1KQ2A

Crystal structure of an hfq-rna complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
NIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*UP*UP*UP*UP*G)-3'
publication title Structures of the pleiotropic translational regulator Hfq and an Hfq-RNA complex: a bacterial Sm-like protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Translation/rna
total genus 13
structure length 60
sequence length 60
chains with identical sequence B, H, I, K, M
ec nomenclature
pdb deposition date 2002-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1kq2A00
2DJZA 4M78D 2DTHA 1B34B 4XTXA 4OP0A 3V8LA 4EMHA 3EFRA 3BW1A 5LJ3f 5GAOm 3AHUA 3JB9I 4J6XA 4M78E 4C8QA 3BDUA 5I21A 4V2SA 1WQWA 4M78G 4EMKA 4XU3A 3INZA 4XTUA 4A54A 5GANg 4C8QD 1M5Q1 4WF2A 3JCMf 4M7DD 1I8FA 4C92C 4M77C 1X01A 4C8QF 4QVDA 2QTXA 2RM4A 4M7DE 1M8VA 1YCYA 2E10A 2DZCA 4F7UB 3BY7A 3PGGA 3V7SA 5GAN5 4M7DG 4NL3A 3JCMX 5CAIA 2CGHA 2E1HA 4M78C 4EMGA 4XTYA 3JCMW 2EJFA 3JCMg 3M4GA 4M75E 3QSUA 2DTOA 4F7UA 1D3BB 2EJ9A 4N0AA 4M75G 2VXEA 4EMKB 5GANj 1LOJA 5GANe 1I5LA 2YHTA 5GMKl 4HT8A 1D3BA 4M7AB 4JLIA 4JRKA 4PJOB 5LJ3j 2DKGA 4M7DC 5LJ3e 1JBMA 4F7UF 2E65A 4XU2A 5GAMd 1BIBA 3RKYA 5GAOp 1TH7A 3JCMJ 4M7AA 4PJOA 3JCMb 5GAN6 5LJ5d 1U1TA 4M75C 4QVCA 5LJ3g 3V8KA 2EJGA 4C8QE 5GMKj 2I2LA 3JCMe 5GAMf 5GMKe 4X9DA 4C8QG 1H641 4JRIA 3FIFA 3RKXA 3RKWA 5GMKi 2Y90A 1JRIA 2JN0A 2EAYA 3V7RA 5LJ5f 3JB9F 2EWNA 2RD1A 4A53A 5GAMh 2E41A 4PJOF 4M7AF 4XQ3A 3JCMQ 4C92B 3SWNB 3JCMc 5LJ5h 4M77B 3JCMP 3JB9J 1KQ2A 4NOYA 3HFNA 1HXDA 4XTWA 3RERA 3V7CA 4C92A 3SWNA 1WNLA 4M77A 4XU1A 4C8QC 4XU0A 2VXFA 4X9CA 1LNXA 4M78B 4XTVA 4EMKC 4F7UE 3L1AA 3FJPA 4C92D 2DZ9A 5GANd 5GAN3 1N9RA 1WQ7A 4M77D 4MMKA 5GAOq 2VC8A 4J6YA 3QUIA 2ZGWA 3RIRA 5GMKm 3JB9H 4J5YA 4M78A 5GAOl 4C92F 3HSBA 4HA8A 1I81A 4M77F 1BIAA 3JB9D 3BFMA 5DY9A 4M7AD 2RB6A 4PNOA 5GAOr 3V8JA 4PJOD 2FYKA 3RESA 4M7DB 5GAMj 5GAMe 2DXTA 4M7AE 4RCCA 4Y91A 3QHSA 5GANh 1KQ1A 4M78F 5LJ5j 3VU3C 3JB9G 2K57A 4M7AG 4MMLA 5LJ5e 1I4K1 4JUVA 4PJOG 3JCMd 4M7DA 4N0AC 1B34A 1N9SA 4M75B 2YLCA 5GAMg 5LJ3h 3GIBA 4RCBA 3FB9A 4XTZA 4DQ2A 5LJ5g 5GAN2 3SWNC 2DXUA 4M75A 3EFSA 2YLBA 5GAOn 2HNIA 3JCMV 1MGQA 5GAN4 3HFOA 4M7DF 1WPYA 3RUXA 3JCMh 1Y96B 5GMKh 2FB7A 4F7UG 2DVEA 4J6WA 1U1SA 3L2ZA 4M75D 5GAN7 4HT9A 4M7AC 4PJOC 1LJOA 4PJOE 1HK9A 2DTIA 2RA2A 2E64A 4C92E 3QO3A 5LJ3d 2DEQA 4M75F 4M77E 5GAN8 3SB2A 1Y96A 5GANf 4C92G 4C8QB 4M77G 4NL2A
chains in the Genus database with same CATH superfamily
1R0BG 3MCAB 4BE1A 3EFOA 3V8LA 1FXXA 3BW1A 1HSQA 2YUOA 2YWWA 2L3SA 2X3XD 4XU3A 1G3YA 4IUPA 1OPLA 4M77C 4C8QF 3BDLA 4PLLA 3CCJA 1AEYA 1RUWA 3VJPA 1Z9ZA 1JB0E 2HKNA 1PKSA 4M4ZA 1Q82C 2K7AA 1K0SA 4IUTA 1O75A 3EG1A 1WHGA 1D3BA 1WIEA 2XMFA 3FLGA 3CCVQ 2HL3A 3JCMJ 1ARKA 4PJOA 1NG2A 5LJ5d 1M3CA 1XNIA 4QVCA 3CC4T 4FIBA 2HAXA 1PC0A 3G71A 3WVDB 5C6SA 3FIFA 1K73U 3P8BB 1UJYA 4Q5WA 5DM7R 3V7RA 4A53A 3SWNB 4M77B 3QDRB 3JB9J 3QYGB 2DPPB 1N8RR 1WHMA 2DBMA 3RR6A 2O9VA 2HEQA 1PSFA 3TSZA 3X25B 2LDMA 5KCOA 3FJPA 4FSSA 4J6YA 1EX4A 3UF4A 4HA8A 3I56A 3G6EA 1YITA 1T3SA 4RTYA 3RESA 2LJ3A 3CC2Q 5KYYA 1WXTA 5GANh 5CVIA 3H0FA 2PZ1A 3C12A 1X6BA 4M7DA 1XOVA 5FU6B 1T0JA 1SEMA 4FYXB 2COYA 2HNIA 3TCJA 5GAN4 2QQRA 4F7UG 3M55A 4XK8E 4A4FA 1PG5B 3UDCA 1VUBA 5CK9A 2E64A 2KY9A 4PKCC 1Y96A 2GTOA 5ECAA 4NS5A 3RDVA 4UC4A 1DJ7B 2KYBA 2QI2A 1D0ZA 4OP0A 3AHUA 5LJ3f 1M9SA 4J6XA 4CC2A 4N4GA 3QZ5B 2RHYA 4EMKA 2AKKA 4ATOA 4ELYC 2L3PA 4AMCA 1G3WA 3LWIA 1VQLA 2H8HA 2OTLQ 4OMNA 4RTWA 3VS3A 1UEBA 2EQIA 1VQ9T 2HD0A 2A0FB 4EDUA 1LOJA 2NUTA 2E12A 2D1XA 4FT4A 2HBWA 1Q86C 1S72Q 1M1KU 4BI4A 4XU2A 1C6VX 1TTHB 1IHWA 1D1BA 1VQ7Q 3KBGA 4ZGJB 2R58A 1W1FA 2DXBA 4C5GA 1HD3A 4KT0E 1JRIA 1VQMA 3NTHA 1XJWB 9ATCB 1QQJA 1KK7A 1GCPA 2BIVA 3HFNA 3V7CA 2DERA 3A8OB 1WJSA 2F2XA 3RNJA 1VQ5T 3M56A 5HK3A 4BY6C 2JM8A 2DIQA 3QUIA 3JB9H 2HL5C 2WSEE 4BUGA 4M7AD 3V8JA 3WXMB 1ZSZC 2QQ9A 1M90U 1Q81R 1NPRA 3E1SA 3QPHA 3OA6A 5KH6A 2P84A 4RTUA 2HQHA 1M4ZA 2LC4A 5I2SA 2QEXA 2QTVA 4D8DA 1YJNQ 3C4SA 2EQKA 3FRNA 1H92A 2KAFA 4QVZA 4Y92A 4Y28E 1W2BS 1B34B 1M27C 2K3BA 1K8AC 4BY6B 4F04B 3JB9I 2CZ1B 3CCQT 4LDUA 3FC3A 3CXCA 4A54A 3CC7Q 2LX7A 1TU0B 4WF2A 3VS6A 2QGFB 1X01A 1EFNA 2EYWA 2FO0A 2XI9A 2E6ZA 2ZCFB 4F7UB 1GCQC 3V7SA 1Y7XA 3JCMX 4OMFB 4KH1B 2EKOA 1BI2A 3A8LB 5CKHA 2DD5A 3OQ5A 1UE9A 2EJ9A 2K9GA 1CSKA 1WGSA 3EH1A 2VXEA 4C0ZA 2FRWA 3UPUA 2K5IA 4HT8A 2P0QA 3ZBDA 2J7IA 1X2QA 5IHIA 4Z88A 1XQHA 2DM1A 2MWOA 4J9HA 3GP8A 3OYNA 1NYFA 5GAMf 3CCMQ 2MAMA 1X2KA 2EAYA 4J9GA 5CIUA 1YHQT 3FEOA 1RAHB 3JCMQ 5LJ5h 2DL3A 3M59A 1KFZA 1QKWA 2V8IA 4JLGA 1GL5A 1AWXA 4JJNK 3JSCA 2YRCA 3MO8A 5GMKm 4J5YA 2MOXA 2QGGA 4M77F 2M0OA 4OMMA 2F69A 2VGMA 4KUIA 4PJOE 4N4IA 4PJOG 3E19A 3CCUT 3M57A 1YJ9A 4DEYA 4QQ6A 3EFSA 3HPWA 5FLXE 3L2UA 3X28B 4KBMB 3RUXA 1KD1R 2FL7A 4FW1A 1SRMA 2DIGA 2C0OA 3EGDB 1KC8C 4M78D 4J9BA 3JV3A 1ABQA 5GAOm 3UA7A 3PMIA 1PKTA 1ZBXA 4XTUA 4JJCA 5IN1A 1FMKA 1H3ZA 2NUPB 4M7DE 1M8VA 1OV3A 3A8MB 2BKDN 4M7DG 2NWMA 2V8KA 5KYUA 1TG0A 3H6ZA 1NLPC 2EJFA 2PTKA 1K4US 1RADB 1ZX6A 2FHDA 1D1AA 2IIMA 2ROTA 1Q7YU 5HKCA 1SHFA 3OS2A 1VQPQ 5GMKl 2JTFA 5AYFA 1R8OB 4IUUA 5CKDA 5LJ3e 1VQKA 1FX7A 2OTJA 1D09B 1RAFB 1RAGB 3G4SA 1TSFA 2EJGA 4KGZB 5GMKe 1VQNQ 1PD0A 3R6OA 4B9WA 4B6MA 5DLQE 1YIJA 3RMQA 4HCBA 4KULA 4XTWA 1QWEA 2FPDA 3GF5A 4LNPA 4QKUA 5CKEA 5FWCA 3CMEQ 2EGEA 3CCET 3QJYA 5GJVB 3A5ZB 2FVUA 2LCCA 1M1FA 1SPKA 1N9RA 2CKKA 5GAOl 1B3QA 3H8ZA 3Q1JA 4LN2A 4DA4A 3BFMA 3OYMA 1YJWQ 4F17A 1U5SA 1M2VB 4Y91A 2E70A 1NJIR 1OU8A 2LJ0A 1B34A 1WFWA 2HCKA 2BZXA 3PVLA 4BDYA 2Y4YA 2EQUA 3HRUA 2X4JA 2DXUA 3NHNA 4M75A 3J81E 2K6DA 2X4WA 3VUBA 4HXJA 2FB7A 3CEYA 4M7AC 2DL7A 1FWZA 3GNGA 1R77A 1Q82U 5IH2A 2ABLA 3EFRA 2KNBB 2O01E 4B9XA 2P4TA 5KYWA 3JCMf 5KYNA 1SKUB 2M1HA 5EG2A 1AD5A 3X26B 3OS1A 2DYBA 3OMGA 3FJ5A 4F14A 3JCMW 1IZ6A 1QP2A 1X6OA 3VKIA 2JUFA 4C5EA 2EKHA 1VQ4T 1VQ6T 3CCRT 4M7AB 2COWA 1QVFA 1G5VA 4F7UF 4IURA 2KXDA 2QA4T 2GQIA 2KR3A 1K9MC 5FROA 2J6OA 3QZ9B 1ZLMA 1TS9A 1X27A 2I2LA 4J9DA 1TUCA 1H641 3LLRA 1WHKA 2X4YA 2Y90A 3MP1A 5A2QE 2EWNA 3SEMA 1H3HA 1I07A 1ZUUA 2OAUA 3RERA 2DX1A 4C92A 3CCLT 2D0QB 1WDXA 3I55T 2O9SA 1RLQC 3HKSA 2ZGWA 4E7IA 2A08A 1I81A 1X6GA 1VQOT 2RO0A 3CCJQ 5CQXA 2D6FA 5GAMe 2L3QA 4JJBA 3EGDA 3MEWA 5L8RE 2BE9B 5FRMA 2A28A 3LGLA 3M4YA 3M0UA 1OX8A 3I9QA 3QYHB 2HBPA 2K3YA 1YWOA 2KK4A 3CMAA 1JJ2S 4HVVA 4M75D 2ED1A 2YUPA 3QO3A 2P4RA 1W70A 2EFIA 3G71Q 2QQAA 2QQSA 4BI8B 1Q86U 3EGUA 2JMCA 4GLMA 2R57A 2JM9A 2VWFA 1W2BP 4C8QA 4F16A 5IXFA 3QKJA 2RPNA 1KD1C 3OYLA 3E9FA 3PIOA 4JZ4A 3UT1A 4C0FA 4QVDA 3OBWA 2BUDA 1X69A 2E10A 3MP8A 2DZCA 2M9UA 2E1HA 3MHXA 4M78C 3JCMg 3M4GA 1ACMB 1YCSB 3I56Q 4OMPA 2IG0A 1YITQ 2GQVA 4A4HA 3L2WA 2OI3A 4A63B 1K73R 3EG9A 3CD6T 1JBMA 1NEGA 4E7JA 2L8DA 4TVRA 2XICA 2PUOB 1AVZC 4X9DA 4HKEA 1WJQA 2KRNA 4ZGEB 1OQKA 1IHVA 4JJDA 2RI5A 2CT4A 4NOYA 2KT1A 1W4SA 3M0QA 4X34A 1AZEA 1YI2T 1WNLA 4XU1A 2LX9A 4M78B 4XTVA 3LGFA 1VIEA 2FRYA 4C92D 4R56A 1QVPA 2DFUA 3HSBA 3ZEHA 4JRQA 1VQLQ 6AT1B 2FYKA 3S6WA 1VQ8A 1BB9A 1KJWA 2EGAA 2I0NA 2L3RA 3QHSA 4YTLA 3VYGA 3JB9G 4CC4B 4JUVA 2KGTA 3LH0A 3ER0A 4AFSC 4OB1B 2D0NA 3HHTB 2D9TA 4XAXB 1E6HA 1QCNA 2HKQB 1VOMA 2CS7A 4LDVA 1NJIC 1HK9A 3H9NA 4BD3A 4OB0B 3L2VA 3VS0A 3OMCA 3CCVT 1KHIA 3WVEB 4DBRA 4EMHA 4E7HA 1BU1A 1OX9A 4V2SA 3ZL7C 1I0CA 3G1JA 4IIMA 2RQUA 4C8QD 2LCLA 2DD4A 3EAEA 3A8GB 3OW2S 2E5QA 4NL3A 3GLXA 4AFQC 1M1KR 1UHCA 3CC4A 1JQQA 2FPFA 4M75E 4FT2A 4M75G 4L6V5 2CP2A 5FW9A 1I5LA 3L2QA 1D0XA 5KE2A 5LJ3j 1BI0A 4BB7A 3CC2T 4R55A 3EG0A 3SD4A 3RBBB 4FCYA 3REAB 3MJXA 5GMKj 3JCMe 2QEXQ 4J9FA 2PU9B 3X20B 5LJ5f 3DB3A 4CI0C 3S3OA 4M7AF 3UATA 2W10A 1UG1A 3N5BB 1U06A 2L2PA 3LW5E 1M90R 3VYHB 5A0LA 2VC8A 2JS2A 3ZFJA 2DMOA 5J26A 1KC8U 2RQRA 1QKXA 2XD0A 5GAOr 4PJOD 1PNJA 1M3AA 3QG1A 4KRTA 4ESRA 4N0AC 1YN8A 2L89A 2OTLT 3FB9A 4XTZA 4AFZC 1KQSS 1MGQA 4LDWA 5A0DA 2EIFA 1YFNA 3QJ6A 4C92E 3VS1A 1ZSGA 4QT7A 1S72T 1QVGS 4C92G 3PIPA 5J3BA 1RAAB 4RTVA 4C0GA 2LZ6B 4OMQA 1VQ7T 5I21A 1VQ9A 2KVQG 1WJRA 1VIFA 1M5Q1 3VV0A 4M7DD 1B07A 2E4HA 3EGXB 4E7SA 4OF1A 3TVTA 1M2OA 3BY7A 3PGGA 2EGCA 5CAIA 3NTIA 1WA7A 1EZZB 1G83A 1K1ZA 2CT3A 4RG8A 2YDLA 4ZNXA 4Z02A 1UFFA 2FPEA 2VB6A 3DB4A 1QCFA 4DBFA 3RMSA 3OYBA 2OTLA 4R0KA 1N5ZA 1YJ9Q 3JCMb 1WHLA 1WLPB 3M5AA 2GF7A 1ZSZB 5LJ3g 4FSXA 1VQ5A 4HCCA 3CPWS 4C8QE 2L0AA 3QXEB 2VUBA 4C8QG 1I5OB 2RI2A 5IT9E 3EHQA 1K73C 1AWWA 2EW3A 1WZOA 2XK0A 4WTOB 5I22A 1YJNT 4LE9A 2WACA 3SWNA 4M77A 2AIRB 2CH4A 2P0PA 2DZ9A 5GAOq 3OS5A 4LXCA 1IO6A 3OYIA 2K3XA 5HCKA 2ECZA 3AT1B 4A4KA 5GAMj 3CC7T 2SEMA 2YUQA 2XDBA 4M78F 4ZGDB 4L59A 1UB4A 2YLCA 2DRMA 5LJ3h 3CCSQ 3GIBA 4RCBA 3CCQA 2CUBA 4AG2C 3QBYA 3UWNA 3FDRA 1WPYA 4LD6A 5GMKh 1TOVA 2KROA 1VQKQ 2OTJQ 3L2ZA 2IPOB 2QDYB 2DEQA 1JJ2P 3ME9A 3NPFA 4LUDA 4J7IA 2FG0A 1N8RC 3C95A 2B8AA 2FZCB 3MPUB 3M53A 1UDLA 1BCMA 2YXYA 2RQWA 2M02A 4FL6A 1YIJQ 4RMOA 1SRLA 2XDPA 3CCMT 1ZUKA 1ZUYA 1K9MU 3GOXA 2DL8A 2RH2A 3LX7A 2KBTA 1Q7YR 3OS0A 2CYZB 1B7TA 3CCST 1IRXA 4PJJA 1X43A 4ZN1A 2J6FA 2VYTA 1MMNA 5IXBA 1MHNA 1YHQA 1SF9A 2YHTA 4JLIA 1FYNA 1BYMA 2GTJA 2PVOB 1AOJA 1M1KC 3T9NA 5CKFA 1UGQB 5FU7C 2KT8A 1CKAA 2MF2A 3MEAA 4PJLA 5DLOA 1W2BA 3QDFA 2DETA 2O31A 4FW2A 2LTOA 5LL6S 5C0MA 4MDWA 2VXFA 2RHIA 1F1BB 5KYXB 2ED0A 3CCUA 1IGQA 1KSWA 1WQ7A 4M77D 2NLUA 1QWFA 2VGNA 4DBHA 3M0TA 3PNWC 5D7UA 2RB6A 4PNOA 4RKUE 4KGVB 1C1AA 4JRPA 4IKFA 3OSVA 3OYHA 5LJ5e 3JCMd 5GAMg 2X4XA 1Q82R 1NZ9A 1XTDA 4AT1B 4JZ3A 3VS5A 4OMOA 3OY9A 3A98A 3P8DA 2J6KA 4J6WA 4PJOC 1VQPT 3EFOB 1OZ3A 2QK0A 1T3LA 2C0TA 2K2MA 2GNCA 2KE9A 4OB2B 2K2VA 4ZN3A 1JEGA 2DILA 1VQNT 3DLMA 1NM7A 4GLKA 4MDXA 2RN8A 4O6JA 1MUZA 2EYXA 2EYYA 2KMTA 2XU8A 2BE7D 1Q81C 2QYZA 3CMET 4QQDA 4EMGA 3QSUA 3OW2P 1AWJA 4F7UA 4E7KA 1D3BB 3TREA 3GBQA 4OVAA 1I1JA 3HL8A 1NPPA 2BZYA 4CRIA 1OEBA 4ME7A 4JS4A 4PJOB 4M7DC 2E65A 1YJWT 4C5HA 1QP3A 3CCEA 1SG5A 2HSEB 4ZTFA 3NGPA 4DOVA 1NE8A 2GGRA 4GBQA 3CMAQ 1GXIE 1NLOC 5CCAA 2O4XB 2RJFA 1M3BA 1TXQA 1Z9QA 2YUNA 3VUZA 2FZKB 2RI3A 5CQYA 1UGSB 2MWPA 1LNXA 4EMKC 3L1AA 1GCQA 5KYYB 1GBRA 4OB3B 3M58A 3JB9D 2AHJB 1A0NB 4N4HA 2RK1A 4M7DB 1LVKA 2RQVA 4MZTA 4MMLA 2P0KA 2CP7A 3GPLA 2RMOA 4Z8AA 1KIKA 4PK4A 4DOWA 1R0CB 1Q86R 4FYVB 2AK5A 2CDTA 1Y96B 2D8HA 1KQSP 1U1SA 3MP6A 5A0GA 1RLPC 2KDSA 1VA7A 2CSIA 1BI1A 2A3LA 4M77E 3JAME 4FU6A 5GANf 2MMPA 4M77G 4PLIA 4CC7A 2LJ1A 2ZPFB 1QVGP 3META 5EC7A 4BE2A 1M8MA 1WQWA 2CZ0B 1VQ4A 2BTTA 1VQ6A 1I8FA 3VS7A 1MMGA 2PVGB 3CCRA 4PJMA 4VUBA 2IVWA 1V1CA 2RM4A 3CBPA 3OYDA 2DO3A 2RHZA 2QA4A 1GBQA 2EYQA 2NUPA 2HZYA 5D6XA 2LQWA 2DBKA 1W6XA 4FM4B 1VQ8Q 4C0DC 3M9QA 3OYAA 4WCIA 5KE3A 3EG2A 4RTZA 5IAYA 2VASA 4MZMA 1PRMC 2D8JA 2O2OA 2JJ9A 2LQNA 3OYEA 3CCJT 1BIBA 1E6GA 3CCLA 3V8KA 2V1QA 3VRZA 3I55A 4JRIA 1PM3A 2EBPA 4IUQA 2XKOC 3CPWP 1U8RA 1MV0B 4RUGA 2RJDA 1VYVA 1VQOA 3G6EQ 3JCMc 3JCMP 3A8HB 2BZ8A 1KQ2A 1QW1A 1HXDA 1UHFA 5IHNA 2E3IA 1NEBA 4LDXA 2K79A 3E9GA 2C0IA 1BKBA 2EYZA 3L42A 1AHJB 1OZ2A 5GAN3 3G71T 2FZGB 3SHWA 1LCKA 3TSWA 1FMVA 4C0DB 1WXBA 1S1NA 2HQEA 2ZPHB 2VV5A 3X24B 4IIOA 1KQ1A 3CC4Q 2LRQA 2V26A 1M2VA 2QDLA 4DQ2A 5GAN2 1ABOA 4PL6A 3SWNC 3JCMV 3I56T 2R5MA 3G6ET 1YITT 4PFPA 3JCMh 3PFSA 2RJEA 3OYJA 4O5VA 5I11A 1LJOA 3PMTA 5LJ3d 1RI9A 3F70A 2MYSA 1K8AU 2PQWA 1PD1A 1AZGB 4NL2A 3MEUA 2DNUA 2DTHA 4XTXA 2RHUA 1IREB 3OYCA 2OAWA 5GANg 3VS4A 2VKNA 3CD6A 2XHCA 2QTXA 5FU6C 5KCHA 2DAQA 4Z89A 2QG9B 3H0HA 5FWBA 2CGHA 1VYTA 4XTYA 4K11A 1VQMQ 4E47A 2O4XA 2H3JA 2YRVA 5AT1B 2DKGA 2CSQA 1VQLT 3MEVA 2Y4XA 1TH7A 1YI2A 4M7AA 4HVWA 2H3EB 2WSFE 1JJ2A 1RABB 2M16A 1P92A 1HYOA 1AT1B 2OX7A 2Z0WA 3D7SB 4PJOF 2DL4A 2YSQA 3ASKA 5L23A 1KC8R 4LD9K 2QASA 3CXCS 3HP9A 3NFCA 3H0IA 4DBQA 2EPDA 4XU0A 2KYMA 1VQ9Q 4F7UE 3E2UA 1QVFP 4MMKA 1VQMT 3OBYA 3U23A 1YBYA 3HRSA 1N8RU 2DXCA 1BIAA 3CQTA 2VVKA 4ELZC 3OYKA 2DJQA 5CKBA 4RCCA 5GJWB 4JDSA 5LJ5j 3QIIA 5D6YA 3CCVA 1JO8A 2B86A 2HDAA 2LQ8A 2DA9A 5I2MA 2XIDA 4M7DF 2CUDA 1HJDA 2ESWA 3C0CA 3ULRB 3JRZA 1IXDA 2RA2A 2DTIA 5GAN8 3TQ7P 1VQ5Q 3DLLA 2RK2A 1YP5A 2KRSA 2RJCA 1OOTA 3KXTA 4A4GA 4E2FB 5IHKA 1K0XA 3OYGA 3BE3A 3EHRA 2NYSA 2QEXT 1BK2A 1MMDA 4OMLA 3O8VA 2C06A 1OU9A 5KYUB 3CC2A 5GAN5 1WI7A 2MI6A 4II1A 2HMAA 2XDDA 1OYXA 1PSEA 2KRMA 5GANe 5D6WA 3M0PA 2PUKB 4GY5A 1T0HA 5GAMd 3RKYA 3THKA 2GFUA 2EQMA 4M75C 3CCQQ 2YT6A 3RKWA 2GCXA 3RKXA 2JVVA 1OI1A 2F2VA 3OB9A 4XQ3A 2RF0A 3C94A 3LWHA 4IUVA 4J83A 2JZ2A 3I5SA 1AWOA 2FEIA 4RTXA 4X9CA 2ENMA 2MPXC 1G3SA 1FMWA 2LP5A 1MV3A 2AT1B 3CPFA 4M78A 2KXCA 4QQGA 3OW2A 1UGPB 4ANJA 1N27A 5DY9A 4J8OA 2DRKA 3M54A 2LCSA 3PVQA 3OYFA 1S72A 2JTEA 4PJNA 4M75B 2NUZA 2OJ2A 1U3OA 2DF6A 1VQ7A 5LJ5g 2DYIA 4OGEA 1YHQQ 3J7AF 1LPLA 1WYXA 1Q81U 5GAN7 1G8XA 2E3HA 1ZA2B 1K9MR 2CP3A 2KSSA 1V29B 5CO7A 1JXOA 5KYWB 1YJ9T 4BACA 1K9AA 3INZA 4E7LA 2RHXA 5HK0A 4C92C 2PVDB 1JXMA 2JW4A 3URGA 1PHTA 1YCYA 3CCUQ 2KQWA 2RQTA 2WSCE 1N6AA 2EQJA 2G3RA 3G4SQ 4ZTJA 1RL2A 1QCOA 1BBZA 2EVRA 1KQSA 3I5RA 2J06A 1YJNA 4BI3A 1U1TA 2LVMA 4D8KA 2CP6A 2YRDA 2CZ6B 2CREA 1M1GA 1JU5C 2J05A 1UGRB 2JN0A 1QVGA 2E41A 4RTTA 1PCXA 1C0MA 4C92B 1X75C 1MNDA 1PWTA 1SSHA 2ZZDA 2COZA 3CC7A 1VQKT 2V1RA 2OTJT 2RNAA 1QLYA 1O9SA 2LNHB 4C8QC 3G4ST 3UA6A 2GFAA 3PT9A 1WHJA 4PFOA 1J3TA 4ORZA 2LT4A 3S3NA 3RIRA 3L2RA 1YIJT 2A37A 5J39A 2A7YA 2JT4A 4LDYA 4M7AE 4M7AG 1I4K1 1N9SA 2X51A 3PTAA 3M0RA 4HVUA 1QVFS 1H8KA 1G2BA 2K5LA 1V76A 5GAOn 3CCMA 2CH4W 3CPWA 3OSSC 1CKBA 1G3TA 3CCEQ 1Y57A 5CR2A 8ATCB 4C8QB 2DJZA 2PNIA 2JMAA 3REBB 1ZQ1A 2HQXA 3CCSA 2W0ZA 4EPCA 4FYWB 1KD1U 2DEUA 2JOYA 1M90C 1UUEA 5FU7B 3S3MA 2MCNA 1MMAA 3KUFA 1GFCA 2ROLA 3LH5A 2E6NA 1D0YA 3MKDA 1D1CA 3EGXA 4J9IA 2CZ7B 2LMJA 3EG9B 4PFZA 4N0AA 2ATCB 2GBQA 4KGXB 1TWBA 4JS5A 2M51A 2CP5A 4JPBW 2KI7A 3EG3A 4JRKA 1SHGA 4QW2A 4MZPA 4KH0B 2F5KA 3VS2A 1TUDA 2XG8D 2L5QA 2QAZA 3HTRA 1Y07A 2O88A 1QMCA 1BCOA 2MIOA 5M9OA 1ZSZA 3JB9F 1UGVA 2F2WA 3P8HA 5GAMh 1GFDA 5FRNA 3I35A 7AT1B 2JTMA 3TU4K 2KEAA 1Q95G 2DL5A 2LQKA 1WHHA 1UECA 2ZPEB 2R5AA 2AZVA 3QWYA 3VRYA 2DLPA 3CXCP 4D6WA 5GANd 1VQ4Q 4KUDK 1VQ6Q 3CCRQ 1E7OA 2HSPA 1NYGA 2DE0X 4J9EA 3M0SA 2K5FA 4X1VA 4BE0A 4BDZA 3NTKA 2QA4Q 1VQPA 1KHCA 2DXTA 2LT1A 3OYYA 8AT1B 2K57A 3R6NA 2DK3A 1YWPA 2AKLA 1KG1A 2ZPBB 1RAEB 1ZBJA 1Y0MA 3HFOA 1VQNA 4AG1C 1NJIU 2DVEA 2A36A 3NMZC 1ZHIA 3CCLQ 4M75F 1PRLC 3I55Q 1IB8A 2MK5A 3CBMA 1WXUA 4E7ZA 3CMEA 4J7FA 1TUGB 4M78E 3BDUA 1VQOQ 4M78G 3HRTA 3CMAT 3O5ZA 2F5TX 1UJ0A 2JNGA 1OPKA 3SFMA 1K76A 2X35A 1YJWA 3G7ZA 4C5IA 4E6RA 1RACB 3CBOA 1BI3A 2DTOA 2AZSA 4EMKB 5GANj 2ZPIB 1IGUA 2K4YA 4LUEA 3GNFB 1ZA1B 3LYIA 2SRCA 3KFVA 5GAOp 4CC3A 1EIFA 4OGCA 4FYYB 3SDZA 5GAN6 3H41A 4L5GA 5GMKi 4DEXA 2RD1A 2M0YA 3TEEA 2NUTB 4P5NA 3A1PA 2DVJA 2X3WD 1UTIA 1M30A 1Q7YC 2JXBA 4A4EA 1RI0A 1VYUA 1WX6A 1RAIB 1Y71A 2F1LA 4RG2A 1SSFA 4HCZA 2ZPGB 1NBEB 3DKMA 2CP0A 4C92F 5KYXA 3CD6Q 1OULA 3IQLA 2JS0A 2E5KA 1GRIA 2QQBA 3VU3C 2ZAEA 4AFUC 3PE0A 3QWXX 1K8AR 2QXFA 1MNEA 3EH2A 2G6FX 3J80E 2YLBA 4EIKA 4HCKA 1VQ8T 2V8JA 4HT9A 2LNVA 1YI2Q 2X9HA 3SB2A 4J9CA 1YNZA 5HY6A
chains in the Genus database with same CATH topology
2B8AA 3MCAB 4BE1A 3M53A 3DLLA 3V8LA 2RK2A 3EFRA 1FXXA 3BW1A 2RJCA 2O01E 4B9XA 2P4TA 3KXTA 4A4GA 4FL6A 4RMOA 3OYGA 2XDPA 2QEXT 3CCMT 4XU3A 1G3YA 1K9MU 4IUPA 3GOXA 3JCMf 2RH2A 3O8VA 2C06A 3LX7A 4M77C 2M1HA 4C8QF 3BDLA 5EG2A 3OS0A 2CYZB 4PLLA 3X26B 3OS1A 3CCJA 3CC2A 5GAN5 3OMGA 3CCST 3VJPA 2MI6A 1JB0E 3JCMW 1IZ6A 4II1A 1QP2A 1X6OA 2XDDA 1OYXA 1PSEA 3VKIA 4ZN1A 2JUFA 4C5EA 1Q82C 2VYTA 5C6SA 1MHNA 4IUTA 5GANe 1VQ4T 1O75A 5D6WA 1VQ6T 1YHQA 2YHTA 3CCRT 1D3BA 4M7AB 4JLIA 2PUKB 1QVFA 1G5VA 4F7UF 3FLGA 4GY5A 1BYMA 2PVOB 5GAMd 3RKYA 1M1KC 4IURA 3T9NA 5CKFA 3JCMJ 2QA4T 2GFUA 2EQMA 4PJOA 1K9MC 1UGQB 5LJ5d 5FROA 1XNIA 4M75C 5FU7C 4QVCA 3QZ9B 4FIBA 3CC4T 2I2LA 2MF2A 3MEAA 2HAXA 3G71A 1H641 2GCXA 3FIFA 3LLRA 3P8BB 3RKXA 2Y90A 2X4YA 3MP1A 4Q5WA 5DM7R 2JVVA 3V7RA 5DLOA 5A2QE 1OI1A 2EWNA 1W2BA 3OB9A 4A53A 4XQ3A 3C94A 3LWHA 3SWNB 4M77B 3QDRB 3JB9J 4IUVA 4J83A 2JZ2A 3QYGB 2DPPB 2OAUA 3RERA 2LTOA 5LL6S 4C92A 5C0MA 3CCLT 4MDWA 2VXFA 4X9CA 2D0QB 2RHIA 1PSFA 3X25B 3CCUA 2LDMA 3I55T 5KCOA 3FJPA 1WQ7A 1G3SA 2NLUA 4M77D 3HKSA 4J6YA 2ZGWA 3CPFA 4E7IA 2VGNA 4M78A 4QQGA 3OW2A 1UGPB 1I81A 4HA8A 3I56A 1VQOT 3G6EA 3PNWC 1N27A 5DY9A 1YITA 2RB6A 4PNOA 2RO0A 3M54A 4J8OA 5CQXA 3RESA 4RKUE 2D6FA 5GAMe 4JRPA 4IKFA 3OSVA 5GANh 3OYFA 5CVIA 3OYHA 3C12A 3WVDB 5LJ5e 3MEWA 3JCMd 1S72A 4M7DA 4M75B 1XOVA 5GAMg 5FU6B 5L8RE 2X4XA 5FRMA 3LGLA 3M4YA 1NZ9A 1XTDA 3QYHB 1VQ7A 5LJ5g 2HBPA 2K3YA 2KK4A 4OGEA 3J7AF 2HNIA 3TCJA 5GAN4 1Q81U 3OY9A 3CMAA 2QQRA 4F7UG 1JJ2S 3M55A 3P8DA 4J6WA 4M75D 4XK8E 4A4FA 5GAN7 4PJOC 3UDCA 1VQPT 1VUBA 5CK9A 2E64A 2KY9A 3QO3A 4PKCC 1OZ3A 1Y96A 4NS5A 2KSSA 4UC4A 2EFIA 1V29B 5CO7A 1DJ7B 2QQAA 2QQSA 2QI2A 4OP0A 4BI8B 1Q86U 1YJ9T 4OB2B 5LJ3f 3AHUA 2R57A 1M9SA 4J6XA 4C8QA 2K2VA 4BACA 4ZN3A 4N4GA 3QZ5B 3QKJA 2RHYA 4EMKA 1KD1C 1VQNT 3INZA 4E7LA 3DLMA 2RHXA 4ATOA 4GLKA 4MDXA 4O6JA 3OYLA 5HK0A 3E9FA 3PIOA 4C92C 2PVDB 3UT1A 4C0FA 4QVDA 3OBWA 4ELYC 2BUDA 3LWIA 1G3WA 2KMTA 3URGA 1VQLA 2XU8A 1YCYA 2E10A 3MP8A 2KQWA 2DZCA 2M9UA 2WSCE 1Q81C 1N6AA 2EQJA 2G3RA 2E1HA 3MHXA 4M78C 4QQDA 4EMGA 3CMET 1UEBA 3JCMg 4ZTJA 3M4GA 1RL2A 3QSUA 2IG0A 4F7UA 1D3BB 4E7KA 1VQ9T 2GQVA 3TREA 2HD0A 4A4HA 3L2WA 4OVAA 3HL8A 4EDUA 1LOJA 1NPPA 2E12A 4FT4A 1K73U 1Q86C 4CRIA 4JS4A 4ME7A 4PJOB 3CD6T 4M7DC 1M1KU 1JBMA 4BI4A 2E65A 1KQSA 4XU2A 4E7JA 1YJWT 2L8DA 4C5HA 1YJNA 1QP3A 3CCEA 3KBGA 4ZGJB 4TVRA 1U1TA 2LVMA 4BI3A 4ZTFA 2XICA 2PUOB 2R58A 2CZ6B 4DOVA 2DXBA 4X9DA 1NE8A 4C5GA 1M1GA 4KT0E 1JRIA 1UGRB 2JN0A 1VQMA 1QVGA 3NTHA 4HKEA 1WJQA 1GXIE 2E41A 5CCAA 2O4XB 2RJFA 4C92B 4ZGEB 2BIVA 1X75C 2RI5A 4NOYA 2ZZDA 3HFNA 3CC7A 1VQKT 3VUZA 4X34A 1W4SA 2OTJT 1YI2T 3V7CA 2RI3A 3A8OB 1WJSA 1UGSB 5CQYA 3G4ST 1O9SA 1WNLA 4XU1A 2LX9A 4C8QC 2GFAA 2MWPA 1VQ5T 1LNXA 3M56A 4M78B 5HK3A 3PT9A 4XTVA 4EMKC 3LGFA 4BY6C 3L1AA 1VIEA 2LT4A 4C92D 4R56A 2DIQA 3S3NA 3RIRA 3QUIA 3JB9H 1QVPA 3HSBA 2WSEE 3ZEHA 3L2RA 4OB3B 3M58A 3JB9D 2AHJB 4BUGA 4JRQA 1YIJT 4M7AD 3V8JA 4N4HA 2FYKA 3S6WA 2RK1A 5J39A 1VQ8A 4M7DB 3WXMB 2QQ9A 2A7YA 1M90U 4LDYA 4M7AE 1NPRA 3QHSA 2L3RA 4YTLA 4MZTA 3VYGA 3JB9G 4M7AG 4MMLA 1I4K1 4JUVA 2P0KA 3LH0A 1N9SA 3E1SA 3ER0A 3PTAA 3QPHA 3OA6A 5KH6A 3GPLA 4OB1B 1QVFS 1M4ZA 2LC4A 3HHTB 4DOWA 2K5LA 2D9TA 5GAOn 4XAXB 5I2SA 2QEXA 3CCMA 1Y96B 3CPWA 3OSSC 1G3TA 1U1SA 2CS7A 3C4SA 3MP6A 5A0GA 4LDVA 2KDSA 2EQKA 3FRNA 1HK9A 2KAFA 4QVZA 4BD3A 5CR2A 1BI1A 1NJIC 2A3LA 4M77E 4OB0B 3JAME 3L2VA 4FU6A 4Y28E 2MMPA 5GANf 4C8QB 1W2BS 4M77G 2DJZA 3OMCA 4PLIA 1KHIA 3CCVT 1B34B 3WVEB 1ZQ1A 2HQXA 2ZPFB 3CCSA 1K8AC 4EMHA 4E7HA 4BY6B 3JB9I 4EPCA 3META 1KD1U 2CZ1B 2JOYA 4LDUA 3FC3A 3CCQT 4BE2A 1WQWA 1M90C 4V2SA 3CXCA 5FU7B 3S3MA 2CZ0B 4A54A 1VQ4A 4C8QD 4WF2A 1VQ6A 2LCLA 1I8FA 2PVGB 2DD4A 3KUFA 3EAEA 3CCRA 4VUBA 1X01A 2IVWA 2E6NA 3RKWA 2RM4A 2XI9A 3CBPA 2E6ZA 2ZCFB 3OYDA 2DO3A 4F7UB 3V7SA 2RHZA 1Y7XA 3A8GB 2E5QA 4NL3A 3GLXA 3JCMX 2QA4A 2EYQA 3OW2S 4OMFB 3CC4A 4M75E 2EKOA 1BI2A 3A8LB 5CKHA 2DD5A 2CZ7B 3OQ5A 4FT2A 2EJ9A 4N0AA 5D6XA 4L6V5 1WGSA 4M75G 2VXEA 4FM4B 4C0DC 3M9QA 4C0ZA 3UPUA 3OYAA 4JS5A 5KE3A 1I5LA 5IAYA 3L2QA 2K5IA 4HT8A 2P0QA 5KE2A 4JRKA 4MZMA 3ZBDA 4QW2A 5LJ3j 1BI0A 3OYEA 4MZPA 3CCJT 4BB7A 3CC2T 1BIBA 4R55A 1XQHA 3SD4A 2MWOA 2F5KA 3CCLA 3V8KA 2XG8D 2L5QA 5GMKj 3OYNA 3GP8A 3JCMe 5GAMf 1Y07A 3I55A 4JRIA 2MAMA 4IUQA 2PU9B 2EAYA 2XKOC 3X20B 3DB3A 3P8HA 4CI0C 5M9OA 5LJ5f 3S3OA 5GAMh 1U8RA 3JB9F 4M7AF 5CIUA 2RJDA 1YHQT 3FEOA 5FRNA 1VQOA 3JCMQ 3JCMc 5LJ5h 3JCMP 3A8HB 1KQ2A 1QW1A 2JTMA 3M59A 3TU4K 1HXDA 2V8IA 4JLGA 3N5BB 4LDXA 2LQKA 3E9GA 4JJNK 3JSCA 2ZPEB 2R5AA 3LW5E 1BKBA 3G71T 3L42A 1AHJB 1OZ2A 3VYHB 4D6WA 5GANd 5GAN3 3MO8A 5A0LA 4KUDK 2VC8A 3ZFJA 5GMKm 4J5YA 4C0DB 5J26A 1KC8U 4M77F 2XD0A 2M0OA 5GAOr 4PJOD 2K5FA 2HQEA 3QG1A 2F69A 4BE0A 4BDZA 3NTKA 2VGMA 2ZPHB 4KUIA 1KHCA 2DXTA 2VV5A 2LT1A 3X24B 3OYYA 1VQPA 1KQ1A 4PJOE 2K57A 4N4IA 4PJOG 2LRQA 4N0AC 2DK3A 3E19A 3CCUT 2L89A 3M57A 2OTLT 1YJ9A 3FB9A 4XTZA 4DQ2A 5GAN2 1KG1A 2ZPBB 4PL6A 3SWNC 4QQ6A 1KQSS 3EFSA 3HPWA 5FLXE 3L2UA 3JCMV 1MGQA 4LDWA 2R5MA 3HFOA 3X28B 5A0DA 4KBMB 3I56T 3RUXA 3G6ET 1YITT 3JCMh 1VQNA 1NJIU 2DVEA 2EIFA 2RJEA 2FL7A 3PFSA 3OYJA 3QJ6A 4O5VA 1LJOA 2DIGA 1ZHIA 3PMTA 4C92E 5LJ3d 4M75F 1S72T 1QVGS 3F70A 4C92G 3PIPA 2PQWA 5HY6A 5J3BA 1KC8C 4NL2A 1K8AU 2OTJA 4M78D 3MEUA 2DTHA 4XTXA 4C0GA 2RHUA 1IREB 3CBMA 3CMEA 4J7FA 5GAOm 3OYCA 1VQ7T 4M78E 3BDUA 5I21A 3PMIA 4M78G 1VQ9A 1ZBXA 2KVQG 1WJRA 4XTUA 3HRTA 5GANg 5IN1A 3CMAT 1VIFA 1M5Q1 2F5TX 3VV0A 4M7DD 1H3ZA 2JNGA 3CD6A 2XHCA 3SFMA 2QTXA 5FU6C 4OF1A 2X35A 5KCHA 2DAQA 1YJWA 4M7DE 1M8VA 3G7ZA 4C5IA 3BY7A 3A8MB 2BKDN 3PGGA 4M7DG 2V8KA 5CAIA 2CGHA 3NTIA 3H6ZA 4XTYA 3CBOA 2EJFA 1BI3A 2DTOA 2FHDA 1Q7YU 5HKCA 4EMKB 5GANj 2ZPIB 2K4YA 4E47A 3GNFB 4RG8A 3OS2A 2O4XA 5GMKl 2H3JA 2YRVA 3LYIA 2JTFA 5AYFA 1R8OB 4Z02A 2DKGA 4IUUA 5CKDA 5LJ3e 1VQLT 3DB4A 1VQKA 1FX7A 3MEVA 2Y4XA 5GAOp 3OYBA 1EIFA 3RMSA 1TH7A 4OGCA 3SDZA 1YI2A 2OTLA 4M7AA 3JCMb 5GAN6 2WSFE 3M5AA 2GF7A 5LJ3g 3G4SA 1JJ2A 4FSXA 1VQ5A 4HCCA 3CPWS 2EJGA 4C8QE 3QXEB 5GMKe 4L5GA 2VUBA 4C8QG 5GMKi 2M16A 2RI2A 3R6OA 1P92A 5IT9E 2RD1A 1K73C 3TEEA 4PJOF 4B9WA 5DLQE 4P5NA 1YIJA 2XK0A 3RMQA 4HCBA 4KULA 3ASKA 1YJNT 4XTWA 2WACA 1Q7YC 3GF5A 5CKEA 3CCET 3CXCS 4LD9K 4A4EA 3HP9A 1RI0A 3NFCA 3SWNA 3QJYA 4M77A 4XU0A 1Y71A 3A5ZB 2FVUA 2LCCA 4F7UE 2P0PA 1M1FA 2DZ9A 4RG2A 1N9RA 1SSFA 4HCZA 4MMKA 5GAOq 2ZPGB 3OBYA 3OS5A 3DKMA 2CKKA 1VQMT 3OYIA 5GAOl 1YBYA 3HRSA 4C92F 2DXCA 2K3XA 3H8ZA 3Q1JA 1N8RU 1BIAA 4DA4A 3BFMA 3OYMA 4ELZC 3OYKA 4A4KA 5GAMj 3CC7T 5CKBA 2QQBA 4RCCA 4Y91A 2XDBA 4JDSA 4M78F 3VU3C 5LJ5j 2E70A 4ZGDB 3QIIA 4L59A 5D6YA 1UB4A 1B34A 3CCVA 2YLCA 4BDYA 5LJ3h 2Y4YA 3GIBA 2EQUA 4RCBA 2LQ8A 3HRUA 2QXFA 3CCQA 2X4JA 2DXUA 4M75A 3QBYA 3J80E 2YLBA 3J81E 3UWNA 2X4WA 3FDRA 5I2MA 3VUBA 2XIDA 4M7DF 1WPYA 4LD6A 5GMKh 2FB7A 1VQ8T 2V8JA 3CEYA 3L2ZA 4HT9A 2LNVA 1FWZA 4M7AC 3JRZA 3GNGA 2RA2A 2DTIA 2QDYB 5GAN8 2DEQA 3ME9A 1Q82U 3SB2A 1N8RC 4J7IA 3C95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJZ A;  4M78 D;  2DTH A;  1B34 B;  4XTX A;  4OP0 A;  3V8L A;  4EMH A;  3EFR A;  3BW1 A;  5LJ3 f;  5GAO m;  3AHU A;  3JB9 I;  4J6X A;  4M78 E;  4C8Q A;  3BDU A;  5I21 A;  4V2S A;  1WQW A;  4M78 G;  4EMK A;  4XU3 A;  3INZ A;  4XTU A;  4A54 A;  5GAN g;  4C8Q D;  1M5Q 1;  4WF2 A;  3JCM f;  4M7D D;  1I8F A;  4C92 C;  4M77 C;  1X01 A;  4C8Q F;  4QVD A;  2QTX A;  2RM4 A;  4M7D E;  1M8V A;  1YCY A;  2E10 A;  2DZC A;  4F7U B;  3BY7 A;  3PGG A;  3V7S A;  5GAN 5;  4M7D G;  4NL3 A;  3JCM X;  5CAI A;  2CGH A;  2E1H A;  4M78 C;  4EMG A;  4XTY A;  3JCM W;  2EJF A;  3JCM g;  3M4G A;  4M75 E;  3QSU A;  2DTO A;  4F7U A;  1D3B B;  2EJ9 A;  4N0A A;  4M75 G;  2VXE A;  4EMK B;  5GAN j;  1LOJ A;  5GAN e;  1I5L A;  2YHT A;  5GMK l;  4HT8 A;  1D3B A;  4M7A B;  4JLI A;  4JRK A;  4PJO B;  5LJ3 j;  2DKG A;  4M7D C;  5LJ3 e;  1JBM A;  4F7U F;  2E65 A;  4XU2 A;  5GAM d;  1BIB A;  3RKY A;  5GAO p;  1TH7 A;  3JCM J;  4M7A A;  4PJO A;  3JCM b;  5GAN 6;  5LJ5 d;  1U1T A;  4M75 C;  4QVC A;  5LJ3 g;  3V8K A;  2EJG A;  4C8Q E;  5GMK j;  2I2L A;  3JCM e;  5GAM f;  5GMK e;  4X9D A;  4C8Q G;  1H64 1;  4JRI A;  3FIF A;  3RKX A;  3RKW A;  5GMK i;  2Y90 A;  1JRI A;  2JN0 A;  2EAY A;  3V7R A;  5LJ5 f;  3JB9 F;  2EWN A;  2RD1 A;  4A53 A;  5GAM h;  2E41 A;  4PJO F;  4M7A F;  4XQ3 A;  3JCM Q;  4C92 B;  3SWN B;  3JCM c;  5LJ5 h;  4M77 B;  3JCM P;  3JB9 J;  1KQ2 A;  4NOY A;  3HFN A;  1HXD A;  4XTW A;  3RER A;  3V7C A;  4C92 A;  3SWN A;  1WNL A;  4M77 A;  4XU1 A;  4C8Q C;  4XU0 A;  2VXF A;  4X9C A;  1LNX A;  4M78 B;  4XTV A;  4EMK C;  4F7U E;  3L1A A;  3FJP A;  4C92 D;  2DZ9 A;  5GAN d;  5GAN 3;  1N9R A;  1WQ7 A;  4M77 D;  4MMK A;  5GAO q;  2VC8 A;  4J6Y A;  3QUI A;  2ZGW A;  3RIR A;  5GMK m;  3JB9 H;  4J5Y A;  4M78 A;  5GAO l;  4C92 F;  3HSB A;  4HA8 A;  1I81 A;  4M77 F;  1BIA A;  3JB9 D;  3BFM A;  5DY9 A;  4M7A D;  2RB6 A;  4PNO A;  5GAO r;  3V8J A;  4PJO D;  2FYK A;  3RES A;  4M7D B;  5GAM j;  5GAM e;  2DXT A;  4M7A E;  4RCC A;  4Y91 A;  3QHS A;  5GAN h;  1KQ1 A;  4M78 F;  5LJ5 j;  3VU3 C;  3JB9 G;  2K57 A;  4M7A G;  4MML A;  5LJ5 e;  1I4K 1;  4JUV A;  4PJO G;  3JCM d;  4M7D A;  4N0A C;  1B34 A;  1N9S A;  4M75 B;  2YLC A;  5GAM g;  5LJ3 h;  3GIB A;  4RCB A;  3FB9 A;  4XTZ A;  4DQ2 A;  5LJ5 g;  5GAN 2;  3SWN C;  2DXU A;  4M75 A;  3EFS A;  2YLB A;  5GAO n;  2HNI A;  3JCM V;  1MGQ A;  5GAN 4;  3HFO A;  4M7D F;  1WPY A;  3RUX A;  3JCM h;  1Y96 B;  5GMK h;  2FB7 A;  4F7U G;  2DVE A;  4J6W A;  1U1S A;  3L2Z A;  4M75 D;  5GAN 7;  4HT9 A;  4M7A C;  4PJO C;  1LJO A;  4PJO E;  1HK9 A;  2DTI A;  2RA2 A;  2E64 A;  4C92 E;  3QO3 A;  5LJ3 d;  2DEQ A;  4M75 F;  4M77 E;  5GAN 8;  3SB2 A;  1Y96 A;  5GAN f;  4C92 G;  4C8Q B;  4M77 G;  4NL2 A; 
#chains in the Genus database with same CATH topology
 1R0B G;  3MCA B;  4BE1 A;  3EFO A;  3V8L A;  1FXX A;  3BW1 A;  1HSQ A;  2YUO A;  2YWW A;  2L3S A;  2X3X D;  4XU3 A;  1G3Y A;  4IUP A;  1OPL A;  4M77 C;  4C8Q F;  3BDL A;  4PLL A;  3CCJ A;  1AEY A;  1RUW A;  3VJP A;  1Z9Z A;  1JB0 E;  2HKN A;  1PKS A;  4M4Z A;  1Q82 C;  2K7A A;  1K0S A;  4IUT A;  1O75 A;  3EG1 A;  1WHG A;  1D3B A;  1WIE A;  2XMF A;  3FLG A;  3CCV Q;  2HL3 A;  3JCM J;  1ARK A;  4PJO A;  1NG2 A;  5LJ5 d;  1M3C A;  1XNI A;  4QVC A;  3CC4 T;  4FIB A;  2HAX A;  1PC0 A;  3G71 A;  3WVD B;  5C6S A;  3FIF A;  1K73 U;  3P8B B;  1UJY A;  4Q5W A;  5DM7 R;  3V7R A;  4A53 A;  3SWN B;  4M77 B;  3QDR B;  3JB9 J;  3QYG B;  2DPP B;  1N8R R;  1WHM A;  2DBM A;  3RR6 A;  2O9V A;  2HEQ A;  1PSF A;  3TSZ A;  3X25 B;  2LDM A;  5KCO A;  3FJP A;  4FSS A;  4J6Y A;  1EX4 A;  3UF4 A;  4HA8 A;  3I56 A;  3G6E A;  1YIT A;  1T3S A;  4RTY A;  3RES A;  2LJ3 A;  3CC2 Q;  5KYY A;  1WXT A;  5GAN h;  5CVI A;  3H0F A;  2PZ1 A;  3C12 A;  1X6B A;  4M7D A;  1XOV A;  5FU6 B;  1T0J A;  1SEM A;  4FYX B;  2COY A;  2HNI A;  3TCJ A;  5GAN 4;  2QQR A;  4F7U G;  3M55 A;  4XK8 E;  4A4F A;  1PG5 B;  3UDC A;  1VUB A;  5CK9 A;  2E64 A;  2KY9 A;  4PKC C;  1Y96 A;  2GTO A;  5ECA A;  4NS5 A;  3RDV A;  4UC4 A;  1DJ7 B;  2KYB A;  2QI2 A;  1D0Z A;  4OP0 A;  3AHU A;  5LJ3 f;  1M9S A;  4J6X A;  4CC2 A;  4N4G A;  3QZ5 B;  2RHY A;  4EMK A;  2AKK A;  4ATO A;  4ELY C;  2L3P A;  4AMC A;  1G3W A;  3LWI A;  1VQL A;  2H8H A;  2OTL Q;  4OMN A;  4RTW A;  3VS3 A;  1UEB A;  2EQI A;  1VQ9 T;  2HD0 A;  2A0F B;  4EDU A;  1LOJ A;  2NUT A;  2E12 A;  2D1X A;  4FT4 A;  2HBW A;  1Q86 C;  1S72 Q;  1M1K U;  4BI4 A;  4XU2 A;  1C6V X;  1TTH B;  1IHW A;  1D1B A;  1VQ7 Q;  3KBG A;  4ZGJ B;  2R58 A;  1W1F A;  2DXB A;  4C5G A;  1HD3 A;  4KT0 E;  1JRI A;  1VQM A;  3NTH A;  1XJW B;  9ATC B;  1QQJ A;  1KK7 A;  1GCP A;  2BIV A;  3HFN A;  3V7C A;  2DER A;  3A8O B;  1WJS A;  2F2X A;  3RNJ A;  1VQ5 T;  3M56 A;  5HK3 A;  4BY6 C;  2JM8 A;  2DIQ A;  3QUI A;  3JB9 H;  2HL5 C;  2WSE E;  4BUG A;  4M7A D;  3V8J A;  3WXM B;  1ZSZ C;  2QQ9 A;  1M90 U;  1Q81 R;  1NPR A;  3E1S A;  3QPH A;  3OA6 A;  5KH6 A;  2P84 A;  4RTU A;  2HQH A;  1M4Z A;  2LC4 A;  5I2S A;  2QEX A;  2QTV A;  4D8D A;  1YJN Q;  3C4S A;  2EQK A;  3FRN A;  1H92 A;  2KAF A;  4QVZ A;  4Y92 A;  4Y28 E;  1W2B S;  1B34 B;  1M27 C;  2K3B A;  1K8A C;  4BY6 B;  4F04 B;  3JB9 I;  2CZ1 B;  3CCQ T;  4LDU A;  3FC3 A;  3CXC A;  4A54 A;  3CC7 Q;  2LX7 A;  1TU0 B;  4WF2 A;  3VS6 A;  2QGF B;  1X01 A;  1EFN A;  2EYW A;  2FO0 A;  2XI9 A;  2E6Z A;  2ZCF B;  4F7U B;  1GCQ C;  3V7S A;  1Y7X A;  3JCM X;  4OMF B;  4KH1 B;  2EKO A;  1BI2 A;  3A8L B;  5CKH A;  2DD5 A;  3OQ5 A;  1UE9 A;  2EJ9 A;  2K9G A;  1CSK A;  1WGS A;  3EH1 A;  2VXE A;  4C0Z A;  2FRW A;  3UPU A;  2K5I A;  4HT8 A;  2P0Q A;  3ZBD A;  2J7I A;  1X2Q A;  5IHI A;  4Z88 A;  1XQH A;  2DM1 A;  2MWO A;  4J9H A;  3GP8 A;  3OYN A;  1NYF A;  5GAM f;  3CCM Q;  2MAM A;  1X2K A;  2EAY A;  4J9G A;  5CIU A;  1YHQ T;  3FEO A;  1RAH B;  3JCM Q;  5LJ5 h;  2DL3 A;  3M59 A;  1KFZ A;  1QKW A;  2V8I A;  4JLG A;  1GL5 A;  1AWX A;  4JJN K;  3JSC A;  2YRC A;  3MO8 A;  5GMK m;  4J5Y A;  2MOX A;  2QGG A;  4M77 F;  2M0O A;  4OMM A;  2F69 A;  2VGM A;  4KUI A;  4PJO E;  4N4I A;  4PJO G;  3E19 A;  3CCU T;  3M57 A;  1YJ9 A;  4DEY A;  4QQ6 A;  3EFS A;  3HPW A;  5FLX E;  3L2U A;  3X28 B;  4KBM B;  3RUX A;  1KD1 R;  2FL7 A;  4FW1 A;  1SRM A;  2DIG A;  2C0O A;  3EGD B;  1KC8 C;  4M78 D;  4J9B A;  3JV3 A;  1ABQ A;  5GAO m;  3UA7 A;  3PMI A;  1PKT A;  1ZBX A;  4XTU A;  4JJC A;  5IN1 A;  1FMK A;  1H3Z A;  2NUP B;  4M7D E;  1M8V A;  1OV3 A;  3A8M B;  2BKD N;  4M7D G;  2NWM A;  2V8K A;  5KYU A;  1TG0 A;  3H6Z A;  1NLP C;  2EJF A;  2PTK A;  1K4U S;  1RAD B;  1ZX6 A;  2FHD A;  1D1A A;  2IIM A;  2ROT A;  1Q7Y U;  5HKC A;  1SHF A;  3OS2 A;  1VQP Q;  5GMK l;  2JTF A;  5AYF A;  1R8O B;  4IUU A;  5CKD A;  5LJ3 e;  1VQK A;  1FX7 A;  2OTJ A;  1D09 B;  1RAF B;  1RAG B;  3G4S A;  1TSF A;  2EJG A;  4KGZ B;  5GMK e;  1VQN Q;  1PD0 A;  3R6O A;  4B9W A;  4B6M A;  5DLQ E;  1YIJ A;  3RMQ A;  4HCB A;  4KUL A;  4XTW A;  1QWE A;  2FPD A;  3GF5 A;  4LNP A;  4QKU A;  5CKE A;  5FWC A;  3CME Q;  2EGE A;  3CCE T;  3QJY A;  5GJV B;  3A5Z B;  2FVU A;  2LCC A;  1M1F A;  1SPK A;  1N9R A;  2CKK A;  5GAO l;  1B3Q A;  3H8Z A;  3Q1J A;  4LN2 A;  4DA4 A;  3BFM A;  3OYM A;  1YJW Q;  4F17 A;  1U5S A;  1M2V B;  4Y91 A;  2E70 A;  1NJI R;  1OU8 A;  2LJ0 A;  1B34 A;  1WFW A;  2HCK A;  2BZX A;  3PVL A;  4BDY A;  2Y4Y A;  2EQU A;  3HRU A;  2X4J A;  2DXU A;  3NHN A;  4M75 A;  3J81 E;  2K6D A;  2X4W A;  3VUB A;  4HXJ A;  2FB7 A;  3CEY A;  4M7A C;  2DL7 A;  1FWZ A;  3GNG A;  1R77 A;  1Q82 U;  5IH2 A;  2ABL A;  3EFR A;  2KNB B;  2O01 E;  4B9X A;  2P4T A;  5KYW A;  3JCM f;  5KYN A;  1SKU B;  2M1H A;  5EG2 A;  1AD5 A;  3X26 B;  3OS1 A;  2DYB A;  3OMG A;  3FJ5 A;  4F14 A;  3JCM W;  1IZ6 A;  1QP2 A;  1X6O A;  3VKI A;  2JUF A;  4C5E A;  2EKH A;  1VQ4 T;  1VQ6 T;  3CCR T;  4M7A B;  2COW A;  1QVF A;  1G5V A;  4F7U F;  4IUR A;  2KXD A;  2QA4 T;  2GQI A;  2KR3 A;  1K9M C;  5FRO A;  2J6O A;  3QZ9 B;  1ZLM A;  1TS9 A;  1X27 A;  2I2L A;  4J9D A;  1TUC A;  1H64 1;  3LLR A;  1WHK A;  2X4Y A;  2Y90 A;  3MP1 A;  5A2Q E;  2EWN A;  3SEM A;  1H3H A;  1I07 A;  1ZUU A;  2OAU A;  3RER A;  2DX1 A;  4C92 A;  3CCL T;  2D0Q B;  1WDX A;  3I55 T;  2O9S A;  1RLQ C;  3HKS A;  2ZGW A;  4E7I A;  2A08 A;  1I81 A;  1X6G A;  1VQO T;  2RO0 A;  3CCJ Q;  5CQX A;  2D6F A;  5GAM e;  2L3Q A;  4JJB A;  3EGD A;  3MEW A;  5L8R E;  2BE9 B;  5FRM A;  2A28 A;  3LGL A;  3M4Y A;  3M0U A;  1OX8 A;  3I9Q A;  3QYH B;  2HBP A;  2K3Y A;  1YWO A;  2KK4 A;  3CMA A;  1JJ2 S;  4HVV A;  4M75 D;  2ED1 A;  2YUP A;  3QO3 A;  2P4R A;  1W70 A;  2EFI A;  3G71 Q;  2QQA A;  2QQS A;  4BI8 B;  1Q86 U;  3EGU A;  2JMC A;  4GLM A;  2R57 A;  2JM9 A;  2VWF A;  1W2B P;  4C8Q A;  4F16 A;  5IXF A;  3QKJ A;  2RPN A;  1KD1 C;  3OYL A;  3E9F A;  3PIO A;  4JZ4 A;  3UT1 A;  4C0F A;  4QVD A;  3OBW A;  2BUD A;  1X69 A;  2E10 A;  3MP8 A;  2DZC A;  2M9U A;  2E1H A;  3MHX A;  4M78 C;  3JCM g;  3M4G A;  1ACM B;  1YCS B;  3I56 Q;  4OMP A;  2IG0 A;  1YIT Q;  2GQV A;  4A4H A;  3L2W A;  2OI3 A;  4A63 B;  1K73 R;  3EG9 A;  3CD6 T;  1JBM A;  1NEG A;  4E7J A;  2L8D A;  4TVR A;  2XIC A;  2PUO B;  1AVZ C;  4X9D A;  4HKE A;  1WJQ A;  2KRN A;  4ZGE B;  1OQK A;  1IHV A;  4JJD A;  2RI5 A;  2CT4 A;  4NOY A;  2KT1 A;  1W4S A;  3M0Q A;  4X34 A;  1AZE A;  1YI2 T;  1WNL A;  4XU1 A;  2LX9 A;  4M78 B;  4XTV A;  3LGF A;  1VIE A;  2FRY A;  4C92 D;  4R56 A;  1QVP A;  2DFU A;  3HSB A;  3ZEH A;  4JRQ A;  1VQL Q;  6AT1 B;  2FYK A;  3S6W A;  1VQ8 A;  1BB9 A;  1KJW A;  2EGA A;  2I0N A;  2L3R A;  3QHS A;  4YTL A;  3VYG A;  3JB9 G;  4CC4 B;  4JUV A;  2KGT A;  3LH0 A;  3ER0 A;  4AFS C;  4OB1 B;  2D0N A;  3HHT B;  2D9T A;  4XAX B;  1E6H A;  1QCN A;  2HKQ B;  1VOM A;  2CS7 A;  4LDV A;  1NJI C;  1HK9 A;  3H9N A;  4BD3 A;  4OB0 B;  3L2V A;  3VS0 A;  3OMC A;  3CCV T;  1KHI A;  3WVE B;  4DBR A;  4EMH A;  4E7H A;  1BU1 A;  1OX9 A;  4V2S A;  3ZL7 C;  1I0C A;  3G1J A;  4IIM A;  2RQU A;  4C8Q D;  2LCL A;  2DD4 A;  3EAE A;  3A8G B;  3OW2 S;  2E5Q A;  4NL3 A;  3GLX A;  4AFQ C;  1M1K R;  1UHC A;  3CC4 A;  1JQQ A;  2FPF A;  4M75 E;  4FT2 A;  4M75 G;  4L6V 5;  2CP2 A;  5FW9 A;  1I5L A;  3L2Q A;  1D0X A;  5KE2 A;  5LJ3 j;  1BI0 A;  4BB7 A;  3CC2 T;  4R55 A;  3EG0 A;  3SD4 A;  3RBB B;  4FCY A;  3REA B;  3MJX A;  5GMK j;  3JCM e;  2QEX Q;  4J9F A;  2PU9 B;  3X20 B;  5LJ5 f;  3DB3 A;  4CI0 C;  3S3O A;  4M7A F;  3UAT A;  2W10 A;  1UG1 A;  3N5B B;  1U06 A;  2L2P A;  3LW5 E;  1M90 R;  3VYH B;  5A0L A;  2VC8 A;  2JS2 A;  3ZFJ A;  2DMO A;  5J26 A;  1KC8 U;  2RQR A;  1QKX A;  2XD0 A;  5GAO r;  4PJO D;  1PNJ A;  1M3A A;  3QG1 A;  4KRT A;  4ESR A;  4N0A C;  1YN8 A;  2L89 A;  2OTL T;  3FB9 A;  4XTZ A;  4AFZ C;  1KQS S;  1MGQ A;  4LDW A;  5A0D A;  2EIF A;  1YFN A;  3QJ6 A;  4C92 E;  3VS1 A;  1ZSG A;  4QT7 A;  1S72 T;  1QVG S;  4C92 G;  3PIP A;  5J3B A;  1RAA B;  4RTV A;  4C0G A;  2LZ6 B;  4OMQ A;  1VQ7 T;  5I21 A;  1VQ9 A;  2KVQ G;  1WJR A;  1VIF A;  1M5Q 1;  3VV0 A;  4M7D D;  1B07 A;  2E4H A;  3EGX B;  4E7S A;  4OF1 A;  3TVT A;  1M2O A;  3BY7 A;  3PGG A;  2EGC A;  5CAI A;  3NTI A;  1WA7 A;  1EZZ B;  1G83 A;  1K1Z A;  2CT3 A;  4RG8 A;  2YDL A;  4ZNX A;  4Z02 A;  1UFF A;  2FPE A;  2VB6 A;  3DB4 A;  1QCF A;  4DBF A;  3RMS A;  3OYB A;  2OTL A;  4R0K A;  1N5Z A;  1YJ9 Q;  3JCM b;  1WHL A;  1WLP B;  3M5A A;  2GF7 A;  1ZSZ B;  5LJ3 g;  4FSX A;  1VQ5 A;  4HCC A;  3CPW S;  4C8Q E;  2L0A A;  3QXE B;  2VUB A;  4C8Q G;  1I5O B;  2RI2 A;  5IT9 E;  3EHQ A;  1K73 C;  1AWW A;  2EW3 A;  1WZO A;  2XK0 A;  4WTO B;  5I22 A;  1YJN T;  4LE9 A;  2WAC A;  3SWN A;  4M77 A;  2AIR B;  2CH4 A;  2P0P A;  2DZ9 A;  5GAO q;  3OS5 A;  4LXC A;  1IO6 A;  3OYI A;  2K3X A;  5HCK A;  2ECZ A;  3AT1 B;  4A4K A;  5GAM j;  3CC7 T;  2SEM A;  2YUQ A;  2XDB A;  4M78 F;  4ZGD B;  4L59 A;  1UB4 A;  2YLC A;  2DRM A;  5LJ3 h;  3CCS Q;  3GIB A;  4RCB A;  3CCQ A;  2CUB A;  4AG2 C;  3QBY A;  3UWN A;  3FDR A;  1WPY A;  4LD6 A;  5GMK h;  1TOV A;  2KRO A;  1VQK Q;  2OTJ Q;  3L2Z A;  2IPO B;  2QDY B;  2DEQ A;  1JJ2 P;  3ME9 A;  3NPF A;  4LUD A;  4J7I A;  2FG0 A;  1N8R C;  3C95 A;  2B8A A;  2FZC B;  3MPU B;  3M53 A;  1UDL A;  1BCM A;  2YXY A;  2RQW A;  2M02 A;  4FL6 A;  1YIJ Q;  4RMO A;  1SRL A;  2XDP A;  3CCM T;  1ZUK A;  1ZUY A;  1K9M U;  3GOX A;  2DL8 A;  2RH2 A;  3LX7 A;  2KBT A;  1Q7Y R;  3OS0 A;  2CYZ B;  1B7T A;  3CCS T;  1IRX A;  4PJJ A;  1X43 A;  4ZN1 A;  2J6F A;  2VYT A;  1MMN A;  5IXB A;  1MHN A;  1YHQ A;  1SF9 A;  2YHT A;  4JLI A;  1FYN A;  1BYM A;  2GTJ A;  2PVO B;  1AOJ A;  1M1K C;  3T9N A;  5CKF A;  1UGQ B;  5FU7 C;  2KT8 A;  1CKA A;  2MF2 A;  3MEA A;  4PJL A;  5DLO A;  1W2B A;  3QDF A;  2DET A;  2O31 A;  4FW2 A;  2LTO A;  5LL6 S;  5C0M A;  4MDW A;  2VXF A;  2RHI A;  1F1B B;  5KYX B;  2ED0 A;  3CCU A;  1IGQ A;  1KSW A;  1WQ7 A;  4M77 D;  2NLU A;  1QWF A;  2VGN A;  4DBH A;  3M0T A;  3PNW C;  5D7U A;  2RB6 A;  4PNO A;  4RKU E;  4KGV B;  1C1A A;  4JRP A;  4IKF A;  3OSV A;  3OYH A;  5LJ5 e;  3JCM d;  5GAM g;  2X4X A;  1Q82 R;  1NZ9 A;  1XTD A;  4AT1 B;  4JZ3 A;  3VS5 A;  4OMO A;  3OY9 A;  3A98 A;  3P8D A;  2J6K A;  4J6W A;  4PJO C;  1VQP T;  3EFO B;  1OZ3 A;  2QK0 A;  1T3L A;  2C0T A;  2K2M A;  2GNC A;  2KE9 A;  4OB2 B;  2K2V A;  4ZN3 A;  1JEG A;  2DIL A;  1VQN T;  3DLM A;  1NM7 A;  4GLK A;  4MDX A;  2RN8 A;  4O6J A;  1MUZ A;  2EYX A;  2EYY A;  2KMT A;  2XU8 A;  2BE7 D;  1Q81 C;  2QYZ A;  3CME T;  4QQD A;  4EMG A;  3QSU A;  3OW2 P;  1AWJ A;  4F7U A;  4E7K A;  1D3B B;  3TRE A;  3GBQ A;  4OVA A;  1I1J A;  3HL8 A;  1NPP A;  2BZY A;  4CRI A;  1OEB A;  4ME7 A;  4JS4 A;  4PJO B;  4M7D C;  2E65 A;  1YJW T;  4C5H A;  1QP3 A;  3CCE A;  1SG5 A;  2HSE B;  4ZTF A;  3NGP A;  4DOV A;  1NE8 A;  2GGR A;  4GBQ A;  3CMA Q;  1GXI E;  1NLO C;  5CCA A;  2O4X B;  2RJF A;  1M3B A;  1TXQ A;  1Z9Q A;  2YUN A;  3VUZ A;  2FZK B;  2RI3 A;  5CQY A;  1UGS B;  2MWP A;  1LNX A;  4EMK C;  3L1A A;  1GCQ A;  5KYY B;  1GBR A;  4OB3 B;  3M58 A;  3JB9 D;  2AHJ B;  1A0N B;  4N4H A;  2RK1 A;  4M7D B;  1LVK A;  2RQV A;  4MZT A;  4MML A;  2P0K A;  2CP7 A;  3GPL A;  2RMO A;  4Z8A A;  1KIK A;  4PK4 A;  4DOW A;  1R0C B;  1Q86 R;  4FYV B;  2AK5 A;  2CDT A;  1Y96 B;  2D8H A;  1KQS P;  1U1S A;  3MP6 A;  5A0G A;  1RLP C;  2KDS A;  1VA7 A;  2CSI A;  1BI1 A;  2A3L A;  4M77 E;  3JAM E;  4FU6 A;  5GAN f;  2MMP A;  4M77 G;  4PLI A;  4CC7 A;  2LJ1 A;  2ZPF B;  1QVG P;  3MET A;  5EC7 A;  4BE2 A;  1M8M A;  1WQW A;  2CZ0 B;  1VQ4 A;  2BTT A;  1VQ6 A;  1I8F A;  3VS7 A;  1MMG A;  2PVG B;  3CCR A;  4PJM A;  4VUB A;  2IVW A;  1V1C A;  2RM4 A;  3CBP A;  3OYD A;  2DO3 A;  2RHZ A;  2QA4 A;  1GBQ A;  2EYQ A;  2NUP A;  2HZY A;  5D6X A;  2LQW A;  2DBK A;  1W6X A;  4FM4 B;  1VQ8 Q;  4C0D C;  3M9Q A;  3OYA A;  4WCI A;  5KE3 A;  3EG2 A;  4RTZ A;  5IAY A;  2VAS A;  4MZM A;  1PRM C;  2D8J A;  2O2O A;  2JJ9 A;  2LQN A;  3OYE A;  3CCJ T;  1BIB A;  1E6G A;  3CCL A;  3V8K A;  2V1Q A;  3VRZ A;  3I55 A;  4JRI A;  1PM3 A;  2EBP A;  4IUQ A;  2XKO C;  3CPW P;  1U8R A;  1MV0 B;  4RUG A;  2RJD A;  1VYV A;  1VQO A;  3G6E Q;  3JCM c;  3JCM P;  3A8H B;  2BZ8 A;  1KQ2 A;  1QW1 A;  1HXD A;  1UHF A;  5IHN A;  2E3I A;  1NEB A;  4LDX A;  2K79 A;  3E9G A;  2C0I A;  1BKB A;  2EYZ A;  3L42 A;  1AHJ B;  1OZ2 A;  5GAN 3;  3G71 T;  2FZG B;  3SHW A;  1LCK A;  3TSW A;  1FMV A;  4C0D B;  1WXB A;  1S1N A;  2HQE A;  2ZPH B;  2VV5 A;  3X24 B;  4IIO A;  1KQ1 A;  3CC4 Q;  2LRQ A;  2V26 A;  1M2V A;  2QDL A;  4DQ2 A;  5GAN 2;  1ABO A;  4PL6 A;  3SWN C;  3JCM V;  3I56 T;  2R5M A;  3G6E T;  1YIT T;  4PFP A;  3JCM h;  3PFS A;  2RJE A;  3OYJ A;  4O5V A;  5I11 A;  1LJO A;  3PMT A;  5LJ3 d;  1RI9 A;  3F70 A;  2MYS A;  1K8A U;  2PQW A;  1PD1 A;  1AZG B;  4NL2 A;  3MEU A;  2DNU A;  2DTH A;  4XTX A;  2RHU A;  1IRE B;  3OYC A;  2OAW A;  5GAN g;  3VS4 A;  2VKN A;  3CD6 A;  2XHC A;  2QTX A;  5FU6 C;  5KCH A;  2DAQ A;  4Z89 A;  2QG9 B;  3H0H A;  5FWB A;  2CGH A;  1VYT A;  4XTY A;  4K11 A;  1VQM Q;  4E47 A;  2O4X A;  2H3J A;  2YRV A;  5AT1 B;  2DKG A;  2CSQ A;  1VQL T;  3MEV A;  2Y4X A;  1TH7 A;  1YI2 A;  4M7A A;  4HVW A;  2H3E B;  2WSF E;  1JJ2 A;  1RAB B;  2M16 A;  1P92 A;  1HYO A;  1AT1 B;  2OX7 A;  2Z0W A;  3D7S B;  4PJO F;  2DL4 A;  2YSQ A;  3ASK A;  5L23 A;  1KC8 R;  4LD9 K;  2QAS A;  3CXC S;  3HP9 A;  3NFC A;  3H0I A;  4DBQ A;  2EPD A;  4XU0 A;  2KYM A;  1VQ9 Q;  4F7U E;  3E2U A;  1QVF P;  4MMK A;  1VQM T;  3OBY A;  3U23 A;  1YBY A;  3HRS A;  1N8R U;  2DXC A;  1BIA A;  3CQT A;  2VVK A;  4ELZ C;  3OYK A;  2DJQ A;  5CKB A;  4RCC A;  5GJW B;  4JDS A;  5LJ5 j;  3QII A;  5D6Y A;  3CCV A;  1JO8 A;  2B86 A;  2HDA A;  2LQ8 A;  2DA9 A;  5I2M A;  2XID A;  4M7D F;  2CUD A;  1HJD A;  2ESW A;  3C0C A;  3ULR B;  3JRZ A;  1IXD A;  2RA2 A;  2DTI A;  5GAN 8;  3TQ7 P;  1VQ5 Q;  3DLL A;  2RK2 A;  1YP5 A;  2KRS A;  2RJC A;  1OOT A;  3KXT A;  4A4G A;  4E2F B;  5IHK A;  1K0X A;  3OYG A;  3BE3 A;  3EHR A;  2NYS A;  2QEX T;  1BK2 A;  1MMD A;  4OML A;  3O8V A;  2C06 A;  1OU9 A;  5KYU B;  3CC2 A;  5GAN 5;  1WI7 A;  2MI6 A;  4II1 A;  2HMA A;  2XDD A;  1OYX A;  1PSE A;  2KRM A;  5GAN e;  5D6W A;  3M0P A;  2PUK B;  4GY5 A;  1T0H A;  5GAM d;  3RKY A;  3THK A;  2GFU A;  2EQM A;  4M75 C;  3CCQ Q;  2YT6 A;  3RKW A;  2GCX A;  3RKX A;  2JVV A;  1OI1 A;  2F2V A;  3OB9 A;  4XQ3 A;  2RF0 A;  3C94 A;  3LWH A;  4IUV A;  4J83 A;  2JZ2 A;  3I5S A;  1AWO A;  2FEI A;  4RTX A;  4X9C A;  2ENM A;  2MPX C;  1G3S A;  1FMW A;  2LP5 A;  1MV3 A;  2AT1 B;  3CPF A;  4M78 A;  2KXC A;  4QQG A;  3OW2 A;  1UGP B;  4ANJ A;  1N27 A;  5DY9 A;  4J8O A;  2DRK A;  3M54 A;  2LCS A;  3PVQ A;  3OYF A;  1S72 A;  2JTE A;  4PJN A;  4M75 B;  2NUZ A;  2OJ2 A;  1U3O A;  2DF6 A;  1VQ7 A;  5LJ5 g;  2DYI A;  4OGE A;  1YHQ Q;  3J7A F;  1LPL A;  1WYX A;  1Q81 U;  5GAN 7;  1G8X A;  2E3H A;  1ZA2 B;  1K9M R;  2CP3 A;  2KSS A;  1V29 B;  5CO7 A;  1JXO A;  5KYW B;  1YJ9 T;  4BAC A;  1K9A A;  3INZ A;  4E7L A;  2RHX A;  5HK0 A;  4C92 C;  2PVD B;  1JXM A;  2JW4 A;  3URG A;  1PHT A;  1YCY A;  3CCU Q;  2KQW A;  2RQT A;  2WSC E;  1N6A A;  2EQJ A;  2G3R A;  3G4S Q;  4ZTJ A;  1RL2 A;  1QCO A;  1BBZ A;  2EVR A;  1KQS A;  3I5R A;  2J06 A;  1YJN A;  4BI3 A;  1U1T A;  2LVM A;  4D8K A;  2CP6 A;  2YRD A;  2CZ6 B;  2CRE A;  1M1G A;  1JU5 C;  2J05 A;  1UGR B;  2JN0 A;  1QVG A;  2E41 A;  4RTT A;  1PCX A;  1C0M A;  4C92 B;  1X75 C;  1MND A;  1PWT A;  1SSH A;  2ZZD A;  2COZ A;  3CC7 A;  1VQK T;  2V1R A;  2OTJ T;  2RNA A;  1QLY A;  1O9S A;  2LNH B;  4C8Q C;  3G4S T;  3UA6 A;  2GFA A;  3PT9 A;  1WHJ A;  4PFO A;  1J3T A;  4ORZ A;  2LT4 A;  3S3N A;  3RIR A;  3L2R A;  1YIJ T;  2A37 A;  5J39 A;  2A7Y A;  2JT4 A;  4LDY A;  4M7A E;  4M7A G;  1I4K 1;  1N9S A;  2X51 A;  3PTA A;  3M0R A;  4HVU A;  1QVF S;  1H8K A;  1G2B A;  2K5L A;  1V76 A;  5GAO n;  3CCM A;  2CH4 W;  3CPW A;  3OSS C;  1CKB A;  1G3T A;  3CCE Q;  1Y57 A;  5CR2 A;  8ATC B;  4C8Q B;  2DJZ A;  2PNI A;  2JMA A;  3REB B;  1ZQ1 A;  2HQX A;  3CCS A;  2W0Z A;  4EPC A;  4FYW B;  1KD1 U;  2DEU A;  2JOY A;  1M90 C;  1UUE A;  5FU7 B;  3S3M A;  2MCN A;  1MMA A;  3KUF A;  1GFC A;  2ROL A;  3LH5 A;  2E6N A;  1D0Y A;  3MKD A;  1D1C A;  3EGX A;  4J9I A;  2CZ7 B;  2LMJ A;  3EG9 B;  4PFZ A;  4N0A A;  2ATC B;  2GBQ A;  4KGX B;  1TWB A;  4JS5 A;  2M51 A;  2CP5 A;  4JPB W;  2KI7 A;  3EG3 A;  4JRK A;  1SHG A;  4QW2 A;  4MZP A;  4KH0 B;  2F5K A;  3VS2 A;  1TUD A;  2XG8 D;  2L5Q A;  2QAZ A;  3HTR A;  1Y07 A;  2O88 A;  1QMC A;  1BCO A;  2MIO A;  5M9O A;  1ZSZ A;  3JB9 F;  1UGV A;  2F2W A;  3P8H A;  5GAM h;  1GFD A;  5FRN A;  3I35 A;  7AT1 B;  2JTM A;  3TU4 K;  2KEA A;  1Q95 G;  2DL5 A;  2LQK A;  1WHH A;  1UEC A;  2ZPE B;  2R5A A;  2AZV A;  3QWY A;  3VRY A;  2DLP A;  3CXC P;  4D6W A;  5GAN d;  1VQ4 Q;  4KUD K;  1VQ6 Q;  3CCR Q;  1E7O A;  2HSP A;  1NYG A;  2DE0 X;  4J9E A;  3M0S A;  2K5F A;  4X1V A;  4BE0 A;  4BDZ A;  3NTK A;  2QA4 Q;  1VQP A;  1KHC A;  2DXT A;  2LT1 A;  3OYY A;  8AT1 B;  2K57 A;  3R6N A;  2DK3 A;  1YWP A;  2AKL A;  1KG1 A;  2ZPB B;  1RAE B;  1ZBJ A;  1Y0M A;  3HFO A;  1VQN A;  4AG1 C;  1NJI U;  2DVE A;  2A36 A;  3NMZ C;  1ZHI A;  3CCL Q;  4M75 F;  1PRL C;  3I55 Q;  1IB8 A;  2MK5 A;  3CBM A;  1WXU A;  4E7Z A;  3CME A;  4J7F A;  1TUG B;  4M78 E;  3BDU A;  1VQO Q;  4M78 G;  3HRT A;  3CMA T;  3O5Z A;  2F5T X;  1UJ0 A;  2JNG A;  1OPK A;  3SFM A;  1K76 A;  2X35 A;  1YJW A;  3G7Z A;  4C5I A;  4E6R A;  1RAC B;  3CBO A;  1BI3 A;  2DTO A;  2AZS A;  4EMK B;  5GAN j;  2ZPI B;  1IGU A;  2K4Y A;  4LUE A;  3GNF B;  1ZA1 B;  3LYI A;  2SRC A;  3KFV A;  5GAO p;  4CC3 A;  1EIF A;  4OGC A;  4FYY B;  3SDZ A;  5GAN 6;  3H41 A;  4L5G A;  5GMK i;  4DEX A;  2RD1 A;  2M0Y A;  3TEE A;  2NUT B;  4P5N A;  3A1P A;  2DVJ A;  2X3W D;  1UTI A;  1M30 A;  1Q7Y C;  2JXB A;  4A4E A;  1RI0 A;  1VYU A;  1WX6 A;  1RAI B;  1Y71 A;  2F1L A;  4RG2 A;  1SSF A;  4HCZ A;  2ZPG B;  1NBE B;  3DKM A;  2CP0 A;  4C92 F;  5KYX A;  3CD6 Q;  1OUL A;  3IQL A;  2JS0 A;  2E5K A;  1GRI A;  2QQB A;  3VU3 C;  2ZAE A;  4AFU C;  3PE0 A;  3QWX X;  1K8A R;  2QXF A;  1MNE A;  3EH2 A;  2G6F X;  3J80 E;  2YLB A;  4EIK A;  4HCK A;  1VQ8 T;  2V8J A;  4HT9 A;  2LNV A;  1YI2 Q;  2X9H A;  3SB2 A;  4J9C A;  1YNZ A;  5HY6 A; 
#chains in the Genus database with same CATH homology
 2B8A A;  3MCA B;  4BE1 A;  3M53 A;  3DLL A;  3V8L A;  2RK2 A;  3EFR A;  1FXX A;  3BW1 A;  2RJC A;  2O01 E;  4B9X A;  2P4T A;  3KXT A;  4A4G A;  4FL6 A;  4RMO A;  3OYG A;  2XDP A;  2QEX T;  3CCM T;  4XU3 A;  1G3Y A;  1K9M U;  4IUP A;  3GOX A;  3JCM f;  2RH2 A;  3O8V A;  2C06 A;  3LX7 A;  4M77 C;  2M1H A;  4C8Q F;  3BDL A;  5EG2 A;  3OS0 A;  2CYZ B;  4PLL A;  3X26 B;  3OS1 A;  3CCJ A;  3CC2 A;  5GAN 5;  3OMG A;  3CCS T;  3VJP A;  2MI6 A;  1JB0 E;  3JCM W;  1IZ6 A;  4II1 A;  1QP2 A;  1X6O A;  2XDD A;  1OYX A;  1PSE A;  3VKI A;  4ZN1 A;  2JUF A;  4C5E A;  1Q82 C;  2VYT A;  5C6S A;  1MHN A;  4IUT A;  5GAN e;  1VQ4 T;  1O75 A;  5D6W A;  1VQ6 T;  1YHQ A;  2YHT A;  3CCR T;  1D3B A;  4M7A B;  4JLI A;  2PUK B;  1QVF A;  1G5V A;  4F7U F;  3FLG A;  4GY5 A;  1BYM A;  2PVO B;  5GAM d;  3RKY A;  1M1K C;  4IUR A;  3T9N A;  5CKF A;  3JCM J;  2QA4 T;  2GFU A;  2EQM A;  4PJO A;  1K9M C;  1UGQ B;  5LJ5 d;  5FRO A;  1XNI A;  4M75 C;  5FU7 C;  4QVC A;  3QZ9 B;  4FIB A;  3CC4 T;  2I2L A;  2MF2 A;  3MEA A;  2HAX A;  3G71 A;  1H64 1;  2GCX A;  3FIF A;  3LLR A;  3P8B B;  3RKX A;  2Y90 A;  2X4Y A;  3MP1 A;  4Q5W A;  5DM7 R;  2JVV A;  3V7R A;  5DLO A;  5A2Q E;  1OI1 A;  2EWN A;  1W2B A;  3OB9 A;  4A53 A;  4XQ3 A;  3C94 A;  3LWH A;  3SWN B;  4M77 B;  3QDR B;  3JB9 J;  4IUV A;  4J83 A;  2JZ2 A;  3QYG B;  2DPP B;  2OAU A;  3RER A;  2LTO A;  5LL6 S;  4C92 A;  5C0M A;  3CCL T;  4MDW A;  2VXF A;  4X9C A;  2D0Q B;  2RHI A;  1PSF A;  3X25 B;  3CCU A;  2LDM A;  3I55 T;  5KCO A;  3FJP A;  1WQ7 A;  1G3S A;  2NLU A;  4M77 D;  3HKS A;  4J6Y A;  2ZGW A;  3CPF A;  4E7I A;  2VGN A;  4M78 A;  4QQG A;  3OW2 A;  1UGP B;  1I81 A;  4HA8 A;  3I56 A;  1VQO T;  3G6E A;  3PNW C;  1N27 A;  5DY9 A;  1YIT A;  2RB6 A;  4PNO A;  2RO0 A;  3M54 A;  4J8O A;  5CQX A;  3RES A;  4RKU E;  2D6F A;  5GAM e;  4JRP A;  4IKF A;  3OSV A;  5GAN h;  3OYF A;  5CVI A;  3OYH A;  3C12 A;  3WVD B;  5LJ5 e;  3MEW A;  3JCM d;  1S72 A;  4M7D A;  4M75 B;  1XOV A;  5GAM g;  5FU6 B;  5L8R E;  2X4X A;  5FRM A;  3LGL A;  3M4Y A;  1NZ9 A;  1XTD A;  3QYH B;  1VQ7 A;  5LJ5 g;  2HBP A;  2K3Y A;  2KK4 A;  4OGE A;  3J7A F;  2HNI A;  3TCJ A;  5GAN 4;  1Q81 U;  3OY9 A;  3CMA A;  2QQR A;  4F7U G;  1JJ2 S;  3M55 A;  3P8D A;  4J6W A;  4M75 D;  4XK8 E;  4A4F A;  5GAN 7;  4PJO C;  3UDC A;  1VQP T;  1VUB A;  5CK9 A;  2E64 A;  2KY9 A;  3QO3 A;  4PKC C;  1OZ3 A;  1Y96 A;  4NS5 A;  2KSS A;  4UC4 A;  2EFI A;  1V29 B;  5CO7 A;  1DJ7 B;  2QQA A;  2QQS A;  2QI2 A;  4OP0 A;  4BI8 B;  1Q86 U;  1YJ9 T;  4OB2 B;  5LJ3 f;  3AHU A;  2R57 A;  1M9S A;  4J6X A;  4C8Q A;  2K2V A;  4BAC A;  4ZN3 A;  4N4G A;  3QZ5 B;  3QKJ A;  2RHY A;  4EMK A;  1KD1 C;  1VQN T;  3INZ A;  4E7L A;  3DLM A;  2RHX A;  4ATO A;  4GLK A;  4MDX A;  4O6J A;  3OYL A;  5HK0 A;  3E9F A;  3PIO A;  4C92 C;  2PVD B;  3UT1 A;  4C0F A;  4QVD A;  3OBW A;  4ELY C;  2BUD A;  3LWI A;  1G3W A;  2KMT A;  3URG A;  1VQL A;  2XU8 A;  1YCY A;  2E10 A;  3MP8 A;  2KQW A;  2DZC A;  2M9U A;  2WSC E;  1Q81 C;  1N6A A;  2EQJ A;  2G3R A;  2E1H A;  3MHX A;  4M78 C;  4QQD A;  4EMG A;  3CME T;  1UEB A;  3JCM g;  4ZTJ A;  3M4G A;  1RL2 A;  3QSU A;  2IG0 A;  4F7U A;  1D3B B;  4E7K A;  1VQ9 T;  2GQV A;  3TRE A;  2HD0 A;  4A4H A;  3L2W A;  4OVA A;  3HL8 A;  4EDU A;  1LOJ A;  1NPP A;  2E12 A;  4FT4 A;  1K73 U;  1Q86 C;  4CRI A;  4JS4 A;  4ME7 A;  4PJO B;  3CD6 T;  4M7D C;  1M1K U;  1JBM A;  4BI4 A;  2E65 A;  1KQS A;  4XU2 A;  4E7J A;  1YJW T;  2L8D A;  4C5H A;  1YJN A;  1QP3 A;  3CCE A;  3KBG A;  4ZGJ B;  4TVR A;  1U1T A;  2LVM A;  4BI3 A;  4ZTF A;  2XIC A;  2PUO B;  2R58 A;  2CZ6 B;  4DOV A;  2DXB A;  4X9D A;  1NE8 A;  4C5G A;  1M1G A;  4KT0 E;  1JRI A;  1UGR B;  2JN0 A;  1VQM A;  1QVG A;  3NTH A;  4HKE A;  1WJQ A;  1GXI E;  2E41 A;  5CCA A;  2O4X B;  2RJF A;  4C92 B;  4ZGE B;  2BIV A;  1X75 C;  2RI5 A;  4NOY A;  2ZZD A;  3HFN A;  3CC7 A;  1VQK T;  3VUZ A;  4X34 A;  1W4S A;  2OTJ T;  1YI2 T;  3V7C A;  2RI3 A;  3A8O B;  1WJS A;  1UGS B;  5CQY A;  3G4S T;  1O9S A;  1WNL A;  4XU1 A;  2LX9 A;  4C8Q C;  2GFA A;  2MWP A;  1VQ5 T;  1LNX A;  3M56 A;  4M78 B;  5HK3 A;  3PT9 A;  4XTV A;  4EMK C;  3LGF A;  4BY6 C;  3L1A A;  1VIE A;  2LT4 A;  4C92 D;  4R56 A;  2DIQ A;  3S3N A;  3RIR A;  3QUI A;  3JB9 H;  1QVP A;  3HSB A;  2WSE E;  3ZEH A;  3L2R A;  4OB3 B;  3M58 A;  3JB9 D;  2AHJ B;  4BUG A;  4JRQ A;  1YIJ T;  4M7A D;  3V8J A;  4N4H A;  2FYK A;  3S6W A;  2RK1 A;  5J39 A;  1VQ8 A;  4M7D B;  3WXM B;  2QQ9 A;  2A7Y A;  1M90 U;  4LDY A;  4M7A E;  1NPR A;  3QHS A;  2L3R A;  4YTL A;  4MZT A;  3VYG A;  3JB9 G;  4M7A G;  4MML A;  1I4K 1;  4JUV A;  2P0K A;  3LH0 A;  1N9S A;  3E1S A;  3ER0 A;  3PTA A;  3QPH A;  3OA6 A;  5KH6 A;  3GPL A;  4OB1 B;  1QVF S;  1M4Z A;  2LC4 A;  3HHT B;  4DOW A;  2K5L A;  2D9T A;  5GAO n;  4XAX B;  5I2S A;  2QEX A;  3CCM A;  1Y96 B;  3CPW A;  3OSS C;  1G3T A;  1U1S A;  2CS7 A;  3C4S A;  3MP6 A;  5A0G A;  4LDV A;  2KDS A;  2EQK A;  3FRN A;  1HK9 A;  2KAF A;  4QVZ A;  4BD3 A;  5CR2 A;  1BI1 A;  1NJI C;  2A3L A;  4M77 E;  4OB0 B;  3JAM E;  3L2V A;  4FU6 A;  4Y28 E;  2MMP A;  5GAN f;  4C8Q B;  1W2B S;  4M77 G;  2DJZ A;  3OMC A;  4PLI A;  1KHI A;  3CCV T;  1B34 B;  3WVE B;  1ZQ1 A;  2HQX A;  2ZPF B;  3CCS A;  1K8A C;  4EMH A;  4E7H A;  4BY6 B;  3JB9 I;  4EPC A;  3MET A;  1KD1 U;  2CZ1 B;  2JOY A;  4LDU A;  3FC3 A;  3CCQ T;  4BE2 A;  1WQW A;  1M90 C;  4V2S A;  3CXC A;  5FU7 B;  3S3M A;  2CZ0 B;  4A54 A;  1VQ4 A;  4C8Q D;  4WF2 A;  1VQ6 A;  2LCL A;  1I8F A;  2PVG B;  2DD4 A;  3KUF A;  3EAE A;  3CCR A;  4VUB A;  1X01 A;  2IVW A;  2E6N A;  3RKW A;  2RM4 A;  2XI9 A;  3CBP A;  2E6Z A;  2ZCF B;  3OYD A;  2DO3 A;  4F7U B;  3V7S A;  2RHZ A;  1Y7X A;  3A8G B;  2E5Q A;  4NL3 A;  3GLX A;  3JCM X;  2QA4 A;  2EYQ A;  3OW2 S;  4OMF B;  3CC4 A;  4M75 E;  2EKO A;  1BI2 A;  3A8L B;  5CKH A;  2DD5 A;  2CZ7 B;  3OQ5 A;  4FT2 A;  2EJ9 A;  4N0A A;  5D6X A;  4L6V 5;  1WGS A;  4M75 G;  2VXE A;  4FM4 B;  4C0D C;  3M9Q A;  4C0Z A;  3UPU A;  3OYA A;  4JS5 A;  5KE3 A;  1I5L A;  5IAY A;  3L2Q A;  2K5I A;  4HT8 A;  2P0Q A;  5KE2 A;  4JRK A;  4MZM A;  3ZBD A;  4QW2 A;  5LJ3 j;  1BI0 A;  3OYE A;  4MZP A;  3CCJ T;  4BB7 A;  3CC2 T;  1BIB A;  4R55 A;  1XQH A;  3SD4 A;  2MWO A;  2F5K A;  3CCL A;  3V8K A;  2XG8 D;  2L5Q A;  5GMK j;  3OYN A;  3GP8 A;  3JCM e;  5GAM f;  1Y07 A;  3I55 A;  4JRI A;  2MAM A;  4IUQ A;  2PU9 B;  2EAY A;  2XKO C;  3X20 B;  3DB3 A;  3P8H A;  4CI0 C;  5M9O A;  5LJ5 f;  3S3O A;  5GAM h;  1U8R A;  3JB9 F;  4M7A F;  5CIU A;  2RJD A;  1YHQ T;  3FEO A;  5FRN A;  1VQO A;  3JCM Q;  3JCM c;  5LJ5 h;  3JCM P;  3A8H B;  1KQ2 A;  1QW1 A;  2JTM A;  3M59 A;  3TU4 K;  1HXD A;  2V8I A;  4JLG A;  3N5B B;  4LDX A;  2LQK A;  3E9G A;  4JJN K;  3JSC A;  2ZPE B;  2R5A A;  3LW5 E;  1BKB A;  3G71 T;  3L42 A;  1AHJ B;  1OZ2 A;  3VYH B;  4D6W A;  5GAN d;  5GAN 3;  3MO8 A;  5A0L A;  4KUD K;  2VC8 A;  3ZFJ A;  5GMK m;  4J5Y A;  4C0D B;  5J26 A;  1KC8 U;  4M77 F;  2XD0 A;  2M0O A;  5GAO r;  4PJO D;  2K5F A;  2HQE A;  3QG1 A;  2F69 A;  4BE0 A;  4BDZ A;  3NTK A;  2VGM A;  2ZPH B;  4KUI A;  1KHC A;  2DXT A;  2VV5 A;  2LT1 A;  3X24 B;  3OYY A;  1VQP A;  1KQ1 A;  4PJO E;  2K57 A;  4N4I A;  4PJO G;  2LRQ A;  4N0A C;  2DK3 A;  3E19 A;  3CCU T;  2L89 A;  3M57 A;  2OTL T;  1YJ9 A;  3FB9 A;  4XTZ A;  4DQ2 A;  5GAN 2;  1KG1 A;  2ZPB B;  4PL6 A;  3SWN C;  4QQ6 A;  1KQS S;  3EFS A;  3HPW A;  5FLX E;  3L2U A;  3JCM V;  1MGQ A;  4LDW A;  2R5M A;  3HFO A;  3X28 B;  5A0D A;  4KBM B;  3I56 T;  3RUX A;  3G6E T;  1YIT T;  3JCM h;  1VQN A;  1NJI U;  2DVE A;  2EIF A;  2RJE A;  2FL7 A;  3PFS A;  3OYJ A;  3QJ6 A;  4O5V A;  1LJO A;  2DIG A;  1ZHI A;  3PMT A;  4C92 E;  5LJ3 d;  4M75 F;  1S72 T;  1QVG S;  3F70 A;  4C92 G;  3PIP A;  2PQW A;  5HY6 A;  5J3B A;  1KC8 C;  4NL2 A;  1K8A U;  2OTJ A;  4M78 D;  3MEU A;  2DTH A;  4XTX A;  4C0G A;  2RHU A;  1IRE B;  3CBM A;  3CME A;  4J7F A;  5GAO m;  3OYC A;  1VQ7 T;  4M78 E;  3BDU A;  5I21 A;  3PMI A;  4M78 G;  1VQ9 A;  1ZBX A;  2KVQ G;  1WJR A;  4XTU A;  3HRT A;  5GAN g;  5IN1 A;  3CMA T;  1VIF A;  1M5Q 1;  2F5T X;  3VV0 A;  4M7D D;  1H3Z A;  2JNG A;  3CD6 A;  2XHC A;  3SFM A;  2QTX A;  5FU6 C;  4OF1 A;  2X35 A;  5KCH A;  2DAQ A;  1YJW A;  4M7D E;  1M8V A;  3G7Z A;  4C5I A;  3BY7 A;  3A8M B;  2BKD N;  3PGG A;  4M7D G;  2V8K A;  5CAI A;  2CGH A;  3NTI A;  3H6Z A;  4XTY A;  3CBO A;  2EJF A;  1BI3 A;  2DTO A;  2FHD A;  1Q7Y U;  5HKC A;  4EMK B;  5GAN j;  2ZPI B;  2K4Y A;  4E47 A;  3GNF B;  4RG8 A;  3OS2 A;  2O4X A;  5GMK l;  2H3J A;  2YRV A;  3LYI A;  2JTF A;  5AYF A;  1R8O B;  4Z02 A;  2DKG A;  4IUU A;  5CKD A;  5LJ3 e;  1VQL T;  3DB4 A;  1VQK A;  1FX7 A;  3MEV A;  2Y4X A;  5GAO p;  3OYB A;  1EIF A;  3RMS A;  1TH7 A;  4OGC A;  3SDZ A;  1YI2 A;  2OTL A;  4M7A A;  3JCM b;  5GAN 6;  2WSF E;  3M5A A;  2GF7 A;  5LJ3 g;  3G4S A;  1JJ2 A;  4FSX A;  1VQ5 A;  4HCC A;  3CPW S;  2EJG A;  4C8Q E;  3QXE B;  5GMK e;  4L5G A;  2VUB A;  4C8Q G;  5GMK i;  2M16 A;  2RI2 A;  3R6O A;  1P92 A;  5IT9 E;  2RD1 A;  1K73 C;  3TEE A;  4PJO F;  4B9W A;  5DLQ E;  4P5N A;  1YIJ A;  2XK0 A;  3RMQ A;  4HCB A;  4KUL A;  3ASK A;  1YJN T;  4XTW A;  2WAC A;  1Q7Y C;  3GF5 A;  5CKE A;  3CCE T;  3CXC S;  4LD9 K;  4A4E A;  3HP9 A;  1RI0 A;  3NFC A;  3SWN A;  3QJY A;  4M77 A;  4XU0 A;  1Y71 A;  3A5Z B;  2FVU A;  2LCC A;  4F7U E;  2P0P A;  1M1F A;  2DZ9 A;  4RG2 A;  1N9R A;  1SSF A;  4HCZ A;  4MMK A;  5GAO q;  2ZPG B;  3OBY A;  3OS5 A;  3DKM A;  2CKK A;  1VQM T;  3OYI A;  5GAO l;  1YBY A;  3HRS A;  4C92 F;  2DXC A;  2K3X A;  3H8Z A;  3Q1J A;  1N8R U;  1BIA A;  4DA4 A;  3BFM A;  3OYM A;  4ELZ C;  3OYK A;  4A4K A;  5GAM j;  3CC7 T;  5CKB A;  2QQB A;  4RCC A;  4Y91 A;  2XDB A;  4JDS A;  4M78 F;  3VU3 C;  5LJ5 j;  2E70 A;  4ZGD B;  3QII A;  4L59 A;  5D6Y A;  1UB4 A;  1B34 A;  3CCV A;  2YLC A;  4BDY A;  5LJ3 h;  2Y4Y A;  3GIB A;  2EQU A;  4RCB A;  2LQ8 A;  3HRU A;  2QXF A;  3CCQ A;  2X4J A;  2DXU A;  4M75 A;  3QBY A;  3J80 E;  2YLB A;  3J81 E;  3UWN A;  2X4W A;  3FDR A;  5I2M A;  3VUB A;  2XID A;  4M7D F;  1WPY A;  4LD6 A;  5GMK h;  2FB7 A;  1VQ8 T;  2V8J A;  3CEY A;  3L2Z A;  4HT9 A;  2LNV A;  1FWZ A;  4M7A C;  3JRZ A;  3GNG A;  2RA2 A;  2DTI A;  2QDY B;  5GAN 8;  2DEQ A;  3ME9 A;  1Q82 U;  3SB2 A;  1N8R C;  4J7I A;  3C95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...