4TVRA

Tandem tudor and phd domains of uhrf2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
273
structure length
222
Chain Sequence
TSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRADEDVIYHIQYDEYPESGTLEMNVKDLRPRARTILKWNELNVGDVVMVNYNVESPGQRGFWFDAEITTLKTISRTKKELRVKIFLGTLNDCKIISVDEIFKIERPGAHPLSFADGKFLRRNDPCDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVAYHIYCLNPPLDKVWYCPSCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase UHRF2
publication title Structure of the Tandem Tudor and PHD domains of UHRF2
rcsb
source organism Homo sapiens
total genus 38
structure length 222
sequence length 273
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
A PF12148 TTD Tandem tudor domain within UHRF1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4tvrA02
2G3RA 3CC4T 1VQ7A 2DO3A 1YIJT 3CC4A 2JNGA 1KD1U 1YIJA 1YBYA 2MWOA 3G71A 1YJ9T 2LCLA 1YJ9A 1QVGS 1KC8C 3CC2T 1Q7YU 3CC2A 1K9MU 1VQ4T 3J7AF 3I56T 1IZ6A 1VQ4A 3I56A 3CMAA 3CCST 1M1KC 1YJWT 1K73C 1NPRA 4X34A 1VQ9T 3CD6T 2OTJT 3CCMA 1YJWA 1K8AU 3CD6A 2OTJA 2LVMA 2OTLT 3CC7T 2KVQG 1NJIC 3CMET 3CC7A 3CMEA 2EIFA 3OW2A 2JOYA 4CRIA 3G71T 3I55T 5IAYA 3I55A 2E6ZA 1NPPA 3PIOA 1Q86C 1VQOT 1VQOA 1SSFA 3J81E 1VQKT 1VQ8T 1VQKA 5IT9E 3OW2S 1VQ8A 1VQ5T 1YHQT 3CMAT 4YTLA 5J3BA 3CCRA 1VQ5A 1YHQA 5LL6S 1M90U 2KDSA 1KHIA 5FLXE 3CCMT 1Q81U 3CCVT 3CCVA 3KBGA 1VQ7T 1VQ6T 3CCEA 3G6ET 3A5ZB 1N8RU 1VQ6A 3G6EA 1YITT 1YJNT 4ZN1A 1YITA 1YJNA 3CCUT 3PIPA 1KD1C 5HY6A 1NZ9A 3CCUA 2JVVA 1VQMT 1KQSA 1S72T 3OYYA 1VQMA 1Q7YC 1S72A 1K9MC 3HKSA 2IG0A 3CCQA 3CCRT 1VQPA 1W2BA 1K73U 3P8BB 1XNIA 3CXCA 3J80E 3CPFA 3DB3A 1Q82U 1VQLT 2QA4A 1VQLA 1XTDA 1EIFA 1YI2T 1NJIU 1UEBA 1KQSS 4RG2A 1Q81C 1K8AC 1YI2A 4TVRA 1QVFA 4QQDA 3CCET 3LGFA 2CKKA 3CPWA 3CCJA 1VQNT 3DB4A 2QEXT 3TREA 3DLLA 1W2BS 1N8RC 2MI6A 3CXCS 1VQNA 3LH0A 2QEXA 2MWPA 1JJ2A 2XHCA 1Q86U 4ZN3A 1KC8U 2E70A 5DLQE 1QVFS 3CPWS 1BKBA 5J26A 5DM7R 3CCQT 3CCLT 1VQPT 1M1GA 5A2QE 3CCSA 3G4ST 1M1KU 1JJ2S 2JUFA 3ER0A 2LQ8A 3CCLA 3G4SA 1X6OA 1RL2A 3JAME 2QA4T 1Q82C 1VQ9A 1M90C 1QVGA 2OTLA 3LGLA 2L3RA 3CCJT
chains in the Genus database with same CATH superfamily
3CC4T 1ZHIA 3E9FA 3TCJA 3OYJA 1KD1U 1PG5B 3G71A 4OB1B 2PZ1A 3PMTA 1H641 1KK7A 1R77A 1W70A 1WNLA 3M5AA 1NPRA 2L89A 2GFAA 1VUBA 4KULA 1SRMA 5DLOA 3PTAA 1BCMA 3E9GA 1RAAB 3JCMf 1I5LA 4XTXA 1NLPC 3G7ZA 4C0GA 1R0CB 4IUPA 5KYUB 1H8KA 1MNEA 3CMAT 4EMKC 5HK0A 1YHQA 1IO6A 1ZBJA 2QA4Q 1UHCA 1AWOA 1TUCA 4OF1A 4L5GA 4QVCA 4CI0C 4LUEA 3MPUB 3M53A 4N0AA 1N8RU 1X75C 2LNVA 3I5RA 4NL3A 2LQKA 1MMDA 3S6WA 5FU7C 4MDWA 1NYGA 2LJ3A 2DXCA 3SDZA 2VV5A 3VJPA 1XNIA 3J80E 1LNXA 2LJ1A 1Q82U 4KH0B 1RUWA 1BU1A 2QA4A 1XJWB 1NJIU 4ATOA 4E7HA 3CCET 4M77F 2FZGB 1VQNA 5CKHA 1X69A 2A7YA 1IHVA 1QVFP 4E6RA 1QCFA 3GBQA 2H3JA 3IQLA 2PU9B 4EPCA 4Y28E 1M1KR 4AG1C 4QKUA 3SB2A 3CPWS 1JO8A 3RKYA 5A2QE 3CMAQ 2JUFA 4IUVA 3EFOA 1GRIA 3HHTB 1YWPA 4KT0E 2LP5A 5CKDA 4ELYC 5LJ3e 1YN8A 1TU0B 2FG0A 2MIOA 4OB3B 2NUTB 1BI0A 2EWNA 5GANg 4PJOB 4GLKA 2MOXA 2M16A 3I56T 3LX7A 2FYKA 3CMAA 1D1AA 2X4JA 2K5LA 3OA6A 2R5MA 3EG9B 2DXTA 2XDBA 2HQHA 3TU4K 1N6AA 3CCEQ 4AFSC 2EKHA 1M3BA 2K3YA 4M7AD 2KQWA 2DILA 1M3AA 4OMNA 5LJ5d 2DRMA 2FVUA 4F7UE 4BUGA 1D09B 4OMOA 5J39A 1QP3A 2KDSA 4PJNA 4XTUA 2DL3A 2DNUA 2NUZA 8ATCB 4C5IA 3OBYA 5KYYB 2RHYA 3CCEA 4OP0A 1NG2A 2LCSA 3OYEA 2YUNA 4C5HA 4ZN1A 2EQIA 5KYNA 2HSPA 2COYA 3UWNA 2VASA 1FWZA 4GBQA 2E41A 4FSSA 2KSSA 3I56Q 2HSEB 2IIMA 4N4IA 4PKCC 4M75B 2ZPFB 2CUBA 2GTJA 1QVFA 4PFOA 5GANe 4AFUC 2MI6A 3LH0A 4C92D 3X20B 1YIJQ 1KC8U 1GBQA 2JTEA 2QDLA 2YRDA 3QYHB 3PMIA 3CC2Q 3EGUA 1VYTA 2M51A 2BZXA 2P84A 1R8OB 2VC8A 4HVUA 2P0PA 4AG2C 2QK0A 1PSFA 4C8QD 1YIJA 2D1XA 2KNBB 5I2MA 3MP1A 1ABQA 4RUGA 3OYBA 5CKBA 4PNOA 2M0OA 4HXJA 3CC2A 3PFSA 2HL3A 4L59A 2I0NA 4M7DA 2VXEA 2QQSA 4X34A 1ZLMA 1OEBA 3QO3A 1RABB 2E5QA 4Z02A 3C94A 2R57A 1PM3A 1KD1R 4WCIA 2PNIA 1VQ6Q 3EG1A 3G6EQ 4C0DC 1K0SA 4M7AF 1YITQ 4EMKB 3JCMV 1D0XA 3QBYA 4F7UG 2EJ9A 1VQKT 4ORZA 1BI2A 1OX8A 3KUFA 2QI2A 2QQBA 3LH5A 4M78A 4KUIA 1KHIA 5FLXE 4J9HA 4IIMA 3VYGA 5I21A 2WACA 4FW1A 3LWIA 1W2BP 3CCVA 2LT4A 4IURA 2A28A 4KH1B 1VQ6A 2CS7A 2K7AA 5FU7B 3G6EA 5DY9A 4JJCA 2E1HA 3AHUA 1NM7A 5CKEA 1YITA 4C92A 2RJDA 5GAMd 4ELZC 3H0IA 4RKUE 2ZZDA 3BFMA 3CCRT 4M78F 5GJVB 4LDXA 3KFVA 2K6DA 2PVGB 2DFUA 4DBQA 2LQWA 3MP6A 2RHXA 2RHZA 3ZL7C 3O8VA 1IREB 3HRTA 3EG0A 2O4XA 2AZVA 4PL6A 3E2UA 4C92F 1SG5A 1NBEB 4MZMA 1JEGA 4F16A 4DQ2A 4BE0A 3ER0A 4JRPA 1NJIR 5LJ3h 1G3TA 4OGCA 3SFMA 4AT1B 2XDDA 2L3RA 3M56A 1MUZA 2DMOA 3JB9I 1ZSZC 3NTKA 3CMEQ 2DERA 3X26B 1X43A 4C8QF 4B9XA 1YJ9T 3HP9A 3TEEA 3M4GA 1M8VA 4Z89A 1VQ4T 3JCMJ 2KXCA 3WVEB 3CCRQ 1UFFA 2X35A 1D1CA 1N27A 2J6KA 1JXOA 4JZ4A 1C0MA 1SEMA 3CMEA 2EIFA 1WQ7A 3I55T 2LZ6B 5LJ5h 1M3CA 1YJNQ 2QQRA 2CT3A 2KYMA 3DKMA 4UC4A 1M90R 3RERA 1AEYA 3CCRA 3QJYA 1JRIA 1O9SA 4FU6A 1ZUYA 5GAOl 5CVIA 3ZFJA 3KBGA 1X2KA 4NOYA 1VA7A 2L8DA 1WX6A 5AYFA 1YJNA 4RTVA 4AFQC 3M0UA 1YJ9Q 1KQ2A 1DJ7B 2GQIA 3QJ6A 1Q7YC 1JJ2P 1BYMA 2VXFA 1QCOA 2CP3A 3HTRA 2F5TX 2PVDB 3MCAB 5D7UA 1UEBA 2MPXC 3VU3C 4TVRA 1C6VX 3CPWA 2A36A 2CGHA 1SRLA 1M27C 2L3PA 4ZN3A 1AT1B 1M2OA 2E70A 3REBB 4EIKA 2O88A 2CH4W 4MDXA 3RIRA 1M1KU 1BI1A 2KMTA 3C4SA 1QWEA 3QZ9B 2XIDA 2XMFA 3EH1A 2DD4A 1OV3A 2E12A 5I22A 4N4HA 3VS4A 1V29B 3M4YA 2HQXA 1IZ6A 3WXMB 1Y96A 3MEVA 1SHGA 4RCBA 1YJWT 2A0FB 4BB7A 5IH2A 3M59A 3TSZA 2F1LA 4E7LA 2LVMA 3DLMA 3SD4A 3H41A 2XU8A 2MAMA 1PRMC 5GAMf 2QGFB 1VQ8T 1LJOA 2K79A 3A8LB 5GAOm 2EAYA 2JXBA 4PJOC 5KE3A 2PUOB 2L2PA 2EQJA 2RM4A 3TVTA 2DJZA 3RR6A 3CXCP 2FEIA 3S3MA 1K1ZA 3JB9G 1AHJB 2EPDA 5GAN3 1M5Q1 3RDVA 3H0FA 1NZ9A 2L3QA 1YWOA 2M0YA 1HD3A 1WXTA 4C5EA 3UT1A 1VQMA 5L23A 2DXBA 2PUKB 2RI3A 1QMCA 1WA7A 3P8BB 2VWFA 3V8LA 1E6HA 2X4XA 1WLPB 4HCBA 4PJOE 3MP8A 2E4HA 1GL5A 8AT1B 1RI0A 4N4GA 3FIFA 2QTXA 3EFRA 1T0JA 5HCKA 3URGA 3P8DA 2X4YA 2YRVA 2G6FX 3L2WA 5CO7A 2CREA 3PT9A 4DEXA 3G4ST 4OMPA 2KT1A 3RKXA 1TWBA 4L6V5 1Y07A 2DL4A 1ZSZB 5GAN2 4DA4A 1M90C 2XI9A 5KYXB 1M2VA 4PFPA 3PVQA 1Y7XA 4LD6A 4M75C 4B9WA 3X28B 2HD0A 4ZTJA 1K9MR 2LCLA 1QWFA 2DEQA 1Q7YU 1YFNA 2CP2A 2M9UA 4PK4A 3LLRA 4XTZA 4A63B 1MMNA 2RK1A 2K9GA 2BZYA 3FB9A 4KGZB 2MCNA 1F1BB 1QP2A 2KVQG 2KEAA 2FRWA 2GFUA 4OVAA 5IN1A 4M75E 2HZYA 4GY5A 1GFDA 1KFZA 5IAYA 2O2OA 4BDZA 2H8HA 3OS5A 5FU6C 2ZPEB 3OYKA 4QT7A 1OOTA 2R5AA 4MMKA 5LL6S 4BE2A 1KQSP 1D3BB 3AT1B 3ASKA 4JJBA 2J6OA 1WPYA 4ME7A 3A98A 3OYGA 4N0AC 4JDSA 3CCUT 2JS0A 2OAUA 3CBMA 5LJ3g 1NYFA 2CZ7B 5D6XA 2AIRB 2LT1A 1RLQC 2DL7A 2K3XA 2ZAEA 3T9NA 5CR2A 3DB3A 4PJOG 1D1BA 1IXDA 3VS2A 2YDLA 3VS5A 1W4SA 3CQTA 3E1SA 4M77A 1W2BS 4KGVB 2DA9A 3JCMh 1VQ7Q 3JCMX 3CC4Q 2YLBA 3EGXB 2QASA 4HVWA 2ROLA 2FZKB 4MZPA 2DVJA 4V2SA 1CKAA 2OX7A 4RTTA 1WIEA 3NHNA 2QDYB 1I8FA 2CP6A 2XG8D 5LJ5g 1OPLA 3OQ5A 2R58A 2DM1A 3HSBA 2CP7A 1VQ7A 2JTMA 3G1JA 3CC4A 4OGEA 4A4GA 5KH6A 3FJ5A 4RTUA 3J7AF 3I9QA 5IHKA 2RMOA 5FWBA 3CD6T 4HT9A 5LJ3j 4BDYA 4B6MA 2NUPB 5I2SA 4E7IA 2L0AA 2KK4A 4M75G 2LJ0A 1PRLC 1RAFB 1VOMA 2CZ6B 3SWNA 4A4HA 2K57A 2DKGA 5GMKl 3PIOA 1VQOT 2JM8A 1N5ZA 2VUBA 3J81E 4OMFB 1B34A 1M90U 1G2BA 4RCCA 1RAGB 1WDXA 2QG9B 2RF0A 3QG1A 1VQ7T 2RJFA 1OQKA 1JU5C 1G5VA 1GCQA 3MEWA 1ACMB 3VS0A 3HFOA 3FC3A 5IXFA 3ME9A 1S72T 1SKUB 1K9MC 3GIBA 4J9IA 4A54A 5LJ5e 2RQWA 3GOXA 2ESWA 4X9CA 2CZ0B 2DETA 4JLIA 2JZ2A 3V7SA 1EIFA 3CD6Q 1YI2T 2LQNA 1Q81C 1I07A 1YCYA 3NTIA 3LGFA 3ZEHA 4RMOA 2MWPA 2XHCA 3EHQA 4DOWA 2RPNA 2LRQA 1WJQA 5DLQE 2BKDN 2F2VA 4C5GA 3V7CA 1PWTA 3A1PA 2ECZA 4A4EA 1WFWA 1JJ2S 2HMAA 4J9DA 1FMWA 1ZUKA 4E7JA 1A0NB 1HYOA 2X3XD 5GANj 5GMKe 4ZTFA 4P5NA 5GJWB 1AVZC 2A3LA 2DX1A 1O75A 2V8IA 2C0TA 4F7UF 2DYIA 1W1FA 2DIQA 4Y91A 1PKTA 4MMLA 1PSEA 3OYLA 4PFZA 5CKFA 1G3WA 1WXBA 3I56A 1BCOA 1K73C 2OTJT 4M7DC 2CUDA 4XTVA 3CC7T 1YI2Q 3ZBDA 1FX7A 2HCKA 2VGMA 2JMAA 5FU6B 1RACB 3A8OB 4KRTA 5GMKm 1Q7YR 3X25B 1KJWA 4M7AA 3OYHA 1IRXA 4PJMA 3RBBB 5IHNA 1VQ5T 2EGEA 1WQWA 2V26A 4CC7A 4M78C 5GAN8 2W0ZA 4M7DE 1UJYA 4X1VA 4A53A 5M9OA 3UA6A 4JZ3A 4CC2A 3OYMA 3P8HA 2KR3A 5HY6A 2E64A 2XKOC 4J9FA 2CT4A 5FWCA 1WJRA 2F2XA 6AT1B 3HKSA 3V8JA 2VYTA 2B86A 3A8MB 3META 1WHKA 1X6GA 4M78E 1QCNA 3V7RA 2AZSA 3CC7Q 1Q86R 2WSEE 3EAEA 2JM9A 3CXCS 3UPUA 4JRKA 1MGQA 1WZOA 2DD5A 5CAIA 4KUDK 4JJDA 1GBRA 1UG1A 3H0HA 2AHJB 1I81A 3EFOB 1I1JA 4F14A 3M54A 1V1CA 3JAME 2COWA 5GMKi 1UTIA 1I4K1 1J3TA 3CCJT 2D8HA 1HSQA 2JNGA 2QAZA 2DVEA 3NPFA 4C8QA 2KAFA 2DL5A 1K9MU 2KI7A 3OMCA 2Y90A 2EYYA 1Z9ZA 1VQKQ 2RD1A 5CQXA 3OBWA 2HBPA 3JB9D 5LJ3f 5GAN7 2F5KA 1ZA2B 2DTIA 3C0CA 2EQKA 2EYQA 2ZCFB 3VS3A 1AWXA 2COZA 3QDFA 3REAB 3GP8A 3OS0A 2DF6A 3EG3A 2YT6A 1VQKA 4XK8E 2I2LA 3JCMg 2LNHB 5GAN5 2GNCA 1TXQA 3HRSA 4M7DG 3M55A 3VS1A 2KXDA 2O31A 2JT4A 1AWWA 2YUPA 3MJXA 3MO8A 3CCJQ 1OPKA 4J7FA 1AOJA 2CP0A 2YSQA 4J9BA 3NGPA 1FMKA 1SPKA 1IGUA 2RI2A 4KBMB 1WHLA 1K73U 1W2BA 4LNPA 1M8MA 2CP5A 4E47A 3A8GB 3M58A 3GNFB 4M78G 1Q95G 4FSXA 4F04B 1KQSS 2QQAA 4RG2A 1FMVA 2FB7A 3BW1A 3CCJA 3EGDA 1OX9A 3H8ZA 3JCMW 2BTTA 2F69A 3QZ5B 4PLLA 3BDUA 2DYBA 1U8RA 5GMKh 3L2QA 4KGXB 3LW5E 3M0SA 1VQ4Q 1MNDA 2DZCA 4FYWB 1YNZA 5GANf 3EG2A 2Y4YA 2VKNA 2P0KA 2CSIA 2KRMA 3L2VA 2MWOA 1YJ9A 4J5YA 1MV3A 4C0ZA 3I55Q 2EQMA 4M7DB 2PQWA 3JCMe 1VQ4A 2EFIA 1TSFA 4OMQA 2M02A 3C12A 1E7OA 4GLMA 2RN8A 3JB9F 4IUQA 1XOVA 2DJQA 2OTLT 3HL8A 4DBRA 4E7KA 5CIUA 2WSCE 3LWHA 4CC3A 4A4FA 4QVDA 2E6ZA 3I55A 2DTHA 2GTOA 1Q86C 5A0DA 4PJOD 4A4KA 4M78B 1BIAA 1TOVA 2EQUA 2SRCA 1SHFA 2GGRA 2ZPHB 4YTLA 3BY7A 4JLGA 5KYUA 3E19A 3FLGA 1YCSB 3M57A 2XK0A 2W10A 4II1A 3JB9H 4JUVA 4X9DA 2EYWA 2VB6A 4HCCA 3QKJA 4ZGEB 1NLOC 4C92B 2EVRA 1I0CA 4RTZA 1U06A 2GQVA 2DBMA 2DRKA 2RJEA 4VUBA 3OYDA 3L1AA 1AWJA 4XQ3A 2FO0A 2CH4A 4FCYA 1HJDA 4EMHA 1ZBXA 3RUXA 2X4WA 1W6XA 2LTOA 4JS4A 3EFSA 4IUTA 1VQLT 3C95A 4JS5A 4HKEA 3SEMA 1GFCA 1UE9A 1KHCA 2O4XB 2OTLQ 1VYVA 4RTWA 1QKXA 4ZGDB 2QEXT 3TREA 3DLLA 1N8RC 5CK9A 5GAMh 5GAOq 1K4US 1JJ2A 2YWWA 2O9SA 1BBZA 1CKBA 1RI9A 1X01A 2VGNA 4PJLA 1M4ZA 5D6WA 2HNIA 3M0QA 3CCLT 4J6XA 1RL2A 1Q82C 3QWYA 4M75D 5GAOn 2NLUA 3OYCA 1YJWQ 1PCXA 2BE9B 2OTLA 2D8JA 1OI1A 4Z8AA 1MHNA 1H92A 2QXFA 3PE0A 1G8XA 3OYAA 3GNGA 4J83A 2NUTA 1U5SA 2C06A 4PJOA 1PD1A 3CCST 1QKWA 1VQ8Q 3EH2A 3OMGA 2M1HA 4Y92A 1YJWA 3FEOA 1ZSGA 2HQEA 2J05A 3L42A 4HA8A 9ATCB 1VQLQ 4E7ZA 3EG9A 4PLIA 1MMAA 4RTYA 1CSKA 1UECA 1NEGA 2QEXQ 2ROTA 1NPPA 2V1QA 2MMPA 4PJOF 2DEUA 1VQ8A 1YHQT 1Q81R 5FRMA 3CCLQ 4DOVA 1PNJA 2HL5C 3FRNA 2OJ2A 3OYNA 1BK2A 3I5SA 4BY6C 4IUUA 1K9AA 3RESA 2AKLA 3H6ZA 5EC7A 2F2WA 2DPPB 2IG0A 4LDWA 4CC4B 3CXCA 3CCSQ 3JSCA 3G4SQ 1K8AC 2EGAA 2LX9A 2K2VA 4QQDA 4ZNXA 1VQNT 5C0MA 1S1NA 3PVLA 1YP5A 1EX4A 2KYBA 4M77C 1D0ZA 3KXTA 1Q86U 3CBOA 5KYWA 3QDRB 2DAQA 1K73R 1MMGA 2ZPIB 2EW3A 3OB9A 3CCSA 1JXMA 1YHQQ 2O01E 3G4SA 1X6OA 3NTHA 3FJPA 4M75F 1UGPB 3GF5A 1LOJA 1HXDA 3OSSC 2MF2A 2IPOB 3D7SB 4F17A 2ATCB 3QXEB 1UUEA 1ZX6A 1UGVA 4M77E 4JJNK 2L5QA 3M0RA 1QVGS 1KC8C 2LX7A 2RHUA 1N9RA 1Y96B 4BI8B 1BIBA 2EJFA 1ABOA 5GAOp 3F70A 5ECAA 2E10A 1B7TA 2CSQA 5FW9A 1VQNQ 2EYXA 5KCOA 3R6OA 3FDRA 1NE8A 3BE3A 1G3YA 3SWNC 4LDVA 3CCUQ 2E5KA 4EMKA 4K11A 2NWMA 1JQQA 2RA2A 3QPHA 4FYVB 2HDAA 2D9TA 4FIBA 1VIEA 2GBQA 2BZ8A 3BDLA 3S3OA 4IIOA 4ANJA 1ARKA 2A37A 4D6WA 2AK5A 4LE9A 3PIPA 2HEQA 3CCUA 1E6GA 2V8KA 1KQSA 1GCQC 1HK9A 2YUOA 2KRSA 2RNAA 1OU9A 2PVOB 1OULA 3OYIA 1WHMA 1XTDA 4RG8A 5LJ3d 4PJJA 3X24B 1N9SA 3VYHB 1H3HA 2HKNA 1JB0E 1Y71A 3LYIA 4BE1A 1LVKA 2K5FA 2VVKA 2RJCA 5LJ5j 1RAHB 3CEYA 3CCQT 5A0GA 1VIFA 2O9VA 2J06A 1OYXA 3QSUA 4FW2A 2E6NA 4BACA 2EJGA 3JCMc 1M2VB 1G3SA 4XU2A 2V8JA 3LGLA 3NFCA 4ZGJB 1PHTA 4XU3A 2LDMA 1YIJT 2BIVA 1TH7A 4RTXA 1UGRB 4BD3A 1I5OB 4M77G 2YXYA 4F7UA 2BE7D 3TQ7P 3CC2T 2FHDA 3O5ZA 2IVWA 1VQOQ 4NL2A 4M7DD 5GMKj 5IHIA 1VQ9T 1K8AU 3MKDA 3CD6A 4IKFA 3I35A 4DEYA 2B8AA 2DTOA 1KQ1A 4OB0B 3R6NA 2ZPGB 1G83A 4CRIA 2XD0A 2P4TA 3NMZC 1VQOA 1M30A 1SSFA 2ED0A 4M78D 4M7AC 1H3ZA 1UGQB 3OW2S 1S72Q 1BB9A 2QQ9A 1WYXA 3CCQQ 5GAMg 2EKOA 3L2ZA 5GANd 2OI3A 3CCVT 3QWXX 4BY6B 1UJ0A 3THKA 5AT1B 2CZ1B 1VQ6T 1AZEA 3G6ET 3A5ZB 2KBTA 5KYWB 1YITT 1OZ3A 1JBMA 3MHXA 4WTOB 4J9EA 2DIGA 3OYYA 1RAEB 4OMMA 3VS7A 1S72A 4M7AE 2FPFA 3CCQA 1U1SA 1Z9QA 4D8DA 1VQ9Q 4AFZC 5HKCA 1YI2A 4M77B 2CKKA 3DB4A 2JTFA 5I11A 1KIKA 1C1AA 2JS2A 3PGGA 4EMGA 5KCHA 1KSWA 2YLCA 4C92C 5HK3A 1LCKA 1WXUA 3RMQA 3CBPA 1RLPC 1T3SA 2EYZA 4HVVA 2DLPA 4LN2A 1VQ9A 2FRYA 1PD0A 2OTJQ 1M9SA 4J6YA 4D8KA 3CCVQ 2RHIA 2DO3A 5GAN6 1YBYA 1QVGP 5GAMj 3UATA 4OMLA 2C0OA 2JW4A 2ZPBB 4C8QC 2CYZB 2ENMA 2X51A 4XU1A 3QIIA 1GXIE 2DK3A 2QTVA 4C92E 5FRNA 5GAMe 4M4ZA 4M7DF 1FYNA 2K4YA 1M1KC 1XQHA 1VQ5Q 2K2MA 2OTJA 2FZCB 3JRZA 1X6BA 1UHFA 2K5IA 2HBWA 4BI4A 3CMET 3CC7A 2FPEA 3MEUA 1TUGB 3Q1JA 3SWNB 2D0QB 1X2QA 2JOYA 3HRUA 4R55A 1B3QA 4XU0A 2E65A 1B34B 4C8QE 3U23A 5J3BA 4ESRA 2P4RA 1VQ5A 2BUDA 1TUDA 2RI5A 1WHHA 2LCCA 3JV3A 1Q81U 1N8RR 4HCKA 3M0TA 1VYUA 2C0IA 2D0NA 3JB9J 1YJNT 4QQ6A 2EGCA 3CPWP 2NYSA 1QLYA 3VRZA 2QGGA 1GCPA 2E3HA 4LUDA 4XTWA 1Q82R 4M7AG 2WSFE 4J6WA 1WJSA 3JCMP 3QYGB 3PNWC 2X9HA 5D6YA 2KRNA 4F7UB 2JMCA 4FT2A 2FL7A 1IHWA 3QUIA 3GLXA 3M0PA 5LJ5f 4J9CA 3UF4A 4HCZA 1VQPT 1M1GA 5IXBA 2RO0A 2D6FA 4NS5A 3VRYA 2DL8A 2DBKA 4FT4A 1NEBA 1QVGA 1BI3A 1ZSZA 4J9GA 5KYXA 3VUZA 2G3RA 4DBHA 1K0XA 1QQJA 1WHJA 3WVDB 1UB4A 2RQVA 4XAXB 3RNJA 3UDCA 3HPWA 4C92G 2KY9A 2MK5A 2JJ9A 1OZ2A 1EZZB 1TS9A 5FROA 2RQTA 1Y57A 3EHRA 2QYZA 4QVZA 2CDTA 2FPDA 2ABLA 4M7AB 1UDLA 4C8QG 4FL6A 3JCMQ 2EBPA 2PTKA 3OW2P 2HKQB 3SHWA 1FXXA 1UGSB 1OU8A 1K8AR 4E2FB 5GANh 4FYXB 4LDUA 1VQPQ 2LC4A 2OAWA 3CCMT 5CCAA 4DBFA 1RADB 1D3BA 3RKWA 1T3LA 3MEAA 3M9QA 4FYYB 3OS1A 1ZUUA 2KT8A 1KG1A 3JCMd 1KD1C 1PC0A 2JVVA 3HFNA 1VQMT 4Q5WA 1MV0B 4HT8A 4MZTA 1D0YA 3GPLA 1VQPA 2RK2A 2RQUA 2YHTA 3CPFA 5C6SA 2Z0WA 5KE2A 4QW2A 2AT1B 2MYSA 2GCXA 3OY9A 1SSHA 4C0FA 4XTYA 2RH2A 2ED1A 2HAXA 1KC8R 1SF9A 4O5VA 1TTHB 1AD5A 1P92A 2P0QA 1QVFS 3EGXA 3VUBA 1X27A 1BKBA 5DM7R 2LQ8A 2E3IA 2RQRA 3L2RA 3S3NA 3VS6A 2XDPA 4C0DB 3CCMQ 1PKSA 3OS2A 2L3SA 3OSVA 4QQGA 3V8KA 5EG2A 2DE0X 4C8QB 4LDYA 2V1RA 7AT1B 3TSWA 5L8RE 4BI3A 1VQMQ 2H3EB 2DZ9A 1RAIB 2SEMA 3VV0A 5A0LA 2Y4XA 2GF7A 4FM4B 3CCMA 2JN0A 3JCMb 4LXCA 1M1FA 1U3OA 1NJIC 3N5BB 2NUPA 2DXUA 1IGQA 5GAN4 1WI7A 1AZGB 4J7IA 3OW2A 3G71T 1T0HA 1B07A 1WGSA 4O6JA 3INZA 1Y0MA 5IT9E 2X3WD 2K3BA 2KE9A 3L2UA 1R0BG 2A08A 1ZQ1A 2J7IA 4JRIA 1WHGA 3OYFA 4LD9K 2XICA 4J8OA 1QW1A 1K76A 2KGTA 4JRQA 1V76A 1QVPA 4R0KA 2LMJA 3VKIA 1VQLA 2YUQA 4WF2A 1LPLA 1U1TA 1ZA1B 4OB2B 4M77D 5GAOr 3EGDB 4EDUA 3ULRB 2ZGWA 2RB6A 2QEXA 2KROA 5CQYA 3RMSA 5KYYA 3A8HB 2AKKA 3G71Q 4AMCA 4E7SA 3H9NA 5J26A 4Z88A 3UA7A 1EFNA 3CCLA 2J6FA 2QA4T 2YRCA 4R56A 1TG0A 1IB8A 4JPBW 4M75A 3QHSA
chains in the Genus database with same CATH topology
4ZGJB 3CC4T 1ZHIA 2DD4A 2LDMA 4XU3A 2E12A 2BIVA 1TH7A 3E9FA 3TCJA 1UGRB 4BD3A 2JNGA 3OYJA 1YIJT 1KD1U 3G71A 2DVEA 4M77G 4C8QA 4F7UA 4N4HA 4OB1B 2KAFA 3PMTA 3CC2T 2FHDA 1H641 1V29B 2IVWA 3M4YA 1K9MU 2HQXA 3OMCA 1IZ6A 4NL2A 4M7DD 2Y90A 5GMKj 3WXMB 1Y96A 2RD1A 3MEVA 1WNLA 3M5AA 3OBWA 4RCBA 5CQXA 2HBPA 1YJWT 1NPRA 4BB7A 3JB9D 1VQ9T 1K8AU 3M59A 3CD6A 4IKFA 5LJ3f 4E7LA 2LVMA 2L89A 5GAN7 2GFAA 1VUBA 2F5KA 3DLMA 3SD4A 4KULA 2DTIA 2B8AA 5DLOA 1N8RC 3PTAA 2DTOA 1KQ1A 2EQKA 4OB0B 2EYQA 2ZCFB 2XU8A 2ZPGB 4CRIA 3GP8A 2MAMA 2XD0A 3E9GA 2P4TA 3OS0A 3JCMf 5GAMf 1I5LA 1VQOA 4XTXA 1SSFA 3G7ZA 4C0GA 4M78D 4IUPA 1VQ8T 1VQKA 4M7AC 1H3ZA 1UGQB 1LJOA 3A8LB 3OW2S 3CMAT 5GAOm 2QQ9A 4EMKC 5HK0A 2EAYA 4XK8E 2I2LA 1YHQA 3JCMg 4PJOC 5KE3A 5GAMg 5GAN5 2PUOB 2EKOA 3HRSA 3L2ZA 4M7DG 3M55A 5GANd 3CCVT 2EQJA 2RM4A 4OF1A 4BY6B 4L5GA 2DJZA 4QVCA 4CI0C 2CZ1B 1VQ6T 3M53A 3MO8A 3G6ET 3A5ZB 4N0AA 3S3MA 3JB9G 1N8RU 1AHJB 1X75C 5GAN3 2LNVA 1YITT 1GXIE 4J7FA 4NL3A 2LQKA 1M5Q1 1OZ3A 1NZ9A 1JBMA 3S6WA 3MHXA 5FU7C 2RI2A 2DIGA 4KBMB 3OYYA 4MDWA 3UT1A 4C5EA 1VQMA 1S72A 2DXCA 3SDZA 2VV5A 2RI3A 2DXBA 2PUKB 3VJPA 3CCQA 1K73U 1W2BA 1U1SA 4M7AE 3P8BB 1XNIA 3V8LA 1LNXA 3J80E 1Q82U 2X4XA 4E47A 2QA4A 3A8GB 3M58A 4HCBA 4PJOE 3GNFB 4M78G 4FSXA 1NJIU 1KQSS 2QQAA 4ATOA 4RG2A 5HKCA 4E7HA 1YI2A 4M77B 2FB7A 3BW1A 3MP8A 3CCET 4M77F 3CCJA 2CKKA 1RI0A 3DB4A 4N4GA 2JTFA 1VQNA 3FIFA 5CKHA 3PGGA 2A7YA 2QTXA 4EMGA 5KCHA 3H8ZA 3EFRA 3JCMW 2F69A 2H3JA 2YLCA 2PU9B 3QZ5B 4PLLA 3BDUA 4Y28E 4C92C 4EPCA 3CPWS 3SB2A 5HK3A 1U8RA 3URGA 5GMKh 3P8DA 2X4YA 3CBPA 3RMQA 2YRVA 3LW5E 3L2QA 3L2WA 5CO7A 3RKYA 3PT9A 5A2QE 3G4ST 2JUFA 3RKXA 2DZCA 4IUVA 4L6V5 1VQ9A 1Y07A 5GAN2 4DA4A 1M90C 2XI9A 3HHTB 5GANf 4KT0E 1M9SA 4J6YA 2Y4YA 2P0KA 5CKDA 4ELYC 5LJ3e 1Y7XA 2RHIA 2DO3A 4LD6A 4M75C 4B9WA 3X28B 3L2VA 2HD0A 4ZTJA 5GAN6 4OB3B 1YBYA 2MWOA 5GAMj 5GANg 1BI0A 2EWNA 2LCLA 1YJ9A 4J5YA 4PJOB 4C0ZA 2DEQA 1Q7YU 2ZPBB 4GLKA 2CYZB 2EQMA 4XU1A 4C8QC 2M16A 3QIIA 3I56T 4M7DB 3LX7A 2DK3A 2PQWA 4C92E 3JCMe 5GAMe 1VQ4A 5FRNA 2FYKA 2M9UA 2EFIA 3CMAA 4M7DF 3LLRA 4XTZA 2K4YA 2X4JA 2RK1A 2K5LA 3C12A 3OA6A 2R5MA 1M1KC 1XQHA 3FB9A 3JB9F 2OTJA 4IUQA 1XOVA 3JRZA 2DXTA 2OTLT 1QP2A 2KVQG 2XDBA 2K5IA 3HL8A 4BI4A 3CMET 3CC7A 4E7KA 3MEUA 3TU4K 1N6AA 3Q1JA 3SWNB 2GFUA 5CIUA 4OVAA 2WSCE 2D0QB 4M75E 5IN1A 3LWHA 2JOYA 2K3YA 3LGLA 4M7AD 4A4FA 4GY5A 2KQWA 3HRUA 5IAYA 4QVDA 2E6ZA 4R55A 2DTHA 3I55A 4BDZA 1Q86C 3OS5A 4XU0A 2E65A 1B34B 2ZPEB 5FU6C 5A0DA 4LDXA 5LJ5d 4PJOD 4A4KA 4C8QE 2FVUA 4M78B 4F7UE 3OYKA 1BIAA 4BUGA 2EQUA 2R5AA 2ZPHB 4MMKA 4YTLA 3BY7A 5J3BA 4JLGA 5J39A 1QP3A 5LL6S 4BE2A 1VQ5A 3E19A 2BUDA 2KDSA 2RI5A 4XTUA 1D3BB 2LCCA 3FLGA 3M57A 2XK0A 1Q81U 4C5IA 4II1A 3ASKA 3GIBA 3JB9H 4JUVA 4X9DA 4HCCA 3OBYA 2RHYA 1WPYA 3QKJA 4OP0A 4ZGEB 3CCEA 3JB9J 4ME7A 4C92B 3OYEA 4C5HA 1YJNT 3OYGA 4QQ6A 4ZN1A 2GQVA 4N0AC 4JDSA 3CCUT 2OAUA 2RJEA 3CBMA 5LJ3g 4VUBA 2CZ7B 5D6XA 3OYDA 3L1AA 3UWNA 4XQ3A 4EMHA 1ZBXA 1FWZA 4XTWA 2LT1A 3RUXA 4M7AG 2E41A 2KSSA 2K3XA 2X4WA 2WSFE 4J6WA 2LTOA 4N4IA 4JS4A 1WJSA 3EFSA 3T9NA 5CR2A 4PKCC 3JCMP 3DB3A 4IUTA 3QYGB 4M75B 3C95A 4PJOG 4JS5A 1VQLT 3PNWC 4HKEA 2ZPFB 1KHCA 1QVFA 2O4XB 3CCJT 5D6YA 1W4SA 4F7UB 3E1SA 4M77A 3TREA 5GANe 4ZGDB 2QEXT 2MI6A 3DLLA 1W2BS 3LH0A 3JCMh 4C92D 4FT2A 5CK9A 5GAMh 3JCMX 5GAOq 1JJ2A 2YLBA 3X20B 2FL7A 1KC8U 4MZPA 1X01A 3QUIA 3GLXA 5LJ5f 2VGNA 4V2SA 3QYHB 3PMIA 1M4ZA 5D6WA 2HNIA 4HCZA 3CCLT 1VQPT 1M1GA 2QDYB 2RO0A 4J6XA 2D6FA 1I8FA 4NS5A 1RL2A 1Q82C 4M75D 5GAOn 2NLUA 1R8OB 2XG8D 5LJ5g 3OYCA 4FT4A 2VC8A 1QVGA 3OQ5A 1BI3A 2R58A 2OTLA 2P0PA 1OI1A 3HSBA 3VUZA 2G3RA 1MHNA 1VQ7A 1PSFA 4C8QD 2JTMA 3CC4A 1YIJA 2QXFA 3WVDB 5I2MA 3MP1A 1UB4A 3OYAA 3OYBA 4OGEA 4A4GA 5CKBA 4PNOA 2M0OA 3GNGA 4J83A 4XAXB 5KH6A 3CC2A 3PFSA 3UDCA 3HPWA 4C92G 2C06A 3J7AF 4PJOA 4L59A 2KY9A 3CCST 4M7DA 2VXEA 3OMGA 2QQSA 4X34A 3CD6T 2M1HA 1YJWA 4HT9A 3FEOA 4HA8A 2HQEA 1OZ2A 3L42A 3QO3A 5LJ3j 2E5QA 4BDYA 4Z02A 5FROA 5I2SA 3C94A 4E7IA 2R57A 4PLIA 2KK4A 4M75G 4QVZA 4C0DC 2CZ6B 4M7AB 3SWNA 4A4HA 2K57A 4M7AF 1NPPA 2DKGA 4EMKB 5GMKl 3PIOA 1VQOT 3JCMV 2MMPA 4C8QG 2VUBA 3QBYA 2EJ9A 4FL6A 4F7UG 3JCMQ 3J81E 4OMFB 4PJOF 1BI2A 1VQKT 3KUFA 1B34A 2QI2A 1VQ8A 1FXXA 2QQBA 1UGSB 1YHQT 4M78A 4KUIA 5FRMA 5GANh 4LDUA 1M90U 1KHIA 2LC4A 5FLXE 3CCMT 5CCAA 4DOVA 4RCCA 3VYGA 5I21A 2WACA 3LWIA 3FRNA 1D3BA 3CCVA 2LT4A 3RKWA 1VQ7T 3QG1A 4IURA 2RJFA 1VQ6A 2CS7A 3MEAA 3M9QA 5FU7B 3OYNA 3G6EA 5DY9A 1G5VA 3OS1A 2E1HA 3AHUA 4BY6C 5CKEA 1YITA 4C92A 1KG1A 4IUUA 2RJDA 3JCMd 5GAMd 3MEWA 4ELZC 1KD1C 2JVVA 3HFOA 3RESA 3FC3A 4RKUE 3HFNA 3ME9A 4Q5WA 2ZZDA 1VQMT 3H6ZA 1S72T 4HT8A 4MZTA 3BFMA 1K9MC 2DPPB 2IG0A 4LDWA 4M78F 3GPLA 4A54A 5LJ5e 3CCRT 1VQPA 2RK2A 3CXCA 2PVGB 3GOXA 3CPFA 2YHTA 5C6SA 5KE2A 3MP6A 4X9CA 2CZ0B 2RHXA 4QW2A 4JLIA 3JSCA 2JZ2A 2RHZA 1EIFA 2GCXA 3V7SA 3O8VA 1YI2T 1IREB 4C0FA 3OY9A 1Q81C 4XTYA 2RH2A 1K8AC 3HRTA 2LX9A 2K2VA 4QQDA 1YCYA 3NTIA 3LGFA 3ZEHA 1VQNT 5C0MA 4RMOA 2HAXA 2O4XA 4O5VA 4PL6A 2MWPA 4C92F 2XHCA 4M77C 1Q86U 3KXTA 4DOWA 1P92A 3CBOA 2LRQA 3QDRB 1WJQA 2P0QA 5DLQE 1QVFS 2BKDN 2DAQA 4MZMA 3V7CA 4C5GA 2ZPIB 3VUBA 1BKBA 5DM7R 3OB9A 4A4EA 3CCSA 4DQ2A 4BE0A 1JJ2S 3ER0A 2LQ8A 4JRPA 2O01E 5LJ3h 1X6OA 3G4SA 3L2RA 4E7JA 3S3NA 1G3TA 3NTHA 4OGCA 5GANj 2XDPA 4C0DB 3FJPA 4M75F 1UGPB 3SFMA 3GF5A 5GMKe 4ZTFA 4P5NA 3OS2A 1LOJA 2XDDA 1HXDA 3OSVA 2L3RA 4QQGA 3M56A 3OSSC 3V8KA 2A3LA 2MF2A 5EG2A 4C8QB 3JB9I 3NTKA 4LDYA 1O75A 2V8IA 3X26B 4C8QF 4F7UF 3QXEB 4B9XA 1YJ9T 2DIQA 3HP9A 3TEEA 4Y91A 5L8RE 4MMLA 4M77E 4BI3A 2L5QA 3M4GA 1PSEA 3OYLA 4JJNK 5CKFA 1QVGS 1KC8C 1G3WA 2RHUA 1M8VA 1N9RA 1VQ4T 1Y96B 4BI8B 2DZ9A 3I56A 3JCMJ 1BIBA 2EJFA 3VV0A 3WVEB 5A0LA 2Y4XA 5GAOp 2X35A 1K73C 2GF7A 3F70A 4FM4B 3CCMA 1N27A 2OTJT 2JN0A 3JCMb 4M7DC 4XTVA 1M1FA 3CC7T 2E10A 1NJIC 3N5BB 3ZBDA 1FX7A 2VGMA 3CMEA 5FU6B 2DXUA 3A8OB 5GAN4 2EIFA 1WQ7A 4J7IA 5GMKm 3OW2A 5KCOA 3G71T 3I55T 5LJ5h 3X25B 3R6OA 3FDRA 1NE8A 4M7AA 2QQRA 1G3YA 3SWNC 4LDVA 3OYHA 1WGSA 4O6JA 3DKMA 4UC4A 4EMKA 3INZA 3RERA 5IT9E 1VQ5T 3CCRA 2RA2A 3QPHA 3QJYA 1WQWA 1JRIA 1O9SA 4FU6A 4M78C 5GAOl 3L2UA 2D9TA 5GAN8 5CVIA 3ZFJA 4FIBA 1VIEA 4M7DE 1ZQ1A 4A53A 3KBGA 3BDLA 3S3OA 4JRIA 5M9OA 4NOYA 4D6WA 2L8DA 3OYFA 4LD9K 5AYFA 1YJNA 3OYMA 2XICA 3P8HA 3PIPA 5HY6A 3CCUA 4J8OA 2E64A 1QW1A 2V8KA 2XKOC 1KQ2A 1DJ7B 1KQSA 1HK9A 3QJ6A 1Q7YC 1BYMA 2VXFA 1WJRA 4JRQA 3HKSA 3V8JA 2VYTA 2PVOB 2F5TX 2PVDB 3A8MB 3OYIA 3META 1QVPA 3MCAB 3VKIA 1VQLA 1XTDA 4RG8A 5LJ3d 3X24B 1UEBA 1N9SA 4M78E 4WF2A 3VYHB 3VU3C 1U1TA 4OB2B 4TVRA 4M77D 3V7RA 5GAOr 1JB0E 4EDUA 1Y71A 3CPWA 2WSEE 3LYIA 2ZGWA 3EAEA 2CGHA 2RB6A 3CXCS 2QEXA 3UPUA 5CQYA 4BE1A 3RMSA 4JRKA 1MGQA 2K5FA 3A8HB 2DD5A 4ZN3A 2E70A 2RJCA 5LJ5j 5CAIA 4KUDK 3CEYA 5J26A 4MDXA 3RIRA 3CCQT 1M1KU 1BI1A 2AHJB 1I81A 5A0GA 1VIFA 3CCLA 2KMTA 3M54A 2QA4T 3JAME 1OYXA 4R56A 3QSUA 4BACA 2E6NA 5GMKi 2EJGA 3C4SA 3JCMc 1G3SA 3QZ9B 4M75A 4XU2A 1I4K1 2V8JA 2XIDA 3NFCA 3QHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3R A;  3CC4 T;  1VQ7 A;  2DO3 A;  1YIJ T;  3CC4 A;  2JNG A;  1KD1 U;  1YIJ A;  1YBY A;  2MWO A;  3G71 A;  1YJ9 T;  2LCL A;  1YJ9 A;  1QVG S;  1KC8 C;  3CC2 T;  1Q7Y U;  3CC2 A;  1K9M U;  1VQ4 T;  3J7A F;  3I56 T;  1IZ6 A;  1VQ4 A;  3I56 A;  3CMA A;  3CCS T;  1M1K C;  1YJW T;  1K73 C;  1NPR A;  4X34 A;  1VQ9 T;  3CD6 T;  2OTJ T;  3CCM A;  1YJW A;  1K8A U;  3CD6 A;  2OTJ A;  2LVM A;  2OTL T;  3CC7 T;  2KVQ G;  1NJI C;  3CME T;  3CC7 A;  3CME A;  2EIF A;  3OW2 A;  2JOY A;  4CRI A;  3G71 T;  3I55 T;  5IAY A;  3I55 A;  2E6Z A;  1NPP A;  3PIO A;  1Q86 C;  1VQO T;  1VQO A;  1SSF A;  3J81 E;  1VQK T;  1VQ8 T;  1VQK A;  5IT9 E;  3OW2 S;  1VQ8 A;  1VQ5 T;  1YHQ T;  3CMA T;  4YTL A;  5J3B A;  3CCR A;  1VQ5 A;  1YHQ A;  5LL6 S;  1M90 U;  2KDS A;  1KHI A;  5FLX E;  3CCM T;  1Q81 U;  3CCV T;  3CCV A;  3KBG A;  1VQ7 T;  1VQ6 T;  3CCE A;  3G6E T;  3A5Z B;  1N8R U;  1VQ6 A;  3G6E A;  1YIT T;  1YJN T;  4ZN1 A;  1YIT A;  1YJN A;  3CCU T;  3PIP A;  1KD1 C;  5HY6 A;  1NZ9 A;  3CCU A;  2JVV A;  1VQM T;  1KQS A;  1S72 T;  3OYY A;  1VQM A;  1Q7Y C;  1S72 A;  1K9M C;  3HKS A;  2IG0 A;  3CCQ A;  3CCR T;  1VQP A;  1W2B A;  1K73 U;  3P8B B;  1XNI A;  3CXC A;  3J80 E;  3CPF A;  3DB3 A;  1Q82 U;  1VQL T;  2QA4 A;  1VQL A;  1XTD A;  1EIF A;  1YI2 T;  1NJI U;  1UEB A;  1KQS S;  4RG2 A;  1Q81 C;  1K8A C;  1YI2 A;  4TVR A;  1QVF A;  4QQD A;  3CCE T;  3LGF A;  2CKK A;  3CPW A;  3CCJ A;  1VQN T;  3DB4 A;  2QEX T;  3TRE A;  3DLL A;  1W2B S;  1N8R C;  2MI6 A;  3CXC S;  1VQN A;  3LH0 A;  2QEX A;  2MWP A;  1JJ2 A;  2XHC A;  1Q86 U;  4ZN3 A;  1KC8 U;  2E70 A;  5DLQ E;  1QVF S;  3CPW S;  1BKB A;  5J26 A;  5DM7 R;  3CCQ T;  3CCL T;  1VQP T;  1M1G A;  5A2Q E;  3CCS A;  3G4S T;  1M1K U;  1JJ2 S;  2JUF A;  3ER0 A;  2LQ8 A;  3CCL A;  3G4S A;  1X6O A;  1RL2 A;  3JAM E;  2QA4 T;  1Q82 C;  1VQ9 A;  1M90 C;  1QVG A;  2OTL A;  3LGL A;  2L3R A;  3CCJ T; 
#chains in the Genus database with same CATH topology
 3CC4 T;  1ZHI A;  3E9F A;  3TCJ A;  3OYJ A;  1KD1 U;  1PG5 B;  3G71 A;  4OB1 B;  2PZ1 A;  3PMT A;  1H64 1;  1KK7 A;  1R77 A;  1W70 A;  1WNL A;  3M5A A;  1NPR A;  2L89 A;  2GFA A;  1VUB A;  4KUL A;  1SRM A;  5DLO A;  3PTA A;  1BCM A;  3E9G A;  1RAA B;  3JCM f;  1I5L A;  4XTX A;  1NLP C;  3G7Z A;  4C0G A;  1R0C B;  4IUP A;  5KYU B;  1H8K A;  1MNE A;  3CMA T;  4EMK C;  5HK0 A;  1YHQ A;  1IO6 A;  1ZBJ A;  2QA4 Q;  1UHC A;  1AWO A;  1TUC A;  4OF1 A;  4L5G A;  4QVC A;  4CI0 C;  4LUE A;  3MPU B;  3M53 A;  4N0A A;  1N8R U;  1X75 C;  2LNV A;  3I5R A;  4NL3 A;  2LQK A;  1MMD A;  3S6W A;  5FU7 C;  4MDW A;  1NYG A;  2LJ3 A;  2DXC A;  3SDZ A;  2VV5 A;  3VJP A;  1XNI A;  3J80 E;  1LNX A;  2LJ1 A;  1Q82 U;  4KH0 B;  1RUW A;  1BU1 A;  2QA4 A;  1XJW B;  1NJI U;  4ATO A;  4E7H A;  3CCE T;  4M77 F;  2FZG B;  1VQN A;  5CKH A;  1X69 A;  2A7Y A;  1IHV A;  1QVF P;  4E6R A;  1QCF A;  3GBQ A;  2H3J A;  3IQL A;  2PU9 B;  4EPC A;  4Y28 E;  1M1K R;  4AG1 C;  4QKU A;  3SB2 A;  3CPW S;  1JO8 A;  3RKY A;  5A2Q E;  3CMA Q;  2JUF A;  4IUV A;  3EFO A;  1GRI A;  3HHT B;  1YWP A;  4KT0 E;  2LP5 A;  5CKD A;  4ELY C;  5LJ3 e;  1YN8 A;  1TU0 B;  2FG0 A;  2MIO A;  4OB3 B;  2NUT B;  1BI0 A;  2EWN A;  5GAN g;  4PJO B;  4GLK A;  2MOX A;  2M16 A;  3I56 T;  3LX7 A;  2FYK A;  3CMA A;  1D1A A;  2X4J A;  2K5L A;  3OA6 A;  2R5M A;  3EG9 B;  2DXT A;  2XDB A;  2HQH A;  3TU4 K;  1N6A A;  3CCE Q;  4AFS C;  2EKH A;  1M3B A;  2K3Y A;  4M7A D;  2KQW A;  2DIL A;  1M3A A;  4OMN A;  5LJ5 d;  2DRM A;  2FVU A;  4F7U E;  4BUG A;  1D09 B;  4OMO A;  5J39 A;  1QP3 A;  2KDS A;  4PJN A;  4XTU A;  2DL3 A;  2DNU A;  2NUZ A;  8ATC B;  4C5I A;  3OBY A;  5KYY B;  2RHY A;  3CCE A;  4OP0 A;  1NG2 A;  2LCS A;  3OYE A;  2YUN A;  4C5H A;  4ZN1 A;  2EQI A;  5KYN A;  2HSP A;  2COY A;  3UWN A;  2VAS A;  1FWZ A;  4GBQ A;  2E41 A;  4FSS A;  2KSS A;  3I56 Q;  2HSE B;  2IIM A;  4N4I A;  4PKC C;  4M75 B;  2ZPF B;  2CUB A;  2GTJ A;  1QVF A;  4PFO A;  5GAN e;  4AFU C;  2MI6 A;  3LH0 A;  4C92 D;  3X20 B;  1YIJ Q;  1KC8 U;  1GBQ A;  2JTE A;  2QDL A;  2YRD A;  3QYH B;  3PMI A;  3CC2 Q;  3EGU A;  1VYT A;  2M51 A;  2BZX A;  2P84 A;  1R8O B;  2VC8 A;  4HVU A;  2P0P A;  4AG2 C;  2QK0 A;  1PSF A;  4C8Q D;  1YIJ A;  2D1X A;  2KNB B;  5I2M A;  3MP1 A;  1ABQ A;  4RUG A;  3OYB A;  5CKB A;  4PNO A;  2M0O A;  4HXJ A;  3CC2 A;  3PFS A;  2HL3 A;  4L59 A;  2I0N A;  4M7D A;  2VXE A;  2QQS A;  4X34 A;  1ZLM A;  1OEB A;  3QO3 A;  1RAB B;  2E5Q A;  4Z02 A;  3C94 A;  2R57 A;  1PM3 A;  1KD1 R;  4WCI A;  2PNI A;  1VQ6 Q;  3EG1 A;  3G6E Q;  4C0D C;  1K0S A;  4M7A F;  1YIT Q;  4EMK B;  3JCM V;  1D0X A;  3QBY A;  4F7U G;  2EJ9 A;  1VQK T;  4ORZ A;  1BI2 A;  1OX8 A;  3KUF A;  2QI2 A;  2QQB A;  3LH5 A;  4M78 A;  4KUI A;  1KHI A;  5FLX E;  4J9H A;  4IIM A;  3VYG A;  5I21 A;  2WAC A;  4FW1 A;  3LWI A;  1W2B P;  3CCV A;  2LT4 A;  4IUR A;  2A28 A;  4KH1 B;  1VQ6 A;  2CS7 A;  2K7A A;  5FU7 B;  3G6E A;  5DY9 A;  4JJC A;  2E1H A;  3AHU A;  1NM7 A;  5CKE A;  1YIT A;  4C92 A;  2RJD A;  5GAM d;  4ELZ C;  3H0I A;  4RKU E;  2ZZD A;  3BFM A;  3CCR T;  4M78 F;  5GJV B;  4LDX A;  3KFV A;  2K6D A;  2PVG B;  2DFU A;  4DBQ A;  2LQW A;  3MP6 A;  2RHX A;  2RHZ A;  3ZL7 C;  3O8V A;  1IRE B;  3HRT A;  3EG0 A;  2O4X A;  2AZV A;  4PL6 A;  3E2U A;  4C92 F;  1SG5 A;  1NBE B;  4MZM A;  1JEG A;  4F16 A;  4DQ2 A;  4BE0 A;  3ER0 A;  4JRP A;  1NJI R;  5LJ3 h;  1G3T A;  4OGC A;  3SFM A;  4AT1 B;  2XDD A;  2L3R A;  3M56 A;  1MUZ A;  2DMO A;  3JB9 I;  1ZSZ C;  3NTK A;  3CME Q;  2DER A;  3X26 B;  1X43 A;  4C8Q F;  4B9X A;  1YJ9 T;  3HP9 A;  3TEE A;  3M4G A;  1M8V A;  4Z89 A;  1VQ4 T;  3JCM J;  2KXC A;  3WVE B;  3CCR Q;  1UFF A;  2X35 A;  1D1C A;  1N27 A;  2J6K A;  1JXO A;  4JZ4 A;  1C0M A;  1SEM A;  3CME A;  2EIF A;  1WQ7 A;  3I55 T;  2LZ6 B;  5LJ5 h;  1M3C A;  1YJN Q;  2QQR A;  2CT3 A;  2KYM A;  3DKM A;  4UC4 A;  1M90 R;  3RER A;  1AEY A;  3CCR A;  3QJY A;  1JRI A;  1O9S A;  4FU6 A;  1ZUY A;  5GAO l;  5CVI A;  3ZFJ A;  3KBG A;  1X2K A;  4NOY A;  1VA7 A;  2L8D A;  1WX6 A;  5AYF A;  1YJN A;  4RTV A;  4AFQ C;  3M0U A;  1YJ9 Q;  1KQ2 A;  1DJ7 B;  2GQI A;  3QJ6 A;  1Q7Y C;  1JJ2 P;  1BYM A;  2VXF A;  1QCO A;  2CP3 A;  3HTR A;  2F5T X;  2PVD B;  3MCA B;  5D7U A;  1UEB A;  2MPX C;  3VU3 C;  4TVR A;  1C6V X;  3CPW A;  2A36 A;  2CGH A;  1SRL A;  1M27 C;  2L3P A;  4ZN3 A;  1AT1 B;  1M2O A;  2E70 A;  3REB B;  4EIK A;  2O88 A;  2CH4 W;  4MDX A;  3RIR A;  1M1K U;  1BI1 A;  2KMT A;  3C4S A;  1QWE A;  3QZ9 B;  2XID A;  2XMF A;  3EH1 A;  2DD4 A;  1OV3 A;  2E12 A;  5I22 A;  4N4H A;  3VS4 A;  1V29 B;  3M4Y A;  2HQX A;  1IZ6 A;  3WXM B;  1Y96 A;  3MEV A;  1SHG A;  4RCB A;  1YJW T;  2A0F B;  4BB7 A;  5IH2 A;  3M59 A;  3TSZ A;  2F1L A;  4E7L A;  2LVM A;  3DLM A;  3SD4 A;  3H41 A;  2XU8 A;  2MAM A;  1PRM C;  5GAM f;  2QGF B;  1VQ8 T;  1LJO A;  2K79 A;  3A8L B;  5GAO m;  2EAY A;  2JXB A;  4PJO C;  5KE3 A;  2PUO B;  2L2P A;  2EQJ A;  2RM4 A;  3TVT A;  2DJZ A;  3RR6 A;  3CXC P;  2FEI A;  3S3M A;  1K1Z A;  3JB9 G;  1AHJ B;  2EPD A;  5GAN 3;  1M5Q 1;  3RDV A;  3H0F A;  1NZ9 A;  2L3Q A;  1YWO A;  2M0Y A;  1HD3 A;  1WXT A;  4C5E A;  3UT1 A;  1VQM A;  5L23 A;  2DXB A;  2PUK B;  2RI3 A;  1QMC A;  1WA7 A;  3P8B B;  2VWF A;  3V8L A;  1E6H A;  2X4X A;  1WLP B;  4HCB A;  4PJO E;  3MP8 A;  2E4H A;  1GL5 A;  8AT1 B;  1RI0 A;  4N4G A;  3FIF A;  2QTX A;  3EFR A;  1T0J A;  5HCK A;  3URG A;  3P8D A;  2X4Y A;  2YRV A;  2G6F X;  3L2W A;  5CO7 A;  2CRE A;  3PT9 A;  4DEX A;  3G4S T;  4OMP A;  2KT1 A;  3RKX A;  1TWB A;  4L6V 5;  1Y07 A;  2DL4 A;  1ZSZ B;  5GAN 2;  4DA4 A;  1M90 C;  2XI9 A;  5KYX B;  1M2V A;  4PFP A;  3PVQ A;  1Y7X A;  4LD6 A;  4M75 C;  4B9W A;  3X28 B;  2HD0 A;  4ZTJ A;  1K9M R;  2LCL A;  1QWF A;  2DEQ A;  1Q7Y U;  1YFN A;  2CP2 A;  2M9U A;  4PK4 A;  3LLR A;  4XTZ A;  4A63 B;  1MMN A;  2RK1 A;  2K9G A;  2BZY A;  3FB9 A;  4KGZ B;  2MCN A;  1F1B B;  1QP2 A;  2KVQ G;  2KEA A;  2FRW A;  2GFU A;  4OVA A;  5IN1 A;  4M75 E;  2HZY A;  4GY5 A;  1GFD A;  1KFZ A;  5IAY A;  2O2O A;  4BDZ A;  2H8H A;  3OS5 A;  5FU6 C;  2ZPE B;  3OYK A;  4QT7 A;  1OOT A;  2R5A A;  4MMK A;  5LL6 S;  4BE2 A;  1KQS P;  1D3B B;  3AT1 B;  3ASK A;  4JJB A;  2J6O A;  1WPY A;  4ME7 A;  3A98 A;  3OYG A;  4N0A C;  4JDS A;  3CCU T;  2JS0 A;  2OAU A;  3CBM A;  5LJ3 g;  1NYF A;  2CZ7 B;  5D6X A;  2AIR B;  2LT1 A;  1RLQ C;  2DL7 A;  2K3X A;  2ZAE A;  3T9N A;  5CR2 A;  3DB3 A;  4PJO G;  1D1B A;  1IXD A;  3VS2 A;  2YDL A;  3VS5 A;  1W4S A;  3CQT A;  3E1S A;  4M77 A;  1W2B S;  4KGV B;  2DA9 A;  3JCM h;  1VQ7 Q;  3JCM X;  3CC4 Q;  2YLB A;  3EGX B;  2QAS A;  4HVW A;  2ROL A;  2FZK B;  4MZP A;  2DVJ A;  4V2S A;  1CKA A;  2OX7 A;  4RTT A;  1WIE A;  3NHN A;  2QDY B;  1I8F A;  2CP6 A;  2XG8 D;  5LJ5 g;  1OPL A;  3OQ5 A;  2R58 A;  2DM1 A;  3HSB A;  2CP7 A;  1VQ7 A;  2JTM A;  3G1J A;  3CC4 A;  4OGE A;  4A4G A;  5KH6 A;  3FJ5 A;  4RTU A;  3J7A F;  3I9Q A;  5IHK A;  2RMO A;  5FWB A;  3CD6 T;  4HT9 A;  5LJ3 j;  4BDY A;  4B6M A;  2NUP B;  5I2S A;  4E7I A;  2L0A A;  2KK4 A;  4M75 G;  2LJ0 A;  1PRL C;  1RAF B;  1VOM A;  2CZ6 B;  3SWN A;  4A4H A;  2K57 A;  2DKG A;  5GMK l;  3PIO A;  1VQO T;  2JM8 A;  1N5Z A;  2VUB A;  3J81 E;  4OMF B;  1B34 A;  1M90 U;  1G2B A;  4RCC A;  1RAG B;  1WDX A;  2QG9 B;  2RF0 A;  3QG1 A;  1VQ7 T;  2RJF A;  1OQK A;  1JU5 C;  1G5V A;  1GCQ A;  3MEW A;  1ACM B;  3VS0 A;  3HFO A;  3FC3 A;  5IXF A;  3ME9 A;  1S72 T;  1SKU B;  1K9M C;  3GIB A;  4J9I A;  4A54 A;  5LJ5 e;  2RQW A;  3GOX A;  2ESW A;  4X9C A;  2CZ0 B;  2DET A;  4JLI A;  2JZ2 A;  3V7S A;  1EIF A;  3CD6 Q;  1YI2 T;  2LQN A;  1Q81 C;  1I07 A;  1YCY A;  3NTI A;  3LGF A;  3ZEH A;  4RMO A;  2MWP A;  2XHC A;  3EHQ A;  4DOW A;  2RPN A;  2LRQ A;  1WJQ A;  5DLQ E;  2BKD N;  2F2V A;  4C5G A;  3V7C A;  1PWT A;  3A1P A;  2ECZ A;  4A4E A;  1WFW A;  1JJ2 S;  2HMA A;  4J9D A;  1FMW A;  1ZUK A;  4E7J A;  1A0N B;  1HYO A;  2X3X D;  5GAN j;  5GMK e;  4ZTF A;  4P5N A;  5GJW B;  1AVZ C;  2A3L A;  2DX1 A;  1O75 A;  2V8I A;  2C0T A;  4F7U F;  2DYI A;  1W1F A;  2DIQ A;  4Y91 A;  1PKT A;  4MML A;  1PSE A;  3OYL A;  4PFZ A;  5CKF A;  1G3W A;  1WXB A;  3I56 A;  1BCO A;  1K73 C;  2OTJ T;  4M7D C;  2CUD A;  4XTV A;  3CC7 T;  1YI2 Q;  3ZBD A;  1FX7 A;  2HCK A;  2VGM A;  2JMA A;  5FU6 B;  1RAC B;  3A8O B;  4KRT A;  5GMK m;  1Q7Y R;  3X25 B;  1KJW A;  4M7A A;  3OYH A;  1IRX A;  4PJM A;  3RBB B;  5IHN A;  1VQ5 T;  2EGE A;  1WQW A;  2V26 A;  4CC7 A;  4M78 C;  5GAN 8;  2W0Z A;  4M7D E;  1UJY A;  4X1V A;  4A53 A;  5M9O A;  3UA6 A;  4JZ3 A;  4CC2 A;  3OYM A;  3P8H A;  2KR3 A;  5HY6 A;  2E64 A;  2XKO C;  4J9F A;  2CT4 A;  5FWC A;  1WJR A;  2F2X A;  6AT1 B;  3HKS A;  3V8J A;  2VYT A;  2B86 A;  3A8M B;  3MET A;  1WHK A;  1X6G A;  4M78 E;  1QCN A;  3V7R A;  2AZS A;  3CC7 Q;  1Q86 R;  2WSE E;  3EAE A;  2JM9 A;  3CXC S;  3UPU A;  4JRK A;  1MGQ A;  1WZO A;  2DD5 A;  5CAI A;  4KUD K;  4JJD A;  1GBR A;  1UG1 A;  3H0H A;  2AHJ B;  1I81 A;  3EFO B;  1I1J A;  4F14 A;  3M54 A;  1V1C A;  3JAM E;  2COW A;  5GMK i;  1UTI A;  1I4K 1;  1J3T A;  3CCJ T;  2D8H A;  1HSQ A;  2JNG A;  2QAZ A;  2DVE A;  3NPF A;  4C8Q A;  2KAF A;  2DL5 A;  1K9M U;  2KI7 A;  3OMC A;  2Y90 A;  2EYY A;  1Z9Z A;  1VQK Q;  2RD1 A;  5CQX A;  3OBW A;  2HBP A;  3JB9 D;  5LJ3 f;  5GAN 7;  2F5K A;  1ZA2 B;  2DTI A;  3C0C A;  2EQK A;  2EYQ A;  2ZCF B;  3VS3 A;  1AWX A;  2COZ A;  3QDF A;  3REA B;  3GP8 A;  3OS0 A;  2DF6 A;  3EG3 A;  2YT6 A;  1VQK A;  4XK8 E;  2I2L A;  3JCM g;  2LNH B;  5GAN 5;  2GNC A;  1TXQ A;  3HRS A;  4M7D G;  3M55 A;  3VS1 A;  2KXD A;  2O31 A;  2JT4 A;  1AWW A;  2YUP A;  3MJX A;  3MO8 A;  3CCJ Q;  1OPK A;  4J7F A;  1AOJ A;  2CP0 A;  2YSQ A;  4J9B A;  3NGP A;  1FMK A;  1SPK A;  1IGU A;  2RI2 A;  4KBM B;  1WHL A;  1K73 U;  1W2B A;  4LNP A;  1M8M A;  2CP5 A;  4E47 A;  3A8G B;  3M58 A;  3GNF B;  4M78 G;  1Q95 G;  4FSX A;  4F04 B;  1KQS S;  2QQA A;  4RG2 A;  1FMV A;  2FB7 A;  3BW1 A;  3CCJ A;  3EGD A;  1OX9 A;  3H8Z A;  3JCM W;  2BTT A;  2F69 A;  3QZ5 B;  4PLL A;  3BDU A;  2DYB A;  1U8R A;  5GMK h;  3L2Q A;  4KGX B;  3LW5 E;  3M0S A;  1VQ4 Q;  1MND A;  2DZC A;  4FYW B;  1YNZ A;  5GAN f;  3EG2 A;  2Y4Y A;  2VKN A;  2P0K A;  2CSI A;  2KRM A;  3L2V A;  2MWO A;  1YJ9 A;  4J5Y A;  1MV3 A;  4C0Z A;  3I55 Q;  2EQM A;  4M7D B;  2PQW A;  3JCM e;  1VQ4 A;  2EFI A;  1TSF A;  4OMQ A;  2M02 A;  3C12 A;  1E7O A;  4GLM A;  2RN8 A;  3JB9 F;  4IUQ A;  1XOV A;  2DJQ A;  2OTL T;  3HL8 A;  4DBR A;  4E7K A;  5CIU A;  2WSC E;  3LWH A;  4CC3 A;  4A4F A;  4QVD A;  2E6Z A;  3I55 A;  2DTH A;  2GTO A;  1Q86 C;  5A0D A;  4PJO D;  4A4K A;  4M78 B;  1BIA A;  1TOV A;  2EQU A;  2SRC A;  1SHF A;  2GGR A;  2ZPH B;  4YTL A;  3BY7 A;  4JLG A;  5KYU A;  3E19 A;  3FLG A;  1YCS B;  3M57 A;  2XK0 A;  2W10 A;  4II1 A;  3JB9 H;  4JUV A;  4X9D A;  2EYW A;  2VB6 A;  4HCC A;  3QKJ A;  4ZGE B;  1NLO C;  4C92 B;  2EVR A;  1I0C A;  4RTZ A;  1U06 A;  2GQV A;  2DBM A;  2DRK A;  2RJE A;  4VUB A;  3OYD A;  3L1A A;  1AWJ A;  4XQ3 A;  2FO0 A;  2CH4 A;  4FCY A;  1HJD A;  4EMH A;  1ZBX A;  3RUX A;  2X4W A;  1W6X A;  2LTO A;  4JS4 A;  3EFS A;  4IUT A;  1VQL T;  3C95 A;  4JS5 A;  4HKE A;  3SEM A;  1GFC A;  1UE9 A;  1KHC A;  2O4X B;  2OTL Q;  1VYV A;  4RTW A;  1QKX A;  4ZGD B;  2QEX T;  3TRE A;  3DLL A;  1N8R C;  5CK9 A;  5GAM h;  5GAO q;  1K4U S;  1JJ2 A;  2YWW A;  2O9S A;  1BBZ A;  1CKB A;  1RI9 A;  1X01 A;  2VGN A;  4PJL A;  1M4Z A;  5D6W A;  2HNI A;  3M0Q A;  3CCL T;  4J6X A;  1RL2 A;  1Q82 C;  3QWY A;  4M75 D;  5GAO n;  2NLU A;  3OYC A;  1YJW Q;  1PCX A;  2BE9 B;  2OTL A;  2D8J A;  1OI1 A;  4Z8A A;  1MHN A;  1H92 A;  2QXF A;  3PE0 A;  1G8X A;  3OYA A;  3GNG A;  4J83 A;  2NUT A;  1U5S A;  2C06 A;  4PJO A;  1PD1 A;  3CCS T;  1QKW A;  1VQ8 Q;  3EH2 A;  3OMG A;  2M1H A;  4Y92 A;  1YJW A;  3FEO A;  1ZSG A;  2HQE A;  2J05 A;  3L42 A;  4HA8 A;  9ATC B;  1VQL Q;  4E7Z A;  3EG9 A;  4PLI A;  1MMA A;  4RTY A;  1CSK A;  1UEC A;  1NEG A;  2QEX Q;  2ROT A;  1NPP A;  2V1Q A;  2MMP A;  4PJO F;  2DEU A;  1VQ8 A;  1YHQ T;  1Q81 R;  5FRM A;  3CCL Q;  4DOV A;  1PNJ A;  2HL5 C;  3FRN A;  2OJ2 A;  3OYN A;  1BK2 A;  3I5S A;  4BY6 C;  4IUU A;  1K9A A;  3RES A;  2AKL A;  3H6Z A;  5EC7 A;  2F2W A;  2DPP B;  2IG0 A;  4LDW A;  4CC4 B;  3CXC A;  3CCS Q;  3JSC A;  3G4S Q;  1K8A C;  2EGA A;  2LX9 A;  2K2V A;  4QQD A;  4ZNX A;  1VQN T;  5C0M A;  1S1N A;  3PVL A;  1YP5 A;  1EX4 A;  2KYB A;  4M77 C;  1D0Z A;  3KXT A;  1Q86 U;  3CBO A;  5KYW A;  3QDR B;  2DAQ A;  1K73 R;  1MMG A;  2ZPI B;  2EW3 A;  3OB9 A;  3CCS A;  1JXM A;  1YHQ Q;  2O01 E;  3G4S A;  1X6O A;  3NTH A;  3FJP A;  4M75 F;  1UGP B;  3GF5 A;  1LOJ A;  1HXD A;  3OSS C;  2MF2 A;  2IPO B;  3D7S B;  4F17 A;  2ATC B;  3QXE B;  1UUE A;  1ZX6 A;  1UGV A;  4M77 E;  4JJN K;  2L5Q A;  3M0R A;  1QVG S;  1KC8 C;  2LX7 A;  2RHU A;  1N9R A;  1Y96 B;  4BI8 B;  1BIB A;  2EJF A;  1ABO A;  5GAO p;  3F70 A;  5ECA A;  2E10 A;  1B7T A;  2CSQ A;  5FW9 A;  1VQN Q;  2EYX A;  5KCO A;  3R6O A;  3FDR A;  1NE8 A;  3BE3 A;  1G3Y A;  3SWN C;  4LDV A;  3CCU Q;  2E5K A;  4EMK A;  4K11 A;  2NWM A;  1JQQ A;  2RA2 A;  3QPH A;  4FYV B;  2HDA A;  2D9T A;  4FIB A;  1VIE A;  2GBQ A;  2BZ8 A;  3BDL A;  3S3O A;  4IIO A;  4ANJ A;  1ARK A;  2A37 A;  4D6W A;  2AK5 A;  4LE9 A;  3PIP A;  2HEQ A;  3CCU A;  1E6G A;  2V8K A;  1KQS A;  1GCQ C;  1HK9 A;  2YUO A;  2KRS A;  2RNA A;  1OU9 A;  2PVO B;  1OUL A;  3OYI A;  1WHM A;  1XTD A;  4RG8 A;  5LJ3 d;  4PJJ A;  3X24 B;  1N9S A;  3VYH B;  1H3H A;  2HKN A;  1JB0 E;  1Y71 A;  3LYI A;  4BE1 A;  1LVK A;  2K5F A;  2VVK A;  2RJC A;  5LJ5 j;  1RAH B;  3CEY A;  3CCQ T;  5A0G A;  1VIF A;  2O9V A;  2J06 A;  1OYX A;  3QSU A;  4FW2 A;  2E6N A;  4BAC A;  2EJG A;  3JCM c;  1M2V B;  1G3S A;  4XU2 A;  2V8J A;  3LGL A;  3NFC A;  4ZGJ B;  1PHT A;  4XU3 A;  2LDM A;  1YIJ T;  2BIV A;  1TH7 A;  4RTX A;  1UGR B;  4BD3 A;  1I5O B;  4M77 G;  2YXY A;  4F7U A;  2BE7 D;  3TQ7 P;  3CC2 T;  2FHD A;  3O5Z A;  2IVW A;  1VQO Q;  4NL2 A;  4M7D D;  5GMK j;  5IHI A;  1VQ9 T;  1K8A U;  3MKD A;  3CD6 A;  4IKF A;  3I35 A;  4DEY A;  2B8A A;  2DTO A;  1KQ1 A;  4OB0 B;  3R6N A;  2ZPG B;  1G83 A;  4CRI A;  2XD0 A;  2P4T A;  3NMZ C;  1VQO A;  1M30 A;  1SSF A;  2ED0 A;  4M78 D;  4M7A C;  1H3Z A;  1UGQ B;  3OW2 S;  1S72 Q;  1BB9 A;  2QQ9 A;  1WYX A;  3CCQ Q;  5GAM g;  2EKO A;  3L2Z A;  5GAN d;  2OI3 A;  3CCV T;  3QWX X;  4BY6 B;  1UJ0 A;  3THK A;  5AT1 B;  2CZ1 B;  1VQ6 T;  1AZE A;  3G6E T;  3A5Z B;  2KBT A;  5KYW B;  1YIT T;  1OZ3 A;  1JBM A;  3MHX A;  4WTO B;  4J9E A;  2DIG A;  3OYY A;  1RAE B;  4OMM A;  3VS7 A;  1S72 A;  4M7A E;  2FPF A;  3CCQ A;  1U1S A;  1Z9Q A;  4D8D A;  1VQ9 Q;  4AFZ C;  5HKC A;  1YI2 A;  4M77 B;  2CKK A;  3DB4 A;  2JTF A;  5I11 A;  1KIK A;  1C1A A;  2JS2 A;  3PGG A;  4EMG A;  5KCH A;  1KSW A;  2YLC A;  4C92 C;  5HK3 A;  1LCK A;  1WXU A;  3RMQ A;  3CBP A;  1RLP C;  1T3S A;  2EYZ A;  4HVV A;  2DLP A;  4LN2 A;  1VQ9 A;  2FRY A;  1PD0 A;  2OTJ Q;  1M9S A;  4J6Y A;  4D8K A;  3CCV Q;  2RHI A;  2DO3 A;  5GAN 6;  1YBY A;  1QVG P;  5GAM j;  3UAT A;  4OML A;  2C0O A;  2JW4 A;  2ZPB B;  4C8Q C;  2CYZ B;  2ENM A;  2X51 A;  4XU1 A;  3QII A;  1GXI E;  2DK3 A;  2QTV A;  4C92 E;  5FRN A;  5GAM e;  4M4Z A;  4M7D F;  1FYN A;  2K4Y A;  1M1K C;  1XQH A;  1VQ5 Q;  2K2M A;  2OTJ A;  2FZC B;  3JRZ A;  1X6B A;  1UHF A;  2K5I A;  2HBW A;  4BI4 A;  3CME T;  3CC7 A;  2FPE A;  3MEU A;  1TUG B;  3Q1J A;  3SWN B;  2D0Q B;  1X2Q A;  2JOY A;  3HRU A;  4R55 A;  1B3Q A;  4XU0 A;  2E65 A;  1B34 B;  4C8Q E;  3U23 A;  5J3B A;  4ESR A;  2P4R A;  1VQ5 A;  2BUD A;  1TUD A;  2RI5 A;  1WHH A;  2LCC A;  3JV3 A;  1Q81 U;  1N8R R;  4HCK A;  3M0T A;  1VYU A;  2C0I A;  2D0N A;  3JB9 J;  1YJN T;  4QQ6 A;  2EGC A;  3CPW P;  2NYS A;  1QLY A;  3VRZ A;  2QGG A;  1GCP A;  2E3H A;  4LUD A;  4XTW A;  1Q82 R;  4M7A G;  2WSF E;  4J6W A;  1WJS A;  3JCM P;  3QYG B;  3PNW C;  2X9H A;  5D6Y A;  2KRN A;  4F7U B;  2JMC A;  4FT2 A;  2FL7 A;  1IHW A;  3QUI A;  3GLX A;  3M0P A;  5LJ5 f;  4J9C A;  3UF4 A;  4HCZ A;  1VQP T;  1M1G A;  5IXB A;  2RO0 A;  2D6F A;  4NS5 A;  3VRY A;  2DL8 A;  2DBK A;  4FT4 A;  1NEB A;  1QVG A;  1BI3 A;  1ZSZ A;  4J9G A;  5KYX A;  3VUZ A;  2G3R A;  4DBH A;  1K0X A;  1QQJ A;  1WHJ A;  3WVD B;  1UB4 A;  2RQV A;  4XAX B;  3RNJ A;  3UDC A;  3HPW A;  4C92 G;  2KY9 A;  2MK5 A;  2JJ9 A;  1OZ2 A;  1EZZ B;  1TS9 A;  5FRO A;  2RQT A;  1Y57 A;  3EHR A;  2QYZ A;  4QVZ A;  2CDT A;  2FPD A;  2ABL A;  4M7A B;  1UDL A;  4C8Q G;  4FL6 A;  3JCM Q;  2EBP A;  2PTK A;  3OW2 P;  2HKQ B;  3SHW A;  1FXX A;  1UGS B;  1OU8 A;  1K8A R;  4E2F B;  5GAN h;  4FYX B;  4LDU A;  1VQP Q;  2LC4 A;  2OAW A;  3CCM T;  5CCA A;  4DBF A;  1RAD B;  1D3B A;  3RKW A;  1T3L A;  3MEA A;  3M9Q A;  4FYY B;  3OS1 A;  1ZUU A;  2KT8 A;  1KG1 A;  3JCM d;  1KD1 C;  1PC0 A;  2JVV A;  3HFN A;  1VQM T;  4Q5W A;  1MV0 B;  4HT8 A;  4MZT A;  1D0Y A;  3GPL A;  1VQP A;  2RK2 A;  2RQU A;  2YHT A;  3CPF A;  5C6S A;  2Z0W A;  5KE2 A;  4QW2 A;  2AT1 B;  2MYS A;  2GCX A;  3OY9 A;  1SSH A;  4C0F A;  4XTY A;  2RH2 A;  2ED1 A;  2HAX A;  1KC8 R;  1SF9 A;  4O5V A;  1TTH B;  1AD5 A;  1P92 A;  2P0Q A;  1QVF S;  3EGX A;  3VUB A;  1X27 A;  1BKB A;  5DM7 R;  2LQ8 A;  2E3I A;  2RQR A;  3L2R A;  3S3N A;  3VS6 A;  2XDP A;  4C0D B;  3CCM Q;  1PKS A;  3OS2 A;  2L3S A;  3OSV A;  4QQG A;  3V8K A;  5EG2 A;  2DE0 X;  4C8Q B;  4LDY A;  2V1R A;  7AT1 B;  3TSW A;  5L8R E;  4BI3 A;  1VQM Q;  2H3E B;  2DZ9 A;  1RAI B;  2SEM A;  3VV0 A;  5A0L A;  2Y4X A;  2GF7 A;  4FM4 B;  3CCM A;  2JN0 A;  3JCM b;  4LXC A;  1M1F A;  1U3O A;  1NJI C;  3N5B B;  2NUP A;  2DXU A;  1IGQ A;  5GAN 4;  1WI7 A;  1AZG B;  4J7I A;  3OW2 A;  3G71 T;  1T0H A;  1B07 A;  1WGS A;  4O6J A;  3INZ A;  1Y0M A;  5IT9 E;  2X3W D;  2K3B A;  2KE9 A;  3L2U A;  1R0B G;  2A08 A;  1ZQ1 A;  2J7I A;  4JRI A;  1WHG A;  3OYF A;  4LD9 K;  2XIC A;  4J8O A;  1QW1 A;  1K76 A;  2KGT A;  4JRQ A;  1V76 A;  1QVP A;  4R0K A;  2LMJ A;  3VKI A;  1VQL A;  2YUQ A;  4WF2 A;  1LPL A;  1U1T A;  1ZA1 B;  4OB2 B;  4M77 D;  5GAO r;  3EGD B;  4EDU A;  3ULR B;  2ZGW A;  2RB6 A;  2QEX A;  2KRO A;  5CQY A;  3RMS A;  5KYY A;  3A8H B;  2AKK A;  3G71 Q;  4AMC A;  4E7S A;  3H9N A;  5J26 A;  4Z88 A;  3UA7 A;  1EFN A;  3CCL A;  2J6F A;  2QA4 T;  2YRC A;  4R56 A;  1TG0 A;  1IB8 A;  4JPB W;  4M75 A;  3QHS A; 
#chains in the Genus database with same CATH homology
 4ZGJ B;  3CC4 T;  1ZHI A;  2DD4 A;  2LDM A;  4XU3 A;  2E12 A;  2BIV A;  1TH7 A;  3E9F A;  3TCJ A;  1UGR B;  4BD3 A;  2JNG A;  3OYJ A;  1YIJ T;  1KD1 U;  3G71 A;  2DVE A;  4M77 G;  4C8Q A;  4F7U A;  4N4H A;  4OB1 B;  2KAF A;  3PMT A;  3CC2 T;  2FHD A;  1H64 1;  1V29 B;  2IVW A;  3M4Y A;  1K9M U;  2HQX A;  3OMC A;  1IZ6 A;  4NL2 A;  4M7D D;  2Y90 A;  5GMK j;  3WXM B;  1Y96 A;  2RD1 A;  3MEV A;  1WNL A;  3M5A A;  3OBW A;  4RCB A;  5CQX A;  2HBP A;  1YJW T;  1NPR A;  4BB7 A;  3JB9 D;  1VQ9 T;  1K8A U;  3M59 A;  3CD6 A;  4IKF A;  5LJ3 f;  4E7L A;  2LVM A;  2L89 A;  5GAN 7;  2GFA A;  1VUB A;  2F5K A;  3DLM A;  3SD4 A;  4KUL A;  2DTI A;  2B8A A;  5DLO A;  1N8R C;  3PTA A;  2DTO A;  1KQ1 A;  2EQK A;  4OB0 B;  2EYQ A;  2ZCF B;  2XU8 A;  2ZPG B;  4CRI A;  3GP8 A;  2MAM A;  2XD0 A;  3E9G A;  2P4T A;  3OS0 A;  3JCM f;  5GAM f;  1I5L A;  1VQO A;  4XTX A;  1SSF A;  3G7Z A;  4C0G A;  4M78 D;  4IUP A;  1VQ8 T;  1VQK A;  4M7A C;  1H3Z A;  1UGQ B;  1LJO A;  3A8L B;  3OW2 S;  3CMA T;  5GAO m;  2QQ9 A;  4EMK C;  5HK0 A;  2EAY A;  4XK8 E;  2I2L A;  1YHQ A;  3JCM g;  4PJO C;  5KE3 A;  5GAM g;  5GAN 5;  2PUO B;  2EKO A;  3HRS A;  3L2Z A;  4M7D G;  3M55 A;  5GAN d;  3CCV T;  2EQJ A;  2RM4 A;  4OF1 A;  4BY6 B;  4L5G A;  2DJZ A;  4QVC A;  4CI0 C;  2CZ1 B;  1VQ6 T;  3M53 A;  3MO8 A;  3G6E T;  3A5Z B;  4N0A A;  3S3M A;  3JB9 G;  1N8R U;  1AHJ B;  1X75 C;  5GAN 3;  2LNV A;  1YIT T;  1GXI E;  4J7F A;  4NL3 A;  2LQK A;  1M5Q 1;  1OZ3 A;  1NZ9 A;  1JBM A;  3S6W A;  3MHX A;  5FU7 C;  2RI2 A;  2DIG A;  4KBM B;  3OYY A;  4MDW A;  3UT1 A;  4C5E A;  1VQM A;  1S72 A;  2DXC A;  3SDZ A;  2VV5 A;  2RI3 A;  2DXB A;  2PUK B;  3VJP A;  3CCQ A;  1K73 U;  1W2B A;  1U1S A;  4M7A E;  3P8B B;  1XNI A;  3V8L A;  1LNX A;  3J80 E;  1Q82 U;  2X4X A;  4E47 A;  2QA4 A;  3A8G B;  3M58 A;  4HCB A;  4PJO E;  3GNF B;  4M78 G;  4FSX A;  1NJI U;  1KQS S;  2QQA A;  4ATO A;  4RG2 A;  5HKC A;  4E7H A;  1YI2 A;  4M77 B;  2FB7 A;  3BW1 A;  3MP8 A;  3CCE T;  4M77 F;  3CCJ A;  2CKK A;  1RI0 A;  3DB4 A;  4N4G A;  2JTF A;  1VQN A;  3FIF A;  5CKH A;  3PGG A;  2A7Y A;  2QTX A;  4EMG A;  5KCH A;  3H8Z A;  3EFR A;  3JCM W;  2F69 A;  2H3J A;  2YLC A;  2PU9 B;  3QZ5 B;  4PLL A;  3BDU A;  4Y28 E;  4C92 C;  4EPC A;  3CPW S;  3SB2 A;  5HK3 A;  1U8R A;  3URG A;  5GMK h;  3P8D A;  2X4Y A;  3CBP A;  3RMQ A;  2YRV A;  3LW5 E;  3L2Q A;  3L2W A;  5CO7 A;  3RKY A;  3PT9 A;  5A2Q E;  3G4S T;  2JUF A;  3RKX A;  2DZC A;  4IUV A;  4L6V 5;  1VQ9 A;  1Y07 A;  5GAN 2;  4DA4 A;  1M90 C;  2XI9 A;  3HHT B;  5GAN f;  4KT0 E;  1M9S A;  4J6Y A;  2Y4Y A;  2P0K A;  5CKD A;  4ELY C;  5LJ3 e;  1Y7X A;  2RHI A;  2DO3 A;  4LD6 A;  4M75 C;  4B9W A;  3X28 B;  3L2V A;  2HD0 A;  4ZTJ A;  5GAN 6;  4OB3 B;  1YBY A;  2MWO A;  5GAM j;  5GAN g;  1BI0 A;  2EWN A;  2LCL A;  1YJ9 A;  4J5Y A;  4PJO B;  4C0Z A;  2DEQ A;  1Q7Y U;  2ZPB B;  4GLK A;  2CYZ B;  2EQM A;  4XU1 A;  4C8Q C;  2M16 A;  3QII A;  3I56 T;  4M7D B;  3LX7 A;  2DK3 A;  2PQW A;  4C92 E;  3JCM e;  5GAM e;  1VQ4 A;  5FRN A;  2FYK A;  2M9U A;  2EFI A;  3CMA A;  4M7D F;  3LLR A;  4XTZ A;  2K4Y A;  2X4J A;  2RK1 A;  2K5L A;  3C12 A;  3OA6 A;  2R5M A;  1M1K C;  1XQH A;  3FB9 A;  3JB9 F;  2OTJ A;  4IUQ A;  1XOV A;  3JRZ A;  2DXT A;  2OTL T;  1QP2 A;  2KVQ G;  2XDB A;  2K5I A;  3HL8 A;  4BI4 A;  3CME T;  3CC7 A;  4E7K A;  3MEU A;  3TU4 K;  1N6A A;  3Q1J A;  3SWN B;  2GFU A;  5CIU A;  4OVA A;  2WSC E;  2D0Q B;  4M75 E;  5IN1 A;  3LWH A;  2JOY A;  2K3Y A;  3LGL A;  4M7A D;  4A4F A;  4GY5 A;  2KQW A;  3HRU A;  5IAY A;  4QVD A;  2E6Z A;  4R55 A;  2DTH A;  3I55 A;  4BDZ A;  1Q86 C;  3OS5 A;  4XU0 A;  2E65 A;  1B34 B;  2ZPE B;  5FU6 C;  5A0D A;  4LDX A;  5LJ5 d;  4PJO D;  4A4K A;  4C8Q E;  2FVU A;  4M78 B;  4F7U E;  3OYK A;  1BIA A;  4BUG A;  2EQU A;  2R5A A;  2ZPH B;  4MMK A;  4YTL A;  3BY7 A;  5J3B A;  4JLG A;  5J39 A;  1QP3 A;  5LL6 S;  4BE2 A;  1VQ5 A;  3E19 A;  2BUD A;  2KDS A;  2RI5 A;  4XTU A;  1D3B B;  2LCC A;  3FLG A;  3M57 A;  2XK0 A;  1Q81 U;  4C5I A;  4II1 A;  3ASK A;  3GIB A;  3JB9 H;  4JUV A;  4X9D A;  4HCC A;  3OBY A;  2RHY A;  1WPY A;  3QKJ A;  4OP0 A;  4ZGE B;  3CCE A;  3JB9 J;  4ME7 A;  4C92 B;  3OYE A;  4C5H A;  1YJN T;  3OYG A;  4QQ6 A;  4ZN1 A;  2GQV A;  4N0A C;  4JDS A;  3CCU T;  2OAU A;  2RJE A;  3CBM A;  5LJ3 g;  4VUB A;  2CZ7 B;  5D6X A;  3OYD A;  3L1A A;  3UWN A;  4XQ3 A;  4EMH A;  1ZBX A;  1FWZ A;  4XTW A;  2LT1 A;  3RUX A;  4M7A G;  2E41 A;  2KSS A;  2K3X A;  2X4W A;  2WSF E;  4J6W A;  2LTO A;  4N4I A;  4JS4 A;  1WJS A;  3EFS A;  3T9N A;  5CR2 A;  4PKC C;  3JCM P;  3DB3 A;  4IUT A;  3QYG B;  4M75 B;  3C95 A;  4PJO G;  4JS5 A;  1VQL T;  3PNW C;  4HKE A;  2ZPF B;  1KHC A;  1QVF A;  2O4X B;  3CCJ T;  5D6Y A;  1W4S A;  4F7U B;  3E1S A;  4M77 A;  3TRE A;  5GAN e;  4ZGD B;  2QEX T;  2MI6 A;  3DLL A;  1W2B S;  3LH0 A;  3JCM h;  4C92 D;  4FT2 A;  5CK9 A;  5GAM h;  3JCM X;  5GAO q;  1JJ2 A;  2YLB A;  3X20 B;  2FL7 A;  1KC8 U;  4MZP A;  1X01 A;  3QUI A;  3GLX A;  5LJ5 f;  2VGN A;  4V2S A;  3QYH B;  3PMI A;  1M4Z A;  5D6W A;  2HNI A;  4HCZ A;  3CCL T;  1VQP T;  1M1G A;  2QDY B;  2RO0 A;  4J6X A;  2D6F A;  1I8F A;  4NS5 A;  1RL2 A;  1Q82 C;  4M75 D;  5GAO n;  2NLU A;  1R8O B;  2XG8 D;  5LJ5 g;  3OYC A;  4FT4 A;  2VC8 A;  1QVG A;  3OQ5 A;  1BI3 A;  2R58 A;  2OTL A;  2P0P A;  1OI1 A;  3HSB A;  3VUZ A;  2G3R A;  1MHN A;  1VQ7 A;  1PSF A;  4C8Q D;  2JTM A;  3CC4 A;  1YIJ A;  2QXF A;  3WVD B;  5I2M A;  3MP1 A;  1UB4 A;  3OYA A;  3OYB A;  4OGE A;  4A4G A;  5CKB A;  4PNO A;  2M0O A;  3GNG A;  4J83 A;  4XAX B;  5KH6 A;  3CC2 A;  3PFS A;  3UDC A;  3HPW A;  4C92 G;  2C06 A;  3J7A F;  4PJO A;  4L59 A;  2KY9 A;  3CCS T;  4M7D A;  2VXE A;  3OMG A;  2QQS A;  4X34 A;  3CD6 T;  2M1H A;  1YJW A;  4HT9 A;  3FEO A;  4HA8 A;  2HQE A;  1OZ2 A;  3L42 A;  3QO3 A;  5LJ3 j;  2E5Q A;  4BDY A;  4Z02 A;  5FRO A;  5I2S A;  3C94 A;  4E7I A;  2R57 A;  4PLI A;  2KK4 A;  4M75 G;  4QVZ A;  4C0D C;  2CZ6 B;  4M7A B;  3SWN A;  4A4H A;  2K57 A;  4M7A F;  1NPP A;  2DKG A;  4EMK B;  5GMK l;  3PIO A;  1VQO T;  3JCM V;  2MMP A;  4C8Q G;  2VUB A;  3QBY A;  2EJ9 A;  4FL6 A;  4F7U G;  3JCM Q;  3J81 E;  4OMF B;  4PJO F;  1BI2 A;  1VQK T;  3KUF A;  1B34 A;  2QI2 A;  1VQ8 A;  1FXX A;  2QQB A;  1UGS B;  1YHQ T;  4M78 A;  4KUI A;  5FRM A;  5GAN h;  4LDU A;  1M90 U;  1KHI A;  2LC4 A;  5FLX E;  3CCM T;  5CCA A;  4DOV A;  4RCC A;  3VYG A;  5I21 A;  2WAC A;  3LWI A;  3FRN A;  1D3B A;  3CCV A;  2LT4 A;  3RKW A;  1VQ7 T;  3QG1 A;  4IUR A;  2RJF A;  1VQ6 A;  2CS7 A;  3MEA A;  3M9Q A;  5FU7 B;  3OYN A;  3G6E A;  5DY9 A;  1G5V A;  3OS1 A;  2E1H A;  3AHU A;  4BY6 C;  5CKE A;  1YIT A;  4C92 A;  1KG1 A;  4IUU A;  2RJD A;  3JCM d;  5GAM d;  3MEW A;  4ELZ C;  1KD1 C;  2JVV A;  3HFO A;  3RES A;  3FC3 A;  4RKU E;  3HFN A;  3ME9 A;  4Q5W A;  2ZZD A;  1VQM T;  3H6Z A;  1S72 T;  4HT8 A;  4MZT A;  3BFM A;  1K9M C;  2DPP B;  2IG0 A;  4LDW A;  4M78 F;  3GPL A;  4A54 A;  5LJ5 e;  3CCR T;  1VQP A;  2RK2 A;  3CXC A;  2PVG B;  3GOX A;  3CPF A;  2YHT A;  5C6S A;  5KE2 A;  3MP6 A;  4X9C A;  2CZ0 B;  2RHX A;  4QW2 A;  4JLI A;  3JSC A;  2JZ2 A;  2RHZ A;  1EIF A;  2GCX A;  3V7S A;  3O8V A;  1YI2 T;  1IRE B;  4C0F A;  3OY9 A;  1Q81 C;  4XTY A;  2RH2 A;  1K8A C;  3HRT A;  2LX9 A;  2K2V A;  4QQD A;  1YCY A;  3NTI A;  3LGF A;  3ZEH A;  1VQN T;  5C0M A;  4RMO A;  2HAX A;  2O4X A;  4O5V A;  4PL6 A;  2MWP A;  4C92 F;  2XHC A;  4M77 C;  1Q86 U;  3KXT A;  4DOW A;  1P92 A;  3CBO A;  2LRQ A;  3QDR B;  1WJQ A;  2P0Q A;  5DLQ E;  1QVF S;  2BKD N;  2DAQ A;  4MZM A;  3V7C A;  4C5G A;  2ZPI B;  3VUB A;  1BKB A;  5DM7 R;  3OB9 A;  4A4E A;  3CCS A;  4DQ2 A;  4BE0 A;  1JJ2 S;  3ER0 A;  2LQ8 A;  4JRP A;  2O01 E;  5LJ3 h;  1X6O A;  3G4S A;  3L2R A;  4E7J A;  3S3N A;  1G3T A;  3NTH A;  4OGC A;  5GAN j;  2XDP A;  4C0D B;  3FJP A;  4M75 F;  1UGP B;  3SFM A;  3GF5 A;  5GMK e;  4ZTF A;  4P5N A;  3OS2 A;  1LOJ A;  2XDD A;  1HXD A;  3OSV A;  2L3R A;  4QQG A;  3M56 A;  3OSS C;  3V8K A;  2A3L A;  2MF2 A;  5EG2 A;  4C8Q B;  3JB9 I;  3NTK A;  4LDY A;  1O75 A;  2V8I A;  3X26 B;  4C8Q F;  4F7U F;  3QXE B;  4B9X A;  1YJ9 T;  2DIQ A;  3HP9 A;  3TEE A;  4Y91 A;  5L8R E;  4MML A;  4M77 E;  4BI3 A;  2L5Q A;  3M4G A;  1PSE A;  3OYL A;  4JJN K;  5CKF A;  1QVG S;  1KC8 C;  1G3W A;  2RHU A;  1M8V A;  1N9R A;  1VQ4 T;  1Y96 B;  4BI8 B;  2DZ9 A;  3I56 A;  3JCM J;  1BIB A;  2EJF A;  3VV0 A;  3WVE B;  5A0L A;  2Y4X A;  5GAO p;  2X35 A;  1K73 C;  2GF7 A;  3F70 A;  4FM4 B;  3CCM A;  1N27 A;  2OTJ T;  2JN0 A;  3JCM b;  4M7D C;  4XTV A;  1M1F A;  3CC7 T;  2E10 A;  1NJI C;  3N5B B;  3ZBD A;  1FX7 A;  2VGM A;  3CME A;  5FU6 B;  2DXU A;  3A8O B;  5GAN 4;  2EIF A;  1WQ7 A;  4J7I A;  5GMK m;  3OW2 A;  5KCO A;  3G71 T;  3I55 T;  5LJ5 h;  3X25 B;  3R6O A;  3FDR A;  1NE8 A;  4M7A A;  2QQR A;  1G3Y A;  3SWN C;  4LDV A;  3OYH A;  1WGS A;  4O6J A;  3DKM A;  4UC4 A;  4EMK A;  3INZ A;  3RER A;  5IT9 E;  1VQ5 T;  3CCR A;  2RA2 A;  3QPH A;  3QJY A;  1WQW A;  1JRI A;  1O9S A;  4FU6 A;  4M78 C;  5GAO l;  3L2U A;  2D9T A;  5GAN 8;  5CVI A;  3ZFJ A;  4FIB A;  1VIE A;  4M7D E;  1ZQ1 A;  4A53 A;  3KBG A;  3BDL A;  3S3O A;  4JRI A;  5M9O A;  4NOY A;  4D6W A;  2L8D A;  3OYF A;  4LD9 K;  5AYF A;  1YJN A;  3OYM A;  2XIC A;  3P8H A;  3PIP A;  5HY6 A;  3CCU A;  4J8O A;  2E64 A;  1QW1 A;  2V8K A;  2XKO C;  1KQ2 A;  1DJ7 B;  1KQS A;  1HK9 A;  3QJ6 A;  1Q7Y C;  1BYM A;  2VXF A;  1WJR A;  4JRQ A;  3HKS A;  3V8J A;  2VYT A;  2PVO B;  2F5T X;  2PVD B;  3A8M B;  3OYI A;  3MET A;  1QVP A;  3MCA B;  3VKI A;  1VQL A;  1XTD A;  4RG8 A;  5LJ3 d;  3X24 B;  1UEB A;  1N9S A;  4M78 E;  4WF2 A;  3VYH B;  3VU3 C;  1U1T A;  4OB2 B;  4TVR A;  4M77 D;  3V7R A;  5GAO r;  1JB0 E;  4EDU A;  1Y71 A;  3CPW A;  2WSE E;  3LYI A;  2ZGW A;  3EAE A;  2CGH A;  2RB6 A;  3CXC S;  2QEX A;  3UPU A;  5CQY A;  4BE1 A;  3RMS A;  4JRK A;  1MGQ A;  2K5F A;  3A8H B;  2DD5 A;  4ZN3 A;  2E70 A;  2RJC A;  5LJ5 j;  5CAI A;  4KUD K;  3CEY A;  5J26 A;  4MDX A;  3RIR A;  3CCQ T;  1M1K U;  1BI1 A;  2AHJ B;  1I81 A;  5A0G A;  1VIF A;  3CCL A;  2KMT A;  3M54 A;  2QA4 T;  3JAM E;  1OYX A;  4R56 A;  3QSU A;  4BAC A;  2E6N A;  5GMK i;  2EJG A;  3C4S A;  3JCM c;  1G3S A;  3QZ9 B;  4M75 A;  4XU2 A;  1I4K 1;  2V8J A;  2XID A;  3NFC A;  3QHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...