4BY6B

Yeast not1-not2-not5 complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
187
structure length
166
Chain Sequence
GLKALVPLLLGADLSSMLYSLGIDHRVLDTFQSPWAETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRVALFQDETLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQRDFLLFYNAIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords GENERAL NEGATIVE REGULATOR OF TRANSCRIPTION SUBUNIT 1
publication title Structure and RNA-Binding Properties of the not1-not2-not5 Module of the Yeast Ccr4-not Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 34
structure length 166
sequence length 187
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04153 NOT2_3_5 NOT2 / NOT3 / NOT5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1020 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4by6B00
4BY6C 5FU6C 5FU6B 4C0DC 4BY6B 4C0DB 4C0GA 5FU7C 4C0FA 5FU7B
chains in the Genus database with same CATH superfamily
3UATA 4LDUA 1CSKA 3OW2S 4C92G 5GAOn 5LJ3e 3SB2A 1BK2A 3CCLQ 1XOVA 3OYNA 5CR2A 3FDRA 3M9QA 2KXDA 1BB9A 2LMJA 3CBPA 2COYA 4M7AC 1C1AA 2DA9A 1GL5A 1AD5A 4F16A 1Q86C 4F7UG 3ZFJA 1EFNA 1I1JA 4MDWA 4EMKA 3EG0A 2X4JA 5IT9E 2CT3A 5GAMh 4FYWB 1I0CA 1RAGB 2JTMA 1R0BG 1ZUKA 4C8QD 2HZYA 1TS9A 2B86A 3LWIA 2BE7D 3OW2P 2GF7A 2F5TX 3PT9A 5KH6A 1SEMA 4OVAA 2ZPGB 3OS2A 1N9RA 3VS4A 1K73U 1PG5B 3EFOA 4AT1B 1NYFA 3VV0A 1N5ZA 1MMDA 5KYYA 3MEVA 3HL8A 3PMIA 2FPFA 4EMHA 3CC7Q 5CVIA 3CMAA 1YJWQ 5LJ5j 4OGCA 2NUTA 3WXMB 4C0FA 2KQWA 3FJPA 4F17A 3JCMJ 5GMKl 4C92C 3JV3A 5HKCA 1NEBA 2CYZB 3JCMb 1ZUYA 5KCHA 3JCMf 3UT1A 1TUCA 1N9SA 3CXCA 4LUEA 5C0MA 4JJCA 2XMFA 4KH1B 2EIFA 1QVGP 5GAN3 1N6AA 4C8QE 5KYNA 5I11A 3JAME 1IHVA 3PMTA 3JCMe 5KYXB 1Y57A 4AFSC 2QI2A 2YRCA 4BI8B 2XDDA 2JNGA 4M77F 4ORZA 1WZOA 1K8AU 1KD1C 1Y07A 4Z89A 1Q7YU 2PVOB 2E3HA 1JU5C 4CC3A 1VQ4T 4E7KA 3OYJA 2QA4A 3ZBDA 1VOMA 2LZ6B 3SDZA 1QCNA 4M75G 4J9DA 2RK1A 2L8DA 2GCXA 2ZPIB 2KSSA 1VQLT 4Z8AA 1AOJA 2MCNA 3CCQT 2JOYA 3TU4K 1AWWA 1IB8A 2H3JA 1Z9QA 3E2UA 4KGVB 2MYSA 5AYFA 2XK0A 3QG1A 2DO3A 2MWPA 2DKGA 1VYTA 2DBMA 3P8DA 2QQRA 1OU8A 5IXFA 1FYNA 1I81A 5GAN7 1T0HA 1M3BA 3I5RA 1VQKQ 1YITA 3NTIA 1WJRA 2P0KA 3QJ6A 4RTUA 2AKKA 2LDMA 3HPWA 4CC2A 1HJDA 1VQOT 5CKHA 2O88A 2QG9B 2RQVA 2KMTA 4J6YA 2KBTA 3CCEQ 2DPPB 1K73C 1YIJQ 4MDXA 4FYXB 1IREB 2ZAEA 5IN1A 2LX9A 2X9HA 3VS2A 3JCMc 4E2FB 3JCMV 3G6EA 2JZ2A 4M75C 5GANj 1M1KU 2KEAA 3X20B 3A1PA 5KYUB 2RO0A 1LVKA 2CH4W 1W1FA 2RM4A 5FRMA 2HBWA 2C06A 4JUVA 1UECA 1WJQA 4NL3A 1TUGB 3PTAA 2FZCB 2LCSA 1D3BA 1X27A 2KI7A 4M78G 4C0ZA 3FC3A 2KRSA 4A4GA 4EIKA 1PSEA 2LNVA 1GCQC 2NLUA 2ZPHB 5HK3A 4AMCA 2DL7A 2EW3A 2QDLA 2QEXA 2P0QA 3M0QA 4D6WA 1GXIE 4JPBW 1ZSZC 2L5QA 4QVDA 2K3BA 3S3OA 4IUVA 1GFDA 4X34A 4ELYC 1U1SA 2ENMA 4PL6A 2VGNA 4MZMA 1Q7YC 3PIOA 1WI7A 5GAMd 1B34B 3SWNA 5FU7C 1NJIU 1VYVA 1RLPC 1WXBA 4Y91A 2L2PA 2BKDN 3VUZA 3OBWA 3CCMA 1ABQA 3GLXA 1RLQC 2LJ1A 2WSFE 1SSFA 2O2OA 1SRMA 4Z88A 1G8XA 2RH2A 2DILA 1Y96B 3CCUT 2LTOA 2AZSA 2DD5A 1R8OB 2EJGA 2OTJA 2GQIA 1VQPQ 1VQ8T 5GAOm 4BI4A 4M7AA 4M77D 1YHQT 2LX7A 4M78C 1UHCA 4ZTFA 4ME7A 1TXQA 1Q81U 4E7SA 5GAN8 3I55Q 4M7DB 4OB1B 4DBRA 3OYGA 1LPLA 2MI6A 4PFPA 4A4KA 1VUBA 5DY9A 1VQ4A 1KQSS 4DBQA 2ABLA 2DD4A 2KY9A 1SF9A 1HYOA 3JB9D 4X9CA 2DIQA 2ESWA 2X4YA 4XTYA 3PGGA 1WPYA 4MZTA 1FMKA 1YBYA 2CP3A 3CC2A 3NFCA 3M58A 4FT4A 3RKYA 5LJ3g 5GAN6 1TUDA 3C94A 4EMGA 1JJ2A 5HY6A 1LNXA 3DB4A 3REAB 1X69A 3CPWA 1PD1A 3CCUQ 2RHXA 2X51A 1M1KC 1PC0A 4O6JA 3QJYA 4J5YA 4IUTA 2VXFA 4HCBA 2NYSA 4C92A 3G4SA 1H3ZA 2RHUA 1RABB 2KXCA 4M77E 2YSQA 3CCSA 1KQSP 1NPRA 2R5MA 2RHZA 5GJWB 2EAYA 2BE9B 2RB6A 3OYLA 3GNGA 2DBKA 3X28B 4IUQA 3H8ZA 4F7UA 2VWFA 1MHNA 2EQIA 5AT1B 2C0OA 5A0GA 1V29B 2YRDA 1YCSB 3QPHA 1LOJA 1VIFA 2ECZA 3EGXA 5FLXE 1RI9A 2DXUA 2YUOA 4QVCA 3OMCA 1NJIC 1XTDA 1S72Q 3URGA 1OQKA 2ED1A 2V8IA 2DYBA 2NUZA 3PFSA 3L2WA 1UGSB 5LJ3h 4LD6A 4OMLA 2XG8D 3D7SB 3RR6A 2VASA 1RAAB 1XNIA 3TQ7P 3V8JA 3BFMA 4JJDA 4C5IA 2EJ9A 3OYEA 2IVWA 1YI2A 1I07A 5IHIA 1HSQA 4JJNK 2CZ1B 4HT8A 1RAHB 2E6NA 1QMCA 3AHUA 2DL5A 2RQRA 1M2VA 2DNUA 2RI3A 1VQ9Q 3JCMg 2V8JA 2E10A 2OX7A 1Q81C 1M8MA 5CKEA 2D8JA 3NHNA 1HD3A 1K0SA 2EGEA 2RF0A 2KRMA 3H9NA 4A4HA 3M4GA 1HK9A 1ZX6A 2MK5A 4C5GA 4XU1A 4M7AF 1NLOC 1X6OA 2DLPA 2V1QA 5I21A 3OMGA 3UWNA 3PNWC 2HQHA 4DBHA 5IXBA 2COWA 1TG0A 1Y0MA 2PTKA 3OS1A 4PJMA 3SFMA 5GMKi 1UJYA 1WJSA 1WGSA 2OTLQ 1WLPB 5EC7A 2F69A 1I5LA 4MMLA 2EBPA 2FHDA 3P8BB 1J3TA 4AG2C 4XU2A 1H641 4M75A 2K7AA 2ROTA 4HA8A 2V8KA 3CC4T 2EPDA 1VQ6A 2HAXA 1IO6A 1JXOA 1D09B 3VS7A 1ABOA 1K9MR 4XK8E 3CCJT 1M27C 2RK2A 4ANJA 4KUIA 4BUGA 3TREA 2PVDB 5J3BA 3OYDA 2DIGA 4DA4A 1TSFA 2JMCA 3EFOB 1QVGA 3LYIA 2P84A 1GCQA 3META 5KYYB 1X2KA 4HCCA 1KIKA 2AHJB 2LJ3A 2X35A 4NOYA 3G71A 2ZGWA 4M7AG 3RERA 4C92F 4ZGEB 4BDZA 4FU6A 1SPKA 3MCAB 5GMKj 1VQ7A 1QP3A 2NUTB 3JCMh 4OP0A 1BI2A 4XU3A 1IXDA 1UEBA 3RIRA 4KRTA 2CSIA 4F7UF 2CS7A 3TEEA 3QSUA 2YWWA 1RACB 4BD3A 3QBYA 2DF6A 3HRUA 2MF2A 3CCRA 3VS6A 4CC4B 3OYAA 3M59A 1RL2A 3PE0A 5IH2A 2AIRB 2QAZA 3QHSA 2FEIA 4HVVA 2I0NA 1VYUA 1W2BS 2RI5A 3OYKA 1MMNA 3OYBA 2M51A 4LDXA 2DTHA 1WA7A 4Q5WA 3VKIA 3FRNA 4C0DB 2R57A 4PFOA 2GFUA 4PJOB 3CC7T 4M78A 2DERA 3A8MB 2EYQA 1YJWT 1M2OA 2FRYA 3RNJA 2C0IA 3L2VA 2K5LA 4N0AC 1U06A 4E7LA 2QTXA 1SG5A 1X43A 3I56A 1AHJB 2FL7A 2XDBA 1OOTA 4N4IA 3CD6A 3ME9A 3INZA 2L3SA 2RQUA 3SEMA 1WHHA 3OYMA 2CH4A 3WVEB 1BKBA 2LNHB 2M02A 3A5ZB 3CBMA 4IIOA 3BDUA 5I22A 1M30A 2RHIA 2EYZA 5LJ5f 1WX6A 4F14A 3EG3A 5FU6B 1VQNQ 1AWXA 1WHLA 1D0ZA 1GBQA 2OAUA 4ZTJA 4M7AD 1NE8A 2YRVA 3IQLA 4PNOA 4M75F 5ECAA 3E1SA 4OMOA 2YHTA 1GFCA 1M3CA 2QASA 2SRCA 5LJ5e 1IGUA 3J7AF 4LD9K 2W0ZA 3EGDA 3M54A 2A3LA 3JCMQ 3MHXA 2MWOA 4XQ3A 3L2UA 2KVQG 3G6EQ 1UGQB 3S3MA 4NS5A 2QQBA 2DAQA 4QW2A 2CP7A 3NTHA 1RUWA 2FB7A 4FSXA 4HVUA 1WHKA 1BBZA 2DRKA 2XU8A 3V7SA 1VQKT 5IHKA 1X6GA 4HCKA 3RUXA 2LQKA 3MEWA 2CREA 1OU9A 5D7UA 3BW1A 1QVFS 4C92D 2VB6A 2CGHA 1B07A 3VYHB 3EAEA 4A4FA 2QEXQ 4FCYA 4M7AE 4HXJA 3RKXA 2DZ9A 1OV3A 4E7ZA 3CCET 1YIJT 1E6GA 5GMKm 3CCLA 2E12A 3SWNB 5GAN5 5FRNA 3PVLA 3QZ9B 2LVMA 1WNLA 2QGFB 1X01A 3CEYA 4C8QB 2DEQA 2JW4A 2WSCE 2WSEE 3TSZA 3BDLA 2LCCA 4FW2A 3FLGA 4LDWA 3CCMQ 2CP2A 4PLIA 5L8RE 4E7HA 1N8RU 1G2BA 3HRTA 4M78F 2QQ9A 4C5EA 2M1HA 1YJNQ 2DJQA 1ZQ1A 1RAIB 3H41A 4ZNXA 5IHNA 1WXTA 1QVFP 3OYHA 4M7DC 2OTJQ 5C6SA 5CKFA 2KR3A 4A4EA 3Q1JA 3JB9I 4LE9A 1H3HA 3ASKA 1ZA1B 1G3SA 4C92E 1Q86R 2EYYA 3OBYA 1W6XA 1EIFA 5GANf 1KSWA 4LNPA 1UGRB 2X4XA 2DTOA 1BI1A 2FZGB 1KC8U 5DM7R 3CC7A 3LGLA 2PU9B 2EKHA 1PRMC 1YJWA 3MP1A 2VKNA 4VUBA 1UDLA 2GBQA 5GAMj 3V8KA 4LN2A 2FYKA 4F7UE 2E3IA 1YP5A 3L2RA 1AEYA 5GANe 3HFNA 3CC2Q 4CC7A 1P92A 4RCCA 1GBRA 2F2WA 3CXCS 4OB2B 2DK3A 2JVVA 2OJ2A 1VQPT 1G3YA 2ZZDA 3A8OB 2P0PA 4X9DA 3RESA 2JM8A 1EX4A 1TWBA 2HEQA 3MP8A 1I5OB 1Q82U 4RUGA 5IAYA 4UC4A 2HSPA 3G4SQ 1M90R 4CI0C 2FVUA 3I55T 2LP5A 2P4TA 6AT1B 2O9SA 1SHFA 3M57A 3THKA 4M75D 4WCIA 3QIIA 2RN8A 2X4WA 1K8AC 4F7UB 3GIBA 2K5IA 2RJEA 2XI9A 1TH7A 4JDSA 1UJ0A 4BI3A 4J9IA 2BZXA 1VQMQ 3CQTA 4M77C 4B6MA 1TOVA 2FZKB 2E41A 3CXCP 3OY9A 4BB7A 3GOXA 4R55A 5KE2A 4J9EA 4ESRA 1KD1R 2EQJA 3GNFB 4R56A 2BUDA 3EH2A 3JCMX 2MMPA 2O4XA 1PKSA 1NBEB 3J80E 1SSHA 1M5Q1 2J05A 4J7FA 4IIMA 3EG2A 1VQKA 2M9UA 1N8RC 1M3AA 4OMPA 4KGXB 2FPEA 1B7TA 2F2XA 3E19A 4L6V5 1WHJA 2JS0A 1X75C 4FIBA 4M75E 1YI2Q 4A63B 2BTTA 3CCVT 3L1AA 4JLIA 2AKLA 4D8DA 1VQLA 2HQEA 1OZ3A 2VUBA 4X1VA 1U1TA 3CCQA 1PD0A 2RJCA 1I8FA 4JJBA 2A36A 2DEUA 2DETA 4PLLA 3EG9B 1D1BA 1KC8C 2YLBA 3FB9A 1YWOA 1GCPA 3EGUA 2ROLA 1S72T 3QWYA 1KQ1A 1YJ9Q 2EQMA 2J7IA 2GTJA 4M78D 5GJVB 2CUDA 5KYUA 3X26B 2D6FA 4GY5A 3OSSC 3SHWA 3VUBA 2LQWA 3ER0A 4OMQA 2OI3A 3BE3A 1K73R 3V8LA 1RAEB 3DLLA 4ZGDB 3OB9A 4J83A 3ZL7C 3OS0A 4C0GA 2DL3A 1VQOA 1VQ6Q 3CCVQ 2H3EB 2AZVA 1Q82C 2DZCA 2YT6A 1VQ9T 1FX7A 2F5KA 4Y92A 4KGZB 3JCMP 4PJLA 4HCZA 2JUFA 3CMET 1G3WA 2NWMA 4HT9A 2XIDA 3VS3A 3M0RA 2A0FB 1MGQA 2IPOB 4KBMB 3JCMW 1VQ5Q 4LUDA 1K1ZA 2D0QB 2P4RA 3VJPA 3LWHA 3O8VA 4FT2A 4M4ZA 1AWOA 3G71Q 3T9NA 5CKDA 4M77B 2R5AA 1B34A 3FEOA 4LDVA 2NUPB 3VYGA 2HNIA 3KBGA 1KHIA 2JXBA 1I4K1 4M78E 4B9WA 5LJ5g 3QWXX 2OTLT 1X6BA 2DTIA 4JS4A 1UGVA 3HSBA 1D1AA 1UGPB 4RTWA 1W4SA 2COZA 2KROA 1E6HA 1Q7YR 4P5NA 2A7YA 2M0OA 1Y96A 4ZGJB 3FIFA 4F04B 3BY7A 2RJFA 2ZCFB 3CCRQ 3I55A 4XTVA 4J9FA 4XTUA 4C0DC 4RTXA 4PJOC 2CDTA 3CMEQ 4DOVA 2ATCB 3G1JA 4FM4B 1JQQA 1QKWA 3JB9J 4M7DA 2EFIA 2R58A 3OW2A 4GBQA 3OQ5A 2MPXC 1NG2A 1KJWA 1WHGA 2DXTA 5A0LA 2VV5A 1OEBA 7AT1B 4KH0B 5D6YA 2Z0WA 4PJJA 1MNEA 5KE3A 3LH5A 1JJ2S 1ARKA 3CCUA 1AZEA 3CPWS 4EMKB 2AK5A 2LRQA 4E7JA 4FSSA 3DKMA 3I56Q 2RQWA 4JRQA 1MV0B 1VQ8A 2RHYA 2EYXA 3EH1A 4XTZA 3LGFA 3CD6Q 4E7IA 5LJ5h 3OYIA 2HD0A 3EFRA 1YHQA 4L59A 3I5SA 3LX7A 5FU6C 2JTEA 2HMAA 2OAWA 3OYFA 2CP5A 3KFVA 4ZN3A 2HKQB 1M1KR 2V1RA 3QDRB 2HL3A 2DE0X 1UHFA 5FWBA 1ZSZA 3OA6A 2J6KA 4FW1A 2HSEB 1NLPC 5GMKe 3CMAQ 2K9GA 1M90U 2EVRA 1RAFB 1WQWA 1S72A 3OSVA 2D9TA 2VC8A 4JRKA 2LT1A 4J9BA 1R77A 4IUPA 3UF4A 3M5AA 1KK7A 5GANg 1LJOA 2LCLA 4BY6C 2CUBA 5CQXA 2XD0A 1IGQA 4JLGA 3HFOA 3LW5E 4CRIA 2JMAA 1SKUB 4E47A 4IKFA 3JB9H 2K79A 3I9QA 2CZ0B 1NJIR 4OMMA 1VQ9A 1VQNT 1BIBA 3HHTB 3UDCA 2L3PA 3SWNC 2KYBA 1YFNA 1O9SA 3QYGB 2RPNA 1ACMB 1WFWA 2MAMA 1WDXA 2ED0A 2QA4Q 2PVGB 1QP2A 3GF5A 4C8QC 1DJ7B 2HCKA 4MZPA 3C4SA 1ZUUA 3NTKA 4DEXA 2X3WD 4RCBA 4RTTA 2IG0A 1BCMA 1BI3A 3TCJA 3VU3C 3A98A 8AT1B 1FMVA 2KE9A 3G6ET 1Q95G 2E5KA 2E70A 4GLKA 4D8KA 2DM1A 1W2BP 1Q81R 2OTLA 5FWCA 4M7DF 4PKCC 2E6ZA 5KCOA 2M16A 1O75A 4AFZC 2YUPA 3M0UA 1K76A 1JB0E 4HKEA 5I2SA 2RJDA 5KYWA 5GANh 1AT1B 1XQHA 1PM3A 1PKTA 1YITQ 2QGGA 5CQYA 4DOWA 5LJ3d 2HDAA 2YUQA 3PIPA 1M8VA 2RD1A 4WTOB 1OULA 3N5BB 2C0TA 2QEXT 1PHTA 3QO3A 4PJNA 1QVGS 1C6VX 2RMOA 2KDSA 4IURA 2X3XD 1NM7A 2J6FA 2VXEA 2KAFA 1JRIA 5GAN4 1G3TA 1QVPA 3REBB 5CCAA 3HP9A 3CPFA 1XJWB 2F2VA 1KG1A 3EHQA 4M7DG 1D3BB 2DL8A 3VS1A 1M90C 1GRIA 1UUEA 3CCMT 1U3OA 4XTWA 5D6XA 3CC4A 1YJNT 3GP8A 3RMQA 4BY6B 4KUDK 1NYGA 1D0XA 2AT1B 3CCJA 4PK4A 3RKWA 4XU0A 3P8HA 3EHRA 2OTJT 2GGRA 2L0AA 2KT8A 2Y4XA 4J6XA 5L23A 1LCKA 4QT7A 4AFUC 2JS2A 2DMOA 4B9XA 4L5GA 5A0DA 1HXDA 1OYXA 4ELZC 5FROA 1FMWA 2XDPA 4WF2A 4BE1A 2KK4A 3MEUA 2GFAA 5LJ5d 2L89A 3UA6A 2HKNA 2A08A 4RMOA 2E4HA 4PJOA 3X25B 1OPLA 4JS5A 3CC2T 3JB9F 5I2MA 3C0CA 3H0IA 2QQAA 3RDVA 1OX9A 3S6WA 4J9HA 2O4XB 1N27A 3GBQA 2EGCA 4JZ4A 3JCMd 4M7AB 2KYMA 3VS5A 2BIVA 3RBBB 2A37A 3C95A 2CZ7B 2JN0A 1U8RA 2DYIA 4A53A 3QKJA 3G4ST 4OMNA 8ATCB 1VA7A 1PCXA 4FYYB 2I2LA 3M0SA 5HCKA 3OS5A 3CCST 4M77G 5M9OA 3NGPA 1YWPA 4QQDA 3V7RA 3MP6A 4OF1A 4PFZA 1QCOA 5GAMf 5CAIA 1VQNA 2G3RA 1V1CA 1KQSA 1FXXA 1WQ7A 1VQ4Q 1W70A 3OYCA 3LH0A 5HK0A 1K9MU 1VQMT 2IIMA 1JXMA 1OZ2A 1VQLQ 1D1CA 4DQ2A 2BZYA 2K5FA 3JB9G 2Y90A 3HKSA 3M0TA 2DXCA 5GAMe 4QKUA 3CCQQ 5J39A 2PQWA 4AFQC 2O9VA 4M7DD 3ULRB 1QLYA 3FJ5A 1QWEA 3QZ5B 3H6ZA 3O5ZA 3H0HA 4C92B 4XTXA 3R6OA 2VYTA 1PRLC 2J6OA 4NL2A 3QDFA 3R6NA 1C0MA 2YXYA 2K4YA 2GTOA 2RI2A 4E6RA 1H92A 3V7CA 3AT1B 1AVZC 5GAOp 1T0JA 1Y7XA 2KNBB 4Z02A 3CCSQ 1RADB 2DL4A 1QW1A 2JM9A 5KYXA 1G83A 4QQ6A 1YI2T 5GAOl 2G6FX 1TTHB 4RG2A 4XAXB 5J26A 3DLMA 1PWTA 2K2MA 2CZ6B 2JJ9A 1VQOQ 1YN8A 4OGEA 4FYVB 3DB3A 3EGXB 1K0XA 1Y71A 4J7IA 5CO7A 1BCOA 2CP6A 5GANd 4QVZA 2J06A 4FL6A 2EYWA 4M7DE 4Y28E 1YJ9T 1BU1A 3A8LB 4QQGA 4C8QA 4N0AA 1PNJA 3GPLA 5FW9A 4N4HA 5GAN2 1EZZB 1KHCA 5D6WA 2GNCA 4OB0B 1YJNA 2K57A 4RTYA 2RA2A 4DEYA 2YLCA 5CK9A 2JTFA 2RQTA 2RNAA 4PJOF 2D0NA 1ZHIA 2XICA 4TVRA 1M2VB 2KGTA 4RTZA 4KT0E 1UE9A 1VQ6T 4ZN1A 2H8HA 2DVJA 2FRWA 3L42A 1OPKA 4J9CA 4J9GA 1R0CB 1YCYA 2QXFA 3CCEA 1YIJA 2A28A 1T3LA 2PUOB 1TU0B 2QQSA 1NEGA 1VQ5T 4BDYA 1E7OA 2FG0A 3LLRA 1ZSGA 2CP0A 4GLMA 1A0NB 3G71T 2W10A 3MJXA 2L3QA 4EMKC 1ZBJA 1K9MC 3EG1A 2V26A 2Y4YA 1VQ7T 1M4ZA 3OYYA 2K3YA 2L3RA 2YDLA 1KQ2A 3VS0A 2EQUA 2CT4A 3NMZC 1CKBA 4M75B 3X24B 2EJFA 2BZ8A 4PJOG 3M0PA 1U5SA 5GMKh 2DJZA 1IRXA 3G7ZA 4BACA 1IZ6A 4RTVA 2LQ8A 4YTLA 3M55A 4J6WA 1VQ8Q 2QDYB 3CCRT 2K6DA 3JSCA 4RG8A 1UFFA 4V2SA 1YHQQ 1JEGA 1JO8A 1K9AA 2CKKA 1KFZA 4AG1C 2ZPEB 2LC4A 4EDUA 1RI0A 2VGMA 1ZSZB 1NPPA 2LT4A 3KXTA 2EQKA 1VQMA 2ZPBB 5EG2A 9ATCB 3CBOA 3UPUA 1VQ7Q 1V76A 3L2ZA 1ZBXA 4LDYA 3I35A 5FU7B 2FO0A 1G5VA 2F1LA 1UG1A 2EGAA 4OB3B 1K8AR 2PUKB 1UB4A 3C12A 3F70A 4J8OA 1VIEA 4EPCA 3I56T 3MO8A 1VQPA 2HL5C 2FPDA 1AZGB 1OI1A 2PZ1A 2JT4A 3WVDB 4N4GA 3A8GB 3CD6T 1MMAA 1QKXA 3VRZA 3TSWA 4BE2A 2XHCA 1M1GA 1K4US 3MKDA 4IUUA 1W2BA 2E5QA 3PVQA 2XKOC 3M56A 3E9GA 4C8QF 2MOXA 1ZA2B 3UA7A 2E1HA 4M78B 2DRMA 2KT1A 4KULA 5CKBA 3NPFA 2O01E 1AWJA 2LQNA 4OMFB 2SEMA 1JBMA 1N8RR 1BYMA 1M1FA 2DX1A 3CMAT 3H0FA 5GAOr 2DFUA 1Q86U 3QYHB 4MMKA 3ZEHA 1YJ9A 3EG9A 3MPUB 3E9FA 4BE0A 2M0YA 1FWZA 5DLOA 3EFSA 4RKUE 2GQVA 2E64A 1F1BB 4PJOD 2K2VA 1UTIA 2KRNA 1M9SA 2K3XA 1NZ9A 2EWNA 1Z9ZA 3QXEB 1OX8A 1T3SA 1ZLMA 1IHWA 3HRSA 1MMGA 5KYWB 1BI0A 1PSFA 1KC8R 1X2QA 1MV3A 1WXUA 4C8QG 2VVKA 3CCVA 4O5VA 3S3NA 1SRLA 3KUFA 1QCFA 2MIOA 5LL6S 3M53A 4C5HA 3A8HB 3TVTA 4II1A 2EKOA 2DVEA 2B8AA 1JJ2P 3CPWP 2QA4T 1VQ5A 1CKAA 1QQJA 1WYXA 4R0KA 3QUIA 3RMSA 2QTVA 1S1NA 3EGDB 1BIAA 4DBFA 4JRPA 1WHMA 3M4YA 3CCLT 4HVWA 2QYZA 3MEAA 3HTRA 3J81E 4K11A 4JRIA 4LXCA 2D1XA 1Q82R 1MUZA 4M77A 5GAMg 2NUPA 2E65A 2CSQA 4PJOE 2D8HA 3U23A 2YUNA 1WIEA 3SD4A 1B3QA 4ATOA 1D0YA 2PNIA 3CC4Q 2QK0A 1SHGA 1YITT 4JZ3A 2DXBA 1KD1U 1MNDA 2LJ0A 2WACA 3VRYA 5LJ3f 3JRZA 5A2QE 1QWFA 3CCJQ 2HQXA 2O31A 5CIUA 2HBPA 3CMEA 5GAOq 3L2QA 4A54A 1QVFA 1H8KA 2ZPFB 1YNZA 5DLQE 5LJ3j
chains in the Genus database with same CATH topology
1YI2A 2MMPA 4LDUA 2O4XA 4JJNK 4JS5A 2CZ1B 3OW2S 3CC2T 4C92G 3J80E 5GAOn 4HT8A 2E6NA 1M5Q1 5I2MA 4J7FA 3SB2A 5LJ3e 3AHUA 1VQKA 2QQAA 2M9UA 1N8RC 2RI3A 3S6WA 3JCMg 2V8JA 1XOVA 2E10A 3OYNA 1Q81C 5CR2A 3FDRA 3M9QA 2O4XB 1N27A 3E19A 4L6V5 5CKEA 3JCMd 4M7AB 3CBPA 2BIVA 4A4HA 1X75C 4FIBA 3M4GA 4M75E 1HK9A 3C95A 4M7AC 3CCVT 2CZ7B 3L1AA 2JN0A 4XU1A 4C5GA 1U8RA 4M7AF 1Q86C 4JLIA 4F7UG 3ZFJA 3QKJA 4A53A 1X6OA 5I21A 3G4ST 3OMGA 4MDWA 3UWNA 1VQLA 3PNWC 4EMKA 2X4JA 2I2LA 5IT9E 2HQEA 1OZ3A 2VUBA 3OS1A 3OS5A 3CCST 1U1TA 3CCQA 4M77G 3SFMA 5M9OA 5GMKi 2RJCA 4QQDA 3V7RA 3MP6A 4OF1A 1I8FA 5GAMf 5GAMh 5CAIA 1VQNA 1WJSA 2G3RA 1WGSA 4PLLA 2JTMA 1KQSA 1KC8C 4C8QD 1FXXA 1WQ7A 2F69A 1I5LA 2YLBA 3FB9A 4MMLA 2FHDA 3P8BB 3LWIA 3OYCA 3LH0A 1S72T 5HK0A 2GF7A 4XU2A 1H641 4M75A 1K9MU 2F5TX 1KQ1A 3PT9A 4HA8A 2V8KA 1VQMT 3CC4T 2EQMA 5KH6A 4M78D 1VQ6A 2HAXA 1OZ2A 4OVAA 2ZPGB 3OS2A 1N9RA 4DQ2A 2K5FA 3JB9G 2Y90A 3HKSA 1K73U 3X26B 2DXCA 4XK8E 3VV0A 5GAMe 3CCJT 2D6FA 2RK2A 4GY5A 2PQWA 3OSSC 5J39A 3MEVA 3VUBA 4KUIA 4BUGA 4M7DD 3HL8A 3ER0A 3PMIA 3TREA 4EMHA 3V8LA 5CVIA 2PVDB 5J3BA 3DLLA 3QZ5B 3OYDA 2DIGA 4ZGDB 3CMAA 3H6ZA 4DA4A 5LJ5j 4OGCA 3WXMB 3OB9A 4C92B 4C0FA 2KQWA 3LYIA 3FJPA 4XTXA 1QVGA 3R6OA 2VYTA 3META 4NL2A 4HCCA 4J83A 2AHJB 2X35A 3OS0A 5GMKl 4C92C 4NOYA 4C0GA 2ZGWA 3G71A 3JCMJ 1VQOA 3RERA 4M7AG 4C92F 4ZGEB 5HKCA 2CYZB 3JCMb 4BDZA 2K4YA 4FU6A 1Q82C 2DZCA 1VQ9T 5KCHA 3MCAB 2RI2A 1FX7A 5GMKj 2F5KA 1QP3A 3V7CA 3JCMf 3JCMh 3UT1A 1VQ7A 3JCMP 5GAOp 4OP0A 4HCZA 1N9SA 2JUFA 1Y7XA 1G3WA 3CMET 4HT9A 4Z02A 3CXCA 2XIDA 1BI2A 5C0MA 4XU3A 1MGQA 1QW1A 4KBMB 3JCMW 1UEBA 4QQ6A 2EIFA 1YI2T 2D0QB 5GAOl 4RG2A 4XAXB 5J26A 3RIRA 3VJPA 5GAN3 3DLMA 1N6AA 3LWHA 2CZ6B 3O8VA 4FT2A 4C8QE 4F7UF 2CS7A 3T9NA 3TEEA 5CKDA 4OGEA 3QSUA 4M77B 3DB3A 4BD3A 2R5AA 3JAME 3PMTA 3JCMe 1B34A 3FEOA 3QBYA 4LDVA 3VYGA 2QI2A 3HRUA 2HNIA 3KBGA 1KHIA 2MF2A 4BI8B 2XDDA 1I4K1 2JNGA 1Y71A 4M78E 4M77F 3OYAA 4J7IA 3M59A 5CO7A 4B9WA 1RL2A 1Y07A 5LJ5g 1Q7YU 1K8AU 1KD1C 2PVOB 2OTLT 2DTIA 5GANd 4JS4A 4QVZA 3HSBA 1VQ4T 4FL6A 1UGPB 1W4SA 4E7KA 3OYJA 2QA4A 3ZBDA 3QHSA 3SDZA 3CCRA 4M7DE 4Y28E 4P5NA 4M75G 1W2BS 2RI5A 1YJ9T 2RK1A 3A8LB 3OYKA 2A7YA 2L8DA 2GCXA 2M0OA 1Y96A 2ZPIB 4ZGJB 2KSSA 1VQLT 3OYBA 4QQGA 3FIFA 4C8QA 4N0AA 4LDXA 2DTHA 3BY7A 3GPLA 4N4HA 5GAN2 1KHCA 5D6WA 3CCQT 4Q5WA 2JOYA 2RJFA 3VKIA 2ZCFB 3FRNA 4C0DB 4OB0B 3TU4K 1YJNA 2R57A 2K57A 2GFUA 2H3JA 4XTVA 3I55A 4PJOB 3CC7T 2RA2A 4M78A 4XTUA 3A8MB 4C0DC 5AYFA 2XK0A 3QG1A 2YLCA 2EYQA 2JTFA 5CK9A 1YJWT 4PJOC 4DOVA 2DO3A 4PJOF 4FM4B 4TVRA 1ZHIA 2MWPA 2XICA 3L2VA 2DKGA 2K5LA 3JB9J 4N0AC 4E7LA 2QTXA 4M7DA 3P8DA 2EFIA 2QQRA 4KT0E 1VQ6T 2R58A 4ZN1A 3OW2A 3OQ5A 3L42A 3I56A 1AHJB 3JB9F 2FL7A 2XDBA 2DXTA 1I81A 5A0LA 5GAN7 4N4IA 1YCYA 2VV5A 3CD6A 3ME9A 3INZA 2QXFA 3CCEA 1YITA 3NTIA 1YIJA 1WJRA 2PUOB 5D6YA 2QQSA 2P0KA 3QJ6A 3OYMA 5KE3A 1VQ5T 4BDYA 3WVEB 1BKBA 3LLRA 1JJ2S 3CCUA 3CPWS 4EMKB 3A5ZB 2LDMA 3CBMA 3HPWA 2LRQA 3G71T 1VQOT 5CKHA 3BDUA 4E7JA 3DKMA 4EMKC 2RHIA 1K9MC 4JRQA 2Y4YA 1VQ7T 1M4ZA 3OYYA 1VQ8A 2K3YA 2RHYA 2KMTA 2L3RA 4XTZA 3LGFA 4J6YA 1KQ2A 4E7IA 2DPPB 5LJ5f 5LJ5h 3OYIA 1K73C 2HD0A 3EFRA 1YHQA 2EQUA 1IREB 4L59A 4MDXA 5IN1A 5FU6B 4M75B 3X24B 2EJFA 2LX9A 3JCMc 3LX7A 2OAUA 3JCMV 3G6EA 2JZ2A 5FU6C 4M75C 1NE8A 2YRVA 5GANj 4ZTJA 1M1KU 4PJOG 4M7AD 4PNOA 4M75F 3X20B 2RO0A 5GMKh 2DJZA 3OYFA 3G7ZA 4BACA 2RM4A 1IZ6A 3E1SA 5FRMA 2LQ8A 4YTLA 3M55A 2YHTA 4ZN3A 2C06A 4J6WA 3QDRB 4JUVA 1WJQA 4NL3A 2QDYB 3CCRT 5LJ5e 3PTAA 3JSCA 3J7AF 4LD9K 1D3BA 4RG8A 4V2SA 3M54A 4M78G 2A3LA 4C0ZA 3FC3A 3JCMQ 3OA6A 4A4GA 3MHXA 2MWOA 1PSEA 2LNVA 4XQ3A 2CKKA 3L2UA 2KVQG 5GMKe 1UGQB 2NLUA 2ZPHB 3S3MA 1M90U 4NS5A 2QQBA 2LC4A 2ZPEB 4EDUA 2DAQA 4QW2A 1RI0A 5HK3A 2VGMA 3NTHA 1WQWA 2FB7A 1S72A 1NPPA 3OSVA 2QEXA 2D9TA 2LT4A 2P0QA 2EQKA 2LT1A 2VC8A 4FSXA 4JRKA 4D6WA 3KXTA 1VQMA 1GXIE 2XU8A 2ZPBB 5EG2A 3V7SA 1VQKT 4IUPA 2L5QA 3CBOA 4QVDA 3UPUA 3S3OA 4IUVA 3M5AA 5GANg 1LJOA 4X34A 2LCLA 3RUXA 1U1SA 4BY6C 4ELYC 3L2ZA 4PL6A 5CQXA 2XD0A 1ZBXA 2LQKA 3MEWA 4LDYA 2VGNA 4MZMA 5FU7B 1Q7YC 3PIOA 4JLGA 3HFOA 1G5VA 3LW5E 5GAMd 1B34B 3SWNA 3BW1A 4OB3B 5FU7C 1QVFS 4CRIA 1NJIU 4C92D 2PUKB 2CGHA 4Y91A 1UB4A 3C12A 3F70A 4J8OA 1VIEA 3VYHB 2BKDN 3EAEA 4A4FA 4EPCA 3MO8A 4E47A 3I56T 1VQPA 4M7AE 4IKFA 1OI1A 3VUZA 3OBWA 3JB9H 3WVDB 4N4GA 2CZ0B 2DZ9A 3A8GB 3RKXA 3CD6T 3CCMA 3CCET 3GLXA 2WSFE 1YIJT 5GMKm 3CCLA 2E12A 3SWNB 5GAN5 5FRNA 1SSFA 1VQ9A 3QZ9B 2LVMA 4BE2A 1VQNT 1BIBA 2XHCA 3HHTB 3UDCA 1WNLA 3SWNC 2RH2A 1M1GA 1X01A 1Y96B 3CCUT 3CEYA 2LTOA 1O9SA 3QYGB 4C8QB 2DEQA 2DD5A 2WSCE 2WSEE 4IUUA 2E5QA 1R8OB 2MAMA 3BDLA 1W2BA 2EJGA 2OTJA 2PVGB 2XKOC 1QP2A 3GF5A 4C8QC 3M56A 2LCCA 3E9GA 4C8QF 1DJ7B 1VQ8T 2E1HA 3FLGA 4M78B 4MZPA 5GAOm 4BI4A 4LDWA 3C4SA 4M7AA 4M77D 4KULA 4PLIA 5L8RE 3NTKA 4E7HA 1N8RU 1YHQT 4M78C 5CKBA 4ZTFA 4ME7A 4RCBA 1Q81U 2IG0A 3HRTA 4M78F 2O01E 2QQ9A 4C5EA 2M1HA 4OMFB 5GAN8 1ZQ1A 1BI3A 3TCJA 3VU3C 4M7DB 4OB1B 1JBMA 3OYGA 3G6ET 1BYMA 1M1FA 3CMAT 2MI6A 2E70A 4GLKA 3OYHA 2OTLA 4M7DC 4A4KA 4M7DF 1VUBA 2E6ZA 4PKCC 5DY9A 5GAOr 1VQ4A 1KQSS 5C6SA 5KCOA 2M16A 2KY9A 2DD4A 1O75A 5CKFA 1Q86U 3QYHB 4A4EA 3JB9D 4X9CA 3Q1JA 2DIQA 4MMKA 3ZEHA 1YJ9A 3JB9I 2X4YA 4XTYA 3ASKA 3PGGA 3E9FA 1JB0E 4BE0A 1WPYA 1G3SA 4HKEA 4MZTA 4C92E 5I2SA 1FWZA 5DLOA 3OBYA 3EFSA 1YBYA 4RKUE 2RJDA 3CC2A 1EIFA 5GANf 5GANh 3NFCA 3M58A 4FT4A 1XQHA 1UGRB 2E64A 2GQVA 3RKYA 2X4XA 5GAN6 2DTOA 5LJ3g 4PJOD 3C94A 2K2VA 1BI1A 1KC8U 1M9SA 5DM7R 2K3XA 1NZ9A 2EWNA 3LGLA 5CQYA 2PU9B 5HY6A 3QXEB 4DOWA 4EMGA 1LNXA 3DB4A 5LJ3d 3CPWA 1JJ2A 3PIPA 1M8VA 1YJWA 2RD1A 3HRSA 3N5BB 3MP1A 2RHXA 4VUBA 1PSFA 1BI0A 2QEXT 1M1KC 5GAMj 3QO3A 4O6JA 3V8KA 1QVGS 3QJYA 4C8QG 4J5YA 2FYKA 4F7UE 4IUTA 3CCVA 2VXFA 2KDSA 4IURA 4O5VA 3S3NA 4HCBA 3L2RA 5GANe 3KUFA 3X25B 3HFNA 4C92A 3G4SA 2VXEA 5LL6S 3M53A 2KAFA 1JRIA 4C5HA 1H3ZA 2RHUA 5GAN4 1G3TA 1QVPA 3A8HB 4M77E 4II1A 2EKOA 1P92A 5CCAA 2DVEA 4RCCA 3CCSA 2B8AA 1NPRA 3HP9A 2QA4T 3CPFA 2R5MA 2RHZA 3CXCS 1VQ5A 2EAYA 4OB2B 2DK3A 2JVVA 3QUIA 2RB6A 3RMSA 3OYLA 1KG1A 4M7DG 3GNGA 1VQPT 1D3BB 1G3YA 2ZZDA 1BIAA 3A8OB 2P0PA 4X9DA 4JRPA 1M90C 3RESA 3X28B 3CC7A 3CCMT 3MP8A 3M4YA 3H8ZA 4IUQA 1Q82U 4F7UA 5IAYA 4UC4A 4XTWA 3CCLT 5D6XA 1MHNA 3MEAA 3CC4A 1YJNT 4CI0C 3J81E 4JRIA 3RMQA 4BY6B 2FVUA 3I55T 3GP8A 4KUDK 5A0GA 2P4TA 1V29B 3M57A 3CCJA 3QPHA 4M77A 1LOJA 4M75D 5GAMg 3RKWA 4XU0A 3P8HA 3QIIA 2X4WA 1K8AC 2OTJT 4F7UB 3GIBA 1VIFA 2E65A 4PJOE 5FLXE 2K5IA 2RJEA 2DXUA 2XI9A 2Y4XA 4J6XA 4QVCA 3SD4A 3OMCA 1TH7A 1XTDA 4JDSA 1NJIC 4BI3A 4ATOA 3URGA 2V8IA 4B9XA 4L5GA 3PFSA 5A0DA 3L2WA 1HXDA 1UGSB 4M77C 1OYXA 4ELZC 2DXBA 5FROA 1YITT 2WACA 1KD1U 5LJ3f 3JRZA 2XDPA 5LJ3h 4LD6A 5A2QE 2XG8D 4WF2A 2E41A 4BE1A 2KK4A 3OY9A 2HQXA 4BB7A 3MEUA 3GOXA 4R55A 2GFAA 5CIUA 2HBPA 5LJ5d 3CMEA 5KE2A 1XNIA 2L89A 5GAOq 2EQJA 3GNFB 4A54A 4R56A 3V8JA 4RMOA 3BFMA 3L2QA 1QVFA 2ZPFB 2BUDA 5DLQE 5LJ3j 4C5IA 4PJOA 2EJ9A 3OYEA 2IVWA 3JCMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY6 C;  5FU6 C;  5FU6 B;  4C0D C;  4BY6 B;  4C0D B;  4C0G A;  5FU7 C;  4C0F A;  5FU7 B; 
#chains in the Genus database with same CATH topology
 3UAT A;  4LDU A;  1CSK A;  3OW2 S;  4C92 G;  5GAO n;  5LJ3 e;  3SB2 A;  1BK2 A;  3CCL Q;  1XOV A;  3OYN A;  5CR2 A;  3FDR A;  3M9Q A;  2KXD A;  1BB9 A;  2LMJ A;  3CBP A;  2COY A;  4M7A C;  1C1A A;  2DA9 A;  1GL5 A;  1AD5 A;  4F16 A;  1Q86 C;  4F7U G;  3ZFJ A;  1EFN A;  1I1J A;  4MDW A;  4EMK A;  3EG0 A;  2X4J A;  5IT9 E;  2CT3 A;  5GAM h;  4FYW B;  1I0C A;  1RAG B;  2JTM A;  1R0B G;  1ZUK A;  4C8Q D;  2HZY A;  1TS9 A;  2B86 A;  3LWI A;  2BE7 D;  3OW2 P;  2GF7 A;  2F5T X;  3PT9 A;  5KH6 A;  1SEM A;  4OVA A;  2ZPG B;  3OS2 A;  1N9R A;  3VS4 A;  1K73 U;  1PG5 B;  3EFO A;  4AT1 B;  1NYF A;  3VV0 A;  1N5Z A;  1MMD A;  5KYY A;  3MEV A;  3HL8 A;  3PMI A;  2FPF A;  4EMH A;  3CC7 Q;  5CVI A;  3CMA A;  1YJW Q;  5LJ5 j;  4OGC A;  2NUT A;  3WXM B;  4C0F A;  2KQW A;  3FJP A;  4F17 A;  3JCM J;  5GMK l;  4C92 C;  3JV3 A;  5HKC A;  1NEB A;  2CYZ B;  3JCM b;  1ZUY A;  5KCH A;  3JCM f;  3UT1 A;  1TUC A;  1N9S A;  3CXC A;  4LUE A;  5C0M A;  4JJC A;  2XMF A;  4KH1 B;  2EIF A;  1QVG P;  5GAN 3;  1N6A A;  4C8Q E;  5KYN A;  5I11 A;  3JAM E;  1IHV A;  3PMT A;  3JCM e;  5KYX B;  1Y57 A;  4AFS C;  2QI2 A;  2YRC A;  4BI8 B;  2XDD A;  2JNG A;  4M77 F;  4ORZ A;  1WZO A;  1K8A U;  1KD1 C;  1Y07 A;  4Z89 A;  1Q7Y U;  2PVO B;  2E3H A;  1JU5 C;  4CC3 A;  1VQ4 T;  4E7K A;  3OYJ A;  2QA4 A;  3ZBD A;  1VOM A;  2LZ6 B;  3SDZ A;  1QCN A;  4M75 G;  4J9D A;  2RK1 A;  2L8D A;  2GCX A;  2ZPI B;  2KSS A;  1VQL T;  4Z8A A;  1AOJ A;  2MCN A;  3CCQ T;  2JOY A;  3TU4 K;  1AWW A;  1IB8 A;  2H3J A;  1Z9Q A;  3E2U A;  4KGV B;  2MYS A;  5AYF A;  2XK0 A;  3QG1 A;  2DO3 A;  2MWP A;  2DKG A;  1VYT A;  2DBM A;  3P8D A;  2QQR A;  1OU8 A;  5IXF A;  1FYN A;  1I81 A;  5GAN 7;  1T0H A;  1M3B A;  3I5R A;  1VQK Q;  1YIT A;  3NTI A;  1WJR A;  2P0K A;  3QJ6 A;  4RTU A;  2AKK A;  2LDM A;  3HPW A;  4CC2 A;  1HJD A;  1VQO T;  5CKH A;  2O88 A;  2QG9 B;  2RQV A;  2KMT A;  4J6Y A;  2KBT A;  3CCE Q;  2DPP B;  1K73 C;  1YIJ Q;  4MDX A;  4FYX B;  1IRE B;  2ZAE A;  5IN1 A;  2LX9 A;  2X9H A;  3VS2 A;  3JCM c;  4E2F B;  3JCM V;  3G6E A;  2JZ2 A;  4M75 C;  5GAN j;  1M1K U;  2KEA A;  3X20 B;  3A1P A;  5KYU B;  2RO0 A;  1LVK A;  2CH4 W;  1W1F A;  2RM4 A;  5FRM A;  2HBW A;  2C06 A;  4JUV A;  1UEC A;  1WJQ A;  4NL3 A;  1TUG B;  3PTA A;  2FZC B;  2LCS A;  1D3B A;  1X27 A;  2KI7 A;  4M78 G;  4C0Z A;  3FC3 A;  2KRS A;  4A4G A;  4EIK A;  1PSE A;  2LNV A;  1GCQ C;  2NLU A;  2ZPH B;  5HK3 A;  4AMC A;  2DL7 A;  2EW3 A;  2QDL A;  2QEX A;  2P0Q A;  3M0Q A;  4D6W A;  1GXI E;  4JPB W;  1ZSZ C;  2L5Q A;  4QVD A;  2K3B A;  3S3O A;  4IUV A;  1GFD A;  4X34 A;  4ELY C;  1U1S A;  2ENM A;  4PL6 A;  2VGN A;  4MZM A;  1Q7Y C;  3PIO A;  1WI7 A;  5GAM d;  1B34 B;  3SWN A;  5FU7 C;  1NJI U;  1VYV A;  1RLP C;  1WXB A;  4Y91 A;  2L2P A;  2BKD N;  3VUZ A;  3OBW A;  3CCM A;  1ABQ A;  3GLX A;  1RLQ C;  2LJ1 A;  2WSF E;  1SSF A;  2O2O A;  1SRM A;  4Z88 A;  1G8X A;  2RH2 A;  2DIL A;  1Y96 B;  3CCU T;  2LTO A;  2AZS A;  2DD5 A;  1R8O B;  2EJG A;  2OTJ A;  2GQI A;  1VQP Q;  1VQ8 T;  5GAO m;  4BI4 A;  4M7A A;  4M77 D;  1YHQ T;  2LX7 A;  4M78 C;  1UHC A;  4ZTF A;  4ME7 A;  1TXQ A;  1Q81 U;  4E7S A;  5GAN 8;  3I55 Q;  4M7D B;  4OB1 B;  4DBR A;  3OYG A;  1LPL A;  2MI6 A;  4PFP A;  4A4K A;  1VUB A;  5DY9 A;  1VQ4 A;  1KQS S;  4DBQ A;  2ABL A;  2DD4 A;  2KY9 A;  1SF9 A;  1HYO A;  3JB9 D;  4X9C A;  2DIQ A;  2ESW A;  2X4Y A;  4XTY A;  3PGG A;  1WPY A;  4MZT A;  1FMK A;  1YBY A;  2CP3 A;  3CC2 A;  3NFC A;  3M58 A;  4FT4 A;  3RKY A;  5LJ3 g;  5GAN 6;  1TUD A;  3C94 A;  4EMG A;  1JJ2 A;  5HY6 A;  1LNX A;  3DB4 A;  3REA B;  1X69 A;  3CPW A;  1PD1 A;  3CCU Q;  2RHX A;  2X51 A;  1M1K C;  1PC0 A;  4O6J A;  3QJY A;  4J5Y A;  4IUT A;  2VXF A;  4HCB A;  2NYS A;  4C92 A;  3G4S A;  1H3Z A;  2RHU A;  1RAB B;  2KXC A;  4M77 E;  2YSQ A;  3CCS A;  1KQS P;  1NPR A;  2R5M A;  2RHZ A;  5GJW B;  2EAY A;  2BE9 B;  2RB6 A;  3OYL A;  3GNG A;  2DBK A;  3X28 B;  4IUQ A;  3H8Z A;  4F7U A;  2VWF A;  1MHN A;  2EQI A;  5AT1 B;  2C0O A;  5A0G A;  1V29 B;  2YRD A;  1YCS B;  3QPH A;  1LOJ A;  1VIF A;  2ECZ A;  3EGX A;  5FLX E;  1RI9 A;  2DXU A;  2YUO A;  4QVC A;  3OMC A;  1NJI C;  1XTD A;  1S72 Q;  3URG A;  1OQK A;  2ED1 A;  2V8I A;  2DYB A;  2NUZ A;  3PFS A;  3L2W A;  1UGS B;  5LJ3 h;  4LD6 A;  4OML A;  2XG8 D;  3D7S B;  3RR6 A;  2VAS A;  1RAA B;  1XNI A;  3TQ7 P;  3V8J A;  3BFM A;  4JJD A;  4C5I A;  2EJ9 A;  3OYE A;  2IVW A;  1YI2 A;  1I07 A;  5IHI A;  1HSQ A;  4JJN K;  2CZ1 B;  4HT8 A;  1RAH B;  2E6N A;  1QMC A;  3AHU A;  2DL5 A;  2RQR A;  1M2V A;  2DNU A;  2RI3 A;  1VQ9 Q;  3JCM g;  2V8J A;  2E10 A;  2OX7 A;  1Q81 C;  1M8M A;  5CKE A;  2D8J A;  3NHN A;  1HD3 A;  1K0S A;  2EGE A;  2RF0 A;  2KRM A;  3H9N A;  4A4H A;  3M4G A;  1HK9 A;  1ZX6 A;  2MK5 A;  4C5G A;  4XU1 A;  4M7A F;  1NLO C;  1X6O A;  2DLP A;  2V1Q A;  5I21 A;  3OMG A;  3UWN A;  3PNW C;  2HQH A;  4DBH A;  5IXB A;  2COW A;  1TG0 A;  1Y0M A;  2PTK A;  3OS1 A;  4PJM A;  3SFM A;  5GMK i;  1UJY A;  1WJS A;  1WGS A;  2OTL Q;  1WLP B;  5EC7 A;  2F69 A;  1I5L A;  4MML A;  2EBP A;  2FHD A;  3P8B B;  1J3T A;  4AG2 C;  4XU2 A;  1H64 1;  4M75 A;  2K7A A;  2ROT A;  4HA8 A;  2V8K A;  3CC4 T;  2EPD A;  1VQ6 A;  2HAX A;  1IO6 A;  1JXO A;  1D09 B;  3VS7 A;  1ABO A;  1K9M R;  4XK8 E;  3CCJ T;  1M27 C;  2RK2 A;  4ANJ A;  4KUI A;  4BUG A;  3TRE A;  2PVD B;  5J3B A;  3OYD A;  2DIG A;  4DA4 A;  1TSF A;  2JMC A;  3EFO B;  1QVG A;  3LYI A;  2P84 A;  1GCQ A;  3MET A;  5KYY B;  1X2K A;  4HCC A;  1KIK A;  2AHJ B;  2LJ3 A;  2X35 A;  4NOY A;  3G71 A;  2ZGW A;  4M7A G;  3RER A;  4C92 F;  4ZGE B;  4BDZ A;  4FU6 A;  1SPK A;  3MCA B;  5GMK j;  1VQ7 A;  1QP3 A;  2NUT B;  3JCM h;  4OP0 A;  1BI2 A;  4XU3 A;  1IXD A;  1UEB A;  3RIR A;  4KRT A;  2CSI A;  4F7U F;  2CS7 A;  3TEE A;  3QSU A;  2YWW A;  1RAC B;  4BD3 A;  3QBY A;  2DF6 A;  3HRU A;  2MF2 A;  3CCR A;  3VS6 A;  4CC4 B;  3OYA A;  3M59 A;  1RL2 A;  3PE0 A;  5IH2 A;  2AIR B;  2QAZ A;  3QHS A;  2FEI A;  4HVV A;  2I0N A;  1VYU A;  1W2B S;  2RI5 A;  3OYK A;  1MMN A;  3OYB A;  2M51 A;  4LDX A;  2DTH A;  1WA7 A;  4Q5W A;  3VKI A;  3FRN A;  4C0D B;  2R57 A;  4PFO A;  2GFU A;  4PJO B;  3CC7 T;  4M78 A;  2DER A;  3A8M B;  2EYQ A;  1YJW T;  1M2O A;  2FRY A;  3RNJ A;  2C0I A;  3L2V A;  2K5L A;  4N0A C;  1U06 A;  4E7L A;  2QTX A;  1SG5 A;  1X43 A;  3I56 A;  1AHJ B;  2FL7 A;  2XDB A;  1OOT A;  4N4I A;  3CD6 A;  3ME9 A;  3INZ A;  2L3S A;  2RQU A;  3SEM A;  1WHH A;  3OYM A;  2CH4 A;  3WVE B;  1BKB A;  2LNH B;  2M02 A;  3A5Z B;  3CBM A;  4IIO A;  3BDU A;  5I22 A;  1M30 A;  2RHI A;  2EYZ A;  5LJ5 f;  1WX6 A;  4F14 A;  3EG3 A;  5FU6 B;  1VQN Q;  1AWX A;  1WHL A;  1D0Z A;  1GBQ A;  2OAU A;  4ZTJ A;  4M7A D;  1NE8 A;  2YRV A;  3IQL A;  4PNO A;  4M75 F;  5ECA A;  3E1S A;  4OMO A;  2YHT A;  1GFC A;  1M3C A;  2QAS A;  2SRC A;  5LJ5 e;  1IGU A;  3J7A F;  4LD9 K;  2W0Z A;  3EGD A;  3M54 A;  2A3L A;  3JCM Q;  3MHX A;  2MWO A;  4XQ3 A;  3L2U A;  2KVQ G;  3G6E Q;  1UGQ B;  3S3M A;  4NS5 A;  2QQB A;  2DAQ A;  4QW2 A;  2CP7 A;  3NTH A;  1RUW A;  2FB7 A;  4FSX A;  4HVU A;  1WHK A;  1BBZ A;  2DRK A;  2XU8 A;  3V7S A;  1VQK T;  5IHK A;  1X6G A;  4HCK A;  3RUX A;  2LQK A;  3MEW A;  2CRE A;  1OU9 A;  5D7U A;  3BW1 A;  1QVF S;  4C92 D;  2VB6 A;  2CGH A;  1B07 A;  3VYH B;  3EAE A;  4A4F A;  2QEX Q;  4FCY A;  4M7A E;  4HXJ A;  3RKX A;  2DZ9 A;  1OV3 A;  4E7Z A;  3CCE T;  1YIJ T;  1E6G A;  5GMK m;  3CCL A;  2E12 A;  3SWN B;  5GAN 5;  5FRN A;  3PVL A;  3QZ9 B;  2LVM A;  1WNL A;  2QGF B;  1X01 A;  3CEY A;  4C8Q B;  2DEQ A;  2JW4 A;  2WSC E;  2WSE E;  3TSZ A;  3BDL A;  2LCC A;  4FW2 A;  3FLG A;  4LDW A;  3CCM Q;  2CP2 A;  4PLI A;  5L8R E;  4E7H A;  1N8R U;  1G2B A;  3HRT A;  4M78 F;  2QQ9 A;  4C5E A;  2M1H A;  1YJN Q;  2DJQ A;  1ZQ1 A;  1RAI B;  3H41 A;  4ZNX A;  5IHN A;  1WXT A;  1QVF P;  3OYH A;  4M7D C;  2OTJ Q;  5C6S A;  5CKF A;  2KR3 A;  4A4E A;  3Q1J A;  3JB9 I;  4LE9 A;  1H3H A;  3ASK A;  1ZA1 B;  1G3S A;  4C92 E;  1Q86 R;  2EYY A;  3OBY A;  1W6X A;  1EIF A;  5GAN f;  1KSW A;  4LNP A;  1UGR B;  2X4X A;  2DTO A;  1BI1 A;  2FZG B;  1KC8 U;  5DM7 R;  3CC7 A;  3LGL A;  2PU9 B;  2EKH A;  1PRM C;  1YJW A;  3MP1 A;  2VKN A;  4VUB A;  1UDL A;  2GBQ A;  5GAM j;  3V8K A;  4LN2 A;  2FYK A;  4F7U E;  2E3I A;  1YP5 A;  3L2R A;  1AEY A;  5GAN e;  3HFN A;  3CC2 Q;  4CC7 A;  1P92 A;  4RCC A;  1GBR A;  2F2W A;  3CXC S;  4OB2 B;  2DK3 A;  2JVV A;  2OJ2 A;  1VQP T;  1G3Y A;  2ZZD A;  3A8O B;  2P0P A;  4X9D A;  3RES A;  2JM8 A;  1EX4 A;  1TWB A;  2HEQ A;  3MP8 A;  1I5O B;  1Q82 U;  4RUG A;  5IAY A;  4UC4 A;  2HSP A;  3G4S Q;  1M90 R;  4CI0 C;  2FVU A;  3I55 T;  2LP5 A;  2P4T A;  6AT1 B;  2O9S A;  1SHF A;  3M57 A;  3THK A;  4M75 D;  4WCI A;  3QII A;  2RN8 A;  2X4W A;  1K8A C;  4F7U B;  3GIB A;  2K5I A;  2RJE A;  2XI9 A;  1TH7 A;  4JDS A;  1UJ0 A;  4BI3 A;  4J9I A;  2BZX A;  1VQM Q;  3CQT A;  4M77 C;  4B6M A;  1TOV A;  2FZK B;  2E41 A;  3CXC P;  3OY9 A;  4BB7 A;  3GOX A;  4R55 A;  5KE2 A;  4J9E A;  4ESR A;  1KD1 R;  2EQJ A;  3GNF B;  4R56 A;  2BUD A;  3EH2 A;  3JCM X;  2MMP A;  2O4X A;  1PKS A;  1NBE B;  3J80 E;  1SSH A;  1M5Q 1;  2J05 A;  4J7F A;  4IIM A;  3EG2 A;  1VQK A;  2M9U A;  1N8R C;  1M3A A;  4OMP A;  4KGX B;  2FPE A;  1B7T A;  2F2X A;  3E19 A;  4L6V 5;  1WHJ A;  2JS0 A;  1X75 C;  4FIB A;  4M75 E;  1YI2 Q;  4A63 B;  2BTT A;  3CCV T;  3L1A A;  4JLI A;  2AKL A;  4D8D A;  1VQL A;  2HQE A;  1OZ3 A;  2VUB A;  4X1V A;  1U1T A;  3CCQ A;  1PD0 A;  2RJC A;  1I8F A;  4JJB A;  2A36 A;  2DEU A;  2DET A;  4PLL A;  3EG9 B;  1D1B A;  1KC8 C;  2YLB A;  3FB9 A;  1YWO A;  1GCP A;  3EGU A;  2ROL A;  1S72 T;  3QWY A;  1KQ1 A;  1YJ9 Q;  2EQM A;  2J7I A;  2GTJ A;  4M78 D;  5GJV B;  2CUD A;  5KYU A;  3X26 B;  2D6F A;  4GY5 A;  3OSS C;  3SHW A;  3VUB A;  2LQW A;  3ER0 A;  4OMQ A;  2OI3 A;  3BE3 A;  1K73 R;  3V8L A;  1RAE B;  3DLL A;  4ZGD B;  3OB9 A;  4J83 A;  3ZL7 C;  3OS0 A;  4C0G A;  2DL3 A;  1VQO A;  1VQ6 Q;  3CCV Q;  2H3E B;  2AZV A;  1Q82 C;  2DZC A;  2YT6 A;  1VQ9 T;  1FX7 A;  2F5K A;  4Y92 A;  4KGZ B;  3JCM P;  4PJL A;  4HCZ A;  2JUF A;  3CME T;  1G3W A;  2NWM A;  4HT9 A;  2XID A;  3VS3 A;  3M0R A;  2A0F B;  1MGQ A;  2IPO B;  4KBM B;  3JCM W;  1VQ5 Q;  4LUD A;  1K1Z A;  2D0Q B;  2P4R A;  3VJP A;  3LWH A;  3O8V A;  4FT2 A;  4M4Z A;  1AWO A;  3G71 Q;  3T9N A;  5CKD A;  4M77 B;  2R5A A;  1B34 A;  3FEO A;  4LDV A;  2NUP B;  3VYG A;  2HNI A;  3KBG A;  1KHI A;  2JXB A;  1I4K 1;  4M78 E;  4B9W A;  5LJ5 g;  3QWX X;  2OTL T;  1X6B A;  2DTI A;  4JS4 A;  1UGV A;  3HSB A;  1D1A A;  1UGP B;  4RTW A;  1W4S A;  2COZ A;  2KRO A;  1E6H A;  1Q7Y R;  4P5N A;  2A7Y A;  2M0O A;  1Y96 A;  4ZGJ B;  3FIF A;  4F04 B;  3BY7 A;  2RJF A;  2ZCF B;  3CCR Q;  3I55 A;  4XTV A;  4J9F A;  4XTU A;  4C0D C;  4RTX A;  4PJO C;  2CDT A;  3CME Q;  4DOV A;  2ATC B;  3G1J A;  4FM4 B;  1JQQ A;  1QKW A;  3JB9 J;  4M7D A;  2EFI A;  2R58 A;  3OW2 A;  4GBQ A;  3OQ5 A;  2MPX C;  1NG2 A;  1KJW A;  1WHG A;  2DXT A;  5A0L A;  2VV5 A;  1OEB A;  7AT1 B;  4KH0 B;  5D6Y A;  2Z0W A;  4PJJ A;  1MNE A;  5KE3 A;  3LH5 A;  1JJ2 S;  1ARK A;  3CCU A;  1AZE A;  3CPW S;  4EMK B;  2AK5 A;  2LRQ A;  4E7J A;  4FSS A;  3DKM A;  3I56 Q;  2RQW A;  4JRQ A;  1MV0 B;  1VQ8 A;  2RHY A;  2EYX A;  3EH1 A;  4XTZ A;  3LGF A;  3CD6 Q;  4E7I A;  5LJ5 h;  3OYI A;  2HD0 A;  3EFR A;  1YHQ A;  4L59 A;  3I5S A;  3LX7 A;  5FU6 C;  2JTE A;  2HMA A;  2OAW A;  3OYF A;  2CP5 A;  3KFV A;  4ZN3 A;  2HKQ B;  1M1K R;  2V1R A;  3QDR B;  2HL3 A;  2DE0 X;  1UHF A;  5FWB A;  1ZSZ A;  3OA6 A;  2J6K A;  4FW1 A;  2HSE B;  1NLP C;  5GMK e;  3CMA Q;  2K9G A;  1M90 U;  2EVR A;  1RAF B;  1WQW A;  1S72 A;  3OSV A;  2D9T A;  2VC8 A;  4JRK A;  2LT1 A;  4J9B A;  1R77 A;  4IUP A;  3UF4 A;  3M5A A;  1KK7 A;  5GAN g;  1LJO A;  2LCL A;  4BY6 C;  2CUB A;  5CQX A;  2XD0 A;  1IGQ A;  4JLG A;  3HFO A;  3LW5 E;  4CRI A;  2JMA A;  1SKU B;  4E47 A;  4IKF A;  3JB9 H;  2K79 A;  3I9Q A;  2CZ0 B;  1NJI R;  4OMM A;  1VQ9 A;  1VQN T;  1BIB A;  3HHT B;  3UDC A;  2L3P A;  3SWN C;  2KYB A;  1YFN A;  1O9S A;  3QYG B;  2RPN A;  1ACM B;  1WFW A;  2MAM A;  1WDX A;  2ED0 A;  2QA4 Q;  2PVG B;  1QP2 A;  3GF5 A;  4C8Q C;  1DJ7 B;  2HCK A;  4MZP A;  3C4S A;  1ZUU A;  3NTK A;  4DEX A;  2X3W D;  4RCB A;  4RTT A;  2IG0 A;  1BCM A;  1BI3 A;  3TCJ A;  3VU3 C;  3A98 A;  8AT1 B;  1FMV A;  2KE9 A;  3G6E T;  1Q95 G;  2E5K A;  2E70 A;  4GLK A;  4D8K A;  2DM1 A;  1W2B P;  1Q81 R;  2OTL A;  5FWC A;  4M7D F;  4PKC C;  2E6Z A;  5KCO A;  2M16 A;  1O75 A;  4AFZ C;  2YUP A;  3M0U A;  1K76 A;  1JB0 E;  4HKE A;  5I2S A;  2RJD A;  5KYW A;  5GAN h;  1AT1 B;  1XQH A;  1PM3 A;  1PKT A;  1YIT Q;  2QGG A;  5CQY A;  4DOW A;  5LJ3 d;  2HDA A;  2YUQ A;  3PIP A;  1M8V A;  2RD1 A;  4WTO B;  1OUL A;  3N5B B;  2C0T A;  2QEX T;  1PHT A;  3QO3 A;  4PJN A;  1QVG S;  1C6V X;  2RMO A;  2KDS A;  4IUR A;  2X3X D;  1NM7 A;  2J6F A;  2VXE A;  2KAF A;  1JRI A;  5GAN 4;  1G3T A;  1QVP A;  3REB B;  5CCA A;  3HP9 A;  3CPF A;  1XJW B;  2F2V A;  1KG1 A;  3EHQ A;  4M7D G;  1D3B B;  2DL8 A;  3VS1 A;  1M90 C;  1GRI A;  1UUE A;  3CCM T;  1U3O A;  4XTW A;  5D6X A;  3CC4 A;  1YJN T;  3GP8 A;  3RMQ A;  4BY6 B;  4KUD K;  1NYG A;  1D0X A;  2AT1 B;  3CCJ A;  4PK4 A;  3RKW A;  4XU0 A;  3P8H A;  3EHR A;  2OTJ T;  2GGR A;  2L0A A;  2KT8 A;  2Y4X A;  4J6X A;  5L23 A;  1LCK A;  4QT7 A;  4AFU C;  2JS2 A;  2DMO A;  4B9X A;  4L5G A;  5A0D A;  1HXD A;  1OYX A;  4ELZ C;  5FRO A;  1FMW A;  2XDP A;  4WF2 A;  4BE1 A;  2KK4 A;  3MEU A;  2GFA A;  5LJ5 d;  2L89 A;  3UA6 A;  2HKN A;  2A08 A;  4RMO A;  2E4H A;  4PJO A;  3X25 B;  1OPL A;  4JS5 A;  3CC2 T;  3JB9 F;  5I2M A;  3C0C A;  3H0I A;  2QQA A;  3RDV A;  1OX9 A;  3S6W A;  4J9H A;  2O4X B;  1N27 A;  3GBQ A;  2EGC A;  4JZ4 A;  3JCM d;  4M7A B;  2KYM A;  3VS5 A;  2BIV A;  3RBB B;  2A37 A;  3C95 A;  2CZ7 B;  2JN0 A;  1U8R A;  2DYI A;  4A53 A;  3QKJ A;  3G4S T;  4OMN A;  8ATC B;  1VA7 A;  1PCX A;  4FYY B;  2I2L A;  3M0S A;  5HCK A;  3OS5 A;  3CCS T;  4M77 G;  5M9O A;  3NGP A;  1YWP A;  4QQD A;  3V7R A;  3MP6 A;  4OF1 A;  4PFZ A;  1QCO A;  5GAM f;  5CAI A;  1VQN A;  2G3R A;  1V1C A;  1KQS A;  1FXX A;  1WQ7 A;  1VQ4 Q;  1W70 A;  3OYC A;  3LH0 A;  5HK0 A;  1K9M U;  1VQM T;  2IIM A;  1JXM A;  1OZ2 A;  1VQL Q;  1D1C A;  4DQ2 A;  2BZY A;  2K5F A;  3JB9 G;  2Y90 A;  3HKS A;  3M0T A;  2DXC A;  5GAM e;  4QKU A;  3CCQ Q;  5J39 A;  2PQW A;  4AFQ C;  2O9V A;  4M7D D;  3ULR B;  1QLY A;  3FJ5 A;  1QWE A;  3QZ5 B;  3H6Z A;  3O5Z A;  3H0H A;  4C92 B;  4XTX A;  3R6O A;  2VYT A;  1PRL C;  2J6O A;  4NL2 A;  3QDF A;  3R6N A;  1C0M A;  2YXY A;  2K4Y A;  2GTO A;  2RI2 A;  4E6R A;  1H92 A;  3V7C A;  3AT1 B;  1AVZ C;  5GAO p;  1T0J A;  1Y7X A;  2KNB B;  4Z02 A;  3CCS Q;  1RAD B;  2DL4 A;  1QW1 A;  2JM9 A;  5KYX A;  1G83 A;  4QQ6 A;  1YI2 T;  5GAO l;  2G6F X;  1TTH B;  4RG2 A;  4XAX B;  5J26 A;  3DLM A;  1PWT A;  2K2M A;  2CZ6 B;  2JJ9 A;  1VQO Q;  1YN8 A;  4OGE A;  4FYV B;  3DB3 A;  3EGX B;  1K0X A;  1Y71 A;  4J7I A;  5CO7 A;  1BCO A;  2CP6 A;  5GAN d;  4QVZ A;  2J06 A;  4FL6 A;  2EYW A;  4M7D E;  4Y28 E;  1YJ9 T;  1BU1 A;  3A8L B;  4QQG A;  4C8Q A;  4N0A A;  1PNJ A;  3GPL A;  5FW9 A;  4N4H A;  5GAN 2;  1EZZ B;  1KHC A;  5D6W A;  2GNC A;  4OB0 B;  1YJN A;  2K57 A;  4RTY A;  2RA2 A;  4DEY A;  2YLC A;  5CK9 A;  2JTF A;  2RQT A;  2RNA A;  4PJO F;  2D0N A;  1ZHI A;  2XIC A;  4TVR A;  1M2V B;  2KGT A;  4RTZ A;  4KT0 E;  1UE9 A;  1VQ6 T;  4ZN1 A;  2H8H A;  2DVJ A;  2FRW A;  3L42 A;  1OPK A;  4J9C A;  4J9G A;  1R0C B;  1YCY A;  2QXF A;  3CCE A;  1YIJ A;  2A28 A;  1T3L A;  2PUO B;  1TU0 B;  2QQS A;  1NEG A;  1VQ5 T;  4BDY A;  1E7O A;  2FG0 A;  3LLR A;  1ZSG A;  2CP0 A;  4GLM A;  1A0N B;  3G71 T;  2W10 A;  3MJX A;  2L3Q A;  4EMK C;  1ZBJ A;  1K9M C;  3EG1 A;  2V26 A;  2Y4Y A;  1VQ7 T;  1M4Z A;  3OYY A;  2K3Y A;  2L3R A;  2YDL A;  1KQ2 A;  3VS0 A;  2EQU A;  2CT4 A;  3NMZ C;  1CKB A;  4M75 B;  3X24 B;  2EJF A;  2BZ8 A;  4PJO G;  3M0P A;  1U5S A;  5GMK h;  2DJZ A;  1IRX A;  3G7Z A;  4BAC A;  1IZ6 A;  4RTV A;  2LQ8 A;  4YTL A;  3M55 A;  4J6W A;  1VQ8 Q;  2QDY B;  3CCR T;  2K6D A;  3JSC A;  4RG8 A;  1UFF A;  4V2S A;  1YHQ Q;  1JEG A;  1JO8 A;  1K9A A;  2CKK A;  1KFZ A;  4AG1 C;  2ZPE B;  2LC4 A;  4EDU A;  1RI0 A;  2VGM A;  1ZSZ B;  1NPP A;  2LT4 A;  3KXT A;  2EQK A;  1VQM A;  2ZPB B;  5EG2 A;  9ATC B;  3CBO A;  3UPU A;  1VQ7 Q;  1V76 A;  3L2Z A;  1ZBX A;  4LDY A;  3I35 A;  5FU7 B;  2FO0 A;  1G5V A;  2F1L A;  1UG1 A;  2EGA A;  4OB3 B;  1K8A R;  2PUK B;  1UB4 A;  3C12 A;  3F70 A;  4J8O A;  1VIE A;  4EPC A;  3I56 T;  3MO8 A;  1VQP A;  2HL5 C;  2FPD A;  1AZG B;  1OI1 A;  2PZ1 A;  2JT4 A;  3WVD B;  4N4G A;  3A8G B;  3CD6 T;  1MMA A;  1QKX A;  3VRZ A;  3TSW A;  4BE2 A;  2XHC A;  1M1G A;  1K4U S;  3MKD A;  4IUU A;  1W2B A;  2E5Q A;  3PVQ A;  2XKO C;  3M56 A;  3E9G A;  4C8Q F;  2MOX A;  1ZA2 B;  3UA7 A;  2E1H A;  4M78 B;  2DRM A;  2KT1 A;  4KUL A;  5CKB A;  3NPF A;  2O01 E;  1AWJ A;  2LQN A;  4OMF B;  2SEM A;  1JBM A;  1N8R R;  1BYM A;  1M1F A;  2DX1 A;  3CMA T;  3H0F A;  5GAO r;  2DFU A;  1Q86 U;  3QYH B;  4MMK A;  3ZEH A;  1YJ9 A;  3EG9 A;  3MPU B;  3E9F A;  4BE0 A;  2M0Y A;  1FWZ A;  5DLO A;  3EFS A;  4RKU E;  2GQV A;  2E64 A;  1F1B B;  4PJO D;  2K2V A;  1UTI A;  2KRN A;  1M9S A;  2K3X A;  1NZ9 A;  2EWN A;  1Z9Z A;  3QXE B;  1OX8 A;  1T3S A;  1ZLM A;  1IHW A;  3HRS A;  1MMG A;  5KYW B;  1BI0 A;  1PSF A;  1KC8 R;  1X2Q A;  1MV3 A;  1WXU A;  4C8Q G;  2VVK A;  3CCV A;  4O5V A;  3S3N A;  1SRL A;  3KUF A;  1QCF A;  2MIO A;  5LL6 S;  3M53 A;  4C5H A;  3A8H B;  3TVT A;  4II1 A;  2EKO A;  2DVE A;  2B8A A;  1JJ2 P;  3CPW P;  2QA4 T;  1VQ5 A;  1CKA A;  1QQJ A;  1WYX A;  4R0K A;  3QUI A;  3RMS A;  2QTV A;  1S1N A;  3EGD B;  1BIA A;  4DBF A;  4JRP A;  1WHM A;  3M4Y A;  3CCL T;  4HVW A;  2QYZ A;  3MEA A;  3HTR A;  3J81 E;  4K11 A;  4JRI A;  4LXC A;  2D1X A;  1Q82 R;  1MUZ A;  4M77 A;  5GAM g;  2NUP A;  2E65 A;  2CSQ A;  4PJO E;  2D8H A;  3U23 A;  2YUN A;  1WIE A;  3SD4 A;  1B3Q A;  4ATO A;  1D0Y A;  2PNI A;  3CC4 Q;  2QK0 A;  1SHG A;  1YIT T;  4JZ3 A;  2DXB A;  1KD1 U;  1MND A;  2LJ0 A;  2WAC A;  3VRY A;  5LJ3 f;  3JRZ A;  5A2Q E;  1QWF A;  3CCJ Q;  2HQX A;  2O31 A;  5CIU A;  2HBP A;  3CME A;  5GAO q;  3L2Q A;  4A54 A;  1QVF A;  1H8K A;  2ZPF B;  1YNZ A;  5DLQ E;  5LJ3 j; 
#chains in the Genus database with same CATH homology
 1YI2 A;  2MMP A;  4LDU A;  2O4X A;  4JJN K;  4JS5 A;  2CZ1 B;  3OW2 S;  3CC2 T;  4C92 G;  3J80 E;  5GAO n;  4HT8 A;  2E6N A;  1M5Q 1;  5I2M A;  4J7F A;  3SB2 A;  5LJ3 e;  3AHU A;  1VQK A;  2QQA A;  2M9U A;  1N8R C;  2RI3 A;  3S6W A;  3JCM g;  2V8J A;  1XOV A;  2E10 A;  3OYN A;  1Q81 C;  5CR2 A;  3FDR A;  3M9Q A;  2O4X B;  1N27 A;  3E19 A;  4L6V 5;  5CKE A;  3JCM d;  4M7A B;  3CBP A;  2BIV A;  4A4H A;  1X75 C;  4FIB A;  3M4G A;  4M75 E;  1HK9 A;  3C95 A;  4M7A C;  3CCV T;  2CZ7 B;  3L1A A;  2JN0 A;  4XU1 A;  4C5G A;  1U8R A;  4M7A F;  1Q86 C;  4JLI A;  4F7U G;  3ZFJ A;  3QKJ A;  4A53 A;  1X6O A;  5I21 A;  3G4S T;  3OMG A;  4MDW A;  3UWN A;  1VQL A;  3PNW C;  4EMK A;  2X4J A;  2I2L A;  5IT9 E;  2HQE A;  1OZ3 A;  2VUB A;  3OS1 A;  3OS5 A;  3CCS T;  1U1T A;  3CCQ A;  4M77 G;  3SFM A;  5M9O A;  5GMK i;  2RJC A;  4QQD A;  3V7R A;  3MP6 A;  4OF1 A;  1I8F A;  5GAM f;  5GAM h;  5CAI A;  1VQN A;  1WJS A;  2G3R A;  1WGS A;  4PLL A;  2JTM A;  1KQS A;  1KC8 C;  4C8Q D;  1FXX A;  1WQ7 A;  2F69 A;  1I5L A;  2YLB A;  3FB9 A;  4MML A;  2FHD A;  3P8B B;  3LWI A;  3OYC A;  3LH0 A;  1S72 T;  5HK0 A;  2GF7 A;  4XU2 A;  1H64 1;  4M75 A;  1K9M U;  2F5T X;  1KQ1 A;  3PT9 A;  4HA8 A;  2V8K A;  1VQM T;  3CC4 T;  2EQM A;  5KH6 A;  4M78 D;  1VQ6 A;  2HAX A;  1OZ2 A;  4OVA A;  2ZPG B;  3OS2 A;  1N9R A;  4DQ2 A;  2K5F A;  3JB9 G;  2Y90 A;  3HKS A;  1K73 U;  3X26 B;  2DXC A;  4XK8 E;  3VV0 A;  5GAM e;  3CCJ T;  2D6F A;  2RK2 A;  4GY5 A;  2PQW A;  3OSS C;  5J39 A;  3MEV A;  3VUB A;  4KUI A;  4BUG A;  4M7D D;  3HL8 A;  3ER0 A;  3PMI A;  3TRE A;  4EMH A;  3V8L A;  5CVI A;  2PVD B;  5J3B A;  3DLL A;  3QZ5 B;  3OYD A;  2DIG A;  4ZGD B;  3CMA A;  3H6Z A;  4DA4 A;  5LJ5 j;  4OGC A;  3WXM B;  3OB9 A;  4C92 B;  4C0F A;  2KQW A;  3LYI A;  3FJP A;  4XTX A;  1QVG A;  3R6O A;  2VYT A;  3MET A;  4NL2 A;  4HCC A;  4J83 A;  2AHJ B;  2X35 A;  3OS0 A;  5GMK l;  4C92 C;  4NOY A;  4C0G A;  2ZGW A;  3G71 A;  3JCM J;  1VQO A;  3RER A;  4M7A G;  4C92 F;  4ZGE B;  5HKC A;  2CYZ B;  3JCM b;  4BDZ A;  2K4Y A;  4FU6 A;  1Q82 C;  2DZC A;  1VQ9 T;  5KCH A;  3MCA B;  2RI2 A;  1FX7 A;  5GMK j;  2F5K A;  1QP3 A;  3V7C A;  3JCM f;  3JCM h;  3UT1 A;  1VQ7 A;  3JCM P;  5GAO p;  4OP0 A;  4HCZ A;  1N9S A;  2JUF A;  1Y7X A;  1G3W A;  3CME T;  4HT9 A;  4Z02 A;  3CXC A;  2XID A;  1BI2 A;  5C0M A;  4XU3 A;  1MGQ A;  1QW1 A;  4KBM B;  3JCM W;  1UEB A;  4QQ6 A;  2EIF A;  1YI2 T;  2D0Q B;  5GAO l;  4RG2 A;  4XAX B;  5J26 A;  3RIR A;  3VJP A;  5GAN 3;  3DLM A;  1N6A A;  3LWH A;  2CZ6 B;  3O8V A;  4FT2 A;  4C8Q E;  4F7U F;  2CS7 A;  3T9N A;  3TEE A;  5CKD A;  4OGE A;  3QSU A;  4M77 B;  3DB3 A;  4BD3 A;  2R5A A;  3JAM E;  3PMT A;  3JCM e;  1B34 A;  3FEO A;  3QBY A;  4LDV A;  3VYG A;  2QI2 A;  3HRU A;  2HNI A;  3KBG A;  1KHI A;  2MF2 A;  4BI8 B;  2XDD A;  1I4K 1;  2JNG A;  1Y71 A;  4M78 E;  4M77 F;  3OYA A;  4J7I A;  3M59 A;  5CO7 A;  4B9W A;  1RL2 A;  1Y07 A;  5LJ5 g;  1Q7Y U;  1K8A U;  1KD1 C;  2PVO B;  2OTL T;  2DTI A;  5GAN d;  4JS4 A;  4QVZ A;  3HSB A;  1VQ4 T;  4FL6 A;  1UGP B;  1W4S A;  4E7K A;  3OYJ A;  2QA4 A;  3ZBD A;  3QHS A;  3SDZ A;  3CCR A;  4M7D E;  4Y28 E;  4P5N A;  4M75 G;  1W2B S;  2RI5 A;  1YJ9 T;  2RK1 A;  3A8L B;  3OYK A;  2A7Y A;  2L8D A;  2GCX A;  2M0O A;  1Y96 A;  2ZPI B;  4ZGJ B;  2KSS A;  1VQL T;  3OYB A;  4QQG A;  3FIF A;  4C8Q A;  4N0A A;  4LDX A;  2DTH A;  3BY7 A;  3GPL A;  4N4H A;  5GAN 2;  1KHC A;  5D6W A;  3CCQ T;  4Q5W A;  2JOY A;  2RJF A;  3VKI A;  2ZCF B;  3FRN A;  4C0D B;  4OB0 B;  3TU4 K;  1YJN A;  2R57 A;  2K57 A;  2GFU A;  2H3J A;  4XTV A;  3I55 A;  4PJO B;  3CC7 T;  2RA2 A;  4M78 A;  4XTU A;  3A8M B;  4C0D C;  5AYF A;  2XK0 A;  3QG1 A;  2YLC A;  2EYQ A;  2JTF A;  5CK9 A;  1YJW T;  4PJO C;  4DOV A;  2DO3 A;  4PJO F;  4FM4 B;  4TVR A;  1ZHI A;  2MWP A;  2XIC A;  3L2V A;  2DKG A;  2K5L A;  3JB9 J;  4N0A C;  4E7L A;  2QTX A;  4M7D A;  3P8D A;  2EFI A;  2QQR A;  4KT0 E;  1VQ6 T;  2R58 A;  4ZN1 A;  3OW2 A;  3OQ5 A;  3L42 A;  3I56 A;  1AHJ B;  3JB9 F;  2FL7 A;  2XDB A;  2DXT A;  1I81 A;  5A0L A;  5GAN 7;  4N4I A;  1YCY A;  2VV5 A;  3CD6 A;  3ME9 A;  3INZ A;  2QXF A;  3CCE A;  1YIT A;  3NTI A;  1YIJ A;  1WJR A;  2PUO B;  5D6Y A;  2QQS A;  2P0K A;  3QJ6 A;  3OYM A;  5KE3 A;  1VQ5 T;  4BDY A;  3WVE B;  1BKB A;  3LLR A;  1JJ2 S;  3CCU A;  3CPW S;  4EMK B;  3A5Z B;  2LDM A;  3CBM A;  3HPW A;  2LRQ A;  3G71 T;  1VQO T;  5CKH A;  3BDU A;  4E7J A;  3DKM A;  4EMK C;  2RHI A;  1K9M C;  4JRQ A;  2Y4Y A;  1VQ7 T;  1M4Z A;  3OYY A;  1VQ8 A;  2K3Y A;  2RHY A;  2KMT A;  2L3R A;  4XTZ A;  3LGF A;  4J6Y A;  1KQ2 A;  4E7I A;  2DPP B;  5LJ5 f;  5LJ5 h;  3OYI A;  1K73 C;  2HD0 A;  3EFR A;  1YHQ A;  2EQU A;  1IRE B;  4L59 A;  4MDX A;  5IN1 A;  5FU6 B;  4M75 B;  3X24 B;  2EJF A;  2LX9 A;  3JCM c;  3LX7 A;  2OAU A;  3JCM V;  3G6E A;  2JZ2 A;  5FU6 C;  4M75 C;  1NE8 A;  2YRV A;  5GAN j;  4ZTJ A;  1M1K U;  4PJO G;  4M7A D;  4PNO A;  4M75 F;  3X20 B;  2RO0 A;  5GMK h;  2DJZ A;  3OYF A;  3G7Z A;  4BAC A;  2RM4 A;  1IZ6 A;  3E1S A;  5FRM A;  2LQ8 A;  4YTL A;  3M55 A;  2YHT A;  4ZN3 A;  2C06 A;  4J6W A;  3QDR B;  4JUV A;  1WJQ A;  4NL3 A;  2QDY B;  3CCR T;  5LJ5 e;  3PTA A;  3JSC A;  3J7A F;  4LD9 K;  1D3B A;  4RG8 A;  4V2S A;  3M54 A;  4M78 G;  2A3L A;  4C0Z A;  3FC3 A;  3JCM Q;  3OA6 A;  4A4G A;  3MHX A;  2MWO A;  1PSE A;  2LNV A;  4XQ3 A;  2CKK A;  3L2U A;  2KVQ G;  5GMK e;  1UGQ B;  2NLU A;  2ZPH B;  3S3M A;  1M90 U;  4NS5 A;  2QQB A;  2LC4 A;  2ZPE B;  4EDU A;  2DAQ A;  4QW2 A;  1RI0 A;  5HK3 A;  2VGM A;  3NTH A;  1WQW A;  2FB7 A;  1S72 A;  1NPP A;  3OSV A;  2QEX A;  2D9T A;  2LT4 A;  2P0Q A;  2EQK A;  2LT1 A;  2VC8 A;  4FSX A;  4JRK A;  4D6W A;  3KXT A;  1VQM A;  1GXI E;  2XU8 A;  2ZPB B;  5EG2 A;  3V7S A;  1VQK T;  4IUP A;  2L5Q A;  3CBO A;  4QVD A;  3UPU A;  3S3O A;  4IUV A;  3M5A A;  5GAN g;  1LJO A;  4X34 A;  2LCL A;  3RUX A;  1U1S A;  4BY6 C;  4ELY C;  3L2Z A;  4PL6 A;  5CQX A;  2XD0 A;  1ZBX A;  2LQK A;  3MEW A;  4LDY A;  2VGN A;  4MZM A;  5FU7 B;  1Q7Y C;  3PIO A;  4JLG A;  3HFO A;  1G5V A;  3LW5 E;  5GAM d;  1B34 B;  3SWN A;  3BW1 A;  4OB3 B;  5FU7 C;  1QVF S;  4CRI A;  1NJI U;  4C92 D;  2PUK B;  2CGH A;  4Y91 A;  1UB4 A;  3C12 A;  3F70 A;  4J8O A;  1VIE A;  3VYH B;  2BKD N;  3EAE A;  4A4F A;  4EPC A;  3MO8 A;  4E47 A;  3I56 T;  1VQP A;  4M7A E;  4IKF A;  1OI1 A;  3VUZ A;  3OBW A;  3JB9 H;  3WVD B;  4N4G A;  2CZ0 B;  2DZ9 A;  3A8G B;  3RKX A;  3CD6 T;  3CCM A;  3CCE T;  3GLX A;  2WSF E;  1YIJ T;  5GMK m;  3CCL A;  2E12 A;  3SWN B;  5GAN 5;  5FRN A;  1SSF A;  1VQ9 A;  3QZ9 B;  2LVM A;  4BE2 A;  1VQN T;  1BIB A;  2XHC A;  3HHT B;  3UDC A;  1WNL A;  3SWN C;  2RH2 A;  1M1G A;  1X01 A;  1Y96 B;  3CCU T;  3CEY A;  2LTO A;  1O9S A;  3QYG B;  4C8Q B;  2DEQ A;  2DD5 A;  2WSC E;  2WSE E;  4IUU A;  2E5Q A;  1R8O B;  2MAM A;  3BDL A;  1W2B A;  2EJG A;  2OTJ A;  2PVG B;  2XKO C;  1QP2 A;  3GF5 A;  4C8Q C;  3M56 A;  2LCC A;  3E9G A;  4C8Q F;  1DJ7 B;  1VQ8 T;  2E1H A;  3FLG A;  4M78 B;  4MZP A;  5GAO m;  4BI4 A;  4LDW A;  3C4S A;  4M7A A;  4M77 D;  4KUL A;  4PLI A;  5L8R E;  3NTK A;  4E7H A;  1N8R U;  1YHQ T;  4M78 C;  5CKB A;  4ZTF A;  4ME7 A;  4RCB A;  1Q81 U;  2IG0 A;  3HRT A;  4M78 F;  2O01 E;  2QQ9 A;  4C5E A;  2M1H A;  4OMF B;  5GAN 8;  1ZQ1 A;  1BI3 A;  3TCJ A;  3VU3 C;  4M7D B;  4OB1 B;  1JBM A;  3OYG A;  3G6E T;  1BYM A;  1M1F A;  3CMA T;  2MI6 A;  2E70 A;  4GLK A;  3OYH A;  2OTL A;  4M7D C;  4A4K A;  4M7D F;  1VUB A;  2E6Z A;  4PKC C;  5DY9 A;  5GAO r;  1VQ4 A;  1KQS S;  5C6S A;  5KCO A;  2M16 A;  2KY9 A;  2DD4 A;  1O75 A;  5CKF A;  1Q86 U;  3QYH B;  4A4E A;  3JB9 D;  4X9C A;  3Q1J A;  2DIQ A;  4MMK A;  3ZEH A;  1YJ9 A;  3JB9 I;  2X4Y A;  4XTY A;  3ASK A;  3PGG A;  3E9F A;  1JB0 E;  4BE0 A;  1WPY A;  1G3S A;  4HKE A;  4MZT A;  4C92 E;  5I2S A;  1FWZ A;  5DLO A;  3OBY A;  3EFS A;  1YBY A;  4RKU E;  2RJD A;  3CC2 A;  1EIF A;  5GAN f;  5GAN h;  3NFC A;  3M58 A;  4FT4 A;  1XQH A;  1UGR B;  2E64 A;  2GQV A;  3RKY A;  2X4X A;  5GAN 6;  2DTO A;  5LJ3 g;  4PJO D;  3C94 A;  2K2V A;  1BI1 A;  1KC8 U;  1M9S A;  5DM7 R;  2K3X A;  1NZ9 A;  2EWN A;  3LGL A;  5CQY A;  2PU9 B;  5HY6 A;  3QXE B;  4DOW A;  4EMG A;  1LNX A;  3DB4 A;  5LJ3 d;  3CPW A;  1JJ2 A;  3PIP A;  1M8V A;  1YJW A;  2RD1 A;  3HRS A;  3N5B B;  3MP1 A;  2RHX A;  4VUB A;  1PSF A;  1BI0 A;  2QEX T;  1M1K C;  5GAM j;  3QO3 A;  4O6J A;  3V8K A;  1QVG S;  3QJY A;  4C8Q G;  4J5Y A;  2FYK A;  4F7U E;  4IUT A;  3CCV A;  2VXF A;  2KDS A;  4IUR A;  4O5V A;  3S3N A;  4HCB A;  3L2R A;  5GAN e;  3KUF A;  3X25 B;  3HFN A;  4C92 A;  3G4S A;  2VXE A;  5LL6 S;  3M53 A;  2KAF A;  1JRI A;  4C5H A;  1H3Z A;  2RHU A;  5GAN 4;  1G3T A;  1QVP A;  3A8H B;  4M77 E;  4II1 A;  2EKO A;  1P92 A;  5CCA A;  2DVE A;  4RCC A;  3CCS A;  2B8A A;  1NPR A;  3HP9 A;  2QA4 T;  3CPF A;  2R5M A;  2RHZ A;  3CXC S;  1VQ5 A;  2EAY A;  4OB2 B;  2DK3 A;  2JVV A;  3QUI A;  2RB6 A;  3RMS A;  3OYL A;  1KG1 A;  4M7D G;  3GNG A;  1VQP T;  1D3B B;  1G3Y A;  2ZZD A;  1BIA A;  3A8O B;  2P0P A;  4X9D A;  4JRP A;  1M90 C;  3RES A;  3X28 B;  3CC7 A;  3CCM T;  3MP8 A;  3M4Y A;  3H8Z A;  4IUQ A;  1Q82 U;  4F7U A;  5IAY A;  4UC4 A;  4XTW A;  3CCL T;  5D6X A;  1MHN A;  3MEA A;  3CC4 A;  1YJN T;  4CI0 C;  3J81 E;  4JRI A;  3RMQ A;  4BY6 B;  2FVU A;  3I55 T;  3GP8 A;  4KUD K;  5A0G A;  2P4T A;  1V29 B;  3M57 A;  3CCJ A;  3QPH A;  4M77 A;  1LOJ A;  4M75 D;  5GAM g;  3RKW A;  4XU0 A;  3P8H A;  3QII A;  2X4W A;  1K8A C;  2OTJ T;  4F7U B;  3GIB A;  1VIF A;  2E65 A;  4PJO E;  5FLX E;  2K5I A;  2RJE A;  2DXU A;  2XI9 A;  2Y4X A;  4J6X A;  4QVC A;  3SD4 A;  3OMC A;  1TH7 A;  1XTD A;  4JDS A;  1NJI C;  4BI3 A;  4ATO A;  3URG A;  2V8I A;  4B9X A;  4L5G A;  3PFS A;  5A0D A;  3L2W A;  1HXD A;  1UGS B;  4M77 C;  1OYX A;  4ELZ C;  2DXB A;  5FRO A;  1YIT T;  2WAC A;  1KD1 U;  5LJ3 f;  3JRZ A;  2XDP A;  5LJ3 h;  4LD6 A;  5A2Q E;  2XG8 D;  4WF2 A;  2E41 A;  4BE1 A;  2KK4 A;  3OY9 A;  2HQX A;  4BB7 A;  3MEU A;  3GOX A;  4R55 A;  2GFA A;  5CIU A;  2HBP A;  5LJ5 d;  3CME A;  5KE2 A;  1XNI A;  2L89 A;  5GAO q;  2EQJ A;  3GNF B;  4A54 A;  4R56 A;  3V8J A;  4RMO A;  3BFM A;  3L2Q A;  1QVF A;  2ZPF B;  2BUD A;  5DLQ E;  5LJ3 j;  4C5I A;  4PJO A;  2EJ9 A;  3OYE A;  2IVW A;  3JCM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...