4M78F

Crystal structure of lsm2-8 complex, space group p21
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
65
Chain Sequence
ILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 10
structure length 65
sequence length 79
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78F00
2EJ9A 5GANd 5GAN3 4M78A 4M7DB 3V7RA 3VU3C 2DJZA 4QVDA 3FB9A 2RA2A 4M77D 4M77E 5DY9A 4XU0A 4J6XA 5GAOl 3JCMh 3JCMe 4M75E 4M77B 3JB9G 4M75F 5GAOn 4PJOA 5GAMf 4HA8A 4X9DA 5GAMd 4M7DG 3V8KA 4EMGA 5I21A 3JCMJ 4PNOA 4EMKC 2ZGWA 3BFMA 3BW1A 1BIAA 4M77G 2E41A 3V7CA 2YHTA 4EMKB 1LOJA 4WF2A 4RCCA 5GAOr 1I5LA 5LJ5h 1Y96B 4C8QD 5LJ5e 5GANg 3JCMV 4M7AC 1B34B 4C8QB 4M7DD 4N0AA 1LNXA 1N9RA 5LJ3h 5LJ3e 3JB9J 3FJPA 4C92A 5LJ3j 3QSUA 4M78C 1WPYA 3INZA 4C92F 4M7DA 2DKGA 4DQ2A 5GAMg 3QUIA 4C8QG 3JB9F 1HK9A 2Y90A 2VXFA 4J6YA 3RKYA 4M7DF 3JCMP 3GIBA 2FB7A 4PJOC 1JRIA 1U1TA 4M75A 4M77F 5GAOq 3HSBA 1U1SA 1D3BB 3V7SA 5GAN7 5GANj 5GAN8 1I81A 3RKWA 1WNLA 3L1AA 4QVCA 3JCMW 3JB9H 5LJ3d 5GAN5 2HNIA 1HXDA 1BIBA 4F7UE 2DZ9A 2CGHA 2FYKA 2E1HA 4JLIA 1X01A 4C8QE 4F7UB 3EFSA 3L2ZA 5GAMj 4V2SA 3RKXA 3SWNA 4M7AE 4C8QF 4J6WA 4M7AD 1M5Q1 3JCMc 4M7AB 1I4K1 2I2LA 3V8JA 5GAOp 1WQ7A 3JCMf 4M78E 4M78D 4XQ3A 4F7UG 3JCMd 3SB2A 4X9CA 4M78B 2DXTA 4M75C 2EWNA 3V8LA 4M7AG 4Y91A 2RM4A 4M77A 1LJOA 3AHUA 2E65A 5GANe 5GANh 4PJOD 5GMKe 4OP0A 5CAIA 4A53A 4PJOB 4JUVA 4XTXA 2DZCA 4M78G 2E10A 2E64A 2YLBA 4XU3A 3EFRA 5LJ5f 5LJ5d 2EJFA 4XTYA 4XTZA 5GMKj 5GAMe 4EMKA 2QTXA 5LJ3f 4PJOG 1MGQA 1Y96A 3SWNC 3JCMg 5GAN4 4XU2A 4JRKA 4N0AC 1B34A 4XU1A 4C8QA 1TH7A 4MMLA 1YCYA 2JN0A 3BDUA 4C92C 4C92D 2RB6A 4F7UF 4XTVA 4A54A 2DTHA 3QO3A 4C92B 3RERA 4M7AF 4M7DC 3FIFA 4NL3A 1KQ1A 2DTOA 3M4GA 2DVEA 5GAN6 2YLCA 2K57A 2DTIA 2DEQA 4M77C 5GMKi 4HT9A 4M78F 1JBMA 3RUXA 5LJ5g 2VC8A 4M75D 4C92G 2EJGA 3JCMQ 4M75B 1M8VA 5LJ3g 1KQ2A 4MMKA 5GMKh 5GMKl 5GAOm 3HFNA 4PJOE 1WQWA 1D3BA 1I8FA 2RD1A 4PJOF 3RIRA 3JCMX 2DXUA 5GAN2 4M75G 4J5YA 5GMKm 5GAMh 4C8QC 1N9SA 4JRIA 3PGGA 4EMHA 3QHSA 3JB9I 3RESA 3HFOA 2VXEA 4F7UA 4XTWA 4HT8A 3SWNB 2EAYA 4XTUA 4NL2A 4C92E 5LJ5j 4NOYA 3JCMb 4M7AA 3BY7A 3JB9D 4M7DE 1H641 5GANf 4RCBA
chains in the Genus database with same CATH superfamily
2GTJA 4RG8A 3FEOA 2E4HA 4KGVB 4KH1B 1W70A 4LDYA 1VUBA 2QAZA 3QXEB 2COYA 3DLLA 1BIAA 1PM3A 3H9NA 4RUGA 5D6WA 4Z88A 2BZYA 4J9IA 3VJPA 1SHFA 3CCUQ 4II1A 4N4IA 2HDAA 3ZL7C 1OPLA 4E7HA 3RMQA 1VQKA 3QUIA 2HQXA 3GPLA 4LDWA 1YJ9Q 1KFZA 1U1SA 1WNLA 2EQKA 1ZSZA 1YIJQ 4F7UB 2RHUA 1J3TA 1JQQA 4MZTA 2RJEA 3OS2A 5A0GA 2BTTA 4XQ3A 4JRPA 2K79A 2KYBA 3A8GB 2DL5A 1RLQC 4AFQC 3TSZA 2A08A 2JS0A 4A53A 2RH2A 3VKIA 1W6XA 3I9QA 5KYUB 1YCSB 2DERA 5FU7B 1AVZC 3NTIA 2EIFA 4ORZA 5D7UA 4O6JA 1Q82U 2FL7A 5CVIA 2RB6A 1GCQC 2F1LA 2JMCA 5KYWB 1QWEA 2RJDA 3LGLA 4Y28E 2DVEA 1RLPC 4J7FA 2EW3A 2X4WA 2DEQA 3CCUT 1YITQ 1WHMA 4MZPA 4ZN3A 3OS1A 1QVGP 1VQ7Q 4PJOF 2XIDA 1UEBA 1X6OA 4PJNA 1YJ9T 3OYGA 4EMHA 2DE0X 4BDZA 2EKHA 1UGPB 4F7UA 1AD5A 1B07A 3JCMb 2ZCFB 1RAEB 3VS2A 1RL2A 5FW9A 1YIJT 3V7RA 2ZZDA 4M77D 1AOJA 1H8KA 4M75E 1PCXA 5GAMd 1BBZA 1VQNQ 3CCRA 5GJVB 2X4JA 4M77G 1PKTA 4IUTA 1BK2A 3V7CA 4ZGJB 1VQ4A 1I5LA 1D1AA 1N9RA 3R6NA 2ABLA 2YUPA 3IQLA 1VQOQ 2KY9A 3OS0A 2RI3A 4DQ2A 2NWMA 2QQRA 1KJWA 3P8DA 1TG0A 3VS4A 1OZ3A 1U1TA 4Z02A 2NLUA 2LDMA 2PUOB 3LLRA 1OX9A 3O8VA 1YITT 2NUTB 1AHJB 2JMAA 1BIBA 1BI3A 1VQ7T 4ZGDB 5AT1B 1EIFA 1N6AA 3CCSA 3EG2A 1I4K1 2I2LA 2FO0A 1RAAB 2XHCA 2IPOB 1M1KR 2XDBA 2R57A 4BD3A 5CO7A 4BI4A 3QDRB 3ASKA 1Q86C 1Q95G 5CAIA 4JUVA 2DILA 5HK0A 1NE8A 2SEMA 5FU6C 1KG1A 3NTKA 4AFUC 1UJ0A 3NPFA 4ATOA 4BE2A 2LNVA 3RERA 2CSIA 3N5BB 3CMAA 1R0BG 1VQ8A 2G6FX 4GBQA 2L2PA 3EFOA 4M75B 5HKCA 1YNZA 1MMAA 2EQMA 1WQWA 1AEYA 5KYNA 5EG2A 1MMGA 1OULA 2FHDA 2X4YA 2NUTA 4HVWA 2KQWA 2L3QA 2EQIA 4JRIA 1S72A 3QHSA 3CPWP 1AT1B 1SSFA 2RI2A 3EG3A 2AT1B 3CBOA 5GANd 1CKAA 2RA2A 4F16A 2ZPFB 1ZQ1A 4EMGA 4Q5WA 1LOJA 1N8RR 3QKJA 1Q7YC 2L89A 3E9GA 1X75C 2QDLA 2J7IA 3OY9A 2WSFE 4N4GA 2D8HA 3HRSA 2AKKA 4KGXB 2DKGA 1M2VB 3MP1A 1G3TA 2VXFA 1CSKA 1E6GA 2YRCA 1RADB 5KCHA 4M75A 2OTJQ 3PNWC 1WZOA 4OMNA 3I56T 3H0HA 3M57A 4A4EA 4C8QF 2DM1A 2KT8A 4BACA 5D6YA 4M78E 3JCMd 1BYMA 3VS0A 3V8LA 2GTOA 2C0TA 5GMKe 3CPFA 4RTTA 3OYCA 5IT9E 3LX7A 1FX7A 2X4XA 1D1CA 2E70A 3SWNC 2ED1A 4K11A 1JXOA 3L2RA 3QZ9B 4XTVA 1NJIR 1PWTA 4HCZA 2DTOA 4FT2A 2HD0A 1YP5A 3M55A 4BE1A 4M78F 3CCUA 2LZ6B 2E3IA 1HYOA 1I8FA 1KHCA 3RIRA 5L23A 1OYXA 1JB0E 3UWNA 4F17A 1HJDA 2KT1A 1YJ9A 1VQKQ 2CP6A 2A36A 2OTJT 2KAFA 1WHGA 4IIOA 4M7DB 3OYLA 1YIJA 4XU0A 4B6MA 4FW1A 1UUEA 4A4GA 5GAOn 4C5HA 3V8KA 1ACMB 1NBEB 2RK2A 2ZGWA 4EMKB 1E6HA 2YXYA 2FZKB 1RAHB 2FPEA 4GY5A 1X43A 3EG1A 3HTRA 3A8OB 4E7ZA 2Y90A 3O5ZA 2EPDA 2A37A 2LQWA 2AZSA 1VQ9Q 2K7AA 3CCET 2L3SA 1HSQA 2RNAA 2MCNA 1VQ7A 3PIOA 4B9XA 1YWPA 1MV0B 2BKDN 2B8AA 1ZBXA 2QQAA 2R5AA 4LUEA 1W2BA 3TVTA 2O4XB 1G3SA 2QG9B 4FM4B 2HMAA 3EFRA 4XU3A 5LJ5d 4JJCA 4EMKA 3CXCP 1SEMA 4L59A 2LMJA 3QPHA 2JOYA 1EFNA 2G3RA 1WJSA 1NYGA 5KYYB 1YCYA 1QCNA 1IZ6A 2DTHA 1BI1A 2Y4XA 2DIGA 2HSEB 4HXJA 3CCRQ 4RTZA 2K57A 4A4KA 4OVAA 1VQ4Q 3G7ZA 2VKNA 5HK3A 2XG8D 2F5TX 3J81E 5I22A 5GAN2 1WGSA 1VQPQ 2MPXC 2NUPA 4E7SA 3SD4A 2PVOB 4E7JA 2BUDA 3RESA 2QGFB 1VQ9T 2KI7A 1M1KU 2A7YA 4MZMA 2C06A 2CZ1B 1F1BB 3JB9D 1CKBA 1ZUKA 1WHKA 3DB3A 3JB9G 1M9SA 1PSFA 2ZAEA 2M9UA 2O4XA 3SFMA 4QVZA 3CCSQ 5IXFA 3PIPA 2SRCA 3OQ5A 5KYYA 3AT1B 5CIUA 4OB2B 4C0DC 3FJPA 3VS5A 3CBMA 2V26A 4Z8AA 4FYVB 4J9FA 2MIOA 1G3YA 2LT4A 4J9EA 1D3BB 2JM8A 3CCRT 1Q82C 1ZBJA 1VQ4T 5GAN5 3I56A 3GOXA 3CMAQ 5KE2A 2CS7A 2O88A 1VQ8Q 1ZUUA 5IN1A 3RKXA 3S3OA 2K5FA 4J9CA 2DLPA 1LCKA 1VQPT 1TS9A 2KVQG 3GBQA 1IREB 3X24B 1W4SA 3E19A 3CC2T 1IB8A 2DJQA 1S72Q 3UATA 4CC3A 4DOWA 3HRUA 4PFPA 3EH2A 2PZ1A 1WHJA 3CBPA 2DBKA 3RBBB 1TH7A 3CC4A 2QGGA 4RTXA 1UGRB 3H0FA 2YDLA 1W1FA 3G4ST 2J06A 2OAUA 1TOVA 1UHCA 3L42A 1HD3A 3JCMQ 1K4US 4J9BA 1G2BA 4J83A 1MNDA 4LDVA 5CKFA 1D3BA 1ZSGA 3I5RA 1K9MR 1GBRA 2OX7A 2LQKA 1RAGB 4ELZC 2LP5A 3SDZA 3JB9I 3GLXA 2OTJA 4C92E 2VVKA 2CREA 4EIKA 3D7SB 3LGFA 1X6GA 3NHNA 1Z9QA 5IXBA 1KHIA 2RK1A 2CUDA 3C4SA 2RQUA 1QVGS 3JV3A 3CC7Q 5GAOr 1S72T 5M9OA 3JRZA 4N0AA 3JB9J 2DXCA 1K8AC 2DL7A 4C92F 1BKBA 3UA6A 2FB7A 2RQVA 4HVVA 3V7SA 2J6FA 3RMSA 3REAB 1KSWA 3CCEA 1YHQT 1VIFA 2QI2A 2DZ9A 2EYQA 3H0IA 4HCKA 4M7AB 2KSSA 3J80E 2PQWA 2D0NA 4F7UG 4X9CA 3QDFA 1N27A 1FMKA 4M75C 3META 1WI7A 2X9HA 1OX8A 3AHUA 2ATCB 4OB3B 2W0ZA 3DLMA 2RQTA 5GAMe 2CSQA 4E2FB 2F2VA 2CP0A 4C92B 2JJ9A 1SSHA 3CC7T 4CRIA 1GXIE 1U06A 4ESRA 2CT4A 5CKHA 1M1FA 1M90R 4PJOE 4KT0E 1AWJA 3U23A 3VRZA 3VUBA 5CR2A 2M1HA 4JJBA 4F04B 1YBYA 4MDWA 3PGGA 2IVWA 1RAIB 3LH0A 4HT8A 4AFZC 1QW1A 2XDDA 1VQ9A 1PD1A 4M7AA 2XKOC 1O9SA 3PMIA 1ABQA 4Z89A 3RDVA 2JTMA 5GAN3 3PMTA 4QVDA 3FB9A 1MNEA 4M77E 2PNIA 3ZEHA 1K73C 4J7IA 1R77A 2K5LA 2K3BA 3EGXB 2JS2A 3CD6Q 3CCLT 2O2OA 2P0KA 3FLGA 4CC4B 2QXFA 4X34A 3CPWS 5LJ3e 4C92A 2BIVA 4HCBA 5GAMg 3JCMP 2JVVA 1Y71A 3ME9A 4M77F 1SF9A 2X3XD 1D1BA 1RUWA 1V1CA 3JAME 5GAN7 3DB4A 4BI3A 2F69A 1WIEA 2RJCA 1QVFP 3OW2A 5GAMj 3I55A 1M5Q1 2VGMA 5J39A 3V8JA 1VQPA 2O9VA 2XMFA 2KR3A 3CC2A 2GGRA 3EFOB 5GANe 1OU8A 4RTUA 1VQMT 4XTXA 4PJOB 4LE9A 4KH0B 3ZFJA 1YWOA 4A63B 4XTZA 3EGXA 4FIBA 3UA7A 4XU2A 2VWFA 2L0AA 4GLMA 4M7DC 3CD6T 3I35A 1KQ1A 3M4GA 4FYYB 5GAN6 2E5QA 5I2SA 2VGNA 3G4SA 2YWWA 4M75D 1JEGA 1OPKA 5LJ3g 5GAOm 3HFNA 3JCMX 4M75G 2AHJB 1G3WA 4FYWB 3CMET 3NMZC 2F2XA 1QKWA 4IUUA 2KGTA 2CZ6B 1QQJA 2JTEA 3M5AA 5LJ3j 2CZ0B 1KC8R 2ENMA 3JCMe 2E6NA 3I56Q 2K3YA 3MJXA 4PJOA 5GAMf 1R8OB 2AIRB 3J7AF 1WLPB 3BFMA 2JNGA 2E41A 2YHTA 4HVUA 2PUKB 2E3HA 2KRMA 2RHIA 5GANg 5C0MA 5KE3A 5KH6A 4YTLA 1KIKA 1FWZA 3L2WA 1Q81R 1GCPA 4ELYC 2JZ2A 1H3HA 1VQ6T 1VYVA 2KYMA 2LX9A 1T3LA 2XK0A 1VIEA 3VYHB 1K9MU 2DYIA 3PTAA 3CC4Q 5GANj 3L1AA 4QVCA 1NG2A 4KBMB 3OYKA 1YHQA 1OU9A 1V76A 3CCQA 2QQBA 4C8QE 3EFSA 4PJMA 5CKBA 2LC4A 4KRTA 2K6DA 4J6WA 2ZPGB 1O75A 1YJNA 2VYTA 3SB2A 4DOVA 2KRSA 2EWNA 1QVFA 2NYSA 4Y91A 1BU1A 1LJOA 1N5ZA 1I5OB 1OOTA 1WX6A 2NUZA 2JT4A 2L3PA 2M51A 1NEBA 3OBYA 5FLXE 5LJ3f 1XQHA 3H6ZA 3BE3A 3JCMg 3G1JA 4MMLA 1W2BP 1S1NA 3CEYA 3OMCA 3CC7A 2FVUA 2COZA 2D1XA 2DPPB 2LVMA 4HT9A 1B3QA 2ESWA 5A0LA 2L3RA 1M2OA 3A8MB 1NLPC 2CT3A 4Y92A 3I5SA 2DX1A 3CXCS 4D8DA 3HFOA 3CC4T 4FCYA 4ME7A 4NOYA 2EGCA 2XICA 3WXMB 4RTWA 4M7DD 5GANf 1ZA1B 5DY9A 4OMOA 3M4YA 3CCEQ 2L5QA 4HA8A 4M7DG 1C0MA 1SPKA 2HZYA 1YI2T 4JS4A 3CCLA 5LJ5e 3OSVA 2KBTA 3JCMV 4C8QB 2QEXQ 3CCJT 3QJYA 4LN2A 2MMPA 1GCQA 2A28A 3A8LB 3HP9A 1M90U 1XOVA 3M0SA 1WYXA 1RAFB 4ZN1A 1N8RC 1HK9A 4DEXA 1VOMA 5ECAA 4ZNXA 5J26A 3OYBA 2CGHA 3OYFA 2CH4W 1QVPA 3JCMf 2J6OA 4KGZB 4X1VA 3GNFB 1PSEA 4M78B 3OYJA 3KXTA 2HSPA 2KROA 2JM9A 2RQWA 1NLOC 4LUDA 1MV3A 4FL6A 4TVRA 1VQMA 2E64A 2A0FB 2DNUA 4QQGA 5EC7A 1Q86U 1AZEA 5GMKj 2NUPB 1BI2A 3M58A 4IUPA 5FU6B 9ATCB 4VUBA 3FDRA 3OA6A 5DLOA 4C8QA 2HCKA 3X25B 2KMTA 2HEQA 3MHXA 4RKUE 4D6WA 2DO3A 3CD6A 5A0DA 5KYXB 2VASA 1K0XA 5LJ5g 1PNJA 2QEXT 1X27A 1M8VA 1XTDA 3VV0A 2CP2A 1NJIC 5FWBA 1KQSA 1LPLA 1ZSZC 4WCIA 3QG1A 1IGUA 3CMEA 2OTLT 4MDXA 3OYNA 1D0YA 2EAYA 4PKCC 1RI0A 5LJ5j 1H641 2EYXA 4C0FA 4M78A 2RF0A 3OYDA 3OMGA 3S6WA 1QP3A 4OGEA 1UGSB 4BY6B 4PLLA 1KD1R 3I55Q 2F2WA 1QLYA 1JJ2A 4WF2A 3X26B 2MF2A 4E47A 4AG2C 4M7AC 3CC2Q 2A3LA 2H3JA 4J9HA 1VQLT 3QSUA 1Q7YU 1R0CB 2B86A 5KYXA 3HL8A 3JB9F 3RKYA 2MAMA 1M3CA 1VQ6A 5DM7R 5GAOq 4NS5A 1XJWB 3QYHB 1JO8A 3P8BB 2O01E 2GCXA 2FYKA 2P0PA 1V29B 3G4SQ 3MO8A 1KC8U 3P8HA 1D0ZA 1QKXA 4OF1A 1TWBA 3RNJA 1PD0A 4JRQA 7AT1B 3SHWA 5AYFA 2DRKA 3OW2S 2QK0A 5FU7C 5LJ5f 1E7OA 5CKDA 4EPCA 2EQJA 4E7KA 4JZ4A 4A4FA 2FZCB 4UC4A 4XU1A 1Q81U 3I55T 2LJ1A 4HCCA 2W10A 1B7TA 5FROA 3EHQA 3RUXA 2D6FA 3A1PA 1UJYA 3RR6A 4XK8E 8AT1B 3A98A 1K8AR 3GNGA 1SG5A 1ARKA 1AWWA 1G83A 2PTKA 4RTYA 1A0NB 1BCOA 1X2KA 1M3AA 3WVDB 5I2MA 2X3WD 4L6V5 2XI9A 1M30A 1WJRA 4QW2A 4XTWA 2ROTA 4XTUA 4FSSA 2DD5A 4F14A 1UB4A 2RHXA 1AWOA 2YUNA 2QDYB 2GQVA 1Y0MA 2QYZA 4JZ3A 2KXCA 4R56A 1YHQQ 3EG9B 3CCQQ 3M59A 2DK3A 4DEYA 4C5IA 3G6EQ 1YJNQ 1YI2A 1IXDA 1G8XA 2CDTA 3M0TA 1G5VA 1LNXA 5LJ3h 1UG1A 2ZPEB 3CCJA 5L8RE 3EGUA 3WVEB 3QWYA 2YRVA 1NEGA 1SKUB 2Z0WA 3EG0A 1I1JA 1JXMA 3E9FA 1BB9A 4PJOC 3HPWA 2KRNA 2P4RA 1QP2A 3RKWA 1WHLA 4ZTJA 5C6SA 2QA4Q 1HXDA 4F7UE 4V2SA 4DBQA 1OV3A 4LDXA 4M7AD 3EH1A 5GJWB 3JCMc 3Q1JA 2DAQA 1WQ7A 1TSFA 2LQ8A 3OBWA 3CCMT 2RQRA 3A5ZB 4M7AG 2RM4A 1UDLA 1VQ5Q 4J8OA 1C1AA 2F5KA 5GANh 3OW2P 2AK5A 3EG9A 4PK4A 4IUVA 2EJFA 2P84A 1PC0A 1U3OA 2P4TA 3CCQT 4JRKA 2HBWA 1QVFS 4F7UF 4C92D 3OYEA 4D8KA 3NFCA 3QO3A 2GQIA 3G6ET 1YJNT 5HCKA 3VS1A 2DBMA 2XD0A 1T0JA 4C92G 2V8IA 1OZ2A 2QEXA 2VV5A 3C95A 3CCLQ 1GFDA 1UTIA 2KK4A 1OQKA 2DVJA 2YUQA 2M16A 1EZZB 1ZX6A 1IRXA 1KK7A 3PVLA 3A8HB 2OTLA 2VXEA 1Y7XA 3E1SA 2FRYA 2QTVA 3ULRB 2MWPA 1Y57A 3MPUB 1RABB 2JW4A 3G71A 2QA4T 4QT7A 2O31A 1OI1A 3H8ZA 1K9MC 4E6RA 2CP3A 4CC2A 3JCMh 3OB9A 2M02A 3EGDA 3OYMA 3CCVT 2GFAA 2JXBA 1I0CA 3MEVA 2JTFA 2LCCA 1TU0B 2HKQB 5I21A 3M9QA 4IIMA 3JSCA 4JPBW 2COWA 5J3BA 1VQ5T 4BDYA 1X2QA 1UECA 3HHTB 2CH4A 1NPPA 3FRNA 4C0DB 1EX4A 1VQLA 4RG2A 3VS6A 2HQEA 1VQMQ 1U5SA 4OB0B 3F70A 2XDPA 4JLGA 2RMOA 2EYZA 4R0KA 4C5EA 2K9GA 2WSCE 1YJWT 3R6OA 2EGAA 4BUGA 2RI5A 1JU5C 1K1ZA 2VUBA 2V1RA 3KBGA 4FYXB 2PVGB 1WA7A 1Q86R 1QWFA 2LQNA 3PT9A 5GAOp 2IG0A 4PJJA 3X20B 2KDSA 5CKEA 1KD1U 2E65A 4PJOD 2VB6A 3CMEQ 3FJ5A 2LJ3A 2E10A 1ABOA 2X51A 2MI6A 4PJOG 1ZLMA 3L2QA 2ZPBB 3EHRA 1UGVA 5A2QE 4O5VA 2CKKA 2DTIA 1JBMA 2VC8A 4R55A 2EVRA 2L8DA 3BDLA 5KYUA 1ZUYA 2RHYA 5GMKh 5GMKl 2K3XA 4AMCA 4BB7A 3S3MA 1FYNA 2K4YA 3LWIA 5GMKm 1WXBA 4C8QC 1M90C 5KYWA 3L2VA 1VQ6Q 4DBRA 1W2BS 2YSQA 3QWXX 3UPUA 2EJ9A 1KQSS 1M3BA 5IHNA 2DJZA 3VU3C 5GAOl 1Q7YR 4QQDA 4M77B 1QCFA 2C0IA 3MCAB 4M75F 4AG1C 4LNPA 5LL6S 4EMKC 4KUIA 2DYBA 5LJ5h 4CI0C 3VYGA 4KULA 2QQ9A 2PU9B 3TREA 3OS5A 2J6KA 4M78C 3EAEA 1SHGA 1JJ2S 4JDSA 3UF4A 2MWOA 1K8AU 4IKFA 1M8MA 1JRIA 1WXUA 3MP8A 1TUDA 1I07A 2FEIA 3M0PA 3QZ5B 2FZGB 5LJ3d 2HNIA 4AFSC 1VQNT 2LTOA 1LVKA 1X01A 1WXTA 2CYZB 2K2VA 1GRIA 2H8HA 2J05A 1PRMC 2HQHA 3CCMA 4M77A 1VQOT 3NGPA 3DKMA 3TSWA 3C94A 1Z9ZA 2DZCA 2RJFA 3OYHA 3VS7A 2V1QA 1GBQA 3MKDA 3PVQA 3ER0A 1D09B 1QVGA 3HKSA 2MOXA 3G6EA 2DD4A 1OEBA 4JJNK 3E2UA 1VYTA 2EGEA 4BY6C 4L5GA 4FSXA 1YI2Q 2M0OA 1GFCA 3VRYA 1IHVA 1QMCA 3CCJQ 4ANJA 1M1KC 1N9SA 3M0RA 5KCOA 4M4ZA 2FPFA 1U8RA 2H3EB 2DA9A 1DJ7B 1M1GA 3LYIA 4M7DE 1WHHA 2QA4A 2GFUA 1KQSP 5FRMA 2BE9B 3VUZA 1TUCA 2P0QA 1UHFA 1UFFA 1XNIA 2RPNA 5CCAA 2RHZA 3CCVA 4BE0A 3JCMJ 5FWCA 2QQSA 4RCCA 1KC8C 1VQ5A 4C8QD 2EFIA 1K73U 3S3NA 1H3ZA 2R58A 1GL5A 2JUFA 2EYYA 4C8QG 1YFNA 1JJ2P 4M7DF 2E12A 4B9WA 3URGA 2QASA 3SEMA 4OB1B 1YJWA 1RACB 3REBB 1Q81C 5GAN8 2LCLA 3JB9H 1MUZA 1ZA2B 4FW2A 2E1HA 2ECZA 2M0YA 4C0ZA 2E6ZA 2K2MA 2CUBA 1FXXA 2EBPA 4ZGEB 4M78D 1M2VA 2LJ0A 1PKSA 3M0QA 3L2UA 1M27C 4OP0A 1QCOA 4M78G 2OTLQ 2EKOA 2YLBA 4IUQA 1M4ZA 3UDCA 4LDUA 1NZ9A 3G71Q 3NTHA 3VS3A 1MGQA 1AWXA 2LT1A 2AZVA 2GBQA 2IIMA 4N0AC 2CP5A 4OMQA 2DL4A 1AZGB 3CPWA 1IO6A 3C0CA 2EJGA 3PE0A 4FT4A 4MMKA 5CQYA 1NM7A 4C5GA 2RD1A 1FMVA 1K0SA 2MK5A 2ZPHB 1C6VX 1Y07A 3M56A 1VQLQ 5DLQE 3TQ7P 1D0XA 4CC7A 3GF5A 3TU4K 3BY7A 1TTHB 4AT1B 1IHWA 3LW5E 5FRNA 2DL3A 2DETA 1NPRA 2BZXA 2RN8A 4X9DA 3OYAA 4OMMA 4PNOA 1YITA 3BW1A 2XU8A 8ATCB 1Y96B 4E7IA 1B34B 3KUFA 5IHIA 2D0QB 1X69A 4N4HA 4PJLA 4OMFB 1YN8A 3G71T 1Q82R 3INZA 1VQKT 4KUDK 4M7DA 2ED0A 2LX7A 3QIIA 3GIBA 2PVDB 4P5NA 2O9SA 1PG5B 4PL6A 4FU6A 4LD6A 2GNCA 2ZPIB 1I81A 3CQTA 4RTVA 2HL3A 2YRDA 4JLIA 3LWHA 1VQNA 3X28B 2FPDA 4ZTFA 3L2ZA 1TXQA 4QQ6A 1H92A 4J9DA 1UGQB 2WACA 4IURA 1MHNA 2DXTA 5D6XA 3OSSC 2DRMA 2I0NA 1VQOA 2GF7A 2DIQA 3HRTA 2LCSA 4WTOB 2YUOA 2Y4YA 4PLIA 4HKEA 1K9AA 1NYFA 4A4HA 1Y96A 5GAN4 1B34A 3MEAA 2JN0A 2KNBB 3BDUA 4C92C 2CZ7B 3GP8A 1MMNA 1RI9A 4A54A 2MYSA 3FIFA 4NL3A 5HY6A 2DXBA 2AKLA 2DEUA 4PFZA 2C0OA 1WJQA 3M54A 4JS5A 4OMPA 4DBFA 3THKA 2KE9A 2X35A 3FC3A 4J5YA 5GAMh 2ROLA 2LNHB 4BI8B 2BE7D 1K76A 3TEEA 5I11A 3SWNB 2HKNA 4EDUA 1BI0A 4OGCA 1WFWA 2E5KA 5CQXA 1BCMA 3MEUA 1PHTA 4LD9K 3ZBDA 4J6XA 1T0HA 1WDXA 2D9TA 2WSEE 4XAXB 1TUGB 4JJDA 1MMDA 2EQUA 3T9NA 3QBYA 2DMOA 2RO0A 2HL5C 3CCMQ 4DA4A 4E7LA 1FMWA 1KD1C 1SRMA 1WPYA 1SRLA 2EYWA 4RMOA 1UE9A 4J6YA 2YT6A 6AT1B 3OYYA 2KXDA 1VA7A 1VYUA 1T3SA 1IGQA 1N8RU 3HSBA 3QJ6A 3JCMW 4DBHA 2FG0A 4M7AE 3SWNA 3CCST 4QKUA 4J9GA 1ZHIA 2HAXA 4GLKA 2OAWA 3CXCA 3QYGB 1X6BA 2CP7A 2DL8A 3UT1A 4OMLA 4PFOA 4XTYA 3MEWA 2QTXA 5CK9A 3TCJA 3MP6A 2DFUA 2D8JA 1P92A 3M0UA 2V8KA 2OI3A 3CMAT 4M7AF 1VQ8T 4LXCA 2DF6A 3CCVQ 2YLCA 5GMKi 4M77C 3M53A 3LH5A 1KQ2A 2FRWA 3EGDB 2DXUA 3H41A 1PRLC 3KFVA 3C12A 1ZSZB 2R5MA 5IHKA 3OYIA 1NJIU 2HBPA 2LRQA 2K5IA 4NL2A 5IH2A 2KEAA 2OJ2A 5IAYA 4C0GA 1YJWQ 1K73R 2V8JA 3PFSA 2BZ8A 4RCBA
chains in the Genus database with same CATH topology
2EJ9A 1KQSS 3VU3C 2DJZA 5DY9A 5GAOl 4RG8A 4QQDA 3FEOA 3M4YA 4M77B 2L5QA 3DB3A 3JB9G 3MCAB 4LDYA 4M75F 1M9SA 1PSFA 1VUBA 4HA8A 2M9UA 2O4XA 3QXEB 3SFMA 4M7DG 4QVZA 5LL6S 4EMKC 3DLLA 4KUIA 1BIAA 5D6WA 1YI2T 3PIPA 4JS4A 3VJPA 3CCLA 5LJ5h 4CI0C 3OSVA 5LJ5e 3OQ5A 3VYGA 4KULA 2QQ9A 3JCMV 4C8QB 2PU9B 5CIUA 4II1A 4N4IA 4OB2B 4C0DC 3TREA 3QJYA 3CCJT 3FJPA 3OS5A 3CBMA 2MMPA 4M78C 3A8LB 4E7HA 3RMQA 3HP9A 1M90U 1XOVA 3QUIA 1VQKA 2HQXA 3GPLA 4ZN1A 1N8RC 1HK9A 3EAEA 1JJ2S 4LDWA 4JDSA 4IKFA 2MWOA 1K8AU 1JRIA 1G3YA 3MP8A 2LT4A 1U1SA 1D3BB 3CCRT 1Q82C 3QZ5B 5J26A 1WNLA 3OYBA 1VQ4T 2EQKA 5LJ3d 5GAN5 2HNIA 3I56A 3GOXA 5KE2A 2CS7A 1VQNT 2CGHA 3OYFA 2LTOA 1X01A 4F7UB 2RHUA 5IN1A 3RKXA 3S3OA 2K5FA 1QVPA 4MZTA 2CYZB 2RJEA 1VQPT 3OS2A 2KVQG 5A0GA 1IREB 2K2VA 3JCMf 4XQ3A 3X24B 4JRPA 3A8GB 3GNFB 1PSEA 1W4SA 3E19A 4M78B 3OYJA 3KXTA 3CC2T 3CCMA 4M77A 1VQOT 3DKMA 4A53A 2RH2A 4FL6A 3C94A 4TVRA 2DZCA 3VKIA 2RJFA 1VQMA 4DOWA 3HRUA 2E64A 3OYHA 5FU7B 4QQGA 1Q86U 3NTIA 5GMKj 2EIFA 1BI2A 3M58A 4IUPA 5FU6B 4O6JA 3FDRA 4VUBA 3ER0A 3OA6A 1Q82U 5DLOA 4C8QA 3CBPA 3X25B 1TH7A 3CC4A 2FL7A 5CVIA 2KMTA 1QVGA 2RB6A 3HKSA 1UGRB 3MHXA 3G6EA 4RKUE 4D6WA 2DO3A 2RJDA 3LGLA 4Y28E 3CD6A 5A0DA 2DVEA 2DD4A 4J7FA 2X4WA 2DEQA 3G4ST 4JJNK 5LJ5g 2OAUA 3CCUT 4BY6C 2QEXT 4L5GA 3L42A 4MZPA 4ZN3A 4FSXA 3JCMQ 1M8VA 3OS1A 4J83A 1XTDA 2M0OA 4LDVA 5CKFA 3VV0A 1D3BA 4PJOF 1NJIC 2XIDA 1KQSA 1UEBA 1X6OA 2LQKA 1M1KC 3QG1A 1YJ9T 1N9SA 4ELZC 4EMHA 3OYGA 5KCOA 3CMEA 4BDZA 3SDZA 2OTLT 3JB9I 1UGPB 3OYNA 3GLXA 4F7UA 4MDXA 1U8RA 2OTJA 2EAYA 4PKCC 4C92E 1RI0A 5LJ5j 3JCMb 1DJ7B 1M1GA 2ZCFB 3LYIA 4M7DE 1H641 2QA4A 2GFUA 4C0FA 1RL2A 5FRMA 4M78A 1YIJT 3V7RA 2ZZDA 3LGFA 3OYDA 3OMGA 4M77D 3S6WA 3VUZA 1QP3A 4OGEA 1UGSB 4M75E 2P0QA 1KHIA 2RK1A 1XNIA 4BY6B 5CCAA 4PLLA 2RHZA 5GAMd 3CCRA 3CCVA 3C4SA 4BE0A 1QVGS 2X4JA 3JCMJ 4M77G 2QQSA 4IUTA 3V7CA 4ZGJB 1VQ4A 1JJ2A 4WF2A 4RCCA 3X26B 5GAOr 2MF2A 1KC8C 1I5LA 1S72T 1VQ5A 4C8QD 2EFIA 5M9OA 3JRZA 4E47A 3S3NA 1K73U 4M7AC 2A3LA 4N0AA 1N9RA 3JB9J 2H3JA 1H3ZA 1VQLT 3QSUA 2DXCA 2R58A 1Q7YU 1K8AC 2KY9A 4C92F 2JUFA 2RI3A 4DQ2A 3HL8A 4C8QG 3OS0A 1BKBA 3JB9F 2QQRA 4M7DF 3P8DA 3RKYA 2MAMA 2E12A 2FB7A 4B9WA 1VQ6A 3URGA 1OZ3A 1U1TA 5DM7R 4Z02A 2NLUA 5GAOq 4OB1B 1YJWA 4NS5A 3UPUA 3V7SA 2LDMA 3QYHB 2PUOB 1Q81C 5GAN8 3LLRA 3O8VA 3RMSA 1YITT 2LCLA 1AHJB 3P8BB 2O01E 2GCXA 3CCEA 3JB9H 1YHQT 1VIFA 1BIBA 2QI2A 1BI3A 2DZ9A 2FYKA 2E1HA 2P0PA 1VQ7T 4ZGDB 2EYQA 1V29B 4C0ZA 1EIFA 1N6AA 2E6ZA 3MO8A 3CCSA 4M7AB 1FXXA 2KSSA 1I4K1 2I2LA 3J80E 1KC8U 2PQWA 2XHCA 4M78D 3P8HA 4F7UG 4ZGEB 4X9CA 2XDBA 2R57A 4BD3A 4OF1A 1N27A 5CO7A 4BI4A 4M75C 3META 3QDRB 4JRQA 3ASKA 3L2UA 3AHUA 1Q86C 5AYFA 4OP0A 3OW2S 5CAIA 4JUVA 4M78G 4OB3B 2EKOA 5FU7C 3DLMA 5LJ5f 2YLBA 4IUQA 5HK0A 1M4ZA 1NE8A 3UDCA 4LDUA 5CKDA 1NZ9A 5FU6C 5GAMe 1KG1A 3NTKA 3NTHA 1MGQA 2EQJA 4EPCA 4E7KA 4A4FA 2LT1A 4UC4A 4ATOA 4N0AC 4XU1A 1Q81U 4BE2A 2LNVA 3I55T 3RERA 4C92B 1GXIE 3CC7T 4CRIA 3N5BB 4HCCA 3CMAA 1VQ8A 5FROA 5CKHA 3RUXA 3CPWA 2D6FA 1M1FA 2EJGA 4M75B 4FT4A 5HKCA 4PJOE 4XK8E 4KT0E 4MMKA 5CQYA 2EQMA 1WQWA 4C5GA 2RD1A 3GNGA 3VUBA 5CR2A 5EG2A 2M1HA 2X4YA 2FHDA 2ZPHB 1Y07A 2KQWA 3M56A 1YBYA 4JRIA 4MDWA 3PGGA 5DLQE 2IVWA 3QHSA 3WVDB 5I2MA 3LH0A 1S72A 4L6V5 2XI9A 4XTWA 1WJRA 4QW2A 4HT8A 1VQ9A 1QW1A 1SSFA 2XDDA 4XTUA 3GF5A 2DD5A 4M7AA 1UB4A 2XKOC 2RHXA 3TU4K 3BY7A 1O9SA 3PMIA 3CBOA 2QDYB 2GQVA 5GANd 2JTMA 5GAN3 3PMTA 3LW5E 4QVDA 5FRNA 3FB9A 2RA2A 4M77E 4R56A 1NPRA 3ZEHA 2ZPFB 4X9DA 3M59A 2DK3A 3OYAA 1ZQ1A 4EMGA 1K73C 4J7IA 4PNOA 4Q5WA 4C5IA 2K5LA 3BW1A 1YITA 1LOJA 3CCLT 3QKJA 1YI2A 2XU8A 1Q7YC 1Y96B 2P0KA 3FLGA 4E7IA 2L89A 2QXFA 1B34B 3KUFA 4X34A 3E9GA 1X75C 1G5VA 1LNXA 2D0QB 5LJ3h 5LJ3e 3CPWS 2ZPEB 2WSFE 4N4GA 4C92A 4N4HA 5L8RE 3OY9A 3HRSA 4OMFB 3G71T 3CCJA 3INZA 2BIVA 3WVEB 1VQKT 4HCBA 2YRVA 4KUDK 2DKGA 4M7DA 5GAMg 3MP1A 1G3TA 2VXFA 3QIIA 3JCMP 3E9FA 3GIBA 4PJOC 2PVDB 3HPWA 2JVVA 4P5NA 5KCHA 4M75A 1Y71A 3ME9A 4M77F 4PL6A 4FU6A 3JAME 4LD6A 5GAN7 1QP2A 2ZPIB 1I81A 3PNWC 3RKWA 4ZTJA 5C6SA 3DB4A 3I56T 4BI3A 2F69A 2RJCA 1HXDA 4F7UE 4JLIA 3LWHA 3GP8A 3OW2A 3X28B 4ZTFA 1VQNA 3L2ZA 5GAMj 3M57A 4LDXA 4V2SA 4A4EA 3I55A 4C8QF 4M7AD 1M5Q1 2VGMA 3JCMc 5J39A 3PFSA 4QQ6A 4BACA 3V8JA 1VQPA 3Q1JA 2DAQA 1WQ7A 5D6YA 2LQ8A 4M78E 3JCMd 1BYMA 1UGQB 3OBWA 2WACA 4IURA 1MHNA 2DXTA 3CCMT 3A5ZB 3CC2A 3V8LA 4M7AG 5D6XA 2RM4A 3OSSC 2F5KA 4J8OA 5GANe 5GANh 2GF7A 5GMKe 2DIQA 3HRTA 3CPFA 1VQOA 1VQMT 4PJOB 4XTXA 3OYCA 5IT9E 3LX7A 1FX7A 2Y4YA 4IUVA 4PLIA 4HKEA 2EJFA 2X4XA 4XTZA 3ZFJA 4FIBA 4A4HA 2E70A 1Y96A 2P4TA 3SWNC 5GAN4 3CCQT 4XU2A 4JRKA 1QVFS 1B34A 3MEAA 4F7UF 2JN0A 3BDUA 4C92C 4C92D 2CZ7B 3QZ9B 3OYEA 4XTVA 4A54A 3NFCA 3QO3A 3L2RA 3G6ET 1YJNT 4M7DC 3CD6T 3FIFA 4HCZA 4NL3A 1KQ1A 2DTOA 3M4GA 2HD0A 4FT2A 5HY6A 5GAN6 3M55A 2DXBA 2E5QA 4BE1A 5I2SA 2XD0A 2VGNA 4M78F 3G4SA 4C92G 4M75D 3CCUA 2V8IA 1OZ2A 2QEXA 2VV5A 3C95A 5LJ3g 5GAOm 3HFNA 1WJQA 3M54A 4JS5A 1I8FA 1KHCA 2KK4A 3RIRA 3JCMX 1OYXA 1JB0E 3UWNA 2X35A 4M75G 2AHJB 1G3WA 2M16A 4J5YA 3FC3A 3CMET 5GAMh 1YJ9A 3A8HB 4BI8B 2OTLA 2VXEA 1Y7XA 3E1SA 2OTJT 3TEEA 3SWNB 2KAFA 4EDUA 4IUUA 1BI0A 2CZ6B 2MWPA 4OGCA 3G71A 2QA4T 5CQXA 1OI1A 3M5AA 3H8ZA 5LJ3j 1K9MC 3MEUA 4M7DB 3OYLA 4LD9K 2CZ0B 3ZBDA 1YIJA 4XU0A 4J6XA 3JCMh 3OB9A 3JCMe 2E6NA 4A4GA 2K3YA 3OYMA 5GAOn 2D9TA 5GAMf 3CCVT 2GFAA 4PJOA 1R8OB 2WSEE 4C5HA 3MEVA 4XAXB 2JTFA 2LCCA 3V8KA 3J7AF 5I21A 2RK2A 3M9QA 3JSCA 2ZGWA 3BFMA 2JNGA 2E41A 5J3BA 2YHTA 4EMKB 1VQ5T 2EQUA 4BDYA 2PUKB 3T9NA 2RHIA 3QBYA 5GANg 3HHTB 5C0MA 2RO0A 4GY5A 5KE3A 5KH6A 4DA4A 4YTLA 4E7LA 1NPPA 1FWZA 3FRNA 4C0DB 1KD1C 1VQLA 1WPYA 3L2WA 4RG2A 2HQEA 4ELYC 4RMOA 3A8OB 4OB0B 3F70A 2XDPA 2Y90A 4J6YA 4JLGA 2JZ2A 1VQ6T 3OYYA 2LX9A 4C5EA 2WSCE 2XK0A 1YJWT 1VIEA 3R6OA 3VYHB 1N8RU 1K9MU 3HSBA 4BUGA 3PTAA 2RI5A 5GANj 3L1AA 3QJ6A 4QVCA 2VUBA 3JCMW 3CCET 3KBGA 4KBMB 3OYKA 1YHQA 3CCQA 2QQBA 2PVGB 4C8QE 3EFSA 5CKBA 1VQ7A 4M7AE 2LC4A 3SWNA 3CCST 4J6WA 2ZPGB 1O75A 3PT9A 1YJNA 1ZHIA 5GAOp 3PIOA 2HAXA 4GLKA 2IG0A 4B9XA 2VYTA 3SB2A 3CXCA 4DOVA 3QYGB 3X20B 2BKDN 2B8AA 1ZBXA 2EWNA 2QQAA 2KDSA 5CKEA 4Y91A 1QVFA 1LJOA 2R5AA 1KD1U 2E65A 4PJOD 1W2BA 3UT1A 2O4XB 1G3SA 2E10A 4FM4B 4XU3A 3EFRA 5LJ5d 5FLXE 3OBYA 4XTYA 3MEWA 2MI6A 2QTXA 4EMKA 5CK9A 3TCJA 5LJ3f 4PJOG 1XQHA 3H6ZA 3MP6A 4L59A 3L2QA 2ZPBB 3QPHA 3JCMg 2JOYA 2G3RA 1WJSA 4MMLA 1P92A 1YCYA 1IZ6A 3CEYA 2DTHA 1BI1A 2Y4XA 2DIGA 2V8KA 3CMAT 4M7AF 5A2QE 3OMCA 4O5VA 3CC7A 2CKKA 2FVUA 1VQ8T 2DPPB 2LVMA 2YLCA 2K57A 2DTIA 4M77C 4A4KA 5GMKi 4HT9A 4OVAA 1JBMA 3M53A 2VC8A 4R55A 2L8DA 3BDLA 5A0LA 2L3RA 1KQ2A 3G7ZA 2RHYA 5GMKh 5GMKl 2K3XA 3A8MB 5HK3A 2XG8D 2F5TX 3J81E 4BB7A 2DXUA 3S3MA 5GAN2 1WGSA 2K4YA 3LWIA 5GMKm 3C12A 2R5MA 4C8QC 3SD4A 3OYIA 2PVOB 3CXCS 1NJIU 4E7JA 2BUDA 1M90C 2HBPA 3RESA 3HFOA 2LRQA 1VQ9T 2K5IA 3CC4T 4ME7A 1M1KU 4NL2A 2A7YA 3L2VA 4NOYA 4MZMA 2C06A 2CZ1B 1W2BS 5IAYA 3JB9D 2XICA 3WXMB 4C0GA 4M7DD 2V8JA 2RI2A 5GANf 4RCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJ9 A;  5GAN d;  5GAN 3;  4M78 A;  4M7D B;  3V7R A;  3VU3 C;  2DJZ A;  4QVD A;  3FB9 A;  2RA2 A;  4M77 D;  4M77 E;  5DY9 A;  4XU0 A;  4J6X A;  5GAO l;  3JCM h;  3JCM e;  4M75 E;  4M77 B;  3JB9 G;  4M75 F;  5GAO n;  4PJO A;  5GAM f;  4HA8 A;  4X9D A;  5GAM d;  4M7D G;  3V8K A;  4EMG A;  5I21 A;  3JCM J;  4PNO A;  4EMK C;  2ZGW A;  3BFM A;  3BW1 A;  1BIA A;  4M77 G;  2E41 A;  3V7C A;  2YHT A;  4EMK B;  1LOJ A;  4WF2 A;  4RCC A;  5GAO r;  1I5L A;  5LJ5 h;  1Y96 B;  4C8Q D;  5LJ5 e;  5GAN g;  3JCM V;  4M7A C;  1B34 B;  4C8Q B;  4M7D D;  4N0A A;  1LNX A;  1N9R A;  5LJ3 h;  5LJ3 e;  3JB9 J;  3FJP A;  4C92 A;  5LJ3 j;  3QSU A;  4M78 C;  1WPY A;  3INZ A;  4C92 F;  4M7D A;  2DKG A;  4DQ2 A;  5GAM g;  3QUI A;  4C8Q G;  3JB9 F;  1HK9 A;  2Y90 A;  2VXF A;  4J6Y A;  3RKY A;  4M7D F;  3JCM P;  3GIB A;  2FB7 A;  4PJO C;  1JRI A;  1U1T A;  4M75 A;  4M77 F;  5GAO q;  3HSB A;  1U1S A;  1D3B B;  3V7S A;  5GAN 7;  5GAN j;  5GAN 8;  1I81 A;  3RKW A;  1WNL A;  3L1A A;  4QVC A;  3JCM W;  3JB9 H;  5LJ3 d;  5GAN 5;  2HNI A;  1HXD A;  1BIB A;  4F7U E;  2DZ9 A;  2CGH A;  2FYK A;  2E1H A;  4JLI A;  1X01 A;  4C8Q E;  4F7U B;  3EFS A;  3L2Z A;  5GAM j;  4V2S A;  3RKX A;  3SWN A;  4M7A E;  4C8Q F;  4J6W A;  4M7A D;  1M5Q 1;  3JCM c;  4M7A B;  1I4K 1;  2I2L A;  3V8J A;  5GAO p;  1WQ7 A;  3JCM f;  4M78 E;  4M78 D;  4XQ3 A;  4F7U G;  3JCM d;  3SB2 A;  4X9C A;  4M78 B;  2DXT A;  4M75 C;  2EWN A;  3V8L A;  4M7A G;  4Y91 A;  2RM4 A;  4M77 A;  1LJO A;  3AHU A;  2E65 A;  5GAN e;  5GAN h;  4PJO D;  5GMK e;  4OP0 A;  5CAI A;  4A53 A;  4PJO B;  4JUV A;  4XTX A;  2DZC A;  4M78 G;  2E10 A;  2E64 A;  2YLB A;  4XU3 A;  3EFR A;  5LJ5 f;  5LJ5 d;  2EJF A;  4XTY A;  4XTZ A;  5GMK j;  5GAM e;  4EMK A;  2QTX A;  5LJ3 f;  4PJO G;  1MGQ A;  1Y96 A;  3SWN C;  3JCM g;  5GAN 4;  4XU2 A;  4JRK A;  4N0A C;  1B34 A;  4XU1 A;  4C8Q A;  1TH7 A;  4MML A;  1YCY A;  2JN0 A;  3BDU A;  4C92 C;  4C92 D;  2RB6 A;  4F7U F;  4XTV A;  4A54 A;  2DTH A;  3QO3 A;  4C92 B;  3RER A;  4M7A F;  4M7D C;  3FIF A;  4NL3 A;  1KQ1 A;  2DTO A;  3M4G A;  2DVE A;  5GAN 6;  2YLC A;  2K57 A;  2DTI A;  2DEQ A;  4M77 C;  5GMK i;  4HT9 A;  4M78 F;  1JBM A;  3RUX A;  5LJ5 g;  2VC8 A;  4M75 D;  4C92 G;  2EJG A;  3JCM Q;  4M75 B;  1M8V A;  5LJ3 g;  1KQ2 A;  4MMK A;  5GMK h;  5GMK l;  5GAO m;  3HFN A;  4PJO E;  1WQW A;  1D3B A;  1I8F A;  2RD1 A;  4PJO F;  3RIR A;  3JCM X;  2DXU A;  5GAN 2;  4M75 G;  4J5Y A;  5GMK m;  5GAM h;  4C8Q C;  1N9S A;  4JRI A;  3PGG A;  4EMH A;  3QHS A;  3JB9 I;  3RES A;  3HFO A;  2VXE A;  4F7U A;  4XTW A;  4HT8 A;  3SWN B;  2EAY A;  4XTU A;  4NL2 A;  4C92 E;  5LJ5 j;  4NOY A;  3JCM b;  4M7A A;  3BY7 A;  3JB9 D;  4M7D E;  1H64 1;  5GAN f;  4RCB A; 
#chains in the Genus database with same CATH topology
 2GTJ A;  4RG8 A;  3FEO A;  2E4H A;  4KGV B;  4KH1 B;  1W70 A;  4LDY A;  1VUB A;  2QAZ A;  3QXE B;  2COY A;  3DLL A;  1BIA A;  1PM3 A;  3H9N A;  4RUG A;  5D6W A;  4Z88 A;  2BZY A;  4J9I A;  3VJP A;  1SHF A;  3CCU Q;  4II1 A;  4N4I A;  2HDA A;  3ZL7 C;  1OPL A;  4E7H A;  3RMQ A;  1VQK A;  3QUI A;  2HQX A;  3GPL A;  4LDW A;  1YJ9 Q;  1KFZ A;  1U1S A;  1WNL A;  2EQK A;  1ZSZ A;  1YIJ Q;  4F7U B;  2RHU A;  1J3T A;  1JQQ A;  4MZT A;  2RJE A;  3OS2 A;  5A0G A;  2BTT A;  4XQ3 A;  4JRP A;  2K79 A;  2KYB A;  3A8G B;  2DL5 A;  1RLQ C;  4AFQ C;  3TSZ A;  2A08 A;  2JS0 A;  4A53 A;  2RH2 A;  3VKI A;  1W6X A;  3I9Q A;  5KYU B;  1YCS B;  2DER A;  5FU7 B;  1AVZ C;  3NTI A;  2EIF A;  4ORZ A;  5D7U A;  4O6J A;  1Q82 U;  2FL7 A;  5CVI A;  2RB6 A;  1GCQ C;  2F1L A;  2JMC A;  5KYW B;  1QWE A;  2RJD A;  3LGL A;  4Y28 E;  2DVE A;  1RLP C;  4J7F A;  2EW3 A;  2X4W A;  2DEQ A;  3CCU T;  1YIT Q;  1WHM A;  4MZP A;  4ZN3 A;  3OS1 A;  1QVG P;  1VQ7 Q;  4PJO F;  2XID A;  1UEB A;  1X6O A;  4PJN A;  1YJ9 T;  3OYG A;  4EMH A;  2DE0 X;  4BDZ A;  2EKH A;  1UGP B;  4F7U A;  1AD5 A;  1B07 A;  3JCM b;  2ZCF B;  1RAE B;  3VS2 A;  1RL2 A;  5FW9 A;  1YIJ T;  3V7R A;  2ZZD A;  4M77 D;  1AOJ A;  1H8K A;  4M75 E;  1PCX A;  5GAM d;  1BBZ A;  1VQN Q;  3CCR A;  5GJV B;  2X4J A;  4M77 G;  1PKT A;  4IUT A;  1BK2 A;  3V7C A;  4ZGJ B;  1VQ4 A;  1I5L A;  1D1A A;  1N9R A;  3R6N A;  2ABL A;  2YUP A;  3IQL A;  1VQO Q;  2KY9 A;  3OS0 A;  2RI3 A;  4DQ2 A;  2NWM A;  2QQR A;  1KJW A;  3P8D A;  1TG0 A;  3VS4 A;  1OZ3 A;  1U1T A;  4Z02 A;  2NLU A;  2LDM A;  2PUO B;  3LLR A;  1OX9 A;  3O8V A;  1YIT T;  2NUT B;  1AHJ B;  2JMA A;  1BIB A;  1BI3 A;  1VQ7 T;  4ZGD B;  5AT1 B;  1EIF A;  1N6A A;  3CCS A;  3EG2 A;  1I4K 1;  2I2L A;  2FO0 A;  1RAA B;  2XHC A;  2IPO B;  1M1K R;  2XDB A;  2R57 A;  4BD3 A;  5CO7 A;  4BI4 A;  3QDR B;  3ASK A;  1Q86 C;  1Q95 G;  5CAI A;  4JUV A;  2DIL A;  5HK0 A;  1NE8 A;  2SEM A;  5FU6 C;  1KG1 A;  3NTK A;  4AFU C;  1UJ0 A;  3NPF A;  4ATO A;  4BE2 A;  2LNV A;  3RER A;  2CSI A;  3N5B B;  3CMA A;  1R0B G;  1VQ8 A;  2G6F X;  4GBQ A;  2L2P A;  3EFO A;  4M75 B;  5HKC A;  1YNZ A;  1MMA A;  2EQM A;  1WQW A;  1AEY A;  5KYN A;  5EG2 A;  1MMG A;  1OUL A;  2FHD A;  2X4Y A;  2NUT A;  4HVW A;  2KQW A;  2L3Q A;  2EQI A;  4JRI A;  1S72 A;  3QHS A;  3CPW P;  1AT1 B;  1SSF A;  2RI2 A;  3EG3 A;  2AT1 B;  3CBO A;  5GAN d;  1CKA A;  2RA2 A;  4F16 A;  2ZPF B;  1ZQ1 A;  4EMG A;  4Q5W A;  1LOJ A;  1N8R R;  3QKJ A;  1Q7Y C;  2L89 A;  3E9G A;  1X75 C;  2QDL A;  2J7I A;  3OY9 A;  2WSF E;  4N4G A;  2D8H A;  3HRS A;  2AKK A;  4KGX B;  2DKG A;  1M2V B;  3MP1 A;  1G3T A;  2VXF A;  1CSK A;  1E6G A;  2YRC A;  1RAD B;  5KCH A;  4M75 A;  2OTJ Q;  3PNW C;  1WZO A;  4OMN A;  3I56 T;  3H0H A;  3M57 A;  4A4E A;  4C8Q F;  2DM1 A;  2KT8 A;  4BAC A;  5D6Y A;  4M78 E;  3JCM d;  1BYM A;  3VS0 A;  3V8L A;  2GTO A;  2C0T A;  5GMK e;  3CPF A;  4RTT A;  3OYC A;  5IT9 E;  3LX7 A;  1FX7 A;  2X4X A;  1D1C A;  2E70 A;  3SWN C;  2ED1 A;  4K11 A;  1JXO A;  3L2R A;  3QZ9 B;  4XTV A;  1NJI R;  1PWT A;  4HCZ A;  2DTO A;  4FT2 A;  2HD0 A;  1YP5 A;  3M55 A;  4BE1 A;  4M78 F;  3CCU A;  2LZ6 B;  2E3I A;  1HYO A;  1I8F A;  1KHC A;  3RIR A;  5L23 A;  1OYX A;  1JB0 E;  3UWN A;  4F17 A;  1HJD A;  2KT1 A;  1YJ9 A;  1VQK Q;  2CP6 A;  2A36 A;  2OTJ T;  2KAF A;  1WHG A;  4IIO A;  4M7D B;  3OYL A;  1YIJ A;  4XU0 A;  4B6M A;  4FW1 A;  1UUE A;  4A4G A;  5GAO n;  4C5H A;  3V8K A;  1ACM B;  1NBE B;  2RK2 A;  2ZGW A;  4EMK B;  1E6H A;  2YXY A;  2FZK B;  1RAH B;  2FPE A;  4GY5 A;  1X43 A;  3EG1 A;  3HTR A;  3A8O B;  4E7Z A;  2Y90 A;  3O5Z A;  2EPD A;  2A37 A;  2LQW A;  2AZS A;  1VQ9 Q;  2K7A A;  3CCE T;  2L3S A;  1HSQ A;  2RNA A;  2MCN A;  1VQ7 A;  3PIO A;  4B9X A;  1YWP A;  1MV0 B;  2BKD N;  2B8A A;  1ZBX A;  2QQA A;  2R5A A;  4LUE A;  1W2B A;  3TVT A;  2O4X B;  1G3S A;  2QG9 B;  4FM4 B;  2HMA A;  3EFR A;  4XU3 A;  5LJ5 d;  4JJC A;  4EMK A;  3CXC P;  1SEM A;  4L59 A;  2LMJ A;  3QPH A;  2JOY A;  1EFN A;  2G3R A;  1WJS A;  1NYG A;  5KYY B;  1YCY A;  1QCN A;  1IZ6 A;  2DTH A;  1BI1 A;  2Y4X A;  2DIG A;  2HSE B;  4HXJ A;  3CCR Q;  4RTZ A;  2K57 A;  4A4K A;  4OVA A;  1VQ4 Q;  3G7Z A;  2VKN A;  5HK3 A;  2XG8 D;  2F5T X;  3J81 E;  5I22 A;  5GAN 2;  1WGS A;  1VQP Q;  2MPX C;  2NUP A;  4E7S A;  3SD4 A;  2PVO B;  4E7J A;  2BUD A;  3RES A;  2QGF B;  1VQ9 T;  2KI7 A;  1M1K U;  2A7Y A;  4MZM A;  2C06 A;  2CZ1 B;  1F1B B;  3JB9 D;  1CKB A;  1ZUK A;  1WHK A;  3DB3 A;  3JB9 G;  1M9S A;  1PSF A;  2ZAE A;  2M9U A;  2O4X A;  3SFM A;  4QVZ A;  3CCS Q;  5IXF A;  3PIP A;  2SRC A;  3OQ5 A;  5KYY A;  3AT1 B;  5CIU A;  4OB2 B;  4C0D C;  3FJP A;  3VS5 A;  3CBM A;  2V26 A;  4Z8A A;  4FYV B;  4J9F A;  2MIO A;  1G3Y A;  2LT4 A;  4J9E A;  1D3B B;  2JM8 A;  3CCR T;  1Q82 C;  1ZBJ A;  1VQ4 T;  5GAN 5;  3I56 A;  3GOX A;  3CMA Q;  5KE2 A;  2CS7 A;  2O88 A;  1VQ8 Q;  1ZUU A;  5IN1 A;  3RKX A;  3S3O A;  2K5F A;  4J9C A;  2DLP A;  1LCK A;  1VQP T;  1TS9 A;  2KVQ G;  3GBQ A;  1IRE B;  3X24 B;  1W4S A;  3E19 A;  3CC2 T;  1IB8 A;  2DJQ A;  1S72 Q;  3UAT A;  4CC3 A;  4DOW A;  3HRU A;  4PFP A;  3EH2 A;  2PZ1 A;  1WHJ A;  3CBP A;  2DBK A;  3RBB B;  1TH7 A;  3CC4 A;  2QGG A;  4RTX A;  1UGR B;  3H0F A;  2YDL A;  1W1F A;  3G4S T;  2J06 A;  2OAU A;  1TOV A;  1UHC A;  3L42 A;  1HD3 A;  3JCM Q;  1K4U S;  4J9B A;  1G2B A;  4J83 A;  1MND A;  4LDV A;  5CKF A;  1D3B A;  1ZSG A;  3I5R A;  1K9M R;  1GBR A;  2OX7 A;  2LQK A;  1RAG B;  4ELZ C;  2LP5 A;  3SDZ A;  3JB9 I;  3GLX A;  2OTJ A;  4C92 E;  2VVK A;  2CRE A;  4EIK A;  3D7S B;  3LGF A;  1X6G A;  3NHN A;  1Z9Q A;  5IXB A;  1KHI A;  2RK1 A;  2CUD A;  3C4S A;  2RQU A;  1QVG S;  3JV3 A;  3CC7 Q;  5GAO r;  1S72 T;  5M9O A;  3JRZ A;  4N0A A;  3JB9 J;  2DXC A;  1K8A C;  2DL7 A;  4C92 F;  1BKB A;  3UA6 A;  2FB7 A;  2RQV A;  4HVV A;  3V7S A;  2J6F A;  3RMS A;  3REA B;  1KSW A;  3CCE A;  1YHQ T;  1VIF A;  2QI2 A;  2DZ9 A;  2EYQ A;  3H0I A;  4HCK A;  4M7A B;  2KSS A;  3J80 E;  2PQW A;  2D0N A;  4F7U G;  4X9C A;  3QDF A;  1N27 A;  1FMK A;  4M75 C;  3MET A;  1WI7 A;  2X9H A;  1OX8 A;  3AHU A;  2ATC B;  4OB3 B;  2W0Z A;  3DLM A;  2RQT A;  5GAM e;  2CSQ A;  4E2F B;  2F2V A;  2CP0 A;  4C92 B;  2JJ9 A;  1SSH A;  3CC7 T;  4CRI A;  1GXI E;  1U06 A;  4ESR A;  2CT4 A;  5CKH A;  1M1F A;  1M90 R;  4PJO E;  4KT0 E;  1AWJ A;  3U23 A;  3VRZ A;  3VUB A;  5CR2 A;  2M1H A;  4JJB A;  4F04 B;  1YBY A;  4MDW A;  3PGG A;  2IVW A;  1RAI B;  3LH0 A;  4HT8 A;  4AFZ C;  1QW1 A;  2XDD A;  1VQ9 A;  1PD1 A;  4M7A A;  2XKO C;  1O9S A;  3PMI A;  1ABQ A;  4Z89 A;  3RDV A;  2JTM A;  5GAN 3;  3PMT A;  4QVD A;  3FB9 A;  1MNE A;  4M77 E;  2PNI A;  3ZEH A;  1K73 C;  4J7I A;  1R77 A;  2K5L A;  2K3B A;  3EGX B;  2JS2 A;  3CD6 Q;  3CCL T;  2O2O A;  2P0K A;  3FLG A;  4CC4 B;  2QXF A;  4X34 A;  3CPW S;  5LJ3 e;  4C92 A;  2BIV A;  4HCB A;  5GAM g;  3JCM P;  2JVV A;  1Y71 A;  3ME9 A;  4M77 F;  1SF9 A;  2X3X D;  1D1B A;  1RUW A;  1V1C A;  3JAM E;  5GAN 7;  3DB4 A;  4BI3 A;  2F69 A;  1WIE A;  2RJC A;  1QVF P;  3OW2 A;  5GAM j;  3I55 A;  1M5Q 1;  2VGM A;  5J39 A;  3V8J A;  1VQP A;  2O9V A;  2XMF A;  2KR3 A;  3CC2 A;  2GGR A;  3EFO B;  5GAN e;  1OU8 A;  4RTU A;  1VQM T;  4XTX A;  4PJO B;  4LE9 A;  4KH0 B;  3ZFJ A;  1YWO A;  4A63 B;  4XTZ A;  3EGX A;  4FIB A;  3UA7 A;  4XU2 A;  2VWF A;  2L0A A;  4GLM A;  4M7D C;  3CD6 T;  3I35 A;  1KQ1 A;  3M4G A;  4FYY B;  5GAN 6;  2E5Q A;  5I2S A;  2VGN A;  3G4S A;  2YWW A;  4M75 D;  1JEG A;  1OPK A;  5LJ3 g;  5GAO m;  3HFN A;  3JCM X;  4M75 G;  2AHJ B;  1G3W A;  4FYW B;  3CME T;  3NMZ C;  2F2X A;  1QKW A;  4IUU A;  2KGT A;  2CZ6 B;  1QQJ A;  2JTE A;  3M5A A;  5LJ3 j;  2CZ0 B;  1KC8 R;  2ENM A;  3JCM e;  2E6N A;  3I56 Q;  2K3Y A;  3MJX A;  4PJO A;  5GAM f;  1R8O B;  2AIR B;  3J7A F;  1WLP B;  3BFM A;  2JNG A;  2E41 A;  2YHT A;  4HVU A;  2PUK B;  2E3H A;  2KRM A;  2RHI A;  5GAN g;  5C0M A;  5KE3 A;  5KH6 A;  4YTL A;  1KIK A;  1FWZ A;  3L2W A;  1Q81 R;  1GCP A;  4ELY C;  2JZ2 A;  1H3H A;  1VQ6 T;  1VYV A;  2KYM A;  2LX9 A;  1T3L A;  2XK0 A;  1VIE A;  3VYH B;  1K9M U;  2DYI A;  3PTA A;  3CC4 Q;  5GAN j;  3L1A A;  4QVC A;  1NG2 A;  4KBM B;  3OYK A;  1YHQ A;  1OU9 A;  1V76 A;  3CCQ A;  2QQB A;  4C8Q E;  3EFS A;  4PJM A;  5CKB A;  2LC4 A;  4KRT A;  2K6D A;  4J6W A;  2ZPG B;  1O75 A;  1YJN A;  2VYT A;  3SB2 A;  4DOV A;  2KRS A;  2EWN A;  1QVF A;  2NYS A;  4Y91 A;  1BU1 A;  1LJO A;  1N5Z A;  1I5O B;  1OOT A;  1WX6 A;  2NUZ A;  2JT4 A;  2L3P A;  2M51 A;  1NEB A;  3OBY A;  5FLX E;  5LJ3 f;  1XQH A;  3H6Z A;  3BE3 A;  3JCM g;  3G1J A;  4MML A;  1W2B P;  1S1N A;  3CEY A;  3OMC A;  3CC7 A;  2FVU A;  2COZ A;  2D1X A;  2DPP B;  2LVM A;  4HT9 A;  1B3Q A;  2ESW A;  5A0L A;  2L3R A;  1M2O A;  3A8M B;  1NLP C;  2CT3 A;  4Y92 A;  3I5S A;  2DX1 A;  3CXC S;  4D8D A;  3HFO A;  3CC4 T;  4FCY A;  4ME7 A;  4NOY A;  2EGC A;  2XIC A;  3WXM B;  4RTW A;  4M7D D;  5GAN f;  1ZA1 B;  5DY9 A;  4OMO A;  3M4Y A;  3CCE Q;  2L5Q A;  4HA8 A;  4M7D G;  1C0M A;  1SPK A;  2HZY A;  1YI2 T;  4JS4 A;  3CCL A;  5LJ5 e;  3OSV A;  2KBT A;  3JCM V;  4C8Q B;  2QEX Q;  3CCJ T;  3QJY A;  4LN2 A;  2MMP A;  1GCQ A;  2A28 A;  3A8L B;  3HP9 A;  1M90 U;  1XOV A;  3M0S A;  1WYX A;  1RAF B;  4ZN1 A;  1N8R C;  1HK9 A;  4DEX A;  1VOM A;  5ECA A;  4ZNX A;  5J26 A;  3OYB A;  2CGH A;  3OYF A;  2CH4 W;  1QVP A;  3JCM f;  2J6O A;  4KGZ B;  4X1V A;  3GNF B;  1PSE A;  4M78 B;  3OYJ A;  3KXT A;  2HSP A;  2KRO A;  2JM9 A;  2RQW A;  1NLO C;  4LUD A;  1MV3 A;  4FL6 A;  4TVR A;  1VQM A;  2E64 A;  2A0F B;  2DNU A;  4QQG A;  5EC7 A;  1Q86 U;  1AZE A;  5GMK j;  2NUP B;  1BI2 A;  3M58 A;  4IUP A;  5FU6 B;  9ATC B;  4VUB A;  3FDR A;  3OA6 A;  5DLO A;  4C8Q A;  2HCK A;  3X25 B;  2KMT A;  2HEQ A;  3MHX A;  4RKU E;  4D6W A;  2DO3 A;  3CD6 A;  5A0D A;  5KYX B;  2VAS A;  1K0X A;  5LJ5 g;  1PNJ A;  2QEX T;  1X27 A;  1M8V A;  1XTD A;  3VV0 A;  2CP2 A;  1NJI C;  5FWB A;  1KQS A;  1LPL A;  1ZSZ C;  4WCI A;  3QG1 A;  1IGU A;  3CME A;  2OTL T;  4MDX A;  3OYN A;  1D0Y A;  2EAY A;  4PKC C;  1RI0 A;  5LJ5 j;  1H64 1;  2EYX A;  4C0F A;  4M78 A;  2RF0 A;  3OYD A;  3OMG A;  3S6W A;  1QP3 A;  4OGE A;  1UGS B;  4BY6 B;  4PLL A;  1KD1 R;  3I55 Q;  2F2W A;  1QLY A;  1JJ2 A;  4WF2 A;  3X26 B;  2MF2 A;  4E47 A;  4AG2 C;  4M7A C;  3CC2 Q;  2A3L A;  2H3J A;  4J9H A;  1VQL T;  3QSU A;  1Q7Y U;  1R0C B;  2B86 A;  5KYX A;  3HL8 A;  3JB9 F;  3RKY A;  2MAM A;  1M3C A;  1VQ6 A;  5DM7 R;  5GAO q;  4NS5 A;  1XJW B;  3QYH B;  1JO8 A;  3P8B B;  2O01 E;  2GCX A;  2FYK A;  2P0P A;  1V29 B;  3G4S Q;  3MO8 A;  1KC8 U;  3P8H A;  1D0Z A;  1QKX A;  4OF1 A;  1TWB A;  3RNJ A;  1PD0 A;  4JRQ A;  7AT1 B;  3SHW A;  5AYF A;  2DRK A;  3OW2 S;  2QK0 A;  5FU7 C;  5LJ5 f;  1E7O A;  5CKD A;  4EPC A;  2EQJ A;  4E7K A;  4JZ4 A;  4A4F A;  2FZC B;  4UC4 A;  4XU1 A;  1Q81 U;  3I55 T;  2LJ1 A;  4HCC A;  2W10 A;  1B7T A;  5FRO A;  3EHQ A;  3RUX A;  2D6F A;  3A1P A;  1UJY A;  3RR6 A;  4XK8 E;  8AT1 B;  3A98 A;  1K8A R;  3GNG A;  1SG5 A;  1ARK A;  1AWW A;  1G83 A;  2PTK A;  4RTY A;  1A0N B;  1BCO A;  1X2K A;  1M3A A;  3WVD B;  5I2M A;  2X3W D;  4L6V 5;  2XI9 A;  1M30 A;  1WJR A;  4QW2 A;  4XTW A;  2ROT A;  4XTU A;  4FSS A;  2DD5 A;  4F14 A;  1UB4 A;  2RHX A;  1AWO A;  2YUN A;  2QDY B;  2GQV A;  1Y0M A;  2QYZ A;  4JZ3 A;  2KXC A;  4R56 A;  1YHQ Q;  3EG9 B;  3CCQ Q;  3M59 A;  2DK3 A;  4DEY A;  4C5I A;  3G6E Q;  1YJN Q;  1YI2 A;  1IXD A;  1G8X A;  2CDT A;  3M0T A;  1G5V A;  1LNX A;  5LJ3 h;  1UG1 A;  2ZPE B;  3CCJ A;  5L8R E;  3EGU A;  3WVE B;  3QWY A;  2YRV A;  1NEG A;  1SKU B;  2Z0W A;  3EG0 A;  1I1J A;  1JXM A;  3E9F A;  1BB9 A;  4PJO C;  3HPW A;  2KRN A;  2P4R A;  1QP2 A;  3RKW A;  1WHL A;  4ZTJ A;  5C6S A;  2QA4 Q;  1HXD A;  4F7U E;  4V2S A;  4DBQ A;  1OV3 A;  4LDX A;  4M7A D;  3EH1 A;  5GJW B;  3JCM c;  3Q1J A;  2DAQ A;  1WQ7 A;  1TSF A;  2LQ8 A;  3OBW A;  3CCM T;  2RQR A;  3A5Z B;  4M7A G;  2RM4 A;  1UDL A;  1VQ5 Q;  4J8O A;  1C1A A;  2F5K A;  5GAN h;  3OW2 P;  2AK5 A;  3EG9 A;  4PK4 A;  4IUV A;  2EJF A;  2P84 A;  1PC0 A;  1U3O A;  2P4T A;  3CCQ T;  4JRK A;  2HBW A;  1QVF S;  4F7U F;  4C92 D;  3OYE A;  4D8K A;  3NFC A;  3QO3 A;  2GQI A;  3G6E T;  1YJN T;  5HCK A;  3VS1 A;  2DBM A;  2XD0 A;  1T0J A;  4C92 G;  2V8I A;  1OZ2 A;  2QEX A;  2VV5 A;  3C95 A;  3CCL Q;  1GFD A;  1UTI A;  2KK4 A;  1OQK A;  2DVJ A;  2YUQ A;  2M16 A;  1EZZ B;  1ZX6 A;  1IRX A;  1KK7 A;  3PVL A;  3A8H B;  2OTL A;  2VXE A;  1Y7X A;  3E1S A;  2FRY A;  2QTV A;  3ULR B;  2MWP A;  1Y57 A;  3MPU B;  1RAB B;  2JW4 A;  3G71 A;  2QA4 T;  4QT7 A;  2O31 A;  1OI1 A;  3H8Z A;  1K9M C;  4E6R A;  2CP3 A;  4CC2 A;  3JCM h;  3OB9 A;  2M02 A;  3EGD A;  3OYM A;  3CCV T;  2GFA A;  2JXB A;  1I0C A;  3MEV A;  2JTF A;  2LCC A;  1TU0 B;  2HKQ B;  5I21 A;  3M9Q A;  4IIM A;  3JSC A;  4JPB W;  2COW A;  5J3B A;  1VQ5 T;  4BDY A;  1X2Q A;  1UEC A;  3HHT B;  2CH4 A;  1NPP A;  3FRN A;  4C0D B;  1EX4 A;  1VQL A;  4RG2 A;  3VS6 A;  2HQE A;  1VQM Q;  1U5S A;  4OB0 B;  3F70 A;  2XDP A;  4JLG A;  2RMO A;  2EYZ A;  4R0K A;  4C5E A;  2K9G A;  2WSC E;  1YJW T;  3R6O A;  2EGA A;  4BUG A;  2RI5 A;  1JU5 C;  1K1Z A;  2VUB A;  2V1R A;  3KBG A;  4FYX B;  2PVG B;  1WA7 A;  1Q86 R;  1QWF A;  2LQN A;  3PT9 A;  5GAO p;  2IG0 A;  4PJJ A;  3X20 B;  2KDS A;  5CKE A;  1KD1 U;  2E65 A;  4PJO D;  2VB6 A;  3CME Q;  3FJ5 A;  2LJ3 A;  2E10 A;  1ABO A;  2X51 A;  2MI6 A;  4PJO G;  1ZLM A;  3L2Q A;  2ZPB B;  3EHR A;  1UGV A;  5A2Q E;  4O5V A;  2CKK A;  2DTI A;  1JBM A;  2VC8 A;  4R55 A;  2EVR A;  2L8D A;  3BDL A;  5KYU A;  1ZUY A;  2RHY A;  5GMK h;  5GMK l;  2K3X A;  4AMC A;  4BB7 A;  3S3M A;  1FYN A;  2K4Y A;  3LWI A;  5GMK m;  1WXB A;  4C8Q C;  1M90 C;  5KYW A;  3L2V A;  1VQ6 Q;  4DBR A;  1W2B S;  2YSQ A;  3QWX X;  3UPU A;  2EJ9 A;  1KQS S;  1M3B A;  5IHN A;  2DJZ A;  3VU3 C;  5GAO l;  1Q7Y R;  4QQD A;  4M77 B;  1QCF A;  2C0I A;  3MCA B;  4M75 F;  4AG1 C;  4LNP A;  5LL6 S;  4EMK C;  4KUI A;  2DYB A;  5LJ5 h;  4CI0 C;  3VYG A;  4KUL A;  2QQ9 A;  2PU9 B;  3TRE A;  3OS5 A;  2J6K A;  4M78 C;  3EAE A;  1SHG A;  1JJ2 S;  4JDS A;  3UF4 A;  2MWO A;  1K8A U;  4IKF A;  1M8M A;  1JRI A;  1WXU A;  3MP8 A;  1TUD A;  1I07 A;  2FEI A;  3M0P A;  3QZ5 B;  2FZG B;  5LJ3 d;  2HNI A;  4AFS C;  1VQN T;  2LTO A;  1LVK A;  1X01 A;  1WXT A;  2CYZ B;  2K2V A;  1GRI A;  2H8H A;  2J05 A;  1PRM C;  2HQH A;  3CCM A;  4M77 A;  1VQO T;  3NGP A;  3DKM A;  3TSW A;  3C94 A;  1Z9Z A;  2DZC A;  2RJF A;  3OYH A;  3VS7 A;  2V1Q A;  1GBQ A;  3MKD A;  3PVQ A;  3ER0 A;  1D09 B;  1QVG A;  3HKS A;  2MOX A;  3G6E A;  2DD4 A;  1OEB A;  4JJN K;  3E2U A;  1VYT A;  2EGE A;  4BY6 C;  4L5G A;  4FSX A;  1YI2 Q;  2M0O A;  1GFC A;  3VRY A;  1IHV A;  1QMC A;  3CCJ Q;  4ANJ A;  1M1K C;  1N9S A;  3M0R A;  5KCO A;  4M4Z A;  2FPF A;  1U8R A;  2H3E B;  2DA9 A;  1DJ7 B;  1M1G A;  3LYI A;  4M7D E;  1WHH A;  2QA4 A;  2GFU A;  1KQS P;  5FRM A;  2BE9 B;  3VUZ A;  1TUC A;  2P0Q A;  1UHF A;  1UFF A;  1XNI A;  2RPN A;  5CCA A;  2RHZ A;  3CCV A;  4BE0 A;  3JCM J;  5FWC A;  2QQS A;  4RCC A;  1KC8 C;  1VQ5 A;  4C8Q D;  2EFI A;  1K73 U;  3S3N A;  1H3Z A;  2R58 A;  1GL5 A;  2JUF A;  2EYY A;  4C8Q G;  1YFN A;  1JJ2 P;  4M7D F;  2E12 A;  4B9W A;  3URG A;  2QAS A;  3SEM A;  4OB1 B;  1YJW A;  1RAC B;  3REB B;  1Q81 C;  5GAN 8;  2LCL A;  3JB9 H;  1MUZ A;  1ZA2 B;  4FW2 A;  2E1H A;  2ECZ A;  2M0Y A;  4C0Z A;  2E6Z A;  2K2M A;  2CUB A;  1FXX A;  2EBP A;  4ZGE B;  4M78 D;  1M2V A;  2LJ0 A;  1PKS A;  3M0Q A;  3L2U A;  1M27 C;  4OP0 A;  1QCO A;  4M78 G;  2OTL Q;  2EKO A;  2YLB A;  4IUQ A;  1M4Z A;  3UDC A;  4LDU A;  1NZ9 A;  3G71 Q;  3NTH A;  3VS3 A;  1MGQ A;  1AWX A;  2LT1 A;  2AZV A;  2GBQ A;  2IIM A;  4N0A C;  2CP5 A;  4OMQ A;  2DL4 A;  1AZG B;  3CPW A;  1IO6 A;  3C0C A;  2EJG A;  3PE0 A;  4FT4 A;  4MMK A;  5CQY A;  1NM7 A;  4C5G A;  2RD1 A;  1FMV A;  1K0S A;  2MK5 A;  2ZPH B;  1C6V X;  1Y07 A;  3M56 A;  1VQL Q;  5DLQ E;  3TQ7 P;  1D0X A;  4CC7 A;  3GF5 A;  3TU4 K;  3BY7 A;  1TTH B;  4AT1 B;  1IHW A;  3LW5 E;  5FRN A;  2DL3 A;  2DET A;  1NPR A;  2BZX A;  2RN8 A;  4X9D A;  3OYA A;  4OMM A;  4PNO A;  1YIT A;  3BW1 A;  2XU8 A;  8ATC B;  1Y96 B;  4E7I A;  1B34 B;  3KUF A;  5IHI A;  2D0Q B;  1X69 A;  4N4H A;  4PJL A;  4OMF B;  1YN8 A;  3G71 T;  1Q82 R;  3INZ A;  1VQK T;  4KUD K;  4M7D A;  2ED0 A;  2LX7 A;  3QII A;  3GIB A;  2PVD B;  4P5N A;  2O9S A;  1PG5 B;  4PL6 A;  4FU6 A;  4LD6 A;  2GNC A;  2ZPI B;  1I81 A;  3CQT A;  4RTV A;  2HL3 A;  2YRD A;  4JLI A;  3LWH A;  1VQN A;  3X28 B;  2FPD A;  4ZTF A;  3L2Z A;  1TXQ A;  4QQ6 A;  1H92 A;  4J9D A;  1UGQ B;  2WAC A;  4IUR A;  1MHN A;  2DXT A;  5D6X A;  3OSS C;  2DRM A;  2I0N A;  1VQO A;  2GF7 A;  2DIQ A;  3HRT A;  2LCS A;  4WTO B;  2YUO A;  2Y4Y A;  4PLI A;  4HKE A;  1K9A A;  1NYF A;  4A4H A;  1Y96 A;  5GAN 4;  1B34 A;  3MEA A;  2JN0 A;  2KNB B;  3BDU A;  4C92 C;  2CZ7 B;  3GP8 A;  1MMN A;  1RI9 A;  4A54 A;  2MYS A;  3FIF A;  4NL3 A;  5HY6 A;  2DXB A;  2AKL A;  2DEU A;  4PFZ A;  2C0O A;  1WJQ A;  3M54 A;  4JS5 A;  4OMP A;  4DBF A;  3THK A;  2KE9 A;  2X35 A;  3FC3 A;  4J5Y A;  5GAM h;  2ROL A;  2LNH B;  4BI8 B;  2BE7 D;  1K76 A;  3TEE A;  5I11 A;  3SWN B;  2HKN A;  4EDU A;  1BI0 A;  4OGC A;  1WFW A;  2E5K A;  5CQX A;  1BCM A;  3MEU A;  1PHT A;  4LD9 K;  3ZBD A;  4J6X A;  1T0H A;  1WDX A;  2D9T A;  2WSE E;  4XAX B;  1TUG B;  4JJD A;  1MMD A;  2EQU A;  3T9N A;  3QBY A;  2DMO A;  2RO0 A;  2HL5 C;  3CCM Q;  4DA4 A;  4E7L A;  1FMW A;  1KD1 C;  1SRM A;  1WPY A;  1SRL A;  2EYW A;  4RMO A;  1UE9 A;  4J6Y A;  2YT6 A;  6AT1 B;  3OYY A;  2KXD A;  1VA7 A;  1VYU A;  1T3S A;  1IGQ A;  1N8R U;  3HSB A;  3QJ6 A;  3JCM W;  4DBH A;  2FG0 A;  4M7A E;  3SWN A;  3CCS T;  4QKU A;  4J9G A;  1ZHI A;  2HAX A;  4GLK A;  2OAW A;  3CXC A;  3QYG B;  1X6B A;  2CP7 A;  2DL8 A;  3UT1 A;  4OML A;  4PFO A;  4XTY A;  3MEW A;  2QTX A;  5CK9 A;  3TCJ A;  3MP6 A;  2DFU A;  2D8J A;  1P92 A;  3M0U A;  2V8K A;  2OI3 A;  3CMA T;  4M7A F;  1VQ8 T;  4LXC A;  2DF6 A;  3CCV Q;  2YLC A;  5GMK i;  4M77 C;  3M53 A;  3LH5 A;  1KQ2 A;  2FRW A;  3EGD B;  2DXU A;  3H41 A;  1PRL C;  3KFV A;  3C12 A;  1ZSZ B;  2R5M A;  5IHK A;  3OYI A;  1NJI U;  2HBP A;  2LRQ A;  2K5I A;  4NL2 A;  5IH2 A;  2KEA A;  2OJ2 A;  5IAY A;  4C0G A;  1YJW Q;  1K73 R;  2V8J A;  3PFS A;  2BZ8 A;  4RCB A; 
#chains in the Genus database with same CATH homology
 2EJ9 A;  1KQS S;  3VU3 C;  2DJZ A;  5DY9 A;  5GAO l;  4RG8 A;  4QQD A;  3FEO A;  3M4Y A;  4M77 B;  2L5Q A;  3DB3 A;  3JB9 G;  3MCA B;  4LDY A;  4M75 F;  1M9S A;  1PSF A;  1VUB A;  4HA8 A;  2M9U A;  2O4X A;  3QXE B;  3SFM A;  4M7D G;  4QVZ A;  5LL6 S;  4EMK C;  3DLL A;  4KUI A;  1BIA A;  5D6W A;  1YI2 T;  3PIP A;  4JS4 A;  3VJP A;  3CCL A;  5LJ5 h;  4CI0 C;  3OSV A;  5LJ5 e;  3OQ5 A;  3VYG A;  4KUL A;  2QQ9 A;  3JCM V;  4C8Q B;  2PU9 B;  5CIU A;  4II1 A;  4N4I A;  4OB2 B;  4C0D C;  3TRE A;  3QJY A;  3CCJ T;  3FJP A;  3OS5 A;  3CBM A;  2MMP A;  4M78 C;  3A8L B;  4E7H A;  3RMQ A;  3HP9 A;  1M90 U;  1XOV A;  3QUI A;  1VQK A;  2HQX A;  3GPL A;  4ZN1 A;  1N8R C;  1HK9 A;  3EAE A;  1JJ2 S;  4LDW A;  4JDS A;  4IKF A;  2MWO A;  1K8A U;  1JRI A;  1G3Y A;  3MP8 A;  2LT4 A;  1U1S A;  1D3B B;  3CCR T;  1Q82 C;  3QZ5 B;  5J26 A;  1WNL A;  3OYB A;  1VQ4 T;  2EQK A;  5LJ3 d;  5GAN 5;  2HNI A;  3I56 A;  3GOX A;  5KE2 A;  2CS7 A;  1VQN T;  2CGH A;  3OYF A;  2LTO A;  1X01 A;  4F7U B;  2RHU A;  5IN1 A;  3RKX A;  3S3O A;  2K5F A;  1QVP A;  4MZT A;  2CYZ B;  2RJE A;  1VQP T;  3OS2 A;  2KVQ G;  5A0G A;  1IRE B;  2K2V A;  3JCM f;  4XQ3 A;  3X24 B;  4JRP A;  3A8G B;  3GNF B;  1PSE A;  1W4S A;  3E19 A;  4M78 B;  3OYJ A;  3KXT A;  3CC2 T;  3CCM A;  4M77 A;  1VQO T;  3DKM A;  4A53 A;  2RH2 A;  4FL6 A;  3C94 A;  4TVR A;  2DZC A;  3VKI A;  2RJF A;  1VQM A;  4DOW A;  3HRU A;  2E64 A;  3OYH A;  5FU7 B;  4QQG A;  1Q86 U;  3NTI A;  5GMK j;  2EIF A;  1BI2 A;  3M58 A;  4IUP A;  5FU6 B;  4O6J A;  3FDR A;  4VUB A;  3ER0 A;  3OA6 A;  1Q82 U;  5DLO A;  4C8Q A;  3CBP A;  3X25 B;  1TH7 A;  3CC4 A;  2FL7 A;  5CVI A;  2KMT A;  1QVG A;  2RB6 A;  3HKS A;  1UGR B;  3MHX A;  3G6E A;  4RKU E;  4D6W A;  2DO3 A;  2RJD A;  3LGL A;  4Y28 E;  3CD6 A;  5A0D A;  2DVE A;  2DD4 A;  4J7F A;  2X4W A;  2DEQ A;  3G4S T;  4JJN K;  5LJ5 g;  2OAU A;  3CCU T;  4BY6 C;  2QEX T;  4L5G A;  3L42 A;  4MZP A;  4ZN3 A;  4FSX A;  3JCM Q;  1M8V A;  3OS1 A;  4J83 A;  1XTD A;  2M0O A;  4LDV A;  5CKF A;  3VV0 A;  1D3B A;  4PJO F;  1NJI C;  2XID A;  1KQS A;  1UEB A;  1X6O A;  2LQK A;  1M1K C;  3QG1 A;  1YJ9 T;  1N9S A;  4ELZ C;  4EMH A;  3OYG A;  5KCO A;  3CME A;  4BDZ A;  3SDZ A;  2OTL T;  3JB9 I;  1UGP B;  3OYN A;  3GLX A;  4F7U A;  4MDX A;  1U8R A;  2OTJ A;  2EAY A;  4PKC C;  4C92 E;  1RI0 A;  5LJ5 j;  3JCM b;  1DJ7 B;  1M1G A;  2ZCF B;  3LYI A;  4M7D E;  1H64 1;  2QA4 A;  2GFU A;  4C0F A;  1RL2 A;  5FRM A;  4M78 A;  1YIJ T;  3V7R A;  2ZZD A;  3LGF A;  3OYD A;  3OMG A;  4M77 D;  3S6W A;  3VUZ A;  1QP3 A;  4OGE A;  1UGS B;  4M75 E;  2P0Q A;  1KHI A;  2RK1 A;  1XNI A;  4BY6 B;  5CCA A;  4PLL A;  2RHZ A;  5GAM d;  3CCR A;  3CCV A;  3C4S A;  4BE0 A;  1QVG S;  2X4J A;  3JCM J;  4M77 G;  2QQS A;  4IUT A;  3V7C A;  4ZGJ B;  1VQ4 A;  1JJ2 A;  4WF2 A;  4RCC A;  3X26 B;  5GAO r;  2MF2 A;  1KC8 C;  1I5L A;  1S72 T;  1VQ5 A;  4C8Q D;  2EFI A;  5M9O A;  3JRZ A;  4E47 A;  3S3N A;  1K73 U;  4M7A C;  2A3L A;  4N0A A;  1N9R A;  3JB9 J;  2H3J A;  1H3Z A;  1VQL T;  3QSU A;  2DXC A;  2R58 A;  1Q7Y U;  1K8A C;  2KY9 A;  4C92 F;  2JUF A;  2RI3 A;  4DQ2 A;  3HL8 A;  4C8Q G;  3OS0 A;  1BKB A;  3JB9 F;  2QQR A;  4M7D F;  3P8D A;  3RKY A;  2MAM A;  2E12 A;  2FB7 A;  4B9W A;  1VQ6 A;  3URG A;  1OZ3 A;  1U1T A;  5DM7 R;  4Z02 A;  2NLU A;  5GAO q;  4OB1 B;  1YJW A;  4NS5 A;  3UPU A;  3V7S A;  2LDM A;  3QYH B;  2PUO B;  1Q81 C;  5GAN 8;  3LLR A;  3O8V A;  3RMS A;  1YIT T;  2LCL A;  1AHJ B;  3P8B B;  2O01 E;  2GCX A;  3CCE A;  3JB9 H;  1YHQ T;  1VIF A;  1BIB A;  2QI2 A;  1BI3 A;  2DZ9 A;  2FYK A;  2E1H A;  2P0P A;  1VQ7 T;  4ZGD B;  2EYQ A;  1V29 B;  4C0Z A;  1EIF A;  1N6A A;  2E6Z A;  3MO8 A;  3CCS A;  4M7A B;  1FXX A;  2KSS A;  1I4K 1;  2I2L A;  3J80 E;  1KC8 U;  2PQW A;  2XHC A;  4M78 D;  3P8H A;  4F7U G;  4ZGE B;  4X9C A;  2XDB A;  2R57 A;  4BD3 A;  4OF1 A;  1N27 A;  5CO7 A;  4BI4 A;  4M75 C;  3MET A;  3QDR B;  4JRQ A;  3ASK A;  3L2U A;  3AHU A;  1Q86 C;  5AYF A;  4OP0 A;  3OW2 S;  5CAI A;  4JUV A;  4M78 G;  4OB3 B;  2EKO A;  5FU7 C;  3DLM A;  5LJ5 f;  2YLB A;  4IUQ A;  5HK0 A;  1M4Z A;  1NE8 A;  3UDC A;  4LDU A;  5CKD A;  1NZ9 A;  5FU6 C;  5GAM e;  1KG1 A;  3NTK A;  3NTH A;  1MGQ A;  2EQJ A;  4EPC A;  4E7K A;  4A4F A;  2LT1 A;  4UC4 A;  4ATO A;  4N0A C;  4XU1 A;  1Q81 U;  4BE2 A;  2LNV A;  3I55 T;  3RER A;  4C92 B;  1GXI E;  3CC7 T;  4CRI A;  3N5B B;  4HCC A;  3CMA A;  1VQ8 A;  5FRO A;  5CKH A;  3RUX A;  3CPW A;  2D6F A;  1M1F A;  2EJG A;  4M75 B;  4FT4 A;  5HKC A;  4PJO E;  4XK8 E;  4KT0 E;  4MMK A;  5CQY A;  2EQM A;  1WQW A;  4C5G A;  2RD1 A;  3GNG A;  3VUB A;  5CR2 A;  5EG2 A;  2M1H A;  2X4Y A;  2FHD A;  2ZPH B;  1Y07 A;  2KQW A;  3M56 A;  1YBY A;  4JRI A;  4MDW A;  3PGG A;  5DLQ E;  2IVW A;  3QHS A;  3WVD B;  5I2M A;  3LH0 A;  1S72 A;  4L6V 5;  2XI9 A;  4XTW A;  1WJR A;  4QW2 A;  4HT8 A;  1VQ9 A;  1QW1 A;  1SSF A;  2XDD A;  4XTU A;  3GF5 A;  2DD5 A;  4M7A A;  1UB4 A;  2XKO C;  2RHX A;  3TU4 K;  3BY7 A;  1O9S A;  3PMI A;  3CBO A;  2QDY B;  2GQV A;  5GAN d;  2JTM A;  5GAN 3;  3PMT A;  3LW5 E;  4QVD A;  5FRN A;  3FB9 A;  2RA2 A;  4M77 E;  4R56 A;  1NPR A;  3ZEH A;  2ZPF B;  4X9D A;  3M59 A;  2DK3 A;  3OYA A;  1ZQ1 A;  4EMG A;  1K73 C;  4J7I A;  4PNO A;  4Q5W A;  4C5I A;  2K5L A;  3BW1 A;  1YIT A;  1LOJ A;  3CCL T;  3QKJ A;  1YI2 A;  2XU8 A;  1Q7Y C;  1Y96 B;  2P0K A;  3FLG A;  4E7I A;  2L89 A;  2QXF A;  1B34 B;  3KUF A;  4X34 A;  3E9G A;  1X75 C;  1G5V A;  1LNX A;  2D0Q B;  5LJ3 h;  5LJ3 e;  3CPW S;  2ZPE B;  2WSF E;  4N4G A;  4C92 A;  4N4H A;  5L8R E;  3OY9 A;  3HRS A;  4OMF B;  3G71 T;  3CCJ A;  3INZ A;  2BIV A;  3WVE B;  1VQK T;  4HCB A;  2YRV A;  4KUD K;  2DKG A;  4M7D A;  5GAM g;  3MP1 A;  1G3T A;  2VXF A;  3QII A;  3JCM P;  3E9F A;  3GIB A;  4PJO C;  2PVD B;  3HPW A;  2JVV A;  4P5N A;  5KCH A;  4M75 A;  1Y71 A;  3ME9 A;  4M77 F;  4PL6 A;  4FU6 A;  3JAM E;  4LD6 A;  5GAN 7;  1QP2 A;  2ZPI B;  1I81 A;  3PNW C;  3RKW A;  4ZTJ A;  5C6S A;  3DB4 A;  3I56 T;  4BI3 A;  2F69 A;  2RJC A;  1HXD A;  4F7U E;  4JLI A;  3LWH A;  3GP8 A;  3OW2 A;  3X28 B;  4ZTF A;  1VQN A;  3L2Z A;  5GAM j;  3M57 A;  4LDX A;  4V2S A;  4A4E A;  3I55 A;  4C8Q F;  4M7A D;  1M5Q 1;  2VGM A;  3JCM c;  5J39 A;  3PFS A;  4QQ6 A;  4BAC A;  3V8J A;  1VQP A;  3Q1J A;  2DAQ A;  1WQ7 A;  5D6Y A;  2LQ8 A;  4M78 E;  3JCM d;  1BYM A;  1UGQ B;  3OBW A;  2WAC A;  4IUR A;  1MHN A;  2DXT A;  3CCM T;  3A5Z B;  3CC2 A;  3V8L A;  4M7A G;  5D6X A;  2RM4 A;  3OSS C;  2F5K A;  4J8O A;  5GAN e;  5GAN h;  2GF7 A;  5GMK e;  2DIQ A;  3HRT A;  3CPF A;  1VQO A;  1VQM T;  4PJO B;  4XTX A;  3OYC A;  5IT9 E;  3LX7 A;  1FX7 A;  2Y4Y A;  4IUV A;  4PLI A;  4HKE A;  2EJF A;  2X4X A;  4XTZ A;  3ZFJ A;  4FIB A;  4A4H A;  2E70 A;  1Y96 A;  2P4T A;  3SWN C;  5GAN 4;  3CCQ T;  4XU2 A;  4JRK A;  1QVF S;  1B34 A;  3MEA A;  4F7U F;  2JN0 A;  3BDU A;  4C92 C;  4C92 D;  2CZ7 B;  3QZ9 B;  3OYE A;  4XTV A;  4A54 A;  3NFC A;  3QO3 A;  3L2R A;  3G6E T;  1YJN T;  4M7D C;  3CD6 T;  3FIF A;  4HCZ A;  4NL3 A;  1KQ1 A;  2DTO A;  3M4G A;  2HD0 A;  4FT2 A;  5HY6 A;  5GAN 6;  3M55 A;  2DXB A;  2E5Q A;  4BE1 A;  5I2S A;  2XD0 A;  2VGN A;  4M78 F;  3G4S A;  4C92 G;  4M75 D;  3CCU A;  2V8I A;  1OZ2 A;  2QEX A;  2VV5 A;  3C95 A;  5LJ3 g;  5GAO m;  3HFN A;  1WJQ A;  3M54 A;  4JS5 A;  1I8F A;  1KHC A;  2KK4 A;  3RIR A;  3JCM X;  1OYX A;  1JB0 E;  3UWN A;  2X35 A;  4M75 G;  2AHJ B;  1G3W A;  2M16 A;  4J5Y A;  3FC3 A;  3CME T;  5GAM h;  1YJ9 A;  3A8H B;  4BI8 B;  2OTL A;  2VXE A;  1Y7X A;  3E1S A;  2OTJ T;  3TEE A;  3SWN B;  2KAF A;  4EDU A;  4IUU A;  1BI0 A;  2CZ6 B;  2MWP A;  4OGC A;  3G71 A;  2QA4 T;  5CQX A;  1OI1 A;  3M5A A;  3H8Z A;  5LJ3 j;  1K9M C;  3MEU A;  4M7D B;  3OYL A;  4LD9 K;  2CZ0 B;  3ZBD A;  1YIJ A;  4XU0 A;  4J6X A;  3JCM h;  3OB9 A;  3JCM e;  2E6N A;  4A4G A;  2K3Y A;  3OYM A;  5GAO n;  2D9T A;  5GAM f;  3CCV T;  2GFA A;  4PJO A;  1R8O B;  2WSE E;  4C5H A;  3MEV A;  4XAX B;  2JTF A;  2LCC A;  3V8K A;  3J7A F;  5I21 A;  2RK2 A;  3M9Q A;  3JSC A;  2ZGW A;  3BFM A;  2JNG A;  2E41 A;  5J3B A;  2YHT A;  4EMK B;  1VQ5 T;  2EQU A;  4BDY A;  2PUK B;  3T9N A;  2RHI A;  3QBY A;  5GAN g;  3HHT B;  5C0M A;  2RO0 A;  4GY5 A;  5KE3 A;  5KH6 A;  4DA4 A;  4YTL A;  4E7L A;  1NPP A;  1FWZ A;  3FRN A;  4C0D B;  1KD1 C;  1VQL A;  1WPY A;  3L2W A;  4RG2 A;  2HQE A;  4ELY C;  4RMO A;  3A8O B;  4OB0 B;  3F70 A;  2XDP A;  2Y90 A;  4J6Y A;  4JLG A;  2JZ2 A;  1VQ6 T;  3OYY A;  2LX9 A;  4C5E A;  2WSC E;  2XK0 A;  1YJW T;  1VIE A;  3R6O A;  3VYH B;  1N8R U;  1K9M U;  3HSB A;  4BUG A;  3PTA A;  2RI5 A;  5GAN j;  3L1A A;  3QJ6 A;  4QVC A;  2VUB A;  3JCM W;  3CCE T;  3KBG A;  4KBM B;  3OYK A;  1YHQ A;  3CCQ A;  2QQB A;  2PVG B;  4C8Q E;  3EFS A;  5CKB A;  1VQ7 A;  4M7A E;  2LC4 A;  3SWN A;  3CCS T;  4J6W A;  2ZPG B;  1O75 A;  3PT9 A;  1YJN A;  1ZHI A;  5GAO p;  3PIO A;  2HAX A;  4GLK A;  2IG0 A;  4B9X A;  2VYT A;  3SB2 A;  3CXC A;  4DOV A;  3QYG B;  3X20 B;  2BKD N;  2B8A A;  1ZBX A;  2EWN A;  2QQA A;  2KDS A;  5CKE A;  4Y91 A;  1QVF A;  1LJO A;  2R5A A;  1KD1 U;  2E65 A;  4PJO D;  1W2B A;  3UT1 A;  2O4X B;  1G3S A;  2E10 A;  4FM4 B;  4XU3 A;  3EFR A;  5LJ5 d;  5FLX E;  3OBY A;  4XTY A;  3MEW A;  2MI6 A;  2QTX A;  4EMK A;  5CK9 A;  3TCJ A;  5LJ3 f;  4PJO G;  1XQH A;  3H6Z A;  3MP6 A;  4L59 A;  3L2Q A;  2ZPB B;  3QPH A;  3JCM g;  2JOY A;  2G3R A;  1WJS A;  4MML A;  1P92 A;  1YCY A;  1IZ6 A;  3CEY A;  2DTH A;  1BI1 A;  2Y4X A;  2DIG A;  2V8K A;  3CMA T;  4M7A F;  5A2Q E;  3OMC A;  4O5V A;  3CC7 A;  2CKK A;  2FVU A;  1VQ8 T;  2DPP B;  2LVM A;  2YLC A;  2K57 A;  2DTI A;  4M77 C;  4A4K A;  5GMK i;  4HT9 A;  4OVA A;  1JBM A;  3M53 A;  2VC8 A;  4R55 A;  2L8D A;  3BDL A;  5A0L A;  2L3R A;  1KQ2 A;  3G7Z A;  2RHY A;  5GMK h;  5GMK l;  2K3X A;  3A8M B;  5HK3 A;  2XG8 D;  2F5T X;  3J81 E;  4BB7 A;  2DXU A;  3S3M A;  5GAN 2;  1WGS A;  2K4Y A;  3LWI A;  5GMK m;  3C12 A;  2R5M A;  4C8Q C;  3SD4 A;  3OYI A;  2PVO B;  3CXC S;  1NJI U;  4E7J A;  2BUD A;  1M90 C;  2HBP A;  3RES A;  3HFO A;  2LRQ A;  1VQ9 T;  2K5I A;  3CC4 T;  4ME7 A;  1M1K U;  4NL2 A;  2A7Y A;  3L2V A;  4NOY A;  4MZM A;  2C06 A;  2CZ1 B;  1W2B S;  5IAY A;  3JB9 D;  2XIC A;  3WXM B;  4C0G A;  4M7D D;  2V8J A;  2RI2 A;  5GAN f;  4RCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...