2JT4A

Solution structure of the sla1 sh3-3-ubiquitin complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
MASKSKKRGIVQYDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEPVRDKKHTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Cytoskeleton assembly control protein SLA1
publication title Structural Basis for Ubiquitin Recognition by SH3 Domains
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 13
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jt4A00
1X2KA 2LNHB 2GNCA 1X69A 4RUGA 3VS5A 2EGEA 2IIMA 3I35A 1QCFA 4F16A 1H8KA 5IXBA 1X2QA 1T0JA 4OMOA 4RTUA 2D8HA 1BB9A 1Y0MA 3VRYA 3VS4A 1K76A 5IHKA 2BTTA 1A0NB 2RNAA 3RBBB 1G2BA 2MCNA 2JTEA 1AZEA 4M4ZA 2NWMA 1VA7A 2HSPA 1WFWA 1MV0B 1QKXA 2PZ1A 5I22A 4K11A 1ARKA 1WX6A 2E5KA 2JS2A 2FG0A 1TUDA 1E6HA 4CC2A 1VYVA 2BZXA 1W6XA 1U5SA 3EG2A 2XMFA 1JEGA 4GLMA 2YUOA 1WXBA 2K3BA 1H92A 1I0CA 1AZGB 1OPLA 1SPKA 4LNPA 2DL4A 2BZ8A 3C0CA 2CUDA 2O9VA 1UJYA 1UE9A 3PVLA 2SRCA 4HVUA 1GFDA 2HCKA 4QT7A 4OMQA 3NGPA 3QWYA 2EVRA 2RN8A 1YWPA 3TVTA 2DF6A 2FPFA 2CH4A 1U3OA 2RPNA 1QLYA 2ROTA 3QWXX 3VS7A 2AK5A 5FWCA 3TSWA 1BK2A 2O2OA 2W10A 4F17A 5ECAA 2JXBA 1K0SA 2EYXA 2DBMA 1NEGA 1K1ZA 3M0TA 1AOJA 1UGVA 1ZUKA 1CSKA 2LQWA 2DL5A 3FJ5A 4JJDA 1X43A 2KNBB 1QKWA 1WIEA 1NLOC 2C0OA 2L0AA 4R0KA 1K4US 1FMKA 1OOTA 2JT4A 1MV3A 2DM1A 2EQIA 2GBQA 1PRMC 1RI9A 2FRYA 1UHCA 1TUCA 2DRKA 1YWOA 2F2WA 1UDLA 1OEBA 2F2VA 2JW4A 5HCKA 1HD3A 2ECZA 1GL5A 2A36A 2O31A 2FPDA 2V1QA 2DNUA 4IIMA 2JMAA 3ZL7C 1X6BA 2YDLA 1ABQA 3H41A 2DL7A 4HCKA 3M0SA 2KT8A 2EYZA 2AZSA 1WXUA 2OJ2A 1PRLC 2J6FA 1Z9QA 2L2PA 1WXTA 2JM9A 2ED0A 1RUWA 2OI3A 1PWTA 1WYXA 5IHIA 2KEAA 2KRNA 1WDXA 2K7AA 4J9BA 1TG0A 1V1CA 3EG0A 2FRWA 2L3QA 4X1VA 2HEQA 5FWBA 2FEIA 5IXFA 2KRMA 3I5SA 2CT4A 1M3CA 1T3LA 2VVKA 1GFCA 2A28A 4LUEA 2KYBA 2LJ3A 3JV3A 2CSQA 3M0QA 4AFUC 1S1NA 2ESWA 2DL8A 4CC7A 2PNIA 2K2MA 4LE9A 4OMPA 2RQVA 5GJVB 1GCPA 1SHGA 3ULRB 2G6FX 1M27C 2V1RA 2MOXA 2CH4W 3GBQA 4DEXA 1AWJA 2X3XD 3R6NA 4J9HA 1JXOA 1UG1A 2MIOA 1MUZA 2W0ZA 3VRZA 3RNJA 1SRMA 1YCSB 1SHFA 1UHFA 3REAB 4F14A 1PNJA 2HDAA 4JJCA 2O9SA 2D8JA 1NM7A 2DA9A 4IIOA 4DEYA 4LN2A 1HSQA 2L3PA 2L3SA 2SEMA 3VS6A 2PTKA 2EW3A 4Z8AA 4Z88A 2KYMA 4AFQC 4Y92A 2KROA 1B07A 4GBQA 2C0TA 1UTIA 2CREA 2FPEA 3I5RA 1UJ0A 1VYUA 2KR3A 1AWOA 1YN8A 1AWWA 2X3WD 3I9QA 3NHNA 2KGTA 3M0RA 2KXDA 1JO8A 4ZNXA 2HBWA 4AFZC 2BZYA 2K6DA 3NPFA 2D1XA 2J6KA 2RF0A 1UUEA 4A63B 2NUZA 4AG2C 4JPBW 2H8HA 1ABOA 4OMNA 3VS3A 2DVJA 2J06A 2GGRA 3SEMA 2CUBA 2JS0A 1CKBA 1I07A 2YSQA 4LUDA 1GCQA 1NEBA 1H3HA 4OMLA 1PKSA 4J9DA 3PE0A 1QWEA 4J9EA 1NYFA 1KFZA 2RQUA 3LH5A 4FSSA 4JZ4A 4CC4B 3A98A 2JMCA 3VS0A 2EBPA 2VKNA 1GBRA 1BU1A 1ZSGA 5EC7A 1BBZA 2DE0X 1UFFA 2DX1A 1AWXA 1YP5A 2ED1A 2KRSA 2RQTA 4J9CA 2AKLA 1K0XA 2FO0A 2DILA 1ZUYA 3EHRA 3REBB 1ZBJA 5L23A 4RTWA 3VS1A 2J6OA 1M3AA 1G83A 2EGCA 3TSZA 2RMOA 3M0PA 4J9FA 3EHQA 1SEMA 3NMZC 1Z9ZA 1W1FA 1RLPC 1CKAA 1NYGA 2DJQA 1M8MA 4Z89A 4HVWA 3EGUA 2LMJA 2D0NA 2EGAA 3UF4A 2JM8A 3UATA 3H0HA 4AFSC 4RTYA 4D8DA 4E6RA 3PVQA 2ENMA 1AEYA 1J3TA 1X27A 2A08A 1NLPC 2KT1A 1JU5C 1K9AA 1HJDA 1T0HA 5IH2A 1JXMA 2GQIA 1GBQA 1KJWA 1NG2A 3O5ZA 1FYNA 3EG1A 3CQTA 4OMMA 5I11A 2F2XA 2RQRA 1I1JA 2M0YA 2YUPA 1X6GA 1PHTA 1RLQC 3EG3A 1XOVA 2GTOA 4EIKA 2AZVA 2A37A 1ZLMA 2CDTA 2AKKA 1KIKA 3VS2A 2EPDA 1AD5A 2CT3A 2EYWA 4HVVA 4ORZA 1E7OA 2LP5A 2C0IA 2LX7A 3H0FA 2EYYA 2CSIA 1UECA 1GRIA 2DL3A 1Y57A 2EKHA 2DMOA 2YT6A 4J9GA 5IHNA 4RTTA 3SHWA 1VYTA 1WA7A 4ESRA 1OPKA 3IQLA 2J7IA 2LJ1A 4D8KA 5FW9A 4RTZA 1N5ZA 2J05A 2LJ0A 3H0IA 1PKTA 2ABLA 4RTVA 4JJBA 2DYBA 3UA7A 2YUNA 2LZ6B 1W70A 2I0NA 1ZUUA 1JQQA 3KFVA 1GCQC 4JZ3A 1SSHA 2RQWA 4KRTA 1AVZC 4AG1C 2QDLA 2DRMA 2KE9A 1SRLA 2P4RA 1YNZA 2B86A 1WI7A 3THKA 3U23A 1LCKA 1B3QA 1QWFA 5GJWB 1E6GA 1EFNA 1M3BA 4RTXA 4WCIA 1M30A 1ZX6A 4HXJA 1KSWA 2KBTA 4CC3A 2K79A 4J9IA 2M51A 3M0UA 2K9GA 2KXCA 2VWFA 2ROLA 2LCSA 1OV3A 2LQNA 2GTJA 2OAWA 2DLPA 1U06A 1T3SA 1WLPB 2YUQA 3UA6A 2DBKA 2O88A 1IO6A
chains in the Genus database with same CATH superfamily
4QW2A 2DYIA 4M7AB 1WGSA 1WNLA 4RUGA 3VS5A 2IIMA 3QKJA 4F16A 3BW1A 3I56Q 4FT2A 2L3RA 1AHJB 5IXBA 4BY6C 5GAOl 3JCMX 4OB1B 2CZ0B 2L8DA 4OMOA 2JTMA 2VXFA 3OSSC 5GAN7 4JRIA 3EGXA 1K76A 2O4XA 1U1SA 1G2BA 1LVKA 2VUBA 2MCNA 2JTEA 2HSPA 3GF5A 1QKXA 5LJ3f 4K11A 1ARKA 2E3HA 5KYXB 2BZXA 2QEXA 1U5SA 3EG2A 4V2SA 2K5IA 4GLMA 2F5KA 5FROA 2LNVA 2K3BA 1YITA 2XI9A 5LJ3d 5CR2A 1AZGB 2MI6A 5LJ5e 4VUBA 3CCET 1TU0B 2O9VA 1IGUA 2SRCA 1FXXA 1GFDA 3NTHA 1RABB 3NGPA 1KK7A 1YWPA 1NJIR 2KDSA 4XK8E 2FPFA 4M77G 4OB3B 2CH4A 3EGDB 1U3OA 3A8GB 3QWXX 1I81A 5FWCA 3TSWA 2A7YA 4ZN1A 2CP0A 2HKQB 3VKIA 3JCMb 4M7AA 4F17A 4XQ3A 2E3IA 3EH2A 3EH1A 3M0TA 1N9RA 1DJ7B 1M1GA 1PC0A 5CAIA 4E7HA 4PK4A 2MWPA 1X01A 1VQMQ 4QQ6A 4R0KA 1ZSZC 3JCMf 4OP0A 2DM1A 1VQLT 2QASA 1YBYA 4KUDK 3CCLA 4X34A 1IXDA 3CD6Q 1S72A 5GMKm 1PD0A 2YDLA 1ABQA 5FRMA 3H41A 3E1SA 3M0SA 4QKUA 4BI4A 2EWNA 4C8QF 2AZSA 2EQJA 3ZBDA 4NS5A 2OI3A 1WYXA 2P0PA 4M7DE 3JB9I 2KEAA 1D1BA 4WF2A 3GNFB 2H3JA 4IUVA 5FWBA 3PGGA 3PIPA 2FEIA 5IXFA 3RMQA 2DO3A 3LH0A 3I5SA 2CT4A 1M3CA 4C5HA 3CCQT 2YRCA 4X9CA 2HZYA 2RB6A 3M0QA 1S1NA 4XTXA 1JJ2P 1K9MC 4OMPA 2RQVA 1GCPA 2V1RA 2X9HA 2MOXA 5GANh 1AWJA 5J26A 3R6NA 1ZHIA 2JNGA 5D6XA 4E7IA 4J9HA 4BI8B 1FX7A 1MUZA 4B9WA 5DY9A 3VRZA 1TWBA 4XU3A 3FC3A 1W4SA 1PNJA 4FW1A 3CCMA 2BUDA 4E7JA 1Q82U 4LN2A 2L3PA 2EW3A 2RHUA 2IPOB 4AFQC 4J6XA 3QUIA 3CC2Q 1B07A 2QEXQ 4GBQA 1YITQ 2KR3A 3I55T 1F1BB 1Q81R 3HSBA 2DIGA 1VQKA 2D0QB 1JO8A 3SB2A 3EAEA 4N4HA 4AFZC 4XTYA 2J6KA 2RF0A 3CCRA 2OAUA 4FYXB 2H8HA 1OX9A 4OMNA 4TVRA 3VS3A 2PQWA 5I21A 1O9SA 3JB9J 3L2RA 2J06A 4E2FB 4IKFA 3SEMA 1OU9A 1P92A 3JCMP 4EPCA 1QQJA 3CC4A 2OTJT 1H3HA 1YI2T 2DVEA 4C0ZA 1XQHA 2XK0A 2DEUA 1MMDA 2CYZB 5A0LA 4J9DA 2FVUA 4J6WA 3LGLA 2X4JA 3OW2P 2DK3A 4J9EA 1VQOT 3M58A 1EX4A 3FLGA 1KFZA 4NL2A 2EKOA 1Q95G 4PNOA 2VKNA 1ACMB 4BE2A 1BU1A 5A2QE 2DX1A 1WHKA 2RHXA 2ED1A 2KRSA 4FT4A 4M75A 3CCLQ 1K0XA 2VGNA 1QCOA 2EIFA 2DTHA 1S72Q 2RI3A 1OU8A 4PJOA 1M3AA 1JB0E 1KC8R 5KYNA 5GAN2 1SG5A 3M0PA 4M7AE 3EHQA 4C8QE 3OYIA 1NYGA 2DJQA 1R77A 3EGUA 4ANJA 2EGAA 2JM8A 4C92D 2ZZDA 4E6RA 4OB2B 2OX7A 1YITT 1AEYA 3CXCP 1T0HA 1KQSP 4M75F 4J6YA 4J83A 5CIUA 5LJ5h 4IURA 1YJ9A 2R5MA 1KJWA 2QGFB 3O5ZA 3OYNA 1YJWA 5GMKl 1WHHA 3EG1A 1I4K1 5GANd 3OMCA 4OMMA 5I11A 2COZA 1G3SA 2RM4A 2M0YA 3URGA 2YUPA 5CKFA 1PHTA 3P8HA 1M2VA 2GTOA 3RESA 2K3YA 1OZ3A 1AD5A 2EYWA 3CCMQ 4KH0B 2EYQA 1TH7A 2LX7A 3CCJT 5GAMd 1V76A 2G3RA 1Y71A 2DL3A 1Y57A 1G3WA 2DFUA 2P4TA 2DMOA 3OY9A 4M7AC 5IHNA 4OMFB 2QDYB 3OYCA 1M2OA 2D6FA 4BD3A 3PT9A 2DAQA 1VQKQ 1WQ7A 2QYZA 2DPPB 4HT9A 3HTRA 3CCLT 4A53A 1NE8A 3L2UA 3N5BB 3KFVA 1JQQA 3CCRQ 3LWHA 5D7UA 1UB4A 1AVZC 3EFRA 1YCYA 2QDLA 3O8VA 2DRMA 3LGFA 3PMTA 1SRLA 2EQMA 1Q7YU 2DJZA 2B86A 3THKA 2ZPHB 5GAOp 3U23A 1LCKA 1QWFA 3CC4Q 3BDUA 2MPXC 3ZFJA 1ZSZA 2JUFA 4WCIA 2DXBA 4KGXB 3MEVA 3UWNA 5CCAA 4KUIA 1KSWA 2QXFA 1RAEB 2E65A 3CPWA 4Z02A 4J9IA 4C0DB 3M0UA 1VQ8T 4GLKA 3LWIA 2RJCA 2ROLA 2CGHA 2LCSA 2RO0A 4RCBA 1OV3A 2DIQA 1VQLA 3HKSA 2DLPA 4UC4A 4MDWA 3LX7A 3UA6A 2LNHB 2GNCA 1X69A 3H8ZA 3WXMB 3EFSA 4MMKA 3I35A 1FWZA 1MGQA 1H8KA 2DEQA 1I5LA 3CBOA 1SKUB 1BI1A 1BCMA 1TUGB 1N8RC 5FU7C 2FL7A 3L2ZA 3VS4A 2XD0A 5FRNA 4M7DD 3OA6A 5IHKA 3TU4K 2RNAA 1D3BB 4QVCA 2VXEA 2PVGB 1AZEA 4M4ZA 2NWMA 1WFWA 1MV0B 5LJ3h 2CP2A 2YWWA 3CCQA 2PZ1A 2XDPA 4JLGA 1WX6A 3JCMJ 2FG0A 4HCCA 1TUDA 4M78B 2F69A 4M75E 5GANe 1JJ2S 2WSEE 1YJWQ 1UEBA 1PG5B 5CQXA 1I0CA 4L5GA 1OPLA 2K5LA 4PJOE 2NUTB 6AT1B 2BZ8A 4PKCC 3L2VA 4O6JA 3PVLA 2MK5A 4HVUA 3JB9D 4QT7A 2LTOA 3C94A 4HT8A 4OMQA 3CC4T 2RN8A 5GAMe 3NTKA 2RJFA 1QLYA 3AT1B 3EG9A 2AK5A 3RERA 1KD1R 2M9UA 1K73R 4L59A 2W10A 2KY9A 3I55A 2E64A 3E9FA 5ECAA 1R8OB 2HD0A 1K0SA 2EYXA 3HRUA 2DBMA 3CCEQ 1K1ZA 2BE7D 1RADB 4RG2A 2E6ZA 2YXYA 1HYOA 2LQWA 2DL5A 1QVFP 4M7AG 1NLOC 5GMKj 1IB8A 2OTLT 4LDWA 4C8QG 1K4US 1OULA 1FMKA 2GCXA 2DETA 3QYHB 4AT1B 1D1AA 2V8IA 2RK2A 2GBQA 1RI9A 1D3BA 2DKGA 1UDLA 1YI2A 1GL5A 2O31A 4KULA 2FPDA 5KYUA 2JMAA 4PJOC 5GAN5 3FEOA 2VB6A 3H9NA 5CKHA 1IREB 2K5FA 1G8XA 3PNWC 4M78A 1VQOA 2F1LA 2EYZA 3OW2S 3G1JA 2OJ2A 1Y7XA 2J6FA 1Z9QA 2HQEA 4J5YA 1WXTA 4P5NA 2ED0A 3LW5E 5IHIA 4N4GA 5GANg 2KRNA 2NUTA 1VQLQ 3UPUA 3M59A 4J9BA 1YJ9T 1V1CA 3EG0A 3RR6A 2GFUA 2FRWA 1YJWT 2FZKB 2L3QA 4X1VA 1NJIU 2R58A 4LUEA 2RJEA 3QXEB 3VUBA 3M53A 2DL8A 2MYSA 2PNIA 2K2MA 2NYSA 1QP2A 3ULRB 3ASKA 2G6FX 5GAMg 3FB9A 4C8QD 2CH4W 3GPLA 2JN0A 3GBQA 2X3XD 4E7SA 4QQGA 1JXOA 2EJFA 2W0ZA 1QW1A 3JCMc 4BUGA 1SRMA 3FRNA 1UHFA 3REAB 4JJCA 3C95A 3CCQQ 3QYGB 2E70A 3CXCS 4DEYA 1KQSS 2SEMA 4Z8AA 4A54A 3GP8A 2KROA 2ZAEA 1UTIA 3C12A 2CREA 3NFCA 1KQ1A 1UJ0A 2XG8D 2X3WD 3I9QA 1PSFA 2KGTA 1VQNT 2P0KA 1W2BP 1LPLA 1UUEA 1N27A 4A4KA 2AT1B 4A63B 1U1TA 1MNDA 4AG2C 4JPBW 4XTWA 3MP6A 2DXUA 1N6AA 3CCJA 2GFAA 1VIFA 5FLXE 2JS0A 1RAGB 3QPHA 2PUOB 5J3BA 5D6YA 3I55Q 2RA2A 1K8AU 3PFSA 1K8AC 4OMLA 4ZTFA 4BE1A 5I2SA 4D6WA 3MEWA 3JSCA 1NYFA 1B7TA 1PCXA 2RQUA 4FSSA 4JZ4A 2XU8A 2JMCA 2EBPA 3JCMd 2KQWA 5EC7A 4M77B 3OBYA 4C5GA 2EFIA 1X6OA 5KYXA 4M7AF 4BE0A 1YP5A 2RQTA 3FJPA 1TS9A 2AKLA 4E47A 2FO0A 3MPUB 3X26B 2JOYA 2OTJQ 4M77D 4EDUA 1YI2Q 4EMKB 4RTWA 3S3MA 4PLLA 3EFOB 3MHXA 2RMOA 5DLOA 4M75G 3BY7A 1VQOQ 3NMZC 5LJ5g 1Z9ZA 2IVWA 4OGEA 3OYAA 3TREA 1W1FA 1VQ8A 4J7FA 4Z89A 4HVWA 4PJMA 3ZEHA 4PJOG 3EGDA 4IUQA 3UATA 4RTYA 4PFPA 3VU3C 4R56A 1JJ2A 5GAN8 1WJSA 3CCUT 5GMKi 1NLPC 3V7CA 5GAOr 1ZA2B 1JU5C 1IGQA 3A8MB 1M90U 1M90C 1K9AA 1HJDA 1JXMA 2RHIA 1TOVA 1JBMA 5CO7A 1ZQ1A 2QQBA 3MP1A 3QDFA 4QVZA 1YIJA 2JZ2A 1FYNA 2BE9B 2VYTA 4FU6A 3CQTA 2E6NA 3ME9A 2DZCA 1Q82C 2YLBA 5CVIA 2RQRA 1I1JA 2R5AA 4M78E 1X6GA 5GAMh 5LJ3e 3EG3A 2FZCB 2A37A 1ZLMA 2QTXA 2AKKA 1KIKA 4C0DC 2VC8A 4HVVA 4ORZA 1E7OA 4ZN3A 4FL6A 4YTLA 3A8OB 4BB7A 4R55A 1GRIA 2YT6A 1VYTA 3CC7T 4ESRA 1OPKA 3IQLA 2J7IA 3QHSA 1TTHB 4EMKA 3GNGA 2H3EB 2RHZA 1IRXA 3OYGA 2ABLA 3RDVA 4JJBA 2X35A 1K9MR 3UA7A 1KC8U 4FM4B 1W70A 2I0NA 1ZUUA 1GCQC 4JZ3A 3WVEB 2XDDA 3M4YA 4AG1C 1YJNT 2LDMA 4KGZB 2M1HA 3CCJQ 3CPFA 1YNZA 3OYYA 3J81E 3OW2A 1WHGA 5GJWB 1TSFA 2XDBA 4DBQA 2R57A 1RI0A 2QQSA 2EJ9A 4M78C 4ATOA 1G5VA 1D1CA 3SD4A 3JCMe 4C0GA 5KYWB 2K79A 2OTLA 2M51A 2K9GA 3QDRB 1QVFS 3META 2KXCA 2VWFA 2E5QA 1OZ2A 2KI7A 4RMOA 2GTJA 1U06A 1T3SA 1WLPB 4C92B 2YUQA 2O88A 3HFOA 1X2KA 3V7RA 3HFNA 1XTDA 5LJ3g 1QCFA 2WACA 1WHLA 4XAXB 1X2QA 3ER0A 2HBPA 2IG0A 1VQ8Q 3KXTA 3L2QA 1BB9A 1Y0MA 3QO3A 1FMWA 3VV0A 4AMCA 1KQSA 2BTTA 4MZMA 4Y91A 1A0NB 2FYKA 4PFZA 4QVDA 3RBBB 3D7SB 1VA7A 4PJOF 1GXIE 2D9TA 4RKUE 4ZGDB 3JB9H 2E5KA 4A4GA 1E6HA 1M1KU 3E9GA 1M1KC 1VYVA 1KHIA 3OYHA 1YHQT 2XMFA 5D6WA 2YUOA 1WXBA 1H92A 3E2UA 2M02A 1SPKA 4DBHA 2CKKA 4PFOA 2DL4A 5GAOq 2L89A 2JJ9A 3DB3A 4PLIA 1UJYA 1VQ6A 1G3YA 2HCKA 1D09B 2K3XA 2EVRA 2CP5A 3M5AA 3RUXA 4F7UB 1VQ9A 2A0FB 1WHMA 3QG1A 1BCOA 3JCMg 2RPNA 1NPRA 2ROTA 1RACB 3VS7A 4C92A 1BK2A 2O2OA 2LX9A 1NEGA 2RHYA 1VQNA 1AOJA 1UGVA 2QA4T 1Q7YC 1ZUKA 4QQDA 3CEYA 2AIRB 1W2BS 1X43A 3JCMQ 1QKWA 1WIEA 2C0OA 2L0AA 1R0BG 2HSEB 1OOTA 2JT4A 1PM3A 2EQIA 5C6SA 1PRMC 2FRYA 1UHCA 2ZGWA 2QQRA 2Y4XA 2DRKA 4XTUA 2JW4A 1OEBA 3J80E 5HCKA 1HD3A 3L1AA 3CMET 2V1QA 4JJNK 4IIMA 5KYYB 5KH6A 1X6BA 5EG2A 2CP7A 3MP8A 2P84A 3S3OA 2FZGB 3GLXA 4MDXA 4LDVA 2DL7A 4HCKA 2KT8A 3A8LB 2QG9B 1WXUA 2OTLQ 2JM9A 1RUWA 3SWNB 1PWTA 1PSEA 1OI1A 4M7DB 2CP6A 4M78G 3GOXA 1YIJT 3CMAT 1C0MA 5HK3A 2HEQA 5CKEA 4FW2A 2KRMA 4F7UA 1GFCA 1PD1A 2A28A 1VQ7T 2LJ3A 3JV3A 2CSQA 5HKCA 1QP3A 2ESWA 2QK0A 3A8HB 4CC7A 2PUKB 4LE9A 5GJVB 1KD1U 1K73U 2F5TX 4HA8A 2JTFA 4LDYA 3CCSA 1ZBXA 3Q1JA 2EAYA 2DXTA 2V26A 1Q86U 1Q86C 1YJ9Q 1VUBA 3OYKA 3CCUA 3QZ9B 1YCSB 1SHFA 5DM7R 4F14A 2O9SA 4E7LA 1NM7A 4IIOA 1QVGP 4M77C 2KMTA 2PTKA 1RAFB 2XIDA 4Z88A 2KYMA 4EMGA 1XNIA 2QQ9A 4Y92A 4KT0E 1WJQA 3PIOA 3RMSA 2MMPA 2C0TA 2X4WA 5HY6A 2Z0WA 1VYUA 5GANj 1AWOA 2CZ1B 5C0MA 1AWWA 4EMKC 5FU6B 1WHJA 4LXCA 5KYYA 4LDXA 4ELZC 2XKOC 4JRPA 4ZNXA 2LC4A 1VQ6Q 2LCLA 2PU9B 2D1XA 3BFMA 4BDYA 2NUZA 1N8RR 2CP3A 5GAN4 1VQ9Q 1ABOA 3SWNA 2DVJA 4M7DA 4FYWB 2CS7A 2CUBA 2CZ6B 5HK0A 5GMKe 1CKBA 1I07A 3WVDB 2YHTA 2YSQA 3MEAA 3CC7A 1GCQA 3JCMh 5AT1B 1QVFA 3LLRA 2BIVA 8AT1B 3G6ET 4MZTA 2DTOA 3HPWA 1VQNQ 1H641 1QWEA 2WSFE 3LH5A 4CC4B 4KGVB 2PVDB 1VQPT 2ZPGB 4B9XA 1YJNA 1GBRA 1SSFA 1ZSGA 1BBZA 3V8KA 3OYMA 1VQ5T 4XU0A 1EIFA 3OYFA 3QIIA 4J9CA 5GAN6 4BDZA 3RKWA 1ZUYA 1M5Q1 3REBB 1UGSB 1G83A 1V29B 3DB4A 1R0CB 2EGCA 4C92E 3CCVT 1LJOA 2P0QA 5KE3A 5IAYA 2GQVA 4JDSA 1MMAA 4J9FA 2DTIA 1SEMA 4PJJA 3OS0A 2DXCA 1NJIC 4C8QB 3J7AF 4KH1B 1M8MA 3HRSA 4AFSC 3BDLA 4D8DA 4M7AD 3G4ST 3PVQA 5LL6S 2ENMA 4Q5WA 1X27A 3BE3A 4M78F 4LD9K 4J8OA 2GQIA 3S3NA 2V8KA 3FDRA 1VQ6T 3JB9F 4IUUA 2EQUA 3P8DA 2M16A 3UDCA 1VQ9T 3CCSQ 3PTAA 2F2XA 1N9SA 1VOMA 1RLQC 3GIBA 4PJLA 3CC2A 1XOVA 4EIKA 2CDTA 2HNIA 3CCUQ 1WQWA 9ATCB 5CQYA 1BYMA 2EPDA 3G71T 3HRTA 2Y90A 2LP5A 2C0IA 4HCZA 4OVAA 1ZA1B 3H0FA 2EYYA 2CSIA 4HKEA 1YHQA 5LJ5j 1UECA 2EKHA 4C92C 2VASA 3T9NA 1W2BA 4F7UE 2E10A 4D8KA 5FW9A 2J05A 2LJ0A 5GAN3 1PKTA 4A4EA 2DYBA 2LRQA 2LZ6B 1RL2A 1MMGA 1SSHA 2RQWA 3INZA 2CZ7B 3MJXA 5FU7B 4C8QA 3QSUA 4XU2A 3QBYA 4OGCA 2KE9A 3PMIA 2JVVA 2P4RA 5CK9A 1WI7A 1VQ4T 3OMGA 1X75C 1B3QA 3CC7Q 4BACA 1E6GA 4JS4A 1EFNA 4A4FA 1O75A 3E19A 2LCCA 4RTXA 4FCYA 1M30A 2QA4A 3I56T 2E12A 1I8FA 1UGRB 4A4HA 1OQKA 3NTIA 1YJNQ 1Y96B 2Y4YA 1C6VX 5IN1A 3UT1A 4IUTA 1MHNA 3CMEA 2E4HA 3CCST 5AYFA 1RAIB 2EGEA 1Q81U 1Q81C 2MF2A 1BIAA 4BI3A 3OB9A 5A0DA 3CPWS 1T0JA 3RKXA 4JRKA 3VYGA 2MAMA 2YRDA 4RTUA 3R6OA 4RCCA 2K2VA 2D8HA 1K8AR 3VRYA 1EZZB 4X9DA 3OYLA 4FYVB 1AT1B 1K9MU 3CMAA 2EQKA 2HQXA 4ZTJA 5I22A 3RIRA 1VQ7A 2JS2A 2X51A 3RKYA 2RK1A 4CC2A 1W6XA 3JCMW 1IHVA 4M75B 3V8JA 1JEGA 2C06A 4O5VA 5KCOA 3X28B 2WSCE 4F04B 3QZ5B 4LNPA 4M77A 4FYYB 4PJOB 3C0CA 2CUDA 4M75D 2LT4A 4DBRA 1UE9A 5I2MA 3L42A 1LNXA 5LJ3j 3QWYA 3JCMV 3TVTA 2DF6A 5GMKh 1VQMT 4PJOD 4PJNA 3SWNC 1Y96A 4DBFA 1QVGS 4DOVA 3EFOA 4M7DC 3OS1A 1YHQQ 3F70A 4CRIA 5KE2A 4DA4A 1KC8C 4BY6B 3CD6T 1M90R 2HL5C 2JXBA 2M0OA 2KVQG 5J39A 1BI0A 2V8JA 4XTZA 4DQ2A 1NPPA 4C92G 1KQ2A 2MWOA 1CSKA 3FJ5A 4JJDA 2FB7A 4NL3A 4M77F 2KNBB 1YFNA 1Q82R 1RAHB 4WTOB 1MV3A 4KBMB 1TXQA 2HL3A 1M2VB 1TUCA 3OQ5A 1YWOA 2F2WA 2F2VA 4B6MA 2ECZA 2A36A 3SDZA 2PVOB 3G6EA 2DNUA 3ZL7C 3P8BB 1MNEA 4IUPA 4NOYA 2QA4Q 4N0AA 2ZPEB 2QI2A 3CBMA 1VQPA 1PRLC 4ELYC 2E41A 2L2PA 1VQ5A 5FU6C 4FSXA 3VUZA 1WDXA 2K7AA 1TG0A 2DD5A 2DERA 3CMEQ 2ATCB 5L8RE 3CXCA 1T3LA 1XJWB 3M54A 2VVKA 3X25B 4XU1A 7AT1B 2KYBA 2LQ8A 4FIBA 5DLQE 4AFUC 3CCVA 3M56A 1M9SA 3CC2T 4XTVA 2QEXT 1SHGA 2YLCA 1M27C 2EJGA 3QJ6A 1ZSZB 4DEXA 2AHJB 5GANf 3HHTB 3M4GA 4F7UG 2FHDA 3HP9A 3QJYA 3MKDA 1UG1A 2MIOA 2O01E 3G4SA 2HQHA 3RNJA 3CMAQ 1YIJQ 4ZGEB 3DKMA 2HDAA 2HMAA 2D8JA 2DA9A 1VQ7Q 1HSQA 3V7SA 2L3SA 4E7KA 2HAXA 3VS6A 1D0YA 2ZPFB 5GAMf 3VYHB 1B34B 1BKBA 1SF9A 1IZ6A 2KK4A 2RH2A 2FPEA 3I5RA 5KYWA 3TCJA 5GAOn 3MCAB 1YN8A 4N4IA 3S6WA 4JLIA 2RI5A 3NHNA 4C0FA 3M0RA 3M57A 2KXDA 1D0XA 2LT1A 2HBWA 2BZYA 2DZ9A 2K6DA 3NPFA 2VV5A 3G71A 3TEEA 1NZ9A 4C8QC 4DOWA 2ZCFB 2A3LA 2X4XA 2XHCA 3CCEA 3TQ7P 2GGRA 1KHCA 1H3ZA 4MMLA 4LDUA 2RJDA 4LUDA 4C5IA 1NEBA 2ZPIB 5GAOm 1S72T 1LOJA 5CKDA 1PKSA 3MEUA 2KSSA 1M1KR 3PE0A 4M7DG 3CBPA 3OYBA 1BI2A 3HL8A 1M8VA 4CI0C 3OBWA 3A98A 3M55A 4M77E 3VS0A 4JRQA 3KUFA 2VGMA 2DE0X 2LVMA 1UFFA 4C92F 2QAZA 1FMVA 1AWXA 3CPWP 1VQ4A 1C1AA 4ZGJB 4Y28E 2COYA 2DILA 3OSVA 8ATCB 2I2LA 1M4ZA 3EHRA 4J7IA 3AHUA 1ZBJA 5L23A 3G6EQ 1HK9A 3G7ZA 4L6V5 3VS1A 2J6OA 3I56A 2COWA 3M9QA 4MZPA 3EG9B 2QQAA 3TSZA 1QVPA 1B34A 2B8AA 1BI3A 2NLUA 3JB9G 1VQPQ 3OYJA 1RLPC 1CKAA 1VQ5Q 2LMJA 2D0NA 1IHWA 3UF4A 2KAFA 1UGPB 3H0HA 3MO8A 1Q7YR 1KD1C 1K73C 2NUPB 2ZPBB 1J3TA 2A08A 1OX8A 2KT1A 1N8RU 3H6ZA 5IH2A 3CCMT 1OYXA 1Y07A 1GBQA 2GF7A 3C4SA 3CCVQ 2HKNA 1WPYA 4RG8A 3A5ZB 1NG2A 5LJ5f 4EMHA 1VIEA 5A0GA 2K4YA 3V8LA 4C5EA 3OS5A 3OYEA 2DD4A 2XICA 5KYUB 3DLMA 1BIBA 1D0ZA 2QGGA 1QVGA 1VQKT 5LJ5d 2AZVA 3G4SQ 4F7UF 3FIFA 1WZOA 3VS2A 4PL6A 5KCHA 3CCRT 2CT3A 3VJPA 1QMCA 4JS5A 2L5QA 4M78D 2YRVA 2K57A 2LQKA 2X4YA 4J9GA 3LYIA 2RI2A 4RTTA 3SHWA 3JRZA 1WA7A 4HCBA 2LJ1A 1QCNA 3EGXB 2O4XB 5GAMj 4RTZA 1N5ZA 3H0IA 4RTVA 1M1FA 3OS2A 3X24B 2YUNA 1VQMA 4ME7A 3G71Q 3L2WA 4OB0B 4KRTA 1UGQB 5IT9E 3A1PA 1WJRA 1Q86R 1I5OB 2E1HA 1RAAB 1JRIA 4JUVA 3X20B 1U8RA 4E7ZA 2QTVA 3CD6A 2NUPA 4LD6A 3JAME 1M3BA 3OYDA 4GY5A 4N0AC 1ZX6A 4HXJA 5M9OA 1NBEB 2BKDN 4M75C 2KBTA 1MMNA 4CC3A 2RD1A 3DLLA 2OTJA 1G3TA 1HXDA 5CKBA 4M7DF 4II1A 3KBGA 2LQNA 3SFMA 2OAWA 1KG1A 4OF1A 2DBKA 1VQ4Q 1IO6A
chains in the Genus database with same CATH topology
1X2KA 2LNHB 2GNCA 1X69A 4RUGA 3VS5A 2EGEA 2IIMA 3I35A 1QCFA 4F16A 1H8KA 5IXBA 1X2QA 1T0JA 4OMOA 4RTUA 2D8HA 1BB9A 1Y0MA 3VRYA 3VS4A 1K76A 5IHKA 2BTTA 1A0NB 2RNAA 3RBBB 1G2BA 2MCNA 2JTEA 1AZEA 4M4ZA 2NWMA 1VA7A 2HSPA 1WFWA 1MV0B 1QKXA 2PZ1A 5I22A 4K11A 1ARKA 1WX6A 2E5KA 2JS2A 2FG0A 1TUDA 1E6HA 4CC2A 1VYVA 2BZXA 1W6XA 1U5SA 3EG2A 2XMFA 1JEGA 4GLMA 2YUOA 1WXBA 2K3BA 1H92A 1I0CA 1AZGB 1OPLA 1SPKA 4LNPA 2DL4A 2BZ8A 3C0CA 2CUDA 2O9VA 1UJYA 1UE9A 3PVLA 2SRCA 4HVUA 1GFDA 2HCKA 4QT7A 4OMQA 3NGPA 3QWYA 2EVRA 2RN8A 1YWPA 3TVTA 2DF6A 2FPFA 2CH4A 1U3OA 2RPNA 1QLYA 2ROTA 3QWXX 3VS7A 2AK5A 5FWCA 3TSWA 1BK2A 2O2OA 2W10A 4F17A 5ECAA 2JXBA 1K0SA 2EYXA 2DBMA 1NEGA 1K1ZA 3M0TA 1AOJA 1UGVA 1ZUKA 1CSKA 2LQWA 2DL5A 3FJ5A 4JJDA 1X43A 2KNBB 1QKWA 1WIEA 1NLOC 2C0OA 2L0AA 4R0KA 1K4US 1FMKA 1OOTA 2JT4A 1MV3A 2DM1A 2EQIA 2GBQA 1PRMC 1RI9A 2FRYA 1UHCA 1TUCA 2DRKA 1YWOA 2F2WA 1UDLA 1OEBA 2F2VA 2JW4A 5HCKA 1HD3A 2ECZA 1GL5A 2A36A 2O31A 2FPDA 2V1QA 2DNUA 4IIMA 2JMAA 3ZL7C 1X6BA 2YDLA 1ABQA 3H41A 2DL7A 4HCKA 3M0SA 2KT8A 2EYZA 2AZSA 1WXUA 2OJ2A 1PRLC 2J6FA 1Z9QA 2L2PA 1WXTA 2JM9A 2ED0A 1RUWA 2OI3A 1PWTA 1WYXA 5IHIA 2KEAA 2KRNA 1WDXA 2K7AA 4J9BA 1TG0A 1V1CA 3EG0A 2FRWA 2L3QA 4X1VA 2HEQA 5FWBA 2FEIA 5IXFA 2KRMA 3I5SA 2CT4A 1M3CA 1T3LA 2VVKA 1GFCA 2A28A 4LUEA 2KYBA 2LJ3A 3JV3A 2CSQA 3M0QA 4AFUC 1S1NA 2ESWA 2DL8A 4CC7A 2PNIA 2K2MA 4LE9A 4OMPA 2RQVA 5GJVB 1GCPA 1SHGA 3ULRB 2G6FX 1M27C 2V1RA 2MOXA 2CH4W 3GBQA 4DEXA 1AWJA 2X3XD 3R6NA 4J9HA 1JXOA 1UG1A 2MIOA 1MUZA 2W0ZA 3VRZA 3RNJA 1SRMA 1YCSB 1SHFA 1UHFA 3REAB 4F14A 1PNJA 2HDAA 4JJCA 2O9SA 2D8JA 1NM7A 2DA9A 4IIOA 4DEYA 4LN2A 1HSQA 2L3PA 2L3SA 2SEMA 3VS6A 2PTKA 2EW3A 4Z8AA 4Z88A 2KYMA 4AFQC 4Y92A 2KROA 1B07A 4GBQA 2C0TA 1UTIA 2CREA 2FPEA 3I5RA 1UJ0A 1VYUA 2KR3A 1AWOA 1YN8A 1AWWA 2X3WD 3I9QA 3NHNA 2KGTA 3M0RA 2KXDA 1JO8A 4ZNXA 2HBWA 4AFZC 2BZYA 2K6DA 3NPFA 2D1XA 2J6KA 2RF0A 1UUEA 4A63B 2NUZA 4AG2C 4JPBW 2H8HA 1ABOA 4OMNA 3VS3A 2DVJA 2J06A 2GGRA 3SEMA 2CUBA 2JS0A 1CKBA 1I07A 2YSQA 4LUDA 1GCQA 1NEBA 1H3HA 4OMLA 1PKSA 4J9DA 3PE0A 1QWEA 4J9EA 1NYFA 1KFZA 2RQUA 3LH5A 4FSSA 4JZ4A 4CC4B 3A98A 2JMCA 3VS0A 2EBPA 2VKNA 1GBRA 1BU1A 1ZSGA 5EC7A 1BBZA 2DE0X 1UFFA 2DX1A 1AWXA 1YP5A 2ED1A 2KRSA 2RQTA 4J9CA 2AKLA 1K0XA 2FO0A 2DILA 1ZUYA 3EHRA 3REBB 1ZBJA 5L23A 4RTWA 3VS1A 2J6OA 1M3AA 1G83A 2EGCA 3TSZA 2RMOA 3M0PA 4J9FA 3EHQA 1SEMA 3NMZC 1Z9ZA 1W1FA 1RLPC 1CKAA 1NYGA 2DJQA 1M8MA 4Z89A 4HVWA 3EGUA 2LMJA 2D0NA 2EGAA 3UF4A 2JM8A 3UATA 3H0HA 4AFSC 4RTYA 4D8DA 4E6RA 3PVQA 2ENMA 1AEYA 1J3TA 1X27A 2A08A 1NLPC 2KT1A 1JU5C 1K9AA 1HJDA 1T0HA 5IH2A 1JXMA 2GQIA 1GBQA 1KJWA 1NG2A 3O5ZA 1FYNA 3EG1A 3CQTA 4OMMA 5I11A 2F2XA 2RQRA 1I1JA 2M0YA 2YUPA 1X6GA 1PHTA 1RLQC 3EG3A 1XOVA 2GTOA 4EIKA 2AZVA 2A37A 1ZLMA 2CDTA 2AKKA 1KIKA 3VS2A 2EPDA 1AD5A 2CT3A 2EYWA 4HVVA 4ORZA 1E7OA 2LP5A 2C0IA 2LX7A 3H0FA 2EYYA 2CSIA 1UECA 1GRIA 2DL3A 1Y57A 2EKHA 2DMOA 2YT6A 4J9GA 5IHNA 4RTTA 3SHWA 1VYTA 1WA7A 4ESRA 1OPKA 3IQLA 2J7IA 2LJ1A 4D8KA 5FW9A 4RTZA 1N5ZA 2J05A 2LJ0A 3H0IA 1PKTA 2ABLA 4RTVA 4JJBA 2DYBA 3UA7A 2YUNA 2LZ6B 1W70A 2I0NA 1ZUUA 1JQQA 3KFVA 1GCQC 4JZ3A 1SSHA 2RQWA 4KRTA 1AVZC 4AG1C 2QDLA 2DRMA 2KE9A 1SRLA 2P4RA 1YNZA 2B86A 1WI7A 3THKA 3U23A 1LCKA 1B3QA 1QWFA 5GJWB 1E6GA 1EFNA 1M3BA 4RTXA 4WCIA 1M30A 1ZX6A 4HXJA 1KSWA 2KBTA 4CC3A 2K79A 4J9IA 2M51A 3M0UA 2K9GA 2KXCA 2VWFA 2ROLA 2LCSA 1OV3A 2LQNA 2GTJA 2OAWA 2DLPA 1U06A 1T3SA 1WLPB 2YUQA 3UA6A 2DBKA 2O88A 1IO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2K A;  2LNH B;  2GNC A;  1X69 A;  4RUG A;  3VS5 A;  2EGE A;  2IIM A;  3I35 A;  1QCF A;  4F16 A;  1H8K A;  5IXB A;  1X2Q A;  1T0J A;  4OMO A;  4RTU A;  2D8H A;  1BB9 A;  1Y0M A;  3VRY A;  3VS4 A;  1K76 A;  5IHK A;  2BTT A;  1A0N B;  2RNA A;  3RBB B;  1G2B A;  2MCN A;  2JTE A;  1AZE A;  4M4Z A;  2NWM A;  1VA7 A;  2HSP A;  1WFW A;  1MV0 B;  1QKX A;  2PZ1 A;  5I22 A;  4K11 A;  1ARK A;  1WX6 A;  2E5K A;  2JS2 A;  2FG0 A;  1TUD A;  1E6H A;  4CC2 A;  1VYV A;  2BZX A;  1W6X A;  1U5S A;  3EG2 A;  2XMF A;  1JEG A;  4GLM A;  2YUO A;  1WXB A;  2K3B A;  1H92 A;  1I0C A;  1AZG B;  1OPL A;  1SPK A;  4LNP A;  2DL4 A;  2BZ8 A;  3C0C A;  2CUD A;  2O9V A;  1UJY A;  1UE9 A;  3PVL A;  2SRC A;  4HVU A;  1GFD A;  2HCK A;  4QT7 A;  4OMQ A;  3NGP A;  3QWY A;  2EVR A;  2RN8 A;  1YWP A;  3TVT A;  2DF6 A;  2FPF A;  2CH4 A;  1U3O A;  2RPN A;  1QLY A;  2ROT A;  3QWX X;  3VS7 A;  2AK5 A;  5FWC A;  3TSW A;  1BK2 A;  2O2O A;  2W10 A;  4F17 A;  5ECA A;  2JXB A;  1K0S A;  2EYX A;  2DBM A;  1NEG A;  1K1Z A;  3M0T A;  1AOJ A;  1UGV A;  1ZUK A;  1CSK A;  2LQW A;  2DL5 A;  3FJ5 A;  4JJD A;  1X43 A;  2KNB B;  1QKW A;  1WIE A;  1NLO C;  2C0O A;  2L0A A;  4R0K A;  1K4U S;  1FMK A;  1OOT A;  2JT4 A;  1MV3 A;  2DM1 A;  2EQI A;  2GBQ A;  1PRM C;  1RI9 A;  2FRY A;  1UHC A;  1TUC A;  2DRK A;  1YWO A;  2F2W A;  1UDL A;  1OEB A;  2F2V A;  2JW4 A;  5HCK A;  1HD3 A;  2ECZ A;  1GL5 A;  2A36 A;  2O31 A;  2FPD A;  2V1Q A;  2DNU A;  4IIM A;  2JMA A;  3ZL7 C;  1X6B A;  2YDL A;  1ABQ A;  3H41 A;  2DL7 A;  4HCK A;  3M0S A;  2KT8 A;  2EYZ A;  2AZS A;  1WXU A;  2OJ2 A;  1PRL C;  2J6F A;  1Z9Q A;  2L2P A;  1WXT A;  2JM9 A;  2ED0 A;  1RUW A;  2OI3 A;  1PWT A;  1WYX A;  5IHI A;  2KEA A;  2KRN A;  1WDX A;  2K7A A;  4J9B A;  1TG0 A;  1V1C A;  3EG0 A;  2FRW A;  2L3Q A;  4X1V A;  2HEQ A;  5FWB A;  2FEI A;  5IXF A;  2KRM A;  3I5S A;  2CT4 A;  1M3C A;  1T3L A;  2VVK A;  1GFC A;  2A28 A;  4LUE A;  2KYB A;  2LJ3 A;  3JV3 A;  2CSQ A;  3M0Q A;  4AFU C;  1S1N A;  2ESW A;  2DL8 A;  4CC7 A;  2PNI A;  2K2M A;  4LE9 A;  4OMP A;  2RQV A;  5GJV B;  1GCP A;  1SHG A;  3ULR B;  2G6F X;  1M27 C;  2V1R A;  2MOX A;  2CH4 W;  3GBQ A;  4DEX A;  1AWJ A;  2X3X D;  3R6N A;  4J9H A;  1JXO A;  1UG1 A;  2MIO A;  1MUZ A;  2W0Z A;  3VRZ A;  3RNJ A;  1SRM A;  1YCS B;  1SHF A;  1UHF A;  3REA B;  4F14 A;  1PNJ A;  2HDA A;  4JJC A;  2O9S A;  2D8J A;  1NM7 A;  2DA9 A;  4IIO A;  4DEY A;  4LN2 A;  1HSQ A;  2L3P A;  2L3S A;  2SEM A;  3VS6 A;  2PTK A;  2EW3 A;  4Z8A A;  4Z88 A;  2KYM A;  4AFQ C;  4Y92 A;  2KRO A;  1B07 A;  4GBQ A;  2C0T A;  1UTI A;  2CRE A;  2FPE A;  3I5R A;  1UJ0 A;  1VYU A;  2KR3 A;  1AWO A;  1YN8 A;  1AWW A;  2X3W D;  3I9Q A;  3NHN A;  2KGT A;  3M0R A;  2KXD A;  1JO8 A;  4ZNX A;  2HBW A;  4AFZ C;  2BZY A;  2K6D A;  3NPF A;  2D1X A;  2J6K A;  2RF0 A;  1UUE A;  4A63 B;  2NUZ A;  4AG2 C;  4JPB W;  2H8H A;  1ABO A;  4OMN A;  3VS3 A;  2DVJ A;  2J06 A;  2GGR A;  3SEM A;  2CUB A;  2JS0 A;  1CKB A;  1I07 A;  2YSQ A;  4LUD A;  1GCQ A;  1NEB A;  1H3H A;  4OML A;  1PKS A;  4J9D A;  3PE0 A;  1QWE A;  4J9E A;  1NYF A;  1KFZ A;  2RQU A;  3LH5 A;  4FSS A;  4JZ4 A;  4CC4 B;  3A98 A;  2JMC A;  3VS0 A;  2EBP A;  2VKN A;  1GBR A;  1BU1 A;  1ZSG A;  5EC7 A;  1BBZ A;  2DE0 X;  1UFF A;  2DX1 A;  1AWX A;  1YP5 A;  2ED1 A;  2KRS A;  2RQT A;  4J9C A;  2AKL A;  1K0X A;  2FO0 A;  2DIL A;  1ZUY A;  3EHR A;  3REB B;  1ZBJ A;  5L23 A;  4RTW A;  3VS1 A;  2J6O A;  1M3A A;  1G83 A;  2EGC A;  3TSZ A;  2RMO A;  3M0P A;  4J9F A;  3EHQ A;  1SEM A;  3NMZ C;  1Z9Z A;  1W1F A;  1RLP C;  1CKA A;  1NYG A;  2DJQ A;  1M8M A;  4Z89 A;  4HVW A;  3EGU A;  2LMJ A;  2D0N A;  2EGA A;  3UF4 A;  2JM8 A;  3UAT A;  3H0H A;  4AFS C;  4RTY A;  4D8D A;  4E6R A;  3PVQ A;  2ENM A;  1AEY A;  1J3T A;  1X27 A;  2A08 A;  1NLP C;  2KT1 A;  1JU5 C;  1K9A A;  1HJD A;  1T0H A;  5IH2 A;  1JXM A;  2GQI A;  1GBQ A;  1KJW A;  1NG2 A;  3O5Z A;  1FYN A;  3EG1 A;  3CQT A;  4OMM A;  5I11 A;  2F2X A;  2RQR A;  1I1J A;  2M0Y A;  2YUP A;  1X6G A;  1PHT A;  1RLQ C;  3EG3 A;  1XOV A;  2GTO A;  4EIK A;  2AZV A;  2A37 A;  1ZLM A;  2CDT A;  2AKK A;  1KIK A;  3VS2 A;  2EPD A;  1AD5 A;  2CT3 A;  2EYW A;  4HVV A;  4ORZ A;  1E7O A;  2LP5 A;  2C0I A;  2LX7 A;  3H0F A;  2EYY A;  2CSI A;  1UEC A;  1GRI A;  2DL3 A;  1Y57 A;  2EKH A;  2DMO A;  2YT6 A;  4J9G A;  5IHN A;  4RTT A;  3SHW A;  1VYT A;  1WA7 A;  4ESR A;  1OPK A;  3IQL A;  2J7I A;  2LJ1 A;  4D8K A;  5FW9 A;  4RTZ A;  1N5Z A;  2J05 A;  2LJ0 A;  3H0I A;  1PKT A;  2ABL A;  4RTV A;  4JJB A;  2DYB A;  3UA7 A;  2YUN A;  2LZ6 B;  1W70 A;  2I0N A;  1ZUU A;  1JQQ A;  3KFV A;  1GCQ C;  4JZ3 A;  1SSH A;  2RQW A;  4KRT A;  1AVZ C;  4AG1 C;  2QDL A;  2DRM A;  2KE9 A;  1SRL A;  2P4R A;  1YNZ A;  2B86 A;  1WI7 A;  3THK A;  3U23 A;  1LCK A;  1B3Q A;  1QWF A;  5GJW B;  1E6G A;  1EFN A;  1M3B A;  4RTX A;  4WCI A;  1M30 A;  1ZX6 A;  4HXJ A;  1KSW A;  2KBT A;  4CC3 A;  2K79 A;  4J9I A;  2M51 A;  3M0U A;  2K9G A;  2KXC A;  2VWF A;  2ROL A;  2LCS A;  1OV3 A;  2LQN A;  2GTJ A;  2OAW A;  2DLP A;  1U06 A;  1T3S A;  1WLP B;  2YUQ A;  3UA6 A;  2DBK A;  2O88 A;  1IO6 A; 
#chains in the Genus database with same CATH topology
 4QW2 A;  2DYI A;  4M7A B;  1WGS A;  1WNL A;  4RUG A;  3VS5 A;  2IIM A;  3QKJ A;  4F16 A;  3BW1 A;  3I56 Q;  4FT2 A;  2L3R A;  1AHJ B;  5IXB A;  4BY6 C;  5GAO l;  3JCM X;  4OB1 B;  2CZ0 B;  2L8D A;  4OMO A;  2JTM A;  2VXF A;  3OSS C;  5GAN 7;  4JRI A;  3EGX A;  1K76 A;  2O4X A;  1U1S A;  1G2B A;  1LVK A;  2VUB A;  2MCN A;  2JTE A;  2HSP A;  3GF5 A;  1QKX A;  5LJ3 f;  4K11 A;  1ARK A;  2E3H A;  5KYX B;  2BZX A;  2QEX A;  1U5S A;  3EG2 A;  4V2S A;  2K5I A;  4GLM A;  2F5K A;  5FRO A;  2LNV A;  2K3B A;  1YIT A;  2XI9 A;  5LJ3 d;  5CR2 A;  1AZG B;  2MI6 A;  5LJ5 e;  4VUB A;  3CCE T;  1TU0 B;  2O9V A;  1IGU A;  2SRC A;  1FXX A;  1GFD A;  3NTH A;  1RAB B;  3NGP A;  1KK7 A;  1YWP A;  1NJI R;  2KDS A;  4XK8 E;  2FPF A;  4M77 G;  4OB3 B;  2CH4 A;  3EGD B;  1U3O A;  3A8G B;  3QWX X;  1I81 A;  5FWC A;  3TSW A;  2A7Y A;  4ZN1 A;  2CP0 A;  2HKQ B;  3VKI A;  3JCM b;  4M7A A;  4F17 A;  4XQ3 A;  2E3I A;  3EH2 A;  3EH1 A;  3M0T A;  1N9R A;  1DJ7 B;  1M1G A;  1PC0 A;  5CAI A;  4E7H A;  4PK4 A;  2MWP A;  1X01 A;  1VQM Q;  4QQ6 A;  4R0K A;  1ZSZ C;  3JCM f;  4OP0 A;  2DM1 A;  1VQL T;  2QAS A;  1YBY A;  4KUD K;  3CCL A;  4X34 A;  1IXD A;  3CD6 Q;  1S72 A;  5GMK m;  1PD0 A;  2YDL A;  1ABQ A;  5FRM A;  3H41 A;  3E1S A;  3M0S A;  4QKU A;  4BI4 A;  2EWN A;  4C8Q F;  2AZS A;  2EQJ A;  3ZBD A;  4NS5 A;  2OI3 A;  1WYX A;  2P0P A;  4M7D E;  3JB9 I;  2KEA A;  1D1B A;  4WF2 A;  3GNF B;  2H3J A;  4IUV A;  5FWB A;  3PGG A;  3PIP A;  2FEI A;  5IXF A;  3RMQ A;  2DO3 A;  3LH0 A;  3I5S A;  2CT4 A;  1M3C A;  4C5H A;  3CCQ T;  2YRC A;  4X9C A;  2HZY A;  2RB6 A;  3M0Q A;  1S1N A;  4XTX A;  1JJ2 P;  1K9M C;  4OMP A;  2RQV A;  1GCP A;  2V1R A;  2X9H A;  2MOX A;  5GAN h;  1AWJ A;  5J26 A;  3R6N A;  1ZHI A;  2JNG A;  5D6X A;  4E7I A;  4J9H A;  4BI8 B;  1FX7 A;  1MUZ A;  4B9W A;  5DY9 A;  3VRZ A;  1TWB A;  4XU3 A;  3FC3 A;  1W4S A;  1PNJ A;  4FW1 A;  3CCM A;  2BUD A;  4E7J A;  1Q82 U;  4LN2 A;  2L3P A;  2EW3 A;  2RHU A;  2IPO B;  4AFQ C;  4J6X A;  3QUI A;  3CC2 Q;  1B07 A;  2QEX Q;  4GBQ A;  1YIT Q;  2KR3 A;  3I55 T;  1F1B B;  1Q81 R;  3HSB A;  2DIG A;  1VQK A;  2D0Q B;  1JO8 A;  3SB2 A;  3EAE A;  4N4H A;  4AFZ C;  4XTY A;  2J6K A;  2RF0 A;  3CCR A;  2OAU A;  4FYX B;  2H8H A;  1OX9 A;  4OMN A;  4TVR A;  3VS3 A;  2PQW A;  5I21 A;  1O9S A;  3JB9 J;  3L2R A;  2J06 A;  4E2F B;  4IKF A;  3SEM A;  1OU9 A;  1P92 A;  3JCM P;  4EPC A;  1QQJ A;  3CC4 A;  2OTJ T;  1H3H A;  1YI2 T;  2DVE A;  4C0Z A;  1XQH A;  2XK0 A;  2DEU A;  1MMD A;  2CYZ B;  5A0L A;  4J9D A;  2FVU A;  4J6W A;  3LGL A;  2X4J A;  3OW2 P;  2DK3 A;  4J9E A;  1VQO T;  3M58 A;  1EX4 A;  3FLG A;  1KFZ A;  4NL2 A;  2EKO A;  1Q95 G;  4PNO A;  2VKN A;  1ACM B;  4BE2 A;  1BU1 A;  5A2Q E;  2DX1 A;  1WHK A;  2RHX A;  2ED1 A;  2KRS A;  4FT4 A;  4M75 A;  3CCL Q;  1K0X A;  2VGN A;  1QCO A;  2EIF A;  2DTH A;  1S72 Q;  2RI3 A;  1OU8 A;  4PJO A;  1M3A A;  1JB0 E;  1KC8 R;  5KYN A;  5GAN 2;  1SG5 A;  3M0P A;  4M7A E;  3EHQ A;  4C8Q E;  3OYI A;  1NYG A;  2DJQ A;  1R77 A;  3EGU A;  4ANJ A;  2EGA A;  2JM8 A;  4C92 D;  2ZZD A;  4E6R A;  4OB2 B;  2OX7 A;  1YIT T;  1AEY A;  3CXC P;  1T0H A;  1KQS P;  4M75 F;  4J6Y A;  4J83 A;  5CIU A;  5LJ5 h;  4IUR A;  1YJ9 A;  2R5M A;  1KJW A;  2QGF B;  3O5Z A;  3OYN A;  1YJW A;  5GMK l;  1WHH A;  3EG1 A;  1I4K 1;  5GAN d;  3OMC A;  4OMM A;  5I11 A;  2COZ A;  1G3S A;  2RM4 A;  2M0Y A;  3URG A;  2YUP A;  5CKF A;  1PHT A;  3P8H A;  1M2V A;  2GTO A;  3RES A;  2K3Y A;  1OZ3 A;  1AD5 A;  2EYW A;  3CCM Q;  4KH0 B;  2EYQ A;  1TH7 A;  2LX7 A;  3CCJ T;  5GAM d;  1V76 A;  2G3R A;  1Y71 A;  2DL3 A;  1Y57 A;  1G3W A;  2DFU A;  2P4T A;  2DMO A;  3OY9 A;  4M7A C;  5IHN A;  4OMF B;  2QDY B;  3OYC A;  1M2O A;  2D6F A;  4BD3 A;  3PT9 A;  2DAQ A;  1VQK Q;  1WQ7 A;  2QYZ A;  2DPP B;  4HT9 A;  3HTR A;  3CCL T;  4A53 A;  1NE8 A;  3L2U A;  3N5B B;  3KFV A;  1JQQ A;  3CCR Q;  3LWH A;  5D7U A;  1UB4 A;  1AVZ C;  3EFR A;  1YCY A;  2QDL A;  3O8V A;  2DRM A;  3LGF A;  3PMT A;  1SRL A;  2EQM A;  1Q7Y U;  2DJZ A;  2B86 A;  3THK A;  2ZPH B;  5GAO p;  3U23 A;  1LCK A;  1QWF A;  3CC4 Q;  3BDU A;  2MPX C;  3ZFJ A;  1ZSZ A;  2JUF A;  4WCI A;  2DXB A;  4KGX B;  3MEV A;  3UWN A;  5CCA A;  4KUI A;  1KSW A;  2QXF A;  1RAE B;  2E65 A;  3CPW A;  4Z02 A;  4J9I A;  4C0D B;  3M0U A;  1VQ8 T;  4GLK A;  3LWI A;  2RJC A;  2ROL A;  2CGH A;  2LCS A;  2RO0 A;  4RCB A;  1OV3 A;  2DIQ A;  1VQL A;  3HKS A;  2DLP A;  4UC4 A;  4MDW A;  3LX7 A;  3UA6 A;  2LNH B;  2GNC A;  1X69 A;  3H8Z A;  3WXM B;  3EFS A;  4MMK A;  3I35 A;  1FWZ A;  1MGQ A;  1H8K A;  2DEQ A;  1I5L A;  3CBO A;  1SKU B;  1BI1 A;  1BCM A;  1TUG B;  1N8R C;  5FU7 C;  2FL7 A;  3L2Z A;  3VS4 A;  2XD0 A;  5FRN A;  4M7D D;  3OA6 A;  5IHK A;  3TU4 K;  2RNA A;  1D3B B;  4QVC A;  2VXE A;  2PVG B;  1AZE A;  4M4Z A;  2NWM A;  1WFW A;  1MV0 B;  5LJ3 h;  2CP2 A;  2YWW A;  3CCQ A;  2PZ1 A;  2XDP A;  4JLG A;  1WX6 A;  3JCM J;  2FG0 A;  4HCC A;  1TUD A;  4M78 B;  2F69 A;  4M75 E;  5GAN e;  1JJ2 S;  2WSE E;  1YJW Q;  1UEB A;  1PG5 B;  5CQX A;  1I0C A;  4L5G A;  1OPL A;  2K5L A;  4PJO E;  2NUT B;  6AT1 B;  2BZ8 A;  4PKC C;  3L2V A;  4O6J A;  3PVL A;  2MK5 A;  4HVU A;  3JB9 D;  4QT7 A;  2LTO A;  3C94 A;  4HT8 A;  4OMQ A;  3CC4 T;  2RN8 A;  5GAM e;  3NTK A;  2RJF A;  1QLY A;  3AT1 B;  3EG9 A;  2AK5 A;  3RER A;  1KD1 R;  2M9U A;  1K73 R;  4L59 A;  2W10 A;  2KY9 A;  3I55 A;  2E64 A;  3E9F A;  5ECA A;  1R8O B;  2HD0 A;  1K0S A;  2EYX A;  3HRU A;  2DBM A;  3CCE Q;  1K1Z A;  2BE7 D;  1RAD B;  4RG2 A;  2E6Z A;  2YXY A;  1HYO A;  2LQW A;  2DL5 A;  1QVF P;  4M7A G;  1NLO C;  5GMK j;  1IB8 A;  2OTL T;  4LDW A;  4C8Q G;  1K4U S;  1OUL A;  1FMK A;  2GCX A;  2DET A;  3QYH B;  4AT1 B;  1D1A A;  2V8I A;  2RK2 A;  2GBQ A;  1RI9 A;  1D3B A;  2DKG A;  1UDL A;  1YI2 A;  1GL5 A;  2O31 A;  4KUL A;  2FPD A;  5KYU A;  2JMA A;  4PJO C;  5GAN 5;  3FEO A;  2VB6 A;  3H9N A;  5CKH A;  1IRE B;  2K5F A;  1G8X A;  3PNW C;  4M78 A;  1VQO A;  2F1L A;  2EYZ A;  3OW2 S;  3G1J A;  2OJ2 A;  1Y7X A;  2J6F A;  1Z9Q A;  2HQE A;  4J5Y A;  1WXT A;  4P5N A;  2ED0 A;  3LW5 E;  5IHI A;  4N4G A;  5GAN g;  2KRN A;  2NUT A;  1VQL Q;  3UPU A;  3M59 A;  4J9B A;  1YJ9 T;  1V1C A;  3EG0 A;  3RR6 A;  2GFU A;  2FRW A;  1YJW T;  2FZK B;  2L3Q A;  4X1V A;  1NJI U;  2R58 A;  4LUE A;  2RJE A;  3QXE B;  3VUB A;  3M53 A;  2DL8 A;  2MYS A;  2PNI A;  2K2M A;  2NYS A;  1QP2 A;  3ULR B;  3ASK A;  2G6F X;  5GAM g;  3FB9 A;  4C8Q D;  2CH4 W;  3GPL A;  2JN0 A;  3GBQ A;  2X3X D;  4E7S A;  4QQG A;  1JXO A;  2EJF A;  2W0Z A;  1QW1 A;  3JCM c;  4BUG A;  1SRM A;  3FRN A;  1UHF A;  3REA B;  4JJC A;  3C95 A;  3CCQ Q;  3QYG B;  2E70 A;  3CXC S;  4DEY A;  1KQS S;  2SEM A;  4Z8A A;  4A54 A;  3GP8 A;  2KRO A;  2ZAE A;  1UTI A;  3C12 A;  2CRE A;  3NFC A;  1KQ1 A;  1UJ0 A;  2XG8 D;  2X3W D;  3I9Q A;  1PSF A;  2KGT A;  1VQN T;  2P0K A;  1W2B P;  1LPL A;  1UUE A;  1N27 A;  4A4K A;  2AT1 B;  4A63 B;  1U1T A;  1MND A;  4AG2 C;  4JPB W;  4XTW A;  3MP6 A;  2DXU A;  1N6A A;  3CCJ A;  2GFA A;  1VIF A;  5FLX E;  2JS0 A;  1RAG B;  3QPH A;  2PUO B;  5J3B A;  5D6Y A;  3I55 Q;  2RA2 A;  1K8A U;  3PFS A;  1K8A C;  4OML A;  4ZTF A;  4BE1 A;  5I2S A;  4D6W A;  3MEW A;  3JSC A;  1NYF A;  1B7T A;  1PCX A;  2RQU A;  4FSS A;  4JZ4 A;  2XU8 A;  2JMC A;  2EBP A;  3JCM d;  2KQW A;  5EC7 A;  4M77 B;  3OBY A;  4C5G A;  2EFI A;  1X6O A;  5KYX A;  4M7A F;  4BE0 A;  1YP5 A;  2RQT A;  3FJP A;  1TS9 A;  2AKL A;  4E47 A;  2FO0 A;  3MPU B;  3X26 B;  2JOY A;  2OTJ Q;  4M77 D;  4EDU A;  1YI2 Q;  4EMK B;  4RTW A;  3S3M A;  4PLL A;  3EFO B;  3MHX A;  2RMO A;  5DLO A;  4M75 G;  3BY7 A;  1VQO Q;  3NMZ C;  5LJ5 g;  1Z9Z A;  2IVW A;  4OGE A;  3OYA A;  3TRE A;  1W1F A;  1VQ8 A;  4J7F A;  4Z89 A;  4HVW A;  4PJM A;  3ZEH A;  4PJO G;  3EGD A;  4IUQ A;  3UAT A;  4RTY A;  4PFP A;  3VU3 C;  4R56 A;  1JJ2 A;  5GAN 8;  1WJS A;  3CCU T;  5GMK i;  1NLP C;  3V7C A;  5GAO r;  1ZA2 B;  1JU5 C;  1IGQ A;  3A8M B;  1M90 U;  1M90 C;  1K9A A;  1HJD A;  1JXM A;  2RHI A;  1TOV A;  1JBM A;  5CO7 A;  1ZQ1 A;  2QQB A;  3MP1 A;  3QDF A;  4QVZ A;  1YIJ A;  2JZ2 A;  1FYN A;  2BE9 B;  2VYT A;  4FU6 A;  3CQT A;  2E6N A;  3ME9 A;  2DZC A;  1Q82 C;  2YLB A;  5CVI A;  2RQR A;  1I1J A;  2R5A A;  4M78 E;  1X6G A;  5GAM h;  5LJ3 e;  3EG3 A;  2FZC B;  2A37 A;  1ZLM A;  2QTX A;  2AKK A;  1KIK A;  4C0D C;  2VC8 A;  4HVV A;  4ORZ A;  1E7O A;  4ZN3 A;  4FL6 A;  4YTL A;  3A8O B;  4BB7 A;  4R55 A;  1GRI A;  2YT6 A;  1VYT A;  3CC7 T;  4ESR A;  1OPK A;  3IQL A;  2J7I A;  3QHS A;  1TTH B;  4EMK A;  3GNG A;  2H3E B;  2RHZ A;  1IRX A;  3OYG A;  2ABL A;  3RDV A;  4JJB A;  2X35 A;  1K9M R;  3UA7 A;  1KC8 U;  4FM4 B;  1W70 A;  2I0N A;  1ZUU A;  1GCQ C;  4JZ3 A;  3WVE B;  2XDD A;  3M4Y A;  4AG1 C;  1YJN T;  2LDM A;  4KGZ B;  2M1H A;  3CCJ Q;  3CPF A;  1YNZ A;  3OYY A;  3J81 E;  3OW2 A;  1WHG A;  5GJW B;  1TSF A;  2XDB A;  4DBQ A;  2R57 A;  1RI0 A;  2QQS A;  2EJ9 A;  4M78 C;  4ATO A;  1G5V A;  1D1C A;  3SD4 A;  3JCM e;  4C0G A;  5KYW B;  2K79 A;  2OTL A;  2M51 A;  2K9G A;  3QDR B;  1QVF S;  3MET A;  2KXC A;  2VWF A;  2E5Q A;  1OZ2 A;  2KI7 A;  4RMO A;  2GTJ A;  1U06 A;  1T3S A;  1WLP B;  4C92 B;  2YUQ A;  2O88 A;  3HFO A;  1X2K A;  3V7R A;  3HFN A;  1XTD A;  5LJ3 g;  1QCF A;  2WAC A;  1WHL A;  4XAX B;  1X2Q A;  3ER0 A;  2HBP A;  2IG0 A;  1VQ8 Q;  3KXT A;  3L2Q A;  1BB9 A;  1Y0M A;  3QO3 A;  1FMW A;  3VV0 A;  4AMC A;  1KQS A;  2BTT A;  4MZM A;  4Y91 A;  1A0N B;  2FYK A;  4PFZ A;  4QVD A;  3RBB B;  3D7S B;  1VA7 A;  4PJO F;  1GXI E;  2D9T A;  4RKU E;  4ZGD B;  3JB9 H;  2E5K A;  4A4G A;  1E6H A;  1M1K U;  3E9G A;  1M1K C;  1VYV A;  1KHI A;  3OYH A;  1YHQ T;  2XMF A;  5D6W A;  2YUO A;  1WXB A;  1H92 A;  3E2U A;  2M02 A;  1SPK A;  4DBH A;  2CKK A;  4PFO A;  2DL4 A;  5GAO q;  2L89 A;  2JJ9 A;  3DB3 A;  4PLI A;  1UJY A;  1VQ6 A;  1G3Y A;  2HCK A;  1D09 B;  2K3X A;  2EVR A;  2CP5 A;  3M5A A;  3RUX A;  4F7U B;  1VQ9 A;  2A0F B;  1WHM A;  3QG1 A;  1BCO A;  3JCM g;  2RPN A;  1NPR A;  2ROT A;  1RAC B;  3VS7 A;  4C92 A;  1BK2 A;  2O2O A;  2LX9 A;  1NEG A;  2RHY A;  1VQN A;  1AOJ A;  1UGV A;  2QA4 T;  1Q7Y C;  1ZUK A;  4QQD A;  3CEY A;  2AIR B;  1W2B S;  1X43 A;  3JCM Q;  1QKW A;  1WIE A;  2C0O A;  2L0A A;  1R0B G;  2HSE B;  1OOT A;  2JT4 A;  1PM3 A;  2EQI A;  5C6S A;  1PRM C;  2FRY A;  1UHC A;  2ZGW A;  2QQR A;  2Y4X A;  2DRK A;  4XTU A;  2JW4 A;  1OEB A;  3J80 E;  5HCK A;  1HD3 A;  3L1A A;  3CME T;  2V1Q A;  4JJN K;  4IIM A;  5KYY B;  5KH6 A;  1X6B A;  5EG2 A;  2CP7 A;  3MP8 A;  2P84 A;  3S3O A;  2FZG B;  3GLX A;  4MDX A;  4LDV A;  2DL7 A;  4HCK A;  2KT8 A;  3A8L B;  2QG9 B;  1WXU A;  2OTL Q;  2JM9 A;  1RUW A;  3SWN B;  1PWT A;  1PSE A;  1OI1 A;  4M7D B;  2CP6 A;  4M78 G;  3GOX A;  1YIJ T;  3CMA T;  1C0M A;  5HK3 A;  2HEQ A;  5CKE A;  4FW2 A;  2KRM A;  4F7U A;  1GFC A;  1PD1 A;  2A28 A;  1VQ7 T;  2LJ3 A;  3JV3 A;  2CSQ A;  5HKC A;  1QP3 A;  2ESW A;  2QK0 A;  3A8H B;  4CC7 A;  2PUK B;  4LE9 A;  5GJV B;  1KD1 U;  1K73 U;  2F5T X;  4HA8 A;  2JTF A;  4LDY A;  3CCS A;  1ZBX A;  3Q1J A;  2EAY A;  2DXT A;  2V26 A;  1Q86 U;  1Q86 C;  1YJ9 Q;  1VUB A;  3OYK A;  3CCU A;  3QZ9 B;  1YCS B;  1SHF A;  5DM7 R;  4F14 A;  2O9S A;  4E7L A;  1NM7 A;  4IIO A;  1QVG P;  4M77 C;  2KMT A;  2PTK A;  1RAF B;  2XID A;  4Z88 A;  2KYM A;  4EMG A;  1XNI A;  2QQ9 A;  4Y92 A;  4KT0 E;  1WJQ A;  3PIO A;  3RMS A;  2MMP A;  2C0T A;  2X4W A;  5HY6 A;  2Z0W A;  1VYU A;  5GAN j;  1AWO A;  2CZ1 B;  5C0M A;  1AWW A;  4EMK C;  5FU6 B;  1WHJ A;  4LXC A;  5KYY A;  4LDX A;  4ELZ C;  2XKO C;  4JRP A;  4ZNX A;  2LC4 A;  1VQ6 Q;  2LCL A;  2PU9 B;  2D1X A;  3BFM A;  4BDY A;  2NUZ A;  1N8R R;  2CP3 A;  5GAN 4;  1VQ9 Q;  1ABO A;  3SWN A;  2DVJ A;  4M7D A;  4FYW B;  2CS7 A;  2CUB A;  2CZ6 B;  5HK0 A;  5GMK e;  1CKB A;  1I07 A;  3WVD B;  2YHT A;  2YSQ A;  3MEA A;  3CC7 A;  1GCQ A;  3JCM h;  5AT1 B;  1QVF A;  3LLR A;  2BIV A;  8AT1 B;  3G6E T;  4MZT A;  2DTO A;  3HPW A;  1VQN Q;  1H64 1;  1QWE A;  2WSF E;  3LH5 A;  4CC4 B;  4KGV B;  2PVD B;  1VQP T;  2ZPG B;  4B9X A;  1YJN A;  1GBR A;  1SSF A;  1ZSG A;  1BBZ A;  3V8K A;  3OYM A;  1VQ5 T;  4XU0 A;  1EIF A;  3OYF A;  3QII A;  4J9C A;  5GAN 6;  4BDZ A;  3RKW A;  1ZUY A;  1M5Q 1;  3REB B;  1UGS B;  1G83 A;  1V29 B;  3DB4 A;  1R0C B;  2EGC A;  4C92 E;  3CCV T;  1LJO A;  2P0Q A;  5KE3 A;  5IAY A;  2GQV A;  4JDS A;  1MMA A;  4J9F A;  2DTI A;  1SEM A;  4PJJ A;  3OS0 A;  2DXC A;  1NJI C;  4C8Q B;  3J7A F;  4KH1 B;  1M8M A;  3HRS A;  4AFS C;  3BDL A;  4D8D A;  4M7A D;  3G4S T;  3PVQ A;  5LL6 S;  2ENM A;  4Q5W A;  1X27 A;  3BE3 A;  4M78 F;  4LD9 K;  4J8O A;  2GQI A;  3S3N A;  2V8K A;  3FDR A;  1VQ6 T;  3JB9 F;  4IUU A;  2EQU A;  3P8D A;  2M16 A;  3UDC A;  1VQ9 T;  3CCS Q;  3PTA A;  2F2X A;  1N9S A;  1VOM A;  1RLQ C;  3GIB A;  4PJL A;  3CC2 A;  1XOV A;  4EIK A;  2CDT A;  2HNI A;  3CCU Q;  1WQW A;  9ATC B;  5CQY A;  1BYM A;  2EPD A;  3G71 T;  3HRT A;  2Y90 A;  2LP5 A;  2C0I A;  4HCZ A;  4OVA A;  1ZA1 B;  3H0F A;  2EYY A;  2CSI A;  4HKE A;  1YHQ A;  5LJ5 j;  1UEC A;  2EKH A;  4C92 C;  2VAS A;  3T9N A;  1W2B A;  4F7U E;  2E10 A;  4D8K A;  5FW9 A;  2J05 A;  2LJ0 A;  5GAN 3;  1PKT A;  4A4E A;  2DYB A;  2LRQ A;  2LZ6 B;  1RL2 A;  1MMG A;  1SSH A;  2RQW A;  3INZ A;  2CZ7 B;  3MJX A;  5FU7 B;  4C8Q A;  3QSU A;  4XU2 A;  3QBY A;  4OGC A;  2KE9 A;  3PMI A;  2JVV A;  2P4R A;  5CK9 A;  1WI7 A;  1VQ4 T;  3OMG A;  1X75 C;  1B3Q A;  3CC7 Q;  4BAC A;  1E6G A;  4JS4 A;  1EFN A;  4A4F A;  1O75 A;  3E19 A;  2LCC A;  4RTX A;  4FCY A;  1M30 A;  2QA4 A;  3I56 T;  2E12 A;  1I8F A;  1UGR B;  4A4H A;  1OQK A;  3NTI A;  1YJN Q;  1Y96 B;  2Y4Y A;  1C6V X;  5IN1 A;  3UT1 A;  4IUT A;  1MHN A;  3CME A;  2E4H A;  3CCS T;  5AYF A;  1RAI B;  2EGE A;  1Q81 U;  1Q81 C;  2MF2 A;  1BIA A;  4BI3 A;  3OB9 A;  5A0D A;  3CPW S;  1T0J A;  3RKX A;  4JRK A;  3VYG A;  2MAM A;  2YRD A;  4RTU A;  3R6O A;  4RCC A;  2K2V A;  2D8H A;  1K8A R;  3VRY A;  1EZZ B;  4X9D A;  3OYL A;  4FYV B;  1AT1 B;  1K9M U;  3CMA A;  2EQK A;  2HQX A;  4ZTJ A;  5I22 A;  3RIR A;  1VQ7 A;  2JS2 A;  2X51 A;  3RKY A;  2RK1 A;  4CC2 A;  1W6X A;  3JCM W;  1IHV A;  4M75 B;  3V8J A;  1JEG A;  2C06 A;  4O5V A;  5KCO A;  3X28 B;  2WSC E;  4F04 B;  3QZ5 B;  4LNP A;  4M77 A;  4FYY B;  4PJO B;  3C0C A;  2CUD A;  4M75 D;  2LT4 A;  4DBR A;  1UE9 A;  5I2M A;  3L42 A;  1LNX A;  5LJ3 j;  3QWY A;  3JCM V;  3TVT A;  2DF6 A;  5GMK h;  1VQM T;  4PJO D;  4PJN A;  3SWN C;  1Y96 A;  4DBF A;  1QVG S;  4DOV A;  3EFO A;  4M7D C;  3OS1 A;  1YHQ Q;  3F70 A;  4CRI A;  5KE2 A;  4DA4 A;  1KC8 C;  4BY6 B;  3CD6 T;  1M90 R;  2HL5 C;  2JXB A;  2M0O A;  2KVQ G;  5J39 A;  1BI0 A;  2V8J A;  4XTZ A;  4DQ2 A;  1NPP A;  4C92 G;  1KQ2 A;  2MWO A;  1CSK A;  3FJ5 A;  4JJD A;  2FB7 A;  4NL3 A;  4M77 F;  2KNB B;  1YFN A;  1Q82 R;  1RAH B;  4WTO B;  1MV3 A;  4KBM B;  1TXQ A;  2HL3 A;  1M2V B;  1TUC A;  3OQ5 A;  1YWO A;  2F2W A;  2F2V A;  4B6M A;  2ECZ A;  2A36 A;  3SDZ A;  2PVO B;  3G6E A;  2DNU A;  3ZL7 C;  3P8B B;  1MNE A;  4IUP A;  4NOY A;  2QA4 Q;  4N0A A;  2ZPE B;  2QI2 A;  3CBM A;  1VQP A;  1PRL C;  4ELY C;  2E41 A;  2L2P A;  1VQ5 A;  5FU6 C;  4FSX A;  3VUZ A;  1WDX A;  2K7A A;  1TG0 A;  2DD5 A;  2DER A;  3CME Q;  2ATC B;  5L8R E;  3CXC A;  1T3L A;  1XJW B;  3M54 A;  2VVK A;  3X25 B;  4XU1 A;  7AT1 B;  2KYB A;  2LQ8 A;  4FIB A;  5DLQ E;  4AFU C;  3CCV A;  3M56 A;  1M9S A;  3CC2 T;  4XTV A;  2QEX T;  1SHG A;  2YLC A;  1M27 C;  2EJG A;  3QJ6 A;  1ZSZ B;  4DEX A;  2AHJ B;  5GAN f;  3HHT B;  3M4G A;  4F7U G;  2FHD A;  3HP9 A;  3QJY A;  3MKD A;  1UG1 A;  2MIO A;  2O01 E;  3G4S A;  2HQH A;  3RNJ A;  3CMA Q;  1YIJ Q;  4ZGE B;  3DKM A;  2HDA A;  2HMA A;  2D8J A;  2DA9 A;  1VQ7 Q;  1HSQ A;  3V7S A;  2L3S A;  4E7K A;  2HAX A;  3VS6 A;  1D0Y A;  2ZPF B;  5GAM f;  3VYH B;  1B34 B;  1BKB A;  1SF9 A;  1IZ6 A;  2KK4 A;  2RH2 A;  2FPE A;  3I5R A;  5KYW A;  3TCJ A;  5GAO n;  3MCA B;  1YN8 A;  4N4I A;  3S6W A;  4JLI A;  2RI5 A;  3NHN A;  4C0F A;  3M0R A;  3M57 A;  2KXD A;  1D0X A;  2LT1 A;  2HBW A;  2BZY A;  2DZ9 A;  2K6D A;  3NPF A;  2VV5 A;  3G71 A;  3TEE A;  1NZ9 A;  4C8Q C;  4DOW A;  2ZCF B;  2A3L A;  2X4X A;  2XHC A;  3CCE A;  3TQ7 P;  2GGR A;  1KHC A;  1H3Z A;  4MML A;  4LDU A;  2RJD A;  4LUD A;  4C5I A;  1NEB A;  2ZPI B;  5GAO m;  1S72 T;  1LOJ A;  5CKD A;  1PKS A;  3MEU A;  2KSS A;  1M1K R;  3PE0 A;  4M7D G;  3CBP A;  3OYB A;  1BI2 A;  3HL8 A;  1M8V A;  4CI0 C;  3OBW A;  3A98 A;  3M55 A;  4M77 E;  3VS0 A;  4JRQ A;  3KUF A;  2VGM A;  2DE0 X;  2LVM A;  1UFF A;  4C92 F;  2QAZ A;  1FMV A;  1AWX A;  3CPW P;  1VQ4 A;  1C1A A;  4ZGJ B;  4Y28 E;  2COY A;  2DIL A;  3OSV A;  8ATC B;  2I2L A;  1M4Z A;  3EHR A;  4J7I A;  3AHU A;  1ZBJ A;  5L23 A;  3G6E Q;  1HK9 A;  3G7Z A;  4L6V 5;  3VS1 A;  2J6O A;  3I56 A;  2COW A;  3M9Q A;  4MZP A;  3EG9 B;  2QQA A;  3TSZ A;  1QVP A;  1B34 A;  2B8A A;  1BI3 A;  2NLU A;  3JB9 G;  1VQP Q;  3OYJ A;  1RLP C;  1CKA A;  1VQ5 Q;  2LMJ A;  2D0N A;  1IHW A;  3UF4 A;  2KAF A;  1UGP B;  3H0H A;  3MO8 A;  1Q7Y R;  1KD1 C;  1K73 C;  2NUP B;  2ZPB B;  1J3T A;  2A08 A;  1OX8 A;  2KT1 A;  1N8R U;  3H6Z A;  5IH2 A;  3CCM T;  1OYX A;  1Y07 A;  1GBQ A;  2GF7 A;  3C4S A;  3CCV Q;  2HKN A;  1WPY A;  4RG8 A;  3A5Z B;  1NG2 A;  5LJ5 f;  4EMH A;  1VIE A;  5A0G A;  2K4Y A;  3V8L A;  4C5E A;  3OS5 A;  3OYE A;  2DD4 A;  2XIC A;  5KYU B;  3DLM A;  1BIB A;  1D0Z A;  2QGG A;  1QVG A;  1VQK T;  5LJ5 d;  2AZV A;  3G4S Q;  4F7U F;  3FIF A;  1WZO A;  3VS2 A;  4PL6 A;  5KCH A;  3CCR T;  2CT3 A;  3VJP A;  1QMC A;  4JS5 A;  2L5Q A;  4M78 D;  2YRV A;  2K57 A;  2LQK A;  2X4Y A;  4J9G A;  3LYI A;  2RI2 A;  4RTT A;  3SHW A;  3JRZ A;  1WA7 A;  4HCB A;  2LJ1 A;  1QCN A;  3EGX B;  2O4X B;  5GAM j;  4RTZ A;  1N5Z A;  3H0I A;  4RTV A;  1M1F A;  3OS2 A;  3X24 B;  2YUN A;  1VQM A;  4ME7 A;  3G71 Q;  3L2W A;  4OB0 B;  4KRT A;  1UGQ B;  5IT9 E;  3A1P A;  1WJR A;  1Q86 R;  1I5O B;  2E1H A;  1RAA B;  1JRI A;  4JUV A;  3X20 B;  1U8R A;  4E7Z A;  2QTV A;  3CD6 A;  2NUP A;  4LD6 A;  3JAM E;  1M3B A;  3OYD A;  4GY5 A;  4N0A C;  1ZX6 A;  4HXJ A;  5M9O A;  1NBE B;  2BKD N;  4M75 C;  2KBT A;  1MMN A;  4CC3 A;  2RD1 A;  3DLL A;  2OTJ A;  1G3T A;  1HXD A;  5CKB A;  4M7D F;  4II1 A;  3KBG A;  2LQN A;  3SFM A;  2OAW A;  1KG1 A;  4OF1 A;  2DBK A;  1VQ4 Q;  1IO6 A; 
#chains in the Genus database with same CATH homology
 1X2K A;  2LNH B;  2GNC A;  1X69 A;  4RUG A;  3VS5 A;  2EGE A;  2IIM A;  3I35 A;  1QCF A;  4F16 A;  1H8K A;  5IXB A;  1X2Q A;  1T0J A;  4OMO A;  4RTU A;  2D8H A;  1BB9 A;  1Y0M A;  3VRY A;  3VS4 A;  1K76 A;  5IHK A;  2BTT A;  1A0N B;  2RNA A;  3RBB B;  1G2B A;  2MCN A;  2JTE A;  1AZE A;  4M4Z A;  2NWM A;  1VA7 A;  2HSP A;  1WFW A;  1MV0 B;  1QKX A;  2PZ1 A;  5I22 A;  4K11 A;  1ARK A;  1WX6 A;  2E5K A;  2JS2 A;  2FG0 A;  1TUD A;  1E6H A;  4CC2 A;  1VYV A;  2BZX A;  1W6X A;  1U5S A;  3EG2 A;  2XMF A;  1JEG A;  4GLM A;  2YUO A;  1WXB A;  2K3B A;  1H92 A;  1I0C A;  1AZG B;  1OPL A;  1SPK A;  4LNP A;  2DL4 A;  2BZ8 A;  3C0C A;  2CUD A;  2O9V A;  1UJY A;  1UE9 A;  3PVL A;  2SRC A;  4HVU A;  1GFD A;  2HCK A;  4QT7 A;  4OMQ A;  3NGP A;  3QWY A;  2EVR A;  2RN8 A;  1YWP A;  3TVT A;  2DF6 A;  2FPF A;  2CH4 A;  1U3O A;  2RPN A;  1QLY A;  2ROT A;  3QWX X;  3VS7 A;  2AK5 A;  5FWC A;  3TSW A;  1BK2 A;  2O2O A;  2W10 A;  4F17 A;  5ECA A;  2JXB A;  1K0S A;  2EYX A;  2DBM A;  1NEG A;  1K1Z A;  3M0T A;  1AOJ A;  1UGV A;  1ZUK A;  1CSK A;  2LQW A;  2DL5 A;  3FJ5 A;  4JJD A;  1X43 A;  2KNB B;  1QKW A;  1WIE A;  1NLO C;  2C0O A;  2L0A A;  4R0K A;  1K4U S;  1FMK A;  1OOT A;  2JT4 A;  1MV3 A;  2DM1 A;  2EQI A;  2GBQ A;  1PRM C;  1RI9 A;  2FRY A;  1UHC A;  1TUC A;  2DRK A;  1YWO A;  2F2W A;  1UDL A;  1OEB A;  2F2V A;  2JW4 A;  5HCK A;  1HD3 A;  2ECZ A;  1GL5 A;  2A36 A;  2O31 A;  2FPD A;  2V1Q A;  2DNU A;  4IIM A;  2JMA A;  3ZL7 C;  1X6B A;  2YDL A;  1ABQ A;  3H41 A;  2DL7 A;  4HCK A;  3M0S A;  2KT8 A;  2EYZ A;  2AZS A;  1WXU A;  2OJ2 A;  1PRL C;  2J6F A;  1Z9Q A;  2L2P A;  1WXT A;  2JM9 A;  2ED0 A;  1RUW A;  2OI3 A;  1PWT A;  1WYX A;  5IHI A;  2KEA A;  2KRN A;  1WDX A;  2K7A A;  4J9B A;  1TG0 A;  1V1C A;  3EG0 A;  2FRW A;  2L3Q A;  4X1V A;  2HEQ A;  5FWB A;  2FEI A;  5IXF A;  2KRM A;  3I5S A;  2CT4 A;  1M3C A;  1T3L A;  2VVK A;  1GFC A;  2A28 A;  4LUE A;  2KYB A;  2LJ3 A;  3JV3 A;  2CSQ A;  3M0Q A;  4AFU C;  1S1N A;  2ESW A;  2DL8 A;  4CC7 A;  2PNI A;  2K2M A;  4LE9 A;  4OMP A;  2RQV A;  5GJV B;  1GCP A;  1SHG A;  3ULR B;  2G6F X;  1M27 C;  2V1R A;  2MOX A;  2CH4 W;  3GBQ A;  4DEX A;  1AWJ A;  2X3X D;  3R6N A;  4J9H A;  1JXO A;  1UG1 A;  2MIO A;  1MUZ A;  2W0Z A;  3VRZ A;  3RNJ A;  1SRM A;  1YCS B;  1SHF A;  1UHF A;  3REA B;  4F14 A;  1PNJ A;  2HDA A;  4JJC A;  2O9S A;  2D8J A;  1NM7 A;  2DA9 A;  4IIO A;  4DEY A;  4LN2 A;  1HSQ A;  2L3P A;  2L3S A;  2SEM A;  3VS6 A;  2PTK A;  2EW3 A;  4Z8A A;  4Z88 A;  2KYM A;  4AFQ C;  4Y92 A;  2KRO A;  1B07 A;  4GBQ A;  2C0T A;  1UTI A;  2CRE A;  2FPE A;  3I5R A;  1UJ0 A;  1VYU A;  2KR3 A;  1AWO A;  1YN8 A;  1AWW A;  2X3W D;  3I9Q A;  3NHN A;  2KGT A;  3M0R A;  2KXD A;  1JO8 A;  4ZNX A;  2HBW A;  4AFZ C;  2BZY A;  2K6D A;  3NPF A;  2D1X A;  2J6K A;  2RF0 A;  1UUE A;  4A63 B;  2NUZ A;  4AG2 C;  4JPB W;  2H8H A;  1ABO A;  4OMN A;  3VS3 A;  2DVJ A;  2J06 A;  2GGR A;  3SEM A;  2CUB A;  2JS0 A;  1CKB A;  1I07 A;  2YSQ A;  4LUD A;  1GCQ A;  1NEB A;  1H3H A;  4OML A;  1PKS A;  4J9D A;  3PE0 A;  1QWE A;  4J9E A;  1NYF A;  1KFZ A;  2RQU A;  3LH5 A;  4FSS A;  4JZ4 A;  4CC4 B;  3A98 A;  2JMC A;  3VS0 A;  2EBP A;  2VKN A;  1GBR A;  1BU1 A;  1ZSG A;  5EC7 A;  1BBZ A;  2DE0 X;  1UFF A;  2DX1 A;  1AWX A;  1YP5 A;  2ED1 A;  2KRS A;  2RQT A;  4J9C A;  2AKL A;  1K0X A;  2FO0 A;  2DIL A;  1ZUY A;  3EHR A;  3REB B;  1ZBJ A;  5L23 A;  4RTW A;  3VS1 A;  2J6O A;  1M3A A;  1G83 A;  2EGC A;  3TSZ A;  2RMO A;  3M0P A;  4J9F A;  3EHQ A;  1SEM A;  3NMZ C;  1Z9Z A;  1W1F A;  1RLP C;  1CKA A;  1NYG A;  2DJQ A;  1M8M A;  4Z89 A;  4HVW A;  3EGU A;  2LMJ A;  2D0N A;  2EGA A;  3UF4 A;  2JM8 A;  3UAT A;  3H0H A;  4AFS C;  4RTY A;  4D8D A;  4E6R A;  3PVQ A;  2ENM A;  1AEY A;  1J3T A;  1X27 A;  2A08 A;  1NLP C;  2KT1 A;  1JU5 C;  1K9A A;  1HJD A;  1T0H A;  5IH2 A;  1JXM A;  2GQI A;  1GBQ A;  1KJW A;  1NG2 A;  3O5Z A;  1FYN A;  3EG1 A;  3CQT A;  4OMM A;  5I11 A;  2F2X A;  2RQR A;  1I1J A;  2M0Y A;  2YUP A;  1X6G A;  1PHT A;  1RLQ C;  3EG3 A;  1XOV A;  2GTO A;  4EIK A;  2AZV A;  2A37 A;  1ZLM A;  2CDT A;  2AKK A;  1KIK A;  3VS2 A;  2EPD A;  1AD5 A;  2CT3 A;  2EYW A;  4HVV A;  4ORZ A;  1E7O A;  2LP5 A;  2C0I A;  2LX7 A;  3H0F A;  2EYY A;  2CSI A;  1UEC A;  1GRI A;  2DL3 A;  1Y57 A;  2EKH A;  2DMO A;  2YT6 A;  4J9G A;  5IHN A;  4RTT A;  3SHW A;  1VYT A;  1WA7 A;  4ESR A;  1OPK A;  3IQL A;  2J7I A;  2LJ1 A;  4D8K A;  5FW9 A;  4RTZ A;  1N5Z A;  2J05 A;  2LJ0 A;  3H0I A;  1PKT A;  2ABL A;  4RTV A;  4JJB A;  2DYB A;  3UA7 A;  2YUN A;  2LZ6 B;  1W70 A;  2I0N A;  1ZUU A;  1JQQ A;  3KFV A;  1GCQ C;  4JZ3 A;  1SSH A;  2RQW A;  4KRT A;  1AVZ C;  4AG1 C;  2QDL A;  2DRM A;  2KE9 A;  1SRL A;  2P4R A;  1YNZ A;  2B86 A;  1WI7 A;  3THK A;  3U23 A;  1LCK A;  1B3Q A;  1QWF A;  5GJW B;  1E6G A;  1EFN A;  1M3B A;  4RTX A;  4WCI A;  1M30 A;  1ZX6 A;  4HXJ A;  1KSW A;  2KBT A;  4CC3 A;  2K79 A;  4J9I A;  2M51 A;  3M0U A;  2K9G A;  2KXC A;  2VWF A;  2ROL A;  2LCS A;  1OV3 A;  2LQN A;  2GTJ A;  2OAW A;  2DLP A;  1U06 A;  1T3S A;  1WLP B;  2YUQ A;  3UA6 A;  2DBK A;  2O88 A;  1IO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...