3C4SA

Crystal structure of the ssl0352 protein from synechocystis sp. northeast structural genomics consortium target sgr42
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
MIFPGATVRVTNVDDTYYRFEGLVQRVSDGKAAVLFENGNWDKLVTFRLSELEAVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Ssl0352 protein
publication title Crystal structure of the Ssl0352 protein from Synechocystis sp.
rcsb
source organism Synechocystis sp.
total genus 9
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11623 NdhS NAD(P)H dehydrogenase subunit S
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3c4sA00
1N27A 2LTOA 2YRVA 3NTKA 1MHNA 4CRIA 2O4XA 4QQDA 3QBYA 3PMTA 3OA6A 4IUUA 4B9XA 2M0OA 3F70A 3H6ZA 5J39A 3OYMA 2RJEA 3NTIA 4N4IA 3LH0A 1WJRA 3FEOA 4L59A 1H3ZA 3QJ6A 1WGSA 3L2WA 2RHXA 2QQRA 4II1A 1OZ2A 4E7HA 2G3RA 3CEYA 2BIVA 2R58A 4QVZA 3S6WA 3P8DA 3H8ZA 5FRMA 3QIIA 2QQSA 4BE0A 2CKKA 2MWOA 2F5KA 4FU6A 2RI2A 3DB4A 4PL6A 2K3XA 3OMCA 2VYTA 3GOXA 2B8AA 3OS1A 1KHCA 2BKDN 2DAQA 4EDUA 3MEAA 4A4EA 3ME9A 2RJDA 3O8VA 3MP8A 5IAYA 3OY9A 2E6NA 3L2VA 2GF7A 4IUPA 5M9OA 2JTFA 3S3NA 5KE3A 3L2UA 2MWPA 4LD6A 3E9GA 3UT1A 3OYIA 2L8DA 4GY5A 2L89A 2RJFA 3DB3A 3LYIA 3OYCA 2M16A 3M9QA 4UC4A 3OYBA 2EQMA 4BACA 3E9FA 4HCZA 2DIQA 3EAEA 3OS0A 2X4YA 3MO8A 2PQWA 2RHUA 3OS2A 3LLRA 4C5IA 5C6SA 4FL6A 2EKOA 5D6WA 3L2QA 2RO0A 3OMGA 2K3YA 3OYHA 2LDMA 4N4HA 4E7LA 2O4XB 3FC3A 3LX7A 4BE1A 2X35A 3MEWA 5D6YA 3OYEA 3FDRA 1XNIA 3S3MA 5IN1A 1OI1A 3PMIA 3ASKA 3Q1JA 5FRNA 2X4WA 2DIGA 4E7KA 3OYGA 4QQ6A 2GFUA 4IUQA 3MP6A 2LRQA 1G5VA 2RI3A 4BE2A 3L42A 2GFAA 2X4XA 2HQEA 2RHIA 3OYLA 3L2RA 4E7JA 3P8HA 4QW2A 2XDPA 4ZTJA 3LGFA 5CIUA 2LCCA 2M1HA 3DLMA 4C5GA 2L3RA 3OYAA 1WJQA 4PLIA 2RHYA 2EQUA 2P0KA 3C4SA 1WJSA 3OB9A 4IUTA 4OVAA 2R5AA 2XK0A 3NTHA 2WACA 4BDYA 3OYDA 4A4GA 5D6XA 2E5QA 4IKFA 2R5MA 3OYFA 4ZTFA 4C5HA 3PNWC 3OQ5A 3FLGA 1SSFA 2RI5A 2LVMA 3OYNA 3META 4Q5WA 2FHDA 3MEUA 4IUVA 3BDLA 2NLUA 3QKJA 3MP1A 5KH6A 3S3OA 5KE2A 1OYXA 4Z02A 3MEVA 1RI0A 4B9WA 3OYKA 2RHZA 4BDZA 4E7IA 2BUDA 3UWNA 3LGLA 2JZ2A 2EFIA 5J26A 5C0MA 2HQXA 4RG2A 5KCOA 4IURA 3OYJA 1OZ3A 2D9TA 4A4FA 2EQJA 4NS5A 3SD4A 5FROA 4QQGA 5KCHA 4N4GA 3PFSA 3KUFA 4PLLA 3ZEHA 4A4HA 2R57A 4BD3A 2RJCA 4C5EA 2IG0A 4X34A 2EQKA
chains in the Genus database with same CATH superfamily
3JB9D 3REBB 1RADB 1PKTA 1RAEB 1UDLA 2COZA 4C0GA 4LDWA 3CCUQ 1NJIC 1RAIB 2KI7A 2JMAA 5LJ3h 4J7IA 4OMLA 5GAOm 2J05A 1HYOA 1RLQC 1QKWA 2JVVA 1Z9ZA 2ZPFB 3OSSC 3MEAA 2XI9A 3ME9A 1JJ2S 5GAOp 1E7OA 5GMKi 4CC4B 2MWPA 2OAUA 5GAMj 4JZ4A 5FWBA 2FRYA 3OS2A 4ZGEB 4J6WA 5GAN7 3JCMg 2RO0A 2V8JA 2KR3A 1IREB 3RKWA 1IB8A 4CC3A 2X4WA 4LN2A 5GAN4 2F2WA 1T3LA 1PNJA 2CREA 3CCRQ 3THKA 5EG2A 4FYXB 2QAZA 5GANe 2XDDA 4BE2A 2JT4A 4J83A 4D8KA 2KROA 5CIUA 2L3RA 1JO8A 3OW2A 3C4SA 5GAMf 3CCVQ 5LJ5d 1OQKA 1TUGB 4LUEA 3G4SQ 4PJOA 3QKJA 3CPWS 1OYXA 1UECA 3EG9A 3OYKA 3UDCA 1QCNA 2BUDA 4J9CA 3UWNA 1VQ7A 1K8AU 2O9VA 2RPNA 4R56A 4OMQA 2EQJA 2FVUA 3PE0A 2H8HA 3C94A 2MIOA 3PFSA 4M7AF 1VQ7T 4PJOB 1D1AA 4KGXB 2K2VA 1IXDA 1YJ9Q 1YI2Q 2LTOA 3EG9B 3RKXA 2YRVA 3J80E 4J8OA 3QBYA 4XAXB 4IUUA 4B9XA 1JRIA 1V76A 3H0HA 1Y0MA 3CCSA 3QSUA 2G3RA 2HBPA 4ZGJB 1KC8R 5L8RE 3I56A 2NUPB 4HCCA 4VUBA 2M9UA 3CCST 1K0XA 3D7SB 3JCMe 3I56T 3H0IA 3JCMW 3GLXA 1B34B 4M77E 4DBRA 2NYSA 4E6RA 3EG0A 1Q7YR 4CC7A 3QZ9B 1VUBA 1GXIE 5GAN5 3QZ5B 2RJFA 1XJWB 4MMLA 2JMCA 3FRNA 3OBWA 2X4YA 2PQWA 1Q95G 4LUDA 4J9GA 1QLYA 1KC8C 4L5GA 3HRSA 4M77G 4M78B 3CC4Q 3JAME 2ESWA 1W70A 2K5FA 5GANj 2AHJB 4JPBW 3M5AA 1Q7YC 2EQIA 1BKBA 1X75C 3QO3A 1GCQC 5LJ3g 2RI3A 1CSKA 1X2QA 1VQKA 1F1BB 2QXFA 1WDXA 5CKHA 2AT1B 4OP0A 2RQUA 3PVLA 5KYYA 1VQKT 1K9MR 2EWNA 3QYGB 3NTHA 1RAAB 2F2VA 4RMOA 4IKFA 4M7DG 4PK4A 2QTXA 3LW5E 2XHCA 1M9SA 2FYKA 2F2XA 4J9DA 3OYYA 1RL2A 1KHIA 3RMQA 2HD0A 2EGCA 3G71T 4KT0E 1K9MC 5KYUB 2DL5A 3CQTA 4C92E 2A7YA 1QKXA 2GGRA 3PIPA 4OB1B 3RIRA 3M55A 1MHNA 4XTXA 4M75A 2IIMA 4MZPA 1UHCA 4CI0C 4JRQA 3QHSA 2ZPGB 3VS6A 1WFWA 2ENMA 1UGRB 2MMPA 2KT8A 4BUGA 2QQRA 1OZ2A 2EAYA 4M75B 1OPKA 2VWFA 2VYTA 2FB7A 3QDFA 3CD6A 1OEBA 1ZA1B 2GF7A 4C0DB 3CCQQ 5GAOl 4XQ3A 2CDTA 3L2UA 1WQWA 3KXTA 3CD6T 4HCBA 1G3YA 3OYBA 2X3XD 1UHFA 1M1FA 2RHUA 5LJ3e 1PD1A 1WZOA 4RKUE 2LDMA 2OI3A 5D6YA 3M0TA 2DERA 1OI1A 1QMCA 1HXDA 3ASKA 1TWBA 4HXJA 3EHQA 4M7AB 1R0CB 4QVDA 1W6XA 5FU7B 2RQRA 3EFOA 5IHKA 1OOTA 4DQ2A 3LH5A 1VQOQ 1ZSGA 2M1HA 3U23A 5CQXA 2EQUA 4AFSC 2DTIA 2XK0A 4C92C 1TTHB 3CPFA 3MPUB 1N5ZA 3EFOB 3M0QA 2JJ9A 3CCMA 1WXTA 4EPCA 3SFMA 3V7SA 2OTLQ 1YJNQ 3GP8A 5CKDA 2FHDA 2V1QA 3CCMT 1ZUKA 4C8QC 2DEUA 2Y4XA 3JB9H 4OGEA 2K3BA 5J26A 4FSXA 3REAB 4PJOE 1I4K1 1AEYA 1H641 1QVGS 1RLPC 4E2FB 1FX7A 2HZYA 4M77F 2FPEA 3P8BB 4CRIA 4XU0A 1K1ZA 1NYGA 3JCMQ 5A0GA 1MUZA 1X6BA 4PJOG 3FEOA 3CCEA 1K9AA 2RN8A 4JJDA 3BY7A 3QJ6A 1KG1A 3CMAQ 2EW3A 4D6WA 1ZUYA 2SRCA 4E7HA 3VKIA 3EH2A 2C0OA 4FSSA 4BE0A 3EH1A 4JLIA 4N0AC 4EDUA 1AWWA 2JN0A 2M0YA 3CC2A 1MMNA 4Z89A 4LD6A 2XU8A 3UT1A 5LJ3j 2K7AA 2CT4A 3E2UA 2LC4A 5KYXA 1Q81R 3CC2T 4AG1C 4HCZA 3A8MB 3UA6A 2MF2A 1VQLA 3A5ZB 1EIFA 4C0FA 3PGGA 2RQTA 3TCJA 1X01A 3HRTA 5CCAA 3OYHA 2HMAA 5GAMd 1CKAA 3BDUA 1VQLT 1BIBA 2MK5A 3CBPA 5KYXB 4MZMA 4RTYA 2WSFE 1MMGA 1BB9A 2ZPIB 3TREA 2BZ8A 3EGUA 4OB0B 1LOJA 4M78G 1KSWA 1Q81C 1RACB 4FYWB 2RD1A 2EJ9A 1UUEA 3L2RA 4E7JA 3DLMA 2MOXA 2PVOB 2XKOC 4C92F 4AFZC 3EGXB 5LJ3f 2HAXA 2C0TA 2LCLA 1VYUA 3M0UA 4XTZA 1VQMA 2LQWA 1MMAA 1WXBA 5CO7A 2XG8D 1K73U 3VJPA 3EGDB 1VQMT 1PD0A 2EYYA 2XMFA 3VYHB 2O9SA 1YNZA 4ORZA 2RHZA 4F7UA 2BZYA 4PFZA 2DL7A 4QT7A 2HL3A 4RG2A 4RG8A 3I55Q 5A0LA 4ANJA 4PLLA 5A2QE 1GCQA 5GAOr 2IG0A 1ARKA 4R0KA 4ME7A 2E1HA 1GFDA 3CXCS 4RTXA 2O4XA 3X24B 3I35A 1WXUA 2WSCE 2C06A 3NHNA 1UTIA 3OA6A 4HT9A 3H6ZA 4WF2A 4Z88A 2W0ZA 2EBPA 4ZGDB 3ZL7C 4M75E 1N8RR 5CK9A 1UGVA 2H3EB 2JM9A 5FRMA 2LJ3A 2CKKA 5ECAA 1UGSB 3M59A 1HD3A 1PM3A 3OS1A 2ZPBB 3C12A 2DXCA 2E6NA 3L2VA 4DBHA 1GFCA 1N9RA 4JRIA 1YFNA 1E6GA 4M75G 2HEQA 3LYIA 2OTJA 3GBQA 1N8RC 3A98A 3RDVA 2OTJT 5D6WA 1AWOA 4OMMA 4BE1A 3T9NA 3OYEA 1JU5C 3FDRA 2RMOA 1AVZC 2E10A 4E7KA 2EYXA 1MNEA 1R77A 1U5SA 2ATCB 2COWA 4RTTA 4FM4B 3EG1A 4M77B 2YUNA 3A8LB 3IQLA 3MJXA 2DBKA 4PJOF 4JJNK 4M7AG 2LZ6B 4PLIA 3RERA 3EFSA 2RK2A 1T0JA 5I2MA 5A0DA 3KBGA 4BY6C 1AWXA 1U06A 1SSFA 3ZFJA 1RAHB 2YLCA 1M1KR 2KAFA 4FYVB 4IUVA 4Z02A 1TOVA 1KK7A 1RI0A 2PU9B 2A28A 1YWOA 4A4FA 2Y4YA 4EMGA 1ABQA 3WXMB 2QG9B 1YITA 4OMFB 4XTWA 1Q7YU 1M1KC 4J7FA 2YXYA 1I81A 1YITT 1VQ9Q 1NPRA 1WX6A 2GTJA 2RHXA 3MKDA 5LJ5h 3HSBA 4O6JA 2MWOA 1G3WA 2RI2A 1BYMA 4ESRA 4C8QA 3JB9I 2LT4A 1M3CA 2CYZB 2LMJA 2P4TA 4J9EA 4C92B 5KE3A 1U1SA 1GCPA 2RF0A 2FZKB 3G6EQ 1PSEA 1M4ZA 2ZPHB 1KFZA 4JS5A 1G2BA 4E47A 4FL6A 1LNXA 4XK8E 4AMCA 2QQAA 4HKEA 3VRZA 2V8IA 2YUQA 5CQYA 3VRYA 3BW1A 1KQSP 2CT3A 5GAN3 1Q86R 1KJWA 2ZCFB 3JCMb 2GFAA 1BU1A 2E5KA 2DTOA 1YJWA 1M90U 1FWZA 1MV0B 3QYHB 3PVQA 2L3PA 2VASA 4A53A 4N0AA 1M3BA 1KQ2A 4MDXA 1PSFA 1YJWT 1WJSA 3LWHA 1SEMA 3PTAA 2V1RA 3HPWA 2DVEA 1WQ7A 2KEAA 3A8GB 4OB3B 2QDYB 1FMWA 1Q86C 1Y7XA 1SRLA 3J81E 2DLPA 1SF9A 3JB9F 1OULA 4M75F 3GIBA 4FYYB 4A63B 1IRXA 2E3HA 1M8VA 2HQXA 3I5RA 1AT1B 2ED1A 1QVFS 1VQKQ 4KGVB 1G3TA 3GF5A 4F7UE 2CZ0B 3NFCA 1I07A 2COYA 2H3JA 3QG1A 1VQ4A 2DETA 3URGA 5J39A 1ZSZC 5GJWB 2ECZA 3SDZA 3LH0A 1VQ4T 1X27A 4BB7A 1JBMA 1H3ZA 2CSIA 1WGSA 4F7UG 3G71Q 2A37A 3JCMJ 3H8ZA 1M5Q1 3V8LA 3EFRA 2K2MA 4KH0B 2DAQA 2HL5C 5IAYA 3PT9A 3OY9A 5EC7A 1BI3A 1VQ6A 1X6GA 1H3HA 2KMTA 1YBYA 3LWIA 3CMEA 1AZEA 1VQ6T 1KD1R 5HKCA 4KGZB 1V1CA 3CMET 2GQVA 4F14A 3LX7A 3RKYA 2LX7A 1NPPA 1G83A 2KRSA 1NLPC 3O5ZA 2FL7A 2DMOA 3CCUA 3VS2A 4QQ6A 2DFUA 1U8RA 5CR2A 3CD6Q 5LJ5g 3CCUT 2LT1A 2P84A 2LX9A 3P8HA 1KD1C 1QP3A 1SHFA 1ZLMA 1JJ2P 3TSZA 3RBBB 4HVVA 2L3SA 4Y92A 1VQ8A 4A4GA 4ZTFA 3J7AF 1MGQA 3OYNA 3META 1VQ8T 1PCXA 1E6HA 2DBMA 3V8KA 1MV3A 4B9WA 1VIEA 2RA2A 2EFIA 3HHTB 1UGPB 3CBMA 4J6YA 4X1VA 5KCHA 5GMKh 3JCMP 3VU3C 3CCRA 4NL3A 2RJCA 2ZGWA 2GQIA 3CCRT 3SB2A 3CCMQ 1EFNA 5IT9E 4KULA 3M4GA 3NTIA 5HY6A 5KYYB 4ZN1A 3CCVA 2DD4A 5GANf 4HVUA 1D1CA 2DZCA 2P4RA 3CCVT 2F5KA 4FU6A 4PJNA 4BI4A 3N5BB 5CVIA 3CCLQ 2V26A 2X3WD 1OV3A 4KUIA 5GAOq 2KDSA 2CH4W 4BY6B 3DB3A 2CP2A 4C8QE 1WNLA 3OS0A 1LPLA 4AG2C 4C92G 5LJ5e 4NOYA 2DL8A 3M54A 1YJ9A 2KXDA 3RR6A 2PVDB 1TUDA 1W2BP 2VGNA 4RTWA 2FG0A 5IN1A 1M8MA 1YJ9T 4C8QG 2CGHA 2EYWA 2E6ZA 3FJ5A 2VXFA 5GAN2 2HQEA 1WPYA 3LGFA 1U3OA 2JXBA 3QJYA 4C5GA 1N6AA 1B7TA 2RB6A 3M58A 2XDBA 8AT1B 4F7UF 2RK1A 1D3BA 3NPFA 3OW2S 3VYGA 1PRLC 3PNWC 1M2VA 4KUDK 3JCMf 1IHWA 4M4ZA 2QI2A 3MP1A 5GAMh 1K8AR 2KQWA 2YT6A 3TQ7P 4RTZA 4FT2A 5L23A 3QPHA 2K5IA 1SRMA 1Z9QA 2DL3A 2A0FB 3M4YA 1KQSA 2G6FX 2F1LA 1KQ1A 4J6XA 3OYMA 4N4IA 2IVWA 1BIAA 1K8AC 2DZ9A 1GBQA 4QKUA 2AKKA 2BIVA 4OB2B 1Y96A 4RTVA 3DB4A 4M7DD 2LQNA 2NUTA 4NL2A 2QYZA 1YHQQ 1MNDA 1IHVA 2L89A 3OYCA 4BACA 3HFOA 5CKEA 3E19A 3DKMA 3JCMc 5IH2A 2DA9A 2NUTB 1TG0A 4PJJA 1PHTA 2BTTA 1W4SA 3V7CA 3CCET 3UATA 1ZSZA 1VQPQ 1DJ7B 1VOMA 4DOWA 2QEXA 2DILA 2LRQA 5GMKm 2QK0A 2HKQB 2AZVA 3EG2A 2LNHB 4X9CA 2QEXT 1ZHIA 1HSQA 2KT1A 2OTJQ 1PWTA 4J9FA 4ZNXA 3H9NA 3CCQA 3ULRB 2P0KA 4XU1A 1LVKA 3VS7A 2K57A 3V7RA 1LCKA 1OU8A 3CCQT 2KRNA 1WA7A 3RESA 3VS0A 2HQHA 1VQNQ 4FW2A 2PZ1A 5D7UA 4E7IA 1AOJA 2GCXA 3LGLA 3QUIA 1BI1A 1NZ9A 2JTMA 2D6FA 1ZBXA 2KYMA 1NJIU 2I0NA 4EMKC 3CCJQ 2FZCB 2ROTA 2DNUA 4BD3A 4C5EA 4X34A 2LQKA 3FB9A 1T3SA 2QA4Q 1VQOA 4MMKA 4C8QF 2E4HA 4MZTA 3TSWA 1WJRA 2D8JA 2BE7D 2OTLA 1JJ2A 2QQSA 4J9IA 1YJNA 5GMKe 1TH7A 4ZN3A 2E70A 3GOXA 1VA7A 1YIJQ 5J3BA 2JNGA 1FYNA 4PKCC 1ZA2B 2L0AA 3O8VA 3BE3A 2OTLT 1YJNT 2W10A 4X9DA 5GAMg 3E9GA 3OYIA 1OX8A 4F7UB 1IGUA 3A1PA 1D1BA 3UPUA 1AWJA 2CP6A 4UC4A 2DIQA 3EAEA 3SHWA 1QVGP 2FZGB 1GBRA 1VQ5Q 2KK4A 2E65A 1WHLA 3VUZA 1UGQB 2SEMA 2EKOA 2O4XB 3VS1A 1NEBA 2MI6A 3EHRA 1QCOA 3OSVA 5FRNA 3CMAA 3JB9G 4EIKA 4PJOD 2EKHA 1Y71A 6AT1B 3CC7A 4ATOA 2QASA 4ZTJA 5DLQE 4F16A 2YUPA 2K5LA 4AFQC 1NE8A 2PNIA 2KRMA 3CC7T 1BI2A 3OB9A 2J7IA 3I5SA 3M56A 4PFOA 2KGTA 2VVKA 3GPLA 3FLGA 1C6VX 2DKGA 2LVMA 1QP2A 3CPWA 1A0NB 3ER0A 1J3TA 4KBMB 4LDVA 3UF4A 2CP5A 4LNPA 1CKBA 5GANd 2DPPB 2RNAA 1LJOA 4N4GA 5HK0A 3NGPA 1W2BA 2R57A 4LDUA 1K0SA 4M78D 1YN8A 1BCOA 1S72A 3PIOA 2JTEA 4MDWA 3MCAB 5GMKj 5GAMe 1S72T 3L2WA 2A08A 1ABOA 1XQHA 1KC8U 3SWNA 4M7DA 3VS5A 4RCBA 5DY9A 4A4EA 2CH4A 3I9QA 1HJDA 2HSPA 4DBQA 3I55A 1YCYA 3QWXX 2CUDA 2HKNA 3ZBDA 1WHMA 5C6SA 3I55T 2CS7A 2X9HA 4N4HA 3CXCP 2LP5A 4LE9A 3MEWA 1SSHA 1VQ7Q 4XU2A 1X6OA 1NYFA 1UFFA 3JCMd 2J6OA 2X4XA 2YWWA 1RUWA 2DL4A 1WIEA 3C0CA 4C8QB 3V8JA 5GMKl 4FT4A 4JJCA 4JS4A 1K9MU 2XIDA 3OYDA 3CCSQ 1K73R 2EYQA 3I56Q 1AD5A 4M75D 1K4US 2CSQA 3RUXA 3BDLA 5I21A 1OX9A 2AKLA 2QTVA 1IZ6A 2FRWA 3MEVA 5LL6S 5DM7R 2D9TA 3SD4A 4QQGA 3VUBA 2NUZA 5GAN6 4FIBA 2JUFA 1K73C 2YHTA 4LDXA 2QDLA 1QCFA 4DBFA 1X2KA 1VQ8Q 3PMTA 4OGCA 1TXQA 3F70A 2EGAA 1H8KA 5DLOA 4M7AD 2QQBA 4E7ZA 2O2OA 3FJPA 3SEMA 1WHJA 4IIOA 3OS5A 1WI7A 1FXXA 2BKDN 4OMNA 2FEIA 2BE9B 3A8HB 2X4JA 2LNVA 2RM4A 4WCIA 1TSFA 3L1AA 4EMKA 1Y57A 2XD0A 3R6OA 4C5IA 4QVCA 3UA7A 2E12A 2DJQA 2JOYA 2M51A 4TVRA 2P0QA 1Q82R 1VQ9A 5HCKA 4EMKB 3L2ZA 2DIGA 2DXBA 3MP6A 1I5LA 4AFUC 1VQ9T 1G5VA 4XU3A 3GNGA 4E7SA 2CZ7B 2L5QA 1NBEB 2LCCA 5GJVB 1AHJB 1PG5B 2OX7A 1O9SA 3HP9A 1UE9A 3A8OB 5LJ3d 3M53A 2FO0A 1Q82C 2R5MA 3G6EA 3R6NA 2RH2A 4C5HA 2I2LA 2NUPA 1W2BS 2RI5A 3GNFB 3X26B 3DLLA 3M0RA 3G6ET 2NLUA 1UJ0A 1B34A 1PKSA 1U1TA 3WVDB 1R0BG 2O01E 4BDZA 1QVGA 2OAWA 5KCOA 3OYJA 2F69A 4OMOA 3HKSA 4NS5A 1D0ZA 1I0CA 2DXUA 2LQ8A 4RCCA 1N27A 2ZPEB 4M78A 3NTKA 1UJYA 2PTKA 1JXOA 5KYWA 2KBTA 2DD5A 1X43A 2WSEE 2JS2A 2Y90A 1RAFB 4JRKA 4HT8A 2J06A 1JQQA 3S6WA 2RQVA 1WYXA 1W1FA 1FMKA 5KYWB 2KYBA 1WHGA 4KH1B 1IO6A 3G7ZA 1JXMA 1SPKA 2D1XA 4M7DE 5IXFA 4WTOB 1N9SA 1QVFP 2P0PA 4D8DA 1Q81U 3MO8A 4OMPA 2X51A 3LLRA 1YCSB 3OMGA 4E7LA 4A54A 3H41A 2LJ0A 1WLPB 3S3MA 3G4SA 4DA4A 3Q1JA 5KYUA 3BFMA 2QGGA 1UB4A 3OYGA 3CPWP 2KNBB 1Y07A 1NLOC 3G4ST 3G71A 9ATCB 3L42A 1M90R 2DO3A 1VYTA 2LJ1A 1ZX6A 1WJQA 2AK5A 1YI2A 3CCEQ 2K9GA 1XTDA 4GLMA 3OYFA 1P92A 4M77C 1YI2T 2DM1A 1WHHA 4F17A 2L3QA 4LD9K 4JLGA 1GL5A 2YRCA 4PJMA 2A3LA 1M90C 4PNOA 2ZZDA 2CP0A 1VIFA 4O5VA 2YDLA 3CC2Q 2VKNA 1NG2A 4EMHA 2QEXQ 2DVJA 1B07A 2VXEA 1SKUB 1I1JA 4BI3A 4A4HA 2YUOA 3EG3A 3CXCA 1VQLQ 3AHUA 2EVRA 3HRUA 5FW9A 4QQDA 2VV5A 2K4YA 3SWNC 4M7DC 2M0OA 3HFNA 1KIKA 3C95A 2PUKB 4PJLA 4M7AA 3MHXA 3CC4A 2L2PA 1QQJA 1D3BB 3FIFA 4II1A 1N8RU 4M77D 4QVZA 3QIIA 4HVWA 1ACMB 4F04B 4PL6A 1M2VB 3CC4T 2JS0A 2LCSA 1OPLA 1KHCA 1G8XA 2E64A 1RAGB 4GLKA 2F5TX 2L8DA 4Y91A 4BI8B 2HDAA 2HCKA 1IGQA 3M9QA 1VQMQ 2EQMA 5KYNA 3E9FA 1I8FA 3TEEA 5GAOn 2VB6A 3VV0A 5FU6C 4OF1A 5AT1B 2X35A 2ABLA 1XNIA 2PUOB 1FMVA 3OBYA 2HBWA 3H0FA 4IUQA 4AT1B 1K76A 4J5YA 5LJ5j 3TU4K 3CBOA 2RHIA 4K11A 2A36A 4DOVA 1Y96B 1D0YA 2DF6A 2HSEB 4QW2A 3CCLA 2NWMA 2DEQA 1OU9A 4IUTA 5IHNA 2R5AA 3CCLT 4FW1A 3X20B 2EJGA 2EIFA 3JSCA 2DYIA 4Q5WA 3MEUA 2AZSA 1M1KU 3S3OA 2B86A 1EX4A 4C92D 4LDYA 1ZSZB 2ZAEA 3CC7Q 1OZ3A 1YP5A 5FROA 1PC0A 2AIRB 2K6DA 1QVPA 2KVQG 3KUFA 4HCKA 1UEBA 4J9HA 4C8QD 5LJ5f 5IXBA 4RTUA 4M7DF 1M1GA 4PFPA 2RJEA 4P5NA 1JEGA 2YRDA 4M78E 3X28B 3KFVA 4V2SA 1O75A 3NMZC 2QGFB 3E1SA 4ELYC 3OW2P 1G3SA 1JB0E 1QWFA 4C0ZA 2K3XA 3OMCA 4LXCA 3M57A 2EPDA 2RJDA 2PVGB 2FPFA 5M9OA 2JTFA 2MAMA 3EGXA 4DEYA 1TUCA 4KRTA 2KXCA 4GY5A 4JJBA 1C0MA 5GANh 5I22A 1TS9A 4JRPA 2CUBA 2RQWA 4R55A 2E3IA 1M27C 1S72Q 1VQOT 1M2OA 3EGDA 1SG5A 1XOVA 4PJOC 1D0XA 3JCMX 1BBZA 3L2QA 2D8HA 2VUBA 2K3YA 1VYVA 8ATCB 3FC3A 2DE0X 1RABB 2CZ1B 1R8OB 5CKFA 2CP7A 2DTHA 4JUVA 2O31A 2GFUA 1HK9A 5HK3A 2KSSA 4RUGA 1Q86U 3QWYA 2IPOB 2DK3A 3OYLA 1V29B 1YITQ 1ZUUA 2VGMA 3JCMV 3WVEB 1BK2A 1AZGB 3RMSA 7AT1B 1YWPA 2CP3A 1SHGA 3M0SA 2KE9A 4IIMA 2RHYA 1YHQA 2HNIA 2CZ6B 4GBQA 1PRMC 1WHKA 4JZ3A 3JB9J 2E5QA 4A4KA 1YHQT 2V8KA 3OQ5A 3JRZA 1X69A 2DJZA 3X25B 4XTUA 5KH6A 4FCYA 5KE2A 1QVFA 4M78C 2QQ9A 3CMAT 1M30A 2JZ2A 1MMDA 5C0MA 1B3QA 3G1JA 5FWCA 1VQPA 3QDRB 5CKBA 2M02A 3TVTA 4JDSA 2J6KA 5IHIA 5FLXE 2JM8A 2ED0A 3JCMh 1VQPT 2MYSA 1ZBJA 4J9BA 1NM7A 1S1NA 2E41A 2MPXC 3AT1B 1KQSS 1BI0A 2D0NA 1QW1A 4L59A 3M0PA 2DXTA 2VC8A 2DX1A 3CEYA 4M77A 2R58A 3P8DA 2C0IA 1VQNA 1YJWQ 4M7AE 3VS4A 2XICA 2B8AA 1D09B 2EJFA 1RI9A 2YLBA 3MP8A 3S3NA 4XTYA 4IUPA 1Q82U 4XTVA 1VQNT 2D0QB 1I5OB 5AYFA 2Z0WA 3JV3A 4DEXA 2K79A 4ELZC 2MCNA 2GNCA 2M16A 1C1AA 2YSQA 2FPDA 4HA8A 3CCJA 2J6FA 1EZZB 3HTRA 2DYBA 2ROLA 4Z8AA 1KD1U 5I11A 3CCJT 2QA4A 4L6V5 1GRIA 2JW4A 3PMIA 5I2SA 2QA4T 3INZA 2OJ2A 1T0HA 3SWNB 2O88A 4M75C 1VQ4Q 4M7DB 2XDPA 1YIJA 1NEGA 2EYZA 3OYAA 3RNJA 1UG1A 1M3AA 5CAIA 4OVAA 4C0DC 4BDYA 2WACA 1YIJT 5GAN8 1H92A 4YTLA 2GBQA 2EGEA 2GTOA 5D6XA 3HL8A 3VS3A 5GANg 4B6MA 1VQ5A 2KY9A 3QXEB 2DRKA 4Y28E 4M78F 4C92A 1VQ5T 4CC2A 1BCMA 1VQ6Q 1NJIR 1ZQ1A 2BZXA 4IURA 3CMEQ 1TU0B 1QWEA 3ZEHA 2DRMA 4M7AC 5FU6B 5FU7C 2EQKA
chains in the Genus database with same CATH topology
4RCCA 3M4YA 1N27A 2ZPEB 2E1HA 4ME7A 3NTKA 4M78A 3CXCS 3JB9D 2O4XA 3X24B 1KQSA 2WSCE 2C06A 1KQ1A 3OA6A 4HT9A 3H6ZA 4J6XA 3OYMA 4WF2A 4C0GA 4N4IA 2IVWA 2DD5A 4ZGDB 4LDWA 1BIAA 1K8AC 2WSEE 2Y90A 4M75E 2DZ9A 1NJIC 4JRKA 5LJ3h 4HT8A 4J7IA 5CK9A 2BIVA 4OB2B 3S6WA 5FRMA 5GAOm 2CKKA 1UGSB 1Y96A 3M59A 3DB4A 2JVVA 4M7DD 3OS1A 2ZPFB 2ZPBB 4NL2A 3OSSC 3MEAA 2XI9A 3ME9A 3C12A 1JJ2S 5GAOp 2DXCA 2E6NA 3G7ZA 3L2VA 5GMKi 1N9RA 2MWPA 4M7DE 2OAUA 5GAMj 4JRIA 4M75G 2L89A 3LYIA 3OYCA 1N9SA 2OTJA 4BACA 3HFOA 2P0PA 3E19A 5CKEA 1Q81U 3DKMA 1N8RC 3JCMc 3MO8A 3OS2A 4ZGEB 4J6WA 3LLRA 5GAN7 2OTJT 5D6WA 3JCMg 2RO0A 3OMGA 2V8JA 1W4SA 1IREB 3RKWA 3V7CA 4A54A 4E7LA 4BE1A 3CCET 3T9NA 3OYEA 3FDRA 3S3MA 3G4SA 4DA4A 3Q1JA 3BFMA 1UB4A 2E10A 2X4WA 4E7KA 5GAN4 1DJ7B 3OYGA 4DOWA 4FM4B 2QEXA 1Y07A 5EG2A 3G4ST 5GANe 3G71A 2LRQA 5GMKm 4M77B 2XDDA 3L42A 4BE2A 2DO3A 3A8LB 4J83A 4X9CA 2QEXT 1ZHIA 5CIUA 4PJOF 4JJNK 2L3RA 4M7AG 1WJQA 4PLIA 3RERA 3EFSA 3CCQA 3OW2A 2P0KA 4XU1A 3C4SA 5GAMf 1YI2A 2RK2A 5A0DA 1XTDA 5I2MA 2K57A 3V7RA 3KBGA 4BY6C 5LJ5d 3OYFA 1P92A 3CCQT 4M77C 1YI2T 3RESA 1SSFA 4LD9K 4JLGA 3ZFJA 2YLCA 2KAFA 4IUVA 2A3LA 1M90C 4PJOA 4PNOA 2ZZDA 3QKJA 1VIFA 4O5VA 3CPWS 1OYXA 4Z02A 1RI0A 2PU9B 3UDCA 3OYKA 4E7IA 2GCXA 2BUDA 3UWNA 3LGLA 4EMHA 1VQ7A 3QUIA 1BI1A 1K8AU 4R56A 2JTMA 1NZ9A 2VXEA 1ZBXA 1NJIU 2D6FA 4A4FA 2EQJA 2FVUA 2Y4YA 4EMGA 4EMKC 3C94A 4BI3A 3PFSA 4A4HA 4M7AF 3CXCA 1VQ7T 4PJOB 4BD3A 4C5EA 3AHUA 2K2VA 4X34A 3HRUA 2LQKA 3WXMB 2LTOA 1YITA 3FB9A 4OMFB 2YRVA 3RKXA 4XTWA 3J80E 1Q7YU 4QQDA 4J8OA 4J7FA 2VV5A 2K4YA 3QBYA 4XAXB 3SWNC 1VQOA 4M7DC 4MMKA 4IUUA 4B9XA 2M0OA 4C8QF 4MZTA 1I81A 1YITT 3HFNA 1JRIA 1NPRA 1WJRA 3C95A 2PUKB 4M7AA 3MHXA 3CCSA 3CC4A 1D3BB 2RHXA 3FIFA 4II1A 3QSUA 2G3RA 2HBPA 4ZGJB 5LJ5h 1N8RU 4M77D 4QVZA 5L8RE 3I56A 2OTLA 3QIIA 1JJ2A 2QQSA 4O6JA 1YJNA 2MWOA 5GMKe 1G3WA 4PL6A 1TH7A 2M9UA 2RI2A 4VUBA 3CC4T 3CCST 4HCCA 1BYMA 4ZN3A 2E70A 3GOXA 1KHCA 5J3BA 2JNGA 4C8QA 3JCMe 3JB9I 4PKCC 3O8VA 2LT4A 2CYZB 3I56T 3GLXA 1B34B 2E64A 2P4TA 4M77E 3JCMW 1YJNT 4C92B 2OTLT 5KE3A 4GLKA 1U1SA 4X9DA 3QZ9B 5GAMg 3E9GA 1VUBA 2F5TX 2L8DA 4Y91A 3QZ5B 4F7UB 4BI8B 5GAN5 2RJFA 1GXIE 3UPUA 4MMLA 3M9QA 4UC4A 1PSEA 2EQMA 3FRNA 1M4ZA 3E9FA 3OBWA 1I8FA 2DIQA 2ZPHB 2X4YA 3EAEA 4JS5A 2PQWA 2KK4A 3TEEA 2E65A 3VUZA 4E47A 5GAOn 1UGQB 4FL6A 1KC8C 2EKOA 3VV0A 4L5GA 5FU6C 1LNXA 3HRSA 4M77G 4M78B 4OF1A 2O4XB 4XK8E 2MI6A 2X35A 3JAME 1XNIA 2K5FA 2PUOB 2QQAA 5GANj 2AHJB 4HKEA 2V8IA 3M5AA 1Q7YC 3OSVA 5CQYA 5FRNA 3BW1A 3OBYA 1BKBA 1X75C 3QO3A 5GAN3 3CMAA 3JB9G 4IUQA 4PJOD 5LJ3g 2ZCFB 2RI3A 4J5YA 5LJ5j 3JCMb 1Y71A 3CC7A 2GFAA 3CBOA 2RHIA 3TU4K 4DOVA 2DTOA 1Y96B 1YJWA 1M90U 1FWZA 1VQKA 4ATOA 3QYHB 4QW2A 4ZTJA 2QXFA 5DLQE 4A53A 2K5LA 4N0AA 5CKHA 3CCLA 1NE8A 4OP0A 2DEQA 3CC7T 1KQ2A 4MDXA 1BI2A 1PSFA 1WJSA 3OB9A 4IUTA 2EWNA 3LWHA 1YJWT 2R5AA 3QYGB 3NTHA 3PTAA 3M56A 4RMOA 3CCLT 3HPWA 4IKFA 4M7DG 2DVEA 3X20B 1WQ7A 2EJGA 3A8GB 2EIFA 4OB3B 3GPLA 2QDYB 3FLGA 2QTXA 3JSCA 2DKGA 2LVMA 1QP2A 3CPWA 3LW5E 4Q5WA 2XHCA 1Q86C 3ER0A 1Y7XA 3MEUA 1M9SA 4KBMB 4LDVA 2FYKA 3J81E 1M1KU 3S3OA 3OYYA 1RL2A 3JB9F 4C92D 1KHIA 4M75F 2HD0A 4LDYA 3RMQA 3GIBA 5GANd 1M8VA 2HQXA 3G71T 2DPPB 4KT0E 1K9MC 1QVFS 1OZ3A 5FROA 1LJOA 4C92E 2A7YA 1QVPA 2KVQG 4N4GA 3KUFA 5HK0A 1UEBA 3PIPA 1G3TA 3GF5A 4F7UE 4C8QD 4OB1B 5LJ5f 2R57A 4LDUA 1W2BA 2CZ0B 3NFCA 3RIRA 2H3JA 3M55A 4M78D 3QG1A 1MHNA 4XTXA 1VQ4A 4M75A 4M7DF 4MZPA 4CI0C 4JRQA 3PIOA 1S72A 3URGA 1M1GA 5J39A 3QHSA 2ZPGB 2RJEA 4P5NA 3SDZA 3LH0A 4MDWA 3MCAB 5GMKj 4M78E 3X28B 1UGRB 4BB7A 1O75A 5GAMe 1VQ4T 1JBMA 1S72T 4V2SA 1H3ZA 2MMPA 1WGSA 3E1SA 4BUGA 4ELYC 3L2WA 2QQRA 4F7UG 1OZ2A 1G3SA 1JB0E 2EAYA 3JCMJ 3H8ZA 4C0ZA 1XQHA 4M75B 1M5Q1 1KC8U 3SWNA 4M7DA 2K3XA 3OMCA 3V8LA 2VYTA 3EFRA 2FB7A 4RCBA 3M57A 3CD6A 2DAQA 5DY9A 4A4EA 2RJDA 2PVGB 5IAYA 3PT9A 3OY9A 2GF7A 4C0DB 5M9OA 2JTFA 2MAMA 1BI3A 5GAOl 4XQ3A 3L2UA 1WQWA 1VQ6A 3KXTA 4GY5A 3CD6T 2KMTA 1YBYA 3I55A 5GANh 3LWIA 4HCBA 1G3YA 3OYBA 3CMEA 1YCYA 4JRPA 1M1FA 4R55A 1VQ6T 2RHUA 3ZBDA 1VQOT 5LJ3e 5C6SA 3I55T 1XOVA 4PJOC 2CS7A 3JCMX 5HKCA 4RKUE 3L2QA 3CMET 2VUBA 2K3YA 2LDMA 2GQVA 4N4HA 3FC3A 3LX7A 3MEWA 5D6YA 3RKYA 1OI1A 1X6OA 2CZ1B 4XU2A 1HXDA 1R8OB 1NPPA 3ASKA 5CKFA 2FL7A 2DTHA 3CCUA 4JUVA 4M7AB 4QQ6A 1U8RA 4QVDA 5CR2A 2GFUA 1HK9A 3JCMd 5FU7B 5HK3A 2KSSA 5LJ5g 1Q86U 4DQ2A 2X4XA 2LT1A 2DK3A 3OYLA 1V29B 3CCUT 2LX9A 3P8HA 1KD1C 2VGMA 1QP3A 3JCMV 3WVEB 3RMSA 2M1HA 4C8QB 5CQXA 3V8JA 2RHYA 5GMKl 1YHQA 2EQUA 4FT4A 2HNIA 4JS4A 2DTIA 2XK0A 4C92C 2CZ6B 1K9MU 2XIDA 3OYDA 1VQ8A 3CPFA 4A4GA 3JB9J 2E5QA 4A4KA 3CCMA 4ZTFA 1YHQT 2V8KA 3OQ5A 4EPCA 2EYQA 3JRZA 3SFMA 3V7SA 4M75D 3J7AF 1MGQA 3OYNA 3META 3GP8A 5CKDA 1VQ8T 2DJZA 2FHDA 3RUXA 3X25B 4XTUA 3BDLA 4C8QC 3CCMT 5I21A 5KH6A 3V8KA 2Y4XA 5KE2A 1IZ6A 3JB9H 4OGEA 1QVFA 3MEVA 4M78C 4B9WA 1VIEA 2QQ9A 3CMAT 2RA2A 2JZ2A 2EFIA 5J26A 4FSXA 5LL6S 5C0MA 3HHTB 4PJOE 1I4K1 1UGPB 5DM7R 3CBMA 2D9TA 1H641 3SD4A 1VQPA 4J6YA 1QVGS 3QDRB 5CKBA 4QQGA 5KCHA 5GMKh 3JCMP 3VUBA 3VU3C 5GAN6 3CCRA 4JDSA 1FX7A 4FIBA 5FLXE 4NL3A 2JUFA 2RJCA 3JCMh 1K73C 2YHTA 4M77F 3HSBA 4LDXA 1VQPT 2ZGWA 3P8BB 4CRIA 4XU0A 3CCRT 3PMTA 3SB2A 3JCMQ 4OGCA 3F70A 5A0GA 5IT9E 4KULA 3M4GA 2E41A 3NTIA 5HY6A 4PJOG 1KQSS 1BI0A 3FEOA 4ZN1A 1QW1A 3CCEA 3CCVA 4L59A 5DLOA 3BY7A 3QJ6A 2DXTA 4M7AD 2DD4A 2QQBA 2VC8A 4D6WA 5GANf 1KG1A 4E7HA 2DZCA 3CEYA 2R58A 4M77A 3VKIA 3P8DA 3FJPA 4BE0A 3CCVT 4JLIA 2F5KA 4FU6A 1VQNA 4M7AE 2XICA 2B8AA 3OS5A 3N5BB 4N0AC 4BI4A 2EJFA 1FXXA 2BKDN 5CVIA 4EDUA 3OYIA 2JN0A 2YLBA 3MP8A 3S3NA 4XTYA 4IUPA 1Q82U 3CC2A 4XTVA 1VQNT 2D0QB 4KUIA 2KDSA 3A8HB 5GAOq 5AYFA 4LD6A 2XU8A 3UT1A 5LJ3j 4BY6B 3DB3A 2X4JA 2LNVA 2RM4A 4C8QE 4ELZC 2LC4A 2M16A 3L1AA 1WNLA 3CC2T 4HCZA 3OS0A 3A8MB 4HA8A 4EMKA 3CCJA 2MF2A 1VQLA 2XD0A 4C92G 3A5ZB 1EIFA 3R6OA 4C5IA 4C0FA 3PGGA 5LJ5e 4NOYA 4QVCA 3M54A 3TCJA 1X01A 2E12A 3HRTA 5CCAA 1YJ9A 1KD1U 3OYHA 3CCJT 1VQKT 2PVDB 5GAMd 2QA4A 2VGNA 3BDUA 1VQLT 1BIBA 2JOYA 3CBPA 4L6V5 5IN1A 4TVRA 2P0QA 4MZMA 1YJ9T 3PMIA 1VQ9A 2WSFE 5I2SA 4C8QG 2CGHA 4EMKB 3L2ZA 2QA4T 2DIGA 2E6ZA 2ZPIB 3TREA 3INZA 4OB0B 2VXFA 1LOJA 2DXBA 4M78G 3MP6A 1Q81C 1I5LA 1VQ9T 1G5VA 2RD1A 4XU3A 2EJ9A 3GNGA 5GAN2 2HQEA 3L2RA 2CZ7B 1WPYA 3SWNB 4E7JA 4M75C 4M7DB 2L5QA 2XDPA 1YIJA 3LGFA 2LCCA 3QJYA 3DLMA 1N6AA 4C5GA 3OYAA 2PVOB 1AHJB 2XKOC 2RB6A 4C92F 5CAIA 3M58A 4OVAA 4C0DC 5LJ3f 4BDYA 1O9SA 3HP9A 2WACA 1YIJT 2HAXA 5GAN8 2XDBA 4F7UF 3A8OB 4YTLA 2LCLA 2RK1A 3M53A 5LJ3d 5D6XA 1Q82C 1D3BA 3HL8A 2R5MA 3G6EA 3OW2S 4C5HA 2RH2A 4XTZA 3PNWC 3VYGA 5GANg 1VQMA 2I2LA 1W2BS 5CO7A 2RI5A 3GNFB 2XG8D 1K73U 1VQ5A 2KY9A 3QXEB 3X26B 3VJPA 3DLLA 4KUDK 3JCMf 3G6ET 1M1KC 1VQMT 2NLUA 2QI2A 3MP1A 1B34A 4Y28E 1U1TA 4M78F 3VYHB 3WVDB 4C92A 1VQ5T 5GAMh 2O01E 2RHZA 4BDZA 1QVGA 4F7UA 2KQWA 1ZQ1A 4FT2A 4RG2A 4RG8A 4IURA 5KCOA 3OYJA 2F69A 5A0LA 3QPHA 3HKSA 4NS5A 2K5IA 2DXUA 3ZEHA 4PLLA 5A2QE 4M7AC 2LQ8A 5FU6B 5GAOr 2IG0A 5FU7C 2EQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N27 A;  2LTO A;  2YRV A;  3NTK A;  1MHN A;  4CRI A;  2O4X A;  4QQD A;  3QBY A;  3PMT A;  3OA6 A;  4IUU A;  4B9X A;  2M0O A;  3F70 A;  3H6Z A;  5J39 A;  3OYM A;  2RJE A;  3NTI A;  4N4I A;  3LH0 A;  1WJR A;  3FEO A;  4L59 A;  1H3Z A;  3QJ6 A;  1WGS A;  3L2W A;  2RHX A;  2QQR A;  4II1 A;  1OZ2 A;  4E7H A;  2G3R A;  3CEY A;  2BIV A;  2R58 A;  4QVZ A;  3S6W A;  3P8D A;  3H8Z A;  5FRM A;  3QII A;  2QQS A;  4BE0 A;  2CKK A;  2MWO A;  2F5K A;  4FU6 A;  2RI2 A;  3DB4 A;  4PL6 A;  2K3X A;  3OMC A;  2VYT A;  3GOX A;  2B8A A;  3OS1 A;  1KHC A;  2BKD N;  2DAQ A;  4EDU A;  3MEA A;  4A4E A;  3ME9 A;  2RJD A;  3O8V A;  3MP8 A;  5IAY A;  3OY9 A;  2E6N A;  3L2V A;  2GF7 A;  4IUP A;  5M9O A;  2JTF A;  3S3N A;  5KE3 A;  3L2U A;  2MWP A;  4LD6 A;  3E9G A;  3UT1 A;  3OYI A;  2L8D A;  4GY5 A;  2L89 A;  2RJF A;  3DB3 A;  3LYI A;  3OYC A;  2M16 A;  3M9Q A;  4UC4 A;  3OYB A;  2EQM A;  4BAC A;  3E9F A;  4HCZ A;  2DIQ A;  3EAE A;  3OS0 A;  2X4Y A;  3MO8 A;  2PQW A;  2RHU A;  3OS2 A;  3LLR A;  4C5I A;  5C6S A;  4FL6 A;  2EKO A;  5D6W A;  3L2Q A;  2RO0 A;  3OMG A;  2K3Y A;  3OYH A;  2LDM A;  4N4H A;  4E7L A;  2O4X B;  3FC3 A;  3LX7 A;  4BE1 A;  2X35 A;  3MEW A;  5D6Y A;  3OYE A;  3FDR A;  1XNI A;  3S3M A;  5IN1 A;  1OI1 A;  3PMI A;  3ASK A;  3Q1J A;  5FRN A;  2X4W A;  2DIG A;  4E7K A;  3OYG A;  4QQ6 A;  2GFU A;  4IUQ A;  3MP6 A;  2LRQ A;  1G5V A;  2RI3 A;  4BE2 A;  3L42 A;  2GFA A;  2X4X A;  2HQE A;  2RHI A;  3OYL A;  3L2R A;  4E7J A;  3P8H A;  4QW2 A;  2XDP A;  4ZTJ A;  3LGF A;  5CIU A;  2LCC A;  2M1H A;  3DLM A;  4C5G A;  2L3R A;  3OYA A;  1WJQ A;  4PLI A;  2RHY A;  2EQU A;  2P0K A;  3C4S A;  1WJS A;  3OB9 A;  4IUT A;  4OVA A;  2R5A A;  2XK0 A;  3NTH A;  2WAC A;  4BDY A;  3OYD A;  4A4G A;  5D6X A;  2E5Q A;  4IKF A;  2R5M A;  3OYF A;  4ZTF A;  4C5H A;  3PNW C;  3OQ5 A;  3FLG A;  1SSF A;  2RI5 A;  2LVM A;  3OYN A;  3MET A;  4Q5W A;  2FHD A;  3MEU A;  4IUV A;  3BDL A;  2NLU A;  3QKJ A;  3MP1 A;  5KH6 A;  3S3O A;  5KE2 A;  1OYX A;  4Z02 A;  3MEV A;  1RI0 A;  4B9W A;  3OYK A;  2RHZ A;  4BDZ A;  4E7I A;  2BUD A;  3UWN A;  3LGL A;  2JZ2 A;  2EFI A;  5J26 A;  5C0M A;  2HQX A;  4RG2 A;  5KCO A;  4IUR A;  3OYJ A;  1OZ3 A;  2D9T A;  4A4F A;  2EQJ A;  4NS5 A;  3SD4 A;  5FRO A;  4QQG A;  5KCH A;  4N4G A;  3PFS A;  3KUF A;  4PLL A;  3ZEH A;  4A4H A;  2R57 A;  4BD3 A;  2RJC A;  4C5E A;  2IG0 A;  4X34 A;  2EQK A; 
#chains in the Genus database with same CATH topology
 3JB9 D;  3REB B;  1RAD B;  1PKT A;  1RAE B;  1UDL A;  2COZ A;  4C0G A;  4LDW A;  3CCU Q;  1NJI C;  1RAI B;  2KI7 A;  2JMA A;  5LJ3 h;  4J7I A;  4OML A;  5GAO m;  2J05 A;  1HYO A;  1RLQ C;  1QKW A;  2JVV A;  1Z9Z A;  2ZPF B;  3OSS C;  3MEA A;  2XI9 A;  3ME9 A;  1JJ2 S;  5GAO p;  1E7O A;  5GMK i;  4CC4 B;  2MWP A;  2OAU A;  5GAM j;  4JZ4 A;  5FWB A;  2FRY A;  3OS2 A;  4ZGE B;  4J6W A;  5GAN 7;  3JCM g;  2RO0 A;  2V8J A;  2KR3 A;  1IRE B;  3RKW A;  1IB8 A;  4CC3 A;  2X4W A;  4LN2 A;  5GAN 4;  2F2W A;  1T3L A;  1PNJ A;  2CRE A;  3CCR Q;  3THK A;  5EG2 A;  4FYX B;  2QAZ A;  5GAN e;  2XDD A;  4BE2 A;  2JT4 A;  4J83 A;  4D8K A;  2KRO A;  5CIU A;  2L3R A;  1JO8 A;  3OW2 A;  3C4S A;  5GAM f;  3CCV Q;  5LJ5 d;  1OQK A;  1TUG B;  4LUE A;  3G4S Q;  4PJO A;  3QKJ A;  3CPW S;  1OYX A;  1UEC A;  3EG9 A;  3OYK A;  3UDC A;  1QCN A;  2BUD A;  4J9C A;  3UWN A;  1VQ7 A;  1K8A U;  2O9V A;  2RPN A;  4R56 A;  4OMQ A;  2EQJ A;  2FVU A;  3PE0 A;  2H8H A;  3C94 A;  2MIO A;  3PFS A;  4M7A F;  1VQ7 T;  4PJO B;  1D1A A;  4KGX B;  2K2V A;  1IXD A;  1YJ9 Q;  1YI2 Q;  2LTO A;  3EG9 B;  3RKX A;  2YRV A;  3J80 E;  4J8O A;  3QBY A;  4XAX B;  4IUU A;  4B9X A;  1JRI A;  1V76 A;  3H0H A;  1Y0M A;  3CCS A;  3QSU A;  2G3R A;  2HBP A;  4ZGJ B;  1KC8 R;  5L8R E;  3I56 A;  2NUP B;  4HCC A;  4VUB A;  2M9U A;  3CCS T;  1K0X A;  3D7S B;  3JCM e;  3I56 T;  3H0I A;  3JCM W;  3GLX A;  1B34 B;  4M77 E;  4DBR A;  2NYS A;  4E6R A;  3EG0 A;  1Q7Y R;  4CC7 A;  3QZ9 B;  1VUB A;  1GXI E;  5GAN 5;  3QZ5 B;  2RJF A;  1XJW B;  4MML A;  2JMC A;  3FRN A;  3OBW A;  2X4Y A;  2PQW A;  1Q95 G;  4LUD A;  4J9G A;  1QLY A;  1KC8 C;  4L5G A;  3HRS A;  4M77 G;  4M78 B;  3CC4 Q;  3JAM E;  2ESW A;  1W70 A;  2K5F A;  5GAN j;  2AHJ B;  4JPB W;  3M5A A;  1Q7Y C;  2EQI A;  1BKB A;  1X75 C;  3QO3 A;  1GCQ C;  5LJ3 g;  2RI3 A;  1CSK A;  1X2Q A;  1VQK A;  1F1B B;  2QXF A;  1WDX A;  5CKH A;  2AT1 B;  4OP0 A;  2RQU A;  3PVL A;  5KYY A;  1VQK T;  1K9M R;  2EWN A;  3QYG B;  3NTH A;  1RAA B;  2F2V A;  4RMO A;  4IKF A;  4M7D G;  4PK4 A;  2QTX A;  3LW5 E;  2XHC A;  1M9S A;  2FYK A;  2F2X A;  4J9D A;  3OYY A;  1RL2 A;  1KHI A;  3RMQ A;  2HD0 A;  2EGC A;  3G71 T;  4KT0 E;  1K9M C;  5KYU B;  2DL5 A;  3CQT A;  4C92 E;  2A7Y A;  1QKX A;  2GGR A;  3PIP A;  4OB1 B;  3RIR A;  3M55 A;  1MHN A;  4XTX A;  4M75 A;  2IIM A;  4MZP A;  1UHC A;  4CI0 C;  4JRQ A;  3QHS A;  2ZPG B;  3VS6 A;  1WFW A;  2ENM A;  1UGR B;  2MMP A;  2KT8 A;  4BUG A;  2QQR A;  1OZ2 A;  2EAY A;  4M75 B;  1OPK A;  2VWF A;  2VYT A;  2FB7 A;  3QDF A;  3CD6 A;  1OEB A;  1ZA1 B;  2GF7 A;  4C0D B;  3CCQ Q;  5GAO l;  4XQ3 A;  2CDT A;  3L2U A;  1WQW A;  3KXT A;  3CD6 T;  4HCB A;  1G3Y A;  3OYB A;  2X3X D;  1UHF A;  1M1F A;  2RHU A;  5LJ3 e;  1PD1 A;  1WZO A;  4RKU E;  2LDM A;  2OI3 A;  5D6Y A;  3M0T A;  2DER A;  1OI1 A;  1QMC A;  1HXD A;  3ASK A;  1TWB A;  4HXJ A;  3EHQ A;  4M7A B;  1R0C B;  4QVD A;  1W6X A;  5FU7 B;  2RQR A;  3EFO A;  5IHK A;  1OOT A;  4DQ2 A;  3LH5 A;  1VQO Q;  1ZSG A;  2M1H A;  3U23 A;  5CQX A;  2EQU A;  4AFS C;  2DTI A;  2XK0 A;  4C92 C;  1TTH B;  3CPF A;  3MPU B;  1N5Z A;  3EFO B;  3M0Q A;  2JJ9 A;  3CCM A;  1WXT A;  4EPC A;  3SFM A;  3V7S A;  2OTL Q;  1YJN Q;  3GP8 A;  5CKD A;  2FHD A;  2V1Q A;  3CCM T;  1ZUK A;  4C8Q C;  2DEU A;  2Y4X A;  3JB9 H;  4OGE A;  2K3B A;  5J26 A;  4FSX A;  3REA B;  4PJO E;  1I4K 1;  1AEY A;  1H64 1;  1QVG S;  1RLP C;  4E2F B;  1FX7 A;  2HZY A;  4M77 F;  2FPE A;  3P8B B;  4CRI A;  4XU0 A;  1K1Z A;  1NYG A;  3JCM Q;  5A0G A;  1MUZ A;  1X6B A;  4PJO G;  3FEO A;  3CCE A;  1K9A A;  2RN8 A;  4JJD A;  3BY7 A;  3QJ6 A;  1KG1 A;  3CMA Q;  2EW3 A;  4D6W A;  1ZUY A;  2SRC A;  4E7H A;  3VKI A;  3EH2 A;  2C0O A;  4FSS A;  4BE0 A;  3EH1 A;  4JLI A;  4N0A C;  4EDU A;  1AWW A;  2JN0 A;  2M0Y A;  3CC2 A;  1MMN A;  4Z89 A;  4LD6 A;  2XU8 A;  3UT1 A;  5LJ3 j;  2K7A A;  2CT4 A;  3E2U A;  2LC4 A;  5KYX A;  1Q81 R;  3CC2 T;  4AG1 C;  4HCZ A;  3A8M B;  3UA6 A;  2MF2 A;  1VQL A;  3A5Z B;  1EIF A;  4C0F A;  3PGG A;  2RQT A;  3TCJ A;  1X01 A;  3HRT A;  5CCA A;  3OYH A;  2HMA A;  5GAM d;  1CKA A;  3BDU A;  1VQL T;  1BIB A;  2MK5 A;  3CBP A;  5KYX B;  4MZM A;  4RTY A;  2WSF E;  1MMG A;  1BB9 A;  2ZPI B;  3TRE A;  2BZ8 A;  3EGU A;  4OB0 B;  1LOJ A;  4M78 G;  1KSW A;  1Q81 C;  1RAC B;  4FYW B;  2RD1 A;  2EJ9 A;  1UUE A;  3L2R A;  4E7J A;  3DLM A;  2MOX A;  2PVO B;  2XKO C;  4C92 F;  4AFZ C;  3EGX B;  5LJ3 f;  2HAX A;  2C0T A;  2LCL A;  1VYU A;  3M0U A;  4XTZ A;  1VQM A;  2LQW A;  1MMA A;  1WXB A;  5CO7 A;  2XG8 D;  1K73 U;  3VJP A;  3EGD B;  1VQM T;  1PD0 A;  2EYY A;  2XMF A;  3VYH B;  2O9S A;  1YNZ A;  4ORZ A;  2RHZ A;  4F7U A;  2BZY A;  4PFZ A;  2DL7 A;  4QT7 A;  2HL3 A;  4RG2 A;  4RG8 A;  3I55 Q;  5A0L A;  4ANJ A;  4PLL A;  5A2Q E;  1GCQ A;  5GAO r;  2IG0 A;  1ARK A;  4R0K A;  4ME7 A;  2E1H A;  1GFD A;  3CXC S;  4RTX A;  2O4X A;  3X24 B;  3I35 A;  1WXU A;  2WSC E;  2C06 A;  3NHN A;  1UTI A;  3OA6 A;  4HT9 A;  3H6Z A;  4WF2 A;  4Z88 A;  2W0Z A;  2EBP A;  4ZGD B;  3ZL7 C;  4M75 E;  1N8R R;  5CK9 A;  1UGV A;  2H3E B;  2JM9 A;  5FRM A;  2LJ3 A;  2CKK A;  5ECA A;  1UGS B;  3M59 A;  1HD3 A;  1PM3 A;  3OS1 A;  2ZPB B;  3C12 A;  2DXC A;  2E6N A;  3L2V A;  4DBH A;  1GFC A;  1N9R A;  4JRI A;  1YFN A;  1E6G A;  4M75 G;  2HEQ A;  3LYI A;  2OTJ A;  3GBQ A;  1N8R C;  3A98 A;  3RDV A;  2OTJ T;  5D6W A;  1AWO A;  4OMM A;  4BE1 A;  3T9N A;  3OYE A;  1JU5 C;  3FDR A;  2RMO A;  1AVZ C;  2E10 A;  4E7K A;  2EYX A;  1MNE A;  1R77 A;  1U5S A;  2ATC B;  2COW A;  4RTT A;  4FM4 B;  3EG1 A;  4M77 B;  2YUN A;  3A8L B;  3IQL A;  3MJX A;  2DBK A;  4PJO F;  4JJN K;  4M7A G;  2LZ6 B;  4PLI A;  3RER A;  3EFS A;  2RK2 A;  1T0J A;  5I2M A;  5A0D A;  3KBG A;  4BY6 C;  1AWX A;  1U06 A;  1SSF A;  3ZFJ A;  1RAH B;  2YLC A;  1M1K R;  2KAF A;  4FYV B;  4IUV A;  4Z02 A;  1TOV A;  1KK7 A;  1RI0 A;  2PU9 B;  2A28 A;  1YWO A;  4A4F A;  2Y4Y A;  4EMG A;  1ABQ A;  3WXM B;  2QG9 B;  1YIT A;  4OMF B;  4XTW A;  1Q7Y U;  1M1K C;  4J7F A;  2YXY A;  1I81 A;  1YIT T;  1VQ9 Q;  1NPR A;  1WX6 A;  2GTJ A;  2RHX A;  3MKD A;  5LJ5 h;  3HSB A;  4O6J A;  2MWO A;  1G3W A;  2RI2 A;  1BYM A;  4ESR A;  4C8Q A;  3JB9 I;  2LT4 A;  1M3C A;  2CYZ B;  2LMJ A;  2P4T A;  4J9E A;  4C92 B;  5KE3 A;  1U1S A;  1GCP A;  2RF0 A;  2FZK B;  3G6E Q;  1PSE A;  1M4Z A;  2ZPH B;  1KFZ A;  4JS5 A;  1G2B A;  4E47 A;  4FL6 A;  1LNX A;  4XK8 E;  4AMC A;  2QQA A;  4HKE A;  3VRZ A;  2V8I A;  2YUQ A;  5CQY A;  3VRY A;  3BW1 A;  1KQS P;  2CT3 A;  5GAN 3;  1Q86 R;  1KJW A;  2ZCF B;  3JCM b;  2GFA A;  1BU1 A;  2E5K A;  2DTO A;  1YJW A;  1M90 U;  1FWZ A;  1MV0 B;  3QYH B;  3PVQ A;  2L3P A;  2VAS A;  4A53 A;  4N0A A;  1M3B A;  1KQ2 A;  4MDX A;  1PSF A;  1YJW T;  1WJS A;  3LWH A;  1SEM A;  3PTA A;  2V1R A;  3HPW A;  2DVE A;  1WQ7 A;  2KEA A;  3A8G B;  4OB3 B;  2QDY B;  1FMW A;  1Q86 C;  1Y7X A;  1SRL A;  3J81 E;  2DLP A;  1SF9 A;  3JB9 F;  1OUL A;  4M75 F;  3GIB A;  4FYY B;  4A63 B;  1IRX A;  2E3H A;  1M8V A;  2HQX A;  3I5R A;  1AT1 B;  2ED1 A;  1QVF S;  1VQK Q;  4KGV B;  1G3T A;  3GF5 A;  4F7U E;  2CZ0 B;  3NFC A;  1I07 A;  2COY A;  2H3J A;  3QG1 A;  1VQ4 A;  2DET A;  3URG A;  5J39 A;  1ZSZ C;  5GJW B;  2ECZ A;  3SDZ A;  3LH0 A;  1VQ4 T;  1X27 A;  4BB7 A;  1JBM A;  1H3Z A;  2CSI A;  1WGS A;  4F7U G;  3G71 Q;  2A37 A;  3JCM J;  3H8Z A;  1M5Q 1;  3V8L A;  3EFR A;  2K2M A;  4KH0 B;  2DAQ A;  2HL5 C;  5IAY A;  3PT9 A;  3OY9 A;  5EC7 A;  1BI3 A;  1VQ6 A;  1X6G A;  1H3H A;  2KMT A;  1YBY A;  3LWI A;  3CME A;  1AZE A;  1VQ6 T;  1KD1 R;  5HKC A;  4KGZ B;  1V1C A;  3CME T;  2GQV A;  4F14 A;  3LX7 A;  3RKY A;  2LX7 A;  1NPP A;  1G83 A;  2KRS A;  1NLP C;  3O5Z A;  2FL7 A;  2DMO A;  3CCU A;  3VS2 A;  4QQ6 A;  2DFU A;  1U8R A;  5CR2 A;  3CD6 Q;  5LJ5 g;  3CCU T;  2LT1 A;  2P84 A;  2LX9 A;  3P8H A;  1KD1 C;  1QP3 A;  1SHF A;  1ZLM A;  1JJ2 P;  3TSZ A;  3RBB B;  4HVV A;  2L3S A;  4Y92 A;  1VQ8 A;  4A4G A;  4ZTF A;  3J7A F;  1MGQ A;  3OYN A;  3MET A;  1VQ8 T;  1PCX A;  1E6H A;  2DBM A;  3V8K A;  1MV3 A;  4B9W A;  1VIE A;  2RA2 A;  2EFI A;  3HHT B;  1UGP B;  3CBM A;  4J6Y A;  4X1V A;  5KCH A;  5GMK h;  3JCM P;  3VU3 C;  3CCR A;  4NL3 A;  2RJC A;  2ZGW A;  2GQI A;  3CCR T;  3SB2 A;  3CCM Q;  1EFN A;  5IT9 E;  4KUL A;  3M4G A;  3NTI A;  5HY6 A;  5KYY B;  4ZN1 A;  3CCV A;  2DD4 A;  5GAN f;  4HVU A;  1D1C A;  2DZC A;  2P4R A;  3CCV T;  2F5K A;  4FU6 A;  4PJN A;  4BI4 A;  3N5B B;  5CVI A;  3CCL Q;  2V26 A;  2X3W D;  1OV3 A;  4KUI A;  5GAO q;  2KDS A;  2CH4 W;  4BY6 B;  3DB3 A;  2CP2 A;  4C8Q E;  1WNL A;  3OS0 A;  1LPL A;  4AG2 C;  4C92 G;  5LJ5 e;  4NOY A;  2DL8 A;  3M54 A;  1YJ9 A;  2KXD A;  3RR6 A;  2PVD B;  1TUD A;  1W2B P;  2VGN A;  4RTW A;  2FG0 A;  5IN1 A;  1M8M A;  1YJ9 T;  4C8Q G;  2CGH A;  2EYW A;  2E6Z A;  3FJ5 A;  2VXF A;  5GAN 2;  2HQE A;  1WPY A;  3LGF A;  1U3O A;  2JXB A;  3QJY A;  4C5G A;  1N6A A;  1B7T A;  2RB6 A;  3M58 A;  2XDB A;  8AT1 B;  4F7U F;  2RK1 A;  1D3B A;  3NPF A;  3OW2 S;  3VYG A;  1PRL C;  3PNW C;  1M2V A;  4KUD K;  3JCM f;  1IHW A;  4M4Z A;  2QI2 A;  3MP1 A;  5GAM h;  1K8A R;  2KQW A;  2YT6 A;  3TQ7 P;  4RTZ A;  4FT2 A;  5L23 A;  3QPH A;  2K5I A;  1SRM A;  1Z9Q A;  2DL3 A;  2A0F B;  3M4Y A;  1KQS A;  2G6F X;  2F1L A;  1KQ1 A;  4J6X A;  3OYM A;  4N4I A;  2IVW A;  1BIA A;  1K8A C;  2DZ9 A;  1GBQ A;  4QKU A;  2AKK A;  2BIV A;  4OB2 B;  1Y96 A;  4RTV A;  3DB4 A;  4M7D D;  2LQN A;  2NUT A;  4NL2 A;  2QYZ A;  1YHQ Q;  1MND A;  1IHV A;  2L89 A;  3OYC A;  4BAC A;  3HFO A;  5CKE A;  3E19 A;  3DKM A;  3JCM c;  5IH2 A;  2DA9 A;  2NUT B;  1TG0 A;  4PJJ A;  1PHT A;  2BTT A;  1W4S A;  3V7C A;  3CCE T;  3UAT A;  1ZSZ A;  1VQP Q;  1DJ7 B;  1VOM A;  4DOW A;  2QEX A;  2DIL A;  2LRQ A;  5GMK m;  2QK0 A;  2HKQ B;  2AZV A;  3EG2 A;  2LNH B;  4X9C A;  2QEX T;  1ZHI A;  1HSQ A;  2KT1 A;  2OTJ Q;  1PWT A;  4J9F A;  4ZNX A;  3H9N A;  3CCQ A;  3ULR B;  2P0K A;  4XU1 A;  1LVK A;  3VS7 A;  2K57 A;  3V7R A;  1LCK A;  1OU8 A;  3CCQ T;  2KRN A;  1WA7 A;  3RES A;  3VS0 A;  2HQH A;  1VQN Q;  4FW2 A;  2PZ1 A;  5D7U A;  4E7I A;  1AOJ A;  2GCX A;  3LGL A;  3QUI A;  1BI1 A;  1NZ9 A;  2JTM A;  2D6F A;  1ZBX A;  2KYM A;  1NJI U;  2I0N A;  4EMK C;  3CCJ Q;  2FZC B;  2ROT A;  2DNU A;  4BD3 A;  4C5E A;  4X34 A;  2LQK A;  3FB9 A;  1T3S A;  2QA4 Q;  1VQO A;  4MMK A;  4C8Q F;  2E4H A;  4MZT A;  3TSW A;  1WJR A;  2D8J A;  2BE7 D;  2OTL A;  1JJ2 A;  2QQS A;  4J9I A;  1YJN A;  5GMK e;  1TH7 A;  4ZN3 A;  2E70 A;  3GOX A;  1VA7 A;  1YIJ Q;  5J3B A;  2JNG A;  1FYN A;  4PKC C;  1ZA2 B;  2L0A A;  3O8V A;  3BE3 A;  2OTL T;  1YJN T;  2W10 A;  4X9D A;  5GAM g;  3E9G A;  3OYI A;  1OX8 A;  4F7U B;  1IGU A;  3A1P A;  1D1B A;  3UPU A;  1AWJ A;  2CP6 A;  4UC4 A;  2DIQ A;  3EAE A;  3SHW A;  1QVG P;  2FZG B;  1GBR A;  1VQ5 Q;  2KK4 A;  2E65 A;  1WHL A;  3VUZ A;  1UGQ B;  2SEM A;  2EKO A;  2O4X B;  3VS1 A;  1NEB A;  2MI6 A;  3EHR A;  1QCO A;  3OSV A;  5FRN A;  3CMA A;  3JB9 G;  4EIK A;  4PJO D;  2EKH A;  1Y71 A;  6AT1 B;  3CC7 A;  4ATO A;  2QAS A;  4ZTJ A;  5DLQ E;  4F16 A;  2YUP A;  2K5L A;  4AFQ C;  1NE8 A;  2PNI A;  2KRM A;  3CC7 T;  1BI2 A;  3OB9 A;  2J7I A;  3I5S A;  3M56 A;  4PFO A;  2KGT A;  2VVK A;  3GPL A;  3FLG A;  1C6V X;  2DKG A;  2LVM A;  1QP2 A;  3CPW A;  1A0N B;  3ER0 A;  1J3T A;  4KBM B;  4LDV A;  3UF4 A;  2CP5 A;  4LNP A;  1CKB A;  5GAN d;  2DPP B;  2RNA A;  1LJO A;  4N4G A;  5HK0 A;  3NGP A;  1W2B A;  2R57 A;  4LDU A;  1K0S A;  4M78 D;  1YN8 A;  1BCO A;  1S72 A;  3PIO A;  2JTE A;  4MDW A;  3MCA B;  5GMK j;  5GAM e;  1S72 T;  3L2W A;  2A08 A;  1ABO A;  1XQH A;  1KC8 U;  3SWN A;  4M7D A;  3VS5 A;  4RCB A;  5DY9 A;  4A4E A;  2CH4 A;  3I9Q A;  1HJD A;  2HSP A;  4DBQ A;  3I55 A;  1YCY A;  3QWX X;  2CUD A;  2HKN A;  3ZBD A;  1WHM A;  5C6S A;  3I55 T;  2CS7 A;  2X9H A;  4N4H A;  3CXC P;  2LP5 A;  4LE9 A;  3MEW A;  1SSH A;  1VQ7 Q;  4XU2 A;  1X6O A;  1NYF A;  1UFF A;  3JCM d;  2J6O A;  2X4X A;  2YWW A;  1RUW A;  2DL4 A;  1WIE A;  3C0C A;  4C8Q B;  3V8J A;  5GMK l;  4FT4 A;  4JJC A;  4JS4 A;  1K9M U;  2XID A;  3OYD A;  3CCS Q;  1K73 R;  2EYQ A;  3I56 Q;  1AD5 A;  4M75 D;  1K4U S;  2CSQ A;  3RUX A;  3BDL A;  5I21 A;  1OX9 A;  2AKL A;  2QTV A;  1IZ6 A;  2FRW A;  3MEV A;  5LL6 S;  5DM7 R;  2D9T A;  3SD4 A;  4QQG A;  3VUB A;  2NUZ A;  5GAN 6;  4FIB A;  2JUF A;  1K73 C;  2YHT A;  4LDX A;  2QDL A;  1QCF A;  4DBF A;  1X2K A;  1VQ8 Q;  3PMT A;  4OGC A;  1TXQ A;  3F70 A;  2EGA A;  1H8K A;  5DLO A;  4M7A D;  2QQB A;  4E7Z A;  2O2O A;  3FJP A;  3SEM A;  1WHJ A;  4IIO A;  3OS5 A;  1WI7 A;  1FXX A;  2BKD N;  4OMN A;  2FEI A;  2BE9 B;  3A8H B;  2X4J A;  2LNV A;  2RM4 A;  4WCI A;  1TSF A;  3L1A A;  4EMK A;  1Y57 A;  2XD0 A;  3R6O A;  4C5I A;  4QVC A;  3UA7 A;  2E12 A;  2DJQ A;  2JOY A;  2M51 A;  4TVR A;  2P0Q A;  1Q82 R;  1VQ9 A;  5HCK A;  4EMK B;  3L2Z A;  2DIG A;  2DXB A;  3MP6 A;  1I5L A;  4AFU C;  1VQ9 T;  1G5V A;  4XU3 A;  3GNG A;  4E7S A;  2CZ7 B;  2L5Q A;  1NBE B;  2LCC A;  5GJV B;  1AHJ B;  1PG5 B;  2OX7 A;  1O9S A;  3HP9 A;  1UE9 A;  3A8O B;  5LJ3 d;  3M53 A;  2FO0 A;  1Q82 C;  2R5M A;  3G6E A;  3R6N A;  2RH2 A;  4C5H A;  2I2L A;  2NUP A;  1W2B S;  2RI5 A;  3GNF B;  3X26 B;  3DLL A;  3M0R A;  3G6E T;  2NLU A;  1UJ0 A;  1B34 A;  1PKS A;  1U1T A;  3WVD B;  1R0B G;  2O01 E;  4BDZ A;  1QVG A;  2OAW A;  5KCO A;  3OYJ A;  2F69 A;  4OMO A;  3HKS A;  4NS5 A;  1D0Z A;  1I0C A;  2DXU A;  2LQ8 A;  4RCC A;  1N27 A;  2ZPE B;  4M78 A;  3NTK A;  1UJY A;  2PTK A;  1JXO A;  5KYW A;  2KBT A;  2DD5 A;  1X43 A;  2WSE E;  2JS2 A;  2Y90 A;  1RAF B;  4JRK A;  4HT8 A;  2J06 A;  1JQQ A;  3S6W A;  2RQV A;  1WYX A;  1W1F A;  1FMK A;  5KYW B;  2KYB A;  1WHG A;  4KH1 B;  1IO6 A;  3G7Z A;  1JXM A;  1SPK A;  2D1X A;  4M7D E;  5IXF A;  4WTO B;  1N9S A;  1QVF P;  2P0P A;  4D8D A;  1Q81 U;  3MO8 A;  4OMP A;  2X51 A;  3LLR A;  1YCS B;  3OMG A;  4E7L A;  4A54 A;  3H41 A;  2LJ0 A;  1WLP B;  3S3M A;  3G4S A;  4DA4 A;  3Q1J A;  5KYU A;  3BFM A;  2QGG A;  1UB4 A;  3OYG A;  3CPW P;  2KNB B;  1Y07 A;  1NLO C;  3G4S T;  3G71 A;  9ATC B;  3L42 A;  1M90 R;  2DO3 A;  1VYT A;  2LJ1 A;  1ZX6 A;  1WJQ A;  2AK5 A;  1YI2 A;  3CCE Q;  2K9G A;  1XTD A;  4GLM A;  3OYF A;  1P92 A;  4M77 C;  1YI2 T;  2DM1 A;  1WHH A;  4F17 A;  2L3Q A;  4LD9 K;  4JLG A;  1GL5 A;  2YRC A;  4PJM A;  2A3L A;  1M90 C;  4PNO A;  2ZZD A;  2CP0 A;  1VIF A;  4O5V A;  2YDL A;  3CC2 Q;  2VKN A;  1NG2 A;  4EMH A;  2QEX Q;  2DVJ A;  1B07 A;  2VXE A;  1SKU B;  1I1J A;  4BI3 A;  4A4H A;  2YUO A;  3EG3 A;  3CXC A;  1VQL Q;  3AHU A;  2EVR A;  3HRU A;  5FW9 A;  4QQD A;  2VV5 A;  2K4Y A;  3SWN C;  4M7D C;  2M0O A;  3HFN A;  1KIK A;  3C95 A;  2PUK B;  4PJL A;  4M7A A;  3MHX A;  3CC4 A;  2L2P A;  1QQJ A;  1D3B B;  3FIF A;  4II1 A;  1N8R U;  4M77 D;  4QVZ A;  3QII A;  4HVW A;  1ACM B;  4F04 B;  4PL6 A;  1M2V B;  3CC4 T;  2JS0 A;  2LCS A;  1OPL A;  1KHC A;  1G8X A;  2E64 A;  1RAG B;  4GLK A;  2F5T X;  2L8D A;  4Y91 A;  4BI8 B;  2HDA A;  2HCK A;  1IGQ A;  3M9Q A;  1VQM Q;  2EQM A;  5KYN A;  3E9F A;  1I8F A;  3TEE A;  5GAO n;  2VB6 A;  3VV0 A;  5FU6 C;  4OF1 A;  5AT1 B;  2X35 A;  2ABL A;  1XNI A;  2PUO B;  1FMV A;  3OBY A;  2HBW A;  3H0F A;  4IUQ A;  4AT1 B;  1K76 A;  4J5Y A;  5LJ5 j;  3TU4 K;  3CBO A;  2RHI A;  4K11 A;  2A36 A;  4DOV A;  1Y96 B;  1D0Y A;  2DF6 A;  2HSE B;  4QW2 A;  3CCL A;  2NWM A;  2DEQ A;  1OU9 A;  4IUT A;  5IHN A;  2R5A A;  3CCL T;  4FW1 A;  3X20 B;  2EJG A;  2EIF A;  3JSC A;  2DYI A;  4Q5W A;  3MEU A;  2AZS A;  1M1K U;  3S3O A;  2B86 A;  1EX4 A;  4C92 D;  4LDY A;  1ZSZ B;  2ZAE A;  3CC7 Q;  1OZ3 A;  1YP5 A;  5FRO A;  1PC0 A;  2AIR B;  2K6D A;  1QVP A;  2KVQ G;  3KUF A;  4HCK A;  1UEB A;  4J9H A;  4C8Q D;  5LJ5 f;  5IXB A;  4RTU A;  4M7D F;  1M1G A;  4PFP A;  2RJE A;  4P5N A;  1JEG A;  2YRD A;  4M78 E;  3X28 B;  3KFV A;  4V2S A;  1O75 A;  3NMZ C;  2QGF B;  3E1S A;  4ELY C;  3OW2 P;  1G3S A;  1JB0 E;  1QWF A;  4C0Z A;  2K3X A;  3OMC A;  4LXC A;  3M57 A;  2EPD A;  2RJD A;  2PVG B;  2FPF A;  5M9O A;  2JTF A;  2MAM A;  3EGX A;  4DEY A;  1TUC A;  4KRT A;  2KXC A;  4GY5 A;  4JJB A;  1C0M A;  5GAN h;  5I22 A;  1TS9 A;  4JRP A;  2CUB A;  2RQW A;  4R55 A;  2E3I A;  1M27 C;  1S72 Q;  1VQO T;  1M2O A;  3EGD A;  1SG5 A;  1XOV A;  4PJO C;  1D0X A;  3JCM X;  1BBZ A;  3L2Q A;  2D8H A;  2VUB A;  2K3Y A;  1VYV A;  8ATC B;  3FC3 A;  2DE0 X;  1RAB B;  2CZ1 B;  1R8O B;  5CKF A;  2CP7 A;  2DTH A;  4JUV A;  2O31 A;  2GFU A;  1HK9 A;  5HK3 A;  2KSS A;  4RUG A;  1Q86 U;  3QWY A;  2IPO B;  2DK3 A;  3OYL A;  1V29 B;  1YIT Q;  1ZUU A;  2VGM A;  3JCM V;  3WVE B;  1BK2 A;  1AZG B;  3RMS A;  7AT1 B;  1YWP A;  2CP3 A;  1SHG A;  3M0S A;  2KE9 A;  4IIM A;  2RHY A;  1YHQ A;  2HNI A;  2CZ6 B;  4GBQ A;  1PRM C;  1WHK A;  4JZ3 A;  3JB9 J;  2E5Q A;  4A4K A;  1YHQ T;  2V8K A;  3OQ5 A;  3JRZ A;  1X69 A;  2DJZ A;  3X25 B;  4XTU A;  5KH6 A;  4FCY A;  5KE2 A;  1QVF A;  4M78 C;  2QQ9 A;  3CMA T;  1M30 A;  2JZ2 A;  1MMD A;  5C0M A;  1B3Q A;  3G1J A;  5FWC A;  1VQP A;  3QDR B;  5CKB A;  2M02 A;  3TVT A;  4JDS A;  2J6K A;  5IHI A;  5FLX E;  2JM8 A;  2ED0 A;  3JCM h;  1VQP T;  2MYS A;  1ZBJ A;  4J9B A;  1NM7 A;  1S1N A;  2E41 A;  2MPX C;  3AT1 B;  1KQS S;  1BI0 A;  2D0N A;  1QW1 A;  4L59 A;  3M0P A;  2DXT A;  2VC8 A;  2DX1 A;  3CEY A;  4M77 A;  2R58 A;  3P8D A;  2C0I A;  1VQN A;  1YJW Q;  4M7A E;  3VS4 A;  2XIC A;  2B8A A;  1D09 B;  2EJF A;  1RI9 A;  2YLB A;  3MP8 A;  3S3N A;  4XTY A;  4IUP A;  1Q82 U;  4XTV A;  1VQN T;  2D0Q B;  1I5O B;  5AYF A;  2Z0W A;  3JV3 A;  4DEX A;  2K79 A;  4ELZ C;  2MCN A;  2GNC A;  2M16 A;  1C1A A;  2YSQ A;  2FPD A;  4HA8 A;  3CCJ A;  2J6F A;  1EZZ B;  3HTR A;  2DYB A;  2ROL A;  4Z8A A;  1KD1 U;  5I11 A;  3CCJ T;  2QA4 A;  4L6V 5;  1GRI A;  2JW4 A;  3PMI A;  5I2S A;  2QA4 T;  3INZ A;  2OJ2 A;  1T0H A;  3SWN B;  2O88 A;  4M75 C;  1VQ4 Q;  4M7D B;  2XDP A;  1YIJ A;  1NEG A;  2EYZ A;  3OYA A;  3RNJ A;  1UG1 A;  1M3A A;  5CAI A;  4OVA A;  4C0D C;  4BDY A;  2WAC A;  1YIJ T;  5GAN 8;  1H92 A;  4YTL A;  2GBQ A;  2EGE A;  2GTO A;  5D6X A;  3HL8 A;  3VS3 A;  5GAN g;  4B6M A;  1VQ5 A;  2KY9 A;  3QXE B;  2DRK A;  4Y28 E;  4M78 F;  4C92 A;  1VQ5 T;  4CC2 A;  1BCM A;  1VQ6 Q;  1NJI R;  1ZQ1 A;  2BZX A;  4IUR A;  3CME Q;  1TU0 B;  1QWE A;  3ZEH A;  2DRM A;  4M7A C;  5FU6 B;  5FU7 C;  2EQK A; 
#chains in the Genus database with same CATH homology
 4RCC A;  3M4Y A;  1N27 A;  2ZPE B;  2E1H A;  4ME7 A;  3NTK A;  4M78 A;  3CXC S;  3JB9 D;  2O4X A;  3X24 B;  1KQS A;  2WSC E;  2C06 A;  1KQ1 A;  3OA6 A;  4HT9 A;  3H6Z A;  4J6X A;  3OYM A;  4WF2 A;  4C0G A;  4N4I A;  2IVW A;  2DD5 A;  4ZGD B;  4LDW A;  1BIA A;  1K8A C;  2WSE E;  2Y90 A;  4M75 E;  2DZ9 A;  1NJI C;  4JRK A;  5LJ3 h;  4HT8 A;  4J7I A;  5CK9 A;  2BIV A;  4OB2 B;  3S6W A;  5FRM A;  5GAO m;  2CKK A;  1UGS B;  1Y96 A;  3M59 A;  3DB4 A;  2JVV A;  4M7D D;  3OS1 A;  2ZPF B;  2ZPB B;  4NL2 A;  3OSS C;  3MEA A;  2XI9 A;  3ME9 A;  3C12 A;  1JJ2 S;  5GAO p;  2DXC A;  2E6N A;  3G7Z A;  3L2V A;  5GMK i;  1N9R A;  2MWP A;  4M7D E;  2OAU A;  5GAM j;  4JRI A;  4M75 G;  2L89 A;  3LYI A;  3OYC A;  1N9S A;  2OTJ A;  4BAC A;  3HFO A;  2P0P A;  3E19 A;  5CKE A;  1Q81 U;  3DKM A;  1N8R C;  3JCM c;  3MO8 A;  3OS2 A;  4ZGE B;  4J6W A;  3LLR A;  5GAN 7;  2OTJ T;  5D6W A;  3JCM g;  2RO0 A;  3OMG A;  2V8J A;  1W4S A;  1IRE B;  3RKW A;  3V7C A;  4A54 A;  4E7L A;  4BE1 A;  3CCE T;  3T9N A;  3OYE A;  3FDR A;  3S3M A;  3G4S A;  4DA4 A;  3Q1J A;  3BFM A;  1UB4 A;  2E10 A;  2X4W A;  4E7K A;  5GAN 4;  1DJ7 B;  3OYG A;  4DOW A;  4FM4 B;  2QEX A;  1Y07 A;  5EG2 A;  3G4S T;  5GAN e;  3G71 A;  2LRQ A;  5GMK m;  4M77 B;  2XDD A;  3L42 A;  4BE2 A;  2DO3 A;  3A8L B;  4J83 A;  4X9C A;  2QEX T;  1ZHI A;  5CIU A;  4PJO F;  4JJN K;  2L3R A;  4M7A G;  1WJQ A;  4PLI A;  3RER A;  3EFS A;  3CCQ A;  3OW2 A;  2P0K A;  4XU1 A;  3C4S A;  5GAM f;  1YI2 A;  2RK2 A;  5A0D A;  1XTD A;  5I2M A;  2K57 A;  3V7R A;  3KBG A;  4BY6 C;  5LJ5 d;  3OYF A;  1P92 A;  3CCQ T;  4M77 C;  1YI2 T;  3RES A;  1SSF A;  4LD9 K;  4JLG A;  3ZFJ A;  2YLC A;  2KAF A;  4IUV A;  2A3L A;  1M90 C;  4PJO A;  4PNO A;  2ZZD A;  3QKJ A;  1VIF A;  4O5V A;  3CPW S;  1OYX A;  4Z02 A;  1RI0 A;  2PU9 B;  3UDC A;  3OYK A;  4E7I A;  2GCX A;  2BUD A;  3UWN A;  3LGL A;  4EMH A;  1VQ7 A;  3QUI A;  1BI1 A;  1K8A U;  4R56 A;  2JTM A;  1NZ9 A;  2VXE A;  1ZBX A;  1NJI U;  2D6F A;  4A4F A;  2EQJ A;  2FVU A;  2Y4Y A;  4EMG A;  4EMK C;  3C94 A;  4BI3 A;  3PFS A;  4A4H A;  4M7A F;  3CXC A;  1VQ7 T;  4PJO B;  4BD3 A;  4C5E A;  3AHU A;  2K2V A;  4X34 A;  3HRU A;  2LQK A;  3WXM B;  2LTO A;  1YIT A;  3FB9 A;  4OMF B;  2YRV A;  3RKX A;  4XTW A;  3J80 E;  1Q7Y U;  4QQD A;  4J8O A;  4J7F A;  2VV5 A;  2K4Y A;  3QBY A;  4XAX B;  3SWN C;  1VQO A;  4M7D C;  4MMK A;  4IUU A;  4B9X A;  2M0O A;  4C8Q F;  4MZT A;  1I81 A;  1YIT T;  3HFN A;  1JRI A;  1NPR A;  1WJR A;  3C95 A;  2PUK B;  4M7A A;  3MHX A;  3CCS A;  3CC4 A;  1D3B B;  2RHX A;  3FIF A;  4II1 A;  3QSU A;  2G3R A;  2HBP A;  4ZGJ B;  5LJ5 h;  1N8R U;  4M77 D;  4QVZ A;  5L8R E;  3I56 A;  2OTL A;  3QII A;  1JJ2 A;  2QQS A;  4O6J A;  1YJN A;  2MWO A;  5GMK e;  1G3W A;  4PL6 A;  1TH7 A;  2M9U A;  2RI2 A;  4VUB A;  3CC4 T;  3CCS T;  4HCC A;  1BYM A;  4ZN3 A;  2E70 A;  3GOX A;  1KHC A;  5J3B A;  2JNG A;  4C8Q A;  3JCM e;  3JB9 I;  4PKC C;  3O8V A;  2LT4 A;  2CYZ B;  3I56 T;  3GLX A;  1B34 B;  2E64 A;  2P4T A;  4M77 E;  3JCM W;  1YJN T;  4C92 B;  2OTL T;  5KE3 A;  4GLK A;  1U1S A;  4X9D A;  3QZ9 B;  5GAM g;  3E9G A;  1VUB A;  2F5T X;  2L8D A;  4Y91 A;  3QZ5 B;  4F7U B;  4BI8 B;  5GAN 5;  2RJF A;  1GXI E;  3UPU A;  4MML A;  3M9Q A;  4UC4 A;  1PSE A;  2EQM A;  3FRN A;  1M4Z A;  3E9F A;  3OBW A;  1I8F A;  2DIQ A;  2ZPH B;  2X4Y A;  3EAE A;  4JS5 A;  2PQW A;  2KK4 A;  3TEE A;  2E65 A;  3VUZ A;  4E47 A;  5GAO n;  1UGQ B;  4FL6 A;  1KC8 C;  2EKO A;  3VV0 A;  4L5G A;  5FU6 C;  1LNX A;  3HRS A;  4M77 G;  4M78 B;  4OF1 A;  2O4X B;  4XK8 E;  2MI6 A;  2X35 A;  3JAM E;  1XNI A;  2K5F A;  2PUO B;  2QQA A;  5GAN j;  2AHJ B;  4HKE A;  2V8I A;  3M5A A;  1Q7Y C;  3OSV A;  5CQY A;  5FRN A;  3BW1 A;  3OBY A;  1BKB A;  1X75 C;  3QO3 A;  5GAN 3;  3CMA A;  3JB9 G;  4IUQ A;  4PJO D;  5LJ3 g;  2ZCF B;  2RI3 A;  4J5Y A;  5LJ5 j;  3JCM b;  1Y71 A;  3CC7 A;  2GFA A;  3CBO A;  2RHI A;  3TU4 K;  4DOV A;  2DTO A;  1Y96 B;  1YJW A;  1M90 U;  1FWZ A;  1VQK A;  4ATO A;  3QYH B;  4QW2 A;  4ZTJ A;  2QXF A;  5DLQ E;  4A53 A;  2K5L A;  4N0A A;  5CKH A;  3CCL A;  1NE8 A;  4OP0 A;  2DEQ A;  3CC7 T;  1KQ2 A;  4MDX A;  1BI2 A;  1PSF A;  1WJS A;  3OB9 A;  4IUT A;  2EWN A;  3LWH A;  1YJW T;  2R5A A;  3QYG B;  3NTH A;  3PTA A;  3M56 A;  4RMO A;  3CCL T;  3HPW A;  4IKF A;  4M7D G;  2DVE A;  3X20 B;  1WQ7 A;  2EJG A;  3A8G B;  2EIF A;  4OB3 B;  3GPL A;  2QDY B;  3FLG A;  2QTX A;  3JSC A;  2DKG A;  2LVM A;  1QP2 A;  3CPW A;  3LW5 E;  4Q5W A;  2XHC A;  1Q86 C;  3ER0 A;  1Y7X A;  3MEU A;  1M9S A;  4KBM B;  4LDV A;  2FYK A;  3J81 E;  1M1K U;  3S3O A;  3OYY A;  1RL2 A;  3JB9 F;  4C92 D;  1KHI A;  4M75 F;  2HD0 A;  4LDY A;  3RMQ A;  3GIB A;  5GAN d;  1M8V A;  2HQX A;  3G71 T;  2DPP B;  4KT0 E;  1K9M C;  1QVF S;  1OZ3 A;  5FRO A;  1LJO A;  4C92 E;  2A7Y A;  1QVP A;  2KVQ G;  4N4G A;  3KUF A;  5HK0 A;  1UEB A;  3PIP A;  1G3T A;  3GF5 A;  4F7U E;  4C8Q D;  4OB1 B;  5LJ5 f;  2R57 A;  4LDU A;  1W2B A;  2CZ0 B;  3NFC A;  3RIR A;  2H3J A;  3M55 A;  4M78 D;  3QG1 A;  1MHN A;  4XTX A;  1VQ4 A;  4M75 A;  4M7D F;  4MZP A;  4CI0 C;  4JRQ A;  3PIO A;  1S72 A;  3URG A;  1M1G A;  5J39 A;  3QHS A;  2ZPG B;  2RJE A;  4P5N A;  3SDZ A;  3LH0 A;  4MDW A;  3MCA B;  5GMK j;  4M78 E;  3X28 B;  1UGR B;  4BB7 A;  1O75 A;  5GAM e;  1VQ4 T;  1JBM A;  1S72 T;  4V2S A;  1H3Z A;  2MMP A;  1WGS A;  3E1S A;  4BUG A;  4ELY C;  3L2W A;  2QQR A;  4F7U G;  1OZ2 A;  1G3S A;  1JB0 E;  2EAY A;  3JCM J;  3H8Z A;  4C0Z A;  1XQH A;  4M75 B;  1M5Q 1;  1KC8 U;  3SWN A;  4M7D A;  2K3X A;  3OMC A;  3V8L A;  2VYT A;  3EFR A;  2FB7 A;  4RCB A;  3M57 A;  3CD6 A;  2DAQ A;  5DY9 A;  4A4E A;  2RJD A;  2PVG B;  5IAY A;  3PT9 A;  3OY9 A;  2GF7 A;  4C0D B;  5M9O A;  2JTF A;  2MAM A;  1BI3 A;  5GAO l;  4XQ3 A;  3L2U A;  1WQW A;  1VQ6 A;  3KXT A;  4GY5 A;  3CD6 T;  2KMT A;  1YBY A;  3I55 A;  5GAN h;  3LWI A;  4HCB A;  1G3Y A;  3OYB A;  3CME A;  1YCY A;  4JRP A;  1M1F A;  4R55 A;  1VQ6 T;  2RHU A;  3ZBD A;  1VQO T;  5LJ3 e;  5C6S A;  3I55 T;  1XOV A;  4PJO C;  2CS7 A;  3JCM X;  5HKC A;  4RKU E;  3L2Q A;  3CME T;  2VUB A;  2K3Y A;  2LDM A;  2GQV A;  4N4H A;  3FC3 A;  3LX7 A;  3MEW A;  5D6Y A;  3RKY A;  1OI1 A;  1X6O A;  2CZ1 B;  4XU2 A;  1HXD A;  1R8O B;  1NPP A;  3ASK A;  5CKF A;  2FL7 A;  2DTH A;  3CCU A;  4JUV A;  4M7A B;  4QQ6 A;  1U8R A;  4QVD A;  5CR2 A;  2GFU A;  1HK9 A;  3JCM d;  5FU7 B;  5HK3 A;  2KSS A;  5LJ5 g;  1Q86 U;  4DQ2 A;  2X4X A;  2LT1 A;  2DK3 A;  3OYL A;  1V29 B;  3CCU T;  2LX9 A;  3P8H A;  1KD1 C;  2VGM A;  1QP3 A;  3JCM V;  3WVE B;  3RMS A;  2M1H A;  4C8Q B;  5CQX A;  3V8J A;  2RHY A;  5GMK l;  1YHQ A;  2EQU A;  4FT4 A;  2HNI A;  4JS4 A;  2DTI A;  2XK0 A;  4C92 C;  2CZ6 B;  1K9M U;  2XID A;  3OYD A;  1VQ8 A;  3CPF A;  4A4G A;  3JB9 J;  2E5Q A;  4A4K A;  3CCM A;  4ZTF A;  1YHQ T;  2V8K A;  3OQ5 A;  4EPC A;  2EYQ A;  3JRZ A;  3SFM A;  3V7S A;  4M75 D;  3J7A F;  1MGQ A;  3OYN A;  3MET A;  3GP8 A;  5CKD A;  1VQ8 T;  2DJZ A;  2FHD A;  3RUX A;  3X25 B;  4XTU A;  3BDL A;  4C8Q C;  3CCM T;  5I21 A;  5KH6 A;  3V8K A;  2Y4X A;  5KE2 A;  1IZ6 A;  3JB9 H;  4OGE A;  1QVF A;  3MEV A;  4M78 C;  4B9W A;  1VIE A;  2QQ9 A;  3CMA T;  2RA2 A;  2JZ2 A;  2EFI A;  5J26 A;  4FSX A;  5LL6 S;  5C0M A;  3HHT B;  4PJO E;  1I4K 1;  1UGP B;  5DM7 R;  3CBM A;  2D9T A;  1H64 1;  3SD4 A;  1VQP A;  4J6Y A;  1QVG S;  3QDR B;  5CKB A;  4QQG A;  5KCH A;  5GMK h;  3JCM P;  3VUB A;  3VU3 C;  5GAN 6;  3CCR A;  4JDS A;  1FX7 A;  4FIB A;  5FLX E;  4NL3 A;  2JUF A;  2RJC A;  3JCM h;  1K73 C;  2YHT A;  4M77 F;  3HSB A;  4LDX A;  1VQP T;  2ZGW A;  3P8B B;  4CRI A;  4XU0 A;  3CCR T;  3PMT A;  3SB2 A;  3JCM Q;  4OGC A;  3F70 A;  5A0G A;  5IT9 E;  4KUL A;  3M4G A;  2E41 A;  3NTI A;  5HY6 A;  4PJO G;  1KQS S;  1BI0 A;  3FEO A;  4ZN1 A;  1QW1 A;  3CCE A;  3CCV A;  4L59 A;  5DLO A;  3BY7 A;  3QJ6 A;  2DXT A;  4M7A D;  2DD4 A;  2QQB A;  2VC8 A;  4D6W A;  5GAN f;  1KG1 A;  4E7H A;  2DZC A;  3CEY A;  2R58 A;  4M77 A;  3VKI A;  3P8D A;  3FJP A;  4BE0 A;  3CCV T;  4JLI A;  2F5K A;  4FU6 A;  1VQN A;  4M7A E;  2XIC A;  2B8A A;  3OS5 A;  3N5B B;  4N0A C;  4BI4 A;  2EJF A;  1FXX A;  2BKD N;  5CVI A;  4EDU A;  3OYI A;  2JN0 A;  2YLB A;  3MP8 A;  3S3N A;  4XTY A;  4IUP A;  1Q82 U;  3CC2 A;  4XTV A;  1VQN T;  2D0Q B;  4KUI A;  2KDS A;  3A8H B;  5GAO q;  5AYF A;  4LD6 A;  2XU8 A;  3UT1 A;  5LJ3 j;  4BY6 B;  3DB3 A;  2X4J A;  2LNV A;  2RM4 A;  4C8Q E;  4ELZ C;  2LC4 A;  2M16 A;  3L1A A;  1WNL A;  3CC2 T;  4HCZ A;  3OS0 A;  3A8M B;  4HA8 A;  4EMK A;  3CCJ A;  2MF2 A;  1VQL A;  2XD0 A;  4C92 G;  3A5Z B;  1EIF A;  3R6O A;  4C5I A;  4C0F A;  3PGG A;  5LJ5 e;  4NOY A;  4QVC A;  3M54 A;  3TCJ A;  1X01 A;  2E12 A;  3HRT A;  5CCA A;  1YJ9 A;  1KD1 U;  3OYH A;  3CCJ T;  1VQK T;  2PVD B;  5GAM d;  2QA4 A;  2VGN A;  3BDU A;  1VQL T;  1BIB A;  2JOY A;  3CBP A;  4L6V 5;  5IN1 A;  4TVR A;  2P0Q A;  4MZM A;  1YJ9 T;  3PMI A;  1VQ9 A;  2WSF E;  5I2S A;  4C8Q G;  2CGH A;  4EMK B;  3L2Z A;  2QA4 T;  2DIG A;  2E6Z A;  2ZPI B;  3TRE A;  3INZ A;  4OB0 B;  2VXF A;  1LOJ A;  2DXB A;  4M78 G;  3MP6 A;  1Q81 C;  1I5L A;  1VQ9 T;  1G5V A;  2RD1 A;  4XU3 A;  2EJ9 A;  3GNG A;  5GAN 2;  2HQE A;  3L2R A;  2CZ7 B;  1WPY A;  3SWN B;  4E7J A;  4M75 C;  4M7D B;  2L5Q A;  2XDP A;  1YIJ A;  3LGF A;  2LCC A;  3QJY A;  3DLM A;  1N6A A;  4C5G A;  3OYA A;  2PVO B;  1AHJ B;  2XKO C;  2RB6 A;  4C92 F;  5CAI A;  3M58 A;  4OVA A;  4C0D C;  5LJ3 f;  4BDY A;  1O9S A;  3HP9 A;  2WAC A;  1YIJ T;  2HAX A;  5GAN 8;  2XDB A;  4F7U F;  3A8O B;  4YTL A;  2LCL A;  2RK1 A;  3M53 A;  5LJ3 d;  5D6X A;  1Q82 C;  1D3B A;  3HL8 A;  2R5M A;  3G6E A;  3OW2 S;  4C5H A;  2RH2 A;  4XTZ A;  3PNW C;  3VYG A;  5GAN g;  1VQM A;  2I2L A;  1W2B S;  5CO7 A;  2RI5 A;  3GNF B;  2XG8 D;  1K73 U;  1VQ5 A;  2KY9 A;  3QXE B;  3X26 B;  3VJP A;  3DLL A;  4KUD K;  3JCM f;  3G6E T;  1M1K C;  1VQM T;  2NLU A;  2QI2 A;  3MP1 A;  1B34 A;  4Y28 E;  1U1T A;  4M78 F;  3VYH B;  3WVD B;  4C92 A;  1VQ5 T;  5GAM h;  2O01 E;  2RHZ A;  4BDZ A;  1QVG A;  4F7U A;  2KQW A;  1ZQ1 A;  4FT2 A;  4RG2 A;  4RG8 A;  4IUR A;  5KCO A;  3OYJ A;  2F69 A;  5A0L A;  3QPH A;  3HKS A;  4NS5 A;  2K5I A;  2DXU A;  3ZEH A;  4PLL A;  5A2Q E;  4M7A C;  2LQ8 A;  5FU6 B;  5GAO r;  2IG0 A;  5FU7 C;  2EQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...