4M78F

Crystal structure of lsm2-8 complex, space group p21
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
65
Chain Sequence
ILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 10
structure length 65
sequence length 79
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78F00
4M77E 4C92G 4HT9A 4PJOE 2RB6A 1LOJA 2CGHA 4N0AA 3JCMh 3EFSA 3RESA 4J6WA 3HFOA 5LJ5e 1I81A 4C92C 4PJOB 1M5Q1 2YHTA 5GAN3 5GAMf 4EMHA 5GAN4 3L2ZA 2DTIA 4M78D 3JCMX 3BDUA 4XU1A 4M77A 5DY9A 3RUXA 4M78G 4M75G 4XTWA 4Y91A 2EAYA 1MGQA 1WPYA 3HSBA 4M7DD 5LJ3g 3JCMe 5LJ5f 4F7UG 3EFRA 5LJ3h 2EJFA 1U1TA 3L1AA 4XTUA 4F7UA 4QVCA 4M75F 4EMKB 3JB9J 4J6YA 3SWNB 5GAMj 4JLIA 5GAMh 3BFMA 4M7AG 3PGGA 4M7AA 4M7AE 3FB9A 4M77D 1U1SA 4PJOD 5GMKm 3GIBA 3JB9H 4EMKC 4F7UE 1WQ7A 3QUIA 3JB9D 5GAN6 5LJ3f 5GAN5 4M7AF 1YCYA 1JBMA 1WNLA 1WQWA 2DTHA 3RKWA 3JCMg 4QVDA 4XU0A 4C92F 5LJ3e 4M78E 3JCMQ 5GANj 2RM4A 3M4GA 2DKGA 2VXFA 2DTOA 1BIAA 2E64A 3AHUA 2DVEA 3FIFA 3QHSA 3BY7A 4A53A 4M77C 4JUVA 5LJ5g 5LJ5j 4PJOC 1I4K1 4XTYA 5GMKi 1X01A 1I8FA 4A54A 2I2LA 4M78F 4HA8A 5GAOq 3JB9G 4DQ2A 1HK9A 3JCMf 4C8QF 5GANg 1B34A 4M7AD 1KQ2A 4F7UF 1N9SA 3RIRA 1M8VA 2YLBA 4PJOA 4J5YA 3RKXA 3JCMd 2E65A 4EMGA 2EJGA 4XQ3A 5GMKe 2FYKA 4JRKA 2YLCA 4C8QA 2ZGWA 2DJZA 2EWNA 4C8QG 2QTXA 5GANd 4M7DG 5GAN8 5GAOl 1TH7A 2DXUA 4X9DA 3HFNA 4XTVA 1JRIA 5GANf 5LJ5d 5GANe 4EMKA 4WF2A 4M7DF 4M77F 5GMKh 4F7UB 5LJ3j 2JN0A 2DXTA 3INZA 4M77B 2K57A 2E1HA 1LJOA 3V8LA 3VU3C 5CAIA 3V8JA 4XTXA 4C8QD 5GMKl 3RKYA 5GAOr 2RD1A 3JCMV 4XTZA 4C92D 4OP0A 3JCMb 2EJ9A 1N9RA 4NL3A 2E10A 5GAOp 5I21A 3JB9F 5GAMe 3V8KA 1Y96B 2RA2A 3QO3A 2FB7A 1LNXA 4MMLA 3JB9I 4XU2A 3V7CA 4M78B 3JCMW 3JCMc 4C92B 4NOYA 4HT8A 2VXEA 4M75D 4X9CA 4C8QB 4M7AB 3FJPA 4M75E 3JCMJ 4V2SA 5GAMg 4C92A 4RCBA 4RCCA 5LJ3d 3JCMP 4N0AC 3V7SA 4M7AC 4MMKA 5GAOn 5GANh 1B34B 5GAN7 1I5LA 1H641 2Y90A 1D3BA 1BIBA 1Y96A 5GMKj 5GAN2 4C8QE 1KQ1A 4JRIA 4M75B 3RERA 4M7DA 5GAOm 4M7DE 2HNIA 3SB2A 4PJOG 1D3BB 1HXDA 4M77G 4XU3A 4M75C 4PNOA 4M78C 3SWNA 4M78A 4C92E 4M75A 3BW1A 5LJ5h 3QSUA 4M7DB 2DEQA 2DZ9A 3SWNC 5GAMd 4C8QC 4M7DC 4J6XA 2VC8A 3V7RA 4NL2A 2DZCA 2E41A 4PJOF
chains in the Genus database with same CATH superfamily
4DEXA 1YI2A 3CC2T 2CP2A 2CDTA 2PZ1A 4FL6A 1W2BP 5AYFA 2JOYA 1QCOA 5DY9A 2LZ6B 1C6VX 3EG0A 4PJLA 4X1VA 2K5IA 2DXCA 3OYAA 2P0QA 1KC8R 3H0IA 1M4ZA 4PJOD 4J9EA 3GIBA 1XOVA 4Z02A 1WHLA 1AD5A 5GAN5 1JBMA 1QVPA 1W1FA 4M78E 2RM4A 1E7OA 3FEOA 1UGPB 3LH5A 2CZ0B 5C6SA 2DVEA 5FLXE 4KBMB 2JUFA 1FWZA 2RJEA 3KXTA 3CCJA 2FPEA 1WHKA 4C8QF 4C0DC 1K9MC 1VQNA 5I22A 5A2QE 1MMDA 4JRKA 2FVUA 4DBQA 1VQ4Q 3P8HA 2XD0A 1M27C 3OYEA 4QVZA 2DYIA 1VQKA 1JRIA 2LX7A 1M2VB 1QCNA 5CAIA 2L2PA 4HCCA 2F2XA 2LDMA 4VUBA 2RQUA 3A98A 3TQ7P 4DOVA 2EYZA 2COZA 4NS5A 4C92B 4C8QB 1SRMA 1VQ8A 2LNVA 3A8LB 3CCQA 2GBQA 3V7SA 3OYLA 1KQSA 3I56A 1Q86U 2LJ1A 1QKWA 1PRLC 3SWNA 4XU3A 2RI2A 4M75C 2YT6A 1RABB 2K6DA 1NM7A 2YUQA 3CD6A 3GP8A 4D8DA 2DL3A 4HT9A 2HL5C 2CGHA 2DE0X 2ECZA 4N0AA 4J6WA 3TSZA 4C0GA 1OPLA 4FW2A 2YUPA 4FIBA 2AK5A 2LJ3A 1Q82R 2GQIA 2QQ9A 1UGSB 2I0NA 1VQPQ 1KC8U 2H3JA 3VS0A 2JM9A 1VQ6Q 4CC3A 2H8HA 1K0SA 4E47A 2HQEA 2FO0A 2YDLA 5HY6A 2K3XA 5IHIA 1KIKA 2RNAA 3GLXA 5IXFA 4DOWA 1D0XA 4QT7A 1WJRA 1KHIA 5L8RE 4A4FA 1QP2A 3M0UA 2MCNA 1M1KR 5LJ5g 1FMWA 3A8GB 1OU9A 5GAOq 1YJWQ 1MMGA 2LT4A 2E6ZA 3ME9A 4QQDA 3OYBA 2ZPIB 3NMZC 4XQ3A 5C0MA 4M7DG 3G4SA 1RAGB 1VQPT 3VKIA 3L2VA 1TUCA 1UE9A 1QVFP 1O75A 2JN0A 2E4HA 1TG0A 2PU9B 1B7TA 3TREA 3UA7A 4BE2A 4PKCC 1GL5A 3G6ET 3RMSA 3OS5A 2CSQA 4LNPA 2RA2A 4RTYA 2GCXA 2HSEB 5HK0A 1BB9A 4M78B 4RKUE 3L2WA 4ORZA 1R0CB 3RBBB 1N5ZA 3EG9A 2HL3A 1PSFA 3MP8A 3I56T 2FPFA 4Q5WA 3JCMP 3I55T 3VS6A 1AT1B 5GAN2 3VUZA 4MDXA 1HXDA 1SPKA 3BW1A 2DEQA 2DRMA 4FSSA 4C8QC 1EX4A 3H41A 1JXMA 1X6GA 2VC8A 1UJ0A 2LTOA 3CC4Q 2ROTA 2CYZB 2KE9A 1PSEA 2CP3A 2EW3A 2IIMA 2XI9A 3ULRB 2KVQG 2F2VA 2NUPB 4QQ6A 2CUBA 2E3HA 2HDAA 4PLIA 1PM3A 2IPOB 5LJ3g 5LJ5f 1VQLT 2NUPA 3QZ9B 5LJ3h 2RF0A 3LGLA 4J9HA 1YHQA 1XQHA 3OYGA 1IB8A 1K73C 3ZEHA 4MZTA 4M7AA 5DLOA 4ZGJB 1U1SA 3GOXA 4E7LA 2LX9A 3S3OA 1OU8A 3UT1A 4M7AF 1WNLA 1VQ5Q 2J6KA 3OW2P 3M57A 2CUDA 2XDBA 4XTYA 2I2LA 2IVWA 2KMTA 4DQ2A 1YJWA 4QQGA 4F7UF 2WACA 2O9VA 4OB2B 1OI1A 3M54A 2DBKA 4BE0A 1G83A 1D1BA 5GANd 2F5KA 1KHCA 2CS7A 2P0KA 1KC8C 2D8HA 2JTMA 4J9CA 1YFNA 4LDYA 1J3TA 1RAEB 2LQ8A 4JPBW 3OS0A 4E7HA 2FB7A 2MI6A 1SSFA 2F69A 2HD0A 4XAXB 4BDYA 3EGUA 4V2SA 4C5GA 1U5SA 1YJNT 4RCCA 5FWBA 2HAXA 5GAN7 2Y90A 1Q86C 2K79A 3LW5E 4M78C 4D6WA 4FCYA 2QA4T 3G7ZA 1JB0E 2EYYA 5GAN3 1UFFA 2OTLA 2M0OA 2F1LA 2RHZA 4JJBA 4A63B 4F7UA 1SRLA 4JZ3A 1PC0A 5I2MA 4ZGEB 2VB6A 2ZPGB 1QP3A 3MEUA 4RTTA 1AZEA 2KSSA 3H0FA 4F7UE 3TVTA 3G1JA 3R6NA 1YCYA 4AFZC 2LCCA 4J7FA 2JS2A 3FLGA 1RLQC 3CBPA 1N6AA 3JCMf 5CVIA 3UA6A 9ATCB 5GANg 1XNIA 2F2WA 1GCQC 2VWFA 1YJNA 1ZBJA 1O9SA 3E9GA 1RUWA 1WFWA 4OB1B 2X3WD 4CI0C 1MMNA 3PVQA 1UJYA 3CBOA 1HSQA 2BUDA 4M7AC 1YCSB 4PJNA 2E5QA 1AWJA 1N9RA 4AFSC 1OOTA 2YRVA 5I21A 4DA4A 2VKNA 1RAAB 4OMNA 4C5IA 1EFNA 3FJPA 5KYWA 2RH2A 3EGDB 3LX7A 1JXOA 4KUDK 2GFAA 4LD9K 2QYZA 4AMCA 3CD6Q 2XHCA 1VQMT 1VQ4A 3CCST 3V7RA 1VQNQ 2DZCA 3ZBDA 4IUVA 3OW2A 4PJOE 1NYGA 1X6BA 1VQ7T 2XDPA 5GAN4 1VQ8Q 3L2ZA 4M78D 3URGA 2CP5A 5IHKA 1UGQB 1ZHIA 4XTWA 3HSBA 3CCLT 3JCMe 1TS9A 1RAHB 1U1TA 1ARKA 1IGQA 2QASA 2KGTA 1YBYA 2A3LA 5GMKm 2ZCFB 1SG5A 3OMCA 4EMKC 2QA4Q 1RAIB 1ACMB 1WQWA 3M0PA 1WXTA 3JCMQ 3QZ5B 1HD3A 2GFUA 5KYYA 5A0GA 4UC4A 2HQHA 3WXMB 1CKBA 2O88A 4TVRA 1HK9A 2XICA 5LL6S 1Q81U 1AEYA 2LNHB 3S6WA 1KQ2A 1W4SA 1QWEA 2QEXT 1M8VA 3JRZA 2JT4A 1BU1A 1G3SA 2LQNA 3VYGA 3H0HA 1K9AA 1MNEA 1SKUB 2MMPA 2WSFE 2DL5A 2QDLA 2ED1A 2E5KA 3CXCA 4XTVA 3QWYA 1M3CA 3GNGA 4LE9A 4M7DF 4M77F 1VQOA 2XU8A 2DXTA 4M77B 2E1HA 1TU0B 1X75C 4BB7A 1NJIR 2Y4YA 4ELYC 1Y96B 2KAFA 5IXBA 1M8MA 1H92A 2L3SA 2G6FX 3J7AF 3M0RA 2VGMA 3I5RA 1VQ9T 4HT8A 2VXEA 4M75D 4GY5A 3CCMT 4FYVB 3CMAA 3OYNA 5EC7A 2COWA 2ZPHB 4M77G 1RAFB 4CRIA 3SWNC 3JAME 2DIGA 3HRSA 3CBMA 3OYYA 4N4HA 3M53A 4LDXA 1BCMA 1M5Q1 2ENMA 2ZAEA 1UGRB 2DJQA 2KBTA 3UDCA 1N8RC 4M78G 1SF9A 3PMIA 2ZPFB 1W2BA 3BDLA 3L1AA 4OMMA 4LUEA 8ATCB 1IGUA 2GNCA 2DILA 4FYXB 2JMCA 4RUGA 3CEYA 1ABQA 5I2SA 2RHYA 2ZPBB 3CCRT 5CIUA 4LD6A 4Z88A 3LLRA 1BIAA 3SEMA 1JU5C 3SFMA 1NJIU 4RTZA 4FT2A 4YTLA 5LJ5j 3CCUA 3META 2A36A 3PTAA 1I8FA 4M78F 4JLGA 2E6NA 3HP9A 4OMFB 3PMTA 1I0CA 2DF6A 1XTDA 3MP6A 1N9SA 2HKNA 2X51A 1VUBA 4PFPA 4C0DB 1BI3A 1LCKA 4OMLA 2JS0A 4J8OA 4MDWA 3CMEA 4B9WA 2DVJA 4N4GA 4C0ZA 2YXYA 4X9DA 4KGVB 3IQLA 2RHIA 4WF2A 4J9FA 2SEMA 1K8AR 1M9SA 2FL7A 1IHVA 3QDFA 5GAOr 3MEWA 1MUZA 2MWPA 4BD3A 1X6OA 1PNJA 1T0JA 4KT0E 2RI5A 3OMGA 5KYYB 2G3RA 2ZZDA 3CCLQ 3M9QA 1CKAA 1TXQA 3NGPA 2OTLT 3CMAT 5CKBA 3HKSA 4C92A 4RCBA 2CP6A 4MMKA 3CCEA 4PJMA 1VQ9A 1FX7A 1BIBA 2JTFA 2XK0A 4PNOA 2DO3A 1VIFA 3EG2A 1TUGB 2EPDA 3CCJQ 4IKFA 4Y91A 2MWOA 2MF2A 2ATCB 4R56A 1M2VA 1Q82C 3RESA 2XIDA 2RN8A 1WHHA 3G71Q 3CPWS 4Z89A 3G4ST 5A0DA 1AWOA 3M56A 2LCSA 4JZ4A 3VS7A 3UWNA 4F7UG 2LCLA 2WSEE 1AZGB 2QG9B 1OV3A 3A8MB 4KGZB 5GAMj 5CKEA 4FT4A 1BYMA 4LDUA 5GAN6 5LJ3f 2AHJB 2P0PA 2K4YA 1G3YA 2L5QA 5GANj 3VYHB 5FROA 3M4GA 5CCAA 1M90R 2MIOA 4JUVA 2D8JA 3RNJA 1X01A 5KYXB 2KNBB 2LJ0A 1PG5B 1GBRA 3CCVT 3RIRA 2M02A 1UHFA 1RLPC 1GBQA 2R58A 2E65A 1UEBA 4EMGA 2EJGA 5FRMA 1TOVA 4FM4B 3LWHA 1E6HA 2SRCA 2EBPA 1VQ7A 1H3HA 2V8IA 3MCAB 2C0TA 1T3LA 3VS2A 3OBWA 4ZNXA 3OQ5A 4A4HA 2EJ9A 5GAOp 1YHQT 2A08A 2FG0A 2EYXA 2A0FB 3QPHA 2DETA 1D09B 4IUPA 2AT1B 2NUTA 1PD1A 2A7YA 4J9DA 1KJWA 2RQWA 3KUFA 5IT9E 4RTWA 1NE8A 3I9QA 3VRZA 1KK7A 4DEYA 3SB2A 4JRPA 5KCOA 5KYNA 1PRMC 1PHTA 5HCKA 3NTIA 2GGRA 1WIEA 3FC3A 2E41A 4OP0A 4PJOF 3UATA 1ZQ1A 3C4SA 1UTIA 1OZ2A 3HFOA 1AOJA 3CCQQ 2NWMA 2K5LA 4L6V5 3LH0A 2KT1A 4ELZC 1FXXA 3CCRQ 1LVKA 3MKDA 2EYWA 1MGQA 1WPYA 2YRCA 1V1CA 3QJ6A 1ABOA 3X20B 2EJFA 3L2QA 2ESWA 4M77D 2X35A 2WSCE 3Q1JA 3M58A 1WQ7A 2XDDA 5CO7A 2BE9B 2E64A 2A28A 2KYMA 4EPCA 3HRTA 3BY7A 3UF4A 3CC4A 4QW2A 3I35A 1I5OB 3PIPA 4IUTA 5EG2A 5KYUB 2M51A 3FJ5A 2EIFA 2QXFA 2DEUA 3NTKA 1UGVA 2YLBA 3EGXA 4ATOA 2KRMA 4J5YA 4II1A 3EHRA 4RG2A 1NZ9A 1RADB 5HK3A 1VYTA 2EWNA 2L8DA 1KQSS 2P84A 1OPKA 2L3RA 3CC2A 2V1QA 4FW1A 3I55A 4RTUA 1V76A 2V8KA 1SEMA 2DAQA 1NJIC 5LJ3j 3OYFA 2O4XB 1JJ2S 1YITT 3GPLA 2KRSA 2EFIA 3QJYA 1D1CA 3L2UA 4ZN3A 1U8RA 1JJ2A 2M16A 2C0OA 2LVMA 5FU6B 2CH4A 1UECA 2CH4W 2EGAA 3CCMQ 1I5LA 3QXEB 1YI2Q 2YSQA 5FU7B 1D0YA 1N8RU 4M7DE 1K9MU 1M90C 1M1KC 3VUBA 1WHJA 1D3BB 4C5HA 5HKCA 2DYBA 1VOMA 5CR2A 1YITA 4XK8E 2EKOA 1BBZA 2RB6A 3OB9A 1YJ9A 1W2BS 2CZ7B 1TUDA 2F5TX 5M9OA 2DFUA 1BKBA 1OEBA 5L23A 3M4YA 4L59A 2KXCA 4E7ZA 2RMOA 1IO6A 5IHNA 3M0TA 2BZYA 4B6MA 5KCHA 3S3MA 1U3OA 5GAMh 4JJCA 3CC4T 1PKSA 1M1FA 2J6OA 5J26A 2QI2A 2PUOB 1OX9A 3X26B 2DTHA 2DTOA 2O9SA 1KG1A 4DBFA 1AWXA 4A4KA 3CC7Q 3FIFA 4M77C 4J9GA 1VQNT 5CKFA 2BZ8A 4A4EA 1WI7A 3GNFB 1YJNQ 5KE2A 5KYWB 1OX8A 1VQLA 4GLKA 3CC7A 4C8QA 5A0LA 2NUTB 1T3SA 1TH7A 3ZFJA 2AKLA 3HFNA 5LJ5d 1VQ8T 5FRNA 3DKMA 3V8LA 4IIOA 1LJOA 2XMFA 4XTXA 3PIOA 1S72A 4XTZA 1ZUUA 2V26A 1R0BG 5D6XA 1VQMQ 3EH2A 1YJWT 3VS5A 3OY9A 4HVWA 3RERA 3REBB 5GAOm 2O01E 3CC7T 4C92E 3THKA 3CCUT 3QSUA 1RI0A 1YIJQ 3I5SA 2CP0A 3MPUB 2KROA 2CZ1B 1LOJA 1VQ5T 2L0AA 4BY6B 4BI3A 1ZBXA 4EMHA 2DTIA 4GBQA 3VRYA 2QEXQ 2XG8D 1UUEA 3E9FA 3CCVA 4J6YA 3SWNB 3REAB 4JLIA 1K8AC 3PGGA 5DLQE 3VJPA 4QVDA 1ZLMA 5IAYA 3CPWA 1ZUKA 2QGFB 3C12A 4A53A 5KYXA 2DPPB 1KD1U 5GMKi 2DBMA 1YI2T 4HA8A 1UB4A 3TEEA 2JMAA 1JJ2P 2O4XA 2OAWA 1SHGA 3RKXA 2ED0A 3EAEA 5GMKe 1NBEB 1WJSA 2QTXA 1KFZA 2JVVA 4F14A 4FYYB 2X3XD 1EIFA 4EMKA 3C0CA 2DX1A 5GMKh 4J83A 2OI3A 3INZA 2K57A 5GMKl 2X4XA 2MYSA 2KT8A 2BTTA 3RKYA 1NPRA 2HEQA 3CD6T 5CQYA 1VQ5A 2RQRA 1M90U 2HBWA 4NL3A 2AKKA 3ASKA 1VQOT 3V8KA 1Q7YC 2YRDA 4XU2A 4ANJA 3E19A 1YHQQ 4P5NA 1YN8A 1D0ZA 4IURA 2CP7A 2D9TA 3A8OB 4OMQA 1H641 4C8QE 5I11A 2M1HA 3FDRA 2A37A 5GMKj 3CC2Q 3VS3A 2CKKA 3M55A 1Q81R 2RI3A 4M7DC 2C06A 5KYUA 4LDVA 4NL2A 2J05A 1YIJA 1Q7YU 2EQKA 1Z9ZA 2E12A 1ZUYA 3MO8A 5GAMf 1VIEA 4M77A 1K4US 3CCSQ 2CREA 4L5GA 3SHWA 1Y0MA 1GRIA 3MEVA 3SD4A 3CCLA 2YUNA 3HPWA 4E7SA 3QWXX 4M7AE 2B86A 3QG1A 1MHNA 3CCJT 1Y57A 3JB9H 4J7IA 3VV0A 2JTEA 1FYNA 5LJ3e 2HMAA 1Y7XA 1KD1R 1U06A 1HYOA 2DKGA 2VXFA 3OSSC 3CXCS 1VQOQ 2DK3A 3CCSA 3ZL7C 2EQJA 1DJ7B 2HZYA 1Q86R 2R5AA 1QMCA 2V8JA 2L89A 5D7UA 2BKDN 1B34A 2Z0WA 1WJQA 2KI7A 2QQAA 1A0NB 2GTJA 4JJNK 2YLCA 1ZX6A 2DJZA 3CPFA 3PNWC 1K8AU 3E2UA 2X9HA 1MV3A 1X69A 5CK9A 1AVZC 2W0ZA 1QKXA 1XJWB 1TSFA 2KYBA 3CCEQ 2BZXA 1X43A 1WDXA 4AFUC 5IH2A 1PKTA 3AT1B 4PJOB 2DD4A 3BE3A 2RD1A 3OA6A 4M4ZA 3JCMb 4DBHA 3HL8A 3QO3A 4RG8A 4LXCA 3G6EA 1NLPC 2L3QA 1ZSZC 1ZA1B 4OMOA 2O31A 1K73U 3GF5A 2OTJQ 5GJWB 1WHGA 3I55Q 2KY9A 3QDRB 5GAMg 2KRNA 2LT1A 3RMQA 4BI8B 4AG2C 2J06A 1D3BA 1QVFS 1Y96A 3CXCP 3M0QA 1SSHA 2RJDA 2EQUA 4JRQA 3CMEQ 4FYWB 2COYA 4PL6A 6AT1B 1F1BB 1FMVA 4M77E 1NEGA 3OYIA 2DRKA 3T9NA 3EFSA 1GFDA 3CPWP 4BE1A 4OGEA 1WXBA 2K9GA 3FRNA 4RTXA 2E70A 1VQMA 2PVOB 3X28B 2RQVA 3OYKA 2QQBA 2PNIA 3EGDA 1X2QA 3TSWA 3F70A 1UG1A 4M75F 4M7AG 1UHCA 3A5ZB 3LGFA 1GXIE 3M59A 5D6WA 4IUQA 1QVFA 1IXDA 3QIIA 4C92F 1AHJB 2FZCB 1K9MR 3QHSA 1FMKA 2FRYA 3JB9G 2D0NA 1WXUA 3G71A 2KDSA 1VYVA 2RHXA 2LP5A 1VQ6T 4HCKA 1BI0A 4F17A 3C94A 3OYMA 1IRXA 2PVDB 1QVGS 5GANe 3O8VA 4OF1A 1B07A 1QW1A 3CCQT 4PLLA 3EG9B 4ME7A 1QVGP 2R57A 1WZOA 4E2FB 1WA7A 1MNDA 3JB9F 5GAMe 4F16A 2RHUA 2HQXA 3QYHB 1NPPA 3JB9I 1C0MA 3M5AA 1M1KU 1B34B 2KK4A 2HCKA 2O2OA 3H9NA 4M75B 4M7DA 4PJOG 1VQKT 5CKHA 1N27A 3TU4K 3HHTB 2P4TA 2VYTA 3CCMA 3JCMh 1QQJA 2YHTA 1Y07A 3P8DA 3NHNA 1T0HA 3OS1A 4M75G 3VS4A 4M7DD 1CSKA 3N5BB 1JEGA 4F04B 3EFRA 3OW2S 3EG1A 2QAZA 2Y4XA 4EMKB 2PTKA 1MV0B 2ROLA 3CCVQ 2DD5A 3PT9A 4BUGA 3PFSA 2X4YA 3SDZA 2JZ2A 4KUIA 2D0QB 7AT1B 3QUIA 3JB9D 1VYUA 3JCMg 4BI4A 2LQKA 2RO0A 4Y28E 3KFVA 3NPFA 3X24B 1WX6A 2XKOC 4DBRA 1R77A 1M3BA 2IG0A 4KULA 4A54A 2W10A 2DL4A 3JSCA 4WCIA 4OGCA 3DLLA 1Z9QA 2RK2A 4AFQC 4PJOA 5IN1A 4A4GA 1C1AA 1G2BA 1W6XA 1ZSGA 4PFOA 1VQ9Q 1G5VA 5CQXA 2NLUA 8AT1B 5KE3A 2QGGA 2QA4A 4F7UB 4C5EA 3UPUA 2MAMA 3JCMV 4C0FA 4CC4B 4C92D 2AZSA 1KQSP 3E1SA 2DM1A 3ER0A 2PQWA 3JCMW 3JCMc 4EDUA 2D1XA 1WGSA 2QK0A 3HRUA 1JO8A 3R6OA 4M7AB 1GCPA 3U23A 1PWTA 4N0AC 5J39A 5GAOn 2FRWA 1SHFA 2OTLQ 4ESRA 1KQ1A 1KSWA 3J81E 1X2KA 2NYSA 4R0KA 5LJ5h 4M75A 4M7DB 4OB0B 4E7JA 2ABLA 4ZGDB 2GTOA 2FEIA 1K76A 4KGXB 3WVEB 2KXDA 1YWPA 3QBYA 2DA9A 2OAUA 4HKEA 1RACB 2DXBA 4C92C 3EFOA 3M0SA 2OTJA 3JCMX 4ZTJA 3CQTA 4OVAA 3OSVA 1IREB 3G6EQ 1WHMA 1RL2A 3C95A 4PK4A 3OYHA 2RPNA 4XTUA 1WLPB 2M9UA 4R55A 3BFMA 4D8KA 5FW9A 3FB9A 2FPDA 2FZGB 1VQ7Q 4LDWA 3VS1A 3S3NA 1BI1A 1Y71A 3MJXA 1M2OA 1Q7YR 3EFOB 4Y92A 2AIRB 5CKDA 3LYIA 2HKQB 1G3WA 3RR6A 2EKHA 3CCRA 1I4K1 1AWWA 4JJDA 2JJ9A 2RJFA 2FZKB 5FWCA 2OX7A 2L3PA 2FYKA 4MZMA 1MMAA 2HSPA 2HBPA 4EIKA 5GAN8 4E7IA 1YIJT 2EGCA 2JM8A 2NUZA 2LMJA 3CCUQ 5GANf 2C0IA 2EYQA 4ZN1A 2MPXC 2VUBA 3V8JA 4C8QD 4N4IA 4FSXA 4PJJA 2K2MA 2DLPA 4CC7A 1Q82U 4LUDA 1IHWA 1I07A 1QWFA 3JCMJ 2RJCA 3NFCA 5AT1B 2QQSA 1VQLQ 4JRIA 2HNIA 4B9XA 1E6GA 3EHQA 1VA7A 1YP5A 4J6XA 2GQVA 1QCFA 2VV5A 2KQWA 3X25B 4QKUA 3QKJA 5LJ5e 1Q95G 1BI2A 3EGXB 3CCET 4FU6A 3BDUA 2ZPEB 4XU1A 3I56Q 3RUXA 2VASA 1K73R 2DL7A 3NTHA 2H3EB 2EAYA 4AT1B 2OTJT 4J9IA 4OMPA 1NYFA 2K7AA 3DB4A 4KRTA 1N8RR 1JQQA 5ECAA 3JV3A 2J7IA 4WTOB 4XU0A 2EGEA 4BACA 1PCXA 2K5FA 1G3TA 2K2VA 1M30A 3TCJA 1S72T 2PVGB 1NLOC 4PJOC 2KEAA 2CT3A 4E7KA 2EQIA 4ZTFA 3QYGB 2CZ6B 4JS4A 2GF7A 4M7AD 1LPLA 2DNUA 1TWBA 3RDVA 4AG1C 3JCMd 1IZ6A 2YUOA 2B8AA 2YWWA 2ZGWA 3WVDB 4JDSA 1H3ZA 2DIQA 4IIMA 5J3BA 5GAOl 2MOXA 4HCBA 1BCOA 2BE7D 2EQMA 4O6JA 3OS2A 2D6FA 1LNXA 2K3BA 1WYXA 4RTVA 2QEXA 1G8XA 2MK5A 2X4JA 3PVLA 4X9CA 3OBYA 2EVRA 2P4RA 5D6YA 5GANh 4MZPA 3OYJA 4CC2A 3DLMA 3A8HB 3OYCA 4GLMA 2DZ9A 1KD1C 2RK1A 3J80E 1EZZB 3CMET 1GFCA 1YJ9T 3D7SB 5GAMd 4C92G 4J9BA 3CMAQ 1I81A 4IUUA 4Z8AA 1TTHB 3H6ZA 1V29B 1K0XA 2RQTA 2M0YA 3LWIA 3MP1A 2X4WA 2LC4A 1W70A 3MHXA 4JS5A 3MEAA 1P92A 1OZ3A 4QVCA 1YWOA 1B3QA 1X27A 4HVUA 3JB9J 1S72Q 1I1JA 2OJ2A 2R5MA 4PFZA 1NG2A 3G71T 4BY6C 3RKWA 1Q81C 4E6RA 2VGNA 3H8ZA 1VQPA 3G4SQ 3AHUA 5DM7R 3PE0A 1S1NA 4RMOA 1GCQA 4LN2A 1VQKQ 2DMOA 3L42A 3L2RA 3GBQA 2QTVA 3O5ZA 4KH0B 1OYXA 3P8BB 1K1ZA 1BK2A 4C8QG 2JXBA 4OB3B 4X34A 2DXUA 2K3YA 2JW4A 2V1RA 3EH1A 2CT4A 1ZA2B 3VU3C 1D1AA 1H8KA 1OULA 2CSIA 2E10A 1ZSZA 1YNZA 2DL8A 4KH1B 1VQ6A 1UDLA 4MMLA 4O5VA 3EG3A 4HVVA 1PD0A 1R8OB 1OQKA 3KBGA 4BDZA 3V7CA 1QLYA 2BIVA 3A1PA 2AZVA 4K11A 4NOYA 1QVGA 1ZSZB 5GJVB 1M1GA 4M75E 5FU7C 2PUKB 3DB3A 4HXJA 5LJ3d 2LRQA 1YJ9Q 2QDYB 5FU6C 1M3AA 2JNGA 1RI9A 4HCZA 2J6FA 2FHDA 1YITQ 3OYDA 1NEBA 4M78A 2DERA 2VVKA 5KH6A 2LQWA 2E3IA 2QQRA 1HJDA 3HTRA 1VQ4T 2KR3A
chains in the Genus database with same CATH topology
2P4TA 2VYTA 4IUVA 3OW2A 1YI2A 2RB6A 3CC2T 4PJOE 3CCMA 3OB9A 3JCMh 1VQ7T 1YJ9A 2YHTA 4FL6A 1Y07A 2XDPA 1W2BS 2CZ7B 3P8DA 5AYFA 3L2ZA 2F5TX 2JOYA 5M9OA 4M78D 1BKBA 5GAN4 3URGA 3M4YA 3OS1A 5DY9A 4L59A 1UGQB 4M75G 1ZHIA 4XTWA 4M7DD 3HSBA 3CCLT 3JCMe 3N5BB 3EFRA 1U1TA 3OW2S 2K5IA 5KCHA 2DXCA 2Y4XA 4EMKB 3OYAA 3S3MA 5GAMh 2P0QA 3CC4T 2DD5A 1M4ZA 3PT9A 3PFSA 4BUGA 4PJOD 1M1FA 1YBYA 2A3LA 2X4YA 2QI2A 2JZ2A 2ZCFB 2PUOB 1XOVA 3OMCA 4KUIA 4Z02A 2D0QB 4EMKC 3QUIA 3JB9D 5GAN5 3X26B 1JBMA 3JCMg 1QVPA 1WQWA 2DTHA 2LQKA 2RO0A 4BI4A 4M78E 4Y28E 3JCMQ 3QZ5B 2RM4A 3FEOA 2DTOA 1UGPB 1KG1A 2GFUA 2CZ0B 5A0GA 4A4KA 2DVEA 5C6SA 4UC4A 4KBMB 3FIFA 2JUFA 3WXMB 3X24B 4M77C 5FLXE 1FWZA 2RJEA 2XKOC 3KXTA 1VQNT 2IG0A 3CCJA 4KULA 5CKFA 4A54A 4TVRA 1HK9A 3JSCA 4A4EA 2XICA 5LL6S 4OGCA 3DLLA 1Q81U 3S6WA 4C8QF 2RK2A 1KQ2A 4C0DC 1W4SA 2QEXT 1K9MC 3GNFB 1M8VA 3JRZA 5IN1A 4A4GA 5KE2A 4PJOA 1VQNA 1G3SA 1VQLA 4GLKA 3VYGA 3CC7A 5A2QE 2WSFE 4JRKA 2MMPA 2FVUA 4C8QA 1G5VA 5A0LA 5CQXA 2NLUA 3P8HA 2XD0A 3OYEA 3ZFJA 1TH7A 4QVZA 3HFNA 3CXCA 4XTVA 1VQKA 1JRIA 5KE3A 5LJ5d 2QA4A 3GNGA 1VQ8T 4M7DF 5FRNA 4M77F 3DKMA 1VQOA 2XU8A 4F7UB 2DXTA 4M77B 3V8LA 5CAIA 2E1HA 1LJOA 4C5EA 4XTXA 3PIOA 2MAMA 3UPUA 1S72A 4HCCA 1X75C 3JCMV 4XTZA 4C0FA 4C92D 2LDMA 4VUBA 4BB7A 2Y4YA 4ELYC 1Y96B 2KAFA 3E1SA 3ER0A 4DOVA 5D6XA 2PQWA 3J7AF 2VGMA 3JCMW 1VQ9T 4NS5A 3JCMc 4C92B 1YJWT 4HT8A 2VXEA 4M75D 4EDUA 1WGSA 4M7AB 3HRUA 3R6OA 4GY5A 4C8QB 2LNVA 3CCMT 1VQ8A 3A8LB 3CCQA 3OY9A 3CMAA 4N0AC 3V7SA 3OYLA 5J39A 1KQSA 3OYNA 5GAOn 5GMKm 3I56A 1Q86U 3RERA 1KQ1A 3J81E 5GAOm 2ZPHB 2O01E 3SWNA 3CC7T 4M77G 4XU3A 2RI2A 4M75C 4C92E 5LJ5h 3CCUT 4M75A 4M7DB 3QSUA 4CRIA 4OB0B 3SWNC 3JAME 1RI0A 4E7JA 3CD6A 4ZGDB 3GP8A 2DIGA 3HRSA 3CBMA 3OYYA 3WVEB 4HT9A 3QBYA 3M53A 2CZ1B 1LOJA 2CGHA 4N0AA 4N4HA 1VQ5T 2OAUA 4HKEA 4LDXA 4J6WA 4BY6B 2DXBA 4BI3A 4C92C 4C0GA 1M5Q1 1ZBXA 1UGRB 4FIBA 4EMHA 2DTIA 2OTJA 3JCMX 4ZTJA 3UDCA 1N8RC 4OVAA 3OSVA 4M78G 2QQ9A 1UGSB 3PMIA 1IREB 2XG8D 2ZPFB 2H3JA 1RL2A 3C95A 1W2BA 3OYHA 1KC8U 3E9FA 3CCVA 4XTUA 3BDLA 3L1AA 2M9UA 4R55A 4E47A 2HQEA 4J6YA 3SWNB 4JLIA 1K8AC 3BFMA 5HY6A 2K3XA 3PGGA 3FB9A 3CEYA 4LDWA 5I2SA 5DLQE 3GLXA 3VJPA 3S3NA 2RHYA 1BI1A 4QVDA 2ZPBB 3CCRT 1Y71A 4DOWA 5CIUA 4LD6A 5IAYA 3LLRA 1BIAA 1WJRA 3CPWA 1KHIA 3SFMA 1NJIU 5CKDA 5L8RE 4A4FA 1QP2A 4FT2A 3LYIA 3C12A 4YTLA 4A53A 1G3WA 5LJ5g 5LJ5j 3CCUA 2DPPB 3CCRA 3A8GB 1I4K1 3META 1KD1U 5GMKi 3PTAA 1I8FA 5GAOq 4M78F 4JLGA 2E6NA 3HP9A 4HA8A 3PMTA 4OMFB 1YI2T 1UB4A 3TEEA 2LT4A 1XTDA 3MP6A 1N9SA 2E6ZA 2RJFA 3ME9A 4QQDA 2O4XA 3OYBA 1VUBA 3EAEA 5J26A 3RKXA 4C0DB 1BI3A 2ZPIB 4XQ3A 5GMKe 2FYKA 4J8OA 4MZMA 4MDWA 1WJSA 5C0MA 3CMEA 2QTXA 3G4SA 2JVVA 2HBPA 4B9WA 5GAN8 4E7IA 4M7DG 1VQPT 1YIJT 4N4GA 4C0ZA 3VKIA 4X9DA 3L2VA 5GANf 1EIFA 2RHIA 2EYQA 4EMKA 4WF2A 4ZN1A 1O75A 5GMKh 4J83A 2JN0A 3INZA 2K57A 1M9SA 2X4XA 2FL7A 2VUBA 5GMKl 3V8JA 4C8QD 5GAOr 4N4IA 1NPRA 3MEWA 2PU9B 4FSXA 2MWPA 3RKYA 3TREA 5CQYA 1VQ5A 4BD3A 4PKCC 4BE2A 3CD6T 1M90U 1X6OA 4NL3A 3G6ET 3ASKA 3RMSA 1VQOT 3OS5A 3V8KA 2RA2A 1Q82U 1Q7YC 4KT0E 2GCXA 2RI5A 3OMGA 4XU2A 5HK0A 2G3RA 4M78B 4RKUE 2ZZDA 3E19A 3L2WA 3M9QA 2OTLT 3CMAT 3JCMJ 5CKBA 4P5NA 2RJCA 1PSFA 3HKSA 2D9TA 3A8OB 3MP8A 4IURA 4Q5WA 4RCBA 4C92A 3I56T 3JCMP 3NFCA 4MMKA 3I55T 2QQSA 3CCEA 1VQ9A 1H641 1FX7A 1BIBA 5GAN2 4C8QE 4JRIA 3VUZA 2M1HA 3FDRA 4MDXA 2HNIA 2JTFA 5GMKj 2XK0A 1HXDA 4B9XA 4PNOA 2DO3A 2CKKA 1VIFA 3BW1A 2DEQA 3M55A 2RI3A 4C8QC 4J6XA 2C06A 4M7DC 4IKFA 4LDVA 2VC8A 2GQVA 2LTOA 4NL2A 4Y91A 2MWOA 2MF2A 1YIJA 1Q7YU 4R56A 2EQKA 1Q82C 2VV5A 2KQWA 2CYZB 2XIDA 3RESA 3QKJA 1PSEA 2XI9A 3X25B 5LJ5e 2E12A 3MO8A 2KVQG 5GAMf 1BI2A 3CCET 3CPWS 4FU6A 3G4ST 3BDUA 1VIEA 4QQ6A 5A0DA 2ZPEB 4XU1A 4M77A 3RUXA 3M56A 4PLIA 3NTHA 2EAYA 4L5GA 5LJ3g 3UWNA 5LJ5f 1VQLT 4F7UG 2OTJT 2LCLA 3QZ9B 5LJ3h 1YHQA 3LGLA 2WSEE 3MEVA 3SD4A 1XQHA 3CCLA 3OYGA 1K73C 3HPWA 3A8MB 3ZEHA 4MZTA 5GAMj 3DB4A 4M7AE 4M7AA 3QG1A 5CKEA 4FT4A 1MHNA 5DLOA 4LDUA 4ZGJB 1BYMA 1U1SA 3CCJT 3JB9H 3GOXA 4J7IA 4E7LA 2LX9A 3S3OA 3VV0A 5GAN6 5LJ3f 2AHJB 2P0PA 3UT1A 1WNLA 5LJ3e 4M7AF 2K4YA 4XU0A 4BACA 1G3YA 1Y7XA 2L5QA 5GANj 3VYHB 5FROA 3M4GA 2DKGA 2K5FA 2VXFA 5CCAA 1G3TA 3OSSC 3CXCS 2K2VA 2DK3A 3M57A 3TCJA 1S72T 3CCSA 2PVGB 4JUVA 2EQJA 4PJOC 1DJ7B 2XDBA 2R5AA 4XTYA 1X01A 4E7KA 2I2LA 2IVWA 2KMTA 2L89A 2V8JA 4DQ2A 4ZTFA 3QYGB 2CZ6B 4JS4A 2GF7A 2BKDN 3CCVT 1B34A 1YJWA 4QQGA 4M7AD 4F7UF 2WACA 3RIRA 1WJQA 2QQAA 2R58A 3JCMd 2E65A 1IZ6A 1OI1A 1UEBA 3M54A 2EJGA 2B8AA 4OB2B 4EMGA 4JJNK 2YLCA 4BE0A 2ZGWA 3WVDB 4JDSA 2DJZA 2DIQA 3CPFA 1H3ZA 5GANd 3PNWC 1K8AU 5J3BA 5FRMA 5GAOl 2F5KA 4FM4B 3LWHA 5CK9A 1KHCA 2CS7A 2P0KA 1VQ7A 1KC8C 4HCBA 2V8IA 3MCAB 4PJOB 2DD4A 2JTMA 4LDYA 3OBWA 2RD1A 3OA6A 3OQ5A 2LQ8A 2EQMA 4A4HA 3JCMb 2EJ9A 4O6JA 3OS2A 5GAOp 3HL8A 1YHQT 2D6FA 3OS0A 4E7HA 3QPHA 3QO3A 1LNXA 2FB7A 4IUPA 4RG8A 3G6EA 3GIBA 2MI6A 1SSFA 2QEXA 2F69A 2HD0A 4XAXB 1K73U 4BDYA 2X4JA 2A7YA 4X9CA 3GF5A 4V2SA 2KY9A 3QDRB 4C5GA 5GAMg 3KUFA 2LT1A 3OBYA 5IT9E 1YJNT 3RMQA 4RCCA 5D6YA 4BI8B 1NE8A 2HAXA 5GANh 4MZPA 5GAN7 2Y90A 1D3BA 3OYJA 1Q86C 1QVFS 1Y96A 3DLMA 2RJDA 3A8HB 3LW5E 2EQUA 3SB2A 4JRQA 4JRPA 5KCOA 4M78C 3OYCA 2DZ9A 3NTIA 1KD1C 4D6WA 2RK1A 4PL6A 3J80E 3FC3A 3CMET 1YJ9T 2E41A 4OP0A 4PJOF 4M77E 4C92G 5GAMd 2QA4T 3G7ZA 3OYIA 1JB0E 1ZQ1A 3C4SA 3T9NA 3EFSA 1OZ2A 3HFOA 1I81A 4BE1A 4IUUA 5GAN3 2K5LA 4OGEA 4L6V5 3LH0A 4ELZC 3H6ZA 1FXXA 1V29B 3FRNA 2OTLA 2E70A 1VQMA 2PVOB 2M0OA 3LWIA 1MGQA 1WPYA 2X4WA 2LC4A 3MP1A 3SDZA 2RHZA 3X28B 3OYKA 3QJ6A 2QQBA 3MHXA 3X20B 2EJFA 4F7UA 3MEAA 3L2QA 4JS5A 1P92A 1OZ3A 3F70A 5I2MA 4M75F 4QVCA 3JB9J 4ZGEB 4M7AG 3A5ZB 2ZPGB 1QP3A 3MEUA 2R5MA 4M77D 2KSSA 2X35A 2WSCE 3LGFA 3Q1JA 3M58A 4F7UE 3G71T 1WQ7A 1GXIE 2XDDA 1YCYA 3M59A 4IUQA 5D6WA 3RKWA 4BY6C 1QVFA 2LCCA 3QIIA 4C92F 1AHJB 5CO7A 1Q81C 2VGNA 4J7FA 3H8ZA 2E64A 1VQPA 3FLGA 3AHUA 5DM7R 4EPCA 3HRTA 3BY7A 3QHSA 4RMOA 4QW2A 3CC4A 3CBPA 3JB9G 1N6AA 3PIPA 4IUTA 3JCMf 2KDSA 3L42A 5CVIA 5EG2A 3L2RA 3G71A 5GANg 2RHXA 1XNIA 2EIFA 2QXFA 3NTKA 2YLBA 4ATOA 4J5YA 4II1A 1OYXA 4RG2A 1YJNA 1NZ9A 1VQ6T 5HK3A 1BI0A 3P8BB 2EWNA 2L8DA 4C8QG 1KQSS 1O9SA 3E9GA 2L3RA 4OB3B 3C94A 3OYMA 3CC2A 4OB1B 4X34A 2DXUA 3I55A 2K3YA 4CI0C 2PVDB 1QVGS 5GANe 2V8KA 3O8VA 3CBOA 4OF1A 1QW1A 2DAQA 3CCQT 5LJ3j 1NJIC 4PLLA 2O4XB 3OYFA 2BUDA 4ME7A 3VU3C 2R57A 1JJ2S 1YITT 4M7AC 2E5QA 3GPLA 1N9RA 2E10A 2YRVA 5I21A 3JB9F 5GAMe 1VQ6A 2EFIA 3QJYA 2RHUA 3L2UA 2HQXA 4DA4A 4MMLA 4O5VA 4ZN3A 1U8RA 3QYHB 1NPPA 1R8OB 3JB9I 1JJ2A 3KBGA 4BDZA 3V7CA 2BIVA 2M16A 4C5IA 4NOYA 1QVGA 3FJPA 1M1GA 4M75E 2LVMA 5FU7C 5FU6B 2PUKB 3DB3A 2RH2A 5LJ3d 2LRQA 3M5AA 3LX7A 1M1KU 4KUDK 2GFAA 1I5LA 1B34B 3QXEB 4LD9K 2QDYB 2KK4A 5FU6C 5FU7B 1N8RU 2JNGA 4M7DE 4HCZA 4M75B 1M90C 1M1KC 1K9MU 2XHCA 3VUBA 2FHDA 1VQMT 4M7DA 4PJOG 1D3BB 4C5HA 5HKCA 3OYDA 5CKHA 1VQKT 4M78A 1N27A 1VQ4A 5CR2A 5KH6A 4XK8E 3HHTB 3CCST 3TU4K 1YITA 2QQRA 3V7RA 1VQ4T 2EKOA 2DZCA 3ZBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M77 E;  4C92 G;  4HT9 A;  4PJO E;  2RB6 A;  1LOJ A;  2CGH A;  4N0A A;  3JCM h;  3EFS A;  3RES A;  4J6W A;  3HFO A;  5LJ5 e;  1I81 A;  4C92 C;  4PJO B;  1M5Q 1;  2YHT A;  5GAN 3;  5GAM f;  4EMH A;  5GAN 4;  3L2Z A;  2DTI A;  4M78 D;  3JCM X;  3BDU A;  4XU1 A;  4M77 A;  5DY9 A;  3RUX A;  4M78 G;  4M75 G;  4XTW A;  4Y91 A;  2EAY A;  1MGQ A;  1WPY A;  3HSB A;  4M7D D;  5LJ3 g;  3JCM e;  5LJ5 f;  4F7U G;  3EFR A;  5LJ3 h;  2EJF A;  1U1T A;  3L1A A;  4XTU A;  4F7U A;  4QVC A;  4M75 F;  4EMK B;  3JB9 J;  4J6Y A;  3SWN B;  5GAM j;  4JLI A;  5GAM h;  3BFM A;  4M7A G;  3PGG A;  4M7A A;  4M7A E;  3FB9 A;  4M77 D;  1U1S A;  4PJO D;  5GMK m;  3GIB A;  3JB9 H;  4EMK C;  4F7U E;  1WQ7 A;  3QUI A;  3JB9 D;  5GAN 6;  5LJ3 f;  5GAN 5;  4M7A F;  1YCY A;  1JBM A;  1WNL A;  1WQW A;  2DTH A;  3RKW A;  3JCM g;  4QVD A;  4XU0 A;  4C92 F;  5LJ3 e;  4M78 E;  3JCM Q;  5GAN j;  2RM4 A;  3M4G A;  2DKG A;  2VXF A;  2DTO A;  1BIA A;  2E64 A;  3AHU A;  2DVE A;  3FIF A;  3QHS A;  3BY7 A;  4A53 A;  4M77 C;  4JUV A;  5LJ5 g;  5LJ5 j;  4PJO C;  1I4K 1;  4XTY A;  5GMK i;  1X01 A;  1I8F A;  4A54 A;  2I2L A;  4M78 F;  4HA8 A;  5GAO q;  3JB9 G;  4DQ2 A;  1HK9 A;  3JCM f;  4C8Q F;  5GAN g;  1B34 A;  4M7A D;  1KQ2 A;  4F7U F;  1N9S A;  3RIR A;  1M8V A;  2YLB A;  4PJO A;  4J5Y A;  3RKX A;  3JCM d;  2E65 A;  4EMG A;  2EJG A;  4XQ3 A;  5GMK e;  2FYK A;  4JRK A;  2YLC A;  4C8Q A;  2ZGW A;  2DJZ A;  2EWN A;  4C8Q G;  2QTX A;  5GAN d;  4M7D G;  5GAN 8;  5GAO l;  1TH7 A;  2DXU A;  4X9D A;  3HFN A;  4XTV A;  1JRI A;  5GAN f;  5LJ5 d;  5GAN e;  4EMK A;  4WF2 A;  4M7D F;  4M77 F;  5GMK h;  4F7U B;  5LJ3 j;  2JN0 A;  2DXT A;  3INZ A;  4M77 B;  2K57 A;  2E1H A;  1LJO A;  3V8L A;  3VU3 C;  5CAI A;  3V8J A;  4XTX A;  4C8Q D;  5GMK l;  3RKY A;  5GAO r;  2RD1 A;  3JCM V;  4XTZ A;  4C92 D;  4OP0 A;  3JCM b;  2EJ9 A;  1N9R A;  4NL3 A;  2E10 A;  5GAO p;  5I21 A;  3JB9 F;  5GAM e;  3V8K A;  1Y96 B;  2RA2 A;  3QO3 A;  2FB7 A;  1LNX A;  4MML A;  3JB9 I;  4XU2 A;  3V7C A;  4M78 B;  3JCM W;  3JCM c;  4C92 B;  4NOY A;  4HT8 A;  2VXE A;  4M75 D;  4X9C A;  4C8Q B;  4M7A B;  3FJP A;  4M75 E;  3JCM J;  4V2S A;  5GAM g;  4C92 A;  4RCB A;  4RCC A;  5LJ3 d;  3JCM P;  4N0A C;  3V7S A;  4M7A C;  4MMK A;  5GAO n;  5GAN h;  1B34 B;  5GAN 7;  1I5L A;  1H64 1;  2Y90 A;  1D3B A;  1BIB A;  1Y96 A;  5GMK j;  5GAN 2;  4C8Q E;  1KQ1 A;  4JRI A;  4M75 B;  3RER A;  4M7D A;  5GAO m;  4M7D E;  2HNI A;  3SB2 A;  4PJO G;  1D3B B;  1HXD A;  4M77 G;  4XU3 A;  4M75 C;  4PNO A;  4M78 C;  3SWN A;  4M78 A;  4C92 E;  4M75 A;  3BW1 A;  5LJ5 h;  3QSU A;  4M7D B;  2DEQ A;  2DZ9 A;  3SWN C;  5GAM d;  4C8Q C;  4M7D C;  4J6X A;  2VC8 A;  3V7R A;  4NL2 A;  2DZC A;  2E41 A;  4PJO F; 
#chains in the Genus database with same CATH topology
 4DEX A;  1YI2 A;  3CC2 T;  2CP2 A;  2CDT A;  2PZ1 A;  4FL6 A;  1W2B P;  5AYF A;  2JOY A;  1QCO A;  5DY9 A;  2LZ6 B;  1C6V X;  3EG0 A;  4PJL A;  4X1V A;  2K5I A;  2DXC A;  3OYA A;  2P0Q A;  1KC8 R;  3H0I A;  1M4Z A;  4PJO D;  4J9E A;  3GIB A;  1XOV A;  4Z02 A;  1WHL A;  1AD5 A;  5GAN 5;  1JBM A;  1QVP A;  1W1F A;  4M78 E;  2RM4 A;  1E7O A;  3FEO A;  1UGP B;  3LH5 A;  2CZ0 B;  5C6S A;  2DVE A;  5FLX E;  4KBM B;  2JUF A;  1FWZ A;  2RJE A;  3KXT A;  3CCJ A;  2FPE A;  1WHK A;  4C8Q F;  4C0D C;  1K9M C;  1VQN A;  5I22 A;  5A2Q E;  1MMD A;  4JRK A;  2FVU A;  4DBQ A;  1VQ4 Q;  3P8H A;  2XD0 A;  1M27 C;  3OYE A;  4QVZ A;  2DYI A;  1VQK A;  1JRI A;  2LX7 A;  1M2V B;  1QCN A;  5CAI A;  2L2P A;  4HCC A;  2F2X A;  2LDM A;  4VUB A;  2RQU A;  3A98 A;  3TQ7 P;  4DOV A;  2EYZ A;  2COZ A;  4NS5 A;  4C92 B;  4C8Q B;  1SRM A;  1VQ8 A;  2LNV A;  3A8L B;  3CCQ A;  2GBQ A;  3V7S A;  3OYL A;  1KQS A;  3I56 A;  1Q86 U;  2LJ1 A;  1QKW A;  1PRL C;  3SWN A;  4XU3 A;  2RI2 A;  4M75 C;  2YT6 A;  1RAB B;  2K6D A;  1NM7 A;  2YUQ A;  3CD6 A;  3GP8 A;  4D8D A;  2DL3 A;  4HT9 A;  2HL5 C;  2CGH A;  2DE0 X;  2ECZ A;  4N0A A;  4J6W A;  3TSZ A;  4C0G A;  1OPL A;  4FW2 A;  2YUP A;  4FIB A;  2AK5 A;  2LJ3 A;  1Q82 R;  2GQI A;  2QQ9 A;  1UGS B;  2I0N A;  1VQP Q;  1KC8 U;  2H3J A;  3VS0 A;  2JM9 A;  1VQ6 Q;  4CC3 A;  2H8H A;  1K0S A;  4E47 A;  2HQE A;  2FO0 A;  2YDL A;  5HY6 A;  2K3X A;  5IHI A;  1KIK A;  2RNA A;  3GLX A;  5IXF A;  4DOW A;  1D0X A;  4QT7 A;  1WJR A;  1KHI A;  5L8R E;  4A4F A;  1QP2 A;  3M0U A;  2MCN A;  1M1K R;  5LJ5 g;  1FMW A;  3A8G B;  1OU9 A;  5GAO q;  1YJW Q;  1MMG A;  2LT4 A;  2E6Z A;  3ME9 A;  4QQD A;  3OYB A;  2ZPI B;  3NMZ C;  4XQ3 A;  5C0M A;  4M7D G;  3G4S A;  1RAG B;  1VQP T;  3VKI A;  3L2V A;  1TUC A;  1UE9 A;  1QVF P;  1O75 A;  2JN0 A;  2E4H A;  1TG0 A;  2PU9 B;  1B7T A;  3TRE A;  3UA7 A;  4BE2 A;  4PKC C;  1GL5 A;  3G6E T;  3RMS A;  3OS5 A;  2CSQ A;  4LNP A;  2RA2 A;  4RTY A;  2GCX A;  2HSE B;  5HK0 A;  1BB9 A;  4M78 B;  4RKU E;  3L2W A;  4ORZ A;  1R0C B;  3RBB B;  1N5Z A;  3EG9 A;  2HL3 A;  1PSF A;  3MP8 A;  3I56 T;  2FPF A;  4Q5W A;  3JCM P;  3I55 T;  3VS6 A;  1AT1 B;  5GAN 2;  3VUZ A;  4MDX A;  1HXD A;  1SPK A;  3BW1 A;  2DEQ A;  2DRM A;  4FSS A;  4C8Q C;  1EX4 A;  3H41 A;  1JXM A;  1X6G A;  2VC8 A;  1UJ0 A;  2LTO A;  3CC4 Q;  2ROT A;  2CYZ B;  2KE9 A;  1PSE A;  2CP3 A;  2EW3 A;  2IIM A;  2XI9 A;  3ULR B;  2KVQ G;  2F2V A;  2NUP B;  4QQ6 A;  2CUB A;  2E3H A;  2HDA A;  4PLI A;  1PM3 A;  2IPO B;  5LJ3 g;  5LJ5 f;  1VQL T;  2NUP A;  3QZ9 B;  5LJ3 h;  2RF0 A;  3LGL A;  4J9H A;  1YHQ A;  1XQH A;  3OYG A;  1IB8 A;  1K73 C;  3ZEH A;  4MZT A;  4M7A A;  5DLO A;  4ZGJ B;  1U1S A;  3GOX A;  4E7L A;  2LX9 A;  3S3O A;  1OU8 A;  3UT1 A;  4M7A F;  1WNL A;  1VQ5 Q;  2J6K A;  3OW2 P;  3M57 A;  2CUD A;  2XDB A;  4XTY A;  2I2L A;  2IVW A;  2KMT A;  4DQ2 A;  1YJW A;  4QQG A;  4F7U F;  2WAC A;  2O9V A;  4OB2 B;  1OI1 A;  3M54 A;  2DBK A;  4BE0 A;  1G83 A;  1D1B A;  5GAN d;  2F5K A;  1KHC A;  2CS7 A;  2P0K A;  1KC8 C;  2D8H A;  2JTM A;  4J9C A;  1YFN A;  4LDY A;  1J3T A;  1RAE B;  2LQ8 A;  4JPB W;  3OS0 A;  4E7H A;  2FB7 A;  2MI6 A;  1SSF A;  2F69 A;  2HD0 A;  4XAX B;  4BDY A;  3EGU A;  4V2S A;  4C5G A;  1U5S A;  1YJN T;  4RCC A;  5FWB A;  2HAX A;  5GAN 7;  2Y90 A;  1Q86 C;  2K79 A;  3LW5 E;  4M78 C;  4D6W A;  4FCY A;  2QA4 T;  3G7Z A;  1JB0 E;  2EYY A;  5GAN 3;  1UFF A;  2OTL A;  2M0O A;  2F1L A;  2RHZ A;  4JJB A;  4A63 B;  4F7U A;  1SRL A;  4JZ3 A;  1PC0 A;  5I2M A;  4ZGE B;  2VB6 A;  2ZPG B;  1QP3 A;  3MEU A;  4RTT A;  1AZE A;  2KSS A;  3H0F A;  4F7U E;  3TVT A;  3G1J A;  3R6N A;  1YCY A;  4AFZ C;  2LCC A;  4J7F A;  2JS2 A;  3FLG A;  1RLQ C;  3CBP A;  1N6A A;  3JCM f;  5CVI A;  3UA6 A;  9ATC B;  5GAN g;  1XNI A;  2F2W A;  1GCQ C;  2VWF A;  1YJN A;  1ZBJ A;  1O9S A;  3E9G A;  1RUW A;  1WFW A;  4OB1 B;  2X3W D;  4CI0 C;  1MMN A;  3PVQ A;  1UJY A;  3CBO A;  1HSQ A;  2BUD A;  4M7A C;  1YCS B;  4PJN A;  2E5Q A;  1AWJ A;  1N9R A;  4AFS C;  1OOT A;  2YRV A;  5I21 A;  4DA4 A;  2VKN A;  1RAA B;  4OMN A;  4C5I A;  1EFN A;  3FJP A;  5KYW A;  2RH2 A;  3EGD B;  3LX7 A;  1JXO A;  4KUD K;  2GFA A;  4LD9 K;  2QYZ A;  4AMC A;  3CD6 Q;  2XHC A;  1VQM T;  1VQ4 A;  3CCS T;  3V7R A;  1VQN Q;  2DZC A;  3ZBD A;  4IUV A;  3OW2 A;  4PJO E;  1NYG A;  1X6B A;  1VQ7 T;  2XDP A;  5GAN 4;  1VQ8 Q;  3L2Z A;  4M78 D;  3URG A;  2CP5 A;  5IHK A;  1UGQ B;  1ZHI A;  4XTW A;  3HSB A;  3CCL T;  3JCM e;  1TS9 A;  1RAH B;  1U1T A;  1ARK A;  1IGQ A;  2QAS A;  2KGT A;  1YBY A;  2A3L A;  5GMK m;  2ZCF B;  1SG5 A;  3OMC A;  4EMK C;  2QA4 Q;  1RAI B;  1ACM B;  1WQW A;  3M0P A;  1WXT A;  3JCM Q;  3QZ5 B;  1HD3 A;  2GFU A;  5KYY A;  5A0G A;  4UC4 A;  2HQH A;  3WXM B;  1CKB A;  2O88 A;  4TVR A;  1HK9 A;  2XIC A;  5LL6 S;  1Q81 U;  1AEY A;  2LNH B;  3S6W A;  1KQ2 A;  1W4S A;  1QWE A;  2QEX T;  1M8V A;  3JRZ A;  2JT4 A;  1BU1 A;  1G3S A;  2LQN A;  3VYG A;  3H0H A;  1K9A A;  1MNE A;  1SKU B;  2MMP A;  2WSF E;  2DL5 A;  2QDL A;  2ED1 A;  2E5K A;  3CXC A;  4XTV A;  3QWY A;  1M3C A;  3GNG A;  4LE9 A;  4M7D F;  4M77 F;  1VQO A;  2XU8 A;  2DXT A;  4M77 B;  2E1H A;  1TU0 B;  1X75 C;  4BB7 A;  1NJI R;  2Y4Y A;  4ELY C;  1Y96 B;  2KAF A;  5IXB A;  1M8M A;  1H92 A;  2L3S A;  2G6F X;  3J7A F;  3M0R A;  2VGM A;  3I5R A;  1VQ9 T;  4HT8 A;  2VXE A;  4M75 D;  4GY5 A;  3CCM T;  4FYV B;  3CMA A;  3OYN A;  5EC7 A;  2COW A;  2ZPH B;  4M77 G;  1RAF B;  4CRI A;  3SWN C;  3JAM E;  2DIG A;  3HRS A;  3CBM A;  3OYY A;  4N4H A;  3M53 A;  4LDX A;  1BCM A;  1M5Q 1;  2ENM A;  2ZAE A;  1UGR B;  2DJQ A;  2KBT A;  3UDC A;  1N8R C;  4M78 G;  1SF9 A;  3PMI A;  2ZPF B;  1W2B A;  3BDL A;  3L1A A;  4OMM A;  4LUE A;  8ATC B;  1IGU A;  2GNC A;  2DIL A;  4FYX B;  2JMC A;  4RUG A;  3CEY A;  1ABQ A;  5I2S A;  2RHY A;  2ZPB B;  3CCR T;  5CIU A;  4LD6 A;  4Z88 A;  3LLR A;  1BIA A;  3SEM A;  1JU5 C;  3SFM A;  1NJI U;  4RTZ A;  4FT2 A;  4YTL A;  5LJ5 j;  3CCU A;  3MET A;  2A36 A;  3PTA A;  1I8F A;  4M78 F;  4JLG A;  2E6N A;  3HP9 A;  4OMF B;  3PMT A;  1I0C A;  2DF6 A;  1XTD A;  3MP6 A;  1N9S A;  2HKN A;  2X51 A;  1VUB A;  4PFP A;  4C0D B;  1BI3 A;  1LCK A;  4OML A;  2JS0 A;  4J8O A;  4MDW A;  3CME A;  4B9W A;  2DVJ A;  4N4G A;  4C0Z A;  2YXY A;  4X9D A;  4KGV B;  3IQL A;  2RHI A;  4WF2 A;  4J9F A;  2SEM A;  1K8A R;  1M9S A;  2FL7 A;  1IHV A;  3QDF A;  5GAO r;  3MEW A;  1MUZ A;  2MWP A;  4BD3 A;  1X6O A;  1PNJ A;  1T0J A;  4KT0 E;  2RI5 A;  3OMG A;  5KYY B;  2G3R A;  2ZZD A;  3CCL Q;  3M9Q A;  1CKA A;  1TXQ A;  3NGP A;  2OTL T;  3CMA T;  5CKB A;  3HKS A;  4C92 A;  4RCB A;  2CP6 A;  4MMK A;  3CCE A;  4PJM A;  1VQ9 A;  1FX7 A;  1BIB A;  2JTF A;  2XK0 A;  4PNO A;  2DO3 A;  1VIF A;  3EG2 A;  1TUG B;  2EPD A;  3CCJ Q;  4IKF A;  4Y91 A;  2MWO A;  2MF2 A;  2ATC B;  4R56 A;  1M2V A;  1Q82 C;  3RES A;  2XID A;  2RN8 A;  1WHH A;  3G71 Q;  3CPW S;  4Z89 A;  3G4S T;  5A0D A;  1AWO A;  3M56 A;  2LCS A;  4JZ4 A;  3VS7 A;  3UWN A;  4F7U G;  2LCL A;  2WSE E;  1AZG B;  2QG9 B;  1OV3 A;  3A8M B;  4KGZ B;  5GAM j;  5CKE A;  4FT4 A;  1BYM A;  4LDU A;  5GAN 6;  5LJ3 f;  2AHJ B;  2P0P A;  2K4Y A;  1G3Y A;  2L5Q A;  5GAN j;  3VYH B;  5FRO A;  3M4G A;  5CCA A;  1M90 R;  2MIO A;  4JUV A;  2D8J A;  3RNJ A;  1X01 A;  5KYX B;  2KNB B;  2LJ0 A;  1PG5 B;  1GBR A;  3CCV T;  3RIR A;  2M02 A;  1UHF A;  1RLP C;  1GBQ A;  2R58 A;  2E65 A;  1UEB A;  4EMG A;  2EJG A;  5FRM A;  1TOV A;  4FM4 B;  3LWH A;  1E6H A;  2SRC A;  2EBP A;  1VQ7 A;  1H3H A;  2V8I A;  3MCA B;  2C0T A;  1T3L A;  3VS2 A;  3OBW A;  4ZNX A;  3OQ5 A;  4A4H A;  2EJ9 A;  5GAO p;  1YHQ T;  2A08 A;  2FG0 A;  2EYX A;  2A0F B;  3QPH A;  2DET A;  1D09 B;  4IUP A;  2AT1 B;  2NUT A;  1PD1 A;  2A7Y A;  4J9D A;  1KJW A;  2RQW A;  3KUF A;  5IT9 E;  4RTW A;  1NE8 A;  3I9Q A;  3VRZ A;  1KK7 A;  4DEY A;  3SB2 A;  4JRP A;  5KCO A;  5KYN A;  1PRM C;  1PHT A;  5HCK A;  3NTI A;  2GGR A;  1WIE A;  3FC3 A;  2E41 A;  4OP0 A;  4PJO F;  3UAT A;  1ZQ1 A;  3C4S A;  1UTI A;  1OZ2 A;  3HFO A;  1AOJ A;  3CCQ Q;  2NWM A;  2K5L A;  4L6V 5;  3LH0 A;  2KT1 A;  4ELZ C;  1FXX A;  3CCR Q;  1LVK A;  3MKD A;  2EYW A;  1MGQ A;  1WPY A;  2YRC A;  1V1C A;  3QJ6 A;  1ABO A;  3X20 B;  2EJF A;  3L2Q A;  2ESW A;  4M77 D;  2X35 A;  2WSC E;  3Q1J A;  3M58 A;  1WQ7 A;  2XDD A;  5CO7 A;  2BE9 B;  2E64 A;  2A28 A;  2KYM A;  4EPC A;  3HRT A;  3BY7 A;  3UF4 A;  3CC4 A;  4QW2 A;  3I35 A;  1I5O B;  3PIP A;  4IUT A;  5EG2 A;  5KYU B;  2M51 A;  3FJ5 A;  2EIF A;  2QXF A;  2DEU A;  3NTK A;  1UGV A;  2YLB A;  3EGX A;  4ATO A;  2KRM A;  4J5Y A;  4II1 A;  3EHR A;  4RG2 A;  1NZ9 A;  1RAD B;  5HK3 A;  1VYT A;  2EWN A;  2L8D A;  1KQS S;  2P84 A;  1OPK A;  2L3R A;  3CC2 A;  2V1Q A;  4FW1 A;  3I55 A;  4RTU A;  1V76 A;  2V8K A;  1SEM A;  2DAQ A;  1NJI C;  5LJ3 j;  3OYF A;  2O4X B;  1JJ2 S;  1YIT T;  3GPL A;  2KRS A;  2EFI A;  3QJY A;  1D1C A;  3L2U A;  4ZN3 A;  1U8R A;  1JJ2 A;  2M16 A;  2C0O A;  2LVM A;  5FU6 B;  2CH4 A;  1UEC A;  2CH4 W;  2EGA A;  3CCM Q;  1I5L A;  3QXE B;  1YI2 Q;  2YSQ A;  5FU7 B;  1D0Y A;  1N8R U;  4M7D E;  1K9M U;  1M90 C;  1M1K C;  3VUB A;  1WHJ A;  1D3B B;  4C5H A;  5HKC A;  2DYB A;  1VOM A;  5CR2 A;  1YIT A;  4XK8 E;  2EKO A;  1BBZ A;  2RB6 A;  3OB9 A;  1YJ9 A;  1W2B S;  2CZ7 B;  1TUD A;  2F5T X;  5M9O A;  2DFU A;  1BKB A;  1OEB A;  5L23 A;  3M4Y A;  4L59 A;  2KXC A;  4E7Z A;  2RMO A;  1IO6 A;  5IHN A;  3M0T A;  2BZY A;  4B6M A;  5KCH A;  3S3M A;  1U3O A;  5GAM h;  4JJC A;  3CC4 T;  1PKS A;  1M1F A;  2J6O A;  5J26 A;  2QI2 A;  2PUO B;  1OX9 A;  3X26 B;  2DTH A;  2DTO A;  2O9S A;  1KG1 A;  4DBF A;  1AWX A;  4A4K A;  3CC7 Q;  3FIF A;  4M77 C;  4J9G A;  1VQN T;  5CKF A;  2BZ8 A;  4A4E A;  1WI7 A;  3GNF B;  1YJN Q;  5KE2 A;  5KYW B;  1OX8 A;  1VQL A;  4GLK A;  3CC7 A;  4C8Q A;  5A0L A;  2NUT B;  1T3S A;  1TH7 A;  3ZFJ A;  2AKL A;  3HFN A;  5LJ5 d;  1VQ8 T;  5FRN A;  3DKM A;  3V8L A;  4IIO A;  1LJO A;  2XMF A;  4XTX A;  3PIO A;  1S72 A;  4XTZ A;  1ZUU A;  2V26 A;  1R0B G;  5D6X A;  1VQM Q;  3EH2 A;  1YJW T;  3VS5 A;  3OY9 A;  4HVW A;  3RER A;  3REB B;  5GAO m;  2O01 E;  3CC7 T;  4C92 E;  3THK A;  3CCU T;  3QSU A;  1RI0 A;  1YIJ Q;  3I5S A;  2CP0 A;  3MPU B;  2KRO A;  2CZ1 B;  1LOJ A;  1VQ5 T;  2L0A A;  4BY6 B;  4BI3 A;  1ZBX A;  4EMH A;  2DTI A;  4GBQ A;  3VRY A;  2QEX Q;  2XG8 D;  1UUE A;  3E9F A;  3CCV A;  4J6Y A;  3SWN B;  3REA B;  4JLI A;  1K8A C;  3PGG A;  5DLQ E;  3VJP A;  4QVD A;  1ZLM A;  5IAY A;  3CPW A;  1ZUK A;  2QGF B;  3C12 A;  4A53 A;  5KYX A;  2DPP B;  1KD1 U;  5GMK i;  2DBM A;  1YI2 T;  4HA8 A;  1UB4 A;  3TEE A;  2JMA A;  1JJ2 P;  2O4X A;  2OAW A;  1SHG A;  3RKX A;  2ED0 A;  3EAE A;  5GMK e;  1NBE B;  1WJS A;  2QTX A;  1KFZ A;  2JVV A;  4F14 A;  4FYY B;  2X3X D;  1EIF A;  4EMK A;  3C0C A;  2DX1 A;  5GMK h;  4J83 A;  2OI3 A;  3INZ A;  2K57 A;  5GMK l;  2X4X A;  2MYS A;  2KT8 A;  2BTT A;  3RKY A;  1NPR A;  2HEQ A;  3CD6 T;  5CQY A;  1VQ5 A;  2RQR A;  1M90 U;  2HBW A;  4NL3 A;  2AKK A;  3ASK A;  1VQO T;  3V8K A;  1Q7Y C;  2YRD A;  4XU2 A;  4ANJ A;  3E19 A;  1YHQ Q;  4P5N A;  1YN8 A;  1D0Z A;  4IUR A;  2CP7 A;  2D9T A;  3A8O B;  4OMQ A;  1H64 1;  4C8Q E;  5I11 A;  2M1H A;  3FDR A;  2A37 A;  5GMK j;  3CC2 Q;  3VS3 A;  2CKK A;  3M55 A;  1Q81 R;  2RI3 A;  4M7D C;  2C06 A;  5KYU A;  4LDV A;  4NL2 A;  2J05 A;  1YIJ A;  1Q7Y U;  2EQK A;  1Z9Z A;  2E12 A;  1ZUY A;  3MO8 A;  5GAM f;  1VIE A;  4M77 A;  1K4U S;  3CCS Q;  2CRE A;  4L5G A;  3SHW A;  1Y0M A;  1GRI A;  3MEV A;  3SD4 A;  3CCL A;  2YUN A;  3HPW A;  4E7S A;  3QWX X;  4M7A E;  2B86 A;  3QG1 A;  1MHN A;  3CCJ T;  1Y57 A;  3JB9 H;  4J7I A;  3VV0 A;  2JTE A;  1FYN A;  5LJ3 e;  2HMA A;  1Y7X A;  1KD1 R;  1U06 A;  1HYO A;  2DKG A;  2VXF A;  3OSS C;  3CXC S;  1VQO Q;  2DK3 A;  3CCS A;  3ZL7 C;  2EQJ A;  1DJ7 B;  2HZY A;  1Q86 R;  2R5A A;  1QMC A;  2V8J A;  2L89 A;  5D7U A;  2BKD N;  1B34 A;  2Z0W A;  1WJQ A;  2KI7 A;  2QQA A;  1A0N B;  2GTJ A;  4JJN K;  2YLC A;  1ZX6 A;  2DJZ A;  3CPF A;  3PNW C;  1K8A U;  3E2U A;  2X9H A;  1MV3 A;  1X69 A;  5CK9 A;  1AVZ C;  2W0Z A;  1QKX A;  1XJW B;  1TSF A;  2KYB A;  3CCE Q;  2BZX A;  1X43 A;  1WDX A;  4AFU C;  5IH2 A;  1PKT A;  3AT1 B;  4PJO B;  2DD4 A;  3BE3 A;  2RD1 A;  3OA6 A;  4M4Z A;  3JCM b;  4DBH A;  3HL8 A;  3QO3 A;  4RG8 A;  4LXC A;  3G6E A;  1NLP C;  2L3Q A;  1ZSZ C;  1ZA1 B;  4OMO A;  2O31 A;  1K73 U;  3GF5 A;  2OTJ Q;  5GJW B;  1WHG A;  3I55 Q;  2KY9 A;  3QDR B;  5GAM g;  2KRN A;  2LT1 A;  3RMQ A;  4BI8 B;  4AG2 C;  2J06 A;  1D3B A;  1QVF S;  1Y96 A;  3CXC P;  3M0Q A;  1SSH A;  2RJD A;  2EQU A;  4JRQ A;  3CME Q;  4FYW B;  2COY A;  4PL6 A;  6AT1 B;  1F1B B;  1FMV A;  4M77 E;  1NEG A;  3OYI A;  2DRK A;  3T9N A;  3EFS A;  1GFD A;  3CPW P;  4BE1 A;  4OGE A;  1WXB A;  2K9G A;  3FRN A;  4RTX A;  2E70 A;  1VQM A;  2PVO B;  3X28 B;  2RQV A;  3OYK A;  2QQB A;  2PNI A;  3EGD A;  1X2Q A;  3TSW A;  3F70 A;  1UG1 A;  4M75 F;  4M7A G;  1UHC A;  3A5Z B;  3LGF A;  1GXI E;  3M59 A;  5D6W A;  4IUQ A;  1QVF A;  1IXD A;  3QII A;  4C92 F;  1AHJ B;  2FZC B;  1K9M R;  3QHS A;  1FMK A;  2FRY A;  3JB9 G;  2D0N A;  1WXU A;  3G71 A;  2KDS A;  1VYV A;  2RHX A;  2LP5 A;  1VQ6 T;  4HCK A;  1BI0 A;  4F17 A;  3C94 A;  3OYM A;  1IRX A;  2PVD B;  1QVG S;  5GAN e;  3O8V A;  4OF1 A;  1B07 A;  1QW1 A;  3CCQ T;  4PLL A;  3EG9 B;  4ME7 A;  1QVG P;  2R57 A;  1WZO A;  4E2F B;  1WA7 A;  1MND A;  3JB9 F;  5GAM e;  4F16 A;  2RHU A;  2HQX A;  3QYH B;  1NPP A;  3JB9 I;  1C0M A;  3M5A A;  1M1K U;  1B34 B;  2KK4 A;  2HCK A;  2O2O A;  3H9N A;  4M75 B;  4M7D A;  4PJO G;  1VQK T;  5CKH A;  1N27 A;  3TU4 K;  3HHT B;  2P4T A;  2VYT A;  3CCM A;  3JCM h;  1QQJ A;  2YHT A;  1Y07 A;  3P8D A;  3NHN A;  1T0H A;  3OS1 A;  4M75 G;  3VS4 A;  4M7D D;  1CSK A;  3N5B B;  1JEG A;  4F04 B;  3EFR A;  3OW2 S;  3EG1 A;  2QAZ A;  2Y4X A;  4EMK B;  2PTK A;  1MV0 B;  2ROL A;  3CCV Q;  2DD5 A;  3PT9 A;  4BUG A;  3PFS A;  2X4Y A;  3SDZ A;  2JZ2 A;  4KUI A;  2D0Q B;  7AT1 B;  3QUI A;  3JB9 D;  1VYU A;  3JCM g;  4BI4 A;  2LQK A;  2RO0 A;  4Y28 E;  3KFV A;  3NPF A;  3X24 B;  1WX6 A;  2XKO C;  4DBR A;  1R77 A;  1M3B A;  2IG0 A;  4KUL A;  4A54 A;  2W10 A;  2DL4 A;  3JSC A;  4WCI A;  4OGC A;  3DLL A;  1Z9Q A;  2RK2 A;  4AFQ C;  4PJO A;  5IN1 A;  4A4G A;  1C1A A;  1G2B A;  1W6X A;  1ZSG A;  4PFO A;  1VQ9 Q;  1G5V A;  5CQX A;  2NLU A;  8AT1 B;  5KE3 A;  2QGG A;  2QA4 A;  4F7U B;  4C5E A;  3UPU A;  2MAM A;  3JCM V;  4C0F A;  4CC4 B;  4C92 D;  2AZS A;  1KQS P;  3E1S A;  2DM1 A;  3ER0 A;  2PQW A;  3JCM W;  3JCM c;  4EDU A;  2D1X A;  1WGS A;  2QK0 A;  3HRU A;  1JO8 A;  3R6O A;  4M7A B;  1GCP A;  3U23 A;  1PWT A;  4N0A C;  5J39 A;  5GAO n;  2FRW A;  1SHF A;  2OTL Q;  4ESR A;  1KQ1 A;  1KSW A;  3J81 E;  1X2K A;  2NYS A;  4R0K A;  5LJ5 h;  4M75 A;  4M7D B;  4OB0 B;  4E7J A;  2ABL A;  4ZGD B;  2GTO A;  2FEI A;  1K76 A;  4KGX B;  3WVE B;  2KXD A;  1YWP A;  3QBY A;  2DA9 A;  2OAU A;  4HKE A;  1RAC B;  2DXB A;  4C92 C;  3EFO A;  3M0S A;  2OTJ A;  3JCM X;  4ZTJ A;  3CQT A;  4OVA A;  3OSV A;  1IRE B;  3G6E Q;  1WHM A;  1RL2 A;  3C95 A;  4PK4 A;  3OYH A;  2RPN A;  4XTU A;  1WLP B;  2M9U A;  4R55 A;  3BFM A;  4D8K A;  5FW9 A;  3FB9 A;  2FPD A;  2FZG B;  1VQ7 Q;  4LDW A;  3VS1 A;  3S3N A;  1BI1 A;  1Y71 A;  3MJX A;  1M2O A;  1Q7Y R;  3EFO B;  4Y92 A;  2AIR B;  5CKD A;  3LYI A;  2HKQ B;  1G3W A;  3RR6 A;  2EKH A;  3CCR A;  1I4K 1;  1AWW A;  4JJD A;  2JJ9 A;  2RJF A;  2FZK B;  5FWC A;  2OX7 A;  2L3P A;  2FYK A;  4MZM A;  1MMA A;  2HSP A;  2HBP A;  4EIK A;  5GAN 8;  4E7I A;  1YIJ T;  2EGC A;  2JM8 A;  2NUZ A;  2LMJ A;  3CCU Q;  5GAN f;  2C0I A;  2EYQ A;  4ZN1 A;  2MPX C;  2VUB A;  3V8J A;  4C8Q D;  4N4I A;  4FSX A;  4PJJ A;  2K2M A;  2DLP A;  4CC7 A;  1Q82 U;  4LUD A;  1IHW A;  1I07 A;  1QWF A;  3JCM J;  2RJC A;  3NFC A;  5AT1 B;  2QQS A;  1VQL Q;  4JRI A;  2HNI A;  4B9X A;  1E6G A;  3EHQ A;  1VA7 A;  1YP5 A;  4J6X A;  2GQV A;  1QCF A;  2VV5 A;  2KQW A;  3X25 B;  4QKU A;  3QKJ A;  5LJ5 e;  1Q95 G;  1BI2 A;  3EGX B;  3CCE T;  4FU6 A;  3BDU A;  2ZPE B;  4XU1 A;  3I56 Q;  3RUX A;  2VAS A;  1K73 R;  2DL7 A;  3NTH A;  2H3E B;  2EAY A;  4AT1 B;  2OTJ T;  4J9I A;  4OMP A;  1NYF A;  2K7A A;  3DB4 A;  4KRT A;  1N8R R;  1JQQ A;  5ECA A;  3JV3 A;  2J7I A;  4WTO B;  4XU0 A;  2EGE A;  4BAC A;  1PCX A;  2K5F A;  1G3T A;  2K2V A;  1M30 A;  3TCJ A;  1S72 T;  2PVG B;  1NLO C;  4PJO C;  2KEA A;  2CT3 A;  4E7K A;  2EQI A;  4ZTF A;  3QYG B;  2CZ6 B;  4JS4 A;  2GF7 A;  4M7A D;  1LPL A;  2DNU A;  1TWB A;  3RDV A;  4AG1 C;  3JCM d;  1IZ6 A;  2YUO A;  2B8A A;  2YWW A;  2ZGW A;  3WVD B;  4JDS A;  1H3Z A;  2DIQ A;  4IIM A;  5J3B A;  5GAO l;  2MOX A;  4HCB A;  1BCO A;  2BE7 D;  2EQM A;  4O6J A;  3OS2 A;  2D6F A;  1LNX A;  2K3B A;  1WYX A;  4RTV A;  2QEX A;  1G8X A;  2MK5 A;  2X4J A;  3PVL A;  4X9C A;  3OBY A;  2EVR A;  2P4R A;  5D6Y A;  5GAN h;  4MZP A;  3OYJ A;  4CC2 A;  3DLM A;  3A8H B;  3OYC A;  4GLM A;  2DZ9 A;  1KD1 C;  2RK1 A;  3J80 E;  1EZZ B;  3CME T;  1GFC A;  1YJ9 T;  3D7S B;  5GAM d;  4C92 G;  4J9B A;  3CMA Q;  1I81 A;  4IUU A;  4Z8A A;  1TTH B;  3H6Z A;  1V29 B;  1K0X A;  2RQT A;  2M0Y A;  3LWI A;  3MP1 A;  2X4W A;  2LC4 A;  1W70 A;  3MHX A;  4JS5 A;  3MEA A;  1P92 A;  1OZ3 A;  4QVC A;  1YWO A;  1B3Q A;  1X27 A;  4HVU A;  3JB9 J;  1S72 Q;  1I1J A;  2OJ2 A;  2R5M A;  4PFZ A;  1NG2 A;  3G71 T;  4BY6 C;  3RKW A;  1Q81 C;  4E6R A;  2VGN A;  3H8Z A;  1VQP A;  3G4S Q;  3AHU A;  5DM7 R;  3PE0 A;  1S1N A;  4RMO A;  1GCQ A;  4LN2 A;  1VQK Q;  2DMO A;  3L42 A;  3L2R A;  3GBQ A;  2QTV A;  3O5Z A;  4KH0 B;  1OYX A;  3P8B B;  1K1Z A;  1BK2 A;  4C8Q G;  2JXB A;  4OB3 B;  4X34 A;  2DXU A;  2K3Y A;  2JW4 A;  2V1R A;  3EH1 A;  2CT4 A;  1ZA2 B;  3VU3 C;  1D1A A;  1H8K A;  1OUL A;  2CSI A;  2E10 A;  1ZSZ A;  1YNZ A;  2DL8 A;  4KH1 B;  1VQ6 A;  1UDL A;  4MML A;  4O5V A;  3EG3 A;  4HVV A;  1PD0 A;  1R8O B;  1OQK A;  3KBG A;  4BDZ A;  3V7C A;  1QLY A;  2BIV A;  3A1P A;  2AZV A;  4K11 A;  4NOY A;  1QVG A;  1ZSZ B;  5GJV B;  1M1G A;  4M75 E;  5FU7 C;  2PUK B;  3DB3 A;  4HXJ A;  5LJ3 d;  2LRQ A;  1YJ9 Q;  2QDY B;  5FU6 C;  1M3A A;  2JNG A;  1RI9 A;  4HCZ A;  2J6F A;  2FHD A;  1YIT Q;  3OYD A;  1NEB A;  4M78 A;  2DER A;  2VVK A;  5KH6 A;  2LQW A;  2E3I A;  2QQR A;  1HJD A;  3HTR A;  1VQ4 T;  2KR3 A; 
#chains in the Genus database with same CATH homology
 2P4T A;  2VYT A;  4IUV A;  3OW2 A;  1YI2 A;  2RB6 A;  3CC2 T;  4PJO E;  3CCM A;  3OB9 A;  3JCM h;  1VQ7 T;  1YJ9 A;  2YHT A;  4FL6 A;  1Y07 A;  2XDP A;  1W2B S;  2CZ7 B;  3P8D A;  5AYF A;  3L2Z A;  2F5T X;  2JOY A;  5M9O A;  4M78 D;  1BKB A;  5GAN 4;  3URG A;  3M4Y A;  3OS1 A;  5DY9 A;  4L59 A;  1UGQ B;  4M75 G;  1ZHI A;  4XTW A;  4M7D D;  3HSB A;  3CCL T;  3JCM e;  3N5B B;  3EFR A;  1U1T A;  3OW2 S;  2K5I A;  5KCH A;  2DXC A;  2Y4X A;  4EMK B;  3OYA A;  3S3M A;  5GAM h;  2P0Q A;  3CC4 T;  2DD5 A;  1M4Z A;  3PT9 A;  3PFS A;  4BUG A;  4PJO D;  1M1F A;  1YBY A;  2A3L A;  2X4Y A;  2QI2 A;  2JZ2 A;  2ZCF B;  2PUO B;  1XOV A;  3OMC A;  4KUI A;  4Z02 A;  2D0Q B;  4EMK C;  3QUI A;  3JB9 D;  5GAN 5;  3X26 B;  1JBM A;  3JCM g;  1QVP A;  1WQW A;  2DTH A;  2LQK A;  2RO0 A;  4BI4 A;  4M78 E;  4Y28 E;  3JCM Q;  3QZ5 B;  2RM4 A;  3FEO A;  2DTO A;  1UGP B;  1KG1 A;  2GFU A;  2CZ0 B;  5A0G A;  4A4K A;  2DVE A;  5C6S A;  4UC4 A;  4KBM B;  3FIF A;  2JUF A;  3WXM B;  3X24 B;  4M77 C;  5FLX E;  1FWZ A;  2RJE A;  2XKO C;  3KXT A;  1VQN T;  2IG0 A;  3CCJ A;  4KUL A;  5CKF A;  4A54 A;  4TVR A;  1HK9 A;  3JSC A;  4A4E A;  2XIC A;  5LL6 S;  4OGC A;  3DLL A;  1Q81 U;  3S6W A;  4C8Q F;  2RK2 A;  1KQ2 A;  4C0D C;  1W4S A;  2QEX T;  1K9M C;  3GNF B;  1M8V A;  3JRZ A;  5IN1 A;  4A4G A;  5KE2 A;  4PJO A;  1VQN A;  1G3S A;  1VQL A;  4GLK A;  3VYG A;  3CC7 A;  5A2Q E;  2WSF E;  4JRK A;  2MMP A;  2FVU A;  4C8Q A;  1G5V A;  5A0L A;  5CQX A;  2NLU A;  3P8H A;  2XD0 A;  3OYE A;  3ZFJ A;  1TH7 A;  4QVZ A;  3HFN A;  3CXC A;  4XTV A;  1VQK A;  1JRI A;  5KE3 A;  5LJ5 d;  2QA4 A;  3GNG A;  1VQ8 T;  4M7D F;  5FRN A;  4M77 F;  3DKM A;  1VQO A;  2XU8 A;  4F7U B;  2DXT A;  4M77 B;  3V8L A;  5CAI A;  2E1H A;  1LJO A;  4C5E A;  4XTX A;  3PIO A;  2MAM A;  3UPU A;  1S72 A;  4HCC A;  1X75 C;  3JCM V;  4XTZ A;  4C0F A;  4C92 D;  2LDM A;  4VUB A;  4BB7 A;  2Y4Y A;  4ELY C;  1Y96 B;  2KAF A;  3E1S A;  3ER0 A;  4DOV A;  5D6X A;  2PQW A;  3J7A F;  2VGM A;  3JCM W;  1VQ9 T;  4NS5 A;  3JCM c;  4C92 B;  1YJW T;  4HT8 A;  2VXE A;  4M75 D;  4EDU A;  1WGS A;  4M7A B;  3HRU A;  3R6O A;  4GY5 A;  4C8Q B;  2LNV A;  3CCM T;  1VQ8 A;  3A8L B;  3CCQ A;  3OY9 A;  3CMA A;  4N0A C;  3V7S A;  3OYL A;  5J39 A;  1KQS A;  3OYN A;  5GAO n;  5GMK m;  3I56 A;  1Q86 U;  3RER A;  1KQ1 A;  3J81 E;  5GAO m;  2ZPH B;  2O01 E;  3SWN A;  3CC7 T;  4M77 G;  4XU3 A;  2RI2 A;  4M75 C;  4C92 E;  5LJ5 h;  3CCU T;  4M75 A;  4M7D B;  3QSU A;  4CRI A;  4OB0 B;  3SWN C;  3JAM E;  1RI0 A;  4E7J A;  3CD6 A;  4ZGD B;  3GP8 A;  2DIG A;  3HRS A;  3CBM A;  3OYY A;  3WVE B;  4HT9 A;  3QBY A;  3M53 A;  2CZ1 B;  1LOJ A;  2CGH A;  4N0A A;  4N4H A;  1VQ5 T;  2OAU A;  4HKE A;  4LDX A;  4J6W A;  4BY6 B;  2DXB A;  4BI3 A;  4C92 C;  4C0G A;  1M5Q 1;  1ZBX A;  1UGR B;  4FIB A;  4EMH A;  2DTI A;  2OTJ A;  3JCM X;  4ZTJ A;  3UDC A;  1N8R C;  4OVA A;  3OSV A;  4M78 G;  2QQ9 A;  1UGS B;  3PMI A;  1IRE B;  2XG8 D;  2ZPF B;  2H3J A;  1RL2 A;  3C95 A;  1W2B A;  3OYH A;  1KC8 U;  3E9F A;  3CCV A;  4XTU A;  3BDL A;  3L1A A;  2M9U A;  4R55 A;  4E47 A;  2HQE A;  4J6Y A;  3SWN B;  4JLI A;  1K8A C;  3BFM A;  5HY6 A;  2K3X A;  3PGG A;  3FB9 A;  3CEY A;  4LDW A;  5I2S A;  5DLQ E;  3GLX A;  3VJP A;  3S3N A;  2RHY A;  1BI1 A;  4QVD A;  2ZPB B;  3CCR T;  1Y71 A;  4DOW A;  5CIU A;  4LD6 A;  5IAY A;  3LLR A;  1BIA A;  1WJR A;  3CPW A;  1KHI A;  3SFM A;  1NJI U;  5CKD A;  5L8R E;  4A4F A;  1QP2 A;  4FT2 A;  3LYI A;  3C12 A;  4YTL A;  4A53 A;  1G3W A;  5LJ5 g;  5LJ5 j;  3CCU A;  2DPP B;  3CCR A;  3A8G B;  1I4K 1;  3MET A;  1KD1 U;  5GMK i;  3PTA A;  1I8F A;  5GAO q;  4M78 F;  4JLG A;  2E6N A;  3HP9 A;  4HA8 A;  3PMT A;  4OMF B;  1YI2 T;  1UB4 A;  3TEE A;  2LT4 A;  1XTD A;  3MP6 A;  1N9S A;  2E6Z A;  2RJF A;  3ME9 A;  4QQD A;  2O4X A;  3OYB A;  1VUB A;  3EAE A;  5J26 A;  3RKX A;  4C0D B;  1BI3 A;  2ZPI B;  4XQ3 A;  5GMK e;  2FYK A;  4J8O A;  4MZM A;  4MDW A;  1WJS A;  5C0M A;  3CME A;  2QTX A;  3G4S A;  2JVV A;  2HBP A;  4B9W A;  5GAN 8;  4E7I A;  4M7D G;  1VQP T;  1YIJ T;  4N4G A;  4C0Z A;  3VKI A;  4X9D A;  3L2V A;  5GAN f;  1EIF A;  2RHI A;  2EYQ A;  4EMK A;  4WF2 A;  4ZN1 A;  1O75 A;  5GMK h;  4J83 A;  2JN0 A;  3INZ A;  2K57 A;  1M9S A;  2X4X A;  2FL7 A;  2VUB A;  5GMK l;  3V8J A;  4C8Q D;  5GAO r;  4N4I A;  1NPR A;  3MEW A;  2PU9 B;  4FSX A;  2MWP A;  3RKY A;  3TRE A;  5CQY A;  1VQ5 A;  4BD3 A;  4PKC C;  4BE2 A;  3CD6 T;  1M90 U;  1X6O A;  4NL3 A;  3G6E T;  3ASK A;  3RMS A;  1VQO T;  3OS5 A;  3V8K A;  2RA2 A;  1Q82 U;  1Q7Y C;  4KT0 E;  2GCX A;  2RI5 A;  3OMG A;  4XU2 A;  5HK0 A;  2G3R A;  4M78 B;  4RKU E;  2ZZD A;  3E19 A;  3L2W A;  3M9Q A;  2OTL T;  3CMA T;  3JCM J;  5CKB A;  4P5N A;  2RJC A;  1PSF A;  3HKS A;  2D9T A;  3A8O B;  3MP8 A;  4IUR A;  4Q5W A;  4RCB A;  4C92 A;  3I56 T;  3JCM P;  3NFC A;  4MMK A;  3I55 T;  2QQS A;  3CCE A;  1VQ9 A;  1H64 1;  1FX7 A;  1BIB A;  5GAN 2;  4C8Q E;  4JRI A;  3VUZ A;  2M1H A;  3FDR A;  4MDX A;  2HNI A;  2JTF A;  5GMK j;  2XK0 A;  1HXD A;  4B9X A;  4PNO A;  2DO3 A;  2CKK A;  1VIF A;  3BW1 A;  2DEQ A;  3M55 A;  2RI3 A;  4C8Q C;  4J6X A;  2C06 A;  4M7D C;  4IKF A;  4LDV A;  2VC8 A;  2GQV A;  2LTO A;  4NL2 A;  4Y91 A;  2MWO A;  2MF2 A;  1YIJ A;  1Q7Y U;  4R56 A;  2EQK A;  1Q82 C;  2VV5 A;  2KQW A;  2CYZ B;  2XID A;  3RES A;  3QKJ A;  1PSE A;  2XI9 A;  3X25 B;  5LJ5 e;  2E12 A;  3MO8 A;  2KVQ G;  5GAM f;  1BI2 A;  3CCE T;  3CPW S;  4FU6 A;  3G4S T;  3BDU A;  1VIE A;  4QQ6 A;  5A0D A;  2ZPE B;  4XU1 A;  4M77 A;  3RUX A;  3M56 A;  4PLI A;  3NTH A;  2EAY A;  4L5G A;  5LJ3 g;  3UWN A;  5LJ5 f;  1VQL T;  4F7U G;  2OTJ T;  2LCL A;  3QZ9 B;  5LJ3 h;  1YHQ A;  3LGL A;  2WSE E;  3MEV A;  3SD4 A;  1XQH A;  3CCL A;  3OYG A;  1K73 C;  3HPW A;  3A8M B;  3ZEH A;  4MZT A;  5GAM j;  3DB4 A;  4M7A E;  4M7A A;  3QG1 A;  5CKE A;  4FT4 A;  1MHN A;  5DLO A;  4LDU A;  4ZGJ B;  1BYM A;  1U1S A;  3CCJ T;  3JB9 H;  3GOX A;  4J7I A;  4E7L A;  2LX9 A;  3S3O A;  3VV0 A;  5GAN 6;  5LJ3 f;  2AHJ B;  2P0P A;  3UT1 A;  1WNL A;  5LJ3 e;  4M7A F;  2K4Y A;  4XU0 A;  4BAC A;  1G3Y A;  1Y7X A;  2L5Q A;  5GAN j;  3VYH B;  5FRO A;  3M4G A;  2DKG A;  2K5F A;  2VXF A;  5CCA A;  1G3T A;  3OSS C;  3CXC S;  2K2V A;  2DK3 A;  3M57 A;  3TCJ A;  1S72 T;  3CCS A;  2PVG B;  4JUV A;  2EQJ A;  4PJO C;  1DJ7 B;  2XDB A;  2R5A A;  4XTY A;  1X01 A;  4E7K A;  2I2L A;  2IVW A;  2KMT A;  2L89 A;  2V8J A;  4DQ2 A;  4ZTF A;  3QYG B;  2CZ6 B;  4JS4 A;  2GF7 A;  2BKD N;  3CCV T;  1B34 A;  1YJW A;  4QQG A;  4M7A D;  4F7U F;  2WAC A;  3RIR A;  1WJQ A;  2QQA A;  2R58 A;  3JCM d;  2E65 A;  1IZ6 A;  1OI1 A;  1UEB A;  3M54 A;  2EJG A;  2B8A A;  4OB2 B;  4EMG A;  4JJN K;  2YLC A;  4BE0 A;  2ZGW A;  3WVD B;  4JDS A;  2DJZ A;  2DIQ A;  3CPF A;  1H3Z A;  5GAN d;  3PNW C;  1K8A U;  5J3B A;  5FRM A;  5GAO l;  2F5K A;  4FM4 B;  3LWH A;  5CK9 A;  1KHC A;  2CS7 A;  2P0K A;  1VQ7 A;  1KC8 C;  4HCB A;  2V8I A;  3MCA B;  4PJO B;  2DD4 A;  2JTM A;  4LDY A;  3OBW A;  2RD1 A;  3OA6 A;  3OQ5 A;  2LQ8 A;  2EQM A;  4A4H A;  3JCM b;  2EJ9 A;  4O6J A;  3OS2 A;  5GAO p;  3HL8 A;  1YHQ T;  2D6F A;  3OS0 A;  4E7H A;  3QPH A;  3QO3 A;  1LNX A;  2FB7 A;  4IUP A;  4RG8 A;  3G6E A;  3GIB A;  2MI6 A;  1SSF A;  2QEX A;  2F69 A;  2HD0 A;  4XAX B;  1K73 U;  4BDY A;  2X4J A;  2A7Y A;  4X9C A;  3GF5 A;  4V2S A;  2KY9 A;  3QDR B;  4C5G A;  5GAM g;  3KUF A;  2LT1 A;  3OBY A;  5IT9 E;  1YJN T;  3RMQ A;  4RCC A;  5D6Y A;  4BI8 B;  1NE8 A;  2HAX A;  5GAN h;  4MZP A;  5GAN 7;  2Y90 A;  1D3B A;  3OYJ A;  1Q86 C;  1QVF S;  1Y96 A;  3DLM A;  2RJD A;  3A8H B;  3LW5 E;  2EQU A;  3SB2 A;  4JRQ A;  4JRP A;  5KCO A;  4M78 C;  3OYC A;  2DZ9 A;  3NTI A;  1KD1 C;  4D6W A;  2RK1 A;  4PL6 A;  3J80 E;  3FC3 A;  3CME T;  1YJ9 T;  2E41 A;  4OP0 A;  4PJO F;  4M77 E;  4C92 G;  5GAM d;  2QA4 T;  3G7Z A;  3OYI A;  1JB0 E;  1ZQ1 A;  3C4S A;  3T9N A;  3EFS A;  1OZ2 A;  3HFO A;  1I81 A;  4BE1 A;  4IUU A;  5GAN 3;  2K5L A;  4OGE A;  4L6V 5;  3LH0 A;  4ELZ C;  3H6Z A;  1FXX A;  1V29 B;  3FRN A;  2OTL A;  2E70 A;  1VQM A;  2PVO B;  2M0O A;  3LWI A;  1MGQ A;  1WPY A;  2X4W A;  2LC4 A;  3MP1 A;  3SDZ A;  2RHZ A;  3X28 B;  3OYK A;  3QJ6 A;  2QQB A;  3MHX A;  3X20 B;  2EJF A;  4F7U A;  3MEA A;  3L2Q A;  4JS5 A;  1P92 A;  1OZ3 A;  3F70 A;  5I2M A;  4M75 F;  4QVC A;  3JB9 J;  4ZGE B;  4M7A G;  3A5Z B;  2ZPG B;  1QP3 A;  3MEU A;  2R5M A;  4M77 D;  2KSS A;  2X35 A;  2WSC E;  3LGF A;  3Q1J A;  3M58 A;  4F7U E;  3G71 T;  1WQ7 A;  1GXI E;  2XDD A;  1YCY A;  3M59 A;  4IUQ A;  5D6W A;  3RKW A;  4BY6 C;  1QVF A;  2LCC A;  3QII A;  4C92 F;  1AHJ B;  5CO7 A;  1Q81 C;  2VGN A;  4J7F A;  3H8Z A;  2E64 A;  1VQP A;  3FLG A;  3AHU A;  5DM7 R;  4EPC A;  3HRT A;  3BY7 A;  3QHS A;  4RMO A;  4QW2 A;  3CC4 A;  3CBP A;  3JB9 G;  1N6A A;  3PIP A;  4IUT A;  3JCM f;  2KDS A;  3L42 A;  5CVI A;  5EG2 A;  3L2R A;  3G71 A;  5GAN g;  2RHX A;  1XNI A;  2EIF A;  2QXF A;  3NTK A;  2YLB A;  4ATO A;  4J5Y A;  4II1 A;  1OYX A;  4RG2 A;  1YJN A;  1NZ9 A;  1VQ6 T;  5HK3 A;  1BI0 A;  3P8B B;  2EWN A;  2L8D A;  4C8Q G;  1KQS S;  1O9S A;  3E9G A;  2L3R A;  4OB3 B;  3C94 A;  3OYM A;  3CC2 A;  4OB1 B;  4X34 A;  2DXU A;  3I55 A;  2K3Y A;  4CI0 C;  2PVD B;  1QVG S;  5GAN e;  2V8K A;  3O8V A;  3CBO A;  4OF1 A;  1QW1 A;  2DAQ A;  3CCQ T;  5LJ3 j;  1NJI C;  4PLL A;  2O4X B;  3OYF A;  2BUD A;  4ME7 A;  3VU3 C;  2R57 A;  1JJ2 S;  1YIT T;  4M7A C;  2E5Q A;  3GPL A;  1N9R A;  2E10 A;  2YRV A;  5I21 A;  3JB9 F;  5GAM e;  1VQ6 A;  2EFI A;  3QJY A;  2RHU A;  3L2U A;  2HQX A;  4DA4 A;  4MML A;  4O5V A;  4ZN3 A;  1U8R A;  3QYH B;  1NPP A;  1R8O B;  3JB9 I;  1JJ2 A;  3KBG A;  4BDZ A;  3V7C A;  2BIV A;  2M16 A;  4C5I A;  4NOY A;  1QVG A;  3FJP A;  1M1G A;  4M75 E;  2LVM A;  5FU7 C;  5FU6 B;  2PUK B;  3DB3 A;  2RH2 A;  5LJ3 d;  2LRQ A;  3M5A A;  3LX7 A;  1M1K U;  4KUD K;  2GFA A;  1I5L A;  1B34 B;  3QXE B;  4LD9 K;  2QDY B;  2KK4 A;  5FU6 C;  5FU7 B;  1N8R U;  2JNG A;  4M7D E;  4HCZ A;  4M75 B;  1M90 C;  1M1K C;  1K9M U;  2XHC A;  3VUB A;  2FHD A;  1VQM T;  4M7D A;  4PJO G;  1D3B B;  4C5H A;  5HKC A;  3OYD A;  5CKH A;  1VQK T;  4M78 A;  1N27 A;  1VQ4 A;  5CR2 A;  5KH6 A;  4XK8 E;  3HHT B;  3CCS T;  3TU4 K;  1YIT A;  2QQR A;  3V7R A;  1VQ4 T;  2EKO A;  2DZC A;  3ZBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...