4NL3A

Crystal structure of listeria monocytogenes hfq in complex with u6 rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
72
structure length
72
Chain Sequence
KQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNFTVLLDVEGKQQLVFKHAISTFSPQKNVALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Protein hfq
publication title Recognition of U-rich RNA by Hfq from the Gram-positive pathogen Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 15
structure length 72
sequence length 72
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4nl3A00
2DTHA 4PJOE 4C92D 1I81A 3BDUA 4M78D 1M5Q1 4XTUA 5LJ3e 5GANh 5GAOl 3JCMP 1JBMA 4M77A 4M7AG 4NOYA 4PNOA 4A54A 4C8QF 4F7UG 4M7AE 1U1TA 1WPYA 1I8FA 4J6XA 3SWNC 2DXTA 4F7UE 4M75A 4QVCA 3L1AA 2DZ9A 5GANe 4M7DG 5LJ5e 3QHSA 1BIBA 1B34A 1WQWA 4M77D 2RM4A 1D3BB 3HFOA 4X9CA 2EWNA 5GAOn 1KQ1A 4M7DC 1JRIA 2DEQA 1LJOA 4M75D 1WQ7A 5GAOr 5GAN2 3JB9I 1HK9A 1TH7A 5GMKl 4NL2A 5GAN8 4M7DF 4HA8A 4PJOA 2EJGA 3RKWA 3SWNA 5GAN6 4XTWA 4M7AA 3JCMb 3QO3A 3AHUA 2VXFA 4M78B 4Y91A 4F7UA 4WF2A 4MMKA 2QTXA 2E64A 4PJOC 1U1SA 4PJOD 4M7DA 1I4K1 5I21A 1Y96B 1HXDA 3BFMA 1N9SA 5GAMe 4M7AC 5GAOm 4PJOF 3RESA 3PGGA 2E1HA 4EMKB 4RCCA 3JCMd 4A53A 4XU2A 4M7DD 2EJFA 3QSUA 4M7AF 4QVDA 4C8QE 4F7UF 4X9DA 4C92G 4M78G 3JCMJ 4HT8A 4XU1A 4N0AC 1H641 4C92E 3RERA 4M78E 3JCMX 3FIFA 4HT9A 3L2ZA 3RKXA 3QUIA 4V2SA 2VXEA 2HNIA 2YLBA 3V8JA 2DZCA 3JCMf 5GMKj 3INZA 4C8QB 1D3BA 4XTXA 3FB9A 3JCMg 3EFSA 4EMHA 4J6YA 4XTYA 5LJ3d 3JB9G 4C92B 3V7RA 5LJ3j 4M77G 2RA2A 4EMGA 4RCBA 4M77E 2FB7A 2I2LA 5GAMd 4JLIA 4M75G 5GAMj 2JN0A 3V8LA 5GANd 4M75E 5LJ5d 3BW1A 5GANj 2DJZA 5LJ5j 2K57A 4N0AA 3JCMV 4M7AD 2DVEA 2YLCA 3JB9F 4DQ2A 5LJ3f 3JCMc 4M77B 4J6WA 5LJ3g 1BIAA 5GAN3 4M78A 2DTIA 4C8QG 3JB9J 5LJ3h 4M75B 3JCMQ 5GAMg 4XU0A 2E41A 5GANf 1Y96A 5LJ5f 3V7CA 4C8QC 2DKGA 1LOJA 1B34B 5LJ5g 5GANg 2RB6A 4C92C 4M78C 3RIRA 5GAN5 4EMKA 5LJ5h 5GAN7 5GAOp 3GIBA 4XQ3A 4J5YA 5GAOq 5CAIA 4JUVA 3RKYA 4XTZA 5GMKi 1WNLA 2E10A 4C92F 3JCMW 4M78F 3JCMh 5GMKm 1X01A 2VC8A 4PJOB 2YHTA 4EMKC 3JB9D 4M7DE 3M4GA 4MMLA 3SWNB 4M77C 2ZGWA 3FJPA 3RUXA 4NL3A 4OP0A 4M7AB 3JCMe 2DXUA 4XTVA 3V7SA 4C8QA 4M75C 3EFRA 2DTOA 1MGQA 4JRKA 5DY9A 3SB2A 4F7UB 2RD1A 4M77F 2EJ9A 2FYKA 4C92A 4XU3A 5GMKh 1I5LA 4M7DB 3BY7A 1N9RA 1YCYA 5GAMf 4JRIA 2CGHA 4M75F 3HSBA 1KQ2A 2Y90A 2EAYA 3JB9H 1LNXA 3V8KA 1M8VA 3HFNA 4C8QD 4PJOG 5GMKe 5GAMh 2E65A 5GAN4 3VU3C
chains in the Genus database with same CATH superfamily
2DL8A 4XTUA 3URGA 4A54A 1GBQA 2KE9A 2DD5A 4F7UE 1WHKA 1WQWA 2OTJA 1VQNT 4LDUA 2E3HA 4M75D 3QWYA 3FDRA 2MCNA 4M7DF 1ZUYA 3RBBB 2CYZB 3CBPA 4JPBW 2JVVA 4XTWA 5KYUB 3VS6A 3I5SA 2VXFA 1KHCA 2AKKA 2QTXA 4J9GA 3EG0A 2KRNA 3GP8A 1WXTA 3A8LB 1YJWA 3QDRB 4RCCA 3CD6T 4EDUA 2DA9A 4FIBA 3OYCA 3G6EA 2FZCB 3UA6A 1JB0E 2QQ9A 3HRSA 2O01E 4XU1A 2NUTA 3EFOB 2RK2A 3JCMX 1FMVA 2EYZA 3MEWA 3JCMf 3G71T 2ZAEA 3CCUQ 4J6YA 3JB9G 1W2BP 2KROA 4TVRA 2HD0A 2I2LA 4E7KA 4M75G 1GFCA 2V8KA 5LL6S 1OOTA 2RJEA 2LDMA 2DEUA 4FYYB 4LD9K 2KXDA 4LNPA 4UC4A 1OYXA 3EG9B 1SRLA 3J81E 2F69A 1YIJQ 4C92F 2YRCA 2BTTA 3DB4A 2XG8D 4JDSA 2D0NA 1MV0B 2QQAA 3M4GA 3NGPA 4LE9A 2DXUA 2B8AA 4OMMA 1OQKA 1IO6A 3BY7A 2QEXT 1N9RA 4KULA 4BI8B 1VQNQ 3D7SB 2GNCA 1VQ6A 1LNXA 2HL3A 1K73U 2G3RA 3MEUA 2J6OA 5IT9E 1QKWA 2EQKA 1V29B 2ZCFB 4M75A 3OW2A 2BZ8A 4BACA 1UUEA 1M1GA 4F14A 2XHCA 1RUWA 2XI9A 2OTLA 1BI3A 2CT4A 5GAN8 3CD6Q 2ECZA 2AZSA 4J9IA 2QQSA 1VQ9A 4BDZA 3AHUA 1M3AA 3G71Q 4ORZA 4RTYA 4D6WA 1OU9A 1PHTA 1Q81R 1KD1R 3OSVA 2YUNA 1M90U 3OS5A 1DJ7B 2BE7D 4PJJA 1KK7A 1UJYA 2CP2A 1VQ7T 1RADB 1WZOA 3L2ZA 2L3PA 1X6GA 1OX8A 2F2WA 1O75A 4OMNA 3AT1B 2FEIA 4ZTJA 1YN8A 2K2VA 4M77E 1I0CA 1YITA 4Z8AA 4J9DA 2ZZDA 2KT8A 2WSEE 5LJ3f 2CKKA 3OYAA 2QA4T 2E3IA 3OS0A 1VQOT 1RLQC 2JJ9A 1AZGB 4BI4A 4JJDA 2Z0WA 2RQWA 4R0KA 5D6YA 4F17A 1N27A 3SDZA 1X01A 5IXFA 1JJ2P 1VQKT 3LWHA 1ZSZB 2CT3A 1Q86R 3H0FA 2D8JA 4M75C 2EJ9A 4A4KA 2VV5A 1PKTA 2LQNA 3M54A 5GAMh 2J6FA 4KRTA 1NJIC 5KYXA 2P0KA 1YNZA 4BI3A 1K4US 1RI0A 2EQIA 4J7FA 1M1KU 2ENMA 5CKEA 3CCET 1QWEA 2SRCA 5KE3A 1G3TA 4C5HA 1UECA 2M9UA 3RKWA 1SRMA 5GAN6 3P8BB 1VQMT 3E9FA 1Y0MA 3H41A 1VQ7Q 2AHJB 2VB6A 3CPWA 1Y96B 1IRXA 2JXBA 2RQUA 4GY5A 4PLIA 2A37A 2LJ3A 2JTFA 4AFSC 1JU5C 2PNIA 4LUEA 1SHFA 4OMFB 3QUIA 2QA4Q 2L3RA 5ECAA 3HPWA 1VQOQ 2MOXA 2LCCA 1KQSP 4CC7A 2HL5C 5LJ3j 2J05A 1WJQA 5GAMd 1ARKA 1ZA2B 3MO8A 2MK5A 1M4ZA 2HKNA 4NS5A 2LJ0A 1SSHA 2K57A 2O9VA 5KH6A 3CC4T 3JB9F 2P4TA 1VQKQ 3EGXA 3WXMB 2DF6A 4DBFA 2O88A 5GAN5 3OYHA 3GNFB 1TXQA 1WGSA 1WNLA 4LN2A 3JCMW 2K9GA 1QP3A 4N4HA 3PMTA 3JCMe 2MF2A 1Y07A 5GMKh 1CKBA 2KYBA 2CGHA 2EFIA 2DILA 3CCEQ 1Y71A 4Z89A 2LZ6B 4QKUA 2FG0A 3E2UA 1EZZB 5CKHA 3CCLT 1UGRB 2EVRA 4OF1A 3PE0A 3CXCP 1U8RA 3I9QA 4C0DB 1VQMQ 3QHSA 4AG1C 2KVQG 1QVFA 2KYMA 2KSSA 2PUKB 5FW9A 2C0IA 1PKSA 2KGTA 3JV3A 4PL6A 2CS7A 4QQ6A 5FLXE 3LLRA 1AZEA 4YTLA 4OB3B 1TS9A 3PVLA 4BY6B 4M7AA 4KGXB 2QDYB 1GCPA 1ZSZC 1K0XA 2YUPA 3OYKA 3ZEHA 3SHWA 4A53A 2EJFA 3QSUA 5L23A 1YJNQ 1WI7A 3CCQT 3VS4A 3CC4Q 3G1JA 3I5RA 1M90C 1VUBA 1QLYA 2RA2A 1SPKA 4EMGA 5KYYA 2G6FX 4Q5WA 4JLIA 5AT1B 3V8LA 1VQ8T 5LJ5d 1JQQA 4KGVB 3QJ6A 1QVPA 4DOWA 2E6ZA 1H3ZA 5DLOA 5GAN3 4M78A 2CDTA 1Z9ZA 4AFQC 5FROA 3S3OA 1MNEA 3KFVA 3I56T 4ZNXA 2DMOA 2DX1A 2CP0A 4C0FA 1W2BA 4GLKA 2RHXA 2A0FB 4QT7A 1D1CA 2IG0A 4RG2A 4X34A 3CCLQ 5I22A 2QI2A 1SHGA 3OYEA 3P8HA 2CREA 2EQJA 3M9QA 4E2FB 4F7UB 4JRKA 2GQIA 3M57A 1M2VA 2ZPEB 4JZ4A 5CQXA 4JRIA 3HSBA 2DIGA 2DL3A 3EH2A 4E7IA 2DTHA 2LVMA 5LJ3e 1X27A 4RTWA 1YHQT 4F7UG 4M7AE 1YI2T 2DAQA 4D8DA 2GF7A 2VYTA 4DA4A 2OAUA 4RTUA 1ZSGA 3O5ZA 4LXCA 1WHMA 2KBTA 2ABLA 2X51A 1M2OA 1RLPC 1M1KC 1QVGA 2O4XB 1G5VA 3DKMA 5D7UA 3CCQQ 1YJ9A 3JAME 3QDFA 4N4IA 3M55A 4J83A 2A7YA 3FC3A 4BE0A 1NLOC 3C95A 3FRNA 2F1LA 1ABQA 4PJOF 3MCAB 5CQYA 4E7LA 1BCMA 3ZBDA 3F70A 3H8ZA 4ELZC 2JNGA 4E7SA 1VQ8Q 3CCVT 4M78E 3LGLA 2HZYA 1KFZA 4BE2A 1Q82C 4V2SA 2NYSA 2DZCA 4XK8E 4XTXA 2JOYA 2VGMA 3V7RA 2AZVA 3T9NA 3I56Q 2DNUA 4ANJA 2DYIA 2HQHA 1CKAA 1AT1B 1VQ5T 2W0ZA 2YLCA 1MV3A 5CVIA 4OMLA 8AT1B 3X24B 1BU1A 3A98A 5HK0A 1BB9A 1UGSB 1R8OB 4LDYA 3H0HA 1VQLT 2E41A 3BE3A 3LYIA 5GANg 4BY6C 1Q7YC 3C0CA 3MEVA 5GAOp 3CC2T 3OSSC 2L3QA 2P4RA 4JUVA 5FWBA 2CZ0B 4AMCA 2RQVA 3SD4A 3HL8A 2E12A 5KYWA 2CSIA 2KDSA 4M7DE 1YHQQ 4OP0A 2K5IA 1YI2Q 4BE1A 5IAYA 1WYXA 2RF0A 4QQGA 3S6WA 1V1CA 1YP5A 2M1HA 2QXFA 2HSEB 3QZ5B 4OGCA 3VS1A 1RAAB 4J7IA 2AT1B 2RHZA 5D6XA 2QQRA 3CC7A 2NUTB 2LX7A 3M0UA 1A0NB 1TU0B 3L1AA 1XTDA 2FZGB 1TUDA 1PC0A 4M77D 1VYTA 2JS0A 1M1FA 4HCCA 1U3OA 1NJIU 3DLMA 5GAN2 1HK9A 1T3LA 5EG2A 1K8AC 4CC4B 3SWNA 2FPEA 1FWZA 4KH0B 3R6OA 3CCVQ 1QCFA 4IKFA 1U1SA 2V8IA 2L5QA 3VKIA 3WVEB 2LJ1A 1YIJA 2QGFB 4WTOB 2AK5A 3NTKA 1FX7A 3OB9A 1VQ5Q 1KC8U 4QVZA 4C0ZA 4C92E 5A0LA 2M0YA 3TSZA 3FIFA 3A1PA 3EFSA 1VQLQ 2M0OA 3OYYA 4M77G 1AWWA 2VVKA 3EG2A 4J9HA 3RMQA 5GAMj 3I55T 3CC2Q 1U06A 4N0AA 4OB1B 4QW2A 1BI2A 1D09B 4CC2A 3PIOA 2XIDA 4M75B 5CO7A 5GJVB 5LJ5f 1YJWT 1OI1A 2YDLA 4JJBA 4JZ3A 1WFWA 3CD6A 1VQ4Q 4FYWB 3A8MB 3ER0A 4CC3A 1RABB 1T0JA 1WJSA 2X4JA 3QYGB 1BYMA 3GLXA 1ZLMA 3G71A 1IHWA 2FRYA 3V7SA 1M27C 2L89A 2RD1A 2ZPGB 2FPDA 1WJRA 2P0PA 1R0CB 1M8VA 5I2MA 1NPRA 5A2QE 3FLGA 5GAN4 5A0DA 2GBQA 2KXCA 1ZBXA 2LNHB 4M77A 3SWNC 1K1ZA 2DXTA 1BCOA 2DD4A 3OYJA 2DBMA 2DZ9A 3CBMA 1B34A 4A4FA 4X9CA 5GAOn 2XDBA 4PFZA 4PK4A 4F04B 4RKUE 2QGGA 1EX4A 1CSKA 3L2WA 2JMCA 3QO3A 3HHTB 2COWA 2XK0A 3KUFA 2RHIA 3CXCA 1VQ6T 3IQLA 1HXDA 2KI7A 4E47A 1QVGS 2E1HA 1PSEA 3I55Q 4C8QE 4X9DA 3MP6A 3L2RA 4N0AC 1TTHB 4C5GA 3M58A 2K3XA 3VS0A 1R0BG 3TCJA 2HNIA 5GMKj 4KUIA 2OTLT 5EC7A 4QQDA 1QCNA 2V1QA 1N8RR 4RCBA 4KT0E 3OBWA 5LJ5j 4B9WA 2F5KA 5KYXB 3CCSA 2JT4A 1K0SA 3CQTA 1XOVA 1BK2A 1G2BA 4A4EA 2EKHA 2VASA 3M5AA 5HKCA 4E7JA 1KIKA 5HCKA 3GOXA 3LGFA 3MP1A 3ASKA 3RDVA 3CMET 1C1AA 3RIRA 1PSFA 2J06A 3QG1A 1MHNA 2PQWA 1D0XA 2RJFA 2X9HA 4M77C 2JTMA 3R6NA 2YXYA 1XJWB 2RI2A 1GCQA 3OMGA 2PTKA 4J9CA 2QYZA 2NUZA 1YITT 4FYXB 1I5LA 3V8KA 4IUTA 4RUGA 4L59A 1NEGA 1H92A 1M9SA 2QEXQ 1JBMA 4ZN3A 1G3SA 4C8QF 3ZL7C 1K9MU 4GBQA 2RJDA 2LMJA 1WHGA 5CKFA 1AD5A 3HFOA 2E5QA 2EWNA 5IHNA 1VQ6Q 3J7AF 4LDWA 2CSQA 5GAOr 2EJGA 4MZMA 5FRNA 4FU6A 4ME7A 2COYA 1PG5B 2QASA 3EGXB 4HCZA 4PJOD 1I4K1 5C6SA 2RN8A 2OTLQ 2PZ1A 3J80E 1X43A 4ZN1A 2L8DA 3RESA 4EIKA 2VKNA 5CKBA 2DYBA 2IPOB 3VRYA 4Y92A 3L2QA 3JCMJ 1RAIB 4OB0B 1RAFB 2K5LA 2K5FA 3CCMT 1LPLA 2EGEA 3PNWC 3QJYA 1KC8C 3CCEA 4IIMA 2YUQA 1TUGB 2GFAA 1K73R 2GGRA 3UATA 3L2UA 4PFOA 4ZGJB 1M3CA 3CMEQ 1QCOA 2KNBB 1UHCA 1W4SA 4M7AD 3E9GA 2DVEA 4HKEA 3RR6A 3M4YA 1TOVA 1VQMA 1Q82U 1BIAA 3UF4A 1GCQC 1MNDA 3V7CA 1LOJA 2R58A 2JM8A 1F1BB 4O6JA 4XQ3A 5CAIA 4PJNA 2BZXA 2E10A 2P84A 6AT1B 2HBWA 3TREA 2XDPA 4FM4B 4Z88A 3MJXA 4RMOA 2LC4A 3TU4K 2ZGWA 3FJPA 5IHIA 3PTAA 1WDXA 4M7AB 2OX7A 1FYNA 1KHIA 3CMAA 3VUBA 1AVZC 5DY9A 4AG2C 1Q7YU 4PKCC 3G4SA 1YCYA 4M75F 2X3WD 1M90R 2ED1A 3PT9A 1YJNA 5GMKe 4DEXA 3P8DA 4JRQA 3BDUA 4M78D 4OMOA 4B6MA 4M7AG 3M0QA 5IHKA 2XICA 2HDAA 3ZFJA 2EKOA 1SEMA 5LJ5e 5FRMA 2DL5A 1QW1A 1NG2A 2DERA 7AT1B 2DM1A 2K4YA 5KYYB 2A3LA 3X26B 4PJOA 1PNJA 3PFSA 1OZ2A 2MPXC 4PLLA 1NEBA 2OI3A 5L8RE 1E6HA 4M78B 5CIUA 3QXEB 3UDCA 3EGDA 2SEMA 2E64A 1PD0A 3CCMQ 4A4HA 2DL7A 3E1SA 5KE2A 1AWOA 3N5BB 2CUBA 2JZ2A 1UTIA 2KRMA 2RHUA 4J9EA 2ZPBB 1K8AU 4XU2A 4M7DD 3PMIA 4M78G 3OYNA 3CEYA 4AFZC 4KBMB 2YLBA 1S72A 3L42A 1EFNA 4LD6A 3OW2S 1VQPT 1M2VB 3U23A 3VJPA 2Y4XA 4L6V5 1ACMB 3BW1A 1GFDA 3OYIA 1C6VX 1D1BA 2BIVA 2HAXA 1OV3A 4JLGA 3LX7A 3NMZC 4J6WA 2M16A 2DTIA 4A63B 4E6RA 1OZ3A 1M1KR 2RHYA 2C06A 1UEBA 4IURA 5J3BA 1U5SA 2CZ1B 1IZ6A 3GIBA 1KJWA 2JTEA 3EGUA 1UG1A 2H8HA 2LQKA 2L3SA 3CCJT 4PJMA 4NL3A 2CUDA 2YSQA 2D9TA 4XTVA 1GBRA 2RNAA 1QKXA 1MGQA 3NTHA 4C0GA 1UJ0A 2V8JA 3TVTA 3PVQA 3TQ7P 2KAFA 1VQ8A 1W1FA 4J9BA 3UPUA 1MMGA 4PJOE 2EYYA 4C92D 4DBRA 5GANh 1XQHA 3M0SA 2RQTA 3NPFA 3HRTA 3CCRA 1YWPA 2LRQA 2QK0A 2ED0A 2A28A 1K9MC 4C5IA 2DEQA 1LJOA 1G3WA 1RAGB 2D1XA 3QWXX 2CH4W 5CKDA 3QBYA 5GMKl 4IUVA 3QIIA 1AOJA 2VUBA 4P5NA 1WA7A 4R56A 3H9NA 3EAEA 3VV0A 3JCMb 4XAXB 4Y91A 3M0PA 4MDWA 2RQRA 1OEBA 5FU7B 4M7DA 3ME9A 2EW3A 2H3EB 2EIFA 2JM9A 1VQPQ 4M7AC 2DJQA 2D6FA 4R55A 1OULA 4IUQA 1X6BA 4C92G 5KYWB 1YI2A 1Y7XA 1NBEB 3RKXA 3S3NA 1BI0A 1X75C 2EQMA 1D3BA 3JCMg 5KYNA 1RAHB 2DFUA 4XTYA 2LNVA 2YT6A 4BB7A 1M30A 3WVDB 2JS2A 5A0GA 5GANd 2ROTA 1WLPB 1YJ9T 1WHHA 1T0HA 3JCMc 3VS5A 2DETA 1D1AA 1H3HA 5LJ3h 3CCJQ 1X2QA 4KGZB 3PIPA 2DKGA 5CCAA 3CPWS 4M78C 2CZ6B 3LW5E 4EMKA 5GAOq 5J39A 3OYMA 2ZPIB 4F16A 2YHTA 4FW1A 4LUDA 2PUOB 4MMLA 2XKOC 3SWNB 3OYLA 3OYGA 2DK3A 2K7AA 4OMQA 1UDLA 2DTOA 4C92A 2QTVA 5GAMf 5HK3A 1OU8A 3X28B 1VQ5A 4C8QD 2EPDA 1M5Q1 1HYOA 4NOYA 4J6XA 2VWFA 5CK9A 2YWWA 2WACA 1E6GA 3Q1JA 4M7DC 4MZPA 1KSWA 1WQ7A 3GNGA 5D6WA 1NE8A 3KXTA 3LH0A 4HA8A 4AT1B 2RI3A 1ZA1B 1VOMA 3E19A 1OPKA 2PU9B 3OMCA 2ZPHB 5I21A 1JJ2A 2LQWA 3BFMA 3CCUA 1VQ4A 2OJ2A 1HJDA 3HTRA 3NHNA 2L2PA 3UWNA 3DB3A 2GQVA 3JSCA 2WSFE 2KRSA 3CC7T 1TWBA 1YJ9Q 1LVKA 2X35A 4PFPA 3HRUA 1I5OB 2RO0A 3MEAA 2EGCA 2LT4A 1JXOA 4CI0C 1D0YA 1O9SA 2AKLA 1QVFS 1ZX6A 1X2KA 1QQJA 1ZQ1A 3M59A 2HKQB 5FWCA 3A8GB 2Y4YA 2QDLA 1RAEB 4LDVA 3OQ5A 2ZPFB 4M77B 5LJ3g 1QP2A 1NYFA 2K6DA 1PD1A 1N8RU 1B34B 4Y28E 3VS7A 1I1JA 4C92C 2OTJT 2EQUA 3EG1A 4FSSA 1VQNA 1WHLA 3RKYA 5FU7C 1Q81U 4KH1B 4E7ZA 4OB2B 1KD1U 1MMAA 1VYUA 1PM3A 1ABOA 1I07A 1YCSB 3JB9D 1WHJA 2BKDN 2NLUA 4C8QA 2E6NA 1MUZA 1M3BA 3I55A 2JW4A 5DLQE 3VU3C 2NUPA 1KQSA 4ZGDB 4PNOA 3G6ET 3LWIA 1U1TA 1GL5A 2DXBA 1X6OA 1JO8A 2XU8A 3THKA 4BD3A 3A5ZB 1W2BS 2X4YA 4RTZA 4OGEA 4A4GA 3CC7Q 1AHJB 1IGQA 1Q86U 2QQBA 4WF2A 1WIEA 3OYDA 5C0MA 4FT2A 4IUPA 3TEEA 4MZTA 5I2SA 3PGGA 1BI1A 2E4HA 2K79A 2ATCB 4FL6A 1ZUKA 4F7UF 3QYHB 2V26A 2M02A 2R5MA 2DVJA 1UHFA 2OTJQ 2MIOA 4D8KA 2M51A 2PVOB 2QEXA 4BDYA 2DRMA 1SSFA 3VS2A 3VYGA 1IREB 1TSFA 5KYUA 1Y57A 1NM7A 3JB9J 4B9XA 3CPFA 1GRIA 4VUBA 5GANf 1QVGP 1AEYA 4C8QC 2FL7A 1NJIR 2PVDB 1N5ZA 5GAN7 3S3MA 5HY6A 5KCOA 4HCBA 5CR2A 1AWXA 2FO0A 4JS5A 1YJWQ 3EFOA 4RTVA 3G6EQ 3H0IA 1VQ9T 3EFRA 4HCKA 2LTOA 2DO3A 2X3XD 1B7TA 4FT4A 5GMKi 3CCST 1KC8R 1K76A 3MKDA 1G83A 2E5KA 1I8FA 1VQ7A 1TG0A 3CMEA 5IN1A 1N6AA 1JRIA 1B07A 1S1NA 3EG9A 2HQXA 3VS3A 2MAMA 2QAZA 2RMOA 1TH7A 1IHVA 2DIQA 2WSCE 2LT1A 1ZBJA 1OX9A 2F2XA 3MPUB 2EBPA 2FPFA 2QA4A 2RK1A 5GAMe 1VQOA 1N9SA 2KT1A 1JEGA 3L2VA 4E7HA 3M53A 4RTTA 2HEQA 4JRPA 4L5GA 4QVDA 1MMNA 4HT8A 2RH2A 2FVUA 1VQKA 1VA7A 3A8HB 1JJ2S 2BE9B 2KR3A 3ULRB 5I11A 1G8XA 1AWJA 1SKUB 1IXDA 5KCHA 2FB7A 4M75E 5GANj 2KQWA 4ATOA 3GBQA 3M0TA 2K3BA 1VQ9Q 4HVVA 2O9SA 2RB6A 4ZGEB 4J5YA 2V1RA 4HVWA 3CCSQ 1N8RC 1H8KA 2KEAA 4DBHA 1WX6A 2VC8A 2LCSA 3DLLA 4PJOB 2K2MA 1TUCA 1HSQA 3O8VA 3CCMA 3SFMA 1RACB 2FRWA 2CP5A 2LP5A 1Q81C 2AIRB 1KD1C 3SB2A 2YRDA 4PJLA 3EGDB 4M77F 2MMPA 3C12A 1PWTA 2HQEA 3OA6A 2KK4A 4PJOG 2O2OA 3I35A 1I81A 4HVUA 1YITQ 1RL2A 3VYHB 4Z02A 4ELYC 4DBQA 4II1A 4QVCA 4EPCA 4ESRA 1BIBA 4FCYA 4X1VA 5AYFA 3LH5A 2F2VA 1Q95G 1W70A 1KQSS 3JB9I 4NL2A 1ZSZA 2C0OA 3VUZA 1K9AA 1HD3A 3EHRA 3QPHA 3CMAT 3CC4A 4MMKA 3G4ST 1B3QA 4LDXA 4K11A 2P0QA 1YJNT 5GAOm 1Q86C 8ATCB 2RI5A 2DBKA 4FSXA 2DXCA 1UGQB 5GJWB 4OMPA 3A8OB 1WXBA 1UE9A 1J3TA 4EMHA 1NYGA 3X20B 2EYQA 1M8MA 4CRIA 1UGPB 1QMCA 2IVWA 4AFUC 2CZ7B 3JCMV 1K9MR 1VYVA 2JMAA 2HBPA 1YFNA 3CCLA 1PCXA 1C0MA 3GF5A 3JCMQ 5GAMg 4XU0A 3H6ZA 1Y96A 4HXJA 3CXCS 4JJCA 1FXXA 1ZHIA 3OYFA 1GXIE 2MYSA 5LJ5h 3QKJA 3JCMh 3HKSA 5GMKm 1K73C 1OPLA 1S72T 3BDLA 2I0NA 3OW2P 1LCKA 3RUXA 2CP3A 1VQPA 2CH4A 1YWOA 2FYKA 1FMKA 4XU3A 3NTIA 3X25B 4M7DB 5IXBA 3QZ9B 1R77A 1T3SA 4J8OA 4RG8A 2X4XA 1SF9A 5GAOl 3EHQA 2PVGB 3M0RA 2VGNA 3UT1A 4C5EA 1WPYA 3CMAQ 3CCQA 4O5VA 5GANe 4M7DG 4IUUA 3G4SQ 1D3BB 2EYWA 2L0AA 1KQ1A 5FU6B 4GLMA 3C94A 2EGAA 1Q82R 2XMFA 4OVAA 1IGUA 3G7ZA 3CCJA 2XD0A 3REBB 2K3YA 2LQ8A 1NZ9A 2BZYA 1XNIA 2MWOA 4PJOC 3MHXA 1WXUA 2H3JA 2LCLA 2E70A 2J7IA 3I56A 4EMKB 2COZA 3JCMd 4FYVB 4N4GA 1ZUUA 2DL4A 1Z9QA 3CCRT 3EG3A 2O31A 2RJCA 2MWPA 1H641 1Q7YR 1UGVA 2VXEA 3CBOA 4IIOA 3INZA 3FB9A 2CP6A 3REAB 4C92B 5M9OA 2GCXA 1UFFA 2CP7A 2JN0A 2JUFA 2DJZA 3M56A 3OS2A 2RPNA 4DQ2A 2DE0X 1S72Q 1YHQA 3TSWA 5LJ5g 1PRLC 4XTZA 2KY9A 1P92A 2YUOA 3KBGA 1IB8A 2D0QB 3OY9A 3OS1A 2XDDA 3RNJA 1SG5A 1JXMA 9ATCB 2OAWA 1NLPC 2ESWA 4JS4A 1K8AR 1UB4A 1KQ2A 2EAYA 2E65A 2C0TA 3JCMP 1W6XA 1QWFA 2DLPA 2FHDA 3CCVA 3UA7A 1RI9A 3CPWP 1BKBA 3RMSA 1X69A 3MP8A 4KUDK 4FW2A 2RM4A 4JJNK 5J26A 2GTJA 1EIFA 2FZKB 1FMWA 1VIEA 4DOVA 3FJ5A 2R5AA 4DEYA 3CCRQ 2MI6A 3JRZA 2IIMA 1MMDA 4MDXA 4F7UA 1NPPA 3C4SA 4C0DC 1VQLA 2YRVA 2A36A 1KG1A 2W10A 2EYXA 2HSPA 4BUGA 3CC2A 2ROLA 4M7AF 2F5TX 2A08A 1E7OA 2B86A 2D8HA 3RERA 1D0ZA 1G3YA 4HT9A 3V8JA 2GFUA 3HP9A 4C8QB 2KMTA 3META 5LJ3d 5DM7R 3OBYA 3NFCA 2LX9A 2O4XA 5FU6C 2NUPB 1BBZA 4WCIA 2HMAA 4C8QG 4J9FA 3OYBA 2GTOA 3CCUT 1VQ4T 3VRZA 2NWMA 1VIFA 2X4WA 3SEMA 4M78F 2BUDA 4EMKC 1V76A 2DRKA 4RTXA 2QG9B 1PRMC 4ZTFA 1QVFP 2J6KA 3GPLA 2HCKA 3EH1A 5IH2A 2R57A 2DPPB 2Y90A 3JB9H 1YIJT 3HFNA 4M4ZA 1YBYA 3FEOA
chains in the Genus database with same CATH topology
2DTHA 3P8DA 4JRQA 3BDUA 2LVMA 4M78D 4XTUA 5LJ3e 3URGA 4M7AG 4A54A 1YHQT 4F7UG 4M7AE 1YI2T 1I8FA 2XICA 2DD5A 4F7UE 3ZFJA 2EKOA 2DAQA 1VQ7A 5LJ5e 5FRMA 2GF7A 1QW1A 2VYTA 1WQWA 2OTJA 3CMEA 4DA4A 2OAUA 1VQNT 5IN1A 1N6AA 4LDUA 1JRIA 2K4YA 4M75D 2A3LA 2HQXA 3FDRA 2MAMA 3X26B 1TH7A 1QVGA 2DIQA 1M1KC 4M7DF 2WSCE 2CYZB 4PJOA 3CBPA 2LT1A 1OZ2A 3PFSA 4PLLA 2O4XB 2JVVA 4XTWA 1G5VA 3DKMA 5L8RE 1YJ9A 2VXFA 1KHCA 3QXEB 4M78B 4N4IA 5CIUA 3UDCA 2QTXA 3JAME 3M55A 2E64A 4J83A 2A7YA 4A4HA 2QA4A 2RK1A 3FC3A 3E1SA 5KE2A 4BE0A 3GP8A 5GAMe 1VQOA 1N9SA 3C95A 3FRNA 3L2VA 3A8LB 3N5BB 2JZ2A 4PJOF 3MCAB 5CQYA 1YJWA 2RHUA 3QDRB 4E7LA 4RCCA 3ZBDA 4E7HA 3F70A 3H8ZA 2ZPBB 3CD6T 1K8AU 4EDUA 4ELZC 4XU2A 3M53A 4JRPA 4FIBA 4M7DD 3PMIA 2JNGA 4L5GA 4QVDA 3OYCA 3G6EA 4M78G 4HT8A 1JB0E 2QQ9A 3HRSA 2O01E 2RH2A 4XU1A 3OYNA 2RK2A 3LGLA 4M78E 3JCMX 2FVUA 3CEYA 4BE2A 1Q82C 1VQKA 4V2SA 3A8HB 4KBMB 1JJ2S 2YLBA 3MEWA 1S72A 2DZCA 3L42A 3JCMf 3G71T 4XK8E 4LD6A 4XTXA 3OW2S 1VQPT 4J6YA 2JOYA 3JB9G 2VGMA 3V7RA 4TVRA 5KCHA 3T9NA 2HD0A 3VJPA 2FB7A 2Y4XA 2I2LA 4E7KA 4M75G 4L6V5 2V8KA 5LL6S 4M75E 3BW1A 5GANj 1VQ5T 2RJEA 3OYIA 2HAXA 2BIVA 2YLCA 4JLGA 3LX7A 2KQWA 4J6WA 2LDMA 5CVIA 4ATOA 2M16A 2DTIA 3X24B 4LD9K 1OZ3A 2RHYA 5HK0A 1UGSB 2C06A 1R8OB 4LDYA 1UEBA 4IURA 5J3BA 1VQLT 2CZ1B 2E41A 3LYIA 5GANg 4BY6C 1Q7YC 4UC4A 2RB6A 3MEVA 1IZ6A 5GAOp 3GIBA 3CC2T 3OSSC 1OYXA 4ZGEB 4J5YA 4JUVA 3J81E 3CCST 2F69A 2CZ0B 4C92F 3SD4A 3HL8A 1N8RC 2E12A 3DB4A 2XG8D 2VC8A 4JDSA 3DLLA 4PJOB 2LQKA 2KDSA 4M7DE 2QQAA 3M4GA 3O8VA 3CCMA 3SFMA 3CCJT 4NL3A 4OP0A 2K5IA 2DXUA 2B8AA 4XTVA 2D9TA 5IAYA 4BE1A 1Q81C 1KD1C 3SB2A 1MGQA 3NTHA 4C0GA 4M77F 2MMPA 2V8JA 3C12A 4QQGA 3BY7A 3S6WA 1N9RA 4KULA 2HQEA 4BI8B 2QEXT 1VQ6A 2M1HA 3OA6A 1LNXA 2KAFA 2KK4A 1VQ8A 2QXFA 3QZ5B 4PJOG 1K73U 4OGCA 2G3RA 3MEUA 3UPUA 4PJOE 4C92D 5IT9E 1I81A 5GANh 1XQHA 4J7IA 2RHZA 5D6XA 2EQKA 1V29B 2QQRA 3HRTA 3CC7A 1RL2A 2ZCFB 3CCRA 3VYHB 4Z02A 4ELYC 4QVCA 4II1A 4M75A 2LRQA 3OW2A 3L1AA 4BACA 1XTDA 4EPCA 1BIBA 1M1GA 4M77D 4HCCA 1M1FA 2XHCA 2XI9A 5AYFA 4C5IA 2DEQA 1LJOA 1G3WA 1YJNA 1NJIU 1K9MC 2OTLA 1BI3A 3DLMA 5CKDA 5GAN2 3JB9I 3QBYA 1HK9A 1KQSS 5GMKl 4IUVA 4NL2A 3QIIA 5GAN8 5EG2A 1K8AC 2VUBA 4P5NA 3VUZA 3QPHA 3SWNA 4R56A 3CMAT 1FWZA 3EAEA 2QQSA 3R6OA 1VQ9A 3VV0A 3JCMb 4BDZA 3CC4A 3AHUA 4XAXB 4Y91A 4MMKA 3G4ST 4MDWA 4IKFA 4LDXA 1U1SA 2V8IA 2L5QA 3VKIA 5FU7B 4M7DA 3WVEB 4D6WA 3ME9A 2P0QA 1YJNT 2EIFA 1YIJA 4M7AC 5GAOm 3OSVA 1Q86C 2D6FA 4R55A 3NTKA 1FX7A 4IUQA 2RI5A 3OS5A 1M90U 1DJ7B 3OB9A 4C92G 1KC8U 1YI2A 4QVZA 4C0ZA 4FSXA 4C92E 5A0LA 1VQ7T 1Y7XA 3FIFA 2DXCA 3L2ZA 1UGQB 3RKXA 3S3NA 1BI0A 1X75C 3A8OB 1O75A 2EQMA 1D3BA 3JCMg 4EMHA 4ZTJA 3EFSA 2M0OA 3OYYA 4XTYA 3X20B 4M77G 2LNVA 2EYQA 4BB7A 3WVDB 2K2VA 4M77E 4CRIA 1YITA 1UGPB 3RMQA 5GAMj 5A0GA 3I55T 2IVWA 2CZ7B 2ZZDA 5GANd 3JCMV 4N0AA 4OB1B 2WSEE 4QW2A 1YJ9T 5LJ3f 2CKKA 1BI2A 3JCMc 2HBPA 3CCLA 3OYAA 2QA4T 3PIOA 2XIDA 3GF5A 4M75B 5CO7A 5LJ3h 3OS0A 3PIPA 3JCMQ 5GAMg 4XU0A 1VQOT 3H6ZA 1Y96A 4BI4A 5LJ5f 2DKGA 5CCAA 3CXCS 1YJWT 1OI1A 1FXXA 1ZHIA 3OYFA 1GXIE 3CPWS 4M78C 2CZ6B 3LW5E 4EMKA 5LJ5h 3CD6A 5GAOq 3QKJA 5J39A 3OYMA 5D6YA 3JCMh 3HKSA 1N27A 3SDZA 5GMKm 1X01A 2ZPIB 1K73C 4M7AD 1VQKT 3A8MB 3LWHA 2YHTA 1S72T 2PUOB 3BDLA 2XKOC 3ER0A 4MMLA 3SWNB 3OYLA 3OYGA 1WJSA 3RUXA 2X4JA 2DK3A 3QYGB 3GLXA 1BYMA 3G71A 3V7SA 4M75C 2DTOA 1VQPA 2L89A 2RD1A 2ZPGB 2EJ9A 2FYKA 4A4KA 4XU3A 2VV5A 4C92A 3NTIA 3X25B 3M54A 4M7DB 1WJRA 2P0PA 3QZ9B 5GAMf 4J8OA 5HK3A 3X28B 4RG8A 1M8VA 5I2MA 4C8QD 1VQ5A 2X4XA 1NPRA 5GAMh 5A2QE 3FLGA 5GAN4 1NJIC 5A0DA 2P0KA 1ZBXA 5GAOl 1M5Q1 2PVGB 4M77A 4NOYA 4BI3A 2VGNA 3UT1A 4C5EA 4J6XA 1WPYA 3SWNC 2DXTA 5CK9A 2DD4A 3OYJA 3CCQA 4O5VA 2DZ9A 1RI0A 4IUUA 5GANe 2WACA 3CBMA 4M7DG 4J7FA 1B34A 4A4FA 1M1KU 3Q1JA 1D3BB 4X9CA 5GAOn 1KQ1A 5CKEA 5FU6B 3CCET 4MZPA 4M7DC 2XDBA 1WQ7A 3GNGA 5D6WA 5KE3A 3C94A 1G3TA 1NE8A 4C5HA 3KXTA 3LH0A 4HA8A 2M9UA 4OVAA 3RKWA 4RKUE 3G7ZA 5GAN6 3CCJA 2RI3A 2XD0A 3L2WA 3P8BB 2K3YA 2LQ8A 1VQMT 1NZ9A 3E19A 1XNIA 3E9FA 3QO3A 2AHJB 2MWOA 3HHTB 2PU9B 2XK0A 3KUFA 2RHIA 3OMCA 3CXCA 4PJOC 3MHXA 1VQ6T 2ZPHB 3CPWA 5I21A 1JJ2A 1Y96B 1HXDA 2H3JA 2LCLA 3BFMA 3CCUA 1VQ4A 4GY5A 4E47A 2E70A 4PLIA 3UWNA 3I56A 1QVGS 4EMKB 2E1HA 3DB3A 2GQVA 3JSCA 3JCMd 2WSFE 4N4GA 1PSEA 2JTFA 3CC7T 3CCRT 4C8QE 2RJCA 4X9DA 3MP6A 3L2RA 2MWPA 4N0AC 1H641 2X35A 4C5GA 3M58A 2K3XA 4OMFB 3HRUA 3TCJA 2RO0A 3MEAA 3QUIA 2HNIA 2LT4A 2VXEA 3CBOA 2L3RA 5GMKj 3INZA 4KUIA 3HPWA 3FB9A 4CI0C 2OTLT 2LCCA 1O9SA 4C92B 5LJ3j 4QQDA 1QVFS 4RCBA 4KT0E 2GCXA 5M9OA 1WJQA 5GAMd 2JN0A 1ZQ1A 3M59A 3MO8A 3OBWA 1M4ZA 2JUFA 2DJZA 3A8GB 4NS5A 3M56A 2K57A 2Y4YA 2F5KA 4B9WA 5LJ5j 4LDVA 3CCSA 5KH6A 3OS2A 3OQ5A 4DQ2A 3CC4T 3JB9F 2ZPFB 2P4TA 4M77B 1XOVA 5LJ3g 1QP2A 3WXMB 4A4EA 1YHQA 5HKCA 3M5AA 4E7JA 3GOXA 3LGFA 3MP1A 1B34B 4Y28E 5LJ5g 3ASKA 1N8RU 4C92C 3CMET 2OTJT 2EQUA 3RIRA 5GAN5 3OYHA 3GNFB 1VQNA 1PSFA 3RKYA 4XTZA 1WGSA 5FU7C 3QG1A 1WNLA 3JCMW 1MHNA 2KY9A 4OB2B 1Q81U 1P92A 1KD1U 2PQWA 1QP3A 2RJFA 3KBGA 3JB9D 4N4HA 4M77C 2JTMA 3PMTA 2BKDN 2D0QB 3OS1A 3OY9A 3JCMe 2RI2A 2XDDA 2NLUA 4C8QA 2MF2A 2E6NA 3OMGA 1Y07A 5GMKh 1YITT 1I5LA 4JS4A 2CGHA 2EFIA 1UB4A 3I55A 1KQ2A 2EAYA 3V8KA 1Y71A 4IUTA 4L59A 2E65A 5DLQE 3VU3C 1M9SA 5CKHA 1KQSA 3CCLT 3JCMP 1JBMA 4ZN3A 4ZGDB 1G3SA 4PNOA 4C8QF 3G6ET 1UGRB 4OF1A 3LWIA 1U1TA 1K9MU 2FHDA 2DXBA 1U8RA 1X6OA 3CCVA 4C0DB 2RJDA 2XU8A 3QHSA 1BKBA 5CKFA 3RMSA 3MP8A 4BD3A 2KVQG 4KUDK 1QVFA 2RM4A 3HFOA 4JJNK 2E5QA 2EWNA 2KSSA 2PUKB 5J26A 1EIFA 3J7AF 4LDWA 4PL6A 1VIEA 4DOVA 2CS7A 4QQ6A 5GAOr 5FLXE 3A5ZB 1W2BS 3LLRA 4YTLA 2X4YA 2R5AA 4OB3B 4OGEA 2EJGA 4MZMA 5FRNA 4A4GA 1AHJB 2MI6A 3JRZA 4FU6A 4ME7A 4BY6B 4M7AA 4MDXA 4F7UA 2QQBA 1Q86U 4WF2A 2QDYB 4HCZA 1NPPA 3C4SA 4C0DC 4PJOD 1I4K1 3OYDA 5C6SA 1VQLA 5C0MA 2YRVA 4FT2A 4IUPA 3J80E 1KG1A 3TEEA 3OYKA 4MZTA 4ZN1A 2L8DA 5I2SA 3RESA 3PGGA 1BI1A 3ZEHA 5CKBA 4A53A 4BUGA 3CC2A 4M7AF 2EJFA 2F5TX 3QSUA 4FL6A 4F7UF 3QYHB 3L2QA 3JCMJ 3CCQT 3RERA 4OB0B 2K5LA 1G3YA 2K5FA 2R5MA 4HT9A 3CCMT 3V8JA 2GFUA 3PNWC 1M90C 3HP9A 3QJYA 1VUBA 4C8QB 2KMTA 3META 1KC8C 3CCEA 5LJ3d 5DM7R 2GFAA 2RA2A 3OBYA 4EMGA 3L2UA 4E7IA 4ZGJB 4Q5WA 4JLIA 3NFCA 2PVOB 2QEXA 4BDYA 2LX9A 3V8LA 1VQ8T 5LJ5d 1SSFA 1W4SA 2O4XA 5FU6C 3QJ6A 1IREB 1QVPA 3E9GA 2DVEA 4HKEA 3VYGA 3M4YA 4DOWA 2E6ZA 1VQMA 1Q82U 5DLOA 1BIAA 1H3ZA 5GAN3 4M78A 4C8QG 3OYBA 3JB9J 4B9XA 3CCUT 1VQ4T 5FROA 3CPFA 3S3OA 4VUBA 5GANf 1VIFA 2FL7A 3V7CA 1LOJA 2X4WA 4C8QC 3I56T 2PVDB 4C0FA 2R58A 1W2BA 5GAN7 4GLKA 3S3MA 4O6JA 4XQ3A 5HY6A 2RHXA 5CAIA 5KCOA 4HCBA 5CR2A 2E10A 4M78F 4JS5A 3TREA 2BUDA 2IG0A 2XDPA 4FM4B 4RMOA 3CCVT 4RG2A 4EMKC 2LC4A 4X34A 2QI2A 3TU4K 2ZGWA 3FJPA 3OYEA 3PTAA 3P8HA 4M7AB 1VQ9T 1KHIA 4ZTFA 2EQJA 3M9QA 3VUBA 4F7UB 3GPLA 3EFRA 4JRKA 5DY9A 3CMAA 1Q7YU 4PKCC 2LTOA 2DO3A 3M57A 3G4SA 2ZPEB 1YCYA 5CQXA 4FT4A 2R57A 4JRIA 2DPPB 2DIGA 4M75F 2Y90A 3HSBA 3JB9H 3PT9A 1YIJT 3HFNA 5GMKi 1YBYA 5GMKe 3FEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTH A;  4PJO E;  4C92 D;  1I81 A;  3BDU A;  4M78 D;  1M5Q 1;  4XTU A;  5LJ3 e;  5GAN h;  5GAO l;  3JCM P;  1JBM A;  4M77 A;  4M7A G;  4NOY A;  4PNO A;  4A54 A;  4C8Q F;  4F7U G;  4M7A E;  1U1T A;  1WPY A;  1I8F A;  4J6X A;  3SWN C;  2DXT A;  4F7U E;  4M75 A;  4QVC A;  3L1A A;  2DZ9 A;  5GAN e;  4M7D G;  5LJ5 e;  3QHS A;  1BIB A;  1B34 A;  1WQW A;  4M77 D;  2RM4 A;  1D3B B;  3HFO A;  4X9C A;  2EWN A;  5GAO n;  1KQ1 A;  4M7D C;  1JRI A;  2DEQ A;  1LJO A;  4M75 D;  1WQ7 A;  5GAO r;  5GAN 2;  3JB9 I;  1HK9 A;  1TH7 A;  5GMK l;  4NL2 A;  5GAN 8;  4M7D F;  4HA8 A;  4PJO A;  2EJG A;  3RKW A;  3SWN A;  5GAN 6;  4XTW A;  4M7A A;  3JCM b;  3QO3 A;  3AHU A;  2VXF A;  4M78 B;  4Y91 A;  4F7U A;  4WF2 A;  4MMK A;  2QTX A;  2E64 A;  4PJO C;  1U1S A;  4PJO D;  4M7D A;  1I4K 1;  5I21 A;  1Y96 B;  1HXD A;  3BFM A;  1N9S A;  5GAM e;  4M7A C;  5GAO m;  4PJO F;  3RES A;  3PGG A;  2E1H A;  4EMK B;  4RCC A;  3JCM d;  4A53 A;  4XU2 A;  4M7D D;  2EJF A;  3QSU A;  4M7A F;  4QVD A;  4C8Q E;  4F7U F;  4X9D A;  4C92 G;  4M78 G;  3JCM J;  4HT8 A;  4XU1 A;  4N0A C;  1H64 1;  4C92 E;  3RER A;  4M78 E;  3JCM X;  3FIF A;  4HT9 A;  3L2Z A;  3RKX A;  3QUI A;  4V2S A;  2VXE A;  2HNI A;  2YLB A;  3V8J A;  2DZC A;  3JCM f;  5GMK j;  3INZ A;  4C8Q B;  1D3B A;  4XTX A;  3FB9 A;  3JCM g;  3EFS A;  4EMH A;  4J6Y A;  4XTY A;  5LJ3 d;  3JB9 G;  4C92 B;  3V7R A;  5LJ3 j;  4M77 G;  2RA2 A;  4EMG A;  4RCB A;  4M77 E;  2FB7 A;  2I2L A;  5GAM d;  4JLI A;  4M75 G;  5GAM j;  2JN0 A;  3V8L A;  5GAN d;  4M75 E;  5LJ5 d;  3BW1 A;  5GAN j;  2DJZ A;  5LJ5 j;  2K57 A;  4N0A A;  3JCM V;  4M7A D;  2DVE A;  2YLC A;  3JB9 F;  4DQ2 A;  5LJ3 f;  3JCM c;  4M77 B;  4J6W A;  5LJ3 g;  1BIA A;  5GAN 3;  4M78 A;  2DTI A;  4C8Q G;  3JB9 J;  5LJ3 h;  4M75 B;  3JCM Q;  5GAM g;  4XU0 A;  2E41 A;  5GAN f;  1Y96 A;  5LJ5 f;  3V7C A;  4C8Q C;  2DKG A;  1LOJ A;  1B34 B;  5LJ5 g;  5GAN g;  2RB6 A;  4C92 C;  4M78 C;  3RIR A;  5GAN 5;  4EMK A;  5LJ5 h;  5GAN 7;  5GAO p;  3GIB A;  4XQ3 A;  4J5Y A;  5GAO q;  5CAI A;  4JUV A;  3RKY A;  4XTZ A;  5GMK i;  1WNL A;  2E10 A;  4C92 F;  3JCM W;  4M78 F;  3JCM h;  5GMK m;  1X01 A;  2VC8 A;  4PJO B;  2YHT A;  4EMK C;  3JB9 D;  4M7D E;  3M4G A;  4MML A;  3SWN B;  4M77 C;  2ZGW A;  3FJP A;  3RUX A;  4NL3 A;  4OP0 A;  4M7A B;  3JCM e;  2DXU A;  4XTV A;  3V7S A;  4C8Q A;  4M75 C;  3EFR A;  2DTO A;  1MGQ A;  4JRK A;  5DY9 A;  3SB2 A;  4F7U B;  2RD1 A;  4M77 F;  2EJ9 A;  2FYK A;  4C92 A;  4XU3 A;  5GMK h;  1I5L A;  4M7D B;  3BY7 A;  1N9R A;  1YCY A;  5GAM f;  4JRI A;  2CGH A;  4M75 F;  3HSB A;  1KQ2 A;  2Y90 A;  2EAY A;  3JB9 H;  1LNX A;  3V8K A;  1M8V A;  3HFN A;  4C8Q D;  4PJO G;  5GMK e;  5GAM h;  2E65 A;  5GAN 4;  3VU3 C; 
#chains in the Genus database with same CATH topology
 2DL8 A;  4XTU A;  3URG A;  4A54 A;  1GBQ A;  2KE9 A;  2DD5 A;  4F7U E;  1WHK A;  1WQW A;  2OTJ A;  1VQN T;  4LDU A;  2E3H A;  4M75 D;  3QWY A;  3FDR A;  2MCN A;  4M7D F;  1ZUY A;  3RBB B;  2CYZ B;  3CBP A;  4JPB W;  2JVV A;  4XTW A;  5KYU B;  3VS6 A;  3I5S A;  2VXF A;  1KHC A;  2AKK A;  2QTX A;  4J9G A;  3EG0 A;  2KRN A;  3GP8 A;  1WXT A;  3A8L B;  1YJW A;  3QDR B;  4RCC A;  3CD6 T;  4EDU A;  2DA9 A;  4FIB A;  3OYC A;  3G6E A;  2FZC B;  3UA6 A;  1JB0 E;  2QQ9 A;  3HRS A;  2O01 E;  4XU1 A;  2NUT A;  3EFO B;  2RK2 A;  3JCM X;  1FMV A;  2EYZ A;  3MEW A;  3JCM f;  3G71 T;  2ZAE A;  3CCU Q;  4J6Y A;  3JB9 G;  1W2B P;  2KRO A;  4TVR A;  2HD0 A;  2I2L A;  4E7K A;  4M75 G;  1GFC A;  2V8K A;  5LL6 S;  1OOT A;  2RJE A;  2LDM A;  2DEU A;  4FYY B;  4LD9 K;  2KXD A;  4LNP A;  4UC4 A;  1OYX A;  3EG9 B;  1SRL A;  3J81 E;  2F69 A;  1YIJ Q;  4C92 F;  2YRC A;  2BTT A;  3DB4 A;  2XG8 D;  4JDS A;  2D0N A;  1MV0 B;  2QQA A;  3M4G A;  3NGP A;  4LE9 A;  2DXU A;  2B8A A;  4OMM A;  1OQK A;  1IO6 A;  3BY7 A;  2QEX T;  1N9R A;  4KUL A;  4BI8 B;  1VQN Q;  3D7S B;  2GNC A;  1VQ6 A;  1LNX A;  2HL3 A;  1K73 U;  2G3R A;  3MEU A;  2J6O A;  5IT9 E;  1QKW A;  2EQK A;  1V29 B;  2ZCF B;  4M75 A;  3OW2 A;  2BZ8 A;  4BAC A;  1UUE A;  1M1G A;  4F14 A;  2XHC A;  1RUW A;  2XI9 A;  2OTL A;  1BI3 A;  2CT4 A;  5GAN 8;  3CD6 Q;  2ECZ A;  2AZS A;  4J9I A;  2QQS A;  1VQ9 A;  4BDZ A;  3AHU A;  1M3A A;  3G71 Q;  4ORZ A;  4RTY A;  4D6W A;  1OU9 A;  1PHT A;  1Q81 R;  1KD1 R;  3OSV A;  2YUN A;  1M90 U;  3OS5 A;  1DJ7 B;  2BE7 D;  4PJJ A;  1KK7 A;  1UJY A;  2CP2 A;  1VQ7 T;  1RAD B;  1WZO A;  3L2Z A;  2L3P A;  1X6G A;  1OX8 A;  2F2W A;  1O75 A;  4OMN A;  3AT1 B;  2FEI A;  4ZTJ A;  1YN8 A;  2K2V A;  4M77 E;  1I0C A;  1YIT A;  4Z8A A;  4J9D A;  2ZZD A;  2KT8 A;  2WSE E;  5LJ3 f;  2CKK A;  3OYA A;  2QA4 T;  2E3I A;  3OS0 A;  1VQO T;  1RLQ C;  2JJ9 A;  1AZG B;  4BI4 A;  4JJD A;  2Z0W A;  2RQW A;  4R0K A;  5D6Y A;  4F17 A;  1N27 A;  3SDZ A;  1X01 A;  5IXF A;  1JJ2 P;  1VQK T;  3LWH A;  1ZSZ B;  2CT3 A;  1Q86 R;  3H0F A;  2D8J A;  4M75 C;  2EJ9 A;  4A4K A;  2VV5 A;  1PKT A;  2LQN A;  3M54 A;  5GAM h;  2J6F A;  4KRT A;  1NJI C;  5KYX A;  2P0K A;  1YNZ A;  4BI3 A;  1K4U S;  1RI0 A;  2EQI A;  4J7F A;  1M1K U;  2ENM A;  5CKE A;  3CCE T;  1QWE A;  2SRC A;  5KE3 A;  1G3T A;  4C5H A;  1UEC A;  2M9U A;  3RKW A;  1SRM A;  5GAN 6;  3P8B B;  1VQM T;  3E9F A;  1Y0M A;  3H41 A;  1VQ7 Q;  2AHJ B;  2VB6 A;  3CPW A;  1Y96 B;  1IRX A;  2JXB A;  2RQU A;  4GY5 A;  4PLI A;  2A37 A;  2LJ3 A;  2JTF A;  4AFS C;  1JU5 C;  2PNI A;  4LUE A;  1SHF A;  4OMF B;  3QUI A;  2QA4 Q;  2L3R A;  5ECA A;  3HPW A;  1VQO Q;  2MOX A;  2LCC A;  1KQS P;  4CC7 A;  2HL5 C;  5LJ3 j;  2J05 A;  1WJQ A;  5GAM d;  1ARK A;  1ZA2 B;  3MO8 A;  2MK5 A;  1M4Z A;  2HKN A;  4NS5 A;  2LJ0 A;  1SSH A;  2K57 A;  2O9V A;  5KH6 A;  3CC4 T;  3JB9 F;  2P4T A;  1VQK Q;  3EGX A;  3WXM B;  2DF6 A;  4DBF A;  2O88 A;  5GAN 5;  3OYH A;  3GNF B;  1TXQ A;  1WGS A;  1WNL A;  4LN2 A;  3JCM W;  2K9G A;  1QP3 A;  4N4H A;  3PMT A;  3JCM e;  2MF2 A;  1Y07 A;  5GMK h;  1CKB A;  2KYB A;  2CGH A;  2EFI A;  2DIL A;  3CCE Q;  1Y71 A;  4Z89 A;  2LZ6 B;  4QKU A;  2FG0 A;  3E2U A;  1EZZ B;  5CKH A;  3CCL T;  1UGR B;  2EVR A;  4OF1 A;  3PE0 A;  3CXC P;  1U8R A;  3I9Q A;  4C0D B;  1VQM Q;  3QHS A;  4AG1 C;  2KVQ G;  1QVF A;  2KYM A;  2KSS A;  2PUK B;  5FW9 A;  2C0I A;  1PKS A;  2KGT A;  3JV3 A;  4PL6 A;  2CS7 A;  4QQ6 A;  5FLX E;  3LLR A;  1AZE A;  4YTL A;  4OB3 B;  1TS9 A;  3PVL A;  4BY6 B;  4M7A A;  4KGX B;  2QDY B;  1GCP A;  1ZSZ C;  1K0X A;  2YUP A;  3OYK A;  3ZEH A;  3SHW A;  4A53 A;  2EJF A;  3QSU A;  5L23 A;  1YJN Q;  1WI7 A;  3CCQ T;  3VS4 A;  3CC4 Q;  3G1J A;  3I5R A;  1M90 C;  1VUB A;  1QLY A;  2RA2 A;  1SPK A;  4EMG A;  5KYY A;  2G6F X;  4Q5W A;  4JLI A;  5AT1 B;  3V8L A;  1VQ8 T;  5LJ5 d;  1JQQ A;  4KGV B;  3QJ6 A;  1QVP A;  4DOW A;  2E6Z A;  1H3Z A;  5DLO A;  5GAN 3;  4M78 A;  2CDT A;  1Z9Z A;  4AFQ C;  5FRO A;  3S3O A;  1MNE A;  3KFV A;  3I56 T;  4ZNX A;  2DMO A;  2DX1 A;  2CP0 A;  4C0F A;  1W2B A;  4GLK A;  2RHX A;  2A0F B;  4QT7 A;  1D1C A;  2IG0 A;  4RG2 A;  4X34 A;  3CCL Q;  5I22 A;  2QI2 A;  1SHG A;  3OYE A;  3P8H A;  2CRE A;  2EQJ A;  3M9Q A;  4E2F B;  4F7U B;  4JRK A;  2GQI A;  3M57 A;  1M2V A;  2ZPE B;  4JZ4 A;  5CQX A;  4JRI A;  3HSB A;  2DIG A;  2DL3 A;  3EH2 A;  4E7I A;  2DTH A;  2LVM A;  5LJ3 e;  1X27 A;  4RTW A;  1YHQ T;  4F7U G;  4M7A E;  1YI2 T;  2DAQ A;  4D8D A;  2GF7 A;  2VYT A;  4DA4 A;  2OAU A;  4RTU A;  1ZSG A;  3O5Z A;  4LXC A;  1WHM A;  2KBT A;  2ABL A;  2X51 A;  1M2O A;  1RLP C;  1M1K C;  1QVG A;  2O4X B;  1G5V A;  3DKM A;  5D7U A;  3CCQ Q;  1YJ9 A;  3JAM E;  3QDF A;  4N4I A;  3M55 A;  4J83 A;  2A7Y A;  3FC3 A;  4BE0 A;  1NLO C;  3C95 A;  3FRN A;  2F1L A;  1ABQ A;  4PJO F;  3MCA B;  5CQY A;  4E7L A;  1BCM A;  3ZBD A;  3F70 A;  3H8Z A;  4ELZ C;  2JNG A;  4E7S A;  1VQ8 Q;  3CCV T;  4M78 E;  3LGL A;  2HZY A;  1KFZ A;  4BE2 A;  1Q82 C;  4V2S A;  2NYS A;  2DZC A;  4XK8 E;  4XTX A;  2JOY A;  2VGM A;  3V7R A;  2AZV A;  3T9N A;  3I56 Q;  2DNU A;  4ANJ A;  2DYI A;  2HQH A;  1CKA A;  1AT1 B;  1VQ5 T;  2W0Z A;  2YLC A;  1MV3 A;  5CVI A;  4OML A;  8AT1 B;  3X24 B;  1BU1 A;  3A98 A;  5HK0 A;  1BB9 A;  1UGS B;  1R8O B;  4LDY A;  3H0H A;  1VQL T;  2E41 A;  3BE3 A;  3LYI A;  5GAN g;  4BY6 C;  1Q7Y C;  3C0C A;  3MEV A;  5GAO p;  3CC2 T;  3OSS C;  2L3Q A;  2P4R A;  4JUV A;  5FWB A;  2CZ0 B;  4AMC A;  2RQV A;  3SD4 A;  3HL8 A;  2E12 A;  5KYW A;  2CSI A;  2KDS A;  4M7D E;  1YHQ Q;  4OP0 A;  2K5I A;  1YI2 Q;  4BE1 A;  5IAY A;  1WYX A;  2RF0 A;  4QQG A;  3S6W A;  1V1C A;  1YP5 A;  2M1H A;  2QXF A;  2HSE B;  3QZ5 B;  4OGC A;  3VS1 A;  1RAA B;  4J7I A;  2AT1 B;  2RHZ A;  5D6X A;  2QQR A;  3CC7 A;  2NUT B;  2LX7 A;  3M0U A;  1A0N B;  1TU0 B;  3L1A A;  1XTD A;  2FZG B;  1TUD A;  1PC0 A;  4M77 D;  1VYT A;  2JS0 A;  1M1F A;  4HCC A;  1U3O A;  1NJI U;  3DLM A;  5GAN 2;  1HK9 A;  1T3L A;  5EG2 A;  1K8A C;  4CC4 B;  3SWN A;  2FPE A;  1FWZ A;  4KH0 B;  3R6O A;  3CCV Q;  1QCF A;  4IKF A;  1U1S A;  2V8I A;  2L5Q A;  3VKI A;  3WVE B;  2LJ1 A;  1YIJ A;  2QGF B;  4WTO B;  2AK5 A;  3NTK A;  1FX7 A;  3OB9 A;  1VQ5 Q;  1KC8 U;  4QVZ A;  4C0Z A;  4C92 E;  5A0L A;  2M0Y A;  3TSZ A;  3FIF A;  3A1P A;  3EFS A;  1VQL Q;  2M0O A;  3OYY A;  4M77 G;  1AWW A;  2VVK A;  3EG2 A;  4J9H A;  3RMQ A;  5GAM j;  3I55 T;  3CC2 Q;  1U06 A;  4N0A A;  4OB1 B;  4QW2 A;  1BI2 A;  1D09 B;  4CC2 A;  3PIO A;  2XID A;  4M75 B;  5CO7 A;  5GJV B;  5LJ5 f;  1YJW T;  1OI1 A;  2YDL A;  4JJB A;  4JZ3 A;  1WFW A;  3CD6 A;  1VQ4 Q;  4FYW B;  3A8M B;  3ER0 A;  4CC3 A;  1RAB B;  1T0J A;  1WJS A;  2X4J A;  3QYG B;  1BYM A;  3GLX A;  1ZLM A;  3G71 A;  1IHW A;  2FRY A;  3V7S A;  1M27 C;  2L89 A;  2RD1 A;  2ZPG B;  2FPD A;  1WJR A;  2P0P A;  1R0C B;  1M8V A;  5I2M A;  1NPR A;  5A2Q E;  3FLG A;  5GAN 4;  5A0D A;  2GBQ A;  2KXC A;  1ZBX A;  2LNH B;  4M77 A;  3SWN C;  1K1Z A;  2DXT A;  1BCO A;  2DD4 A;  3OYJ A;  2DBM A;  2DZ9 A;  3CBM A;  1B34 A;  4A4F A;  4X9C A;  5GAO n;  2XDB A;  4PFZ A;  4PK4 A;  4F04 B;  4RKU E;  2QGG A;  1EX4 A;  1CSK A;  3L2W A;  2JMC A;  3QO3 A;  3HHT B;  2COW A;  2XK0 A;  3KUF A;  2RHI A;  3CXC A;  1VQ6 T;  3IQL A;  1HXD A;  2KI7 A;  4E47 A;  1QVG S;  2E1H A;  1PSE A;  3I55 Q;  4C8Q E;  4X9D A;  3MP6 A;  3L2R A;  4N0A C;  1TTH B;  4C5G A;  3M58 A;  2K3X A;  3VS0 A;  1R0B G;  3TCJ A;  2HNI A;  5GMK j;  4KUI A;  2OTL T;  5EC7 A;  4QQD A;  1QCN A;  2V1Q A;  1N8R R;  4RCB A;  4KT0 E;  3OBW A;  5LJ5 j;  4B9W A;  2F5K A;  5KYX B;  3CCS A;  2JT4 A;  1K0S A;  3CQT A;  1XOV A;  1BK2 A;  1G2B A;  4A4E A;  2EKH A;  2VAS A;  3M5A A;  5HKC A;  4E7J A;  1KIK A;  5HCK A;  3GOX A;  3LGF A;  3MP1 A;  3ASK A;  3RDV A;  3CME T;  1C1A A;  3RIR A;  1PSF A;  2J06 A;  3QG1 A;  1MHN A;  2PQW A;  1D0X A;  2RJF A;  2X9H A;  4M77 C;  2JTM A;  3R6N A;  2YXY A;  1XJW B;  2RI2 A;  1GCQ A;  3OMG A;  2PTK A;  4J9C A;  2QYZ A;  2NUZ A;  1YIT T;  4FYX B;  1I5L A;  3V8K A;  4IUT A;  4RUG A;  4L59 A;  1NEG A;  1H92 A;  1M9S A;  2QEX Q;  1JBM A;  4ZN3 A;  1G3S A;  4C8Q F;  3ZL7 C;  1K9M U;  4GBQ A;  2RJD A;  2LMJ A;  1WHG A;  5CKF A;  1AD5 A;  3HFO A;  2E5Q A;  2EWN A;  5IHN A;  1VQ6 Q;  3J7A F;  4LDW A;  2CSQ A;  5GAO r;  2EJG A;  4MZM A;  5FRN A;  4FU6 A;  4ME7 A;  2COY A;  1PG5 B;  2QAS A;  3EGX B;  4HCZ A;  4PJO D;  1I4K 1;  5C6S A;  2RN8 A;  2OTL Q;  2PZ1 A;  3J80 E;  1X43 A;  4ZN1 A;  2L8D A;  3RES A;  4EIK A;  2VKN A;  5CKB A;  2DYB A;  2IPO B;  3VRY A;  4Y92 A;  3L2Q A;  3JCM J;  1RAI B;  4OB0 B;  1RAF B;  2K5L A;  2K5F A;  3CCM T;  1LPL A;  2EGE A;  3PNW C;  3QJY A;  1KC8 C;  3CCE A;  4IIM A;  2YUQ A;  1TUG B;  2GFA A;  1K73 R;  2GGR A;  3UAT A;  3L2U A;  4PFO A;  4ZGJ B;  1M3C A;  3CME Q;  1QCO A;  2KNB B;  1UHC A;  1W4S A;  4M7A D;  3E9G A;  2DVE A;  4HKE A;  3RR6 A;  3M4Y A;  1TOV A;  1VQM A;  1Q82 U;  1BIA A;  3UF4 A;  1GCQ C;  1MND A;  3V7C A;  1LOJ A;  2R58 A;  2JM8 A;  1F1B B;  4O6J A;  4XQ3 A;  5CAI A;  4PJN A;  2BZX A;  2E10 A;  2P84 A;  6AT1 B;  2HBW A;  3TRE A;  2XDP A;  4FM4 B;  4Z88 A;  3MJX A;  4RMO A;  2LC4 A;  3TU4 K;  2ZGW A;  3FJP A;  5IHI A;  3PTA A;  1WDX A;  4M7A B;  2OX7 A;  1FYN A;  1KHI A;  3CMA A;  3VUB A;  1AVZ C;  5DY9 A;  4AG2 C;  1Q7Y U;  4PKC C;  3G4S A;  1YCY A;  4M75 F;  2X3W D;  1M90 R;  2ED1 A;  3PT9 A;  1YJN A;  5GMK e;  4DEX A;  3P8D A;  4JRQ A;  3BDU A;  4M78 D;  4OMO A;  4B6M A;  4M7A G;  3M0Q A;  5IHK A;  2XIC A;  2HDA A;  3ZFJ A;  2EKO A;  1SEM A;  5LJ5 e;  5FRM A;  2DL5 A;  1QW1 A;  1NG2 A;  2DER A;  7AT1 B;  2DM1 A;  2K4Y A;  5KYY B;  2A3L A;  3X26 B;  4PJO A;  1PNJ A;  3PFS A;  1OZ2 A;  2MPX C;  4PLL A;  1NEB A;  2OI3 A;  5L8R E;  1E6H A;  4M78 B;  5CIU A;  3QXE B;  3UDC A;  3EGD A;  2SEM A;  2E64 A;  1PD0 A;  3CCM Q;  4A4H A;  2DL7 A;  3E1S A;  5KE2 A;  1AWO A;  3N5B B;  2CUB A;  2JZ2 A;  1UTI A;  2KRM A;  2RHU A;  4J9E A;  2ZPB B;  1K8A U;  4XU2 A;  4M7D D;  3PMI A;  4M78 G;  3OYN A;  3CEY A;  4AFZ C;  4KBM B;  2YLB A;  1S72 A;  3L42 A;  1EFN A;  4LD6 A;  3OW2 S;  1VQP T;  1M2V B;  3U23 A;  3VJP A;  2Y4X A;  4L6V 5;  1ACM B;  3BW1 A;  1GFD A;  3OYI A;  1C6V X;  1D1B A;  2BIV A;  2HAX A;  1OV3 A;  4JLG A;  3LX7 A;  3NMZ C;  4J6W A;  2M16 A;  2DTI A;  4A63 B;  4E6R A;  1OZ3 A;  1M1K R;  2RHY A;  2C06 A;  1UEB A;  4IUR A;  5J3B A;  1U5S A;  2CZ1 B;  1IZ6 A;  3GIB A;  1KJW A;  2JTE A;  3EGU A;  1UG1 A;  2H8H A;  2LQK A;  2L3S A;  3CCJ T;  4PJM A;  4NL3 A;  2CUD A;  2YSQ A;  2D9T A;  4XTV A;  1GBR A;  2RNA A;  1QKX A;  1MGQ A;  3NTH A;  4C0G A;  1UJ0 A;  2V8J A;  3TVT A;  3PVQ A;  3TQ7 P;  2KAF A;  1VQ8 A;  1W1F A;  4J9B A;  3UPU A;  1MMG A;  4PJO E;  2EYY A;  4C92 D;  4DBR A;  5GAN h;  1XQH A;  3M0S A;  2RQT A;  3NPF A;  3HRT A;  3CCR A;  1YWP A;  2LRQ A;  2QK0 A;  2ED0 A;  2A28 A;  1K9M C;  4C5I A;  2DEQ A;  1LJO A;  1G3W A;  1RAG B;  2D1X A;  3QWX X;  2CH4 W;  5CKD A;  3QBY A;  5GMK l;  4IUV A;  3QII A;  1AOJ A;  2VUB A;  4P5N A;  1WA7 A;  4R56 A;  3H9N A;  3EAE A;  3VV0 A;  3JCM b;  4XAX B;  4Y91 A;  3M0P A;  4MDW A;  2RQR A;  1OEB A;  5FU7 B;  4M7D A;  3ME9 A;  2EW3 A;  2H3E B;  2EIF A;  2JM9 A;  1VQP Q;  4M7A C;  2DJQ A;  2D6F A;  4R55 A;  1OUL A;  4IUQ A;  1X6B A;  4C92 G;  5KYW B;  1YI2 A;  1Y7X A;  1NBE B;  3RKX A;  3S3N A;  1BI0 A;  1X75 C;  2EQM A;  1D3B A;  3JCM g;  5KYN A;  1RAH B;  2DFU A;  4XTY A;  2LNV A;  2YT6 A;  4BB7 A;  1M30 A;  3WVD B;  2JS2 A;  5A0G A;  5GAN d;  2ROT A;  1WLP B;  1YJ9 T;  1WHH A;  1T0H A;  3JCM c;  3VS5 A;  2DET A;  1D1A A;  1H3H A;  5LJ3 h;  3CCJ Q;  1X2Q A;  4KGZ B;  3PIP A;  2DKG A;  5CCA A;  3CPW S;  4M78 C;  2CZ6 B;  3LW5 E;  4EMK A;  5GAO q;  5J39 A;  3OYM A;  2ZPI B;  4F16 A;  2YHT A;  4FW1 A;  4LUD A;  2PUO B;  4MML A;  2XKO C;  3SWN B;  3OYL A;  3OYG A;  2DK3 A;  2K7A A;  4OMQ A;  1UDL A;  2DTO A;  4C92 A;  2QTV A;  5GAM f;  5HK3 A;  1OU8 A;  3X28 B;  1VQ5 A;  4C8Q D;  2EPD A;  1M5Q 1;  1HYO A;  4NOY A;  4J6X A;  2VWF A;  5CK9 A;  2YWW A;  2WAC A;  1E6G A;  3Q1J A;  4M7D C;  4MZP A;  1KSW A;  1WQ7 A;  3GNG A;  5D6W A;  1NE8 A;  3KXT A;  3LH0 A;  4HA8 A;  4AT1 B;  2RI3 A;  1ZA1 B;  1VOM A;  3E19 A;  1OPK A;  2PU9 B;  3OMC A;  2ZPH B;  5I21 A;  1JJ2 A;  2LQW A;  3BFM A;  3CCU A;  1VQ4 A;  2OJ2 A;  1HJD A;  3HTR A;  3NHN A;  2L2P A;  3UWN A;  3DB3 A;  2GQV A;  3JSC A;  2WSF E;  2KRS A;  3CC7 T;  1TWB A;  1YJ9 Q;  1LVK A;  2X35 A;  4PFP A;  3HRU A;  1I5O B;  2RO0 A;  3MEA A;  2EGC A;  2LT4 A;  1JXO A;  4CI0 C;  1D0Y A;  1O9S A;  2AKL A;  1QVF S;  1ZX6 A;  1X2K A;  1QQJ A;  1ZQ1 A;  3M59 A;  2HKQ B;  5FWC A;  3A8G B;  2Y4Y A;  2QDL A;  1RAE B;  4LDV A;  3OQ5 A;  2ZPF B;  4M77 B;  5LJ3 g;  1QP2 A;  1NYF A;  2K6D A;  1PD1 A;  1N8R U;  1B34 B;  4Y28 E;  3VS7 A;  1I1J A;  4C92 C;  2OTJ T;  2EQU A;  3EG1 A;  4FSS A;  1VQN A;  1WHL A;  3RKY A;  5FU7 C;  1Q81 U;  4KH1 B;  4E7Z A;  4OB2 B;  1KD1 U;  1MMA A;  1VYU A;  1PM3 A;  1ABO A;  1I07 A;  1YCS B;  3JB9 D;  1WHJ A;  2BKD N;  2NLU A;  4C8Q A;  2E6N A;  1MUZ A;  1M3B A;  3I55 A;  2JW4 A;  5DLQ E;  3VU3 C;  2NUP A;  1KQS A;  4ZGD B;  4PNO A;  3G6E T;  3LWI A;  1U1T A;  1GL5 A;  2DXB A;  1X6O A;  1JO8 A;  2XU8 A;  3THK A;  4BD3 A;  3A5Z B;  1W2B S;  2X4Y A;  4RTZ A;  4OGE A;  4A4G A;  3CC7 Q;  1AHJ B;  1IGQ A;  1Q86 U;  2QQB A;  4WF2 A;  1WIE A;  3OYD A;  5C0M A;  4FT2 A;  4IUP A;  3TEE A;  4MZT A;  5I2S A;  3PGG A;  1BI1 A;  2E4H A;  2K79 A;  2ATC B;  4FL6 A;  1ZUK A;  4F7U F;  3QYH B;  2V26 A;  2M02 A;  2R5M A;  2DVJ A;  1UHF A;  2OTJ Q;  2MIO A;  4D8K A;  2M51 A;  2PVO B;  2QEX A;  4BDY A;  2DRM A;  1SSF A;  3VS2 A;  3VYG A;  1IRE B;  1TSF A;  5KYU A;  1Y57 A;  1NM7 A;  3JB9 J;  4B9X A;  3CPF A;  1GRI A;  4VUB A;  5GAN f;  1QVG P;  1AEY A;  4C8Q C;  2FL7 A;  1NJI R;  2PVD B;  1N5Z A;  5GAN 7;  3S3M A;  5HY6 A;  5KCO A;  4HCB A;  5CR2 A;  1AWX A;  2FO0 A;  4JS5 A;  1YJW Q;  3EFO A;  4RTV A;  3G6E Q;  3H0I A;  1VQ9 T;  3EFR A;  4HCK A;  2LTO A;  2DO3 A;  2X3X D;  1B7T A;  4FT4 A;  5GMK i;  3CCS T;  1KC8 R;  1K76 A;  3MKD A;  1G83 A;  2E5K A;  1I8F A;  1VQ7 A;  1TG0 A;  3CME A;  5IN1 A;  1N6A A;  1JRI A;  1B07 A;  1S1N A;  3EG9 A;  2HQX A;  3VS3 A;  2MAM A;  2QAZ A;  2RMO A;  1TH7 A;  1IHV A;  2DIQ A;  2WSC E;  2LT1 A;  1ZBJ A;  1OX9 A;  2F2X A;  3MPU B;  2EBP A;  2FPF A;  2QA4 A;  2RK1 A;  5GAM e;  1VQO A;  1N9S A;  2KT1 A;  1JEG A;  3L2V A;  4E7H A;  3M53 A;  4RTT A;  2HEQ A;  4JRP A;  4L5G A;  4QVD A;  1MMN A;  4HT8 A;  2RH2 A;  2FVU A;  1VQK A;  1VA7 A;  3A8H B;  1JJ2 S;  2BE9 B;  2KR3 A;  3ULR B;  5I11 A;  1G8X A;  1AWJ A;  1SKU B;  1IXD A;  5KCH A;  2FB7 A;  4M75 E;  5GAN j;  2KQW A;  4ATO A;  3GBQ A;  3M0T A;  2K3B A;  1VQ9 Q;  4HVV A;  2O9S A;  2RB6 A;  4ZGE B;  4J5Y A;  2V1R A;  4HVW A;  3CCS Q;  1N8R C;  1H8K A;  2KEA A;  4DBH A;  1WX6 A;  2VC8 A;  2LCS A;  3DLL A;  4PJO B;  2K2M A;  1TUC A;  1HSQ A;  3O8V A;  3CCM A;  3SFM A;  1RAC B;  2FRW A;  2CP5 A;  2LP5 A;  1Q81 C;  2AIR B;  1KD1 C;  3SB2 A;  2YRD A;  4PJL A;  3EGD B;  4M77 F;  2MMP A;  3C12 A;  1PWT A;  2HQE A;  3OA6 A;  2KK4 A;  4PJO G;  2O2O A;  3I35 A;  1I81 A;  4HVU A;  1YIT Q;  1RL2 A;  3VYH B;  4Z02 A;  4ELY C;  4DBQ A;  4II1 A;  4QVC A;  4EPC A;  4ESR A;  1BIB A;  4FCY A;  4X1V A;  5AYF A;  3LH5 A;  2F2V A;  1Q95 G;  1W70 A;  1KQS S;  3JB9 I;  4NL2 A;  1ZSZ A;  2C0O A;  3VUZ A;  1K9A A;  1HD3 A;  3EHR A;  3QPH A;  3CMA T;  3CC4 A;  4MMK A;  3G4S T;  1B3Q A;  4LDX A;  4K11 A;  2P0Q A;  1YJN T;  5GAO m;  1Q86 C;  8ATC B;  2RI5 A;  2DBK A;  4FSX A;  2DXC A;  1UGQ B;  5GJW B;  4OMP A;  3A8O B;  1WXB A;  1UE9 A;  1J3T A;  4EMH A;  1NYG A;  3X20 B;  2EYQ A;  1M8M A;  4CRI A;  1UGP B;  1QMC A;  2IVW A;  4AFU C;  2CZ7 B;  3JCM V;  1K9M R;  1VYV A;  2JMA A;  2HBP A;  1YFN A;  3CCL A;  1PCX A;  1C0M A;  3GF5 A;  3JCM Q;  5GAM g;  4XU0 A;  3H6Z A;  1Y96 A;  4HXJ A;  3CXC S;  4JJC A;  1FXX A;  1ZHI A;  3OYF A;  1GXI E;  2MYS A;  5LJ5 h;  3QKJ A;  3JCM h;  3HKS A;  5GMK m;  1K73 C;  1OPL A;  1S72 T;  3BDL A;  2I0N A;  3OW2 P;  1LCK A;  3RUX A;  2CP3 A;  1VQP A;  2CH4 A;  1YWO A;  2FYK A;  1FMK A;  4XU3 A;  3NTI A;  3X25 B;  4M7D B;  5IXB A;  3QZ9 B;  1R77 A;  1T3S A;  4J8O A;  4RG8 A;  2X4X A;  1SF9 A;  5GAO l;  3EHQ A;  2PVG B;  3M0R A;  2VGN A;  3UT1 A;  4C5E A;  1WPY A;  3CMA Q;  3CCQ A;  4O5V A;  5GAN e;  4M7D G;  4IUU A;  3G4S Q;  1D3B B;  2EYW A;  2L0A A;  1KQ1 A;  5FU6 B;  4GLM A;  3C94 A;  2EGA A;  1Q82 R;  2XMF A;  4OVA A;  1IGU A;  3G7Z A;  3CCJ A;  2XD0 A;  3REB B;  2K3Y A;  2LQ8 A;  1NZ9 A;  2BZY A;  1XNI A;  2MWO A;  4PJO C;  3MHX A;  1WXU A;  2H3J A;  2LCL A;  2E70 A;  2J7I A;  3I56 A;  4EMK B;  2COZ A;  3JCM d;  4FYV B;  4N4G A;  1ZUU A;  2DL4 A;  1Z9Q A;  3CCR T;  3EG3 A;  2O31 A;  2RJC A;  2MWP A;  1H64 1;  1Q7Y R;  1UGV A;  2VXE A;  3CBO A;  4IIO A;  3INZ A;  3FB9 A;  2CP6 A;  3REA B;  4C92 B;  5M9O A;  2GCX A;  1UFF A;  2CP7 A;  2JN0 A;  2JUF A;  2DJZ A;  3M56 A;  3OS2 A;  2RPN A;  4DQ2 A;  2DE0 X;  1S72 Q;  1YHQ A;  3TSW A;  5LJ5 g;  1PRL C;  4XTZ A;  2KY9 A;  1P92 A;  2YUO A;  3KBG A;  1IB8 A;  2D0Q B;  3OY9 A;  3OS1 A;  2XDD A;  3RNJ A;  1SG5 A;  1JXM A;  9ATC B;  2OAW A;  1NLP C;  2ESW A;  4JS4 A;  1K8A R;  1UB4 A;  1KQ2 A;  2EAY A;  2E65 A;  2C0T A;  3JCM P;  1W6X A;  1QWF A;  2DLP A;  2FHD A;  3CCV A;  3UA7 A;  1RI9 A;  3CPW P;  1BKB A;  3RMS A;  1X69 A;  3MP8 A;  4KUD K;  4FW2 A;  2RM4 A;  4JJN K;  5J26 A;  2GTJ A;  1EIF A;  2FZK B;  1FMW A;  1VIE A;  4DOV A;  3FJ5 A;  2R5A A;  4DEY A;  3CCR Q;  2MI6 A;  3JRZ A;  2IIM A;  1MMD A;  4MDX A;  4F7U A;  1NPP A;  3C4S A;  4C0D C;  1VQL A;  2YRV A;  2A36 A;  1KG1 A;  2W10 A;  2EYX A;  2HSP A;  4BUG A;  3CC2 A;  2ROL A;  4M7A F;  2F5T X;  2A08 A;  1E7O A;  2B86 A;  2D8H A;  3RER A;  1D0Z A;  1G3Y A;  4HT9 A;  3V8J A;  2GFU A;  3HP9 A;  4C8Q B;  2KMT A;  3MET A;  5LJ3 d;  5DM7 R;  3OBY A;  3NFC A;  2LX9 A;  2O4X A;  5FU6 C;  2NUP B;  1BBZ A;  4WCI A;  2HMA A;  4C8Q G;  4J9F A;  3OYB A;  2GTO A;  3CCU T;  1VQ4 T;  3VRZ A;  2NWM A;  1VIF A;  2X4W A;  3SEM A;  4M78 F;  2BUD A;  4EMK C;  1V76 A;  2DRK A;  4RTX A;  2QG9 B;  1PRM C;  4ZTF A;  1QVF P;  2J6K A;  3GPL A;  2HCK A;  3EH1 A;  5IH2 A;  2R57 A;  2DPP B;  2Y90 A;  3JB9 H;  1YIJ T;  3HFN A;  4M4Z A;  1YBY A;  3FEO A; 
#chains in the Genus database with same CATH homology
 2DTH A;  3P8D A;  4JRQ A;  3BDU A;  2LVM A;  4M78 D;  4XTU A;  5LJ3 e;  3URG A;  4M7A G;  4A54 A;  1YHQ T;  4F7U G;  4M7A E;  1YI2 T;  1I8F A;  2XIC A;  2DD5 A;  4F7U E;  3ZFJ A;  2EKO A;  2DAQ A;  1VQ7 A;  5LJ5 e;  5FRM A;  2GF7 A;  1QW1 A;  2VYT A;  1WQW A;  2OTJ A;  3CME A;  4DA4 A;  2OAU A;  1VQN T;  5IN1 A;  1N6A A;  4LDU A;  1JRI A;  2K4Y A;  4M75 D;  2A3L A;  2HQX A;  3FDR A;  2MAM A;  3X26 B;  1TH7 A;  1QVG A;  2DIQ A;  1M1K C;  4M7D F;  2WSC E;  2CYZ B;  4PJO A;  3CBP A;  2LT1 A;  1OZ2 A;  3PFS A;  4PLL A;  2O4X B;  2JVV A;  4XTW A;  1G5V A;  3DKM A;  5L8R E;  1YJ9 A;  2VXF A;  1KHC A;  3QXE B;  4M78 B;  4N4I A;  5CIU A;  3UDC A;  2QTX A;  3JAM E;  3M55 A;  2E64 A;  4J83 A;  2A7Y A;  4A4H A;  2QA4 A;  2RK1 A;  3FC3 A;  3E1S A;  5KE2 A;  4BE0 A;  3GP8 A;  5GAM e;  1VQO A;  1N9S A;  3C95 A;  3FRN A;  3L2V A;  3A8L B;  3N5B B;  2JZ2 A;  4PJO F;  3MCA B;  5CQY A;  1YJW A;  2RHU A;  3QDR B;  4E7L A;  4RCC A;  3ZBD A;  4E7H A;  3F70 A;  3H8Z A;  2ZPB B;  3CD6 T;  1K8A U;  4EDU A;  4ELZ C;  4XU2 A;  3M53 A;  4JRP A;  4FIB A;  4M7D D;  3PMI A;  2JNG A;  4L5G A;  4QVD A;  3OYC A;  3G6E A;  4M78 G;  4HT8 A;  1JB0 E;  2QQ9 A;  3HRS A;  2O01 E;  2RH2 A;  4XU1 A;  3OYN A;  2RK2 A;  3LGL A;  4M78 E;  3JCM X;  2FVU A;  3CEY A;  4BE2 A;  1Q82 C;  1VQK A;  4V2S A;  3A8H B;  4KBM B;  1JJ2 S;  2YLB A;  3MEW A;  1S72 A;  2DZC A;  3L42 A;  3JCM f;  3G71 T;  4XK8 E;  4LD6 A;  4XTX A;  3OW2 S;  1VQP T;  4J6Y A;  2JOY A;  3JB9 G;  2VGM A;  3V7R A;  4TVR A;  5KCH A;  3T9N A;  2HD0 A;  3VJP A;  2FB7 A;  2Y4X A;  2I2L A;  4E7K A;  4M75 G;  4L6V 5;  2V8K A;  5LL6 S;  4M75 E;  3BW1 A;  5GAN j;  1VQ5 T;  2RJE A;  3OYI A;  2HAX A;  2BIV A;  2YLC A;  4JLG A;  3LX7 A;  2KQW A;  4J6W A;  2LDM A;  5CVI A;  4ATO A;  2M16 A;  2DTI A;  3X24 B;  4LD9 K;  1OZ3 A;  2RHY A;  5HK0 A;  1UGS B;  2C06 A;  1R8O B;  4LDY A;  1UEB A;  4IUR A;  5J3B A;  1VQL T;  2CZ1 B;  2E41 A;  3LYI A;  5GAN g;  4BY6 C;  1Q7Y C;  4UC4 A;  2RB6 A;  3MEV A;  1IZ6 A;  5GAO p;  3GIB A;  3CC2 T;  3OSS C;  1OYX A;  4ZGE B;  4J5Y A;  4JUV A;  3J81 E;  3CCS T;  2F69 A;  2CZ0 B;  4C92 F;  3SD4 A;  3HL8 A;  1N8R C;  2E12 A;  3DB4 A;  2XG8 D;  2VC8 A;  4JDS A;  3DLL A;  4PJO B;  2LQK A;  2KDS A;  4M7D E;  2QQA A;  3M4G A;  3O8V A;  3CCM A;  3SFM A;  3CCJ T;  4NL3 A;  4OP0 A;  2K5I A;  2DXU A;  2B8A A;  4XTV A;  2D9T A;  5IAY A;  4BE1 A;  1Q81 C;  1KD1 C;  3SB2 A;  1MGQ A;  3NTH A;  4C0G A;  4M77 F;  2MMP A;  2V8J A;  3C12 A;  4QQG A;  3BY7 A;  3S6W A;  1N9R A;  4KUL A;  2HQE A;  4BI8 B;  2QEX T;  1VQ6 A;  2M1H A;  3OA6 A;  1LNX A;  2KAF A;  2KK4 A;  1VQ8 A;  2QXF A;  3QZ5 B;  4PJO G;  1K73 U;  4OGC A;  2G3R A;  3MEU A;  3UPU A;  4PJO E;  4C92 D;  5IT9 E;  1I81 A;  5GAN h;  1XQH A;  4J7I A;  2RHZ A;  5D6X A;  2EQK A;  1V29 B;  2QQR A;  3HRT A;  3CC7 A;  1RL2 A;  2ZCF B;  3CCR A;  3VYH B;  4Z02 A;  4ELY C;  4QVC A;  4II1 A;  4M75 A;  2LRQ A;  3OW2 A;  3L1A A;  4BAC A;  1XTD A;  4EPC A;  1BIB A;  1M1G A;  4M77 D;  4HCC A;  1M1F A;  2XHC A;  2XI9 A;  5AYF A;  4C5I A;  2DEQ A;  1LJO A;  1G3W A;  1YJN A;  1NJI U;  1K9M C;  2OTL A;  1BI3 A;  3DLM A;  5CKD A;  5GAN 2;  3JB9 I;  3QBY A;  1HK9 A;  1KQS S;  5GMK l;  4IUV A;  4NL2 A;  3QII A;  5GAN 8;  5EG2 A;  1K8A C;  2VUB A;  4P5N A;  3VUZ A;  3QPH A;  3SWN A;  4R56 A;  3CMA T;  1FWZ A;  3EAE A;  2QQS A;  3R6O A;  1VQ9 A;  3VV0 A;  3JCM b;  4BDZ A;  3CC4 A;  3AHU A;  4XAX B;  4Y91 A;  4MMK A;  3G4S T;  4MDW A;  4IKF A;  4LDX A;  1U1S A;  2V8I A;  2L5Q A;  3VKI A;  5FU7 B;  4M7D A;  3WVE B;  4D6W A;  3ME9 A;  2P0Q A;  1YJN T;  2EIF A;  1YIJ A;  4M7A C;  5GAO m;  3OSV A;  1Q86 C;  2D6F A;  4R55 A;  3NTK A;  1FX7 A;  4IUQ A;  2RI5 A;  3OS5 A;  1M90 U;  1DJ7 B;  3OB9 A;  4C92 G;  1KC8 U;  1YI2 A;  4QVZ A;  4C0Z A;  4FSX A;  4C92 E;  5A0L A;  1VQ7 T;  1Y7X A;  3FIF A;  2DXC A;  3L2Z A;  1UGQ B;  3RKX A;  3S3N A;  1BI0 A;  1X75 C;  3A8O B;  1O75 A;  2EQM A;  1D3B A;  3JCM g;  4EMH A;  4ZTJ A;  3EFS A;  2M0O A;  3OYY A;  4XTY A;  3X20 B;  4M77 G;  2LNV A;  2EYQ A;  4BB7 A;  3WVD B;  2K2V A;  4M77 E;  4CRI A;  1YIT A;  1UGP B;  3RMQ A;  5GAM j;  5A0G A;  3I55 T;  2IVW A;  2CZ7 B;  2ZZD A;  5GAN d;  3JCM V;  4N0A A;  4OB1 B;  2WSE E;  4QW2 A;  1YJ9 T;  5LJ3 f;  2CKK A;  1BI2 A;  3JCM c;  2HBP A;  3CCL A;  3OYA A;  2QA4 T;  3PIO A;  2XID A;  3GF5 A;  4M75 B;  5CO7 A;  5LJ3 h;  3OS0 A;  3PIP A;  3JCM Q;  5GAM g;  4XU0 A;  1VQO T;  3H6Z A;  1Y96 A;  4BI4 A;  5LJ5 f;  2DKG A;  5CCA A;  3CXC S;  1YJW T;  1OI1 A;  1FXX A;  1ZHI A;  3OYF A;  1GXI E;  3CPW S;  4M78 C;  2CZ6 B;  3LW5 E;  4EMK A;  5LJ5 h;  3CD6 A;  5GAO q;  3QKJ A;  5J39 A;  3OYM A;  5D6Y A;  3JCM h;  3HKS A;  1N27 A;  3SDZ A;  5GMK m;  1X01 A;  2ZPI B;  1K73 C;  4M7A D;  1VQK T;  3A8M B;  3LWH A;  2YHT A;  1S72 T;  2PUO B;  3BDL A;  2XKO C;  3ER0 A;  4MML A;  3SWN B;  3OYL A;  3OYG A;  1WJS A;  3RUX A;  2X4J A;  2DK3 A;  3QYG B;  3GLX A;  1BYM A;  3G71 A;  3V7S A;  4M75 C;  2DTO A;  1VQP A;  2L89 A;  2RD1 A;  2ZPG B;  2EJ9 A;  2FYK A;  4A4K A;  4XU3 A;  2VV5 A;  4C92 A;  3NTI A;  3X25 B;  3M54 A;  4M7D B;  1WJR A;  2P0P A;  3QZ9 B;  5GAM f;  4J8O A;  5HK3 A;  3X28 B;  4RG8 A;  1M8V A;  5I2M A;  4C8Q D;  1VQ5 A;  2X4X A;  1NPR A;  5GAM h;  5A2Q E;  3FLG A;  5GAN 4;  1NJI C;  5A0D A;  2P0K A;  1ZBX A;  5GAO l;  1M5Q 1;  2PVG B;  4M77 A;  4NOY A;  4BI3 A;  2VGN A;  3UT1 A;  4C5E A;  4J6X A;  1WPY A;  3SWN C;  2DXT A;  5CK9 A;  2DD4 A;  3OYJ A;  3CCQ A;  4O5V A;  2DZ9 A;  1RI0 A;  4IUU A;  5GAN e;  2WAC A;  3CBM A;  4M7D G;  4J7F A;  1B34 A;  4A4F A;  1M1K U;  3Q1J A;  1D3B B;  4X9C A;  5GAO n;  1KQ1 A;  5CKE A;  5FU6 B;  3CCE T;  4MZP A;  4M7D C;  2XDB A;  1WQ7 A;  3GNG A;  5D6W A;  5KE3 A;  3C94 A;  1G3T A;  1NE8 A;  4C5H A;  3KXT A;  3LH0 A;  4HA8 A;  2M9U A;  4OVA A;  3RKW A;  4RKU E;  3G7Z A;  5GAN 6;  3CCJ A;  2RI3 A;  2XD0 A;  3L2W A;  3P8B B;  2K3Y A;  2LQ8 A;  1VQM T;  1NZ9 A;  3E19 A;  1XNI A;  3E9F A;  3QO3 A;  2AHJ B;  2MWO A;  3HHT B;  2PU9 B;  2XK0 A;  3KUF A;  2RHI A;  3OMC A;  3CXC A;  4PJO C;  3MHX A;  1VQ6 T;  2ZPH B;  3CPW A;  5I21 A;  1JJ2 A;  1Y96 B;  1HXD A;  2H3J A;  2LCL A;  3BFM A;  3CCU A;  1VQ4 A;  4GY5 A;  4E47 A;  2E70 A;  4PLI A;  3UWN A;  3I56 A;  1QVG S;  4EMK B;  2E1H A;  3DB3 A;  2GQV A;  3JSC A;  3JCM d;  2WSF E;  4N4G A;  1PSE A;  2JTF A;  3CC7 T;  3CCR T;  4C8Q E;  2RJC A;  4X9D A;  3MP6 A;  3L2R A;  2MWP A;  4N0A C;  1H64 1;  2X35 A;  4C5G A;  3M58 A;  2K3X A;  4OMF B;  3HRU A;  3TCJ A;  2RO0 A;  3MEA A;  3QUI A;  2HNI A;  2LT4 A;  2VXE A;  3CBO A;  2L3R A;  5GMK j;  3INZ A;  4KUI A;  3HPW A;  3FB9 A;  4CI0 C;  2OTL T;  2LCC A;  1O9S A;  4C92 B;  5LJ3 j;  4QQD A;  1QVF S;  4RCB A;  4KT0 E;  2GCX A;  5M9O A;  1WJQ A;  5GAM d;  2JN0 A;  1ZQ1 A;  3M59 A;  3MO8 A;  3OBW A;  1M4Z A;  2JUF A;  2DJZ A;  3A8G B;  4NS5 A;  3M56 A;  2K57 A;  2Y4Y A;  2F5K A;  4B9W A;  5LJ5 j;  4LDV A;  3CCS A;  5KH6 A;  3OS2 A;  3OQ5 A;  4DQ2 A;  3CC4 T;  3JB9 F;  2ZPF B;  2P4T A;  4M77 B;  1XOV A;  5LJ3 g;  1QP2 A;  3WXM B;  4A4E A;  1YHQ A;  5HKC A;  3M5A A;  4E7J A;  3GOX A;  3LGF A;  3MP1 A;  1B34 B;  4Y28 E;  5LJ5 g;  3ASK A;  1N8R U;  4C92 C;  3CME T;  2OTJ T;  2EQU A;  3RIR A;  5GAN 5;  3OYH A;  3GNF B;  1VQN A;  1PSF A;  3RKY A;  4XTZ A;  1WGS A;  5FU7 C;  3QG1 A;  1WNL A;  3JCM W;  1MHN A;  2KY9 A;  4OB2 B;  1Q81 U;  1P92 A;  1KD1 U;  2PQW A;  1QP3 A;  2RJF A;  3KBG A;  3JB9 D;  4N4H A;  4M77 C;  2JTM A;  3PMT A;  2BKD N;  2D0Q B;  3OS1 A;  3OY9 A;  3JCM e;  2RI2 A;  2XDD A;  2NLU A;  4C8Q A;  2MF2 A;  2E6N A;  3OMG A;  1Y07 A;  5GMK h;  1YIT T;  1I5L A;  4JS4 A;  2CGH A;  2EFI A;  1UB4 A;  3I55 A;  1KQ2 A;  2EAY A;  3V8K A;  1Y71 A;  4IUT A;  4L59 A;  2E65 A;  5DLQ E;  3VU3 C;  1M9S A;  5CKH A;  1KQS A;  3CCL T;  3JCM P;  1JBM A;  4ZN3 A;  4ZGD B;  1G3S A;  4PNO A;  4C8Q F;  3G6E T;  1UGR B;  4OF1 A;  3LWI A;  1U1T A;  1K9M U;  2FHD A;  2DXB A;  1U8R A;  1X6O A;  3CCV A;  4C0D B;  2RJD A;  2XU8 A;  3QHS A;  1BKB A;  5CKF A;  3RMS A;  3MP8 A;  4BD3 A;  2KVQ G;  4KUD K;  1QVF A;  2RM4 A;  3HFO A;  4JJN K;  2E5Q A;  2EWN A;  2KSS A;  2PUK B;  5J26 A;  1EIF A;  3J7A F;  4LDW A;  4PL6 A;  1VIE A;  4DOV A;  2CS7 A;  4QQ6 A;  5GAO r;  5FLX E;  3A5Z B;  1W2B S;  3LLR A;  4YTL A;  2X4Y A;  2R5A A;  4OB3 B;  4OGE A;  2EJG A;  4MZM A;  5FRN A;  4A4G A;  1AHJ B;  2MI6 A;  3JRZ A;  4FU6 A;  4ME7 A;  4BY6 B;  4M7A A;  4MDX A;  4F7U A;  2QQB A;  1Q86 U;  4WF2 A;  2QDY B;  4HCZ A;  1NPP A;  3C4S A;  4C0D C;  4PJO D;  1I4K 1;  3OYD A;  5C6S A;  1VQL A;  5C0M A;  2YRV A;  4FT2 A;  4IUP A;  3J80 E;  1KG1 A;  3TEE A;  3OYK A;  4MZT A;  4ZN1 A;  2L8D A;  5I2S A;  3RES A;  3PGG A;  1BI1 A;  3ZEH A;  5CKB A;  4A53 A;  4BUG A;  3CC2 A;  4M7A F;  2EJF A;  2F5T X;  3QSU A;  4FL6 A;  4F7U F;  3QYH B;  3L2Q A;  3JCM J;  3CCQ T;  3RER A;  4OB0 B;  2K5L A;  1G3Y A;  2K5F A;  2R5M A;  4HT9 A;  3CCM T;  3V8J A;  2GFU A;  3PNW C;  1M90 C;  3HP9 A;  3QJY A;  1VUB A;  4C8Q B;  2KMT A;  3MET A;  1KC8 C;  3CCE A;  5LJ3 d;  5DM7 R;  2GFA A;  2RA2 A;  3OBY A;  4EMG A;  3L2U A;  4E7I A;  4ZGJ B;  4Q5W A;  4JLI A;  3NFC A;  2PVO B;  2QEX A;  4BDY A;  2LX9 A;  3V8L A;  1VQ8 T;  5LJ5 d;  1SSF A;  1W4S A;  2O4X A;  5FU6 C;  3QJ6 A;  1IRE B;  1QVP A;  3E9G A;  2DVE A;  4HKE A;  3VYG A;  3M4Y A;  4DOW A;  2E6Z A;  1VQM A;  1Q82 U;  5DLO A;  1BIA A;  1H3Z A;  5GAN 3;  4M78 A;  4C8Q G;  3OYB A;  3JB9 J;  4B9X A;  3CCU T;  1VQ4 T;  5FRO A;  3CPF A;  3S3O A;  4VUB A;  5GAN f;  1VIF A;  2FL7 A;  3V7C A;  1LOJ A;  2X4W A;  4C8Q C;  3I56 T;  2PVD B;  4C0F A;  2R58 A;  1W2B A;  5GAN 7;  4GLK A;  3S3M A;  4O6J A;  4XQ3 A;  5HY6 A;  2RHX A;  5CAI A;  5KCO A;  4HCB A;  5CR2 A;  2E10 A;  4M78 F;  4JS5 A;  3TRE A;  2BUD A;  2IG0 A;  2XDP A;  4FM4 B;  4RMO A;  3CCV T;  4RG2 A;  4EMK C;  2LC4 A;  4X34 A;  2QI2 A;  3TU4 K;  2ZGW A;  3FJP A;  3OYE A;  3PTA A;  3P8H A;  4M7A B;  1VQ9 T;  1KHI A;  4ZTF A;  2EQJ A;  3M9Q A;  3VUB A;  4F7U B;  3GPL A;  3EFR A;  4JRK A;  5DY9 A;  3CMA A;  1Q7Y U;  4PKC C;  2LTO A;  2DO3 A;  3M57 A;  3G4S A;  2ZPE B;  1YCY A;  5CQX A;  4FT4 A;  2R57 A;  4JRI A;  2DPP B;  2DIG A;  4M75 F;  2Y90 A;  3HSB A;  3JB9 H;  3PT9 A;  1YIJ T;  3HFN A;  5GMK i;  1YBY A;  5GMK e;  3FEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...