3C4SA

Crystal structure of the ssl0352 protein from synechocystis sp. northeast structural genomics consortium target sgr42
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
57
Chain Sequence
b'MIFPGATVRVTNVDDTYYRFEGLVQRVSDGKAAVLFENGNWDKLVTFRLSELEAVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ssl0352 protein
publication title Crystal structure of the Ssl0352 protein from Synechocystis sp.
rcsb
source organism Synechocystis sp.
molecule tags Structural genomics, unknown function
total genus 9
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11623 NdhS NAD(P)H dehydrogenase subunit S
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3c4sA00
3E9GA 2VYTA 3PFSA 4N4IA 2R5AA 2JTFA 5D6WA 4E7IA 2K3XA 2L89A 2LTOA 4B9XA 2BIVA 3S3MA 3DLMA 4IUVA 3OYMA 1OZ3A 2EQMA 3MP6A 2X4WA 1H3ZA 2X4YA 2M16A 3P8DA 2RI2A 2RHYA 3OMCA 2XDPA 4BD3A 1WJSA 3E9FA 3OB9A 4E7HA 2EFIA 3S3NA 3PMTA 5IN1A 4ZTJA 1OI1A 5FRNA 2CKKA 2X4XA 1XNIA 4NS5A 4RG2A 3SD4A 4B9WA 4E7KA 1WJQA 1SSFA 3BDLA 2RHXA 5J26A 2P0KA 5J39A 1N27A 3DB4A 4IKFA 3MP8A 4GY5A 3OYBA 1WGSA 3S3OA 4UC4A 2LDMA 4IUPA 3NTIA 3OYEA 2DIGA 3QJ6A 1MHNA 2G3RA 4IURA 4A4HA 3MP1A 3LGFA 3MEUA 3L2QA 3DB3A 5FRMA 3OYCA 5D6YA 3OS0A 3NTKA 3PNWC 4QQDA 5CIUA 4A4GA 2R57A 3LLRA 3F70A 3OY9A 3OYGA 5KCOA 2RHUA 4OVAA 4BDZA 2DAQA 4PL6A 3L42A 3OYDA 2EQJA 4BDYA 3L2WA 5KCHA 3LYIA 2GFUA 2O4XB 4IUTA 3FDRA 3FC3A 2X35A 4C5IA 3OYHA 2RHIA 4BE0A 2M1HA 2BUDA 3UT1A 5IAYA 2E5QA 2EQKA 3LGLA 2M0OA 3H8ZA 4Z02A 5KE3A 4BE2A 5C0MA 2QQSA 3CEYA 3EAEA 3ME9A 4LD6A 3ZEHA 3O8VA 2MWOA 3C4SA 3OS2A 3META 2NLUA 2RJCA 2EKOA 3NTHA 2F5KA 2B8AA 2EQUA 2XK0A 2HQEA 3ASKA 3QKJA 4QQ6A 5FROA 2WACA 4A4FA 3OYNA 1RI0A 2YRVA 4FU6A 3OMGA 3LX7A 3FEOA 2L8DA 1OZ2A 3H6ZA 5M9OA 3MEAA 3P8HA 2GF7A 2RI5A 3OS1A 2O4XA 5KH6A 1WJRA 4IUQA 3KUFA 4C5GA 4BACA 2JZ2A 4FL6A 2PQWA 4IUUA 5C6SA 3MEWA 2BKDN 2GFAA 2RHZA 4A4EA 4II1A 3OYIA 2MWPA 2RJEA 2RJFA 2RI3A 3UWNA 4E7JA 3FLGA 3Q1JA 3QBYA 3OYKA 4ZTFA 2LRQA 3MEVA 5D6XA 3PMIA 3MO8A 4Q5WA 4HCZA 4L59A 3OYLA 3OYJA 2E6NA 4QVZA 5KE2A 4CRIA 2IG0A 3LH0A 2LCCA 4PLIA 2FHDA 2HQXA 4N4HA 3L2VA 3L2RA 2D9TA 2LVMA 3L2UA 3OYAA 2RJDA 2RO0A 3OQ5A 3OYFA 3GOXA 2K3YA 3QIIA 1KHCA 4C5EA 4QW2A 2R5MA 4BE1A 3OA6A 2R58A 1G5VA 2L3RA 4PLLA 3M9QA 4N4GA 4C5HA 2QQRA 4EDUA 4X34A 4E7LA 3S6WA 2DIQA 1OYXA 4QQGA
chains in the Genus database with same CATH superfamily
1FXXA 5KYUA 3GIBA 4AG1C 4PJOA 4RTVA 5D6WA 5GAN5 1GBRA 3CMEA 5HKCA 1KK7A 4LDUA 2RM4A 4MDWA 2K9GA 4E2FB 1ZUYA 1YCSB 1LCKA 1NJIC 2CKKA 7AT1B 3V8JA 4FW2A 1WHMA 2JMAA 5GAMj 5CKBA 5GAN2 2J05A 1LNXA 4JUVA 5GANf 2OTLQ 1AZEA 4PJLA 5GAMf 4IUPA 3RNJA 3CC2T 2CUDA 5A0LA 1PKTA 3CCLQ 2DRKA 1Y71A 4M7AG 1QWEA 1JJ2A 1SPKA 5CIUA 3LLRA 3OY9A 1YITA 1KJWA 5LJ3h 1U1TA 1UTIA 1MNDA 4M78D 4XU1A 3JCMP 3OSSC 2KROA 4FYWB 2JOYA 2DEQA 4CC4B 2BUDA 3UT1A 1U3OA 1OULA 1PRMC 2FPFA 3CEYA 3ME9A 4AT1B 4Y91A 1M5Q1 2EQUA 4KGXB 4JJBA 5FROA 1U5SA 1VQ8T 1I4K1 1ARKA 4FCYA 3FEOA 5L8RE 1X6GA 1FYNA 4KT0E 5M9OA 3P8HA 1JU5C 5GAOp 1G3SA 1MV0B 3X26B 3PVLA 1YJWQ 2AKLA 1SSHA 1G3YA 1K8AU 1NEGA 1Q7YR 5DLOA 3OYIA 2MWPA 2FPDA 2EGCA 3M5AA 1WXUA 5HK3A 2GQVA 2E41A 1BIBA 1K8AC 4QVZA 5KE2A 2IG0A 1BI1A 1BI3A 1IHWA 3RKYA 1KHCA 2K57A 3HKSA 3UF4A 4M78C 1I0CA 3G4SQ 1YHQT 4KH1B 4NL3A 4M75F 4C92D 3BDUA 4NOYA 5GAOm 3JB9I 4BUGA 4BD3A 1WJSA 4E7HA 4M7DF 1ZSZA 2P4RA 1M2VB 1KHIA 1OI1A 4O5VA 2X4XA 3SD4A 2YUPA 2K2MA 1VUBA 3BDLA 1KQ2A 4J83A 4C0DC 3LW5E 4HCCA 1B07A 2KRSA 2IIMA 2RQUA 5IH2A 5LJ3f 3CCET 1MHNA 2G3RA 1VQMA 3MP1A 2C06A 2R57A 3OW2S 2CT3A 2OTJA 4PL6A 3OYDA 4CC2A 4ZGJB 2QQBA 1QVPA 1N8RU 4BE2A 4M7AA 2QQSA 5GMKm 4IIOA 3O8VA 3VS2A 2E64A 1NLPC 2LQWA 1ZA2B 1N8RC 2J7IA 1GXIE 2FZKB 2L3SA 5GMKh 2JM8A 3VS6A 3CCMQ 2LP5A 1OPKA 1M30A 4DQ2A 4C8QF 1X75C 2K5LA 3CCST 2ZPEB 2J6OA 2JM9A 1UHCA 5GAN8 4ME7A 3L2RA 2CUBA 2AZVA 1R0CB 4LDXA 1MMNA 4C5EA 4A53A 4C5HA 4RKUE 1QKXA 3J81E 2DIQA 4JPBW 2VYTA 2OTLT 3FB9A 2VB6A 4C8QD 2M51A 4B6MA 1FWZA 3CCQA 1VQPQ 1OZ3A 4LUEA 5CKHA 2E3HA 4OMPA 3RMSA 3CQTA 3X24B 2DXUA 2YDLA 1XNIA 2DD5A 2E4HA 1AWOA 4IKFA 1K0SA 1TOVA 2B86A 4M77G 5GMKi 1WXBA 4FM4B 1GRIA 1M1GA 2YRCA 2BZXA 2DYIA 4OMFB 1K0XA 5ECAA 4OVAA 2O31A 4BDZA 2DAQA 1K73U 3GNGA 1JQQA 2QQAA 1YI2Q 1WZOA 4BE0A 1BI0A 4FT4A 4Z02A 2C0OA 3QDFA 4F16A 1TUCA 1AVZC 2RNAA 4X9DA 1K73C 1AZGB 3TSZA 2DVJA 4FU6A 3SB2A 1OZ2A 2PUKB 3HRSA 2MOXA 4DBRA 4LDYA 3KUFA 1RLQC 4LNPA 2KSSA 5C6SA 2PQWA 4LDWA 4II1A 1Q95G 3G4ST 2W10A 2DPPB 4FIBA 3URGA 2A0FB 2DNUA 4HCZA 2X4JA 4CRIA 2FHDA 2I0NA 2HD0A 2LJ0A 2RJDA 2JS0A 2RO0A 2QG9B 3GOXA 1S72Q 4QW2A 2QEXA 1YCYA 1YJ9A 2CS7A 2CZ0B 2DLPA 2COYA 2QASA 4ZNXA 2JTFA 2KYMA 1VQ9A 1BYMA 1WHJA 3CPFA 4YTLA 4ELZC 2EYYA 4OGEA 2DE0X 2A37A 3P8BB 3UA6A 1TWBA 2JTMA 1VQ7Q 4J7IA 1UG1A 4OMMA 5FRNA 2V8KA 2DTIA 1YJNQ 4RG2A 1WJQA 2EJGA 1W2BS 1WGSA 1TXQA 4EIKA 5CAIA 2D8HA 1VA7A 1IRXA 4X1VA 1VQNA 2E10A 3G1JA 3M59A 1GCQA 4Y28E 5D6YA 2XICA 1M9SA 4M78E 4NL2A 1OU9A 3CCMT 3RIRA 2K6DA 1AWWA 2KK4A 2DERA 5GANe 3V8LA 4EMHA 4M77A 1SKUB 4N0AA 3VS3A 5GAMe 3TCJA 3QSUA 3ULRB 4LD6A 3GPLA 3QWYA 1KQSA 4E7SA 3H41A 1BB9A 3JCMJ 2OTJQ 1HSQA 2ZAEA 1V1CA 4FSXA 1KSWA 3I55A 1Q86U 3CXCS 3WXMB 1TUDA 1N5ZA 1IGUA 2CP0A 5CKEA 1AT1B 2VXEA 2QTXA 3PVQA 5FWBA 2QXFA 1VQ5A 1VQPT 2E70A 2HQXA 1JRIA 4M7AC 4OMNA 2FG0A 3GLXA 4JJCA 3M0QA 2KE9A 4MZMA 2F2VA 2KAFA 4M7DG 1D0XA 3TSWA 1T3SA 1X6OA 2EPDA 1QCOA 4HA8A 1LPLA 2JW4A 4C0DB 2MPXC 2HBPA 1D0YA 1UJ0A 4R56A 3G71Q 4WF2A 4QQGA 2SRCA 4C92E 2ZZDA 2VGNA 4J6YA 2DX1A 4JJNK 1WFWA 1VQ6Q 3A8LB 2BIVA 4JRKA 4F7UG 2EQMA 1MMAA 3A8MB 3CCRQ 4WTOB 3EGUA 2MF2A 4HKEA 1M1FA 2L0AA 2LCSA 1TUGB 3EFSA 2EWNA 3OYYA 4F14A 2JN0A 2IPOB 2COWA 1RLPC 5CCAA 1YI2T 2A36A 3G6EQ 3AT1B 1DJ7B 1PM3A 1YN8A 1QP2A 4RCBA 2DL3A 1X69A 4J9FA 2LMJA 1B34A 1R0BG 2VWFA 5L23A 2VVKA 4IURA 1B3QA 5IT9E 2YRDA 3NTKA 3F70A 2P84A 5CO7A 3PT9A 1NYFA 5FWCA 1SRMA 5DY9A 2RQRA 1VQ4A 2PNIA 2QI2A 2M9UA 3HRTA 2PVGB 1PCXA 4C8QG 2EQKA 1GCPA 1Y57A 3JCMh 2WSCE 2MWOA 1HK9A 3THKA 2DZ9A 1M2OA 1ZUKA 4DBQA 3JSCA 2K5FA 1RL2A 3LX7A 2JVVA 3QYHB 3FRNA 2V8IA 1S72T 4XU2A 1WJRA 5GANd 4M4ZA 3CC7A 5GAMd 2JZ2A 3CCJQ 3CCUT 2G6FX 2DO3A 2RJFA 2RI3A 3CPWS 2CP3A 4PJMA 2D1XA 3RR6A 3PTAA 2XD0A 1T3LA 4JS4A 4M75B 1N9SA 3I35A 1T0HA 3OSVA 1KD1R 1VQ7T 2F1LA 2DBMA 2DL5A 2X3XD 4BE1A 1M90R 1YJNT 1N6AA 1YIJA 2BZ8A 3FJ5A 3ER0A 3E9GA 4BY6C 1QVGA 1H8KA 2D0NA 2DVEA 4M75A 2RN8A 1VQOQ 3CBOA 2YUNA 3SWNB 2K79A 4IIMA 1I8FA 1WYXA 3ZL7C 4IUVA 1K9MU 2CZ1B 3BE3A 4PJOB 4M7DA 1UHFA 2XKOC 2XDPA 1RABB 3BY7A 1W2BP 2RK2A 1E7OA 2FZCB 2EIFA 4KULA 3RDVA 3CC4A 1QCFA 1UE9A 5I2SA 1K9MC 2RHXA 2DA9A 3SWNA 3S3OA 4GLKA 3OYEA 1QVFS 1NJIU 4JRPA 1UJYA 1D3BA 3SDZA 4A4HA 2VV5A 1OQKA 4M78F 2ENMA 3JCMf 3VS5A 4AFSC 1H641 5GANj 3CMAT 2HEQA 3JB9F 4EMKB 2X51A 1VQLA 3H8ZA 2FYKA 4CC7A 3H0FA 4OF1A 1VQKA 3OS2A 1R77A 1NBEB 4XTYA 2B8AA 2XK0A 1K8AR 3CXCP 2AT1B 1M3CA 5KYYA 2GGRA 2EYQA 4R0KA 2EKHA 4J7FA 4ZGEB 1XQHA 3I56A 4EMKA 4O6JA 3RUXA 4C5GA 4C8QA 1GCQC 2BKDN 4XAXB 1K76A 5LJ3d 4A4EA 5GANg 2EYWA 3G71T 5GAMg 2HKNA 5GJWB 2OX7A 3JB9D 2C0TA 2VKNA 1VQ6T 5I11A 4N0AC 1WDXA 3T9NA 3OYLA 1D0ZA 2O2OA 2KXDA 4PLIA 3CCRT 5GAOl 2D6FA 2D9TA 2R5MA 1PRLC 2O88A 1QKWA 2AIRB 1W1FA 2FVUA 1RI9A 3G6ET 2O9VA 3M0SA 4C92F 1VQ5Q 2YHTA 1QW1A 1ABQA 3X28B 2X4WA 4OP0A 4LE9A 2XDDA 3KXTA 1NEBA 3H9NA 3PMTA 4ZTJA 2DYBA 1WHLA 4HCBA 3CCVQ 4E7KA 4RUGA 2LT4A 3VYHB 2D8JA 1ZSZB 4RTUA 3QZ9B 3G7ZA 2H8HA 3KBGA 5EG2A 2ECZA 3HFOA 3QZ5B 4TVRA 5GMKl 2BZYA 5EC7A 3NPFA 1ZBJA 3PNWC 1N8RR 3JRZA 2ZPFB 1Q82U 3HSBA 3CCJT 3L2WA 4J9EA 1WPYA 2JT4A 5LJ3j 1BCMA 2KR3A 1JEGA 3EAEA 1Q82C 4F7UF 3META 3SHWA 1X2QA 4RMOA 4M7AB 4Y92A 1M8MA 2CP5A 4E7ZA 3CPWP 2AK5A 2KGTA 3QHSA 2QA4A 2LX9A 1D09B 1RAAB 1X6BA 2GFAA 2RH2A 3LWIA 2VUBA 1K4US 2HBWA 4E47A 3EH1A 1VQOT 5LJ3g 1WIEA 3QJYA 1PD0A 1WA7A 5HY6A 3HPWA 2L3PA 3LH5A 3CC7Q 3C94A 4CI0C 2K3YA 3EHRA 4FYVB 2L3RA 3RERA 2JTEA 2BE7D 3QO3A 2HL3A 1FX7A 2DJZA 2H3JA 1W4SA 3TU4K 2C0IA 1RADB 3BFMA 2F2WA 3CC2A 1UGSB 1UGPB 2HL5C 3E9FA 4AFZC 1QVFP 1M1KU 1UECA 4MMLA 2QYZA 1VYVA 1RUWA 3MP8A 1W6XA 2LX7A 2WSEE 1BKBA 1JJ2S 1MMGA 2DIGA 1M1KC 1SEMA 5DM7R 1LJOA 1K73R 1GL5A 4XTZA 3CCLT 1ZSGA 1Q81U 4HVVA 4M75C 6AT1B 5IXFA 1VQ8A 1J3TA 3JCMc 2JUFA 3CD6Q 3L42A 4M7DC 2CDTA 1OPLA 2DL8A 2KVQG 1NZ9A 2O4XB 4IUTA 1Q81C 3U23A 2EVRA 2M1HA 3LGLA 1VYUA 3CMEQ 2M0OA 5DLQE 1MGQA 3C4SA 2J6KA 2ZPGB 2NLUA 3SWNC 4E6RA 3JCMX 4R55A 1HD3A 4PJOC 2K3BA 2O4XA 4FYYB 1BU1A 1YJWT 1M3BA 1ZQ1A 4BY6B 5GMKj 1ZBXA 4JLGA 4E7JA 2GQIA 2YUOA 2E5KA 4JDSA 3OYKA 2LRQA 4Q5WA 1NM7A 1YHQA 2HSPA 2CP6A 1QWFA 1YITQ 5GAN7 1D1BA 2YWWA 2W0ZA 3FIFA 1TS9A 1FMVA 3CCVT 3JCMW 1BK2A 3NMZC 1NPPA 4A63B 3RMQA 2PTKA 1CSKA 2HDAA 4KBMB 2RA2A 1HXDA 2MAMA 4RTTA 4EMKC 2R5AA 4OB2B 3M58A 1KC8U 1X43A 5KYWA 3EGXA 2AHJB 3BW1A 4QT7A 1PSEA 4B9XA 3S3MA 3CCEA 4RCCA 3OB9A 1TSFA 1FMKA 2DXCA 1KC8C 1AHJB 4J9HA 4M78G 3VYGA 1QCNA 2PVOB 3E2UA 1MMDA 1HJDA 3DB4A 1PSFA 1M27C 2MK5A 4D6WA 3JB9G 3QWXX 2LDMA 2KI7A 3QYGB 3LGFA 3L2QA 1V76A 1WQWA 3M4YA 2KRNA 4C0FA 3OYGA 5KCOA 5LJ5h 4OMLA 3TEEA 1IHVA 2A7YA 4Z88A 4K11A 2E5QA 5C0MA 3OW2P 4M77B 5AT1B 3CCSA 1UDLA 1WQ7A 3CPWA 1Q86R 2RMOA 4M7AD 2H3EB 2RPNA 1U8RA 2RI5A 1ZUUA 2CZ6B 3M55A 4IUQA 2SEMA 3DKMA 5A0DA 1H3HA 1ZSZC 3NFCA 3FLGA 1KG1A 1Y96A 3Q1JA 2ESWA 1TH7A 1IXDA 1VQMQ 4C92G 2OTLA 3RBBB 3QDRB 2KYBA 1TU0B 2DXBA 3DLLA 2NUPA 2O01E 3J80E 4WCIA 1I5OB 3I9QA 1QQJA 2JJ9A 4E7IA 2DTHA 3X20B 1YP5A 2ED0A 5CK9A 1QVFA 2X4YA 4RTZA 4J5YA 3GF5A 2J06A 3LWHA 2EFIA 2DJQA 1VYTA 4AFUC 4JZ4A 1JJ2P 3CD6T 2K7AA 2IVWA 2YLBA 1D1CA 3A1PA 2KMTA 3VS0A 2CSQA 1QLYA 5GAOr 3OYBA 5GAN6 3CMET 1U1SA 2PZ1A 3A8HB 2EYXA 3CC2Q 4DBHA 5LJ5f 4ESRA 4OMQA 2GTJA 4KGVB 4DEYA 2HZYA 1SF9A 1D1AA 5FRMA 4M78A 4P5NA 2A28A 3I5SA 4A4GA 1B34B 4J9GA 3EFRA 4HCKA 2V1RA 1W70A 3GNFB 2EQJA 1VOMA 3FC3A 3VS7A 4QKUA 5KYXA 2Y90A 5IAYA 5KE3A 2L5QA 3CCQQ 4D8KA 3QUIA 3G4SA 3M4GA 2COZA 2RD1A 4RG8A 3OYNA 1YITT 3M0RA 5FU7B 3H6ZA 3MEAA 1SHFA 1UUEA 4BACA 3UATA 4DOVA 1OOTA 4F17A 4GLMA 4Z89A 1I1JA 5LJ3e 2HMAA 4JRIA 2E12A 4OMOA 4M75E 4D8DA 2RB6A 3JCMd 3JCMQ 2JMCA 3EFOB 2ZPBB 4QVDA 3H0IA 2VC8A 2VGMA 3OA6A 3JAME 5HK0A 2MMPA 4N4GA 4BB7A 2I2LA 3MKDA 1K9MR 4HXJA 2KT8A 4C92A 4E7LA 1E6GA 4JRQA 3E1SA 3PFSA 1ZLMA 2JNGA 1C0MA 4L6V5 3UPUA 1YBYA 2EJ9A 2F69A 4XTWA 3EFOA 2Z0WA 4PJOE 3DLMA 1UFFA 1VIEA 1Y07A 5GAMh 2LJ3A 2V26A 1YNZA 1CKBA 5IN1A 4F04B 4M7DB 5AYFA 2DMOA 1NJIR 2E1HA 3CCMA 1G8XA 3CBMA 5IHNA 2KDSA 3GP8A 3PIOA 2EBPA 2CP7A 1AWJA 2HSEB 4JZ3A 3EG9B 2QEXQ 1D3BB 1YJ9Q 3ZBDA 2E65A 2M0YA 4BDYA 1GBQA 3OW2A 4C5IA 1KQSS 1VQ9Q 2F2XA 4ATOA 1PWTA 2CYZB 4F7UA 1HYOA 1M3AA 3UDCA 5IHKA 4J9CA 2HKQB 3EG9A 5FW9A 4A4FA 2XDBA 2KQWA 1JBMA 4J9BA 2CSIA 1UGQB 2EJFA 1VQPA 2OTJT 5CQYA 1WHGA 1UB4A 2LQNA 5KYYB 5FLXE 3JB9J 1M8VA 2X9HA 1Z9ZA 4FL6A 1EX4A 1WHKA 3VU3C 3M0TA 2QAZA 4PNOA 3CCSQ 1KD1U 1BCOA 4C8QB 1M90U 2NUTA 1S1NA 2K4YA 1VQNQ 3GBQA 3QBYA 2A08A 3OYJA 2E6NA 1IO6A 4HT9A 1SRLA 2LCCA 1X27A 1KD1C 1FMWA 1KQ1A 2LJ1A 2NYSA 1SHGA 4KUDK 2FO0A 3JCMg 1M90C 3OQ5A 1WX6A 2VXFA 4XTVA 4AG2C 1C1AA 3SFMA 1PG5B 5CR2A 1MUZA 5GMKe 1O9SA 1XTDA 3INZA 4J9DA 1YI2A 1G2BA 1Y0MA 4C0GA 1I5LA 2DFUA 4XK8E 4M77C 4PK4A 2K2VA 2RI2A 1PNJA 2YT6A 3H0HA 4ZGDB 2QGGA 3I55Q 2YSQA 4CC3A 4ZN3A 4FSSA 2CGHA 3OS5A 1LVKA 3M0PA 4DOWA 3MPUB 5J39A 3OBYA 4A54A 3JCMV 3VV0A 2HNIA 4ORZA 3CCQT 1JXMA 3NTIA 3O5ZA 4RTWA 1AD5A 2F5TX 4OB0B 1Q82R 1ZX6A 3MCAB 3MEUA 4PJJA 3VJPA 1H92A 2GNCA 2M02A 3EH2A 2PUOB 2DEUA 1S72A 2OAUA 3LYIA 4DBFA 3EG1A 3OYHA 2DF6A 4XTXA 1KIKA 3CCUA 1WI7A 2P0QA 2RF0A 3M56A 4M7AE 1AWXA 5A0GA 3EGDB 2DKGA 3MHXA 4PKCC 2DL4A 1IZ6A 1BBZA 3EHQA 1VQ7A 4EPCA 4KRTA 2BTTA 1ZHIA 2MI6A 1YJNA 2DILA 5FU6C 3EGDA 4ELYC 3MO8A 1Q7YU 1K9AA 4BI3A 4PJNA 1JO8A 3EG3A 1VQ4Q 2HQHA 3KFVA 4LXCA 2L3QA 4JLIA 1CKAA 4PLLA 4PFPA 1QVGS 4X34A 5GJVB 3SEMA 2A3LA 2QGFB 1Q7YC 5HCKA 4HT8A 2Y4YA 2NUZA 2PVDB 1ACMB 2AZSA 2K3XA 5I2MA 4PJOF 1M1KR 3VUZA 1M2VA 3VKIA 4M75D 1NE8A 2QEXT 4VUBA 1YJ9T 5FU7C 4J6WA 4HVUA 2PU9B 4M7DD 2EQIA 3V8KA 1Q81R 1VQ9T 3VRYA 3QXEB 3CMAA 1NLOC 4OB3B 3REBB 1TTHB 2Y4XA 2CT4A 2AKKA 8ATCB 2GCXA 4C92C 3M57A 1W2BA 1KQSP 2JS2A 3OYCA 2DK3A 3OS0A 4PJOD 1OU8A 4QQDA 4XQ3A 1YIJQ 4X9CA 2EAYA 4BI8B 1B7TA 1JB0E 1QP3A 2RK1A 3RESA 4RTYA 5CKDA 1X2KA 1BI2A 1GFDA 5LJ5e 4KH0B 3TREA 1VQNT 1BIAA 3G71A 1U06A 2DRMA 2DM1A 1MV3A 3HL8A 3ASKA 1VQ6A 2FL7A 3D7SB 3CC4Q 1ZA1B 3CCRA 3OS1A 4LUDA 3C12A 4XTUA 2LQKA 3PE0A 2EGEA 2K5IA 3HHTB 4IUUA 2LNVA 2HAXA 2ZCFB 3EG0A 3G6EA 1NG2A 1WHHA 1YFNA 3CXCA 2CZ7B 8AT1B 5D6XA 4RTXA 3NGPA 5D7UA 4FW1A 3L2ZA 2FRWA 2X3WD 3C95A 4N4HA 4ZN1A 2LVMA 3HTRA 3I55T 3QIIA 2DL7A 1NPRA 3M0UA 1KC8R 2MCNA 2LQ8A 1VQLQ 2QQRA 4EDUA 1N9RA 1EIFA 1VQKQ 1OX8A 1VQ5T 2FZGB 2JXBA 2LTOA 1IGQA 1H3ZA 2QQ9A 3MP6A 4PFOA 5I22A 2GBQA 3P8DA 2RHYA 3EGXB 5KYWB 3I56Q 1JXOA 1I81A 4Z8AA 3R6OA 3VS1A 4LN2A 1KFZA 1YWPA 2KXCA 4NS5A 4B9WA 2QDYB 1SSFA 2P0KA 1PD1A 4DEXA 3CCJA 2E3IA 4KGZB 2YLCA 4C8QC 3QJ6A 3CBPA 4FYXB 5IXBA 1LOJA 4OB1B 4MZPA 2CH4A 2FB7A 4OGCA 2GFUA 2HCKA 3FDRA 3VS4A 2RHIA 1WXTA 2OAWA 1RACB 3L1AA 4M77E 3TVTA 3A8GB 4JS5A 4GBQA 4M7AF 2EKOA 1VQOA 3A8OB 1RAFB 1OV3A 1VQ4T 4MZTA 4J6XA 2QTVA 3HRUA 3CCUQ 1RAEB 1A0NB 3PIPA 1WLPB 1AEYA 2CH4W 3E19A 5LJ5d 3M54A 1UGVA 1F1BB 3NHNA 3R6NA 4ZTFA 4MDXA 3AHUA 1YWOA 3V7CA 1QVGP 4L59A 1Y96B 3LH0A 2V8JA 3JCMe 3L2UA 3OYAA 3CC7T 2KT1A 1XJWB 1AOJA 2R58A 2MIOA 1V29B 3S6WA 2NUPB 2XMFA 3QPHA 4N4IA 1NYGA 2EYZA 2L2PA 3A5ZB 2XHCA 2V1QA 4XU0A 3OMCA 2FPEA 4KUIA 4C0ZA 1Z9QA 4LDVA 3S3NA 2XU8A 5IHIA 2QA4Q 1YIJT 3CCLA 3V7RA 3HFNA 1RAIB 2LCLA 4JJDA 3WVDB 4V2SA 5J26A 2EGAA 4FT2A 5CVIA 3N5BB 4UC4A 1Y7XA 2RQVA 1PKSA 1RAHB 1OEBA 5LL6S 3ZFJA 1G3WA 2ZGWA 4BI4A 3PGGA 1O75A 3CC4T 1G83A 1PC0A 1MNEA 4DA4A 4M78B 2DXTA 1T0JA 3CMAQ 3VRZA 2X35A 1YJWA 3HP9A 5FU6B 5LJ5j 2WSFE 1C6VX 3A98A 5KYXB 1Q86C 2RJCA 4M75G 3JB9H 1GFCA 2ATCB 2F5KA 3QKJA 4QQ6A 2WACA 3IQLA 2YRVA 5CQXA 1UGRB 2RQTA 2RQWA 2L8DA 1M4ZA 1EFNA 2GF7A 3I5RA 1IREB 5KH6A 2ABLA 1VQLT 4EMGA 3MEWA 2ED1A 1G3TA 3CCVA 2RHZA 2VASA 2RJEA 3UWNA 1VQKT 3QG1A 5LJ5g 3J7AF 3MEVA 3PMIA 1QMCA 5GAOq 1VQ8Q 4PJOG 1UEBA 3I56T 3L2VA 2KBTA 4LD9K 4J9IA 1G5VA 2YXYA 2XIDA 3M9QA 1IB8A 5GAN3 2QK0A 1OYXA 2LNHB 3JCMb 1R8OB 2DBKA 4C92B 2L89A 4HVWA 1E6HA 2DETA 2GTOA 3OYMA 2ZPHB 2XG8D 1PHTA 2M16A 1K1ZA 1WNLA 1EZZB 1TG0A 2DD4A 3UA7A 3V7SA 5GAOn 4M7DE 2LT1A 2LC4A 2YUQA 3VUBA 3MJXA 2DZCA 2O9SA 1N27A 2KY9A 2OI3A 4A4KA 3OBWA 4GY5A 2FEIA 2KRMA 1X01A 1YHQQ 4F7UE 1RAGB 2E6ZA 3FJPA 2ZPIB 3DB3A 5GANh 2RHUA 2CP2A 4ANJA 3TQ7P 2CREA 3JV3A 4AMCA 3RKWA 5J3BA 9ATCB 2FRYA 5KCHA 4QVCA 2NWMA 2D0QB 5I21A 1I07A 4M77F 4PFZA 1OX9A 2ROLA 2LZ6B 3ZEHA 3CCEQ 1VIFA 4J8OA 3NTHA 2HQEA 2KNBB 1ABOA 4F7UB 1SG5A 1RI0A 5CKFA 3OMGA 2DTOA 2XI9A 4XU3A 4AFQC 3X25B 3M53A 2MYSA 2KEAA 3EG2A 4C8QE 4MMKA 2J6FA 2P0PA 1VQMT 4M77D 5KYUB 4L5GA 2P4TA 2NUTB 5KYNA 5A2QE 3WVEB 1P92A 3RKXA 5GAN4 3OYFA 2QA4T 2EW3A 3C0CA 2BE9B 1XOVA 3REAB 2ROTA 2QDLA 3CD6A 2OJ2A
chains in the Genus database with same CATH topology
1HXDA 1FXXA 2MAMA 2Y4YA 4EMKC 4C92E 2PVDB 2R5AA 2VGNA 2ZZDA 3M58A 4J6YA 4OB2B 4JJNK 1KC8U 3GIBA 4PJOA 5D6WA 5GAN5 2AHJB 2K3XA 3A8LB 3BW1A 5I2MA 3CMEA 4PJOF 1PSEA 5HKCA 3VUZA 4B9XA 2BIVA 4JRKA 3S3MA 4LDUA 4F7UG 2EQMA 3VKIA 3A8MB 4M75D 4RCCA 3CCEA 2RM4A 2MF2A 4HKEA 4MDWA 1NE8A 3OB9A 2QEXT 1M1FA 4VUBA 2DXCA 5FU7C 3EFSA 4J6WA 2EWNA 1YJ9T 1AHJB 1KC8C 1NJIC 2CKKA 2PU9B 3OYYA 4M78G 3V8JA 3VYGA 4M7DD 2JN0A 2PVOB 5GAMj 5GAN2 5CKBA 5CCAA 1YI2T 3V8KA 3DB4A 1LNXA 1PSFA 4JUVA 5GANf 1VQ9T 4D6WA 3QXEB 3JB9G 3CMAA 1DJ7B 4OB3B 5GAMf 2LDMA 4IUPA 3QYGB 2Y4XA 1QP2A 5KCHA 4RCBA 3CC2T 2GCXA 1B34A 4C92C 3M57A 5A0LA 1W2BA 4IURA 1Y71A 4M7AG 3LGFA 5IT9E 3L2QA 1WQWA 1JJ2A 3OYCA 2DK3A 3M4YA 3NTKA 3OS0A 4PJOD 4QQDA 4XQ3A 5CIUA 3LLRA 3F70A 4X9CA 5CO7A 4C0FA 5KCOA 3PT9A 3OY9A 3OYGA 1YITA 2EAYA 4BI8B 5LJ5h 5LJ3h 1U1TA 5DY9A 1VQ4A 1JB0E 2QI2A 1QP3A 2RK1A 4M78D 4XU1A 3OSSC 3RESA 2M9UA 3TEEA 3JCMP 5CKDA 3HRTA 2PVGB 2JOYA 2A7YA 1BI2A 2DEQA 2BUDA 3UT1A 5LJ5e 2E5QA 2EQKA 4C8QG 3JCMh 3TREA 5C0MA 3CEYA 1BIAA 2WSCE 3ME9A 4M77B 3G71A 1VQNT 3CCSA 1WQ7A 2MWOA 4Y91A 1M5Q1 3HL8A 3CPWA 2EQUA 5FROA 1HK9A 3ASKA 1VQ8T 1VQ6A 1I4K1 4M7AD 2DZ9A 2FL7A 3JSCA 2K5FA 1RL2A 3LX7A 2JVVA 3FEOA 3QYHB 5L8RE 4KT0E 5M9OA 1U8RA 3FRNA 3P8HA 2V8IA 2RI5A 5GAOp 3CCRA 1G3SA 3OS1A 3X26B 1S72T 4XU2A 3M55A 2CZ6B 1WJRA 3C12A 4IUQA 4XTUA 5GANd 3CC7A 1G3YA 2JZ2A 2LQKA 5GAMd 1K8AU 3CCUT 2K5IA 3HHTB 4IUUA 3DKMA 5A0DA 2LNVA 5DLOA 2DO3A 3OYIA 2MWPA 3NFCA 2ZCFB 2RJFA 2HAXA 2RI3A 3FLGA 1KG1A 3CPWS 1Y96A 3M5AA 3Q1JA 3CXCA 3G6EA 1TH7A 3PTAA 4C92G 2CZ7B 2OTLA 2XD0A 5HK3A 2GQVA 2E41A 5D6XA 4JS4A 1BIBA 1K8AC 4M75B 3L2ZA 4QVZA 5KE2A 1H3ZA 2IG0A 3C95A 1N9SA 3QDRB 1BI1A 4N4HA 4ZN1A 2LVMA 3OSVA 1BI3A 3I55T 1VQ7T 3RKYA 3QIIA 1KHCA 2DXBA 4BE1A 1NPRA 2K57A 3DLLA 2O01E 3J80E 1YJNT 1N6AA 1YIJA 2LQ8A 3HKSA 2QQRA 4EDUA 3ER0A 1N9RA 4M78C 1EIFA 3E9GA 4BY6C 1QVGA 2DVEA 4M75A 1VQ5T 3CBOA 1YHQT 3SWNB 4NL3A 4E7IA 4M75F 4C92D 2DTHA 3BDUA 2LTOA 3X20B 1I8FA 4IUVA 1K9MU 4NOYA 2QQ9A 3MP6A 5GAOm 2CZ1B 5CK9A 2X4YA 3P8DA 1QVFA 4M7DA 3JB9I 2RHYA 2XKOC 4BUGA 2XDPA 4J5YA 4PJOB 4BD3A 1I81A 1WJSA 3BY7A 3GF5A 3LWHA 2EFIA 2RK2A 3R6OA 4E7HA 4M7DF 1KHIA 1OI1A 2EIFA 4O5VA 4KULA 2X4XA 4NS5A 3SD4A 4B9WA 3CC4A 3CD6T 2IVWA 2YLBA 2QDYB 1SSFA 5I2SA 1K9MC 1VUBA 3BDLA 2RHXA 2KMTA 1KQ2A 2P0KA 4J83A 4C0DC 3LW5E 3SWNA 3CCJA 5GAOr 3OYBA 5GAN6 4HCCA 3S3OA 3CMET 4GLKA 1U1SA 2YLCA 3A8HB 3OYEA 1QVFS 4C8QC 5LJ3f 5LJ5f 1NJIU 4JRPA 3CCET 3QJ6A 3CBPA 1MHNA 1D3BA 3SDZA 2G3RA 4A4HA 2VV5A 3MP1A 1VQMA 5FRMA 4M78A 4P5NA 1LOJA 4OB1B 1B34B 4MZPA 2R57A 4A4GA 2C06A 3OW2S 4M78F 3EFRA 3JCMf 2OTJA 3GNFB 4PL6A 2FB7A 3OYDA 2EQJA 1H641 4OGCA 5GANj 3CMAT 2GFUA 4ZGJB 3FC3A 3FDRA 3JB9F 2QQBA 4EMKB 1QVPA 2RHIA 2Y90A 1N8RU 1VQLA 3L1AA 5IAYA 4M77E 5KE3A 3A8GB 2L5QA 3H8ZA 4JS5A 4BE2A 4M7AA 2QQSA 5GMKm 2FYKA 3QUIA 3O8VA 4OF1A 3G4SA 1VQKA 3OS2A 4M7AF 3M4GA 2EKOA 4XTYA 2RD1A 4RG8A 2B8AA 2E64A 2XK0A 3A8OB 3OYNA 1VQOA 2EYQA 1YITT 5FU7B 1N8RC 3H6ZA 1GXIE 4J7FA 1S72A 1VQ4T 3MEAA 4MZTA 4ZGEB 5GMKh 4J6XA 1XQHA 3I56A 4EMKA 4O6JA 3RUXA 3HRUA 4C5GA 4BACA 4C8QA 3PIPA 4DOVA 2BKDN 4XAXB 4DQ2A 4C8QF 3E19A 5LJ3d 3M54A 4A4EA 5LJ5d 1X75C 5GANg 3G71T 2K5LA 5GAMg 3CCST 2ZPEB 5LJ3e 3JB9D 4JRIA 2E12A 4ZTFA 4MDXA 4M75E 1VQ6T 3AHUA 4N0AC 3V7CA 3T9NA 4L59A 2RB6A 3JCMd 3JCMQ 3OYLA 1Y96B 3LH0A 4PLIA 5GAN8 4ME7A 3CCRT 5GAOl 2D6FA 2V8JA 3JCMe 2D9TA 2ZPBB 3L2RA 3L2UA 4QVDA 3OYAA 3CC7T 4LDXA 4C5EA 2VC8A 2R5MA 2VGMA 2R58A 4A53A 3OA6A 3JAME 5HK0A 2MMPA 4N4GA 4C5HA 4BB7A 2I2LA 2FVUA 1V29B 4RKUE 4C92A 3G6ET 3S6WA 3J81E 4E7LA 2DIQA 4JRQA 3E1SA 2VYTA 3PFSA 3QPHA 4C92F 2OTLT 2JNGA 3FB9A 4N4IA 2YHTA 4L6V5 3UPUA 4C8QD 1YBYA 1QW1A 2EJ9A 2F69A 4XTWA 1FWZA 3CCQA 4PJOE 3A5ZB 2XHCA 3DLMA 1OZ3A 3X28B 2X4WA 4XU0A 1VIEA 1Y07A 5CKHA 3OMCA 4OP0A 4KUIA 5GAMh 3RMSA 2XDDA 3KXTA 3X24B 4C0ZA 4LDVA 3S3NA 2DXUA 2XU8A 3PMTA 1YIJT 3CCLA 5IN1A 3V7RA 3HFNA 4ZTJA 4M7DB 4HCBA 2LCLA 1XNIA 5AYFA 4E7KA 2DD5A 2LT4A 2E1HA 3VYHB 3WVDB 3CCMA 4V2SA 5J26A 3CBMA 3QZ9B 4IKFA 3G7ZA 4FT2A 2KDSA 3GP8A 5CVIA 3N5BB 4UC4A 1Y7XA 3KBGA 3PIOA 5EG2A 4M77G 5GMKi 4FM4B 3HFOA 3QZ5B 5LL6S 1M1GA 4TVRA 5GMKl 3ZFJA 1G3WA 2ZGWA 4BI4A 3PGGA 3PNWC 1O75A 3CC4T 1D3BB 4OMFB 3JRZA 2ZPFB 4OVAA 2E65A 3ZBDA 4BDZA 4DA4A 2DAQA 1Q82U 4M78B 3HSBA 1K73U 3GNGA 2DXTA 3CCJT 4BDYA 3L2WA 3OW2A 2QQAA 2X35A 4C5IA 1YJWA 1KQSS 3HP9A 4BE0A 1WPYA 1BI0A 4FT4A 5FU6B 2WSFE 5LJ3j 5LJ5j 4ATOA 4Z02A 2CYZB 4F7UA 3EAEA 4X9DA 3UDCA 1Q82C 4F7UF 1K73C 1Q86C 3META 2RJCA 4M75G 3JB9H 2F5KA 4A4FA 3QKJA 4QQ6A 4RMOA 2XDBA 2KQWA 4M7AB 2WACA 1JBMA 2YRVA 1UGQB 2EJFA 4FU6A 5CQXA 1UGRB 1VQPA 3SB2A 2L8DA 1OZ2A 2PUKB 3HRSA 5CQYA 2OTJT 1M4ZA 1UB4A 2GF7A 5FLXE 3JB9J 1IREB 5KH6A 1M8VA 4LDYA 3KUFA 3QHSA 2QA4A 2KSSA 2LX9A 4FL6A 2PQWA 3VU3C 4EMGA 5C6SA 3MEWA 1VQLT 2GFAA 1G3TA 2RH2A 4LDWA 3CCVA 2RHZA 4PNOA 4II1A 1KD1U 3LWIA 2VUBA 2RJEA 3UWNA 1VQKT 4C8QB 3QG1A 4E47A 2DPPB 3G4ST 1M90U 2K4YA 1VQOT 5LJ5g 3QBYA 5LJ3g 4FIBA 3URGA 3J7AF 3MEVA 3PMIA 3QJYA 4HCZA 5GAOq 3OYJA 2E6NA 2X4JA 4PJOG 4CRIA 4HT9A 2LCCA 5HY6A 1UEBA 2FHDA 3HPWA 1KD1C 3I56T 3L2VA 1KQ1A 2HD0A 4LD9K 3C94A 4KUDK 2RJDA 3JCMg 2RO0A 3OQ5A 4CI0C 3GOXA 1M90C 2K3YA 1G5VA 4QW2A 2L3RA 3RERA 2VXFA 2XIDA 2QEXA 1YCYA 3M9QA 1YJ9A 2CS7A 3QO3A 5GAN3 4XTVA 2CZ0B 1FX7A 3SFMA 2H3JA 2DJZA 1OYXA 5CR2A 5GMKe 1O9SA 1W4SA 1XTDA 3INZA 1YI2A 3TU4K 3JCMb 2JTFA 1R8OB 4C0GA 4C92B 3CPFA 4YTLA 4ELZC 1I5LA 4OGEA 1VQ9A 1BYMA 2L89A 4XK8E 4M77C 2K2VA 3BFMA 3OYMA 2ZPHB 2XG8D 2M16A 3P8BB 3CC2A 2RI2A 1UGSB 1UGPB 3E9FA 4ZGDB 1WNLA 2DD4A 2JTMA 4M7DE 4J7IA 3V7SA 5GAOn 4ZN3A 2LT1A 5FRNA 2LC4A 2DTIA 2V8KA 1M1KU 2CGHA 3OS5A 4RG2A 3VUBA 4MMLA 1WJQA 4DOWA 2DZCA 2EJGA 5J39A 1N27A 2KY9A 3OBYA 4A54A 3MP8A 4A4KA 3OBWA 3JCMV 3VV0A 4GY5A 1W2BS 1WGSA 2HNIA 3CCQT 1X01A 2WSEE 3NTIA 1BKBA 5CAIA 1JJ2S 2DIGA 1M1KC 4F7UE 2F5TX 2E6ZA 3FJPA 4OB0B 5DM7R 1LJOA 1VQNA 2E10A 4XTZA 2ZPIB 3CCLT 3MCAB 3MEUA 3VJPA 1Q81U 3DB3A 3M59A 4M75C 4Y28E 5D6YA 2XICA 5GANh 1VQ8A 1M9SA 4M78E 4NL2A 2RHUA 3JCMc 3CCMT 2PUOB 2JUFA 3RIRA 3L42A 4M7DC 3RKWA 2KK4A 5J3BA 2OAUA 5GANe 3V8LA 4EMHA 2KVQG 3LYIA 1NZ9A 2D0QB 2O4XB 4IUTA 4M77A 4N0AA 5GAMe 3TCJA 5I21A 1Q81C 3OYHA 3QSUA 4XTXA 2M1HA 4M77F 3CCUA 3LGLA 2M0OA 4LD6A 5DLQE 2P0QA 1MGQA 3GPLA 3ZEHA 1KQSA 3M56A 3C4SA 2ZPGB 1VIFA 4J8OA 2NLUA 3NTHA 4M7AE 3SWNC 2HQEA 3JCMX 4R55A 4F7UB 1RI0A 5A0GA 5CKFA 3JCMJ 3OMGA 2DKGA 2DTOA 4PJOC 3MHXA 2XI9A 4FSXA 4PKCC 4XU3A 2O4XA 1IZ6A 3I55A 1VQ7A 3X25B 4EPCA 1YJWT 3M53A 1Q86U 1ZHIA 2MI6A 1ZQ1A 3CXCS 1YJNA 3WXMB 4BY6B 5GMKj 4C8QE 1ZBXA 4MMKA 4JLGA 5CKEA 4E7JA 2P0PA 5FU6C 4JDSA 3OYKA 4QVCA 2LRQA 2VXEA 1VQMT 4M77D 2QTXA 4ELYC 3MO8A 2QXFA 4Q5WA 1YHQA 1VQPT 4L5GA 1VQ5A 2P4TA 1Q7YU 2E70A 5A2QE 4BI3A 5GAN7 2HQXA 1JRIA 4M7AC 3WVEB 1P92A 3GLXA 3RKXA 5GAN4 3FIFA 3OYFA 2QA4T 4MZMA 2KAFA 4JLIA 4M7DG 1XOVA 3CCVT 1X6OA 4PLLA 3JCMW 1QVGS 1NPPA 4HA8A 3RMQA 4C0DB 4X34A 2HBPA 2A3LA 1Q7YC 4R56A 3CD6A 4KBMB 4WF2A 2RA2A 4QQGA 4HT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9G A;  2VYT A;  3PFS A;  4N4I A;  2R5A A;  2JTF A;  5D6W A;  4E7I A;  2K3X A;  2L89 A;  2LTO A;  4B9X A;  2BIV A;  3S3M A;  3DLM A;  4IUV A;  3OYM A;  1OZ3 A;  2EQM A;  3MP6 A;  2X4W A;  1H3Z A;  2X4Y A;  2M16 A;  3P8D A;  2RI2 A;  2RHY A;  3OMC A;  2XDP A;  4BD3 A;  1WJS A;  3E9F A;  3OB9 A;  4E7H A;  2EFI A;  3S3N A;  3PMT A;  5IN1 A;  4ZTJ A;  1OI1 A;  5FRN A;  2CKK A;  2X4X A;  1XNI A;  4NS5 A;  4RG2 A;  3SD4 A;  4B9W A;  4E7K A;  1WJQ A;  1SSF A;  3BDL A;  2RHX A;  5J26 A;  2P0K A;  5J39 A;  1N27 A;  3DB4 A;  4IKF A;  3MP8 A;  4GY5 A;  3OYB A;  1WGS A;  3S3O A;  4UC4 A;  2LDM A;  4IUP A;  3NTI A;  3OYE A;  2DIG A;  3QJ6 A;  1MHN A;  2G3R A;  4IUR A;  4A4H A;  3MP1 A;  3LGF A;  3MEU A;  3L2Q A;  3DB3 A;  5FRM A;  3OYC A;  5D6Y A;  3OS0 A;  3NTK A;  3PNW C;  4QQD A;  5CIU A;  4A4G A;  2R57 A;  3LLR A;  3F70 A;  3OY9 A;  3OYG A;  5KCO A;  2RHU A;  4OVA A;  4BDZ A;  2DAQ A;  4PL6 A;  3L42 A;  3OYD A;  2EQJ A;  4BDY A;  3L2W A;  5KCH A;  3LYI A;  2GFU A;  2O4X B;  4IUT A;  3FDR A;  3FC3 A;  2X35 A;  4C5I A;  3OYH A;  2RHI A;  4BE0 A;  2M1H A;  2BUD A;  3UT1 A;  5IAY A;  2E5Q A;  2EQK A;  3LGL A;  2M0O A;  3H8Z A;  4Z02 A;  5KE3 A;  4BE2 A;  5C0M A;  2QQS A;  3CEY A;  3EAE A;  3ME9 A;  4LD6 A;  3ZEH A;  3O8V A;  2MWO A;  3C4S A;  3OS2 A;  3MET A;  2NLU A;  2RJC A;  2EKO A;  3NTH A;  2F5K A;  2B8A A;  2EQU A;  2XK0 A;  2HQE A;  3ASK A;  3QKJ A;  4QQ6 A;  5FRO A;  2WAC A;  4A4F A;  3OYN A;  1RI0 A;  2YRV A;  4FU6 A;  3OMG A;  3LX7 A;  3FEO A;  2L8D A;  1OZ2 A;  3H6Z A;  5M9O A;  3MEA A;  3P8H A;  2GF7 A;  2RI5 A;  3OS1 A;  2O4X A;  5KH6 A;  1WJR A;  4IUQ A;  3KUF A;  4C5G A;  4BAC A;  2JZ2 A;  4FL6 A;  2PQW A;  4IUU A;  5C6S A;  3MEW A;  2BKD N;  2GFA A;  2RHZ A;  4A4E A;  4II1 A;  3OYI A;  2MWP A;  2RJE A;  2RJF A;  2RI3 A;  3UWN A;  4E7J A;  3FLG A;  3Q1J A;  3QBY A;  3OYK A;  4ZTF A;  2LRQ A;  3MEV A;  5D6X A;  3PMI A;  3MO8 A;  4Q5W A;  4HCZ A;  4L59 A;  3OYL A;  3OYJ A;  2E6N A;  4QVZ A;  5KE2 A;  4CRI A;  2IG0 A;  3LH0 A;  2LCC A;  4PLI A;  2FHD A;  2HQX A;  4N4H A;  3L2V A;  3L2R A;  2D9T A;  2LVM A;  3L2U A;  3OYA A;  2RJD A;  2RO0 A;  3OQ5 A;  3OYF A;  3GOX A;  2K3Y A;  3QII A;  1KHC A;  4C5E A;  4QW2 A;  2R5M A;  4BE1 A;  3OA6 A;  2R58 A;  1G5V A;  2L3R A;  4PLL A;  3M9Q A;  4N4G A;  4C5H A;  2QQR A;  4EDU A;  4X34 A;  4E7L A;  3S6W A;  2DIQ A;  1OYX A;  4QQG A; 
#chains in the Genus database with same CATH topology
 1FXX A;  5KYU A;  3GIB A;  4AG1 C;  4PJO A;  4RTV A;  5D6W A;  5GAN 5;  1GBR A;  3CME A;  5HKC A;  1KK7 A;  4LDU A;  2RM4 A;  4MDW A;  2K9G A;  4E2F B;  1ZUY A;  1YCS B;  1LCK A;  1NJI C;  2CKK A;  7AT1 B;  3V8J A;  4FW2 A;  1WHM A;  2JMA A;  5GAM j;  5CKB A;  5GAN 2;  2J05 A;  1LNX A;  4JUV A;  5GAN f;  2OTL Q;  1AZE A;  4PJL A;  5GAM f;  4IUP A;  3RNJ A;  3CC2 T;  2CUD A;  5A0L A;  1PKT A;  3CCL Q;  2DRK A;  1Y71 A;  4M7A G;  1QWE A;  1JJ2 A;  1SPK A;  5CIU A;  3LLR A;  3OY9 A;  1YIT A;  1KJW A;  5LJ3 h;  1U1T A;  1UTI A;  1MND A;  4M78 D;  4XU1 A;  3JCM P;  3OSS C;  2KRO A;  4FYW B;  2JOY A;  2DEQ A;  4CC4 B;  2BUD A;  3UT1 A;  1U3O A;  1OUL A;  1PRM C;  2FPF A;  3CEY A;  3ME9 A;  4AT1 B;  4Y91 A;  1M5Q 1;  2EQU A;  4KGX B;  4JJB A;  5FRO A;  1U5S A;  1VQ8 T;  1I4K 1;  1ARK A;  4FCY A;  3FEO A;  5L8R E;  1X6G A;  1FYN A;  4KT0 E;  5M9O A;  3P8H A;  1JU5 C;  5GAO p;  1G3S A;  1MV0 B;  3X26 B;  3PVL A;  1YJW Q;  2AKL A;  1SSH A;  1G3Y A;  1K8A U;  1NEG A;  1Q7Y R;  5DLO A;  3OYI A;  2MWP A;  2FPD A;  2EGC A;  3M5A A;  1WXU A;  5HK3 A;  2GQV A;  2E41 A;  1BIB A;  1K8A C;  4QVZ A;  5KE2 A;  2IG0 A;  1BI1 A;  1BI3 A;  1IHW A;  3RKY A;  1KHC A;  2K57 A;  3HKS A;  3UF4 A;  4M78 C;  1I0C A;  3G4S Q;  1YHQ T;  4KH1 B;  4NL3 A;  4M75 F;  4C92 D;  3BDU A;  4NOY A;  5GAO m;  3JB9 I;  4BUG A;  4BD3 A;  1WJS A;  4E7H A;  4M7D F;  1ZSZ A;  2P4R A;  1M2V B;  1KHI A;  1OI1 A;  4O5V A;  2X4X A;  3SD4 A;  2YUP A;  2K2M A;  1VUB A;  3BDL A;  1KQ2 A;  4J83 A;  4C0D C;  3LW5 E;  4HCC A;  1B07 A;  2KRS A;  2IIM A;  2RQU A;  5IH2 A;  5LJ3 f;  3CCE T;  1MHN A;  2G3R A;  1VQM A;  3MP1 A;  2C06 A;  2R57 A;  3OW2 S;  2CT3 A;  2OTJ A;  4PL6 A;  3OYD A;  4CC2 A;  4ZGJ B;  2QQB A;  1QVP A;  1N8R U;  4BE2 A;  4M7A A;  2QQS A;  5GMK m;  4IIO A;  3O8V A;  3VS2 A;  2E64 A;  1NLP C;  2LQW A;  1ZA2 B;  1N8R C;  2J7I A;  1GXI E;  2FZK B;  2L3S A;  5GMK h;  2JM8 A;  3VS6 A;  3CCM Q;  2LP5 A;  1OPK A;  1M30 A;  4DQ2 A;  4C8Q F;  1X75 C;  2K5L A;  3CCS T;  2ZPE B;  2J6O A;  2JM9 A;  1UHC A;  5GAN 8;  4ME7 A;  3L2R A;  2CUB A;  2AZV A;  1R0C B;  4LDX A;  1MMN A;  4C5E A;  4A53 A;  4C5H A;  4RKU E;  1QKX A;  3J81 E;  2DIQ A;  4JPB W;  2VYT A;  2OTL T;  3FB9 A;  2VB6 A;  4C8Q D;  2M51 A;  4B6M A;  1FWZ A;  3CCQ A;  1VQP Q;  1OZ3 A;  4LUE A;  5CKH A;  2E3H A;  4OMP A;  3RMS A;  3CQT A;  3X24 B;  2DXU A;  2YDL A;  1XNI A;  2DD5 A;  2E4H A;  1AWO A;  4IKF A;  1K0S A;  1TOV A;  2B86 A;  4M77 G;  5GMK i;  1WXB A;  4FM4 B;  1GRI A;  1M1G A;  2YRC A;  2BZX A;  2DYI A;  4OMF B;  1K0X A;  5ECA A;  4OVA A;  2O31 A;  4BDZ A;  2DAQ A;  1K73 U;  3GNG A;  1JQQ A;  2QQA A;  1YI2 Q;  1WZO A;  4BE0 A;  1BI0 A;  4FT4 A;  4Z02 A;  2C0O A;  3QDF A;  4F16 A;  1TUC A;  1AVZ C;  2RNA A;  4X9D A;  1K73 C;  1AZG B;  3TSZ A;  2DVJ A;  4FU6 A;  3SB2 A;  1OZ2 A;  2PUK B;  3HRS A;  2MOX A;  4DBR A;  4LDY A;  3KUF A;  1RLQ C;  4LNP A;  2KSS A;  5C6S A;  2PQW A;  4LDW A;  4II1 A;  1Q95 G;  3G4S T;  2W10 A;  2DPP B;  4FIB A;  3URG A;  2A0F B;  2DNU A;  4HCZ A;  2X4J A;  4CRI A;  2FHD A;  2I0N A;  2HD0 A;  2LJ0 A;  2RJD A;  2JS0 A;  2RO0 A;  2QG9 B;  3GOX A;  1S72 Q;  4QW2 A;  2QEX A;  1YCY A;  1YJ9 A;  2CS7 A;  2CZ0 B;  2DLP A;  2COY A;  2QAS A;  4ZNX A;  2JTF A;  2KYM A;  1VQ9 A;  1BYM A;  1WHJ A;  3CPF A;  4YTL A;  4ELZ C;  2EYY A;  4OGE A;  2DE0 X;  2A37 A;  3P8B B;  3UA6 A;  1TWB A;  2JTM A;  1VQ7 Q;  4J7I A;  1UG1 A;  4OMM A;  5FRN A;  2V8K A;  2DTI A;  1YJN Q;  4RG2 A;  1WJQ A;  2EJG A;  1W2B S;  1WGS A;  1TXQ A;  4EIK A;  5CAI A;  2D8H A;  1VA7 A;  1IRX A;  4X1V A;  1VQN A;  2E10 A;  3G1J A;  3M59 A;  1GCQ A;  4Y28 E;  5D6Y A;  2XIC A;  1M9S A;  4M78 E;  4NL2 A;  1OU9 A;  3CCM T;  3RIR A;  2K6D A;  1AWW A;  2KK4 A;  2DER A;  5GAN e;  3V8L A;  4EMH A;  4M77 A;  1SKU B;  4N0A A;  3VS3 A;  5GAM e;  3TCJ A;  3QSU A;  3ULR B;  4LD6 A;  3GPL A;  3QWY A;  1KQS A;  4E7S A;  3H41 A;  1BB9 A;  3JCM J;  2OTJ Q;  1HSQ A;  2ZAE A;  1V1C A;  4FSX A;  1KSW A;  3I55 A;  1Q86 U;  3CXC S;  3WXM B;  1TUD A;  1N5Z A;  1IGU A;  2CP0 A;  5CKE A;  1AT1 B;  2VXE A;  2QTX A;  3PVQ A;  5FWB A;  2QXF A;  1VQ5 A;  1VQP T;  2E70 A;  2HQX A;  1JRI A;  4M7A C;  4OMN A;  2FG0 A;  3GLX A;  4JJC A;  3M0Q A;  2KE9 A;  4MZM A;  2F2V A;  2KAF A;  4M7D G;  1D0X A;  3TSW A;  1T3S A;  1X6O A;  2EPD A;  1QCO A;  4HA8 A;  1LPL A;  2JW4 A;  4C0D B;  2MPX C;  2HBP A;  1D0Y A;  1UJ0 A;  4R56 A;  3G71 Q;  4WF2 A;  4QQG A;  2SRC A;  4C92 E;  2ZZD A;  2VGN A;  4J6Y A;  2DX1 A;  4JJN K;  1WFW A;  1VQ6 Q;  3A8L B;  2BIV A;  4JRK A;  4F7U G;  2EQM A;  1MMA A;  3A8M B;  3CCR Q;  4WTO B;  3EGU A;  2MF2 A;  4HKE A;  1M1F A;  2L0A A;  2LCS A;  1TUG B;  3EFS A;  2EWN A;  3OYY A;  4F14 A;  2JN0 A;  2IPO B;  2COW A;  1RLP C;  5CCA A;  1YI2 T;  2A36 A;  3G6E Q;  3AT1 B;  1DJ7 B;  1PM3 A;  1YN8 A;  1QP2 A;  4RCB A;  2DL3 A;  1X69 A;  4J9F A;  2LMJ A;  1B34 A;  1R0B G;  2VWF A;  5L23 A;  2VVK A;  4IUR A;  1B3Q A;  5IT9 E;  2YRD A;  3NTK A;  3F70 A;  2P84 A;  5CO7 A;  3PT9 A;  1NYF A;  5FWC A;  1SRM A;  5DY9 A;  2RQR A;  1VQ4 A;  2PNI A;  2QI2 A;  2M9U A;  3HRT A;  2PVG B;  1PCX A;  4C8Q G;  2EQK A;  1GCP A;  1Y57 A;  3JCM h;  2WSC E;  2MWO A;  1HK9 A;  3THK A;  2DZ9 A;  1M2O A;  1ZUK A;  4DBQ A;  3JSC A;  2K5F A;  1RL2 A;  3LX7 A;  2JVV A;  3QYH B;  3FRN A;  2V8I A;  1S72 T;  4XU2 A;  1WJR A;  5GAN d;  4M4Z A;  3CC7 A;  5GAM d;  2JZ2 A;  3CCJ Q;  3CCU T;  2G6F X;  2DO3 A;  2RJF A;  2RI3 A;  3CPW S;  2CP3 A;  4PJM A;  2D1X A;  3RR6 A;  3PTA A;  2XD0 A;  1T3L A;  4JS4 A;  4M75 B;  1N9S A;  3I35 A;  1T0H A;  3OSV A;  1KD1 R;  1VQ7 T;  2F1L A;  2DBM A;  2DL5 A;  2X3X D;  4BE1 A;  1M90 R;  1YJN T;  1N6A A;  1YIJ A;  2BZ8 A;  3FJ5 A;  3ER0 A;  3E9G A;  4BY6 C;  1QVG A;  1H8K A;  2D0N A;  2DVE A;  4M75 A;  2RN8 A;  1VQO Q;  3CBO A;  2YUN A;  3SWN B;  2K79 A;  4IIM A;  1I8F A;  1WYX A;  3ZL7 C;  4IUV A;  1K9M U;  2CZ1 B;  3BE3 A;  4PJO B;  4M7D A;  1UHF A;  2XKO C;  2XDP A;  1RAB B;  3BY7 A;  1W2B P;  2RK2 A;  1E7O A;  2FZC B;  2EIF A;  4KUL A;  3RDV A;  3CC4 A;  1QCF A;  1UE9 A;  5I2S A;  1K9M C;  2RHX A;  2DA9 A;  3SWN A;  3S3O A;  4GLK A;  3OYE A;  1QVF S;  1NJI U;  4JRP A;  1UJY A;  1D3B A;  3SDZ A;  4A4H A;  2VV5 A;  1OQK A;  4M78 F;  2ENM A;  3JCM f;  3VS5 A;  4AFS C;  1H64 1;  5GAN j;  3CMA T;  2HEQ A;  3JB9 F;  4EMK B;  2X51 A;  1VQL A;  3H8Z A;  2FYK A;  4CC7 A;  3H0F A;  4OF1 A;  1VQK A;  3OS2 A;  1R77 A;  1NBE B;  4XTY A;  2B8A A;  2XK0 A;  1K8A R;  3CXC P;  2AT1 B;  1M3C A;  5KYY A;  2GGR A;  2EYQ A;  4R0K A;  2EKH A;  4J7F A;  4ZGE B;  1XQH A;  3I56 A;  4EMK A;  4O6J A;  3RUX A;  4C5G A;  4C8Q A;  1GCQ C;  2BKD N;  4XAX B;  1K76 A;  5LJ3 d;  4A4E A;  5GAN g;  2EYW A;  3G71 T;  5GAM g;  2HKN A;  5GJW B;  2OX7 A;  3JB9 D;  2C0T A;  2VKN A;  1VQ6 T;  5I11 A;  4N0A C;  1WDX A;  3T9N A;  3OYL A;  1D0Z A;  2O2O A;  2KXD A;  4PLI A;  3CCR T;  5GAO l;  2D6F A;  2D9T A;  2R5M A;  1PRL C;  2O88 A;  1QKW A;  2AIR B;  1W1F A;  2FVU A;  1RI9 A;  3G6E T;  2O9V A;  3M0S A;  4C92 F;  1VQ5 Q;  2YHT A;  1QW1 A;  1ABQ A;  3X28 B;  2X4W A;  4OP0 A;  4LE9 A;  2XDD A;  3KXT A;  1NEB A;  3H9N A;  3PMT A;  4ZTJ A;  2DYB A;  1WHL A;  4HCB A;  3CCV Q;  4E7K A;  4RUG A;  2LT4 A;  3VYH B;  2D8J A;  1ZSZ B;  4RTU A;  3QZ9 B;  3G7Z A;  2H8H A;  3KBG A;  5EG2 A;  2ECZ A;  3HFO A;  3QZ5 B;  4TVR A;  5GMK l;  2BZY A;  5EC7 A;  3NPF A;  1ZBJ A;  3PNW C;  1N8R R;  3JRZ A;  2ZPF B;  1Q82 U;  3HSB A;  3CCJ T;  3L2W A;  4J9E A;  1WPY A;  2JT4 A;  5LJ3 j;  1BCM A;  2KR3 A;  1JEG A;  3EAE A;  1Q82 C;  4F7U F;  3MET A;  3SHW A;  1X2Q A;  4RMO A;  4M7A B;  4Y92 A;  1M8M A;  2CP5 A;  4E7Z A;  3CPW P;  2AK5 A;  2KGT A;  3QHS A;  2QA4 A;  2LX9 A;  1D09 B;  1RAA B;  1X6B A;  2GFA A;  2RH2 A;  3LWI A;  2VUB A;  1K4U S;  2HBW A;  4E47 A;  3EH1 A;  1VQO T;  5LJ3 g;  1WIE A;  3QJY A;  1PD0 A;  1WA7 A;  5HY6 A;  3HPW A;  2L3P A;  3LH5 A;  3CC7 Q;  3C94 A;  4CI0 C;  2K3Y A;  3EHR A;  4FYV B;  2L3R A;  3RER A;  2JTE A;  2BE7 D;  3QO3 A;  2HL3 A;  1FX7 A;  2DJZ A;  2H3J A;  1W4S A;  3TU4 K;  2C0I A;  1RAD B;  3BFM A;  2F2W A;  3CC2 A;  1UGS B;  1UGP B;  2HL5 C;  3E9F A;  4AFZ C;  1QVF P;  1M1K U;  1UEC A;  4MML A;  2QYZ A;  1VYV A;  1RUW A;  3MP8 A;  1W6X A;  2LX7 A;  2WSE E;  1BKB A;  1JJ2 S;  1MMG A;  2DIG A;  1M1K C;  1SEM A;  5DM7 R;  1LJO A;  1K73 R;  1GL5 A;  4XTZ A;  3CCL T;  1ZSG A;  1Q81 U;  4HVV A;  4M75 C;  6AT1 B;  5IXF A;  1VQ8 A;  1J3T A;  3JCM c;  2JUF A;  3CD6 Q;  3L42 A;  4M7D C;  2CDT A;  1OPL A;  2DL8 A;  2KVQ G;  1NZ9 A;  2O4X B;  4IUT A;  1Q81 C;  3U23 A;  2EVR A;  2M1H A;  3LGL A;  1VYU A;  3CME Q;  2M0O A;  5DLQ E;  1MGQ A;  3C4S A;  2J6K A;  2ZPG B;  2NLU A;  3SWN C;  4E6R A;  3JCM X;  4R55 A;  1HD3 A;  4PJO C;  2K3B A;  2O4X A;  4FYY B;  1BU1 A;  1YJW T;  1M3B A;  1ZQ1 A;  4BY6 B;  5GMK j;  1ZBX A;  4JLG A;  4E7J A;  2GQI A;  2YUO A;  2E5K A;  4JDS A;  3OYK A;  2LRQ A;  4Q5W A;  1NM7 A;  1YHQ A;  2HSP A;  2CP6 A;  1QWF A;  1YIT Q;  5GAN 7;  1D1B A;  2YWW A;  2W0Z A;  3FIF A;  1TS9 A;  1FMV A;  3CCV T;  3JCM W;  1BK2 A;  3NMZ C;  1NPP A;  4A63 B;  3RMQ A;  2PTK A;  1CSK A;  2HDA A;  4KBM B;  2RA2 A;  1HXD A;  2MAM A;  4RTT A;  4EMK C;  2R5A A;  4OB2 B;  3M58 A;  1KC8 U;  1X43 A;  5KYW A;  3EGX A;  2AHJ B;  3BW1 A;  4QT7 A;  1PSE A;  4B9X A;  3S3M A;  3CCE A;  4RCC A;  3OB9 A;  1TSF A;  1FMK A;  2DXC A;  1KC8 C;  1AHJ B;  4J9H A;  4M78 G;  3VYG A;  1QCN A;  2PVO B;  3E2U A;  1MMD A;  1HJD A;  3DB4 A;  1PSF A;  1M27 C;  2MK5 A;  4D6W A;  3JB9 G;  3QWX X;  2LDM A;  2KI7 A;  3QYG B;  3LGF A;  3L2Q A;  1V76 A;  1WQW A;  3M4Y A;  2KRN A;  4C0F A;  3OYG A;  5KCO A;  5LJ5 h;  4OML A;  3TEE A;  1IHV A;  2A7Y A;  4Z88 A;  4K11 A;  2E5Q A;  5C0M A;  3OW2 P;  4M77 B;  5AT1 B;  3CCS A;  1UDL A;  1WQ7 A;  3CPW A;  1Q86 R;  2RMO A;  4M7A D;  2H3E B;  2RPN A;  1U8R A;  2RI5 A;  1ZUU A;  2CZ6 B;  3M55 A;  4IUQ A;  2SEM A;  3DKM A;  5A0D A;  1H3H A;  1ZSZ C;  3NFC A;  3FLG A;  1KG1 A;  1Y96 A;  3Q1J A;  2ESW A;  1TH7 A;  1IXD A;  1VQM Q;  4C92 G;  2OTL A;  3RBB B;  3QDR B;  2KYB A;  1TU0 B;  2DXB A;  3DLL A;  2NUP A;  2O01 E;  3J80 E;  4WCI A;  1I5O B;  3I9Q A;  1QQJ A;  2JJ9 A;  4E7I A;  2DTH A;  3X20 B;  1YP5 A;  2ED0 A;  5CK9 A;  1QVF A;  2X4Y A;  4RTZ A;  4J5Y A;  3GF5 A;  2J06 A;  3LWH A;  2EFI A;  2DJQ A;  1VYT A;  4AFU C;  4JZ4 A;  1JJ2 P;  3CD6 T;  2K7A A;  2IVW A;  2YLB A;  1D1C A;  3A1P A;  2KMT A;  3VS0 A;  2CSQ A;  1QLY A;  5GAO r;  3OYB A;  5GAN 6;  3CME T;  1U1S A;  2PZ1 A;  3A8H B;  2EYX A;  3CC2 Q;  4DBH A;  5LJ5 f;  4ESR A;  4OMQ A;  2GTJ A;  4KGV B;  4DEY A;  2HZY A;  1SF9 A;  1D1A A;  5FRM A;  4M78 A;  4P5N A;  2A28 A;  3I5S A;  4A4G A;  1B34 B;  4J9G A;  3EFR A;  4HCK A;  2V1R A;  1W70 A;  3GNF B;  2EQJ A;  1VOM A;  3FC3 A;  3VS7 A;  4QKU A;  5KYX A;  2Y90 A;  5IAY A;  5KE3 A;  2L5Q A;  3CCQ Q;  4D8K A;  3QUI A;  3G4S A;  3M4G A;  2COZ A;  2RD1 A;  4RG8 A;  3OYN A;  1YIT T;  3M0R A;  5FU7 B;  3H6Z A;  3MEA A;  1SHF A;  1UUE A;  4BAC A;  3UAT A;  4DOV A;  1OOT A;  4F17 A;  4GLM A;  4Z89 A;  1I1J A;  5LJ3 e;  2HMA A;  4JRI A;  2E12 A;  4OMO A;  4M75 E;  4D8D A;  2RB6 A;  3JCM d;  3JCM Q;  2JMC A;  3EFO B;  2ZPB B;  4QVD A;  3H0I A;  2VC8 A;  2VGM A;  3OA6 A;  3JAM E;  5HK0 A;  2MMP A;  4N4G A;  4BB7 A;  2I2L A;  3MKD A;  1K9M R;  4HXJ A;  2KT8 A;  4C92 A;  4E7L A;  1E6G A;  4JRQ A;  3E1S A;  3PFS A;  1ZLM A;  2JNG A;  1C0M A;  4L6V 5;  3UPU A;  1YBY A;  2EJ9 A;  2F69 A;  4XTW A;  3EFO A;  2Z0W A;  4PJO E;  3DLM A;  1UFF A;  1VIE A;  1Y07 A;  5GAM h;  2LJ3 A;  2V26 A;  1YNZ A;  1CKB A;  5IN1 A;  4F04 B;  4M7D B;  5AYF A;  2DMO A;  1NJI R;  2E1H A;  3CCM A;  1G8X A;  3CBM A;  5IHN A;  2KDS A;  3GP8 A;  3PIO A;  2EBP A;  2CP7 A;  1AWJ A;  2HSE B;  4JZ3 A;  3EG9 B;  2QEX Q;  1D3B B;  1YJ9 Q;  3ZBD A;  2E65 A;  2M0Y A;  4BDY A;  1GBQ A;  3OW2 A;  4C5I A;  1KQS S;  1VQ9 Q;  2F2X A;  4ATO A;  1PWT A;  2CYZ B;  4F7U A;  1HYO A;  1M3A A;  3UDC A;  5IHK A;  4J9C A;  2HKQ B;  3EG9 A;  5FW9 A;  4A4F A;  2XDB A;  2KQW A;  1JBM A;  4J9B A;  2CSI A;  1UGQ B;  2EJF A;  1VQP A;  2OTJ T;  5CQY A;  1WHG A;  1UB4 A;  2LQN A;  5KYY B;  5FLX E;  3JB9 J;  1M8V A;  2X9H A;  1Z9Z A;  4FL6 A;  1EX4 A;  1WHK A;  3VU3 C;  3M0T A;  2QAZ A;  4PNO A;  3CCS Q;  1KD1 U;  1BCO A;  4C8Q B;  1M90 U;  2NUT A;  1S1N A;  2K4Y A;  1VQN Q;  3GBQ A;  3QBY A;  2A08 A;  3OYJ A;  2E6N A;  1IO6 A;  4HT9 A;  1SRL A;  2LCC A;  1X27 A;  1KD1 C;  1FMW A;  1KQ1 A;  2LJ1 A;  2NYS A;  1SHG A;  4KUD K;  2FO0 A;  3JCM g;  1M90 C;  3OQ5 A;  1WX6 A;  2VXF A;  4XTV A;  4AG2 C;  1C1A A;  3SFM A;  1PG5 B;  5CR2 A;  1MUZ A;  5GMK e;  1O9S A;  1XTD A;  3INZ A;  4J9D A;  1YI2 A;  1G2B A;  1Y0M A;  4C0G A;  1I5L A;  2DFU A;  4XK8 E;  4M77 C;  4PK4 A;  2K2V A;  2RI2 A;  1PNJ A;  2YT6 A;  3H0H A;  4ZGD B;  2QGG A;  3I55 Q;  2YSQ A;  4CC3 A;  4ZN3 A;  4FSS A;  2CGH A;  3OS5 A;  1LVK A;  3M0P A;  4DOW A;  3MPU B;  5J39 A;  3OBY A;  4A54 A;  3JCM V;  3VV0 A;  2HNI A;  4ORZ A;  3CCQ T;  1JXM A;  3NTI A;  3O5Z A;  4RTW A;  1AD5 A;  2F5T X;  4OB0 B;  1Q82 R;  1ZX6 A;  3MCA B;  3MEU A;  4PJJ A;  3VJP A;  1H92 A;  2GNC A;  2M02 A;  3EH2 A;  2PUO B;  2DEU A;  1S72 A;  2OAU A;  3LYI A;  4DBF A;  3EG1 A;  3OYH A;  2DF6 A;  4XTX A;  1KIK A;  3CCU A;  1WI7 A;  2P0Q A;  2RF0 A;  3M56 A;  4M7A E;  1AWX A;  5A0G A;  3EGD B;  2DKG A;  3MHX A;  4PKC C;  2DL4 A;  1IZ6 A;  1BBZ A;  3EHQ A;  1VQ7 A;  4EPC A;  4KRT A;  2BTT A;  1ZHI A;  2MI6 A;  1YJN A;  2DIL A;  5FU6 C;  3EGD A;  4ELY C;  3MO8 A;  1Q7Y U;  1K9A A;  4BI3 A;  4PJN A;  1JO8 A;  3EG3 A;  1VQ4 Q;  2HQH A;  3KFV A;  4LXC A;  2L3Q A;  4JLI A;  1CKA A;  4PLL A;  4PFP A;  1QVG S;  4X34 A;  5GJV B;  3SEM A;  2A3L A;  2QGF B;  1Q7Y C;  5HCK A;  4HT8 A;  2Y4Y A;  2NUZ A;  2PVD B;  1ACM B;  2AZS A;  2K3X A;  5I2M A;  4PJO F;  1M1K R;  3VUZ A;  1M2V A;  3VKI A;  4M75 D;  1NE8 A;  2QEX T;  4VUB A;  1YJ9 T;  5FU7 C;  4J6W A;  4HVU A;  2PU9 B;  4M7D D;  2EQI A;  3V8K A;  1Q81 R;  1VQ9 T;  3VRY A;  3QXE B;  3CMA A;  1NLO C;  4OB3 B;  3REB B;  1TTH B;  2Y4X A;  2CT4 A;  2AKK A;  8ATC B;  2GCX A;  4C92 C;  3M57 A;  1W2B A;  1KQS P;  2JS2 A;  3OYC A;  2DK3 A;  3OS0 A;  4PJO D;  1OU8 A;  4QQD A;  4XQ3 A;  1YIJ Q;  4X9C A;  2EAY A;  4BI8 B;  1B7T A;  1JB0 E;  1QP3 A;  2RK1 A;  3RES A;  4RTY A;  5CKD A;  1X2K A;  1BI2 A;  1GFD A;  5LJ5 e;  4KH0 B;  3TRE A;  1VQN T;  1BIA A;  3G71 A;  1U06 A;  2DRM A;  2DM1 A;  1MV3 A;  3HL8 A;  3ASK A;  1VQ6 A;  2FL7 A;  3D7S B;  3CC4 Q;  1ZA1 B;  3CCR A;  3OS1 A;  4LUD A;  3C12 A;  4XTU A;  2LQK A;  3PE0 A;  2EGE A;  2K5I A;  3HHT B;  4IUU A;  2LNV A;  2HAX A;  2ZCF B;  3EG0 A;  3G6E A;  1NG2 A;  1WHH A;  1YFN A;  3CXC A;  2CZ7 B;  8AT1 B;  5D6X A;  4RTX A;  3NGP A;  5D7U A;  4FW1 A;  3L2Z A;  2FRW A;  2X3W D;  3C95 A;  4N4H A;  4ZN1 A;  2LVM A;  3HTR A;  3I55 T;  3QII A;  2DL7 A;  1NPR A;  3M0U A;  1KC8 R;  2MCN A;  2LQ8 A;  1VQL Q;  2QQR A;  4EDU A;  1N9R A;  1EIF A;  1VQK Q;  1OX8 A;  1VQ5 T;  2FZG B;  2JXB A;  2LTO A;  1IGQ A;  1H3Z A;  2QQ9 A;  3MP6 A;  4PFO A;  5I22 A;  2GBQ A;  3P8D A;  2RHY A;  3EGX B;  5KYW B;  3I56 Q;  1JXO A;  1I81 A;  4Z8A A;  3R6O A;  3VS1 A;  4LN2 A;  1KFZ A;  1YWP A;  2KXC A;  4NS5 A;  4B9W A;  2QDY B;  1SSF A;  2P0K A;  1PD1 A;  4DEX A;  3CCJ A;  2E3I A;  4KGZ B;  2YLC A;  4C8Q C;  3QJ6 A;  3CBP A;  4FYX B;  5IXB A;  1LOJ A;  4OB1 B;  4MZP A;  2CH4 A;  2FB7 A;  4OGC A;  2GFU A;  2HCK A;  3FDR A;  3VS4 A;  2RHI A;  1WXT A;  2OAW A;  1RAC B;  3L1A A;  4M77 E;  3TVT A;  3A8G B;  4JS5 A;  4GBQ A;  4M7A F;  2EKO A;  1VQO A;  3A8O B;  1RAF B;  1OV3 A;  1VQ4 T;  4MZT A;  4J6X A;  2QTV A;  3HRU A;  3CCU Q;  1RAE B;  1A0N B;  3PIP A;  1WLP B;  1AEY A;  2CH4 W;  3E19 A;  5LJ5 d;  3M54 A;  1UGV A;  1F1B B;  3NHN A;  3R6N A;  4ZTF A;  4MDX A;  3AHU A;  1YWO A;  3V7C A;  1QVG P;  4L59 A;  1Y96 B;  3LH0 A;  2V8J A;  3JCM e;  3L2U A;  3OYA A;  3CC7 T;  2KT1 A;  1XJW B;  1AOJ A;  2R58 A;  2MIO A;  1V29 B;  3S6W A;  2NUP B;  2XMF A;  3QPH A;  4N4I A;  1NYG A;  2EYZ A;  2L2P A;  3A5Z B;  2XHC A;  2V1Q A;  4XU0 A;  3OMC A;  2FPE A;  4KUI A;  4C0Z A;  1Z9Q A;  4LDV A;  3S3N A;  2XU8 A;  5IHI A;  2QA4 Q;  1YIJ T;  3CCL A;  3V7R A;  3HFN A;  1RAI B;  2LCL A;  4JJD A;  3WVD B;  4V2S A;  5J26 A;  2EGA A;  4FT2 A;  5CVI A;  3N5B B;  4UC4 A;  1Y7X A;  2RQV A;  1PKS A;  1RAH B;  1OEB A;  5LL6 S;  3ZFJ A;  1G3W A;  2ZGW A;  4BI4 A;  3PGG A;  1O75 A;  3CC4 T;  1G83 A;  1PC0 A;  1MNE A;  4DA4 A;  4M78 B;  2DXT A;  1T0J A;  3CMA Q;  3VRZ A;  2X35 A;  1YJW A;  3HP9 A;  5FU6 B;  5LJ5 j;  2WSF E;  1C6V X;  3A98 A;  5KYX B;  1Q86 C;  2RJC A;  4M75 G;  3JB9 H;  1GFC A;  2ATC B;  2F5K A;  3QKJ A;  4QQ6 A;  2WAC A;  3IQL A;  2YRV A;  5CQX A;  1UGR B;  2RQT A;  2RQW A;  2L8D A;  1M4Z A;  1EFN A;  2GF7 A;  3I5R A;  1IRE B;  5KH6 A;  2ABL A;  1VQL T;  4EMG A;  3MEW A;  2ED1 A;  1G3T A;  3CCV A;  2RHZ A;  2VAS A;  2RJE A;  3UWN A;  1VQK T;  3QG1 A;  5LJ5 g;  3J7A F;  3MEV A;  3PMI A;  1QMC A;  5GAO q;  1VQ8 Q;  4PJO G;  1UEB A;  3I56 T;  3L2V A;  2KBT A;  4LD9 K;  4J9I A;  1G5V A;  2YXY A;  2XID A;  3M9Q A;  1IB8 A;  5GAN 3;  2QK0 A;  1OYX A;  2LNH B;  3JCM b;  1R8O B;  2DBK A;  4C92 B;  2L89 A;  4HVW A;  1E6H A;  2DET A;  2GTO A;  3OYM A;  2ZPH B;  2XG8 D;  1PHT A;  2M16 A;  1K1Z A;  1WNL A;  1EZZ B;  1TG0 A;  2DD4 A;  3UA7 A;  3V7S A;  5GAO n;  4M7D E;  2LT1 A;  2LC4 A;  2YUQ A;  3VUB A;  3MJX A;  2DZC A;  2O9S A;  1N27 A;  2KY9 A;  2OI3 A;  4A4K A;  3OBW A;  4GY5 A;  2FEI A;  2KRM A;  1X01 A;  1YHQ Q;  4F7U E;  1RAG B;  2E6Z A;  3FJP A;  2ZPI B;  3DB3 A;  5GAN h;  2RHU A;  2CP2 A;  4ANJ A;  3TQ7 P;  2CRE A;  3JV3 A;  4AMC A;  3RKW A;  5J3B A;  9ATC B;  2FRY A;  5KCH A;  4QVC A;  2NWM A;  2D0Q B;  5I21 A;  1I07 A;  4M77 F;  4PFZ A;  1OX9 A;  2ROL A;  2LZ6 B;  3ZEH A;  3CCE Q;  1VIF A;  4J8O A;  3NTH A;  2HQE A;  2KNB B;  1ABO A;  4F7U B;  1SG5 A;  1RI0 A;  5CKF A;  3OMG A;  2DTO A;  2XI9 A;  4XU3 A;  4AFQ C;  3X25 B;  3M53 A;  2MYS A;  2KEA A;  3EG2 A;  4C8Q E;  4MMK A;  2J6F A;  2P0P A;  1VQM T;  4M77 D;  5KYU B;  4L5G A;  2P4T A;  2NUT B;  5KYN A;  5A2Q E;  3WVE B;  1P92 A;  3RKX A;  5GAN 4;  3OYF A;  2QA4 T;  2EW3 A;  3C0C A;  2BE9 B;  1XOV A;  3REA B;  2ROT A;  2QDL A;  3CD6 A;  2OJ2 A; 
#chains in the Genus database with same CATH homology
 1HXD A;  1FXX A;  2MAM A;  2Y4Y A;  4EMK C;  4C92 E;  2PVD B;  2R5A A;  2VGN A;  2ZZD A;  3M58 A;  4J6Y A;  4OB2 B;  4JJN K;  1KC8 U;  3GIB A;  4PJO A;  5D6W A;  5GAN 5;  2AHJ B;  2K3X A;  3A8L B;  3BW1 A;  5I2M A;  3CME A;  4PJO F;  1PSE A;  5HKC A;  3VUZ A;  4B9X A;  2BIV A;  4JRK A;  3S3M A;  4LDU A;  4F7U G;  2EQM A;  3VKI A;  3A8M B;  4M75 D;  4RCC A;  3CCE A;  2RM4 A;  2MF2 A;  4HKE A;  4MDW A;  1NE8 A;  3OB9 A;  2QEX T;  1M1F A;  4VUB A;  2DXC A;  5FU7 C;  3EFS A;  4J6W A;  2EWN A;  1YJ9 T;  1AHJ B;  1KC8 C;  1NJI C;  2CKK A;  2PU9 B;  3OYY A;  4M78 G;  3V8J A;  3VYG A;  4M7D D;  2JN0 A;  2PVO B;  5GAM j;  5GAN 2;  5CKB A;  5CCA A;  1YI2 T;  3V8K A;  3DB4 A;  1LNX A;  1PSF A;  4JUV A;  5GAN f;  1VQ9 T;  4D6W A;  3QXE B;  3JB9 G;  3CMA A;  1DJ7 B;  4OB3 B;  5GAM f;  2LDM A;  4IUP A;  3QYG B;  2Y4X A;  1QP2 A;  5KCH A;  4RCB A;  3CC2 T;  2GCX A;  1B34 A;  4C92 C;  3M57 A;  5A0L A;  1W2B A;  4IUR A;  1Y71 A;  4M7A G;  3LGF A;  5IT9 E;  3L2Q A;  1WQW A;  1JJ2 A;  3OYC A;  2DK3 A;  3M4Y A;  3NTK A;  3OS0 A;  4PJO D;  4QQD A;  4XQ3 A;  5CIU A;  3LLR A;  3F70 A;  4X9C A;  5CO7 A;  4C0F A;  5KCO A;  3PT9 A;  3OY9 A;  3OYG A;  1YIT A;  2EAY A;  4BI8 B;  5LJ5 h;  5LJ3 h;  1U1T A;  5DY9 A;  1VQ4 A;  1JB0 E;  2QI2 A;  1QP3 A;  2RK1 A;  4M78 D;  4XU1 A;  3OSS C;  3RES A;  2M9U A;  3TEE A;  3JCM P;  5CKD A;  3HRT A;  2PVG B;  2JOY A;  2A7Y A;  1BI2 A;  2DEQ A;  2BUD A;  3UT1 A;  5LJ5 e;  2E5Q A;  2EQK A;  4C8Q G;  3JCM h;  3TRE A;  5C0M A;  3CEY A;  1BIA A;  2WSC E;  3ME9 A;  4M77 B;  3G71 A;  1VQN T;  3CCS A;  1WQ7 A;  2MWO A;  4Y91 A;  1M5Q 1;  3HL8 A;  3CPW A;  2EQU A;  5FRO A;  1HK9 A;  3ASK A;  1VQ8 T;  1VQ6 A;  1I4K 1;  4M7A D;  2DZ9 A;  2FL7 A;  3JSC A;  2K5F A;  1RL2 A;  3LX7 A;  2JVV A;  3FEO A;  3QYH B;  5L8R E;  4KT0 E;  5M9O A;  1U8R A;  3FRN A;  3P8H A;  2V8I A;  2RI5 A;  5GAO p;  3CCR A;  1G3S A;  3OS1 A;  3X26 B;  1S72 T;  4XU2 A;  3M55 A;  2CZ6 B;  1WJR A;  3C12 A;  4IUQ A;  4XTU A;  5GAN d;  3CC7 A;  1G3Y A;  2JZ2 A;  2LQK A;  5GAM d;  1K8A U;  3CCU T;  2K5I A;  3HHT B;  4IUU A;  3DKM A;  5A0D A;  2LNV A;  5DLO A;  2DO3 A;  3OYI A;  2MWP A;  3NFC A;  2ZCF B;  2RJF A;  2HAX A;  2RI3 A;  3FLG A;  1KG1 A;  3CPW S;  1Y96 A;  3M5A A;  3Q1J A;  3CXC A;  3G6E A;  1TH7 A;  3PTA A;  4C92 G;  2CZ7 B;  2OTL A;  2XD0 A;  5HK3 A;  2GQV A;  2E41 A;  5D6X A;  4JS4 A;  1BIB A;  1K8A C;  4M75 B;  3L2Z A;  4QVZ A;  5KE2 A;  1H3Z A;  2IG0 A;  3C95 A;  1N9S A;  3QDR B;  1BI1 A;  4N4H A;  4ZN1 A;  2LVM A;  3OSV A;  1BI3 A;  3I55 T;  1VQ7 T;  3RKY A;  3QII A;  1KHC A;  2DXB A;  4BE1 A;  1NPR A;  2K57 A;  3DLL A;  2O01 E;  3J80 E;  1YJN T;  1N6A A;  1YIJ A;  2LQ8 A;  3HKS A;  2QQR A;  4EDU A;  3ER0 A;  1N9R A;  4M78 C;  1EIF A;  3E9G A;  4BY6 C;  1QVG A;  2DVE A;  4M75 A;  1VQ5 T;  3CBO A;  1YHQ T;  3SWN B;  4NL3 A;  4E7I A;  4M75 F;  4C92 D;  2DTH A;  3BDU A;  2LTO A;  3X20 B;  1I8F A;  4IUV A;  1K9M U;  4NOY A;  2QQ9 A;  3MP6 A;  5GAO m;  2CZ1 B;  5CK9 A;  2X4Y A;  3P8D A;  1QVF A;  4M7D A;  3JB9 I;  2RHY A;  2XKO C;  4BUG A;  2XDP A;  4J5Y A;  4PJO B;  4BD3 A;  1I81 A;  1WJS A;  3BY7 A;  3GF5 A;  3LWH A;  2EFI A;  2RK2 A;  3R6O A;  4E7H A;  4M7D F;  1KHI A;  1OI1 A;  2EIF A;  4O5V A;  4KUL A;  2X4X A;  4NS5 A;  3SD4 A;  4B9W A;  3CC4 A;  3CD6 T;  2IVW A;  2YLB A;  2QDY B;  1SSF A;  5I2S A;  1K9M C;  1VUB A;  3BDL A;  2RHX A;  2KMT A;  1KQ2 A;  2P0K A;  4J83 A;  4C0D C;  3LW5 E;  3SWN A;  3CCJ A;  5GAO r;  3OYB A;  5GAN 6;  4HCC A;  3S3O A;  3CME T;  4GLK A;  1U1S A;  2YLC A;  3A8H B;  3OYE A;  1QVF S;  4C8Q C;  5LJ3 f;  5LJ5 f;  1NJI U;  4JRP A;  3CCE T;  3QJ6 A;  3CBP A;  1MHN A;  1D3B A;  3SDZ A;  2G3R A;  4A4H A;  2VV5 A;  3MP1 A;  1VQM A;  5FRM A;  4M78 A;  4P5N A;  1LOJ A;  4OB1 B;  1B34 B;  4MZP A;  2R57 A;  4A4G A;  2C06 A;  3OW2 S;  4M78 F;  3EFR A;  3JCM f;  2OTJ A;  3GNF B;  4PL6 A;  2FB7 A;  3OYD A;  2EQJ A;  1H64 1;  4OGC A;  5GAN j;  3CMA T;  2GFU A;  4ZGJ B;  3FC3 A;  3FDR A;  3JB9 F;  2QQB A;  4EMK B;  1QVP A;  2RHI A;  2Y90 A;  1N8R U;  1VQL A;  3L1A A;  5IAY A;  4M77 E;  5KE3 A;  3A8G B;  2L5Q A;  3H8Z A;  4JS5 A;  4BE2 A;  4M7A A;  2QQS A;  5GMK m;  2FYK A;  3QUI A;  3O8V A;  4OF1 A;  3G4S A;  1VQK A;  3OS2 A;  4M7A F;  3M4G A;  2EKO A;  4XTY A;  2RD1 A;  4RG8 A;  2B8A A;  2E64 A;  2XK0 A;  3A8O B;  3OYN A;  1VQO A;  2EYQ A;  1YIT T;  5FU7 B;  1N8R C;  3H6Z A;  1GXI E;  4J7F A;  1S72 A;  1VQ4 T;  3MEA A;  4MZT A;  4ZGE B;  5GMK h;  4J6X A;  1XQH A;  3I56 A;  4EMK A;  4O6J A;  3RUX A;  3HRU A;  4C5G A;  4BAC A;  4C8Q A;  3PIP A;  4DOV A;  2BKD N;  4XAX B;  4DQ2 A;  4C8Q F;  3E19 A;  5LJ3 d;  3M54 A;  4A4E A;  5LJ5 d;  1X75 C;  5GAN g;  3G71 T;  2K5L A;  5GAM g;  3CCS T;  2ZPE B;  5LJ3 e;  3JB9 D;  4JRI A;  2E12 A;  4ZTF A;  4MDX A;  4M75 E;  1VQ6 T;  3AHU A;  4N0A C;  3V7C A;  3T9N A;  4L59 A;  2RB6 A;  3JCM d;  3JCM Q;  3OYL A;  1Y96 B;  3LH0 A;  4PLI A;  5GAN 8;  4ME7 A;  3CCR T;  5GAO l;  2D6F A;  2V8J A;  3JCM e;  2D9T A;  2ZPB B;  3L2R A;  3L2U A;  4QVD A;  3OYA A;  3CC7 T;  4LDX A;  4C5E A;  2VC8 A;  2R5M A;  2VGM A;  2R58 A;  4A53 A;  3OA6 A;  3JAM E;  5HK0 A;  2MMP A;  4N4G A;  4C5H A;  4BB7 A;  2I2L A;  2FVU A;  1V29 B;  4RKU E;  4C92 A;  3G6E T;  3S6W A;  3J81 E;  4E7L A;  2DIQ A;  4JRQ A;  3E1S A;  2VYT A;  3PFS A;  3QPH A;  4C92 F;  2OTL T;  2JNG A;  3FB9 A;  4N4I A;  2YHT A;  4L6V 5;  3UPU A;  4C8Q D;  1YBY A;  1QW1 A;  2EJ9 A;  2F69 A;  4XTW A;  1FWZ A;  3CCQ A;  4PJO E;  3A5Z B;  2XHC A;  3DLM A;  1OZ3 A;  3X28 B;  2X4W A;  4XU0 A;  1VIE A;  1Y07 A;  5CKH A;  3OMC A;  4OP0 A;  4KUI A;  5GAM h;  3RMS A;  2XDD A;  3KXT A;  3X24 B;  4C0Z A;  4LDV A;  3S3N A;  2DXU A;  2XU8 A;  3PMT A;  1YIJ T;  3CCL A;  5IN1 A;  3V7R A;  3HFN A;  4ZTJ A;  4M7D B;  4HCB A;  2LCL A;  1XNI A;  5AYF A;  4E7K A;  2DD5 A;  2LT4 A;  2E1H A;  3VYH B;  3WVD B;  3CCM A;  4V2S A;  5J26 A;  3CBM A;  3QZ9 B;  4IKF A;  3G7Z A;  4FT2 A;  2KDS A;  3GP8 A;  5CVI A;  3N5B B;  4UC4 A;  1Y7X A;  3KBG A;  3PIO A;  5EG2 A;  4M77 G;  5GMK i;  4FM4 B;  3HFO A;  3QZ5 B;  5LL6 S;  1M1G A;  4TVR A;  5GMK l;  3ZFJ A;  1G3W A;  2ZGW A;  4BI4 A;  3PGG A;  3PNW C;  1O75 A;  3CC4 T;  1D3B B;  4OMF B;  3JRZ A;  2ZPF B;  4OVA A;  2E65 A;  3ZBD A;  4BDZ A;  4DA4 A;  2DAQ A;  1Q82 U;  4M78 B;  3HSB A;  1K73 U;  3GNG A;  2DXT A;  3CCJ T;  4BDY A;  3L2W A;  3OW2 A;  2QQA A;  2X35 A;  4C5I A;  1YJW A;  1KQS S;  3HP9 A;  4BE0 A;  1WPY A;  1BI0 A;  4FT4 A;  5FU6 B;  2WSF E;  5LJ3 j;  5LJ5 j;  4ATO A;  4Z02 A;  2CYZ B;  4F7U A;  3EAE A;  4X9D A;  3UDC A;  1Q82 C;  4F7U F;  1K73 C;  1Q86 C;  3MET A;  2RJC A;  4M75 G;  3JB9 H;  2F5K A;  4A4F A;  3QKJ A;  4QQ6 A;  4RMO A;  2XDB A;  2KQW A;  4M7A B;  2WAC A;  1JBM A;  2YRV A;  1UGQ B;  2EJF A;  4FU6 A;  5CQX A;  1UGR B;  1VQP A;  3SB2 A;  2L8D A;  1OZ2 A;  2PUK B;  3HRS A;  5CQY A;  2OTJ T;  1M4Z A;  1UB4 A;  2GF7 A;  5FLX E;  3JB9 J;  1IRE B;  5KH6 A;  1M8V A;  4LDY A;  3KUF A;  3QHS A;  2QA4 A;  2KSS A;  2LX9 A;  4FL6 A;  2PQW A;  3VU3 C;  4EMG A;  5C6S A;  3MEW A;  1VQL T;  2GFA A;  1G3T A;  2RH2 A;  4LDW A;  3CCV A;  2RHZ A;  4PNO A;  4II1 A;  1KD1 U;  3LWI A;  2VUB A;  2RJE A;  3UWN A;  1VQK T;  4C8Q B;  3QG1 A;  4E47 A;  2DPP B;  3G4S T;  1M90 U;  2K4Y A;  1VQO T;  5LJ5 g;  3QBY A;  5LJ3 g;  4FIB A;  3URG A;  3J7A F;  3MEV A;  3PMI A;  3QJY A;  4HCZ A;  5GAO q;  3OYJ A;  2E6N A;  2X4J A;  4PJO G;  4CRI A;  4HT9 A;  2LCC A;  5HY6 A;  1UEB A;  2FHD A;  3HPW A;  1KD1 C;  3I56 T;  3L2V A;  1KQ1 A;  2HD0 A;  4LD9 K;  3C94 A;  4KUD K;  2RJD A;  3JCM g;  2RO0 A;  3OQ5 A;  4CI0 C;  3GOX A;  1M90 C;  2K3Y A;  1G5V A;  4QW2 A;  2L3R A;  3RER A;  2VXF A;  2XID A;  2QEX A;  1YCY A;  3M9Q A;  1YJ9 A;  2CS7 A;  3QO3 A;  5GAN 3;  4XTV A;  2CZ0 B;  1FX7 A;  3SFM A;  2H3J A;  2DJZ A;  1OYX A;  5CR2 A;  5GMK e;  1O9S A;  1W4S A;  1XTD A;  3INZ A;  1YI2 A;  3TU4 K;  3JCM b;  2JTF A;  1R8O B;  4C0G A;  4C92 B;  3CPF A;  4YTL A;  4ELZ C;  1I5L A;  4OGE A;  1VQ9 A;  1BYM A;  2L89 A;  4XK8 E;  4M77 C;  2K2V A;  3BFM A;  3OYM A;  2ZPH B;  2XG8 D;  2M16 A;  3P8B B;  3CC2 A;  2RI2 A;  1UGS B;  1UGP B;  3E9F A;  4ZGD B;  1WNL A;  2DD4 A;  2JTM A;  4M7D E;  4J7I A;  3V7S A;  5GAO n;  4ZN3 A;  2LT1 A;  5FRN A;  2LC4 A;  2DTI A;  2V8K A;  1M1K U;  2CGH A;  3OS5 A;  4RG2 A;  3VUB A;  4MML A;  1WJQ A;  4DOW A;  2DZC A;  2EJG A;  5J39 A;  1N27 A;  2KY9 A;  3OBY A;  4A54 A;  3MP8 A;  4A4K A;  3OBW A;  3JCM V;  3VV0 A;  4GY5 A;  1W2B S;  1WGS A;  2HNI A;  3CCQ T;  1X01 A;  2WSE E;  3NTI A;  1BKB A;  5CAI A;  1JJ2 S;  2DIG A;  1M1K C;  4F7U E;  2F5T X;  2E6Z A;  3FJP A;  4OB0 B;  5DM7 R;  1LJO A;  1VQN A;  2E10 A;  4XTZ A;  2ZPI B;  3CCL T;  3MCA B;  3MEU A;  3VJP A;  1Q81 U;  3DB3 A;  3M59 A;  4M75 C;  4Y28 E;  5D6Y A;  2XIC A;  5GAN h;  1VQ8 A;  1M9S A;  4M78 E;  4NL2 A;  2RHU A;  3JCM c;  3CCM T;  2PUO B;  2JUF A;  3RIR A;  3L42 A;  4M7D C;  3RKW A;  2KK4 A;  5J3B A;  2OAU A;  5GAN e;  3V8L A;  4EMH A;  2KVQ G;  3LYI A;  1NZ9 A;  2D0Q B;  2O4X B;  4IUT A;  4M77 A;  4N0A A;  5GAM e;  3TCJ A;  5I21 A;  1Q81 C;  3OYH A;  3QSU A;  4XTX A;  2M1H A;  4M77 F;  3CCU A;  3LGL A;  2M0O A;  4LD6 A;  5DLQ E;  2P0Q A;  1MGQ A;  3GPL A;  3ZEH A;  1KQS A;  3M56 A;  3C4S A;  2ZPG B;  1VIF A;  4J8O A;  2NLU A;  3NTH A;  4M7A E;  3SWN C;  2HQE A;  3JCM X;  4R55 A;  4F7U B;  1RI0 A;  5A0G A;  5CKF A;  3JCM J;  3OMG A;  2DKG A;  2DTO A;  4PJO C;  3MHX A;  2XI9 A;  4FSX A;  4PKC C;  4XU3 A;  2O4X A;  1IZ6 A;  3I55 A;  1VQ7 A;  3X25 B;  4EPC A;  1YJW T;  3M53 A;  1Q86 U;  1ZHI A;  2MI6 A;  1ZQ1 A;  3CXC S;  1YJN A;  3WXM B;  4BY6 B;  5GMK j;  4C8Q E;  1ZBX A;  4MMK A;  4JLG A;  5CKE A;  4E7J A;  2P0P A;  5FU6 C;  4JDS A;  3OYK A;  4QVC A;  2LRQ A;  2VXE A;  1VQM T;  4M77 D;  2QTX A;  4ELY C;  3MO8 A;  2QXF A;  4Q5W A;  1YHQ A;  1VQP T;  4L5G A;  1VQ5 A;  2P4T A;  1Q7Y U;  2E70 A;  5A2Q E;  4BI3 A;  5GAN 7;  2HQX A;  1JRI A;  4M7A C;  3WVE B;  1P92 A;  3GLX A;  3RKX A;  5GAN 4;  3FIF A;  3OYF A;  2QA4 T;  4MZM A;  2KAF A;  4JLI A;  4M7D G;  1XOV A;  3CCV T;  1X6O A;  4PLL A;  3JCM W;  1QVG S;  1NPP A;  4HA8 A;  3RMQ A;  4C0D B;  4X34 A;  2HBP A;  2A3L A;  1Q7Y C;  4R56 A;  3CD6 A;  4KBM B;  4WF2 A;  2RA2 A;  4QQG A;  4HT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...