2O2OA

Solution structure of domain b from human cin85 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
75
structure length
75
Chain Sequence
TNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords SH3-domain kinase-binding protein 1
publication title Investigation of Domain B from Human Cin85 Protein: Structure, Dynamics and Proline-Rich Motif Binding
rcsb
source organism Homo sapiens
total genus 6
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2o2oA00
1OV3A 1V1CA 1X6BA 3REBB 2CSQA 1UGVA 2JM9A 5IHIA 1SPKA 2H8HA 4Z89A 3UA7A 1MV0B 4OMPA 2OAWA 2O88A 2M0YA 2DL4A 1OPKA 2GTJA 1TG0A 3M0RA 1UECA 1YNZA 2LP5A 4LNPA 2EKHA 2DNUA 1MUZA 2K3BA 3EHQA 3IQLA 1X2QA 2RNAA 2ROLA 1M27C 3I35A 3H41A 1QCFA 1UFFA 2KXCA 4J9CA 2FEIA 1GCQC 2LCSA 2JTEA 2EVRA 2FRWA 4QT7A 2ED1A 1H92A 4CC2A 3SHWA 1BBZA 4E6RA 2K9GA 3PVQA 1QKWA 1Y57A 4AFUC 1PNJA 2F2XA 1UE9A 1K9AA 4AFZC 2L0AA 3I5RA 2FPDA 4F14A 1SHGA 1UJYA 2OJ2A 2HSPA 1NM7A 1K0XA 1RLPC 2LNHB 2J06A 1E6HA 2EW3A 2M51A 1JXMA 3NHNA 1VYUA 1W6XA 2MCNA 4GLMA 2RPNA 2O9VA 2BZYA 2KNBB 1NYGA 1U3OA 1Z9ZA 4HXJA 2FPFA 1GL5A 3M0SA 1VYTA 1PRMC 2ABLA 2RQTA 1SEMA 4D8KA 3I9QA 2EYYA 1TUDA 2EYZA 4LE9A 2MOXA 4OMQA 2CH4W 1T0JA 2RQRA 4CC7A 2AKLA 1MV3A 2KXDA 1AZGB 3U23A 1UHFA 2FO0A 1JEGA 5EC7A 1ZX6A 3JV3A 1XOVA 5HCKA 2KT1A 3H0IA 4GBQA 1T3SA 4D8DA 2CDTA 4RUGA 3VRYA 4F17A 1GFDA 2RF0A 1VA7A 4RTWA 1ABOA 4RTXA 2CH4A 3C0CA 2K6DA 2LJ1A 4J9IA 1OEBA 2J05A 2RQWA 4ZNXA 4DEYA 2YUOA 2L2PA 2DJQA 1UUEA 2VVKA 2DILA 3THKA 1H3HA 2SRCA 1U06A 2HEQA 5I22A 2AKKA 2KRSA 5ECAA 2SEMA 1KIKA 4J9BA 4OMMA 1RLQC 2C0TA 4IIOA 2CT4A 3EGUA 2XMFA 2D1XA 4AFSC 1TUCA 2EBPA 1S1NA 1K1ZA 2DL8A 2EYXA 1M30A 1SRLA 2I0NA 2IIMA 2YUQA 2LX7A 1B3QA 3VS4A 1UG1A 1AEYA 4K11A 3M0UA 1WXBA 3GBQA 1RI9A 1T3LA 2K7AA 4J9DA 1Y0MA 1AWOA 3O5ZA 4KRTA 1PWTA 2F2WA 3VRZA 4R0KA 2KT8A 2O31A 2YUNA 3TSWA 2EGCA 3NGPA 2L3QA 3VS5A 1UHCA 2CT3A 5I11A 5GJWB 1M3AA 2D8JA 3REAB 1CKBA 1WIEA 3CQTA 4OMOA 5FWBA 5IHNA 2ED0A 4LUDA 4AFQC 3VS3A 2GTOA 3H0HA 2A37A 1ZSGA 4CC3A 1EFNA 1I0CA 2J6FA 1QKXA 1QWFA 1M3CA 2PZ1A 4FSSA 1NLOC 2MIOA 1SHFA 4HVUA 3EG3A 1X2KA 4RTVA 1CSKA 1KSWA 2BZ8A 2RMOA 3TVTA 1E6GA 1K76A 4LN2A 4A63B 1WLPB 2EYWA 1VYVA 1GCQA 2K2MA 5FW9A 1YWOA 1GBQA 2HBWA 2O9SA 2EGEA 2JMAA 1RUWA 2KYBA 1UDLA 4ESRA 1SSHA 1ZLMA 1WX6A 3VS6A 2YUPA 2V1RA 1UJ0A 2DA9A 1G2BA 2X3WD 2DL3A 1JU5C 1JXOA 2JXBA 2JS0A 4J9FA 5IXFA 4AG1C 3RBBB 1YN8A 2RN8A 2DF6A 1YWPA 2RQUA 2FRYA 2VKNA 4JPBW 3EG0A 3M0PA 1IO6A 3RNJA 1M8MA 2YSQA 2G6FX 2KYMA 2E5KA 3ZL7C 1B07A 4CC4B 2VWFA 4RTUA 4EIKA 3VS2A 1OPLA 2GGRA 1PRLC 3EG1A 2DLPA 1X69A 2V1QA 2FG0A 1BB9A 3M0QA 2KRMA 3QWXX 4HVWA 2JM8A 2DRKA 1GBRA 1QLYA 1WXTA 2RQVA 4RTTA 1AZEA 4JZ4A 2BZXA 2A36A 4Z8AA 1ZUKA 2GNCA 1X6GA 2O2OA 4RTYA 1YP5A 2J6KA 3TSZA 2FPEA 1AVZC 2DE0X 2AZVA 2L3PA 4DEXA 2YT6A 1ARKA 2ENMA 3NPFA 2YDLA 1WFWA 2D0NA 3FJ5A 1AWWA 2GBQA 1E7OA 2KE9A 1K0SA 4J9EA 1LCKA 2DMOA 1I1JA 3LH5A 2C0IA 3VS7A 2AK5A 3KFVA 2JT4A 4F16A 2DRMA 2L3SA 2CSIA 2HCKA 2X3XD 4OMNA 4Y92A 3EG2A 2LMJA 1WI7A 1QWEA 1Z9QA 1WA7A 2D8HA 2HDAA 1N5ZA 2KEAA 2J6OA 1UTIA 4ORZA 2B86A 2DL5A 2GQIA 5GJVB 3NMZC 2BTTA 1NEBA 2J7IA 3UF4A 2K79A 1NYFA 3QWYA 4JJBA 3ULRB 5IXBA 5L23A 4LUEA 1NLPC 1T0HA 4J9HA 4WCIA 1GRIA 1AWJA 1FMKA 1PHTA 1NG2A 3PVLA 1AD5A 5IHKA 1K4US 2ROTA 1FYNA 1WYXA 1BK2A 2DM1A 1ABQA 2JMCA 3H0FA 1WDXA 2LQNA 1U5SA 1X43A 2KR3A 1GCPA 1A0NB 3EHRA 2KGTA 2OI3A 2ESWA 4JJCA 2DYBA 1GFCA 3I5SA 2LJ0A 2EPDA 2C0OA 3UATA 2NUZA 1X27A 2DBKA 2EQIA 1KJWA 1WXUA 1SRMA 4Z88A 2DVJA 1OOTA 2LZ6B 3VS1A 2F2VA 2A08A 2NWMA 5IH2A 1CKAA 2AZSA 4JZ3A 1PKTA 1HD3A 2KRNA 1W1FA 1ZBJA 2KROA 2EGAA 1YCSB 2LJ3A 4J9GA 2W0ZA 1ZUUA 1HJDA 1J3TA 1W70A 4X1VA 1PKSA 2JS2A 2W10A 2CREA 1M3BA 2PTKA 1AOJA 1BU1A 4HCKA 1AWXA 4JJDA 1JQQA 3M0TA 4M4ZA 1KFZA 2DX1A 1H8KA 2JW4A 3A98A 4OMLA 2A28A 5FWCA 2ECZA 4IIMA 3R6NA 3UA6A 2QDLA 2CUDA 2CUBA 4AG2C 1JO8A 2LQWA 2KBTA 3SEMA 1HSQA 3VS0A 4HVVA 1G83A 2DBMA 2DL7A 2PNIA 2P4RA 1ZUYA 1I07A 3PE0A 4RTZA 1NEGA
chains in the Genus database with same CATH superfamily
4PKCC 2JM9A 3UT1A 5IHIA 2RH2A 1D0YA 1JRIA 1PD1A 3JCMJ 2EQKA 2O88A 4OMPA 5CR2A 4FW2A 2MF2A 1N9SA 3MHXA 3VYGA 2JTMA 5LL6S 1M8VA 3L2RA 2RHIA 4M75G 2WACA 4HCBA 4GLKA 3CD6A 1Q82C 2ROLA 2ZPBB 3I35A 1VQ5T 4C8QF 1UFFA 2KXCA 4J9CA 3G7ZA 3OYHA 4RG8A 1ZHIA 3HRUA 4PLLA 2LCSA 1H92A 2I2LA 3PVQA 4C5IA 4AFUC 2OTLQ 3A8HB 1UE9A 4HT8A 1UB4A 5GANd 2K2VA 1VQLA 2QA4Q 2L0AA 2RHZA 4F14A 3EG9A 4DBHA 3JB9I 2OJ2A 3SWNB 2KSSA 5GMKl 3UWNA 1K9MU 5LJ5f 3CPWS 2J06A 2EW3A 2QEXT 4QQ6A 3NHNA 1LOJA 4J8OA 3G6EQ 2KNBB 3N5BB 1IHVA 3CCJQ 1YI2A 2EJGA 4ZGEB 3MP1A 5M9OA 2RJDA 2IPOB 4D8KA 3I9QA 2EYYA 5GANj 1WHLA 2QK0A 1TUDA 4J6XA 4RCCA 1MV3A 3E1SA 5FU7C 1UHFA 4QVZA 1JEGA 1X6OA 2QAZA 1JJ2P 2RJCA 2BIVA 2XDDA 2COWA 3E2UA 2KT1A 1RABB 3CC7Q 2XD0A 1T3SA 4D8DA 2CP0A 3QDRB 4FL6A 2AIRB 4KBMB 3VRYA 1Y71A 4KGZB 2RF0A 1VA7A 1MNDA 2CZ1B 2E3HA 4FYVB 3CPWA 4XU0A 4HA8A 3OW2S 4X34A 2DJQA 4J6WA 5LJ5e 3THKA 1H3HA 2VB6A 5D6XA 1U06A 2BKDN 1SKUB 3CCLT 2E6ZA 1X01A 1VQ9A 2D1XA 2HQHA 2QASA 2K3YA 4HT9A 3JB9J 1SF9A 5GMKi 2IIMA 1B3QA 3VS4A 4FCYA 1AEYA 4K11A 3CCSQ 4C8QE 5A0LA 3G71T 1RI0A 1KD1U 2QTVA 3JCMc 3WXMB 1AT1B 4C5GA 4OB2B 1Y0MA 3QYHB 1YJ9A 3O5ZA 4KRTA 1PWTA 3RMSA 3VRZA 1QW1A 1OU8A 2YUNA 3TSWA 5CKEA 2L3QA 4BB7A 1K73R 1YITQ 3EGXA 2QTXA 3FRNA 2DXUA 4NS5A 2HL3A 3REAB 4PFPA 1DJ7B 2DJZA 3VS3A 1KQSP 2GTOA 3OW2A 3H0HA 1ZSGA 3GNGA 1I0CA 2PZ1A 4M78A 5KCHA 1G3YA 4AT1B 2KK4A 1CSKA 2BZ8A 3KUFA 3NTHA 3V8JA 1ZSZA 1K76A 4LN2A 4D6WA 4JRIA 1VYVA 2K2MA 4RG2A 3JCMW 1S72Q 4PLIA 4C92A 1UDLA 2QGFB 3DB3A 1N8RC 5D7UA 2R5AA 1VIFA 4ELZC 1SSFA 2HKNA 2RHUA 4BI8B 1UGSB 3CEYA 2DA9A 2LNVA 5HK3A 1M90R 4M7DA 1JU5C 2RJEA 1PG5B 4N4IA 4J7IA 3CCET 4CI0C 1YN8A 2CS7A 4C8QC 2FRYA 2QQ9A 3EG0A 2M0OA 5IN1A 3E9FA 1IO6A 3URGA 2XKOC 1D09B 2YSQA 5KYYB 1HXDA 1VQMT 3V7CA 5CAIA 4ZTFA 3VJPA 2VWFA 4RTUA 1Q81R 4M77B 3Q1JA 3JRZA 4VUBA 4AMCA 2V1QA 2Z0WA 1BB9A 4KGVB 4JDSA 1Q86C 1P92A 2OTJQ 4KUIA 3OYJA 1AZEA 1VQ5A 4JUVA 4A4HA 3PGGA 4F7UB 2YRDA 2GNCA 1D1AA 2O2OA 1BCOA 3A8GB 5GAOq 3CMEA 3TCJA 5C6SA 2DPPB 2AZVA 4DEXA 2YT6A 3L2QA 3A1PA 2D0NA 4DBFA 1I81A 1KC8U 1QCOA 2X4WA 2FZCB 1K0SA 3L42A 3JSCA 1K9MC 4J9EA 2VC8A 1LCKA 4C0GA 2K5LA 2P0KA 2AK5A 3LYIA 1D1CA 5KE3A 2HSEB 4C5EA 5KE2A 2CSIA 1RACB 4M78G 4ZGDB 4Y92A 1WI7A 1QWEA 1Z9QA 1I8FA 4DOWA 2HDAA 2X4YA 4PJOF 2E41A 1VQ4Q 2VV5A 1VQNT 3PMIA 2KQWA 3L2UA 1C0MA 1UGRB 2AT1B 5GAN6 1NEBA 2V8KA 4E7ZA 1T0HA 1M2VA 4F04B 4M78D 1JB0E 1AD5A 1QMCA 1KQ1A 1K8AR 1FYNA 5GAN8 1ABQA 4BUGA 1X43A 1WZOA 1Q7YR 2EJFA 4LXCA 4LDWA 2DTHA 5LJ3g 2OI3A 2O4XA 1GFCA 2FB7A 2RM4A 2M02A 3UATA 3RKXA 1YFNA 3DKMA 2DBKA 1WXUA 1SRMA 2FVUA 4B6MA 3CCLA 3HKSA 3EFOB 2NWMA 1OU9A 5IH2A 1WJRA 3RIRA 3JCMX 3CBMA 2A3LA 1W1FA 4M7DD 3DB4A 1VOMA 2VXFA 4Y28E 3G71A 2KROA 2EGAA 1YCSB 1Q82U 5CKFA 2LDMA 1OI1A 3OYFA 1WJQA 2W0ZA 3JCMe 2V8JA 1I5LA 3JCMh 3VYHB 3CXCP 1J3TA 4DBRA 1NPPA 2VYTA 1TUGB 3NTKA 2EFIA 5GMKj 2PTKA 3OYGA 1VQLT 4M4ZA 1KFZA 2X35A 1H8KA 2X9HA 5GAOm 3PFSA 3I56T 4N0AA 4FSXA 3VKIA 4A4EA 1Y96B 3MPUB 4M7AB 4E7LA 2E1HA 4IIMA 3R6NA 3QDFA 1V29B 2QDLA 2ZPIB 2DERA 3JAME 1R77A 4KULA 4HVVA 2VGMA 1G83A 2G3RA 4XTVA 4BE0A 4OMFB 1PCXA 4P5NA 2E12A 3EGDB 5FROA 1ZUYA 4EMKB 3EH1A 4RTZA 1M4ZA 3FEOA 1NEGA 1RAGB 1KG1A 1OV3A 3REBB 1X6BA 2CSQA 1UGVA 3RERA 1JJ2S 4OB0B 1M1KR 2K5IA 2VXEA 1Y7XA 4Z89A 2DIQA 3LWIA 2CZ6B 3CCEA 2KI7A 3LX7A 4WTOB 2GTJA 1KHIA 3M0RA 1YNZA 2GFUA 2LP5A 4C0DC 2RI3A 1TS9A 2DNUA 1MUZA 1VQ7Q 2VUBA 1VQMA 5DLQE 3H41A 3CC2Q 1QCFA 3M4GA 4M75A 1ZQ1A 1GCQC 3AHUA 4CC2A 3SHWA 1Y57A 4ZN1A 2EQUA 2DAQA 2NUPB 1VUBA 1UJYA 2K57A 1JJ2A 1YJ9T 1VQKQ 1VQPQ 1E6HA 3SDZA 5KYXA 5LJ3d 1JXMA 1Y07A 2RJFA 2RD1A 1W6XA 2MCNA 1B34B 3HFNA 4GLMA 4PJOG 4BE1A 2BZYA 1NYGA 1U3OA 4RKUE 3JB9D 3QO3A 3CMAQ 1VYTA 1G3SA 2CP6A 2RQTA 4A54A 1SEMA 3RR6A 3FB9A 2E10A 2CKKA 4LE9A 1I4K1 1G8XA 5GAMg 1JBMA 5I2MA 1QVFP 3MP8A 4J83A 2OTJT 1KHCA 2GCXA 4PFZA 3M55A 1AZGB 3G4SQ 4PJLA 2FO0A 1PSFA 2D6FA 4PJOD 2WSFE 5C0MA 5HCKA 5LJ3j 4LD9K 2RK2A 1WHHA 1W2BS 2E6NA 4GBQA 1NJIC 2Y4XA 4LDYA 4RUGA 1N8RU 4F17A 2QA4A 4XTYA 4M77F 1ABOA 4QW2A 4J9IA 3PIPA 2RQWA 1W4SA 5A0GA 2XI9A 1KD1R 1M2VB 2AKKA 1C1AA 3CCQT 2DO3A 1EZZB 3LWHA 4F7UF 2Y90A 3R6OA 3G6EA 4IIOA 4BE2A 2CT4A 2YLCA 5GANf 3OSSC 4AFSC 5GAOr 1TUCA 2MWPA 1S1NA 2DKGA 2EYXA 1SRLA 2I0NA 5KYWB 2L8DA 1QCNA 4A4KA 5GAN3 3CC4T 2HQXA 4J9DA 1AWOA 1ACMB 2CP5A 2F2WA 4R0KA 3S3OA 2KT8A 3FC3A 3BDLA 1BIBA 1IZ6A 4E7IA 1UHCA 3E9GA 5GJWB 1W2BA 1OZ3A 4QKUA 1Q86U 3O8VA 1EIFA 2HQEA 3CCUT 3MP6A 1CKBA 5FWBA 4OMOA 3CC7A 4Y91A 4AFQC 2OAUA 3OMCA 2A37A 3J81E 1EFNA 2J6FA 1QKXA 4FSSA 3CMET 2MIOA 1X2KA 2CYZB 2P84A 1KSWA 1E6GA 1VQ8Q 2NUTA 5FW9A 4JS4A 2JZ2A 1GBQA 3I56A 9ATCB 1VQOQ 4M75D 4ESRA 5GANe 5GANh 3OS1A 1VQ6Q 1SSHA 1D0ZA 5I2SA 1WX6A 2YUPA 2LC4A 1UJ0A 5GAN4 1QP2A 2EYQA 2X3WD 2DL3A 3MEWA 1HK9A 2CP7A 5KYUB 2JXBA 2JS0A 1YJNT 3X28B 4J9FA 7AT1B 3INZA 4AG1C 4ELYC 3TQ7P 4BACA 2PQWA 4J6YA 2DF6A 2HL5C 1BCMA 4M77E 2XHCA 4JPBW 1WQWA 1TU0B 3M0PA 3RNJA 3LGLA 1BI2A 3OYDA 3TEEA 4MZPA 1YJWT 1NE8A 4C8QA 1BI1A 3ZL7C 4E47A 2E3IA 5GAMd 3X24B 4F7UE 4N4GA 1YIJT 1OPLA 1PRLC 2L3RA 4JLIA 1OZ2A 3EH2A 3M0QA 4HVWA 2KRMA 3QWXX 2DRKA 5FRMA 1GBRA 1TXQA 3OQ5A 3CD6Q 5LJ5h 3C12A 2GF7A 1KC8R 1X6GA 1YP5A 3GNFB 2VGNA 4GY5A 3TSZA 2FPEA 2H3JA 4M7AF 2L3PA 1H3ZA 4FYYB 1FX7A 1ARKA 2ENMA 5GAMj 1WHMA 3FJ5A 1BI3A 3VUBA 5FU6B 1E7OA 3CXCS 1R0CB 4FW1A 2KE9A 4JRQA 3S3MA 3LH5A 4EDUA 3VS7A 1YHQT 2IG0A 2DD5A 3ZEHA 3SFMA 2QGGA 4Z02A 2QYZA 3CCRT 2DRMA 3BE3A 2X3XD 4M77C 3RKYA 4M77G 1WA7A 1UEBA 4XU2A 2CP2A 3CCVT 1N5ZA 1YI2Q 3L2ZA 2J6OA 4ORZA 3UPUA 2DL5A 2GQIA 3EAEA 2D0QB 3NMZC 4NL3A 2OTJA 4FYXB 4IUQA 3V8KA 1IHWA 1KQ2A 4IUTA 3UF4A 4F7UG 1ZBXA 3QWYA 3ULRB 5IXBA 5L23A 1HYOA 2QQAA 1GRIA 2R58A 2JTFA 1PHTA 1M5Q1 2ROTA 3LLRA 1WYXA 3H0FA 3OYLA 1U5SA 2DXBA 3A8OB 3LH0A 3EHRA 1WNLA 3ZBDA 2KGTA 2DK3A 2O01E 2ESWA 2DYBA 4QVDA 2YXYA 2LJ0A 4C5HA 1Q82R 3V7RA 3CCQA 5FRNA 1X27A 4MDXA 2DVJA 1OOTA 2PVDB 2KAFA 2HNIA 4C8QG 4PK4A 4R56A 4HCZA 5CQYA 4KH1B 1VQ9Q 2HKQB 5HY6A 2ZPHB 1X75C 3CC4A 2LJ3A 1VQ4A 4PL6A 5D6YA 1SG5A 3C95A 1HJDA 3FIFA 4PFOA 4TVRA 4X1VA 1BI0A 1EX4A 1PKSA 4M7AE 4ZGJB 2CREA 5AT1B 1AOJA 1PD0A 1AWXA 2K4YA 1FMWA 1BIAA 2DXCA 4C8QD 2XIDA 3CCUA 2LRQA 2JW4A 4C92E 5IT9E 1RADB 3M56A 3I55T 4MZTA 2RO0A 2LTOA 1FXXA 3V7SA 3GIBA 4FM4B 1MNEA 4AG2C 3OYIA 4ANJA 3SEMA 2KBTA 1HSQA 2YRCA 3EG9B 5A2QE 1M1KC 2DFUA 2P4RA 3PIOA 3OBWA 1I07A 2EQMA 3GOXA 3PE0A 3OYEA 1V1CA 4FT2A 2PUOB 1SPKA 3G1JA 4OVAA 2E64A 2EKOA 2H8HA 1YJNA 2DYIA 3TU4K 1MV0B 4FIBA 4IUUA 2M0YA 1OPKA 2OTLT 3JCMQ 1NJIU 1TG0A 1TH7A 2X51A 1QVGS 1NBEB 1MMNA 3QZ5B 2QA4T 4LNPA 2P0PA 5AYFA 3CCMQ 4MMLA 2LCLA 1YJWA 4M7AC 2JUFA 2RNAA 1N9RA 4XQ3A 2P0QA 1ZSZC 2FHDA 2OX7A 4E2FB 1OX9A 1ZA2B 3M58A 4OF1A 1YIJA 2JTEA 2EVRA 2FRWA 3HRTA 2ED1A 4QT7A 4E7HA 1BBZA 3G6ET 2B8AA 2F2XA 4C92C 2YLBA 2PVOB 4NL2A 2LCCA 3CCJT 3X25B 3CPFA 2FPDA 4EMKC 1F1BB 2FZKB 5L8RE 2HSPA 3HRSA 1K0XA 1VQ5Q 2E70A 4M7DC 5GMKe 2M51A 3DLLA 5GMKh 4ZTJA 1QP3A 1TSFA 2DTIA 2EAYA 2MPXC 2O9VA 1QVGA 2FPFA 1GL5A 2XICA 2RHXA 1G3TA 3OW2P 1PRMC 3OSVA 4PJOA 3H9NA 3CC7T 1YHQA 1YCYA 2EYZA 3QUIA 1N8RR 3CCRA 2RQRA 4DQ2A 3EGXB 2QEXQ 1R0BG 2E4HA 5KYNA 3OS5A 4HKEA 2COZA 3QKJA 5GAOp 3CCVA 1XOVA 1U1TA 4M78B 2EQJA 3H0IA 3OYBA 1ZSZB 1GFDA 3KBGA 4OB3B 4RTXA 3CCST 3C0CA 2K6DA 4JRKA 1OEBA 2J05A 1LJOA 4DEYA 2L2PA 1UUEA 4C92B 4C0ZA 2SRCA 3JCMP 3CBPA 3SWNA 2KRSA 3VUZA 1KIKA 1YITT 4J9BA 4OMMA 4JS5A 3QYGB 1RLQC 8AT1B 2C0TA 3MJXA 3EGUA 2EWNA 1RL2A 3CMAA 4RCBA 4M7DB 3M4YA 1M30A 1WHJA 2LX7A 1UG1A 6AT1B 3QBYA 2LVMA 1FMVA 3GBQA 2K7AA 2YRVA 3BY7A 4X9CA 2LX9A 4BD3A 4JJNK 1RAHB 3HFOA 2EGCA 5LJ3f 1WQ7A 1N6AA 3VS5A 3G4SA 1M3AA 3E19A 3CCLQ 4WF2A 3MCAB 1S72T 3BDUA 4BI4A 1WIEA 2ED0A 4LUDA 2XDBA 2ATCB 4X9DA 1K9MR 1G3WA 1SHFA 4HVUA 2FL7A 3QZ9B 2XK0A 2ZPFB 3TVTA 3NTIA 5EG2A 4A63B 1WLPB 2EYWA 3NFCA 2PUKB 4A53A 5GAOl 3GF5A 2DD4A 5CQXA 4JLGA 2YHTA 1RUWA 2KYBA 3I55A 4XK8E 3VS6A 4XU3A 2V1RA 1XTDA 5DY9A 1G2BA 1M1GA 3KXTA 1KQSS 1JXOA 5LJ3e 5LJ3h 5CCAA 2GQVA 5DLOA 5CVIA 1RAFB 1TWBA 1QQJA 1YWPA 2RN8A 4A4FA 2RQUA 2FZGB 4HCCA 2A0FB 5A0DA 1G5VA 2G6FX 4O6JA 4XAXB 1U8RA 5GAOn 2E5KA 1MMAA 1OX8A 2WSCE 4CC4B 3VS2A 2OTLA 5J3BA 3EG1A 3CCEQ 2DLPA 2H3EB 3LGFA 2JM8A 2DTOA 1D3BA 1VQOA 1WXTA 2RQVA 4RTTA 1M9SA 2BZXA 4QQGA 3H6ZA 2A36A 1VQMQ 1ZUKA 1KQSA 1NZ9A 4RTYA 5GMKm 1OYXA 2J6KA 1K73C 3OYKA 5CKBA 3CCJA 2HBPA 4XTWA 2O4XB 1WFWA 3M54A 3J7AF 2CZ0B 1VQ4T 2LT1A 2DMOA 3BFMA 3KFVA 3L2VA 3CCMT 2GFAA 2JT4A 4F16A 4J5YA 3V8LA 2L3SA 5CK9A 2M1HA 2X4XA 2QDYB 2HCKA 4OMNA 4PJOB 3EG2A 3M53A 5KYYA 1IGQA 2D8HA 4XTZA 2PVGB 2KEAA 4J7FA 3M9QA 2B86A 2L89A 3QIIA 5GJVB 4M77A 1XQHA 2CGHA 4E7JA 4M75C 4QQDA 1M90C 4FYWB 2K79A 1M1KU 4KGXB 2XG8D 3P8DA 4LUEA 5GAMf 4WCIA 1NG2A 3PVLA 4F7UA 1K4US 1RAEB 3MEAA 1BK2A 1VQNQ 2KY9A 5FU6C 2LQNA 2KR3A 3L2WA 2DEQA 2MAMA 3CCSA 2LT4A 3OYCA 3GP8A 2C0OA 3RDVA 1Q81C 3A8LB 3D7SB 2EQIA 4Z88A 4EPCA 1YITA 4ATOA 3JB9H 2LZ6B 3VS1A 2A08A 2AZSA 4JZ3A 2A7YA 2EIFA 3HP9A 5CIUA 1HD3A 4BY6C 4DBQA 4J9GA 4CRIA 1MMGA 1ZUUA 4KUDK 4PJMA 4IKFA 2JS2A 5GAN2 1H641 1M3BA 2JN0A 1PSEA 4HCKA 5GAMe 5GAMh 1S72A 1JQQA 3OA6A 4RMOA 2F69A 4M75B 3MO8A 3C4SA 3A98A 5DM7R 5FWCA 3QJ6A 2ECZA 5LJ5d 4M78F 2RB6A 2CUDA 5HKCA 3VU3C 4XTXA 1WJSA 1VQLQ 2DBMA 2V8IA 3TREA 2PNIA 4XTUA 4C92F 3I56Q 3RMQA 2NYSA 5KYXB 2R5MA 1C6VX 1LPLA 1NJIR 1VQ7T 3EFOA 3A5ZB 1LVKA 3CC2T 3GLXA 3UA7A 2OAWA 4M7DF 1YBYA 2RHYA 5LJ5j 4BY6B 1K8AC 1MHNA 2DL4A 4L59A 2D9TA 1Q7YC 3EFRA 2FYKA 1UECA 2XDPA 2EKHA 2K3BA 3EHQA 3IQLA 1X2QA 2ZGWA 1M27C 4QVCA 3MKDA 1VQKT 4LD6A 1VQPT 2P4TA 3FLGA 3L1AA 3HTRA 2FEIA 5FU7B 3CXCA 1ZA1B 1Y96A 4M77D 4M7AA 4E6RA 2K9GA 5GAN5 1QKWA 1PNJA 1TTHB 4ME7A 1D3BB 1K9AA 4AFZC 3S3NA 3META 3FDRA 4BDZA 3I5RA 1M2OA 3CMAT 1SHGA 4E7KA 3PMTA 2MK5A 1NM7A 1RLPC 3OMGA 4BI3A 2LNHB 2WSEE 3EGDA 4EMKA 3QSUA 1W2BP 1VYUA 3G4ST 2RPNA 3QJYA 5KCOA 3OYNA 3EFSA 2MI6A 5J26A 3JCMg 1Z9ZA 4HXJA 5HK0A 2E5QA 3M0SA 5FLXE 3OYMA 2ABLA 3WVDB 3OYAA 2YWWA 4M78E 1IGUA 1YJ9Q 2NLUA 2RI2A 3CCMA 2KMTA 2MOXA 4OMQA 2CH4W 1T0JA 4CC7A 2AKLA 1D1BA 2KXDA 3U23A 2LQKA 2MYSA 5EC7A 1ZX6A 3JV3A 3HSBA 1Q95G 1WPYA 4II1A 2DVEA 2C06A 2KVQG 1KK7A 2CDTA 8ATCB 1MMDA 1RAIB 3SD4A 3LW5E 1RAAB 4L5GA 4RTWA 2JOYA 2NUTB 1WHKA 2CH4A 5CKDA 3M57A 2LJ1A 4IURA 4MMKA 2HMAA 2NUPA 3QG1A 4ZNXA 2YUOA 2KDSA 4M7DE 2VVKA 2DILA 5I22A 2HEQA 5ECAA 3MEVA 2SEMA 1QVFS 4O5VA 2JNGA 4FT4A 2XMFA 4PJNA 2EBPA 4OGEA 1K1ZA 1B34A 2DL8A 2YUQA 3M0UA 5IAYA 1WXBA 2MMPA 2R57A 1NPRA 3JB9F 1RI9A 1T3LA 4DA4A 3OYYA 2QQBA 2O31A 2QEXA 3CCQQ 3AT1B 3NGPA 4OB1B 1VQ8T 2CT3A 4OP0A 5I11A 4DOVA 3CPWP 4JRPA 4M78C 4C8QB 1VQOT 2COYA 4M7AG 2D8JA 1IXDA 1U1SA 3RKWA 3CQTA 5IHNA 4E7SA 1VQ6T 1PC0A 3CC4Q 2F1LA 3WVEB 1O75A 4CC3A 2ZPGB 1QWFA 1M3CA 1NLOC 3EG3A 3JCMf 1K73U 1AHJB 4BDYA 4RTVA 2RMOA 4OGCA 1QVFA 4C92G 1MGQA 4KT0E 2CP3A 1GCQA 2JJ9A 1IREB 1YWOA 1XJWB 2HBWA 2O9SA 2QQRA 2EGEA 2JMAA 3CCUQ 2MWOA 2F5KA 2HD0A 3QHSA 4MDWA 4N4HA 4M7AD 1ZLMA 4PNOA 4NOYA 4M7DG 2VASA 2BUDA 3HHTB 3CMEQ 3HL8A 1UGPB 2DZCA 3OY9A 4L6V5 2RA2A 5CO7A 3H8ZA 5KYWA 5D6WA 4C92D 2BE7D 3RESA 2LQ8A 5IXFA 3RBBB 3P8BB 1B7TA 4Q5WA 3HPWA 5GAN7 3JCMd 1VQ7A 2QQSA 3F70A 2VKNA 3P8HA 5KH6A 5I21A 1M8MA 3QXEB 1KD1C 1M90U 3CC2A 3CD6T 3OB9A 2KYMA 1IRXA 1B07A 1YJNQ 4EIKA 2QXFA 2GGRA 1IB8A 1X69A 3X26B 2FG0A 2Y4YA 2F5TX 1QLYA 2JVVA 1WGSA 4LDXA 1VQKA 1XNIA 4JZ4A 1VQPA 1YJWQ 1UGQB 4Z8AA 3ZFJA 4XU1A 3UDCA 4KH0B 1Q81U 3M59A 4R55A 2BE9B 3M5AA 4M75F 3A8MB 1AVZC 2K5FA 1YIJQ 2DE0X 3PTAA 1D0XA 3NPFA 1Q86R 5J39A 2YDLA 3PT9A 4IUVA 2V26A 1AWWA 2GBQA 1OQKA 1YI2T 4PJOE 5KYUA 1I1JA 2C0IA 4FU6A 2RI5A 1BKBA 3J80E 1I5OB 2DETA 1PM3A 4MZMA 4ZN3A 3GPLA 2LMJA 3OBYA 2DEUA 3G71Q 3BW1A 1UTIA 1V76A 3ASKA 3OS2A 3ME9A 2EJ9A 1YHQQ 2BTTA 2HZYA 4YTLA 2J7IA 3FJPA 1QVPA 2IVWA 3CCRQ 1GXIE 1NYFA 4JJBA 2RK1A 1NLPC 3SB2A 5GANg 4J9HA 3X20B 1AWJA 1FMKA 2M16A 5IHKA 3CCVQ 2DM1A 3JB9G 2PU9B 2JMCA 1WDXA 3JCMb 4A4GA 1VQ9T 2CZ7B 1GCPA 1A0NB 4JJCA 1VIEA 3QPHA 3MEUA 1R8OB 3I5SA 1M1FA 2EPDA 4LDVA 2QI2A 2NUZA 3VV0A 4LDUA 4IUPA 2DXTA 2DZ9A 1K8AU 1KJWA 2F2VA 2HAXA 2X4JA 2K3XA 4PJOC 1Q7YU 2XU8A 1CKAA 3T9NA 1LNXA 1PKTA 1TOVA 3ER0A 2ZZDA 2KRNA 1O9SA 1ZBJA 4C0FA 1KC8C 3JCMV 3CBOA 4EMHA 4M75E 4PJJA 1W70A 2W10A 2ZCFB 5CKHA 2AHJB 1VQ8A 4N0AC 3RUXA 1BU1A 4V2SA 2QG9B 5LJ5g 4JJDA 2L5QA 3M0TA 2DX1A 4C0DB 3PNWC 1VQ6A 2ZAEA 2M9UA 4OMLA 2A28A 1VQNA 3S6WA 3DLMA 2E65A 3UA6A 4B9XA 2CUBA 3SWNC 2DIGA 1JO8A 2LQWA 3C94A 1QVGP 1WHGA 3VS0A 4B9WA 1BYMA 2DL7A 1FWZA 4EMGA 3OS0A 2ZPEB 4UC4A 1N27A 1OULA 3I55Q
chains in the Genus database with same CATH topology
1OV3A 1V1CA 1X6BA 3REBB 2CSQA 1UGVA 2JM9A 5IHIA 1SPKA 2H8HA 4Z89A 3UA7A 1MV0B 4OMPA 2OAWA 2O88A 2M0YA 2DL4A 1OPKA 2GTJA 1TG0A 3M0RA 1UECA 1YNZA 2LP5A 4LNPA 2EKHA 2DNUA 1MUZA 2K3BA 3EHQA 3IQLA 1X2QA 2RNAA 2ROLA 1M27C 3I35A 3H41A 1QCFA 1UFFA 2KXCA 4J9CA 2FEIA 1GCQC 2LCSA 2JTEA 2EVRA 2FRWA 4QT7A 2ED1A 1H92A 4CC2A 3SHWA 1BBZA 4E6RA 2K9GA 3PVQA 1QKWA 1Y57A 4AFUC 1PNJA 2F2XA 1UE9A 1K9AA 4AFZC 2L0AA 3I5RA 2FPDA 4F14A 1SHGA 1UJYA 2OJ2A 2HSPA 1NM7A 1K0XA 1RLPC 2LNHB 2J06A 1E6HA 2EW3A 2M51A 1JXMA 3NHNA 1VYUA 1W6XA 2MCNA 4GLMA 2RPNA 2O9VA 2BZYA 2KNBB 1NYGA 1U3OA 1Z9ZA 4HXJA 2FPFA 1GL5A 3M0SA 1VYTA 1PRMC 2ABLA 2RQTA 1SEMA 4D8KA 3I9QA 2EYYA 1TUDA 2EYZA 4LE9A 2MOXA 4OMQA 2CH4W 1T0JA 2RQRA 4CC7A 2AKLA 1MV3A 2KXDA 1AZGB 3U23A 1UHFA 2FO0A 1JEGA 5EC7A 1ZX6A 3JV3A 1XOVA 5HCKA 2KT1A 3H0IA 4GBQA 1T3SA 4D8DA 2CDTA 4RUGA 3VRYA 4F17A 1GFDA 2RF0A 1VA7A 4RTWA 1ABOA 4RTXA 2CH4A 3C0CA 2K6DA 2LJ1A 4J9IA 1OEBA 2J05A 2RQWA 4ZNXA 4DEYA 2YUOA 2L2PA 2DJQA 1UUEA 2VVKA 2DILA 3THKA 1H3HA 2SRCA 1U06A 2HEQA 5I22A 2AKKA 2KRSA 5ECAA 2SEMA 1KIKA 4J9BA 4OMMA 1RLQC 2C0TA 4IIOA 2CT4A 3EGUA 2XMFA 2D1XA 4AFSC 1TUCA 2EBPA 1S1NA 1K1ZA 2DL8A 2EYXA 1M30A 1SRLA 2I0NA 2IIMA 2YUQA 2LX7A 1B3QA 3VS4A 1UG1A 1AEYA 4K11A 3M0UA 1WXBA 3GBQA 1RI9A 1T3LA 2K7AA 4J9DA 1Y0MA 1AWOA 3O5ZA 4KRTA 1PWTA 2F2WA 3VRZA 4R0KA 2KT8A 2O31A 2YUNA 3TSWA 2EGCA 3NGPA 2L3QA 3VS5A 1UHCA 2CT3A 5I11A 5GJWB 1M3AA 2D8JA 3REAB 1CKBA 1WIEA 3CQTA 4OMOA 5FWBA 5IHNA 2ED0A 4LUDA 4AFQC 3VS3A 2GTOA 3H0HA 2A37A 1ZSGA 4CC3A 1EFNA 1I0CA 2J6FA 1QKXA 1QWFA 1M3CA 2PZ1A 4FSSA 1NLOC 2MIOA 1SHFA 4HVUA 3EG3A 1X2KA 4RTVA 1CSKA 1KSWA 2BZ8A 2RMOA 3TVTA 1E6GA 1K76A 4LN2A 4A63B 1WLPB 2EYWA 1VYVA 1GCQA 2K2MA 5FW9A 1YWOA 1GBQA 2HBWA 2O9SA 2EGEA 2JMAA 1RUWA 2KYBA 1UDLA 4ESRA 1SSHA 1ZLMA 1WX6A 3VS6A 2YUPA 2V1RA 1UJ0A 2DA9A 1G2BA 2X3WD 2DL3A 1JU5C 1JXOA 2JXBA 2JS0A 4J9FA 5IXFA 4AG1C 3RBBB 1YN8A 2RN8A 2DF6A 1YWPA 2RQUA 2FRYA 2VKNA 4JPBW 3EG0A 3M0PA 1IO6A 3RNJA 1M8MA 2YSQA 2G6FX 2KYMA 2E5KA 3ZL7C 1B07A 4CC4B 2VWFA 4RTUA 4EIKA 3VS2A 1OPLA 2GGRA 1PRLC 3EG1A 2DLPA 1X69A 2V1QA 2FG0A 1BB9A 3M0QA 2KRMA 3QWXX 4HVWA 2JM8A 2DRKA 1GBRA 1QLYA 1WXTA 2RQVA 4RTTA 1AZEA 4JZ4A 2BZXA 2A36A 4Z8AA 1ZUKA 2GNCA 1X6GA 2O2OA 4RTYA 1YP5A 2J6KA 3TSZA 2FPEA 1AVZC 2DE0X 2AZVA 2L3PA 4DEXA 2YT6A 1ARKA 2ENMA 3NPFA 2YDLA 1WFWA 2D0NA 3FJ5A 1AWWA 2GBQA 1E7OA 2KE9A 1K0SA 4J9EA 1LCKA 2DMOA 1I1JA 3LH5A 2C0IA 3VS7A 2AK5A 3KFVA 2JT4A 4F16A 2DRMA 2L3SA 2CSIA 2HCKA 2X3XD 4OMNA 4Y92A 3EG2A 2LMJA 1WI7A 1QWEA 1Z9QA 1WA7A 2D8HA 2HDAA 1N5ZA 2KEAA 2J6OA 1UTIA 4ORZA 2B86A 2DL5A 2GQIA 5GJVB 3NMZC 2BTTA 1NEBA 2J7IA 3UF4A 2K79A 1NYFA 3QWYA 4JJBA 3ULRB 5IXBA 5L23A 4LUEA 1NLPC 1T0HA 4J9HA 4WCIA 1GRIA 1AWJA 1FMKA 1PHTA 1NG2A 3PVLA 1AD5A 5IHKA 1K4US 2ROTA 1FYNA 1WYXA 1BK2A 2DM1A 1ABQA 2JMCA 3H0FA 1WDXA 2LQNA 1U5SA 1X43A 2KR3A 1GCPA 1A0NB 3EHRA 2KGTA 2OI3A 2ESWA 4JJCA 2DYBA 1GFCA 3I5SA 2LJ0A 2EPDA 2C0OA 3UATA 2NUZA 1X27A 2DBKA 2EQIA 1KJWA 1WXUA 1SRMA 4Z88A 2DVJA 1OOTA 2LZ6B 3VS1A 2F2VA 2A08A 2NWMA 5IH2A 1CKAA 2AZSA 4JZ3A 1PKTA 1HD3A 2KRNA 1W1FA 1ZBJA 2KROA 2EGAA 1YCSB 2LJ3A 4J9GA 2W0ZA 1ZUUA 1HJDA 1J3TA 1W70A 4X1VA 1PKSA 2JS2A 2W10A 2CREA 1M3BA 2PTKA 1AOJA 1BU1A 4HCKA 1AWXA 4JJDA 1JQQA 3M0TA 4M4ZA 1KFZA 2DX1A 1H8KA 2JW4A 3A98A 4OMLA 2A28A 5FWCA 2ECZA 4IIMA 3R6NA 3UA6A 2QDLA 2CUDA 2CUBA 4AG2C 1JO8A 2LQWA 2KBTA 3SEMA 1HSQA 3VS0A 4HVVA 1G83A 2DBMA 2DL7A 2PNIA 2P4RA 1ZUYA 1I07A 3PE0A 4RTZA 1NEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OV3 A;  1V1C A;  1X6B A;  3REB B;  2CSQ A;  1UGV A;  2JM9 A;  5IHI A;  1SPK A;  2H8H A;  4Z89 A;  3UA7 A;  1MV0 B;  4OMP A;  2OAW A;  2O88 A;  2M0Y A;  2DL4 A;  1OPK A;  2GTJ A;  1TG0 A;  3M0R A;  1UEC A;  1YNZ A;  2LP5 A;  4LNP A;  2EKH A;  2DNU A;  1MUZ A;  2K3B A;  3EHQ A;  3IQL A;  1X2Q A;  2RNA A;  2ROL A;  1M27 C;  3I35 A;  3H41 A;  1QCF A;  1UFF A;  2KXC A;  4J9C A;  2FEI A;  1GCQ C;  2LCS A;  2JTE A;  2EVR A;  2FRW A;  4QT7 A;  2ED1 A;  1H92 A;  4CC2 A;  3SHW A;  1BBZ A;  4E6R A;  2K9G A;  3PVQ A;  1QKW A;  1Y57 A;  4AFU C;  1PNJ A;  2F2X A;  1UE9 A;  1K9A A;  4AFZ C;  2L0A A;  3I5R A;  2FPD A;  4F14 A;  1SHG A;  1UJY A;  2OJ2 A;  2HSP A;  1NM7 A;  1K0X A;  1RLP C;  2LNH B;  2J06 A;  1E6H A;  2EW3 A;  2M51 A;  1JXM A;  3NHN A;  1VYU A;  1W6X A;  2MCN A;  4GLM A;  2RPN A;  2O9V A;  2BZY A;  2KNB B;  1NYG A;  1U3O A;  1Z9Z A;  4HXJ A;  2FPF A;  1GL5 A;  3M0S A;  1VYT A;  1PRM C;  2ABL A;  2RQT A;  1SEM A;  4D8K A;  3I9Q A;  2EYY A;  1TUD A;  2EYZ A;  4LE9 A;  2MOX A;  4OMQ A;  2CH4 W;  1T0J A;  2RQR A;  4CC7 A;  2AKL A;  1MV3 A;  2KXD A;  1AZG B;  3U23 A;  1UHF A;  2FO0 A;  1JEG A;  5EC7 A;  1ZX6 A;  3JV3 A;  1XOV A;  5HCK A;  2KT1 A;  3H0I A;  4GBQ A;  1T3S A;  4D8D A;  2CDT A;  4RUG A;  3VRY A;  4F17 A;  1GFD A;  2RF0 A;  1VA7 A;  4RTW A;  1ABO A;  4RTX A;  2CH4 A;  3C0C A;  2K6D A;  2LJ1 A;  4J9I A;  1OEB A;  2J05 A;  2RQW A;  4ZNX A;  4DEY A;  2YUO A;  2L2P A;  2DJQ A;  1UUE A;  2VVK A;  2DIL A;  3THK A;  1H3H A;  2SRC A;  1U06 A;  2HEQ A;  5I22 A;  2AKK A;  2KRS A;  5ECA A;  2SEM A;  1KIK A;  4J9B A;  4OMM A;  1RLQ C;  2C0T A;  4IIO A;  2CT4 A;  3EGU A;  2XMF A;  2D1X A;  4AFS C;  1TUC A;  2EBP A;  1S1N A;  1K1Z A;  2DL8 A;  2EYX A;  1M30 A;  1SRL A;  2I0N A;  2IIM A;  2YUQ A;  2LX7 A;  1B3Q A;  3VS4 A;  1UG1 A;  1AEY A;  4K11 A;  3M0U A;  1WXB A;  3GBQ A;  1RI9 A;  1T3L A;  2K7A A;  4J9D A;  1Y0M A;  1AWO A;  3O5Z A;  4KRT A;  1PWT A;  2F2W A;  3VRZ A;  4R0K A;  2KT8 A;  2O31 A;  2YUN A;  3TSW A;  2EGC A;  3NGP A;  2L3Q A;  3VS5 A;  1UHC A;  2CT3 A;  5I11 A;  5GJW B;  1M3A A;  2D8J A;  3REA B;  1CKB A;  1WIE A;  3CQT A;  4OMO A;  5FWB A;  5IHN A;  2ED0 A;  4LUD A;  4AFQ C;  3VS3 A;  2GTO A;  3H0H A;  2A37 A;  1ZSG A;  4CC3 A;  1EFN A;  1I0C A;  2J6F A;  1QKX A;  1QWF A;  1M3C A;  2PZ1 A;  4FSS A;  1NLO C;  2MIO A;  1SHF A;  4HVU A;  3EG3 A;  1X2K A;  4RTV A;  1CSK A;  1KSW A;  2BZ8 A;  2RMO A;  3TVT A;  1E6G A;  1K76 A;  4LN2 A;  4A63 B;  1WLP B;  2EYW A;  1VYV A;  1GCQ A;  2K2M A;  5FW9 A;  1YWO A;  1GBQ A;  2HBW A;  2O9S A;  2EGE A;  2JMA A;  1RUW A;  2KYB A;  1UDL A;  4ESR A;  1SSH A;  1ZLM A;  1WX6 A;  3VS6 A;  2YUP A;  2V1R A;  1UJ0 A;  2DA9 A;  1G2B A;  2X3W D;  2DL3 A;  1JU5 C;  1JXO A;  2JXB A;  2JS0 A;  4J9F A;  5IXF A;  4AG1 C;  3RBB B;  1YN8 A;  2RN8 A;  2DF6 A;  1YWP A;  2RQU A;  2FRY A;  2VKN A;  4JPB W;  3EG0 A;  3M0P A;  1IO6 A;  3RNJ A;  1M8M A;  2YSQ A;  2G6F X;  2KYM A;  2E5K A;  3ZL7 C;  1B07 A;  4CC4 B;  2VWF A;  4RTU A;  4EIK A;  3VS2 A;  1OPL A;  2GGR A;  1PRL C;  3EG1 A;  2DLP A;  1X69 A;  2V1Q A;  2FG0 A;  1BB9 A;  3M0Q A;  2KRM A;  3QWX X;  4HVW A;  2JM8 A;  2DRK A;  1GBR A;  1QLY A;  1WXT A;  2RQV A;  4RTT A;  1AZE A;  4JZ4 A;  2BZX A;  2A36 A;  4Z8A A;  1ZUK A;  2GNC A;  1X6G A;  2O2O A;  4RTY A;  1YP5 A;  2J6K A;  3TSZ A;  2FPE A;  1AVZ C;  2DE0 X;  2AZV A;  2L3P A;  4DEX A;  2YT6 A;  1ARK A;  2ENM A;  3NPF A;  2YDL A;  1WFW A;  2D0N A;  3FJ5 A;  1AWW A;  2GBQ A;  1E7O A;  2KE9 A;  1K0S A;  4J9E A;  1LCK A;  2DMO A;  1I1J A;  3LH5 A;  2C0I A;  3VS7 A;  2AK5 A;  3KFV A;  2JT4 A;  4F16 A;  2DRM A;  2L3S A;  2CSI A;  2HCK A;  2X3X D;  4OMN A;  4Y92 A;  3EG2 A;  2LMJ A;  1WI7 A;  1QWE A;  1Z9Q A;  1WA7 A;  2D8H A;  2HDA A;  1N5Z A;  2KEA A;  2J6O A;  1UTI A;  4ORZ A;  2B86 A;  2DL5 A;  2GQI A;  5GJV B;  3NMZ C;  2BTT A;  1NEB A;  2J7I A;  3UF4 A;  2K79 A;  1NYF A;  3QWY A;  4JJB A;  3ULR B;  5IXB A;  5L23 A;  4LUE A;  1NLP C;  1T0H A;  4J9H A;  4WCI A;  1GRI A;  1AWJ A;  1FMK A;  1PHT A;  1NG2 A;  3PVL A;  1AD5 A;  5IHK A;  1K4U S;  2ROT A;  1FYN A;  1WYX A;  1BK2 A;  2DM1 A;  1ABQ A;  2JMC A;  3H0F A;  1WDX A;  2LQN A;  1U5S A;  1X43 A;  2KR3 A;  1GCP A;  1A0N B;  3EHR A;  2KGT A;  2OI3 A;  2ESW A;  4JJC A;  2DYB A;  1GFC A;  3I5S A;  2LJ0 A;  2EPD A;  2C0O A;  3UAT A;  2NUZ A;  1X27 A;  2DBK A;  2EQI A;  1KJW A;  1WXU A;  1SRM A;  4Z88 A;  2DVJ A;  1OOT A;  2LZ6 B;  3VS1 A;  2F2V A;  2A08 A;  2NWM A;  5IH2 A;  1CKA A;  2AZS A;  4JZ3 A;  1PKT A;  1HD3 A;  2KRN A;  1W1F A;  1ZBJ A;  2KRO A;  2EGA A;  1YCS B;  2LJ3 A;  4J9G A;  2W0Z A;  1ZUU A;  1HJD A;  1J3T A;  1W70 A;  4X1V A;  1PKS A;  2JS2 A;  2W10 A;  2CRE A;  1M3B A;  2PTK A;  1AOJ A;  1BU1 A;  4HCK A;  1AWX A;  4JJD A;  1JQQ A;  3M0T A;  4M4Z A;  1KFZ A;  2DX1 A;  1H8K A;  2JW4 A;  3A98 A;  4OML A;  2A28 A;  5FWC A;  2ECZ A;  4IIM A;  3R6N A;  3UA6 A;  2QDL A;  2CUD A;  2CUB A;  4AG2 C;  1JO8 A;  2LQW A;  2KBT A;  3SEM A;  1HSQ A;  3VS0 A;  4HVV A;  1G83 A;  2DBM A;  2DL7 A;  2PNI A;  2P4R A;  1ZUY A;  1I07 A;  3PE0 A;  4RTZ A;  1NEG A; 
#chains in the Genus database with same CATH topology
 4PKC C;  2JM9 A;  3UT1 A;  5IHI A;  2RH2 A;  1D0Y A;  1JRI A;  1PD1 A;  3JCM J;  2EQK A;  2O88 A;  4OMP A;  5CR2 A;  4FW2 A;  2MF2 A;  1N9S A;  3MHX A;  3VYG A;  2JTM A;  5LL6 S;  1M8V A;  3L2R A;  2RHI A;  4M75 G;  2WAC A;  4HCB A;  4GLK A;  3CD6 A;  1Q82 C;  2ROL A;  2ZPB B;  3I35 A;  1VQ5 T;  4C8Q F;  1UFF A;  2KXC A;  4J9C A;  3G7Z A;  3OYH A;  4RG8 A;  1ZHI A;  3HRU A;  4PLL A;  2LCS A;  1H92 A;  2I2L A;  3PVQ A;  4C5I A;  4AFU C;  2OTL Q;  3A8H B;  1UE9 A;  4HT8 A;  1UB4 A;  5GAN d;  2K2V A;  1VQL A;  2QA4 Q;  2L0A A;  2RHZ A;  4F14 A;  3EG9 A;  4DBH A;  3JB9 I;  2OJ2 A;  3SWN B;  2KSS A;  5GMK l;  3UWN A;  1K9M U;  5LJ5 f;  3CPW S;  2J06 A;  2EW3 A;  2QEX T;  4QQ6 A;  3NHN A;  1LOJ A;  4J8O A;  3G6E Q;  2KNB B;  3N5B B;  1IHV A;  3CCJ Q;  1YI2 A;  2EJG A;  4ZGE B;  3MP1 A;  5M9O A;  2RJD A;  2IPO B;  4D8K A;  3I9Q A;  2EYY A;  5GAN j;  1WHL A;  2QK0 A;  1TUD A;  4J6X A;  4RCC A;  1MV3 A;  3E1S A;  5FU7 C;  1UHF A;  4QVZ A;  1JEG A;  1X6O A;  2QAZ A;  1JJ2 P;  2RJC A;  2BIV A;  2XDD A;  2COW A;  3E2U A;  2KT1 A;  1RAB B;  3CC7 Q;  2XD0 A;  1T3S A;  4D8D A;  2CP0 A;  3QDR B;  4FL6 A;  2AIR B;  4KBM B;  3VRY A;  1Y71 A;  4KGZ B;  2RF0 A;  1VA7 A;  1MND A;  2CZ1 B;  2E3H A;  4FYV B;  3CPW A;  4XU0 A;  4HA8 A;  3OW2 S;  4X34 A;  2DJQ A;  4J6W A;  5LJ5 e;  3THK A;  1H3H A;  2VB6 A;  5D6X A;  1U06 A;  2BKD N;  1SKU B;  3CCL T;  2E6Z A;  1X01 A;  1VQ9 A;  2D1X A;  2HQH A;  2QAS A;  2K3Y A;  4HT9 A;  3JB9 J;  1SF9 A;  5GMK i;  2IIM A;  1B3Q A;  3VS4 A;  4FCY A;  1AEY A;  4K11 A;  3CCS Q;  4C8Q E;  5A0L A;  3G71 T;  1RI0 A;  1KD1 U;  2QTV A;  3JCM c;  3WXM B;  1AT1 B;  4C5G A;  4OB2 B;  1Y0M A;  3QYH B;  1YJ9 A;  3O5Z A;  4KRT A;  1PWT A;  3RMS A;  3VRZ A;  1QW1 A;  1OU8 A;  2YUN A;  3TSW A;  5CKE A;  2L3Q A;  4BB7 A;  1K73 R;  1YIT Q;  3EGX A;  2QTX A;  3FRN A;  2DXU A;  4NS5 A;  2HL3 A;  3REA B;  4PFP A;  1DJ7 B;  2DJZ A;  3VS3 A;  1KQS P;  2GTO A;  3OW2 A;  3H0H A;  1ZSG A;  3GNG A;  1I0C A;  2PZ1 A;  4M78 A;  5KCH A;  1G3Y A;  4AT1 B;  2KK4 A;  1CSK A;  2BZ8 A;  3KUF A;  3NTH A;  3V8J A;  1ZSZ A;  1K76 A;  4LN2 A;  4D6W A;  4JRI A;  1VYV A;  2K2M A;  4RG2 A;  3JCM W;  1S72 Q;  4PLI A;  4C92 A;  1UDL A;  2QGF B;  3DB3 A;  1N8R C;  5D7U A;  2R5A A;  1VIF A;  4ELZ C;  1SSF A;  2HKN A;  2RHU A;  4BI8 B;  1UGS B;  3CEY A;  2DA9 A;  2LNV A;  5HK3 A;  1M90 R;  4M7D A;  1JU5 C;  2RJE A;  1PG5 B;  4N4I A;  4J7I A;  3CCE T;  4CI0 C;  1YN8 A;  2CS7 A;  4C8Q C;  2FRY A;  2QQ9 A;  3EG0 A;  2M0O A;  5IN1 A;  3E9F A;  1IO6 A;  3URG A;  2XKO C;  1D09 B;  2YSQ A;  5KYY B;  1HXD A;  1VQM T;  3V7C A;  5CAI A;  4ZTF A;  3VJP A;  2VWF A;  4RTU A;  1Q81 R;  4M77 B;  3Q1J A;  3JRZ A;  4VUB A;  4AMC A;  2V1Q A;  2Z0W A;  1BB9 A;  4KGV B;  4JDS A;  1Q86 C;  1P92 A;  2OTJ Q;  4KUI A;  3OYJ A;  1AZE A;  1VQ5 A;  4JUV A;  4A4H A;  3PGG A;  4F7U B;  2YRD A;  2GNC A;  1D1A A;  2O2O A;  1BCO A;  3A8G B;  5GAO q;  3CME A;  3TCJ A;  5C6S A;  2DPP B;  2AZV A;  4DEX A;  2YT6 A;  3L2Q A;  3A1P A;  2D0N A;  4DBF A;  1I81 A;  1KC8 U;  1QCO A;  2X4W A;  2FZC B;  1K0S A;  3L42 A;  3JSC A;  1K9M C;  4J9E A;  2VC8 A;  1LCK A;  4C0G A;  2K5L A;  2P0K A;  2AK5 A;  3LYI A;  1D1C A;  5KE3 A;  2HSE B;  4C5E A;  5KE2 A;  2CSI A;  1RAC B;  4M78 G;  4ZGD B;  4Y92 A;  1WI7 A;  1QWE A;  1Z9Q A;  1I8F A;  4DOW A;  2HDA A;  2X4Y A;  4PJO F;  2E41 A;  1VQ4 Q;  2VV5 A;  1VQN T;  3PMI A;  2KQW A;  3L2U A;  1C0M A;  1UGR B;  2AT1 B;  5GAN 6;  1NEB A;  2V8K A;  4E7Z A;  1T0H A;  1M2V A;  4F04 B;  4M78 D;  1JB0 E;  1AD5 A;  1QMC A;  1KQ1 A;  1K8A R;  1FYN A;  5GAN 8;  1ABQ A;  4BUG A;  1X43 A;  1WZO A;  1Q7Y R;  2EJF A;  4LXC A;  4LDW A;  2DTH A;  5LJ3 g;  2OI3 A;  2O4X A;  1GFC A;  2FB7 A;  2RM4 A;  2M02 A;  3UAT A;  3RKX A;  1YFN A;  3DKM A;  2DBK A;  1WXU A;  1SRM A;  2FVU A;  4B6M A;  3CCL A;  3HKS A;  3EFO B;  2NWM A;  1OU9 A;  5IH2 A;  1WJR A;  3RIR A;  3JCM X;  3CBM A;  2A3L A;  1W1F A;  4M7D D;  3DB4 A;  1VOM A;  2VXF A;  4Y28 E;  3G71 A;  2KRO A;  2EGA A;  1YCS B;  1Q82 U;  5CKF A;  2LDM A;  1OI1 A;  3OYF A;  1WJQ A;  2W0Z A;  3JCM e;  2V8J A;  1I5L A;  3JCM h;  3VYH B;  3CXC P;  1J3T A;  4DBR A;  1NPP A;  2VYT A;  1TUG B;  3NTK A;  2EFI A;  5GMK j;  2PTK A;  3OYG A;  1VQL T;  4M4Z A;  1KFZ A;  2X35 A;  1H8K A;  2X9H A;  5GAO m;  3PFS A;  3I56 T;  4N0A A;  4FSX A;  3VKI A;  4A4E A;  1Y96 B;  3MPU B;  4M7A B;  4E7L A;  2E1H A;  4IIM A;  3R6N A;  3QDF A;  1V29 B;  2QDL A;  2ZPI B;  2DER A;  3JAM E;  1R77 A;  4KUL A;  4HVV A;  2VGM A;  1G83 A;  2G3R A;  4XTV A;  4BE0 A;  4OMF B;  1PCX A;  4P5N A;  2E12 A;  3EGD B;  5FRO A;  1ZUY A;  4EMK B;  3EH1 A;  4RTZ A;  1M4Z A;  3FEO A;  1NEG A;  1RAG B;  1KG1 A;  1OV3 A;  3REB B;  1X6B A;  2CSQ A;  1UGV A;  3RER A;  1JJ2 S;  4OB0 B;  1M1K R;  2K5I A;  2VXE A;  1Y7X A;  4Z89 A;  2DIQ A;  3LWI A;  2CZ6 B;  3CCE A;  2KI7 A;  3LX7 A;  4WTO B;  2GTJ A;  1KHI A;  3M0R A;  1YNZ A;  2GFU A;  2LP5 A;  4C0D C;  2RI3 A;  1TS9 A;  2DNU A;  1MUZ A;  1VQ7 Q;  2VUB A;  1VQM A;  5DLQ E;  3H41 A;  3CC2 Q;  1QCF A;  3M4G A;  4M75 A;  1ZQ1 A;  1GCQ C;  3AHU A;  4CC2 A;  3SHW A;  1Y57 A;  4ZN1 A;  2EQU A;  2DAQ A;  2NUP B;  1VUB A;  1UJY A;  2K57 A;  1JJ2 A;  1YJ9 T;  1VQK Q;  1VQP Q;  1E6H A;  3SDZ A;  5KYX A;  5LJ3 d;  1JXM A;  1Y07 A;  2RJF A;  2RD1 A;  1W6X A;  2MCN A;  1B34 B;  3HFN A;  4GLM A;  4PJO G;  4BE1 A;  2BZY A;  1NYG A;  1U3O A;  4RKU E;  3JB9 D;  3QO3 A;  3CMA Q;  1VYT A;  1G3S A;  2CP6 A;  2RQT A;  4A54 A;  1SEM A;  3RR6 A;  3FB9 A;  2E10 A;  2CKK A;  4LE9 A;  1I4K 1;  1G8X A;  5GAM g;  1JBM A;  5I2M A;  1QVF P;  3MP8 A;  4J83 A;  2OTJ T;  1KHC A;  2GCX A;  4PFZ A;  3M55 A;  1AZG B;  3G4S Q;  4PJL A;  2FO0 A;  1PSF A;  2D6F A;  4PJO D;  2WSF E;  5C0M A;  5HCK A;  5LJ3 j;  4LD9 K;  2RK2 A;  1WHH A;  1W2B S;  2E6N A;  4GBQ A;  1NJI C;  2Y4X A;  4LDY A;  4RUG A;  1N8R U;  4F17 A;  2QA4 A;  4XTY A;  4M77 F;  1ABO A;  4QW2 A;  4J9I A;  3PIP A;  2RQW A;  1W4S A;  5A0G A;  2XI9 A;  1KD1 R;  1M2V B;  2AKK A;  1C1A A;  3CCQ T;  2DO3 A;  1EZZ B;  3LWH A;  4F7U F;  2Y90 A;  3R6O A;  3G6E A;  4IIO A;  4BE2 A;  2CT4 A;  2YLC A;  5GAN f;  3OSS C;  4AFS C;  5GAO r;  1TUC A;  2MWP A;  1S1N A;  2DKG A;  2EYX A;  1SRL A;  2I0N A;  5KYW B;  2L8D A;  1QCN A;  4A4K A;  5GAN 3;  3CC4 T;  2HQX A;  4J9D A;  1AWO A;  1ACM B;  2CP5 A;  2F2W A;  4R0K A;  3S3O A;  2KT8 A;  3FC3 A;  3BDL A;  1BIB A;  1IZ6 A;  4E7I A;  1UHC A;  3E9G A;  5GJW B;  1W2B A;  1OZ3 A;  4QKU A;  1Q86 U;  3O8V A;  1EIF A;  2HQE A;  3CCU T;  3MP6 A;  1CKB A;  5FWB A;  4OMO A;  3CC7 A;  4Y91 A;  4AFQ C;  2OAU A;  3OMC A;  2A37 A;  3J81 E;  1EFN A;  2J6F A;  1QKX A;  4FSS A;  3CME T;  2MIO A;  1X2K A;  2CYZ B;  2P84 A;  1KSW A;  1E6G A;  1VQ8 Q;  2NUT A;  5FW9 A;  4JS4 A;  2JZ2 A;  1GBQ A;  3I56 A;  9ATC B;  1VQO Q;  4M75 D;  4ESR A;  5GAN e;  5GAN h;  3OS1 A;  1VQ6 Q;  1SSH A;  1D0Z A;  5I2S A;  1WX6 A;  2YUP A;  2LC4 A;  1UJ0 A;  5GAN 4;  1QP2 A;  2EYQ A;  2X3W D;  2DL3 A;  3MEW A;  1HK9 A;  2CP7 A;  5KYU B;  2JXB A;  2JS0 A;  1YJN T;  3X28 B;  4J9F A;  7AT1 B;  3INZ A;  4AG1 C;  4ELY C;  3TQ7 P;  4BAC A;  2PQW A;  4J6Y A;  2DF6 A;  2HL5 C;  1BCM A;  4M77 E;  2XHC A;  4JPB W;  1WQW A;  1TU0 B;  3M0P A;  3RNJ A;  3LGL A;  1BI2 A;  3OYD A;  3TEE A;  4MZP A;  1YJW T;  1NE8 A;  4C8Q A;  1BI1 A;  3ZL7 C;  4E47 A;  2E3I A;  5GAM d;  3X24 B;  4F7U E;  4N4G A;  1YIJ T;  1OPL A;  1PRL C;  2L3R A;  4JLI A;  1OZ2 A;  3EH2 A;  3M0Q A;  4HVW A;  2KRM A;  3QWX X;  2DRK A;  5FRM A;  1GBR A;  1TXQ A;  3OQ5 A;  3CD6 Q;  5LJ5 h;  3C12 A;  2GF7 A;  1KC8 R;  1X6G A;  1YP5 A;  3GNF B;  2VGN A;  4GY5 A;  3TSZ A;  2FPE A;  2H3J A;  4M7A F;  2L3P A;  1H3Z A;  4FYY B;  1FX7 A;  1ARK A;  2ENM A;  5GAM j;  1WHM A;  3FJ5 A;  1BI3 A;  3VUB A;  5FU6 B;  1E7O A;  3CXC S;  1R0C B;  4FW1 A;  2KE9 A;  4JRQ A;  3S3M A;  3LH5 A;  4EDU A;  3VS7 A;  1YHQ T;  2IG0 A;  2DD5 A;  3ZEH A;  3SFM A;  2QGG A;  4Z02 A;  2QYZ A;  3CCR T;  2DRM A;  3BE3 A;  2X3X D;  4M77 C;  3RKY A;  4M77 G;  1WA7 A;  1UEB A;  4XU2 A;  2CP2 A;  3CCV T;  1N5Z A;  1YI2 Q;  3L2Z A;  2J6O A;  4ORZ A;  3UPU A;  2DL5 A;  2GQI A;  3EAE A;  2D0Q B;  3NMZ C;  4NL3 A;  2OTJ A;  4FYX B;  4IUQ A;  3V8K A;  1IHW A;  1KQ2 A;  4IUT A;  3UF4 A;  4F7U G;  1ZBX A;  3QWY A;  3ULR B;  5IXB A;  5L23 A;  1HYO A;  2QQA A;  1GRI A;  2R58 A;  2JTF A;  1PHT A;  1M5Q 1;  2ROT A;  3LLR A;  1WYX A;  3H0F A;  3OYL A;  1U5S A;  2DXB A;  3A8O B;  3LH0 A;  3EHR A;  1WNL A;  3ZBD A;  2KGT A;  2DK3 A;  2O01 E;  2ESW A;  2DYB A;  4QVD A;  2YXY A;  2LJ0 A;  4C5H A;  1Q82 R;  3V7R A;  3CCQ A;  5FRN A;  1X27 A;  4MDX A;  2DVJ A;  1OOT A;  2PVD B;  2KAF A;  2HNI A;  4C8Q G;  4PK4 A;  4R56 A;  4HCZ A;  5CQY A;  4KH1 B;  1VQ9 Q;  2HKQ B;  5HY6 A;  2ZPH B;  1X75 C;  3CC4 A;  2LJ3 A;  1VQ4 A;  4PL6 A;  5D6Y A;  1SG5 A;  3C95 A;  1HJD A;  3FIF A;  4PFO A;  4TVR A;  4X1V A;  1BI0 A;  1EX4 A;  1PKS A;  4M7A E;  4ZGJ B;  2CRE A;  5AT1 B;  1AOJ A;  1PD0 A;  1AWX A;  2K4Y A;  1FMW A;  1BIA A;  2DXC A;  4C8Q D;  2XID A;  3CCU A;  2LRQ A;  2JW4 A;  4C92 E;  5IT9 E;  1RAD B;  3M56 A;  3I55 T;  4MZT A;  2RO0 A;  2LTO A;  1FXX A;  3V7S A;  3GIB A;  4FM4 B;  1MNE A;  4AG2 C;  3OYI A;  4ANJ A;  3SEM A;  2KBT A;  1HSQ A;  2YRC A;  3EG9 B;  5A2Q E;  1M1K C;  2DFU A;  2P4R A;  3PIO A;  3OBW A;  1I07 A;  2EQM A;  3GOX A;  3PE0 A;  3OYE A;  1V1C A;  4FT2 A;  2PUO B;  1SPK A;  3G1J A;  4OVA A;  2E64 A;  2EKO A;  2H8H A;  1YJN A;  2DYI A;  3TU4 K;  1MV0 B;  4FIB A;  4IUU A;  2M0Y A;  1OPK A;  2OTL T;  3JCM Q;  1NJI U;  1TG0 A;  1TH7 A;  2X51 A;  1QVG S;  1NBE B;  1MMN A;  3QZ5 B;  2QA4 T;  4LNP A;  2P0P A;  5AYF A;  3CCM Q;  4MML A;  2LCL A;  1YJW A;  4M7A C;  2JUF A;  2RNA A;  1N9R A;  4XQ3 A;  2P0Q A;  1ZSZ C;  2FHD A;  2OX7 A;  4E2F B;  1OX9 A;  1ZA2 B;  3M58 A;  4OF1 A;  1YIJ A;  2JTE A;  2EVR A;  2FRW A;  3HRT A;  2ED1 A;  4QT7 A;  4E7H A;  1BBZ A;  3G6E T;  2B8A A;  2F2X A;  4C92 C;  2YLB A;  2PVO B;  4NL2 A;  2LCC A;  3CCJ T;  3X25 B;  3CPF A;  2FPD A;  4EMK C;  1F1B B;  2FZK B;  5L8R E;  2HSP A;  3HRS A;  1K0X A;  1VQ5 Q;  2E70 A;  4M7D C;  5GMK e;  2M51 A;  3DLL A;  5GMK h;  4ZTJ A;  1QP3 A;  1TSF A;  2DTI A;  2EAY A;  2MPX C;  2O9V A;  1QVG A;  2FPF A;  1GL5 A;  2XIC A;  2RHX A;  1G3T A;  3OW2 P;  1PRM C;  3OSV A;  4PJO A;  3H9N A;  3CC7 T;  1YHQ A;  1YCY A;  2EYZ A;  3QUI A;  1N8R R;  3CCR A;  2RQR A;  4DQ2 A;  3EGX B;  2QEX Q;  1R0B G;  2E4H A;  5KYN A;  3OS5 A;  4HKE A;  2COZ A;  3QKJ A;  5GAO p;  3CCV A;  1XOV A;  1U1T A;  4M78 B;  2EQJ A;  3H0I A;  3OYB A;  1ZSZ B;  1GFD A;  3KBG A;  4OB3 B;  4RTX A;  3CCS T;  3C0C A;  2K6D A;  4JRK A;  1OEB A;  2J05 A;  1LJO A;  4DEY A;  2L2P A;  1UUE A;  4C92 B;  4C0Z A;  2SRC A;  3JCM P;  3CBP A;  3SWN A;  2KRS A;  3VUZ A;  1KIK A;  1YIT T;  4J9B A;  4OMM A;  4JS5 A;  3QYG B;  1RLQ C;  8AT1 B;  2C0T A;  3MJX A;  3EGU A;  2EWN A;  1RL2 A;  3CMA A;  4RCB A;  4M7D B;  3M4Y A;  1M30 A;  1WHJ A;  2LX7 A;  1UG1 A;  6AT1 B;  3QBY A;  2LVM A;  1FMV A;  3GBQ A;  2K7A A;  2YRV A;  3BY7 A;  4X9C A;  2LX9 A;  4BD3 A;  4JJN K;  1RAH B;  3HFO A;  2EGC A;  5LJ3 f;  1WQ7 A;  1N6A A;  3VS5 A;  3G4S A;  1M3A A;  3E19 A;  3CCL Q;  4WF2 A;  3MCA B;  1S72 T;  3BDU A;  4BI4 A;  1WIE A;  2ED0 A;  4LUD A;  2XDB A;  2ATC B;  4X9D A;  1K9M R;  1G3W A;  1SHF A;  4HVU A;  2FL7 A;  3QZ9 B;  2XK0 A;  2ZPF B;  3TVT A;  3NTI A;  5EG2 A;  4A63 B;  1WLP B;  2EYW A;  3NFC A;  2PUK B;  4A53 A;  5GAO l;  3GF5 A;  2DD4 A;  5CQX A;  4JLG A;  2YHT A;  1RUW A;  2KYB A;  3I55 A;  4XK8 E;  3VS6 A;  4XU3 A;  2V1R A;  1XTD A;  5DY9 A;  1G2B A;  1M1G A;  3KXT A;  1KQS S;  1JXO A;  5LJ3 e;  5LJ3 h;  5CCA A;  2GQV A;  5DLO A;  5CVI A;  1RAF B;  1TWB A;  1QQJ A;  1YWP A;  2RN8 A;  4A4F A;  2RQU A;  2FZG B;  4HCC A;  2A0F B;  5A0D A;  1G5V A;  2G6F X;  4O6J A;  4XAX B;  1U8R A;  5GAO n;  2E5K A;  1MMA A;  1OX8 A;  2WSC E;  4CC4 B;  3VS2 A;  2OTL A;  5J3B A;  3EG1 A;  3CCE Q;  2DLP A;  2H3E B;  3LGF A;  2JM8 A;  2DTO A;  1D3B A;  1VQO A;  1WXT A;  2RQV A;  4RTT A;  1M9S A;  2BZX A;  4QQG A;  3H6Z A;  2A36 A;  1VQM Q;  1ZUK A;  1KQS A;  1NZ9 A;  4RTY A;  5GMK m;  1OYX A;  2J6K A;  1K73 C;  3OYK A;  5CKB A;  3CCJ A;  2HBP A;  4XTW A;  2O4X B;  1WFW A;  3M54 A;  3J7A F;  2CZ0 B;  1VQ4 T;  2LT1 A;  2DMO A;  3BFM A;  3KFV A;  3L2V A;  3CCM T;  2GFA A;  2JT4 A;  4F16 A;  4J5Y A;  3V8L A;  2L3S A;  5CK9 A;  2M1H A;  2X4X A;  2QDY B;  2HCK A;  4OMN A;  4PJO B;  3EG2 A;  3M53 A;  5KYY A;  1IGQ A;  2D8H A;  4XTZ A;  2PVG B;  2KEA A;  4J7F A;  3M9Q A;  2B86 A;  2L89 A;  3QII A;  5GJV B;  4M77 A;  1XQH A;  2CGH A;  4E7J A;  4M75 C;  4QQD A;  1M90 C;  4FYW B;  2K79 A;  1M1K U;  4KGX B;  2XG8 D;  3P8D A;  4LUE A;  5GAM f;  4WCI A;  1NG2 A;  3PVL A;  4F7U A;  1K4U S;  1RAE B;  3MEA A;  1BK2 A;  1VQN Q;  2KY9 A;  5FU6 C;  2LQN A;  2KR3 A;  3L2W A;  2DEQ A;  2MAM A;  3CCS A;  2LT4 A;  3OYC A;  3GP8 A;  2C0O A;  3RDV A;  1Q81 C;  3A8L B;  3D7S B;  2EQI A;  4Z88 A;  4EPC A;  1YIT A;  4ATO A;  3JB9 H;  2LZ6 B;  3VS1 A;  2A08 A;  2AZS A;  4JZ3 A;  2A7Y A;  2EIF A;  3HP9 A;  5CIU A;  1HD3 A;  4BY6 C;  4DBQ A;  4J9G A;  4CRI A;  1MMG A;  1ZUU A;  4KUD K;  4PJM A;  4IKF A;  2JS2 A;  5GAN 2;  1H64 1;  1M3B A;  2JN0 A;  1PSE A;  4HCK A;  5GAM e;  5GAM h;  1S72 A;  1JQQ A;  3OA6 A;  4RMO A;  2F69 A;  4M75 B;  3MO8 A;  3C4S A;  3A98 A;  5DM7 R;  5FWC A;  3QJ6 A;  2ECZ A;  5LJ5 d;  4M78 F;  2RB6 A;  2CUD A;  5HKC A;  3VU3 C;  4XTX A;  1WJS A;  1VQL Q;  2DBM A;  2V8I A;  3TRE A;  2PNI A;  4XTU A;  4C92 F;  3I56 Q;  3RMQ A;  2NYS A;  5KYX B;  2R5M A;  1C6V X;  1LPL A;  1NJI R;  1VQ7 T;  3EFO A;  3A5Z B;  1LVK A;  3CC2 T;  3GLX A;  3UA7 A;  2OAW A;  4M7D F;  1YBY A;  2RHY A;  5LJ5 j;  4BY6 B;  1K8A C;  1MHN A;  2DL4 A;  4L59 A;  2D9T A;  1Q7Y C;  3EFR A;  2FYK A;  1UEC A;  2XDP A;  2EKH A;  2K3B A;  3EHQ A;  3IQL A;  1X2Q A;  2ZGW A;  1M27 C;  4QVC A;  3MKD A;  1VQK T;  4LD6 A;  1VQP T;  2P4T A;  3FLG A;  3L1A A;  3HTR A;  2FEI A;  5FU7 B;  3CXC A;  1ZA1 B;  1Y96 A;  4M77 D;  4M7A A;  4E6R A;  2K9G A;  5GAN 5;  1QKW A;  1PNJ A;  1TTH B;  4ME7 A;  1D3B B;  1K9A A;  4AFZ C;  3S3N A;  3MET A;  3FDR A;  4BDZ A;  3I5R A;  1M2O A;  3CMA T;  1SHG A;  4E7K A;  3PMT A;  2MK5 A;  1NM7 A;  1RLP C;  3OMG A;  4BI3 A;  2LNH B;  2WSE E;  3EGD A;  4EMK A;  3QSU A;  1W2B P;  1VYU A;  3G4S T;  2RPN A;  3QJY A;  5KCO A;  3OYN A;  3EFS A;  2MI6 A;  5J26 A;  3JCM g;  1Z9Z A;  4HXJ A;  5HK0 A;  2E5Q A;  3M0S A;  5FLX E;  3OYM A;  2ABL A;  3WVD B;  3OYA A;  2YWW A;  4M78 E;  1IGU A;  1YJ9 Q;  2NLU A;  2RI2 A;  3CCM A;  2KMT A;  2MOX A;  4OMQ A;  2CH4 W;  1T0J A;  4CC7 A;  2AKL A;  1D1B A;  2KXD A;  3U23 A;  2LQK A;  2MYS A;  5EC7 A;  1ZX6 A;  3JV3 A;  3HSB A;  1Q95 G;  1WPY A;  4II1 A;  2DVE A;  2C06 A;  2KVQ G;  1KK7 A;  2CDT A;  8ATC B;  1MMD A;  1RAI B;  3SD4 A;  3LW5 E;  1RAA B;  4L5G A;  4RTW A;  2JOY A;  2NUT B;  1WHK A;  2CH4 A;  5CKD A;  3M57 A;  2LJ1 A;  4IUR A;  4MMK A;  2HMA A;  2NUP A;  3QG1 A;  4ZNX A;  2YUO A;  2KDS A;  4M7D E;  2VVK A;  2DIL A;  5I22 A;  2HEQ A;  5ECA A;  3MEV A;  2SEM A;  1QVF S;  4O5V A;  2JNG A;  4FT4 A;  2XMF A;  4PJN A;  2EBP A;  4OGE A;  1K1Z A;  1B34 A;  2DL8 A;  2YUQ A;  3M0U A;  5IAY A;  1WXB A;  2MMP A;  2R57 A;  1NPR A;  3JB9 F;  1RI9 A;  1T3L A;  4DA4 A;  3OYY A;  2QQB A;  2O31 A;  2QEX A;  3CCQ Q;  3AT1 B;  3NGP A;  4OB1 B;  1VQ8 T;  2CT3 A;  4OP0 A;  5I11 A;  4DOV A;  3CPW P;  4JRP A;  4M78 C;  4C8Q B;  1VQO T;  2COY A;  4M7A G;  2D8J A;  1IXD A;  1U1S A;  3RKW A;  3CQT A;  5IHN A;  4E7S A;  1VQ6 T;  1PC0 A;  3CC4 Q;  2F1L A;  3WVE B;  1O75 A;  4CC3 A;  2ZPG B;  1QWF A;  1M3C A;  1NLO C;  3EG3 A;  3JCM f;  1K73 U;  1AHJ B;  4BDY A;  4RTV A;  2RMO A;  4OGC A;  1QVF A;  4C92 G;  1MGQ A;  4KT0 E;  2CP3 A;  1GCQ A;  2JJ9 A;  1IRE B;  1YWO A;  1XJW B;  2HBW A;  2O9S A;  2QQR A;  2EGE A;  2JMA A;  3CCU Q;  2MWO A;  2F5K A;  2HD0 A;  3QHS A;  4MDW A;  4N4H A;  4M7A D;  1ZLM A;  4PNO A;  4NOY A;  4M7D G;  2VAS A;  2BUD A;  3HHT B;  3CME Q;  3HL8 A;  1UGP B;  2DZC A;  3OY9 A;  4L6V 5;  2RA2 A;  5CO7 A;  3H8Z A;  5KYW A;  5D6W A;  4C92 D;  2BE7 D;  3RES A;  2LQ8 A;  5IXF A;  3RBB B;  3P8B B;  1B7T A;  4Q5W A;  3HPW A;  5GAN 7;  3JCM d;  1VQ7 A;  2QQS A;  3F70 A;  2VKN A;  3P8H A;  5KH6 A;  5I21 A;  1M8M A;  3QXE B;  1KD1 C;  1M90 U;  3CC2 A;  3CD6 T;  3OB9 A;  2KYM A;  1IRX A;  1B07 A;  1YJN Q;  4EIK A;  2QXF A;  2GGR A;  1IB8 A;  1X69 A;  3X26 B;  2FG0 A;  2Y4Y A;  2F5T X;  1QLY A;  2JVV A;  1WGS A;  4LDX A;  1VQK A;  1XNI A;  4JZ4 A;  1VQP A;  1YJW Q;  1UGQ B;  4Z8A A;  3ZFJ A;  4XU1 A;  3UDC A;  4KH0 B;  1Q81 U;  3M59 A;  4R55 A;  2BE9 B;  3M5A A;  4M75 F;  3A8M B;  1AVZ C;  2K5F A;  1YIJ Q;  2DE0 X;  3PTA A;  1D0X A;  3NPF A;  1Q86 R;  5J39 A;  2YDL A;  3PT9 A;  4IUV A;  2V26 A;  1AWW A;  2GBQ A;  1OQK A;  1YI2 T;  4PJO E;  5KYU A;  1I1J A;  2C0I A;  4FU6 A;  2RI5 A;  1BKB A;  3J80 E;  1I5O B;  2DET A;  1PM3 A;  4MZM A;  4ZN3 A;  3GPL A;  2LMJ A;  3OBY A;  2DEU A;  3G71 Q;  3BW1 A;  1UTI A;  1V76 A;  3ASK A;  3OS2 A;  3ME9 A;  2EJ9 A;  1YHQ Q;  2BTT A;  2HZY A;  4YTL A;  2J7I A;  3FJP A;  1QVP A;  2IVW A;  3CCR Q;  1GXI E;  1NYF A;  4JJB A;  2RK1 A;  1NLP C;  3SB2 A;  5GAN g;  4J9H A;  3X20 B;  1AWJ A;  1FMK A;  2M16 A;  5IHK A;  3CCV Q;  2DM1 A;  3JB9 G;  2PU9 B;  2JMC A;  1WDX A;  3JCM b;  4A4G A;  1VQ9 T;  2CZ7 B;  1GCP A;  1A0N B;  4JJC A;  1VIE A;  3QPH A;  3MEU A;  1R8O B;  3I5S A;  1M1F A;  2EPD A;  4LDV A;  2QI2 A;  2NUZ A;  3VV0 A;  4LDU A;  4IUP A;  2DXT A;  2DZ9 A;  1K8A U;  1KJW A;  2F2V A;  2HAX A;  2X4J A;  2K3X A;  4PJO C;  1Q7Y U;  2XU8 A;  1CKA A;  3T9N A;  1LNX A;  1PKT A;  1TOV A;  3ER0 A;  2ZZD A;  2KRN A;  1O9S A;  1ZBJ A;  4C0F A;  1KC8 C;  3JCM V;  3CBO A;  4EMH A;  4M75 E;  4PJJ A;  1W70 A;  2W10 A;  2ZCF B;  5CKH A;  2AHJ B;  1VQ8 A;  4N0A C;  3RUX A;  1BU1 A;  4V2S A;  2QG9 B;  5LJ5 g;  4JJD A;  2L5Q A;  3M0T A;  2DX1 A;  4C0D B;  3PNW C;  1VQ6 A;  2ZAE A;  2M9U A;  4OML A;  2A28 A;  1VQN A;  3S6W A;  3DLM A;  2E65 A;  3UA6 A;  4B9X A;  2CUB A;  3SWN C;  2DIG A;  1JO8 A;  2LQW A;  3C94 A;  1QVG P;  1WHG A;  3VS0 A;  4B9W A;  1BYM A;  2DL7 A;  1FWZ A;  4EMG A;  3OS0 A;  2ZPE B;  4UC4 A;  1N27 A;  1OUL A;  3I55 Q; 
#chains in the Genus database with same CATH homology
 1OV3 A;  1V1C A;  1X6B A;  3REB B;  2CSQ A;  1UGV A;  2JM9 A;  5IHI A;  1SPK A;  2H8H A;  4Z89 A;  3UA7 A;  1MV0 B;  4OMP A;  2OAW A;  2O88 A;  2M0Y A;  2DL4 A;  1OPK A;  2GTJ A;  1TG0 A;  3M0R A;  1UEC A;  1YNZ A;  2LP5 A;  4LNP A;  2EKH A;  2DNU A;  1MUZ A;  2K3B A;  3EHQ A;  3IQL A;  1X2Q A;  2RNA A;  2ROL A;  1M27 C;  3I35 A;  3H41 A;  1QCF A;  1UFF A;  2KXC A;  4J9C A;  2FEI A;  1GCQ C;  2LCS A;  2JTE A;  2EVR A;  2FRW A;  4QT7 A;  2ED1 A;  1H92 A;  4CC2 A;  3SHW A;  1BBZ A;  4E6R A;  2K9G A;  3PVQ A;  1QKW A;  1Y57 A;  4AFU C;  1PNJ A;  2F2X A;  1UE9 A;  1K9A A;  4AFZ C;  2L0A A;  3I5R A;  2FPD A;  4F14 A;  1SHG A;  1UJY A;  2OJ2 A;  2HSP A;  1NM7 A;  1K0X A;  1RLP C;  2LNH B;  2J06 A;  1E6H A;  2EW3 A;  2M51 A;  1JXM A;  3NHN A;  1VYU A;  1W6X A;  2MCN A;  4GLM A;  2RPN A;  2O9V A;  2BZY A;  2KNB B;  1NYG A;  1U3O A;  1Z9Z A;  4HXJ A;  2FPF A;  1GL5 A;  3M0S A;  1VYT A;  1PRM C;  2ABL A;  2RQT A;  1SEM A;  4D8K A;  3I9Q A;  2EYY A;  1TUD A;  2EYZ A;  4LE9 A;  2MOX A;  4OMQ A;  2CH4 W;  1T0J A;  2RQR A;  4CC7 A;  2AKL A;  1MV3 A;  2KXD A;  1AZG B;  3U23 A;  1UHF A;  2FO0 A;  1JEG A;  5EC7 A;  1ZX6 A;  3JV3 A;  1XOV A;  5HCK A;  2KT1 A;  3H0I A;  4GBQ A;  1T3S A;  4D8D A;  2CDT A;  4RUG A;  3VRY A;  4F17 A;  1GFD A;  2RF0 A;  1VA7 A;  4RTW A;  1ABO A;  4RTX A;  2CH4 A;  3C0C A;  2K6D A;  2LJ1 A;  4J9I A;  1OEB A;  2J05 A;  2RQW A;  4ZNX A;  4DEY A;  2YUO A;  2L2P A;  2DJQ A;  1UUE A;  2VVK A;  2DIL A;  3THK A;  1H3H A;  2SRC A;  1U06 A;  2HEQ A;  5I22 A;  2AKK A;  2KRS A;  5ECA A;  2SEM A;  1KIK A;  4J9B A;  4OMM A;  1RLQ C;  2C0T A;  4IIO A;  2CT4 A;  3EGU A;  2XMF A;  2D1X A;  4AFS C;  1TUC A;  2EBP A;  1S1N A;  1K1Z A;  2DL8 A;  2EYX A;  1M30 A;  1SRL A;  2I0N A;  2IIM A;  2YUQ A;  2LX7 A;  1B3Q A;  3VS4 A;  1UG1 A;  1AEY A;  4K11 A;  3M0U A;  1WXB A;  3GBQ A;  1RI9 A;  1T3L A;  2K7A A;  4J9D A;  1Y0M A;  1AWO A;  3O5Z A;  4KRT A;  1PWT A;  2F2W A;  3VRZ A;  4R0K A;  2KT8 A;  2O31 A;  2YUN A;  3TSW A;  2EGC A;  3NGP A;  2L3Q A;  3VS5 A;  1UHC A;  2CT3 A;  5I11 A;  5GJW B;  1M3A A;  2D8J A;  3REA B;  1CKB A;  1WIE A;  3CQT A;  4OMO A;  5FWB A;  5IHN A;  2ED0 A;  4LUD A;  4AFQ C;  3VS3 A;  2GTO A;  3H0H A;  2A37 A;  1ZSG A;  4CC3 A;  1EFN A;  1I0C A;  2J6F A;  1QKX A;  1QWF A;  1M3C A;  2PZ1 A;  4FSS A;  1NLO C;  2MIO A;  1SHF A;  4HVU A;  3EG3 A;  1X2K A;  4RTV A;  1CSK A;  1KSW A;  2BZ8 A;  2RMO A;  3TVT A;  1E6G A;  1K76 A;  4LN2 A;  4A63 B;  1WLP B;  2EYW A;  1VYV A;  1GCQ A;  2K2M A;  5FW9 A;  1YWO A;  1GBQ A;  2HBW A;  2O9S A;  2EGE A;  2JMA A;  1RUW A;  2KYB A;  1UDL A;  4ESR A;  1SSH A;  1ZLM A;  1WX6 A;  3VS6 A;  2YUP A;  2V1R A;  1UJ0 A;  2DA9 A;  1G2B A;  2X3W D;  2DL3 A;  1JU5 C;  1JXO A;  2JXB A;  2JS0 A;  4J9F A;  5IXF A;  4AG1 C;  3RBB B;  1YN8 A;  2RN8 A;  2DF6 A;  1YWP A;  2RQU A;  2FRY A;  2VKN A;  4JPB W;  3EG0 A;  3M0P A;  1IO6 A;  3RNJ A;  1M8M A;  2YSQ A;  2G6F X;  2KYM A;  2E5K A;  3ZL7 C;  1B07 A;  4CC4 B;  2VWF A;  4RTU A;  4EIK A;  3VS2 A;  1OPL A;  2GGR A;  1PRL C;  3EG1 A;  2DLP A;  1X69 A;  2V1Q A;  2FG0 A;  1BB9 A;  3M0Q A;  2KRM A;  3QWX X;  4HVW A;  2JM8 A;  2DRK A;  1GBR A;  1QLY A;  1WXT A;  2RQV A;  4RTT A;  1AZE A;  4JZ4 A;  2BZX A;  2A36 A;  4Z8A A;  1ZUK A;  2GNC A;  1X6G A;  2O2O A;  4RTY A;  1YP5 A;  2J6K A;  3TSZ A;  2FPE A;  1AVZ C;  2DE0 X;  2AZV A;  2L3P A;  4DEX A;  2YT6 A;  1ARK A;  2ENM A;  3NPF A;  2YDL A;  1WFW A;  2D0N A;  3FJ5 A;  1AWW A;  2GBQ A;  1E7O A;  2KE9 A;  1K0S A;  4J9E A;  1LCK A;  2DMO A;  1I1J A;  3LH5 A;  2C0I A;  3VS7 A;  2AK5 A;  3KFV A;  2JT4 A;  4F16 A;  2DRM A;  2L3S A;  2CSI A;  2HCK A;  2X3X D;  4OMN A;  4Y92 A;  3EG2 A;  2LMJ A;  1WI7 A;  1QWE A;  1Z9Q A;  1WA7 A;  2D8H A;  2HDA A;  1N5Z A;  2KEA A;  2J6O A;  1UTI A;  4ORZ A;  2B86 A;  2DL5 A;  2GQI A;  5GJV B;  3NMZ C;  2BTT A;  1NEB A;  2J7I A;  3UF4 A;  2K79 A;  1NYF A;  3QWY A;  4JJB A;  3ULR B;  5IXB A;  5L23 A;  4LUE A;  1NLP C;  1T0H A;  4J9H A;  4WCI A;  1GRI A;  1AWJ A;  1FMK A;  1PHT A;  1NG2 A;  3PVL A;  1AD5 A;  5IHK A;  1K4U S;  2ROT A;  1FYN A;  1WYX A;  1BK2 A;  2DM1 A;  1ABQ A;  2JMC A;  3H0F A;  1WDX A;  2LQN A;  1U5S A;  1X43 A;  2KR3 A;  1GCP A;  1A0N B;  3EHR A;  2KGT A;  2OI3 A;  2ESW A;  4JJC A;  2DYB A;  1GFC A;  3I5S A;  2LJ0 A;  2EPD A;  2C0O A;  3UAT A;  2NUZ A;  1X27 A;  2DBK A;  2EQI A;  1KJW A;  1WXU A;  1SRM A;  4Z88 A;  2DVJ A;  1OOT A;  2LZ6 B;  3VS1 A;  2F2V A;  2A08 A;  2NWM A;  5IH2 A;  1CKA A;  2AZS A;  4JZ3 A;  1PKT A;  1HD3 A;  2KRN A;  1W1F A;  1ZBJ A;  2KRO A;  2EGA A;  1YCS B;  2LJ3 A;  4J9G A;  2W0Z A;  1ZUU A;  1HJD A;  1J3T A;  1W70 A;  4X1V A;  1PKS A;  2JS2 A;  2W10 A;  2CRE A;  1M3B A;  2PTK A;  1AOJ A;  1BU1 A;  4HCK A;  1AWX A;  4JJD A;  1JQQ A;  3M0T A;  4M4Z A;  1KFZ A;  2DX1 A;  1H8K A;  2JW4 A;  3A98 A;  4OML A;  2A28 A;  5FWC A;  2ECZ A;  4IIM A;  3R6N A;  3UA6 A;  2QDL A;  2CUD A;  2CUB A;  4AG2 C;  1JO8 A;  2LQW A;  2KBT A;  3SEM A;  1HSQ A;  3VS0 A;  4HVV A;  1G83 A;  2DBM A;  2DL7 A;  2PNI A;  2P4R A;  1ZUY A;  1I07 A;  3PE0 A;  4RTZ A;  1NEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...