4M78F

Crystal structure of lsm2-8 complex, space group p21
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
65
Chain Sequence
ILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 10
structure length 65
sequence length 79
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78F00
4M75D 3SWNC 4J5YA 4XQ3A 4M77B 5GAOq 1N9RA 2VXFA 4C8QF 5LJ5j 2RB6A 5GAN4 4M78D 2E64A 1D3BB 5LJ5h 5GAOr 1WNLA 4F7UF 3EFRA 4PNOA 5GAMj 4A53A 3EFSA 5GAMh 4M77C 4C8QA 5GANj 1Y96B 2RA2A 3FJPA 5GANh 2Y90A 1X01A 4M77E 3RESA 5LJ3d 3V8KA 2EJGA 4C8QG 4F7UA 3JCMg 5GMKm 5GAOl 3JCMJ 1I81A 4F7UG 2DZCA 1YCYA 5LJ3f 3JCMf 1LNXA 1I4K1 3BDUA 5GMKj 1WQWA 3FB9A 3JB9G 4M7DF 2ZGWA 1I8FA 5GMKh 1I5LA 5DY9A 1M5Q1 3BY7A 4M75C 3AHUA 4M7AF 4NL3A 4QVCA 4M7DA 4M78C 3V8JA 3QSUA 2DTHA 5LJ5d 4PJOD 4RCCA 4M78E 4M7DG 1WQ7A 4Y91A 5LJ5g 4PJOB 1JBMA 2DXUA 3JB9J 3RERA 4M7AA 1N9SA 2YLCA 5GMKl 2JN0A 3V7CA 5GAMg 4EMKA 3V7SA 4JRKA 2DVEA 2I2LA 5GANg 3QUIA 4C92F 5GAN5 1HK9A 2EWNA 4XTWA 1U1TA 3PGGA 4M75F 3JCMe 5LJ3e 3JB9I 3HSBA 3GIBA 1HXDA 3JB9H 2DTOA 3RIRA 4XU1A 1B34B 4M78F 4C8QD 2CGHA 4EMGA 4C92A 1M8VA 2DJZA 1BIBA 5GAN6 3RKWA 2FB7A 4M75A 3SB2A 3HFNA 3V7RA 3HFOA 4XU3A 4PJOC 3BW1A 3JB9D 3RUXA 4V2SA 4XU0A 1BIAA 3L2ZA 2DZ9A 2VXEA 4N0AC 4XTZA 2FYKA 4JRIA 1KQ2A 4RCBA 4PJOE 3SWNA 4J6WA 1KQ1A 2QTXA 4M77F 3JCMV 5LJ5e 3JCMb 2E10A 4QVDA 1LJOA 3FIFA 2DXTA 4OP0A 4C8QB 2K57A 4J6XA 4M7DD 3RKXA 1WPYA 5LJ5f 5GAMd 4F7UB 3JCMW 4M77A 4M7AG 5GANd 4EMHA 5GAMf 1LOJA 1D3BA 2VC8A 4M77G 5GMKi 4M7AD 4PJOF 4C8QC 4WF2A 2YLBA 2DTIA 5GANf 5LJ3j 3JCMd 5GAN2 4C8QE 4MMKA 3JCMh 5LJ3h 5GAOp 3JCMc 3V8LA 4JLIA 3L1AA 1Y96A 4F7UE 5CAIA 1H641 4PJOA 2RD1A 4M7DB 4J6YA 1TH7A 4XTVA 4C92G 4JUVA 3BFMA 4C92D 5GAOn 4M75G 4M78A 2DKGA 3M4GA 4M7AB 4XU2A 5I21A 2HNIA 1U1SA 5GAN3 4M78G 4EMKB 4M7DC 4M7DE 5GAN8 4A54A 4HT9A 4XTYA 4X9CA 4M7AC 3QO3A 5GAMe 4NOYA 3JB9F 4M7AE 4EMKC 1MGQA 5GAN7 5GANe 4HA8A 4C92B 5LJ3g 4M75B 2E65A 4M77D 4NL2A 3JCMX 4HT8A 2EAYA 2YHTA 1JRIA 4M78B 4X9DA 2RM4A 3INZA 5GMKe 2DEQA 3RKYA 2E41A 4C92C 3VU3C 3SWNB 5GAOm 4C92E 4N0AA 1B34A 3JCMQ 3JCMP 2EJ9A 4XTXA 4PJOG 2EJFA 4M75E 2E1HA 4XTUA 3QHSA 4MMLA 4DQ2A
chains in the Genus database with same CATH superfamily
2C06A 4AG1C 1RAHB 5LJ5j 4JZ3A 2K3YA 1YI2Q 1AD5A 4J9FA 4LUEA 3UWNA 3P8DA 2VUBA 3EH1A 3X20B 4QKUA 3VS1A 5IH2A 1MNEA 5GMKh 2MMPA 4RUGA 3SHWA 4KGZB 2DO3A 1Q82R 4DEXA 4JLGA 3CMEQ 2CP2A 3CCQA 3RERA 1GXIE 4PJLA 3CCEA 3H0HA 2QG9B 1HK9A 1ABQA 1KK7A 3GBQA 1AZGB 2EBPA 4LDXA 4RG8A 4OB3B 3VS5A 5GAN6 3SB2A 2QXFA 2R5MA 3CBPA 2M1HA 3CCVT 1MMNA 4DEYA 2D8HA 3SWNA 2GBQA 3CCMQ 3JCMb 2BZXA 3VV0A 1PHTA 2QK0A 1ABOA 4M4ZA 4DBFA 2FL7A 3KXTA 1QVGS 2QQAA 1X2QA 2O9SA 4EMHA 1LOJA 3L2QA 1IB8A 2AKKA 4FT2A 4MMKA 1VQ7Q 3JRZA 3MO8A 1DJ7B 3VJPA 5C6SA 4J6YA 2X4YA 4BUGA 1KD1U 3TVTA 4RG2A 4M7AB 1NEBA 3EHRA 4C5IA 5GAN3 4M7DC 5CVIA 1AWWA 4C5EA 3UF4A 3REBB 2F2WA 4LUDA 2V1QA 4M77D 3WVEB 3FJ5A 2EAYA 2YHTA 3VS0A 4X9DA 1NBEB 1Z9ZA 5HKCA 1G5VA 3A8HB 3UA6A 4E7HA 3JCMQ 4AFQC 2EJ9A 1YN8A 3MEAA 1S72T 2P4TA 2VXFA 3OBWA 2RB6A 2JS0A 1M90R 3OYGA 1JXMA 1M30A 1S1NA 3FJPA 8AT1B 1QCFA 4Q5WA 4YTLA 1G3TA 2AZVA 4PFOA 2X3XD 5CKDA 4OF1A 1I8FA 3HRSA 2CYZB 3M54A 2ESWA 3QJ6A 1WXTA 4ELYC 5L23A 4M78E 5HY6A 5HK3A 2GF7A 3H8ZA 1RADB 4JS5A 1TUGB 3LLRA 2I2LA 2NWMA 1KD1C 1TUCA 4Y28E 3PGGA 2D6FA 2O88A 2EFIA 1Y0MA 3E9GA 2CGHA 1BIBA 4JDSA 3OQ5A 4FYVB 4X1VA 4C5HA 1BIAA 3HTRA 4PJOE 2K2VA 4D8KA 1XTDA 1IXDA 3ZFJA 2PZ1A 4ZN1A 3THKA 3CPFA 1KC8R 4M7AG 2VB6A 2LMJA 5GMKi 1ZUUA 5D6WA 1D1AA 1FWZA 4JLIA 4DOWA 4M7DB 2KMTA 3X25B 1YCSB 1VQ5T 2K79A 1IGUA 3BFMA 1FX7A 5GAOn 3VS2A 1M3CA 1NPRA 4A4HA 5CO7A 3MEWA 2BTTA 4HVUA 3CD6Q 5GAN8 4J8OA 3VYHB 1QWFA 2KRMA 4LDVA 2HDAA 1VQKA 2CP3A 4QQ6A 1OOTA 5GANe 1M3AA 4BY6C 3CCLA 4C0GA 2LVMA 1G3WA 5CKFA 3REAB 5CR2A 2V8IA 3OYKA 1IREB 2RHYA 3CPWP 1KQSP 2OTLT 4FU6A 1X27A 3OYLA 5GAOq 1RAIB 2E64A 4F7UF 2FHDA 2P0KA 2Z0WA 2F5TX 1X01A 3JCMd 3C95A 1YJNA 3CCLQ 4FW1A 2P84A 2YUNA 2AK5A 4MZTA 3WVDB 3UPUA 3QKJA 4O5VA 2K6DA 2XDPA 2VV5A 4HCBA 2DTHA 5LJ5d 2KT1A 3E2UA 3TQ7P 3OYBA 3G4ST 1V1CA 1VQOT 2EYZA 1M1GA 1Q7YU 1AVZC 2C0TA 2MWOA 2LRQA 2EQMA 3EH2A 3EHQA 3MP1A 4GLKA 1O9SA 2RQUA 1I0CA 4C92A 4HCKA 4N0AC 1K1ZA 2QTXA 2LCCA 3FDRA 4BDZA 2LX7A 2RHXA 1D1BA 1QLYA 1WYXA 4F16A 3ER0A 2J7IA 2B86A 5GAMf 4M77G 1N6AA 3CCJT 4MDXA 3ZL7C 3CMAT 2BUDA 4F7UE 2O9VA 4FYWB 4PJOA 3CCVQ 2FZCB 3TEEA 3RBBB 2LNVA 1SG5A 3CBOA 2X51A 1YIJT 1UJYA 1QVFP 3VRYA 1KC8U 4R56A 5GJVB 4BY6B 1SRMA 4PJNA 1MMGA 4KH1B 2BE7D 3LW5E 2DYBA 2E3IA 4Z02A 1X75C 1Q7YC 1WZOA 5KYYB 5GAOm 2HD0A 5IAYA 3M0QA 3QHSA 4OMQA 3SWNC 1JJ2A 4II1A 1VQNT 2D8JA 3EGXA 1JJ2S 5GAMh 3PFSA 3FC3A 5M9OA 2MI6A 1IO6A 2BIVA 2Y90A 2DRMA 3NGPA 5L8RE 2HEQA 2SRCA 4DBQA 2M51A 1PKSA 2DL8A 1S72Q 2XD0A 2DL4A 3QDFA 1AZEA 3OYEA 4Y91A 2IIMA 2DAQA 2RJDA 1D09B 4BE0A 5FLXE 1Q81U 3ASKA 3QZ9B 5GAMg 3CMET 2KXCA 5KYXB 5J3BA 4HXJA 1WHHA 2RQWA 2J06A 2D9TA 5DM7R 1KC8C 2JTMA 4AT1B 2DPPB 2FB7A 3TREA 3HFNA 3OS2A 1B7TA 2F69A 5D6YA 5CIUA 2NUZA 4OMFB 1UGPB 2VVKA 2EQUA 4ESRA 2X4WA 3JCMW 2DD5A 4M77A 4ME7A 4PLLA 1D3BA 2QQRA 4OMPA 2BE9B 5GAN2 5LJ3j 2DE0X 1OI1A 1RUWA 2A36A 2KK4A 1VQ5A 4GBQA 2AKLA 1TS9A 3VS7A 2HBPA 2DKGA 1Y57A 3CPWA 1KQSA 1TG0A 2X35A 3S3MA 4L6V5 4J9GA 2DA9A 1PNJA 4LNPA 4MZPA 5GAN7 2ECZA 1KG1A 1WLPB 5HK0A 3L2VA 2BKDN 4P5NA 1UG1A 3OMGA 2CSQA 3FLGA 1Q81C 1VQ5Q 5IXBA 2KSSA 2RQVA 2DXCA 2EQIA 3SWNB 4K11A 1YNZA 2OTLA 5C0MA 1FMVA 2E12A 1UFFA 1PKTA 1WDXA 1QVGP 2CP5A 4C8QF 3NMZC 1UTIA 3OMCA 1MNDA 1ZLMA 2IPOB 3C94A 4OB2B 2KNBB 4XAXB 1M8MA 2R57A 3CCRT 3PNWC 2OTLQ 3BY7A 2OAWA 1ZBXA 2J6OA 4FCYA 4N4IA 3LH5A 3G4SA 1WJQA 3Q1JA 1RACB 4RTTA 3QWYA 1M27C 2JN0A 1C1AA 1Y07A 1EZZB 1W2BS 3MCAB 2YUOA 3SFMA 5IXFA 2OJ2A 1M8VA 4OMMA 3OYAA 5CQXA 5J39A 2DNUA 4XU0A 5A0DA 3G4SQ 1VQOQ 4PFPA 4OP0A 1QVFA 3OYMA 5CK9A 3MPUB 1BB9A 2XU8A 4KGXB 2K5IA 1ZSZA 5GANd 3CCJA 3OW2P 3META 3CMAA 4C8QE 4HCZA 3J81E 3L1AA 1AT1B 3VKIA 3M59A 2M0OA 3C4SA 4XTVA 4L5GA 4B9WA 3X28B 3G7ZA 1VQPT 2K4YA 1YIJA 4X34A 2FZKB 2CP0A 5KYWA 4IUUA 1Q86U 1X6BA 2JM8A 2ZZDA 3CD6T 3CMAQ 2K3XA 1ACMB 4NL2A 2RM4A 1U8RA 4C92C 2RJFA 2DX1A 1E7OA 2HL3A 2RHUA 1YIJQ 3GLXA 4E7ZA 5HCKA 1M1KR 3OYNA 3P8BB 4ZGDB 3CC4A 1JQQA 4M78D 1NZ9A 3OS0A 7AT1B 4A53A 4QVZA 1YI2A 2JVVA 3V8KA 2ENMA 3JCMf 3OYJA 5KYXA 5GMKj 1WGSA 2HMAA 3AHUA 2PVDB 1M9SA 3EG1A 4QVCA 1R0CB 2L8DA 4PJOD 1BI0A 1UUEA 3MP8A 1VQNQ 4Z89A 2DIGA 3LWHA 2L3QA 3CMEA 3OA6A 2NUPA 5FRNA 2W10A 3FRNA 2ROLA 1JB0E 4E7KA 5J26A 2MOXA 2E6ZA 2H8HA 1Q86C 4XU1A 2LT1A 1EX4A 2FPDA 2COYA 4M75A 4XU3A 2M0YA 3NTIA 3DB3A 1KSWA 2VXEA 3M0TA 4QVDA 3CCMA 3RDVA 1WJRA 2LC4A 4JS4A 2XI9A 2JMCA 4KT0E 4E2FB 1W6XA 1E6HA 3JCMh 5CAIA 1VQ7A 1OX8A 2KGTA 4J7FA 1MV0B 2CP7A 1QVGA 1OPKA 3PE0A 1M2VA 2QGGA 2FZGB 4C92B 2XMFA 4AFSC 3CXCS 2E65A 3E9FA 4M78B 2OAUA 4FYYB 5A2QE 2E41A 3VU3C 2COZA 2L2PA 1B34A 3VS6A 4RTWA 2MF2A 3NHNA 2ABLA 1NPPA 4RTVA 4PL6A 1KIKA 1N9RA 3OYHA 2OTJQ 4BI4A 3KUFA 2X4XA 1OYXA 5KH6A 4M77C 2GFUA 2RI2A 4PJOB 1VUBA 2A3LA 2EJGA 3OSVA 3CCRA 1TUDA 4C5GA 1CKAA 2QI2A 2ZGWA 2L5QA 4FM4B 1M1KU 2GGRA 4M7AF 4FT4A 1I5OB 1Z9QA 3I35A 1IHVA 4RCCA 1K4US 4AMCA 2PNIA 3A8MB 2FG0A 2MPXC 1SF9A 2LNHB 1VQ4T 3QUIA 5GAN5 3UDCA 3NTHA 3CCRQ 1XOVA 3OW2A 1Q7YR 1G83A 4EMGA 3O5ZA 2HQEA 3ULRB 3OW2S 3RNJA 2JS2A 4OGEA 3HFOA 3I5SA 1UGRB 2DZ9A 4XTZA 3QYHB 2H3EB 4JRIA 8ATCB 5CKHA 1JJ2P 3EGXB 2DXTA 2VGMA 3FEOA 1K73U 2EQJA 2JM9A 1WJSA 1YP5A 2CT3A 1GBRA 1G2BA 1UGQB 1WXBA 5FROA 2D0NA 2JZ2A 4JJBA 3GP8A 2NYSA 1VQPA 4C92G 4KUDK 2L0AA 4N4GA 1LCKA 3JV3A 2JOYA 4M78G 4OB0B 3CD6A 1M1KC 2HBWA 4M7AE 1RAAB 4RTXA 2M16A 1M1FA 4WCIA 4HT8A 2OX7A 1H8KA 4E7JA 1T3SA 2AZSA 1VQPQ 2QQ9A 1W70A 2PQWA 4PJOG 3CCSQ 1GCPA 4OGCA 1MMAA 3JSCA 4M77B 1PSEA 4LXCA 3EG0A 3MJXA 1D3BB 1WNLA 2P0QA 1N5ZA 1WHLA 1AHJB 4J9IA 3CBMA 2RA2A 1ZA2B 2CZ0B 2LTOA 5GMKm 1M2OA 1K9AA 1YCYA 4LDUA 1JU5C 1VA7A 1I4K1 1RI9A 4M7DF 1K73C 2IVWA 3IQLA 1ZSGA 1BI1A 2XG8D 2KXDA 1D0ZA 3CC2T 2NLUA 4B6MA 1YITT 1SEMA 3V8JA 3QSUA 1UHCA 3M53A 2DMOA 2JT4A 2YUQA 1N9SA 4JZ4A 4RTYA 1VYTA 1WI7A 4KULA 2XICA 2QDYB 3MEUA 2E5QA 2HKNA 1C0MA 1PM3A 1Q81R 3G1JA 2CZ1B 1VQ9Q 4ANJA 5AT1B 2QASA 2CKKA 3E19A 1HD3A 2V8JA 3RUXA 2FEIA 2D1XA 2MCNA 2RK2A 4RCBA 4Z88A 1RLQC 2E10A 3J7AF 2K57A 1OZ3A 3L42A 1XNIA 2LJ3A 3S6WA 3VS4A 2E3HA 5GANf 4KH0B 2K5FA 2QTVA 3EAEA 1YJ9T 2EYXA 2BZ8A 3CCVA 4M78A 1NLOC 2FRWA 4E47A 3TSWA 1W2BP 3QIIA 4M7DE 1X2KA 4X9CA 4BI3A 2AIRB 2C0OA 3OB9A 3UT1A 4LN2A 1HYOA 2GFAA 1BBZA 3VUZA 4HCCA 2HSPA 3R6NA 2O2OA 2A08A 3N5BB 4O6JA 3G71T 2M9UA 4A4GA 2GQIA 1ZUKA 1OU8A 4M75D 3QG1A 4BE1A 2YRCA 1ZSZB 4IUQA 1JEGA 5GAMj 2CZ6B 4A4KA 4QT7A 6AT1B 5GANh 2A28A 4DA4A 2VWFA 3JCMJ 2GNCA 4F7UG 2DZCA 2PTKA 3HPWA 3DKMA 4B9XA 1PD0A 1VQMQ 4AFZC 1KHIA 5KYWB 3RMQA 2MWPA 1LVKA 1MUZA 3DLMA 2JTFA 2EYQA 1S72A 3AT1B 3CCUT 2QDLA 2LX9A 2OI3A 1VQ4A 4JRKA 2KI7A 5GANg 1RI0A 3GF5A 4PLIA 3PIPA 5LJ3e 4C8QD 2FRYA 3SDZA 1GCQA 4J9CA 2AHJB 2JW4A 3JB9D 3R6OA 1T3LA 2DL5A 1OU9A 3NFCA 4A4EA 1UB4A 2MAMA 4PFZA 4BACA 1VQ4Q 3SD4A 2V8KA 3QYGB 3CC7Q 1WIEA 3QDRB 1GRIA 1O75A 2YWWA 9ATCB 2JNGA 2DJQA 3JCMc 2ZAEA 1H641 3NTKA 3OY9A 4OMOA 5KYUA 2DLPA 3M4GA 2K9GA 3HRUA 1U1SA 2JMAA 2E5KA 2NUPB 2L3SA 1B3QA 1WHJA 4A63B 4NOYA 2P0PA 3LGLA 1Q86R 2DIQA 2RF0A 4FL6A 4M75B 1WX6A 4FSXA 5EC7A 2CDTA 2WACA 2LP5A 2B8AA 2ZPHB 3VYGA 2VGNA 2DVJA 5I11A 1BCMA 1F1BB 1VYVA 2CUDA 3PMIA 3PTAA 3A5ZB 3CCQT 2CH4A 5GAN4 1PG5B 4HVVA 3EFRA 3CCET 2LDMA 3EFSA 2YT6A 2OTJT 2YRDA 1H3ZA 3HHTB 3HKSA 3HL8A 4F7UA 2CZ7B 2RQRA 3L2RA 2O01E 1K0XA 3NPFA 5DY9A 2M02A 3M0PA 2DEUA 3CC2A 2DXBA 4ORZA 1AWXA 1AWOA 1G8XA 1M2VB 3OS5A 1P92A 1UECA 4JJCA 1UE9A 1BYMA 1VYUA 2EYWA 3CXCP 2DVEA 2L89A 2EYYA 5CCAA 2EWNA 2ZPFB 1YJWQ 3JB9I 3PMTA 1B34B 1NYFA 2HAXA 2PVGB 4CI0C 2KY9A 2ZPGB 3M4YA 3CC2Q 1YITQ 3L2ZA 1WHMA 2PUOB 3A98A 2EKOA 2JUFA 2GTJA 4AG2C 1RL2A 1VQOA 3EFOA 4E7LA 1W2BA 1A0NB 1QW1A 2CP6A 1GBQA 3PVLA 4EDUA 2QYZA 3MEVA 2X9HA 4LDYA 3LH0A 3G6EQ 2DETA 1QCNA 2K7AA 3CEYA 3I56Q 3U23A 4R55A 1PSFA 4PKCC 1E6GA 4M75G 1WHKA 2ED0A 2LZ6B 4C0FA 1T0HA 2K3BA 2DYIA 1OPLA 1QMCA 2X3WD 1WHGA 3SEMA 1I07A 2XDBA 4LD6A 1YJ9Q 3I9QA 5GMKe 2RN8A 3S3OA 4F17A 3G71A 4IKFA 1TTHB 4OB1B 3A8OB 1U5SA 1QKWA 1FMKA 2O4XB 3CCST 3EGUA 1TOVA 1ZBJA 1HJDA 3BDLA 3DB4A 4PJMA 1M3BA 2XIDA 4IIOA 4BD3A 4C8QG 5GAOl 2F2XA 5KCOA 4AFUC 3G71Q 3JB9G 2A37A 2K2MA 1KFZA 4NL3A 1Y71A 4E6RA 4M78C 2LJ0A 3CCUA 1VQLQ 1I1JA 1QQJA 1VQNA 1VQ8T 3M0RA 1N27A 1NYGA 1W4SA 4XTWA 5CKEA 2DTOA 2Y4YA 2XK0A 4LE9A 5LL6S 5I2SA 1VQ9T 4TVRA 1K9MU 2HQHA 4IIMA 4PJOC 3BW1A 1H3HA 1XQHA 2JJ9A 4JRQA 1FXXA 1K8AR 4PJJA 3CCUQ 2LQ8A 4J6WA 2LCSA 2QEXT 1RAEB 1UHFA 2F1LA 4J6XA 5LJ5f 1PCXA 1VQKT 3GPLA 1RABB 1NEGA 2O31A 3C12A 4M7AD 2CS7A 1PWTA 1K73R 4JJNK 1SPKA 2RK1A 5IHKA 2RD1A 1OV3A 1OEBA 4JUVA 4RTZA 2MK5A 4N4HA 4EPCA 2HNIA 3M5AA 4QW2A 3M9QA 3C0CA 4HT9A 2H3JA 1MGQA 3OBYA 4HA8A 3A8GB 2HKQB 1YJNT 2CREA 1OZ2A 4J9DA 3RR6A 4ELZC 4NS5A 2DEQA 3QJYA 1N8RR 2DBKA 1GCQC 4ZGEB 4E7IA 1OX9A 2E1HA 1ZA1B 3QXEB 2P4RA 2EQKA 3LYIA 5LJ5h 3TU4K 1YHQT 4PNOA 1K9MC 5KCHA 3LGFA 2OTJA 3CXCA 4C8QA 2DILA 4MZMA 1JO8A 5ECAA 5LJ3d 3JCMg 4R0KA 5FRMA 1LNXA 1R8OB 2DF6A 1I5LA 2SEMA 3CCQQ 5IN1A 1VQMT 1KJWA 1WQ7A 5LJ5g 2L3RA 5IHIA 3CCEQ 5FU6C 5A0GA 3V7CA 5IT9E 3ME9A 1J3TA 4C92F 4BE2A 4CC4B 2LQNA 3HSBA 2KROA 1UJ0A 2FPFA 4M78F 4QQGA 2DERA 2DJZA 1K0SA 3L2UA 4DBRA 3H9NA 2YUPA 1KQ2A 3M0SA 2ZPEB 1X69A 3ZEHA 1X6OA 2KBTA 1LJOA 4EIKA 4IUVA 2A0FB 4M7DD 4OMLA 1YWOA 2RPNA 4PJOF 1YBYA 3GNGA 1FYNA 4E7SA 4CC2A 1SHGA 5GAOp 3P8HA 3CC7T 1Y96A 1H92A 1BK2A 1K8AU 2DD4A 2RH2A 1GFCA 3OS1A 3PVQA 5I21A 1IHWA 2EGCA 2W0ZA 2ATCB 3A8LB 3F70A 4L59A 2O4XA 2XHCA 4UC4A 2CH4W 1JRIA 2HZYA 4C92E 2YRVA 2KYMA 1U06A 5GJWB 2FPEA 4XTUA 4MMLA 1EIFA 3EG9A 4J5YA 3CCSA 1QP3A 4IURA 3O8VA 1QVPA 4J83A 4KUIA 1VIEA 2RQTA 1W1FA 3RESA 2ED1A 4VUBA 2QA4T 1N8RU 3I55T 5KYUB 1WQWA 1Q82U 4Z8AA 1ZX6A 2V26A 2A7YA 2COWA 5FU6B 4KGVB 1M4ZA 2ZPBB 1RAGB 1TSFA 2Y4XA 5CKBA 1AOJA 1WXUA 1VQ8A 2YLCA 1K8AC 2RMOA 4EMKA 2LCLA 3I5RA 3V7SA 3BE3A 1PRLC 1U1TA 1ZSZC 3H41A 5EG2A 1BKBA 3GIBA 3TCJA 4LD9K 2LT4A 1VQ9A 1YJWT 2NUTA 2IG0A 1UEBA 4XK8E 3ZBDA 4GLMA 2QEXA 4J9HA 1NM7A 4M77F 3JCMV 1VQ8Q 1D1CA 1QCOA 2KQWA 1R0BG 3RKXA 2VYTA 4F7UB 2RHIA 2X4JA 3VRZA 2ROTA 2JXBA 2L3PA 3EGDB 2RJEA 3E1SA 3G6ET 1SKUB 3URGA 3I56T 2HSEB 3WXMB 2QEXQ 1VQ6T 2DRKA 2LQWA 2BZYA 1N8RC 2G6FX 1VQKQ 1Q82C 3VUBA 4JRPA 4RMOA 4C0DC 5GAMe 1NG2A 3JAME 1BI2A 4GY5A 4BI8B 3JCMX 4JJDA 3H0FA 1IGQA 1QKXA 4CC7A 2CUBA 4OMNA 2D0QB 3S3NA 4XTXA 1TU0B 2DL7A 3EFOB 1M90U 3EG2A 4DQ2A 1MMDA 2QQBA 4XQ3A 3H6ZA 3DLLA 1YFNA 1YHQA 3QPHA 4JPBW 3UATA 2YXYA 1BU1A 2RI5A 1YJNQ 5GANj 2LQKA 4M77E 1I81A 3D7SB 3FB9A 3M58A 2EGEA 1AWJA 4M75C 1VIFA 4ZGJB 1EFNA 1VQMA 1RLPC 4F14A 4J7IA 1B07A 1YHQQ 4M7DG 1X43A 1IRXA 3JB9J 2ZCFB 4M7AA 5DLQE 1VQLT 4RTUA 1UDLA 2DFUA 3VS3A 2YDLA 3RKWA 1BI3A 1V76A 4V2SA 2R58A 1IZ6A 3FIFA 2PVOB 1UGVA 1WPYA 2EVRA 1G3SA 1M90C 4C8QC 1T0JA 2YLBA 3CC7A 2XDDA 3LX7A 2PU9B 2J6KA 1U3OA 4FSSA 3M55A 1TH7A 2VASA 3PT9A 1NJIR 4J9EA 2HL5C 4C0DB 4IUPA 1FMWA 3EG3A 4BDYA 2G3RA 3CC4T 2KRNA 5KE2A 3CQTA 4KBMB 1YWPA 2YSQA 2LJ1A 3UA7A 2KYBA 2GCXA 3X24B 1YI2T 2MIOA 2WSEE 2WSFE 5DLOA 2KE9A 2R5AA 3INZA 3RKYA 4F04B 3MKDA 1RAFB 4CC3A 1X6GA 3OSSC 1GFDA 1NLPC 4DBHA 3M57A 2QA4A 2EPDA 2CT4A 5LJ3f 3TSZA 3I55A 1ARKA 4MDWA 4M7DA 1Q95G 1JXOA 3MP6A 2E6NA 5FU7C 4OVAA 2AT1B 3CCMT 2J05A 5GMKl 3OYCA 1WA7A 1QP2A 2KT8A 5D7UA 2QA4Q 3LWIA 2J6FA 2RI3A 4M75F 3I55Q 1HXDA 1D0XA 3HP9A 2DK3A 1YJWA 3T9NA 3A1PA 5A0LA 1VQ7T 5FW9A 1HSQA 1K76A 3GNFB 1PRMC 3EGDA 3OYYA 1YITA 2V1RA 4WTOB 1K9MR 5IHNA 3CPWS 1KQSS 4C8QB 4DOVA 1ZUYA 2KR3A 2F5KA 4KRTA 1SSFA 5I22A 3KFVA 4ZTJA 3OYFA 4WF2A 1D0YA 2DTIA 4D8DA 5LJ3h 4FYXB 2QGFB 5KE3A 3G6EA 3GOXA 3RMSA 3I56A 1TXQA 1MHNA 1VQ6A 2JTEA 5FWBA 2HQXA 5KYNA 1CSKA 4A54A 4QQDA 4RKUE 1V29B 3JB9F 2EKHA 4IUTA 4EMKC 3H0IA 2DBMA 3L2WA 4ZN3A 3QWXX 5LJ3g 1UGSB 1G3YA 2GQVA 1NJIU 2F2VA 1NE8A 2I0NA 2RO0A 4CRIA 3QZ5B 1YJ9A 4ATOA 1VQ6Q 3JCMP 2GTOA 4M75E 2KEAA 3OYDA 3OYIA 2DM1A 1PC0A 1Y7XA 2XKOC 5FWCA 4LDWA 2EGAA 2KRSA 2DL3A 2QQSA 5I2MA 1Y96B 1SHFA 2RJCA 4FIBA 5GAOr 5D6XA 1KHCA 2C0IA 1GL5A 2ZPIB 3BDUA 1M5Q1 5FU7B 5AYFA 2KAFA 1QWEA 2KDSA 2VKNA 1CKBA 1TWBA 1PD1A 1JBMA 2DXUA 1VQLA 1ZQ1A 4PK4A 1QVFS 2K5LA 2E4HA 2FO0A 3QBYA 3JCMe 4D6WA 2RHZA 2E70A 3JB9H 3RIRA 1SRLA 3KBGA 1BCOA 3V7RA 4A4FA 2EW3A 3EG9B 4J9BA 3J80E 1OULA 4ZNXA 4C0ZA 2FVUA 2FYKA 1R77A 4Y92A 5KYYA 1KQ1A 5LJ5e 2CSIA 1NJIC 2WSCE 1KD1R 1C6VX 3CCJQ 5GAMd 3M56A 2HCKA 2VC8A 1AEYA 2QAZA 2MYSA 3V8LA 1LPLA 4FW2A 2RNAA 1XJWB 4C92D 4HVWA 4BB7A 3PIOA 4XU2A 4HKEA 4EMKB 3X26B 2PUKB 1VOMA 4XTYA 4M7AC 3QO3A 4ZTFA 1SSHA 2EIFA 2KVQG 2NUTB 1OQKA 3HRTA 3M0UA 3CCLT 5CQYA 1ZHIA 3MHXA 1WFWA 4N0AA 1MV3A 2EJFA 3CC4Q
chains in the Genus database with same CATH topology
4M75D 3QG1A 3CCSA 4J5YA 4BE1A 2C06A 1QP3A 4IURA 3O8VA 4C8QF 5LJ5j 4IUQA 3OMCA 2K3YA 3C94A 1QVPA 4OB2B 2CZ6B 5GAMj 4J83A 4A4KA 4KUIA 3UWNA 1VIEA 4XAXB 5GANh 4DA4A 3RESA 3JCMJ 4VUBA 3P8DA 2VUBA 3X20B 1YJNA 2QA4T 2R57A 2DZCA 3HPWA 4F7UG 3CCRT 1N8RU 3DKMA 4B9XA 3PNWC 3I55T 1WQWA 1Q82U 5GMKh 2MMPA 3BY7A 1ZBXA 2A7YA 1KHIA 3RMQA 2MWPA 5FU6B 4N4IA 2DO3A 1M4ZA 2ZPBB 2JTFA 2EYQA 2Y4XA 3DLMA 3G4SA 4JLGA 1S72A 1WJQA 3CCQA 4PJOB 3Q1JA 5CKBA 3CCUT 1VQ8A 3RERA 1GXIE 2YLCA 1K8AC 2LX9A 2JN0A 4EMKA 2LCLA 1Y07A 3V7SA 3CCEA 4JRKA 1VQ4A 1W2BS 5GANg 1RI0A 3MCAB 1HK9A 3GF5A 1U1TA 4PLIA 5EG2A 3SFMA 3PIPA 5LJ3e 1BKBA 3GIBA 3TCJA 4LD9K 4LDXA 4RG8A 2LT4A 1M8VA 4C8QD 4OB3B 1VQ9A 1YJWT 5GAN6 3SB2A 3SDZA 2QXFA 2IG0A 5CQXA 5J39A 3OYAA 2R5MA 1UEBA 2AHJB 3CBPA 3JB9D 4XK8E 2M1HA 4XU0A 3ZBDA 3R6OA 5A0DA 3CCVT 3NFCA 3SWNA 4A4EA 2QEXA 1UB4A 4M77F 2MAMA 3JCMV 3JCMb 3VV0A 2KQWA 4OP0A 1QVFA 3OYMA 5CK9A 4BACA 3RKXA 2FL7A 2VYTA 3KXTA 3SD4A 4F7UB 1QVGS 2RHIA 2QQAA 2X4JA 2XU8A 2K5IA 2V8KA 3QYGB 5GANd 4EMHA 3CCJA 1LOJA 3META 3CMAA 3L2QA 3QDRB 1O75A 4C8QE 4FT2A 4MMKA 4HCZA 2JNGA 3JCMc 3JRZA 3J81E 3MO8A 3L1AA 1DJ7B 3VJPA 2RJEA 3VKIA 1H641 3E1SA 3G6ET 3M59A 3NTKA 5C6SA 4J6YA 2M0OA 3C4SA 3OY9A 4XTVA 4L5GA 4B9WA 3X28B 2X4YA 3G7ZA 3URGA 3I56T 2K4YA 1VQPT 3WXMB 4BUGA 1YIJA 1KD1U 4RG2A 3M4GA 4X34A 3HRUA 4M7AB 1U1SA 4C5IA 5GAN3 1VQ6T 4M7DC 1N8RC 4IUUA 1Q86U 5CVIA 1Q82C 3VUBA 4C5EA 4RMOA 4JRPA 4C0DC 2ZZDA 5GAMe 4NOYA 2P0PA 3CD6T 3JAME 3LGLA 1BI2A 2K3XA 2DIQA 4GY5A 4FL6A 4BI8B 4M75B 4FSXA 4NL2A 4M77D 3WVEB 3JCMX 2EAYA 2YHTA 2WACA 4X9DA 2RM4A 5HKCA 2ZPHB 2B8AA 1U8RA 2D0QB 4C92C 1G5VA 2RJFA 3A8HB 4E7HA 3VYGA 2VGNA 3S3NA 2RHUA 3JCMQ 2EJ9A 4XTXA 3GLXA 3MEAA 1M90U 4DQ2A 3OYNA 1S72T 3PMIA 2QQBA 2P4TA 3A5ZB 3P8BB 3H6ZA 4XQ3A 4ZGDB 3PTAA 2VXFA 3DLLA 5GAN4 3OBWA 2RB6A 3CCQT 4M78D 1YHQA 1NZ9A 3OS0A 3EFRA 3QPHA 3OYGA 4A53A 3CCET 2LDMA 3EFSA 2RI5A 4QVZA 5GANj 2OTJT 3FJPA 1YI2A 2JVVA 2LQKA 1H3ZA 4M77E 3HHTB 3HKSA 3HL8A 3V8KA 2CZ7B 4Q5WA 4F7UA 4YTLA 1I81A 3JCMf 1G3TA 3OYJA 5CKDA 5GMKj 4OF1A 3FB9A 3L2RA 1I8FA 2O01E 3M58A 3HRSA 2CYZB 5DY9A 1WGSA 3M54A 3CC2A 4M75C 3QJ6A 3AHUA 2PVDB 1M9SA 1VIFA 2DXBA 4ZGJB 4QVCA 2L8DA 1VQMA 4PJOD 1BI0A 3MP8A 4J7IA 4ELYC 2DIGA 4M78E 5HY6A 3OS5A 4M7DG 3LWHA 1P92A 3JB9J 5HK3A 3CMEA 2ZCFB 2GF7A 4M7AA 3H8ZA 5DLQE 3OA6A 4JS5A 1VQLT 1BYMA 5FRNA 3FRNA 2DVEA 3LLRA 2I2LA 2L89A 1KD1C 4Y28E 5CCAA 2EWNA 1JB0E 2ZPFB 5J26A 3PGGA 4E7KA 2D6FA 3JB9I 2EFIA 3E9GA 2E6ZA 3PMTA 1Q86C 4XU1A 1B34B 2LT1A 2CGHA 2HAXA 2PVGB 1BIBA 2KY9A 4CI0C 4JDSA 2ZPGB 3OQ5A 4M75A 3M4YA 3RKWA 1BI3A 4XU3A 4C5HA 4V2SA 3NTIA 1BIAA 3L2ZA 3DB3A 2VXEA 4PJOE 2PUOB 2R58A 2EKOA 2JUFA 2K2VA 1XTDA 1VQOA 1RL2A 1IZ6A 3FIFA 4QVDA 3ZFJA 4E7LA 3CCMA 2PVOB 1W2BA 1WJRA 1WPYA 2LC4A 1QW1A 4ZN1A 4JS4A 2XI9A 3CPFA 4M7AG 4KT0E 4EDUA 5GMKi 1G3SA 1M90C 5D6WA 3MEVA 4C8QC 2YLBA 4LDYA 1FWZA 3LH0A 3CC7A 3JCMh 2XDDA 4JLIA 3LX7A 3CEYA 5CAIA 2PU9B 4DOWA 1VQ7A 4R55A 1PSFA 4M7DB 3M55A 2KMTA 1TH7A 4PKCC 3PT9A 3X25B 1VQ5T 3BFMA 4J7FA 1FX7A 5GAOn 4M75G 4C0DB 1NPRA 3CC4A 4IUPA 4A4HA 4C0FA 5CO7A 1QVGA 3MEWA 4BDYA 2G3RA 3CC4T 5KE2A 5GAN8 4J8OA 3VYHB 4KBMB 4LDVA 1VQKA 4QQ6A 2GCXA 5GANe 3X24B 4C92B 1YI2T 2WSEE 4BY6C 2WSFE 5DLOA 3CXCS 2E65A 2XDBA 2R5AA 3CCLA 3E9FA 4C0GA 4LD6A 2LVMA 4M78B 1G3WA 3INZA 5GMKe 2OAUA 3RKYA 5CKFA 5A2QE 2E41A 3S3OA 3VU3C 3G71A 5CR2A 4IKFA 1B34A 2V8IA 3OYKA 1IREB 2RHYA 4OB1B 2MF2A 2OTLT 3A8OB 4FU6A 1NPPA 4PL6A 3OSSC 3OYLA 5GAOq 1N9RA 2O4XB 3CCST 3OYHA 2E64A 4F7UF 2FHDA 2P0KA 4BI4A 3KUFA 2F5TX 2X4XA 3M57A 1OYXA 5KH6A 4M77C 2GFUA 3BDLA 3DB4A 1X01A 2RI2A 2XIDA 3C95A 4BD3A 1VUBA 2A3LA 2EJGA 3OSVA 4C8QG 5GAOl 3CCRA 2QA4A 5KCOA 5LJ3f 4C5GA 3I55A 4MZTA 2QI2A 3WVDB 3UPUA 3JB9G 2ZGWA 2L5QA 3QKJA 4FM4B 1M1KU 4O5VA 2XDPA 2VV5A 4HCBA 4M7AF 4FT4A 4MDWA 1Y71A 4NL3A 4M7DA 4M78C 2DTHA 5LJ5d 3MP6A 3CCUA 2E6NA 4RCCA 5FU7C 4OVAA 3OYBA 3G4ST 1VQOT 1VQNA 3A8MB 3CCMT 1VQ8T 5GMKl 1M1GA 3OYCA 1Q7YU 2MWOA 1QP2A 2LRQA 1VQ4T 3QUIA 1N27A 2EQMA 5GAN5 3UDCA 1W4SA 3NTHA 4XTWA 2RI3A 3MP1A 1XOVA 4GLKA 4M75F 5CKEA 1O9SA 3LWIA 3OW2A 1HXDA 2DTOA 2Y4YA 2XK0A 2DK3A 3HP9A 5LL6S 4EMGA 5I2SA 2HQEA 4C92A 1YJWA 3T9NA 3OW2S 5A0LA 1VQ9T 4TVRA 1VQ7T 1K9MU 3HFOA 4OGEA 3GNFB 1UGRB 4PJOC 3BW1A 1XQHA 3OYYA 4N0AC 1FXXA 2DZ9A 4XTZA 4JRQA 3QYHB 1YITA 4JRIA 2LQ8A 4J6WA 5CKHA 2QTXA 2QEXT 2LCCA 2DXTA 3FDRA 3CPWS 4C8QB 4BDZA 2RHXA 4DOVA 1KQSS 4J6XA 2VGMA 2F5KA 5LJ5f 3FEOA 1K73U 1SSFA 1VQKT 2EQJA 3ER0A 3GPLA 1WJSA 5GAMf 4ZTJA 3C12A 4M77G 1N6AA 3CCJT 4M7AD 3OYFA 4WF2A 2CS7A 2DTIA 1UGQB 4MDXA 3JCMd 5FROA 4JJNK 3CMAT 5LJ3h 2RK1A 2JZ2A 2BUDA 4F7UE 5KE3A 3G6EA 3GOXA 3RMSA 4PJOA 2RD1A 3GP8A 1VQPA 3I56A 3TEEA 4C92G 4KUDK 2LNVA 4JUVA 1MHNA 1VQ6A 4N4HA 4N4GA 3CBOA 4EPCA 2HNIA 2HQXA 1YIJT 2JOYA 3M5AA 4M78G 4OB0B 4QW2A 3M9QA 1KC8U 4R56A 4BY6B 4A54A 4QQDA 4HT9A 4RKUE 3CD6A 1V29B 1M1KC 2H3JA 3JB9F 4IUTA 4M7AE 4EMKC 1MGQA 3L2WA 4ZN3A 3OBYA 4HA8A 3A8GB 3LW5E 2M16A 1UGSB 5LJ3g 1G3YA 1YJNT 1M1FA 1OZ2A 4ELZC 4HT8A 2GQVA 4E7JA 4Z02A 1NJIU 1X75C 4NS5A 1NE8A 2RO0A 2DEQA 4CRIA 3QJYA 3QZ5B 1YJ9A 1Q7YC 4ATOA 5GAOm 2QQ9A 2HD0A 3JCMP 2PQWA 4ZGEB 5IAYA 4PJOG 4M75E 4E7IA 2E1HA 3QHSA 3QXEB 4OGCA 3OYDA 3SWNC 1JJ2A 4M77B 3JSCA 3OYIA 1PSEA 2EQKA 1Y7XA 3LYIA 4II1A 1D3BB 5LJ5h 3TU4K 1VQNT 1WNLA 2P0QA 1YHQT 2XKOC 4PNOA 5KCHA 3LGFA 4LDWA 1K9MC 2QQSA 1JJ2S 2OTJA 1AHJB 5I2MA 5GAMh 3PFSA 3FC3A 3CBMA 3CXCA 4C8QA 2MI6A 5M9OA 1Y96B 2RA2A 2BIVA 4MZMA 2RJCA 2Y90A 4FIBA 2CZ0B 2LTOA 5LJ3d 5GMKm 5GAOr 5L8RE 5D6XA 3JCMg 5FRMA 1KHCA 1YCYA 4LDUA 1LNXA 2ZPIB 1I4K1 3BDUA 4M7DF 1K73C 1R8OB 2IVWA 1BI1A 1I5LA 1M5Q1 2XG8D 5FU7B 5AYFA 2KAFA 2KDSA 3CC2T 2NLUA 1YITT 5IN1A 2XD0A 3V8JA 3QSUA 1VQMT 3OYEA 1WQ7A 4Y91A 3M53A 5LJ5g 1JBMA 2DAQA 2DXUA 2L3RA 2RJDA 1VQLA 4BE0A 1N9SA 1ZQ1A 5FU6C 5FLXE 3ASKA 1Q81U 5A0GA 3QZ9B 3V7CA 5GAMg 4KULA 3ME9A 3CMET 5IT9E 1QVFS 2K5LA 2XICA 2QDYB 3MEUA 4C92F 2E5QA 4BE2A 5J3BA 3QBYA 3JCMe 4D6WA 2CZ1B 2D9TA 3HSBA 2RHZA 2E70A 5DM7R 3JB9H 3RIRA 1KC8C 4M78F 4QQGA 2JTMA 3KBGA 2DJZA 2DPPB 2CKKA 3L2UA 2FB7A 3E19A 3TREA 2V8JA 3HFNA 3V7RA 4A4FA 3RUXA 3J80E 3OS2A 4C0ZA 1KQ2A 2FVUA 2F69A 2FYKA 2RK2A 4RCBA 5D6YA 5CIUA 2ZPEB 1KQ1A 4OMFB 3ZEHA 1UGPB 1X6OA 5LJ5e 1NJIC 2E10A 1LJOA 2WSCE 3J7AF 4IUVA 2K57A 2EQUA 1OZ3A 3L42A 4M7DD 5GAMd 2X4WA 3M56A 3JCMW 2DD5A 4M77A 1XNIA 4ME7A 3S6WA 2VC8A 1D3BA 2QQRA 4PLLA 4PJOF 1YBYA 3GNGA 5GANf 5LJ3j 5GAN2 1OI1A 5GAOp 3V8LA 3P8HA 3CC7T 1Y96A 2K5FA 2KK4A 3EAEA 1K8AU 1YJ9T 1VQ5A 2DD4A 2RH2A 4C92D 2HBPA 3CCVA 4M78A 3OS1A 2DKGA 4BB7A 3CPWA 5I21A 4XU2A 3PIOA 1KQSA 4E47A 4HKEA 2X35A 3S3MA 4EMKB 4L6V5 3QIIA 4M7DE 3X26B 3A8LB 3F70A 2PUKB 4XTYA 4X9CA 4M7AC 4L59A 3QO3A 4BI3A 3UT1A 4MZPA 3OB9A 5GAN7 1KG1A 4ZTFA 2O4XA 2EIFA 2KVQG 2XHCA 4UC4A 5HK0A 3L2VA 2GFAA 3VUZA 3HRTA 2BKDN 4P5NA 4HCCA 1JRIA 3OMGA 3FLGA 5CQYA 3CCLT 1ZHIA 3MHXA 1Q81C 2KSSA 2DXCA 3SWNB 4C92E 2OTLA 2YRVA 4N0AA 3N5BB 4O6JA 3G71T 5C0MA 2EJFA 2M9UA 2E12A 4A4GA 4XTUA 4MMLA 1EIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 D;  3SWN C;  4J5Y A;  4XQ3 A;  4M77 B;  5GAO q;  1N9R A;  2VXF A;  4C8Q F;  5LJ5 j;  2RB6 A;  5GAN 4;  4M78 D;  2E64 A;  1D3B B;  5LJ5 h;  5GAO r;  1WNL A;  4F7U F;  3EFR A;  4PNO A;  5GAM j;  4A53 A;  3EFS A;  5GAM h;  4M77 C;  4C8Q A;  5GAN j;  1Y96 B;  2RA2 A;  3FJP A;  5GAN h;  2Y90 A;  1X01 A;  4M77 E;  3RES A;  5LJ3 d;  3V8K A;  2EJG A;  4C8Q G;  4F7U A;  3JCM g;  5GMK m;  5GAO l;  3JCM J;  1I81 A;  4F7U G;  2DZC A;  1YCY A;  5LJ3 f;  3JCM f;  1LNX A;  1I4K 1;  3BDU A;  5GMK j;  1WQW A;  3FB9 A;  3JB9 G;  4M7D F;  2ZGW A;  1I8F A;  5GMK h;  1I5L A;  5DY9 A;  1M5Q 1;  3BY7 A;  4M75 C;  3AHU A;  4M7A F;  4NL3 A;  4QVC A;  4M7D A;  4M78 C;  3V8J A;  3QSU A;  2DTH A;  5LJ5 d;  4PJO D;  4RCC A;  4M78 E;  4M7D G;  1WQ7 A;  4Y91 A;  5LJ5 g;  4PJO B;  1JBM A;  2DXU A;  3JB9 J;  3RER A;  4M7A A;  1N9S A;  2YLC A;  5GMK l;  2JN0 A;  3V7C A;  5GAM g;  4EMK A;  3V7S A;  4JRK A;  2DVE A;  2I2L A;  5GAN g;  3QUI A;  4C92 F;  5GAN 5;  1HK9 A;  2EWN A;  4XTW A;  1U1T A;  3PGG A;  4M75 F;  3JCM e;  5LJ3 e;  3JB9 I;  3HSB A;  3GIB A;  1HXD A;  3JB9 H;  2DTO A;  3RIR A;  4XU1 A;  1B34 B;  4M78 F;  4C8Q D;  2CGH A;  4EMG A;  4C92 A;  1M8V A;  2DJZ A;  1BIB A;  5GAN 6;  3RKW A;  2FB7 A;  4M75 A;  3SB2 A;  3HFN A;  3V7R A;  3HFO A;  4XU3 A;  4PJO C;  3BW1 A;  3JB9 D;  3RUX A;  4V2S A;  4XU0 A;  1BIA A;  3L2Z A;  2DZ9 A;  2VXE A;  4N0A C;  4XTZ A;  2FYK A;  4JRI A;  1KQ2 A;  4RCB A;  4PJO E;  3SWN A;  4J6W A;  1KQ1 A;  2QTX A;  4M77 F;  3JCM V;  5LJ5 e;  3JCM b;  2E10 A;  4QVD A;  1LJO A;  3FIF A;  2DXT A;  4OP0 A;  4C8Q B;  2K57 A;  4J6X A;  4M7D D;  3RKX A;  1WPY A;  5LJ5 f;  5GAM d;  4F7U B;  3JCM W;  4M77 A;  4M7A G;  5GAN d;  4EMH A;  5GAM f;  1LOJ A;  1D3B A;  2VC8 A;  4M77 G;  5GMK i;  4M7A D;  4PJO F;  4C8Q C;  4WF2 A;  2YLB A;  2DTI A;  5GAN f;  5LJ3 j;  3JCM d;  5GAN 2;  4C8Q E;  4MMK A;  3JCM h;  5LJ3 h;  5GAO p;  3JCM c;  3V8L A;  4JLI A;  3L1A A;  1Y96 A;  4F7U E;  5CAI A;  1H64 1;  4PJO A;  2RD1 A;  4M7D B;  4J6Y A;  1TH7 A;  4XTV A;  4C92 G;  4JUV A;  3BFM A;  4C92 D;  5GAO n;  4M75 G;  4M78 A;  2DKG A;  3M4G A;  4M7A B;  4XU2 A;  5I21 A;  2HNI A;  1U1S A;  5GAN 3;  4M78 G;  4EMK B;  4M7D C;  4M7D E;  5GAN 8;  4A54 A;  4HT9 A;  4XTY A;  4X9C A;  4M7A C;  3QO3 A;  5GAM e;  4NOY A;  3JB9 F;  4M7A E;  4EMK C;  1MGQ A;  5GAN 7;  5GAN e;  4HA8 A;  4C92 B;  5LJ3 g;  4M75 B;  2E65 A;  4M77 D;  4NL2 A;  3JCM X;  4HT8 A;  2EAY A;  2YHT A;  1JRI A;  4M78 B;  4X9D A;  2RM4 A;  3INZ A;  5GMK e;  2DEQ A;  3RKY A;  2E41 A;  4C92 C;  3VU3 C;  3SWN B;  5GAO m;  4C92 E;  4N0A A;  1B34 A;  3JCM Q;  3JCM P;  2EJ9 A;  4XTX A;  4PJO G;  2EJF A;  4M75 E;  2E1H A;  4XTU A;  3QHS A;  4MML A;  4DQ2 A; 
#chains in the Genus database with same CATH topology
 2C06 A;  4AG1 C;  1RAH B;  5LJ5 j;  4JZ3 A;  2K3Y A;  1YI2 Q;  1AD5 A;  4J9F A;  4LUE A;  3UWN A;  3P8D A;  2VUB A;  3EH1 A;  3X20 B;  4QKU A;  3VS1 A;  5IH2 A;  1MNE A;  5GMK h;  2MMP A;  4RUG A;  3SHW A;  4KGZ B;  2DO3 A;  1Q82 R;  4DEX A;  4JLG A;  3CME Q;  2CP2 A;  3CCQ A;  3RER A;  1GXI E;  4PJL A;  3CCE A;  3H0H A;  2QG9 B;  1HK9 A;  1ABQ A;  1KK7 A;  3GBQ A;  1AZG B;  2EBP A;  4LDX A;  4RG8 A;  4OB3 B;  3VS5 A;  5GAN 6;  3SB2 A;  2QXF A;  2R5M A;  3CBP A;  2M1H A;  3CCV T;  1MMN A;  4DEY A;  2D8H A;  3SWN A;  2GBQ A;  3CCM Q;  3JCM b;  2BZX A;  3VV0 A;  1PHT A;  2QK0 A;  1ABO A;  4M4Z A;  4DBF A;  2FL7 A;  3KXT A;  1QVG S;  2QQA A;  1X2Q A;  2O9S A;  4EMH A;  1LOJ A;  3L2Q A;  1IB8 A;  2AKK A;  4FT2 A;  4MMK A;  1VQ7 Q;  3JRZ A;  3MO8 A;  1DJ7 B;  3VJP A;  5C6S A;  4J6Y A;  2X4Y A;  4BUG A;  1KD1 U;  3TVT A;  4RG2 A;  4M7A B;  1NEB A;  3EHR A;  4C5I A;  5GAN 3;  4M7D C;  5CVI A;  1AWW A;  4C5E A;  3UF4 A;  3REB B;  2F2W A;  4LUD A;  2V1Q A;  4M77 D;  3WVE B;  3FJ5 A;  2EAY A;  2YHT A;  3VS0 A;  4X9D A;  1NBE B;  1Z9Z A;  5HKC A;  1G5V A;  3A8H B;  3UA6 A;  4E7H A;  3JCM Q;  4AFQ C;  2EJ9 A;  1YN8 A;  3MEA A;  1S72 T;  2P4T A;  2VXF A;  3OBW A;  2RB6 A;  2JS0 A;  1M90 R;  3OYG A;  1JXM A;  1M30 A;  1S1N A;  3FJP A;  8AT1 B;  1QCF A;  4Q5W A;  4YTL A;  1G3T A;  2AZV A;  4PFO A;  2X3X D;  5CKD A;  4OF1 A;  1I8F A;  3HRS A;  2CYZ B;  3M54 A;  2ESW A;  3QJ6 A;  1WXT A;  4ELY C;  5L23 A;  4M78 E;  5HY6 A;  5HK3 A;  2GF7 A;  3H8Z A;  1RAD B;  4JS5 A;  1TUG B;  3LLR A;  2I2L A;  2NWM A;  1KD1 C;  1TUC A;  4Y28 E;  3PGG A;  2D6F A;  2O88 A;  2EFI A;  1Y0M A;  3E9G A;  2CGH A;  1BIB A;  4JDS A;  3OQ5 A;  4FYV B;  4X1V A;  4C5H A;  1BIA A;  3HTR A;  4PJO E;  2K2V A;  4D8K A;  1XTD A;  1IXD A;  3ZFJ A;  2PZ1 A;  4ZN1 A;  3THK A;  3CPF A;  1KC8 R;  4M7A G;  2VB6 A;  2LMJ A;  5GMK i;  1ZUU A;  5D6W A;  1D1A A;  1FWZ A;  4JLI A;  4DOW A;  4M7D B;  2KMT A;  3X25 B;  1YCS B;  1VQ5 T;  2K79 A;  1IGU A;  3BFM A;  1FX7 A;  5GAO n;  3VS2 A;  1M3C A;  1NPR A;  4A4H A;  5CO7 A;  3MEW A;  2BTT A;  4HVU A;  3CD6 Q;  5GAN 8;  4J8O A;  3VYH B;  1QWF A;  2KRM A;  4LDV A;  2HDA A;  1VQK A;  2CP3 A;  4QQ6 A;  1OOT A;  5GAN e;  1M3A A;  4BY6 C;  3CCL A;  4C0G A;  2LVM A;  1G3W A;  5CKF A;  3REA B;  5CR2 A;  2V8I A;  3OYK A;  1IRE B;  2RHY A;  3CPW P;  1KQS P;  2OTL T;  4FU6 A;  1X27 A;  3OYL A;  5GAO q;  1RAI B;  2E64 A;  4F7U F;  2FHD A;  2P0K A;  2Z0W A;  2F5T X;  1X01 A;  3JCM d;  3C95 A;  1YJN A;  3CCL Q;  4FW1 A;  2P84 A;  2YUN A;  2AK5 A;  4MZT A;  3WVD B;  3UPU A;  3QKJ A;  4O5V A;  2K6D A;  2XDP A;  2VV5 A;  4HCB A;  2DTH A;  5LJ5 d;  2KT1 A;  3E2U A;  3TQ7 P;  3OYB A;  3G4S T;  1V1C A;  1VQO T;  2EYZ A;  1M1G A;  1Q7Y U;  1AVZ C;  2C0T A;  2MWO A;  2LRQ A;  2EQM A;  3EH2 A;  3EHQ A;  3MP1 A;  4GLK A;  1O9S A;  2RQU A;  1I0C A;  4C92 A;  4HCK A;  4N0A C;  1K1Z A;  2QTX A;  2LCC A;  3FDR A;  4BDZ A;  2LX7 A;  2RHX A;  1D1B A;  1QLY A;  1WYX A;  4F16 A;  3ER0 A;  2J7I A;  2B86 A;  5GAM f;  4M77 G;  1N6A A;  3CCJ T;  4MDX A;  3ZL7 C;  3CMA T;  2BUD A;  4F7U E;  2O9V A;  4FYW B;  4PJO A;  3CCV Q;  2FZC B;  3TEE A;  3RBB B;  2LNV A;  1SG5 A;  3CBO A;  2X51 A;  1YIJ T;  1UJY A;  1QVF P;  3VRY A;  1KC8 U;  4R56 A;  5GJV B;  4BY6 B;  1SRM A;  4PJN A;  1MMG A;  4KH1 B;  2BE7 D;  3LW5 E;  2DYB A;  2E3I A;  4Z02 A;  1X75 C;  1Q7Y C;  1WZO A;  5KYY B;  5GAO m;  2HD0 A;  5IAY A;  3M0Q A;  3QHS A;  4OMQ A;  3SWN C;  1JJ2 A;  4II1 A;  1VQN T;  2D8J A;  3EGX A;  1JJ2 S;  5GAM h;  3PFS A;  3FC3 A;  5M9O A;  2MI6 A;  1IO6 A;  2BIV A;  2Y90 A;  2DRM A;  3NGP A;  5L8R E;  2HEQ A;  2SRC A;  4DBQ A;  2M51 A;  1PKS A;  2DL8 A;  1S72 Q;  2XD0 A;  2DL4 A;  3QDF A;  1AZE A;  3OYE A;  4Y91 A;  2IIM A;  2DAQ A;  2RJD A;  1D09 B;  4BE0 A;  5FLX E;  1Q81 U;  3ASK A;  3QZ9 B;  5GAM g;  3CME T;  2KXC A;  5KYX B;  5J3B A;  4HXJ A;  1WHH A;  2RQW A;  2J06 A;  2D9T A;  5DM7 R;  1KC8 C;  2JTM A;  4AT1 B;  2DPP B;  2FB7 A;  3TRE A;  3HFN A;  3OS2 A;  1B7T A;  2F69 A;  5D6Y A;  5CIU A;  2NUZ A;  4OMF B;  1UGP B;  2VVK A;  2EQU A;  4ESR A;  2X4W A;  3JCM W;  2DD5 A;  4M77 A;  4ME7 A;  4PLL A;  1D3B A;  2QQR A;  4OMP A;  2BE9 B;  5GAN 2;  5LJ3 j;  2DE0 X;  1OI1 A;  1RUW A;  2A36 A;  2KK4 A;  1VQ5 A;  4GBQ A;  2AKL A;  1TS9 A;  3VS7 A;  2HBP A;  2DKG A;  1Y57 A;  3CPW A;  1KQS A;  1TG0 A;  2X35 A;  3S3M A;  4L6V 5;  4J9G A;  2DA9 A;  1PNJ A;  4LNP A;  4MZP A;  5GAN 7;  2ECZ A;  1KG1 A;  1WLP B;  5HK0 A;  3L2V A;  2BKD N;  4P5N A;  1UG1 A;  3OMG A;  2CSQ A;  3FLG A;  1Q81 C;  1VQ5 Q;  5IXB A;  2KSS A;  2RQV A;  2DXC A;  2EQI A;  3SWN B;  4K11 A;  1YNZ A;  2OTL A;  5C0M A;  1FMV A;  2E12 A;  1UFF A;  1PKT A;  1WDX A;  1QVG P;  2CP5 A;  4C8Q F;  3NMZ C;  1UTI A;  3OMC A;  1MND A;  1ZLM A;  2IPO B;  3C94 A;  4OB2 B;  2KNB B;  4XAX B;  1M8M A;  2R57 A;  3CCR T;  3PNW C;  2OTL Q;  3BY7 A;  2OAW A;  1ZBX A;  2J6O A;  4FCY A;  4N4I A;  3LH5 A;  3G4S A;  1WJQ A;  3Q1J A;  1RAC B;  4RTT A;  3QWY A;  1M27 C;  2JN0 A;  1C1A A;  1Y07 A;  1EZZ B;  1W2B S;  3MCA B;  2YUO A;  3SFM A;  5IXF A;  2OJ2 A;  1M8V A;  4OMM A;  3OYA A;  5CQX A;  5J39 A;  2DNU A;  4XU0 A;  5A0D A;  3G4S Q;  1VQO Q;  4PFP A;  4OP0 A;  1QVF A;  3OYM A;  5CK9 A;  3MPU B;  1BB9 A;  2XU8 A;  4KGX B;  2K5I A;  1ZSZ A;  5GAN d;  3CCJ A;  3OW2 P;  3MET A;  3CMA A;  4C8Q E;  4HCZ A;  3J81 E;  3L1A A;  1AT1 B;  3VKI A;  3M59 A;  2M0O A;  3C4S A;  4XTV A;  4L5G A;  4B9W A;  3X28 B;  3G7Z A;  1VQP T;  2K4Y A;  1YIJ A;  4X34 A;  2FZK B;  2CP0 A;  5KYW A;  4IUU A;  1Q86 U;  1X6B A;  2JM8 A;  2ZZD A;  3CD6 T;  3CMA Q;  2K3X A;  1ACM B;  4NL2 A;  2RM4 A;  1U8R A;  4C92 C;  2RJF A;  2DX1 A;  1E7O A;  2HL3 A;  2RHU A;  1YIJ Q;  3GLX A;  4E7Z A;  5HCK A;  1M1K R;  3OYN A;  3P8B B;  4ZGD B;  3CC4 A;  1JQQ A;  4M78 D;  1NZ9 A;  3OS0 A;  7AT1 B;  4A53 A;  4QVZ A;  1YI2 A;  2JVV A;  3V8K A;  2ENM A;  3JCM f;  3OYJ A;  5KYX A;  5GMK j;  1WGS A;  2HMA A;  3AHU A;  2PVD B;  1M9S A;  3EG1 A;  4QVC A;  1R0C B;  2L8D A;  4PJO D;  1BI0 A;  1UUE A;  3MP8 A;  1VQN Q;  4Z89 A;  2DIG A;  3LWH A;  2L3Q A;  3CME A;  3OA6 A;  2NUP A;  5FRN A;  2W10 A;  3FRN A;  2ROL A;  1JB0 E;  4E7K A;  5J26 A;  2MOX A;  2E6Z A;  2H8H A;  1Q86 C;  4XU1 A;  2LT1 A;  1EX4 A;  2FPD A;  2COY A;  4M75 A;  4XU3 A;  2M0Y A;  3NTI A;  3DB3 A;  1KSW A;  2VXE A;  3M0T A;  4QVD A;  3CCM A;  3RDV A;  1WJR A;  2LC4 A;  4JS4 A;  2XI9 A;  2JMC A;  4KT0 E;  4E2F B;  1W6X A;  1E6H A;  3JCM h;  5CAI A;  1VQ7 A;  1OX8 A;  2KGT A;  4J7F A;  1MV0 B;  2CP7 A;  1QVG A;  1OPK A;  3PE0 A;  1M2V A;  2QGG A;  2FZG B;  4C92 B;  2XMF A;  4AFS C;  3CXC S;  2E65 A;  3E9F A;  4M78 B;  2OAU A;  4FYY B;  5A2Q E;  2E41 A;  3VU3 C;  2COZ A;  2L2P A;  1B34 A;  3VS6 A;  4RTW A;  2MF2 A;  3NHN A;  2ABL A;  1NPP A;  4RTV A;  4PL6 A;  1KIK A;  1N9R A;  3OYH A;  2OTJ Q;  4BI4 A;  3KUF A;  2X4X A;  1OYX A;  5KH6 A;  4M77 C;  2GFU A;  2RI2 A;  4PJO B;  1VUB A;  2A3L A;  2EJG A;  3OSV A;  3CCR A;  1TUD A;  4C5G A;  1CKA A;  2QI2 A;  2ZGW A;  2L5Q A;  4FM4 B;  1M1K U;  2GGR A;  4M7A F;  4FT4 A;  1I5O B;  1Z9Q A;  3I35 A;  1IHV A;  4RCC A;  1K4U S;  4AMC A;  2PNI A;  3A8M B;  2FG0 A;  2MPX C;  1SF9 A;  2LNH B;  1VQ4 T;  3QUI A;  5GAN 5;  3UDC A;  3NTH A;  3CCR Q;  1XOV A;  3OW2 A;  1Q7Y R;  1G83 A;  4EMG A;  3O5Z A;  2HQE A;  3ULR B;  3OW2 S;  3RNJ A;  2JS2 A;  4OGE A;  3HFO A;  3I5S A;  1UGR B;  2DZ9 A;  4XTZ A;  3QYH B;  2H3E B;  4JRI A;  8ATC B;  5CKH A;  1JJ2 P;  3EGX B;  2DXT A;  2VGM A;  3FEO A;  1K73 U;  2EQJ A;  2JM9 A;  1WJS A;  1YP5 A;  2CT3 A;  1GBR A;  1G2B A;  1UGQ B;  1WXB A;  5FRO A;  2D0N A;  2JZ2 A;  4JJB A;  3GP8 A;  2NYS A;  1VQP A;  4C92 G;  4KUD K;  2L0A A;  4N4G A;  1LCK A;  3JV3 A;  2JOY A;  4M78 G;  4OB0 B;  3CD6 A;  1M1K C;  2HBW A;  4M7A E;  1RAA B;  4RTX A;  2M16 A;  1M1F A;  4WCI A;  4HT8 A;  2OX7 A;  1H8K A;  4E7J A;  1T3S A;  2AZS A;  1VQP Q;  2QQ9 A;  1W70 A;  2PQW A;  4PJO G;  3CCS Q;  1GCP A;  4OGC A;  1MMA A;  3JSC A;  4M77 B;  1PSE A;  4LXC A;  3EG0 A;  3MJX A;  1D3B B;  1WNL A;  2P0Q A;  1N5Z A;  1WHL A;  1AHJ B;  4J9I A;  3CBM A;  2RA2 A;  1ZA2 B;  2CZ0 B;  2LTO A;  5GMK m;  1M2O A;  1K9A A;  1YCY A;  4LDU A;  1JU5 C;  1VA7 A;  1I4K 1;  1RI9 A;  4M7D F;  1K73 C;  2IVW A;  3IQL A;  1ZSG A;  1BI1 A;  2XG8 D;  2KXD A;  1D0Z A;  3CC2 T;  2NLU A;  4B6M A;  1YIT T;  1SEM A;  3V8J A;  3QSU A;  1UHC A;  3M53 A;  2DMO A;  2JT4 A;  2YUQ A;  1N9S A;  4JZ4 A;  4RTY A;  1VYT A;  1WI7 A;  4KUL A;  2XIC A;  2QDY B;  3MEU A;  2E5Q A;  2HKN A;  1C0M A;  1PM3 A;  1Q81 R;  3G1J A;  2CZ1 B;  1VQ9 Q;  4ANJ A;  5AT1 B;  2QAS A;  2CKK A;  3E19 A;  1HD3 A;  2V8J A;  3RUX A;  2FEI A;  2D1X A;  2MCN A;  2RK2 A;  4RCB A;  4Z88 A;  1RLQ C;  2E10 A;  3J7A F;  2K57 A;  1OZ3 A;  3L42 A;  1XNI A;  2LJ3 A;  3S6W A;  3VS4 A;  2E3H A;  5GAN f;  4KH0 B;  2K5F A;  2QTV A;  3EAE A;  1YJ9 T;  2EYX A;  2BZ8 A;  3CCV A;  4M78 A;  1NLO C;  2FRW A;  4E47 A;  3TSW A;  1W2B P;  3QII A;  4M7D E;  1X2K A;  4X9C A;  4BI3 A;  2AIR B;  2C0O A;  3OB9 A;  3UT1 A;  4LN2 A;  1HYO A;  2GFA A;  1BBZ A;  3VUZ A;  4HCC A;  2HSP A;  3R6N A;  2O2O A;  2A08 A;  3N5B B;  4O6J A;  3G71 T;  2M9U A;  4A4G A;  2GQI A;  1ZUK A;  1OU8 A;  4M75 D;  3QG1 A;  4BE1 A;  2YRC A;  1ZSZ B;  4IUQ A;  1JEG A;  5GAM j;  2CZ6 B;  4A4K A;  4QT7 A;  6AT1 B;  5GAN h;  2A28 A;  4DA4 A;  2VWF A;  3JCM J;  2GNC A;  4F7U G;  2DZC A;  2PTK A;  3HPW A;  3DKM A;  4B9X A;  1PD0 A;  1VQM Q;  4AFZ C;  1KHI A;  5KYW B;  3RMQ A;  2MWP A;  1LVK A;  1MUZ A;  3DLM A;  2JTF A;  2EYQ A;  1S72 A;  3AT1 B;  3CCU T;  2QDL A;  2LX9 A;  2OI3 A;  1VQ4 A;  4JRK A;  2KI7 A;  5GAN g;  1RI0 A;  3GF5 A;  4PLI A;  3PIP A;  5LJ3 e;  4C8Q D;  2FRY A;  3SDZ A;  1GCQ A;  4J9C A;  2AHJ B;  2JW4 A;  3JB9 D;  3R6O A;  1T3L A;  2DL5 A;  1OU9 A;  3NFC A;  4A4E A;  1UB4 A;  2MAM A;  4PFZ A;  4BAC A;  1VQ4 Q;  3SD4 A;  2V8K A;  3QYG B;  3CC7 Q;  1WIE A;  3QDR B;  1GRI A;  1O75 A;  2YWW A;  9ATC B;  2JNG A;  2DJQ A;  3JCM c;  2ZAE A;  1H64 1;  3NTK A;  3OY9 A;  4OMO A;  5KYU A;  2DLP A;  3M4G A;  2K9G A;  3HRU A;  1U1S A;  2JMA A;  2E5K A;  2NUP B;  2L3S A;  1B3Q A;  1WHJ A;  4A63 B;  4NOY A;  2P0P A;  3LGL A;  1Q86 R;  2DIQ A;  2RF0 A;  4FL6 A;  4M75 B;  1WX6 A;  4FSX A;  5EC7 A;  2CDT A;  2WAC A;  2LP5 A;  2B8A A;  2ZPH B;  3VYG A;  2VGN A;  2DVJ A;  5I11 A;  1BCM A;  1F1B B;  1VYV A;  2CUD A;  3PMI A;  3PTA A;  3A5Z B;  3CCQ T;  2CH4 A;  5GAN 4;  1PG5 B;  4HVV A;  3EFR A;  3CCE T;  2LDM A;  3EFS A;  2YT6 A;  2OTJ T;  2YRD A;  1H3Z A;  3HHT B;  3HKS A;  3HL8 A;  4F7U A;  2CZ7 B;  2RQR A;  3L2R A;  2O01 E;  1K0X A;  3NPF A;  5DY9 A;  2M02 A;  3M0P A;  2DEU A;  3CC2 A;  2DXB A;  4ORZ A;  1AWX A;  1AWO A;  1G8X A;  1M2V B;  3OS5 A;  1P92 A;  1UEC A;  4JJC A;  1UE9 A;  1BYM A;  1VYU A;  2EYW A;  3CXC P;  2DVE A;  2L89 A;  2EYY A;  5CCA A;  2EWN A;  2ZPF B;  1YJW Q;  3JB9 I;  3PMT A;  1B34 B;  1NYF A;  2HAX A;  2PVG B;  4CI0 C;  2KY9 A;  2ZPG B;  3M4Y A;  3CC2 Q;  1YIT Q;  3L2Z A;  1WHM A;  2PUO B;  3A98 A;  2EKO A;  2JUF A;  2GTJ A;  4AG2 C;  1RL2 A;  1VQO A;  3EFO A;  4E7L A;  1W2B A;  1A0N B;  1QW1 A;  2CP6 A;  1GBQ A;  3PVL A;  4EDU A;  2QYZ A;  3MEV A;  2X9H A;  4LDY A;  3LH0 A;  3G6E Q;  2DET A;  1QCN A;  2K7A A;  3CEY A;  3I56 Q;  3U23 A;  4R55 A;  1PSF A;  4PKC C;  1E6G A;  4M75 G;  1WHK A;  2ED0 A;  2LZ6 B;  4C0F A;  1T0H A;  2K3B A;  2DYI A;  1OPL A;  1QMC A;  2X3W D;  1WHG A;  3SEM A;  1I07 A;  2XDB A;  4LD6 A;  1YJ9 Q;  3I9Q A;  5GMK e;  2RN8 A;  3S3O A;  4F17 A;  3G71 A;  4IKF A;  1TTH B;  4OB1 B;  3A8O B;  1U5S A;  1QKW A;  1FMK A;  2O4X B;  3CCS T;  3EGU A;  1TOV A;  1ZBJ A;  1HJD A;  3BDL A;  3DB4 A;  4PJM A;  1M3B A;  2XID A;  4IIO A;  4BD3 A;  4C8Q G;  5GAO l;  2F2X A;  5KCO A;  4AFU C;  3G71 Q;  3JB9 G;  2A37 A;  2K2M A;  1KFZ A;  4NL3 A;  1Y71 A;  4E6R A;  4M78 C;  2LJ0 A;  3CCU A;  1VQL Q;  1I1J A;  1QQJ A;  1VQN A;  1VQ8 T;  3M0R A;  1N27 A;  1NYG A;  1W4S A;  4XTW A;  5CKE A;  2DTO A;  2Y4Y A;  2XK0 A;  4LE9 A;  5LL6 S;  5I2S A;  1VQ9 T;  4TVR A;  1K9M U;  2HQH A;  4IIM A;  4PJO C;  3BW1 A;  1H3H A;  1XQH A;  2JJ9 A;  4JRQ A;  1FXX A;  1K8A R;  4PJJ A;  3CCU Q;  2LQ8 A;  4J6W A;  2LCS A;  2QEX T;  1RAE B;  1UHF A;  2F1L A;  4J6X A;  5LJ5 f;  1PCX A;  1VQK T;  3GPL A;  1RAB B;  1NEG A;  2O31 A;  3C12 A;  4M7A D;  2CS7 A;  1PWT A;  1K73 R;  4JJN K;  1SPK A;  2RK1 A;  5IHK A;  2RD1 A;  1OV3 A;  1OEB A;  4JUV A;  4RTZ A;  2MK5 A;  4N4H A;  4EPC A;  2HNI A;  3M5A A;  4QW2 A;  3M9Q A;  3C0C A;  4HT9 A;  2H3J A;  1MGQ A;  3OBY A;  4HA8 A;  3A8G B;  2HKQ B;  1YJN T;  2CRE A;  1OZ2 A;  4J9D A;  3RR6 A;  4ELZ C;  4NS5 A;  2DEQ A;  3QJY A;  1N8R R;  2DBK A;  1GCQ C;  4ZGE B;  4E7I A;  1OX9 A;  2E1H A;  1ZA1 B;  3QXE B;  2P4R A;  2EQK A;  3LYI A;  5LJ5 h;  3TU4 K;  1YHQ T;  4PNO A;  1K9M C;  5KCH A;  3LGF A;  2OTJ A;  3CXC A;  4C8Q A;  2DIL A;  4MZM A;  1JO8 A;  5ECA A;  5LJ3 d;  3JCM g;  4R0K A;  5FRM A;  1LNX A;  1R8O B;  2DF6 A;  1I5L A;  2SEM A;  3CCQ Q;  5IN1 A;  1VQM T;  1KJW A;  1WQ7 A;  5LJ5 g;  2L3R A;  5IHI A;  3CCE Q;  5FU6 C;  5A0G A;  3V7C A;  5IT9 E;  3ME9 A;  1J3T A;  4C92 F;  4BE2 A;  4CC4 B;  2LQN A;  3HSB A;  2KRO A;  1UJ0 A;  2FPF A;  4M78 F;  4QQG A;  2DER A;  2DJZ A;  1K0S A;  3L2U A;  4DBR A;  3H9N A;  2YUP A;  1KQ2 A;  3M0S A;  2ZPE B;  1X69 A;  3ZEH A;  1X6O A;  2KBT A;  1LJO A;  4EIK A;  4IUV A;  2A0F B;  4M7D D;  4OML A;  1YWO A;  2RPN A;  4PJO F;  1YBY A;  3GNG A;  1FYN A;  4E7S A;  4CC2 A;  1SHG A;  5GAO p;  3P8H A;  3CC7 T;  1Y96 A;  1H92 A;  1BK2 A;  1K8A U;  2DD4 A;  2RH2 A;  1GFC A;  3OS1 A;  3PVQ A;  5I21 A;  1IHW A;  2EGC A;  2W0Z A;  2ATC B;  3A8L B;  3F70 A;  4L59 A;  2O4X A;  2XHC A;  4UC4 A;  2CH4 W;  1JRI A;  2HZY A;  4C92 E;  2YRV A;  2KYM A;  1U06 A;  5GJW B;  2FPE A;  4XTU A;  4MML A;  1EIF A;  3EG9 A;  4J5Y A;  3CCS A;  1QP3 A;  4IUR A;  3O8V A;  1QVP A;  4J83 A;  4KUI A;  1VIE A;  2RQT A;  1W1F A;  3RES A;  2ED1 A;  4VUB A;  2QA4 T;  1N8R U;  3I55 T;  5KYU B;  1WQW A;  1Q82 U;  4Z8A A;  1ZX6 A;  2V26 A;  2A7Y A;  2COW A;  5FU6 B;  4KGV B;  1M4Z A;  2ZPB B;  1RAG B;  1TSF A;  2Y4X A;  5CKB A;  1AOJ A;  1WXU A;  1VQ8 A;  2YLC A;  1K8A C;  2RMO A;  4EMK A;  2LCL A;  3I5R A;  3V7S A;  3BE3 A;  1PRL C;  1U1T A;  1ZSZ C;  3H41 A;  5EG2 A;  1BKB A;  3GIB A;  3TCJ A;  4LD9 K;  2LT4 A;  1VQ9 A;  1YJW T;  2NUT A;  2IG0 A;  1UEB A;  4XK8 E;  3ZBD A;  4GLM A;  2QEX A;  4J9H A;  1NM7 A;  4M77 F;  3JCM V;  1VQ8 Q;  1D1C A;  1QCO A;  2KQW A;  1R0B G;  3RKX A;  2VYT A;  4F7U B;  2RHI A;  2X4J A;  3VRZ A;  2ROT A;  2JXB A;  2L3P A;  3EGD B;  2RJE A;  3E1S A;  3G6E T;  1SKU B;  3URG A;  3I56 T;  2HSE B;  3WXM B;  2QEX Q;  1VQ6 T;  2DRK A;  2LQW A;  2BZY A;  1N8R C;  2G6F X;  1VQK Q;  1Q82 C;  3VUB A;  4JRP A;  4RMO A;  4C0D C;  5GAM e;  1NG2 A;  3JAM E;  1BI2 A;  4GY5 A;  4BI8 B;  3JCM X;  4JJD A;  3H0F A;  1IGQ A;  1QKX A;  4CC7 A;  2CUB A;  4OMN A;  2D0Q B;  3S3N A;  4XTX A;  1TU0 B;  2DL7 A;  3EFO B;  1M90 U;  3EG2 A;  4DQ2 A;  1MMD A;  2QQB A;  4XQ3 A;  3H6Z A;  3DLL A;  1YFN A;  1YHQ A;  3QPH A;  4JPB W;  3UAT A;  2YXY A;  1BU1 A;  2RI5 A;  1YJN Q;  5GAN j;  2LQK A;  4M77 E;  1I81 A;  3D7S B;  3FB9 A;  3M58 A;  2EGE A;  1AWJ A;  4M75 C;  1VIF A;  4ZGJ B;  1EFN A;  1VQM A;  1RLP C;  4F14 A;  4J7I A;  1B07 A;  1YHQ Q;  4M7D G;  1X43 A;  1IRX A;  3JB9 J;  2ZCF B;  4M7A A;  5DLQ E;  1VQL T;  4RTU A;  1UDL A;  2DFU A;  3VS3 A;  2YDL A;  3RKW A;  1BI3 A;  1V76 A;  4V2S A;  2R58 A;  1IZ6 A;  3FIF A;  2PVO B;  1UGV A;  1WPY A;  2EVR A;  1G3S A;  1M90 C;  4C8Q C;  1T0J A;  2YLB A;  3CC7 A;  2XDD A;  3LX7 A;  2PU9 B;  2J6K A;  1U3O A;  4FSS A;  3M55 A;  1TH7 A;  2VAS A;  3PT9 A;  1NJI R;  4J9E A;  2HL5 C;  4C0D B;  4IUP A;  1FMW A;  3EG3 A;  4BDY A;  2G3R A;  3CC4 T;  2KRN A;  5KE2 A;  3CQT A;  4KBM B;  1YWP A;  2YSQ A;  2LJ1 A;  3UA7 A;  2KYB A;  2GCX A;  3X24 B;  1YI2 T;  2MIO A;  2WSE E;  2WSF E;  5DLO A;  2KE9 A;  2R5A A;  3INZ A;  3RKY A;  4F04 B;  3MKD A;  1RAF B;  4CC3 A;  1X6G A;  3OSS C;  1GFD A;  1NLP C;  4DBH A;  3M57 A;  2QA4 A;  2EPD A;  2CT4 A;  5LJ3 f;  3TSZ A;  3I55 A;  1ARK A;  4MDW A;  4M7D A;  1Q95 G;  1JXO A;  3MP6 A;  2E6N A;  5FU7 C;  4OVA A;  2AT1 B;  3CCM T;  2J05 A;  5GMK l;  3OYC A;  1WA7 A;  1QP2 A;  2KT8 A;  5D7U A;  2QA4 Q;  3LWI A;  2J6F A;  2RI3 A;  4M75 F;  3I55 Q;  1HXD A;  1D0X A;  3HP9 A;  2DK3 A;  1YJW A;  3T9N A;  3A1P A;  5A0L A;  1VQ7 T;  5FW9 A;  1HSQ A;  1K76 A;  3GNF B;  1PRM C;  3EGD A;  3OYY A;  1YIT A;  2V1R A;  4WTO B;  1K9M R;  5IHN A;  3CPW S;  1KQS S;  4C8Q B;  4DOV A;  1ZUY A;  2KR3 A;  2F5K A;  4KRT A;  1SSF A;  5I22 A;  3KFV A;  4ZTJ A;  3OYF A;  4WF2 A;  1D0Y A;  2DTI A;  4D8D A;  5LJ3 h;  4FYX B;  2QGF B;  5KE3 A;  3G6E A;  3GOX A;  3RMS A;  3I56 A;  1TXQ A;  1MHN A;  1VQ6 A;  2JTE A;  5FWB A;  2HQX A;  5KYN A;  1CSK A;  4A54 A;  4QQD A;  4RKU E;  1V29 B;  3JB9 F;  2EKH A;  4IUT A;  4EMK C;  3H0I A;  2DBM A;  3L2W A;  4ZN3 A;  3QWX X;  5LJ3 g;  1UGS B;  1G3Y A;  2GQV A;  1NJI U;  2F2V A;  1NE8 A;  2I0N A;  2RO0 A;  4CRI A;  3QZ5 B;  1YJ9 A;  4ATO A;  1VQ6 Q;  3JCM P;  2GTO A;  4M75 E;  2KEA A;  3OYD A;  3OYI A;  2DM1 A;  1PC0 A;  1Y7X A;  2XKO C;  5FWC A;  4LDW A;  2EGA A;  2KRS A;  2DL3 A;  2QQS A;  5I2M A;  1Y96 B;  1SHF A;  2RJC A;  4FIB A;  5GAO r;  5D6X A;  1KHC A;  2C0I A;  1GL5 A;  2ZPI B;  3BDU A;  1M5Q 1;  5FU7 B;  5AYF A;  2KAF A;  1QWE A;  2KDS A;  2VKN A;  1CKB A;  1TWB A;  1PD1 A;  1JBM A;  2DXU A;  1VQL A;  1ZQ1 A;  4PK4 A;  1QVF S;  2K5L A;  2E4H A;  2FO0 A;  3QBY A;  3JCM e;  4D6W A;  2RHZ A;  2E70 A;  3JB9 H;  3RIR A;  1SRL A;  3KBG A;  1BCO A;  3V7R A;  4A4F A;  2EW3 A;  3EG9 B;  4J9B A;  3J80 E;  1OUL A;  4ZNX A;  4C0Z A;  2FVU A;  2FYK A;  1R77 A;  4Y92 A;  5KYY A;  1KQ1 A;  5LJ5 e;  2CSI A;  1NJI C;  2WSC E;  1KD1 R;  1C6V X;  3CCJ Q;  5GAM d;  3M56 A;  2HCK A;  2VC8 A;  1AEY A;  2QAZ A;  2MYS A;  3V8L A;  1LPL A;  4FW2 A;  2RNA A;  1XJW B;  4C92 D;  4HVW A;  4BB7 A;  3PIO A;  4XU2 A;  4HKE A;  4EMK B;  3X26 B;  2PUK B;  1VOM A;  4XTY A;  4M7A C;  3QO3 A;  4ZTF A;  1SSH A;  2EIF A;  2KVQ G;  2NUT B;  1OQK A;  3HRT A;  3M0U A;  3CCL T;  5CQY A;  1ZHI A;  3MHX A;  1WFW A;  4N0A A;  1MV3 A;  2EJF A;  3CC4 Q; 
#chains in the Genus database with same CATH homology
 4M75 D;  3QG1 A;  3CCS A;  4J5Y A;  4BE1 A;  2C06 A;  1QP3 A;  4IUR A;  3O8V A;  4C8Q F;  5LJ5 j;  4IUQ A;  3OMC A;  2K3Y A;  3C94 A;  1QVP A;  4OB2 B;  2CZ6 B;  5GAM j;  4J83 A;  4A4K A;  4KUI A;  3UWN A;  1VIE A;  4XAX B;  5GAN h;  4DA4 A;  3RES A;  3JCM J;  4VUB A;  3P8D A;  2VUB A;  3X20 B;  1YJN A;  2QA4 T;  2R57 A;  2DZC A;  3HPW A;  4F7U G;  3CCR T;  1N8R U;  3DKM A;  4B9X A;  3PNW C;  3I55 T;  1WQW A;  1Q82 U;  5GMK h;  2MMP A;  3BY7 A;  1ZBX A;  2A7Y A;  1KHI A;  3RMQ A;  2MWP A;  5FU6 B;  4N4I A;  2DO3 A;  1M4Z A;  2ZPB B;  2JTF A;  2EYQ A;  2Y4X A;  3DLM A;  3G4S A;  4JLG A;  1S72 A;  1WJQ A;  3CCQ A;  4PJO B;  3Q1J A;  5CKB A;  3CCU T;  1VQ8 A;  3RER A;  1GXI E;  2YLC A;  1K8A C;  2LX9 A;  2JN0 A;  4EMK A;  2LCL A;  1Y07 A;  3V7S A;  3CCE A;  4JRK A;  1VQ4 A;  1W2B S;  5GAN g;  1RI0 A;  3MCA B;  1HK9 A;  3GF5 A;  1U1T A;  4PLI A;  5EG2 A;  3SFM A;  3PIP A;  5LJ3 e;  1BKB A;  3GIB A;  3TCJ A;  4LD9 K;  4LDX A;  4RG8 A;  2LT4 A;  1M8V A;  4C8Q D;  4OB3 B;  1VQ9 A;  1YJW T;  5GAN 6;  3SB2 A;  3SDZ A;  2QXF A;  2IG0 A;  5CQX A;  5J39 A;  3OYA A;  2R5M A;  1UEB A;  2AHJ B;  3CBP A;  3JB9 D;  4XK8 E;  2M1H A;  4XU0 A;  3ZBD A;  3R6O A;  5A0D A;  3CCV T;  3NFC A;  3SWN A;  4A4E A;  2QEX A;  1UB4 A;  4M77 F;  2MAM A;  3JCM V;  3JCM b;  3VV0 A;  2KQW A;  4OP0 A;  1QVF A;  3OYM A;  5CK9 A;  4BAC A;  3RKX A;  2FL7 A;  2VYT A;  3KXT A;  3SD4 A;  4F7U B;  1QVG S;  2RHI A;  2QQA A;  2X4J A;  2XU8 A;  2K5I A;  2V8K A;  3QYG B;  5GAN d;  4EMH A;  3CCJ A;  1LOJ A;  3MET A;  3CMA A;  3L2Q A;  3QDR B;  1O75 A;  4C8Q E;  4FT2 A;  4MMK A;  4HCZ A;  2JNG A;  3JCM c;  3JRZ A;  3J81 E;  3MO8 A;  3L1A A;  1DJ7 B;  3VJP A;  2RJE A;  3VKI A;  1H64 1;  3E1S A;  3G6E T;  3M59 A;  3NTK A;  5C6S A;  4J6Y A;  2M0O A;  3C4S A;  3OY9 A;  4XTV A;  4L5G A;  4B9W A;  3X28 B;  2X4Y A;  3G7Z A;  3URG A;  3I56 T;  2K4Y A;  1VQP T;  3WXM B;  4BUG A;  1YIJ A;  1KD1 U;  4RG2 A;  3M4G A;  4X34 A;  3HRU A;  4M7A B;  1U1S A;  4C5I A;  5GAN 3;  1VQ6 T;  4M7D C;  1N8R C;  4IUU A;  1Q86 U;  5CVI A;  1Q82 C;  3VUB A;  4C5E A;  4RMO A;  4JRP A;  4C0D C;  2ZZD A;  5GAM e;  4NOY A;  2P0P A;  3CD6 T;  3JAM E;  3LGL A;  1BI2 A;  2K3X A;  2DIQ A;  4GY5 A;  4FL6 A;  4BI8 B;  4M75 B;  4FSX A;  4NL2 A;  4M77 D;  3WVE B;  3JCM X;  2EAY A;  2YHT A;  2WAC A;  4X9D A;  2RM4 A;  5HKC A;  2ZPH B;  2B8A A;  1U8R A;  2D0Q B;  4C92 C;  1G5V A;  2RJF A;  3A8H B;  4E7H A;  3VYG A;  2VGN A;  3S3N A;  2RHU A;  3JCM Q;  2EJ9 A;  4XTX A;  3GLX A;  3MEA A;  1M90 U;  4DQ2 A;  3OYN A;  1S72 T;  3PMI A;  2QQB A;  2P4T A;  3A5Z B;  3P8B B;  3H6Z A;  4XQ3 A;  4ZGD B;  3PTA A;  2VXF A;  3DLL A;  5GAN 4;  3OBW A;  2RB6 A;  3CCQ T;  4M78 D;  1YHQ A;  1NZ9 A;  3OS0 A;  3EFR A;  3QPH A;  3OYG A;  4A53 A;  3CCE T;  2LDM A;  3EFS A;  2RI5 A;  4QVZ A;  5GAN j;  2OTJ T;  3FJP A;  1YI2 A;  2JVV A;  2LQK A;  1H3Z A;  4M77 E;  3HHT B;  3HKS A;  3HL8 A;  3V8K A;  2CZ7 B;  4Q5W A;  4F7U A;  4YTL A;  1I81 A;  3JCM f;  1G3T A;  3OYJ A;  5CKD A;  5GMK j;  4OF1 A;  3FB9 A;  3L2R A;  1I8F A;  2O01 E;  3M58 A;  3HRS A;  2CYZ B;  5DY9 A;  1WGS A;  3M54 A;  3CC2 A;  4M75 C;  3QJ6 A;  3AHU A;  2PVD B;  1M9S A;  1VIF A;  2DXB A;  4ZGJ B;  4QVC A;  2L8D A;  1VQM A;  4PJO D;  1BI0 A;  3MP8 A;  4J7I A;  4ELY C;  2DIG A;  4M78 E;  5HY6 A;  3OS5 A;  4M7D G;  3LWH A;  1P92 A;  3JB9 J;  5HK3 A;  3CME A;  2ZCF B;  2GF7 A;  4M7A A;  3H8Z A;  5DLQ E;  3OA6 A;  4JS5 A;  1VQL T;  1BYM A;  5FRN A;  3FRN A;  2DVE A;  3LLR A;  2I2L A;  2L89 A;  1KD1 C;  4Y28 E;  5CCA A;  2EWN A;  1JB0 E;  2ZPF B;  5J26 A;  3PGG A;  4E7K A;  2D6F A;  3JB9 I;  2EFI A;  3E9G A;  2E6Z A;  3PMT A;  1Q86 C;  4XU1 A;  1B34 B;  2LT1 A;  2CGH A;  2HAX A;  2PVG B;  1BIB A;  2KY9 A;  4CI0 C;  4JDS A;  2ZPG B;  3OQ5 A;  4M75 A;  3M4Y A;  3RKW A;  1BI3 A;  4XU3 A;  4C5H A;  4V2S A;  3NTI A;  1BIA A;  3L2Z A;  3DB3 A;  2VXE A;  4PJO E;  2PUO B;  2R58 A;  2EKO A;  2JUF A;  2K2V A;  1XTD A;  1VQO A;  1RL2 A;  1IZ6 A;  3FIF A;  4QVD A;  3ZFJ A;  4E7L A;  3CCM A;  2PVO B;  1W2B A;  1WJR A;  1WPY A;  2LC4 A;  1QW1 A;  4ZN1 A;  4JS4 A;  2XI9 A;  3CPF A;  4M7A G;  4KT0 E;  4EDU A;  5GMK i;  1G3S A;  1M90 C;  5D6W A;  3MEV A;  4C8Q C;  2YLB A;  4LDY A;  1FWZ A;  3LH0 A;  3CC7 A;  3JCM h;  2XDD A;  4JLI A;  3LX7 A;  3CEY A;  5CAI A;  2PU9 B;  4DOW A;  1VQ7 A;  4R55 A;  1PSF A;  4M7D B;  3M55 A;  2KMT A;  1TH7 A;  4PKC C;  3PT9 A;  3X25 B;  1VQ5 T;  3BFM A;  4J7F A;  1FX7 A;  5GAO n;  4M75 G;  4C0D B;  1NPR A;  3CC4 A;  4IUP A;  4A4H A;  4C0F A;  5CO7 A;  1QVG A;  3MEW A;  4BDY A;  2G3R A;  3CC4 T;  5KE2 A;  5GAN 8;  4J8O A;  3VYH B;  4KBM B;  4LDV A;  1VQK A;  4QQ6 A;  2GCX A;  5GAN e;  3X24 B;  4C92 B;  1YI2 T;  2WSE E;  4BY6 C;  2WSF E;  5DLO A;  3CXC S;  2E65 A;  2XDB A;  2R5A A;  3CCL A;  3E9F A;  4C0G A;  4LD6 A;  2LVM A;  4M78 B;  1G3W A;  3INZ A;  5GMK e;  2OAU A;  3RKY A;  5CKF A;  5A2Q E;  2E41 A;  3S3O A;  3VU3 C;  3G71 A;  5CR2 A;  4IKF A;  1B34 A;  2V8I A;  3OYK A;  1IRE B;  2RHY A;  4OB1 B;  2MF2 A;  2OTL T;  3A8O B;  4FU6 A;  1NPP A;  4PL6 A;  3OSS C;  3OYL A;  5GAO q;  1N9R A;  2O4X B;  3CCS T;  3OYH A;  2E64 A;  4F7U F;  2FHD A;  2P0K A;  4BI4 A;  3KUF A;  2F5T X;  2X4X A;  3M57 A;  1OYX A;  5KH6 A;  4M77 C;  2GFU A;  3BDL A;  3DB4 A;  1X01 A;  2RI2 A;  2XID A;  3C95 A;  4BD3 A;  1VUB A;  2A3L A;  2EJG A;  3OSV A;  4C8Q G;  5GAO l;  3CCR A;  2QA4 A;  5KCO A;  5LJ3 f;  4C5G A;  3I55 A;  4MZT A;  2QI2 A;  3WVD B;  3UPU A;  3JB9 G;  2ZGW A;  2L5Q A;  3QKJ A;  4FM4 B;  1M1K U;  4O5V A;  2XDP A;  2VV5 A;  4HCB A;  4M7A F;  4FT4 A;  4MDW A;  1Y71 A;  4NL3 A;  4M7D A;  4M78 C;  2DTH A;  5LJ5 d;  3MP6 A;  3CCU A;  2E6N A;  4RCC A;  5FU7 C;  4OVA A;  3OYB A;  3G4S T;  1VQO T;  1VQN A;  3A8M B;  3CCM T;  1VQ8 T;  5GMK l;  1M1G A;  3OYC A;  1Q7Y U;  2MWO A;  1QP2 A;  2LRQ A;  1VQ4 T;  3QUI A;  1N27 A;  2EQM A;  5GAN 5;  3UDC A;  1W4S A;  3NTH A;  4XTW A;  2RI3 A;  3MP1 A;  1XOV A;  4GLK A;  4M75 F;  5CKE A;  1O9S A;  3LWI A;  3OW2 A;  1HXD A;  2DTO A;  2Y4Y A;  2XK0 A;  2DK3 A;  3HP9 A;  5LL6 S;  4EMG A;  5I2S A;  2HQE A;  4C92 A;  1YJW A;  3T9N A;  3OW2 S;  5A0L A;  1VQ9 T;  4TVR A;  1VQ7 T;  1K9M U;  3HFO A;  4OGE A;  3GNF B;  1UGR B;  4PJO C;  3BW1 A;  1XQH A;  3OYY A;  4N0A C;  1FXX A;  2DZ9 A;  4XTZ A;  4JRQ A;  3QYH B;  1YIT A;  4JRI A;  2LQ8 A;  4J6W A;  5CKH A;  2QTX A;  2QEX T;  2LCC A;  2DXT A;  3FDR A;  3CPW S;  4C8Q B;  4BDZ A;  2RHX A;  4DOV A;  1KQS S;  4J6X A;  2VGM A;  2F5K A;  5LJ5 f;  3FEO A;  1K73 U;  1SSF A;  1VQK T;  2EQJ A;  3ER0 A;  3GPL A;  1WJS A;  5GAM f;  4ZTJ A;  3C12 A;  4M77 G;  1N6A A;  3CCJ T;  4M7A D;  3OYF A;  4WF2 A;  2CS7 A;  2DTI A;  1UGQ B;  4MDX A;  3JCM d;  5FRO A;  4JJN K;  3CMA T;  5LJ3 h;  2RK1 A;  2JZ2 A;  2BUD A;  4F7U E;  5KE3 A;  3G6E A;  3GOX A;  3RMS A;  4PJO A;  2RD1 A;  3GP8 A;  1VQP A;  3I56 A;  3TEE A;  4C92 G;  4KUD K;  2LNV A;  4JUV A;  1MHN A;  1VQ6 A;  4N4H A;  4N4G A;  3CBO A;  4EPC A;  2HNI A;  2HQX A;  1YIJ T;  2JOY A;  3M5A A;  4M78 G;  4OB0 B;  4QW2 A;  3M9Q A;  1KC8 U;  4R56 A;  4BY6 B;  4A54 A;  4QQD A;  4HT9 A;  4RKU E;  3CD6 A;  1V29 B;  1M1K C;  2H3J A;  3JB9 F;  4IUT A;  4M7A E;  4EMK C;  1MGQ A;  3L2W A;  4ZN3 A;  3OBY A;  4HA8 A;  3A8G B;  3LW5 E;  2M16 A;  1UGS B;  5LJ3 g;  1G3Y A;  1YJN T;  1M1F A;  1OZ2 A;  4ELZ C;  4HT8 A;  2GQV A;  4E7J A;  4Z02 A;  1NJI U;  1X75 C;  4NS5 A;  1NE8 A;  2RO0 A;  2DEQ A;  4CRI A;  3QJY A;  3QZ5 B;  1YJ9 A;  1Q7Y C;  4ATO A;  5GAO m;  2QQ9 A;  2HD0 A;  3JCM P;  2PQW A;  4ZGE B;  5IAY A;  4PJO G;  4M75 E;  4E7I A;  2E1H A;  3QHS A;  3QXE B;  4OGC A;  3OYD A;  3SWN C;  1JJ2 A;  4M77 B;  3JSC A;  3OYI A;  1PSE A;  2EQK A;  1Y7X A;  3LYI A;  4II1 A;  1D3B B;  5LJ5 h;  3TU4 K;  1VQN T;  1WNL A;  2P0Q A;  1YHQ T;  2XKO C;  4PNO A;  5KCH A;  3LGF A;  4LDW A;  1K9M C;  2QQS A;  1JJ2 S;  2OTJ A;  1AHJ B;  5I2M A;  5GAM h;  3PFS A;  3FC3 A;  3CBM A;  3CXC A;  4C8Q A;  2MI6 A;  5M9O A;  1Y96 B;  2RA2 A;  2BIV A;  4MZM A;  2RJC A;  2Y90 A;  4FIB A;  2CZ0 B;  2LTO A;  5LJ3 d;  5GMK m;  5GAO r;  5L8R E;  5D6X A;  3JCM g;  5FRM A;  1KHC A;  1YCY A;  4LDU A;  1LNX A;  2ZPI B;  1I4K 1;  3BDU A;  4M7D F;  1K73 C;  1R8O B;  2IVW A;  1BI1 A;  1I5L A;  1M5Q 1;  2XG8 D;  5FU7 B;  5AYF A;  2KAF A;  2KDS A;  3CC2 T;  2NLU A;  1YIT T;  5IN1 A;  2XD0 A;  3V8J A;  3QSU A;  1VQM T;  3OYE A;  1WQ7 A;  4Y91 A;  3M53 A;  5LJ5 g;  1JBM A;  2DAQ A;  2DXU A;  2L3R A;  2RJD A;  1VQL A;  4BE0 A;  1N9S A;  1ZQ1 A;  5FU6 C;  5FLX E;  3ASK A;  1Q81 U;  5A0G A;  3QZ9 B;  3V7C A;  5GAM g;  4KUL A;  3ME9 A;  3CME T;  5IT9 E;  1QVF S;  2K5L A;  2XIC A;  2QDY B;  3MEU A;  4C92 F;  2E5Q A;  4BE2 A;  5J3B A;  3QBY A;  3JCM e;  4D6W A;  2CZ1 B;  2D9T A;  3HSB A;  2RHZ A;  2E70 A;  5DM7 R;  3JB9 H;  3RIR A;  1KC8 C;  4M78 F;  4QQG A;  2JTM A;  3KBG A;  2DJZ A;  2DPP B;  2CKK A;  3L2U A;  2FB7 A;  3E19 A;  3TRE A;  2V8J A;  3HFN A;  3V7R A;  4A4F A;  3RUX A;  3J80 E;  3OS2 A;  4C0Z A;  1KQ2 A;  2FVU A;  2F69 A;  2FYK A;  2RK2 A;  4RCB A;  5D6Y A;  5CIU A;  2ZPE B;  1KQ1 A;  4OMF B;  3ZEH A;  1UGP B;  1X6O A;  5LJ5 e;  1NJI C;  2E10 A;  1LJO A;  2WSC E;  3J7A F;  4IUV A;  2K57 A;  2EQU A;  1OZ3 A;  3L42 A;  4M7D D;  5GAM d;  2X4W A;  3M56 A;  3JCM W;  2DD5 A;  4M77 A;  1XNI A;  4ME7 A;  3S6W A;  2VC8 A;  1D3B A;  2QQR A;  4PLL A;  4PJO F;  1YBY A;  3GNG A;  5GAN f;  5LJ3 j;  5GAN 2;  1OI1 A;  5GAO p;  3V8L A;  3P8H A;  3CC7 T;  1Y96 A;  2K5F A;  2KK4 A;  3EAE A;  1K8A U;  1YJ9 T;  1VQ5 A;  2DD4 A;  2RH2 A;  4C92 D;  2HBP A;  3CCV A;  4M78 A;  3OS1 A;  2DKG A;  4BB7 A;  3CPW A;  5I21 A;  4XU2 A;  3PIO A;  1KQS A;  4E47 A;  4HKE A;  2X35 A;  3S3M A;  4EMK B;  4L6V 5;  3QII A;  4M7D E;  3X26 B;  3A8L B;  3F70 A;  2PUK B;  4XTY A;  4X9C A;  4M7A C;  4L59 A;  3QO3 A;  4BI3 A;  3UT1 A;  4MZP A;  3OB9 A;  5GAN 7;  1KG1 A;  4ZTF A;  2O4X A;  2EIF A;  2KVQ G;  2XHC A;  4UC4 A;  5HK0 A;  3L2V A;  2GFA A;  3VUZ A;  3HRT A;  2BKD N;  4P5N A;  4HCC A;  1JRI A;  3OMG A;  3FLG A;  5CQY A;  3CCL T;  1ZHI A;  3MHX A;  1Q81 C;  2KSS A;  2DXC A;  3SWN B;  4C92 E;  2OTL A;  2YRV A;  4N0A A;  3N5B B;  4O6J A;  3G71 T;  5C0M A;  2EJF A;  2M9U A;  2E12 A;  4A4G A;  4XTU A;  4MML A;  1EIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...