2O2OA

Solution structure of domain b from human cin85 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
75
structure length
75
Chain Sequence
TNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SH3-domain kinase-binding protein 1
publication title Investigation of Domain B from Human Cin85 Protein: Structure, Dynamics and Proline-Rich Motif Binding
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 6
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2o2oA00
1JQQA 2BZYA 2JM8A 5EC7A 2X3XD 1TUDA 1HSQA 2ROTA 1LCKA 1AVZC 1GCQC 4F14A 1PKSA 1RLPC 2GQIA 1J3TA 2NWMA 4K11A 1BU1A 1Z9ZA 3TVTA 1UG1A 1GBRA 2C0TA 1WXUA 2LMJA 4R0KA 4J9DA 2W0ZA 1YP5A 4AFUC 1SSHA 1Z9QA 2DJQA 2OJ2A 4FSSA 2C0OA 1GFDA 1MUZA 4M4ZA 3JV3A 4OMMA 2XMFA 3VS1A 1AZEA 4LUEA 2EW3A 2CH4W 2K3BA 1GL5A 2RMOA 4RUGA 5ECAA 1NG2A 4ZNXA 2DLPA 1GBQA 1A0NB 1ABQA 1W70A 2L3QA 3H0IA 1WXBA 2BZXA 2OI3A 2CH4A 1OEBA 1Y0MA 1NEGA 2GTOA 2YDLA 1NM7A 3RNJA 2GNCA 2FPEA 3EG1A 3UATA 4CC7A 2O88A 3SHWA 4JZ3A 4RTVA 2A08A 1YN8A 1U06A 1NEBA 2FO0A 2YT6A 3M0PA 1AWOA 2EBPA 3LH5A 3REBB 4RTTA 3M0RA 1UUEA 2ENMA 4AG1C 1I1JA 1N5ZA 1HD3A 4KRTA 3NHNA 1VYVA 2IIMA 1VYUA 3VS3A 2CUDA 2AZSA 2J05A 1GRIA 2EQIA 2O31A 3VRYA 2KGTA 1B07A 1PHTA 3TSZA 1AWJA 2JMCA 3H0HA 1WXTA 2EYXA 2MOXA 2M51A 3VS6A 4J9HA 2KEAA 4OMNA 4ESRA 4JZ4A 1UHFA 2CT4A 1T0JA 1WYXA 1X69A 1ZUUA 2OAWA 4Z8AA 5IHKA 4RTZA 1YWPA 2YUPA 2LZ6B 5GJWB 2EKHA 2J6OA 1RUWA 2JTEA 4J9GA 2K6DA 4EIKA 2A36A 2EGAA 3RBBB 1YNZA 2DL8A 2EGEA 2HCKA 4ORZA 2JM9A 3I9QA 2DVJA 1OPLA 1X2QA 2RPNA 4RTUA 2C0IA 5GJVB 1TG0A 1UHCA 2HEQA 2K2MA 1W1FA 4X1VA 2V1RA 2ED0A 1K4US 2LQNA 1E6GA 3THKA 1UTIA 2J06A 3NGPA 1WDXA 5FWCA 1PRMC 3VRZA 3VS0A 1OOTA 1RI9A 1QCFA 5FW9A 4JPBW 1VYTA 2MCNA 4HXJA 1IO6A 2KRMA 1M30A 4CC2A 1TUCA 2ESWA 1ARKA 1SHFA 3UF4A 3I35A 2J6FA 4HVWA 2X3WD 1ABOA 2KROA 2O9SA 4Z88A 2KT1A 2DBMA 4E6RA 3M0UA 1BBZA 1SPKA 1T3SA 2A28A 2BTTA 1K1ZA 4AFSC 2O2OA 2I0NA 1AZGB 2EVRA 4D8KA 5L23A 2JS0A 3M0SA 2HSPA 4IIOA 2FG0A 2DNUA 2MIOA 3PVLA 4A63B 2O9VA 3QWYA 1X6GA 2PTKA 3SEMA 2F2WA 1PKTA 3VS4A 2EYYA 1BK2A 2DL5A 1XOVA 1QWFA 2K9GA 3NMZC 2DMOA 1NLPC 2YUOA 2FRWA 1JXOA 3UA6A 1QLYA 2DL4A 5IHNA 1JXMA 1KJWA 5IHIA 1ZX6A 2ECZA 1K76A 2LJ1A 2NUZA 1X2KA 2EYWA 1ZBJA 2A37A 3R6NA 1NYGA 3VS2A 2KYBA 2LJ0A 1AWXA 1JEGA 2B86A 2F2VA 2L3PA 2DE0X 2DBKA 1I07A 2L2PA 1QKWA 2DYBA 2AKLA 2KRNA 2VWFA 4RTXA 3C0CA 1VA7A 2D8HA 2H8HA 4HVUA 1GCPA 2KXCA 1RLQC 3A98A 4J9EA 2EGCA 3EHRA 2YUQA 1M3AA 1SRLA 1ZLMA 1X6BA 1MV3A 1UFFA 1UDLA 2KNBB 1NYFA 2RQRA 4JJBA 2AZVA 4WCIA 2GGRA 1W6XA 3EGUA 1M3BA 2E5KA 1G2BA 2CDTA 4IIMA 2KRSA 1T0HA 1K9AA 1M3CA 2M0YA 4LE9A 2LQWA 2HBWA 1X27A 2FEIA 1X43A 3H0FA 1QKXA 2KXDA 4LNPA 2L3SA 2P4RA 5I11A 2LX7A 1T3LA 1G83A 1OPKA 2EPDA 1NLOC 1E7OA 1ZSGA 4F16A 1EFNA 1V1CA 2JT4A 2CSIA 1ZUKA 3ULRB 1SRMA 1BB9A 4J9CA 3TSWA 1GFCA 1JO8A 1YWOA 2L0AA 2AK5A 2FPFA 4CC3A 1WLPB 3QWXX 1WIEA 2LCSA 2CUBA 4AFQC 2G6FX 3I5SA 1I0CA 2DA9A 5FWBA 1Y57A 2JMAA 3VS5A 1M8MA 1AEYA 2GTJA 1PRLC 1FYNA 2KE9A 2GBQA 3GBQA 4LN2A 2KR3A 4Z89A 4JJDA 1K0XA 3IQLA 1CKBA 2ED1A 2JS2A 1AOJA 1KFZA 2DM1A 2RQWA 5HCKA 2PNIA 4F17A 2D0NA 2SRCA 1YCSB 2BZ8A 3ZL7C 4OMQA 2CSQA 3EG3A 1SHGA 2RQVA 2JXBA 2QDLA 2PZ1A 2YUNA 1SEMA 2V1QA 2D1XA 5IH2A 1U5SA 2W10A 2LNHB 4RTWA 2DILA 2F2XA 5I22A 1WX6A 2RN8A 2SEMA 3EHQA 5IXFA 1H3HA 1GCQA 3REAB 1H8KA 2DF6A 2KBTA 1WFWA 3PVQA 1AWWA 1CSKA 2EYZA 2ROLA 1QWEA 2DX1A 1ZUYA 4GBQA 2LP5A 1UGVA 1E6HA 2VVKA 3FJ5A 5IXBA 1WI7A 2DRMA 2ABLA 3O5ZA 1PWTA 2VKNA 4OMOA 3EG2A 2DL3A 2K7AA 1S1NA 2RQUA 1CKAA 1K0SA 1B3QA 1KIKA 3EG0A 1WA7A 4HCKA 4AFZC 3KFVA 3M0QA 1UJYA 4HVVA 3PE0A 4OMPA 2FRYA 2RF0A 1PNJA 3I5RA 3UA7A 4GLMA 3NPFA 3VS7A 3M0TA 4D8DA 3H41A 4DEXA 4J9IA 1UECA 2JW4A 1M27C 3U23A 4DEYA 2J6KA 1UE9A 2D8JA 2YSQA 1MV0B 2LJ3A 4J9FA 1AD5A 1U3OA 2DL7A 4JJCA 2CT3A 2KT8A 1JU5C 4QT7A 2FPDA 4LUDA 1KSWA 4AG2C 4OMLA 2KYMA 1HJDA 1OV3A 1FMKA 2AKKA 4CC4B 4Y92A 2CREA 2K79A 3CQTA 2J7IA 4J9BA 1UJ0A 1H92A 2DRKA 2HDAA 2RNAA 2RQTA 4RTYA
chains in the Genus database with same CATH superfamily
3E9FA 2X3XD 1TUDA 3X25B 2NYSA 1D3BB 4IUTA 3BW1A 1LCKA 4C8QD 2OTJQ 3HRTA 1YIJT 1PKSA 1WHMA 1RLPC 1C0MA 2GQIA 1QVGP 3M53A 2GFUA 1BU1A 1Z9ZA 3PT9A 1YJ9Q 2CP2A 2AIRB 3G7ZA 1SKUB 5C6SA 2KVQG 1YP5A 3CMAT 3OYMA 4AFUC 1SSHA 1TUGB 2DJQA 4ZGJB 3OYNA 1MUZA 4FYXB 2MI6A 3JV3A 2XMFA 3VS1A 1YJNQ 1YCYA 4WTOB 4M7DF 2RMOA 1M8VA 4LDWA 4ZN1A 2DLPA 1C6VX 4PJOD 2HZYA 5KYXB 1GBQA 2L3QA 3CCQQ 1XQHA 2GTOA 4RG8A 3NTIA 2FPEA 2E3IA 3OBYA 4M75G 2A08A 2E10A 1U06A 1NEBA 1IGQA 2DO3A 4RTTA 1EX4A 2CP7A 4KBMB 2LQKA 4BI3A 1HD3A 2M0OA 3OW2A 3ZFJA 3CPWS 5HK3A 4KGZB 3GF5A 4A4KA 1VYUA 3VS3A 2CUDA 5CVIA 2I2LA 1VQ7T 2EQIA 2J05A 4M75E 4A54A 1PHTA 3TSZA 1AWJA 4M77F 3OY9A 1C1AA 2DEUA 4OMNA 1RL2A 4ESRA 4M7AB 1VQ5T 2DXUA 5GMKh 1KK7A 1X69A 1QW1A 3VJPA 2ZZDA 2JN0A 3CCUA 2DYIA 3JCMW 2E41A 4J9GA 2P0QA 2WACA 4M75D 3BY7A 4M78A 3RBBB 1YNZA 2JM9A 4NL3A 1KD1C 1QCOA 4RMOA 4F7UG 2RPNA 1M9SA 1K73R 1R0BG 4HT9A 2K2MA 1VQ8Q 2RI3A 1Y07A 4X1VA 2OTLA 2RJFA 1VQ9Q 3EFOB 3CCEQ 2KI7A 4O5VA 2QDYB 5KH6A 3OS1A 1YI2T 4F7UE 2F1LA 1JJ2A 4J8OA 3RESA 3LGLA 3OYDA 3VS0A 3QBYA 4L6V5 4PJOB 3EG9A 2D6FA 5A0GA 1G8XA 3EGDA 1TUCA 5LJ3d 1SHFA 5FRNA 3I35A 2J6FA 1IRXA 1WPYA 3CC7T 3NFCA 5LJ5j 3RMQA 2O9SA 2Y4YA 4XTXA 5CIUA 5CKHA 5KCOA 2KT1A 3E9GA 1M90U 1BCOA 4BDYA 1N9SA 1BBZA 4RG2A 3CCSA 1KQ1A 2RH2A 2HD0A 2A28A 5D6XA 5CKEA 5GANd 1AZGB 2L89A 2COWA 2JS0A 3M0SA 3CCRT 5FU6B 3G4SA 3E1SA 3OYIA 3GP8A 4DOWA 4IUQA 1SG5A 3META 2DNUA 2MIOA 2B8AA 3FIFA 1M5Q1 1X6GA 2QQSA 1QVPA 1G5VA 1WGSA 2DMOA 2FZKB 2YUOA 4N4HA 1N8RC 3UA6A 3EFRA 5IHNA 2VGMA 2E6NA 5LJ5e 3LYIA 1ZBJA 2A37A 2RHYA 3R6NA 3VS2A 2X4XA 4FYWB 2K3XA 1AWXA 1JEGA 1S72Q 2E4HA 4C5EA 4BUGA 2DBKA 3QDRB 2AT1B 1I07A 1N8RU 2HSEB 4RCCA 5GAMd 1VA7A 2VXFA 2H8HA 2CYZB 3CPWA 2NUPB 2ZAEA 4J9EA 4L59A 3A8HB 1ZLMA 4QQGA 1X6BA 4QKUA 2BKDN 3G71T 3CCLT 1RACB 2H3JA 4WCIA 4PL6A 5CKFA 2QQBA 2KY9A 5FROA 1VQKT 4M77A 1D1CA 1Y96B 2HQHA 2LC4A 2LQWA 2K2VA 2K57A 2P0PA 3JB9F 2EFIA 1QKXA 2KXDA 4VUBA 3QJ6A 2L3SA 3OYCA 1LJOA 2HQXA 1F1BB 1OPKA 2HKQB 1E7OA 1NJIC 2JT4A 1SF9A 1WHLA 4II1A 3I56Q 1WQWA 4BI4A 4LDVA 2BIVA 2QEXQ 1JO8A 4PFZA 2L0AA 2FPFA 4CC3A 1W4SA 2EJ9A 4Z02A 1IGUA 2LCSA 2JUFA 3QDFA 8AT1B 3OYAA 2G6FX 3HKSA 3CCMQ 1YHQT 5FWBA 2QGGA 2LTOA 1AEYA 2KE9A 3IQLA 4EMHA 2ED1A 3VKIA 1B34B 2JS2A 2E6ZA 4DBQA 4Q5WA 4FCYA 3BE3A 3D7SB 4C92A 5GANg 2EWNA 2D0NA 1WJRA 1HXDA 2ZPEB 3ZL7C 1Q82U 1M2VA 1YIJQ 5GAOn 4KUIA 2JXBA 3VU3C 1BI3A 2YUNA 2V8IA 4B9XA 2JJ9A 1U5SA 2LNHB 3PMTA 4PJMA 3CCQA 4RTWA 4QQ6A 2SEMA 4A53A 5IXFA 1H3HA 1H8KA 4C0GA 3G6ET 5A2QE 1WFWA 1AWWA 3MEWA 1TSFA 3TU4K 3OYLA 1VQLT 4DBRA 1WI7A 2DRMA 2ABLA 1KC8U 1O9SA 4BD3A 3QO3A 4BB7A 1K0SA 5GAMg 1FXXA 4LXCA 5LJ3f 3JCMg 1AHJB 1MMDA 2MAMA 4MMLA 3M0QA 3CCJA 3CCVT 2HBPA 2K5LA 2FRYA 2LT1A 2JZ2A 3NPFA 3VS7A 3HRSA 4ELYC 2M9UA 2CP5A 2HL5C 2PVDB 1QVGS 4XU3A 2RK1A 5LL6S 3GOXA 1AD5A 1P92A 5GANf 2LX9A 2CT3A 1PG5B 2FPDA 4LUDA 4AG2C 3GIBA 4FT4A 2AKKA 4FW1A 3NTHA 2K79A 1RAAB 2J7IA 4J9BA 3JCMX 1VQ5Q 2RNAA 3GLXA 2RQTA 1WHGA 1VQ8A 2PUKB 1U1SA 4LD6A 2VB6A 3MHXA 1VQ9A 2CP6A 1GCQC 3CCEA 3JB9I 1IB8A 4PK4A 4UC4A 4K11A 4B6MA 3TVTA 3C94A 2C0TA 1M1FA 2R5AA 1YJWT 3PTAA 1X75C 2W0ZA 2DD5A 2YRCA 1QVFS 2RA2A 3CEYA 4HA8A 4M4ZA 1KG1A 2DZCA 5LJ5h 2EW3A 3PNWC 2CH4W 1GL5A 4M7AC 3RKYA 5ECAA 3MO8A 3FDRA 4ZNXA 4FW2A 5KYUA 1VQNT 2BZXA 2CH4A 3MP6A 1OEBA 1Y0MA 1NEGA 3VYGA 2DD4A 1O75A 2QAZA 3EG1A 3DLMA 4CC7A 2O88A 2DXBA 4C8QC 2DAQA 2FL7A 4MZTA 2WSFE 2NUTA 1HK9A 1Q86U 4AG1C 1I1JA 3JRZA 4XU1A 2GQVA 3HPWA 1G3SA 1VYVA 2IIMA 2ZPIB 3SDZA 2AZSA 4E7KA 1Q7YR 4NL2A 2CKKA 4C5IA 2KGTA 3CPFA 3MEVA 1B07A 2DTIA 2JMCA 3OMGA 2EYXA 2LCLA 5KYYA 2QA4T 3J7AF 2M51A 2XKOC 3CCRQ 4IUUA 5I21A 2CT4A 3INZA 2D0QB 2QTXA 4Z8AA 5IHKA 3CMET 1YWPA 3CC4Q 5GJWB 1WJQA 1RUWA 2PU9B 4EIKA 2A36A 2P0KA 4M78B 2DL8A 4C0DC 4ORZA 5GAN3 3I9QA 1LNXA 2CZ0B 2EQKA 3OYJA 1W2BP 4PJOG 3JCMV 2R57A 1JRIA 3V7SA 5GJVB 3SB2A 2HEQA 4PJNA 3I55T 5C0MA 2V1RA 2ED0A 1QVGA 4Y28E 4HT8A 1XTDA 1D0ZA 3TCJA 1M1KR 1UTIA 1BYMA 3NGPA 5FWCA 4JS4A 4PJOE 2LNVA 3TQ7P 1PD0A 3JCMb 3CCLQ 4JPBW 5GAOl 2WSCE 3EG9B 1IO6A 1M30A 1VQKQ 2E12A 3QUIA 1ARKA 3EGDB 2QTVA 3UF4A 2BUDA 4HVWA 2XDPA 4M75C 2YXYA 3CCMA 2KROA 1FMWA 2DBMA 3M0UA 2EQMA 3BFMA 1G3TA 1U1TA 4DQ2A 2R58A 3UT1A 2K5IA 4C92E 1SPKA 3ZEHA 5GAOq 1T3SA 2BTTA 2FB7A 4AFSC 2O2OA 4BE2A 1FX7A 4D8KA 2KAFA 5KCHA 2O01E 4QVZA 1RAGB 1BI2A 2XG8D 4IIOA 1VQ4T 1QVFA 3PVLA 2VGNA 1YHQQ 4A63B 4IKFA 3CCUT 2O9VA 2DXTA 3QIIA 3SEMA 2EYYA 3KBGA 1XOVA 2F5KA 4D6WA 4M7AF 2G3RA 1NLPC 2FRWA 1JXOA 5CKBA 4C92D 3JCMc 4PJLA 1JXMA 1KJWA 2MPXC 5GAOp 2QQ9A 3M54A 1ZBXA 3OYBA 4C8QF 1YFNA 4GLKA 3R6OA 2VC8A 2ATCB 3SWNC 2ZPBB 2RJCA 2EYQA 4RTXA 3JSCA 1PSFA 1GCPA 2KXCA 1UB4A 3A98A 2WSEE 4EDUA 5LJ5f 5FLXE 1SRLA 1MV3A 4JS5A 4ZTJA 1W6XA 2MWOA 3EGUA 3MJXA 4GY5A 4IUVA 1G2BA 5L8RE 1T0HA 4M77B 3O8VA 2M0YA 5DY9A 1KQSS 3M56A 4J7FA 1KD1R 4BY6C 1MMAA 1PD1A 1X27A 1X43A 3H0FA 2DKGA 2LDMA 4R56A 2P4RA 2QQAA 3LH0A 4BI8B 1G83A 1NLOC 1D09B 3CCVQ 1ZSGA 1V1CA 1Y7XA 4XTVA 4XTWA 4J6WA 1M90C 4J9CA 1VQ5A 2CS7A 4J83A 3EFSA 3G4ST 1GFCA 2DEQA 3X20B 1K73U 1YWOA 1WLPB 4AFQC 3I5SA 1I0CA 2VYTA 4JDSA 2X35A 4HKEA 1Y57A 3VS5A 3UPUA 3LW5E 4MZMA 3EGXA 3GBQA 2LRQA 2RHUA 4LN2A 3OYYA 1EIFA 1JJ2P 3OS0A 1CKBA 4FT2A 1M1GA 1IXDA 1WJSA 1I4K1 4FYYB 1YBYA 1KFZA 5M9OA 2DM1A 2FZGB 2PNIA 2X51A 4C92B 2E65A 3CXCS 4QVCA 3OBWA 1YCSB 1D0YA 2L8DA 4OB2B 3HSBA 2CP3A 3L42A 3LX7A 2QQRA 3JB9D 1M2VB 2PZ1A 5KYXA 4ZTFA 4HCBA 1SEMA 1Q95G 2D9TA 2KK4A 2V1QA 2HAXA 3PFSA 2D1XA 1K8AC 4M75F 1VUBA 4FSXA 3E19A 2F2XA 4ME7A 1WX6A 2RN8A 1FWZA 5KYWA 4M7DA 4AMCA 2RB6A 5GAN6 1GCQA 3REAB 3URGA 2YLBA 3SFMA 2ZGWA 1N6AA 2DK3A 1CSKA 2RJDA 4KUDK 5GAN5 2BE7D 1ZSZC 1ZUYA 1N8RR 4GBQA 1K8AU 2LP5A 1UGVA 1E6HA 2VKNA 4OMOA 2XD0A 3LWHA 3M55A 4A4GA 3OYHA 1MMGA 1VQNQ 5GAN4 3M9QA 2L5QA 1WA7A 5AYFA 4AFZC 4XAXB 1EZZB 1UJYA 1WHHA 2A3LA 2PVGB 3LGFA 1KHIA 1RAEB 1VQOT 3CCRA 3H8ZA 4DEXA 4J9IA 1UECA 2JW4A 2A7YA 3U23A 1BI1A 1MGQA 1QCNA 2LJ3A 1BCMA 4EMKC 4J9FA 2DTOA 3CC2T 3QZ9B 2JNGA 3CC4A 1QP3A 2DL7A 4F7UF 1VQPA 2KT8A 4C8QA 4DOVA 3CPWP 1VQ6Q 4KGVB 3C4SA 1HJDA 2QA4Q 5CQYA 3E2UA 1UEBA 2JOYA 2DRKA 4XK8E 4Y91A 3CD6Q 3GNGA 3CMEQ 1NJIR 1HSQA 2ROTA 3L2VA 1AVZC 5LJ3g 1KQSA 4F14A 2OTJA 3QPHA 1J3TA 5HK0A 4E7JA 3CCQT 1WNLA 4E7IA 1Q82C 2LMJA 1YJ9A 2XICA 2V8KA 4R0KA 2MF2A 4J9DA 3M58A 5A0DA 3OSSC 1Z9QA 1VQKA 2OJ2A 4FSSA 1I5LA 2E70A 2VASA 3QJYA 3I55Q 4OMMA 1ZQ1A 3M5AA 4LUEA 1YJNA 4RUGA 3HP9A 1NG2A 2EQUA 1MMNA 1A0NB 3H0IA 3S3MA 2V8JA 3OSVA 3OYEA 3CCJT 1KC8C 3UATA 3X24B 3N5BB 3SHWA 3CMAQ 3MKDA 3RUXA 3MP1A 1YN8A 1RADB 2YT6A 2CP0A 3M0PA 1AWOA 3LH5A 3REBB 4XQ3A 3CXCA 2NUTB 1YHQA 4JLGA 3FJPA 3Q1JA 1N5ZA 4KRTA 3NHNA 3QSUA 5DLOA 3JCMJ 1QP2A 4XTZA 2O4XA 5FU7B 1GRIA 3BDUA 4PLIA 2O31A 3VRYA 2A0FB 4IUPA 1R0CB 3H0HA 4M75A 4PLLA 1NZ9A 3WXMB 1WXTA 4M78G 5IT9E 2MOXA 5KYYB 3VUZA 3J81E 3VS6A 2KEAA 4JJNK 4IURA 4JZ4A 1M2OA 1Q81C 1VQ4Q 3FEOA 3C95A 1WYXA 3A1PA 1ZUUA 4RTZA 1VQ9T 5GAN2 2LZ6B 2EKHA 2HQEA 2J6OA 4MDXA 5GAOm 4M78E 2V26A 3VV0A 3PIOA 1VQ7Q 2RM4A 1Q81U 2QG9B 1VQMT 2EGEA 2XK0A 2DVJA 4MZPA 3L2QA 4RTUA 5GMKl 3QG1A 1UHCA 1W1FA 4NS5A 2BE9B 2ZPHB 4V2SA 2RK2A 2HL3A 2LQNA 1E6GA 3THKA 4M78D 3QYGB 4BDZA 4TVRA 3OA6A 1PRMC 3OB9A 3VRZA 2MMPA 4F7UA 1FMVA 2IVWA 3P8BB 6AT1B 1OOTA 1G3WA 1RI9A 1NPRA 3SWNA 3AT1B 1B7TA 3RMSA 3S3OA 2Y90A 2E3HA 4FL6A 3OYGA 1DJ7B 5LJ3j 5LJ5d 1UGPB 4N4GA 4ELZC 5CR2A 3M57A 1YITT 1ABOA 1WHKA 4E7SA 4E6RA 5HKCA 3DB4A 4LDXA 1YI2Q 1OX8A 3EAEA 1IZ6A 1Q86C 3HFNA 2F5TX 3V7CA 5GANj 2DTHA 2RHZA 5IAYA 1OZ2A 2RHIA 3CC7Q 2F2WA 4M7DE 2OAUA 4DBHA 2DL5A 2H3EB 2PQWA 2K9GA 3KXTA 2RD1A 4FM4B 2DL4A 5LJ3e 3QKJA 5IHIA 1ZX6A 1K76A 2NUZA 1X2KA 1KQ2A 2EKOA 3FLGA 1K9MU 2JVVA 1U8RA 1TH7A 2LJ0A 3L2RA 2B86A 2F2VA 2EQJA 1OI1A 1S72A 2DE0X 1TXQA 4M77G 4PJOC 1H641 2L2PA 1QKWA 2AKLA 3QZ5B 2K3YA 5GANe 4M7DD 1SSFA 4HVUA 1VQNA 1RLQC 3MEAA 5GAMj 1Q7YU 2KSSA 5CQXA 2MYSA 2YUQA 1M3AA 2CZ6B 1UFFA 1UDLA 2KNBB 4HCCA 2RQRA 1NBEB 2AZVA 4M77E 2MK5A 2GGRA 3EH2A 1MNEA 3MPUB 4JLIA 1M3BA 2E5KA 2CDTA 4IIMA 4EPCA 3H6ZA 1JB0E 1K9AA 3SD4A 3WVDB 4MMKA 4OB0B 2X4YA 5I2SA 3CCMT 2FEIA 4YTLA 4QW2A 2DZ9A 1I8FA 3NTKA 3ER0A 5FU6C 5CCAA 1ZSZA 1VQ6A 2EPDA 4N0AC 4RCBA 4F16A 3UDCA 4ZGEB 4X34A 1VQOQ 3PMIA 3G71Q 3I56A 4M77D 2OX7A 3AHUA 5GAMe 3TSWA 3CD6A 1QQJA 4FIBA 4ZN3A 2AK5A 2QEXA 3JCMe 5J39A 3QWXX 4C92G 5AT1B 3CMEA 3CC2Q 2CUBA 2CZ7B 2DJZA 4KGXB 5LJ5g 2JMAA 2ZPGB 2GTJA 2MWPA 4F04B 1M1KU 3L2WA 1FYNA 3EGXB 2KR3A 5KE3A 1K0XA 2GFAA 4A4FA 4EMKA 2XIDA 1I81A 3A5ZB 5HCKA 2FVUA 5KE2A 4MDWA 3CBPA 2IG0A 3HL8A 7AT1B 3I55A 3L1AA 2BZ8A 2RHXA 4OMQA 2FZCB 3EG3A 5IN1A 4QVDA 3OS5A 1YIJA 2GF7A 4LDUA 5IH2A 1LOJA 2W10A 3OQ5A 4PJJA 2DILA 5GAN8 3L2ZA 4E2FB 3MP8A 5KYWB 4M7DB 1RAHB 2JTFA 4CRIA 2DF6A 3CMAA 1WZOA 2K5FA 1TWBA 5KYNA 2YHTA 3C12A 1QVFP 3O5ZA 1PWTA 3EG2A 2DL3A 2OTLT 2GCXA 4JRIA 2RQUA 4OMFB 1CKAA 3V8KA 3OW2P 1B3QA 1NE8A 1KIKA 4HCKA 3CCJQ 5CO7A 2AHJB 2Y4XA 1ZA2B 1V29B 1PNJA 2VUBA 3G6EQ 4GLMA 2VXEA 2LQ8A 4D8DA 2QASA 2VV5A 4LD9K 1VQ4A 3RERA 1M27C 4DEYA 1UE9A 2YSQA 3V8JA 2HNIA 1VQLQ 2DVEA 2QGFB 1V76A 3JB9J 2LT4A 4XTYA 1JU5C 4QT7A 4PJOF 1K73C 4C8QB 5D6WA 1VQ7A 4C0FA 3FC3A 1OULA 2XU8A 4OMLA 3CCST 2KDSA 4CC4B 3JB9G 4Y92A 2CREA 2QI2A 3CQTA 3QYHB 2EJFA 3TEEA 5D6YA 1UJ0A 3V8LA 3DKMA 3JCMP 1H92A 4A4HA 1ZA1B 3LWIA 4AT1B 2L3RA 2DFUA 1OZ3A 5J26A 1WQ7A 2DETA 4XTUA 1JQQA 2BZYA 2JM8A 4N4IA 5EC7A 1D3BA 3QXEB 3OS2A 2QXFA 1UGRB 1KD1U 4CI0C 1M90R 3V7RA 2NWMA 2E64A 4C92F 2P4TA 1UG1A 1VQMQ 1GBRA 1WXUA 2RJEA 4FYVB 3OYKA 1XJWB 5FU7C 3X28B 2C0OA 1BIAA 1GFDA 5LJ3h 2CZ1B 3M59A 2CGHA 1AZEA 4C0DB 4QQDA 2PVOB 2K3BA 4KH0B 1YI2A 1ABQA 1W70A 2PUOB 1WXBA 2OI3A 2LCCA 1YJWQ 1ACMB 2YDLA 1RABB 1NM7A 3RNJA 2GNCA 4JRKA 1X01A 1OU9A 5GANh 3HRUA 1RI0A 4JZ3A 4KH1B 4RTVA 2DIQA 1K8AR 5DLQE 1VOMA 1PM3A 2LVMA 2FO0A 2EBPA 3M4YA 5HY6A 1PCXA 3M0RA 1UUEA 2ENMA 2X4WA 2COYA 1YITQ 4DA4A 3CC4T 3CC7A 4E7LA 1VQPT 1TOVA 1OQKA 5GMKm 2O4XB 5DM7R 4X9CA 4DBFA 4PFOA 3HFOA 4M75B 2X9HA 4M7AA 4J9HA 3UWNA 1UHFA 3A8GB 1IHVA 3M4GA 3L2UA 3WVEB 1T0JA 2DPPB 1AT1B 4X9DA 2OAWA 4C0ZA 4BE0A 3GNFB 2YUPA 3VYHB 5GAMh 2IPOB 2OTJT 2JTEA 3JCMd 2K6DA 3JCMh 3RDVA 2YWWA 2EGAA 4FU6A 4OGCA 4B9WA 2HCKA 1YJ9T 1G3YA 1OPLA 1X2QA 3RKWA 1RAFB 2C0IA 1TG0A 4J7IA 3ASKA 3HHTB 2YLCA 3CBMA 3KUFA 3EFOA 3OMCA 1YJNT 1HYOA 1K4US 1RAIB 4OP0A 3FB9A 2J06A 4PKCC 4A4EA 1WDXA 1OX9A 2EIFA 5CAIA 4JRPA 4F7UB 2X4JA 3F70A 4WF2A 4PJOA 1QCFA 1VQOA 1GXIE 3JB9H 3SWNB 5FW9A 1VYTA 1IREB 2MCNA 3G71A 4HXJA 3CCLA 2KRMA 2XI9A 4J6XA 4CC2A 3RR6A 2ESWA 2FHDA 4KULA 3CC2A 1Q82R 1NJIU 2X3WD 4Z88A 1KQSP 2E5QA 4ATOA 1D1AA 2KMTA 5GAOr 5KYUB 1TS9A 5D7UA 3HTRA 4O6JA 1K1ZA 3P8HA 4BY6B 8ATCB 2I0NA 1VIEA 2EVRA 2R5MA 5L23A 4ANJA 2HSPA 2XHCA 4N0AA 4JRQA 2FG0A 4M78C 1KHCA 5FRMA 1VIFA 1KC8R 3EH1A 4OB3B 3QWYA 3X26B 2PTKA 3A8LB 1D1BA 1BI0A 1PKTA 3VS4A 1H3ZA 2C06A 1BK2A 2ZPFB 1QWFA 1LVKA 3NMZC 4PFPA 1LPLA 5EG2A 3JAME 2XDDA 1QLYA 4R55A 1W2BS 2ECZA 2RI5A 4BE1A 3MEUA 1BKBA 2LJ1A 2M1HA 2EYWA 4EMGA 1NYGA 2KYBA 3CBOA 1TU0B 4LDYA 4E47A 3G1JA 5CKDA 3OYFA 2L3PA 1VQ8T 3CXCP 5GMKj 3CCUQ 2HKNA 2DYBA 2KRNA 4PNOA 2VWFA 4P5NA 1WHJA 1N9RA 3C0CA 1UGSB 2K4YA 2D8HA 3CCET 2DXCA 1Y71A 2EAYA 1Q81R 2NUPA 3FRNA 2EGCA 1D0XA 3EHRA 2E1HA 3JCMQ 1NYFA 4JJBA 3G6EA 3GPLA 2XDBA 1Y96A 2KRSA 4XU2A 1M3CA 3S6WA 4LE9A 1VQLA 2OTLQ 2HBWA 3ME9A 9ATCB 3H9NA 4E7ZA 3DLLA 2M16A 4LNPA 4NOYA 5I11A 3LLRA 4OGEA 2LX7A 3PIPA 1T3LA 2YRDA 1ZSZB 4XU0A 4C5HA 1EFNA 2CSIA 1ZUKA 5GMKe 3J80E 3CCVA 3ULRB 1SRMA 1BB9A 2HMAA 3T9NA 1XNIA 2QYZA 4J6YA 3RIRA 2M02A 4M7DC 1WIEA 4C5GA 1M4ZA 4OB1B 2DA9A 1M8MA 1N27A 1PRLC 5J3BA 4E7HA 1ZHIA 2GBQA 3CCSQ 4Z89A 4JJDA 1VQMA 1B34A 4EMKB 1AOJA 3RKXA 5GAMf 5A0LA 2RQWA 4M7DG 3QHSA 4F17A 2Z0WA 3JCMf 2SRCA 3G4SQ 3DB3A 4L5GA 3OW2S 1Q86R 3S3NA 2CSQA 1S72T 1IHWA 2F69A 1SHGA 2RQVA 1K9MC 2QDLA 4JUVA 3VUBA 2QK0A 1MHNA 2P84A 5I22A 4M77C 4J5YA 1YJWA 1QMCA 3EHQA 1K9MR 1NPPA 4ZGDB 1PSEA 3ZBDA 2KBTA 4BACA 4M7AG 3PVQA 2EYZA 2ROLA 1Q7YC 1QWEA 2DX1A 1OYXA 3TREA 2VVKA 5IXBA 3FJ5A 1YITA 1R8OB 3A8OB 1I5OB 4M78F 1PC0A 2K7AA 1S1NA 5GAN7 3BDLA 1JBMA 2JTMA 4RKUE 3EG0A 3MCAB 1VQ6T 4M7AE 4HCZA 4C8QG 3PGGA 5I2MA 4OF1A 2RI2A 3KFVA 4HVVA 1BIBA 3PE0A 4OMPA 1UGQB 2RF0A 3I5RA 3UA7A 1MNDA 1TTHB 3I56T 1W2BA 2YRVA 3M0TA 3H41A 3CD6T 2DERA 1OU8A 4KT0E 2QEXT 2J6KA 2COZA 2D8JA 5GMKi 1MV0B 2RO0A 2FYKA 4C8QE 2EJGA 1U3OA 1VQPQ 5CK9A 4JJCA 1JJ2S 1R77A 4OVAA 4C92C 3A8MB 1KSWA 4M7AD 2KYMA 2NLUA 1OV3A 1FMKA 2KQWA 2QA4A 3P8DA 1M1KC 2DIGA 2ZCFB 2HDAA 1X6OA 4RTYA
chains in the Genus database with same CATH topology
1JQQA 2BZYA 2JM8A 5EC7A 2X3XD 1TUDA 1HSQA 2ROTA 1LCKA 1AVZC 1GCQC 4F14A 1PKSA 1RLPC 2GQIA 1J3TA 2NWMA 4K11A 1BU1A 1Z9ZA 3TVTA 1UG1A 1GBRA 2C0TA 1WXUA 2LMJA 4R0KA 4J9DA 2W0ZA 1YP5A 4AFUC 1SSHA 1Z9QA 2DJQA 2OJ2A 4FSSA 2C0OA 1GFDA 1MUZA 4M4ZA 3JV3A 4OMMA 2XMFA 3VS1A 1AZEA 4LUEA 2EW3A 2CH4W 2K3BA 1GL5A 2RMOA 4RUGA 5ECAA 1NG2A 4ZNXA 2DLPA 1GBQA 1A0NB 1ABQA 1W70A 2L3QA 3H0IA 1WXBA 2BZXA 2OI3A 2CH4A 1OEBA 1Y0MA 1NEGA 2GTOA 2YDLA 1NM7A 3RNJA 2GNCA 2FPEA 3EG1A 3UATA 4CC7A 2O88A 3SHWA 4JZ3A 4RTVA 2A08A 1YN8A 1U06A 1NEBA 2FO0A 2YT6A 3M0PA 1AWOA 2EBPA 3LH5A 3REBB 4RTTA 3M0RA 1UUEA 2ENMA 4AG1C 1I1JA 1N5ZA 1HD3A 4KRTA 3NHNA 1VYVA 2IIMA 1VYUA 3VS3A 2CUDA 2AZSA 2J05A 1GRIA 2EQIA 2O31A 3VRYA 2KGTA 1B07A 1PHTA 3TSZA 1AWJA 2JMCA 3H0HA 1WXTA 2EYXA 2MOXA 2M51A 3VS6A 4J9HA 2KEAA 4OMNA 4ESRA 4JZ4A 1UHFA 2CT4A 1T0JA 1WYXA 1X69A 1ZUUA 2OAWA 4Z8AA 5IHKA 4RTZA 1YWPA 2YUPA 2LZ6B 5GJWB 2EKHA 2J6OA 1RUWA 2JTEA 4J9GA 2K6DA 4EIKA 2A36A 2EGAA 3RBBB 1YNZA 2DL8A 2EGEA 2HCKA 4ORZA 2JM9A 3I9QA 2DVJA 1OPLA 1X2QA 2RPNA 4RTUA 2C0IA 5GJVB 1TG0A 1UHCA 2HEQA 2K2MA 1W1FA 4X1VA 2V1RA 2ED0A 1K4US 2LQNA 1E6GA 3THKA 1UTIA 2J06A 3NGPA 1WDXA 5FWCA 1PRMC 3VRZA 3VS0A 1OOTA 1RI9A 1QCFA 5FW9A 4JPBW 1VYTA 2MCNA 4HXJA 1IO6A 2KRMA 1M30A 4CC2A 1TUCA 2ESWA 1ARKA 1SHFA 3UF4A 3I35A 2J6FA 4HVWA 2X3WD 1ABOA 2KROA 2O9SA 4Z88A 2KT1A 2DBMA 4E6RA 3M0UA 1BBZA 1SPKA 1T3SA 2A28A 2BTTA 1K1ZA 4AFSC 2O2OA 2I0NA 1AZGB 2EVRA 4D8KA 5L23A 2JS0A 3M0SA 2HSPA 4IIOA 2FG0A 2DNUA 2MIOA 3PVLA 4A63B 2O9VA 3QWYA 1X6GA 2PTKA 3SEMA 2F2WA 1PKTA 3VS4A 2EYYA 1BK2A 2DL5A 1XOVA 1QWFA 2K9GA 3NMZC 2DMOA 1NLPC 2YUOA 2FRWA 1JXOA 3UA6A 1QLYA 2DL4A 5IHNA 1JXMA 1KJWA 5IHIA 1ZX6A 2ECZA 1K76A 2LJ1A 2NUZA 1X2KA 2EYWA 1ZBJA 2A37A 3R6NA 1NYGA 3VS2A 2KYBA 2LJ0A 1AWXA 1JEGA 2B86A 2F2VA 2L3PA 2DE0X 2DBKA 1I07A 2L2PA 1QKWA 2DYBA 2AKLA 2KRNA 2VWFA 4RTXA 3C0CA 1VA7A 2D8HA 2H8HA 4HVUA 1GCPA 2KXCA 1RLQC 3A98A 4J9EA 2EGCA 3EHRA 2YUQA 1M3AA 1SRLA 1ZLMA 1X6BA 1MV3A 1UFFA 1UDLA 2KNBB 1NYFA 2RQRA 4JJBA 2AZVA 4WCIA 2GGRA 1W6XA 3EGUA 1M3BA 2E5KA 1G2BA 2CDTA 4IIMA 2KRSA 1T0HA 1K9AA 1M3CA 2M0YA 4LE9A 2LQWA 2HBWA 1X27A 2FEIA 1X43A 3H0FA 1QKXA 2KXDA 4LNPA 2L3SA 2P4RA 5I11A 2LX7A 1T3LA 1G83A 1OPKA 2EPDA 1NLOC 1E7OA 1ZSGA 4F16A 1EFNA 1V1CA 2JT4A 2CSIA 1ZUKA 3ULRB 1SRMA 1BB9A 4J9CA 3TSWA 1GFCA 1JO8A 1YWOA 2L0AA 2AK5A 2FPFA 4CC3A 1WLPB 3QWXX 1WIEA 2LCSA 2CUBA 4AFQC 2G6FX 3I5SA 1I0CA 2DA9A 5FWBA 1Y57A 2JMAA 3VS5A 1M8MA 1AEYA 2GTJA 1PRLC 1FYNA 2KE9A 2GBQA 3GBQA 4LN2A 2KR3A 4Z89A 4JJDA 1K0XA 3IQLA 1CKBA 2ED1A 2JS2A 1AOJA 1KFZA 2DM1A 2RQWA 5HCKA 2PNIA 4F17A 2D0NA 2SRCA 1YCSB 2BZ8A 3ZL7C 4OMQA 2CSQA 3EG3A 1SHGA 2RQVA 2JXBA 2QDLA 2PZ1A 2YUNA 1SEMA 2V1QA 2D1XA 5IH2A 1U5SA 2W10A 2LNHB 4RTWA 2DILA 2F2XA 5I22A 1WX6A 2RN8A 2SEMA 3EHQA 5IXFA 1H3HA 1GCQA 3REAB 1H8KA 2DF6A 2KBTA 1WFWA 3PVQA 1AWWA 1CSKA 2EYZA 2ROLA 1QWEA 2DX1A 1ZUYA 4GBQA 2LP5A 1UGVA 1E6HA 2VVKA 3FJ5A 5IXBA 1WI7A 2DRMA 2ABLA 3O5ZA 1PWTA 2VKNA 4OMOA 3EG2A 2DL3A 2K7AA 1S1NA 2RQUA 1CKAA 1K0SA 1B3QA 1KIKA 3EG0A 1WA7A 4HCKA 4AFZC 3KFVA 3M0QA 1UJYA 4HVVA 3PE0A 4OMPA 2FRYA 2RF0A 1PNJA 3I5RA 3UA7A 4GLMA 3NPFA 3VS7A 3M0TA 4D8DA 3H41A 4DEXA 4J9IA 1UECA 2JW4A 1M27C 3U23A 4DEYA 2J6KA 1UE9A 2D8JA 2YSQA 1MV0B 2LJ3A 4J9FA 1AD5A 1U3OA 2DL7A 4JJCA 2CT3A 2KT8A 1JU5C 4QT7A 2FPDA 4LUDA 1KSWA 4AG2C 4OMLA 2KYMA 1HJDA 1OV3A 1FMKA 2AKKA 4CC4B 4Y92A 2CREA 2K79A 3CQTA 2J7IA 4J9BA 1UJ0A 1H92A 2DRKA 2HDAA 2RNAA 2RQTA 4RTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQQ A;  2BZY A;  2JM8 A;  5EC7 A;  2X3X D;  1TUD A;  1HSQ A;  2ROT A;  1LCK A;  1AVZ C;  1GCQ C;  4F14 A;  1PKS A;  1RLP C;  2GQI A;  1J3T A;  2NWM A;  4K11 A;  1BU1 A;  1Z9Z A;  3TVT A;  1UG1 A;  1GBR A;  2C0T A;  1WXU A;  2LMJ A;  4R0K A;  4J9D A;  2W0Z A;  1YP5 A;  4AFU C;  1SSH A;  1Z9Q A;  2DJQ A;  2OJ2 A;  4FSS A;  2C0O A;  1GFD A;  1MUZ A;  4M4Z A;  3JV3 A;  4OMM A;  2XMF A;  3VS1 A;  1AZE A;  4LUE A;  2EW3 A;  2CH4 W;  2K3B A;  1GL5 A;  2RMO A;  4RUG A;  5ECA A;  1NG2 A;  4ZNX A;  2DLP A;  1GBQ A;  1A0N B;  1ABQ A;  1W70 A;  2L3Q A;  3H0I A;  1WXB A;  2BZX A;  2OI3 A;  2CH4 A;  1OEB A;  1Y0M A;  1NEG A;  2GTO A;  2YDL A;  1NM7 A;  3RNJ A;  2GNC A;  2FPE A;  3EG1 A;  3UAT A;  4CC7 A;  2O88 A;  3SHW A;  4JZ3 A;  4RTV A;  2A08 A;  1YN8 A;  1U06 A;  1NEB A;  2FO0 A;  2YT6 A;  3M0P A;  1AWO A;  2EBP A;  3LH5 A;  3REB B;  4RTT A;  3M0R A;  1UUE A;  2ENM A;  4AG1 C;  1I1J A;  1N5Z A;  1HD3 A;  4KRT A;  3NHN A;  1VYV A;  2IIM A;  1VYU A;  3VS3 A;  2CUD A;  2AZS A;  2J05 A;  1GRI A;  2EQI A;  2O31 A;  3VRY A;  2KGT A;  1B07 A;  1PHT A;  3TSZ A;  1AWJ A;  2JMC A;  3H0H A;  1WXT A;  2EYX A;  2MOX A;  2M51 A;  3VS6 A;  4J9H A;  2KEA A;  4OMN A;  4ESR A;  4JZ4 A;  1UHF A;  2CT4 A;  1T0J A;  1WYX A;  1X69 A;  1ZUU A;  2OAW A;  4Z8A A;  5IHK A;  4RTZ A;  1YWP A;  2YUP A;  2LZ6 B;  5GJW B;  2EKH A;  2J6O A;  1RUW A;  2JTE A;  4J9G A;  2K6D A;  4EIK A;  2A36 A;  2EGA A;  3RBB B;  1YNZ A;  2DL8 A;  2EGE A;  2HCK A;  4ORZ A;  2JM9 A;  3I9Q A;  2DVJ A;  1OPL A;  1X2Q A;  2RPN A;  4RTU A;  2C0I A;  5GJV B;  1TG0 A;  1UHC A;  2HEQ A;  2K2M A;  1W1F A;  4X1V A;  2V1R A;  2ED0 A;  1K4U S;  2LQN A;  1E6G A;  3THK A;  1UTI A;  2J06 A;  3NGP A;  1WDX A;  5FWC A;  1PRM C;  3VRZ A;  3VS0 A;  1OOT A;  1RI9 A;  1QCF A;  5FW9 A;  4JPB W;  1VYT A;  2MCN A;  4HXJ A;  1IO6 A;  2KRM A;  1M30 A;  4CC2 A;  1TUC A;  2ESW A;  1ARK A;  1SHF A;  3UF4 A;  3I35 A;  2J6F A;  4HVW A;  2X3W D;  1ABO A;  2KRO A;  2O9S A;  4Z88 A;  2KT1 A;  2DBM A;  4E6R A;  3M0U A;  1BBZ A;  1SPK A;  1T3S A;  2A28 A;  2BTT A;  1K1Z A;  4AFS C;  2O2O A;  2I0N A;  1AZG B;  2EVR A;  4D8K A;  5L23 A;  2JS0 A;  3M0S A;  2HSP A;  4IIO A;  2FG0 A;  2DNU A;  2MIO A;  3PVL A;  4A63 B;  2O9V A;  3QWY A;  1X6G A;  2PTK A;  3SEM A;  2F2W A;  1PKT A;  3VS4 A;  2EYY A;  1BK2 A;  2DL5 A;  1XOV A;  1QWF A;  2K9G A;  3NMZ C;  2DMO A;  1NLP C;  2YUO A;  2FRW A;  1JXO A;  3UA6 A;  1QLY A;  2DL4 A;  5IHN A;  1JXM A;  1KJW A;  5IHI A;  1ZX6 A;  2ECZ A;  1K76 A;  2LJ1 A;  2NUZ A;  1X2K A;  2EYW A;  1ZBJ A;  2A37 A;  3R6N A;  1NYG A;  3VS2 A;  2KYB A;  2LJ0 A;  1AWX A;  1JEG A;  2B86 A;  2F2V A;  2L3P A;  2DE0 X;  2DBK A;  1I07 A;  2L2P A;  1QKW A;  2DYB A;  2AKL A;  2KRN A;  2VWF A;  4RTX A;  3C0C A;  1VA7 A;  2D8H A;  2H8H A;  4HVU A;  1GCP A;  2KXC A;  1RLQ C;  3A98 A;  4J9E A;  2EGC A;  3EHR A;  2YUQ A;  1M3A A;  1SRL A;  1ZLM A;  1X6B A;  1MV3 A;  1UFF A;  1UDL A;  2KNB B;  1NYF A;  2RQR A;  4JJB A;  2AZV A;  4WCI A;  2GGR A;  1W6X A;  3EGU A;  1M3B A;  2E5K A;  1G2B A;  2CDT A;  4IIM A;  2KRS A;  1T0H A;  1K9A A;  1M3C A;  2M0Y A;  4LE9 A;  2LQW A;  2HBW A;  1X27 A;  2FEI A;  1X43 A;  3H0F A;  1QKX A;  2KXD A;  4LNP A;  2L3S A;  2P4R A;  5I11 A;  2LX7 A;  1T3L A;  1G83 A;  1OPK A;  2EPD A;  1NLO C;  1E7O A;  1ZSG A;  4F16 A;  1EFN A;  1V1C A;  2JT4 A;  2CSI A;  1ZUK A;  3ULR B;  1SRM A;  1BB9 A;  4J9C A;  3TSW A;  1GFC A;  1JO8 A;  1YWO A;  2L0A A;  2AK5 A;  2FPF A;  4CC3 A;  1WLP B;  3QWX X;  1WIE A;  2LCS A;  2CUB A;  4AFQ C;  2G6F X;  3I5S A;  1I0C A;  2DA9 A;  5FWB A;  1Y57 A;  2JMA A;  3VS5 A;  1M8M A;  1AEY A;  2GTJ A;  1PRL C;  1FYN A;  2KE9 A;  2GBQ A;  3GBQ A;  4LN2 A;  2KR3 A;  4Z89 A;  4JJD A;  1K0X A;  3IQL A;  1CKB A;  2ED1 A;  2JS2 A;  1AOJ A;  1KFZ A;  2DM1 A;  2RQW A;  5HCK A;  2PNI A;  4F17 A;  2D0N A;  2SRC A;  1YCS B;  2BZ8 A;  3ZL7 C;  4OMQ A;  2CSQ A;  3EG3 A;  1SHG A;  2RQV A;  2JXB A;  2QDL A;  2PZ1 A;  2YUN A;  1SEM A;  2V1Q A;  2D1X A;  5IH2 A;  1U5S A;  2W10 A;  2LNH B;  4RTW A;  2DIL A;  2F2X A;  5I22 A;  1WX6 A;  2RN8 A;  2SEM A;  3EHQ A;  5IXF A;  1H3H A;  1GCQ A;  3REA B;  1H8K A;  2DF6 A;  2KBT A;  1WFW A;  3PVQ A;  1AWW A;  1CSK A;  2EYZ A;  2ROL A;  1QWE A;  2DX1 A;  1ZUY A;  4GBQ A;  2LP5 A;  1UGV A;  1E6H A;  2VVK A;  3FJ5 A;  5IXB A;  1WI7 A;  2DRM A;  2ABL A;  3O5Z A;  1PWT A;  2VKN A;  4OMO A;  3EG2 A;  2DL3 A;  2K7A A;  1S1N A;  2RQU A;  1CKA A;  1K0S A;  1B3Q A;  1KIK A;  3EG0 A;  1WA7 A;  4HCK A;  4AFZ C;  3KFV A;  3M0Q A;  1UJY A;  4HVV A;  3PE0 A;  4OMP A;  2FRY A;  2RF0 A;  1PNJ A;  3I5R A;  3UA7 A;  4GLM A;  3NPF A;  3VS7 A;  3M0T A;  4D8D A;  3H41 A;  4DEX A;  4J9I A;  1UEC A;  2JW4 A;  1M27 C;  3U23 A;  4DEY A;  2J6K A;  1UE9 A;  2D8J A;  2YSQ A;  1MV0 B;  2LJ3 A;  4J9F A;  1AD5 A;  1U3O A;  2DL7 A;  4JJC A;  2CT3 A;  2KT8 A;  1JU5 C;  4QT7 A;  2FPD A;  4LUD A;  1KSW A;  4AG2 C;  4OML A;  2KYM A;  1HJD A;  1OV3 A;  1FMK A;  2AKK A;  4CC4 B;  4Y92 A;  2CRE A;  2K79 A;  3CQT A;  2J7I A;  4J9B A;  1UJ0 A;  1H92 A;  2DRK A;  2HDA A;  2RNA A;  2RQT A;  4RTY A; 
#chains in the Genus database with same CATH topology
 3E9F A;  2X3X D;  1TUD A;  3X25 B;  2NYS A;  1D3B B;  4IUT A;  3BW1 A;  1LCK A;  4C8Q D;  2OTJ Q;  3HRT A;  1YIJ T;  1PKS A;  1WHM A;  1RLP C;  1C0M A;  2GQI A;  1QVG P;  3M53 A;  2GFU A;  1BU1 A;  1Z9Z A;  3PT9 A;  1YJ9 Q;  2CP2 A;  2AIR B;  3G7Z A;  1SKU B;  5C6S A;  2KVQ G;  1YP5 A;  3CMA T;  3OYM A;  4AFU C;  1SSH A;  1TUG B;  2DJQ A;  4ZGJ B;  3OYN A;  1MUZ A;  4FYX B;  2MI6 A;  3JV3 A;  2XMF A;  3VS1 A;  1YJN Q;  1YCY A;  4WTO B;  4M7D F;  2RMO A;  1M8V A;  4LDW A;  4ZN1 A;  2DLP A;  1C6V X;  4PJO D;  2HZY A;  5KYX B;  1GBQ A;  2L3Q A;  3CCQ Q;  1XQH A;  2GTO A;  4RG8 A;  3NTI A;  2FPE A;  2E3I A;  3OBY A;  4M75 G;  2A08 A;  2E10 A;  1U06 A;  1NEB A;  1IGQ A;  2DO3 A;  4RTT A;  1EX4 A;  2CP7 A;  4KBM B;  2LQK A;  4BI3 A;  1HD3 A;  2M0O A;  3OW2 A;  3ZFJ A;  3CPW S;  5HK3 A;  4KGZ B;  3GF5 A;  4A4K A;  1VYU A;  3VS3 A;  2CUD A;  5CVI A;  2I2L A;  1VQ7 T;  2EQI A;  2J05 A;  4M75 E;  4A54 A;  1PHT A;  3TSZ A;  1AWJ A;  4M77 F;  3OY9 A;  1C1A A;  2DEU A;  4OMN A;  1RL2 A;  4ESR A;  4M7A B;  1VQ5 T;  2DXU A;  5GMK h;  1KK7 A;  1X69 A;  1QW1 A;  3VJP A;  2ZZD A;  2JN0 A;  3CCU A;  2DYI A;  3JCM W;  2E41 A;  4J9G A;  2P0Q A;  2WAC A;  4M75 D;  3BY7 A;  4M78 A;  3RBB B;  1YNZ A;  2JM9 A;  4NL3 A;  1KD1 C;  1QCO A;  4RMO A;  4F7U G;  2RPN A;  1M9S A;  1K73 R;  1R0B G;  4HT9 A;  2K2M A;  1VQ8 Q;  2RI3 A;  1Y07 A;  4X1V A;  2OTL A;  2RJF A;  1VQ9 Q;  3EFO B;  3CCE Q;  2KI7 A;  4O5V A;  2QDY B;  5KH6 A;  3OS1 A;  1YI2 T;  4F7U E;  2F1L A;  1JJ2 A;  4J8O A;  3RES A;  3LGL A;  3OYD A;  3VS0 A;  3QBY A;  4L6V 5;  4PJO B;  3EG9 A;  2D6F A;  5A0G A;  1G8X A;  3EGD A;  1TUC A;  5LJ3 d;  1SHF A;  5FRN A;  3I35 A;  2J6F A;  1IRX A;  1WPY A;  3CC7 T;  3NFC A;  5LJ5 j;  3RMQ A;  2O9S A;  2Y4Y A;  4XTX A;  5CIU A;  5CKH A;  5KCO A;  2KT1 A;  3E9G A;  1M90 U;  1BCO A;  4BDY A;  1N9S A;  1BBZ A;  4RG2 A;  3CCS A;  1KQ1 A;  2RH2 A;  2HD0 A;  2A28 A;  5D6X A;  5CKE A;  5GAN d;  1AZG B;  2L89 A;  2COW A;  2JS0 A;  3M0S A;  3CCR T;  5FU6 B;  3G4S A;  3E1S A;  3OYI A;  3GP8 A;  4DOW A;  4IUQ A;  1SG5 A;  3MET A;  2DNU A;  2MIO A;  2B8A A;  3FIF A;  1M5Q 1;  1X6G A;  2QQS A;  1QVP A;  1G5V A;  1WGS A;  2DMO A;  2FZK B;  2YUO A;  4N4H A;  1N8R C;  3UA6 A;  3EFR A;  5IHN A;  2VGM A;  2E6N A;  5LJ5 e;  3LYI A;  1ZBJ A;  2A37 A;  2RHY A;  3R6N A;  3VS2 A;  2X4X A;  4FYW B;  2K3X A;  1AWX A;  1JEG A;  1S72 Q;  2E4H A;  4C5E A;  4BUG A;  2DBK A;  3QDR B;  2AT1 B;  1I07 A;  1N8R U;  2HSE B;  4RCC A;  5GAM d;  1VA7 A;  2VXF A;  2H8H A;  2CYZ B;  3CPW A;  2NUP B;  2ZAE A;  4J9E A;  4L59 A;  3A8H B;  1ZLM A;  4QQG A;  1X6B A;  4QKU A;  2BKD N;  3G71 T;  3CCL T;  1RAC B;  2H3J A;  4WCI A;  4PL6 A;  5CKF A;  2QQB A;  2KY9 A;  5FRO A;  1VQK T;  4M77 A;  1D1C A;  1Y96 B;  2HQH A;  2LC4 A;  2LQW A;  2K2V A;  2K57 A;  2P0P A;  3JB9 F;  2EFI A;  1QKX A;  2KXD A;  4VUB A;  3QJ6 A;  2L3S A;  3OYC A;  1LJO A;  2HQX A;  1F1B B;  1OPK A;  2HKQ B;  1E7O A;  1NJI C;  2JT4 A;  1SF9 A;  1WHL A;  4II1 A;  3I56 Q;  1WQW A;  4BI4 A;  4LDV A;  2BIV A;  2QEX Q;  1JO8 A;  4PFZ A;  2L0A A;  2FPF A;  4CC3 A;  1W4S A;  2EJ9 A;  4Z02 A;  1IGU A;  2LCS A;  2JUF A;  3QDF A;  8AT1 B;  3OYA A;  2G6F X;  3HKS A;  3CCM Q;  1YHQ T;  5FWB A;  2QGG A;  2LTO A;  1AEY A;  2KE9 A;  3IQL A;  4EMH A;  2ED1 A;  3VKI A;  1B34 B;  2JS2 A;  2E6Z A;  4DBQ A;  4Q5W A;  4FCY A;  3BE3 A;  3D7S B;  4C92 A;  5GAN g;  2EWN A;  2D0N A;  1WJR A;  1HXD A;  2ZPE B;  3ZL7 C;  1Q82 U;  1M2V A;  1YIJ Q;  5GAO n;  4KUI A;  2JXB A;  3VU3 C;  1BI3 A;  2YUN A;  2V8I A;  4B9X A;  2JJ9 A;  1U5S A;  2LNH B;  3PMT A;  4PJM A;  3CCQ A;  4RTW A;  4QQ6 A;  2SEM A;  4A53 A;  5IXF A;  1H3H A;  1H8K A;  4C0G A;  3G6E T;  5A2Q E;  1WFW A;  1AWW A;  3MEW A;  1TSF A;  3TU4 K;  3OYL A;  1VQL T;  4DBR A;  1WI7 A;  2DRM A;  2ABL A;  1KC8 U;  1O9S A;  4BD3 A;  3QO3 A;  4BB7 A;  1K0S A;  5GAM g;  1FXX A;  4LXC A;  5LJ3 f;  3JCM g;  1AHJ B;  1MMD A;  2MAM A;  4MML A;  3M0Q A;  3CCJ A;  3CCV T;  2HBP A;  2K5L A;  2FRY A;  2LT1 A;  2JZ2 A;  3NPF A;  3VS7 A;  3HRS A;  4ELY C;  2M9U A;  2CP5 A;  2HL5 C;  2PVD B;  1QVG S;  4XU3 A;  2RK1 A;  5LL6 S;  3GOX A;  1AD5 A;  1P92 A;  5GAN f;  2LX9 A;  2CT3 A;  1PG5 B;  2FPD A;  4LUD A;  4AG2 C;  3GIB A;  4FT4 A;  2AKK A;  4FW1 A;  3NTH A;  2K79 A;  1RAA B;  2J7I A;  4J9B A;  3JCM X;  1VQ5 Q;  2RNA A;  3GLX A;  2RQT A;  1WHG A;  1VQ8 A;  2PUK B;  1U1S A;  4LD6 A;  2VB6 A;  3MHX A;  1VQ9 A;  2CP6 A;  1GCQ C;  3CCE A;  3JB9 I;  1IB8 A;  4PK4 A;  4UC4 A;  4K11 A;  4B6M A;  3TVT A;  3C94 A;  2C0T A;  1M1F A;  2R5A A;  1YJW T;  3PTA A;  1X75 C;  2W0Z A;  2DD5 A;  2YRC A;  1QVF S;  2RA2 A;  3CEY A;  4HA8 A;  4M4Z A;  1KG1 A;  2DZC A;  5LJ5 h;  2EW3 A;  3PNW C;  2CH4 W;  1GL5 A;  4M7A C;  3RKY A;  5ECA A;  3MO8 A;  3FDR A;  4ZNX A;  4FW2 A;  5KYU A;  1VQN T;  2BZX A;  2CH4 A;  3MP6 A;  1OEB A;  1Y0M A;  1NEG A;  3VYG A;  2DD4 A;  1O75 A;  2QAZ A;  3EG1 A;  3DLM A;  4CC7 A;  2O88 A;  2DXB A;  4C8Q C;  2DAQ A;  2FL7 A;  4MZT A;  2WSF E;  2NUT A;  1HK9 A;  1Q86 U;  4AG1 C;  1I1J A;  3JRZ A;  4XU1 A;  2GQV A;  3HPW A;  1G3S A;  1VYV A;  2IIM A;  2ZPI B;  3SDZ A;  2AZS A;  4E7K A;  1Q7Y R;  4NL2 A;  2CKK A;  4C5I A;  2KGT A;  3CPF A;  3MEV A;  1B07 A;  2DTI A;  2JMC A;  3OMG A;  2EYX A;  2LCL A;  5KYY A;  2QA4 T;  3J7A F;  2M51 A;  2XKO C;  3CCR Q;  4IUU A;  5I21 A;  2CT4 A;  3INZ A;  2D0Q B;  2QTX A;  4Z8A A;  5IHK A;  3CME T;  1YWP A;  3CC4 Q;  5GJW B;  1WJQ A;  1RUW A;  2PU9 B;  4EIK A;  2A36 A;  2P0K A;  4M78 B;  2DL8 A;  4C0D C;  4ORZ A;  5GAN 3;  3I9Q A;  1LNX A;  2CZ0 B;  2EQK A;  3OYJ A;  1W2B P;  4PJO G;  3JCM V;  2R57 A;  1JRI A;  3V7S A;  5GJV B;  3SB2 A;  2HEQ A;  4PJN A;  3I55 T;  5C0M A;  2V1R A;  2ED0 A;  1QVG A;  4Y28 E;  4HT8 A;  1XTD A;  1D0Z A;  3TCJ A;  1M1K R;  1UTI A;  1BYM A;  3NGP A;  5FWC A;  4JS4 A;  4PJO E;  2LNV A;  3TQ7 P;  1PD0 A;  3JCM b;  3CCL Q;  4JPB W;  5GAO l;  2WSC E;  3EG9 B;  1IO6 A;  1M30 A;  1VQK Q;  2E12 A;  3QUI A;  1ARK A;  3EGD B;  2QTV A;  3UF4 A;  2BUD A;  4HVW A;  2XDP A;  4M75 C;  2YXY A;  3CCM A;  2KRO A;  1FMW A;  2DBM A;  3M0U A;  2EQM A;  3BFM A;  1G3T A;  1U1T A;  4DQ2 A;  2R58 A;  3UT1 A;  2K5I A;  4C92 E;  1SPK A;  3ZEH A;  5GAO q;  1T3S A;  2BTT A;  2FB7 A;  4AFS C;  2O2O A;  4BE2 A;  1FX7 A;  4D8K A;  2KAF A;  5KCH A;  2O01 E;  4QVZ A;  1RAG B;  1BI2 A;  2XG8 D;  4IIO A;  1VQ4 T;  1QVF A;  3PVL A;  2VGN A;  1YHQ Q;  4A63 B;  4IKF A;  3CCU T;  2O9V A;  2DXT A;  3QII A;  3SEM A;  2EYY A;  3KBG A;  1XOV A;  2F5K A;  4D6W A;  4M7A F;  2G3R A;  1NLP C;  2FRW A;  1JXO A;  5CKB A;  4C92 D;  3JCM c;  4PJL A;  1JXM A;  1KJW A;  2MPX C;  5GAO p;  2QQ9 A;  3M54 A;  1ZBX A;  3OYB A;  4C8Q F;  1YFN A;  4GLK A;  3R6O A;  2VC8 A;  2ATC B;  3SWN C;  2ZPB B;  2RJC A;  2EYQ A;  4RTX A;  3JSC A;  1PSF A;  1GCP A;  2KXC A;  1UB4 A;  3A98 A;  2WSE E;  4EDU A;  5LJ5 f;  5FLX E;  1SRL A;  1MV3 A;  4JS5 A;  4ZTJ A;  1W6X A;  2MWO A;  3EGU A;  3MJX A;  4GY5 A;  4IUV A;  1G2B A;  5L8R E;  1T0H A;  4M77 B;  3O8V A;  2M0Y A;  5DY9 A;  1KQS S;  3M56 A;  4J7F A;  1KD1 R;  4BY6 C;  1MMA A;  1PD1 A;  1X27 A;  1X43 A;  3H0F A;  2DKG A;  2LDM A;  4R56 A;  2P4R A;  2QQA A;  3LH0 A;  4BI8 B;  1G83 A;  1NLO C;  1D09 B;  3CCV Q;  1ZSG A;  1V1C A;  1Y7X A;  4XTV A;  4XTW A;  4J6W A;  1M90 C;  4J9C A;  1VQ5 A;  2CS7 A;  4J83 A;  3EFS A;  3G4S T;  1GFC A;  2DEQ A;  3X20 B;  1K73 U;  1YWO A;  1WLP B;  4AFQ C;  3I5S A;  1I0C A;  2VYT A;  4JDS A;  2X35 A;  4HKE A;  1Y57 A;  3VS5 A;  3UPU A;  3LW5 E;  4MZM A;  3EGX A;  3GBQ A;  2LRQ A;  2RHU A;  4LN2 A;  3OYY A;  1EIF A;  1JJ2 P;  3OS0 A;  1CKB A;  4FT2 A;  1M1G A;  1IXD A;  1WJS A;  1I4K 1;  4FYY B;  1YBY A;  1KFZ A;  5M9O A;  2DM1 A;  2FZG B;  2PNI A;  2X51 A;  4C92 B;  2E65 A;  3CXC S;  4QVC A;  3OBW A;  1YCS B;  1D0Y A;  2L8D A;  4OB2 B;  3HSB A;  2CP3 A;  3L42 A;  3LX7 A;  2QQR A;  3JB9 D;  1M2V B;  2PZ1 A;  5KYX A;  4ZTF A;  4HCB A;  1SEM A;  1Q95 G;  2D9T A;  2KK4 A;  2V1Q A;  2HAX A;  3PFS A;  2D1X A;  1K8A C;  4M75 F;  1VUB A;  4FSX A;  3E19 A;  2F2X A;  4ME7 A;  1WX6 A;  2RN8 A;  1FWZ A;  5KYW A;  4M7D A;  4AMC A;  2RB6 A;  5GAN 6;  1GCQ A;  3REA B;  3URG A;  2YLB A;  3SFM A;  2ZGW A;  1N6A A;  2DK3 A;  1CSK A;  2RJD A;  4KUD K;  5GAN 5;  2BE7 D;  1ZSZ C;  1ZUY A;  1N8R R;  4GBQ A;  1K8A U;  2LP5 A;  1UGV A;  1E6H A;  2VKN A;  4OMO A;  2XD0 A;  3LWH A;  3M55 A;  4A4G A;  3OYH A;  1MMG A;  1VQN Q;  5GAN 4;  3M9Q A;  2L5Q A;  1WA7 A;  5AYF A;  4AFZ C;  4XAX B;  1EZZ B;  1UJY A;  1WHH A;  2A3L A;  2PVG B;  3LGF A;  1KHI A;  1RAE B;  1VQO T;  3CCR A;  3H8Z A;  4DEX A;  4J9I A;  1UEC A;  2JW4 A;  2A7Y A;  3U23 A;  1BI1 A;  1MGQ A;  1QCN A;  2LJ3 A;  1BCM A;  4EMK C;  4J9F A;  2DTO A;  3CC2 T;  3QZ9 B;  2JNG A;  3CC4 A;  1QP3 A;  2DL7 A;  4F7U F;  1VQP A;  2KT8 A;  4C8Q A;  4DOV A;  3CPW P;  1VQ6 Q;  4KGV B;  3C4S A;  1HJD A;  2QA4 Q;  5CQY A;  3E2U A;  1UEB A;  2JOY A;  2DRK A;  4XK8 E;  4Y91 A;  3CD6 Q;  3GNG A;  3CME Q;  1NJI R;  1HSQ A;  2ROT A;  3L2V A;  1AVZ C;  5LJ3 g;  1KQS A;  4F14 A;  2OTJ A;  3QPH A;  1J3T A;  5HK0 A;  4E7J A;  3CCQ T;  1WNL A;  4E7I A;  1Q82 C;  2LMJ A;  1YJ9 A;  2XIC A;  2V8K A;  4R0K A;  2MF2 A;  4J9D A;  3M58 A;  5A0D A;  3OSS C;  1Z9Q A;  1VQK A;  2OJ2 A;  4FSS A;  1I5L A;  2E70 A;  2VAS A;  3QJY A;  3I55 Q;  4OMM A;  1ZQ1 A;  3M5A A;  4LUE A;  1YJN A;  4RUG A;  3HP9 A;  1NG2 A;  2EQU A;  1MMN A;  1A0N B;  3H0I A;  3S3M A;  2V8J A;  3OSV A;  3OYE A;  3CCJ T;  1KC8 C;  3UAT A;  3X24 B;  3N5B B;  3SHW A;  3CMA Q;  3MKD A;  3RUX A;  3MP1 A;  1YN8 A;  1RAD B;  2YT6 A;  2CP0 A;  3M0P A;  1AWO A;  3LH5 A;  3REB B;  4XQ3 A;  3CXC A;  2NUT B;  1YHQ A;  4JLG A;  3FJP A;  3Q1J A;  1N5Z A;  4KRT A;  3NHN A;  3QSU A;  5DLO A;  3JCM J;  1QP2 A;  4XTZ A;  2O4X A;  5FU7 B;  1GRI A;  3BDU A;  4PLI A;  2O31 A;  3VRY A;  2A0F B;  4IUP A;  1R0C B;  3H0H A;  4M75 A;  4PLL A;  1NZ9 A;  3WXM B;  1WXT A;  4M78 G;  5IT9 E;  2MOX A;  5KYY B;  3VUZ A;  3J81 E;  3VS6 A;  2KEA A;  4JJN K;  4IUR A;  4JZ4 A;  1M2O A;  1Q81 C;  1VQ4 Q;  3FEO A;  3C95 A;  1WYX A;  3A1P A;  1ZUU A;  4RTZ A;  1VQ9 T;  5GAN 2;  2LZ6 B;  2EKH A;  2HQE A;  2J6O A;  4MDX A;  5GAO m;  4M78 E;  2V26 A;  3VV0 A;  3PIO A;  1VQ7 Q;  2RM4 A;  1Q81 U;  2QG9 B;  1VQM T;  2EGE A;  2XK0 A;  2DVJ A;  4MZP A;  3L2Q A;  4RTU A;  5GMK l;  3QG1 A;  1UHC A;  1W1F A;  4NS5 A;  2BE9 B;  2ZPH B;  4V2S A;  2RK2 A;  2HL3 A;  2LQN A;  1E6G A;  3THK A;  4M78 D;  3QYG B;  4BDZ A;  4TVR A;  3OA6 A;  1PRM C;  3OB9 A;  3VRZ A;  2MMP A;  4F7U A;  1FMV A;  2IVW A;  3P8B B;  6AT1 B;  1OOT A;  1G3W A;  1RI9 A;  1NPR A;  3SWN A;  3AT1 B;  1B7T A;  3RMS A;  3S3O A;  2Y90 A;  2E3H A;  4FL6 A;  3OYG A;  1DJ7 B;  5LJ3 j;  5LJ5 d;  1UGP B;  4N4G A;  4ELZ C;  5CR2 A;  3M57 A;  1YIT T;  1ABO A;  1WHK A;  4E7S A;  4E6R A;  5HKC A;  3DB4 A;  4LDX A;  1YI2 Q;  1OX8 A;  3EAE A;  1IZ6 A;  1Q86 C;  3HFN A;  2F5T X;  3V7C A;  5GAN j;  2DTH A;  2RHZ A;  5IAY A;  1OZ2 A;  2RHI A;  3CC7 Q;  2F2W A;  4M7D E;  2OAU A;  4DBH A;  2DL5 A;  2H3E B;  2PQW A;  2K9G A;  3KXT A;  2RD1 A;  4FM4 B;  2DL4 A;  5LJ3 e;  3QKJ A;  5IHI A;  1ZX6 A;  1K76 A;  2NUZ A;  1X2K A;  1KQ2 A;  2EKO A;  3FLG A;  1K9M U;  2JVV A;  1U8R A;  1TH7 A;  2LJ0 A;  3L2R A;  2B86 A;  2F2V A;  2EQJ A;  1OI1 A;  1S72 A;  2DE0 X;  1TXQ A;  4M77 G;  4PJO C;  1H64 1;  2L2P A;  1QKW A;  2AKL A;  3QZ5 B;  2K3Y A;  5GAN e;  4M7D D;  1SSF A;  4HVU A;  1VQN A;  1RLQ C;  3MEA A;  5GAM j;  1Q7Y U;  2KSS A;  5CQX A;  2MYS A;  2YUQ A;  1M3A A;  2CZ6 B;  1UFF A;  1UDL A;  2KNB B;  4HCC A;  2RQR A;  1NBE B;  2AZV A;  4M77 E;  2MK5 A;  2GGR A;  3EH2 A;  1MNE A;  3MPU B;  4JLI A;  1M3B A;  2E5K A;  2CDT A;  4IIM A;  4EPC A;  3H6Z A;  1JB0 E;  1K9A A;  3SD4 A;  3WVD B;  4MMK A;  4OB0 B;  2X4Y A;  5I2S A;  3CCM T;  2FEI A;  4YTL A;  4QW2 A;  2DZ9 A;  1I8F A;  3NTK A;  3ER0 A;  5FU6 C;  5CCA A;  1ZSZ A;  1VQ6 A;  2EPD A;  4N0A C;  4RCB A;  4F16 A;  3UDC A;  4ZGE B;  4X34 A;  1VQO Q;  3PMI A;  3G71 Q;  3I56 A;  4M77 D;  2OX7 A;  3AHU A;  5GAM e;  3TSW A;  3CD6 A;  1QQJ A;  4FIB A;  4ZN3 A;  2AK5 A;  2QEX A;  3JCM e;  5J39 A;  3QWX X;  4C92 G;  5AT1 B;  3CME A;  3CC2 Q;  2CUB A;  2CZ7 B;  2DJZ A;  4KGX B;  5LJ5 g;  2JMA A;  2ZPG B;  2GTJ A;  2MWP A;  4F04 B;  1M1K U;  3L2W A;  1FYN A;  3EGX B;  2KR3 A;  5KE3 A;  1K0X A;  2GFA A;  4A4F A;  4EMK A;  2XID A;  1I81 A;  3A5Z B;  5HCK A;  2FVU A;  5KE2 A;  4MDW A;  3CBP A;  2IG0 A;  3HL8 A;  7AT1 B;  3I55 A;  3L1A A;  2BZ8 A;  2RHX A;  4OMQ A;  2FZC B;  3EG3 A;  5IN1 A;  4QVD A;  3OS5 A;  1YIJ A;  2GF7 A;  4LDU A;  5IH2 A;  1LOJ A;  2W10 A;  3OQ5 A;  4PJJ A;  2DIL A;  5GAN 8;  3L2Z A;  4E2F B;  3MP8 A;  5KYW B;  4M7D B;  1RAH B;  2JTF A;  4CRI A;  2DF6 A;  3CMA A;  1WZO A;  2K5F A;  1TWB A;  5KYN A;  2YHT A;  3C12 A;  1QVF P;  3O5Z A;  1PWT A;  3EG2 A;  2DL3 A;  2OTL T;  2GCX A;  4JRI A;  2RQU A;  4OMF B;  1CKA A;  3V8K A;  3OW2 P;  1B3Q A;  1NE8 A;  1KIK A;  4HCK A;  3CCJ Q;  5CO7 A;  2AHJ B;  2Y4X A;  1ZA2 B;  1V29 B;  1PNJ A;  2VUB A;  3G6E Q;  4GLM A;  2VXE A;  2LQ8 A;  4D8D A;  2QAS A;  2VV5 A;  4LD9 K;  1VQ4 A;  3RER A;  1M27 C;  4DEY A;  1UE9 A;  2YSQ A;  3V8J A;  2HNI A;  1VQL Q;  2DVE A;  2QGF B;  1V76 A;  3JB9 J;  2LT4 A;  4XTY A;  1JU5 C;  4QT7 A;  4PJO F;  1K73 C;  4C8Q B;  5D6W A;  1VQ7 A;  4C0F A;  3FC3 A;  1OUL A;  2XU8 A;  4OML A;  3CCS T;  2KDS A;  4CC4 B;  3JB9 G;  4Y92 A;  2CRE A;  2QI2 A;  3CQT A;  3QYH B;  2EJF A;  3TEE A;  5D6Y A;  1UJ0 A;  3V8L A;  3DKM A;  3JCM P;  1H92 A;  4A4H A;  1ZA1 B;  3LWI A;  4AT1 B;  2L3R A;  2DFU A;  1OZ3 A;  5J26 A;  1WQ7 A;  2DET A;  4XTU A;  1JQQ A;  2BZY A;  2JM8 A;  4N4I A;  5EC7 A;  1D3B A;  3QXE B;  3OS2 A;  2QXF A;  1UGR B;  1KD1 U;  4CI0 C;  1M90 R;  3V7R A;  2NWM A;  2E64 A;  4C92 F;  2P4T A;  1UG1 A;  1VQM Q;  1GBR A;  1WXU A;  2RJE A;  4FYV B;  3OYK A;  1XJW B;  5FU7 C;  3X28 B;  2C0O A;  1BIA A;  1GFD A;  5LJ3 h;  2CZ1 B;  3M59 A;  2CGH A;  1AZE A;  4C0D B;  4QQD A;  2PVO B;  2K3B A;  4KH0 B;  1YI2 A;  1ABQ A;  1W70 A;  2PUO B;  1WXB A;  2OI3 A;  2LCC A;  1YJW Q;  1ACM B;  2YDL A;  1RAB B;  1NM7 A;  3RNJ A;  2GNC A;  4JRK A;  1X01 A;  1OU9 A;  5GAN h;  3HRU A;  1RI0 A;  4JZ3 A;  4KH1 B;  4RTV A;  2DIQ A;  1K8A R;  5DLQ E;  1VOM A;  1PM3 A;  2LVM A;  2FO0 A;  2EBP A;  3M4Y A;  5HY6 A;  1PCX A;  3M0R A;  1UUE A;  2ENM A;  2X4W A;  2COY A;  1YIT Q;  4DA4 A;  3CC4 T;  3CC7 A;  4E7L A;  1VQP T;  1TOV A;  1OQK A;  5GMK m;  2O4X B;  5DM7 R;  4X9C A;  4DBF A;  4PFO A;  3HFO A;  4M75 B;  2X9H A;  4M7A A;  4J9H A;  3UWN A;  1UHF A;  3A8G B;  1IHV A;  3M4G A;  3L2U A;  3WVE B;  1T0J A;  2DPP B;  1AT1 B;  4X9D A;  2OAW A;  4C0Z A;  4BE0 A;  3GNF B;  2YUP A;  3VYH B;  5GAM h;  2IPO B;  2OTJ T;  2JTE A;  3JCM d;  2K6D A;  3JCM h;  3RDV A;  2YWW A;  2EGA A;  4FU6 A;  4OGC A;  4B9W A;  2HCK A;  1YJ9 T;  1G3Y A;  1OPL A;  1X2Q A;  3RKW A;  1RAF B;  2C0I A;  1TG0 A;  4J7I A;  3ASK A;  3HHT B;  2YLC A;  3CBM A;  3KUF A;  3EFO A;  3OMC A;  1YJN T;  1HYO A;  1K4U S;  1RAI B;  4OP0 A;  3FB9 A;  2J06 A;  4PKC C;  4A4E A;  1WDX A;  1OX9 A;  2EIF A;  5CAI A;  4JRP A;  4F7U B;  2X4J A;  3F70 A;  4WF2 A;  4PJO A;  1QCF A;  1VQO A;  1GXI E;  3JB9 H;  3SWN B;  5FW9 A;  1VYT A;  1IRE B;  2MCN A;  3G71 A;  4HXJ A;  3CCL A;  2KRM A;  2XI9 A;  4J6X A;  4CC2 A;  3RR6 A;  2ESW A;  2FHD A;  4KUL A;  3CC2 A;  1Q82 R;  1NJI U;  2X3W D;  4Z88 A;  1KQS P;  2E5Q A;  4ATO A;  1D1A A;  2KMT A;  5GAO r;  5KYU B;  1TS9 A;  5D7U A;  3HTR A;  4O6J A;  1K1Z A;  3P8H A;  4BY6 B;  8ATC B;  2I0N A;  1VIE A;  2EVR A;  2R5M A;  5L23 A;  4ANJ A;  2HSP A;  2XHC A;  4N0A A;  4JRQ A;  2FG0 A;  4M78 C;  1KHC A;  5FRM A;  1VIF A;  1KC8 R;  3EH1 A;  4OB3 B;  3QWY A;  3X26 B;  2PTK A;  3A8L B;  1D1B A;  1BI0 A;  1PKT A;  3VS4 A;  1H3Z A;  2C06 A;  1BK2 A;  2ZPF B;  1QWF A;  1LVK A;  3NMZ C;  4PFP A;  1LPL A;  5EG2 A;  3JAM E;  2XDD A;  1QLY A;  4R55 A;  1W2B S;  2ECZ A;  2RI5 A;  4BE1 A;  3MEU A;  1BKB A;  2LJ1 A;  2M1H A;  2EYW A;  4EMG A;  1NYG A;  2KYB A;  3CBO A;  1TU0 B;  4LDY A;  4E47 A;  3G1J A;  5CKD A;  3OYF A;  2L3P A;  1VQ8 T;  3CXC P;  5GMK j;  3CCU Q;  2HKN A;  2DYB A;  2KRN A;  4PNO A;  2VWF A;  4P5N A;  1WHJ A;  1N9R A;  3C0C A;  1UGS B;  2K4Y A;  2D8H A;  3CCE T;  2DXC A;  1Y71 A;  2EAY A;  1Q81 R;  2NUP A;  3FRN A;  2EGC A;  1D0X A;  3EHR A;  2E1H A;  3JCM Q;  1NYF A;  4JJB A;  3G6E A;  3GPL A;  2XDB A;  1Y96 A;  2KRS A;  4XU2 A;  1M3C A;  3S6W A;  4LE9 A;  1VQL A;  2OTL Q;  2HBW A;  3ME9 A;  9ATC B;  3H9N A;  4E7Z A;  3DLL A;  2M16 A;  4LNP A;  4NOY A;  5I11 A;  3LLR A;  4OGE A;  2LX7 A;  3PIP A;  1T3L A;  2YRD A;  1ZSZ B;  4XU0 A;  4C5H A;  1EFN A;  2CSI A;  1ZUK A;  5GMK e;  3J80 E;  3CCV A;  3ULR B;  1SRM A;  1BB9 A;  2HMA A;  3T9N A;  1XNI A;  2QYZ A;  4J6Y A;  3RIR A;  2M02 A;  4M7D C;  1WIE A;  4C5G A;  1M4Z A;  4OB1 B;  2DA9 A;  1M8M A;  1N27 A;  1PRL C;  5J3B A;  4E7H A;  1ZHI A;  2GBQ A;  3CCS Q;  4Z89 A;  4JJD A;  1VQM A;  1B34 A;  4EMK B;  1AOJ A;  3RKX A;  5GAM f;  5A0L A;  2RQW A;  4M7D G;  3QHS A;  4F17 A;  2Z0W A;  3JCM f;  2SRC A;  3G4S Q;  3DB3 A;  4L5G A;  3OW2 S;  1Q86 R;  3S3N A;  2CSQ A;  1S72 T;  1IHW A;  2F69 A;  1SHG A;  2RQV A;  1K9M C;  2QDL A;  4JUV A;  3VUB A;  2QK0 A;  1MHN A;  2P84 A;  5I22 A;  4M77 C;  4J5Y A;  1YJW A;  1QMC A;  3EHQ A;  1K9M R;  1NPP A;  4ZGD B;  1PSE A;  3ZBD A;  2KBT A;  4BAC A;  4M7A G;  3PVQ A;  2EYZ A;  2ROL A;  1Q7Y C;  1QWE A;  2DX1 A;  1OYX A;  3TRE A;  2VVK A;  5IXB A;  3FJ5 A;  1YIT A;  1R8O B;  3A8O B;  1I5O B;  4M78 F;  1PC0 A;  2K7A A;  1S1N A;  5GAN 7;  3BDL A;  1JBM A;  2JTM A;  4RKU E;  3EG0 A;  3MCA B;  1VQ6 T;  4M7A E;  4HCZ A;  4C8Q G;  3PGG A;  5I2M A;  4OF1 A;  2RI2 A;  3KFV A;  4HVV A;  1BIB A;  3PE0 A;  4OMP A;  1UGQ B;  2RF0 A;  3I5R A;  3UA7 A;  1MND A;  1TTH B;  3I56 T;  1W2B A;  2YRV A;  3M0T A;  3H41 A;  3CD6 T;  2DER A;  1OU8 A;  4KT0 E;  2QEX T;  2J6K A;  2COZ A;  2D8J A;  5GMK i;  1MV0 B;  2RO0 A;  2FYK A;  4C8Q E;  2EJG A;  1U3O A;  1VQP Q;  5CK9 A;  4JJC A;  1JJ2 S;  1R77 A;  4OVA A;  4C92 C;  3A8M B;  1KSW A;  4M7A D;  2KYM A;  2NLU A;  1OV3 A;  1FMK A;  2KQW A;  2QA4 A;  3P8D A;  1M1K C;  2DIG A;  2ZCF B;  2HDA A;  1X6O A;  4RTY A; 
#chains in the Genus database with same CATH homology
 1JQQ A;  2BZY A;  2JM8 A;  5EC7 A;  2X3X D;  1TUD A;  1HSQ A;  2ROT A;  1LCK A;  1AVZ C;  1GCQ C;  4F14 A;  1PKS A;  1RLP C;  2GQI A;  1J3T A;  2NWM A;  4K11 A;  1BU1 A;  1Z9Z A;  3TVT A;  1UG1 A;  1GBR A;  2C0T A;  1WXU A;  2LMJ A;  4R0K A;  4J9D A;  2W0Z A;  1YP5 A;  4AFU C;  1SSH A;  1Z9Q A;  2DJQ A;  2OJ2 A;  4FSS A;  2C0O A;  1GFD A;  1MUZ A;  4M4Z A;  3JV3 A;  4OMM A;  2XMF A;  3VS1 A;  1AZE A;  4LUE A;  2EW3 A;  2CH4 W;  2K3B A;  1GL5 A;  2RMO A;  4RUG A;  5ECA A;  1NG2 A;  4ZNX A;  2DLP A;  1GBQ A;  1A0N B;  1ABQ A;  1W70 A;  2L3Q A;  3H0I A;  1WXB A;  2BZX A;  2OI3 A;  2CH4 A;  1OEB A;  1Y0M A;  1NEG A;  2GTO A;  2YDL A;  1NM7 A;  3RNJ A;  2GNC A;  2FPE A;  3EG1 A;  3UAT A;  4CC7 A;  2O88 A;  3SHW A;  4JZ3 A;  4RTV A;  2A08 A;  1YN8 A;  1U06 A;  1NEB A;  2FO0 A;  2YT6 A;  3M0P A;  1AWO A;  2EBP A;  3LH5 A;  3REB B;  4RTT A;  3M0R A;  1UUE A;  2ENM A;  4AG1 C;  1I1J A;  1N5Z A;  1HD3 A;  4KRT A;  3NHN A;  1VYV A;  2IIM A;  1VYU A;  3VS3 A;  2CUD A;  2AZS A;  2J05 A;  1GRI A;  2EQI A;  2O31 A;  3VRY A;  2KGT A;  1B07 A;  1PHT A;  3TSZ A;  1AWJ A;  2JMC A;  3H0H A;  1WXT A;  2EYX A;  2MOX A;  2M51 A;  3VS6 A;  4J9H A;  2KEA A;  4OMN A;  4ESR A;  4JZ4 A;  1UHF A;  2CT4 A;  1T0J A;  1WYX A;  1X69 A;  1ZUU A;  2OAW A;  4Z8A A;  5IHK A;  4RTZ A;  1YWP A;  2YUP A;  2LZ6 B;  5GJW B;  2EKH A;  2J6O A;  1RUW A;  2JTE A;  4J9G A;  2K6D A;  4EIK A;  2A36 A;  2EGA A;  3RBB B;  1YNZ A;  2DL8 A;  2EGE A;  2HCK A;  4ORZ A;  2JM9 A;  3I9Q A;  2DVJ A;  1OPL A;  1X2Q A;  2RPN A;  4RTU A;  2C0I A;  5GJV B;  1TG0 A;  1UHC A;  2HEQ A;  2K2M A;  1W1F A;  4X1V A;  2V1R A;  2ED0 A;  1K4U S;  2LQN A;  1E6G A;  3THK A;  1UTI A;  2J06 A;  3NGP A;  1WDX A;  5FWC A;  1PRM C;  3VRZ A;  3VS0 A;  1OOT A;  1RI9 A;  1QCF A;  5FW9 A;  4JPB W;  1VYT A;  2MCN A;  4HXJ A;  1IO6 A;  2KRM A;  1M30 A;  4CC2 A;  1TUC A;  2ESW A;  1ARK A;  1SHF A;  3UF4 A;  3I35 A;  2J6F A;  4HVW A;  2X3W D;  1ABO A;  2KRO A;  2O9S A;  4Z88 A;  2KT1 A;  2DBM A;  4E6R A;  3M0U A;  1BBZ A;  1SPK A;  1T3S A;  2A28 A;  2BTT A;  1K1Z A;  4AFS C;  2O2O A;  2I0N A;  1AZG B;  2EVR A;  4D8K A;  5L23 A;  2JS0 A;  3M0S A;  2HSP A;  4IIO A;  2FG0 A;  2DNU A;  2MIO A;  3PVL A;  4A63 B;  2O9V A;  3QWY A;  1X6G A;  2PTK A;  3SEM A;  2F2W A;  1PKT A;  3VS4 A;  2EYY A;  1BK2 A;  2DL5 A;  1XOV A;  1QWF A;  2K9G A;  3NMZ C;  2DMO A;  1NLP C;  2YUO A;  2FRW A;  1JXO A;  3UA6 A;  1QLY A;  2DL4 A;  5IHN A;  1JXM A;  1KJW A;  5IHI A;  1ZX6 A;  2ECZ A;  1K76 A;  2LJ1 A;  2NUZ A;  1X2K A;  2EYW A;  1ZBJ A;  2A37 A;  3R6N A;  1NYG A;  3VS2 A;  2KYB A;  2LJ0 A;  1AWX A;  1JEG A;  2B86 A;  2F2V A;  2L3P A;  2DE0 X;  2DBK A;  1I07 A;  2L2P A;  1QKW A;  2DYB A;  2AKL A;  2KRN A;  2VWF A;  4RTX A;  3C0C A;  1VA7 A;  2D8H A;  2H8H A;  4HVU A;  1GCP A;  2KXC A;  1RLQ C;  3A98 A;  4J9E A;  2EGC A;  3EHR A;  2YUQ A;  1M3A A;  1SRL A;  1ZLM A;  1X6B A;  1MV3 A;  1UFF A;  1UDL A;  2KNB B;  1NYF A;  2RQR A;  4JJB A;  2AZV A;  4WCI A;  2GGR A;  1W6X A;  3EGU A;  1M3B A;  2E5K A;  1G2B A;  2CDT A;  4IIM A;  2KRS A;  1T0H A;  1K9A A;  1M3C A;  2M0Y A;  4LE9 A;  2LQW A;  2HBW A;  1X27 A;  2FEI A;  1X43 A;  3H0F A;  1QKX A;  2KXD A;  4LNP A;  2L3S A;  2P4R A;  5I11 A;  2LX7 A;  1T3L A;  1G83 A;  1OPK A;  2EPD A;  1NLO C;  1E7O A;  1ZSG A;  4F16 A;  1EFN A;  1V1C A;  2JT4 A;  2CSI A;  1ZUK A;  3ULR B;  1SRM A;  1BB9 A;  4J9C A;  3TSW A;  1GFC A;  1JO8 A;  1YWO A;  2L0A A;  2AK5 A;  2FPF A;  4CC3 A;  1WLP B;  3QWX X;  1WIE A;  2LCS A;  2CUB A;  4AFQ C;  2G6F X;  3I5S A;  1I0C A;  2DA9 A;  5FWB A;  1Y57 A;  2JMA A;  3VS5 A;  1M8M A;  1AEY A;  2GTJ A;  1PRL C;  1FYN A;  2KE9 A;  2GBQ A;  3GBQ A;  4LN2 A;  2KR3 A;  4Z89 A;  4JJD A;  1K0X A;  3IQL A;  1CKB A;  2ED1 A;  2JS2 A;  1AOJ A;  1KFZ A;  2DM1 A;  2RQW A;  5HCK A;  2PNI A;  4F17 A;  2D0N A;  2SRC A;  1YCS B;  2BZ8 A;  3ZL7 C;  4OMQ A;  2CSQ A;  3EG3 A;  1SHG A;  2RQV A;  2JXB A;  2QDL A;  2PZ1 A;  2YUN A;  1SEM A;  2V1Q A;  2D1X A;  5IH2 A;  1U5S A;  2W10 A;  2LNH B;  4RTW A;  2DIL A;  2F2X A;  5I22 A;  1WX6 A;  2RN8 A;  2SEM A;  3EHQ A;  5IXF A;  1H3H A;  1GCQ A;  3REA B;  1H8K A;  2DF6 A;  2KBT A;  1WFW A;  3PVQ A;  1AWW A;  1CSK A;  2EYZ A;  2ROL A;  1QWE A;  2DX1 A;  1ZUY A;  4GBQ A;  2LP5 A;  1UGV A;  1E6H A;  2VVK A;  3FJ5 A;  5IXB A;  1WI7 A;  2DRM A;  2ABL A;  3O5Z A;  1PWT A;  2VKN A;  4OMO A;  3EG2 A;  2DL3 A;  2K7A A;  1S1N A;  2RQU A;  1CKA A;  1K0S A;  1B3Q A;  1KIK A;  3EG0 A;  1WA7 A;  4HCK A;  4AFZ C;  3KFV A;  3M0Q A;  1UJY A;  4HVV A;  3PE0 A;  4OMP A;  2FRY A;  2RF0 A;  1PNJ A;  3I5R A;  3UA7 A;  4GLM A;  3NPF A;  3VS7 A;  3M0T A;  4D8D A;  3H41 A;  4DEX A;  4J9I A;  1UEC A;  2JW4 A;  1M27 C;  3U23 A;  4DEY A;  2J6K A;  1UE9 A;  2D8J A;  2YSQ A;  1MV0 B;  2LJ3 A;  4J9F A;  1AD5 A;  1U3O A;  2DL7 A;  4JJC A;  2CT3 A;  2KT8 A;  1JU5 C;  4QT7 A;  2FPD A;  4LUD A;  1KSW A;  4AG2 C;  4OML A;  2KYM A;  1HJD A;  1OV3 A;  1FMK A;  2AKK A;  4CC4 B;  4Y92 A;  2CRE A;  2K79 A;  3CQT A;  2J7I A;  4J9B A;  1UJ0 A;  1H92 A;  2DRK A;  2HDA A;  2RNA A;  2RQT A;  4RTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...