1KQ2A

Crystal structure of an hfq-rna complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
NIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation/rna
molecule keywords 5'-R(*AP*UP*UP*UP*UP*UP*G)-3'
publication title Structures of the pleiotropic translational regulator Hfq and an Hfq-RNA complex: a bacterial Sm-like protein.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 13
structure length 60
sequence length 60
chains with identical sequence B, H, I, K, M
ec nomenclature
pdb deposition date 2002-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1kq2A00
4M75G 4M7AB 4A53A 1U1SA 1D3BB 5GMKi 1WPYA 5GMKm 4M7DF 2DKGA 4QVDA 2E10A 2CGHA 2K57A 4M7AA 4WF2A 2EWNA 4XU0A 5GMKj 2E1HA 4NL3A 1LJOA 5GAOl 2EJGA 1LNXA 3JCMQ 5LJ3h 4J6YA 5GAN6 3QO3A 5GAN4 2DXTA 3JCMV 5LJ3d 3JCMb 2DVEA 4XU1A 5GAN3 4M77B 4HT8A 4J6XA 4M78F 4C92B 4C8QB 1WQ7A 3JCMf 4M7AD 3M4GA 1N9SA 4M77A 4V2SA 4C92A 2VC8A 4JRIA 2FYKA 3EFRA 3BW1A 4M77C 5LJ5f 3L2ZA 4C92C 3SWNB 4C8QC 4F7UE 4M7AE 1JBMA 4M75F 3JCMe 4M7AG 3L1AA 1YCYA 1LOJA 4XU2A 3RKXA 3SWNA 5GMKh 2E64A 1BIBA 4M78E 4XTUA 5GANd 2E41A 4M77D 1WQWA 3SWNC 5GMKe 5GAMj 1Y96B 4C8QD 4C92D 5GAN5 3BFMA 3RUXA 3V8LA 4XTWA 4N0AC 3GIBA 5LJ5j 1D3BA 3BDUA 4PJOF 1Y96A 3SB2A 5GAOp 2I2LA 3JB9D 4JLIA 2EJFA 4M77G 2EAYA 3JCMg 4XTZA 2RM4A 4C8QG 4C92G 3JCMc 2QTXA 5GAN2 2VXFA 4F7UB 2E65A 2RD1A 4M7DE 5LJ5g 2DXUA 4MMLA 1JRIA 4MMKA 3RKWA 2ZGWA 1M5Q1 4F7UA 4M78B 5GAMf 4PJOE 3V7RA 4C8QA 4M7AF 2RA2A 3JCMh 4XTYA 1BIAA 1B34B 2DTOA 3JB9I 3JCMd 2DEQA 4NL2A 5LJ5h 4NOYA 4M78C 4QVCA 5GAMe 1B34A 3HFNA 4M75B 4HA8A 4EMKB 1N9RA 5LJ5d 5GAN7 3FIFA 5LJ5e 3JCMJ 1I4K1 4N0AA 3V8JA 4J5YA 3JCMP 1KQ2A 4M78D 4XTVA 4M75C 4M7DB 4EMKC 4J6WA 5I21A 4M75E 3RESA 2Y90A 1I81A 1WNLA 4PJOB 4F7UG 4M7DA 5GAOq 4Y91A 5LJ3j 5GAMg 5GAN8 3HSBA 4M7DC 1HXDA 4XQ3A 4M75D 4M78G 4EMHA 5GANf 3V8KA 2YLBA 4PJOC 4XTXA 3RKYA 3JB9G 2YLCA 4JRKA 3FJPA 4OP0A 5CAIA 1U1TA 3AHUA 3QSUA 5GAOr 4M7DD 5GAMh 1TH7A 4M78A 4X9DA 4DQ2A 4PJOD 3HFOA 3RIRA 5GAMd 3EFSA 1I8FA 4X9CA 4XU3A 4HT9A 2VXEA 5GANj 1KQ1A 5LJ3f 3RERA 2DTIA 4M7AC 4RCBA 4RCCA 4M7DG 1HK9A 4M75A 4EMKA 3INZA 5GMKl 3JCMX 3JCMW 2HNIA 4PJOG 4M77F 4F7UF 3JB9J 3VU3C 2EJ9A 5GAOn 4C92F 4C8QF 3JB9H 5LJ3e 1MGQA 5GANg 2DJZA 1H641 3QUIA 5GAOm 2DTHA 3JB9F 4EMGA 4PJOA 3V7CA 2DZCA 1X01A 3BY7A 2YHTA 2JN0A 3FB9A 4M77E 3V7SA 5GANh 1I5LA 4C92E 2RB6A 4C8QE 3QHSA 2FB7A 3PGGA 1M8VA 4JUVA 4PNOA 4A54A 5GANe 5LJ3g 5DY9A 2DZ9A
chains in the Genus database with same CATH superfamily
3L2VA 2DKGA 1N6AA 4AG2C 3VJPA 3S6WA 2L3RA 4GLMA 5GAOl 1NJIU 2LMJA 2YDLA 1K73U 4PK4A 1GCPA 1MNEA 3CCVQ 2PTKA 2RJEA 5CO7A 3VS0A 1YJNQ 3CMAA 4JRIA 1VQ8T 1OZ2A 2YT6A 2K3YA 3NHNA 3JRZA 1YP5A 1VQKQ 3NTIA 4D8KA 1LOJA 1YCYA 4XTWA 1PRLC 3BDUA 4A4FA 3M53A 3OYMA 2LCLA 2DIQA 5KCOA 1BKBA 3REAB 1R8OB 1M3CA 2E65A 4LDVA 2E3IA 1SHGA 3CBMA 4DEXA 2L89A 2LC4A 3HFNA 3OSSC 2D8HA 4RTWA 2CSIA 2JXBA 3A8MB 2YWWA 1Y0MA 1GFDA 1W1FA 2FO0A 2DERA 3SEMA 3P8HA 3RR6A 1QW1A 1WNLA 4FT2A 1VQ4T 1WHLA 2AKKA 3TSZA 4M78G 3OA6A 3V8KA 1AWWA 2YLCA 4JRKA 3FJPA 4RTYA 5DLOA 4ZGEB 4PKCC 1N8RR 2AZSA 4J9HA 5KCHA 2LQKA 1MV0B 1A0NB 1VQOQ 2F1LA 1KG1A 1UDLA 1WIEA 1VQ6Q 5EG2A 1RI9A 2DJZA 5CKEA 2K6DA 2ED0A 3TCJA 3L2WA 2YHTA 3OB9A 2GQIA 5IHKA 2D0QB 3I5SA 1Y7XA 1UJYA 2MIOA 3P8DA 1D3BB 4M7AA 2L0AA 2VASA 3CMAQ 2COWA 2KMTA 4JJCA 2DVEA 1VOMA 1WQ7A 1K0SA 1N5ZA 1NPRA 4A4KA 2JMAA 1XNIA 4M78E 1YHQA 2VWFA 4FYYB 1UGVA 1NJIR 2KGTA 1Y96B 4HVUA 3GBQA 1K73R 3NTKA 1MNDA 2HMAA 4CRIA 4R55A 2JVVA 1X2QA 4LNPA 2ZPGB 1M27C 1ZUUA 5FLXE 3M55A 2O88A 1GFCA 4MMKA 2YRCA 5GAMf 4BACA 2EQIA 3OYLA 4XTYA 1PSEA 1WA7A 3VS5A 3EG3A 2YUOA 3LWIA 1N9RA 2KI7A 2DAQA 4FT4A 4LDWA 3OYKA 3V8JA 2DXBA 4M78D 1K0XA 5CQYA 3QDRB 5AYFA 1YIJA 2DA9A 3KUFA 4ATOA 1BCOA 5GAMg 3RMQA 4XQ3A 4M75D 1MUZA 1UHCA 3EHRA 3G4ST 1U1TA 2ATCB 4J9CA 1D0YA 5KYYB 4J8OA 5I22A 2ZPBB 3C4SA 3RERA 1NYGA 2JW4A 3LH0A 4RCCA 3VU3C 1TSFA 2QAZA 3A8LB 4IURA 2K5LA 3CPWA 3MEVA 4EMGA 2RI5A 1HSQA 1UECA 3CXCP 1B3QA 4JUVA 2HBWA 1U1SA 1W4SA 2AKLA 3ZL7C 2OJ2A 2LZ6B 2EWNA 5GMKj 2E1HA 2P84A 1LNXA 3M56A 5FWCA 3DB4A 4J9DA 4XU1A 1W2BP 4F14A 1UHFA 3H0FA 2K2VA 5CKDA 2FYKA 1NBEB 2CT4A 3SWNB 2DL4A 3RMSA 3A1PA 1HJDA 4M7AG 2A7YA 1TS9A 4KH1B 2R57A 1M2VB 2E41A 2M0YA 2NUPA 1KC8U 1AWJA 4Y28E 2KEAA 1X27A 3GIBA 2KRSA 5GAOp 1I07A 4HCCA 2V8KA 4JLIA 2HSPA 2QTXA 1JB0E 3DLLA 1ZSZA 3V7RA 4C8QA 5FW9A 1Y07A 2LP5A 2GTOA 3I35A 3EG0A 3CD6T 1YIJQ 3M9QA 4JPBW 3JCMJ 3PMTA 2ZZDA 4RG2A 1UG1A 2JOYA 3G1JA 4J5YA 4WCIA 3JCMP 1AZEA 4IKFA 3OS5A 1TUGB 4Z88A 3RESA 2QEXA 2CSQA 4M7DA 4FYVB 1ZA1B 3QZ9B 1UTIA 2BE7D 4II1A 3H41A 3EG9B 2YSQA 3NFCA 1S72A 1U06A 2ZPHB 1M1KC 2RK1A 2DBMA 1BI2A 2R5MA 3OQ5A 4M7AE 3CCVT 1WDXA 4CC2A 2QASA 1IB8A 1YJNT 2LDMA 4PJOA 4AMCA 1GCQA 4PLLA 1S1NA 4PLIA 1PNJA 5KYXA 1VQKT 3X25B 4JJBA 3HRTA 2BKDN 3F70A 1RLPC 2GBQA 1NLOC 3OYAA 1YCSB 3EGUA 1EX4A 5CQXA 2KQWA 5KYWB 1NEGA 3VUBA 2K7AA 5D6YA 4N4IA 4M7AD 4DBFA 2K4YA 5IHNA 4PFOA 1IO6A 5J26A 2JM9A 2BZXA 3L1AA 5GMKh 2OAUA 4KT0E 2X3XD 3M59A 1PWTA 2IIMA 5IAYA 3M5AA 4GY5A 2GQVA 4CC3A 2EAYA 2XHCA 2QQAA 4A4GA 2L5QA 1K9AA 4OB2B 3EG2A 3L42A 1OX8A 3VS2A 2QEXQ 2ZPEB 2FZCB 2LQ8A 1KHCA 4ANJA 4N0AA 1X43A 2DEUA 3CC7A 3CXCA 4CC7A 3MEAA 2KAFA 4Y91A 1HXDA 4EMHA 3ER0A 3VUZA 2E6NA 5J39A 2XI9A 3RKYA 2RN8A 4JS4A 5D7UA 1KQSS 2G6FX 3HFOA 1W2BA 1JXOA 4PJJA 5IXBA 3LX7A 3GF5A 3CCQA 1K9MU 1PG5B 4PJLA 3CMAT 4M7DG 1Z9ZA 1OI1A 1H3HA 1E6HA 1C1AA 4F7UF 3OMCA 4CC4B 2DD5A 1OU8A 4RTXA 3THKA 1GXIE 1EZZB 4MZMA 5HY6A 1OULA 3QYHB 3TVTA 2EBPA 1TUDA 2FL7A 3X24B 2CUDA 1KFZA 1RL2A 4XU0A 1ABQA 2C0IA 2P0KA 2HQEA 2KXDA 2K79A 4OMLA 2XICA 1TOVA 2XIDA 2DNUA 3CCUA 2XMFA 2VC8A 1Q82U 3EFRA 4KBMB 1G3WA 3OMGA 2RHYA 2RI2A 2NUTB 2QG9B 2QK0A 4E6RA 3SWNC 5GAN5 3V8LA 4KULA 4KGXB 2KVQG 2GCXA 3R6OA 1FYNA 2DF6A 1PCXA 2DETA 3OBWA 3OBYA 5FU7B 2ZPFB 2VXFA 2V26A 4M7DE 1NEBA 2CZ6B 2MCNA 4DOVA 1ZA2B 1JQQA 1M8MA 1I1JA 4KRTA 3CC7Q 3FEOA 1WI7A 2D9TA 2DEQA 5LL6S 3M4YA 4BE1A 3GPLA 1UGPB 2RJFA 2KE9A 1M4ZA 2CZ7B 4BDZA 2EGEA 2VKNA 4E2FB 3URGA 3AT1B 2Y90A 5FRNA 1WHHA 2VYTA 1P92A 1LCKA 5LJ3j 4JS5A 1YITA 3HPWA 1JEGA 2K5IA 3CCQQ 3G6EA 3PTAA 3CCRQ 1M1KU 4M7DD 4M78A 2LT4A 4DQ2A 5I2SA 3RIRA 1UGRB 4FYWB 4XU3A 1VQMA 2VXEA 2QA4T 3EFOA 4IIMA 1ZQ1A 4M75A 1WXTA 2HNIA 3EGXB 2JTEA 4BE0A 3C12A 3LYIA 2LQWA 1D1AA 1KSWA 2EIFA 2A08A 1RUWA 2FPEA 1T0JA 4FYXB 3BY7A 4WTOB 2VVKA 1H92A 2L3QA 1U3OA 4ZTJA 1K9MR 4PNOA 3ZFJA 4HCBA 2EYYA 1G3YA 3E1SA 4RTUA 3KFVA 4BB7A 2F5KA 3A5ZB 3CCUQ 3JCMQ 2KRNA 2OTLA 1IHWA 2DL3A 2PZ1A 2RF0A 1M90U 3OS0A 2XK0A 5GAN3 4M77B 4E7ZA 3E19A 1UFFA 4OMQA 3VV0A 1BBZA 1WHJA 4KGVB 4F04B 3OYEA 1TTHB 1YIJT 2CP6A 4DBRA 1W70A 2E12A 1M1GA 1OPKA 1JJ2P 3JB9D 5KYUA 4BI4A 4FIBA 2XDDA 4C5HA 2LJ0A 2FRYA 2P0QA 1VQ9A 4AT1B 1B34B 2X4XA 2RQWA 3QJYA 2HZYA 2M51A 3A8GB 5LJ5d 3FIFA 2VUBA 2BZ8A 1T0HA 1YITQ 1I0CA 1KC8C 2Y4YA 3G6EQ 4OGCA 2CH4A 3CQTA 5GAOq 2JM8A 2O31A 2YLBA 4Z89A 3CCSA 4LXCA 4OP0A 2CKKA 3I55Q 5KH6A 1TH7A 3MEUA 1VYUA 5GANj 3CCJA 1KQ1A 2EGAA 3GNGA 1G2BA 3OYGA 1HK9A 4OB3B 1RAIB 2RJCA 4KGZB 4ESRA 3HRUA 1M1KR 4QQDA 2RK2A 3MPUB 2RQRA 3CCEA 4FCYA 1KIKA 2OTLQ 3A98A 4M75G 5GMKi 2VV5A 4EPCA 4QVDA 3GP8A 2E10A 4FSXA 1QP2A 2HL3A 1AZGB 2VGMA 4FSSA 3N5BB 2DL7A 2LX9A 3JCMV 1KQSP 1AWOA 1FXXA 2EQKA 1YJWA 3QG1A 3M4GA 3LGFA 2P4TA 1VQLA 1UE9A 1QP3A 3VS6A 1IRXA 1YI2A 2FVUA 4FL6A 2QEXT 1M1FA 3FJ5A 2BUDA 2EKOA 1QQJA 2EYQA 3PIOA 1OOTA 3RUXA 2CZ0B 4OF1A 2O2OA 5LJ5j 3M57A 2PU9B 3DB3A 8ATCB 4C5IA 1VQ9Q 4IUUA 4X34A 3QJ6A 5HK3A 1R77A 3M0SA 3RKWA 2R5AA 2ZGWA 2K9GA 5FU7C 1D1BA 5C0MA 3JB9I 4FW2A 3RNJA 3NGPA 4XK8E 1E7OA 1UB4A 5I2MA 1OV3A 2V8JA 3CCSQ 1F1BB 4M75E 1QVPA 2F2WA 3VS1A 2A36A 3A8OB 1NYFA 5L8RE 3PE0A 2DILA 3OYHA 1T3SA 5FRMA 1Q81U 4RCBA 3E9GA 1V1CA 1FMVA 3QIIA 4M77F 3JB9J 3CCEQ 2DK3A 3JB9H 2LX7A 2LVMA 1JO8A 1VQPT 4JRPA 4F16A 1PC0A 2X4WA 1YJ9A 5GANh 2OTJA 2NUPB 3G71A 4JJNK 1W6XA 2HEQA 1BI0A 4QQGA 1VA7A 3CCLA 1WLPB 3KBGA 1YJWQ 4HXJA 2A3LA 4PJMA 2MWOA 1K9MC 1WXBA 1VQLQ 5GAN6 4DA4A 1MMNA 3CC2A 1CKAA 1PD0A 1ZSZB 2LCCA 1KD1U 4E7LA 4C92B 4C8QB 4OMFB 1OEBA 1N9SA 3QYGB 2CS7A 3CC7T 3BW1A 2O9SA 4M77C 3CBOA 2CP7A 2MWPA 4JZ4A 4OMMA 4GLKA 2EKHA 3M0UA 3E2UA 5GMKe 5GAMj 1CKBA 3MP8A 1Y96A 1M30A 3SB2A 1UJ0A 1JXMA 1AT1B 2BE9B 4F7UB 1YHQQ 3EAEA 2L2PA 1SPKA 1M5Q1 3CCRT 2HAXA 4M7AF 2DTOA 1Q82C 3JCMd 5LJ5h 4NOYA 2X9HA 3UWNA 1WJSA 5GAN7 3VS4A 1VQ5A 2RQTA 3E9FA 3OW2S 2ESWA 5HCKA 2LTOA 4PJOB 4IUPA 5IH2A 5KYXB 4L5GA 3HSBA 1NG2A 4RG8A 3WVEB 2RQUA 3REBB 3U23A 1UGQB 4C0FA 2E3HA 4HCKA 3QSUA 4R56A 5GAOr 3PIPA 2QDYB 4J9FA 3VYHB 1KQSA 2D1XA 4HT9A 3CCUT 4PFZA 4M7AC 1B7TA 1YJ9Q 2OTJQ 4J9IA 3G71Q 5CKBA 4DOWA 1X01A 5ECAA 4ELYC 1I5LA 1Q81R 2FB7A 3H0HA 1R0BG 1KHIA 3OYYA 1JU5C 2QXFA 3CC2Q 3VS7A 2K57A 2E70A 1K8AU 2DFUA 4MZPA 1MMGA 4J9BA 2FHDA 2F2VA 2RHZA 2PVOB 1SHFA 1BI3A 4QQ6A 4HVWA 1D09B 2QQ9A 3S3OA 1CSKA 4DBHA 1JJ2S 3JCMe 1RAFB 1ZBXA 1BYMA 4RTTA 3SWNA 2KK4A 2AHJB 2KDSA 1K4US 2OAWA 2JJ9A 4AFSC 3G6ET 2CT3A 2KT1A 3EGDA 3NMZC 4BUGA 1KD1R 3NPFA 5GJVB 1M90C 2CP2A 5CCAA 4OMOA 2CREA 1VQ5Q 2V1QA 3I55T 1AWXA 2WSEE 3EHQA 2MAMA 1M2OA 3IQLA 4M4ZA 4PFPA 1RABB 2HKQB 2AZVA 1YWPA 2EW3A 4QW2A 3CMEA 1Q7YU 3D7SB 2I0NA 1I81A 4Q5WA 2XU8A 3UA6A 2H3JA 1WYXA 2A37A 4P5NA 5I11A 3OYJA 3EG9A 4RTZA 2OTLT 4J9EA 1KC8R 2IPOB 2QGGA 1VQOT 2DJQA 4QVZA 1B07A 1UEBA 4EMKA 5A2QE 5GMKl 1VQ6T 4ZN3A 1IXDA 3MHXA 4AG1C 1S72Q 2RNAA 4C92F 4C8QF 1AEYA 3ZBDA 2DL8A 2GGRA 1SRMA 1H641 3QUIA 3DLMA 2DZCA 5AT1B 1Q86U 3J7AF 2AIRB 2LCSA 2HD0A 2RB6A 3TU4K 2JMCA 3CBPA 2CP0A 1WPYA 4M7DF 1IZ6A 1VQ9T 2GFUA 1TWBA 2VGNA 1LJOA 2E6ZA 2EJGA 4J7IA 5LJ3d 3JCMb 4KUIA 1G8XA 1SF9A 1WHMA 3LLRA 3MJXA 3FDRA 1ZSZC 4C92C 4C8QC 1FWZA 3X28B 4JRQA 3QXEB 1XJWB 1D0XA 3QZ5B 1H3ZA 2LJ3A 4JDSA 3OS1A 3CCST 4PJOF 2P4RA 4GBQA 1QVFS 2A28A 2EYWA 2JNGA 2QGFB 2RM4A 1U8RA 1TG0A 5GAN2 1ZUYA 4M78B 3EH1A 3JCMh 1O75A 3CMEQ 1IHVA 3HHTB 1GBRA 1WJQA 4NL2A 2QI2A 2B8AA 2JUFA 1RLQC 4M75B 2EFIA 4MZTA 1FMKA 3CCET 1WGSA 4J6WA 1X69A 3MP6A 2HQXA 1GRIA 4PJOC 3LH5A 1GCQC 3JB9G 1XOVA 4O6JA 1LPLA 5CK9A 4IUQA 2HDAA 1PHTA 4C5GA 5IXFA 4BY6B 1VQLT 2RQVA 2RO0A 4DEYA 3JCMW 2ECZA 1MMAA 5LJ3e 4JZ3A 2YRDA 4NS5A 4PL6A 4Z02A 2JS2A 2QTVA 3L2UA 4A4EA 3CCVA 3OW2P 1OYXA 4FW1A 2HL5C 3PGGA 2YUPA 2O4XA 2HSEB 3ASKA 3WVDB 3OYBA 2KYBA 5KYUB 2LQNA 2GFAA 1VIFA 1Q81C 2X51A 2KRMA 2FPFA 1Y71A 3OYDA 4J7FA 3O8VA 1QCNA 1YHQT 4J6XA 1Q86R 4E7KA 2K2MA 4J83A 2WSFE 2BTTA 5HKCA 4XU2A 1BIBA 1KJWA 4OB0B 5GANd 2FZGB 1YN8A 2J7IA 3KXTA 4N0AC 4LD6A 2RH2A 2DM1A 3OY9A 4E7JA 1RADB 1X2KA 2EJFA 2EGCA 2MYSA 4MMLA 1ZUKA 2MI6A 1KD1C 4K11A 3OYNA 3OSVA 4HVVA 2ED1A 2RA2A 1PKTA 1VQ7A 2O9VA 2KYMA 2J06A 2FEIA 4ZNXA 5IN1A 1M3BA 1YJ9T 4L59A 4C0GA 3G71T 2CDTA 1QVGS 2RHUA 1VYTA 3J81E 5C6SA 1BK2A 3UA7A 1Q82R 5GANf 5KYNA 3UDCA 4C0DB 1D1CA 2RI3A 2IG0A 3G7ZA 4AFUC 2QQSA 4Z8AA 4X9DA 1M3AA 3CC2T 3PVLA 1I8FA 2P0PA 3CC4A 4IIOA 3L2QA 1OPLA 1RAGB 1SRLA 4KUDK 2LNHB 3M0QA 3C94A 3TREA 3WXMB 3EGXA 3O5ZA 6AT1B 4HCZA 5GANg 1EFNA 2XDBA 5A0LA 4J9GA 1VQMQ 1G5VA 4C5EA 8AT1B 4LDYA 5CR2A 3QHSA 1C6VX 1X75C 3I56A 3CPWP 4X9CA 5GANe 4VUBA 1G3TA 1QKWA 2PNIA 4M7AB 4A53A 3CCMA 1ABOA 5GMKm 2OX7A 4AFQC 2K3XA 2Z0WA 4WF2A 1K1ZA 2DL5A 2D6FA 1ZLMA 5LJ3h 3QO3A 1PRMC 1QCOA 2LT1A 3HL8A 3VRZA 2ZAEA 4N4HA 2L3SA 4M78F 1VQ5T 4LUEA 1EIFA 1LVKA 4M77A 2EQMA 4V2SA 2VB6A 4HKEA 5LJ5f 3EH2A 1TU0B 4M75F 3M54A 5J3BA 4E7SA 4KH0B 3RKXA 1VQNA 1OQKA 4LN2A 2CH4W 2L3PA 4RTVA 4F17A 2I2LA 2DVJA 1VQ7Q 2F5TX 2J6KA 1K8AC 3OYFA 4OMPA 3LGLA 4D6WA 4B6MA 2DBKA 5LJ5g 5D6WA 5CKFA 2PUOB 5HK0A 2BIVA 4BDYA 3QKJA 2RHXA 3HP9A 1NPPA 2DRKA 4M78C 2OI3A 4QVCA 1B34A 2C06A 2DIGA 5LJ5e 2F69A 1S72T 1M90R 1PM3A 4M75C 3OW2A 5I21A 3L2RA 2HKNA 4QKUA 1K76A 1RACB 2E4HA 2EYXA 4OGEA 4LDXA 2G3RA 3H6ZA 4ZGJB 4RKUE 3CC4Q 2PVGB 2PUKB 4XTXA 5CAIA 5D6XA 1QVFP 1YBYA 3AHUA 2M1HA 3FLGA 5GAMd 4EDUA 1Q95G 2HCKA 3BDLA 2V8IA 3P8BB 2KNBB 2MPXC 1MHNA 1Q7YC 4BY6C 2JT4A 3I56Q 3ULRB 4B9WA 2QA4A 2DTHA 4A63B 3CCMQ 1QLYA 2B86A 1H8KA 3GLXA 3CCJQ 2XG8D 3S3MA 4QT7A 5L23A 2DO3A 4A54A 5DY9A 3X20B 2F2XA 2CGHA 5DLQE 2ABLA 3JAME 1N27A 5GAN4 3RBBB 4HT8A 4B9XA 1VQNQ 5CKHA 2JTFA 3CMET 4BD3A 2SRCA 2LNVA 3BE3A 1YNZA 2J6OA 1JJ2A 3FC3A 1Q86C 3C0CA 1D3BA 1MV3A 4BI3A 4DBQA 4M77G 2CP3A 4FU6A 3C95A 1YI2Q 5FU6B 3CEYA 1BB9A 5GJWB 2XD0A 2COYA 3OS2A 5GAMe 4FM4B 3UATA 5KE2A 1D0ZA 1AHJB 2X35A 2KBTA 4C0ZA 2H8HA 1RAEB 1I4K1 2FPDA 1TXQA 2C0OA 1VQ8A 4M7DB 1ZX6A 1BU1A 2C0TA 3UF4A 1ARKA 2DLPA 1ZSGA 5GAN8 1NM7A 2DE0X 2ROTA 3CCQT 4Y92A 4ORZA 2KY9A 4C0DC 3MEWA 4ZGDB 2NUZA 1QWEA 2DD4A 1WXUA 3I5RA 1C0MA 2QA4Q 1O9SA 1QWFA 2CP5A 2W0ZA 4L6V5 3HTRA 2NLUA 3INZA 2QYZA 2FG0A 1VYVA 3OYCA 2K5FA 3V7CA 2YRVA 3GNFB 3T9NA 2M02A 2YUQA 2L8DA 3FB9A 4M77E 4LDUA 1QKXA 2DYIA 2M16A 1QVGP 5CIUA 1VQ4A 5GAOm 2MK5A 1NZ9A 2KSSA 3EGDB 1VIEA 5KYYA 1RAAB 1FMWA 1WHGA 4TVRA 1WHKA 4J6YA 2LJ1A 2RMOA 2FZKB 2CYZB 3JCMf 2IVWA 4C92A 3CCLQ 2GF7A 3A8HB 2DYBA 3L2ZA 1JBMA 1WFWA 1NE8A 2ENMA 2J6FA 3VS3A 4M77D 1WQWA 2KROA 2PQWA 3BFMA 2WSCE 4UC4A 2QQRA 4ELZC 2AT1B 1QVFA 4D8DA 2HQHA 3JCMg 4XTZA 2A0FB 5EC7A 2DMOA 4F7UA 2QDLA 3M0RA 2DPPB 3MP1A 1BIAA 1VQ8Q 2KXCA 2JS0A 2CUBA 2NWMA 2WACA 2W10A 1DJ7B 1ZHIA 3VYGA 4EMKB 3QBYA 1I5OB 2ZCFB 1YITT 1M2VA 2COZA 1N8RC 4LUDA 1PD1A 4X1VA 1BI1A 5FWBA 3H9NA 1VQMT 7AT1B 1WX6A 1J3TA 3JSCA 2EQUA 5GAMh 3QPHA 4ME7A 2D0NA 1E6GA 2YXYA 1YFNA 3QDFA 1X6OA 3SHWA 1AD5A 1X6BA 2EJ9A 5GAOn 1MGQA 3CPWS 1HYOA 1VQ4Q 1OX9A 4E7IA 2EQJA 2M9UA 4R0KA 3FRNA 2EPDA 4XAXB 2HBPA 1ZBJA 3J80E 1OZ3A 3Q1JA 4OB1B 1VQPA 3HRSA 2KR3A 2GNCA 3M0PA 1VQ7T 3G4SA 1NJIC 1AVZC 1RI0A 2DXTA 1K73C 3M58A 5IT9E 3QWXX 1R0CB 3VKIA 1PKSA 3LW5E 4XTUA 5CVIA 1GL5A 1Z9QA 2MOXA 3SDZA 2KT8A 2M0OA 2DRMA 4C92G 4C8QG 5KYWA 3I9QA 3CC4T 4YTLA 1JRIA 3CPFA 3TQ7P 2RJDA 5FU6C 3TEEA 4BI8B 2XDPA 1M9SA 4AFZC 1SSFA 4CI0C 3SD4A 1K8AR 3CCRA 4XTVA 3SFMA 4PJNA 4A4HA 4LD9K 3I56T 1QVGA 4F7UG 1BCMA 3CCMT 4OVAA 1IGQA 3UT1A 4M7DC 4RUGA 2RPNA 3CCJT 1WJRA 2SEMA 4IUTA 1UGSB 2O4XB 2FRWA 1PSFA 1WZOA 1V76A 2EVRA 5KE3A 2K3BA 3EFOB 3EFSA 3PNWC 3MO8A 5LJ3f 3RDVA 2DTIA 3JCMX 4PJOG 1HD3A 3OYIA 1Y57A 1VQNT 3CD6A 4ZN1A 1OU9A 2Y4XA 3JB9F 1VQPQ 1SKUB 3GOXA 4E7HA 2JN0A 1IGUA 1VUBA 3V7SA 2DX1A 4C92E 4C8QE 1SSHA 1KK7A 3UPUA 3G4SQ 2O01E 5LJ3g 2R58A 2NYSA 3H0IA 5IHIA 1YJWT 1Q7YR 4NL3A 5A0DA 2RHIA 2J05A 2XKOC 1G83A 2ROLA 1YI2T 4MDXA 1FX7A 1AOJA 1G3SA 1SG5A 3PFSA 4JLGA 5M9OA 3PMIA 1ACMB 1QCFA 2AK5A 1T3LA 1TUCA 4F7UE 4BE2A 3M0TA 3EG1A 2E64A 2ZPIB 1YJNA 4IUVA 4C92D 4C8QD 1MMDA 1IREB 2X4JA 1NLPC 3PVQA 1VQKA 4LE9A 3JV3A 2E5QA 3X26B 1V29B 3JCMc 2RD1A 3DKMA 1X6GA 2DXUA 1XTDA 5DM7R 4O5VA 2H3EB 5A0GA 4PJOE 1GBQA 2GTJA 4JJDA 1RAHB 2E5KA 4E47A 5FROA 1QMCA 3H8ZA 3HKSA 4HA8A 2BZYA 2CZ1B 3NTHA 3S3NA 2NUTA 4RMOA 2V1RA 1N8RU 3I55A 2PVDB 1KQ2A 3ME9A 4EMKC 3CXCS 4N4GA 2YUNA 4MDWA 3QWYA 2QQBA 3MCAB 3R6NA 2MF2A 3TSWA 3LWHA 2X3WD 4EIKA 2MMPA 3PT9A 9ATCB 1YWOA 3ZEHA 1W2BS 4PJOD 3CD6Q 2JTMA 2JZ2A 2D8JA 3VRYA 1XQHA 2OTJT 2LRQA 2X4YA 3META 4ZTFA 1SEMA 4OMNA 3CCLT 1VQOA 1UUEA 1VQ6A 1U5SA 2DXCA 2EYZA 1M8VA 3MKDA 2DZ9A
chains in the Genus database with same CATH topology
3L2VA 1KHIA 2FL7A 3OYYA 3X24B 3X20B 2QXFA 2DKGA 1RL2A 2CGHA 1N6AA 2K57A 4XU0A 5DLQE 3VJPA 3S6WA 2L3RA 2HQEA 2P0KA 1NJIU 5GAOl 3JAME 2E70A 1N27A 1K8AU 1K73U 4MZPA 5GAN4 2XICA 4HT8A 4B9XA 2RJEA 5CKHA 5CO7A 2FHDA 2XIDA 2RHZA 3CCUA 2PVOB 2JTFA 3CMET 1BI3A 4BD3A 3CMAA 2VC8A 1Q82U 4JRIA 3EFRA 1VQ8T 4KBMB 4QQ6A 1G3WA 1OZ2A 2LNVA 2K3YA 2QQ9A 3OMGA 3S3OA 1JJ2S 2RHYA 2RI2A 3JRZA 3JCMe 1JJ2A 1ZBXA 3NTIA 3FC3A 1Q86C 1LOJA 1YCYA 1BYMA 3SWNA 2KK4A 2AHJB 3SWNC 2KDSA 5GAN5 3V8LA 4KULA 4XTWA 2KVQG 2GCXA 3R6OA 3G6ET 1D3BA 3BDUA 4A4FA 4BI3A 4BUGA 3M53A 3OYMA 2LCLA 2DIQA 4FU6A 1BKBA 3OBWA 3OBYA 4M77G 5KCOA 3C95A 5FU7B 2ZPFB 1R8OB 3OYBA 5FU6B 1M90C 2VXFA 3CEYA 2E65A 5CCAA 4M7DE 2CZ6B 4DOVA 4LDVA 3CBMA 3I55T 2XD0A 2WSEE 2MAMA 3FEOA 3OS2A 2DEQA 2D9TA 5LL6S 2L89A 2LC4A 3M4YA 3HFNA 3OSSC 4FM4B 5GAMe 5KE2A 3GPLA 4BE1A 1UGPB 3A8MB 1AHJB 2X35A 4C0ZA 1I4K1 2RJFA 1M4ZA 4QW2A 2CZ7B 4BDZA 3CMEA 1Q7YU 1VQ8A 4M7DB 3URGA 3P8HA 1QW1A 2Y90A 5FRNA 1I81A 1WNLA 4FT2A 4Q5WA 1VQ4T 2VYTA 1P92A 5LJ3j 2XU8A 5GAN8 4JS5A 1YITA 3HPWA 2H3JA 4M78G 3V8KA 3OA6A 3CCQT 2K5IA 4P5NA 2YLCA 4JRKA 3G6EA 3FJPA 3OYJA 2KY9A 2OTLT 3PTAA 5DLOA 1M1KU 4M7DD 4M78A 2LT4A 4DQ2A 5I2SA 4C0DC 3MEWA 4ZGDB 4ZGEB 4PKCC 3RIRA 2DD4A 1UGRB 4XU3A 5KCHA 5LJ5d 2VXEA 2QA4T 1VQOT 2LQKA 1VQMA 4QVZA 1O9SA 4L6V5 1ZQ1A 4M75A 1KG1A 1UEBA 4EMKA 2NLUA 3INZA 5GMKl 5A2QE 1VQ6T 2HNIA 4ZN3A 3MHXA 4BE0A 3C12A 4C92F 4C8QF 3LYIA 5EG2A 3ZBDA 2DJZA 2EIFA 5CKEA 1H641 3QUIA 3OYCA 3DLMA 2K5FA 3TCJA 2DZCA 3V7CA 2YRVA 3GNFB 3BY7A 3T9NA 3L2WA 2L8DA 2YHTA 3FB9A 3OB9A 4M77E 1Q86U 4LDUA 3J7AF 2HD0A 2RB6A 2M16A 2D0QB 3TU4K 3CBPA 4ZTJA 4PNOA 3ZFJA 1Y7XA 5CIUA 1VQ4A 5GAOm 4HCBA 4EMKB 1G3YA 3P8DA 1D3BB 1NZ9A 1WPYA 2KSSA 3E1SA 4BB7A 4M7DF 2F5KA 1IZ6A 1VIEA 4M7AA 1VQ9T 2GFUA 2VGNA 3A5ZB 1LJOA 2E6ZA 2EJGA 3JCMQ 4TVRA 4J6YA 2KMTA 2OTLA 1M90U 4J7IA 5LJ3d 3JCMb 4KUIA 2XK0A 2DVEA 3OS0A 5GAN3 4M77B 2CYZB 3E19A 1WQ7A 3JCMf 3VV0A 2IVWA 3LLRA 4C92A 3FDRA 1NPRA 2GF7A 3A8HB 4A4KA 3OYEA 3L2ZA 4C92C 4C8QC 1JBMA 1YIJT 1XNIA 1NE8A 1FWZA 3X28B 4M78E 1YHQA 4JRQA 3QXEB 3QZ5B 4M77D 1WQWA 1H3ZA 1Y96B 2PQWA 3BFMA 3NTKA 4JDSA 3OS1A 3CCST 2E12A 2WSCE 4UC4A 4PJOF 2QQRA 1M1GA 1QVFS 4ELZC 3JB9D 1QVFA 4CRIA 4R55A 4BI4A 2JVVA 4FIBA 2JNGA 3JCMg 4XTZA 2RM4A 2ZPGB 1U8RA 5FLXE 2XDDA 4C5HA 3M55A 5GAN2 2P0QA 4MMKA 5GAMf 4F7UA 4M78B 1VQ9A 4BACA 3OYLA 3JCMh 4XTYA 1O75A 2DPPB 1BIAA 3MP1A 1B34B 1PSEA 2X4XA 3HHTB 1WJQA 4NL2A 3LWIA 2QI2A 3QJYA 2WACA 1DJ7B 1ZHIA 2B8AA 2JUFA 3QBYA 1N9RA 2EFIA 2DAQA 2ZCFB 2VUBA 3A8GB 3FIFA 4FT4A 4LDWA 4MZTA 3OYKA 1YITT 3V8JA 2DXBA 1KC8C 3CCET 4M78D 1N8RC 1WGSA 2Y4YA 4J6WA 5CQYA 3MP6A 3QDRB 5AYFA 4OGCA 1YIJA 5GAOq 3KUFA 4ATOA 5GAMg 2HQXA 1BI1A 3RMQA 4XQ3A 1VQMT 4M75D 2YLBA 4PJOC 3CCSA 3JB9G 1XOVA 3G4ST 4OP0A 4O6JA 1U1TA 3JSCA 2CKKA 5CK9A 2EQUA 5KH6A 1TH7A 3QPHA 5GAMh 3MEUA 4J8OA 4ME7A 2ZPBB 4IUQA 5GANj 3CCJA 1KQ1A 3C4SA 4C5GA 3RERA 4BY6B 1VQLT 3GNGA 2RO0A 3LH0A 4RCCA 3OYGA 1X6OA 1HK9A 4OB3B 4M7AD 3JCMW 3VU3C 2EJ9A 5GAOn 2RJCA 5LJ3e 1MGQA 3CPWS 4NS5A 4PL6A 3A8LB 4IURA 2K5LA 4Z02A 3CPWA 3MEVA 3HRUA 4E7IA 4EMGA 3L2UA 2EQJA 2RI5A 2M9UA 4QQDA 2RK2A 3FRNA 4XAXB 2HBPA 3CCEA 4A4EA 3CCVA 1OYXA 3J80E 3PGGA 4JUVA 4M75G 1OZ3A 2O4XA 1U1SA 3Q1JA 3ASKA 1W4SA 2VV5A 4OB1B 3WVDB 4EPCA 5GMKi 3HRSA 4QVDA 3GP8A 2E10A 4FSXA 1QP2A 2EWNA 2GFAA 1VIFA 5GMKj 2E1HA 1Q81C 1VQ7T 2VGMA 1LNXA 3G4SA 1NJIC 3M56A 1Y71A 2LX9A 3N5BB 1RI0A 2DXTA 4J7FA 3OYDA 3JCMV 3DB4A 1K73C 4XU1A 3O8VA 1FXXA 1YHQT 2EQKA 3M58A 4J6XA 5IT9E 1YJWA 3QG1A 2K2VA 3M4GA 4E7KA 3LGFA 5CKDA 3VKIA 2P4TA 1VQLA 2FYKA 1QP3A 4J83A 2WSFE 3SWNB 1YI2A 3RMSA 2FVUA 4FL6A 2QEXT 4M7AG 3LW5E 5HKCA 2A7YA 4XU2A 1M1FA 1BIBA 2R57A 4OB0B 4XTUA 5GANd 2BUDA 2E41A 2EKOA 5CVIA 2EYQA 1KC8U 3PIOA 4Y28E 3RUXA 2CZ0B 3KXTA 4OF1A 4N0AC 3GIBA 4LD6A 2RH2A 5LJ5j 3OY9A 3M57A 4E7JA 2PU9B 3DB3A 3SDZA 4C5IA 5GAOp 4HCCA 2M0OA 2V8KA 4IUUA 4JLIA 4X34A 2EJFA 3QJ6A 4C92G 4C8QG 5HK3A 2QTXA 3CC4T 4YTLA 4MMLA 2MI6A 1JRIA 1JB0E 3CPFA 2R5AA 2RJDA 2ZGWA 3RKWA 3OSVA 5FU7C 3OYNA 3V7RA 3DLLA 5FU6C 4C8QA 2RA2A 1VQ7A 3TEEA 5C0MA 3JB9I 1Y07A 3CD6T 3VYGA 4BI8B 3M9QA 4XK8E 2XDPA 1M9SA 5IN1A 1UB4A 3JCMJ 1SSFA 3PMTA 4CI0C 2ZZDA 3SD4A 4RG2A 2JOYA 4J5YA 3CCRA 3JCMP 5I2MA 1YJ9T 4XTVA 3SFMA 4IKFA 2V8JA 4L59A 4A4HA 4C0GA 3OS5A 3I56T 3G71T 1QVGS 4LD9K 2RHUA 4M75E 3RESA 2QEXA 1QVGA 1QVPA 4F7UG 3J81E 4M7DA 5C6SA 3CCMT 3QZ9B 4OVAA 3UT1A 4M7DC 4II1A 5GANf 3CCJT 1WJRA 3NFCA 3UDCA 4C0DB 3A8OB 1S72A 2RI3A 4IUTA 2IG0A 1UGSB 2ZPHB 3G7ZA 5L8RE 2O4XB 1PSFA 2QQSA 4X9DA 3CC2T 1M1KC 5KE3A 3OYHA 3EFSA 1I8FA 2P0PA 3PNWC 1Q81U 5FRMA 3MO8A 3CC4A 2RK1A 5LJ3f 1BI2A 2DTIA 3L2QA 4RCBA 3E9GA 4KUDK 2R5MA 3JCMX 3OQ5A 4M7AE 3CCVT 3QIIA 4M77F 4PJOG 3OYIA 3JB9J 1VQNT 2DK3A 3JB9H 4M75B 3C94A 3TREA 3WXMB 5GANg 4HCZA 4ZN1A 1YJNT 2LVMA 2XDBA 3CD6A 1VQPT 2Y4XA 2LDMA 5A0LA 3JB9F 4JRPA 4PJOA 4PLLA 3GOXA 1G5VA 4PLIA 4E7HA 1KD1C 2X4WA 1VQKT 2JN0A 4C5EA 1VUBA 4LDYA 3V7SA 5GANh 1YJ9A 4C92E 4C8QE 5CR2A 3QHSA 2OTJA 1X75C 3X25B 3I56A 3G71A 4JJNK 2O01E 4X9CA 3UPUA 5GANe 5LJ3g 3HRTA 4VUBA 1VQPA 1BI0A 1G3TA 2BKDN 2R58A 3F70A 4QQGA 4M7AB 4A53A 3CCMA 5GMKm 1YJWT 3CCLA 3KBGA 2K3XA 4WF2A 3OYAA 4NL3A 2A3LA 2MWOA 5CQXA 2D6FA 2KQWA 5A0DA 1K9MC 2RHIA 5LJ3h 2XKOC 1YI2T 5GAN6 4MDXA 3QO3A 3VUBA 4DA4A 3HL8A 2LT1A 1FX7A 4N4HA 3CC2A 2LCCA 1G3SA 3PFSA 5D6YA 4M78F 4JLGA 4N4IA 4C8QB 4OMFB 4C92B 4E7LA 5M9OA 1KD1U 1VQ5T 1EIFA 2K4YA 3PMIA 1N9SA 3QYGB 4M77A 2CS7A 2EQMA 4V2SA 5J26A 4HKEA 5LJ5f 3CC7T 3BW1A 4M77C 3CBOA 2MWPA 4F7UE 4BE2A 5J3BA 4M75F 3M54A 3L1AA 4GLKA 3RKXA 5GMKh 1VQNA 2E64A 2OAUA 4KT0E 2ZPIB 3M59A 1YJNA 4IUVA 5GMKe 5GAMj 4C92D 4C8QD 5IAYA 3M5AA 1IREB 3MP8A 1Y96A 2X4JA 4GY5A 2GQVA 3SB2A 1VQKA 2I2LA 2F5TX 2E5QA 2EAYA 3X26B 1K8AC 1V29B 2XHCA 3JCMc 2QQAA 3OYFA 3LGLA 4A4GA 2L5QA 4D6WA 4F7UB 2RD1A 3DKMA 5LJ5g 5D6WA 2DXUA 1XTDA 4OB2B 2PUOB 3EAEA 5CKFA 5HK0A 5DM7R 1M5Q1 4O5VA 5A0GA 3CCRT 4PJOE 2BIVA 2HAXA 3L42A 4BDYA 4M7AF 3QKJA 4E47A 2DTOA 1Q82C 5FROA 2RHXA 3H8ZA 3JCMd 3HP9A 1NPPA 5LJ5h 3HKSA 4M78C 4NOYA 4QVCA 1B34A 2C06A 2ZPEB 2LQ8A 2DIGA 4HA8A 1WJSA 2CZ1B 3UWNA 3NTHA 5GAN7 5LJ5e 3S3NA 1VQ5A 1KHCA 4RMOA 4N0AA 2F69A 3E9FA 1N8RU 3I55A 2PVDB 1S72T 1KQ2A 3ME9A 4M75C 3CC7A 4EMKC 3CXCS 3OW2A 4N4GA 3CXCA 3OW2S 5I21A 3L2RA 4MDWA 2LTOA 4PJOB 3MEAA 2QQBA 3MCAB 2KAFA 4IUPA 2MF2A 4Y91A 4OGEA 4L5GA 3HSBA 4LDXA 1HXDA 4EMHA 3LWHA 2G3RA 3ER0A 3H6ZA 4RKUE 4ZGJB 3VUZA 2E6NA 4RG8A 3WVEB 5J39A 2PVGB 2PUKB 2XI9A 4XTXA 3RKYA 1UGQB 5CAIA 2MMPA 4C0FA 5D6XA 3PT9A 1YBYA 3AHUA 3QSUA 4R56A 4JS4A 5GAOr 3PIPA 2QDYB 2M1HA 3ZEHA 1KQSS 3VYHB 1W2BS 1KQSA 3HFOA 4PJOD 1W2BA 3FLGA 5GAMd 4HT9A 4EDUA 2JTMA 2JZ2A 3CCUT 3LX7A 3BDLA 2V8IA 3GF5A 3CCQA 1K9MU 3CMAT 3P8BB 4M7AC 4M7DG 1OI1A 1XQHA 4F7UF 2OTJT 2LRQA 2X4YA 1MHNA 3META 1Q7YC 4BY6C 3OMCA 4ZTFA 5CKBA 4B9WA 4DOWA 3CCLT 2DTHA 2QA4A 1VQOA 2DD5A 1GXIE 1X01A 4MZMA 3GLXA 5HY6A 2XG8D 4ELYC 3QYHB 3S3MA 1I5LA 2DXCA 1VQ6A 2FB7A 1M8VA 2DO3A 4A54A 5DY9A 2DZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 G;  4M7A B;  4A53 A;  1U1S A;  1D3B B;  5GMK i;  1WPY A;  5GMK m;  4M7D F;  2DKG A;  4QVD A;  2E10 A;  2CGH A;  2K57 A;  4M7A A;  4WF2 A;  2EWN A;  4XU0 A;  5GMK j;  2E1H A;  4NL3 A;  1LJO A;  5GAO l;  2EJG A;  1LNX A;  3JCM Q;  5LJ3 h;  4J6Y A;  5GAN 6;  3QO3 A;  5GAN 4;  2DXT A;  3JCM V;  5LJ3 d;  3JCM b;  2DVE A;  4XU1 A;  5GAN 3;  4M77 B;  4HT8 A;  4J6X A;  4M78 F;  4C92 B;  4C8Q B;  1WQ7 A;  3JCM f;  4M7A D;  3M4G A;  1N9S A;  4M77 A;  4V2S A;  4C92 A;  2VC8 A;  4JRI A;  2FYK A;  3EFR A;  3BW1 A;  4M77 C;  5LJ5 f;  3L2Z A;  4C92 C;  3SWN B;  4C8Q C;  4F7U E;  4M7A E;  1JBM A;  4M75 F;  3JCM e;  4M7A G;  3L1A A;  1YCY A;  1LOJ A;  4XU2 A;  3RKX A;  3SWN A;  5GMK h;  2E64 A;  1BIB A;  4M78 E;  4XTU A;  5GAN d;  2E41 A;  4M77 D;  1WQW A;  3SWN C;  5GMK e;  5GAM j;  1Y96 B;  4C8Q D;  4C92 D;  5GAN 5;  3BFM A;  3RUX A;  3V8L A;  4XTW A;  4N0A C;  3GIB A;  5LJ5 j;  1D3B A;  3BDU A;  4PJO F;  1Y96 A;  3SB2 A;  5GAO p;  2I2L A;  3JB9 D;  4JLI A;  2EJF A;  4M77 G;  2EAY A;  3JCM g;  4XTZ A;  2RM4 A;  4C8Q G;  4C92 G;  3JCM c;  2QTX A;  5GAN 2;  2VXF A;  4F7U B;  2E65 A;  2RD1 A;  4M7D E;  5LJ5 g;  2DXU A;  4MML A;  1JRI A;  4MMK A;  3RKW A;  2ZGW A;  1M5Q 1;  4F7U A;  4M78 B;  5GAM f;  4PJO E;  3V7R A;  4C8Q A;  4M7A F;  2RA2 A;  3JCM h;  4XTY A;  1BIA A;  1B34 B;  2DTO A;  3JB9 I;  3JCM d;  2DEQ A;  4NL2 A;  5LJ5 h;  4NOY A;  4M78 C;  4QVC A;  5GAM e;  1B34 A;  3HFN A;  4M75 B;  4HA8 A;  4EMK B;  1N9R A;  5LJ5 d;  5GAN 7;  3FIF A;  5LJ5 e;  3JCM J;  1I4K 1;  4N0A A;  3V8J A;  4J5Y A;  3JCM P;  1KQ2 A;  4M78 D;  4XTV A;  4M75 C;  4M7D B;  4EMK C;  4J6W A;  5I21 A;  4M75 E;  3RES A;  2Y90 A;  1I81 A;  1WNL A;  4PJO B;  4F7U G;  4M7D A;  5GAO q;  4Y91 A;  5LJ3 j;  5GAM g;  5GAN 8;  3HSB A;  4M7D C;  1HXD A;  4XQ3 A;  4M75 D;  4M78 G;  4EMH A;  5GAN f;  3V8K A;  2YLB A;  4PJO C;  4XTX A;  3RKY A;  3JB9 G;  2YLC A;  4JRK A;  3FJP A;  4OP0 A;  5CAI A;  1U1T A;  3AHU A;  3QSU A;  5GAO r;  4M7D D;  5GAM h;  1TH7 A;  4M78 A;  4X9D A;  4DQ2 A;  4PJO D;  3HFO A;  3RIR A;  5GAM d;  3EFS A;  1I8F A;  4X9C A;  4XU3 A;  4HT9 A;  2VXE A;  5GAN j;  1KQ1 A;  5LJ3 f;  3RER A;  2DTI A;  4M7A C;  4RCB A;  4RCC A;  4M7D G;  1HK9 A;  4M75 A;  4EMK A;  3INZ A;  5GMK l;  3JCM X;  3JCM W;  2HNI A;  4PJO G;  4M77 F;  4F7U F;  3JB9 J;  3VU3 C;  2EJ9 A;  5GAO n;  4C92 F;  4C8Q F;  3JB9 H;  5LJ3 e;  1MGQ A;  5GAN g;  2DJZ A;  1H64 1;  3QUI A;  5GAO m;  2DTH A;  3JB9 F;  4EMG A;  4PJO A;  3V7C A;  2DZC A;  1X01 A;  3BY7 A;  2YHT A;  2JN0 A;  3FB9 A;  4M77 E;  3V7S A;  5GAN h;  1I5L A;  4C92 E;  2RB6 A;  4C8Q E;  3QHS A;  2FB7 A;  3PGG A;  1M8V A;  4JUV A;  4PNO A;  4A54 A;  5GAN e;  5LJ3 g;  5DY9 A;  2DZ9 A; 
#chains in the Genus database with same CATH topology
 3L2V A;  2DKG A;  1N6A A;  4AG2 C;  3VJP A;  3S6W A;  2L3R A;  4GLM A;  5GAO l;  1NJI U;  2LMJ A;  2YDL A;  1K73 U;  4PK4 A;  1GCP A;  1MNE A;  3CCV Q;  2PTK A;  2RJE A;  5CO7 A;  3VS0 A;  1YJN Q;  3CMA A;  4JRI A;  1VQ8 T;  1OZ2 A;  2YT6 A;  2K3Y A;  3NHN A;  3JRZ A;  1YP5 A;  1VQK Q;  3NTI A;  4D8K A;  1LOJ A;  1YCY A;  4XTW A;  1PRL C;  3BDU A;  4A4F A;  3M53 A;  3OYM A;  2LCL A;  2DIQ A;  5KCO A;  1BKB A;  3REA B;  1R8O B;  1M3C A;  2E65 A;  4LDV A;  2E3I A;  1SHG A;  3CBM A;  4DEX A;  2L89 A;  2LC4 A;  3HFN A;  3OSS C;  2D8H A;  4RTW A;  2CSI A;  2JXB A;  3A8M B;  2YWW A;  1Y0M A;  1GFD A;  1W1F A;  2FO0 A;  2DER A;  3SEM A;  3P8H A;  3RR6 A;  1QW1 A;  1WNL A;  4FT2 A;  1VQ4 T;  1WHL A;  2AKK A;  3TSZ A;  4M78 G;  3OA6 A;  3V8K A;  1AWW A;  2YLC A;  4JRK A;  3FJP A;  4RTY A;  5DLO A;  4ZGE B;  4PKC C;  1N8R R;  2AZS A;  4J9H A;  5KCH A;  2LQK A;  1MV0 B;  1A0N B;  1VQO Q;  2F1L A;  1KG1 A;  1UDL A;  1WIE A;  1VQ6 Q;  5EG2 A;  1RI9 A;  2DJZ A;  5CKE A;  2K6D A;  2ED0 A;  3TCJ A;  3L2W A;  2YHT A;  3OB9 A;  2GQI A;  5IHK A;  2D0Q B;  3I5S A;  1Y7X A;  1UJY A;  2MIO A;  3P8D A;  1D3B B;  4M7A A;  2L0A A;  2VAS A;  3CMA Q;  2COW A;  2KMT A;  4JJC A;  2DVE A;  1VOM A;  1WQ7 A;  1K0S A;  1N5Z A;  1NPR A;  4A4K A;  2JMA A;  1XNI A;  4M78 E;  1YHQ A;  2VWF A;  4FYY B;  1UGV A;  1NJI R;  2KGT A;  1Y96 B;  4HVU A;  3GBQ A;  1K73 R;  3NTK A;  1MND A;  2HMA A;  4CRI A;  4R55 A;  2JVV A;  1X2Q A;  4LNP A;  2ZPG B;  1M27 C;  1ZUU A;  5FLX E;  3M55 A;  2O88 A;  1GFC A;  4MMK A;  2YRC A;  5GAM f;  4BAC A;  2EQI A;  3OYL A;  4XTY A;  1PSE A;  1WA7 A;  3VS5 A;  3EG3 A;  2YUO A;  3LWI A;  1N9R A;  2KI7 A;  2DAQ A;  4FT4 A;  4LDW A;  3OYK A;  3V8J A;  2DXB A;  4M78 D;  1K0X A;  5CQY A;  3QDR B;  5AYF A;  1YIJ A;  2DA9 A;  3KUF A;  4ATO A;  1BCO A;  5GAM g;  3RMQ A;  4XQ3 A;  4M75 D;  1MUZ A;  1UHC A;  3EHR A;  3G4S T;  1U1T A;  2ATC B;  4J9C A;  1D0Y A;  5KYY B;  4J8O A;  5I22 A;  2ZPB B;  3C4S A;  3RER A;  1NYG A;  2JW4 A;  3LH0 A;  4RCC A;  3VU3 C;  1TSF A;  2QAZ A;  3A8L B;  4IUR A;  2K5L A;  3CPW A;  3MEV A;  4EMG A;  2RI5 A;  1HSQ A;  1UEC A;  3CXC P;  1B3Q A;  4JUV A;  2HBW A;  1U1S A;  1W4S A;  2AKL A;  3ZL7 C;  2OJ2 A;  2LZ6 B;  2EWN A;  5GMK j;  2E1H A;  2P84 A;  1LNX A;  3M56 A;  5FWC A;  3DB4 A;  4J9D A;  4XU1 A;  1W2B P;  4F14 A;  1UHF A;  3H0F A;  2K2V A;  5CKD A;  2FYK A;  1NBE B;  2CT4 A;  3SWN B;  2DL4 A;  3RMS A;  3A1P A;  1HJD A;  4M7A G;  2A7Y A;  1TS9 A;  4KH1 B;  2R57 A;  1M2V B;  2E41 A;  2M0Y A;  2NUP A;  1KC8 U;  1AWJ A;  4Y28 E;  2KEA A;  1X27 A;  3GIB A;  2KRS A;  5GAO p;  1I07 A;  4HCC A;  2V8K A;  4JLI A;  2HSP A;  2QTX A;  1JB0 E;  3DLL A;  1ZSZ A;  3V7R A;  4C8Q A;  5FW9 A;  1Y07 A;  2LP5 A;  2GTO A;  3I35 A;  3EG0 A;  3CD6 T;  1YIJ Q;  3M9Q A;  4JPB W;  3JCM J;  3PMT A;  2ZZD A;  4RG2 A;  1UG1 A;  2JOY A;  3G1J A;  4J5Y A;  4WCI A;  3JCM P;  1AZE A;  4IKF A;  3OS5 A;  1TUG B;  4Z88 A;  3RES A;  2QEX A;  2CSQ A;  4M7D A;  4FYV B;  1ZA1 B;  3QZ9 B;  1UTI A;  2BE7 D;  4II1 A;  3H41 A;  3EG9 B;  2YSQ A;  3NFC A;  1S72 A;  1U06 A;  2ZPH B;  1M1K C;  2RK1 A;  2DBM A;  1BI2 A;  2R5M A;  3OQ5 A;  4M7A E;  3CCV T;  1WDX A;  4CC2 A;  2QAS A;  1IB8 A;  1YJN T;  2LDM A;  4PJO A;  4AMC A;  1GCQ A;  4PLL A;  1S1N A;  4PLI A;  1PNJ A;  5KYX A;  1VQK T;  3X25 B;  4JJB A;  3HRT A;  2BKD N;  3F70 A;  1RLP C;  2GBQ A;  1NLO C;  3OYA A;  1YCS B;  3EGU A;  1EX4 A;  5CQX A;  2KQW A;  5KYW B;  1NEG A;  3VUB A;  2K7A A;  5D6Y A;  4N4I A;  4M7A D;  4DBF A;  2K4Y A;  5IHN A;  4PFO A;  1IO6 A;  5J26 A;  2JM9 A;  2BZX A;  3L1A A;  5GMK h;  2OAU A;  4KT0 E;  2X3X D;  3M59 A;  1PWT A;  2IIM A;  5IAY A;  3M5A A;  4GY5 A;  2GQV A;  4CC3 A;  2EAY A;  2XHC A;  2QQA A;  4A4G A;  2L5Q A;  1K9A A;  4OB2 B;  3EG2 A;  3L42 A;  1OX8 A;  3VS2 A;  2QEX Q;  2ZPE B;  2FZC B;  2LQ8 A;  1KHC A;  4ANJ A;  4N0A A;  1X43 A;  2DEU A;  3CC7 A;  3CXC A;  4CC7 A;  3MEA A;  2KAF A;  4Y91 A;  1HXD A;  4EMH A;  3ER0 A;  3VUZ A;  2E6N A;  5J39 A;  2XI9 A;  3RKY A;  2RN8 A;  4JS4 A;  5D7U A;  1KQS S;  2G6F X;  3HFO A;  1W2B A;  1JXO A;  4PJJ A;  5IXB A;  3LX7 A;  3GF5 A;  3CCQ A;  1K9M U;  1PG5 B;  4PJL A;  3CMA T;  4M7D G;  1Z9Z A;  1OI1 A;  1H3H A;  1E6H A;  1C1A A;  4F7U F;  3OMC A;  4CC4 B;  2DD5 A;  1OU8 A;  4RTX A;  3THK A;  1GXI E;  1EZZ B;  4MZM A;  5HY6 A;  1OUL A;  3QYH B;  3TVT A;  2EBP A;  1TUD A;  2FL7 A;  3X24 B;  2CUD A;  1KFZ A;  1RL2 A;  4XU0 A;  1ABQ A;  2C0I A;  2P0K A;  2HQE A;  2KXD A;  2K79 A;  4OML A;  2XIC A;  1TOV A;  2XID A;  2DNU A;  3CCU A;  2XMF A;  2VC8 A;  1Q82 U;  3EFR A;  4KBM B;  1G3W A;  3OMG A;  2RHY A;  2RI2 A;  2NUT B;  2QG9 B;  2QK0 A;  4E6R A;  3SWN C;  5GAN 5;  3V8L A;  4KUL A;  4KGX B;  2KVQ G;  2GCX A;  3R6O A;  1FYN A;  2DF6 A;  1PCX A;  2DET A;  3OBW A;  3OBY A;  5FU7 B;  2ZPF B;  2VXF A;  2V26 A;  4M7D E;  1NEB A;  2CZ6 B;  2MCN A;  4DOV A;  1ZA2 B;  1JQQ A;  1M8M A;  1I1J A;  4KRT A;  3CC7 Q;  3FEO A;  1WI7 A;  2D9T A;  2DEQ A;  5LL6 S;  3M4Y A;  4BE1 A;  3GPL A;  1UGP B;  2RJF A;  2KE9 A;  1M4Z A;  2CZ7 B;  4BDZ A;  2EGE A;  2VKN A;  4E2F B;  3URG A;  3AT1 B;  2Y90 A;  5FRN A;  1WHH A;  2VYT A;  1P92 A;  1LCK A;  5LJ3 j;  4JS5 A;  1YIT A;  3HPW A;  1JEG A;  2K5I A;  3CCQ Q;  3G6E A;  3PTA A;  3CCR Q;  1M1K U;  4M7D D;  4M78 A;  2LT4 A;  4DQ2 A;  5I2S A;  3RIR A;  1UGR B;  4FYW B;  4XU3 A;  1VQM A;  2VXE A;  2QA4 T;  3EFO A;  4IIM A;  1ZQ1 A;  4M75 A;  1WXT A;  2HNI A;  3EGX B;  2JTE A;  4BE0 A;  3C12 A;  3LYI A;  2LQW A;  1D1A A;  1KSW A;  2EIF A;  2A08 A;  1RUW A;  2FPE A;  1T0J A;  4FYX B;  3BY7 A;  4WTO B;  2VVK A;  1H92 A;  2L3Q A;  1U3O A;  4ZTJ A;  1K9M R;  4PNO A;  3ZFJ A;  4HCB A;  2EYY A;  1G3Y A;  3E1S A;  4RTU A;  3KFV A;  4BB7 A;  2F5K A;  3A5Z B;  3CCU Q;  3JCM Q;  2KRN A;  2OTL A;  1IHW A;  2DL3 A;  2PZ1 A;  2RF0 A;  1M90 U;  3OS0 A;  2XK0 A;  5GAN 3;  4M77 B;  4E7Z A;  3E19 A;  1UFF A;  4OMQ A;  3VV0 A;  1BBZ A;  1WHJ A;  4KGV B;  4F04 B;  3OYE A;  1TTH B;  1YIJ T;  2CP6 A;  4DBR A;  1W70 A;  2E12 A;  1M1G A;  1OPK A;  1JJ2 P;  3JB9 D;  5KYU A;  4BI4 A;  4FIB A;  2XDD A;  4C5H A;  2LJ0 A;  2FRY A;  2P0Q A;  1VQ9 A;  4AT1 B;  1B34 B;  2X4X A;  2RQW A;  3QJY A;  2HZY A;  2M51 A;  3A8G B;  5LJ5 d;  3FIF A;  2VUB A;  2BZ8 A;  1T0H A;  1YIT Q;  1I0C A;  1KC8 C;  2Y4Y A;  3G6E Q;  4OGC A;  2CH4 A;  3CQT A;  5GAO q;  2JM8 A;  2O31 A;  2YLB A;  4Z89 A;  3CCS A;  4LXC A;  4OP0 A;  2CKK A;  3I55 Q;  5KH6 A;  1TH7 A;  3MEU A;  1VYU A;  5GAN j;  3CCJ A;  1KQ1 A;  2EGA A;  3GNG A;  1G2B A;  3OYG A;  1HK9 A;  4OB3 B;  1RAI B;  2RJC A;  4KGZ B;  4ESR A;  3HRU A;  1M1K R;  4QQD A;  2RK2 A;  3MPU B;  2RQR A;  3CCE A;  4FCY A;  1KIK A;  2OTL Q;  3A98 A;  4M75 G;  5GMK i;  2VV5 A;  4EPC A;  4QVD A;  3GP8 A;  2E10 A;  4FSX A;  1QP2 A;  2HL3 A;  1AZG B;  2VGM A;  4FSS A;  3N5B B;  2DL7 A;  2LX9 A;  3JCM V;  1KQS P;  1AWO A;  1FXX A;  2EQK A;  1YJW A;  3QG1 A;  3M4G A;  3LGF A;  2P4T A;  1VQL A;  1UE9 A;  1QP3 A;  3VS6 A;  1IRX A;  1YI2 A;  2FVU A;  4FL6 A;  2QEX T;  1M1F A;  3FJ5 A;  2BUD A;  2EKO A;  1QQJ A;  2EYQ A;  3PIO A;  1OOT A;  3RUX A;  2CZ0 B;  4OF1 A;  2O2O A;  5LJ5 j;  3M57 A;  2PU9 B;  3DB3 A;  8ATC B;  4C5I A;  1VQ9 Q;  4IUU A;  4X34 A;  3QJ6 A;  5HK3 A;  1R77 A;  3M0S A;  3RKW A;  2R5A A;  2ZGW A;  2K9G A;  5FU7 C;  1D1B A;  5C0M A;  3JB9 I;  4FW2 A;  3RNJ A;  3NGP A;  4XK8 E;  1E7O A;  1UB4 A;  5I2M A;  1OV3 A;  2V8J A;  3CCS Q;  1F1B B;  4M75 E;  1QVP A;  2F2W A;  3VS1 A;  2A36 A;  3A8O B;  1NYF A;  5L8R E;  3PE0 A;  2DIL A;  3OYH A;  1T3S A;  5FRM A;  1Q81 U;  4RCB A;  3E9G A;  1V1C A;  1FMV A;  3QII A;  4M77 F;  3JB9 J;  3CCE Q;  2DK3 A;  3JB9 H;  2LX7 A;  2LVM A;  1JO8 A;  1VQP T;  4JRP A;  4F16 A;  1PC0 A;  2X4W A;  1YJ9 A;  5GAN h;  2OTJ A;  2NUP B;  3G71 A;  4JJN K;  1W6X A;  2HEQ A;  1BI0 A;  4QQG A;  1VA7 A;  3CCL A;  1WLP B;  3KBG A;  1YJW Q;  4HXJ A;  2A3L A;  4PJM A;  2MWO A;  1K9M C;  1WXB A;  1VQL Q;  5GAN 6;  4DA4 A;  1MMN A;  3CC2 A;  1CKA A;  1PD0 A;  1ZSZ B;  2LCC A;  1KD1 U;  4E7L A;  4C92 B;  4C8Q B;  4OMF B;  1OEB A;  1N9S A;  3QYG B;  2CS7 A;  3CC7 T;  3BW1 A;  2O9S A;  4M77 C;  3CBO A;  2CP7 A;  2MWP A;  4JZ4 A;  4OMM A;  4GLK A;  2EKH A;  3M0U A;  3E2U A;  5GMK e;  5GAM j;  1CKB A;  3MP8 A;  1Y96 A;  1M30 A;  3SB2 A;  1UJ0 A;  1JXM A;  1AT1 B;  2BE9 B;  4F7U B;  1YHQ Q;  3EAE A;  2L2P A;  1SPK A;  1M5Q 1;  3CCR T;  2HAX A;  4M7A F;  2DTO A;  1Q82 C;  3JCM d;  5LJ5 h;  4NOY A;  2X9H A;  3UWN A;  1WJS A;  5GAN 7;  3VS4 A;  1VQ5 A;  2RQT A;  3E9F A;  3OW2 S;  2ESW A;  5HCK A;  2LTO A;  4PJO B;  4IUP A;  5IH2 A;  5KYX B;  4L5G A;  3HSB A;  1NG2 A;  4RG8 A;  3WVE B;  2RQU A;  3REB B;  3U23 A;  1UGQ B;  4C0F A;  2E3H A;  4HCK A;  3QSU A;  4R56 A;  5GAO r;  3PIP A;  2QDY B;  4J9F A;  3VYH B;  1KQS A;  2D1X A;  4HT9 A;  3CCU T;  4PFZ A;  4M7A C;  1B7T A;  1YJ9 Q;  2OTJ Q;  4J9I A;  3G71 Q;  5CKB A;  4DOW A;  1X01 A;  5ECA A;  4ELY C;  1I5L A;  1Q81 R;  2FB7 A;  3H0H A;  1R0B G;  1KHI A;  3OYY A;  1JU5 C;  2QXF A;  3CC2 Q;  3VS7 A;  2K57 A;  2E70 A;  1K8A U;  2DFU A;  4MZP A;  1MMG A;  4J9B A;  2FHD A;  2F2V A;  2RHZ A;  2PVO B;  1SHF A;  1BI3 A;  4QQ6 A;  4HVW A;  1D09 B;  2QQ9 A;  3S3O A;  1CSK A;  4DBH A;  1JJ2 S;  3JCM e;  1RAF B;  1ZBX A;  1BYM A;  4RTT A;  3SWN A;  2KK4 A;  2AHJ B;  2KDS A;  1K4U S;  2OAW A;  2JJ9 A;  4AFS C;  3G6E T;  2CT3 A;  2KT1 A;  3EGD A;  3NMZ C;  4BUG A;  1KD1 R;  3NPF A;  5GJV B;  1M90 C;  2CP2 A;  5CCA A;  4OMO A;  2CRE A;  1VQ5 Q;  2V1Q A;  3I55 T;  1AWX A;  2WSE E;  3EHQ A;  2MAM A;  1M2O A;  3IQL A;  4M4Z A;  4PFP A;  1RAB B;  2HKQ B;  2AZV A;  1YWP A;  2EW3 A;  4QW2 A;  3CME A;  1Q7Y U;  3D7S B;  2I0N A;  1I81 A;  4Q5W A;  2XU8 A;  3UA6 A;  2H3J A;  1WYX A;  2A37 A;  4P5N A;  5I11 A;  3OYJ A;  3EG9 A;  4RTZ A;  2OTL T;  4J9E A;  1KC8 R;  2IPO B;  2QGG A;  1VQO T;  2DJQ A;  4QVZ A;  1B07 A;  1UEB A;  4EMK A;  5A2Q E;  5GMK l;  1VQ6 T;  4ZN3 A;  1IXD A;  3MHX A;  4AG1 C;  1S72 Q;  2RNA A;  4C92 F;  4C8Q F;  1AEY A;  3ZBD A;  2DL8 A;  2GGR A;  1SRM A;  1H64 1;  3QUI A;  3DLM A;  2DZC A;  5AT1 B;  1Q86 U;  3J7A F;  2AIR B;  2LCS A;  2HD0 A;  2RB6 A;  3TU4 K;  2JMC A;  3CBP A;  2CP0 A;  1WPY A;  4M7D F;  1IZ6 A;  1VQ9 T;  2GFU A;  1TWB A;  2VGN A;  1LJO A;  2E6Z A;  2EJG A;  4J7I A;  5LJ3 d;  3JCM b;  4KUI A;  1G8X A;  1SF9 A;  1WHM A;  3LLR A;  3MJX A;  3FDR A;  1ZSZ C;  4C92 C;  4C8Q C;  1FWZ A;  3X28 B;  4JRQ A;  3QXE B;  1XJW B;  1D0X A;  3QZ5 B;  1H3Z A;  2LJ3 A;  4JDS A;  3OS1 A;  3CCS T;  4PJO F;  2P4R A;  4GBQ A;  1QVF S;  2A28 A;  2EYW A;  2JNG A;  2QGF B;  2RM4 A;  1U8R A;  1TG0 A;  5GAN 2;  1ZUY A;  4M78 B;  3EH1 A;  3JCM h;  1O75 A;  3CME Q;  1IHV A;  3HHT B;  1GBR A;  1WJQ A;  4NL2 A;  2QI2 A;  2B8A A;  2JUF A;  1RLQ C;  4M75 B;  2EFI A;  4MZT A;  1FMK A;  3CCE T;  1WGS A;  4J6W A;  1X69 A;  3MP6 A;  2HQX A;  1GRI A;  4PJO C;  3LH5 A;  1GCQ C;  3JB9 G;  1XOV A;  4O6J A;  1LPL A;  5CK9 A;  4IUQ A;  2HDA A;  1PHT A;  4C5G A;  5IXF A;  4BY6 B;  1VQL T;  2RQV A;  2RO0 A;  4DEY A;  3JCM W;  2ECZ A;  1MMA A;  5LJ3 e;  4JZ3 A;  2YRD A;  4NS5 A;  4PL6 A;  4Z02 A;  2JS2 A;  2QTV A;  3L2U A;  4A4E A;  3CCV A;  3OW2 P;  1OYX A;  4FW1 A;  2HL5 C;  3PGG A;  2YUP A;  2O4X A;  2HSE B;  3ASK A;  3WVD B;  3OYB A;  2KYB A;  5KYU B;  2LQN A;  2GFA A;  1VIF A;  1Q81 C;  2X51 A;  2KRM A;  2FPF A;  1Y71 A;  3OYD A;  4J7F A;  3O8V A;  1QCN A;  1YHQ T;  4J6X A;  1Q86 R;  4E7K A;  2K2M A;  4J83 A;  2WSF E;  2BTT A;  5HKC A;  4XU2 A;  1BIB A;  1KJW A;  4OB0 B;  5GAN d;  2FZG B;  1YN8 A;  2J7I A;  3KXT A;  4N0A C;  4LD6 A;  2RH2 A;  2DM1 A;  3OY9 A;  4E7J A;  1RAD B;  1X2K A;  2EJF A;  2EGC A;  2MYS A;  4MML A;  1ZUK A;  2MI6 A;  1KD1 C;  4K11 A;  3OYN A;  3OSV A;  4HVV A;  2ED1 A;  2RA2 A;  1PKT A;  1VQ7 A;  2O9V A;  2KYM A;  2J06 A;  2FEI A;  4ZNX A;  5IN1 A;  1M3B A;  1YJ9 T;  4L59 A;  4C0G A;  3G71 T;  2CDT A;  1QVG S;  2RHU A;  1VYT A;  3J81 E;  5C6S A;  1BK2 A;  3UA7 A;  1Q82 R;  5GAN f;  5KYN A;  3UDC A;  4C0D B;  1D1C A;  2RI3 A;  2IG0 A;  3G7Z A;  4AFU C;  2QQS A;  4Z8A A;  4X9D A;  1M3A A;  3CC2 T;  3PVL A;  1I8F A;  2P0P A;  3CC4 A;  4IIO A;  3L2Q A;  1OPL A;  1RAG B;  1SRL A;  4KUD K;  2LNH B;  3M0Q A;  3C94 A;  3TRE A;  3WXM B;  3EGX A;  3O5Z A;  6AT1 B;  4HCZ A;  5GAN g;  1EFN A;  2XDB A;  5A0L A;  4J9G A;  1VQM Q;  1G5V A;  4C5E A;  8AT1 B;  4LDY A;  5CR2 A;  3QHS A;  1C6V X;  1X75 C;  3I56 A;  3CPW P;  4X9C A;  5GAN e;  4VUB A;  1G3T A;  1QKW A;  2PNI A;  4M7A B;  4A53 A;  3CCM A;  1ABO A;  5GMK m;  2OX7 A;  4AFQ C;  2K3X A;  2Z0W A;  4WF2 A;  1K1Z A;  2DL5 A;  2D6F A;  1ZLM A;  5LJ3 h;  3QO3 A;  1PRM C;  1QCO A;  2LT1 A;  3HL8 A;  3VRZ A;  2ZAE A;  4N4H A;  2L3S A;  4M78 F;  1VQ5 T;  4LUE A;  1EIF A;  1LVK A;  4M77 A;  2EQM A;  4V2S A;  2VB6 A;  4HKE A;  5LJ5 f;  3EH2 A;  1TU0 B;  4M75 F;  3M54 A;  5J3B A;  4E7S A;  4KH0 B;  3RKX A;  1VQN A;  1OQK A;  4LN2 A;  2CH4 W;  2L3P A;  4RTV A;  4F17 A;  2I2L A;  2DVJ A;  1VQ7 Q;  2F5T X;  2J6K A;  1K8A C;  3OYF A;  4OMP A;  3LGL A;  4D6W A;  4B6M A;  2DBK A;  5LJ5 g;  5D6W A;  5CKF A;  2PUO B;  5HK0 A;  2BIV A;  4BDY A;  3QKJ A;  2RHX A;  3HP9 A;  1NPP A;  2DRK A;  4M78 C;  2OI3 A;  4QVC A;  1B34 A;  2C06 A;  2DIG A;  5LJ5 e;  2F69 A;  1S72 T;  1M90 R;  1PM3 A;  4M75 C;  3OW2 A;  5I21 A;  3L2R A;  2HKN A;  4QKU A;  1K76 A;  1RAC B;  2E4H A;  2EYX A;  4OGE A;  4LDX A;  2G3R A;  3H6Z A;  4ZGJ B;  4RKU E;  3CC4 Q;  2PVG B;  2PUK B;  4XTX A;  5CAI A;  5D6X A;  1QVF P;  1YBY A;  3AHU A;  2M1H A;  3FLG A;  5GAM d;  4EDU A;  1Q95 G;  2HCK A;  3BDL A;  2V8I A;  3P8B B;  2KNB B;  2MPX C;  1MHN A;  1Q7Y C;  4BY6 C;  2JT4 A;  3I56 Q;  3ULR B;  4B9W A;  2QA4 A;  2DTH A;  4A63 B;  3CCM Q;  1QLY A;  2B86 A;  1H8K A;  3GLX A;  3CCJ Q;  2XG8 D;  3S3M A;  4QT7 A;  5L23 A;  2DO3 A;  4A54 A;  5DY9 A;  3X20 B;  2F2X A;  2CGH A;  5DLQ E;  2ABL A;  3JAM E;  1N27 A;  5GAN 4;  3RBB B;  4HT8 A;  4B9X A;  1VQN Q;  5CKH A;  2JTF A;  3CME T;  4BD3 A;  2SRC A;  2LNV A;  3BE3 A;  1YNZ A;  2J6O A;  1JJ2 A;  3FC3 A;  1Q86 C;  3C0C A;  1D3B A;  1MV3 A;  4BI3 A;  4DBQ A;  4M77 G;  2CP3 A;  4FU6 A;  3C95 A;  1YI2 Q;  5FU6 B;  3CEY A;  1BB9 A;  5GJW B;  2XD0 A;  2COY A;  3OS2 A;  5GAM e;  4FM4 B;  3UAT A;  5KE2 A;  1D0Z A;  1AHJ B;  2X35 A;  2KBT A;  4C0Z A;  2H8H A;  1RAE B;  1I4K 1;  2FPD A;  1TXQ A;  2C0O A;  1VQ8 A;  4M7D B;  1ZX6 A;  1BU1 A;  2C0T A;  3UF4 A;  1ARK A;  2DLP A;  1ZSG A;  5GAN 8;  1NM7 A;  2DE0 X;  2ROT A;  3CCQ T;  4Y92 A;  4ORZ A;  2KY9 A;  4C0D C;  3MEW A;  4ZGD B;  2NUZ A;  1QWE A;  2DD4 A;  1WXU A;  3I5R A;  1C0M A;  2QA4 Q;  1O9S A;  1QWF A;  2CP5 A;  2W0Z A;  4L6V 5;  3HTR A;  2NLU A;  3INZ A;  2QYZ A;  2FG0 A;  1VYV A;  3OYC A;  2K5F A;  3V7C A;  2YRV A;  3GNF B;  3T9N A;  2M02 A;  2YUQ A;  2L8D A;  3FB9 A;  4M77 E;  4LDU A;  1QKX A;  2DYI A;  2M16 A;  1QVG P;  5CIU A;  1VQ4 A;  5GAO m;  2MK5 A;  1NZ9 A;  2KSS A;  3EGD B;  1VIE A;  5KYY A;  1RAA B;  1FMW A;  1WHG A;  4TVR A;  1WHK A;  4J6Y A;  2LJ1 A;  2RMO A;  2FZK B;  2CYZ B;  3JCM f;  2IVW A;  4C92 A;  3CCL Q;  2GF7 A;  3A8H B;  2DYB A;  3L2Z A;  1JBM A;  1WFW A;  1NE8 A;  2ENM A;  2J6F A;  3VS3 A;  4M77 D;  1WQW A;  2KRO A;  2PQW A;  3BFM A;  2WSC E;  4UC4 A;  2QQR A;  4ELZ C;  2AT1 B;  1QVF A;  4D8D A;  2HQH A;  3JCM g;  4XTZ A;  2A0F B;  5EC7 A;  2DMO A;  4F7U A;  2QDL A;  3M0R A;  2DPP B;  3MP1 A;  1BIA A;  1VQ8 Q;  2KXC A;  2JS0 A;  2CUB A;  2NWM A;  2WAC A;  2W10 A;  1DJ7 B;  1ZHI A;  3VYG A;  4EMK B;  3QBY A;  1I5O B;  2ZCF B;  1YIT T;  1M2V A;  2COZ A;  1N8R C;  4LUD A;  1PD1 A;  4X1V A;  1BI1 A;  5FWB A;  3H9N A;  1VQM T;  7AT1 B;  1WX6 A;  1J3T A;  3JSC A;  2EQU A;  5GAM h;  3QPH A;  4ME7 A;  2D0N A;  1E6G A;  2YXY A;  1YFN A;  3QDF A;  1X6O A;  3SHW A;  1AD5 A;  1X6B A;  2EJ9 A;  5GAO n;  1MGQ A;  3CPW S;  1HYO A;  1VQ4 Q;  1OX9 A;  4E7I A;  2EQJ A;  2M9U A;  4R0K A;  3FRN A;  2EPD A;  4XAX B;  2HBP A;  1ZBJ A;  3J80 E;  1OZ3 A;  3Q1J A;  4OB1 B;  1VQP A;  3HRS A;  2KR3 A;  2GNC A;  3M0P A;  1VQ7 T;  3G4S A;  1NJI C;  1AVZ C;  1RI0 A;  2DXT A;  1K73 C;  3M58 A;  5IT9 E;  3QWX X;  1R0C B;  3VKI A;  1PKS A;  3LW5 E;  4XTU A;  5CVI A;  1GL5 A;  1Z9Q A;  2MOX A;  3SDZ A;  2KT8 A;  2M0O A;  2DRM A;  4C92 G;  4C8Q G;  5KYW A;  3I9Q A;  3CC4 T;  4YTL A;  1JRI A;  3CPF A;  3TQ7 P;  2RJD A;  5FU6 C;  3TEE A;  4BI8 B;  2XDP A;  1M9S A;  4AFZ C;  1SSF A;  4CI0 C;  3SD4 A;  1K8A R;  3CCR A;  4XTV A;  3SFM A;  4PJN A;  4A4H A;  4LD9 K;  3I56 T;  1QVG A;  4F7U G;  1BCM A;  3CCM T;  4OVA A;  1IGQ A;  3UT1 A;  4M7D C;  4RUG A;  2RPN A;  3CCJ T;  1WJR A;  2SEM A;  4IUT A;  1UGS B;  2O4X B;  2FRW A;  1PSF A;  1WZO A;  1V76 A;  2EVR A;  5KE3 A;  2K3B A;  3EFO B;  3EFS A;  3PNW C;  3MO8 A;  5LJ3 f;  3RDV A;  2DTI A;  3JCM X;  4PJO G;  1HD3 A;  3OYI A;  1Y57 A;  1VQN T;  3CD6 A;  4ZN1 A;  1OU9 A;  2Y4X A;  3JB9 F;  1VQP Q;  1SKU B;  3GOX A;  4E7H A;  2JN0 A;  1IGU A;  1VUB A;  3V7S A;  2DX1 A;  4C92 E;  4C8Q E;  1SSH A;  1KK7 A;  3UPU A;  3G4S Q;  2O01 E;  5LJ3 g;  2R58 A;  2NYS A;  3H0I A;  5IHI A;  1YJW T;  1Q7Y R;  4NL3 A;  5A0D A;  2RHI A;  2J05 A;  2XKO C;  1G83 A;  2ROL A;  1YI2 T;  4MDX A;  1FX7 A;  1AOJ A;  1G3S A;  1SG5 A;  3PFS A;  4JLG A;  5M9O A;  3PMI A;  1ACM B;  1QCF A;  2AK5 A;  1T3L A;  1TUC A;  4F7U E;  4BE2 A;  3M0T A;  3EG1 A;  2E64 A;  2ZPI B;  1YJN A;  4IUV A;  4C92 D;  4C8Q D;  1MMD A;  1IRE B;  2X4J A;  1NLP C;  3PVQ A;  1VQK A;  4LE9 A;  3JV3 A;  2E5Q A;  3X26 B;  1V29 B;  3JCM c;  2RD1 A;  3DKM A;  1X6G A;  2DXU A;  1XTD A;  5DM7 R;  4O5V A;  2H3E B;  5A0G A;  4PJO E;  1GBQ A;  2GTJ A;  4JJD A;  1RAH B;  2E5K A;  4E47 A;  5FRO A;  1QMC A;  3H8Z A;  3HKS A;  4HA8 A;  2BZY A;  2CZ1 B;  3NTH A;  3S3N A;  2NUT A;  4RMO A;  2V1R A;  1N8R U;  3I55 A;  2PVD B;  1KQ2 A;  3ME9 A;  4EMK C;  3CXC S;  4N4G A;  2YUN A;  4MDW A;  3QWY A;  2QQB A;  3MCA B;  3R6N A;  2MF2 A;  3TSW A;  3LWH A;  2X3W D;  4EIK A;  2MMP A;  3PT9 A;  9ATC B;  1YWO A;  3ZEH A;  1W2B S;  4PJO D;  3CD6 Q;  2JTM A;  2JZ2 A;  2D8J A;  3VRY A;  1XQH A;  2OTJ T;  2LRQ A;  2X4Y A;  3MET A;  4ZTF A;  1SEM A;  4OMN A;  3CCL T;  1VQO A;  1UUE A;  1VQ6 A;  1U5S A;  2DXC A;  2EYZ A;  1M8V A;  3MKD A;  2DZ9 A; 
#chains in the Genus database with same CATH homology
 3L2V A;  1KHI A;  2FL7 A;  3OYY A;  3X24 B;  3X20 B;  2QXF A;  2DKG A;  1RL2 A;  2CGH A;  1N6A A;  2K57 A;  4XU0 A;  5DLQ E;  3VJP A;  3S6W A;  2L3R A;  2HQE A;  2P0K A;  1NJI U;  5GAO l;  3JAM E;  2E70 A;  1N27 A;  1K8A U;  1K73 U;  4MZP A;  5GAN 4;  2XIC A;  4HT8 A;  4B9X A;  2RJE A;  5CKH A;  5CO7 A;  2FHD A;  2XID A;  2RHZ A;  3CCU A;  2PVO B;  2JTF A;  3CME T;  1BI3 A;  4BD3 A;  3CMA A;  2VC8 A;  1Q82 U;  4JRI A;  3EFR A;  1VQ8 T;  4KBM B;  4QQ6 A;  1G3W A;  1OZ2 A;  2LNV A;  2K3Y A;  2QQ9 A;  3OMG A;  3S3O A;  1JJ2 S;  2RHY A;  2RI2 A;  3JRZ A;  3JCM e;  1JJ2 A;  1ZBX A;  3NTI A;  3FC3 A;  1Q86 C;  1LOJ A;  1YCY A;  1BYM A;  3SWN A;  2KK4 A;  2AHJ B;  3SWN C;  2KDS A;  5GAN 5;  3V8L A;  4KUL A;  4XTW A;  2KVQ G;  2GCX A;  3R6O A;  3G6E T;  1D3B A;  3BDU A;  4A4F A;  4BI3 A;  4BUG A;  3M53 A;  3OYM A;  2LCL A;  2DIQ A;  4FU6 A;  1BKB A;  3OBW A;  3OBY A;  4M77 G;  5KCO A;  3C95 A;  5FU7 B;  2ZPF B;  1R8O B;  3OYB A;  5FU6 B;  1M90 C;  2VXF A;  3CEY A;  2E65 A;  5CCA A;  4M7D E;  2CZ6 B;  4DOV A;  4LDV A;  3CBM A;  3I55 T;  2XD0 A;  2WSE E;  2MAM A;  3FEO A;  3OS2 A;  2DEQ A;  2D9T A;  5LL6 S;  2L89 A;  2LC4 A;  3M4Y A;  3HFN A;  3OSS C;  4FM4 B;  5GAM e;  5KE2 A;  3GPL A;  4BE1 A;  1UGP B;  3A8M B;  1AHJ B;  2X35 A;  4C0Z A;  1I4K 1;  2RJF A;  1M4Z A;  4QW2 A;  2CZ7 B;  4BDZ A;  3CME A;  1Q7Y U;  1VQ8 A;  4M7D B;  3URG A;  3P8H A;  1QW1 A;  2Y90 A;  5FRN A;  1I81 A;  1WNL A;  4FT2 A;  4Q5W A;  1VQ4 T;  2VYT A;  1P92 A;  5LJ3 j;  2XU8 A;  5GAN 8;  4JS5 A;  1YIT A;  3HPW A;  2H3J A;  4M78 G;  3V8K A;  3OA6 A;  3CCQ T;  2K5I A;  4P5N A;  2YLC A;  4JRK A;  3G6E A;  3FJP A;  3OYJ A;  2KY9 A;  2OTL T;  3PTA A;  5DLO A;  1M1K U;  4M7D D;  4M78 A;  2LT4 A;  4DQ2 A;  5I2S A;  4C0D C;  3MEW A;  4ZGD B;  4ZGE B;  4PKC C;  3RIR A;  2DD4 A;  1UGR B;  4XU3 A;  5KCH A;  5LJ5 d;  2VXE A;  2QA4 T;  1VQO T;  2LQK A;  1VQM A;  4QVZ A;  1O9S A;  4L6V 5;  1ZQ1 A;  4M75 A;  1KG1 A;  1UEB A;  4EMK A;  2NLU A;  3INZ A;  5GMK l;  5A2Q E;  1VQ6 T;  2HNI A;  4ZN3 A;  3MHX A;  4BE0 A;  3C12 A;  4C92 F;  4C8Q F;  3LYI A;  5EG2 A;  3ZBD A;  2DJZ A;  2EIF A;  5CKE A;  1H64 1;  3QUI A;  3OYC A;  3DLM A;  2K5F A;  3TCJ A;  2DZC A;  3V7C A;  2YRV A;  3GNF B;  3BY7 A;  3T9N A;  3L2W A;  2L8D A;  2YHT A;  3FB9 A;  3OB9 A;  4M77 E;  1Q86 U;  4LDU A;  3J7A F;  2HD0 A;  2RB6 A;  2M16 A;  2D0Q B;  3TU4 K;  3CBP A;  4ZTJ A;  4PNO A;  3ZFJ A;  1Y7X A;  5CIU A;  1VQ4 A;  5GAO m;  4HCB A;  4EMK B;  1G3Y A;  3P8D A;  1D3B B;  1NZ9 A;  1WPY A;  2KSS A;  3E1S A;  4BB7 A;  4M7D F;  2F5K A;  1IZ6 A;  1VIE A;  4M7A A;  1VQ9 T;  2GFU A;  2VGN A;  3A5Z B;  1LJO A;  2E6Z A;  2EJG A;  3JCM Q;  4TVR A;  4J6Y A;  2KMT A;  2OTL A;  1M90 U;  4J7I A;  5LJ3 d;  3JCM b;  4KUI A;  2XK0 A;  2DVE A;  3OS0 A;  5GAN 3;  4M77 B;  2CYZ B;  3E19 A;  1WQ7 A;  3JCM f;  3VV0 A;  2IVW A;  3LLR A;  4C92 A;  3FDR A;  1NPR A;  2GF7 A;  3A8H B;  4A4K A;  3OYE A;  3L2Z A;  4C92 C;  4C8Q C;  1JBM A;  1YIJ T;  1XNI A;  1NE8 A;  1FWZ A;  3X28 B;  4M78 E;  1YHQ A;  4JRQ A;  3QXE B;  3QZ5 B;  4M77 D;  1WQW A;  1H3Z A;  1Y96 B;  2PQW A;  3BFM A;  3NTK A;  4JDS A;  3OS1 A;  3CCS T;  2E12 A;  2WSC E;  4UC4 A;  4PJO F;  2QQR A;  1M1G A;  1QVF S;  4ELZ C;  3JB9 D;  1QVF A;  4CRI A;  4R55 A;  4BI4 A;  2JVV A;  4FIB A;  2JNG A;  3JCM g;  4XTZ A;  2RM4 A;  2ZPG B;  1U8R A;  5FLX E;  2XDD A;  4C5H A;  3M55 A;  5GAN 2;  2P0Q A;  4MMK A;  5GAM f;  4F7U A;  4M78 B;  1VQ9 A;  4BAC A;  3OYL A;  3JCM h;  4XTY A;  1O75 A;  2DPP B;  1BIA A;  3MP1 A;  1B34 B;  1PSE A;  2X4X A;  3HHT B;  1WJQ A;  4NL2 A;  3LWI A;  2QI2 A;  3QJY A;  2WAC A;  1DJ7 B;  1ZHI A;  2B8A A;  2JUF A;  3QBY A;  1N9R A;  2EFI A;  2DAQ A;  2ZCF B;  2VUB A;  3A8G B;  3FIF A;  4FT4 A;  4LDW A;  4MZT A;  3OYK A;  1YIT T;  3V8J A;  2DXB A;  1KC8 C;  3CCE T;  4M78 D;  1N8R C;  1WGS A;  2Y4Y A;  4J6W A;  5CQY A;  3MP6 A;  3QDR B;  5AYF A;  4OGC A;  1YIJ A;  5GAO q;  3KUF A;  4ATO A;  5GAM g;  2HQX A;  1BI1 A;  3RMQ A;  4XQ3 A;  1VQM T;  4M75 D;  2YLB A;  4PJO C;  3CCS A;  3JB9 G;  1XOV A;  3G4S T;  4OP0 A;  4O6J A;  1U1T A;  3JSC A;  2CKK A;  5CK9 A;  2EQU A;  5KH6 A;  1TH7 A;  3QPH A;  5GAM h;  3MEU A;  4J8O A;  4ME7 A;  2ZPB B;  4IUQ A;  5GAN j;  3CCJ A;  1KQ1 A;  3C4S A;  4C5G A;  3RER A;  4BY6 B;  1VQL T;  3GNG A;  2RO0 A;  3LH0 A;  4RCC A;  3OYG A;  1X6O A;  1HK9 A;  4OB3 B;  4M7A D;  3JCM W;  3VU3 C;  2EJ9 A;  5GAO n;  2RJC A;  5LJ3 e;  1MGQ A;  3CPW S;  4NS5 A;  4PL6 A;  3A8L B;  4IUR A;  2K5L A;  4Z02 A;  3CPW A;  3MEV A;  3HRU A;  4E7I A;  4EMG A;  3L2U A;  2EQJ A;  2RI5 A;  2M9U A;  4QQD A;  2RK2 A;  3FRN A;  4XAX B;  2HBP A;  3CCE A;  4A4E A;  3CCV A;  1OYX A;  3J80 E;  3PGG A;  4JUV A;  4M75 G;  1OZ3 A;  2O4X A;  1U1S A;  3Q1J A;  3ASK A;  1W4S A;  2VV5 A;  4OB1 B;  3WVD B;  4EPC A;  5GMK i;  3HRS A;  4QVD A;  3GP8 A;  2E10 A;  4FSX A;  1QP2 A;  2EWN A;  2GFA A;  1VIF A;  5GMK j;  2E1H A;  1Q81 C;  1VQ7 T;  2VGM A;  1LNX A;  3G4S A;  1NJI C;  3M56 A;  1Y71 A;  2LX9 A;  3N5B B;  1RI0 A;  2DXT A;  4J7F A;  3OYD A;  3JCM V;  3DB4 A;  1K73 C;  4XU1 A;  3O8V A;  1FXX A;  1YHQ T;  2EQK A;  3M58 A;  4J6X A;  5IT9 E;  1YJW A;  3QG1 A;  2K2V A;  3M4G A;  4E7K A;  3LGF A;  5CKD A;  3VKI A;  2P4T A;  1VQL A;  2FYK A;  1QP3 A;  4J83 A;  2WSF E;  3SWN B;  1YI2 A;  3RMS A;  2FVU A;  4FL6 A;  2QEX T;  4M7A G;  3LW5 E;  5HKC A;  2A7Y A;  4XU2 A;  1M1F A;  1BIB A;  2R57 A;  4OB0 B;  4XTU A;  5GAN d;  2BUD A;  2E41 A;  2EKO A;  5CVI A;  2EYQ A;  1KC8 U;  3PIO A;  4Y28 E;  3RUX A;  2CZ0 B;  3KXT A;  4OF1 A;  4N0A C;  3GIB A;  4LD6 A;  2RH2 A;  5LJ5 j;  3OY9 A;  3M57 A;  4E7J A;  2PU9 B;  3DB3 A;  3SDZ A;  4C5I A;  5GAO p;  4HCC A;  2M0O A;  2V8K A;  4IUU A;  4JLI A;  4X34 A;  2EJF A;  3QJ6 A;  4C92 G;  4C8Q G;  5HK3 A;  2QTX A;  3CC4 T;  4YTL A;  4MML A;  2MI6 A;  1JRI A;  1JB0 E;  3CPF A;  2R5A A;  2RJD A;  2ZGW A;  3RKW A;  3OSV A;  5FU7 C;  3OYN A;  3V7R A;  3DLL A;  5FU6 C;  4C8Q A;  2RA2 A;  1VQ7 A;  3TEE A;  5C0M A;  3JB9 I;  1Y07 A;  3CD6 T;  3VYG A;  4BI8 B;  3M9Q A;  4XK8 E;  2XDP A;  1M9S A;  5IN1 A;  1UB4 A;  3JCM J;  1SSF A;  3PMT A;  4CI0 C;  2ZZD A;  3SD4 A;  4RG2 A;  2JOY A;  4J5Y A;  3CCR A;  3JCM P;  5I2M A;  1YJ9 T;  4XTV A;  3SFM A;  4IKF A;  2V8J A;  4L59 A;  4A4H A;  4C0G A;  3OS5 A;  3I56 T;  3G71 T;  1QVG S;  4LD9 K;  2RHU A;  4M75 E;  3RES A;  2QEX A;  1QVG A;  1QVP A;  4F7U G;  3J81 E;  4M7D A;  5C6S A;  3CCM T;  3QZ9 B;  4OVA A;  3UT1 A;  4M7D C;  4II1 A;  5GAN f;  3CCJ T;  1WJR A;  3NFC A;  3UDC A;  4C0D B;  3A8O B;  1S72 A;  2RI3 A;  4IUT A;  2IG0 A;  1UGS B;  2ZPH B;  3G7Z A;  5L8R E;  2O4X B;  1PSF A;  2QQS A;  4X9D A;  3CC2 T;  1M1K C;  5KE3 A;  3OYH A;  3EFS A;  1I8F A;  2P0P A;  3PNW C;  1Q81 U;  5FRM A;  3MO8 A;  3CC4 A;  2RK1 A;  5LJ3 f;  1BI2 A;  2DTI A;  3L2Q A;  4RCB A;  3E9G A;  4KUD K;  2R5M A;  3JCM X;  3OQ5 A;  4M7A E;  3CCV T;  3QII A;  4M77 F;  4PJO G;  3OYI A;  3JB9 J;  1VQN T;  2DK3 A;  3JB9 H;  4M75 B;  3C94 A;  3TRE A;  3WXM B;  5GAN g;  4HCZ A;  4ZN1 A;  1YJN T;  2LVM A;  2XDB A;  3CD6 A;  1VQP T;  2Y4X A;  2LDM A;  5A0L A;  3JB9 F;  4JRP A;  4PJO A;  4PLL A;  3GOX A;  1G5V A;  4PLI A;  4E7H A;  1KD1 C;  2X4W A;  1VQK T;  2JN0 A;  4C5E A;  1VUB A;  4LDY A;  3V7S A;  5GAN h;  1YJ9 A;  4C92 E;  4C8Q E;  5CR2 A;  3QHS A;  2OTJ A;  1X75 C;  3X25 B;  3I56 A;  3G71 A;  4JJN K;  2O01 E;  4X9C A;  3UPU A;  5GAN e;  5LJ3 g;  3HRT A;  4VUB A;  1VQP A;  1BI0 A;  1G3T A;  2BKD N;  2R58 A;  3F70 A;  4QQG A;  4M7A B;  4A53 A;  3CCM A;  5GMK m;  1YJW T;  3CCL A;  3KBG A;  2K3X A;  4WF2 A;  3OYA A;  4NL3 A;  2A3L A;  2MWO A;  5CQX A;  2D6F A;  2KQW A;  5A0D A;  1K9M C;  2RHI A;  5LJ3 h;  2XKO C;  1YI2 T;  5GAN 6;  4MDX A;  3QO3 A;  3VUB A;  4DA4 A;  3HL8 A;  2LT1 A;  1FX7 A;  4N4H A;  3CC2 A;  2LCC A;  1G3S A;  3PFS A;  5D6Y A;  4M78 F;  4JLG A;  4N4I A;  4C8Q B;  4OMF B;  4C92 B;  4E7L A;  5M9O A;  1KD1 U;  1VQ5 T;  1EIF A;  2K4Y A;  3PMI A;  1N9S A;  3QYG B;  4M77 A;  2CS7 A;  2EQM A;  4V2S A;  5J26 A;  4HKE A;  5LJ5 f;  3CC7 T;  3BW1 A;  4M77 C;  3CBO A;  2MWP A;  4F7U E;  4BE2 A;  5J3B A;  4M75 F;  3M54 A;  3L1A A;  4GLK A;  3RKX A;  5GMK h;  1VQN A;  2E64 A;  2OAU A;  4KT0 E;  2ZPI B;  3M59 A;  1YJN A;  4IUV A;  5GMK e;  5GAM j;  4C92 D;  4C8Q D;  5IAY A;  3M5A A;  1IRE B;  3MP8 A;  1Y96 A;  2X4J A;  4GY5 A;  2GQV A;  3SB2 A;  1VQK A;  2I2L A;  2F5T X;  2E5Q A;  2EAY A;  3X26 B;  1K8A C;  1V29 B;  2XHC A;  3JCM c;  2QQA A;  3OYF A;  3LGL A;  4A4G A;  2L5Q A;  4D6W A;  4F7U B;  2RD1 A;  3DKM A;  5LJ5 g;  5D6W A;  2DXU A;  1XTD A;  4OB2 B;  2PUO B;  3EAE A;  5CKF A;  5HK0 A;  5DM7 R;  1M5Q 1;  4O5V A;  5A0G A;  3CCR T;  4PJO E;  2BIV A;  2HAX A;  3L42 A;  4BDY A;  4M7A F;  3QKJ A;  4E47 A;  2DTO A;  1Q82 C;  5FRO A;  2RHX A;  3H8Z A;  3JCM d;  3HP9 A;  1NPP A;  5LJ5 h;  3HKS A;  4M78 C;  4NOY A;  4QVC A;  1B34 A;  2C06 A;  2ZPE B;  2LQ8 A;  2DIG A;  4HA8 A;  1WJS A;  2CZ1 B;  3UWN A;  3NTH A;  5GAN 7;  5LJ5 e;  3S3N A;  1VQ5 A;  1KHC A;  4RMO A;  4N0A A;  2F69 A;  3E9F A;  1N8R U;  3I55 A;  2PVD B;  1S72 T;  1KQ2 A;  3ME9 A;  4M75 C;  3CC7 A;  4EMK C;  3CXC S;  3OW2 A;  4N4G A;  3CXC A;  3OW2 S;  5I21 A;  3L2R A;  4MDW A;  2LTO A;  4PJO B;  3MEA A;  2QQB A;  3MCA B;  2KAF A;  4IUP A;  2MF2 A;  4Y91 A;  4OGE A;  4L5G A;  3HSB A;  4LDX A;  1HXD A;  4EMH A;  3LWH A;  2G3R A;  3ER0 A;  3H6Z A;  4RKU E;  4ZGJ B;  3VUZ A;  2E6N A;  4RG8 A;  3WVE B;  5J39 A;  2PVG B;  2PUK B;  2XI9 A;  4XTX A;  3RKY A;  1UGQ B;  5CAI A;  2MMP A;  4C0F A;  5D6X A;  3PT9 A;  1YBY A;  3AHU A;  3QSU A;  4R56 A;  4JS4 A;  5GAO r;  3PIP A;  2QDY B;  2M1H A;  3ZEH A;  1KQS S;  3VYH B;  1W2B S;  1KQS A;  3HFO A;  4PJO D;  1W2B A;  3FLG A;  5GAM d;  4HT9 A;  4EDU A;  2JTM A;  2JZ2 A;  3CCU T;  3LX7 A;  3BDL A;  2V8I A;  3GF5 A;  3CCQ A;  1K9M U;  3CMA T;  3P8B B;  4M7A C;  4M7D G;  1OI1 A;  1XQH A;  4F7U F;  2OTJ T;  2LRQ A;  2X4Y A;  1MHN A;  3MET A;  1Q7Y C;  4BY6 C;  3OMC A;  4ZTF A;  5CKB A;  4B9W A;  4DOW A;  3CCL T;  2DTH A;  2QA4 A;  1VQO A;  2DD5 A;  1GXI E;  1X01 A;  4MZM A;  3GLX A;  5HY6 A;  2XG8 D;  4ELY C;  3QYH B;  3S3M A;  1I5L A;  2DXC A;  1VQ6 A;  2FB7 A;  1M8V A;  2DO3 A;  4A54 A;  5DY9 A;  2DZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...