1KQ2A

Crystal structure of an hfq-rna complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
NIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the pleiotropic translational regulator Hfq and an Hfq-RNA complex: a bacterial Sm-like protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Translation/rna
molecule keywords 5'-R(*AP*UP*UP*UP*UP*UP*G)-3'
total genus 13
structure length 60
sequence length 60
chains with identical sequence B, H, I, K, M
ec nomenclature
pdb deposition date 2002-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1kq2A00
4M7DC 2JN0A 2I2LA 4JRIA 4QVCA 4M77E 5LJ5j 5GMKe 2DZ9A 4EMGA 5GANh 4M7AG 4C92A 5GAOn 5GAOl 1D3BA 1HXDA 4C92F 4JUVA 4DQ2A 4M77C 4M78A 4WF2A 4M7DG 3JCMJ 4M7DF 4V2SA 1LOJA 4MMKA 3AHUA 1YCYA 3JCMh 4JRKA 2K57A 4XQ3A 4XTXA 1X01A 4C92B 3JCMd 3EFRA 4M77D 2CGHA 4M75F 1D3BB 1LJOA 2DKGA 2DXUA 2YLCA 3V7RA 5GAN6 4M78B 3RESA 5LJ3g 4C8QC 1N9RA 2RA2A 5GAOm 5GANj 3L2ZA 4HT9A 5LJ3d 4J5YA 5LJ5e 4OP0A 3JB9D 4M78C 3V8JA 4EMHA 5GANe 2Y90A 2VXFA 4C92D 3VU3C 4Y91A 2DVEA 4M77B 5GANf 4PJOE 3V7CA 2YHTA 4F7UB 4MMLA 5GAN8 4C8QA 4M78F 1TH7A 2E41A 3BFMA 4XU0A 5GMKi 5GAOq 5GAMh 3JCMW 1I81A 3JCMP 3JB9H 1M5Q1 4XTZA 5GMKm 4M75A 3QUIA 4J6YA 2DTIA 4C8QB 5GMKh 5GAMe 3SB2A 5GAMg 1BIBA 3PGGA 5GAN5 4PJOG 2E1HA 4PJOF 4F7UG 1HK9A 4M7AF 3HFOA 4XTWA 5GANg 5GAMj 3V8LA 3RERA 4F7UE 1MGQA 3RKYA 1M8VA 2E10A 2EJ9A 3INZA 4JLIA 4C8QD 1Y96A 2ZGWA 4M75C 2FYKA 5GAN7 3JCMb 1WPYA 4X9DA 5LJ3e 3L1AA 2EAYA 4M7AE 2EJGA 2EWNA 5GAMf 5LJ5d 2DTHA 3BY7A 1WQWA 2VXEA 5DY9A 4M7AB 5LJ3h 5LJ5g 5GAN3 1BIAA 4HT8A 3SWNB 2VC8A 4F7UA 5CAIA 1B34A 2EJFA 3FJPA 5GMKl 3JCMV 3JCMX 5LJ5h 1KQ1A 4NL2A 1I4K1 2E64A 3BDUA 3JB9G 1LNXA 2RM4A 1H641 4M75B 4NOYA 4EMKB 3JB9I 4M7AD 1B34B 2YLBA 1KQ2A 2DZCA 1WNLA 5GANd 5GAN2 4C92G 2DTOA 4XTYA 3RUXA 5LJ3j 4NL3A 4M77G 4C8QE 4PJOC 3HSBA 2RB6A 3JCMg 3HFNA 3V8KA 5GAOp 3M4GA 4M75E 1I5LA 1U1SA 5LJ3f 4XU3A 3SWNC 4M7DE 1JBMA 3EFSA 1Y96B 4M78D 4F7UF 3BW1A 4RCBA 3JCMf 3QHSA 2QTXA 3V7SA 3QSUA 4EMKC 2DXTA 4N0AC 4PJOA 3JCMQ 2DJZA 4C8QG 4M7AA 4C8QF 4J6WA 4XTUA 4HA8A 3QO3A 3JB9J 3JB9F 3SWNA 3FIFA 2FB7A 1U1TA 4A54A 4QVDA 5GAN4 3RKXA 4A53A 4RCCA 4M78G 5GAOr 4M7DA 4M75G 4PJOB 4XTVA 2DEQA 3JCMe 3JCMc 5LJ5f 4C92C 5GAMd 3FB9A 4M75D 4XU2A 4M77F 1N9SA 4M78E 2RD1A 3RIRA 5I21A 3RKWA 2E65A 4EMKA 5GMKj 4M77A 2HNIA 4N0AA 3GIBA 4M7DB 1I8FA 4PNOA 4C92E 4M7DD 1JRIA 4M7AC 4PJOD 4X9CA 4XU1A 4J6XA 1WQ7A
chains in the Genus database with same CATH superfamily
4IUTA 1GBRA 1PD0A 4QVCA 1G3TA 2DYBA 3EG1A 1QKWA 2FPFA 2ZPIB 1MNDA 1A0NB 3T9NA 2AHJB 2K57A 4M78B 4C8QC 1SRLA 4J9BA 3THKA 3I56A 2AT1B 4FIBA 3CCVA 2A0FB 2V8IA 2R57A 4LDYA 1AT1B 4M77B 2KT8A 4E7IA 1TH7A 1W4SA 3OYNA 4FW2A 5CQXA 2ROLA 2X3WD 2M0YA 2VYTA 4MZTA 2PUOB 2DILA 1RLQC 3PGGA 1I1JA 1D09B 1VQ5Q 2QA4Q 3EG3A 5LJ3e 1CKBA 4A63B 1UDLA 2RQTA 1Q86U 1M3BA 1WYXA 2DF6A 3META 3X24B 1NLOC 2RI3A 3DLLA 1Y0MA 1OV3A 2CSIA 1V29B 2O9SA 3L2RA 3CMAQ 2VVKA 4RKUE 1PKTA 3DB3A 5GAOp 1GCQC 2KY9A 3LH5A 5HK0A 1FMVA 3S6WA 1VIFA 2DXTA 4PKCC 3TSWA 2QEXT 4C8QG 3CCQQ 4M7AA 2L2PA 5FRNA 1O9SA 4QVDA 3CCSA 1UGQB 1MMDA 4XTVA 3ZEHA 1Q7YU 1KQSP 2LJ0A 3RKWA 1G8XA 2X4WA 4OB3B 3OSVA 4CC3A 4QQGA 1W6XA 3I9QA 2O4XA 4M77E 2KYBA 4M7AG 1KJWA 1WGSA 4TVRA 3WVEB 4EIKA 4DQ2A 2DK3A 2PUKB 2X3XD 2HKQB 3NTKA 3CXCP 3LGFA 3VUZA 2KYMA 4FCYA 2K3XA 3PIPA 1GBQA 2ROTA 1VQ9T 2BZXA 2X51A 2VKNA 1VQMT 1M9SA 3OBYA 2AIRB 1H3HA 4C0DB 3QUIA 1NPPA 2HDAA 2J6OA 3TU4K 2KDSA 4J8OA 5GAN5 3EG2A 3ME9A 1XTDA 1WX6A 1EZZB 1GCPA 1VQ5A 2EJ9A 1IO6A 2DERA 4OB1B 1VUBA 1WPYA 1AWWA 1VQ8A 4RG8A 1SG5A 3VKIA 2NUPB 5GAMf 2O2OA 1PM3A 2K5IA 3MCAB 2JVVA 4Z02A 2K79A 2XHCA 3I56T 1AZGB 2E64A 3SHWA 4CC4B 2E6NA 1ZQ1A 2FEIA 4M77G 2EVRA 3PNWC 1OPLA 3CEYA 2RNAA 4XU3A 5D6XA 3I5SA 2RI2A 3BDLA 3BW1A 1KC8C 1MMNA 2GFAA 3UDCA 3JCMQ 4LDVA 1VQ7T 4DBQA 3M0QA 3G71Q 4PJOB 2RQRA 1N8RC 1YJ9Q 5GAN2 3IQLA 1O75A 2DBKA 3EAEA 3CCST 1VQPT 1NJIU 4PNOA 3CBOA 3PIOA 2E6ZA 1PRMC 1Q82U 3LW5E 2ATCB 1FMWA 3ASKA 5GANh 5KE2A 4ZTJA 2RHYA 2MI6A 1OZ2A 1E7OA 1AWJA 2FG0A 2VV5A 4M75F 1D3BB 3M55A 2LC4A 3MEWA 3VS0A 4C5GA 1E6HA 2I0NA 2LMJA 5FROA 1UEBA 3VS4A 3M56A 4BUGA 2JTMA 1EIFA 3QBYA 4DOVA 2QA4T 1T0JA 5GAN8 3OYJA 2KI7A 4IURA 2KMTA 2ZPFB 3CBMA 1VQNT 1PSEA 4PJMA 4FU6A 3EGDA 5DLQE 1BKBA 3A1PA 4GLMA 2EYZA 3HFOA 1OU8A 4O6JA 2K3YA 3PE0A 2DX1A 1ZSZA 3I35A 3TREA 4JJCA 1JJ2A 2CDTA 5LJ5d 3CMET 3NFCA 1TOVA 5DY9A 1YIJA 2EJFA 4FT4A 5HKCA 5DLOA 4NL2A 1SHFA 3C95A 1H641 1X2KA 5EG2A 1Q82R 2MK5A 2G6FX 2XDPA 5LJ3j 4JPBW 1WI7A 4KRTA 5FU6C 1H8KA 4KGZB 3PVLA 2LX9A 2FL7A 1WJSA 3SD4A 3FEOA 5L23A 4RCBA 3OYIA 2XMFA 3J7AF 3EG9B 2L5QA 2DO3A 2J6FA 2OJ2A 2LT4A 3O8VA 2HKNA 5GAOr 3R6OA 2L3QA 2XD0A 5LJ5f 2L3RA 2K6DA 2QGGA 5GMKj 2EW3A 4EPCA 3CCUQ 2X4XA 4JRIA 2AZSA 2VB6A 5GAOl 3OBWA 4BY6B 3KFVA 2V26A 1XQHA 3CPWP 3BE3A 5GAN6 3V7RA 4R55A 4C0DC 2FO0A 3SEMA 4DOWA 3GPLA 3L2ZA 1FX7A 4CI0C 5A2QE 2RHUA 1PCXA 5IHIA 4CC7A 5GANe 2Y90A 1K9MR 5IH2A 2QXFA 2VUBA 3VU3C 5GANf 1M1KR 2QEXQ 4RTYA 1KD1C 2QDLA 3JCMP 1NG2A 1C0MA 3SB2A 3VS7A 4DBRA 2E1HA 1QKXA 1SRMA 4JLIA 4C8QD 5GAN7 3JCMb 5IT9E 2GNCA 3LYIA 4X9DA 1K8AC 2K4YA 4KUIA 5IXFA 2X4YA 4M7AE 2BZYA 2YUPA 2CREA 2LP5A 2GCXA 4JZ4A 5LJ5g 2DL7A 2RK1A 3M58A 3HPWA 1QQJA 1SKUB 2ABLA 2MIOA 4LDWA 1YJNT 2X4JA 1Z9QA 3X20B 1S72T 2L89A 4M7AD 1B34B 2YLBA 2EKOA 3GP8A 4J9IA 2FPEA 2BE9B 4WTOB 1I5OB 4C8QE 2ED0A 4IIMA 3QDRB 4M4ZA 1MMGA 3V8KA 2HQEA 4KGVB 1YIJQ 3CCUT 3VRZA 4M78D 4L59A 4ELZC 1RAIB 3JCMf 3QHSA 2EQKA 3EGXA 3CC2Q 4C5HA 2GFUA 2JZ2A 5GAN4 2LRQA 1PC0A 2CP6A 4M77F 4M78E 1QVFP 2E65A 2IG0A 2OX7A 1NM7A 4M7DD 2RJFA 1QVGS 4ME7A 3TVTA 2HL3A 3I55A 2DZ9A 2J6KA 1X69A 4PL6A 1M2VA 4JRKA 4XTXA 2QGFB 4FYYB 1D0YA 2DL4A 4FT2A 2A7YA 4JLGA 4AFQC 3CCUA 1OX9A 2DL3A 1ZUKA 2F2WA 2JTFA 1WXTA 4JS4A 1NBEB 4JDSA 3V8JA 2DE0X 1Q95G 2LJ1A 1W2BP 2HZYA 2EQIA 4MMLA 1BI0A 3UA6A 2E41A 4C8QA 3JSCA 1AD5A 4BDZA 4RTVA 3CMEQ 1JU5C 4J9EA 2XIDA 4LNPA 4N4HA 2HEQA 5KYWA 1BIBA 2CP0A 2JMCA 3OYDA 3TEEA 2BKDN 1HD3A 1QW1A 3RERA 3I55Q 1M8VA 3FRNA 2E10A 4AFSC 2VGMA 1K73R 1UJYA 4M75C 3OW2A 2O9VA 4KULA 3PMTA 4OMNA 4HCCA 1Y7XA 3E2UA 2PU9B 3EG9A 4LUEA 4ZNXA 2EQJA 2V8KA 3A98A 1OYXA 1RADB 3SWNB 4LD6A 2PVOB 3FJPA 2A36A 4Y92A 4N4GA 4IKFA 3MJXA 2KRNA 4OMOA 5L8RE 3BDUA 3S3OA 2XI9A 1DJ7B 4M75B 1Q7YR 5M9OA 1HSQA 1H3ZA 2L8DA 1TUDA 2FHDA 1T3SA 2JW4A 1GL5A 4E7ZA 1KC8R 3VYHB 3OS2A 1VQKA 3V7SA 2GQIA 1G5VA 1RLPC 3JV3A 4X34A 3CXCS 1BK2A 3QO3A 1FXXA 1VQLT 4F16A 2QQ9A 4M78G 1T0HA 1AHJB 2LCSA 4E2FB 5GAMh 2ZPEB 1XJWB 2DYIA 3OYGA 2OTLA 2EYWA 1VQ4Q 3RDVA 2JN0A 2JM9A 3LWHA 4KH0B 4M7DG 2YRVA 4HCZA 1QVFS 1K8AU 2KNBB 2DL8A 4IUUA 3WXMB 3REBB 2CH4W 2XICA 1SSFA 2C0TA 2EGEA 1MMAA 2DFUA 2WSCE 5CKDA 5CR2A 2E4HA 4FYVB 5GMKi 2JXBA 1KHCA 1I81A 1QLYA 2M9UA 1SSHA 2M16A 1B7TA 1VQNQ 3UA7A 4CRIA 4XAXB 5AT1B 1YJWA 3V8LA 4LXCA 3FJ5A 3MKDA 3GBQA 4HCKA 3L1AA 3C12A 1VQPA 1YHQT 5FU7C 3C0CA 3DB4A 2KR3A 2MAMA 1B3QA 1D0ZA 1NZ9A 1VQLQ 1G3SA 1YN8A 5KYWB 4C92G 1S72A 3SFMA 4PJOC 3HSBA 2KRSA 3JCMg 4D6WA 2CP2A 5CQYA 2K7AA 4ANJA 5KCOA 1WJQA 4EMKC 2BTTA 3CCQA 1VQ6T 3OYLA 3JB9J 3SWNA 1U1TA 3CCJA 3CCMQ 5KH6A 5CCAA 3E9GA 4M75D 4A4EA 5ECAA 1OEBA 1VYUA 3HRTA 4OVAA 1M30A 2F69A 2QQBA 1U8RA 2R5MA 2ZZDA 4X9CA 3OQ5A 1S1NA 1M3AA 4OGEA 1IXDA 1NJIC 1Q81R 3CC7T 2O31A 4M77C 4C0GA 1OZ3A 1JJ2P 3JCMh 4PLIA 1X01A 1E6GA 5FWBA 1YJNQ 2DXUA 3C94A 3OYEA 4ATOA 2RQUA 5GANj 3ZBDA 3QDFA 2YRCA 2IVWA 1VQKQ 1SEMA 3NMZC 2HSEB 3CCVQ 2F5TX 4J83A 4LN2A 4PJJA 2NLUA 4M78F 3CCMA 4LUDA 1WXUA 2XDBA 2CUBA 2FZCB 2DRKA 1LCKA 4PJOG 2PTKA 3CMAT 1M1GA 3H9NA 2ECZA 5D6WA 4M7AF 4BD3A 2WSEE 5GAMj 1YJ9T 2NUTB 2RHZA 5CVIA 1KHIA 4FW1A 2LVMA 2ZPGB 3OW2P 3M4YA 5CO7A 2DTHA 5GAN3 1PWTA 5J39A 2VC8A 2GTOA 2KROA 4LD9K 3KXTA 3EH1A 4NOYA 2E5QA 3MEAA 2KAFA 2RB6A 4QT7A 2M0OA 1MNEA 1ABQA 3SWNC 2LQ8A 1X6BA 2VWFA 2FZKB 2XKOC 1WHJA 2DM1A 2Y4XA 2KEAA 3RMQA 5IAYA 2AKKA 3VV0A 2J05A 2PNIA 3OYHA 2QEXA 2EQUA 2KQWA 2MWPA 4J9CA 3JCMc 2H3EB 5J26A 3TSZA 2CH4A 4PFPA 1JRIA 4AMCA 5KYUB 4M7DC 2GF7A 2P4RA 2RQVA 2DMOA 1HXDA 2EGAA 4JUVA 3AHUA 4Z88A 1QMCA 1RI0A 1YI2T 1K76A 2CGHA 1VQOQ 4OF1A 1F1BB 3TQ7P 1N9RA 4OGCA 5LJ5e 4A4FA 1JB0E 4M78C 2M51A 4Q5WA 1VQMA 4DEXA 5FW9A 4Y91A 1XNIA 2E3HA 4XU0A 4MZMA 1X43A 1G2BA 2DRMA 3M53A 2KXCA 1ZSZC 1FWZA 5GMKh 1KIKA 1X6GA 3M9QA 1ZBXA 1B07A 1VQNA 3L2VA 2FRYA 1RAAB 2JMAA 3L42A 3RMSA 1ZX6A 5IHKA 4OMFB 4LDXA 2YWWA 2ESWA 4OMLA 2L3SA 2EJGA 2F2VA 4AFUC 2CZ0B 1IB8A 1LVKA 4OB2B 4HT8A 2EIFA 4MZPA 4K11A 3HTRA 1ZLMA 3RNJA 4BI3A 2XG8D 5DM7R 1LNXA 1SPKA 4EMKB 4PFZA 1KD1R 4B9WA 1KQ2A 2KT1A 2SRCA 3EGUA 1UGSB 2GBQA 2WACA 2ED1A 1OOTA 4M75E 1VOMA 1UECA 3H0HA 3CCVT 3CCQT 1OQKA 1QP3A 3I56Q 4N0AC 2QDYB 3ZL7C 1WIEA 3JB9F 3QG1A 2FB7A 4A4GA 3NGPA 1Q81U 1WHLA 4RCCA 3UATA 5A0GA 1Y71A 3C4SA 4C92C 2RD1A 3GIBA 1UFFA 2GGRA 4M7DB 3CCET 1UG1A 1TWBA 3P8DA 1W2BS 1RL2A 1JQQA 2PVDB 1VYTA 4WF2A 1Q82C 2RHIA 2E5KA 4V2SA 1W70A 3CCRA 3QXEB 3CC4T 4OB0B 2EYXA 4OP0A 1M1KU 5D6YA 3EHRA 4EMHA 2QA4A 3JRZA 2FRWA 1QCNA 2DVEA 2V8JA 4F7UB 4FL6A 4JRQA 1VQ4T 2D0QB 3UF4A 1ZBJA 2GQVA 3M0TA 2A08A 2DL5A 1M1FA 2X35A 2F5KA 1RABB 3OS5A 1HK9A 4F7UG 2RI5A 4F7UE 3QIIA 1LPLA 4D8KA 1Y57A 1ZSGA 1W1FA 1NYGA 2EAYA 3NTIA 4J9HA 3CD6Q 2C0IA 3E19A 4IUVA 3AT1B 1RI9A 1XOVA 3KBGA 4KH1B 2Y4YA 3PMIA 2F1LA 4RTWA 2W10A 3LH0A 3JB9G 2DZCA 1MV0B 3I5RA 3A8HB 1SHGA 4M7DE 3PVQA 4J9FA 1GXIE 3CCLT 4J6WA 5FU6B 4A54A 4A53A 4E7SA 2P4TA 1KD1U 3M59A 3M57A 1AWOA 4C5IA 3OS0A 4EMKA 5A0DA 2HNIA 3VS2A 2K9GA 1UHFA 1P92A 1TXQA 2MF2A 4QKUA 3G6ET 3CC7Q 1FMKA 4J9GA 2BUDA 3JCMJ 4PLLA 1R77A 2O4XB 1KG1A 1WFWA 3JCMd 4BB7A 4F17A 5HCKA 1PHTA 1HJDA 3CPWS 3TCJA 3QZ5B 1NYFA 1TUCA 3CBPA 4C92D 4PJOE 1VQ9Q 1NPRA 2ZCFB 1OPKA 2LTOA 2CSQA 3URGA 2PZ1A 1K9MU 2NWMA 1RAEB 2AZVA 1U3OA 1JO8A 2PQWA 1K73U 2ENMA 3VS3A 2LQNA 5FRMA 8ATCB 1WA7A 2MPXC 1BCOA 1Y96A 2CZ7B 2E12A 1H92A 1ZUUA 2EWNA 3CCRT 1N8RR 2NUPA 5CAIA 1QVFA 3JCMV 1AOJA 2DD4A 1WXBA 1K0XA 2CKKA 4IUPA 2LZ6B 5GANd 1TG0A 3RUXA 2LT1A 2QQRA 3EH2A 2LQKA 2NUZA 5GJWB 3EFSA 4J9DA 8AT1B 2D9TA 1D1CA 4GLKA 3EG0A 2QTXA 2CP5A 3CXCA 3MEVA 4PJOA 2LNVA 4C8QF 1YJWT 3G7ZA 3CC2A 4E7HA 1BU1A 2KRMA 2DIGA 4Z8AA 2PVGB 4X1VA 3KUFA 5GAMd 3JCMe 1WZOA 1BCMA 2KK4A 1ZHIA 4C92E 4JS5A 2YUOA 1X2QA 3A8MB 1G83A 1N6AA 1UJ0A 5GMKe 2D8JA 3UWNA 2RJDA 2JTEA 4C92F 2DLPA 4R0KA 5KCHA 3CC4A 2MCNA 1PNJA 4DBHA 2V1RA 4RG2A 3OYFA 2W0ZA 4C92B 2DXCA 1MUZA 2YLCA 5LJ3g 4E7KA 2HQXA 4ZGEB 1K9AA 2EFIA 3OW2S 3MP1A 2VXFA 2YXYA 1ABOA 1OU9A 3CC2T 3JB9H 2HL5C 2JJ9A 1UGRB 1OX8A 2K2MA 2RK2A 1YCSB 1RAHB 2LCLA 3GNGA 1YITA 5CIUA 2OAWA 4BY6C 2P0KA 5C6SA 2B86A 3CC7A 3REAB 5I2MA 4RTUA 1WQWA 2RHXA 4ZN1A 4PJLA 5GJVB 1NJIR 6AT1B 3OYYA 3MHXA 5LJ5h 1BI2A 2DBMA 2OTJQ 4L5GA 1HYOA 1K73C 5I22A 1WNLA 4KT0E 1Q7YC 1VQPQ 1QVGA 2AK5A 1AWXA 1QVPA 1U1SA 3CD6T 2E70A 3N5BB 1UGVA 4F7UF 1KQSA 1RUWA 4D8DA 3L2WA 3QSUA 1QWEA 3A5ZB 1ACMB 4KGXB 1S72Q 1VQ5T 2B8AA 4JJDA 4N4IA 3HP9A 3FB9A 5I21A 3RIRA 3E1SA 4XTZA 4IIOA 2I2LA 5LJ5j 2G3RA 3MPUB 1T3LA 1TTHB 3EFOB 4RUGA 4M78A 2EYQA 3EGXB 4BE2A 3EFRA 1LJOA 2DKGA 1YJNA 2COWA 3QYHB 2RA2A 2DJQA 4HVVA 4J5YA 5LJ3d 3QWYA 2XU8A 1OULA 3LX7A 3OYBA 3A8OB 5C0MA 1YWOA 4AG1C 3V7CA 2LQWA 3CCLQ 4OMPA 3BFMA 2HSPA 1M5Q1 3M0PA 2HCKA 2JUFA 1UE9A 1WHMA 3OYAA 3VS1A 1M90C 2SEMA 2JS0A 1MGQA 3M54A 3RKYA 1I07A 2YUQA 3CMAA 1YHQA 1Y07A 3OYMA 4A4KA 3GOXA 2RPNA 3A8GB 3S3NA 4HCBA 4HXJA 1GFCA 2OTLT 1M2OA 3BY7A 5LJ3h 4ZN3A 3UT1A 1OI1A 2XDDA 3M0UA 1B34A 3X25B 5HY6A 1TSFA 1R0CB 1NEGA 4LDUA 4RMOA 3MP6A 3RBBB 4FSXA 5IN1A 4RTTA 5KE3A 3QWXX 1K4US 4NL3A 1VQ8Q 2MOXA 1UGPB 1YP5A 2KXDA 4ZTFA 2JM8A 4PJNA 4C5EA 4E47A 1I5LA 1VQ9A 1VYVA 1K8AR 4XTUA 2A28A 4HA8A 3P8HA 3CQTA 1GCQA 4JRPA 3RKXA 2LX7A 3OS1A 1KQSS 1VQ6A 2DEUA 3OYKA 3EHQA 2KSSA 3L2UA 1U5SA 2YDLA 4N0AA 3CCJT 1WHHA 1WLPB 2YRDA 3CMEA 2C06A 3J80E 1KSWA 2LCCA 4C92A 2MMPA 1IZ6A 4B6MA 5KYUA 3H0IA 1LOJA 2DPPB 1JXMA 1X27A 3PT9A 3A8LB 1VQOA 3QJ6A 1Q86R 2LJ3A 4E7LA 1JJ2S 2BIVA 1TUGB 3JB9D 2BZ8A 3DLMA 5KYYA 4JJNK 1ARKA 1PG5B 2CP3A 1ZA2B 2COYA 5FLXE 3G1JA 1BI1A 2H8HA 1NE8A 4A4HA 2EGCA 5GMKm 1QCFA 2LNHB 4J6YA 2DTIA 4C8QB 1GRIA 2FPDA 2E3IA 1NLPC 3MP8A 4JJBA 1YITT 2QQAA 5GANg 1AZEA 2CS7A 1VQ8T 3P8BB 1YHQQ 2ZGWA 2ZPBB 4OMQA 2CZ1B 4QQDA 4FYXB 3M0SA 2JT4A 3PTAA 2D1XA 2QQSA 2VGNA 4M7AB 1BIAA 4GY5A 3H6ZA 2A3LA 1VQOT 2J7IA 2CT4A 3D7SB 3SDZA 2X9HA 3NPFA 1K1ZA 5CKBA 1QP2A 1VQ4A 2F2XA 4VUBA 4BE1A 1JBMA 3EFOA 2FVUA 4HVUA 1N27A 1YBYA 5I2SA 1KK7A 3CCMT 1ZUYA 2K5FA 3G4ST 1G3WA 2DETA 1IGUA 2QYZA 1QCOA 2DA9A 5IHNA 4XU2A 2COZA 5KYNA 2EBPA 1WDXA 3HL8A 4QQ6A 1VQMQ 1X75C 3X28B 1D3BA 3M0RA 2QI2A 3OMCA 3X26B 1IHVA 4XQ3A 1V1CA 1EFNA 2HAXA 3R6NA 4HT9A 3FLGA 3RESA 2LDMA 4ORZA 1YJWQ 2OTJA 1M90U 1Q86C 2OTLQ 2EQMA 3FDRA 1Z9ZA 2CZ6B 2WSFE 2YHTA 4LE9A 2DNUA 2KBTA 3E9FA 5GAOq 2RQWA 1BYMA 3G4SA 4AT1B 1WHGA 1TS9A 5EC7A 4M75A 2P84A 5GAMe 5GAMg 4ZGDB 1M8MA 2RJEA 4UC4A 2OAUA 2O88A 4FYWB 2EYYA 2D0NA 3CPWA 3HRUA 4RTZA 5IXBA 4DA4A 4KUDK 2GTJA 3JAME 3H0FA 1ZSZB 2CUDA 1D1BA 4L6V5 4BI4A 3ZFJA 3U23A 1D0XA 4GBQA 2QK0A 2YT6A 1Q81C 1YWPA 5KYXA 3DKMA 2J06A 1YI2A 2RMOA 2QG9B 3CD6A 5FU7B 3J81E 3NHNA 1EX4A 4BI8B 5I11A 3VS5A 3M4GA 2EKHA 3MEUA 4ELYC 1Y96B 2DD5A 4F04B 1BBZA 3HHTB 2H3JA 2NYSA 3QPHA 3VRYA 2DJZA 1X6OA 2MWOA 4QW2A 3FC3A 1UTIA 1G3YA 3CCEA 4PJOD 5KYYB 3UPUA 3LLRA 4EDUA 4OMMA 3MO8A 4YTLA 4R56A 3QYGB 2RN8A 4EMGA 1KC8U 2A37A 2VASA 2R5AA 3EGDB 4M7DF 4MMKA 1YITQ 1VQ7Q 1I0CA 5A0LA 4M77D 1VIEA 2P0QA 5GAOm 4E6RA 2C0OA 1FYNA 1UHCA 2KVQG 2O01E 2M1HA 2K2VA 1SF9A 3M5AA 1VQKT 1IRXA 5CK9A 1YNZA 4J7IA 2JS2A 3G71A 3JCMW 4CC2A 2CP7A 3NTHA 2V1QA 2KGTA 2MYSA 4BACA 4O5VA 3PFSA 2RO0A 2YUNA 4NS5A 3INZA 2FYKA 1N8RU 1IHWA 2XK0A 2NUTA 2HD0A 2FZGB 2VXEA 2DAQA 2JOYA 4PK4A 3G6EQ 4BE0A 3HRSA 1KQ1A 1V76A 5CKFA 1WHKA 1K9MC 4XTYA 3OA6A 2HMAA 4DBFA 2RJCA 1W2BA 4KBMB 1M3CA 4J7FA 4ZGJB 3HFNA 1NEBA 4B9XA 4ESRA 5LJ3f 3WVDB 5FWCA 1JEGA 4II1A 5CKEA 1BB9A 4WCIA 3VYGA 3HKSA 1AVZC 4DEYA 4FSSA 1UB4A 3CPFA 4HVWA 4BDYA 3ER0A 2QAZA 3FIFA 3VUBA 1IGQA 2BE7D 3CCLA 2KE9A 3CCEQ 5D7UA 5AYFA 2K5LA 4M77A 4HKEA 2Z0WA 1J3TA 2L0AA 5KYXB 1BI3A 1R0BG 4C0FA 3I55T 1QVGP 1MHNA 5LL6S 3G6EA 1M90R 1WQ7A 4P5NA 3QJYA 2CYZB 4PFOA 5GAOn 3ULRB 1PD1A 4XK8E 1YFNA 4E7JA 3CC4Q 1PRLC 1YCYA 2OTJT 1AEYA 2AKLA 3L2QA 1YI2Q 2JNGA 5HK3A 3VJPA 2R58A 3H8ZA 3VS6A 1M27C 5J3BA 3O5ZA 3LWIA 4AFZC 3OYCA 2D8HA 2L3PA 4FM4B 1VQ7A 1PKSA 1WJRA 1VA7A 3G71T 4Y28E 1MV3A 2K3BA 1C1AA 4F14A 4PJOF 3GF5A 4XTWA 1VQLA 4MDXA 4QVZA 2QASA 2CT3A 2ZAEA 1M1KC 3OY9A 1IREB 2ZPHB 1U06A 4AG2C 1RACB 3OMGA 2D6FA 4JZ3A 2DVJA 2OI3A 2DXBA 1VQ6Q 2DIQA 1CKAA 4F7UA 1TU0B 5GMKl 3JCMX 3S3MA 3Q1JA 2HBWA 4C0ZA 4Z89A 1R8OB 1I4K1 3OSSC 2RM4A 9ATCB 3JB9I 3QKJA 2DTOA 1RAGB 1M4ZA 1QWFA 3CCJQ 1KFZA 3CCSQ 4RTXA 3LGLA 1C6VX 1RAFB 3H41A 2RH2A 1N5ZA 1GFDA 1M2VB 1PSFA 2M02A 4IUQA 2QTVA 7AT1B 3F70A 1JXOA 1UUEA 3OB9A 2HBPA 2RF0A 2P0PA 3CCRQ 3QZ9B 1YJ9A 3G4SQ 4MDWA 4M7DA 3GNFB 5CKHA 2IIMA 4M75G 1D1AA 2DEQA 3RR6A 1K0SA 1CSKA 3GLXA 1N9SA 2YSQA 2EPDA 2HQHA 1ZA1B 1I8FA 2IPOB 4M7AC 4XU1A 1YIJT 4J6XA
chains in the Genus database with same CATH topology
1RL2A 4IUTA 4ME7A 4QVCA 1G3TA 2LCCA 2DZ9A 3I55A 4C92A 2MMPA 1IZ6A 4PL6A 2PVDB 2ZPIB 4WF2A 1Q82C 2RHIA 4V2SA 1LOJA 2DPPB 3CCRA 4JRKA 2AHJB 2K57A 3QXEB 4XTXA 3T9NA 3PT9A 3A8LB 1VQOA 4FT2A 4M78B 2A7YA 3QJ6A 4JLGA 4C8QC 3I56A 3CC4T 4OB0B 4E7LA 1JJ2S 3CCUA 4OP0A 1M1KU 2BIVA 2JTFA 5D6YA 4FIBA 3CCVA 4JS4A 3JB9D 2V8IA 4JDSA 3V8JA 2R57A 3DLMA 4EMHA 2QA4A 3JRZA 4LDYA 4JJNK 2DVEA 4M77B 2V8JA 4F7UB 4FL6A 4MMLA 5FLXE 4JRQA 1BI0A 4C8QA 1TH7A 2E41A 1W4SA 3JSCA 4E7IA 1BI1A 3OYNA 2D0QB 5CQXA 1NE8A 4A4HA 4BDZA 2GQVA 5GMKm 2XIDA 2DTIA 2VYTA 4J6YA 2PUOB 4MZTA 4N4HA 4C8QB 1BIBA 3PGGA 1M1FA 2X35A 3OYDA 2F5KA 3MP8A 3TEEA 3OS5A 2BKDN 1HK9A 4F7UG 2QQAA 1YITT 2RI5A 1QW1A 3RERA 5GANg 4F7UE 2CS7A 1VQ8T 1M8VA 3FRNA 3QIIA 2E10A 3P8BB 2VGMA 4HT8A 2ZGWA 2ZPBB 4M75C 3OW2A 2CZ1B 4KULA 3PMTA 4QQDA 5LJ3e 2EAYA 4HCCA 1Y7XA 3NTIA 2PU9B 2EQJA 1Q86U 3PTAA 3E19A 4IUVA 2QQSA 2VGNA 4M7AB 1XOVA 2V8KA 3KBGA 2Y4YA 1BIAA 1OYXA 3PMIA 4GY5A 4LD6A 2PVOB 3H6ZA 3META 3FJPA 2A3LA 3SWNB 3X24B 4N4GA 1VQOT 1QVGS 4IKFA 3LH0A 2RI3A 3DLLA 5L8RE 3BDUA 3S3OA 2XI9A 3JB9G 1V29B 1DJ7B 3SDZA 4M75B 3L2RA 5M9OA 4RKUE 2DZCA 1H3ZA 5CKBA 2L8DA 1QP2A 2FHDA 3DB3A 1VQ4A 4VUBA 3A8HB 5GAOp 4BE1A 4M7DE 2KY9A 1JBMA 5HK0A 3VYHB 2FVUA 3OS2A 3S6WA 1GXIE 1VQKA 3V7SA 1G5VA 1N27A 1VIFA 1YBYA 5I2SA 2DXTA 4PKCC 2QEXT 3CCLT 4C8QG 3CCMT 4M7AA 4X34A 4J6WA 3CXCS 2K5FA 3QO3A 5FRNA 1FXXA 5FU6B 1VQLT 3G4ST 1G3WA 4A54A 1O9SA 4QVDA 4A53A 2QQ9A 1UGQB 4M78G 3CCSA 2P4TA 1AHJB 4XTVA 3ZEHA 1Q7YU 1KD1U 3M59A 4XU2A 3M57A 5GAMh 4C5IA 3OS0A 2ZPEB 3RKWA 4EMKA 5A0DA 2HNIA 3OYGA 2OTLA 2X4WA 3HL8A 4OB3B 3OSVA 1P92A 4QQGA 2JN0A 4QQ6A 4M7AG 2MF2A 2O4XA 4M77E 3LWHA 1X75C 3X28B 3G6ET 1WGSA 4TVRA 3WVEB 1D3BA 4DQ2A 2BUDA 2QI2A 2DK3A 3OMCA 2PUKB 3X26B 3JCMJ 4M7DG 4PLLA 2YRVA 4HCZA 2O4XB 3NTKA 4XQ3A 1K8AU 1QVFS 1KG1A 3JCMd 3LGFA 3VUZA 4BB7A 2HAXA 4IUUA 4HT9A 3FLGA 3RESA 2LDMA 3WXMB 2OTJA 2XICA 1M90U 1SSFA 1Q86C 3CPWS 2WSCE 2K3XA 3TCJA 5CKDA 3PIPA 3QZ5B 5CR2A 2EQMA 3FDRA 3CBPA 4C92D 1VQ9T 4PJOE 2CZ6B 2WSFE 1NPRA 2YHTA 2ZCFB 2LTOA 3E9FA 5GMKi 1KHCA 5GAOq 3URGA 1VQMT 1I81A 1M9SA 2M9UA 1BYMA 3G4SA 1K9MU 3OBYA 2M16A 4M75A 4C0DB 3QUIA 1NPPA 2PQWA 4CRIA 5GAMe 5GAMg 4ZGDB 3TU4K 2KDSA 1K73U 4XAXB 4J8OA 5GAN5 3ME9A 2RJEA 1YJWA 4UC4A 1XTDA 3V8LA 5FRMA 2OAUA 1VQ5A 2EJ9A 1Y96A 4OB1B 1VUBA 1WPYA 3CPWA 2CZ7B 2E12A 3HRUA 3L1AA 4RG8A 3C12A 3VKIA 1VQPA 1VQ8A 1YHQT 4DA4A 4KUDK 5FU7C 3JAME 2EWNA 5GAMf 2K5IA 3CCRT 3MCAB 4L6V5 3DB4A 2JVVA 3ZFJA 4Z02A 4BI4A 5CAIA 1QVFA 2MAMA 2XHCA 3JCMV 4LDXA 3I56T 2DD4A 1NZ9A 2E64A 1G3SA 1Q81C 2CKKA 4IUPA 5GANd 2E6NA 3DKMA 4C92G 1ZQ1A 3RUXA 1YI2A 1S72A 3CD6A 2LT1A 2QQRA 3SFMA 5FU7B 4M77G 3J81E 3PNWC 3HSBA 2LQKA 4PJOC 3JCMg 4BI8B 3CEYA 3M4GA 3MEUA 4D6WA 5CQYA 4XU3A 5D6XA 4ELYC 2RI2A 3EFSA 1Y96B 2D9TA 3BDLA 5KCOA 3BW1A 1WJQA 2DD5A 4GLKA 3HHTB 2QTXA 2H3JA 1KC8C 2GFAA 4EMKC 3QPHA 3UDCA 3MEVA 3CXCA 3JCMQ 2DJZA 4PJOA 4LDVA 1X6OA 2LNVA 4C8QF 3CCQA 1VQ7T 3OYLA 3JB9J 1VQ6T 1YJWT 3SWNA 2MWOA 3G7ZA 4QW2A 1U1TA 3FC3A 3CC2A 4E7HA 2DIGA 3CCJA 2PVGB 1G3YA 5KH6A 3KUFA 3CCEA 4PJOB 4PJOD 1N8RC 5GAMd 5CCAA 3E9GA 4M75D 1O75A 3JCMe 4A4EA 5GAN2 3UPUA 3EAEA 3CCST 3HRTA 1VQPT 4OVAA 1NJIU 2KK4A 1ZHIA 2F69A 3LLRA 4PNOA 3CBOA 4C92E 4EDUA 3PIOA 2QQBA 4JS5A 2R5MA 2ZZDA 4X9CA 1U8RA 3MO8A 3OQ5A 2E6ZA 4OGEA 3A8MB 1NJIC 4YTLA 1N6AA 1Q82U 3LW5E 4R56A 3ASKA 3QYGB 5GMKe 4EMGA 5GANh 1KC8U 5KE2A 3UWNA 3CC7T 2RJDA 4C92F 4ZTJA 4M77C 2RHYA 4C0GA 2R5AA 2MI6A 5KCHA 4M7DF 3CC4A 1OZ3A 1OZ2A 4MMKA 4RG2A 4PLIA 3JCMh 3OYFA 5A0LA 1X01A 4C92B 2VV5A 2DXCA 4M77D 1VIEA 4M75F 1D3BB 2P0QA 2DXUA 2YLCA 2LC4A 3C94A 3M55A 3MEWA 5LJ3g 5GAOm 3OYEA 4E7KA 4ATOA 2HQXA 5FROA 4C5GA 5GANj 3ZBDA 1UEBA 2O01E 2KVQG 2M1HA 4ZGEB 2K2VA 2EFIA 3OW2S 3M56A 2VXFA 3MP1A 2IVWA 4BUGA 2JTMA 3M5AA 1VQKT 1EIFA 3QBYA 4DOVA 2F5TX 4J83A 5CK9A 4J7IA 2QA4T 2NLUA 5GAN8 4M78F 3CCMA 3G71A 3JCMW 3CC2T 3OYJA 3JB9H 3NTHA 4IURA 2XDBA 1UGRB 2KMTA 2ZPFB 3CBMA 2RK2A 1VQNT 1PSEA 4FU6A 4PJOG 4BACA 3CMAT 1M1GA 5D6WA 5DLQE 1BKBA 4O5VA 4M7AF 3HFOA 3PFSA 2WSEE 4BD3A 5GAMj 1YJ9T 2LCLA 2RO0A 4NS5A 2RHZA 4O6JA 3GNGA 5CVIA 2K3YA 1KHIA 3INZA 1YITA 5CIUA 2FYKA 2LVMA 2ZPGB 1N8RU 4BY6C 3TREA 2P0KA 5C6SA 2XK0A 3CC7A 1JJ2A 3M4YA 2HD0A 5I2MA 5CO7A 5LJ5d 3CMET 3NFCA 2DTHA 5DY9A 1WQWA 2VXEA 5GAN3 1YIJA 2RHXA 5J39A 2DAQA 2VC8A 2EJFA 2JOYA 4FT4A 5HKCA 4ZN1A 4LD9K 5DLOA 3OYYA 4BE0A 3MHXA 3HRSA 1BI2A 1KQ1A 4NL2A 5LJ5h 3KXTA 3C95A 5CKFA 4L5GA 4NOYA 1H641 1K73C 5EG2A 1K9MC 2E5QA 1WNLA 3MEAA 2XDPA 4KT0E 4XTYA 5LJ3j 1Q7YC 3OA6A 1QVGA 5FU6C 2KAFA 2RB6A 2RJCA 4KBMB 4J7FA 2M0OA 4ZGJB 1W2BA 3HFNA 4B9XA 1QVPA 3OYBA 2LX9A 2FL7A 1U1SA 5LJ3f 2LQ8A 3SWNC 3WVDB 2E70A 3N5BB 1WJSA 4II1A 5CKEA 3CD6T 3SD4A 3FEOA 2XKOC 4F7UF 3VYGA 1KQSA 3HKSA 4RCBA 3OYIA 3L2WA 2Y4XA 3J7AF 1UB4A 3QSUA 2L5QA 3RMQA 2DO3A 3CPFA 4BDYA 5IAYA 3A5ZB 2LT4A 3ER0A 3FIFA 3VUBA 3O8VA 3VV0A 5GAOr 3R6OA 3OYHA 2QEXA 1VQ5T 2B8AA 2EQUA 2KQWA 3CCLA 5AYFA 4N4IA 2MWPA 3JCMc 2K5LA 3HP9A 5LJ5f 3FB9A 2L3RA 5I21A 2XD0A 5GMKj 3RIRA 5J26A 4M77A 4HKEA 3E1SA 1JRIA 1BI3A 4C0FA 3I55T 1MHNA 5LL6S 4EPCA 3G6EA 1WQ7A 4XTZA 4M7DC 2X4XA 2I2LA 4JRIA 4P5NA 2GF7A 5LJ5j 3QJYA 2G3RA 2CYZB 5GAOn 3OBWA 5GAOl 4BY6B 1HXDA 4JUVA 4XK8E 4M78A 4E7JA 2EYQA 3AHUA 1YCYA 2OTJT 1XQHA 4BE2A 1RI0A 3L2QA 1YI2T 3EFRA 2CGHA 5GAN6 1LJOA 2DKGA 2JNGA 4OF1A 3V7RA 4C0DC 5HK3A 3QYHB 4R55A 1YJNA 1N9RA 2RA2A 4OGCA 4DOWA 3L2ZA 1FX7A 3GPLA 5LJ3d 4J5YA 3VJPA 4A4FA 2XU8A 1JB0E 2RHUA 3LX7A 4CI0C 5LJ5e 5A2QE 2R58A 3A8OB 4M78C 5C0MA 3H8ZA 5GANe 2Y90A 5J3BA 4Q5WA 2QXFA 2VUBA 1VQMA 3VU3C 4Y91A 5GANf 1XNIA 3V7CA 3LWIA 3OYCA 3BFMA 4XU0A 4FM4B 1KD1C 4MZMA 1VQ7A 1WJRA 3JCMP 1M5Q1 3M53A 2JUFA 3G71T 1FWZA 4Y28E 5GMKh 3OYAA 3SB2A 3M9QA 1ZBXA 2E1HA 4PJOF 3GF5A 4XTWA 1M90C 1VQNA 1VQLA 1MGQA 4MDXA 3M54A 4QVZA 3RKYA 3L2VA 3L42A 3CMAA 1YHQA 3RMSA 4JLIA 4C8QD 1M1KC 1Y07A 3OYMA 3OY9A 5GAN7 1IREB 2ZPHB 4OMFB 4A4KA 3LYIA 4X9DA 3JCMb 3A8GB 3GOXA 5IT9E 3S3NA 2K4YA 4KUIA 1K8AC 3OMGA 4HCBA 2D6FA 2X4YA 4M7AE 2EJGA 2OTLT 2DXBA 2CZ0B 3BY7A 4OB2B 2GCXA 2DIQA 5LJ3h 5LJ5g 2EIFA 2RK1A 1OI1A 3HPWA 3M58A 4MZPA 3UT1A 4F7UA 4ZN3A 2XDDA 1B34A 3X25B 4LDWA 1YJNT 2X4JA 5HY6A 5GMKl 3JCMX 3Q1JA 3S3MA 4C0ZA 1VQ4T 4LDUA 1R8OB 1I4K1 3OSSC 4BI3A 2XG8D 3X20B 4RMOA 5DM7R 3MP6A 1LNXA 2RM4A 3JB9I 1S72T 2L89A 4EMKB 4M7AD 3QKJA 1B34B 2YLBA 2EKOA 4FSXA 5IN1A 4B9WA 3GP8A 1KQ2A 5KE3A 2DTOA 1M4ZA 4NL3A 1UGSB 2WACA 1UGPB 4C8QE 4ZTFA 3QDRB 3LGLA 4C5EA 3V8KA 2HQEA 4E47A 4M75E 1I5LA 3CCUT 3CCVT 2RH2A 1PSFA 4M78D 4IUQA 3CCQT 4L59A 1QP3A 3JCMf 4ELZC 3QHSA 2EQKA 1VQ9A 3F70A 4C5HA 3OB9A 4N0AC 2HBPA 2GFUA 2QDYB 2P0PA 4XTUA 3QZ9B 4HA8A 3P8HA 3QG1A 4JRPA 2FB7A 4A4GA 1YJ9A 4MDWA 3JB9F 1Q81U 2JZ2A 5GAN4 3RKXA 2LRQA 3GNFB 4RCCA 4M7DA 5CKHA 4M75G 5A0GA 3OS1A 1Y71A 3C4SA 1KQSS 2DEQA 1VQ6A 4C92C 3OYKA 2KSSA 3GLXA 4M77F 1N9SA 4M78E 2RD1A 3L2UA 3GIBA 2E65A 3CCJT 2IG0A 4N0AA 4M7DB 3CCET 1I8FA 4M7DD 4M7AC 3P8DA 1W2BS 2RJFA 3CMEA 2C06A 4XU1A 1YIJT 4J6XA 3J80E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7D C;  2JN0 A;  2I2L A;  4JRI A;  4QVC A;  4M77 E;  5LJ5 j;  5GMK e;  2DZ9 A;  4EMG A;  5GAN h;  4M7A G;  4C92 A;  5GAO n;  5GAO l;  1D3B A;  1HXD A;  4C92 F;  4JUV A;  4DQ2 A;  4M77 C;  4M78 A;  4WF2 A;  4M7D G;  3JCM J;  4M7D F;  4V2S A;  1LOJ A;  4MMK A;  3AHU A;  1YCY A;  3JCM h;  4JRK A;  2K57 A;  4XQ3 A;  4XTX A;  1X01 A;  4C92 B;  3JCM d;  3EFR A;  4M77 D;  2CGH A;  4M75 F;  1D3B B;  1LJO A;  2DKG A;  2DXU A;  2YLC A;  3V7R A;  5GAN 6;  4M78 B;  3RES A;  5LJ3 g;  4C8Q C;  1N9R A;  2RA2 A;  5GAO m;  5GAN j;  3L2Z A;  4HT9 A;  5LJ3 d;  4J5Y A;  5LJ5 e;  4OP0 A;  3JB9 D;  4M78 C;  3V8J A;  4EMH A;  5GAN e;  2Y90 A;  2VXF A;  4C92 D;  3VU3 C;  4Y91 A;  2DVE A;  4M77 B;  5GAN f;  4PJO E;  3V7C A;  2YHT A;  4F7U B;  4MML A;  5GAN 8;  4C8Q A;  4M78 F;  1TH7 A;  2E41 A;  3BFM A;  4XU0 A;  5GMK i;  5GAO q;  5GAM h;  3JCM W;  1I81 A;  3JCM P;  3JB9 H;  1M5Q 1;  4XTZ A;  5GMK m;  4M75 A;  3QUI A;  4J6Y A;  2DTI A;  4C8Q B;  5GMK h;  5GAM e;  3SB2 A;  5GAM g;  1BIB A;  3PGG A;  5GAN 5;  4PJO G;  2E1H A;  4PJO F;  4F7U G;  1HK9 A;  4M7A F;  3HFO A;  4XTW A;  5GAN g;  5GAM j;  3V8L A;  3RER A;  4F7U E;  1MGQ A;  3RKY A;  1M8V A;  2E10 A;  2EJ9 A;  3INZ A;  4JLI A;  4C8Q D;  1Y96 A;  2ZGW A;  4M75 C;  2FYK A;  5GAN 7;  3JCM b;  1WPY A;  4X9D A;  5LJ3 e;  3L1A A;  2EAY A;  4M7A E;  2EJG A;  2EWN A;  5GAM f;  5LJ5 d;  2DTH A;  3BY7 A;  1WQW A;  2VXE A;  5DY9 A;  4M7A B;  5LJ3 h;  5LJ5 g;  5GAN 3;  1BIA A;  4HT8 A;  3SWN B;  2VC8 A;  4F7U A;  5CAI A;  1B34 A;  2EJF A;  3FJP A;  5GMK l;  3JCM V;  3JCM X;  5LJ5 h;  1KQ1 A;  4NL2 A;  1I4K 1;  2E64 A;  3BDU A;  3JB9 G;  1LNX A;  2RM4 A;  1H64 1;  4M75 B;  4NOY A;  4EMK B;  3JB9 I;  4M7A D;  1B34 B;  2YLB A;  1KQ2 A;  2DZC A;  1WNL A;  5GAN d;  5GAN 2;  4C92 G;  2DTO A;  4XTY A;  3RUX A;  5LJ3 j;  4NL3 A;  4M77 G;  4C8Q E;  4PJO C;  3HSB A;  2RB6 A;  3JCM g;  3HFN A;  3V8K A;  5GAO p;  3M4G A;  4M75 E;  1I5L A;  1U1S A;  5LJ3 f;  4XU3 A;  3SWN C;  4M7D E;  1JBM A;  3EFS A;  1Y96 B;  4M78 D;  4F7U F;  3BW1 A;  4RCB A;  3JCM f;  3QHS A;  2QTX A;  3V7S A;  3QSU A;  4EMK C;  2DXT A;  4N0A C;  4PJO A;  3JCM Q;  2DJZ A;  4C8Q G;  4M7A A;  4C8Q F;  4J6W A;  4XTU A;  4HA8 A;  3QO3 A;  3JB9 J;  3JB9 F;  3SWN A;  3FIF A;  2FB7 A;  1U1T A;  4A54 A;  4QVD A;  5GAN 4;  3RKX A;  4A53 A;  4RCC A;  4M78 G;  5GAO r;  4M7D A;  4M75 G;  4PJO B;  4XTV A;  2DEQ A;  3JCM e;  3JCM c;  5LJ5 f;  4C92 C;  5GAM d;  3FB9 A;  4M75 D;  4XU2 A;  4M77 F;  1N9S A;  4M78 E;  2RD1 A;  3RIR A;  5I21 A;  3RKW A;  2E65 A;  4EMK A;  5GMK j;  4M77 A;  2HNI A;  4N0A A;  3GIB A;  4M7D B;  1I8F A;  4PNO A;  4C92 E;  4M7D D;  1JRI A;  4M7A C;  4PJO D;  4X9C A;  4XU1 A;  4J6X A;  1WQ7 A; 
#chains in the Genus database with same CATH topology
 4IUT A;  1GBR A;  1PD0 A;  4QVC A;  1G3T A;  2DYB A;  3EG1 A;  1QKW A;  2FPF A;  2ZPI B;  1MND A;  1A0N B;  3T9N A;  2AHJ B;  2K57 A;  4M78 B;  4C8Q C;  1SRL A;  4J9B A;  3THK A;  3I56 A;  2AT1 B;  4FIB A;  3CCV A;  2A0F B;  2V8I A;  2R57 A;  4LDY A;  1AT1 B;  4M77 B;  2KT8 A;  4E7I A;  1TH7 A;  1W4S A;  3OYN A;  4FW2 A;  5CQX A;  2ROL A;  2X3W D;  2M0Y A;  2VYT A;  4MZT A;  2PUO B;  2DIL A;  1RLQ C;  3PGG A;  1I1J A;  1D09 B;  1VQ5 Q;  2QA4 Q;  3EG3 A;  5LJ3 e;  1CKB A;  4A63 B;  1UDL A;  2RQT A;  1Q86 U;  1M3B A;  1WYX A;  2DF6 A;  3MET A;  3X24 B;  1NLO C;  2RI3 A;  3DLL A;  1Y0M A;  1OV3 A;  2CSI A;  1V29 B;  2O9S A;  3L2R A;  3CMA Q;  2VVK A;  4RKU E;  1PKT A;  3DB3 A;  5GAO p;  1GCQ C;  2KY9 A;  3LH5 A;  5HK0 A;  1FMV A;  3S6W A;  1VIF A;  2DXT A;  4PKC C;  3TSW A;  2QEX T;  4C8Q G;  3CCQ Q;  4M7A A;  2L2P A;  5FRN A;  1O9S A;  4QVD A;  3CCS A;  1UGQ B;  1MMD A;  4XTV A;  3ZEH A;  1Q7Y U;  1KQS P;  2LJ0 A;  3RKW A;  1G8X A;  2X4W A;  4OB3 B;  3OSV A;  4CC3 A;  4QQG A;  1W6X A;  3I9Q A;  2O4X A;  4M77 E;  2KYB A;  4M7A G;  1KJW A;  1WGS A;  4TVR A;  3WVE B;  4EIK A;  4DQ2 A;  2DK3 A;  2PUK B;  2X3X D;  2HKQ B;  3NTK A;  3CXC P;  3LGF A;  3VUZ A;  2KYM A;  4FCY A;  2K3X A;  3PIP A;  1GBQ A;  2ROT A;  1VQ9 T;  2BZX A;  2X51 A;  2VKN A;  1VQM T;  1M9S A;  3OBY A;  2AIR B;  1H3H A;  4C0D B;  3QUI A;  1NPP A;  2HDA A;  2J6O A;  3TU4 K;  2KDS A;  4J8O A;  5GAN 5;  3EG2 A;  3ME9 A;  1XTD A;  1WX6 A;  1EZZ B;  1GCP A;  1VQ5 A;  2EJ9 A;  1IO6 A;  2DER A;  4OB1 B;  1VUB A;  1WPY A;  1AWW A;  1VQ8 A;  4RG8 A;  1SG5 A;  3VKI A;  2NUP B;  5GAM f;  2O2O A;  1PM3 A;  2K5I A;  3MCA B;  2JVV A;  4Z02 A;  2K79 A;  2XHC A;  3I56 T;  1AZG B;  2E64 A;  3SHW A;  4CC4 B;  2E6N A;  1ZQ1 A;  2FEI A;  4M77 G;  2EVR A;  3PNW C;  1OPL A;  3CEY A;  2RNA A;  4XU3 A;  5D6X A;  3I5S A;  2RI2 A;  3BDL A;  3BW1 A;  1KC8 C;  1MMN A;  2GFA A;  3UDC A;  3JCM Q;  4LDV A;  1VQ7 T;  4DBQ A;  3M0Q A;  3G71 Q;  4PJO B;  2RQR A;  1N8R C;  1YJ9 Q;  5GAN 2;  3IQL A;  1O75 A;  2DBK A;  3EAE A;  3CCS T;  1VQP T;  1NJI U;  4PNO A;  3CBO A;  3PIO A;  2E6Z A;  1PRM C;  1Q82 U;  3LW5 E;  2ATC B;  1FMW A;  3ASK A;  5GAN h;  5KE2 A;  4ZTJ A;  2RHY A;  2MI6 A;  1OZ2 A;  1E7O A;  1AWJ A;  2FG0 A;  2VV5 A;  4M75 F;  1D3B B;  3M55 A;  2LC4 A;  3MEW A;  3VS0 A;  4C5G A;  1E6H A;  2I0N A;  2LMJ A;  5FRO A;  1UEB A;  3VS4 A;  3M56 A;  4BUG A;  2JTM A;  1EIF A;  3QBY A;  4DOV A;  2QA4 T;  1T0J A;  5GAN 8;  3OYJ A;  2KI7 A;  4IUR A;  2KMT A;  2ZPF B;  3CBM A;  1VQN T;  1PSE A;  4PJM A;  4FU6 A;  3EGD A;  5DLQ E;  1BKB A;  3A1P A;  4GLM A;  2EYZ A;  3HFO A;  1OU8 A;  4O6J A;  2K3Y A;  3PE0 A;  2DX1 A;  1ZSZ A;  3I35 A;  3TRE A;  4JJC A;  1JJ2 A;  2CDT A;  5LJ5 d;  3CME T;  3NFC A;  1TOV A;  5DY9 A;  1YIJ A;  2EJF A;  4FT4 A;  5HKC A;  5DLO A;  4NL2 A;  1SHF A;  3C95 A;  1H64 1;  1X2K A;  5EG2 A;  1Q82 R;  2MK5 A;  2G6F X;  2XDP A;  5LJ3 j;  4JPB W;  1WI7 A;  4KRT A;  5FU6 C;  1H8K A;  4KGZ B;  3PVL A;  2LX9 A;  2FL7 A;  1WJS A;  3SD4 A;  3FEO A;  5L23 A;  4RCB A;  3OYI A;  2XMF A;  3J7A F;  3EG9 B;  2L5Q A;  2DO3 A;  2J6F A;  2OJ2 A;  2LT4 A;  3O8V A;  2HKN A;  5GAO r;  3R6O A;  2L3Q A;  2XD0 A;  5LJ5 f;  2L3R A;  2K6D A;  2QGG A;  5GMK j;  2EW3 A;  4EPC A;  3CCU Q;  2X4X A;  4JRI A;  2AZS A;  2VB6 A;  5GAO l;  3OBW A;  4BY6 B;  3KFV A;  2V26 A;  1XQH A;  3CPW P;  3BE3 A;  5GAN 6;  3V7R A;  4R55 A;  4C0D C;  2FO0 A;  3SEM A;  4DOW A;  3GPL A;  3L2Z A;  1FX7 A;  4CI0 C;  5A2Q E;  2RHU A;  1PCX A;  5IHI A;  4CC7 A;  5GAN e;  2Y90 A;  1K9M R;  5IH2 A;  2QXF A;  2VUB A;  3VU3 C;  5GAN f;  1M1K R;  2QEX Q;  4RTY A;  1KD1 C;  2QDL A;  3JCM P;  1NG2 A;  1C0M A;  3SB2 A;  3VS7 A;  4DBR A;  2E1H A;  1QKX A;  1SRM A;  4JLI A;  4C8Q D;  5GAN 7;  3JCM b;  5IT9 E;  2GNC A;  3LYI A;  4X9D A;  1K8A C;  2K4Y A;  4KUI A;  5IXF A;  2X4Y A;  4M7A E;  2BZY A;  2YUP A;  2CRE A;  2LP5 A;  2GCX A;  4JZ4 A;  5LJ5 g;  2DL7 A;  2RK1 A;  3M58 A;  3HPW A;  1QQJ A;  1SKU B;  2ABL A;  2MIO A;  4LDW A;  1YJN T;  2X4J A;  1Z9Q A;  3X20 B;  1S72 T;  2L89 A;  4M7A D;  1B34 B;  2YLB A;  2EKO A;  3GP8 A;  4J9I A;  2FPE A;  2BE9 B;  4WTO B;  1I5O B;  4C8Q E;  2ED0 A;  4IIM A;  3QDR B;  4M4Z A;  1MMG A;  3V8K A;  2HQE A;  4KGV B;  1YIJ Q;  3CCU T;  3VRZ A;  4M78 D;  4L59 A;  4ELZ C;  1RAI B;  3JCM f;  3QHS A;  2EQK A;  3EGX A;  3CC2 Q;  4C5H A;  2GFU A;  2JZ2 A;  5GAN 4;  2LRQ A;  1PC0 A;  2CP6 A;  4M77 F;  4M78 E;  1QVF P;  2E65 A;  2IG0 A;  2OX7 A;  1NM7 A;  4M7D D;  2RJF A;  1QVG S;  4ME7 A;  3TVT A;  2HL3 A;  3I55 A;  2DZ9 A;  2J6K A;  1X69 A;  4PL6 A;  1M2V A;  4JRK A;  4XTX A;  2QGF B;  4FYY B;  1D0Y A;  2DL4 A;  4FT2 A;  2A7Y A;  4JLG A;  4AFQ C;  3CCU A;  1OX9 A;  2DL3 A;  1ZUK A;  2F2W A;  2JTF A;  1WXT A;  4JS4 A;  1NBE B;  4JDS A;  3V8J A;  2DE0 X;  1Q95 G;  2LJ1 A;  1W2B P;  2HZY A;  2EQI A;  4MML A;  1BI0 A;  3UA6 A;  2E41 A;  4C8Q A;  3JSC A;  1AD5 A;  4BDZ A;  4RTV A;  3CME Q;  1JU5 C;  4J9E A;  2XID A;  4LNP A;  4N4H A;  2HEQ A;  5KYW A;  1BIB A;  2CP0 A;  2JMC A;  3OYD A;  3TEE A;  2BKD N;  1HD3 A;  1QW1 A;  3RER A;  3I55 Q;  1M8V A;  3FRN A;  2E10 A;  4AFS C;  2VGM A;  1K73 R;  1UJY A;  4M75 C;  3OW2 A;  2O9V A;  4KUL A;  3PMT A;  4OMN A;  4HCC A;  1Y7X A;  3E2U A;  2PU9 B;  3EG9 A;  4LUE A;  4ZNX A;  2EQJ A;  2V8K A;  3A98 A;  1OYX A;  1RAD B;  3SWN B;  4LD6 A;  2PVO B;  3FJP A;  2A36 A;  4Y92 A;  4N4G A;  4IKF A;  3MJX A;  2KRN A;  4OMO A;  5L8R E;  3BDU A;  3S3O A;  2XI9 A;  1DJ7 B;  4M75 B;  1Q7Y R;  5M9O A;  1HSQ A;  1H3Z A;  2L8D A;  1TUD A;  2FHD A;  1T3S A;  2JW4 A;  1GL5 A;  4E7Z A;  1KC8 R;  3VYH B;  3OS2 A;  1VQK A;  3V7S A;  2GQI A;  1G5V A;  1RLP C;  3JV3 A;  4X34 A;  3CXC S;  1BK2 A;  3QO3 A;  1FXX A;  1VQL T;  4F16 A;  2QQ9 A;  4M78 G;  1T0H A;  1AHJ B;  2LCS A;  4E2F B;  5GAM h;  2ZPE B;  1XJW B;  2DYI A;  3OYG A;  2OTL A;  2EYW A;  1VQ4 Q;  3RDV A;  2JN0 A;  2JM9 A;  3LWH A;  4KH0 B;  4M7D G;  2YRV A;  4HCZ A;  1QVF S;  1K8A U;  2KNB B;  2DL8 A;  4IUU A;  3WXM B;  3REB B;  2CH4 W;  2XIC A;  1SSF A;  2C0T A;  2EGE A;  1MMA A;  2DFU A;  2WSC E;  5CKD A;  5CR2 A;  2E4H A;  4FYV B;  5GMK i;  2JXB A;  1KHC A;  1I81 A;  1QLY A;  2M9U A;  1SSH A;  2M16 A;  1B7T A;  1VQN Q;  3UA7 A;  4CRI A;  4XAX B;  5AT1 B;  1YJW A;  3V8L A;  4LXC A;  3FJ5 A;  3MKD A;  3GBQ A;  4HCK A;  3L1A A;  3C12 A;  1VQP A;  1YHQ T;  5FU7 C;  3C0C A;  3DB4 A;  2KR3 A;  2MAM A;  1B3Q A;  1D0Z A;  1NZ9 A;  1VQL Q;  1G3S A;  1YN8 A;  5KYW B;  4C92 G;  1S72 A;  3SFM A;  4PJO C;  3HSB A;  2KRS A;  3JCM g;  4D6W A;  2CP2 A;  5CQY A;  2K7A A;  4ANJ A;  5KCO A;  1WJQ A;  4EMK C;  2BTT A;  3CCQ A;  1VQ6 T;  3OYL A;  3JB9 J;  3SWN A;  1U1T A;  3CCJ A;  3CCM Q;  5KH6 A;  5CCA A;  3E9G A;  4M75 D;  4A4E A;  5ECA A;  1OEB A;  1VYU A;  3HRT A;  4OVA A;  1M30 A;  2F69 A;  2QQB A;  1U8R A;  2R5M A;  2ZZD A;  4X9C A;  3OQ5 A;  1S1N A;  1M3A A;  4OGE A;  1IXD A;  1NJI C;  1Q81 R;  3CC7 T;  2O31 A;  4M77 C;  4C0G A;  1OZ3 A;  1JJ2 P;  3JCM h;  4PLI A;  1X01 A;  1E6G A;  5FWB A;  1YJN Q;  2DXU A;  3C94 A;  3OYE A;  4ATO A;  2RQU A;  5GAN j;  3ZBD A;  3QDF A;  2YRC A;  2IVW A;  1VQK Q;  1SEM A;  3NMZ C;  2HSE B;  3CCV Q;  2F5T X;  4J83 A;  4LN2 A;  4PJJ A;  2NLU A;  4M78 F;  3CCM A;  4LUD A;  1WXU A;  2XDB A;  2CUB A;  2FZC B;  2DRK A;  1LCK A;  4PJO G;  2PTK A;  3CMA T;  1M1G A;  3H9N A;  2ECZ A;  5D6W A;  4M7A F;  4BD3 A;  2WSE E;  5GAM j;  1YJ9 T;  2NUT B;  2RHZ A;  5CVI A;  1KHI A;  4FW1 A;  2LVM A;  2ZPG B;  3OW2 P;  3M4Y A;  5CO7 A;  2DTH A;  5GAN 3;  1PWT A;  5J39 A;  2VC8 A;  2GTO A;  2KRO A;  4LD9 K;  3KXT A;  3EH1 A;  4NOY A;  2E5Q A;  3MEA A;  2KAF A;  2RB6 A;  4QT7 A;  2M0O A;  1MNE A;  1ABQ A;  3SWN C;  2LQ8 A;  1X6B A;  2VWF A;  2FZK B;  2XKO C;  1WHJ A;  2DM1 A;  2Y4X A;  2KEA A;  3RMQ A;  5IAY A;  2AKK A;  3VV0 A;  2J05 A;  2PNI A;  3OYH A;  2QEX A;  2EQU A;  2KQW A;  2MWP A;  4J9C A;  3JCM c;  2H3E B;  5J26 A;  3TSZ A;  2CH4 A;  4PFP A;  1JRI A;  4AMC A;  5KYU B;  4M7D C;  2GF7 A;  2P4R A;  2RQV A;  2DMO A;  1HXD A;  2EGA A;  4JUV A;  3AHU A;  4Z88 A;  1QMC A;  1RI0 A;  1YI2 T;  1K76 A;  2CGH A;  1VQO Q;  4OF1 A;  1F1B B;  3TQ7 P;  1N9R A;  4OGC A;  5LJ5 e;  4A4F A;  1JB0 E;  4M78 C;  2M51 A;  4Q5W A;  1VQM A;  4DEX A;  5FW9 A;  4Y91 A;  1XNI A;  2E3H A;  4XU0 A;  4MZM A;  1X43 A;  1G2B A;  2DRM A;  3M53 A;  2KXC A;  1ZSZ C;  1FWZ A;  5GMK h;  1KIK A;  1X6G A;  3M9Q A;  1ZBX A;  1B07 A;  1VQN A;  3L2V A;  2FRY A;  1RAA B;  2JMA A;  3L42 A;  3RMS A;  1ZX6 A;  5IHK A;  4OMF B;  4LDX A;  2YWW A;  2ESW A;  4OML A;  2L3S A;  2EJG A;  2F2V A;  4AFU C;  2CZ0 B;  1IB8 A;  1LVK A;  4OB2 B;  4HT8 A;  2EIF A;  4MZP A;  4K11 A;  3HTR A;  1ZLM A;  3RNJ A;  4BI3 A;  2XG8 D;  5DM7 R;  1LNX A;  1SPK A;  4EMK B;  4PFZ A;  1KD1 R;  4B9W A;  1KQ2 A;  2KT1 A;  2SRC A;  3EGU A;  1UGS B;  2GBQ A;  2WAC A;  2ED1 A;  1OOT A;  4M75 E;  1VOM A;  1UEC A;  3H0H A;  3CCV T;  3CCQ T;  1OQK A;  1QP3 A;  3I56 Q;  4N0A C;  2QDY B;  3ZL7 C;  1WIE A;  3JB9 F;  3QG1 A;  2FB7 A;  4A4G A;  3NGP A;  1Q81 U;  1WHL A;  4RCC A;  3UAT A;  5A0G A;  1Y71 A;  3C4S A;  4C92 C;  2RD1 A;  3GIB A;  1UFF A;  2GGR A;  4M7D B;  3CCE T;  1UG1 A;  1TWB A;  3P8D A;  1W2B S;  1RL2 A;  1JQQ A;  2PVD B;  1VYT A;  4WF2 A;  1Q82 C;  2RHI A;  2E5K A;  4V2S A;  1W70 A;  3CCR A;  3QXE B;  3CC4 T;  4OB0 B;  2EYX A;  4OP0 A;  1M1K U;  5D6Y A;  3EHR A;  4EMH A;  2QA4 A;  3JRZ A;  2FRW A;  1QCN A;  2DVE A;  2V8J A;  4F7U B;  4FL6 A;  4JRQ A;  1VQ4 T;  2D0Q B;  3UF4 A;  1ZBJ A;  2GQV A;  3M0T A;  2A08 A;  2DL5 A;  1M1F A;  2X35 A;  2F5K A;  1RAB B;  3OS5 A;  1HK9 A;  4F7U G;  2RI5 A;  4F7U E;  3QII A;  1LPL A;  4D8K A;  1Y57 A;  1ZSG A;  1W1F A;  1NYG A;  2EAY A;  3NTI A;  4J9H A;  3CD6 Q;  2C0I A;  3E19 A;  4IUV A;  3AT1 B;  1RI9 A;  1XOV A;  3KBG A;  4KH1 B;  2Y4Y A;  3PMI A;  2F1L A;  4RTW A;  2W10 A;  3LH0 A;  3JB9 G;  2DZC A;  1MV0 B;  3I5R A;  3A8H B;  1SHG A;  4M7D E;  3PVQ A;  4J9F A;  1GXI E;  3CCL T;  4J6W A;  5FU6 B;  4A54 A;  4A53 A;  4E7S A;  2P4T A;  1KD1 U;  3M59 A;  3M57 A;  1AWO A;  4C5I A;  3OS0 A;  4EMK A;  5A0D A;  2HNI A;  3VS2 A;  2K9G A;  1UHF A;  1P92 A;  1TXQ A;  2MF2 A;  4QKU A;  3G6E T;  3CC7 Q;  1FMK A;  4J9G A;  2BUD A;  3JCM J;  4PLL A;  1R77 A;  2O4X B;  1KG1 A;  1WFW A;  3JCM d;  4BB7 A;  4F17 A;  5HCK A;  1PHT A;  1HJD A;  3CPW S;  3TCJ A;  3QZ5 B;  1NYF A;  1TUC A;  3CBP A;  4C92 D;  4PJO E;  1VQ9 Q;  1NPR A;  2ZCF B;  1OPK A;  2LTO A;  2CSQ A;  3URG A;  2PZ1 A;  1K9M U;  2NWM A;  1RAE B;  2AZV A;  1U3O A;  1JO8 A;  2PQW A;  1K73 U;  2ENM A;  3VS3 A;  2LQN A;  5FRM A;  8ATC B;  1WA7 A;  2MPX C;  1BCO A;  1Y96 A;  2CZ7 B;  2E12 A;  1H92 A;  1ZUU A;  2EWN A;  3CCR T;  1N8R R;  2NUP A;  5CAI A;  1QVF A;  3JCM V;  1AOJ A;  2DD4 A;  1WXB A;  1K0X A;  2CKK A;  4IUP A;  2LZ6 B;  5GAN d;  1TG0 A;  3RUX A;  2LT1 A;  2QQR A;  3EH2 A;  2LQK A;  2NUZ A;  5GJW B;  3EFS A;  4J9D A;  8AT1 B;  2D9T A;  1D1C A;  4GLK A;  3EG0 A;  2QTX A;  2CP5 A;  3CXC A;  3MEV A;  4PJO A;  2LNV A;  4C8Q F;  1YJW T;  3G7Z A;  3CC2 A;  4E7H A;  1BU1 A;  2KRM A;  2DIG A;  4Z8A A;  2PVG B;  4X1V A;  3KUF A;  5GAM d;  3JCM e;  1WZO A;  1BCM A;  2KK4 A;  1ZHI A;  4C92 E;  4JS5 A;  2YUO A;  1X2Q A;  3A8M B;  1G83 A;  1N6A A;  1UJ0 A;  5GMK e;  2D8J A;  3UWN A;  2RJD A;  2JTE A;  4C92 F;  2DLP A;  4R0K A;  5KCH A;  3CC4 A;  2MCN A;  1PNJ A;  4DBH A;  2V1R A;  4RG2 A;  3OYF A;  2W0Z A;  4C92 B;  2DXC A;  1MUZ A;  2YLC A;  5LJ3 g;  4E7K A;  2HQX A;  4ZGE B;  1K9A A;  2EFI A;  3OW2 S;  3MP1 A;  2VXF A;  2YXY A;  1ABO A;  1OU9 A;  3CC2 T;  3JB9 H;  2HL5 C;  2JJ9 A;  1UGR B;  1OX8 A;  2K2M A;  2RK2 A;  1YCS B;  1RAH B;  2LCL A;  3GNG A;  1YIT A;  5CIU A;  2OAW A;  4BY6 C;  2P0K A;  5C6S A;  2B86 A;  3CC7 A;  3REA B;  5I2M A;  4RTU A;  1WQW A;  2RHX A;  4ZN1 A;  4PJL A;  5GJV B;  1NJI R;  6AT1 B;  3OYY A;  3MHX A;  5LJ5 h;  1BI2 A;  2DBM A;  2OTJ Q;  4L5G A;  1HYO A;  1K73 C;  5I22 A;  1WNL A;  4KT0 E;  1Q7Y C;  1VQP Q;  1QVG A;  2AK5 A;  1AWX A;  1QVP A;  1U1S A;  3CD6 T;  2E70 A;  3N5B B;  1UGV A;  4F7U F;  1KQS A;  1RUW A;  4D8D A;  3L2W A;  3QSU A;  1QWE A;  3A5Z B;  1ACM B;  4KGX B;  1S72 Q;  1VQ5 T;  2B8A A;  4JJD A;  4N4I A;  3HP9 A;  3FB9 A;  5I21 A;  3RIR A;  3E1S A;  4XTZ A;  4IIO A;  2I2L A;  5LJ5 j;  2G3R A;  3MPU B;  1T3L A;  1TTH B;  3EFO B;  4RUG A;  4M78 A;  2EYQ A;  3EGX B;  4BE2 A;  3EFR A;  1LJO A;  2DKG A;  1YJN A;  2COW A;  3QYH B;  2RA2 A;  2DJQ A;  4HVV A;  4J5Y A;  5LJ3 d;  3QWY A;  2XU8 A;  1OUL A;  3LX7 A;  3OYB A;  3A8O B;  5C0M A;  1YWO A;  4AG1 C;  3V7C A;  2LQW A;  3CCL Q;  4OMP A;  3BFM A;  2HSP A;  1M5Q 1;  3M0P A;  2HCK A;  2JUF A;  1UE9 A;  1WHM A;  3OYA A;  3VS1 A;  1M90 C;  2SEM A;  2JS0 A;  1MGQ A;  3M54 A;  3RKY A;  1I07 A;  2YUQ A;  3CMA A;  1YHQ A;  1Y07 A;  3OYM A;  4A4K A;  3GOX A;  2RPN A;  3A8G B;  3S3N A;  4HCB A;  4HXJ A;  1GFC A;  2OTL T;  1M2O A;  3BY7 A;  5LJ3 h;  4ZN3 A;  3UT1 A;  1OI1 A;  2XDD A;  3M0U A;  1B34 A;  3X25 B;  5HY6 A;  1TSF A;  1R0C B;  1NEG A;  4LDU A;  4RMO A;  3MP6 A;  3RBB B;  4FSX A;  5IN1 A;  4RTT A;  5KE3 A;  3QWX X;  1K4U S;  4NL3 A;  1VQ8 Q;  2MOX A;  1UGP B;  1YP5 A;  2KXD A;  4ZTF A;  2JM8 A;  4PJN A;  4C5E A;  4E47 A;  1I5L A;  1VQ9 A;  1VYV A;  1K8A R;  4XTU A;  2A28 A;  4HA8 A;  3P8H A;  3CQT A;  1GCQ A;  4JRP A;  3RKX A;  2LX7 A;  3OS1 A;  1KQS S;  1VQ6 A;  2DEU A;  3OYK A;  3EHQ A;  2KSS A;  3L2U A;  1U5S A;  2YDL A;  4N0A A;  3CCJ T;  1WHH A;  1WLP B;  2YRD A;  3CME A;  2C06 A;  3J80 E;  1KSW A;  2LCC A;  4C92 A;  2MMP A;  1IZ6 A;  4B6M A;  5KYU A;  3H0I A;  1LOJ A;  2DPP B;  1JXM A;  1X27 A;  3PT9 A;  3A8L B;  1VQO A;  3QJ6 A;  1Q86 R;  2LJ3 A;  4E7L A;  1JJ2 S;  2BIV A;  1TUG B;  3JB9 D;  2BZ8 A;  3DLM A;  5KYY A;  4JJN K;  1ARK A;  1PG5 B;  2CP3 A;  1ZA2 B;  2COY A;  5FLX E;  3G1J A;  1BI1 A;  2H8H A;  1NE8 A;  4A4H A;  2EGC A;  5GMK m;  1QCF A;  2LNH B;  4J6Y A;  2DTI A;  4C8Q B;  1GRI A;  2FPD A;  2E3I A;  1NLP C;  3MP8 A;  4JJB A;  1YIT T;  2QQA A;  5GAN g;  1AZE A;  2CS7 A;  1VQ8 T;  3P8B B;  1YHQ Q;  2ZGW A;  2ZPB B;  4OMQ A;  2CZ1 B;  4QQD A;  4FYX B;  3M0S A;  2JT4 A;  3PTA A;  2D1X A;  2QQS A;  2VGN A;  4M7A B;  1BIA A;  4GY5 A;  3H6Z A;  2A3L A;  1VQO T;  2J7I A;  2CT4 A;  3D7S B;  3SDZ A;  2X9H A;  3NPF A;  1K1Z A;  5CKB A;  1QP2 A;  1VQ4 A;  2F2X A;  4VUB A;  4BE1 A;  1JBM A;  3EFO A;  2FVU A;  4HVU A;  1N27 A;  1YBY A;  5I2S A;  1KK7 A;  3CCM T;  1ZUY A;  2K5F A;  3G4S T;  1G3W A;  2DET A;  1IGU A;  2QYZ A;  1QCO A;  2DA9 A;  5IHN A;  4XU2 A;  2COZ A;  5KYN A;  2EBP A;  1WDX A;  3HL8 A;  4QQ6 A;  1VQM Q;  1X75 C;  3X28 B;  1D3B A;  3M0R A;  2QI2 A;  3OMC A;  3X26 B;  1IHV A;  4XQ3 A;  1V1C A;  1EFN A;  2HAX A;  3R6N A;  4HT9 A;  3FLG A;  3RES A;  2LDM A;  4ORZ A;  1YJW Q;  2OTJ A;  1M90 U;  1Q86 C;  2OTL Q;  2EQM A;  3FDR A;  1Z9Z A;  2CZ6 B;  2WSF E;  2YHT A;  4LE9 A;  2DNU A;  2KBT A;  3E9F A;  5GAO q;  2RQW A;  1BYM A;  3G4S A;  4AT1 B;  1WHG A;  1TS9 A;  5EC7 A;  4M75 A;  2P84 A;  5GAM e;  5GAM g;  4ZGD B;  1M8M A;  2RJE A;  4UC4 A;  2OAU A;  2O88 A;  4FYW B;  2EYY A;  2D0N A;  3CPW A;  3HRU A;  4RTZ A;  5IXB A;  4DA4 A;  4KUD K;  2GTJ A;  3JAM E;  3H0F A;  1ZSZ B;  2CUD A;  1D1B A;  4L6V 5;  4BI4 A;  3ZFJ A;  3U23 A;  1D0X A;  4GBQ A;  2QK0 A;  2YT6 A;  1Q81 C;  1YWP A;  5KYX A;  3DKM A;  2J06 A;  1YI2 A;  2RMO A;  2QG9 B;  3CD6 A;  5FU7 B;  3J81 E;  3NHN A;  1EX4 A;  4BI8 B;  5I11 A;  3VS5 A;  3M4G A;  2EKH A;  3MEU A;  4ELY C;  1Y96 B;  2DD5 A;  4F04 B;  1BBZ A;  3HHT B;  2H3J A;  2NYS A;  3QPH A;  3VRY A;  2DJZ A;  1X6O A;  2MWO A;  4QW2 A;  3FC3 A;  1UTI A;  1G3Y A;  3CCE A;  4PJO D;  5KYY B;  3UPU A;  3LLR A;  4EDU A;  4OMM A;  3MO8 A;  4YTL A;  4R56 A;  3QYG B;  2RN8 A;  4EMG A;  1KC8 U;  2A37 A;  2VAS A;  2R5A A;  3EGD B;  4M7D F;  4MMK A;  1YIT Q;  1VQ7 Q;  1I0C A;  5A0L A;  4M77 D;  1VIE A;  2P0Q A;  5GAO m;  4E6R A;  2C0O A;  1FYN A;  1UHC A;  2KVQ G;  2O01 E;  2M1H A;  2K2V A;  1SF9 A;  3M5A A;  1VQK T;  1IRX A;  5CK9 A;  1YNZ A;  4J7I A;  2JS2 A;  3G71 A;  3JCM W;  4CC2 A;  2CP7 A;  3NTH A;  2V1Q A;  2KGT A;  2MYS A;  4BAC A;  4O5V A;  3PFS A;  2RO0 A;  2YUN A;  4NS5 A;  3INZ A;  2FYK A;  1N8R U;  1IHW A;  2XK0 A;  2NUT A;  2HD0 A;  2FZG B;  2VXE A;  2DAQ A;  2JOY A;  4PK4 A;  3G6E Q;  4BE0 A;  3HRS A;  1KQ1 A;  1V76 A;  5CKF A;  1WHK A;  1K9M C;  4XTY A;  3OA6 A;  2HMA A;  4DBF A;  2RJC A;  1W2B A;  4KBM B;  1M3C A;  4J7F A;  4ZGJ B;  3HFN A;  1NEB A;  4B9X A;  4ESR A;  5LJ3 f;  3WVD B;  5FWC A;  1JEG A;  4II1 A;  5CKE A;  1BB9 A;  4WCI A;  3VYG A;  3HKS A;  1AVZ C;  4DEY A;  4FSS A;  1UB4 A;  3CPF A;  4HVW A;  4BDY A;  3ER0 A;  2QAZ A;  3FIF A;  3VUB A;  1IGQ A;  2BE7 D;  3CCL A;  2KE9 A;  3CCE Q;  5D7U A;  5AYF A;  2K5L A;  4M77 A;  4HKE A;  2Z0W A;  1J3T A;  2L0A A;  5KYX B;  1BI3 A;  1R0B G;  4C0F A;  3I55 T;  1QVG P;  1MHN A;  5LL6 S;  3G6E A;  1M90 R;  1WQ7 A;  4P5N A;  3QJY A;  2CYZ B;  4PFO A;  5GAO n;  3ULR B;  1PD1 A;  4XK8 E;  1YFN A;  4E7J A;  3CC4 Q;  1PRL C;  1YCY A;  2OTJ T;  1AEY A;  2AKL A;  3L2Q A;  1YI2 Q;  2JNG A;  5HK3 A;  3VJP A;  2R58 A;  3H8Z A;  3VS6 A;  1M27 C;  5J3B A;  3O5Z A;  3LWI A;  4AFZ C;  3OYC A;  2D8H A;  2L3P A;  4FM4 B;  1VQ7 A;  1PKS A;  1WJR A;  1VA7 A;  3G71 T;  4Y28 E;  1MV3 A;  2K3B A;  1C1A A;  4F14 A;  4PJO F;  3GF5 A;  4XTW A;  1VQL A;  4MDX A;  4QVZ A;  2QAS A;  2CT3 A;  2ZAE A;  1M1K C;  3OY9 A;  1IRE B;  2ZPH B;  1U06 A;  4AG2 C;  1RAC B;  3OMG A;  2D6F A;  4JZ3 A;  2DVJ A;  2OI3 A;  2DXB A;  1VQ6 Q;  2DIQ A;  1CKA A;  4F7U A;  1TU0 B;  5GMK l;  3JCM X;  3S3M A;  3Q1J A;  2HBW A;  4C0Z A;  4Z89 A;  1R8O B;  1I4K 1;  3OSS C;  2RM4 A;  9ATC B;  3JB9 I;  3QKJ A;  2DTO A;  1RAG B;  1M4Z A;  1QWF A;  3CCJ Q;  1KFZ A;  3CCS Q;  4RTX A;  3LGL A;  1C6V X;  1RAF B;  3H41 A;  2RH2 A;  1N5Z A;  1GFD A;  1M2V B;  1PSF A;  2M02 A;  4IUQ A;  2QTV A;  7AT1 B;  3F70 A;  1JXO A;  1UUE A;  3OB9 A;  2HBP A;  2RF0 A;  2P0P A;  3CCR Q;  3QZ9 B;  1YJ9 A;  3G4S Q;  4MDW A;  4M7D A;  3GNF B;  5CKH A;  2IIM A;  4M75 G;  1D1A A;  2DEQ A;  3RR6 A;  1K0S A;  1CSK A;  3GLX A;  1N9S A;  2YSQ A;  2EPD A;  2HQH A;  1ZA1 B;  1I8F A;  2IPO B;  4M7A C;  4XU1 A;  1YIJ T;  4J6X A; 
#chains in the Genus database with same CATH homology
 1RL2 A;  4IUT A;  4ME7 A;  4QVC A;  1G3T A;  2LCC A;  2DZ9 A;  3I55 A;  4C92 A;  2MMP A;  1IZ6 A;  4PL6 A;  2PVD B;  2ZPI B;  4WF2 A;  1Q82 C;  2RHI A;  4V2S A;  1LOJ A;  2DPP B;  3CCR A;  4JRK A;  2AHJ B;  2K57 A;  3QXE B;  4XTX A;  3T9N A;  3PT9 A;  3A8L B;  1VQO A;  4FT2 A;  4M78 B;  2A7Y A;  3QJ6 A;  4JLG A;  4C8Q C;  3I56 A;  3CC4 T;  4OB0 B;  4E7L A;  1JJ2 S;  3CCU A;  4OP0 A;  1M1K U;  2BIV A;  2JTF A;  5D6Y A;  4FIB A;  3CCV A;  4JS4 A;  3JB9 D;  2V8I A;  4JDS A;  3V8J A;  2R57 A;  3DLM A;  4EMH A;  2QA4 A;  3JRZ A;  4LDY A;  4JJN K;  2DVE A;  4M77 B;  2V8J A;  4F7U B;  4FL6 A;  4MML A;  5FLX E;  4JRQ A;  1BI0 A;  4C8Q A;  1TH7 A;  2E41 A;  1W4S A;  3JSC A;  4E7I A;  1BI1 A;  3OYN A;  2D0Q B;  5CQX A;  1NE8 A;  4A4H A;  4BDZ A;  2GQV A;  5GMK m;  2XID A;  2DTI A;  2VYT A;  4J6Y A;  2PUO B;  4MZT A;  4N4H A;  4C8Q B;  1BIB A;  3PGG A;  1M1F A;  2X35 A;  3OYD A;  2F5K A;  3MP8 A;  3TEE A;  3OS5 A;  2BKD N;  1HK9 A;  4F7U G;  2QQA A;  1YIT T;  2RI5 A;  1QW1 A;  3RER A;  5GAN g;  4F7U E;  2CS7 A;  1VQ8 T;  1M8V A;  3FRN A;  3QII A;  2E10 A;  3P8B B;  2VGM A;  4HT8 A;  2ZGW A;  2ZPB B;  4M75 C;  3OW2 A;  2CZ1 B;  4KUL A;  3PMT A;  4QQD A;  5LJ3 e;  2EAY A;  4HCC A;  1Y7X A;  3NTI A;  2PU9 B;  2EQJ A;  1Q86 U;  3PTA A;  3E19 A;  4IUV A;  2QQS A;  2VGN A;  4M7A B;  1XOV A;  2V8K A;  3KBG A;  2Y4Y A;  1BIA A;  1OYX A;  3PMI A;  4GY5 A;  4LD6 A;  2PVO B;  3H6Z A;  3MET A;  3FJP A;  2A3L A;  3SWN B;  3X24 B;  4N4G A;  1VQO T;  1QVG S;  4IKF A;  3LH0 A;  2RI3 A;  3DLL A;  5L8R E;  3BDU A;  3S3O A;  2XI9 A;  3JB9 G;  1V29 B;  1DJ7 B;  3SDZ A;  4M75 B;  3L2R A;  5M9O A;  4RKU E;  2DZC A;  1H3Z A;  5CKB A;  2L8D A;  1QP2 A;  2FHD A;  3DB3 A;  1VQ4 A;  4VUB A;  3A8H B;  5GAO p;  4BE1 A;  4M7D E;  2KY9 A;  1JBM A;  5HK0 A;  3VYH B;  2FVU A;  3OS2 A;  3S6W A;  1GXI E;  1VQK A;  3V7S A;  1G5V A;  1N27 A;  1VIF A;  1YBY A;  5I2S A;  2DXT A;  4PKC C;  2QEX T;  3CCL T;  4C8Q G;  3CCM T;  4M7A A;  4X34 A;  4J6W A;  3CXC S;  2K5F A;  3QO3 A;  5FRN A;  1FXX A;  5FU6 B;  1VQL T;  3G4S T;  1G3W A;  4A54 A;  1O9S A;  4QVD A;  4A53 A;  2QQ9 A;  1UGQ B;  4M78 G;  3CCS A;  2P4T A;  1AHJ B;  4XTV A;  3ZEH A;  1Q7Y U;  1KD1 U;  3M59 A;  4XU2 A;  3M57 A;  5GAM h;  4C5I A;  3OS0 A;  2ZPE B;  3RKW A;  4EMK A;  5A0D A;  2HNI A;  3OYG A;  2OTL A;  2X4W A;  3HL8 A;  4OB3 B;  3OSV A;  1P92 A;  4QQG A;  2JN0 A;  4QQ6 A;  4M7A G;  2MF2 A;  2O4X A;  4M77 E;  3LWH A;  1X75 C;  3X28 B;  3G6E T;  1WGS A;  4TVR A;  3WVE B;  1D3B A;  4DQ2 A;  2BUD A;  2QI2 A;  2DK3 A;  3OMC A;  2PUK B;  3X26 B;  3JCM J;  4M7D G;  4PLL A;  2YRV A;  4HCZ A;  2O4X B;  3NTK A;  4XQ3 A;  1K8A U;  1QVF S;  1KG1 A;  3JCM d;  3LGF A;  3VUZ A;  4BB7 A;  2HAX A;  4IUU A;  4HT9 A;  3FLG A;  3RES A;  2LDM A;  3WXM B;  2OTJ A;  2XIC A;  1M90 U;  1SSF A;  1Q86 C;  3CPW S;  2WSC E;  2K3X A;  3TCJ A;  5CKD A;  3PIP A;  3QZ5 B;  5CR2 A;  2EQM A;  3FDR A;  3CBP A;  4C92 D;  1VQ9 T;  4PJO E;  2CZ6 B;  2WSF E;  1NPR A;  2YHT A;  2ZCF B;  2LTO A;  3E9F A;  5GMK i;  1KHC A;  5GAO q;  3URG A;  1VQM T;  1I81 A;  1M9S A;  2M9U A;  1BYM A;  3G4S A;  1K9M U;  3OBY A;  2M16 A;  4M75 A;  4C0D B;  3QUI A;  1NPP A;  2PQW A;  4CRI A;  5GAM e;  5GAM g;  4ZGD B;  3TU4 K;  2KDS A;  1K73 U;  4XAX B;  4J8O A;  5GAN 5;  3ME9 A;  2RJE A;  1YJW A;  4UC4 A;  1XTD A;  3V8L A;  5FRM A;  2OAU A;  1VQ5 A;  2EJ9 A;  1Y96 A;  4OB1 B;  1VUB A;  1WPY A;  3CPW A;  2CZ7 B;  2E12 A;  3HRU A;  3L1A A;  4RG8 A;  3C12 A;  3VKI A;  1VQP A;  1VQ8 A;  1YHQ T;  4DA4 A;  4KUD K;  5FU7 C;  3JAM E;  2EWN A;  5GAM f;  2K5I A;  3CCR T;  3MCA B;  4L6V 5;  3DB4 A;  2JVV A;  3ZFJ A;  4Z02 A;  4BI4 A;  5CAI A;  1QVF A;  2MAM A;  2XHC A;  3JCM V;  4LDX A;  3I56 T;  2DD4 A;  1NZ9 A;  2E64 A;  1G3S A;  1Q81 C;  2CKK A;  4IUP A;  5GAN d;  2E6N A;  3DKM A;  4C92 G;  1ZQ1 A;  3RUX A;  1YI2 A;  1S72 A;  3CD6 A;  2LT1 A;  2QQR A;  3SFM A;  5FU7 B;  4M77 G;  3J81 E;  3PNW C;  3HSB A;  2LQK A;  4PJO C;  3JCM g;  4BI8 B;  3CEY A;  3M4G A;  3MEU A;  4D6W A;  5CQY A;  4XU3 A;  5D6X A;  4ELY C;  2RI2 A;  3EFS A;  1Y96 B;  2D9T A;  3BDL A;  5KCO A;  3BW1 A;  1WJQ A;  2DD5 A;  4GLK A;  3HHT B;  2QTX A;  2H3J A;  1KC8 C;  2GFA A;  4EMK C;  3QPH A;  3UDC A;  3MEV A;  3CXC A;  3JCM Q;  2DJZ A;  4PJO A;  4LDV A;  1X6O A;  2LNV A;  4C8Q F;  3CCQ A;  1VQ7 T;  3OYL A;  3JB9 J;  1VQ6 T;  1YJW T;  3SWN A;  2MWO A;  3G7Z A;  4QW2 A;  1U1T A;  3FC3 A;  3CC2 A;  4E7H A;  2DIG A;  3CCJ A;  2PVG B;  1G3Y A;  5KH6 A;  3KUF A;  3CCE A;  4PJO B;  4PJO D;  1N8R C;  5GAM d;  5CCA A;  3E9G A;  4M75 D;  1O75 A;  3JCM e;  4A4E A;  5GAN 2;  3UPU A;  3EAE A;  3CCS T;  3HRT A;  1VQP T;  4OVA A;  1NJI U;  2KK4 A;  1ZHI A;  2F69 A;  3LLR A;  4PNO A;  3CBO A;  4C92 E;  4EDU A;  3PIO A;  2QQB A;  4JS5 A;  2R5M A;  2ZZD A;  4X9C A;  1U8R A;  3MO8 A;  3OQ5 A;  2E6Z A;  4OGE A;  3A8M B;  1NJI C;  4YTL A;  1N6A A;  1Q82 U;  3LW5 E;  4R56 A;  3ASK A;  3QYG B;  5GMK e;  4EMG A;  5GAN h;  1KC8 U;  5KE2 A;  3UWN A;  3CC7 T;  2RJD A;  4C92 F;  4ZTJ A;  4M77 C;  2RHY A;  4C0G A;  2R5A A;  2MI6 A;  5KCH A;  4M7D F;  3CC4 A;  1OZ3 A;  1OZ2 A;  4MMK A;  4RG2 A;  4PLI A;  3JCM h;  3OYF A;  5A0L A;  1X01 A;  4C92 B;  2VV5 A;  2DXC A;  4M77 D;  1VIE A;  4M75 F;  1D3B B;  2P0Q A;  2DXU A;  2YLC A;  2LC4 A;  3C94 A;  3M55 A;  3MEW A;  5LJ3 g;  5GAO m;  3OYE A;  4E7K A;  4ATO A;  2HQX A;  5FRO A;  4C5G A;  5GAN j;  3ZBD A;  1UEB A;  2O01 E;  2KVQ G;  2M1H A;  4ZGE B;  2K2V A;  2EFI A;  3OW2 S;  3M56 A;  2VXF A;  3MP1 A;  2IVW A;  4BUG A;  2JTM A;  3M5A A;  1VQK T;  1EIF A;  3QBY A;  4DOV A;  2F5T X;  4J83 A;  5CK9 A;  4J7I A;  2QA4 T;  2NLU A;  5GAN 8;  4M78 F;  3CCM A;  3G71 A;  3JCM W;  3CC2 T;  3OYJ A;  3JB9 H;  3NTH A;  4IUR A;  2XDB A;  1UGR B;  2KMT A;  2ZPF B;  3CBM A;  2RK2 A;  1VQN T;  1PSE A;  4FU6 A;  4PJO G;  4BAC A;  3CMA T;  1M1G A;  5D6W A;  5DLQ E;  1BKB A;  4O5V A;  4M7A F;  3HFO A;  3PFS A;  2WSE E;  4BD3 A;  5GAM j;  1YJ9 T;  2LCL A;  2RO0 A;  4NS5 A;  2RHZ A;  4O6J A;  3GNG A;  5CVI A;  2K3Y A;  1KHI A;  3INZ A;  1YIT A;  5CIU A;  2FYK A;  2LVM A;  2ZPG B;  1N8R U;  4BY6 C;  3TRE A;  2P0K A;  5C6S A;  2XK0 A;  3CC7 A;  1JJ2 A;  3M4Y A;  2HD0 A;  5I2M A;  5CO7 A;  5LJ5 d;  3CME T;  3NFC A;  2DTH A;  5DY9 A;  1WQW A;  2VXE A;  5GAN 3;  1YIJ A;  2RHX A;  5J39 A;  2DAQ A;  2VC8 A;  2EJF A;  2JOY A;  4FT4 A;  5HKC A;  4ZN1 A;  4LD9 K;  5DLO A;  3OYY A;  4BE0 A;  3MHX A;  3HRS A;  1BI2 A;  1KQ1 A;  4NL2 A;  5LJ5 h;  3KXT A;  3C95 A;  5CKF A;  4L5G A;  4NOY A;  1H64 1;  1K73 C;  5EG2 A;  1K9M C;  2E5Q A;  1WNL A;  3MEA A;  2XDP A;  4KT0 E;  4XTY A;  5LJ3 j;  1Q7Y C;  3OA6 A;  1QVG A;  5FU6 C;  2KAF A;  2RB6 A;  2RJC A;  4KBM B;  4J7F A;  2M0O A;  4ZGJ B;  1W2B A;  3HFN A;  4B9X A;  1QVP A;  3OYB A;  2LX9 A;  2FL7 A;  1U1S A;  5LJ3 f;  2LQ8 A;  3SWN C;  3WVD B;  2E70 A;  3N5B B;  1WJS A;  4II1 A;  5CKE A;  3CD6 T;  3SD4 A;  3FEO A;  2XKO C;  4F7U F;  3VYG A;  1KQS A;  3HKS A;  4RCB A;  3OYI A;  3L2W A;  2Y4X A;  3J7A F;  1UB4 A;  3QSU A;  2L5Q A;  3RMQ A;  2DO3 A;  3CPF A;  4BDY A;  5IAY A;  3A5Z B;  2LT4 A;  3ER0 A;  3FIF A;  3VUB A;  3O8V A;  3VV0 A;  5GAO r;  3R6O A;  3OYH A;  2QEX A;  1VQ5 T;  2B8A A;  2EQU A;  2KQW A;  3CCL A;  5AYF A;  4N4I A;  2MWP A;  3JCM c;  2K5L A;  3HP9 A;  5LJ5 f;  3FB9 A;  2L3R A;  5I21 A;  2XD0 A;  5GMK j;  3RIR A;  5J26 A;  4M77 A;  4HKE A;  3E1S A;  1JRI A;  1BI3 A;  4C0F A;  3I55 T;  1MHN A;  5LL6 S;  4EPC A;  3G6E A;  1WQ7 A;  4XTZ A;  4M7D C;  2X4X A;  2I2L A;  4JRI A;  4P5N A;  2GF7 A;  5LJ5 j;  3QJY A;  2G3R A;  2CYZ B;  5GAO n;  3OBW A;  5GAO l;  4BY6 B;  1HXD A;  4JUV A;  4XK8 E;  4M78 A;  4E7J A;  2EYQ A;  3AHU A;  1YCY A;  2OTJ T;  1XQH A;  4BE2 A;  1RI0 A;  3L2Q A;  1YI2 T;  3EFR A;  2CGH A;  5GAN 6;  1LJO A;  2DKG A;  2JNG A;  4OF1 A;  3V7R A;  4C0D C;  5HK3 A;  3QYH B;  4R55 A;  1YJN A;  1N9R A;  2RA2 A;  4OGC A;  4DOW A;  3L2Z A;  1FX7 A;  3GPL A;  5LJ3 d;  4J5Y A;  3VJP A;  4A4F A;  2XU8 A;  1JB0 E;  2RHU A;  3LX7 A;  4CI0 C;  5LJ5 e;  5A2Q E;  2R58 A;  3A8O B;  4M78 C;  5C0M A;  3H8Z A;  5GAN e;  2Y90 A;  5J3B A;  4Q5W A;  2QXF A;  2VUB A;  1VQM A;  3VU3 C;  4Y91 A;  5GAN f;  1XNI A;  3V7C A;  3LWI A;  3OYC A;  3BFM A;  4XU0 A;  4FM4 B;  1KD1 C;  4MZM A;  1VQ7 A;  1WJR A;  3JCM P;  1M5Q 1;  3M53 A;  2JUF A;  3G71 T;  1FWZ A;  4Y28 E;  5GMK h;  3OYA A;  3SB2 A;  3M9Q A;  1ZBX A;  2E1H A;  4PJO F;  3GF5 A;  4XTW A;  1M90 C;  1VQN A;  1VQL A;  1MGQ A;  4MDX A;  3M54 A;  4QVZ A;  3RKY A;  3L2V A;  3L42 A;  3CMA A;  1YHQ A;  3RMS A;  4JLI A;  4C8Q D;  1M1K C;  1Y07 A;  3OYM A;  3OY9 A;  5GAN 7;  1IRE B;  2ZPH B;  4OMF B;  4A4K A;  3LYI A;  4X9D A;  3JCM b;  3A8G B;  3GOX A;  5IT9 E;  3S3N A;  2K4Y A;  4KUI A;  1K8A C;  3OMG A;  4HCB A;  2D6F A;  2X4Y A;  4M7A E;  2EJG A;  2OTL T;  2DXB A;  2CZ0 B;  3BY7 A;  4OB2 B;  2GCX A;  2DIQ A;  5LJ3 h;  5LJ5 g;  2EIF A;  2RK1 A;  1OI1 A;  3HPW A;  3M58 A;  4MZP A;  3UT1 A;  4F7U A;  4ZN3 A;  2XDD A;  1B34 A;  3X25 B;  4LDW A;  1YJN T;  2X4J A;  5HY6 A;  5GMK l;  3JCM X;  3Q1J A;  3S3M A;  4C0Z A;  1VQ4 T;  4LDU A;  1R8O B;  1I4K 1;  3OSS C;  4BI3 A;  2XG8 D;  3X20 B;  4RMO A;  5DM7 R;  3MP6 A;  1LNX A;  2RM4 A;  3JB9 I;  1S72 T;  2L89 A;  4EMK B;  4M7A D;  3QKJ A;  1B34 B;  2YLB A;  2EKO A;  4FSX A;  5IN1 A;  4B9W A;  3GP8 A;  1KQ2 A;  5KE3 A;  2DTO A;  1M4Z A;  4NL3 A;  1UGS B;  2WAC A;  1UGP B;  4C8Q E;  4ZTF A;  3QDR B;  3LGL A;  4C5E A;  3V8K A;  2HQE A;  4E47 A;  4M75 E;  1I5L A;  3CCU T;  3CCV T;  2RH2 A;  1PSF A;  4M78 D;  4IUQ A;  3CCQ T;  4L59 A;  1QP3 A;  3JCM f;  4ELZ C;  3QHS A;  2EQK A;  1VQ9 A;  3F70 A;  4C5H A;  3OB9 A;  4N0A C;  2HBP A;  2GFU A;  2QDY B;  2P0P A;  4XTU A;  3QZ9 B;  4HA8 A;  3P8H A;  3QG1 A;  4JRP A;  2FB7 A;  4A4G A;  1YJ9 A;  4MDW A;  3JB9 F;  1Q81 U;  2JZ2 A;  5GAN 4;  3RKX A;  2LRQ A;  3GNF B;  4RCC A;  4M7D A;  5CKH A;  4M75 G;  5A0G A;  3OS1 A;  1Y71 A;  3C4S A;  1KQS S;  2DEQ A;  1VQ6 A;  4C92 C;  3OYK A;  2KSS A;  3GLX A;  4M77 F;  1N9S A;  4M78 E;  2RD1 A;  3L2U A;  3GIB A;  2E65 A;  3CCJ T;  2IG0 A;  4N0A A;  4M7D B;  3CCE T;  1I8F A;  4M7D D;  4M7A C;  3P8D A;  1W2B S;  2RJF A;  3CME A;  2C06 A;  4XU1 A;  1YIJ T;  4J6X A;  3J80 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...