5GAMd

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
82
Chain Sequence
NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
total genus 12
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamd00
4J6XA 5LJ5g 4HT9A 3QSUA 2I2LA 2DEQA 2EJGA 4C92A 4M77B 4C8QF 1MGQA 2DZ9A 2VXEA 4C8QG 1I81A 2DZCA 4JLIA 4PJOB 2DJZA 2RA2A 4M78D 5GAN6 4M77C 4M7DB 2VC8A 2DKGA 1LOJA 4M75F 4XTVA 1U1TA 1N9RA 5GMKm 4PJOC 2RD1A 2K57A 4M75G 4F7UB 3JCMd 1I8FA 4M78E 3QO3A 5I21A 3QUIA 3JCMg 5GAN7 4J5YA 1WPYA 4MMLA 5GMKh 5GAMd 1WQWA 3JCMb 1BIAA 2EAYA 5GAMg 2E41A 4C8QB 4EMKB 5GAOq 4N0AC 4HA8A 3BFMA 3INZA 5LJ3e 4M77D 3SWNC 2E1HA 3JCMQ 5LJ3j 4PJOD 3RKWA 1WNLA 1HXDA 4M75B 3RIRA 3JB9H 4MMKA 4M77E 4M7DD 1JBMA 4M78A 5LJ3f 5GANd 4X9DA 1Y96A 2DTOA 4PJOE 3BDUA 1I4K1 4XU1A 5GANg 3AHUA 4M75C 2E10A 4N0AA 3JB9F 3HSBA 4EMHA 5LJ3h 3JB9G 1B34B 3BY7A 4M7DE 3SWNA 4RCBA 3JB9I 4JRKA 5GAOl 3RKYA 4WF2A 1H641 5GMKi 4M7AF 3FJPA 3RESA 4F7UE 3FB9A 3JCMf 4M7AG 5GAN3 2DVEA 2FB7A 4JUVA 2DXUA 4C8QD 4M7DC 4C92F 1BIBA 4DQ2A 4NL3A 4C92G 5GAOn 1D3BB 5LJ5e 2DTHA 4V2SA 2EJFA 3JCMJ 3GIBA 2QTXA 5LJ5j 2RB6A 2YHTA 3HFNA 4M77A 4NOYA 4XTXA 3RUXA 2EJ9A 1N9SA 1TH7A 4C8QE 4M75D 5GAN2 5GAOp 2VXFA 4PJOA 4PNOA 4XU2A 5GANe 2DXTA 5LJ5f 5GMKl 3V7SA 5GANj 4M7DA 4C8QC 4EMKC 4M75E 2HNIA 5CAIA 3HFOA 1YCYA 4XTZA 4M7AB 5LJ5h 4F7UA 4EMGA 2YLCA 5GANf 4Y91A 1KQ1A 1U1SA 3V7CA 4C92B 2EWNA 3BW1A 4M77F 3JCMe 3JCMP 2RM4A 3EFSA 4RCCA 5GAN4 3V8LA 2YLBA 3SB2A 4J6WA 3RKXA 2FYKA 4C8QA 4EMKA 5GAMe 4C92C 3JCMV 1M8VA 3L2ZA 5GAMj 3FIFA 4QVDA 4XU0A 4F7UF 4M78F 3JCMh 2E65A 4M75A 4M78G 5GAMf 2Y90A 2ZGWA 2CGHA 3JB9D 4JRIA 3EFRA 1LJOA 5GAMh 3V8KA 4M7AD 4XQ3A 4XTWA 3JB9J 1HK9A 1M5Q1 5GAN8 5LJ3d 5GAN5 3JCMW 4A54A 1B34A 5GMKe 1LNXA 4C92D 5LJ3g 3RERA 5GMKj 4M7AE 3L1AA 2DTIA 4XU3A 1WQ7A 1KQ2A 4C92E 4HT8A 1X01A 4J6YA 1D3BA 1JRIA 4M77G 4M78B 4OP0A 4X9CA 4PJOF 1Y96B 5GANh 4A53A 4M7AC 4PJOG 3PGGA 4M7DF 3V8JA 4M7DG 4M78C 3SWNB 3V7RA 1I5LA 4NL2A 4XTUA 4XTYA 3QHSA 3JCMc 3JCMX 3VU3C 4F7UG 5GAOm 2JN0A 3M4GA 5LJ5d 5GAOr 2E64A 4M7AA 5DY9A 4QVCA
chains in the Genus database with same CATH superfamily
3VV0A 1PSFA 2EJGA 2WSFE 4J9BA 1WI7A 4KUDK 2OTJQ 2L3QA 4E7KA 2VC8A 3JV3A 1VQ7Q 2CZ1B 2LVMA 1Y57A 5A0DA 5IT9E 4RKUE 4PFZA 1RAEB 2KXCA 2WACA 2KT1A 2PTKA 4BY6B 4KT0E 4J9FA 4Z02A 4DOVA 2X35A 3INZA 3M59A 2RQVA 1VQ8Q 2ROLA 3MJXA 3EAEA 3GNFB 1QVFS 5KYXA 1V76A 3MHXA 2D0QB 4IURA 3BDLA 2EQUA 2L3PA 1YBYA 1AOJA 4JPBW 1PNJA 2BE9B 1E7OA 1YIJA 4C5IA 2KQWA 3OYIA 1U3OA 2AHJB 1AWOA 1UJYA 2WSEE 2DX1A 3A1PA 1G3WA 3RUXA 3JB9I 1NYGA 3OBYA 4RTWA 3CCRA 3LX7A 2XDDA 1VQLQ 2FPDA 4ZGJB 1QVGP 3CCUA 1VQ6A 1VQ4A 1I1JA 3JSCA 2V8KA 2JZ2A 5LJ5h 2IG0A 2NUTA 2C0IA 2C0TA 1NJIR 1UHFA 1D0XA 1NG2A 2R5MA 1WLPB 3JCMV 3THKA 4JJNK 1EFNA 2HBWA 3JCMh 4M78G 3UPUA 4OMLA 2DFUA 4M7AD 4KGVB 2GGRA 4JZ4A 3CCLQ 3LW5E 2LCLA 2CP3A 2QAZA 1K9MC 2IVWA 4J9IA 1W1FA 4X9CA 2KDSA 2DK3A 1OQKA 4OMFB 2QK0A 3EGUA 3NTKA 3V7RA 2XU8A 3JCMX 3CCJA 3G6EA 3NTIA 2BZXA 2RNAA 4OMPA 1V1CA 1X27A 2QQAA 2FVUA 4AMCA 3EHRA 1X6OA 3QIIA 2K57A 4LDUA 3FEOA 5I2MA 4M78E 2RQTA 3QO3A 1BYMA 4J5YA 2LQ8A 4LD9K 1BIAA 4FW2A 1ARKA 1MMAA 3WXMB 4OMMA 4FL6A 5LJ3j 1OYXA 2CP0A 1ZQ1A 5CIUA 1WNLA 3MEAA 3J81E 2MWOA 1KC8R 3S3OA 1NBEB 1JXOA 3AT1B 1SPKA 2M02A 3O5ZA 4AG1C 2PVOB 3H0FA 1JJ2A 4OMQA 1Q81C 2RB6A 5IXBA 4M77A 2LDMA 2ZPIB 1YWPA 5KCHA 2R57A 5GMKl 2XMFA 2CP2A 3EGXA 1N5ZA 4F7UA 4R55A 1KQSS 4EIKA 3TCJA 2RI3A 1M90R 1K9AA 2FZKB 2CH4W 4LNPA 2VV5A 2X4JA 2KYMA 3GF5A 4XK8E 1KD1R 1QP2A 4AFSC 1JB0E 1OV3A 3HHTB 4GLKA 3EFRA 5FRNA 2X4WA 2HL5C 3CMEA 1UDLA 2HD0A 2DJQA 4AFUC 4JJDA 2DBMA 1VOMA 1NPPA 4A4FA 2YSQA 1W2BA 3OYYA 1RAAB 2RMOA 1K8AR 4IUUA 1D3BA 3NMZC 2MAMA 2RI2A 2GQIA 3OB9A 1SRLA 1NE8A 2QEXA 4KBMB 3H0HA 4A4KA 1H8KA 5IH2A 2JN0A 1UHCA 1UFFA 2E64A 2MI6A 1WJSA 2YUQA 3M57A 1JO8A 4J6XA 3GPLA 2P0QA 4E47A 1KG1A 1IREB 2IPOB 3E2UA 3TSZA 1GBQA 4LDYA 3FLGA 1ZUYA 1I8FA 2RF0A 3OYNA 3HRSA 3I56A 1IXDA 1RLQC 4C5GA 1IRXA 1NM7A 2GFAA 2KRSA 3VS5A 3VS2A 5LJ3e 2DL7A 2FZCB 2K5LA 2CSIA 4RG2A 4ZN1A 1Y0MA 2HZYA 3CCSA 1KJWA 1OEBA 1IGUA 2ZPHB 4J7FA 4AFZC 3RKYA 5HK0A 2FB7A 3CCMT 5CKFA 3CC7T 2P0PA 2KEAA 1AZGB 2QTXA 3KFVA 3NHNA 2EJ9A 5KYUA 3G71T 2NLUA 2JTFA 1RLPC 2DXTA 5LJ5f 1KIKA 1YWOA 1M90U 1QWEA 1HSQA 2MCNA 3HFOA 2LNHB 3CPWS 3QBYA 3MP6A 3A5ZB 1AWWA 3HRTA 1VQNA 2KY9A 1KD1U 3ZL7C 1T0HA 2CYZB 2ZPFB 4DBQA 4IUQA 1IGQA 2G3RA 2ABLA 3VJPA 5GAMh 1K8AU 1QCOA 1WHMA 2DAQA 2DO3A 1W2BP 2L2PA 2VGNA 2DA9A 3LWHA 5EC7A 1M2OA 5C6SA 1AEYA 1BBZA 2O2OA 1C6VX 1M2VB 3S6WA 3OYMA 1RL2A 3RDVA 3H9NA 1SG5A 2P4RA 1MHNA 4L59A 2HEQA 1XQHA 4DEXA 3NFCA 1K73R 2AKLA 1YI2A 4KULA 1OU9A 3L2UA 5CKBA 1OX9A 4PJOB 4X1VA 2FO0A 4ESRA 2RA2A 1Z9QA 2DXCA 1G3TA 2EYZA 3EG3A 2DERA 1K76A 5GAN7 3VRZA 4D8DA 2HAXA 4X34A 1BB9A 5CR2A 3G1JA 4LXCA 4PJJA 4ORZA 3CC2T 4M7DD 1GCPA 2LT1A 2XK0A 2F1LA 4N0AA 2JM9A 5LL6S 3DLLA 2DEUA 4LUDA 3F70A 2D9TA 1VQOT 2EQJA 2EW3A 4JZ3A 4DQ2A 1GFDA 2QQ9A 3TEEA 2YHTA 5GAOn 1UB4A 5GAN2 1M3CA 3CCMQ 3CC7Q 2DPPB 4Y28E 3I5RA 2D8JA 3G71Q 4MZTA 4XTZA 1PC0A 4E7ZA 5KE2A 2A08A 2K5FA 4C92C 3OYEA 3L2ZA 3FIFA 2GTJA 3PVQA 1QLYA 3EHQA 3H8ZA 2RJEA 4HCZA 2Y90A 2F69A 4BE2A 5CK9A 3V8KA 2DL4A 3TREA 1B34A 4EPCA 3J7AF 2O9VA 2BTTA 2K3XA 2DIQA 2LJ1A 2DTIA 1ZSZC 3EFOA 4HKEA 1QVPA 1VYUA 5CKEA 1UUEA 2MWPA 2NWMA 4J6YA 1XNIA 3CCEQ 4PJOG 3E1SA 1O75A 1PCXA 1K73U 2LRQA 3QHSA 1SSFA 3FJ5A 2V1RA 5GAOm 1S72A 2BE7D 4LN2A 4M7AA 1FYNA 4RUGA 2KBTA 2CP6A 2KI7A 4JRQA 3QSUA 1BI2A 2COWA 4Q5WA 8AT1B 3SDZA 2DZ9A 1SHGA 2KXDA 1UGVA 2KR3A 5GAN6 3H6ZA 1YJWT 1N9RA 1Y7XA 2QXFA 2M1HA 2WSCE 2RJFA 1VQ5T 2QGGA 1HYOA 3REBB 2RQRA 5GAOq 1ZUUA 4N0AC 2ENMA 2KT8A 1ACMB 4J83A 3C94A 1Q7YR 2RJDA 3LH5A 2O9SA 2ED1A 3ZEHA 2E6ZA 3CQTA 2C06A 2DTOA 4PJOE 4FSSA 1TWBA 2DL5A 4II1A 4M75C 3CC2Q 3C4SA 1K4US 2MIOA 2HKNA 3UA7A 4M7AF 1Q95G 2E3HA 4C8QD 5IHNA 3LWIA 2RO0A 1Q82R 5GJVB 5HCKA 2A0FB 3GIBA 4A4EA 2LJ3A 4PLLA 2CH4A 1E6HA 4C0DC 4PNOA 2J06A 3MCAB 4CI0C 3GP8A 4QT7A 1YCYA 1VQOA 5GANf 1X6GA 1TG0A 5FW9A 1PD0A 2RM4A 2O31A 3SFMA 3SB2A 4J6WA 3M55A 4ZTJA 3GOXA 4IKFA 1TOVA 2E4HA 2L8DA 3I55A 5KH6A 5HKCA 3EG9B 5GAMf 3JB9D 2ZZDA 3TQ7P 1R0CB 1ZX6A 2DYBA 5IHIA 2ECZA 1JU5C 4C92D 1KHCA 1M3AA 2X9HA 3A98A 2EBPA 3CC4A 4E7IA 1VQKT 2CDTA 5KYXB 1X01A 2PVDB 4M7AC 4OP0A 3JAME 1Z9ZA 2YRVA 1Y07A 2LQNA 3CXCA 2OTLQ 3OS5A 3ULRB 2OI3A 4QVCA 5HY6A 4HT9A 1NEBA 4JLIA 2RJCA 4HCKA 1I5OB 1LOJA 3KUFA 1OU8A 5FU6C 2NUTB 5I21A 2J6FA 1YJWQ 1Q7YU 3OYDA 1K0SA 1D0ZA 2Z0WA 2QTVA 1VQ5Q 2AZSA 4E6RA 2DL8A 2E1HA 2EGEA 3UATA 2K2VA 3RIRA 1A0NB 4HVVA 2GFUA 1M90C 3QG1A 4FM4B 3M58A 1Q82U 4EMHA 1AWXA 1GCQC 2M0YA 1KD1C 1M30A 3VUBA 2K2MA 1RI0A 2W10A 1QKXA 2LQWA 3MEUA 2OTJA 4M75D 1VQ7A 4XU2A 1ZHIA 3MKDA 3OYGA 1HJDA 1PRMC 2JXBA 1BK2A 1K8AC 3CCQT 1H3HA 3V7CA 3C12A 3ZFJA 2D6FA 1RADB 1VQ8A 2FYKA 2ZAEA 4ZNXA 4RMOA 1MMDA 2XHCA 1QKWA 3OYLA 1Q86R 5GJWB 3MEVA 2RK1A 3LYIA 1QCFA 4JJBA 1YIJQ 1AT1B 3JB9J 1HK9A 2O01E 4OB2B 2QA4Q 2EYYA 1WYXA 4O6JA 2CP5A 4LD6A 3PVLA 2RHYA 3CMAQ 1VQLA 1VQ6Q 5AYFA 2NUZA 1WA7A 1FX7A 1AVZC 1VQMT 1R8OB 5D7UA 4OB0B 1VQKQ 4A63B 3G7ZA 3CXCP 2XD0A 4XTYA 3MPUB 1VIEA 3M4GA 1VUBA 2JTMA 4M77B 2KAFA 1SHFA 2ZPBB 1WJRA 3L2RA 3KXTA 4RTZA 5I11A 2FG0A 3EGXB 4F7UB 1H92A 1P92A 1UG1A 5IXFA 1H3ZA 1C0MA 3OBWA 2RHUA 4PL6A 1GFCA 3VYGA 3CCLA 1QCNA 3T9NA 2PZ1A 2CSQA 3CD6Q 3X24B 2CKKA 4HCCA 1RI9A 2CREA 1JBMA 1UGQB 2XKOC 4FYVB 4IIOA 5LJ3h 2X3WD 1GRIA 1H641 1VQ9A 3RESA 1PD1A 2LTOA 2MMPA 2VWFA 4L6V5 4NL3A 4C0ZA 1D3BB 2EJFA 1BKBA 1KK7A 4C0FA 3VS6A 3VS1A 2YWWA 4PJLA 2EGAA 3EG2A 1X69A 4M7DA 3PFSA 1ZLMA 2HNIA 3G4ST 1UGPB 1I07A 4N4IA 2M9UA 4OB3B 3CCQQ 1QVFP 2AT1B 1ZBJA 3EFSA 4RCCA 2YLBA 2EKHA 3VYHB 4BACA 3OYCA 1GBRA 1K73C 2EIFA 1IB8A 2EGCA 4JLGA 4IUVA 1NJIU 2V26A 3L2WA 3TSWA 1X75C 1R77A 1YNZA 4PLIA 1YHQT 2A3LA 1JJ2S 3CCVT 3VS4A 5FU7C 4M77G 2FRWA 2F2WA 5CQXA 4D6WA 1EIFA 4RG8A 1TUCA 4N4GA 4M7DF 4M78C 4PFPA 3P8BB 3C0CA 1VQMQ 4F7UG 5LJ5g 1V29B 2DEQA 4OVAA 2VXEA 3QKJA 1G2BA 5KYUB 2QQRA 5FWBA 3N5BB 2LX9A 3M0UA 3QDFA 3CMEQ 4HVWA 3J80E 3JCMg 1WHHA 2EPDA 1WPYA 2X51A 5DM7R 3M0PA 4FU6A 4R0KA 2KROA 4PJMA 5KYYB 1S1NA 1W2BS 2CP7A 3QYGB 2GF7A 4BY6C 1QQJA 1RAGB 4M77E 2YUNA 3UDCA 4X9DA 1Y96A 3BDUA 1I4K1 4KGXB 3D7SB 4DOWA 5GMKi 1K0XA 4QW2A 1G5VA 4F7UE 4M7DC 3RR6A 5A0GA 1KC8U 4UC4A 2X4XA 1PM3A 3I56Q 1B07A 1IO6A 4WTOB 2CT3A 1SF9A 4FW1A 1NLOC 2HDAA 4RTXA 3G4SQ 3V8LA 1KHIA 1UE9A 4C8QA 4HCBA 1SRMA 1QMCA 2BKDN 1OULA 2BZYA 4ELYC 4PFOA 2L5QA 1W70A 1YJ9Q 2M0OA 1WQ7A 4B9XA 4HT8A 5AT1B 1JRIA 5GANh 2SRCA 1YHQQ 3CCVQ 2O4XA 2LQKA 1Q7YC 2K4YA 2L0AA 4Z8AA 2QASA 1VQNQ 5FLXE 5LJ5d 1YITT 4C92A 4C8QF 1FWZA 2C0OA 4J9CA 2YRCA 2DJZA 4M78D 3CCET 1VQPT 4CRIA 1Q82C 3JCMd 3O8VA 3QUIA 3CBOA 2ZPEB 3REAB 5GMKh 1YJNT 1ZSZA 3URGA 3QPHA 2B86A 1WJQA 1G83A 1M1KR 2JS2A 3JCMQ 2V8JA 5LJ3f 5HK3A 2LP5A 3OSSC 3JB9F 3HSBA 1BU1A 1B34B 2DLPA 1YI2Q 1OZ2A 4JRPA 3EFOB 3EG1A 3M56A 4JUVA 4L5GA 5CVIA 1FMVA 4C92F 2XDPA 1BCMA 2ROTA 4XTXA 3A8GB 1TH7A 2D1XA 4C8QC 3EH2A 1WIEA 1RUWA 2K9GA 4M7AB 3KBGA 4EMGA 2M51A 4MDWA 4Y91A 2V8IA 2EWNA 2HSEB 1M1FA 2DD4A 4XAXB 2PUOB 3X26B 4F14A 4EMKA 1WHJA 4E7JA 3M54A 3FDRA 3BE3A 1AWJA 4M75A 1QWFA 2LX7A 2A28A 4ATOA 2RHZA 2PQWA 4GBQA 2DVJA 3NPFA 3A8HB 4XU3A 4CC7A 3R6NA 3CC7A 3CCMA 2KK4A 3PGGA 3G71A 2ZCFB 1QP3A 4XTUA 3OMCA 1AZEA 3JCMc 3GLXA 2JM8A 3PT9A 3VU3C 3M0QA 4MZMA 2OAWA 2HMAA 2PNIA 3LGFA 1G3YA 1OPLA 3DB4A 3NTHA 1YITQ 1AD5A 4MDXA 2RH2A 2CUDA 2L3SA 3PE0A 4MZPA 3OW2S 4M75F 3WVDB 1ABQA 2MOXA 1VA7A 2RD1A 2VUBA 5DLQE 3P8HA 1GXIE 4D8KA 2EQMA 1VQPQ 4CC4B 2OTLT 4WCIA 2XDBA 5GAMg 2E41A 3BFMA 4E2FB 1N6AA 1HD3A 3CCEA 1YJNQ 2KVQG 4LDXA 3M5AA 1RAFB 6AT1B 3DB3A 2LT4A 2QDLA 5D6YA 1X43A 4FIBA 4RCBA 2L3RA 4JRKA 3NGPA 4Z88A 3OYBA 3QXEB 2K7AA 2KRMA 3VS7A 3FB9A 4M7AG 5GAN3 2DXUA 3R6OA 1BIBA 2P84A 3L42A 1M8VA 1M4ZA 5KYWA 5GAOp 2BIVA 4EMKC 4DBRA 5CAIA 1NJIC 5L23A 3OS0A 1NLPC 2RPNA 2CZ7B 3HRUA 4PJNA 3E19A 2DXBA 4OMNA 1MMNA 2HSPA 2ATCB 3PMTA 5KYNA 4XU0A 4ZN3A 3CC2A 1SEMA 1GCQA 2JNGA 1MMGA 5KE3A 1T0JA 2E12A 4BI3A 3DLMA 5GAN8 1TUDA 3RERA 4M7AE 4BI8B 4JDSA 3Q1JA 5I2SA 4E7HA 1M1GA 2BUDA 1N8RR 4RTTA 1YIJT 3HKSA 3I9QA 5DY9A 2QA4T 3VS3A 3L2QA 2KYBA 1MGQA 3CCRT 3CMAT 4QVZA 1VQ6T 1VQ4T 2KRNA 3CBMA 3X25B 4BE1A 2CUBA 5GMKm 4PK4A 4PJOC 4P5NA 1U8RA 3OMGA 2HQHA 4OGCA 1M8MA 2ESWA 4MMLA 2RI5A 5GAMd 1QVGS 4KH0B 1FMKA 1ABOA 1VIFA 1KC8C 3HP9A 3QYHB 2KGTA 2DETA 4E7LA 4ZGEB 4MMKA 1JEGA 1TUGB 3CXCS 2OTLA 3SWNA 1G8XA 2Y4YA 2KNBB 1AHJB 3CD6T 1N9SA 2J6OA 4IUTA 1YJWA 2JW4A 3CCJT 4FT2A 1VQ5A 4BE0A 1KQ1A 2HBPA 2YUOA 4GY5A 2JOYA 2LZ6B 2BZ8A 2JS0A 1WX6A 2ZPGB 1SKUB 1D1AA 4ZGDB 3VS0A 2FPEA 1OX8A 1ZSGA 2XG8D 1CKAA 4XTWA 2EFIA 2YXYA 5GAN5 3JCMW 2P0KA 2GBQA 2EKOA 2F5TX 4RTYA 2LCSA 4YTLA 2A36A 3MP8A 3QWXX 1N8RU 3EG9A 1PKTA 2NUPA 2B8AA 1QVFA 3OSVA 1N27A 1NYFA 4NL2A 2H8HA 1D1CA 3OYHA 5FROA 2CZ6B 4AT1B 1WZOA 1PHTA 5C0MA 2I0NA 4O5VA 1LPLA 4M7DB 3CCRQ 3OQ5A 2EQIA 3CCUQ 1WHGA 1VQ4Q 5L8RE 5D6WA 2QA4A 5CKHA 4A4GA 1WDXA 3EGDA 1WQWA 4FYYB 3UWNA 1E6GA 3CMAA 3SWNC 3A8MB 2QYZA 4PJOD 1RAHB 2GCXA 4J9HA 8ATCB 4VUBA 3JB9H 1VQKA 2YDLA 3PIPA 1UGRB 4M78A 2JMCA 3AHUA 2E10A 3CMET 1ZA2B 1IHVA 2DMOA 2D0NA 2AK5A 5GAOl 3FJPA 2XIDA 3SHWA 2DTHA 3JCMJ 4F16A 2AKKA 5LJ5j 2YUPA 2QEXT 2K6DA 1WHLA 2RHXA 1G3SA 2FHDA 4JS4A 2YLCA 3S3NA 5CO7A 4BDYA 3CCJQ 3UF4A 3G6EQ 3QZ9B 2RQWA 1XJWB 3RKXA 3CD6A 2QQSA 1VYTA 4BUGA 1UECA 4RTVA 4M78F 2YRDA 2X4YA 3I56T 2K3BA 1VQ9Q 1D09B 5DLOA 2P4TA 1PSEA 4IIMA 4J9DA 2HL3A 4JS5A 3CCST 4KH1B 1TSFA 1T3SA 1Y96B 4CC2A 1Q86U 4A4HA 4FT4A 2EQKA 4QQGA 3V8JA 1ZUKA 3HL8A 4LE9A 4M7DG 2F2XA 1M1KC 1LVKA 1CKBA 2GTOA 1XTDA 1NPRA 3CCQA 1UTIA 2X3XD 4AFQC 1YJ9T 5EG2A 2I2LA 3GBQA 1UJ0A 3RMSA 5A0LA 1TS9A 4XTVA 2JJ9A 3SEMA 2CT4A 3OY9A 2VVKA 1VQNT 1KQSA 1WGSA 2EAYA 2MYSA 3P8DA 4C8QB 2DNUA 3PMIA 5IAYA 4B9WA 2A7YA 1HXDA 2DYIA 4N4HA 4V2SA 3I5SA 1VQMA 1MNDA 1J3TA 4M7DE 2LCCA 1GL5A 3EH1A 1ZA1B 2LJ0A 3QZ5B 5LJ5e 2O4XB 1MNEA 5IN1A 1B3QA 1UEBA 2CS7A 2G6FX 3QJ6A 4OF1A 2QEXQ 4KUIA 2MF2A 1YI2T 3META 4KRTA 3OYJA 4E7SA 3JCMe 1U1SA 4C92B 4M77F 2HKQB 3X20B 1YCSB 4LDWA 3SD4A 1RAIB 2JT4A 3VKIA 1YFNA 4F7UF 3M53A 2RHIA 1TTHB 2DF6A 2ZGWA 4QQ6A 2OJ2A 5J3BA 5FRMA 3E9FA 4AG2C 2H3EB 1MV3A 1RABB 1FXXA 4XQ3A 3TVTA 3X28B 1ZSZB 4A54A 5LJ3g 5IHKA 3M4YA 1JXMA 1YN8A 5ECAA 4A53A 5D6XA 3CCSQ 5CQYA 2E5KA 4JJCA 2XICA 1O9SA 3OS2A 3G4SA 2DBKA 5A2QE 1CSKA 2FL7A 2LNVA 5J39A 4BDZA 4C8QG 1I81A 3CPFA 4CC3A 3HPWA 3CBPA 1OPKA 4M77C 7AT1B 1B7TA 4J9GA 2COYA 2J6KA 4ELZC 2RQUA 2VASA 2DM1A 1JJ2P 1KQSP 1K9MR 2EYWA 1YJ9A 3CPWA 3JCMb 2DILA 3OYAA 2QGFB 1PWTA 4EMKB 4HA8A 4FYWB 2EVRA 3QDRB 3VUZA 3RKWA 1YHQA 3L2VA 4M75B 3CCVA 1OI1A 1WXBA 1WFWA 1BI0A 4XU1A 1K1ZA 3JB9G 4LDVA 3BY7A 2E6NA 4Y92A 4WF2A 5KYYA 2V1QA 3JCMf 2LC4A 3OS1A 1MV0B 3FRNA 2KE9A 4C92G 4C0DB 3UA6A 4NOYA 4BI4A 4C8QE 1D0YA 2F5KA 1WHKA 4ANJA 1VYVA 4HXJA 5GANj 2QDYB 1C1AA 1S72T 3QJYA 1YP5A 4C5HA 3LGLA 3BW1A 2E5QA 3OYFA 5GAN4 1N8RC 5GAMj 4KGZB 3LLRA 4QVDA 4F17A 1D1BA 4JRIA 1DJ7B 1LJOA 4LUEA 1Q81R 3I35A 5LJ3d 2PU9B 4K11A 1LNXA 3DKMA 3H41A 5GMKj 2OAUA 3L1AA 3MO8A 2JMAA 1ZBXA 2DIGA 3OYKA 1KQ2A 4C92E 2VGMA 2EYXA 4Z89A 4OGEA 4J8OA 3IQLA 2K5IA 1IZ6A 1I5LA 4PKCC 1BI3A 1U06A 5I22A 2DRMA 3PTAA 2GQVA 2IIMA 2XI9A 5KYWB 3JRZA 2DZCA 5FU6B 1K9MU 3C95A 1BCOA 2DKGA 2MK5A 2QQBA 4M75G 1RACB 1NZ9A 2MPXC 4TVRA 2JTEA 3CPWP 2DD5A 1IHWA 4DA4A 1KSWA 2R58A 4M77D 3I55T 1WXTA 1X2QA 3MEWA 1I0CA 1M2VA 5GANg 2KMTA 1FMWA 5M9OA 3CC4T 1M1KU 3OW2A 2JUFA 1TXQA 3M0TA 2W0ZA 1YITA 2M16A 2KSSA 3EG0A 2VXFA 4PJOA 5GANe 2DRKA 3H0IA 3V7SA 2DL3A 2SEMA 4M75E 1VQPA 1KFZA 2VKNA 1X2KA 1S72Q 3JCMP 2A37A 2E3IA 2JVVA 2ED0A 5GAMe 2HCKA 5FWCA 1YJNA 2VYTA 1Q86C 3VRYA 3M9QA 1Q81U 4B6MA 3RMQA 3CEYA 4J7IA 2L89A 1F1BB 2RK2A 4QKUA 3ASKA 1M5Q1 3OA6A 5GMKe 2CZ0B 3U23A 4OB1B 4PJOF 3A8OB 3FC3A 2H3JA 3M0SA 3QWYA 4ME7A 3SWNB 3A8LB 4C0GA 1OZ3A 3ME9A 1WXUA 5CKDA 2OTJT 2YT6A 2QI2A 3MP1A 1VQ7T 2EYQA 4BD3A 1W6XA 4J9EA 1U1TA 1W4SA 1MUZA 3LH0A 4DBFA 1M9SA 2E70A 2J05A 3UT1A 4FCYA 1EZZB 1TU0B 1NEGA 3S3MA 1SSHA 2DE0X 3GNGA 1VQOQ 1VQ8T 2LMJA 4GLMA 4C5EA 1PKSA 2K79A 2O88A 2J7IA 3RNJA 4QQDA 4HVUA 2F2VA 1X6BA 3I55Q 5GANd 3CCUT 1R0BG 2AZVA 2PUKB 1U5SA 3E9GA 1OOTA 3OW2P 4ZTFA 2DVEA 1VQLT 4F04B 2VB6A 2AIRB 2NUPB 1UGSB 3ZBDA 3HFNA 2HQEA 2D8HA 3CC4Q 3RBBB 2NYSA 2COZA 2FEIA 1JQQA 2QG9B 2Y4XA 5CCAA 1QVGA 4BB7A 1T3LA 1Y71A 1LCKA 1M27C 4NS5A 1XOVA 2OX7A 2PVGB 4M4ZA 4RTUA 2K3YA 4DEYA 2RN8A 1QW1A 2E65A 4DBHA 2FRYA 2CGHA 3HTRA 4FSXA 3EGDB 2HQXA 3TU4K 3CCLT 1M3BA 2R5AA 1PG5B 5J26A 5FU7B 3WVEB 4IUPA 3G6ET 1BI1A 4OMOA 3M0RA 5KCOA 3PNWC 3ER0A 9ATCB 4M78B 1PRLC 1EX4A 2GNCA 3PIOA 4FYXB 1VQ9T 4EDUA 4R56A 5GAOr 2FZGB 2FPFA
chains in the Genus database with same CATH topology
1YJ9T 5EG2A 3VV0A 4JRQA 2I2LA 1BI2A 1PSFA 2EJGA 4Q5WA 3SDZA 2WSFE 4C8QF 1FWZA 2DZ9A 4C92A 3RMSA 5A0LA 4KUDK 2DJZA 4M78D 5GAN6 4E7KA 3CCET 3H6ZA 2VC8A 1YJWT 4XTVA 1N9RA 1VQPT 1Y7XA 2CZ1B 2LVMA 2QXFA 4CRIA 2M1HA 5A0DA 1Q82C 3JCMd 3OY9A 5IT9E 2WSCE 3O8VA 2RJFA 3CBOA 3QUIA 4RKUE 1VQ5T 2ZPEB 1VQNT 1KQSA 5GMKh 1WGSA 2EAYA 3P8DA 2WACA 4C8QB 3URGA 3QPHA 5GAOq 4N0AC 3PMIA 4KT0E 4BY6B 4Z02A 4DOVA 5IAYA 1WJQA 2X35A 3INZA 3M59A 4J83A 3C94A 4B9WA 2RJDA 3JCMQ 2A7YA 2V8JA 1HXDA 3EAEA 3GNFB 3ZEHA 1QVFS 3MHXA 4N4HA 2E6ZA 5LJ3f 2C06A 2D0QB 4V2SA 2DTOA 4IURA 4PJOE 3BDLA 5HK3A 1VQMA 3OSSC 2EQUA 4II1A 4M75C 3JB9F 3C4SA 1YITT 1YBYA 3HSBA 4M7DE 1B34B 2LCCA 1OZ2A 4JRPA 4M7AF 1YIJA 3M56A 4JUVA 4L5GA 5CVIA 2KQWA 4C5IA 2XDPA 4C8QD 4C92F 3QZ5B 3LWIA 2RO0A 3OYIA 5LJ5e 2AHJB 3GIBA 4A4EA 2WSEE 1G3WA 4XTXA 3RUXA 3JB9I 3A8GB 1TH7A 3OBYA 4PLLA 3LX7A 2O4XB 2XDDA 3CCRA 5IN1A 4PNOA 4C0DC 3MCAB 4ZGJB 3CCUA 1UEBA 2CS7A 1VQ4A 1VQ6A 3QJ6A 4C8QC 4OF1A 3JSCA 4CI0C 2V8KA 2JZ2A 3GP8A 4KUIA 5LJ5h 1YCYA 2MF2A 4M7AB 2IG0A 3KBGA 1VQOA 3META 4EMGA 1YI2T 5GANf 3OYJA 4MDWA 4Y91A 1U1SA 3JCMe 4C92B 2V8IA 2EWNA 4M77F 2RM4A 1M1FA 2DD4A 4XAXB 2PUOB 3X20B 3SFMA 3SB2A 4J6WA 3M55A 3X26B 2R5MA 4EMKA 4LDWA 3GOXA 3JCMV 4ZTJA 4IKFA 3SD4A 3M54A 4E7JA 2L8DA 3VKIA 4JJNK 3I55A 5KH6A 3FDRA 5HKCA 4F7UF 3M53A 3JCMh 4M75A 4M78G 2RHIA 5GAMf 2ZGWA 5J3BA 3UPUA 2ZZDA 4QQ6A 3JB9D 5FRMA 3E9FA 4M7AD 1FXXA 4XQ3A 3X28B 4A54A 4ATOA 4C92D 1KHCA 5LJ3g 3M4YA 2RHZA 3LW5E 2PQWA 2LCLA 3CC4A 3A8HB 4XU3A 3CCMA 4E7IA 3CC7A 2IVWA 1K9MC 1VQKT 1X01A 2KK4A 4X9CA 2PVDB 2KDSA 4OP0A 4M7AC 3JAME 4A53A 2DK3A 4OMFB 5D6XA 2YRVA 3PGGA 3NTKA 3G71A 3V7RA 2ZCFB 2XU8A 1QP3A 4XTUA 3OMCA 3JCMc 3GLXA 3PT9A 1Y07A 5CQYA 3VU3C 3JCMX 2XICA 3CXCA 3CCJA 1O9SA 3OS2A 3G6EA 3G4SA 3NTIA 3OS5A 4QVCA 5HY6A 4HT9A 4MZMA 5A2QE 2FL7A 2LNVA 3LGFA 5J39A 1G3YA 4BDZA 3DB4A 4C8QG 2QQAA 1I81A 2FVUA 4JLIA 3NTHA 3CPFA 1X6OA 2RJCA 3HPWA 3QIIA 3CBPA 4MDXA 2RH2A 4M77C 3OW2S 4MZPA 1LOJA 3KUFA 4M75F 3WVDB 2RD1A 2K57A 4LDUA 2VUBA 5DLQE 5FU6C 3FEOA 3P8HA 5I2MA 4M78E 3QO3A 5I21A 1BYMA 4ELZC 1GXIE 2EQMA 1Q7YU 3OYDA 4J5YA 2LQ8A 1YJ9A 3CPWA 2OTLT 4LD9K 3JCMb 3OYAA 1BIAA 2XDBA 5GAMg 2E41A 4EMKB 3WXMB 4HA8A 3BFMA 1N6AA 2E1HA 3CCEA 4FL6A 5LJ3j 3QDRB 1OYXA 3RKWA 1ZQ1A 5CIUA 3VUZA 3L2VA 1WNLA 4M75B 3CCVA 2KVQG 2K2VA 3MEAA 3RIRA 3J81E 2MWOA 1OI1A 3M5AA 4LDXA 1M90C 2GFUA 3QG1A 1BI0A 3S3OA 3DB3A 4XU1A 4FM4B 3M58A 2LT4A 1Q82U 5D6YA 4FIBA 4LDVA 4EMHA 3BY7A 3JB9G 4RCBA 2L3RA 4JRKA 2E6NA 4WF2A 3OYBA 3QXEB 4M7AG 3FB9A 3JCMf 2LC4A 3OS1A 5GAN3 1KD1C 3VUBA 2DXUA 3R6OA 1BIBA 2PVOB 1RI0A 3FRNA 4C92G 4C0DB 1JJ2A 3MEUA 3L42A 2OTJA 1Q81C 2RB6A 4NOYA 4M77A 4BI4A 4C8QE 1M8VA 1M4ZA 2F5KA 2LDMA 2ZPIB 4M75D 5GAOp 1VQ7A 4XU2A 2BIVA 5KCHA 1ZHIA 3OYGA 2R57A 5GMKl 5GANj 2QDYB 4EMKC 1K8AC 3CCQT 1S72T 5CAIA 3QJYA 1NJIC 4F7UA 4R55A 4C5HA 3LGLA 1KQSS 3TCJA 3OS0A 3V7CA 3C12A 3BW1A 3ZFJA 2D6FA 2CZ7B 2RI3A 3HRUA 2E5QA 3OYFA 5GAN4 1N8RC 1VQ8A 3E19A 2FYKA 2DXBA 5GAMj 3PMTA 2VV5A 2X4JA 4QVDA 3LLRA 4XU0A 3GF5A 4RMOA 2XHCA 4XK8E 3OYLA 1QP2A 3QSUA 1JB0E 3HHTB 4GLKA 4ZN3A 4JRIA 3EFRA 3MEVA 1YHQA 2RK1A 3LYIA 1DJ7B 2JNGA 5FRNA 2X4WA 1LJOA 4BI3A 2E12A 5KE3A 3DLMA 3JB9J 3CMEA 2HD0A 1HK9A 5GAN8 2O01E 5LJ3d 2PU9B 4OB2B 1LNXA 4O6JA 3RERA 3DKMA 5GMKj 1NPPA 2OAUA 3L1AA 3MO8A 4A4FA 4LD6A 1W2BA 4M7AE 3OYYA 1ZBXA 2DIGA 3OYKA 2RHYA 1KQ2A 4BI8B 4C92E 2VGMA 1VQLA 4IUUA 1D3BA 4OGEA 4JDSA 5AYFA 4J8OA 1FX7A 2MAMA 2RI2A 3OB9A 3Q1JA 1VQMT 2QEXA 1NE8A 1R8OB 2K5IA 4OB0B 1IZ6A 4KBMB 5I2SA 4E7HA 3G7ZA 1I5LA 1M1GA 2BUDA 4A4KA 2XD0A 4XTYA 1YIJT 4PKCC 1VIEA 1BI3A 2JN0A 3HKSA 2E64A 3M4GA 2MI6A 5DY9A 2QA4T 1WJSA 4J6XA 3M57A 3L2QA 3GPLA 2P0QA 1VUBA 4E47A 1KG1A 2JTMA 1IREB 3PTAA 4M77B 1MGQA 2GQVA 2XI9A 3CCRT 3JRZA 2DZCA 2KAFA 2ZPBB 3CMAT 5FU6B 4QVZA 1WJRA 3L2RA 1VQ6T 3KXTA 3C95A 3CBMA 1VQ4T 1K9MU 3X25B 2DKGA 4LDYA 4BE1A 3FLGA 5GMKm 2QQBA 4M75G 4P5NA 1U8RA 4PJOC 4F7UB 1NZ9A 1I8FA 1P92A 3OMGA 1H3ZA 3OYNA 4OGCA 3HRSA 4TVRA 3I56A 3OBWA 2DD5A 4MMLA 2RI5A 2RHUA 4PL6A 3VYGA 4C5GA 5GAMd 2GFAA 1QVGS 3CCLA 4DA4A 2R58A 1VIFA 3T9NA 5LJ3e 4M77D 3I55T 2K5LA 1KC8C 3HP9A 3QYHB 3MEWA 4RG2A 4ZN1A 3X24B 4E7LA 2CKKA 4HCCA 4ZGEB 4MMKA 3CCSA 1JBMA 1UGQB 2XKOC 5GANg 2ZPHB 2KMTA 5LJ3h 4J7FA 2OTLA 3CXCS 3SWNA 3RKYA 1H641 1VQ9A 3RESA 5HK0A 2LTOA 2MMPA 2Y4YA 3CC2A 2FB7A 5M9OA 3CC4T 1AHJB 4L6V5 5CKFA 3CCMT 2P0PA 4NL3A 2JUFA 4C0ZA 3OW2A 1M1KU 1D3BB 3CC7T 2EJFA 1BKBA 1YITA 2QTXA 4C0FA 2M16A 2KSSA 3CD6T 2EJ9A 1N9SA 3G71T 4PJOA 2VXFA 2NLUA 2JTFA 5GANe 2DXTA 5LJ5f 3V7SA 4IUTA 4M7DA 1M90U 1YJWA 3PFSA 4M75E 3CCJT 2HNIA 4FT2A 1VQPA 3HFOA 3G4ST 1UGPB 4N4IA 1VQ5A 4BE0A 3CPWS 1KQ1A 2HBPA 2M9UA 3MP6A 3A5ZB 3QBYA 4OB3B 3HRTA 4GY5A 3JCMP 2JVVA 2KY9A 1VQNA 3EFSA 4RCCA 2JOYA 1KD1U 2YLBA 5GAMe 1YJNA 2VYTA 1Q86C 3VYHB 4BACA 3M9QA 2CYZB 2ZPGB 3OYCA 1Q81U 1K73C 2ZPFB 3RMQA 2EIFA 4ZGDB 4IUQA 3CEYA 4J7IA 2L89A 2G3RA 2RK2A 3ASKA 3VJPA 5GAMh 2XG8D 1K8AU 4JLGA 4IUVA 4XTWA 2EFIA 1M5Q1 5GAN5 3OA6A 3JCMW 1NJIU 3L2WA 2P0KA 1X75C 2DAQA 2DO3A 5GMKe 2EKOA 2VGNA 2CZ0B 2F5TX 4PLIA 1YHQT 2A3LA 4YTLA 3LWHA 1JJ2S 3MP8A 3CCVT 1N8RU 4OB1B 5C6SA 5FU7C 4M77G 4PJOF 3S6WA 3OYMA 3A8OB 2B8AA 1RL2A 5CQXA 1QVFA 4D6WA 1EIFA 2H3JA 4RG8A 3FC3A 1MHNA 4N4GA 4M7DF 3OSVA 1N27A 4M78C 4ME7A 3A8LB 4L59A 3SWNB 4NL2A 4C0GA 1OZ3A 3P8BB 3OYHA 3ME9A 5FROA 1XQHA 4F7UG 3NFCA 1YI2A 2CZ6B 5LJ5g 4KULA 5CKDA 1V29B 3L2UA 5CKBA 2OTJT 5C0MA 2DEQA 4OVAA 2QI2A 2VXEA 3QKJA 4O5VA 3MP1A 1VQ7T 2QQRA 4PJOB 2EYQA 4BD3A 2RA2A 4M7DB 3N5BB 2LX9A 3OQ5A 1U1TA 1W4SA 2DXCA 1G3TA 3LH0A 3J80E 5L8RE 3JCMg 1M9SA 5D6WA 2E70A 2QA4A 5CKHA 3UT1A 4A4GA 5GAN7 1WPYA 3S3MA 1WQWA 3GNGA 1VQ8T 5DM7R 4FU6A 2HAXA 4X34A 3UWNA 4C5EA 1W2BS 5CR2A 3CMAA 3QYGB 3SWNC 3A8MB 4PJOD 2GF7A 2GCXA 4BY6C 3CC2T 4VUBA 3JB9H 1VQKA 4QQDA 4M77E 4M7DD 2LT1A 3PIPA 2XK0A 1UGRB 4M78A 3UDCA 5GANd 4X9DA 1Y96A 3BDUA 1I4K1 3AHUA 4N0AA 2E10A 5LL6S 3CMET 3DLLA 3CCUT 3F70A 2D9TA 5GAOl 4DOWA 5GMKi 2PUKB 3E9GA 3FJPA 4QW2A 1G5VA 4F7UE 1VQOT 2XIDA 4ZTFA 2DVEA 4M7DC 2EQJA 4DQ2A 1VQLT 2DTHA 5A0GA 3JCMJ 1UGSB 2QQ9A 2YHTA 3HFNA 2HQEA 3TEEA 3ZBDA 1UB4A 5LJ5j 5GAN2 5GAOn 2QEXT 1KC8U 4UC4A 2X4XA 2RHXA 2DPPB 4Y28E 2Y4XA 5CCAA 1G3SA 2FHDA 1QVGA 4BB7A 1Y71A 4MZTA 4XTZA 4JS4A 2YLCA 5KE2A 5CO7A 3S3NA 4NS5A 4BDYA 1XOVA 2PVGB 2K5FA 3QZ9B 3V8LA 1KHIA 3RKXA 4C8QA 3CD6A 4C92C 3OYEA 4HCBA 2QQSA 3L2ZA 2K3YA 4BUGA 3FIFA 3H8ZA 1QW1A 2RJEA 4M78F 4HCZA 2E65A 2BKDN 2Y90A 2CGHA 4FSXA 2X4YA 3I56T 2F69A 2HQXA 5CK9A 5DLOA 3V8KA 3CCLT 4BE2A 3TU4K 4ELYC 2R5AA 2P4TA 3TREA 1PSEA 1B34A 4EPCA 2L5QA 3J7AF 5J26A 1YJNT 5FU7B 3WVEB 4IUPA 3G6ET 1BI1A 2K3XA 2DIQA 2DTIA 5KCOA 4HKEA 2M0OA 1QVPA 1WQ7A 3PNWC 5CKEA 3ER0A 4B9XA 2MWPA 4J6YA 3CCST 4JS5A 1JRIA 4M78B 4HT8A 1XNIA 5GANh 1Y96B 1Q86U 4PJOG 3E1SA 1O75A 4A4HA 4FT4A 1K73U 2EQKA 2LRQA 2O4XA 4QQGA 3V8JA 3HL8A 4M7DG 2LQKA 3PIOA 1M1KC 1Q7YC 2K4YA 3QHSA 1VQ9T 4EDUA 1SSFA 1XTDA 1NPRA 4R56A 5FLXE 5GAOm 3CCQA 1S72A 5LJ5d 5GAOr 4M7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J6X A;  5LJ5 g;  4HT9 A;  3QSU A;  2I2L A;  2DEQ A;  2EJG A;  4C92 A;  4M77 B;  4C8Q F;  1MGQ A;  2DZ9 A;  2VXE A;  4C8Q G;  1I81 A;  2DZC A;  4JLI A;  4PJO B;  2DJZ A;  2RA2 A;  4M78 D;  5GAN 6;  4M77 C;  4M7D B;  2VC8 A;  2DKG A;  1LOJ A;  4M75 F;  4XTV A;  1U1T A;  1N9R A;  5GMK m;  4PJO C;  2RD1 A;  2K57 A;  4M75 G;  4F7U B;  3JCM d;  1I8F A;  4M78 E;  3QO3 A;  5I21 A;  3QUI A;  3JCM g;  5GAN 7;  4J5Y A;  1WPY A;  4MML A;  5GMK h;  5GAM d;  1WQW A;  3JCM b;  1BIA A;  2EAY A;  5GAM g;  2E41 A;  4C8Q B;  4EMK B;  5GAO q;  4N0A C;  4HA8 A;  3BFM A;  3INZ A;  5LJ3 e;  4M77 D;  3SWN C;  2E1H A;  3JCM Q;  5LJ3 j;  4PJO D;  3RKW A;  1WNL A;  1HXD A;  4M75 B;  3RIR A;  3JB9 H;  4MMK A;  4M77 E;  4M7D D;  1JBM A;  4M78 A;  5LJ3 f;  5GAN d;  4X9D A;  1Y96 A;  2DTO A;  4PJO E;  3BDU A;  1I4K 1;  4XU1 A;  5GAN g;  3AHU A;  4M75 C;  2E10 A;  4N0A A;  3JB9 F;  3HSB A;  4EMH A;  5LJ3 h;  3JB9 G;  1B34 B;  3BY7 A;  4M7D E;  3SWN A;  4RCB A;  3JB9 I;  4JRK A;  5GAO l;  3RKY A;  4WF2 A;  1H64 1;  5GMK i;  4M7A F;  3FJP A;  3RES A;  4F7U E;  3FB9 A;  3JCM f;  4M7A G;  5GAN 3;  2DVE A;  2FB7 A;  4JUV A;  2DXU A;  4C8Q D;  4M7D C;  4C92 F;  1BIB A;  4DQ2 A;  4NL3 A;  4C92 G;  5GAO n;  1D3B B;  5LJ5 e;  2DTH A;  4V2S A;  2EJF A;  3JCM J;  3GIB A;  2QTX A;  5LJ5 j;  2RB6 A;  2YHT A;  3HFN A;  4M77 A;  4NOY A;  4XTX A;  3RUX A;  2EJ9 A;  1N9S A;  1TH7 A;  4C8Q E;  4M75 D;  5GAN 2;  5GAO p;  2VXF A;  4PJO A;  4PNO A;  4XU2 A;  5GAN e;  2DXT A;  5LJ5 f;  5GMK l;  3V7S A;  5GAN j;  4M7D A;  4C8Q C;  4EMK C;  4M75 E;  2HNI A;  5CAI A;  3HFO A;  1YCY A;  4XTZ A;  4M7A B;  5LJ5 h;  4F7U A;  4EMG A;  2YLC A;  5GAN f;  4Y91 A;  1KQ1 A;  1U1S A;  3V7C A;  4C92 B;  2EWN A;  3BW1 A;  4M77 F;  3JCM e;  3JCM P;  2RM4 A;  3EFS A;  4RCC A;  5GAN 4;  3V8L A;  2YLB A;  3SB2 A;  4J6W A;  3RKX A;  2FYK A;  4C8Q A;  4EMK A;  5GAM e;  4C92 C;  3JCM V;  1M8V A;  3L2Z A;  5GAM j;  3FIF A;  4QVD A;  4XU0 A;  4F7U F;  4M78 F;  3JCM h;  2E65 A;  4M75 A;  4M78 G;  5GAM f;  2Y90 A;  2ZGW A;  2CGH A;  3JB9 D;  4JRI A;  3EFR A;  1LJO A;  5GAM h;  3V8K A;  4M7A D;  4XQ3 A;  4XTW A;  3JB9 J;  1HK9 A;  1M5Q 1;  5GAN 8;  5LJ3 d;  5GAN 5;  3JCM W;  4A54 A;  1B34 A;  5GMK e;  1LNX A;  4C92 D;  5LJ3 g;  3RER A;  5GMK j;  4M7A E;  3L1A A;  2DTI A;  4XU3 A;  1WQ7 A;  1KQ2 A;  4C92 E;  4HT8 A;  1X01 A;  4J6Y A;  1D3B A;  1JRI A;  4M77 G;  4M78 B;  4OP0 A;  4X9C A;  4PJO F;  1Y96 B;  5GAN h;  4A53 A;  4M7A C;  4PJO G;  3PGG A;  4M7D F;  3V8J A;  4M7D G;  4M78 C;  3SWN B;  3V7R A;  1I5L A;  4NL2 A;  4XTU A;  4XTY A;  3QHS A;  3JCM c;  3JCM X;  3VU3 C;  4F7U G;  5GAO m;  2JN0 A;  3M4G A;  5LJ5 d;  5GAO r;  2E64 A;  4M7A A;  5DY9 A;  4QVC A; 
#chains in the Genus database with same CATH topology
 3VV0 A;  1PSF A;  2EJG A;  2WSF E;  4J9B A;  1WI7 A;  4KUD K;  2OTJ Q;  2L3Q A;  4E7K A;  2VC8 A;  3JV3 A;  1VQ7 Q;  2CZ1 B;  2LVM A;  1Y57 A;  5A0D A;  5IT9 E;  4RKU E;  4PFZ A;  1RAE B;  2KXC A;  2WAC A;  2KT1 A;  2PTK A;  4BY6 B;  4KT0 E;  4J9F A;  4Z02 A;  4DOV A;  2X35 A;  3INZ A;  3M59 A;  2RQV A;  1VQ8 Q;  2ROL A;  3MJX A;  3EAE A;  3GNF B;  1QVF S;  5KYX A;  1V76 A;  3MHX A;  2D0Q B;  4IUR A;  3BDL A;  2EQU A;  2L3P A;  1YBY A;  1AOJ A;  4JPB W;  1PNJ A;  2BE9 B;  1E7O A;  1YIJ A;  4C5I A;  2KQW A;  3OYI A;  1U3O A;  2AHJ B;  1AWO A;  1UJY A;  2WSE E;  2DX1 A;  3A1P A;  1G3W A;  3RUX A;  3JB9 I;  1NYG A;  3OBY A;  4RTW A;  3CCR A;  3LX7 A;  2XDD A;  1VQL Q;  2FPD A;  4ZGJ B;  1QVG P;  3CCU A;  1VQ6 A;  1VQ4 A;  1I1J A;  3JSC A;  2V8K A;  2JZ2 A;  5LJ5 h;  2IG0 A;  2NUT A;  2C0I A;  2C0T A;  1NJI R;  1UHF A;  1D0X A;  1NG2 A;  2R5M A;  1WLP B;  3JCM V;  3THK A;  4JJN K;  1EFN A;  2HBW A;  3JCM h;  4M78 G;  3UPU A;  4OML A;  2DFU A;  4M7A D;  4KGV B;  2GGR A;  4JZ4 A;  3CCL Q;  3LW5 E;  2LCL A;  2CP3 A;  2QAZ A;  1K9M C;  2IVW A;  4J9I A;  1W1F A;  4X9C A;  2KDS A;  2DK3 A;  1OQK A;  4OMF B;  2QK0 A;  3EGU A;  3NTK A;  3V7R A;  2XU8 A;  3JCM X;  3CCJ A;  3G6E A;  3NTI A;  2BZX A;  2RNA A;  4OMP A;  1V1C A;  1X27 A;  2QQA A;  2FVU A;  4AMC A;  3EHR A;  1X6O A;  3QII A;  2K57 A;  4LDU A;  3FEO A;  5I2M A;  4M78 E;  2RQT A;  3QO3 A;  1BYM A;  4J5Y A;  2LQ8 A;  4LD9 K;  1BIA A;  4FW2 A;  1ARK A;  1MMA A;  3WXM B;  4OMM A;  4FL6 A;  5LJ3 j;  1OYX A;  2CP0 A;  1ZQ1 A;  5CIU A;  1WNL A;  3MEA A;  3J81 E;  2MWO A;  1KC8 R;  3S3O A;  1NBE B;  1JXO A;  3AT1 B;  1SPK A;  2M02 A;  3O5Z A;  4AG1 C;  2PVO B;  3H0F A;  1JJ2 A;  4OMQ A;  1Q81 C;  2RB6 A;  5IXB A;  4M77 A;  2LDM A;  2ZPI B;  1YWP A;  5KCH A;  2R57 A;  5GMK l;  2XMF A;  2CP2 A;  3EGX A;  1N5Z A;  4F7U A;  4R55 A;  1KQS S;  4EIK A;  3TCJ A;  2RI3 A;  1M90 R;  1K9A A;  2FZK B;  2CH4 W;  4LNP A;  2VV5 A;  2X4J A;  2KYM A;  3GF5 A;  4XK8 E;  1KD1 R;  1QP2 A;  4AFS C;  1JB0 E;  1OV3 A;  3HHT B;  4GLK A;  3EFR A;  5FRN A;  2X4W A;  2HL5 C;  3CME A;  1UDL A;  2HD0 A;  2DJQ A;  4AFU C;  4JJD A;  2DBM A;  1VOM A;  1NPP A;  4A4F A;  2YSQ A;  1W2B A;  3OYY A;  1RAA B;  2RMO A;  1K8A R;  4IUU A;  1D3B A;  3NMZ C;  2MAM A;  2RI2 A;  2GQI A;  3OB9 A;  1SRL A;  1NE8 A;  2QEX A;  4KBM B;  3H0H A;  4A4K A;  1H8K A;  5IH2 A;  2JN0 A;  1UHC A;  1UFF A;  2E64 A;  2MI6 A;  1WJS A;  2YUQ A;  3M57 A;  1JO8 A;  4J6X A;  3GPL A;  2P0Q A;  4E47 A;  1KG1 A;  1IRE B;  2IPO B;  3E2U A;  3TSZ A;  1GBQ A;  4LDY A;  3FLG A;  1ZUY A;  1I8F A;  2RF0 A;  3OYN A;  3HRS A;  3I56 A;  1IXD A;  1RLQ C;  4C5G A;  1IRX A;  1NM7 A;  2GFA A;  2KRS A;  3VS5 A;  3VS2 A;  5LJ3 e;  2DL7 A;  2FZC B;  2K5L A;  2CSI A;  4RG2 A;  4ZN1 A;  1Y0M A;  2HZY A;  3CCS A;  1KJW A;  1OEB A;  1IGU A;  2ZPH B;  4J7F A;  4AFZ C;  3RKY A;  5HK0 A;  2FB7 A;  3CCM T;  5CKF A;  3CC7 T;  2P0P A;  2KEA A;  1AZG B;  2QTX A;  3KFV A;  3NHN A;  2EJ9 A;  5KYU A;  3G71 T;  2NLU A;  2JTF A;  1RLP C;  2DXT A;  5LJ5 f;  1KIK A;  1YWO A;  1M90 U;  1QWE A;  1HSQ A;  2MCN A;  3HFO A;  2LNH B;  3CPW S;  3QBY A;  3MP6 A;  3A5Z B;  1AWW A;  3HRT A;  1VQN A;  2KY9 A;  1KD1 U;  3ZL7 C;  1T0H A;  2CYZ B;  2ZPF B;  4DBQ A;  4IUQ A;  1IGQ A;  2G3R A;  2ABL A;  3VJP A;  5GAM h;  1K8A U;  1QCO A;  1WHM A;  2DAQ A;  2DO3 A;  1W2B P;  2L2P A;  2VGN A;  2DA9 A;  3LWH A;  5EC7 A;  1M2O A;  5C6S A;  1AEY A;  1BBZ A;  2O2O A;  1C6V X;  1M2V B;  3S6W A;  3OYM A;  1RL2 A;  3RDV A;  3H9N A;  1SG5 A;  2P4R A;  1MHN A;  4L59 A;  2HEQ A;  1XQH A;  4DEX A;  3NFC A;  1K73 R;  2AKL A;  1YI2 A;  4KUL A;  1OU9 A;  3L2U A;  5CKB A;  1OX9 A;  4PJO B;  4X1V A;  2FO0 A;  4ESR A;  2RA2 A;  1Z9Q A;  2DXC A;  1G3T A;  2EYZ A;  3EG3 A;  2DER A;  1K76 A;  5GAN 7;  3VRZ A;  4D8D A;  2HAX A;  4X34 A;  1BB9 A;  5CR2 A;  3G1J A;  4LXC A;  4PJJ A;  4ORZ A;  3CC2 T;  4M7D D;  1GCP A;  2LT1 A;  2XK0 A;  2F1L A;  4N0A A;  2JM9 A;  5LL6 S;  3DLL A;  2DEU A;  4LUD A;  3F70 A;  2D9T A;  1VQO T;  2EQJ A;  2EW3 A;  4JZ3 A;  4DQ2 A;  1GFD A;  2QQ9 A;  3TEE A;  2YHT A;  5GAO n;  1UB4 A;  5GAN 2;  1M3C A;  3CCM Q;  3CC7 Q;  2DPP B;  4Y28 E;  3I5R A;  2D8J A;  3G71 Q;  4MZT A;  4XTZ A;  1PC0 A;  4E7Z A;  5KE2 A;  2A08 A;  2K5F A;  4C92 C;  3OYE A;  3L2Z A;  3FIF A;  2GTJ A;  3PVQ A;  1QLY A;  3EHQ A;  3H8Z A;  2RJE A;  4HCZ A;  2Y90 A;  2F69 A;  4BE2 A;  5CK9 A;  3V8K A;  2DL4 A;  3TRE A;  1B34 A;  4EPC A;  3J7A F;  2O9V A;  2BTT A;  2K3X A;  2DIQ A;  2LJ1 A;  2DTI A;  1ZSZ C;  3EFO A;  4HKE A;  1QVP A;  1VYU A;  5CKE A;  1UUE A;  2MWP A;  2NWM A;  4J6Y A;  1XNI A;  3CCE Q;  4PJO G;  3E1S A;  1O75 A;  1PCX A;  1K73 U;  2LRQ A;  3QHS A;  1SSF A;  3FJ5 A;  2V1R A;  5GAO m;  1S72 A;  2BE7 D;  4LN2 A;  4M7A A;  1FYN A;  4RUG A;  2KBT A;  2CP6 A;  2KI7 A;  4JRQ A;  3QSU A;  1BI2 A;  2COW A;  4Q5W A;  8AT1 B;  3SDZ A;  2DZ9 A;  1SHG A;  2KXD A;  1UGV A;  2KR3 A;  5GAN 6;  3H6Z A;  1YJW T;  1N9R A;  1Y7X A;  2QXF A;  2M1H A;  2WSC E;  2RJF A;  1VQ5 T;  2QGG A;  1HYO A;  3REB B;  2RQR A;  5GAO q;  1ZUU A;  4N0A C;  2ENM A;  2KT8 A;  1ACM B;  4J83 A;  3C94 A;  1Q7Y R;  2RJD A;  3LH5 A;  2O9S A;  2ED1 A;  3ZEH A;  2E6Z A;  3CQT A;  2C06 A;  2DTO A;  4PJO E;  4FSS A;  1TWB A;  2DL5 A;  4II1 A;  4M75 C;  3CC2 Q;  3C4S A;  1K4U S;  2MIO A;  2HKN A;  3UA7 A;  4M7A F;  1Q95 G;  2E3H A;  4C8Q D;  5IHN A;  3LWI A;  2RO0 A;  1Q82 R;  5GJV B;  5HCK A;  2A0F B;  3GIB A;  4A4E A;  2LJ3 A;  4PLL A;  2CH4 A;  1E6H A;  4C0D C;  4PNO A;  2J06 A;  3MCA B;  4CI0 C;  3GP8 A;  4QT7 A;  1YCY A;  1VQO A;  5GAN f;  1X6G A;  1TG0 A;  5FW9 A;  1PD0 A;  2RM4 A;  2O31 A;  3SFM A;  3SB2 A;  4J6W A;  3M55 A;  4ZTJ A;  3GOX A;  4IKF A;  1TOV A;  2E4H A;  2L8D A;  3I55 A;  5KH6 A;  5HKC A;  3EG9 B;  5GAM f;  3JB9 D;  2ZZD A;  3TQ7 P;  1R0C B;  1ZX6 A;  2DYB A;  5IHI A;  2ECZ A;  1JU5 C;  4C92 D;  1KHC A;  1M3A A;  2X9H A;  3A98 A;  2EBP A;  3CC4 A;  4E7I A;  1VQK T;  2CDT A;  5KYX B;  1X01 A;  2PVD B;  4M7A C;  4OP0 A;  3JAM E;  1Z9Z A;  2YRV A;  1Y07 A;  2LQN A;  3CXC A;  2OTL Q;  3OS5 A;  3ULR B;  2OI3 A;  4QVC A;  5HY6 A;  4HT9 A;  1NEB A;  4JLI A;  2RJC A;  4HCK A;  1I5O B;  1LOJ A;  3KUF A;  1OU8 A;  5FU6 C;  2NUT B;  5I21 A;  2J6F A;  1YJW Q;  1Q7Y U;  3OYD A;  1K0S A;  1D0Z A;  2Z0W A;  2QTV A;  1VQ5 Q;  2AZS A;  4E6R A;  2DL8 A;  2E1H A;  2EGE A;  3UAT A;  2K2V A;  3RIR A;  1A0N B;  4HVV A;  2GFU A;  1M90 C;  3QG1 A;  4FM4 B;  3M58 A;  1Q82 U;  4EMH A;  1AWX A;  1GCQ C;  2M0Y A;  1KD1 C;  1M30 A;  3VUB A;  2K2M A;  1RI0 A;  2W10 A;  1QKX A;  2LQW A;  3MEU A;  2OTJ A;  4M75 D;  1VQ7 A;  4XU2 A;  1ZHI A;  3MKD A;  3OYG A;  1HJD A;  1PRM C;  2JXB A;  1BK2 A;  1K8A C;  3CCQ T;  1H3H A;  3V7C A;  3C12 A;  3ZFJ A;  2D6F A;  1RAD B;  1VQ8 A;  2FYK A;  2ZAE A;  4ZNX A;  4RMO A;  1MMD A;  2XHC A;  1QKW A;  3OYL A;  1Q86 R;  5GJW B;  3MEV A;  2RK1 A;  3LYI A;  1QCF A;  4JJB A;  1YIJ Q;  1AT1 B;  3JB9 J;  1HK9 A;  2O01 E;  4OB2 B;  2QA4 Q;  2EYY A;  1WYX A;  4O6J A;  2CP5 A;  4LD6 A;  3PVL A;  2RHY A;  3CMA Q;  1VQL A;  1VQ6 Q;  5AYF A;  2NUZ A;  1WA7 A;  1FX7 A;  1AVZ C;  1VQM T;  1R8O B;  5D7U A;  4OB0 B;  1VQK Q;  4A63 B;  3G7Z A;  3CXC P;  2XD0 A;  4XTY A;  3MPU B;  1VIE A;  3M4G A;  1VUB A;  2JTM A;  4M77 B;  2KAF A;  1SHF A;  2ZPB B;  1WJR A;  3L2R A;  3KXT A;  4RTZ A;  5I11 A;  2FG0 A;  3EGX B;  4F7U B;  1H92 A;  1P92 A;  1UG1 A;  5IXF A;  1H3Z A;  1C0M A;  3OBW A;  2RHU A;  4PL6 A;  1GFC A;  3VYG A;  3CCL A;  1QCN A;  3T9N A;  2PZ1 A;  2CSQ A;  3CD6 Q;  3X24 B;  2CKK A;  4HCC A;  1RI9 A;  2CRE A;  1JBM A;  1UGQ B;  2XKO C;  4FYV B;  4IIO A;  5LJ3 h;  2X3W D;  1GRI A;  1H64 1;  1VQ9 A;  3RES A;  1PD1 A;  2LTO A;  2MMP A;  2VWF A;  4L6V 5;  4NL3 A;  4C0Z A;  1D3B B;  2EJF A;  1BKB A;  1KK7 A;  4C0F A;  3VS6 A;  3VS1 A;  2YWW A;  4PJL A;  2EGA A;  3EG2 A;  1X69 A;  4M7D A;  3PFS A;  1ZLM A;  2HNI A;  3G4S T;  1UGP B;  1I07 A;  4N4I A;  2M9U A;  4OB3 B;  3CCQ Q;  1QVF P;  2AT1 B;  1ZBJ A;  3EFS A;  4RCC A;  2YLB A;  2EKH A;  3VYH B;  4BAC A;  3OYC A;  1GBR A;  1K73 C;  2EIF A;  1IB8 A;  2EGC A;  4JLG A;  4IUV A;  1NJI U;  2V26 A;  3L2W A;  3TSW A;  1X75 C;  1R77 A;  1YNZ A;  4PLI A;  1YHQ T;  2A3L A;  1JJ2 S;  3CCV T;  3VS4 A;  5FU7 C;  4M77 G;  2FRW A;  2F2W A;  5CQX A;  4D6W A;  1EIF A;  4RG8 A;  1TUC A;  4N4G A;  4M7D F;  4M78 C;  4PFP A;  3P8B B;  3C0C A;  1VQM Q;  4F7U G;  5LJ5 g;  1V29 B;  2DEQ A;  4OVA A;  2VXE A;  3QKJ A;  1G2B A;  5KYU B;  2QQR A;  5FWB A;  3N5B B;  2LX9 A;  3M0U A;  3QDF A;  3CME Q;  4HVW A;  3J80 E;  3JCM g;  1WHH A;  2EPD A;  1WPY A;  2X51 A;  5DM7 R;  3M0P A;  4FU6 A;  4R0K A;  2KRO A;  4PJM A;  5KYY B;  1S1N A;  1W2B S;  2CP7 A;  3QYG B;  2GF7 A;  4BY6 C;  1QQJ A;  1RAG B;  4M77 E;  2YUN A;  3UDC A;  4X9D A;  1Y96 A;  3BDU A;  1I4K 1;  4KGX B;  3D7S B;  4DOW A;  5GMK i;  1K0X A;  4QW2 A;  1G5V A;  4F7U E;  4M7D C;  3RR6 A;  5A0G A;  1KC8 U;  4UC4 A;  2X4X A;  1PM3 A;  3I56 Q;  1B07 A;  1IO6 A;  4WTO B;  2CT3 A;  1SF9 A;  4FW1 A;  1NLO C;  2HDA A;  4RTX A;  3G4S Q;  3V8L A;  1KHI A;  1UE9 A;  4C8Q A;  4HCB A;  1SRM A;  1QMC A;  2BKD N;  1OUL A;  2BZY A;  4ELY C;  4PFO A;  2L5Q A;  1W70 A;  1YJ9 Q;  2M0O A;  1WQ7 A;  4B9X A;  4HT8 A;  5AT1 B;  1JRI A;  5GAN h;  2SRC A;  1YHQ Q;  3CCV Q;  2O4X A;  2LQK A;  1Q7Y C;  2K4Y A;  2L0A A;  4Z8A A;  2QAS A;  1VQN Q;  5FLX E;  5LJ5 d;  1YIT T;  4C92 A;  4C8Q F;  1FWZ A;  2C0O A;  4J9C A;  2YRC A;  2DJZ A;  4M78 D;  3CCE T;  1VQP T;  4CRI A;  1Q82 C;  3JCM d;  3O8V A;  3QUI A;  3CBO A;  2ZPE B;  3REA B;  5GMK h;  1YJN T;  1ZSZ A;  3URG A;  3QPH A;  2B86 A;  1WJQ A;  1G83 A;  1M1K R;  2JS2 A;  3JCM Q;  2V8J A;  5LJ3 f;  5HK3 A;  2LP5 A;  3OSS C;  3JB9 F;  3HSB A;  1BU1 A;  1B34 B;  2DLP A;  1YI2 Q;  1OZ2 A;  4JRP A;  3EFO B;  3EG1 A;  3M56 A;  4JUV A;  4L5G A;  5CVI A;  1FMV A;  4C92 F;  2XDP A;  1BCM A;  2ROT A;  4XTX A;  3A8G B;  1TH7 A;  2D1X A;  4C8Q C;  3EH2 A;  1WIE A;  1RUW A;  2K9G A;  4M7A B;  3KBG A;  4EMG A;  2M51 A;  4MDW A;  4Y91 A;  2V8I A;  2EWN A;  2HSE B;  1M1F A;  2DD4 A;  4XAX B;  2PUO B;  3X26 B;  4F14 A;  4EMK A;  1WHJ A;  4E7J A;  3M54 A;  3FDR A;  3BE3 A;  1AWJ A;  4M75 A;  1QWF A;  2LX7 A;  2A28 A;  4ATO A;  2RHZ A;  2PQW A;  4GBQ A;  2DVJ A;  3NPF A;  3A8H B;  4XU3 A;  4CC7 A;  3R6N A;  3CC7 A;  3CCM A;  2KK4 A;  3PGG A;  3G71 A;  2ZCF B;  1QP3 A;  4XTU A;  3OMC A;  1AZE A;  3JCM c;  3GLX A;  2JM8 A;  3PT9 A;  3VU3 C;  3M0Q A;  4MZM A;  2OAW A;  2HMA A;  2PNI A;  3LGF A;  1G3Y A;  1OPL A;  3DB4 A;  3NTH A;  1YIT Q;  1AD5 A;  4MDX A;  2RH2 A;  2CUD A;  2L3S A;  3PE0 A;  4MZP A;  3OW2 S;  4M75 F;  3WVD B;  1ABQ A;  2MOX A;  1VA7 A;  2RD1 A;  2VUB A;  5DLQ E;  3P8H A;  1GXI E;  4D8K A;  2EQM A;  1VQP Q;  4CC4 B;  2OTL T;  4WCI A;  2XDB A;  5GAM g;  2E41 A;  3BFM A;  4E2F B;  1N6A A;  1HD3 A;  3CCE A;  1YJN Q;  2KVQ G;  4LDX A;  3M5A A;  1RAF B;  6AT1 B;  3DB3 A;  2LT4 A;  2QDL A;  5D6Y A;  1X43 A;  4FIB A;  4RCB A;  2L3R A;  4JRK A;  3NGP A;  4Z88 A;  3OYB A;  3QXE B;  2K7A A;  2KRM A;  3VS7 A;  3FB9 A;  4M7A G;  5GAN 3;  2DXU A;  3R6O A;  1BIB A;  2P84 A;  3L42 A;  1M8V A;  1M4Z A;  5KYW A;  5GAO p;  2BIV A;  4EMK C;  4DBR A;  5CAI A;  1NJI C;  5L23 A;  3OS0 A;  1NLP C;  2RPN A;  2CZ7 B;  3HRU A;  4PJN A;  3E19 A;  2DXB A;  4OMN A;  1MMN A;  2HSP A;  2ATC B;  3PMT A;  5KYN A;  4XU0 A;  4ZN3 A;  3CC2 A;  1SEM A;  1GCQ A;  2JNG A;  1MMG A;  5KE3 A;  1T0J A;  2E12 A;  4BI3 A;  3DLM A;  5GAN 8;  1TUD A;  3RER A;  4M7A E;  4BI8 B;  4JDS A;  3Q1J A;  5I2S A;  4E7H A;  1M1G A;  2BUD A;  1N8R R;  4RTT A;  1YIJ T;  3HKS A;  3I9Q A;  5DY9 A;  2QA4 T;  3VS3 A;  3L2Q A;  2KYB A;  1MGQ A;  3CCR T;  3CMA T;  4QVZ A;  1VQ6 T;  1VQ4 T;  2KRN A;  3CBM A;  3X25 B;  4BE1 A;  2CUB A;  5GMK m;  4PK4 A;  4PJO C;  4P5N A;  1U8R A;  3OMG A;  2HQH A;  4OGC A;  1M8M A;  2ESW A;  4MML A;  2RI5 A;  5GAM d;  1QVG S;  4KH0 B;  1FMK A;  1ABO A;  1VIF A;  1KC8 C;  3HP9 A;  3QYH B;  2KGT A;  2DET A;  4E7L A;  4ZGE B;  4MMK A;  1JEG A;  1TUG B;  3CXC S;  2OTL A;  3SWN A;  1G8X A;  2Y4Y A;  2KNB B;  1AHJ B;  3CD6 T;  1N9S A;  2J6O A;  4IUT A;  1YJW A;  2JW4 A;  3CCJ T;  4FT2 A;  1VQ5 A;  4BE0 A;  1KQ1 A;  2HBP A;  2YUO A;  4GY5 A;  2JOY A;  2LZ6 B;  2BZ8 A;  2JS0 A;  1WX6 A;  2ZPG B;  1SKU B;  1D1A A;  4ZGD B;  3VS0 A;  2FPE A;  1OX8 A;  1ZSG A;  2XG8 D;  1CKA A;  4XTW A;  2EFI A;  2YXY A;  5GAN 5;  3JCM W;  2P0K A;  2GBQ A;  2EKO A;  2F5T X;  4RTY A;  2LCS A;  4YTL A;  2A36 A;  3MP8 A;  3QWX X;  1N8R U;  3EG9 A;  1PKT A;  2NUP A;  2B8A A;  1QVF A;  3OSV A;  1N27 A;  1NYF A;  4NL2 A;  2H8H A;  1D1C A;  3OYH A;  5FRO A;  2CZ6 B;  4AT1 B;  1WZO A;  1PHT A;  5C0M A;  2I0N A;  4O5V A;  1LPL A;  4M7D B;  3CCR Q;  3OQ5 A;  2EQI A;  3CCU Q;  1WHG A;  1VQ4 Q;  5L8R E;  5D6W A;  2QA4 A;  5CKH A;  4A4G A;  1WDX A;  3EGD A;  1WQW A;  4FYY B;  3UWN A;  1E6G A;  3CMA A;  3SWN C;  3A8M B;  2QYZ A;  4PJO D;  1RAH B;  2GCX A;  4J9H A;  8ATC B;  4VUB A;  3JB9 H;  1VQK A;  2YDL A;  3PIP A;  1UGR B;  4M78 A;  2JMC A;  3AHU A;  2E10 A;  3CME T;  1ZA2 B;  1IHV A;  2DMO A;  2D0N A;  2AK5 A;  5GAO l;  3FJP A;  2XID A;  3SHW A;  2DTH A;  3JCM J;  4F16 A;  2AKK A;  5LJ5 j;  2YUP A;  2QEX T;  2K6D A;  1WHL A;  2RHX A;  1G3S A;  2FHD A;  4JS4 A;  2YLC A;  3S3N A;  5CO7 A;  4BDY A;  3CCJ Q;  3UF4 A;  3G6E Q;  3QZ9 B;  2RQW A;  1XJW B;  3RKX A;  3CD6 A;  2QQS A;  1VYT A;  4BUG A;  1UEC A;  4RTV A;  4M78 F;  2YRD A;  2X4Y A;  3I56 T;  2K3B A;  1VQ9 Q;  1D09 B;  5DLO A;  2P4T A;  1PSE A;  4IIM A;  4J9D A;  2HL3 A;  4JS5 A;  3CCS T;  4KH1 B;  1TSF A;  1T3S A;  1Y96 B;  4CC2 A;  1Q86 U;  4A4H A;  4FT4 A;  2EQK A;  4QQG A;  3V8J A;  1ZUK A;  3HL8 A;  4LE9 A;  4M7D G;  2F2X A;  1M1K C;  1LVK A;  1CKB A;  2GTO A;  1XTD A;  1NPR A;  3CCQ A;  1UTI A;  2X3X D;  4AFQ C;  1YJ9 T;  5EG2 A;  2I2L A;  3GBQ A;  1UJ0 A;  3RMS A;  5A0L A;  1TS9 A;  4XTV A;  2JJ9 A;  3SEM A;  2CT4 A;  3OY9 A;  2VVK A;  1VQN T;  1KQS A;  1WGS A;  2EAY A;  2MYS A;  3P8D A;  4C8Q B;  2DNU A;  3PMI A;  5IAY A;  4B9W A;  2A7Y A;  1HXD A;  2DYI A;  4N4H A;  4V2S A;  3I5S A;  1VQM A;  1MND A;  1J3T A;  4M7D E;  2LCC A;  1GL5 A;  3EH1 A;  1ZA1 B;  2LJ0 A;  3QZ5 B;  5LJ5 e;  2O4X B;  1MNE A;  5IN1 A;  1B3Q A;  1UEB A;  2CS7 A;  2G6F X;  3QJ6 A;  4OF1 A;  2QEX Q;  4KUI A;  2MF2 A;  1YI2 T;  3MET A;  4KRT A;  3OYJ A;  4E7S A;  3JCM e;  1U1S A;  4C92 B;  4M77 F;  2HKQ B;  3X20 B;  1YCS B;  4LDW A;  3SD4 A;  1RAI B;  2JT4 A;  3VKI A;  1YFN A;  4F7U F;  3M53 A;  2RHI A;  1TTH B;  2DF6 A;  2ZGW A;  4QQ6 A;  2OJ2 A;  5J3B A;  5FRM A;  3E9F A;  4AG2 C;  2H3E B;  1MV3 A;  1RAB B;  1FXX A;  4XQ3 A;  3TVT A;  3X28 B;  1ZSZ B;  4A54 A;  5LJ3 g;  5IHK A;  3M4Y A;  1JXM A;  1YN8 A;  5ECA A;  4A53 A;  5D6X A;  3CCS Q;  5CQY A;  2E5K A;  4JJC A;  2XIC A;  1O9S A;  3OS2 A;  3G4S A;  2DBK A;  5A2Q E;  1CSK A;  2FL7 A;  2LNV A;  5J39 A;  4BDZ A;  4C8Q G;  1I81 A;  3CPF A;  4CC3 A;  3HPW A;  3CBP A;  1OPK A;  4M77 C;  7AT1 B;  1B7T A;  4J9G A;  2COY A;  2J6K A;  4ELZ C;  2RQU A;  2VAS A;  2DM1 A;  1JJ2 P;  1KQS P;  1K9M R;  2EYW A;  1YJ9 A;  3CPW A;  3JCM b;  2DIL A;  3OYA A;  2QGF B;  1PWT A;  4EMK B;  4HA8 A;  4FYW B;  2EVR A;  3QDR B;  3VUZ A;  3RKW A;  1YHQ A;  3L2V A;  4M75 B;  3CCV A;  1OI1 A;  1WXB A;  1WFW A;  1BI0 A;  4XU1 A;  1K1Z A;  3JB9 G;  4LDV A;  3BY7 A;  2E6N A;  4Y92 A;  4WF2 A;  5KYY A;  2V1Q A;  3JCM f;  2LC4 A;  3OS1 A;  1MV0 B;  3FRN A;  2KE9 A;  4C92 G;  4C0D B;  3UA6 A;  4NOY A;  4BI4 A;  4C8Q E;  1D0Y A;  2F5K A;  1WHK A;  4ANJ A;  1VYV A;  4HXJ A;  5GAN j;  2QDY B;  1C1A A;  1S72 T;  3QJY A;  1YP5 A;  4C5H A;  3LGL A;  3BW1 A;  2E5Q A;  3OYF A;  5GAN 4;  1N8R C;  5GAM j;  4KGZ B;  3LLR A;  4QVD A;  4F17 A;  1D1B A;  4JRI A;  1DJ7 B;  1LJO A;  4LUE A;  1Q81 R;  3I35 A;  5LJ3 d;  2PU9 B;  4K11 A;  1LNX A;  3DKM A;  3H41 A;  5GMK j;  2OAU A;  3L1A A;  3MO8 A;  2JMA A;  1ZBX A;  2DIG A;  3OYK A;  1KQ2 A;  4C92 E;  2VGM A;  2EYX A;  4Z89 A;  4OGE A;  4J8O A;  3IQL A;  2K5I A;  1IZ6 A;  1I5L A;  4PKC C;  1BI3 A;  1U06 A;  5I22 A;  2DRM A;  3PTA A;  2GQV A;  2IIM A;  2XI9 A;  5KYW B;  3JRZ A;  2DZC A;  5FU6 B;  1K9M U;  3C95 A;  1BCO A;  2DKG A;  2MK5 A;  2QQB A;  4M75 G;  1RAC B;  1NZ9 A;  2MPX C;  4TVR A;  2JTE A;  3CPW P;  2DD5 A;  1IHW A;  4DA4 A;  1KSW A;  2R58 A;  4M77 D;  3I55 T;  1WXT A;  1X2Q A;  3MEW A;  1I0C A;  1M2V A;  5GAN g;  2KMT A;  1FMW A;  5M9O A;  3CC4 T;  1M1K U;  3OW2 A;  2JUF A;  1TXQ A;  3M0T A;  2W0Z A;  1YIT A;  2M16 A;  2KSS A;  3EG0 A;  2VXF A;  4PJO A;  5GAN e;  2DRK A;  3H0I A;  3V7S A;  2DL3 A;  2SEM A;  4M75 E;  1VQP A;  1KFZ A;  2VKN A;  1X2K A;  1S72 Q;  3JCM P;  2A37 A;  2E3I A;  2JVV A;  2ED0 A;  5GAM e;  2HCK A;  5FWC A;  1YJN A;  2VYT A;  1Q86 C;  3VRY A;  3M9Q A;  1Q81 U;  4B6M A;  3RMQ A;  3CEY A;  4J7I A;  2L89 A;  1F1B B;  2RK2 A;  4QKU A;  3ASK A;  1M5Q 1;  3OA6 A;  5GMK e;  2CZ0 B;  3U23 A;  4OB1 B;  4PJO F;  3A8O B;  3FC3 A;  2H3J A;  3M0S A;  3QWY A;  4ME7 A;  3SWN B;  3A8L B;  4C0G A;  1OZ3 A;  3ME9 A;  1WXU A;  5CKD A;  2OTJ T;  2YT6 A;  2QI2 A;  3MP1 A;  1VQ7 T;  2EYQ A;  4BD3 A;  1W6X A;  4J9E A;  1U1T A;  1W4S A;  1MUZ A;  3LH0 A;  4DBF A;  1M9S A;  2E70 A;  2J05 A;  3UT1 A;  4FCY A;  1EZZ B;  1TU0 B;  1NEG A;  3S3M A;  1SSH A;  2DE0 X;  3GNG A;  1VQO Q;  1VQ8 T;  2LMJ A;  4GLM A;  4C5E A;  1PKS A;  2K79 A;  2O88 A;  2J7I A;  3RNJ A;  4QQD A;  4HVU A;  2F2V A;  1X6B A;  3I55 Q;  5GAN d;  3CCU T;  1R0B G;  2AZV A;  2PUK B;  1U5S A;  3E9G A;  1OOT A;  3OW2 P;  4ZTF A;  2DVE A;  1VQL T;  4F04 B;  2VB6 A;  2AIR B;  2NUP B;  1UGS B;  3ZBD A;  3HFN A;  2HQE A;  2D8H A;  3CC4 Q;  3RBB B;  2NYS A;  2COZ A;  2FEI A;  1JQQ A;  2QG9 B;  2Y4X A;  5CCA A;  1QVG A;  4BB7 A;  1T3L A;  1Y71 A;  1LCK A;  1M27 C;  4NS5 A;  1XOV A;  2OX7 A;  2PVG B;  4M4Z A;  4RTU A;  2K3Y A;  4DEY A;  2RN8 A;  1QW1 A;  2E65 A;  4DBH A;  2FRY A;  2CGH A;  3HTR A;  4FSX A;  3EGD B;  2HQX A;  3TU4 K;  3CCL T;  1M3B A;  2R5A A;  1PG5 B;  5J26 A;  5FU7 B;  3WVE B;  4IUP A;  3G6E T;  1BI1 A;  4OMO A;  3M0R A;  5KCO A;  3PNW C;  3ER0 A;  9ATC B;  4M78 B;  1PRL C;  1EX4 A;  2GNC A;  3PIO A;  4FYX B;  1VQ9 T;  4EDU A;  4R56 A;  5GAO r;  2FZG B;  2FPF A; 
#chains in the Genus database with same CATH homology
 1YJ9 T;  5EG2 A;  3VV0 A;  4JRQ A;  2I2L A;  1BI2 A;  1PSF A;  2EJG A;  4Q5W A;  3SDZ A;  2WSF E;  4C8Q F;  1FWZ A;  2DZ9 A;  4C92 A;  3RMS A;  5A0L A;  4KUD K;  2DJZ A;  4M78 D;  5GAN 6;  4E7K A;  3CCE T;  3H6Z A;  2VC8 A;  1YJW T;  4XTV A;  1N9R A;  1VQP T;  1Y7X A;  2CZ1 B;  2LVM A;  2QXF A;  4CRI A;  2M1H A;  5A0D A;  1Q82 C;  3JCM d;  3OY9 A;  5IT9 E;  2WSC E;  3O8V A;  2RJF A;  3CBO A;  3QUI A;  4RKU E;  1VQ5 T;  2ZPE B;  1VQN T;  1KQS A;  5GMK h;  1WGS A;  2EAY A;  3P8D A;  2WAC A;  4C8Q B;  3URG A;  3QPH A;  5GAO q;  4N0A C;  3PMI A;  4KT0 E;  4BY6 B;  4Z02 A;  4DOV A;  5IAY A;  1WJQ A;  2X35 A;  3INZ A;  3M59 A;  4J83 A;  3C94 A;  4B9W A;  2RJD A;  3JCM Q;  2A7Y A;  2V8J A;  1HXD A;  3EAE A;  3GNF B;  3ZEH A;  1QVF S;  3MHX A;  4N4H A;  2E6Z A;  5LJ3 f;  2C06 A;  2D0Q B;  4V2S A;  2DTO A;  4IUR A;  4PJO E;  3BDL A;  5HK3 A;  1VQM A;  3OSS C;  2EQU A;  4II1 A;  4M75 C;  3JB9 F;  3C4S A;  1YIT T;  1YBY A;  3HSB A;  4M7D E;  1B34 B;  2LCC A;  1OZ2 A;  4JRP A;  4M7A F;  1YIJ A;  3M56 A;  4JUV A;  4L5G A;  5CVI A;  2KQW A;  4C5I A;  2XDP A;  4C8Q D;  4C92 F;  3QZ5 B;  3LWI A;  2RO0 A;  3OYI A;  5LJ5 e;  2AHJ B;  3GIB A;  4A4E A;  2WSE E;  1G3W A;  4XTX A;  3RUX A;  3JB9 I;  3A8G B;  1TH7 A;  3OBY A;  4PLL A;  3LX7 A;  2O4X B;  2XDD A;  3CCR A;  5IN1 A;  4PNO A;  4C0D C;  3MCA B;  4ZGJ B;  3CCU A;  1UEB A;  2CS7 A;  1VQ4 A;  1VQ6 A;  3QJ6 A;  4C8Q C;  4OF1 A;  3JSC A;  4CI0 C;  2V8K A;  2JZ2 A;  3GP8 A;  4KUI A;  5LJ5 h;  1YCY A;  2MF2 A;  4M7A B;  2IG0 A;  3KBG A;  1VQO A;  3MET A;  4EMG A;  1YI2 T;  5GAN f;  3OYJ A;  4MDW A;  4Y91 A;  1U1S A;  3JCM e;  4C92 B;  2V8I A;  2EWN A;  4M77 F;  2RM4 A;  1M1F A;  2DD4 A;  4XAX B;  2PUO B;  3X20 B;  3SFM A;  3SB2 A;  4J6W A;  3M55 A;  3X26 B;  2R5M A;  4EMK A;  4LDW A;  3GOX A;  3JCM V;  4ZTJ A;  4IKF A;  3SD4 A;  3M54 A;  4E7J A;  2L8D A;  3VKI A;  4JJN K;  3I55 A;  5KH6 A;  3FDR A;  5HKC A;  4F7U F;  3M53 A;  3JCM h;  4M75 A;  4M78 G;  2RHI A;  5GAM f;  2ZGW A;  5J3B A;  3UPU A;  2ZZD A;  4QQ6 A;  3JB9 D;  5FRM A;  3E9F A;  4M7A D;  1FXX A;  4XQ3 A;  3X28 B;  4A54 A;  4ATO A;  4C92 D;  1KHC A;  5LJ3 g;  3M4Y A;  2RHZ A;  3LW5 E;  2PQW A;  2LCL A;  3CC4 A;  3A8H B;  4XU3 A;  3CCM A;  4E7I A;  3CC7 A;  2IVW A;  1K9M C;  1VQK T;  1X01 A;  2KK4 A;  4X9C A;  2PVD B;  2KDS A;  4OP0 A;  4M7A C;  3JAM E;  4A53 A;  2DK3 A;  4OMF B;  5D6X A;  2YRV A;  3PGG A;  3NTK A;  3G71 A;  3V7R A;  2ZCF B;  2XU8 A;  1QP3 A;  4XTU A;  3OMC A;  3JCM c;  3GLX A;  3PT9 A;  1Y07 A;  5CQY A;  3VU3 C;  3JCM X;  2XIC A;  3CXC A;  3CCJ A;  1O9S A;  3OS2 A;  3G6E A;  3G4S A;  3NTI A;  3OS5 A;  4QVC A;  5HY6 A;  4HT9 A;  4MZM A;  5A2Q E;  2FL7 A;  2LNV A;  3LGF A;  5J39 A;  1G3Y A;  4BDZ A;  3DB4 A;  4C8Q G;  2QQA A;  1I81 A;  2FVU A;  4JLI A;  3NTH A;  3CPF A;  1X6O A;  2RJC A;  3HPW A;  3QII A;  3CBP A;  4MDX A;  2RH2 A;  4M77 C;  3OW2 S;  4MZP A;  1LOJ A;  3KUF A;  4M75 F;  3WVD B;  2RD1 A;  2K57 A;  4LDU A;  2VUB A;  5DLQ E;  5FU6 C;  3FEO A;  3P8H A;  5I2M A;  4M78 E;  3QO3 A;  5I21 A;  1BYM A;  4ELZ C;  1GXI E;  2EQM A;  1Q7Y U;  3OYD A;  4J5Y A;  2LQ8 A;  1YJ9 A;  3CPW A;  2OTL T;  4LD9 K;  3JCM b;  3OYA A;  1BIA A;  2XDB A;  5GAM g;  2E41 A;  4EMK B;  3WXM B;  4HA8 A;  3BFM A;  1N6A A;  2E1H A;  3CCE A;  4FL6 A;  5LJ3 j;  3QDR B;  1OYX A;  3RKW A;  1ZQ1 A;  5CIU A;  3VUZ A;  3L2V A;  1WNL A;  4M75 B;  3CCV A;  2KVQ G;  2K2V A;  3MEA A;  3RIR A;  3J81 E;  2MWO A;  1OI1 A;  3M5A A;  4LDX A;  1M90 C;  2GFU A;  3QG1 A;  1BI0 A;  3S3O A;  3DB3 A;  4XU1 A;  4FM4 B;  3M58 A;  2LT4 A;  1Q82 U;  5D6Y A;  4FIB A;  4LDV A;  4EMH A;  3BY7 A;  3JB9 G;  4RCB A;  2L3R A;  4JRK A;  2E6N A;  4WF2 A;  3OYB A;  3QXE B;  4M7A G;  3FB9 A;  3JCM f;  2LC4 A;  3OS1 A;  5GAN 3;  1KD1 C;  3VUB A;  2DXU A;  3R6O A;  1BIB A;  2PVO B;  1RI0 A;  3FRN A;  4C92 G;  4C0D B;  1JJ2 A;  3MEU A;  3L42 A;  2OTJ A;  1Q81 C;  2RB6 A;  4NOY A;  4M77 A;  4BI4 A;  4C8Q E;  1M8V A;  1M4Z A;  2F5K A;  2LDM A;  2ZPI B;  4M75 D;  5GAO p;  1VQ7 A;  4XU2 A;  2BIV A;  5KCH A;  1ZHI A;  3OYG A;  2R57 A;  5GMK l;  5GAN j;  2QDY B;  4EMK C;  1K8A C;  3CCQ T;  1S72 T;  5CAI A;  3QJY A;  1NJI C;  4F7U A;  4R55 A;  4C5H A;  3LGL A;  1KQS S;  3TCJ A;  3OS0 A;  3V7C A;  3C12 A;  3BW1 A;  3ZFJ A;  2D6F A;  2CZ7 B;  2RI3 A;  3HRU A;  2E5Q A;  3OYF A;  5GAN 4;  1N8R C;  1VQ8 A;  3E19 A;  2FYK A;  2DXB A;  5GAM j;  3PMT A;  2VV5 A;  2X4J A;  4QVD A;  3LLR A;  4XU0 A;  3GF5 A;  4RMO A;  2XHC A;  4XK8 E;  3OYL A;  1QP2 A;  3QSU A;  1JB0 E;  3HHT B;  4GLK A;  4ZN3 A;  4JRI A;  3EFR A;  3MEV A;  1YHQ A;  2RK1 A;  3LYI A;  1DJ7 B;  2JNG A;  5FRN A;  2X4W A;  1LJO A;  4BI3 A;  2E12 A;  5KE3 A;  3DLM A;  3JB9 J;  3CME A;  2HD0 A;  1HK9 A;  5GAN 8;  2O01 E;  5LJ3 d;  2PU9 B;  4OB2 B;  1LNX A;  4O6J A;  3RER A;  3DKM A;  5GMK j;  1NPP A;  2OAU A;  3L1A A;  3MO8 A;  4A4F A;  4LD6 A;  1W2B A;  4M7A E;  3OYY A;  1ZBX A;  2DIG A;  3OYK A;  2RHY A;  1KQ2 A;  4BI8 B;  4C92 E;  2VGM A;  1VQL A;  4IUU A;  1D3B A;  4OGE A;  4JDS A;  5AYF A;  4J8O A;  1FX7 A;  2MAM A;  2RI2 A;  3OB9 A;  3Q1J A;  1VQM T;  2QEX A;  1NE8 A;  1R8O B;  2K5I A;  4OB0 B;  1IZ6 A;  4KBM B;  5I2S A;  4E7H A;  3G7Z A;  1I5L A;  1M1G A;  2BUD A;  4A4K A;  2XD0 A;  4XTY A;  1YIJ T;  4PKC C;  1VIE A;  1BI3 A;  2JN0 A;  3HKS A;  2E64 A;  3M4G A;  2MI6 A;  5DY9 A;  2QA4 T;  1WJS A;  4J6X A;  3M57 A;  3L2Q A;  3GPL A;  2P0Q A;  1VUB A;  4E47 A;  1KG1 A;  2JTM A;  1IRE B;  3PTA A;  4M77 B;  1MGQ A;  2GQV A;  2XI9 A;  3CCR T;  3JRZ A;  2DZC A;  2KAF A;  2ZPB B;  3CMA T;  5FU6 B;  4QVZ A;  1WJR A;  3L2R A;  1VQ6 T;  3KXT A;  3C95 A;  3CBM A;  1VQ4 T;  1K9M U;  3X25 B;  2DKG A;  4LDY A;  4BE1 A;  3FLG A;  5GMK m;  2QQB A;  4M75 G;  4P5N A;  1U8R A;  4PJO C;  4F7U B;  1NZ9 A;  1I8F A;  1P92 A;  3OMG A;  1H3Z A;  3OYN A;  4OGC A;  3HRS A;  4TVR A;  3I56 A;  3OBW A;  2DD5 A;  4MML A;  2RI5 A;  2RHU A;  4PL6 A;  3VYG A;  4C5G A;  5GAM d;  2GFA A;  1QVG S;  3CCL A;  4DA4 A;  2R58 A;  1VIF A;  3T9N A;  5LJ3 e;  4M77 D;  3I55 T;  2K5L A;  1KC8 C;  3HP9 A;  3QYH B;  3MEW A;  4RG2 A;  4ZN1 A;  3X24 B;  4E7L A;  2CKK A;  4HCC A;  4ZGE B;  4MMK A;  3CCS A;  1JBM A;  1UGQ B;  2XKO C;  5GAN g;  2ZPH B;  2KMT A;  5LJ3 h;  4J7F A;  2OTL A;  3CXC S;  3SWN A;  3RKY A;  1H64 1;  1VQ9 A;  3RES A;  5HK0 A;  2LTO A;  2MMP A;  2Y4Y A;  3CC2 A;  2FB7 A;  5M9O A;  3CC4 T;  1AHJ B;  4L6V 5;  5CKF A;  3CCM T;  2P0P A;  4NL3 A;  2JUF A;  4C0Z A;  3OW2 A;  1M1K U;  1D3B B;  3CC7 T;  2EJF A;  1BKB A;  1YIT A;  2QTX A;  4C0F A;  2M16 A;  2KSS A;  3CD6 T;  2EJ9 A;  1N9S A;  3G71 T;  4PJO A;  2VXF A;  2NLU A;  2JTF A;  5GAN e;  2DXT A;  5LJ5 f;  3V7S A;  4IUT A;  4M7D A;  1M90 U;  1YJW A;  3PFS A;  4M75 E;  3CCJ T;  2HNI A;  4FT2 A;  1VQP A;  3HFO A;  3G4S T;  1UGP B;  4N4I A;  1VQ5 A;  4BE0 A;  3CPW S;  1KQ1 A;  2HBP A;  2M9U A;  3MP6 A;  3A5Z B;  3QBY A;  4OB3 B;  3HRT A;  4GY5 A;  3JCM P;  2JVV A;  2KY9 A;  1VQN A;  3EFS A;  4RCC A;  2JOY A;  1KD1 U;  2YLB A;  5GAM e;  1YJN A;  2VYT A;  1Q86 C;  3VYH B;  4BAC A;  3M9Q A;  2CYZ B;  2ZPG B;  3OYC A;  1Q81 U;  1K73 C;  2ZPF B;  3RMQ A;  2EIF A;  4ZGD B;  4IUQ A;  3CEY A;  4J7I A;  2L89 A;  2G3R A;  2RK2 A;  3ASK A;  3VJP A;  5GAM h;  2XG8 D;  1K8A U;  4JLG A;  4IUV A;  4XTW A;  2EFI A;  1M5Q 1;  5GAN 5;  3OA6 A;  3JCM W;  1NJI U;  3L2W A;  2P0K A;  1X75 C;  2DAQ A;  2DO3 A;  5GMK e;  2EKO A;  2VGN A;  2CZ0 B;  2F5T X;  4PLI A;  1YHQ T;  2A3L A;  4YTL A;  3LWH A;  1JJ2 S;  3MP8 A;  3CCV T;  1N8R U;  4OB1 B;  5C6S A;  5FU7 C;  4M77 G;  4PJO F;  3S6W A;  3OYM A;  3A8O B;  2B8A A;  1RL2 A;  5CQX A;  1QVF A;  4D6W A;  1EIF A;  2H3J A;  4RG8 A;  3FC3 A;  1MHN A;  4N4G A;  4M7D F;  3OSV A;  1N27 A;  4M78 C;  4ME7 A;  3A8L B;  4L59 A;  3SWN B;  4NL2 A;  4C0G A;  1OZ3 A;  3P8B B;  3OYH A;  3ME9 A;  5FRO A;  1XQH A;  4F7U G;  3NFC A;  1YI2 A;  2CZ6 B;  5LJ5 g;  4KUL A;  5CKD A;  1V29 B;  3L2U A;  5CKB A;  2OTJ T;  5C0M A;  2DEQ A;  4OVA A;  2QI2 A;  2VXE A;  3QKJ A;  4O5V A;  3MP1 A;  1VQ7 T;  2QQR A;  4PJO B;  2EYQ A;  4BD3 A;  2RA2 A;  4M7D B;  3N5B B;  2LX9 A;  3OQ5 A;  1U1T A;  1W4S A;  2DXC A;  1G3T A;  3LH0 A;  3J80 E;  5L8R E;  3JCM g;  1M9S A;  5D6W A;  2E70 A;  2QA4 A;  5CKH A;  3UT1 A;  4A4G A;  5GAN 7;  1WPY A;  3S3M A;  1WQW A;  3GNG A;  1VQ8 T;  5DM7 R;  4FU6 A;  2HAX A;  4X34 A;  3UWN A;  4C5E A;  1W2B S;  5CR2 A;  3CMA A;  3QYG B;  3SWN C;  3A8M B;  4PJO D;  2GF7 A;  2GCX A;  4BY6 C;  3CC2 T;  4VUB A;  3JB9 H;  1VQK A;  4QQD A;  4M77 E;  4M7D D;  2LT1 A;  3PIP A;  2XK0 A;  1UGR B;  4M78 A;  3UDC A;  5GAN d;  4X9D A;  1Y96 A;  3BDU A;  1I4K 1;  3AHU A;  4N0A A;  2E10 A;  5LL6 S;  3CME T;  3DLL A;  3CCU T;  3F70 A;  2D9T A;  5GAO l;  4DOW A;  5GMK i;  2PUK B;  3E9G A;  3FJP A;  4QW2 A;  1G5V A;  4F7U E;  1VQO T;  2XID A;  4ZTF A;  2DVE A;  4M7D C;  2EQJ A;  4DQ2 A;  1VQL T;  2DTH A;  5A0G A;  3JCM J;  1UGS B;  2QQ9 A;  2YHT A;  3HFN A;  2HQE A;  3TEE A;  3ZBD A;  1UB4 A;  5LJ5 j;  5GAN 2;  5GAO n;  2QEX T;  1KC8 U;  4UC4 A;  2X4X A;  2RHX A;  2DPP B;  4Y28 E;  2Y4X A;  5CCA A;  1G3S A;  2FHD A;  1QVG A;  4BB7 A;  1Y71 A;  4MZT A;  4XTZ A;  4JS4 A;  2YLC A;  5KE2 A;  5CO7 A;  3S3N A;  4NS5 A;  4BDY A;  1XOV A;  2PVG B;  2K5F A;  3QZ9 B;  3V8L A;  1KHI A;  3RKX A;  4C8Q A;  3CD6 A;  4C92 C;  3OYE A;  4HCB A;  2QQS A;  3L2Z A;  2K3Y A;  4BUG A;  3FIF A;  3H8Z A;  1QW1 A;  2RJE A;  4M78 F;  4HCZ A;  2E65 A;  2BKD N;  2Y90 A;  2CGH A;  4FSX A;  2X4Y A;  3I56 T;  2F69 A;  2HQX A;  5CK9 A;  5DLO A;  3V8K A;  3CCL T;  4BE2 A;  3TU4 K;  4ELY C;  2R5A A;  2P4T A;  3TRE A;  1PSE A;  1B34 A;  4EPC A;  2L5Q A;  3J7A F;  5J26 A;  1YJN T;  5FU7 B;  3WVE B;  4IUP A;  3G6E T;  1BI1 A;  2K3X A;  2DIQ A;  2DTI A;  5KCO A;  4HKE A;  2M0O A;  1QVP A;  1WQ7 A;  3PNW C;  5CKE A;  3ER0 A;  4B9X A;  2MWP A;  4J6Y A;  3CCS T;  4JS5 A;  1JRI A;  4M78 B;  4HT8 A;  1XNI A;  5GAN h;  1Y96 B;  1Q86 U;  4PJO G;  3E1S A;  1O75 A;  4A4H A;  4FT4 A;  1K73 U;  2EQK A;  2LRQ A;  2O4X A;  4QQG A;  3V8J A;  3HL8 A;  4M7D G;  2LQK A;  3PIO A;  1M1K C;  1Q7Y C;  2K4Y A;  3QHS A;  1VQ9 T;  4EDU A;  1SSF A;  1XTD A;  1NPR A;  4R56 A;  5FLX E;  5GAO m;  3CCQ A;  1S72 A;  5LJ5 d;  5GAO r;  4M7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...