 4FW2A 4D8KA 2DPPB 3RDVA 2QA4A 3WVDB 1Q81C 1K73U 2DFUA 5GMKh 2COWA 4M77G 3JCMP 2K5LA 1WX6A 2DNUA 1BIAA 1S1NA 2A28A 4QW2A 4IUTA 1QQJA 3QO3A 4BI3A 1QCFA 2X51A 4E47A 3VS6A 2QASA 2XIDA 5GAN2 4PJLA 1WFWA 4HKEA 4QQGA 5GAN7 4M7AB 4XU0A 4FU6A 2DETA 4N0AA 1AOJA 2EW3A 3M56A 3EG0A 3OSVA 3WVEB 1VYUA 2Y90A 1ABQA 4J5YA 5GAOr 4CRIA 5IHIA 4C92A 4MDWA 3CXCS 1WXUA 5IN1A 2VVKA 1B34B 3UDCA 2LRQA 2DJZA 2RM4A 4ZGEB 3OYDA 1NZ9A 1OX8A 1NLPC 3ZEHA 4J7IA 4PK4A 3QJYA 3TVTA 2DERA 2ATCB 2IG0A 5LL6S 1VQ4T 1SKUB 3OBYA 4M7DB 1OOTA 4Z8AA 4DOWA 5DLQE 4RTYA 3OYJA 1W2BP 4C5EA 3CPFA 5FLXE 3L2RA 1LPLA 1AT1B 3EGDA 5HY6A 3H9NA 1VQ7A 3TSZA 1WHLA 1HK9A 4F7UG 2V1QA 3CCQA 2GTJA 3V7RA 1VYVA 1WQWA 1H92A 2CP0A 1W2BA 4LDXA 1NYGA 2GFAA 2JOYA 1UB4A 2XMFA 3CEYA 4XK8E 2KRSA 4QVZA 2ED1A 2E64A 5CCAA 2AKKA 2KE9A 1FYNA 1I07A 3UATA 4C8QG 5LJ5j 2FZCB 3M9QA 2DM1A 4RG8A 5DM7R 1YJ9T 1PRLC 3JB9D 2E5QA 2HCKA 1WXBA 5ECAA 1VQOQ 3OW2P 2K79A 5GAMh 1RUWA 3EAEA 2OI3A 1KD1U 5FU7B 2X3XD 1M1KU 2O01E 4JRKA 1U3OA 2QQSA 1M3CA 4C92G 2DMOA 2FEIA 3LWIA 1I4K1 2DIQA 5GAMg 3G1JA 4Y28E 3OW2A 1VQKT 4AG2C 3J80E 3GP8A 4M7AA 1TWBA 2PUOB 2EQKA 3CC2Q 1KFZA 3DLMA 2O9VA 4A4KA 1VQLQ 3QWYA 3EFRA 3M58A 1ZX6A 2DBMA 3JCMh 4C0DC 2F1LA 1VQOA 2F2VA 3ASKA 2LJ3A 1U5SA 1JQQA 5LJ3e 3OYFA 3GBQA 3JCMd 4JS5A 2VGNA 1Y57A 2QXFA 1RAIB 1N8RR 2QYZA 3BDLA 2BE7D 1YWOA 4J9DA 2SEMA 1K8AU 2CP2A 1RI0A 2JN0A 2DX1A 2LCCA 1UFFA 3I56Q 2LQKA 3DLLA 1ZSZC 1I5OB 3C94A 1D09B 1BIBA 2XU8A 1VQLA 5CKFA 4A4GA 1IGUA 2CH4W 4Y92A 3CD6Q 3L42A 5GAMf 4M75C 2DIGA 2PQWA 2RI3A 2HL5C 4C0DB 3OS0A 2AT1B 2ENMA 2RD1A 5AT1B 2WACA 3CMAA 1KC8U 1X43A 4DQ2A 2L5QA 4Z88A 1AWWA 2DEQA 4M75F 4RMOA 5IHKA 5FWBA 2COYA 5KYYA 3ME9A 2J05A 2RMOA 3VRYA 3LGLA 3CCJQ 1TOVA 1UGRB 2CZ7B 4PJJA 5EG2A 2RHXA 3VRZA 5GAOq 2QDYB 4JJNK 3I5SA 4M7DE 3V8JA 2DKGA 1H641 3JCMV 1WHJA 1OZ3A 2QQRA 2HL3A 3CD6A 4PFPA 1NPRA 1VQOT 3C12A 4MZTA 5LJ5h 4M75B 2Z0WA 8ATCB 2ECZA 3M53A 5IHNA 4JLIA 1H3ZA 3LYIA 2MWPA 1YN8A 4BB7A 1WLPB 5LJ5d 5FW9A 1K73R 2VC8A 4LD9K 1N6AA 4KULA 4NL3A 2X4WA 2ZPIB 2YRDA 1Z9ZA 3C95A 5LJ5g 3PIOA 2PVDB 2YUQA 4C5IA 2E5KA 3GOXA 3THKA 1OZ2A 3CC2T 4EMGA 4IUPA 1UUEA 4HCKA 5GMKm 1VQLT 2YLBA 2BUDA 3J81E 1N8RC 5J26A 4M77B 2C06A 2CGHA 1QCNA 4OMNA 3OQ5A 2RH2A 4QQ6A 2LCLA 2L8DA 3EG9A 5EC7A 4CC4B 1GXIE 4BE0A 3JCMb 3X28B 4RTTA 3OMCA 4OMLA 4IUVA 1ZHIA 2WSEE 5C0MA 2AZSA 4AFUC 3I56T 2DXTA 3FDRA 5CQYA 3RMQA 4IKFA 2RQUA 2R57A 3PMTA 2ZAEA 2LTOA 1ZUYA 3CD6T 1OU8A 2O4XB 2KMTA 3E2UA 2M16A 5I22A 2LJ1A 5GAN5 2XDPA 1WZOA 1X01A 2V8KA 1QLYA 5D7UA 3I55A 4F04B 3S3OA 1PRMC 3KUFA 2JNGA 2ZPHB 2V26A 1HXDA 4DOVA 4Z89A 4C8QC 1K9MU 3OA6A 4F14A 4OB1B 3CCJT 1VQ5Q 4AFSC 3ULRB 2RJCA 1Q95G 1IZ6A 2EYWA 3VUBA 4NS5A 4E7SA 1QVGP 2LT4A 4MMLA 1M1FA 3OS2A 4F7UB 3JCMc 2JS2A 2F5KA 1ZSZA 1MMDA 1K73C 2PVGB 2NWMA 1U06A 1X6OA 4J9EA 1VQ9Q 5KE2A 1QVGA 2JW4A 1AZEA 2J6FA 5KYWB 4M75A 3UT1A 2CH4A 4E7HA 4OMPA 5HK0A 2VWFA 1KD1R 3EHRA 1RAFB 2H3JA 2HKNA 3OYIA 1M1KR 4C8QB 1Q7YU 3A1PA 3HFNA 1GCPA 3P8BB 2QAZA 3C0CA 3SHWA 2QGGA 3L2WA 2MAMA 1U1TA 2FO0A 1ZA2B 2KXDA 4Q5WA 1G3TA 3FC3A 1JJ2S 1OV3A 1ZBJA 2MF2A 2HQEA 1UJYA 2RJFA 1W6XA 2SRCA 3SDZA 4LD6A 3WXMB 1AHJB 4E7LA 2DRKA 3VKIA 4C92B 2DYIA 3ER0A 1W1FA 1Y96A 5J39A 1TG0A 1XNIA 1IHWA 4A4EA 2EVRA 5CVIA 2DTIA 1VYTA 3E9GA 5L8RE 2P4RA 2EYXA 1OULA 1R77A 4PL6A 1WHHA 3MP6A 1FMVA 1K8AR 1VUBA 4LUDA 1E6HA 4PJOD 2QTVA 3QSUA 1H3HA 1WJSA 3QWXX 5GANf 2FRYA 3M54A 3A8HB 4XTXA 2O4XA 4AMCA 2BZ8A 2G6FX 3QHSA 2HMAA 3HRTA 2KAFA 2F69A 4M77E 4Y91A 2K57A 2DBKA 3V7SA 3OYCA 1KC8R 1C0MA 1KG1A 3NTKA 4FYVB 2CP5A 3G6EQ 4B6MA 1XQHA 2DYBA 1VQ5T 2D8HA 1YWPA 2CZ0B 2JTEA 2AHJB 1WJQA 3QJ6A 2ZPEB 1QMCA 1ZQ1A 2O9SA 3X26B 2HKQB 3V7CA 1X6BA 4OGCA 1U1SA 2E6ZA 5HK3A 3S6WA 2GBQA 2PZ1A 1KD1C 1N27A 1VQ9T 2YUPA 4J6XA 1M1KC 5CO7A 4KGXB 1SRLA 5GAOp 1SSHA 2XK0A 5KYWA 5KYXB 3OSSC 4IUUA 1AD5A 3M0PA 2PVOB 4LXCA 4B9XA 1KSWA 2I2LA 1AEYA 2H3EB 3INZA 4C8QA 1T0HA 1TUDA 3L2VA 2ZCFB 2R58A 3VU3C 2JS0A 3VV0A 4Z02A 2E4HA 2HNIA 3H0FA 3QPHA 3VYGA 4PJOE 5GMKe 3L2QA 1VQKQ 3JB9F 4F7UE 3M0QA 1M2VA 1QVFS 2R5AA 2CDTA 4WTOB 4D8DA 3RIRA 4ATOA 1M8MA 4IIOA 1YJ9A 1K8AC 2OTLQ 2MMPA 4XTZA 3N5BB 1NJIU 1YP5A 4M78G 3QIIA 3JB9H 2AZVA 2D0QB 4HVWA 2M0OA 3A8LB 3E19A 3FJ5A 5GAOl 1X2QA 2Y4YA 2FHDA 2DL4A 1UJ0A 3V8LA 2RN8A 5KYUB 2DVJA 3MCAB 1G3YA 3TQ7P 2HDAA 2HQXA 1FMKA 1VQKA 2WSFE 3O8VA 3FB9A 1KC8C 1QVPA 3PTAA 3KXTA 5GAN6 1B07A 1NYFA 4RCBA 1IO6A 5C6SA 2RK1A 4FM4B 2OTLA 4C92E 2YDLA 1UECA 3HKSA 3G6ET 1Q82U 1MV3A 1YNZA 1M8VA 2WSCE 1Q86U 1I0CA 1UHFA 2RO0A 6AT1B 3EGXA 1M90U 1K9MR 3OYYA 5KYYB 2YUNA 4N4GA 1PG5B 2P0KA 2D6FA 1ARKA 3M5AA 2DEUA 4FSSA 3E1SA 1G83A 4M7AD 1JRIA 2YT6A 2ZZDA 4LNPA 2DZ9A 4ZN3A 4XTWA 2HSEB 2K3BA 2LZ6B 2MOXA 3SEMA 2HAXA 4J7FA 2FPDA 4JS4A 3P8HA 1N5ZA 1G3WA 3OMGA 1LNXA 2JM9A 3QXEB 1YIJQ 1HSQA 3EFOB 3H0IA 3MPUB 2KVQG 1BI2A 5KYXA 4X9CA 4BE2A 2NUTB 3HSBA 1RADB 4MZMA 4FSXA 1Q7YR 2FL7A 2QTXA 1NG2A 3PNWC 5GAMd 1S72Q 3EG1A 3UA6A 3UWNA 5GAMe 4M7DD 1JBMA 2LVMA 1YHQQ 2RQWA 5L23A 2HSPA 1Y7XA 3CCUQ 1YI2Q 4E7IA 1JO8A 4ELYC 3QZ9B 3NGPA 2A37A 1C1AA 2OTLT 5DLOA 3JB9J 1YIJA 3MO8A 3QUIA 1VQNQ 3T9NA 4LE9A 1ZLMA 2JTFA 4ZNXA 3EG9B 2O31A 1UTIA 2E1HA 2EKHA 4EPCA 3CQTA 3A8OB 3JCMe 5CK9A 4KBMB 5A0GA 3GNGA 2BE9B 4LDVA 5KYUA 2DE0X 1YHQA 1JXMA 3CCUA 1YI2A 4MDXA 3EFSA 2LCSA 3QYGB 5LJ3g 2K2MA 3CC2A 4KGZB 4OB3B 4M7AE 1VIEA 1K9MC 4XU1A 3L2ZA 1EZZB 3JV3A 2GNCA 2VGMA 2VASA 2B86A 5FRMA 1QWFA 4II1A 1YCSB 3H8ZA 2KGTA 4C0GA 4GLMA 3EHQA 4J9CA 1NE8A 1IHVA 5GMKi 4O5VA 1BYMA 2K6DA 1Y07A 2JVVA 1NPPA 1AZGB 1MGQA 4FYXB 1XTDA 2EGAA 2RF0A 1PD1A 1GFCA 4JUVA 3OYGA 3I56A 2M02A 4OMOA 5GANj 2XDDA 1YJNQ 2KI7A 4A4HA 3OYEA 1ZSZB 2BZYA 1PHTA 2MCNA 4DA4A 1Q7YC 3RERA 3M0UA 1YIJT 5D6XA 4WCIA 5LJ3f 3EFOA 4FIBA 3VS5A 2ROTA 9ATCB 3E9FA 4YTLA 2NUTA 2ZGWA 1S72T 4EMKC 1HJDA 1PNJA 2IIMA 2DRMA 5LJ5e 2EQJA 4DEYA 3CCJA 2F5TX 1E7OA 1KHCA 1SHGA 2HBPA 1YHQT 1XOVA 4A53A 3CCUT 1YI2T 1UGSB 2LC4A 4M78C 3VS1A 2F2WA 1TSFA 3PVQA 1X75C 2EJGA 3BFMA 3CC7Q 4ZGDB 1IGQA 1WHMA 1YCYA 1CKAA 5IT9E 2RHYA 1AVZC 2JT4A 4M78F 2BTTA 4RTVA 2CUBA 2DL7A 3MEVA 3M4YA 3GPLA 2A3LA 2DTOA 4RTZA 1VQNT 3JB9G 1NJIR 5A0LA 1Y96B 3H41A 5I2MA 2LNVA 1SG5A 3A5ZB 2DILA 4XTUA 2V8JA 4FW1A 4DBQA 3P8DA 4J6YA 2EKOA 3JSCA 4L59A 1OI1A 3CCRQ 2EQMA 1CSKA 4O6JA 3LGFA 2X4XA 4R55A 2CP6A 2K5IA 4PJNA 3CC7A 4M78B 1K1ZA 2LDMA 4JRIA 4RUGA 4JRQA 2I0NA 3HTRA 1K0XA 3GIBA 5CKDA 2CP3A 4L5GA 4J9IA 5AYFA 3NTHA 4M75D 1Q82R 3A8MB 1ZA1B 1O75A 1Q86R 1FX7A 1M90R 4BI4A 2B8AA 1WHGA 1FXXA 1ZSGA 1JJ2P 1BI3A 2DXBA 3CCRA 1FMWA 3JAME 1WHKA 4A4FA 1G2BA 3MHXA 4PLLA 2E65A 3CCSQ 2AKLA 4DBRA 1YJNT 3GF5A 1VQPQ 3SFMA 1U8RA 2DK3A 4FCYA 2LJ0A 1WA7A 1JJ2A 1M30A 4HXJA 1KK7A 4QQDA 1QCOA 1UGVA 4RTUA 4LUEA 3V8KA 2JJ9A 2CYZB 4M77D 1RAAB 4PLIA 2GFUA 5GANh 4HVUA 2KK4A 1MNDA 3REBB 1GBQA 2KT1A 3CBOA 4C5GA 1P92A 3S3MA 2L3PA 5GANd 1UE9A 1Z9QA 1V76A 1EFNA 1PWTA 3ZL7C 3JRZA 3JCMW 1LJOA 4AFZC 3G71T 5GANg 2DJQA 1VQ5A 8AT1B 2OTJQ 3HRUA 2XD0A 1LCKA 5KCHA 4JJDA 1D3BA 3NPFA 2NUZA 2KEAA 5FRNA 3PFSA 3CCSA 4QVDA 3G7ZA 1VQPA 2M1HA 3FEOA 4M4ZA 3O5ZA 1NJIC 3CC7T 4TVRA 1QW1A 4EDUA 1X27A 1YJWQ 2QEXT 1M2VB 4PJMA 3QG1A 3DKMA 1M27C 4LDWA 7AT1B 5GAOn 1VQ9A 2EYQA 2DXUA 4BY6C 3D7SB 1VQ6Q 5D6YA 2L3QA 2KYBA 3MJXA 2MYSA 1BCOA 3QZ5B 2LQ8A 1OQKA 4M75E 2K3YA 2FRWA 3TCJA 2P84A 2RQVA 2K2VA 1ACMB 3AT1B 4HCCA 2OTJA 5I2SA 3CCRT 3CBPA 3RESA 2ZPFB 5FROA 3VS3A 4EMKA 1CKBA 2LMJA 2YLCA 3NTIA 2RI5A 1NEBA 1Q82C 4A54A 2A08A 4M78A 4CC2A 3NFCA 1HYOA 1TUCA 1BK2A 1Q86C 2X4YA 4OVAA 1M90C 1VQMQ 3CPWP 4RTXA 1TU0B 1OX9A 3OYMA 4JJBA 2YSQA 1PSFA 4OMQA 5CKHA 4FT4A 4JJCA 2KSSA 3CCMQ 4J6WA 2O88A 3LH0A 4XTYA 3EGXB 1ZUUA 2VXEA 4C8QD 1AWXA 2PTKA 3RKWA 1QVFP 2RJDA 1K9AA 2KY9A 4OP0A 3CPWA 5KCOA 4JRPA 2X4JA 3TEEA 2JM8A 2LQNA 3NMZC 4WF2A 3CCST 1SHFA 4AG1C 1VQPT 3TREA 1G3SA 4RG2A 2QK0A 5GJWB 2AIRB 3M0TA 1GBRA 1BBZA 2RPNA 1VA7A 3RNJA 1HD3A 2ESWA 5A0DA 1RI9A 1QVFA 2FPEA 2QA4Q 4OB2B 3PIPA 2YUOA 2K9GA 4C92D 4J9BA 2M0YA 3QKJA 1T0JA 3HFOA 1BCMA 2GF7A 1D0XA 1KQ1A 3GNFB 3G6EA 3OYBA 5IH2A 2IPOB 1BU1A 1ZUKA 4GBQA 3QDFA 1I8FA 1MMNA 2EQUA 2OTJT 4JZ3A 4J83A 4CC7A 2RQTA 2QG9B 3QYHB 1YFNA 2JTMA 3META 2MPXC 4BE1A 3CPWS 3JCMQ 1BB9A 4N4HA 2L89A 2E12A 3CMEQ 3CBMA 4E6RA 2BZXA 2LQWA 1M3BA 1YJWT 2RHIA 2C0IA 2KNBB 2E41A 3OYAA 3REAB 3PT9A 1RABB 3OYHA 5GAN3 2F2XA 2HZYA 3JCMJ 2CP7A 1VQ6T 3DB3A 2YHTA 3I35A 2EQIA 3LW5E 4AT1B 1FWZA 4DEXA 1GRIA 1UGQB 4M7DC 1PM3A 5LJ3j 2W0ZA 5CQXA 3HHTB 4CC3A 1MMAA 2MIOA 4FL6A 4XAXB 1RLPC 3BE3A 4ZTJA 4JZ4A 4XQ3A 1PKSA 2NLUA 3DB4A 4M7DF 2CZ6B 1I1JA 3JB9I 3A98A 4C8QE 3CMEA 2PU9B 1QP2A 3HRSA 1VQ7Q 2J6OA 3KBGA 1KJWA 2OAWA 1VQMT 3CCQQ 2XG8D 3UF4A 4FYWB 3RKYA 3FIFA 4L6V5 2E70A 3LX7A 1LVKA 2HEQA 1XJWB 2DL8A 3CCMT 3MEWA 1QP3A 2L0AA 2OAUA 2RQRA 1VQ8Q 2FZKB 1T3LA 3EH1A 2EJ9A 2A36A 2EGCA 2OX7A 1JB0E 1PKTA 1F1BB 2EYZA 3X24B 3VYHB 3PE0A 3SD4A 3MEUA 1EX4A 4PJOG 2NYSA 3R6NA 4ELZC 5CKEA 4HT9A 1X6GA 3CCVQ 2JMAA 4DBHA 2FYKA 5D6WA 2E10A 5CIUA 5FU7C 2RJEA 4DBFA 3ZBDA 2QA4T 2GTOA 1R8OB 2ED0A 2D0NA 4XTVA 5HCKA 2YRVA 4E7KA 1WI7A 1OEBA 3TSWA 1OYXA 1V29B 1QWEA 2DXCA 1VQ8A 5GAN8 2A0FB 4PKCC 4BACA 2IVWA 2QQ9A 1MV0B 1D1BA 1UGPB 2W10A 1YBYA 1PSEA 4X1VA 5CAIA 3CMET 3C4SA 2VKNA 4PFZA 4CI0C 2CREA 2PUKB 1N9SA 1PD0A 5GMKl 2HBWA 2VV5A 3CCVA 2P0QA 4E7ZA 2EGEA 1RAEB 2X9HA 4NL2A 3S3NA 2DF6A 2MWOA 2CKKA 2KT8A 2BKDN 1J3TA 1W2BS 2HQHA 4K11A 4ME7A 1B7TA 2D1XA 2NUPB 1DJ7B 1WNLA 1IXDA 1PC0A 2J7IA 1I5LA 4PFOA 4KGVB 2JMCA 4BI8B 2ZPGB 1SPKA 1M9SA 4FYYB 3OBWA 2V1RA 2XI9A 1Q81U 3RR6A 2ROLA 3M4GA 1KHIA 1M4ZA 5LJ3h 1S72A 1X69A 2HD0A 3L1AA 1G8XA 2DVEA 3PMIA 1SRMA 3X20B 4R0KA 5GJVB 1VQ7T 4ZTFA 3VS4A 5LJ3d 1GL5A 1SSFA 4F16A 5CR2A 1D1AA 3CCQT 2E3HA 2DTHA 5HKCA 1B34A 2QQAA 2CUDA 5IAYA 3CMAQ 2FZGB 2GGRA 2A7YA 1K0SA 1PCXA 3JCMg 2R5MA 4LDUA 2FPFA 5IXBA 1TXQA 3MP1A 1K76A 1R0CB 2M9UA 2KROA 2QDLA 3OS1A 3VS2A 1VQNA 5GAOm 1VQ8T 2KBTA 4ANJA 4M7DA 3M0RA 2EIFA 3OW2S
chains in the Genus database with same CATH topology
3FJPA 1O75A 2K3XA 2KAFA 2F69A 3HRTA 3L2RA 4HT8A 2CS7A 4M77E 1FX7A 4Y91A 2P4TA 2B8AA 2K57A 1FXXA 4OGEA 3V7SA 4BI4A 5HY6A 3OYCA 5CKBA 1KG1A 2DD4A 3NTKA 1BI3A 2DZCA 1VQ7A 2K4YA 2DXBA 4KT0E 2RHZA 1HK9A 3CCRA 4F7UG 1XQHA 3CCVT 3CCQA 1VQ5T 3JAME 4LDYA 4OF1A 4A4FA 3V7RA 1WQWA 3FRNA 4LDXA 1W2BA 2CZ0B 3MHXA 4VUBA 4PLLA 2E65A 2RI2A 4HA8A 2GFAA 2AHJB 5DY9A 2JOYA 3GF5A 1WJQA 3SFMA 1YJNT 3QJ6A 4P5NA 4C5HA 1U8RA 2ZPEB 2DK3A 3OY9A 1UB4A 1JJ2A 3CEYA 4XK8E 1ZQ1A 3X26B 1UEBA 3V7CA 4QVZA 4QQDA 4OGCA 1U1SA 2E6ZA 5HK3A 2E64A 3S6WA 3OS5A 3V8KA 4M77D 2CYZB 1LOJA 2RHUA 5CCAA 1KD1C 4PLIA 2GFUA 1WGSA 5GANh 1N27A 2KK4A 3SWNC 1VQ9T 4J6XA 1M1KC 5CO7A 3JCMX 3CBOA 4C8QG 3LWHA 4C5GA 1P92A 5LJ5j 3G4SA 4BDYA 3S3MA 3M9QA 5GANd 4RG8A 3JCMW 4MZPA 3JCMf 3JRZA 5GAOp 5DM7R 4E7JA 1YJ9T 1N9RA 1M1GA 2XK0A 1LJOA 3JB9D 1G5VA 2E5QA 4M77C 1D3BB 5M9OA 5A2QE 3OSSC 4RKUE 3G71T 4IUUA 5GANg 2LX9A 1VQ5A 3HRUA 2XD0A 1YITA 2PVOB 1KQ2A 1O9SA 5KCHA 4GLKA 1D3BA 4B9XA 5GAMh 4KUIA 2I2LA 3EAEA 5FRNA 4M7AG 3INZA 1KD1U 4C8QA 3PFSA 3CCSA 1YJNA 4M77F 5FU7B 4QVDA 3G7ZA 1VQPA 2M1HA 3FEOA 1M1KU 4QVCA 3L2VA 1NJIC 3CC7T 2O01E 2ZCFB 4JRKA 4TVRA 4KUDK 4V2SA 2R58A 2QQSA 4C92G 1QW1A 4NOYA 4IUQA 3VU3C 4X34A 3VV0A 4XU2A 3SB2A 4EDUA 4Z02A 2QEXT 4ZGJB 2HNIA 3LWIA 3MP8A 3QPHA 1I4K1 3VYGA 4PJOE 5GMKe 2DIQA 3QG1A 5GAMg 3DKMA 3L2QA 2QI2A 1BKBA 4LDWA 4Y28E 4F7UE 3OW2A 5GAOn 1VQKT 3JB9F 1VQ9A 2EYQA 3J80E 3GP8A 2DXUA 4BY6C 4M7AA 1QVFS 5D6YA 2R5AA 2PUOB 2EQKA 3SWNB 3RIRA 4D6WA 3CC4A 3QZ5B 4ATOA 2GQVA 3DLMA 3VUZA 4A4KA 1YJ9A 2LQ8A 1K8AC 2MMPA 4M75E 2K3YA 4XTZA 2GCXA 3N5BB 1NJIU 3TCJA 3EFRA 3M58A 3G71A 4M78G 2K2VA 3QIIA 3JCMh 4C0DC 1VQOA 4HCCA 4EMKB 3ASKA 3JB9H 1KQSA 2OTJA 2D0QB 5I2SA 3CCRT 3TU4K 2FB7A 3CBPA 2M0OA 3A8LB 3RESA 2ZPFB 5LJ3e 5FROA 3R6OA 3OYFA 2Y4XA 3E19A 4EMKA 3GLXA 3JCMd 4M7DG 5GAOl 4JS5A 2VGNA 2YLCA 3CMAT 2Y4YA 2FHDA 3URGA 2QXFA 3NTIA 3V8LA 2RI5A 4OB0B 3BDLA 3HP9A 1Q82C 4A54A 2QEXA 2ZPBB 3MCAB 1G3YA 3A8GB 4M78A 3M57A 3NFCA 4EMHA 2XHCA 1Q86C 2X4YA 1K8AU 2HQXA 4OVAA 1M90C 3CCEA 2JN0A 1RI0A 1VQKA 2WSFE 3HL8A 3O8VA 3FB9A 1KC8C 3BW1A 1QVPA 2LCCA 4R56A 3PTAA 4PJOC 3KXTA 5GAN6 2LQKA 3OYMA 5KH6A 1PSFA 3DLLA 5CKHA 4FT4A 3C94A 4RCBA 5C6SA 2KSSA 1BIBA 3G4ST 3RUXA 2XU8A 1VQLA 2RK1A 4FM4B 2OTLA 5CKFA 4J6WA 4A4GA 3LH0A 4XTYA 2XKOC 4PJOF 4C92E 3G6ET 1Q82U 3HKSA 2VXEA 3L42A 5KE3A 1M8VA 4F7UF 5GAMf 5LJ5f 2WSCE 4M75C 2DIGA 2PQWA 4C8QD 2RI3A 3RKWA 1Q86U 4C0DB 2RJDA 3H6ZA 3OS0A 2KY9A 2RO0A 4OP0A 3CPWA 1YITT 1M90U 4B9WA 2RD1A 5KCOA 4JRPA 1KQSS 2WACA 2X4JA 3TEEA 3CMAA 1KC8U 3OYYA 4DQ2A 2L5QA 4N4GA 4WF2A 3CCST 2RK2A 3M59A 2P0KA 1VQPT 3TREA 2DEQA 4M75F 2JUFA 1G3SA 4RMOA 2D6FA 4RG2A 2JZ2A 3M5AA 1WPYA 3UPUA 2LT1A 4C0ZA 3ME9A 3E1SA 4M7AD 3LGLA 4UC4A 1UGRB 2CZ7B 1JRIA 3BY7A 3RMSA 4RCCA 5A0DA 3BDUA 1QVFA 2ZZDA 2RHXA 2DZ9A 5EG2A 2D9TA 4ZN3A 4XTWA 5GAOq 2QDYB 4OB2B 4ZN1A 4BD3A 4C92D 3PIPA 4C8QF 1VIFA 4JJNK 2HAXA 4M7DE 4OMFB 3V8JA 2DKGA 4PJOB 1H641 3QKJA 3JCMV 3HFOA 4J7FA 4N0AC 4JS4A 3CC4T 1OZ3A 2GF7A 2EJFA 2QQRA 3P8HA 1G3WA 1WQ7A 1LNXA 3OMGA 1KQ1A 3GNFB 5GANe 3G6EA 3OYBA 3CD6A 2L3RA 1IREB 1NPRA 3QXEB 4BUGA 3Q1JA 3OYLA 1I8FA 2EQUA 3F70A 3C12A 1VQOT 2OTJT 2KVQG 4MZTA 4C92C 1BI2A 4J83A 5GAN4 3OYKA 3QYHB 2RA2A 4X9CA 4M75B 5LJ5h 4BE2A 3HSBA 2JTMA 3META 3M53A 1WJRA 3CPWS 4BE1A 4JLIA 4MZMA 4FSXA 2FL7A 1H3ZA 4M78D 3JCMQ 3LYIA 2MWPA 2QTXA 4N4HA 3PNWC 2L89A 2E12A 4XU3A 4BB7A 3CBMA 5GMKj 4C92F 5LJ5d 5GAMd 2VC8A 4LD9K 1YJWT 3UWNA 2RHIA 1N6AA 4N4IA 5GAMe 4KULA 4NL3A 4M7DD 2X4WA 1JBMA 2LVMA 2ZPIB 1EIFA 1TH7A 2E41A 3C95A 5LJ5g 3PT9A 3OYAA 3PIOA 3CCET 1Y7XA 2EAYA 2PVDB 2QQBA 4C5IA 3OYHA 5GAN3 3GOXA 4BDZA 4X9DA 4E7IA 3JCMJ 3CCLA 1VQ6T 1OZ2A 3DB3A 4ELYC 3QZ9B 3CC2T 2YHTA 4EMGA 3LW5E 1FWZA 4IUPA 1UGQB 5GMKm 4M7DC 3SWNA 1VQLT 2OTLT 5LJ3j 2EFIA 2P0PA 5CQXA 3HHTB 2DAQA 5DLOA 2YLBA 4PNOA 3JB9J 2BUDA 4FL6A 4XAXB 4GY5A 5J26A 3J81E 1YIJA 1N8RC 3AHUA 2KQWA 3MO8A 3QUIA 4M77B 3T9NA 4ZTJA 2C06A 2JTFA 2CGHA 4JLGA 5J3BA 4XQ3A 4M7DF 2NLUA 3DB4A 2KDSA 3OQ5A 3QDRB 3RKXA 4M77A 2CZ6B 2E1HA 2RH2A 4EPCA 4QQ6A 3JB9I 3I55T 2LCLA 3A8OB 4C8QE 3JCMe 2L8DA 1QVGS 5CK9A 4IURA 3CMEA 1M5Q1 1GXIE 2PU9B 4BE0A 4KBMB 3JCMb 3X28B 5A0GA 3GNGA 1YJWA 4LDVA 1QP2A 3FLGA 3HRSA 3OMCA 3HPWA 3LLRA 4IUVA 3KBGA 1YHQA 1ZHIA 2WSEE 1VQMT 2VXFA 4MMKA 5C0MA 2XG8D 1N8RU 3CCUA 4HCZA 1YI2A 4MDXA 3RKYA 3EFSA 1VQ6A 2EWNA 1ZBXA 3OB9A 2K5FA 3FIFA 3QYGB 2E70A 4L6V5 5LJ3g 3I56T 4FT2A 3LX7A 4OB3B 3CC2A 4BY6B 2RB6A 2DXTA 3FDRA 4M7AE 5CQYA 1VIEA 3RMQA 4IKFA 2R57A 1K9MC 3CCMT 1MHNA 3PMTA 4C0FA 3MEWA 1QP3A 2G3RA 3OYNA 2LTOA 1I81A 2BIVA 3L2ZA 4XU1A 5FU6C 3CD6T 3L2UA 2O4XB 2VGMA 2KMTA 1BI1A 2M16A 2OAUA 5FRMA 3M55A 2VYTA 5GAN5 2V8IA 2XDPA 3ZFJA 4II1A 4HCBA 3H8ZA 4C0GA 2EJ9A 1X01A 2V8KA 3I55A 1JB0E 3S3OA 1BI0A 3KUFA 3X24B 3VYHB 3QBYA 2JNGA 2ZPHB 3SD4A 3MEUA 1HXDA 1NE8A 5GMKi 4DOVA 4O5VA 1BYMA 1RL2A 4PJOG 4C8QC 4ELZC 1K9MU 5CKEA 1Y07A 3OA6A 2JVVA 1NPPA 4HT9A 4OB1B 4M78E 1MGQA 1VQMA 4J8OA 3CCJT 1XTDA 2FYKA 5D6WA 2E10A 2X35A 5CIUA 2RJCA 5FU7C 4JUVA 2RJEA 1IZ6A 3VUBA 3ZBDA 4NS5A 2DO3A 3OYGA 3I56A 2LT4A 4MMLA 2QA4T 5GANj 3VJPA 2XDDA 3CCLT 1R8OB 2DD5A 1M1FA 4A4HA 3OS2A 3OYEA 3CCMA 4XTVA 4M75G 4F7UB 3J7AF 2YRVA 1Y71A 1W4SA 3PGGA 3JCMc 4E7KA 4M7AC 4PJOA 1VQ4A 2F5KA 4DA4A 1Q7YC 1OYXA 3RERA 4F7UA 1V29B 2MI6A 2XICA 2E6NA 2DXCA 1VQ8A 5GAN8 1YIJT 5FU6B 1K73C 2PVGB 3MEAA 1X6OA 4PKCC 4BACA 5D6XA 2IVWA 2QQ9A 5KE2A 4M7AF 4JDSA 5LJ3f 2CZ1B 1QVGA 4FIBA 2FVUA 3E9FA 4YTLA 5GAMj 1UGPB 3CXCA 1YBYA 1PSEA 4M75A 3UT1A 5I21A 3X25B 5CAIA 4E7HA 2ZGWA 2XDBA 3CMET 1S72T 5HK0A 3C4SA 4CI0C 4EMKC 2PUKB 5LJ5e 1N9SA 2H3JA 5GMKl 2EQJA 3OYIA 2VV5A 3CCJA 2P0QA 2VUBA 3CCVA 2F5TX 1KHCA 4NL2A 4C8QB 1Q7YU 2HBPA 1YHQT 2DPPB 3S3NA 3HFNA 2QA4A 1XOVA 2MWOA 3WVDB 4A53A 2CKKA 1UGSB 2LC4A 4M78C 3CCUT 1YI2T 1Q81C 1K73U 5GMKh 3P8BB 1X75C 2BKDN 4M77G 3JCMP 2EJGA 3BFMA 2K5LA 1BIAA 2MAMA 4ZGDB 3L2WA 1W2BS 1U1TA 4QW2A 1YCYA 4IUTA 5IT9E 3QO3A 2RHYA 4BI3A 4ME7A 4Q5WA 4E47A 1G3TA 1DJ7B 2XIDA 1WNLA 4M78F 5GAN2 3FC3A 1JJ2S 4HKEA 4QQGA 3MEVA 5GAN7 4M7AB 1I5LA 2MF2A 3M4YA 2HQEA 4XU0A 4BI8B 4FU6A 2RJFA 3GPLA 4N0AA 2ZPGB 2A3LA 2DTOA 1VQNT 3JB9G 3SDZA 4LD6A 3WXMB 5A0LA 1AHJB 1Y96B 3M56A 3OSVA 5I2MA 2LNVA 3WVEB 4E7LA 2Y90A 1M9SA 3A5ZB 4J5YA 3VKIA 4C92B 5GAOr 3OBWA 4XTUA 2XI9A 3ER0A 2V8JA 1Q81U 4CRIA 1Y96A 3M4GA 1KHIA 1M4ZA 5LJ3h 3P8DA 5J39A 4J6YA 1XNIA 1S72A 2EKOA 4A4EA 4C92A 4MDWA 2HD0A 3CXCS 3L1AA 3JSCA 5CVIA 2DTIA 2DVEA 4L59A 3PMIA 1OI1A 3X20B 3E9GA 5L8RE 1VQ7T 5IN1A 4ZTFA 5LJ3d 1SSFA 4PL6A 5CR2A 1B34B 3UDCA 2EQMA 4O6JA 3CCQT 2LRQA 3MP6A 2DJZA 2RM4A 2DTHA 3LGFA 4ZGEB 5HKCA 3OYDA 2X4XA 1B34A 1NZ9A 1VUBA 4R55A 2QQAA 5IAYA 2K5IA 3ZEHA 3CC7A 4PJOD 4M78B 4J7IA 2A7YA 2LDMA 4JRIA 3QSUA 3JCMg 2R5MA 1WJSA 3QJYA 4JRQA 4LDUA 2IG0A 3MP1A 5LL6S 2M9UA 1VQ4T 3OBYA 5GANf 3GIBA 4M7DB 3OS1A 5CKDA 4L5GA 1VQNA 4DOWA 5DLQE 3M54A 5GAOm 3A8HB 1VQ8T 4XTXA 4M7DA 5AYFA 2O4XA 3NTHA 2EIFA 4M75D 3OYJA 3A8MB 3QHSA 3CPFA 4C5EA 5FLXE 3OW2S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JBM A;  3FJP A;  3PGG A;  3JCM c;  4HT8 A;  4M7A C;  4EMK A;  1TH7 A;  2E41 A;  5LJ5 g;  4M77 E;  3JCM d;  4M7D G;  5GAO l;  4Y91 A;  4PJO A;  2K57 A;  2EAY A;  3V7S A;  2YLC A;  3RER A;  4F7U A;  5GAN 3;  4X9D A;  3V8L A;  3JCM J;  5GAN 8;  2DZC A;  4A54 A;  1HK9 A;  4F7U G;  2YHT A;  4M7A F;  5LJ3 f;  4M78 A;  4EMG A;  4EMH A;  5GMK m;  5GAM j;  4M7D C;  3SWN A;  3V7R A;  2JN0 A;  5LJ3 j;  1WQW A;  4M75 A;  3FB9 A;  5I21 A;  2E65 A;  5CAI A;  2YLB A;  2ZGW A;  4HA8 A;  3BW1 A;  4PNO A;  3JB9 J;  5DY9 A;  4EMK C;  5GAM e;  3AHU A;  5GAN 6;  4PJO C;  3QUI A;  4M77 B;  5LJ5 e;  1N9S A;  5GMK l;  2CGH A;  4XQ3 A;  4M7D F;  4RCB A;  4NL2 A;  4C8Q B;  3V7C A;  1BIB A;  3RKX A;  3RUX A;  4M77 A;  2E1H A;  1U1S A;  3HFN A;  4J6W A;  2E64 A;  3JB9 I;  4A53 A;  4C8Q E;  4XTY A;  4M78 C;  4PJO F;  4C92 E;  3JCM e;  3V8K A;  4M77 D;  1M5Q 1;  1LOJ A;  5GMK h;  5GAN h;  2VXE A;  3JCM b;  4M77 G;  4F7U F;  2EJG A;  3BFM A;  3SWN C;  5GAM f;  5LJ5 f;  4J6X A;  3JCM P;  1M8V A;  1BIA A;  4M75 C;  4C8Q D;  3RKW A;  1U1T A;  3JCM X;  1YCY A;  4C8Q G;  3QO3 A;  4OP0 A;  5LJ5 j;  2RD1 A;  5GAN d;  1WNL A;  2VXF A;  4M78 F;  4MMK A;  5GAN 2;  3JCM W;  3JCM f;  4DQ2 A;  5GAN 7;  5GAO p;  4M7A B;  1I5L A;  4WF2 A;  3RKY A;  4XU0 A;  3EFS A;  1N9R A;  2EWN A;  1LJO A;  3JB9 D;  3FIF A;  2DEQ A;  4M75 F;  4N0A A;  5LJ3 g;  2DTO A;  4M77 C;  1D3B B;  3JB9 G;  4M7A E;  2RB6 A;  1WPY A;  2DXT A;  1Y96 B;  5GAN g;  2Y90 A;  4J5Y A;  4C92 B;  5GAO r;  1KQ2 A;  4XTU A;  1D3B A;  4M7A D;  5GAM h;  1JRI A;  1Y96 A;  2I2L A;  3M4G A;  5LJ3 h;  4M7A G;  3INZ A;  3BY7 A;  4J6Y A;  4RCC A;  1I81 A;  3BDU A;  3L2Z A;  4XU1 A;  4C8Q A;  2DZ9 A;  4M77 F;  4C92 A;  4QVD A;  3L1A A;  5LJ3 e;  4XTW A;  2DTI A;  2DVE A;  4QVC A;  5GAO q;  5GAN 5;  4C92 D;  4JRK A;  4C8Q F;  4V2S A;  4M7D E;  3V8J A;  5LJ3 d;  4C92 G;  4NOY A;  2DKG A;  3VU3 C;  1H64 1;  4PJO B;  4XU2 A;  1B34 B;  3HFO A;  3SB2 A;  3JCM V;  4N0A C;  2EJ9 A;  1X01 A;  2HNI A;  2EJF A;  4PJO E;  2DJZ A;  2RM4 A;  1I4K 1;  2DTH A;  1KQ1 A;  1WQ7 A;  1LNX A;  5GMK e;  5GAN e;  5GAM g;  1B34 A;  3JB9 F;  4F7U E;  5GAO n;  2DXU A;  1HXD A;  5GMK i;  4M7A A;  4PJO D;  4M78 B;  1I8F A;  4JRI A;  4C8Q C;  4PJO G;  3QSU A;  4C92 C;  5GAN 4;  3JCM g;  3SWN B;  4HT9 A;  3RIR A;  4M78 E;  1MGQ A;  2RA2 A;  4M75 B;  4X9C A;  5LJ5 h;  2FYK A;  3HSB A;  2E10 A;  4JLI A;  5GAN f;  3GIB A;  4M7D B;  4M75 E;  4JUV A;  4M78 D;  4XTZ A;  3JCM Q;  3EFR A;  2QTX A;  5GMK j;  4XU3 A;  4MML A;  4M78 G;  5GAO m;  3JCM h;  5GAM d;  4XTX A;  4C92 F;  5LJ5 d;  5GAN j;  2VC8 A;  4M7D A;  4EMK B;  3JB9 H;  4M75 D;  3QHS A;  4XTV A;  2FB7 A;  4M75 G;  4F7U B;  4NL3 A;  3RES A;  4M7D D; 
#chains in the Genus database with same CATH topology
 3FJP A;  4HT8 A;  2K3X A;  2J6K A;  3G4S Q;  2CS7 A;  2P4T A;  1WYX A;  4OGE A;  1OPK A;  2EYY A;  5CKB A;  2DD4 A;  2KRN A;  2DZC A;  2K4Y A;  4KT0 E;  2FG0 A;  2RHZ A;  3CCV T;  1YIT Q;  1GFD A;  4LDY A;  4OF1 A;  3LH5 A;  3FRN A;  4VUB A;  3I5R A;  2RI2 A;  4HA8 A;  5DY9 A;  4P5N A;  4C5H A;  3OY9 A;  2O2O A;  1UEB A;  1A0N B;  3EG3 A;  1X2K A;  1D0Z A;  1RAC B;  3OS5 A;  1JU5 C;  1LOJ A;  2RHU A;  1WGS A;  1T3S A;  3SWN C;  2ABL A;  1TS9 A;  4A63 B;  1M2O A;  2DA9 A;  3JCM X;  1D0Y A;  1C6V X;  3LWH A;  4BDY A;  3G4S A;  3CC4 Q;  4MZP A;  3JCM f;  4E7J A;  1M1G A;  1N9R A;  1AWO A;  1G5V A;  4M77 C;  5M9O A;  1D3B B;  3G71 Q;  5A2Q E;  4RKU E;  2LX9 A;  1YIT A;  1H8K A;  1KQ2 A;  1O9S A;  4GLK A;  4KUI A;  1IRX A;  3VS7 A;  4M7A G;  2COZ A;  1YJN A;  4M77 F;  2PNI A;  4QVC A;  2JXB A;  4KUD K;  2KYM A;  4V2S A;  4NOY A;  4IUQ A;  4X34 A;  4JPB W;  4XU2 A;  3SB2 A;  2QEX Q;  4ZGJ B;  3MP8 A;  1KQS P;  4KH1 B;  2NUP A;  3CCE Q;  2QI2 A;  1BKB A;  4KRT A;  2CT3 A;  1D1C A;  1TUG B;  3EGU A;  2KXC A;  3SWN B;  2DL3 A;  4D6W A;  3CC4 A;  2GQV A;  1NBE B;  3VUZ A;  1RAG B;  2D8J A;  2GCX A;  2EPD A;  3G71 A;  2RNA A;  4EMK B;  1KQS A;  4J9H A;  3TU4 K;  2FB7 A;  2AK5 A;  2YWW A;  3R6O A;  2OJ2 A;  2Y4X A;  3GLX A;  4M7D G;  2LP5 A;  3I55 Q;  3CMA T;  3VS0 A;  3URG A;  4OB0 B;  3HP9 A;  3KFV A;  2QEX A;  2ZPB B;  3A8G B;  1MNE A;  3M57 A;  4EMH A;  2XHC A;  2LNH B;  1GCQ C;  3CCE A;  3HL8 A;  1W70 A;  3BW1 A;  4R56 A;  2LX7 A;  4PJO C;  3UA7 A;  1V1C A;  5KH6 A;  2GQI A;  3G4S T;  3RUX A;  1ABO A;  2XKO C;  2M51 A;  4PJO F;  1JEG A;  5KE3 A;  4F7U F;  1B3Q A;  5LJ5 f;  2CSQ A;  3H6Z A;  1YIT T;  4B9W A;  1KQS S;  2X3W D;  2KRM A;  1SEM A;  2RK2 A;  3M59 A;  2JUF A;  2YRC A;  1UDL A;  2JZ2 A;  1WPY A;  3UPU A;  2LT1 A;  4C0Z A;  1NLO C;  1R0B G;  1UHC A;  1IB8 A;  4UC4 A;  3M0S A;  4F17 A;  3BY7 A;  3RMS A;  4RCC A;  3BDU A;  1JXO A;  2D9T A;  1K4U S;  4ZN1 A;  4BD3 A;  4C8Q F;  1VIF A;  3CCL Q;  4OMF B;  4QKU A;  1AWJ A;  4PJO B;  4N0A C;  3CC4 T;  2EJF A;  1WQ7 A;  3U23 A;  5GAN e;  2L3R A;  2QGF B;  1IRE B;  4KH0 B;  4BUG A;  2DL5 A;  3Q1J A;  3OYL A;  3F70 A;  1SF9 A;  4C92 C;  5GAN 4;  3OYK A;  2RA2 A;  2DLP A;  1Y0M A;  4EIK A;  3EH2 A;  1WJR A;  2VB6 A;  4IIM A;  4M78 D;  4ORZ A;  2H8H A;  3IQL A;  5GMK j;  4XU3 A;  4C92 F;  2KR3 A;  2E3I A;  4N4I A;  4AFQ C;  1EIF A;  1QKW A;  1TH7 A;  2L3S A;  4E2F B;  5I11 A;  2L2P A;  3CCE T;  1MMG A;  2EAY A;  2QQB A;  5IXF A;  1QKX A;  4BDZ A;  4X9D A;  3CCL A;  2J06 A;  4HVV A;  2C0T A;  1VOM A;  1OU9 A;  3SWN A;  2EFI A;  2P0P A;  3H0H A;  3NHN A;  3RBB B;  2DAQ A;  1Q81 R;  4PNO A;  1WXT A;  4GY5 A;  3AHU A;  2KQW A;  1NEG A;  5J3B A;  4JLG A;  2KDS A;  3QDR B;  3RKX A;  4OMM A;  4M77 A;  1WDX A;  3I55 T;  1QVG S;  2CT4 A;  1NM7 A;  1M5Q 1;  4IUR A;  1KIK A;  1YJW A;  3FLG A;  3HPW A;  3LLR A;  5FWC A;  2VXF A;  4MMK A;  4ESR A;  1N8R U;  4HCZ A;  1VQ6 A;  2EWN A;  1ZBX A;  3OB9 A;  2K5F A;  4FT2 A;  4BY6 B;  2RB6 A;  2EBP A;  3I9Q A;  1MHN A;  4C0F A;  1MUZ A;  2G3R A;  3OYN A;  1VQ4 Q;  1I81 A;  2BIV A;  5FU6 C;  3L2U A;  1BI1 A;  1WIE A;  4RTW A;  3M55 A;  2VYT A;  4LN2 A;  2V8I A;  3ZFJ A;  4HCB A;  3EGD B;  1BI0 A;  4J9G A;  3QBY A;  1RL2 A;  1M3A A;  4M78 E;  1VQM A;  4J8O A;  2X35 A;  2CSI A;  2MK5 A;  1TTH B;  2DO3 A;  3VJP A;  1RAH B;  3CXC P;  3CCL T;  1GCQ A;  2DD5 A;  3CCM A;  4M75 G;  1E6G A;  3J7A F;  1Y71 A;  1W4S A;  3PGG A;  4M7A C;  2C0O A;  4PJO A;  2K7A A;  1VQ4 A;  4F7U A;  2MI6 A;  2XIC A;  2E6N A;  4J9F A;  5FU6 B;  3MEA A;  1OPL A;  5KYN A;  3PVL A;  4M7A F;  4JDS A;  2CZ1 B;  2FVU A;  3CXC A;  2YXY A;  5GAM j;  3MKD A;  5I21 A;  1UG1 A;  3X25 B;  2XDB A;  4QT7 A;  1YJ9 Q;  1RLQ C;  3EG2 A;  2VUB A;  4FW2 A;  4D8K A;  2DPP B;  3RDV A;  2QA4 A;  3WVD B;  1Q81 C;  1K73 U;  2DFU A;  5GMK h;  2COW A;  4M77 G;  3JCM P;  2K5L A;  1WX6 A;  2DNU A;  1BIA A;  1S1N A;  2A28 A;  4QW2 A;  4IUT A;  1QQJ A;  3QO3 A;  4BI3 A;  1QCF A;  2X51 A;  4E47 A;  3VS6 A;  2QAS A;  2XID A;  5GAN 2;  4PJL A;  1WFW A;  4HKE A;  4QQG A;  5GAN 7;  4M7A B;  4XU0 A;  4FU6 A;  2DET A;  4N0A A;  1AOJ A;  2EW3 A;  3M56 A;  3EG0 A;  3OSV A;  3WVE B;  1VYU A;  2Y90 A;  1ABQ A;  4J5Y A;  5GAO r;  4CRI A;  5IHI A;  4C92 A;  4MDW A;  3CXC S;  1WXU A;  5IN1 A;  2VVK A;  1B34 B;  3UDC A;  2LRQ A;  2DJZ A;  2RM4 A;  4ZGE B;  3OYD A;  1NZ9 A;  1OX8 A;  1NLP C;  3ZEH A;  4J7I A;  4PK4 A;  3QJY A;  3TVT A;  2DER A;  2ATC B;  2IG0 A;  5LL6 S;  1VQ4 T;  1SKU B;  3OBY A;  4M7D B;  1OOT A;  4Z8A A;  4DOW A;  5DLQ E;  4RTY A;  3OYJ A;  1W2B P;  4C5E A;  3CPF A;  5FLX E;  3L2R A;  1LPL A;  1AT1 B;  3EGD A;  5HY6 A;  3H9N A;  1VQ7 A;  3TSZ A;  1WHL A;  1HK9 A;  4F7U G;  2V1Q A;  3CCQ A;  2GTJ A;  3V7R A;  1VYV A;  1WQW A;  1H92 A;  2CP0 A;  1W2B A;  4LDX A;  1NYG A;  2GFA A;  2JOY A;  1UB4 A;  2XMF A;  3CEY A;  4XK8 E;  2KRS A;  4QVZ A;  2ED1 A;  2E64 A;  5CCA A;  2AKK A;  2KE9 A;  1FYN A;  1I07 A;  3UAT A;  4C8Q G;  5LJ5 j;  2FZC B;  3M9Q A;  2DM1 A;  4RG8 A;  5DM7 R;  1YJ9 T;  1PRL C;  3JB9 D;  2E5Q A;  2HCK A;  1WXB A;  5ECA A;  1VQO Q;  3OW2 P;  2K79 A;  5GAM h;  1RUW A;  3EAE A;  2OI3 A;  1KD1 U;  5FU7 B;  2X3X D;  1M1K U;  2O01 E;  4JRK A;  1U3O A;  2QQS A;  1M3C A;  4C92 G;  2DMO A;  2FEI A;  3LWI A;  1I4K 1;  2DIQ A;  5GAM g;  3G1J A;  4Y28 E;  3OW2 A;  1VQK T;  4AG2 C;  3J80 E;  3GP8 A;  4M7A A;  1TWB A;  2PUO B;  2EQK A;  3CC2 Q;  1KFZ A;  3DLM A;  2O9V A;  4A4K A;  1VQL Q;  3QWY A;  3EFR A;  3M58 A;  1ZX6 A;  2DBM A;  3JCM h;  4C0D C;  2F1L A;  1VQO A;  2F2V A;  3ASK A;  2LJ3 A;  1U5S A;  1JQQ A;  5LJ3 e;  3OYF A;  3GBQ A;  3JCM d;  4JS5 A;  2VGN A;  1Y57 A;  2QXF A;  1RAI B;  1N8R R;  2QYZ A;  3BDL A;  2BE7 D;  1YWO A;  4J9D A;  2SEM A;  1K8A U;  2CP2 A;  1RI0 A;  2JN0 A;  2DX1 A;  2LCC A;  1UFF A;  3I56 Q;  2LQK A;  3DLL A;  1ZSZ C;  1I5O B;  3C94 A;  1D09 B;  1BIB A;  2XU8 A;  1VQL A;  5CKF A;  4A4G A;  1IGU A;  2CH4 W;  4Y92 A;  3CD6 Q;  3L42 A;  5GAM f;  4M75 C;  2DIG A;  2PQW A;  2RI3 A;  2HL5 C;  4C0D B;  3OS0 A;  2AT1 B;  2ENM A;  2RD1 A;  5AT1 B;  2WAC A;  3CMA A;  1KC8 U;  1X43 A;  4DQ2 A;  2L5Q A;  4Z88 A;  1AWW A;  2DEQ A;  4M75 F;  4RMO A;  5IHK A;  5FWB A;  2COY A;  5KYY A;  3ME9 A;  2J05 A;  2RMO A;  3VRY A;  3LGL A;  3CCJ Q;  1TOV A;  1UGR B;  2CZ7 B;  4PJJ A;  5EG2 A;  2RHX A;  3VRZ A;  5GAO q;  2QDY B;  4JJN K;  3I5S A;  4M7D E;  3V8J A;  2DKG A;  1H64 1;  3JCM V;  1WHJ A;  1OZ3 A;  2QQR A;  2HL3 A;  3CD6 A;  4PFP A;  1NPR A;  1VQO T;  3C12 A;  4MZT A;  5LJ5 h;  4M75 B;  2Z0W A;  8ATC B;  2ECZ A;  3M53 A;  5IHN A;  4JLI A;  1H3Z A;  3LYI A;  2MWP A;  1YN8 A;  4BB7 A;  1WLP B;  5LJ5 d;  5FW9 A;  1K73 R;  2VC8 A;  4LD9 K;  1N6A A;  4KUL A;  4NL3 A;  2X4W A;  2ZPI B;  2YRD A;  1Z9Z A;  3C95 A;  5LJ5 g;  3PIO A;  2PVD B;  2YUQ A;  4C5I A;  2E5K A;  3GOX A;  3THK A;  1OZ2 A;  3CC2 T;  4EMG A;  4IUP A;  1UUE A;  4HCK A;  5GMK m;  1VQL T;  2YLB A;  2BUD A;  3J81 E;  1N8R C;  5J26 A;  4M77 B;  2C06 A;  2CGH A;  1QCN A;  4OMN A;  3OQ5 A;  2RH2 A;  4QQ6 A;  2LCL A;  2L8D A;  3EG9 A;  5EC7 A;  4CC4 B;  1GXI E;  4BE0 A;  3JCM b;  3X28 B;  4RTT A;  3OMC A;  4OML A;  4IUV A;  1ZHI A;  2WSE E;  5C0M A;  2AZS A;  4AFU C;  3I56 T;  2DXT A;  3FDR A;  5CQY A;  3RMQ A;  4IKF A;  2RQU A;  2R57 A;  3PMT A;  2ZAE A;  2LTO A;  1ZUY A;  3CD6 T;  1OU8 A;  2O4X B;  2KMT A;  3E2U A;  2M16 A;  5I22 A;  2LJ1 A;  5GAN 5;  2XDP A;  1WZO A;  1X01 A;  2V8K A;  1QLY A;  5D7U A;  3I55 A;  4F04 B;  3S3O A;  1PRM C;  3KUF A;  2JNG A;  2ZPH B;  2V26 A;  1HXD A;  4DOV A;  4Z89 A;  4C8Q C;  1K9M U;  3OA6 A;  4F14 A;  4OB1 B;  3CCJ T;  1VQ5 Q;  4AFS C;  3ULR B;  2RJC A;  1Q95 G;  1IZ6 A;  2EYW A;  3VUB A;  4NS5 A;  4E7S A;  1QVG P;  2LT4 A;  4MML A;  1M1F A;  3OS2 A;  4F7U B;  3JCM c;  2JS2 A;  2F5K A;  1ZSZ A;  1MMD A;  1K73 C;  2PVG B;  2NWM A;  1U06 A;  1X6O A;  4J9E A;  1VQ9 Q;  5KE2 A;  1QVG A;  2JW4 A;  1AZE A;  2J6F A;  5KYW B;  4M75 A;  3UT1 A;  2CH4 A;  4E7H A;  4OMP A;  5HK0 A;  2VWF A;  1KD1 R;  3EHR A;  1RAF B;  2H3J A;  2HKN A;  3OYI A;  1M1K R;  4C8Q B;  1Q7Y U;  3A1P A;  3HFN A;  1GCP A;  3P8B B;  2QAZ A;  3C0C A;  3SHW A;  2QGG A;  3L2W A;  2MAM A;  1U1T A;  2FO0 A;  1ZA2 B;  2KXD A;  4Q5W A;  1G3T A;  3FC3 A;  1JJ2 S;  1OV3 A;  1ZBJ A;  2MF2 A;  2HQE A;  1UJY A;  2RJF A;  1W6X A;  2SRC A;  3SDZ A;  4LD6 A;  3WXM B;  1AHJ B;  4E7L A;  2DRK A;  3VKI A;  4C92 B;  2DYI A;  3ER0 A;  1W1F A;  1Y96 A;  5J39 A;  1TG0 A;  1XNI A;  1IHW A;  4A4E A;  2EVR A;  5CVI A;  2DTI A;  1VYT A;  3E9G A;  5L8R E;  2P4R A;  2EYX A;  1OUL A;  1R77 A;  4PL6 A;  1WHH A;  3MP6 A;  1FMV A;  1K8A R;  1VUB A;  4LUD A;  1E6H A;  4PJO D;  2QTV A;  3QSU A;  1H3H A;  1WJS A;  3QWX X;  5GAN f;  2FRY A;  3M54 A;  3A8H B;  4XTX A;  2O4X A;  4AMC A;  2BZ8 A;  2G6F X;  3QHS A;  2HMA A;  3HRT A;  2KAF A;  2F69 A;  4M77 E;  4Y91 A;  2K57 A;  2DBK A;  3V7S A;  3OYC A;  1KC8 R;  1C0M A;  1KG1 A;  3NTK A;  4FYV B;  2CP5 A;  3G6E Q;  4B6M A;  1XQH A;  2DYB A;  1VQ5 T;  2D8H A;  1YWP A;  2CZ0 B;  2JTE A;  2AHJ B;  1WJQ A;  3QJ6 A;  2ZPE B;  1QMC A;  1ZQ1 A;  2O9S A;  3X26 B;  2HKQ B;  3V7C A;  1X6B A;  4OGC A;  1U1S A;  2E6Z A;  5HK3 A;  3S6W A;  2GBQ A;  2PZ1 A;  1KD1 C;  1N27 A;  1VQ9 T;  2YUP A;  4J6X A;  1M1K C;  5CO7 A;  4KGX B;  1SRL A;  5GAO p;  1SSH A;  2XK0 A;  5KYW A;  5KYX B;  3OSS C;  4IUU A;  1AD5 A;  3M0P A;  2PVO B;  4LXC A;  4B9X A;  1KSW A;  2I2L A;  1AEY A;  2H3E B;  3INZ A;  4C8Q A;  1T0H A;  1TUD A;  3L2V A;  2ZCF B;  2R58 A;  3VU3 C;  2JS0 A;  3VV0 A;  4Z02 A;  2E4H A;  2HNI A;  3H0F A;  3QPH A;  3VYG A;  4PJO E;  5GMK e;  3L2Q A;  1VQK Q;  3JB9 F;  4F7U E;  3M0Q A;  1M2V A;  1QVF S;  2R5A A;  2CDT A;  4WTO B;  4D8D A;  3RIR A;  4ATO A;  1M8M A;  4IIO A;  1YJ9 A;  1K8A C;  2OTL Q;  2MMP A;  4XTZ A;  3N5B B;  1NJI U;  1YP5 A;  4M78 G;  3QII A;  3JB9 H;  2AZV A;  2D0Q B;  4HVW A;  2M0O A;  3A8L B;  3E19 A;  3FJ5 A;  5GAO l;  1X2Q A;  2Y4Y A;  2FHD A;  2DL4 A;  1UJ0 A;  3V8L A;  2RN8 A;  5KYU B;  2DVJ A;  3MCA B;  1G3Y A;  3TQ7 P;  2HDA A;  2HQX A;  1FMK A;  1VQK A;  2WSF E;  3O8V A;  3FB9 A;  1KC8 C;  1QVP A;  3PTA A;  3KXT A;  5GAN 6;  1B07 A;  1NYF A;  4RCB A;  1IO6 A;  5C6S A;  2RK1 A;  4FM4 B;  2OTL A;  4C92 E;  2YDL A;  1UEC A;  3HKS A;  3G6E T;  1Q82 U;  1MV3 A;  1YNZ A;  1M8V A;  2WSC E;  1Q86 U;  1I0C A;  1UHF A;  2RO0 A;  6AT1 B;  3EGX A;  1M90 U;  1K9M R;  3OYY A;  5KYY B;  2YUN A;  4N4G A;  1PG5 B;  2P0K A;  2D6F A;  1ARK A;  3M5A A;  2DEU A;  4FSS A;  3E1S A;  1G83 A;  4M7A D;  1JRI A;  2YT6 A;  2ZZD A;  4LNP A;  2DZ9 A;  4ZN3 A;  4XTW A;  2HSE B;  2K3B A;  2LZ6 B;  2MOX A;  3SEM A;  2HAX A;  4J7F A;  2FPD A;  4JS4 A;  3P8H A;  1N5Z A;  1G3W A;  3OMG A;  1LNX A;  2JM9 A;  3QXE B;  1YIJ Q;  1HSQ A;  3EFO B;  3H0I A;  3MPU B;  2KVQ G;  1BI2 A;  5KYX A;  4X9C A;  4BE2 A;  2NUT B;  3HSB A;  1RAD B;  4MZM A;  4FSX A;  1Q7Y R;  2FL7 A;  2QTX A;  1NG2 A;  3PNW C;  5GAM d;  1S72 Q;  3EG1 A;  3UA6 A;  3UWN A;  5GAM e;  4M7D D;  1JBM A;  2LVM A;  1YHQ Q;  2RQW A;  5L23 A;  2HSP A;  1Y7X A;  3CCU Q;  1YI2 Q;  4E7I A;  1JO8 A;  4ELY C;  3QZ9 B;  3NGP A;  2A37 A;  1C1A A;  2OTL T;  5DLO A;  3JB9 J;  1YIJ A;  3MO8 A;  3QUI A;  1VQN Q;  3T9N A;  4LE9 A;  1ZLM A;  2JTF A;  4ZNX A;  3EG9 B;  2O31 A;  1UTI A;  2E1H A;  2EKH A;  4EPC A;  3CQT A;  3A8O B;  3JCM e;  5CK9 A;  4KBM B;  5A0G A;  3GNG A;  2BE9 B;  4LDV A;  5KYU A;  2DE0 X;  1YHQ A;  1JXM A;  3CCU A;  1YI2 A;  4MDX A;  3EFS A;  2LCS A;  3QYG B;  5LJ3 g;  2K2M A;  3CC2 A;  4KGZ B;  4OB3 B;  4M7A E;  1VIE A;  1K9M C;  4XU1 A;  3L2Z A;  1EZZ B;  3JV3 A;  2GNC A;  2VGM A;  2VAS A;  2B86 A;  5FRM A;  1QWF A;  4II1 A;  1YCS B;  3H8Z A;  2KGT A;  4C0G A;  4GLM A;  3EHQ A;  4J9C A;  1NE8 A;  1IHV A;  5GMK i;  4O5V A;  1BYM A;  2K6D A;  1Y07 A;  2JVV A;  1NPP A;  1AZG B;  1MGQ A;  4FYX B;  1XTD A;  2EGA A;  2RF0 A;  1PD1 A;  1GFC A;  4JUV A;  3OYG A;  3I56 A;  2M02 A;  4OMO A;  5GAN j;  2XDD A;  1YJN Q;  2KI7 A;  4A4H A;  3OYE A;  1ZSZ B;  2BZY A;  1PHT A;  2MCN A;  4DA4 A;  1Q7Y C;  3RER A;  3M0U A;  1YIJ T;  5D6X A;  4WCI A;  5LJ3 f;  3EFO A;  4FIB A;  3VS5 A;  2ROT A;  9ATC B;  3E9F A;  4YTL A;  2NUT A;  2ZGW A;  1S72 T;  4EMK C;  1HJD A;  1PNJ A;  2IIM A;  2DRM A;  5LJ5 e;  2EQJ A;  4DEY A;  3CCJ A;  2F5T X;  1E7O A;  1KHC A;  1SHG A;  2HBP A;  1YHQ T;  1XOV A;  4A53 A;  3CCU T;  1YI2 T;  1UGS B;  2LC4 A;  4M78 C;  3VS1 A;  2F2W A;  1TSF A;  3PVQ A;  1X75 C;  2EJG A;  3BFM A;  3CC7 Q;  4ZGD B;  1IGQ A;  1WHM A;  1YCY A;  1CKA A;  5IT9 E;  2RHY A;  1AVZ C;  2JT4 A;  4M78 F;  2BTT A;  4RTV A;  2CUB A;  2DL7 A;  3MEV A;  3M4Y A;  3GPL A;  2A3L A;  2DTO A;  4RTZ A;  1VQN T;  3JB9 G;  1NJI R;  5A0L A;  1Y96 B;  3H41 A;  5I2M A;  2LNV A;  1SG5 A;  3A5Z B;  2DIL A;  4XTU A;  2V8J A;  4FW1 A;  4DBQ A;  3P8D A;  4J6Y A;  2EKO A;  3JSC A;  4L59 A;  1OI1 A;  3CCR Q;  2EQM A;  1CSK A;  4O6J A;  3LGF A;  2X4X A;  4R55 A;  2CP6 A;  2K5I A;  4PJN A;  3CC7 A;  4M78 B;  1K1Z A;  2LDM A;  4JRI A;  4RUG A;  4JRQ A;  2I0N A;  3HTR A;  1K0X A;  3GIB A;  5CKD A;  2CP3 A;  4L5G A;  4J9I A;  5AYF A;  3NTH A;  4M75 D;  1Q82 R;  3A8M B;  1ZA1 B;  1O75 A;  1Q86 R;  1FX7 A;  1M90 R;  4BI4 A;  2B8A A;  1WHG A;  1FXX A;  1ZSG A;  1JJ2 P;  1BI3 A;  2DXB A;  3CCR A;  1FMW A;  3JAM E;  1WHK A;  4A4F A;  1G2B A;  3MHX A;  4PLL A;  2E65 A;  3CCS Q;  2AKL A;  4DBR A;  1YJN T;  3GF5 A;  1VQP Q;  3SFM A;  1U8R A;  2DK3 A;  4FCY A;  2LJ0 A;  1WA7 A;  1JJ2 A;  1M30 A;  4HXJ A;  1KK7 A;  4QQD A;  1QCO A;  1UGV A;  4RTU A;  4LUE A;  3V8K A;  2JJ9 A;  2CYZ B;  4M77 D;  1RAA B;  4PLI A;  2GFU A;  5GAN h;  4HVU A;  2KK4 A;  1MND A;  3REB B;  1GBQ A;  2KT1 A;  3CBO A;  4C5G A;  1P92 A;  3S3M A;  2L3P A;  5GAN d;  1UE9 A;  1Z9Q A;  1V76 A;  1EFN A;  1PWT A;  3ZL7 C;  3JRZ A;  3JCM W;  1LJO A;  4AFZ C;  3G71 T;  5GAN g;  2DJQ A;  1VQ5 A;  8AT1 B;  2OTJ Q;  3HRU A;  2XD0 A;  1LCK A;  5KCH A;  4JJD A;  1D3B A;  3NPF A;  2NUZ A;  2KEA A;  5FRN A;  3PFS A;  3CCS A;  4QVD A;  3G7Z A;  1VQP A;  2M1H A;  3FEO A;  4M4Z A;  3O5Z A;  1NJI C;  3CC7 T;  4TVR A;  1QW1 A;  4EDU A;  1X27 A;  1YJW Q;  2QEX T;  1M2V B;  4PJM A;  3QG1 A;  3DKM A;  1M27 C;  4LDW A;  7AT1 B;  5GAO n;  1VQ9 A;  2EYQ A;  2DXU A;  4BY6 C;  3D7S B;  1VQ6 Q;  5D6Y A;  2L3Q A;  2KYB A;  3MJX A;  2MYS A;  1BCO A;  3QZ5 B;  2LQ8 A;  1OQK A;  4M75 E;  2K3Y A;  2FRW A;  3TCJ A;  2P84 A;  2RQV A;  2K2V A;  1ACM B;  3AT1 B;  4HCC A;  2OTJ A;  5I2S A;  3CCR T;  3CBP A;  3RES A;  2ZPF B;  5FRO A;  3VS3 A;  4EMK A;  1CKB A;  2LMJ A;  2YLC A;  3NTI A;  2RI5 A;  1NEB A;  1Q82 C;  4A54 A;  2A08 A;  4M78 A;  4CC2 A;  3NFC A;  1HYO A;  1TUC A;  1BK2 A;  1Q86 C;  2X4Y A;  4OVA A;  1M90 C;  1VQM Q;  3CPW P;  4RTX A;  1TU0 B;  1OX9 A;  3OYM A;  4JJB A;  2YSQ A;  1PSF A;  4OMQ A;  5CKH A;  4FT4 A;  4JJC A;  2KSS A;  3CCM Q;  4J6W A;  2O88 A;  3LH0 A;  4XTY A;  3EGX B;  1ZUU A;  2VXE A;  4C8Q D;  1AWX A;  2PTK A;  3RKW A;  1QVF P;  2RJD A;  1K9A A;  2KY9 A;  4OP0 A;  3CPW A;  5KCO A;  4JRP A;  2X4J A;  3TEE A;  2JM8 A;  2LQN A;  3NMZ C;  4WF2 A;  3CCS T;  1SHF A;  4AG1 C;  1VQP T;  3TRE A;  1G3S A;  4RG2 A;  2QK0 A;  5GJW B;  2AIR B;  3M0T A;  1GBR A;  1BBZ A;  2RPN A;  1VA7 A;  3RNJ A;  1HD3 A;  2ESW A;  5A0D A;  1RI9 A;  1QVF A;  2FPE A;  2QA4 Q;  4OB2 B;  3PIP A;  2YUO A;  2K9G A;  4C92 D;  4J9B A;  2M0Y A;  3QKJ A;  1T0J A;  3HFO A;  1BCM A;  2GF7 A;  1D0X A;  1KQ1 A;  3GNF B;  3G6E A;  3OYB A;  5IH2 A;  2IPO B;  1BU1 A;  1ZUK A;  4GBQ A;  3QDF A;  1I8F A;  1MMN A;  2EQU A;  2OTJ T;  4JZ3 A;  4J83 A;  4CC7 A;  2RQT A;  2QG9 B;  3QYH B;  1YFN A;  2JTM A;  3MET A;  2MPX C;  4BE1 A;  3CPW S;  3JCM Q;  1BB9 A;  4N4H A;  2L89 A;  2E12 A;  3CME Q;  3CBM A;  4E6R A;  2BZX A;  2LQW A;  1M3B A;  1YJW T;  2RHI A;  2C0I A;  2KNB B;  2E41 A;  3OYA A;  3REA B;  3PT9 A;  1RAB B;  3OYH A;  5GAN 3;  2F2X A;  2HZY A;  3JCM J;  2CP7 A;  1VQ6 T;  3DB3 A;  2YHT A;  3I35 A;  2EQI A;  3LW5 E;  4AT1 B;  1FWZ A;  4DEX A;  1GRI A;  1UGQ B;  4M7D C;  1PM3 A;  5LJ3 j;  2W0Z A;  5CQX A;  3HHT B;  4CC3 A;  1MMA A;  2MIO A;  4FL6 A;  4XAX B;  1RLP C;  3BE3 A;  4ZTJ A;  4JZ4 A;  4XQ3 A;  1PKS A;  2NLU A;  3DB4 A;  4M7D F;  2CZ6 B;  1I1J A;  3JB9 I;  3A98 A;  4C8Q E;  3CME A;  2PU9 B;  1QP2 A;  3HRS A;  1VQ7 Q;  2J6O A;  3KBG A;  1KJW A;  2OAW A;  1VQM T;  3CCQ Q;  2XG8 D;  3UF4 A;  4FYW B;  3RKY A;  3FIF A;  4L6V 5;  2E70 A;  3LX7 A;  1LVK A;  2HEQ A;  1XJW B;  2DL8 A;  3CCM T;  3MEW A;  1QP3 A;  2L0A A;  2OAU A;  2RQR A;  1VQ8 Q;  2FZK B;  1T3L A;  3EH1 A;  2EJ9 A;  2A36 A;  2EGC A;  2OX7 A;  1JB0 E;  1PKT A;  1F1B B;  2EYZ A;  3X24 B;  3VYH B;  3PE0 A;  3SD4 A;  3MEU A;  1EX4 A;  4PJO G;  2NYS A;  3R6N A;  4ELZ C;  5CKE A;  4HT9 A;  1X6G A;  3CCV Q;  2JMA A;  4DBH A;  2FYK A;  5D6W A;  2E10 A;  5CIU A;  5FU7 C;  2RJE A;  4DBF A;  3ZBD A;  2QA4 T;  2GTO A;  1R8O B;  2ED0 A;  2D0N A;  4XTV A;  5HCK A;  2YRV A;  4E7K A;  1WI7 A;  1OEB A;  3TSW A;  1OYX A;  1V29 B;  1QWE A;  2DXC A;  1VQ8 A;  5GAN 8;  2A0F B;  4PKC C;  4BAC A;  2IVW A;  2QQ9 A;  1MV0 B;  1D1B A;  1UGP B;  2W10 A;  1YBY A;  1PSE A;  4X1V A;  5CAI A;  3CME T;  3C4S A;  2VKN A;  4PFZ A;  4CI0 C;  2CRE A;  2PUK B;  1N9S A;  1PD0 A;  5GMK l;  2HBW A;  2VV5 A;  3CCV A;  2P0Q A;  4E7Z A;  2EGE A;  1RAE B;  2X9H A;  4NL2 A;  3S3N A;  2DF6 A;  2MWO A;  2CKK A;  2KT8 A;  2BKD N;  1J3T A;  1W2B S;  2HQH A;  4K11 A;  4ME7 A;  1B7T A;  2D1X A;  2NUP B;  1DJ7 B;  1WNL A;  1IXD A;  1PC0 A;  2J7I A;  1I5L A;  4PFO A;  4KGV B;  2JMC A;  4BI8 B;  2ZPG B;  1SPK A;  1M9S A;  4FYY B;  3OBW A;  2V1R A;  2XI9 A;  1Q81 U;  3RR6 A;  2ROL A;  3M4G A;  1KHI A;  1M4Z A;  5LJ3 h;  1S72 A;  1X69 A;  2HD0 A;  3L1A A;  1G8X A;  2DVE A;  3PMI A;  1SRM A;  3X20 B;  4R0K A;  5GJV B;  1VQ7 T;  4ZTF A;  3VS4 A;  5LJ3 d;  1GL5 A;  1SSF A;  4F16 A;  5CR2 A;  1D1A A;  3CCQ T;  2E3H A;  2DTH A;  5HKC A;  1B34 A;  2QQA A;  2CUD A;  5IAY A;  3CMA Q;  2FZG B;  2GGR A;  2A7Y A;  1K0S A;  1PCX A;  3JCM g;  2R5M A;  4LDU A;  2FPF A;  5IXB A;  1TXQ A;  3MP1 A;  1K76 A;  1R0C B;  2M9U A;  2KRO A;  2QDL A;  3OS1 A;  3VS2 A;  1VQN A;  5GAO m;  1VQ8 T;  2KBT A;  4ANJ A;  4M7D A;  3M0R A;  2EIF A;  3OW2 S; 
#chains in the Genus database with same CATH homology
 3FJP A;  1O75 A;  2K3X A;  2KAF A;  2F69 A;  3HRT A;  3L2R A;  4HT8 A;  2CS7 A;  4M77 E;  1FX7 A;  4Y91 A;  2P4T A;  2B8A A;  2K57 A;  1FXX A;  4OGE A;  3V7S A;  4BI4 A;  5HY6 A;  3OYC A;  5CKB A;  1KG1 A;  2DD4 A;  3NTK A;  1BI3 A;  2DZC A;  1VQ7 A;  2K4Y A;  2DXB A;  4KT0 E;  2RHZ A;  1HK9 A;  3CCR A;  4F7U G;  1XQH A;  3CCV T;  3CCQ A;  1VQ5 T;  3JAM E;  4LDY A;  4OF1 A;  4A4F A;  3V7R A;  1WQW A;  3FRN A;  4LDX A;  1W2B A;  2CZ0 B;  3MHX A;  4VUB A;  4PLL A;  2E65 A;  2RI2 A;  4HA8 A;  2GFA A;  2AHJ B;  5DY9 A;  2JOY A;  3GF5 A;  1WJQ A;  3SFM A;  1YJN T;  3QJ6 A;  4P5N A;  4C5H A;  1U8R A;  2ZPE B;  2DK3 A;  3OY9 A;  1UB4 A;  1JJ2 A;  3CEY A;  4XK8 E;  1ZQ1 A;  3X26 B;  1UEB A;  3V7C A;  4QVZ A;  4QQD A;  4OGC A;  1U1S A;  2E6Z A;  5HK3 A;  2E64 A;  3S6W A;  3OS5 A;  3V8K A;  4M77 D;  2CYZ B;  1LOJ A;  2RHU A;  5CCA A;  1KD1 C;  4PLI A;  2GFU A;  1WGS A;  5GAN h;  1N27 A;  2KK4 A;  3SWN C;  1VQ9 T;  4J6X A;  1M1K C;  5CO7 A;  3JCM X;  3CBO A;  4C8Q G;  3LWH A;  4C5G A;  1P92 A;  5LJ5 j;  3G4S A;  4BDY A;  3S3M A;  3M9Q A;  5GAN d;  4RG8 A;  3JCM W;  4MZP A;  3JCM f;  3JRZ A;  5GAO p;  5DM7 R;  4E7J A;  1YJ9 T;  1N9R A;  1M1G A;  2XK0 A;  1LJO A;  3JB9 D;  1G5V A;  2E5Q A;  4M77 C;  1D3B B;  5M9O A;  5A2Q E;  3OSS C;  4RKU E;  3G71 T;  4IUU A;  5GAN g;  2LX9 A;  1VQ5 A;  3HRU A;  2XD0 A;  1YIT A;  2PVO B;  1KQ2 A;  1O9S A;  5KCH A;  4GLK A;  1D3B A;  4B9X A;  5GAM h;  4KUI A;  2I2L A;  3EAE A;  5FRN A;  4M7A G;  3INZ A;  1KD1 U;  4C8Q A;  3PFS A;  3CCS A;  1YJN A;  4M77 F;  5FU7 B;  4QVD A;  3G7Z A;  1VQP A;  2M1H A;  3FEO A;  1M1K U;  4QVC A;  3L2V A;  1NJI C;  3CC7 T;  2O01 E;  2ZCF B;  4JRK A;  4TVR A;  4KUD K;  4V2S A;  2R58 A;  2QQS A;  4C92 G;  1QW1 A;  4NOY A;  4IUQ A;  3VU3 C;  4X34 A;  3VV0 A;  4XU2 A;  3SB2 A;  4EDU A;  4Z02 A;  2QEX T;  4ZGJ B;  2HNI A;  3LWI A;  3MP8 A;  3QPH A;  1I4K 1;  3VYG A;  4PJO E;  5GMK e;  2DIQ A;  3QG1 A;  5GAM g;  3DKM A;  3L2Q A;  2QI2 A;  1BKB A;  4LDW A;  4Y28 E;  4F7U E;  3OW2 A;  5GAO n;  1VQK T;  3JB9 F;  1VQ9 A;  2EYQ A;  3J80 E;  3GP8 A;  2DXU A;  4BY6 C;  4M7A A;  1QVF S;  5D6Y A;  2R5A A;  2PUO B;  2EQK A;  3SWN B;  3RIR A;  4D6W A;  3CC4 A;  3QZ5 B;  4ATO A;  2GQV A;  3DLM A;  3VUZ A;  4A4K A;  1YJ9 A;  2LQ8 A;  1K8A C;  2MMP A;  4M75 E;  2K3Y A;  4XTZ A;  2GCX A;  3N5B B;  1NJI U;  3TCJ A;  3EFR A;  3M58 A;  3G71 A;  4M78 G;  2K2V A;  3QII A;  3JCM h;  4C0D C;  1VQO A;  4HCC A;  4EMK B;  3ASK A;  3JB9 H;  1KQS A;  2OTJ A;  2D0Q B;  5I2S A;  3CCR T;  3TU4 K;  2FB7 A;  3CBP A;  2M0O A;  3A8L B;  3RES A;  2ZPF B;  5LJ3 e;  5FRO A;  3R6O A;  3OYF A;  2Y4X A;  3E19 A;  4EMK A;  3GLX A;  3JCM d;  4M7D G;  5GAO l;  4JS5 A;  2VGN A;  2YLC A;  3CMA T;  2Y4Y A;  2FHD A;  3URG A;  2QXF A;  3NTI A;  3V8L A;  2RI5 A;  4OB0 B;  3BDL A;  3HP9 A;  1Q82 C;  4A54 A;  2QEX A;  2ZPB B;  3MCA B;  1G3Y A;  3A8G B;  4M78 A;  3M57 A;  3NFC A;  4EMH A;  2XHC A;  1Q86 C;  2X4Y A;  1K8A U;  2HQX A;  4OVA A;  1M90 C;  3CCE A;  2JN0 A;  1RI0 A;  1VQK A;  2WSF E;  3HL8 A;  3O8V A;  3FB9 A;  1KC8 C;  3BW1 A;  1QVP A;  2LCC A;  4R56 A;  3PTA A;  4PJO C;  3KXT A;  5GAN 6;  2LQK A;  3OYM A;  5KH6 A;  1PSF A;  3DLL A;  5CKH A;  4FT4 A;  3C94 A;  4RCB A;  5C6S A;  2KSS A;  1BIB A;  3G4S T;  3RUX A;  2XU8 A;  1VQL A;  2RK1 A;  4FM4 B;  2OTL A;  5CKF A;  4J6W A;  4A4G A;  3LH0 A;  4XTY A;  2XKO C;  4PJO F;  4C92 E;  3G6E T;  1Q82 U;  3HKS A;  2VXE A;  3L42 A;  5KE3 A;  1M8V A;  4F7U F;  5GAM f;  5LJ5 f;  2WSC E;  4M75 C;  2DIG A;  2PQW A;  4C8Q D;  2RI3 A;  3RKW A;  1Q86 U;  4C0D B;  2RJD A;  3H6Z A;  3OS0 A;  2KY9 A;  2RO0 A;  4OP0 A;  3CPW A;  1YIT T;  1M90 U;  4B9W A;  2RD1 A;  5KCO A;  4JRP A;  1KQS S;  2WAC A;  2X4J A;  3TEE A;  3CMA A;  1KC8 U;  3OYY A;  4DQ2 A;  2L5Q A;  4N4G A;  4WF2 A;  3CCS T;  2RK2 A;  3M59 A;  2P0K A;  1VQP T;  3TRE A;  2DEQ A;  4M75 F;  2JUF A;  1G3S A;  4RMO A;  2D6F A;  4RG2 A;  2JZ2 A;  3M5A A;  1WPY A;  3UPU A;  2LT1 A;  4C0Z A;  3ME9 A;  3E1S A;  4M7A D;  3LGL A;  4UC4 A;  1UGR B;  2CZ7 B;  1JRI A;  3BY7 A;  3RMS A;  4RCC A;  5A0D A;  3BDU A;  1QVF A;  2ZZD A;  2RHX A;  2DZ9 A;  5EG2 A;  2D9T A;  4ZN3 A;  4XTW A;  5GAO q;  2QDY B;  4OB2 B;  4ZN1 A;  4BD3 A;  4C92 D;  3PIP A;  4C8Q F;  1VIF A;  4JJN K;  2HAX A;  4M7D E;  4OMF B;  3V8J A;  2DKG A;  4PJO B;  1H64 1;  3QKJ A;  3JCM V;  3HFO A;  4J7F A;  4N0A C;  4JS4 A;  3CC4 T;  1OZ3 A;  2GF7 A;  2EJF A;  2QQR A;  3P8H A;  1G3W A;  1WQ7 A;  1LNX A;  3OMG A;  1KQ1 A;  3GNF B;  5GAN e;  3G6E A;  3OYB A;  3CD6 A;  2L3R A;  1IRE B;  1NPR A;  3QXE B;  4BUG A;  3Q1J A;  3OYL A;  1I8F A;  2EQU A;  3F70 A;  3C12 A;  1VQO T;  2OTJ T;  2KVQ G;  4MZT A;  4C92 C;  1BI2 A;  4J83 A;  5GAN 4;  3OYK A;  3QYH B;  2RA2 A;  4X9C A;  4M75 B;  5LJ5 h;  4BE2 A;  3HSB A;  2JTM A;  3MET A;  3M53 A;  1WJR A;  3CPW S;  4BE1 A;  4JLI A;  4MZM A;  4FSX A;  2FL7 A;  1H3Z A;  4M78 D;  3JCM Q;  3LYI A;  2MWP A;  2QTX A;  4N4H A;  3PNW C;  2L89 A;  2E12 A;  4XU3 A;  4BB7 A;  3CBM A;  5GMK j;  4C92 F;  5LJ5 d;  5GAM d;  2VC8 A;  4LD9 K;  1YJW T;  3UWN A;  2RHI A;  1N6A A;  4N4I A;  5GAM e;  4KUL A;  4NL3 A;  4M7D D;  2X4W A;  1JBM A;  2LVM A;  2ZPI B;  1EIF A;  1TH7 A;  2E41 A;  3C95 A;  5LJ5 g;  3PT9 A;  3OYA A;  3PIO A;  3CCE T;  1Y7X A;  2EAY A;  2PVD B;  2QQB A;  4C5I A;  3OYH A;  5GAN 3;  3GOX A;  4BDZ A;  4X9D A;  4E7I A;  3JCM J;  3CCL A;  1VQ6 T;  1OZ2 A;  3DB3 A;  4ELY C;  3QZ9 B;  3CC2 T;  2YHT A;  4EMG A;  3LW5 E;  1FWZ A;  4IUP A;  1UGQ B;  5GMK m;  4M7D C;  3SWN A;  1VQL T;  2OTL T;  5LJ3 j;  2EFI A;  2P0P A;  5CQX A;  3HHT B;  2DAQ A;  5DLO A;  2YLB A;  4PNO A;  3JB9 J;  2BUD A;  4FL6 A;  4XAX B;  4GY5 A;  5J26 A;  3J81 E;  1YIJ A;  1N8R C;  3AHU A;  2KQW A;  3MO8 A;  3QUI A;  4M77 B;  3T9N A;  4ZTJ A;  2C06 A;  2JTF A;  2CGH A;  4JLG A;  5J3B A;  4XQ3 A;  4M7D F;  2NLU A;  3DB4 A;  2KDS A;  3OQ5 A;  3QDR B;  3RKX A;  4M77 A;  2CZ6 B;  2E1H A;  2RH2 A;  4EPC A;  4QQ6 A;  3JB9 I;  3I55 T;  2LCL A;  3A8O B;  4C8Q E;  3JCM e;  2L8D A;  1QVG S;  5CK9 A;  4IUR A;  3CME A;  1M5Q 1;  1GXI E;  2PU9 B;  4BE0 A;  4KBM B;  3JCM b;  3X28 B;  5A0G A;  3GNG A;  1YJW A;  4LDV A;  1QP2 A;  3FLG A;  3HRS A;  3OMC A;  3HPW A;  3LLR A;  4IUV A;  3KBG A;  1YHQ A;  1ZHI A;  2WSE E;  1VQM T;  2VXF A;  4MMK A;  5C0M A;  2XG8 D;  1N8R U;  3CCU A;  4HCZ A;  1YI2 A;  4MDX A;  3RKY A;  3EFS A;  1VQ6 A;  2EWN A;  1ZBX A;  3OB9 A;  2K5F A;  3FIF A;  3QYG B;  2E70 A;  4L6V 5;  5LJ3 g;  3I56 T;  4FT2 A;  3LX7 A;  4OB3 B;  3CC2 A;  4BY6 B;  2RB6 A;  2DXT A;  3FDR A;  4M7A E;  5CQY A;  1VIE A;  3RMQ A;  4IKF A;  2R57 A;  1K9M C;  3CCM T;  1MHN A;  3PMT A;  4C0F A;  3MEW A;  1QP3 A;  2G3R A;  3OYN A;  2LTO A;  1I81 A;  2BIV A;  3L2Z A;  4XU1 A;  5FU6 C;  3CD6 T;  3L2U A;  2O4X B;  2VGM A;  2KMT A;  1BI1 A;  2M16 A;  2OAU A;  5FRM A;  3M55 A;  2VYT A;  5GAN 5;  2V8I A;  2XDP A;  3ZFJ A;  4II1 A;  4HCB A;  3H8Z A;  4C0G A;  2EJ9 A;  1X01 A;  2V8K A;  3I55 A;  1JB0 E;  3S3O A;  1BI0 A;  3KUF A;  3X24 B;  3VYH B;  3QBY A;  2JNG A;  2ZPH B;  3SD4 A;  3MEU A;  1HXD A;  1NE8 A;  5GMK i;  4DOV A;  4O5V A;  1BYM A;  1RL2 A;  4PJO G;  4C8Q C;  4ELZ C;  1K9M U;  5CKE A;  1Y07 A;  3OA6 A;  2JVV A;  1NPP A;  4HT9 A;  4OB1 B;  4M78 E;  1MGQ A;  1VQM A;  4J8O A;  3CCJ T;  1XTD A;  2FYK A;  5D6W A;  2E10 A;  2X35 A;  5CIU A;  2RJC A;  5FU7 C;  4JUV A;  2RJE A;  1IZ6 A;  3VUB A;  3ZBD A;  4NS5 A;  2DO3 A;  3OYG A;  3I56 A;  2LT4 A;  4MML A;  2QA4 T;  5GAN j;  3VJP A;  2XDD A;  3CCL T;  1R8O B;  2DD5 A;  1M1F A;  4A4H A;  3OS2 A;  3OYE A;  3CCM A;  4XTV A;  4M75 G;  4F7U B;  3J7A F;  2YRV A;  1Y71 A;  1W4S A;  3PGG A;  3JCM c;  4E7K A;  4M7A C;  4PJO A;  1VQ4 A;  2F5K A;  4DA4 A;  1Q7Y C;  1OYX A;  3RER A;  4F7U A;  1V29 B;  2MI6 A;  2XIC A;  2E6N A;  2DXC A;  1VQ8 A;  5GAN 8;  1YIJ T;  5FU6 B;  1K73 C;  2PVG B;  3MEA A;  1X6O A;  4PKC C;  4BAC A;  5D6X A;  2IVW A;  2QQ9 A;  5KE2 A;  4M7A F;  4JDS A;  5LJ3 f;  2CZ1 B;  1QVG A;  4FIB A;  2FVU A;  3E9F A;  4YTL A;  5GAM j;  1UGP B;  3CXC A;  1YBY A;  1PSE A;  4M75 A;  3UT1 A;  5I21 A;  3X25 B;  5CAI A;  4E7H A;  2ZGW A;  2XDB A;  3CME T;  1S72 T;  5HK0 A;  3C4S A;  4CI0 C;  4EMK C;  2PUK B;  5LJ5 e;  1N9S A;  2H3J A;  5GMK l;  2EQJ A;  3OYI A;  2VV5 A;  3CCJ A;  2P0Q A;  2VUB A;  3CCV A;  2F5T X;  1KHC A;  4NL2 A;  4C8Q B;  1Q7Y U;  2HBP A;  1YHQ T;  2DPP B;  3S3N A;  3HFN A;  2QA4 A;  1XOV A;  2MWO A;  3WVD B;  4A53 A;  2CKK A;  1UGS B;  2LC4 A;  4M78 C;  3CCU T;  1YI2 T;  1Q81 C;  1K73 U;  5GMK h;  3P8B B;  1X75 C;  2BKD N;  4M77 G;  3JCM P;  2EJG A;  3BFM A;  2K5L A;  1BIA A;  2MAM A;  4ZGD B;  3L2W A;  1W2B S;  1U1T A;  4QW2 A;  1YCY A;  4IUT A;  5IT9 E;  3QO3 A;  2RHY A;  4BI3 A;  4ME7 A;  4Q5W A;  4E47 A;  1G3T A;  1DJ7 B;  2XID A;  1WNL A;  4M78 F;  5GAN 2;  3FC3 A;  1JJ2 S;  4HKE A;  4QQG A;  3MEV A;  5GAN 7;  4M7A B;  1I5L A;  2MF2 A;  3M4Y A;  2HQE A;  4XU0 A;  4BI8 B;  4FU6 A;  2RJF A;  3GPL A;  4N0A A;  2ZPG B;  2A3L A;  2DTO A;  1VQN T;  3JB9 G;  3SDZ A;  4LD6 A;  3WXM B;  5A0L A;  1AHJ B;  1Y96 B;  3M56 A;  3OSV A;  5I2M A;  2LNV A;  3WVE B;  4E7L A;  2Y90 A;  1M9S A;  3A5Z B;  4J5Y A;  3VKI A;  4C92 B;  5GAO r;  3OBW A;  4XTU A;  2XI9 A;  3ER0 A;  2V8J A;  1Q81 U;  4CRI A;  1Y96 A;  3M4G A;  1KHI A;  1M4Z A;  5LJ3 h;  3P8D A;  5J39 A;  4J6Y A;  1XNI A;  1S72 A;  2EKO A;  4A4E A;  4C92 A;  4MDW A;  2HD0 A;  3CXC S;  3L1A A;  3JSC A;  5CVI A;  2DTI A;  2DVE A;  4L59 A;  3PMI A;  1OI1 A;  3X20 B;  3E9G A;  5L8R E;  1VQ7 T;  5IN1 A;  4ZTF A;  5LJ3 d;  1SSF A;  4PL6 A;  5CR2 A;  1B34 B;  3UDC A;  2EQM A;  4O6J A;  3CCQ T;  2LRQ A;  3MP6 A;  2DJZ A;  2RM4 A;  2DTH A;  3LGF A;  4ZGE B;  5HKC A;  3OYD A;  2X4X A;  1B34 A;  1NZ9 A;  1VUB A;  4R55 A;  2QQA A;  5IAY A;  2K5I A;  3ZEH A;  3CC7 A;  4PJO D;  4M78 B;  4J7I A;  2A7Y A;  2LDM A;  4JRI A;  3QSU A;  3JCM g;  2R5M A;  1WJS A;  3QJY A;  4JRQ A;  4LDU A;  2IG0 A;  3MP1 A;  5LL6 S;  2M9U A;  1VQ4 T;  3OBY A;  5GAN f;  3GIB A;  4M7D B;  3OS1 A;  5CKD A;  4L5G A;  1VQN A;  4DOW A;  5DLQ E;  3M54 A;  5GAO m;  3A8H B;  1VQ8 T;  4XTX A;  4M7D A;  5AYF A;  2O4X A;  3NTH A;  2EIF A;  4M75 D;  3OYJ A;  3A8M B;  3QHS A;  3CPF A;  4C5E A;  5FLX E;  3OW2 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...