3QUIA

Crystal structure of pseudomonas aeruginosa hfq in complex with adpnp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
SKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hfq
publication title Hfq binds ribonucleotides in three different RNA-binding sites.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
total genus 15
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3quiA00
4M75C 1HXDA 4N0AC 5GANg 2CGHA 3L1AA 5GAMe 3RKWA 4C8QA 4M77F 4PJOA 1X01A 4J5YA 2DZ9A 3SWNA 3JB9D 4M75D 5GAN4 3JB9G 3BY7A 1U1SA 3RKYA 1N9RA 1U1TA 3JB9J 4M7DC 3JCMV 3V7SA 4C92C 4XQ3A 2YHTA 4A53A 4NL2A 3V8JA 4XU2A 2RM4A 4M78C 3M4GA 4M7DD 3QO3A 4JUVA 1M5Q1 5LJ3f 4C92D 1LNXA 4HA8A 4PNOA 5GMKe 3PGGA 1M8VA 4M77G 2EJFA 2EAYA 5LJ5e 5GMKl 5GAOq 5LJ3d 4EMHA 2E41A 4C92E 3JCMP 2DVEA 2DXTA 4M77E 5GAOr 3FIFA 3V7RA 4M77B 4NOYA 4XTXA 3JB9I 2RD1A 3QHSA 4X9CA 2Y90A 5LJ3h 2RA2A 4XTWA 5LJ5g 3JCMe 4C8QF 3GIBA 2VXEA 4XTVA 3JCMc 4F7UB 4M78A 5GANj 3JCMX 1WPYA 4J6XA 3L2ZA 4XTZA 3SB2A 4XU0A 2RB6A 3EFSA 4EMKC 1B34A 5GAMg 4F7UF 4XTYA 1LOJA 2DZCA 1HK9A 2FB7A 3FB9A 1Y96A 4M77C 2HNIA 2DKGA 2EWNA 1D3BB 3RUXA 3INZA 4M7AB 2DTIA 3RKXA 3BFMA 4M75A 5GAN6 2ZGWA 4N0AA 2E10A 4M77D 4JRIA 3BW1A 4C8QB 1BIBA 1TH7A 5GANf 5GAN8 1N9SA 2DTOA 3HFNA 3AHUA 4EMKA 3SWNB 2E1HA 2VC8A 4Y91A 3JCMb 4M7AF 1I4K1 5GANd 4F7UG 5GMKj 3JB9H 4M7DA 3QSUA 4C92A 5DY9A 5LJ5j 2DJZA 2YLBA 4A54A 4F7UE 3VU3C 1I81A 4PJOF 5GAMf 2DXUA 5GANh 3RERA 2QTXA 4M7AC 3JCMg 4XU1A 4WF2A 1JRIA 4MMLA 4X9DA 2DTHA 4C8QC 2E64A 5GAMj 5GAMh 5GAN2 4XTUA 5GAOn 1KQ2A 4M7AG 4M7AD 3SWNC 2EJGA 3V7CA 5LJ3e 3JB9F 4M75F 4M7AE 5GAN7 1BIAA 4C8QD 1YCYA 3QUIA 4C8QG 5GAN5 3V8LA 4PJOG 2I2LA 3FJPA 5CAIA 1WQWA 5LJ5f 4C8QE 4NL3A 5GAOm 4M78B 2EJ9A 4XU3A 3RIRA 5LJ3g 3JCMW 4PJOE 4PJOB 5LJ5d 4V2SA 2K57A 4M7DF 3HFOA 4RCCA 3BDUA 5GMKh 4C92F 4JLIA 5I21A 1B34B 3JCMf 5LJ5h 1WQ7A 2DEQA 1I8FA 4HT8A 1LJOA 4M78F 3V8KA 4M77A 3HSBA 1Y96B 4M75G 3JCMd 4EMGA 1KQ1A 1JBMA 5GAMd 4M75E 5GAN3 3RESA 4RCBA 5GMKi 4J6YA 4JRKA 4M75B 3JCMh 4F7UA 2VXFA 4PJOC 2YLCA 3EFRA 4OP0A 3JCMQ 4HT9A 4M7DG 4EMKB 4C92G 5GAOp 4J6WA 4M78D 1I5LA 4M7DE 4QVDA 4M7DB 4M78G 4DQ2A 4PJOD 1WNLA 2JN0A 4C92B 5GANe 5GMKm 5GAOl 4QVCA 4M78E 1MGQA 1D3BA 2E65A 3JCMJ 4M7AA 2FYKA 5LJ3j 4MMKA 1H641
chains in the Genus database with same CATH superfamily
4N0AC 3HTRA 4CC4B 3CCJQ 5AT1B 3CCET 2HQHA 1U3OA 1GBRA 1NPRA 1AD5A 1OZ2A 3GNGA 4M78C 4KT0E 2GCXA 3CBMA 1Q7YC 3IQLA 1YJ9Q 2M51A 2EJFA 3FDRA 5LJ5e 1ACMB 2E5QA 4DBQA 2DE0X 2DD4A 1N8RU 1OULA 3VUZA 3CC7A 2MK5A 7AT1B 2HDAA 4C0ZA 5GANj 3M0RA 5KE2A 1VQ5A 1NYFA 3CCJT 1UUEA 1GFCA 2DEUA 3CCLQ 4FYWB 1D1AA 1Q95G 3RUXA 1W6XA 2EYZA 2EIFA 2ZPEB 3JCMb 3AHUA 3OQ5A 3VS0A 2A3LA 2FO0A 4J83A 3VU3C 1I81A 5FU7B 3VS4A 5IHIA 3BDLA 5AYFA 4RTUA 2PVGB 2XDBA 3E19A 3M0TA 2RQTA 1XJWB 2A7YA 5ECAA 1WJQA 2DILA 1VQ7T 1TSFA 4LDVA 3CCLT 2SRCA 3V8LA 1YWOA 3OYEA 1N8RR 3QZ5B 1X69A 1S72Q 1SF9A 4A63B 2HMAA 1B34B 1X27A 1KHCA 1NM7A 1PRMC 3JCMd 1WX6A 1NLPC 8AT1B 5CQYA 5DLQE 2E12A 2P0QA 2AKLA 2RHIA 2K3YA 1UGRB 1QKWA 3CCEA 5GAOp 2JXBA 3MEUA 4C5IA 4QT7A 1B3QA 2JZ2A 2EKHA 3OYCA 1D0ZA 4M75C 3CXCA 1XOVA 4RTVA 2RJDA 4J7FA 2FEIA 3L2RA 1YWPA 1MMNA 1OI1A 1N9RA 1M27C 4M7DC 2JM9A 5KYYB 2RM4A 1LPLA 3MEVA 1IO6A 4JUVA 1ZHIA 5IXFA 3CCJA 2E6NA 1WHLA 2RA2A 4ZTJA 1UHCA 3E1SA 4A4HA 3O8VA 2DYIA 1OU8A 2L2PA 1NJIR 1FX7A 1WHGA 3WXMB 3NTHA 1YITQ 2P4TA 3I5RA 5CO7A 3QZ9B 2HNIA 1OX8A 3OYGA 1BCMA 3EG9B 4OGCA 3C95A 5GAN6 4BI4A 2DD5A 2E10A 2DNUA 1YCSB 1VIFA 1VQ7A 3CCLA 5DY9A 1BK2A 5GAMf 4BI3A 1AT1B 2QQBA 3EGDB 2P0PA 2L8DA 2K79A 1RABB 1YI2Q 2XHCA 1GXIE 3QKJA 3P8HA 5GAMh 1YITT 1AZGB 3UDCA 3WVEB 1BIAA 2JTEA 3X28B 3E9GA 3JCMW 5LJ3g 2EJ9A 3T9NA 1E7OA 4V2SA 3S3NA 4GBQA 2FPFA 3NPFA 4L5GA 1NEBA 4HT8A 3E9FA 1D0YA 4II1A 1UTIA 1UECA 1VUBA 3QIIA 3EHRA 2CT4A 3ZL7C 1NEGA 1SRMA 4OB1B 2LT4A 5FW9A 3G6EQ 3LH5A 1D1CA 2ROLA 4LDYA 4M78D 1X75C 4M78G 1NYGA 4O6JA 1B07A 3GBQA 1P92A 1OV3A 1ZSZB 1PKTA 4C8QA 2ED0A 2DL3A 1WIEA 3H8ZA 4J9CA 4C92C 3L2VA 4CC2A 2CDTA 3MO8A 1PM3A 2PVDB 3CPFA 2Y4YA 5LJ3f 3G6ET 4D6WA 2EVRA 2KY9A 1VQOQ 2DA9A 4MDXA 3QHSA 5LJ3h 3LW5E 1JJ2P 2LP5A 1OEBA 2HSEB 1YHQT 1JQQA 2LCLA 5FU6C 3CC4T 1LOJA 2BUDA 4RKUE 1YN8A 2EWNA 1M8MA 4XAXB 2O4XB 2BZXA 2OX7A 4M77D 1M2VB 2DM1A 3M56A 2MMPA 1R0BG 1YITA 2X3WD 3OYDA 2F2WA 1VQOT 2YRCA 5GMKj 2AZVA 3EG0A 2CT3A 3R6NA 3MEAA 3M4YA 2YUPA 1N27A 2X4YA 2E64A 3WVDB 4OMNA 3S6WA 2GTJA 4RTXA 2MIOA 2ECZA 4PJOB 2LCSA 4RCCA 2ENMA 1VQKQ 4A4KA 3LWHA 3QYGB 3URGA 1M90C 1QVFP 1V1CA 2XU8A 2V8KA 4M75G 1MV0B 1OYXA 1MV3A 4LD6A 5KE3A 1RL2A 3M0UA 1X6GA 4M7DG 5CKEA 1PHTA 3VYGA 4AG2C 2HBWA 4ME7A 4QVDA 4M78E 3C4SA 1C0MA 2VASA 4B9XA 3ZFJA 3REBB 1UGQB 2K5FA 1H3ZA 3G6EA 2EPDA 3H0HA 5KYWA 1VQKT 2EFIA 3SWNA 2ZPFB 2D8JA 4KULA 3BY7A 2ATCB 5C0MA 1WHJA 1YHQA 3G71T 3QWYA 1M5Q1 3UWNA 3X24B 2M16A 1M8VA 2A36A 1VQ6T 3M9QA 2DVEA 3CC4A 2J6FA 4M4ZA 4X9CA 5IN1A 4FIBA 2YDLA 4RTTA 1WPYA 2RK1A 2XIDA 4JJBA 1YJWT 4GY5A 4XU0A 1VQOA 3P8BB 1RLQC 3AT1B 1QW1A 3L2QA 3INZA 4LUDA 4FM4B 2F5TX 4C0GA 1LVKA 4IURA 3DLMA 1KQSP 2EGCA 1QQJA 4PKCC 1OPKA 1ZA1B 4GLKA 4EDUA 4B9WA 1WI7A 5FRMA 4PJOF 3FRNA 4ZNXA 4M7AC 2A08A 2JNGA 1TWBA 2DTHA 4XTUA 4TVRA 1W4SA 2F2VA 2MCNA 2PUKB 3Q1JA 3OBWA 2HZYA 5LJ5d 1WFWA 4ANJA 3JCMf 1LJOA 5EG2A 3QDRB 5GAMd 4M75E 3ER0A 5GAN3 1ZUUA 3JCMh 3GLXA 2EQIA 2J6KA 4JPBW 1VQKA 1EX4A 4PFZA 4MZPA 4EMKB 1VYUA 4C92G 1VQNT 4HVUA 1I5LA 4M7DE 2QXFA 2KBTA 2FYKA 4CC3A 3G71A 1PD0A 1RUWA 1IHWA 2RI5A 1VQ6A 4F04B 3LX7A 3JB9D 2HD0A 3FLGA 3JB9G 1BI3A 3RKYA 3CCUQ 4OGEA 3V7SA 1JJ2A 2CP2A 2FPEA 4NL2A 4RTYA 4X34A 2HCKA 5CIUA 1YJWA 3CMEQ 1SSFA 4PLLA 5HCKA 1M1FA 2E41A 3FIFA 4A4EA 2O9SA 1JJ2S 1KHIA 1TU0B 4IIMA 2JOYA 3M0PA 1VQ8T 1HJDA 1ZBJA 3CCUT 2ZGWA 4N0AA 2AIRB 1R8OB 3A8GB 2RHYA 3VKIA 1BIBA 1OZ3A 4M7AF 2HAXA 5D6WA 2KVQG 1WHMA 1K9MC 2ZPIB 3OMCA 3CCQQ 2C0OA 1Q7YU 2NUTB 4FT2A 4FL6A 4AG1C 5KYXB 1QVFA 5EC7A 2C0IA 4C8QD 2MWPA 2QGGA 4C8QG 3OS0A 2EYWA 1WQWA 2RH2A 2FZKB 3RNJA 2QQ9A 1Q82U 1QVFS 1VQNA 3X26B 2H3EB 3OW2P 2P0KA 1JBMA 2CREA 2RPNA 1FXXA 4MZMA 3CCQT 1WA7A 1O9SA 4IUUA 3M58A 2G3RA 3M5AA 3FC3A 2JN0A 2D0NA 2DBMA 2F2XA 2RNAA 4N4HA 5LJ3j 2CP0A 2PVOB 2GFAA 2RQVA 1Q7YR 2KDSA 2E3IA 3M53A 3EAEA 1H8KA 1KFZA 1XNIA 1IXDA 2OAWA 3QXEB 4BUGA 4MZTA 2DLPA 4LDUA 4A53A 2NUZA 1OPLA 4HVVA 3VRYA 3QO3A 1SHFA 3EG2A 2CYZB 4HA8A 2BTTA 4CC7A 3SFMA 1VQ8A 2CZ0B 1MNEA 3REAB 3CCUA 5J26A 4XTXA 1Y07A 4LN2A 3META 3GIBA 1KQSA 1QWEA 4JZ3A 5L23A 4F7UF 2KQWA 2XDDA 4A4FA 4LDXA 1D3BB 1WLPB 4E6RA 3TU4K 4C5HA 4M75A 2RQWA 2O01E 1UFFA 4OMLA 4HXJA 1KQSS 2KR3A 1V76A 2DTOA 4F17A 3EFOB 1I4K1 4M7DA 3I35A 3QBYA 1AEYA 4DBHA 2GQVA 4JJDA 4XU1A 1Q82C 3ZEHA 1Z9QA 3EH1A 2LQWA 4VUBA 2V1QA 3RMSA 2K6DA 2IG0A 1VQ4Q 3CCQA 3M57A 2A0FB 4C8QE 3PMTA 4M78B 1NBEB 1K0XA 4CRIA 1YJ9T 3LGLA 1Q86U 1F1BB 1LCKA 3OYAA 3L2WA 3EH2A 1IB8A 2ZAEA 2O88A 4HKEA 2KRNA 4JRKA 4MDWA 1OX9A 4FU6A 3M54A 2YT6A 2JS0A 2IPOB 3OYYA 1YJNQ 1R77A 4KGZB 1WNLA 2QA4Q 1YIJQ 1U5SA 2E65A 1VQ4T 1QP2A 3VUBA 4QW2A 3C94A 1PKSA 1K73U 3VRZA 2KNBB 2NYSA 3VS6A 4Q5WA 2YUNA 1NLOC 3A98A 4K11A 3JCMV 1Y71A 1Y57A 4XK8E 1QP3A 1TXQA 2EYXA 2FL7A 3ME9A 1M3BA 2GGRA 4FSSA 4M77B 4KUIA 3JB9I 2NWMA 2JTMA 2QA4T 1YIJT 5LJ5g 3OB9A 2JM8A 2QEXQ 1FMVA 1S72T 2DL8A 3NGPA 2CZ7B 1Y0MA 5GAMg 2NUPA 2PUOB 1Y96A 3PT9A 2CSIA 1GBQA 4Z02A 2FPDA 4WCIA 5KH6A 2BE9B 5CQXA 1TUCA 4AFUC 4FYVB 5D6YA 4E7HA 1SRLA 2HSPA 1PC0A 1YP5A 2LTOA 3SDZA 1W2BP 2LC4A 4C92A 1BU1A 1VIEA 2IIMA 3CCMQ 2QEXT 5I2MA 1J3TA 1YJ9A 1BI1A 2LVMA 1Q86C 1RAAB 1JXMA 3LLRA 5GAOn 3OW2A 2ESWA 1D1BA 2KXDA 4CI0C 3V7CA 5GAN7 3THKA 5LJ5f 3NHNA 2CP7A 2KXCA 2QTVA 2EQMA 3OW2S 3M0QA 5LJ5h 1KG1A 2E3HA 1FYNA 1Y7XA 1EIFA 2L3PA 1CKAA 1WXUA 1VQ4A 3RDVA 1QCOA 3UPUA 3CCMT 2XDPA 5GJWB 2XICA 2DRKA 1Q81C 1K73C 1MHNA 1XTDA 5GANe 4QVCA 4RUGA 2L5QA 1AVZC 1WHHA 2LT1A 4JJNK 1T0JA 4M77F 4PJOA 1X01A 1BKBA 2DL7A 4ORZA 4ATOA 2QA4A 2EBPA 1YIJA 1JO8A 1M4ZA 2YHTA 2FRYA 1YI2T 1RAGB 1S72A 4BY6B 1AWJA 4J9FA 1ZSZC 4PNOA 1M90U 2EAYA 3I5SA 4J9HA 2XD0A 2XMFA 4XTWA 1FMWA 1PD1A 4FCYA 4XTVA 3G4SQ 2LRQA 2FVUA 2DPPB 1AZEA 4BI8B 1EZZB 4LE9A 1IRXA 3RKXA 3BFMA 3MPUB 2QEXA 1SPKA 3BW1A 3CBOA 4FYXB 2KSSA 1H92A 4RMOA 1WDXA 2DJZA 3G4ST 2DO3A 1NPPA 3JRZA 1FWZA 2GTOA 2RK2A 1M90R 1CSKA 4Z88A 1GCQA 1PWTA 3FJPA 3CCMA 3RIRA 3PFSA 1QVGP 5FRNA 3VJPA 1ZQ1A 4ZGJB 2X3XD 1PCXA 3HSBA 1VQPQ 2HL3A 2QQRA 2RMOA 4AFZC 3LWIA 4JRQA 3KFVA 1UEBA 5A0LA 5KYUA 2CP6A 5HK3A 4QQDA 1OU9A 4PJOC 1X43A 2J7IA 4J6WA 2HBPA 3X25B 2KGTA 2PTKA 3PIOA 2K4YA 4NS5A 1YI2A 4M7AA 4A4GA 3OYFA 5GJVB 1I07A 4RTZA 2DBKA 3L1AA 4OF1A 3EHQA 2RJFA 4AFSC 4J5YA 4M75D 1RACB 2CUDA 1VQPT 2AT1B 2KI7A 2F5KA 2E70A 3VS2A 5IHKA 2K7AA 3V8JA 2QG9B 4M7DD 4LD9K 4BE0A 2M1HA 2YWWA 3C0CA 4C0DB 4BDZA 3H0IA 1I5OB 1UGPB 5FLXE 5IAYA 4F14A 2XKOC 3X20B 1K1ZA 1YBYA 4E7JA 3JCMc 2JMAA 3M59A 2VB6A 3SB2A 2RB6A 4X1VA 6AT1B 4JRPA 4FT4A 1W2BA 1UJYA 2ABLA 3H41A 3G4SA 4KRTA 4C8QB 2LJ1A 3HRTA 2MI6A 2KEAA 2LJ0A 1W2BS 5DM7R 3GOXA 1IREB 3FEOA 1GCQC 2P4RA 4A54A 2QTXA 2KMTA 1D09B 3JCMg 2K2VA 2OTJQ 4FW2A 2QDYB 3TREA 3M55A 3GNFB 1H3HA 3OYJA 3G1JA 2DERA 2HEQA 1UGSB 1UDLA 4L59A 5CKHA 3JB9F 1D0XA 3S3MA 5GAN5 2RQRA 2K2MA 3SEMA 2O9VA 2LQKA 1GRIA 5A2QE 1MMDA 2R5MA 3PMIA 4FW1A 1NG2A 2RQUA 3BE3A 4JDSA 3OSSC 4C5EA 4F7UA 4ZN1A 2X4JA 1DJ7B 2NUTA 3CQTA 3UA7A 1K9MU 1VQPA 5GAOl 5KYNA 2BIVA 3I9QA 4MMKA 1PG5B 1M3CA 1CKBA 1H641 4OVAA 4IUPA 1G3WA 4KGXB 2DFUA 1WGSA 2OTLQ 3JB9J 4XQ3A 3A8OB 3QWXX 3JAME 1KD1U 3PTAA 1G83A 3CCVQ 4C92D 1AWXA 5GMKe 2HKNA 5GAOr 2CSQA 2PNIA 1T3LA 3I56Q 2LMJA 3CCRQ 3EGXA 4C8QF 3H6ZA 2VUBA 1UJ0A 1MUZA 4E7SA 3ASKA 4OMPA 1B7TA 2VKNA 1K9MR 2M9UA 4JRIA 4E7KA 3CCVT 1C1AA 4PFPA 3VS7A 5KYWB 3SWNB 3DKMA 1KC8U 1K8AU 5LJ5j 4RTWA 1IGUA 2YUOA 5A0GA 1QVGA 2L3RA 5D6XA 2BZYA 3KUFA 2RHZA 2L3QA 3PVQA 1KD1R 5GAMj 1ZA2B 1KQ2A 4KGVB 2EJGA 5C6SA 4KH1B 4PJOG 1QVGS 2MF2A 3CMET 4PL6A 3MKDA 2ZPGB 1RLPC 1WHKA 2JW4A 2DF6A 1M1KU 4PJJA 3UA6A 2DETA 2QYZA 4DBFA 3A8LB 2I0NA 1G2BA 2L89A 4PFOA 2E6ZA 2O2OA 1IZ6A 2CKKA 2CH4A 4HT9A 3OYKA 1NE8A 1VQ5Q 4R55A 3LYIA 5FWBA 1HD3A 2AKKA 2KRMA 1MGQA 4O5VA 2RD1A 1OOTA 4J8OA 3D7SB 4IKFA 1KD1C 2RI2A 3QPHA 4FSXA 2DAQA 1U8RA 4OMMA 1JB0E 2EGAA 2RJEA 3OYNA 1X2QA 4XU2A 2ROTA 3RBBB 1X6OA 5CKBA 1ZUYA 2V26A 4LUEA 3PIPA 2JVVA 4C92E 3V7RA 4NOYA 4PLIA 1WZOA 4IIOA 3NFCA 4LNPA 1M1KR 1VQMQ 4C0FA 3VV0A 3CCVA 4J7IA 4PK4A 3P8DA 3EFSA 1PRLC 4QQ6A 3VS5A 5J39A 1B34A 2WSEE 4DBRA 3FB9A 1PSEA 1KC8C 1K8AC 2DKGA 1E6HA 3EG1A 4QQGA 4ZGEB 2KK4A 2M0OA 1Q82R 5GANd 2C06A 3JB9H 4D8DA 4WTOB 2YLBA 2E5KA 3NTIA 2DXBA 2DXUA 3GF5A 2X9HA 2ZPBB 1VQMT 4R0KA 2CH4W 3CMEA 3S3OA 2K3BA 2D8HA 1RI9A 3HRUA 4M7AD 4M7AG 3HL8A 1M1KC 2XG8D 4E7ZA 1AHJB 3H0FA 1YCYA 2COYA 1RAEB 5KYYA 3OYIA 4HCCA 2DK3A 5GAOm 4PJOE 5IH2A 1G3YA 4OB3B 3A5ZB 4Z89A 1WQ7A 2FZCB 3MP8A 4ZGDB 2H3JA 2ZCFB 2W10A 2GF7A 3EFRA 2DIGA 1PNJA 4KUDK 4LXCA 2AZSA 1OQKA 1SHGA 5FU7C 3EG9A 3CPWP 2BE7D 5I22A 1ABOA 3OYLA 2LX7A 2MOXA 5GAMe 1GFDA 3DLLA 2KT1A 1U1SA 1VQ7Q 2JS2A 3EGDA 3ULRB 2H8HA 3PGGA 2KRSA 2LQ8A 4BD3A 1EFNA 1Q81U 2X35A 3TVTA 2QQSA 2DL5A 1HK9A 2FB7A 1I1JA 4ZTFA 3PE0A 4M77C 4ESRA 1K4US 2VGNA 1VQMA 1X6BA 3R6OA 5KCOA 1N5ZA 1QWFA 1VQLQ 1SG5A 5GAN8 1YJNT 3L2UA 1SKUB 1FMKA 4Y91A 1Q86R 4F7UG 2VGMA 3QSUA 2JUFA 4AT1B 2DIQA 3CC2Q 1NJIU 1BB9A 3MJXA 2EKOA 4KBMB 1ZSZA 3A1PA 4MMLA 2LX9A 2BZ8A 2CZ6B 5LJ3e 3OS2A 4J9BA 4M7AE 1VYTA 1MMAA 1UE9A 2I2LA 2Y4XA 3OYHA 2V1RA 2WSFE 4XU3A 2J6OA 2D1XA 1VQLT 2QAZA 1Q81R 2EQUA 2EGEA 3BDUA 1K73R 2DEQA 4M78F 1TUDA 5HY6A 2IVWA 4HCZA 1A0NB 1MNDA 4EMGA 2F1LA 1N8RC 3CC2T 4J6YA 4M75B 4LDWA 1GL5A 2LQNA 2DJQA 1BBZA 2P84A 3CXCS 5KCHA 2YLCA 4JJCA 4OP0A 4E7LA 2LZ6B 3CMAQ 4JLGA 4M7DB 8ATCB 1RAIB 3OMGA 2OJ2A 1ZSGA 2O4XA 2PZ1A 4ZN3A 1HXDA 4DEXA 4DOWA 1M2VA 2CP5A 1T0HA 4JS4A 2FZGB 1ABQA 3JSCA 3UF4A 3UT1A 1QLYA 2OAUA 1WXTA 1ZX6A 1QCFA 3DB3A 2DX1A 2F69A 2X51A 3M4GA 2QI2A 1O75A 3J80E 5GAOq 3MCAB 3HPWA 4BACA 4RG8A 3CMAT 2DXTA 4ELYC 1QMCA 1ZLMA 3KXTA 5I11A 2YXYA 3MHXA 2VXEA 3JCMX 4BY6C 1I0CA 1YJNA 4XTZA 2JJ9A 2X4XA 2RJCA 2ZPHB 1WXBA 4IUTA 4IUQA 1K76A 4EIKA 1NJIC 4R56A 2MYSA 1NZ9A 3MP6A 1TH7A 2B86A 1N9SA 1S1NA 2EYYA 3HFNA 3F70A 2E1HA 1TG0A 1W1FA 3H9NA 2EW3A 5CR2A 1TOVA 4OB2B 4F7UE 4JZ4A 1SSHA 3RERA 2B8AA 1RI0A 1T3SA 1VQLA 5A0DA 2W0ZA 2VV5A 4M75F 3QUIA 1M2OA 2K5LA 2COZA 3CC2A 3HKSA 3SD4A 4UC4A 2MAMA 3A8HB 4YTLA 1YHQQ 4M7DF 3HFOA 3MP1A 3CD6Q 2NUPB 2VVKA 3CC4Q 1Y96B 4D8KA 3JV3A 3CPWA 2WACA 5LL6S 4QVZA 3A8MB 1UGVA 2M0YA 1TTHB 4C92B 3CPWS 2KROA 3NTKA 5GANg 2CGHA 3RKWA 4BE2A 3VYHB 2AHJB 2DZ9A 3CMAA 4F16A 3CD6T 5GAN4 1K0SA 5D7UA 2JTFA 1W70A 4RG2A 3OYMA 4M77G 1KK7A 3TSZA 5FU6B 2G6FX 2YUQA 1BCOA 2QQAA 4E7IA 4HCKA 2Y90A 4OMFB 3NMZC 5M9OA 3JCMe 4J9IA 1JEGA 1WYXA 4J6XA 3L2ZA 4BE1A 1RAFB 1U06A 4C0DC 3PVLA 2QDLA 2K9GA 5HKCA 1QCNA 3OY9A 2DTIA 3I55Q 2FRWA 2GQIA 5GANf 2M02A 4EMKA 5HK0A 3VS3A 3HHTB 2CUBA 3OA6A 4DOVA 3TSWA 2HQEA 3N5BB 2DVJA 3HP9A 5GANh 5J3BA 3LH0A 1ARKA 3G71Q 3LGFA 3ZBDA 4C8QC 1QKXA 2OI3A 1M3AA 1VQ6Q 4Y92A 2DXCA 2XI9A 1M9SA 4OMQA 3KBGA 2O31A 1KIKA 2HL5C 3I55T 1K9AA 2HQXA 2DYBA 4GLMA 1YJWQ 4C92F 5I21A 2YRDA 4E2FB 1HYOA 5IHNA 1KQ1A 5CVIA 1YNZA 1M30A 3FJ5A 9ATCB 3DB4A 2KAFA 2RHXA 2L3SA 1X2KA 3CD6A 3CBPA 4ELZC 4N4GA 1KJWA 2COWA 4J9DA 1UB4A 3JCMJ 3OYBA 3TEEA 1YFNA 2D6FA 4JS5A 5IT9E 2QGFB 1UG1A 1WJSA 3QDFA 1ZUKA 2VYTA 2VWFA 2RHUA 2FHDA 1G3TA 4J9EA 1U1TA 4BDYA 2LNVA 4B6MA 2KE9A 2PQWA 3SHWA 5DLOA 2R5AA 2OTJT 4Z8AA 3CCSQ 2J06A 2ZZDA 2K5IA 1IGQA 1ZBXA 2DMOA 5KYXA 5GMKl 4EMHA 4M77E 1HSQA 3M0SA 2MPXC 3E2UA 5CKFA 1BYMA 5KYUB 2KYBA 2FG0A 1VQ9Q 3MEWA 1SEMA 2RO0A 4EMKC 3QG1A 1VQNQ 4XTYA 2DZCA 2WSCE 4QKUA 3RR6A 5CCAA 4M7AB 5IXBA 2SEMA 2V8JA 3QJ6A 3CCST 1G8XA 3EG3A 1VOMA 2D9TA 2EQKA 2GNCA 2VC8A 2A28A 2JMCA 4OB0B 5L8RE 2LCCA 2EYQA 3I55A 2BKDN 4Y28E 3L42A 1VQ9T 4OMOA 2OTLT 2GBQA 2V8IA 3EGUA 2RN8A 3SWNC 4E47A 1E6GA 1WJRA 5I2SA 4NL3A 2KT8A 1KSWA 4PJNA 4JLIA 1BI0A 2R58A 1VQ8Q 1IHVA 3I56T 3V8KA 2RI3A 1AWOA 3CCRT 1VA7A 4N4IA 4DEYA 3RESA 4DA4A 1C6VX 3J81E 3GPLA 1MMGA 2VXFA 3UATA 2MWOA 3OBYA 2ED1A 3OS1A 1PSFA 2D0QB 3HRSA 4DQ2A 4PJOD 1TS9A 3TQ7P 4IUVA 1D3BA 3PNWC 2OTJA 1UHFA 3OS5A 2HKQB 2Z0WA 1RADB 3EFOA 2L0AA 1N6AA 1TUGB 1XQHA 2GFUA 3CC7Q 3O5ZA 1AWWA 1LNXA 3CXCP 1JU5C 5LJ3d 3JCMP 1AOJA 3J7AF 1GCPA 2E4HA 1KC8R 1K8AR 4F7UB 2CS7A 4M78A 3CCSA 2LJ3A 2X4WA 3OSVA 5CKDA 2QK0A 2QASA 4AFQC 4HVWA 1M1GA 2A37A 2AK5A 5FWCA 2RF0A 4AMCA 3CC7T 4J9GA 1BI2A 1G5VA 3U23A 1VQ9A 2OTLA 1VQ5T 3GP8A 2PU9B 4PJMA 2LNHB 2CZ1B 2KYMA 5CK9A 2EQJA 2NLUA 2LDMA 3RMQA 4PJLA 4WF2A 1JRIA 3CEYA 4X9DA 5GAN2 1G3SA 3I56A 3CCRA 2YSQA 1JXOA 3EGXB 3C12A 2DL4A 5CAIA 2DRMA 3TCJA 2K57A 1RAHB 5GMKh 3CCEQ 1I8FA 1V29B 4M77A 3VS1A 1QVPA 1R0CB 1Z9ZA 4P5NA 2K3XA 4L6V5 4RCBA 5GMKi 2JT4A 4HCBA 2J05A 4BB7A 5FROA 4FYYB 3JCMQ 2XK0A 2C0TA 2YRVA 4EPCA 2R57A 5GMKm 3QJYA 4KH0B 2CP3A 3G7ZA 1VYVA 3QYHB 4C5GA
chains in the Genus database with same CATH topology
1HXDA 4A4GA 3OYFA 4N0AC 4DOWA 2RI5A 3L1AA 4OF1A 2RJFA 1VQ6A 4J5YA 3LX7A 3JB9D 4M75D 2HD0A 3FLGA 4JS4A 3JB9G 3CCET 3JSCA 3UT1A 1BI3A 3RKYA 1VQPT 2OAUA 4OGEA 2F5KA 3V7SA 2E70A 1JJ2A 1NPRA 3DB3A 2F69A 1OZ2A 4NL2A 4X34A 3V8JA 3GNGA 4M78C 3M4GA 4KT0E 2GCXA 2QI2A 3CBMA 1Q7YC 4LD9K 4M7DD 4BE0A 1O75A 5CIUA 3J80E 1YJWA 2M1HA 4C0DB 4BDZA 1SSFA 4PLLA 2EJFA 5GAOq 3FDRA 3MCAB 1M1FA 3HPWA 5LJ5e 2E41A 4RG8A 4BACA 3CMAT 2DXTA 4ELYC 1UGPB 3FIFA 5FLXE 5IAYA 4A4EA 2E5QA 2XKOC 2DD4A 3X20B 1N8RU 3KXTA 1JJ2S 3VUZA 3CC7A 1YBYA 1KHIA 2VXEA 3MHXA 4E7JA 3JCMc 4C0ZA 5GANj 2JOYA 3JCMX 4BY6C 3M59A 5KE2A 1YJNA 4XTZA 3SB2A 1VQ5A 2RB6A 2X4XA 3CCJT 4JRPA 2RJCA 2ZPHB 1VQ8T 4FT4A 1W2BA 4IUTA 4IUQA 3CCUT 3RUXA 3G4SA 2ZGWA 4R56A 4N0AA 1NJIC 1R8OB 3A8GB 1NZ9A 2RHYA 3MP6A 4C8QB 3VKIA 1BIBA 1TH7A 1N9SA 3HFNA 3HRTA 1OZ3A 2EIFA 2ZPEB 2MI6A 2E1HA 3F70A 3OQ5A 3JCMb 1W2BS 5DM7R 2HAXA 3GOXA 4M7AF 5D6WA 1IREB 3FEOA 2KVQG 2A3LA 5CR2A 1K9MC 4OB2B 4F7UE 2ZPIB 3OMCA 4J83A 1I81A 5FU7B 3VU3C 4A54A 1Q7YU 3RERA 2QTXA 2KMTA 2B8AA 3BDLA 4FT2A 1RI0A 5AYFA 4FL6A 1VQLA 3JCMg 2K2VA 2PVGB 5A0DA 2XDBA 3E19A 2QDYB 3TREA 3M55A 3GNFB 1QVFA 2A7YA 3OYJA 1WJQA 1UGSB 4L59A 2VV5A 4M75F 4LDVA 5CKHA 3CCLT 3S3MA 4C8QD 2MWPA 3JB9F 3QUIA 4C8QG 5GAN5 2K5LA 3V8LA 3CC2A 3OS0A 3HKSA 3SD4A 1WQWA 2RH2A 3OYEA 4UC4A 2MAMA 3A8HB 4YTLA 3QZ5B 2QQ9A 1Q82U 2LQKA 4M7DF 3HFOA 1QVFS 1VQNA 3MP1A 3X26B 1B34B 5A2QE 2R5MA 3PMIA 2P0KA 1KHCA 1Y96B 3JCMd 3CPWA 2WACA 5LL6S 1JBMA 1FXXA 4JDSA 4MZMA 3CCQT 3OSSC 4QVZA 4C5EA 4F7UA 3A8MB 4ZN1A 2X4JA 5CQYA 1DJ7B 5DLQE 2E12A 2P0QA 1O9SA 2RHIA 2K3YA 4IUUA 1UGRB 3CCEA 5GAOp 3M58A 3MEUA 3QYHB 2G3RA 1K9MU 1VQPA 3M5AA 4C5IA 2JN0A 4C92B 5GAOl 3FC3A 3CPWS 2JZ2A 3OYCA 4N4HA 2BIVA 5LJ3j 4MMKA 1H641 2PVOB 2GFAA 4M75C 3CXCA 1XOVA 3NTKA 2RJDA 4J7FA 5GANg 2CGHA 4OVAA 4IUPA 3RKWA 2KDSA 4BE2A 1G3WA 3VYHB 3L2RA 3M53A 3EAEA 1WGSA 2AHJB 2DZ9A 3CMAA 1OI1A 3CD6T 5GAN4 1XNIA 1N9RA 3JB9J 3QXEB 4M7DC 4BUGA 4MZTA 2JTFA 4LDUA 4XQ3A 4A53A 3A8OB 2RM4A 4RG2A 3JAME 1KD1U 3PTAA 3OYMA 3QO3A 3MEVA 4JUVA 4C92D 1ZHIA 2CYZB 4HA8A 5GMKe 3CCJA 4M77G 1VQ8A 3SFMA 5FU6B 5GAOr 2CZ0B 2E6NA 2QQAA 3CCUA 5J26A 4XTXA 4E7IA 1Y07A 2Y90A 4OMFB 3META 2RA2A 4ZTJA 5M9OA 3JCMe 4C8QF 3H6ZA 2VUBA 3E1SA 3GIBA 4A4HA 3O8VA 1FX7A 4J6XA 3L2ZA 4BE1A 3ASKA 3WXMB 1KQSA 4C0DC 3NTHA 2P4TA 5CO7A 4F7UF 2KQWA 3QZ9B 2XDDA 4A4FA 2HNIA 4LDXA 5HKCA 3OYGA 1D3BB 3OY9A 3TU4K 2DTIA 4C5HA 4M75A 3C95A 4OGCA 5GAN6 2M9UA 2O01E 4BI4A 2DD5A 2E10A 4JRIA 4E7KA 3CCVT 1KQSS 5GANf 2DTOA 4EMKA 5HK0A 3SWNB 3DKMA 1VIFA 3HHTB 1I4K1 1VQ7A 3OA6A 4M7DA 4DOVA 3CCLA 3QBYA 1KC8U 1K8AU 5LJ5j 2HQEA 3N5BB 5DY9A 3HP9A 5GAMf 4BI3A 5GANh 5A0GA 1QVGA 2QQBA 2GQVA 2L8DA 2P0PA 5J3BA 3LH0A 2L3RA 2XHCA 5D6XA 3KUFA 3LGFA 4XU1A 3QKJA 1Q82C 2RHZA 3P8HA 3ZEHA 1GXIE 3ZBDA 4C8QC 5GAMh 5GAMj 1YITT 1KQ2A 2DXCA 2EJGA 4VUBA 3UDCA 3WVEB 2XI9A 1BIAA 1M9SA 3RMSA 5C6SA 2IG0A 3KBGA 3CCQA 4PJOG 1QVGS 3X28B 3E9GA 3I55T 3M57A 4C8QE 3JCMW 3PMTA 2EJ9A 4M78B 2MF2A 2HQXA 4PL6A 3T9NA 5LJ3g 3CMET 4CRIA 1YJ9T 3LGLA 4V2SA 2ZPGB 1Q86U 3S3NA 4C92F 5I21A 4L5GA 3OYAA 3L2WA 1M1KU 4HT8A 3E9FA 4II1A 1KQ1A 5CVIA 1VUBA 3A8LB 3QIIA 4HKEA 3DB4A 2KAFA 4JRKA 4MDWA 2RHXA 2L89A 4OB1B 2LT4A 4FU6A 2E6ZA 3M54A 1IZ6A 2CKKA 4HT9A 3OYYA 1NE8A 3OYKA 3CD6A 4LDYA 3CBPA 4M78D 4R55A 3LYIA 4ELZC 4N4GA 1X75C 4M78G 4O6JA 1WNLA 1MGQA 1UB4A 2E65A 3JCMJ 1VQ4T 4O5VA 3OYBA 1QP2A 2RD1A 3TEEA 1P92A 4J8OA 3VUBA 4JS5A 4IKFA 2D6FA 4QW2A 5IT9E 1KD1C 3C94A 1WJSA 1K73U 2RI2A 4C8QA 3QPHA 4FSXA 2VYTA 5GAN2 2RHUA 2FHDA 1G3TA 2DAQA 1U8RA 4Q5WA 3CC2T 1U1TA 4BDYA 2LNVA 1JB0E 2RJEA 3H8ZA 3JCMV 3OYNA 4C92C 1Y71A 3L2VA 2PQWA 5DLOA 4XU2A 2R5AA 3MO8A 1X6OA 4XK8E 2OTJT 1QP3A 2PVDB 3CPFA 2Y4YA 2ZZDA 2K5IA 5LJ3f 1ZBXA 3G6ET 4D6WA 5CKBA 2FL7A 3PIPA 2JVVA 5GMKl 2KY9A 3ME9A 4EMHA 4C92E 5GMKi 4M77E 4MDXA 3V7RA 4M77B 4KUIA 4NOYA 4PLIA 3JB9I 3QHSA 5LJ3h 2JTMA 2QA4T 1YIJT 5LJ5g 3NFCA 3OB9A 5CKFA 1BYMA 3LW5E 4C0FA 3VV0A 1YHQT 1S72T 3CCVA 4J7IA 3MEWA 2RO0A 3P8DA 2CZ7B 3EFSA 3QG1A 4QQ6A 4EMKC 2LCLA 5J39A 1B34A 5FU6C 5GAMg 3CC4T 4XTYA 1LOJA 2BUDA 2DZCA 2WSEE 3FB9A 2PUOB 1Y96A 1PSEA 2WSCE 3PT9A 4RKUE 1KC8C 1K8AC 2DKGA 2EWNA 5CCAA 4XAXB 4QQGA 4M7AB 4ZGEB 2KK4A 2O4XB 4Z02A 2V8JA 2M0OA 4M77D 3QJ6A 3CCST 5KH6A 3M56A 5CQXA 2MMPA 1YITA 5D6YA 2D9TA 3OYDA 2EQKA 2VC8A 4E7HA 1VQOT 5GANd 4OB0B 3SDZA 2LTOA 5L8RE 5GMKj 2LCCA 2C06A 3JB9H 2LC4A 3MEAA 4C92A 2EYQA 2YLBA 3NTIA 2DXBA 1VIEA 2DXUA 3GF5A 3M4YA 2BKDN 3I55A 2ZPBB 1VQMT 2QEXT 3CMEA 1N8RC 4Y28E 5I2MA 1N27A 3L42A 2X4YA 3S3OA 1YJ9A 1VQ9T 3HRUA 1BI1A 2LVMA 1Q86C 3LLRA 5GAOn 2E64A 3OW2A 2OTLT 4M7AD 2V8IA 4M7AG 3HL8A 3SWNC 4E47A 3WVDB 4CI0C 1M1KC 3V7CA 2XG8D 5GAN7 1AHJB 3S6WA 1YCYA 1WJRA 3OYIA 4HCCA 2DK3A 5LJ5f 5I2SA 4NL3A 5GAOm 4PJOE 4PJOB 1G3YA 4M7DE 2EQMA 3A5ZB 4OB3B 4RCCA 3OW2S 4A4KA 3LWHA 4JLIA 1BI0A 2R58A 3QYGB 5LJ5h 3URGA 1WQ7A 1M90C 1KG1A 3I56T 3V8KA 2RI3A 2XU8A 1Y7XA 2V8KA 3CCRT 1EIFA 4M75G 4N4IA 3MP8A 1OYXA 4ZGDB 1VQ4A 4LD6A 3RESA 4DA4A 5KE3A 1RL2A 3J81E 3UPUA 2H3JA 3GPLA 2XDPA 3CCMT 2ZCFB 2VXFA 2XICA 1Q81C 1K73C 2GF7A 2MWOA 2DIGA 3EFRA 4M7DG 5CKEA 3VYGA 3OBYA 3OS1A 1PSFA 4KUDK 4ME7A 1MHNA 2D0QB 3HRSA 4QVDA 1XTDA 4DQ2A 4PJOD 4IUVA 5GANe 5FU7C 4QVCA 4M78E 1D3BA 3C4SA 3PNWC 4B9XA 2L5QA 2OTJA 3ZFJA 3OS5A 1UGQB 2K5FA 2LT1A 3OYLA 1H3ZA 3G6EA 4JJNK 5GAMe 4M77F 4PJOA 1X01A 1VQKT 1BKBA 2EFIA 3SWNA 2ZPFB 4KULA 3DLLA 4ATOA 3BY7A 1U1SA 5C0MA 1N6AA 2QA4A 1YIJA 1XQHA 2GFUA 1M4ZA 2YHTA 1YI2T 1YHQA 3G71T 1S72A 4BY6B 1M5Q1 3UWNA 3X24B 1LNXA 2M16A 4PNOA 1M90U 3PGGA 1M8VA 2EAYA 1VQ6T 3M9QA 5LJ3d 2LQ8A 4BD3A 2DVEA 3JCMP 3CC4A 2XD0A 4X9CA 3J7AF 4XTWA 5IN1A 1Q81U 4XTVA 4FIBA 2CS7A 4F7UB 4M78A 3CCSA 2X35A 1WPYA 2LRQA 2RK1A 2X4WA 2XIDA 1YJWT 4GY5A 3OSVA 4XU0A 5CKDA 1VQOA 3P8BB 2FVUA 2QQSA 1M1GA 1HK9A 2FB7A 4ZTFA 2DPPB 1QW1A 4M77C 4BI8B 3L2QA 2VGNA 3INZA 3CC7T 3RKXA 1VQMA 3BFMA 2QEXA 1BI2A 1G5VA 3R6OA 5KCOA 4FM4B 2F5TX 1VQ9A 3BW1A 3CBOA 4C0GA 2OTLA 4IURA 5GAN8 1YJNT 1VQ5T 3L2UA 2KSSA 3DLMA 3GP8A 4Y91A 4PKCC 2PU9B 4F7UG 2VGMA 4RMOA 3QSUA 4GLKA 4EDUA 2CZ1B 2JUFA 4B9WA 2DJZA 5CK9A 2EQJA 5FRMA 4PJOF 2NLUA 2DIQA 2LDMA 3FRNA 1NJIU 4M7AC 3RMQA 4KBMB 2JNGA 2EKOA 3G4ST 3G71A 4WF2A 1JRIA 2DO3A 1NPPA 3CEYA 1FWZA 2DTHA 3JRZA 4MMLA 2LX9A 1G3SA 4X9DA 4XTUA 2RK2A 3I56A 4TVRA 1W4SA 3CCRA 2CZ6B 5LJ3e 3OS2A 4M7AE 2PUKB 3C12A 3Q1JA 2I2LA 2Y4XA 3FJPA 5CAIA 3OYHA 3CCMA 3TCJA 4XU3A 2WSFE 3RIRA 3PFSA 5FRNA 3OBWA 3VJPA 5LJ5d 1VQLT 1ZQ1A 2K57A 4ZGJB 2EQUA 3BDUA 5GMKh 3JCMf 3HSBA 2DEQA 1I8FA 1VQ7T 1LJOA 4M78F 1V29B 4M77A 5HY6A 2IVWA 1QVPA 4HCZA 2QQRA 4EMGA 5EG2A 4JRQA 3LWIA 3QDRB 5GAMd 4M75E 3ER0A 5GAN3 4P5NA 4RCBA 1UEBA 2K3XA 4J6YA 4L6V5 4LDWA 4M75B 3JCMh 5A0LA 3GLXA 5HK3A 4HCBA 4QQDA 4BB7A 3CXCS 5FROA 4PJOC 5KCHA 2YLCA 3JCMQ 4OP0A 1VQKA 3AHUA 4E7LA 4MZPA 4EMKB 4C92G 1VQNT 4J6WA 4JLGA 1I5LA 2HBPA 2QXFA 2XK0A 4M7DB 2YRVA 3X25B 4EPCA 2R57A 5GMKm 3QJYA 3OMGA 3PIOA 3G7ZA 2K4YA 4NS5A 1YI2A 2FYKA 4M7AA 2O4XA 4C5GA 4ZN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 C;  1HXD A;  4N0A C;  5GAN g;  2CGH A;  3L1A A;  5GAM e;  3RKW A;  4C8Q A;  4M77 F;  4PJO A;  1X01 A;  4J5Y A;  2DZ9 A;  3SWN A;  3JB9 D;  4M75 D;  5GAN 4;  3JB9 G;  3BY7 A;  1U1S A;  3RKY A;  1N9R A;  1U1T A;  3JB9 J;  4M7D C;  3JCM V;  3V7S A;  4C92 C;  4XQ3 A;  2YHT A;  4A53 A;  4NL2 A;  3V8J A;  4XU2 A;  2RM4 A;  4M78 C;  3M4G A;  4M7D D;  3QO3 A;  4JUV A;  1M5Q 1;  5LJ3 f;  4C92 D;  1LNX A;  4HA8 A;  4PNO A;  5GMK e;  3PGG A;  1M8V A;  4M77 G;  2EJF A;  2EAY A;  5LJ5 e;  5GMK l;  5GAO q;  5LJ3 d;  4EMH A;  2E41 A;  4C92 E;  3JCM P;  2DVE A;  2DXT A;  4M77 E;  5GAO r;  3FIF A;  3V7R A;  4M77 B;  4NOY A;  4XTX A;  3JB9 I;  2RD1 A;  3QHS A;  4X9C A;  2Y90 A;  5LJ3 h;  2RA2 A;  4XTW A;  5LJ5 g;  3JCM e;  4C8Q F;  3GIB A;  2VXE A;  4XTV A;  3JCM c;  4F7U B;  4M78 A;  5GAN j;  3JCM X;  1WPY A;  4J6X A;  3L2Z A;  4XTZ A;  3SB2 A;  4XU0 A;  2RB6 A;  3EFS A;  4EMK C;  1B34 A;  5GAM g;  4F7U F;  4XTY A;  1LOJ A;  2DZC A;  1HK9 A;  2FB7 A;  3FB9 A;  1Y96 A;  4M77 C;  2HNI A;  2DKG A;  2EWN A;  1D3B B;  3RUX A;  3INZ A;  4M7A B;  2DTI A;  3RKX A;  3BFM A;  4M75 A;  5GAN 6;  2ZGW A;  4N0A A;  2E10 A;  4M77 D;  4JRI A;  3BW1 A;  4C8Q B;  1BIB A;  1TH7 A;  5GAN f;  5GAN 8;  1N9S A;  2DTO A;  3HFN A;  3AHU A;  4EMK A;  3SWN B;  2E1H A;  2VC8 A;  4Y91 A;  3JCM b;  4M7A F;  1I4K 1;  5GAN d;  4F7U G;  5GMK j;  3JB9 H;  4M7D A;  3QSU A;  4C92 A;  5DY9 A;  5LJ5 j;  2DJZ A;  2YLB A;  4A54 A;  4F7U E;  3VU3 C;  1I81 A;  4PJO F;  5GAM f;  2DXU A;  5GAN h;  3RER A;  2QTX A;  4M7A C;  3JCM g;  4XU1 A;  4WF2 A;  1JRI A;  4MML A;  4X9D A;  2DTH A;  4C8Q C;  2E64 A;  5GAM j;  5GAM h;  5GAN 2;  4XTU A;  5GAO n;  1KQ2 A;  4M7A G;  4M7A D;  3SWN C;  2EJG A;  3V7C A;  5LJ3 e;  3JB9 F;  4M75 F;  4M7A E;  5GAN 7;  1BIA A;  4C8Q D;  1YCY A;  3QUI A;  4C8Q G;  5GAN 5;  3V8L A;  4PJO G;  2I2L A;  3FJP A;  5CAI A;  1WQW A;  5LJ5 f;  4C8Q E;  4NL3 A;  5GAO m;  4M78 B;  2EJ9 A;  4XU3 A;  3RIR A;  5LJ3 g;  3JCM W;  4PJO E;  4PJO B;  5LJ5 d;  4V2S A;  2K57 A;  4M7D F;  3HFO A;  4RCC A;  3BDU A;  5GMK h;  4C92 F;  4JLI A;  5I21 A;  1B34 B;  3JCM f;  5LJ5 h;  1WQ7 A;  2DEQ A;  1I8F A;  4HT8 A;  1LJO A;  4M78 F;  3V8K A;  4M77 A;  3HSB A;  1Y96 B;  4M75 G;  3JCM d;  4EMG A;  1KQ1 A;  1JBM A;  5GAM d;  4M75 E;  5GAN 3;  3RES A;  4RCB A;  5GMK i;  4J6Y A;  4JRK A;  4M75 B;  3JCM h;  4F7U A;  2VXF A;  4PJO C;  2YLC A;  3EFR A;  4OP0 A;  3JCM Q;  4HT9 A;  4M7D G;  4EMK B;  4C92 G;  5GAO p;  4J6W A;  4M78 D;  1I5L A;  4M7D E;  4QVD A;  4M7D B;  4M78 G;  4DQ2 A;  4PJO D;  1WNL A;  2JN0 A;  4C92 B;  5GAN e;  5GMK m;  5GAO l;  4QVC A;  4M78 E;  1MGQ A;  1D3B A;  2E65 A;  3JCM J;  4M7A A;  2FYK A;  5LJ3 j;  4MMK A;  1H64 1; 
#chains in the Genus database with same CATH topology
 4N0A C;  3HTR A;  4CC4 B;  3CCJ Q;  5AT1 B;  3CCE T;  2HQH A;  1U3O A;  1GBR A;  1NPR A;  1AD5 A;  1OZ2 A;  3GNG A;  4M78 C;  4KT0 E;  2GCX A;  3CBM A;  1Q7Y C;  3IQL A;  1YJ9 Q;  2M51 A;  2EJF A;  3FDR A;  5LJ5 e;  1ACM B;  2E5Q A;  4DBQ A;  2DE0 X;  2DD4 A;  1N8R U;  1OUL A;  3VUZ A;  3CC7 A;  2MK5 A;  7AT1 B;  2HDA A;  4C0Z A;  5GAN j;  3M0R A;  5KE2 A;  1VQ5 A;  1NYF A;  3CCJ T;  1UUE A;  1GFC A;  2DEU A;  3CCL Q;  4FYW B;  1D1A A;  1Q95 G;  3RUX A;  1W6X A;  2EYZ A;  2EIF A;  2ZPE B;  3JCM b;  3AHU A;  3OQ5 A;  3VS0 A;  2A3L A;  2FO0 A;  4J83 A;  3VU3 C;  1I81 A;  5FU7 B;  3VS4 A;  5IHI A;  3BDL A;  5AYF A;  4RTU A;  2PVG B;  2XDB A;  3E19 A;  3M0T A;  2RQT A;  1XJW B;  2A7Y A;  5ECA A;  1WJQ A;  2DIL A;  1VQ7 T;  1TSF A;  4LDV A;  3CCL T;  2SRC A;  3V8L A;  1YWO A;  3OYE A;  1N8R R;  3QZ5 B;  1X69 A;  1S72 Q;  1SF9 A;  4A63 B;  2HMA A;  1B34 B;  1X27 A;  1KHC A;  1NM7 A;  1PRM C;  3JCM d;  1WX6 A;  1NLP C;  8AT1 B;  5CQY A;  5DLQ E;  2E12 A;  2P0Q A;  2AKL A;  2RHI A;  2K3Y A;  1UGR B;  1QKW A;  3CCE A;  5GAO p;  2JXB A;  3MEU A;  4C5I A;  4QT7 A;  1B3Q A;  2JZ2 A;  2EKH A;  3OYC A;  1D0Z A;  4M75 C;  3CXC A;  1XOV A;  4RTV A;  2RJD A;  4J7F A;  2FEI A;  3L2R A;  1YWP A;  1MMN A;  1OI1 A;  1N9R A;  1M27 C;  4M7D C;  2JM9 A;  5KYY B;  2RM4 A;  1LPL A;  3MEV A;  1IO6 A;  4JUV A;  1ZHI A;  5IXF A;  3CCJ A;  2E6N A;  1WHL A;  2RA2 A;  4ZTJ A;  1UHC A;  3E1S A;  4A4H A;  3O8V A;  2DYI A;  1OU8 A;  2L2P A;  1NJI R;  1FX7 A;  1WHG A;  3WXM B;  3NTH A;  1YIT Q;  2P4T A;  3I5R A;  5CO7 A;  3QZ9 B;  2HNI A;  1OX8 A;  3OYG A;  1BCM A;  3EG9 B;  4OGC A;  3C95 A;  5GAN 6;  4BI4 A;  2DD5 A;  2E10 A;  2DNU A;  1YCS B;  1VIF A;  1VQ7 A;  3CCL A;  5DY9 A;  1BK2 A;  5GAM f;  4BI3 A;  1AT1 B;  2QQB A;  3EGD B;  2P0P A;  2L8D A;  2K79 A;  1RAB B;  1YI2 Q;  2XHC A;  1GXI E;  3QKJ A;  3P8H A;  5GAM h;  1YIT T;  1AZG B;  3UDC A;  3WVE B;  1BIA A;  2JTE A;  3X28 B;  3E9G A;  3JCM W;  5LJ3 g;  2EJ9 A;  3T9N A;  1E7O A;  4V2S A;  3S3N A;  4GBQ A;  2FPF A;  3NPF A;  4L5G A;  1NEB A;  4HT8 A;  3E9F A;  1D0Y A;  4II1 A;  1UTI A;  1UEC A;  1VUB A;  3QII A;  3EHR A;  2CT4 A;  3ZL7 C;  1NEG A;  1SRM A;  4OB1 B;  2LT4 A;  5FW9 A;  3G6E Q;  3LH5 A;  1D1C A;  2ROL A;  4LDY A;  4M78 D;  1X75 C;  4M78 G;  1NYG A;  4O6J A;  1B07 A;  3GBQ A;  1P92 A;  1OV3 A;  1ZSZ B;  1PKT A;  4C8Q A;  2ED0 A;  2DL3 A;  1WIE A;  3H8Z A;  4J9C A;  4C92 C;  3L2V A;  4CC2 A;  2CDT A;  3MO8 A;  1PM3 A;  2PVD B;  3CPF A;  2Y4Y A;  5LJ3 f;  3G6E T;  4D6W A;  2EVR A;  2KY9 A;  1VQO Q;  2DA9 A;  4MDX A;  3QHS A;  5LJ3 h;  3LW5 E;  1JJ2 P;  2LP5 A;  1OEB A;  2HSE B;  1YHQ T;  1JQQ A;  2LCL A;  5FU6 C;  3CC4 T;  1LOJ A;  2BUD A;  4RKU E;  1YN8 A;  2EWN A;  1M8M A;  4XAX B;  2O4X B;  2BZX A;  2OX7 A;  4M77 D;  1M2V B;  2DM1 A;  3M56 A;  2MMP A;  1R0B G;  1YIT A;  2X3W D;  3OYD A;  2F2W A;  1VQO T;  2YRC A;  5GMK j;  2AZV A;  3EG0 A;  2CT3 A;  3R6N A;  3MEA A;  3M4Y A;  2YUP A;  1N27 A;  2X4Y A;  2E64 A;  3WVD B;  4OMN A;  3S6W A;  2GTJ A;  4RTX A;  2MIO A;  2ECZ A;  4PJO B;  2LCS A;  4RCC A;  2ENM A;  1VQK Q;  4A4K A;  3LWH A;  3QYG B;  3URG A;  1M90 C;  1QVF P;  1V1C A;  2XU8 A;  2V8K A;  4M75 G;  1MV0 B;  1OYX A;  1MV3 A;  4LD6 A;  5KE3 A;  1RL2 A;  3M0U A;  1X6G A;  4M7D G;  5CKE A;  1PHT A;  3VYG A;  4AG2 C;  2HBW A;  4ME7 A;  4QVD A;  4M78 E;  3C4S A;  1C0M A;  2VAS A;  4B9X A;  3ZFJ A;  3REB B;  1UGQ B;  2K5F A;  1H3Z A;  3G6E A;  2EPD A;  3H0H A;  5KYW A;  1VQK T;  2EFI A;  3SWN A;  2ZPF B;  2D8J A;  4KUL A;  3BY7 A;  2ATC B;  5C0M A;  1WHJ A;  1YHQ A;  3G71 T;  3QWY A;  1M5Q 1;  3UWN A;  3X24 B;  2M16 A;  1M8V A;  2A36 A;  1VQ6 T;  3M9Q A;  2DVE A;  3CC4 A;  2J6F A;  4M4Z A;  4X9C A;  5IN1 A;  4FIB A;  2YDL A;  4RTT A;  1WPY A;  2RK1 A;  2XID A;  4JJB A;  1YJW T;  4GY5 A;  4XU0 A;  1VQO A;  3P8B B;  1RLQ C;  3AT1 B;  1QW1 A;  3L2Q A;  3INZ A;  4LUD A;  4FM4 B;  2F5T X;  4C0G A;  1LVK A;  4IUR A;  3DLM A;  1KQS P;  2EGC A;  1QQJ A;  4PKC C;  1OPK A;  1ZA1 B;  4GLK A;  4EDU A;  4B9W A;  1WI7 A;  5FRM A;  4PJO F;  3FRN A;  4ZNX A;  4M7A C;  2A08 A;  2JNG A;  1TWB A;  2DTH A;  4XTU A;  4TVR A;  1W4S A;  2F2V A;  2MCN A;  2PUK B;  3Q1J A;  3OBW A;  2HZY A;  5LJ5 d;  1WFW A;  4ANJ A;  3JCM f;  1LJO A;  5EG2 A;  3QDR B;  5GAM d;  4M75 E;  3ER0 A;  5GAN 3;  1ZUU A;  3JCM h;  3GLX A;  2EQI A;  2J6K A;  4JPB W;  1VQK A;  1EX4 A;  4PFZ A;  4MZP A;  4EMK B;  1VYU A;  4C92 G;  1VQN T;  4HVU A;  1I5L A;  4M7D E;  2QXF A;  2KBT A;  2FYK A;  4CC3 A;  3G71 A;  1PD0 A;  1RUW A;  1IHW A;  2RI5 A;  1VQ6 A;  4F04 B;  3LX7 A;  3JB9 D;  2HD0 A;  3FLG A;  3JB9 G;  1BI3 A;  3RKY A;  3CCU Q;  4OGE A;  3V7S A;  1JJ2 A;  2CP2 A;  2FPE A;  4NL2 A;  4RTY A;  4X34 A;  2HCK A;  5CIU A;  1YJW A;  3CME Q;  1SSF A;  4PLL A;  5HCK A;  1M1F A;  2E41 A;  3FIF A;  4A4E A;  2O9S A;  1JJ2 S;  1KHI A;  1TU0 B;  4IIM A;  2JOY A;  3M0P A;  1VQ8 T;  1HJD A;  1ZBJ A;  3CCU T;  2ZGW A;  4N0A A;  2AIR B;  1R8O B;  3A8G B;  2RHY A;  3VKI A;  1BIB A;  1OZ3 A;  4M7A F;  2HAX A;  5D6W A;  2KVQ G;  1WHM A;  1K9M C;  2ZPI B;  3OMC A;  3CCQ Q;  2C0O A;  1Q7Y U;  2NUT B;  4FT2 A;  4FL6 A;  4AG1 C;  5KYX B;  1QVF A;  5EC7 A;  2C0I A;  4C8Q D;  2MWP A;  2QGG A;  4C8Q G;  3OS0 A;  2EYW A;  1WQW A;  2RH2 A;  2FZK B;  3RNJ A;  2QQ9 A;  1Q82 U;  1QVF S;  1VQN A;  3X26 B;  2H3E B;  3OW2 P;  2P0K A;  1JBM A;  2CRE A;  2RPN A;  1FXX A;  4MZM A;  3CCQ T;  1WA7 A;  1O9S A;  4IUU A;  3M58 A;  2G3R A;  3M5A A;  3FC3 A;  2JN0 A;  2D0N A;  2DBM A;  2F2X A;  2RNA A;  4N4H A;  5LJ3 j;  2CP0 A;  2PVO B;  2GFA A;  2RQV A;  1Q7Y R;  2KDS A;  2E3I A;  3M53 A;  3EAE A;  1H8K A;  1KFZ A;  1XNI A;  1IXD A;  2OAW A;  3QXE B;  4BUG A;  4MZT A;  2DLP A;  4LDU A;  4A53 A;  2NUZ A;  1OPL A;  4HVV A;  3VRY A;  3QO3 A;  1SHF A;  3EG2 A;  2CYZ B;  4HA8 A;  2BTT A;  4CC7 A;  3SFM A;  1VQ8 A;  2CZ0 B;  1MNE A;  3REA B;  3CCU A;  5J26 A;  4XTX A;  1Y07 A;  4LN2 A;  3MET A;  3GIB A;  1KQS A;  1QWE A;  4JZ3 A;  5L23 A;  4F7U F;  2KQW A;  2XDD A;  4A4F A;  4LDX A;  1D3B B;  1WLP B;  4E6R A;  3TU4 K;  4C5H A;  4M75 A;  2RQW A;  2O01 E;  1UFF A;  4OML A;  4HXJ A;  1KQS S;  2KR3 A;  1V76 A;  2DTO A;  4F17 A;  3EFO B;  1I4K 1;  4M7D A;  3I35 A;  3QBY A;  1AEY A;  4DBH A;  2GQV A;  4JJD A;  4XU1 A;  1Q82 C;  3ZEH A;  1Z9Q A;  3EH1 A;  2LQW A;  4VUB A;  2V1Q A;  3RMS A;  2K6D A;  2IG0 A;  1VQ4 Q;  3CCQ A;  3M57 A;  2A0F B;  4C8Q E;  3PMT A;  4M78 B;  1NBE B;  1K0X A;  4CRI A;  1YJ9 T;  3LGL A;  1Q86 U;  1F1B B;  1LCK A;  3OYA A;  3L2W A;  3EH2 A;  1IB8 A;  2ZAE A;  2O88 A;  4HKE A;  2KRN A;  4JRK A;  4MDW A;  1OX9 A;  4FU6 A;  3M54 A;  2YT6 A;  2JS0 A;  2IPO B;  3OYY A;  1YJN Q;  1R77 A;  4KGZ B;  1WNL A;  2QA4 Q;  1YIJ Q;  1U5S A;  2E65 A;  1VQ4 T;  1QP2 A;  3VUB A;  4QW2 A;  3C94 A;  1PKS A;  1K73 U;  3VRZ A;  2KNB B;  2NYS A;  3VS6 A;  4Q5W A;  2YUN A;  1NLO C;  3A98 A;  4K11 A;  3JCM V;  1Y71 A;  1Y57 A;  4XK8 E;  1QP3 A;  1TXQ A;  2EYX A;  2FL7 A;  3ME9 A;  1M3B A;  2GGR A;  4FSS A;  4M77 B;  4KUI A;  3JB9 I;  2NWM A;  2JTM A;  2QA4 T;  1YIJ T;  5LJ5 g;  3OB9 A;  2JM8 A;  2QEX Q;  1FMV A;  1S72 T;  2DL8 A;  3NGP A;  2CZ7 B;  1Y0M A;  5GAM g;  2NUP A;  2PUO B;  1Y96 A;  3PT9 A;  2CSI A;  1GBQ A;  4Z02 A;  2FPD A;  4WCI A;  5KH6 A;  2BE9 B;  5CQX A;  1TUC A;  4AFU C;  4FYV B;  5D6Y A;  4E7H A;  1SRL A;  2HSP A;  1PC0 A;  1YP5 A;  2LTO A;  3SDZ A;  1W2B P;  2LC4 A;  4C92 A;  1BU1 A;  1VIE A;  2IIM A;  3CCM Q;  2QEX T;  5I2M A;  1J3T A;  1YJ9 A;  1BI1 A;  2LVM A;  1Q86 C;  1RAA B;  1JXM A;  3LLR A;  5GAO n;  3OW2 A;  2ESW A;  1D1B A;  2KXD A;  4CI0 C;  3V7C A;  5GAN 7;  3THK A;  5LJ5 f;  3NHN A;  2CP7 A;  2KXC A;  2QTV A;  2EQM A;  3OW2 S;  3M0Q A;  5LJ5 h;  1KG1 A;  2E3H A;  1FYN A;  1Y7X A;  1EIF A;  2L3P A;  1CKA A;  1WXU A;  1VQ4 A;  3RDV A;  1QCO A;  3UPU A;  3CCM T;  2XDP A;  5GJW B;  2XIC A;  2DRK A;  1Q81 C;  1K73 C;  1MHN A;  1XTD A;  5GAN e;  4QVC A;  4RUG A;  2L5Q A;  1AVZ C;  1WHH A;  2LT1 A;  4JJN K;  1T0J A;  4M77 F;  4PJO A;  1X01 A;  1BKB A;  2DL7 A;  4ORZ A;  4ATO A;  2QA4 A;  2EBP A;  1YIJ A;  1JO8 A;  1M4Z A;  2YHT A;  2FRY A;  1YI2 T;  1RAG B;  1S72 A;  4BY6 B;  1AWJ A;  4J9F A;  1ZSZ C;  4PNO A;  1M90 U;  2EAY A;  3I5S A;  4J9H A;  2XD0 A;  2XMF A;  4XTW A;  1FMW A;  1PD1 A;  4FCY A;  4XTV A;  3G4S Q;  2LRQ A;  2FVU A;  2DPP B;  1AZE A;  4BI8 B;  1EZZ B;  4LE9 A;  1IRX A;  3RKX A;  3BFM A;  3MPU B;  2QEX A;  1SPK A;  3BW1 A;  3CBO A;  4FYX B;  2KSS A;  1H92 A;  4RMO A;  1WDX A;  2DJZ A;  3G4S T;  2DO3 A;  1NPP A;  3JRZ A;  1FWZ A;  2GTO A;  2RK2 A;  1M90 R;  1CSK A;  4Z88 A;  1GCQ A;  1PWT A;  3FJP A;  3CCM A;  3RIR A;  3PFS A;  1QVG P;  5FRN A;  3VJP A;  1ZQ1 A;  4ZGJ B;  2X3X D;  1PCX A;  3HSB A;  1VQP Q;  2HL3 A;  2QQR A;  2RMO A;  4AFZ C;  3LWI A;  4JRQ A;  3KFV A;  1UEB A;  5A0L A;  5KYU A;  2CP6 A;  5HK3 A;  4QQD A;  1OU9 A;  4PJO C;  1X43 A;  2J7I A;  4J6W A;  2HBP A;  3X25 B;  2KGT A;  2PTK A;  3PIO A;  2K4Y A;  4NS5 A;  1YI2 A;  4M7A A;  4A4G A;  3OYF A;  5GJV B;  1I07 A;  4RTZ A;  2DBK A;  3L1A A;  4OF1 A;  3EHQ A;  2RJF A;  4AFS C;  4J5Y A;  4M75 D;  1RAC B;  2CUD A;  1VQP T;  2AT1 B;  2KI7 A;  2F5K A;  2E70 A;  3VS2 A;  5IHK A;  2K7A A;  3V8J A;  2QG9 B;  4M7D D;  4LD9 K;  4BE0 A;  2M1H A;  2YWW A;  3C0C A;  4C0D B;  4BDZ A;  3H0I A;  1I5O B;  1UGP B;  5FLX E;  5IAY A;  4F14 A;  2XKO C;  3X20 B;  1K1Z A;  1YBY A;  4E7J A;  3JCM c;  2JMA A;  3M59 A;  2VB6 A;  3SB2 A;  2RB6 A;  4X1V A;  6AT1 B;  4JRP A;  4FT4 A;  1W2B A;  1UJY A;  2ABL A;  3H41 A;  3G4S A;  4KRT A;  4C8Q B;  2LJ1 A;  3HRT A;  2MI6 A;  2KEA A;  2LJ0 A;  1W2B S;  5DM7 R;  3GOX A;  1IRE B;  3FEO A;  1GCQ C;  2P4R A;  4A54 A;  2QTX A;  2KMT A;  1D09 B;  3JCM g;  2K2V A;  2OTJ Q;  4FW2 A;  2QDY B;  3TRE A;  3M55 A;  3GNF B;  1H3H A;  3OYJ A;  3G1J A;  2DER A;  2HEQ A;  1UGS B;  1UDL A;  4L59 A;  5CKH A;  3JB9 F;  1D0X A;  3S3M A;  5GAN 5;  2RQR A;  2K2M A;  3SEM A;  2O9V A;  2LQK A;  1GRI A;  5A2Q E;  1MMD A;  2R5M A;  3PMI A;  4FW1 A;  1NG2 A;  2RQU A;  3BE3 A;  4JDS A;  3OSS C;  4C5E A;  4F7U A;  4ZN1 A;  2X4J A;  1DJ7 B;  2NUT A;  3CQT A;  3UA7 A;  1K9M U;  1VQP A;  5GAO l;  5KYN A;  2BIV A;  3I9Q A;  4MMK A;  1PG5 B;  1M3C A;  1CKB A;  1H64 1;  4OVA A;  4IUP A;  1G3W A;  4KGX B;  2DFU A;  1WGS A;  2OTL Q;  3JB9 J;  4XQ3 A;  3A8O B;  3QWX X;  3JAM E;  1KD1 U;  3PTA A;  1G83 A;  3CCV Q;  4C92 D;  1AWX A;  5GMK e;  2HKN A;  5GAO r;  2CSQ A;  2PNI A;  1T3L A;  3I56 Q;  2LMJ A;  3CCR Q;  3EGX A;  4C8Q F;  3H6Z A;  2VUB A;  1UJ0 A;  1MUZ A;  4E7S A;  3ASK A;  4OMP A;  1B7T A;  2VKN A;  1K9M R;  2M9U A;  4JRI A;  4E7K A;  3CCV T;  1C1A A;  4PFP A;  3VS7 A;  5KYW B;  3SWN B;  3DKM A;  1KC8 U;  1K8A U;  5LJ5 j;  4RTW A;  1IGU A;  2YUO A;  5A0G A;  1QVG A;  2L3R A;  5D6X A;  2BZY A;  3KUF A;  2RHZ A;  2L3Q A;  3PVQ A;  1KD1 R;  5GAM j;  1ZA2 B;  1KQ2 A;  4KGV B;  2EJG A;  5C6S A;  4KH1 B;  4PJO G;  1QVG S;  2MF2 A;  3CME T;  4PL6 A;  3MKD A;  2ZPG B;  1RLP C;  1WHK A;  2JW4 A;  2DF6 A;  1M1K U;  4PJJ A;  3UA6 A;  2DET A;  2QYZ A;  4DBF A;  3A8L B;  2I0N A;  1G2B A;  2L89 A;  4PFO A;  2E6Z A;  2O2O A;  1IZ6 A;  2CKK A;  2CH4 A;  4HT9 A;  3OYK A;  1NE8 A;  1VQ5 Q;  4R55 A;  3LYI A;  5FWB A;  1HD3 A;  2AKK A;  2KRM A;  1MGQ A;  4O5V A;  2RD1 A;  1OOT A;  4J8O A;  3D7S B;  4IKF A;  1KD1 C;  2RI2 A;  3QPH A;  4FSX A;  2DAQ A;  1U8R A;  4OMM A;  1JB0 E;  2EGA A;  2RJE A;  3OYN A;  1X2Q A;  4XU2 A;  2ROT A;  3RBB B;  1X6O A;  5CKB A;  1ZUY A;  2V26 A;  4LUE A;  3PIP A;  2JVV A;  4C92 E;  3V7R A;  4NOY A;  4PLI A;  1WZO A;  4IIO A;  3NFC A;  4LNP A;  1M1K R;  1VQM Q;  4C0F A;  3VV0 A;  3CCV A;  4J7I A;  4PK4 A;  3P8D A;  3EFS A;  1PRL C;  4QQ6 A;  3VS5 A;  5J39 A;  1B34 A;  2WSE E;  4DBR A;  3FB9 A;  1PSE A;  1KC8 C;  1K8A C;  2DKG A;  1E6H A;  3EG1 A;  4QQG A;  4ZGE B;  2KK4 A;  2M0O A;  1Q82 R;  5GAN d;  2C06 A;  3JB9 H;  4D8D A;  4WTO B;  2YLB A;  2E5K A;  3NTI A;  2DXB A;  2DXU A;  3GF5 A;  2X9H A;  2ZPB B;  1VQM T;  4R0K A;  2CH4 W;  3CME A;  3S3O A;  2K3B A;  2D8H A;  1RI9 A;  3HRU A;  4M7A D;  4M7A G;  3HL8 A;  1M1K C;  2XG8 D;  4E7Z A;  1AHJ B;  3H0F A;  1YCY A;  2COY A;  1RAE B;  5KYY A;  3OYI A;  4HCC A;  2DK3 A;  5GAO m;  4PJO E;  5IH2 A;  1G3Y A;  4OB3 B;  3A5Z B;  4Z89 A;  1WQ7 A;  2FZC B;  3MP8 A;  4ZGD B;  2H3J A;  2ZCF B;  2W10 A;  2GF7 A;  3EFR A;  2DIG A;  1PNJ A;  4KUD K;  4LXC A;  2AZS A;  1OQK A;  1SHG A;  5FU7 C;  3EG9 A;  3CPW P;  2BE7 D;  5I22 A;  1ABO A;  3OYL A;  2LX7 A;  2MOX A;  5GAM e;  1GFD A;  3DLL A;  2KT1 A;  1U1S A;  1VQ7 Q;  2JS2 A;  3EGD A;  3ULR B;  2H8H A;  3PGG A;  2KRS A;  2LQ8 A;  4BD3 A;  1EFN A;  1Q81 U;  2X35 A;  3TVT A;  2QQS A;  2DL5 A;  1HK9 A;  2FB7 A;  1I1J A;  4ZTF A;  3PE0 A;  4M77 C;  4ESR A;  1K4U S;  2VGN A;  1VQM A;  1X6B A;  3R6O A;  5KCO A;  1N5Z A;  1QWF A;  1VQL Q;  1SG5 A;  5GAN 8;  1YJN T;  3L2U A;  1SKU B;  1FMK A;  4Y91 A;  1Q86 R;  4F7U G;  2VGM A;  3QSU A;  2JUF A;  4AT1 B;  2DIQ A;  3CC2 Q;  1NJI U;  1BB9 A;  3MJX A;  2EKO A;  4KBM B;  1ZSZ A;  3A1P A;  4MML A;  2LX9 A;  2BZ8 A;  2CZ6 B;  5LJ3 e;  3OS2 A;  4J9B A;  4M7A E;  1VYT A;  1MMA A;  1UE9 A;  2I2L A;  2Y4X A;  3OYH A;  2V1R A;  2WSF E;  4XU3 A;  2J6O A;  2D1X A;  1VQL T;  2QAZ A;  1Q81 R;  2EQU A;  2EGE A;  3BDU A;  1K73 R;  2DEQ A;  4M78 F;  1TUD A;  5HY6 A;  2IVW A;  4HCZ A;  1A0N B;  1MND A;  4EMG A;  2F1L A;  1N8R C;  3CC2 T;  4J6Y A;  4M75 B;  4LDW A;  1GL5 A;  2LQN A;  2DJQ A;  1BBZ A;  2P84 A;  3CXC S;  5KCH A;  2YLC A;  4JJC A;  4OP0 A;  4E7L A;  2LZ6 B;  3CMA Q;  4JLG A;  4M7D B;  8ATC B;  1RAI B;  3OMG A;  2OJ2 A;  1ZSG A;  2O4X A;  2PZ1 A;  4ZN3 A;  1HXD A;  4DEX A;  4DOW A;  1M2V A;  2CP5 A;  1T0H A;  4JS4 A;  2FZG B;  1ABQ A;  3JSC A;  3UF4 A;  3UT1 A;  1QLY A;  2OAU A;  1WXT A;  1ZX6 A;  1QCF A;  3DB3 A;  2DX1 A;  2F69 A;  2X51 A;  3M4G A;  2QI2 A;  1O75 A;  3J80 E;  5GAO q;  3MCA B;  3HPW A;  4BAC A;  4RG8 A;  3CMA T;  2DXT A;  4ELY C;  1QMC A;  1ZLM A;  3KXT A;  5I11 A;  2YXY A;  3MHX A;  2VXE A;  3JCM X;  4BY6 C;  1I0C A;  1YJN A;  4XTZ A;  2JJ9 A;  2X4X A;  2RJC A;  2ZPH B;  1WXB A;  4IUT A;  4IUQ A;  1K76 A;  4EIK A;  1NJI C;  4R56 A;  2MYS A;  1NZ9 A;  3MP6 A;  1TH7 A;  2B86 A;  1N9S A;  1S1N A;  2EYY A;  3HFN A;  3F70 A;  2E1H A;  1TG0 A;  1W1F A;  3H9N A;  2EW3 A;  5CR2 A;  1TOV A;  4OB2 B;  4F7U E;  4JZ4 A;  1SSH A;  3RER A;  2B8A A;  1RI0 A;  1T3S A;  1VQL A;  5A0D A;  2W0Z A;  2VV5 A;  4M75 F;  3QUI A;  1M2O A;  2K5L A;  2COZ A;  3CC2 A;  3HKS A;  3SD4 A;  4UC4 A;  2MAM A;  3A8H B;  4YTL A;  1YHQ Q;  4M7D F;  3HFO A;  3MP1 A;  3CD6 Q;  2NUP B;  2VVK A;  3CC4 Q;  1Y96 B;  4D8K A;  3JV3 A;  3CPW A;  2WAC A;  5LL6 S;  4QVZ A;  3A8M B;  1UGV A;  2M0Y A;  1TTH B;  4C92 B;  3CPW S;  2KRO A;  3NTK A;  5GAN g;  2CGH A;  3RKW A;  4BE2 A;  3VYH B;  2AHJ B;  2DZ9 A;  3CMA A;  4F16 A;  3CD6 T;  5GAN 4;  1K0S A;  5D7U A;  2JTF A;  1W70 A;  4RG2 A;  3OYM A;  4M77 G;  1KK7 A;  3TSZ A;  5FU6 B;  2G6F X;  2YUQ A;  1BCO A;  2QQA A;  4E7I A;  4HCK A;  2Y90 A;  4OMF B;  3NMZ C;  5M9O A;  3JCM e;  4J9I A;  1JEG A;  1WYX A;  4J6X A;  3L2Z A;  4BE1 A;  1RAF B;  1U06 A;  4C0D C;  3PVL A;  2QDL A;  2K9G A;  5HKC A;  1QCN A;  3OY9 A;  2DTI A;  3I55 Q;  2FRW A;  2GQI A;  5GAN f;  2M02 A;  4EMK A;  5HK0 A;  3VS3 A;  3HHT B;  2CUB A;  3OA6 A;  4DOV A;  3TSW A;  2HQE A;  3N5B B;  2DVJ A;  3HP9 A;  5GAN h;  5J3B A;  3LH0 A;  1ARK A;  3G71 Q;  3LGF A;  3ZBD A;  4C8Q C;  1QKX A;  2OI3 A;  1M3A A;  1VQ6 Q;  4Y92 A;  2DXC A;  2XI9 A;  1M9S A;  4OMQ A;  3KBG A;  2O31 A;  1KIK A;  2HL5 C;  3I55 T;  1K9A A;  2HQX A;  2DYB A;  4GLM A;  1YJW Q;  4C92 F;  5I21 A;  2YRD A;  4E2F B;  1HYO A;  5IHN A;  1KQ1 A;  5CVI A;  1YNZ A;  1M30 A;  3FJ5 A;  9ATC B;  3DB4 A;  2KAF A;  2RHX A;  2L3S A;  1X2K A;  3CD6 A;  3CBP A;  4ELZ C;  4N4G A;  1KJW A;  2COW A;  4J9D A;  1UB4 A;  3JCM J;  3OYB A;  3TEE A;  1YFN A;  2D6F A;  4JS5 A;  5IT9 E;  2QGF B;  1UG1 A;  1WJS A;  3QDF A;  1ZUK A;  2VYT A;  2VWF A;  2RHU A;  2FHD A;  1G3T A;  4J9E A;  1U1T A;  4BDY A;  2LNV A;  4B6M A;  2KE9 A;  2PQW A;  3SHW A;  5DLO A;  2R5A A;  2OTJ T;  4Z8A A;  3CCS Q;  2J06 A;  2ZZD A;  2K5I A;  1IGQ A;  1ZBX A;  2DMO A;  5KYX A;  5GMK l;  4EMH A;  4M77 E;  1HSQ A;  3M0S A;  2MPX C;  3E2U A;  5CKF A;  1BYM A;  5KYU B;  2KYB A;  2FG0 A;  1VQ9 Q;  3MEW A;  1SEM A;  2RO0 A;  4EMK C;  3QG1 A;  1VQN Q;  4XTY A;  2DZC A;  2WSC E;  4QKU A;  3RR6 A;  5CCA A;  4M7A B;  5IXB A;  2SEM A;  2V8J A;  3QJ6 A;  3CCS T;  1G8X A;  3EG3 A;  1VOM A;  2D9T A;  2EQK A;  2GNC A;  2VC8 A;  2A28 A;  2JMC A;  4OB0 B;  5L8R E;  2LCC A;  2EYQ A;  3I55 A;  2BKD N;  4Y28 E;  3L42 A;  1VQ9 T;  4OMO A;  2OTL T;  2GBQ A;  2V8I A;  3EGU A;  2RN8 A;  3SWN C;  4E47 A;  1E6G A;  1WJR A;  5I2S A;  4NL3 A;  2KT8 A;  1KSW A;  4PJN A;  4JLI A;  1BI0 A;  2R58 A;  1VQ8 Q;  1IHV A;  3I56 T;  3V8K A;  2RI3 A;  1AWO A;  3CCR T;  1VA7 A;  4N4I A;  4DEY A;  3RES A;  4DA4 A;  1C6V X;  3J81 E;  3GPL A;  1MMG A;  2VXF A;  3UAT A;  2MWO A;  3OBY A;  2ED1 A;  3OS1 A;  1PSF A;  2D0Q B;  3HRS A;  4DQ2 A;  4PJO D;  1TS9 A;  3TQ7 P;  4IUV A;  1D3B A;  3PNW C;  2OTJ A;  1UHF A;  3OS5 A;  2HKQ B;  2Z0W A;  1RAD B;  3EFO A;  2L0A A;  1N6A A;  1TUG B;  1XQH A;  2GFU A;  3CC7 Q;  3O5Z A;  1AWW A;  1LNX A;  3CXC P;  1JU5 C;  5LJ3 d;  3JCM P;  1AOJ A;  3J7A F;  1GCP A;  2E4H A;  1KC8 R;  1K8A R;  4F7U B;  2CS7 A;  4M78 A;  3CCS A;  2LJ3 A;  2X4W A;  3OSV A;  5CKD A;  2QK0 A;  2QAS A;  4AFQ C;  4HVW A;  1M1G A;  2A37 A;  2AK5 A;  5FWC A;  2RF0 A;  4AMC A;  3CC7 T;  4J9G A;  1BI2 A;  1G5V A;  3U23 A;  1VQ9 A;  2OTL A;  1VQ5 T;  3GP8 A;  2PU9 B;  4PJM A;  2LNH B;  2CZ1 B;  2KYM A;  5CK9 A;  2EQJ A;  2NLU A;  2LDM A;  3RMQ A;  4PJL A;  4WF2 A;  1JRI A;  3CEY A;  4X9D A;  5GAN 2;  1G3S A;  3I56 A;  3CCR A;  2YSQ A;  1JXO A;  3EGX B;  3C12 A;  2DL4 A;  5CAI A;  2DRM A;  3TCJ A;  2K57 A;  1RAH B;  5GMK h;  3CCE Q;  1I8F A;  1V29 B;  4M77 A;  3VS1 A;  1QVP A;  1R0C B;  1Z9Z A;  4P5N A;  2K3X A;  4L6V 5;  4RCB A;  5GMK i;  2JT4 A;  4HCB A;  2J05 A;  4BB7 A;  5FRO A;  4FYY B;  3JCM Q;  2XK0 A;  2C0T A;  2YRV A;  4EPC A;  2R57 A;  5GMK m;  3QJY A;  4KH0 B;  2CP3 A;  3G7Z A;  1VYV A;  3QYH B;  4C5G A; 
#chains in the Genus database with same CATH homology
 1HXD A;  4A4G A;  3OYF A;  4N0A C;  4DOW A;  2RI5 A;  3L1A A;  4OF1 A;  2RJF A;  1VQ6 A;  4J5Y A;  3LX7 A;  3JB9 D;  4M75 D;  2HD0 A;  3FLG A;  4JS4 A;  3JB9 G;  3CCE T;  3JSC A;  3UT1 A;  1BI3 A;  3RKY A;  1VQP T;  2OAU A;  4OGE A;  2F5K A;  3V7S A;  2E70 A;  1JJ2 A;  1NPR A;  3DB3 A;  2F69 A;  1OZ2 A;  4NL2 A;  4X34 A;  3V8J A;  3GNG A;  4M78 C;  3M4G A;  4KT0 E;  2GCX A;  2QI2 A;  3CBM A;  1Q7Y C;  4LD9 K;  4M7D D;  4BE0 A;  1O75 A;  5CIU A;  3J80 E;  1YJW A;  2M1H A;  4C0D B;  4BDZ A;  1SSF A;  4PLL A;  2EJF A;  5GAO q;  3FDR A;  3MCA B;  1M1F A;  3HPW A;  5LJ5 e;  2E41 A;  4RG8 A;  4BAC A;  3CMA T;  2DXT A;  4ELY C;  1UGP B;  3FIF A;  5FLX E;  5IAY A;  4A4E A;  2E5Q A;  2XKO C;  2DD4 A;  3X20 B;  1N8R U;  3KXT A;  1JJ2 S;  3VUZ A;  3CC7 A;  1YBY A;  1KHI A;  2VXE A;  3MHX A;  4E7J A;  3JCM c;  4C0Z A;  5GAN j;  2JOY A;  3JCM X;  4BY6 C;  3M59 A;  5KE2 A;  1YJN A;  4XTZ A;  3SB2 A;  1VQ5 A;  2RB6 A;  2X4X A;  3CCJ T;  4JRP A;  2RJC A;  2ZPH B;  1VQ8 T;  4FT4 A;  1W2B A;  4IUT A;  4IUQ A;  3CCU T;  3RUX A;  3G4S A;  2ZGW A;  4R56 A;  4N0A A;  1NJI C;  1R8O B;  3A8G B;  1NZ9 A;  2RHY A;  3MP6 A;  4C8Q B;  3VKI A;  1BIB A;  1TH7 A;  1N9S A;  3HFN A;  3HRT A;  1OZ3 A;  2EIF A;  2ZPE B;  2MI6 A;  2E1H A;  3F70 A;  3OQ5 A;  3JCM b;  1W2B S;  5DM7 R;  2HAX A;  3GOX A;  4M7A F;  5D6W A;  1IRE B;  3FEO A;  2KVQ G;  2A3L A;  5CR2 A;  1K9M C;  4OB2 B;  4F7U E;  2ZPI B;  3OMC A;  4J83 A;  1I81 A;  5FU7 B;  3VU3 C;  4A54 A;  1Q7Y U;  3RER A;  2QTX A;  2KMT A;  2B8A A;  3BDL A;  4FT2 A;  1RI0 A;  5AYF A;  4FL6 A;  1VQL A;  3JCM g;  2K2V A;  2PVG B;  5A0D A;  2XDB A;  3E19 A;  2QDY B;  3TRE A;  3M55 A;  3GNF B;  1QVF A;  2A7Y A;  3OYJ A;  1WJQ A;  1UGS B;  4L59 A;  2VV5 A;  4M75 F;  4LDV A;  5CKH A;  3CCL T;  3S3M A;  4C8Q D;  2MWP A;  3JB9 F;  3QUI A;  4C8Q G;  5GAN 5;  2K5L A;  3V8L A;  3CC2 A;  3OS0 A;  3HKS A;  3SD4 A;  1WQW A;  2RH2 A;  3OYE A;  4UC4 A;  2MAM A;  3A8H B;  4YTL A;  3QZ5 B;  2QQ9 A;  1Q82 U;  2LQK A;  4M7D F;  3HFO A;  1QVF S;  1VQN A;  3MP1 A;  3X26 B;  1B34 B;  5A2Q E;  2R5M A;  3PMI A;  2P0K A;  1KHC A;  1Y96 B;  3JCM d;  3CPW A;  2WAC A;  5LL6 S;  1JBM A;  1FXX A;  4JDS A;  4MZM A;  3CCQ T;  3OSS C;  4QVZ A;  4C5E A;  4F7U A;  3A8M B;  4ZN1 A;  2X4J A;  5CQY A;  1DJ7 B;  5DLQ E;  2E12 A;  2P0Q A;  1O9S A;  2RHI A;  2K3Y A;  4IUU A;  1UGR B;  3CCE A;  5GAO p;  3M58 A;  3MEU A;  3QYH B;  2G3R A;  1K9M U;  1VQP A;  3M5A A;  4C5I A;  2JN0 A;  4C92 B;  5GAO l;  3FC3 A;  3CPW S;  2JZ2 A;  3OYC A;  4N4H A;  2BIV A;  5LJ3 j;  4MMK A;  1H64 1;  2PVO B;  2GFA A;  4M75 C;  3CXC A;  1XOV A;  3NTK A;  2RJD A;  4J7F A;  5GAN g;  2CGH A;  4OVA A;  4IUP A;  3RKW A;  2KDS A;  4BE2 A;  1G3W A;  3VYH B;  3L2R A;  3M53 A;  3EAE A;  1WGS A;  2AHJ B;  2DZ9 A;  3CMA A;  1OI1 A;  3CD6 T;  5GAN 4;  1XNI A;  1N9R A;  3JB9 J;  3QXE B;  4M7D C;  4BUG A;  4MZT A;  2JTF A;  4LDU A;  4XQ3 A;  4A53 A;  3A8O B;  2RM4 A;  4RG2 A;  3JAM E;  1KD1 U;  3PTA A;  3OYM A;  3QO3 A;  3MEV A;  4JUV A;  4C92 D;  1ZHI A;  2CYZ B;  4HA8 A;  5GMK e;  3CCJ A;  4M77 G;  1VQ8 A;  3SFM A;  5FU6 B;  5GAO r;  2CZ0 B;  2E6N A;  2QQA A;  3CCU A;  5J26 A;  4XTX A;  4E7I A;  1Y07 A;  2Y90 A;  4OMF B;  3MET A;  2RA2 A;  4ZTJ A;  5M9O A;  3JCM e;  4C8Q F;  3H6Z A;  2VUB A;  3E1S A;  3GIB A;  4A4H A;  3O8V A;  1FX7 A;  4J6X A;  3L2Z A;  4BE1 A;  3ASK A;  3WXM B;  1KQS A;  4C0D C;  3NTH A;  2P4T A;  5CO7 A;  4F7U F;  2KQW A;  3QZ9 B;  2XDD A;  4A4F A;  2HNI A;  4LDX A;  5HKC A;  3OYG A;  1D3B B;  3OY9 A;  3TU4 K;  2DTI A;  4C5H A;  4M75 A;  3C95 A;  4OGC A;  5GAN 6;  2M9U A;  2O01 E;  4BI4 A;  2DD5 A;  2E10 A;  4JRI A;  4E7K A;  3CCV T;  1KQS S;  5GAN f;  2DTO A;  4EMK A;  5HK0 A;  3SWN B;  3DKM A;  1VIF A;  3HHT B;  1I4K 1;  1VQ7 A;  3OA6 A;  4M7D A;  4DOV A;  3CCL A;  3QBY A;  1KC8 U;  1K8A U;  5LJ5 j;  2HQE A;  3N5B B;  5DY9 A;  3HP9 A;  5GAM f;  4BI3 A;  5GAN h;  5A0G A;  1QVG A;  2QQB A;  2GQV A;  2L8D A;  2P0P A;  5J3B A;  3LH0 A;  2L3R A;  2XHC A;  5D6X A;  3KUF A;  3LGF A;  4XU1 A;  3QKJ A;  1Q82 C;  2RHZ A;  3P8H A;  3ZEH A;  1GXI E;  3ZBD A;  4C8Q C;  5GAM h;  5GAM j;  1YIT T;  1KQ2 A;  2DXC A;  2EJG A;  4VUB A;  3UDC A;  3WVE B;  2XI9 A;  1BIA A;  1M9S A;  3RMS A;  5C6S A;  2IG0 A;  3KBG A;  3CCQ A;  4PJO G;  1QVG S;  3X28 B;  3E9G A;  3I55 T;  3M57 A;  4C8Q E;  3JCM W;  3PMT A;  2EJ9 A;  4M78 B;  2MF2 A;  2HQX A;  4PL6 A;  3T9N A;  5LJ3 g;  3CME T;  4CRI A;  1YJ9 T;  3LGL A;  4V2S A;  2ZPG B;  1Q86 U;  3S3N A;  4C92 F;  5I21 A;  4L5G A;  3OYA A;  3L2W A;  1M1K U;  4HT8 A;  3E9F A;  4II1 A;  1KQ1 A;  5CVI A;  1VUB A;  3A8L B;  3QII A;  4HKE A;  3DB4 A;  2KAF A;  4JRK A;  4MDW A;  2RHX A;  2L89 A;  4OB1 B;  2LT4 A;  4FU6 A;  2E6Z A;  3M54 A;  1IZ6 A;  2CKK A;  4HT9 A;  3OYY A;  1NE8 A;  3OYK A;  3CD6 A;  4LDY A;  3CBP A;  4M78 D;  4R55 A;  3LYI A;  4ELZ C;  4N4G A;  1X75 C;  4M78 G;  4O6J A;  1WNL A;  1MGQ A;  1UB4 A;  2E65 A;  3JCM J;  1VQ4 T;  4O5V A;  3OYB A;  1QP2 A;  2RD1 A;  3TEE A;  1P92 A;  4J8O A;  3VUB A;  4JS5 A;  4IKF A;  2D6F A;  4QW2 A;  5IT9 E;  1KD1 C;  3C94 A;  1WJS A;  1K73 U;  2RI2 A;  4C8Q A;  3QPH A;  4FSX A;  2VYT A;  5GAN 2;  2RHU A;  2FHD A;  1G3T A;  2DAQ A;  1U8R A;  4Q5W A;  3CC2 T;  1U1T A;  4BDY A;  2LNV A;  1JB0 E;  2RJE A;  3H8Z A;  3JCM V;  3OYN A;  4C92 C;  1Y71 A;  3L2V A;  2PQW A;  5DLO A;  4XU2 A;  2R5A A;  3MO8 A;  1X6O A;  4XK8 E;  2OTJ T;  1QP3 A;  2PVD B;  3CPF A;  2Y4Y A;  2ZZD A;  2K5I A;  5LJ3 f;  1ZBX A;  3G6E T;  4D6W A;  5CKB A;  2FL7 A;  3PIP A;  2JVV A;  5GMK l;  2KY9 A;  3ME9 A;  4EMH A;  4C92 E;  5GMK i;  4M77 E;  4MDX A;  3V7R A;  4M77 B;  4KUI A;  4NOY A;  4PLI A;  3JB9 I;  3QHS A;  5LJ3 h;  2JTM A;  2QA4 T;  1YIJ T;  5LJ5 g;  3NFC A;  3OB9 A;  5CKF A;  1BYM A;  3LW5 E;  4C0F A;  3VV0 A;  1YHQ T;  1S72 T;  3CCV A;  4J7I A;  3MEW A;  2RO0 A;  3P8D A;  2CZ7 B;  3EFS A;  3QG1 A;  4QQ6 A;  4EMK C;  2LCL A;  5J39 A;  1B34 A;  5FU6 C;  5GAM g;  3CC4 T;  4XTY A;  1LOJ A;  2BUD A;  2DZC A;  2WSE E;  3FB9 A;  2PUO B;  1Y96 A;  1PSE A;  2WSC E;  3PT9 A;  4RKU E;  1KC8 C;  1K8A C;  2DKG A;  2EWN A;  5CCA A;  4XAX B;  4QQG A;  4M7A B;  4ZGE B;  2KK4 A;  2O4X B;  4Z02 A;  2V8J A;  2M0O A;  4M77 D;  3QJ6 A;  3CCS T;  5KH6 A;  3M56 A;  5CQX A;  2MMP A;  1YIT A;  5D6Y A;  2D9T A;  3OYD A;  2EQK A;  2VC8 A;  4E7H A;  1VQO T;  5GAN d;  4OB0 B;  3SDZ A;  2LTO A;  5L8R E;  5GMK j;  2LCC A;  2C06 A;  3JB9 H;  2LC4 A;  3MEA A;  4C92 A;  2EYQ A;  2YLB A;  3NTI A;  2DXB A;  1VIE A;  2DXU A;  3GF5 A;  3M4Y A;  2BKD N;  3I55 A;  2ZPB B;  1VQM T;  2QEX T;  3CME A;  1N8R C;  4Y28 E;  5I2M A;  1N27 A;  3L42 A;  2X4Y A;  3S3O A;  1YJ9 A;  1VQ9 T;  3HRU A;  1BI1 A;  2LVM A;  1Q86 C;  3LLR A;  5GAO n;  2E64 A;  3OW2 A;  2OTL T;  4M7A D;  2V8I A;  4M7A G;  3HL8 A;  3SWN C;  4E47 A;  3WVD B;  4CI0 C;  1M1K C;  3V7C A;  2XG8 D;  5GAN 7;  1AHJ B;  3S6W A;  1YCY A;  1WJR A;  3OYI A;  4HCC A;  2DK3 A;  5LJ5 f;  5I2S A;  4NL3 A;  5GAO m;  4PJO E;  4PJO B;  1G3Y A;  4M7D E;  2EQM A;  3A5Z B;  4OB3 B;  4RCC A;  3OW2 S;  4A4K A;  3LWH A;  4JLI A;  1BI0 A;  2R58 A;  3QYG B;  5LJ5 h;  3URG A;  1WQ7 A;  1M90 C;  1KG1 A;  3I56 T;  3V8K A;  2RI3 A;  2XU8 A;  1Y7X A;  2V8K A;  3CCR T;  1EIF A;  4M75 G;  4N4I A;  3MP8 A;  1OYX A;  4ZGD B;  1VQ4 A;  4LD6 A;  3RES A;  4DA4 A;  5KE3 A;  1RL2 A;  3J81 E;  3UPU A;  2H3J A;  3GPL A;  2XDP A;  3CCM T;  2ZCF B;  2VXF A;  2XIC A;  1Q81 C;  1K73 C;  2GF7 A;  2MWO A;  2DIG A;  3EFR A;  4M7D G;  5CKE A;  3VYG A;  3OBY A;  3OS1 A;  1PSF A;  4KUD K;  4ME7 A;  1MHN A;  2D0Q B;  3HRS A;  4QVD A;  1XTD A;  4DQ2 A;  4PJO D;  4IUV A;  5GAN e;  5FU7 C;  4QVC A;  4M78 E;  1D3B A;  3C4S A;  3PNW C;  4B9X A;  2L5Q A;  2OTJ A;  3ZFJ A;  3OS5 A;  1UGQ B;  2K5F A;  2LT1 A;  3OYL A;  1H3Z A;  3G6E A;  4JJN K;  5GAM e;  4M77 F;  4PJO A;  1X01 A;  1VQK T;  1BKB A;  2EFI A;  3SWN A;  2ZPF B;  4KUL A;  3DLL A;  4ATO A;  3BY7 A;  1U1S A;  5C0M A;  1N6A A;  2QA4 A;  1YIJ A;  1XQH A;  2GFU A;  1M4Z A;  2YHT A;  1YI2 T;  1YHQ A;  3G71 T;  1S72 A;  4BY6 B;  1M5Q 1;  3UWN A;  3X24 B;  1LNX A;  2M16 A;  4PNO A;  1M90 U;  3PGG A;  1M8V A;  2EAY A;  1VQ6 T;  3M9Q A;  5LJ3 d;  2LQ8 A;  4BD3 A;  2DVE A;  3JCM P;  3CC4 A;  2XD0 A;  4X9C A;  3J7A F;  4XTW A;  5IN1 A;  1Q81 U;  4XTV A;  4FIB A;  2CS7 A;  4F7U B;  4M78 A;  3CCS A;  2X35 A;  1WPY A;  2LRQ A;  2RK1 A;  2X4W A;  2XID A;  1YJW T;  4GY5 A;  3OSV A;  4XU0 A;  5CKD A;  1VQO A;  3P8B B;  2FVU A;  2QQS A;  1M1G A;  1HK9 A;  2FB7 A;  4ZTF A;  2DPP B;  1QW1 A;  4M77 C;  4BI8 B;  3L2Q A;  2VGN A;  3INZ A;  3CC7 T;  3RKX A;  1VQM A;  3BFM A;  2QEX A;  1BI2 A;  1G5V A;  3R6O A;  5KCO A;  4FM4 B;  2F5T X;  1VQ9 A;  3BW1 A;  3CBO A;  4C0G A;  2OTL A;  4IUR A;  5GAN 8;  1YJN T;  1VQ5 T;  3L2U A;  2KSS A;  3DLM A;  3GP8 A;  4Y91 A;  4PKC C;  2PU9 B;  4F7U G;  2VGM A;  4RMO A;  3QSU A;  4GLK A;  4EDU A;  2CZ1 B;  2JUF A;  4B9W A;  2DJZ A;  5CK9 A;  2EQJ A;  5FRM A;  4PJO F;  2NLU A;  2DIQ A;  2LDM A;  3FRN A;  1NJI U;  4M7A C;  3RMQ A;  4KBM B;  2JNG A;  2EKO A;  3G4S T;  3G71 A;  4WF2 A;  1JRI A;  2DO3 A;  1NPP A;  3CEY A;  1FWZ A;  2DTH A;  3JRZ A;  4MML A;  2LX9 A;  1G3S A;  4X9D A;  4XTU A;  2RK2 A;  3I56 A;  4TVR A;  1W4S A;  3CCR A;  2CZ6 B;  5LJ3 e;  3OS2 A;  4M7A E;  2PUK B;  3C12 A;  3Q1J A;  2I2L A;  2Y4X A;  3FJP A;  5CAI A;  3OYH A;  3CCM A;  3TCJ A;  4XU3 A;  2WSF E;  3RIR A;  3PFS A;  5FRN A;  3OBW A;  3VJP A;  5LJ5 d;  1VQL T;  1ZQ1 A;  2K57 A;  4ZGJ B;  2EQU A;  3BDU A;  5GMK h;  3JCM f;  3HSB A;  2DEQ A;  1I8F A;  1VQ7 T;  1LJO A;  4M78 F;  1V29 B;  4M77 A;  5HY6 A;  2IVW A;  1QVP A;  4HCZ A;  2QQR A;  4EMG A;  5EG2 A;  4JRQ A;  3LWI A;  3QDR B;  5GAM d;  4M75 E;  3ER0 A;  5GAN 3;  4P5N A;  4RCB A;  1UEB A;  2K3X A;  4J6Y A;  4L6V 5;  4LDW A;  4M75 B;  3JCM h;  5A0L A;  3GLX A;  5HK3 A;  4HCB A;  4QQD A;  4BB7 A;  3CXC S;  5FRO A;  4PJO C;  5KCH A;  2YLC A;  3JCM Q;  4OP0 A;  1VQK A;  3AHU A;  4E7L A;  4MZP A;  4EMK B;  4C92 G;  1VQN T;  4J6W A;  4JLG A;  1I5L A;  2HBP A;  2QXF A;  2XK0 A;  4M7D B;  2YRV A;  3X25 B;  4EPC A;  2R57 A;  5GMK m;  3QJY A;  3OMG A;  3PIO A;  3G7Z A;  2K4Y A;  4NS5 A;  1YI2 A;  2FYK A;  4M7A A;  2O4X A;  4C5G A;  4ZN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...