2JT4A

Solution structure of the sla1 sh3-3-ubiquitin complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
b'MASKSKKRGIVQYDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEPVRDKKHTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoskeleton assembly control protein SLA1
publication title Structural Basis for Ubiquitin Recognition by SH3 Domains
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 13
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2007-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2jt4A00
1I0CA 3VRYA 2EYXA 2KRNA 3C0CA 2CSQA 2M0YA 2W10A 1UJYA 2AZSA 1U06A 1SHGA 2K3BA 4JJCA 2CUDA 4E6RA 1Y57A 3ULRB 2RF0A 1AWXA 1QLYA 3VS3A 4FSSA 1SRLA 2I0NA 1J3TA 2JMAA 4IIOA 2O9SA 3EHQA 1UECA 2LJ3A 2RQWA 2RQUA 3EGUA 3EG3A 5IXFA 2C0TA 1AEYA 2PZ1A 1M3BA 1PKSA 4OMPA 4D8KA 2L0AA 4JZ3A 1WI7A 2GNCA 3RBBB 2RQTA 1YN8A 1T3LA 2D8HA 1SPKA 1UJ0A 2EVRA 2P4RA 5IHKA 2KXDA 3NMZC 2JMCA 3TSZA 1UE9A 4JPBW 1M3AA 2DM1A 2GQIA 1NYGA 2RQRA 3VS1A 1YWOA 2NWMA 1AZEA 4RTVA 2CH4A 2L3PA 4Y92A 1GFDA 1FMKA 2LQWA 5IHIA 1NLOC 2F2XA 1X43A 5I22A 2FEIA 1V1CA 4OMNA 2LJ0A 2EGAA 1GCQC 2DA9A 2CREA 2KEAA 5GJWB 1K76A 4LE9A 2F2VA 1SEMA 1E6HA 4LUDA 2PNIA 2AKLA 2NUZA 3UA6A 2D1XA 2AK5A 1MV0B 1GCQA 1JXMA 5IXBA 4Z89A 1ZBJA 4HCKA 2L3SA 1VYTA 2A28A 3M0UA 2BTTA 2GTJA 3EG2A 5FWCA 1UG1A 2O2OA 1LCKA 4HVUA 1WXUA 2O88A 2ABLA 2JT4A 2HCKA 1K0SA 5ECAA 4F17A 1HSQA 3H0FA 1QWFA 2CT3A 3TVTA 1QWEA 1KFZA 2JXBA 3ZL7C 2DJQA 1QKWA 1K0XA 1TG0A 2VVKA 3IQLA 1I1JA 1EFNA 2MIOA 2YUPA 2KBTA 3SHWA 2LZ6B 4AFQC 4CC7A 2LCSA 1VA7A 1CKAA 1UTIA 2JS2A 2YUQA 2HDAA 1ZX6A 1FYNA 1HJDA 1JEGA 4CC2A 2CUBA 2KNBB 1CKBA 1GBQA 1H3HA 2MCNA 2GBQA 1NG2A 1U5SA 1Z9QA 4RTZA 2KYBA 4OMQA 4OMLA 1WIEA 3O5ZA 2KXCA 1YWPA 5L23A 3SEMA 1WYXA 2YUOA 2JS0A 2DVJA 4DEXA 2CH4W 2A37A 2EPDA 1AVZC 3VS7A 2EQIA 4ORZA 1QCFA 1YCSB 1PHTA 4RTUA 3CQTA 2M51A 5GJVB 4CC3A 1NEBA 1E7OA 2J06A 3REBB 2W0ZA 1WFWA 1VYUA 3NGPA 1W1FA 2HBWA 2BZXA 1JU5C 2YUNA 4ZNXA 1X6BA 4F16A 2DRMA 3H0IA 2RQVA 4OMMA 1K4US 1AOJA 1BK2A 2L2PA 2DMOA 3PVLA 1X27A 2XMFA 3QWXX 2DLPA 4J9BA 3M0SA 3EG0A 3JV3A 4J9FA 4RTXA 3UATA 4M4ZA 2KR3A 2RPNA 1ZUKA 2BZYA 2A08A 3I5SA 3GBQA 1SSHA 3H0HA 1AWWA 1WXTA 2CSIA 2DL3A 1X69A 2ESWA 3VS0A 3U23A 2DE0X 2DL7A 3R6NA 4JJDA 3TSWA 1RI9A 2KT1A 2IIMA 1PRMC 4RTTA 2EYYA 5IH2A 1X2QA 2DL8A 4AFZC 2B86A 1M27C 4GLMA 3THKA 2LJ1A 2RMOA 2BZ8A 1Z9ZA 3VS6A 2KROA 4LN2A 2F2WA 1VYVA 2KYMA 1W6XA 1NEGA 2EKHA 2K2MA 4AFSC 2ED0A 2G6FX 2E5KA 3NHNA 1MV3A 1WLPB 2LP5A 2YDLA 3A98A 2OI3A 3FJ5A 1AZGB 2YSQA 1UDLA 2DX1A 3M0QA 1ZSGA 3VRZA 3REAB 1SRMA 1KIKA 2PTKA 4R0KA 4EIKA 2J7IA 2LNHB 1WX6A 4HVVA 2FPFA 4Z8AA 3M0TA 1QKXA 2K6DA 2JTEA 3H41A 2GTOA 1RUWA 1XOVA 4KRTA 1PWTA 1T0JA 3PVQA 4QT7A 5EC7A 5HCKA 1GRIA 2DL5A 4OMOA 4J9DA 2EYZA 2DBMA 2K7AA 2DNUA 1ZUYA 2ENMA 1S1NA 4HVWA 2DL4A 1RLQC 2EBPA 2ED1A 1UHFA 2O9VA 2DBKA 2ECZA 2GGRA 1K1ZA 4HXJA 2DRKA 2X3XD 4RTYA 2KRSA 1M30A 2RNAA 4RUGA 5I11A 2LX7A 1AWJA 1GBRA 3UA7A 1M3CA 3M0PA 2AZVA 4D8DA 2YT6A 4AFUC 3M0RA 1OOTA 1X2KA 1JQQA 2MOXA 1SHFA 4J9HA 4IIMA 1ZUUA 3I9QA 1UGVA 1BB9A 4J9GA 1UUEA 3VS2A 1ABQA 2QDLA 2C0OA 3I35A 1TUDA 2RN8A 2SEMA 2JW4A 1RLPC 2K9GA 1X6GA 1KJWA 1A0NB 2JM9A 2FO0A 1TUCA 4Z88A 1E6GA 3VS4A 2HSPA 1G83A 5IHNA 2CDTA 1W70A 3I5RA 4LNPA 2FRYA 2LMJA 2ROLA 2VKNA 3QWYA 4A63B 2FPEA 1CSKA 2J05A 2JM8A 1YP5A 3LH5A 1T0HA 4F14A 4WCIA 2KGTA 3EHRA 3KFVA 1JO8A 4J9IA 2DYBA 4JZ4A 1GL5A 1B07A 1YNZA 4LUEA 2HEQA 1KSWA 4RTWA 3RNJA 4ESRA 1H92A 1PRLC 2A36A 2KT8A 4JJBA 3PE0A 2K79A 2VWFA 2DILA 2EW3A 1PKTA 1OPKA 5FWBA 1U3OA 4CC4B 1UFFA 2V1QA 2X3WD 1OEBA 2KRMA 3VS5A 1NLPC 2AKKA 2DF6A 1AWOA 2H8HA 1I07A 2L3QA 1M8MA 1T3SA 2D8JA 2CT4A 2SRCA 3NPFA 1Y0MA 1NM7A 1G2BA 1UHCA 1HD3A 1OPLA 1N5ZA 1BU1A 2OAWA 1IO6A 1GFCA 2EGCA 4J9EA 4AG2C 4K11A 2EGEA 2J6FA 2ROTA 1WXBA 2C0IA 1AD5A 1GCPA 1H8KA 1ABOA 1WDXA 2O31A 1WA7A 1ZLMA 2FPDA 1OV3A 2KE9A 4GBQA 1ARKA 2EYWA 4J9CA 2V1RA 4X1VA 1B3QA 1PNJA 1K9AA 3UF4A 1MUZA 2FRWA 2OJ2A 2LQNA 2FG0A 4DEYA 2J6KA 1BBZA 2J6OA 2D0NA 3EG1A 5FW9A 4AG1C 1JXOA 1NYFA
chains in the Genus database with same CATH superfamily
1S72Q 4KGVB 3OSSC 3V8JA 3VRYA 2X51A 2EYXA 5CKBA 1KD1C 2V8KA 1VQ9A 1YJNQ 1K9MU 1RAIB 4OF1A 4L59A 3CC4A 2HKNA 3QYHB 1SHGA 2AT1B 5GAOp 3A8OB 2COYA 3X26B 4ZGDB 1BCMA 5GMKj 4PJOE 1AWXA 2M0OA 3X24B 2I0NA 4IIOA 5GAMd 3X20B 3QUIA 3CCLT 1PC0A 2RQUA 2X9HA 3HPWA 4OGCA 5CQYA 2PZ1A 3CCRQ 4NS5A 1VQ7Q 3H8ZA 8ATCB 4JZ3A 1VQ5A 3S6WA 1RAEB 3HRUA 3I55A 3RDVA 5IT9E 3NMZC 3GLXA 2F5TX 3TSZA 4O6JA 1OX9A 1U1SA 3QZ9B 4B9WA 1NYGA 3CC2Q 2RQRA 3CCMA 3VS1A 5KYYA 4TVRA 1DJ7B 3A1PA 4KUDK 2CH4A 2BKDN 2L3PA 1FMKA 1NPRA 2LQWA 2VC8A 4PJOF 1X43A 3MCAB 1JJ2S 1X6OA 3G4SA 1V1CA 4OMNA 2VGMA 1TS9A 1D1AA 3M58A 2KSSA 3DLLA 1K76A 1M1FA 2QDYB 2ZPIB 4IURA 2EFIA 3UWNA 1VQ6A 4M75E 1WPYA 1D1CA 2DD5A 1JXMA 3WXMB 5IXBA 2K5FA 5M9OA 1VYTA 3JRZA 3M0UA 2BTTA 5LJ5j 3P8BB 2DFUA 3VKIA 2HCKA 1K0SA 3M5AA 1HSQA 2CT3A 4M7DE 1M9SA 4F7UF 4BY6B 4R56A 1B34B 3M9QA 2JTMA 1MHNA 1TG0A 2DXTA 3E2UA 3CCVQ 4QVDA 1UB4A 1EFNA 4M7DC 4MZPA 2K3XA 2KBTA 3SHWA 1G8XA 3AHUA 4CC7A 4MMKA 3D7SB 3OMGA 2XG8D 1YJ9T 1CKAA 2HNIA 1QCOA 5LL6S 1F1BB 2JTFA 1QQJA 1VQPQ 1ZX6A 2K5IA 5A0GA 4M7DA 2CUBA 4M75F 1CKBA 1GBQA 1X01A 3E19A 2QEXQ 4BE2A 2MWPA 5KYUA 4OMQA 1EZZB 7AT1B 3QJYA 2KXCA 3PIPA 2JS0A 2E3IA 2EIFA 5LJ5e 3META 2A37A 1AVZC 4XTWA 2NLUA 5GMKi 1VQNQ 4XTUA 1D0YA 4RTUA 3CCJQ 1E7OA 3RKWA 3REBB 4JLIA 2W0ZA 1VQ8A 1I81A 2QI2A 3LYIA 3L2UA 3NGPA 1IREB 3GNGA 4ZNXA 2ZPHB 4F16A 4OMMA 1AOJA 3V7CA 1X27A 2DETA 2XMFA 1QMCA 4J9BA 4ZN3A 1VQMA 3EG0A 3JV3A 4OMFB 3UATA 3LGFA 2KR3A 1ZUKA 1BCOA 1QP2A 3VV0A 3H0HA 2FYKA 3RKYA 2CS7A 4M78F 3VS0A 1WZOA 1Y96A 3TSWA 4ATOA 1SKUB 1R77A 5GAN8 2KY9A 4E7HA 3KUFA 1PRMC 1KG1A 1X2QA 2DL8A 3MJXA 2DK3A 4AFZC 1YIJA 1QVGA 2LJ1A 4XTXA 2PVOB 3J7AF 4N0AC 3VS6A 3OB9A 2KYMA 1QP3A 1W2BS 3ZFJA 2LCCA 1JJ2P 5GAOl 3M4GA 2K2MA 4AFSC 1TH7A 2ED0A 1WHHA 5LJ5d 4PFOA 4J7IA 1QVFS 4FYXB 1H641 4N0AA 2XHCA 3RKXA 1U8RA 1VQLA 3EG9B 2JN0A 1YI2Q 3CC2A 1ZSGA 2FVUA 1SSFA 2J7IA 1OI1A 3CCEQ 3JB9I 2FPFA 1QKXA 2L8DA 2JTEA 1QVPA 3H41A 1Q81R 2GTOA 3OYMA 1PWTA 1T0JA 2OTJT 3FRNA 5J39A 3I56T 2XKOC 5HK0A 5HCKA 2DTOA 4BDZA 1IB8A 3JB9F 2DBMA 3OBWA 1S1NA 3CCUQ 2P4TA 4M77C 2MK5A 1Q81C 1IZ6A 2DBKA 2ECZA 2GGRA 3CD6T 2Z0WA 4PJLA 2JJ9A 3BDUA 3RMQA 2KRSA 1XQHA 1AWJA 4IUPA 4C92A 3TQ7P 4M77A 4M75B 5DY9A 4D8DA 1X2KA 4PFZA 1ZUUA 2DXUA 3VYGA 1UGVA 3CCVA 1YITT 1UUEA 3MEVA 3FC3A 1BIBA 4NOYA 1RLPC 1X6GA 1KJWA 2HQEA 1C0MA 4BI8B 1E6GA 2QA4T 1ZA2B 2HSPA 1M2OA 4M7DB 4LNPA 3JCMV 1D3BB 1U1TA 2ROLA 2E6NA 4IUVA 3GIBA 4LD9K 3QWYA 3JCMQ 4J5YA 2QEXA 1Q82U 3M54A 4F14A 3L2QA 2COWA 4J8OA 1VQKQ 4DOVA 4LXCA 3KFVA 2RK2A 2P0PA 3G71Q 4JZ4A 2HEQA 4FW2A 1KSWA 4X9DA 2CGHA 4EMKC 3EFSA 4ESRA 3CMAA 2PU9B 2A36A 5CR2A 3PE0A 3CCSQ 2ZZDA 4AT1B 2EW3A 4GLKA 1OPKA 1U3OA 4C92G 4M77G 2V1QA 2RJFA 3A8MB 3VS5A 2AKKA 2HZYA 2L3QA 4EMKA 1VQ9Q 3NPFA 3EGXB 1Q86C 1NJIU 3E9GA 4C5EA 1N5ZA 3EGDA 4D6WA 1FX7A 3CXCP 1C1AA 4K11A 2ROTA 4JJNK 3SWNC 2C0IA 1AD5A 1GCPA 5FRMA 1WDXA 3L2ZA 2DEUA 2E12A 2FPDA 4HCZA 5CO7A 1MNEA 1OV3A 2KE9A 1C6VX 4QW2A 2QTXA 1RADB 2NUPA 5J3BA 1Y96B 1PNJA 3SWNA 1K9AA 4E7KA 1QVFP 2J6OA 5FW9A 2PUOB 4AG1C 1VQ5Q 3I55Q 5KE2A 2K3YA 3L42A 3EAEA 3C0CA 1UGRB 2CSQA 3QKJA 4M7DD 3OYDA 2M0YA 1VQ4A 1UJYA 4RCBA 2JNGA 1U06A 1YI2A 2K3BA 1PM3A 1HXDA 3EH2A 2K2VA 1R0CB 4E6RA 3ULRB 4FCYA 3CCEA 4OP0A 2M1HA 2PVDB 2RHYA 3URGA 5LJ5g 1UECA 2LJ3A 2LC4A 3OSVA 2XDDA 2QASA 5IXFA 3OYGA 1W4SA 1VQ6Q 1AEYA 4PK4A 1PKSA 4XK8E 1VUBA 2O4XB 2X35A 2MF2A 1WI7A 4RCCA 3OYYA 3CCMT 3F70A 3P8DA 1MGQA 1UJ0A 4JRKA 4E2FB 2EVRA 1V29B 4E7SA 3SFMA 2KXDA 4L6V5 3G4ST 1FWZA 2R57A 2K57A 2LQ8A 4M77B 2HD0A 3HP9A 4PJNA 4R55A 4IUQA 4V2SA 2EJ9A 5IHIA 3R6OA 2I2LA 2RHUA 2DTIA 3S3MA 1OX8A 2PQWA 4PFPA 2XIDA 1GCQC 2CREA 4C8QE 4YTLA 2MPXC 5GAN2 1H3ZA 1VQOT 3LW5E 4C8QC 1Y71A 2D1XA 2AHJB 3QPHA 2Y4YA 1GCQA 2RH2A 4Z89A 1ZBJA 2M16A 2GTJA 1VQKA 5CKDA 4C8QA 5ECAA 4FL6A 2E5QA 4F17A 3GNFB 1QWFA 2HL3A 2L3RA 5D6WA 1QWEA 2JXBA 3JCMc 4JS4A 1QKWA 2O01E 4KULA 3ZBDA 1K0XA 1N8RR 1VQ8Q 1MMAA 2MIOA 3CBMA 1OZ3A 2IPOB 2LZ6B 4EMKB 5CCAA 1QVGS 2EQUA 5FU6C 2LCSA 1D0ZA 3HL8A 3EGDB 3CPWA 2RHXA 2OTLA 1BI0A 3C94A 4ELZC 2KNBB 1VQMQ 5I21A 4DBQA 4BI3A 4DA4A 3M53A 2GBQA 1N8RC 1NZ9A 3LX7A 1RAAB 3PT9A 1Z9QA 2E65A 3ASKA 3J81E 3FLGA 1WIEA 1YWPA 5L23A 1S72T 1YHQA 1WYXA 2NUPB 5FRNA 4KUIA 4C92D 4DEXA 4M77D 2EPDA 4M7AG 2EQIA 3SWNB 4ORZA 5C0MA 3LLRA 3A8HB 1QCFA 3QXEB 1YCSB 2A0FB 1PHTA 1YJNT 2ZCFB 3PGGA 1YIJQ 4C8QG 2M51A 5GJVB 1NEBA 2J06A 1K73R 1VOMA 1W1FA 4N4GA 1IGUA 2BZXA 5FU7C 4MZTA 3JB9J 1Q7YU 1MMDA 2GFUA 1K4US 2DRMA 2B8AA 4QQDA 4JS5A 1QW1A 1BKBA 2RJDA 4C5GA 3QWXX 2DLPA 3BDLA 1VQLQ 1RI0A 3M0SA 2OAUA 3DB4A 2F1LA 1WGSA 1K73C 2RPNA 2LTOA 2BZYA 3CCRT 2A3LA 1K8AU 1VQ7T 3GBQA 2EYQA 2QQBA 3NFCA 3OA6A 2CSIA 3RIRA 5LJ5f 3CMEA 2CP0A 5GAOr 2DE0X 2HQXA 1X75C 3DKMA 4JJDA 1KC8R 4XU0A 3X28B 2KT1A 2CZ6B 2IIMA 2LNVA 2EYYA 1IXDA 2RMOA 2BZ8A 2EWNA 2DVEA 3CC2T 1V76A 1VYVA 2EKHA 1M90R 3OS1A 2EJFA 2BE9B 1M2VA 3OMCA 2G6FX 2HKQB 2E5KA 1KC8C 1VIFA 3A98A 2YDLA 3CCQQ 2OI3A 2HL5C 2DKGA 2IVWA 2RM4A 2X4JA 1SRMA 4BE1A 1KIKA 4A4GA 2PTKA 4EIKA 4FT2A 4Z8AA 3M0TA 3M57A 1TXQA 5LJ3h 1TTHB 1M90C 1RUWA 2RI5A 4KRTA 2E6ZA 5GANh 5EC7A 1GRIA 9ATCB 4OMOA 1KK7A 2K7AA 1KD1U 1ZUYA 2ENMA 3JCMh 1XTDA 4E7LA 1YBYA 1PD0A 5IAYA 1UHFA 3HTRA 2O9VA 3CCVT 4C8QB 3CBOA 1M4ZA 1UEBA 1WJQA 2WACA 4RTYA 1QVGP 1M30A 2WSFE 2PUKB 3C12A 5I11A 2Y90A 3ER0A 3CMAQ 3M0PA 4M7DF 2AZVA 5GAN7 2E41A 3M0RA 1VQPT 1JQQA 3DLMA 4RKUE 2MOXA 1WHGA 4LDWA 4J9HA 4IIMA 2F69A 4XTZA 4F7UG 1TOVA 3I9QA 1OZ2A 3JAME 4JLGA 3SDZA 4C0DC 2C0OA 2QEXT 2RJCA 2SEMA 2GF7A 2JW4A 1A0NB 2JM9A 1D1BA 1TUCA 2DTHA 3OW2S 4AMCA 1G83A 2CDTA 2CZ0B 4RG2A 3I5RA 2FRYA 5GAMh 4RG8A 3M4YA 5GAN4 4FYWB 3HRTA 4Q5WA 1B7TA 3OYNA 1YP5A 2E70A 5FU6B 1VQNT 2BUDA 3JCMg 3CCLA 2XDBA 3JB9H 4L5GA 3CCJT 1T0HA 2JOYA 5CKFA 4ZN1A 2KGTA 2DIGA 2YHTA 4UC4A 2GFAA 4XU2A 1TSFA 2Y4XA 3CXCS 3RNJA 2KT8A 4E7IA 1Q95G 1AT1B 2VWFA 1NJIR 1PSFA 2YWWA 2DXCA 1UFFA 1TUGB 2DIQA 1I07A 1M8MA 2MMPA 3TREA 2M02A 2CYZB 1VQ4Q 1UHCA 1BYMA 1ACMB 1OPLA 1BU1A 2R58A 5FU7B 4M7AD 5KYYB 1NJIC 2DD4A 1BI1A 1WXBA 2K5LA 1H8KA 1ABOA 2VASA 2O31A 1WA7A 5KYNA 4C8QD 4MDWA 4HT8A 1ARKA 4J9CA 4RMOA 2V1RA 1SF9A 4X1VA 1B3QA 1UGSB 2CP6A 4M78G 3JCMb 2MI6A 1MUZA 2FRWA 2LQNA 4C92E 2FG0A 4M77E 2J6KA 2D0NA 3H9NA 1OU9A 5CKHA 1NYFA 1I0CA 4C92C 1LPLA 3TCJA 5I2MA 2QG9B 3QG1A 3CCET 2EKOA 2G3RA 4JDSA 3KBGA 4HKEA 2YLCA 3CCQA 1YJWQ 1IRXA 4XTVA 1MMNA 3OYEA 5GAN5 4KGXB 2A7YA 2CUDA 1Y57A 2CKKA 1KQSS 2RF0A 3OYFA 1OYXA 1QLYA 1J3TA 2JMAA 1BIAA 4LDYA 5CAIA 2QXFA 2O9SA 1YJ9A 3EHQA 3CCUT 4CRIA 4Z02A 1IHVA 3JCMJ 1JRIA 3EGUA 1Y7XA 2WSEE 3EG3A 2BIVA 1ZSZC 4FIBA 3G7ZA 5GMKh 3NTHA 2P0QA 4C92F 4M77F 1I5LA 2CP5A 1ZHIA 2L0AA 3V8KA 1G3WA 3RBBB 1O75A 1UGPB 3J80E 1T3LA 5KYUB 3CPWS 4OB1B 2GCXA 1ZSZA 1SPKA 3HRSA 2HSEB 2JMCA 4X9CA 2E4HA 2LT1A 2XK0A 4CI0C 1Q86R 3OW2P 2DM1A 2NWMA 3QIIA 2RI3A 1LVKA 1GFDA 4DBHA 4EDUA 3G1JA 1ZA1B 3UT1A 4Y28E 2CZ7B 5KYWA 1HYOA 2MWOA 2WSCE 2XU8A 1RAFB 3L2VA 3OBYA 1G3SA 2F2VA 1VQKT 1SEMA 2PVGB 2OTLQ 2ZPEB 3BY7A 4LUDA 2PNIA 3G71T 4QKUA 2AKLA 2NUZA 4C0DB 2LCLA 2AK5A 2OX7A 3CC7Q 1MMGA 3TU4K 1N27A 3MHXA 3CCST 3JCMf 3HHTB 2A28A 2DJZA 3M56A 1YHQQ 4FYVB 4HVUA 2O2OA 2VB6A 2CP3A 3VU3C 5KE3A 2X4WA 3WVDB 1VQ9T 1D09B 5EG2A 2EQJA 3MKDA 3BE3A 1KHIA 1K9MR 4A4EA 2DJQA 5CK9A 1KHCA 3V7SA 3IQLA 3CC4T 4A4FA 5FROA 4C0GA 1VA7A 4P5NA 1WNLA 2JS2A 2YUQA 2YXYA 1I5OB 4LD6A 1MNDA 2ZPFB 1FYNA 3CBPA 1JEGA 1K9MC 2QYZA 4JRQA 5DLQE 4QVZA 1Q81U 2MCNA 2VGNA 4IKFA 1LOJA 4RTZA 1OU8A 2KYBA 5L8RE 2OTJA 2AIRB 2DYIA 3O5ZA 1VQ5T 5A0DA 3I55T 3CMEQ 1RACB 2DVJA 2CH4W 1RAHB 3VS7A 1Q7YR 3JCMP 2HMAA 3PNWC 5GANe 2LX9A 3CQTA 2EJGA 4DBRA 2RD1A 3RR6A 3CD6A 3MP6A 3MPUB 1KQSP 5D7UA 3M59A 2KK4A 2V8IA 1X6BA 3JCMe 3OYAA 2QK0A 3INZA 3UDCA 2DMOA 2YLBA 3PVLA 1Q7YC 4HCBA 1W2BA 1YJWA 4C92B 1WJRA 4NL3A 1YITA 4WF2A 4KGZB 4J9FA 4XU1A 4JRPA 5HY6A 4RTXA 3E1SA 3EFOA 1SG5A 1VQ6T 4BDYA 2E1HA 2A08A 1SSHA 2DEQA 4M7AE 2QA4A 1X69A 3CPWP 4A4HA 2ESWA 2DL7A 4HT9A 4M7AC 2JZ2A 1O9SA 3S3OA 2IG0A 2COZA 2B86A 4GLMA 3OYHA 4FW1A 3G6EQ 1B34A 3S3NA 4GY5A 4MZMA 2KROA 4LN2A 2CP7A 5GAMe 1W6XA 5C6SA 4M7AA 3OS5A 4EMGA 4O5VA 4OB3B 1PSEA 2LRQA 3FJ5A 1WLPB 4C0FA 2KVQG 2YSQA 1JB0E 2R5AA 4EPCA 1UDLA 4IUUA 2DX1A 3UPUA 4R0KA 1D0XA 2LNHB 1WX6A 4ANJA 5GAOn 4HVVA 5KYWB 3L2WA 2K6DA 4M7AF 1XOVA 3JCMd 4QT7A 4C8QF 3PTAA 2DL5A 3RESA 3T9NA 5A2QE 2EYZA 3ME9A 3RUXA 4ZGEB 3CC7A 2DL4A 2QQSA 4DOWA 3MEAA 3CCLQ 4QQ6A 2EBPA 2ED1A 1FMWA 2ATCB 1GXIE 3QYGB 1K1ZA 1VQ8T 4HXJA 2BE7D 4MDXA 4LDVA 2X3XD 2RNAA 3LGLA 2LX7A 4C5IA 1GBRA 3UA7A 2LT4A 2YRCA 3JCMX 2E10A 2YT6A 2RO0A 4AFUC 1OOTA 4IUTA 1Y07A 1VQMT 3VS2A 2VXEA 2RN8A 1KQ2A 4PJOC 3LWHA 5IN1A 3VS4A 3Q1JA 5IHNA 2RI2A 1W70A 2JUFA 2LMJA 2VKNA 2KAFA 2J05A 3SB2A 1I8FA 3LH5A 4PJOA 2NYSA 1YIJT 3E9FA 4WCIA 3WVEB 1M1GA 5D6YA 2LVMA 3EHRA 3OS2A 3H6ZA 1GL5A 4LUEA 1QCNA 2LDMA 3MP1A 4RTWA 4F7UE 3QHSA 2FZKB 1KQ1A 3EG9A 1PRLC 5KYXA 2FL7A 2DILA 1PKTA 1VQLT 5FWBA 5GMKm 5GMKe 2L89A 4C0ZA 1OEBA 2KRMA 1NLPC 4XAXB 2XD0A 2DF6A 4PLIA 2H8HA 2QAZA 4DQ2A 1WHLA 4N4HA 2D8JA 3HKSA 1Y0MA 3OYCA 1HD3A 3OYIA 2OAWA 1XNIA 1UGQB 4F7UA 1WHKA 4J9EA 2EGCA 2ZAEA 3EFOB 5HK3A 4BD3A 4PLLA 1ZLMA 4M75C 1YJ9Q 4E7JA 4A54A 3VUZA 1VQOA 4PJOG 3UF4A 4EMHA 1M1KU 3A8LB 3OYLA 3BW1A 4M75A 1BBZA 3CCQT 1JXOA 3G6EA 5AT1B 4KBMB 4M7AB 3O8VA 2KRNA 4ZGJB 3CEYA 3SD4A 4J6XA 2W10A 3EH1A 2AZSA 3BFMA 1N8RU 1D3BA 3GPLA 1I4K1 4JJCA 3VS3A 4FSSA 1SRLA 3KXTA 4M78E 1IHWA 2RQWA 5LJ3g 4XU3A 3M55A 1Q82R 1WQWA 5GANg 2X4YA 3C95A 4M78C 3QDRB 3JSCA 2C0TA 2C06A 4JRIA 4ELYC 1M3BA 3MEUA 4OMPA 1FMVA 2XI9A 2KMTA 4ME7A 4BB7A 5GAOq 4D8KA 4II1A 1S72A 3OYJA 3PMTA 2GNCA 4BACA 3QDFA 3CMAT 2RQTA 1YN8A 2D8HA 5FLXE 4M75G 3OS0A 4M78A 3QSUA 2P4RA 5IHKA 1Q82C 1YJNA 1UE9A 3EGXA 4FM4B 4JPBW 1ZQ1A 1M3AA 1WHJA 2ZPGB 1K73U 2CZ1B 2GQIA 1NPPA 3V7RA 1YWOA 1R8OB 2HBPA 3RERA 1AZEA 4RTVA 4Y92A 1NLOC 4M7DG 2F2XA 5I22A 2FEIA 4ZTFA 2LJ0A 2E64A 4OGEA 4PL6A 2EGAA 2DAQA 2HAXA 3FJPA 1WQ7A 2DA9A 1FXXA 3VYHB 2KEAA 5GJWB 4LE9A 4BE0A 1E6HA 2QQAA 3CCRA 4QVCA 2FHDA 3UA6A 1VQ7A 4DBFA 5GAMg 4PJOB 3RMSA 1MV0B 3A8GB 3LH0A 4HCKA 2OTJQ 2L3SA 1KC8U 3I56Q 4PKCC 2DZCA 3EG2A 5CKEA 1UG1A 5FWCA 1LCKA 8AT1B 1WXUA 2O88A 2ABLA 2H3EB 4J6WA 2JT4A 2DZ9A 5GAN3 3H0FA 2RK1A 3TVTA 4J6YA 5KYXB 4B9XA 1VQ4T 1KFZA 3ZL7C 2VV5A 2P0KA 4BUGA 1M90U 1OULA 2VVKA 3CD6Q 1I1JA 2VYTA 1YI2T 3HFOA 2YUPA 4QQGA 1WHMA 3NTIA 1RAGB 4AFQC 1M2VB 2E3HA 1UTIA 3N5BB 3MEWA 2HDAA 2KDSA 2RJEA 4F7UB 1HJDA 2GQVA 5KCOA 4CC2A 4JUVA 1YITQ 2V26A 4HCCA 1H3HA 2O4XA 3MP8A 1NG2A 1U5SA 4OMLA 1PG5B 2QA4Q 3SEMA 2YUOA 2L5QA 2QGGA 5I2SA 5CIUA 1PCXA 4PNOA 5CQXA 1JJ2A 4A53A 6AT1B 1M8VA 3FEOA 5GAN6 3GOXA 4PJMA 5J26A 2D0QB 4CC3A 1JBMA 1WJSA 1YJWT 2XDPA 2DPPB 1WFWA 4Y91A 3QJ6A 3JB9G 1VYUA 3QZ5B 2HBWA 2YUNA 1JU5C 2M9UA 2R5MA 2D9TA 3H0IA 2RQVA 3X25B 2QQRA 3JCMW 4XTYA 1BK2A 2ZPBB 2L2PA 4E7ZA 1VQPA 1G5VA 4A4KA 4PJOD 2DXBA 3OY9A 2MAMA 3ZEHA 4M4ZA 3I5SA 1TWBA 1G3YA 1AWWA 1WXTA 2DL3A 5HKCA 5KH6A 1EIFA 3HSBA 3U23A 3QO3A 5LJ3f 1EX4A 4PJJA 3R6NA 2YRVA 5GAOm 4X34A 1RI9A 4LDUA 4HA8A 4FSXA 5GANf 4RTTA 2FZCB 5IH2A 1VQNA 3V8LA 2NUTA 3PMIA 4FU6A 1M27C 4E47A 3CCJA 3THKA 1Z9ZA 2F2WA 2D6FA 1R0BG 5KCHA 4M78B 1NEGA 1N6AA 1BI2A 5A0LA 1VIEA 2H3JA 5LJ3j 3NHNA 4N4IA 1MV3A 2LP5A 3A5ZB 1AZGB 1YCYA 3CC4Q 5GANj 3M0QA 3OYBA 3VRZA 3REAB 4KT0E 2OTLT 4OB2B 5LJ5h 5D6XA 4KH0B 1AHJB 3FIFA 4J7FA 2RHIA 2VUBA 3CC7T 1W2BP 4BI4A 1NBEB 3PVQA 4M75D 3FDRA 3VUBA 3OQ5A 4F04B 1YHQT 4OVAA 4J9DA 3TEEA 1IGQA 1TU0B 2DNUA 4OB0B 3OW2A 1LJOA 3AT1B 5AYFA 5GAMf 4HVWA 3CPFA 1RLQC 3PIOA 3I56A 2V8JA 4MMLA 2LQKA 4C5HA 2DRKA 5DM7R 3PFSA 4FYYB 4NL2A 4RUGA 4FT4A 3EFRA 5LJ3e 3MO8A 1M3CA 3CCMQ 2MYSA 1SHFA 2KI7A 1BB9A 5GAMj 4J9GA 3CXCA 3G4SQ 1ABQA 2QDLA 2QTVA 3I35A 1TUDA 1BI3A 2K9GA 2XICA 2VXFA 1K8AR 2FO0A 4Z88A 1RL2A 5DLOA 1P92A 3CMET 4ZTJA 3C4SA 2KQWA 1YFNA 3P8HA 2K4YA 4XQ3A 4A63B 2FPEA 1CSKA 2JM8A 3CCUA 4M78D 1QVFA 1LNXA 2EQKA 2X4XA 2EQMA 3HFNA 4BY6C 1XJWB 2EAYA 4VUBA 1VQOQ 1JO8A 4J9IA 1K8AC 5CVIA 2DYBA 2QQ9A 2F5KA 1B07A 1YNZA 2QGFB 2JVVA 1H92A 4JJBA 3FB9A 1OQKA 2K79A 2DERA 3L2RA 4CC4B 2X3WD 1ZSZB 2HQHA 1Q86U 1AWOA 1M5Q1 1T3SA 4KH1B 4WTOB 2CT4A 3OYKA 2SRCA 1NM7A 1G2BA 3GP8A 1HK9A 1N9SA 4J83A 3GF5A 1IO6A 5LJ3d 3NTKA 1GFCA 4AG2C 5GANd 5GMKl 1G3TA 2EGEA 1PD1A 1N9RA 2J6FA 2ZGWA 1M1KR 2P84A 4B6MA 3LWIA 3QBYA 1NE8A 3G6ET 4GBQA 1KD1R 2CP2A 1RABB 2EYWA 1KQSA 3L1AA 3G71A 2FZGB 3JB9D 3DB3A 2RB6A 4LDXA 2YRDA 2FB7A 2NUTB 2OJ2A 3VJPA 4DEYA 2RHZA 3CCSA 3EG1A 2RA2A 1ZBXA 1M1KC 2DO3A
chains in the Genus database with same CATH topology
1I0CA 3VRYA 2EYXA 2KRNA 3C0CA 2CSQA 2M0YA 2W10A 1UJYA 2AZSA 1U06A 1SHGA 2K3BA 4JJCA 2CUDA 4E6RA 1Y57A 3ULRB 2RF0A 1AWXA 1QLYA 3VS3A 4FSSA 1SRLA 2I0NA 1J3TA 2JMAA 4IIOA 2O9SA 3EHQA 1UECA 2LJ3A 2RQWA 2RQUA 3EGUA 3EG3A 5IXFA 2C0TA 1AEYA 2PZ1A 1M3BA 1PKSA 4OMPA 4D8KA 2L0AA 4JZ3A 1WI7A 2GNCA 3RBBB 2RQTA 1YN8A 1T3LA 2D8HA 1SPKA 1UJ0A 2EVRA 2P4RA 5IHKA 2KXDA 3NMZC 2JMCA 3TSZA 1UE9A 4JPBW 1M3AA 2DM1A 2GQIA 1NYGA 2RQRA 3VS1A 1YWOA 2NWMA 1AZEA 4RTVA 2CH4A 2L3PA 4Y92A 1GFDA 1FMKA 2LQWA 5IHIA 1NLOC 2F2XA 1X43A 5I22A 2FEIA 1V1CA 4OMNA 2LJ0A 2EGAA 1GCQC 2DA9A 2CREA 2KEAA 5GJWB 1K76A 4LE9A 2F2VA 1SEMA 1E6HA 4LUDA 2PNIA 2AKLA 2NUZA 3UA6A 2D1XA 2AK5A 1MV0B 1GCQA 1JXMA 5IXBA 4Z89A 1ZBJA 4HCKA 2L3SA 1VYTA 2A28A 3M0UA 2BTTA 2GTJA 3EG2A 5FWCA 1UG1A 2O2OA 1LCKA 4HVUA 1WXUA 2O88A 2ABLA 2JT4A 2HCKA 1K0SA 5ECAA 4F17A 1HSQA 3H0FA 1QWFA 2CT3A 3TVTA 1QWEA 1KFZA 2JXBA 3ZL7C 2DJQA 1QKWA 1K0XA 1TG0A 2VVKA 3IQLA 1I1JA 1EFNA 2MIOA 2YUPA 2KBTA 3SHWA 2LZ6B 4AFQC 4CC7A 2LCSA 1VA7A 1CKAA 1UTIA 2JS2A 2YUQA 2HDAA 1ZX6A 1FYNA 1HJDA 1JEGA 4CC2A 2CUBA 2KNBB 1CKBA 1GBQA 1H3HA 2MCNA 2GBQA 1NG2A 1U5SA 1Z9QA 4RTZA 2KYBA 4OMQA 4OMLA 1WIEA 3O5ZA 2KXCA 1YWPA 5L23A 3SEMA 1WYXA 2YUOA 2JS0A 2DVJA 4DEXA 2CH4W 2A37A 2EPDA 1AVZC 3VS7A 2EQIA 4ORZA 1QCFA 1YCSB 1PHTA 4RTUA 3CQTA 2M51A 5GJVB 4CC3A 1NEBA 1E7OA 2J06A 3REBB 2W0ZA 1WFWA 1VYUA 3NGPA 1W1FA 2HBWA 2BZXA 1JU5C 2YUNA 4ZNXA 1X6BA 4F16A 2DRMA 3H0IA 2RQVA 4OMMA 1K4US 1AOJA 1BK2A 2L2PA 2DMOA 3PVLA 1X27A 2XMFA 3QWXX 2DLPA 4J9BA 3M0SA 3EG0A 3JV3A 4J9FA 4RTXA 3UATA 4M4ZA 2KR3A 2RPNA 1ZUKA 2BZYA 2A08A 3I5SA 3GBQA 1SSHA 3H0HA 1AWWA 1WXTA 2CSIA 2DL3A 1X69A 2ESWA 3VS0A 3U23A 2DE0X 2DL7A 3R6NA 4JJDA 3TSWA 1RI9A 2KT1A 2IIMA 1PRMC 4RTTA 2EYYA 5IH2A 1X2QA 2DL8A 4AFZC 2B86A 1M27C 4GLMA 3THKA 2LJ1A 2RMOA 2BZ8A 1Z9ZA 3VS6A 2KROA 4LN2A 2F2WA 1VYVA 2KYMA 1W6XA 1NEGA 2EKHA 2K2MA 4AFSC 2ED0A 2G6FX 2E5KA 3NHNA 1MV3A 1WLPB 2LP5A 2YDLA 3A98A 2OI3A 3FJ5A 1AZGB 2YSQA 1UDLA 2DX1A 3M0QA 1ZSGA 3VRZA 3REAB 1SRMA 1KIKA 2PTKA 4R0KA 4EIKA 2J7IA 2LNHB 1WX6A 4HVVA 2FPFA 4Z8AA 3M0TA 1QKXA 2K6DA 2JTEA 3H41A 2GTOA 1RUWA 1XOVA 4KRTA 1PWTA 1T0JA 3PVQA 4QT7A 5EC7A 5HCKA 1GRIA 2DL5A 4OMOA 4J9DA 2EYZA 2DBMA 2K7AA 2DNUA 1ZUYA 2ENMA 1S1NA 4HVWA 2DL4A 1RLQC 2EBPA 2ED1A 1UHFA 2O9VA 2DBKA 2ECZA 2GGRA 1K1ZA 4HXJA 2DRKA 2X3XD 4RTYA 2KRSA 1M30A 2RNAA 4RUGA 5I11A 2LX7A 1AWJA 1GBRA 3UA7A 1M3CA 3M0PA 2AZVA 4D8DA 2YT6A 4AFUC 3M0RA 1OOTA 1X2KA 1JQQA 2MOXA 1SHFA 4J9HA 4IIMA 1ZUUA 3I9QA 1UGVA 1BB9A 4J9GA 1UUEA 3VS2A 1ABQA 2QDLA 2C0OA 3I35A 1TUDA 2RN8A 2SEMA 2JW4A 1RLPC 2K9GA 1X6GA 1KJWA 1A0NB 2JM9A 2FO0A 1TUCA 4Z88A 1E6GA 3VS4A 2HSPA 1G83A 5IHNA 2CDTA 1W70A 3I5RA 4LNPA 2FRYA 2LMJA 2ROLA 2VKNA 3QWYA 4A63B 2FPEA 1CSKA 2J05A 2JM8A 1YP5A 3LH5A 1T0HA 4F14A 4WCIA 2KGTA 3EHRA 3KFVA 1JO8A 4J9IA 2DYBA 4JZ4A 1GL5A 1B07A 1YNZA 4LUEA 2HEQA 1KSWA 4RTWA 3RNJA 4ESRA 1H92A 1PRLC 2A36A 2KT8A 4JJBA 3PE0A 2K79A 2VWFA 2DILA 2EW3A 1PKTA 1OPKA 5FWBA 1U3OA 4CC4B 1UFFA 2V1QA 2X3WD 1OEBA 2KRMA 3VS5A 1NLPC 2AKKA 2DF6A 1AWOA 2H8HA 1I07A 2L3QA 1M8MA 1T3SA 2D8JA 2CT4A 2SRCA 3NPFA 1Y0MA 1NM7A 1G2BA 1UHCA 1HD3A 1OPLA 1N5ZA 1BU1A 2OAWA 1IO6A 1GFCA 2EGCA 4J9EA 4AG2C 4K11A 2EGEA 2J6FA 2ROTA 1WXBA 2C0IA 1AD5A 1GCPA 1H8KA 1ABOA 1WDXA 2O31A 1WA7A 1ZLMA 2FPDA 1OV3A 2KE9A 4GBQA 1ARKA 2EYWA 4J9CA 2V1RA 4X1VA 1B3QA 1PNJA 1K9AA 3UF4A 1MUZA 2FRWA 2OJ2A 2LQNA 2FG0A 4DEYA 2J6KA 1BBZA 2J6OA 2D0NA 3EG1A 5FW9A 4AG1C 1JXOA 1NYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I0C A;  3VRY A;  2EYX A;  2KRN A;  3C0C A;  2CSQ A;  2M0Y A;  2W10 A;  1UJY A;  2AZS A;  1U06 A;  1SHG A;  2K3B A;  4JJC A;  2CUD A;  4E6R A;  1Y57 A;  3ULR B;  2RF0 A;  1AWX A;  1QLY A;  3VS3 A;  4FSS A;  1SRL A;  2I0N A;  1J3T A;  2JMA A;  4IIO A;  2O9S A;  3EHQ A;  1UEC A;  2LJ3 A;  2RQW A;  2RQU A;  3EGU A;  3EG3 A;  5IXF A;  2C0T A;  1AEY A;  2PZ1 A;  1M3B A;  1PKS A;  4OMP A;  4D8K A;  2L0A A;  4JZ3 A;  1WI7 A;  2GNC A;  3RBB B;  2RQT A;  1YN8 A;  1T3L A;  2D8H A;  1SPK A;  1UJ0 A;  2EVR A;  2P4R A;  5IHK A;  2KXD A;  3NMZ C;  2JMC A;  3TSZ A;  1UE9 A;  4JPB W;  1M3A A;  2DM1 A;  2GQI A;  1NYG A;  2RQR A;  3VS1 A;  1YWO A;  2NWM A;  1AZE A;  4RTV A;  2CH4 A;  2L3P A;  4Y92 A;  1GFD A;  1FMK A;  2LQW A;  5IHI A;  1NLO C;  2F2X A;  1X43 A;  5I22 A;  2FEI A;  1V1C A;  4OMN A;  2LJ0 A;  2EGA A;  1GCQ C;  2DA9 A;  2CRE A;  2KEA A;  5GJW B;  1K76 A;  4LE9 A;  2F2V A;  1SEM A;  1E6H A;  4LUD A;  2PNI A;  2AKL A;  2NUZ A;  3UA6 A;  2D1X A;  2AK5 A;  1MV0 B;  1GCQ A;  1JXM A;  5IXB A;  4Z89 A;  1ZBJ A;  4HCK A;  2L3S A;  1VYT A;  2A28 A;  3M0U A;  2BTT A;  2GTJ A;  3EG2 A;  5FWC A;  1UG1 A;  2O2O A;  1LCK A;  4HVU A;  1WXU A;  2O88 A;  2ABL A;  2JT4 A;  2HCK A;  1K0S A;  5ECA A;  4F17 A;  1HSQ A;  3H0F A;  1QWF A;  2CT3 A;  3TVT A;  1QWE A;  1KFZ A;  2JXB A;  3ZL7 C;  2DJQ A;  1QKW A;  1K0X A;  1TG0 A;  2VVK A;  3IQL A;  1I1J A;  1EFN A;  2MIO A;  2YUP A;  2KBT A;  3SHW A;  2LZ6 B;  4AFQ C;  4CC7 A;  2LCS A;  1VA7 A;  1CKA A;  1UTI A;  2JS2 A;  2YUQ A;  2HDA A;  1ZX6 A;  1FYN A;  1HJD A;  1JEG A;  4CC2 A;  2CUB A;  2KNB B;  1CKB A;  1GBQ A;  1H3H A;  2MCN A;  2GBQ A;  1NG2 A;  1U5S A;  1Z9Q A;  4RTZ A;  2KYB A;  4OMQ A;  4OML A;  1WIE A;  3O5Z A;  2KXC A;  1YWP A;  5L23 A;  3SEM A;  1WYX A;  2YUO A;  2JS0 A;  2DVJ A;  4DEX A;  2CH4 W;  2A37 A;  2EPD A;  1AVZ C;  3VS7 A;  2EQI A;  4ORZ A;  1QCF A;  1YCS B;  1PHT A;  4RTU A;  3CQT A;  2M51 A;  5GJV B;  4CC3 A;  1NEB A;  1E7O A;  2J06 A;  3REB B;  2W0Z A;  1WFW A;  1VYU A;  3NGP A;  1W1F A;  2HBW A;  2BZX A;  1JU5 C;  2YUN A;  4ZNX A;  1X6B A;  4F16 A;  2DRM A;  3H0I A;  2RQV A;  4OMM A;  1K4U S;  1AOJ A;  1BK2 A;  2L2P A;  2DMO A;  3PVL A;  1X27 A;  2XMF A;  3QWX X;  2DLP A;  4J9B A;  3M0S A;  3EG0 A;  3JV3 A;  4J9F A;  4RTX A;  3UAT A;  4M4Z A;  2KR3 A;  2RPN A;  1ZUK A;  2BZY A;  2A08 A;  3I5S A;  3GBQ A;  1SSH A;  3H0H A;  1AWW A;  1WXT A;  2CSI A;  2DL3 A;  1X69 A;  2ESW A;  3VS0 A;  3U23 A;  2DE0 X;  2DL7 A;  3R6N A;  4JJD A;  3TSW A;  1RI9 A;  2KT1 A;  2IIM A;  1PRM C;  4RTT A;  2EYY A;  5IH2 A;  1X2Q A;  2DL8 A;  4AFZ C;  2B86 A;  1M27 C;  4GLM A;  3THK A;  2LJ1 A;  2RMO A;  2BZ8 A;  1Z9Z A;  3VS6 A;  2KRO A;  4LN2 A;  2F2W A;  1VYV A;  2KYM A;  1W6X A;  1NEG A;  2EKH A;  2K2M A;  4AFS C;  2ED0 A;  2G6F X;  2E5K A;  3NHN A;  1MV3 A;  1WLP B;  2LP5 A;  2YDL A;  3A98 A;  2OI3 A;  3FJ5 A;  1AZG B;  2YSQ A;  1UDL A;  2DX1 A;  3M0Q A;  1ZSG A;  3VRZ A;  3REA B;  1SRM A;  1KIK A;  2PTK A;  4R0K A;  4EIK A;  2J7I A;  2LNH B;  1WX6 A;  4HVV A;  2FPF A;  4Z8A A;  3M0T A;  1QKX A;  2K6D A;  2JTE A;  3H41 A;  2GTO A;  1RUW A;  1XOV A;  4KRT A;  1PWT A;  1T0J A;  3PVQ A;  4QT7 A;  5EC7 A;  5HCK A;  1GRI A;  2DL5 A;  4OMO A;  4J9D A;  2EYZ A;  2DBM A;  2K7A A;  2DNU A;  1ZUY A;  2ENM A;  1S1N A;  4HVW A;  2DL4 A;  1RLQ C;  2EBP A;  2ED1 A;  1UHF A;  2O9V A;  2DBK A;  2ECZ A;  2GGR A;  1K1Z A;  4HXJ A;  2DRK A;  2X3X D;  4RTY A;  2KRS A;  1M30 A;  2RNA A;  4RUG A;  5I11 A;  2LX7 A;  1AWJ A;  1GBR A;  3UA7 A;  1M3C A;  3M0P A;  2AZV A;  4D8D A;  2YT6 A;  4AFU C;  3M0R A;  1OOT A;  1X2K A;  1JQQ A;  2MOX A;  1SHF A;  4J9H A;  4IIM A;  1ZUU A;  3I9Q A;  1UGV A;  1BB9 A;  4J9G A;  1UUE A;  3VS2 A;  1ABQ A;  2QDL A;  2C0O A;  3I35 A;  1TUD A;  2RN8 A;  2SEM A;  2JW4 A;  1RLP C;  2K9G A;  1X6G A;  1KJW A;  1A0N B;  2JM9 A;  2FO0 A;  1TUC A;  4Z88 A;  1E6G A;  3VS4 A;  2HSP A;  1G83 A;  5IHN A;  2CDT A;  1W70 A;  3I5R A;  4LNP A;  2FRY A;  2LMJ A;  2ROL A;  2VKN A;  3QWY A;  4A63 B;  2FPE A;  1CSK A;  2J05 A;  2JM8 A;  1YP5 A;  3LH5 A;  1T0H A;  4F14 A;  4WCI A;  2KGT A;  3EHR A;  3KFV A;  1JO8 A;  4J9I A;  2DYB A;  4JZ4 A;  1GL5 A;  1B07 A;  1YNZ A;  4LUE A;  2HEQ A;  1KSW A;  4RTW A;  3RNJ A;  4ESR A;  1H92 A;  1PRL C;  2A36 A;  2KT8 A;  4JJB A;  3PE0 A;  2K79 A;  2VWF A;  2DIL A;  2EW3 A;  1PKT A;  1OPK A;  5FWB A;  1U3O A;  4CC4 B;  1UFF A;  2V1Q A;  2X3W D;  1OEB A;  2KRM A;  3VS5 A;  1NLP C;  2AKK A;  2DF6 A;  1AWO A;  2H8H A;  1I07 A;  2L3Q A;  1M8M A;  1T3S A;  2D8J A;  2CT4 A;  2SRC A;  3NPF A;  1Y0M A;  1NM7 A;  1G2B A;  1UHC A;  1HD3 A;  1OPL A;  1N5Z A;  1BU1 A;  2OAW A;  1IO6 A;  1GFC A;  2EGC A;  4J9E A;  4AG2 C;  4K11 A;  2EGE A;  2J6F A;  2ROT A;  1WXB A;  2C0I A;  1AD5 A;  1GCP A;  1H8K A;  1ABO A;  1WDX A;  2O31 A;  1WA7 A;  1ZLM A;  2FPD A;  1OV3 A;  2KE9 A;  4GBQ A;  1ARK A;  2EYW A;  4J9C A;  2V1R A;  4X1V A;  1B3Q A;  1PNJ A;  1K9A A;  3UF4 A;  1MUZ A;  2FRW A;  2OJ2 A;  2LQN A;  2FG0 A;  4DEY A;  2J6K A;  1BBZ A;  2J6O A;  2D0N A;  3EG1 A;  5FW9 A;  4AG1 C;  1JXO A;  1NYF A; 
#chains in the Genus database with same CATH topology
 1S72 Q;  4KGV B;  3OSS C;  3V8J A;  3VRY A;  2X51 A;  2EYX A;  5CKB A;  1KD1 C;  2V8K A;  1VQ9 A;  1YJN Q;  1K9M U;  1RAI B;  4OF1 A;  4L59 A;  3CC4 A;  2HKN A;  3QYH B;  1SHG A;  2AT1 B;  5GAO p;  3A8O B;  2COY A;  3X26 B;  4ZGD B;  1BCM A;  5GMK j;  4PJO E;  1AWX A;  2M0O A;  3X24 B;  2I0N A;  4IIO A;  5GAM d;  3X20 B;  3QUI A;  3CCL T;  1PC0 A;  2RQU A;  2X9H A;  3HPW A;  4OGC A;  5CQY A;  2PZ1 A;  3CCR Q;  4NS5 A;  1VQ7 Q;  3H8Z A;  8ATC B;  4JZ3 A;  1VQ5 A;  3S6W A;  1RAE B;  3HRU A;  3I55 A;  3RDV A;  5IT9 E;  3NMZ C;  3GLX A;  2F5T X;  3TSZ A;  4O6J A;  1OX9 A;  1U1S A;  3QZ9 B;  4B9W A;  1NYG A;  3CC2 Q;  2RQR A;  3CCM A;  3VS1 A;  5KYY A;  4TVR A;  1DJ7 B;  3A1P A;  4KUD K;  2CH4 A;  2BKD N;  2L3P A;  1FMK A;  1NPR A;  2LQW A;  2VC8 A;  4PJO F;  1X43 A;  3MCA B;  1JJ2 S;  1X6O A;  3G4S A;  1V1C A;  4OMN A;  2VGM A;  1TS9 A;  1D1A A;  3M58 A;  2KSS A;  3DLL A;  1K76 A;  1M1F A;  2QDY B;  2ZPI B;  4IUR A;  2EFI A;  3UWN A;  1VQ6 A;  4M75 E;  1WPY A;  1D1C A;  2DD5 A;  1JXM A;  3WXM B;  5IXB A;  2K5F A;  5M9O A;  1VYT A;  3JRZ A;  3M0U A;  2BTT A;  5LJ5 j;  3P8B B;  2DFU A;  3VKI A;  2HCK A;  1K0S A;  3M5A A;  1HSQ A;  2CT3 A;  4M7D E;  1M9S A;  4F7U F;  4BY6 B;  4R56 A;  1B34 B;  3M9Q A;  2JTM A;  1MHN A;  1TG0 A;  2DXT A;  3E2U A;  3CCV Q;  4QVD A;  1UB4 A;  1EFN A;  4M7D C;  4MZP A;  2K3X A;  2KBT A;  3SHW A;  1G8X A;  3AHU A;  4CC7 A;  4MMK A;  3D7S B;  3OMG A;  2XG8 D;  1YJ9 T;  1CKA A;  2HNI A;  1QCO A;  5LL6 S;  1F1B B;  2JTF A;  1QQJ A;  1VQP Q;  1ZX6 A;  2K5I A;  5A0G A;  4M7D A;  2CUB A;  4M75 F;  1CKB A;  1GBQ A;  1X01 A;  3E19 A;  2QEX Q;  4BE2 A;  2MWP A;  5KYU A;  4OMQ A;  1EZZ B;  7AT1 B;  3QJY A;  2KXC A;  3PIP A;  2JS0 A;  2E3I A;  2EIF A;  5LJ5 e;  3MET A;  2A37 A;  1AVZ C;  4XTW A;  2NLU A;  5GMK i;  1VQN Q;  4XTU A;  1D0Y A;  4RTU A;  3CCJ Q;  1E7O A;  3RKW A;  3REB B;  4JLI A;  2W0Z A;  1VQ8 A;  1I81 A;  2QI2 A;  3LYI A;  3L2U A;  3NGP A;  1IRE B;  3GNG A;  4ZNX A;  2ZPH B;  4F16 A;  4OMM A;  1AOJ A;  3V7C A;  1X27 A;  2DET A;  2XMF A;  1QMC A;  4J9B A;  4ZN3 A;  1VQM A;  3EG0 A;  3JV3 A;  4OMF B;  3UAT A;  3LGF A;  2KR3 A;  1ZUK A;  1BCO A;  1QP2 A;  3VV0 A;  3H0H A;  2FYK A;  3RKY A;  2CS7 A;  4M78 F;  3VS0 A;  1WZO A;  1Y96 A;  3TSW A;  4ATO A;  1SKU B;  1R77 A;  5GAN 8;  2KY9 A;  4E7H A;  3KUF A;  1PRM C;  1KG1 A;  1X2Q A;  2DL8 A;  3MJX A;  2DK3 A;  4AFZ C;  1YIJ A;  1QVG A;  2LJ1 A;  4XTX A;  2PVO B;  3J7A F;  4N0A C;  3VS6 A;  3OB9 A;  2KYM A;  1QP3 A;  1W2B S;  3ZFJ A;  2LCC A;  1JJ2 P;  5GAO l;  3M4G A;  2K2M A;  4AFS C;  1TH7 A;  2ED0 A;  1WHH A;  5LJ5 d;  4PFO A;  4J7I A;  1QVF S;  4FYX B;  1H64 1;  4N0A A;  2XHC A;  3RKX A;  1U8R A;  1VQL A;  3EG9 B;  2JN0 A;  1YI2 Q;  3CC2 A;  1ZSG A;  2FVU A;  1SSF A;  2J7I A;  1OI1 A;  3CCE Q;  3JB9 I;  2FPF A;  1QKX A;  2L8D A;  2JTE A;  1QVP A;  3H41 A;  1Q81 R;  2GTO A;  3OYM A;  1PWT A;  1T0J A;  2OTJ T;  3FRN A;  5J39 A;  3I56 T;  2XKO C;  5HK0 A;  5HCK A;  2DTO A;  4BDZ A;  1IB8 A;  3JB9 F;  2DBM A;  3OBW A;  1S1N A;  3CCU Q;  2P4T A;  4M77 C;  2MK5 A;  1Q81 C;  1IZ6 A;  2DBK A;  2ECZ A;  2GGR A;  3CD6 T;  2Z0W A;  4PJL A;  2JJ9 A;  3BDU A;  3RMQ A;  2KRS A;  1XQH A;  1AWJ A;  4IUP A;  4C92 A;  3TQ7 P;  4M77 A;  4M75 B;  5DY9 A;  4D8D A;  1X2K A;  4PFZ A;  1ZUU A;  2DXU A;  3VYG A;  1UGV A;  3CCV A;  1YIT T;  1UUE A;  3MEV A;  3FC3 A;  1BIB A;  4NOY A;  1RLP C;  1X6G A;  1KJW A;  2HQE A;  1C0M A;  4BI8 B;  1E6G A;  2QA4 T;  1ZA2 B;  2HSP A;  1M2O A;  4M7D B;  4LNP A;  3JCM V;  1D3B B;  1U1T A;  2ROL A;  2E6N A;  4IUV A;  3GIB A;  4LD9 K;  3QWY A;  3JCM Q;  4J5Y A;  2QEX A;  1Q82 U;  3M54 A;  4F14 A;  3L2Q A;  2COW A;  4J8O A;  1VQK Q;  4DOV A;  4LXC A;  3KFV A;  2RK2 A;  2P0P A;  3G71 Q;  4JZ4 A;  2HEQ A;  4FW2 A;  1KSW A;  4X9D A;  2CGH A;  4EMK C;  3EFS A;  4ESR A;  3CMA A;  2PU9 B;  2A36 A;  5CR2 A;  3PE0 A;  3CCS Q;  2ZZD A;  4AT1 B;  2EW3 A;  4GLK A;  1OPK A;  1U3O A;  4C92 G;  4M77 G;  2V1Q A;  2RJF A;  3A8M B;  3VS5 A;  2AKK A;  2HZY A;  2L3Q A;  4EMK A;  1VQ9 Q;  3NPF A;  3EGX B;  1Q86 C;  1NJI U;  3E9G A;  4C5E A;  1N5Z A;  3EGD A;  4D6W A;  1FX7 A;  3CXC P;  1C1A A;  4K11 A;  2ROT A;  4JJN K;  3SWN C;  2C0I A;  1AD5 A;  1GCP A;  5FRM A;  1WDX A;  3L2Z A;  2DEU A;  2E12 A;  2FPD A;  4HCZ A;  5CO7 A;  1MNE A;  1OV3 A;  2KE9 A;  1C6V X;  4QW2 A;  2QTX A;  1RAD B;  2NUP A;  5J3B A;  1Y96 B;  1PNJ A;  3SWN A;  1K9A A;  4E7K A;  1QVF P;  2J6O A;  5FW9 A;  2PUO B;  4AG1 C;  1VQ5 Q;  3I55 Q;  5KE2 A;  2K3Y A;  3L42 A;  3EAE A;  3C0C A;  1UGR B;  2CSQ A;  3QKJ A;  4M7D D;  3OYD A;  2M0Y A;  1VQ4 A;  1UJY A;  4RCB A;  2JNG A;  1U06 A;  1YI2 A;  2K3B A;  1PM3 A;  1HXD A;  3EH2 A;  2K2V A;  1R0C B;  4E6R A;  3ULR B;  4FCY A;  3CCE A;  4OP0 A;  2M1H A;  2PVD B;  2RHY A;  3URG A;  5LJ5 g;  1UEC A;  2LJ3 A;  2LC4 A;  3OSV A;  2XDD A;  2QAS A;  5IXF A;  3OYG A;  1W4S A;  1VQ6 Q;  1AEY A;  4PK4 A;  1PKS A;  4XK8 E;  1VUB A;  2O4X B;  2X35 A;  2MF2 A;  1WI7 A;  4RCC A;  3OYY A;  3CCM T;  3F70 A;  3P8D A;  1MGQ A;  1UJ0 A;  4JRK A;  4E2F B;  2EVR A;  1V29 B;  4E7S A;  3SFM A;  2KXD A;  4L6V 5;  3G4S T;  1FWZ A;  2R57 A;  2K57 A;  2LQ8 A;  4M77 B;  2HD0 A;  3HP9 A;  4PJN A;  4R55 A;  4IUQ A;  4V2S A;  2EJ9 A;  5IHI A;  3R6O A;  2I2L A;  2RHU A;  2DTI A;  3S3M A;  1OX8 A;  2PQW A;  4PFP A;  2XID A;  1GCQ C;  2CRE A;  4C8Q E;  4YTL A;  2MPX C;  5GAN 2;  1H3Z A;  1VQO T;  3LW5 E;  4C8Q C;  1Y71 A;  2D1X A;  2AHJ B;  3QPH A;  2Y4Y A;  1GCQ A;  2RH2 A;  4Z89 A;  1ZBJ A;  2M16 A;  2GTJ A;  1VQK A;  5CKD A;  4C8Q A;  5ECA A;  4FL6 A;  2E5Q A;  4F17 A;  3GNF B;  1QWF A;  2HL3 A;  2L3R A;  5D6W A;  1QWE A;  2JXB A;  3JCM c;  4JS4 A;  1QKW A;  2O01 E;  4KUL A;  3ZBD A;  1K0X A;  1N8R R;  1VQ8 Q;  1MMA A;  2MIO A;  3CBM A;  1OZ3 A;  2IPO B;  2LZ6 B;  4EMK B;  5CCA A;  1QVG S;  2EQU A;  5FU6 C;  2LCS A;  1D0Z A;  3HL8 A;  3EGD B;  3CPW A;  2RHX A;  2OTL A;  1BI0 A;  3C94 A;  4ELZ C;  2KNB B;  1VQM Q;  5I21 A;  4DBQ A;  4BI3 A;  4DA4 A;  3M53 A;  2GBQ A;  1N8R C;  1NZ9 A;  3LX7 A;  1RAA B;  3PT9 A;  1Z9Q A;  2E65 A;  3ASK A;  3J81 E;  3FLG A;  1WIE A;  1YWP A;  5L23 A;  1S72 T;  1YHQ A;  1WYX A;  2NUP B;  5FRN A;  4KUI A;  4C92 D;  4DEX A;  4M77 D;  2EPD A;  4M7A G;  2EQI A;  3SWN B;  4ORZ A;  5C0M A;  3LLR A;  3A8H B;  1QCF A;  3QXE B;  1YCS B;  2A0F B;  1PHT A;  1YJN T;  2ZCF B;  3PGG A;  1YIJ Q;  4C8Q G;  2M51 A;  5GJV B;  1NEB A;  2J06 A;  1K73 R;  1VOM A;  1W1F A;  4N4G A;  1IGU A;  2BZX A;  5FU7 C;  4MZT A;  3JB9 J;  1Q7Y U;  1MMD A;  2GFU A;  1K4U S;  2DRM A;  2B8A A;  4QQD A;  4JS5 A;  1QW1 A;  1BKB A;  2RJD A;  4C5G A;  3QWX X;  2DLP A;  3BDL A;  1VQL Q;  1RI0 A;  3M0S A;  2OAU A;  3DB4 A;  2F1L A;  1WGS A;  1K73 C;  2RPN A;  2LTO A;  2BZY A;  3CCR T;  2A3L A;  1K8A U;  1VQ7 T;  3GBQ A;  2EYQ A;  2QQB A;  3NFC A;  3OA6 A;  2CSI A;  3RIR A;  5LJ5 f;  3CME A;  2CP0 A;  5GAO r;  2DE0 X;  2HQX A;  1X75 C;  3DKM A;  4JJD A;  1KC8 R;  4XU0 A;  3X28 B;  2KT1 A;  2CZ6 B;  2IIM A;  2LNV A;  2EYY A;  1IXD A;  2RMO A;  2BZ8 A;  2EWN A;  2DVE A;  3CC2 T;  1V76 A;  1VYV A;  2EKH A;  1M90 R;  3OS1 A;  2EJF A;  2BE9 B;  1M2V A;  3OMC A;  2G6F X;  2HKQ B;  2E5K A;  1KC8 C;  1VIF A;  3A98 A;  2YDL A;  3CCQ Q;  2OI3 A;  2HL5 C;  2DKG A;  2IVW A;  2RM4 A;  2X4J A;  1SRM A;  4BE1 A;  1KIK A;  4A4G A;  2PTK A;  4EIK A;  4FT2 A;  4Z8A A;  3M0T A;  3M57 A;  1TXQ A;  5LJ3 h;  1TTH B;  1M90 C;  1RUW A;  2RI5 A;  4KRT A;  2E6Z A;  5GAN h;  5EC7 A;  1GRI A;  9ATC B;  4OMO A;  1KK7 A;  2K7A A;  1KD1 U;  1ZUY A;  2ENM A;  3JCM h;  1XTD A;  4E7L A;  1YBY A;  1PD0 A;  5IAY A;  1UHF A;  3HTR A;  2O9V A;  3CCV T;  4C8Q B;  3CBO A;  1M4Z A;  1UEB A;  1WJQ A;  2WAC A;  4RTY A;  1QVG P;  1M30 A;  2WSF E;  2PUK B;  3C12 A;  5I11 A;  2Y90 A;  3ER0 A;  3CMA Q;  3M0P A;  4M7D F;  2AZV A;  5GAN 7;  2E41 A;  3M0R A;  1VQP T;  1JQQ A;  3DLM A;  4RKU E;  2MOX A;  1WHG A;  4LDW A;  4J9H A;  4IIM A;  2F69 A;  4XTZ A;  4F7U G;  1TOV A;  3I9Q A;  1OZ2 A;  3JAM E;  4JLG A;  3SDZ A;  4C0D C;  2C0O A;  2QEX T;  2RJC A;  2SEM A;  2GF7 A;  2JW4 A;  1A0N B;  2JM9 A;  1D1B A;  1TUC A;  2DTH A;  3OW2 S;  4AMC A;  1G83 A;  2CDT A;  2CZ0 B;  4RG2 A;  3I5R A;  2FRY A;  5GAM h;  4RG8 A;  3M4Y A;  5GAN 4;  4FYW B;  3HRT A;  4Q5W A;  1B7T A;  3OYN A;  1YP5 A;  2E70 A;  5FU6 B;  1VQN T;  2BUD A;  3JCM g;  3CCL A;  2XDB A;  3JB9 H;  4L5G A;  3CCJ T;  1T0H A;  2JOY A;  5CKF A;  4ZN1 A;  2KGT A;  2DIG A;  2YHT A;  4UC4 A;  2GFA A;  4XU2 A;  1TSF A;  2Y4X A;  3CXC S;  3RNJ A;  2KT8 A;  4E7I A;  1Q95 G;  1AT1 B;  2VWF A;  1NJI R;  1PSF A;  2YWW A;  2DXC A;  1UFF A;  1TUG B;  2DIQ A;  1I07 A;  1M8M A;  2MMP A;  3TRE A;  2M02 A;  2CYZ B;  1VQ4 Q;  1UHC A;  1BYM A;  1ACM B;  1OPL A;  1BU1 A;  2R58 A;  5FU7 B;  4M7A D;  5KYY B;  1NJI C;  2DD4 A;  1BI1 A;  1WXB A;  2K5L A;  1H8K A;  1ABO A;  2VAS A;  2O31 A;  1WA7 A;  5KYN A;  4C8Q D;  4MDW A;  4HT8 A;  1ARK A;  4J9C A;  4RMO A;  2V1R A;  1SF9 A;  4X1V A;  1B3Q A;  1UGS B;  2CP6 A;  4M78 G;  3JCM b;  2MI6 A;  1MUZ A;  2FRW A;  2LQN A;  4C92 E;  2FG0 A;  4M77 E;  2J6K A;  2D0N A;  3H9N A;  1OU9 A;  5CKH A;  1NYF A;  1I0C A;  4C92 C;  1LPL A;  3TCJ A;  5I2M A;  2QG9 B;  3QG1 A;  3CCE T;  2EKO A;  2G3R A;  4JDS A;  3KBG A;  4HKE A;  2YLC A;  3CCQ A;  1YJW Q;  1IRX A;  4XTV A;  1MMN A;  3OYE A;  5GAN 5;  4KGX B;  2A7Y A;  2CUD A;  1Y57 A;  2CKK A;  1KQS S;  2RF0 A;  3OYF A;  1OYX A;  1QLY A;  1J3T A;  2JMA A;  1BIA A;  4LDY A;  5CAI A;  2QXF A;  2O9S A;  1YJ9 A;  3EHQ A;  3CCU T;  4CRI A;  4Z02 A;  1IHV A;  3JCM J;  1JRI A;  3EGU A;  1Y7X A;  2WSE E;  3EG3 A;  2BIV A;  1ZSZ C;  4FIB A;  3G7Z A;  5GMK h;  3NTH A;  2P0Q A;  4C92 F;  4M77 F;  1I5L A;  2CP5 A;  1ZHI A;  2L0A A;  3V8K A;  1G3W A;  3RBB B;  1O75 A;  1UGP B;  3J80 E;  1T3L A;  5KYU B;  3CPW S;  4OB1 B;  2GCX A;  1ZSZ A;  1SPK A;  3HRS A;  2HSE B;  2JMC A;  4X9C A;  2E4H A;  2LT1 A;  2XK0 A;  4CI0 C;  1Q86 R;  3OW2 P;  2DM1 A;  2NWM A;  3QII A;  2RI3 A;  1LVK A;  1GFD A;  4DBH A;  4EDU A;  3G1J A;  1ZA1 B;  3UT1 A;  4Y28 E;  2CZ7 B;  5KYW A;  1HYO A;  2MWO A;  2WSC E;  2XU8 A;  1RAF B;  3L2V A;  3OBY A;  1G3S A;  2F2V A;  1VQK T;  1SEM A;  2PVG B;  2OTL Q;  2ZPE B;  3BY7 A;  4LUD A;  2PNI A;  3G71 T;  4QKU A;  2AKL A;  2NUZ A;  4C0D B;  2LCL A;  2AK5 A;  2OX7 A;  3CC7 Q;  1MMG A;  3TU4 K;  1N27 A;  3MHX A;  3CCS T;  3JCM f;  3HHT B;  2A28 A;  2DJZ A;  3M56 A;  1YHQ Q;  4FYV B;  4HVU A;  2O2O A;  2VB6 A;  2CP3 A;  3VU3 C;  5KE3 A;  2X4W A;  3WVD B;  1VQ9 T;  1D09 B;  5EG2 A;  2EQJ A;  3MKD A;  3BE3 A;  1KHI A;  1K9M R;  4A4E A;  2DJQ A;  5CK9 A;  1KHC A;  3V7S A;  3IQL A;  3CC4 T;  4A4F A;  5FRO A;  4C0G A;  1VA7 A;  4P5N A;  1WNL A;  2JS2 A;  2YUQ A;  2YXY A;  1I5O B;  4LD6 A;  1MND A;  2ZPF B;  1FYN A;  3CBP A;  1JEG A;  1K9M C;  2QYZ A;  4JRQ A;  5DLQ E;  4QVZ A;  1Q81 U;  2MCN A;  2VGN A;  4IKF A;  1LOJ A;  4RTZ A;  1OU8 A;  2KYB A;  5L8R E;  2OTJ A;  2AIR B;  2DYI A;  3O5Z A;  1VQ5 T;  5A0D A;  3I55 T;  3CME Q;  1RAC B;  2DVJ A;  2CH4 W;  1RAH B;  3VS7 A;  1Q7Y R;  3JCM P;  2HMA A;  3PNW C;  5GAN e;  2LX9 A;  3CQT A;  2EJG A;  4DBR A;  2RD1 A;  3RR6 A;  3CD6 A;  3MP6 A;  3MPU B;  1KQS P;  5D7U A;  3M59 A;  2KK4 A;  2V8I A;  1X6B A;  3JCM e;  3OYA A;  2QK0 A;  3INZ A;  3UDC A;  2DMO A;  2YLB A;  3PVL A;  1Q7Y C;  4HCB A;  1W2B A;  1YJW A;  4C92 B;  1WJR A;  4NL3 A;  1YIT A;  4WF2 A;  4KGZ B;  4J9F A;  4XU1 A;  4JRP A;  5HY6 A;  4RTX A;  3E1S A;  3EFO A;  1SG5 A;  1VQ6 T;  4BDY A;  2E1H A;  2A08 A;  1SSH A;  2DEQ A;  4M7A E;  2QA4 A;  1X69 A;  3CPW P;  4A4H A;  2ESW A;  2DL7 A;  4HT9 A;  4M7A C;  2JZ2 A;  1O9S A;  3S3O A;  2IG0 A;  2COZ A;  2B86 A;  4GLM A;  3OYH A;  4FW1 A;  3G6E Q;  1B34 A;  3S3N A;  4GY5 A;  4MZM A;  2KRO A;  4LN2 A;  2CP7 A;  5GAM e;  1W6X A;  5C6S A;  4M7A A;  3OS5 A;  4EMG A;  4O5V A;  4OB3 B;  1PSE A;  2LRQ A;  3FJ5 A;  1WLP B;  4C0F A;  2KVQ G;  2YSQ A;  1JB0 E;  2R5A A;  4EPC A;  1UDL A;  4IUU A;  2DX1 A;  3UPU A;  4R0K A;  1D0X A;  2LNH B;  1WX6 A;  4ANJ A;  5GAO n;  4HVV A;  5KYW B;  3L2W A;  2K6D A;  4M7A F;  1XOV A;  3JCM d;  4QT7 A;  4C8Q F;  3PTA A;  2DL5 A;  3RES A;  3T9N A;  5A2Q E;  2EYZ A;  3ME9 A;  3RUX A;  4ZGE B;  3CC7 A;  2DL4 A;  2QQS A;  4DOW A;  3MEA A;  3CCL Q;  4QQ6 A;  2EBP A;  2ED1 A;  1FMW A;  2ATC B;  1GXI E;  3QYG B;  1K1Z A;  1VQ8 T;  4HXJ A;  2BE7 D;  4MDX A;  4LDV A;  2X3X D;  2RNA A;  3LGL A;  2LX7 A;  4C5I A;  1GBR A;  3UA7 A;  2LT4 A;  2YRC A;  3JCM X;  2E10 A;  2YT6 A;  2RO0 A;  4AFU C;  1OOT A;  4IUT A;  1Y07 A;  1VQM T;  3VS2 A;  2VXE A;  2RN8 A;  1KQ2 A;  4PJO C;  3LWH A;  5IN1 A;  3VS4 A;  3Q1J A;  5IHN A;  2RI2 A;  1W70 A;  2JUF A;  2LMJ A;  2VKN A;  2KAF A;  2J05 A;  3SB2 A;  1I8F A;  3LH5 A;  4PJO A;  2NYS A;  1YIJ T;  3E9F A;  4WCI A;  3WVE B;  1M1G A;  5D6Y A;  2LVM A;  3EHR A;  3OS2 A;  3H6Z A;  1GL5 A;  4LUE A;  1QCN A;  2LDM A;  3MP1 A;  4RTW A;  4F7U E;  3QHS A;  2FZK B;  1KQ1 A;  3EG9 A;  1PRL C;  5KYX A;  2FL7 A;  2DIL A;  1PKT A;  1VQL T;  5FWB A;  5GMK m;  5GMK e;  2L89 A;  4C0Z A;  1OEB A;  2KRM A;  1NLP C;  4XAX B;  2XD0 A;  2DF6 A;  4PLI A;  2H8H A;  2QAZ A;  4DQ2 A;  1WHL A;  4N4H A;  2D8J A;  3HKS A;  1Y0M A;  3OYC A;  1HD3 A;  3OYI A;  2OAW A;  1XNI A;  1UGQ B;  4F7U A;  1WHK A;  4J9E A;  2EGC A;  2ZAE A;  3EFO B;  5HK3 A;  4BD3 A;  4PLL A;  1ZLM A;  4M75 C;  1YJ9 Q;  4E7J A;  4A54 A;  3VUZ A;  1VQO A;  4PJO G;  3UF4 A;  4EMH A;  1M1K U;  3A8L B;  3OYL A;  3BW1 A;  4M75 A;  1BBZ A;  3CCQ T;  1JXO A;  3G6E A;  5AT1 B;  4KBM B;  4M7A B;  3O8V A;  2KRN A;  4ZGJ B;  3CEY A;  3SD4 A;  4J6X A;  2W10 A;  3EH1 A;  2AZS A;  3BFM A;  1N8R U;  1D3B A;  3GPL A;  1I4K 1;  4JJC A;  3VS3 A;  4FSS A;  1SRL A;  3KXT A;  4M78 E;  1IHW A;  2RQW A;  5LJ3 g;  4XU3 A;  3M55 A;  1Q82 R;  1WQW A;  5GAN g;  2X4Y A;  3C95 A;  4M78 C;  3QDR B;  3JSC A;  2C0T A;  2C06 A;  4JRI A;  4ELY C;  1M3B A;  3MEU A;  4OMP A;  1FMV A;  2XI9 A;  2KMT A;  4ME7 A;  4BB7 A;  5GAO q;  4D8K A;  4II1 A;  1S72 A;  3OYJ A;  3PMT A;  2GNC A;  4BAC A;  3QDF A;  3CMA T;  2RQT A;  1YN8 A;  2D8H A;  5FLX E;  4M75 G;  3OS0 A;  4M78 A;  3QSU A;  2P4R A;  5IHK A;  1Q82 C;  1YJN A;  1UE9 A;  3EGX A;  4FM4 B;  4JPB W;  1ZQ1 A;  1M3A A;  1WHJ A;  2ZPG B;  1K73 U;  2CZ1 B;  2GQI A;  1NPP A;  3V7R A;  1YWO A;  1R8O B;  2HBP A;  3RER A;  1AZE A;  4RTV A;  4Y92 A;  1NLO C;  4M7D G;  2F2X A;  5I22 A;  2FEI A;  4ZTF A;  2LJ0 A;  2E64 A;  4OGE A;  4PL6 A;  2EGA A;  2DAQ A;  2HAX A;  3FJP A;  1WQ7 A;  2DA9 A;  1FXX A;  3VYH B;  2KEA A;  5GJW B;  4LE9 A;  4BE0 A;  1E6H A;  2QQA A;  3CCR A;  4QVC A;  2FHD A;  3UA6 A;  1VQ7 A;  4DBF A;  5GAM g;  4PJO B;  3RMS A;  1MV0 B;  3A8G B;  3LH0 A;  4HCK A;  2OTJ Q;  2L3S A;  1KC8 U;  3I56 Q;  4PKC C;  2DZC A;  3EG2 A;  5CKE A;  1UG1 A;  5FWC A;  1LCK A;  8AT1 B;  1WXU A;  2O88 A;  2ABL A;  2H3E B;  4J6W A;  2JT4 A;  2DZ9 A;  5GAN 3;  3H0F A;  2RK1 A;  3TVT A;  4J6Y A;  5KYX B;  4B9X A;  1VQ4 T;  1KFZ A;  3ZL7 C;  2VV5 A;  2P0K A;  4BUG A;  1M90 U;  1OUL A;  2VVK A;  3CD6 Q;  1I1J A;  2VYT A;  1YI2 T;  3HFO A;  2YUP A;  4QQG A;  1WHM A;  3NTI A;  1RAG B;  4AFQ C;  1M2V B;  2E3H A;  1UTI A;  3N5B B;  3MEW A;  2HDA A;  2KDS A;  2RJE A;  4F7U B;  1HJD A;  2GQV A;  5KCO A;  4CC2 A;  4JUV A;  1YIT Q;  2V26 A;  4HCC A;  1H3H A;  2O4X A;  3MP8 A;  1NG2 A;  1U5S A;  4OML A;  1PG5 B;  2QA4 Q;  3SEM A;  2YUO A;  2L5Q A;  2QGG A;  5I2S A;  5CIU A;  1PCX A;  4PNO A;  5CQX A;  1JJ2 A;  4A53 A;  6AT1 B;  1M8V A;  3FEO A;  5GAN 6;  3GOX A;  4PJM A;  5J26 A;  2D0Q B;  4CC3 A;  1JBM A;  1WJS A;  1YJW T;  2XDP A;  2DPP B;  1WFW A;  4Y91 A;  3QJ6 A;  3JB9 G;  1VYU A;  3QZ5 B;  2HBW A;  2YUN A;  1JU5 C;  2M9U A;  2R5M A;  2D9T A;  3H0I A;  2RQV A;  3X25 B;  2QQR A;  3JCM W;  4XTY A;  1BK2 A;  2ZPB B;  2L2P A;  4E7Z A;  1VQP A;  1G5V A;  4A4K A;  4PJO D;  2DXB A;  3OY9 A;  2MAM A;  3ZEH A;  4M4Z A;  3I5S A;  1TWB A;  1G3Y A;  1AWW A;  1WXT A;  2DL3 A;  5HKC A;  5KH6 A;  1EIF A;  3HSB A;  3U23 A;  3QO3 A;  5LJ3 f;  1EX4 A;  4PJJ A;  3R6N A;  2YRV A;  5GAO m;  4X34 A;  1RI9 A;  4LDU A;  4HA8 A;  4FSX A;  5GAN f;  4RTT A;  2FZC B;  5IH2 A;  1VQN A;  3V8L A;  2NUT A;  3PMI A;  4FU6 A;  1M27 C;  4E47 A;  3CCJ A;  3THK A;  1Z9Z A;  2F2W A;  2D6F A;  1R0B G;  5KCH A;  4M78 B;  1NEG A;  1N6A A;  1BI2 A;  5A0L A;  1VIE A;  2H3J A;  5LJ3 j;  3NHN A;  4N4I A;  1MV3 A;  2LP5 A;  3A5Z B;  1AZG B;  1YCY A;  3CC4 Q;  5GAN j;  3M0Q A;  3OYB A;  3VRZ A;  3REA B;  4KT0 E;  2OTL T;  4OB2 B;  5LJ5 h;  5D6X A;  4KH0 B;  1AHJ B;  3FIF A;  4J7F A;  2RHI A;  2VUB A;  3CC7 T;  1W2B P;  4BI4 A;  1NBE B;  3PVQ A;  4M75 D;  3FDR A;  3VUB A;  3OQ5 A;  4F04 B;  1YHQ T;  4OVA A;  4J9D A;  3TEE A;  1IGQ A;  1TU0 B;  2DNU A;  4OB0 B;  3OW2 A;  1LJO A;  3AT1 B;  5AYF A;  5GAM f;  4HVW A;  3CPF A;  1RLQ C;  3PIO A;  3I56 A;  2V8J A;  4MML A;  2LQK A;  4C5H A;  2DRK A;  5DM7 R;  3PFS A;  4FYY B;  4NL2 A;  4RUG A;  4FT4 A;  3EFR A;  5LJ3 e;  3MO8 A;  1M3C A;  3CCM Q;  2MYS A;  1SHF A;  2KI7 A;  1BB9 A;  5GAM j;  4J9G A;  3CXC A;  3G4S Q;  1ABQ A;  2QDL A;  2QTV A;  3I35 A;  1TUD A;  1BI3 A;  2K9G A;  2XIC A;  2VXF A;  1K8A R;  2FO0 A;  4Z88 A;  1RL2 A;  5DLO A;  1P92 A;  3CME T;  4ZTJ A;  3C4S A;  2KQW A;  1YFN A;  3P8H A;  2K4Y A;  4XQ3 A;  4A63 B;  2FPE A;  1CSK A;  2JM8 A;  3CCU A;  4M78 D;  1QVF A;  1LNX A;  2EQK A;  2X4X A;  2EQM A;  3HFN A;  4BY6 C;  1XJW B;  2EAY A;  4VUB A;  1VQO Q;  1JO8 A;  4J9I A;  1K8A C;  5CVI A;  2DYB A;  2QQ9 A;  2F5K A;  1B07 A;  1YNZ A;  2QGF B;  2JVV A;  1H92 A;  4JJB A;  3FB9 A;  1OQK A;  2K79 A;  2DER A;  3L2R A;  4CC4 B;  2X3W D;  1ZSZ B;  2HQH A;  1Q86 U;  1AWO A;  1M5Q 1;  1T3S A;  4KH1 B;  4WTO B;  2CT4 A;  3OYK A;  2SRC A;  1NM7 A;  1G2B A;  3GP8 A;  1HK9 A;  1N9S A;  4J83 A;  3GF5 A;  1IO6 A;  5LJ3 d;  3NTK A;  1GFC A;  4AG2 C;  5GAN d;  5GMK l;  1G3T A;  2EGE A;  1PD1 A;  1N9R A;  2J6F A;  2ZGW A;  1M1K R;  2P84 A;  4B6M A;  3LWI A;  3QBY A;  1NE8 A;  3G6E T;  4GBQ A;  1KD1 R;  2CP2 A;  1RAB B;  2EYW A;  1KQS A;  3L1A A;  3G71 A;  2FZG B;  3JB9 D;  3DB3 A;  2RB6 A;  4LDX A;  2YRD A;  2FB7 A;  2NUT B;  2OJ2 A;  3VJP A;  4DEY A;  2RHZ A;  3CCS A;  3EG1 A;  2RA2 A;  1ZBX A;  1M1K C;  2DO3 A; 
#chains in the Genus database with same CATH homology
 1I0C A;  3VRY A;  2EYX A;  2KRN A;  3C0C A;  2CSQ A;  2M0Y A;  2W10 A;  1UJY A;  2AZS A;  1U06 A;  1SHG A;  2K3B A;  4JJC A;  2CUD A;  4E6R A;  1Y57 A;  3ULR B;  2RF0 A;  1AWX A;  1QLY A;  3VS3 A;  4FSS A;  1SRL A;  2I0N A;  1J3T A;  2JMA A;  4IIO A;  2O9S A;  3EHQ A;  1UEC A;  2LJ3 A;  2RQW A;  2RQU A;  3EGU A;  3EG3 A;  5IXF A;  2C0T A;  1AEY A;  2PZ1 A;  1M3B A;  1PKS A;  4OMP A;  4D8K A;  2L0A A;  4JZ3 A;  1WI7 A;  2GNC A;  3RBB B;  2RQT A;  1YN8 A;  1T3L A;  2D8H A;  1SPK A;  1UJ0 A;  2EVR A;  2P4R A;  5IHK A;  2KXD A;  3NMZ C;  2JMC A;  3TSZ A;  1UE9 A;  4JPB W;  1M3A A;  2DM1 A;  2GQI A;  1NYG A;  2RQR A;  3VS1 A;  1YWO A;  2NWM A;  1AZE A;  4RTV A;  2CH4 A;  2L3P A;  4Y92 A;  1GFD A;  1FMK A;  2LQW A;  5IHI A;  1NLO C;  2F2X A;  1X43 A;  5I22 A;  2FEI A;  1V1C A;  4OMN A;  2LJ0 A;  2EGA A;  1GCQ C;  2DA9 A;  2CRE A;  2KEA A;  5GJW B;  1K76 A;  4LE9 A;  2F2V A;  1SEM A;  1E6H A;  4LUD A;  2PNI A;  2AKL A;  2NUZ A;  3UA6 A;  2D1X A;  2AK5 A;  1MV0 B;  1GCQ A;  1JXM A;  5IXB A;  4Z89 A;  1ZBJ A;  4HCK A;  2L3S A;  1VYT A;  2A28 A;  3M0U A;  2BTT A;  2GTJ A;  3EG2 A;  5FWC A;  1UG1 A;  2O2O A;  1LCK A;  4HVU A;  1WXU A;  2O88 A;  2ABL A;  2JT4 A;  2HCK A;  1K0S A;  5ECA A;  4F17 A;  1HSQ A;  3H0F A;  1QWF A;  2CT3 A;  3TVT A;  1QWE A;  1KFZ A;  2JXB A;  3ZL7 C;  2DJQ A;  1QKW A;  1K0X A;  1TG0 A;  2VVK A;  3IQL A;  1I1J A;  1EFN A;  2MIO A;  2YUP A;  2KBT A;  3SHW A;  2LZ6 B;  4AFQ C;  4CC7 A;  2LCS A;  1VA7 A;  1CKA A;  1UTI A;  2JS2 A;  2YUQ A;  2HDA A;  1ZX6 A;  1FYN A;  1HJD A;  1JEG A;  4CC2 A;  2CUB A;  2KNB B;  1CKB A;  1GBQ A;  1H3H A;  2MCN A;  2GBQ A;  1NG2 A;  1U5S A;  1Z9Q A;  4RTZ A;  2KYB A;  4OMQ A;  4OML A;  1WIE A;  3O5Z A;  2KXC A;  1YWP A;  5L23 A;  3SEM A;  1WYX A;  2YUO A;  2JS0 A;  2DVJ A;  4DEX A;  2CH4 W;  2A37 A;  2EPD A;  1AVZ C;  3VS7 A;  2EQI A;  4ORZ A;  1QCF A;  1YCS B;  1PHT A;  4RTU A;  3CQT A;  2M51 A;  5GJV B;  4CC3 A;  1NEB A;  1E7O A;  2J06 A;  3REB B;  2W0Z A;  1WFW A;  1VYU A;  3NGP A;  1W1F A;  2HBW A;  2BZX A;  1JU5 C;  2YUN A;  4ZNX A;  1X6B A;  4F16 A;  2DRM A;  3H0I A;  2RQV A;  4OMM A;  1K4U S;  1AOJ A;  1BK2 A;  2L2P A;  2DMO A;  3PVL A;  1X27 A;  2XMF A;  3QWX X;  2DLP A;  4J9B A;  3M0S A;  3EG0 A;  3JV3 A;  4J9F A;  4RTX A;  3UAT A;  4M4Z A;  2KR3 A;  2RPN A;  1ZUK A;  2BZY A;  2A08 A;  3I5S A;  3GBQ A;  1SSH A;  3H0H A;  1AWW A;  1WXT A;  2CSI A;  2DL3 A;  1X69 A;  2ESW A;  3VS0 A;  3U23 A;  2DE0 X;  2DL7 A;  3R6N A;  4JJD A;  3TSW A;  1RI9 A;  2KT1 A;  2IIM A;  1PRM C;  4RTT A;  2EYY A;  5IH2 A;  1X2Q A;  2DL8 A;  4AFZ C;  2B86 A;  1M27 C;  4GLM A;  3THK A;  2LJ1 A;  2RMO A;  2BZ8 A;  1Z9Z A;  3VS6 A;  2KRO A;  4LN2 A;  2F2W A;  1VYV A;  2KYM A;  1W6X A;  1NEG A;  2EKH A;  2K2M A;  4AFS C;  2ED0 A;  2G6F X;  2E5K A;  3NHN A;  1MV3 A;  1WLP B;  2LP5 A;  2YDL A;  3A98 A;  2OI3 A;  3FJ5 A;  1AZG B;  2YSQ A;  1UDL A;  2DX1 A;  3M0Q A;  1ZSG A;  3VRZ A;  3REA B;  1SRM A;  1KIK A;  2PTK A;  4R0K A;  4EIK A;  2J7I A;  2LNH B;  1WX6 A;  4HVV A;  2FPF A;  4Z8A A;  3M0T A;  1QKX A;  2K6D A;  2JTE A;  3H41 A;  2GTO A;  1RUW A;  1XOV A;  4KRT A;  1PWT A;  1T0J A;  3PVQ A;  4QT7 A;  5EC7 A;  5HCK A;  1GRI A;  2DL5 A;  4OMO A;  4J9D A;  2EYZ A;  2DBM A;  2K7A A;  2DNU A;  1ZUY A;  2ENM A;  1S1N A;  4HVW A;  2DL4 A;  1RLQ C;  2EBP A;  2ED1 A;  1UHF A;  2O9V A;  2DBK A;  2ECZ A;  2GGR A;  1K1Z A;  4HXJ A;  2DRK A;  2X3X D;  4RTY A;  2KRS A;  1M30 A;  2RNA A;  4RUG A;  5I11 A;  2LX7 A;  1AWJ A;  1GBR A;  3UA7 A;  1M3C A;  3M0P A;  2AZV A;  4D8D A;  2YT6 A;  4AFU C;  3M0R A;  1OOT A;  1X2K A;  1JQQ A;  2MOX A;  1SHF A;  4J9H A;  4IIM A;  1ZUU A;  3I9Q A;  1UGV A;  1BB9 A;  4J9G A;  1UUE A;  3VS2 A;  1ABQ A;  2QDL A;  2C0O A;  3I35 A;  1TUD A;  2RN8 A;  2SEM A;  2JW4 A;  1RLP C;  2K9G A;  1X6G A;  1KJW A;  1A0N B;  2JM9 A;  2FO0 A;  1TUC A;  4Z88 A;  1E6G A;  3VS4 A;  2HSP A;  1G83 A;  5IHN A;  2CDT A;  1W70 A;  3I5R A;  4LNP A;  2FRY A;  2LMJ A;  2ROL A;  2VKN A;  3QWY A;  4A63 B;  2FPE A;  1CSK A;  2J05 A;  2JM8 A;  1YP5 A;  3LH5 A;  1T0H A;  4F14 A;  4WCI A;  2KGT A;  3EHR A;  3KFV A;  1JO8 A;  4J9I A;  2DYB A;  4JZ4 A;  1GL5 A;  1B07 A;  1YNZ A;  4LUE A;  2HEQ A;  1KSW A;  4RTW A;  3RNJ A;  4ESR A;  1H92 A;  1PRL C;  2A36 A;  2KT8 A;  4JJB A;  3PE0 A;  2K79 A;  2VWF A;  2DIL A;  2EW3 A;  1PKT A;  1OPK A;  5FWB A;  1U3O A;  4CC4 B;  1UFF A;  2V1Q A;  2X3W D;  1OEB A;  2KRM A;  3VS5 A;  1NLP C;  2AKK A;  2DF6 A;  1AWO A;  2H8H A;  1I07 A;  2L3Q A;  1M8M A;  1T3S A;  2D8J A;  2CT4 A;  2SRC A;  3NPF A;  1Y0M A;  1NM7 A;  1G2B A;  1UHC A;  1HD3 A;  1OPL A;  1N5Z A;  1BU1 A;  2OAW A;  1IO6 A;  1GFC A;  2EGC A;  4J9E A;  4AG2 C;  4K11 A;  2EGE A;  2J6F A;  2ROT A;  1WXB A;  2C0I A;  1AD5 A;  1GCP A;  1H8K A;  1ABO A;  1WDX A;  2O31 A;  1WA7 A;  1ZLM A;  2FPD A;  1OV3 A;  2KE9 A;  4GBQ A;  1ARK A;  2EYW A;  4J9C A;  2V1R A;  4X1V A;  1B3Q A;  1PNJ A;  1K9A A;  3UF4 A;  1MUZ A;  2FRW A;  2OJ2 A;  2LQN A;  2FG0 A;  4DEY A;  2J6K A;  1BBZ A;  2J6O A;  2D0N A;  3EG1 A;  5FW9 A;  4AG1 C;  1JXO A;  1NYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...