1KQ2A

Crystal structure of an hfq-rna complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
NIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*UP*UP*UP*UP*G)-3'
publication title Structures of the pleiotropic translational regulator Hfq and an Hfq-RNA complex: a bacterial Sm-like protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Translation/rna
total genus 13
structure length 60
sequence length 60
chains with identical sequence B, H, I, K, M
ec nomenclature
pdb deposition date 2002-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1kq2A00
2E65A 4M7DC 5GAMg 4M75B 3RERA 2YLCA 4EMKC 4C92A 3BY7A 2DTOA 1D3BA 2EJGA 4M7AB 1HK9A 4M78G 3V7CA 3RUXA 5GMKm 5LJ3g 5GAN8 4C8QE 5GMKl 5LJ5f 2YLBA 5LJ5h 5GAOr 3JB9G 3JB9H 3V8KA 3SB2A 4M78F 4C8QC 4EMGA 1LJOA 1WPYA 1HXDA 2VC8A 4PJOC 5LJ5g 4N0AA 1KQ1A 4M78D 1I8FA 1WQWA 2DTIA 2Y90A 3BW1A 1TH7A 4M77E 4C8QA 4PJOG 1M8VA 4M7AF 2DZCA 1WQ7A 2ZGWA 4M7AD 1M5Q1 2VXFA 4M77A 3JCMQ 4PNOA 5GAN3 5GANd 3AHUA 2HNIA 5GANj 4M7DD 4F7UG 4HT9A 4X9DA 4J6YA 2DXTA 4JRIA 4M78E 4F7UF 3EFSA 3GIBA 4M78C 1U1TA 3RKXA 4QVCA 4DQ2A 3FB9A 5GANe 1BIBA 4M7DA 4J5YA 4XTWA 1H641 4EMKA 4M7AC 3INZA 4M75G 4PJOE 3SWNB 3V7RA 4M7AG 5GANh 5GANf 4M75F 1YCYA 1BIAA 2I2LA 4XU1A 3JB9J 1KQ2A 2DEQA 2RD1A 4C92B 1D3BB 3L1AA 4PJOA 2DJZA 4M75D 4XU3A 4A54A 3QSUA 4M7DB 5GANg 2K57A 4F7UE 1N9RA 1I5LA 4EMKB 4XQ3A 5GAN6 1B34A 4XTZA 2EJ9A 3QUIA 4OP0A 3PGGA 4EMHA 4XTVA 4MMKA 4NOYA 4C8QB 4WF2A 4F7UA 5GMKh 5GAOm 4JLIA 1LOJA 3SWNA 3JB9I 1MGQA 4XU2A 3L2ZA 5GAOn 3RIRA 5GAOl 4M75E 4C92D 3BDUA 1B34B 1JBMA 4M75C 4M77B 4M78A 4M7AE 2JN0A 3JCMb 1Y96A 3JCMJ 1I81A 5GMKj 5GAN2 5GAN7 3RESA 2E41A 3JCMW 2EAYA 4X9CA 4M7AA 4C8QD 3FIFA 3JCMX 1N9SA 4XTUA 3SWNC 5GAOp 1WNLA 4NL2A 3JCMd 4J6XA 4XTYA 4JUVA 3VU3C 2E10A 4M77F 5GMKe 4M78B 4HT8A 4Y91A 2DTHA 3JCMV 3JCMc 4A53A 4M77D 4C92G 2EJFA 2DVEA 4HA8A 2CGHA 2RM4A 2DZ9A 2YHTA 4MMLA 3V8JA 3HFNA 4C92F 3JCMe 4M7DG 1LNXA 5GAMd 1X01A 3V7SA 5GAMj 4PJOB 4M7DF 4N0AC 5DY9A 4RCBA 2E1HA 2FB7A 3V8LA 3M4GA 5GMKi 3JCMh 5LJ3d 3JCMf 2RA2A 5LJ3j 4RCCA 4C8QG 5GAOq 3JB9F 2E64A 4XTXA 5GAN5 3RKWA 4NL3A 3HSBA 3BFMA 5GAMe 1U1SA 3QHSA 4C8QF 3JB9D 3JCMP 4M77C 4M75A 3JCMg 4F7UB 2DXUA 5LJ5d 4V2SA 5LJ5j 4J6WA 4XU0A 4PJOF 2QTXA 3RKYA 4QVDA 1I4K1 4M77G 4JRKA 5LJ3e 2VXEA 1JRIA 5GAMh 5GAMf 2EWNA 5GAN4 5I21A 2FYKA 3HFOA 4C92E 5CAIA 4PJOD 3QO3A 3EFRA 3FJPA 2RB6A 4C92C 4M7DE 2DKGA 5LJ5e 1Y96B 5LJ3h 5LJ3f
chains in the Genus database with same CATH superfamily
2LJ3A 4EMKC 4E6RA 3QYGB 4L6V5 1VQMT 5HK0A 2V1QA 2VB6A 4GLMA 1HSQA 4PFZA 1CSKA 1QWFA 1O75A 4PK4A 3CC4Q 2JT4A 4C8QA 2EYQA 2DBMA 1TH7A 1BI0A 1WGSA 2R57A 3BW1A 3EGXB 3VS0A 1KJWA 3SDZA 5KYYB 4OMOA 1WA7A 2FEIA 3OYFA 2NUPB 2V8JA 3G6EA 4F7UG 1YJ9T 3CMAT 4HT9A 1AWXA 1WHMA 3KXTA 2KYBA 2O9SA 5HCKA 3OS0A 1BB9A 2CP0A 1ZSZA 1WXUA 4JS5A 2CP2A 2XG8D 2XICA 3I56A 5J39A 4J9CA 2YUNA 3VS3A 2DEQA 2V8IA 3L1AA 4XU3A 2QEXT 2AKKA 3E1SA 4OMMA 1EFNA 1ABOA 4J9BA 1VQMQ 2LX7A 4PFPA 6AT1B 2G6FX 2FHDA 2EGCA 1QVFS 7AT1B 5GAOn 3CD6A 1RL2A 2H3JA 1KQSA 1N8RU 1M90C 1JBMA 4LDVA 1N8RR 1Z9ZA 2ZAEA 1AZGB 1VQ7A 3UWNA 1HD3A 3PMTA 2RNAA 1BCOA 2PUOB 2DYIA 3M0UA 3CMAQ 1YJ9Q 2ENMA 5LL6S 1IGQA 1M3BA 5KYNA 2K4YA 2EJFA 1FMVA 2YDLA 4KH0B 2O4XA 4C0DC 4PJOB 4OMNA 5LJ3j 2KVQG 4XTXA 1OZ2A 1TOVA 2FPEA 5GAMe 2OTJT 3E9GA 2K9GA 2JNGA 3CQTA 4DBFA 3LH5A 1ZBXA 1KK7A 1X27A 5KCHA 3HKSA 2LRQA 2JOYA 1VUBA 2DO3A 4BE2A 4FYWB 1D3BA 2QA4Q 3G71A 5GAN8 1I1JA 2VYTA 3V8KA 2XIDA 5CR2A 1M1KU 3X26B 2EYXA 3CCJA 1M1KR 4E7LA 1ZHIA 4PJOG 1GCQA 2PTKA 3S3NA 1OU9A 3P8DA 4E7KA 3QBYA 5GANd 3QPHA 4N4GA 1U1TA 4M7DA 4XTWA 2OTJQ 2F1LA 1M3CA 2RI2A 3EGUA 2XI9A 4BB7A 3EH1A 3P8HA 4JRQA 1TTHB 2E6ZA 2JMCA 4M7DB 1U8RA 2DYBA 4J9EA 1YJNA 1I5LA 3VYHB 3OYNA 2LMJA 1N8RC 2GBQA 4MMKA 3CMET 1UE9A 4RMOA 2OX7A 4M75E 4DA4A 1GXIE 4M75C 2MIOA 2LNVA 4RTZA 3CCVA 2DL8A 4JZ4A 2FZGB 3ZL7C 1IHWA 2ED0A 3ZBDA 2JMAA 2EAYA 4YTLA 4M77F 4MZMA 4HT8A 1Y0MA 3OYJA 1U3OA 1PG5B 1X2KA 2CGHA 4M7DG 1YIJQ 1UGRB 3VS7A 2E1HA 5GAOq 1GCPA 4RCCA 2YRDA 1TWBA 5FWBA 4L59A 2MF2A 2R5MA 3X28B 3M59A 2QTVA 3U23A 3CPWA 2CUBA 3OYKA 3HFOA 5CAIA 2JTFA 2QQBA 1M1KC 2M1HA 1M2OA 5GAOr 5IH2A 1LVKA 3SB2A 2JS0A 1ZQ1A 1ABQA 2DIGA 1SG5A 4VUBA 1M9SA 2L89A 2EQJA 2LQWA 5FU7C 1WHJA 3FRNA 1S72T 1VQKA 2HNIA 1JB0E 3CPWP 4M78E 2XKOC 4F7UF 4M78C 2L3PA 1E7OA 4DQ2A 2D0QB 2YSQA 5FU6B 1NZ9A 2SRCA 4RKUE 2PVOB 1Y71A 1TSFA 4JZ3A 3EG0A 4XTZA 2YUPA 3A8HB 1YJWT 4C92D 2RI5A 4HVWA 2PVGB 1SPKA 4X1VA 4B9WA 4CC4B 5IHIA 1UB4A 4KRTA 3X20B 3FIFA 1S72Q 3GLXA 5KE2A 2DIQA 5GMKe 3REBB 2X3XD 2DLPA 2R58A 2BZ8A 2FG0A 1VQ4T 2GQIA 2CZ0B 3D7SB 2XMFA 1OEBA 2DETA 3JV3A 3R6OA 2L3QA 3BDLA 2CS7A 2CSIA 3CXCP 4II1A 3CCRT 4QVDA 1W2BS 9ATCB 2QQAA 2IIMA 2VXEA 3CCEA 1HJDA 1M1GA 2ROLA 4C92E 3MP6A 4PFOA 4C92C 5CKBA 3SWNA 2KQWA 1Y96B 1QVGP 5LJ3f 1YJWQ 1I07A 2PQWA 4EIKA 1HK9A 1E6HA 1W70A 2KGTA 1VQLT 3EGDB 1MMNA 4OVAA 1WPYA 4FL6A 1VYVA 2GGRA 4N0AA 1AD5A 4O5VA 1YI2T 3VRYA 2EQIA 1VQPT 2HL3A 4LD6A 4B9XA 5CCAA 2RK2A 2XDPA 3M5AA 3TSWA 4BE0A 3EFOB 1SHFA 1VQ4Q 4O6JA 3JSCA 3QXEB 2DXTA 4JRIA 1KHCA 2HQXA 3LX7A 3PVLA 4QVCA 2OJ2A 2LP5A 2QASA 4ESRA 4LD9K 4M7AC 3CCRQ 4ANJA 2K6DA 5GANh 1VYUA 2CT4A 5GANg 2DAQA 2MOXA 3OYYA 5GAN6 2ROTA 2X35A 2KEAA 3QKJA 3PGGA 2MI6A 2DRMA 1VQLQ 1SRMA 1LOJA 1JJ2P 4LXCA 2M51A 2MYSA 1VQPQ 2KRNA 2JN0A 4E7JA 1QCOA 4CRIA 1BI2A 3JCMX 3CCQA 3IQLA 1ZUYA 3VU3C 4FW1A 5C0MA 2RF0A 2M16A 3MEAA 5D6XA 3X24B 2EQMA 3RMQA 2DILA 1KG1A 4M7DF 5GMKi 4Z02A 3SFMA 1ARKA 3S6WA 1VIFA 3GP8A 4ZGJB 2HQEA 2X4XA 1RI0A 4LE9A 2KT8A 3FJPA 2JM9A 2RQVA 1M4ZA 2QEXA 2E65A 2H3EB 4C5GA 1VQ9T 4C92A 3BY7A 4HCBA 1XOVA 5CVIA 1HXDA 3G4ST 1YNZA 2RI3A 1M2VA 2BE9B 3OSSC 1WQ7A 1JQQA 1RAIB 3M0PA 3H6ZA 2P0PA 3M9QA 3L42A 2YRVA 4FW2A 2IG0A 5FWCA 3VS6A 1G8XA 1NYGA 3H8ZA 4OMFB 5IXBA 1H641 1ZUKA 1Q86R 1RAEB 3I55T 4AFSC 4E47A 2P0QA 1VQ8T 2AK5A 1NBEB 1VQ9Q 1K4US 1K9MU 2CZ1B 1IREB 5GAOm 1K9MR 4JLIA 1JO8A 3RIRA 2HBPA 2J06A 4C0GA 3FEOA 3OB9A 5AYFA 3FLGA 1AEYA 1PNJA 4M77B 1QKWA 2DK3A 1MV3A 3RBBB 3OA6A 5I2MA 1FX7A 1YHQA 1VIEA 5I2SA 1SKUB 1EIFA 2HSPA 1D0XA 5M9OA 2GTOA 2VKNA 2ZCFB 2VGMA 3LGLA 1ZA1B 4E7ZA 3JCMc 3EH2A 3H0IA 3OYHA 2CH4A 5A2QE 1LNXA 1RLPC 3V7SA 1PSEA 2K2MA 3NFCA 1AHJB 3OS5A 3I55Q 1M1FA 1PCXA 1RUWA 1VQ8Q 3HSBA 3VV0A 3BFMA 3MEVA 3JB9D 3QWYA 1AVZC 4ORZA 4BDZA 2QTXA 3RKYA 3PFSA 4M77G 2ESWA 4HVUA 5FRMA 1H3HA 4KULA 2CP7A 4PJMA 2K2VA 4OGEA 2O2OA 1IXDA 4QQDA 3CMEA 1LJOA 1GFDA 5KYUB 4PJOC 1RAFB 3TSZA 3S3OA 2K7AA 2P4RA 2VGNA 3CCLA 3OYBA 2PU9B 1Q86C 3WVEB 1VQOT 1D0YA 2X9HA 5GANe 1QLYA 2J05A 5KH6A 4PJJA 1V76A 2AIRB 3VJPA 2L0AA 1M8MA 1VQ6T 3J80E 4OB3B 2NUZA 1TS9A 2I2LA 2LJ1A 2RD1A 4IIMA 1J3TA 1K9MC 4FT2A 5HY6A 2F69A 1OX9A 2M9UA 1QP3A 2L3RA 4C8QB 2CDTA 2RJDA 1KHIA 3TCJA 5CKEA 1OPKA 3OYGA 3MO8A 1G3SA 5GAN2 5GAN7 3G7ZA 3JCMW 4PJLA 1N9SA 1PSFA 3M0RA 5IHNA 3ASKA 3RR6A 1ZSZB 2C06A 1PC0A 4OB1B 3OS2A 2X4YA 3OQ5A 3HTRA 2X4JA 1VQOQ 2RHIA 2RM4A 2KNBB 3HFNA 3KUFA 3HP9A 2FPDA 4FYXB 1X69A 1VQ6Q 2CZ7B 2CP5A 4FM4B 3TU4K 1KQSS 5LJ3d 3JCMf 4C8QG 1WIEA 2QA4T 2M02A 1N5ZA 1SF9A 4C5HA 3HPWA 1I5OB 1PWTA 5LJ5j 1I4K1 2L3SA 3OBWA 3EFRA 3UATA 3S3MA 1A0NB 3V7CA 3RUXA 3JAME 2JUFA 2SEMA 2ED1A 1VOMA 3UPUA 3L2VA 3DKMA 3LLRA 3NGPA 1TU0B 4PLLA 2HKQB 4IUTA 1KQSP 1BKBA 2O4XB 1KFZA 5L8RE 1Z9QA 4TVRA 2EQUA 1SSHA 3EFSA 3LYIA 3CC7A 1D1CA 2BKDN 2CP6A 3OS1A 3CCMT 3A5ZB 2A3LA 2A28A 4EMKA 3A1PA 4FIBA 3BE3A 3V7RA 1D1BA 2KY9A 1D3BB 2F5KA 4M75D 3R6NA 1G5VA 4EMKB 2X3WD 3CBOA 1B34A 1M27C 3CCSA 2XK0A 1BBZA 1OZ3A 4NOYA 1OV3A 4FT4A 3L2ZA 1Q82U 3REAB 2LT4A 1Q82R 2RQWA 1B34B 1ZSGA 4DBHA 3DLMA 4PKCC 1YIJT 1QMCA 4ZN3A 2M0YA 1MMAA 3NTKA 1ZA2B 3G1JA 5A0LA 1UECA 1YI2A 2B86A 3QWXX 4FSXA 1GBQA 1YBYA 4A53A 2XD0A 1R0CB 3M4YA 3CCMQ 1H8KA 5CKFA 1WJSA 4RTUA 4KUIA 3I35A 4D8DA 2DA9A 3PVQA 1YITA 1X6OA 4IUVA 2DXBA 2EKOA 1BK2A 1WI7A 1FYNA 2JM8A 3NTHA 4D8KA 1VQ5T 4JRPA 4E7SA 1JRIA 1QCNA 2ZPGB 2QG9B 4KUDK 3TEEA 2Y4YA 3RERA 3CPFA 1CKAA 2COZA 3OYLA 1YP5A 4BUGA 4BY6C 2FRYA 2FVUA 3A8GB 5GMKl 2JXBA 2VC8A 4M78D 1H92A 2BE7D 1VQNA 3SHWA 4ZTFA 1PKSA 3CPWS 5FROA 3QDRB 2PNIA 3JCMQ 1UJ0A 1UJYA 2HQHA 2K5LA 3ER0A 2MAMA 1YCSB 4J6YA 5CK9A 2AZVA 1W4SA 2CZ6B 2QGFB 2ZPFB 4Q5WA 1RADB 4J7FA 4LDYA 3O5ZA 1ZBJA 4IIOA 1VQ5Q 3HRTA 3OYAA 2LCSA 2I0NA 2QQ9A 4QW2A 3MCAB 3RNJA 1Q82C 3QUIA 1CKBA 2PUKB 2HDAA 3MJXA 1O9SA 3I5SA 3UA6A 2QQSA 3I56T 1I0CA 2FO0A 4F04B 2XDBA 8AT1B 3PIOA 3P8BB 1Y07A 2C0TA 1TUDA 3G4SA 2E4HA 3URGA 2W0ZA 4QT7A 3CD6T 4HCCA 4MDXA 1UDLA 2V8KA 2YHTA 1SSFA 3MP8A 2LX9A 5GAMj 5IXFA 1VQ7T 2WSCE 3V8LA 4R55A 3AT1B 2KXDA 4N4HA 1F1BB 3CXCS 3GBQA 2OTLA 3G6EQ 1OYXA 2GF7A 4C8QF 4M75A 1SEMA 2DXUA 4J6WA 4JRKA 1K0SA 1QVGS 5HK3A 2F5TX 2RHZA 1NEGA 4J8OA 4AFQC 2CUDA 2RB6A 3EHRA 2DKGA 4IKFA 4NS5A 5LJ3h 3CC2A 2HL5C 4HVVA 4M75B 4XAXB 3I56Q 2YLCA 2YRCA 4OGCA 5LJ3g 5LJ5f 1YN8A 3PT9A 2HD0A 3CCUA 4LNPA 1I8FA 2FZCB 2DTIA 1M8VA 2M0OA 2RJCA 1LPLA 3CD6Q 2ZGWA 4M7AD 1M5Q1 3VS1A 1JXOA 5GAN3 3HHTB 3G71T 2B8AA 1VQ7Q 1C1AA 3RKXA 3A98A 3CCJT 1R77A 2EQKA 2V26A 2DL7A 2NLUA 4XK8E 2DX1A 4M75G 1RABB 2MWPA 1KC8U 1Y57A 2DD4A 3SWNB 3M56A 1W2BA 1KC8R 1BIAA 1NLOC 2DL3A 2EBPA 2DJZA 1N9RA 2ECZA 3CC4A 2HBWA 2MWOA 1JJ2S 2E5KA 5I22A 2RO0A 2A0FB 4QQGA 1T3SA 3NMZC 1S1NA 4M7AE 4M78A 3JCMJ 1WFWA 3EG2A 5FU7B 1YJNT 4CC3A 4X9CA 2NWMA 2EGEA 4NL2A 3JCMd 3G71Q 3LW5E 2CP3A 4M78B 3DB4A 2DTHA 4RTXA 2KMTA 3CCJQ 3GOXA 2C0IA 1R0BG 1V1CA 1X01A 1X43A 2DXCA 2JW4A 5KCOA 3M55A 3JB9F 1VQMA 2E5QA 3UT1A 1IZ6A 2E12A 4M77C 3VRZA 1K73U 2PVDB 3H41A 1K73R 2RK1A 1RAHB 3QJ6A 4JJDA 4FCYA 2RH2A 3META 4KGXB 1X2QA 4M78G 1NM7A 3CMAA 1YJ9A 2O88A 2CYZB 2MCNA 1YJNQ 1NYFA 2DERA 2DPPB 2DRKA 4GBQA 1NJIU 1B07A 2NUTA 4ZGEB 4KGVB 2LQKA 1NJIR 1FMWA 1GBRA 4ATOA 4K11A 4X9DA 3CCVQ 2EW3A 2YUOA 4EPCA 4ZN1A 4E7IA 4F17A 4FYYB 1KC8C 8ATCB 2O9VA 5L23A 2FRWA 4FYVB 1UHCA 1UUEA 4KT0E 1B7TA 1WHHA 1YCYA 2QA4A 1MUZA 2BZYA 2P0KA 4C92B 2JVVA 2LT1A 3SD4A 2X51A 4F7UE 1SRLA 1IRXA 4JPBW 4XTVA 1M2VB 5C6SA 1MGQA 3I9QA 2QI2A 4CC2A 2DJQA 1W1FA 1Q86U 3C0CA 2LCCA 4OF1A 1I81A 3A8OB 5GMKj 3C94A 3F70A 5AT1B 4PJNA 2ABLA 4M7AA 4XTUA 2F2VA 4N4IA 1NLPC 2OTJA 3RDVA 3C12A 1QKXA 4KGZB 4C0FA 1MNDA 4C92G 3H0HA 2L2PA 3OMCA 2Y4XA 1BYMA 2FB7A 4KBMB 1Q95G 4L5GA 1K73C 2DM1A 3LGFA 1U5SA 4AFZC 1VQKQ 4QVZA 2JS2A 5LJ3e 1M30A 5GAMf 1X75C 4PJOD 2ZPIB 1UGQB 2YWWA 3MHXA 1ZSZC 4BDYA 2DL5A 2DL4A 1WHKA 4DBQA 3MKDA 1NJIC 3DB3A 4EMGA 3KBGA 1JXMA 1BU1A 3QZ5B 3M0TA 3CCET 1YIJA 3L2WA 2RN8A 2GNCA 1OQKA 3EG3A 3OW2A 1NG2A 2D6FA 1EX4A 3KFVA 2JTEA 4R0KA 2ZPBB 1Q7YU 3VUZA 1Q7YR 3EG1A 3PTAA 1XTDA 4PJOE 5A0DA 1OU8A 4Y28E 2A7YA 2GCXA 4M75F 5KYWA 2EGAA 4J83A 2KBTA 4RG2A 4AMCA 1FMKA 4DEYA 1NE8A 2HAXA 4ZTJA 2QYZA 3MPUB 4MDWA 5CIUA 4RTWA 4EMHA 1N6AA 5KYWB 1WXTA 4F7UA 1XQHA 3OW2P 1DJ7B 2DMOA 3CCEQ 5CO7A 2EYYA 2J7IA 3JCMb 2D8HA 1B3QA 2R5AA 3H0FA 2KR3A 2MK5A 3FDRA 2L5QA 2HKNA 4QQ6A 1YWOA 3WVDB 4X34A 3EGXA 5KYYA 3M58A 1M3AA 3GPLA 1PHTA 1UEBA 1NPPA 3RMSA 1GCQC 3JCMh 2NUPA 2XHCA 2YXYA 5GAN5 1TXQA 2CH4W 3CCQT 3OBYA 3TREA 3JCMg 3UDCA 2V1RA 5LJ5d 2EVRA 3OYDA 5GAN4 4JJBA 4UC4A 4A4HA 4M7DE 4Z88A 4BACA 4IUUA 4M7DC 3O8VA 2GQVA 3ZEHA 2QK0A 2VVKA 1S72A 3PNWC 4IUQA 3NTIA 3E2UA 4WCIA 4M78F 5DLOA 1AWJA 2E70A 3PIPA 2DD5A 1RAGB 2RHYA 2FPFA 3HRUA 3M57A 3JRZA 3H9NA 2VXFA 4P5NA 3C95A 5FRNA 2K5FA 3EHQA 1Q7YC 5DM7R 1QVFA 3GIBA 1IGUA 1BCMA 2RMOA 5ECAA 3CCQQ 4JJNK 3QIIA 2LTOA 3J81E 1YJWA 1XNIA 2KXCA 4PJOA 3QYHB 3QSUA 2K57A 3TVTA 1K1ZA 3VS5A 5GMKh 1Q81U 1TUCA 1Q81R 2ZZDA 3FC3A 5CQXA 5KYXA 3VKIA 1QVFP 1VQ4A 5IT9E 3RESA 4LUDA 2QEXQ 1MV0B 2E41A 4ZGDB 2DNUA 2CREA 5GAOp 2RJEA 2LCLA 5KYXB 4E7HA 2D9TA 3CCRA 3JCMV 2J6FA 3Q1JA 4HA8A 1WHLA 4C92F 4AT1B 1OOTA 5DY9A 1YHQT 4D6WA 3NPFA 1RACB 2E64A 1VQLA 2CKKA 2DE0X 2EYWA 3QHSA 5FU6C 2F2WA 4GLKA 4F16A 4ELYC 1YWPA 1PRLC 1MHNA 1VQPA 5IAYA 3QO3A 2O31A 4DOVA 4OB2B 3PMIA 1AWOA 1AZEA 4A4GA 5GMKm 3ME9A 3QJYA 3JB9G 4QKUA 2XDDA 2RQUA 2MPXC 1WJRA 4CC7A 3A8LB 3WXMB 2OAWA 2F2XA 2XU8A 4M7AF 2RQTA 1E6GA 1UG1A 3A8MB 3EAEA 1WDXA 4PNOA 4C5EA 5GANj 4JLGA 4MZPA 3CEYA 1YHQQ 2LNHB 2COWA 4ME7A 1K76A 5DLQE 3INZA 1AOJA 4IURA 5HKCA 4A63B 4OMLA 4E2FB 4BD3A 3CBPA 3MEUA 1WLPB 4MZTA 3CCLT 1Q81C 4XQ3A 1OULA 4BI4A 4C0DB 2P4TA 2CT3A 2COYA 4WF2A 1WJQA 3JB9I 1XJWB 4BE1A 2K5IA 4RUGA 3MP1A 1NEBA 1GRIA 2O01E 1VYTA 3E19A 1PKTA 2IVWA 4PL6A 3SWNC 3G6ET 4JUVA 2E10A 2LQ8A 2AZSA 2LVMA 3CMEQ 3EG9A 1UGSB 1TG0A 4MMLA 1EZZB 3JCMe 5GAMd 3OY9A 4N0AC 2KROA 1VQ9A 2QDYB 2ZPHB 4C5IA 2GFAA 3EG9B 4NL3A 3RKWA 1D09B 3CCLQ 5IHKA 1K8AU 4LN2A 4V2SA 4M4ZA 1ZX6A 3OYCA 4XU0A 5GJWB 1K8AR 1D0ZA 1FXXA 2W10A 4RG8A 2BIVA 2AKLA 2H8HA 2YT6A 2VASA 4J9DA 5LJ5h 2YLBA 3JB9H 3HRSA 2QQRA 2NYSA 3LWIA 5LJ5g 1WX6A 2EFIA 4J9FA 3C4SA 2A36A 1OPLA 1QWEA 3I55A 2KSSA 2Z0WA 1BI3A 1HYOA 2E3IA 1VQ8A 1PD1A 5D6WA 5KE3A 2CSQA 2HEQA 2KAFA 4Z89A 4HCZA 3GF5A 4Y92A 2OI3A 4LDXA 4J7IA 3CXCA 5FW9A 4A4FA 1PD0A 2KDSA 2DVJA 2FZKB 1QP2A 3QG1A 3M0QA 2EPDA 4ELZC 1QVPA 1QVGA 2HMAA 3OYEA 5D7UA 1QW1A 4A54A 1IHVA 2VV5A 3OYMA 4A4KA 3NHNA 3CC7T 2MMPA 1TUGB 4J9HA 2OAUA 4B6MA 4BY6B 2E6NA 3OMGA 2DEUA 2EYZA 2D8JA 3E9FA 3HL8A 3OSVA 2L8DA 1T0HA 1Y96A 2C0OA 1KD1U 3QZ9B 1WYXA 1KD1R 1UHFA 3M53A 1WNLA 3CCST 2K3XA 3EGDA 4J6XA 2FL7A 4Z8AA 2JJ9A 2AHJB 3TQ7P 1T3LA 2RPNA 4RTYA 4M77D 2DVEA 1NPRA 2HSEB 3GNFB 3V8JA 2BTTA 5J26A 2D0NA 1RI9A 2QGGA 4AG1C 1G3TA 3UA7A 3M4GA 3EFOA 1K8AC 2RA2A 2EIFA 4JDSA 1WHGA 5D6YA 2JZ2A 4HCKA 1UFFA 2GTJA 4J9GA 4EDUA 4HKEA 4LDUA 1AT1B 5A0GA 4PJOF 4CI0C 3CC7Q 2KE9A 3ULRB 4OMPA 1JJ2A 1GFCA 5CKHA 4WTOB 1W2BP 2A37A 1QCFA 5EC7A 2LJ0A 1MMDA 4JS4A 3CCVT 1YITT 4BI3A 4AFUC 1VQOA 1G83A 2DF6A 3T9NA 2KYMA 1OX8A 1KQ1A 2X4WA 4RTTA 3CCSQ 1U06A 4M77E 1H3ZA 4LDWA 1VQ6A 1LCKA 5EG2A 1Y7XA 3VYGA 1ACMB 4KH1B 3AHUA 2LZ6B 2K3BA 4IUPA 2EKHA 4LUEA 1MNEA 1QQJA 3FB9A 2DBKA 1YI2Q 2ATCB 4J5YA 2LDMA 2QAZA 1RLQC 1JU5C 1VQNT 2GFUA 1C0MA 5IN1A 3SEMA 5GANf 4XU1A 3L2RA 1KQ2A 2K79A 2KT1A 2VUBA 4DOWA 1PRMC 1ZUUA 2P84A 4PLIA 2KK4A 1G3YA 2J6OA 2EJ9A 4OP0A 1YITQ 2NUTB 3J7AF 3PE0A 2WSFE 2QXFA 3UF4A 3DLLA 4OB0B 4F14A 1KD1C 1SHGA 4JJCA 1KIKA 1FWZA 1G3WA 1C6VX 2E3HA 1P92A 4C8QD 1VQKT 4XTYA 3VUBA 4BI8B 3M54A 2DFUA 4Y91A 2HCKA 5FLXE 1PM3A 3VS2A 4DBRA 2DZ9A 1VA7A 1VQNQ 4FSSA 5GJVB 4RCBA 2IPOB 1RAAB 1U1SA 3QDFA 2KRMA 2QDLA 3ZFJA 3LWHA 1UTIA 2G3RA 5GAMh 2FYKA 3I5RA 1WXBA 3CBMA 5LJ5e 1UGVA 1WZOA 5GAMg 2WSEE 2DTOA 4M7AB 2EJGA 1R8OB 2LQNA 3OYIA 1N27A 2OTLT 4C8QE 2BZXA 2KRSA 1OI1A 1YFNA 2JTMA 4C8QC 2PZ1A 5CQYA 4OMQA 1WQWA 2Y90A 3CCMA 1T0JA 1W6XA 3MEWA 3GNGA 2DZCA 2J6KA 3CC2T 1MMGA 4J9IA 4HXJA 4M77A 3M0SA 4FU6A 1JEGA 3L2UA 1G2BA 1KSWA 2ZPEB 3G4SQ 3CCUT 1V29B 1BIBA 2WACA 1UGPB 4ZNXA 2RQRA 4AG2C 2K3YA 2BUDA 2HZYA 4M7AG 4RTVA 3JB9J 1D1AA 5I11A 4A4EA 2RJFA 3OW2S 3LH0A 2OTLQ 1ZLMA 3VS4A 2RHUA 2A08A 4XU2A 5GAOl 3BDUA 1K0XA 1M90U 3CC2Q 2D1XA 3CC4T 1X6GA 2AT1B 1M90R 4GY5A 3FJ5A 5CKDA 3L2QA 5KYUA 1VQ5A 2VWFA 1IO6A 1IB8A 3CCUQ 4DEXA 1AWWA 4R56A 4M7DD 1BI1A 2YUQA 1X6BA 4C0ZA 5J3BA 2LC4A 3JCMP 4F7UB 3N5BB 3X25B 1K9AA 2EWNA 5I21A 3THKA 1GL5A 2KI7A 2RHXA
chains in the Genus database with same CATH topology
2E65A 1VQ9T 4C5GA 3PMIA 4M75B 4XAXB 2YLCA 4EMKC 4A4GA 3QYGB 4L6V5 3BY7A 4C92A 5GMKm 1VQMT 4HCBA 3ME9A 5HK0A 4OGCA 5LJ3g 3QJYA 1XOVA 5LJ5f 3JB9G 3PT9A 5CVIA 2HD0A 1HXDA 1O75A 2XDDA 3G4ST 3CCUA 1WJRA 1I8FA 2RI3A 2DTIA 3A8LB 2EYQA 3BW1A 1TH7A 1BI0A 1WGSA 2M0OA 2R57A 2RJCA 2XU8A 3SDZA 3WXMB 4C8QA 4M7AF 3OSSC 3A8MB 1WQ7A 2ZGWA 4M7AD 1M5Q1 3EAEA 3OYFA 4PNOA 4C5EA 3H6ZA 2P0PA 2V8JA 3HHTB 3M9QA 4JLGA 5GAN3 3G6EA 4F7UG 5GANj 1YJ9T 4MZPA 3G71T 3CMAT 4HT9A 3L42A 2B8AA 2YRVA 3CEYA 3KXTA 2IG0A 4ME7A 3RKXA 3CCJT 4OB2B 2EQKA 3OS0A 3H8ZA 4OMFB 4JS5A 1H641 2NLUA 4XK8E 5DLQE 3INZA 4M75G 2MWPA 1KC8U 2XG8D 2DD4A 2XICA 4IURA 3SWNB 3I56A 5HKCA 3I55T 3M56A 4E47A 1W2BA 5J39A 1BIAA 2P0QA 4BD3A 3CBPA 2DEQA 2V8IA 3MEUA 1VQ8T 2OTLT 3L1AA 2DJZA 4MZTA 4XU3A 3CCLT 1N9RA 2QEXT 1Q81C 4XQ3A 3CC4A 3E1SA 2MWOA 1JJ2S 1K9MU 4BI4A 2CZ1B 4C0DB 1IREB 2P4TA 2RO0A 5GAOm 4WF2A 1WJQA 2FHDA 4JLIA 4QQGA 3JB9I 1QVFS 5GAOn 3RIRA 3CD6A 4BE1A 2K5IA 1RL2A 2HBPA 2H3JA 3FEOA 3MP1A 3OB9A 5AYFA 4C0GA 3FLGA 1N8RU 1KQSA 1M90C 1JBMA 4LDVA 4M77B 2DK3A 4M78A 4M7AE 3OA6A 5I2MA 1VQ7A 1FX7A 2O01E 3JCMJ 5FU7B 1YHQA 3E19A 1YJNT 1VIEA 3UWNA 5I2SA 3PMTA 4X9CA 2IVWA 1EIFA 4PL6A 3SWNC 2PUOB 4NL2A 3JCMd 5M9OA 3G6ET 4JUVA 2E10A 2LQ8A 2ZCFB 3LW5E 4M78B 2VGMA 3DB4A 3LGLA 5LL6S 2DTHA 2LVMA 3JCMc 2K4YA 1UGSB 2KMTA 2EJFA 3OYHA 3GOXA 4MMLA 3JCMe 5A2QE 1LNXA 5GAMd 1X01A 3V7SA 2O4XA 4C0DC 3OY9A 4PJOB 4N0AC 1VQ9A 2DXCA 2QDYB 5KCOA 1PSEA 2ZPHB 3M55A 1AHJB 3NFCA 3OS5A 4C5IA 3JB9F 1M1FA 5LJ3j 1VQMA 2GFAA 2E5QA 2KVQG 4XTXA 3RKWA 4NL3A 1OZ2A 3VV0A 3HSBA 3UT1A 1IZ6A 3BFMA 5GAMe 3MEVA 3JB9D 2OTJT 3E9GA 2E12A 2JNGA 4M77C 1K73U 1K8AU 4V2SA 3OYCA 2PVDB 4XU0A 1ZBXA 4BDZA 2QTXA 3RKYA 3PFSA 2RK1A 4M77G 5KCHA 1FXXA 3QJ6A 3HKSA 2LRQA 2JOYA 1VUBA 2DO3A 5FRMA 4RG8A 4KULA 2RH2A 2BIVA 3META 4BE2A 2K2VA 4OGEA 1D3BA 4M78G 3CMAA 1YJ9A 3G71A 5GAN8 5LJ5h 2YLBA 4QQDA 2VYTA 3JB9H 2CYZB 2XIDA 3HRSA 3V8KA 5CR2A 2QQRA 1M1KU 3CMEA 1LJOA 3X26B 2DPPB 3LWIA 3CCJA 4PJOC 5LJ5g 4E7LA 1ZHIA 2EFIA 1NJIU 1K8AC 4ZGEB 4PJOG 2LQKA 3C4SA 3S3NA 3I55A 2KSSA 3S3OA 4ATOA 3P8DA 1BI3A 4E7KA 1VQ8A 3QBYA 5D6WA 2VGNA 5KE3A 5GANd 3CCLA 3OYBA 2PU9B 4X9DA 4EPCA 2KAFA 4ZN1A 1Q86C 3QPHA 4N4GA 4HCZA 3GF5A 4E7IA 1U1TA 3WVEB 1VQOT 1KC8C 4LDXA 5GANe 4M7DA 4J7IA 3CXCA 5KH6A 4A4FA 4XTWA 3VJPA 2KDSA 2RI2A 1VQ6T 2XI9A 4KT0E 3J80E 1QP2A 3QG1A 4BB7A 4OB3B 1YCYA 3P8HA 4JRQA 2I2LA 2QA4A 4ELZC 1QVPA 1QVGA 2RD1A 2P0KA 4C92B 3OYEA 1QW1A 2JVVA 2E6ZA 1K9MC 2LT1A 4FT2A 3SD4A 4A54A 1U8RA 4M7DB 1YJNA 2VV5A 5HY6A 4F7UE 3OYMA 1I5LA 4A4KA 3CC7T 2F69A 3VYHB 2MMPA 2M9UA 1QP3A 3OYNA 4BY6B 2OAUA 1N8RC 2L3RA 4XTVA 4MMKA 4C8QB 2RJDA 5C6SA 2E6NA 1MGQA 1KHIA 3CMET 3TCJA 4RMOA 3OMGA 4M75E 5CKEA 4DA4A 2QI2A 1GXIE 4M75C 3OSVA 3E9FA 3HL8A 1Q86U 2LNVA 3OYGA 2L8DA 3CCVA 3MO8A 1G3SA 1Y96A 2LCCA 4OF1A 1I81A 3A8OB 5GMKj 5GAN2 3C94A 5GAN7 1KD1U 3QZ9B 3G7ZA 3JCMW 3F70A 3ZBDA 2EAYA 4M7AA 4YTLA 1N9SA 1PSFA 4XTUA 3M53A 1WNLA 3CCST 2K3XA 3ASKA 4J6XA 4N4IA 2OTJA 4M77F 4MZMA 2C06A 3C12A 2FL7A 4HT8A 4OB1B 2AHJB 3OS2A 2X4YA 4C0FA 3OQ5A 4M77D 3OYJA 2X4JA 4C92G 2DVEA 1NPRA 2RHIA 3GNFB 2CGHA 2RM4A 3V8JA 3OMCA 4M7DG 3HFNA 3KUFA 3HP9A 5J26A 1UGRB 2Y4XA 1G3TA 1BYMA 2CZ7B 2E1HA 2FB7A 4FM4B 3M4GA 4KBMB 3TU4K 1KQSS 4L5GA 5GAOq 5LJ3d 3JCMf 2RA2A 1K73C 4RCCA 2EIFA 4JDSA 4C8QG 3LGFA 5D6YA 2JZ2A 2QA4T 4L59A 2MF2A 4EDUA 4C5HA 4HKEA 4LDUA 4QVZA 2R5MA 3X28B 3HPWA 5A0GA 3M59A 5LJ5j 4PJOF 4CI0C 3CPWA 1I4K1 3OBWA 5LJ3e 1JJ2A 5GAMf 1X75C 5CKHA 3OYKA 2ZPIB 1UGQB 3HFOA 5CAIA 3MHXA 2JTFA 4PJOD 3EFRA 2QQBA 3S3MA 4BDYA 1M1KC 3V7CA 3RUXA 4JS4A 3JAME 2JUFA 2M1HA 3CCVT 5GAOr 1YITT 1NJIC 3DB3A 3UPUA 3SB2A 4EMGA 3KBGA 3L2VA 3DKMA 3LLRA 4BI3A 1VQOA 1ZQ1A 3T9NA 4PLLA 3QZ5B 1KQ1A 2X4WA 3CCET 4M77E 1YIJA 2DIGA 4IUTA 4VUBA 1H3ZA 1M9SA 2L89A 4LDWA 1VQ6A 2EQJA 3L2WA 5EG2A 1BKBA 2O4XB 1Y7XA 5FU7C 3VYGA 5L8RE 3FRNA 4TVRA 1S72T 1VQKA 3OW2A 2HNIA 3AHUA 2D6FA 1JB0E 2EQUA 4IUPA 4M78E 2XKOC 4F7UF 3EFSA 3LYIA 4M78C 3CC7A 2ZPBB 4DQ2A 2D0QB 3FB9A 2BKDN 1Q7YU 3OS1A 4J5YA 2LDMA 3A5ZB 5FU6B 2A3LA 3VUZA 3CCMT 4EMKA 3PTAA 1XTDA 4FIBA 2GFUA 1VQNT 4PJOE 5A0DA 3V7RA 1NZ9A 5IN1A 4Y28E 2A7YA 5GANf 2GCXA 4M75F 4XU1A 2KY9A 3L2RA 4RKUE 1KQ2A 2PVOB 4J83A 4RG2A 1D3BB 1Y71A 2VUBA 4DOWA 2F5KA 4M75D 1G5VA 1NE8A 2HAXA 4ZTJA 4EMKB 3CBOA 4PLIA 1B34A 4MDWA 2KK4A 5CIUA 1G3YA 4XTZA 3CCSA 2EJ9A 2XK0A 4OP0A 1OZ3A 1N6AA 4EMHA 4NOYA 4F7UA 3J7AF 1XQHA 4FT4A 2WSFE 3L2ZA 3A8HB 1Q82U 1YJWT 2QXFA 4C92D 1DJ7B 2LT4A 2RI5A 4OB0B 3DLLA 2PVGB 1KD1C 1B34B 5CO7A 3DLMA 4PKCC 1YIJT 4ZN3A 3JCMb 4B9WA 1FWZA 1G3WA 2R5AA 1UB4A 3X20B 3NTKA 1P92A 3FDRA 4C8QD 2L5QA 3FIFA 5A0LA 1YI2A 1VQKT 3GLXA 5KE2A 2DIQA 4QQ6A 4XTYA 3VUBA 4BI8B 4FSXA 5GMKe 1YBYA 3M54A 4Y91A 4A53A 2XD0A 3WVDB 5FLXE 2R58A 4X34A 3M4YA 2DZ9A 3M58A 1VQ4T 5CKFA 2CZ0B 3GPLA 1UEBA 1WJSA 4RCBA 4KUIA 1NPPA 3RMSA 3R6OA 3JCMh 2XHCA 5GAN5 3CCQT 1YITA 1X6OA 3BDLA 3OBYA 1U1SA 4IUVA 2DXBA 2EKOA 3JCMg 3TREA 2CS7A 3UDCA 5LJ5d 4II1A 3CCRT 4QVDA 1W2BS 3NTHA 3ZFJA 3LWHA 1VQ5T 4JRPA 2QQAA 2VXEA 1JRIA 3CCEA 3OYDA 2G3RA 5GAMh 5GAN4 1M1GA 2FYKA 4C92E 2ZPGB 3MP6A 4UC4A 4A4HA 3CBMA 5CKBA 4C92C 4KUDK 3SWNA 2KQWA 5LJ5e 1Y96B 4BACA 5LJ3f 4IUUA 3TEEA 5GAMg 2Y4YA 3O8VA 4M7DC 2GQVA 3RERA 2PQWA 3ZEHA 1S72A 2WSEE 3CPFA 2DTOA 4M7AB 2EJGA 3PNWC 1HK9A 1R8OB 4IUQA 3NTIA 1N27A 4BUGA 3OYLA 3OYIA 4C8QE 4BY6C 2FVUA 1OI1A 3A8GB 2JTMA 5GMKl 1VQLT 4M78F 4OVAA 4C8QC 5DLOA 1WPYA 4FL6A 2QEXA 2VC8A 5CQYA 2E70A 4N0AA 4O5VA 4M78D 3PIPA 1YI2T 1WQWA 2DD5A 2Y90A 3CCMA 1VQPT 2RHYA 4LD6A 1VQNA 4B9XA 3MEWA 3GNGA 5CCAA 2DZCA 2RK2A 2XDPA 3HRUA 3M57A 3M5AA 4ZTFA 3JRZA 3CPWS 3CC2T 5FROA 2VXFA 4M77A 3QDRB 4P5NA 3JCMQ 3C95A 4BE0A 2K5LA 4FU6A 3ER0A 5FRNA 2K5FA 2MAMA 3JSCA 4O6JA 1Q7YC 4M7DE 3QXEB 2DXTA 4J6YA 1KHCA 4JRIA 5DM7R 1QVFA 2HQXA 3LX7A 3L2UA 3GIBA 5CK9A 2ZPEB 4QVCA 3CCUT 1W4SA 2CZ6B 1V29B 2ZPFB 1BIBA 2WACA 4JJNK 4LD9K 1UGPB 4Q5WA 3QIIA 2LTOA 4M7AC 3J81E 1YJWA 2K3YA 4J7FA 4LDYA 2BUDA 4M7AG 1XNIA 5GANh 3HRTA 3JB9J 3OYAA 4PJOA 3QYHB 1M8VA 3QSUA 5GANg 2DAQA 2K57A 2QQ9A 3OYYA 4QW2A 3MCAB 4A4EA 2RJFA 5GAN6 1Q82C 2X35A 3QKJA 3OW2S 3QUIA 3LH0A 3PGGA 2PUKB 5GMKh 1Q81U 2MI6A 1O9SA 1LOJA 2RHUA 4XU2A 5GAOl 2QQSA 2ZZDA 3FC3A 5CQXA 3I56T 3VKIA 3BDUA 1VQ4A 5IT9E 2XDBA 2JN0A 3PIOA 3P8BB 1Y07A 4E7JA 4CRIA 1M90U 3RESA 2E41A 3G4SA 1BI2A 4ZGDB 3CC4T 3JCMX 4GY5A 5GAOp 3CCQA 3URGA 2RJEA 2LCLA 4E7HA 5CKDA 2D9TA 3VU3C 4NS5A 5C0MA 3L2QA 3CCRA 2M16A 3JCMV 1VQ5A 3CD6T 4HCCA 4MDXA 3MEAA 3Q1JA 5D6XA 2EQMA 2V8KA 3X24B 4HA8A 3RMQA 1KG1A 2YHTA 4C92F 1SSFA 3MP8A 2LX9A 5GAMj 1VQ7T 4M7DF 5DY9A 2WSCE 3V8LA 4D6WA 5GMKi 4R55A 4Z02A 1YHQT 3SFMA 4R56A 4N4HA 4M7DD 3CXCS 2E64A 1BI1A 2OTLA 1VQLA 2CKKA 1OYXA 3S6WA 4C0ZA 2GF7A 3QHSA 5J3BA 2LC4A 4C8QF 5FU6C 4M75A 4F7UB 3JCMP 2DXUA 4GLKA 4J6WA 4ELYC 3N5BB 1VIFA 3X25B 4JRKA 3GP8A 1QVGS 4ZGJB 5HK3A 1MHNA 2F5TX 2HQEA 2RHZA 2EWNA 2X4XA 1RI0A 5I21A 1VQPA 4J8OA 5IAYA 3QO3A 3FJPA 4DOVA 2RB6A 2RHXA 2DKGA 4IKFA 1M4ZA 5LJ3h 3CC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E65 A;  4M7D C;  5GAM g;  4M75 B;  3RER A;  2YLC A;  4EMK C;  4C92 A;  3BY7 A;  2DTO A;  1D3B A;  2EJG A;  4M7A B;  1HK9 A;  4M78 G;  3V7C A;  3RUX A;  5GMK m;  5LJ3 g;  5GAN 8;  4C8Q E;  5GMK l;  5LJ5 f;  2YLB A;  5LJ5 h;  5GAO r;  3JB9 G;  3JB9 H;  3V8K A;  3SB2 A;  4M78 F;  4C8Q C;  4EMG A;  1LJO A;  1WPY A;  1HXD A;  2VC8 A;  4PJO C;  5LJ5 g;  4N0A A;  1KQ1 A;  4M78 D;  1I8F A;  1WQW A;  2DTI A;  2Y90 A;  3BW1 A;  1TH7 A;  4M77 E;  4C8Q A;  4PJO G;  1M8V A;  4M7A F;  2DZC A;  1WQ7 A;  2ZGW A;  4M7A D;  1M5Q 1;  2VXF A;  4M77 A;  3JCM Q;  4PNO A;  5GAN 3;  5GAN d;  3AHU A;  2HNI A;  5GAN j;  4M7D D;  4F7U G;  4HT9 A;  4X9D A;  4J6Y A;  2DXT A;  4JRI A;  4M78 E;  4F7U F;  3EFS A;  3GIB A;  4M78 C;  1U1T A;  3RKX A;  4QVC A;  4DQ2 A;  3FB9 A;  5GAN e;  1BIB A;  4M7D A;  4J5Y A;  4XTW A;  1H64 1;  4EMK A;  4M7A C;  3INZ A;  4M75 G;  4PJO E;  3SWN B;  3V7R A;  4M7A G;  5GAN h;  5GAN f;  4M75 F;  1YCY A;  1BIA A;  2I2L A;  4XU1 A;  3JB9 J;  1KQ2 A;  2DEQ A;  2RD1 A;  4C92 B;  1D3B B;  3L1A A;  4PJO A;  2DJZ A;  4M75 D;  4XU3 A;  4A54 A;  3QSU A;  4M7D B;  5GAN g;  2K57 A;  4F7U E;  1N9R A;  1I5L A;  4EMK B;  4XQ3 A;  5GAN 6;  1B34 A;  4XTZ A;  2EJ9 A;  3QUI A;  4OP0 A;  3PGG A;  4EMH A;  4XTV A;  4MMK A;  4NOY A;  4C8Q B;  4WF2 A;  4F7U A;  5GMK h;  5GAO m;  4JLI A;  1LOJ A;  3SWN A;  3JB9 I;  1MGQ A;  4XU2 A;  3L2Z A;  5GAO n;  3RIR A;  5GAO l;  4M75 E;  4C92 D;  3BDU A;  1B34 B;  1JBM A;  4M75 C;  4M77 B;  4M78 A;  4M7A E;  2JN0 A;  3JCM b;  1Y96 A;  3JCM J;  1I81 A;  5GMK j;  5GAN 2;  5GAN 7;  3RES A;  2E41 A;  3JCM W;  2EAY A;  4X9C A;  4M7A A;  4C8Q D;  3FIF A;  3JCM X;  1N9S A;  4XTU A;  3SWN C;  5GAO p;  1WNL A;  4NL2 A;  3JCM d;  4J6X A;  4XTY A;  4JUV A;  3VU3 C;  2E10 A;  4M77 F;  5GMK e;  4M78 B;  4HT8 A;  4Y91 A;  2DTH A;  3JCM V;  3JCM c;  4A53 A;  4M77 D;  4C92 G;  2EJF A;  2DVE A;  4HA8 A;  2CGH A;  2RM4 A;  2DZ9 A;  2YHT A;  4MML A;  3V8J A;  3HFN A;  4C92 F;  3JCM e;  4M7D G;  1LNX A;  5GAM d;  1X01 A;  3V7S A;  5GAM j;  4PJO B;  4M7D F;  4N0A C;  5DY9 A;  4RCB A;  2E1H A;  2FB7 A;  3V8L A;  3M4G A;  5GMK i;  3JCM h;  5LJ3 d;  3JCM f;  2RA2 A;  5LJ3 j;  4RCC A;  4C8Q G;  5GAO q;  3JB9 F;  2E64 A;  4XTX A;  5GAN 5;  3RKW A;  4NL3 A;  3HSB A;  3BFM A;  5GAM e;  1U1S A;  3QHS A;  4C8Q F;  3JB9 D;  3JCM P;  4M77 C;  4M75 A;  3JCM g;  4F7U B;  2DXU A;  5LJ5 d;  4V2S A;  5LJ5 j;  4J6W A;  4XU0 A;  4PJO F;  2QTX A;  3RKY A;  4QVD A;  1I4K 1;  4M77 G;  4JRK A;  5LJ3 e;  2VXE A;  1JRI A;  5GAM h;  5GAM f;  2EWN A;  5GAN 4;  5I21 A;  2FYK A;  3HFO A;  4C92 E;  5CAI A;  4PJO D;  3QO3 A;  3EFR A;  3FJP A;  2RB6 A;  4C92 C;  4M7D E;  2DKG A;  5LJ5 e;  1Y96 B;  5LJ3 h;  5LJ3 f; 
#chains in the Genus database with same CATH topology
 2LJ3 A;  4EMK C;  4E6R A;  3QYG B;  4L6V 5;  1VQM T;  5HK0 A;  2V1Q A;  2VB6 A;  4GLM A;  1HSQ A;  4PFZ A;  1CSK A;  1QWF A;  1O75 A;  4PK4 A;  3CC4 Q;  2JT4 A;  4C8Q A;  2EYQ A;  2DBM A;  1TH7 A;  1BI0 A;  1WGS A;  2R57 A;  3BW1 A;  3EGX B;  3VS0 A;  1KJW A;  3SDZ A;  5KYY B;  4OMO A;  1WA7 A;  2FEI A;  3OYF A;  2NUP B;  2V8J A;  3G6E A;  4F7U G;  1YJ9 T;  3CMA T;  4HT9 A;  1AWX A;  1WHM A;  3KXT A;  2KYB A;  2O9S A;  5HCK A;  3OS0 A;  1BB9 A;  2CP0 A;  1ZSZ A;  1WXU A;  4JS5 A;  2CP2 A;  2XG8 D;  2XIC A;  3I56 A;  5J39 A;  4J9C A;  2YUN A;  3VS3 A;  2DEQ A;  2V8I A;  3L1A A;  4XU3 A;  2QEX T;  2AKK A;  3E1S A;  4OMM A;  1EFN A;  1ABO A;  4J9B A;  1VQM Q;  2LX7 A;  4PFP A;  6AT1 B;  2G6F X;  2FHD A;  2EGC A;  1QVF S;  7AT1 B;  5GAO n;  3CD6 A;  1RL2 A;  2H3J A;  1KQS A;  1N8R U;  1M90 C;  1JBM A;  4LDV A;  1N8R R;  1Z9Z A;  2ZAE A;  1AZG B;  1VQ7 A;  3UWN A;  1HD3 A;  3PMT A;  2RNA A;  1BCO A;  2PUO B;  2DYI A;  3M0U A;  3CMA Q;  1YJ9 Q;  2ENM A;  5LL6 S;  1IGQ A;  1M3B A;  5KYN A;  2K4Y A;  2EJF A;  1FMV A;  2YDL A;  4KH0 B;  2O4X A;  4C0D C;  4PJO B;  4OMN A;  5LJ3 j;  2KVQ G;  4XTX A;  1OZ2 A;  1TOV A;  2FPE A;  5GAM e;  2OTJ T;  3E9G A;  2K9G A;  2JNG A;  3CQT A;  4DBF A;  3LH5 A;  1ZBX A;  1KK7 A;  1X27 A;  5KCH A;  3HKS A;  2LRQ A;  2JOY A;  1VUB A;  2DO3 A;  4BE2 A;  4FYW B;  1D3B A;  2QA4 Q;  3G71 A;  5GAN 8;  1I1J A;  2VYT A;  3V8K A;  2XID A;  5CR2 A;  1M1K U;  3X26 B;  2EYX A;  3CCJ A;  1M1K R;  4E7L A;  1ZHI A;  4PJO G;  1GCQ A;  2PTK A;  3S3N A;  1OU9 A;  3P8D A;  4E7K A;  3QBY A;  5GAN d;  3QPH A;  4N4G A;  1U1T A;  4M7D A;  4XTW A;  2OTJ Q;  2F1L A;  1M3C A;  2RI2 A;  3EGU A;  2XI9 A;  4BB7 A;  3EH1 A;  3P8H A;  4JRQ A;  1TTH B;  2E6Z A;  2JMC A;  4M7D B;  1U8R A;  2DYB A;  4J9E A;  1YJN A;  1I5L A;  3VYH B;  3OYN A;  2LMJ A;  1N8R C;  2GBQ A;  4MMK A;  3CME T;  1UE9 A;  4RMO A;  2OX7 A;  4M75 E;  4DA4 A;  1GXI E;  4M75 C;  2MIO A;  2LNV A;  4RTZ A;  3CCV A;  2DL8 A;  4JZ4 A;  2FZG B;  3ZL7 C;  1IHW A;  2ED0 A;  3ZBD A;  2JMA A;  2EAY A;  4YTL A;  4M77 F;  4MZM A;  4HT8 A;  1Y0M A;  3OYJ A;  1U3O A;  1PG5 B;  1X2K A;  2CGH A;  4M7D G;  1YIJ Q;  1UGR B;  3VS7 A;  2E1H A;  5GAO q;  1GCP A;  4RCC A;  2YRD A;  1TWB A;  5FWB A;  4L59 A;  2MF2 A;  2R5M A;  3X28 B;  3M59 A;  2QTV A;  3U23 A;  3CPW A;  2CUB A;  3OYK A;  3HFO A;  5CAI A;  2JTF A;  2QQB A;  1M1K C;  2M1H A;  1M2O A;  5GAO r;  5IH2 A;  1LVK A;  3SB2 A;  2JS0 A;  1ZQ1 A;  1ABQ A;  2DIG A;  1SG5 A;  4VUB A;  1M9S A;  2L89 A;  2EQJ A;  2LQW A;  5FU7 C;  1WHJ A;  3FRN A;  1S72 T;  1VQK A;  2HNI A;  1JB0 E;  3CPW P;  4M78 E;  2XKO C;  4F7U F;  4M78 C;  2L3P A;  1E7O A;  4DQ2 A;  2D0Q B;  2YSQ A;  5FU6 B;  1NZ9 A;  2SRC A;  4RKU E;  2PVO B;  1Y71 A;  1TSF A;  4JZ3 A;  3EG0 A;  4XTZ A;  2YUP A;  3A8H B;  1YJW T;  4C92 D;  2RI5 A;  4HVW A;  2PVG B;  1SPK A;  4X1V A;  4B9W A;  4CC4 B;  5IHI A;  1UB4 A;  4KRT A;  3X20 B;  3FIF A;  1S72 Q;  3GLX A;  5KE2 A;  2DIQ A;  5GMK e;  3REB B;  2X3X D;  2DLP A;  2R58 A;  2BZ8 A;  2FG0 A;  1VQ4 T;  2GQI A;  2CZ0 B;  3D7S B;  2XMF A;  1OEB A;  2DET A;  3JV3 A;  3R6O A;  2L3Q A;  3BDL A;  2CS7 A;  2CSI A;  3CXC P;  4II1 A;  3CCR T;  4QVD A;  1W2B S;  9ATC B;  2QQA A;  2IIM A;  2VXE A;  3CCE A;  1HJD A;  1M1G A;  2ROL A;  4C92 E;  3MP6 A;  4PFO A;  4C92 C;  5CKB A;  3SWN A;  2KQW A;  1Y96 B;  1QVG P;  5LJ3 f;  1YJW Q;  1I07 A;  2PQW A;  4EIK A;  1HK9 A;  1E6H A;  1W70 A;  2KGT A;  1VQL T;  3EGD B;  1MMN A;  4OVA A;  1WPY A;  4FL6 A;  1VYV A;  2GGR A;  4N0A A;  1AD5 A;  4O5V A;  1YI2 T;  3VRY A;  2EQI A;  1VQP T;  2HL3 A;  4LD6 A;  4B9X A;  5CCA A;  2RK2 A;  2XDP A;  3M5A A;  3TSW A;  4BE0 A;  3EFO B;  1SHF A;  1VQ4 Q;  4O6J A;  3JSC A;  3QXE B;  2DXT A;  4JRI A;  1KHC A;  2HQX A;  3LX7 A;  3PVL A;  4QVC A;  2OJ2 A;  2LP5 A;  2QAS A;  4ESR A;  4LD9 K;  4M7A C;  3CCR Q;  4ANJ A;  2K6D A;  5GAN h;  1VYU A;  2CT4 A;  5GAN g;  2DAQ A;  2MOX A;  3OYY A;  5GAN 6;  2ROT A;  2X35 A;  2KEA A;  3QKJ A;  3PGG A;  2MI6 A;  2DRM A;  1VQL Q;  1SRM A;  1LOJ A;  1JJ2 P;  4LXC A;  2M51 A;  2MYS A;  1VQP Q;  2KRN A;  2JN0 A;  4E7J A;  1QCO A;  4CRI A;  1BI2 A;  3JCM X;  3CCQ A;  3IQL A;  1ZUY A;  3VU3 C;  4FW1 A;  5C0M A;  2RF0 A;  2M16 A;  3MEA A;  5D6X A;  3X24 B;  2EQM A;  3RMQ A;  2DIL A;  1KG1 A;  4M7D F;  5GMK i;  4Z02 A;  3SFM A;  1ARK A;  3S6W A;  1VIF A;  3GP8 A;  4ZGJ B;  2HQE A;  2X4X A;  1RI0 A;  4LE9 A;  2KT8 A;  3FJP A;  2JM9 A;  2RQV A;  1M4Z A;  2QEX A;  2E65 A;  2H3E B;  4C5G A;  1VQ9 T;  4C92 A;  3BY7 A;  4HCB A;  1XOV A;  5CVI A;  1HXD A;  3G4S T;  1YNZ A;  2RI3 A;  1M2V A;  2BE9 B;  3OSS C;  1WQ7 A;  1JQQ A;  1RAI B;  3M0P A;  3H6Z A;  2P0P A;  3M9Q A;  3L42 A;  2YRV A;  4FW2 A;  2IG0 A;  5FWC A;  3VS6 A;  1G8X A;  1NYG A;  3H8Z A;  4OMF B;  5IXB A;  1H64 1;  1ZUK A;  1Q86 R;  1RAE B;  3I55 T;  4AFS C;  4E47 A;  2P0Q A;  1VQ8 T;  2AK5 A;  1NBE B;  1VQ9 Q;  1K4U S;  1K9M U;  2CZ1 B;  1IRE B;  5GAO m;  1K9M R;  4JLI A;  1JO8 A;  3RIR A;  2HBP A;  2J06 A;  4C0G A;  3FEO A;  3OB9 A;  5AYF A;  3FLG A;  1AEY A;  1PNJ A;  4M77 B;  1QKW A;  2DK3 A;  1MV3 A;  3RBB B;  3OA6 A;  5I2M A;  1FX7 A;  1YHQ A;  1VIE A;  5I2S A;  1SKU B;  1EIF A;  2HSP A;  1D0X A;  5M9O A;  2GTO A;  2VKN A;  2ZCF B;  2VGM A;  3LGL A;  1ZA1 B;  4E7Z A;  3JCM c;  3EH2 A;  3H0I A;  3OYH A;  2CH4 A;  5A2Q E;  1LNX A;  1RLP C;  3V7S A;  1PSE A;  2K2M A;  3NFC A;  1AHJ B;  3OS5 A;  3I55 Q;  1M1F A;  1PCX A;  1RUW A;  1VQ8 Q;  3HSB A;  3VV0 A;  3BFM A;  3MEV A;  3JB9 D;  3QWY A;  1AVZ C;  4ORZ A;  4BDZ A;  2QTX A;  3RKY A;  3PFS A;  4M77 G;  2ESW A;  4HVU A;  5FRM A;  1H3H A;  4KUL A;  2CP7 A;  4PJM A;  2K2V A;  4OGE A;  2O2O A;  1IXD A;  4QQD A;  3CME A;  1LJO A;  1GFD A;  5KYU B;  4PJO C;  1RAF B;  3TSZ A;  3S3O A;  2K7A A;  2P4R A;  2VGN A;  3CCL A;  3OYB A;  2PU9 B;  1Q86 C;  3WVE B;  1VQO T;  1D0Y A;  2X9H A;  5GAN e;  1QLY A;  2J05 A;  5KH6 A;  4PJJ A;  1V76 A;  2AIR B;  3VJP A;  2L0A A;  1M8M A;  1VQ6 T;  3J80 E;  4OB3 B;  2NUZ A;  1TS9 A;  2I2L A;  2LJ1 A;  2RD1 A;  4IIM A;  1J3T A;  1K9M C;  4FT2 A;  5HY6 A;  2F69 A;  1OX9 A;  2M9U A;  1QP3 A;  2L3R A;  4C8Q B;  2CDT A;  2RJD A;  1KHI A;  3TCJ A;  5CKE A;  1OPK A;  3OYG A;  3MO8 A;  1G3S A;  5GAN 2;  5GAN 7;  3G7Z A;  3JCM W;  4PJL A;  1N9S A;  1PSF A;  3M0R A;  5IHN A;  3ASK A;  3RR6 A;  1ZSZ B;  2C06 A;  1PC0 A;  4OB1 B;  3OS2 A;  2X4Y A;  3OQ5 A;  3HTR A;  2X4J A;  1VQO Q;  2RHI A;  2RM4 A;  2KNB B;  3HFN A;  3KUF A;  3HP9 A;  2FPD A;  4FYX B;  1X69 A;  1VQ6 Q;  2CZ7 B;  2CP5 A;  4FM4 B;  3TU4 K;  1KQS S;  5LJ3 d;  3JCM f;  4C8Q G;  1WIE A;  2QA4 T;  2M02 A;  1N5Z A;  1SF9 A;  4C5H A;  3HPW A;  1I5O B;  1PWT A;  5LJ5 j;  1I4K 1;  2L3S A;  3OBW A;  3EFR A;  3UAT A;  3S3M A;  1A0N B;  3V7C A;  3RUX A;  3JAM E;  2JUF A;  2SEM A;  2ED1 A;  1VOM A;  3UPU A;  3L2V A;  3DKM A;  3LLR A;  3NGP A;  1TU0 B;  4PLL A;  2HKQ B;  4IUT A;  1KQS P;  1BKB A;  2O4X B;  1KFZ A;  5L8R E;  1Z9Q A;  4TVR A;  2EQU A;  1SSH A;  3EFS A;  3LYI A;  3CC7 A;  1D1C A;  2BKD N;  2CP6 A;  3OS1 A;  3CCM T;  3A5Z B;  2A3L A;  2A28 A;  4EMK A;  3A1P A;  4FIB A;  3BE3 A;  3V7R A;  1D1B A;  2KY9 A;  1D3B B;  2F5K A;  4M75 D;  3R6N A;  1G5V A;  4EMK B;  2X3W D;  3CBO A;  1B34 A;  1M27 C;  3CCS A;  2XK0 A;  1BBZ A;  1OZ3 A;  4NOY A;  1OV3 A;  4FT4 A;  3L2Z A;  1Q82 U;  3REA B;  2LT4 A;  1Q82 R;  2RQW A;  1B34 B;  1ZSG A;  4DBH A;  3DLM A;  4PKC C;  1YIJ T;  1QMC A;  4ZN3 A;  2M0Y A;  1MMA A;  3NTK A;  1ZA2 B;  3G1J A;  5A0L A;  1UEC A;  1YI2 A;  2B86 A;  3QWX X;  4FSX A;  1GBQ A;  1YBY A;  4A53 A;  2XD0 A;  1R0C B;  3M4Y A;  3CCM Q;  1H8K A;  5CKF A;  1WJS A;  4RTU A;  4KUI A;  3I35 A;  4D8D A;  2DA9 A;  3PVQ A;  1YIT A;  1X6O A;  4IUV A;  2DXB A;  2EKO A;  1BK2 A;  1WI7 A;  1FYN A;  2JM8 A;  3NTH A;  4D8K A;  1VQ5 T;  4JRP A;  4E7S A;  1JRI A;  1QCN A;  2ZPG B;  2QG9 B;  4KUD K;  3TEE A;  2Y4Y A;  3RER A;  3CPF A;  1CKA A;  2COZ A;  3OYL A;  1YP5 A;  4BUG A;  4BY6 C;  2FRY A;  2FVU A;  3A8G B;  5GMK l;  2JXB A;  2VC8 A;  4M78 D;  1H92 A;  2BE7 D;  1VQN A;  3SHW A;  4ZTF A;  1PKS A;  3CPW S;  5FRO A;  3QDR B;  2PNI A;  3JCM Q;  1UJ0 A;  1UJY A;  2HQH A;  2K5L A;  3ER0 A;  2MAM A;  1YCS B;  4J6Y A;  5CK9 A;  2AZV A;  1W4S A;  2CZ6 B;  2QGF B;  2ZPF B;  4Q5W A;  1RAD B;  4J7F A;  4LDY A;  3O5Z A;  1ZBJ A;  4IIO A;  1VQ5 Q;  3HRT A;  3OYA A;  2LCS A;  2I0N A;  2QQ9 A;  4QW2 A;  3MCA B;  3RNJ A;  1Q82 C;  3QUI A;  1CKB A;  2PUK B;  2HDA A;  3MJX A;  1O9S A;  3I5S A;  3UA6 A;  2QQS A;  3I56 T;  1I0C A;  2FO0 A;  4F04 B;  2XDB A;  8AT1 B;  3PIO A;  3P8B B;  1Y07 A;  2C0T A;  1TUD A;  3G4S A;  2E4H A;  3URG A;  2W0Z A;  4QT7 A;  3CD6 T;  4HCC A;  4MDX A;  1UDL A;  2V8K A;  2YHT A;  1SSF A;  3MP8 A;  2LX9 A;  5GAM j;  5IXF A;  1VQ7 T;  2WSC E;  3V8L A;  4R55 A;  3AT1 B;  2KXD A;  4N4H A;  1F1B B;  3CXC S;  3GBQ A;  2OTL A;  3G6E Q;  1OYX A;  2GF7 A;  4C8Q F;  4M75 A;  1SEM A;  2DXU A;  4J6W A;  4JRK A;  1K0S A;  1QVG S;  5HK3 A;  2F5T X;  2RHZ A;  1NEG A;  4J8O A;  4AFQ C;  2CUD A;  2RB6 A;  3EHR A;  2DKG A;  4IKF A;  4NS5 A;  5LJ3 h;  3CC2 A;  2HL5 C;  4HVV A;  4M75 B;  4XAX B;  3I56 Q;  2YLC A;  2YRC A;  4OGC A;  5LJ3 g;  5LJ5 f;  1YN8 A;  3PT9 A;  2HD0 A;  3CCU A;  4LNP A;  1I8F A;  2FZC B;  2DTI A;  1M8V A;  2M0O A;  2RJC A;  1LPL A;  3CD6 Q;  2ZGW A;  4M7A D;  1M5Q 1;  3VS1 A;  1JXO A;  5GAN 3;  3HHT B;  3G71 T;  2B8A A;  1VQ7 Q;  1C1A A;  3RKX A;  3A98 A;  3CCJ T;  1R77 A;  2EQK A;  2V26 A;  2DL7 A;  2NLU A;  4XK8 E;  2DX1 A;  4M75 G;  1RAB B;  2MWP A;  1KC8 U;  1Y57 A;  2DD4 A;  3SWN B;  3M56 A;  1W2B A;  1KC8 R;  1BIA A;  1NLO C;  2DL3 A;  2EBP A;  2DJZ A;  1N9R A;  2ECZ A;  3CC4 A;  2HBW A;  2MWO A;  1JJ2 S;  2E5K A;  5I22 A;  2RO0 A;  2A0F B;  4QQG A;  1T3S A;  3NMZ C;  1S1N A;  4M7A E;  4M78 A;  3JCM J;  1WFW A;  3EG2 A;  5FU7 B;  1YJN T;  4CC3 A;  4X9C A;  2NWM A;  2EGE A;  4NL2 A;  3JCM d;  3G71 Q;  3LW5 E;  2CP3 A;  4M78 B;  3DB4 A;  2DTH A;  4RTX A;  2KMT A;  3CCJ Q;  3GOX A;  2C0I A;  1R0B G;  1V1C A;  1X01 A;  1X43 A;  2DXC A;  2JW4 A;  5KCO A;  3M55 A;  3JB9 F;  1VQM A;  2E5Q A;  3UT1 A;  1IZ6 A;  2E12 A;  4M77 C;  3VRZ A;  1K73 U;  2PVD B;  3H41 A;  1K73 R;  2RK1 A;  1RAH B;  3QJ6 A;  4JJD A;  4FCY A;  2RH2 A;  3MET A;  4KGX B;  1X2Q A;  4M78 G;  1NM7 A;  3CMA A;  1YJ9 A;  2O88 A;  2CYZ B;  2MCN A;  1YJN Q;  1NYF A;  2DER A;  2DPP B;  2DRK A;  4GBQ A;  1NJI U;  1B07 A;  2NUT A;  4ZGE B;  4KGV B;  2LQK A;  1NJI R;  1FMW A;  1GBR A;  4ATO A;  4K11 A;  4X9D A;  3CCV Q;  2EW3 A;  2YUO A;  4EPC A;  4ZN1 A;  4E7I A;  4F17 A;  4FYY B;  1KC8 C;  8ATC B;  2O9V A;  5L23 A;  2FRW A;  4FYV B;  1UHC A;  1UUE A;  4KT0 E;  1B7T A;  1WHH A;  1YCY A;  2QA4 A;  1MUZ A;  2BZY A;  2P0K A;  4C92 B;  2JVV A;  2LT1 A;  3SD4 A;  2X51 A;  4F7U E;  1SRL A;  1IRX A;  4JPB W;  4XTV A;  1M2V B;  5C6S A;  1MGQ A;  3I9Q A;  2QI2 A;  4CC2 A;  2DJQ A;  1W1F A;  1Q86 U;  3C0C A;  2LCC A;  4OF1 A;  1I81 A;  3A8O B;  5GMK j;  3C94 A;  3F70 A;  5AT1 B;  4PJN A;  2ABL A;  4M7A A;  4XTU A;  2F2V A;  4N4I A;  1NLP C;  2OTJ A;  3RDV A;  3C12 A;  1QKX A;  4KGZ B;  4C0F A;  1MND A;  4C92 G;  3H0H A;  2L2P A;  3OMC A;  2Y4X A;  1BYM A;  2FB7 A;  4KBM B;  1Q95 G;  4L5G A;  1K73 C;  2DM1 A;  3LGF A;  1U5S A;  4AFZ C;  1VQK Q;  4QVZ A;  2JS2 A;  5LJ3 e;  1M30 A;  5GAM f;  1X75 C;  4PJO D;  2ZPI B;  1UGQ B;  2YWW A;  3MHX A;  1ZSZ C;  4BDY A;  2DL5 A;  2DL4 A;  1WHK A;  4DBQ A;  3MKD A;  1NJI C;  3DB3 A;  4EMG A;  3KBG A;  1JXM A;  1BU1 A;  3QZ5 B;  3M0T A;  3CCE T;  1YIJ A;  3L2W A;  2RN8 A;  2GNC A;  1OQK A;  3EG3 A;  3OW2 A;  1NG2 A;  2D6F A;  1EX4 A;  3KFV A;  2JTE A;  4R0K A;  2ZPB B;  1Q7Y U;  3VUZ A;  1Q7Y R;  3EG1 A;  3PTA A;  1XTD A;  4PJO E;  5A0D A;  1OU8 A;  4Y28 E;  2A7Y A;  2GCX A;  4M75 F;  5KYW A;  2EGA A;  4J83 A;  2KBT A;  4RG2 A;  4AMC A;  1FMK A;  4DEY A;  1NE8 A;  2HAX A;  4ZTJ A;  2QYZ A;  3MPU B;  4MDW A;  5CIU A;  4RTW A;  4EMH A;  1N6A A;  5KYW B;  1WXT A;  4F7U A;  1XQH A;  3OW2 P;  1DJ7 B;  2DMO A;  3CCE Q;  5CO7 A;  2EYY A;  2J7I A;  3JCM b;  2D8H A;  1B3Q A;  2R5A A;  3H0F A;  2KR3 A;  2MK5 A;  3FDR A;  2L5Q A;  2HKN A;  4QQ6 A;  1YWO A;  3WVD B;  4X34 A;  3EGX A;  5KYY A;  3M58 A;  1M3A A;  3GPL A;  1PHT A;  1UEB A;  1NPP A;  3RMS A;  1GCQ C;  3JCM h;  2NUP A;  2XHC A;  2YXY A;  5GAN 5;  1TXQ A;  2CH4 W;  3CCQ T;  3OBY A;  3TRE A;  3JCM g;  3UDC A;  2V1R A;  5LJ5 d;  2EVR A;  3OYD A;  5GAN 4;  4JJB A;  4UC4 A;  4A4H A;  4M7D E;  4Z88 A;  4BAC A;  4IUU A;  4M7D C;  3O8V A;  2GQV A;  3ZEH A;  2QK0 A;  2VVK A;  1S72 A;  3PNW C;  4IUQ A;  3NTI A;  3E2U A;  4WCI A;  4M78 F;  5DLO A;  1AWJ A;  2E70 A;  3PIP A;  2DD5 A;  1RAG B;  2RHY A;  2FPF A;  3HRU A;  3M57 A;  3JRZ A;  3H9N A;  2VXF A;  4P5N A;  3C95 A;  5FRN A;  2K5F A;  3EHQ A;  1Q7Y C;  5DM7 R;  1QVF A;  3GIB A;  1IGU A;  1BCM A;  2RMO A;  5ECA A;  3CCQ Q;  4JJN K;  3QII A;  2LTO A;  3J81 E;  1YJW A;  1XNI A;  2KXC A;  4PJO A;  3QYH B;  3QSU A;  2K57 A;  3TVT A;  1K1Z A;  3VS5 A;  5GMK h;  1Q81 U;  1TUC A;  1Q81 R;  2ZZD A;  3FC3 A;  5CQX A;  5KYX A;  3VKI A;  1QVF P;  1VQ4 A;  5IT9 E;  3RES A;  4LUD A;  2QEX Q;  1MV0 B;  2E41 A;  4ZGD B;  2DNU A;  2CRE A;  5GAO p;  2RJE A;  2LCL A;  5KYX B;  4E7H A;  2D9T A;  3CCR A;  3JCM V;  2J6F A;  3Q1J A;  4HA8 A;  1WHL A;  4C92 F;  4AT1 B;  1OOT A;  5DY9 A;  1YHQ T;  4D6W A;  3NPF A;  1RAC B;  2E64 A;  1VQL A;  2CKK A;  2DE0 X;  2EYW A;  3QHS A;  5FU6 C;  2F2W A;  4GLK A;  4F16 A;  4ELY C;  1YWP A;  1PRL C;  1MHN A;  1VQP A;  5IAY A;  3QO3 A;  2O31 A;  4DOV A;  4OB2 B;  3PMI A;  1AWO A;  1AZE A;  4A4G A;  5GMK m;  3ME9 A;  3QJY A;  3JB9 G;  4QKU A;  2XDD A;  2RQU A;  2MPX C;  1WJR A;  4CC7 A;  3A8L B;  3WXM B;  2OAW A;  2F2X A;  2XU8 A;  4M7A F;  2RQT A;  1E6G A;  1UG1 A;  3A8M B;  3EAE A;  1WDX A;  4PNO A;  4C5E A;  5GAN j;  4JLG A;  4MZP A;  3CEY A;  1YHQ Q;  2LNH B;  2COW A;  4ME7 A;  1K76 A;  5DLQ E;  3INZ A;  1AOJ A;  4IUR A;  5HKC A;  4A63 B;  4OML A;  4E2F B;  4BD3 A;  3CBP A;  3MEU A;  1WLP B;  4MZT A;  3CCL T;  1Q81 C;  4XQ3 A;  1OUL A;  4BI4 A;  4C0D B;  2P4T A;  2CT3 A;  2COY A;  4WF2 A;  1WJQ A;  3JB9 I;  1XJW B;  4BE1 A;  2K5I A;  4RUG A;  3MP1 A;  1NEB A;  1GRI A;  2O01 E;  1VYT A;  3E19 A;  1PKT A;  2IVW A;  4PL6 A;  3SWN C;  3G6E T;  4JUV A;  2E10 A;  2LQ8 A;  2AZS A;  2LVM A;  3CME Q;  3EG9 A;  1UGS B;  1TG0 A;  4MML A;  1EZZ B;  3JCM e;  5GAM d;  3OY9 A;  4N0A C;  2KRO A;  1VQ9 A;  2QDY B;  2ZPH B;  4C5I A;  2GFA A;  3EG9 B;  4NL3 A;  3RKW A;  1D09 B;  3CCL Q;  5IHK A;  1K8A U;  4LN2 A;  4V2S A;  4M4Z A;  1ZX6 A;  3OYC A;  4XU0 A;  5GJW B;  1K8A R;  1D0Z A;  1FXX A;  2W10 A;  4RG8 A;  2BIV A;  2AKL A;  2H8H A;  2YT6 A;  2VAS A;  4J9D A;  5LJ5 h;  2YLB A;  3JB9 H;  3HRS A;  2QQR A;  2NYS A;  3LWI A;  5LJ5 g;  1WX6 A;  2EFI A;  4J9F A;  3C4S A;  2A36 A;  1OPL A;  1QWE A;  3I55 A;  2KSS A;  2Z0W A;  1BI3 A;  1HYO A;  2E3I A;  1VQ8 A;  1PD1 A;  5D6W A;  5KE3 A;  2CSQ A;  2HEQ A;  2KAF A;  4Z89 A;  4HCZ A;  3GF5 A;  4Y92 A;  2OI3 A;  4LDX A;  4J7I A;  3CXC A;  5FW9 A;  4A4F A;  1PD0 A;  2KDS A;  2DVJ A;  2FZK B;  1QP2 A;  3QG1 A;  3M0Q A;  2EPD A;  4ELZ C;  1QVP A;  1QVG A;  2HMA A;  3OYE A;  5D7U A;  1QW1 A;  4A54 A;  1IHV A;  2VV5 A;  3OYM A;  4A4K A;  3NHN A;  3CC7 T;  2MMP A;  1TUG B;  4J9H A;  2OAU A;  4B6M A;  4BY6 B;  2E6N A;  3OMG A;  2DEU A;  2EYZ A;  2D8J A;  3E9F A;  3HL8 A;  3OSV A;  2L8D A;  1T0H A;  1Y96 A;  2C0O A;  1KD1 U;  3QZ9 B;  1WYX A;  1KD1 R;  1UHF A;  3M53 A;  1WNL A;  3CCS T;  2K3X A;  3EGD A;  4J6X A;  2FL7 A;  4Z8A A;  2JJ9 A;  2AHJ B;  3TQ7 P;  1T3L A;  2RPN A;  4RTY A;  4M77 D;  2DVE A;  1NPR A;  2HSE B;  3GNF B;  3V8J A;  2BTT A;  5J26 A;  2D0N A;  1RI9 A;  2QGG A;  4AG1 C;  1G3T A;  3UA7 A;  3M4G A;  3EFO A;  1K8A C;  2RA2 A;  2EIF A;  4JDS A;  1WHG A;  5D6Y A;  2JZ2 A;  4HCK A;  1UFF A;  2GTJ A;  4J9G A;  4EDU A;  4HKE A;  4LDU A;  1AT1 B;  5A0G A;  4PJO F;  4CI0 C;  3CC7 Q;  2KE9 A;  3ULR B;  4OMP A;  1JJ2 A;  1GFC A;  5CKH A;  4WTO B;  1W2B P;  2A37 A;  1QCF A;  5EC7 A;  2LJ0 A;  1MMD A;  4JS4 A;  3CCV T;  1YIT T;  4BI3 A;  4AFU C;  1VQO A;  1G83 A;  2DF6 A;  3T9N A;  2KYM A;  1OX8 A;  1KQ1 A;  2X4W A;  4RTT A;  3CCS Q;  1U06 A;  4M77 E;  1H3Z A;  4LDW A;  1VQ6 A;  1LCK A;  5EG2 A;  1Y7X A;  3VYG A;  1ACM B;  4KH1 B;  3AHU A;  2LZ6 B;  2K3B A;  4IUP A;  2EKH A;  4LUE A;  1MNE A;  1QQJ A;  3FB9 A;  2DBK A;  1YI2 Q;  2ATC B;  4J5Y A;  2LDM A;  2QAZ A;  1RLQ C;  1JU5 C;  1VQN T;  2GFU A;  1C0M A;  5IN1 A;  3SEM A;  5GAN f;  4XU1 A;  3L2R A;  1KQ2 A;  2K79 A;  2KT1 A;  2VUB A;  4DOW A;  1PRM C;  1ZUU A;  2P84 A;  4PLI A;  2KK4 A;  1G3Y A;  2J6O A;  2EJ9 A;  4OP0 A;  1YIT Q;  2NUT B;  3J7A F;  3PE0 A;  2WSF E;  2QXF A;  3UF4 A;  3DLL A;  4OB0 B;  4F14 A;  1KD1 C;  1SHG A;  4JJC A;  1KIK A;  1FWZ A;  1G3W A;  1C6V X;  2E3H A;  1P92 A;  4C8Q D;  1VQK T;  4XTY A;  3VUB A;  4BI8 B;  3M54 A;  2DFU A;  4Y91 A;  2HCK A;  5FLX E;  1PM3 A;  3VS2 A;  4DBR A;  2DZ9 A;  1VA7 A;  1VQN Q;  4FSS A;  5GJV B;  4RCB A;  2IPO B;  1RAA B;  1U1S A;  3QDF A;  2KRM A;  2QDL A;  3ZFJ A;  3LWH A;  1UTI A;  2G3R A;  5GAM h;  2FYK A;  3I5R A;  1WXB A;  3CBM A;  5LJ5 e;  1UGV A;  1WZO A;  5GAM g;  2WSE E;  2DTO A;  4M7A B;  2EJG A;  1R8O B;  2LQN A;  3OYI A;  1N27 A;  2OTL T;  4C8Q E;  2BZX A;  2KRS A;  1OI1 A;  1YFN A;  2JTM A;  4C8Q C;  2PZ1 A;  5CQY A;  4OMQ A;  1WQW A;  2Y90 A;  3CCM A;  1T0J A;  1W6X A;  3MEW A;  3GNG A;  2DZC A;  2J6K A;  3CC2 T;  1MMG A;  4J9I A;  4HXJ A;  4M77 A;  3M0S A;  4FU6 A;  1JEG A;  3L2U A;  1G2B A;  1KSW A;  2ZPE B;  3G4S Q;  3CCU T;  1V29 B;  1BIB A;  2WAC A;  1UGP B;  4ZNX A;  2RQR A;  4AG2 C;  2K3Y A;  2BUD A;  2HZY A;  4M7A G;  4RTV A;  3JB9 J;  1D1A A;  5I11 A;  4A4E A;  2RJF A;  3OW2 S;  3LH0 A;  2OTL Q;  1ZLM A;  3VS4 A;  2RHU A;  2A08 A;  4XU2 A;  5GAO l;  3BDU A;  1K0X A;  1M90 U;  3CC2 Q;  2D1X A;  3CC4 T;  1X6G A;  2AT1 B;  1M90 R;  4GY5 A;  3FJ5 A;  5CKD A;  3L2Q A;  5KYU A;  1VQ5 A;  2VWF A;  1IO6 A;  1IB8 A;  3CCU Q;  4DEX A;  1AWW A;  4R56 A;  4M7D D;  1BI1 A;  2YUQ A;  1X6B A;  4C0Z A;  5J3B A;  2LC4 A;  3JCM P;  4F7U B;  3N5B B;  3X25 B;  1K9A A;  2EWN A;  5I21 A;  3THK A;  1GL5 A;  2KI7 A;  2RHX A; 
#chains in the Genus database with same CATH homology
 2E65 A;  1VQ9 T;  4C5G A;  3PMI A;  4M75 B;  4XAX B;  2YLC A;  4EMK C;  4A4G A;  3QYG B;  4L6V 5;  3BY7 A;  4C92 A;  5GMK m;  1VQM T;  4HCB A;  3ME9 A;  5HK0 A;  4OGC A;  5LJ3 g;  3QJY A;  1XOV A;  5LJ5 f;  3JB9 G;  3PT9 A;  5CVI A;  2HD0 A;  1HXD A;  1O75 A;  2XDD A;  3G4S T;  3CCU A;  1WJR A;  1I8F A;  2RI3 A;  2DTI A;  3A8L B;  2EYQ A;  3BW1 A;  1TH7 A;  1BI0 A;  1WGS A;  2M0O A;  2R57 A;  2RJC A;  2XU8 A;  3SDZ A;  3WXM B;  4C8Q A;  4M7A F;  3OSS C;  3A8M B;  1WQ7 A;  2ZGW A;  4M7A D;  1M5Q 1;  3EAE A;  3OYF A;  4PNO A;  4C5E A;  3H6Z A;  2P0P A;  2V8J A;  3HHT B;  3M9Q A;  4JLG A;  5GAN 3;  3G6E A;  4F7U G;  5GAN j;  1YJ9 T;  4MZP A;  3G71 T;  3CMA T;  4HT9 A;  3L42 A;  2B8A A;  2YRV A;  3CEY A;  3KXT A;  2IG0 A;  4ME7 A;  3RKX A;  3CCJ T;  4OB2 B;  2EQK A;  3OS0 A;  3H8Z A;  4OMF B;  4JS5 A;  1H64 1;  2NLU A;  4XK8 E;  5DLQ E;  3INZ A;  4M75 G;  2MWP A;  1KC8 U;  2XG8 D;  2DD4 A;  2XIC A;  4IUR A;  3SWN B;  3I56 A;  5HKC A;  3I55 T;  3M56 A;  4E47 A;  1W2B A;  5J39 A;  1BIA A;  2P0Q A;  4BD3 A;  3CBP A;  2DEQ A;  2V8I A;  3MEU A;  1VQ8 T;  2OTL T;  3L1A A;  2DJZ A;  4MZT A;  4XU3 A;  3CCL T;  1N9R A;  2QEX T;  1Q81 C;  4XQ3 A;  3CC4 A;  3E1S A;  2MWO A;  1JJ2 S;  1K9M U;  4BI4 A;  2CZ1 B;  4C0D B;  1IRE B;  2P4T A;  2RO0 A;  5GAO m;  4WF2 A;  1WJQ A;  2FHD A;  4JLI A;  4QQG A;  3JB9 I;  1QVF S;  5GAO n;  3RIR A;  3CD6 A;  4BE1 A;  2K5I A;  1RL2 A;  2HBP A;  2H3J A;  3FEO A;  3MP1 A;  3OB9 A;  5AYF A;  4C0G A;  3FLG A;  1N8R U;  1KQS A;  1M90 C;  1JBM A;  4LDV A;  4M77 B;  2DK3 A;  4M78 A;  4M7A E;  3OA6 A;  5I2M A;  1VQ7 A;  1FX7 A;  2O01 E;  3JCM J;  5FU7 B;  1YHQ A;  3E19 A;  1YJN T;  1VIE A;  3UWN A;  5I2S A;  3PMT A;  4X9C A;  2IVW A;  1EIF A;  4PL6 A;  3SWN C;  2PUO B;  4NL2 A;  3JCM d;  5M9O A;  3G6E T;  4JUV A;  2E10 A;  2LQ8 A;  2ZCF B;  3LW5 E;  4M78 B;  2VGM A;  3DB4 A;  3LGL A;  5LL6 S;  2DTH A;  2LVM A;  3JCM c;  2K4Y A;  1UGS B;  2KMT A;  2EJF A;  3OYH A;  3GOX A;  4MML A;  3JCM e;  5A2Q E;  1LNX A;  5GAM d;  1X01 A;  3V7S A;  2O4X A;  4C0D C;  3OY9 A;  4PJO B;  4N0A C;  1VQ9 A;  2DXC A;  2QDY B;  5KCO A;  1PSE A;  2ZPH B;  3M55 A;  1AHJ B;  3NFC A;  3OS5 A;  4C5I A;  3JB9 F;  1M1F A;  5LJ3 j;  1VQM A;  2GFA A;  2E5Q A;  2KVQ G;  4XTX A;  3RKW A;  4NL3 A;  1OZ2 A;  3VV0 A;  3HSB A;  3UT1 A;  1IZ6 A;  3BFM A;  5GAM e;  3MEV A;  3JB9 D;  2OTJ T;  3E9G A;  2E12 A;  2JNG A;  4M77 C;  1K73 U;  1K8A U;  4V2S A;  3OYC A;  2PVD B;  4XU0 A;  1ZBX A;  4BDZ A;  2QTX A;  3RKY A;  3PFS A;  2RK1 A;  4M77 G;  5KCH A;  1FXX A;  3QJ6 A;  3HKS A;  2LRQ A;  2JOY A;  1VUB A;  2DO3 A;  5FRM A;  4RG8 A;  4KUL A;  2RH2 A;  2BIV A;  3MET A;  4BE2 A;  2K2V A;  4OGE A;  1D3B A;  4M78 G;  3CMA A;  1YJ9 A;  3G71 A;  5GAN 8;  5LJ5 h;  2YLB A;  4QQD A;  2VYT A;  3JB9 H;  2CYZ B;  2XID A;  3HRS A;  3V8K A;  5CR2 A;  2QQR A;  1M1K U;  3CME A;  1LJO A;  3X26 B;  2DPP B;  3LWI A;  3CCJ A;  4PJO C;  5LJ5 g;  4E7L A;  1ZHI A;  2EFI A;  1NJI U;  1K8A C;  4ZGE B;  4PJO G;  2LQK A;  3C4S A;  3S3N A;  3I55 A;  2KSS A;  3S3O A;  4ATO A;  3P8D A;  1BI3 A;  4E7K A;  1VQ8 A;  3QBY A;  5D6W A;  2VGN A;  5KE3 A;  5GAN d;  3CCL A;  3OYB A;  2PU9 B;  4X9D A;  4EPC A;  2KAF A;  4ZN1 A;  1Q86 C;  3QPH A;  4N4G A;  4HCZ A;  3GF5 A;  4E7I A;  1U1T A;  3WVE B;  1VQO T;  1KC8 C;  4LDX A;  5GAN e;  4M7D A;  4J7I A;  3CXC A;  5KH6 A;  4A4F A;  4XTW A;  3VJP A;  2KDS A;  2RI2 A;  1VQ6 T;  2XI9 A;  4KT0 E;  3J80 E;  1QP2 A;  3QG1 A;  4BB7 A;  4OB3 B;  1YCY A;  3P8H A;  4JRQ A;  2I2L A;  2QA4 A;  4ELZ C;  1QVP A;  1QVG A;  2RD1 A;  2P0K A;  4C92 B;  3OYE A;  1QW1 A;  2JVV A;  2E6Z A;  1K9M C;  2LT1 A;  4FT2 A;  3SD4 A;  4A54 A;  1U8R A;  4M7D B;  1YJN A;  2VV5 A;  5HY6 A;  4F7U E;  3OYM A;  1I5L A;  4A4K A;  3CC7 T;  2F69 A;  3VYH B;  2MMP A;  2M9U A;  1QP3 A;  3OYN A;  4BY6 B;  2OAU A;  1N8R C;  2L3R A;  4XTV A;  4MMK A;  4C8Q B;  2RJD A;  5C6S A;  2E6N A;  1MGQ A;  1KHI A;  3CME T;  3TCJ A;  4RMO A;  3OMG A;  4M75 E;  5CKE A;  4DA4 A;  2QI2 A;  1GXI E;  4M75 C;  3OSV A;  3E9F A;  3HL8 A;  1Q86 U;  2LNV A;  3OYG A;  2L8D A;  3CCV A;  3MO8 A;  1G3S A;  1Y96 A;  2LCC A;  4OF1 A;  1I81 A;  3A8O B;  5GMK j;  5GAN 2;  3C94 A;  5GAN 7;  1KD1 U;  3QZ9 B;  3G7Z A;  3JCM W;  3F70 A;  3ZBD A;  2EAY A;  4M7A A;  4YTL A;  1N9S A;  1PSF A;  4XTU A;  3M53 A;  1WNL A;  3CCS T;  2K3X A;  3ASK A;  4J6X A;  4N4I A;  2OTJ A;  4M77 F;  4MZM A;  2C06 A;  3C12 A;  2FL7 A;  4HT8 A;  4OB1 B;  2AHJ B;  3OS2 A;  2X4Y A;  4C0F A;  3OQ5 A;  4M77 D;  3OYJ A;  2X4J A;  4C92 G;  2DVE A;  1NPR A;  2RHI A;  3GNF B;  2CGH A;  2RM4 A;  3V8J A;  3OMC A;  4M7D G;  3HFN A;  3KUF A;  3HP9 A;  5J26 A;  1UGR B;  2Y4X A;  1G3T A;  1BYM A;  2CZ7 B;  2E1H A;  2FB7 A;  4FM4 B;  3M4G A;  4KBM B;  3TU4 K;  1KQS S;  4L5G A;  5GAO q;  5LJ3 d;  3JCM f;  2RA2 A;  1K73 C;  4RCC A;  2EIF A;  4JDS A;  4C8Q G;  3LGF A;  5D6Y A;  2JZ2 A;  2QA4 T;  4L59 A;  2MF2 A;  4EDU A;  4C5H A;  4HKE A;  4LDU A;  4QVZ A;  2R5M A;  3X28 B;  3HPW A;  5A0G A;  3M59 A;  5LJ5 j;  4PJO F;  4CI0 C;  3CPW A;  1I4K 1;  3OBW A;  5LJ3 e;  1JJ2 A;  5GAM f;  1X75 C;  5CKH A;  3OYK A;  2ZPI B;  1UGQ B;  3HFO A;  5CAI A;  3MHX A;  2JTF A;  4PJO D;  3EFR A;  2QQB A;  3S3M A;  4BDY A;  1M1K C;  3V7C A;  3RUX A;  4JS4 A;  3JAM E;  2JUF A;  2M1H A;  3CCV T;  5GAO r;  1YIT T;  1NJI C;  3DB3 A;  3UPU A;  3SB2 A;  4EMG A;  3KBG A;  3L2V A;  3DKM A;  3LLR A;  4BI3 A;  1VQO A;  1ZQ1 A;  3T9N A;  4PLL A;  3QZ5 B;  1KQ1 A;  2X4W A;  3CCE T;  4M77 E;  1YIJ A;  2DIG A;  4IUT A;  4VUB A;  1H3Z A;  1M9S A;  2L89 A;  4LDW A;  1VQ6 A;  2EQJ A;  3L2W A;  5EG2 A;  1BKB A;  2O4X B;  1Y7X A;  5FU7 C;  3VYG A;  5L8R E;  3FRN A;  4TVR A;  1S72 T;  1VQK A;  3OW2 A;  2HNI A;  3AHU A;  2D6F A;  1JB0 E;  2EQU A;  4IUP A;  4M78 E;  2XKO C;  4F7U F;  3EFS A;  3LYI A;  4M78 C;  3CC7 A;  2ZPB B;  4DQ2 A;  2D0Q B;  3FB9 A;  2BKD N;  1Q7Y U;  3OS1 A;  4J5Y A;  2LDM A;  3A5Z B;  5FU6 B;  2A3L A;  3VUZ A;  3CCM T;  4EMK A;  3PTA A;  1XTD A;  4FIB A;  2GFU A;  1VQN T;  4PJO E;  5A0D A;  3V7R A;  1NZ9 A;  5IN1 A;  4Y28 E;  2A7Y A;  5GAN f;  2GCX A;  4M75 F;  4XU1 A;  2KY9 A;  3L2R A;  4RKU E;  1KQ2 A;  2PVO B;  4J83 A;  4RG2 A;  1D3B B;  1Y71 A;  2VUB A;  4DOW A;  2F5K A;  4M75 D;  1G5V A;  1NE8 A;  2HAX A;  4ZTJ A;  4EMK B;  3CBO A;  4PLI A;  1B34 A;  4MDW A;  2KK4 A;  5CIU A;  1G3Y A;  4XTZ A;  3CCS A;  2EJ9 A;  2XK0 A;  4OP0 A;  1OZ3 A;  1N6A A;  4EMH A;  4NOY A;  4F7U A;  3J7A F;  1XQH A;  4FT4 A;  2WSF E;  3L2Z A;  3A8H B;  1Q82 U;  1YJW T;  2QXF A;  4C92 D;  1DJ7 B;  2LT4 A;  2RI5 A;  4OB0 B;  3DLL A;  2PVG B;  1KD1 C;  1B34 B;  5CO7 A;  3DLM A;  4PKC C;  1YIJ T;  4ZN3 A;  3JCM b;  4B9W A;  1FWZ A;  1G3W A;  2R5A A;  1UB4 A;  3X20 B;  3NTK A;  1P92 A;  3FDR A;  4C8Q D;  2L5Q A;  3FIF A;  5A0L A;  1YI2 A;  1VQK T;  3GLX A;  5KE2 A;  2DIQ A;  4QQ6 A;  4XTY A;  3VUB A;  4BI8 B;  4FSX A;  5GMK e;  1YBY A;  3M54 A;  4Y91 A;  4A53 A;  2XD0 A;  3WVD B;  5FLX E;  2R58 A;  4X34 A;  3M4Y A;  2DZ9 A;  3M58 A;  1VQ4 T;  5CKF A;  2CZ0 B;  3GPL A;  1UEB A;  1WJS A;  4RCB A;  4KUI A;  1NPP A;  3RMS A;  3R6O A;  3JCM h;  2XHC A;  5GAN 5;  3CCQ T;  1YIT A;  1X6O A;  3BDL A;  3OBY A;  1U1S A;  4IUV A;  2DXB A;  2EKO A;  3JCM g;  3TRE A;  2CS7 A;  3UDC A;  5LJ5 d;  4II1 A;  3CCR T;  4QVD A;  1W2B S;  3NTH A;  3ZFJ A;  3LWH A;  1VQ5 T;  4JRP A;  2QQA A;  2VXE A;  1JRI A;  3CCE A;  3OYD A;  2G3R A;  5GAM h;  5GAN 4;  1M1G A;  2FYK A;  4C92 E;  2ZPG B;  3MP6 A;  4UC4 A;  4A4H A;  3CBM A;  5CKB A;  4C92 C;  4KUD K;  3SWN A;  2KQW A;  5LJ5 e;  1Y96 B;  4BAC A;  5LJ3 f;  4IUU A;  3TEE A;  5GAM g;  2Y4Y A;  3O8V A;  4M7D C;  2GQV A;  3RER A;  2PQW A;  3ZEH A;  1S72 A;  2WSE E;  3CPF A;  2DTO A;  4M7A B;  2EJG A;  3PNW C;  1HK9 A;  1R8O B;  4IUQ A;  3NTI A;  1N27 A;  4BUG A;  3OYL A;  3OYI A;  4C8Q E;  4BY6 C;  2FVU A;  1OI1 A;  3A8G B;  2JTM A;  5GMK l;  1VQL T;  4M78 F;  4OVA A;  4C8Q C;  5DLO A;  1WPY A;  4FL6 A;  2QEX A;  2VC8 A;  5CQY A;  2E70 A;  4N0A A;  4O5V A;  4M78 D;  3PIP A;  1YI2 T;  1WQW A;  2DD5 A;  2Y90 A;  3CCM A;  1VQP T;  2RHY A;  4LD6 A;  1VQN A;  4B9X A;  3MEW A;  3GNG A;  5CCA A;  2DZC A;  2RK2 A;  2XDP A;  3HRU A;  3M57 A;  3M5A A;  4ZTF A;  3JRZ A;  3CPW S;  3CC2 T;  5FRO A;  2VXF A;  4M77 A;  3QDR B;  4P5N A;  3JCM Q;  3C95 A;  4BE0 A;  2K5L A;  4FU6 A;  3ER0 A;  5FRN A;  2K5F A;  2MAM A;  3JSC A;  4O6J A;  1Q7Y C;  4M7D E;  3QXE B;  2DXT A;  4J6Y A;  1KHC A;  4JRI A;  5DM7 R;  1QVF A;  2HQX A;  3LX7 A;  3L2U A;  3GIB A;  5CK9 A;  2ZPE B;  4QVC A;  3CCU T;  1W4S A;  2CZ6 B;  1V29 B;  2ZPF B;  1BIB A;  2WAC A;  4JJN K;  4LD9 K;  1UGP B;  4Q5W A;  3QII A;  2LTO A;  4M7A C;  3J81 E;  1YJW A;  2K3Y A;  4J7F A;  4LDY A;  2BUD A;  4M7A G;  1XNI A;  5GAN h;  3HRT A;  3JB9 J;  3OYA A;  4PJO A;  3QYH B;  1M8V A;  3QSU A;  5GAN g;  2DAQ A;  2K57 A;  2QQ9 A;  3OYY A;  4QW2 A;  3MCA B;  4A4E A;  2RJF A;  5GAN 6;  1Q82 C;  2X35 A;  3QKJ A;  3OW2 S;  3QUI A;  3LH0 A;  3PGG A;  2PUK B;  5GMK h;  1Q81 U;  2MI6 A;  1O9S A;  1LOJ A;  2RHU A;  4XU2 A;  5GAO l;  2QQS A;  2ZZD A;  3FC3 A;  5CQX A;  3I56 T;  3VKI A;  3BDU A;  1VQ4 A;  5IT9 E;  2XDB A;  2JN0 A;  3PIO A;  3P8B B;  1Y07 A;  4E7J A;  4CRI A;  1M90 U;  3RES A;  2E41 A;  3G4S A;  1BI2 A;  4ZGD B;  3CC4 T;  3JCM X;  4GY5 A;  5GAO p;  3CCQ A;  3URG A;  2RJE A;  2LCL A;  4E7H A;  5CKD A;  2D9T A;  3VU3 C;  4NS5 A;  5C0M A;  3L2Q A;  3CCR A;  2M16 A;  3JCM V;  1VQ5 A;  3CD6 T;  4HCC A;  4MDX A;  3MEA A;  3Q1J A;  5D6X A;  2EQM A;  2V8K A;  3X24 B;  4HA8 A;  3RMQ A;  1KG1 A;  2YHT A;  4C92 F;  1SSF A;  3MP8 A;  2LX9 A;  5GAM j;  1VQ7 T;  4M7D F;  5DY9 A;  2WSC E;  3V8L A;  4D6W A;  5GMK i;  4R55 A;  4Z02 A;  1YHQ T;  3SFM A;  4R56 A;  4N4H A;  4M7D D;  3CXC S;  2E64 A;  1BI1 A;  2OTL A;  1VQL A;  2CKK A;  1OYX A;  3S6W A;  4C0Z A;  2GF7 A;  3QHS A;  5J3B A;  2LC4 A;  4C8Q F;  5FU6 C;  4M75 A;  4F7U B;  3JCM P;  2DXU A;  4GLK A;  4J6W A;  4ELY C;  3N5B B;  1VIF A;  3X25 B;  4JRK A;  3GP8 A;  1QVG S;  4ZGJ B;  5HK3 A;  1MHN A;  2F5T X;  2HQE A;  2RHZ A;  2EWN A;  2X4X A;  1RI0 A;  5I21 A;  1VQP A;  4J8O A;  5IAY A;  3QO3 A;  3FJP A;  4DOV A;  2RB6 A;  2RHX A;  2DKG A;  4IKF A;  1M4Z A;  5LJ3 h;  3CC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...