3C4SA

Crystal structure of the ssl0352 protein from synechocystis sp. northeast structural genomics consortium target sgr42
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
MIFPGATVRVTNVDDTYYRFEGLVQRVSDGKAAVLFENGNWDKLVTFRLSELEAVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ssl0352 protein
publication title Crystal structure of the Ssl0352 protein from Synechocystis sp.
rcsb
source organism Synechocystis sp.
molecule tags Structural genomics, unknown function
total genus 9
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11623 NdhS NAD(P)H dehydrogenase subunit S
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3c4sA00
2D9TA 4BE2A 1KHCA 3QIIA 3ME9A 4C5HA 1WJSA 4E7HA 2LDMA 3FLGA 2M0OA 2R58A 3OYMA 2X4XA 3LH0A 4B9WA 4FU6A 3OYIA 3KUFA 3LGLA 1RI0A 2MWOA 3MO8A 4Q5WA 5KCOA 5FRNA 3OYCA 3H8ZA 4QQDA 2M16A 2R5AA 2VYTA 5D6YA 2BIVA 3F70A 4UC4A 3MEWA 4IUQA 4A4EA 2LTOA 2G3RA 4N4HA 2X35A 2NLUA 3H6ZA 5M9OA 4QVZA 3GOXA 2GFUA 2X4YA 4BD3A 2JZ2A 2RO0A 4E7LA 2F5KA 4CRIA 2R57A 3ASKA 2DIQA 3OQ5A 5KH6A 4ZTFA 3OYEA 2E5QA 4QW2A 4IURA 3ZEHA 2HQEA 5C0MA 3S3NA 2DIGA 3C4SA 4IKFA 3OMCA 4NS5A 4E7KA 3Q1JA 3MEAA 2P0KA 2RI5A 2RJCA 2LVMA 3PMIA 3META 3QKJA 3OMGA 3MP6A 4QQ6A 5KE3A 3OS0A 2EQJA 4C5IA 2LCCA 2QQRA 4B9XA 4X34A 1WJRA 3QJ6A 2YRVA 2DAQA 3MP1A 2CKKA 2XK0A 4E7IA 1MHNA 2EFIA 4QQGA 4N4IA 4L59A 2IG0A 3OYNA 2O4XA 3FEOA 3OYAA 3UT1A 4BDYA 2WACA 4C5GA 3OYJA 2RHZA 3OS1A 3NTHA 4IUUA 3CEYA 3OA6A 3FDRA 3L42A 3L2UA 5IAYA 5J39A 4RG2A 1OZ3A 3OS2A 2EQKA 2E6NA 4E7JA 3DB4A 2R5MA 3FC3A 3LX7A 3PNWC 2QQSA 2RHUA 4EDUA 3E9GA 5J26A 3MP8A 3NTIA 3OYHA 2RJFA 3OYFA 2XDPA 3OY9A 5FRMA 4BE0A 1OZ2A 2FHDA 5FROA 4IUVA 2BKDN 1G5VA 3MEVA 2RI2A 5C6SA 4ZTJA 3EAEA 4A4GA 2EKOA 3E9FA 3NTKA 3OB9A 4GY5A 2PQWA 2BUDA 4OVAA 1XNIA 3QBYA 3PMTA 4IUPA 3UWNA 3PFSA 2L89A 2O4XB 3P8DA 4N4GA 4A4HA 5D6XA 2RI3A 3LGFA 2L3RA 4IUTA 4PL6A 5D6WA 3S6WA 3SD4A 4PLLA 3DB3A 1WGSA 2B8AA 4BDZA 2RHXA 2EQMA 1WJQA 4Z02A 2HQXA 2K3YA 3LLRA 2JTFA 5CIUA 3OYDA 3OYBA 2EQUA 4HCZA 5KCHA 3S3MA 3M9QA 4FL6A 4A4FA 2M1HA 2K3XA 2RHIA 3BDLA 2RHYA 4BE1A 3S3OA 2GFAA 4LD6A 3L2RA 3DLMA 1OYXA 3L2VA 1OI1A 3O8VA 3L2WA 3OYGA 2L8DA 2MWPA 1H3ZA 3LYIA 2RJDA 4PLIA 4C5EA 4II1A 2X4WA 5KE2A 2LRQA 5IN1A 1N27A 3OYLA 3MEUA 2GF7A 3P8HA 3OYKA 1SSFA 4BACA 3L2QA 2RJEA
chains in the Genus database with same CATH superfamily
1U1SA 1M3AA 4EMGA 1D0ZA 3OSVA 2OJ2A 3EGXA 1T3LA 1M1FA 5DLOA 3TSWA 3CPWS 3TCJA 5KCOA 2H3EB 4AFUC 4F14A 2HDAA 2PUKB 4E47A 1I0CA 4R56A 8AT1B 2L3QA 2ZPEB 2PNIA 3HHTB 2NLUA 2MPXC 4OB2B 2F5KA 4ME7A 2LJ1A 2XU8A 5GAOp 1TUDA 2A37A 4TVRA 2DXCA 4J9HA 2XG8D 2PTKA 1FX7A 3META 4RCCA 2J6FA 2OTJA 1M1KC 2O88A 1WHJA 3QPHA 3OBYA 3X20B 4FW1A 2YLBA 1ZBJA 4IUUA 1WA7A 1X27A 1VQMA 3OS2A 2A08A 3EG9B 2DXUA 1D0XA 2LQKA 5HY6A 2CZ7B 1YIJA 1H8KA 1O75A 4RTWA 1ARKA 1M3BA 4M78G 2YWWA 1UGVA 1S72T 3OS5A 2FHDA 4JLIA 1G5VA 1SEMA 3QBYA 5CKFA 1A0NB 5GAOr 3HRTA 1VQ4A 4J6WA 3RBBB 3EHQA 2KROA 2V8JA 3DB3A 4BDZA 3MHXA 3O5ZA 3JB9I 3CQTA 1S72A 4J9IA 4DOWA 1Y07A 2FVUA 4LD9K 5CKHA 2HL3A 3CCMA 1EIFA 4A53A 1X6OA 3SDZA 3CPWA 3CXCP 1YJWQ 3SHWA 2LQNA 4ELYC 4KULA 1N27A 2CSQA 5IXFA 2COWA 1RABB 5I22A 1MNDA 3CCRA 4Z89A 3HFNA 2G6FX 4JJBA 1VQNQ 3QXEB 3HTRA 3EGXB 3ZFJA 3RNJA 3H8ZA 5D7UA 2VYTA 4ZGDB 2KMTA 4Y92A 4M7DA 1H641 5LJ5d 4RUGA 2OAUA 2XHCA 2DL7A 5KYYA 4QT7A 4IIOA 2JM9A 4JRPA 2BZ8A 2QYZA 5HCKA 2H3JA 1K8AC 1VOMA 1VQ6A 1BI0A 2V1QA 2CZ1B 1I8FA 2RJCA 5KE3A 2QQRA 2C0OA 5IHNA 4RTXA 1QVGA 1QVPA 2KXDA 4FW2A 1VQ5A 1LOJA 3FDRA 1NLOC 4RG2A 2SRCA 2OTLA 3VUBA 1W2BA 1LNXA 3I56Q 2KYMA 2M0YA 1WLPB 3CMAA 1V76A 4C8QG 2RHUA 5J26A 2XD0A 1GBQA 5FRMA 1XOVA 1AWOA 1I4K1 1PRLC 4M77F 2J6KA 2JS2A 2BKDN 2EGEA 3QHSA 3EAEA 2DYIA 2JM8A 2CP3A 4M75B 3OW2P 1OEBA 4IUPA 1M9SA 1YJ9Q 1ZUUA 5GAMf 2CGHA 1PRMC 2LCLA 3S6WA 3QO3A 2CDTA 2SEMA 3FB9A 3M53A 1QLYA 4ESRA 4HCZA 3QDRB 1GBRA 2DPPB 1UEBA 3VJPA 1OI1A 2DKGA 1VQKA 1K76A 4JDSA 3CCJQ 3RESA 4OP0A 1KQSP 2F1LA 2HD0A 4ANJA 5LJ5g 4NL3A 2QI2A 5KYXA 5DLQE 1IRXA 1K9MC 4M75F 1KD1C 2AKLA 1WJSA 1NLPC 3GNGA 3JCMX 2EQIA 4M78A 3KUFA 2VWFA 3CCST 1PCXA 5GAN8 2ZPHB 3F70A 2ZZDA 4UC4A 3RERA 4KRTA 3EHRA 3U23A 5M9OA 1YITT 2RQTA 4M7DB 5I21A 2XKOC 1PWTA 1ZUYA 1YJ9T 5GAN3 1ZLMA 5KH6A 4M7DC 2E5QA 1X6GA 3M4GA 3NHNA 2HQEA 2RK1A 5LJ3f 5GANj 4NS5A 3M0QA 3TU4K 2DL3A 3CD6A 4MMKA 2ROLA 3QKJA 2KQWA 2X51A 5GMKl 4QKUA 2EQJA 4BY6C 2JOYA 2Y4XA 3OYAA 3FEOA 2WSEE 3QWYA 3RR6A 4J9EA 4C0ZA 4KUDK 2EQKA 2COZA 1SRMA 4M7DF 2CS7A 3M4YA 1TH7A 3CC4T 2VVKA 2F2XA 2NUPA 3FC3A 1OQKA 1KC8C 1QWFA 2DXBA 1QVFS 5CR2A 1M90C 3CCLQ 1AEYA 2PQWA 2QAZA 3JAME 2E12A 3JCMe 3CMEA 1WHLA 1PKTA 4JPBW 4C8QD 4K11A 4M7AG 2HBWA 2K2MA 2RNAA 1T0HA 3ZL7C 4DBHA 3OYDA 2PUOB 2CP5A 3I55T 4RMOA 2GFAA 1VQ9Q 5GMKi 2O9SA 2QGFB 2FO0A 4ZN3A 4RKUE 1D1CA 4B6MA 2QEXQ 3M55A 4BE2A 1WYXA 2X9HA 3RKWA 4C5HA 5KYXB 3I5SA 4C8QA 3I55A 1KFZA 1D09B 4GLKA 4KGXB 2RPNA 2MWOA 1Y96A 4M78B 2JT4A 5D6YA 4A4EA 2QDYB 4LNPA 2YSQA 2DD4A 1KQ2A 4M78C 3OBWA 2XDBA 3CCVA 2EJFA 3G1JA 4R0KA 5GJVB 1KG1A 5GANf 3Q1JA 4XK8E 4LUDA 1VQ9T 1WJRA 3BY7A 2YUNA 2DAQA 3VS3A 1KSWA 1VIEA 2PVDB 1U5SA 1NZ9A 4PJOG 1U8RA 2VV5A 1QVFA 1GRIA 1QP3A 1WXBA 2QEXT 3GLXA 1GL5A 1N9SA 5GMKm 3THKA 4PNOA 3LX7A 4X1VA 4EDUA 3URGA 2DF6A 2HL5C 3PIOA 3JB9D 1LVKA 2RJFA 2DLPA 2DL5A 3QWXX 1VIFA 4OMFB 3CXCS 2QTVA 5AYFA 1B3QA 3DLLA 2FB7A 1NJIR 1YHQT 3H0IA 2MAMA 5D6WA 2QA4T 4XU0A 4PJLA 1KIKA 3RKYA 5KCHA 1WXTA 1Y7XA 1Q7YC 2DRKA 3PE0A 1K73C 1OU9A 1ABQA 2PVGB 4C92G 4LE9A 1OX8A 4M7AD 3OYKA 2GF7A 4BACA 4FT4A 1P92A 4J9DA 4BUGA 4MDWA 2KDSA 2M0OA 1B07A 4FU6A 3OYIA 2JXBA 4QVDA 1RL2A 4C8QC 1RLPC 4VUBA 1RAHB 3G6ET 4M7AA 4M77G 4OMLA 3OMCA 3M0SA 3GP8A 1TUCA 1R77A 3CC7T 1I5LA 2OX7A 4AG2C 3MP6A 1JXMA 1CKAA 4B9XA 2VXFA 1JBMA 3QJ6A 3M0RA 5KYUA 1SPKA 1IXDA 3QZ9B 3OW2S 3OYJA 1G8XA 3L2UA 3JCMQ 3CXCA 5IAYA 3G71T 2L5QA 1UGPB 4M77E 1Q81R 1WHHA 3CCET 1SHFA 3REBB 3BDUA 5CKBA 1N5ZA 2GQIA 4WF2A 2CH4W 1N8RC 1NJIU 4EMKA 1VQLT 4RTTA 5CKDA 1S1NA 4JS5A 1FWZA 2KBTA 3G71A 1KQSS 3OB9A 5CO7A 2JTEA 1JJ2P 2J6OA 1SKUB 4MMLA 2O01E 1D3BA 3RMQA 2D1XA 1MNEA 2HKQB 4Z02A 2K3YA 4KUIA 1BI1A 1R0BG 2QK0A 4E2FB 4HCCA 1VQOT 3PVLA 4F7UB 1BI3A 1TUGB 4M75E 4PJOA 1Q82R 2MI6A 3JCMd 4YTLA 1UG1A 2RQUA 2HAXA 3VS1A 1YI2Q 5FU6B 1EZZB 3KXTA 2CT4A 2HQHA 3I9QA 1MUZA 4AFZC 5FU6C 3M54A 4E7HA 2R58A 3L1AA 1F1BB 5GMKh 1GFCA 1G3SA 4PJMA 5IT9E 2YLCA 4C92D 1W6XA 2COYA 2OTJQ 2CH4A 1TTHB 2DILA 4IUQA 1YJNT 2CREA 3UATA 4ELZC 4F7UF 3G7ZA 1WX6A 3CBMA 2LQ8A 2DIQA 2HZYA 3EGDB 1VQMQ 2E4HA 2DEUA 2K9GA 2K3BA 2MYSA 5A2QE 3PMIA 2NUTA 2VXEA 1YJNA 3LH5A 4M7AC 2MOXA 2XK0A 4P5NA 2EFIA 2YHTA 3OYNA 1Q81U 1AZEA 3PT9A 3VS0A 4HCKA 2WACA 4M77D 4PFOA 2DYBA 5GAMh 2J7IA 1JEGA 4F16A 2XICA 3L2ZA 5FU7B 3G4ST 2AK5A 1G83A 1KQSA 4A54A 1M3CA 3CCUT 2NUZA 5FU7C 1VQ8Q 1TSFA 5GMKj 3CCQQ 4HT8A 1M2VA 1OX9A 1YNZA 2YUQA 2X3XD 2ZPBB 2A28A 3TREA 4Y28E 2DE0X 3CCMQ 4FYWB 3VS6A 2BUDA 3V8JA 4LUEA 4XU3A 4HCBA 3JCMg 3T9NA 4EMKC 2DFUA 3UWNA 1M27C 2B86A 3TQ7P 1K8AR 4Z88A 4A4KA 1WGSA 1UGSB 1Q82U 3CCRQ 3QUIA 1SF9A 2EQUA 5FWCA 1M8VA 2AIRB 1WI7A 1K0XA 1NE8A 3DLMA 1E6HA 2LX7A 4JJCA 1PHTA 2L8DA 2RJDA 1AWWA 2EGAA 2ZPGB 3EG3A 2MF2A 4HT9A 5KE2A 1SRLA 4OMQA 3E1SA 5GAMj 4FYYB 4ORZA 1X43A 2RJEA 4OMPA 2Y90A 1XQHA 4PJOC 5LJ3h 2HCKA 4JRIA 1YCYA 1N6AA 2ED0A 1VQ8T 1VQ6Q 2ED1A 4B9WA 3CCQT 3NPFA 2L0AA 4AG1C 2RA2A 4OGCA 2IPOB 3H9NA 4OMNA 2LTOA 4N4HA 2CZ6B 2RO0A 4X9CA 3JSCA 1H92A 3EGUA 3HP9A 2OTLQ 2EYQA 3TSZA 1ZA2B 3CMAQ 2P0QA 3WVDB 4JRKA 2NUTB 1LPLA 1ZUKA 2CKKA 4E7IA 3UT1A 4C5GA 3EG2A 1TU0B 2RHZA 2DVEA 3NTHA 3CEYA 5CK9A 1K9MR 5LJ3j 2EYYA 2IIMA 3RIRA 2EVRA 5CAIA 2DNUA 1UJ0A 3GIBA 3MPUB 1QW1A 4MZPA 2QGGA 4J9BA 4JLGA 4DBRA 2L3PA 3MEVA 1TOVA 3RMSA 1W1FA 2DRMA 4MZMA 1YJWT 2HSPA 2O9VA 2ZGWA 3PFSA 3VV0A 3P8DA 1UB4A 1IHVA 1VA7A 4GBQA 1GCQA 1AHJB 2RHXA 2KRSA 4FCYA 2D8HA 3TVTA 1HXDA 2HMAA 3M9QA 2RF0A 1MV3A 2K4YA 1VQNT 1N9RA 4DOVA 3O8VA 3RDVA 4XTWA 2J05A 3CC2Q 1JXOA 3JB9J 3I35A 1G3TA 1RI9A 3L2QA 1WHGA 2D9TA 4PFPA 2CYZB 1BI2A 2Y4YA 3OYYA 5GANh 4HVWA 2EIFA 3MCAB 3CD6Q 4M4ZA 1IHWA 1RI0A 2DVJA 3MO8A 4Q5WA 4XTXA 2DK3A 2RQVA 2E3IA 4QQDA 2R5AA 3MEWA 2E10A 4PJNA 2RQRA 2CT3A 2XI9A 1D1BA 3OYEA 3E19A 1YCSB 5C0MA 3I56T 1FMWA 3C4SA 4IKFA 3H0HA 4JJDA 2AT1B 2KGTA 5GAN6 1TXQA 1FMKA 2O4XA 2GTOA 3CC2T 1JJ2S 1YWOA 2RD1A 3I56A 3C95A 3CMEQ 1VYVA 2P0PA 5KYYB 3N5BB 2ESWA 4BY6B 3CCSA 1EFNA 2EYZA 2LZ6B 4HXJA 3JCMV 4CC3A 3SWNA 3BE3A 2XDPA 1D0YA 1OZ2A 2EJGA 3BFMA 1PM3A 4J7FA 2DZ9A 1YITA 3JB9G 3CCJT 2VC8A 1KQ1A 4A4GA 3E2UA 1Y71A 1YJ9A 4LN2A 5GAOn 3PMTA 1C6VX 1BU1A 1I5OB 4N4GA 1Q86R 1NEGA 1WPYA 1UTIA 3QYGB 2DXTA 3A5ZB 1WJQA 3FRNA 3LLRA 2XIDA 2J06A 1TWBA 4WTOB 5HK0A 2CUBA 2C0TA 1VQPQ 2YRDA 1GCQC 3REAB 4C5EA 3M0UA 3UPUA 4BI8B 2DTHA 3V7CA 1PSFA 2KAFA 3CCVQ 3CC4A 2LC4A 5KYWA 1CSKA 1KJWA 3PTAA 4F7UE 2HEQA 4D6WA 4ZGEB 3LH0A 4JZ4A 1XJWB 1O9SA 1HJDA 2RN8A 1X2QA 2M9UA 2YDLA 2K6DA 2RK2A 1U1TA 2C0IA 2V26A 3GOXA 4BD3A 2GGRA 4KGVB 4J6YA 3OQ5A 1NG2A 1NM7A 3EFRA 4IURA 5GJWB 4LDUA 1YFNA 3INZA 1MMGA 4C0GA 1Q7YR 4E7KA 2DL8A 1K73R 1WHKA 2K5LA 3V8LA 2VKNA 2P4TA 1G3WA 3EG0A 3CCLT 2KI7A 3M57A 3LWHA 1I07A 1K1ZA 1BCOA 1RLQC 1V29B 2KT1A 1OPLA 5A0LA 2KNBB 1WZOA 2OAWA 1HSQA 4FT2A 3SWNB 1Q86U 3CCLA 4CC4B 5C6SA 4ZTJA 4XAXB 2EKOA 4GY5A 4JUVA 1W2BP 1FMVA 3SWNC 1VQ7Q 1AT1B 4M78F 2JMCA 4E7ZA 2CP0A 1RUWA 3SD4A 4LDXA 4ZN1A 2FZGB 1VQ9A 3EFSA 2NUPB 3S3OA 5CVIA 2LP5A 3V7SA 1OOTA 4DEXA 3EH1A 5A0DA 2QEXA 1UGQB 1ZBXA 1E6GA 3QSUA 2AHJB 2FL7A 4EMHA 2F2VA 2CZ0B 1N8RR 3QZ5B 5LJ5h 5KYWB 3LGLA 2FPEA 3JCMf 2E3HA 2M16A 1OPKA 1YHQA 4QVZA 1RAEB 2M51A 5IH2A 3M59A 5J3BA 2QA4A 4ZTFA 3A1PA 4QW2A 1ZSZA 3I5RA 3VKIA 2MK5A 1E7OA 2GTJA 5I11A 2A7YA 2LCSA 4C8QB 1MGQA 1PC0A 1B34A 1OULA 2Z0WA 4F17A 1Y96B 2FRWA 2VGMA 2MMPA 1W4SA 2DX1A 3NMZC 4E7JA 2LNHB 2L2PA 2GBQA 3EH2A 1ZQ1A 5LJ5j 1OV3A 3ER0A 3NTIA 2ROTA 2NYSA 3OY9A 2ZCFB 3R6NA 3VRYA 1QWEA 2HNIA 4PKCC 4BI3A 3G6EA 4C8QF 2L89A 4A4HA 3WXMB 3VS2A 3AHUA 2FG0A 2KYBA 2QG9B 1PKSA 1G2BA 4XTUA 3CC7A 2EQMA 2O2OA 2M1HA 3V7RA 4BE1A 1EX4A 1R8OB 2FYKA 4M75G 3LYIA 4OMMA 2AZSA 1SSHA 2DJQA 1NJIC 3MEUA 1GCPA 3CCEA 3QIIA 3ME9A 4OB3B 3X28B 4LDVA 2HKNA 1VQLA 2C06A 1AD5A 4DEYA 1D1AA 2AKKA 1M1KR 1DJ7B 3DKMA 2HSEB 2X4YA 1R0CB 2JZ2A 2R57A 1QCOA 2E5KA 3H41A 6AT1B 3S3NA 4J83A 4QVCA 3J80E 1PD1A 2YXYA 1VQOA 1OU8A 2LVMA 2DA9A 4A63B 1TS9A 4M7DG 5HKCA 1WNLA 4BDYA 4JRQA 1AWJA 1B34B 4DBFA 4KT0E 1SHGA 4F04B 5CQXA 3SFMA 4RG8A 4ZGJB 3OW2A 2EKHA 1BIAA 8ATCB 4O5VA 1YIJQ 3FJ5A 4M7AB 4IIMA 5LJ5f 3WVEB 1YP5A 1M2OA 2QASA 1UGRB 4AFSC 4M7DE 5GAOl 4C92A 7AT1B 1WDXA 4J9GA 1IB8A 3QG1A 1X01A 2A0FB 5KYUB 1WXUA 1YI2T 1T0JA 2I2LA 4ATOA 3D7SB 3JCMb 1VQ4Q 2H8HA 4PL6A 1Q81C 3UA7A 1ABOA 5GAOq 2HQXA 2QXFA 1M5Q1 3S3MA 3BDLA 2FEIA 1I1JA 3MKDA 1S72Q 4LD6A 1VUBA 3L2VA 4M7AF 2OTJT 2ENMA 4EMKB 1YI2A 4II1A 1Y0MA 2X4WA 3VS4A 3G4SA 5GMKe 1WQ7A 3P8HA 4PK4A 5IXBA 2KSSA 4M77A 4X9DA 1KHCA 3CCUA 1VQMT 1M1KU 1SG5A 1YIJT 1D3BB 3UA6A 2MIOA 2QQBA 1QP2A 1AZGB 4M75D 2BE9B 3M56A 3OYCA 3J7AF 4V2SA 1NYFA 1Q82C 2G3RA 1JU5C 2WSCE 4FSSA 4PJOB 3NGPA 4E7LA 1WFWA 5CCAA 1IO6A 3EFOA 1J3TA 2O31A 1VQ4T 2KK4A 3AT1B 2LT1A 1QVGS 1QCNA 4D8DA 3OMGA 5GAMe 2LCCA 1YBYA 2YRVA 4M75A 2ZPFB 3A8HB 3CCMT 3KBGA 1W2BS 4HVUA 3R6OA 1ZX6A 4JJNK 2D8JA 3OA6A 1VQ5Q 3OSSC 2BTTA 2A36A 1H3HA 4MDXA 4PJOF 2ATCB 4HA8A 1VQ8A 3PIPA 1HK9A 3DB4A 3P8BB 3CCQA 2PZ1A 2D0QB 3CCRT 4M78E 4KBMB 4RTVA 3OYHA 4M7DD 4BE0A 4E7SA 1NYGA 1BKBA 1UUEA 2FPFA 2KEAA 2FZCB 5FROA 4OB0B 1BB9A 1NBEB 2BE7D 2VGNA 3J81E 3CBOA 5IHKA 2CP2A 5DY9A 4C92B 2DBKA 3ZBDA 2CUDA 4C0DB 1M1GA 4KH1B 1KD1R 2V1RA 4C92C 3GBQA 1M30A 3JRZA 2LJ3A 1RAIB 4DA4A 4L5GA 1RADB 4C0DC 4RCBA 1Z9ZA 5GAOm 1VQ6T 2KVQG 2RHYA 2EAYA 3M58A 3L2WA 5LJ3e 1M2VB 3ULRB 2JMAA 4Y91A 1K8AU 1VQKQ 3EG1A 2W10A 1VQ5T 4FYVB 1MMDA 1QCFA 1VYTA 4R55A 2OTLT 1UE9A 4C92F 4M77B 3FLGA 2F5TX 1XTDA 2X4XA 1C1AA 3CMAT 1MMNA 4Z8AA 2BZYA 2XDDA 4M77C 1KHIA 2YUPA 3JCMP 3FJPA 1YJWA 1JO8A 1G3YA 1WQWA 4RTUA 3JB9H 3CBPA 3HL8A 4NOYA 5AT1B 1NPRA 2GFUA 4J9CA 3UDCA 1QKXA 1X75C 2DM1A 2DZCA 3EFOB 1TG0A 1KC8R 2W0ZA 3CCSQ 2E64A 2RI5A 1VQNA 3UF4A 3OS0A 4QQ6A 4E6RA 3LW5E 3MJXA 3HRSA 4N0AA 1M90R 4EPCA 4JZ3A 1MMAA 4QQGA 3HRUA 5HK3A 1VQKT 1YITQ 1K0SA 2RB6A 1Z9QA 1QKWA 1OZ3A 4M75C 2P4RA 2E6NA 4L6V5 4M78D 4C8QE 2ZPIB 2E41A 2QQSA 3PNWC 3E9GA 2K79A 1LJOA 2CP6A 3BW1A 4O6JA 5EG2A 1K9MU 1X2KA 1KD1U 3X26B 3NTKA 2K5FA 1X6BA 2GNCA 4CC2A 3C0CA 5D6XA 5CKEA 3CC4Q 4PLLA 3VS7A 5A0GA 1UHFA 2JTFA 3A98A 1UFFA 5CIUA 3OYBA 1IZ6A 1FYNA 2VB6A 3JCMh 4FL6A 4A4FA 3CD6T 3LWIA 1OYXA 4J9FA 5GAN2 3OYGA 4J8OA 3VS5A 5EC7A 1AVZC 4PLIA 3CC2A 2JJ9A 2JTMA 3X25B 5GANe 2JS0A 2EYWA 3VYHB 3OYLA 3GPLA 2P84A 4CI0C 1X69A 2L3SA 2LDMA 4F7UG 3I55Q 4XTYA 3PGGA 2DL4A 1FXXA 3CCJA 1ZHIA 2YRCA 3VU3C 2DERA 4OB1B 2V8IA 2K2VA 1PNJA 4HKEA 1KC8U 4CRIA 3ASKA 5GAN5 1PG5B 4DBQA 3CMET 5FWBA 2DIGA 1M90U 1NPPA 2DMOA 5GAN7 3MEAA 3CPWP 1BIBA 2JNGA 4C5IA 1NEBA 2DJZA 1YWPA 2D6FA 2QDLA 1MHNA 3QJYA 4N4IA 2IG0A 5I2MA 1UECA 3RUXA 1IGQA 4KH0B 4N0AC 3IQLA 1BK2A 3VRZA 3JCMJ 1V1CA 1JJ2A 4FSXA 2DD5A 1YN8A 5GAMd 2LT4A 3V8KA 2KRMA 3MP8A 4FYXB 4NL2A 1BBZA 2VASA 2MCNA 1AWXA 2IVWA 2KR3A 2K57A 1VQPT 2RM4A 3VYGA 2O4XB 3FIFA 3SEMA 2WSFE 4M7AE 3CCVT 3TEEA 4IUTA 4XU2A 2EWNA 2B8AA 4XQ3A 1IGUA 1QVGP 1ZA1B 3JV3A 4RTYA 2HBPA 3L2RA 1VQPA 2LMJA 3RKXA 1B7TA 3M0TA 2MWPA 4AT1B 4RTZA 2EYXA 1YHQQ 2E1HA 5LL6S 1C0MA 2CSIA 4JS4A 1Q86C 2QA4Q 3C12A 3VUZA 5L23A 2LNVA 1Y57A 2E65A 3H0FA 2RMOA 2EJ9A 5FRNA 5LJ3d 3NFCA 2QQ9A 2GQVA 2X35A 1PD0A 3H6ZA 1AOJA 2FZKB 2F2WA 4OMOA 2PVOB 1UHCA 1HYOA 3ZEHA 1BYMA 2KY9A 1WIEA 2LX9A 5GAMg 1JQQA 4LXCA 3X24B 4WCIA 3MP1A 4PJOE 4L59A 3G6EQ 3CPFA 1IREB 1Q95G 3OS1A 1VQ7T 2V8KA 4J7IA 1Q7YU 1UDLA 2DTIA 3A8OB 3GNFB 4D8KA 1QMCA 2EBPA 1K73U 4AMCA 4F7UA 1RACB 2R5MA 3CC7Q 3A8GB 4XTZA 3OYFA 2ABLA 2DETA 2FPDA 2LQWA 5CQYA 4IUVA 4J5YA 3C94A 3JCMc 4BB7A 1VQ7A 2E6ZA 2K5IA 3G71Q 3PVQA 4DQ2A 2OI3A 2JVVA 3CCEQ 4EIKA 1LCKA 1W70A 1VYUA 1M8MA 1VQLQ 2F69A 2K3XA 2RHIA 2AZVA 2KXCA 2X4JA 4C92E 2ZAEA 5LJ3g 1H3ZA 2KE9A 1GFDA 2YUOA 3EGDA 1MV0B 1PSEA 5LJ5e 4FIBA 5DM7R 5IN1A 4J6XA 1KK7A 1SSFA 2DO3A 9ATCB 2DEQA 1WHMA 2JW4A 3OYMA 4LDYA 3QDFA 2VUBA 1VQOQ 2EPDA 1ACMB 5IHIA 3HKSA 2DBMA 4FM4B 3GF5A 3HPWA 3JCMW 4AFQC 4MZTA 1U3OA 2BIVA 2BZXA 2QQAA 5GANd 2QTXA 2XMFA 2CP7A 4GLMA 4XTVA 4PFZA 1K4US 2NWMA 1N8RU 1I81A 1BCMA 4OGEA 2DTOA 4HVVA 2K7AA 4OF1A 5I2SA 1CKBA 4PJJA 4CC7A 4ZNXA 2EW3A 3HFOA 2P0KA 1RAFB 1JRIA 4PJOD 3M0PA 4XU1A 4X34A 4LDWA 1ZSGA 5KYNA 4KGZB 1YJNQ 2A3LA 5FW9A 2KT8A 3EG9A 1RAGB 2GCXA 5L8RE 3L42A 5J39A 3A8MB 2YT6A 2X3WD 2ECZA 1U06A 2PU9B 1GXIE 2E70A 5ECAA 2EGCA 3M5AA 2KRNA 1K9AA 1HD3A 1JB0E 1ZSZB 5GAN4 4BI4A 2JN0A 2RI2A 2I0NA 1ZSZC 3E9FA 4OVAA 2D0NA 4C0FA 1RAAB 1XNIA 2LJ0A 3A8LB 3G4SQ 1QQJA 2RI3A 3LGFA 2L3RA 3JB9F 3CCUQ 3KFVA 2JUFA 1T3SA 2M02A 1QVFP 3HSBA 5FLXE 1UJYA 5GANg 2LRQA 2RQWA 2RH2A 1M4ZA 3QYHB 2FRYA 3SB2A
chains in the Genus database with same CATH topology
3CC4A 2LC4A 4R55A 2OTLT 1U1SA 3PTAA 4EMGA 3OSVA 4C92F 4F7UE 4M77B 4BUGA 4MDWA 3FLGA 2KDSA 2M0OA 4D6WA 2F5TX 1XTDA 1M1FA 2X4XA 3LH0A 4ZGEB 3CMAT 4FU6A 5DLOA 3OYIA 3CPWS 3TCJA 2XDDA 5KCOA 1O9SA 4M77C 1KHIA 2PUKB 4QVDA 1RL2A 4E47A 3JCMP 2M9UA 3FJPA 1YJWA 4R56A 1G3YA 1WQWA 3JB9H 2ZPEB 4C8QC 2RK2A 1U1TA 3HHTB 4VUBA 3CBPA 3HL8A 2NLUA 4NOYA 1NPRA 3GOXA 3G6ET 2GFUA 4OB2B 4BD3A 3UDCA 2F5KA 4ME7A 4J6YA 2XU8A 3OQ5A 1X75C 4M7AA 4M77G 5GAOp 3EFRA 4IURA 2DZCA 4LDUA 3INZA 3OMCA 2DXCA 4TVRA 4C0GA 3GP8A 4E7KA 2XG8D 1FX7A 2E64A 2RI5A 1I5LA 3OS0A 3META 4RCCA 3CC7T 3MP6A 4QQ6A 3LW5E 2OTJA 3HRSA 4N0AA 4B9XA 2K5LA 1JBMA 2VXFA 3QJ6A 3V8LA 1M1KC 2P4TA 4EPCA 1G3WA 4QQGA 3QPHA 3OBYA 3QZ9B 3HRUA 5HK3A 3X20B 1VQKT 3OW2S 3CCLT 3OYJA 2RB6A 3M57A 2YLBA 3L2UA 4IUUA 3JCMQ 3LWHA 3CXCA 5IAYA 3G71T 2L5QA 1VQMA 1UGPB 1OZ3A 3OS2A 4M77E 2DXUA 2LQKA 4M75C 2E6NA 5HY6A 1V29B 2CZ7B 1YIJA 1O75A 3CCET 4L6V5 4M78D 3BDUA 4C8QE 2ZPIB 5CKBA 5A0LA 2E41A 2QQSA 3PNWC 4WF2A 1N8RC 3E9GA 1NJIU 4EMKA 1VQLT 4M78G 1LJOA 4FT2A 3SWNB 1S72T 3OS5A 2FHDA 3BW1A 4JLIA 5CKDA 4O6JA 5EG2A 1Q86U 1K9MU 3CCLA 1G5VA 5C6SA 4ZTJA 4JS5A 1FWZA 4XAXB 3G71A 3X26B 2EKOA 3NTKA 4GY5A 2K5FA 3OB9A 4JUVA 5CO7A 1KQSS 3QBYA 3SWNC 5CKFA 4M78F 4MMLA 5GAOr 3HRTA 1VQ4A 2O01E 4J6WA 5D6XA 1D3BA 5CKEA 2V8JA 3RMQA 3SD4A 4PLLA 3DB3A 4LDXA 4BDZA 3MHXA 4Z02A 2K3YA 4KUIA 4ZN1A 5CIUA 2JTFA 1BI1A 5A0GA 3JB9I 3OYBA 1IZ6A 3JCMh 1S72A 1VQ9A 4FL6A 4A4FA 3EFSA 1VQOT 4HCCA 3CD6T 4DOWA 1Y07A 2FVUA 4F7UB 3LWIA 3S3OA 1BI3A 4LD9K 5CKHA 1OYXA 5GAN2 1EIFA 4M75E 5CVIA 3V7SA 4A53A 3CCMA 4PJOA 3OYGA 1X6OA 4J8OA 3SDZA 3CPWA 2MI6A 4PLIA 3CC2A 3JCMd 2JTMA 5A0DA 4YTLA 3X25B 5GANe 2HAXA 2QEXA 4ELYC 5FU6B 4KULA 3VYHB 1N27A 1UGQB 3OYLA 1ZBXA 3KXTA 3GPLA 3QSUA 2AHJB 2FL7A 4EMHA 5FU6C 3M54A 2CZ0B 4CI0C 3CCRA 2LDMA 3QZ5B 4E7HA 5LJ5h 2R58A 3HFNA 3L1AA 4F7UG 5GMKh 3LGLA 3JCMf 1G3SA 3QXEB 4XTYA 5IT9E 2YLCA 3ZFJA 3PGGA 4C92D 3H8ZA 1FXXA 3CCJA 1ZHIA 2M16A 2VYTA 4ZGDB 2KMTA 3VU3C 4M7DA 1H641 4IUQA 5LJ5d 1YJNT 4OB1B 2V8IA 4ELZC 4F7UF 2K2VA 1YHQA 2OAUA 2XHCA 4QVZA 3G7ZA 3CBMA 2LQ8A 4HKEA 1KC8U 4CRIA 3M59A 5J3BA 3ASKA 2DIQA 2QA4A 4ZTFA 5GAN5 4QW2A 3CMET 4JRPA 2H3JA 1K8AC 2DIGA 1M90U 1NPPA 1VQ6A 3VKIA 5GAN7 1BI0A 5A2QE 2CZ1B 3MEAA 1I8FA 2RJCA 3PMIA 2A7YA 5KE3A 1BIBA 4C8QB 2JNGA 4C5IA 2VXEA 2DJZA 2QQRA 1YJNA 1MGQA 4M7AC 2D6FA 1QVGA 2XK0A 1QVPA 1B34A 4P5NA 1MHNA 2EFIA 2YHTA 3QJYA 4N4IA 2IG0A 3PT9A 1Y96B 3OYNA 1Q81U 2VGMA 1VQ5A 2MMPA 5I2MA 2WACA 4M77D 1LOJA 3RUXA 5GAMh 1W4SA 3FDRA 2XICA 3L2ZA 4N0AC 4RG2A 5FU7B 3G4ST 2OTLA 1KQSA 3VUBA 1W2BA 1LNXA 4A54A 4E7JA 3JCMJ 1JJ2A 4FSXA 3CMAA 2DD5A 3CCUT 5GAMd 2LT4A 5FU7C 4C8QG 1ZQ1A 2RHUA 3V8KA 5LJ5j 5J26A 3ER0A 5GMKj 4HT8A 4NL2A 3MP8A 3NTIA 2XD0A 2ZPBB 3OY9A 2ZCFB 5FRMA 3TREA 1XOVA 4Y28E 1I4K1 2HNIA 4M77F 2IVWA 2BKDN 4PKCC 2K57A 3QHSA 4BI3A 3G6EA 2RM4A 1VQPT 3EAEA 4C8QF 3VYGA 4M75B 2BUDA 3V8JA 4IUPA 4XU3A 4HCBA 1M9SA 3T9NA 3JCMg 4EMKC 3UWNA 2CGHA 2L89A 2O4XB 5GAMf 3FIFA 4A4HA 2WSFE 3WXMB 3AHUA 4M7AE 3CCVT 1KD1U 3TEEA 4IUTA 2LCLA 4XU2A 3S6WA 4A4KA 2EWNA 1WGSA 4XTUA 2B8AA 3QO3A 3CC7A 1UGSB 2EQMA 3FB9A 4XQ3A 1Q82U 3M53A 3QUIA 2EQUA 4HCZA 2M1HA 3QDRB 3V7RA 1M8VA 4BE1A 2HBPA 2DPPB 1R8OB 1UEBA 1NE8A 3DLMA 3L2RA 3VJPA 1OI1A 2DKGA 3RKXA 1VQPA 2FYKA 1VQKA 2L8DA 4JDSA 2MWPA 4M75G 3LYIA 2RJDA 2ZPGB 3RESA 2MF2A 4OP0A 4HT9A 2HD0A 5LJ5g 5KE2A 1NJIC 2E1HA 5LL6S 3E1SA 5GAMj 4NL3A 4JS4A 3MEUA 2QI2A 2RJEA 3CCEA 1Q86C 2Y90A 5DLQE 1XQHA 1K9MC 3QIIA 3C12A 4M75F 5LJ3h 4PJOC 3VUZA 3ME9A 2LNVA 4OB3B 1KD1C 1WJSA 3GNGA 2E65A 3X28B 4LDVA 4JRIA 1YCYA 1N6AA 3JCMX 1VQ8T 1VQLA 4B9WA 2C06A 4M78A 3CCQT 3KUFA 2EJ9A 3CCST 5FRNA 5LJ3d 5GAN8 3NFCA 2RA2A 4OGCA 2QQ9A 2ZPHB 1DJ7B 2ZZDA 3F70A 4UC4A 3RERA 2LTOA 3DKMA 4N4HA 2GQVA 2X35A 2CZ6B 3H6ZA 5M9OA 1YITT 4M7DB 2X4YA 2XKOC 5I21A 2JZ2A 2RO0A 4X9CA 1YJ9T 3JSCA 2R57A 5GAN3 3HP9A 5KH6A 2PVOB 4M7DC 2E5QA 3M4GA 1BYMA 3ZEHA 2EYQA 2HQEA 2RK1A 5LJ3f 3S3NA 2KY9A 4J83A 4QVCA 3J80E 4NS5A 3TU4K 5GANj 2LX9A 1VQOA 3CD6A 2P0QA 4MMKA 2LVMA 3QKJA 2KQWA 5GMKl 5GAMg 3WVDB 2EQJA 4BY6C 3X24B 4JRKA 3MP1A 2CKKA 4E7IA 4PJOE 2JOYA 2Y4XA 4M7DG 4L59A 5HKCA 1WNLA 3OYAA 3FEOA 3UT1A 2WSEE 4BDYA 3CPFA 4C5GA 4JRQA 1IREB 1B34B 4C0ZA 2RHZA 2DVEA 3NTHA 3OS1A 3CEYA 4KUDK 1VQ7T 2V8KA 4J7IA 4KT0E 1Q7YU 2DTIA 5CK9A 3A8OB 2EQKA 3GNFB 5CQXA 4RG8A 3SFMA 4ZGJB 3OW2A 4M7DF 1K73U 2CS7A 5LJ3j 3M4YA 1BIAA 1TH7A 4M7DE 3CC4T 4O5VA 3RIRA 4F7UA 5CAIA 2R5MA 3FC3A 4M7AB 1KC8C 5LJ5f 3A8GB 4XTZA 3OYFA 3WVEB 3GIBA 1QW1A 4MZPA 1UGRB 2DXBA 1QVFS 4JLGA 4IUVA 4J5YA 3C94A 5CQYA 5CR2A 3MEVA 3JCMc 3RMSA 5GAOl 1M90C 4C92A 4BB7A 1YJWT 4MZMA 1VQ7A 3QG1A 2PQWA 1X01A 2E6ZA 2ZGWA 3JAME 2K5IA 2E12A 3JCMe 1YI2T 3PFSA 3VV0A 3P8DA 2I2LA 4DQ2A 3CMEA 1UB4A 4ATOA 2JVVA 4C8QD 3JCMb 1Q81C 4PL6A 4M7AG 1AHJB 2RHXA 5GAOq 2HQXA 2QXFA 3OYDA 2PUOB 1M5Q1 1HXDA 3S3MA 2F69A 3M9QA 3I55T 2K3XA 2K4YA 2RHIA 3BDLA 1VQNT 4RMOA 2GFAA 1N9RA 1VUBA 4LD6A 3L2VA 4DOVA 3O8VA 4M7AF 2OTJT 4XTWA 2X4JA 4C92E 5GMKi 5LJ3g 1H3ZA 4EMKB 1YI2A 4II1A 1PSEA 4ZN3A 2X4WA 4FIBA 4RKUE 5LJ5e 5DM7R 5GMKe 5IN1A 1WQ7A 3G4SA 3JB9J 3P8HA 4J6XA 1G3TA 1SSFA 2KSSA 3L2QA 3M55A 4M77A 2DO3A 4X9DA 2D9TA 4BE2A 1KHCA 2CYZB 3CCUA 2DEQA 1VQMT 3RKWA 1M1KU 4C5HA 4C8QA 1BI2A 3I55A 2Y4YA 3OYYA 5GANh 1YIJT 1D3BB 3OYMA 2EIFA 3MCAB 4LDYA 2VUBA 2QQBA 1QP2A 4GLKA 4M75D 1RI0A 2MWOA 1Y96A 3M56A 3MO8A 2DK3A 3HKSA 4Q5WA 4FM4B 3GF5A 3HPWA 4XTXA 3OYCA 3J7AF 4M78B 4QQDA 3JCMW 4MZTA 2R5AA 4V2SA 5D6YA 2BIVA 5GANd 2QQAA 3MEWA 4A4EA 2QTXA 1Q82C 2G3RA 2QDYB 2E10A 2WSCE 4XTVA 2DD4A 1KQ2A 4M78C 4PJOB 3OBWA 2XDBA 1N8RU 4E7LA 1I81A 3CCVA 4OGEA 5CCAA 2XI9A 2DTOA 2EJFA 4OF1A 5I2SA 1VQ4T 3OYEA 2KK4A 3E19A 5C0MA 3I56T 3C4SA 4IKFA 2LT1A 1QVGS 1KG1A 5GANf 3Q1JA 3HFOA 2P0KA 4XK8E 1JRIA 3OMGA 4PJOD 5GAMe 4XU1A 2LCCA 1YBYA 4X34A 1VQ9T 1WJRA 4LDWA 2YRVA 2ZPFB 3BY7A 2DAQA 4M75A 5GAN6 2PVDB 1VIEA 3A8HB 3CCMT 1NZ9A 4PJOG 3KBGA 2O4XA 1W2BS 2A3LA 3R6OA 1U8RA 2VV5A 4JJNK 3CC2T 1JJ2S 1QVFA 3OA6A 2GCXA 2RD1A 1QP3A 5L8RE 3L42A 5J39A 3OSSC 3A8MB 2QEXT 3I56A 3C95A 3GLXA 1N9SA 1VQNA 2P0PA 4MDXA 2PU9B 4PJOF 4HA8A 1VQ8A 5GMKm 1GXIE 3PIPA 1HK9A 2E70A 3DB4A 3N5BB 3P8BB 4PNOA 2D0QB 3LX7A 4BY6B 3JCMV 3CCQA 3CCSA 3M5AA 4EDUA 3CCRT 3SWNA 4M78E 3URGA 4KBMB 3PIOA 3JB9D 1JB0E 3OYHA 4M7DD 2RJFA 2XDPA 4BE0A 1BKBA 1OZ2A 2EJGA 3BFMA 5FROA 5GAN4 1VIFA 4J7FA 4OB0B 2DZ9A 2JN0A 2RI2A 4OMFB 5AYFA 4BI4A 3CXCS 3CCJT 3JB9G 2VC8A 1KQ1A 1YITA 4A4GA 3E9FA 1Y71A 4OVAA 2VGNA 2FB7A 4C0FA 3CBOA 5GAOn 3J81E 1XNIA 3DLLA 3PMTA 1YJ9A 5DY9A 4C92B 1YHQT 3A8LB 4N4GA 3ZBDA 2RI3A 3LGFA 1M1GA 2L3RA 2MAMA 4C0DB 1WPYA 5D6WA 2QA4T 3JB9F 3QYGB 2DXTA 4XU0A 4C92C 3A5ZB 3JRZA 1WJQA 3FRNA 4DA4A 3LLRA 4L5GA 3RKYA 2XIDA 4C0DC 4RCBA 5KCHA 5GAOm 2JUFA 1Y7XA 1VQ6T 1Q7YC 2KVQG 2RHYA 2EAYA 5HK0A 1K73C 3M58A 3L2WA 5LJ3e 3HSBA 5FLXE 2PVGB 4C92G 4Y91A 4C5EA 1K8AU 3UPUA 4BI8B 5GANg 2DTHA 2LRQA 3V7CA 1VQ5T 1PSFA 4M7AD 2RH2A 1M4ZA 2KAFA 3OYKA 2GF7A 3QYHB 4BACA 3SB2A 4FT4A 1P92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9T A;  4BE2 A;  1KHC A;  3QII A;  3ME9 A;  4C5H A;  1WJS A;  4E7H A;  2LDM A;  3FLG A;  2M0O A;  2R58 A;  3OYM A;  2X4X A;  3LH0 A;  4B9W A;  4FU6 A;  3OYI A;  3KUF A;  3LGL A;  1RI0 A;  2MWO A;  3MO8 A;  4Q5W A;  5KCO A;  5FRN A;  3OYC A;  3H8Z A;  4QQD A;  2M16 A;  2R5A A;  2VYT A;  5D6Y A;  2BIV A;  3F70 A;  4UC4 A;  3MEW A;  4IUQ A;  4A4E A;  2LTO A;  2G3R A;  4N4H A;  2X35 A;  2NLU A;  3H6Z A;  5M9O A;  4QVZ A;  3GOX A;  2GFU A;  2X4Y A;  4BD3 A;  2JZ2 A;  2RO0 A;  4E7L A;  2F5K A;  4CRI A;  2R57 A;  3ASK A;  2DIQ A;  3OQ5 A;  5KH6 A;  4ZTF A;  3OYE A;  2E5Q A;  4QW2 A;  4IUR A;  3ZEH A;  2HQE A;  5C0M A;  3S3N A;  2DIG A;  3C4S A;  4IKF A;  3OMC A;  4NS5 A;  4E7K A;  3Q1J A;  3MEA A;  2P0K A;  2RI5 A;  2RJC A;  2LVM A;  3PMI A;  3MET A;  3QKJ A;  3OMG A;  3MP6 A;  4QQ6 A;  5KE3 A;  3OS0 A;  2EQJ A;  4C5I A;  2LCC A;  2QQR A;  4B9X A;  4X34 A;  1WJR A;  3QJ6 A;  2YRV A;  2DAQ A;  3MP1 A;  2CKK A;  2XK0 A;  4E7I A;  1MHN A;  2EFI A;  4QQG A;  4N4I A;  4L59 A;  2IG0 A;  3OYN A;  2O4X A;  3FEO A;  3OYA A;  3UT1 A;  4BDY A;  2WAC A;  4C5G A;  3OYJ A;  2RHZ A;  3OS1 A;  3NTH A;  4IUU A;  3CEY A;  3OA6 A;  3FDR A;  3L42 A;  3L2U A;  5IAY A;  5J39 A;  4RG2 A;  1OZ3 A;  3OS2 A;  2EQK A;  2E6N A;  4E7J A;  3DB4 A;  2R5M A;  3FC3 A;  3LX7 A;  3PNW C;  2QQS A;  2RHU A;  4EDU A;  3E9G A;  5J26 A;  3MP8 A;  3NTI A;  3OYH A;  2RJF A;  3OYF A;  2XDP A;  3OY9 A;  5FRM A;  4BE0 A;  1OZ2 A;  2FHD A;  5FRO A;  4IUV A;  2BKD N;  1G5V A;  3MEV A;  2RI2 A;  5C6S A;  4ZTJ A;  3EAE A;  4A4G A;  2EKO A;  3E9F A;  3NTK A;  3OB9 A;  4GY5 A;  2PQW A;  2BUD A;  4OVA A;  1XNI A;  3QBY A;  3PMT A;  4IUP A;  3UWN A;  3PFS A;  2L89 A;  2O4X B;  3P8D A;  4N4G A;  4A4H A;  5D6X A;  2RI3 A;  3LGF A;  2L3R A;  4IUT A;  4PL6 A;  5D6W A;  3S6W A;  3SD4 A;  4PLL A;  3DB3 A;  1WGS A;  2B8A A;  4BDZ A;  2RHX A;  2EQM A;  1WJQ A;  4Z02 A;  2HQX A;  2K3Y A;  3LLR A;  2JTF A;  5CIU A;  3OYD A;  3OYB A;  2EQU A;  4HCZ A;  5KCH A;  3S3M A;  3M9Q A;  4FL6 A;  4A4F A;  2M1H A;  2K3X A;  2RHI A;  3BDL A;  2RHY A;  4BE1 A;  3S3O A;  2GFA A;  4LD6 A;  3L2R A;  3DLM A;  1OYX A;  3L2V A;  1OI1 A;  3O8V A;  3L2W A;  3OYG A;  2L8D A;  2MWP A;  1H3Z A;  3LYI A;  2RJD A;  4PLI A;  4C5E A;  4II1 A;  2X4W A;  5KE2 A;  2LRQ A;  5IN1 A;  1N27 A;  3OYL A;  3MEU A;  2GF7 A;  3P8H A;  3OYK A;  1SSF A;  4BAC A;  3L2Q A;  2RJE A; 
#chains in the Genus database with same CATH topology
 1U1S A;  1M3A A;  4EMG A;  1D0Z A;  3OSV A;  2OJ2 A;  3EGX A;  1T3L A;  1M1F A;  5DLO A;  3TSW A;  3CPW S;  3TCJ A;  5KCO A;  2H3E B;  4AFU C;  4F14 A;  2HDA A;  2PUK B;  4E47 A;  1I0C A;  4R56 A;  8AT1 B;  2L3Q A;  2ZPE B;  2PNI A;  3HHT B;  2NLU A;  2MPX C;  4OB2 B;  2F5K A;  4ME7 A;  2LJ1 A;  2XU8 A;  5GAO p;  1TUD A;  2A37 A;  4TVR A;  2DXC A;  4J9H A;  2XG8 D;  2PTK A;  1FX7 A;  3MET A;  4RCC A;  2J6F A;  2OTJ A;  1M1K C;  2O88 A;  1WHJ A;  3QPH A;  3OBY A;  3X20 B;  4FW1 A;  2YLB A;  1ZBJ A;  4IUU A;  1WA7 A;  1X27 A;  1VQM A;  3OS2 A;  2A08 A;  3EG9 B;  2DXU A;  1D0X A;  2LQK A;  5HY6 A;  2CZ7 B;  1YIJ A;  1H8K A;  1O75 A;  4RTW A;  1ARK A;  1M3B A;  4M78 G;  2YWW A;  1UGV A;  1S72 T;  3OS5 A;  2FHD A;  4JLI A;  1G5V A;  1SEM A;  3QBY A;  5CKF A;  1A0N B;  5GAO r;  3HRT A;  1VQ4 A;  4J6W A;  3RBB B;  3EHQ A;  2KRO A;  2V8J A;  3DB3 A;  4BDZ A;  3MHX A;  3O5Z A;  3JB9 I;  3CQT A;  1S72 A;  4J9I A;  4DOW A;  1Y07 A;  2FVU A;  4LD9 K;  5CKH A;  2HL3 A;  3CCM A;  1EIF A;  4A53 A;  1X6O A;  3SDZ A;  3CPW A;  3CXC P;  1YJW Q;  3SHW A;  2LQN A;  4ELY C;  4KUL A;  1N27 A;  2CSQ A;  5IXF A;  2COW A;  1RAB B;  5I22 A;  1MND A;  3CCR A;  4Z89 A;  3HFN A;  2G6F X;  4JJB A;  1VQN Q;  3QXE B;  3HTR A;  3EGX B;  3ZFJ A;  3RNJ A;  3H8Z A;  5D7U A;  2VYT A;  4ZGD B;  2KMT A;  4Y92 A;  4M7D A;  1H64 1;  5LJ5 d;  4RUG A;  2OAU A;  2XHC A;  2DL7 A;  5KYY A;  4QT7 A;  4IIO A;  2JM9 A;  4JRP A;  2BZ8 A;  2QYZ A;  5HCK A;  2H3J A;  1K8A C;  1VOM A;  1VQ6 A;  1BI0 A;  2V1Q A;  2CZ1 B;  1I8F A;  2RJC A;  5KE3 A;  2QQR A;  2C0O A;  5IHN A;  4RTX A;  1QVG A;  1QVP A;  2KXD A;  4FW2 A;  1VQ5 A;  1LOJ A;  3FDR A;  1NLO C;  4RG2 A;  2SRC A;  2OTL A;  3VUB A;  1W2B A;  1LNX A;  3I56 Q;  2KYM A;  2M0Y A;  1WLP B;  3CMA A;  1V76 A;  4C8Q G;  2RHU A;  5J26 A;  2XD0 A;  1GBQ A;  5FRM A;  1XOV A;  1AWO A;  1I4K 1;  1PRL C;  4M77 F;  2J6K A;  2JS2 A;  2BKD N;  2EGE A;  3QHS A;  3EAE A;  2DYI A;  2JM8 A;  2CP3 A;  4M75 B;  3OW2 P;  1OEB A;  4IUP A;  1M9S A;  1YJ9 Q;  1ZUU A;  5GAM f;  2CGH A;  1PRM C;  2LCL A;  3S6W A;  3QO3 A;  2CDT A;  2SEM A;  3FB9 A;  3M53 A;  1QLY A;  4ESR A;  4HCZ A;  3QDR B;  1GBR A;  2DPP B;  1UEB A;  3VJP A;  1OI1 A;  2DKG A;  1VQK A;  1K76 A;  4JDS A;  3CCJ Q;  3RES A;  4OP0 A;  1KQS P;  2F1L A;  2HD0 A;  4ANJ A;  5LJ5 g;  4NL3 A;  2QI2 A;  5KYX A;  5DLQ E;  1IRX A;  1K9M C;  4M75 F;  1KD1 C;  2AKL A;  1WJS A;  1NLP C;  3GNG A;  3JCM X;  2EQI A;  4M78 A;  3KUF A;  2VWF A;  3CCS T;  1PCX A;  5GAN 8;  2ZPH B;  3F70 A;  2ZZD A;  4UC4 A;  3RER A;  4KRT A;  3EHR A;  3U23 A;  5M9O A;  1YIT T;  2RQT A;  4M7D B;  5I21 A;  2XKO C;  1PWT A;  1ZUY A;  1YJ9 T;  5GAN 3;  1ZLM A;  5KH6 A;  4M7D C;  2E5Q A;  1X6G A;  3M4G A;  3NHN A;  2HQE A;  2RK1 A;  5LJ3 f;  5GAN j;  4NS5 A;  3M0Q A;  3TU4 K;  2DL3 A;  3CD6 A;  4MMK A;  2ROL A;  3QKJ A;  2KQW A;  2X51 A;  5GMK l;  4QKU A;  2EQJ A;  4BY6 C;  2JOY A;  2Y4X A;  3OYA A;  3FEO A;  2WSE E;  3QWY A;  3RR6 A;  4J9E A;  4C0Z A;  4KUD K;  2EQK A;  2COZ A;  1SRM A;  4M7D F;  2CS7 A;  3M4Y A;  1TH7 A;  3CC4 T;  2VVK A;  2F2X A;  2NUP A;  3FC3 A;  1OQK A;  1KC8 C;  1QWF A;  2DXB A;  1QVF S;  5CR2 A;  1M90 C;  3CCL Q;  1AEY A;  2PQW A;  2QAZ A;  3JAM E;  2E12 A;  3JCM e;  3CME A;  1WHL A;  1PKT A;  4JPB W;  4C8Q D;  4K11 A;  4M7A G;  2HBW A;  2K2M A;  2RNA A;  1T0H A;  3ZL7 C;  4DBH A;  3OYD A;  2PUO B;  2CP5 A;  3I55 T;  4RMO A;  2GFA A;  1VQ9 Q;  5GMK i;  2O9S A;  2QGF B;  2FO0 A;  4ZN3 A;  4RKU E;  1D1C A;  4B6M A;  2QEX Q;  3M55 A;  4BE2 A;  1WYX A;  2X9H A;  3RKW A;  4C5H A;  5KYX B;  3I5S A;  4C8Q A;  3I55 A;  1KFZ A;  1D09 B;  4GLK A;  4KGX B;  2RPN A;  2MWO A;  1Y96 A;  4M78 B;  2JT4 A;  5D6Y A;  4A4E A;  2QDY B;  4LNP A;  2YSQ A;  2DD4 A;  1KQ2 A;  4M78 C;  3OBW A;  2XDB A;  3CCV A;  2EJF A;  3G1J A;  4R0K A;  5GJV B;  1KG1 A;  5GAN f;  3Q1J A;  4XK8 E;  4LUD A;  1VQ9 T;  1WJR A;  3BY7 A;  2YUN A;  2DAQ A;  3VS3 A;  1KSW A;  1VIE A;  2PVD B;  1U5S A;  1NZ9 A;  4PJO G;  1U8R A;  2VV5 A;  1QVF A;  1GRI A;  1QP3 A;  1WXB A;  2QEX T;  3GLX A;  1GL5 A;  1N9S A;  5GMK m;  3THK A;  4PNO A;  3LX7 A;  4X1V A;  4EDU A;  3URG A;  2DF6 A;  2HL5 C;  3PIO A;  3JB9 D;  1LVK A;  2RJF A;  2DLP A;  2DL5 A;  3QWX X;  1VIF A;  4OMF B;  3CXC S;  2QTV A;  5AYF A;  1B3Q A;  3DLL A;  2FB7 A;  1NJI R;  1YHQ T;  3H0I A;  2MAM A;  5D6W A;  2QA4 T;  4XU0 A;  4PJL A;  1KIK A;  3RKY A;  5KCH A;  1WXT A;  1Y7X A;  1Q7Y C;  2DRK A;  3PE0 A;  1K73 C;  1OU9 A;  1ABQ A;  2PVG B;  4C92 G;  4LE9 A;  1OX8 A;  4M7A D;  3OYK A;  2GF7 A;  4BAC A;  4FT4 A;  1P92 A;  4J9D A;  4BUG A;  4MDW A;  2KDS A;  2M0O A;  1B07 A;  4FU6 A;  3OYI A;  2JXB A;  4QVD A;  1RL2 A;  4C8Q C;  1RLP C;  4VUB A;  1RAH B;  3G6E T;  4M7A A;  4M77 G;  4OML A;  3OMC A;  3M0S A;  3GP8 A;  1TUC A;  1R77 A;  3CC7 T;  1I5L A;  2OX7 A;  4AG2 C;  3MP6 A;  1JXM A;  1CKA A;  4B9X A;  2VXF A;  1JBM A;  3QJ6 A;  3M0R A;  5KYU A;  1SPK A;  1IXD A;  3QZ9 B;  3OW2 S;  3OYJ A;  1G8X A;  3L2U A;  3JCM Q;  3CXC A;  5IAY A;  3G71 T;  2L5Q A;  1UGP B;  4M77 E;  1Q81 R;  1WHH A;  3CCE T;  1SHF A;  3REB B;  3BDU A;  5CKB A;  1N5Z A;  2GQI A;  4WF2 A;  2CH4 W;  1N8R C;  1NJI U;  4EMK A;  1VQL T;  4RTT A;  5CKD A;  1S1N A;  4JS5 A;  1FWZ A;  2KBT A;  3G71 A;  1KQS S;  3OB9 A;  5CO7 A;  2JTE A;  1JJ2 P;  2J6O A;  1SKU B;  4MML A;  2O01 E;  1D3B A;  3RMQ A;  2D1X A;  1MNE A;  2HKQ B;  4Z02 A;  2K3Y A;  4KUI A;  1BI1 A;  1R0B G;  2QK0 A;  4E2F B;  4HCC A;  1VQO T;  3PVL A;  4F7U B;  1BI3 A;  1TUG B;  4M75 E;  4PJO A;  1Q82 R;  2MI6 A;  3JCM d;  4YTL A;  1UG1 A;  2RQU A;  2HAX A;  3VS1 A;  1YI2 Q;  5FU6 B;  1EZZ B;  3KXT A;  2CT4 A;  2HQH A;  3I9Q A;  1MUZ A;  4AFZ C;  5FU6 C;  3M54 A;  4E7H A;  2R58 A;  3L1A A;  1F1B B;  5GMK h;  1GFC A;  1G3S A;  4PJM A;  5IT9 E;  2YLC A;  4C92 D;  1W6X A;  2COY A;  2OTJ Q;  2CH4 A;  1TTH B;  2DIL A;  4IUQ A;  1YJN T;  2CRE A;  3UAT A;  4ELZ C;  4F7U F;  3G7Z A;  1WX6 A;  3CBM A;  2LQ8 A;  2DIQ A;  2HZY A;  3EGD B;  1VQM Q;  2E4H A;  2DEU A;  2K9G A;  2K3B A;  2MYS A;  5A2Q E;  3PMI A;  2NUT A;  2VXE A;  1YJN A;  3LH5 A;  4M7A C;  2MOX A;  2XK0 A;  4P5N A;  2EFI A;  2YHT A;  3OYN A;  1Q81 U;  1AZE A;  3PT9 A;  3VS0 A;  4HCK A;  2WAC A;  4M77 D;  4PFO A;  2DYB A;  5GAM h;  2J7I A;  1JEG A;  4F16 A;  2XIC A;  3L2Z A;  5FU7 B;  3G4S T;  2AK5 A;  1G83 A;  1KQS A;  4A54 A;  1M3C A;  3CCU T;  2NUZ A;  5FU7 C;  1VQ8 Q;  1TSF A;  5GMK j;  3CCQ Q;  4HT8 A;  1M2V A;  1OX9 A;  1YNZ A;  2YUQ A;  2X3X D;  2ZPB B;  2A28 A;  3TRE A;  4Y28 E;  2DE0 X;  3CCM Q;  4FYW B;  3VS6 A;  2BUD A;  3V8J A;  4LUE A;  4XU3 A;  4HCB A;  3JCM g;  3T9N A;  4EMK C;  2DFU A;  3UWN A;  1M27 C;  2B86 A;  3TQ7 P;  1K8A R;  4Z88 A;  4A4K A;  1WGS A;  1UGS B;  1Q82 U;  3CCR Q;  3QUI A;  1SF9 A;  2EQU A;  5FWC A;  1M8V A;  2AIR B;  1WI7 A;  1K0X A;  1NE8 A;  3DLM A;  1E6H A;  2LX7 A;  4JJC A;  1PHT A;  2L8D A;  2RJD A;  1AWW A;  2EGA A;  2ZPG B;  3EG3 A;  2MF2 A;  4HT9 A;  5KE2 A;  1SRL A;  4OMQ A;  3E1S A;  5GAM j;  4FYY B;  4ORZ A;  1X43 A;  2RJE A;  4OMP A;  2Y90 A;  1XQH A;  4PJO C;  5LJ3 h;  2HCK A;  4JRI A;  1YCY A;  1N6A A;  2ED0 A;  1VQ8 T;  1VQ6 Q;  2ED1 A;  4B9W A;  3CCQ T;  3NPF A;  2L0A A;  4AG1 C;  2RA2 A;  4OGC A;  2IPO B;  3H9N A;  4OMN A;  2LTO A;  4N4H A;  2CZ6 B;  2RO0 A;  4X9C A;  3JSC A;  1H92 A;  3EGU A;  3HP9 A;  2OTL Q;  2EYQ A;  3TSZ A;  1ZA2 B;  3CMA Q;  2P0Q A;  3WVD B;  4JRK A;  2NUT B;  1LPL A;  1ZUK A;  2CKK A;  4E7I A;  3UT1 A;  4C5G A;  3EG2 A;  1TU0 B;  2RHZ A;  2DVE A;  3NTH A;  3CEY A;  5CK9 A;  1K9M R;  5LJ3 j;  2EYY A;  2IIM A;  3RIR A;  2EVR A;  5CAI A;  2DNU A;  1UJ0 A;  3GIB A;  3MPU B;  1QW1 A;  4MZP A;  2QGG A;  4J9B A;  4JLG A;  4DBR A;  2L3P A;  3MEV A;  1TOV A;  3RMS A;  1W1F A;  2DRM A;  4MZM A;  1YJW T;  2HSP A;  2O9V A;  2ZGW A;  3PFS A;  3VV0 A;  3P8D A;  1UB4 A;  1IHV A;  1VA7 A;  4GBQ A;  1GCQ A;  1AHJ B;  2RHX A;  2KRS A;  4FCY A;  2D8H A;  3TVT A;  1HXD A;  2HMA A;  3M9Q A;  2RF0 A;  1MV3 A;  2K4Y A;  1VQN T;  1N9R A;  4DOV A;  3O8V A;  3RDV A;  4XTW A;  2J05 A;  3CC2 Q;  1JXO A;  3JB9 J;  3I35 A;  1G3T A;  1RI9 A;  3L2Q A;  1WHG A;  2D9T A;  4PFP A;  2CYZ B;  1BI2 A;  2Y4Y A;  3OYY A;  5GAN h;  4HVW A;  2EIF A;  3MCA B;  3CD6 Q;  4M4Z A;  1IHW A;  1RI0 A;  2DVJ A;  3MO8 A;  4Q5W A;  4XTX A;  2DK3 A;  2RQV A;  2E3I A;  4QQD A;  2R5A A;  3MEW A;  2E10 A;  4PJN A;  2RQR A;  2CT3 A;  2XI9 A;  1D1B A;  3OYE A;  3E19 A;  1YCS B;  5C0M A;  3I56 T;  1FMW A;  3C4S A;  4IKF A;  3H0H A;  4JJD A;  2AT1 B;  2KGT A;  5GAN 6;  1TXQ A;  1FMK A;  2O4X A;  2GTO A;  3CC2 T;  1JJ2 S;  1YWO A;  2RD1 A;  3I56 A;  3C95 A;  3CME Q;  1VYV A;  2P0P A;  5KYY B;  3N5B B;  2ESW A;  4BY6 B;  3CCS A;  1EFN A;  2EYZ A;  2LZ6 B;  4HXJ A;  3JCM V;  4CC3 A;  3SWN A;  3BE3 A;  2XDP A;  1D0Y A;  1OZ2 A;  2EJG A;  3BFM A;  1PM3 A;  4J7F A;  2DZ9 A;  1YIT A;  3JB9 G;  3CCJ T;  2VC8 A;  1KQ1 A;  4A4G A;  3E2U A;  1Y71 A;  1YJ9 A;  4LN2 A;  5GAO n;  3PMT A;  1C6V X;  1BU1 A;  1I5O B;  4N4G A;  1Q86 R;  1NEG A;  1WPY A;  1UTI A;  3QYG B;  2DXT A;  3A5Z B;  1WJQ A;  3FRN A;  3LLR A;  2XID A;  2J06 A;  1TWB A;  4WTO B;  5HK0 A;  2CUB A;  2C0T A;  1VQP Q;  2YRD A;  1GCQ C;  3REA B;  4C5E A;  3M0U A;  3UPU A;  4BI8 B;  2DTH A;  3V7C A;  1PSF A;  2KAF A;  3CCV Q;  3CC4 A;  2LC4 A;  5KYW A;  1CSK A;  1KJW A;  3PTA A;  4F7U E;  2HEQ A;  4D6W A;  4ZGE B;  3LH0 A;  4JZ4 A;  1XJW B;  1O9S A;  1HJD A;  2RN8 A;  1X2Q A;  2M9U A;  2YDL A;  2K6D A;  2RK2 A;  1U1T A;  2C0I A;  2V26 A;  3GOX A;  4BD3 A;  2GGR A;  4KGV B;  4J6Y A;  3OQ5 A;  1NG2 A;  1NM7 A;  3EFR A;  4IUR A;  5GJW B;  4LDU A;  1YFN A;  3INZ A;  1MMG A;  4C0G A;  1Q7Y R;  4E7K A;  2DL8 A;  1K73 R;  1WHK A;  2K5L A;  3V8L A;  2VKN A;  2P4T A;  1G3W A;  3EG0 A;  3CCL T;  2KI7 A;  3M57 A;  3LWH A;  1I07 A;  1K1Z A;  1BCO A;  1RLQ C;  1V29 B;  2KT1 A;  1OPL A;  5A0L A;  2KNB B;  1WZO A;  2OAW A;  1HSQ A;  4FT2 A;  3SWN B;  1Q86 U;  3CCL A;  4CC4 B;  5C6S A;  4ZTJ A;  4XAX B;  2EKO A;  4GY5 A;  4JUV A;  1W2B P;  1FMV A;  3SWN C;  1VQ7 Q;  1AT1 B;  4M78 F;  2JMC A;  4E7Z A;  2CP0 A;  1RUW A;  3SD4 A;  4LDX A;  4ZN1 A;  2FZG B;  1VQ9 A;  3EFS A;  2NUP B;  3S3O A;  5CVI A;  2LP5 A;  3V7S A;  1OOT A;  4DEX A;  3EH1 A;  5A0D A;  2QEX A;  1UGQ B;  1ZBX A;  1E6G A;  3QSU A;  2AHJ B;  2FL7 A;  4EMH A;  2F2V A;  2CZ0 B;  1N8R R;  3QZ5 B;  5LJ5 h;  5KYW B;  3LGL A;  2FPE A;  3JCM f;  2E3H A;  2M16 A;  1OPK A;  1YHQ A;  4QVZ A;  1RAE B;  2M51 A;  5IH2 A;  3M59 A;  5J3B A;  2QA4 A;  4ZTF A;  3A1P A;  4QW2 A;  1ZSZ A;  3I5R A;  3VKI A;  2MK5 A;  1E7O A;  2GTJ A;  5I11 A;  2A7Y A;  2LCS A;  4C8Q B;  1MGQ A;  1PC0 A;  1B34 A;  1OUL A;  2Z0W A;  4F17 A;  1Y96 B;  2FRW A;  2VGM A;  2MMP A;  1W4S A;  2DX1 A;  3NMZ C;  4E7J A;  2LNH B;  2L2P A;  2GBQ A;  3EH2 A;  1ZQ1 A;  5LJ5 j;  1OV3 A;  3ER0 A;  3NTI A;  2ROT A;  2NYS A;  3OY9 A;  2ZCF B;  3R6N A;  3VRY A;  1QWE A;  2HNI A;  4PKC C;  4BI3 A;  3G6E A;  4C8Q F;  2L89 A;  4A4H A;  3WXM B;  3VS2 A;  3AHU A;  2FG0 A;  2KYB A;  2QG9 B;  1PKS A;  1G2B A;  4XTU A;  3CC7 A;  2EQM A;  2O2O A;  2M1H A;  3V7R A;  4BE1 A;  1EX4 A;  1R8O B;  2FYK A;  4M75 G;  3LYI A;  4OMM A;  2AZS A;  1SSH A;  2DJQ A;  1NJI C;  3MEU A;  1GCP A;  3CCE A;  3QII A;  3ME9 A;  4OB3 B;  3X28 B;  4LDV A;  2HKN A;  1VQL A;  2C06 A;  1AD5 A;  4DEY A;  1D1A A;  2AKK A;  1M1K R;  1DJ7 B;  3DKM A;  2HSE B;  2X4Y A;  1R0C B;  2JZ2 A;  2R57 A;  1QCO A;  2E5K A;  3H41 A;  6AT1 B;  3S3N A;  4J83 A;  4QVC A;  3J80 E;  1PD1 A;  2YXY A;  1VQO A;  1OU8 A;  2LVM A;  2DA9 A;  4A63 B;  1TS9 A;  4M7D G;  5HKC A;  1WNL A;  4BDY A;  4JRQ A;  1AWJ A;  1B34 B;  4DBF A;  4KT0 E;  1SHG A;  4F04 B;  5CQX A;  3SFM A;  4RG8 A;  4ZGJ B;  3OW2 A;  2EKH A;  1BIA A;  8ATC B;  4O5V A;  1YIJ Q;  3FJ5 A;  4M7A B;  4IIM A;  5LJ5 f;  3WVE B;  1YP5 A;  1M2O A;  2QAS A;  1UGR B;  4AFS C;  4M7D E;  5GAO l;  4C92 A;  7AT1 B;  1WDX A;  4J9G A;  1IB8 A;  3QG1 A;  1X01 A;  2A0F B;  5KYU B;  1WXU A;  1YI2 T;  1T0J A;  2I2L A;  4ATO A;  3D7S B;  3JCM b;  1VQ4 Q;  2H8H A;  4PL6 A;  1Q81 C;  3UA7 A;  1ABO A;  5GAO q;  2HQX A;  2QXF A;  1M5Q 1;  3S3M A;  3BDL A;  2FEI A;  1I1J A;  3MKD A;  1S72 Q;  4LD6 A;  1VUB A;  3L2V A;  4M7A F;  2OTJ T;  2ENM A;  4EMK B;  1YI2 A;  4II1 A;  1Y0M A;  2X4W A;  3VS4 A;  3G4S A;  5GMK e;  1WQ7 A;  3P8H A;  4PK4 A;  5IXB A;  2KSS A;  4M77 A;  4X9D A;  1KHC A;  3CCU A;  1VQM T;  1M1K U;  1SG5 A;  1YIJ T;  1D3B B;  3UA6 A;  2MIO A;  2QQB A;  1QP2 A;  1AZG B;  4M75 D;  2BE9 B;  3M56 A;  3OYC A;  3J7A F;  4V2S A;  1NYF A;  1Q82 C;  2G3R A;  1JU5 C;  2WSC E;  4FSS A;  4PJO B;  3NGP A;  4E7L A;  1WFW A;  5CCA A;  1IO6 A;  3EFO A;  1J3T A;  2O31 A;  1VQ4 T;  2KK4 A;  3AT1 B;  2LT1 A;  1QVG S;  1QCN A;  4D8D A;  3OMG A;  5GAM e;  2LCC A;  1YBY A;  2YRV A;  4M75 A;  2ZPF B;  3A8H B;  3CCM T;  3KBG A;  1W2B S;  4HVU A;  3R6O A;  1ZX6 A;  4JJN K;  2D8J A;  3OA6 A;  1VQ5 Q;  3OSS C;  2BTT A;  2A36 A;  1H3H A;  4MDX A;  4PJO F;  2ATC B;  4HA8 A;  1VQ8 A;  3PIP A;  1HK9 A;  3DB4 A;  3P8B B;  3CCQ A;  2PZ1 A;  2D0Q B;  3CCR T;  4M78 E;  4KBM B;  4RTV A;  3OYH A;  4M7D D;  4BE0 A;  4E7S A;  1NYG A;  1BKB A;  1UUE A;  2FPF A;  2KEA A;  2FZC B;  5FRO A;  4OB0 B;  1BB9 A;  1NBE B;  2BE7 D;  2VGN A;  3J81 E;  3CBO A;  5IHK A;  2CP2 A;  5DY9 A;  4C92 B;  2DBK A;  3ZBD A;  2CUD A;  4C0D B;  1M1G A;  4KH1 B;  1KD1 R;  2V1R A;  4C92 C;  3GBQ A;  1M30 A;  3JRZ A;  2LJ3 A;  1RAI B;  4DA4 A;  4L5G A;  1RAD B;  4C0D C;  4RCB A;  1Z9Z A;  5GAO m;  1VQ6 T;  2KVQ G;  2RHY A;  2EAY A;  3M58 A;  3L2W A;  5LJ3 e;  1M2V B;  3ULR B;  2JMA A;  4Y91 A;  1K8A U;  1VQK Q;  3EG1 A;  2W10 A;  1VQ5 T;  4FYV B;  1MMD A;  1QCF A;  1VYT A;  4R55 A;  2OTL T;  1UE9 A;  4C92 F;  4M77 B;  3FLG A;  2F5T X;  1XTD A;  2X4X A;  1C1A A;  3CMA T;  1MMN A;  4Z8A A;  2BZY A;  2XDD A;  4M77 C;  1KHI A;  2YUP A;  3JCM P;  3FJP A;  1YJW A;  1JO8 A;  1G3Y A;  1WQW A;  4RTU A;  3JB9 H;  3CBP A;  3HL8 A;  4NOY A;  5AT1 B;  1NPR A;  2GFU A;  4J9C A;  3UDC A;  1QKX A;  1X75 C;  2DM1 A;  2DZC A;  3EFO B;  1TG0 A;  1KC8 R;  2W0Z A;  3CCS Q;  2E64 A;  2RI5 A;  1VQN A;  3UF4 A;  3OS0 A;  4QQ6 A;  4E6R A;  3LW5 E;  3MJX A;  3HRS A;  4N0A A;  1M90 R;  4EPC A;  4JZ3 A;  1MMA A;  4QQG A;  3HRU A;  5HK3 A;  1VQK T;  1YIT Q;  1K0S A;  2RB6 A;  1Z9Q A;  1QKW A;  1OZ3 A;  4M75 C;  2P4R A;  2E6N A;  4L6V 5;  4M78 D;  4C8Q E;  2ZPI B;  2E41 A;  2QQS A;  3PNW C;  3E9G A;  2K79 A;  1LJO A;  2CP6 A;  3BW1 A;  4O6J A;  5EG2 A;  1K9M U;  1X2K A;  1KD1 U;  3X26 B;  3NTK A;  2K5F A;  1X6B A;  2GNC A;  4CC2 A;  3C0C A;  5D6X A;  5CKE A;  3CC4 Q;  4PLL A;  3VS7 A;  5A0G A;  1UHF A;  2JTF A;  3A98 A;  1UFF A;  5CIU A;  3OYB A;  1IZ6 A;  1FYN A;  2VB6 A;  3JCM h;  4FL6 A;  4A4F A;  3CD6 T;  3LWI A;  1OYX A;  4J9F A;  5GAN 2;  3OYG A;  4J8O A;  3VS5 A;  5EC7 A;  1AVZ C;  4PLI A;  3CC2 A;  2JJ9 A;  2JTM A;  3X25 B;  5GAN e;  2JS0 A;  2EYW A;  3VYH B;  3OYL A;  3GPL A;  2P84 A;  4CI0 C;  1X69 A;  2L3S A;  2LDM A;  4F7U G;  3I55 Q;  4XTY A;  3PGG A;  2DL4 A;  1FXX A;  3CCJ A;  1ZHI A;  2YRC A;  3VU3 C;  2DER A;  4OB1 B;  2V8I A;  2K2V A;  1PNJ A;  4HKE A;  1KC8 U;  4CRI A;  3ASK A;  5GAN 5;  1PG5 B;  4DBQ A;  3CME T;  5FWB A;  2DIG A;  1M90 U;  1NPP A;  2DMO A;  5GAN 7;  3MEA A;  3CPW P;  1BIB A;  2JNG A;  4C5I A;  1NEB A;  2DJZ A;  1YWP A;  2D6F A;  2QDL A;  1MHN A;  3QJY A;  4N4I A;  2IG0 A;  5I2M A;  1UEC A;  3RUX A;  1IGQ A;  4KH0 B;  4N0A C;  3IQL A;  1BK2 A;  3VRZ A;  3JCM J;  1V1C A;  1JJ2 A;  4FSX A;  2DD5 A;  1YN8 A;  5GAM d;  2LT4 A;  3V8K A;  2KRM A;  3MP8 A;  4FYX B;  4NL2 A;  1BBZ A;  2VAS A;  2MCN A;  1AWX A;  2IVW A;  2KR3 A;  2K57 A;  1VQP T;  2RM4 A;  3VYG A;  2O4X B;  3FIF A;  3SEM A;  2WSF E;  4M7A E;  3CCV T;  3TEE A;  4IUT A;  4XU2 A;  2EWN A;  2B8A A;  4XQ3 A;  1IGU A;  1QVG P;  1ZA1 B;  3JV3 A;  4RTY A;  2HBP A;  3L2R A;  1VQP A;  2LMJ A;  3RKX A;  1B7T A;  3M0T A;  2MWP A;  4AT1 B;  4RTZ A;  2EYX A;  1YHQ Q;  2E1H A;  5LL6 S;  1C0M A;  2CSI A;  4JS4 A;  1Q86 C;  2QA4 Q;  3C12 A;  3VUZ A;  5L23 A;  2LNV A;  1Y57 A;  2E65 A;  3H0F A;  2RMO A;  2EJ9 A;  5FRN A;  5LJ3 d;  3NFC A;  2QQ9 A;  2GQV A;  2X35 A;  1PD0 A;  3H6Z A;  1AOJ A;  2FZK B;  2F2W A;  4OMO A;  2PVO B;  1UHC A;  1HYO A;  3ZEH A;  1BYM A;  2KY9 A;  1WIE A;  2LX9 A;  5GAM g;  1JQQ A;  4LXC A;  3X24 B;  4WCI A;  3MP1 A;  4PJO E;  4L59 A;  3G6E Q;  3CPF A;  1IRE B;  1Q95 G;  3OS1 A;  1VQ7 T;  2V8K A;  4J7I A;  1Q7Y U;  1UDL A;  2DTI A;  3A8O B;  3GNF B;  4D8K A;  1QMC A;  2EBP A;  1K73 U;  4AMC A;  4F7U A;  1RAC B;  2R5M A;  3CC7 Q;  3A8G B;  4XTZ A;  3OYF A;  2ABL A;  2DET A;  2FPD A;  2LQW A;  5CQY A;  4IUV A;  4J5Y A;  3C94 A;  3JCM c;  4BB7 A;  1VQ7 A;  2E6Z A;  2K5I A;  3G71 Q;  3PVQ A;  4DQ2 A;  2OI3 A;  2JVV A;  3CCE Q;  4EIK A;  1LCK A;  1W70 A;  1VYU A;  1M8M A;  1VQL Q;  2F69 A;  2K3X A;  2RHI A;  2AZV A;  2KXC A;  2X4J A;  4C92 E;  2ZAE A;  5LJ3 g;  1H3Z A;  2KE9 A;  1GFD A;  2YUO A;  3EGD A;  1MV0 B;  1PSE A;  5LJ5 e;  4FIB A;  5DM7 R;  5IN1 A;  4J6X A;  1KK7 A;  1SSF A;  2DO3 A;  9ATC B;  2DEQ A;  1WHM A;  2JW4 A;  3OYM A;  4LDY A;  3QDF A;  2VUB A;  1VQO Q;  2EPD A;  1ACM B;  5IHI A;  3HKS A;  2DBM A;  4FM4 B;  3GF5 A;  3HPW A;  3JCM W;  4AFQ C;  4MZT A;  1U3O A;  2BIV A;  2BZX A;  2QQA A;  5GAN d;  2QTX A;  2XMF A;  2CP7 A;  4GLM A;  4XTV A;  4PFZ A;  1K4U S;  2NWM A;  1N8R U;  1I81 A;  1BCM A;  4OGE A;  2DTO A;  4HVV A;  2K7A A;  4OF1 A;  5I2S A;  1CKB A;  4PJJ A;  4CC7 A;  4ZNX A;  2EW3 A;  3HFO A;  2P0K A;  1RAF B;  1JRI A;  4PJO D;  3M0P A;  4XU1 A;  4X34 A;  4LDW A;  1ZSG A;  5KYN A;  4KGZ B;  1YJN Q;  2A3L A;  5FW9 A;  2KT8 A;  3EG9 A;  1RAG B;  2GCX A;  5L8R E;  3L42 A;  5J39 A;  3A8M B;  2YT6 A;  2X3W D;  2ECZ A;  1U06 A;  2PU9 B;  1GXI E;  2E70 A;  5ECA A;  2EGC A;  3M5A A;  2KRN A;  1K9A A;  1HD3 A;  1JB0 E;  1ZSZ B;  5GAN 4;  4BI4 A;  2JN0 A;  2RI2 A;  2I0N A;  1ZSZ C;  3E9F A;  4OVA A;  2D0N A;  4C0F A;  1RAA B;  1XNI A;  2LJ0 A;  3A8L B;  3G4S Q;  1QQJ A;  2RI3 A;  3LGF A;  2L3R A;  3JB9 F;  3CCU Q;  3KFV A;  2JUF A;  1T3S A;  2M02 A;  1QVF P;  3HSB A;  5FLX E;  1UJY A;  5GAN g;  2LRQ A;  2RQW A;  2RH2 A;  1M4Z A;  3QYH B;  2FRY A;  3SB2 A; 
#chains in the Genus database with same CATH homology
 3CC4 A;  2LC4 A;  4R55 A;  2OTL T;  1U1S A;  3PTA A;  4EMG A;  3OSV A;  4C92 F;  4F7U E;  4M77 B;  4BUG A;  4MDW A;  3FLG A;  2KDS A;  2M0O A;  4D6W A;  2F5T X;  1XTD A;  1M1F A;  2X4X A;  3LH0 A;  4ZGE B;  3CMA T;  4FU6 A;  5DLO A;  3OYI A;  3CPW S;  3TCJ A;  2XDD A;  5KCO A;  1O9S A;  4M77 C;  1KHI A;  2PUK B;  4QVD A;  1RL2 A;  4E47 A;  3JCM P;  2M9U A;  3FJP A;  1YJW A;  4R56 A;  1G3Y A;  1WQW A;  3JB9 H;  2ZPE B;  4C8Q C;  2RK2 A;  1U1T A;  3HHT B;  4VUB A;  3CBP A;  3HL8 A;  2NLU A;  4NOY A;  1NPR A;  3GOX A;  3G6E T;  2GFU A;  4OB2 B;  4BD3 A;  3UDC A;  2F5K A;  4ME7 A;  4J6Y A;  2XU8 A;  3OQ5 A;  1X75 C;  4M7A A;  4M77 G;  5GAO p;  3EFR A;  4IUR A;  2DZC A;  4LDU A;  3INZ A;  3OMC A;  2DXC A;  4TVR A;  4C0G A;  3GP8 A;  4E7K A;  2XG8 D;  1FX7 A;  2E64 A;  2RI5 A;  1I5L A;  3OS0 A;  3MET A;  4RCC A;  3CC7 T;  3MP6 A;  4QQ6 A;  3LW5 E;  2OTJ A;  3HRS A;  4N0A A;  4B9X A;  2K5L A;  1JBM A;  2VXF A;  3QJ6 A;  3V8L A;  1M1K C;  2P4T A;  4EPC A;  1G3W A;  4QQG A;  3QPH A;  3OBY A;  3QZ9 B;  3HRU A;  5HK3 A;  3X20 B;  1VQK T;  3OW2 S;  3CCL T;  3OYJ A;  2RB6 A;  3M57 A;  2YLB A;  3L2U A;  4IUU A;  3JCM Q;  3LWH A;  3CXC A;  5IAY A;  3G71 T;  2L5Q A;  1VQM A;  1UGP B;  1OZ3 A;  3OS2 A;  4M77 E;  2DXU A;  2LQK A;  4M75 C;  2E6N A;  5HY6 A;  1V29 B;  2CZ7 B;  1YIJ A;  1O75 A;  3CCE T;  4L6V 5;  4M78 D;  3BDU A;  4C8Q E;  2ZPI B;  5CKB A;  5A0L A;  2E41 A;  2QQS A;  3PNW C;  4WF2 A;  1N8R C;  3E9G A;  1NJI U;  4EMK A;  1VQL T;  4M78 G;  1LJO A;  4FT2 A;  3SWN B;  1S72 T;  3OS5 A;  2FHD A;  3BW1 A;  4JLI A;  5CKD A;  4O6J A;  5EG2 A;  1Q86 U;  1K9M U;  3CCL A;  1G5V A;  5C6S A;  4ZTJ A;  4JS5 A;  1FWZ A;  4XAX B;  3G71 A;  3X26 B;  2EKO A;  3NTK A;  4GY5 A;  2K5F A;  3OB9 A;  4JUV A;  5CO7 A;  1KQS S;  3QBY A;  3SWN C;  5CKF A;  4M78 F;  4MML A;  5GAO r;  3HRT A;  1VQ4 A;  2O01 E;  4J6W A;  5D6X A;  1D3B A;  5CKE A;  2V8J A;  3RMQ A;  3SD4 A;  4PLL A;  3DB3 A;  4LDX A;  4BDZ A;  3MHX A;  4Z02 A;  2K3Y A;  4KUI A;  4ZN1 A;  5CIU A;  2JTF A;  1BI1 A;  5A0G A;  3JB9 I;  3OYB A;  1IZ6 A;  3JCM h;  1S72 A;  1VQ9 A;  4FL6 A;  4A4F A;  3EFS A;  1VQO T;  4HCC A;  3CD6 T;  4DOW A;  1Y07 A;  2FVU A;  4F7U B;  3LWI A;  3S3O A;  1BI3 A;  4LD9 K;  5CKH A;  1OYX A;  5GAN 2;  1EIF A;  4M75 E;  5CVI A;  3V7S A;  4A53 A;  3CCM A;  4PJO A;  3OYG A;  1X6O A;  4J8O A;  3SDZ A;  3CPW A;  2MI6 A;  4PLI A;  3CC2 A;  3JCM d;  2JTM A;  5A0D A;  4YTL A;  3X25 B;  5GAN e;  2HAX A;  2QEX A;  4ELY C;  5FU6 B;  4KUL A;  3VYH B;  1N27 A;  1UGQ B;  3OYL A;  1ZBX A;  3KXT A;  3GPL A;  3QSU A;  2AHJ B;  2FL7 A;  4EMH A;  5FU6 C;  3M54 A;  2CZ0 B;  4CI0 C;  3CCR A;  2LDM A;  3QZ5 B;  4E7H A;  5LJ5 h;  2R58 A;  3HFN A;  3L1A A;  4F7U G;  5GMK h;  3LGL A;  3JCM f;  1G3S A;  3QXE B;  4XTY A;  5IT9 E;  2YLC A;  3ZFJ A;  3PGG A;  4C92 D;  3H8Z A;  1FXX A;  3CCJ A;  1ZHI A;  2M16 A;  2VYT A;  4ZGD B;  2KMT A;  3VU3 C;  4M7D A;  1H64 1;  4IUQ A;  5LJ5 d;  1YJN T;  4OB1 B;  2V8I A;  4ELZ C;  4F7U F;  2K2V A;  1YHQ A;  2OAU A;  2XHC A;  4QVZ A;  3G7Z A;  3CBM A;  2LQ8 A;  4HKE A;  1KC8 U;  4CRI A;  3M59 A;  5J3B A;  3ASK A;  2DIQ A;  2QA4 A;  4ZTF A;  5GAN 5;  4QW2 A;  3CME T;  4JRP A;  2H3J A;  1K8A C;  2DIG A;  1M90 U;  1NPP A;  1VQ6 A;  3VKI A;  5GAN 7;  1BI0 A;  5A2Q E;  2CZ1 B;  3MEA A;  1I8F A;  2RJC A;  3PMI A;  2A7Y A;  5KE3 A;  1BIB A;  4C8Q B;  2JNG A;  4C5I A;  2VXE A;  2DJZ A;  2QQR A;  1YJN A;  1MGQ A;  4M7A C;  2D6F A;  1QVG A;  2XK0 A;  1QVP A;  1B34 A;  4P5N A;  1MHN A;  2EFI A;  2YHT A;  3QJY A;  4N4I A;  2IG0 A;  3PT9 A;  1Y96 B;  3OYN A;  1Q81 U;  2VGM A;  1VQ5 A;  2MMP A;  5I2M A;  2WAC A;  4M77 D;  1LOJ A;  3RUX A;  5GAM h;  1W4S A;  3FDR A;  2XIC A;  3L2Z A;  4N0A C;  4RG2 A;  5FU7 B;  3G4S T;  2OTL A;  1KQS A;  3VUB A;  1W2B A;  1LNX A;  4A54 A;  4E7J A;  3JCM J;  1JJ2 A;  4FSX A;  3CMA A;  2DD5 A;  3CCU T;  5GAM d;  2LT4 A;  5FU7 C;  4C8Q G;  1ZQ1 A;  2RHU A;  3V8K A;  5LJ5 j;  5J26 A;  3ER0 A;  5GMK j;  4HT8 A;  4NL2 A;  3MP8 A;  3NTI A;  2XD0 A;  2ZPB B;  3OY9 A;  2ZCF B;  5FRM A;  3TRE A;  1XOV A;  4Y28 E;  1I4K 1;  2HNI A;  4M77 F;  2IVW A;  2BKD N;  4PKC C;  2K57 A;  3QHS A;  4BI3 A;  3G6E A;  2RM4 A;  1VQP T;  3EAE A;  4C8Q F;  3VYG A;  4M75 B;  2BUD A;  3V8J A;  4IUP A;  4XU3 A;  4HCB A;  1M9S A;  3T9N A;  3JCM g;  4EMK C;  3UWN A;  2CGH A;  2L89 A;  2O4X B;  5GAM f;  3FIF A;  4A4H A;  2WSF E;  3WXM B;  3AHU A;  4M7A E;  3CCV T;  1KD1 U;  3TEE A;  4IUT A;  2LCL A;  4XU2 A;  3S6W A;  4A4K A;  2EWN A;  1WGS A;  4XTU A;  2B8A A;  3QO3 A;  3CC7 A;  1UGS B;  2EQM A;  3FB9 A;  4XQ3 A;  1Q82 U;  3M53 A;  3QUI A;  2EQU A;  4HCZ A;  2M1H A;  3QDR B;  3V7R A;  1M8V A;  4BE1 A;  2HBP A;  2DPP B;  1R8O B;  1UEB A;  1NE8 A;  3DLM A;  3L2R A;  3VJP A;  1OI1 A;  2DKG A;  3RKX A;  1VQP A;  2FYK A;  1VQK A;  2L8D A;  4JDS A;  2MWP A;  4M75 G;  3LYI A;  2RJD A;  2ZPG B;  3RES A;  2MF2 A;  4OP0 A;  4HT9 A;  2HD0 A;  5LJ5 g;  5KE2 A;  1NJI C;  2E1H A;  5LL6 S;  3E1S A;  5GAM j;  4NL3 A;  4JS4 A;  3MEU A;  2QI2 A;  2RJE A;  3CCE A;  1Q86 C;  2Y90 A;  5DLQ E;  1XQH A;  1K9M C;  3QII A;  3C12 A;  4M75 F;  5LJ3 h;  4PJO C;  3VUZ A;  3ME9 A;  2LNV A;  4OB3 B;  1KD1 C;  1WJS A;  3GNG A;  2E65 A;  3X28 B;  4LDV A;  4JRI A;  1YCY A;  1N6A A;  3JCM X;  1VQ8 T;  1VQL A;  4B9W A;  2C06 A;  4M78 A;  3CCQ T;  3KUF A;  2EJ9 A;  3CCS T;  5FRN A;  5LJ3 d;  5GAN 8;  3NFC A;  2RA2 A;  4OGC A;  2QQ9 A;  2ZPH B;  1DJ7 B;  2ZZD A;  3F70 A;  4UC4 A;  3RER A;  2LTO A;  3DKM A;  4N4H A;  2GQV A;  2X35 A;  2CZ6 B;  3H6Z A;  5M9O A;  1YIT T;  4M7D B;  2X4Y A;  2XKO C;  5I21 A;  2JZ2 A;  2RO0 A;  4X9C A;  1YJ9 T;  3JSC A;  2R57 A;  5GAN 3;  3HP9 A;  5KH6 A;  2PVO B;  4M7D C;  2E5Q A;  3M4G A;  1BYM A;  3ZEH A;  2EYQ A;  2HQE A;  2RK1 A;  5LJ3 f;  3S3N A;  2KY9 A;  4J83 A;  4QVC A;  3J80 E;  4NS5 A;  3TU4 K;  5GAN j;  2LX9 A;  1VQO A;  3CD6 A;  2P0Q A;  4MMK A;  2LVM A;  3QKJ A;  2KQW A;  5GMK l;  5GAM g;  3WVD B;  2EQJ A;  4BY6 C;  3X24 B;  4JRK A;  3MP1 A;  2CKK A;  4E7I A;  4PJO E;  2JOY A;  2Y4X A;  4M7D G;  4L59 A;  5HKC A;  1WNL A;  3OYA A;  3FEO A;  3UT1 A;  2WSE E;  4BDY A;  3CPF A;  4C5G A;  4JRQ A;  1IRE B;  1B34 B;  4C0Z A;  2RHZ A;  2DVE A;  3NTH A;  3OS1 A;  3CEY A;  4KUD K;  1VQ7 T;  2V8K A;  4J7I A;  4KT0 E;  1Q7Y U;  2DTI A;  5CK9 A;  3A8O B;  2EQK A;  3GNF B;  5CQX A;  4RG8 A;  3SFM A;  4ZGJ B;  3OW2 A;  4M7D F;  1K73 U;  2CS7 A;  5LJ3 j;  3M4Y A;  1BIA A;  1TH7 A;  4M7D E;  3CC4 T;  4O5V A;  3RIR A;  4F7U A;  5CAI A;  2R5M A;  3FC3 A;  4M7A B;  1KC8 C;  5LJ5 f;  3A8G B;  4XTZ A;  3OYF A;  3WVE B;  3GIB A;  1QW1 A;  4MZP A;  1UGR B;  2DXB A;  1QVF S;  4JLG A;  4IUV A;  4J5Y A;  3C94 A;  5CQY A;  5CR2 A;  3MEV A;  3JCM c;  3RMS A;  5GAO l;  1M90 C;  4C92 A;  4BB7 A;  1YJW T;  4MZM A;  1VQ7 A;  3QG1 A;  2PQW A;  1X01 A;  2E6Z A;  2ZGW A;  3JAM E;  2K5I A;  2E12 A;  3JCM e;  1YI2 T;  3PFS A;  3VV0 A;  3P8D A;  2I2L A;  4DQ2 A;  3CME A;  1UB4 A;  4ATO A;  2JVV A;  4C8Q D;  3JCM b;  1Q81 C;  4PL6 A;  4M7A G;  1AHJ B;  2RHX A;  5GAO q;  2HQX A;  2QXF A;  3OYD A;  2PUO B;  1M5Q 1;  1HXD A;  3S3M A;  2F69 A;  3M9Q A;  3I55 T;  2K3X A;  2K4Y A;  2RHI A;  3BDL A;  1VQN T;  4RMO A;  2GFA A;  1N9R A;  1VUB A;  4LD6 A;  3L2V A;  4DOV A;  3O8V A;  4M7A F;  2OTJ T;  4XTW A;  2X4J A;  4C92 E;  5GMK i;  5LJ3 g;  1H3Z A;  4EMK B;  1YI2 A;  4II1 A;  1PSE A;  4ZN3 A;  2X4W A;  4FIB A;  4RKU E;  5LJ5 e;  5DM7 R;  5GMK e;  5IN1 A;  1WQ7 A;  3G4S A;  3JB9 J;  3P8H A;  4J6X A;  1G3T A;  1SSF A;  2KSS A;  3L2Q A;  3M55 A;  4M77 A;  2DO3 A;  4X9D A;  2D9T A;  4BE2 A;  1KHC A;  2CYZ B;  3CCU A;  2DEQ A;  1VQM T;  3RKW A;  1M1K U;  4C5H A;  4C8Q A;  1BI2 A;  3I55 A;  2Y4Y A;  3OYY A;  5GAN h;  1YIJ T;  1D3B B;  3OYM A;  2EIF A;  3MCA B;  4LDY A;  2VUB A;  2QQB A;  1QP2 A;  4GLK A;  4M75 D;  1RI0 A;  2MWO A;  1Y96 A;  3M56 A;  3MO8 A;  2DK3 A;  3HKS A;  4Q5W A;  4FM4 B;  3GF5 A;  3HPW A;  4XTX A;  3OYC A;  3J7A F;  4M78 B;  4QQD A;  3JCM W;  4MZT A;  2R5A A;  4V2S A;  5D6Y A;  2BIV A;  5GAN d;  2QQA A;  3MEW A;  4A4E A;  2QTX A;  1Q82 C;  2G3R A;  2QDY B;  2E10 A;  2WSC E;  4XTV A;  2DD4 A;  1KQ2 A;  4M78 C;  4PJO B;  3OBW A;  2XDB A;  1N8R U;  4E7L A;  1I81 A;  3CCV A;  4OGE A;  5CCA A;  2XI9 A;  2DTO A;  2EJF A;  4OF1 A;  5I2S A;  1VQ4 T;  3OYE A;  2KK4 A;  3E19 A;  5C0M A;  3I56 T;  3C4S A;  4IKF A;  2LT1 A;  1QVG S;  1KG1 A;  5GAN f;  3Q1J A;  3HFO A;  2P0K A;  4XK8 E;  1JRI A;  3OMG A;  4PJO D;  5GAM e;  4XU1 A;  2LCC A;  1YBY A;  4X34 A;  1VQ9 T;  1WJR A;  4LDW A;  2YRV A;  2ZPF B;  3BY7 A;  2DAQ A;  4M75 A;  5GAN 6;  2PVD B;  1VIE A;  3A8H B;  3CCM T;  1NZ9 A;  4PJO G;  3KBG A;  2O4X A;  1W2B S;  2A3L A;  3R6O A;  1U8R A;  2VV5 A;  4JJN K;  3CC2 T;  1JJ2 S;  1QVF A;  3OA6 A;  2GCX A;  2RD1 A;  1QP3 A;  5L8R E;  3L42 A;  5J39 A;  3OSS C;  3A8M B;  2QEX T;  3I56 A;  3C95 A;  3GLX A;  1N9S A;  1VQN A;  2P0P A;  4MDX A;  2PU9 B;  4PJO F;  4HA8 A;  1VQ8 A;  5GMK m;  1GXI E;  3PIP A;  1HK9 A;  2E70 A;  3DB4 A;  3N5B B;  3P8B B;  4PNO A;  2D0Q B;  3LX7 A;  4BY6 B;  3JCM V;  3CCQ A;  3CCS A;  3M5A A;  4EDU A;  3CCR T;  3SWN A;  4M78 E;  3URG A;  4KBM B;  3PIO A;  3JB9 D;  1JB0 E;  3OYH A;  4M7D D;  2RJF A;  2XDP A;  4BE0 A;  1BKB A;  1OZ2 A;  2EJG A;  3BFM A;  5FRO A;  5GAN 4;  1VIF A;  4J7F A;  4OB0 B;  2DZ9 A;  2JN0 A;  2RI2 A;  4OMF B;  5AYF A;  4BI4 A;  3CXC S;  3CCJ T;  3JB9 G;  2VC8 A;  1KQ1 A;  1YIT A;  4A4G A;  3E9F A;  1Y71 A;  4OVA A;  2VGN A;  2FB7 A;  4C0F A;  3CBO A;  5GAO n;  3J81 E;  1XNI A;  3DLL A;  3PMT A;  1YJ9 A;  5DY9 A;  4C92 B;  1YHQ T;  3A8L B;  4N4G A;  3ZBD A;  2RI3 A;  3LGF A;  1M1G A;  2L3R A;  2MAM A;  4C0D B;  1WPY A;  5D6W A;  2QA4 T;  3JB9 F;  3QYG B;  2DXT A;  4XU0 A;  4C92 C;  3A5Z B;  3JRZ A;  1WJQ A;  3FRN A;  4DA4 A;  3LLR A;  4L5G A;  3RKY A;  2XID A;  4C0D C;  4RCB A;  5KCH A;  5GAO m;  2JUF A;  1Y7X A;  1VQ6 T;  1Q7Y C;  2KVQ G;  2RHY A;  2EAY A;  5HK0 A;  1K73 C;  3M58 A;  3L2W A;  5LJ3 e;  3HSB A;  5FLX E;  2PVG B;  4C92 G;  4Y91 A;  4C5E A;  1K8A U;  3UPU A;  4BI8 B;  5GAN g;  2DTH A;  2LRQ A;  3V7C A;  1VQ5 T;  1PSF A;  4M7A D;  2RH2 A;  1M4Z A;  2KAF A;  3OYK A;  2GF7 A;  3QYH B;  4BAC A;  3SB2 A;  4FT4 A;  1P92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...