4TVRA

Tandem tudor and phd domains of uhrf2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
273
structure length
222
Chain Sequence
TSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRADEDVIYHIQYDEYPESGTLEMNVKDLRPRARTILKWNELNVGDVVMVNYNVESPGQRGFWFDAEITTLKTISRTKKELRVKIFLGTLNDCKIISVDEIFKIERPGAHPLSFADGKFLRRNDPCDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVAYHIYCLNPPLDKVWYCPSCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Tandem Tudor and PHD domains of UHRF2
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase UHRF2
total genus 38
structure length 222
sequence length 273
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
A PF12148 TTD Tandem tudor domain within UHRF1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4tvrA02
5DLQE 3G4SA 3CCRT 1EIFA 2QEXA 1NJIU 1VQ6T 2JOYA 1VQNT 3A5ZB 1YIJT 1NJIC 1VQKA 3KBGA 1VQLA 2EIFA 3J80E 1K73U 1K9MC 3CCMA 1VQ5A 5A2QE 1YJ9A 3G6ET 1VQ8A 1XTDA 1YJ9T 1KD1C 2JNGA 3G4ST 3CCVT 1YJWA 1VQ7A 1NPPA 2JVVA 4QQDA 3CCRA 3LH0A 2G3RA 3CMAT 1NPRA 3CPWS 1M1KU 3CPWA 1BKBA 1VQOT 1QVFS 1YI2T 5DM7R 1M90C 1KHIA 4CRIA 3I56T 1N8RC 3CCET 3LGLA 5J26A 1QVFA 5LL6S 5FLXE 5J3BA 4TVRA 3G71A 2MI6A 1Q81U 1JJ2S 3CC2T 1M1GA 1YJWT 3CC2A 3DB4A 2E70A 1VQ4T 1VQ6A 1SSFA 1KD1U 1W2BS 1YI2A 3CCUA 2E6ZA 2LQ8A 1VQKT 5HY6A 1S72A 1Q7YC 1VQLT 3CCQT 2QA4A 3I56A 3CCMT 1QVGS 2KVQG 2IG0A 2QA4T 1K73C 1K9MU 1VQMA 1Q81C 1VQ9A 4ZN1A 1K8AU 3CCEA 2CKKA 3OW2S 3I55A 1X6OA 3G6EA 3OW2A 1VQPT 1VQ8T 1VQPA 1QVGA 1NZ9A 4ZN3A 3PIOA 3CCVA 1Q86C 3CCJA 1YITT 5IT9E 1KC8U 1VQ4A 3CPFA 2QEXT 3CCJT 3JAME 1YITA 1UEBA 3CC4T 1VQOA 1VQNA 3ER0A 2MWPA 4RG2A 2DO3A 5IAYA 2OTJT 1S72T 2KDSA 1VQMT 1VQ9T 1Q82U 1YHQT 3CCLT 3HKSA 1Q86U 1VQ5T 3CCLA 3CC7A 3DB3A 1RL2A 2JUFA 3LGFA 1M1KC 3I55T 4X34A 1JJ2A 3G71T 2L3RA 2OTLA 3J81E 1M90U 3CMET 2LCLA 2OTLT 1Q82C 3CC4A 3CD6A 3PIPA 1VQ7T 2OTJA 1Q7YU 1YBYA 3CMAA 3CCUT 3OYYA 1K8AC 3CCQA 1KC8C 1XNIA 2LVMA 2MWOA 1YIJA 1YHQA 3P8BB 1KQSA 1YJNA 2XHCA 3J7AF 1YJNT 3CC7T 4YTLA 3DLLA 1IZ6A 3CCST 1W2BA 3TREA 3CXCS 3CCSA 1N8RU 3CD6T 3CXCA 1KQSS 3CMEA
chains in the Genus database with same CATH superfamily
5GAMh 3C12A 4XU1A 3DLMA 2X4WA 2K2MA 2COWA 4ELZC 4EMKA 1VQ5Q 2GQIA 3T9NA 2XD0A 3MP1A 4M77F 5EG2A 1KD1C 5ECAA 2E3IA 2P0QA 2QGFB 3LYIA 4OB0B 2LRQA 4XTUA 1VQ7A 4BI8B 4QQDA 3SB2A 1OQKA 5CKHA 1T0JA 4E7LA 1M1KU 4M7AB 2F2XA 3VS1A 3LLRA 1KHIA 4HVWA 4ZTJA 2C06A 1Q81R 2NUPA 4KRTA 1SG5A 1C0MA 4FT4A 4M77B 3SEMA 4LN2A 1W2BS 1PSEA 3ZFJA 1NLPC 3JCMJ 1QCNA 2CH4W 8AT1B 1KFZA 5I2MA 2IG0A 2PUKB 1ZQ1A 2M02A 3ASKA 2RHUA 1MGQA 4IUVA 1MMGA 4M7DD 4JPBW 1D3BA 1WI7A 1CKAA 3VU3C 1YIJQ 1Q7YR 3JCMX 3V8JA 2LT1A 2JTMA 3FJPA 3CCLT 2J6KA 2E5KA 2QQAA 2F69A 1IREB 2JUFA 2LCSA 4Q5WA 1TUCA 3V7RA 1IO6A 3OYIA 4JLGA 4M7AG 3OMCA 2PQWA 2LVMA 2OX7A 2DRKA 1B7TA 1WGSA 1M1KR 3QUIA 4BI3A 3CC7T 2DBMA 3E19A 2K57A 4C5IA 1RADB 1S72Q 5C6SA 4M7AE 4KH0B 3M56A 1H641 2YUPA 1R77A 4X1VA 3A5ZB 2P0KA 4PNOA 2DRMA 2G6FX 5KYWB 2E5QA 2BZYA 2PVDB 1OPKA 4PL6A 2EVRA 3G6ET 4QVCA 1I5OB 2D6FA 3CD6Q 3REAB 3LH0A 3CMAT 2QAZA 2JZ2A 3QJ6A 2XI9A 1VQNQ 5IHKA 1M90C 1FYNA 5GANj 1ABOA 2LJ3A 1SKUB 4J5YA 1X27A 1BI3A 3G71A 4JRIA 3TCJA 3L2ZA 1HSQA 2BKDN 2M9UA 3TSWA 3BFMA 5I11A 5IXFA 1AD5A 3JCMP 2FL7A 5FRMA 2QQBA 4M7DF 4C92A 2IVWA 2JJ9A 2QI2A 4M77C 4PJOA 4FYYB 5CKEA 2RF0A 3MEWA 2VGMA 3G6EA 4KH1B 1OZ3A 2DM1A 5CCAA 1NZ9A 3E2UA 4C92B 3QXEB 3M4YA 2QEXT 3HFNA 1QKWA 4ESRA 2K6DA 2DX1A 5IAYA 1UDLA 2QK0A 2JM9A 3WXMB 1UGQB 4A54A 1G3SA 1BI2A 5GAN7 2RPNA 2O88A 1QWFA 1VQ8Q 4X9DA 5KYUA 1J3TA 2RMOA 2XDDA 2A3LA 3JCMQ 2DXTA 4QQ6A 2DYIA 4RTXA 2HQHA 5KH6A 4C92F 2MF2A 2K4YA 2LQWA 4M75A 2OJ2A 1NG2A 3P8BB 4E2FB 3G71Q 1VQMQ 3I35A 3GBQA 1OEBA 2V1QA 2EJFA 3QDRB 2AKLA 3CD6T 2YUNA 1D0XA 2JM8A 2QEXA 3X24B 1GFDA 3G1JA 2LDMA 4C8QB 4M77E 4Y91A 3EG3A 1VQ5A 3FB9A 3TVTA 4IUUA 4A4EA 1ARKA 1WHLA 4XU0A 4B9WA 2VYTA 1NPRA 1FMWA 2F5TX 8ATCB 4XQ3A 4LDYA 3RNJA 1MUZA 2OI3A 1FX7A 4JUVA 3RR6A 2J05A 1IXDA 4TVRA 5KYWA 2KBTA 5IN1A 2I0NA 1SSHA 4DBRA 5HK0A 1VQ4T 2YRCA 5CIUA 1W2BP 2RK2A 3MEUA 1EZZB 1VYUA 1K0SA 2KT1A 1ZSZA 2VASA 2JMCA 3A8OB 2QA4T 3ZL7C 1YJNQ 1E7OA 4DQ2A 1W6XA 1VQ8T 3EFOA 5D6XA 4ZN3A 5GANg 3FLGA 1ZUKA 3L42A 5DLOA 5D6YA 1QWEA 3NTKA 3MP6A 3KUFA 5LJ5g 2RQTA 1S72T 1VQMT 4PJNA 1AWOA 2EW3A 3E9FA 3JCMc 2FG0A 3DB3A 2NUTA 2DTIA 4UC4A 2DVEA 1D3BB 4GY5A 3EGUA 2L3RA 3CXCP 1ZSZC 3I5SA 3E1SA 1WJRA 3VRZA 1OI1A 1IHWA 4CC2A 4ME7A 3VS3A 1K9MR 2XHCA 3JCMg 1SRMA 2RQUA 3DLLA 2K3YA 2PU9B 4M7AC 1M4ZA 2LZ6B 2O31A 5I2SA 2QXFA 4MDWA 4OB2B 1WHGA 3JCMh 1VQLA 3CCMA 5A2QE 2DXCA 1H8KA 4HCCA 4PJMA 4PJOG 1NJIR 1VQ7Q 2HNIA 2D0NA 1PHTA 4O5VA 1HJDA 1VUBA 1RAHB 2SEMA 3KXTA 1Z9ZA 3G4ST 4LD9K 1PCXA 2FYKA 5KYNA 2D9TA 2Y4YA 2L3QA 1H92A 4BI4A 2DMOA 3CPWP 4MDXA 2L2PA 4F04B 4CRIA 1X2QA 2GF7A 3NGPA 4RTZA 2ZZDA 2KEAA 5J3BA 1OU9A 3CC2A 4O6JA 3OYJA 2A36A 2CUDA 1JJ2P 3CCQT 3CCMT 1AHJB 3H0FA 3UWNA 4KGZB 3MO8A 2RHIA 4ZTFA 2RK1A 1W70A 3LWHA 1PRLC 3L2RA 4WCIA 2RQRA 4ZNXA 2DEUA 3VRYA 1AWJA 5AYFA 4RTTA 3CCJT 1UEBA 1S1NA 4BDZA 3OYKA 4RG2A 1Y96B 1YI2Q 1YHQT 3UF4A 3CCRQ 4M75C 4HXJA 3EG2A 4E7KA 3LGFA 4OMMA 1WXUA 4C5EA 4C0DB 4HCZA 2O9SA 2F2WA 2JS0A 2GTJA 3ZBDA 2EJGA 3L2VA 3JCMd 1YBYA 3OYYA 1K8AC 1AWWA 3SHWA 4PK4A 4ZGDB 4C92E 2YWWA 3THKA 1ZUUA 2PUOB 1OULA 3G4SA 3D7SB 3HHTB 2JW4A 1WHJA 1NJIC 2XKOC 4OMFB 1D0ZA 4PJOB 2EFIA 1UGVA 2K5IA 4BY6B 2DZ9A 4FCYA 1AZEA 2A08A 4C92D 4BE2A 1PKSA 2JVVA 2CP0A 3OW2P 4QVDA 1WPYA 3U23A 1YJWQ 2RHZA 4ELYC 2H3EB 2MYSA 5KYYA 3JB9F 2PVOB 3RMQA 1BYMA 2MI6A 2JS2A 2NUTB 1JXMA 2RO0A 4MZMA 3DB4A 2E70A 2YT6A 4FM4B 3EGXB 1OU8A 5KCHA 3URGA 2DJZA 2HQXA 4KT0E 4PFPA 4M7AD 1I4K1 1X6OA 2RM4A 3OYHA 2XDPA 1VQOQ 2K3BA 5FW9A 3CCVA 1TUDA 5J39A 2FO0A 2LT4A 2OTJT 5KYXB 5CVIA 2HEQA 3A8GB 2PNIA 3BDLA 3EG9B 1ZUYA 2EGCA 3EG0A 1K0XA 2BZ8A 5GMKm 4M78D 3CC2Q 1RLPC 1SRLA 1VQ7T 2KAFA 1G5VA 1BCMA 1RUWA 4J83A 3A8LB 4F7UE 1BCOA 1GL5A 1YJNA 5KE2A 3V7CA 1QKXA 3PE0A 1K76A 4N4GA 1TG0A 3CCST 1QVPA 3VYGA 4J9FA 3M0PA 1T0HA 2EYZA 1X43A 1Y71A 3JCMe 1M27C 3GIBA 4M78E 3QSUA 4AG2C 5L8RE 1VQKA 1K9MC 3J80E 3EGDA 2XG8D 1WHKA 2AZVA 2FPFA 2V8KA 4LDXA 4FYVB 3HFOA 2ZPFB 1AWXA 1R8OB 1YJ9T 2HL3A 4FW1A 2R5MA 1SHGA 1Z9QA 2RQVA 4PFOA 1PD1A 1M9SA 5DM7R 1M8MA 4C92C 2CREA 2HBWA 4PLLA 1O75A 3BY7A 2RI2A 2DJQA 2O01E 3QWYA 5L23A 4A4HA 5GAMj 4J9BA 4J7IA 3L2UA 1VQKT 6AT1B 3L2WA 1BI1A 3OYFA 1U1TA 2RA2A 2CKKA 2EQKA 3PVQA 3OW2A 1SHFA 2JTEA 5HKCA 2OAUA 4XTXA 4EMHA 4F7UA 2GNCA 3OSSC 5IT9E 2BE7D 5GAN5 3AT1B 1YITA 2K3XA 2ROTA 1GBQA 1FXXA 3RIRA 1PWTA 2E4HA 2JT4A 4RG8A 2GFUA 2CP2A 1DJ7B 3VV0A 2KRMA 4M75D 3INZA 2OTLT 4OMLA 2RJEA 3FC3A 3ULRB 4M78G 3AHUA 1KQSP 1B3QA 1U3OA 5M9OA 4JS4A 4DA4A 1KQSA 4M78F 3RMSA 1YWOA 1I07A 3JCMW 4AT1B 2DXUA 2R57A 4L6V5 5GAOp 1XJWB 1VIEA 3S6WA 2OAWA 3V8KA 1N8RU 3PGGA 1W4SA 3PT9A 3CMEA 3JCMf 1EIFA 3M0UA 1WFWA 2ZPEB 2HSPA 1W1FA 1QVGP 9ATCB 2K79A 4DOWA 2EIFA 5GAN6 4VUBA 2X4XA 5CKFA 4JJCA 4KULA 2Z0WA 3V8LA 4M78B 1ZA1B 2DA9A 2EYQA 3EGXA 4GLMA 5IXBA 1ZSGA 3FIFA 4XU2A 4OMPA 2CH4A 4XK8E 4C8QE 3OS1A 1MMDA 4PJOF 2CP3A 3H0IA 3I56T 3CCET 5GAN8 4A63B 5KYYB 3TQ7P 3OYAA 2CP6A 2ESWA 3O5ZA 1GBRA 2ABLA 2WSCE 2RHXA 1UB4A 2PZ1A 1PC0A 3NPFA 1Q7YC 1YITQ 2QA4A 3GP8A 3QO3A 1N8RR 5CO7A 2NYSA 2MCNA 2LCCA 1RAFB 4MMKA 2CYZB 3I55A 1VQ4Q 2EQMA 1QCFA 4J6XA 2CZ7B 2CZ1B 1A0NB 3TEEA 3OYNA 1WQWA 2X35A 1QMCA 4JRQA 1Y0MA 2LJ1A 3OS2A 1QQJA 3A8MB 1BU1A 4RKUE 1VQ5T 2DIQA 4E47A 2VXEA 4NL3A 2OTLA 2LNHB 1O9SA 3PIPA 2CT4A 4D8DA 2OTJA 2KXDA 2C0IA 4GBQA 4JJNK 2LC4A 4M77G 3CCQA 1LOJA 2BUDA 2KI7A 1YFNA 1B34A 3BE3A 3UT1A 1I1JA 2R5AA 4F17A 4K11A 1JQQA 3EG9A 2HCKA 1ABQA 2DERA 2FPEA 1VQ6T 2EJ9A 3CQTA 2ECZA 3I55Q 1R0BG 4V2SA 3L1AA 4R56A 2F5KA 5CQXA 5GAOn 2B86A 4B9XA 4D8KA 2AZSA 3H41A 1G8XA 1YN8A 4N0AC 2LMJA 4JS5A 2G3RA 5KE3A 3CPWA 1BKBA 2KE9A 2P4TA 2KGTA 4J8OA 1QP3A 2QQ9A 1TXQA 2ZPBB 4RUGA 4J9CA 5CR2A 3X25B 5LL6S 1I5LA 5IHNA 4WF2A 1ZLMA 1LJOA 2LQKA 2RN8A 2JXBA 2EGAA 4OMQA 2IPOB 2O9VA 2X51A 4ANJA 2HMAA 1K9MU 1FMVA 1KSWA 3QZ5B 3CCVQ 2BZXA 5CQYA 3OW2S 2EQJA 1VQPT 2KXCA 3A1PA 3QYGB 4E6RA 2P4RA 4AMCA 1UE9A 2LJ0A 3IQLA 3S3NA 3CCLA 2YLBA 3S3MA 4FIBA 1RL2A 3RDVA 3OB9A 2XICA 4C92G 3EH1A 1U8RA 1EX4A 3VS6A 4ZGEB 1VQ6Q 4Z8AA 2O4XA 1QCOA 1X6BA 2CZ6B 1UG1A 1OYXA 1BBZA 3CCUT 3SWNB 3SDZA 3VS2A 1WZOA 1XNIA 2FZGB 2K9GA 2QGGA 4FYWB 2DL7A 3SWNA 2KT8A 4M7AA 4LDWA 2FHDA 3L2QA 4C8QG 2ATCB 5GJVB 4C8QF 1UHCA 2E65A 2YUQA 5D7UA 4IUQA 2AKKA 5FU7C 1KD1R 3CCEQ 1YNZA 1WIEA 1TS9A 4C5GA 1IGUA 1RAGB 2A0FB 2HDAA 2IIMA 2O4XB 1MHNA 2J06A 4OP0A 2DD4A 1F1BB 1PKTA 2CDTA 2QA4Q 1V76A 1KIKA 1EFNA 2L3PA 2MPXC 4L5GA 3EGDB 1WJSA 3CCRA 2DL4A 2FB7A 4XTYA 1KQ2A 2LX7A 1K9AA 3OYDA 3VS4A 5CK9A 1GFCA 1M90R 4DBQA 5GAN3 2CSQA 1M1GA 4FL6A 4E7JA 3TSZA 3QZ9B 1YJWT 5FRNA 1AT1B 2ZPIB 1OX9A 1YI2A 3OYMA 2RI3A 3JB9J 2VKNA 4CI0C 2EBPA 1S72A 1WNLA 1QVGS 3I56A 1M3AA 3EHRA 2KVQG 3H8ZA 5FU6B 2LP5A 3CCEA 1JB0E 4N4HA 1QVGA 2QG9B 1K73R 2W10A 2LTOA 2NLUA 1E6HA 4IURA 5KCOA 2Y90A 3MEVA 4PLIA 1G3WA 2X3XD 2AK5A 1LPLA 2F2VA 1E6GA 1YWPA 2MK5A 2XU8A 3OS0A 3A8HB 1WX6A 1D1BA 4QKUA 2DIGA 2H8HA 1M1KC 3I55T 5EC7A 5GMKe 1NEBA 2FRYA 4DEXA 5GAOm 3QWXX 1M90U 3CMET 2ROLA 3EFSA 2QDYB 1M2OA 2E3HA 1JO8A 3CMAA 1KG1A 1RAAB 1GCPA 2WSFE 2M0YA 3CBOA 1RACB 4DOVA 4JRKA 1YHQA 5IH2A 3J7AF 1K4US 3GPLA 4Y92A 1KQ1A 1I8FA 3M4GA 2V8IA 4J9GA 3CCSA 4A4GA 1X2KA 1KQSS 2GQVA 3VS7A 1KK7A 1N9RA 1CKBA 4JZ4A 5DLQE 4FSXA 2QTVA 2CP7A 1NBEB 2WSEE 2FZCB 2M51A 3NHNA 2PTKA 1UGPB 2D8HA 1K73U 1PM3A 2QDLA 1OOTA 2RQWA 4HCBA 4EMKB 1UHFA 4M77A 4QVZA 3HSBA 3CCVT 3X20B 4FU6A 7AT1B 1QVFS 2CT3A 4OVAA 1YJ9Q 4HVVA 4C0DC 3CCJQ 2XK0A 2NUPB 2E6NA 2NWMA 5I22A 3C0CA 1AEYA 2EQUA 5HK3A 5GMKl 3WVDB 2KK4A 4XAXB 2ZPGB 3S3OA 5I21A 2DFUA 3C94A 3DKMA 3HRSA 5LJ3h 1WDXA 4LUDA 5HCKA 2E12A 1UGSB 1TU0B 4P5NA 3EFOB 1AZGB 2YXYA 1VQKQ 1KJWA 5GAN2 3CPFA 2DLPA 4KUIA 3CC4T 1KHCA 3VS5A 2P0PA 1Q86U 1K8AR 2M16A 2MIOA 3HTRA 4BD3A 2K5FA 3G71T 3CEYA 1M1FA 2LCLA 4ZGJB 2L8DA 4MZPA 4HT9A 1AVZC 1QP2A 1Y57A 2KMTA 3QDFA 5LJ5f 3M0QA 4D6WA 4Z02A 1MV0B 3UA7A 3R6OA 4IUTA 3CXCA 3MCAB 3EG1A 1G2BA 3BDUA 4NS5A 2DETA 1YIJT 4OGEA 4GLKA 3CCMQ 3NTHA 5FWCA 3M57A 2DBKA 2CS7A 3UATA 3JB9I 3V7SA 3X28B 1VQ8A 5LJ5j 3SFMA 5LJ3j 1VYTA 1PG5B 2RNAA 3RKWA 1MMNA 1NPPA 2DTOA 4QW2A 4KBMB 1VQOT 4CC3A 2L3SA 1YHQQ 5GANe 3SD4A 4MZTA 3LGLA 1QVFA 4EMGA 1UGRB 2L89A 4E7HA 2KSSA 3CCSQ 4M7DB 1U5SA 5A0LA 4RCCA 4F16A 1SF9A 2BIVA 1VQ6A 2EKOA 3CBMA 3WVEB 3HRUA 3VUZA 2LQ8A 1JU5C 2FRWA 3VS0A 2X4JA 4HT8A 2LX9A 1QVFP 1Q81C 4J9EA 1BI0A 3G6EQ 2RD1A 4NL2A 4PFZA 3UA6A 1TOVA 1KC8U 2X9HA 5GAOl 3FDRA 1WA7A 4EIKA 4E7ZA 1VQNA 3UPUA 2KDSA 5AT1B 3OYGA 3MEAA 3HKSA 4RTWA 4DBHA 2M0OA 1ZSZB 2DAQA 2X3WD 2A7YA 4X34A 1JJ2A 2KRSA 3MJXA 3GNGA 3HL8A 2EKHA 1MNDA 3C95A 2O2OA 3CD6A 2FPDA 1Q7YU 2KROA 5GAMg 1KC8C 4WTOB 4FT2A 2GBQA 4LNPA 3GNFB 1VQ9Q 3FJ5A 1NYFA 2VUBA 1RAEB 2CGHA 1HK9A 5GANd 5A0GA 2AIRB 2PVGB 4XTVA 3JB9H 3M53A 3QYHB 4OF1A 3RUXA 1KC8R 2RJFA 2KR3A 2M1HA 3CCUQ 1H3HA 4E7SA 1C6VX 1PD0A 2DE0X 3QPHA 2YUOA 3GLXA 2DF6A 4F7UG 1G3TA 4E7IA 2DILA 1YJWA 4BB7A 2HKQB 2RH2A 4JLIA 4M7DA 1RAIB 1ACMB 4IUPA 3JCMV 2EAYA 2KRNA 3H0HA 4C5HA 4NOYA 4C8QD 4IIOA 3CCQQ 2K2VA 4C0ZA 4ATOA 3N5BB 2GGRA 1JJ2S 1I81A 1X75C 3OYCA 1OPLA 4PJLA 5FROA 5CAIA 2D8JA 1G83A 4XU3A 2E6ZA 4BACA 1VQLT 1K73C 5FWBA 1TSFA 2QTXA 1VQMA 1VIFA 4PJJA 3P8DA 4LUEA 3A98A 1PSFA 3M5AA 3RKXA 3Q1JA 1Q86C 2CZ0B 1WYXA 2P84A 3ER0A 2MWPA 1T3SA 1VQ9T 3OBYA 1M5Q1 4M78C 2J6FA 2C0OA 1U06A 4R55A 2EYWA 3EHQA 1X01A 2CUBA 3H9NA 1Q82C 3CC4A 3CMAQ 2A37A 1M3CA 2KQWA 3QIIA 4HKEA 4J7FA 1NE8A 5GAMd 1QLYA 2KYBA 4C8QC 1NEGA 4OB1B 1Y7XA 2DVJA 2X4YA 4EMKC 5GAN4 1YJNT 1D1AA 5GANh 3P8HA 2QEXQ 1N9SA 2XDBA 1D0YA 4BUGA 2ZPHB 4JJDA 3CMEQ 5LJ5h 2LNVA 2JOYA 3OY9A 3SWNC 1RABB 1LVKA 1TTHB 2MOXA 2JMAA 4ORZA 3QBYA 4M78A 1K1ZA 1U1SA 1B34B 3X26B 1WXTA 4C8QA 1UFFA 1VA7A 1RI0A 3PTAA 2DL8A 2YRVA 1FMKA 2RB6A 3RKYA 3M55A 1N8RC 1SPKA 2HL5C 2KNBB 1JEGA 3FRNA 2DNUA 2ENMA 2OTLQ 2D1XA 3EAEA 1WHHA 3REBB 4A4FA 1TUGB 1T3LA 2DEQA 1VQ9A 1M2VB 2YRDA 2OTJQ 1M30A 5LJ5e 4JRPA 2V8JA 1OX8A 1OV3A 4R0KA 3OBWA 3CCJA 4Y28E 1R0CB 1VQ4A 2K5LA 2ZGWA 2MAMA 2E10A 3JB9G 1LNXA 2B8AA 1MMAA 2VB6A 3PVLA 4JJBA 3EFRA 3OSVA 4HA8A 3VYHB 1N5ZA 4AG1C 4RMOA 2QQRA 3PNWC 3C4SA 2KY9A 2BTTA 5CKDA 2BE9B 4FSSA 1ZBJA 4EPCA 4II1A 2DYBA 2K7AA 2ED1A 2YLCA 2NUZA 5GAOr 1W2BA 3CXCS 4BE0A 5GAMe 2R58A 3F70A 1IHVA 2DL3A 4XTZA 2HKNA 5A0DA 4JDSA 2AT1B 1X69A 3KBGA 4F14A 4MMLA 1HD3A 1ZHIA 4AFQC 1NLOC 1XTDA 3H6ZA 1M2VA 4OMOA 2RI5A 5FU6C 4AFUC 1D1CA 3FEOA 3HRTA 2VVKA 1C1AA 1GRIA 4RTVA 3OYBA 2EYYA 3HP9A 4B6MA 3QHSA 2FEIA 3LH5A 3O8VA 2KYMA 2FVUA 1BK2A 1UJ0A 2QQSA 4N4IA 1BIAA 2L5QA 3META 3M59A 5HY6A 3OMGA 5LJ5d 3OA6A 3GF5A 4M7AF 1WQ7A 3ZEHA 2CP5A 3M0TA 4OMNA 4RTUA 1VQOA 1N6AA 5KYUB 1N27A 4BE1A 1G3YA 3OYLA 1GXIE 3PFSA 4HVUA 3OS5A 2Y4XA 1JXOA 1V29B 3G4SQ 4XTWA 1GCQA 2H3JA 5C0MA 4C0GA 2YSQA 4M75F 1D09B 3KFVA 5LJ3f 5IHIA 1QW1A 1SEMA 1RI9A 1PRMC 1B07A 1YP5A 4RCBA 1H3ZA 2GCXA 2J7IA 4YTLA 2C0TA 5GAMf 1NYGA 4M75E 4M7DG 3RBBB 1WHMA 4JZ3A 3CCRT 1NJIU 3MKDA 4IIMA 2F1LA 1VQNT 3E9GA 4QQGA 1V1CA 1M3BA 3JRZA 2GFAA 2ZCFB 1XQHA 3M54A 4LE9A 1OZ2A 2CSIA 1YJ9A 2EQIA 1IGQA 1WXBA 2J6OA 2COYA 2DK3A 4LDVA 4M7DE 2DKGA 3MHXA 4J6WA 3MP8A 5D6WA 2DL5A 5DY9A 1YI2T 2E41A 1WLPB 2V26A 2VV5A 1ZA2B 2VC8A 4RTYA 1Y96A 3LX7A 2L0AA 2RJCA 2D0QB 2W0ZA 1ZX6A 2GTOA 1VYVA 2E1HA 1WJQA 4AFSC 3BW1A 2EWNA 3NMZC 4OB3B 2RHYA 2VXFA 1YCSB 3OQ5A 4KGXB 3R6NA 1RLQC 3I9QA 2DXBA 2HAXA 3I5RA 2E64A 1Q86R 1K8AU 5GMKj 3JV3A 1VQPA 4M77D 2QASA 1HXDA 4CC7A 4F7UF 1UECA 1YITT 2COZA 3VUBA 2VWFA 2EPDA 2DO3A 3VKIA 5LJ3g 1VOMA 1VQLQ 2FZKB 5KYXA 1I0CA 3CC7A 1Q82R 4J9IA 4A53A 1Y07A 3OYEA 4N0AA 3PMTA 4IKFA 4J6YA 1TWBA 1GCQC 2V1RA 4J9HA 4C0FA 4F7UB 4FYXB 5GANf 1CSKA 3RERA 4LXCA 2JTFA 5GJWB 1LCKA 1X6GA 3RESA 3NFCA 4PKCC 3TREA 2XMFA 2DTHA 4DEYA 3JCMb 3CCLQ 2ED0A 4PJOE 5LJ3e 3HPWA 3CC4Q 2A28A 2HBPA 4M7DC 1Q95G 1BB9A 3TU4K 4BY6C 4X9CA 2HZYA 4KUDK 1P92A 1XOVA 3G7ZA 5GMKh 4FW2A 2JNGA 2ZAEA 1JRIA 1IRXA 1UTIA 3CPWS 4DBFA 3CC7Q 2DD5A 4AFZC 3MPUB 3JB9D 3M58A 4KGVB 4A4KA 3QKJA 4CC4B 1AOJA 4Z89A 5GMKi 3NTIA 1YCYA 3QG1A 2JN0A 1M8VA 5J26A 5FLXE 4M75G 1Q81U 2DPPB 3CC2T 4LDUA 1VQPQ 2XIDA 1SSFA 2WACA 1MNEA 2VGNA 1KD1U 3JSCA 4Z88A 2YHTA 5FU7B 3CCUA 4PJOD 1PNJA 3UDCA 4OGCA 2EGEA 3VJPA 1HYOA 5GAOq 4ZN1A 4J9DA 1ZBXA 3PMIA 3LW5E 3PIOA 2AHJB 2HQEA 2LQNA 2I2LA 3JAME 1NM7A 2MMPA 1UUEA 4EDUA 1UJYA 1Q82U 2YDLA 1FWZA 3I56Q 4HCKA 2RJDA 3ME9A 2DZCA 3J81E 3CBPA 4L59A 3EH2A 3LWIA 3GOXA 4BDYA 1BIBA 2HSEB 4LD6A 2HD0A 2MWOA 1YIJA 4M4ZA 4PJOC 2QYZA 4QT7A 5CKBA 1IB8A 1JBMA 3QJYA 3M0RA 2SRCA 1IZ6A 1TH7A 5LJ3d 3M9QA 2EYXA 3M0SA 1MV3A 4M75B
chains in the Genus database with same CATH topology
5GAMh 2ZPHB 3G4SA 4C5GA 5LJ5h 2LNVA 3C12A 3HHTB 2JOYA 3OY9A 1NJIC 2O4XB 1MHNA 2XKOC 4OMFB 3DLMA 4XU1A 3SWNC 2X4WA 4OP0A 4ELZC 4EMKA 3QBYA 2DD4A 3T9NA 2XD0A 4PJOB 2EFIA 3MP1A 4M77F 4M78A 5EG2A 1U1SA 2K5IA 1B34B 4BY6B 1KD1C 3X26B 2DZ9A 2P0QA 3LYIA 4OB0B 4C8QA 2LRQA 4XTUA 4C92D 4L5GA 1RI0A 4BE2A 1VQ7A 4BI8B 2JVVA 1WJSA 4QQDA 3SB2A 3CCRA 5CKHA 3PTAA 2FB7A 2YRVA 4QVDA 4XTYA 4E7LA 1M1KU 1KQ2A 1WPYA 4M7AB 3OYDA 2RB6A 2RHZA 3RKYA 3M55A 3LLRA 4ELYC 1KHIA 1N8RC 5CK9A 4ZTJA 2C06A 3JB9F 2PVOB 3RMQA 3FRNA 1BYMA 5GAN3 2MI6A 4FT4A 1M1GA 3EAEA 4FL6A 4E7JA 1YJWT 2RO0A 3QZ9B 4MZMA 4A4FA 3DB4A 2E70A 4M77B 5FRNA 2ZPIB 1W2BS 1YI2A 1PSEA 3OYMA 3ZFJA 2RI3A 4FM4B 3JCMJ 3JB9J 4CI0C 5KCHA 1S72A 1WNLA 2DEQA 3URGA 2DJZA 1QVGS 3I56A 5I2MA 2IG0A 2KVQG 2HQXA 2PUKB 1ZQ1A 3ASKA 3H8ZA 5FU6B 1VQ9A 4KT0E 4M7AD 3CCEA 2RHUA 1I4K1 1X6OA 1JB0E 1MGQA 4N4HA 5LJ5e 4JRPA 2RM4A 3OYHA 2XDPA 2V8JA 4IUVA 1QVGA 2LTOA 2NLUA 3CCVA 3OBWA 4IURA 5KCOA 3CCJA 4Y28E 4M7DD 2Y90A 5J39A 1VQ4A 3MEVA 2K5LA 2ZGWA 4PLIA 1D3BA 2MAMA 1G3WA 2E10A 3VU3C 3JB9G 1LNXA 3JCMX 2B8AA 2LT4A 2OTJT 3V8JA 2LT1A 2JTMA 5CVIA 3FJPA 3CCLT 2XU8A 3EFRA 3A8GB 3A8HB 3OSVA 4HA8A 3BDLA 3OS0A 2QQAA 3VYHB 2F69A 1IREB 2DIGA 2JUFA 1M1KC 3I55T 5GMKe 4RMOA 5GMKm 4Q5WA 2QQRA 3PNWC 5GAOm 3C4SA 2KY9A 3V7RA 1M90U 3CMET 4M78D 5CKDA 3EFSA 2QDYB 1VQ7T 3OYIA 2KAFA 4JLGA 3CMAA 4M7AG 1KG1A 4EPCA 3OMCA 1G5VA 4J83A 2WSFE 2PQWA 3A8LB 3CBOA 4DOVA 4JRKA 4F7UE 2LVMA 4II1A 1YHQA 1YJNA 1WGSA 2YLCA 3QUIA 5KE2A 3V7CA 4BI3A 3CC7T 3J7AF 3E19A 2K57A 3GPLA 4N4GA 4C5IA 3CCST 1KQ1A 5GAOr 1I8FA 1QVPA 3M4GA 1W2BA 3VYGA 2V8IA 3CXCS 3CCSA 4A4GA 4BE0A 1KQSS 5GAMe 2GQVA 2R58A 3F70A 1N9RA 5DLQE 5C6SA 4M7AE 4FSXA 4XTZA 1Y71A 5A0DA 3M56A 3JCMe 1H641 3GIBA 2WSEE 3A5ZB 4JDSA 4M78E 3QSUA 2P0KA 4PNOA 5L8RE 1VQKA 1UGPB 3KBGA 1K73U 3J80E 1K9MC 2XG8D 4MMLA 1ZHIA 2V8KA 2E5QA 4LDXA 4PL6A 2PVDB 4HCBA 3HFOA 2ZPFB 4EMKB 3G6ET 1R8OB 1XTDA 1YJ9T 4M77A 3H6ZA 4QVCA 4QVZA 2D6FA 3HSBA 3CCVT 2RI5A 5FU6C 3X20B 2R5MA 4FU6A 3LH0A 3CMAT 1M9SA 3FEOA 1QVFS 2JZ2A 3QJ6A 2XI9A 5DM7R 3HRTA 4OVAA 4C92C 1M90C 4C0DC 5GANj 2XK0A 4PLLA 1O75A 4J5YA 1BI3A 3BY7A 2RI2A 2E6NA 3OYBA 2O01E 3HP9A 3G71A 3QHSA 3O8VA 4JRIA 4A4HA 2EQUA 3TCJA 2FVUA 3L2ZA 5GAMj 5HK3A 2BKDN 5GMKl 2M9UA 2QQSA 3BFMA 4J7IA 4N4IA 3JCMP 1BIAA 2FL7A 2KK4A 3WVDB 2L5QA 4XAXB 5FRMA 2QQBA 3META 3L2UA 2ZPGB 4M7DF 1VQKT 4C92A 2IVWA 3M59A 3OMGA 5HY6A 4M77C 2QI2A 3L2WA 3S3OA 5LJ5d 3OA6A 4PJOA 5I21A 1BI1A 3C94A 3OYFA 5CKEA 1U1TA 3DKMA 3HRSA 2RA2A 2VGMA 3MEWA 2CKKA 2EQKA 3GF5A 3G6EA 1OZ3A 5LJ3h 3OW2A 4M7AF 1WQ7A 3ZEHA 5HKCA 2OAUA 5CCAA 4XTXA 1NZ9A 1UGSB 2E12A 4P5NA 4EMHA 4C92B 4F7UA 3QXEB 3OSSC 5GAN2 5IT9E 3M4YA 3CPFA 5GAN5 4KUIA 2QEXT 1YITA 3CC4T 1KHCA 3HFNA 2K3XA 1VQOA 1N6AA 5IAYA 1N27A 1FXXA 2P0PA 3RIRA 4BE1A 1Q86U 3WXMB 1G3YA 3OYLA 1GXIE 1UGQB 4A54A 2M16A 3PFSA 1G3SA 3OS5A 1BI2A 2Y4XA 5GAN7 4RG8A 1V29B 2GFUA 4BD3A 2K5FA 4X9DA 4XTWA 1DJ7B 3VV0A 2H3JA 3CEYA 3G71T 4M75D 1M1FA 2XDDA 5C0MA 2LCLA 3INZA 2OTLT 4ZGJB 2A3LA 3JCMQ 2DXTA 2L8DA 4MZPA 4C0GA 2RJEA 4HT9A 4M75F 3FC3A 4QQ6A 1QP2A 4M78G 3AHUA 5LJ3f 4C92F 2KMTA 2MF2A 5KH6A 2K4YA 5M9OA 4JS4A 4M75A 1QW1A 5LJ5f 4DA4A 3P8BB 1KQSA 4M78F 4D6WA 4Z02A 3RMSA 4RCBA 1H3ZA 2GCXA 3JCMW 3R6OA 4YTLA 2DXUA 2R57A 4IUTA 4L6V5 5GAOp 5GAMf 1VIEA 3S6WA 2EJFA 3V8KA 4M75E 1N8RU 3QDRB 3PGGA 1W4SA 3MCAB 3PT9A 3CXCA 3CD6T 4M7DG 3CMEA 3JCMf 3CCRT 1EIFA 3BDUA 2QEXA 2ZPEB 3X24B 1NJIU 4NS5A 1VQNT 3E9GA 4QQGA 1YIJT 4OGEA 2LDMA 4C8QB 4M77E 4GLKA 4DOWA 4Y91A 3JRZA 2EIFA 2GFAA 2ZCFB 1XQHA 1VQ5A 3M54A 3FB9A 3NTHA 1OZ2A 3M57A 5GAN6 2CS7A 4VUBA 1YJ9A 2X4XA 3JB9I 5CKFA 3V7SA 4IUUA 4KULA 3X28B 4A4EA 5LJ5j 1VQ8A 2DK3A 4LDVA 3V8LA 4M7DE 4XU0A 2DKGA 3SFMA 5LJ3j 4M78B 2EYQA 3MHXA 4J6WA 3MP8A 3RKWA 4B9WA 1NPPA 5D6WA 3FIFA 4XU2A 2DTOA 2VYTA 1NPRA 4QW2A 4KBMB 5DY9A 1VQOT 2F5TX 1YI2T 2E41A 4XK8E 4XQ3A 4C8QE 4LDYA 2VV5A 5GANe 3OS1A 3SD4A 4PJOF 2VC8A 4MZTA 3I56T 1Y96A 3LX7A 5GAN8 3CCET 2RJCA 3LGLA 4JUVA 1QVFA 1FX7A 2D0QB 4EMGA 1UGRB 2L89A 3OYAA 4E7HA 4TVRA 2KSSA 4M7DB 5IN1A 2E1HA 5A0LA 4RCCA 1WJQA 5HK0A 1VQ4T 2WSCE 2BIVA 3BW1A 5CIUA 2EKOA 1VQ6A 2RK2A 2RHXA 3CBMA 1UB4A 2EWNA 3MEUA 4OB3B 2RHYA 2VXFA 3WVEB 3HRUA 3VUZA 2LQ8A 3OQ5A 1Q7YC 2QA4A 2X4JA 3GP8A 3QO3A 4HT8A 2DXBA 2LX9A 2HAXA 3A8OB 5CO7A 2QA4T 2E64A 2LCCA 4DQ2A 1Q81C 1K8AU 5GMKj 4MMKA 2CYZB 3I55A 1VQ8T 1BI0A 2EQMA 1VQPA 4M77D 4J6XA 2CZ7B 5D6XA 2RD1A 4ZN3A 1HXDA 5GANg 3FLGA 4F7UF 2CZ1B 4NL2A 1YITT 3L42A 3TEEA 5DLOA 5D6YA 3VUBA 1WQWA 5GAOl 3OYNA 1KC8U 3FDRA 3NTKA 1VQNA 3MP6A 3UPUA 2X35A 3KUFA 2DO3A 5LJ5g 4JRQA 3VKIA 3OS2A 1S72T 2KDSA 1VQMT 5LJ3g 3A8MB 3OYGA 3MEAA 3HKSA 4RKUE 1VQ5T 2DIQA 2M0OA 3E9FA 3JCMc 3CC7A 2DAQA 3DB3A 4A53A 1Y07A 2DTIA 4UC4A 2A7YA 2DVEA 2VXEA 4X34A 1D3BB 4E47A 4GY5A 3OYEA 1JJ2A 4NL3A 2L3RA 4N0AA 2OTLA 3PMTA 3GNGA 3E1SA 3HL8A 4IKFA 1O9SA 3C95A 4J6YA 3PIPA 3CD6A 1WJRA 2OTJA 1Q7YU 4C0FA 1OI1A 2LC4A 4M77G 4F7UB 4JJNK 5GAMg 1LOJA 2BUDA 3CCQA 1KC8C 4FT2A 5GANf 3RERA 1B34A 2JTFA 3GNFB 4ME7A 3UT1A 2XHCA 3JCMg 3RESA 2VUBA 2CGHA 3NFCA 1HK9A 5GANd 5A0GA 2R5AA 2PVGB 4PKCC 4XTVA 3DLLA 3JB9H 2K3YA 3M53A 3TREA 2PU9B 2DTHA 4M7AC 1M4ZA 3JCMb 3QYHB 5I2SA 4PJOE 5LJ3e 2QXFA 3HPWA 2EJ9A 4OF1A 3RUXA 1VQ6T 4MDWA 4OB2B 2RJFA 3JCMh 2HBPA 4M7DC 2M1HA 1VQLA 3TU4K 3CCMA 4BY6C 5A2QE 4X9CA 4V2SA 2DXCA 4HCCA 4KUDK 1P92A 3L1AA 3QPHA 4PJOG 4R56A 2F5KA 5CQXA 1XOVA 2HNIA 3G7ZA 4O5VA 3GLXA 5GMKh 5GAOn 4F7UG 1VUBA 2JNGA 4B9XA 1G3TA 4E7IA 3G4ST 3KXTA 4LD9K 1JRIA 1YJWA 4N0AC 4BB7A 4JS5A 2RH2A 2G3RA 2FYKA 5KE3A 3CPWS 2D9TA 4JLIA 3CPWA 1BKBA 4M7DA 2Y4YA 2DD5A 2P4TA 4J8OA 3M58A 4A4KA 3JB9D 1QP3A 3QKJA 2QQ9A 4BI4A 4MDXA 4IUPA 2ZPBB 3JCMV 5GMKi 4CRIA 2EAYA 3NTIA 1YCYA 2GF7A 4C5HA 5CR2A 3QG1A 2JN0A 4NOYA 5J26A 3X25B 5LL6S 4C8QD 1M8VA 5FLXE 2K2VA 4C0ZA 2ZZDA 4M75G 4ATOA 1I5LA 3N5BB 5J3BA 1Q81U 2DPPB 1JJ2S 1I81A 1X75C 3OYCA 4WF2A 3CC2T 4LDUA 2XIDA 3CC2A 5FROA 1SSFA 1LJOA 2WACA 1KD1U 2VGNA 2LQKA 4O6JA 5CAIA 3JSCA 3OYJA 2YHTA 4XU3A 5FU7B 2E6ZA 3CCUA 4PJOD 4BACA 1VQLT 3CCQT 3UDCA 4OGCA 3CCMT 1AHJB 3UWNA 2QTXA 1K73C 1K9MU 3MO8A 3QZ5B 3VJPA 1VQMA 5GAOq 2RHIA 4ZN1A 1VIFA 4ZTFA 5CQYA 3OW2S 2EQJA 1VQPT 2RK1A 1ZBXA 3P8DA 3QYGB 3PMIA 3LWHA 3LW5E 3PIOA 2AHJB 3L2RA 1PSFA 3M5AA 2HQEA 3RKXA 3Q1JA 1Q86C 5AYFA 2I2LA 3CCJT 3JAME 1UEBA 2CZ0B 4BDZA 3OYKA 2MMPA 3ER0A 2MWPA 4RG2A 4EDUA 1Y96B 1VQ9T 1Q82U 1YHQT 4M75C 3OBYA 1M5Q1 3S3NA 3CCLA 2YLBA 4M78C 3S3MA 1FWZA 4FIBA 1RL2A 3LGFA 4E7KA 3OB9A 4R55A 4C5EA 4C0DB 2XICA 4C92G 2RJDA 1U8RA 4HCZA 1X01A 3ME9A 2DZCA 4ZGEB 3J81E 1Q82C 2O4XA 3CC4A 3ZBDA 2EJGA 3L2VA 3JCMd 2CZ6B 3CBPA 4L59A 1YBYA 3LWIA 1OYXA 2KQWA 3QIIA 3CCUT 3OYYA 3GOXA 4HKEA 4BDYA 1BIBA 4J7FA 1NE8A 4LD6A 3SDZA 2HD0A 3SWNB 1XNIA 4C8QC 5GAMd 1K8AC 2MWOA 1YIJA 4OB1B 3SWNA 1Y7XA 4ZGDB 4M7AA 2X4YA 4PJOC 4EMKC 5GAN4 5CKBA 1YJNT 1JBMA 4LDWA 3QJYA 5GANh 3P8HA 2FHDA 4C92E 3L2QA 1N9SA 4C8QG 1IZ6A 1TH7A 5LJ3d 2XDBA 3M9QA 4C8QF 2E65A 5FU7C 4IUQA 4BUGA 2PUOB 4M75B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DLQ E;  3G4S A;  3CCR T;  1EIF A;  2QEX A;  1NJI U;  1VQ6 T;  2JOY A;  1VQN T;  3A5Z B;  1YIJ T;  1NJI C;  1VQK A;  3KBG A;  1VQL A;  2EIF A;  3J80 E;  1K73 U;  1K9M C;  3CCM A;  1VQ5 A;  5A2Q E;  1YJ9 A;  3G6E T;  1VQ8 A;  1XTD A;  1YJ9 T;  1KD1 C;  2JNG A;  3G4S T;  3CCV T;  1YJW A;  1VQ7 A;  1NPP A;  2JVV A;  4QQD A;  3CCR A;  3LH0 A;  2G3R A;  3CMA T;  1NPR A;  3CPW S;  1M1K U;  3CPW A;  1BKB A;  1VQO T;  1QVF S;  1YI2 T;  5DM7 R;  1M90 C;  1KHI A;  4CRI A;  3I56 T;  1N8R C;  3CCE T;  3LGL A;  5J26 A;  1QVF A;  5LL6 S;  5FLX E;  5J3B A;  4TVR A;  3G71 A;  2MI6 A;  1Q81 U;  1JJ2 S;  3CC2 T;  1M1G A;  1YJW T;  3CC2 A;  3DB4 A;  2E70 A;  1VQ4 T;  1VQ6 A;  1SSF A;  1KD1 U;  1W2B S;  1YI2 A;  3CCU A;  2E6Z A;  2LQ8 A;  1VQK T;  5HY6 A;  1S72 A;  1Q7Y C;  1VQL T;  3CCQ T;  2QA4 A;  3I56 A;  3CCM T;  1QVG S;  2KVQ G;  2IG0 A;  2QA4 T;  1K73 C;  1K9M U;  1VQM A;  1Q81 C;  1VQ9 A;  4ZN1 A;  1K8A U;  3CCE A;  2CKK A;  3OW2 S;  3I55 A;  1X6O A;  3G6E A;  3OW2 A;  1VQP T;  1VQ8 T;  1VQP A;  1QVG A;  1NZ9 A;  4ZN3 A;  3PIO A;  3CCV A;  1Q86 C;  3CCJ A;  1YIT T;  5IT9 E;  1KC8 U;  1VQ4 A;  3CPF A;  2QEX T;  3CCJ T;  3JAM E;  1YIT A;  1UEB A;  3CC4 T;  1VQO A;  1VQN A;  3ER0 A;  2MWP A;  4RG2 A;  2DO3 A;  5IAY A;  2OTJ T;  1S72 T;  2KDS A;  1VQM T;  1VQ9 T;  1Q82 U;  1YHQ T;  3CCL T;  3HKS A;  1Q86 U;  1VQ5 T;  3CCL A;  3CC7 A;  3DB3 A;  1RL2 A;  2JUF A;  3LGF A;  1M1K C;  3I55 T;  4X34 A;  1JJ2 A;  3G71 T;  2L3R A;  2OTL A;  3J81 E;  1M90 U;  3CME T;  2LCL A;  2OTL T;  1Q82 C;  3CC4 A;  3CD6 A;  3PIP A;  1VQ7 T;  2OTJ A;  1Q7Y U;  1YBY A;  3CMA A;  3CCU T;  3OYY A;  1K8A C;  3CCQ A;  1KC8 C;  1XNI A;  2LVM A;  2MWO A;  1YIJ A;  1YHQ A;  3P8B B;  1KQS A;  1YJN A;  2XHC A;  3J7A F;  1YJN T;  3CC7 T;  4YTL A;  3DLL A;  1IZ6 A;  3CCS T;  1W2B A;  3TRE A;  3CXC S;  3CCS A;  1N8R U;  3CD6 T;  3CXC A;  1KQS S;  3CME A; 
#chains in the Genus database with same CATH topology
 5GAM h;  3C12 A;  4XU1 A;  3DLM A;  2X4W A;  2K2M A;  2COW A;  4ELZ C;  4EMK A;  1VQ5 Q;  2GQI A;  3T9N A;  2XD0 A;  3MP1 A;  4M77 F;  5EG2 A;  1KD1 C;  5ECA A;  2E3I A;  2P0Q A;  2QGF B;  3LYI A;  4OB0 B;  2LRQ A;  4XTU A;  1VQ7 A;  4BI8 B;  4QQD A;  3SB2 A;  1OQK A;  5CKH A;  1T0J A;  4E7L A;  1M1K U;  4M7A B;  2F2X A;  3VS1 A;  3LLR A;  1KHI A;  4HVW A;  4ZTJ A;  2C06 A;  1Q81 R;  2NUP A;  4KRT A;  1SG5 A;  1C0M A;  4FT4 A;  4M77 B;  3SEM A;  4LN2 A;  1W2B S;  1PSE A;  3ZFJ A;  1NLP C;  3JCM J;  1QCN A;  2CH4 W;  8AT1 B;  1KFZ A;  5I2M A;  2IG0 A;  2PUK B;  1ZQ1 A;  2M02 A;  3ASK A;  2RHU A;  1MGQ A;  4IUV A;  1MMG A;  4M7D D;  4JPB W;  1D3B A;  1WI7 A;  1CKA A;  3VU3 C;  1YIJ Q;  1Q7Y R;  3JCM X;  3V8J A;  2LT1 A;  2JTM A;  3FJP A;  3CCL T;  2J6K A;  2E5K A;  2QQA A;  2F69 A;  1IRE B;  2JUF A;  2LCS A;  4Q5W A;  1TUC A;  3V7R A;  1IO6 A;  3OYI A;  4JLG A;  4M7A G;  3OMC A;  2PQW A;  2LVM A;  2OX7 A;  2DRK A;  1B7T A;  1WGS A;  1M1K R;  3QUI A;  4BI3 A;  3CC7 T;  2DBM A;  3E19 A;  2K57 A;  4C5I A;  1RAD B;  1S72 Q;  5C6S A;  4M7A E;  4KH0 B;  3M56 A;  1H64 1;  2YUP A;  1R77 A;  4X1V A;  3A5Z B;  2P0K A;  4PNO A;  2DRM A;  2G6F X;  5KYW B;  2E5Q A;  2BZY A;  2PVD B;  1OPK A;  4PL6 A;  2EVR A;  3G6E T;  4QVC A;  1I5O B;  2D6F A;  3CD6 Q;  3REA B;  3LH0 A;  3CMA T;  2QAZ A;  2JZ2 A;  3QJ6 A;  2XI9 A;  1VQN Q;  5IHK A;  1M90 C;  1FYN A;  5GAN j;  1ABO A;  2LJ3 A;  1SKU B;  4J5Y A;  1X27 A;  1BI3 A;  3G71 A;  4JRI A;  3TCJ A;  3L2Z A;  1HSQ A;  2BKD N;  2M9U A;  3TSW A;  3BFM A;  5I11 A;  5IXF A;  1AD5 A;  3JCM P;  2FL7 A;  5FRM A;  2QQB A;  4M7D F;  4C92 A;  2IVW A;  2JJ9 A;  2QI2 A;  4M77 C;  4PJO A;  4FYY B;  5CKE A;  2RF0 A;  3MEW A;  2VGM A;  3G6E A;  4KH1 B;  1OZ3 A;  2DM1 A;  5CCA A;  1NZ9 A;  3E2U A;  4C92 B;  3QXE B;  3M4Y A;  2QEX T;  3HFN A;  1QKW A;  4ESR A;  2K6D A;  2DX1 A;  5IAY A;  1UDL A;  2QK0 A;  2JM9 A;  3WXM B;  1UGQ B;  4A54 A;  1G3S A;  1BI2 A;  5GAN 7;  2RPN A;  2O88 A;  1QWF A;  1VQ8 Q;  4X9D A;  5KYU A;  1J3T A;  2RMO A;  2XDD A;  2A3L A;  3JCM Q;  2DXT A;  4QQ6 A;  2DYI A;  4RTX A;  2HQH A;  5KH6 A;  4C92 F;  2MF2 A;  2K4Y A;  2LQW A;  4M75 A;  2OJ2 A;  1NG2 A;  3P8B B;  4E2F B;  3G71 Q;  1VQM Q;  3I35 A;  3GBQ A;  1OEB A;  2V1Q A;  2EJF A;  3QDR B;  2AKL A;  3CD6 T;  2YUN A;  1D0X A;  2JM8 A;  2QEX A;  3X24 B;  1GFD A;  3G1J A;  2LDM A;  4C8Q B;  4M77 E;  4Y91 A;  3EG3 A;  1VQ5 A;  3FB9 A;  3TVT A;  4IUU A;  4A4E A;  1ARK A;  1WHL A;  4XU0 A;  4B9W A;  2VYT A;  1NPR A;  1FMW A;  2F5T X;  8ATC B;  4XQ3 A;  4LDY A;  3RNJ A;  1MUZ A;  2OI3 A;  1FX7 A;  4JUV A;  3RR6 A;  2J05 A;  1IXD A;  4TVR A;  5KYW A;  2KBT A;  5IN1 A;  2I0N A;  1SSH A;  4DBR A;  5HK0 A;  1VQ4 T;  2YRC A;  5CIU A;  1W2B P;  2RK2 A;  3MEU A;  1EZZ B;  1VYU A;  1K0S A;  2KT1 A;  1ZSZ A;  2VAS A;  2JMC A;  3A8O B;  2QA4 T;  3ZL7 C;  1YJN Q;  1E7O A;  4DQ2 A;  1W6X A;  1VQ8 T;  3EFO A;  5D6X A;  4ZN3 A;  5GAN g;  3FLG A;  1ZUK A;  3L42 A;  5DLO A;  5D6Y A;  1QWE A;  3NTK A;  3MP6 A;  3KUF A;  5LJ5 g;  2RQT A;  1S72 T;  1VQM T;  4PJN A;  1AWO A;  2EW3 A;  3E9F A;  3JCM c;  2FG0 A;  3DB3 A;  2NUT A;  2DTI A;  4UC4 A;  2DVE A;  1D3B B;  4GY5 A;  3EGU A;  2L3R A;  3CXC P;  1ZSZ C;  3I5S A;  3E1S A;  1WJR A;  3VRZ A;  1OI1 A;  1IHW A;  4CC2 A;  4ME7 A;  3VS3 A;  1K9M R;  2XHC A;  3JCM g;  1SRM A;  2RQU A;  3DLL A;  2K3Y A;  2PU9 B;  4M7A C;  1M4Z A;  2LZ6 B;  2O31 A;  5I2S A;  2QXF A;  4MDW A;  4OB2 B;  1WHG A;  3JCM h;  1VQL A;  3CCM A;  5A2Q E;  2DXC A;  1H8K A;  4HCC A;  4PJM A;  4PJO G;  1NJI R;  1VQ7 Q;  2HNI A;  2D0N A;  1PHT A;  4O5V A;  1HJD A;  1VUB A;  1RAH B;  2SEM A;  3KXT A;  1Z9Z A;  3G4S T;  4LD9 K;  1PCX A;  2FYK A;  5KYN A;  2D9T A;  2Y4Y A;  2L3Q A;  1H92 A;  4BI4 A;  2DMO A;  3CPW P;  4MDX A;  2L2P A;  4F04 B;  4CRI A;  1X2Q A;  2GF7 A;  3NGP A;  4RTZ A;  2ZZD A;  2KEA A;  5J3B A;  1OU9 A;  3CC2 A;  4O6J A;  3OYJ A;  2A36 A;  2CUD A;  1JJ2 P;  3CCQ T;  3CCM T;  1AHJ B;  3H0F A;  3UWN A;  4KGZ B;  3MO8 A;  2RHI A;  4ZTF A;  2RK1 A;  1W70 A;  3LWH A;  1PRL C;  3L2R A;  4WCI A;  2RQR A;  4ZNX A;  2DEU A;  3VRY A;  1AWJ A;  5AYF A;  4RTT A;  3CCJ T;  1UEB A;  1S1N A;  4BDZ A;  3OYK A;  4RG2 A;  1Y96 B;  1YI2 Q;  1YHQ T;  3UF4 A;  3CCR Q;  4M75 C;  4HXJ A;  3EG2 A;  4E7K A;  3LGF A;  4OMM A;  1WXU A;  4C5E A;  4C0D B;  4HCZ A;  2O9S A;  2F2W A;  2JS0 A;  2GTJ A;  3ZBD A;  2EJG A;  3L2V A;  3JCM d;  1YBY A;  3OYY A;  1K8A C;  1AWW A;  3SHW A;  4PK4 A;  4ZGD B;  4C92 E;  2YWW A;  3THK A;  1ZUU A;  2PUO B;  1OUL A;  3G4S A;  3D7S B;  3HHT B;  2JW4 A;  1WHJ A;  1NJI C;  2XKO C;  4OMF B;  1D0Z A;  4PJO B;  2EFI A;  1UGV A;  2K5I A;  4BY6 B;  2DZ9 A;  4FCY A;  1AZE A;  2A08 A;  4C92 D;  4BE2 A;  1PKS A;  2JVV A;  2CP0 A;  3OW2 P;  4QVD A;  1WPY A;  3U23 A;  1YJW Q;  2RHZ A;  4ELY C;  2H3E B;  2MYS A;  5KYY A;  3JB9 F;  2PVO B;  3RMQ A;  1BYM A;  2MI6 A;  2JS2 A;  2NUT B;  1JXM A;  2RO0 A;  4MZM A;  3DB4 A;  2E70 A;  2YT6 A;  4FM4 B;  3EGX B;  1OU8 A;  5KCH A;  3URG A;  2DJZ A;  2HQX A;  4KT0 E;  4PFP A;  4M7A D;  1I4K 1;  1X6O A;  2RM4 A;  3OYH A;  2XDP A;  1VQO Q;  2K3B A;  5FW9 A;  3CCV A;  1TUD A;  5J39 A;  2FO0 A;  2LT4 A;  2OTJ T;  5KYX B;  5CVI A;  2HEQ A;  3A8G B;  2PNI A;  3BDL A;  3EG9 B;  1ZUY A;  2EGC A;  3EG0 A;  1K0X A;  2BZ8 A;  5GMK m;  4M78 D;  3CC2 Q;  1RLP C;  1SRL A;  1VQ7 T;  2KAF A;  1G5V A;  1BCM A;  1RUW A;  4J83 A;  3A8L B;  4F7U E;  1BCO A;  1GL5 A;  1YJN A;  5KE2 A;  3V7C A;  1QKX A;  3PE0 A;  1K76 A;  4N4G A;  1TG0 A;  3CCS T;  1QVP A;  3VYG A;  4J9F A;  3M0P A;  1T0H A;  2EYZ A;  1X43 A;  1Y71 A;  3JCM e;  1M27 C;  3GIB A;  4M78 E;  3QSU A;  4AG2 C;  5L8R E;  1VQK A;  1K9M C;  3J80 E;  3EGD A;  2XG8 D;  1WHK A;  2AZV A;  2FPF A;  2V8K A;  4LDX A;  4FYV B;  3HFO A;  2ZPF B;  1AWX A;  1R8O B;  1YJ9 T;  2HL3 A;  4FW1 A;  2R5M A;  1SHG A;  1Z9Q A;  2RQV A;  4PFO A;  1PD1 A;  1M9S A;  5DM7 R;  1M8M A;  4C92 C;  2CRE A;  2HBW A;  4PLL A;  1O75 A;  3BY7 A;  2RI2 A;  2DJQ A;  2O01 E;  3QWY A;  5L23 A;  4A4H A;  5GAM j;  4J9B A;  4J7I A;  3L2U A;  1VQK T;  6AT1 B;  3L2W A;  1BI1 A;  3OYF A;  1U1T A;  2RA2 A;  2CKK A;  2EQK A;  3PVQ A;  3OW2 A;  1SHF A;  2JTE A;  5HKC A;  2OAU A;  4XTX A;  4EMH A;  4F7U A;  2GNC A;  3OSS C;  5IT9 E;  2BE7 D;  5GAN 5;  3AT1 B;  1YIT A;  2K3X A;  2ROT A;  1GBQ A;  1FXX A;  3RIR A;  1PWT A;  2E4H A;  2JT4 A;  4RG8 A;  2GFU A;  2CP2 A;  1DJ7 B;  3VV0 A;  2KRM A;  4M75 D;  3INZ A;  2OTL T;  4OML A;  2RJE A;  3FC3 A;  3ULR B;  4M78 G;  3AHU A;  1KQS P;  1B3Q A;  1U3O A;  5M9O A;  4JS4 A;  4DA4 A;  1KQS A;  4M78 F;  3RMS A;  1YWO A;  1I07 A;  3JCM W;  4AT1 B;  2DXU A;  2R57 A;  4L6V 5;  5GAO p;  1XJW B;  1VIE A;  3S6W A;  2OAW A;  3V8K A;  1N8R U;  3PGG A;  1W4S A;  3PT9 A;  3CME A;  3JCM f;  1EIF A;  3M0U A;  1WFW A;  2ZPE B;  2HSP A;  1W1F A;  1QVG P;  9ATC B;  2K79 A;  4DOW A;  2EIF A;  5GAN 6;  4VUB A;  2X4X A;  5CKF A;  4JJC A;  4KUL A;  2Z0W A;  3V8L A;  4M78 B;  1ZA1 B;  2DA9 A;  2EYQ A;  3EGX A;  4GLM A;  5IXB A;  1ZSG A;  3FIF A;  4XU2 A;  4OMP A;  2CH4 A;  4XK8 E;  4C8Q E;  3OS1 A;  1MMD A;  4PJO F;  2CP3 A;  3H0I A;  3I56 T;  3CCE T;  5GAN 8;  4A63 B;  5KYY B;  3TQ7 P;  3OYA A;  2CP6 A;  2ESW A;  3O5Z A;  1GBR A;  2ABL A;  2WSC E;  2RHX A;  1UB4 A;  2PZ1 A;  1PC0 A;  3NPF A;  1Q7Y C;  1YIT Q;  2QA4 A;  3GP8 A;  3QO3 A;  1N8R R;  5CO7 A;  2NYS A;  2MCN A;  2LCC A;  1RAF B;  4MMK A;  2CYZ B;  3I55 A;  1VQ4 Q;  2EQM A;  1QCF A;  4J6X A;  2CZ7 B;  2CZ1 B;  1A0N B;  3TEE A;  3OYN A;  1WQW A;  2X35 A;  1QMC A;  4JRQ A;  1Y0M A;  2LJ1 A;  3OS2 A;  1QQJ A;  3A8M B;  1BU1 A;  4RKU E;  1VQ5 T;  2DIQ A;  4E47 A;  2VXE A;  4NL3 A;  2OTL A;  2LNH B;  1O9S A;  3PIP A;  2CT4 A;  4D8D A;  2OTJ A;  2KXD A;  2C0I A;  4GBQ A;  4JJN K;  2LC4 A;  4M77 G;  3CCQ A;  1LOJ A;  2BUD A;  2KI7 A;  1YFN A;  1B34 A;  3BE3 A;  3UT1 A;  1I1J A;  2R5A A;  4F17 A;  4K11 A;  1JQQ A;  3EG9 A;  2HCK A;  1ABQ A;  2DER A;  2FPE A;  1VQ6 T;  2EJ9 A;  3CQT A;  2ECZ A;  3I55 Q;  1R0B G;  4V2S A;  3L1A A;  4R56 A;  2F5K A;  5CQX A;  5GAO n;  2B86 A;  4B9X A;  4D8K A;  2AZS A;  3H41 A;  1G8X A;  1YN8 A;  4N0A C;  2LMJ A;  4JS5 A;  2G3R A;  5KE3 A;  3CPW A;  1BKB A;  2KE9 A;  2P4T A;  2KGT A;  4J8O A;  1QP3 A;  2QQ9 A;  1TXQ A;  2ZPB B;  4RUG A;  4J9C A;  5CR2 A;  3X25 B;  5LL6 S;  1I5L A;  5IHN A;  4WF2 A;  1ZLM A;  1LJO A;  2LQK A;  2RN8 A;  2JXB A;  2EGA A;  4OMQ A;  2IPO B;  2O9V A;  2X51 A;  4ANJ A;  2HMA A;  1K9M U;  1FMV A;  1KSW A;  3QZ5 B;  3CCV Q;  2BZX A;  5CQY A;  3OW2 S;  2EQJ A;  1VQP T;  2KXC A;  3A1P A;  3QYG B;  4E6R A;  2P4R A;  4AMC A;  1UE9 A;  2LJ0 A;  3IQL A;  3S3N A;  3CCL A;  2YLB A;  3S3M A;  4FIB A;  1RL2 A;  3RDV A;  3OB9 A;  2XIC A;  4C92 G;  3EH1 A;  1U8R A;  1EX4 A;  3VS6 A;  4ZGE B;  1VQ6 Q;  4Z8A A;  2O4X A;  1QCO A;  1X6B A;  2CZ6 B;  1UG1 A;  1OYX A;  1BBZ A;  3CCU T;  3SWN B;  3SDZ A;  3VS2 A;  1WZO A;  1XNI A;  2FZG B;  2K9G A;  2QGG A;  4FYW B;  2DL7 A;  3SWN A;  2KT8 A;  4M7A A;  4LDW A;  2FHD A;  3L2Q A;  4C8Q G;  2ATC B;  5GJV B;  4C8Q F;  1UHC A;  2E65 A;  2YUQ A;  5D7U A;  4IUQ A;  2AKK A;  5FU7 C;  1KD1 R;  3CCE Q;  1YNZ A;  1WIE A;  1TS9 A;  4C5G A;  1IGU A;  1RAG B;  2A0F B;  2HDA A;  2IIM A;  2O4X B;  1MHN A;  2J06 A;  4OP0 A;  2DD4 A;  1F1B B;  1PKT A;  2CDT A;  2QA4 Q;  1V76 A;  1KIK A;  1EFN A;  2L3P A;  2MPX C;  4L5G A;  3EGD B;  1WJS A;  3CCR A;  2DL4 A;  2FB7 A;  4XTY A;  1KQ2 A;  2LX7 A;  1K9A A;  3OYD A;  3VS4 A;  5CK9 A;  1GFC A;  1M90 R;  4DBQ A;  5GAN 3;  2CSQ A;  1M1G A;  4FL6 A;  4E7J A;  3TSZ A;  3QZ9 B;  1YJW T;  5FRN A;  1AT1 B;  2ZPI B;  1OX9 A;  1YI2 A;  3OYM A;  2RI3 A;  3JB9 J;  2VKN A;  4CI0 C;  2EBP A;  1S72 A;  1WNL A;  1QVG S;  3I56 A;  1M3A A;  3EHR A;  2KVQ G;  3H8Z A;  5FU6 B;  2LP5 A;  3CCE A;  1JB0 E;  4N4H A;  1QVG A;  2QG9 B;  1K73 R;  2W10 A;  2LTO A;  2NLU A;  1E6H A;  4IUR A;  5KCO A;  2Y90 A;  3MEV A;  4PLI A;  1G3W A;  2X3X D;  2AK5 A;  1LPL A;  2F2V A;  1E6G A;  1YWP A;  2MK5 A;  2XU8 A;  3OS0 A;  3A8H B;  1WX6 A;  1D1B A;  4QKU A;  2DIG A;  2H8H A;  1M1K C;  3I55 T;  5EC7 A;  5GMK e;  1NEB A;  2FRY A;  4DEX A;  5GAO m;  3QWX X;  1M90 U;  3CME T;  2ROL A;  3EFS A;  2QDY B;  1M2O A;  2E3H A;  1JO8 A;  3CMA A;  1KG1 A;  1RAA B;  1GCP A;  2WSF E;  2M0Y A;  3CBO A;  1RAC B;  4DOV A;  4JRK A;  1YHQ A;  5IH2 A;  3J7A F;  1K4U S;  3GPL A;  4Y92 A;  1KQ1 A;  1I8F A;  3M4G A;  2V8I A;  4J9G A;  3CCS A;  4A4G A;  1X2K A;  1KQS S;  2GQV A;  3VS7 A;  1KK7 A;  1N9R A;  1CKB A;  4JZ4 A;  5DLQ E;  4FSX A;  2QTV A;  2CP7 A;  1NBE B;  2WSE E;  2FZC B;  2M51 A;  3NHN A;  2PTK A;  1UGP B;  2D8H A;  1K73 U;  1PM3 A;  2QDL A;  1OOT A;  2RQW A;  4HCB A;  4EMK B;  1UHF A;  4M77 A;  4QVZ A;  3HSB A;  3CCV T;  3X20 B;  4FU6 A;  7AT1 B;  1QVF S;  2CT3 A;  4OVA A;  1YJ9 Q;  4HVV A;  4C0D C;  3CCJ Q;  2XK0 A;  2NUP B;  2E6N A;  2NWM A;  5I22 A;  3C0C A;  1AEY A;  2EQU A;  5HK3 A;  5GMK l;  3WVD B;  2KK4 A;  4XAX B;  2ZPG B;  3S3O A;  5I21 A;  2DFU A;  3C94 A;  3DKM A;  3HRS A;  5LJ3 h;  1WDX A;  4LUD A;  5HCK A;  2E12 A;  1UGS B;  1TU0 B;  4P5N A;  3EFO B;  1AZG B;  2YXY A;  1VQK Q;  1KJW A;  5GAN 2;  3CPF A;  2DLP A;  4KUI A;  3CC4 T;  1KHC A;  3VS5 A;  2P0P A;  1Q86 U;  1K8A R;  2M16 A;  2MIO A;  3HTR A;  4BD3 A;  2K5F A;  3G71 T;  3CEY A;  1M1F A;  2LCL A;  4ZGJ B;  2L8D A;  4MZP A;  4HT9 A;  1AVZ C;  1QP2 A;  1Y57 A;  2KMT A;  3QDF A;  5LJ5 f;  3M0Q A;  4D6W A;  4Z02 A;  1MV0 B;  3UA7 A;  3R6O A;  4IUT A;  3CXC A;  3MCA B;  3EG1 A;  1G2B A;  3BDU A;  4NS5 A;  2DET A;  1YIJ T;  4OGE A;  4GLK A;  3CCM Q;  3NTH A;  5FWC A;  3M57 A;  2DBK A;  2CS7 A;  3UAT A;  3JB9 I;  3V7S A;  3X28 B;  1VQ8 A;  5LJ5 j;  3SFM A;  5LJ3 j;  1VYT A;  1PG5 B;  2RNA A;  3RKW A;  1MMN A;  1NPP A;  2DTO A;  4QW2 A;  4KBM B;  1VQO T;  4CC3 A;  2L3S A;  1YHQ Q;  5GAN e;  3SD4 A;  4MZT A;  3LGL A;  1QVF A;  4EMG A;  1UGR B;  2L89 A;  4E7H A;  2KSS A;  3CCS Q;  4M7D B;  1U5S A;  5A0L A;  4RCC A;  4F16 A;  1SF9 A;  2BIV A;  1VQ6 A;  2EKO A;  3CBM A;  3WVE B;  3HRU A;  3VUZ A;  2LQ8 A;  1JU5 C;  2FRW A;  3VS0 A;  2X4J A;  4HT8 A;  2LX9 A;  1QVF P;  1Q81 C;  4J9E A;  1BI0 A;  3G6E Q;  2RD1 A;  4NL2 A;  4PFZ A;  3UA6 A;  1TOV A;  1KC8 U;  2X9H A;  5GAO l;  3FDR A;  1WA7 A;  4EIK A;  4E7Z A;  1VQN A;  3UPU A;  2KDS A;  5AT1 B;  3OYG A;  3MEA A;  3HKS A;  4RTW A;  4DBH A;  2M0O A;  1ZSZ B;  2DAQ A;  2X3W D;  2A7Y A;  4X34 A;  1JJ2 A;  2KRS A;  3MJX A;  3GNG A;  3HL8 A;  2EKH A;  1MND A;  3C95 A;  2O2O A;  3CD6 A;  2FPD A;  1Q7Y U;  2KRO A;  5GAM g;  1KC8 C;  4WTO B;  4FT2 A;  2GBQ A;  4LNP A;  3GNF B;  1VQ9 Q;  3FJ5 A;  1NYF A;  2VUB A;  1RAE B;  2CGH A;  1HK9 A;  5GAN d;  5A0G A;  2AIR B;  2PVG B;  4XTV A;  3JB9 H;  3M53 A;  3QYH B;  4OF1 A;  3RUX A;  1KC8 R;  2RJF A;  2KR3 A;  2M1H A;  3CCU Q;  1H3H A;  4E7S A;  1C6V X;  1PD0 A;  2DE0 X;  3QPH A;  2YUO A;  3GLX A;  2DF6 A;  4F7U G;  1G3T A;  4E7I A;  2DIL A;  1YJW A;  4BB7 A;  2HKQ B;  2RH2 A;  4JLI A;  4M7D A;  1RAI B;  1ACM B;  4IUP A;  3JCM V;  2EAY A;  2KRN A;  3H0H A;  4C5H A;  4NOY A;  4C8Q D;  4IIO A;  3CCQ Q;  2K2V A;  4C0Z A;  4ATO A;  3N5B B;  2GGR A;  1JJ2 S;  1I81 A;  1X75 C;  3OYC A;  1OPL A;  4PJL A;  5FRO A;  5CAI A;  2D8J A;  1G83 A;  4XU3 A;  2E6Z A;  4BAC A;  1VQL T;  1K73 C;  5FWB A;  1TSF A;  2QTX A;  1VQM A;  1VIF A;  4PJJ A;  3P8D A;  4LUE A;  3A98 A;  1PSF A;  3M5A A;  3RKX A;  3Q1J A;  1Q86 C;  2CZ0 B;  1WYX A;  2P84 A;  3ER0 A;  2MWP A;  1T3S A;  1VQ9 T;  3OBY A;  1M5Q 1;  4M78 C;  2J6F A;  2C0O A;  1U06 A;  4R55 A;  2EYW A;  3EHQ A;  1X01 A;  2CUB A;  3H9N A;  1Q82 C;  3CC4 A;  3CMA Q;  2A37 A;  1M3C A;  2KQW A;  3QII A;  4HKE A;  4J7F A;  1NE8 A;  5GAM d;  1QLY A;  2KYB A;  4C8Q C;  1NEG A;  4OB1 B;  1Y7X A;  2DVJ A;  2X4Y A;  4EMK C;  5GAN 4;  1YJN T;  1D1A A;  5GAN h;  3P8H A;  2QEX Q;  1N9S A;  2XDB A;  1D0Y A;  4BUG A;  2ZPH B;  4JJD A;  3CME Q;  5LJ5 h;  2LNV A;  2JOY A;  3OY9 A;  3SWN C;  1RAB B;  1LVK A;  1TTH B;  2MOX A;  2JMA A;  4ORZ A;  3QBY A;  4M78 A;  1K1Z A;  1U1S A;  1B34 B;  3X26 B;  1WXT A;  4C8Q A;  1UFF A;  1VA7 A;  1RI0 A;  3PTA A;  2DL8 A;  2YRV A;  1FMK A;  2RB6 A;  3RKY A;  3M55 A;  1N8R C;  1SPK A;  2HL5 C;  2KNB B;  1JEG A;  3FRN A;  2DNU A;  2ENM A;  2OTL Q;  2D1X A;  3EAE A;  1WHH A;  3REB B;  4A4F A;  1TUG B;  1T3L A;  2DEQ A;  1VQ9 A;  1M2V B;  2YRD A;  2OTJ Q;  1M30 A;  5LJ5 e;  4JRP A;  2V8J A;  1OX8 A;  1OV3 A;  4R0K A;  3OBW A;  3CCJ A;  4Y28 E;  1R0C B;  1VQ4 A;  2K5L A;  2ZGW A;  2MAM A;  2E10 A;  3JB9 G;  1LNX A;  2B8A A;  1MMA A;  2VB6 A;  3PVL A;  4JJB A;  3EFR A;  3OSV A;  4HA8 A;  3VYH B;  1N5Z A;  4AG1 C;  4RMO A;  2QQR A;  3PNW C;  3C4S A;  2KY9 A;  2BTT A;  5CKD A;  2BE9 B;  4FSS A;  1ZBJ A;  4EPC A;  4II1 A;  2DYB A;  2K7A A;  2ED1 A;  2YLC A;  2NUZ A;  5GAO r;  1W2B A;  3CXC S;  4BE0 A;  5GAM e;  2R58 A;  3F70 A;  1IHV A;  2DL3 A;  4XTZ A;  2HKN A;  5A0D A;  4JDS A;  2AT1 B;  1X69 A;  3KBG A;  4F14 A;  4MML A;  1HD3 A;  1ZHI A;  4AFQ C;  1NLO C;  1XTD A;  3H6Z A;  1M2V A;  4OMO A;  2RI5 A;  5FU6 C;  4AFU C;  1D1C A;  3FEO A;  3HRT A;  2VVK A;  1C1A A;  1GRI A;  4RTV A;  3OYB A;  2EYY A;  3HP9 A;  4B6M A;  3QHS A;  2FEI A;  3LH5 A;  3O8V A;  2KYM A;  2FVU A;  1BK2 A;  1UJ0 A;  2QQS A;  4N4I A;  1BIA A;  2L5Q A;  3MET A;  3M59 A;  5HY6 A;  3OMG A;  5LJ5 d;  3OA6 A;  3GF5 A;  4M7A F;  1WQ7 A;  3ZEH A;  2CP5 A;  3M0T A;  4OMN A;  4RTU A;  1VQO A;  1N6A A;  5KYU B;  1N27 A;  4BE1 A;  1G3Y A;  3OYL A;  1GXI E;  3PFS A;  4HVU A;  3OS5 A;  2Y4X A;  1JXO A;  1V29 B;  3G4S Q;  4XTW A;  1GCQ A;  2H3J A;  5C0M A;  4C0G A;  2YSQ A;  4M75 F;  1D09 B;  3KFV A;  5LJ3 f;  5IHI A;  1QW1 A;  1SEM A;  1RI9 A;  1PRM C;  1B07 A;  1YP5 A;  4RCB A;  1H3Z A;  2GCX A;  2J7I A;  4YTL A;  2C0T A;  5GAM f;  1NYG A;  4M75 E;  4M7D G;  3RBB B;  1WHM A;  4JZ3 A;  3CCR T;  1NJI U;  3MKD A;  4IIM A;  2F1L A;  1VQN T;  3E9G A;  4QQG A;  1V1C A;  1M3B A;  3JRZ A;  2GFA A;  2ZCF B;  1XQH A;  3M54 A;  4LE9 A;  1OZ2 A;  2CSI A;  1YJ9 A;  2EQI A;  1IGQ A;  1WXB A;  2J6O A;  2COY A;  2DK3 A;  4LDV A;  4M7D E;  2DKG A;  3MHX A;  4J6W A;  3MP8 A;  5D6W A;  2DL5 A;  5DY9 A;  1YI2 T;  2E41 A;  1WLP B;  2V26 A;  2VV5 A;  1ZA2 B;  2VC8 A;  4RTY A;  1Y96 A;  3LX7 A;  2L0A A;  2RJC A;  2D0Q B;  2W0Z A;  1ZX6 A;  2GTO A;  1VYV A;  2E1H A;  1WJQ A;  4AFS C;  3BW1 A;  2EWN A;  3NMZ C;  4OB3 B;  2RHY A;  2VXF A;  1YCS B;  3OQ5 A;  4KGX B;  3R6N A;  1RLQ C;  3I9Q A;  2DXB A;  2HAX A;  3I5R A;  2E64 A;  1Q86 R;  1K8A U;  5GMK j;  3JV3 A;  1VQP A;  4M77 D;  2QAS A;  1HXD A;  4CC7 A;  4F7U F;  1UEC A;  1YIT T;  2COZ A;  3VUB A;  2VWF A;  2EPD A;  2DO3 A;  3VKI A;  5LJ3 g;  1VOM A;  1VQL Q;  2FZK B;  5KYX A;  1I0C A;  3CC7 A;  1Q82 R;  4J9I A;  4A53 A;  1Y07 A;  3OYE A;  4N0A A;  3PMT A;  4IKF A;  4J6Y A;  1TWB A;  1GCQ C;  2V1R A;  4J9H A;  4C0F A;  4F7U B;  4FYX B;  5GAN f;  1CSK A;  3RER A;  4LXC A;  2JTF A;  5GJW B;  1LCK A;  1X6G A;  3RES A;  3NFC A;  4PKC C;  3TRE A;  2XMF A;  2DTH A;  4DEY A;  3JCM b;  3CCL Q;  2ED0 A;  4PJO E;  5LJ3 e;  3HPW A;  3CC4 Q;  2A28 A;  2HBP A;  4M7D C;  1Q95 G;  1BB9 A;  3TU4 K;  4BY6 C;  4X9C A;  2HZY A;  4KUD K;  1P92 A;  1XOV A;  3G7Z A;  5GMK h;  4FW2 A;  2JNG A;  2ZAE A;  1JRI A;  1IRX A;  1UTI A;  3CPW S;  4DBF A;  3CC7 Q;  2DD5 A;  4AFZ C;  3MPU B;  3JB9 D;  3M58 A;  4KGV B;  4A4K A;  3QKJ A;  4CC4 B;  1AOJ A;  4Z89 A;  5GMK i;  3NTI A;  1YCY A;  3QG1 A;  2JN0 A;  1M8V A;  5J26 A;  5FLX E;  4M75 G;  1Q81 U;  2DPP B;  3CC2 T;  4LDU A;  1VQP Q;  2XID A;  1SSF A;  2WAC A;  1MNE A;  2VGN A;  1KD1 U;  3JSC A;  4Z88 A;  2YHT A;  5FU7 B;  3CCU A;  4PJO D;  1PNJ A;  3UDC A;  4OGC A;  2EGE A;  3VJP A;  1HYO A;  5GAO q;  4ZN1 A;  4J9D A;  1ZBX A;  3PMI A;  3LW5 E;  3PIO A;  2AHJ B;  2HQE A;  2LQN A;  2I2L A;  3JAM E;  1NM7 A;  2MMP A;  1UUE A;  4EDU A;  1UJY A;  1Q82 U;  2YDL A;  1FWZ A;  3I56 Q;  4HCK A;  2RJD A;  3ME9 A;  2DZC A;  3J81 E;  3CBP A;  4L59 A;  3EH2 A;  3LWI A;  3GOX A;  4BDY A;  1BIB A;  2HSE B;  4LD6 A;  2HD0 A;  2MWO A;  1YIJ A;  4M4Z A;  4PJO C;  2QYZ A;  4QT7 A;  5CKB A;  1IB8 A;  1JBM A;  3QJY A;  3M0R A;  2SRC A;  1IZ6 A;  1TH7 A;  5LJ3 d;  3M9Q A;  2EYX A;  3M0S A;  1MV3 A;  4M75 B; 
#chains in the Genus database with same CATH homology
 5GAM h;  2ZPH B;  3G4S A;  4C5G A;  5LJ5 h;  2LNV A;  3C12 A;  3HHT B;  2JOY A;  3OY9 A;  1NJI C;  2O4X B;  1MHN A;  2XKO C;  4OMF B;  3DLM A;  4XU1 A;  3SWN C;  2X4W A;  4OP0 A;  4ELZ C;  4EMK A;  3QBY A;  2DD4 A;  3T9N A;  2XD0 A;  4PJO B;  2EFI A;  3MP1 A;  4M77 F;  4M78 A;  5EG2 A;  1U1S A;  2K5I A;  1B34 B;  4BY6 B;  1KD1 C;  3X26 B;  2DZ9 A;  2P0Q A;  3LYI A;  4OB0 B;  4C8Q A;  2LRQ A;  4XTU A;  4C92 D;  4L5G A;  1RI0 A;  4BE2 A;  1VQ7 A;  4BI8 B;  2JVV A;  1WJS A;  4QQD A;  3SB2 A;  3CCR A;  5CKH A;  3PTA A;  2FB7 A;  2YRV A;  4QVD A;  4XTY A;  4E7L A;  1M1K U;  1KQ2 A;  1WPY A;  4M7A B;  3OYD A;  2RB6 A;  2RHZ A;  3RKY A;  3M55 A;  3LLR A;  4ELY C;  1KHI A;  1N8R C;  5CK9 A;  4ZTJ A;  2C06 A;  3JB9 F;  2PVO B;  3RMQ A;  3FRN A;  1BYM A;  5GAN 3;  2MI6 A;  4FT4 A;  1M1G A;  3EAE A;  4FL6 A;  4E7J A;  1YJW T;  2RO0 A;  3QZ9 B;  4MZM A;  4A4F A;  3DB4 A;  2E70 A;  4M77 B;  5FRN A;  2ZPI B;  1W2B S;  1YI2 A;  1PSE A;  3OYM A;  3ZFJ A;  2RI3 A;  4FM4 B;  3JCM J;  3JB9 J;  4CI0 C;  5KCH A;  1S72 A;  1WNL A;  2DEQ A;  3URG A;  2DJZ A;  1QVG S;  3I56 A;  5I2M A;  2IG0 A;  2KVQ G;  2HQX A;  2PUK B;  1ZQ1 A;  3ASK A;  3H8Z A;  5FU6 B;  1VQ9 A;  4KT0 E;  4M7A D;  3CCE A;  2RHU A;  1I4K 1;  1X6O A;  1JB0 E;  1MGQ A;  4N4H A;  5LJ5 e;  4JRP A;  2RM4 A;  3OYH A;  2XDP A;  2V8J A;  4IUV A;  1QVG A;  2LTO A;  2NLU A;  3CCV A;  3OBW A;  4IUR A;  5KCO A;  3CCJ A;  4Y28 E;  4M7D D;  2Y90 A;  5J39 A;  1VQ4 A;  3MEV A;  2K5L A;  2ZGW A;  4PLI A;  1D3B A;  2MAM A;  1G3W A;  2E10 A;  3VU3 C;  3JB9 G;  1LNX A;  3JCM X;  2B8A A;  2LT4 A;  2OTJ T;  3V8J A;  2LT1 A;  2JTM A;  5CVI A;  3FJP A;  3CCL T;  2XU8 A;  3EFR A;  3A8G B;  3A8H B;  3OSV A;  4HA8 A;  3BDL A;  3OS0 A;  2QQA A;  3VYH B;  2F69 A;  1IRE B;  2DIG A;  2JUF A;  1M1K C;  3I55 T;  5GMK e;  4RMO A;  5GMK m;  4Q5W A;  2QQR A;  3PNW C;  5GAO m;  3C4S A;  2KY9 A;  3V7R A;  1M90 U;  3CME T;  4M78 D;  5CKD A;  3EFS A;  2QDY B;  1VQ7 T;  3OYI A;  2KAF A;  4JLG A;  3CMA A;  4M7A G;  1KG1 A;  4EPC A;  3OMC A;  1G5V A;  4J83 A;  2WSF E;  2PQW A;  3A8L B;  3CBO A;  4DOV A;  4JRK A;  4F7U E;  2LVM A;  4II1 A;  1YHQ A;  1YJN A;  1WGS A;  2YLC A;  3QUI A;  5KE2 A;  3V7C A;  4BI3 A;  3CC7 T;  3J7A F;  3E19 A;  2K57 A;  3GPL A;  4N4G A;  4C5I A;  3CCS T;  1KQ1 A;  5GAO r;  1I8F A;  1QVP A;  3M4G A;  1W2B A;  3VYG A;  2V8I A;  3CXC S;  3CCS A;  4A4G A;  4BE0 A;  1KQS S;  5GAM e;  2GQV A;  2R58 A;  3F70 A;  1N9R A;  5DLQ E;  5C6S A;  4M7A E;  4FSX A;  4XTZ A;  1Y71 A;  5A0D A;  3M56 A;  3JCM e;  1H64 1;  3GIB A;  2WSE E;  3A5Z B;  4JDS A;  4M78 E;  3QSU A;  2P0K A;  4PNO A;  5L8R E;  1VQK A;  1UGP B;  3KBG A;  1K73 U;  3J80 E;  1K9M C;  2XG8 D;  4MML A;  1ZHI A;  2V8K A;  2E5Q A;  4LDX A;  4PL6 A;  2PVD B;  4HCB A;  3HFO A;  2ZPF B;  4EMK B;  3G6E T;  1R8O B;  1XTD A;  1YJ9 T;  4M77 A;  3H6Z A;  4QVC A;  4QVZ A;  2D6F A;  3HSB A;  3CCV T;  2RI5 A;  5FU6 C;  3X20 B;  2R5M A;  4FU6 A;  3LH0 A;  3CMA T;  1M9S A;  3FEO A;  1QVF S;  2JZ2 A;  3QJ6 A;  2XI9 A;  5DM7 R;  3HRT A;  4OVA A;  4C92 C;  1M90 C;  4C0D C;  5GAN j;  2XK0 A;  4PLL A;  1O75 A;  4J5Y A;  1BI3 A;  3BY7 A;  2RI2 A;  2E6N A;  3OYB A;  2O01 E;  3HP9 A;  3G71 A;  3QHS A;  3O8V A;  4JRI A;  4A4H A;  2EQU A;  3TCJ A;  2FVU A;  3L2Z A;  5GAM j;  5HK3 A;  2BKD N;  5GMK l;  2M9U A;  2QQS A;  3BFM A;  4J7I A;  4N4I A;  3JCM P;  1BIA A;  2FL7 A;  2KK4 A;  3WVD B;  2L5Q A;  4XAX B;  5FRM A;  2QQB A;  3MET A;  3L2U A;  2ZPG B;  4M7D F;  1VQK T;  4C92 A;  2IVW A;  3M59 A;  3OMG A;  5HY6 A;  4M77 C;  2QI2 A;  3L2W A;  3S3O A;  5LJ5 d;  3OA6 A;  4PJO A;  5I21 A;  1BI1 A;  3C94 A;  3OYF A;  5CKE A;  1U1T A;  3DKM A;  3HRS A;  2RA2 A;  2VGM A;  3MEW A;  2CKK A;  2EQK A;  3GF5 A;  3G6E A;  1OZ3 A;  5LJ3 h;  3OW2 A;  4M7A F;  1WQ7 A;  3ZEH A;  5HKC A;  2OAU A;  5CCA A;  4XTX A;  1NZ9 A;  1UGS B;  2E12 A;  4P5N A;  4EMH A;  4C92 B;  4F7U A;  3QXE B;  3OSS C;  5GAN 2;  5IT9 E;  3M4Y A;  3CPF A;  5GAN 5;  4KUI A;  2QEX T;  1YIT A;  3CC4 T;  1KHC A;  3HFN A;  2K3X A;  1VQO A;  1N6A A;  5IAY A;  1N27 A;  1FXX A;  2P0P A;  3RIR A;  4BE1 A;  1Q86 U;  3WXM B;  1G3Y A;  3OYL A;  1GXI E;  1UGQ B;  4A54 A;  2M16 A;  3PFS A;  1G3S A;  3OS5 A;  1BI2 A;  2Y4X A;  5GAN 7;  4RG8 A;  1V29 B;  2GFU A;  4BD3 A;  2K5F A;  4X9D A;  4XTW A;  1DJ7 B;  3VV0 A;  2H3J A;  3CEY A;  3G71 T;  4M75 D;  1M1F A;  2XDD A;  5C0M A;  2LCL A;  3INZ A;  2OTL T;  4ZGJ B;  2A3L A;  3JCM Q;  2DXT A;  2L8D A;  4MZP A;  4C0G A;  2RJE A;  4HT9 A;  4M75 F;  3FC3 A;  4QQ6 A;  1QP2 A;  4M78 G;  3AHU A;  5LJ3 f;  4C92 F;  2KMT A;  2MF2 A;  5KH6 A;  2K4Y A;  5M9O A;  4JS4 A;  4M75 A;  1QW1 A;  5LJ5 f;  4DA4 A;  3P8B B;  1KQS A;  4M78 F;  4D6W A;  4Z02 A;  3RMS A;  4RCB A;  1H3Z A;  2GCX A;  3JCM W;  3R6O A;  4YTL A;  2DXU A;  2R57 A;  4IUT A;  4L6V 5;  5GAO p;  5GAM f;  1VIE A;  3S6W A;  2EJF A;  3V8K A;  4M75 E;  1N8R U;  3QDR B;  3PGG A;  1W4S A;  3MCA B;  3PT9 A;  3CXC A;  3CD6 T;  4M7D G;  3CME A;  3JCM f;  3CCR T;  1EIF A;  3BDU A;  2QEX A;  2ZPE B;  3X24 B;  1NJI U;  4NS5 A;  1VQN T;  3E9G A;  4QQG A;  1YIJ T;  4OGE A;  2LDM A;  4C8Q B;  4M77 E;  4GLK A;  4DOW A;  4Y91 A;  3JRZ A;  2EIF A;  2GFA A;  2ZCF B;  1XQH A;  1VQ5 A;  3M54 A;  3FB9 A;  3NTH A;  1OZ2 A;  3M57 A;  5GAN 6;  2CS7 A;  4VUB A;  1YJ9 A;  2X4X A;  3JB9 I;  5CKF A;  3V7S A;  4IUU A;  4KUL A;  3X28 B;  4A4E A;  5LJ5 j;  1VQ8 A;  2DK3 A;  4LDV A;  3V8L A;  4M7D E;  4XU0 A;  2DKG A;  3SFM A;  5LJ3 j;  4M78 B;  2EYQ A;  3MHX A;  4J6W A;  3MP8 A;  3RKW A;  4B9W A;  1NPP A;  5D6W A;  3FIF A;  4XU2 A;  2DTO A;  2VYT A;  1NPR A;  4QW2 A;  4KBM B;  5DY9 A;  1VQO T;  2F5T X;  1YI2 T;  2E41 A;  4XK8 E;  4XQ3 A;  4C8Q E;  4LDY A;  2VV5 A;  5GAN e;  3OS1 A;  3SD4 A;  4PJO F;  2VC8 A;  4MZT A;  3I56 T;  1Y96 A;  3LX7 A;  5GAN 8;  3CCE T;  2RJC A;  3LGL A;  4JUV A;  1QVF A;  1FX7 A;  2D0Q B;  4EMG A;  1UGR B;  2L89 A;  3OYA A;  4E7H A;  4TVR A;  2KSS A;  4M7D B;  5IN1 A;  2E1H A;  5A0L A;  4RCC A;  1WJQ A;  5HK0 A;  1VQ4 T;  2WSC E;  2BIV A;  3BW1 A;  5CIU A;  2EKO A;  1VQ6 A;  2RK2 A;  2RHX A;  3CBM A;  1UB4 A;  2EWN A;  3MEU A;  4OB3 B;  2RHY A;  2VXF A;  3WVE B;  3HRU A;  3VUZ A;  2LQ8 A;  3OQ5 A;  1Q7Y C;  2QA4 A;  2X4J A;  3GP8 A;  3QO3 A;  4HT8 A;  2DXB A;  2LX9 A;  2HAX A;  3A8O B;  5CO7 A;  2QA4 T;  2E64 A;  2LCC A;  4DQ2 A;  1Q81 C;  1K8A U;  5GMK j;  4MMK A;  2CYZ B;  3I55 A;  1VQ8 T;  1BI0 A;  2EQM A;  1VQP A;  4M77 D;  4J6X A;  2CZ7 B;  5D6X A;  2RD1 A;  4ZN3 A;  1HXD A;  5GAN g;  3FLG A;  4F7U F;  2CZ1 B;  4NL2 A;  1YIT T;  3L42 A;  3TEE A;  5DLO A;  5D6Y A;  3VUB A;  1WQW A;  5GAO l;  3OYN A;  1KC8 U;  3FDR A;  3NTK A;  1VQN A;  3MP6 A;  3UPU A;  2X35 A;  3KUF A;  2DO3 A;  5LJ5 g;  4JRQ A;  3VKI A;  3OS2 A;  1S72 T;  2KDS A;  1VQM T;  5LJ3 g;  3A8M B;  3OYG A;  3MEA A;  3HKS A;  4RKU E;  1VQ5 T;  2DIQ A;  2M0O A;  3E9F A;  3JCM c;  3CC7 A;  2DAQ A;  3DB3 A;  4A53 A;  1Y07 A;  2DTI A;  4UC4 A;  2A7Y A;  2DVE A;  2VXE A;  4X34 A;  1D3B B;  4E47 A;  4GY5 A;  3OYE A;  1JJ2 A;  4NL3 A;  2L3R A;  4N0A A;  2OTL A;  3PMT A;  3GNG A;  3E1S A;  3HL8 A;  4IKF A;  1O9S A;  3C95 A;  4J6Y A;  3PIP A;  3CD6 A;  1WJR A;  2OTJ A;  1Q7Y U;  4C0F A;  1OI1 A;  2LC4 A;  4M77 G;  4F7U B;  4JJN K;  5GAM g;  1LOJ A;  2BUD A;  3CCQ A;  1KC8 C;  4FT2 A;  5GAN f;  3RER A;  1B34 A;  2JTF A;  3GNF B;  4ME7 A;  3UT1 A;  2XHC A;  3JCM g;  3RES A;  2VUB A;  2CGH A;  3NFC A;  1HK9 A;  5GAN d;  5A0G A;  2R5A A;  2PVG B;  4PKC C;  4XTV A;  3DLL A;  3JB9 H;  2K3Y A;  3M53 A;  3TRE A;  2PU9 B;  2DTH A;  4M7A C;  1M4Z A;  3JCM b;  3QYH B;  5I2S A;  4PJO E;  5LJ3 e;  2QXF A;  3HPW A;  2EJ9 A;  4OF1 A;  3RUX A;  1VQ6 T;  4MDW A;  4OB2 B;  2RJF A;  3JCM h;  2HBP A;  4M7D C;  2M1H A;  1VQL A;  3TU4 K;  3CCM A;  4BY6 C;  5A2Q E;  4X9C A;  4V2S A;  2DXC A;  4HCC A;  4KUD K;  1P92 A;  3L1A A;  3QPH A;  4PJO G;  4R56 A;  2F5K A;  5CQX A;  1XOV A;  2HNI A;  3G7Z A;  4O5V A;  3GLX A;  5GMK h;  5GAO n;  4F7U G;  1VUB A;  2JNG A;  4B9X A;  1G3T A;  4E7I A;  3G4S T;  3KXT A;  4LD9 K;  1JRI A;  1YJW A;  4N0A C;  4BB7 A;  4JS5 A;  2RH2 A;  2G3R A;  2FYK A;  5KE3 A;  3CPW S;  2D9T A;  4JLI A;  3CPW A;  1BKB A;  4M7D A;  2Y4Y A;  2DD5 A;  2P4T A;  4J8O A;  3M58 A;  4A4K A;  3JB9 D;  1QP3 A;  3QKJ A;  2QQ9 A;  4BI4 A;  4MDX A;  4IUP A;  2ZPB B;  3JCM V;  5GMK i;  4CRI A;  2EAY A;  3NTI A;  1YCY A;  2GF7 A;  4C5H A;  5CR2 A;  3QG1 A;  2JN0 A;  4NOY A;  5J26 A;  3X25 B;  5LL6 S;  4C8Q D;  1M8V A;  5FLX E;  2K2V A;  4C0Z A;  2ZZD A;  4M75 G;  4ATO A;  1I5L A;  3N5B B;  5J3B A;  1Q81 U;  2DPP B;  1JJ2 S;  1I81 A;  1X75 C;  3OYC A;  4WF2 A;  3CC2 T;  4LDU A;  2XID A;  3CC2 A;  5FRO A;  1SSF A;  1LJO A;  2WAC A;  1KD1 U;  2VGN A;  2LQK A;  4O6J A;  5CAI A;  3JSC A;  3OYJ A;  2YHT A;  4XU3 A;  5FU7 B;  2E6Z A;  3CCU A;  4PJO D;  4BAC A;  1VQL T;  3CCQ T;  3UDC A;  4OGC A;  3CCM T;  1AHJ B;  3UWN A;  2QTX A;  1K73 C;  1K9M U;  3MO8 A;  3QZ5 B;  3VJP A;  1VQM A;  5GAO q;  2RHI A;  4ZN1 A;  1VIF A;  4ZTF A;  5CQY A;  3OW2 S;  2EQJ A;  1VQP T;  2RK1 A;  1ZBX A;  3P8D A;  3QYG B;  3PMI A;  3LWH A;  3LW5 E;  3PIO A;  2AHJ B;  3L2R A;  1PSF A;  3M5A A;  2HQE A;  3RKX A;  3Q1J A;  1Q86 C;  5AYF A;  2I2L A;  3CCJ T;  3JAM E;  1UEB A;  2CZ0 B;  4BDZ A;  3OYK A;  2MMP A;  3ER0 A;  2MWP A;  4RG2 A;  4EDU A;  1Y96 B;  1VQ9 T;  1Q82 U;  1YHQ T;  4M75 C;  3OBY A;  1M5Q 1;  3S3N A;  3CCL A;  2YLB A;  4M78 C;  3S3M A;  1FWZ A;  4FIB A;  1RL2 A;  3LGF A;  4E7K A;  3OB9 A;  4R55 A;  4C5E A;  4C0D B;  2XIC A;  4C92 G;  2RJD A;  1U8R A;  4HCZ A;  1X01 A;  3ME9 A;  2DZC A;  4ZGE B;  3J81 E;  1Q82 C;  2O4X A;  3CC4 A;  3ZBD A;  2EJG A;  3L2V A;  3JCM d;  2CZ6 B;  3CBP A;  4L59 A;  1YBY A;  3LWI A;  1OYX A;  2KQW A;  3QII A;  3CCU T;  3OYY A;  3GOX A;  4HKE A;  4BDY A;  1BIB A;  4J7F A;  1NE8 A;  4LD6 A;  3SDZ A;  2HD0 A;  3SWN B;  1XNI A;  4C8Q C;  5GAM d;  1K8A C;  2MWO A;  1YIJ A;  4OB1 B;  3SWN A;  1Y7X A;  4ZGD B;  4M7A A;  2X4Y A;  4PJO C;  4EMK C;  5GAN 4;  5CKB A;  1YJN T;  1JBM A;  4LDW A;  3QJY A;  5GAN h;  3P8H A;  2FHD A;  4C92 E;  3L2Q A;  1N9S A;  4C8Q G;  1IZ6 A;  1TH7 A;  5LJ3 d;  2XDB A;  3M9Q A;  4C8Q F;  2E65 A;  5FU7 C;  4IUQ A;  4BUG A;  2PUO B;  4M75 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...