3QUIA

Crystal structure of pseudomonas aeruginosa hfq in complex with adpnp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
b'SKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hfq
molecule tags Rna binding protein
source organism Pseudomonas aeruginosa
publication title Hfq binds ribonucleotides in three different RNA-binding sites.
pubmed doi rcsb
total genus 15
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3quiA00
1D3BA 1D3BB 4JLIA 4C8QE 3JCMe 5GAN7 4M7DC 5GAN5 4PJOD 4J5YA 3V8LA 4C92G 4J6YA 3QO3A 2RD1A 4RCBA 5GANe 3BY7A 3QUIA 1YCYA 3VU3C 2YHTA 2DVEA 4A54A 5GAN2 3JCMb 5LJ3h 2VXFA 4A53A 4N0AC 5GAMe 2EJFA 3RKXA 1BIBA 1I8FA 4C92D 4C92E 4C8QF 4C8QG 5LJ3d 1WQ7A 5LJ5e 4PJOE 4M7DD 3BW1A 4QVCA 2FYKA 3SWNC 3HFNA 2YLCA 3L2ZA 4MMLA 2E65A 3JB9G 4M78D 5GAN6 3PGGA 4M7AD 4X9DA 5GANf 1JRIA 4PJOB 4M7AB 3QHSA 2VC8A 4J6XA 1N9RA 3GIBA 4XTVA 3JB9I 2RM4A 1HK9A 4M77B 4F7UB 2Y90A 1KQ1A 2HNIA 4M75A 3RUXA 2EWNA 2DTOA 4HA8A 1LNXA 3JCMJ 2DXTA 4M75G 2EJ9A 4XTWA 4N0AA 3JCMP 4M77F 4EMGA 4F7UF 1M5Q1 3JCMh 5GAN8 2CGHA 1N9SA 4M78C 3QSUA 4M7AC 3JCMg 2QTXA 2JN0A 4C8QB 5CAIA 5GMKi 5GANh 4HT8A 1MGQA 1M8VA 4RCCA 2ZGWA 4XU3A 1B34A 3JB9H 4XTXA 2DEQA 2DZCA 4M77E 4M78G 3BFMA 4M78A 4F7UE 2DTIA 4M7AA 4M7AG 4XQ3A 3JB9J 3JB9F 4M75C 2YLBA 4C8QA 1U1TA 5LJ3f 2DJZA 1I81A 1Y96A 2DZ9A 2E1HA 4EMKC 3SWNA 5LJ3g 4PNOA 4PJOF 3V8KA 2RB6A 5LJ5f 4DQ2A 2E10A 5I21A 5LJ3j 1TH7A 5GAOr 5GANj 4C8QC 3JCMW 4M7DE 5GAMg 4NL3A 4XU1A 3RKYA 1Y96B 2EAYA 3V7CA 5GAN4 3RESA 5LJ5d 3EFSA 4C92C 5GMKl 5GMKe 3JCMc 3M4GA 4M7DF 3BDUA 4EMHA 5LJ5g 2DKGA 4NL2A 4EMKB 4M7DG 4XTUA 4C8QD 3HSBA 5GAMf 4Y91A 2E41A 3JCMX 3AHUA 5GAMh 2RA2A 4V2SA 2EJGA 4JUVA 1H641 4M75B 5GAOm 1I5LA 4M77A 4F7UA 2FB7A 4X9CA 4MMKA 4NOYA 4QVDA 4PJOG 4EMKA 3JCMV 1WQWA 4WF2A 4C92A 3INZA 1WNLA 5GMKj 5GAOq 5LJ3e 3FB9A 3SB2A 4JRIA 5GAOp 4M7AF 4PJOA 2E64A 4C92B 3JCMd 2I2LA 1BIAA 4XU0A 3FJPA 4JRKA 4M77G 1JBMA 4M78E 1HXDA 4M75F 4F7UG 5LJ5h 5GAN3 4M7AE 5LJ5j 4M7DB 4J6WA 3JCMf 5GMKm 5GANd 4PJOC 3JCMQ 3SWNB 3V7RA 1LJOA 1LOJA 3EFRA 3RKWA 1I4K1 1U1SA 3L1AA 4M77C 5GAMj 2DTHA 5GMKh 4HT9A 1X01A 4M78F 4M75D 3HFOA 4M75E 4XU2A 4XTYA 3RIRA 3V8JA 1WPYA 5GAMd 5GAOl 4M7DA 4M77D 3V7SA 2DXUA 5DY9A 3FIFA 5GAOn 3JB9D 2VXEA 5GANg 1KQ2A 1B34B 3RERA 4XTZA 4M78B 4OP0A 4C92F 2K57A
chains in the Genus database with same CATH superfamily
2HL5C 1G8XA 3JAME 1EZZB 1YJWT 4E47A 2K5FA 1Y57A 1NLPC 3VS4A 2COYA 1YHQQ 1RADB 1O9SA 2EGEA 4MMLA 1PG5B 5J26A 2PVGB 1JRIA 3CMAQ 2RK1A 3CC7A 3GIBA 2XICA 4FU6A 5CK9A 3OYFA 1GBQA 3MCAB 4J9FA 2M0OA 5CVIA 5CQYA 1H3HA 3TQ7P 3JCMP 1SEMA 2NWMA 2YRCA 2C0OA 2QTXA 2QDLA 3QDRB 2DIQA 1GBRA 1OI1A 3QJ6A 5FU7C 2AZVA 1QVPA 1KC8R 4JS5A 2E1HA 3ZEHA 2HKNA 1QKWA 3M53A 3CC4T 2DERA 5I21A 4TVRA 4FYVB 2EYYA 3EG0A 3CBMA 3QJYA 4D8KA 2LJ1A 2X4YA 1RL2A 2EAYA 2XKOC 4J9HA 5IHKA 1X6OA 1MNEA 3SDZA 4B6MA 2H3JA 3LH0A 4C92C 1ABOA 1WFWA 5LJ5g 1G3TA 4XAXB 2F1LA 1KC8U 2E41A 3DB3A 1IGQA 4PJLA 4PJMA 1U06A 3TEEA 4E6RA 5DM7R 5GAOm 1UFFA 4L59A 1Y7XA 1RUWA 3FEOA 3OA6A 1TS9A 3GP8A 4BY6B 5CKEA 4L5GA 4C92B 4XU0A 5LJ5h 4M78E 2VKNA 4M7DB 2VGMA 3CD6T 3JCMf 2DBMA 4LUEA 3MEWA 1PSFA 2MMPA 1QVFP 1Y0MA 3CCUT 5GAOn 2RHUA 3VV0A 3META 3VRZA 4XTZA 2RNAA 4II1A 2XD0A 1QQJA 1ZSGA 1Q82U 1PD1A 4VUBA 3ME9A 2YSQA 5AYFA 2EJFA 1ZUYA 2WSEE 3QG1A 3RMQA 1VQ8T 2M9UA 2F2XA 1VQLQ 4LDWA 4AG2C 5A0DA 2LT4A 1VQ4T 2XIDA 3PFSA 2O01E 2V1QA 4X9DA 4JDSA 4RG8A 2CSIA 1N27A 1YJNQ 1MV0B 1VQ8A 1PKTA 1YP5A 4YTLA 4E7JA 2P0PA 4JRPA 4FT4A 2RHXA 2DPPB 3CCMA 1VQMQ 5GANh 4BD3A 2JUFA 1S72T 2DBKA 4C0FA 2KRNA 4KGXB 2LCSA 2RJEA 2YWWA 2EYXA 2A08A 1U1TA 1ZQ1A 1BB9A 4RTVA 2J7IA 3EG1A 4PJOF 4DQ2A 1U8RA 2LQKA 2OX7A 3A5ZB 1QVFS 1ZA1B 3HRSA 3TVTA 2YXYA 4BE1A 1TU0B 2LJ3A 3WXMB 1VA7A 2DRKA 2CZ7B 4GLKA 3BDUA 2DKGA 2LQWA 4XTUA 3MEAA 4RUGA 3FJ5A 1NG2A 1K8AC 3LX7A 2NLUA 1OX8A 2EJGA 1SF9A 3I55T 2L3QA 1AVZC 1YITQ 1M1KR 3OW2S 1MMNA 1T0HA 2KRSA 4Z89A 2E5KA 2KK4A 1GL5A 1BIAA 3MHXA 1OZ2A 1JBMA 2QGGA 2E6NA 3HP9A 4BI4A 3V7RA 1SRLA 4RMOA 4FCYA 3G4SQ 2DA9A 2K2MA 4M77C 1X01A 4HCZA 3RIRA 1D0XA 4BE2A 4QKUA 3A8MB 3MP6A 1KQ2A 1H92A 1E6GA 4PK4A 4RTWA 5IHNA 2JVVA 1NEGA 1WZOA 1YIJT 3AT1B 2IIMA 3X20B 4OVAA 4RCBA 1VQ7Q 3QUIA 1IRXA 5IH2A 3J81E 1YJWQ 3G6ET 4C8QF 1G3WA 5LJ5e 3CCJT 4HVVA 2YLCA 5A0GA 1X27A 2EYWA 5GANf 4PJOB 1Q86R 2DAQA 4XTVA 3JB9I 4KH0B 2BE7D 2K4YA 2DVJA 2RI3A 3PMTA 4HA8A 2DXTA 4JJNK 3OW2P 3RBBB 2L3PA 1TSFA 5KYYA 2XI9A 4XTXA 4ME7A 2GF7A 1KQSA 5FLXE 4JJDA 1LPLA 1MNDA 2YT6A 4RTUA 4OB2B 2RB6A 3E1SA 3A8LB 1BI2A 1TH7A 3R6NA 3VRYA 4GLMA 3M55A 3FC3A 3V7CA 2CT4A 1W2BA 2PNIA 1NYFA 3CC2A 2RJDA 2X4JA 4BB7A 3G4ST 4N4IA 4OMMA 2CYZB 3QZ5B 2JXBA 3P8HA 4N4GA 5KYXA 1BBZA 2QTVA 2P0QA 1PD0A 3H8ZA 2BUDA 4PL6A 3MKDA 1SSFA 2FVUA 4JS4A 1PCXA 2MF2A 1OV3A 5CCAA 3V7SA 3CCLA 3RMSA 1HSQA 2W0ZA 1T3SA 1D3BA 4JLIA 5C0MA 1QCNA 2K3YA 4MZTA 2CT3A 4RTTA 1YJWA 3NFCA 5FU6B 3OS5A 4C92D 4J7FA 2FZCB 4M7DD 4QVCA 3OYJA 2OTJT 2GCXA 1NBEB 3QIIA 3PNWC 3OS2A 3QHSA 2D9TA 1KJWA 1K8AU 4D6WA 2RHIA 4OMQA 1C6VX 4OB0B 5M9OA 3CCSA 2A0FB 2HBPA 3REAB 1JJ2P 2XDDA 1RAAB 4M75G 2NUZA 3D7SB 1VQ5A 5KYUA 2X51A 4RTYA 1E6HA 1M8VA 1RABB 3MP8A 4M77E 4F7UE 2DTIA 4XQ3A 1KK7A 3CCVQ 2HSEB 2LT1A 1RI9A 4C8QA 2DJZA 4MDWA 2E5QA 1R8OB 2ZPBB 5IXBA 5GAOr 4K11A 3EHQA 5HK3A 4NL3A 3VS7A 3O8VA 2FPDA 2FHDA 3QDFA 4KBMB 3CC2T 1FMKA 1VYUA 4C0DB 2WACA 3A98A 4E7ZA 2CP3A 5IN1A 4OGEA 1YBYA 1BCMA 4EMHA 2ZPGB 3ZBDA 1AWWA 1WI7A 5GAMh 2RHYA 4CC2A 3H0IA 1QW1A 2LNHB 5KH6A 1QKXA 1BCOA 5KCHA 3PTAA 3FJPA 4M77G 3ZFJA 4F7UG 1X6BA 2O88A 1QVGA 2M51A 1JO8A 5GANd 1M2OA 1R0CB 1RAHB 4M78F 2K3XA 3REBB 2BZXA 4XTYA 1RLPC 2L0AA 1QP3A 2KNBB 3FDRA 3LGFA 1TWBA 1K73R 2C0IA 3RERA 2DX1A 4OP0A 5C6SA 1PHTA 2K57A 2YRVA 1UEBA 4BDYA 1WJQA 1Q7YR 1IXDA 3VYGA 4J6YA 1T3LA 1JXMA 1Y71A 4IUQA 4Y28E 2O9VA 3OYKA 2XK0A 2OAWA 3H9NA 3VS0A 3CCQQ 3G6EA 1WHLA 1IGUA 4OB1B 1ZX6A 4M78D 4FL6A 2AIRB 1GFCA 2RM4A 2KGTA 1X2QA 5FROA 4FSXA 4ZNXA 2RMOA 1YJ9A 4NS5A 2JN0A 1K9AA 1TTHB 2PQWA 1W6XA 1M1KU 1B7TA 1NJIC 1PRLC 2DZ9A 2RO0A 3CCQT 5A2QE 2KEAA 3L2WA 3VS6A 3L2QA 2VVKA 3VUBA 3OS1A 1KIKA 3RESA 1VQPT 2DILA 2AKKA 2MOXA 1PKSA 4Z8AA 1OZ3A 3HSBA 1AT1B 3HHTB 4E7HA 4P5NA 3SHWA 2WSCE 1M90R 2NYSA 1UTIA 4JJBA 1OEBA 1VQKQ 2VGNA 4ZTJA 3G4SA 1UGQB 3NTHA 3OS0A 1YJ9Q 3URGA 1XOVA 1W4SA 2PU9B 4PJOC 1M2VB 4PLLA 1SHFA 1VQ5T 1UG1A 2QEXQ 1ZHIA 2QI2A 4ELZC 3FIFA 2EYZA 3JB9D 1KD1C 5GAMe 2RI2A 3SFMA 2GFAA 3OBWA 2ECZA 2W10A 1VQ6Q 4RTXA 2RD1A 2LJ0A 3OW2A 1EIFA 5GAN2 3CCRQ 2R5MA 3RKXA 2LX9A 4LE9A 2A28A 1IO6A 1S1NA 2KXCA 1T0JA 1PSEA 2WSFE 2YUPA 4CC7A 2ED0A 2KR3A 2R57A 2COWA 2HNIA 1N5ZA 3RUXA 2DIGA 5CKHA 1PM3A 3I5SA 4EMGA 5J3BA 2JJ9A 4C8QB 3UA7A 4M7AA 2BTTA 4Z02A 1A0NB 5KYXB 1G3YA 2RJFA 2BKDN 2G6FX 5IXFA 2BZ8A 3OYHA 2PZ1A 4DBRA 3JCMW 2LCCA 2CZ0B 1D09B 2FPEA 1K4US 2V26A 2A7YA 3S3MA 2RQVA 4PFZA 1UGPB 1ACMB 4BUGA 4DOVA 2EQMA 2EQJA 3CC2Q 3C0CA 1UB4A 3JCMX 3F70A 1JB0E 2XG8D 2D8JA 3CQTA 3CMEQ 2X4WA 2XHCA 1FXXA 2F5KA 3H6ZA 4QVDA 3DKMA 5GMKj 3OMGA 2DF6A 2CZ1B 3FB9A 2RH2A 4LD9K 2I2LA 1GCPA 4Z88A 5GAN3 5GMKm 4F04B 2FRYA 4ATOA 4RTZA 1B3QA 4XU2A 1YJ9T 2LNVA 2OAUA 4DBHA 3E2UA 2DXUA 3JRZA 3L2VA 1JXOA 2QYZA 4FT2A 1R77A 2RQWA 4J8OA 3CC7Q 2CH4W 1YI2Q 4IURA 1Q7YC 4A54A 5KE3A 1WIEA 3JCMb 5LJ3h 4GY5A 1I8FA 3TSWA 2XMFA 4C8QG 1WQ7A 4KGVB 2R58A 1M3CA 5HK0A 3CCUA 1OPLA 2E3HA 4J9IA 1Q82R 4MDXA 1NJIR 4LD6A 4M75A 2PUOB 4GBQA 1AWOA 4QVZA 4IIMA 4OGCA 2AZSA 3MEVA 3G7ZA 1PRMC 2JTMA 5GMKi 1MGQA 2HL3A 1B07A 4DBFA 2CKKA 3CCMQ 2B8AA 1NPPA 3BFMA 1UGRB 3QZ9B 3JB9J 4HKEA 4ZGJB 1I81A 3G71T 5I2MA 4E2FB 4PNOA 1QP2A 2JT4A 2CP5A 5GAMg 3CCQA 4AMCA 3RKYA 3JV3A 3WVEB 2ZAEA 2X3XD 3M57A 1QVGP 2DXCA 2OTLA 3M0PA 5LJ5d 1NPRA 3X24B 2EYQA 1GXIE 5GAMf 3M59A 4V2SA 5KE2A 2DJQA 2L89A 1QWEA 4MMKA 3G71Q 1H3ZA 4LN2A 4C5GA 4EMKA 2FL7A 1IHWA 2O2OA 1VQNQ 1UUEA 2PTKA 3JCMd 3HRUA 3QWYA 1XJWB 4J9DA 3PIPA 4EIKA 1YITT 2CP0A 1CKBA 3RKWA 2DLPA 1Q86U 2ZPFB 2P4RA 4EPCA 1WX6A 1Q81C 1BI3A 2MIOA 4A4FA 1H641 1OQKA 3JSCA 1CSKA 2YHTA 3OYNA 2IVWA 3DLMA 2E3IA 1VYTA 4R55A 2EQKA 1AOJA 2YUQA 4OMPA 2FPFA 4FW2A 4KGZB 1Q81U 2NUTA 1VQ7T 3EG2A 2RQTA 3CXCS 5GAN6 3SEMA 5KYWB 1WJSA 1DJ7B 2ZCFB 2QEXT 2V8KA 1S72Q 4M77B 4F7UB 3LWHA 4AFZC 4WTOB 1RACB 3I55A 1OYXA 1KFZA 1RI0A 4A4GA 1ZBXA 3CMEA 5I11A 3CXCA 2ZGWA 2DEQA 1VIFA 1VQLT 3OMCA 5DLQE 2YRDA 2L3SA 3NHNA 3OSSC 3EG3A 3GNFB 1U5SA 1BI1A 4LNPA 2VV5A 3PMIA 4X1VA 3NPFA 2XDBA 3E9GA 4JLGA 4HVWA 2JS2A 2LVMA 4OB3B 2DYIA 3MO8A 3JCMc 3C12A 3CBPA 2M1HA 4NL2A 3UPUA 4J9CA 1YI2A 2PUKB 1H8KA 2GBQA 1RAIB 3LH5A 2AKLA 3OYAA 2DRMA 4RKUE 3CCET 5FRMA 2KY9A 3INZA 5GAOq 3R6OA 1FMWA 1WHJA 2J6KA 1W70A 2MK5A 2K79A 2QQAA 4KULA 2DK3A 4ZN3A 4HVUA 2LX7A 3CCST 1LJOA 1W1FA 2RI5A 4C0GA 4PLIA 2L3RA 4M7AF 4M75D 1Y07A 4ANJA 3IQLA 2VXEA 4C92F 3MEUA 2XU8A 4A4EA 1VQKT 3O5ZA 1VQ9A 3UATA 3X26B 1QMCA 2YDLA 2DYBA 1N8RU 2COZA 3BW1A 1WLPB 3ZL7C 3S3OA 2X3WD 3CPFA 2ZZDA 3L2ZA 3JB9G 4IUTA 4JJCA 4M7AD 5FW9A 1YIJA 1OU9A 1K9MR 2QK0A 4QW2A 2OI3A 5D7UA 2E70A 2NUPB 4FM4B 3OYBA 5D6YA 4M77F 4F7UF 2CP7A 3J80E 1N9SA 1QCOA 4F14A 2C0TA 1D1CA 3I9QA 2JOYA 2ESWA 1MMDA 4M78G 1ZSZA 2RQUA 3GF5A 1RAGB 2HDAA 3NMZC 1UGVA 2CS7A 2QAZA 4IIOA 2X4XA 2CP6A 2JTFA 2K7AA 2MWPA 3C4SA 3SWNA 2E10A 5LJ3j 4M7DE 2ED1A 5GANj 3G6EQ 2NUPA 3L42A 1KQSP 2HZYA 1Z9ZA 1M30A 1YI2T 1XQHA 1CKAA 3CD6A 1N6AA 2EQIA 5IT9E 4X34A 3RR6A 2HCKA 2LZ6B 4Q5WA 3L2UA 2KDSA 2F5TX 4M75B 1V1CA 1OULA 2HD0A 3CEYA 3CCLQ 4X9CA 2M0YA 1IZ6A 1WQWA 3N5BB 3SD4A 5LJ3e 1D1AA 3A1PA 1VIEA 2KT8A 4JRIA 1MV3A 2LTOA 1M8MA 3M9QA 4MZMA 1YHQA 3L1AA 5GAMj 2DTHA 3CMET 2KI7A 5GAOl 4IKFA 4KRTA 5CR2A 2DL3A 1WHMA 1G3SA 4M7AB 1R0BG 3NTIA 4BY6C 4C8QE 5GAN7 1K8AR 2QA4Q 3V8LA 1VQOA 1N8RC 3ER0A 4AFSC 2MAMA 2JMAA 5LJ3d 4J9EA 1UHCA 1QVGS 3SWNC 3KUFA 3H0FA 3PGGA 3OQ5A 2OTLQ 3NTKA 1X43A 2V8JA 5A0LA 5GAN8 8ATCB 2CGHA 4OMOA 1EX4A 5CAIA 3BE3A 1UECA 1UDLA 3JB9H 4M78A 3EH2A 2KVQG 1Z9QA 1WXTA 5IAYA 1LVKA 1VQ8Q 3M0SA 3PT9A 4FYYB 1VQ9Q 3CCRT 6AT1B 1WA7A 1F1BB 4C8QC 2L5QA 3HL8A 1YJNT 3ULRB 4D8DA 5GAN4 3TU4K 1NJIU 2EIFA 5KYWA 2RN8A 2A37A 1ZSZB 4M7DF 1S72A 1AZGB 5J39A 2O9SA 1RLQC 2GTOA 4J7IA 1VQ5Q 3LLRA 3KFVA 4KH1B 4CRIA 1NEBA 1NZ9A 1BYMA 1NYGA 4FIBA 3CC4A 2EKHA 2EGCA 1RAFB 4WF2A 1WNLA 2QEXA 3E19A 2RJCA 2K3BA 2QG9B 3EFOB 3CCVT 1X6GA 2LQNA 1D1BA 1X69A 2YUOA 2MYSA 2AK5A 1HXDA 3TCJA 1YNZA 2D0QB 4C0DC 1M3BA 1M90U 1U1SA 3HFOA 4M75E 3S6WA 5GAMd 1WPYA 2DE0X 4IUPA 1J3TA 5CIUA 3X28B 2P84A 5KCOA 3OYMA 2HQEA 4C92G 5GANe 2JTEA 2OTJQ 4DA4A 2EQUA 1YCYA 1V29B 2Z0WA 2QGFB 1BK2A 4A53A 2H3EB 2DXBA 1YIJQ 5HCKA 2SRCA 3VS1A 3OYGA 2K5LA 1K0SA 3CPWS 3VS3A 2O4XB 5CKFA 1VQ6T 2E65A 2JW4A 1UJYA 9ATCB 1EFNA 5L23A 3A8GB 2DM1A 3T9NA 3CC4Q 1KD1R 4M78C 4CC3A 4RCCA 2MPXC 1AEYA 1UGSB 1PWTA 3CCVA 4M75C 2YLBA 3P8BB 3I55Q 4AFUC 4O5VA 3OYIA 5CKBA 1Q81R 1TXQA 2EFIA 1I5OB 3QWXX 1KD1U 4PJJA 4XU1A 1TOVA 2QQ9A 5L8RE 3EFSA 1NE8A 5GMKe 1Q82C 4JZ3A 2J6OA 4A4HA 1P92A 1JJ2A 5HKCA 1SPKA 4OMFB 1YFNA 4QQDA 1K73C 1JQQA 3BDLA 5ECAA 5GAOp 2QQSA 1VQ6A 2E64A 3QBYA 1N8RR 2BZYA 2HAXA 5LJ5j 1G83A 1I1JA 2VWFA 3EGXA 3TSZA 3SWNB 1TUDA 2DL8A 3EAEA 2IG0A 3NGPA 2FG0A 2SEMA 3I35A 4HCKA 3VYHB 1KSWA 3M5AA 2KYMA 2JM8A 3QKJA 2L2PA 4ZGEB 2E12A 2KMTA 1WXUA 1VQ4Q 2FO0A 1VQOQ 2HSPA 3GLXA 4PJOD 3H41A 2E6ZA 3A8OB 1M1FA 5EC7A 2M16A 2EW3A 2BIVA 1M9SA 4N0AC 2JS0A 4ORZA 4A63B 4C92E 1VQ9T 1VQKA 4A4KA 3OYCA 1TUCA 3PIOA 3UDCA 2LCLA 3M56A 1VQOT 2DD5A 4R56A 3HKSA 2DL7A 4C5HA 3VKIA 4QQ6A 2Y90A 3PVLA 4F16A 4RG2A 3KXTA 2D6FA 1TG0A 1M5Q1 1ZSZC 2AT1B 2KAFA 4B9XA 3A8HB 4BACA 1VQNT 2DEUA 3QPHA 2HMAA 4OMLA 1MHNA 2YUNA 4ZTFA 1WHKA 1AD5A 5GJVB 1VQMT 3JB9F 4LDVA 4ESRA 3QXEB 4EMKC 3U23A 1NM7A 5LJ3g 3S3NA 5LJ5f 2X9HA 2K5IA 2H8HA 1NLOC 3H0HA 3WVDB 4AT1B 1AZEA 2B86A 5FRNA 5IHIA 3CXCP 5GMKl 3M4GA 4EDUA 4C0ZA 1VQPA 3EG9B 2CUBA 2RA2A 4LDUA 1K1ZA 1ARKA 2EBPA 3LGLA 2CREA 4Y92A 3VS5A 5GJWB 2QDYB 4C92A 3G71A 2LP5A 3CCMT 1RAEB 4HCBA 4JRKA 2ENMA 1VOMA 4DEXA 4J6WA 1K0XA 2K6DA 2F2VA 1M2VA 1I4K1 2IPOB 3M58A 2G3RA 3V8JA 1W2BS 4BI8B 2DL4A 5GANg 5HY6A 1WGSA 3HPWA 3JCMe 3M54A 2FZKB 2I0NA 1ZUKA 3VU3C 2D0NA 1YWPA 3RDVA 1BIBA 1YITA 1KQSS 3CMAA 2VYTA 8AT1B 3CC7T 3LW5E 1MMGA 5CKDA 3OYDA 1BU1A 2C06A 4C5IA 3X25B 2O4XA 4J6XA 4FYWB 1IHVA 1HK9A 5FU7B 1ZBJA 1K9MC 2EJ9A 3QSUA 3GPLA 2EGAA 1FMVA 2KQWA 1AWJA 4J9BA 4HT8A 1LCKA 4XU3A 1B34A 2A36A 4JPBW 4M7AG 4M4ZA 3UF4A 1M1GA 1K9MU 5D6WA 1XTDA 1IB8A 1Y96A 4C5EA 3V8KA 1Q86C 4LXCA 2LDMA 1OOTA 1OPKA 1PC0A 2HKQB 4KT0E 1YHQT 4AFQC 1MMAA 1K73U 4Y91A 1OX9A 5AT1B 2RQRA 1FWZA 3UWNA 4QT7A 3LYIA 3OYLA 3CPWP 3PVQA 5LL6S 2VUBA 1C0MA 3EGUA 3OBYA 3VUZA 2P4TA 4M7AE 4M75F 3CCJA 2QXFA 3I56A 2CDTA 3CCEQ 1ZA2B 4PFPA 1VQNA 1JU5C 1Q95G 4FYXB 3MPUB 4PKCC 3MJXA 2RPNA 4BDZA 4M77D 3M4YA 3HRTA 4M78B 2Y4YA 3CMAT 2ROTA 4M7DC 2HQXA 4B9WA 2LQ8A 3RNJA 1QLYA 4CC4B 4DBQA 1GCQA 3BY7A 1WDXA 2RK2A 1SRMA 2QQBA 2QA4T 2QA4A 1V76A 1AWXA 2JNGA 4J83A 2JMCA 2J06A 2PVDB 2QASA 2LRQA 2VC8A 1N9RA 3FLGA 3C94A 2XDPA 2EWNA 1WHHA 4F17A 2J6FA 4PJNA 4N0AA 2RHZA 3JCMh 3EGXB 4E7KA 1BI0A 2FEIA 3OYEA 1ABQA 3I56Q 2GGRA 3I56T 2F2WA 3CCLT 1WXBA 1YCSB 1UJ0A 4UC4A 1D0YA 5EG2A 2ATCB 1HYOA 4OF1A 1SKUB 2ZPHB 2ZPIB 3EGDB 2CUDA 1WJRA 1Y96B 4ZGDB 1M4ZA 1M1KC 3VJPA 1VQPQ 3M0RA 2VASA 2KROA 3G1JA 2K2VA 4HCCA 4M7DG 3M0TA 5CO7A 3CCUQ 5CQXA 1JJ2S 4KUDK 2KBTA 4E7LA 4PJOG 2GFUA 7AT1B 1BKBA 1VYVA 1X2KA 1OU8A 1UE9A 4PFOA 3P8DA 3TREA 2LC4A 1SSHA 4FSSA 2KYBA 2EVRA 3EFRA 2R5AA 1KG1A 2DNUA 5I2SA 3EH1A 5GMKh 4HT9A 2MWOA 2DETA 5DY9A 2D1XA 1VQ7A 4J9GA 3Q1JA 2NUTB 3MP1A 2K9GA 3QYGB 1TUGB 3PE0A 2E4HA 1QCFA 1KHIA 1X75C 3QO3A 2KE9A 1U3OA 1FX7A 1I0CA 4LUDA 2FYKA 4XK8E 2DMOA 1I07A 3E9FA 3CPWA 2F69A 3GBQA 5D6XA 4AG1C 1O75A 1PNJA 3JCMJ 1IREB 1QWFA 3UA6A 5DLOA 1W2BP 4M7AC 1C1AA 2JM9A 3FRNA 2BE9B 3EG9A 2X35A 1M3AA 2DZCA 2FRWA 2GQVA 2M02A 1UHFA 1VQMA 3CCEA 2DFUA 2AHJB 2OJ2A 3J7AF 4E7SA 3I5RA 3LWIA 1VUBA 2EKOA 5I22A 1KHCA 1HJDA 1G2BA 1FYNA 2GNCA 3ASKA 3AHUA 5KYUB 3THKA 2V8IA 4KUIA 3CCRA 1WHGA 2LMJA 2GQIA 3OYYA 3SB2A 4HXJA 4IUUA 4LDYA 1KC8C 3M0UA 2CSQA 1Q7YU 4BE0A 2ROLA 1LOJA 2P0KA 3CCSQ 2OTLT 1AHJB 2CH4A 1G5VA 2JZ2A 3M0QA 1K76A 4BI3A 1JEGA 4WCIA 1B34B 4E7IA 5FWCA 3EFOA 1D3BB 4N4HA 5GAN5 4J5YA 4MZPA 3EGDA 2A3LA 2DL5A 4OMNA 1VQ4A 3C95A 2DVEA 1ZUUA 2OTJA 2EPDA 2KRMA 2VXFA 1ZLMA 1XNIA 4ELYC 1SHGA 4PJOE 3HFNA 2RF0A 4L6V5 2CZ6B 3CBOA 1YWOA 3OY9A 2KSSA 4JRQA 5FU6C 1KQ1A 2GTJA 1D0ZA 5FWBA 2DTOA 1LNXA 4XTWA 2DD4A 3DB4A 2VB6A 3JCMg 2O31A 4ZN1A 3QYHB 4O6JA 5KYNA 3GOXA 2HQHA 3GNGA 2V1RA 3L2RA 5LJ3f 1QVFA 2KT1A 2QQRA 2KXDA 2D8HA 2ABLA 1WYXA 2PVOB 4FW1A 1MUZA 4R0KA 3VS2A 1YN8A 4IUVA 2MCNA 1E7OA 1YJNA 3OSVA 4EMKB 4CI0C 5KYYB 2CP2A 4C8QD 4JZ4A 2MI6A 2HBWA 2Y4XA 2L8DA 1VQLA 4DEYA 4JUVA 4DOWA 3HTRA 1I5LA 4M77A 4F7UA 2FB7A 4QQGA 4NOYA 3JCMV 4LDXA 3DLLA 2HEQA 1M90C 3UT1A 4PJOA 3KBGA 2FZGB 1SG5A 3EHRA 2DO3A 1GRIA 1GFDA 1HD3A 3JCMQ 2J05A 1GCQC 2ZPEB 3OB9A 3CD6Q 4M7DA 1M27C 3CCJQ
chains in the Genus database with same CATH topology
2YRVA 1WGSA 2XU8A 3MEUA 1UEBA 3HPWA 3M54A 4A4EA 1WJQA 3JCMe 4BDYA 1VQKT 3VYGA 4J6YA 3X26B 1VQ9A 3JAME 1Y71A 4IUQA 3VU3C 1YJWT 4Y28E 4E47A 2K5FA 3OYKA 2XK0A 1BIBA 1YITA 1KQSS 3CMAA 1N8RU 3G6EA 2VYTA 3BW1A 3CC7T 3LW5E 5CKDA 3OYDA 3S3OA 3CPFA 2C06A 4C5IA 1O9SA 2ZZDA 3L2ZA 4MMLA 4IUTA 4OB1B 5J26A 4M78D 3JB9G 3X25B 2PVGB 4M7AD 1YIJA 4FL6A 1JRIA 2O4XA 2RK1A 3CC7A 4J6XA 3GIBA 2XICA 1HK9A 2RM4A 4FU6A 5CK9A 4QW2A 3OYFA 5FU7B 3MCAB 2M0OA 2E70A 4FM4B 5CVIA 5FROA 5CQYA 1K9MC 3OYBA 4FSXA 2EJ9A 5D6YA 3JCMP 4M77F 4F7UF 1YJ9A 3J80E 3QSUA 1N9SA 3GPLA 4NS5A 2KQWA 2QTXA 2JN0A 4HT8A 3QDRB 2DIQA 2PQWA 4XU3A 1B34A 2JOYA 1OI1A 3QJ6A 1M1KU 4M78G 3GF5A 4M7AG 5FU7C 1NJIC 1QVPA 1M1GA 2CS7A 1K9MU 5D6WA 4JS5A 1XTDA 1Y96A 2DZ9A 2E1HA 2JTFA 2MWPA 2RO0A 2X4XA 3C4SA 3SWNA 3V8KA 3ZEHA 4C5EA 5A2QE 3M53A 3CC4T 2E10A 5I21A 4TVRA 5LJ3j 4M7DE 5GANj 3L42A 3CBMA 3L2WA 3QJYA 2LDMA 2X4YA 1RL2A 3L2QA 2EAYA 2XKOC 3VUBA 3OS1A 3RESA 1VQPT 1X6OA 3SDZA 4KT0E 2H3JA 1YI2T 3LH0A 4C92C 1XQHA 1YHQT 3CD6A 5LJ5g 1N6AA 1OZ3A 1K73U 3HSBA 1G3TA 3HHTB 4XAXB 4Y91A 1KC8U 2E41A 3DB3A 4E7HA 4X34A 5IT9E 4P5NA 4Q5WA 3L2UA 1FWZA 2KDSA 2F5TX 2WSCE 3TEEA 4M75B 5DM7R 5GAOm 2HD0A 3UWNA 3OYLA 3CEYA 3LYIA 4X9CA 2VGNA 1Y7XA 4L59A 4ZTJA 3G4SA 1IZ6A 1UGQB 1WQWA 3FEOA 3N5BB 3OA6A 3NTHA 5LL6S 2VUBA 3SD4A 5LJ3e 4BY6B 3GP8A 1VIEA 3OBYA 4JRIA 4L5GA 5CKEA 3VUZA 4C92B 2P4TA 3OS0A 4XU0A 2LTOA 5LJ5h 4M78E 4M7AE 3M9QA 4M75F 2QXFA 3URGA 3I56A 3CCJA 1XOVA 2VGMA 3CD6T 4M7DB 3JCMf 1VQNA 4MZMA 1W4SA 2PU9B 1YHQA 3MEWA 1PSFA 4PJOC 4PLLA 3L1AA 5GAMj 2DTHA 4PKCC 2MMPA 3CMET 1VQ5T 5GAOl 4IKFA 5CR2A 4BDZA 4M77D 1ZHIA 2QI2A 4ELZC 3CCUT 3FIFA 5GAOn 3JB9D 1G3SA 3M4YA 2RHUA 3VV0A 3META 1KD1C 3HRTA 4XTZA 4M78B 4M7AB 2RI2A 2Y4YA 5GAMe 3CMAT 3NTIA 2GFAA 3OBWA 3SFMA 4BY6C 4C8QE 2HQXA 5GAN7 4M7DC 4B9WA 2LQ8A 4II1A 3V8LA 2XD0A 1VQOA 2RD1A 1N8RC 3BY7A 1Q82U 3OW2A 4VUBA 1EIFA 2RK2A 5GAN2 2QQBA 3ME9A 5AYFA 2EJFA 2R5MA 3ER0A 3RKXA 2LX9A 2WSEE 3QG1A 2MAMA 3RMQA 2QA4T 2QA4A 5LJ3d 1VQ8T 2M9UA 2JNGA 4J83A 4LDWA 5A0DA 1QVGS 3SWNC 2LT4A 3KUFA 1VQ4T 1PSEA 2PVDB 2XIDA 3PFSA 2O01E 2WSFE 3PGGA 3OQ5A 4X9DA 4JDSA 4RG8A 2LRQA 2VC8A 1N27A 1N9RA 2R57A 3FLGA 1VQ8A 3C94A 2HNIA 3NTKA 2XDPA 3RUXA 2DIGA 2EWNA 5CKHA 2V8JA 4YTLA 4E7JA 5A0LA 2P0PA 4N0AA 4JRPA 2RHZA 4FT4A 4EMGA 3JCMh 5GAN8 2CGHA 4E7KA 2RHXA 1BI0A 2DPPB 5J3BA 4C8QB 3OYEA 3CCMA 5CAIA 5GANh 4BD3A 2JUFA 1S72T 4C0FA 3JB9H 3I56T 4M78A 4M7AA 4Z02A 3CCLT 1G3YA 2RJFA 2RJEA 2KVQG 2BKDN 1U1TA 1ZQ1A 4UC4A 5IAYA 5EG2A 3PT9A 4PJOF 3OYHA 4OF1A 4DQ2A 3CCRT 1U8RA 2LQKA 2ZPHB 2L5QA 2ZPIB 4C8QC 3A5ZB 3JCMW 3HL8A 1YJNT 3HRSA 1QVFS 2LCCA 1WJRA 2CZ0B 1Y96B 4ZGDB 1M4ZA 4BE1A 5GAN4 3WXMB 1M1KC 3VJPA 3TU4K 1NJIU 2A7YA 3S3MA 2EIFA 2CZ7B 4GLKA 1UGPB 4M7DF 1S72A 2K2VA 3BDUA 4HCCA 4M7DG 2DKGA 4XTUA 4BUGA 3MEAA 4DOVA 2EQMA 5J39A 2EQJA 5CO7A 1UB4A 3JCMX 3F70A 1K8AC 1JB0E 3LX7A 4J7IA 5CQXA 2XG8D 2NLUA 3LLRA 1JJ2S 4KUDK 2EJGA 3I55T 2X4WA 2XHCA 1FXXA 4CRIA 2F5KA 1NZ9A 1BYMA 4FIBA 3OW2S 4E7LA 3H6ZA 3CC4A 4QVDA 4PJOG 3DKMA 5GMKj 4WF2A 1WNLA 2GFUA 2KK4A 1BKBA 2CZ1B 2RJCA 3E19A 3OMGA 2QEXA 3FB9A 3CCVT 2RH2A 4LD9K 2I2LA 1BIAA 3MHXA 1OZ2A 1JBMA 1HXDA 3P8DA 3TREA 2E6NA 2LC4A 3TCJA 5GAN3 4C0DC 2D0QB 5GMKm 3HP9A 4BI4A 4ATOA 3V7RA 1M90U 4RMOA 3EFRA 2R5AA 1KG1A 1U1SA 4M77C 5I2SA 4HT9A 5GMKh 1X01A 4XU2A 3HFOA 4HCZA 4M75E 3RIRA 3S6WA 2LNVA 1WPYA 5GAMd 1YJ9T 2MWOA 2OAUA 4BE2A 2DXUA 3A8MB 3JRZA 5DY9A 3L2VA 4FT2A 4IUPA 3MP6A 1VQ7A 1KQ2A 4J8OA 3Q1JA 5CIUA 3X28B 3MP1A 2JVVA 3QYGB 1YIJT 5KCOA 3X20B 3OYMA 1KHIA 1X75C 2HQEA 4C92G 4OVAA 3QO3A 5GANe 4RCBA 4IURA 1Q7YC 3QUIA 2EQUA 1YCYA 4DA4A 4A54A 3J81E 5KE3A 1V29B 3G6ET 3JCMb 5LJ3h 4GY5A 4A53A 1FX7A 1I8FA 4C8QF 1G3WA 2DXBA 4C8QG 1WQ7A 5LJ5e 3OYGA 2R58A 3CCJT 2K5LA 5HK0A 2FYKA 3CPWS 2O4XB 4XK8E 5CKFA 2YLCA 3CCUA 5A0GA 1VQ6T 2E65A 3E9FA 3CPWA 5GANf 2F69A 4PJOB 2DAQA 4XTVA 1O75A 5D6XA 3JB9I 4MDXA 4LD6A 3A8GB 4M75A 2PUOB 2K4YA 3T9NA 2RI3A 3PMTA 4HA8A 4QVZA 3JCMJ 1IREB 2DXTA 4OGCA 3MEVA 3G7ZA 5DLOA 4JJNK 4M78C 4M7AC 3FRNA 2JTMA 5GMKi 1MGQA 4RCCA 2CKKA 2X35A 2B8AA 2XI9A 4XTXA 2DZCA 1NPPA 3BFMA 1UGRB 3QZ9B 1UGSB 4ME7A 2GF7A 3CCVA 3JB9J 4M75C 2YLBA 4HKEA 2GQVA 4ZGJB 3P8BB 1KQSA 5FLXE 1I81A 4O5VA 3OYIA 4OB2B 5CKBA 5I2MA 3G71T 4PNOA 3CCQT 2RB6A 1QP2A 1VQMA 3E1SA 3CCEA 3A8LB 1BI2A 1TH7A 2AHJB 2EFIA 3M55A 5GAMg 3CCQA 1KD1U 4XU1A 3J7AF 3RKYA 3FC3A 3WVEB 2QQ9A 5L8RE 3M57A 3V7CA 3LWIA 2DXCA 1VUBA 2OTLA 2EKOA 5LJ5d 3EFSA 1NE8A 5GMKe 1NPRA 1Q82C 3X24B 2EYQA 1W2BA 1KHCA 4A4HA 1GXIE 1P92A 5GAMf 3M59A 1JJ2A 5HKCA 3ASKA 3AHUA 4OMFB 3CC2A 2RJDA 4V2SA 4QQDA 2X4JA 5KE2A 4BB7A 3G4ST 4N4IA 2V8IA 1K73C 2L89A 4KUIA 3CCRA 4MMKA 1H3ZA 4C5GA 4EMKA 2CYZB 3QZ5B 3P8HA 2FL7A 3BDLA 4N4GA 3OYYA 3SB2A 2QQSA 5GAOp 1VQ6A 2E64A 3JCMd 3HRUA 2P0QA 3QBYA 4IUUA 4LDYA 1KC8C 2HAXA 3H8ZA 2BUDA 4PL6A 5LJ5j 1Q7YU 4BE0A 1SSFA 2FVUA 3PIPA 4JS4A 1YITT 3SWNB 2MF2A 1LOJA 2P0KA 2IG0A 3EAEA 2OTLT 3RKWA 1AHJB 3VYHB 1G5VA 3M5AA 1Q86U 2ZPFB 2JZ2A 3QKJA 3V7SA 5CCAA 4BI3A 4EPCA 4ZGEB 2E12A 2KMTA 3CCLA 1B34B 1Q81C 1BI3A 3RMSA 4E7IA 3GLXA 1H641 4A4FA 1D3BA 1D3BB 4JLIA 4PJOD 5C0MA 4N4HA 5GAN5 4J5YA 3JSCA 2K3YA 2E6ZA 3A8OB 4MZPA 4MZTA 1M1FA 2A3LA 2M16A 1VQ4A 3C95A 2YHTA 2DVEA 3OYNA 1YJWA 3NFCA 5FU6B 2IVWA 3DLMA 2BIVA 2OTJA 2VXFA 1M9SA 4N0AC 1VQKA 3OS5A 4C92D 4C92E 4R55A 1VQ9T 4A4KA 3OYCA 4ELYC 1XNIA 2EQKA 3PIOA 4J7FA 3UDCA 4PJOE 4M7DD 2LCLA 3M56A 4QVCA 3OYJA 1VQ7T 1Q81U 2GCXA 2OTJT 3QIIA 1VQOT 3HFNA 2DD5A 3CXCS 4L6V5 5GAN6 2CZ6B 3CBOA 3PNWC 1WJSA 3OS2A 1DJ7B 2ZCFB 3HKSA 4R56A 3QHSA 2QEXT 2D9TA 2V8KA 3OY9A 2KSSA 4C5HA 3VKIA 4D6WA 4M77B 4F7UB 3LWHA 1K8AU 2RHIA 4QQ6A 4JRQA 2Y90A 1KQ1A 5FU6C 4OB0B 5M9OA 3CCSA 3I55A 1OYXA 2DTOA 2HBPA 1LNXA 2XDDA 4M75G 4RG2A 4XTWA 3KXTA 1RI0A 2D6FA 1M5Q1 1ZBXA 4A4GA 2DD4A 3CMEA 1VQ5A 3DB4A 3JCMg 2KAFA 4B9XA 3A8HB 4BACA 4ZN1A 1VQNT 1M8VA 3CXCA 3QPHA 2ZGWA 3QYHB 4O6JA 1MHNA 3GOXA 4ZTFA 3MP8A 2DEQA 1VIFA 4M77E 4F7UE 3GNGA 2DTIA 1VQMT 4XQ3A 3L2RA 3JB9F 4LDVA 2LT1A 4C8QA 5LJ3f 2DJZA 4MDWA 2E5QA 1VQLT 3QXEB 3OMCA 5DLQE 1R8OB 4EMKC 5LJ3g 3S3NA 5LJ5f 1QVFA 2ZPBB 2QQRA 3OSSC 2K5IA 5GAOr 2PVOB 3GNFB 3WVDB 5HK3A 4NL3A 3O8VA 2FHDA 1BI1A 2VV5A 3PMIA 4KBMB 4IUVA 3CC2T 2XDBA 3E9GA 4JLGA 4C0DB 2WACA 5FRNA 2LVMA 4OGEA 5IN1A 4OB3B 1YJNA 3MO8A 5GMKl 1YBYA 3JCMc 3C12A 3CBPA 2M1HA 3M4GA 4EDUA 3OSVA 4EMHA 4NL2A 4EMKB 3UPUA 4C0ZA 4CI0C 2ZPGB 1VQPA 4C8QD 1YI2A 2PUKB 3ZBDA 2MI6A 2Y4XA 2L8DA 5GAMh 2RA2A 1VQLA 4LDUA 2RHYA 4JUVA 3OYAA 4DOWA 1QW1A 3LGLA 1I5LA 4M77A 4F7UA 2FB7A 4RKUE 4QQGA 5KH6A 4NOYA 3CCET 1Q86C 5FRMA 2QDYB 3JCMV 4C92A 2KY9A 3INZA 3G71A 3CCMT 3DLLA 5GAOq 3R6OA 4LDXA 1M90C 3UT1A 4PJOA 4HCBA 5KCHA 3KBGA 2QQAA 3PTAA 4KULA 3FJPA 4JRKA 4M77G 3ZFJA 4F7UG 2DK3A 1QVGA 2DO3A 4J6WA 4ZN3A 5GANd 3JCMQ 3CCST 1LJOA 2RI5A 4C0GA 1I4K1 2ZPEB 3OB9A 4PLIA 2L3RA 3M58A 4M78F 2G3RA 2K3XA 4M75D 3V8JA 1Y07A 4XTYA 1W2BS 4M7AF 4M7DA 4BI8B 3FDRA 1QP3A 3LGFA 2VXEA 5GANg 5HY6A 3RERA 4OP0A 5C6SA 4C92F 2K57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D3B A;  1D3B B;  4JLI A;  4C8Q E;  3JCM e;  5GAN 7;  4M7D C;  5GAN 5;  4PJO D;  4J5Y A;  3V8L A;  4C92 G;  4J6Y A;  3QO3 A;  2RD1 A;  4RCB A;  5GAN e;  3BY7 A;  3QUI A;  1YCY A;  3VU3 C;  2YHT A;  2DVE A;  4A54 A;  5GAN 2;  3JCM b;  5LJ3 h;  2VXF A;  4A53 A;  4N0A C;  5GAM e;  2EJF A;  3RKX A;  1BIB A;  1I8F A;  4C92 D;  4C92 E;  4C8Q F;  4C8Q G;  5LJ3 d;  1WQ7 A;  5LJ5 e;  4PJO E;  4M7D D;  3BW1 A;  4QVC A;  2FYK A;  3SWN C;  3HFN A;  2YLC A;  3L2Z A;  4MML A;  2E65 A;  3JB9 G;  4M78 D;  5GAN 6;  3PGG A;  4M7A D;  4X9D A;  5GAN f;  1JRI A;  4PJO B;  4M7A B;  3QHS A;  2VC8 A;  4J6X A;  1N9R A;  3GIB A;  4XTV A;  3JB9 I;  2RM4 A;  1HK9 A;  4M77 B;  4F7U B;  2Y90 A;  1KQ1 A;  2HNI A;  4M75 A;  3RUX A;  2EWN A;  2DTO A;  4HA8 A;  1LNX A;  3JCM J;  2DXT A;  4M75 G;  2EJ9 A;  4XTW A;  4N0A A;  3JCM P;  4M77 F;  4EMG A;  4F7U F;  1M5Q 1;  3JCM h;  5GAN 8;  2CGH A;  1N9S A;  4M78 C;  3QSU A;  4M7A C;  3JCM g;  2QTX A;  2JN0 A;  4C8Q B;  5CAI A;  5GMK i;  5GAN h;  4HT8 A;  1MGQ A;  1M8V A;  4RCC A;  2ZGW A;  4XU3 A;  1B34 A;  3JB9 H;  4XTX A;  2DEQ A;  2DZC A;  4M77 E;  4M78 G;  3BFM A;  4M78 A;  4F7U E;  2DTI A;  4M7A A;  4M7A G;  4XQ3 A;  3JB9 J;  3JB9 F;  4M75 C;  2YLB A;  4C8Q A;  1U1T A;  5LJ3 f;  2DJZ A;  1I81 A;  1Y96 A;  2DZ9 A;  2E1H A;  4EMK C;  3SWN A;  5LJ3 g;  4PNO A;  4PJO F;  3V8K A;  2RB6 A;  5LJ5 f;  4DQ2 A;  2E10 A;  5I21 A;  5LJ3 j;  1TH7 A;  5GAO r;  5GAN j;  4C8Q C;  3JCM W;  4M7D E;  5GAM g;  4NL3 A;  4XU1 A;  3RKY A;  1Y96 B;  2EAY A;  3V7C A;  5GAN 4;  3RES A;  5LJ5 d;  3EFS A;  4C92 C;  5GMK l;  5GMK e;  3JCM c;  3M4G A;  4M7D F;  3BDU A;  4EMH A;  5LJ5 g;  2DKG A;  4NL2 A;  4EMK B;  4M7D G;  4XTU A;  4C8Q D;  3HSB A;  5GAM f;  4Y91 A;  2E41 A;  3JCM X;  3AHU A;  5GAM h;  2RA2 A;  4V2S A;  2EJG A;  4JUV A;  1H64 1;  4M75 B;  5GAO m;  1I5L A;  4M77 A;  4F7U A;  2FB7 A;  4X9C A;  4MMK A;  4NOY A;  4QVD A;  4PJO G;  4EMK A;  3JCM V;  1WQW A;  4WF2 A;  4C92 A;  3INZ A;  1WNL A;  5GMK j;  5GAO q;  5LJ3 e;  3FB9 A;  3SB2 A;  4JRI A;  5GAO p;  4M7A F;  4PJO A;  2E64 A;  4C92 B;  3JCM d;  2I2L A;  1BIA A;  4XU0 A;  3FJP A;  4JRK A;  4M77 G;  1JBM A;  4M78 E;  1HXD A;  4M75 F;  4F7U G;  5LJ5 h;  5GAN 3;  4M7A E;  5LJ5 j;  4M7D B;  4J6W A;  3JCM f;  5GMK m;  5GAN d;  4PJO C;  3JCM Q;  3SWN B;  3V7R A;  1LJO A;  1LOJ A;  3EFR A;  3RKW A;  1I4K 1;  1U1S A;  3L1A A;  4M77 C;  5GAM j;  2DTH A;  5GMK h;  4HT9 A;  1X01 A;  4M78 F;  4M75 D;  3HFO A;  4M75 E;  4XU2 A;  4XTY A;  3RIR A;  3V8J A;  1WPY A;  5GAM d;  5GAO l;  4M7D A;  4M77 D;  3V7S A;  2DXU A;  5DY9 A;  3FIF A;  5GAO n;  3JB9 D;  2VXE A;  5GAN g;  1KQ2 A;  1B34 B;  3RER A;  4XTZ A;  4M78 B;  4OP0 A;  4C92 F;  2K57 A; 
#chains in the Genus database with same CATH topology
 2HL5 C;  1G8X A;  3JAM E;  1EZZ B;  1YJW T;  4E47 A;  2K5F A;  1Y57 A;  1NLP C;  3VS4 A;  2COY A;  1YHQ Q;  1RAD B;  1O9S A;  2EGE A;  4MML A;  1PG5 B;  5J26 A;  2PVG B;  1JRI A;  3CMA Q;  2RK1 A;  3CC7 A;  3GIB A;  2XIC A;  4FU6 A;  5CK9 A;  3OYF A;  1GBQ A;  3MCA B;  4J9F A;  2M0O A;  5CVI A;  5CQY A;  1H3H A;  3TQ7 P;  3JCM P;  1SEM A;  2NWM A;  2YRC A;  2C0O A;  2QTX A;  2QDL A;  3QDR B;  2DIQ A;  1GBR A;  1OI1 A;  3QJ6 A;  5FU7 C;  2AZV A;  1QVP A;  1KC8 R;  4JS5 A;  2E1H A;  3ZEH A;  2HKN A;  1QKW A;  3M53 A;  3CC4 T;  2DER A;  5I21 A;  4TVR A;  4FYV B;  2EYY A;  3EG0 A;  3CBM A;  3QJY A;  4D8K A;  2LJ1 A;  2X4Y A;  1RL2 A;  2EAY A;  2XKO C;  4J9H A;  5IHK A;  1X6O A;  1MNE A;  3SDZ A;  4B6M A;  2H3J A;  3LH0 A;  4C92 C;  1ABO A;  1WFW A;  5LJ5 g;  1G3T A;  4XAX B;  2F1L A;  1KC8 U;  2E41 A;  3DB3 A;  1IGQ A;  4PJL A;  4PJM A;  1U06 A;  3TEE A;  4E6R A;  5DM7 R;  5GAO m;  1UFF A;  4L59 A;  1Y7X A;  1RUW A;  3FEO A;  3OA6 A;  1TS9 A;  3GP8 A;  4BY6 B;  5CKE A;  4L5G A;  4C92 B;  4XU0 A;  5LJ5 h;  4M78 E;  2VKN A;  4M7D B;  2VGM A;  3CD6 T;  3JCM f;  2DBM A;  4LUE A;  3MEW A;  1PSF A;  2MMP A;  1QVF P;  1Y0M A;  3CCU T;  5GAO n;  2RHU A;  3VV0 A;  3MET A;  3VRZ A;  4XTZ A;  2RNA A;  4II1 A;  2XD0 A;  1QQJ A;  1ZSG A;  1Q82 U;  1PD1 A;  4VUB A;  3ME9 A;  2YSQ A;  5AYF A;  2EJF A;  1ZUY A;  2WSE E;  3QG1 A;  3RMQ A;  1VQ8 T;  2M9U A;  2F2X A;  1VQL Q;  4LDW A;  4AG2 C;  5A0D A;  2LT4 A;  1VQ4 T;  2XID A;  3PFS A;  2O01 E;  2V1Q A;  4X9D A;  4JDS A;  4RG8 A;  2CSI A;  1N27 A;  1YJN Q;  1MV0 B;  1VQ8 A;  1PKT A;  1YP5 A;  4YTL A;  4E7J A;  2P0P A;  4JRP A;  4FT4 A;  2RHX A;  2DPP B;  3CCM A;  1VQM Q;  5GAN h;  4BD3 A;  2JUF A;  1S72 T;  2DBK A;  4C0F A;  2KRN A;  4KGX B;  2LCS A;  2RJE A;  2YWW A;  2EYX A;  2A08 A;  1U1T A;  1ZQ1 A;  1BB9 A;  4RTV A;  2J7I A;  3EG1 A;  4PJO F;  4DQ2 A;  1U8R A;  2LQK A;  2OX7 A;  3A5Z B;  1QVF S;  1ZA1 B;  3HRS A;  3TVT A;  2YXY A;  4BE1 A;  1TU0 B;  2LJ3 A;  3WXM B;  1VA7 A;  2DRK A;  2CZ7 B;  4GLK A;  3BDU A;  2DKG A;  2LQW A;  4XTU A;  3MEA A;  4RUG A;  3FJ5 A;  1NG2 A;  1K8A C;  3LX7 A;  2NLU A;  1OX8 A;  2EJG A;  1SF9 A;  3I55 T;  2L3Q A;  1AVZ C;  1YIT Q;  1M1K R;  3OW2 S;  1MMN A;  1T0H A;  2KRS A;  4Z89 A;  2E5K A;  2KK4 A;  1GL5 A;  1BIA A;  3MHX A;  1OZ2 A;  1JBM A;  2QGG A;  2E6N A;  3HP9 A;  4BI4 A;  3V7R A;  1SRL A;  4RMO A;  4FCY A;  3G4S Q;  2DA9 A;  2K2M A;  4M77 C;  1X01 A;  4HCZ A;  3RIR A;  1D0X A;  4BE2 A;  4QKU A;  3A8M B;  3MP6 A;  1KQ2 A;  1H92 A;  1E6G A;  4PK4 A;  4RTW A;  5IHN A;  2JVV A;  1NEG A;  1WZO A;  1YIJ T;  3AT1 B;  2IIM A;  3X20 B;  4OVA A;  4RCB A;  1VQ7 Q;  3QUI A;  1IRX A;  5IH2 A;  3J81 E;  1YJW Q;  3G6E T;  4C8Q F;  1G3W A;  5LJ5 e;  3CCJ T;  4HVV A;  2YLC A;  5A0G A;  1X27 A;  2EYW A;  5GAN f;  4PJO B;  1Q86 R;  2DAQ A;  4XTV A;  3JB9 I;  4KH0 B;  2BE7 D;  2K4Y A;  2DVJ A;  2RI3 A;  3PMT A;  4HA8 A;  2DXT A;  4JJN K;  3OW2 P;  3RBB B;  2L3P A;  1TSF A;  5KYY A;  2XI9 A;  4XTX A;  4ME7 A;  2GF7 A;  1KQS A;  5FLX E;  4JJD A;  1LPL A;  1MND A;  2YT6 A;  4RTU A;  4OB2 B;  2RB6 A;  3E1S A;  3A8L B;  1BI2 A;  1TH7 A;  3R6N A;  3VRY A;  4GLM A;  3M55 A;  3FC3 A;  3V7C A;  2CT4 A;  1W2B A;  2PNI A;  1NYF A;  3CC2 A;  2RJD A;  2X4J A;  4BB7 A;  3G4S T;  4N4I A;  4OMM A;  2CYZ B;  3QZ5 B;  2JXB A;  3P8H A;  4N4G A;  5KYX A;  1BBZ A;  2QTV A;  2P0Q A;  1PD0 A;  3H8Z A;  2BUD A;  4PL6 A;  3MKD A;  1SSF A;  2FVU A;  4JS4 A;  1PCX A;  2MF2 A;  1OV3 A;  5CCA A;  3V7S A;  3CCL A;  3RMS A;  1HSQ A;  2W0Z A;  1T3S A;  1D3B A;  4JLI A;  5C0M A;  1QCN A;  2K3Y A;  4MZT A;  2CT3 A;  4RTT A;  1YJW A;  3NFC A;  5FU6 B;  3OS5 A;  4C92 D;  4J7F A;  2FZC B;  4M7D D;  4QVC A;  3OYJ A;  2OTJ T;  2GCX A;  1NBE B;  3QII A;  3PNW C;  3OS2 A;  3QHS A;  2D9T A;  1KJW A;  1K8A U;  4D6W A;  2RHI A;  4OMQ A;  1C6V X;  4OB0 B;  5M9O A;  3CCS A;  2A0F B;  2HBP A;  3REA B;  1JJ2 P;  2XDD A;  1RAA B;  4M75 G;  2NUZ A;  3D7S B;  1VQ5 A;  5KYU A;  2X51 A;  4RTY A;  1E6H A;  1M8V A;  1RAB B;  3MP8 A;  4M77 E;  4F7U E;  2DTI A;  4XQ3 A;  1KK7 A;  3CCV Q;  2HSE B;  2LT1 A;  1RI9 A;  4C8Q A;  2DJZ A;  4MDW A;  2E5Q A;  1R8O B;  2ZPB B;  5IXB A;  5GAO r;  4K11 A;  3EHQ A;  5HK3 A;  4NL3 A;  3VS7 A;  3O8V A;  2FPD A;  2FHD A;  3QDF A;  4KBM B;  3CC2 T;  1FMK A;  1VYU A;  4C0D B;  2WAC A;  3A98 A;  4E7Z A;  2CP3 A;  5IN1 A;  4OGE A;  1YBY A;  1BCM A;  4EMH A;  2ZPG B;  3ZBD A;  1AWW A;  1WI7 A;  5GAM h;  2RHY A;  4CC2 A;  3H0I A;  1QW1 A;  2LNH B;  5KH6 A;  1QKX A;  1BCO A;  5KCH A;  3PTA A;  3FJP A;  4M77 G;  3ZFJ A;  4F7U G;  1X6B A;  2O88 A;  1QVG A;  2M51 A;  1JO8 A;  5GAN d;  1M2O A;  1R0C B;  1RAH B;  4M78 F;  2K3X A;  3REB B;  2BZX A;  4XTY A;  1RLP C;  2L0A A;  1QP3 A;  2KNB B;  3FDR A;  3LGF A;  1TWB A;  1K73 R;  2C0I A;  3RER A;  2DX1 A;  4OP0 A;  5C6S A;  1PHT A;  2K57 A;  2YRV A;  1UEB A;  4BDY A;  1WJQ A;  1Q7Y R;  1IXD A;  3VYG A;  4J6Y A;  1T3L A;  1JXM A;  1Y71 A;  4IUQ A;  4Y28 E;  2O9V A;  3OYK A;  2XK0 A;  2OAW A;  3H9N A;  3VS0 A;  3CCQ Q;  3G6E A;  1WHL A;  1IGU A;  4OB1 B;  1ZX6 A;  4M78 D;  4FL6 A;  2AIR B;  1GFC A;  2RM4 A;  2KGT A;  1X2Q A;  5FRO A;  4FSX A;  4ZNX A;  2RMO A;  1YJ9 A;  4NS5 A;  2JN0 A;  1K9A A;  1TTH B;  2PQW A;  1W6X A;  1M1K U;  1B7T A;  1NJI C;  1PRL C;  2DZ9 A;  2RO0 A;  3CCQ T;  5A2Q E;  2KEA A;  3L2W A;  3VS6 A;  3L2Q A;  2VVK A;  3VUB A;  3OS1 A;  1KIK A;  3RES A;  1VQP T;  2DIL A;  2AKK A;  2MOX A;  1PKS A;  4Z8A A;  1OZ3 A;  3HSB A;  1AT1 B;  3HHT B;  4E7H A;  4P5N A;  3SHW A;  2WSC E;  1M90 R;  2NYS A;  1UTI A;  4JJB A;  1OEB A;  1VQK Q;  2VGN A;  4ZTJ A;  3G4S A;  1UGQ B;  3NTH A;  3OS0 A;  1YJ9 Q;  3URG A;  1XOV A;  1W4S A;  2PU9 B;  4PJO C;  1M2V B;  4PLL A;  1SHF A;  1VQ5 T;  1UG1 A;  2QEX Q;  1ZHI A;  2QI2 A;  4ELZ C;  3FIF A;  2EYZ A;  3JB9 D;  1KD1 C;  5GAM e;  2RI2 A;  3SFM A;  2GFA A;  3OBW A;  2ECZ A;  2W10 A;  1VQ6 Q;  4RTX A;  2RD1 A;  2LJ0 A;  3OW2 A;  1EIF A;  5GAN 2;  3CCR Q;  2R5M A;  3RKX A;  2LX9 A;  4LE9 A;  2A28 A;  1IO6 A;  1S1N A;  2KXC A;  1T0J A;  1PSE A;  2WSF E;  2YUP A;  4CC7 A;  2ED0 A;  2KR3 A;  2R57 A;  2COW A;  2HNI A;  1N5Z A;  3RUX A;  2DIG A;  5CKH A;  1PM3 A;  3I5S A;  4EMG A;  5J3B A;  2JJ9 A;  4C8Q B;  3UA7 A;  4M7A A;  2BTT A;  4Z02 A;  1A0N B;  5KYX B;  1G3Y A;  2RJF A;  2BKD N;  2G6F X;  5IXF A;  2BZ8 A;  3OYH A;  2PZ1 A;  4DBR A;  3JCM W;  2LCC A;  2CZ0 B;  1D09 B;  2FPE A;  1K4U S;  2V26 A;  2A7Y A;  3S3M A;  2RQV A;  4PFZ A;  1UGP B;  1ACM B;  4BUG A;  4DOV A;  2EQM A;  2EQJ A;  3CC2 Q;  3C0C A;  1UB4 A;  3JCM X;  3F70 A;  1JB0 E;  2XG8 D;  2D8J A;  3CQT A;  3CME Q;  2X4W A;  2XHC A;  1FXX A;  2F5K A;  3H6Z A;  4QVD A;  3DKM A;  5GMK j;  3OMG A;  2DF6 A;  2CZ1 B;  3FB9 A;  2RH2 A;  4LD9 K;  2I2L A;  1GCP A;  4Z88 A;  5GAN 3;  5GMK m;  4F04 B;  2FRY A;  4ATO A;  4RTZ A;  1B3Q A;  4XU2 A;  1YJ9 T;  2LNV A;  2OAU A;  4DBH A;  3E2U A;  2DXU A;  3JRZ A;  3L2V A;  1JXO A;  2QYZ A;  4FT2 A;  1R77 A;  2RQW A;  4J8O A;  3CC7 Q;  2CH4 W;  1YI2 Q;  4IUR A;  1Q7Y C;  4A54 A;  5KE3 A;  1WIE A;  3JCM b;  5LJ3 h;  4GY5 A;  1I8F A;  3TSW A;  2XMF A;  4C8Q G;  1WQ7 A;  4KGV B;  2R58 A;  1M3C A;  5HK0 A;  3CCU A;  1OPL A;  2E3H A;  4J9I A;  1Q82 R;  4MDX A;  1NJI R;  4LD6 A;  4M75 A;  2PUO B;  4GBQ A;  1AWO A;  4QVZ A;  4IIM A;  4OGC A;  2AZS A;  3MEV A;  3G7Z A;  1PRM C;  2JTM A;  5GMK i;  1MGQ A;  2HL3 A;  1B07 A;  4DBF A;  2CKK A;  3CCM Q;  2B8A A;  1NPP A;  3BFM A;  1UGR B;  3QZ9 B;  3JB9 J;  4HKE A;  4ZGJ B;  1I81 A;  3G71 T;  5I2M A;  4E2F B;  4PNO A;  1QP2 A;  2JT4 A;  2CP5 A;  5GAM g;  3CCQ A;  4AMC A;  3RKY A;  3JV3 A;  3WVE B;  2ZAE A;  2X3X D;  3M57 A;  1QVG P;  2DXC A;  2OTL A;  3M0P A;  5LJ5 d;  1NPR A;  3X24 B;  2EYQ A;  1GXI E;  5GAM f;  3M59 A;  4V2S A;  5KE2 A;  2DJQ A;  2L89 A;  1QWE A;  4MMK A;  3G71 Q;  1H3Z A;  4LN2 A;  4C5G A;  4EMK A;  2FL7 A;  1IHW A;  2O2O A;  1VQN Q;  1UUE A;  2PTK A;  3JCM d;  3HRU A;  3QWY A;  1XJW B;  4J9D A;  3PIP A;  4EIK A;  1YIT T;  2CP0 A;  1CKB A;  3RKW A;  2DLP A;  1Q86 U;  2ZPF B;  2P4R A;  4EPC A;  1WX6 A;  1Q81 C;  1BI3 A;  2MIO A;  4A4F A;  1H64 1;  1OQK A;  3JSC A;  1CSK A;  2YHT A;  3OYN A;  2IVW A;  3DLM A;  2E3I A;  1VYT A;  4R55 A;  2EQK A;  1AOJ A;  2YUQ A;  4OMP A;  2FPF A;  4FW2 A;  4KGZ B;  1Q81 U;  2NUT A;  1VQ7 T;  3EG2 A;  2RQT A;  3CXC S;  5GAN 6;  3SEM A;  5KYW B;  1WJS A;  1DJ7 B;  2ZCF B;  2QEX T;  2V8K A;  1S72 Q;  4M77 B;  4F7U B;  3LWH A;  4AFZ C;  4WTO B;  1RAC B;  3I55 A;  1OYX A;  1KFZ A;  1RI0 A;  4A4G A;  1ZBX A;  3CME A;  5I11 A;  3CXC A;  2ZGW A;  2DEQ A;  1VIF A;  1VQL T;  3OMC A;  5DLQ E;  2YRD A;  2L3S A;  3NHN A;  3OSS C;  3EG3 A;  3GNF B;  1U5S A;  1BI1 A;  4LNP A;  2VV5 A;  3PMI A;  4X1V A;  3NPF A;  2XDB A;  3E9G A;  4JLG A;  4HVW A;  2JS2 A;  2LVM A;  4OB3 B;  2DYI A;  3MO8 A;  3JCM c;  3C12 A;  3CBP A;  2M1H A;  4NL2 A;  3UPU A;  4J9C A;  1YI2 A;  2PUK B;  1H8K A;  2GBQ A;  1RAI B;  3LH5 A;  2AKL A;  3OYA A;  2DRM A;  4RKU E;  3CCE T;  5FRM A;  2KY9 A;  3INZ A;  5GAO q;  3R6O A;  1FMW A;  1WHJ A;  2J6K A;  1W70 A;  2MK5 A;  2K79 A;  2QQA A;  4KUL A;  2DK3 A;  4ZN3 A;  4HVU A;  2LX7 A;  3CCS T;  1LJO A;  1W1F A;  2RI5 A;  4C0G A;  4PLI A;  2L3R A;  4M7A F;  4M75 D;  1Y07 A;  4ANJ A;  3IQL A;  2VXE A;  4C92 F;  3MEU A;  2XU8 A;  4A4E A;  1VQK T;  3O5Z A;  1VQ9 A;  3UAT A;  3X26 B;  1QMC A;  2YDL A;  2DYB A;  1N8R U;  2COZ A;  3BW1 A;  1WLP B;  3ZL7 C;  3S3O A;  2X3W D;  3CPF A;  2ZZD A;  3L2Z A;  3JB9 G;  4IUT A;  4JJC A;  4M7A D;  5FW9 A;  1YIJ A;  1OU9 A;  1K9M R;  2QK0 A;  4QW2 A;  2OI3 A;  5D7U A;  2E70 A;  2NUP B;  4FM4 B;  3OYB A;  5D6Y A;  4M77 F;  4F7U F;  2CP7 A;  3J80 E;  1N9S A;  1QCO A;  4F14 A;  2C0T A;  1D1C A;  3I9Q A;  2JOY A;  2ESW A;  1MMD A;  4M78 G;  1ZSZ A;  2RQU A;  3GF5 A;  1RAG B;  2HDA A;  3NMZ C;  1UGV A;  2CS7 A;  2QAZ A;  4IIO A;  2X4X A;  2CP6 A;  2JTF A;  2K7A A;  2MWP A;  3C4S A;  3SWN A;  2E10 A;  5LJ3 j;  4M7D E;  2ED1 A;  5GAN j;  3G6E Q;  2NUP A;  3L42 A;  1KQS P;  2HZY A;  1Z9Z A;  1M30 A;  1YI2 T;  1XQH A;  1CKA A;  3CD6 A;  1N6A A;  2EQI A;  5IT9 E;  4X34 A;  3RR6 A;  2HCK A;  2LZ6 B;  4Q5W A;  3L2U A;  2KDS A;  2F5T X;  4M75 B;  1V1C A;  1OUL A;  2HD0 A;  3CEY A;  3CCL Q;  4X9C A;  2M0Y A;  1IZ6 A;  1WQW A;  3N5B B;  3SD4 A;  5LJ3 e;  1D1A A;  3A1P A;  1VIE A;  2KT8 A;  4JRI A;  1MV3 A;  2LTO A;  1M8M A;  3M9Q A;  4MZM A;  1YHQ A;  3L1A A;  5GAM j;  2DTH A;  3CME T;  2KI7 A;  5GAO l;  4IKF A;  4KRT A;  5CR2 A;  2DL3 A;  1WHM A;  1G3S A;  4M7A B;  1R0B G;  3NTI A;  4BY6 C;  4C8Q E;  5GAN 7;  1K8A R;  2QA4 Q;  3V8L A;  1VQO A;  1N8R C;  3ER0 A;  4AFS C;  2MAM A;  2JMA A;  5LJ3 d;  4J9E A;  1UHC A;  1QVG S;  3SWN C;  3KUF A;  3H0F A;  3PGG A;  3OQ5 A;  2OTL Q;  3NTK A;  1X43 A;  2V8J A;  5A0L A;  5GAN 8;  8ATC B;  2CGH A;  4OMO A;  1EX4 A;  5CAI A;  3BE3 A;  1UEC A;  1UDL A;  3JB9 H;  4M78 A;  3EH2 A;  2KVQ G;  1Z9Q A;  1WXT A;  5IAY A;  1LVK A;  1VQ8 Q;  3M0S A;  3PT9 A;  4FYY B;  1VQ9 Q;  3CCR T;  6AT1 B;  1WA7 A;  1F1B B;  4C8Q C;  2L5Q A;  3HL8 A;  1YJN T;  3ULR B;  4D8D A;  5GAN 4;  3TU4 K;  1NJI U;  2EIF A;  5KYW A;  2RN8 A;  2A37 A;  1ZSZ B;  4M7D F;  1S72 A;  1AZG B;  5J39 A;  2O9S A;  1RLQ C;  2GTO A;  4J7I A;  1VQ5 Q;  3LLR A;  3KFV A;  4KH1 B;  4CRI A;  1NEB A;  1NZ9 A;  1BYM A;  1NYG A;  4FIB A;  3CC4 A;  2EKH A;  2EGC A;  1RAF B;  4WF2 A;  1WNL A;  2QEX A;  3E19 A;  2RJC A;  2K3B A;  2QG9 B;  3EFO B;  3CCV T;  1X6G A;  2LQN A;  1D1B A;  1X69 A;  2YUO A;  2MYS A;  2AK5 A;  1HXD A;  3TCJ A;  1YNZ A;  2D0Q B;  4C0D C;  1M3B A;  1M90 U;  1U1S A;  3HFO A;  4M75 E;  3S6W A;  5GAM d;  1WPY A;  2DE0 X;  4IUP A;  1J3T A;  5CIU A;  3X28 B;  2P84 A;  5KCO A;  3OYM A;  2HQE A;  4C92 G;  5GAN e;  2JTE A;  2OTJ Q;  4DA4 A;  2EQU A;  1YCY A;  1V29 B;  2Z0W A;  2QGF B;  1BK2 A;  4A53 A;  2H3E B;  2DXB A;  1YIJ Q;  5HCK A;  2SRC A;  3VS1 A;  3OYG A;  2K5L A;  1K0S A;  3CPW S;  3VS3 A;  2O4X B;  5CKF A;  1VQ6 T;  2E65 A;  2JW4 A;  1UJY A;  9ATC B;  1EFN A;  5L23 A;  3A8G B;  2DM1 A;  3T9N A;  3CC4 Q;  1KD1 R;  4M78 C;  4CC3 A;  4RCC A;  2MPX C;  1AEY A;  1UGS B;  1PWT A;  3CCV A;  4M75 C;  2YLB A;  3P8B B;  3I55 Q;  4AFU C;  4O5V A;  3OYI A;  5CKB A;  1Q81 R;  1TXQ A;  2EFI A;  1I5O B;  3QWX X;  1KD1 U;  4PJJ A;  4XU1 A;  1TOV A;  2QQ9 A;  5L8R E;  3EFS A;  1NE8 A;  5GMK e;  1Q82 C;  4JZ3 A;  2J6O A;  4A4H A;  1P92 A;  1JJ2 A;  5HKC A;  1SPK A;  4OMF B;  1YFN A;  4QQD A;  1K73 C;  1JQQ A;  3BDL A;  5ECA A;  5GAO p;  2QQS A;  1VQ6 A;  2E64 A;  3QBY A;  1N8R R;  2BZY A;  2HAX A;  5LJ5 j;  1G83 A;  1I1J A;  2VWF A;  3EGX A;  3TSZ A;  3SWN B;  1TUD A;  2DL8 A;  3EAE A;  2IG0 A;  3NGP A;  2FG0 A;  2SEM A;  3I35 A;  4HCK A;  3VYH B;  1KSW A;  3M5A A;  2KYM A;  2JM8 A;  3QKJ A;  2L2P A;  4ZGE B;  2E12 A;  2KMT A;  1WXU A;  1VQ4 Q;  2FO0 A;  1VQO Q;  2HSP A;  3GLX A;  4PJO D;  3H41 A;  2E6Z A;  3A8O B;  1M1F A;  5EC7 A;  2M16 A;  2EW3 A;  2BIV A;  1M9S A;  4N0A C;  2JS0 A;  4ORZ A;  4A63 B;  4C92 E;  1VQ9 T;  1VQK A;  4A4K A;  3OYC A;  1TUC A;  3PIO A;  3UDC A;  2LCL A;  3M56 A;  1VQO T;  2DD5 A;  4R56 A;  3HKS A;  2DL7 A;  4C5H A;  3VKI A;  4QQ6 A;  2Y90 A;  3PVL A;  4F16 A;  4RG2 A;  3KXT A;  2D6F A;  1TG0 A;  1M5Q 1;  1ZSZ C;  2AT1 B;  2KAF A;  4B9X A;  3A8H B;  4BAC A;  1VQN T;  2DEU A;  3QPH A;  2HMA A;  4OML A;  1MHN A;  2YUN A;  4ZTF A;  1WHK A;  1AD5 A;  5GJV B;  1VQM T;  3JB9 F;  4LDV A;  4ESR A;  3QXE B;  4EMK C;  3U23 A;  1NM7 A;  5LJ3 g;  3S3N A;  5LJ5 f;  2X9H A;  2K5I A;  2H8H A;  1NLO C;  3H0H A;  3WVD B;  4AT1 B;  1AZE A;  2B86 A;  5FRN A;  5IHI A;  3CXC P;  5GMK l;  3M4G A;  4EDU A;  4C0Z A;  1VQP A;  3EG9 B;  2CUB A;  2RA2 A;  4LDU A;  1K1Z A;  1ARK A;  2EBP A;  3LGL A;  2CRE A;  4Y92 A;  3VS5 A;  5GJW B;  2QDY B;  4C92 A;  3G71 A;  2LP5 A;  3CCM T;  1RAE B;  4HCB A;  4JRK A;  2ENM A;  1VOM A;  4DEX A;  4J6W A;  1K0X A;  2K6D A;  2F2V A;  1M2V A;  1I4K 1;  2IPO B;  3M58 A;  2G3R A;  3V8J A;  1W2B S;  4BI8 B;  2DL4 A;  5GAN g;  5HY6 A;  1WGS A;  3HPW A;  3JCM e;  3M54 A;  2FZK B;  2I0N A;  1ZUK A;  3VU3 C;  2D0N A;  1YWP A;  3RDV A;  1BIB A;  1YIT A;  1KQS S;  3CMA A;  2VYT A;  8AT1 B;  3CC7 T;  3LW5 E;  1MMG A;  5CKD A;  3OYD A;  1BU1 A;  2C06 A;  4C5I A;  3X25 B;  2O4X A;  4J6X A;  4FYW B;  1IHV A;  1HK9 A;  5FU7 B;  1ZBJ A;  1K9M C;  2EJ9 A;  3QSU A;  3GPL A;  2EGA A;  1FMV A;  2KQW A;  1AWJ A;  4J9B A;  4HT8 A;  1LCK A;  4XU3 A;  1B34 A;  2A36 A;  4JPB W;  4M7A G;  4M4Z A;  3UF4 A;  1M1G A;  1K9M U;  5D6W A;  1XTD A;  1IB8 A;  1Y96 A;  4C5E A;  3V8K A;  1Q86 C;  4LXC A;  2LDM A;  1OOT A;  1OPK A;  1PC0 A;  2HKQ B;  4KT0 E;  1YHQ T;  4AFQ C;  1MMA A;  1K73 U;  4Y91 A;  1OX9 A;  5AT1 B;  2RQR A;  1FWZ A;  3UWN A;  4QT7 A;  3LYI A;  3OYL A;  3CPW P;  3PVQ A;  5LL6 S;  2VUB A;  1C0M A;  3EGU A;  3OBY A;  3VUZ A;  2P4T A;  4M7A E;  4M75 F;  3CCJ A;  2QXF A;  3I56 A;  2CDT A;  3CCE Q;  1ZA2 B;  4PFP A;  1VQN A;  1JU5 C;  1Q95 G;  4FYX B;  3MPU B;  4PKC C;  3MJX A;  2RPN A;  4BDZ A;  4M77 D;  3M4Y A;  3HRT A;  4M78 B;  2Y4Y A;  3CMA T;  2ROT A;  4M7D C;  2HQX A;  4B9W A;  2LQ8 A;  3RNJ A;  1QLY A;  4CC4 B;  4DBQ A;  1GCQ A;  3BY7 A;  1WDX A;  2RK2 A;  1SRM A;  2QQB A;  2QA4 T;  2QA4 A;  1V76 A;  1AWX A;  2JNG A;  4J83 A;  2JMC A;  2J06 A;  2PVD B;  2QAS A;  2LRQ A;  2VC8 A;  1N9R A;  3FLG A;  3C94 A;  2XDP A;  2EWN A;  1WHH A;  4F17 A;  2J6F A;  4PJN A;  4N0A A;  2RHZ A;  3JCM h;  3EGX B;  4E7K A;  1BI0 A;  2FEI A;  3OYE A;  1ABQ A;  3I56 Q;  2GGR A;  3I56 T;  2F2W A;  3CCL T;  1WXB A;  1YCS B;  1UJ0 A;  4UC4 A;  1D0Y A;  5EG2 A;  2ATC B;  1HYO A;  4OF1 A;  1SKU B;  2ZPH B;  2ZPI B;  3EGD B;  2CUD A;  1WJR A;  1Y96 B;  4ZGD B;  1M4Z A;  1M1K C;  3VJP A;  1VQP Q;  3M0R A;  2VAS A;  2KRO A;  3G1J A;  2K2V A;  4HCC A;  4M7D G;  3M0T A;  5CO7 A;  3CCU Q;  5CQX A;  1JJ2 S;  4KUD K;  2KBT A;  4E7L A;  4PJO G;  2GFU A;  7AT1 B;  1BKB A;  1VYV A;  1X2K A;  1OU8 A;  1UE9 A;  4PFO A;  3P8D A;  3TRE A;  2LC4 A;  1SSH A;  4FSS A;  2KYB A;  2EVR A;  3EFR A;  2R5A A;  1KG1 A;  2DNU A;  5I2S A;  3EH1 A;  5GMK h;  4HT9 A;  2MWO A;  2DET A;  5DY9 A;  2D1X A;  1VQ7 A;  4J9G A;  3Q1J A;  2NUT B;  3MP1 A;  2K9G A;  3QYG B;  1TUG B;  3PE0 A;  2E4H A;  1QCF A;  1KHI A;  1X75 C;  3QO3 A;  2KE9 A;  1U3O A;  1FX7 A;  1I0C A;  4LUD A;  2FYK A;  4XK8 E;  2DMO A;  1I07 A;  3E9F A;  3CPW A;  2F69 A;  3GBQ A;  5D6X A;  4AG1 C;  1O75 A;  1PNJ A;  3JCM J;  1IRE B;  1QWF A;  3UA6 A;  5DLO A;  1W2B P;  4M7A C;  1C1A A;  2JM9 A;  3FRN A;  2BE9 B;  3EG9 A;  2X35 A;  1M3A A;  2DZC A;  2FRW A;  2GQV A;  2M02 A;  1UHF A;  1VQM A;  3CCE A;  2DFU A;  2AHJ B;  2OJ2 A;  3J7A F;  4E7S A;  3I5R A;  3LWI A;  1VUB A;  2EKO A;  5I22 A;  1KHC A;  1HJD A;  1G2B A;  1FYN A;  2GNC A;  3ASK A;  3AHU A;  5KYU B;  3THK A;  2V8I A;  4KUI A;  3CCR A;  1WHG A;  2LMJ A;  2GQI A;  3OYY A;  3SB2 A;  4HXJ A;  4IUU A;  4LDY A;  1KC8 C;  3M0U A;  2CSQ A;  1Q7Y U;  4BE0 A;  2ROL A;  1LOJ A;  2P0K A;  3CCS Q;  2OTL T;  1AHJ B;  2CH4 A;  1G5V A;  2JZ2 A;  3M0Q A;  1K76 A;  4BI3 A;  1JEG A;  4WCI A;  1B34 B;  4E7I A;  5FWC A;  3EFO A;  1D3B B;  4N4H A;  5GAN 5;  4J5Y A;  4MZP A;  3EGD A;  2A3L A;  2DL5 A;  4OMN A;  1VQ4 A;  3C95 A;  2DVE A;  1ZUU A;  2OTJ A;  2EPD A;  2KRM A;  2VXF A;  1ZLM A;  1XNI A;  4ELY C;  1SHG A;  4PJO E;  3HFN A;  2RF0 A;  4L6V 5;  2CZ6 B;  3CBO A;  1YWO A;  3OY9 A;  2KSS A;  4JRQ A;  5FU6 C;  1KQ1 A;  2GTJ A;  1D0Z A;  5FWB A;  2DTO A;  1LNX A;  4XTW A;  2DD4 A;  3DB4 A;  2VB6 A;  3JCM g;  2O31 A;  4ZN1 A;  3QYH B;  4O6J A;  5KYN A;  3GOX A;  2HQH A;  3GNG A;  2V1R A;  3L2R A;  5LJ3 f;  1QVF A;  2KT1 A;  2QQR A;  2KXD A;  2D8H A;  2ABL A;  1WYX A;  2PVO B;  4FW1 A;  1MUZ A;  4R0K A;  3VS2 A;  1YN8 A;  4IUV A;  2MCN A;  1E7O A;  1YJN A;  3OSV A;  4EMK B;  4CI0 C;  5KYY B;  2CP2 A;  4C8Q D;  4JZ4 A;  2MI6 A;  2HBW A;  2Y4X A;  2L8D A;  1VQL A;  4DEY A;  4JUV A;  4DOW A;  3HTR A;  1I5L A;  4M77 A;  4F7U A;  2FB7 A;  4QQG A;  4NOY A;  3JCM V;  4LDX A;  3DLL A;  2HEQ A;  1M90 C;  3UT1 A;  4PJO A;  3KBG A;  2FZG B;  1SG5 A;  3EHR A;  2DO3 A;  1GRI A;  1GFD A;  1HD3 A;  3JCM Q;  2J05 A;  1GCQ C;  2ZPE B;  3OB9 A;  3CD6 Q;  4M7D A;  1M27 C;  3CCJ Q; 
#chains in the Genus database with same CATH homology
 2YRV A;  1WGS A;  2XU8 A;  3MEU A;  1UEB A;  3HPW A;  3M54 A;  4A4E A;  1WJQ A;  3JCM e;  4BDY A;  1VQK T;  3VYG A;  4J6Y A;  3X26 B;  1VQ9 A;  3JAM E;  1Y71 A;  4IUQ A;  3VU3 C;  1YJW T;  4Y28 E;  4E47 A;  2K5F A;  3OYK A;  2XK0 A;  1BIB A;  1YIT A;  1KQS S;  3CMA A;  1N8R U;  3G6E A;  2VYT A;  3BW1 A;  3CC7 T;  3LW5 E;  5CKD A;  3OYD A;  3S3O A;  3CPF A;  2C06 A;  4C5I A;  1O9S A;  2ZZD A;  3L2Z A;  4MML A;  4IUT A;  4OB1 B;  5J26 A;  4M78 D;  3JB9 G;  3X25 B;  2PVG B;  4M7A D;  1YIJ A;  4FL6 A;  1JRI A;  2O4X A;  2RK1 A;  3CC7 A;  4J6X A;  3GIB A;  2XIC A;  1HK9 A;  2RM4 A;  4FU6 A;  5CK9 A;  4QW2 A;  3OYF A;  5FU7 B;  3MCA B;  2M0O A;  2E70 A;  4FM4 B;  5CVI A;  5FRO A;  5CQY A;  1K9M C;  3OYB A;  4FSX A;  2EJ9 A;  5D6Y A;  3JCM P;  4M77 F;  4F7U F;  1YJ9 A;  3J80 E;  3QSU A;  1N9S A;  3GPL A;  4NS5 A;  2KQW A;  2QTX A;  2JN0 A;  4HT8 A;  3QDR B;  2DIQ A;  2PQW A;  4XU3 A;  1B34 A;  2JOY A;  1OI1 A;  3QJ6 A;  1M1K U;  4M78 G;  3GF5 A;  4M7A G;  5FU7 C;  1NJI C;  1QVP A;  1M1G A;  2CS7 A;  1K9M U;  5D6W A;  4JS5 A;  1XTD A;  1Y96 A;  2DZ9 A;  2E1H A;  2JTF A;  2MWP A;  2RO0 A;  2X4X A;  3C4S A;  3SWN A;  3V8K A;  3ZEH A;  4C5E A;  5A2Q E;  3M53 A;  3CC4 T;  2E10 A;  5I21 A;  4TVR A;  5LJ3 j;  4M7D E;  5GAN j;  3L42 A;  3CBM A;  3L2W A;  3QJY A;  2LDM A;  2X4Y A;  1RL2 A;  3L2Q A;  2EAY A;  2XKO C;  3VUB A;  3OS1 A;  3RES A;  1VQP T;  1X6O A;  3SDZ A;  4KT0 E;  2H3J A;  1YI2 T;  3LH0 A;  4C92 C;  1XQH A;  1YHQ T;  3CD6 A;  5LJ5 g;  1N6A A;  1OZ3 A;  1K73 U;  3HSB A;  1G3T A;  3HHT B;  4XAX B;  4Y91 A;  1KC8 U;  2E41 A;  3DB3 A;  4E7H A;  4X34 A;  5IT9 E;  4P5N A;  4Q5W A;  3L2U A;  1FWZ A;  2KDS A;  2F5T X;  2WSC E;  3TEE A;  4M75 B;  5DM7 R;  5GAO m;  2HD0 A;  3UWN A;  3OYL A;  3CEY A;  3LYI A;  4X9C A;  2VGN A;  1Y7X A;  4L59 A;  4ZTJ A;  3G4S A;  1IZ6 A;  1UGQ B;  1WQW A;  3FEO A;  3N5B B;  3OA6 A;  3NTH A;  5LL6 S;  2VUB A;  3SD4 A;  5LJ3 e;  4BY6 B;  3GP8 A;  1VIE A;  3OBY A;  4JRI A;  4L5G A;  5CKE A;  3VUZ A;  4C92 B;  2P4T A;  3OS0 A;  4XU0 A;  2LTO A;  5LJ5 h;  4M78 E;  4M7A E;  3M9Q A;  4M75 F;  2QXF A;  3URG A;  3I56 A;  3CCJ A;  1XOV A;  2VGM A;  3CD6 T;  4M7D B;  3JCM f;  1VQN A;  4MZM A;  1W4S A;  2PU9 B;  1YHQ A;  3MEW A;  1PSF A;  4PJO C;  4PLL A;  3L1A A;  5GAM j;  2DTH A;  4PKC C;  2MMP A;  3CME T;  1VQ5 T;  5GAO l;  4IKF A;  5CR2 A;  4BDZ A;  4M77 D;  1ZHI A;  2QI2 A;  4ELZ C;  3CCU T;  3FIF A;  5GAO n;  3JB9 D;  1G3S A;  3M4Y A;  2RHU A;  3VV0 A;  3MET A;  1KD1 C;  3HRT A;  4XTZ A;  4M78 B;  4M7A B;  2RI2 A;  2Y4Y A;  5GAM e;  3CMA T;  3NTI A;  2GFA A;  3OBW A;  3SFM A;  4BY6 C;  4C8Q E;  2HQX A;  5GAN 7;  4M7D C;  4B9W A;  2LQ8 A;  4II1 A;  3V8L A;  2XD0 A;  1VQO A;  2RD1 A;  1N8R C;  3BY7 A;  1Q82 U;  3OW2 A;  4VUB A;  1EIF A;  2RK2 A;  5GAN 2;  2QQB A;  3ME9 A;  5AYF A;  2EJF A;  2R5M A;  3ER0 A;  3RKX A;  2LX9 A;  2WSE E;  3QG1 A;  2MAM A;  3RMQ A;  2QA4 T;  2QA4 A;  5LJ3 d;  1VQ8 T;  2M9U A;  2JNG A;  4J83 A;  4LDW A;  5A0D A;  1QVG S;  3SWN C;  2LT4 A;  3KUF A;  1VQ4 T;  1PSE A;  2PVD B;  2XID A;  3PFS A;  2O01 E;  2WSF E;  3PGG A;  3OQ5 A;  4X9D A;  4JDS A;  4RG8 A;  2LRQ A;  2VC8 A;  1N27 A;  1N9R A;  2R57 A;  3FLG A;  1VQ8 A;  3C94 A;  2HNI A;  3NTK A;  2XDP A;  3RUX A;  2DIG A;  2EWN A;  5CKH A;  2V8J A;  4YTL A;  4E7J A;  5A0L A;  2P0P A;  4N0A A;  4JRP A;  2RHZ A;  4FT4 A;  4EMG A;  3JCM h;  5GAN 8;  2CGH A;  4E7K A;  2RHX A;  1BI0 A;  2DPP B;  5J3B A;  4C8Q B;  3OYE A;  3CCM A;  5CAI A;  5GAN h;  4BD3 A;  2JUF A;  1S72 T;  4C0F A;  3JB9 H;  3I56 T;  4M78 A;  4M7A A;  4Z02 A;  3CCL T;  1G3Y A;  2RJF A;  2RJE A;  2KVQ G;  2BKD N;  1U1T A;  1ZQ1 A;  4UC4 A;  5IAY A;  5EG2 A;  3PT9 A;  4PJO F;  3OYH A;  4OF1 A;  4DQ2 A;  3CCR T;  1U8R A;  2LQK A;  2ZPH B;  2L5Q A;  2ZPI B;  4C8Q C;  3A5Z B;  3JCM W;  3HL8 A;  1YJN T;  3HRS A;  1QVF S;  2LCC A;  1WJR A;  2CZ0 B;  1Y96 B;  4ZGD B;  1M4Z A;  4BE1 A;  5GAN 4;  3WXM B;  1M1K C;  3VJP A;  3TU4 K;  1NJI U;  2A7Y A;  3S3M A;  2EIF A;  2CZ7 B;  4GLK A;  1UGP B;  4M7D F;  1S72 A;  2K2V A;  3BDU A;  4HCC A;  4M7D G;  2DKG A;  4XTU A;  4BUG A;  3MEA A;  4DOV A;  2EQM A;  5J39 A;  2EQJ A;  5CO7 A;  1UB4 A;  3JCM X;  3F70 A;  1K8A C;  1JB0 E;  3LX7 A;  4J7I A;  5CQX A;  2XG8 D;  2NLU A;  3LLR A;  1JJ2 S;  4KUD K;  2EJG A;  3I55 T;  2X4W A;  2XHC A;  1FXX A;  4CRI A;  2F5K A;  1NZ9 A;  1BYM A;  4FIB A;  3OW2 S;  4E7L A;  3H6Z A;  3CC4 A;  4QVD A;  4PJO G;  3DKM A;  5GMK j;  4WF2 A;  1WNL A;  2GFU A;  2KK4 A;  1BKB A;  2CZ1 B;  2RJC A;  3E19 A;  3OMG A;  2QEX A;  3FB9 A;  3CCV T;  2RH2 A;  4LD9 K;  2I2L A;  1BIA A;  3MHX A;  1OZ2 A;  1JBM A;  1HXD A;  3P8D A;  3TRE A;  2E6N A;  2LC4 A;  3TCJ A;  5GAN 3;  4C0D C;  2D0Q B;  5GMK m;  3HP9 A;  4BI4 A;  4ATO A;  3V7R A;  1M90 U;  4RMO A;  3EFR A;  2R5A A;  1KG1 A;  1U1S A;  4M77 C;  5I2S A;  4HT9 A;  5GMK h;  1X01 A;  4XU2 A;  3HFO A;  4HCZ A;  4M75 E;  3RIR A;  3S6W A;  2LNV A;  1WPY A;  5GAM d;  1YJ9 T;  2MWO A;  2OAU A;  4BE2 A;  2DXU A;  3A8M B;  3JRZ A;  5DY9 A;  3L2V A;  4FT2 A;  4IUP A;  3MP6 A;  1VQ7 A;  1KQ2 A;  4J8O A;  3Q1J A;  5CIU A;  3X28 B;  3MP1 A;  2JVV A;  3QYG B;  1YIJ T;  5KCO A;  3X20 B;  3OYM A;  1KHI A;  1X75 C;  2HQE A;  4C92 G;  4OVA A;  3QO3 A;  5GAN e;  4RCB A;  4IUR A;  1Q7Y C;  3QUI A;  2EQU A;  1YCY A;  4DA4 A;  4A54 A;  3J81 E;  5KE3 A;  1V29 B;  3G6E T;  3JCM b;  5LJ3 h;  4GY5 A;  4A53 A;  1FX7 A;  1I8F A;  4C8Q F;  1G3W A;  2DXB A;  4C8Q G;  1WQ7 A;  5LJ5 e;  3OYG A;  2R58 A;  3CCJ T;  2K5L A;  5HK0 A;  2FYK A;  3CPW S;  2O4X B;  4XK8 E;  5CKF A;  2YLC A;  3CCU A;  5A0G A;  1VQ6 T;  2E65 A;  3E9F A;  3CPW A;  5GAN f;  2F69 A;  4PJO B;  2DAQ A;  4XTV A;  1O75 A;  5D6X A;  3JB9 I;  4MDX A;  4LD6 A;  3A8G B;  4M75 A;  2PUO B;  2K4Y A;  3T9N A;  2RI3 A;  3PMT A;  4HA8 A;  4QVZ A;  3JCM J;  1IRE B;  2DXT A;  4OGC A;  3MEV A;  3G7Z A;  5DLO A;  4JJN K;  4M78 C;  4M7A C;  3FRN A;  2JTM A;  5GMK i;  1MGQ A;  4RCC A;  2CKK A;  2X35 A;  2B8A A;  2XI9 A;  4XTX A;  2DZC A;  1NPP A;  3BFM A;  1UGR B;  3QZ9 B;  1UGS B;  4ME7 A;  2GF7 A;  3CCV A;  3JB9 J;  4M75 C;  2YLB A;  4HKE A;  2GQV A;  4ZGJ B;  3P8B B;  1KQS A;  5FLX E;  1I81 A;  4O5V A;  3OYI A;  4OB2 B;  5CKB A;  5I2M A;  3G71 T;  4PNO A;  3CCQ T;  2RB6 A;  1QP2 A;  1VQM A;  3E1S A;  3CCE A;  3A8L B;  1BI2 A;  1TH7 A;  2AHJ B;  2EFI A;  3M55 A;  5GAM g;  3CCQ A;  1KD1 U;  4XU1 A;  3J7A F;  3RKY A;  3FC3 A;  3WVE B;  2QQ9 A;  5L8R E;  3M57 A;  3V7C A;  3LWI A;  2DXC A;  1VUB A;  2OTL A;  2EKO A;  5LJ5 d;  3EFS A;  1NE8 A;  5GMK e;  1NPR A;  1Q82 C;  3X24 B;  2EYQ A;  1W2B A;  1KHC A;  4A4H A;  1GXI E;  1P92 A;  5GAM f;  3M59 A;  1JJ2 A;  5HKC A;  3ASK A;  3AHU A;  4OMF B;  3CC2 A;  2RJD A;  4V2S A;  4QQD A;  2X4J A;  5KE2 A;  4BB7 A;  3G4S T;  4N4I A;  2V8I A;  1K73 C;  2L89 A;  4KUI A;  3CCR A;  4MMK A;  1H3Z A;  4C5G A;  4EMK A;  2CYZ B;  3QZ5 B;  3P8H A;  2FL7 A;  3BDL A;  4N4G A;  3OYY A;  3SB2 A;  2QQS A;  5GAO p;  1VQ6 A;  2E64 A;  3JCM d;  3HRU A;  2P0Q A;  3QBY A;  4IUU A;  4LDY A;  1KC8 C;  2HAX A;  3H8Z A;  2BUD A;  4PL6 A;  5LJ5 j;  1Q7Y U;  4BE0 A;  1SSF A;  2FVU A;  3PIP A;  4JS4 A;  1YIT T;  3SWN B;  2MF2 A;  1LOJ A;  2P0K A;  2IG0 A;  3EAE A;  2OTL T;  3RKW A;  1AHJ B;  3VYH B;  1G5V A;  3M5A A;  1Q86 U;  2ZPF B;  2JZ2 A;  3QKJ A;  3V7S A;  5CCA A;  4BI3 A;  4EPC A;  4ZGE B;  2E12 A;  2KMT A;  3CCL A;  1B34 B;  1Q81 C;  1BI3 A;  3RMS A;  4E7I A;  3GLX A;  1H64 1;  4A4F A;  1D3B A;  1D3B B;  4JLI A;  4PJO D;  5C0M A;  4N4H A;  5GAN 5;  4J5Y A;  3JSC A;  2K3Y A;  2E6Z A;  3A8O B;  4MZP A;  4MZT A;  1M1F A;  2A3L A;  2M16 A;  1VQ4 A;  3C95 A;  2YHT A;  2DVE A;  3OYN A;  1YJW A;  3NFC A;  5FU6 B;  2IVW A;  3DLM A;  2BIV A;  2OTJ A;  2VXF A;  1M9S A;  4N0A C;  1VQK A;  3OS5 A;  4C92 D;  4C92 E;  4R55 A;  1VQ9 T;  4A4K A;  3OYC A;  4ELY C;  1XNI A;  2EQK A;  3PIO A;  4J7F A;  3UDC A;  4PJO E;  4M7D D;  2LCL A;  3M56 A;  4QVC A;  3OYJ A;  1VQ7 T;  1Q81 U;  2GCX A;  2OTJ T;  3QII A;  1VQO T;  3HFN A;  2DD5 A;  3CXC S;  4L6V 5;  5GAN 6;  2CZ6 B;  3CBO A;  3PNW C;  1WJS A;  3OS2 A;  1DJ7 B;  2ZCF B;  3HKS A;  4R56 A;  3QHS A;  2QEX T;  2D9T A;  2V8K A;  3OY9 A;  2KSS A;  4C5H A;  3VKI A;  4D6W A;  4M77 B;  4F7U B;  3LWH A;  1K8A U;  2RHI A;  4QQ6 A;  4JRQ A;  2Y90 A;  1KQ1 A;  5FU6 C;  4OB0 B;  5M9O A;  3CCS A;  3I55 A;  1OYX A;  2DTO A;  2HBP A;  1LNX A;  2XDD A;  4M75 G;  4RG2 A;  4XTW A;  3KXT A;  1RI0 A;  2D6F A;  1M5Q 1;  1ZBX A;  4A4G A;  2DD4 A;  3CME A;  1VQ5 A;  3DB4 A;  3JCM g;  2KAF A;  4B9X A;  3A8H B;  4BAC A;  4ZN1 A;  1VQN T;  1M8V A;  3CXC A;  3QPH A;  2ZGW A;  3QYH B;  4O6J A;  1MHN A;  3GOX A;  4ZTF A;  3MP8 A;  2DEQ A;  1VIF A;  4M77 E;  4F7U E;  3GNG A;  2DTI A;  1VQM T;  4XQ3 A;  3L2R A;  3JB9 F;  4LDV A;  2LT1 A;  4C8Q A;  5LJ3 f;  2DJZ A;  4MDW A;  2E5Q A;  1VQL T;  3QXE B;  3OMC A;  5DLQ E;  1R8O B;  4EMK C;  5LJ3 g;  3S3N A;  5LJ5 f;  1QVF A;  2ZPB B;  2QQR A;  3OSS C;  2K5I A;  5GAO r;  2PVO B;  3GNF B;  3WVD B;  5HK3 A;  4NL3 A;  3O8V A;  2FHD A;  1BI1 A;  2VV5 A;  3PMI A;  4KBM B;  4IUV A;  3CC2 T;  2XDB A;  3E9G A;  4JLG A;  4C0D B;  2WAC A;  5FRN A;  2LVM A;  4OGE A;  5IN1 A;  4OB3 B;  1YJN A;  3MO8 A;  5GMK l;  1YBY A;  3JCM c;  3C12 A;  3CBP A;  2M1H A;  3M4G A;  4EDU A;  3OSV A;  4EMH A;  4NL2 A;  4EMK B;  3UPU A;  4C0Z A;  4CI0 C;  2ZPG B;  1VQP A;  4C8Q D;  1YI2 A;  2PUK B;  3ZBD A;  2MI6 A;  2Y4X A;  2L8D A;  5GAM h;  2RA2 A;  1VQL A;  4LDU A;  2RHY A;  4JUV A;  3OYA A;  4DOW A;  1QW1 A;  3LGL A;  1I5L A;  4M77 A;  4F7U A;  2FB7 A;  4RKU E;  4QQG A;  5KH6 A;  4NOY A;  3CCE T;  1Q86 C;  5FRM A;  2QDY B;  3JCM V;  4C92 A;  2KY9 A;  3INZ A;  3G71 A;  3CCM T;  3DLL A;  5GAO q;  3R6O A;  4LDX A;  1M90 C;  3UT1 A;  4PJO A;  4HCB A;  5KCH A;  3KBG A;  2QQA A;  3PTA A;  4KUL A;  3FJP A;  4JRK A;  4M77 G;  3ZFJ A;  4F7U G;  2DK3 A;  1QVG A;  2DO3 A;  4J6W A;  4ZN3 A;  5GAN d;  3JCM Q;  3CCS T;  1LJO A;  2RI5 A;  4C0G A;  1I4K 1;  2ZPE B;  3OB9 A;  4PLI A;  2L3R A;  3M58 A;  4M78 F;  2G3R A;  2K3X A;  4M75 D;  3V8J A;  1Y07 A;  4XTY A;  1W2B S;  4M7A F;  4M7D A;  4BI8 B;  3FDR A;  1QP3 A;  3LGF A;  2VXE A;  5GAN g;  5HY6 A;  3RER A;  4OP0 A;  5C6S A;  4C92 F;  2K57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...