3M0UA

Crystal structure of the r21d mutant of alpha-spectrin sh3 domain. hexagonal crystal obtained in sodium formate at ph 6.5.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
GKELVLALYDYQEKSPDEVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Spectrin alpha chain, brain
publication title Understanding the polymorphic behaviour of a mutant of the alpha-spectrin SH3 domain by means of two 1.1 A structures
rcsb
source organism Gallus gallus
total genus 12
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3m0uA00
3SEMA 2FRWA 1ZX6A 2CH4A 1GRIA 2PNIA 2I0NA 2EYYA 2LNHB 3IQLA 2J06A 1NLPC 3EHQA 2KNBB 2ECZA 4OMMA 2BZYA 4LNPA 1X43A 1U5SA 1RI9A 4R0KA 1OPLA 2RQUA 2YUPA 2DE0X 2ED0A 4ORZA 3C0CA 1UFFA 4AG2C 4WCIA 1BU1A 2EBPA 1YWPA 3SHWA 3U23A 2RQWA 4RTYA 2ABLA 2DRKA 2M51A 2KYMA 1W6XA 2EW3A 2DM1A 3H41A 3QWXX 3EG0A 4F14A 4LUDA 2YUOA 1X27A 2AKKA 5L23A 1NLOC 2MOXA 2DA9A 4F16A 1YCSB 1NM7A 1ZBJA 2DJQA 2F2XA 4QT7A 1ARKA 1JU5C 3UA6A 2PZ1A 1WXBA 2DLPA 2J6OA 2W10A 3VS4A 2KXCA 3ULRB 3KFVA 1Z9ZA 2LQNA 1HD3A 3UF4A 3H0HA 4JJCA 2V1QA 1W70A 1OV3A 4RTTA 1UHFA 2FPDA 2RQTA 1IO6A 3M0QA 4RTUA 1U06A 3A98A 5FW9A 1PKSA 1PHTA 2A36A 4M4ZA 2NUZA 2K2MA 2DL7A 4IIMA 1LCKA 2A28A 1NEGA 2IIMA 4AFQC 2G6FX 2BTTA 4ZNXA 4JJBA 2ESWA 3M0PA 4AFSC 1N5ZA 4OMPA 1M8MA 5IH2A 2J6KA 4Y92A 1QLYA 1WIEA 1T3SA 1B07A 2L0AA 3H0IA 1SSHA 1PNJA 3THKA 4JJDA 2O31A 2K3BA 5ECAA 4J9GA 2HEQA 1ZUYA 1GCQA 2O9VA 2H8HA 1FYNA 3NGPA 2OI3A 2CUBA 4GBQA 2JS2A 2L2PA 1WA7A 2YUNA 2YSQA 2LJ1A 3RNJA 2VVKA 1I0CA 2GNCA 4HVWA 2JXBA 2EYWA 1MV3A 2A37A 4RTWA 2JMCA 1AWWA 2K79A 1BK2A 3EHRA 1QKXA 3M0TA 2X3XD 4IIOA 1X69A 2F2WA 1MUZA 1M30A 2P4RA 3M0RA 1TUDA 2K7AA 2X3WD 2FPEA 4E6RA 2GBQA 1UDLA 2DVJA 4LUEA 4Z89A 1AEYA 2W0ZA 3VS6A 2BZ8A 2LJ3A 4AFZC 3TSZA 1EFNA 2KRNA 1AD5A 2GGRA 4OMNA 1GCPA 1WX6A 1E6GA 1X6GA 1PRMC 1WI7A 3NMZC 4KRTA 2EVRA 1G83A 1AVZC 2GTOA 1AZGB 2EGAA 4DEXA 2FG0A 1KSWA 2BZXA 1UJYA 2AZVA 4Z88A 1JXOA 2F2VA 1UUEA 1GBRA 1BB9A 2CDTA 2FPFA 1M3AA 3EG2A 1SPKA 1HSQA 1SHFA 2VWFA 2AK5A 2JTEA 3PVLA 2LP5A 4K11A 3VRYA 2K9GA 5GJVB 2HBWA 2CUDA 4RTZA 5IXBA 5IHNA 1UGVA 2EGCA 1WLPB 4J9HA 4EIKA 1GCQC 2KR3A 2DL5A 1M3CA 2RMOA 2C0IA 1K1ZA 2EPDA 1KJWA 2LZ6B 2DBMA 4AFUC 4CC4B 2DRMA 1UTIA 2FEIA 1W1FA 4J9BA 1YWOA 1ABOA 3UATA 4D8DA 2L3SA 3M0SA 4JZ4A 1WXTA 1VYTA 1VA7A 2O9SA 2NWMA 3REAB 5IHIA 1Y57A 1H3HA 2L3PA 1SHGA 1T3LA 3PE0A 2CT4A 1FMKA 1ZUKA 3I5RA 1TUCA 3VS3A 1PKTA 1YN8A 2DL8A 1JXMA 1K9AA 3NHNA 1WFWA 1ZUUA 5I22A 1HJDA 2DNUA 4DEYA 2ROTA 1UJ0A 1V1CA 3VS2A 2CREA 1A0NB 1RLPC 1RUWA 2CSIA 2EQIA 2LQWA 2O88A 1T0JA 2CT3A 3M0UA 1SEMA 1TG0A 1GFCA 2SRCA 1KIKA 2RPNA 1X6BA 1ZLMA 2DL4A 1GBQA 4RTXA 4J9CA 1M3BA 2DMOA 1K0XA 2L3QA 3H0FA 4AG1C 4CC7A 1XOVA 2YDLA 2KE9A 3QWYA 2JMAA 1NG2A 2DYBA 4CC3A 4FSSA 4OMQA 3NPFA 4LE9A 2XMFA 1G2BA 2JM9A 2E5KA 1J3TA 4RUGA 4HCKA 2V1RA 5EC7A 1GFDA 1MV0B 4J9FA 2VKNA 2KGTA 3PVQA 2ROLA 2KT1A 2RN8A 2M0YA 1AWXA 1Y0MA 1UECA 1WXUA 2KRMA 1QWEA 1YP5A 1PRLC 2KT8A 4CC2A 4LN2A 1X2QA 2QDLA 5IXFA 2PTKA 2HSPA 4Z8AA 3FJ5A 1U3OA 3O5ZA 2EYXA 2OAWA 4HXJA 2LJ0A 2YT6A 1B3QA 1KFZA 3EGUA 1NYFA 2DF6A 4OMOA 4X1VA 1I1JA 3I9QA 3EG3A 3VS1A 1K4US 5FWBA 2LCSA 1SRMA 2FO0A 2RQRA 2RF0A 2C0TA 1UE9A 2CSQA 1SRLA 1X2KA 2LMJA 2LX7A 4GLMA 3LH5A 1H92A 2CH4W 4F17A 2HDAA 3VS7A 2JT4A 2DILA 1GL5A 5FWCA 2MCNA 1S1NA 2O2OA 2RQVA 1JEGA 2KROA 2J6FA 2KYBA 2AKLA 4JZ3A 3TVTA 3RBBB 2KBTA 2K6DA 2D8HA 1WDXA 1K0SA 2KRSA 2MIOA 4J9IA 1YNZA 2ENMA 2A08A 2YUQA 3VRZA 2AZSA 3R6NA 3TSWA 3CQTA 1ZSGA 3VS0A 2EYZA 3ZL7C 1AWOA 2KEAA 2RNAA 2GTJA 4ESRA 1UG1A 2JW4A 1Z9QA 1QWFA 1OPKA 5HCKA 1NYGA 4HVVA 1WYXA 2DBKA 2J05A 1AWJA 4OMLA 1E7OA 1RLQC 2D1XA 2JS0A 1AZEA 3I35A 1QKWA 1BBZA 3UA7A 5GJWB 1PWTA 1QCFA 2DX1A 2SEMA 2ED1A 1AOJA 1VYVA 1I07A 2DL3A 2HCKA 4RTVA 2KXDA 1M27C 5I11A 3REBB 4JPBW 2D8JA 4J9EA 2JM8A 3I5SA 1UHCA 2C0OA 4A63B 1CKBA 1H8KA 1NEBA 1OEBA 4D8KA 1E6HA 1OOTA 3GBQA 1JQQA 2EGEA 4HVUA 1JO8A 2D0NA 4J9DA 2FRYA 2B86A 2EKHA 1CSKA 2OJ2A 2J7IA 1T0HA 3VS5A 5IHKA 1VYUA 2GQIA 3JV3A 3EG1A 1CKAA 1K76A 1ABQA
chains in the Genus database with same CATH superfamily
3SEMA 2CH4A 4M7AF 5M9OA 3MCAB 2PNIA 1WHLA 4M77C 4KULA 3A8HB 3EHQA 3CCQA 2MMPA 3CD6Q 4EMKB 4A53A 2IVWA 1RL2A 4LD9K 1OZ2A 4R0KA 1OPLA 2YUPA 5D6WA 3H8ZA 3NTHA 2NUPA 3C0CA 2XDDA 1IZ6A 4WCIA 1BU1A 2EBPA 1BKBA 1VQKQ 2RQWA 4RTYA 2DRKA 3QG1A 2MWPA 2KYMA 2DM1A 4F14A 1G3YA 3SFMA 2QQBA 4PJOE 3OA6A 3CC7A 2Y90A 4FW2A 4L5GA 4JJNK 2FB7A 5KH6A 1I81A 1RABB 2KXCA 1TXQA 3OYHA 1HK9A 4C0GA 2DIGA 1QVGA 2V1QA 4NL3A 3L2RA 3CCVT 1UHFA 2ZPBB 2RQTA 1IO6A 3OYLA 4BY6B 3CC4T 3AHUA 1MNEA 3MEWA 3I55Q 4M75E 4BDYA 3A98A 4M75F 4CRIA 3LLRA 5FW9A 2IPOB 2DL7A 2QQ9A 2IIMA 4C8QC 1VQMQ 3LW5E 5GAN4 3M0PA 3X26B 2D0QB 2J6KA 2RK1A 4OGCA 1N8RC 3HRUA 1B7TA 1PNJA 3JCMb 2K2VA 4IUPA 3LX7A 4JJDA 5ECAA 1X01A 4XU2A 4MZPA 1BYMA 3MP1A 1R8OB 1NJIU 1FYNA 1EX4A 1RAHB 4FYXB 2CUBA 1QVPA 4GBQA 2OTLQ 2YUNA 1B34A 5CR2A 4PJOD 1MV3A 2JMCA 1AWWA 3EHRA 2VUBA 4IIOA 2ZPHB 3Q1JA 3ZEHA 3EH1A 1WQWA 1M30A 2HBPA 1D0ZA 3G4ST 3M0RA 2X3WD 2K5IA 4E6RA 1VQ7T 1UDLA 4LUEA 4M7DG 4HCCA 1MMNA 1VQNQ 2KRNA 2DZCA 1AD5A 3G1JA 4WF2A 4R55A 1VQKA 4DBQA 1WX6A 4O5VA 2MWOA 5AYFA 2L8DA 2E41A 2EVRA 3JCMe 1G83A 3GIBA 3HKSA 4DEXA 1JXOA 1UUEA 3G71Q 3EG2A 2RA2A 4A4KA 2HNIA 3P8DA 4KH0B 1N8RR 1I5LA 1SPKA 1Q7YC 2JOYA 2VWFA 2KI7A 3OYGA 2HKNA 4BD3A 3JCMX 4EMKC 1RACB 1RI0A 1M2VB 4XAXB 2K9GA 4F7UB 3CMET 3CCJT 3L2ZA 3L1AA 1VQ9T 1IREB 3GF5A 3I55A 2L5QA 2EQUA 1BIBA 4A4GA 3JAME 1K1ZA 2JVVA 3CXCS 2EPDA 3JB9F 4IUTA 3CCEQ 3OBWA 2P4TA 1VQMA 1I5OB 1JBMA 2HKQB 1W4SA 3EFRA 4D8DA 4MDXA 3QO3A 1Y57A 1VQ5T 3PFSA 1SHGA 2HD0A 2F5KA 4LXCA 5C0MA 4UC4A 1RADB 5KYUA 1Y07A 1TUCA 1YN8A 4M7DB 1OZ3A 4LDYA 4F7UE 5KYWB 5LJ5f 3G6EQ 3JB9I 4PNOA 3J80E 2QYZA 2QI2A 3JSCA 2OTLA 3LH0A 3V8JA 1A0NB 3CCSQ 2FZKB 2EQIA 2LQWA 3OW2P 1T0JA 2H3JA 1MMGA 1Q7YR 3M0UA 1ZSZB 2AIRB 1VQ8Q 1KIKA 3JRZA 1YJNT 5D6XA 4XTYA 1KHIA 4ATOA 4M78B 5LJ5j 2OTJQ 4ZN3A 2YLCA 2VGMA 2V8IA 4AG1C 2QA4T 1AHJB 2QDYB 4QVDA 1S72A 2QASA 2YDLA 2R5AA 2QEXQ 1NG2A 2DYBA 4CC3A 1NPRA 1VQNA 4OMQA 1QVFA 2KMTA 5A0GA 8AT1B 1VIFA 2PUKB 5LJ5g 1PCXA 3KBGA 3UWNA 1HYOA 5HK3A 1GFDA 1VQLA 4J9FA 2RB6A 4C92B 1MMDA 1M8VA 1F1BB 3G71A 2M0YA 2QGGA 1AWXA 1X75C 1WXUA 3M59A 3OYAA 2CGHA 1QWEA 5KYXA 1P92A 1YP5A 1PRLC 4LN2A 4RCBA 3RESA 2PTKA 2HSPA 2LNVA 3ZBDA 4M78E 4Z8AA 2E12A 5GMKj 2XG8D 2LJ0A 2YT6A 1KFZA 3DB3A 2LC4A 3EG3A 3CCEA 3CMAT 4RKUE 1MGQA 3HL8A 2FO0A 2RF0A 3TCJA 2K5FA 2CSQA 2PVOB 1YJWA 1X2KA 2LX7A 4YTLA 4C92E 3VKIA 2JT4A 3QSUA 3OS0A 2DILA 3QKJA 1GL5A 1JJ2S 1M4ZA 1LPLA 1S1NA 4Y28E 2CP2A 4N0AA 2KROA 3LWHA 1QW1A 4KT0E 3TVTA 2K6DA 1VQ4Q 4KGZB 3DKMA 2KRSA 2MIOA 3WXMB 2QQRA 2Z0WA 2ENMA 3G6EA 1M2OA 4J6XA 3CCUQ 3VRZA 5CKFA 2XKOC 4OB0B 4M7DD 3CCSA 2M9UA 3TREA 5GAN6 2O01E 3PIOA 4C5GA 2HSEB 2KEAA 5IN1A 5LJ5h 4C0ZA 2YHTA 2FZGB 4PFOA 1KQ1A 1PSFA 1NYGA 2LTOA 3E9GA 5FU7B 1E7OA 4BI4A 5CKBA 1UGPB 2HQEA 2OTJA 1M1FA 2XHCA 5GJWB 2SEMA 4E7JA 3META 1YFNA 4HA8A 3CPWP 3L2WA 4AMCA 2VASA 3REBB 4M7DC 1Q95G 2RHUA 1IRXA 2EQKA 4A63B 3MPUB 4QVCA 1IXDA 1OEBA 4D8KA 1E6HA 3ASKA 1JQQA 1WJSA 4FT2A 1YITQ 3M55A 3F70A 3CCLQ 4BI3A 5IHKA 3OMCA 1ZSZC 3FRNA 5GMKh 4C92D 3RR6A 2GQIA 2R5MA 2FL7A 2EKOA 2P84A 1D0XA 2COZA 3EGXB 4C0FA 3IQLA 3QHSA 2J06A 2KNBB 2ECZA 1VQOA 3EGDB 1R77A 2CYZB 3LGLA 2MYSA 5HK0A 2E4HA 4E7LA 4X9DA 5KYNA 5AT1B 2WACA 4C92C 1BCOA 1YWPA 3SHWA 3U23A 1N6AA 2JZ2A 3H41A 3OYJA 2EW3A 1IHVA 3QWXX 1X27A 2O4XA 3VUBA 5L23A 4PJOG 1V76A 2XK0A 2X9HA 4OB2B 1NM7A 2DJQA 3RKYA 2F2XA 2P0PA 5I2MA 4M77F 3MHXA 2J6OA 3VS4A 3CCUA 4ME7A 2DO3A 3A8MB 1Z9ZA 1BI0A 2LQNA 5C6SA 3UF4A 3FJPA 1G3WA 2EJ9A 3INZA 1W70A 1R0CB 4RTTA 3HP9A 3S3OA 1FMWA 1M1KU 4RTUA 4MZTA 1U06A 2XU8A 9ATCB 5GAMd 3CCRT 1OQKA 3CCVQ 4HCZA 4FW1A 4M4ZA 2A28A 4JLIA 4HT8A 2G6FX 1KQSA 2BTTA 4ZNXA 2C06A 1ZA2B 1FX7A 4M7AB 4AFSC 2V8KA 1N5ZA 4OMPA 4PKCC 5IH2A 3FEOA 4Y92A 1C1AA 3CCMT 2CS7A 3EG9A 2M16A 3H0IA 4JRQA 3QJYA 2LQ8A 4B9WA 2K3BA 3D7SB 3CBMA 1GCQA 2O9VA 2X35A 1QQJA 3QYHB 1ZHIA 4PJLA 1QCOA 1YITA 3GPLA 3NGPA 3EFOB 3M4YA 2L3RA 1D1CA 3L2UA 2L2PA 1XQHA 3M53A 5FU7C 3ZFJA 1I0CA 4JRPA 4KUDK 4C8QF 2JXBA 2DIQA 1XJWB 2A37A 4IUVA 4FSXA 2EJGA 1BK2A 1QKXA 2KK4A 3MO8A 2BE9B 1X69A 2MK5A 2DERA 2DD5A 2P4RA 1TUDA 5FU6B 4OB1B 1FXXA 1QVGP 2LVMA 5GAMf 1SF9A 3JCMP 3G4SQ 3NFCA 1C6VX 3M54A 1DJ7B 1VQ7Q 2BE7D 4M75B 1PRMC 2CZ1B 4KRTA 2VV5A 2I2LA 2GTOA 1UJYA 4XK8E 1TU0B 1W2BP 2F2VA 5GAMj 1WQ7A 3OS1A 2JN0A 2AK5A 1K9MU 4EDUA 1KC8U 3SB2A 5GAOp 3PTAA 2LT4A 2HBWA 2CUDA 5IXBA 1UB4A 2ZCFB 1UGVA 2EGCA 1WLPB 4KBMB 2HMAA 4EIKA 1GCQC 4DQ2A 4XTUA 3FIFA 1ZQ1A 5GAMg 1ZBXA 4KH1B 4NS5A 2DL5A 4GLKA 3CMEQ 3CCJQ 2C0IA 2YXYA 3CCVA 1VQ9Q 1PG5B 3CC4A 5GAN3 2DRMA 2RI2A 3V8LA 4BACA 1EZZB 2GQVA 4PJOA 3C94A 1ABOA 2F5TX 2EYQA 3CEYA 2QGFB 3M0SA 5KCOA 1VYTA 2O9SA 1GXIE 4M7AD 3QJ6A 2AT1B 2L3PA 1H3HA 3RMQA 3M4GA 4LDXA 1ZUKA 1YCYA 5GAN8 1VQPT 1KQ2A 2NUTB 1PKTA 2CZ6B 4KUIA 3FC3A 2DL8A 1VQ5Q 4EMKA 1Q82U 1K9AA 4F7UG 3GOXA 1WFWA 1ZUUA 1RAIB 2DNUA 3CC2T 3VS2A 1QP2A 1OYXA 2CP5A 1YI2T 2EQJA 1TG0A 4M7AC 3SWNB 3ME9A 4RTXA 4IUQA 5L8RE 2DAQA 3H0FA 2LCCA 4FIBA 4J8OA 4CC7A 2BKDN 4XU0A 1YJNQ 2YLBA 3QWYA 3G4SA 2FHDA 2WSFE 1IGQA 2VB6A 4LE9A 1VQ7A 2QA4Q 4JRKA 3KUFA 3UT1A 1G2BA 1S72Q 4L59A 5GAMh 2E5KA 2MF2A 4HCKA 4E7HA 4MDWA 1MV0B 2VKNA 3QBYA 1VQ6T 4M75D 2RN8A 3CD6T 2HL3A 4PJOC 4N4GA 3J7AF 1Y0MA 1Y7XA 1UECA 2KRMA 3HRTA 1VQLQ 4ZTJA 4PLIA 1OU8A 3A1PA 5LJ5d 2QDLA 5IXFA 1IGUA 3FJ5A 4M78G 1I4K1 3O5ZA 4FU6A 2PUOB 4HXJA 4O6JA 4VUBA 2A7YA 3R6OA 4PFPA 3SDZA 1B3QA 3CMEA 1NYFA 3CCJA 3TU4K 3E19A 3OS2A 2DF6A 3VJPA 4X1VA 3OW2S 1VQ9A 3FB9A 4M75C 1K4US 4LDVA 3VYGA 1OI1A 2RQRA 1UE9A 1UGRB 1M1KC 2MPXC 1H92A 4F17A 1MNDA 4C92G 3CMAQ 5GMKe 4OMFB 4FM4B 1JEGA 1YJWQ 4JRIA 2AKLA 3RBBB 2KBTA 2D8HA 2RH2A 5J39A 4XU1A 2RI3A 3QXEB 5J26A 1VQ5A 2DXTA 1QVFP 2A08A 4TVRA 3OYKA 2KDSA 5FLXE 2AZSA 4JS4A 2E1HA 2NYSA 4J83A 4MMKA 4RCCA 3TSWA 4DBFA 5DM7R 1K8AU 3M58A 5CKHA 2KQWA 1IB8A 3M9QA 4BY6C 1Y96B 4ESRA 2DEUA 5DLQE 1Z9QA 1R0BG 5GAOn 2OAUA 3N5BB 1RLQC 1EIFA 1WZOA 3I35A 3NTKA 4BE2A 1PWTA 3VV0A 1YJNA 4FCYA 1I07A 4LDWA 1UGQB 5EG2A 2HCKA 3MEVA 4RTVA 2E10A 3AT1B 1M27C 3TEEA 3V7CA 4JPBW 2QA4A 2LX9A 3S3NA 2D8JA 2JM8A 1M2VA 3I5SA 4F7UA 3T9NA 1H8KA 3JCMV 2EIFA 4ELZC 1OOTA 2RD1A 2YRDA 1M1KR 1MHNA 2EGEA 2D0NA 3JB9D 5CQXA 1T0HA 5GAOm 1CKAA 2DKGA 1ZX6A 3PMIA 4JLGA 1D1AA 1GRIA 3BDLA 2EYYA 2LNHB 5GANd 4N4IA 1WHMA 2XICA 1NLPC 4OMMA 4MMLA 4ZGDB 4XU3A 1KC8C 3CBPA 1NBEB 1RAGB 2EJFA 2DJZA 3URGA 5GAOl 1RI9A 3JCMg 2RQUA 4M7DA 3KXTA 1D3BB 5CQYA 5KYWA 1MMAA 1VQOQ 2ED0A 4P5NA 1UFFA 4AG2C 2OX7A 4Q5WA 1NE8A 4HCBA 2ABLA 2M51A 4IUUA 3CMAA 1W6XA 3PIPA 3EG0A 4LUDA 4J7FA 2YUOA 3CPWS 1BCMA 3QIIA 4F16A 5GMKi 1ZSZA 3H6ZA 4MZMA 1TTHB 4DBHA 3CXCA 5A0DA 4QT7A 1ARKA 1JU5C 2E6ZA 5LJ3d 2PZ1A 1OX9A 1WXBA 2E64A 1D1BA 4M78A 2W10A 2A3LA 3QYGB 4PK4A 3KFVA 4FYYB 1D0YA 5A0LA 4F04B 2QXFA 1HD3A 2MI6A 3MEUA 4R56A 4BE1A 1N27A 3BE3A 1OV3A 2P0KA 2FPDA 2WSCE 1BI3A 1NZ9A 3M0QA 1TSFA 5GANf 3NTIA 2RI5A 1NJIC 1PKSA 2EAYA 2A36A 4C92A 2K2MA 1LCKA 1KD1U 4QVZA 2WSEE 2RJFA 1JB0E 1OX8A 4JUVA 3CCRQ 2JNGA 1WJRA 2COYA 1KC8R 2EQMA 3OY9A 4AT1B 1QLYA 2HAXA 2DFUA 2F1LA 1SSHA 2X4WA 5CO7A 4M78D 4GY5A 5GANj 2O31A 1YIJT 2CP7A 3CCMQ 3OYDA 1ZUYA 1VQ8T 1M90U 1O75A 3PMTA 3JCMh 2VGNA 2XDPA 2H8HA 2OI3A 5D6YA 2PU9B 5LJ3f 1M1GA 2JS2A 2YSQA 2LJ1A 3RNJA 4NOYA 2RJCA 2QEXT 5CKDA 5GANg 1Q86U 4L6V5 2KAFA 3DB4A 2RK2A 4RTWA 2K79A 3M0TA 2X3XD 4M77B 2V26A 3L42A 2IG0A 2R57A 2F2WA 1MUZA 4M78C 4M7AG 3OYBA 2FPEA 2GBQA 2DVJA 4PJNA 5LJ3j 1YHQT 2VXEA 1AEYA 2W0ZA 3VS6A 2LJ3A 4AFZC 3MP8A 2YRVA 3HFNA 3MKDA 1PSEA 4DBRA 1NJIR 1GCPA 1E6GA 1PC0A 4E7ZA 1WI7A 4QW2A 3OSSC 2ZPGB 2KVQG 1KQSP 5LJ3g 4EPCA 2FG0A 3LYIA 2BZXA 3MP6A 4Z88A 1BB9A 2CDTA 2EWNA 5GAOr 3H9NA 4PL6A 1HSQA 1WHHA 3P8BB 4RG2A 2JTEA 4M77E 5KYYB 3PVLA 4LDUA 4RMOA 1RAAB 2E65A 4K11A 5GJVB 1JJ2A 2ATCB 4J9HA 3EFSA 3BDUA 4B9XA 1YJ9T 2KR3A 1K8AC 2DETA 5GAMe 2RMOA 1BIAA 2P0QA 4II1A 1WNLA 2F69A 2LZ6B 2JTFA 1VQ4T 3MEAA 2DBMA 4AFUC 3I56T 4M75G 4C8QB 1BI1A 1UTIA 1D09B 5GANh 3CCRA 1WJQA 1W1FA 4J9BA 1QVGS 1WXTA 4A4EA 3CC4Q 3REAB 5IHIA 2CT4A 4E7KA 1FWZA 3EGXA 3CCMA 3WVDB 1G3SA 4ZGEB 1NPPA 3EGDA 3NHNA 1U1TA 2NUPB 1HXDA 3PGGA 1TS9A 4J5YA 4DEYA 2ROTA 2DXBA 1H641 1V1CA 2CREA 1VQPQ 4FT4A 1W2BS 4A54A 4ZGJB 2L89A 1RUWA 2K4YA 1UEBA 1WPYA 2O88A 5LJ3h 1GFCA 2DTHA 1UGSB 2AHJB 3RDVA 5KCHA 5IT9E 4C8QE 5FROA 2DMOA 1K0XA 1YI2Q 2L3QA 2K5LA 4KGXB 5DY9A 3S6WA 2QTXA 1XOVA 2JTMA 2R58A 1WHGA 2JMAA 3CCLT 4FSSA 3NPFA 1K8AR 3C12A 4ZTFA 2RM4A 2CP6A 2JM9A 4RUGA 2V1RA 5EC7A 2KGTA 2X4XA 5HY6A 2QK0A 3PVQA 4JDSA 2ROLA 3HHTB 5CVIA 1SG5A 2E3HA 5KE3A 2K3XA 2KT8A 3OS5A 1VQ6Q 4CC2A 4BUGA 1M9SA 3CCQT 4M7AA 5KE2A 3OMGA 2OAWA 4OMOA 1Q81U 3I9QA 2DD4A 5FWBA 3QDFA 2LCSA 3JB9G 1B34B 1SRLA 3EFOA 4GLMA 2CH4W 4PJOF 3VS7A 2LDMA 1WHKA 3CC7T 2MCNA 4C8QD 1KD1C 2RQVA 3RERA 4C0DB 2J6FA 3JCMc 1IHWA 5CCAA 4J9IA 2E5QA 5CIUA 1YNZA 3JB9J 2Y4YA 1QMCA 1VQPA 2JUFA 1TWBA 2X4JA 5I2SA 2EYZA 1AWOA 1M90C 2RNAA 2GTJA 4ZN1A 3CC2A 2JW4A 2BIVA 3SD4A 5IAYA 4M75A 1QWFA 1JRIA 1OPKA 4QQ6A 2A0FB 2J05A 2VC8A 1AWJA 1W2BA 2D1XA 2E6NA 2FZCB 1Q86C 1YI2A 1BBZA 1QCFA 2HQHA 2DX1A 1WHJA 2ED1A 1AOJA 3PNWC 1VYVA 3O8VA 1N9SA 2DL3A 2QAZA 1TH7A 2KXDA 2DTIA 2ZPIB 3JCMW 1VOMA 1LJOA 4BI8B 1UHCA 2C0OA 4HKEA 1CKBA 3X20B 3RMSA 3FLGA 2LRQA 3GBQA 4J9DA 2FRYA 1AT1B 2CZ0B 2G3RA 4PJMA 1CSKA 2OJ2A 1KD1R 3LGFA 3BY7A 1VYUA 8ATCB 3JV3A 2LQKA 3GP8A 1LOJA 5LJ5e 1VQ6A 3CD6A 2FRWA 4N4HA 4E47A 1QVFS 1TUGB 4E7SA 2I0NA 5CK9A 3QUIA 5KYUB 4LD6A 4XQ3A 2LT1A 2XIDA 5FU6C 2BZYA 4LNPA 1X43A 2DXUA 1M90R 1VQKT 1I8FA 3M56A 2NUTA 1U5SA 3HSBA 2DE0X 4J6YA 4ORZA 4E7IA 2NLUA 3DLMA 3OYMA 3E1SA 1Q86R 5DLOA 2AKKA 3M57A 3X24B 1NLOC 3JCMd 2MOXA 2DA9A 3OYYA 2B8AA 1YCSB 1C0MA 1ZBJA 3SWNA 4ELYC 3UA6A 2DLPA 1FMVA 3EH2A 1V29B 3ULRB 5FRNA 3OBYA 5GAN2 1K73U 3HPWA 2FYKA 3HFOA 3I55T 4V2SA 3H0HA 3A8GB 4JJCA 4J7IA 4KGVB 2HL5C 3VYHB 4PLLA 1VQMT 1U8RA 4E2FB 3GNFB 1PHTA 4OGEA 5KYXB 2NUZA 4IIMA 4AFQC 1NEGA 4C0DC 4A4HA 4JJBA 2ESWA 4WTOB 1M8MA 3RKXA 2VXFA 3WVEB 3A8LB 1WIEA 4XTVA 3OYFA 1T3SA 1B07A 4XTZA 2DEQA 2L0AA 3THKA 4F7UF 1LVKA 4J9GA 2QTVA 2OTLT 2PVDB 2DVEA 2HEQA 3JCMf 3UPUA 4OP0A 3OYIA 1YIJQ 2X51A 1WA7A 2VVKA 2GNCA 4HVWA 2X4YA 1M5Q1 3V8KA 4QQDA 4XTXA 3CXCP 2EYWA 2HZYA 3SWNC 5GANe 2YRCA 3P8HA 1S72T 2EFIA 4QKUA 4ANJA 2D6FA 2QG9B 2K7AA 4IKFA 1VQNT 2FVUA 4C5HA 4M7DE 4Z89A 2RO0A 1K9MC 2BZ8A 3OB9A 3TSZA 2K57A 3QDRB 4M7DF 1EFNA 3QPHA 5FRMA 2GGRA 1VQLT 2M02A 3GNGA 4X34A 4OMNA 2CP3A 1Q81C 1YHQQ 2CZ7B 2GF7A 1X6GA 3G71T 4Y91A 3NMZC 3UDCA 4BDZA 4B6MA 1Y96A 1AVZC 1AZGB 2EGAA 5A2QE 1KSWA 2AZVA 3OW2A 2RJEA 1GBRA 2FPFA 5LJ3e 1M3AA 1SHFA 2KY9A 3OYCA 4DA4A 4M78F 1PD1A 4M77G 2ZAEA 2LP5A 3VRYA 2M1HA 1OU9A 1QP3A 3C4SA 3X25B 4RTZA 4FYVB 5IHNA 1G3TA 3CCET 1ZA1B 4DOVA 1M3CA 1Y71A 4X9CA 1YJWT 1WGSA 2DXCA 1KJWA 1Q82C 1XNIA 3BW1A 4Z02A 1LNXA 1PD0A 3CPFA 4CC4B 4C92F 1PM3A 1YJ9Q 3JB9H 1BI2A 3BFMA 2FEIA 5D7UA 1YWOA 2HQXA 3UATA 2L3SA 4JZ4A 1VA7A 3A5ZB 2NWMA 3I56Q 1TOVA 3E2UA 3A8OB 1T3LA 2RHYA 2ZGWA 4PJJA 3PE0A 3G6ET 1K9MR 2BUDA 1FMKA 3HTRA 3I5RA 3VS3A 2ZPFB 5CKEA 3CCST 1JXMA 1Q81R 2GFAA 1U1SA 2CKKA 5I22A 1HJDA 3E9FA 3TQ7P 1YIJA 4FL6A 1KQSS 2JJ9A 1UJ0A 4C5IA 1VQ8A 2PQWA 3PT9A 1D3BA 2RJDA 1RLPC 1YBYA 2CSIA 4QQGA 3FDRA 2COWA 2O4XB 3RUXA 3G7ZA 5GMKm 2OTJT 2CT3A 4PFZA 1SEMA 2SRCA 2ZZDA 2RHZA 2QEXA 4D6WA 2RPNA 1X6BA 1ZLMA 4C8QG 4FYWB 2DL4A 1GBQA 4EMHA 2XI9A 4J9CA 1M3BA 1N8RU 2E3IA 3QZ9B 1JJ2P 2KE9A 1RAFB 3X28B 1N9RA 2ZPEB 4OVAA 2CP0A 5GMKl 2QQSA 4BE0A 1YHQA 1Q82R 2XMFA 1VIEA 2RHXA 1J3TA 3OYNA 3VUZA 2XDBA 5GAOq 3ER0A 3GLXA 4A4FA 4N0AC 4BB7A 2KT1A 4RG8A 4XTWA 2XD0A 3V7SA 2MAMA 5J3BA 2E70A 2VYTA 5LL6S 3L2VA 3C95A 1X2QA 1VQOT 3EG9B 3OYEA 3VU3C 1U3OA 3M5AA 2DTOA 4CI0C 1ACMB 2EYXA 3CPWA 1XTDA 2DPPB 3CCQQ 1K73C 2K3YA 3EGUA 5I21A 3HRSA 1KK7A 1H3ZA 1I1JA 2V8JA 3QZ5B 3VS1A 3DLLA 1X6OA 1SRMA 3CBOA 1YJ9A 5GAN5 1QCNA 2C0TA 4OF1A 1G5VA 4DOWA 4IURA 2LMJA 1VQ4A 4HT9A 3LH5A 1SKUB 2HDAA 3LWIA 2DZ9A 5FWCA 3I56A 1Q7YU 1G8XA 2O2OA 2KYBA 4JZ3A 2H3EB 3CCUT 1WDXA 3JCMJ 1K0SA 3CC7Q 4M77A 2LCLA 3V7RA 4EMGA 2YUQA 3RKWA 3R6NA 2RHIA 2D9TA 3CQTA 1ZSGA 3VS0A 5CAIA 1OULA 3ZL7C 6AT1B 1SSFA 4C5EA 1KHCA 2Y4XA 7AT1B 3JCMQ 1UG1A 5HCKA 4HVVA 3RIRA 1WYXA 2DBKA 4OMLA 2PVGB 2KSSA 4JS5A 1O9SA 2JS0A 3S3MA 1AZEA 3CC2Q 1QKWA 3UA7A 2DK3A 2GCXA 5HKCA 2YWWA 1K73R 5I11A 4OB3B 3OSVA 4M77D 5KYYA 4J9EA 1YITT 3CCLA 2DYIA 3L2QA 3MJXA 1NEBA 4HVUA 1JO8A 2QQAA 2B86A 1VUBA 2EKHA 2M0OA 1RAEB 2J7IA 3VS5A 5GAN7 4PJOB 2GFUA 4NL2A 3EAEA 4J6WA 3EG1A 3OQ5A 1KG1A 1K76A 1ABQA 4M7AE 4C8QA 3J81E
chains in the Genus database with same CATH topology
3SEMA 2FRWA 1ZX6A 2CH4A 1GRIA 2PNIA 2I0NA 2EYYA 2LNHB 3IQLA 2J06A 1NLPC 3EHQA 2KNBB 2ECZA 4OMMA 2BZYA 4LNPA 1X43A 1U5SA 1RI9A 4R0KA 1OPLA 2RQUA 2YUPA 2DE0X 2ED0A 4ORZA 3C0CA 1UFFA 4AG2C 4WCIA 1BU1A 2EBPA 1YWPA 3SHWA 3U23A 2RQWA 4RTYA 2ABLA 2DRKA 2M51A 2KYMA 1W6XA 2EW3A 2DM1A 3H41A 3QWXX 3EG0A 4F14A 4LUDA 2YUOA 1X27A 2AKKA 5L23A 1NLOC 2MOXA 2DA9A 4F16A 1YCSB 1NM7A 1ZBJA 2DJQA 2F2XA 4QT7A 1ARKA 1JU5C 3UA6A 2PZ1A 1WXBA 2DLPA 2J6OA 2W10A 3VS4A 2KXCA 3ULRB 3KFVA 1Z9ZA 2LQNA 1HD3A 3UF4A 3H0HA 4JJCA 2V1QA 1W70A 1OV3A 4RTTA 1UHFA 2FPDA 2RQTA 1IO6A 3M0QA 4RTUA 1U06A 3A98A 5FW9A 1PKSA 1PHTA 2A36A 4M4ZA 2NUZA 2K2MA 2DL7A 4IIMA 1LCKA 2A28A 1NEGA 2IIMA 4AFQC 2G6FX 2BTTA 4ZNXA 4JJBA 2ESWA 3M0PA 4AFSC 1N5ZA 4OMPA 1M8MA 5IH2A 2J6KA 4Y92A 1QLYA 1WIEA 1T3SA 1B07A 2L0AA 3H0IA 1SSHA 1PNJA 3THKA 4JJDA 2O31A 2K3BA 5ECAA 4J9GA 2HEQA 1ZUYA 1GCQA 2O9VA 2H8HA 1FYNA 3NGPA 2OI3A 2CUBA 4GBQA 2JS2A 2L2PA 1WA7A 2YUNA 2YSQA 2LJ1A 3RNJA 2VVKA 1I0CA 2GNCA 4HVWA 2JXBA 2EYWA 1MV3A 2A37A 4RTWA 2JMCA 1AWWA 2K79A 1BK2A 3EHRA 1QKXA 3M0TA 2X3XD 4IIOA 1X69A 2F2WA 1MUZA 1M30A 2P4RA 3M0RA 1TUDA 2K7AA 2X3WD 2FPEA 4E6RA 2GBQA 1UDLA 2DVJA 4LUEA 4Z89A 1AEYA 2W0ZA 3VS6A 2BZ8A 2LJ3A 4AFZC 3TSZA 1EFNA 2KRNA 1AD5A 2GGRA 4OMNA 1GCPA 1WX6A 1E6GA 1X6GA 1PRMC 1WI7A 3NMZC 4KRTA 2EVRA 1G83A 1AVZC 2GTOA 1AZGB 2EGAA 4DEXA 2FG0A 1KSWA 2BZXA 1UJYA 2AZVA 4Z88A 1JXOA 2F2VA 1UUEA 1GBRA 1BB9A 2CDTA 2FPFA 1M3AA 3EG2A 1SPKA 1HSQA 1SHFA 2VWFA 2AK5A 2JTEA 3PVLA 2LP5A 4K11A 3VRYA 2K9GA 5GJVB 2HBWA 2CUDA 4RTZA 5IXBA 5IHNA 1UGVA 2EGCA 1WLPB 4J9HA 4EIKA 1GCQC 2KR3A 2DL5A 1M3CA 2RMOA 2C0IA 1K1ZA 2EPDA 1KJWA 2LZ6B 2DBMA 4AFUC 4CC4B 2DRMA 1UTIA 2FEIA 1W1FA 4J9BA 1YWOA 1ABOA 3UATA 4D8DA 2L3SA 3M0SA 4JZ4A 1WXTA 1VYTA 1VA7A 2O9SA 2NWMA 3REAB 5IHIA 1Y57A 1H3HA 2L3PA 1SHGA 1T3LA 3PE0A 2CT4A 1FMKA 1ZUKA 3I5RA 1TUCA 3VS3A 1PKTA 1YN8A 2DL8A 1JXMA 1K9AA 3NHNA 1WFWA 1ZUUA 5I22A 1HJDA 2DNUA 4DEYA 2ROTA 1UJ0A 1V1CA 3VS2A 2CREA 1A0NB 1RLPC 1RUWA 2CSIA 2EQIA 2LQWA 2O88A 1T0JA 2CT3A 3M0UA 1SEMA 1TG0A 1GFCA 2SRCA 1KIKA 2RPNA 1X6BA 1ZLMA 2DL4A 1GBQA 4RTXA 4J9CA 1M3BA 2DMOA 1K0XA 2L3QA 3H0FA 4AG1C 4CC7A 1XOVA 2YDLA 2KE9A 3QWYA 2JMAA 1NG2A 2DYBA 4CC3A 4FSSA 4OMQA 3NPFA 4LE9A 2XMFA 1G2BA 2JM9A 2E5KA 1J3TA 4RUGA 4HCKA 2V1RA 5EC7A 1GFDA 1MV0B 4J9FA 2VKNA 2KGTA 3PVQA 2ROLA 2KT1A 2RN8A 2M0YA 1AWXA 1Y0MA 1UECA 1WXUA 2KRMA 1QWEA 1YP5A 1PRLC 2KT8A 4CC2A 4LN2A 1X2QA 2QDLA 5IXFA 2PTKA 2HSPA 4Z8AA 3FJ5A 1U3OA 3O5ZA 2EYXA 2OAWA 4HXJA 2LJ0A 2YT6A 1B3QA 1KFZA 3EGUA 1NYFA 2DF6A 4OMOA 4X1VA 1I1JA 3I9QA 3EG3A 3VS1A 1K4US 5FWBA 2LCSA 1SRMA 2FO0A 2RQRA 2RF0A 2C0TA 1UE9A 2CSQA 1SRLA 1X2KA 2LMJA 2LX7A 4GLMA 3LH5A 1H92A 2CH4W 4F17A 2HDAA 3VS7A 2JT4A 2DILA 1GL5A 5FWCA 2MCNA 1S1NA 2O2OA 2RQVA 1JEGA 2KROA 2J6FA 2KYBA 2AKLA 4JZ3A 3TVTA 3RBBB 2KBTA 2K6DA 2D8HA 1WDXA 1K0SA 2KRSA 2MIOA 4J9IA 1YNZA 2ENMA 2A08A 2YUQA 3VRZA 2AZSA 3R6NA 3TSWA 3CQTA 1ZSGA 3VS0A 2EYZA 3ZL7C 1AWOA 2KEAA 2RNAA 2GTJA 4ESRA 1UG1A 2JW4A 1Z9QA 1QWFA 1OPKA 5HCKA 1NYGA 4HVVA 1WYXA 2DBKA 2J05A 1AWJA 4OMLA 1E7OA 1RLQC 2D1XA 2JS0A 1AZEA 3I35A 1QKWA 1BBZA 3UA7A 5GJWB 1PWTA 1QCFA 2DX1A 2SEMA 2ED1A 1AOJA 1VYVA 1I07A 2DL3A 2HCKA 4RTVA 2KXDA 1M27C 5I11A 3REBB 4JPBW 2D8JA 4J9EA 2JM8A 3I5SA 1UHCA 2C0OA 4A63B 1CKBA 1H8KA 1NEBA 1OEBA 4D8KA 1E6HA 1OOTA 3GBQA 1JQQA 2EGEA 4HVUA 1JO8A 2D0NA 4J9DA 2FRYA 2B86A 2EKHA 1CSKA 2OJ2A 2J7IA 1T0HA 3VS5A 5IHKA 1VYUA 2GQIA 3JV3A 3EG1A 1CKAA 1K76A 1ABQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEM A;  2FRW A;  1ZX6 A;  2CH4 A;  1GRI A;  2PNI A;  2I0N A;  2EYY A;  2LNH B;  3IQL A;  2J06 A;  1NLP C;  3EHQ A;  2KNB B;  2ECZ A;  4OMM A;  2BZY A;  4LNP A;  1X43 A;  1U5S A;  1RI9 A;  4R0K A;  1OPL A;  2RQU A;  2YUP A;  2DE0 X;  2ED0 A;  4ORZ A;  3C0C A;  1UFF A;  4AG2 C;  4WCI A;  1BU1 A;  2EBP A;  1YWP A;  3SHW A;  3U23 A;  2RQW A;  4RTY A;  2ABL A;  2DRK A;  2M51 A;  2KYM A;  1W6X A;  2EW3 A;  2DM1 A;  3H41 A;  3QWX X;  3EG0 A;  4F14 A;  4LUD A;  2YUO A;  1X27 A;  2AKK A;  5L23 A;  1NLO C;  2MOX A;  2DA9 A;  4F16 A;  1YCS B;  1NM7 A;  1ZBJ A;  2DJQ A;  2F2X A;  4QT7 A;  1ARK A;  1JU5 C;  3UA6 A;  2PZ1 A;  1WXB A;  2DLP A;  2J6O A;  2W10 A;  3VS4 A;  2KXC A;  3ULR B;  3KFV A;  1Z9Z A;  2LQN A;  1HD3 A;  3UF4 A;  3H0H A;  4JJC A;  2V1Q A;  1W70 A;  1OV3 A;  4RTT A;  1UHF A;  2FPD A;  2RQT A;  1IO6 A;  3M0Q A;  4RTU A;  1U06 A;  3A98 A;  5FW9 A;  1PKS A;  1PHT A;  2A36 A;  4M4Z A;  2NUZ A;  2K2M A;  2DL7 A;  4IIM A;  1LCK A;  2A28 A;  1NEG A;  2IIM A;  4AFQ C;  2G6F X;  2BTT A;  4ZNX A;  4JJB A;  2ESW A;  3M0P A;  4AFS C;  1N5Z A;  4OMP A;  1M8M A;  5IH2 A;  2J6K A;  4Y92 A;  1QLY A;  1WIE A;  1T3S A;  1B07 A;  2L0A A;  3H0I A;  1SSH A;  1PNJ A;  3THK A;  4JJD A;  2O31 A;  2K3B A;  5ECA A;  4J9G A;  2HEQ A;  1ZUY A;  1GCQ A;  2O9V A;  2H8H A;  1FYN A;  3NGP A;  2OI3 A;  2CUB A;  4GBQ A;  2JS2 A;  2L2P A;  1WA7 A;  2YUN A;  2YSQ A;  2LJ1 A;  3RNJ A;  2VVK A;  1I0C A;  2GNC A;  4HVW A;  2JXB A;  2EYW A;  1MV3 A;  2A37 A;  4RTW A;  2JMC A;  1AWW A;  2K79 A;  1BK2 A;  3EHR A;  1QKX A;  3M0T A;  2X3X D;  4IIO A;  1X69 A;  2F2W A;  1MUZ A;  1M30 A;  2P4R A;  3M0R A;  1TUD A;  2K7A A;  2X3W D;  2FPE A;  4E6R A;  2GBQ A;  1UDL A;  2DVJ A;  4LUE A;  4Z89 A;  1AEY A;  2W0Z A;  3VS6 A;  2BZ8 A;  2LJ3 A;  4AFZ C;  3TSZ A;  1EFN A;  2KRN A;  1AD5 A;  2GGR A;  4OMN A;  1GCP A;  1WX6 A;  1E6G A;  1X6G A;  1PRM C;  1WI7 A;  3NMZ C;  4KRT A;  2EVR A;  1G83 A;  1AVZ C;  2GTO A;  1AZG B;  2EGA A;  4DEX A;  2FG0 A;  1KSW A;  2BZX A;  1UJY A;  2AZV A;  4Z88 A;  1JXO A;  2F2V A;  1UUE A;  1GBR A;  1BB9 A;  2CDT A;  2FPF A;  1M3A A;  3EG2 A;  1SPK A;  1HSQ A;  1SHF A;  2VWF A;  2AK5 A;  2JTE A;  3PVL A;  2LP5 A;  4K11 A;  3VRY A;  2K9G A;  5GJV B;  2HBW A;  2CUD A;  4RTZ A;  5IXB A;  5IHN A;  1UGV A;  2EGC A;  1WLP B;  4J9H A;  4EIK A;  1GCQ C;  2KR3 A;  2DL5 A;  1M3C A;  2RMO A;  2C0I A;  1K1Z A;  2EPD A;  1KJW A;  2LZ6 B;  2DBM A;  4AFU C;  4CC4 B;  2DRM A;  1UTI A;  2FEI A;  1W1F A;  4J9B A;  1YWO A;  1ABO A;  3UAT A;  4D8D A;  2L3S A;  3M0S A;  4JZ4 A;  1WXT A;  1VYT A;  1VA7 A;  2O9S A;  2NWM A;  3REA B;  5IHI A;  1Y57 A;  1H3H A;  2L3P A;  1SHG A;  1T3L A;  3PE0 A;  2CT4 A;  1FMK A;  1ZUK A;  3I5R A;  1TUC A;  3VS3 A;  1PKT A;  1YN8 A;  2DL8 A;  1JXM A;  1K9A A;  3NHN A;  1WFW A;  1ZUU A;  5I22 A;  1HJD A;  2DNU A;  4DEY A;  2ROT A;  1UJ0 A;  1V1C A;  3VS2 A;  2CRE A;  1A0N B;  1RLP C;  1RUW A;  2CSI A;  2EQI A;  2LQW A;  2O88 A;  1T0J A;  2CT3 A;  3M0U A;  1SEM A;  1TG0 A;  1GFC A;  2SRC A;  1KIK A;  2RPN A;  1X6B A;  1ZLM A;  2DL4 A;  1GBQ A;  4RTX A;  4J9C A;  1M3B A;  2DMO A;  1K0X A;  2L3Q A;  3H0F A;  4AG1 C;  4CC7 A;  1XOV A;  2YDL A;  2KE9 A;  3QWY A;  2JMA A;  1NG2 A;  2DYB A;  4CC3 A;  4FSS A;  4OMQ A;  3NPF A;  4LE9 A;  2XMF A;  1G2B A;  2JM9 A;  2E5K A;  1J3T A;  4RUG A;  4HCK A;  2V1R A;  5EC7 A;  1GFD A;  1MV0 B;  4J9F A;  2VKN A;  2KGT A;  3PVQ A;  2ROL A;  2KT1 A;  2RN8 A;  2M0Y A;  1AWX A;  1Y0M A;  1UEC A;  1WXU A;  2KRM A;  1QWE A;  1YP5 A;  1PRL C;  2KT8 A;  4CC2 A;  4LN2 A;  1X2Q A;  2QDL A;  5IXF A;  2PTK A;  2HSP A;  4Z8A A;  3FJ5 A;  1U3O A;  3O5Z A;  2EYX A;  2OAW A;  4HXJ A;  2LJ0 A;  2YT6 A;  1B3Q A;  1KFZ A;  3EGU A;  1NYF A;  2DF6 A;  4OMO A;  4X1V A;  1I1J A;  3I9Q A;  3EG3 A;  3VS1 A;  1K4U S;  5FWB A;  2LCS A;  1SRM A;  2FO0 A;  2RQR A;  2RF0 A;  2C0T A;  1UE9 A;  2CSQ A;  1SRL A;  1X2K A;  2LMJ A;  2LX7 A;  4GLM A;  3LH5 A;  1H92 A;  2CH4 W;  4F17 A;  2HDA A;  3VS7 A;  2JT4 A;  2DIL A;  1GL5 A;  5FWC A;  2MCN A;  1S1N A;  2O2O A;  2RQV A;  1JEG A;  2KRO A;  2J6F A;  2KYB A;  2AKL A;  4JZ3 A;  3TVT A;  3RBB B;  2KBT A;  2K6D A;  2D8H A;  1WDX A;  1K0S A;  2KRS A;  2MIO A;  4J9I A;  1YNZ A;  2ENM A;  2A08 A;  2YUQ A;  3VRZ A;  2AZS A;  3R6N A;  3TSW A;  3CQT A;  1ZSG A;  3VS0 A;  2EYZ A;  3ZL7 C;  1AWO A;  2KEA A;  2RNA A;  2GTJ A;  4ESR A;  1UG1 A;  2JW4 A;  1Z9Q A;  1QWF A;  1OPK A;  5HCK A;  1NYG A;  4HVV A;  1WYX A;  2DBK A;  2J05 A;  1AWJ A;  4OML A;  1E7O A;  1RLQ C;  2D1X A;  2JS0 A;  1AZE A;  3I35 A;  1QKW A;  1BBZ A;  3UA7 A;  5GJW B;  1PWT A;  1QCF A;  2DX1 A;  2SEM A;  2ED1 A;  1AOJ A;  1VYV A;  1I07 A;  2DL3 A;  2HCK A;  4RTV A;  2KXD A;  1M27 C;  5I11 A;  3REB B;  4JPB W;  2D8J A;  4J9E A;  2JM8 A;  3I5S A;  1UHC A;  2C0O A;  4A63 B;  1CKB A;  1H8K A;  1NEB A;  1OEB A;  4D8K A;  1E6H A;  1OOT A;  3GBQ A;  1JQQ A;  2EGE A;  4HVU A;  1JO8 A;  2D0N A;  4J9D A;  2FRY A;  2B86 A;  2EKH A;  1CSK A;  2OJ2 A;  2J7I A;  1T0H A;  3VS5 A;  5IHK A;  1VYU A;  2GQI A;  3JV3 A;  3EG1 A;  1CKA A;  1K76 A;  1ABQ A; 
#chains in the Genus database with same CATH topology
 3SEM A;  2CH4 A;  4M7A F;  5M9O A;  3MCA B;  2PNI A;  1WHL A;  4M77 C;  4KUL A;  3A8H B;  3EHQ A;  3CCQ A;  2MMP A;  3CD6 Q;  4EMK B;  4A53 A;  2IVW A;  1RL2 A;  4LD9 K;  1OZ2 A;  4R0K A;  1OPL A;  2YUP A;  5D6W A;  3H8Z A;  3NTH A;  2NUP A;  3C0C A;  2XDD A;  1IZ6 A;  4WCI A;  1BU1 A;  2EBP A;  1BKB A;  1VQK Q;  2RQW A;  4RTY A;  2DRK A;  3QG1 A;  2MWP A;  2KYM A;  2DM1 A;  4F14 A;  1G3Y A;  3SFM A;  2QQB A;  4PJO E;  3OA6 A;  3CC7 A;  2Y90 A;  4FW2 A;  4L5G A;  4JJN K;  2FB7 A;  5KH6 A;  1I81 A;  1RAB B;  2KXC A;  1TXQ A;  3OYH A;  1HK9 A;  4C0G A;  2DIG A;  1QVG A;  2V1Q A;  4NL3 A;  3L2R A;  3CCV T;  1UHF A;  2ZPB B;  2RQT A;  1IO6 A;  3OYL A;  4BY6 B;  3CC4 T;  3AHU A;  1MNE A;  3MEW A;  3I55 Q;  4M75 E;  4BDY A;  3A98 A;  4M75 F;  4CRI A;  3LLR A;  5FW9 A;  2IPO B;  2DL7 A;  2QQ9 A;  2IIM A;  4C8Q C;  1VQM Q;  3LW5 E;  5GAN 4;  3M0P A;  3X26 B;  2D0Q B;  2J6K A;  2RK1 A;  4OGC A;  1N8R C;  3HRU A;  1B7T A;  1PNJ A;  3JCM b;  2K2V A;  4IUP A;  3LX7 A;  4JJD A;  5ECA A;  1X01 A;  4XU2 A;  4MZP A;  1BYM A;  3MP1 A;  1R8O B;  1NJI U;  1FYN A;  1EX4 A;  1RAH B;  4FYX B;  2CUB A;  1QVP A;  4GBQ A;  2OTL Q;  2YUN A;  1B34 A;  5CR2 A;  4PJO D;  1MV3 A;  2JMC A;  1AWW A;  3EHR A;  2VUB A;  4IIO A;  2ZPH B;  3Q1J A;  3ZEH A;  3EH1 A;  1WQW A;  1M30 A;  2HBP A;  1D0Z A;  3G4S T;  3M0R A;  2X3W D;  2K5I A;  4E6R A;  1VQ7 T;  1UDL A;  4LUE A;  4M7D G;  4HCC A;  1MMN A;  1VQN Q;  2KRN A;  2DZC A;  1AD5 A;  3G1J A;  4WF2 A;  4R55 A;  1VQK A;  4DBQ A;  1WX6 A;  4O5V A;  2MWO A;  5AYF A;  2L8D A;  2E41 A;  2EVR A;  3JCM e;  1G83 A;  3GIB A;  3HKS A;  4DEX A;  1JXO A;  1UUE A;  3G71 Q;  3EG2 A;  2RA2 A;  4A4K A;  2HNI A;  3P8D A;  4KH0 B;  1N8R R;  1I5L A;  1SPK A;  1Q7Y C;  2JOY A;  2VWF A;  2KI7 A;  3OYG A;  2HKN A;  4BD3 A;  3JCM X;  4EMK C;  1RAC B;  1RI0 A;  1M2V B;  4XAX B;  2K9G A;  4F7U B;  3CME T;  3CCJ T;  3L2Z A;  3L1A A;  1VQ9 T;  1IRE B;  3GF5 A;  3I55 A;  2L5Q A;  2EQU A;  1BIB A;  4A4G A;  3JAM E;  1K1Z A;  2JVV A;  3CXC S;  2EPD A;  3JB9 F;  4IUT A;  3CCE Q;  3OBW A;  2P4T A;  1VQM A;  1I5O B;  1JBM A;  2HKQ B;  1W4S A;  3EFR A;  4D8D A;  4MDX A;  3QO3 A;  1Y57 A;  1VQ5 T;  3PFS A;  1SHG A;  2HD0 A;  2F5K A;  4LXC A;  5C0M A;  4UC4 A;  1RAD B;  5KYU A;  1Y07 A;  1TUC A;  1YN8 A;  4M7D B;  1OZ3 A;  4LDY A;  4F7U E;  5KYW B;  5LJ5 f;  3G6E Q;  3JB9 I;  4PNO A;  3J80 E;  2QYZ A;  2QI2 A;  3JSC A;  2OTL A;  3LH0 A;  3V8J A;  1A0N B;  3CCS Q;  2FZK B;  2EQI A;  2LQW A;  3OW2 P;  1T0J A;  2H3J A;  1MMG A;  1Q7Y R;  3M0U A;  1ZSZ B;  2AIR B;  1VQ8 Q;  1KIK A;  3JRZ A;  1YJN T;  5D6X A;  4XTY A;  1KHI A;  4ATO A;  4M78 B;  5LJ5 j;  2OTJ Q;  4ZN3 A;  2YLC A;  2VGM A;  2V8I A;  4AG1 C;  2QA4 T;  1AHJ B;  2QDY B;  4QVD A;  1S72 A;  2QAS A;  2YDL A;  2R5A A;  2QEX Q;  1NG2 A;  2DYB A;  4CC3 A;  1NPR A;  1VQN A;  4OMQ A;  1QVF A;  2KMT A;  5A0G A;  8AT1 B;  1VIF A;  2PUK B;  5LJ5 g;  1PCX A;  3KBG A;  3UWN A;  1HYO A;  5HK3 A;  1GFD A;  1VQL A;  4J9F A;  2RB6 A;  4C92 B;  1MMD A;  1M8V A;  1F1B B;  3G71 A;  2M0Y A;  2QGG A;  1AWX A;  1X75 C;  1WXU A;  3M59 A;  3OYA A;  2CGH A;  1QWE A;  5KYX A;  1P92 A;  1YP5 A;  1PRL C;  4LN2 A;  4RCB A;  3RES A;  2PTK A;  2HSP A;  2LNV A;  3ZBD A;  4M78 E;  4Z8A A;  2E12 A;  5GMK j;  2XG8 D;  2LJ0 A;  2YT6 A;  1KFZ A;  3DB3 A;  2LC4 A;  3EG3 A;  3CCE A;  3CMA T;  4RKU E;  1MGQ A;  3HL8 A;  2FO0 A;  2RF0 A;  3TCJ A;  2K5F A;  2CSQ A;  2PVO B;  1YJW A;  1X2K A;  2LX7 A;  4YTL A;  4C92 E;  3VKI A;  2JT4 A;  3QSU A;  3OS0 A;  2DIL A;  3QKJ A;  1GL5 A;  1JJ2 S;  1M4Z A;  1LPL A;  1S1N A;  4Y28 E;  2CP2 A;  4N0A A;  2KRO A;  3LWH A;  1QW1 A;  4KT0 E;  3TVT A;  2K6D A;  1VQ4 Q;  4KGZ B;  3DKM A;  2KRS A;  2MIO A;  3WXM B;  2QQR A;  2Z0W A;  2ENM A;  3G6E A;  1M2O A;  4J6X A;  3CCU Q;  3VRZ A;  5CKF A;  2XKO C;  4OB0 B;  4M7D D;  3CCS A;  2M9U A;  3TRE A;  5GAN 6;  2O01 E;  3PIO A;  4C5G A;  2HSE B;  2KEA A;  5IN1 A;  5LJ5 h;  4C0Z A;  2YHT A;  2FZG B;  4PFO A;  1KQ1 A;  1PSF A;  1NYG A;  2LTO A;  3E9G A;  5FU7 B;  1E7O A;  4BI4 A;  5CKB A;  1UGP B;  2HQE A;  2OTJ A;  1M1F A;  2XHC A;  5GJW B;  2SEM A;  4E7J A;  3MET A;  1YFN A;  4HA8 A;  3CPW P;  3L2W A;  4AMC A;  2VAS A;  3REB B;  4M7D C;  1Q95 G;  2RHU A;  1IRX A;  2EQK A;  4A63 B;  3MPU B;  4QVC A;  1IXD A;  1OEB A;  4D8K A;  1E6H A;  3ASK A;  1JQQ A;  1WJS A;  4FT2 A;  1YIT Q;  3M55 A;  3F70 A;  3CCL Q;  4BI3 A;  5IHK A;  3OMC A;  1ZSZ C;  3FRN A;  5GMK h;  4C92 D;  3RR6 A;  2GQI A;  2R5M A;  2FL7 A;  2EKO A;  2P84 A;  1D0X A;  2COZ A;  3EGX B;  4C0F A;  3IQL A;  3QHS A;  2J06 A;  2KNB B;  2ECZ A;  1VQO A;  3EGD B;  1R77 A;  2CYZ B;  3LGL A;  2MYS A;  5HK0 A;  2E4H A;  4E7L A;  4X9D A;  5KYN A;  5AT1 B;  2WAC A;  4C92 C;  1BCO A;  1YWP A;  3SHW A;  3U23 A;  1N6A A;  2JZ2 A;  3H41 A;  3OYJ A;  2EW3 A;  1IHV A;  3QWX X;  1X27 A;  2O4X A;  3VUB A;  5L23 A;  4PJO G;  1V76 A;  2XK0 A;  2X9H A;  4OB2 B;  1NM7 A;  2DJQ A;  3RKY A;  2F2X A;  2P0P A;  5I2M A;  4M77 F;  3MHX A;  2J6O A;  3VS4 A;  3CCU A;  4ME7 A;  2DO3 A;  3A8M B;  1Z9Z A;  1BI0 A;  2LQN A;  5C6S A;  3UF4 A;  3FJP A;  1G3W A;  2EJ9 A;  3INZ A;  1W70 A;  1R0C B;  4RTT A;  3HP9 A;  3S3O A;  1FMW A;  1M1K U;  4RTU A;  4MZT A;  1U06 A;  2XU8 A;  9ATC B;  5GAM d;  3CCR T;  1OQK A;  3CCV Q;  4HCZ A;  4FW1 A;  4M4Z A;  2A28 A;  4JLI A;  4HT8 A;  2G6F X;  1KQS A;  2BTT A;  4ZNX A;  2C06 A;  1ZA2 B;  1FX7 A;  4M7A B;  4AFS C;  2V8K A;  1N5Z A;  4OMP A;  4PKC C;  5IH2 A;  3FEO A;  4Y92 A;  1C1A A;  3CCM T;  2CS7 A;  3EG9 A;  2M16 A;  3H0I A;  4JRQ A;  3QJY A;  2LQ8 A;  4B9W A;  2K3B A;  3D7S B;  3CBM A;  1GCQ A;  2O9V A;  2X35 A;  1QQJ A;  3QYH B;  1ZHI A;  4PJL A;  1QCO A;  1YIT A;  3GPL A;  3NGP A;  3EFO B;  3M4Y A;  2L3R A;  1D1C A;  3L2U A;  2L2P A;  1XQH A;  3M53 A;  5FU7 C;  3ZFJ A;  1I0C A;  4JRP A;  4KUD K;  4C8Q F;  2JXB A;  2DIQ A;  1XJW B;  2A37 A;  4IUV A;  4FSX A;  2EJG A;  1BK2 A;  1QKX A;  2KK4 A;  3MO8 A;  2BE9 B;  1X69 A;  2MK5 A;  2DER A;  2DD5 A;  2P4R A;  1TUD A;  5FU6 B;  4OB1 B;  1FXX A;  1QVG P;  2LVM A;  5GAM f;  1SF9 A;  3JCM P;  3G4S Q;  3NFC A;  1C6V X;  3M54 A;  1DJ7 B;  1VQ7 Q;  2BE7 D;  4M75 B;  1PRM C;  2CZ1 B;  4KRT A;  2VV5 A;  2I2L A;  2GTO A;  1UJY A;  4XK8 E;  1TU0 B;  1W2B P;  2F2V A;  5GAM j;  1WQ7 A;  3OS1 A;  2JN0 A;  2AK5 A;  1K9M U;  4EDU A;  1KC8 U;  3SB2 A;  5GAO p;  3PTA A;  2LT4 A;  2HBW A;  2CUD A;  5IXB A;  1UB4 A;  2ZCF B;  1UGV A;  2EGC A;  1WLP B;  4KBM B;  2HMA A;  4EIK A;  1GCQ C;  4DQ2 A;  4XTU A;  3FIF A;  1ZQ1 A;  5GAM g;  1ZBX A;  4KH1 B;  4NS5 A;  2DL5 A;  4GLK A;  3CME Q;  3CCJ Q;  2C0I A;  2YXY A;  3CCV A;  1VQ9 Q;  1PG5 B;  3CC4 A;  5GAN 3;  2DRM A;  2RI2 A;  3V8L A;  4BAC A;  1EZZ B;  2GQV A;  4PJO A;  3C94 A;  1ABO A;  2F5T X;  2EYQ A;  3CEY A;  2QGF B;  3M0S A;  5KCO A;  1VYT A;  2O9S A;  1GXI E;  4M7A D;  3QJ6 A;  2AT1 B;  2L3P A;  1H3H A;  3RMQ A;  3M4G A;  4LDX A;  1ZUK A;  1YCY A;  5GAN 8;  1VQP T;  1KQ2 A;  2NUT B;  1PKT A;  2CZ6 B;  4KUI A;  3FC3 A;  2DL8 A;  1VQ5 Q;  4EMK A;  1Q82 U;  1K9A A;  4F7U G;  3GOX A;  1WFW A;  1ZUU A;  1RAI B;  2DNU A;  3CC2 T;  3VS2 A;  1QP2 A;  1OYX A;  2CP5 A;  1YI2 T;  2EQJ A;  1TG0 A;  4M7A C;  3SWN B;  3ME9 A;  4RTX A;  4IUQ A;  5L8R E;  2DAQ A;  3H0F A;  2LCC A;  4FIB A;  4J8O A;  4CC7 A;  2BKD N;  4XU0 A;  1YJN Q;  2YLB A;  3QWY A;  3G4S A;  2FHD A;  2WSF E;  1IGQ A;  2VB6 A;  4LE9 A;  1VQ7 A;  2QA4 Q;  4JRK A;  3KUF A;  3UT1 A;  1G2B A;  1S72 Q;  4L59 A;  5GAM h;  2E5K A;  2MF2 A;  4HCK A;  4E7H A;  4MDW A;  1MV0 B;  2VKN A;  3QBY A;  1VQ6 T;  4M75 D;  2RN8 A;  3CD6 T;  2HL3 A;  4PJO C;  4N4G A;  3J7A F;  1Y0M A;  1Y7X A;  1UEC A;  2KRM A;  3HRT A;  1VQL Q;  4ZTJ A;  4PLI A;  1OU8 A;  3A1P A;  5LJ5 d;  2QDL A;  5IXF A;  1IGU A;  3FJ5 A;  4M78 G;  1I4K 1;  3O5Z A;  4FU6 A;  2PUO B;  4HXJ A;  4O6J A;  4VUB A;  2A7Y A;  3R6O A;  4PFP A;  3SDZ A;  1B3Q A;  3CME A;  1NYF A;  3CCJ A;  3TU4 K;  3E19 A;  3OS2 A;  2DF6 A;  3VJP A;  4X1V A;  3OW2 S;  1VQ9 A;  3FB9 A;  4M75 C;  1K4U S;  4LDV A;  3VYG A;  1OI1 A;  2RQR A;  1UE9 A;  1UGR B;  1M1K C;  2MPX C;  1H92 A;  4F17 A;  1MND A;  4C92 G;  3CMA Q;  5GMK e;  4OMF B;  4FM4 B;  1JEG A;  1YJW Q;  4JRI A;  2AKL A;  3RBB B;  2KBT A;  2D8H A;  2RH2 A;  5J39 A;  4XU1 A;  2RI3 A;  3QXE B;  5J26 A;  1VQ5 A;  2DXT A;  1QVF P;  2A08 A;  4TVR A;  3OYK A;  2KDS A;  5FLX E;  2AZS A;  4JS4 A;  2E1H A;  2NYS A;  4J83 A;  4MMK A;  4RCC A;  3TSW A;  4DBF A;  5DM7 R;  1K8A U;  3M58 A;  5CKH A;  2KQW A;  1IB8 A;  3M9Q A;  4BY6 C;  1Y96 B;  4ESR A;  2DEU A;  5DLQ E;  1Z9Q A;  1R0B G;  5GAO n;  2OAU A;  3N5B B;  1RLQ C;  1EIF A;  1WZO A;  3I35 A;  3NTK A;  4BE2 A;  1PWT A;  3VV0 A;  1YJN A;  4FCY A;  1I07 A;  4LDW A;  1UGQ B;  5EG2 A;  2HCK A;  3MEV A;  4RTV A;  2E10 A;  3AT1 B;  1M27 C;  3TEE A;  3V7C A;  4JPB W;  2QA4 A;  2LX9 A;  3S3N A;  2D8J A;  2JM8 A;  1M2V A;  3I5S A;  4F7U A;  3T9N A;  1H8K A;  3JCM V;  2EIF A;  4ELZ C;  1OOT A;  2RD1 A;  2YRD A;  1M1K R;  1MHN A;  2EGE A;  2D0N A;  3JB9 D;  5CQX A;  1T0H A;  5GAO m;  1CKA A;  2DKG A;  1ZX6 A;  3PMI A;  4JLG A;  1D1A A;  1GRI A;  3BDL A;  2EYY A;  2LNH B;  5GAN d;  4N4I A;  1WHM A;  2XIC A;  1NLP C;  4OMM A;  4MML A;  4ZGD B;  4XU3 A;  1KC8 C;  3CBP A;  1NBE B;  1RAG B;  2EJF A;  2DJZ A;  3URG A;  5GAO l;  1RI9 A;  3JCM g;  2RQU A;  4M7D A;  3KXT A;  1D3B B;  5CQY A;  5KYW A;  1MMA A;  1VQO Q;  2ED0 A;  4P5N A;  1UFF A;  4AG2 C;  2OX7 A;  4Q5W A;  1NE8 A;  4HCB A;  2ABL A;  2M51 A;  4IUU A;  3CMA A;  1W6X A;  3PIP A;  3EG0 A;  4LUD A;  4J7F A;  2YUO A;  3CPW S;  1BCM A;  3QII A;  4F16 A;  5GMK i;  1ZSZ A;  3H6Z A;  4MZM A;  1TTH B;  4DBH A;  3CXC A;  5A0D A;  4QT7 A;  1ARK A;  1JU5 C;  2E6Z A;  5LJ3 d;  2PZ1 A;  1OX9 A;  1WXB A;  2E64 A;  1D1B A;  4M78 A;  2W10 A;  2A3L A;  3QYG B;  4PK4 A;  3KFV A;  4FYY B;  1D0Y A;  5A0L A;  4F04 B;  2QXF A;  1HD3 A;  2MI6 A;  3MEU A;  4R56 A;  4BE1 A;  1N27 A;  3BE3 A;  1OV3 A;  2P0K A;  2FPD A;  2WSC E;  1BI3 A;  1NZ9 A;  3M0Q A;  1TSF A;  5GAN f;  3NTI A;  2RI5 A;  1NJI C;  1PKS A;  2EAY A;  2A36 A;  4C92 A;  2K2M A;  1LCK A;  1KD1 U;  4QVZ A;  2WSE E;  2RJF A;  1JB0 E;  1OX8 A;  4JUV A;  3CCR Q;  2JNG A;  1WJR A;  2COY A;  1KC8 R;  2EQM A;  3OY9 A;  4AT1 B;  1QLY A;  2HAX A;  2DFU A;  2F1L A;  1SSH A;  2X4W A;  5CO7 A;  4M78 D;  4GY5 A;  5GAN j;  2O31 A;  1YIJ T;  2CP7 A;  3CCM Q;  3OYD A;  1ZUY A;  1VQ8 T;  1M90 U;  1O75 A;  3PMT A;  3JCM h;  2VGN A;  2XDP A;  2H8H A;  2OI3 A;  5D6Y A;  2PU9 B;  5LJ3 f;  1M1G A;  2JS2 A;  2YSQ A;  2LJ1 A;  3RNJ A;  4NOY A;  2RJC A;  2QEX T;  5CKD A;  5GAN g;  1Q86 U;  4L6V 5;  2KAF A;  3DB4 A;  2RK2 A;  4RTW A;  2K79 A;  3M0T A;  2X3X D;  4M77 B;  2V26 A;  3L42 A;  2IG0 A;  2R57 A;  2F2W A;  1MUZ A;  4M78 C;  4M7A G;  3OYB A;  2FPE A;  2GBQ A;  2DVJ A;  4PJN A;  5LJ3 j;  1YHQ T;  2VXE A;  1AEY A;  2W0Z A;  3VS6 A;  2LJ3 A;  4AFZ C;  3MP8 A;  2YRV A;  3HFN A;  3MKD A;  1PSE A;  4DBR A;  1NJI R;  1GCP A;  1E6G A;  1PC0 A;  4E7Z A;  1WI7 A;  4QW2 A;  3OSS C;  2ZPG B;  2KVQ G;  1KQS P;  5LJ3 g;  4EPC A;  2FG0 A;  3LYI A;  2BZX A;  3MP6 A;  4Z88 A;  1BB9 A;  2CDT A;  2EWN A;  5GAO r;  3H9N A;  4PL6 A;  1HSQ A;  1WHH A;  3P8B B;  4RG2 A;  2JTE A;  4M77 E;  5KYY B;  3PVL A;  4LDU A;  4RMO A;  1RAA B;  2E65 A;  4K11 A;  5GJV B;  1JJ2 A;  2ATC B;  4J9H A;  3EFS A;  3BDU A;  4B9X A;  1YJ9 T;  2KR3 A;  1K8A C;  2DET A;  5GAM e;  2RMO A;  1BIA A;  2P0Q A;  4II1 A;  1WNL A;  2F69 A;  2LZ6 B;  2JTF A;  1VQ4 T;  3MEA A;  2DBM A;  4AFU C;  3I56 T;  4M75 G;  4C8Q B;  1BI1 A;  1UTI A;  1D09 B;  5GAN h;  3CCR A;  1WJQ A;  1W1F A;  4J9B A;  1QVG S;  1WXT A;  4A4E A;  3CC4 Q;  3REA B;  5IHI A;  2CT4 A;  4E7K A;  1FWZ A;  3EGX A;  3CCM A;  3WVD B;  1G3S A;  4ZGE B;  1NPP A;  3EGD A;  3NHN A;  1U1T A;  2NUP B;  1HXD A;  3PGG A;  1TS9 A;  4J5Y A;  4DEY A;  2ROT A;  2DXB A;  1H64 1;  1V1C A;  2CRE A;  1VQP Q;  4FT4 A;  1W2B S;  4A54 A;  4ZGJ B;  2L89 A;  1RUW A;  2K4Y A;  1UEB A;  1WPY A;  2O88 A;  5LJ3 h;  1GFC A;  2DTH A;  1UGS B;  2AHJ B;  3RDV A;  5KCH A;  5IT9 E;  4C8Q E;  5FRO A;  2DMO A;  1K0X A;  1YI2 Q;  2L3Q A;  2K5L A;  4KGX B;  5DY9 A;  3S6W A;  2QTX A;  1XOV A;  2JTM A;  2R58 A;  1WHG A;  2JMA A;  3CCL T;  4FSS A;  3NPF A;  1K8A R;  3C12 A;  4ZTF A;  2RM4 A;  2CP6 A;  2JM9 A;  4RUG A;  2V1R A;  5EC7 A;  2KGT A;  2X4X A;  5HY6 A;  2QK0 A;  3PVQ A;  4JDS A;  2ROL A;  3HHT B;  5CVI A;  1SG5 A;  2E3H A;  5KE3 A;  2K3X A;  2KT8 A;  3OS5 A;  1VQ6 Q;  4CC2 A;  4BUG A;  1M9S A;  3CCQ T;  4M7A A;  5KE2 A;  3OMG A;  2OAW A;  4OMO A;  1Q81 U;  3I9Q A;  2DD4 A;  5FWB A;  3QDF A;  2LCS A;  3JB9 G;  1B34 B;  1SRL A;  3EFO A;  4GLM A;  2CH4 W;  4PJO F;  3VS7 A;  2LDM A;  1WHK A;  3CC7 T;  2MCN A;  4C8Q D;  1KD1 C;  2RQV A;  3RER A;  4C0D B;  2J6F A;  3JCM c;  1IHW A;  5CCA A;  4J9I A;  2E5Q A;  5CIU A;  1YNZ A;  3JB9 J;  2Y4Y A;  1QMC A;  1VQP A;  2JUF A;  1TWB A;  2X4J A;  5I2S A;  2EYZ A;  1AWO A;  1M90 C;  2RNA A;  2GTJ A;  4ZN1 A;  3CC2 A;  2JW4 A;  2BIV A;  3SD4 A;  5IAY A;  4M75 A;  1QWF A;  1JRI A;  1OPK A;  4QQ6 A;  2A0F B;  2J05 A;  2VC8 A;  1AWJ A;  1W2B A;  2D1X A;  2E6N A;  2FZC B;  1Q86 C;  1YI2 A;  1BBZ A;  1QCF A;  2HQH A;  2DX1 A;  1WHJ A;  2ED1 A;  1AOJ A;  3PNW C;  1VYV A;  3O8V A;  1N9S A;  2DL3 A;  2QAZ A;  1TH7 A;  2KXD A;  2DTI A;  2ZPI B;  3JCM W;  1VOM A;  1LJO A;  4BI8 B;  1UHC A;  2C0O A;  4HKE A;  1CKB A;  3X20 B;  3RMS A;  3FLG A;  2LRQ A;  3GBQ A;  4J9D A;  2FRY A;  1AT1 B;  2CZ0 B;  2G3R A;  4PJM A;  1CSK A;  2OJ2 A;  1KD1 R;  3LGF A;  3BY7 A;  1VYU A;  8ATC B;  3JV3 A;  2LQK A;  3GP8 A;  1LOJ A;  5LJ5 e;  1VQ6 A;  3CD6 A;  2FRW A;  4N4H A;  4E47 A;  1QVF S;  1TUG B;  4E7S A;  2I0N A;  5CK9 A;  3QUI A;  5KYU B;  4LD6 A;  4XQ3 A;  2LT1 A;  2XID A;  5FU6 C;  2BZY A;  4LNP A;  1X43 A;  2DXU A;  1M90 R;  1VQK T;  1I8F A;  3M56 A;  2NUT A;  1U5S A;  3HSB A;  2DE0 X;  4J6Y A;  4ORZ A;  4E7I A;  2NLU A;  3DLM A;  3OYM A;  3E1S A;  1Q86 R;  5DLO A;  2AKK A;  3M57 A;  3X24 B;  1NLO C;  3JCM d;  2MOX A;  2DA9 A;  3OYY A;  2B8A A;  1YCS B;  1C0M A;  1ZBJ A;  3SWN A;  4ELY C;  3UA6 A;  2DLP A;  1FMV A;  3EH2 A;  1V29 B;  3ULR B;  5FRN A;  3OBY A;  5GAN 2;  1K73 U;  3HPW A;  2FYK A;  3HFO A;  3I55 T;  4V2S A;  3H0H A;  3A8G B;  4JJC A;  4J7I A;  4KGV B;  2HL5 C;  3VYH B;  4PLL A;  1VQM T;  1U8R A;  4E2F B;  3GNF B;  1PHT A;  4OGE A;  5KYX B;  2NUZ A;  4IIM A;  4AFQ C;  1NEG A;  4C0D C;  4A4H A;  4JJB A;  2ESW A;  4WTO B;  1M8M A;  3RKX A;  2VXF A;  3WVE B;  3A8L B;  1WIE A;  4XTV A;  3OYF A;  1T3S A;  1B07 A;  4XTZ A;  2DEQ A;  2L0A A;  3THK A;  4F7U F;  1LVK A;  4J9G A;  2QTV A;  2OTL T;  2PVD B;  2DVE A;  2HEQ A;  3JCM f;  3UPU A;  4OP0 A;  3OYI A;  1YIJ Q;  2X51 A;  1WA7 A;  2VVK A;  2GNC A;  4HVW A;  2X4Y A;  1M5Q 1;  3V8K A;  4QQD A;  4XTX A;  3CXC P;  2EYW A;  2HZY A;  3SWN C;  5GAN e;  2YRC A;  3P8H A;  1S72 T;  2EFI A;  4QKU A;  4ANJ A;  2D6F A;  2QG9 B;  2K7A A;  4IKF A;  1VQN T;  2FVU A;  4C5H A;  4M7D E;  4Z89 A;  2RO0 A;  1K9M C;  2BZ8 A;  3OB9 A;  3TSZ A;  2K57 A;  3QDR B;  4M7D F;  1EFN A;  3QPH A;  5FRM A;  2GGR A;  1VQL T;  2M02 A;  3GNG A;  4X34 A;  4OMN A;  2CP3 A;  1Q81 C;  1YHQ Q;  2CZ7 B;  2GF7 A;  1X6G A;  3G71 T;  4Y91 A;  3NMZ C;  3UDC A;  4BDZ A;  4B6M A;  1Y96 A;  1AVZ C;  1AZG B;  2EGA A;  5A2Q E;  1KSW A;  2AZV A;  3OW2 A;  2RJE A;  1GBR A;  2FPF A;  5LJ3 e;  1M3A A;  1SHF A;  2KY9 A;  3OYC A;  4DA4 A;  4M78 F;  1PD1 A;  4M77 G;  2ZAE A;  2LP5 A;  3VRY A;  2M1H A;  1OU9 A;  1QP3 A;  3C4S A;  3X25 B;  4RTZ A;  4FYV B;  5IHN A;  1G3T A;  3CCE T;  1ZA1 B;  4DOV A;  1M3C A;  1Y71 A;  4X9C A;  1YJW T;  1WGS A;  2DXC A;  1KJW A;  1Q82 C;  1XNI A;  3BW1 A;  4Z02 A;  1LNX A;  1PD0 A;  3CPF A;  4CC4 B;  4C92 F;  1PM3 A;  1YJ9 Q;  3JB9 H;  1BI2 A;  3BFM A;  2FEI A;  5D7U A;  1YWO A;  2HQX A;  3UAT A;  2L3S A;  4JZ4 A;  1VA7 A;  3A5Z B;  2NWM A;  3I56 Q;  1TOV A;  3E2U A;  3A8O B;  1T3L A;  2RHY A;  2ZGW A;  4PJJ A;  3PE0 A;  3G6E T;  1K9M R;  2BUD A;  1FMK A;  3HTR A;  3I5R A;  3VS3 A;  2ZPF B;  5CKE A;  3CCS T;  1JXM A;  1Q81 R;  2GFA A;  1U1S A;  2CKK A;  5I22 A;  1HJD A;  3E9F A;  3TQ7 P;  1YIJ A;  4FL6 A;  1KQS S;  2JJ9 A;  1UJ0 A;  4C5I A;  1VQ8 A;  2PQW A;  3PT9 A;  1D3B A;  2RJD A;  1RLP C;  1YBY A;  2CSI A;  4QQG A;  3FDR A;  2COW A;  2O4X B;  3RUX A;  3G7Z A;  5GMK m;  2OTJ T;  2CT3 A;  4PFZ A;  1SEM A;  2SRC A;  2ZZD A;  2RHZ A;  2QEX A;  4D6W A;  2RPN A;  1X6B A;  1ZLM A;  4C8Q G;  4FYW B;  2DL4 A;  1GBQ A;  4EMH A;  2XI9 A;  4J9C A;  1M3B A;  1N8R U;  2E3I A;  3QZ9 B;  1JJ2 P;  2KE9 A;  1RAF B;  3X28 B;  1N9R A;  2ZPE B;  4OVA A;  2CP0 A;  5GMK l;  2QQS A;  4BE0 A;  1YHQ A;  1Q82 R;  2XMF A;  1VIE A;  2RHX A;  1J3T A;  3OYN A;  3VUZ A;  2XDB A;  5GAO q;  3ER0 A;  3GLX A;  4A4F A;  4N0A C;  4BB7 A;  2KT1 A;  4RG8 A;  4XTW A;  2XD0 A;  3V7S A;  2MAM A;  5J3B A;  2E70 A;  2VYT A;  5LL6 S;  3L2V A;  3C95 A;  1X2Q A;  1VQO T;  3EG9 B;  3OYE A;  3VU3 C;  1U3O A;  3M5A A;  2DTO A;  4CI0 C;  1ACM B;  2EYX A;  3CPW A;  1XTD A;  2DPP B;  3CCQ Q;  1K73 C;  2K3Y A;  3EGU A;  5I21 A;  3HRS A;  1KK7 A;  1H3Z A;  1I1J A;  2V8J A;  3QZ5 B;  3VS1 A;  3DLL A;  1X6O A;  1SRM A;  3CBO A;  1YJ9 A;  5GAN 5;  1QCN A;  2C0T A;  4OF1 A;  1G5V A;  4DOW A;  4IUR A;  2LMJ A;  1VQ4 A;  4HT9 A;  3LH5 A;  1SKU B;  2HDA A;  3LWI A;  2DZ9 A;  5FWC A;  3I56 A;  1Q7Y U;  1G8X A;  2O2O A;  2KYB A;  4JZ3 A;  2H3E B;  3CCU T;  1WDX A;  3JCM J;  1K0S A;  3CC7 Q;  4M77 A;  2LCL A;  3V7R A;  4EMG A;  2YUQ A;  3RKW A;  3R6N A;  2RHI A;  2D9T A;  3CQT A;  1ZSG A;  3VS0 A;  5CAI A;  1OUL A;  3ZL7 C;  6AT1 B;  1SSF A;  4C5E A;  1KHC A;  2Y4X A;  7AT1 B;  3JCM Q;  1UG1 A;  5HCK A;  4HVV A;  3RIR A;  1WYX A;  2DBK A;  4OML A;  2PVG B;  2KSS A;  4JS5 A;  1O9S A;  2JS0 A;  3S3M A;  1AZE A;  3CC2 Q;  1QKW A;  3UA7 A;  2DK3 A;  2GCX A;  5HKC A;  2YWW A;  1K73 R;  5I11 A;  4OB3 B;  3OSV A;  4M77 D;  5KYY A;  4J9E A;  1YIT T;  3CCL A;  2DYI A;  3L2Q A;  3MJX A;  1NEB A;  4HVU A;  1JO8 A;  2QQA A;  2B86 A;  1VUB A;  2EKH A;  2M0O A;  1RAE B;  2J7I A;  3VS5 A;  5GAN 7;  4PJO B;  2GFU A;  4NL2 A;  3EAE A;  4J6W A;  3EG1 A;  3OQ5 A;  1KG1 A;  1K76 A;  1ABQ A;  4M7A E;  4C8Q A;  3J81 E; 
#chains in the Genus database with same CATH homology
 3SEM A;  2FRW A;  1ZX6 A;  2CH4 A;  1GRI A;  2PNI A;  2I0N A;  2EYY A;  2LNH B;  3IQL A;  2J06 A;  1NLP C;  3EHQ A;  2KNB B;  2ECZ A;  4OMM A;  2BZY A;  4LNP A;  1X43 A;  1U5S A;  1RI9 A;  4R0K A;  1OPL A;  2RQU A;  2YUP A;  2DE0 X;  2ED0 A;  4ORZ A;  3C0C A;  1UFF A;  4AG2 C;  4WCI A;  1BU1 A;  2EBP A;  1YWP A;  3SHW A;  3U23 A;  2RQW A;  4RTY A;  2ABL A;  2DRK A;  2M51 A;  2KYM A;  1W6X A;  2EW3 A;  2DM1 A;  3H41 A;  3QWX X;  3EG0 A;  4F14 A;  4LUD A;  2YUO A;  1X27 A;  2AKK A;  5L23 A;  1NLO C;  2MOX A;  2DA9 A;  4F16 A;  1YCS B;  1NM7 A;  1ZBJ A;  2DJQ A;  2F2X A;  4QT7 A;  1ARK A;  1JU5 C;  3UA6 A;  2PZ1 A;  1WXB A;  2DLP A;  2J6O A;  2W10 A;  3VS4 A;  2KXC A;  3ULR B;  3KFV A;  1Z9Z A;  2LQN A;  1HD3 A;  3UF4 A;  3H0H A;  4JJC A;  2V1Q A;  1W70 A;  1OV3 A;  4RTT A;  1UHF A;  2FPD A;  2RQT A;  1IO6 A;  3M0Q A;  4RTU A;  1U06 A;  3A98 A;  5FW9 A;  1PKS A;  1PHT A;  2A36 A;  4M4Z A;  2NUZ A;  2K2M A;  2DL7 A;  4IIM A;  1LCK A;  2A28 A;  1NEG A;  2IIM A;  4AFQ C;  2G6F X;  2BTT A;  4ZNX A;  4JJB A;  2ESW A;  3M0P A;  4AFS C;  1N5Z A;  4OMP A;  1M8M A;  5IH2 A;  2J6K A;  4Y92 A;  1QLY A;  1WIE A;  1T3S A;  1B07 A;  2L0A A;  3H0I A;  1SSH A;  1PNJ A;  3THK A;  4JJD A;  2O31 A;  2K3B A;  5ECA A;  4J9G A;  2HEQ A;  1ZUY A;  1GCQ A;  2O9V A;  2H8H A;  1FYN A;  3NGP A;  2OI3 A;  2CUB A;  4GBQ A;  2JS2 A;  2L2P A;  1WA7 A;  2YUN A;  2YSQ A;  2LJ1 A;  3RNJ A;  2VVK A;  1I0C A;  2GNC A;  4HVW A;  2JXB A;  2EYW A;  1MV3 A;  2A37 A;  4RTW A;  2JMC A;  1AWW A;  2K79 A;  1BK2 A;  3EHR A;  1QKX A;  3M0T A;  2X3X D;  4IIO A;  1X69 A;  2F2W A;  1MUZ A;  1M30 A;  2P4R A;  3M0R A;  1TUD A;  2K7A A;  2X3W D;  2FPE A;  4E6R A;  2GBQ A;  1UDL A;  2DVJ A;  4LUE A;  4Z89 A;  1AEY A;  2W0Z A;  3VS6 A;  2BZ8 A;  2LJ3 A;  4AFZ C;  3TSZ A;  1EFN A;  2KRN A;  1AD5 A;  2GGR A;  4OMN A;  1GCP A;  1WX6 A;  1E6G A;  1X6G A;  1PRM C;  1WI7 A;  3NMZ C;  4KRT A;  2EVR A;  1G83 A;  1AVZ C;  2GTO A;  1AZG B;  2EGA A;  4DEX A;  2FG0 A;  1KSW A;  2BZX A;  1UJY A;  2AZV A;  4Z88 A;  1JXO A;  2F2V A;  1UUE A;  1GBR A;  1BB9 A;  2CDT A;  2FPF A;  1M3A A;  3EG2 A;  1SPK A;  1HSQ A;  1SHF A;  2VWF A;  2AK5 A;  2JTE A;  3PVL A;  2LP5 A;  4K11 A;  3VRY A;  2K9G A;  5GJV B;  2HBW A;  2CUD A;  4RTZ A;  5IXB A;  5IHN A;  1UGV A;  2EGC A;  1WLP B;  4J9H A;  4EIK A;  1GCQ C;  2KR3 A;  2DL5 A;  1M3C A;  2RMO A;  2C0I A;  1K1Z A;  2EPD A;  1KJW A;  2LZ6 B;  2DBM A;  4AFU C;  4CC4 B;  2DRM A;  1UTI A;  2FEI A;  1W1F A;  4J9B A;  1YWO A;  1ABO A;  3UAT A;  4D8D A;  2L3S A;  3M0S A;  4JZ4 A;  1WXT A;  1VYT A;  1VA7 A;  2O9S A;  2NWM A;  3REA B;  5IHI A;  1Y57 A;  1H3H A;  2L3P A;  1SHG A;  1T3L A;  3PE0 A;  2CT4 A;  1FMK A;  1ZUK A;  3I5R A;  1TUC A;  3VS3 A;  1PKT A;  1YN8 A;  2DL8 A;  1JXM A;  1K9A A;  3NHN A;  1WFW A;  1ZUU A;  5I22 A;  1HJD A;  2DNU A;  4DEY A;  2ROT A;  1UJ0 A;  1V1C A;  3VS2 A;  2CRE A;  1A0N B;  1RLP C;  1RUW A;  2CSI A;  2EQI A;  2LQW A;  2O88 A;  1T0J A;  2CT3 A;  3M0U A;  1SEM A;  1TG0 A;  1GFC A;  2SRC A;  1KIK A;  2RPN A;  1X6B A;  1ZLM A;  2DL4 A;  1GBQ A;  4RTX A;  4J9C A;  1M3B A;  2DMO A;  1K0X A;  2L3Q A;  3H0F A;  4AG1 C;  4CC7 A;  1XOV A;  2YDL A;  2KE9 A;  3QWY A;  2JMA A;  1NG2 A;  2DYB A;  4CC3 A;  4FSS A;  4OMQ A;  3NPF A;  4LE9 A;  2XMF A;  1G2B A;  2JM9 A;  2E5K A;  1J3T A;  4RUG A;  4HCK A;  2V1R A;  5EC7 A;  1GFD A;  1MV0 B;  4J9F A;  2VKN A;  2KGT A;  3PVQ A;  2ROL A;  2KT1 A;  2RN8 A;  2M0Y A;  1AWX A;  1Y0M A;  1UEC A;  1WXU A;  2KRM A;  1QWE A;  1YP5 A;  1PRL C;  2KT8 A;  4CC2 A;  4LN2 A;  1X2Q A;  2QDL A;  5IXF A;  2PTK A;  2HSP A;  4Z8A A;  3FJ5 A;  1U3O A;  3O5Z A;  2EYX A;  2OAW A;  4HXJ A;  2LJ0 A;  2YT6 A;  1B3Q A;  1KFZ A;  3EGU A;  1NYF A;  2DF6 A;  4OMO A;  4X1V A;  1I1J A;  3I9Q A;  3EG3 A;  3VS1 A;  1K4U S;  5FWB A;  2LCS A;  1SRM A;  2FO0 A;  2RQR A;  2RF0 A;  2C0T A;  1UE9 A;  2CSQ A;  1SRL A;  1X2K A;  2LMJ A;  2LX7 A;  4GLM A;  3LH5 A;  1H92 A;  2CH4 W;  4F17 A;  2HDA A;  3VS7 A;  2JT4 A;  2DIL A;  1GL5 A;  5FWC A;  2MCN A;  1S1N A;  2O2O A;  2RQV A;  1JEG A;  2KRO A;  2J6F A;  2KYB A;  2AKL A;  4JZ3 A;  3TVT A;  3RBB B;  2KBT A;  2K6D A;  2D8H A;  1WDX A;  1K0S A;  2KRS A;  2MIO A;  4J9I A;  1YNZ A;  2ENM A;  2A08 A;  2YUQ A;  3VRZ A;  2AZS A;  3R6N A;  3TSW A;  3CQT A;  1ZSG A;  3VS0 A;  2EYZ A;  3ZL7 C;  1AWO A;  2KEA A;  2RNA A;  2GTJ A;  4ESR A;  1UG1 A;  2JW4 A;  1Z9Q A;  1QWF A;  1OPK A;  5HCK A;  1NYG A;  4HVV A;  1WYX A;  2DBK A;  2J05 A;  1AWJ A;  4OML A;  1E7O A;  1RLQ C;  2D1X A;  2JS0 A;  1AZE A;  3I35 A;  1QKW A;  1BBZ A;  3UA7 A;  5GJW B;  1PWT A;  1QCF A;  2DX1 A;  2SEM A;  2ED1 A;  1AOJ A;  1VYV A;  1I07 A;  2DL3 A;  2HCK A;  4RTV A;  2KXD A;  1M27 C;  5I11 A;  3REB B;  4JPB W;  2D8J A;  4J9E A;  2JM8 A;  3I5S A;  1UHC A;  2C0O A;  4A63 B;  1CKB A;  1H8K A;  1NEB A;  1OEB A;  4D8K A;  1E6H A;  1OOT A;  3GBQ A;  1JQQ A;  2EGE A;  4HVU A;  1JO8 A;  2D0N A;  4J9D A;  2FRY A;  2B86 A;  2EKH A;  1CSK A;  2OJ2 A;  2J7I A;  1T0H A;  3VS5 A;  5IHK A;  1VYU A;  2GQI A;  3JV3 A;  3EG1 A;  1CKA A;  1K76 A;  1ABQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...