2JT4A

Solution structure of the sla1 sh3-3-ubiquitin complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
MASKSKKRGIVQYDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEPVRDKKHTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoskeleton assembly control protein SLA1
publication title Structural Basis for Ubiquitin Recognition by SH3 Domains
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 13
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jt4A00
1M3BA 4FSSA 1WXBA 2AZSA 1M3AA 5ECAA 1SRMA 2FRYA 3I35A 1T3SA 1MV0B 1UHCA 1W1FA 2AK5A 2G6FX 1QWFA 2GTJA 3H41A 2J6OA 1RLQC 1H92A 4JZ4A 1KFZA 4J9CA 4LNPA 4ZNXA 1BBZA 1J3TA 1SHFA 4J9EA 1GL5A 3NGPA 3EHQA 2L2PA 3I9QA 3TVTA 1BK2A 3TSZA 1ZUKA 1YP5A 1Y0MA 1M8MA 2LJ1A 1JO8A 2DL8A 2A28A 1VYVA 1E6GA 1FYNA 2J6KA 1PKSA 1ZBJA 1I1JA 4K11A 1GFDA 1NEGA 4RTTA 1U5SA 2EYZA 2CSQA 4KRTA 2DE0X 2GGRA 3JV3A 1ABOA 1LCKA 4AG1C 1ABQA 2LCSA 1H3HA 1WYXA 1A0NB 1N5ZA 2RMOA 1E6HA 2K6DA 4LN2A 4AFSC 1UE9A 2HDAA 2F2XA 1GRIA 2OJ2A 1X6BA 2P4RA 5I11A 1NYFA 3QWYA 2SEMA 3LH5A 2KR3A 2L3QA 1K4US 1ZUUA 2RQRA 2CH4A 1SHGA 2C0TA 1JXMA 1OPLA 2KT1A 4D8KA 2RQVA 2DRKA 4IIMA 2KE9A 2LZ6B 2EGCA 2D0NA 2CT4A 3NPFA 5HCKA 2DL7A 2EYXA 1WA7A 2YUQA 2FPDA 3R6NA 1JU5C 3VS4A 2KYMA 2A37A 2CDTA 1G2BA 1QKWA 2K3BA 1AWWA 2J6FA 2PTKA 3EG2A 2DF6A 1X43A 2DLPA 4Z8AA 4J9DA 4LUDA 1Y57A 2AKLA 2CREA 1AVZC 1Z9QA 2J7IA 2O2OA 4J9GA 1E7OA 1YCSB 5GJWB 1GCQC 4RUGA 2LQWA 4RTYA 3QWXX 2H8HA 2LQNA 3U23A 4Z88A 2K9GA 4J9IA 2JS2A 1QLYA 4RTUA 2LX7A 4GBQA 5GJVB 4J9HA 2HSPA 2K2MA 1UTIA 2BZ8A 2KXDA 2F2WA 4RTVA 2KYBA 2CUDA 2A36A 4RTXA 4A63B 2BZXA 1GBRA 1PKTA 1V1CA 2M51A 1T3LA 1Z9ZA 2CUBA 2DL5A 2EGAA 3M0RA 2KRNA 1SSHA 1AEYA 2KRSA 4OMQA 3EG0A 1I0CA 1SRLA 2VVKA 4IIOA 3PVQA 2L3SA 2EW3A 2K7AA 2PZ1A 5IHIA 1AOJA 1BB9A 3I5SA 2V1QA 1JXOA 5IH2A 4Y92A 1GBQA 2DA9A 2FPEA 2LMJA 2BTTA 5I22A 1AWJA 1WXUA 1X2KA 1WIEA 3VS0A 4JZ3A 4F17A 1RLPC 2O31A 1JEGA 2KEAA 1NLPC 4ORZA 1KIKA 5IHNA 2EYYA 2RQWA 1K76A 1K1ZA 2YT6A 1WDXA 1SPKA 1YNZA 1QKXA 2EKHA 2DMOA 1W70A 1OPKA 2FO0A 1X27A 1WFWA 2ABLA 2KT8A 1BU1A 1M3CA 4CC4B 1RI9A 2YSQA 3PE0A 3RNJA 1ZUYA 3NMZC 1UUEA 4RTWA 1HD3A 2DL3A 4WCIA 1IO6A 4JJCA 1CKBA 4ESRA 3ULRB 2JTEA 1GCPA 2YUPA 4X1VA 1NG2A 2D1XA 2CT3A 2KNBB 2DVJA 3KFVA 3SEMA 1EFNA 1PWTA 3RBBB 2OAWA 2V1RA 2RPNA 1AZEA 4HVWA 2VKNA 4HVUA 2D8HA 2J06A 4HCKA 1VYTA 3VS6A 2B86A 1AD5A 3ZL7C 2KXCA 4DEYA 1M27C 3THKA 3NHNA 1GFCA 3M0SA 4EIKA 2NUZA 2EGEA 2DBKA 1SEMA 3IQLA 2JMCA 4AFZC 2HCKA 3UA7A 2KBTA 1K0SA 2YDLA 3M0QA 2LP5A 2X3WD 1OV3A 2RN8A 4AG2C 4GLMA 1ZX6A 1VYUA 2KRMA 3EG1A 2EBPA 1AWXA 1CKAA 1W6XA 4OMNA 4OMOA 1AZGB 1YWPA 2MIOA 4F16A 2SRCA 4J9FA 3VRZA 1RUWA 2L0AA 1UJ0A 1PRMC 2C0IA 2DRMA 1GCQA 4OMLA 1ARKA 1HJDA 5EC7A 1K9AA 2HBWA 2PNIA 2A08A 2F2VA 1QWEA 2AKKA 3VS7A 4F14A 2JMAA 3GBQA 3UATA 2XMFA 1WI7A 2QDLA 2DNUA 2OI3A 2D8JA 4OMMA 3PVLA 3SHWA 3VS1A 1AWOA 3REBB 2DBMA 2ROTA 3A98A 4CC2A 1M30A 2ENMA 3FJ5A 3EG3A 4JPBW 2IIMA 4E6RA 2LNHB 4HVVA 2JT4A 1X6GA 2HEQA 1B07A 3VS3A 3VS5A 3H0IA 1OEBA 1TUCA 2GQIA 4JJDA 1NEBA 4JJBA 1UG1A 1OOTA 2O9SA 3O5ZA 4LUEA 1VA7A 1UGVA 2ESWA 1UHFA 3EHRA 3H0FA 1PNJA 4Z89A 2DM1A 4DEXA 2JM9A 2YUOA 1JQQA 2FRWA 1WXTA 1NLOC 1CSKA 1MUZA 1XOVA 2KGTA 1UECA 3EGUA 2ECZA 2W10A 2MCNA 4LE9A 3VRYA 1U06A 1S1NA 2W0ZA 1MV3A 2RNAA 5IXFA 2EPDA 3M0TA 1X69A 2JM8A 4RTZA 4R0KA 5IXBA 4OMPA 1T0HA 1I07A 2EYWA 5FWCA 2RQUA 1X2QA 1UJYA 2DYBA 5FWBA 1NM7A 1U3OA 1WX6A 1TG0A 1PRLC 2CSIA 3M0PA 3M0UA 1FMKA 2I0NA 4D8DA 4CC3A 4AFQC 2FPFA 2DILA 2LJ0A 2VWFA 2MOXA 2KROA 2JW4A 4CC7A 2ED0A 2AZVA 1KJWA 4J9BA 3TSWA 3UF4A 2DJQA 2RF0A 5IHKA 2RQTA 1YWOA 2YUNA 2L3PA 1UDLA 1TUDA 2EVRA 1H8KA 2EQIA 1HSQA 2ROLA 2BZYA 5L23A 2J05A 2E5KA 1KSWA 2NWMA 2O9VA 4AFUC 2JXBA 1PHTA 2FEIA 2O88A 1YN8A 2GNCA 1UFFA 3CQTA 3H0HA 2CH4W 3I5RA 1QCFA 4M4ZA 2JS0A 4HXJA 1T0JA 3REAB 1NYGA 1ZSGA 3C0CA 2LJ3A 1B3QA 1G83A 2GTOA 1WLPB 2DX1A 4QT7A 2FG0A 1ZLMA 5FW9A 1K0XA 3UA6A 3VS2A 2C0OA 2K79A 2GBQA 2ED1A 2M0YA 2X3XD 2DL4A
chains in the Genus database with same CATH superfamily
1O9SA 1WXBA 2AZSA 1M3AA 5LJ5f 2FRYA 2G6FX 2AK5A 1QWFA 4PJLA 1RLQC 2EQUA 3S3NA 2ATCB 3OMGA 4DA4A 4ZNXA 1BBZA 3CC4A 1SHFA 4J9EA 4PLIA 1GL5A 4GLKA 2L2PA 1I81A 1Q86R 1WHKA 2ZGWA 1G3TA 3QZ5B 4DBQA 3TSZA 5FLXE 1K9MR 4BE0A 3FJPA 2XDPA 2AT1B 1FWZA 1MMDA 1RAIB 4ZTFA 1MMGA 2JVVA 1E6GA 3SD4A 3FB9A 2NUPA 1N8RC 5GAMg 3ZFJA 1VQ5T 1C0MA 4KRTA 2DE0X 2GGRA 1A0NB 1WHMA 4F7UG 2CKKA 1D0ZA 1XTDA 1QVFA 2P4RA 1NYFA 3QDFA 3X24B 1YJ9T 2CP3A 4FSXA 2CH4A 1RAAB 4IIMA 2KE9A 1VQMA 3CC4Q 2LZ6B 2RK1A 4O5VA 2EGCA 1Q82U 2CT4A 2HKQB 2KDSA 4N4IA 2DL7A 1WA7A 2YUQA 1GXIE 3VYHB 2KYMA 1G2BA 1QKWA 3RERA 1SKUB 2DLPA 4N0AC 4HCZA 1BKBA 2D0QB 2CREA 2OTJA 2EQJA 5DLOA 2CP2A 2HZYA 1JJ2S 1WQWA 2XDBA 4RTYA 4KGZB 5GMKm 5CCAA 3VV0A 1N9RA 3U23A 4Z88A 2E64A 4J9IA 2LX7A 1YJNT 4GBQA 5GJVB 4J9HA 1AT1B 1UTIA 2HKNA 2K3XA 2F2WA 1ZA1B 2F5KA 2CUDA 5GAOm 3LX7A 3CCVT 3OYEA 4BACA 3V7RA 1T3LA 2K3YA 1YI2T 1Q81C 2BE7D 2DL5A 3KBGA 3M0RA 2MMPA 2WACA 1S72T 1MHNA 2VXEA 3CCLQ 4JJNK 3META 2FHDA 2KAFA 4JRQA 5LJ3j 1VQ7A 3OY9A 5IHIA 1D0XA 2JTMA 2OTJQ 3OS1A 4A4GA 2XHCA 3QHSA 2WSFE 4BI3A 1GBQA 3DB3A 2FPEA 1QCOA 1WXUA 1DJ7B 3BE3A 2ZZDA 4UC4A 3INZA 1NLPC 1YHQQ 3BW1A 1YIJA 2RQWA 2G3RA 4ELYC 1OU8A 4FIBA 3TU4K 2EKHA 2CZ1B 1OPKA 4IUPA 3QUIA 1D1CA 1X27A 4ZN1A 3SWNC 3PE0A 3RNJA 1C1AA 1HD3A 1H641 3EG9A 3CXCA 2OX7A 2E6ZA 2DD5A 4M78G 5FU6C 3ULRB 2JTEA 3OSSC 4ESRA 1KD1R 4JLIA 4X1VA 2D1XA 3RKXA 2CT3A 2QQSA 2DVJA 3KFVA 5GMKh 1EX4A 3G1JA 4PKCC 1YJWA 3X28B 1V29B 2OAWA 2V1RA 2RPNA 2D6FA 3DLLA 3QJYA 2D8HA 3UDCA 3SB2A 1IZ6A 2YLBA 4DBHA 5GMKi 1YIJQ 4QVCA 2NUZA 4IURA 3VJPA 2DBKA 1SEMA 4HCBA 5GANe 1U8RA 2JMCA 1VQ5A 4AFZC 2H3EB 2DKGA 2KBTA 4ZTJA 4BY6C 2R57A 3P8HA 1D1AA 3SFMA 2EJFA 2EBPA 1AWXA 5CKBA 4M77C 1W6XA 3JB9J 4C0DC 3OYAA 4XU0A 3VRZA 2HQEA 3NTKA 2DRMA 4OMLA 1ARKA 1K9AA 2HBWA 1MMAA 3DKMA 2DPPB 3VS7A 3GBQA 2XMFA 5LJ5e 2QDLA 2DNUA 2EJ9A 4PJOG 1PCXA 3HHTB 4BUGA 1YJWQ 3E1SA 4II1A 1ACMB 3FC3A 4M7DG 5GANd 2M02A 3A98A 4XTWA 4J6YA 2ENMA 3FJ5A 1JB0E 5GAOr 2RH2A 4E6RA 3OS2A 2LNHB 2QGFB 4HVVA 3VS5A 1VQ5Q 4B6MA 1N8RU 1D0YA 1TUCA 3TQ7P 4B9XA 4XTUA 1NEBA 3GIBA 1OX8A 5FU7B 3V8KA 1VA7A 1UGVA 1UHFA 5M9OA 2A3LA 3H0FA 3QBYA 4R56A 1M90R 4L6V5 2JM9A 5LJ5d 1WXTA 3CCVA 1BCOA 2F5TX 2QG9B 4RG8A 1UECA 4M78E 1TUGB 2ECZA 4XQ3A 3G4SQ 2PQWA 2YHTA 2YRVA 2GCXA 3FIFA 4M7AA 1S1NA 2W0ZA 3M0TA 1S72A 2JM8A 4V2SA 2KK4A 4YTLA 1WHHA 1B7TA 3CCMQ 2EYWA 5FWCA 2RQUA 1D3BB 2DYBA 1M4ZA 2E5QA 3OYYA 4Y28E 1KQ2A 4M78F 1FMWA 2MWOA 3M0UA 1UGSB 1Q82C 4CC3A 4FT2A 2PUKB 2CP7A 2NUTB 2DXBA 2QK0A 3KUFA 2VWFA 2ZPFB 5CK9A 2QQRA 3OBYA 5LL6S 4CC7A 2D9TA 2RF0A 2EIFA 2L3PA 5J39A 2EVRA 1H8KA 3RMSA 3EGDA 4F04B 2BZYA 1KSWA 8ATCB 1VQ9A 2P0QA 3CC7T 4R55A 4N4HA 2FEIA 1YN8A 1X75C 3CQTA 5GAMj 3C95A 4BY6B 4PJOE 1QCFA 3JCMb 2X4WA 4PFPA 1T0JA 4JDSA 4KUDK 3C0CA 2LJ3A 3L2WA 1G83A 4E7HA 2GTOA 4QT7A 3E19A 2EKOA 3V8JA 1Y96A 1PC0A 2QI2A 4P5NA 4Q5WA 3OQ5A 1Q7YR 2LTOA 2QXFA 2E1HA 2P4TA 1KQSP 5ECAA 2HL5C 2O4XA 1T3SA 1UHCA 2GTJA 3CCLT 2QA4T 1BYMA 4PJOF 1VQ4Q 3GF5A 5CKFA 1H92A 4F7UB 5I21A 1Q81R 1N27A 1PD0A 2DEQA 3QYHB 3JCMP 2HL3A 2XICA 5HY6A 4PFZA 3S6WA 1FMVA 3I9QA 3OB9A 4EMKA 1BK2A 4BDYA 3EGXB 1FXXA 3MEVA 2RJCA 4X9DA 1VQ9Q 3FRNA 1JO8A 2EJGA 2DL8A 4E7ZA 2J6KA 5KE3A 1IGUA 1ZA2B 1ZBJA 4K11A 1M2VB 1HXDA 3A8MB 5I2MA 2CSQA 1X6OA 1ABOA 2RM4A 4OB0B 3BFMA 2LCSA 1H3HA 1YHQT 4M78D 3A8GB 2RMOA 2LX9A 5DLQE 2K6DA 4AFSC 1OULA 1UE9A 2HDAA 3H8ZA 3QO3A 4BI8B 4PJMA 4A53A 1X6BA 2PVGB 4E7LA 1NZ9A 1TH7A 2L3QA 4PJJA 1K4US 2RQRA 3A5ZB 1SHGA 1TU0B 2KMTA 2KT1A 2RQVA 2DAQA 2DRKA 1RAEB 4A4FA 3QIIA 1IB8A 4C92A 1RABB 2D0NA 2RI5A 5KYWB 1HYOA 1SG5A 2FPDA 3R6NA 5I2SA 3VS4A 5HK0A 4FYVB 1AWWA 2K3BA 1NJIC 4NL3A 3HTRA 1X43A 5CIUA 1RAFB 4LUDA 1Y57A 4M75C 1F1BB 1Z9QA 4M7DC 3HP9A 4IUTA 2PUOB 1E7OA 3CCEA 5GJWB 2E4HA 5FROA 2E3IA 1PD1A 4PJNA 3QWXX 2DZ9A 1AHJB 1BI0A 2K5LA 1TWBA 5GANh 4EPCA 2LQNA 4OP0A 2K9GA 2JS2A 1QLYA 1YIJT 4RTUA 1VIEA 2L89A 2PVDB 4X34A 2BZ8A 3A8OB 2K5FA 4QQ6A 4QVZA 3RUXA 4PJOD 2KYBA 4HCCA 4RTXA 1KQSS 1SSFA 1OU9A 4IUUA 2BZXA 3Q1JA 5KYUB 1V1CA 2M51A 2V8IA 3PNWC 1Z9ZA 1K73R 2CUBA 2EGAA 2KRNA 1QMCA 4FT4A 3WVEB 2KRSA 4OMQA 2QQBA 2NYSA 2FZGB 2WSCE 3OYKA 2VVKA 3ER0A 3URGA 5LJ5h 3WVDB 5CQYA 2VXFA 2K7AA 3PIPA 4PFOA 4OGEA 4ME7A 2ZCFB 5KE2A 5GAN7 4OVAA 1YJWT 4LDVA 2V1QA 1JXOA 2E3HA 3EFOB 3CCEQ 2QTXA 5IH2A 4Y92A 2DA9A 2QQAA 2JTFA 1OQKA 2LMJA 4KBMB 2BTTA 1X2KA 3FEOA 2GFAA 4A4KA 4M78B 2O31A 2ZPHB 2HQHA 1JEGA 5GANg 1BI1A 3GOXA 3CC7A 2R5AA 2XD0A 2OTLT 1WHLA 4ORZA 1KIKA 2DTOA 3D7SB 1KC8U 2EYYA 1UB4A 1VIFA 3M58A 2RB6A 4MZMA 1G3YA 2YT6A 1I4K1 1WDXA 1SPKA 1YNZA 4C0GA 2IVWA 2K2VA 2DMOA 2KI7A 4DOVA 3RMQA 2H3JA 3OYBA 2EAYA 1BU1A 2KT8A 4LD6A 3CBMA 1RI9A 2KSSA 3OS5A 1M5Q1 2YSQA 1ZHIA 1UUEA 3G4ST 3QG1A 2VC8A 1FX7A 1TXQA 3JCMV 5LJ5g 3CC2A 2DL3A 3G6EA 2V26A 4WCIA 3CCQA 4JJCA 2QA4A 3CCLA 2DIGA 2HNIA 5A0GA 1NG2A 1NPPA 3SEMA 2R58A 3CCMT 1K8AU 5CVIA 3JCMc 5GMKj 2DEUA 3CCSA 4M7AG 2VKNA 4B9WA 4E7KA 1QVPA 2K5IA 3CC7Q 3ZL7C 2KXCA 4DEYA 4PJOB 4XAXB 4LDXA 3ASKA 4BE1A 4M75B 2COZA 2F1LA 4DOWA 1QVGA 1Y71A 2VYTA 4M7DB 1Q82R 2HCKA 4Z02A 1K0SA 3M0QA 2LP5A 2X3WD 1OV3A 5CKHA 2LDMA 2QDYB 4GLMA 3AT1B 1VYUA 2KRMA 2HQXA 1YHQA 2BIVA 1CKAA 4OMOA 2RD1A 2CZ0B 4QQGA 2MIOA 2DTHA 4J9FA 1RUWA 3CC2Q 2LT4A 3G6EQ 2FYKA 5EC7A 1I5OB 3CCQQ 2QA4Q 5GAN8 3CMEA 3CCJQ 2F2VA 4EMHA 4F14A 2JMAA 5FRMA 3UATA 3TCJA 4O6JA 4OMMA 3OA6A 3RKYA 3CCSQ 1AWOA 2XKOC 3CBPA 3L2RA 3LWIA 4CC2A 4XU2A 1C6VX 4C8QE 1KK7A 3I55Q 1M30A 5FU7C 1B34A 4JPBW 1VQ4T 5GAN4 3VS3A 3JCMe 2RJEA 3P8DA 2Z0WA 2NUPB 4JJBA 3L2VA 3ZBDA 1HK9A 2O9SA 4QVDA 3E2UA 3O5ZA 2VUBA 3VUBA 2A7YA 4DQ2A 1VQ9T 1PM3A 2LNVA 1RI0A 4C8QF 1Y7XA 2FRWA 3J80E 1QVFP 5KYYA 3M4YA 4J6XA 2DXCA 3N5BB 1MUZA 2HSEB 3CMEQ 2X4XA 4BB7A 4J7IA 1MV3A 2RNAA 2EPDA 1X69A 2XG8D 4FCYA 4JUVA 4RTZA 1PSEA 3CPFA 1KG1A 3C12A 2RI3A 4M7AE 5IN1A 3JCMd 1G3SA 3H6ZA 4OMPA 1T0HA 3S3MA 3H9NA 3MCAB 1NJIU 3JCMJ 1U3OA 1WX6A 2AHJB 3O8VA 1TG0A 3M0PA 3OW2A 4E2FB 4FYWB 1XQHA 4D8DA 2CZ6B 1ZQ1A 3SWNA 2LVMA 4KH1B 4JRKA 2CP5A 2FPFA 2LJ0A 1D3BA 2KROA 4FYXB 2JW4A 4RCBA 4HKEA 2LQKA 4OF1A 4M7AF 4J9BA 1QVGP 3UF4A 2DJQA 1MNDA 5D6XA 2OTLA 4AT1B 1U1SA 1UDLA 3ZEHA 3QKJA 2ROLA 1IRXA 2O9VA 4C92G 4RMOA 4C5GA 4AFUC 1BIBA 2FVUA 2JXBA 1PHTA 5GAMe 3HRTA 3JSCA 2CH4W 4KGVB 3I5RA 2JS0A 4HXJA 1KHIA 2BKDN 4OB1B 1OI1A 3BY7A 1ZSGA 5GAN3 4XU3A 3G4SA 3ME9A 2DX1A 5DM7R 2R5MA 3LYIA 4HT9A 3QXEB 2XU8A 2RHIA 2C0OA 2K79A 5DY9A 3MKDA 3RIRA 1W4SA 4NS5A 4C8QA 1RAHB 1WNLA 2M0YA 2X3XD 2DL4A 1M3BA 5LJ3f 4M77A 1SRMA 3CCMA 3H41A 1W1FA 2J6OA 1WJSA 1Q86C 4JS4A 4JZ4A 2DYIA 4DBFA 1V76A 4LNPA 3A8LB 4C8QD 2JOYA 2RO0A 1D1BA 3L2ZA 3NGPA 2OTLQ 3TVTA 2P84A 5GAOp 1G8XA 2IG0A 1ZUKA 1YP5A 2LRQA 1M8MA 1QVFS 4FM4B 3CCET 3OYJA 2RHXA 2LJ1A 1WGSA 1VYVA 1JRIA 1FYNA 1M1GA 1PKSA 1GFDA 1NEGA 4RTTA 1U5SA 2EYZA 3OSVA 3MEWA 3JV3A 1LCKA 4Y91A 1KC8C 1YCYA 3VUZA 1WYXA 1N5ZA 1N8RR 4BE2A 2CP0A 3CXCP 2YLCA 1M2VA 4OMFB 5I11A 3CCRA 4M7AD 2KR3A 3QPHA 9ATCB 1ZUUA 1RL2A 1QCNA 1JXMA 1OPLA 2CZ7B 4D8KA 5CR2A 2CP6A 2K4YA 3PFSA 4PNOA 2DETA 3OW2P 3L2UA 1QVGS 2EYXA 1VQNT 1VQ4A 4EDUA 2RHZA 1RADB 4C92E 2J6FA 2PTKA 2DF6A 3LGLA 1K8AC 2COWA 4Z8AA 3CCUA 2J7IA 2O2OA 4J9GA 1RACB 3GLXA 1GCQC 4RUGA 2MI6A 2H8HA 2L8DA 3PIOA 3HFOA 5GANj 5IAYA 4KH0B 2HSPA 3EFSA 4DBRA 1R77A 2ZPIB 2K2MA 1TS9A 2KXDA 1N6AA 4C92F 2M16A 4FYYB 1M1FA 4E7SA 1VQ8Q 3CCRQ 2E6NA 3QYGB 1Y07A 1D09B 5GAN6 2E70A 1AEYA 2ZPBB 2RA2A 1IHWA 3CC2T 1I0CA 2FZKB 3G6ET 1O75A 4MMKA 3CCQT 4IIOA 3SDZA 3PVQA 2L3SA 2ZPEB 3CCJT 5KYUA 2EWNA 5LJ5j 4XTZA 4MMLA 2P0KA 4KT0E 2FL7A 3CCUQ 5KYXA 1AOJA 4M78C 3G7ZA 1BB9A 3I5SA 3CCST 3VU3C 3OYGA 1QP2A 1QQJA 3NTHA 3JCMf 3F70A 4ANJA 3I55T 1R0CB 5I22A 1AWJA 4C5EA 3JCMh 3VS0A 5J26A 4F17A 2X9HA 2KEAA 4XK8E 4MDWA 3M59A 2ZAEA 3FDRA 3CXCS 4ZGJB 3CPWA 1K1ZA 1ZSZC 2KY9A 1WJQA 3X26B 2RJFA 3E9FA 3L2QA 1W70A 2DK3A 4CRIA 1WFWA 2ABLA 1M3CA 4CC4B 3OYFA 3EAEA 4JRPA 3OW2S 2XIDA 1ZUYA 3NMZC 3CMET 3A1PA 1TSFA 3M9QA 5D7UA 3S3OA 4JS5A 1GCPA 3JCMW 2YUPA 2MAMA 2Y90A 4XTXA 3OYCA 2DIQA 4N4GA 1PG5B 4PJOC 4ZGDB 1OX9A 1R8OB 1PWTA 3RBBB 5GMKe 4C92D 1LVKA 3G71Q 3OYNA 3GP8A 4HCKA 2RI2A 1VYTA 3VS6A 1M27C 3EGDB 3PGGA 3NHNA 3MP8A 3M0SA 2EGEA 1WPYA 1MGQA 3UA7A 2YDLA 1RAGB 4AG2C 5EG2A 5GAMf 2VV5A 2QEXA 1W2BA 3TREA 2QQ9A 5C6SA 2CGHA 4M75A 1Y96B 1AZGB 1YWPA 5A2QE 5CKEA 2L0AA 4C0ZA 5KH6A 2K57A 2C0IA 1HJDA 4EMGA 2PNIA 3RDVA 2XI9A 2O4XB 2A08A 1QWEA 1Q86U 3I56A 5LJ3e 2CS7A 1K9MU 1H3ZA 2DFUA 2D8JA 1R0BG 3PVLA 1NE8A 1VQNA 3SHWA 3T9NA 3JB9I 1YBYA 3REBB 2DBMA 4L5GA 2QTVA 4BI4A 4EMKB 3EG3A 3DB4A 2IIMA 2YRCA 2LT1A 2JT4A 1X6GA 2HEQA 4ATOA 1OEBA 3LH0A 2GQIA 4JJDA 4QKUA 1M90C 4NL2A 4RKUE 4C8QG 3GNFB 1OOTA 4GY5A 1OZ2A 1NPRA 4LDUA 2QEXQ 1IHVA 2ESWA 4M77G 3CPWP 4Z89A 1I8FA 2DM1A 4LXCA 5LJ3d 4DEXA 1JQQA 5D6YA 3VYGA 2KGTA 3V7CA 2XDDA 2MCNA 1VQLA 4LE9A 3VRYA 3MO8A 3I56Q 1ZSZB 2COYA 1U06A 5IXFA 3MEUA 3P8BB 2PU9B 3CD6Q 2VB6A 2P0PA 3RR6A 5GAN5 1VQNQ 3DLMA 2GF7A 4C92B 1KC8R 3CCJA 2EQMA 5CQXA 3JAME 2HBPA 1M9SA 4BD3A 1UJYA 3PMTA 4LD9K 2L3RA 2M0OA 2RHUA 1PRLC 1BIAA 4WF2A 3EH2A 2CSIA 3RKWA 2C06A 2V8JA 2I0NA 2IPOB 2DJZA 2RHYA 1BCMA 3I55A 4AFQC 1BI3A 2DILA 2MOXA 2DXTA 3OYMA 5HK3A 2AZVA 2EFIA 1KJWA 1M2OA 2OAUA 3M5AA 2QAZA 5IHKA 2RQTA 4E47A 2YUNA 1VQOT 1HSQA 2FB7A 3JB9G 5L23A 2NWMA 2E5KA 1W2BP 1VQLQ 1K8AR 4N0AA 2GNCA 3PTAA 4M4ZA 4MZPA 3OS0A 1Q7YC 3M56A 3UT1A 3MHXA 1WLPB 3M54A 2E12A 1VQKA 1VQ6A 2FG0A 1K0XA 1YITA 3CMAT 1SF9A 3VS2A 3L1AA 1VQ8T 4IKFA 3CCRT 2GBQA 3QJ6A 4FU6A 1EZZB 1VQMQ 4FSSA 1G5VA 2LCLA 1IGQA 3I35A 1MV0B 2M1HA 4ZN3A 3MP6A 4J5YA 4X9CA 4M77E 4J9CA 1M1KC 1KFZA 3RESA 3V7SA 1YFNA 2WSEE 1J3TA 3V8LA 4PK4A 1UGRB 3CPWS 3EHQA 3CCUT 2JN0A 1LNXA 2ZPGB 2YXYA 3QDRB 1Y0MA 3CBOA 3MJXA 4L59A 2DERA 2LCCA 3M55A 2VASA 3OYIA 2A28A 3JB9H 5FRNA 1NBEB 2QASA 4F7UE 1I1JA 4E7JA 2Y4YA 5AYFA 1WJRA 2MYSA 3HFNA 4M77F 1VQ6Q 5GMKl 1VQKQ 4AG1C 1ABQA 1KD1U 4A54A 4A4EA 2B8AA 1VQPA 3CEYA 1YITQ 2DZCA 3OYLA 1E6HA 4J6WA 4LN2A 2BE9B 5L8RE 2F2XA 1GRIA 2OJ2A 4CI0C 5GAOl 3C4SA 3QWYA 2SEMA 4ELZC 3LH5A 2JNGA 2JZ2A 1I5LA 2RJDA 2C0TA 4F7UF 1VQ7Q 3NPFA 5HCKA 3KXTA 1P92A 2HMAA 2AIRB 1JU5C 5C0MA 1EIFA 1PSFA 3X25B 2A37A 2CDTA 3EG2A 4AMCA 4PLLA 2MK5A 4J9DA 1W2BS 2AKLA 1AVZC 3M4GA 2NUTA 4D6WA 1YCSB 3G71T 1NJIR 1JBMA 2LQWA 4WTOB 2VGMA 2CYZB 1VQPQ 5GAOq 5CAIA 3TEEA 2LQ8A 1X01A 1QW1A 4C8QC 2YWWA 3JB9F 4J83A 1K73C 1XNIA 2X4JA 4RTVA 5CO7A 2A36A 2EYQA 4A63B 2EQKA 3HKSA 5KYNA 5J3BA 1GBRA 1PKTA 1TTHB 3QSUA 1SSHA 1IXDA 3JCMX 6AT1B 2F69A 3EG0A 4RG2A 1YJ9A 4NOYA 4HT8A 1SRLA 2KQWA 5LJ3h 4FW2A 1UEBA 4BDZA 2EW3A 2MF2A 1K9MC 1B34B 3E9GA 2LC4A 2PZ1A 2GFUA 3AHUA 5GAMd 2E65A 4M75G 7AT1B 1M90U 4M77D 4A4HA 1KQSA 3EH1A 3VKIA 4F7UA 5KCHA 4MDXA 2Y4XA 4C5HA 1WIEA 5A0LA 1VQOA 4LDYA 4M7AC 1ZBXA 4JZ3A 3J81E 1RLPC 2X51A 4QW2A 3OBWA 5KYYB 3EGXA 4LDWA 4QQDA 2DXUA 1LOJA 5IHNA 1K76A 1YJNA 4OB3B 4RCCA 2QEXT 3UWNA 1QKXA 2FZCB 2L5QA 2X35A 3EG9B 4FW1A 1MMNA 2FO0A 3CMAA 3BDUA 4XU1A 1YJ9Q 2HAXA 1VQ8A 2MWPA 1MNEA 5D6WA 2M9UA 1YI2A 4J7FA 3I56T 4OB2B 4E7IA 4RTWA 5LJ3g 3JRZA 3CD6T 4VUBA 1IO6A 1VOMA 4C0FA 1CKBA 2VGNA 3SWNB 1G3WA 1OZ3A 3LGFA 2KNBB 2QYZA 1EFNA 4J8OA 1VQOQ 3HSBA 3JB9D 3EFRA 5GAN2 1AZEA 4HVWA 5FU6B 4HVUA 3JCMQ 3OYHA 5KYWA 2J06A 3HL8A 3CC4T 2B86A 1AD5A 3THKA 3PT9A 1GFCA 1VUBA 4EIKA 1YJNQ 3IQLA 3FLGA 1Q7YU 3HRUA 3CCVQ 2RN8A 1ZX6A 3CMAQ 3EG1A 4OMNA 3UPUA 3LLRA 2E41A 3L42A 1YI2Q 1VQLT 2V8KA 2PVOB 4F16A 2SRCA 1M8VA 4C8QB 1S72Q 1JJ2A 1UJ0A 1Q81U 1PRMC 1GCQA 4M75E 4ZGEB 4M7DE 4M77B 3R6OA 2GQVA 1XJWB 3J7AF 2AKKA 4C0DB 4EMKC 3GNGA 4MZTA 3LWHA 1M1KU 1WI7A 3NTIA 2OI3A 2JUFA 2DVEA 8AT1B 3X20B 5HKCA 3VS1A 1LPLA 1WHJA 4C5IA 2ROTA 3M53A 1VQMT 2KVQG 2JJ9A 4IUVA 1Q95G 3QZ9B 1UGQB 2X4YA 4M75F 1B07A 4M7DF 2RK2A 3G71A 3H0IA 1WZOA 1TOVA 2MPXC 2XK0A 3EFOA 3MEAA 1UG1A 3LW5E 2OTJT 5IT9E 1M1KR 4LUEA 2NLUA 1N9SA 3EHRA 4M7AB 5CKDA 1PNJA 4KULA 5GAOn 1WQ7A 4M78A 1U1TA 4JRIA 2YUOA 4JLGA 4XTYA 1IREB 1NLOC 1CSKA 2DTIA 1XOVA 3EGUA 4C92C 2W10A 2O01E 3HRSA 5KCOA 1KD1C 3OYDA 1VQ6T 1VQKT 1KHCA 3PMIA 1YITT 3C94A 4HA8A 1OYXA 3MPUB 4KGXB 4R0KA 5IXBA 4OGCA 2DO3A 1I07A 1KQ1A 2QGGA 1ZSZA 1X2QA 3WXMB 3M57A 5FWBA 1LJOA 1NM7A 1VQ7T 1FMKA 3JCMg 1UGPB 1QP3A 2YRDA 4IUQA 2ED0A 3TSWA 4TVRA 1YWOA 3A8HB 4FL6A 1TUDA 1K73U 2EQIA 4PJOA 5GANf 2J05A 2E10A 5GAMh 5A0DA 2O88A 1UFFA 4M7DA 4XTVA 3NFCA 3H0HA 2A0FB 1VQPT 1JJ2P 2DD4A 2BUDA 3MP1A 1WHGA 3REAB 1NYGA 2I2LA 3HPWA 4KUIA 1B3QA 2HD0A 3BDLA 1ZLMA 5FW9A 4M75D 4PL6A 5AT1B 3UA6A 3GPLA 1BI2A 4M7DD 3CD6A 2ED1A 3OMCA 5KYXB
chains in the Genus database with same CATH topology
1M3BA 4FSSA 1WXBA 2AZSA 1M3AA 5ECAA 1SRMA 2FRYA 3I35A 1T3SA 1MV0B 1UHCA 1W1FA 2AK5A 2G6FX 1QWFA 2GTJA 3H41A 2J6OA 1RLQC 1H92A 4JZ4A 1KFZA 4J9CA 4LNPA 4ZNXA 1BBZA 1J3TA 1SHFA 4J9EA 1GL5A 3NGPA 3EHQA 2L2PA 3I9QA 3TVTA 1BK2A 3TSZA 1ZUKA 1YP5A 1Y0MA 1M8MA 2LJ1A 1JO8A 2DL8A 2A28A 1VYVA 1E6GA 1FYNA 2J6KA 1PKSA 1ZBJA 1I1JA 4K11A 1GFDA 1NEGA 4RTTA 1U5SA 2EYZA 2CSQA 4KRTA 2DE0X 2GGRA 3JV3A 1ABOA 1LCKA 4AG1C 1ABQA 2LCSA 1H3HA 1WYXA 1A0NB 1N5ZA 2RMOA 1E6HA 2K6DA 4LN2A 4AFSC 1UE9A 2HDAA 2F2XA 1GRIA 2OJ2A 1X6BA 2P4RA 5I11A 1NYFA 3QWYA 2SEMA 3LH5A 2KR3A 2L3QA 1K4US 1ZUUA 2RQRA 2CH4A 1SHGA 2C0TA 1JXMA 1OPLA 2KT1A 4D8KA 2RQVA 2DRKA 4IIMA 2KE9A 2LZ6B 2EGCA 2D0NA 2CT4A 3NPFA 5HCKA 2DL7A 2EYXA 1WA7A 2YUQA 2FPDA 3R6NA 1JU5C 3VS4A 2KYMA 2A37A 2CDTA 1G2BA 1QKWA 2K3BA 1AWWA 2J6FA 2PTKA 3EG2A 2DF6A 1X43A 2DLPA 4Z8AA 4J9DA 4LUDA 1Y57A 2AKLA 2CREA 1AVZC 1Z9QA 2J7IA 2O2OA 4J9GA 1E7OA 1YCSB 5GJWB 1GCQC 4RUGA 2LQWA 4RTYA 3QWXX 2H8HA 2LQNA 3U23A 4Z88A 2K9GA 4J9IA 2JS2A 1QLYA 4RTUA 2LX7A 4GBQA 5GJVB 4J9HA 2HSPA 2K2MA 1UTIA 2BZ8A 2KXDA 2F2WA 4RTVA 2KYBA 2CUDA 2A36A 4RTXA 4A63B 2BZXA 1GBRA 1PKTA 1V1CA 2M51A 1T3LA 1Z9ZA 2CUBA 2DL5A 2EGAA 3M0RA 2KRNA 1SSHA 1AEYA 2KRSA 4OMQA 3EG0A 1I0CA 1SRLA 2VVKA 4IIOA 3PVQA 2L3SA 2EW3A 2K7AA 2PZ1A 5IHIA 1AOJA 1BB9A 3I5SA 2V1QA 1JXOA 5IH2A 4Y92A 1GBQA 2DA9A 2FPEA 2LMJA 2BTTA 5I22A 1AWJA 1WXUA 1X2KA 1WIEA 3VS0A 4JZ3A 4F17A 1RLPC 2O31A 1JEGA 2KEAA 1NLPC 4ORZA 1KIKA 5IHNA 2EYYA 2RQWA 1K76A 1K1ZA 2YT6A 1WDXA 1SPKA 1YNZA 1QKXA 2EKHA 2DMOA 1W70A 1OPKA 2FO0A 1X27A 1WFWA 2ABLA 2KT8A 1BU1A 1M3CA 4CC4B 1RI9A 2YSQA 3PE0A 3RNJA 1ZUYA 3NMZC 1UUEA 4RTWA 1HD3A 2DL3A 4WCIA 1IO6A 4JJCA 1CKBA 4ESRA 3ULRB 2JTEA 1GCPA 2YUPA 4X1VA 1NG2A 2D1XA 2CT3A 2KNBB 2DVJA 3KFVA 3SEMA 1EFNA 1PWTA 3RBBB 2OAWA 2V1RA 2RPNA 1AZEA 4HVWA 2VKNA 4HVUA 2D8HA 2J06A 4HCKA 1VYTA 3VS6A 2B86A 1AD5A 3ZL7C 2KXCA 4DEYA 1M27C 3THKA 3NHNA 1GFCA 3M0SA 4EIKA 2NUZA 2EGEA 2DBKA 1SEMA 3IQLA 2JMCA 4AFZC 2HCKA 3UA7A 2KBTA 1K0SA 2YDLA 3M0QA 2LP5A 2X3WD 1OV3A 2RN8A 4AG2C 4GLMA 1ZX6A 1VYUA 2KRMA 3EG1A 2EBPA 1AWXA 1CKAA 1W6XA 4OMNA 4OMOA 1AZGB 1YWPA 2MIOA 4F16A 2SRCA 4J9FA 3VRZA 1RUWA 2L0AA 1UJ0A 1PRMC 2C0IA 2DRMA 1GCQA 4OMLA 1ARKA 1HJDA 5EC7A 1K9AA 2HBWA 2PNIA 2A08A 2F2VA 1QWEA 2AKKA 3VS7A 4F14A 2JMAA 3GBQA 3UATA 2XMFA 1WI7A 2QDLA 2DNUA 2OI3A 2D8JA 4OMMA 3PVLA 3SHWA 3VS1A 1AWOA 3REBB 2DBMA 2ROTA 3A98A 4CC2A 1M30A 2ENMA 3FJ5A 3EG3A 4JPBW 2IIMA 4E6RA 2LNHB 4HVVA 2JT4A 1X6GA 2HEQA 1B07A 3VS3A 3VS5A 3H0IA 1OEBA 1TUCA 2GQIA 4JJDA 1NEBA 4JJBA 1UG1A 1OOTA 2O9SA 3O5ZA 4LUEA 1VA7A 1UGVA 2ESWA 1UHFA 3EHRA 3H0FA 1PNJA 4Z89A 2DM1A 4DEXA 2JM9A 2YUOA 1JQQA 2FRWA 1WXTA 1NLOC 1CSKA 1MUZA 1XOVA 2KGTA 1UECA 3EGUA 2ECZA 2W10A 2MCNA 4LE9A 3VRYA 1U06A 1S1NA 2W0ZA 1MV3A 2RNAA 5IXFA 2EPDA 3M0TA 1X69A 2JM8A 4RTZA 4R0KA 5IXBA 4OMPA 1T0HA 1I07A 2EYWA 5FWCA 2RQUA 1X2QA 1UJYA 2DYBA 5FWBA 1NM7A 1U3OA 1WX6A 1TG0A 1PRLC 2CSIA 3M0PA 3M0UA 1FMKA 2I0NA 4D8DA 4CC3A 4AFQC 2FPFA 2DILA 2LJ0A 2VWFA 2MOXA 2KROA 2JW4A 4CC7A 2ED0A 2AZVA 1KJWA 4J9BA 3TSWA 3UF4A 2DJQA 2RF0A 5IHKA 2RQTA 1YWOA 2YUNA 2L3PA 1UDLA 1TUDA 2EVRA 1H8KA 2EQIA 1HSQA 2ROLA 2BZYA 5L23A 2J05A 2E5KA 1KSWA 2NWMA 2O9VA 4AFUC 2JXBA 1PHTA 2FEIA 2O88A 1YN8A 2GNCA 1UFFA 3CQTA 3H0HA 2CH4W 3I5RA 1QCFA 4M4ZA 2JS0A 4HXJA 1T0JA 3REAB 1NYGA 1ZSGA 3C0CA 2LJ3A 1B3QA 1G83A 2GTOA 1WLPB 2DX1A 4QT7A 2FG0A 1ZLMA 5FW9A 1K0XA 3UA6A 3VS2A 2C0OA 2K79A 2GBQA 2ED1A 2M0YA 2X3XD 2DL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M3B A;  4FSS A;  1WXB A;  2AZS A;  1M3A A;  5ECA A;  1SRM A;  2FRY A;  3I35 A;  1T3S A;  1MV0 B;  1UHC A;  1W1F A;  2AK5 A;  2G6F X;  1QWF A;  2GTJ A;  3H41 A;  2J6O A;  1RLQ C;  1H92 A;  4JZ4 A;  1KFZ A;  4J9C A;  4LNP A;  4ZNX A;  1BBZ A;  1J3T A;  1SHF A;  4J9E A;  1GL5 A;  3NGP A;  3EHQ A;  2L2P A;  3I9Q A;  3TVT A;  1BK2 A;  3TSZ A;  1ZUK A;  1YP5 A;  1Y0M A;  1M8M A;  2LJ1 A;  1JO8 A;  2DL8 A;  2A28 A;  1VYV A;  1E6G A;  1FYN A;  2J6K A;  1PKS A;  1ZBJ A;  1I1J A;  4K11 A;  1GFD A;  1NEG A;  4RTT A;  1U5S A;  2EYZ A;  2CSQ A;  4KRT A;  2DE0 X;  2GGR A;  3JV3 A;  1ABO A;  1LCK A;  4AG1 C;  1ABQ A;  2LCS A;  1H3H A;  1WYX A;  1A0N B;  1N5Z A;  2RMO A;  1E6H A;  2K6D A;  4LN2 A;  4AFS C;  1UE9 A;  2HDA A;  2F2X A;  1GRI A;  2OJ2 A;  1X6B A;  2P4R A;  5I11 A;  1NYF A;  3QWY A;  2SEM A;  3LH5 A;  2KR3 A;  2L3Q A;  1K4U S;  1ZUU A;  2RQR A;  2CH4 A;  1SHG A;  2C0T A;  1JXM A;  1OPL A;  2KT1 A;  4D8K A;  2RQV A;  2DRK A;  4IIM A;  2KE9 A;  2LZ6 B;  2EGC A;  2D0N A;  2CT4 A;  3NPF A;  5HCK A;  2DL7 A;  2EYX A;  1WA7 A;  2YUQ A;  2FPD A;  3R6N A;  1JU5 C;  3VS4 A;  2KYM A;  2A37 A;  2CDT A;  1G2B A;  1QKW A;  2K3B A;  1AWW A;  2J6F A;  2PTK A;  3EG2 A;  2DF6 A;  1X43 A;  2DLP A;  4Z8A A;  4J9D A;  4LUD A;  1Y57 A;  2AKL A;  2CRE A;  1AVZ C;  1Z9Q A;  2J7I A;  2O2O A;  4J9G A;  1E7O A;  1YCS B;  5GJW B;  1GCQ C;  4RUG A;  2LQW A;  4RTY A;  3QWX X;  2H8H A;  2LQN A;  3U23 A;  4Z88 A;  2K9G A;  4J9I A;  2JS2 A;  1QLY A;  4RTU A;  2LX7 A;  4GBQ A;  5GJV B;  4J9H A;  2HSP A;  2K2M A;  1UTI A;  2BZ8 A;  2KXD A;  2F2W A;  4RTV A;  2KYB A;  2CUD A;  2A36 A;  4RTX A;  4A63 B;  2BZX A;  1GBR A;  1PKT A;  1V1C A;  2M51 A;  1T3L A;  1Z9Z A;  2CUB A;  2DL5 A;  2EGA A;  3M0R A;  2KRN A;  1SSH A;  1AEY A;  2KRS A;  4OMQ A;  3EG0 A;  1I0C A;  1SRL A;  2VVK A;  4IIO A;  3PVQ A;  2L3S A;  2EW3 A;  2K7A A;  2PZ1 A;  5IHI A;  1AOJ A;  1BB9 A;  3I5S A;  2V1Q A;  1JXO A;  5IH2 A;  4Y92 A;  1GBQ A;  2DA9 A;  2FPE A;  2LMJ A;  2BTT A;  5I22 A;  1AWJ A;  1WXU A;  1X2K A;  1WIE A;  3VS0 A;  4JZ3 A;  4F17 A;  1RLP C;  2O31 A;  1JEG A;  2KEA A;  1NLP C;  4ORZ A;  1KIK A;  5IHN A;  2EYY A;  2RQW A;  1K76 A;  1K1Z A;  2YT6 A;  1WDX A;  1SPK A;  1YNZ A;  1QKX A;  2EKH A;  2DMO A;  1W70 A;  1OPK A;  2FO0 A;  1X27 A;  1WFW A;  2ABL A;  2KT8 A;  1BU1 A;  1M3C A;  4CC4 B;  1RI9 A;  2YSQ A;  3PE0 A;  3RNJ A;  1ZUY A;  3NMZ C;  1UUE A;  4RTW A;  1HD3 A;  2DL3 A;  4WCI A;  1IO6 A;  4JJC A;  1CKB A;  4ESR A;  3ULR B;  2JTE A;  1GCP A;  2YUP A;  4X1V A;  1NG2 A;  2D1X A;  2CT3 A;  2KNB B;  2DVJ A;  3KFV A;  3SEM A;  1EFN A;  1PWT A;  3RBB B;  2OAW A;  2V1R A;  2RPN A;  1AZE A;  4HVW A;  2VKN A;  4HVU A;  2D8H A;  2J06 A;  4HCK A;  1VYT A;  3VS6 A;  2B86 A;  1AD5 A;  3ZL7 C;  2KXC A;  4DEY A;  1M27 C;  3THK A;  3NHN A;  1GFC A;  3M0S A;  4EIK A;  2NUZ A;  2EGE A;  2DBK A;  1SEM A;  3IQL A;  2JMC A;  4AFZ C;  2HCK A;  3UA7 A;  2KBT A;  1K0S A;  2YDL A;  3M0Q A;  2LP5 A;  2X3W D;  1OV3 A;  2RN8 A;  4AG2 C;  4GLM A;  1ZX6 A;  1VYU A;  2KRM A;  3EG1 A;  2EBP A;  1AWX A;  1CKA A;  1W6X A;  4OMN A;  4OMO A;  1AZG B;  1YWP A;  2MIO A;  4F16 A;  2SRC A;  4J9F A;  3VRZ A;  1RUW A;  2L0A A;  1UJ0 A;  1PRM C;  2C0I A;  2DRM A;  1GCQ A;  4OML A;  1ARK A;  1HJD A;  5EC7 A;  1K9A A;  2HBW A;  2PNI A;  2A08 A;  2F2V A;  1QWE A;  2AKK A;  3VS7 A;  4F14 A;  2JMA A;  3GBQ A;  3UAT A;  2XMF A;  1WI7 A;  2QDL A;  2DNU A;  2OI3 A;  2D8J A;  4OMM A;  3PVL A;  3SHW A;  3VS1 A;  1AWO A;  3REB B;  2DBM A;  2ROT A;  3A98 A;  4CC2 A;  1M30 A;  2ENM A;  3FJ5 A;  3EG3 A;  4JPB W;  2IIM A;  4E6R A;  2LNH B;  4HVV A;  2JT4 A;  1X6G A;  2HEQ A;  1B07 A;  3VS3 A;  3VS5 A;  3H0I A;  1OEB A;  1TUC A;  2GQI A;  4JJD A;  1NEB A;  4JJB A;  1UG1 A;  1OOT A;  2O9S A;  3O5Z A;  4LUE A;  1VA7 A;  1UGV A;  2ESW A;  1UHF A;  3EHR A;  3H0F A;  1PNJ A;  4Z89 A;  2DM1 A;  4DEX A;  2JM9 A;  2YUO A;  1JQQ A;  2FRW A;  1WXT A;  1NLO C;  1CSK A;  1MUZ A;  1XOV A;  2KGT A;  1UEC A;  3EGU A;  2ECZ A;  2W10 A;  2MCN A;  4LE9 A;  3VRY A;  1U06 A;  1S1N A;  2W0Z A;  1MV3 A;  2RNA A;  5IXF A;  2EPD A;  3M0T A;  1X69 A;  2JM8 A;  4RTZ A;  4R0K A;  5IXB A;  4OMP A;  1T0H A;  1I07 A;  2EYW A;  5FWC A;  2RQU A;  1X2Q A;  1UJY A;  2DYB A;  5FWB A;  1NM7 A;  1U3O A;  1WX6 A;  1TG0 A;  1PRL C;  2CSI A;  3M0P A;  3M0U A;  1FMK A;  2I0N A;  4D8D A;  4CC3 A;  4AFQ C;  2FPF A;  2DIL A;  2LJ0 A;  2VWF A;  2MOX A;  2KRO A;  2JW4 A;  4CC7 A;  2ED0 A;  2AZV A;  1KJW A;  4J9B A;  3TSW A;  3UF4 A;  2DJQ A;  2RF0 A;  5IHK A;  2RQT A;  1YWO A;  2YUN A;  2L3P A;  1UDL A;  1TUD A;  2EVR A;  1H8K A;  2EQI A;  1HSQ A;  2ROL A;  2BZY A;  5L23 A;  2J05 A;  2E5K A;  1KSW A;  2NWM A;  2O9V A;  4AFU C;  2JXB A;  1PHT A;  2FEI A;  2O88 A;  1YN8 A;  2GNC A;  1UFF A;  3CQT A;  3H0H A;  2CH4 W;  3I5R A;  1QCF A;  4M4Z A;  2JS0 A;  4HXJ A;  1T0J A;  3REA B;  1NYG A;  1ZSG A;  3C0C A;  2LJ3 A;  1B3Q A;  1G83 A;  2GTO A;  1WLP B;  2DX1 A;  4QT7 A;  2FG0 A;  1ZLM A;  5FW9 A;  1K0X A;  3UA6 A;  3VS2 A;  2C0O A;  2K79 A;  2GBQ A;  2ED1 A;  2M0Y A;  2X3X D;  2DL4 A; 
#chains in the Genus database with same CATH topology
 1O9S A;  1WXB A;  2AZS A;  1M3A A;  5LJ5 f;  2FRY A;  2G6F X;  2AK5 A;  1QWF A;  4PJL A;  1RLQ C;  2EQU A;  3S3N A;  2ATC B;  3OMG A;  4DA4 A;  4ZNX A;  1BBZ A;  3CC4 A;  1SHF A;  4J9E A;  4PLI A;  1GL5 A;  4GLK A;  2L2P A;  1I81 A;  1Q86 R;  1WHK A;  2ZGW A;  1G3T A;  3QZ5 B;  4DBQ A;  3TSZ A;  5FLX E;  1K9M R;  4BE0 A;  3FJP A;  2XDP A;  2AT1 B;  1FWZ A;  1MMD A;  1RAI B;  4ZTF A;  1MMG A;  2JVV A;  1E6G A;  3SD4 A;  3FB9 A;  2NUP A;  1N8R C;  5GAM g;  3ZFJ A;  1VQ5 T;  1C0M A;  4KRT A;  2DE0 X;  2GGR A;  1A0N B;  1WHM A;  4F7U G;  2CKK A;  1D0Z A;  1XTD A;  1QVF A;  2P4R A;  1NYF A;  3QDF A;  3X24 B;  1YJ9 T;  2CP3 A;  4FSX A;  2CH4 A;  1RAA B;  4IIM A;  2KE9 A;  1VQM A;  3CC4 Q;  2LZ6 B;  2RK1 A;  4O5V A;  2EGC A;  1Q82 U;  2CT4 A;  2HKQ B;  2KDS A;  4N4I A;  2DL7 A;  1WA7 A;  2YUQ A;  1GXI E;  3VYH B;  2KYM A;  1G2B A;  1QKW A;  3RER A;  1SKU B;  2DLP A;  4N0A C;  4HCZ A;  1BKB A;  2D0Q B;  2CRE A;  2OTJ A;  2EQJ A;  5DLO A;  2CP2 A;  2HZY A;  1JJ2 S;  1WQW A;  2XDB A;  4RTY A;  4KGZ B;  5GMK m;  5CCA A;  3VV0 A;  1N9R A;  3U23 A;  4Z88 A;  2E64 A;  4J9I A;  2LX7 A;  1YJN T;  4GBQ A;  5GJV B;  4J9H A;  1AT1 B;  1UTI A;  2HKN A;  2K3X A;  2F2W A;  1ZA1 B;  2F5K A;  2CUD A;  5GAO m;  3LX7 A;  3CCV T;  3OYE A;  4BAC A;  3V7R A;  1T3L A;  2K3Y A;  1YI2 T;  1Q81 C;  2BE7 D;  2DL5 A;  3KBG A;  3M0R A;  2MMP A;  2WAC A;  1S72 T;  1MHN A;  2VXE A;  3CCL Q;  4JJN K;  3MET A;  2FHD A;  2KAF A;  4JRQ A;  5LJ3 j;  1VQ7 A;  3OY9 A;  5IHI A;  1D0X A;  2JTM A;  2OTJ Q;  3OS1 A;  4A4G A;  2XHC A;  3QHS A;  2WSF E;  4BI3 A;  1GBQ A;  3DB3 A;  2FPE A;  1QCO A;  1WXU A;  1DJ7 B;  3BE3 A;  2ZZD A;  4UC4 A;  3INZ A;  1NLP C;  1YHQ Q;  3BW1 A;  1YIJ A;  2RQW A;  2G3R A;  4ELY C;  1OU8 A;  4FIB A;  3TU4 K;  2EKH A;  2CZ1 B;  1OPK A;  4IUP A;  3QUI A;  1D1C A;  1X27 A;  4ZN1 A;  3SWN C;  3PE0 A;  3RNJ A;  1C1A A;  1HD3 A;  1H64 1;  3EG9 A;  3CXC A;  2OX7 A;  2E6Z A;  2DD5 A;  4M78 G;  5FU6 C;  3ULR B;  2JTE A;  3OSS C;  4ESR A;  1KD1 R;  4JLI A;  4X1V A;  2D1X A;  3RKX A;  2CT3 A;  2QQS A;  2DVJ A;  3KFV A;  5GMK h;  1EX4 A;  3G1J A;  4PKC C;  1YJW A;  3X28 B;  1V29 B;  2OAW A;  2V1R A;  2RPN A;  2D6F A;  3DLL A;  3QJY A;  2D8H A;  3UDC A;  3SB2 A;  1IZ6 A;  2YLB A;  4DBH A;  5GMK i;  1YIJ Q;  4QVC A;  2NUZ A;  4IUR A;  3VJP A;  2DBK A;  1SEM A;  4HCB A;  5GAN e;  1U8R A;  2JMC A;  1VQ5 A;  4AFZ C;  2H3E B;  2DKG A;  2KBT A;  4ZTJ A;  4BY6 C;  2R57 A;  3P8H A;  1D1A A;  3SFM A;  2EJF A;  2EBP A;  1AWX A;  5CKB A;  4M77 C;  1W6X A;  3JB9 J;  4C0D C;  3OYA A;  4XU0 A;  3VRZ A;  2HQE A;  3NTK A;  2DRM A;  4OML A;  1ARK A;  1K9A A;  2HBW A;  1MMA A;  3DKM A;  2DPP B;  3VS7 A;  3GBQ A;  2XMF A;  5LJ5 e;  2QDL A;  2DNU A;  2EJ9 A;  4PJO G;  1PCX A;  3HHT B;  4BUG A;  1YJW Q;  3E1S A;  4II1 A;  1ACM B;  3FC3 A;  4M7D G;  5GAN d;  2M02 A;  3A98 A;  4XTW A;  4J6Y A;  2ENM A;  3FJ5 A;  1JB0 E;  5GAO r;  2RH2 A;  4E6R A;  3OS2 A;  2LNH B;  2QGF B;  4HVV A;  3VS5 A;  1VQ5 Q;  4B6M A;  1N8R U;  1D0Y A;  1TUC A;  3TQ7 P;  4B9X A;  4XTU A;  1NEB A;  3GIB A;  1OX8 A;  5FU7 B;  3V8K A;  1VA7 A;  1UGV A;  1UHF A;  5M9O A;  2A3L A;  3H0F A;  3QBY A;  4R56 A;  1M90 R;  4L6V 5;  2JM9 A;  5LJ5 d;  1WXT A;  3CCV A;  1BCO A;  2F5T X;  2QG9 B;  4RG8 A;  1UEC A;  4M78 E;  1TUG B;  2ECZ A;  4XQ3 A;  3G4S Q;  2PQW A;  2YHT A;  2YRV A;  2GCX A;  3FIF A;  4M7A A;  1S1N A;  2W0Z A;  3M0T A;  1S72 A;  2JM8 A;  4V2S A;  2KK4 A;  4YTL A;  1WHH A;  1B7T A;  3CCM Q;  2EYW A;  5FWC A;  2RQU A;  1D3B B;  2DYB A;  1M4Z A;  2E5Q A;  3OYY A;  4Y28 E;  1KQ2 A;  4M78 F;  1FMW A;  2MWO A;  3M0U A;  1UGS B;  1Q82 C;  4CC3 A;  4FT2 A;  2PUK B;  2CP7 A;  2NUT B;  2DXB A;  2QK0 A;  3KUF A;  2VWF A;  2ZPF B;  5CK9 A;  2QQR A;  3OBY A;  5LL6 S;  4CC7 A;  2D9T A;  2RF0 A;  2EIF A;  2L3P A;  5J39 A;  2EVR A;  1H8K A;  3RMS A;  3EGD A;  4F04 B;  2BZY A;  1KSW A;  8ATC B;  1VQ9 A;  2P0Q A;  3CC7 T;  4R55 A;  4N4H A;  2FEI A;  1YN8 A;  1X75 C;  3CQT A;  5GAM j;  3C95 A;  4BY6 B;  4PJO E;  1QCF A;  3JCM b;  2X4W A;  4PFP A;  1T0J A;  4JDS A;  4KUD K;  3C0C A;  2LJ3 A;  3L2W A;  1G83 A;  4E7H A;  2GTO A;  4QT7 A;  3E19 A;  2EKO A;  3V8J A;  1Y96 A;  1PC0 A;  2QI2 A;  4P5N A;  4Q5W A;  3OQ5 A;  1Q7Y R;  2LTO A;  2QXF A;  2E1H A;  2P4T A;  1KQS P;  5ECA A;  2HL5 C;  2O4X A;  1T3S A;  1UHC A;  2GTJ A;  3CCL T;  2QA4 T;  1BYM A;  4PJO F;  1VQ4 Q;  3GF5 A;  5CKF A;  1H92 A;  4F7U B;  5I21 A;  1Q81 R;  1N27 A;  1PD0 A;  2DEQ A;  3QYH B;  3JCM P;  2HL3 A;  2XIC A;  5HY6 A;  4PFZ A;  3S6W A;  1FMV A;  3I9Q A;  3OB9 A;  4EMK A;  1BK2 A;  4BDY A;  3EGX B;  1FXX A;  3MEV A;  2RJC A;  4X9D A;  1VQ9 Q;  3FRN A;  1JO8 A;  2EJG A;  2DL8 A;  4E7Z A;  2J6K A;  5KE3 A;  1IGU A;  1ZA2 B;  1ZBJ A;  4K11 A;  1M2V B;  1HXD A;  3A8M B;  5I2M A;  2CSQ A;  1X6O A;  1ABO A;  2RM4 A;  4OB0 B;  3BFM A;  2LCS A;  1H3H A;  1YHQ T;  4M78 D;  3A8G B;  2RMO A;  2LX9 A;  5DLQ E;  2K6D A;  4AFS C;  1OUL A;  1UE9 A;  2HDA A;  3H8Z A;  3QO3 A;  4BI8 B;  4PJM A;  4A53 A;  1X6B A;  2PVG B;  4E7L A;  1NZ9 A;  1TH7 A;  2L3Q A;  4PJJ A;  1K4U S;  2RQR A;  3A5Z B;  1SHG A;  1TU0 B;  2KMT A;  2KT1 A;  2RQV A;  2DAQ A;  2DRK A;  1RAE B;  4A4F A;  3QII A;  1IB8 A;  4C92 A;  1RAB B;  2D0N A;  2RI5 A;  5KYW B;  1HYO A;  1SG5 A;  2FPD A;  3R6N A;  5I2S A;  3VS4 A;  5HK0 A;  4FYV B;  1AWW A;  2K3B A;  1NJI C;  4NL3 A;  3HTR A;  1X43 A;  5CIU A;  1RAF B;  4LUD A;  1Y57 A;  4M75 C;  1F1B B;  1Z9Q A;  4M7D C;  3HP9 A;  4IUT A;  2PUO B;  1E7O A;  3CCE A;  5GJW B;  2E4H A;  5FRO A;  2E3I A;  1PD1 A;  4PJN A;  3QWX X;  2DZ9 A;  1AHJ B;  1BI0 A;  2K5L A;  1TWB A;  5GAN h;  4EPC A;  2LQN A;  4OP0 A;  2K9G A;  2JS2 A;  1QLY A;  1YIJ T;  4RTU A;  1VIE A;  2L89 A;  2PVD B;  4X34 A;  2BZ8 A;  3A8O B;  2K5F A;  4QQ6 A;  4QVZ A;  3RUX A;  4PJO D;  2KYB A;  4HCC A;  4RTX A;  1KQS S;  1SSF A;  1OU9 A;  4IUU A;  2BZX A;  3Q1J A;  5KYU B;  1V1C A;  2M51 A;  2V8I A;  3PNW C;  1Z9Z A;  1K73 R;  2CUB A;  2EGA A;  2KRN A;  1QMC A;  4FT4 A;  3WVE B;  2KRS A;  4OMQ A;  2QQB A;  2NYS A;  2FZG B;  2WSC E;  3OYK A;  2VVK A;  3ER0 A;  3URG A;  5LJ5 h;  3WVD B;  5CQY A;  2VXF A;  2K7A A;  3PIP A;  4PFO A;  4OGE A;  4ME7 A;  2ZCF B;  5KE2 A;  5GAN 7;  4OVA A;  1YJW T;  4LDV A;  2V1Q A;  1JXO A;  2E3H A;  3EFO B;  3CCE Q;  2QTX A;  5IH2 A;  4Y92 A;  2DA9 A;  2QQA A;  2JTF A;  1OQK A;  2LMJ A;  4KBM B;  2BTT A;  1X2K A;  3FEO A;  2GFA A;  4A4K A;  4M78 B;  2O31 A;  2ZPH B;  2HQH A;  1JEG A;  5GAN g;  1BI1 A;  3GOX A;  3CC7 A;  2R5A A;  2XD0 A;  2OTL T;  1WHL A;  4ORZ A;  1KIK A;  2DTO A;  3D7S B;  1KC8 U;  2EYY A;  1UB4 A;  1VIF A;  3M58 A;  2RB6 A;  4MZM A;  1G3Y A;  2YT6 A;  1I4K 1;  1WDX A;  1SPK A;  1YNZ A;  4C0G A;  2IVW A;  2K2V A;  2DMO A;  2KI7 A;  4DOV A;  3RMQ A;  2H3J A;  3OYB A;  2EAY A;  1BU1 A;  2KT8 A;  4LD6 A;  3CBM A;  1RI9 A;  2KSS A;  3OS5 A;  1M5Q 1;  2YSQ A;  1ZHI A;  1UUE A;  3G4S T;  3QG1 A;  2VC8 A;  1FX7 A;  1TXQ A;  3JCM V;  5LJ5 g;  3CC2 A;  2DL3 A;  3G6E A;  2V26 A;  4WCI A;  3CCQ A;  4JJC A;  2QA4 A;  3CCL A;  2DIG A;  2HNI A;  5A0G A;  1NG2 A;  1NPP A;  3SEM A;  2R58 A;  3CCM T;  1K8A U;  5CVI A;  3JCM c;  5GMK j;  2DEU A;  3CCS A;  4M7A G;  2VKN A;  4B9W A;  4E7K A;  1QVP A;  2K5I A;  3CC7 Q;  3ZL7 C;  2KXC A;  4DEY A;  4PJO B;  4XAX B;  4LDX A;  3ASK A;  4BE1 A;  4M75 B;  2COZ A;  2F1L A;  4DOW A;  1QVG A;  1Y71 A;  2VYT A;  4M7D B;  1Q82 R;  2HCK A;  4Z02 A;  1K0S A;  3M0Q A;  2LP5 A;  2X3W D;  1OV3 A;  5CKH A;  2LDM A;  2QDY B;  4GLM A;  3AT1 B;  1VYU A;  2KRM A;  2HQX A;  1YHQ A;  2BIV A;  1CKA A;  4OMO A;  2RD1 A;  2CZ0 B;  4QQG A;  2MIO A;  2DTH A;  4J9F A;  1RUW A;  3CC2 Q;  2LT4 A;  3G6E Q;  2FYK A;  5EC7 A;  1I5O B;  3CCQ Q;  2QA4 Q;  5GAN 8;  3CME A;  3CCJ Q;  2F2V A;  4EMH A;  4F14 A;  2JMA A;  5FRM A;  3UAT A;  3TCJ A;  4O6J A;  4OMM A;  3OA6 A;  3RKY A;  3CCS Q;  1AWO A;  2XKO C;  3CBP A;  3L2R A;  3LWI A;  4CC2 A;  4XU2 A;  1C6V X;  4C8Q E;  1KK7 A;  3I55 Q;  1M30 A;  5FU7 C;  1B34 A;  4JPB W;  1VQ4 T;  5GAN 4;  3VS3 A;  3JCM e;  2RJE A;  3P8D A;  2Z0W A;  2NUP B;  4JJB A;  3L2V A;  3ZBD A;  1HK9 A;  2O9S A;  4QVD A;  3E2U A;  3O5Z A;  2VUB A;  3VUB A;  2A7Y A;  4DQ2 A;  1VQ9 T;  1PM3 A;  2LNV A;  1RI0 A;  4C8Q F;  1Y7X A;  2FRW A;  3J80 E;  1QVF P;  5KYY A;  3M4Y A;  4J6X A;  2DXC A;  3N5B B;  1MUZ A;  2HSE B;  3CME Q;  2X4X A;  4BB7 A;  4J7I A;  1MV3 A;  2RNA A;  2EPD A;  1X69 A;  2XG8 D;  4FCY A;  4JUV A;  4RTZ A;  1PSE A;  3CPF A;  1KG1 A;  3C12 A;  2RI3 A;  4M7A E;  5IN1 A;  3JCM d;  1G3S A;  3H6Z A;  4OMP A;  1T0H A;  3S3M A;  3H9N A;  3MCA B;  1NJI U;  3JCM J;  1U3O A;  1WX6 A;  2AHJ B;  3O8V A;  1TG0 A;  3M0P A;  3OW2 A;  4E2F B;  4FYW B;  1XQH A;  4D8D A;  2CZ6 B;  1ZQ1 A;  3SWN A;  2LVM A;  4KH1 B;  4JRK A;  2CP5 A;  2FPF A;  2LJ0 A;  1D3B A;  2KRO A;  4FYX B;  2JW4 A;  4RCB A;  4HKE A;  2LQK A;  4OF1 A;  4M7A F;  4J9B A;  1QVG P;  3UF4 A;  2DJQ A;  1MND A;  5D6X A;  2OTL A;  4AT1 B;  1U1S A;  1UDL A;  3ZEH A;  3QKJ A;  2ROL A;  1IRX A;  2O9V A;  4C92 G;  4RMO A;  4C5G A;  4AFU C;  1BIB A;  2FVU A;  2JXB A;  1PHT A;  5GAM e;  3HRT A;  3JSC A;  2CH4 W;  4KGV B;  3I5R A;  2JS0 A;  4HXJ A;  1KHI A;  2BKD N;  4OB1 B;  1OI1 A;  3BY7 A;  1ZSG A;  5GAN 3;  4XU3 A;  3G4S A;  3ME9 A;  2DX1 A;  5DM7 R;  2R5M A;  3LYI A;  4HT9 A;  3QXE B;  2XU8 A;  2RHI A;  2C0O A;  2K79 A;  5DY9 A;  3MKD A;  3RIR A;  1W4S A;  4NS5 A;  4C8Q A;  1RAH B;  1WNL A;  2M0Y A;  2X3X D;  2DL4 A;  1M3B A;  5LJ3 f;  4M77 A;  1SRM A;  3CCM A;  3H41 A;  1W1F A;  2J6O A;  1WJS A;  1Q86 C;  4JS4 A;  4JZ4 A;  2DYI A;  4DBF A;  1V76 A;  4LNP A;  3A8L B;  4C8Q D;  2JOY A;  2RO0 A;  1D1B A;  3L2Z A;  3NGP A;  2OTL Q;  3TVT A;  2P84 A;  5GAO p;  1G8X A;  2IG0 A;  1ZUK A;  1YP5 A;  2LRQ A;  1M8M A;  1QVF S;  4FM4 B;  3CCE T;  3OYJ A;  2RHX A;  2LJ1 A;  1WGS A;  1VYV A;  1JRI A;  1FYN A;  1M1G A;  1PKS A;  1GFD A;  1NEG A;  4RTT A;  1U5S A;  2EYZ A;  3OSV A;  3MEW A;  3JV3 A;  1LCK A;  4Y91 A;  1KC8 C;  1YCY A;  3VUZ A;  1WYX A;  1N5Z A;  1N8R R;  4BE2 A;  2CP0 A;  3CXC P;  2YLC A;  1M2V A;  4OMF B;  5I11 A;  3CCR A;  4M7A D;  2KR3 A;  3QPH A;  9ATC B;  1ZUU A;  1RL2 A;  1QCN A;  1JXM A;  1OPL A;  2CZ7 B;  4D8K A;  5CR2 A;  2CP6 A;  2K4Y A;  3PFS A;  4PNO A;  2DET A;  3OW2 P;  3L2U A;  1QVG S;  2EYX A;  1VQN T;  1VQ4 A;  4EDU A;  2RHZ A;  1RAD B;  4C92 E;  2J6F A;  2PTK A;  2DF6 A;  3LGL A;  1K8A C;  2COW A;  4Z8A A;  3CCU A;  2J7I A;  2O2O A;  4J9G A;  1RAC B;  3GLX A;  1GCQ C;  4RUG A;  2MI6 A;  2H8H A;  2L8D A;  3PIO A;  3HFO A;  5GAN j;  5IAY A;  4KH0 B;  2HSP A;  3EFS A;  4DBR A;  1R77 A;  2ZPI B;  2K2M A;  1TS9 A;  2KXD A;  1N6A A;  4C92 F;  2M16 A;  4FYY B;  1M1F A;  4E7S A;  1VQ8 Q;  3CCR Q;  2E6N A;  3QYG B;  1Y07 A;  1D09 B;  5GAN 6;  2E70 A;  1AEY A;  2ZPB B;  2RA2 A;  1IHW A;  3CC2 T;  1I0C A;  2FZK B;  3G6E T;  1O75 A;  4MMK A;  3CCQ T;  4IIO A;  3SDZ A;  3PVQ A;  2L3S A;  2ZPE B;  3CCJ T;  5KYU A;  2EWN A;  5LJ5 j;  4XTZ A;  4MML A;  2P0K A;  4KT0 E;  2FL7 A;  3CCU Q;  5KYX A;  1AOJ A;  4M78 C;  3G7Z A;  1BB9 A;  3I5S A;  3CCS T;  3VU3 C;  3OYG A;  1QP2 A;  1QQJ A;  3NTH A;  3JCM f;  3F70 A;  4ANJ A;  3I55 T;  1R0C B;  5I22 A;  1AWJ A;  4C5E A;  3JCM h;  3VS0 A;  5J26 A;  4F17 A;  2X9H A;  2KEA A;  4XK8 E;  4MDW A;  3M59 A;  2ZAE A;  3FDR A;  3CXC S;  4ZGJ B;  3CPW A;  1K1Z A;  1ZSZ C;  2KY9 A;  1WJQ A;  3X26 B;  2RJF A;  3E9F A;  3L2Q A;  1W70 A;  2DK3 A;  4CRI A;  1WFW A;  2ABL A;  1M3C A;  4CC4 B;  3OYF A;  3EAE A;  4JRP A;  3OW2 S;  2XID A;  1ZUY A;  3NMZ C;  3CME T;  3A1P A;  1TSF A;  3M9Q A;  5D7U A;  3S3O A;  4JS5 A;  1GCP A;  3JCM W;  2YUP A;  2MAM A;  2Y90 A;  4XTX A;  3OYC A;  2DIQ A;  4N4G A;  1PG5 B;  4PJO C;  4ZGD B;  1OX9 A;  1R8O B;  1PWT A;  3RBB B;  5GMK e;  4C92 D;  1LVK A;  3G71 Q;  3OYN A;  3GP8 A;  4HCK A;  2RI2 A;  1VYT A;  3VS6 A;  1M27 C;  3EGD B;  3PGG A;  3NHN A;  3MP8 A;  3M0S A;  2EGE A;  1WPY A;  1MGQ A;  3UA7 A;  2YDL A;  1RAG B;  4AG2 C;  5EG2 A;  5GAM f;  2VV5 A;  2QEX A;  1W2B A;  3TRE A;  2QQ9 A;  5C6S A;  2CGH A;  4M75 A;  1Y96 B;  1AZG B;  1YWP A;  5A2Q E;  5CKE A;  2L0A A;  4C0Z A;  5KH6 A;  2K57 A;  2C0I A;  1HJD A;  4EMG A;  2PNI A;  3RDV A;  2XI9 A;  2O4X B;  2A08 A;  1QWE A;  1Q86 U;  3I56 A;  5LJ3 e;  2CS7 A;  1K9M U;  1H3Z A;  2DFU A;  2D8J A;  1R0B G;  3PVL A;  1NE8 A;  1VQN A;  3SHW A;  3T9N A;  3JB9 I;  1YBY A;  3REB B;  2DBM A;  4L5G A;  2QTV A;  4BI4 A;  4EMK B;  3EG3 A;  3DB4 A;  2IIM A;  2YRC A;  2LT1 A;  2JT4 A;  1X6G A;  2HEQ A;  4ATO A;  1OEB A;  3LH0 A;  2GQI A;  4JJD A;  4QKU A;  1M90 C;  4NL2 A;  4RKU E;  4C8Q G;  3GNF B;  1OOT A;  4GY5 A;  1OZ2 A;  1NPR A;  4LDU A;  2QEX Q;  1IHV A;  2ESW A;  4M77 G;  3CPW P;  4Z89 A;  1I8F A;  2DM1 A;  4LXC A;  5LJ3 d;  4DEX A;  1JQQ A;  5D6Y A;  3VYG A;  2KGT A;  3V7C A;  2XDD A;  2MCN A;  1VQL A;  4LE9 A;  3VRY A;  3MO8 A;  3I56 Q;  1ZSZ B;  2COY A;  1U06 A;  5IXF A;  3MEU A;  3P8B B;  2PU9 B;  3CD6 Q;  2VB6 A;  2P0P A;  3RR6 A;  5GAN 5;  1VQN Q;  3DLM A;  2GF7 A;  4C92 B;  1KC8 R;  3CCJ A;  2EQM A;  5CQX A;  3JAM E;  2HBP A;  1M9S A;  4BD3 A;  1UJY A;  3PMT A;  4LD9 K;  2L3R A;  2M0O A;  2RHU A;  1PRL C;  1BIA A;  4WF2 A;  3EH2 A;  2CSI A;  3RKW A;  2C06 A;  2V8J A;  2I0N A;  2IPO B;  2DJZ A;  2RHY A;  1BCM A;  3I55 A;  4AFQ C;  1BI3 A;  2DIL A;  2MOX A;  2DXT A;  3OYM A;  5HK3 A;  2AZV A;  2EFI A;  1KJW A;  1M2O A;  2OAU A;  3M5A A;  2QAZ A;  5IHK A;  2RQT A;  4E47 A;  2YUN A;  1VQO T;  1HSQ A;  2FB7 A;  3JB9 G;  5L23 A;  2NWM A;  2E5K A;  1W2B P;  1VQL Q;  1K8A R;  4N0A A;  2GNC A;  3PTA A;  4M4Z A;  4MZP A;  3OS0 A;  1Q7Y C;  3M56 A;  3UT1 A;  3MHX A;  1WLP B;  3M54 A;  2E12 A;  1VQK A;  1VQ6 A;  2FG0 A;  1K0X A;  1YIT A;  3CMA T;  1SF9 A;  3VS2 A;  3L1A A;  1VQ8 T;  4IKF A;  3CCR T;  2GBQ A;  3QJ6 A;  4FU6 A;  1EZZ B;  1VQM Q;  4FSS A;  1G5V A;  2LCL A;  1IGQ A;  3I35 A;  1MV0 B;  2M1H A;  4ZN3 A;  3MP6 A;  4J5Y A;  4X9C A;  4M77 E;  4J9C A;  1M1K C;  1KFZ A;  3RES A;  3V7S A;  1YFN A;  2WSE E;  1J3T A;  3V8L A;  4PK4 A;  1UGR B;  3CPW S;  3EHQ A;  3CCU T;  2JN0 A;  1LNX A;  2ZPG B;  2YXY A;  3QDR B;  1Y0M A;  3CBO A;  3MJX A;  4L59 A;  2DER A;  2LCC A;  3M55 A;  2VAS A;  3OYI A;  2A28 A;  3JB9 H;  5FRN A;  1NBE B;  2QAS A;  4F7U E;  1I1J A;  4E7J A;  2Y4Y A;  5AYF A;  1WJR A;  2MYS A;  3HFN A;  4M77 F;  1VQ6 Q;  5GMK l;  1VQK Q;  4AG1 C;  1ABQ A;  1KD1 U;  4A54 A;  4A4E A;  2B8A A;  1VQP A;  3CEY A;  1YIT Q;  2DZC A;  3OYL A;  1E6H A;  4J6W A;  4LN2 A;  2BE9 B;  5L8R E;  2F2X A;  1GRI A;  2OJ2 A;  4CI0 C;  5GAO l;  3C4S A;  3QWY A;  2SEM A;  4ELZ C;  3LH5 A;  2JNG A;  2JZ2 A;  1I5L A;  2RJD A;  2C0T A;  4F7U F;  1VQ7 Q;  3NPF A;  5HCK A;  3KXT A;  1P92 A;  2HMA A;  2AIR B;  1JU5 C;  5C0M A;  1EIF A;  1PSF A;  3X25 B;  2A37 A;  2CDT A;  3EG2 A;  4AMC A;  4PLL A;  2MK5 A;  4J9D A;  1W2B S;  2AKL A;  1AVZ C;  3M4G A;  2NUT A;  4D6W A;  1YCS B;  3G71 T;  1NJI R;  1JBM A;  2LQW A;  4WTO B;  2VGM A;  2CYZ B;  1VQP Q;  5GAO q;  5CAI A;  3TEE A;  2LQ8 A;  1X01 A;  1QW1 A;  4C8Q C;  2YWW A;  3JB9 F;  4J83 A;  1K73 C;  1XNI A;  2X4J A;  4RTV A;  5CO7 A;  2A36 A;  2EYQ A;  4A63 B;  2EQK A;  3HKS A;  5KYN A;  5J3B A;  1GBR A;  1PKT A;  1TTH B;  3QSU A;  1SSH A;  1IXD A;  3JCM X;  6AT1 B;  2F69 A;  3EG0 A;  4RG2 A;  1YJ9 A;  4NOY A;  4HT8 A;  1SRL A;  2KQW A;  5LJ3 h;  4FW2 A;  1UEB A;  4BDZ A;  2EW3 A;  2MF2 A;  1K9M C;  1B34 B;  3E9G A;  2LC4 A;  2PZ1 A;  2GFU A;  3AHU A;  5GAM d;  2E65 A;  4M75 G;  7AT1 B;  1M90 U;  4M77 D;  4A4H A;  1KQS A;  3EH1 A;  3VKI A;  4F7U A;  5KCH A;  4MDX A;  2Y4X A;  4C5H A;  1WIE A;  5A0L A;  1VQO A;  4LDY A;  4M7A C;  1ZBX A;  4JZ3 A;  3J81 E;  1RLP C;  2X51 A;  4QW2 A;  3OBW A;  5KYY B;  3EGX A;  4LDW A;  4QQD A;  2DXU A;  1LOJ A;  5IHN A;  1K76 A;  1YJN A;  4OB3 B;  4RCC A;  2QEX T;  3UWN A;  1QKX A;  2FZC B;  2L5Q A;  2X35 A;  3EG9 B;  4FW1 A;  1MMN A;  2FO0 A;  3CMA A;  3BDU A;  4XU1 A;  1YJ9 Q;  2HAX A;  1VQ8 A;  2MWP A;  1MNE A;  5D6W A;  2M9U A;  1YI2 A;  4J7F A;  3I56 T;  4OB2 B;  4E7I A;  4RTW A;  5LJ3 g;  3JRZ A;  3CD6 T;  4VUB A;  1IO6 A;  1VOM A;  4C0F A;  1CKB A;  2VGN A;  3SWN B;  1G3W A;  1OZ3 A;  3LGF A;  2KNB B;  2QYZ A;  1EFN A;  4J8O A;  1VQO Q;  3HSB A;  3JB9 D;  3EFR A;  5GAN 2;  1AZE A;  4HVW A;  5FU6 B;  4HVU A;  3JCM Q;  3OYH A;  5KYW A;  2J06 A;  3HL8 A;  3CC4 T;  2B86 A;  1AD5 A;  3THK A;  3PT9 A;  1GFC A;  1VUB A;  4EIK A;  1YJN Q;  3IQL A;  3FLG A;  1Q7Y U;  3HRU A;  3CCV Q;  2RN8 A;  1ZX6 A;  3CMA Q;  3EG1 A;  4OMN A;  3UPU A;  3LLR A;  2E41 A;  3L42 A;  1YI2 Q;  1VQL T;  2V8K A;  2PVO B;  4F16 A;  2SRC A;  1M8V A;  4C8Q B;  1S72 Q;  1JJ2 A;  1UJ0 A;  1Q81 U;  1PRM C;  1GCQ A;  4M75 E;  4ZGE B;  4M7D E;  4M77 B;  3R6O A;  2GQV A;  1XJW B;  3J7A F;  2AKK A;  4C0D B;  4EMK C;  3GNG A;  4MZT A;  3LWH A;  1M1K U;  1WI7 A;  3NTI A;  2OI3 A;  2JUF A;  2DVE A;  8AT1 B;  3X20 B;  5HKC A;  3VS1 A;  1LPL A;  1WHJ A;  4C5I A;  2ROT A;  3M53 A;  1VQM T;  2KVQ G;  2JJ9 A;  4IUV A;  1Q95 G;  3QZ9 B;  1UGQ B;  2X4Y A;  4M75 F;  1B07 A;  4M7D F;  2RK2 A;  3G71 A;  3H0I A;  1WZO A;  1TOV A;  2MPX C;  2XK0 A;  3EFO A;  3MEA A;  1UG1 A;  3LW5 E;  2OTJ T;  5IT9 E;  1M1K R;  4LUE A;  2NLU A;  1N9S A;  3EHR A;  4M7A B;  5CKD A;  1PNJ A;  4KUL A;  5GAO n;  1WQ7 A;  4M78 A;  1U1T A;  4JRI A;  2YUO A;  4JLG A;  4XTY A;  1IRE B;  1NLO C;  1CSK A;  2DTI A;  1XOV A;  3EGU A;  4C92 C;  2W10 A;  2O01 E;  3HRS A;  5KCO A;  1KD1 C;  3OYD A;  1VQ6 T;  1VQK T;  1KHC A;  3PMI A;  1YIT T;  3C94 A;  4HA8 A;  1OYX A;  3MPU B;  4KGX B;  4R0K A;  5IXB A;  4OGC A;  2DO3 A;  1I07 A;  1KQ1 A;  2QGG A;  1ZSZ A;  1X2Q A;  3WXM B;  3M57 A;  5FWB A;  1LJO A;  1NM7 A;  1VQ7 T;  1FMK A;  3JCM g;  1UGP B;  1QP3 A;  2YRD A;  4IUQ A;  2ED0 A;  3TSW A;  4TVR A;  1YWO A;  3A8H B;  4FL6 A;  1TUD A;  1K73 U;  2EQI A;  4PJO A;  5GAN f;  2J05 A;  2E10 A;  5GAM h;  5A0D A;  2O88 A;  1UFF A;  4M7D A;  4XTV A;  3NFC A;  3H0H A;  2A0F B;  1VQP T;  1JJ2 P;  2DD4 A;  2BUD A;  3MP1 A;  1WHG A;  3REA B;  1NYG A;  2I2L A;  3HPW A;  4KUI A;  1B3Q A;  2HD0 A;  3BDL A;  1ZLM A;  5FW9 A;  4M75 D;  4PL6 A;  5AT1 B;  3UA6 A;  3GPL A;  1BI2 A;  4M7D D;  3CD6 A;  2ED1 A;  3OMC A;  5KYX B; 
#chains in the Genus database with same CATH homology
 1M3B A;  4FSS A;  1WXB A;  2AZS A;  1M3A A;  5ECA A;  1SRM A;  2FRY A;  3I35 A;  1T3S A;  1MV0 B;  1UHC A;  1W1F A;  2AK5 A;  2G6F X;  1QWF A;  2GTJ A;  3H41 A;  2J6O A;  1RLQ C;  1H92 A;  4JZ4 A;  1KFZ A;  4J9C A;  4LNP A;  4ZNX A;  1BBZ A;  1J3T A;  1SHF A;  4J9E A;  1GL5 A;  3NGP A;  3EHQ A;  2L2P A;  3I9Q A;  3TVT A;  1BK2 A;  3TSZ A;  1ZUK A;  1YP5 A;  1Y0M A;  1M8M A;  2LJ1 A;  1JO8 A;  2DL8 A;  2A28 A;  1VYV A;  1E6G A;  1FYN A;  2J6K A;  1PKS A;  1ZBJ A;  1I1J A;  4K11 A;  1GFD A;  1NEG A;  4RTT A;  1U5S A;  2EYZ A;  2CSQ A;  4KRT A;  2DE0 X;  2GGR A;  3JV3 A;  1ABO A;  1LCK A;  4AG1 C;  1ABQ A;  2LCS A;  1H3H A;  1WYX A;  1A0N B;  1N5Z A;  2RMO A;  1E6H A;  2K6D A;  4LN2 A;  4AFS C;  1UE9 A;  2HDA A;  2F2X A;  1GRI A;  2OJ2 A;  1X6B A;  2P4R A;  5I11 A;  1NYF A;  3QWY A;  2SEM A;  3LH5 A;  2KR3 A;  2L3Q A;  1K4U S;  1ZUU A;  2RQR A;  2CH4 A;  1SHG A;  2C0T A;  1JXM A;  1OPL A;  2KT1 A;  4D8K A;  2RQV A;  2DRK A;  4IIM A;  2KE9 A;  2LZ6 B;  2EGC A;  2D0N A;  2CT4 A;  3NPF A;  5HCK A;  2DL7 A;  2EYX A;  1WA7 A;  2YUQ A;  2FPD A;  3R6N A;  1JU5 C;  3VS4 A;  2KYM A;  2A37 A;  2CDT A;  1G2B A;  1QKW A;  2K3B A;  1AWW A;  2J6F A;  2PTK A;  3EG2 A;  2DF6 A;  1X43 A;  2DLP A;  4Z8A A;  4J9D A;  4LUD A;  1Y57 A;  2AKL A;  2CRE A;  1AVZ C;  1Z9Q A;  2J7I A;  2O2O A;  4J9G A;  1E7O A;  1YCS B;  5GJW B;  1GCQ C;  4RUG A;  2LQW A;  4RTY A;  3QWX X;  2H8H A;  2LQN A;  3U23 A;  4Z88 A;  2K9G A;  4J9I A;  2JS2 A;  1QLY A;  4RTU A;  2LX7 A;  4GBQ A;  5GJV B;  4J9H A;  2HSP A;  2K2M A;  1UTI A;  2BZ8 A;  2KXD A;  2F2W A;  4RTV A;  2KYB A;  2CUD A;  2A36 A;  4RTX A;  4A63 B;  2BZX A;  1GBR A;  1PKT A;  1V1C A;  2M51 A;  1T3L A;  1Z9Z A;  2CUB A;  2DL5 A;  2EGA A;  3M0R A;  2KRN A;  1SSH A;  1AEY A;  2KRS A;  4OMQ A;  3EG0 A;  1I0C A;  1SRL A;  2VVK A;  4IIO A;  3PVQ A;  2L3S A;  2EW3 A;  2K7A A;  2PZ1 A;  5IHI A;  1AOJ A;  1BB9 A;  3I5S A;  2V1Q A;  1JXO A;  5IH2 A;  4Y92 A;  1GBQ A;  2DA9 A;  2FPE A;  2LMJ A;  2BTT A;  5I22 A;  1AWJ A;  1WXU A;  1X2K A;  1WIE A;  3VS0 A;  4JZ3 A;  4F17 A;  1RLP C;  2O31 A;  1JEG A;  2KEA A;  1NLP C;  4ORZ A;  1KIK A;  5IHN A;  2EYY A;  2RQW A;  1K76 A;  1K1Z A;  2YT6 A;  1WDX A;  1SPK A;  1YNZ A;  1QKX A;  2EKH A;  2DMO A;  1W70 A;  1OPK A;  2FO0 A;  1X27 A;  1WFW A;  2ABL A;  2KT8 A;  1BU1 A;  1M3C A;  4CC4 B;  1RI9 A;  2YSQ A;  3PE0 A;  3RNJ A;  1ZUY A;  3NMZ C;  1UUE A;  4RTW A;  1HD3 A;  2DL3 A;  4WCI A;  1IO6 A;  4JJC A;  1CKB A;  4ESR A;  3ULR B;  2JTE A;  1GCP A;  2YUP A;  4X1V A;  1NG2 A;  2D1X A;  2CT3 A;  2KNB B;  2DVJ A;  3KFV A;  3SEM A;  1EFN A;  1PWT A;  3RBB B;  2OAW A;  2V1R A;  2RPN A;  1AZE A;  4HVW A;  2VKN A;  4HVU A;  2D8H A;  2J06 A;  4HCK A;  1VYT A;  3VS6 A;  2B86 A;  1AD5 A;  3ZL7 C;  2KXC A;  4DEY A;  1M27 C;  3THK A;  3NHN A;  1GFC A;  3M0S A;  4EIK A;  2NUZ A;  2EGE A;  2DBK A;  1SEM A;  3IQL A;  2JMC A;  4AFZ C;  2HCK A;  3UA7 A;  2KBT A;  1K0S A;  2YDL A;  3M0Q A;  2LP5 A;  2X3W D;  1OV3 A;  2RN8 A;  4AG2 C;  4GLM A;  1ZX6 A;  1VYU A;  2KRM A;  3EG1 A;  2EBP A;  1AWX A;  1CKA A;  1W6X A;  4OMN A;  4OMO A;  1AZG B;  1YWP A;  2MIO A;  4F16 A;  2SRC A;  4J9F A;  3VRZ A;  1RUW A;  2L0A A;  1UJ0 A;  1PRM C;  2C0I A;  2DRM A;  1GCQ A;  4OML A;  1ARK A;  1HJD A;  5EC7 A;  1K9A A;  2HBW A;  2PNI A;  2A08 A;  2F2V A;  1QWE A;  2AKK A;  3VS7 A;  4F14 A;  2JMA A;  3GBQ A;  3UAT A;  2XMF A;  1WI7 A;  2QDL A;  2DNU A;  2OI3 A;  2D8J A;  4OMM A;  3PVL A;  3SHW A;  3VS1 A;  1AWO A;  3REB B;  2DBM A;  2ROT A;  3A98 A;  4CC2 A;  1M30 A;  2ENM A;  3FJ5 A;  3EG3 A;  4JPB W;  2IIM A;  4E6R A;  2LNH B;  4HVV A;  2JT4 A;  1X6G A;  2HEQ A;  1B07 A;  3VS3 A;  3VS5 A;  3H0I A;  1OEB A;  1TUC A;  2GQI A;  4JJD A;  1NEB A;  4JJB A;  1UG1 A;  1OOT A;  2O9S A;  3O5Z A;  4LUE A;  1VA7 A;  1UGV A;  2ESW A;  1UHF A;  3EHR A;  3H0F A;  1PNJ A;  4Z89 A;  2DM1 A;  4DEX A;  2JM9 A;  2YUO A;  1JQQ A;  2FRW A;  1WXT A;  1NLO C;  1CSK A;  1MUZ A;  1XOV A;  2KGT A;  1UEC A;  3EGU A;  2ECZ A;  2W10 A;  2MCN A;  4LE9 A;  3VRY A;  1U06 A;  1S1N A;  2W0Z A;  1MV3 A;  2RNA A;  5IXF A;  2EPD A;  3M0T A;  1X69 A;  2JM8 A;  4RTZ A;  4R0K A;  5IXB A;  4OMP A;  1T0H A;  1I07 A;  2EYW A;  5FWC A;  2RQU A;  1X2Q A;  1UJY A;  2DYB A;  5FWB A;  1NM7 A;  1U3O A;  1WX6 A;  1TG0 A;  1PRL C;  2CSI A;  3M0P A;  3M0U A;  1FMK A;  2I0N A;  4D8D A;  4CC3 A;  4AFQ C;  2FPF A;  2DIL A;  2LJ0 A;  2VWF A;  2MOX A;  2KRO A;  2JW4 A;  4CC7 A;  2ED0 A;  2AZV A;  1KJW A;  4J9B A;  3TSW A;  3UF4 A;  2DJQ A;  2RF0 A;  5IHK A;  2RQT A;  1YWO A;  2YUN A;  2L3P A;  1UDL A;  1TUD A;  2EVR A;  1H8K A;  2EQI A;  1HSQ A;  2ROL A;  2BZY A;  5L23 A;  2J05 A;  2E5K A;  1KSW A;  2NWM A;  2O9V A;  4AFU C;  2JXB A;  1PHT A;  2FEI A;  2O88 A;  1YN8 A;  2GNC A;  1UFF A;  3CQT A;  3H0H A;  2CH4 W;  3I5R A;  1QCF A;  4M4Z A;  2JS0 A;  4HXJ A;  1T0J A;  3REA B;  1NYG A;  1ZSG A;  3C0C A;  2LJ3 A;  1B3Q A;  1G83 A;  2GTO A;  1WLP B;  2DX1 A;  4QT7 A;  2FG0 A;  1ZLM A;  5FW9 A;  1K0X A;  3UA6 A;  3VS2 A;  2C0O A;  2K79 A;  2GBQ A;  2ED1 A;  2M0Y A;  2X3X D;  2DL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...