4TVRA

Tandem tudor and phd domains of uhrf2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
273
structure length
222
Chain Sequence
TSARARLIDPGFGIYKVNELVDARDVGLGAWFEAHIHSVTRADEDVIYHIQYDEYPESGTLEMNVKDLRPRARTILKWNELNVGDVVMVNYNVESPGQRGFWFDAEITTLKTISRTKKELRVKIFLGTLNDCKIISVDEIFKIERPGAHPLSFADGKFLRRNDPCDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVAYHIYCLNPPLDKVWYCPSCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase UHRF2
publication title Structure of the Tandem Tudor and PHD domains of UHRF2
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 38
structure length 222
sequence length 273
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
A PF12148 TTD Tandem tudor domain within UHRF1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4tvrA02
1VQ6A 1VQ9A 1NZ9A 3DB4A 3G4ST 1VQ7T 1K9MC 2JUFA 1KC8U 3I55A 3CCMA 1Q81C 5DLQE 2JVVA 3CC2A 2E6ZA 3CXCA 3CCRA 1M1GA 1VQ8T 1VQ5A 3P8BB 2OTJA 2JNGA 1N8RC 1VQOT 3CCLA 3TREA 1XTDA 3DB3A 2DO3A 1NPRA 3I56T 3J7AF 2IG0A 3I55T 3G4SA 3OW2A 1VQ7A 5HY6A 2MI6A 1Q7YC 3G71T 1K73C 3LGFA 3CCJT 2QEXT 1SSFA 4YTLA 5IAYA 1VQ8A 3CPFA 2L3RA 5FLXE 1IZ6A 3G6ET 1VQOA 3I56A 3CPWS 1YJNT 1KQSS 2G3RA 3HKSA 3LGLA 1BKBA 1YI2T 5J26A 1YJ9T 1M90U 1JJ2A 3G71A 3CCJA 2QEXA 3CCUT 3CC4T 4RG2A 3CCET 1Q86U 3G6EA 1KD1U 1KC8C 1VQLT 1VQKA 1X6OA 2EIFA 5J3BA 1VQMT 1NJIU 3CD6T 1YJNA 1W2BA 1QVFS 1YI2A 1YJ9A 2OTLT 2LVMA 4ZN3A 1Q86C 3PIOA 5LL6S 3CCST 2QA4T 5A2QE 1QVGS 1Q82U 3CCUA 3CC4A 3J81E 1VQKT 5DM7R 3CCEA 2MWOA 4QQDA 1M1KU 3OYYA 1VQLA 3J80E 2LCLA 3CCQT 3CXCS 1VQMA 3CD6A 4CRIA 2KVQG 1VQNT 1YJWT 2OTLA 1K8AU 2QA4A 3CCSA 4TVRA 1K9MU 3CCVT 5IT9E 3OW2S 4ZN1A 1YIJT 1Q81U 3CMET 2E70A 1M90C 2MWPA 4X34A 3CCQA 1QVFA 3LH0A 3ER0A 1N8RU 2KDSA 3A5ZB 1VQNA 1YJWA 1VQ4T 1KD1C 1VQPT 3CC7T 3CMAT 3CPWA 1KQSA 1YHQT 3CCVA 1NJIC 1YITA 1Q7YU 1K73U 1NPPA 3DLLA 1XNIA 2XHCA 1YIJA 1JJ2S 1S72T 3CMEA 1UEBA 1K8AC 1VQ6T 1VQ9T 1Q82C 1YBYA 3CCMT 1VQ4A 1VQPA 1M1KC 2LQ8A 1KHIA 3CCRT 1VQ5T 3CC2T 2CKKA 3CC7A 1YITT 2OTJT 3CMAA 1W2BS 1YHQA 3CCLT 2JOYA 3PIPA 1S72A 1EIFA 3JAME 1RL2A 1QVGA 3KBGA
chains in the Genus database with same CATH superfamily
2QG9B 3G4SQ 2ZPFB 1RAAB 1JQQA 4BE2A 3I55A 3M0UA 4CC7A 1N6AA 5I22A 1MNEA 3CC4Q 2LX7A 1ARKA 4OB0B 4RTWA 3MEUA 2EQMA 3MEVA 3OYDA 3OBYA 2EGEA 1Y07A 4BI8B 3M53A 1BB9A 5LJ3j 4C0ZA 3G6EQ 3HFNA 4A4HA 2RHYA 4XU1A 3EFRA 2X51A 3LGLA 2FRWA 1AEYA 3MEAA 4QW2A 4D6WA 1Y0MA 3OYJA 2IPOB 1VQLT 5FU6C 1WDXA 3CD6Q 4RUGA 4HCKA 1X6GA 3UATA 2HEQA 2CSQA 1G3TA 3CCST 4HT9A 1HSQA 2LJ3A 4A4KA 2MWOA 3MP8A 2E5QA 3L42A 2LCLA 4KBMB 2LC4A 1FMWA 4M7AA 3GIBA 2L8DA 4E7LA 4M75A 3U23A 3HHTB 1YITQ 3CBMA 3CMET 2F5TX 1WNLA 4AFQC 4M78C 4R0KA 5CQYA 3SB2A 3P8DA 4ZGEB 2KBTA 3A8MB 4ZGJB 1AOJA 1Q7YU 3TEEA 1MV0B 3WVEB 1EFNA 2AKLA 3VJPA 2QYZA 5LJ5e 2DVEA 3UA7A 4IUUA 2L3SA 5LJ5h 5GMKj 3ZL7C 1LNXA 3PNWC 3CCLT 1I5LA 5A0DA 2RJCA 1RAEB 1MGQA 2F69A 1VQ9A 5GAMd 4E7JA 1SPKA 1WHKA 1Q81C 1M30A 4J6WA 1WX6A 4WTOB 2L2PA 2XIDA 1UHCA 4J9FA 1RI9A 4HVWA 2DXUA 3HPWA 5IXBA 3JCMg 2W0ZA 3REBB 2WACA 4A63B 3I55T 3G4SA 1XJWB 1QVGP 3G71Q 2KT8A 1QCNA 3LGFA 1X6BA 5IXFA 2QEXT 1MNDA 2L3RA 5CVIA 3QKJA 3DKMA 3CXCP 1Q81R 1WIEA 2X4JA 3QWXX 4LD9K 4M7AG 2QDLA 3TQ7P 1JXOA 4M75G 1YJ9T 1I07A 2QASA 2NWMA 4M7DG 4C8QD 1V1CA 3CCUT 4A54A 3G6EA 2EYWA 3PMTA 3RERA 1VQMT 4M78F 1M9SA 1IHWA 1HK9A 4ZN3A 1Q86C 3L1AA 5GAN6 1FMKA 2E6NA 3C94A 3CD6A 3RR6A 2V8JA 4K11A 3RMSA 1ACMB 2QGGA 3JCMQ 4ME7A 1PSFA 4KGZB 5EC7A 3EAEA 1AHJB 5GAMf 2D9TA 1VYUA 2AKKA 4J9DA 4BD3A 2A3LA 1YITA 1NPPA 4ZTFA 5FU7B 2GFUA 4AFUC 4FL6A 3I56Q 5GMKl 4LD6A 1YP5A 3OYEA 2JOYA 3OBWA 1RL2A 1VQ6A 5FW9A 2F1LA 1BYMA 2D1XA 3CCRA 3TSWA 2OTJA 4KT0E 4DBHA 1D0ZA 2HMAA 4GBQA 1YCYA 2DL5A 1WLPB 3H8ZA 1SHFA 2CDTA 1BI2A 3FJ5A 5LJ5j 1AWOA 2AHJB 5HY6A 2VWFA 3BE3A 1QP3A 4N4IA 1N9RA 1XOVA 5HCKA 3VS6A 2RH2A 2X35A 2ZPEB 3G71A 2BE9B 3VYHB 2X4WA 1ZBJA 3CC4T 3EGUA 1U1TA 1UGVA 3LYIA 1PSEA 2KRSA 1YFNA 2PNIA 4IUPA 3BW1A 4PJLA 2D8HA 4BI3A 2CS7A 2DLPA 2P0KA 4L59A 1YJNA 1M4ZA 1KQ1A 2KRMA 2R5AA 2LVMA 2BE7D 2ED0A 2J6OA 4ESRA 1RACB 2VXEA 5GAN2 2HBPA 4J9HA 5CO7A 1TWBA 1JEGA 1T0JA 3OS0A 4M7DC 2L5QA 3GP8A 3NTHA 2VC8A 3FB9A 5CQXA 4MZMA 5L8RE 2JMAA 2NUTB 3LLRA 2KT1A 2K6DA 1I5OB 1SRMA 1MMAA 5CKDA 3CPWA 3JCMe 1S72Q 3O8VA 1VQOQ 1RI0A 2YWWA 3FC3A 2X4XA 3P8HA 4GY5A 3E19A 1ZUYA 2LQ8A 4Q5WA 3VRYA 2RHXA 3CC7A 1YITT 2LJ1A 1N9SA 2SEMA 4XU0A 3JAME 2F5KA 2DKGA 3RNJA 2YSQA 4O5VA 3P8BB 2X4YA 3M5AA 2CREA 3QDRB 2NYSA 1I4K1 4E2FB 2PQWA 1I81A 1U1SA 4IURA 5M9OA 2LZ6B 1QWEA 4PJOD 4DQ2A 2EQJA 2O2OA 3CCQQ 2KY9A 4M75F 1BKBA 2CP5A 4M7DF 1G2BA 2DIQA 3D7SB 1WPYA 1T3SA 1FX7A 4E7HA 3REAB 4JUVA 1VYTA 8AT1B 1X6OA 2JS2A 1NYGA 1OI1A 1W2BA 2FL7A 2AT1B 2QXFA 1M27C 2EKHA 5A2QE 2FO0A 4KGVB 5GAMg 4J8OA 4Z02A 2RF0A 1QP2A 3QZ5B 1AVZC 2DPPB 3G1JA 5CAIA 1QVPA 1Y96B 4N0AC 1Q7YR 1VQ5Q 1ZSZB 1RLPC 2GFAA 2LDMA 1Q81U 1KHCA 4X34A 1M8VA 1U06A 3AT1B 2IIMA 3URGA 4RKUE 4E7ZA 2DXBA 1FYNA 2OJ2A 2H8HA 1YIJA 4LE9A 3SEMA 6AT1B 2NLUA 1SF9A 2OX7A 3VS0A 2HQHA 3TSZA 2MIOA 1PCXA 3UPUA 1VQPA 4C0FA 1TG0A 2ZAEA 1P92A 4M77D 3FEOA 3PIPA 2XD0A 1S72A 1KQSP 5KYUA 4FW2A 3VRZA 3PE0A 2HQEA 1K9MC 1KFZA 4C8QB 3MO8A 4CI0C 3QIIA 1UUEA 2DL4A 2ECZA 4B9XA 1WHMA 3M0RA 2LQKA 3DB3A 3I56T 1YWOA 4M77C 4EMHA 3N5BB 2DL7A 2QEXQ 3JB9D 1K9MR 2RQVA 1X2QA 1JU5C 1IZ6A 4BI4A 5FLXE 1HD3A 1PD0A 2RHUA 5A0GA 2KXCA 1M8MA 2KE9A 1D1BA 2D6FA 4MDXA 1FWZA 3A8HB 4IIOA 2RJDA 2FHDA 5CR2A 1C6VX 3CCUQ 1OPLA 2M02A 2D8JA 3JCMJ 4FYYB 2DETA 2DXTA 4ATOA 5C6SA 5IN1A 1OEBA 1QKWA 2E3IA 2O01E 1UGPB 4IUVA 2AZSA 1B34B 1S1NA 3CMAQ 2K9GA 1VQLA 1VIFA 1K0SA 1WHLA 3OSVA 3A1PA 3OYKA 3S6WA 3QYHB 4RG8A 3CCMQ 2RMOA 3CCSA 3CC2Q 3OW2S 1KQ2A 2RI2A 1NEGA 1Y96A 4XTVA 3EGXB 1BIAA 2K3XA 1QVFA 1ZSZA 2RB6A 2EAYA 2JJ9A 1UGSB 1R8OB 1KD1C 2F2XA 3H0HA 3MJXA 1YHQT 2DRKA 4HVUA 3V7CA 3CMEA 4OGEA 2D0NA 5GAOr 1D1AA 4M77F 4PL6A 4QQGA 2E5KA 3M56A 4C92D 3ASKA 3X20B 4JRQA 2HQXA 2JW4A 3CCJQ 1U5SA 4QVDA 2JTEA 2AZVA 1KD1R 4EMKB 2K5FA 4PFZA 3RDVA 2FZGB 4AG1C 3CEYA 1T0HA 2BTTA 2RHIA 2JM9A 3HRTA 2EJFA 4OP0A 4C92C 5KCHA 5FWCA 1CKBA 4C8QA 2JNGA 3SWNB 1VQOT 2PVGB 3CCLA 1XTDA 3JB9F 4A53A 3UA6A 3MP6A 4KH0B 2JTMA 1Y71A 3L2VA 4XU3A 4PK4A 1M2OA 3HTRA 4F04B 2O9SA 5GAMe 1QCOA 2CZ7B 1M5Q1 2DBMA 5GAMh 1AD5A 4RCBA 1UHFA 2VV5A 3V7SA 3OYCA 3VU3C 1EX4A 3WXMB 2QEXA 1VQNQ 1RAHB 2QTXA 4J9BA 3CBOA 1NBEB 3C4SA 1RAGB 5L23A 4JLIA 3VS5A 1SSHA 3M9QA 5LJ3d 2L3QA 1QVFS 2JZ2A 1YJ9A 3RBBB 3EG1A 1ZUUA 4IKFA 2QA4T 3CCUA 1WGSA 2XDPA 5DM7R 3ULRB 1B34A 1BBZA 3E9GA 3CCQT 1N5ZA 1YNZA 2RQUA 1VQMA 2DTOA 4RCCA 2DK3A 3GOXA 2JM8A 1QCFA 3LW5E 4A4GA 1KSWA 2I0NA 5I2MA 2RO0A 4KUDK 2M9UA 3S3MA 2QQBA 1OQKA 3EGXA 2HDAA 4JJDA 2LMJA 3TU4K 2M1HA 1VQ7Q 2MMPA 1K76A 4M78D 1IB8A 1LVKA 1AT1B 4C92F 2RI5A 1TTHB 3RESA 3PMIA 1OZ2A 4MMLA 2PUKB 4OGCA 2J7IA 1GCQC 2R58A 3S3NA 1M3BA 4ZTJA 2O4XB 1VQ5T 4QKUA 1QW1A 5J39A 4N4GA 2ROTA 4RTXA 4EMKA 2BKDN 2HBWA 5GAN4 2E3HA 1ZBXA 3JCMX 1M1GA 4BACA 2QDYB 2DYIA 1WHGA 3LWHA 3TREA 7AT1B 1OX8A 3SWNA 2CUBA 2J6FA 4GLKA 5LJ3f 4HCZA 2OAWA 4X9DA 1C1AA 1F1BB 1UDLA 3JCMV 4PFOA 1SSFA 3VS4A 3OB9A 2O31A 4JRKA 5C0MA 2E1HA 2K2MA 2PU9B 3X24B 3HKSA 4QQ6A 5AT1B 4PJJA 2ROLA 4XTWA 1D09B 2E12A 1UTIA 4FYVB 1NM7A 3CCET 2CZ1B 4X9CA 2L0AA 3O5ZA 4E7KA 3WVDB 4V2SA 1UG1A 2DAQA 1UJYA 2P0QA 2QK0A 5GJVB 2R5MA 2Y4YA 2HL3A 3CC4A 4LUEA 4OMOA 2CUDA 3I35A 4Y91A 1MMGA 2C0OA 3J80E 5KCOA 3RUXA 3THKA 4FSSA 3M0PA 1K9MU 2ZZDA 2YRVA 2HL5C 3AHUA 2GQIA 4VUBA 1WXUA 2VYTA 2XU8A 1CKAA 2EGAA 4DBFA 1V76A 4FT4A 4FSXA 3UDCA 3CMAT 1VQ8Q 2FRYA 1XNIA 1JJ2S 4JS5A 2B86A 4KGXB 1O9SA 2RHZA 1Q82C 1SHGA 4LDVA 2Y4XA 3CCMT 2GNCA 4R56A 3CC2T 2COYA 2QQ9A 2O4XA 4OVAA 1HYOA 3V7RA 4KRTA 1Q86R 1ZUKA 5KH6A 3CPWP 4DBQA 1ZA2B 3OS1A 1PRLC 3VUBA 1BU1A 3ZBDA 1OULA 3PT9A 2GQVA 2JVVA 4RTZA 5DLQE 2J06A 5CKHA 1Q82R 1TOVA 3FLGA 1N8RC 1RAIB 3CQTA 4JS4A 5FROA 3E2UA 5KYYB 4PNOA 3HFOA 3CCJT 2XDBA 3CPFA 2X3WD 1VYVA 3RKYA 4AG2C 1LCKA 2XK0A 1E6HA 1N8RR 1YI2T 4JDSA 4PKCC 3EG3A 2CYZB 1KG1A 3CCVQ 1KD1U 2K4YA 1AWJA 2QGFB 2FYKA 3INZA 2CP6A 2P4RA 2RA2A 3HSBA 4Z8AA 2CSIA 5LL6S 2HNIA 1VQ4Q 1JRIA 2KMTA 4AT1B 5D6XA 3CBPA 2EVRA 1W70A 4LDXA 4DEXA 4OMNA 4M7AD 1VQNT 4JJBA 3EHQA 1W2BP 4Z88A 4M75D 2V8KA 1ZLMA 3JV3A 2KI7A 4JZ4A 3PGGA 1WI7A 4OB1B 4M7DD 2X3XD 1AWWA 3MKDA 4QT7A 2EQKA 3R6OA 1U8RA 3JB9H 2DD4A 3MCAB 5GAN3 1UGRB 1YHQQ 4M7AC 4JZ3A 2XICA 2A0FB 4WF2A 4M75C 4RMOA 1WXBA 1R0CB 3M4YA 3OY9A 1PNJA 3META 4JRPA 3HP9A 2LQWA 4P5NA 3E9FA 3OA6A 4ORZA 3VUZA 2O88A 1EIFA 2PVDB 5LJ3g 1SG5A 1TUGB 4LDWA 2SRCA 2JT4A 4AFZC 4C8QE 4EMGA 1VQ7T 4MDWA 2YLCA 2VKNA 1ABQA 3HRUA 1WZOA 1BCOA 2LCCA 3VS1A 2DO3A 3KFVA 1W4SA 4E7SA 4IUTA 2EPDA 3VS7A 1WHHA 5FU6B 4HXJA 4DOVA 1G3WA 1WJSA 4KUIA 3GNFB 5IAYA 5KYUB 5D7UA 4RTUA 3SFMA 5KYYA 4J6YA 2JXBA 2RK1A 1GFCA 1M1FA 5DLOA 3SD4A 2OI3A 3M4GA 3I56A 1RUWA 5HK3A 1G3YA 2ESWA 4OMLA 3GF5A 4RG2A 3OS2A 1PKTA 2DMOA 2ZCFB 2A08A 3QJ6A 2FPEA 3PIOA 2QA4Q 1QVGS 4RTYA 4M7AF 1TXQA 3M0QA 2QQSA 3CXCS 2PVOB 1D3BB 1AZGB 5DY9A 3H6ZA 4L6V5 1JXMA 5HKCA 2E70A 2NUPB 1NYFA 2ENMA 2I2LA 4IIMA 3JCMW 4BE1A 2QI2A 1OOTA 3NGPA 1BI3A 5GANh 3DLLA 3V8LA 2M16A 5KYWB 3EFOB 5IHIA 2YT6A 4GLMA 3QYGB 2CT4A 1YHQA 2GTJA 4RTTA 2QAZA 2L89A 3I5SA 2V8IA 3QDFA 1VQ8T 3A98A 1U3OA 3ZFJA 4PJNA 5FRMA 4C0DB 1UGQB 2DF6A 2YHTA 2FZCB 2MF2A 1NPRA 1RLQC 2DTHA 2IG0A 3OW2A 1XQHA 1K73C 2OTLQ 1M2VB 2YUQA 4QVCA 2M0OA 1W1FA 1VQOA 3DLMA 4II1A 1UJ0A 4F7UE 4FIBA 4JJNK 4NOYA 1TS9A 2CH4A 3JCMd 1ZX6A 1E6GA 3V8JA 3UF4A 2VGNA 1QQJA 3CCEQ 1Q86U 1K73R 1IXDA 5J3BA 3VV0A 3QPHA 5GJWB 1G8XA 5GAOl 2AK5A 1Q82U 3L2UA 5ECAA 4FYXB 1GL5A 1PKSA 2MPXC 3OYLA 2LT1A 1H3ZA 8ATCB 1WYXA 4CRIA 1YJWT 1GFDA 4FYWB 1D3BA 3OYGA 2QA4A 1WA7A 4OF1A 3CCVT 5LJ3e 3EG0A 2DEQA 3C12A 4OMFB 3LWIA 1SRLA 2A36A 1W6XA 2MWPA 1M90C 3CCQA 3KUFA 5LJ3h 3OSSC 1N8RU 1NLPC 1JB0E 3NMZC 1QMCA 2NUPA 2RD1A 1VQ4T 1LPLA 5GANd 1H8KA 4F16A 1JBMA 2A7YA 1BIBA 1UEBA 2K2VA 2QQAA 3UT1A 1OU9A 5KYWA 3EFOA 2Z0WA 2ZGWA 4PJOE 1M1KC 3KXTA 2CKKA 3R6NA 1Q95G 2FB7A 3A8LB 4DEYA 2XG8D 2YXYA 4J9GA 3DB4A 5CIUA 4PLIA 2JUFA 2CH4W 3JCMf 2DXCA 4ELZC 1VQ5A 5FU7C 2EGCA 1DJ7B 4OMMA 2ZPIB 3X25B 2CZ0B 2KRNA 2V26A 4LNPA 3MHXA 1X69A 3G7ZA 5GAOp 5I2SA 2RJEA 4AMCA 5KYNA 1WJRA 4J7FA 2RPNA 1M2VA 1VQKQ 3FDRA 3BY7A 1R0BG 5GAN5 3OQ5A 5IHKA 4OMPA 1YI2Q 1VA7A 3NPFA 2DYBA 3JRZA 2CT3A 3PTAA 1O75A 4F14A 3TVTA 2DA9A 5GMKe 5FWBA 1GBQA 5CCAA 2DM1A 4M7DB 1PRMC 2GGRA 2D0QB 3GNGA 5GMKh 1YCSB 4X1VA 5GAOm 2COWA 4BUGA 5GANf 5D6YA 3CCEA 3OS5A 1G83A 5GAN8 3OYMA 5EG2A 2KNBB 4F7UB 1PHTA 2DD5A 1YN8A 2C0TA 4M77E 3H0FA 4BDZA 1ABOA 2KROA 3QUIA 3QZ9B 2FG0A 1WHJA 3VS3A 4BY6B 2K5LA 1N27A 9ATCB 4JJCA 2E4HA 4Y28E 4M4ZA 2VGMA 2ATCB 3M54A 2DILA 4AFSC 1NG2A 4XK8E 3VYGA 3QJYA 2XDDA 2NUZA 3M0TA 1TSFA 1KHIA 2QQRA 3CMAA 4EDUA 2KEAA 2KGTA 4KULA 1KIKA 4XAXB 4C8QG 3CCMA 1E7OA 3CC2A 4B6MA 3L2RA 4UC4A 5AYFA 1G3SA 4XTZA 1BCMA 1OV3A 2XKOC 3J7AF 4MMKA 1MMNA 2MI6A 4PJOB 2RQWA 3QHSA 3MEWA 4XQ3A 1A0NB 2EBPA 1UB4A 3JSCA 2BZXA 1KQSS 1IRXA 5J26A 1JJ2A 2ZPGB 5FRNA 5I11A 2GBQA 3CCJA 2E65A 1WXTA 5GAN7 1FMVA 1VQKA 3HL8A 4E6RA 4M7DA 4C5EA 4E47A 1V29B 1YI2A 2OTLT 2KQWA 4B9WA 2E41A 3J81E 3LX7A 3GPLA 2HSPA 4Z89A 4E7IA 4C92E 2K3BA 1PM3A 3GBQA 3T9NA 5CK9A 1VQ6Q 4LN2A 2DBKA 3OYAA 4F7UA 4LDYA 3UWNA 3CCRQ 4ZN1A 2OTJQ 2GTOA 3EH2A 1WQWA 4BE0A 2DEUA 1SEMA 2G6FX 3OMGA 4A4EA 3LH0A 2HD0A 1OU8A 2DRMA 3A5ZB 1VQNA 3EGDB 2VUBA 5GAMj 4F17A 1K73U 2XHCA 3VKIA 1GCPA 2J05A 4XTYA 1BK2A 3A8OB 1X01A 1ZSZC 3V8KA 1MHNA 4M77B 1QWFA 2FEIA 2M0YA 3ZEHA 4C5GA 3RKWA 3OYFA 1K8AC 3KBGA 2DTIA 2W10A 2LNHB 4A4FA 1YJNQ 4C5HA 4J6XA 1BI0A 4C0DC 1OX9A 2COZA 1X27A 2K5IA 3F70A 4EPCA 2DIGA 1VUBA 2EYQA 3LH5A 3JCMb 1VQ7A 1H641 1K4US 4CC3A 2EFIA 1K8AR 4YTLA 2HKNA 1M3CA 2F2WA 2FPFA 5I21A 3JCMP 4PJOA 2BZ8A 2FPDA 4ANJA 2PZ1A 4D8DA 1IHVA 2Y90A 4C8QC 4F7UG 2YDLA 1M90U 4FW1A 5KE3A 5GANg 2MOXA 1KC8C 4J5YA 1WQ7A 2L3PA 2JN0A 4M78E 2V1QA 4N0AA 2WSCE 3RIRA 1UECA 4DBRA 1BI1A 3EG9B 1GXIE 3CC7Q 2EYYA 1VQKT 2HZYA 3EG2A 1M1KU 1OPKA 2RNAA 1I0CA 2CP7A 2LTOA 3MPUB 1KC8R 1YJWQ 2EKOA 1WFWA 3NTIA 5LJ5d 3BDUA 1MMDA 1ZQ1A 2XI9A 3OYIA 1B07A 4CC4B 3BFMA 3ER0A 2JTFA 4FCYA 2HKQB 3OYHA 4HVVA 2MCNA 1TUDA 4R55A 1PWTA 2VXFA 1HXDA 3EGDA 5KE2A 1NJIC 1B3QA 3SDZA 3PFSA 4QVZA 3RKXA 4C92B 2BUDA 1VQ9T 4HCBA 1T3LA 1VOMA 4PLLA 4HT8A 4PJOG 1MUZA 4M77A 2IVWA 4XTXA 2DNUA 1QVGA 2EQUA 4C8QF 1NZ9A 3G4ST 4J7IA 1NJIR 2VVKA 2ZPBB 1NEBA 4OB3B 2E6ZA 2EYZA 3CXCA 3QO3A 2JMCA 5KYXB 2MYSA 2JS0A 4NS5A 2EJ9A 2MAMA 5IHNA 4LXCA 1I8FA 1ZSGA 3I5RA 1RAFB 1QKXA 3NFCA 4EIKA 2DX1A 4EMKC 3M58A 1VQ8A 2EW3A 4JLGA 2DL8A 2WSFE 3G6ET 4N4HA 2P4TA 3VS2A 5HK0A 3EH1A 1RADB 4LUDA 2G3RA 3JCMc 3SWNC 3OW2P 5LJ5f 4HKEA 5A0LA 2K7AA 3OMCA 2J6KA 3IQLA 1Y7XA 3OYNA 2KK4A 1YIJQ 2KSSA 2EIFA 3CD6T 4J9EA 2DZ9A 1ZHIA 1VQPQ 2K79A 2YLBA 3JB9I 2VB6A 4KH1B 3EG9A 3SHWA 4J83A 3ME9A 1X2KA 2P0PA 2HAXA 1D0YA 1UFFA 2MK5A 1MV3A 1IGQA 2KVQG 4M77G 3JCMh 5GMKm 2KXDA 4XTUA 2M51A 4FM4B 3EHRA 1PC0A 2A37A 5IT9E 2DERA 4BY6C 2ABLA 3PVQA 4BB7A 2DJZA 1B7TA 4ELYC 1Z9QA 4M78B 2EYXA 2CP2A 1YJWA 3OYBA 4FT2A 2DFUA 3CCVA 1SKUB 1Z9ZA 2X9HA 4DA4A 4WCIA 1K1ZA 1K9AA 1VQ6T 2GF7A 3JB9G 4C92A 2LJ0A 4HA8A 4IUQA 1VQ4A 2HSEB 2LX9A 3H41A 3CCRT 2OTJT 1PG5B 2DVJA 2QTVA 1JO8A 5GMKi 2YUPA 2EJGA 2HCKA 3HRSA 2A28A 1LJOA 4J9IA 5GANe 1CSKA 4PJMA 4ZNXA 2RI3A 2FVUA 1C0MA 1ZA1B 1K0XA 2DE0X 1M3AA 5KYXA 1VQLQ 1QVFP 2DL3A 1Q7YC 4PJOC 3G71T 3GLXA 4CC2A 1H92A 3CCSQ 2RM4A 1PD1A 4M7AE 4BDYA 3C0CA 3RMQA 4F7UF 4MZTA 3CPWS 1YJNT 4M75E 2YRDA 2WSEE 2VASA 4M7DE 1HJDA 2YUNA 2RK2A 1D0XA 4JRIA 4NL3A 3M57A 2ED1A 1KK7A 1TU0B 2OAUA 3C95A 3CMEQ 4MZPA 3A8GB 2NUTA 3MP1A 3QBYA 4QQDA 4C92G 1UE9A 2CP3A 3Q1JA 4J9CA 2LQNA 1K8AU 3L2QA 3L2WA 2P84A 4TVRA 2B8AA 2YUOA 5CKEA 1GCQA 1IGUA 2BIVA 3S3OA 3QSUA 2O9VA 3H0IA 3CCLQ 3EFSA 2XMFA 5CKFA 2K3YA 2PUOB 2KYMA 2KYBA 2K57A 4M78A 4NL2A 1X43A 3CC7T 4OB2B 3L2ZA 4ZGDB 2H3JA 2RQRA 4C5IA 5D6WA 4Y92A 3JB9J 4JPBW 3FRNA 1GRIA 3TCJA 1OZ3A 2GCXA 1IREB 2FZKB 3I55Q 1YBYA 4PJOF 1TUCA 1W2BS 1QLYA 2DJQA 3M59A 1KC8U 3E1SA 2LNVA 1YJ9Q 2H3EB 2EQIA 1LOJA 3M0SA 1GBRA 3FIFA 2F2VA 4RTVA 2AIRB 2C0IA 3QXEB 1NE8A 4L5GA 1J3TA 1VQMQ 1M90R 2KR3A 5LJ5g 2ZPHB 4HCCA 1YWPA 1KJWA 3X28B 4DOWA 2CZ6B 5GANj 2R57A 3I9QA 1M1KR 2C06A 1I1JA 1FXXA 2E10A 2KAFA 2V1RA 1NJIU 4M78G 1NLOC 1Y57A 5IH2A 2RQTA 1EZZB 1TH7A 1JJ2P 2LP5A 3M55A 5GAOq 3BDLA 3OYYA 1VIEA 4FU6A 2PTKA 3H9NA 4M7AB 2DZCA 4XU2A 4M75B 2OTLA 1IO6A 4D8KA 4O6JA 1WJQA 1D1CA 2LT4A 4PFPA 1RABB 1YIJT 2E64A 2BZYA 4C0GA 2CP0A 2KDSA 3FJPA 3QG1A 1VQPT 2EWNA 3NHNA 1KQSA 1H3HA 2YRCA 1AWXA 1S72T 2RJFA 2LCSA 5GAOn 3X26B 1X75C 1VQ9Q 2LRQA 2RN8A 4LDUA 1G5VA 3NTKA 1R77A 4OMQA 1OYXA 2CGHA 3PVLA 5CKBA 3QWYA 1AZEA
chains in the Genus database with same CATH topology
4LDWA 2DTIA 2HQEA 4EMGA 4C8QE 2ZPFB 1K9MC 4A4FA 1VQ7T 4MDWA 4BE2A 2YLCA 4C5HA 3I55A 3HRUA 4J6XA 4C8QB 1BI0A 3MO8A 4CI0C 1N6AA 3QIIA 4C0DC 4B9XA 2LCCA 2LQKA 2K5IA 4OB0B 3F70A 3DB3A 3MEUA 4EPCA 2DO3A 2EQMA 1W4SA 2DIGA 4EMHA 4M77C 3I56T 4IUTA 1VUBA 2EYQA 3MEVA 3JCMb 1VQ7A 3OYDA 1H641 3OBYA 3N5BB 5FU6B 1Y07A 4BI8B 1G3WA 2EFIA 4DOVA 1WJSA 4KUIA 3JB9D 4YTLA 3GNFB 5IAYA 3M53A 3SFMA 4J6YA 5I21A 5FLXE 1IZ6A 4BI4A 4C0ZA 5LJ3j 3JCMP 2RK1A 4PJOA 1M1FA 2RHUA 5DLOA 3SD4A 5A0GA 3HFNA 4A4HA 3M4GA 2RHYA 4XU1A 2Y90A 3EFRA 4C8QC 4F7UG 3I56A 3LGLA 3ZEHA 2D6FA 4MDXA 1FWZA 3MEAA 4BDYA 5HK3A 1M90U 4QW2A 1G3YA 4D6WA 3A8HB 5KE3A 2RJDA 5GANg 2FHDA 3GF5A 5CR2A 3OYJA 4RG2A 3OS2A 1KC8C 3JCMJ 1VQLT 4J5YA 1WQ7A 5FU6C 2ZCFB 2JN0A 2DXTA 4M78E 4ATOA 4N0AA 2WSCE 5C6SA 5IN1A 3RIRA 3QJ6A 2O01E 1G3TA 3PIOA 3CCST 1UGPB 4IUVA 1QVGS 1BI1A 1B34B 1GXIE 1VQKT 4HT9A 4M7AF 4A4KA 2QQSA 2MWOA 3MP8A 1M1KU 2E5QA 1VQLA 3L42A 1VIFA 2LCLA 3CXCS 4KBMB 2PVOB 2LTOA 3OSVA 2LC4A 1D3BB 4M7AA 3OYKA 2EKOA 3GIBA 2L8DA 3S6WA 3QYHB 4RG8A 5DY9A 4E7LA 3NTIA 3CCSA 3H6ZA 4M75A 5LJ5d 4L6V5 3OW2S 3HHTB 3BDUA 2RI2A 1KQ2A 1ZQ1A 1Y96A 4XTVA 5HKCA 2XI9A 3CBMA 1BIAA 2K3XA 3CMET 2E70A 3OYIA 1QVFA 2F5TX 1WNLA 2RB6A 4M78C 2EAYA 5CQYA 3BFMA 3ER0A 3SB2A 2I2LA 2JTFA 1UGSB 3JCMW 1R8OB 3OYHA 3P8DA 4BE1A 1KD1C 4ZGEB 3A8MB 4R55A 2VXFA 1HXDA 5KE2A 1YHQT 4ZGJB 2QI2A 1NJIC 1Q7YU 3SDZA 3DLLA 1BI3A 3PFSA 4QVZA 3TEEA 3WVEB 5GANh 3V8LA 3RKXA 3V7CA 3CMEA 2M16A 4C92B 4OGEA 3VJPA 2BUDA 5LJ5e 5GAOr 1VQ9T 4M77F 4PL6A 4QQGA 2DVEA 3M56A 4C92D 4HCBA 3ASKA 4IUUA 4PLLA 3X20B 4HT8A 4PJOG 4JRQA 3QYGB 5LJ5h 2HQXA 5CKBA 5GMKj 1LNXA 1YHQA 3PNWC 4M77A 4QVDA 2IVWA 3CCLT 1I5LA 4EMKB 2K5FA 2L89A 2RJCA 4XTXA 5A0DA 1MGQA 2F69A 1QVGA 2EQUA 4C8QF 1NZ9A 5GAMd 4J7IA 2V8IA 3G4ST 4E7JA 1VQ9A 2ZPBB 4OB3B 1Q81C 3CEYA 3HRTA 2RHIA 2E6ZA 4J6WA 3CXCA 1VQ8T 2EJFA 3QO3A 2XIDA 4OP0A 4C92C 5KCHA 4C8QA 4NS5A 2JNGA 3SWNB 3ZFJA 5FRMA 2EJ9A 2PVGB 4C0DB 1VQOT 3CCLA 1XTDA 1UGQB 2YHTA 2DXUA 2MAMA 3HPWA 4A53A 3JB9F 2MF2A 3MP6A 2JTMA 3JCMg 1NPRA 1Y71A 2DTHA 2IG0A 2WACA 3I55T 3G4SA 3OW2A 1I8FA 3L2VA 1XQHA 1K73C 4XU3A 3LGFA 3NFCA 2QEXT 4EMKC 3M58A 1VQ8A 5GAMe 4JLGA 4QVCA 2L3RA 5CVIA 2CZ7B 1M5Q1 2WSFE 3QKJA 2M0OA 3DKMA 3G6ET 1VQOA 2X4JA 4N4HA 2P4TA 5HK0A 3DLMA 4II1A 4LD9K 4M7AG 5GAMh 4RCBA 4F7UE 2G3RA 2VV5A 3V7SA 3JCMc 4M75G 4FIBA 1YJ9T 4JJNK 3OYCA 4NOYA 3SWNC 3JCMd 3VU3C 4HKEA 3WXMB 4C8QD 5A0LA 5LJ5f 2QEXA 4M7DG 3OMCA 3CCUT 2QTXA 3V8JA 4A54A 2VGNA 1Q86U 3G6EA 3CBOA 3PMTA 3C4SA 1Y7XA 3OYNA 2KK4A 3RERA 2KSSA 2EIFA 5J3BA 3VV0A 1VQMT 3QPHA 4M78F 4JLIA 3CD6T 1M9SA 5LJ3d 3M9QA 1QVFS 1HK9A 2JZ2A 1YJ9A 5GAOl 4ZN3A 4IKFA 1Q86C 3L1AA 5GAN6 2DZ9A 2QA4T 1ZHIA 1Q82U 3CCUA 3L2UA 1WGSA 2XDPA 2YLBA 3JB9I 5DM7R 1B34A 3E9GA 4J83A 3OYLA 2E6NA 3CCQT 2LT1A 1VQMA 1H3ZA 3C94A 3ME9A 2DTOA 4RCCA 2DK3A 3CD6A 3GOXA 2P0PA 2HAXA 4CRIA 2KVQG 2V8JA 1YJWT 4M77G 3LW5E 3RMSA 3JCMh 4A4GA 4XTUA 5GMKm 1D3BA 3OYGA 4FM4B 3JCMQ 5I2MA 2RO0A 4OF1A 2QA4A 4ME7A 3CCVT 4KUDK 2M9UA 5IT9E 5LJ3e 1PSFA 2DEQA 3C12A 3S3MA 4OMFB 4BY6C 3LWIA 3EAEA 1M90C 2MWPA 2QQBA 1AHJB 5GAMf 2D9TA 3CCQA 3KUFA 4BB7A 2DJZA 5LJ3h 4ELYC 3OSSC 1N8RU 3TU4K 4M78B 2M1HA 1JB0E 2RD1A 1VQ4T 4BD3A 2MMPA 4FT2A 2A3LA 3OYBA 4M78D 1YJWA 3CCVA 4C92F 2RI5A 5GANd 1YITA 1NPPA 4ZTFA 5FU7B 1JBMA 2GFUA 3RESA 2A7YA 1BIBA 1OZ2A 1UEBA 3PMIA 4MMLA 4DA4A 2QQAA 2K2VA 2PUKB 4FL6A 4OGCA 2GF7A 3UT1A 1VQ6T 3JB9G 4C92A 2R58A 3S3NA 4ZTJA 2O4XB 2ZGWA 4HA8A 4IUQA 1VQ4A 2LX9A 4PJOE 5GMKl 4LD6A 3CCRT 1M1KC 1VQ5T 3KXTA 2CKKA 2OTJT 1QW1A 2FB7A 3OYEA 3A8LB 5GMKi 2JOYA 5J39A 4N4GA 2EJGA 3OBWA 1RL2A 2XG8D 3HRSA 4EMKA 1VQ6A 3DB4A 5CIUA 1LJOA 5GANe 4PLIA 2JUFA 2BKDN 3JCMf 5GAN4 1BYMA 2DXCA 2RI3A 2FVUA 4ELZC 1ZBXA 1VQ5A 5FU7C 3JCMX 1M1GA 3CCRA 4BACA 2OTJA 2QDYB 4KT0E 1DJ7B 3LWHA 3TREA 2ZPIB 3X25B 2CZ0B 3SWNA 1YCYA 4GLKA 5LJ3f 4HCZA 3MHXA 3G7ZA 4X9DA 3H8ZA 5LJ5j 1BI2A 2AHJB 5HY6A 1Q7YC 4PJOC 3G71T 3JCMV 3GLXA 5I2SA 5GAOp 1SSFA 2RJEA 1WJRA 1QP3A 3OB9A 4N4IA 4J7FA 4JRKA 2RM4A 1N9RA 5C0MA 1XOVA 2E1HA 3FDRA 3BY7A 3RMQA 2RH2A 4F7UF 2PU9B 4MZTA 5GAN5 3X24B 3CPWS 1YJNT 3HKSA 3OQ5A 4QQ6A 2X35A 4M7AE 4M75E 4V2SA 2ZPEB 4XTWA 3JRZA 3G71A 3PTAA 1O75A 2WSEE 4M7DE 2E12A 3VYHB 5GMKe 2X4WA 3CC4T 5CCAA 3CCET 1U1TA 2CZ1B 3LYIA 4M7DB 2D0QB 2RK2A 4X9CA 1PSEA 4E7KA 4JRIA 4NL3A 3WVDB 3GNGA 3M57A 5GMKh 2OAUA 3BW1A 3C95A 4IUPA 4BI3A 2CS7A 2P0KA 4L59A 1YJNA 5GAOm 4MZPA 3A8GB 1M4ZA 1KQ1A 2R5AA 2DAQA 2LVMA 2P0QA 4BUGA 2R5MA 5D6YA 2Y4YA 3MP1A 5GANf 3CC4A 2VXEA 3QBYA 5GAN2 3CCEA 2HBPA 5CO7A 4QQDA 4Y91A 4C92G 3J80E 3OS5A 5KCOA 3RUXA 5GAN8 3OYMA 3Q1JA 5EG2A 4F7UB 2DD5A 4M77E 3OS0A 4M7DC 1K8AU 3L2QA 3L2WA 4BDZA 3QUIA 3QZ9B 4TVRA 2L5QA 1K9MU 2ZZDA 2B8AA 2YRVA 3GP8A 3NTHA 5CKEA 3S3OA 2VC8A 2BIVA 3FB9A 4VUBA 5CQXA 4MZMA 5L8RE 3QSUA 2VYTA 4BY6B 3EFSA 2XU8A 2K5LA 5CKFA 2K3YA 2PUOB 3LLRA 1N27A 2K57A 4FT4A 4M78A 4FSXA 4NL2A 4Y28E 3CC7T 5CKDA 4OB2B 3UDCA 3CMAT 2VGMA 3CPWA 3L2ZA 4ZGDB 2H3JA 3M54A 4C5IA 3JCMe 1XNIA 5D6WA 3JB9J 1JJ2S 3O8VA 4JS5A 3FRNA 1RI0A 3TCJA 1OZ3A 2GCXA 1IREB 4XK8E 3VYGA 1O9SA 2RHZA 3QJYA 1Q82C 2XDDA 3FC3A 2X4XA 4LDVA 1YBYA 2Y4XA 3P8HA 4GY5A 4PJOF 3E19A 3CCMT 3CC2T 4R56A 2LQ8A 1KHIA 4Q5WA 2RHXA 3CC7A 2QQ9A 2QQRA 2O4XA 3CMAA 1YITT 4EDUA 4OVAA 1W2BS 3V7RA 1N9SA 5KH6A 4XU0A 3JAME 2F5KA 2DKGA 4KULA 3M59A 4XAXB 3OS1A 4C8QG 3VUBA 1KC8U 3E1SA 4O5VA 3ZBDA 3CCMA 3PT9A 2LNVA 2GQVA 2JVVA 5DLQE 3CC2A 3P8BB 2X4YA 5CKHA 1LOJA 3L2RA 3FIFA 3M5AA 3QDRB 3FLGA 4UC4A 5AYFA 1N8RC 1G3SA 4XTZA 3QXEB 1NE8A 4L5GA 2XKOC 3J7AF 4MMKA 1I4K1 4JS4A 5FROA 5LJ3g 2MI6A 1I81A 1U1SA 2PQWA 2ZPHB 3HFOA 4IURA 4PNOA 5LJ5g 3CCJT 5M9OA 4HCCA 4PJOB 2XDBA 3QHSA 3CPFA 4PJOD 3MEWA 4XQ3A 3RKYA 4DQ2A 2EQJA 1UB4A 3JSCA 3X28B 2XK0A 1KQSS 2KY9A 4M75F 1BKBA 4DOWA 1YI2T 5J26A 2CZ6B 1JJ2A 2ZPGB 5GANj 5FRNA 4JDSA 4PKCC 4M7DF 3CCJA 2E65A 2DIQA 2R57A 5GAN7 1WPYA 2CYZB 2C06A 1KG1A 1FX7A 1KD1U 4E7HA 2K4YA 1FXXA 4JUVA 1VQKA 3HL8A 1X6OA 4M7DA 2FYKA 3INZA 2E10A 2KAFA 2RA2A 1NJIU 1OI1A 4C5EA 4M78G 1W2BA 4E47A 3HSBA 2FL7A 2QXFA 1V29B 1YI2A 2OTLT 2KQWA 4B9WA 1TH7A 5LL6S 2HNIA 1JRIA 2E41A 2KMTA 5A2QE 5D6XA 3J81E 3LX7A 3GPLA 3M55A 3CBPA 5GAOq 3BDLA 4E7IA 4C92E 5GAMg 3OYYA 4LDXA 4J8OA 1VIEA 4Z02A 4FU6A 4M7AB 3AHUA 1QP2A 3QZ5B 3T9NA 2DPPB 2DZCA 4XU2A 5CK9A 4M7AD 4M75B 5CAIA 1VQNT 1QVPA 2OTLA 3OYAA 4F7UA 4LDYA 3UWNA 1Y96B 4O6JA 4M75D 1WJQA 4N0AC 2V8KA 4ZN1A 2LT4A 2GFAA 2LDMA 3PGGA 4OB1B 1YIJT 1Q81U 1WQWA 2E64A 4BE0A 4M7DD 1KHCA 3OMGA 4X34A 4A4EA 4C0GA 1M8VA 3LH0A 2EQKA 3R6OA 1U8RA 2HD0A 2KDSA 3FJPA 3JB9H 3URGA 2DD4A 3QG1A 4RKUE 3MCAB 3A5ZB 1VQNA 1VQPT 2EWNA 2DXBA 2VUBA 5GAN3 1UGRB 5GAMj 1KQSA 4M7AC 1K73U 2XICA 4WF2A 2XHCA 3VKIA 4XTYA 1YIJA 1S72T 2RJFA 2NLUA 4M75C 4RMOA 3A8OB 5GAOn 3X26B 1X75C 2LRQA 1X01A 3M4YA 4LDUA 3V8KA 3OY9A 1MHNA 3META 4M77B 3UPUA 1VQPA 4JRPA 1G5VA 3HP9A 3NTKA 4P5NA 3E9FA 4C0FA 1P92A 4M77D 1OYXA 2CGHA 3VUZA 3FEOA 3OA6A 3PIPA 2XD0A 1S72A 1EIFA 2PVDB 4C5GA 3RKWA 3OYFA 1K8AC 3KBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 A;  1VQ9 A;  1NZ9 A;  3DB4 A;  3G4S T;  1VQ7 T;  1K9M C;  2JUF A;  1KC8 U;  3I55 A;  3CCM A;  1Q81 C;  5DLQ E;  2JVV A;  3CC2 A;  2E6Z A;  3CXC A;  3CCR A;  1M1G A;  1VQ8 T;  1VQ5 A;  3P8B B;  2OTJ A;  2JNG A;  1N8R C;  1VQO T;  3CCL A;  3TRE A;  1XTD A;  3DB3 A;  2DO3 A;  1NPR A;  3I56 T;  3J7A F;  2IG0 A;  3I55 T;  3G4S A;  3OW2 A;  1VQ7 A;  5HY6 A;  2MI6 A;  1Q7Y C;  3G71 T;  1K73 C;  3LGF A;  3CCJ T;  2QEX T;  1SSF A;  4YTL A;  5IAY A;  1VQ8 A;  3CPF A;  2L3R A;  5FLX E;  1IZ6 A;  3G6E T;  1VQO A;  3I56 A;  3CPW S;  1YJN T;  1KQS S;  2G3R A;  3HKS A;  3LGL A;  1BKB A;  1YI2 T;  5J26 A;  1YJ9 T;  1M90 U;  1JJ2 A;  3G71 A;  3CCJ A;  2QEX A;  3CCU T;  3CC4 T;  4RG2 A;  3CCE T;  1Q86 U;  3G6E A;  1KD1 U;  1KC8 C;  1VQL T;  1VQK A;  1X6O A;  2EIF A;  5J3B A;  1VQM T;  1NJI U;  3CD6 T;  1YJN A;  1W2B A;  1QVF S;  1YI2 A;  1YJ9 A;  2OTL T;  2LVM A;  4ZN3 A;  1Q86 C;  3PIO A;  5LL6 S;  3CCS T;  2QA4 T;  5A2Q E;  1QVG S;  1Q82 U;  3CCU A;  3CC4 A;  3J81 E;  1VQK T;  5DM7 R;  3CCE A;  2MWO A;  4QQD A;  1M1K U;  3OYY A;  1VQL A;  3J80 E;  2LCL A;  3CCQ T;  3CXC S;  1VQM A;  3CD6 A;  4CRI A;  2KVQ G;  1VQN T;  1YJW T;  2OTL A;  1K8A U;  2QA4 A;  3CCS A;  4TVR A;  1K9M U;  3CCV T;  5IT9 E;  3OW2 S;  4ZN1 A;  1YIJ T;  1Q81 U;  3CME T;  2E70 A;  1M90 C;  2MWP A;  4X34 A;  3CCQ A;  1QVF A;  3LH0 A;  3ER0 A;  1N8R U;  2KDS A;  3A5Z B;  1VQN A;  1YJW A;  1VQ4 T;  1KD1 C;  1VQP T;  3CC7 T;  3CMA T;  3CPW A;  1KQS A;  1YHQ T;  3CCV A;  1NJI C;  1YIT A;  1Q7Y U;  1K73 U;  1NPP A;  3DLL A;  1XNI A;  2XHC A;  1YIJ A;  1JJ2 S;  1S72 T;  3CME A;  1UEB A;  1K8A C;  1VQ6 T;  1VQ9 T;  1Q82 C;  1YBY A;  3CCM T;  1VQ4 A;  1VQP A;  1M1K C;  2LQ8 A;  1KHI A;  3CCR T;  1VQ5 T;  3CC2 T;  2CKK A;  3CC7 A;  1YIT T;  2OTJ T;  3CMA A;  1W2B S;  1YHQ A;  3CCL T;  2JOY A;  3PIP A;  1S72 A;  1EIF A;  3JAM E;  1RL2 A;  1QVG A;  3KBG A; 
#chains in the Genus database with same CATH topology
 2QG9 B;  3G4S Q;  2ZPF B;  1RAA B;  1JQQ A;  4BE2 A;  3I55 A;  3M0U A;  4CC7 A;  1N6A A;  5I22 A;  1MNE A;  3CC4 Q;  2LX7 A;  1ARK A;  4OB0 B;  4RTW A;  3MEU A;  2EQM A;  3MEV A;  3OYD A;  3OBY A;  2EGE A;  1Y07 A;  4BI8 B;  3M53 A;  1BB9 A;  5LJ3 j;  4C0Z A;  3G6E Q;  3HFN A;  4A4H A;  2RHY A;  4XU1 A;  3EFR A;  2X51 A;  3LGL A;  2FRW A;  1AEY A;  3MEA A;  4QW2 A;  4D6W A;  1Y0M A;  3OYJ A;  2IPO B;  1VQL T;  5FU6 C;  1WDX A;  3CD6 Q;  4RUG A;  4HCK A;  1X6G A;  3UAT A;  2HEQ A;  2CSQ A;  1G3T A;  3CCS T;  4HT9 A;  1HSQ A;  2LJ3 A;  4A4K A;  2MWO A;  3MP8 A;  2E5Q A;  3L42 A;  2LCL A;  4KBM B;  2LC4 A;  1FMW A;  4M7A A;  3GIB A;  2L8D A;  4E7L A;  4M75 A;  3U23 A;  3HHT B;  1YIT Q;  3CBM A;  3CME T;  2F5T X;  1WNL A;  4AFQ C;  4M78 C;  4R0K A;  5CQY A;  3SB2 A;  3P8D A;  4ZGE B;  2KBT A;  3A8M B;  4ZGJ B;  1AOJ A;  1Q7Y U;  3TEE A;  1MV0 B;  3WVE B;  1EFN A;  2AKL A;  3VJP A;  2QYZ A;  5LJ5 e;  2DVE A;  3UA7 A;  4IUU A;  2L3S A;  5LJ5 h;  5GMK j;  3ZL7 C;  1LNX A;  3PNW C;  3CCL T;  1I5L A;  5A0D A;  2RJC A;  1RAE B;  1MGQ A;  2F69 A;  1VQ9 A;  5GAM d;  4E7J A;  1SPK A;  1WHK A;  1Q81 C;  1M30 A;  4J6W A;  1WX6 A;  4WTO B;  2L2P A;  2XID A;  1UHC A;  4J9F A;  1RI9 A;  4HVW A;  2DXU A;  3HPW A;  5IXB A;  3JCM g;  2W0Z A;  3REB B;  2WAC A;  4A63 B;  3I55 T;  3G4S A;  1XJW B;  1QVG P;  3G71 Q;  2KT8 A;  1QCN A;  3LGF A;  1X6B A;  5IXF A;  2QEX T;  1MND A;  2L3R A;  5CVI A;  3QKJ A;  3DKM A;  3CXC P;  1Q81 R;  1WIE A;  2X4J A;  3QWX X;  4LD9 K;  4M7A G;  2QDL A;  3TQ7 P;  1JXO A;  4M75 G;  1YJ9 T;  1I07 A;  2QAS A;  2NWM A;  4M7D G;  4C8Q D;  1V1C A;  3CCU T;  4A54 A;  3G6E A;  2EYW A;  3PMT A;  3RER A;  1VQM T;  4M78 F;  1M9S A;  1IHW A;  1HK9 A;  4ZN3 A;  1Q86 C;  3L1A A;  5GAN 6;  1FMK A;  2E6N A;  3C94 A;  3CD6 A;  3RR6 A;  2V8J A;  4K11 A;  3RMS A;  1ACM B;  2QGG A;  3JCM Q;  4ME7 A;  1PSF A;  4KGZ B;  5EC7 A;  3EAE A;  1AHJ B;  5GAM f;  2D9T A;  1VYU A;  2AKK A;  4J9D A;  4BD3 A;  2A3L A;  1YIT A;  1NPP A;  4ZTF A;  5FU7 B;  2GFU A;  4AFU C;  4FL6 A;  3I56 Q;  5GMK l;  4LD6 A;  1YP5 A;  3OYE A;  2JOY A;  3OBW A;  1RL2 A;  1VQ6 A;  5FW9 A;  2F1L A;  1BYM A;  2D1X A;  3CCR A;  3TSW A;  2OTJ A;  4KT0 E;  4DBH A;  1D0Z A;  2HMA A;  4GBQ A;  1YCY A;  2DL5 A;  1WLP B;  3H8Z A;  1SHF A;  2CDT A;  1BI2 A;  3FJ5 A;  5LJ5 j;  1AWO A;  2AHJ B;  5HY6 A;  2VWF A;  3BE3 A;  1QP3 A;  4N4I A;  1N9R A;  1XOV A;  5HCK A;  3VS6 A;  2RH2 A;  2X35 A;  2ZPE B;  3G71 A;  2BE9 B;  3VYH B;  2X4W A;  1ZBJ A;  3CC4 T;  3EGU A;  1U1T A;  1UGV A;  3LYI A;  1PSE A;  2KRS A;  1YFN A;  2PNI A;  4IUP A;  3BW1 A;  4PJL A;  2D8H A;  4BI3 A;  2CS7 A;  2DLP A;  2P0K A;  4L59 A;  1YJN A;  1M4Z A;  1KQ1 A;  2KRM A;  2R5A A;  2LVM A;  2BE7 D;  2ED0 A;  2J6O A;  4ESR A;  1RAC B;  2VXE A;  5GAN 2;  2HBP A;  4J9H A;  5CO7 A;  1TWB A;  1JEG A;  1T0J A;  3OS0 A;  4M7D C;  2L5Q A;  3GP8 A;  3NTH A;  2VC8 A;  3FB9 A;  5CQX A;  4MZM A;  5L8R E;  2JMA A;  2NUT B;  3LLR A;  2KT1 A;  2K6D A;  1I5O B;  1SRM A;  1MMA A;  5CKD A;  3CPW A;  3JCM e;  1S72 Q;  3O8V A;  1VQO Q;  1RI0 A;  2YWW A;  3FC3 A;  2X4X A;  3P8H A;  4GY5 A;  3E19 A;  1ZUY A;  2LQ8 A;  4Q5W A;  3VRY A;  2RHX A;  3CC7 A;  1YIT T;  2LJ1 A;  1N9S A;  2SEM A;  4XU0 A;  3JAM E;  2F5K A;  2DKG A;  3RNJ A;  2YSQ A;  4O5V A;  3P8B B;  2X4Y A;  3M5A A;  2CRE A;  3QDR B;  2NYS A;  1I4K 1;  4E2F B;  2PQW A;  1I81 A;  1U1S A;  4IUR A;  5M9O A;  2LZ6 B;  1QWE A;  4PJO D;  4DQ2 A;  2EQJ A;  2O2O A;  3CCQ Q;  2KY9 A;  4M75 F;  1BKB A;  2CP5 A;  4M7D F;  1G2B A;  2DIQ A;  3D7S B;  1WPY A;  1T3S A;  1FX7 A;  4E7H A;  3REA B;  4JUV A;  1VYT A;  8AT1 B;  1X6O A;  2JS2 A;  1NYG A;  1OI1 A;  1W2B A;  2FL7 A;  2AT1 B;  2QXF A;  1M27 C;  2EKH A;  5A2Q E;  2FO0 A;  4KGV B;  5GAM g;  4J8O A;  4Z02 A;  2RF0 A;  1QP2 A;  3QZ5 B;  1AVZ C;  2DPP B;  3G1J A;  5CAI A;  1QVP A;  1Y96 B;  4N0A C;  1Q7Y R;  1VQ5 Q;  1ZSZ B;  1RLP C;  2GFA A;  2LDM A;  1Q81 U;  1KHC A;  4X34 A;  1M8V A;  1U06 A;  3AT1 B;  2IIM A;  3URG A;  4RKU E;  4E7Z A;  2DXB A;  1FYN A;  2OJ2 A;  2H8H A;  1YIJ A;  4LE9 A;  3SEM A;  6AT1 B;  2NLU A;  1SF9 A;  2OX7 A;  3VS0 A;  2HQH A;  3TSZ A;  2MIO A;  1PCX A;  3UPU A;  1VQP A;  4C0F A;  1TG0 A;  2ZAE A;  1P92 A;  4M77 D;  3FEO A;  3PIP A;  2XD0 A;  1S72 A;  1KQS P;  5KYU A;  4FW2 A;  3VRZ A;  3PE0 A;  2HQE A;  1K9M C;  1KFZ A;  4C8Q B;  3MO8 A;  4CI0 C;  3QII A;  1UUE A;  2DL4 A;  2ECZ A;  4B9X A;  1WHM A;  3M0R A;  2LQK A;  3DB3 A;  3I56 T;  1YWO A;  4M77 C;  4EMH A;  3N5B B;  2DL7 A;  2QEX Q;  3JB9 D;  1K9M R;  2RQV A;  1X2Q A;  1JU5 C;  1IZ6 A;  4BI4 A;  5FLX E;  1HD3 A;  1PD0 A;  2RHU A;  5A0G A;  2KXC A;  1M8M A;  2KE9 A;  1D1B A;  2D6F A;  4MDX A;  1FWZ A;  3A8H B;  4IIO A;  2RJD A;  2FHD A;  5CR2 A;  1C6V X;  3CCU Q;  1OPL A;  2M02 A;  2D8J A;  3JCM J;  4FYY B;  2DET A;  2DXT A;  4ATO A;  5C6S A;  5IN1 A;  1OEB A;  1QKW A;  2E3I A;  2O01 E;  1UGP B;  4IUV A;  2AZS A;  1B34 B;  1S1N A;  3CMA Q;  2K9G A;  1VQL A;  1VIF A;  1K0S A;  1WHL A;  3OSV A;  3A1P A;  3OYK A;  3S6W A;  3QYH B;  4RG8 A;  3CCM Q;  2RMO A;  3CCS A;  3CC2 Q;  3OW2 S;  1KQ2 A;  2RI2 A;  1NEG A;  1Y96 A;  4XTV A;  3EGX B;  1BIA A;  2K3X A;  1QVF A;  1ZSZ A;  2RB6 A;  2EAY A;  2JJ9 A;  1UGS B;  1R8O B;  1KD1 C;  2F2X A;  3H0H A;  3MJX A;  1YHQ T;  2DRK A;  4HVU A;  3V7C A;  3CME A;  4OGE A;  2D0N A;  5GAO r;  1D1A A;  4M77 F;  4PL6 A;  4QQG A;  2E5K A;  3M56 A;  4C92 D;  3ASK A;  3X20 B;  4JRQ A;  2HQX A;  2JW4 A;  3CCJ Q;  1U5S A;  4QVD A;  2JTE A;  2AZV A;  1KD1 R;  4EMK B;  2K5F A;  4PFZ A;  3RDV A;  2FZG B;  4AG1 C;  3CEY A;  1T0H A;  2BTT A;  2RHI A;  2JM9 A;  3HRT A;  2EJF A;  4OP0 A;  4C92 C;  5KCH A;  5FWC A;  1CKB A;  4C8Q A;  2JNG A;  3SWN B;  1VQO T;  2PVG B;  3CCL A;  1XTD A;  3JB9 F;  4A53 A;  3UA6 A;  3MP6 A;  4KH0 B;  2JTM A;  1Y71 A;  3L2V A;  4XU3 A;  4PK4 A;  1M2O A;  3HTR A;  4F04 B;  2O9S A;  5GAM e;  1QCO A;  2CZ7 B;  1M5Q 1;  2DBM A;  5GAM h;  1AD5 A;  4RCB A;  1UHF A;  2VV5 A;  3V7S A;  3OYC A;  3VU3 C;  1EX4 A;  3WXM B;  2QEX A;  1VQN Q;  1RAH B;  2QTX A;  4J9B A;  3CBO A;  1NBE B;  3C4S A;  1RAG B;  5L23 A;  4JLI A;  3VS5 A;  1SSH A;  3M9Q A;  5LJ3 d;  2L3Q A;  1QVF S;  2JZ2 A;  1YJ9 A;  3RBB B;  3EG1 A;  1ZUU A;  4IKF A;  2QA4 T;  3CCU A;  1WGS A;  2XDP A;  5DM7 R;  3ULR B;  1B34 A;  1BBZ A;  3E9G A;  3CCQ T;  1N5Z A;  1YNZ A;  2RQU A;  1VQM A;  2DTO A;  4RCC A;  2DK3 A;  3GOX A;  2JM8 A;  1QCF A;  3LW5 E;  4A4G A;  1KSW A;  2I0N A;  5I2M A;  2RO0 A;  4KUD K;  2M9U A;  3S3M A;  2QQB A;  1OQK A;  3EGX A;  2HDA A;  4JJD A;  2LMJ A;  3TU4 K;  2M1H A;  1VQ7 Q;  2MMP A;  1K76 A;  4M78 D;  1IB8 A;  1LVK A;  1AT1 B;  4C92 F;  2RI5 A;  1TTH B;  3RES A;  3PMI A;  1OZ2 A;  4MML A;  2PUK B;  4OGC A;  2J7I A;  1GCQ C;  2R58 A;  3S3N A;  1M3B A;  4ZTJ A;  2O4X B;  1VQ5 T;  4QKU A;  1QW1 A;  5J39 A;  4N4G A;  2ROT A;  4RTX A;  4EMK A;  2BKD N;  2HBW A;  5GAN 4;  2E3H A;  1ZBX A;  3JCM X;  1M1G A;  4BAC A;  2QDY B;  2DYI A;  1WHG A;  3LWH A;  3TRE A;  7AT1 B;  1OX8 A;  3SWN A;  2CUB A;  2J6F A;  4GLK A;  5LJ3 f;  4HCZ A;  2OAW A;  4X9D A;  1C1A A;  1F1B B;  1UDL A;  3JCM V;  4PFO A;  1SSF A;  3VS4 A;  3OB9 A;  2O31 A;  4JRK A;  5C0M A;  2E1H A;  2K2M A;  2PU9 B;  3X24 B;  3HKS A;  4QQ6 A;  5AT1 B;  4PJJ A;  2ROL A;  4XTW A;  1D09 B;  2E12 A;  1UTI A;  4FYV B;  1NM7 A;  3CCE T;  2CZ1 B;  4X9C A;  2L0A A;  3O5Z A;  4E7K A;  3WVD B;  4V2S A;  1UG1 A;  2DAQ A;  1UJY A;  2P0Q A;  2QK0 A;  5GJV B;  2R5M A;  2Y4Y A;  2HL3 A;  3CC4 A;  4LUE A;  4OMO A;  2CUD A;  3I35 A;  4Y91 A;  1MMG A;  2C0O A;  3J80 E;  5KCO A;  3RUX A;  3THK A;  4FSS A;  3M0P A;  1K9M U;  2ZZD A;  2YRV A;  2HL5 C;  3AHU A;  2GQI A;  4VUB A;  1WXU A;  2VYT A;  2XU8 A;  1CKA A;  2EGA A;  4DBF A;  1V76 A;  4FT4 A;  4FSX A;  3UDC A;  3CMA T;  1VQ8 Q;  2FRY A;  1XNI A;  1JJ2 S;  4JS5 A;  2B86 A;  4KGX B;  1O9S A;  2RHZ A;  1Q82 C;  1SHG A;  4LDV A;  2Y4X A;  3CCM T;  2GNC A;  4R56 A;  3CC2 T;  2COY A;  2QQ9 A;  2O4X A;  4OVA A;  1HYO A;  3V7R A;  4KRT A;  1Q86 R;  1ZUK A;  5KH6 A;  3CPW P;  4DBQ A;  1ZA2 B;  3OS1 A;  1PRL C;  3VUB A;  1BU1 A;  3ZBD A;  1OUL A;  3PT9 A;  2GQV A;  2JVV A;  4RTZ A;  5DLQ E;  2J06 A;  5CKH A;  1Q82 R;  1TOV A;  3FLG A;  1N8R C;  1RAI B;  3CQT A;  4JS4 A;  5FRO A;  3E2U A;  5KYY B;  4PNO A;  3HFO A;  3CCJ T;  2XDB A;  3CPF A;  2X3W D;  1VYV A;  3RKY A;  4AG2 C;  1LCK A;  2XK0 A;  1E6H A;  1N8R R;  1YI2 T;  4JDS A;  4PKC C;  3EG3 A;  2CYZ B;  1KG1 A;  3CCV Q;  1KD1 U;  2K4Y A;  1AWJ A;  2QGF B;  2FYK A;  3INZ A;  2CP6 A;  2P4R A;  2RA2 A;  3HSB A;  4Z8A A;  2CSI A;  5LL6 S;  2HNI A;  1VQ4 Q;  1JRI A;  2KMT A;  4AT1 B;  5D6X A;  3CBP A;  2EVR A;  1W70 A;  4LDX A;  4DEX A;  4OMN A;  4M7A D;  1VQN T;  4JJB A;  3EHQ A;  1W2B P;  4Z88 A;  4M75 D;  2V8K A;  1ZLM A;  3JV3 A;  2KI7 A;  4JZ4 A;  3PGG A;  1WI7 A;  4OB1 B;  4M7D D;  2X3X D;  1AWW A;  3MKD A;  4QT7 A;  2EQK A;  3R6O A;  1U8R A;  3JB9 H;  2DD4 A;  3MCA B;  5GAN 3;  1UGR B;  1YHQ Q;  4M7A C;  4JZ3 A;  2XIC A;  2A0F B;  4WF2 A;  4M75 C;  4RMO A;  1WXB A;  1R0C B;  3M4Y A;  3OY9 A;  1PNJ A;  3MET A;  4JRP A;  3HP9 A;  2LQW A;  4P5N A;  3E9F A;  3OA6 A;  4ORZ A;  3VUZ A;  2O88 A;  1EIF A;  2PVD B;  5LJ3 g;  1SG5 A;  1TUG B;  4LDW A;  2SRC A;  2JT4 A;  4AFZ C;  4C8Q E;  4EMG A;  1VQ7 T;  4MDW A;  2YLC A;  2VKN A;  1ABQ A;  3HRU A;  1WZO A;  1BCO A;  2LCC A;  3VS1 A;  2DO3 A;  3KFV A;  1W4S A;  4E7S A;  4IUT A;  2EPD A;  3VS7 A;  1WHH A;  5FU6 B;  4HXJ A;  4DOV A;  1G3W A;  1WJS A;  4KUI A;  3GNF B;  5IAY A;  5KYU B;  5D7U A;  4RTU A;  3SFM A;  5KYY A;  4J6Y A;  2JXB A;  2RK1 A;  1GFC A;  1M1F A;  5DLO A;  3SD4 A;  2OI3 A;  3M4G A;  3I56 A;  1RUW A;  5HK3 A;  1G3Y A;  2ESW A;  4OML A;  3GF5 A;  4RG2 A;  3OS2 A;  1PKT A;  2DMO A;  2ZCF B;  2A08 A;  3QJ6 A;  2FPE A;  3PIO A;  2QA4 Q;  1QVG S;  4RTY A;  4M7A F;  1TXQ A;  3M0Q A;  2QQS A;  3CXC S;  2PVO B;  1D3B B;  1AZG B;  5DY9 A;  3H6Z A;  4L6V 5;  1JXM A;  5HKC A;  2E70 A;  2NUP B;  1NYF A;  2ENM A;  2I2L A;  4IIM A;  3JCM W;  4BE1 A;  2QI2 A;  1OOT A;  3NGP A;  1BI3 A;  5GAN h;  3DLL A;  3V8L A;  2M16 A;  5KYW B;  3EFO B;  5IHI A;  2YT6 A;  4GLM A;  3QYG B;  2CT4 A;  1YHQ A;  2GTJ A;  4RTT A;  2QAZ A;  2L89 A;  3I5S A;  2V8I A;  3QDF A;  1VQ8 T;  3A98 A;  1U3O A;  3ZFJ A;  4PJN A;  5FRM A;  4C0D B;  1UGQ B;  2DF6 A;  2YHT A;  2FZC B;  2MF2 A;  1NPR A;  1RLQ C;  2DTH A;  2IG0 A;  3OW2 A;  1XQH A;  1K73 C;  2OTL Q;  1M2V B;  2YUQ A;  4QVC A;  2M0O A;  1W1F A;  1VQO A;  3DLM A;  4II1 A;  1UJ0 A;  4F7U E;  4FIB A;  4JJN K;  4NOY A;  1TS9 A;  2CH4 A;  3JCM d;  1ZX6 A;  1E6G A;  3V8J A;  3UF4 A;  2VGN A;  1QQJ A;  3CCE Q;  1Q86 U;  1K73 R;  1IXD A;  5J3B A;  3VV0 A;  3QPH A;  5GJW B;  1G8X A;  5GAO l;  2AK5 A;  1Q82 U;  3L2U A;  5ECA A;  4FYX B;  1GL5 A;  1PKS A;  2MPX C;  3OYL A;  2LT1 A;  1H3Z A;  8ATC B;  1WYX A;  4CRI A;  1YJW T;  1GFD A;  4FYW B;  1D3B A;  3OYG A;  2QA4 A;  1WA7 A;  4OF1 A;  3CCV T;  5LJ3 e;  3EG0 A;  2DEQ A;  3C12 A;  4OMF B;  3LWI A;  1SRL A;  2A36 A;  1W6X A;  2MWP A;  1M90 C;  3CCQ A;  3KUF A;  5LJ3 h;  3OSS C;  1N8R U;  1NLP C;  1JB0 E;  3NMZ C;  1QMC A;  2NUP A;  2RD1 A;  1VQ4 T;  1LPL A;  5GAN d;  1H8K A;  4F16 A;  1JBM A;  2A7Y A;  1BIB A;  1UEB A;  2K2V A;  2QQA A;  3UT1 A;  1OU9 A;  5KYW A;  3EFO A;  2Z0W A;  2ZGW A;  4PJO E;  1M1K C;  3KXT A;  2CKK A;  3R6N A;  1Q95 G;  2FB7 A;  3A8L B;  4DEY A;  2XG8 D;  2YXY A;  4J9G A;  3DB4 A;  5CIU A;  4PLI A;  2JUF A;  2CH4 W;  3JCM f;  2DXC A;  4ELZ C;  1VQ5 A;  5FU7 C;  2EGC A;  1DJ7 B;  4OMM A;  2ZPI B;  3X25 B;  2CZ0 B;  2KRN A;  2V26 A;  4LNP A;  3MHX A;  1X69 A;  3G7Z A;  5GAO p;  5I2S A;  2RJE A;  4AMC A;  5KYN A;  1WJR A;  4J7F A;  2RPN A;  1M2V A;  1VQK Q;  3FDR A;  3BY7 A;  1R0B G;  5GAN 5;  3OQ5 A;  5IHK A;  4OMP A;  1YI2 Q;  1VA7 A;  3NPF A;  2DYB A;  3JRZ A;  2CT3 A;  3PTA A;  1O75 A;  4F14 A;  3TVT A;  2DA9 A;  5GMK e;  5FWB A;  1GBQ A;  5CCA A;  2DM1 A;  4M7D B;  1PRM C;  2GGR A;  2D0Q B;  3GNG A;  5GMK h;  1YCS B;  4X1V A;  5GAO m;  2COW A;  4BUG A;  5GAN f;  5D6Y A;  3CCE A;  3OS5 A;  1G83 A;  5GAN 8;  3OYM A;  5EG2 A;  2KNB B;  4F7U B;  1PHT A;  2DD5 A;  1YN8 A;  2C0T A;  4M77 E;  3H0F A;  4BDZ A;  1ABO A;  2KRO A;  3QUI A;  3QZ9 B;  2FG0 A;  1WHJ A;  3VS3 A;  4BY6 B;  2K5L A;  1N27 A;  9ATC B;  4JJC A;  2E4H A;  4Y28 E;  4M4Z A;  2VGM A;  2ATC B;  3M54 A;  2DIL A;  4AFS C;  1NG2 A;  4XK8 E;  3VYG A;  3QJY A;  2XDD A;  2NUZ A;  3M0T A;  1TSF A;  1KHI A;  2QQR A;  3CMA A;  4EDU A;  2KEA A;  2KGT A;  4KUL A;  1KIK A;  4XAX B;  4C8Q G;  3CCM A;  1E7O A;  3CC2 A;  4B6M A;  3L2R A;  4UC4 A;  5AYF A;  1G3S A;  4XTZ A;  1BCM A;  1OV3 A;  2XKO C;  3J7A F;  4MMK A;  1MMN A;  2MI6 A;  4PJO B;  2RQW A;  3QHS A;  3MEW A;  4XQ3 A;  1A0N B;  2EBP A;  1UB4 A;  3JSC A;  2BZX A;  1KQS S;  1IRX A;  5J26 A;  1JJ2 A;  2ZPG B;  5FRN A;  5I11 A;  2GBQ A;  3CCJ A;  2E65 A;  1WXT A;  5GAN 7;  1FMV A;  1VQK A;  3HL8 A;  4E6R A;  4M7D A;  4C5E A;  4E47 A;  1V29 B;  1YI2 A;  2OTL T;  2KQW A;  4B9W A;  2E41 A;  3J81 E;  3LX7 A;  3GPL A;  2HSP A;  4Z89 A;  4E7I A;  4C92 E;  2K3B A;  1PM3 A;  3GBQ A;  3T9N A;  5CK9 A;  1VQ6 Q;  4LN2 A;  2DBK A;  3OYA A;  4F7U A;  4LDY A;  3UWN A;  3CCR Q;  4ZN1 A;  2OTJ Q;  2GTO A;  3EH2 A;  1WQW A;  4BE0 A;  2DEU A;  1SEM A;  2G6F X;  3OMG A;  4A4E A;  3LH0 A;  2HD0 A;  1OU8 A;  2DRM A;  3A5Z B;  1VQN A;  3EGD B;  2VUB A;  5GAM j;  4F17 A;  1K73 U;  2XHC A;  3VKI A;  1GCP A;  2J05 A;  4XTY A;  1BK2 A;  3A8O B;  1X01 A;  1ZSZ C;  3V8K A;  1MHN A;  4M77 B;  1QWF A;  2FEI A;  2M0Y A;  3ZEH A;  4C5G A;  3RKW A;  3OYF A;  1K8A C;  3KBG A;  2DTI A;  2W10 A;  2LNH B;  4A4F A;  1YJN Q;  4C5H A;  4J6X A;  1BI0 A;  4C0D C;  1OX9 A;  2COZ A;  1X27 A;  2K5I A;  3F70 A;  4EPC A;  2DIG A;  1VUB A;  2EYQ A;  3LH5 A;  3JCM b;  1VQ7 A;  1H64 1;  1K4U S;  4CC3 A;  2EFI A;  1K8A R;  4YTL A;  2HKN A;  1M3C A;  2F2W A;  2FPF A;  5I21 A;  3JCM P;  4PJO A;  2BZ8 A;  2FPD A;  4ANJ A;  2PZ1 A;  4D8D A;  1IHV A;  2Y90 A;  4C8Q C;  4F7U G;  2YDL A;  1M90 U;  4FW1 A;  5KE3 A;  5GAN g;  2MOX A;  1KC8 C;  4J5Y A;  1WQ7 A;  2L3P A;  2JN0 A;  4M78 E;  2V1Q A;  4N0A A;  2WSC E;  3RIR A;  1UEC A;  4DBR A;  1BI1 A;  3EG9 B;  1GXI E;  3CC7 Q;  2EYY A;  1VQK T;  2HZY A;  3EG2 A;  1M1K U;  1OPK A;  2RNA A;  1I0C A;  2CP7 A;  2LTO A;  3MPU B;  1KC8 R;  1YJW Q;  2EKO A;  1WFW A;  3NTI A;  5LJ5 d;  3BDU A;  1MMD A;  1ZQ1 A;  2XI9 A;  3OYI A;  1B07 A;  4CC4 B;  3BFM A;  3ER0 A;  2JTF A;  4FCY A;  2HKQ B;  3OYH A;  4HVV A;  2MCN A;  1TUD A;  4R55 A;  1PWT A;  2VXF A;  1HXD A;  3EGD A;  5KE2 A;  1NJI C;  1B3Q A;  3SDZ A;  3PFS A;  4QVZ A;  3RKX A;  4C92 B;  2BUD A;  1VQ9 T;  4HCB A;  1T3L A;  1VOM A;  4PLL A;  4HT8 A;  4PJO G;  1MUZ A;  4M77 A;  2IVW A;  4XTX A;  2DNU A;  1QVG A;  2EQU A;  4C8Q F;  1NZ9 A;  3G4S T;  4J7I A;  1NJI R;  2VVK A;  2ZPB B;  1NEB A;  4OB3 B;  2E6Z A;  2EYZ A;  3CXC A;  3QO3 A;  2JMC A;  5KYX B;  2MYS A;  2JS0 A;  4NS5 A;  2EJ9 A;  2MAM A;  5IHN A;  4LXC A;  1I8F A;  1ZSG A;  3I5R A;  1RAF B;  1QKX A;  3NFC A;  4EIK A;  2DX1 A;  4EMK C;  3M58 A;  1VQ8 A;  2EW3 A;  4JLG A;  2DL8 A;  2WSF E;  3G6E T;  4N4H A;  2P4T A;  3VS2 A;  5HK0 A;  3EH1 A;  1RAD B;  4LUD A;  2G3R A;  3JCM c;  3SWN C;  3OW2 P;  5LJ5 f;  4HKE A;  5A0L A;  2K7A A;  3OMC A;  2J6K A;  3IQL A;  1Y7X A;  3OYN A;  2KK4 A;  1YIJ Q;  2KSS A;  2EIF A;  3CD6 T;  4J9E A;  2DZ9 A;  1ZHI A;  1VQP Q;  2K79 A;  2YLB A;  3JB9 I;  2VB6 A;  4KH1 B;  3EG9 A;  3SHW A;  4J83 A;  3ME9 A;  1X2K A;  2P0P A;  2HAX A;  1D0Y A;  1UFF A;  2MK5 A;  1MV3 A;  1IGQ A;  2KVQ G;  4M77 G;  3JCM h;  5GMK m;  2KXD A;  4XTU A;  2M51 A;  4FM4 B;  3EHR A;  1PC0 A;  2A37 A;  5IT9 E;  2DER A;  4BY6 C;  2ABL A;  3PVQ A;  4BB7 A;  2DJZ A;  1B7T A;  4ELY C;  1Z9Q A;  4M78 B;  2EYX A;  2CP2 A;  1YJW A;  3OYB A;  4FT2 A;  2DFU A;  3CCV A;  1SKU B;  1Z9Z A;  2X9H A;  4DA4 A;  4WCI A;  1K1Z A;  1K9A A;  1VQ6 T;  2GF7 A;  3JB9 G;  4C92 A;  2LJ0 A;  4HA8 A;  4IUQ A;  1VQ4 A;  2HSE B;  2LX9 A;  3H41 A;  3CCR T;  2OTJ T;  1PG5 B;  2DVJ A;  2QTV A;  1JO8 A;  5GMK i;  2YUP A;  2EJG A;  2HCK A;  3HRS A;  2A28 A;  1LJO A;  4J9I A;  5GAN e;  1CSK A;  4PJM A;  4ZNX A;  2RI3 A;  2FVU A;  1C0M A;  1ZA1 B;  1K0X A;  2DE0 X;  1M3A A;  5KYX A;  1VQL Q;  1QVF P;  2DL3 A;  1Q7Y C;  4PJO C;  3G71 T;  3GLX A;  4CC2 A;  1H92 A;  3CCS Q;  2RM4 A;  1PD1 A;  4M7A E;  4BDY A;  3C0C A;  3RMQ A;  4F7U F;  4MZT A;  3CPW S;  1YJN T;  4M75 E;  2YRD A;  2WSE E;  2VAS A;  4M7D E;  1HJD A;  2YUN A;  2RK2 A;  1D0X A;  4JRI A;  4NL3 A;  3M57 A;  2ED1 A;  1KK7 A;  1TU0 B;  2OAU A;  3C95 A;  3CME Q;  4MZP A;  3A8G B;  2NUT A;  3MP1 A;  3QBY A;  4QQD A;  4C92 G;  1UE9 A;  2CP3 A;  3Q1J A;  4J9C A;  2LQN A;  1K8A U;  3L2Q A;  3L2W A;  2P84 A;  4TVR A;  2B8A A;  2YUO A;  5CKE A;  1GCQ A;  1IGU A;  2BIV A;  3S3O A;  3QSU A;  2O9V A;  3H0I A;  3CCL Q;  3EFS A;  2XMF A;  5CKF A;  2K3Y A;  2PUO B;  2KYM A;  2KYB A;  2K57 A;  4M78 A;  4NL2 A;  1X43 A;  3CC7 T;  4OB2 B;  3L2Z A;  4ZGD B;  2H3J A;  2RQR A;  4C5I A;  5D6W A;  4Y92 A;  3JB9 J;  4JPB W;  3FRN A;  1GRI A;  3TCJ A;  1OZ3 A;  2GCX A;  1IRE B;  2FZK B;  3I55 Q;  1YBY A;  4PJO F;  1TUC A;  1W2B S;  1QLY A;  2DJQ A;  3M59 A;  1KC8 U;  3E1S A;  2LNV A;  1YJ9 Q;  2H3E B;  2EQI A;  1LOJ A;  3M0S A;  1GBR A;  3FIF A;  2F2V A;  4RTV A;  2AIR B;  2C0I A;  3QXE B;  1NE8 A;  4L5G A;  1J3T A;  1VQM Q;  1M90 R;  2KR3 A;  5LJ5 g;  2ZPH B;  4HCC A;  1YWP A;  1KJW A;  3X28 B;  4DOW A;  2CZ6 B;  5GAN j;  2R57 A;  3I9Q A;  1M1K R;  2C06 A;  1I1J A;  1FXX A;  2E10 A;  2KAF A;  2V1R A;  1NJI U;  4M78 G;  1NLO C;  1Y57 A;  5IH2 A;  2RQT A;  1EZZ B;  1TH7 A;  1JJ2 P;  2LP5 A;  3M55 A;  5GAO q;  3BDL A;  3OYY A;  1VIE A;  4FU6 A;  2PTK A;  3H9N A;  4M7A B;  2DZC A;  4XU2 A;  4M75 B;  2OTL A;  1IO6 A;  4D8K A;  4O6J A;  1WJQ A;  1D1C A;  2LT4 A;  4PFP A;  1RAB B;  1YIJ T;  2E64 A;  2BZY A;  4C0G A;  2CP0 A;  2KDS A;  3FJP A;  3QG1 A;  1VQP T;  2EWN A;  3NHN A;  1KQS A;  1H3H A;  2YRC A;  1AWX A;  1S72 T;  2RJF A;  2LCS A;  5GAO n;  3X26 B;  1X75 C;  1VQ9 Q;  2LRQ A;  2RN8 A;  4LDU A;  1G5V A;  3NTK A;  1R77 A;  4OMQ A;  1OYX A;  2CGH A;  3PVL A;  5CKB A;  3QWY A;  1AZE A; 
#chains in the Genus database with same CATH homology
 4LDW A;  2DTI A;  2HQE A;  4EMG A;  4C8Q E;  2ZPF B;  1K9M C;  4A4F A;  1VQ7 T;  4MDW A;  4BE2 A;  2YLC A;  4C5H A;  3I55 A;  3HRU A;  4J6X A;  4C8Q B;  1BI0 A;  3MO8 A;  4CI0 C;  1N6A A;  3QII A;  4C0D C;  4B9X A;  2LCC A;  2LQK A;  2K5I A;  4OB0 B;  3F70 A;  3DB3 A;  3MEU A;  4EPC A;  2DO3 A;  2EQM A;  1W4S A;  2DIG A;  4EMH A;  4M77 C;  3I56 T;  4IUT A;  1VUB A;  2EYQ A;  3MEV A;  3JCM b;  1VQ7 A;  3OYD A;  1H64 1;  3OBY A;  3N5B B;  5FU6 B;  1Y07 A;  4BI8 B;  1G3W A;  2EFI A;  4DOV A;  1WJS A;  4KUI A;  3JB9 D;  4YTL A;  3GNF B;  5IAY A;  3M53 A;  3SFM A;  4J6Y A;  5I21 A;  5FLX E;  1IZ6 A;  4BI4 A;  4C0Z A;  5LJ3 j;  3JCM P;  2RK1 A;  4PJO A;  1M1F A;  2RHU A;  5DLO A;  3SD4 A;  5A0G A;  3HFN A;  4A4H A;  3M4G A;  2RHY A;  4XU1 A;  2Y90 A;  3EFR A;  4C8Q C;  4F7U G;  3I56 A;  3LGL A;  3ZEH A;  2D6F A;  4MDX A;  1FWZ A;  3MEA A;  4BDY A;  5HK3 A;  1M90 U;  4QW2 A;  1G3Y A;  4D6W A;  3A8H B;  5KE3 A;  2RJD A;  5GAN g;  2FHD A;  3GF5 A;  5CR2 A;  3OYJ A;  4RG2 A;  3OS2 A;  1KC8 C;  3JCM J;  1VQL T;  4J5Y A;  1WQ7 A;  5FU6 C;  2ZCF B;  2JN0 A;  2DXT A;  4M78 E;  4ATO A;  4N0A A;  2WSC E;  5C6S A;  5IN1 A;  3RIR A;  3QJ6 A;  2O01 E;  1G3T A;  3PIO A;  3CCS T;  1UGP B;  4IUV A;  1QVG S;  1BI1 A;  1B34 B;  1GXI E;  1VQK T;  4HT9 A;  4M7A F;  4A4K A;  2QQS A;  2MWO A;  3MP8 A;  1M1K U;  2E5Q A;  1VQL A;  3L42 A;  1VIF A;  2LCL A;  3CXC S;  4KBM B;  2PVO B;  2LTO A;  3OSV A;  2LC4 A;  1D3B B;  4M7A A;  3OYK A;  2EKO A;  3GIB A;  2L8D A;  3S6W A;  3QYH B;  4RG8 A;  5DY9 A;  4E7L A;  3NTI A;  3CCS A;  3H6Z A;  4M75 A;  5LJ5 d;  4L6V 5;  3OW2 S;  3HHT B;  3BDU A;  2RI2 A;  1KQ2 A;  1ZQ1 A;  1Y96 A;  4XTV A;  5HKC A;  2XI9 A;  3CBM A;  1BIA A;  2K3X A;  3CME T;  2E70 A;  3OYI A;  1QVF A;  2F5T X;  1WNL A;  2RB6 A;  4M78 C;  2EAY A;  5CQY A;  3BFM A;  3ER0 A;  3SB2 A;  2I2L A;  2JTF A;  1UGS B;  3JCM W;  1R8O B;  3OYH A;  3P8D A;  4BE1 A;  1KD1 C;  4ZGE B;  3A8M B;  4R55 A;  2VXF A;  1HXD A;  5KE2 A;  1YHQ T;  4ZGJ B;  2QI2 A;  1NJI C;  1Q7Y U;  3SDZ A;  3DLL A;  1BI3 A;  3PFS A;  4QVZ A;  3TEE A;  3WVE B;  5GAN h;  3V8L A;  3RKX A;  3V7C A;  3CME A;  2M16 A;  4C92 B;  4OGE A;  3VJP A;  2BUD A;  5LJ5 e;  5GAO r;  1VQ9 T;  4M77 F;  4PL6 A;  4QQG A;  2DVE A;  3M56 A;  4C92 D;  4HCB A;  3ASK A;  4IUU A;  4PLL A;  3X20 B;  4HT8 A;  4PJO G;  4JRQ A;  3QYG B;  5LJ5 h;  2HQX A;  5CKB A;  5GMK j;  1LNX A;  1YHQ A;  3PNW C;  4M77 A;  4QVD A;  2IVW A;  3CCL T;  1I5L A;  4EMK B;  2K5F A;  2L89 A;  2RJC A;  4XTX A;  5A0D A;  1MGQ A;  2F69 A;  1QVG A;  2EQU A;  4C8Q F;  1NZ9 A;  5GAM d;  4J7I A;  2V8I A;  3G4S T;  4E7J A;  1VQ9 A;  2ZPB B;  4OB3 B;  1Q81 C;  3CEY A;  3HRT A;  2RHI A;  2E6Z A;  4J6W A;  3CXC A;  1VQ8 T;  2EJF A;  3QO3 A;  2XID A;  4OP0 A;  4C92 C;  5KCH A;  4C8Q A;  4NS5 A;  2JNG A;  3SWN B;  3ZFJ A;  5FRM A;  2EJ9 A;  2PVG B;  4C0D B;  1VQO T;  3CCL A;  1XTD A;  1UGQ B;  2YHT A;  2DXU A;  2MAM A;  3HPW A;  4A53 A;  3JB9 F;  2MF2 A;  3MP6 A;  2JTM A;  3JCM g;  1NPR A;  1Y71 A;  2DTH A;  2IG0 A;  2WAC A;  3I55 T;  3G4S A;  3OW2 A;  1I8F A;  3L2V A;  1XQH A;  1K73 C;  4XU3 A;  3LGF A;  3NFC A;  2QEX T;  4EMK C;  3M58 A;  1VQ8 A;  5GAM e;  4JLG A;  4QVC A;  2L3R A;  5CVI A;  2CZ7 B;  1M5Q 1;  2WSF E;  3QKJ A;  2M0O A;  3DKM A;  3G6E T;  1VQO A;  2X4J A;  4N4H A;  2P4T A;  5HK0 A;  3DLM A;  4II1 A;  4LD9 K;  4M7A G;  5GAM h;  4RCB A;  4F7U E;  2G3R A;  2VV5 A;  3V7S A;  3JCM c;  4M75 G;  4FIB A;  1YJ9 T;  4JJN K;  3OYC A;  4NOY A;  3SWN C;  3JCM d;  3VU3 C;  4HKE A;  3WXM B;  4C8Q D;  5A0L A;  5LJ5 f;  2QEX A;  4M7D G;  3OMC A;  3CCU T;  2QTX A;  3V8J A;  4A54 A;  2VGN A;  1Q86 U;  3G6E A;  3CBO A;  3PMT A;  3C4S A;  1Y7X A;  3OYN A;  2KK4 A;  3RER A;  2KSS A;  2EIF A;  5J3B A;  3VV0 A;  1VQM T;  3QPH A;  4M78 F;  4JLI A;  3CD6 T;  1M9S A;  5LJ3 d;  3M9Q A;  1QVF S;  1HK9 A;  2JZ2 A;  1YJ9 A;  5GAO l;  4ZN3 A;  4IKF A;  1Q86 C;  3L1A A;  5GAN 6;  2DZ9 A;  2QA4 T;  1ZHI A;  1Q82 U;  3CCU A;  3L2U A;  1WGS A;  2XDP A;  2YLB A;  3JB9 I;  5DM7 R;  1B34 A;  3E9G A;  4J83 A;  3OYL A;  2E6N A;  3CCQ T;  2LT1 A;  1VQM A;  1H3Z A;  3C94 A;  3ME9 A;  2DTO A;  4RCC A;  2DK3 A;  3CD6 A;  3GOX A;  2P0P A;  2HAX A;  4CRI A;  2KVQ G;  2V8J A;  1YJW T;  4M77 G;  3LW5 E;  3RMS A;  3JCM h;  4A4G A;  4XTU A;  5GMK m;  1D3B A;  3OYG A;  4FM4 B;  3JCM Q;  5I2M A;  2RO0 A;  4OF1 A;  2QA4 A;  4ME7 A;  3CCV T;  4KUD K;  2M9U A;  5IT9 E;  5LJ3 e;  1PSF A;  2DEQ A;  3C12 A;  3S3M A;  4OMF B;  4BY6 C;  3LWI A;  3EAE A;  1M90 C;  2MWP A;  2QQB A;  1AHJ B;  5GAM f;  2D9T A;  3CCQ A;  3KUF A;  4BB7 A;  2DJZ A;  5LJ3 h;  4ELY C;  3OSS C;  1N8R U;  3TU4 K;  4M78 B;  2M1H A;  1JB0 E;  2RD1 A;  1VQ4 T;  4BD3 A;  2MMP A;  4FT2 A;  2A3L A;  3OYB A;  4M78 D;  1YJW A;  3CCV A;  4C92 F;  2RI5 A;  5GAN d;  1YIT A;  1NPP A;  4ZTF A;  5FU7 B;  1JBM A;  2GFU A;  3RES A;  2A7Y A;  1BIB A;  1OZ2 A;  1UEB A;  3PMI A;  4MML A;  4DA4 A;  2QQA A;  2K2V A;  2PUK B;  4FL6 A;  4OGC A;  2GF7 A;  3UT1 A;  1VQ6 T;  3JB9 G;  4C92 A;  2R58 A;  3S3N A;  4ZTJ A;  2O4X B;  2ZGW A;  4HA8 A;  4IUQ A;  1VQ4 A;  2LX9 A;  4PJO E;  5GMK l;  4LD6 A;  3CCR T;  1M1K C;  1VQ5 T;  3KXT A;  2CKK A;  2OTJ T;  1QW1 A;  2FB7 A;  3OYE A;  3A8L B;  5GMK i;  2JOY A;  5J39 A;  4N4G A;  2EJG A;  3OBW A;  1RL2 A;  2XG8 D;  3HRS A;  4EMK A;  1VQ6 A;  3DB4 A;  5CIU A;  1LJO A;  5GAN e;  4PLI A;  2JUF A;  2BKD N;  3JCM f;  5GAN 4;  1BYM A;  2DXC A;  2RI3 A;  2FVU A;  4ELZ C;  1ZBX A;  1VQ5 A;  5FU7 C;  3JCM X;  1M1G A;  3CCR A;  4BAC A;  2OTJ A;  2QDY B;  4KT0 E;  1DJ7 B;  3LWH A;  3TRE A;  2ZPI B;  3X25 B;  2CZ0 B;  3SWN A;  1YCY A;  4GLK A;  5LJ3 f;  4HCZ A;  3MHX A;  3G7Z A;  4X9D A;  3H8Z A;  5LJ5 j;  1BI2 A;  2AHJ B;  5HY6 A;  1Q7Y C;  4PJO C;  3G71 T;  3JCM V;  3GLX A;  5I2S A;  5GAO p;  1SSF A;  2RJE A;  1WJR A;  1QP3 A;  3OB9 A;  4N4I A;  4J7F A;  4JRK A;  2RM4 A;  1N9R A;  5C0M A;  1XOV A;  2E1H A;  3FDR A;  3BY7 A;  3RMQ A;  2RH2 A;  4F7U F;  2PU9 B;  4MZT A;  5GAN 5;  3X24 B;  3CPW S;  1YJN T;  3HKS A;  3OQ5 A;  4QQ6 A;  2X35 A;  4M7A E;  4M75 E;  4V2S A;  2ZPE B;  4XTW A;  3JRZ A;  3G71 A;  3PTA A;  1O75 A;  2WSE E;  4M7D E;  2E12 A;  3VYH B;  5GMK e;  2X4W A;  3CC4 T;  5CCA A;  3CCE T;  1U1T A;  2CZ1 B;  3LYI A;  4M7D B;  2D0Q B;  2RK2 A;  4X9C A;  1PSE A;  4E7K A;  4JRI A;  4NL3 A;  3WVD B;  3GNG A;  3M57 A;  5GMK h;  2OAU A;  3BW1 A;  3C95 A;  4IUP A;  4BI3 A;  2CS7 A;  2P0K A;  4L59 A;  1YJN A;  5GAO m;  4MZP A;  3A8G B;  1M4Z A;  1KQ1 A;  2R5A A;  2DAQ A;  2LVM A;  2P0Q A;  4BUG A;  2R5M A;  5D6Y A;  2Y4Y A;  3MP1 A;  5GAN f;  3CC4 A;  2VXE A;  3QBY A;  5GAN 2;  3CCE A;  2HBP A;  5CO7 A;  4QQD A;  4Y91 A;  4C92 G;  3J80 E;  3OS5 A;  5KCO A;  3RUX A;  5GAN 8;  3OYM A;  3Q1J A;  5EG2 A;  4F7U B;  2DD5 A;  4M77 E;  3OS0 A;  4M7D C;  1K8A U;  3L2Q A;  3L2W A;  4BDZ A;  3QUI A;  3QZ9 B;  4TVR A;  2L5Q A;  1K9M U;  2ZZD A;  2B8A A;  2YRV A;  3GP8 A;  3NTH A;  5CKE A;  3S3O A;  2VC8 A;  2BIV A;  3FB9 A;  4VUB A;  5CQX A;  4MZM A;  5L8R E;  3QSU A;  2VYT A;  4BY6 B;  3EFS A;  2XU8 A;  2K5L A;  5CKF A;  2K3Y A;  2PUO B;  3LLR A;  1N27 A;  2K57 A;  4FT4 A;  4M78 A;  4FSX A;  4NL2 A;  4Y28 E;  3CC7 T;  5CKD A;  4OB2 B;  3UDC A;  3CMA T;  2VGM A;  3CPW A;  3L2Z A;  4ZGD B;  2H3J A;  3M54 A;  4C5I A;  3JCM e;  1XNI A;  5D6W A;  3JB9 J;  1JJ2 S;  3O8V A;  4JS5 A;  3FRN A;  1RI0 A;  3TCJ A;  1OZ3 A;  2GCX A;  1IRE B;  4XK8 E;  3VYG A;  1O9S A;  2RHZ A;  3QJY A;  1Q82 C;  2XDD A;  3FC3 A;  2X4X A;  4LDV A;  1YBY A;  2Y4X A;  3P8H A;  4GY5 A;  4PJO F;  3E19 A;  3CCM T;  3CC2 T;  4R56 A;  2LQ8 A;  1KHI A;  4Q5W A;  2RHX A;  3CC7 A;  2QQ9 A;  2QQR A;  2O4X A;  3CMA A;  1YIT T;  4EDU A;  4OVA A;  1W2B S;  3V7R A;  1N9S A;  5KH6 A;  4XU0 A;  3JAM E;  2F5K A;  2DKG A;  4KUL A;  3M59 A;  4XAX B;  3OS1 A;  4C8Q G;  3VUB A;  1KC8 U;  3E1S A;  4O5V A;  3ZBD A;  3CCM A;  3PT9 A;  2LNV A;  2GQV A;  2JVV A;  5DLQ E;  3CC2 A;  3P8B B;  2X4Y A;  5CKH A;  1LOJ A;  3L2R A;  3FIF A;  3M5A A;  3QDR B;  3FLG A;  4UC4 A;  5AYF A;  1N8R C;  1G3S A;  4XTZ A;  3QXE B;  1NE8 A;  4L5G A;  2XKO C;  3J7A F;  4MMK A;  1I4K 1;  4JS4 A;  5FRO A;  5LJ3 g;  2MI6 A;  1I81 A;  1U1S A;  2PQW A;  2ZPH B;  3HFO A;  4IUR A;  4PNO A;  5LJ5 g;  3CCJ T;  5M9O A;  4HCC A;  4PJO B;  2XDB A;  3QHS A;  3CPF A;  4PJO D;  3MEW A;  4XQ3 A;  3RKY A;  4DQ2 A;  2EQJ A;  1UB4 A;  3JSC A;  3X28 B;  2XK0 A;  1KQS S;  2KY9 A;  4M75 F;  1BKB A;  4DOW A;  1YI2 T;  5J26 A;  2CZ6 B;  1JJ2 A;  2ZPG B;  5GAN j;  5FRN A;  4JDS A;  4PKC C;  4M7D F;  3CCJ A;  2E65 A;  2DIQ A;  2R57 A;  5GAN 7;  1WPY A;  2CYZ B;  2C06 A;  1KG1 A;  1FX7 A;  1KD1 U;  4E7H A;  2K4Y A;  1FXX A;  4JUV A;  1VQK A;  3HL8 A;  1X6O A;  4M7D A;  2FYK A;  3INZ A;  2E10 A;  2KAF A;  2RA2 A;  1NJI U;  1OI1 A;  4C5E A;  4M78 G;  1W2B A;  4E47 A;  3HSB A;  2FL7 A;  2QXF A;  1V29 B;  1YI2 A;  2OTL T;  2KQW A;  4B9W A;  1TH7 A;  5LL6 S;  2HNI A;  1JRI A;  2E41 A;  2KMT A;  5A2Q E;  5D6X A;  3J81 E;  3LX7 A;  3GPL A;  3M55 A;  3CBP A;  5GAO q;  3BDL A;  4E7I A;  4C92 E;  5GAM g;  3OYY A;  4LDX A;  4J8O A;  1VIE A;  4Z02 A;  4FU6 A;  4M7A B;  3AHU A;  1QP2 A;  3QZ5 B;  3T9N A;  2DPP B;  2DZC A;  4XU2 A;  5CK9 A;  4M7A D;  4M75 B;  5CAI A;  1VQN T;  1QVP A;  2OTL A;  3OYA A;  4F7U A;  4LDY A;  3UWN A;  1Y96 B;  4O6J A;  4M75 D;  1WJQ A;  4N0A C;  2V8K A;  4ZN1 A;  2LT4 A;  2GFA A;  2LDM A;  3PGG A;  4OB1 B;  1YIJ T;  1Q81 U;  1WQW A;  2E64 A;  4BE0 A;  4M7D D;  1KHC A;  3OMG A;  4X34 A;  4A4E A;  4C0G A;  1M8V A;  3LH0 A;  2EQK A;  3R6O A;  1U8R A;  2HD0 A;  2KDS A;  3FJP A;  3JB9 H;  3URG A;  2DD4 A;  3QG1 A;  4RKU E;  3MCA B;  3A5Z B;  1VQN A;  1VQP T;  2EWN A;  2DXB A;  2VUB A;  5GAN 3;  1UGR B;  5GAM j;  1KQS A;  4M7A C;  1K73 U;  2XIC A;  4WF2 A;  2XHC A;  3VKI A;  4XTY A;  1YIJ A;  1S72 T;  2RJF A;  2NLU A;  4M75 C;  4RMO A;  3A8O B;  5GAO n;  3X26 B;  1X75 C;  2LRQ A;  1X01 A;  3M4Y A;  4LDU A;  3V8K A;  3OY9 A;  1MHN A;  3MET A;  4M77 B;  3UPU A;  1VQP A;  4JRP A;  1G5V A;  3HP9 A;  3NTK A;  4P5N A;  3E9F A;  4C0F A;  1P92 A;  4M77 D;  1OYX A;  2CGH A;  3VUZ A;  3FEO A;  3OA6 A;  3PIP A;  2XD0 A;  1S72 A;  1EIF A;  2PVD B;  4C5G A;  3RKW A;  3OYF A;  1K8A C;  3KBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...