5GAMd

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
82
Chain Sequence
b'NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamd00
4XTVA 2K57A 4A53A 3L2ZA 5GAN6 1N9SA 2DXTA 3GIBA 5GANf 4M75F 4M7DD 4M7AB 2EWNA 2DTIA 4M78E 4M78G 2CGHA 3RESA 4EMKA 2EJFA 2QTXA 1KQ1A 3V7RA 4M75D 4M78A 3JB9H 3JCMX 4M7DE 2E10A 4Y91A 1I8FA 4HT9A 4F7UE 1B34A 4M77C 1TH7A 4C8QC 3RKYA 5LJ5j 2YLCA 4NL3A 4XU3A 3JCMc 5GAOm 5GMKe 4M77B 3RIRA 5GMKj 4C8QB 2DXUA 5GMKi 4PJOE 2DVEA 4PJOG 3FIFA 4NOYA 3JCMg 2ZGWA 4M78F 4RCBA 2JN0A 2E64A 4EMGA 3JCMe 2E41A 5DY9A 5GAOr 4M7DC 2DZ9A 4PJOA 2DTHA 2VC8A 5GAOn 2E65A 1D3BB 1HK9A 4XTXA 3SWNA 4C92F 5GAN7 4M7AG 4M7AE 4M7DB 3JCMd 4M75C 4J5YA 3FJPA 1U1SA 4JRKA 5GAN5 3V8JA 3VU3C 4M7AA 4X9CA 4C92D 5GAMg 2EJ9A 4M75B 4XTWA 4N0AC 5GAMe 5GAMj 1I5LA 4XU2A 2FB7A 4PJOF 5LJ5g 2YHTA 5GMKl 5GANh 5GAN2 4JUVA 1H641 4MMKA 4F7UG 5LJ5e 4XU0A 3BW1A 3HFOA 2E1HA 5LJ3g 5GAMd 4M77E 1I4K1 4M77G 4C8QE 3QSUA 4QVCA 1Y96B 4F7UA 5LJ3e 5LJ3j 4M7AF 5LJ5d 5GAN4 3V8KA 1N9RA 1LNXA 3QO3A 3JCMP 4M77A 1M5Q1 2YLBA 4JRIA 5LJ3d 1WQ7A 4EMHA 3QHSA 5GAN3 3PGGA 4C92C 3JB9J 4XTZA 4M7DG 4M7AD 3JB9G 2VXFA 3JCMf 4M78D 2RA2A 2RB6A 5GAOp 2Y90A 1JRIA 2RD1A 3QUIA 3EFRA 1B34B 4F7UF 1KQ2A 4M7DA 4M7AC 4C92B 4J6XA 4M75E 4M75G 3RUXA 5GMKh 3EFSA 4M77F 3BDUA 3JCMQ 3V8LA 3RKWA 3JCMh 4M75A 3RERA 5I21A 1M8VA 1HXDA 1WNLA 4J6YA 2HNIA 2I2LA 3V7SA 5CAIA 3JB9I 4M77D 2DEQA 4JLIA 5GAMf 1JBMA 4OP0A 4M7DF 4XTUA 4C8QG 4N0AA 5GANj 4J6WA 4EMKC 3JCMb 5LJ5f 3JB9F 4XU1A 4V2SA 4PJOD 4HA8A 1LJOA 1Y96A 2RM4A 3V7CA 1WPYA 2FYKA 4M78C 4C8QA 5LJ3f 1BIAA 3RKXA 2DJZA 4EMKB 1MGQA 5GAMh 4XQ3A 5GANd 5GAOl 5GMKm 2DKGA 4X9DA 3JCMV 5GAN8 3JB9D 3AHUA 3HSBA 1U1TA 4M78B 5LJ5h 4C92E 1D3BA 3BY7A 2DZCA 3HFNA 4C92G 3JCMJ 4WF2A 4NL2A 1LOJA 3BFMA 4PNOA 4XTYA 2EAYA 5LJ3h 3L1AA 5GAOq 4C8QF 4A54A 4C92A 4F7UB 1YCYA 1BIBA 3M4GA 4MMLA 4PJOC 2VXEA 4DQ2A 3SWNC 2EJGA 3FB9A 4RCCA 4QVDA 4HT8A 3INZA 3JCMW 4C8QD 1I81A 1WQWA 5GANg 2DTOA 3SB2A 4PJOB 5GANe 1X01A 3SWNB
chains in the Genus database with same CATH superfamily
2CZ1B 2OTJQ 5GAN6 2O9SA 4DA4A 5KYUB 2CGHA 1MMDA 3HTRA 1M1FA 1M1KR 3CCRA 4PL6A 1NM7A 4FYXB 5CKHA 1KQSS 2QASA 3QJYA 4BI3A 4F17A 4JJBA 3NPFA 1IZ6A 3CPWS 3OYEA 5CCAA 2RQVA 4R0KA 3MEWA 2E41A 1SF9A 4J9HA 4A63B 1D3BB 1OEBA 1VQ9Q 4AFSC 3VS1A 1OU9A 1WX6A 4X9CA 1Q81U 3REBB 4FYVB 2RMOA 3VS3A 4PJOF 1FYNA 1EX4A 3T9NA 5I2MA 1N6AA 2A0FB 2LTOA 4XAXB 5ECAA 2M0OA 4N4HA 3QIIA 3PNWC 1VYUA 2F5KA 4RTVA 1M3CA 2LNHB 1TOVA 1WFWA 4Z02A 3QZ9B 2V8JA 2OI3A 3X24B 4JZ4A 1X75C 2HQXA 3CCET 1MUZA 4A4KA 4M75E 1YIJA 2DNUA 2E5KA 4ELZC 2LVMA 3JCMh 5KYWB 2F1LA 2CSQA 2F5TX 3OSVA 2QA4A 4PJNA 2QTVA 5D6WA 4D6WA 2IVWA 1NEBA 2M16A 1XQHA 2DJZA 2CT4A 5GMKm 4IUTA 4KUIA 4WTOB 4X1VA 5C0MA 4JLGA 1OX9A 4C92E 4E6RA 2MMPA 3G1JA 4PNOA 3I5RA 2CS7A 4FL6A 4UC4A 2FHDA 5GANg 3LX7A 1VQ6A 1S72Q 1KC8U 1ZSZC 1K8AR 1YI2T 2ZZDA 2H8HA 2BZ8A 2ECZA 2SEMA 4KGVB 3C0CA 2QK0A 3M0SA 4RTYA 4RTUA 3V7RA 4M75D 2EYQA 5LL6S 1TH7A 1TTHB 1QKXA 1O75A 1TG0A 3CCRT 3M0RA 2O9VA 4XU3A 3KUFA 5GMKe 3EHRA 2MCNA 1ZBXA 1K73U 1X6BA 3VJPA 3DB4A 5DY9A 5AYFA 2LRQA 4C0DB 3QDFA 2BE7D 2EVRA 2CP2A 1ZUUA 2ZPHB 3C12A 3D7SB 4C92D 9ATCB 2EQMA 4JJCA 2XD0A 2FB7A 2HD0A 2MF2A 1WZOA 1XJWB 2E12A 5CKBA 3MEUA 1LVKA 2GBQA 4M77A 2KNBB 2EPDA 2J6OA 1WLPB 4RKUE 1C0MA 4RTTA 1GCQC 3OYJA 3N5BB 2X4YA 1VYTA 1KQ2A 3RBBB 1BI2A 1S1NA 1Q7YU 2EQIA 5CKDA 5CO7A 2BUDA 2I2LA 1JBMA 1YIJT 1ZQ1A 1OZ2A 1NYFA 1K9MR 4HA8A 2RM4A 4C8QA 2CKKA 4HKEA 1BIAA 3RKXA 2ZPEB 2QA4T 3CXCP 1D1AA 2FL7A 2R5AA 3G7ZA 2V26A 2J6FA 1K76A 5A2QE 2DERA 3PFSA 2VXEA 2JXBA 1NJIU 3M9QA 2HSPA 4RG8A 4ZGDB 1MMAA 3EG9A 3UDCA 4ESRA 2CSIA 1X01A 3REAB 4E7ZA 5FW9A 1UDLA 3L2ZA 2DX1A 2AIRB 4FIBA 1Z9QA 2HZYA 3E9GA 1X69A 1VQ6T 3M0PA 3CCMA 3QWXX 3A98A 1M2VB 2PNIA 2L3QA 2RJCA 1RLPC 4C5HA 1B34A 3DB3A 4N4GA 4AFQC 3OYDA 4Z8AA 5GAOm 2WACA 2KROA 4C0DC 4NOYA 2DZ9A 2CP6A 4PJOA 4XTXA 1BK2A 4AT1B 3FJPA 4IIMA 4DEXA 5GAN5 4JRKA 1AWXA 2MAMA 4BUGA 1WXTA 3OS1A 1I5LA 3CCQA 3HFOA 1KC8C 2FPEA 4M77G 4KGXB 4IIOA 3M0QA 1KD1U 4JRIA 2M9UA 3BDLA 3MKDA 2CT3A 3EG2A 2RB6A 1VOMA 4VUBA 3Q1JA 5IXBA 2QYZA 7AT1B 1Y07A 3H0FA 1HYOA 3OW2P 1K73C 2VV5A 1C6VX 2XICA 4JS4A 3LLRA 4C8QG 1VQ8A 2DFUA 1LJOA 4RG2A 1TS9A 3AHUA 1FMVA 2RF0A 4M78B 2FZKB 2EIFA 5DM7R 2YRDA 1M2OA 1FX7A 2FRWA 1K8AC 3WVEB 1I81A 1WQWA 1D09B 5FWBA 4L6V5 4OMLA 1X6OA 4M7AB 5J39A 4LNPA 3HRTA 1Q7YC 3FEOA 3G6EA 5IHIA 2EYZA 2M02A 3O5ZA 1YBYA 3CCMT 2LX9A 2AZVA 3RIRA 4PJOG 1KHIA 2C0OA 1FXXA 4IUVA 1AWJA 2GFAA 1PNJA 4M7DB 2YXYA 2COYA 4DBHA 1AWWA 3CMAA 1U1SA 1GRIA 1V76A 2HQEA 4DEYA 2EQJA 5GAMg 3QWYA 4KBMB 1GXIE 1GL5A 8ATCB 1OPKA 3VYHB 4C8QE 1MV3A 5LJ3e 2HCKA 1Q82C 2AKKA 1BI1A 4DOWA 4C5IA 3TQ7P 3CCQT 3M4YA 2KDSA 2OTJA 2CZ0B 2ED0A 5GAOp 1AD5A 2Y90A 1JRIA 4F7UF 3OY9A 3PT9A 5GMKh 2QGFB 4L5GA 1M8VA 1QWFA 2GCXA 1YWPA 4J6YA 3JB9I 1ARKA 4M77D 5FU6C 4J9GA 3OYKA 2RK2A 4F16A 2PU9B 4M78C 2KXDA 1VQ8T 4MDWA 3E19A 3EG1A 3QJ6A 2P4RA 4XTYA 5CQXA 2Z0WA 1HJDA 4BI8B 3OA6A 3A8MB 1JXMA 1KD1C 3H41A 3JCMW 4C8QD 2DTOA 2CZ7B 3HPWA 1PRMC 4OMOA 2XIDA 4M7AC 1G3SA 1OU8A 1RAGB 2QEXQ 2RPNA 3F70A 3M56A 1QLYA 3HKSA 3VS0A 4LDVA 1U06A 4ZN3A 2VKNA 3HHTB 3CCQQ 4Y91A 4HT9A 2I0NA 1I0CA 3H6ZA 2LC4A 3EH1A 4A4FA 4NL3A 3G6ET 1WA7A 1PKSA 1JQQA 1W4SA 2KAFA 3GBQA 4DBRA 3CXCA 2JMAA 4M7DC 2E64A 4PJJA 3PTAA 2D6FA 2VC8A 5GAOn 2DL5A 4IURA 3SDZA 2EYWA 4ZN1A 1ZSZA 3GPLA 1ACMB 3URGA 3EG3A 5GMKl 3CMAT 2FVUA 5LJ5e 2EYYA 5DLOA 2ABLA 1YJWA 1UEBA 4QQGA 4K11A 2DO3A 1VQ8Q 2F69A 3R6NA 1N9RA 2IG0A 1UGSB 1S72A 1PKTA 3CC2Q 4Z89A 2K79A 2VASA 1M30A 2NUZA 3U23A 3CBOA 3V8LA 2OTJT 2DE0X 2DEUA 1PHTA 1RADB 2AKLA 3PMIA 1BYMA 5GAMf 3UWNA 3OB9A 1UECA 4ME7A 1YNZA 5L8RE 1Q86U 2RI5A 1I07A 2CREA 4RTZA 2K3YA 2CP5A 3S3NA 3CD6Q 4OGCA 1GCQA 3L2QA 2MWPA 2VWFA 3FB9A 3MJXA 4BDYA 1W2BP 1GFCA 2KQWA 2JM9A 4OMPA 1VQMQ 4JJNK 2K57A 1WXBA 2O01E 2FO0A 2L89A 1Y57A 3ER0A 2LZ6B 5FLXE 4E7SA 3CPFA 2XG8D 3PVLA 3H0HA 3OW2A 2B86A 2FEIA 5CK9A 1Q81R 6AT1B 1I8FA 3OYGA 1X2KA 3CCSQ 3S3OA 3M57A 2EQUA 3LGFA 4R55A 2DL7A 4M78F 3L2VA 1IGUA 2KK4A 2E65A 4J7FA 1HK9A 4O5VA 4X34A 1RI0A 1TUCA 2MI6A 3RDVA 1T0HA 1OV3A 5KE3A 4M75B 4NS5A 3EGUA 4JDSA 4XU2A 1RABB 3I5SA 1H641 3P8BB 3EGDB 5GAMd 2X9HA 4F7UA 2A28A 4M7AF 1P92A 4FT2A 2J6KA 1YJWT 2LDMA 2J06A 3J7AF 4CC7A 4AFUC 2A08A 2ATCB 4F14A 3J81E 2QQSA 2M0YA 4C92B 2KY9A 3NTKA 1S72T 3CEYA 3VV0A 2PQWA 4EDUA 1UGRB 4ZTJA 5M9OA 2LQNA 4BY6B 2VGNA 1SSHA 4M7DF 3FC3A 3UF4A 2KYBA 1KC8R 5EG2A 4J9EA 2YUPA 5GAOl 3GF5A 5IXFA 2FG0A 4WF2A 5LJ3h 2EAYA 1BCMA 1OOTA 4BACA 2J7IA 4E47A 1YCYA 2KT1A 3NTHA 4E7LA 2KBTA 1K73R 3SWNB 2KE9A 4A53A 5IT9E 2JS2A 1RAEB 2QDLA 2RJFA 2QQRA 3ME9A 4OB1B 3CMEQ 2LT1A 2ROLA 2P0QA 2D0QB 1BCOA 3EFOA 3NHNA 4O6JA 3SEMA 1QVFP 1YJWQ 1NYGA 2YLCA 3LH5A 4QQ6A 1SHGA 5KCOA 3LW5E 2MWOA 2F2XA 1NLPC 1WI7A 2E6ZA 1KFZA 4IUUA 4M75C 1JU5C 1BKBA 1UHCA 4ATOA 3SD4A 3VU3C 3CCJQ 2Y4YA 5D6XA 3TCJA 4N0AC 1ZBJA 5GAMj 1M2VA 3A8OB 4IUQA 1U3OA 1BBZA 4F7UG 1Q7YR 3ZBDA 2Y4XA 1OPLA 1V29B 5L23A 3V8KA 1MMNA 4E7IA 1WHMA 2V1QA 3EG0A 3BE3A 2K9GA 4C92C 3THKA 1RI9A 2P84A 2VXFA 4AG1C 4MZMA 3OYFA 3VYGA 4PFZA 1BB9A 2A37A 3BDUA 2LP5A 2JTMA 4CC3A 4BY6C 2RHYA 2LX7A 1YITQ 2MOXA 3OMCA 1NJIR 4J9CA 3PIOA 2DVJA 1UGQB 4DOVA 2EYXA 1AWOA 2FYKA 3H9NA 3PIPA 4EMKB 3UATA 1Q82R 1ZUYA 5LJ5h 1E6HA 2FZGB 3CBMA 3ZL7C 2QAZA 4KUDK 1VIEA 3SWNC 4QVDA 3CC7A 2RN8A 1ABOA 4OGEA 4D8KA 3EGXB 2YT6A 3GNGA 2HSEB 1CSKA 3VS5A 1Q81C 2BZXA 2RK1A 2DIQA 2LJ1A 2LNVA 2QTXA 4M78A 2CDTA 3I56Q 1SHFA 2E10A 4F7UE 1W1FA 1OYXA 3JCMc 4BI4A 1YJ9Q 3MP6A 5GMKi 3FIFA 3JCMg 4KULA 2ENMA 3M59A 4TVRA 2GQVA 3CCUQ 1KD1R 4J8OA 2RHUA 1RLQC 1QWEA 4J5YA 2DA9A 1KHCA 2C06A 4M7AA 2OTLQ 1AT1B 2RJDA 3A1PA 1W2BA 2G3RA 3CC4Q 1QKWA 2F2VA 4MMKA 1YWOA 4LE9A 2A7YA 3LWIA 3CXCS 2QQ9A 1PWTA 5GAN4 1T3LA 2DL4A 2K2MA 2DF6A 3I55Q 3L2UA 4PJLA 2NYSA 2LCSA 2QEXA 4M7DA 3RUXA 1UJYA 4Y92A 1CKAA 1JB0E 3M5AA 3RKWA 1N5ZA 4GBQA 2YUOA 1RACB 2WSCE 1K9MU 4XTUA 4MZPA 1NE8A 4J6WA 4EMKC 1VQNQ 5IH2A 4LXCA 8AT1B 5KCHA 2JJ9A 2HBWA 3L1AA 2G6FX 1SRLA 2KSSA 4IKFA 1UGVA 2CP0A 4DQ2A 3M58A 4DBFA 2NUPA 2RNAA 1WIEA 1JXOA 5GANe 2EBPA 2EW3A 4LN2A 2DK3A 2DILA 2HL3A 4CC4B 3KXTA 3CC7T 4M78G 5FU7B 3CC2A 3HP9A 5HKCA 2B8AA 2ZCFB 4PJMA 1D0ZA 1HSQA 4QKUA 3MEVA 2COZA 2DD5A 1RAIB 2K5LA 2XDBA 3JV3A 2FPFA 5FROA 4BE2A 2J05A 4II1A 2L5QA 2RHIA 4C8QB 1WHHA 3GOXA 3CBPA 1EZZB 1SRMA 4EMGA 3MHXA 3QPHA 4M7AG 3OW2S 5HK3A 2PVGB 3VRZA 2QG9B 2YDLA 4WCIA 2CZ6B 5KYYB 4ZGEB 2C0TA 2O4XA 4Y28E 2R5MA 5GAN2 2XMFA 2AK5A 3EG9B 3QDRB 4HVWA 1Z9ZA 2H3EB 3CD6A 4M77E 4JRQA 1B07A 2GGRA 2GQIA 1KSWA 3WXMB 3TSWA 4M7DG 4LUDA 2RH2A 1VQMA 4J83A 3JCMf 3QZ5B 1QVFA 1N8RU 1B34B 2HBPA 3EFSA 1ZHIA 4C5GA 2EQKA 1NJIC 1M3AA 1IHVA 3CC7Q 2QEXT 1BU1A 1RAFB 1ZLMA 3CCSA 2CH4A 2QGGA 1WHJA 3KFVA 1V1CA 3MPUB 3G4SQ 5KE2A 1G83A 2DKGA 4IUPA 5GAN8 4J9FA 4ELYC 2AZSA 1SG5A 3M0TA 1IXDA 2JTEA 5IHNA 3SFMA 2NWMA 2EFIA 4PFOA 2O31A 3SB2A 3P8HA 3M0UA 1YP5A 5KYNA 3OBYA 1CKBA 2K6DA 1QCNA 1UUEA 2HEQA 2NUTB 3C4SA 4C8QC 1KIKA 3LH0A 3CC2T 2VYTA 4JJDA 1M90U 2DPPB 4PJOE 2JTFA 5I22A 3AT1B 3E2UA 2FZCB 2X3XD 2RQTA 3GP8A 4QVZA 2K3BA 2CUDA 3IQLA 5AT1B 2OAUA 3JCMd 2DRKA 1H3ZA 3V8JA 1VUBA 2E5QA 4MZTA 1NZ9A 2C0IA 2MPXC 1I5OB 2D1XA 5D6YA 4BB7A 1I4K1 1UFFA 4FYWB 2DETA 4HCCA 2HAXA 3CD6T 4M7AD 5GAN3 4HCBA 2KEAA 4JZ3A 2GFUA 3QUIA 1B3QA 3NTIA 3R6OA 4FW1A 4R56A 5KYUA 3CMEA 1JJ2P 1VQMT 1OZ3A 1KJWA 4M75A 3OMGA 2L3RA 2BTTA 4FM4B 1G3TA 2K5IA 4N0AA 4PJOD 4ANJA 4JPBW 2RJEA 1VQPQ 2JM8A 3SHWA 1X6GA 3CCST 4XQ3A 1VQKQ 4X9DA 1M9SA 2X35A 4RTXA 3C95A 1Q95G 1D3BA 1MNDA 1IGQA 3ZEHA 3CCJA 4C92A 2VGMA 1WHLA 2EJGA 1YJNA 2PTKA 3G71Q 1QVGP 3QKJA 2ED1A 1PSEA 1UG1A 3A8HB 1R77A 1N8RC 2R58A 1UGPB 4PLLA 2EJFA 1YHQQ 1KQ1A 2V1RA 1DJ7B 2KR3A 2DMOA 3RMQA 2V8KA 2O2OA 2X4WA 1G3YA 1AHJB 3OYLA 4BE1A 1YCSB 2D8JA 1K1ZA 1YITA 2IIMA 2JMCA 5KYWA 2E4HA 3DLMA 5GAOr 2JZ2A 1D1BA 2LJ3A 3SWNA 2F2WA 2CP3A 2X4JA 1WHGA 2EJ9A 2KI7A 5GAMe 3FRNA 2KRNA 3VUZA 5GANh 4BE0A 2YUQA 5KYXB 1HD3A 3VS6A 3X20B 3QSUA 1Y96B 1KQSP 4CI0C 5IAYA 3JCMP 1GFDA 3L2WA 2YLBA 2GTJA 2RO0A 2PUOB 2L3SA 2KXCA 1VQ5Q 3CPWP 3RNJA 1W2BS 4M75G 5HK0A 4EPCA 3I9QA 2LJ0A 1M90C 2XU8A 1I1JA 1PC0A 2K3XA 2PZ1A 1WNLA 5CIUA 3I56A 3M55A 2LMJA 3CMET 2K2VA 2JUFA 2P4TA 3JCMb 3JB9F 3FJ5A 3E9FA 1YJ9A 2L0AA 2JNGA 5A0LA 3RR6A 1ZSZB 1MGQA 1SSFA 2P0PA 4KT0E 3OSSC 2WSEE 3CCUA 1U1TA 2ESWA 3PMTA 2DRMA 2DZCA 3BY7A 2A36A 4C92G 1XTDA 2BKDN 2XI9A 2OTLA 1LCKA 2L2PA 1WJQA 1BIBA 4OMFB 1TWBA 3CC4A 1NG2A 1BI3A 1D0XA 3CCJT 2DL8A 3QG1A 2RQUA 1M8MA 5D7UA 1UE9A 1X2QA 2DXTA 1YJNT 2LQKA 3GIBA 1AZGB 2DTIA 2L3PA 2XDDA 3I55A 1FMWA 2RHXA 4EMKA 2K4YA 3QXEB 1AEYA 3OYAA 2DIGA 2A3LA 3JCMX 2SRCA 5J3BA 5LJ5j 2K5FA 3NGPA 1VQOQ 2AT1B 2DXUA 2JT4A 2D0NA 2X3WD 2JN0A 4FSSA 1IHWA 2YUNA 1UB4A 3M54A 3EGXA 1YITT 1VQNA 1G8XA 1M1KU 4QW2A 2GTOA 1U8RA 5A0GA 5CKFA 5HY6A 1QQJA 2AHJB 4OMQA 2KRSA 4N4IA 2E3HA 4JUVA 3OBWA 1OULA 2DBKA 1Q86C 1Y71A 5FRMA 5IHKA 1QCFA 3QHSA 2DLPA 3TU4K 3L42A 4AMCA 4LDUA 1C1AA 3EFRA 1PRLC 4LUEA 1ZA2B 2X4XA 4LD9K 4PK4A 1GBQA 1EFNA 4OB3B 2IPOB 2RQRA 3L2RA 1OQKA 1YJNQ 2VUBA 2HNIA 2D9TA 1JEGA 1H3HA 1ZSGA 2EGEA 4BD3A 4BDZA 3VRYA 1PG5B 1WPYA 2HQHA 3I56T 1IO6A 1QVFS 2BE9B 4ZNXA 3JSCA 1WJRA 2H3JA 1YJ9T 1NBEB 5CR2A 4NL2A 2DJQA 1PD0A 2BZYA 1M4ZA 4F7UB 3CCUT 4MMLA 3QBYA 3CCEQ 4RCCA 4PLIA 1SPKA 2OTLT 3E1SA 4E7KA 3HRSA 5I11A 3LWHA 3CC4T 3A8GB 3ULRB 1JJ2A 1WDXA 1WJSA 1TU0B 5CQYA 1SKUB 2HL5C 1JO8A 1YFNA 1BI0A 3A5ZB 1VQ4A 3I55T 1NLOC 3OYIA 4FU6A 3MP1A 1MHNA 4J7IA 1QCOA 1UTIA 3O8VA 4KRTA 1QW1A 2DL3A 1K8AU 1IREB 1XNIA 4HVVA 4E7JA 3MP8A 5KH6A 5GAN7 4OB0B 2LQ8A 3G4SA 3M53A 4GLKA 3CCLA 1TUDA 2DBMA 1YI2Q 4DBQA 1D0YA 1QVGA 1VQNT 3META 1N27A 4JS5A 2D8HA 2E1HA 5LJ3g 4QVCA 4CRIA 4PFPA 3X28B 4LDWA 4PKCC 3GLXA 3HL8A 1MMGA 5C6SA 2EKOA 4QQDA 2V8IA 3CCRQ 3JB9J 3EFOB 4C5EA 2RA2A 3GNFB 2RD1A 4P5NA 4B9WA 3OYYA 1R0CB 1AVZC 2CUBA 5KYYA 3FLGA 4M4ZA 5I21A 3OS0A 2XK0A 1KG1A 2HDAA 2DXBA 5CAIA 1ZUKA 3OYCA 1UJ0A 1X43A 4F04B 2DD4A 4EIKA 2W10A 1M1KC 1VQ7A 1NEGA 1VQLA 1Q82U 5GAMh 2LT4A 2GF7A 1VA7A 4A4GA 2DXCA 4C0ZA 3JCMJ 3BFMA 2O88A 1GBRA 2M1HA 1KQSA 1FWZA 2YRVA 1K0XA 5A0DA 3VS2A 3S6WA 2KT8A 4HT8A 3INZA 4E7HA 4A4EA 3CPWA 1KK7A 4XTVA 2EKHA 1N9SA 5GANf 4M75F 2EWNA 1YIJQ 1EIFA 1F1BB 1G2BA 4RUGA 3MCAB 2W0ZA 1E7OA 2QDYB 4B6MA 3RKYA 2QA4Q 1J3TA 3KBGA 4M77B 5GMKj 4LDXA 2ZGWA 4LD6A 1VQ4T 1AOJA 4ORZA 4E2FB 1R0BG 4C92F 1B7TA 4OMMA 1G3WA 1VQPA 1ZA1B 4LDYA 3TSZA 1N8RR 1VQKA 3OQ5A 2CYZB 2XHCA 3UA6A 3QYGB 2COWA 1IRXA 5LJ5g 2YHTA 2DYBA 1VQ6Q 1FMKA 3G4ST 2NUTA 3BW1A 3CCLT 2HKNA 4RTWA 2FRYA 1Y0MA 1H92A 5FU6B 1LNXA 2ZPIB 3G71A 3OYBA 1TUGB 4D8DA 2KVQG 3PGGA 3JB9G 1W70A 1WXUA 4Q5WA 1UHFA 2XKOC 2E6NA 4J6XA 2MYSA 3LGLA 4B9XA 5GJWB 1YHQA 1D1CA 1PM3A 1XOVA 3V7SA 1M3BA 3VUBA 2MK5A 4OP0A 1TSFA 4J9IA 2FPDA 3V7CA 3A8LB 1SEMA 5LJ3f 5GANd 3PVQA 1T0JA 2RI3A 3JCMV 3X26B 1RAAB 4YTLA 1VQ7T 1A0NB 1VQ4Q 1VQLT 5GAOq 4A54A 2RHZA 1K0SA 3UA7A 1M90R 3UPUA 4FW2A 4PJOB 1MV0B 4HVUA 1Y7XA 2EGAA 3C94A 3VKIA 3P8DA 4ZTFA 3OS5A 3CCLQ 3OS2A 4M78E 3OYMA 2JS0A 3RESA 2KRMA 4XK8E 3WVDB 1VQ5A 4MDXA 1VYVA 4HCKA 1M1GA 3JB9H 4M77C 2K7AA 3HRUA 2DAQA 2ZPBB 1PCXA 5HCKA 3OYHA 2JVVA 3CCVA 5CKEA 3UT1A 4RCBA 2M51A 3JCMe 2DTHA 1K9AA 5FU7C 1W6XA 4M7AE 3LYIA 1OX8A 2RQWA 3EHQA 4OVAA 5J26A 4XTWA 1RUWA 4CC2A 1AZEA 1IB8A 2NUPB 3OYNA 2PUKB 4GY5A 1VQPT 4C0FA 1K9MC 4XU0A 2OAWA 1VQKT 2KGTA 2VB6A 2YSQA 4RMOA 3MEAA 1VQ7Q 1X27A 2QQAA 1VQLQ 1TXQA 4KGZB 4AFZC 3I35A 3QYHB 5LJ3d 3CCMQ 4M7DE 4EMHA 1T3SA 2YWWA 4HCZA 3H8ZA 4M78D 4FT4A 2ROTA 1VQ9A 2DM1A 2QI2A 3G71T 3FDRA 4GLMA 4FYYB 1PD1A 3EH2A 1RL2A 3JCMQ 1NPPA 5CVIA 4FCYA 4OMNA 5KYXA 2HKQB 2L8DA 1VQOA 1ZX6A 3ZFJA 5GANj 5LJ5f 1YHQT 4V2SA 2E3IA 1Y96A 3TVTA 1G5VA 2GNCA 1WYXA 4OB2B 3JB9D 1Q86R 2O4XB 3TEEA 2ZAEA 3H0IA 4C0GA 3MO8A 4AG2C 2QQBA 1LOJA 4L59A 2WSFE 1U5SA 4PJOC 3DLLA 2ZPGB 3TREA 1QMCA 1MNEA 3EGDA 1WGSA 4JRPA 5DLQE 4QT7A 1O9SA 3DKMA 4M7DD 3ASKA 1GCPA 1QP3A 2CP7A 4OF1A 3X25B 4ZGJB 1WHKA 2EGCA 4KH0B 2MIOA 1H8KA 5I2SA 3NFCA 3NMZC 1VQ5T 2E70A 5FRNA 1NPRA 3J80E 2DVEA 1JJ2S 2QXFA 1M27C 2OJ2A 3JRZA 2XDPA 3CCVT 1LPLA 5EC7A 1YN8A 2VVKA 2YRCA 2KMTA 2P0KA 2KYMA 1R8OB 2JOYA 2ZPFB 1E6GA 1QP2A 4J9BA 5LJ3j 1QVPA 3VS7A 5LJ5d 3CCEA 2NLUA 3QO3A 1M5Q1 3CQTA 5FWCA 1WQ7A 4XTZA 3G6EQ 1ABQA 2JW4A 3RMSA 1QVGS 4A4HA 2DYIA 4M77F 5IN1A 1OI1A 3RERA 1VQ9T 1HXDA 1VIFA 2OX7A 3VS4A 3JAME 2DEQA 4JLIA 2LCLA 4J9DA 2PVOB 4XU1A 2CH4W 3S3MA 3CMAQ 2BIVA 4KH1B 2LCCA 1PSFA 1VQOT 3HSBA 1RAHB 2PVDB 2LQWA 2RI2A 3HFNA 2HMAA 4Z88A 3EAEA 4C8QF 5GJVB 3PE0A 1YI2A 2R57A 3M4GA 3CCVQ 2X51A 1K4US 4FSXA 4HXJA
chains in the Genus database with same CATH topology
2CZ1B 3HRSA 5GAN6 3LWHA 3CC4T 2DK3A 3A8GB 3F70A 3M56A 3KXTA 3CC7T 1JJ2A 4DA4A 3HKSA 4M78G 1WJSA 2CGHA 4LDVA 5CQYA 5FU7B 3CC2A 3HP9A 1M1FA 5HKCA 3CCRA 2B8AA 2ZCFB 4ZN3A 3HHTB 4PL6A 1BI0A 5CKHA 3A5ZB 3MEVA 1KQSS 2DD5A 4Y91A 4HT9A 1VQ4A 3H6ZA 2K5LA 3QJYA 4BI3A 3OYIA 3I55T 2XDBA 2LC4A 4FU6A 1IZ6A 1MHNA 3MP1A 4J7IA 4A4FA 5FROA 4NL3A 3OYEA 4II1A 5CCAA 3G6ET 2L5QA 3O8VA 2RHIA 1W4SA 4C8QB 3GOXA 2KAFA 3CBPA 1QW1A 3CXCA 1K8AU 1IREB 1XNIA 2E64A 3MEWA 2E41A 3MP8A 4EMGA 3PTAA 4E7JA 2D6FA 2VC8A 5GAOn 1D3BB 5KH6A 5GAN7 3MHXA 3QPHA 4OB0B 4M7AG 2LQ8A 4IURA 3SDZA 3OW2S 5HK3A 2OTLT 2PVGB 4ZN1A 3G4SA 3M53A 4GLKA 3CCLA 2CZ6B 4X9CA 1Q81U 3GPLA 4ZGEB 4Y28E 2O4XA 3URGA 1QVGA 2R5MA 4PJOF 3META 5GMKl 5GAN2 1VQNT 1N27A 3QDRB 3T9NA 2FVUA 5LJ5e 5I2MA 4JS5A 3CMAT 5DLOA 1N6AA 1YJWA 2LTOA 1UEBA 2E1HA 4QQGA 5LJ3g 4M77E 3CD6A 2DO3A 4XAXB 2M0OA 4JRQA 4N4HA 3QIIA 4QVCA 4CRIA 3PNWC 2F69A 2F5KA 3X28B 4LDWA 1N9RA 4PKCC 2IG0A 3GLXA 1UGSB 3HL8A 5C6SA 1S72A 2EKOA 4QQDA 3WXMB 4Z02A 2V8IA 3JB9J 4M7DG 3QZ9B 2RH2A 2V8JA 1VQMA 3X24B 4J83A 1X75C 4C5EA 2HQXA 3QZ5B 3JCMf 2RA2A 1QVFA 3CCET 1N8RU 3GNFB 2RD1A 1B34B 4P5NA 4A4KA 4B9WA 4M75E 3OYYA 2HBPA 1YIJA 3EFSA 1ZHIA 4C5GA 2EQKA 1NJIC 3CBOA 3FLGA 3V8LA 4ELZC 2LVMA 3JCMh 2OTJT 5I21A 3OS0A 2XK0A 2QEXT 1KG1A 2DXBA 5CAIA 3OYCA 2F5TX 3OSVA 3PMIA 1BYMA 5GAMf 3CCSA 3UWNA 2QA4A 2DD4A 3OB9A 5D6WA 4ME7A 4D6WA 2IVWA 1M1KC 1VQ7A 2M16A 5L8RE 1Q86U 1Q82U 1VQLA 2RI5A 1XQHA 2DJZA 5KE2A 5GAMh 2LT4A 5GMKm 2DKGA 4IUPA 4IUTA 2GF7A 4KUIA 5GAN8 5C0MA 2K3YA 4JLGA 2DXCA 4A4GA 4C0ZA 4C92E 4ELYC 2MMPA 3S3NA 3JCMJ 4PNOA 3BFMA 2M1HA 2CS7A 4OGCA 1KQSA 3SFMA 1FWZA 2YRVA 2EFIA 4FL6A 5A0DA 3L2QA 2MWPA 3FB9A 3S6WA 4BDYA 4UC4A 3INZA 4E7HA 4HT8A 2FHDA 5GANg 3LX7A 1VQ6A 3SB2A 3P8HA 4A4EA 3CPWA 2KQWA 1KC8U 4XTVA 1YI2T 4JJNK 2K57A 2ZZDA 2O01E 3OBYA 1N9SA 2L89A 4M75F 5GANf 2EWNA 3ER0A 5FLXE 3CPFA 2XG8D 1EIFA 3OW2A 3MCAB 5CK9A 3V7RA 4M75D 2EYQA 5LL6S 2QDYB 1I8FA 3C4SA 3OYGA 3S3OA 1TH7A 4C8QC 3RKYA 3M57A 3LH0A 3CC2T 2EQUA 1O75A 3LGFA 4R55A 3CCRT 2VYTA 4XU3A 3KUFA 1M90U 5GMKe 3KBGA 4M77B 2DPPB 5GMKj 4PJOE 1ZBXA 2JTFA 1K73U 4LDXA 2ZGWA 4LD6A 4M78F 1VQ4T 3VJPA 3DB4A 5DY9A 5AYFA 2LRQA 3L2VA 3GP8A 4QVZA 2KK4A 4C0DB 2E65A 1HK9A 4J7FA 4O5VA 4C92F 4X34A 2OAUA 1RI0A 3JCMd 2MI6A 1G3WA 1VQPA 2ZPHB 3C12A 4LDYA 3V8JA 1H3ZA 1VUBA 1VQKA 3OQ5A 4C92D 2CYZB 2XHCA 2E5QA 3QYGB 5KE3A 4M75B 2EQMA 4NS5A 2XD0A 4JDSA 4XU2A 2FB7A 2HD0A 2MF2A 5LJ5g 2YHTA 4MZTA 1NZ9A 1H641 3P8BB 3G4ST 2E12A 3CCLT 3BW1A 5D6YA 4BB7A 5GAMd 1I4K1 4F7UA 4M7AF 1P92A 3MEUA 5CKBA 5FU6B 1LNXA 4HCCA 4M77A 2ZPIB 3G71A 4FT2A 3OYBA 2HAXA 1YJWT 3CD6T 4M7AD 2LDMA 5GAN3 2KVQG 3PGGA 4RKUE 3JB9G 4HCBA 3OYJA 3J7AF 2GFUA 4Q5WA 3QUIA 3N5BB 2X4YA 2QQSA 2XKOC 2E6NA 3J81E 3NTIA 3R6OA 4J6XA 4C92B 1KQ2A 2KY9A 3NTKA 3LGLA 4R56A 1BI2A 3CEYA 3VV0A 4B9XA 3CMEA 1S72T 2PQWA 4EDUA 1VQMT 1UGRB 1YHQA 1OZ3A 1Q7YU 4M75A 3OMGA 5CKDA 5CO7A 2L3RA 1XOVA 2BUDA 4ZTJA 3V7SA 2I2LA 5M9OA 3VUBA 4FM4B 1JBMA 1G3TA 4OP0A 4BY6B 2VGNA 1YIJT 4M7DF 1ZQ1A 2K5IA 4N0AA 4PJOD 1OZ2A 2RJEA 4HA8A 3FC3A 2RM4A 3A8LB 3V7CA 4C8QA 5EG2A 2CKKA 4HKEA 1BIAA 5LJ3f 3RKXA 5GANd 2ZPEB 5GAOl 4XQ3A 3GF5A 3CCST 2RI3A 2QA4T 4X9DA 1M9SA 2X35A 3JCMV 3X26B 2FL7A 3C95A 2R5AA 3G7ZA 4YTLA 1D3BA 1VQ7T 4WF2A 1VQLT 3ZEHA 5LJ3h 5GAOq 2EAYA 3CCJA 5A2QE 4A54A 4C92A 2VGMA 4BACA 4E47A 1YCYA 2RHZA 3PFSA 2VXEA 3NTHA 1NJIU 2EJGA 3M9QA 1YJNA 4E7LA 4RG8A 4ZGDB 3CPWS 3QKJA 3UPUA 4PJOB 1PSEA 3UDCA 3A8HB 1X01A 1Y7XA 3SWNB 3C94A 4A53A 1N8RC 3L2ZA 2R58A 3VKIA 5IT9E 3P8DA 1UGPB 4FIBA 4ZTFA 2RJFA 3OS5A 3E9GA 2QQRA 3ME9A 4M78E 4OB1B 3OS2A 3OYMA 1VQ6T 4PLLA 3CCMA 2LT1A 4XK8E 3RESA 3WVDB 1VQ5A 4MDXA 2EJFA 2P0QA 2D0QB 1KQ1A 1M1GA 1DJ7B 3JB9H 4O6JA 2V8KA 2RJCA 3RMQA 2X4WA 4C5HA 1B34A 1G3YA 1AHJB 3DB3A 4M77C 4N4GA 3OYDA 3OYLA 4BE1A 3HRUA 2DAQA 2YLCA 2ZPBB 5GAOm 4QQ6A 3OYHA 1YITA 2WACA 2JVVA 3CCVA 4C0DC 5CKEA 4NOYA 3UT1A 5KCOA 4RCBA 3DLMA 3LW5E 3JCMe 2MWOA 5GAOr 2JZ2A 2DZ9A 4PJOA 2DTHA 5FU7C 4XTXA 2E6ZA 3SWNA 4M7AE 3LYIA 4IUUA 4M75C 3FJPA 1BKBA 4ATOA 3SD4A 5GAN5 4JRKA 3VU3C 2Y4YA 2MAMA 4BUGA 4OVAA 2X4JA 3OS1A 2EJ9A 5J26A 5D6XA 4XTWA 3TCJA 4N0AC 5GAMe 3FRNA 5GAMj 1I5LA 3VUZA 5GANh 4BE0A 1VQPT 3OYNA 2PUKB 3A8OB 4GY5A 4IUQA 4C0FA 4F7UG 3CCQA 1K9MC 4XU0A 3HFOA 2Y4XA 3ZBDA 1KC8C 1VQKT 3X20B 4M77G 4RMOA 3QSUA 1V29B 1Y96B 3MEAA 4CI0C 5IAYA 3V8KA 2QQAA 4E7IA 3JCMP 1KD1U 3L2WA 2YLBA 3QYHB 4JRIA 2M9UA 2RO0A 2PUOB 5LJ3d 3BDLA 4M7DE 4EMHA 4C92C 4HCZA 2VXFA 3H8ZA 4M78D 4FT4A 2RB6A 4MZMA 1VQ9A 2QI2A 4VUBA 3OYFA 3G71T 3FDRA 3Q1JA 1W2BS 4M75G 3VYGA 5HK0A 4EPCA 3BDUA 1M90C 1RL2A 2JTMA 2XU8A 1Y07A 1NPPA 4BY6C 3JCMQ 2RHYA 1K73C 2K3XA 2VV5A 1WNLA 5CIUA 5CVIA 3I56A 3M55A 3OMCA 2XICA 3CMET 2K2VA 4JS4A 2JUFA 3LLRA 4C8QG 2L8DA 2P4TA 1VQOA 3ZFJA 3JCMb 3PIOA 5GANj 5LJ5f 1YHQT 1VQ8A 3JB9F 4V2SA 1UGQB 3E9FA 4DOVA 1LJOA 1Y96A 1YJ9A 2FYKA 2JNGA 4RG2A 5A0LA 1G5VA 3PIPA 4OB2B 4EMKB 1MGQA 1SSFA 2P0PA 4KT0E 3OSSC 3JB9D 3AHUA 2WSEE 2O4XB 3TEEA 3CCUA 1U1TA 4M78B 5LJ5h 3PMTA 4C0GA 3MO8A 4M7DC 3BY7A 2DZCA 4C92G 2EIFA 2QQBA 5DM7R 1XTDA 2BKDN 3CBMA 1LOJA 2XI9A 4L59A 4KUDK 2OTLA 1VIEA 2WSFE 1WJQA 1BIBA 3DLLA 4PJOC 4OMFB 1FX7A 2ZPGB 3TREA 3CC4A 3SWNC 4QVDA 3WVEB 1K8AC 3CC7A 1BI3A 1I81A 1WQWA 3CCJT 1WGSA 4JRPA 3QG1A 4OGEA 3GNGA 5DLQE 1O9SA 3DKMA 4L6V5 1X6OA 2DXTA 1YJNT 2LQKA 3GIBA 4M7DD 4M7AB 1Q81C 2DTIA 2RK1A 2XDDA 2DIQA 5J39A 3I55A 2RHXA 3HRTA 3ASKA 2K4YA 3QXEB 4EMKA 1Q7YC 3FEOA 1QP3A 2LNVA 2QTXA 4OF1A 3G6EA 3X25B 3OYAA 2DIGA 4M78A 2A3LA 4ZGJB 3JCMX 2E10A 5J3BA 4F7UE 1YBYA 5LJ5j 3CCMT 1OYXA 2K5FA 3NFCA 5I2SA 1VQ5T 2E70A 3JCMc 2LX9A 4BI4A 5FRNA 3RIRA 1NPRA 2DXUA 3MP6A 5GMKi 2DVEA 4PJOG 1KHIA 3FIFA 3JCMg 3J80E 4KULA 1FXXA 2JN0A 3M59A 4IUVA 4TVRA 2GQVA 1JJ2S 2QXFA 4J8OA 1UB4A 3M54A 2GFAA 2RHUA 2XDPA 3JRZA 1YITT 1VQNA 4M7DB 3CCVT 4J5YA 1M1KU 3CMAA 1U1SA 4QW2A 2HQEA 1KHCA 4E7KA 2C06A 1U8RA 4M7AA 5A0GA 2EQJA 5GAMg 5CKFA 5HY6A 2AHJB 2KMTA 2P0KA 2RJDA 2G3RA 1W2BA 1R8OB 4N4IA 4KBMB 4JUVA 2JOYA 4MMKA 1GXIE 2ZPFB 3VYHB 2A7YA 1QP2A 3OBWA 3LWIA 4C8QE 3CXCS 5LJ3e 5LJ3j 2QQ9A 1QVPA 5LJ5d 1Q86C 5GAN4 1Y71A 2NLUA 1BI1A 4DOWA 3CCEA 3QO3A 1Q82C 4C5IA 1M5Q1 3CCQT 5FRMA 3M4YA 3L2UA 1WQ7A 2KDSA 3QHSA 3TU4K 3L42A 4XTZA 2OTJA 2CZ0B 5GAOp 3RMSA 2QEXA 2Y90A 1JRIA 4LDUA 4F7UF 3EFRA 3OY9A 3PT9A 4M7DA 2X4XA 1QVGS 4A4HA 3RUXA 5GMKh 4LD9K 4M77F 5IN1A 1JB0E 3M5AA 4OB3B 1OI1A 4L5GA 3L2RA 3RKWA 3RERA 1M8VA 2VUBA 1HXDA 1VIFA 2GCXA 2HNIA 4J6YA 3JAME 2D9TA 3JB9I 1VQ9T 4M77D 2DEQA 4JLIA 5FU6C 2WSCE 2LCLA 4BD3A 3OYKA 4BDZA 1K9MU 4XTUA 2PVOB 1NE8A 2RK2A 4J6WA 4MZPA 4EMKC 4XU1A 4BE2A 2PU9B 3S3MA 1WPYA 4M78C 2BIVA 3I56T 1QVFS 2LCCA 3JSCA 1PSFA 1VQOT 3HSBA 2PVDB 1VQ8T 4MDWA 3E19A 1WJRA 2H3JA 2RI2A 3HFNA 1YJ9T 5CR2A 3QJ6A 4NL2A 4XTYA 5KCHA 5CQXA 3L1AA 3EAEA 4C8QF 1M4ZA 4F7UB 3CCUT 2KSSA 1YI2A 2R57A 4MMLA 3M4GA 3QBYA 4BI8B 4IKFA 4DQ2A 3OA6A 3A8MB 3M58A 4RCCA 1KD1C 3JCMW 4PLIA 4C8QD 2DTOA 2CZ7B 3HPWA 4FSXA 2XIDA 5GANe 3E1SA 4M7AC 1G3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTV A;  2K57 A;  4A53 A;  3L2Z A;  5GAN 6;  1N9S A;  2DXT A;  3GIB A;  5GAN f;  4M75 F;  4M7D D;  4M7A B;  2EWN A;  2DTI A;  4M78 E;  4M78 G;  2CGH A;  3RES A;  4EMK A;  2EJF A;  2QTX A;  1KQ1 A;  3V7R A;  4M75 D;  4M78 A;  3JB9 H;  3JCM X;  4M7D E;  2E10 A;  4Y91 A;  1I8F A;  4HT9 A;  4F7U E;  1B34 A;  4M77 C;  1TH7 A;  4C8Q C;  3RKY A;  5LJ5 j;  2YLC A;  4NL3 A;  4XU3 A;  3JCM c;  5GAO m;  5GMK e;  4M77 B;  3RIR A;  5GMK j;  4C8Q B;  2DXU A;  5GMK i;  4PJO E;  2DVE A;  4PJO G;  3FIF A;  4NOY A;  3JCM g;  2ZGW A;  4M78 F;  4RCB A;  2JN0 A;  2E64 A;  4EMG A;  3JCM e;  2E41 A;  5DY9 A;  5GAO r;  4M7D C;  2DZ9 A;  4PJO A;  2DTH A;  2VC8 A;  5GAO n;  2E65 A;  1D3B B;  1HK9 A;  4XTX A;  3SWN A;  4C92 F;  5GAN 7;  4M7A G;  4M7A E;  4M7D B;  3JCM d;  4M75 C;  4J5Y A;  3FJP A;  1U1S A;  4JRK A;  5GAN 5;  3V8J A;  3VU3 C;  4M7A A;  4X9C A;  4C92 D;  5GAM g;  2EJ9 A;  4M75 B;  4XTW A;  4N0A C;  5GAM e;  5GAM j;  1I5L A;  4XU2 A;  2FB7 A;  4PJO F;  5LJ5 g;  2YHT A;  5GMK l;  5GAN h;  5GAN 2;  4JUV A;  1H64 1;  4MMK A;  4F7U G;  5LJ5 e;  4XU0 A;  3BW1 A;  3HFO A;  2E1H A;  5LJ3 g;  5GAM d;  4M77 E;  1I4K 1;  4M77 G;  4C8Q E;  3QSU A;  4QVC A;  1Y96 B;  4F7U A;  5LJ3 e;  5LJ3 j;  4M7A F;  5LJ5 d;  5GAN 4;  3V8K A;  1N9R A;  1LNX A;  3QO3 A;  3JCM P;  4M77 A;  1M5Q 1;  2YLB A;  4JRI A;  5LJ3 d;  1WQ7 A;  4EMH A;  3QHS A;  5GAN 3;  3PGG A;  4C92 C;  3JB9 J;  4XTZ A;  4M7D G;  4M7A D;  3JB9 G;  2VXF A;  3JCM f;  4M78 D;  2RA2 A;  2RB6 A;  5GAO p;  2Y90 A;  1JRI A;  2RD1 A;  3QUI A;  3EFR A;  1B34 B;  4F7U F;  1KQ2 A;  4M7D A;  4M7A C;  4C92 B;  4J6X A;  4M75 E;  4M75 G;  3RUX A;  5GMK h;  3EFS A;  4M77 F;  3BDU A;  3JCM Q;  3V8L A;  3RKW A;  3JCM h;  4M75 A;  3RER A;  5I21 A;  1M8V A;  1HXD A;  1WNL A;  4J6Y A;  2HNI A;  2I2L A;  3V7S A;  5CAI A;  3JB9 I;  4M77 D;  2DEQ A;  4JLI A;  5GAM f;  1JBM A;  4OP0 A;  4M7D F;  4XTU A;  4C8Q G;  4N0A A;  5GAN j;  4J6W A;  4EMK C;  3JCM b;  5LJ5 f;  3JB9 F;  4XU1 A;  4V2S A;  4PJO D;  4HA8 A;  1LJO A;  1Y96 A;  2RM4 A;  3V7C A;  1WPY A;  2FYK A;  4M78 C;  4C8Q A;  5LJ3 f;  1BIA A;  3RKX A;  2DJZ A;  4EMK B;  1MGQ A;  5GAM h;  4XQ3 A;  5GAN d;  5GAO l;  5GMK m;  2DKG A;  4X9D A;  3JCM V;  5GAN 8;  3JB9 D;  3AHU A;  3HSB A;  1U1T A;  4M78 B;  5LJ5 h;  4C92 E;  1D3B A;  3BY7 A;  2DZC A;  3HFN A;  4C92 G;  3JCM J;  4WF2 A;  4NL2 A;  1LOJ A;  3BFM A;  4PNO A;  4XTY A;  2EAY A;  5LJ3 h;  3L1A A;  5GAO q;  4C8Q F;  4A54 A;  4C92 A;  4F7U B;  1YCY A;  1BIB A;  3M4G A;  4MML A;  4PJO C;  2VXE A;  4DQ2 A;  3SWN C;  2EJG A;  3FB9 A;  4RCC A;  4QVD A;  4HT8 A;  3INZ A;  3JCM W;  4C8Q D;  1I81 A;  1WQW A;  5GAN g;  2DTO A;  3SB2 A;  4PJO B;  5GAN e;  1X01 A;  3SWN B; 
#chains in the Genus database with same CATH topology
 2CZ1 B;  2OTJ Q;  5GAN 6;  2O9S A;  4DA4 A;  5KYU B;  2CGH A;  1MMD A;  3HTR A;  1M1F A;  1M1K R;  3CCR A;  4PL6 A;  1NM7 A;  4FYX B;  5CKH A;  1KQS S;  2QAS A;  3QJY A;  4BI3 A;  4F17 A;  4JJB A;  3NPF A;  1IZ6 A;  3CPW S;  3OYE A;  5CCA A;  2RQV A;  4R0K A;  3MEW A;  2E41 A;  1SF9 A;  4J9H A;  4A63 B;  1D3B B;  1OEB A;  1VQ9 Q;  4AFS C;  3VS1 A;  1OU9 A;  1WX6 A;  4X9C A;  1Q81 U;  3REB B;  4FYV B;  2RMO A;  3VS3 A;  4PJO F;  1FYN A;  1EX4 A;  3T9N A;  5I2M A;  1N6A A;  2A0F B;  2LTO A;  4XAX B;  5ECA A;  2M0O A;  4N4H A;  3QII A;  3PNW C;  1VYU A;  2F5K A;  4RTV A;  1M3C A;  2LNH B;  1TOV A;  1WFW A;  4Z02 A;  3QZ9 B;  2V8J A;  2OI3 A;  3X24 B;  4JZ4 A;  1X75 C;  2HQX A;  3CCE T;  1MUZ A;  4A4K A;  4M75 E;  1YIJ A;  2DNU A;  2E5K A;  4ELZ C;  2LVM A;  3JCM h;  5KYW B;  2F1L A;  2CSQ A;  2F5T X;  3OSV A;  2QA4 A;  4PJN A;  2QTV A;  5D6W A;  4D6W A;  2IVW A;  1NEB A;  2M16 A;  1XQH A;  2DJZ A;  2CT4 A;  5GMK m;  4IUT A;  4KUI A;  4WTO B;  4X1V A;  5C0M A;  4JLG A;  1OX9 A;  4C92 E;  4E6R A;  2MMP A;  3G1J A;  4PNO A;  3I5R A;  2CS7 A;  4FL6 A;  4UC4 A;  2FHD A;  5GAN g;  3LX7 A;  1VQ6 A;  1S72 Q;  1KC8 U;  1ZSZ C;  1K8A R;  1YI2 T;  2ZZD A;  2H8H A;  2BZ8 A;  2ECZ A;  2SEM A;  4KGV B;  3C0C A;  2QK0 A;  3M0S A;  4RTY A;  4RTU A;  3V7R A;  4M75 D;  2EYQ A;  5LL6 S;  1TH7 A;  1TTH B;  1QKX A;  1O75 A;  1TG0 A;  3CCR T;  3M0R A;  2O9V A;  4XU3 A;  3KUF A;  5GMK e;  3EHR A;  2MCN A;  1ZBX A;  1K73 U;  1X6B A;  3VJP A;  3DB4 A;  5DY9 A;  5AYF A;  2LRQ A;  4C0D B;  3QDF A;  2BE7 D;  2EVR A;  2CP2 A;  1ZUU A;  2ZPH B;  3C12 A;  3D7S B;  4C92 D;  9ATC B;  2EQM A;  4JJC A;  2XD0 A;  2FB7 A;  2HD0 A;  2MF2 A;  1WZO A;  1XJW B;  2E12 A;  5CKB A;  3MEU A;  1LVK A;  2GBQ A;  4M77 A;  2KNB B;  2EPD A;  2J6O A;  1WLP B;  4RKU E;  1C0M A;  4RTT A;  1GCQ C;  3OYJ A;  3N5B B;  2X4Y A;  1VYT A;  1KQ2 A;  3RBB B;  1BI2 A;  1S1N A;  1Q7Y U;  2EQI A;  5CKD A;  5CO7 A;  2BUD A;  2I2L A;  1JBM A;  1YIJ T;  1ZQ1 A;  1OZ2 A;  1NYF A;  1K9M R;  4HA8 A;  2RM4 A;  4C8Q A;  2CKK A;  4HKE A;  1BIA A;  3RKX A;  2ZPE B;  2QA4 T;  3CXC P;  1D1A A;  2FL7 A;  2R5A A;  3G7Z A;  2V26 A;  2J6F A;  1K76 A;  5A2Q E;  2DER A;  3PFS A;  2VXE A;  2JXB A;  1NJI U;  3M9Q A;  2HSP A;  4RG8 A;  4ZGD B;  1MMA A;  3EG9 A;  3UDC A;  4ESR A;  2CSI A;  1X01 A;  3REA B;  4E7Z A;  5FW9 A;  1UDL A;  3L2Z A;  2DX1 A;  2AIR B;  4FIB A;  1Z9Q A;  2HZY A;  3E9G A;  1X69 A;  1VQ6 T;  3M0P A;  3CCM A;  3QWX X;  3A98 A;  1M2V B;  2PNI A;  2L3Q A;  2RJC A;  1RLP C;  4C5H A;  1B34 A;  3DB3 A;  4N4G A;  4AFQ C;  3OYD A;  4Z8A A;  5GAO m;  2WAC A;  2KRO A;  4C0D C;  4NOY A;  2DZ9 A;  2CP6 A;  4PJO A;  4XTX A;  1BK2 A;  4AT1 B;  3FJP A;  4IIM A;  4DEX A;  5GAN 5;  4JRK A;  1AWX A;  2MAM A;  4BUG A;  1WXT A;  3OS1 A;  1I5L A;  3CCQ A;  3HFO A;  1KC8 C;  2FPE A;  4M77 G;  4KGX B;  4IIO A;  3M0Q A;  1KD1 U;  4JRI A;  2M9U A;  3BDL A;  3MKD A;  2CT3 A;  3EG2 A;  2RB6 A;  1VOM A;  4VUB A;  3Q1J A;  5IXB A;  2QYZ A;  7AT1 B;  1Y07 A;  3H0F A;  1HYO A;  3OW2 P;  1K73 C;  2VV5 A;  1C6V X;  2XIC A;  4JS4 A;  3LLR A;  4C8Q G;  1VQ8 A;  2DFU A;  1LJO A;  4RG2 A;  1TS9 A;  3AHU A;  1FMV A;  2RF0 A;  4M78 B;  2FZK B;  2EIF A;  5DM7 R;  2YRD A;  1M2O A;  1FX7 A;  2FRW A;  1K8A C;  3WVE B;  1I81 A;  1WQW A;  1D09 B;  5FWB A;  4L6V 5;  4OML A;  1X6O A;  4M7A B;  5J39 A;  4LNP A;  3HRT A;  1Q7Y C;  3FEO A;  3G6E A;  5IHI A;  2EYZ A;  2M02 A;  3O5Z A;  1YBY A;  3CCM T;  2LX9 A;  2AZV A;  3RIR A;  4PJO G;  1KHI A;  2C0O A;  1FXX A;  4IUV A;  1AWJ A;  2GFA A;  1PNJ A;  4M7D B;  2YXY A;  2COY A;  4DBH A;  1AWW A;  3CMA A;  1U1S A;  1GRI A;  1V76 A;  2HQE A;  4DEY A;  2EQJ A;  5GAM g;  3QWY A;  4KBM B;  1GXI E;  1GL5 A;  8ATC B;  1OPK A;  3VYH B;  4C8Q E;  1MV3 A;  5LJ3 e;  2HCK A;  1Q82 C;  2AKK A;  1BI1 A;  4DOW A;  4C5I A;  3TQ7 P;  3CCQ T;  3M4Y A;  2KDS A;  2OTJ A;  2CZ0 B;  2ED0 A;  5GAO p;  1AD5 A;  2Y90 A;  1JRI A;  4F7U F;  3OY9 A;  3PT9 A;  5GMK h;  2QGF B;  4L5G A;  1M8V A;  1QWF A;  2GCX A;  1YWP A;  4J6Y A;  3JB9 I;  1ARK A;  4M77 D;  5FU6 C;  4J9G A;  3OYK A;  2RK2 A;  4F16 A;  2PU9 B;  4M78 C;  2KXD A;  1VQ8 T;  4MDW A;  3E19 A;  3EG1 A;  3QJ6 A;  2P4R A;  4XTY A;  5CQX A;  2Z0W A;  1HJD A;  4BI8 B;  3OA6 A;  3A8M B;  1JXM A;  1KD1 C;  3H41 A;  3JCM W;  4C8Q D;  2DTO A;  2CZ7 B;  3HPW A;  1PRM C;  4OMO A;  2XID A;  4M7A C;  1G3S A;  1OU8 A;  1RAG B;  2QEX Q;  2RPN A;  3F70 A;  3M56 A;  1QLY A;  3HKS A;  3VS0 A;  4LDV A;  1U06 A;  4ZN3 A;  2VKN A;  3HHT B;  3CCQ Q;  4Y91 A;  4HT9 A;  2I0N A;  1I0C A;  3H6Z A;  2LC4 A;  3EH1 A;  4A4F A;  4NL3 A;  3G6E T;  1WA7 A;  1PKS A;  1JQQ A;  1W4S A;  2KAF A;  3GBQ A;  4DBR A;  3CXC A;  2JMA A;  4M7D C;  2E64 A;  4PJJ A;  3PTA A;  2D6F A;  2VC8 A;  5GAO n;  2DL5 A;  4IUR A;  3SDZ A;  2EYW A;  4ZN1 A;  1ZSZ A;  3GPL A;  1ACM B;  3URG A;  3EG3 A;  5GMK l;  3CMA T;  2FVU A;  5LJ5 e;  2EYY A;  5DLO A;  2ABL A;  1YJW A;  1UEB A;  4QQG A;  4K11 A;  2DO3 A;  1VQ8 Q;  2F69 A;  3R6N A;  1N9R A;  2IG0 A;  1UGS B;  1S72 A;  1PKT A;  3CC2 Q;  4Z89 A;  2K79 A;  2VAS A;  1M30 A;  2NUZ A;  3U23 A;  3CBO A;  3V8L A;  2OTJ T;  2DE0 X;  2DEU A;  1PHT A;  1RAD B;  2AKL A;  3PMI A;  1BYM A;  5GAM f;  3UWN A;  3OB9 A;  1UEC A;  4ME7 A;  1YNZ A;  5L8R E;  1Q86 U;  2RI5 A;  1I07 A;  2CRE A;  4RTZ A;  2K3Y A;  2CP5 A;  3S3N A;  3CD6 Q;  4OGC A;  1GCQ A;  3L2Q A;  2MWP A;  2VWF A;  3FB9 A;  3MJX A;  4BDY A;  1W2B P;  1GFC A;  2KQW A;  2JM9 A;  4OMP A;  1VQM Q;  4JJN K;  2K57 A;  1WXB A;  2O01 E;  2FO0 A;  2L89 A;  1Y57 A;  3ER0 A;  2LZ6 B;  5FLX E;  4E7S A;  3CPF A;  2XG8 D;  3PVL A;  3H0H A;  3OW2 A;  2B86 A;  2FEI A;  5CK9 A;  1Q81 R;  6AT1 B;  1I8F A;  3OYG A;  1X2K A;  3CCS Q;  3S3O A;  3M57 A;  2EQU A;  3LGF A;  4R55 A;  2DL7 A;  4M78 F;  3L2V A;  1IGU A;  2KK4 A;  2E65 A;  4J7F A;  1HK9 A;  4O5V A;  4X34 A;  1RI0 A;  1TUC A;  2MI6 A;  3RDV A;  1T0H A;  1OV3 A;  5KE3 A;  4M75 B;  4NS5 A;  3EGU A;  4JDS A;  4XU2 A;  1RAB B;  3I5S A;  1H64 1;  3P8B B;  3EGD B;  5GAM d;  2X9H A;  4F7U A;  2A28 A;  4M7A F;  1P92 A;  4FT2 A;  2J6K A;  1YJW T;  2LDM A;  2J06 A;  3J7A F;  4CC7 A;  4AFU C;  2A08 A;  2ATC B;  4F14 A;  3J81 E;  2QQS A;  2M0Y A;  4C92 B;  2KY9 A;  3NTK A;  1S72 T;  3CEY A;  3VV0 A;  2PQW A;  4EDU A;  1UGR B;  4ZTJ A;  5M9O A;  2LQN A;  4BY6 B;  2VGN A;  1SSH A;  4M7D F;  3FC3 A;  3UF4 A;  2KYB A;  1KC8 R;  5EG2 A;  4J9E A;  2YUP A;  5GAO l;  3GF5 A;  5IXF A;  2FG0 A;  4WF2 A;  5LJ3 h;  2EAY A;  1BCM A;  1OOT A;  4BAC A;  2J7I A;  4E47 A;  1YCY A;  2KT1 A;  3NTH A;  4E7L A;  2KBT A;  1K73 R;  3SWN B;  2KE9 A;  4A53 A;  5IT9 E;  2JS2 A;  1RAE B;  2QDL A;  2RJF A;  2QQR A;  3ME9 A;  4OB1 B;  3CME Q;  2LT1 A;  2ROL A;  2P0Q A;  2D0Q B;  1BCO A;  3EFO A;  3NHN A;  4O6J A;  3SEM A;  1QVF P;  1YJW Q;  1NYG A;  2YLC A;  3LH5 A;  4QQ6 A;  1SHG A;  5KCO A;  3LW5 E;  2MWO A;  2F2X A;  1NLP C;  1WI7 A;  2E6Z A;  1KFZ A;  4IUU A;  4M75 C;  1JU5 C;  1BKB A;  1UHC A;  4ATO A;  3SD4 A;  3VU3 C;  3CCJ Q;  2Y4Y A;  5D6X A;  3TCJ A;  4N0A C;  1ZBJ A;  5GAM j;  1M2V A;  3A8O B;  4IUQ A;  1U3O A;  1BBZ A;  4F7U G;  1Q7Y R;  3ZBD A;  2Y4X A;  1OPL A;  1V29 B;  5L23 A;  3V8K A;  1MMN A;  4E7I A;  1WHM A;  2V1Q A;  3EG0 A;  3BE3 A;  2K9G A;  4C92 C;  3THK A;  1RI9 A;  2P84 A;  2VXF A;  4AG1 C;  4MZM A;  3OYF A;  3VYG A;  4PFZ A;  1BB9 A;  2A37 A;  3BDU A;  2LP5 A;  2JTM A;  4CC3 A;  4BY6 C;  2RHY A;  2LX7 A;  1YIT Q;  2MOX A;  3OMC A;  1NJI R;  4J9C A;  3PIO A;  2DVJ A;  1UGQ B;  4DOV A;  2EYX A;  1AWO A;  2FYK A;  3H9N A;  3PIP A;  4EMK B;  3UAT A;  1Q82 R;  1ZUY A;  5LJ5 h;  1E6H A;  2FZG B;  3CBM A;  3ZL7 C;  2QAZ A;  4KUD K;  1VIE A;  3SWN C;  4QVD A;  3CC7 A;  2RN8 A;  1ABO A;  4OGE A;  4D8K A;  3EGX B;  2YT6 A;  3GNG A;  2HSE B;  1CSK A;  3VS5 A;  1Q81 C;  2BZX A;  2RK1 A;  2DIQ A;  2LJ1 A;  2LNV A;  2QTX A;  4M78 A;  2CDT A;  3I56 Q;  1SHF A;  2E10 A;  4F7U E;  1W1F A;  1OYX A;  3JCM c;  4BI4 A;  1YJ9 Q;  3MP6 A;  5GMK i;  3FIF A;  3JCM g;  4KUL A;  2ENM A;  3M59 A;  4TVR A;  2GQV A;  3CCU Q;  1KD1 R;  4J8O A;  2RHU A;  1RLQ C;  1QWE A;  4J5Y A;  2DA9 A;  1KHC A;  2C06 A;  4M7A A;  2OTL Q;  1AT1 B;  2RJD A;  3A1P A;  1W2B A;  2G3R A;  3CC4 Q;  1QKW A;  2F2V A;  4MMK A;  1YWO A;  4LE9 A;  2A7Y A;  3LWI A;  3CXC S;  2QQ9 A;  1PWT A;  5GAN 4;  1T3L A;  2DL4 A;  2K2M A;  2DF6 A;  3I55 Q;  3L2U A;  4PJL A;  2NYS A;  2LCS A;  2QEX A;  4M7D A;  3RUX A;  1UJY A;  4Y92 A;  1CKA A;  1JB0 E;  3M5A A;  3RKW A;  1N5Z A;  4GBQ A;  2YUO A;  1RAC B;  2WSC E;  1K9M U;  4XTU A;  4MZP A;  1NE8 A;  4J6W A;  4EMK C;  1VQN Q;  5IH2 A;  4LXC A;  8AT1 B;  5KCH A;  2JJ9 A;  2HBW A;  3L1A A;  2G6F X;  1SRL A;  2KSS A;  4IKF A;  1UGV A;  2CP0 A;  4DQ2 A;  3M58 A;  4DBF A;  2NUP A;  2RNA A;  1WIE A;  1JXO A;  5GAN e;  2EBP A;  2EW3 A;  4LN2 A;  2DK3 A;  2DIL A;  2HL3 A;  4CC4 B;  3KXT A;  3CC7 T;  4M78 G;  5FU7 B;  3CC2 A;  3HP9 A;  5HKC A;  2B8A A;  2ZCF B;  4PJM A;  1D0Z A;  1HSQ A;  4QKU A;  3MEV A;  2COZ A;  2DD5 A;  1RAI B;  2K5L A;  2XDB A;  3JV3 A;  2FPF A;  5FRO A;  4BE2 A;  2J05 A;  4II1 A;  2L5Q A;  2RHI A;  4C8Q B;  1WHH A;  3GOX A;  3CBP A;  1EZZ B;  1SRM A;  4EMG A;  3MHX A;  3QPH A;  4M7A G;  3OW2 S;  5HK3 A;  2PVG B;  3VRZ A;  2QG9 B;  2YDL A;  4WCI A;  2CZ6 B;  5KYY B;  4ZGE B;  2C0T A;  2O4X A;  4Y28 E;  2R5M A;  5GAN 2;  2XMF A;  2AK5 A;  3EG9 B;  3QDR B;  4HVW A;  1Z9Z A;  2H3E B;  3CD6 A;  4M77 E;  4JRQ A;  1B07 A;  2GGR A;  2GQI A;  1KSW A;  3WXM B;  3TSW A;  4M7D G;  4LUD A;  2RH2 A;  1VQM A;  4J83 A;  3JCM f;  3QZ5 B;  1QVF A;  1N8R U;  1B34 B;  2HBP A;  3EFS A;  1ZHI A;  4C5G A;  2EQK A;  1NJI C;  1M3A A;  1IHV A;  3CC7 Q;  2QEX T;  1BU1 A;  1RAF B;  1ZLM A;  3CCS A;  2CH4 A;  2QGG A;  1WHJ A;  3KFV A;  1V1C A;  3MPU B;  3G4S Q;  5KE2 A;  1G83 A;  2DKG A;  4IUP A;  5GAN 8;  4J9F A;  4ELY C;  2AZS A;  1SG5 A;  3M0T A;  1IXD A;  2JTE A;  5IHN A;  3SFM A;  2NWM A;  2EFI A;  4PFO A;  2O31 A;  3SB2 A;  3P8H A;  3M0U A;  1YP5 A;  5KYN A;  3OBY A;  1CKB A;  2K6D A;  1QCN A;  1UUE A;  2HEQ A;  2NUT B;  3C4S A;  4C8Q C;  1KIK A;  3LH0 A;  3CC2 T;  2VYT A;  4JJD A;  1M90 U;  2DPP B;  4PJO E;  2JTF A;  5I22 A;  3AT1 B;  3E2U A;  2FZC B;  2X3X D;  2RQT A;  3GP8 A;  4QVZ A;  2K3B A;  2CUD A;  3IQL A;  5AT1 B;  2OAU A;  3JCM d;  2DRK A;  1H3Z A;  3V8J A;  1VUB A;  2E5Q A;  4MZT A;  1NZ9 A;  2C0I A;  2MPX C;  1I5O B;  2D1X A;  5D6Y A;  4BB7 A;  1I4K 1;  1UFF A;  4FYW B;  2DET A;  4HCC A;  2HAX A;  3CD6 T;  4M7A D;  5GAN 3;  4HCB A;  2KEA A;  4JZ3 A;  2GFU A;  3QUI A;  1B3Q A;  3NTI A;  3R6O A;  4FW1 A;  4R56 A;  5KYU A;  3CME A;  1JJ2 P;  1VQM T;  1OZ3 A;  1KJW A;  4M75 A;  3OMG A;  2L3R A;  2BTT A;  4FM4 B;  1G3T A;  2K5I A;  4N0A A;  4PJO D;  4ANJ A;  4JPB W;  2RJE A;  1VQP Q;  2JM8 A;  3SHW A;  1X6G A;  3CCS T;  4XQ3 A;  1VQK Q;  4X9D A;  1M9S A;  2X35 A;  4RTX A;  3C95 A;  1Q95 G;  1D3B A;  1MND A;  1IGQ A;  3ZEH A;  3CCJ A;  4C92 A;  2VGM A;  1WHL A;  2EJG A;  1YJN A;  2PTK A;  3G71 Q;  1QVG P;  3QKJ A;  2ED1 A;  1PSE A;  1UG1 A;  3A8H B;  1R77 A;  1N8R C;  2R58 A;  1UGP B;  4PLL A;  2EJF A;  1YHQ Q;  1KQ1 A;  2V1R A;  1DJ7 B;  2KR3 A;  2DMO A;  3RMQ A;  2V8K A;  2O2O A;  2X4W A;  1G3Y A;  1AHJ B;  3OYL A;  4BE1 A;  1YCS B;  2D8J A;  1K1Z A;  1YIT A;  2IIM A;  2JMC A;  5KYW A;  2E4H A;  3DLM A;  5GAO r;  2JZ2 A;  1D1B A;  2LJ3 A;  3SWN A;  2F2W A;  2CP3 A;  2X4J A;  1WHG A;  2EJ9 A;  2KI7 A;  5GAM e;  3FRN A;  2KRN A;  3VUZ A;  5GAN h;  4BE0 A;  2YUQ A;  5KYX B;  1HD3 A;  3VS6 A;  3X20 B;  3QSU A;  1Y96 B;  1KQS P;  4CI0 C;  5IAY A;  3JCM P;  1GFD A;  3L2W A;  2YLB A;  2GTJ A;  2RO0 A;  2PUO B;  2L3S A;  2KXC A;  1VQ5 Q;  3CPW P;  3RNJ A;  1W2B S;  4M75 G;  5HK0 A;  4EPC A;  3I9Q A;  2LJ0 A;  1M90 C;  2XU8 A;  1I1J A;  1PC0 A;  2K3X A;  2PZ1 A;  1WNL A;  5CIU A;  3I56 A;  3M55 A;  2LMJ A;  3CME T;  2K2V A;  2JUF A;  2P4T A;  3JCM b;  3JB9 F;  3FJ5 A;  3E9F A;  1YJ9 A;  2L0A A;  2JNG A;  5A0L A;  3RR6 A;  1ZSZ B;  1MGQ A;  1SSF A;  2P0P A;  4KT0 E;  3OSS C;  2WSE E;  3CCU A;  1U1T A;  2ESW A;  3PMT A;  2DRM A;  2DZC A;  3BY7 A;  2A36 A;  4C92 G;  1XTD A;  2BKD N;  2XI9 A;  2OTL A;  1LCK A;  2L2P A;  1WJQ A;  1BIB A;  4OMF B;  1TWB A;  3CC4 A;  1NG2 A;  1BI3 A;  1D0X A;  3CCJ T;  2DL8 A;  3QG1 A;  2RQU A;  1M8M A;  5D7U A;  1UE9 A;  1X2Q A;  2DXT A;  1YJN T;  2LQK A;  3GIB A;  1AZG B;  2DTI A;  2L3P A;  2XDD A;  3I55 A;  1FMW A;  2RHX A;  4EMK A;  2K4Y A;  3QXE B;  1AEY A;  3OYA A;  2DIG A;  2A3L A;  3JCM X;  2SRC A;  5J3B A;  5LJ5 j;  2K5F A;  3NGP A;  1VQO Q;  2AT1 B;  2DXU A;  2JT4 A;  2D0N A;  2X3W D;  2JN0 A;  4FSS A;  1IHW A;  2YUN A;  1UB4 A;  3M54 A;  3EGX A;  1YIT T;  1VQN A;  1G8X A;  1M1K U;  4QW2 A;  2GTO A;  1U8R A;  5A0G A;  5CKF A;  5HY6 A;  1QQJ A;  2AHJ B;  4OMQ A;  2KRS A;  4N4I A;  2E3H A;  4JUV A;  3OBW A;  1OUL A;  2DBK A;  1Q86 C;  1Y71 A;  5FRM A;  5IHK A;  1QCF A;  3QHS A;  2DLP A;  3TU4 K;  3L42 A;  4AMC A;  4LDU A;  1C1A A;  3EFR A;  1PRL C;  4LUE A;  1ZA2 B;  2X4X A;  4LD9 K;  4PK4 A;  1GBQ A;  1EFN A;  4OB3 B;  2IPO B;  2RQR A;  3L2R A;  1OQK A;  1YJN Q;  2VUB A;  2HNI A;  2D9T A;  1JEG A;  1H3H A;  1ZSG A;  2EGE A;  4BD3 A;  4BDZ A;  3VRY A;  1PG5 B;  1WPY A;  2HQH A;  3I56 T;  1IO6 A;  1QVF S;  2BE9 B;  4ZNX A;  3JSC A;  1WJR A;  2H3J A;  1YJ9 T;  1NBE B;  5CR2 A;  4NL2 A;  2DJQ A;  1PD0 A;  2BZY A;  1M4Z A;  4F7U B;  3CCU T;  4MML A;  3QBY A;  3CCE Q;  4RCC A;  4PLI A;  1SPK A;  2OTL T;  3E1S A;  4E7K A;  3HRS A;  5I11 A;  3LWH A;  3CC4 T;  3A8G B;  3ULR B;  1JJ2 A;  1WDX A;  1WJS A;  1TU0 B;  5CQY A;  1SKU B;  2HL5 C;  1JO8 A;  1YFN A;  1BI0 A;  3A5Z B;  1VQ4 A;  3I55 T;  1NLO C;  3OYI A;  4FU6 A;  3MP1 A;  1MHN A;  4J7I A;  1QCO A;  1UTI A;  3O8V A;  4KRT A;  1QW1 A;  2DL3 A;  1K8A U;  1IRE B;  1XNI A;  4HVV A;  4E7J A;  3MP8 A;  5KH6 A;  5GAN 7;  4OB0 B;  2LQ8 A;  3G4S A;  3M53 A;  4GLK A;  3CCL A;  1TUD A;  2DBM A;  1YI2 Q;  4DBQ A;  1D0Y A;  1QVG A;  1VQN T;  3MET A;  1N27 A;  4JS5 A;  2D8H A;  2E1H A;  5LJ3 g;  4QVC A;  4CRI A;  4PFP A;  3X28 B;  4LDW A;  4PKC C;  3GLX A;  3HL8 A;  1MMG A;  5C6S A;  2EKO A;  4QQD A;  2V8I A;  3CCR Q;  3JB9 J;  3EFO B;  4C5E A;  2RA2 A;  3GNF B;  2RD1 A;  4P5N A;  4B9W A;  3OYY A;  1R0C B;  1AVZ C;  2CUB A;  5KYY A;  3FLG A;  4M4Z A;  5I21 A;  3OS0 A;  2XK0 A;  1KG1 A;  2HDA A;  2DXB A;  5CAI A;  1ZUK A;  3OYC A;  1UJ0 A;  1X43 A;  4F04 B;  2DD4 A;  4EIK A;  2W10 A;  1M1K C;  1VQ7 A;  1NEG A;  1VQL A;  1Q82 U;  5GAM h;  2LT4 A;  2GF7 A;  1VA7 A;  4A4G A;  2DXC A;  4C0Z A;  3JCM J;  3BFM A;  2O88 A;  1GBR A;  2M1H A;  1KQS A;  1FWZ A;  2YRV A;  1K0X A;  5A0D A;  3VS2 A;  3S6W A;  2KT8 A;  4HT8 A;  3INZ A;  4E7H A;  4A4E A;  3CPW A;  1KK7 A;  4XTV A;  2EKH A;  1N9S A;  5GAN f;  4M75 F;  2EWN A;  1YIJ Q;  1EIF A;  1F1B B;  1G2B A;  4RUG A;  3MCA B;  2W0Z A;  1E7O A;  2QDY B;  4B6M A;  3RKY A;  2QA4 Q;  1J3T A;  3KBG A;  4M77 B;  5GMK j;  4LDX A;  2ZGW A;  4LD6 A;  1VQ4 T;  1AOJ A;  4ORZ A;  4E2F B;  1R0B G;  4C92 F;  1B7T A;  4OMM A;  1G3W A;  1VQP A;  1ZA1 B;  4LDY A;  3TSZ A;  1N8R R;  1VQK A;  3OQ5 A;  2CYZ B;  2XHC A;  3UA6 A;  3QYG B;  2COW A;  1IRX A;  5LJ5 g;  2YHT A;  2DYB A;  1VQ6 Q;  1FMK A;  3G4S T;  2NUT A;  3BW1 A;  3CCL T;  2HKN A;  4RTW A;  2FRY A;  1Y0M A;  1H92 A;  5FU6 B;  1LNX A;  2ZPI B;  3G71 A;  3OYB A;  1TUG B;  4D8D A;  2KVQ G;  3PGG A;  3JB9 G;  1W70 A;  1WXU A;  4Q5W A;  1UHF A;  2XKO C;  2E6N A;  4J6X A;  2MYS A;  3LGL A;  4B9X A;  5GJW B;  1YHQ A;  1D1C A;  1PM3 A;  1XOV A;  3V7S A;  1M3B A;  3VUB A;  2MK5 A;  4OP0 A;  1TSF A;  4J9I A;  2FPD A;  3V7C A;  3A8L B;  1SEM A;  5LJ3 f;  5GAN d;  3PVQ A;  1T0J A;  2RI3 A;  3JCM V;  3X26 B;  1RAA B;  4YTL A;  1VQ7 T;  1A0N B;  1VQ4 Q;  1VQL T;  5GAO q;  4A54 A;  2RHZ A;  1K0S A;  3UA7 A;  1M90 R;  3UPU A;  4FW2 A;  4PJO B;  1MV0 B;  4HVU A;  1Y7X A;  2EGA A;  3C94 A;  3VKI A;  3P8D A;  4ZTF A;  3OS5 A;  3CCL Q;  3OS2 A;  4M78 E;  3OYM A;  2JS0 A;  3RES A;  2KRM A;  4XK8 E;  3WVD B;  1VQ5 A;  4MDX A;  1VYV A;  4HCK A;  1M1G A;  3JB9 H;  4M77 C;  2K7A A;  3HRU A;  2DAQ A;  2ZPB B;  1PCX A;  5HCK A;  3OYH A;  2JVV A;  3CCV A;  5CKE A;  3UT1 A;  4RCB A;  2M51 A;  3JCM e;  2DTH A;  1K9A A;  5FU7 C;  1W6X A;  4M7A E;  3LYI A;  1OX8 A;  2RQW A;  3EHQ A;  4OVA A;  5J26 A;  4XTW A;  1RUW A;  4CC2 A;  1AZE A;  1IB8 A;  2NUP B;  3OYN A;  2PUK B;  4GY5 A;  1VQP T;  4C0F A;  1K9M C;  4XU0 A;  2OAW A;  1VQK T;  2KGT A;  2VB6 A;  2YSQ A;  4RMO A;  3MEA A;  1VQ7 Q;  1X27 A;  2QQA A;  1VQL Q;  1TXQ A;  4KGZ B;  4AFZ C;  3I35 A;  3QYH B;  5LJ3 d;  3CCM Q;  4M7D E;  4EMH A;  1T3S A;  2YWW A;  4HCZ A;  3H8Z A;  4M78 D;  4FT4 A;  2ROT A;  1VQ9 A;  2DM1 A;  2QI2 A;  3G71 T;  3FDR A;  4GLM A;  4FYY B;  1PD1 A;  3EH2 A;  1RL2 A;  3JCM Q;  1NPP A;  5CVI A;  4FCY A;  4OMN A;  5KYX A;  2HKQ B;  2L8D A;  1VQO A;  1ZX6 A;  3ZFJ A;  5GAN j;  5LJ5 f;  1YHQ T;  4V2S A;  2E3I A;  1Y96 A;  3TVT A;  1G5V A;  2GNC A;  1WYX A;  4OB2 B;  3JB9 D;  1Q86 R;  2O4X B;  3TEE A;  2ZAE A;  3H0I A;  4C0G A;  3MO8 A;  4AG2 C;  2QQB A;  1LOJ A;  4L59 A;  2WSF E;  1U5S A;  4PJO C;  3DLL A;  2ZPG B;  3TRE A;  1QMC A;  1MNE A;  3EGD A;  1WGS A;  4JRP A;  5DLQ E;  4QT7 A;  1O9S A;  3DKM A;  4M7D D;  3ASK A;  1GCP A;  1QP3 A;  2CP7 A;  4OF1 A;  3X25 B;  4ZGJ B;  1WHK A;  2EGC A;  4KH0 B;  2MIO A;  1H8K A;  5I2S A;  3NFC A;  3NMZ C;  1VQ5 T;  2E70 A;  5FRN A;  1NPR A;  3J80 E;  2DVE A;  1JJ2 S;  2QXF A;  1M27 C;  2OJ2 A;  3JRZ A;  2XDP A;  3CCV T;  1LPL A;  5EC7 A;  1YN8 A;  2VVK A;  2YRC A;  2KMT A;  2P0K A;  2KYM A;  1R8O B;  2JOY A;  2ZPF B;  1E6G A;  1QP2 A;  4J9B A;  5LJ3 j;  1QVP A;  3VS7 A;  5LJ5 d;  3CCE A;  2NLU A;  3QO3 A;  1M5Q 1;  3CQT A;  5FWC A;  1WQ7 A;  4XTZ A;  3G6E Q;  1ABQ A;  2JW4 A;  3RMS A;  1QVG S;  4A4H A;  2DYI A;  4M77 F;  5IN1 A;  1OI1 A;  3RER A;  1VQ9 T;  1HXD A;  1VIF A;  2OX7 A;  3VS4 A;  3JAM E;  2DEQ A;  4JLI A;  2LCL A;  4J9D A;  2PVO B;  4XU1 A;  2CH4 W;  3S3M A;  3CMA Q;  2BIV A;  4KH1 B;  2LCC A;  1PSF A;  1VQO T;  3HSB A;  1RAH B;  2PVD B;  2LQW A;  2RI2 A;  3HFN A;  2HMA A;  4Z88 A;  3EAE A;  4C8Q F;  5GJV B;  3PE0 A;  1YI2 A;  2R57 A;  3M4G A;  3CCV Q;  2X51 A;  1K4U S;  4FSX A;  4HXJ A; 
#chains in the Genus database with same CATH homology
 2CZ1 B;  3HRS A;  5GAN 6;  3LWH A;  3CC4 T;  2DK3 A;  3A8G B;  3F70 A;  3M56 A;  3KXT A;  3CC7 T;  1JJ2 A;  4DA4 A;  3HKS A;  4M78 G;  1WJS A;  2CGH A;  4LDV A;  5CQY A;  5FU7 B;  3CC2 A;  3HP9 A;  1M1F A;  5HKC A;  3CCR A;  2B8A A;  2ZCF B;  4ZN3 A;  3HHT B;  4PL6 A;  1BI0 A;  5CKH A;  3A5Z B;  3MEV A;  1KQS S;  2DD5 A;  4Y91 A;  4HT9 A;  1VQ4 A;  3H6Z A;  2K5L A;  3QJY A;  4BI3 A;  3OYI A;  3I55 T;  2XDB A;  2LC4 A;  4FU6 A;  1IZ6 A;  1MHN A;  3MP1 A;  4J7I A;  4A4F A;  5FRO A;  4NL3 A;  3OYE A;  4II1 A;  5CCA A;  3G6E T;  2L5Q A;  3O8V A;  2RHI A;  1W4S A;  4C8Q B;  3GOX A;  2KAF A;  3CBP A;  1QW1 A;  3CXC A;  1K8A U;  1IRE B;  1XNI A;  2E64 A;  3MEW A;  2E41 A;  3MP8 A;  4EMG A;  3PTA A;  4E7J A;  2D6F A;  2VC8 A;  5GAO n;  1D3B B;  5KH6 A;  5GAN 7;  3MHX A;  3QPH A;  4OB0 B;  4M7A G;  2LQ8 A;  4IUR A;  3SDZ A;  3OW2 S;  5HK3 A;  2OTL T;  2PVG B;  4ZN1 A;  3G4S A;  3M53 A;  4GLK A;  3CCL A;  2CZ6 B;  4X9C A;  1Q81 U;  3GPL A;  4ZGE B;  4Y28 E;  2O4X A;  3URG A;  1QVG A;  2R5M A;  4PJO F;  3MET A;  5GMK l;  5GAN 2;  1VQN T;  1N27 A;  3QDR B;  3T9N A;  2FVU A;  5LJ5 e;  5I2M A;  4JS5 A;  3CMA T;  5DLO A;  1N6A A;  1YJW A;  2LTO A;  1UEB A;  2E1H A;  4QQG A;  5LJ3 g;  4M77 E;  3CD6 A;  2DO3 A;  4XAX B;  2M0O A;  4JRQ A;  4N4H A;  3QII A;  4QVC A;  4CRI A;  3PNW C;  2F69 A;  2F5K A;  3X28 B;  4LDW A;  1N9R A;  4PKC C;  2IG0 A;  3GLX A;  1UGS B;  3HL8 A;  5C6S A;  1S72 A;  2EKO A;  4QQD A;  3WXM B;  4Z02 A;  2V8I A;  3JB9 J;  4M7D G;  3QZ9 B;  2RH2 A;  2V8J A;  1VQM A;  3X24 B;  4J83 A;  1X75 C;  4C5E A;  2HQX A;  3QZ5 B;  3JCM f;  2RA2 A;  1QVF A;  3CCE T;  1N8R U;  3GNF B;  2RD1 A;  1B34 B;  4P5N A;  4A4K A;  4B9W A;  4M75 E;  3OYY A;  2HBP A;  1YIJ A;  3EFS A;  1ZHI A;  4C5G A;  2EQK A;  1NJI C;  3CBO A;  3FLG A;  3V8L A;  4ELZ C;  2LVM A;  3JCM h;  2OTJ T;  5I21 A;  3OS0 A;  2XK0 A;  2QEX T;  1KG1 A;  2DXB A;  5CAI A;  3OYC A;  2F5T X;  3OSV A;  3PMI A;  1BYM A;  5GAM f;  3CCS A;  3UWN A;  2QA4 A;  2DD4 A;  3OB9 A;  5D6W A;  4ME7 A;  4D6W A;  2IVW A;  1M1K C;  1VQ7 A;  2M16 A;  5L8R E;  1Q86 U;  1Q82 U;  1VQL A;  2RI5 A;  1XQH A;  2DJZ A;  5KE2 A;  5GAM h;  2LT4 A;  5GMK m;  2DKG A;  4IUP A;  4IUT A;  2GF7 A;  4KUI A;  5GAN 8;  5C0M A;  2K3Y A;  4JLG A;  2DXC A;  4A4G A;  4C0Z A;  4C92 E;  4ELY C;  2MMP A;  3S3N A;  3JCM J;  4PNO A;  3BFM A;  2M1H A;  2CS7 A;  4OGC A;  1KQS A;  3SFM A;  1FWZ A;  2YRV A;  2EFI A;  4FL6 A;  5A0D A;  3L2Q A;  2MWP A;  3FB9 A;  3S6W A;  4BDY A;  4UC4 A;  3INZ A;  4E7H A;  4HT8 A;  2FHD A;  5GAN g;  3LX7 A;  1VQ6 A;  3SB2 A;  3P8H A;  4A4E A;  3CPW A;  2KQW A;  1KC8 U;  4XTV A;  1YI2 T;  4JJN K;  2K57 A;  2ZZD A;  2O01 E;  3OBY A;  1N9S A;  2L89 A;  4M75 F;  5GAN f;  2EWN A;  3ER0 A;  5FLX E;  3CPF A;  2XG8 D;  1EIF A;  3OW2 A;  3MCA B;  5CK9 A;  3V7R A;  4M75 D;  2EYQ A;  5LL6 S;  2QDY B;  1I8F A;  3C4S A;  3OYG A;  3S3O A;  1TH7 A;  4C8Q C;  3RKY A;  3M57 A;  3LH0 A;  3CC2 T;  2EQU A;  1O75 A;  3LGF A;  4R55 A;  3CCR T;  2VYT A;  4XU3 A;  3KUF A;  1M90 U;  5GMK e;  3KBG A;  4M77 B;  2DPP B;  5GMK j;  4PJO E;  1ZBX A;  2JTF A;  1K73 U;  4LDX A;  2ZGW A;  4LD6 A;  4M78 F;  1VQ4 T;  3VJP A;  3DB4 A;  5DY9 A;  5AYF A;  2LRQ A;  3L2V A;  3GP8 A;  4QVZ A;  2KK4 A;  4C0D B;  2E65 A;  1HK9 A;  4J7F A;  4O5V A;  4C92 F;  4X34 A;  2OAU A;  1RI0 A;  3JCM d;  2MI6 A;  1G3W A;  1VQP A;  2ZPH B;  3C12 A;  4LDY A;  3V8J A;  1H3Z A;  1VUB A;  1VQK A;  3OQ5 A;  4C92 D;  2CYZ B;  2XHC A;  2E5Q A;  3QYG B;  5KE3 A;  4M75 B;  2EQM A;  4NS5 A;  2XD0 A;  4JDS A;  4XU2 A;  2FB7 A;  2HD0 A;  2MF2 A;  5LJ5 g;  2YHT A;  4MZT A;  1NZ9 A;  1H64 1;  3P8B B;  3G4S T;  2E12 A;  3CCL T;  3BW1 A;  5D6Y A;  4BB7 A;  5GAM d;  1I4K 1;  4F7U A;  4M7A F;  1P92 A;  3MEU A;  5CKB A;  5FU6 B;  1LNX A;  4HCC A;  4M77 A;  2ZPI B;  3G71 A;  4FT2 A;  3OYB A;  2HAX A;  1YJW T;  3CD6 T;  4M7A D;  2LDM A;  5GAN 3;  2KVQ G;  3PGG A;  4RKU E;  3JB9 G;  4HCB A;  3OYJ A;  3J7A F;  2GFU A;  4Q5W A;  3QUI A;  3N5B B;  2X4Y A;  2QQS A;  2XKO C;  2E6N A;  3J81 E;  3NTI A;  3R6O A;  4J6X A;  4C92 B;  1KQ2 A;  2KY9 A;  3NTK A;  3LGL A;  4R56 A;  1BI2 A;  3CEY A;  3VV0 A;  4B9X A;  3CME A;  1S72 T;  2PQW A;  4EDU A;  1VQM T;  1UGR B;  1YHQ A;  1OZ3 A;  1Q7Y U;  4M75 A;  3OMG A;  5CKD A;  5CO7 A;  2L3R A;  1XOV A;  2BUD A;  4ZTJ A;  3V7S A;  2I2L A;  5M9O A;  3VUB A;  4FM4 B;  1JBM A;  1G3T A;  4OP0 A;  4BY6 B;  2VGN A;  1YIJ T;  4M7D F;  1ZQ1 A;  2K5I A;  4N0A A;  4PJO D;  1OZ2 A;  2RJE A;  4HA8 A;  3FC3 A;  2RM4 A;  3A8L B;  3V7C A;  4C8Q A;  5EG2 A;  2CKK A;  4HKE A;  1BIA A;  5LJ3 f;  3RKX A;  5GAN d;  2ZPE B;  5GAO l;  4XQ3 A;  3GF5 A;  3CCS T;  2RI3 A;  2QA4 T;  4X9D A;  1M9S A;  2X35 A;  3JCM V;  3X26 B;  2FL7 A;  3C95 A;  2R5A A;  3G7Z A;  4YTL A;  1D3B A;  1VQ7 T;  4WF2 A;  1VQL T;  3ZEH A;  5LJ3 h;  5GAO q;  2EAY A;  3CCJ A;  5A2Q E;  4A54 A;  4C92 A;  2VGM A;  4BAC A;  4E47 A;  1YCY A;  2RHZ A;  3PFS A;  2VXE A;  3NTH A;  1NJI U;  2EJG A;  3M9Q A;  1YJN A;  4E7L A;  4RG8 A;  4ZGD B;  3CPW S;  3QKJ A;  3UPU A;  4PJO B;  1PSE A;  3UDC A;  3A8H B;  1X01 A;  1Y7X A;  3SWN B;  3C94 A;  4A53 A;  1N8R C;  3L2Z A;  2R58 A;  3VKI A;  5IT9 E;  3P8D A;  1UGP B;  4FIB A;  4ZTF A;  2RJF A;  3OS5 A;  3E9G A;  2QQR A;  3ME9 A;  4M78 E;  4OB1 B;  3OS2 A;  3OYM A;  1VQ6 T;  4PLL A;  3CCM A;  2LT1 A;  4XK8 E;  3RES A;  3WVD B;  1VQ5 A;  4MDX A;  2EJF A;  2P0Q A;  2D0Q B;  1KQ1 A;  1M1G A;  1DJ7 B;  3JB9 H;  4O6J A;  2V8K A;  2RJC A;  3RMQ A;  2X4W A;  4C5H A;  1B34 A;  1G3Y A;  1AHJ B;  3DB3 A;  4M77 C;  4N4G A;  3OYD A;  3OYL A;  4BE1 A;  3HRU A;  2DAQ A;  2YLC A;  2ZPB B;  5GAO m;  4QQ6 A;  3OYH A;  1YIT A;  2WAC A;  2JVV A;  3CCV A;  4C0D C;  5CKE A;  4NOY A;  3UT1 A;  5KCO A;  4RCB A;  3DLM A;  3LW5 E;  3JCM e;  2MWO A;  5GAO r;  2JZ2 A;  2DZ9 A;  4PJO A;  2DTH A;  5FU7 C;  4XTX A;  2E6Z A;  3SWN A;  4M7A E;  3LYI A;  4IUU A;  4M75 C;  3FJP A;  1BKB A;  4ATO A;  3SD4 A;  5GAN 5;  4JRK A;  3VU3 C;  2Y4Y A;  2MAM A;  4BUG A;  4OVA A;  2X4J A;  3OS1 A;  2EJ9 A;  5J26 A;  5D6X A;  4XTW A;  3TCJ A;  4N0A C;  5GAM e;  3FRN A;  5GAM j;  1I5L A;  3VUZ A;  5GAN h;  4BE0 A;  1VQP T;  3OYN A;  2PUK B;  3A8O B;  4GY5 A;  4IUQ A;  4C0F A;  4F7U G;  3CCQ A;  1K9M C;  4XU0 A;  3HFO A;  2Y4X A;  3ZBD A;  1KC8 C;  1VQK T;  3X20 B;  4M77 G;  4RMO A;  3QSU A;  1V29 B;  1Y96 B;  3MEA A;  4CI0 C;  5IAY A;  3V8K A;  2QQA A;  4E7I A;  3JCM P;  1KD1 U;  3L2W A;  2YLB A;  3QYH B;  4JRI A;  2M9U A;  2RO0 A;  2PUO B;  5LJ3 d;  3BDL A;  4M7D E;  4EMH A;  4C92 C;  4HCZ A;  2VXF A;  3H8Z A;  4M78 D;  4FT4 A;  2RB6 A;  4MZM A;  1VQ9 A;  2QI2 A;  4VUB A;  3OYF A;  3G71 T;  3FDR A;  3Q1J A;  1W2B S;  4M75 G;  3VYG A;  5HK0 A;  4EPC A;  3BDU A;  1M90 C;  1RL2 A;  2JTM A;  2XU8 A;  1Y07 A;  1NPP A;  4BY6 C;  3JCM Q;  2RHY A;  1K73 C;  2K3X A;  2VV5 A;  1WNL A;  5CIU A;  5CVI A;  3I56 A;  3M55 A;  3OMC A;  2XIC A;  3CME T;  2K2V A;  4JS4 A;  2JUF A;  3LLR A;  4C8Q G;  2L8D A;  2P4T A;  1VQO A;  3ZFJ A;  3JCM b;  3PIO A;  5GAN j;  5LJ5 f;  1YHQ T;  1VQ8 A;  3JB9 F;  4V2S A;  1UGQ B;  3E9F A;  4DOV A;  1LJO A;  1Y96 A;  1YJ9 A;  2FYK A;  2JNG A;  4RG2 A;  5A0L A;  1G5V A;  3PIP A;  4OB2 B;  4EMK B;  1MGQ A;  1SSF A;  2P0P A;  4KT0 E;  3OSS C;  3JB9 D;  3AHU A;  2WSE E;  2O4X B;  3TEE A;  3CCU A;  1U1T A;  4M78 B;  5LJ5 h;  3PMT A;  4C0G A;  3MO8 A;  4M7D C;  3BY7 A;  2DZC A;  4C92 G;  2EIF A;  2QQB A;  5DM7 R;  1XTD A;  2BKD N;  3CBM A;  1LOJ A;  2XI9 A;  4L59 A;  4KUD K;  2OTL A;  1VIE A;  2WSF E;  1WJQ A;  1BIB A;  3DLL A;  4PJO C;  4OMF B;  1FX7 A;  2ZPG B;  3TRE A;  3CC4 A;  3SWN C;  4QVD A;  3WVE B;  1K8A C;  3CC7 A;  1BI3 A;  1I81 A;  1WQW A;  3CCJ T;  1WGS A;  4JRP A;  3QG1 A;  4OGE A;  3GNG A;  5DLQ E;  1O9S A;  3DKM A;  4L6V 5;  1X6O A;  2DXT A;  1YJN T;  2LQK A;  3GIB A;  4M7D D;  4M7A B;  1Q81 C;  2DTI A;  2RK1 A;  2XDD A;  2DIQ A;  5J39 A;  3I55 A;  2RHX A;  3HRT A;  3ASK A;  2K4Y A;  3QXE B;  4EMK A;  1Q7Y C;  3FEO A;  1QP3 A;  2LNV A;  2QTX A;  4OF1 A;  3G6E A;  3X25 B;  3OYA A;  2DIG A;  4M78 A;  2A3L A;  4ZGJ B;  3JCM X;  2E10 A;  5J3B A;  4F7U E;  1YBY A;  5LJ5 j;  3CCM T;  1OYX A;  2K5F A;  3NFC A;  5I2S A;  1VQ5 T;  2E70 A;  3JCM c;  2LX9 A;  4BI4 A;  5FRN A;  3RIR A;  1NPR A;  2DXU A;  3MP6 A;  5GMK i;  2DVE A;  4PJO G;  1KHI A;  3FIF A;  3JCM g;  3J80 E;  4KUL A;  1FXX A;  2JN0 A;  3M59 A;  4IUV A;  4TVR A;  2GQV A;  1JJ2 S;  2QXF A;  4J8O A;  1UB4 A;  3M54 A;  2GFA A;  2RHU A;  2XDP A;  3JRZ A;  1YIT T;  1VQN A;  4M7D B;  3CCV T;  4J5Y A;  1M1K U;  3CMA A;  1U1S A;  4QW2 A;  2HQE A;  1KHC A;  4E7K A;  2C06 A;  1U8R A;  4M7A A;  5A0G A;  2EQJ A;  5GAM g;  5CKF A;  5HY6 A;  2AHJ B;  2KMT A;  2P0K A;  2RJD A;  2G3R A;  1W2B A;  1R8O B;  4N4I A;  4KBM B;  4JUV A;  2JOY A;  4MMK A;  1GXI E;  2ZPF B;  3VYH B;  2A7Y A;  1QP2 A;  3OBW A;  3LWI A;  4C8Q E;  3CXC S;  5LJ3 e;  5LJ3 j;  2QQ9 A;  1QVP A;  5LJ5 d;  1Q86 C;  5GAN 4;  1Y71 A;  2NLU A;  1BI1 A;  4DOW A;  3CCE A;  3QO3 A;  1Q82 C;  4C5I A;  1M5Q 1;  3CCQ T;  5FRM A;  3M4Y A;  3L2U A;  1WQ7 A;  2KDS A;  3QHS A;  3TU4 K;  3L42 A;  4XTZ A;  2OTJ A;  2CZ0 B;  5GAO p;  3RMS A;  2QEX A;  2Y90 A;  1JRI A;  4LDU A;  4F7U F;  3EFR A;  3OY9 A;  3PT9 A;  4M7D A;  2X4X A;  1QVG S;  4A4H A;  3RUX A;  5GMK h;  4LD9 K;  4M77 F;  5IN1 A;  1JB0 E;  3M5A A;  4OB3 B;  1OI1 A;  4L5G A;  3L2R A;  3RKW A;  3RER A;  1M8V A;  2VUB A;  1HXD A;  1VIF A;  2GCX A;  2HNI A;  4J6Y A;  3JAM E;  2D9T A;  3JB9 I;  1VQ9 T;  4M77 D;  2DEQ A;  4JLI A;  5FU6 C;  2WSC E;  2LCL A;  4BD3 A;  3OYK A;  4BDZ A;  1K9M U;  4XTU A;  2PVO B;  1NE8 A;  2RK2 A;  4J6W A;  4MZP A;  4EMK C;  4XU1 A;  4BE2 A;  2PU9 B;  3S3M A;  1WPY A;  4M78 C;  2BIV A;  3I56 T;  1QVF S;  2LCC A;  3JSC A;  1PSF A;  1VQO T;  3HSB A;  2PVD B;  1VQ8 T;  4MDW A;  3E19 A;  1WJR A;  2H3J A;  2RI2 A;  3HFN A;  1YJ9 T;  5CR2 A;  3QJ6 A;  4NL2 A;  4XTY A;  5KCH A;  5CQX A;  3L1A A;  3EAE A;  4C8Q F;  1M4Z A;  4F7U B;  3CCU T;  2KSS A;  1YI2 A;  2R57 A;  4MML A;  3M4G A;  3QBY A;  4BI8 B;  4IKF A;  4DQ2 A;  3OA6 A;  3A8M B;  3M58 A;  4RCC A;  1KD1 C;  3JCM W;  4PLI A;  4C8Q D;  2DTO A;  2CZ7 B;  3HPW A;  4FSX A;  2XID A;  5GAN e;  3E1S A;  4M7A C;  1G3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...