2JT4A

Solution structure of the sla1 sh3-3-ubiquitin complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
MASKSKKRGIVQYDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEPVRDKKHTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Ubiquitin Recognition by SH3 Domains
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords Cytoskeleton assembly control protein SLA1
total genus 13
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jt4A00
4LE9A 4OMMA 4F14A 1VA7A 3VS3A 3H0HA 1ARKA 1I0CA 1W6XA 4OMPA 1M3BA 1WFWA 1JU5C 1KSWA 1WXTA 2M51A 2ABLA 2ECZA 2PTKA 1SHFA 2DA9A 2LJ0A 4Z88A 2DRMA 2DF6A 2DRKA 1ZUKA 4ESRA 2KYBA 1PKTA 2LQNA 1KFZA 1Y0MA 1UJYA 2AZVA 2X3XD 2EYXA 2L2PA 5L23A 4K11A 2DNUA 1GCQC 1TUDA 5FWCA 3VS7A 2HBWA 2IIMA 4OMNA 3UA7A 1NEBA 3VS6A 1M3CA 2FPFA 2RNAA 2JS0A 2GGRA 2DYBA 2KEAA 1OPKA 2J6OA 1M27C 2L0AA 5FW9A 4IIMA 2HCKA 4RTZA 3EHRA 2NWMA 1PWTA 4AG1C 2DM1A 4KRTA 1VYUA 1RLPC 5IHKA 4J9BA 3SEMA 3VS5A 1G2BA 2ED1A 2JXBA 1NYFA 1OPLA 1MV3A 1WX6A 1OV3A 2I0NA 2LQWA 1CKBA 2EYWA 3EG3A 1HSQA 2W0ZA 1ZLMA 1PRLC 1MV0B 1NM7A 3RNJA 2FEIA 2K6DA 2BTTA 2BZ8A 4JJCA 2RQVA 3I9QA 4F17A 2A08A 2JW4A 4GLMA 2O2OA 2LNHB 4ZNXA 1ZSGA 2K2MA 1ZX6A 2CSQA 1FYNA 1U06A 2A28A 4DEXA 1WIEA 1G83A 2DL7A 2HEQA 3NPFA 1GCPA 1UTIA 1JXMA 1CSKA 1UJ0A 2D0NA 2LP5A 1GBRA 1AWWA 2HDAA 2KYMA 2GTOA 1SRLA 5ECAA 1YWOA 1KIKA 3M0PA 3EG2A 2FPEA 2EBPA 1ABOA 2EYZA 2YUNA 2A36A 2D8HA 3NHNA 4EIKA 3IQLA 1RLQC 1QKXA 2DL4A 4Z89A 4HVVA 2DMOA 2RF0A 2BZYA 3M0RA 2KROA 2D1XA 2SRCA 2F2XA 2RQRA 1AZEA 2EGEA 3PVLA 1AEYA 2YDLA 1SPKA 2KT8A 4AG2C 4F16A 2YUOA 1AWJA 4RTWA 1GFDA 1B3QA 1I1JA 2BZXA 3UATA 1Z9ZA 2EKHA 4DEYA 1X27A 2F2WA 1QKWA 4RTYA 1J3TA 5FWBA 3NGPA 1H92A 1GRIA 1AWXA 1YNZA 3RBBB 2YUPA 5GJWB 1IO6A 4Y92A 2OAWA 2KNBB 5I22A 3NMZC 4HVUA 4CC3A 1GBQA 3REBB 3C0CA 1UGVA 1W70A 1ABQA 1YP5A 4QT7A 2AK5A 2RMOA 2EYYA 2DJQA 2ED0A 2JM8A 3ZL7C 2OI3A 2C0TA 2MCNA 2KRSA 1FMKA 2OJ2A 3QWXX 2LCSA 2D8JA 2E5KA 4RTUA 1WXUA 1H3HA 2DE0X 2EPDA 2DLPA 1X2KA 1E6HA 4JZ3A 2CSIA 2CT4A 2DL5A 1JO8A 1JQQA 4D8KA 4R0KA 3UA6A 2FRWA 5IH2A 2ROLA 2CUDA 3KFVA 2KE9A 1X43A 3VS1A 4JJBA 4OMOA 2DX1A 1EFNA 2SEMA 3I5SA 5EC7A 2VKNA 4A63B 1SRMA 2F2VA 4J9IA 2DL8A 4RTTA 2O9SA 2RN8A 2O31A 1SEMA 2LJ3A 1I07A 2V1QA 4CC7A 1S1NA 1AOJA 2J05A 1K0SA 2KRNA 1JEGA 2NUZA 3JV3A 4J9HA 4X1VA 5IHIA 1WXBA 3PVQA 1M3AA 1TG0A 2JMCA 4LUDA 2J6KA 1A0NB 1Z9QA 2GTJA 1WYXA 2FRYA 4J9CA 2QDLA 3H0FA 2JS2A 1SSHA 2RQTA 4OMQA 1PRMC 5IHNA 3I5RA 1WI7A 2P4RA 4JZ4A 2EQIA 2KT1A 3M0TA 3EHQA 1WLPB 1BK2A 1X2QA 1TUCA 1N5ZA 1ZBJA 2VVKA 3TSWA 1H8KA 2KRMA 1NEGA 1UECA 3H41A 3UF4A 2EW3A 3PE0A 2MIOA 1UG1A 1GFCA 3EG1A 4RTXA 1NLPC 1GL5A 2L3SA 3VS4A 2VWFA 3TVTA 1E6GA 4GBQA 2JTEA 1X6BA 2EGCA 4LNPA 1V1CA 4D8DA 2K3BA 1UFFA 2PNIA 1K1ZA 2J7IA 4J9DA 2FPDA 2CREA 2C0IA 1UE9A 1ZUYA 1X69A 4ORZA 2ENMA 2C0OA 2K9GA 2JM9A 2LJ1A 5GJVB 4RUGA 1M8MA 2CDTA 2O88A 1OOTA 4J9GA 4Z8AA 1MUZA 4HVWA 1BB9A 1RUWA 1T3LA 2KBTA 2XMFA 3REAB 1M30A 4CC4B 2X3WD 1NYGA 2KGTA 2RQUA 2YT6A 2FG0A 4J9EA 5HCKA 2K79A 1KJWA 3CQTA 1T0JA 3U23A 1T0HA 4LN2A 1AZGB 3M0QA 1BU1A 1CKAA 2KR3A 2K7AA 1U3OA 2LZ6B 1AWOA 1GCQA 2DVJA 1E7OA 3O5ZA 2CH4W 4HXJA 1K0XA 1X6GA 1OEBA 4HCKA 2LX7A 2W10A 2DILA 3VS0A 3FJ5A 1YCSB 2AKLA 1W1FA 2O9VA 5IXBA 2CH4A 2L3QA 2RPNA 2KXCA 3EG0A 1T3SA 3R6NA 1QLYA 3THKA 5I11A 1BBZA 1AVZC 2AZSA 1UDLA 2LMJA 2AKKA 2B86A 2V1RA 1XOVA 4AFUC 3VRZA 1VYVA 2CT3A 2G6FX 1K76A 2JMAA 1NG2A 4JJDA 2H8HA 3LH5A 2DBMA 2RQWA 1K4US 4RTVA 1ZUUA 2EGAA 4AFZC 1QWFA 1WA7A 1B07A 1QCFA 2YSQA 2A37A 5IXFA 4CC2A 2YUQA 3SHWA 3H0IA 4E6RA 4M4ZA 3I35A 1U5SA 1RI9A 2DBKA 2EVRA 3M0UA 1AD5A 1VYTA 1UUEA 4AFSC 2ROTA 2GNCA 1PHTA 4IIOA 3QWYA 2GQIA 2HSPA 1PKSA 1UHCA 2KXDA 1PNJA 2J6FA 3A98A 1HJDA 4OMLA 1YN8A 2ESWA 1NLOC 4JPBW 4LUEA 2MOXA 3EGUA 1QWEA 2GBQA 1JXOA 1SHGA 3VRYA 2FO0A 1Y57A 2JT4A 1LCKA 1K9AA 1YWPA 3VS2A 1HD3A 2DL3A 4FSSA 4WCIA 3ULRB 2L3PA 4J9FA 2J06A 1WDXA 2M0YA 2PZ1A 1UHFA 3TSZA 3GBQA 3M0SA 2CUBA 4AFQC
chains in the Genus database with same CATH superfamily
4LE9A 2F69A 2LNVA 2QA4Q 2EQJA 2AT1B 3V8JA 4J6YA 3CXCP 4O6JA 5CK9A 2RK2A 2V8IA 1NJIU 4OB3B 3RESA 3INZA 2M16A 3CCMQ 1JU5C 4M7DF 2M51A 3R6OA 1VQ8Q 2IVWA 5HK0A 1UGQB 2LJ0A 4XTWA 2COYA 2EQMA 5FRMA 1ZUKA 3S3MA 2DIGA 2KYBA 3EFRA 3GLXA 1B34B 2X3XD 4N0AA 2GF7A 2P0QA 3CCUQ 1GCQC 3CCVT 1QCNA 3MEUA 4OMNA 3LYIA 3QG1A 8AT1B 5DY9A 2GGRA 2DYBA 3JCMg 4C92D 3HTRA 1IGQA 3OYBA 4PJOD 3QYHB 4XQ3A 2LX9A 3OYMA 2HCKA 4DBQA 3M57A 3JCMQ 2E5QA 4PJOA 1V76A 1VQ4Q 3SEMA 1I5OB 4J8OA 1OPLA 1MV3A 1G3TA 2EJGA 2QYZA 4FSXA 4FYVB 3M54A 2EYWA 1ZLMA 2LTOA 2FEIA 1VQ7A 4A53A 2BTTA 2K57A 4XTXA 2G3RA 3CCJT 4JRPA 4JJCA 1YITQ 2RQVA 4DBHA 5GMKi 3CBOA 1VQ5T 4N4IA 1WZOA 2RHYA 1ZSGA 1QVGS 4DEXA 4PJOF 2DL7A 4PJLA 1G3YA 2QXFA 1N6AA 2QA4A 3RDVA 1XJWB 2GTOA 3MJXA 3JCMW 3MEWA 1YIJT 1VQLQ 4JJNK 5LJ5g 2EBPA 2EYZA 2D8HA 3NHNA 1IRXA 4E2FB 4EMGA 2E3IA 1YBYA 4HKEA 4QQGA 3CC4Q 1FMVA 2RF0A 1XTDA 2BZYA 4FYYB 2VASA 2KROA 2COZA 1VQOA 3QJYA 1YHQQ 2EJ9A 3CD6T 3UWNA 5LJ5f 5C6SA 3C12A 2E1HA 2OTLT 3AHUA 1WGSA 5GAN2 3GNFB 1GFDA 1B3QA 2BZXA 3UATA 1RADB 2HMAA 1X27A 4RTYA 1J3TA 5FWBA 3NGPA 2HL5C 1YNZA 2R5AA 2LCCA 2XU8A 5GJWB 4E7JA 3OA6A 1WJSA 1UB4A 5I22A 2DD4A 5HKCA 4CC3A 3OYAA 2HQXA 5L8RE 3SWNA 2LQ8A 4ANJA 1C0MA 4A4EA 3BDUA 3GP8A 2EYYA 2DJQA 2NUTB 1YIJQ 2C0TA 2KRSA 1YI2A 3FEOA 5GAOr 2AIRB 2E5KA 4RTUA 4KT0E 3JCMf 1H3HA 2EPDA 2DLPA 2RI3A 1RAIB 3TQ7P 2ZPGB 2IG0A 2XDDA 2CT4A 4C8QB 1JQQA 2RHUA 3UA6A 3CD6Q 2JOYA 3A8HB 5IH2A 4M75C 2RB6A 3GF5A 3LWHA 3BW1A 1PCXA 2QGFB 1P92A 3OSSC 3MHXA 3G6EQ 5EC7A 5HK3A 3CCRQ 4A63B 3EGDA 4WTOB 1K73C 1YJ9A 4X34A 1UEBA 2LJ3A 2NUPB 4F7UB 2V1QA 2DZCA 1BYMA 2HQHA 2NUTA 1LJOA 3F70A 2P84A 3RMSA 1VQKA 4C92A 1K0SA 3CMET 4MZTA 1U1SA 1JJ2P 3JV3A 2L3RA 4X1VA 4PFOA 5GAN4 5IHIA 5FRNA 3PVQA 3QYGB 4BACA 1RAFB 2Y4XA 2J6KA 1VQ7T 1NPRA 5GANj 2ZGWA 2RD1A 3JRZA 2R5MA 1M90U 3HHTB 3EGDB 2DIQA 3T9NA 2CP2A 4M75A 2WSFE 4ZTFA 4XU1A 4EMKC 1VQMT 1BK2A 1Q82U 3QDFA 1N5ZA 3VUZA 3UF4A 4PJOE 1M5Q1 3SWNC 1SF9A 3PFSA 1GFCA 3H9NA 1GL5A 2L3SA 3VS4A 1VQLA 1YIJA 5KYWA 4NL3A 3DLLA 4C8QG 2F5KA 2FPDA 1UE9A 4M7DC 1MNDA 2QQSA 4RUGA 3QBYA 3CCVQ 2O4XA 2CDTA 4J9GA 2QQAA 1T3LA 2QDYB 1BI3A 4Y91A 3OW2A 3EGXB 2X3WD 4CC4B 2DXUA 2EKOA 3EH2A 4EDUA 5HCKA 1KJWA 3LGLA 3E1SA 3U23A 3X24B 2KR3A 4M7AB 3CPFA 5FU7B 2X35A 3OYGA 2E4HA 4FW1A 1YJNT 2DVJA 1AWOA 4A4HA 2VGNA 3URGA 2FB7A 3P8BB 3CMAA 3CCLA 1W1FA 4XK8E 2O9VA 2HBPA 1OZ3A 2KXCA 4GY5A 3HRTA 4C0ZA 5J3BA 1YFNA 3PMIA 2KVQG 2YXYA 2AZSA 2IPOB 2LMJA 1YI2T 1Q7YU 2B86A 4C5IA 2E64A 5GANd 2V1RA 4AFUC 4M78B 1I4K1 2G6FX 1K76A 5AT1B 2A3LA 1NE8A 1N27A 3LH5A 3QZ5B 4PK4A 1K4US 1ZUUA 1VQ5Q 3UPUA 2YLBA 3CPWS 3RUXA 1QCFA 5FU7C 2YSQA 2A37A 4CC2A 4LDVA 3TU4K 4BE0A 4M78E 2E12A 3L2RA 1I5LA 4FL6A 3M0UA 2QI2A 3CCEQ 1EIFA 4ELZC 3QWYA 1TH7A 4XTUA 3G4SA 1YN8A 3CC4A 1NLOC 1ACMB 1VQKT 3V7CA 3C4SA 1M8VA 3P8DA 3MKDA 1JXOA 5GAN6 4M7DD 1SHGA 1VQ6Q 3VRYA 4LDUA 2EAYA 3CC2A 2DTIA 2NUPA 3G71A 4FSSA 1BI1A 4AT1B 3SWNB 4M78D 3ULRB 3CCUT 1G5VA 4X9CA 2L3PA 2GFUA 2QQ9A 4RMOA 4RTTA 2QK0A 4EMKB 3I55A 6AT1B 3LWIA 1VQMA 3C95A 3NFCA 4Z02A 3AT1B 3H0HA 4IUTA 2E3HA 1WXTA 5KYUA 4BY6B 3KBGA 1SHFA 1M1KR 2K4YA 5C0MA 2DA9A 1WQWA 2HQEA 1RAGB 2DF6A 2LQKA 2DVEA 3V7SA 3OS2A 1N8RU 2LQNA 1Q86R 4KUDK 2HZYA 1KFZA 2H3EB 1UGPB 1UGRB 4PJOB 4K11A 3VS7A 3JB9D 1UGSB 4F7UF 2MMPA 1VQKQ 2HBWA 2IIMA 1AT1B 3VS6A 4L59A 2A0FB 2HKNA 1OULA 4M75E 3ZEHA 3JAME 1M27C 4PFZA 2L0AA 1M1GA 5FW9A 2K5LA 2NWMA 4C5EA 3CCQQ 1WHKA 3CMAQ 3CCLQ 3VUBA 3PNWC 2DM1A 4KRTA 1VYUA 5KYXA 5IHKA 4B6MA 1JB0E 2NLUA 2ED1A 2JXBA 4QKUA 2XK0A 1WX6A 1VQ9A 2K3XA 3CCST 2JTMA 2W0ZA 2FL7A 1MV0B 1NM7A 2BE7D 3JCMV 4M75D 5I2SA 2RO0A 4KGVB 3CCJA 5GAMd 1QQJA 2A08A 1DJ7B 1RAHB 1VQMQ 1VQ5A 2MWOA 5GANg 1NZ9A 4ZNXA 8ATCB 2FVUA 1U06A 2KQWA 2FHDA 4TVRA 2ZPEB 1WIEA 2HEQA 3NPFA 1G8XA 2RJEA 5FLXE 1M1FA 5DLOA 2ZAEA 2GQVA 3SD4A 2DTOA 2RJDA 4PJNA 2E6ZA 2YRCA 2K5IA 5KCOA 3OB9A 3M0PA 5CKHA 2DD5A 5GAN7 2M9UA 4KH0B 2A36A 4EIKA 3IQLA 5LL6S 3L2WA 5D6XA 1RAEB 2LDMA 2I2LA 5LJ3g 2D1XA 2XDPA 2ZPIB 2SRCA 3JCMJ 5CKBA 2OTJT 3M4GA 2EGEA 5CQYA 1Y7XA 2O4XB 4BDYA 1SPKA 1K8AU 3L2QA 1R0BG 2PUOB 4RTWA 4PNOA 2EKHA 3LLRA 4II1A 3JCMe 2JUFA 3LW5E 2F2WA 1QKWA 4DBRA 3CCRA 5LJ3f 2WSEE 1KD1U 1H92A 1ZBXA 1GRIA 1AWXA 1N8RC 3MP6A 2YUPA 4Y92A 2CP3A 2X4XA 1ZHIA 4FIBA 5GMKh 4A4FA 2E65A 5GAMe 1GBQA 1W2BS 3CCVA 2MI6A 3JB9I 1IGUA 4BB7A 4C0FA 1TS9A 3JCMX 2MCNA 3M53A 1Q81U 1YI2Q 5FU6C 2MF2A 1VIEA 1QP2A 2X4WA 3FB9A 2FZCB 1M2OA 2CSIA 2DL5A 2X9HA 1K73R 1TTHB 2ROLA 4M75G 2CUDA 1M90C 2HAXA 1U1TA 5GAOl 4M78C 1OI1A 4OMOA 2L89A 4M7DB 3OYIA 1SRMA 5KYNA 4J9IA 2DL8A 2RN8A 2O31A 1SEMA 4BUGA 2L5QA 2BE9B 4GLKA 1QCOA 1VQ4T 1KQ2A 1I81A 4M75B 3HKSA 2QEXT 3WVDB 1MHNA 4B9XA 2KRNA 4J5YA 2NUZA 3PIOA 2RHXA 1WXBA 2ZPHB 4LUDA 4OF1A 3JB9G 5D6YA 5AYFA 2QDLA 4DBFA 1H3ZA 4C5HA 1SSHA 4OMQA 5IHNA 2P4RA 1OX9A 2DO3A 1D0YA 3M0TA 1YHQA 3CD6A 3EHQA 3RERA 4RCCA 1X2QA 3J80E 1ZBJA 2VVKA 2OTLA 4J6XA 2KRMA 1NEGA 3H41A 5CKFA 3OS1A 3VKIA 1SSFA 1Q7YR 4LXCA 1YITA 5EG2A 1Q82R 4RTXA 1NLPC 4NOYA 4DOVA 2K3YA 2JTEA 1X6BA 2EGCA 4LNPA 4D8DA 2K3BA 1VQLT 1UFFA 3BE3A 2AHJB 1QP3A 5DM7R 2J7IA 4EPCA 2CREA 3OSVA 1KQ1A 1X69A 4ORZA 2ENMA 2C0OA 2K9GA 4M78G 2JM9A 1VQ7Q 4E7ZA 1OOTA 3META 2V26A 2OAUA 1RUWA 2RK1A 1KK7A 1QMCA 1KQSP 3REAB 1M30A 3DKMA 4M7DG 1ZA2B 2F5TX 4C8QC 4X9DA 2YT6A 2FG0A 4FU6A 1KC8U 3V8KA 4QQDA 3M9QA 2PU9B 4FW2A 3CCQT 2YLCA 1MGQA 1YJWQ 4LN2A 4BI4A 1CKAA 3CC7Q 2XHCA 2K7AA 1IB8A 5KYWB 5GAMg 4YTLA 5LJ5h 5GAOn 2JN0A 3O5ZA 1VOMA 1YJNA 4BE2A 4QW2A 1X6GA 1OEBA 1WHJA 4Y28E 2NYSA 3FJ5A 4BE1A 3GNGA 3VYHB 2AKLA 2MK5A 5IXBA 5GMKl 2CH4A 5CO7A 4KH1B 4FCYA 3E9GA 5I11A 2P4TA 3CCET 1AVZC 3CCSQ 1YJ9T 3SDZA 1RAAB 3OBWA 2AKKA 1KHCA 3ER0A 3VRZA 4XTZA 2CT3A 4C0GA 2JMAA 4OGEA 3JB9H 2PVGB 5CKDA 2CP0A 2RQWA 3LH0A 1WJQA 2VB6A 4RTVA 4IURA 4AFZC 4LD9K 1JJ2S 1WA7A 2HSEB 1B07A 4KUIA 4B9WA 3OYKA 3CCMT 5IXFA 1M1KU 2D0QB 3NTKA 1S72Q 3H0IA 1YJWT 4XU3A 1U5SA 4KBMB 2EVRA 4RKUE 1ZSZB 3OYEA 3JB9J 1MMGA 1VYTA 2VXFA 2XG8D 2RJFA 9ATCB 2GNCA 2HSPA 1W4SA 4AMCA 5M9OA 3A98A 2MAMA 4JLIA 1VQ4A 2ESWA 4M77F 1B34A 2KI7A 1H641 2RI5A 1VQOQ 1RACB 1WPYA 2JT4A 1V29B 2DEUA 3VS2A 3QSUA 2DL3A 3TEEA 4WCIA 3CCUA 1WDXA 4C8QD 1VQPA 1UHFA 3TSZA 1K8AC 3GBQA 2CUBA 4AFQC 4C92F 3EG9B 2VC8A 4F14A 1VA7A 3VS3A 1ARKA 1I0CA 1W6XA 1ZSZC 4R55A 1WFWA 1KSWA 5DLQE 1S72T 4HCBA 2CP6A 2ABLA 1M4ZA 1SKUB 3M5AA 2ECZA 2LT4A 3CPWP 2EJFA 4Z88A 3CCJQ 1VQ6T 3FIFA 4M7AF 3X25B 4ESRA 3SB2A 1PKTA 5A0DA 4ZN1A 1UJYA 3CBMA 2EYXA 2HKQB 2PVDB 3EGXA 3SFMA 5FWCA 4XTVA 4C8QA 1NJIR 1WHLA 2RNAA 3OY9A 3H8ZA 2JS0A 2QTXA 1EZZB 3QHSA 4IIMA 4PL6A 3CCQA 1PWTA 4AG1C 1OU9A 3HFOA 4NL2A 5I2MA 3VS5A 1G2BA 3QKJA 2ATCB 3OYNA 3A5ZB 2LRQA 2DPPB 1NYFA 1FXXA 3A1PA 1OV3A 2I0NA 2LQWA 3QJ6A 1CKBA 4M7AC 3EG3A 1HSQA 1Y96A 1HXDA 3WVEB 2KY9A 5CIUA 4E7SA 2EQUA 2K6DA 3OW2S 2CZ1B 4RCBA 3CCEA 3I9QA 4KGXB 2GFAA 2JW4A 4GLMA 2LNHB 5KCHA 1VUBA 1ZX6A 2CSQA 1FYNA 2CS7A 3JCMc 4V2SA 4E7KA 2EFIA 2F1LA 4ZGEB 2D0NA 2LP5A 1JXMA 1CSKA 5GAOp 4JRKA 1AWWA 1M9SA 3TREA 2EYQA 1XNIA 2KYMA 5IAYA 1SRLA 3GPLA 1YWOA 2YHTA 1KIKA 5GAN8 2FPEA 3CCMA 1ABOA 1ZA1B 5FU6B 4J83A 1RLQC 2DL4A 4Z89A 2DMOA 1LNXA 3I55T 1BIAA 2PVOB 3G7ZA 2MPXC 4M7AA 2XI9A 1Y96B 2CP5A 1WQ7A 3PVLA 1M2VB 1AEYA 1FMWA 4AG2C 1AWJA 1KG1A 1NBEB 2CKKA 3TCJA 1I1JA 1Z9ZA 1Y71A 1K9MC 4FYXB 2VYTA 2JTFA 2EIFA 4VUBA 3CCRT 1C6VX 3EFOB 2OAWA 2KNBB 2JNGA 2Y90A 3OYFA 4HVUA 3EG9A 3L2ZA 4JRIA 2KK4A 4C8QF 3PMTA 3QUIA 1UGVA 1WHHA 3EH1A 1ABQA 4QT7A 3LGFA 3ZBDA 4QVDA 3ZL7C 3RMQA 2QGGA 3EFSA 3L2UA 2LCSA 1RI0A 2ZZDA 3MP1A 2DE0X 4PJMA 4IKFA 1M1KC 5LJ3d 1X2KA 2QEXQ 1E6HA 4MMKA 4JZ3A 1IZ6A 1LOJA 3I55Q 1VQ6A 2RH2A 4L5GA 2EQKA 4D8KA 2FRWA 3UT1A 1QVGP 2XIDA 1WHGA 3KFVA 1X43A 3VS1A 3NTIA 3QXEB 5CCAA 4JJBA 2DX1A 1EFNA 1NPPA 2SEMA 3I5SA 4OVAA 4PLIA 3OYDA 2VKNA 2FYKA 5CVIA 2WACA 2M1HA 4C0DC 2F2VA 3S6WA 1BIBA 3VYGA 4BI3A 4M77A 5CKEA 1I07A 4CC7A 4ELYC 1S1NA 1AOJA 2J05A 2DXCA 4PJOG 4C92G 1TOVA 1JEGA 3MO8A 5GMKm 2DKGA 5LJ5d 2YWWA 4XTYA 4ME7A 1KQSA 3Q1JA 1QVGA 1Z9QA 3S3NA 4P5NA 5J39A 2JS2A 1OU8A 4D6WA 2RQTA 1PRMC 1WI7A 4JZ4A 1KD1C 2EQIA 2KT1A 2QTVA 4IUQA 3M0SA 5LJ3e 2P0PA 1K73U 1OYXA 4EMHA 1TUCA 1BCOA 4M7DA 5LJ3j 3OQ5A 2COWA 1UECA 2EW3A 4HT8A 2MIOA 1VQPQ 2LCLA 3OS5A 3HL8A 2VWFA 3HRSA 3TVTA 4GBQA 4HA8A 2CZ7B 3RKWA 2OTJQ 4DOWA 3HRUA 2PNIA 3CXCS 4J9DA 5GJVB 2DEQA 3P8HA 3VU3C 4BY6C 2O88A 4Z8AA 4JDSA 4DA4A 3DB4A 4HVWA 1BB9A 3QZ9B 1TSFA 4ZGDB 2CZ0B 3V7RA 1W2BP 2QQBA 3ZFJA 1X01A 2KGTA 2RQUA 4XU2A 2MWPA 2ZPBB 1WJRA 4J9EA 3CXCA 2K79A 1T0JA 1T0HA 3GIBA 1Q95G 1AZGB 1BU1A 4N0AC 1KD1R 2LZ6B 2DETA 3NTHA 1Q86C 1GCQA 1E7OA 2CH4W 4HXJA 4M77C 5GANf 3VV0A 2W10A 1VIFA 4RG8A 3VS0A 4FYWB 1YCSB 2M02A 1PM3A 1VQNQ 3OS0A 2HD0A 3EG0A 1T3SA 3R6NA 1QLYA 3THKA 1BBZA 3OMGA 4M7AE 3E2UA 3M4YA 1D1CA 5CR2A 1N9SA 3MCAB 4DQ2A 4ZGJB 1BKBA 3FRNA 1XOVA 1VYVA 4J7FA 3OMCA 5GAN5 1I8FA 1HK9A 3CPWA 2EGAA 3MP8A 1IHVA 3WXMB 2DAQA 1QWFA 3PT9A 2GCXA 2PUKB 4A54A 4HCZA 3MEVA 3FDRA 2VUBA 2DFUA 3MEAA 2A7YA 2BKDN 4E6RA 4M4ZA 3CC7A 3I35A 4C8QE 2DBKA 4M7AD 1AD5A 1UUEA 4AFSC 4PKCC 2DK3A 4QQ6A 1YHQT 2RM4A 2E6NA 4PFPA 1UHCA 1FX7A 4CRIA 1PNJA 4ZTJA 4LDXA 4OMLA 1G3WA 2OX7A 5A0GA 1Q81C 4JPBW 2MOXA 3QIIA 2R58A 5GAN3 1Y57A 1LCKA 1YWPA 4F7UE 1HD3A 3ASKA 1D0ZA 2E10A 2Z0WA 1MMAA 4J9FA 2J06A 2RHZA 3HFNA 3X28B 1VQ8A 3JSCA 5GANe 4L6V5 4OMMA 4F04B 1KQSS 4OMPA 1M3BA 1ZQ1A 2QG9B 3X20B 1R0CB 2PTKA 4J6WA 1S72A 3OW2P 3A8GB 4JLGA 5LJ5j 2DRMA 4M77D 1X6OA 3ME9A 3CC2T 2DRKA 3G71T 5HY6A 3HSBA 4MDWA 1W2BA 3A8MB 1Y0MA 2AZVA 2L2PA 4ZN3A 5L23A 3QDRB 3S3OA 2DNUA 1TUDA 5GAOm 2V8JA 3UA7A 1NEBA 2RJCA 1M3CA 2FPFA 1VQ9Q 3D7SB 3N5BB 2KEAA 1OPKA 3X26B 3M55A 2BUDA 2J6OA 4QVZA 5GANh 1C1AA 1R8OB 2X4YA 4RTZA 3EHRA 1QVPA 2O01E 3BFMA 2B8AA 1RLPC 4J9BA 3DLMA 4C92B 1NJIC 3EFOA 4OP0A 4C5GA 4BDZA 3JCMP 2K5FA 4JS5A 3HP9A 3J81E 2LT1A 1O75A 5CQXA 3JCMd 2JZ2A 1QVFA 3E9FA 1PRLC 1YJWA 3FLGA 1M2VA 4WF2A 2YRDA 3RNJA 2BZ8A 3FC3A 3OYYA 3I56T 5GAMj 4MMLA 4C92E 1B7TA 4F17A 2O2OA 2K2MA 2OTJA 2OTLQ 4M78F 4LD6A 2A28A 3JCMh 1F1BB 4C92C 3QO3A 1G83A 1UTIA 1GCPA 1UJ0A 1GBRA 3HPWA 5GAMf 2HDAA 1KC8C 2HNIA 5KE2A 1GXIE 1VQ9T 3CCSA 2LVMA 1PG5B 5ECAA 5GMKe 1R77A 4E47A 3EG2A 5GMKj 2YUNA 5KE3A 1RABB 4MDXA 1HYOA 1QKXA 4OB2B 5GAOq 4HVVA 1VQPT 4QVCA 3M0RA 1VQOT 4A4GA 2F2XA 2RQRA 1AZEA 4OB1B 1TUGB 2RA2A 3L2VA 2VGMA 2YDLA 3M59A 2E41A 2KT8A 4F16A 2YUOA 1D1BA 2DXTA 3UDCA 4M77E 1BI2A 1SG5A 1WNLA 4DEYA 4J7IA 4XAXB 3RKXA 1X75C 3RBBB 2DJZA 1IO6A 1RL2A 3KXTA 3NMZC 3REBB 5A0LA 1VQ8T 4PJOC 3C0CA 4FM4B 1K8AR 1W70A 4M77B 1YP5A 4F7UA 2AK5A 2RMOA 2ED0A 2JM8A 1D3BA 2OI3A 5KYYA 4E7HA 2EWNA 1FMKA 2OJ2A 3QWXX 2RI2A 2D8JA 3CBPA 4KULA 4M7DE 1WXUA 5KYUB 1TU0B 2DYIA 2ZCFB 3A8LB 2LC4A 4KGZB 4FT4A 1JO8A 4R0KA 4N4GA 5IT9E 4XU0A 4MZMA 2WSCE 2KE9A 2YRVA 1YCYA 2JJ9A 4UC4A 5GAMh 1VQNA 2R57A 1N8RR 1D3BB 5KYYB 3CEYA 1IHWA 2FZKB 4OB0B 2XD0A 1TWBA 2XKOC 2O9SA 3G1JA 2CP7A 2PQWA 4Q5WA 2MYSA 1Q81R 4JRQA 1IREB 1QVFS 3CMEA 2QQRA 2K2VA 1PD0A 1YITT 3BY7A 4IUPA 4J9HA 2HL3A 5I21A 4CI0C 1LVKA 1PSFA 4N4HA 3RR6A 4R56A 1M3AA 1TG0A 2JMCA 5IN1A 3VJPA 1A0NB 2GTJA 1WYXA 2FRYA 4J9CA 3H0FA 4RG2A 3G6ET 3I56A 3I5RA 2Y4YA 2X4JA 3E19A 1D0XA 2KDSA 1WLPB 4M77G 2DXBA 2RHIA 1M90R 2KMTA 3TSWA 2FZGB 5A2QE 1H8KA 3EAEA 4OMFB 3OYJA 2QEXA 3A8OB 1OX8A 3PE0A 5D7UA 3CC4T 1UG1A 2XDBA 5LJ5e 3EG1A 1D09B 1KHIA 1E6GA 2QAZA 3DB3A 4BI8B 2X51A 1V1CA 3G71Q 3JB9F 2XICA 1K1ZA 5KH6A 4HCCA 2BIVA 3BDLA 1AHJB 2C0IA 1FWZA 3RKYA 1ZUYA 2L8DA 2LJ1A 1M8MA 2KAFA 4MZPA 1Q86U 1MUZA 4E7LA 3OYLA 1PD1A 5KYXB 3O8VA 3OYHA 2KBTA 2XMFA 4ATOA 2DZ9A 1NYGA 1D1AA 1PC0A 3OBYA 2KSSA 5LJ3h 3C94A 4PJJA 5FROA 4FT2A 3CQTA 4BD3A 2ZPFB 1TXQA 4A4KA 5J26A 3M0QA 1K9MR 3KUFA 3PTAA 2VXEA 4LDYA 3M58A 1IXDA 2M0OA 1U3OA 2CGHA 4M75F 4M7AG 3G4SQ 3J7AF 1K0XA 4E7IA 4HCKA 2LX7A 3CCLT 3CMAT 2DILA 4F7UG 4NS5A 3MPUB 2L3QA 2RPNA 2DERA 2P0KA 5CAIA 2C06A 2CYZB 2QASA 1N9RA 2V8KA 1UDLA 4JUVA 4IUUA 1MMNA 4JS4A 3L1AA 4O5VA 1XQHA 1WHMA 2D9TA 1NG2A 4JJDA 2E70A 2H3JA 1KC8R 2H8HA 3V8LA 3QPHA 2DBMA 3I56Q 1G3SA 3OYCA 1LPLA 1OQKA 2QA4T 2CZ6B 4C0DB 1K9MU 4IUVA 4OGCA 1YJNQ 4EMKA 3H6ZA 1JJ2A 1JRIA 1MMDA 2YUQA 5D6WA 3SHWA 2DTHA 1RI9A 1VQNT 3CC7T 3CMEQ 1U8RA 2ROTA 3JCMb 3LX7A 1QVFP 1PHTA 4IIOA 2GQIA 3L42A 1PKSA 3G4ST 2KXDA 1MNEA 1Y07A 2D6FA 2J6FA 4LDWA 7AT1B 4M78A 1HJDA 1BCMA 2JVVA 1QW1A 3PIPA 1O9SA 4LUEA 3GOXA 1JBMA 1Q7YC 3EGUA 1PSEA 1QWEA 2GBQA 1Q82C 3M56A 3CC2Q 1ZSZA 2FO0A 1K9AA 1YJ9Q 4PLLA 3FJPA 4HT9A 1EX4A 2VV5A 1OZ2A 1BI0A 3RIRA 3G6EA 2M0YA 2PZ1A 3PGGA
chains in the Genus database with same CATH topology
4LE9A 4OMMA 4F14A 1VA7A 3VS3A 3H0HA 1ARKA 1I0CA 1W6XA 4OMPA 1M3BA 1WFWA 1JU5C 1KSWA 1WXTA 2M51A 2ABLA 2ECZA 2PTKA 1SHFA 2DA9A 2LJ0A 4Z88A 2DRMA 2DF6A 2DRKA 1ZUKA 4ESRA 2KYBA 1PKTA 2LQNA 1KFZA 1Y0MA 1UJYA 2AZVA 2X3XD 2EYXA 2L2PA 5L23A 4K11A 2DNUA 1GCQC 1TUDA 5FWCA 3VS7A 2HBWA 2IIMA 4OMNA 3UA7A 1NEBA 3VS6A 1M3CA 2FPFA 2RNAA 2JS0A 2GGRA 2DYBA 2KEAA 1OPKA 2J6OA 1M27C 2L0AA 5FW9A 4IIMA 2HCKA 4RTZA 3EHRA 2NWMA 1PWTA 4AG1C 2DM1A 4KRTA 1VYUA 1RLPC 5IHKA 4J9BA 3SEMA 3VS5A 1G2BA 2ED1A 2JXBA 1NYFA 1OPLA 1MV3A 1WX6A 1OV3A 2I0NA 2LQWA 1CKBA 2EYWA 3EG3A 1HSQA 2W0ZA 1ZLMA 1PRLC 1MV0B 1NM7A 3RNJA 2FEIA 2K6DA 2BTTA 2BZ8A 4JJCA 2RQVA 3I9QA 4F17A 2A08A 2JW4A 4GLMA 2O2OA 2LNHB 4ZNXA 1ZSGA 2K2MA 1ZX6A 2CSQA 1FYNA 1U06A 2A28A 4DEXA 1WIEA 1G83A 2DL7A 2HEQA 3NPFA 1GCPA 1UTIA 1JXMA 1CSKA 1UJ0A 2D0NA 2LP5A 1GBRA 1AWWA 2HDAA 2KYMA 2GTOA 1SRLA 5ECAA 1YWOA 1KIKA 3M0PA 3EG2A 2FPEA 2EBPA 1ABOA 2EYZA 2YUNA 2A36A 2D8HA 3NHNA 4EIKA 3IQLA 1RLQC 1QKXA 2DL4A 4Z89A 4HVVA 2DMOA 2RF0A 2BZYA 3M0RA 2KROA 2D1XA 2SRCA 2F2XA 2RQRA 1AZEA 2EGEA 3PVLA 1AEYA 2YDLA 1SPKA 2KT8A 4AG2C 4F16A 2YUOA 1AWJA 4RTWA 1GFDA 1B3QA 1I1JA 2BZXA 3UATA 1Z9ZA 2EKHA 4DEYA 1X27A 2F2WA 1QKWA 4RTYA 1J3TA 5FWBA 3NGPA 1H92A 1GRIA 1AWXA 1YNZA 3RBBB 2YUPA 5GJWB 1IO6A 4Y92A 2OAWA 2KNBB 5I22A 3NMZC 4HVUA 4CC3A 1GBQA 3REBB 3C0CA 1UGVA 1W70A 1ABQA 1YP5A 4QT7A 2AK5A 2RMOA 2EYYA 2DJQA 2ED0A 2JM8A 3ZL7C 2OI3A 2C0TA 2MCNA 2KRSA 1FMKA 2OJ2A 3QWXX 2LCSA 2D8JA 2E5KA 4RTUA 1WXUA 1H3HA 2DE0X 2EPDA 2DLPA 1X2KA 1E6HA 4JZ3A 2CSIA 2CT4A 2DL5A 1JO8A 1JQQA 4D8KA 4R0KA 3UA6A 2FRWA 5IH2A 2ROLA 2CUDA 3KFVA 2KE9A 1X43A 3VS1A 4JJBA 4OMOA 2DX1A 1EFNA 2SEMA 3I5SA 5EC7A 2VKNA 4A63B 1SRMA 2F2VA 4J9IA 2DL8A 4RTTA 2O9SA 2RN8A 2O31A 1SEMA 2LJ3A 1I07A 2V1QA 4CC7A 1S1NA 1AOJA 2J05A 1K0SA 2KRNA 1JEGA 2NUZA 3JV3A 4J9HA 4X1VA 5IHIA 1WXBA 3PVQA 1M3AA 1TG0A 2JMCA 4LUDA 2J6KA 1A0NB 1Z9QA 2GTJA 1WYXA 2FRYA 4J9CA 2QDLA 3H0FA 2JS2A 1SSHA 2RQTA 4OMQA 1PRMC 5IHNA 3I5RA 1WI7A 2P4RA 4JZ4A 2EQIA 2KT1A 3M0TA 3EHQA 1WLPB 1BK2A 1X2QA 1TUCA 1N5ZA 1ZBJA 2VVKA 3TSWA 1H8KA 2KRMA 1NEGA 1UECA 3H41A 3UF4A 2EW3A 3PE0A 2MIOA 1UG1A 1GFCA 3EG1A 4RTXA 1NLPC 1GL5A 2L3SA 3VS4A 2VWFA 3TVTA 1E6GA 4GBQA 2JTEA 1X6BA 2EGCA 4LNPA 1V1CA 4D8DA 2K3BA 1UFFA 2PNIA 1K1ZA 2J7IA 4J9DA 2FPDA 2CREA 2C0IA 1UE9A 1ZUYA 1X69A 4ORZA 2ENMA 2C0OA 2K9GA 2JM9A 2LJ1A 5GJVB 4RUGA 1M8MA 2CDTA 2O88A 1OOTA 4J9GA 4Z8AA 1MUZA 4HVWA 1BB9A 1RUWA 1T3LA 2KBTA 2XMFA 3REAB 1M30A 4CC4B 2X3WD 1NYGA 2KGTA 2RQUA 2YT6A 2FG0A 4J9EA 5HCKA 2K79A 1KJWA 3CQTA 1T0JA 3U23A 1T0HA 4LN2A 1AZGB 3M0QA 1BU1A 1CKAA 2KR3A 2K7AA 1U3OA 2LZ6B 1AWOA 1GCQA 2DVJA 1E7OA 3O5ZA 2CH4W 4HXJA 1K0XA 1X6GA 1OEBA 4HCKA 2LX7A 2W10A 2DILA 3VS0A 3FJ5A 1YCSB 2AKLA 1W1FA 2O9VA 5IXBA 2CH4A 2L3QA 2RPNA 2KXCA 3EG0A 1T3SA 3R6NA 1QLYA 3THKA 5I11A 1BBZA 1AVZC 2AZSA 1UDLA 2LMJA 2AKKA 2B86A 2V1RA 1XOVA 4AFUC 3VRZA 1VYVA 2CT3A 2G6FX 1K76A 2JMAA 1NG2A 4JJDA 2H8HA 3LH5A 2DBMA 2RQWA 1K4US 4RTVA 1ZUUA 2EGAA 4AFZC 1QWFA 1WA7A 1B07A 1QCFA 2YSQA 2A37A 5IXFA 4CC2A 2YUQA 3SHWA 3H0IA 4E6RA 4M4ZA 3I35A 1U5SA 1RI9A 2DBKA 2EVRA 3M0UA 1AD5A 1VYTA 1UUEA 4AFSC 2ROTA 2GNCA 1PHTA 4IIOA 3QWYA 2GQIA 2HSPA 1PKSA 1UHCA 2KXDA 1PNJA 2J6FA 3A98A 1HJDA 4OMLA 1YN8A 2ESWA 1NLOC 4JPBW 4LUEA 2MOXA 3EGUA 1QWEA 2GBQA 1JXOA 1SHGA 3VRYA 2FO0A 1Y57A 2JT4A 1LCKA 1K9AA 1YWPA 3VS2A 1HD3A 2DL3A 4FSSA 4WCIA 3ULRB 2L3PA 4J9FA 2J06A 1WDXA 2M0YA 2PZ1A 1UHFA 3TSZA 3GBQA 3M0SA 2CUBA 4AFQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LE9 A;  4OMM A;  4F14 A;  1VA7 A;  3VS3 A;  3H0H A;  1ARK A;  1I0C A;  1W6X A;  4OMP A;  1M3B A;  1WFW A;  1JU5 C;  1KSW A;  1WXT A;  2M51 A;  2ABL A;  2ECZ A;  2PTK A;  1SHF A;  2DA9 A;  2LJ0 A;  4Z88 A;  2DRM A;  2DF6 A;  2DRK A;  1ZUK A;  4ESR A;  2KYB A;  1PKT A;  2LQN A;  1KFZ A;  1Y0M A;  1UJY A;  2AZV A;  2X3X D;  2EYX A;  2L2P A;  5L23 A;  4K11 A;  2DNU A;  1GCQ C;  1TUD A;  5FWC A;  3VS7 A;  2HBW A;  2IIM A;  4OMN A;  3UA7 A;  1NEB A;  3VS6 A;  1M3C A;  2FPF A;  2RNA A;  2JS0 A;  2GGR A;  2DYB A;  2KEA A;  1OPK A;  2J6O A;  1M27 C;  2L0A A;  5FW9 A;  4IIM A;  2HCK A;  4RTZ A;  3EHR A;  2NWM A;  1PWT A;  4AG1 C;  2DM1 A;  4KRT A;  1VYU A;  1RLP C;  5IHK A;  4J9B A;  3SEM A;  3VS5 A;  1G2B A;  2ED1 A;  2JXB A;  1NYF A;  1OPL A;  1MV3 A;  1WX6 A;  1OV3 A;  2I0N A;  2LQW A;  1CKB A;  2EYW A;  3EG3 A;  1HSQ A;  2W0Z A;  1ZLM A;  1PRL C;  1MV0 B;  1NM7 A;  3RNJ A;  2FEI A;  2K6D A;  2BTT A;  2BZ8 A;  4JJC A;  2RQV A;  3I9Q A;  4F17 A;  2A08 A;  2JW4 A;  4GLM A;  2O2O A;  2LNH B;  4ZNX A;  1ZSG A;  2K2M A;  1ZX6 A;  2CSQ A;  1FYN A;  1U06 A;  2A28 A;  4DEX A;  1WIE A;  1G83 A;  2DL7 A;  2HEQ A;  3NPF A;  1GCP A;  1UTI A;  1JXM A;  1CSK A;  1UJ0 A;  2D0N A;  2LP5 A;  1GBR A;  1AWW A;  2HDA A;  2KYM A;  2GTO A;  1SRL A;  5ECA A;  1YWO A;  1KIK A;  3M0P A;  3EG2 A;  2FPE A;  2EBP A;  1ABO A;  2EYZ A;  2YUN A;  2A36 A;  2D8H A;  3NHN A;  4EIK A;  3IQL A;  1RLQ C;  1QKX A;  2DL4 A;  4Z89 A;  4HVV A;  2DMO A;  2RF0 A;  2BZY A;  3M0R A;  2KRO A;  2D1X A;  2SRC A;  2F2X A;  2RQR A;  1AZE A;  2EGE A;  3PVL A;  1AEY A;  2YDL A;  1SPK A;  2KT8 A;  4AG2 C;  4F16 A;  2YUO A;  1AWJ A;  4RTW A;  1GFD A;  1B3Q A;  1I1J A;  2BZX A;  3UAT A;  1Z9Z A;  2EKH A;  4DEY A;  1X27 A;  2F2W A;  1QKW A;  4RTY A;  1J3T A;  5FWB A;  3NGP A;  1H92 A;  1GRI A;  1AWX A;  1YNZ A;  3RBB B;  2YUP A;  5GJW B;  1IO6 A;  4Y92 A;  2OAW A;  2KNB B;  5I22 A;  3NMZ C;  4HVU A;  4CC3 A;  1GBQ A;  3REB B;  3C0C A;  1UGV A;  1W70 A;  1ABQ A;  1YP5 A;  4QT7 A;  2AK5 A;  2RMO A;  2EYY A;  2DJQ A;  2ED0 A;  2JM8 A;  3ZL7 C;  2OI3 A;  2C0T A;  2MCN A;  2KRS A;  1FMK A;  2OJ2 A;  3QWX X;  2LCS A;  2D8J A;  2E5K A;  4RTU A;  1WXU A;  1H3H A;  2DE0 X;  2EPD A;  2DLP A;  1X2K A;  1E6H A;  4JZ3 A;  2CSI A;  2CT4 A;  2DL5 A;  1JO8 A;  1JQQ A;  4D8K A;  4R0K A;  3UA6 A;  2FRW A;  5IH2 A;  2ROL A;  2CUD A;  3KFV A;  2KE9 A;  1X43 A;  3VS1 A;  4JJB A;  4OMO A;  2DX1 A;  1EFN A;  2SEM A;  3I5S A;  5EC7 A;  2VKN A;  4A63 B;  1SRM A;  2F2V A;  4J9I A;  2DL8 A;  4RTT A;  2O9S A;  2RN8 A;  2O31 A;  1SEM A;  2LJ3 A;  1I07 A;  2V1Q A;  4CC7 A;  1S1N A;  1AOJ A;  2J05 A;  1K0S A;  2KRN A;  1JEG A;  2NUZ A;  3JV3 A;  4J9H A;  4X1V A;  5IHI A;  1WXB A;  3PVQ A;  1M3A A;  1TG0 A;  2JMC A;  4LUD A;  2J6K A;  1A0N B;  1Z9Q A;  2GTJ A;  1WYX A;  2FRY A;  4J9C A;  2QDL A;  3H0F A;  2JS2 A;  1SSH A;  2RQT A;  4OMQ A;  1PRM C;  5IHN A;  3I5R A;  1WI7 A;  2P4R A;  4JZ4 A;  2EQI A;  2KT1 A;  3M0T A;  3EHQ A;  1WLP B;  1BK2 A;  1X2Q A;  1TUC A;  1N5Z A;  1ZBJ A;  2VVK A;  3TSW A;  1H8K A;  2KRM A;  1NEG A;  1UEC A;  3H41 A;  3UF4 A;  2EW3 A;  3PE0 A;  2MIO A;  1UG1 A;  1GFC A;  3EG1 A;  4RTX A;  1NLP C;  1GL5 A;  2L3S A;  3VS4 A;  2VWF A;  3TVT A;  1E6G A;  4GBQ A;  2JTE A;  1X6B A;  2EGC A;  4LNP A;  1V1C A;  4D8D A;  2K3B A;  1UFF A;  2PNI A;  1K1Z A;  2J7I A;  4J9D A;  2FPD A;  2CRE A;  2C0I A;  1UE9 A;  1ZUY A;  1X69 A;  4ORZ A;  2ENM A;  2C0O A;  2K9G A;  2JM9 A;  2LJ1 A;  5GJV B;  4RUG A;  1M8M A;  2CDT A;  2O88 A;  1OOT A;  4J9G A;  4Z8A A;  1MUZ A;  4HVW A;  1BB9 A;  1RUW A;  1T3L A;  2KBT A;  2XMF A;  3REA B;  1M30 A;  4CC4 B;  2X3W D;  1NYG A;  2KGT A;  2RQU A;  2YT6 A;  2FG0 A;  4J9E A;  5HCK A;  2K79 A;  1KJW A;  3CQT A;  1T0J A;  3U23 A;  1T0H A;  4LN2 A;  1AZG B;  3M0Q A;  1BU1 A;  1CKA A;  2KR3 A;  2K7A A;  1U3O A;  2LZ6 B;  1AWO A;  1GCQ A;  2DVJ A;  1E7O A;  3O5Z A;  2CH4 W;  4HXJ A;  1K0X A;  1X6G A;  1OEB A;  4HCK A;  2LX7 A;  2W10 A;  2DIL A;  3VS0 A;  3FJ5 A;  1YCS B;  2AKL A;  1W1F A;  2O9V A;  5IXB A;  2CH4 A;  2L3Q A;  2RPN A;  2KXC A;  3EG0 A;  1T3S A;  3R6N A;  1QLY A;  3THK A;  5I11 A;  1BBZ A;  1AVZ C;  2AZS A;  1UDL A;  2LMJ A;  2AKK A;  2B86 A;  2V1R A;  1XOV A;  4AFU C;  3VRZ A;  1VYV A;  2CT3 A;  2G6F X;  1K76 A;  2JMA A;  1NG2 A;  4JJD A;  2H8H A;  3LH5 A;  2DBM A;  2RQW A;  1K4U S;  4RTV A;  1ZUU A;  2EGA A;  4AFZ C;  1QWF A;  1WA7 A;  1B07 A;  1QCF A;  2YSQ A;  2A37 A;  5IXF A;  4CC2 A;  2YUQ A;  3SHW A;  3H0I A;  4E6R A;  4M4Z A;  3I35 A;  1U5S A;  1RI9 A;  2DBK A;  2EVR A;  3M0U A;  1AD5 A;  1VYT A;  1UUE A;  4AFS C;  2ROT A;  2GNC A;  1PHT A;  4IIO A;  3QWY A;  2GQI A;  2HSP A;  1PKS A;  1UHC A;  2KXD A;  1PNJ A;  2J6F A;  3A98 A;  1HJD A;  4OML A;  1YN8 A;  2ESW A;  1NLO C;  4JPB W;  4LUE A;  2MOX A;  3EGU A;  1QWE A;  2GBQ A;  1JXO A;  1SHG A;  3VRY A;  2FO0 A;  1Y57 A;  2JT4 A;  1LCK A;  1K9A A;  1YWP A;  3VS2 A;  1HD3 A;  2DL3 A;  4FSS A;  4WCI A;  3ULR B;  2L3P A;  4J9F A;  2J06 A;  1WDX A;  2M0Y A;  2PZ1 A;  1UHF A;  3TSZ A;  3GBQ A;  3M0S A;  2CUB A;  4AFQ C; 
#chains in the Genus database with same CATH topology
 4LE9 A;  2F69 A;  2LNV A;  2QA4 Q;  2EQJ A;  2AT1 B;  3V8J A;  4J6Y A;  3CXC P;  4O6J A;  5CK9 A;  2RK2 A;  2V8I A;  1NJI U;  4OB3 B;  3RES A;  3INZ A;  2M16 A;  3CCM Q;  1JU5 C;  4M7D F;  2M51 A;  3R6O A;  1VQ8 Q;  2IVW A;  5HK0 A;  1UGQ B;  2LJ0 A;  4XTW A;  2COY A;  2EQM A;  5FRM A;  1ZUK A;  3S3M A;  2DIG A;  2KYB A;  3EFR A;  3GLX A;  1B34 B;  2X3X D;  4N0A A;  2GF7 A;  2P0Q A;  3CCU Q;  1GCQ C;  3CCV T;  1QCN A;  3MEU A;  4OMN A;  3LYI A;  3QG1 A;  8AT1 B;  5DY9 A;  2GGR A;  2DYB A;  3JCM g;  4C92 D;  3HTR A;  1IGQ A;  3OYB A;  4PJO D;  3QYH B;  4XQ3 A;  2LX9 A;  3OYM A;  2HCK A;  4DBQ A;  3M57 A;  3JCM Q;  2E5Q A;  4PJO A;  1V76 A;  1VQ4 Q;  3SEM A;  1I5O B;  4J8O A;  1OPL A;  1MV3 A;  1G3T A;  2EJG A;  2QYZ A;  4FSX A;  4FYV B;  3M54 A;  2EYW A;  1ZLM A;  2LTO A;  2FEI A;  1VQ7 A;  4A53 A;  2BTT A;  2K57 A;  4XTX A;  2G3R A;  3CCJ T;  4JRP A;  4JJC A;  1YIT Q;  2RQV A;  4DBH A;  5GMK i;  3CBO A;  1VQ5 T;  4N4I A;  1WZO A;  2RHY A;  1ZSG A;  1QVG S;  4DEX A;  4PJO F;  2DL7 A;  4PJL A;  1G3Y A;  2QXF A;  1N6A A;  2QA4 A;  3RDV A;  1XJW B;  2GTO A;  3MJX A;  3JCM W;  3MEW A;  1YIJ T;  1VQL Q;  4JJN K;  5LJ5 g;  2EBP A;  2EYZ A;  2D8H A;  3NHN A;  1IRX A;  4E2F B;  4EMG A;  2E3I A;  1YBY A;  4HKE A;  4QQG A;  3CC4 Q;  1FMV A;  2RF0 A;  1XTD A;  2BZY A;  4FYY B;  2VAS A;  2KRO A;  2COZ A;  1VQO A;  3QJY A;  1YHQ Q;  2EJ9 A;  3CD6 T;  3UWN A;  5LJ5 f;  5C6S A;  3C12 A;  2E1H A;  2OTL T;  3AHU A;  1WGS A;  5GAN 2;  3GNF B;  1GFD A;  1B3Q A;  2BZX A;  3UAT A;  1RAD B;  2HMA A;  1X27 A;  4RTY A;  1J3T A;  5FWB A;  3NGP A;  2HL5 C;  1YNZ A;  2R5A A;  2LCC A;  2XU8 A;  5GJW B;  4E7J A;  3OA6 A;  1WJS A;  1UB4 A;  5I22 A;  2DD4 A;  5HKC A;  4CC3 A;  3OYA A;  2HQX A;  5L8R E;  3SWN A;  2LQ8 A;  4ANJ A;  1C0M A;  4A4E A;  3BDU A;  3GP8 A;  2EYY A;  2DJQ A;  2NUT B;  1YIJ Q;  2C0T A;  2KRS A;  1YI2 A;  3FEO A;  5GAO r;  2AIR B;  2E5K A;  4RTU A;  4KT0 E;  3JCM f;  1H3H A;  2EPD A;  2DLP A;  2RI3 A;  1RAI B;  3TQ7 P;  2ZPG B;  2IG0 A;  2XDD A;  2CT4 A;  4C8Q B;  1JQQ A;  2RHU A;  3UA6 A;  3CD6 Q;  2JOY A;  3A8H B;  5IH2 A;  4M75 C;  2RB6 A;  3GF5 A;  3LWH A;  3BW1 A;  1PCX A;  2QGF B;  1P92 A;  3OSS C;  3MHX A;  3G6E Q;  5EC7 A;  5HK3 A;  3CCR Q;  4A63 B;  3EGD A;  4WTO B;  1K73 C;  1YJ9 A;  4X34 A;  1UEB A;  2LJ3 A;  2NUP B;  4F7U B;  2V1Q A;  2DZC A;  1BYM A;  2HQH A;  2NUT A;  1LJO A;  3F70 A;  2P84 A;  3RMS A;  1VQK A;  4C92 A;  1K0S A;  3CME T;  4MZT A;  1U1S A;  1JJ2 P;  3JV3 A;  2L3R A;  4X1V A;  4PFO A;  5GAN 4;  5IHI A;  5FRN A;  3PVQ A;  3QYG B;  4BAC A;  1RAF B;  2Y4X A;  2J6K A;  1VQ7 T;  1NPR A;  5GAN j;  2ZGW A;  2RD1 A;  3JRZ A;  2R5M A;  1M90 U;  3HHT B;  3EGD B;  2DIQ A;  3T9N A;  2CP2 A;  4M75 A;  2WSF E;  4ZTF A;  4XU1 A;  4EMK C;  1VQM T;  1BK2 A;  1Q82 U;  3QDF A;  1N5Z A;  3VUZ A;  3UF4 A;  4PJO E;  1M5Q 1;  3SWN C;  1SF9 A;  3PFS A;  1GFC A;  3H9N A;  1GL5 A;  2L3S A;  3VS4 A;  1VQL A;  1YIJ A;  5KYW A;  4NL3 A;  3DLL A;  4C8Q G;  2F5K A;  2FPD A;  1UE9 A;  4M7D C;  1MND A;  2QQS A;  4RUG A;  3QBY A;  3CCV Q;  2O4X A;  2CDT A;  4J9G A;  2QQA A;  1T3L A;  2QDY B;  1BI3 A;  4Y91 A;  3OW2 A;  3EGX B;  2X3W D;  4CC4 B;  2DXU A;  2EKO A;  3EH2 A;  4EDU A;  5HCK A;  1KJW A;  3LGL A;  3E1S A;  3U23 A;  3X24 B;  2KR3 A;  4M7A B;  3CPF A;  5FU7 B;  2X35 A;  3OYG A;  2E4H A;  4FW1 A;  1YJN T;  2DVJ A;  1AWO A;  4A4H A;  2VGN A;  3URG A;  2FB7 A;  3P8B B;  3CMA A;  3CCL A;  1W1F A;  4XK8 E;  2O9V A;  2HBP A;  1OZ3 A;  2KXC A;  4GY5 A;  3HRT A;  4C0Z A;  5J3B A;  1YFN A;  3PMI A;  2KVQ G;  2YXY A;  2AZS A;  2IPO B;  2LMJ A;  1YI2 T;  1Q7Y U;  2B86 A;  4C5I A;  2E64 A;  5GAN d;  2V1R A;  4AFU C;  4M78 B;  1I4K 1;  2G6F X;  1K76 A;  5AT1 B;  2A3L A;  1NE8 A;  1N27 A;  3LH5 A;  3QZ5 B;  4PK4 A;  1K4U S;  1ZUU A;  1VQ5 Q;  3UPU A;  2YLB A;  3CPW S;  3RUX A;  1QCF A;  5FU7 C;  2YSQ A;  2A37 A;  4CC2 A;  4LDV A;  3TU4 K;  4BE0 A;  4M78 E;  2E12 A;  3L2R A;  1I5L A;  4FL6 A;  3M0U A;  2QI2 A;  3CCE Q;  1EIF A;  4ELZ C;  3QWY A;  1TH7 A;  4XTU A;  3G4S A;  1YN8 A;  3CC4 A;  1NLO C;  1ACM B;  1VQK T;  3V7C A;  3C4S A;  1M8V A;  3P8D A;  3MKD A;  1JXO A;  5GAN 6;  4M7D D;  1SHG A;  1VQ6 Q;  3VRY A;  4LDU A;  2EAY A;  3CC2 A;  2DTI A;  2NUP A;  3G71 A;  4FSS A;  1BI1 A;  4AT1 B;  3SWN B;  4M78 D;  3ULR B;  3CCU T;  1G5V A;  4X9C A;  2L3P A;  2GFU A;  2QQ9 A;  4RMO A;  4RTT A;  2QK0 A;  4EMK B;  3I55 A;  6AT1 B;  3LWI A;  1VQM A;  3C95 A;  3NFC A;  4Z02 A;  3AT1 B;  3H0H A;  4IUT A;  2E3H A;  1WXT A;  5KYU A;  4BY6 B;  3KBG A;  1SHF A;  1M1K R;  2K4Y A;  5C0M A;  2DA9 A;  1WQW A;  2HQE A;  1RAG B;  2DF6 A;  2LQK A;  2DVE A;  3V7S A;  3OS2 A;  1N8R U;  2LQN A;  1Q86 R;  4KUD K;  2HZY A;  1KFZ A;  2H3E B;  1UGP B;  1UGR B;  4PJO B;  4K11 A;  3VS7 A;  3JB9 D;  1UGS B;  4F7U F;  2MMP A;  1VQK Q;  2HBW A;  2IIM A;  1AT1 B;  3VS6 A;  4L59 A;  2A0F B;  2HKN A;  1OUL A;  4M75 E;  3ZEH A;  3JAM E;  1M27 C;  4PFZ A;  2L0A A;  1M1G A;  5FW9 A;  2K5L A;  2NWM A;  4C5E A;  3CCQ Q;  1WHK A;  3CMA Q;  3CCL Q;  3VUB A;  3PNW C;  2DM1 A;  4KRT A;  1VYU A;  5KYX A;  5IHK A;  4B6M A;  1JB0 E;  2NLU A;  2ED1 A;  2JXB A;  4QKU A;  2XK0 A;  1WX6 A;  1VQ9 A;  2K3X A;  3CCS T;  2JTM A;  2W0Z A;  2FL7 A;  1MV0 B;  1NM7 A;  2BE7 D;  3JCM V;  4M75 D;  5I2S A;  2RO0 A;  4KGV B;  3CCJ A;  5GAM d;  1QQJ A;  2A08 A;  1DJ7 B;  1RAH B;  1VQM Q;  1VQ5 A;  2MWO A;  5GAN g;  1NZ9 A;  4ZNX A;  8ATC B;  2FVU A;  1U06 A;  2KQW A;  2FHD A;  4TVR A;  2ZPE B;  1WIE A;  2HEQ A;  3NPF A;  1G8X A;  2RJE A;  5FLX E;  1M1F A;  5DLO A;  2ZAE A;  2GQV A;  3SD4 A;  2DTO A;  2RJD A;  4PJN A;  2E6Z A;  2YRC A;  2K5I A;  5KCO A;  3OB9 A;  3M0P A;  5CKH A;  2DD5 A;  5GAN 7;  2M9U A;  4KH0 B;  2A36 A;  4EIK A;  3IQL A;  5LL6 S;  3L2W A;  5D6X A;  1RAE B;  2LDM A;  2I2L A;  5LJ3 g;  2D1X A;  2XDP A;  2ZPI B;  2SRC A;  3JCM J;  5CKB A;  2OTJ T;  3M4G A;  2EGE A;  5CQY A;  1Y7X A;  2O4X B;  4BDY A;  1SPK A;  1K8A U;  3L2Q A;  1R0B G;  2PUO B;  4RTW A;  4PNO A;  2EKH A;  3LLR A;  4II1 A;  3JCM e;  2JUF A;  3LW5 E;  2F2W A;  1QKW A;  4DBR A;  3CCR A;  5LJ3 f;  2WSE E;  1KD1 U;  1H92 A;  1ZBX A;  1GRI A;  1AWX A;  1N8R C;  3MP6 A;  2YUP A;  4Y92 A;  2CP3 A;  2X4X A;  1ZHI A;  4FIB A;  5GMK h;  4A4F A;  2E65 A;  5GAM e;  1GBQ A;  1W2B S;  3CCV A;  2MI6 A;  3JB9 I;  1IGU A;  4BB7 A;  4C0F A;  1TS9 A;  3JCM X;  2MCN A;  3M53 A;  1Q81 U;  1YI2 Q;  5FU6 C;  2MF2 A;  1VIE A;  1QP2 A;  2X4W A;  3FB9 A;  2FZC B;  1M2O A;  2CSI A;  2DL5 A;  2X9H A;  1K73 R;  1TTH B;  2ROL A;  4M75 G;  2CUD A;  1M90 C;  2HAX A;  1U1T A;  5GAO l;  4M78 C;  1OI1 A;  4OMO A;  2L89 A;  4M7D B;  3OYI A;  1SRM A;  5KYN A;  4J9I A;  2DL8 A;  2RN8 A;  2O31 A;  1SEM A;  4BUG A;  2L5Q A;  2BE9 B;  4GLK A;  1QCO A;  1VQ4 T;  1KQ2 A;  1I81 A;  4M75 B;  3HKS A;  2QEX T;  3WVD B;  1MHN A;  4B9X A;  2KRN A;  4J5Y A;  2NUZ A;  3PIO A;  2RHX A;  1WXB A;  2ZPH B;  4LUD A;  4OF1 A;  3JB9 G;  5D6Y A;  5AYF A;  2QDL A;  4DBF A;  1H3Z A;  4C5H A;  1SSH A;  4OMQ A;  5IHN A;  2P4R A;  1OX9 A;  2DO3 A;  1D0Y A;  3M0T A;  1YHQ A;  3CD6 A;  3EHQ A;  3RER A;  4RCC A;  1X2Q A;  3J80 E;  1ZBJ A;  2VVK A;  2OTL A;  4J6X A;  2KRM A;  1NEG A;  3H41 A;  5CKF A;  3OS1 A;  3VKI A;  1SSF A;  1Q7Y R;  4LXC A;  1YIT A;  5EG2 A;  1Q82 R;  4RTX A;  1NLP C;  4NOY A;  4DOV A;  2K3Y A;  2JTE A;  1X6B A;  2EGC A;  4LNP A;  4D8D A;  2K3B A;  1VQL T;  1UFF A;  3BE3 A;  2AHJ B;  1QP3 A;  5DM7 R;  2J7I A;  4EPC A;  2CRE A;  3OSV A;  1KQ1 A;  1X69 A;  4ORZ A;  2ENM A;  2C0O A;  2K9G A;  4M78 G;  2JM9 A;  1VQ7 Q;  4E7Z A;  1OOT A;  3MET A;  2V26 A;  2OAU A;  1RUW A;  2RK1 A;  1KK7 A;  1QMC A;  1KQS P;  3REA B;  1M30 A;  3DKM A;  4M7D G;  1ZA2 B;  2F5T X;  4C8Q C;  4X9D A;  2YT6 A;  2FG0 A;  4FU6 A;  1KC8 U;  3V8K A;  4QQD A;  3M9Q A;  2PU9 B;  4FW2 A;  3CCQ T;  2YLC A;  1MGQ A;  1YJW Q;  4LN2 A;  4BI4 A;  1CKA A;  3CC7 Q;  2XHC A;  2K7A A;  1IB8 A;  5KYW B;  5GAM g;  4YTL A;  5LJ5 h;  5GAO n;  2JN0 A;  3O5Z A;  1VOM A;  1YJN A;  4BE2 A;  4QW2 A;  1X6G A;  1OEB A;  1WHJ A;  4Y28 E;  2NYS A;  3FJ5 A;  4BE1 A;  3GNG A;  3VYH B;  2AKL A;  2MK5 A;  5IXB A;  5GMK l;  2CH4 A;  5CO7 A;  4KH1 B;  4FCY A;  3E9G A;  5I11 A;  2P4T A;  3CCE T;  1AVZ C;  3CCS Q;  1YJ9 T;  3SDZ A;  1RAA B;  3OBW A;  2AKK A;  1KHC A;  3ER0 A;  3VRZ A;  4XTZ A;  2CT3 A;  4C0G A;  2JMA A;  4OGE A;  3JB9 H;  2PVG B;  5CKD A;  2CP0 A;  2RQW A;  3LH0 A;  1WJQ A;  2VB6 A;  4RTV A;  4IUR A;  4AFZ C;  4LD9 K;  1JJ2 S;  1WA7 A;  2HSE B;  1B07 A;  4KUI A;  4B9W A;  3OYK A;  3CCM T;  5IXF A;  1M1K U;  2D0Q B;  3NTK A;  1S72 Q;  3H0I A;  1YJW T;  4XU3 A;  1U5S A;  4KBM B;  2EVR A;  4RKU E;  1ZSZ B;  3OYE A;  3JB9 J;  1MMG A;  1VYT A;  2VXF A;  2XG8 D;  2RJF A;  9ATC B;  2GNC A;  2HSP A;  1W4S A;  4AMC A;  5M9O A;  3A98 A;  2MAM A;  4JLI A;  1VQ4 A;  2ESW A;  4M77 F;  1B34 A;  2KI7 A;  1H64 1;  2RI5 A;  1VQO Q;  1RAC B;  1WPY A;  2JT4 A;  1V29 B;  2DEU A;  3VS2 A;  3QSU A;  2DL3 A;  3TEE A;  4WCI A;  3CCU A;  1WDX A;  4C8Q D;  1VQP A;  1UHF A;  3TSZ A;  1K8A C;  3GBQ A;  2CUB A;  4AFQ C;  4C92 F;  3EG9 B;  2VC8 A;  4F14 A;  1VA7 A;  3VS3 A;  1ARK A;  1I0C A;  1W6X A;  1ZSZ C;  4R55 A;  1WFW A;  1KSW A;  5DLQ E;  1S72 T;  4HCB A;  2CP6 A;  2ABL A;  1M4Z A;  1SKU B;  3M5A A;  2ECZ A;  2LT4 A;  3CPW P;  2EJF A;  4Z88 A;  3CCJ Q;  1VQ6 T;  3FIF A;  4M7A F;  3X25 B;  4ESR A;  3SB2 A;  1PKT A;  5A0D A;  4ZN1 A;  1UJY A;  3CBM A;  2EYX A;  2HKQ B;  2PVD B;  3EGX A;  3SFM A;  5FWC A;  4XTV A;  4C8Q A;  1NJI R;  1WHL A;  2RNA A;  3OY9 A;  3H8Z A;  2JS0 A;  2QTX A;  1EZZ B;  3QHS A;  4IIM A;  4PL6 A;  3CCQ A;  1PWT A;  4AG1 C;  1OU9 A;  3HFO A;  4NL2 A;  5I2M A;  3VS5 A;  1G2B A;  3QKJ A;  2ATC B;  3OYN A;  3A5Z B;  2LRQ A;  2DPP B;  1NYF A;  1FXX A;  3A1P A;  1OV3 A;  2I0N A;  2LQW A;  3QJ6 A;  1CKB A;  4M7A C;  3EG3 A;  1HSQ A;  1Y96 A;  1HXD A;  3WVE B;  2KY9 A;  5CIU A;  4E7S A;  2EQU A;  2K6D A;  3OW2 S;  2CZ1 B;  4RCB A;  3CCE A;  3I9Q A;  4KGX B;  2GFA A;  2JW4 A;  4GLM A;  2LNH B;  5KCH A;  1VUB A;  1ZX6 A;  2CSQ A;  1FYN A;  2CS7 A;  3JCM c;  4V2S A;  4E7K A;  2EFI A;  2F1L A;  4ZGE B;  2D0N A;  2LP5 A;  1JXM A;  1CSK A;  5GAO p;  4JRK A;  1AWW A;  1M9S A;  3TRE A;  2EYQ A;  1XNI A;  2KYM A;  5IAY A;  1SRL A;  3GPL A;  1YWO A;  2YHT A;  1KIK A;  5GAN 8;  2FPE A;  3CCM A;  1ABO A;  1ZA1 B;  5FU6 B;  4J83 A;  1RLQ C;  2DL4 A;  4Z89 A;  2DMO A;  1LNX A;  3I55 T;  1BIA A;  2PVO B;  3G7Z A;  2MPX C;  4M7A A;  2XI9 A;  1Y96 B;  2CP5 A;  1WQ7 A;  3PVL A;  1M2V B;  1AEY A;  1FMW A;  4AG2 C;  1AWJ A;  1KG1 A;  1NBE B;  2CKK A;  3TCJ A;  1I1J A;  1Z9Z A;  1Y71 A;  1K9M C;  4FYX B;  2VYT A;  2JTF A;  2EIF A;  4VUB A;  3CCR T;  1C6V X;  3EFO B;  2OAW A;  2KNB B;  2JNG A;  2Y90 A;  3OYF A;  4HVU A;  3EG9 A;  3L2Z A;  4JRI A;  2KK4 A;  4C8Q F;  3PMT A;  3QUI A;  1UGV A;  1WHH A;  3EH1 A;  1ABQ A;  4QT7 A;  3LGF A;  3ZBD A;  4QVD A;  3ZL7 C;  3RMQ A;  2QGG A;  3EFS A;  3L2U A;  2LCS A;  1RI0 A;  2ZZD A;  3MP1 A;  2DE0 X;  4PJM A;  4IKF A;  1M1K C;  5LJ3 d;  1X2K A;  2QEX Q;  1E6H A;  4MMK A;  4JZ3 A;  1IZ6 A;  1LOJ A;  3I55 Q;  1VQ6 A;  2RH2 A;  4L5G A;  2EQK A;  4D8K A;  2FRW A;  3UT1 A;  1QVG P;  2XID A;  1WHG A;  3KFV A;  1X43 A;  3VS1 A;  3NTI A;  3QXE B;  5CCA A;  4JJB A;  2DX1 A;  1EFN A;  1NPP A;  2SEM A;  3I5S A;  4OVA A;  4PLI A;  3OYD A;  2VKN A;  2FYK A;  5CVI A;  2WAC A;  2M1H A;  4C0D C;  2F2V A;  3S6W A;  1BIB A;  3VYG A;  4BI3 A;  4M77 A;  5CKE A;  1I07 A;  4CC7 A;  4ELY C;  1S1N A;  1AOJ A;  2J05 A;  2DXC A;  4PJO G;  4C92 G;  1TOV A;  1JEG A;  3MO8 A;  5GMK m;  2DKG A;  5LJ5 d;  2YWW A;  4XTY A;  4ME7 A;  1KQS A;  3Q1J A;  1QVG A;  1Z9Q A;  3S3N A;  4P5N A;  5J39 A;  2JS2 A;  1OU8 A;  4D6W A;  2RQT A;  1PRM C;  1WI7 A;  4JZ4 A;  1KD1 C;  2EQI A;  2KT1 A;  2QTV A;  4IUQ A;  3M0S A;  5LJ3 e;  2P0P A;  1K73 U;  1OYX A;  4EMH A;  1TUC A;  1BCO A;  4M7D A;  5LJ3 j;  3OQ5 A;  2COW A;  1UEC A;  2EW3 A;  4HT8 A;  2MIO A;  1VQP Q;  2LCL A;  3OS5 A;  3HL8 A;  2VWF A;  3HRS A;  3TVT A;  4GBQ A;  4HA8 A;  2CZ7 B;  3RKW A;  2OTJ Q;  4DOW A;  3HRU A;  2PNI A;  3CXC S;  4J9D A;  5GJV B;  2DEQ A;  3P8H A;  3VU3 C;  4BY6 C;  2O88 A;  4Z8A A;  4JDS A;  4DA4 A;  3DB4 A;  4HVW A;  1BB9 A;  3QZ9 B;  1TSF A;  4ZGD B;  2CZ0 B;  3V7R A;  1W2B P;  2QQB A;  3ZFJ A;  1X01 A;  2KGT A;  2RQU A;  4XU2 A;  2MWP A;  2ZPB B;  1WJR A;  4J9E A;  3CXC A;  2K79 A;  1T0J A;  1T0H A;  3GIB A;  1Q95 G;  1AZG B;  1BU1 A;  4N0A C;  1KD1 R;  2LZ6 B;  2DET A;  3NTH A;  1Q86 C;  1GCQ A;  1E7O A;  2CH4 W;  4HXJ A;  4M77 C;  5GAN f;  3VV0 A;  2W10 A;  1VIF A;  4RG8 A;  3VS0 A;  4FYW B;  1YCS B;  2M02 A;  1PM3 A;  1VQN Q;  3OS0 A;  2HD0 A;  3EG0 A;  1T3S A;  3R6N A;  1QLY A;  3THK A;  1BBZ A;  3OMG A;  4M7A E;  3E2U A;  3M4Y A;  1D1C A;  5CR2 A;  1N9S A;  3MCA B;  4DQ2 A;  4ZGJ B;  1BKB A;  3FRN A;  1XOV A;  1VYV A;  4J7F A;  3OMC A;  5GAN 5;  1I8F A;  1HK9 A;  3CPW A;  2EGA A;  3MP8 A;  1IHV A;  3WXM B;  2DAQ A;  1QWF A;  3PT9 A;  2GCX A;  2PUK B;  4A54 A;  4HCZ A;  3MEV A;  3FDR A;  2VUB A;  2DFU A;  3MEA A;  2A7Y A;  2BKD N;  4E6R A;  4M4Z A;  3CC7 A;  3I35 A;  4C8Q E;  2DBK A;  4M7A D;  1AD5 A;  1UUE A;  4AFS C;  4PKC C;  2DK3 A;  4QQ6 A;  1YHQ T;  2RM4 A;  2E6N A;  4PFP A;  1UHC A;  1FX7 A;  4CRI A;  1PNJ A;  4ZTJ A;  4LDX A;  4OML A;  1G3W A;  2OX7 A;  5A0G A;  1Q81 C;  4JPB W;  2MOX A;  3QII A;  2R58 A;  5GAN 3;  1Y57 A;  1LCK A;  1YWP A;  4F7U E;  1HD3 A;  3ASK A;  1D0Z A;  2E10 A;  2Z0W A;  1MMA A;  4J9F A;  2J06 A;  2RHZ A;  3HFN A;  3X28 B;  1VQ8 A;  3JSC A;  5GAN e;  4L6V 5;  4OMM A;  4F04 B;  1KQS S;  4OMP A;  1M3B A;  1ZQ1 A;  2QG9 B;  3X20 B;  1R0C B;  2PTK A;  4J6W A;  1S72 A;  3OW2 P;  3A8G B;  4JLG A;  5LJ5 j;  2DRM A;  4M77 D;  1X6O A;  3ME9 A;  3CC2 T;  2DRK A;  3G71 T;  5HY6 A;  3HSB A;  4MDW A;  1W2B A;  3A8M B;  1Y0M A;  2AZV A;  2L2P A;  4ZN3 A;  5L23 A;  3QDR B;  3S3O A;  2DNU A;  1TUD A;  5GAO m;  2V8J A;  3UA7 A;  1NEB A;  2RJC A;  1M3C A;  2FPF A;  1VQ9 Q;  3D7S B;  3N5B B;  2KEA A;  1OPK A;  3X26 B;  3M55 A;  2BUD A;  2J6O A;  4QVZ A;  5GAN h;  1C1A A;  1R8O B;  2X4Y A;  4RTZ A;  3EHR A;  1QVP A;  2O01 E;  3BFM A;  2B8A A;  1RLP C;  4J9B A;  3DLM A;  4C92 B;  1NJI C;  3EFO A;  4OP0 A;  4C5G A;  4BDZ A;  3JCM P;  2K5F A;  4JS5 A;  3HP9 A;  3J81 E;  2LT1 A;  1O75 A;  5CQX A;  3JCM d;  2JZ2 A;  1QVF A;  3E9F A;  1PRL C;  1YJW A;  3FLG A;  1M2V A;  4WF2 A;  2YRD A;  3RNJ A;  2BZ8 A;  3FC3 A;  3OYY A;  3I56 T;  5GAM j;  4MML A;  4C92 E;  1B7T A;  4F17 A;  2O2O A;  2K2M A;  2OTJ A;  2OTL Q;  4M78 F;  4LD6 A;  2A28 A;  3JCM h;  1F1B B;  4C92 C;  3QO3 A;  1G83 A;  1UTI A;  1GCP A;  1UJ0 A;  1GBR A;  3HPW A;  5GAM f;  2HDA A;  1KC8 C;  2HNI A;  5KE2 A;  1GXI E;  1VQ9 T;  3CCS A;  2LVM A;  1PG5 B;  5ECA A;  5GMK e;  1R77 A;  4E47 A;  3EG2 A;  5GMK j;  2YUN A;  5KE3 A;  1RAB B;  4MDX A;  1HYO A;  1QKX A;  4OB2 B;  5GAO q;  4HVV A;  1VQP T;  4QVC A;  3M0R A;  1VQO T;  4A4G A;  2F2X A;  2RQR A;  1AZE A;  4OB1 B;  1TUG B;  2RA2 A;  3L2V A;  2VGM A;  2YDL A;  3M59 A;  2E41 A;  2KT8 A;  4F16 A;  2YUO A;  1D1B A;  2DXT A;  3UDC A;  4M77 E;  1BI2 A;  1SG5 A;  1WNL A;  4DEY A;  4J7I A;  4XAX B;  3RKX A;  1X75 C;  3RBB B;  2DJZ A;  1IO6 A;  1RL2 A;  3KXT A;  3NMZ C;  3REB B;  5A0L A;  1VQ8 T;  4PJO C;  3C0C A;  4FM4 B;  1K8A R;  1W70 A;  4M77 B;  1YP5 A;  4F7U A;  2AK5 A;  2RMO A;  2ED0 A;  2JM8 A;  1D3B A;  2OI3 A;  5KYY A;  4E7H A;  2EWN A;  1FMK A;  2OJ2 A;  3QWX X;  2RI2 A;  2D8J A;  3CBP A;  4KUL A;  4M7D E;  1WXU A;  5KYU B;  1TU0 B;  2DYI A;  2ZCF B;  3A8L B;  2LC4 A;  4KGZ B;  4FT4 A;  1JO8 A;  4R0K A;  4N4G A;  5IT9 E;  4XU0 A;  4MZM A;  2WSC E;  2KE9 A;  2YRV A;  1YCY A;  2JJ9 A;  4UC4 A;  5GAM h;  1VQN A;  2R57 A;  1N8R R;  1D3B B;  5KYY B;  3CEY A;  1IHW A;  2FZK B;  4OB0 B;  2XD0 A;  1TWB A;  2XKO C;  2O9S A;  3G1J A;  2CP7 A;  2PQW A;  4Q5W A;  2MYS A;  1Q81 R;  4JRQ A;  1IRE B;  1QVF S;  3CME A;  2QQR A;  2K2V A;  1PD0 A;  1YIT T;  3BY7 A;  4IUP A;  4J9H A;  2HL3 A;  5I21 A;  4CI0 C;  1LVK A;  1PSF A;  4N4H A;  3RR6 A;  4R56 A;  1M3A A;  1TG0 A;  2JMC A;  5IN1 A;  3VJP A;  1A0N B;  2GTJ A;  1WYX A;  2FRY A;  4J9C A;  3H0F A;  4RG2 A;  3G6E T;  3I56 A;  3I5R A;  2Y4Y A;  2X4J A;  3E19 A;  1D0X A;  2KDS A;  1WLP B;  4M77 G;  2DXB A;  2RHI A;  1M90 R;  2KMT A;  3TSW A;  2FZG B;  5A2Q E;  1H8K A;  3EAE A;  4OMF B;  3OYJ A;  2QEX A;  3A8O B;  1OX8 A;  3PE0 A;  5D7U A;  3CC4 T;  1UG1 A;  2XDB A;  5LJ5 e;  3EG1 A;  1D09 B;  1KHI A;  1E6G A;  2QAZ A;  3DB3 A;  4BI8 B;  2X51 A;  1V1C A;  3G71 Q;  3JB9 F;  2XIC A;  1K1Z A;  5KH6 A;  4HCC A;  2BIV A;  3BDL A;  1AHJ B;  2C0I A;  1FWZ A;  3RKY A;  1ZUY A;  2L8D A;  2LJ1 A;  1M8M A;  2KAF A;  4MZP A;  1Q86 U;  1MUZ A;  4E7L A;  3OYL A;  1PD1 A;  5KYX B;  3O8V A;  3OYH A;  2KBT A;  2XMF A;  4ATO A;  2DZ9 A;  1NYG A;  1D1A A;  1PC0 A;  3OBY A;  2KSS A;  5LJ3 h;  3C94 A;  4PJJ A;  5FRO A;  4FT2 A;  3CQT A;  4BD3 A;  2ZPF B;  1TXQ A;  4A4K A;  5J26 A;  3M0Q A;  1K9M R;  3KUF A;  3PTA A;  2VXE A;  4LDY A;  3M58 A;  1IXD A;  2M0O A;  1U3O A;  2CGH A;  4M75 F;  4M7A G;  3G4S Q;  3J7A F;  1K0X A;  4E7I A;  4HCK A;  2LX7 A;  3CCL T;  3CMA T;  2DIL A;  4F7U G;  4NS5 A;  3MPU B;  2L3Q A;  2RPN A;  2DER A;  2P0K A;  5CAI A;  2C06 A;  2CYZ B;  2QAS A;  1N9R A;  2V8K A;  1UDL A;  4JUV A;  4IUU A;  1MMN A;  4JS4 A;  3L1A A;  4O5V A;  1XQH A;  1WHM A;  2D9T A;  1NG2 A;  4JJD A;  2E70 A;  2H3J A;  1KC8 R;  2H8H A;  3V8L A;  3QPH A;  2DBM A;  3I56 Q;  1G3S A;  3OYC A;  1LPL A;  1OQK A;  2QA4 T;  2CZ6 B;  4C0D B;  1K9M U;  4IUV A;  4OGC A;  1YJN Q;  4EMK A;  3H6Z A;  1JJ2 A;  1JRI A;  1MMD A;  2YUQ A;  5D6W A;  3SHW A;  2DTH A;  1RI9 A;  1VQN T;  3CC7 T;  3CME Q;  1U8R A;  2ROT A;  3JCM b;  3LX7 A;  1QVF P;  1PHT A;  4IIO A;  2GQI A;  3L42 A;  1PKS A;  3G4S T;  2KXD A;  1MNE A;  1Y07 A;  2D6F A;  2J6F A;  4LDW A;  7AT1 B;  4M78 A;  1HJD A;  1BCM A;  2JVV A;  1QW1 A;  3PIP A;  1O9S A;  4LUE A;  3GOX A;  1JBM A;  1Q7Y C;  3EGU A;  1PSE A;  1QWE A;  2GBQ A;  1Q82 C;  3M56 A;  3CC2 Q;  1ZSZ A;  2FO0 A;  1K9A A;  1YJ9 Q;  4PLL A;  3FJP A;  4HT9 A;  1EX4 A;  2VV5 A;  1OZ2 A;  1BI0 A;  3RIR A;  3G6E A;  2M0Y A;  2PZ1 A;  3PGG A; 
#chains in the Genus database with same CATH homology
 4LE9 A;  4OMM A;  4F14 A;  1VA7 A;  3VS3 A;  3H0H A;  1ARK A;  1I0C A;  1W6X A;  4OMP A;  1M3B A;  1WFW A;  1JU5 C;  1KSW A;  1WXT A;  2M51 A;  2ABL A;  2ECZ A;  2PTK A;  1SHF A;  2DA9 A;  2LJ0 A;  4Z88 A;  2DRM A;  2DF6 A;  2DRK A;  1ZUK A;  4ESR A;  2KYB A;  1PKT A;  2LQN A;  1KFZ A;  1Y0M A;  1UJY A;  2AZV A;  2X3X D;  2EYX A;  2L2P A;  5L23 A;  4K11 A;  2DNU A;  1GCQ C;  1TUD A;  5FWC A;  3VS7 A;  2HBW A;  2IIM A;  4OMN A;  3UA7 A;  1NEB A;  3VS6 A;  1M3C A;  2FPF A;  2RNA A;  2JS0 A;  2GGR A;  2DYB A;  2KEA A;  1OPK A;  2J6O A;  1M27 C;  2L0A A;  5FW9 A;  4IIM A;  2HCK A;  4RTZ A;  3EHR A;  2NWM A;  1PWT A;  4AG1 C;  2DM1 A;  4KRT A;  1VYU A;  1RLP C;  5IHK A;  4J9B A;  3SEM A;  3VS5 A;  1G2B A;  2ED1 A;  2JXB A;  1NYF A;  1OPL A;  1MV3 A;  1WX6 A;  1OV3 A;  2I0N A;  2LQW A;  1CKB A;  2EYW A;  3EG3 A;  1HSQ A;  2W0Z A;  1ZLM A;  1PRL C;  1MV0 B;  1NM7 A;  3RNJ A;  2FEI A;  2K6D A;  2BTT A;  2BZ8 A;  4JJC A;  2RQV A;  3I9Q A;  4F17 A;  2A08 A;  2JW4 A;  4GLM A;  2O2O A;  2LNH B;  4ZNX A;  1ZSG A;  2K2M A;  1ZX6 A;  2CSQ A;  1FYN A;  1U06 A;  2A28 A;  4DEX A;  1WIE A;  1G83 A;  2DL7 A;  2HEQ A;  3NPF A;  1GCP A;  1UTI A;  1JXM A;  1CSK A;  1UJ0 A;  2D0N A;  2LP5 A;  1GBR A;  1AWW A;  2HDA A;  2KYM A;  2GTO A;  1SRL A;  5ECA A;  1YWO A;  1KIK A;  3M0P A;  3EG2 A;  2FPE A;  2EBP A;  1ABO A;  2EYZ A;  2YUN A;  2A36 A;  2D8H A;  3NHN A;  4EIK A;  3IQL A;  1RLQ C;  1QKX A;  2DL4 A;  4Z89 A;  4HVV A;  2DMO A;  2RF0 A;  2BZY A;  3M0R A;  2KRO A;  2D1X A;  2SRC A;  2F2X A;  2RQR A;  1AZE A;  2EGE A;  3PVL A;  1AEY A;  2YDL A;  1SPK A;  2KT8 A;  4AG2 C;  4F16 A;  2YUO A;  1AWJ A;  4RTW A;  1GFD A;  1B3Q A;  1I1J A;  2BZX A;  3UAT A;  1Z9Z A;  2EKH A;  4DEY A;  1X27 A;  2F2W A;  1QKW A;  4RTY A;  1J3T A;  5FWB A;  3NGP A;  1H92 A;  1GRI A;  1AWX A;  1YNZ A;  3RBB B;  2YUP A;  5GJW B;  1IO6 A;  4Y92 A;  2OAW A;  2KNB B;  5I22 A;  3NMZ C;  4HVU A;  4CC3 A;  1GBQ A;  3REB B;  3C0C A;  1UGV A;  1W70 A;  1ABQ A;  1YP5 A;  4QT7 A;  2AK5 A;  2RMO A;  2EYY A;  2DJQ A;  2ED0 A;  2JM8 A;  3ZL7 C;  2OI3 A;  2C0T A;  2MCN A;  2KRS A;  1FMK A;  2OJ2 A;  3QWX X;  2LCS A;  2D8J A;  2E5K A;  4RTU A;  1WXU A;  1H3H A;  2DE0 X;  2EPD A;  2DLP A;  1X2K A;  1E6H A;  4JZ3 A;  2CSI A;  2CT4 A;  2DL5 A;  1JO8 A;  1JQQ A;  4D8K A;  4R0K A;  3UA6 A;  2FRW A;  5IH2 A;  2ROL A;  2CUD A;  3KFV A;  2KE9 A;  1X43 A;  3VS1 A;  4JJB A;  4OMO A;  2DX1 A;  1EFN A;  2SEM A;  3I5S A;  5EC7 A;  2VKN A;  4A63 B;  1SRM A;  2F2V A;  4J9I A;  2DL8 A;  4RTT A;  2O9S A;  2RN8 A;  2O31 A;  1SEM A;  2LJ3 A;  1I07 A;  2V1Q A;  4CC7 A;  1S1N A;  1AOJ A;  2J05 A;  1K0S A;  2KRN A;  1JEG A;  2NUZ A;  3JV3 A;  4J9H A;  4X1V A;  5IHI A;  1WXB A;  3PVQ A;  1M3A A;  1TG0 A;  2JMC A;  4LUD A;  2J6K A;  1A0N B;  1Z9Q A;  2GTJ A;  1WYX A;  2FRY A;  4J9C A;  2QDL A;  3H0F A;  2JS2 A;  1SSH A;  2RQT A;  4OMQ A;  1PRM C;  5IHN A;  3I5R A;  1WI7 A;  2P4R A;  4JZ4 A;  2EQI A;  2KT1 A;  3M0T A;  3EHQ A;  1WLP B;  1BK2 A;  1X2Q A;  1TUC A;  1N5Z A;  1ZBJ A;  2VVK A;  3TSW A;  1H8K A;  2KRM A;  1NEG A;  1UEC A;  3H41 A;  3UF4 A;  2EW3 A;  3PE0 A;  2MIO A;  1UG1 A;  1GFC A;  3EG1 A;  4RTX A;  1NLP C;  1GL5 A;  2L3S A;  3VS4 A;  2VWF A;  3TVT A;  1E6G A;  4GBQ A;  2JTE A;  1X6B A;  2EGC A;  4LNP A;  1V1C A;  4D8D A;  2K3B A;  1UFF A;  2PNI A;  1K1Z A;  2J7I A;  4J9D A;  2FPD A;  2CRE A;  2C0I A;  1UE9 A;  1ZUY A;  1X69 A;  4ORZ A;  2ENM A;  2C0O A;  2K9G A;  2JM9 A;  2LJ1 A;  5GJV B;  4RUG A;  1M8M A;  2CDT A;  2O88 A;  1OOT A;  4J9G A;  4Z8A A;  1MUZ A;  4HVW A;  1BB9 A;  1RUW A;  1T3L A;  2KBT A;  2XMF A;  3REA B;  1M30 A;  4CC4 B;  2X3W D;  1NYG A;  2KGT A;  2RQU A;  2YT6 A;  2FG0 A;  4J9E A;  5HCK A;  2K79 A;  1KJW A;  3CQT A;  1T0J A;  3U23 A;  1T0H A;  4LN2 A;  1AZG B;  3M0Q A;  1BU1 A;  1CKA A;  2KR3 A;  2K7A A;  1U3O A;  2LZ6 B;  1AWO A;  1GCQ A;  2DVJ A;  1E7O A;  3O5Z A;  2CH4 W;  4HXJ A;  1K0X A;  1X6G A;  1OEB A;  4HCK A;  2LX7 A;  2W10 A;  2DIL A;  3VS0 A;  3FJ5 A;  1YCS B;  2AKL A;  1W1F A;  2O9V A;  5IXB A;  2CH4 A;  2L3Q A;  2RPN A;  2KXC A;  3EG0 A;  1T3S A;  3R6N A;  1QLY A;  3THK A;  5I11 A;  1BBZ A;  1AVZ C;  2AZS A;  1UDL A;  2LMJ A;  2AKK A;  2B86 A;  2V1R A;  1XOV A;  4AFU C;  3VRZ A;  1VYV A;  2CT3 A;  2G6F X;  1K76 A;  2JMA A;  1NG2 A;  4JJD A;  2H8H A;  3LH5 A;  2DBM A;  2RQW A;  1K4U S;  4RTV A;  1ZUU A;  2EGA A;  4AFZ C;  1QWF A;  1WA7 A;  1B07 A;  1QCF A;  2YSQ A;  2A37 A;  5IXF A;  4CC2 A;  2YUQ A;  3SHW A;  3H0I A;  4E6R A;  4M4Z A;  3I35 A;  1U5S A;  1RI9 A;  2DBK A;  2EVR A;  3M0U A;  1AD5 A;  1VYT A;  1UUE A;  4AFS C;  2ROT A;  2GNC A;  1PHT A;  4IIO A;  3QWY A;  2GQI A;  2HSP A;  1PKS A;  1UHC A;  2KXD A;  1PNJ A;  2J6F A;  3A98 A;  1HJD A;  4OML A;  1YN8 A;  2ESW A;  1NLO C;  4JPB W;  4LUE A;  2MOX A;  3EGU A;  1QWE A;  2GBQ A;  1JXO A;  1SHG A;  3VRY A;  2FO0 A;  1Y57 A;  2JT4 A;  1LCK A;  1K9A A;  1YWP A;  3VS2 A;  1HD3 A;  2DL3 A;  4FSS A;  4WCI A;  3ULR B;  2L3P A;  4J9F A;  2J06 A;  1WDX A;  2M0Y A;  2PZ1 A;  1UHF A;  3TSZ A;  3GBQ A;  3M0S A;  2CUB A;  4AFQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...