5GAMd

Foot region of the yeast spliceosomal u4/u6.u5 tri-snrnp
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
82
Chain Sequence
NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA
publication title Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 Angstrom resolution
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2015-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gamd00
2YLCA 5LJ5j 5GANe 2FYKA 4M78F 5GMKe 3JB9F 4EMKC 3JB9H 1X01A 3PGGA 5LJ5h 4C92E 3HFOA 4J5YA 4WF2A 3JB9I 3RKWA 3INZA 4C8QB 1Y96A 4M7AG 5GAOn 4M7AA 4OP0A 4JRIA 3BDUA 5LJ5g 4PJOA 4C92F 4M7DG 1U1TA 1D3BB 2I2LA 3BW1A 1B34B 4JRKA 4M7DA 2Y90A 4C92B 1JBMA 5LJ3d 5LJ3g 3JCMJ 2DZCA 3FB9A 4N0AC 3GIBA 4A53A 1I8FA 5DY9A 3QO3A 2EAYA 3FJPA 3JCMP 2VC8A 4C8QC 4V2SA 2DTIA 3L1AA 4NOYA 4F7UG 1LNXA 3RKXA 4F7UA 4HT8A 4M78E 4EMHA 3JCMb 5GAMe 4QVCA 5I21A 2VXFA 4PJOD 1WQWA 4C92C 3RUXA 3VU3C 2DJZA 3JCMX 3HFNA 3QHSA 5LJ3f 4M75A 4M77G 3V7SA 4M77A 5GAN6 1LJOA 2DXTA 4XU0A 3SWNA 3QSUA 4J6XA 2DTHA 3FIFA 4Y91A 4EMGA 4PJOE 4XU2A 4M78B 2EJFA 5LJ3j 3RIRA 5LJ3h 4XTZA 3JCMQ 5GANd 4PJOF 1I81A 4XTVA 5GMKl 3JCMe 3M4GA 4MMLA 4EMKA 4M7DF 4PJOB 1KQ1A 1WNLA 4M75D 4JUVA 4M77D 2DKGA 3BFMA 3JB9J 4M78C 4HT9A 2RA2A 3V7RA 4A54A 1BIAA 3JCMW 1N9SA 4M75E 4XTWA 4F7UF 1KQ2A 2VXEA 2E64A 4XTXA 5GANf 4M7AD 2FB7A 2YLBA 4X9CA 3BY7A 5LJ5e 2HNIA 4PJOC 3V7CA 3HSBA 4N0AA 1HK9A 4M75F 4XTYA 3AHUA 5GANj 1WPYA 2DVEA 4C8QG 4C8QA 4M7AE 5GAOr 4M75B 2E10A 4MMKA 3RKYA 5GANh 5GAMd 1U1SA 4J6WA 3SWNB 4M7DE 1B34A 4C92G 4XQ3A 5GAOl 2RM4A 1WQ7A 4M7AF 4XU3A 3JCMV 4M7DD 2K57A 5GANg 1Y96B 4M7AB 1N9RA 3QUIA 3V8LA 4F7UE 4EMKB 4M7DB 4C8QD 5GAOq 1M5Q1 4HA8A 3EFSA 3V8KA 2DXUA 4PNOA 2ZGWA 3JCMg 4M77E 1HXDA 2CGHA 3JCMd 4X9DA 4M7AC 5GAMj 4RCBA 4F7UB 5GAN3 5GMKm 1BIBA 2EJ9A 2DEQA 4M78G 1I4K1 4M78A 5GAMh 5GAN8 3EFRA 3JB9G 3RERA 4M7DC 4M77F 3V8JA 4C8QF 5CAIA 5LJ3e 5GMKj 1JRIA 4M77B 4XTUA 5GAMg 3JCMf 5GMKh 2RD1A 2E65A 4JLIA 4XU1A 4PJOG 5LJ5d 1D3BA 3RESA 2DTOA 4C92A 4DQ2A 1MGQA 4QVDA 5GAOp 4NL3A 1I5LA 1H641 2EJGA 4M78D 1YCYA 2E1HA 3JB9D 4RCCA 4M75C 3JCMh 4M77C 5GAN2 1LOJA 5GAN7 5GMKi 2DZ9A 3SWNC 2QTXA 5GAMf 3L2ZA 5GAN5 3SB2A 5LJ5f 1M8VA 4J6YA 1TH7A 2JN0A 4NL2A 2E41A 2EWNA 2YHTA 5GAOm 4C8QE 5GAN4 4C92D 4M75G 2RB6A 3JCMc
chains in the Genus database with same CATH superfamily
2P4RA 4C92E 3I56Q 4FCYA 1EX4A 1QLYA 2XI9A 4M7AG 3ZEHA 2I2LA 4IUTA 2ECZA 4PL6A 2EQUA 4OB3B 4OMLA 1BI2A 3VS2A 2VYTA 4HT8A 2LC4A 1WI7A 1M90U 5GAN6 4ELYC 2O01E 2DXTA 4FU6A 2QYZA 2RHZA 5KH6A 3CCMA 1TUCA 3OYYA 2GFAA 3JCMQ 1M1FA 2KDSA 1YJ9T 1KQ1A 1KK7A 1OOTA 4HT9A 2FPEA 3V7RA 1G2BA 2KI7A 1YIJT 4L5GA 2VXEA 2DXBA 1IREB 2EFIA 5I2MA 4F17A 2O4XB 3M0SA 2NUPB 4PJOC 3E1SA 3GOXA 1JB0E 2YUOA 2YDLA 1OZ3A 3CPWS 3REBB 2KGTA 3EG2A 4M7AF 2B8AA 4KBMB 2GBQA 5J39A 1AOJA 3CCQA 5GAMj 1ABOA 2P84A 2DBMA 2E5KA 4M78A 3R6NA 1V76A 5LJ3e 5CCAA 4RG8A 2LDMA 1JQQA 4PLLA 3RESA 4FM4B 1UJYA 3CCMQ 2QTVA 3HP9A 1ZSZC 1RLPC 1SPKA 3CC7T 2QK0A 2QQAA 3A8MB 2ZCFB 5I22A 5FWCA 3PIOA 2RB6A 3JCMc 1HD3A 2JXBA 5IHKA 1R0CB 3LYIA 3TREA 1LCKA 3G71A 2VKNA 4E47A 3NGPA 3I56T 5CKDA 5HKCA 2F2XA 3CBMA 4N0AC 2DD5A 2R58A 3CQTA 3RKXA 1NJIU 1BCMA 4BUGA 3PE0A 3A8HB 1YITA 2K6DA 4Z02A 2JTEA 2M51A 2CP0A 3HFNA 2KEAA 1SKUB 4M77A 1TWBA 1D1AA 3EG3A 5GMKl 5L23A 1W70A 1WGSA 1MNEA 3LH5A 3OYEA 5D6XA 4E6RA 2LJ0A 1DJ7B 2RJDA 5I11A 3BY7A 4DA4A 1SEMA 2X3WD 4BY6B 2DVJA 1BI1A 3H8ZA 5GANg 4FW2A 5FU6B 3OW2A 3G71Q 3EGXB 4EMKB 1TUGB 1Z9QA 4PFPA 5IXFA 2ZGWA 2LX7A 2WSCE 4ZNXA 4Z89A 4F7UB 1J3TA 1JXOA 2EQIA 4HCCA 1LVKA 3SEMA 3CCLA 3C0CA 3S3MA 4BE2A 1Q81U 3EGDB 3URGA 1ZA1B 3RMQA 2A36A 3MP1A 2XD0A 2XMFA 3I35A 4M78D 2HD0A 3H6ZA 3SWNC 2QTXA 3CCMT 1I5OB 2K4YA 4A63B 5GAOm 2P0KA 1QKWA 4OMMA 3FJ5A 4ZN3A 1OPLA 2J7IA 3EG9A 3INZA 1PC0A 1Y96A 5GAOn 4QQDA 4M7AA 3JAME 4LDWA 1Q82C 4PJOA 3O8VA 2VUBA 3BW1A 1D3BB 2DYBA 1B34B 1AWWA 2M16A 5LJ3g 3FB9A 2COZA 3QO3A 4N4IA 2DTIA 2V8IA 1G3TA 3OW2S 3J81E 1QVPA 4RG2A 3OYJA 2PVGB 3JCMX 3AT1B 2JUFA 4IURA 2HAXA 4PFOA 2R57A 2H8HA 5CK9A 5KCOA 2BE9B 3CCLQ 4M77D 3JB9J 1ZLMA 1BIAA 3VS1A 2LNVA 5FLXE 5GANf 5D6WA 2D9TA 2YUPA 3SFMA 3U23A 1HYOA 1O75A 3VS6A 1MNDA 2CZ7B 3C95A 1YHQA 1H92A 1D1BA 2PVOB 4HVUA 1VQ6A 2DF6A 3JCMV 5HK0A 1UGRB 2K57A 2QASA 3QXEB 4J9HA 4BY6C 3M0PA 4PJNA 4ZTFA 4RMOA 2RK1A 4FYVB 1S1NA 1TU0B 2X4YA 1ZBJA 3E9FA 3G71T 2KY9A 6AT1B 1ZQ1A 5FU6C 1QWFA 1K4US 1GL5A 1WZOA 1QVGS 3MCAB 3META 3QPHA 1H3ZA 1X43A 2HL3A 1Q81C 2RNAA 3JCMf 4XU1A 2PVDB 1UDLA 5KCHA 2DTOA 4EIKA 4DEYA 1VQLQ 4L6V5 4E7LA 2KVQG 2KNBB 2HDAA 2P4TA 2L3SA 2E41A 2EWNA 2HQXA 2HCKA 2EQKA 2K3YA 3A98A 3JB9F 2COWA 3OB9A 3L2UA 1OZ2A 2RHYA 1H8KA 1WLPB 3OS5A 3HFOA 4RUGA 2L3QA 4OP0A 3BDUA 3EG1A 2DRKA 2KT1A 1U1TA 3VUBA 2QI2A 1YHQQ 1OYXA 3WXMB 5FRMA 2VV5A 3EFOA 3JCMJ 3LX7A 1VQ6Q 4V2SA 2C0IA 2VASA 1UJ0A 3GNGA 1E6GA 5I21A 4PJOD 2D0NA 1NPRA 4OGEA 1X69A 2CSQA 1VIFA 3VYGA 3PTAA 3OW2P 4M78B 1RLQC 1X6GA 1RAGB 2RJFA 2O88A 1O9SA 4X34A 4C0ZA 4LNPA 1WHMA 2QGFB 3CCVA 1M8MA 3CCLT 2KAFA 2E64A 1YWPA 3OS2A 1JU5C 3HRTA 1R77A 4E7KA 5AT1B 4JJBA 2KROA 4C8QG 4M75B 2ED1A 3DKMA 3RKYA 5GANh 5KYXB 2ESWA 4KRTA 4C92G 4XQ3A 4J7FA 1HJDA 2KRNA 2SRCA 4FL6A 1TG0A 1WA7A 3M54A 4C0DC 2PTKA 3CBPA 2KBTA 3A8OB 1G83A 2DXUA 2CGHA 2CSIA 1AHJB 1VQ5A 2LX9A 5FROA 3RERA 2A3LA 4LDXA 2DBKA 3G4SQ 3KUFA 4M77B 2OX7A 5GAMg 2RO0A 1NG2A 1GCQA 2RHXA 2XIDA 2QDYB 4F04B 1QVGP 3LWHA 1YN8A 2YRDA 4LD9K 2EYXA 3QG1A 3VYHB 1X6OA 3JCMh 4JRPA 1VQLT 1KC8R 2YT6A 2RJCA 2YLCA 2MPXC 1MV3A 1T0JA 1G3YA 4IUQA 1C6VX 3VS7A 4C92F 4CC2A 3KXTA 4JRKA 4KH0B 2E5QA 2JJ9A 2ZPIB 1VQMQ 5KYYB 5DY9A 4LDYA 4JS4A 4C5EA 1YHQT 4DOVA 1W4SA 4OMPA 3SHWA 1KJWA 1VQ6T 1BKBA 3SD4A 4B9XA 4XU0A 3I5SA 4C5HA 3QSUA 1VQKA 2DFUA 3HRUA 5LJ3j 4J9IA 1VQ5Q 2VVKA 4M7DF 3EGXA 4EMKA 4JUVA 5CQXA 1PM3A 1RAFB 3FDRA 4M78C 2K5IA 2ABLA 1UTIA 1WYXA 1D09B 4Y92A 1R8OB 2W0ZA 1I07A 3VS0A 5CO7A 3CCRQ 5GJWB 3ZFJA 1K0XA 1N8RC 2E10A 4HCKA 2HBWA 2JM8A 3S3NA 3VV0A 1TTHB 4LUDA 1VUBA 1Y96B 4M7AB 1ZHIA 2XU8A 1BB9A 2XDBA 3VS5A 1M3BA 2RQUA 4IUPA 4KH1B 1GFDA 3Q1JA 3OYCA 1PNJA 1NE8A 2X51A 4GLKA 1CSKA 3LLRA 5LJ5d 3OY9A 2K5LA 3QYHB 3G4ST 1D3BA 4NL3A 3BE3A 5M9OA 1VYVA 1YI2A 1IO6A 2PUKB 4L59A 3E2UA 4MZTA 1Q7YC 4M77C 4F16A 1SHGA 1FXXA 1AWJA 3OS1A 2FPFA 2FPDA 1UGSB 3WVDB 2V1RA 3KBGA 3QWYA 3DLLA 1WXUA 2JMCA 4ANJA 1SHFA 5IXBA 2DEUA 4QQ6A 1WJSA 2H3EB 1QQJA 1W6XA 3I55Q 1LNXA 2DRMA 1VQMT 4EMHA 2A37A 4JJDA 4E7JA 2ZPGB 2EGEA 2RI3A 2LCLA 4EPCA 2YUNA 2RF0A 2CT4A 1T3LA 1I81A 2AK5A 2KRSA 3F70A 4Q5WA 1VQ5T 2VB6A 3LGLA 2MIOA 1K76A 2RQWA 5IHIA 1VYTA 2LP5A 5L8RE 2XK0A 3PVLA 4C8QA 1V29B 1GBRA 3CCRT 4KUIA 4J6WA 4M7DE 2ZPHB 1RI0A 1X2QA 5A2QE 3CMET 3M9QA 1VQOT 1KD1R 2EBPA 1G3WA 1KHCA 3EFOB 1OEBA 3H0FA 4BDYA 1Y57A 1VQPA 1K73R 4M7AC 2ZAEA 2G3RA 5GAMh 3ZL7C 5D6YA 1YJWQ 3TSZA 2OTLT 2CKKA 2QGGA 5GMKj 4LDUA 2GCXA 2DL8A 3EHQA 1SRLA 1B7TA 5HK3A 4LXCA 2R5AA 3X26B 2DAQA 2L8DA 3NMZC 2IG0A 5IN1A 3MO8A 2EW3A 3CCJA 3T9NA 2C0TA 1MMGA 1X2KA 2XDDA 2AZSA 2RHUA 3CCEA 1Q86R 1ARKA 3OYBA 1MMDA 3ME9A 4J9BA 1IRXA 1XQHA 1RADB 1WDXA 1VQ7A 4Z8AA 2Y90A 4Y28E 3RR6A 3UA7A 2Z0WA 3OYMA 2KRMA 2DMOA 3GNFB 3OYHA 2CH4W 4QVCA 2EQJA 2DO3A 3I55T 1SRMA 4M75A 2KYMA 2X4XA 2M9UA 5KYXA 3G1JA 5CKEA 1M1KR 3CPFA 3OMGA 4FYWB 3D7SB 1M2OA 1JJ2A 3M53A 4MMLA 2EGAA 2CZ6B 4J9EA 1IHWA 4A54A 4XTWA 2F1LA 4OMNA 5LJ5e 2HNIA 3CCJQ 1M90C 1YWOA 2WSFE 4KGVB 3CCEQ 1VQ8A 1U5SA 1ZX6A 3CCQQ 3I9QA 1H3HA 4XU3A 1NLPC 2LT4A 2FZCB 4ATOA 4C8QD 1VQ7Q 4CC4B 4ELZC 1CKAA 5CVIA 2QEXA 5GAN8 2BUDA 5DM7R 4LUEA 3H0IA 2IVWA 5J26A 1YJWT 4JJCA 4C5IA 4BACA 1QP2A 1OX8A 2KXCA 5KYYA 4LN2A 1YCYA 1RAEB 5GAN2 1GRIA 2MI6A 2RPNA 2DK3A 1JJ2S 1TH7A 1MMNA 2PNIA 1QP3A 2EIFA 1ACMB 2KR3A 1UGVA 4JZ4A 2DPPB 2E6ZA 2FEIA 2FYKA 3GLXA 3O5ZA 5CQYA 1C0MA 3E9GA 3MP8A 3MP6A 4J5YA 3OYIA 3TU4K 1OU9A 2YUQA 1YITQ 4PFZA 1PCXA 1V1CA 2GF7A 3FRNA 4HVVA 4KUDK 3WVEB 4KGZB 3VRZA 3G6EA 1VQ8Q 1XTDA 3M0RA 1I8FA 4BI8B 2K2MA 2NLUA 7AT1B 2MMPA 3QKJA 4RTVA 3CC2A 1UGQB 2P0PA 3UT1A 4ZGEB 1KC8U 2J6OA 4PJOE 2AHJB 2E12A 3LGFA 2K7AA 2DM1A 1K8AR 3LWIA 3GBQA 2EYQA 2AZVA 1WXTA 2OTJA 2V8KA 4M75D 1RACB 1U06A 2CYZB 2OJ2A 2CDTA 1QVGA 1NJIC 2VGMA 1S72A 3CCUA 2FB7A 1GCQC 1K1ZA 3THKA 1OX9A 3CD6A 2J6KA 4HKEA 3CCJT 4BE1A 8ATCB 2FL7A 2O2OA 2KSSA 5HCKA 1X6BA 5KE2A 3CCET 3P8DA 1N9RA 3CCQT 2DNUA 2LTOA 1QKXA 3V8LA 4WTOB 4J8OA 4IUUA 4MDXA 3V8KA 1VQ7T 3G6EQ 3M56A 2DEQA 3JB9G 1D0XA 5IAYA 5CAIA 4ESRA 3CC2Q 1VQ9A 1K0SA 2A08A 2EYWA 1ZBXA 2E65A 1MGQA 4OB2B 2WACA 3VJPA 3CXCP 3JSCA 2KMTA 1AEYA 4KULA 4NL2A 2OTJQ 1AT1B 1YJNA 2YHTA 5LL6S 1BI0A 1N27A 4EMKC 3M59A 1JJ2P 1SG5A 1S72Q 3CCUQ 4C8QB 2LNHB 3LH0A 2XG8D 3CD6Q 3A8LB 4C92B 1NEGA 3JV3A 1JBMA 2KXDA 4RKUE 1YITT 2EKOA 2C0OA 4E7SA 2F2VA 1UE9A 2GQVA 4PKCC 3X28B 4II1A 3JCMb 3J80E 1WJRA 2O9SA 1PRLC 4J9FA 5LJ3f 4HVWA 3S6WA 2DTHA 2KT8A 2ZPFB 4E7HA 3MPUB 1JXMA 4E2FB 1VQ9Q 3PNWC 1GBQA 2HEQA 4D8KA 4F7UF 1D0YA 4FT4A 3RMSA 4M7AD 4FSXA 3HSBA 1RAAB 2MF2A 1GXIE 4HCZA 4XTYA 2AKKA 3H0HA 1Q82R 1R0BG 2HBPA 2LJ3A 2JOYA 1WQ7A 1NZ9A 1TS9A 2BKDN 1TSFA 2V8JA 1QCOA 2RK2A 4HA8A 1XJWB 2HSPA 2EYYA 2LT1A 1RI9A 4JZ3A 2BIVA 1E6HA 4PLIA 3VUZA 5GMKm 5GAN3 4LD6A 1F1BB 1WHHA 2JS0A 4Z88A 3G6ET 2JMAA 2L89A 2Y4YA 3TVTA 3FEOA 1OV3A 3CC2T 1TXQA 2J6FA 1RAIB 2DETA 2SEMA 3GF5A 4R56A 2I0NA 4OMFB 1D1CA 2V1QA 1LPLA 3L42A 4M4ZA 1K73U 2OTJT 1M4ZA 4CC7A 3EH2A 3RBBB 3PGGA 1QVFP 3ZBDA 1VA7A 3M55A 1M3CA 2EKHA 1S72T 2LJ1A 4HCBA 3CCUT 4M7DG 3UF4A 1IHVA 1VQNA 4BE0A 2FRWA 4A53A 3CD6T 2EAYA 3HHTB 4C8QC 4JS5A 2J06A 4NOYA 3REAB 4J9CA 2ZZDA 1CKBA 1UGPB 4C92C 1IGUA 2OI3A 1PD1A 4RTWA 3CCVQ 1AZGB 1Q81R 2LMJA 1RL2A 4LDVA 1Q86U 4EMGA 2IPOB 5IHNA 4PJJA 3RIRA 5LJ3h 5GANd 2BZXA 2QQSA 3MJXA 3OSVA 1UG1A 2R5MA 2KK4A 2YRCA 1NM7A 2GTOA 3PT9A 5GJVB 2DYIA 1VQ9T 1T3SA 2J05A 3TCJA 3V7CA 1ZUYA 1G5VA 1OPKA 3NFCA 5FRNA 2NYSA 4FW1A 2RM4A 1M1KU 2AT1B 2DILA 2A28A 2L3PA 1XNIA 2GNCA 2X4WA 4F7UE 2YRVA 3QJ6A 3JCMd 1IXDA 3EG0A 2JVVA 1QWEA 3DB3A 1VQNQ 1BIBA 1MUZA 4A4GA 4JRQA 1PWTA 5KYUB 2CZ1B 5GAOp 1BI3A 2DLPA 2MCNA 3OQ5A 1H641 4FYYB 2E1HA 4M75C 4CRIA 4ZTJA 1NYFA 2D1XA 2DZ9A 2COYA 3EH1A 5GAMf 2ROLA 2MAMA 1QMCA 2D6FA 5LJ5j 2D0QB 4M78F 2CP3A 1M1GA 4WF2A 3CC7A 2K3XA 2QDLA 2RH2A 1GFCA 2NUTA 4PJMA 1VQKQ 2JS2A 2CREA 1UHFA 2VC8A 1GCPA 1WQWA 2LQWA 3VU3C 1EZZB 4A4HA 1Q86C 4D6WA 4ZGJB 3CCVT 1X75C 3NTIA 2VWFA 4PJLA 5CIUA 1PRMC 5KYWB 2CUDA 2DL7A 3PVQA 3NHNA 2GQIA 2C06A 1YBYA 3MHXA 4MDWA 2D8HA 2V26A 2DVEA 3TQ7P 4RTYA 2CH4A 4DEXA 4DBQA 2QAZA 1WHGA 2RJEA 5DLQE 1M1KC 1MHNA 5GAOl 1YFNA 1A0NB 4VUBA 3DLMA 1ZSGA 1KQSP 1K8AU 3OBWA 3PMTA 1M5Q1 1BK2A 3OMCA 2CP5A 8AT1B 4PNOA 2PU9B 4QKUA 2DJQA 1YI2Q 4C0FA 1VQNT 3EFRA 4QQGA 1WJQA 3NTHA 1PD0A 1G8XA 3DB4A 5AYFA 2LQNA 5GMKh 2RD1A 1WX6A 4JLIA 4OMOA 2F69A 4PJOG 5IH2A 4C92A 2JM9A 1OU8A 4OB1B 3JB9D 2E4HA 1YNZA 4A4EA 1RUWA 3SB2A 2DL3A 2RHIA 4EDUA 2M1HA 2X3XD 1N8RR 3J7AF 5GANe 4ZGDB 1M2VB 2GFUA 4WCIA 4J7IA 5HY6A 3QWXX 4M7DA 1PKSA 2HQEA 2LQ8A 3S3OA 4JJNK 2M0OA 1UHCA 4TVRA 5FW9A 5CKFA 2M0YA 1VQKT 4B6MA 4M78E 2QXFA 2VXFA 2AIRB 1M9SA 4AFZC 1UFFA 3V7SA 3MKDA 4R0KA 2IIMA 5A0GA 1Q95G 4Y91A 4MZPA 4XU2A 1B3QA 4PJOF 3JCMe 2K2VA 1N5ZA 1Q7YR 3M4GA 1K9MR 1MV0B 1ZA2B 2DKGA 5D7UA 2BZYA 2EVRA 4XAXB 2XHCA 4J9DA 3JCMW 1N9SA 4M75E 1KQ2A 1SF9A 2KE9A 3M0QA 3CXCA 1K9AA 1C1AA 5GAOr 1BYMA 3M58A 2FZGB 4DBHA 5GAMd 3L2WA 1VQPQ 3SWNB 2F5TX 4N4HA 5ECAA 1RAHB 1K8AC 2KYBA 2CUBA 2DXCA 1BCOA 4E7ZA 5GAOq 4AT1B 1VYUA 1RABB 1KIKA 1TOVA 2E70A 4M77E 2RI2A 1PG5B 2K3BA 4AFQC 1UEBA 1NEBA 2W10A 1WFWA 3C4SA 1YI2T 3M57A 2RQRA 1JRIA 2JNGA 1W1FA 5A0DA 1Q82U 4QVDA 4AG1C 3CCSA 2CS7A 2VGNA 2QQ9A 2QG9B 4KT0E 4OGCA 4PK4A 3SDZA 1FX7A 5GMKi 4RTXA 1IB8A 1M8VA 4FYXB 4BDZA 2FO0A 5CKBA 4D8DA 4C92D 3OYDA 2NUZA 1W2BA 2CP7A 3JB9I 4CI0C 3RNJA 1KSWA 1YCSB 3CXCS 1QCFA 3CBOA 2JTFA 5J3BA 3GIBA 4J83A 1P92A 2G6FX 3FJPA 2LCSA 3JCMP 2XDPA 2EPDA 2GTJA 3PMIA 3FC3A 2HQHA 3UWNA 2ROTA 3RUXA 4M7DD 1VOMA 4J6XA 3FIFA 2QA4A 1QW1A 1Y71A 3CPWP 1B07A 4FSSA 4OMQA 3QIIA 3OYFA 2YWWA 3M0TA 2X4JA 5DLOA 2KQWA 3A1PA 3FLGA 4IIOA 4UC4A 3CCSQ 2RQVA 1OULA 1X27A 4X9CA 3OYAA 2BZ8A 2F2WA 3OA6A 3IQLA 2MWOA 5KYUA 4RTTA 4BI3A 1WPYA 4M7AE 3EAEA 4AFSC 2ZPEB 4GY5A 3HPWA 3A5ZB 1NLOC 2DL4A 2QEXQ 1W2BS 1VQPT 1QVFA 2DE0X 3QUIA 2E6NA 2O9VA 3MEAA 2NUTB 3CC4A 2L0AA 3EFSA 3PFSA 2QQBA 1ABQA 3JCMg 2DL5A 1HXDA 3EGUA 2PQWA 2F5KA 5C0MA 3GPLA 2HMAA 2RI5A 1I5LA 3QDFA 1JEGA 2X35A 2QA4Q 1Y07A 2O31A 2BE7D 3G7ZA 2ATCB 1M90R 1Y7XA 4OVAA 2DERA 1KFZA 3MEVA 4OF1A 5GMKe 1X01A 1VQLA 1VIEA 1WHLA 1T0HA 3VS3A 5C6SA 5LJ5g 5KYWA 1AZEA 2A7YA 1ZUKA 2OAWA 4IIMA 4RTZA 4DOWA 4F7UG 1QVFS 5GAMe 1OQKA 2B86A 2DD4A 2K5FA 1M30A 1VQ4A 3OSSC 3NTKA 3CC4Q 3OYNA 1ZSZA 4C0DB 4X1VA 4BI4A 1PSEA 1Z9ZA 1WHKA 4DBFA 2RN8A 2X9HA 3CMAA 1WNLA 3HTRA 1JO8A 3GP8A 3BFMA 4BD3A 4AFUC 2ZPBB 1VQ8T 1WIEA 3OBYA 4B9WA 2FG0A 4N0AA 3CCST 4DBRA 1KC8C 5KYNA 3EHRA 4AMCA 4C0GA 3C12A 1FMWA 3UPUA 3P8BB 2RMOA 2HSEB 4A4KA 3N5BB 4M7DB 2QEXT 2P0QA 2FZKB 3JRZA 2YSQA 1I0CA 1PHTA 1W2BP 2OAUA 2RQTA 4RCBA 1U8RA 3A8GB 3TSWA 1M2VA 3OS0A 1IGQA 1UECA 2LRQA 3X24B 4XTUA 4NS5A 1YJNQ 1VQ4Q 2WSEE 1I1JA 4DQ2A 2HKQB 1OI1A 1NJIR 2E3IA 3G4SA 2QA4T 3NPFA 2O4XA 2NUPA 5LJ5f 2M02A 5CKHA 2MOXA 1FMKA 1NPPA 3CMAQ 4A4FA 2H3JA 4CC3A 5GAN4 3C94A 3MEWA 2GGRA 2XICA 1IZ6A 3UDCA 4F14A 2BTTA 4QVZA 2DIGA 3RKWA 3L2QA 2E3HA 4JRIA 1Y0MA 3OYKA 2Y4XA 1WHJA 4GLMA 3VS4A 4OB0B 2DZCA 3QZ5B 4ME7A 3L1AA 1KD1U 1UB4A 1KQSA 4YTLA 2L5QA 2EYZA 3HRSA 5FU7B 2AKLA 4GBQA 4JDSA 2DJZA 3QJYA 3LW5E 5CR2A 1LJOA 3SWNA 1N8RU 2CP6A 2EJFA 2K79A 1VQMA 3CC4T 3UA6A 4QT7A 1NBEB 1UUEA 2XKOC 4XTVA 3OYGA 4FT2A 3KFVA 4ORZA 1QCNA 2CT3A 3QDRB 3ASKA 4QW2A 4JPBW 1M27C 3L2VA 5GANj 2LQKA 4MMKA 4E7IA 3M5AA 5A0LA 2EQMA 4O5VA 3CCRA 3X25B 1Q7YU 4IKFA 2JZ2A 1K9MU 4KGXB 2MK5A 3CMEA 1VQOA 1U3OA 2ED0A 1YJ9A 1AVZC 2HKNA 2YXYA 5KE3A 2EJ9A 2JW4A 4M78G 1I4K1 4M7DC 3UATA 1YIJA 3V8JA 4C8QF 4BB7A 3BDLA 1KQSS 2K9GA 2HL5C 1KHIA 4O6JA 2FRYA 4P5NA 1YJNT 1VQ4T 2OTLA 2EJGA 3VKIA 3E19A 3ULRB 1E7OA 5GAN7 2EGCA 3CEYA 5EG2A 3M4YA 4J6YA 3H41A 1KG1A 1G3SA 2CP2A 4K11A 4M75G 1D0ZA 1BBZA 2L2PA 3QZ9B 2JT4A 3JB9H 2A0FB 4JLGA 3CMAT 5LJ5h 5I2SA 2LVMA 1WXBA 3OYLA 2CZ0B 1YP5A 1SSFA 3QBYA 1XOVA 1AD5A 2D8JA 5EC7A 5LJ3d 1PKTA 1KD1C 1NYGA 4F7UA 2FVUA 4HXJA 3QHSA 4C5GA 4M77G 3RDVA 1K73C 4MZMA 2NWMA 3EGDA 2ENMA 3CMEQ 1VQOQ 3HKSA 1YJ9Q 3I5RA 3I55A 5FWBA 2DA9A 3EG9B 5FU7C 4XTZA 1TUDA 4IUVA 1YIJQ 3P8HA 2LZ6B 4PJOB 1HSQA 9ATCB 3R6OA 2RA2A 3QYGB 4J9GA 2LCCA 3I56A 3TEEA 4XTXA 2OTLQ 2YLBA 2PUOB 2PZ1A 4ZN1A 1HK9A 4M75F 3AHUA 3H9NA 4FIBA 1FYNA 4R55A 1N6AA 1FMVA 1SSHA 1U1SA 3PIPA 1B34A 1M3AA 2QQRA 1ZUUA 3HL8A 4XK8E 2MWPA 4N4GA 4RTUA 1EFNA 2DX1A 1MMAA 4AG2C 2JTMA 1K9MC 3ER0A 3M0UA 1AWOA 2MYSA 4X9DA 2HZYA 1FWZA 3X20B 1EIFA 4LE9A 4M77F 3MEUA 1ZSZB 1BU1A 2DIQA 2L3RA 4RCCA 3CC7Q 1LOJA 3L2RA 1PSFA 2FHDA 1YJWA 5GAN5 3L2ZA 1AWXA 5IT9E 2JN0A 3CPWA 4C8QE 3VRYA
chains in the Genus database with same CATH topology
2YLCA 1BI0A 1N27A 3OYDA 4EMKC 3M59A 1W2BA 4C92E 3JB9I 4CI0C 2XI9A 4C8QB 4M7AG 1G3YA 3LH0A 3CXCS 4IUQA 2XG8D 3CBOA 3ZEHA 2JTFA 4C92F 3KXTA 2I2LA 4JRKA 4IUTA 3A8LB 5J3BA 4C92B 3GIBA 1JBMA 4RKUE 1YITT 2EKOA 2E5QA 2ZPIB 4J83A 4PL6A 1P92A 2EQUA 4OB3B 4LDYA 5DY9A 4JS4A 3FJPA 1BI2A 4C5EA 3JCMP 1YHQT 2VYTA 4DOVA 4HT8A 2XDPA 2GQVA 4PKCC 3PMIA 3X28B 1W4SA 2LC4A 4II1A 3JCMb 3J80E 3FC3A 1VQ6T 1WJRA 3UWNA 1BKBA 1M90U 3RUXA 4M7DD 5LJ3f 3SD4A 4ELYC 5GAN6 2O01E 4B9XA 3S6WA 2DXTA 4XU0A 4C5HA 3QSUA 4J6XA 2DTHA 3FIFA 2RHZA 2ZPFB 4FU6A 5KH6A 2QA4A 3CCMA 1VQKA 1QW1A 3HRUA 5LJ3j 3OYYA 2GFAA 1Y71A 3JCMQ 4E7HA 1M1FA 2KDSA 1YJ9T 4M7DF 4EMKA 1KQ1A 4JUVA 5CQXA 3PNWC 3QIIA 3FDRA 4M78C 3OYFA 3V7RA 5DLOA 4HT9A 2X4JA 1YIJT 2K5IA 4L5GA 2KQWA 4UC4A 3FLGA 4FT4A 3RMSA 2VXEA 4F7UF 2DXBA 1IREB 2EFIA 5I2MA 1R8OB 2O4XB 4X9CA 3OYAA 4FSXA 4M7AD 4PJOC 5CO7A 3OA6A 3HSBA 3E1SA 2MF2A 3GOXA 1GXIE 2MWOA 4HCZA 4XTYA 3ZFJA 4BI3A 1WPYA 4M7AE 1JB0E 1N8RC 1OZ3A 3EAEA 2E10A 3CPWS 2ZPEB 3CMAT 4GY5A 2HBPA 3VV0A 3S3NA 2JOYA 1WQ7A 2B8AA 3HPWA 1NZ9A 3A5ZB 2BKDN 4M7AF 1W2BS 1VUBA 1Y96B 1VQPT 4M7AB 1QVFA 4KBMB 2V8JA 3QUIA 1ZHIA 2E6NA 2RK2A 3MEAA 4HA8A 3CC4A 5J39A 3EFSA 3PFSA 2QQBA 2XU8A 3JCMg 1HXDA 3CCQA 2XDBA 2LT1A 5GAMj 5GAN3 2BIVA 4IUPA 4PLIA 3VUZA 3Q1JA 2PQWA 5GMKm 2F5KA 4M78A 4LD6A 5C0MA 3OYCA 1NE8A 3G6ET 5LJ3e 5CCAA 2L89A 4RG8A 2Y4YA 3GPLA 3FEOA 4GLKA 3LLRA 2LDMA 5LJ5d 2K5LA 4PLLA 3OY9A 3QYHB 3G4ST 1D3BA 2RI5A 3RESA 4NL3A 5M9OA 4FM4B 1I5LA 3CC2T 2X35A 1Y07A 1YI2A 2PUKB 4L59A 4MZTA 1H3ZA 1Q7YC 4M77C 3G7ZA 3HP9A 3GF5A 4R56A 1Y7XA 4OMFB 1FXXA 3CC7T 3OS1A 4OVAA 2QQAA 3A8MB 2ZCFB 3PIOA 2RB6A 3L42A 3JCMc 1UGSB 3WVDB 1K73U 2OTJT 3MEVA 1M4ZA 4OF1A 5GMKe 3LYIA 1X01A 3PGGA 3TREA 3KBGA 1VQLA 1VIEA 3ZBDA 3DLLA 3M55A 3G71A 4E47A 5C6SA 5LJ5g 3I56T 5CKDA 1S72T 4HCBA 3CCUT 4M7DG 4QQ6A 1VQNA 5HKCA 1WJSA 3CBMA 4BE0A 4N0AC 2A7YA 4A53A 2DD5A 2R58A 3CD6T 2EAYA 3HHTB 4C8QC 4DOWA 4JS5A 4NOYA 4F7UG 1LNXA 3RKXA 1NJIU 1QVFS 4BUGA 1VQMT 2ZZDA 4EMHA 5GAMe 3A8HB 4E7JA 1UGPB 2DD4A 2K5FA 1YITA 4C92C 2ZPGB 1VQ4A 4Z02A 3HFNA 2RI3A 3OSSC 3NTKA 4M77A 2LCLA 3OYNA 1RL2A 4EPCA 4LDVA 1Q86U 4C0DB 4EMGA 4BI4A 1PSEA 3RIRA 5LJ3h 5GANd 1I81A 5GMKl 3F70A 4Q5WA 2QQSA 3OSVA 1WNLA 3CMAA 1WGSA 1VQ5T 3GP8A 3LGLA 2R5MA 3BFMA 3OYEA 2KK4A 5D6XA 4BD3A 3PT9A 1DJ7B 2RJDA 1VQ9T 2ZPBB 1VQ8T 3TCJA 3BY7A 3OBYA 4DA4A 4B9WA 3V7CA 4N0AA 1G5VA 3NFCA 3CCST 5L8RE 2XK0A 4BY6B 1KC8C 4C8QA 5FRNA 1V29B 3CCRT 3S3OA 4KUIA 4C0GA 4J6WA 4M7DE 3C12A 2ZPHB 2RM4A 3UPUA 1M1KU 1RI0A 1BI1A 3P8BB 5A2QE 3H8ZA 5GANg 3CMET 3M9QA 1VQOT 1XNIA 5FU6B 3OW2A 2X4WA 4A4KA 3N5BB 4F7UE 1G3WA 4EMKB 1KHCA 4M7DB 2QEXT 2P0QA 3JRZA 2YRVA 3QJ6A 4BDYA 3JCMd 2ZGWA 1VQPA 2JVVA 2OAUA 2WSCE 3DB3A 4M7AC 4RCBA 4F7UB 1U8RA 2G3RA 3A8GB 3OS0A 1BIBA 5GAMh 5D6YA 4HCCA 4A4GA 4JRQA 4M7DC 2OTLT 2CKKA 2LRQA 3CCLA 5GMKj 4LDUA 3S3MA 2GCXA 3X24B 4XTUA 4BE2A 4NS5A 1Q81U 2CZ1B 3URGA 2WSEE 3RMQA 5HK3A 4DQ2A 1BI3A 3X26B 2R5AA 3MP1A 5GAOp 2DAQA 2L8DA 2XD0A 3OQ5A 1H641 2IG0A 5IN1A 3MO8A 4M78D 2E1HA 1OI1A 2HD0A 3CCJA 3T9NA 4M75C 3H6ZA 4CRIA 4ZTJA 3G4SA 2DZ9A 3SWNC 2O4XA 2QTXA 5GAMf 2QA4T 5LJ5f 3CCMT 2K4YA 5CKHA 2XDDA 1NPPA 2MAMA 2RHUA 2H3JA 4A4FA 5GAN4 5GAOm 2P0KA 3C94A 3CCEA 3MEWA 2XICA 2D6FA 5LJ5j 1IZ6A 2D0QB 3OYBA 3UDCA 4M78F 4ZN3A 1M1GA 3ME9A 4QVZA 2DIGA 4WF2A 3CC7A 3RKWA 3INZA 3L2QA 1XQHA 1Y96A 5GAOn 2K3XA 4QQDA 4M7AA 4JRIA 3JAME 1VQ7A 4LDWA 3OYKA 1Q82C 2RH2A 4PJOA 3O8VA 2VUBA 2Y4XA 1D3BB 3BW1A 1B34B 2Y90A 4Y28E 2M16A 4OB0B 5LJ3g 3OYMA 2DZCA 3FB9A 3GNFB 3QO3A 3OYHA 3QZ5B 4N4IA 2VC8A 2DTIA 3L1AA 2V8IA 4ME7A 1KD1U 1G3TA 3OW2S 3J81E 1UB4A 4QVCA 1KQSA 2EQJA 2DO3A 2L5QA 1QVPA 3HRSA 4YTLA 1WQWA 4JDSA 4RG2A 5FU7B 3OYJA 2PVGB 3VU3C 2DJZA 3JCMX 4A4HA 3QJYA 4M75A 5FRMA 3LW5E 5CR2A 1LJOA 2X4XA 4D6WA 4ZGJB 2M9UA 2JUFA 3SWNA 1Q86C 5CKEA 1N8RU 4IURA 1VQMA 2EJFA 3CCVT 3CPFA 3OMGA 3CC4T 2HAXA 3I55T 2R57A 5CK9A 1X75C 3NTIA 5KCOA 1JJ2A 4XTVA 3M53A 3OYGA 2XKOC 4MMLA 2CZ6B 5CIUA 4M77D 3JB9J 4FT2A 4A54A 1BIAA 4XTWA 3QDRB 3ASKA 2LNVA 5FLXE 5GANf 2C06A 4QW2A 1YBYA 5D6WA 2HNIA 2D9TA 5LJ5e 1M90C 3MHXA 4MDWA 3SFMA 2WSFE 1O75A 3L2VA 5GANj 2DVEA 2LQKA 1YHQA 2CZ7B 3C95A 4MMKA 2PVOB 1VQ8A 2RJEA 4E7IA 5DLQE 1M1KC 1VQ6A 1MHNA 5GAOl 4VUBA 4XU3A 3JCMV 5HK0A 1UGRB 2K57A 3DLMA 3M5AA 2EQMA 2LT4A 5A0LA 3QXEB 4BY6C 4O5VA 1K8AU 3CCRA 3X25B 3OBWA 4ZTFA 4ATOA 3PMTA 4C8QD 4RMOA 1Q7YU 4IKFA 1M5Q1 2JZ2A 2RK1A 3OMCA 1K9MU 2X4YA 3E9FA 2PU9B 4PNOA 2KY9A 3G71T 4ELZC 3CMEA 1VQOA 1YJ9A 1ZQ1A 5FU6C 5KE3A 1QVGS 3MCAB 3META 5CVIA 2EJ9A 3QPHA 4M78G 1I4K1 4C0FA 5GAN8 2QEXA 3EFRA 2BUDA 4QQGA 5DM7R 1VQNT 1YIJA 1WJQA 3V8JA 4C8QF 3NTHA 4BB7A 3BDLA 1KQSS 1KHIA 3DB4A 1Q81C 4O6JA 2IVWA 5AYFA 5J26A 1YJWT 3JCMf 5GMKh 2RD1A 4JLIA 4XU1A 2F69A 2PVDB 4PJOG 5KCHA 4C5IA 4BACA 2DTOA 4C92A 1QP2A 4P5NA 4OB1B 1YJNT 1VQ4T 2OTLA 2EJGA 1YCYA 3E19A 4L6V5 3VKIA 3JB9D 4E7LA 2KVQG 5GAN2 2MI6A 4A4EA 2P4TA 5GAN7 1JJ2S 2DK3A 3CEYA 3SB2A 5EG2A 2RHIA 1TH7A 3M4YA 4J6YA 2E41A 4EDUA 1G3SA 1QP3A 2EIFA 2EWNA 2HQXA 2M1HA 1KG1A 4M75G 2EQKA 2DPPB 2E6ZA 3QZ9B 2K3YA 5GANe 3J7AF 2FYKA 3GLXA 3JB9H 5CQYA 4JLGA 3OB9A 4ZGDB 3L2UA 1OZ2A 2RHYA 5LJ5h 5I2SA 2GFUA 2LVMA 3E9GA 3OS5A 3MP8A 3HFOA 3MP6A 4J5YA 3OYIA 3TU4K 3OYLA 4J7IA 2CZ0B 5HY6A 4OP0A 2GF7A 3FRNA 3BDUA 1SSFA 3QBYA 1XOVA 1U1TA 4M7DA 3VUBA 2QI2A 4KUDK 1OYXA 2HQEA 2LQ8A 2VV5A 5LJ3d 3WVEB 3WXMB 3G6EA 2M0OA 1XTDA 4JJNK 3JCMJ 1I8FA 3LX7A 4BI8B 2NLUA 4TVRA 1KD1C 4V2SA 5CKFA 4F7UA 1VQKT 2MMPA 3QKJA 3GNGA 4M78E 2QXFA 3CC2A 5I21A 2VXFA 4PJOD 1NPRA 2FVUA 1M9SA 1UGQB 3QHSA 4C5GA 2P0PA 4M77G 4OGEA 3V7SA 4MZMA 1K73C 3UT1A 5A0GA 4ZGEB 1KC8U 1VIFA 3VYGA 4PJOE 3PTAA 2AHJB 4Y91A 4MZPA 4XU2A 4M78B 2E12A 3HKSA 3LGFA 3I55A 5FU7C 3LWIA 2EYQA 4XTZA 2RJFA 4IUVA 4PJOF 3JCMe 1O9SA 2K2VA 4X34A 3M4GA 4C0ZA 2V8KA 3P8HA 4PJOB 2OTJA 4M75D 2DKGA 3CCVA 3R6OA 4XAXB 2CYZB 2RA2A 2XHCA 3QYGB 3CCLT 3JCMW 1QVGA 1N9SA 4M75E 1NJIC 2VGMA 1KQ2A 2LCCA 3I56A 2KAFA 1S72A 2E64A 4XTXA 3TEEA 3OS2A 2FB7A 2YLBA 3CCUA 2PUOB 3HRTA 4E7KA 4ZN1A 3CXCA 1HK9A 4M75F 3AHUA 3CD6A 4C8QG 4FIBA 5GAOr 4M75B 4HKEA 4R55A 1BYMA 3M58A 3CCJT 3DKMA 3RKYA 1N6AA 5GAMd 5GANh 1U1SA 3PIPA 3SWNB 2F5TX 3L2WA 4BE1A 2FL7A 2KSSA 1B34A 4N4HA 4XQ3A 4J7FA 4C92G 2QQRA 3HL8A 4XK8E 5KE2A 2MWPA 3CCET 3P8DA 1N9RA 4N4GA 3CCQT 1K8AC 2LTOA 2DXCA 3V8LA 4FL6A 3M54A 4J8OA 4C0DC 5GAOq 2JTMA 4IUUA 3CBPA 1K9MC 4MDXA 3A8OB 3ER0A 3JB9F 3V8KA 2DXUA 2E70A 2CGHA 4M77E 2RI2A 1AHJB 4X9DA 1VQ7T 1FWZA 3M56A 3X20B 1VQ5A 1UEBA 1EIFA 2LX9A 5FROA 3RERA 2DEQA 2A3LA 3JB9G 4LDXA 5IAYA 3C4SA 4M77F 1YI2T 3M57A 5CAIA 1JRIA 3KUFA 4M77B 1VQ9A 2JNGA 3MEUA 2RO0A 5GAMg 1ZBXA 2E65A 2RHXA 2DIQA 5A0DA 2XIDA 2QDYB 1Q82U 1MGQA 4QVDA 4OB2B 3LWHA 2WACA 3CCSA 4LD9K 2CS7A 2VGNA 2QQ9A 3QG1A 4KT0E 4OGCA 2L3RA 4RCCA 3VJPA 3VYHB 1X6OA 3JCMh 3SDZA 4JRPA 1LOJA 3L2RA 1PSFA 2FHDA 1FX7A 1YJWA 3JSCA 5GMKi 5GAN5 2KMTA 3L2ZA 1VQLT 1M8VA 5IT9E 2JN0A 4KULA 4NL2A 4BDZA 5CKBA 3CPWA 2YHTA 1YJNA 4C8QE 5LL6S 4C92D 2RJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YLC A;  5LJ5 j;  5GAN e;  2FYK A;  4M78 F;  5GMK e;  3JB9 F;  4EMK C;  3JB9 H;  1X01 A;  3PGG A;  5LJ5 h;  4C92 E;  3HFO A;  4J5Y A;  4WF2 A;  3JB9 I;  3RKW A;  3INZ A;  4C8Q B;  1Y96 A;  4M7A G;  5GAO n;  4M7A A;  4OP0 A;  4JRI A;  3BDU A;  5LJ5 g;  4PJO A;  4C92 F;  4M7D G;  1U1T A;  1D3B B;  2I2L A;  3BW1 A;  1B34 B;  4JRK A;  4M7D A;  2Y90 A;  4C92 B;  1JBM A;  5LJ3 d;  5LJ3 g;  3JCM J;  2DZC A;  3FB9 A;  4N0A C;  3GIB A;  4A53 A;  1I8F A;  5DY9 A;  3QO3 A;  2EAY A;  3FJP A;  3JCM P;  2VC8 A;  4C8Q C;  4V2S A;  2DTI A;  3L1A A;  4NOY A;  4F7U G;  1LNX A;  3RKX A;  4F7U A;  4HT8 A;  4M78 E;  4EMH A;  3JCM b;  5GAM e;  4QVC A;  5I21 A;  2VXF A;  4PJO D;  1WQW A;  4C92 C;  3RUX A;  3VU3 C;  2DJZ A;  3JCM X;  3HFN A;  3QHS A;  5LJ3 f;  4M75 A;  4M77 G;  3V7S A;  4M77 A;  5GAN 6;  1LJO A;  2DXT A;  4XU0 A;  3SWN A;  3QSU A;  4J6X A;  2DTH A;  3FIF A;  4Y91 A;  4EMG A;  4PJO E;  4XU2 A;  4M78 B;  2EJF A;  5LJ3 j;  3RIR A;  5LJ3 h;  4XTZ A;  3JCM Q;  5GAN d;  4PJO F;  1I81 A;  4XTV A;  5GMK l;  3JCM e;  3M4G A;  4MML A;  4EMK A;  4M7D F;  4PJO B;  1KQ1 A;  1WNL A;  4M75 D;  4JUV A;  4M77 D;  2DKG A;  3BFM A;  3JB9 J;  4M78 C;  4HT9 A;  2RA2 A;  3V7R A;  4A54 A;  1BIA A;  3JCM W;  1N9S A;  4M75 E;  4XTW A;  4F7U F;  1KQ2 A;  2VXE A;  2E64 A;  4XTX A;  5GAN f;  4M7A D;  2FB7 A;  2YLB A;  4X9C A;  3BY7 A;  5LJ5 e;  2HNI A;  4PJO C;  3V7C A;  3HSB A;  4N0A A;  1HK9 A;  4M75 F;  4XTY A;  3AHU A;  5GAN j;  1WPY A;  2DVE A;  4C8Q G;  4C8Q A;  4M7A E;  5GAO r;  4M75 B;  2E10 A;  4MMK A;  3RKY A;  5GAN h;  5GAM d;  1U1S A;  4J6W A;  3SWN B;  4M7D E;  1B34 A;  4C92 G;  4XQ3 A;  5GAO l;  2RM4 A;  1WQ7 A;  4M7A F;  4XU3 A;  3JCM V;  4M7D D;  2K57 A;  5GAN g;  1Y96 B;  4M7A B;  1N9R A;  3QUI A;  3V8L A;  4F7U E;  4EMK B;  4M7D B;  4C8Q D;  5GAO q;  1M5Q 1;  4HA8 A;  3EFS A;  3V8K A;  2DXU A;  4PNO A;  2ZGW A;  3JCM g;  4M77 E;  1HXD A;  2CGH A;  3JCM d;  4X9D A;  4M7A C;  5GAM j;  4RCB A;  4F7U B;  5GAN 3;  5GMK m;  1BIB A;  2EJ9 A;  2DEQ A;  4M78 G;  1I4K 1;  4M78 A;  5GAM h;  5GAN 8;  3EFR A;  3JB9 G;  3RER A;  4M7D C;  4M77 F;  3V8J A;  4C8Q F;  5CAI A;  5LJ3 e;  5GMK j;  1JRI A;  4M77 B;  4XTU A;  5GAM g;  3JCM f;  5GMK h;  2RD1 A;  2E65 A;  4JLI A;  4XU1 A;  4PJO G;  5LJ5 d;  1D3B A;  3RES A;  2DTO A;  4C92 A;  4DQ2 A;  1MGQ A;  4QVD A;  5GAO p;  4NL3 A;  1I5L A;  1H64 1;  2EJG A;  4M78 D;  1YCY A;  2E1H A;  3JB9 D;  4RCC A;  4M75 C;  3JCM h;  4M77 C;  5GAN 2;  1LOJ A;  5GAN 7;  5GMK i;  2DZ9 A;  3SWN C;  2QTX A;  5GAM f;  3L2Z A;  5GAN 5;  3SB2 A;  5LJ5 f;  1M8V A;  4J6Y A;  1TH7 A;  2JN0 A;  4NL2 A;  2E41 A;  2EWN A;  2YHT A;  5GAO m;  4C8Q E;  5GAN 4;  4C92 D;  4M75 G;  2RB6 A;  3JCM c; 
#chains in the Genus database with same CATH topology
 2P4R A;  4C92 E;  3I56 Q;  4FCY A;  1EX4 A;  1QLY A;  2XI9 A;  4M7A G;  3ZEH A;  2I2L A;  4IUT A;  2ECZ A;  4PL6 A;  2EQU A;  4OB3 B;  4OML A;  1BI2 A;  3VS2 A;  2VYT A;  4HT8 A;  2LC4 A;  1WI7 A;  1M90 U;  5GAN 6;  4ELY C;  2O01 E;  2DXT A;  4FU6 A;  2QYZ A;  2RHZ A;  5KH6 A;  3CCM A;  1TUC A;  3OYY A;  2GFA A;  3JCM Q;  1M1F A;  2KDS A;  1YJ9 T;  1KQ1 A;  1KK7 A;  1OOT A;  4HT9 A;  2FPE A;  3V7R A;  1G2B A;  2KI7 A;  1YIJ T;  4L5G A;  2VXE A;  2DXB A;  1IRE B;  2EFI A;  5I2M A;  4F17 A;  2O4X B;  3M0S A;  2NUP B;  4PJO C;  3E1S A;  3GOX A;  1JB0 E;  2YUO A;  2YDL A;  1OZ3 A;  3CPW S;  3REB B;  2KGT A;  3EG2 A;  4M7A F;  2B8A A;  4KBM B;  2GBQ A;  5J39 A;  1AOJ A;  3CCQ A;  5GAM j;  1ABO A;  2P84 A;  2DBM A;  2E5K A;  4M78 A;  3R6N A;  1V76 A;  5LJ3 e;  5CCA A;  4RG8 A;  2LDM A;  1JQQ A;  4PLL A;  3RES A;  4FM4 B;  1UJY A;  3CCM Q;  2QTV A;  3HP9 A;  1ZSZ C;  1RLP C;  1SPK A;  3CC7 T;  2QK0 A;  2QQA A;  3A8M B;  2ZCF B;  5I22 A;  5FWC A;  3PIO A;  2RB6 A;  3JCM c;  1HD3 A;  2JXB A;  5IHK A;  1R0C B;  3LYI A;  3TRE A;  1LCK A;  3G71 A;  2VKN A;  4E47 A;  3NGP A;  3I56 T;  5CKD A;  5HKC A;  2F2X A;  3CBM A;  4N0A C;  2DD5 A;  2R58 A;  3CQT A;  3RKX A;  1NJI U;  1BCM A;  4BUG A;  3PE0 A;  3A8H B;  1YIT A;  2K6D A;  4Z02 A;  2JTE A;  2M51 A;  2CP0 A;  3HFN A;  2KEA A;  1SKU B;  4M77 A;  1TWB A;  1D1A A;  3EG3 A;  5GMK l;  5L23 A;  1W70 A;  1WGS A;  1MNE A;  3LH5 A;  3OYE A;  5D6X A;  4E6R A;  2LJ0 A;  1DJ7 B;  2RJD A;  5I11 A;  3BY7 A;  4DA4 A;  1SEM A;  2X3W D;  4BY6 B;  2DVJ A;  1BI1 A;  3H8Z A;  5GAN g;  4FW2 A;  5FU6 B;  3OW2 A;  3G71 Q;  3EGX B;  4EMK B;  1TUG B;  1Z9Q A;  4PFP A;  5IXF A;  2ZGW A;  2LX7 A;  2WSC E;  4ZNX A;  4Z89 A;  4F7U B;  1J3T A;  1JXO A;  2EQI A;  4HCC A;  1LVK A;  3SEM A;  3CCL A;  3C0C A;  3S3M A;  4BE2 A;  1Q81 U;  3EGD B;  3URG A;  1ZA1 B;  3RMQ A;  2A36 A;  3MP1 A;  2XD0 A;  2XMF A;  3I35 A;  4M78 D;  2HD0 A;  3H6Z A;  3SWN C;  2QTX A;  3CCM T;  1I5O B;  2K4Y A;  4A63 B;  5GAO m;  2P0K A;  1QKW A;  4OMM A;  3FJ5 A;  4ZN3 A;  1OPL A;  2J7I A;  3EG9 A;  3INZ A;  1PC0 A;  1Y96 A;  5GAO n;  4QQD A;  4M7A A;  3JAM E;  4LDW A;  1Q82 C;  4PJO A;  3O8V A;  2VUB A;  3BW1 A;  1D3B B;  2DYB A;  1B34 B;  1AWW A;  2M16 A;  5LJ3 g;  3FB9 A;  2COZ A;  3QO3 A;  4N4I A;  2DTI A;  2V8I A;  1G3T A;  3OW2 S;  3J81 E;  1QVP A;  4RG2 A;  3OYJ A;  2PVG B;  3JCM X;  3AT1 B;  2JUF A;  4IUR A;  2HAX A;  4PFO A;  2R57 A;  2H8H A;  5CK9 A;  5KCO A;  2BE9 B;  3CCL Q;  4M77 D;  3JB9 J;  1ZLM A;  1BIA A;  3VS1 A;  2LNV A;  5FLX E;  5GAN f;  5D6W A;  2D9T A;  2YUP A;  3SFM A;  3U23 A;  1HYO A;  1O75 A;  3VS6 A;  1MND A;  2CZ7 B;  3C95 A;  1YHQ A;  1H92 A;  1D1B A;  2PVO B;  4HVU A;  1VQ6 A;  2DF6 A;  3JCM V;  5HK0 A;  1UGR B;  2K57 A;  2QAS A;  3QXE B;  4J9H A;  4BY6 C;  3M0P A;  4PJN A;  4ZTF A;  4RMO A;  2RK1 A;  4FYV B;  1S1N A;  1TU0 B;  2X4Y A;  1ZBJ A;  3E9F A;  3G71 T;  2KY9 A;  6AT1 B;  1ZQ1 A;  5FU6 C;  1QWF A;  1K4U S;  1GL5 A;  1WZO A;  1QVG S;  3MCA B;  3MET A;  3QPH A;  1H3Z A;  1X43 A;  2HL3 A;  1Q81 C;  2RNA A;  3JCM f;  4XU1 A;  2PVD B;  1UDL A;  5KCH A;  2DTO A;  4EIK A;  4DEY A;  1VQL Q;  4L6V 5;  4E7L A;  2KVQ G;  2KNB B;  2HDA A;  2P4T A;  2L3S A;  2E41 A;  2EWN A;  2HQX A;  2HCK A;  2EQK A;  2K3Y A;  3A98 A;  3JB9 F;  2COW A;  3OB9 A;  3L2U A;  1OZ2 A;  2RHY A;  1H8K A;  1WLP B;  3OS5 A;  3HFO A;  4RUG A;  2L3Q A;  4OP0 A;  3BDU A;  3EG1 A;  2DRK A;  2KT1 A;  1U1T A;  3VUB A;  2QI2 A;  1YHQ Q;  1OYX A;  3WXM B;  5FRM A;  2VV5 A;  3EFO A;  3JCM J;  3LX7 A;  1VQ6 Q;  4V2S A;  2C0I A;  2VAS A;  1UJ0 A;  3GNG A;  1E6G A;  5I21 A;  4PJO D;  2D0N A;  1NPR A;  4OGE A;  1X69 A;  2CSQ A;  1VIF A;  3VYG A;  3PTA A;  3OW2 P;  4M78 B;  1RLQ C;  1X6G A;  1RAG B;  2RJF A;  2O88 A;  1O9S A;  4X34 A;  4C0Z A;  4LNP A;  1WHM A;  2QGF B;  3CCV A;  1M8M A;  3CCL T;  2KAF A;  2E64 A;  1YWP A;  3OS2 A;  1JU5 C;  3HRT A;  1R77 A;  4E7K A;  5AT1 B;  4JJB A;  2KRO A;  4C8Q G;  4M75 B;  2ED1 A;  3DKM A;  3RKY A;  5GAN h;  5KYX B;  2ESW A;  4KRT A;  4C92 G;  4XQ3 A;  4J7F A;  1HJD A;  2KRN A;  2SRC A;  4FL6 A;  1TG0 A;  1WA7 A;  3M54 A;  4C0D C;  2PTK A;  3CBP A;  2KBT A;  3A8O B;  1G83 A;  2DXU A;  2CGH A;  2CSI A;  1AHJ B;  1VQ5 A;  2LX9 A;  5FRO A;  3RER A;  2A3L A;  4LDX A;  2DBK A;  3G4S Q;  3KUF A;  4M77 B;  2OX7 A;  5GAM g;  2RO0 A;  1NG2 A;  1GCQ A;  2RHX A;  2XID A;  2QDY B;  4F04 B;  1QVG P;  3LWH A;  1YN8 A;  2YRD A;  4LD9 K;  2EYX A;  3QG1 A;  3VYH B;  1X6O A;  3JCM h;  4JRP A;  1VQL T;  1KC8 R;  2YT6 A;  2RJC A;  2YLC A;  2MPX C;  1MV3 A;  1T0J A;  1G3Y A;  4IUQ A;  1C6V X;  3VS7 A;  4C92 F;  4CC2 A;  3KXT A;  4JRK A;  4KH0 B;  2E5Q A;  2JJ9 A;  2ZPI B;  1VQM Q;  5KYY B;  5DY9 A;  4LDY A;  4JS4 A;  4C5E A;  1YHQ T;  4DOV A;  1W4S A;  4OMP A;  3SHW A;  1KJW A;  1VQ6 T;  1BKB A;  3SD4 A;  4B9X A;  4XU0 A;  3I5S A;  4C5H A;  3QSU A;  1VQK A;  2DFU A;  3HRU A;  5LJ3 j;  4J9I A;  1VQ5 Q;  2VVK A;  4M7D F;  3EGX A;  4EMK A;  4JUV A;  5CQX A;  1PM3 A;  1RAF B;  3FDR A;  4M78 C;  2K5I A;  2ABL A;  1UTI A;  1WYX A;  1D09 B;  4Y92 A;  1R8O B;  2W0Z A;  1I07 A;  3VS0 A;  5CO7 A;  3CCR Q;  5GJW B;  3ZFJ A;  1K0X A;  1N8R C;  2E10 A;  4HCK A;  2HBW A;  2JM8 A;  3S3N A;  3VV0 A;  1TTH B;  4LUD A;  1VUB A;  1Y96 B;  4M7A B;  1ZHI A;  2XU8 A;  1BB9 A;  2XDB A;  3VS5 A;  1M3B A;  2RQU A;  4IUP A;  4KH1 B;  1GFD A;  3Q1J A;  3OYC A;  1PNJ A;  1NE8 A;  2X51 A;  4GLK A;  1CSK A;  3LLR A;  5LJ5 d;  3OY9 A;  2K5L A;  3QYH B;  3G4S T;  1D3B A;  4NL3 A;  3BE3 A;  5M9O A;  1VYV A;  1YI2 A;  1IO6 A;  2PUK B;  4L59 A;  3E2U A;  4MZT A;  1Q7Y C;  4M77 C;  4F16 A;  1SHG A;  1FXX A;  1AWJ A;  3OS1 A;  2FPF A;  2FPD A;  1UGS B;  3WVD B;  2V1R A;  3KBG A;  3QWY A;  3DLL A;  1WXU A;  2JMC A;  4ANJ A;  1SHF A;  5IXB A;  2DEU A;  4QQ6 A;  1WJS A;  2H3E B;  1QQJ A;  1W6X A;  3I55 Q;  1LNX A;  2DRM A;  1VQM T;  4EMH A;  2A37 A;  4JJD A;  4E7J A;  2ZPG B;  2EGE A;  2RI3 A;  2LCL A;  4EPC A;  2YUN A;  2RF0 A;  2CT4 A;  1T3L A;  1I81 A;  2AK5 A;  2KRS A;  3F70 A;  4Q5W A;  1VQ5 T;  2VB6 A;  3LGL A;  2MIO A;  1K76 A;  2RQW A;  5IHI A;  1VYT A;  2LP5 A;  5L8R E;  2XK0 A;  3PVL A;  4C8Q A;  1V29 B;  1GBR A;  3CCR T;  4KUI A;  4J6W A;  4M7D E;  2ZPH B;  1RI0 A;  1X2Q A;  5A2Q E;  3CME T;  3M9Q A;  1VQO T;  1KD1 R;  2EBP A;  1G3W A;  1KHC A;  3EFO B;  1OEB A;  3H0F A;  4BDY A;  1Y57 A;  1VQP A;  1K73 R;  4M7A C;  2ZAE A;  2G3R A;  5GAM h;  3ZL7 C;  5D6Y A;  1YJW Q;  3TSZ A;  2OTL T;  2CKK A;  2QGG A;  5GMK j;  4LDU A;  2GCX A;  2DL8 A;  3EHQ A;  1SRL A;  1B7T A;  5HK3 A;  4LXC A;  2R5A A;  3X26 B;  2DAQ A;  2L8D A;  3NMZ C;  2IG0 A;  5IN1 A;  3MO8 A;  2EW3 A;  3CCJ A;  3T9N A;  2C0T A;  1MMG A;  1X2K A;  2XDD A;  2AZS A;  2RHU A;  3CCE A;  1Q86 R;  1ARK A;  3OYB A;  1MMD A;  3ME9 A;  4J9B A;  1IRX A;  1XQH A;  1RAD B;  1WDX A;  1VQ7 A;  4Z8A A;  2Y90 A;  4Y28 E;  3RR6 A;  3UA7 A;  2Z0W A;  3OYM A;  2KRM A;  2DMO A;  3GNF B;  3OYH A;  2CH4 W;  4QVC A;  2EQJ A;  2DO3 A;  3I55 T;  1SRM A;  4M75 A;  2KYM A;  2X4X A;  2M9U A;  5KYX A;  3G1J A;  5CKE A;  1M1K R;  3CPF A;  3OMG A;  4FYW B;  3D7S B;  1M2O A;  1JJ2 A;  3M53 A;  4MML A;  2EGA A;  2CZ6 B;  4J9E A;  1IHW A;  4A54 A;  4XTW A;  2F1L A;  4OMN A;  5LJ5 e;  2HNI A;  3CCJ Q;  1M90 C;  1YWO A;  2WSF E;  4KGV B;  3CCE Q;  1VQ8 A;  1U5S A;  1ZX6 A;  3CCQ Q;  3I9Q A;  1H3H A;  4XU3 A;  1NLP C;  2LT4 A;  2FZC B;  4ATO A;  4C8Q D;  1VQ7 Q;  4CC4 B;  4ELZ C;  1CKA A;  5CVI A;  2QEX A;  5GAN 8;  2BUD A;  5DM7 R;  4LUE A;  3H0I A;  2IVW A;  5J26 A;  1YJW T;  4JJC A;  4C5I A;  4BAC A;  1QP2 A;  1OX8 A;  2KXC A;  5KYY A;  4LN2 A;  1YCY A;  1RAE B;  5GAN 2;  1GRI A;  2MI6 A;  2RPN A;  2DK3 A;  1JJ2 S;  1TH7 A;  1MMN A;  2PNI A;  1QP3 A;  2EIF A;  1ACM B;  2KR3 A;  1UGV A;  4JZ4 A;  2DPP B;  2E6Z A;  2FEI A;  2FYK A;  3GLX A;  3O5Z A;  5CQY A;  1C0M A;  3E9G A;  3MP8 A;  3MP6 A;  4J5Y A;  3OYI A;  3TU4 K;  1OU9 A;  2YUQ A;  1YIT Q;  4PFZ A;  1PCX A;  1V1C A;  2GF7 A;  3FRN A;  4HVV A;  4KUD K;  3WVE B;  4KGZ B;  3VRZ A;  3G6E A;  1VQ8 Q;  1XTD A;  3M0R A;  1I8F A;  4BI8 B;  2K2M A;  2NLU A;  7AT1 B;  2MMP A;  3QKJ A;  4RTV A;  3CC2 A;  1UGQ B;  2P0P A;  3UT1 A;  4ZGE B;  1KC8 U;  2J6O A;  4PJO E;  2AHJ B;  2E12 A;  3LGF A;  2K7A A;  2DM1 A;  1K8A R;  3LWI A;  3GBQ A;  2EYQ A;  2AZV A;  1WXT A;  2OTJ A;  2V8K A;  4M75 D;  1RAC B;  1U06 A;  2CYZ B;  2OJ2 A;  2CDT A;  1QVG A;  1NJI C;  2VGM A;  1S72 A;  3CCU A;  2FB7 A;  1GCQ C;  1K1Z A;  3THK A;  1OX9 A;  3CD6 A;  2J6K A;  4HKE A;  3CCJ T;  4BE1 A;  8ATC B;  2FL7 A;  2O2O A;  2KSS A;  5HCK A;  1X6B A;  5KE2 A;  3CCE T;  3P8D A;  1N9R A;  3CCQ T;  2DNU A;  2LTO A;  1QKX A;  3V8L A;  4WTO B;  4J8O A;  4IUU A;  4MDX A;  3V8K A;  1VQ7 T;  3G6E Q;  3M56 A;  2DEQ A;  3JB9 G;  1D0X A;  5IAY A;  5CAI A;  4ESR A;  3CC2 Q;  1VQ9 A;  1K0S A;  2A08 A;  2EYW A;  1ZBX A;  2E65 A;  1MGQ A;  4OB2 B;  2WAC A;  3VJP A;  3CXC P;  3JSC A;  2KMT A;  1AEY A;  4KUL A;  4NL2 A;  2OTJ Q;  1AT1 B;  1YJN A;  2YHT A;  5LL6 S;  1BI0 A;  1N27 A;  4EMK C;  3M59 A;  1JJ2 P;  1SG5 A;  1S72 Q;  3CCU Q;  4C8Q B;  2LNH B;  3LH0 A;  2XG8 D;  3CD6 Q;  3A8L B;  4C92 B;  1NEG A;  3JV3 A;  1JBM A;  2KXD A;  4RKU E;  1YIT T;  2EKO A;  2C0O A;  4E7S A;  2F2V A;  1UE9 A;  2GQV A;  4PKC C;  3X28 B;  4II1 A;  3JCM b;  3J80 E;  1WJR A;  2O9S A;  1PRL C;  4J9F A;  5LJ3 f;  4HVW A;  3S6W A;  2DTH A;  2KT8 A;  2ZPF B;  4E7H A;  3MPU B;  1JXM A;  4E2F B;  1VQ9 Q;  3PNW C;  1GBQ A;  2HEQ A;  4D8K A;  4F7U F;  1D0Y A;  4FT4 A;  3RMS A;  4M7A D;  4FSX A;  3HSB A;  1RAA B;  2MF2 A;  1GXI E;  4HCZ A;  4XTY A;  2AKK A;  3H0H A;  1Q82 R;  1R0B G;  2HBP A;  2LJ3 A;  2JOY A;  1WQ7 A;  1NZ9 A;  1TS9 A;  2BKD N;  1TSF A;  2V8J A;  1QCO A;  2RK2 A;  4HA8 A;  1XJW B;  2HSP A;  2EYY A;  2LT1 A;  1RI9 A;  4JZ3 A;  2BIV A;  1E6H A;  4PLI A;  3VUZ A;  5GMK m;  5GAN 3;  4LD6 A;  1F1B B;  1WHH A;  2JS0 A;  4Z88 A;  3G6E T;  2JMA A;  2L89 A;  2Y4Y A;  3TVT A;  3FEO A;  1OV3 A;  3CC2 T;  1TXQ A;  2J6F A;  1RAI B;  2DET A;  2SEM A;  3GF5 A;  4R56 A;  2I0N A;  4OMF B;  1D1C A;  2V1Q A;  1LPL A;  3L42 A;  4M4Z A;  1K73 U;  2OTJ T;  1M4Z A;  4CC7 A;  3EH2 A;  3RBB B;  3PGG A;  1QVF P;  3ZBD A;  1VA7 A;  3M55 A;  1M3C A;  2EKH A;  1S72 T;  2LJ1 A;  4HCB A;  3CCU T;  4M7D G;  3UF4 A;  1IHV A;  1VQN A;  4BE0 A;  2FRW A;  4A53 A;  3CD6 T;  2EAY A;  3HHT B;  4C8Q C;  4JS5 A;  2J06 A;  4NOY A;  3REA B;  4J9C A;  2ZZD A;  1CKB A;  1UGP B;  4C92 C;  1IGU A;  2OI3 A;  1PD1 A;  4RTW A;  3CCV Q;  1AZG B;  1Q81 R;  2LMJ A;  1RL2 A;  4LDV A;  1Q86 U;  4EMG A;  2IPO B;  5IHN A;  4PJJ A;  3RIR A;  5LJ3 h;  5GAN d;  2BZX A;  2QQS A;  3MJX A;  3OSV A;  1UG1 A;  2R5M A;  2KK4 A;  2YRC A;  1NM7 A;  2GTO A;  3PT9 A;  5GJV B;  2DYI A;  1VQ9 T;  1T3S A;  2J05 A;  3TCJ A;  3V7C A;  1ZUY A;  1G5V A;  1OPK A;  3NFC A;  5FRN A;  2NYS A;  4FW1 A;  2RM4 A;  1M1K U;  2AT1 B;  2DIL A;  2A28 A;  2L3P A;  1XNI A;  2GNC A;  2X4W A;  4F7U E;  2YRV A;  3QJ6 A;  3JCM d;  1IXD A;  3EG0 A;  2JVV A;  1QWE A;  3DB3 A;  1VQN Q;  1BIB A;  1MUZ A;  4A4G A;  4JRQ A;  1PWT A;  5KYU B;  2CZ1 B;  5GAO p;  1BI3 A;  2DLP A;  2MCN A;  3OQ5 A;  1H64 1;  4FYY B;  2E1H A;  4M75 C;  4CRI A;  4ZTJ A;  1NYF A;  2D1X A;  2DZ9 A;  2COY A;  3EH1 A;  5GAM f;  2ROL A;  2MAM A;  1QMC A;  2D6F A;  5LJ5 j;  2D0Q B;  4M78 F;  2CP3 A;  1M1G A;  4WF2 A;  3CC7 A;  2K3X A;  2QDL A;  2RH2 A;  1GFC A;  2NUT A;  4PJM A;  1VQK Q;  2JS2 A;  2CRE A;  1UHF A;  2VC8 A;  1GCP A;  1WQW A;  2LQW A;  3VU3 C;  1EZZ B;  4A4H A;  1Q86 C;  4D6W A;  4ZGJ B;  3CCV T;  1X75 C;  3NTI A;  2VWF A;  4PJL A;  5CIU A;  1PRM C;  5KYW B;  2CUD A;  2DL7 A;  3PVQ A;  3NHN A;  2GQI A;  2C06 A;  1YBY A;  3MHX A;  4MDW A;  2D8H A;  2V26 A;  2DVE A;  3TQ7 P;  4RTY A;  2CH4 A;  4DEX A;  4DBQ A;  2QAZ A;  1WHG A;  2RJE A;  5DLQ E;  1M1K C;  1MHN A;  5GAO l;  1YFN A;  1A0N B;  4VUB A;  3DLM A;  1ZSG A;  1KQS P;  1K8A U;  3OBW A;  3PMT A;  1M5Q 1;  1BK2 A;  3OMC A;  2CP5 A;  8AT1 B;  4PNO A;  2PU9 B;  4QKU A;  2DJQ A;  1YI2 Q;  4C0F A;  1VQN T;  3EFR A;  4QQG A;  1WJQ A;  3NTH A;  1PD0 A;  1G8X A;  3DB4 A;  5AYF A;  2LQN A;  5GMK h;  2RD1 A;  1WX6 A;  4JLI A;  4OMO A;  2F69 A;  4PJO G;  5IH2 A;  4C92 A;  2JM9 A;  1OU8 A;  4OB1 B;  3JB9 D;  2E4H A;  1YNZ A;  4A4E A;  1RUW A;  3SB2 A;  2DL3 A;  2RHI A;  4EDU A;  2M1H A;  2X3X D;  1N8R R;  3J7A F;  5GAN e;  4ZGD B;  1M2V B;  2GFU A;  4WCI A;  4J7I A;  5HY6 A;  3QWX X;  4M7D A;  1PKS A;  2HQE A;  2LQ8 A;  3S3O A;  4JJN K;  2M0O A;  1UHC A;  4TVR A;  5FW9 A;  5CKF A;  2M0Y A;  1VQK T;  4B6M A;  4M78 E;  2QXF A;  2VXF A;  2AIR B;  1M9S A;  4AFZ C;  1UFF A;  3V7S A;  3MKD A;  4R0K A;  2IIM A;  5A0G A;  1Q95 G;  4Y91 A;  4MZP A;  4XU2 A;  1B3Q A;  4PJO F;  3JCM e;  2K2V A;  1N5Z A;  1Q7Y R;  3M4G A;  1K9M R;  1MV0 B;  1ZA2 B;  2DKG A;  5D7U A;  2BZY A;  2EVR A;  4XAX B;  2XHC A;  4J9D A;  3JCM W;  1N9S A;  4M75 E;  1KQ2 A;  1SF9 A;  2KE9 A;  3M0Q A;  3CXC A;  1K9A A;  1C1A A;  5GAO r;  1BYM A;  3M58 A;  2FZG B;  4DBH A;  5GAM d;  3L2W A;  1VQP Q;  3SWN B;  2F5T X;  4N4H A;  5ECA A;  1RAH B;  1K8A C;  2KYB A;  2CUB A;  2DXC A;  1BCO A;  4E7Z A;  5GAO q;  4AT1 B;  1VYU A;  1RAB B;  1KIK A;  1TOV A;  2E70 A;  4M77 E;  2RI2 A;  1PG5 B;  2K3B A;  4AFQ C;  1UEB A;  1NEB A;  2W10 A;  1WFW A;  3C4S A;  1YI2 T;  3M57 A;  2RQR A;  1JRI A;  2JNG A;  1W1F A;  5A0D A;  1Q82 U;  4QVD A;  4AG1 C;  3CCS A;  2CS7 A;  2VGN A;  2QQ9 A;  2QG9 B;  4KT0 E;  4OGC A;  4PK4 A;  3SDZ A;  1FX7 A;  5GMK i;  4RTX A;  1IB8 A;  1M8V A;  4FYX B;  4BDZ A;  2FO0 A;  5CKB A;  4D8D A;  4C92 D;  3OYD A;  2NUZ A;  1W2B A;  2CP7 A;  3JB9 I;  4CI0 C;  3RNJ A;  1KSW A;  1YCS B;  3CXC S;  1QCF A;  3CBO A;  2JTF A;  5J3B A;  3GIB A;  4J83 A;  1P92 A;  2G6F X;  3FJP A;  2LCS A;  3JCM P;  2XDP A;  2EPD A;  2GTJ A;  3PMI A;  3FC3 A;  2HQH A;  3UWN A;  2ROT A;  3RUX A;  4M7D D;  1VOM A;  4J6X A;  3FIF A;  2QA4 A;  1QW1 A;  1Y71 A;  3CPW P;  1B07 A;  4FSS A;  4OMQ A;  3QII A;  3OYF A;  2YWW A;  3M0T A;  2X4J A;  5DLO A;  2KQW A;  3A1P A;  3FLG A;  4IIO A;  4UC4 A;  3CCS Q;  2RQV A;  1OUL A;  1X27 A;  4X9C A;  3OYA A;  2BZ8 A;  2F2W A;  3OA6 A;  3IQL A;  2MWO A;  5KYU A;  4RTT A;  4BI3 A;  1WPY A;  4M7A E;  3EAE A;  4AFS C;  2ZPE B;  4GY5 A;  3HPW A;  3A5Z B;  1NLO C;  2DL4 A;  2QEX Q;  1W2B S;  1VQP T;  1QVF A;  2DE0 X;  3QUI A;  2E6N A;  2O9V A;  3MEA A;  2NUT B;  3CC4 A;  2L0A A;  3EFS A;  3PFS A;  2QQB A;  1ABQ A;  3JCM g;  2DL5 A;  1HXD A;  3EGU A;  2PQW A;  2F5K A;  5C0M A;  3GPL A;  2HMA A;  2RI5 A;  1I5L A;  3QDF A;  1JEG A;  2X35 A;  2QA4 Q;  1Y07 A;  2O31 A;  2BE7 D;  3G7Z A;  2ATC B;  1M90 R;  1Y7X A;  4OVA A;  2DER A;  1KFZ A;  3MEV A;  4OF1 A;  5GMK e;  1X01 A;  1VQL A;  1VIE A;  1WHL A;  1T0H A;  3VS3 A;  5C6S A;  5LJ5 g;  5KYW A;  1AZE A;  2A7Y A;  1ZUK A;  2OAW A;  4IIM A;  4RTZ A;  4DOW A;  4F7U G;  1QVF S;  5GAM e;  1OQK A;  2B86 A;  2DD4 A;  2K5F A;  1M30 A;  1VQ4 A;  3OSS C;  3NTK A;  3CC4 Q;  3OYN A;  1ZSZ A;  4C0D B;  4X1V A;  4BI4 A;  1PSE A;  1Z9Z A;  1WHK A;  4DBF A;  2RN8 A;  2X9H A;  3CMA A;  1WNL A;  3HTR A;  1JO8 A;  3GP8 A;  3BFM A;  4BD3 A;  4AFU C;  2ZPB B;  1VQ8 T;  1WIE A;  3OBY A;  4B9W A;  2FG0 A;  4N0A A;  3CCS T;  4DBR A;  1KC8 C;  5KYN A;  3EHR A;  4AMC A;  4C0G A;  3C12 A;  1FMW A;  3UPU A;  3P8B B;  2RMO A;  2HSE B;  4A4K A;  3N5B B;  4M7D B;  2QEX T;  2P0Q A;  2FZK B;  3JRZ A;  2YSQ A;  1I0C A;  1PHT A;  1W2B P;  2OAU A;  2RQT A;  4RCB A;  1U8R A;  3A8G B;  3TSW A;  1M2V A;  3OS0 A;  1IGQ A;  1UEC A;  2LRQ A;  3X24 B;  4XTU A;  4NS5 A;  1YJN Q;  1VQ4 Q;  2WSE E;  1I1J A;  4DQ2 A;  2HKQ B;  1OI1 A;  1NJI R;  2E3I A;  3G4S A;  2QA4 T;  3NPF A;  2O4X A;  2NUP A;  5LJ5 f;  2M02 A;  5CKH A;  2MOX A;  1FMK A;  1NPP A;  3CMA Q;  4A4F A;  2H3J A;  4CC3 A;  5GAN 4;  3C94 A;  3MEW A;  2GGR A;  2XIC A;  1IZ6 A;  3UDC A;  4F14 A;  2BTT A;  4QVZ A;  2DIG A;  3RKW A;  3L2Q A;  2E3H A;  4JRI A;  1Y0M A;  3OYK A;  2Y4X A;  1WHJ A;  4GLM A;  3VS4 A;  4OB0 B;  2DZC A;  3QZ5 B;  4ME7 A;  3L1A A;  1KD1 U;  1UB4 A;  1KQS A;  4YTL A;  2L5Q A;  2EYZ A;  3HRS A;  5FU7 B;  2AKL A;  4GBQ A;  4JDS A;  2DJZ A;  3QJY A;  3LW5 E;  5CR2 A;  1LJO A;  3SWN A;  1N8R U;  2CP6 A;  2EJF A;  2K79 A;  1VQM A;  3CC4 T;  3UA6 A;  4QT7 A;  1NBE B;  1UUE A;  2XKO C;  4XTV A;  3OYG A;  4FT2 A;  3KFV A;  4ORZ A;  1QCN A;  2CT3 A;  3QDR B;  3ASK A;  4QW2 A;  4JPB W;  1M27 C;  3L2V A;  5GAN j;  2LQK A;  4MMK A;  4E7I A;  3M5A A;  5A0L A;  2EQM A;  4O5V A;  3CCR A;  3X25 B;  1Q7Y U;  4IKF A;  2JZ2 A;  1K9M U;  4KGX B;  2MK5 A;  3CME A;  1VQO A;  1U3O A;  2ED0 A;  1YJ9 A;  1AVZ C;  2HKN A;  2YXY A;  5KE3 A;  2EJ9 A;  2JW4 A;  4M78 G;  1I4K 1;  4M7D C;  3UAT A;  1YIJ A;  3V8J A;  4C8Q F;  4BB7 A;  3BDL A;  1KQS S;  2K9G A;  2HL5 C;  1KHI A;  4O6J A;  2FRY A;  4P5N A;  1YJN T;  1VQ4 T;  2OTL A;  2EJG A;  3VKI A;  3E19 A;  3ULR B;  1E7O A;  5GAN 7;  2EGC A;  3CEY A;  5EG2 A;  3M4Y A;  4J6Y A;  3H41 A;  1KG1 A;  1G3S A;  2CP2 A;  4K11 A;  4M75 G;  1D0Z A;  1BBZ A;  2L2P A;  3QZ9 B;  2JT4 A;  3JB9 H;  2A0F B;  4JLG A;  3CMA T;  5LJ5 h;  5I2S A;  2LVM A;  1WXB A;  3OYL A;  2CZ0 B;  1YP5 A;  1SSF A;  3QBY A;  1XOV A;  1AD5 A;  2D8J A;  5EC7 A;  5LJ3 d;  1PKT A;  1KD1 C;  1NYG A;  4F7U A;  2FVU A;  4HXJ A;  3QHS A;  4C5G A;  4M77 G;  3RDV A;  1K73 C;  4MZM A;  2NWM A;  3EGD A;  2ENM A;  3CME Q;  1VQO Q;  3HKS A;  1YJ9 Q;  3I5R A;  3I55 A;  5FWB A;  2DA9 A;  3EG9 B;  5FU7 C;  4XTZ A;  1TUD A;  4IUV A;  1YIJ Q;  3P8H A;  2LZ6 B;  4PJO B;  1HSQ A;  9ATC B;  3R6O A;  2RA2 A;  3QYG B;  4J9G A;  2LCC A;  3I56 A;  3TEE A;  4XTX A;  2OTL Q;  2YLB A;  2PUO B;  2PZ1 A;  4ZN1 A;  1HK9 A;  4M75 F;  3AHU A;  3H9N A;  4FIB A;  1FYN A;  4R55 A;  1N6A A;  1FMV A;  1SSH A;  1U1S A;  3PIP A;  1B34 A;  1M3A A;  2QQR A;  1ZUU A;  3HL8 A;  4XK8 E;  2MWP A;  4N4G A;  4RTU A;  1EFN A;  2DX1 A;  1MMA A;  4AG2 C;  2JTM A;  1K9M C;  3ER0 A;  3M0U A;  1AWO A;  2MYS A;  4X9D A;  2HZY A;  1FWZ A;  3X20 B;  1EIF A;  4LE9 A;  4M77 F;  3MEU A;  1ZSZ B;  1BU1 A;  2DIQ A;  2L3R A;  4RCC A;  3CC7 Q;  1LOJ A;  3L2R A;  1PSF A;  2FHD A;  1YJW A;  5GAN 5;  3L2Z A;  1AWX A;  5IT9 E;  2JN0 A;  3CPW A;  4C8Q E;  3VRY A; 
#chains in the Genus database with same CATH homology
 2YLC A;  1BI0 A;  1N27 A;  3OYD A;  4EMK C;  3M59 A;  1W2B A;  4C92 E;  3JB9 I;  4CI0 C;  2XI9 A;  4C8Q B;  4M7A G;  1G3Y A;  3LH0 A;  3CXC S;  4IUQ A;  2XG8 D;  3CBO A;  3ZEH A;  2JTF A;  4C92 F;  3KXT A;  2I2L A;  4JRK A;  4IUT A;  3A8L B;  5J3B A;  4C92 B;  3GIB A;  1JBM A;  4RKU E;  1YIT T;  2EKO A;  2E5Q A;  2ZPI B;  4J83 A;  4PL6 A;  1P92 A;  2EQU A;  4OB3 B;  4LDY A;  5DY9 A;  4JS4 A;  3FJP A;  1BI2 A;  4C5E A;  3JCM P;  1YHQ T;  2VYT A;  4DOV A;  4HT8 A;  2XDP A;  2GQV A;  4PKC C;  3PMI A;  3X28 B;  1W4S A;  2LC4 A;  4II1 A;  3JCM b;  3J80 E;  3FC3 A;  1VQ6 T;  1WJR A;  3UWN A;  1BKB A;  1M90 U;  3RUX A;  4M7D D;  5LJ3 f;  3SD4 A;  4ELY C;  5GAN 6;  2O01 E;  4B9X A;  3S6W A;  2DXT A;  4XU0 A;  4C5H A;  3QSU A;  4J6X A;  2DTH A;  3FIF A;  2RHZ A;  2ZPF B;  4FU6 A;  5KH6 A;  2QA4 A;  3CCM A;  1VQK A;  1QW1 A;  3HRU A;  5LJ3 j;  3OYY A;  2GFA A;  1Y71 A;  3JCM Q;  4E7H A;  1M1F A;  2KDS A;  1YJ9 T;  4M7D F;  4EMK A;  1KQ1 A;  4JUV A;  5CQX A;  3PNW C;  3QII A;  3FDR A;  4M78 C;  3OYF A;  3V7R A;  5DLO A;  4HT9 A;  2X4J A;  1YIJ T;  2K5I A;  4L5G A;  2KQW A;  4UC4 A;  3FLG A;  4FT4 A;  3RMS A;  2VXE A;  4F7U F;  2DXB A;  1IRE B;  2EFI A;  5I2M A;  1R8O B;  2O4X B;  4X9C A;  3OYA A;  4FSX A;  4M7A D;  4PJO C;  5CO7 A;  3OA6 A;  3HSB A;  3E1S A;  2MF2 A;  3GOX A;  1GXI E;  2MWO A;  4HCZ A;  4XTY A;  3ZFJ A;  4BI3 A;  1WPY A;  4M7A E;  1JB0 E;  1N8R C;  1OZ3 A;  3EAE A;  2E10 A;  3CPW S;  2ZPE B;  3CMA T;  4GY5 A;  2HBP A;  3VV0 A;  3S3N A;  2JOY A;  1WQ7 A;  2B8A A;  3HPW A;  1NZ9 A;  3A5Z B;  2BKD N;  4M7A F;  1W2B S;  1VUB A;  1Y96 B;  1VQP T;  4M7A B;  1QVF A;  4KBM B;  2V8J A;  3QUI A;  1ZHI A;  2E6N A;  2RK2 A;  3MEA A;  4HA8 A;  3CC4 A;  5J39 A;  3EFS A;  3PFS A;  2QQB A;  2XU8 A;  3JCM g;  1HXD A;  3CCQ A;  2XDB A;  2LT1 A;  5GAM j;  5GAN 3;  2BIV A;  4IUP A;  4PLI A;  3VUZ A;  3Q1J A;  2PQW A;  5GMK m;  2F5K A;  4M78 A;  4LD6 A;  5C0M A;  3OYC A;  1NE8 A;  3G6E T;  5LJ3 e;  5CCA A;  2L89 A;  4RG8 A;  2Y4Y A;  3GPL A;  3FEO A;  4GLK A;  3LLR A;  2LDM A;  5LJ5 d;  2K5L A;  4PLL A;  3OY9 A;  3QYH B;  3G4S T;  1D3B A;  2RI5 A;  3RES A;  4NL3 A;  5M9O A;  4FM4 B;  1I5L A;  3CC2 T;  2X35 A;  1Y07 A;  1YI2 A;  2PUK B;  4L59 A;  4MZT A;  1H3Z A;  1Q7Y C;  4M77 C;  3G7Z A;  3HP9 A;  3GF5 A;  4R56 A;  1Y7X A;  4OMF B;  1FXX A;  3CC7 T;  3OS1 A;  4OVA A;  2QQA A;  3A8M B;  2ZCF B;  3PIO A;  2RB6 A;  3L42 A;  3JCM c;  1UGS B;  3WVD B;  1K73 U;  2OTJ T;  3MEV A;  1M4Z A;  4OF1 A;  5GMK e;  3LYI A;  1X01 A;  3PGG A;  3TRE A;  3KBG A;  1VQL A;  1VIE A;  3ZBD A;  3DLL A;  3M55 A;  3G71 A;  4E47 A;  5C6S A;  5LJ5 g;  3I56 T;  5CKD A;  1S72 T;  4HCB A;  3CCU T;  4M7D G;  4QQ6 A;  1VQN A;  5HKC A;  1WJS A;  3CBM A;  4BE0 A;  4N0A C;  2A7Y A;  4A53 A;  2DD5 A;  2R58 A;  3CD6 T;  2EAY A;  3HHT B;  4C8Q C;  4DOW A;  4JS5 A;  4NOY A;  4F7U G;  1LNX A;  3RKX A;  1NJI U;  1QVF S;  4BUG A;  1VQM T;  2ZZD A;  4EMH A;  5GAM e;  3A8H B;  4E7J A;  1UGP B;  2DD4 A;  2K5F A;  1YIT A;  4C92 C;  2ZPG B;  1VQ4 A;  4Z02 A;  3HFN A;  2RI3 A;  3OSS C;  3NTK A;  4M77 A;  2LCL A;  3OYN A;  1RL2 A;  4EPC A;  4LDV A;  1Q86 U;  4C0D B;  4EMG A;  4BI4 A;  1PSE A;  3RIR A;  5LJ3 h;  5GAN d;  1I81 A;  5GMK l;  3F70 A;  4Q5W A;  2QQS A;  3OSV A;  1WNL A;  3CMA A;  1WGS A;  1VQ5 T;  3GP8 A;  3LGL A;  2R5M A;  3BFM A;  3OYE A;  2KK4 A;  5D6X A;  4BD3 A;  3PT9 A;  1DJ7 B;  2RJD A;  1VQ9 T;  2ZPB B;  1VQ8 T;  3TCJ A;  3BY7 A;  3OBY A;  4DA4 A;  4B9W A;  3V7C A;  4N0A A;  1G5V A;  3NFC A;  3CCS T;  5L8R E;  2XK0 A;  4BY6 B;  1KC8 C;  4C8Q A;  5FRN A;  1V29 B;  3CCR T;  3S3O A;  4KUI A;  4C0G A;  4J6W A;  4M7D E;  3C12 A;  2ZPH B;  2RM4 A;  3UPU A;  1M1K U;  1RI0 A;  1BI1 A;  3P8B B;  5A2Q E;  3H8Z A;  5GAN g;  3CME T;  3M9Q A;  1VQO T;  1XNI A;  5FU6 B;  3OW2 A;  2X4W A;  4A4K A;  3N5B B;  4F7U E;  1G3W A;  4EMK B;  1KHC A;  4M7D B;  2QEX T;  2P0Q A;  3JRZ A;  2YRV A;  3QJ6 A;  4BDY A;  3JCM d;  2ZGW A;  1VQP A;  2JVV A;  2OAU A;  2WSC E;  3DB3 A;  4M7A C;  4RCB A;  4F7U B;  1U8R A;  2G3R A;  3A8G B;  3OS0 A;  1BIB A;  5GAM h;  5D6Y A;  4HCC A;  4A4G A;  4JRQ A;  4M7D C;  2OTL T;  2CKK A;  2LRQ A;  3CCL A;  5GMK j;  4LDU A;  3S3M A;  2GCX A;  3X24 B;  4XTU A;  4BE2 A;  4NS5 A;  1Q81 U;  2CZ1 B;  3URG A;  2WSE E;  3RMQ A;  5HK3 A;  4DQ2 A;  1BI3 A;  3X26 B;  2R5A A;  3MP1 A;  5GAO p;  2DAQ A;  2L8D A;  2XD0 A;  3OQ5 A;  1H64 1;  2IG0 A;  5IN1 A;  3MO8 A;  4M78 D;  2E1H A;  1OI1 A;  2HD0 A;  3CCJ A;  3T9N A;  4M75 C;  3H6Z A;  4CRI A;  4ZTJ A;  3G4S A;  2DZ9 A;  3SWN C;  2O4X A;  2QTX A;  5GAM f;  2QA4 T;  5LJ5 f;  3CCM T;  2K4Y A;  5CKH A;  2XDD A;  1NPP A;  2MAM A;  2RHU A;  2H3J A;  4A4F A;  5GAN 4;  5GAO m;  2P0K A;  3C94 A;  3CCE A;  3MEW A;  2XIC A;  2D6F A;  5LJ5 j;  1IZ6 A;  2D0Q B;  3OYB A;  3UDC A;  4M78 F;  4ZN3 A;  1M1G A;  3ME9 A;  4QVZ A;  2DIG A;  4WF2 A;  3CC7 A;  3RKW A;  3INZ A;  3L2Q A;  1XQH A;  1Y96 A;  5GAO n;  2K3X A;  4QQD A;  4M7A A;  4JRI A;  3JAM E;  1VQ7 A;  4LDW A;  3OYK A;  1Q82 C;  2RH2 A;  4PJO A;  3O8V A;  2VUB A;  2Y4X A;  1D3B B;  3BW1 A;  1B34 B;  2Y90 A;  4Y28 E;  2M16 A;  4OB0 B;  5LJ3 g;  3OYM A;  2DZC A;  3FB9 A;  3GNF B;  3QO3 A;  3OYH A;  3QZ5 B;  4N4I A;  2VC8 A;  2DTI A;  3L1A A;  2V8I A;  4ME7 A;  1KD1 U;  1G3T A;  3OW2 S;  3J81 E;  1UB4 A;  4QVC A;  1KQS A;  2EQJ A;  2DO3 A;  2L5Q A;  1QVP A;  3HRS A;  4YTL A;  1WQW A;  4JDS A;  4RG2 A;  5FU7 B;  3OYJ A;  2PVG B;  3VU3 C;  2DJZ A;  3JCM X;  4A4H A;  3QJY A;  4M75 A;  5FRM A;  3LW5 E;  5CR2 A;  1LJO A;  2X4X A;  4D6W A;  4ZGJ B;  2M9U A;  2JUF A;  3SWN A;  1Q86 C;  5CKE A;  1N8R U;  4IUR A;  1VQM A;  2EJF A;  3CCV T;  3CPF A;  3OMG A;  3CC4 T;  2HAX A;  3I55 T;  2R57 A;  5CK9 A;  1X75 C;  3NTI A;  5KCO A;  1JJ2 A;  4XTV A;  3M53 A;  3OYG A;  2XKO C;  4MML A;  2CZ6 B;  5CIU A;  4M77 D;  3JB9 J;  4FT2 A;  4A54 A;  1BIA A;  4XTW A;  3QDR B;  3ASK A;  2LNV A;  5FLX E;  5GAN f;  2C06 A;  4QW2 A;  1YBY A;  5D6W A;  2HNI A;  2D9T A;  5LJ5 e;  1M90 C;  3MHX A;  4MDW A;  3SFM A;  2WSF E;  1O75 A;  3L2V A;  5GAN j;  2DVE A;  2LQK A;  1YHQ A;  2CZ7 B;  3C95 A;  4MMK A;  2PVO B;  1VQ8 A;  2RJE A;  4E7I A;  5DLQ E;  1M1K C;  1VQ6 A;  1MHN A;  5GAO l;  4VUB A;  4XU3 A;  3JCM V;  5HK0 A;  1UGR B;  2K57 A;  3DLM A;  3M5A A;  2EQM A;  2LT4 A;  5A0L A;  3QXE B;  4BY6 C;  4O5V A;  1K8A U;  3CCR A;  3X25 B;  3OBW A;  4ZTF A;  4ATO A;  3PMT A;  4C8Q D;  4RMO A;  1Q7Y U;  4IKF A;  1M5Q 1;  2JZ2 A;  2RK1 A;  3OMC A;  1K9M U;  2X4Y A;  3E9F A;  2PU9 B;  4PNO A;  2KY9 A;  3G71 T;  4ELZ C;  3CME A;  1VQO A;  1YJ9 A;  1ZQ1 A;  5FU6 C;  5KE3 A;  1QVG S;  3MCA B;  3MET A;  5CVI A;  2EJ9 A;  3QPH A;  4M78 G;  1I4K 1;  4C0F A;  5GAN 8;  2QEX A;  3EFR A;  2BUD A;  4QQG A;  5DM7 R;  1VQN T;  1YIJ A;  1WJQ A;  3V8J A;  4C8Q F;  3NTH A;  4BB7 A;  3BDL A;  1KQS S;  1KHI A;  3DB4 A;  1Q81 C;  4O6J A;  2IVW A;  5AYF A;  5J26 A;  1YJW T;  3JCM f;  5GMK h;  2RD1 A;  4JLI A;  4XU1 A;  2F69 A;  2PVD B;  4PJO G;  5KCH A;  4C5I A;  4BAC A;  2DTO A;  4C92 A;  1QP2 A;  4P5N A;  4OB1 B;  1YJN T;  1VQ4 T;  2OTL A;  2EJG A;  1YCY A;  3E19 A;  4L6V 5;  3VKI A;  3JB9 D;  4E7L A;  2KVQ G;  5GAN 2;  2MI6 A;  4A4E A;  2P4T A;  5GAN 7;  1JJ2 S;  2DK3 A;  3CEY A;  3SB2 A;  5EG2 A;  2RHI A;  1TH7 A;  3M4Y A;  4J6Y A;  2E41 A;  4EDU A;  1G3S A;  1QP3 A;  2EIF A;  2EWN A;  2HQX A;  2M1H A;  1KG1 A;  4M75 G;  2EQK A;  2DPP B;  2E6Z A;  3QZ9 B;  2K3Y A;  5GAN e;  3J7A F;  2FYK A;  3GLX A;  3JB9 H;  5CQY A;  4JLG A;  3OB9 A;  4ZGD B;  3L2U A;  1OZ2 A;  2RHY A;  5LJ5 h;  5I2S A;  2GFU A;  2LVM A;  3E9G A;  3OS5 A;  3MP8 A;  3HFO A;  3MP6 A;  4J5Y A;  3OYI A;  3TU4 K;  3OYL A;  4J7I A;  2CZ0 B;  5HY6 A;  4OP0 A;  2GF7 A;  3FRN A;  3BDU A;  1SSF A;  3QBY A;  1XOV A;  1U1T A;  4M7D A;  3VUB A;  2QI2 A;  4KUD K;  1OYX A;  2HQE A;  2LQ8 A;  2VV5 A;  5LJ3 d;  3WVE B;  3WXM B;  3G6E A;  2M0O A;  1XTD A;  4JJN K;  3JCM J;  1I8F A;  3LX7 A;  4BI8 B;  2NLU A;  4TVR A;  1KD1 C;  4V2S A;  5CKF A;  4F7U A;  1VQK T;  2MMP A;  3QKJ A;  3GNG A;  4M78 E;  2QXF A;  3CC2 A;  5I21 A;  2VXF A;  4PJO D;  1NPR A;  2FVU A;  1M9S A;  1UGQ B;  3QHS A;  4C5G A;  2P0P A;  4M77 G;  4OGE A;  3V7S A;  4MZM A;  1K73 C;  3UT1 A;  5A0G A;  4ZGE B;  1KC8 U;  1VIF A;  3VYG A;  4PJO E;  3PTA A;  2AHJ B;  4Y91 A;  4MZP A;  4XU2 A;  4M78 B;  2E12 A;  3HKS A;  3LGF A;  3I55 A;  5FU7 C;  3LWI A;  2EYQ A;  4XTZ A;  2RJF A;  4IUV A;  4PJO F;  3JCM e;  1O9S A;  2K2V A;  4X34 A;  3M4G A;  4C0Z A;  2V8K A;  3P8H A;  4PJO B;  2OTJ A;  4M75 D;  2DKG A;  3CCV A;  3R6O A;  4XAX B;  2CYZ B;  2RA2 A;  2XHC A;  3QYG B;  3CCL T;  3JCM W;  1QVG A;  1N9S A;  4M75 E;  1NJI C;  2VGM A;  1KQ2 A;  2LCC A;  3I56 A;  2KAF A;  1S72 A;  2E64 A;  4XTX A;  3TEE A;  3OS2 A;  2FB7 A;  2YLB A;  3CCU A;  2PUO B;  3HRT A;  4E7K A;  4ZN1 A;  3CXC A;  1HK9 A;  4M75 F;  3AHU A;  3CD6 A;  4C8Q G;  4FIB A;  5GAO r;  4M75 B;  4HKE A;  4R55 A;  1BYM A;  3M58 A;  3CCJ T;  3DKM A;  3RKY A;  1N6A A;  5GAM d;  5GAN h;  1U1S A;  3PIP A;  3SWN B;  2F5T X;  3L2W A;  4BE1 A;  2FL7 A;  2KSS A;  1B34 A;  4N4H A;  4XQ3 A;  4J7F A;  4C92 G;  2QQR A;  3HL8 A;  4XK8 E;  5KE2 A;  2MWP A;  3CCE T;  3P8D A;  1N9R A;  4N4G A;  3CCQ T;  1K8A C;  2LTO A;  2DXC A;  3V8L A;  4FL6 A;  3M54 A;  4J8O A;  4C0D C;  5GAO q;  2JTM A;  4IUU A;  3CBP A;  1K9M C;  4MDX A;  3A8O B;  3ER0 A;  3JB9 F;  3V8K A;  2DXU A;  2E70 A;  2CGH A;  4M77 E;  2RI2 A;  1AHJ B;  4X9D A;  1VQ7 T;  1FWZ A;  3M56 A;  3X20 B;  1VQ5 A;  1UEB A;  1EIF A;  2LX9 A;  5FRO A;  3RER A;  2DEQ A;  2A3L A;  3JB9 G;  4LDX A;  5IAY A;  3C4S A;  4M77 F;  1YI2 T;  3M57 A;  5CAI A;  1JRI A;  3KUF A;  4M77 B;  1VQ9 A;  2JNG A;  3MEU A;  2RO0 A;  5GAM g;  1ZBX A;  2E65 A;  2RHX A;  2DIQ A;  5A0D A;  2XID A;  2QDY B;  1Q82 U;  1MGQ A;  4QVD A;  4OB2 B;  3LWH A;  2WAC A;  3CCS A;  4LD9 K;  2CS7 A;  2VGN A;  2QQ9 A;  3QG1 A;  4KT0 E;  4OGC A;  2L3R A;  4RCC A;  3VJP A;  3VYH B;  1X6O A;  3JCM h;  3SDZ A;  4JRP A;  1LOJ A;  3L2R A;  1PSF A;  2FHD A;  1FX7 A;  1YJW A;  3JSC A;  5GMK i;  5GAN 5;  2KMT A;  3L2Z A;  1VQL T;  1M8V A;  5IT9 E;  2JN0 A;  4KUL A;  4NL2 A;  4BDZ A;  5CKB A;  3CPW A;  2YHT A;  1YJN A;  4C8Q E;  5LL6 S;  4C92 D;  2RJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...