3QUIA

Crystal structure of pseudomonas aeruginosa hfq in complex with adpnp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
SKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Protein hfq
publication title Hfq binds ribonucleotides in three different RNA-binding sites.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 15
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3quiA00
4F7UF 4JUVA 5GAMh 4NL2A 5GMKh 4J6WA 4M75B 1KQ1A 2ZGWA 1HXDA 5GANg 5GMKm 4M75C 3JCMh 3JB9I 4M78D 1M5Q1 1B34B 2EJGA 1WNLA 1BIAA 2RA2A 4C92F 4OP0A 4M7AE 5GANe 3FJPA 1LJOA 1WQ7A 5GAN4 3QSUA 1LOJA 2E1HA 2YLBA 4C8QE 4XQ3A 5GAOl 1D3BB 1WQWA 2DTIA 4PJOA 2FB7A 4M77G 1I81A 4M7DE 4RCCA 4M75D 4PJOG 3JCMc 1U1TA 4C92D 2VXEA 2CGHA 5GMKi 4RCBA 3RKXA 5LJ3h 3GIBA 5LJ5h 2DZ9A 1I5LA 3RUXA 5DY9A 4M7AF 1YCYA 4MMLA 4J6YA 3SB2A 3QUIA 3M4GA 4XU2A 4C8QF 2K57A 4F7UB 4M77F 3JCMP 3RIRA 1KQ2A 3INZA 4N0AA 1U1SA 4M7DF 4V2SA 3SWNB 2DKGA 4M78A 5I21A 3SWNC 1N9SA 4C92B 4M7AD 1JBMA 3JCMX 4C92C 3JB9G 3EFRA 4M78G 3JCMV 2E41A 3VU3C 1M8VA 4C8QD 2VC8A 2YLCA 2DZCA 1BIBA 3BY7A 5GMKe 5GANd 4J5YA 2DXUA 4MMKA 5GAOp 4NL3A 4HT9A 4M77E 4M75A 4C92A 3JCMe 4PJOE 2EJFA 4EMHA 2QTXA 3JB9F 1B34A 4M75G 4M7AB 4A54A 4EMKB 1MGQA 4QVDA 5GANf 4XTWA 3JCMW 4M7DD 4EMKC 3HFOA 3PGGA 1Y96B 4M7AC 5GAN3 5GANh 2EJ9A 3QO3A 3RESA 2DXTA 4C8QB 5GAN7 1D3BA 3FB9A 4M77B 4C8QC 4JRIA 5GAN6 3JCMQ 5GAOn 5GANj 4M7DB 5GAOm 1LNXA 2DTOA 4PJOF 5GAOr 4M7DC 5LJ3e 4M7AA 5LJ5e 4QVCA 1WPYA 3V7SA 1TH7A 1Y96A 4M78E 4C8QA 2E65A 4WF2A 3AHUA 4XU0A 5GAMg 4X9DA 1N9RA 4F7UA 3QHSA 4XTYA 4M77D 4M7DA 2RB6A 3JCMg 5GAMe 4XTVA 5GAOq 3SWNA 4F7UG 5GMKl 2DVEA 4XU1A 2JN0A 2DTHA 3BW1A 4M75E 4M78F 3EFSA 2VXFA 4C92G 3JCMd 2EAYA 1I4K1 5GAN8 3HSBA 4PNOA 4Y91A 1I8FA 3HFNA 5GAN5 3JB9J 4HA8A 4DQ2A 1H641 2DJZA 2EWNA 2YHTA 3JCMf 3V7RA 4M77C 5LJ5g 4PJOB 4PJOC 3BFMA 3BDUA 2DEQA 5GAMj 2RD1A 4M75F 4EMGA 4EMKA 5GMKj 3JB9D 4XTXA 3V7CA 3L1AA 3L2ZA 5LJ3d 5LJ5d 4A53A 4M7AG 2Y90A 5LJ3g 3JCMb 2RM4A 4M77A 3RKYA 4XU3A 3V8JA 3V8LA 3JCMJ 4C8QG 2E10A 1JRIA 4F7UE 4J6XA 5LJ3f 2E64A 5LJ5f 4PJOD 4JRKA 3FIFA 4M7DG 3RKWA 5GAMd 4N0AC 2I2LA 4XTZA 4M78B 4HT8A 3V8KA 3RERA 4C92E 4XTUA 5GAN2 3JB9H 4M78C 2HNIA 5LJ3j 5LJ5j 5CAIA 2FYKA 4NOYA 4X9CA 1X01A 4JLIA 1HK9A 5GAMf
chains in the Genus database with same CATH superfamily
1WJRA 2LJ0A 1KQ1A 2FO0A 3G4ST 1TOVA 2ZAEA 3PE0A 2DBMA 1VQNQ 2DO3A 2V1QA 2RQRA 3BDLA 2XDPA 3L42A 5GMKi 2CGHA 2KT1A 1MNDA 4KT0E 1WHHA 3H0HA 2GTOA 3M4GA 1Y07A 2HL3A 4M77F 3INZA 4A4EA 1U3OA 1A0NB 2LJ1A 2LVMA 5IXBA 2DKGA 2K5IA 4BD3A 1U8RA 4OB1B 4M78G 2FPDA 1WJSA 5FU7B 3M5AA 3OYNA 1VQ8A 1BIBA 4M7DD 1OV3A 4M77E 2KROA 3ER0A 3CMEQ 1YJWQ 4OF1A 3CCLT 1OX9A 5GANh 2EJ9A 2L2PA 1Z9ZA 1D0YA 2RQUA 2OX7A 5GANj 1Q82C 2SEMA 1W2BP 3OYKA 3EHRA 2DIGA 2QA4Q 3MCAB 3RMSA 3OYLA 2MIOA 3ULRB 2DNUA 4M75E 1VQKT 5KYWB 1KHCA 4LDYA 4OGEA 4YTLA 4Y91A 1KQSS 1QCOA 5LJ3g 2DJZA 5HKCA 2RF0A 2KXDA 2CH4W 5GMKj 2NUTB 1NLPC 2F5KA 1UJYA 1OQKA 3I5RA 2DJQA 2YUNA 1V29B 1PRLC 4C5IA 1T0JA 4F7UE 5A2QE 5KH6A 3OSVA 3GNFB 1YWPA 1GCQA 1VQ5T 4ZN1A 3C0CA 2FYKA 8AT1B 4ZGEB 3I35A 1TG0A 3FDRA 3OA6A 1M3CA 1GRIA 1KJWA 3HHTB 2LQKA 2ZPBB 3QPHA 2YUPA 4HCCA 2FEIA 4IIOA 5A0GA 2H3JA 4XQ3A 2FZGB 4MDXA 1OU9A 2QQ9A 1PD1A 2R5MA 1G3YA 3PIOA 2O88A 4RCCA 4B9XA 2M51A 2VXEA 1X69A 3PMIA 1G8XA 3EGDA 1Z9QA 1FX7A 3OW2S 1YJ9T 3THKA 3QWYA 3JCMP 4N0AA 3PMTA 2JMCA 2DD4A 2YWWA 3H41A 4M78A 2DYBA 2CS7A 3VRZA 3GOXA 3J81E 3VU3C 4L6V5 2I0NA 3JRZA 1FMVA 3X26B 2DZCA 1PG5B 4NL3A 1M2VA 4OMPA 1FWZA 2HQXA 2OAWA 5A0DA 3UT1A 3VS1A 2RK1A 4EMKC 3PGGA 1RLQC 5GAN3 3NTHA 3TCJA 2ROTA 2GFAA 5GAOm 2PUOB 1VQPA 2KXCA 2JMAA 4C5GA 1W70A 1UDLA 2MK5A 3EG1A 1OOTA 1G5VA 2J6KA 3TVTA 4LD6A 3OMCA 3BW1A 3H9NA 4ESRA 3J80E 3CC4T 3OYIA 1TS9A 4BE0A 2VKNA 4PNOA 2L5QA 2GBQA 5D6YA 4Y92A 2E6NA 4HA8A 4DQ2A 1N8RC 1PCXA 1X6OA 2LTOA 2EQMA 3I5SA 3E2UA 4JJCA 2DL8A 5IHKA 1BCMA 4FU6A 1X6BA 4C8QG 3LLRA 2L3PA 1GCPA 3CCVT 1K9MR 4BI8B 1WI7A 3S3NA 3FC3A 4IUQA 3MHXA 1M2OA 2RHUA 3JAME 2EGCA 3L2UA 3MEVA 1Q81R 2WACA 4OP0A 1KFZA 4L5GA 3FLGA 2E1HA 4FL6A 3SD4A 1G83A 2EKOA 2VGMA 1VQPQ 1KG1A 1K4US 2RI3A 3T9NA 3GIBA 3GP8A 4C0DC 5IHIA 4EDUA 1Q95G 4J6YA 2DL3A 4XU2A 1K73U 2NUPB 3S3MA 1GBQA 3VS4A 1PKTA 4QQDA 4J9BA 3MP1A 5KCOA 3SWNC 2HBWA 4C92B 1YJNQ 8ATCB 1G3TA 3CCRQ 2K9GA 5HK0A 1IREB 1PHTA 3BY7A 4J5YA 2DXUA 3P8DA 4KH0B 4PJOE 1RAGB 2W0ZA 4M7AB 4B6MA 1EX4A 3CCSA 2O4XA 3SEMA 1IB8A 3FB9A 4J9DA 1MV0B 4J7IA 1ZUUA 2AZSA 2DTOA 3URGA 1TH7A 4TVRA 2PTKA 2SRCA 3CCEA 5GAMg 2D8HA 2CZ7B 4RKUE 4M77D 2KYMA 4IUTA 4KGXB 3CXCS 4O5VA 2DTHA 3G7ZA 1U5SA 2DRKA 3OYHA 1BI0A 1RAIB 1I8FA 1TTHB 3HFNA 1VQ7A 3OYEA 1R0CB 4WCIA 4LE9A 3UF4A 3E9GA 4BY6B 1S72A 2ABLA 3EGDB 1M27C 3GF5A 2KVQG 3RKYA 1VA7A 5FLXE 1BKBA 2D9TA 2XMFA 4C0DB 1RAFB 1UFFA 2I2LA 1WHLA 4M78B 1D0ZA 4XTUA 1EIFA 3JB9H 2FZCB 2K3XA 5FU6C 1WFWA 3OYGA 2VWFA 4F14A 5GMKm 1M2VB 2QQBA 5C0MA 1VQNT 3CCSQ 3KUFA 2YLBA 5GAOl 1PNJA 2RJFA 4JLGA 3VRYA 4FT2A 2AKKA 1SKUB 4OGCA 4FW1A 5KYYA 2KI7A 3CCEQ 1JO8A 1BU1A 3E19A 1KD1R 3QZ5B 1IO6A 4M7DF 4FW2A 1R0BG 1C6VX 2HCKA 1NJIC 1K8AU 2RHIA 3QG1A 1SRMA 1VQ7Q 4OB0B 2O9VA 3A8GB 2QDYB 1OULA 2DA9A 4QVDA 1S72Q 2RK2A 3EAEA 2VASA 2E4HA 2DXTA 2LCLA 4HVUA 5LJ5e 4IUVA 1O9SA 3MO8A 4E7KA 2MOXA 2QA4T 5CQYA 3C94A 3VUZA 2O9SA 3SHWA 1Q7YR 1Y57A 2M16A 1XJWB 1M3BA 2DVEA 4AMCA 2QK0A 2F5TX 4C0ZA 3OYDA 3QXEB 1ZUKA 5GAN8 1O75A 4D6WA 1VIFA 1KQSP 4J9CA 1KC8R 2CP5A 3TSZA 3MEAA 1JB0E 4E47A 1UG1A 2YRCA 3L1AA 4AFUC 2OAUA 2R57A 4RTTA 2E10A 4A63B 2KSSA 2X3WD 2J7IA 3RKWA 1TUCA 3V8KA 3IQLA 1LCKA 1UJ0A 4X9CA 1VQ8T 1KSWA 2CT4A 3GLXA 1JJ2S 4E2FB 4PFOA 3EG3A 2HSPA 4HCBA 5GANe 4E7HA 1AT1B 3EHQA 5I2SA 5GAN4 2O4XB 2DTIA 1G2BA 2D1XA 2J06A 3CC7A 2VUBA 4Z88A 1D1CA 3OS1A 3OW2P 1BI2A 3RIRA 3X28B 2KGTA 1QLYA 2X4YA 1DJ7B 4FSSA 3E9FA 3CCMQ 1FXXA 2YLCA 4PL6A 3R6NA 5FRNA 5GMKe 2EQIA 4PJNA 1M1KU 3JCMe 3DLLA 1CKAA 3JB9F 2X3XD 5LL6S 2E3HA 4DA4A 1Y96B 1KK7A 2V26A 1K1ZA 4C8QB 2A7YA 2MCNA 1YNZA 4PLLA 1X27A 4E6RA 1NYGA 6AT1B 4JS5A 1TSFA 4J9IA 2V8JA 4Z02A 1AWOA 2ECZA 5KYXA 2L8DA 3QHSA 4XTYA 4BE2A 2JUFA 4M7DA 1BI3A 1QVPA 2LDMA 4D8KA 5GMKl 3A98A 5C6SA 2QTVA 3UDCA 3M59A 3GNGA 1BI1A 2EGEA 4K11A 1YI2A 3CC7Q 4P5NA 5KYYB 2XDDA 2KEAA 2QDLA 3VS6A 3V8LA 3O5ZA 4J9EA 4C92E 2HNIA 2ED1A 2YDLA 4M4ZA 5LJ3j 1RAHB 1W6XA 4NOYA 3CCQA 1IRXA 1OU8A 3CBMA 1V1CA 1M1KR 1Y7XA 1X2QA 3CMEA 4M7AE 1YJWA 2HKQB 1LJOA 2QAZA 2DETA 1WQ7A 4QW2A 3LWIA 1I1JA 3VS7A 4DBHA 4CC7A 1VQPT 3CMAQ 2A0FB 2CP2A 1T3SA 3G71Q 2P0KA 5LJ5h 2FRWA 1VQLQ 2OTJQ 3RUXA 1J3TA 4FM4B 2JTMA 4E7JA 4PK4A 1NEGA 4EPCA 2HQEA 3LYIA 3EGUA 2CSQA 2DILA 1BBZA 1YBYA 3CCRT 1ZSZC 2HQHA 1YI2Q 5GJVB 3A8OB 2M0OA 3A5ZB 4JZ4A 4MDWA 3FRNA 4GY5A 5IN1A 5GAN6 3JCMQ 1BCOA 2OTLA 1M30A 1VQ4A 4M7DC 1PRMC 4LDVA 1HJDA 2HEQA 4M78E 5CQXA 2DK3A 2J6OA 2P4RA 3CCQQ 2EPDA 3VJPA 3CXCP 2JN0A 4E7LA 1T3LA 3EFSA 4MZPA 1WYXA 4KULA 1QMCA 4M75F 1ABOA 4EMKA 1IGQA 2IIMA 3H8ZA 4DBQA 3QDFA 1GFCA 2A37A 2D0QB 3META 2MYSA 2EBPA 3FJ5A 4LDWA 4JLIA 5GAMf 2K2VA 1VQ9A 4F7UF 4LXCA 3KFVA 1WXBA 2M02A 1ZQ1A 5GMKh 1AVZC 3JCMh 1K73C 1ZA2B 1M5Q1 9ATCB 1PD0A 3FJPA 3CCST 5HY6A 5KE2A 1VQOQ 2OTLQ 3MJXA 1VQ4Q 1Q86R 1M90R 2GNCA 3CCET 5DY9A 2G6FX 2C0IA 2CUBA 2ZPHB 4LUEA 5KYXB 4NS5A 1JU5C 1KQ2A 3CC2Q 1AHJB 5EG2A 2EYYA 2X4JA 2X35A 2Y4YA 1JBMA 4DBFA 4J9HA 2ZPEB 2PZ1A 4ATOA 1T0HA 1VQ7T 4N4GA 1RACB 4RTWA 2YRDA 1QVFA 3ZEHA 2V8KA 1D1BA 1S72T 4A4HA 1OPKA 3M57A 2CP6A 3L2VA 1K9MU 2EGAA 2L3SA 2XI9A 5GAOr 3HKSA 3EG0A 3TREA 3PTAA 2KYBA 3TEEA 3CCJA 5CCAA 1VQ9Q 3M9QA 3SWNA 4CI0C 1Q81U 3OYBA 2IPOB 4JJBA 3ZL7C 3CBPA 4AFQC 1SRLA 1M1FA 2LT4A 2JS0A 2MPXC 2RI2A 5GAN5 3X24B 1E6GA 3JB9D 5GAMj 1VQ6A 4RG2A 2CZ1B 2R58A 4M77A 2QI2A 2RM4A 1QVGA 3V8JA 2BUDA 1JXMA 2E64A 5GAMd 2GTJA 2A3LA 2DERA 3M58A 1YJNA 5IXFA 1LVKA 3CCRA 1JJ2P 2P0PA 5GANg 3JB9I 1WNLA 1BIAA 4A4FA 2COZA 1H3ZA 3QKJA 2ZPIB 4C8QE 1XOVA 1IHVA 1K8AC 2LNVA 1IZ6A 2F69A 4C92D 3OY9A 2DD5A 3RKXA 5AYFA 2EW3A 2DZ9A 2K3BA 3CCJQ 4GLKA 1RABB 3TSWA 2VYTA 1TXQA 4LDXA 4M7AD 3A1PA 3CPWS 3OMGA 1PC0A 2CDTA 2QQAA 5FWCA 3A8MB 4OVAA 2LT1A 3TU4K 3MKDA 4FYVB 5CKEA 5D7UA 2DL5A 2RO0A 1VQ6Q 4EMKB 3WXMB 1Q82U 1MGQA 3LX7A 3HPWA 2L3QA 2LJ3A 5IT9E 2C0TA 4PJOF 3HL8A 2LMJA 4QVCA 3M54A 3VS2A 1RL2A 1ZA1B 1WXUA 4O6JA 1MMNA 2KY9A 1HYOA 3DKMA 1MMDA 4E7ZA 1NZ9A 4QQGA 1FMKA 4FYWB 2CP3A 2EVRA 2YUOA 1QKWA 4M77C 4UC4A 4X1VA 3CC7T 1UHFA 2FPFA 1GBRA 1FMWA 4Q5WA 5J26A 2RJEA 1G3WA 1PSEA 2JOYA 1KD1U 3VS0A 1VQMA 3QJ6A 1JRIA 2HMAA 3LH0A 3VUBA 2ROLA 1ZLMA 2KT8A 3OSSC 1WIEA 1MMGA 3RNJA 5D6WA 3TQ7P 1W1FA 1QWFA 5HK3A 2J6FA 3UA7A 2ZGWA 2LNHB 4M75C 3RBBB 1Q82R 3PNWC 4OMMA 5A0LA 2RJCA 3CMAT 4ELZC 4M75D 2XK0A 2BTTA 3NMZC 2DMOA 1VQLT 1ZBXA 1Q7YU 4MMLA 3F70A 4KGZB 1SSFA 3SWNB 1TU0B 1KC8U 2F2WA 2LQ8A 1R8OB 2PUKB 2QG9B 1HD3A 1YI2T 2EYQA 1D1AA 2EJFA 4R0KA 1YN8A 2CREA 1YFNA 2DF6A 3JCMW 2BZ8A 2P4TA 3HFOA 3LWHA 3CPWA 3X20B 3QO3A 3RESA 1VQMQ 2HKNA 5GAN7 4M77B 4JRIA 2XDBA 2Z0WA 1D0XA 5LJ3e 2HBPA 3V7SA 3LGFA 3VS5A 4BE1A 3M56A 1FYNA 1PSFA 2K7AA 3CCQT 4XTVA 4XAXB 2E3IA 1MMAA 3A8HB 3QZ9B 3J7AF 3OS2A 3CMET 1YJWT 4HVWA 5I11A 3A8LB 3M0SA 2RPNA 1C0MA 4N4HA 2PVOB 1H8KA 3OBWA 4EMGA 4HCKA 2WSCE 1AEYA 3VV0A 1CKBA 1C1AA 1N27A 2D8JA 1B7TA 1JEGA 2DL7A 3OYJA 2PNIA 4M7DG 4DOWA 3CD6A 3NTIA 1YJ9Q 5FU6B 3CCMA 1PKSA 2EQKA 3OS5A 1K0XA 1WDXA 3P8BB 2K5FA 3QSUA 2OTLT 1QKXA 1WA7A 2FB7A 2RH2A 1VQ4T 3VKIA 3VYHB 2LRQA 2ZCFB 3QIIA 1VUBA 1NPRA 5CKFA 3HP9A 1AWJA 2X9HA 4RTUA 1UGSB 4AG1C 3MEWA 1EZZB 3CEYA 1SPKA 4C8QD 3G6EA 2A28A 1N8RR 2BIVA 2KQWA 1SHFA 1W2BA 4JZ3A 4KBMB 3CC4Q 4J9GA 3M4YA 4FYXB 4HCZA 1D3BA 1YP5A 2R5AA 3E1SA 3CD6Q 2XHCA 1VQ9T 1AZEA 1TUDA 1NG2A 1WX6A 1HSQA 4XU1A 1ZSZA 1WZOA 4PFZA 2JM9A 2HSEB 4VUBA 1Y0MA 3V7RA 3LGLA 3NGPA 1S1NA 4PJOC 3BFMA 2YT6A 4J7FA 3CMAA 1UGRB 3G71A 1TUGB 5EC7A 1AD5A 1VQLA 2OTJA 2VB6A 2ENMA 3QWXX 3JCMJ 3M0UA 3QDRB 4ZGDB 4PJOD 5LJ5f 2YRVA 3FIFA 1OI1A 2ZPFB 4PFPA 3G6EQ 1ZHIA 4OMOA 4OMNA 5I21A 1R77A 3OYYA 4GLMA 4J6WA 4NL2A 3JSCA 2RMOA 4RUGA 2DE0X 5ECAA 4C92F 1NYFA 1M4ZA 1PWTA 1WGSA 2CYZB 1SSHA 1XNIA 2KNBB 2MF2A 3OYMA 3L2WA 4RTZA 5LJ3h 2EKHA 4M7AF 2PVDB 3CCJT 1NJIU 3VS3A 2QEXA 1PM3A 2DFUA 2XD0A 4BACA 4FCYA 2MWPA 2WSFE 4AFSC 3CPWP 1K9MC 4DBRA 3I56A 2RN8A 3WVEB 1M8VA 3DB3A 1QCNA 2RHXA 5FU7C 4BUGA 1VYUA 4HT9A 3C4SA 1M9SA 4EMHA 2NWMA 1B34A 1VQ6T 1UGPB 5GANf 1Q81C 1CSKA 1Y71A 2XG8D 2EYXA 2JVVA 3EFOA 2JT4A 3OQ5A 1QVFS 2EYWA 3QBYA 1YJNT 4LDUA 4X9DA 2JNGA 4CC3A 4BB7A 3REAB 2RB6A 2HL5C 5DLOA 5GAOq 2DXBA 1EFNA 1K0SA 4OMLA 3UWNA 1YHQA 2V1RA 4M78F 3EGXA 3KXTA 2AT1B 3UATA 4PJMA 1RI9A 2FZKB 1K76A 4CC2A 3JB9J 2LZ6B 3JCMf 1VQOA 1Q86U 1M90U 4ANJA 3DB4A 5M9OA 3V7CA 3DLMA 3I9QA 5LJ5d 1TWBA 2Y90A 2QEXQ 3H0FA 3CQTA 3ZFJA 1NJIR 2RQWA 2LCSA 3CC2A 2AZVA 2C0OA 2H3EB 4KGVB 1X2KA 4GBQA 3I56Q 2GQIA 5CAIA 1QVGS 3M55A 1HK9A 4D8DA 4JUVA 3LW5E 3RDVA 5IAYA 1K9AA 2RA2A 2E70A 1IHWA 1D3BB 2IG0A 2L89A 5DM7R 3CCUA 2F2XA 2K3YA 1I81A 4M77G 1M3AA 4XK8E 4RCBA 4A4KA 4J9FA 1WXTA 2NLUA 4R55A 3OYFA 1I5LA 1YCYA 3G1JA 3SB2A 2BE7D 4R56A 2EQJA 3CBOA 3OB9A 4FSXA 1ACMB 2FL7A 1YIJA 1N9SA 4EIKA 1U06A 1YHQQ 1RAEB 1ZSZB 1IXDA 5CK9A 2NUPA 4FIBA 3I55A 3OBYA 5GANd 3N5BB 4LUDA 4MMKA 2KE9A 4C92A 3HTRA 5D6XA 4E7IA 2EFIA 3UA6A 2A08A 1GXIE 4M75G 2Y4XA 2XICA 2DL4A 1OYXA 1VYTA 1YITA 2CUDA 4FT4A 1VQMT 4MZTA 5L8RE 4JJDA 4M7DB 3M53A 4M7AA 1E7OA 1QP2A 2QGFB 3AT1B 4JDSA 4LNPA 1N9RA 2MI6A 2JM8A 4F7UG 1KD1C 2LX7A 3JCMd 2MMPA 1VQ8Q 2E5QA 5LJ5g 2EWNA 3CCUQ 3C95A 5DLQE 2HDAA 3BDUA 4XTXA 3L2ZA 4L59A 1VIEA 1X43A 1N5ZA 4JJNK 5IH2A 3JCMb 1NPPA 2CZ6B 1RADB 1WLPB 2BE9B 2COYA 1AWWA 1OZ3A 4QQ6A 4ZNXA 2M0YA 1YIJQ 3RERA 3P8HA 2GF7A 2KAFA 1UGQB 3I55Q 4PLIA 2V8IA 2JXBA 3QYGB 1UHCA 5GAMh 1RLPC 2CSIA 4J8OA 1Q7YC 5FRMA 1LPLA 1B34B 3ASKA 5KCHA 3LH5A 3RMQA 2M9UA 1YITQ 3U23A 1LOJA 5I22A 2O2OA 2P0QA 1KC8C 3EFOB 2RI5A 2A36A 2CT3A 2XIDA 4Y28E 2LQWA 1QW1A 3QUIA 4C8QF 3HRUA 2LP5A 1U1SA 2X4XA 2EYZA 4C92C 3C12A 3EGXB 3FEOA 1NEBA 3SDZA 3M0TA 1AZGB 5GAOp 4ZGJB 4M75A 1SHGA 1OZ2A 2B8AA 2ZZDA 3G4SA 2GCXA 2K2MA 2O31A 4HVVA 2J05A 5CVIA 4BI4A 4M7AC 5CIUA 2EIFA 1UGVA 4Z8AA 4ME7A 1GCQC 3CD6T 4WF2A 2OJ2A 4ZTFA 5CKHA 5IHNA 3CCMT 4ELYC 3H6ZA 3H0IA 4F7UA 2QGGA 1KQSA 3JCMg 4E7SA 1MUZA 2ED0A 4RTYA 1IGUA 4OMFB 1NBEB 5KYUA 4JPBW 5J3BA 2EAYA 2AHJB 3L2RA 1E6HA 3MEUA 1BB9A 4AT1B 5GJWB 3PVLA 3NHNA 2QXFA 4ZTJA 4RTXA 3CCLA 4RTVA 2XU8A 4BY6C 2DAQA 2DPPB 3NTKA 2KMTA 1AOJA 2OI3A 4N0AC 3GPLA 2C06A 4M78C 4F04B 5J39A 2AIRB 3O8VA 3G6ET 4BDYA 2RQTA 1MHNA 3EG9A 2LQNA 2FG0A 4WTOB 1MNEA 4J83A 3S3OA 1HXDA 2B86A 3G4SQ 1VQKA 4M78D 4C0GA 2BKDN 3OW2A 2CZ0B 4PJOG 4OB2B 3JCMc 1U1TA 1D09B 1RI0A 2E5KA 1WHKA 2ZPGB 1QQJA 2CH4A 1WJQA 4A4GA 2NUZA 3PT9A 1H3HA 4F16A 2QYZA 2FVUA 3R6OA 3JCMX 5FROA 1VQ5A 3BE3A 3L2QA 3HRSA 2VC8A 1QCFA 1RAAB 4IUPA 2IVWA 2L0AA 3M0QA 3M0PA 2H8HA 4HXJA 2YUQA 3G71T 5CKDA 1NE8A 3CCLQ 2OTJT 1M1KC 2ESWA 2GGRA 3WVDB 1W2BS 1B07A 1WPYA 4KH1B 1I5OB 1QVFP 1Y96A 1UEBA 4DOVA 4C8QA 4XU0A 1I0CA 2DBKA 2KRSA 4CRIA 1YJ9A 4N4IA 7AT1B 1K73R 1YCSB 1WHJA 2LC4A 1VQKQ 2VXFA 3QJYA 1I4K1 4PJLA 1GL5A 3PIPA 2JTEA 1WHGA 2DEQA 1OPLA 3REBB 2HD0A 1UECA 4QKUA 3ZBDA 2QEXT 1JXOA 2K5LA 4XU3A 1M8MA 2YXYA 2L3RA 3PFSA 4IIMA 4JRKA 4ZN3A 1GFDA 1H92A 4HT8A 1P92A 1N8RU 1VQ5Q 3I56T 3VYGA 2JTFA 2KDSA 1QVGP 2JW4A 5FW9A 2RJDA 4PKCC 2RNAA 1ABQA 4M75B 2RQVA 4C5EA 2EJGA 3UPUA 3CC4A 2DRMA 4LD9K 5I2MA 1WQWA 4PJOA 4M7DE 4IKFA 1BYMA 4AFZC 1W4SA 2DX1A 2DXCA 4DEXA 5KYNA 4QT7A 4F7UB 4BDZA 2VGNA 2XKOC 2WSEE 1V76A 4IURA 4V2SA 3CCVA 3EH1A 5KYUB 1X6GA 2G3RA 1UTIA 1SG5A 1YHQT 3MP8A 3EFRA 3JCMV 2GFUA 2P84A 1SEMA 1X75C 4B9WA 1VQOT 4C5HA 2KRMA 2FHDA 1F1BB 2FRYA 3SFMA 2RHZA 2K79A 5L23A 1QWEA 4C8QC 1SF9A 4X34A 4KUIA 1UUEA 3PVQA 3OYAA 3CC2T 3CXCA 4KUDK 2E65A 4CC4B 1Q86C 3AHUA 4IUUA 2KRNA 1G3SA 1M90C 3EH2A 2JS2A 3MP6A 3EG9B 1KHIA 2VVKA 1KIKA 2F1LA 2AKLA 1OX8A 4JRPA 2QASA 5CO7A 3HSBA 1K8AR 2BZYA 3NPFA 3CCUT 4JS4A 2RD1A 1YWOA 2K4YA 1OEBA 2NYSA 5CKBA 2VV5A 4HKEA 1WHMA 1ZX6A 2X51A 2MWOA 3OS0A 4J6XA 2DLPA 5LJ3f 3CCVQ 2RHYA 2YSQA 4AG2C 1YIJT 1ARKA 3ME9A 4XTZA 5KE3A 5GAN2 1N6AA 3S6WA 3I55T 2GQVA 5KYWA 2K6DA 2D0NA 2O01E 1YITT 4OB3B 3X25B 5AT1B 4KRTA 2PQWA 4ORZA 3RR6A 1ZUYA 1VOMA 2KK4A 2DYIA 3D7SB 2NUTA 2PU9B 2K57A 2DIQA 1XQHA 3GBQA 2ATCB 1NM7A 4RG8A 3MPUB 2HZYA 3KBGA 3JB9G 1ZSGA 3NFCA 1JQQA 2E41A 1QP3A 2CP7A 4RMOA 2LCCA 5CR2A 2QTXA 2EQUA 4A54A 4XTWA 1VQNA 4II1A 3CPFA 5GAOn 2D6FA 4C0FA 1UB4A 2COWA 1LNXA 4QVZA 4F17A 2M1HA 2KBTA 3QYHB 3HRTA 1MV3A 4OMQA 2FPEA 2PVGB 2CP0A 4JRQA 2QQSA 2QQRA 1BK2A 1ZBJA 4Z89A 5GAMe 4LN2A 1UE9A 2W10A 5HCKA 2F2VA 2DM1A 2HAXA 4C92G 3Q1JA 4MZMA 1VYVA 2DVJA 2DEUA 1H641 1I07A 1M1GA 1NLOC 2JJ9A 2YHTA 1B3QA 4PJOB 4FYYB 2KR3A 1RUWA 2MAMA 5LJ3d 4A53A 4M7AG 2BZXA 2CKKA 3JV3A 4DEYA 2X4WA 1XTDA 4BI3A 3OYCA 1JJ2A 2AK5A 2E6ZA 5FWBA 2E12A 3EG2A 2LX9A 2JZ2A 3M0RA 1AWXA 2QA4A 5LJ5j 4PJJA 1X01A
chains in the Genus database with same CATH topology
4F7UA 1WJRA 3QYGB 5GAMh 3GLXA 4J8OA 1Q7YC 1JJ2S 5FRMA 1KQ1A 2ZGWA 3G4ST 4M75C 1B34B 3ASKA 5KCHA 3RMQA 4HCBA 2M9UA 5GANe 4E7HA 2DO3A 5I2SA 5GAN4 1LOJA 3PNWC 2O4XB 2DTIA 5A0LA 3BDLA 2P0QA 2RJCA 2XDPA 1KC8C 4ELZC 3L42A 3CC7A 2RI5A 2VUBA 4M75D 5GMKi 3CMAT 2XK0A 2CGHA 2XIDA 4Y28E 1VQLT 1ZBXA 4KT0E 1QW1A 3OS1A 4MMLA 1Q7YU 3QUIA 3M4GA 1Y07A 4C8QF 1BI2A 3F70A 4M77F 3HRUA 1SSFA 3RIRA 3INZA 4A4EA 1U1SA 3X28B 3SWNB 2LVMA 2DKGA 2X4XA 2X4YA 2K5IA 4BD3A 4C92C 3C12A 1DJ7B 4OB1B 4M78G 1U8RA 1KC8U 3FEOA 1WJSA 3E9FA 3M5AA 5FU7B 3OYNA 1FXXA 2YLCA 4PL6A 3SDZA 2LQ8A 1VQ8A 1BIBA 1R8OB 2PUKB 5FRNA 5GMKe 4M7DD 5GAOp 4ZGJB 1YI2T 2EYQA 4M75A 4M77E 1M1KU 3JCMe 1OZ2A 3DLLA 2B8AA 2EJFA 2ZZDA 3G4SA 2GCXA 3JB9F 3ER0A 5LL6S 4OF1A 3JCMW 2P4TA 5CVIA 4BI4A 3CCLT 3HFOA 4DA4A 1Y96B 3LWHA 3CPWA 3X20B 5GANh 2EJ9A 3QO3A 5CIUA 2A7YA 2EIFA 3RESA 4C8QB 5GAN7 4M77B 4PLLA 4JRIA 1KQSA 2XDBA 4JS5A 5GANj 1Q82C 4ME7A 5LJ3e 2HBPA 2V8JA 4Z02A 3V7SA 3LGFA 3OYKA 4BE1A 3M56A 2DIGA 3CD6T 4WF2A 4ZTFA 3MCAB 3RMSA 5CKHA 3OYLA 3CCMT 2L8DA 3H6ZA 3QHSA 4XTYA 1PSFA 2JUFA 1BI3A 1QVPA 3JCMg 4ELYC 4XTVA 2LDMA 4XAXB 3CCQT 5GMKl 3A8HB 4OMFB 3QZ9B 5C6SA 3J7AF 4M75E 3OS2A 3UDCA 1KHCA 3M59A 5J3BA 1VQKT 4LDYA 4OGEA 3CMET 3GNGA 4YTLA 1YJWT 2EAYA 2AHJB 3L2RA 3A8LB 4Y91A 1KQSS 1BI1A 3MEUA 4N4HA 5LJ3g 2DJZA 5HKCA 1YI2A 2PVOB 3OBWA 4EMGA 2WSCE 4P5NA 5GMKj 2QXFA 2XDDA 2F5KA 4ZTJA 3CCLA 3VV0A 2XU8A 4BY6C 2DAQA 1N27A 1V29B 3V8LA 4C5IA 3OYJA 2DPPB 4F7UE 3NTKA 5A2QE 5KH6A 2KMTA 3GNFB 3OSVA 4M7DG 4N0AC 4DOWA 3GPLA 4C92E 1VQ5T 2C06A 4M78C 2HNIA 3CD6A 5J39A 3O8VA 4ZN1A 3NTIA 5LJ3j 3G6ET 2FYKA 4BDYA 4NOYA 5FU6B 3CCMA 1MHNA 2EQKA 4ZGEB 3CCQA 4J83A 3FDRA 3OA6A 3S3OA 1HXDA 3HHTB 3CBMA 1VQKA 3OS5A 4M78D 2LQKA 2ZPBB 1Y7XA 3CMEA 3QPHA 4M7AE 1YJWA 4C0GA 3P8BB 4HCCA 1LJOA 5A0GA 1WQ7A 2BKDN 2H3JA 4QW2A 3LWIA 2K5FA 3QSUA 3OW2A 4XQ3A 4MDXA 2QQ9A 2R5MA 2OTLT 1G3YA 2FB7A 2RH2A 3PIOA 2CZ0B 1VQ4T 4RCCA 1VQPT 4PJOG 4OB2B 3JCMc 1U1TA 3VKIA 2VXEA 3VYHB 4B9XA 2P0KA 2LRQA 3PMIA 5LJ5h 1RI0A 2ZCFB 3RUXA 2ZPGB 3QIIA 1VUBA 1FX7A 4FM4B 3OW2S 2JTMA 1YJ9T 1WJQA 4A4GA 1NPRA 3PT9A 4E7JA 5CKFA 3JCMP 4EPCA 3HP9A 2HQEA 4N0AA 3PMTA 3LYIA 2DD4A 4M78A 2FVUA 3R6OA 2CS7A 3JCMX 5FROA 1UGSB 1VQ5A 3GOXA 3MEWA 3J81E 3L2QA 3VU3C 1YBYA 3CEYA 3HRSA 4L6V5 2VC8A 4C8QD 3JRZA 3X26B 3G6EA 3CCRT 2DZCA 4IUPA 2IVWA 2BIVA 2KQWA 4NL3A 1W2BA 3A8OB 2M0OA 4KBMB 5CKDA 1FWZA 2HQXA 5A0DA 3A5ZB 3G71T 3UT1A 4MDWA 1NE8A 3FRNA 2RK1A 4EMKC 3PGGA 2OTJT 4GY5A 5GAN3 3M4YA 3NTHA 1M1KC 3TCJA 4HCZA 1D3BA 5IN1A 5GAN6 3JCMQ 2GFAA 3WVDB 2OTLA 2R5AA 5GAOm 2PUOB 3E1SA 1VQPA 1W2BS 1VQ4A 4M7DC 1WPYA 4LDVA 1Y96A 1UEBA 4C5GA 4DOVA 4M78E 4C8QA 5CQXA 4XU0A 2DK3A 2XHCA 4CRIA 1YJ9A 1VQ9T 1G5VA 4N4IA 3VJPA 4XU1A 4LD6A 2JN0A 3OMCA 4E7LA 2LC4A 3BW1A 3J80E 3EFSA 2VXFA 3QJYA 3CC4T 3OYIA 1I4K1 4BE0A 4MZPA 4PNOA 2L5QA 5D6YA 3PIPA 4KULA 2E6NA 4HA8A 4DQ2A 1N8RC 4VUBA 3V7RA 1X6OA 3LGLA 2LTOA 4PJOC 2EQMA 3BFMA 2DEQA 4J7FA 1UGRB 4M75F 3CMAA 4EMKA 3G71A 2HD0A 1VQLA 2OTJA 3ZBDA 2QEXT 4FU6A 2K5LA 4XU3A 3H8ZA 3JCMJ 4C8QG 3QDRB 3LLRA 2L3RA 3PFSA 4ZGDB 2D0QB 4PJOD 5LJ5f 3META 4JRKA 4ZN3A 2YRVA 3FIFA 3CCVT 4BI8B 3S3NA 4HT8A 4LDWA 1OI1A 3FC3A 1P92A 2ZPFB 4IUQA 1N8RU 3MHXA 3VYGA 2JTFA 3I56T 2KDSA 2RHUA 1ZHIA 3JAME 4JLIA 5GAMf 2K2VA 5I21A 1VQ9A 2RJDA 4PKCC 4F7UF 3OYYA 1ZQ1A 4J6WA 4NL2A 3JSCA 4M75B 5GMKh 3L2UA 3MEVA 4C5EA 3JCMh 1K73C 4C92F 1M5Q1 2EJGA 2WACA 3UPUA 3CC4A 4OP0A 3FJPA 3CCST 4L5GA 1M4ZA 3FLGA 2E1HA 5HY6A 5I2MA 5KE2A 4LD9K 1WGSA 2CYZB 1WQWA 1XNIA 4PJOA 4FL6A 2MF2A 2EKOA 3SD4A 2VGMA 3OYMA 3L2WA 4M7DE 1KG1A 2RI3A 4IKFA 1BYMA 3T9NA 5LJ3h 3GIBA 3GP8A 3CCET 4C0DC 1W4SA 5DY9A 4M7AF 2PVDB 4EDUA 3CCJT 1NJIU 2DXCA 4J6YA 2QEXA 2ZPHB 4XU2A 1K73U 4M7DA 4NS5A 4F7UB 4BDZA 2VGNA 2XKOC 3S3MA 1KQ2A 2WSEE 4QQDA 2XD0A 4IURA 4BACA 4V2SA 1AHJB 5EG2A 3CCVA 2X4JA 2X35A 2Y4YA 3MP1A 2MWPA 3SWNC 2G3RA 4C92B 5KCOA 1YHQT 1JBMA 2WSFE 3MP8A 3EFRA 1K9MC 3JCMV 3I56A 4ATOA 2ZPEB 1G3TA 2GFUA 3DB3A 3WVEB 1M8VA 1X75C 2RHXA 5HK0A 5FU7C 4BUGA 1IREB 4B9WA 1VQ7T 3BY7A 4J5YA 2DXUA 4N4GA 1VQOT 4HT9A 3C4SA 3P8DA 4C5HA 4PJOE 1M9SA 4EMHA 1VQ6T 1B34A 2FHDA 1QVFA 1UGPB 2V8KA 4M7AB 3ZEHA 3SFMA 5GANf 1S72T 2RHZA 1Q81C 1Y71A 2XG8D 3CCSA 4A4HA 2O4XA 2JVVA 3FB9A 3M57A 4C8QC 3L2VA 1K9MU 4J7IA 4X34A 4KUIA 2DTOA 2XI9A 3URGA 3OYAA 5GAOr 3CC2T 3HKSA 3CXCA 3OQ5A 3TREA 1TH7A 3PTAA 1QVFS 3QBYA 4TVRA 3CCEA 1YJNT 4KUDK 2E65A 4LDUA 1Q86C 3AHUA 4IUUA 5GAMg 3TEEA 1M90C 1G3SA 4X9DA 3CCJA 2JNGA 2CZ7B 4RKUE 5CCAA 4M77D 4BB7A 5DLOA 2RB6A 3M9QA 5GAOq 2DXBA 3MP6A 3SWNA 4CI0C 4IUTA 1Q81U 1KHIA 3OYBA 3CXCS 4O5VA 2DTHA 3CBPA 3G7ZA 1YHQA 3UWNA 4M78F 3KXTA 4JRPA 1M1FA 2LT4A 5CO7A 3OYHA 1BI0A 3HSBA 2RI2A 1I8FA 3HFNA 5GAN5 3JB9J 1VQ7A 3OYEA 3JCMf 3X24B 3CCUT 1VQOA 1Q86U 1M90U 4JS4A 3JB9D 5GAMj 2RD1A 2K4YA 5CKBA 3DB4A 1VQ6A 4PLIA 4RG2A 5M9OA 2VV5A 4HKEA 3DLMA 3V7CA 3E9GA 4BY6B 5LJ5d 1S72A 2CZ1B 2Y90A 3GF5A 2RM4A 2R58A 2KVQG 2QI2A 4M77A 3RKYA 1QVGA 3V8JA 2BUDA 5FLXE 1BKBA 2MWOA 2D9TA 3OS0A 3ZFJA 4J6XA 5LJ3f 2E64A 3CC2A 4C0DB 2RHYA 5GAMd 1YIJT 2A3LA 2I2LA 3ME9A 4M78B 4XTZA 5KE3A 3M58A 4XTUA 1EIFA 5GAN2 1YJNA 1Q82U 3JB9H 1N6AA 5CAIA 2K3XA 3S6WA 3I55T 3M55A 3CCRA 1QVGS 2GQVA 1HK9A 5FU6C 4JUVA 3LW5E 2P0PA 3OYGA 5GANg 5IAYA 5GMKm 2O01E 3JB9I 2QQBA 1WNLA 1BIAA 2RA2A 4A4FA 5C0MA 2E70A 1YITT 4OB3B 1VQNT 1H3ZA 3QKJA 3X25B 3KUFA 2ZPIB 2YLBA 1XOVA 4C8QE 5GAOl 2RJFA 4JLGA 1D3BB 2PQWA 2IG0A 1K8AC 2L89A 2LNVA 5DM7R 1IZ6A 3CCUA 2K3YA 1I81A 4FT2A 4M77G 4XK8E 2F69A 4C92D 4OGCA 3OY9A 2KK4A 2DD5A 4RCBA 3RKXA 5AYFA 4A4KA 2DZ9A 2NLUA 4R55A 4E47A 3OYFA 1I5LA 2PU9B 4M7AC 1YCYA 4GLKA 3SB2A 3E19A 4R56A 2EQJA 3CBOA 3QZ5B 2VYTA 2K57A 3OB9A 2DIQA 4BE2A 1XQHA 4M7DF 4FSXA 4RG8A 4LDXA 2FL7A 1NJIC 1YIJA 1N9SA 4M7AD 3KBGA 3CPWS 3JB9G 1K8AU 3OMGA 2RHIA 3NFCA 2E41A 5CK9A 2QQAA 1QP3A 4FIBA 3I55A 3QG1A 3A8MB 4OVAA 2LT1A 3OBYA 5GANd 4OB0B 3N5BB 5CKEA 4MMKA 4RMOA 3TU4K 4C92A 5D6XA 2LCCA 3A8GB 2QDYB 5CR2A 2EFIA 2RO0A 4E7IA 2QTXA 1GXIE 4M75G 2Y4XA 2EQUA 2XICA 3WXMB 4A54A 1MGQA 4EMKB 3LX7A 3HPWA 1OYXA 4XTWA 4QVDA 2RK2A 3EAEA 1YITA 4II1A 1VQNA 3CPFA 4FT4A 2DXTA 5IT9E 1VQMT 4MZTA 5L8RE 5GAOn 2D6FA 4C0FA 4M7DB 1UB4A 1LNXA 2LCLA 3M53A 4QVZA 2M1HA 3QYHB 4PJOF 4M7AA 3HL8A 4QVCA 4IUVA 5LJ5e 3HRTA 3M54A 1QP2A 2PVGB 1O9SA 3MO8A 4E7KA 4JRQA 4JDSA 2QA4T 5CQYA 3C94A 1RL2A 2QQSA 2QQRA 3VUZA 1N9RA 2MI6A 4O6JA 5GAMe 2M16A 4F7UG 1KD1C 2KY9A 2DVEA 3DKMA 2F5TX 4C0ZA 3OYDA 4C92G 3JCMd 3QXEB 2HAXA 1NZ9A 3Q1JA 4QQGA 5GAN8 2MMPA 1O75A 4D6WA 1VIFA 4MZMA 2E5QA 1H641 1M1GA 2EWNA 2YHTA 5LJ5g 4PJOB 4M77C 4UC4A 3C95A 5DLQE 3CC7T 3BDUA 3MEAA 1JB0E 4Q5WA 4XTXA 5J26A 2MAMA 2RJEA 1G3WA 3L1AA 3L2ZA 1VIEA 4L59A 1PSEA 2JOYA 5LJ3d 4A53A 1KD1U 4M7AG 4JJNK 3JCMb 1NPPA 2OAUA 2CZ6B 2R57A 1VQMA 2CKKA 2E10A 1JRIA 3QJ6A 2KSSA 1XTDA 2X4WA 3LH0A 4BI3A 3VUBA 1OZ3A 3OYCA 1JJ2A 4QQ6A 3RKWA 2E6ZA 2E12A 3V8KA 3OSSC 3RERA 2LX9A 2JZ2A 5D6WA 3P8HA 2QA4A 2GF7A 2KAFA 5LJ5j 1UGQB 4X9CA 1X01A 2V8IA 1VQ8T 5HK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7U F;  4JUV A;  5GAM h;  4NL2 A;  5GMK h;  4J6W A;  4M75 B;  1KQ1 A;  2ZGW A;  1HXD A;  5GAN g;  5GMK m;  4M75 C;  3JCM h;  3JB9 I;  4M78 D;  1M5Q 1;  1B34 B;  2EJG A;  1WNL A;  1BIA A;  2RA2 A;  4C92 F;  4OP0 A;  4M7A E;  5GAN e;  3FJP A;  1LJO A;  1WQ7 A;  5GAN 4;  3QSU A;  1LOJ A;  2E1H A;  2YLB A;  4C8Q E;  4XQ3 A;  5GAO l;  1D3B B;  1WQW A;  2DTI A;  4PJO A;  2FB7 A;  4M77 G;  1I81 A;  4M7D E;  4RCC A;  4M75 D;  4PJO G;  3JCM c;  1U1T A;  4C92 D;  2VXE A;  2CGH A;  5GMK i;  4RCB A;  3RKX A;  5LJ3 h;  3GIB A;  5LJ5 h;  2DZ9 A;  1I5L A;  3RUX A;  5DY9 A;  4M7A F;  1YCY A;  4MML A;  4J6Y A;  3SB2 A;  3QUI A;  3M4G A;  4XU2 A;  4C8Q F;  2K57 A;  4F7U B;  4M77 F;  3JCM P;  3RIR A;  1KQ2 A;  3INZ A;  4N0A A;  1U1S A;  4M7D F;  4V2S A;  3SWN B;  2DKG A;  4M78 A;  5I21 A;  3SWN C;  1N9S A;  4C92 B;  4M7A D;  1JBM A;  3JCM X;  4C92 C;  3JB9 G;  3EFR A;  4M78 G;  3JCM V;  2E41 A;  3VU3 C;  1M8V A;  4C8Q D;  2VC8 A;  2YLC A;  2DZC A;  1BIB A;  3BY7 A;  5GMK e;  5GAN d;  4J5Y A;  2DXU A;  4MMK A;  5GAO p;  4NL3 A;  4HT9 A;  4M77 E;  4M75 A;  4C92 A;  3JCM e;  4PJO E;  2EJF A;  4EMH A;  2QTX A;  3JB9 F;  1B34 A;  4M75 G;  4M7A B;  4A54 A;  4EMK B;  1MGQ A;  4QVD A;  5GAN f;  4XTW A;  3JCM W;  4M7D D;  4EMK C;  3HFO A;  3PGG A;  1Y96 B;  4M7A C;  5GAN 3;  5GAN h;  2EJ9 A;  3QO3 A;  3RES A;  2DXT A;  4C8Q B;  5GAN 7;  1D3B A;  3FB9 A;  4M77 B;  4C8Q C;  4JRI A;  5GAN 6;  3JCM Q;  5GAO n;  5GAN j;  4M7D B;  5GAO m;  1LNX A;  2DTO A;  4PJO F;  5GAO r;  4M7D C;  5LJ3 e;  4M7A A;  5LJ5 e;  4QVC A;  1WPY A;  3V7S A;  1TH7 A;  1Y96 A;  4M78 E;  4C8Q A;  2E65 A;  4WF2 A;  3AHU A;  4XU0 A;  5GAM g;  4X9D A;  1N9R A;  4F7U A;  3QHS A;  4XTY A;  4M77 D;  4M7D A;  2RB6 A;  3JCM g;  5GAM e;  4XTV A;  5GAO q;  3SWN A;  4F7U G;  5GMK l;  2DVE A;  4XU1 A;  2JN0 A;  2DTH A;  3BW1 A;  4M75 E;  4M78 F;  3EFS A;  2VXF A;  4C92 G;  3JCM d;  2EAY A;  1I4K 1;  5GAN 8;  3HSB A;  4PNO A;  4Y91 A;  1I8F A;  3HFN A;  5GAN 5;  3JB9 J;  4HA8 A;  4DQ2 A;  1H64 1;  2DJZ A;  2EWN A;  2YHT A;  3JCM f;  3V7R A;  4M77 C;  5LJ5 g;  4PJO B;  4PJO C;  3BFM A;  3BDU A;  2DEQ A;  5GAM j;  2RD1 A;  4M75 F;  4EMG A;  4EMK A;  5GMK j;  3JB9 D;  4XTX A;  3V7C A;  3L1A A;  3L2Z A;  5LJ3 d;  5LJ5 d;  4A53 A;  4M7A G;  2Y90 A;  5LJ3 g;  3JCM b;  2RM4 A;  4M77 A;  3RKY A;  4XU3 A;  3V8J A;  3V8L A;  3JCM J;  4C8Q G;  2E10 A;  1JRI A;  4F7U E;  4J6X A;  5LJ3 f;  2E64 A;  5LJ5 f;  4PJO D;  4JRK A;  3FIF A;  4M7D G;  3RKW A;  5GAM d;  4N0A C;  2I2L A;  4XTZ A;  4M78 B;  4HT8 A;  3V8K A;  3RER A;  4C92 E;  4XTU A;  5GAN 2;  3JB9 H;  4M78 C;  2HNI A;  5LJ3 j;  5LJ5 j;  5CAI A;  2FYK A;  4NOY A;  4X9C A;  1X01 A;  4JLI A;  1HK9 A;  5GAM f; 
#chains in the Genus database with same CATH topology
 1WJR A;  2LJ0 A;  1KQ1 A;  2FO0 A;  3G4S T;  1TOV A;  2ZAE A;  3PE0 A;  2DBM A;  1VQN Q;  2DO3 A;  2V1Q A;  2RQR A;  3BDL A;  2XDP A;  3L42 A;  5GMK i;  2CGH A;  2KT1 A;  1MND A;  4KT0 E;  1WHH A;  3H0H A;  2GTO A;  3M4G A;  1Y07 A;  2HL3 A;  4M77 F;  3INZ A;  4A4E A;  1U3O A;  1A0N B;  2LJ1 A;  2LVM A;  5IXB A;  2DKG A;  2K5I A;  4BD3 A;  1U8R A;  4OB1 B;  4M78 G;  2FPD A;  1WJS A;  5FU7 B;  3M5A A;  3OYN A;  1VQ8 A;  1BIB A;  4M7D D;  1OV3 A;  4M77 E;  2KRO A;  3ER0 A;  3CME Q;  1YJW Q;  4OF1 A;  3CCL T;  1OX9 A;  5GAN h;  2EJ9 A;  2L2P A;  1Z9Z A;  1D0Y A;  2RQU A;  2OX7 A;  5GAN j;  1Q82 C;  2SEM A;  1W2B P;  3OYK A;  3EHR A;  2DIG A;  2QA4 Q;  3MCA B;  3RMS A;  3OYL A;  2MIO A;  3ULR B;  2DNU A;  4M75 E;  1VQK T;  5KYW B;  1KHC A;  4LDY A;  4OGE A;  4YTL A;  4Y91 A;  1KQS S;  1QCO A;  5LJ3 g;  2DJZ A;  5HKC A;  2RF0 A;  2KXD A;  2CH4 W;  5GMK j;  2NUT B;  1NLP C;  2F5K A;  1UJY A;  1OQK A;  3I5R A;  2DJQ A;  2YUN A;  1V29 B;  1PRL C;  4C5I A;  1T0J A;  4F7U E;  5A2Q E;  5KH6 A;  3OSV A;  3GNF B;  1YWP A;  1GCQ A;  1VQ5 T;  4ZN1 A;  3C0C A;  2FYK A;  8AT1 B;  4ZGE B;  3I35 A;  1TG0 A;  3FDR A;  3OA6 A;  1M3C A;  1GRI A;  1KJW A;  3HHT B;  2LQK A;  2ZPB B;  3QPH A;  2YUP A;  4HCC A;  2FEI A;  4IIO A;  5A0G A;  2H3J A;  4XQ3 A;  2FZG B;  4MDX A;  1OU9 A;  2QQ9 A;  1PD1 A;  2R5M A;  1G3Y A;  3PIO A;  2O88 A;  4RCC A;  4B9X A;  2M51 A;  2VXE A;  1X69 A;  3PMI A;  1G8X A;  3EGD A;  1Z9Q A;  1FX7 A;  3OW2 S;  1YJ9 T;  3THK A;  3QWY A;  3JCM P;  4N0A A;  3PMT A;  2JMC A;  2DD4 A;  2YWW A;  3H41 A;  4M78 A;  2DYB A;  2CS7 A;  3VRZ A;  3GOX A;  3J81 E;  3VU3 C;  4L6V 5;  2I0N A;  3JRZ A;  1FMV A;  3X26 B;  2DZC A;  1PG5 B;  4NL3 A;  1M2V A;  4OMP A;  1FWZ A;  2HQX A;  2OAW A;  5A0D A;  3UT1 A;  3VS1 A;  2RK1 A;  4EMK C;  3PGG A;  1RLQ C;  5GAN 3;  3NTH A;  3TCJ A;  2ROT A;  2GFA A;  5GAO m;  2PUO B;  1VQP A;  2KXC A;  2JMA A;  4C5G A;  1W70 A;  1UDL A;  2MK5 A;  3EG1 A;  1OOT A;  1G5V A;  2J6K A;  3TVT A;  4LD6 A;  3OMC A;  3BW1 A;  3H9N A;  4ESR A;  3J80 E;  3CC4 T;  3OYI A;  1TS9 A;  4BE0 A;  2VKN A;  4PNO A;  2L5Q A;  2GBQ A;  5D6Y A;  4Y92 A;  2E6N A;  4HA8 A;  4DQ2 A;  1N8R C;  1PCX A;  1X6O A;  2LTO A;  2EQM A;  3I5S A;  3E2U A;  4JJC A;  2DL8 A;  5IHK A;  1BCM A;  4FU6 A;  1X6B A;  4C8Q G;  3LLR A;  2L3P A;  1GCP A;  3CCV T;  1K9M R;  4BI8 B;  1WI7 A;  3S3N A;  3FC3 A;  4IUQ A;  3MHX A;  1M2O A;  2RHU A;  3JAM E;  2EGC A;  3L2U A;  3MEV A;  1Q81 R;  2WAC A;  4OP0 A;  1KFZ A;  4L5G A;  3FLG A;  2E1H A;  4FL6 A;  3SD4 A;  1G83 A;  2EKO A;  2VGM A;  1VQP Q;  1KG1 A;  1K4U S;  2RI3 A;  3T9N A;  3GIB A;  3GP8 A;  4C0D C;  5IHI A;  4EDU A;  1Q95 G;  4J6Y A;  2DL3 A;  4XU2 A;  1K73 U;  2NUP B;  3S3M A;  1GBQ A;  3VS4 A;  1PKT A;  4QQD A;  4J9B A;  3MP1 A;  5KCO A;  3SWN C;  2HBW A;  4C92 B;  1YJN Q;  8ATC B;  1G3T A;  3CCR Q;  2K9G A;  5HK0 A;  1IRE B;  1PHT A;  3BY7 A;  4J5Y A;  2DXU A;  3P8D A;  4KH0 B;  4PJO E;  1RAG B;  2W0Z A;  4M7A B;  4B6M A;  1EX4 A;  3CCS A;  2O4X A;  3SEM A;  1IB8 A;  3FB9 A;  4J9D A;  1MV0 B;  4J7I A;  1ZUU A;  2AZS A;  2DTO A;  3URG A;  1TH7 A;  4TVR A;  2PTK A;  2SRC A;  3CCE A;  5GAM g;  2D8H A;  2CZ7 B;  4RKU E;  4M77 D;  2KYM A;  4IUT A;  4KGX B;  3CXC S;  4O5V A;  2DTH A;  3G7Z A;  1U5S A;  2DRK A;  3OYH A;  1BI0 A;  1RAI B;  1I8F A;  1TTH B;  3HFN A;  1VQ7 A;  3OYE A;  1R0C B;  4WCI A;  4LE9 A;  3UF4 A;  3E9G A;  4BY6 B;  1S72 A;  2ABL A;  3EGD B;  1M27 C;  3GF5 A;  2KVQ G;  3RKY A;  1VA7 A;  5FLX E;  1BKB A;  2D9T A;  2XMF A;  4C0D B;  1RAF B;  1UFF A;  2I2L A;  1WHL A;  4M78 B;  1D0Z A;  4XTU A;  1EIF A;  3JB9 H;  2FZC B;  2K3X A;  5FU6 C;  1WFW A;  3OYG A;  2VWF A;  4F14 A;  5GMK m;  1M2V B;  2QQB A;  5C0M A;  1VQN T;  3CCS Q;  3KUF A;  2YLB A;  5GAO l;  1PNJ A;  2RJF A;  4JLG A;  3VRY A;  4FT2 A;  2AKK A;  1SKU B;  4OGC A;  4FW1 A;  5KYY A;  2KI7 A;  3CCE Q;  1JO8 A;  1BU1 A;  3E19 A;  1KD1 R;  3QZ5 B;  1IO6 A;  4M7D F;  4FW2 A;  1R0B G;  1C6V X;  2HCK A;  1NJI C;  1K8A U;  2RHI A;  3QG1 A;  1SRM A;  1VQ7 Q;  4OB0 B;  2O9V A;  3A8G B;  2QDY B;  1OUL A;  2DA9 A;  4QVD A;  1S72 Q;  2RK2 A;  3EAE A;  2VAS A;  2E4H A;  2DXT A;  2LCL A;  4HVU A;  5LJ5 e;  4IUV A;  1O9S A;  3MO8 A;  4E7K A;  2MOX A;  2QA4 T;  5CQY A;  3C94 A;  3VUZ A;  2O9S A;  3SHW A;  1Q7Y R;  1Y57 A;  2M16 A;  1XJW B;  1M3B A;  2DVE A;  4AMC A;  2QK0 A;  2F5T X;  4C0Z A;  3OYD A;  3QXE B;  1ZUK A;  5GAN 8;  1O75 A;  4D6W A;  1VIF A;  1KQS P;  4J9C A;  1KC8 R;  2CP5 A;  3TSZ A;  3MEA A;  1JB0 E;  4E47 A;  1UG1 A;  2YRC A;  3L1A A;  4AFU C;  2OAU A;  2R57 A;  4RTT A;  2E10 A;  4A63 B;  2KSS A;  2X3W D;  2J7I A;  3RKW A;  1TUC A;  3V8K A;  3IQL A;  1LCK A;  1UJ0 A;  4X9C A;  1VQ8 T;  1KSW A;  2CT4 A;  3GLX A;  1JJ2 S;  4E2F B;  4PFO A;  3EG3 A;  2HSP A;  4HCB A;  5GAN e;  4E7H A;  1AT1 B;  3EHQ A;  5I2S A;  5GAN 4;  2O4X B;  2DTI A;  1G2B A;  2D1X A;  2J06 A;  3CC7 A;  2VUB A;  4Z88 A;  1D1C A;  3OS1 A;  3OW2 P;  1BI2 A;  3RIR A;  3X28 B;  2KGT A;  1QLY A;  2X4Y A;  1DJ7 B;  4FSS A;  3E9F A;  3CCM Q;  1FXX A;  2YLC A;  4PL6 A;  3R6N A;  5FRN A;  5GMK e;  2EQI A;  4PJN A;  1M1K U;  3JCM e;  3DLL A;  1CKA A;  3JB9 F;  2X3X D;  5LL6 S;  2E3H A;  4DA4 A;  1Y96 B;  1KK7 A;  2V26 A;  1K1Z A;  4C8Q B;  2A7Y A;  2MCN A;  1YNZ A;  4PLL A;  1X27 A;  4E6R A;  1NYG A;  6AT1 B;  4JS5 A;  1TSF A;  4J9I A;  2V8J A;  4Z02 A;  1AWO A;  2ECZ A;  5KYX A;  2L8D A;  3QHS A;  4XTY A;  4BE2 A;  2JUF A;  4M7D A;  1BI3 A;  1QVP A;  2LDM A;  4D8K A;  5GMK l;  3A98 A;  5C6S A;  2QTV A;  3UDC A;  3M59 A;  3GNG A;  1BI1 A;  2EGE A;  4K11 A;  1YI2 A;  3CC7 Q;  4P5N A;  5KYY B;  2XDD A;  2KEA A;  2QDL A;  3VS6 A;  3V8L A;  3O5Z A;  4J9E A;  4C92 E;  2HNI A;  2ED1 A;  2YDL A;  4M4Z A;  5LJ3 j;  1RAH B;  1W6X A;  4NOY A;  3CCQ A;  1IRX A;  1OU8 A;  3CBM A;  1V1C A;  1M1K R;  1Y7X A;  1X2Q A;  3CME A;  4M7A E;  1YJW A;  2HKQ B;  1LJO A;  2QAZ A;  2DET A;  1WQ7 A;  4QW2 A;  3LWI A;  1I1J A;  3VS7 A;  4DBH A;  4CC7 A;  1VQP T;  3CMA Q;  2A0F B;  2CP2 A;  1T3S A;  3G71 Q;  2P0K A;  5LJ5 h;  2FRW A;  1VQL Q;  2OTJ Q;  3RUX A;  1J3T A;  4FM4 B;  2JTM A;  4E7J A;  4PK4 A;  1NEG A;  4EPC A;  2HQE A;  3LYI A;  3EGU A;  2CSQ A;  2DIL A;  1BBZ A;  1YBY A;  3CCR T;  1ZSZ C;  2HQH A;  1YI2 Q;  5GJV B;  3A8O B;  2M0O A;  3A5Z B;  4JZ4 A;  4MDW A;  3FRN A;  4GY5 A;  5IN1 A;  5GAN 6;  3JCM Q;  1BCO A;  2OTL A;  1M30 A;  1VQ4 A;  4M7D C;  1PRM C;  4LDV A;  1HJD A;  2HEQ A;  4M78 E;  5CQX A;  2DK3 A;  2J6O A;  2P4R A;  3CCQ Q;  2EPD A;  3VJP A;  3CXC P;  2JN0 A;  4E7L A;  1T3L A;  3EFS A;  4MZP A;  1WYX A;  4KUL A;  1QMC A;  4M75 F;  1ABO A;  4EMK A;  1IGQ A;  2IIM A;  3H8Z A;  4DBQ A;  3QDF A;  1GFC A;  2A37 A;  2D0Q B;  3MET A;  2MYS A;  2EBP A;  3FJ5 A;  4LDW A;  4JLI A;  5GAM f;  2K2V A;  1VQ9 A;  4F7U F;  4LXC A;  3KFV A;  1WXB A;  2M02 A;  1ZQ1 A;  5GMK h;  1AVZ C;  3JCM h;  1K73 C;  1ZA2 B;  1M5Q 1;  9ATC B;  1PD0 A;  3FJP A;  3CCS T;  5HY6 A;  5KE2 A;  1VQO Q;  2OTL Q;  3MJX A;  1VQ4 Q;  1Q86 R;  1M90 R;  2GNC A;  3CCE T;  5DY9 A;  2G6F X;  2C0I A;  2CUB A;  2ZPH B;  4LUE A;  5KYX B;  4NS5 A;  1JU5 C;  1KQ2 A;  3CC2 Q;  1AHJ B;  5EG2 A;  2EYY A;  2X4J A;  2X35 A;  2Y4Y A;  1JBM A;  4DBF A;  4J9H A;  2ZPE B;  2PZ1 A;  4ATO A;  1T0H A;  1VQ7 T;  4N4G A;  1RAC B;  4RTW A;  2YRD A;  1QVF A;  3ZEH A;  2V8K A;  1D1B A;  1S72 T;  4A4H A;  1OPK A;  3M57 A;  2CP6 A;  3L2V A;  1K9M U;  2EGA A;  2L3S A;  2XI9 A;  5GAO r;  3HKS A;  3EG0 A;  3TRE A;  3PTA A;  2KYB A;  3TEE A;  3CCJ A;  5CCA A;  1VQ9 Q;  3M9Q A;  3SWN A;  4CI0 C;  1Q81 U;  3OYB A;  2IPO B;  4JJB A;  3ZL7 C;  3CBP A;  4AFQ C;  1SRL A;  1M1F A;  2LT4 A;  2JS0 A;  2MPX C;  2RI2 A;  5GAN 5;  3X24 B;  1E6G A;  3JB9 D;  5GAM j;  1VQ6 A;  4RG2 A;  2CZ1 B;  2R58 A;  4M77 A;  2QI2 A;  2RM4 A;  1QVG A;  3V8J A;  2BUD A;  1JXM A;  2E64 A;  5GAM d;  2GTJ A;  2A3L A;  2DER A;  3M58 A;  1YJN A;  5IXF A;  1LVK A;  3CCR A;  1JJ2 P;  2P0P A;  5GAN g;  3JB9 I;  1WNL A;  1BIA A;  4A4F A;  2COZ A;  1H3Z A;  3QKJ A;  2ZPI B;  4C8Q E;  1XOV A;  1IHV A;  1K8A C;  2LNV A;  1IZ6 A;  2F69 A;  4C92 D;  3OY9 A;  2DD5 A;  3RKX A;  5AYF A;  2EW3 A;  2DZ9 A;  2K3B A;  3CCJ Q;  4GLK A;  1RAB B;  3TSW A;  2VYT A;  1TXQ A;  4LDX A;  4M7A D;  3A1P A;  3CPW S;  3OMG A;  1PC0 A;  2CDT A;  2QQA A;  5FWC A;  3A8M B;  4OVA A;  2LT1 A;  3TU4 K;  3MKD A;  4FYV B;  5CKE A;  5D7U A;  2DL5 A;  2RO0 A;  1VQ6 Q;  4EMK B;  3WXM B;  1Q82 U;  1MGQ A;  3LX7 A;  3HPW A;  2L3Q A;  2LJ3 A;  5IT9 E;  2C0T A;  4PJO F;  3HL8 A;  2LMJ A;  4QVC A;  3M54 A;  3VS2 A;  1RL2 A;  1ZA1 B;  1WXU A;  4O6J A;  1MMN A;  2KY9 A;  1HYO A;  3DKM A;  1MMD A;  4E7Z A;  1NZ9 A;  4QQG A;  1FMK A;  4FYW B;  2CP3 A;  2EVR A;  2YUO A;  1QKW A;  4M77 C;  4UC4 A;  4X1V A;  3CC7 T;  1UHF A;  2FPF A;  1GBR A;  1FMW A;  4Q5W A;  5J26 A;  2RJE A;  1G3W A;  1PSE A;  2JOY A;  1KD1 U;  3VS0 A;  1VQM A;  3QJ6 A;  1JRI A;  2HMA A;  3LH0 A;  3VUB A;  2ROL A;  1ZLM A;  2KT8 A;  3OSS C;  1WIE A;  1MMG A;  3RNJ A;  5D6W A;  3TQ7 P;  1W1F A;  1QWF A;  5HK3 A;  2J6F A;  3UA7 A;  2ZGW A;  2LNH B;  4M75 C;  3RBB B;  1Q82 R;  3PNW C;  4OMM A;  5A0L A;  2RJC A;  3CMA T;  4ELZ C;  4M75 D;  2XK0 A;  2BTT A;  3NMZ C;  2DMO A;  1VQL T;  1ZBX A;  1Q7Y U;  4MML A;  3F70 A;  4KGZ B;  1SSF A;  3SWN B;  1TU0 B;  1KC8 U;  2F2W A;  2LQ8 A;  1R8O B;  2PUK B;  2QG9 B;  1HD3 A;  1YI2 T;  2EYQ A;  1D1A A;  2EJF A;  4R0K A;  1YN8 A;  2CRE A;  1YFN A;  2DF6 A;  3JCM W;  2BZ8 A;  2P4T A;  3HFO A;  3LWH A;  3CPW A;  3X20 B;  3QO3 A;  3RES A;  1VQM Q;  2HKN A;  5GAN 7;  4M77 B;  4JRI A;  2XDB A;  2Z0W A;  1D0X A;  5LJ3 e;  2HBP A;  3V7S A;  3LGF A;  3VS5 A;  4BE1 A;  3M56 A;  1FYN A;  1PSF A;  2K7A A;  3CCQ T;  4XTV A;  4XAX B;  2E3I A;  1MMA A;  3A8H B;  3QZ9 B;  3J7A F;  3OS2 A;  3CME T;  1YJW T;  4HVW A;  5I11 A;  3A8L B;  3M0S A;  2RPN A;  1C0M A;  4N4H A;  2PVO B;  1H8K A;  3OBW A;  4EMG A;  4HCK A;  2WSC E;  1AEY A;  3VV0 A;  1CKB A;  1C1A A;  1N27 A;  2D8J A;  1B7T A;  1JEG A;  2DL7 A;  3OYJ A;  2PNI A;  4M7D G;  4DOW A;  3CD6 A;  3NTI A;  1YJ9 Q;  5FU6 B;  3CCM A;  1PKS A;  2EQK A;  3OS5 A;  1K0X A;  1WDX A;  3P8B B;  2K5F A;  3QSU A;  2OTL T;  1QKX A;  1WA7 A;  2FB7 A;  2RH2 A;  1VQ4 T;  3VKI A;  3VYH B;  2LRQ A;  2ZCF B;  3QII A;  1VUB A;  1NPR A;  5CKF A;  3HP9 A;  1AWJ A;  2X9H A;  4RTU A;  1UGS B;  4AG1 C;  3MEW A;  1EZZ B;  3CEY A;  1SPK A;  4C8Q D;  3G6E A;  2A28 A;  1N8R R;  2BIV A;  2KQW A;  1SHF A;  1W2B A;  4JZ3 A;  4KBM B;  3CC4 Q;  4J9G A;  3M4Y A;  4FYX B;  4HCZ A;  1D3B A;  1YP5 A;  2R5A A;  3E1S A;  3CD6 Q;  2XHC A;  1VQ9 T;  1AZE A;  1TUD A;  1NG2 A;  1WX6 A;  1HSQ A;  4XU1 A;  1ZSZ A;  1WZO A;  4PFZ A;  2JM9 A;  2HSE B;  4VUB A;  1Y0M A;  3V7R A;  3LGL A;  3NGP A;  1S1N A;  4PJO C;  3BFM A;  2YT6 A;  4J7F A;  3CMA A;  1UGR B;  3G71 A;  1TUG B;  5EC7 A;  1AD5 A;  1VQL A;  2OTJ A;  2VB6 A;  2ENM A;  3QWX X;  3JCM J;  3M0U A;  3QDR B;  4ZGD B;  4PJO D;  5LJ5 f;  2YRV A;  3FIF A;  1OI1 A;  2ZPF B;  4PFP A;  3G6E Q;  1ZHI A;  4OMO A;  4OMN A;  5I21 A;  1R77 A;  3OYY A;  4GLM A;  4J6W A;  4NL2 A;  3JSC A;  2RMO A;  4RUG A;  2DE0 X;  5ECA A;  4C92 F;  1NYF A;  1M4Z A;  1PWT A;  1WGS A;  2CYZ B;  1SSH A;  1XNI A;  2KNB B;  2MF2 A;  3OYM A;  3L2W A;  4RTZ A;  5LJ3 h;  2EKH A;  4M7A F;  2PVD B;  3CCJ T;  1NJI U;  3VS3 A;  2QEX A;  1PM3 A;  2DFU A;  2XD0 A;  4BAC A;  4FCY A;  2MWP A;  2WSF E;  4AFS C;  3CPW P;  1K9M C;  4DBR A;  3I56 A;  2RN8 A;  3WVE B;  1M8V A;  3DB3 A;  1QCN A;  2RHX A;  5FU7 C;  4BUG A;  1VYU A;  4HT9 A;  3C4S A;  1M9S A;  4EMH A;  2NWM A;  1B34 A;  1VQ6 T;  1UGP B;  5GAN f;  1Q81 C;  1CSK A;  1Y71 A;  2XG8 D;  2EYX A;  2JVV A;  3EFO A;  2JT4 A;  3OQ5 A;  1QVF S;  2EYW A;  3QBY A;  1YJN T;  4LDU A;  4X9D A;  2JNG A;  4CC3 A;  4BB7 A;  3REA B;  2RB6 A;  2HL5 C;  5DLO A;  5GAO q;  2DXB A;  1EFN A;  1K0S A;  4OML A;  3UWN A;  1YHQ A;  2V1R A;  4M78 F;  3EGX A;  3KXT A;  2AT1 B;  3UAT A;  4PJM A;  1RI9 A;  2FZK B;  1K76 A;  4CC2 A;  3JB9 J;  2LZ6 B;  3JCM f;  1VQO A;  1Q86 U;  1M90 U;  4ANJ A;  3DB4 A;  5M9O A;  3V7C A;  3DLM A;  3I9Q A;  5LJ5 d;  1TWB A;  2Y90 A;  2QEX Q;  3H0F A;  3CQT A;  3ZFJ A;  1NJI R;  2RQW A;  2LCS A;  3CC2 A;  2AZV A;  2C0O A;  2H3E B;  4KGV B;  1X2K A;  4GBQ A;  3I56 Q;  2GQI A;  5CAI A;  1QVG S;  3M55 A;  1HK9 A;  4D8D A;  4JUV A;  3LW5 E;  3RDV A;  5IAY A;  1K9A A;  2RA2 A;  2E70 A;  1IHW A;  1D3B B;  2IG0 A;  2L89 A;  5DM7 R;  3CCU A;  2F2X A;  2K3Y A;  1I81 A;  4M77 G;  1M3A A;  4XK8 E;  4RCB A;  4A4K A;  4J9F A;  1WXT A;  2NLU A;  4R55 A;  3OYF A;  1I5L A;  1YCY A;  3G1J A;  3SB2 A;  2BE7 D;  4R56 A;  2EQJ A;  3CBO A;  3OB9 A;  4FSX A;  1ACM B;  2FL7 A;  1YIJ A;  1N9S A;  4EIK A;  1U06 A;  1YHQ Q;  1RAE B;  1ZSZ B;  1IXD A;  5CK9 A;  2NUP A;  4FIB A;  3I55 A;  3OBY A;  5GAN d;  3N5B B;  4LUD A;  4MMK A;  2KE9 A;  4C92 A;  3HTR A;  5D6X A;  4E7I A;  2EFI A;  3UA6 A;  2A08 A;  1GXI E;  4M75 G;  2Y4X A;  2XIC A;  2DL4 A;  1OYX A;  1VYT A;  1YIT A;  2CUD A;  4FT4 A;  1VQM T;  4MZT A;  5L8R E;  4JJD A;  4M7D B;  3M53 A;  4M7A A;  1E7O A;  1QP2 A;  2QGF B;  3AT1 B;  4JDS A;  4LNP A;  1N9R A;  2MI6 A;  2JM8 A;  4F7U G;  1KD1 C;  2LX7 A;  3JCM d;  2MMP A;  1VQ8 Q;  2E5Q A;  5LJ5 g;  2EWN A;  3CCU Q;  3C95 A;  5DLQ E;  2HDA A;  3BDU A;  4XTX A;  3L2Z A;  4L59 A;  1VIE A;  1X43 A;  1N5Z A;  4JJN K;  5IH2 A;  3JCM b;  1NPP A;  2CZ6 B;  1RAD B;  1WLP B;  2BE9 B;  2COY A;  1AWW A;  1OZ3 A;  4QQ6 A;  4ZNX A;  2M0Y A;  1YIJ Q;  3RER A;  3P8H A;  2GF7 A;  2KAF A;  1UGQ B;  3I55 Q;  4PLI A;  2V8I A;  2JXB A;  3QYG B;  1UHC A;  5GAM h;  1RLP C;  2CSI A;  4J8O A;  1Q7Y C;  5FRM A;  1LPL A;  1B34 B;  3ASK A;  5KCH A;  3LH5 A;  3RMQ A;  2M9U A;  1YIT Q;  3U23 A;  1LOJ A;  5I22 A;  2O2O A;  2P0Q A;  1KC8 C;  3EFO B;  2RI5 A;  2A36 A;  2CT3 A;  2XID A;  4Y28 E;  2LQW A;  1QW1 A;  3QUI A;  4C8Q F;  3HRU A;  2LP5 A;  1U1S A;  2X4X A;  2EYZ A;  4C92 C;  3C12 A;  3EGX B;  3FEO A;  1NEB A;  3SDZ A;  3M0T A;  1AZG B;  5GAO p;  4ZGJ B;  4M75 A;  1SHG A;  1OZ2 A;  2B8A A;  2ZZD A;  3G4S A;  2GCX A;  2K2M A;  2O31 A;  4HVV A;  2J05 A;  5CVI A;  4BI4 A;  4M7A C;  5CIU A;  2EIF A;  1UGV A;  4Z8A A;  4ME7 A;  1GCQ C;  3CD6 T;  4WF2 A;  2OJ2 A;  4ZTF A;  5CKH A;  5IHN A;  3CCM T;  4ELY C;  3H6Z A;  3H0I A;  4F7U A;  2QGG A;  1KQS A;  3JCM g;  4E7S A;  1MUZ A;  2ED0 A;  4RTY A;  1IGU A;  4OMF B;  1NBE B;  5KYU A;  4JPB W;  5J3B A;  2EAY A;  2AHJ B;  3L2R A;  1E6H A;  3MEU A;  1BB9 A;  4AT1 B;  5GJW B;  3PVL A;  3NHN A;  2QXF A;  4ZTJ A;  4RTX A;  3CCL A;  4RTV A;  2XU8 A;  4BY6 C;  2DAQ A;  2DPP B;  3NTK A;  2KMT A;  1AOJ A;  2OI3 A;  4N0A C;  3GPL A;  2C06 A;  4M78 C;  4F04 B;  5J39 A;  2AIR B;  3O8V A;  3G6E T;  4BDY A;  2RQT A;  1MHN A;  3EG9 A;  2LQN A;  2FG0 A;  4WTO B;  1MNE A;  4J83 A;  3S3O A;  1HXD A;  2B86 A;  3G4S Q;  1VQK A;  4M78 D;  4C0G A;  2BKD N;  3OW2 A;  2CZ0 B;  4PJO G;  4OB2 B;  3JCM c;  1U1T A;  1D09 B;  1RI0 A;  2E5K A;  1WHK A;  2ZPG B;  1QQJ A;  2CH4 A;  1WJQ A;  4A4G A;  2NUZ A;  3PT9 A;  1H3H A;  4F16 A;  2QYZ A;  2FVU A;  3R6O A;  3JCM X;  5FRO A;  1VQ5 A;  3BE3 A;  3L2Q A;  3HRS A;  2VC8 A;  1QCF A;  1RAA B;  4IUP A;  2IVW A;  2L0A A;  3M0Q A;  3M0P A;  2H8H A;  4HXJ A;  2YUQ A;  3G71 T;  5CKD A;  1NE8 A;  3CCL Q;  2OTJ T;  1M1K C;  2ESW A;  2GGR A;  3WVD B;  1W2B S;  1B07 A;  1WPY A;  4KH1 B;  1I5O B;  1QVF P;  1Y96 A;  1UEB A;  4DOV A;  4C8Q A;  4XU0 A;  1I0C A;  2DBK A;  2KRS A;  4CRI A;  1YJ9 A;  4N4I A;  7AT1 B;  1K73 R;  1YCS B;  1WHJ A;  2LC4 A;  1VQK Q;  2VXF A;  3QJY A;  1I4K 1;  4PJL A;  1GL5 A;  3PIP A;  2JTE A;  1WHG A;  2DEQ A;  1OPL A;  3REB B;  2HD0 A;  1UEC A;  4QKU A;  3ZBD A;  2QEX T;  1JXO A;  2K5L A;  4XU3 A;  1M8M A;  2YXY A;  2L3R A;  3PFS A;  4IIM A;  4JRK A;  4ZN3 A;  1GFD A;  1H92 A;  4HT8 A;  1P92 A;  1N8R U;  1VQ5 Q;  3I56 T;  3VYG A;  2JTF A;  2KDS A;  1QVG P;  2JW4 A;  5FW9 A;  2RJD A;  4PKC C;  2RNA A;  1ABQ A;  4M75 B;  2RQV A;  4C5E A;  2EJG A;  3UPU A;  3CC4 A;  2DRM A;  4LD9 K;  5I2M A;  1WQW A;  4PJO A;  4M7D E;  4IKF A;  1BYM A;  4AFZ C;  1W4S A;  2DX1 A;  2DXC A;  4DEX A;  5KYN A;  4QT7 A;  4F7U B;  4BDZ A;  2VGN A;  2XKO C;  2WSE E;  1V76 A;  4IUR A;  4V2S A;  3CCV A;  3EH1 A;  5KYU B;  1X6G A;  2G3R A;  1UTI A;  1SG5 A;  1YHQ T;  3MP8 A;  3EFR A;  3JCM V;  2GFU A;  2P84 A;  1SEM A;  1X75 C;  4B9W A;  1VQO T;  4C5H A;  2KRM A;  2FHD A;  1F1B B;  2FRY A;  3SFM A;  2RHZ A;  2K79 A;  5L23 A;  1QWE A;  4C8Q C;  1SF9 A;  4X34 A;  4KUI A;  1UUE A;  3PVQ A;  3OYA A;  3CC2 T;  3CXC A;  4KUD K;  2E65 A;  4CC4 B;  1Q86 C;  3AHU A;  4IUU A;  2KRN A;  1G3S A;  1M90 C;  3EH2 A;  2JS2 A;  3MP6 A;  3EG9 B;  1KHI A;  2VVK A;  1KIK A;  2F1L A;  2AKL A;  1OX8 A;  4JRP A;  2QAS A;  5CO7 A;  3HSB A;  1K8A R;  2BZY A;  3NPF A;  3CCU T;  4JS4 A;  2RD1 A;  1YWO A;  2K4Y A;  1OEB A;  2NYS A;  5CKB A;  2VV5 A;  4HKE A;  1WHM A;  1ZX6 A;  2X51 A;  2MWO A;  3OS0 A;  4J6X A;  2DLP A;  5LJ3 f;  3CCV Q;  2RHY A;  2YSQ A;  4AG2 C;  1YIJ T;  1ARK A;  3ME9 A;  4XTZ A;  5KE3 A;  5GAN 2;  1N6A A;  3S6W A;  3I55 T;  2GQV A;  5KYW A;  2K6D A;  2D0N A;  2O01 E;  1YIT T;  4OB3 B;  3X25 B;  5AT1 B;  4KRT A;  2PQW A;  4ORZ A;  3RR6 A;  1ZUY A;  1VOM A;  2KK4 A;  2DYI A;  3D7S B;  2NUT A;  2PU9 B;  2K57 A;  2DIQ A;  1XQH A;  3GBQ A;  2ATC B;  1NM7 A;  4RG8 A;  3MPU B;  2HZY A;  3KBG A;  3JB9 G;  1ZSG A;  3NFC A;  1JQQ A;  2E41 A;  1QP3 A;  2CP7 A;  4RMO A;  2LCC A;  5CR2 A;  2QTX A;  2EQU A;  4A54 A;  4XTW A;  1VQN A;  4II1 A;  3CPF A;  5GAO n;  2D6F A;  4C0F A;  1UB4 A;  2COW A;  1LNX A;  4QVZ A;  4F17 A;  2M1H A;  2KBT A;  3QYH B;  3HRT A;  1MV3 A;  4OMQ A;  2FPE A;  2PVG B;  2CP0 A;  4JRQ A;  2QQS A;  2QQR A;  1BK2 A;  1ZBJ A;  4Z89 A;  5GAM e;  4LN2 A;  1UE9 A;  2W10 A;  5HCK A;  2F2V A;  2DM1 A;  2HAX A;  4C92 G;  3Q1J A;  4MZM A;  1VYV A;  2DVJ A;  2DEU A;  1H64 1;  1I07 A;  1M1G A;  1NLO C;  2JJ9 A;  2YHT A;  1B3Q A;  4PJO B;  4FYY B;  2KR3 A;  1RUW A;  2MAM A;  5LJ3 d;  4A53 A;  4M7A G;  2BZX A;  2CKK A;  3JV3 A;  4DEY A;  2X4W A;  1XTD A;  4BI3 A;  3OYC A;  1JJ2 A;  2AK5 A;  2E6Z A;  5FWB A;  2E12 A;  3EG2 A;  2LX9 A;  2JZ2 A;  3M0R A;  1AWX A;  2QA4 A;  5LJ5 j;  4PJJ A;  1X01 A; 
#chains in the Genus database with same CATH homology
 4F7U A;  1WJR A;  3QYG B;  5GAM h;  3GLX A;  4J8O A;  1Q7Y C;  1JJ2 S;  5FRM A;  1KQ1 A;  2ZGW A;  3G4S T;  4M75 C;  1B34 B;  3ASK A;  5KCH A;  3RMQ A;  4HCB A;  2M9U A;  5GAN e;  4E7H A;  2DO3 A;  5I2S A;  5GAN 4;  1LOJ A;  3PNW C;  2O4X B;  2DTI A;  5A0L A;  3BDL A;  2P0Q A;  2RJC A;  2XDP A;  1KC8 C;  4ELZ C;  3L42 A;  3CC7 A;  2RI5 A;  2VUB A;  4M75 D;  5GMK i;  3CMA T;  2XK0 A;  2CGH A;  2XID A;  4Y28 E;  1VQL T;  1ZBX A;  4KT0 E;  1QW1 A;  3OS1 A;  4MML A;  1Q7Y U;  3QUI A;  3M4G A;  1Y07 A;  4C8Q F;  1BI2 A;  3F70 A;  4M77 F;  3HRU A;  1SSF A;  3RIR A;  3INZ A;  4A4E A;  1U1S A;  3X28 B;  3SWN B;  2LVM A;  2DKG A;  2X4X A;  2X4Y A;  2K5I A;  4BD3 A;  4C92 C;  3C12 A;  1DJ7 B;  4OB1 B;  4M78 G;  1U8R A;  1KC8 U;  3FEO A;  1WJS A;  3E9F A;  3M5A A;  5FU7 B;  3OYN A;  1FXX A;  2YLC A;  4PL6 A;  3SDZ A;  2LQ8 A;  1VQ8 A;  1BIB A;  1R8O B;  2PUK B;  5FRN A;  5GMK e;  4M7D D;  5GAO p;  4ZGJ B;  1YI2 T;  2EYQ A;  4M75 A;  4M77 E;  1M1K U;  3JCM e;  1OZ2 A;  3DLL A;  2B8A A;  2EJF A;  2ZZD A;  3G4S A;  2GCX A;  3JB9 F;  3ER0 A;  5LL6 S;  4OF1 A;  3JCM W;  2P4T A;  5CVI A;  4BI4 A;  3CCL T;  3HFO A;  4DA4 A;  1Y96 B;  3LWH A;  3CPW A;  3X20 B;  5GAN h;  2EJ9 A;  3QO3 A;  5CIU A;  2A7Y A;  2EIF A;  3RES A;  4C8Q B;  5GAN 7;  4M77 B;  4PLL A;  4JRI A;  1KQS A;  2XDB A;  4JS5 A;  5GAN j;  1Q82 C;  4ME7 A;  5LJ3 e;  2HBP A;  2V8J A;  4Z02 A;  3V7S A;  3LGF A;  3OYK A;  4BE1 A;  3M56 A;  2DIG A;  3CD6 T;  4WF2 A;  4ZTF A;  3MCA B;  3RMS A;  5CKH A;  3OYL A;  3CCM T;  2L8D A;  3H6Z A;  3QHS A;  4XTY A;  1PSF A;  2JUF A;  1BI3 A;  1QVP A;  3JCM g;  4ELY C;  4XTV A;  2LDM A;  4XAX B;  3CCQ T;  5GMK l;  3A8H B;  4OMF B;  3QZ9 B;  5C6S A;  3J7A F;  4M75 E;  3OS2 A;  3UDC A;  1KHC A;  3M59 A;  5J3B A;  1VQK T;  4LDY A;  4OGE A;  3CME T;  3GNG A;  4YTL A;  1YJW T;  2EAY A;  2AHJ B;  3L2R A;  3A8L B;  4Y91 A;  1KQS S;  1BI1 A;  3MEU A;  4N4H A;  5LJ3 g;  2DJZ A;  5HKC A;  1YI2 A;  2PVO B;  3OBW A;  4EMG A;  2WSC E;  4P5N A;  5GMK j;  2QXF A;  2XDD A;  2F5K A;  4ZTJ A;  3CCL A;  3VV0 A;  2XU8 A;  4BY6 C;  2DAQ A;  1N27 A;  1V29 B;  3V8L A;  4C5I A;  3OYJ A;  2DPP B;  4F7U E;  3NTK A;  5A2Q E;  5KH6 A;  2KMT A;  3GNF B;  3OSV A;  4M7D G;  4N0A C;  4DOW A;  3GPL A;  4C92 E;  1VQ5 T;  2C06 A;  4M78 C;  2HNI A;  3CD6 A;  5J39 A;  3O8V A;  4ZN1 A;  3NTI A;  5LJ3 j;  3G6E T;  2FYK A;  4BDY A;  4NOY A;  5FU6 B;  3CCM A;  1MHN A;  2EQK A;  4ZGE B;  3CCQ A;  4J83 A;  3FDR A;  3OA6 A;  3S3O A;  1HXD A;  3HHT B;  3CBM A;  1VQK A;  3OS5 A;  4M78 D;  2LQK A;  2ZPB B;  1Y7X A;  3CME A;  3QPH A;  4M7A E;  1YJW A;  4C0G A;  3P8B B;  4HCC A;  1LJO A;  5A0G A;  1WQ7 A;  2BKD N;  2H3J A;  4QW2 A;  3LWI A;  2K5F A;  3QSU A;  3OW2 A;  4XQ3 A;  4MDX A;  2QQ9 A;  2R5M A;  2OTL T;  1G3Y A;  2FB7 A;  2RH2 A;  3PIO A;  2CZ0 B;  1VQ4 T;  4RCC A;  1VQP T;  4PJO G;  4OB2 B;  3JCM c;  1U1T A;  3VKI A;  2VXE A;  3VYH B;  4B9X A;  2P0K A;  2LRQ A;  3PMI A;  5LJ5 h;  1RI0 A;  2ZCF B;  3RUX A;  2ZPG B;  3QII A;  1VUB A;  1FX7 A;  4FM4 B;  3OW2 S;  2JTM A;  1YJ9 T;  1WJQ A;  4A4G A;  1NPR A;  3PT9 A;  4E7J A;  5CKF A;  3JCM P;  4EPC A;  3HP9 A;  2HQE A;  4N0A A;  3PMT A;  3LYI A;  2DD4 A;  4M78 A;  2FVU A;  3R6O A;  2CS7 A;  3JCM X;  5FRO A;  1UGS B;  1VQ5 A;  3GOX A;  3MEW A;  3J81 E;  3L2Q A;  3VU3 C;  1YBY A;  3CEY A;  3HRS A;  4L6V 5;  2VC8 A;  4C8Q D;  3JRZ A;  3X26 B;  3G6E A;  3CCR T;  2DZC A;  4IUP A;  2IVW A;  2BIV A;  2KQW A;  4NL3 A;  1W2B A;  3A8O B;  2M0O A;  4KBM B;  5CKD A;  1FWZ A;  2HQX A;  5A0D A;  3A5Z B;  3G71 T;  3UT1 A;  4MDW A;  1NE8 A;  3FRN A;  2RK1 A;  4EMK C;  3PGG A;  2OTJ T;  4GY5 A;  5GAN 3;  3M4Y A;  3NTH A;  1M1K C;  3TCJ A;  4HCZ A;  1D3B A;  5IN1 A;  5GAN 6;  3JCM Q;  2GFA A;  3WVD B;  2OTL A;  2R5A A;  5GAO m;  2PUO B;  3E1S A;  1VQP A;  1W2B S;  1VQ4 A;  4M7D C;  1WPY A;  4LDV A;  1Y96 A;  1UEB A;  4C5G A;  4DOV A;  4M78 E;  4C8Q A;  5CQX A;  4XU0 A;  2DK3 A;  2XHC A;  4CRI A;  1YJ9 A;  1VQ9 T;  1G5V A;  4N4I A;  3VJP A;  4XU1 A;  4LD6 A;  2JN0 A;  3OMC A;  4E7L A;  2LC4 A;  3BW1 A;  3J80 E;  3EFS A;  2VXF A;  3QJY A;  3CC4 T;  3OYI A;  1I4K 1;  4BE0 A;  4MZP A;  4PNO A;  2L5Q A;  5D6Y A;  3PIP A;  4KUL A;  2E6N A;  4HA8 A;  4DQ2 A;  1N8R C;  4VUB A;  3V7R A;  1X6O A;  3LGL A;  2LTO A;  4PJO C;  2EQM A;  3BFM A;  2DEQ A;  4J7F A;  1UGR B;  4M75 F;  3CMA A;  4EMK A;  3G71 A;  2HD0 A;  1VQL A;  2OTJ A;  3ZBD A;  2QEX T;  4FU6 A;  2K5L A;  4XU3 A;  3H8Z A;  3JCM J;  4C8Q G;  3QDR B;  3LLR A;  2L3R A;  3PFS A;  4ZGD B;  2D0Q B;  4PJO D;  5LJ5 f;  3MET A;  4JRK A;  4ZN3 A;  2YRV A;  3FIF A;  3CCV T;  4BI8 B;  3S3N A;  4HT8 A;  4LDW A;  1OI1 A;  3FC3 A;  1P92 A;  2ZPF B;  4IUQ A;  1N8R U;  3MHX A;  3VYG A;  2JTF A;  3I56 T;  2KDS A;  2RHU A;  1ZHI A;  3JAM E;  4JLI A;  5GAM f;  2K2V A;  5I21 A;  1VQ9 A;  2RJD A;  4PKC C;  4F7U F;  3OYY A;  1ZQ1 A;  4J6W A;  4NL2 A;  3JSC A;  4M75 B;  5GMK h;  3L2U A;  3MEV A;  4C5E A;  3JCM h;  1K73 C;  4C92 F;  1M5Q 1;  2EJG A;  2WAC A;  3UPU A;  3CC4 A;  4OP0 A;  3FJP A;  3CCS T;  4L5G A;  1M4Z A;  3FLG A;  2E1H A;  5HY6 A;  5I2M A;  5KE2 A;  4LD9 K;  1WGS A;  2CYZ B;  1WQW A;  1XNI A;  4PJO A;  4FL6 A;  2MF2 A;  2EKO A;  3SD4 A;  2VGM A;  3OYM A;  3L2W A;  4M7D E;  1KG1 A;  2RI3 A;  4IKF A;  1BYM A;  3T9N A;  5LJ3 h;  3GIB A;  3GP8 A;  3CCE T;  4C0D C;  1W4S A;  5DY9 A;  4M7A F;  2PVD B;  4EDU A;  3CCJ T;  1NJI U;  2DXC A;  4J6Y A;  2QEX A;  2ZPH B;  4XU2 A;  1K73 U;  4M7D A;  4NS5 A;  4F7U B;  4BDZ A;  2VGN A;  2XKO C;  3S3M A;  1KQ2 A;  2WSE E;  4QQD A;  2XD0 A;  4IUR A;  4BAC A;  4V2S A;  1AHJ B;  5EG2 A;  3CCV A;  2X4J A;  2X35 A;  2Y4Y A;  3MP1 A;  2MWP A;  3SWN C;  2G3R A;  4C92 B;  5KCO A;  1YHQ T;  1JBM A;  2WSF E;  3MP8 A;  3EFR A;  1K9M C;  3JCM V;  3I56 A;  4ATO A;  2ZPE B;  1G3T A;  2GFU A;  3DB3 A;  3WVE B;  1M8V A;  1X75 C;  2RHX A;  5HK0 A;  5FU7 C;  4BUG A;  1IRE B;  4B9W A;  1VQ7 T;  3BY7 A;  4J5Y A;  2DXU A;  4N4G A;  1VQO T;  4HT9 A;  3C4S A;  3P8D A;  4C5H A;  4PJO E;  1M9S A;  4EMH A;  1VQ6 T;  1B34 A;  2FHD A;  1QVF A;  1UGP B;  2V8K A;  4M7A B;  3ZEH A;  3SFM A;  5GAN f;  1S72 T;  2RHZ A;  1Q81 C;  1Y71 A;  2XG8 D;  3CCS A;  4A4H A;  2O4X A;  2JVV A;  3FB9 A;  3M57 A;  4C8Q C;  3L2V A;  1K9M U;  4J7I A;  4X34 A;  4KUI A;  2DTO A;  2XI9 A;  3URG A;  3OYA A;  5GAO r;  3CC2 T;  3HKS A;  3CXC A;  3OQ5 A;  3TRE A;  1TH7 A;  3PTA A;  1QVF S;  3QBY A;  4TVR A;  3CCE A;  1YJN T;  4KUD K;  2E65 A;  4LDU A;  1Q86 C;  3AHU A;  4IUU A;  5GAM g;  3TEE A;  1M90 C;  1G3S A;  4X9D A;  3CCJ A;  2JNG A;  2CZ7 B;  4RKU E;  5CCA A;  4M77 D;  4BB7 A;  5DLO A;  2RB6 A;  3M9Q A;  5GAO q;  2DXB A;  3MP6 A;  3SWN A;  4CI0 C;  4IUT A;  1Q81 U;  1KHI A;  3OYB A;  3CXC S;  4O5V A;  2DTH A;  3CBP A;  3G7Z A;  1YHQ A;  3UWN A;  4M78 F;  3KXT A;  4JRP A;  1M1F A;  2LT4 A;  5CO7 A;  3OYH A;  1BI0 A;  3HSB A;  2RI2 A;  1I8F A;  3HFN A;  5GAN 5;  3JB9 J;  1VQ7 A;  3OYE A;  3JCM f;  3X24 B;  3CCU T;  1VQO A;  1Q86 U;  1M90 U;  4JS4 A;  3JB9 D;  5GAM j;  2RD1 A;  2K4Y A;  5CKB A;  3DB4 A;  1VQ6 A;  4PLI A;  4RG2 A;  5M9O A;  2VV5 A;  4HKE A;  3DLM A;  3V7C A;  3E9G A;  4BY6 B;  5LJ5 d;  1S72 A;  2CZ1 B;  2Y90 A;  3GF5 A;  2RM4 A;  2R58 A;  2KVQ G;  2QI2 A;  4M77 A;  3RKY A;  1QVG A;  3V8J A;  2BUD A;  5FLX E;  1BKB A;  2MWO A;  2D9T A;  3OS0 A;  3ZFJ A;  4J6X A;  5LJ3 f;  2E64 A;  3CC2 A;  4C0D B;  2RHY A;  5GAM d;  1YIJ T;  2A3L A;  2I2L A;  3ME9 A;  4M78 B;  4XTZ A;  5KE3 A;  3M58 A;  4XTU A;  1EIF A;  5GAN 2;  1YJN A;  1Q82 U;  3JB9 H;  1N6A A;  5CAI A;  2K3X A;  3S6W A;  3I55 T;  3M55 A;  3CCR A;  1QVG S;  2GQV A;  1HK9 A;  5FU6 C;  4JUV A;  3LW5 E;  2P0P A;  3OYG A;  5GAN g;  5IAY A;  5GMK m;  2O01 E;  3JB9 I;  2QQB A;  1WNL A;  1BIA A;  2RA2 A;  4A4F A;  5C0M A;  2E70 A;  1YIT T;  4OB3 B;  1VQN T;  1H3Z A;  3QKJ A;  3X25 B;  3KUF A;  2ZPI B;  2YLB A;  1XOV A;  4C8Q E;  5GAO l;  2RJF A;  4JLG A;  1D3B B;  2PQW A;  2IG0 A;  1K8A C;  2L89 A;  2LNV A;  5DM7 R;  1IZ6 A;  3CCU A;  2K3Y A;  1I81 A;  4FT2 A;  4M77 G;  4XK8 E;  2F69 A;  4C92 D;  4OGC A;  3OY9 A;  2KK4 A;  2DD5 A;  4RCB A;  3RKX A;  5AYF A;  4A4K A;  2DZ9 A;  2NLU A;  4R55 A;  4E47 A;  3OYF A;  1I5L A;  2PU9 B;  4M7A C;  1YCY A;  4GLK A;  3SB2 A;  3E19 A;  4R56 A;  2EQJ A;  3CBO A;  3QZ5 B;  2VYT A;  2K57 A;  3OB9 A;  2DIQ A;  4BE2 A;  1XQH A;  4M7D F;  4FSX A;  4RG8 A;  4LDX A;  2FL7 A;  1NJI C;  1YIJ A;  1N9S A;  4M7A D;  3KBG A;  3CPW S;  3JB9 G;  1K8A U;  3OMG A;  2RHI A;  3NFC A;  2E41 A;  5CK9 A;  2QQA A;  1QP3 A;  4FIB A;  3I55 A;  3QG1 A;  3A8M B;  4OVA A;  2LT1 A;  3OBY A;  5GAN d;  4OB0 B;  3N5B B;  5CKE A;  4MMK A;  4RMO A;  3TU4 K;  4C92 A;  5D6X A;  2LCC A;  3A8G B;  2QDY B;  5CR2 A;  2EFI A;  2RO0 A;  4E7I A;  2QTX A;  1GXI E;  4M75 G;  2Y4X A;  2EQU A;  2XIC A;  3WXM B;  4A54 A;  1MGQ A;  4EMK B;  3LX7 A;  3HPW A;  1OYX A;  4XTW A;  4QVD A;  2RK2 A;  3EAE A;  1YIT A;  4II1 A;  1VQN A;  3CPF A;  4FT4 A;  2DXT A;  5IT9 E;  1VQM T;  4MZT A;  5L8R E;  5GAO n;  2D6F A;  4C0F A;  4M7D B;  1UB4 A;  1LNX A;  2LCL A;  3M53 A;  4QVZ A;  2M1H A;  3QYH B;  4PJO F;  4M7A A;  3HL8 A;  4QVC A;  4IUV A;  5LJ5 e;  3HRT A;  3M54 A;  1QP2 A;  2PVG B;  1O9S A;  3MO8 A;  4E7K A;  4JRQ A;  4JDS A;  2QA4 T;  5CQY A;  3C94 A;  1RL2 A;  2QQS A;  2QQR A;  3VUZ A;  1N9R A;  2MI6 A;  4O6J A;  5GAM e;  2M16 A;  4F7U G;  1KD1 C;  2KY9 A;  2DVE A;  3DKM A;  2F5T X;  4C0Z A;  3OYD A;  4C92 G;  3JCM d;  3QXE B;  2HAX A;  1NZ9 A;  3Q1J A;  4QQG A;  5GAN 8;  2MMP A;  1O75 A;  4D6W A;  1VIF A;  4MZM A;  2E5Q A;  1H64 1;  1M1G A;  2EWN A;  2YHT A;  5LJ5 g;  4PJO B;  4M77 C;  4UC4 A;  3C95 A;  5DLQ E;  3CC7 T;  3BDU A;  3MEA A;  1JB0 E;  4Q5W A;  4XTX A;  5J26 A;  2MAM A;  2RJE A;  1G3W A;  3L1A A;  3L2Z A;  1VIE A;  4L59 A;  1PSE A;  2JOY A;  5LJ3 d;  4A53 A;  1KD1 U;  4M7A G;  4JJN K;  3JCM b;  1NPP A;  2OAU A;  2CZ6 B;  2R57 A;  1VQM A;  2CKK A;  2E10 A;  1JRI A;  3QJ6 A;  2KSS A;  1XTD A;  2X4W A;  3LH0 A;  4BI3 A;  3VUB A;  1OZ3 A;  3OYC A;  1JJ2 A;  4QQ6 A;  3RKW A;  2E6Z A;  2E12 A;  3V8K A;  3OSS C;  3RER A;  2LX9 A;  2JZ2 A;  5D6W A;  3P8H A;  2QA4 A;  2GF7 A;  2KAF A;  5LJ5 j;  1UGQ B;  4X9C A;  1X01 A;  2V8I A;  1VQ8 T;  5HK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...