4M78F

Crystal structure of lsm2-8 complex, space group p21
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
65
Chain Sequence
b'ILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 10
structure length 65
sequence length 79
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78F00
4PJOE 4M75C 5GAOl 4M77A 2E64A 1KQ1A 1M5Q1 2YLCA 4OP0A 4RCBA 5LJ5d 4M77C 1JRIA 1N9SA 4XTWA 3JCMX 2VXEA 4PJOC 3SWNB 2Y90A 3EFRA 4EMKA 4M7AB 4EMKC 1D3BB 4M7DE 5GAOn 2DXUA 5GAN5 1MGQA 1WNLA 4F7UE 1TH7A 1WQ7A 2E65A 2I2LA 4M78E 3JCMb 4M7DA 2ZGWA 4C92E 2DKGA 4M7DC 3FB9A 3JCMh 4F7UA 2DZCA 4EMHA 4X9DA 1WQWA 4M78A 1WPYA 5LJ3e 3HFOA 1LJOA 3INZA 4A54A 4C92A 4M78C 3L2ZA 2VC8A 4C92C 5GMKm 1B34A 1HK9A 4J6XA 4C8QE 3JCMd 2QTXA 2EJFA 2DTIA 4MMLA 3JCMc 4J6WA 4M75D 3RKYA 5DY9A 5GAN8 4HA8A 5GANg 4C8QA 3GIBA 4JRKA 2EWNA 4XU1A 4QVDA 1YCYA 4M77D 4C8QC 1Y96B 2CGHA 2DVEA 4PJOA 5LJ3g 5LJ3f 2HNIA 3SB2A 1U1TA 4QVCA 4M7AE 4M75F 5GAMe 3QSUA 5GAN6 2E41A 4M75G 4Y91A 4M77F 1N9RA 4M7AA 2DTHA 4XQ3A 3BFMA 1D3BA 4M7AC 4M77G 5GAN2 4MMKA 5GANe 4M75B 4V2SA 4PJOG 5CAIA 1KQ2A 1U1SA 5LJ3j 4M77B 3RUXA 4JRIA 4NOYA 4XTZA 2DTOA 2EAYA 5GAMg 3QHSA 5GAMf 4HT9A 3BW1A 5GAOm 4EMKB 5GMKi 5LJ5g 2K57A 4M7DG 4F7UF 4RCCA 4XTYA 5GAN7 5GANf 1LNXA 4M78F 3V7CA 4C92F 4F7UG 2VXFA 5LJ3d 1X01A 2DEQA 4M78G 4XU3A 3JCMQ 4C92G 5GAOq 4PJOD 1LOJA 3PGGA 3JB9F 5GAMj 2RD1A 3L1AA 4C92B 3JB9I 3SWNA 5GAOr 3JB9G 1BIAA 4C8QF 3SWNC 5LJ5e 3M4GA 3RIRA 4A53A 4C8QG 4XTVA 3JCMJ 4PJOF 5GANj 5GMKe 4M7DD 4EMGA 2YHTA 2FB7A 3VU3C 3FJPA 3QO3A 5I21A 5GAN4 3BY7A 1HXDA 3JCMg 4M78D 3RKXA 3V8JA 5GMKl 3RESA 4C92D 5GANh 5GAMd 4DQ2A 4PJOB 2YLBA 4PNOA 4M7AF 3JCMV 5LJ3h 4N0AA 3JB9H 3BDUA 4M7AG 4M7DF 4N0AC 3HFNA 5LJ5f 3JB9D 3V8LA 2E10A 4HT8A 5GANd 2DJZA 3EFSA 3RERA 4C8QD 3JCMf 4NL2A 3V8KA 1I5LA 1I81A 3JB9J 5GAOp 3AHUA 4M7DB 4X9CA 3V7SA 1M8VA 3JCMe 4XTUA 4JLIA 1Y96A 4F7UB 3V7RA 3RKWA 4JUVA 2RB6A 4M78B 3FIFA 5LJ5j 4NL3A 4XU2A 4WF2A 1B34B 2FYKA 4M7AD 3JCMW 5GAMh 4J6YA 5GMKj 1BIBA 2RA2A 4M75E 2DXTA 1H641 4J5YA 2JN0A 1I8FA 2DZ9A 2EJGA 3QUIA 4XTXA 4XU0A 2EJ9A 5LJ5h 4C8QB 3JCMP 4M77E 5GAN3 1JBMA 3HSBA 4M75A 2E1HA 5GMKh 2RM4A 1I4K1
chains in the Genus database with same CATH superfamily
2RJFA 1D1BA 4M77A 2BUDA 2ZPHB 4D8DA 3EG3A 5CKEA 3EFRA 2H3JA 4F16A 1UHCA 3RMSA 2A37A 4RKUE 3CC4A 2E5QA 4JPBW 2QDLA 4Y92A 1SEMA 4R56A 2DYIA 1X75C 3UA7A 4OGCA 3CCQA 2EQUA 3UT1A 3TSWA 4M75D 2XG8D 4HA8A 1KC8C 4N4HA 5KE2A 5CKFA 2FZGB 2MWOA 1ZX6A 2K4YA 3OYCA 2V26A 2D0NA 1N6AA 2M9UA 1YI2A 1KQ2A 1G3TA 4OMPA 1I1JA 3OYDA 1RAHB 4NOYA 4C0DB 3OSVA 1GXIE 1KHIA 2LQWA 5HCKA 1HSQA 2ZPEB 4DBHA 2WSCE 2NYSA 4M78G 2COZA 4Z89A 2RMOA 2RD1A 2F2WA 3M0PA 1WLPB 4C8QG 3EH2A 4FIBA 2CYZB 1NE8A 3JCMg 1WFWA 4RTUA 5IT9E 2HCKA 1QVFA 1YIJT 3CMAT 2DM1A 3LGFA 2LMJA 5HY6A 5FU7C 4NL2A 3CCMT 5KYXB 2PVGB 2D9TA 4FYXB 3FIFA 1XNIA 3D7SB 2L89A 4DBRA 1M2OA 2DXTA 4M77E 5GAN3 8AT1B 5GMKh 1G5VA 3VYHB 2X4XA 1OOTA 1HYOA 3ZFJA 3ZEHA 1D0XA 1WHJA 3CCRT 2EW3A 3OA6A 1ZA2B 3A8HB 1U06A 2GCXA 1WQ7A 2QAZA 2ZGWA 4WTOB 1B7TA 5D7UA 2EQJA 1BK2A 1M90U 2KXDA 1IXDA 3RMQA 3PIPA 3CCMQ 1N8RU 3PIOA 1SG5A 3CPWA 4RTYA 3OW2P 4HVWA 2B86A 3HL8A 3BFMA 1TU0B 4M7AC 1G8XA 1IHWA 4M75B 4V2SA 4DOWA 2LQNA 3J80E 1ZSZC 2RQTA 2V1RA 1W2BA 1G3YA 3L2UA 1PC0A 1WYXA 4GLKA 2K5LA 4JRPA 4Q5WA 5LJ5g 1OI1A 3M9QA 1KD1C 3V7CA 3OQ5A 4FU6A 1F1BB 4RTXA 3PGGA 1VYTA 2BZYA 2C0TA 2AT1B 5J3BA 1RAIB 4C92B 3S3NA 4P5NA 2HBWA 3G71Q 1VQ7A 1K9MR 4LD9K 4PNOA 1K4US 1IGUA 4OMFB 3UA6A 4O5VA 1X6GA 1WIEA 2A0FB 1G3WA 2HQXA 5CQYA 3RERA 5FW9A 1YCSB 2LVMA 1JB0E 1Y96A 3GPLA 1IO6A 2OTJQ 2CSIA 3CC2T 2KNBB 4AMCA 1GRIA 2V1QA 5KYUB 1T3LA 3CC4T 3HSBA 4KUDK 2R57A 4OP0A 1WZOA 1ZLMA 3THKA 2DFUA 1IB8A 4B9XA 1YWOA 1M9SA 3MO8A 4XTWA 1K8AU 4EMKA 2R5AA 4FM4B 1QP2A 5L8RE 1NBEB 2SEMA 1WNLA 3LH5A 2QEXT 4BI8B 2RJDA 1VUBA 2KY9A 1WPYA 3HFOA 2FRYA 4M78C 2LT4A 5KYUA 2L3PA 4D6WA 1YI2T 2L0AA 2PQWA 5C6SA 2P0PA 1NJIC 4C8QC 4JJNK 3CC2Q 1SHGA 4PJOA 4BUGA 1E7OA 1WXUA 4OF1A 5DM7R 3A8OB 2K3YA 1P92A 2M0OA 3ME9A 3E19A 2LCSA 4FSXA 4M77F 4E7SA 5FU6B 2KT8A 4MZTA 2OJ2A 2LJ1A 2EAYA 2E6ZA 3QDFA 4BD3A 3CD6A 2VV5A 5GANf 1J3TA 2QEXQ 2FEIA 3OYNA 1K9AA 2QGGA 1JJ2S 2QA4Q 2MIOA 2KT1A 4XTVA 1MV0B 2DLPA 2MF2A 3QWYA 3FJPA 1CKAA 1VQ6Q 2LQKA 4CI0C 3KUFA 3UATA 2DJZA 3JSCA 1WJSA 2DL7A 4QQ6A 2HBPA 2M1HA 1X6BA 1MMNA 2HKNA 2E4HA 4IUQA 5LJ5j 2AHJB 2RNAA 4J6YA 1SRLA 1VQ5Q 2CH4W 2EJ9A 2J7IA 2RI2A 4HVUA 4FW1A 4EIKA 2RJCA 1VYUA 2A36A 2VGNA 1OEBA 3ZBDA 2X4WA 4JS4A 2F69A 4BDYA 3PFSA 4MZPA 4GBQA 1MGQA 2A7YA 4AFQC 4FW2A 1GCQA 1M1KR 3OYJA 4RMOA 2YUPA 2DZCA 2VB6A 4IIOA 4BI4A 1FXXA 1ABQA 2XDBA 9ATCB 3C0CA 4L59A 3CCLA 1FMKA 3I56A 4N4IA 1U8RA 4HKEA 4BACA 3RR6A 2GNCA 1RL2A 4A4HA 2HZYA 4FL6A 3RDVA 4MMKA 3M4YA 2YXYA 4PJOG 5LJ3j 5KYYB 4CC4B 4RTWA 4ZGJB 1VQ7T 2YWWA 1VQPQ 1I0CA 4BE2A 3GF5A 4J7IA 4QT7A 2XK0A 3VS1A 2DD4A 1Q95G 3TCJA 4A53A 3OYFA 1NYFA 1BKBA 1W4SA 1YJWA 3GBQA 2O2OA 1Q81R 1IHVA 5KYYA 1PRLC 1MV3A 2K5IA 4QKUA 4PFPA 3JB9D 4OGEA 2MK5A 1M30A 1I5LA 3PNWC 2RHUA 4XTUA 2QDYB 4F14A 1D1AA 1MUZA 1B34B 3HKSA 2LRQA 3X20B 4RTVA 1KD1U 1Q7YR 3L2RA 2K9GA 3R6NA 2ZAEA 1D0ZA 3VYGA 5I11A 4Z88A 2RQRA 1KIKA 2RI3A 2IPOB 4J9BA 1K73R 2DXUA 1VQLT 4KT0E 1FMWA 2KBTA 2E65A 1YJ9A 1QCNA 3INZA 2FZCB 1B34A 4J6XA 3RKYA 1UECA 1UEBA 4XU1A 1MMGA 2CZ6B 2E3HA 3META 2DERA 2LCCA 3CD6T 2DK3A 2IG0A 1ABOA 1QCOA 1U1TA 3LYIA 2DXBA 4BE0A 1KFZA 3CXCS 4E7IA 4J9GA 3I55A 5GANe 4QW2A 1ZA1B 2LCLA 4KGZB 5CKHA 2DTOA 2IIMA 2BIVA 4AG1C 3E2UA 3VV0A 3EHRA 3QIIA 2C0OA 3REAB 2E12A 2J6KA 3H0HA 1VQLQ 1X01A 2KGTA 2CUDA 1LCKA 3L1AA 1JXMA 3OYMA 3SWNA 3NHNA 2XKOC 2OTLT 1NLPC 4PJOF 1IRXA 4AFZC 2JM8A 3M0UA 3QO3A 1VQNA 1RAEB 2EQKA 2V8JA 3AT1B 4KGVB 1JQQA 4II1A 1K9MC 3CXCP 1FWZA 2QTVA 3OBWA 2NUZA 3V8KA 2JMCA 1VQMA 4JJDA 3CCVT 4ANJA 3QBYA 4OB1B 1KG1A 4WF2A 2NUTA 3JCMW 2PVDB 3CCJA 1W6XA 1H641 1SHFA 1ZUYA 2E1HA 3PVQA 1VQKA 1MMAA 2P84A 2CZ1B 2O4XA 2OTLQ 4PJOC 1WXTA 5EG2A 3NGPA 3CCLT 4YTLA 3VRYA 1VQOQ 2KK4A 1TSFA 1YITT 2P0KA 2K5FA 2FRWA 3TSZA 3I56T 1UTIA 1UE9A 1WXBA 2CP6A 2ESWA 1QVGP 2DILA 3RNJA 1RAFB 2D1XA 1NPRA 1X2KA 3CEYA 2V8IA 3JCMd 2QQSA 1D0YA 2JNGA 2DNUA 3OYKA 3CCVQ 3G4SA 1UG1A 2BKDN 1UGQB 1OPLA 2X3XD 1VQ4T 2ZPFB 2Y4YA 3LWIA 2HSPA 4Y91A 1SRMA 2QQAA 3MJXA 4PKCC 2WACA 3P8DA 4OMOA 3DB4A 5IH2A 4BB7A 2K6DA 1U1SA 3RUXA 4J83A 4PFZA 5KE3A 3QHSA 5GAMf 1YHQQ 2CT4A 1WHKA 4E7ZA 3H0IA 1YITQ 1PKTA 2HQHA 1YJWT 3M54A 1LNXA 4KBMB 4KRTA 4BDZA 1RABB 1SPKA 5CVIA 3QDRB 1Q82R 2DF6A 4A4KA 1UJYA 2AK5A 3JCMJ 5GMKe 4M7DD 3VU3C 1MHNA 1RLPC 3BY7A 3V8JA 3QPHA 4C92D 2F5TX 4OMLA 3OMGA 1VQ4Q 1E6HA 1PD0A 2E10A 1VYVA 1BI0A 5J39A 4E7HA 4OMNA 3AHUA 3C4SA 2FL7A 4JRQA 4JLIA 3V7RA 3RKWA 1S72A 1GCQC 4NL3A 1K1ZA 2FYKA 4AFUC 4Z02A 2C06A 4J9CA 1YJ9T 3CC7A 2LX9A 2JS2A 1M3BA 5GAOl 1UGRB 1M5Q1 5LJ5d 3JCMX 2MYSA 3E1SA 1MNEA 1QVPA 1T0HA 3CBOA 5IXBA 4PL6A 1CKBA 1PG5B 4BE1A 1M1KC 3FB9A 3HP9A 4AG2C 1LJOA 1RADB 2QTXA 3REBB 2KRMA 2IVWA 1VIFA 3KBGA 4LN2A 2J6FA 4JRKA 3G6ET 4QVDA 3NTKA 1YNZA 1FX7A 2KQWA 4LUDA 3SHWA 3TQ7P 2X4JA 3QSUA 3OYLA 4N4GA 1IGQA 2HDAA 3NTHA 1G2BA 4M77G 4LDXA 5FRNA 5KYXA 3CMAQ 1YIJQ 5A2QE 1M3AA 1PNJA 2K7AA 2GFAA 3NFCA 4CRIA 4X34A 2LX7A 3X26B 4O6JA 2YT6A 4R55A 1HD3A 2K79A 1JO8A 5LJ3d 2DEQA 3C94A 5A0GA 3JCMQ 1K0SA 2PUKB 1PSEA 3VS7A 2EYZA 1VQ9T 2CUBA 2E6NA 1UUEA 2XDPA 3CCSA 2YDLA 1VQMT 5L23A 1GCPA 2L3QA 4BY6C 2K2VA 4OB3B 4EMGA 3MEWA 4WCIA 3G6EQ 3UF4A 3R6OA 3EG1A 3CCRQ 2YLBA 1Q86R 3CCJT 1Q81C 3BDUA 3ULRB 2DL3A 2DMOA 4HT8A 5KYNA 3T9NA 3CCUT 2CDTA 5CKDA 1H92A 2F2XA 5GAOp 4M7DB 3VRZA 1DJ7B 2DX1A 3PE0A 5AYFA 3QYGB 1SKUB 3CXCA 2L2PA 2RN8A 4X1VA 3HRUA 4M75A 4A4EA 3M57A 1NYGA 1Q7YC 1VQ9Q 3CCEA 2SRCA 1WJRA 4FCYA 4DOVA 1AT1B 1TUGB 2DD5A 1K73C 1VQ8A 4M7DA 2XMFA 1KQSS 4C92A 3L2ZA 4JDSA 4DEYA 3CCUQ 1HK9A 1M1GA 3QXEB 5IHNA 1QVGA 5GANg 4FT4A 5IHKA 1WA7A 2CGHA 2M16A 2QI2A 5ECAA 2JTMA 3Q1JA 5KH6A 5LJ3g 3CCQT 2J05A 1K8AR 2CP0A 5FLXE 5GAMe 2DL5A 1AVZC 2DIGA 3URGA 4CC3A 4ELYC 5CAIA 3QKJA 2DIQA 5CK9A 3X28B 4JRIA 2ZPBB 2CREA 1M2VB 1Y71A 2ROLA 5GAOm 3QZ9B 1G3SA 2LQ8A 2MAMA 4HXJA 3JB9F 1OQKA 2OAWA 2W10A 5IXFA 3CC4Q 1BIAA 1M3CA 1GFCA 4LDWA 5I2MA 3VS2A 3SD4A 3UWNA 5I21A 3CCQQ 1WJQA 2A08A 2AIRB 2CZ7B 4N0AC 5FWCA 3CC7T 3VS0A 2MCNA 4EPCA 2ABLA 4F7UB 2KRSA 3MKDA 3N5BB 1YI2Q 4ORZA 1QWEA 4M7AD 2FVUA 5GAMh 4FYVB 3EG0A 4M75E 3QG1A 1D09B 2JN0A 2DZ9A 4DA4A 1KC8U 1MNDA 3M0QA 2JUFA 1R8OB 2RQVA 2HMAA 4M77C 1N9SA 4PFOA 3CMEA 2Y90A 1M4ZA 4M7DE 4HCKA 4E47A 1TH7A 1RACB 4C92E 2LJ3A 1H8KA 4PJLA 4F7UA 1Z9QA 4ELZC 4B6MA 4DBQA 2DETA 2VC8A 3A5ZB 2F1LA 3PT9A 1OU9A 1TOVA 2GTOA 4MMLA 2HAXA 1PKSA 5EC7A 1JJ2P 1GBQA 2ATCB 1RUWA 2EGCA 3O5ZA 3E9FA 4LDVA 2JW4A 3SB2A 2G6FX 2MWPA 2VKNA 3EG2A 4XQ3A 3HPWA 4E2FB 1ZSGA 3LW5E 1HJDA 4HCCA 4E6RA 4XAXB 5FU7B 1YJNA 1TTHB 2LNVA 2KDSA 2CZ0B 3JAME 4LXCA 2RH2A 4RCCA 4XU3A 2ZPGB 3CBMA 1M1KU 7AT1B 2ECZA 2DO3A 3OMCA 4DEXA 1BB9A 3TREA 1M8MA 2DE0X 5GANj 1Q82C 1OX9A 2YHTA 4IUUA 1TG0A 3TVTA 2MMPA 4FT2A 4M78D 2EKOA 2D8HA 2YSQA 5LL6S 3M0SA 4C8QD 1U5SA 1V76A 2XD0A 5IN1A 1M1FA 3I5RA 2QGFB 2RB6A 4Z8AA 5CIUA 2XI9A 3M56A 1AZEA 2O88A 1VQ8T 4J5YA 2K2MA 2VYTA 1SSHA 1UGSB 1KK7A 2E64A 2GQIA 3FLGA 2VXEA 3JRZA 1B07A 3X24B 1ZBXA 4M7AB 4E7JA 1C1AA 1ZSZB 5D6XA 4F7UE 2O9SA 2G3RA 4XK8E 3JCMh 4J9HA 2QG9B 1Q81U 3DLLA 2YRDA 1TWBA 1VQ7Q 1BI2A 3I5SA 3FEOA 2GF7A 4D8KA 2EWNA 4M77D 3WVDB 2HNIA 4K11A 4M75F 3L2QA 1ZUKA 1CSKA 2BTTA 2JMAA 4M7AA 1JU5C 1MMDA 1RLQC 2ENMA 2O01E 3M0TA 2JM9A 2MPXC 1Q7YU 1IREB 3M53A 1NZ9A 2YUQA 3CPFA 3X25B 4Y28E 1JEGA 3OY9A 1AWXA 1SF9A 2CKKA 4F17A 1EX4A 3QJ6A 3CPWS 5GAN7 4C92F 3OYHA 1K73U 4ME7A 1LOJA 2LDMA 3OS1A 1VIEA 2VASA 3VS5A 2XDDA 4C5EA 3M58A 2D6FA 2NWMA 1WX6A 2EGEA 1UJ0A 5CO7A 1W2BS 1X69A 1QWFA 4UC4A 2V8KA 5GMKl 2I0NA 3RESA 1Y57A 5KCOA 1UGVA 1TS9A 3JCMV 5HK0A 2HKQB 1Q86C 3CCMA 2EQIA 1C6VX 1QLYA 2KAFA 2VUBA 4PJNA 1H3HA 2JS0A 3V7SA 4ZN1A 1BBZA 2EFIA 3ZL7C 4M78B 4ZN3A 5GMKj 3UPUA 2XHCA 1GBRA 4QQDA 3LWHA 4XU0A 3QUIA 5LJ5h 2PNIA 4C8QB 2X4YA 1NJIU 1JBMA 3CD6Q 3QJYA 1PHTA 5GJWB 2KYBA 3VKIA 2KSSA 3VUZA 4EMKC 2QK0A 3P8HA 1ZBJA 3JCMb 1UGPB 4PLLA 3E9GA 4EMHA 1WQWA 4M78A 3QZ5B 4A54A 1R0CB 3G71A 3OB9A 1AHJB 5HK3A 2FG0A 1BU1A 2DXCA 4C8QA 3S3MA 2H3EB 1YJNT 5D6WA 3EGDB 2HEQA 2FO0A 4M7AE 1UFFA 2FHDA 2EYQA 2OTJA 1N9RA 3FDRA 1JJ2A 5GAN2 3EG9B 3ASKA 4CC7A 4C5HA 4M77B 3S3OA 2LJ0A 2JJ9A 5CKBA 4F7UF 4XTYA 3DB3A 2HL5C 2L3SA 5GAOq 3GNGA 4QQGA 4RG8A 5M9OA 1OZ2A 3M55A 2ROTA 1AWOA 3RIRA 1SSFA 1QP3A 2BZ8A 5I22A 1BI1A 1PRMC 2DPPB 2A3LA 1BYMA 3CCLQ 4J9IA 2P0QA 1AWJA 4IURA 3I56Q 2NLUA 4PK4A 3CC2A 3PMTA 3H41A 3OYYA 3I9QA 1H3ZA 5AT1B 3OSSC 1PCXA 1YWPA 4A4FA 3RBBB 1BIBA 2RA2A 3OYGA 5IAYA 2DL8A 1I8FA 1TUCA 5FWBA 3CBPA 2ZZDA 3JV3A 4RCBA 4OB2B 2K3XA 2YLCA 1JRIA 1KSWA 2XIDA 2RK2A 2QEXA 1QQJA 1D3BB 1Q82U 2GTJA 5CR2A 2JT4A 5GAOn 2QA4A 1BCMA 4M78E 3VS4A 2EYXA 2DKGA 2VWFA 1YJWQ 1NEBA 3MPUB 5GMKm 4C8QE 1G83A 1NG2A 2O31A 1VQ6A 5GAN8 1FMVA 2JZ2A 2QQ9A 2XU8A 3A1PA 1WHMA 5GAN6 1AEYA 4MDWA 3L42A 4EDUA 1D3BA 2ZPIB 4OMQA 4FSSA 2EYYA 2O9VA 1RI9A 1VQ5A 4XTZA 3I55T 5I2SA 5GMKi 4OB0B 3SEMA 1NLOC 2K57A 1GFDA 2COWA 3HTRA 4KUIA 3LX7A 4LNPA 4PJJA 5KYWB 2GGRA 3WVEB 2L3RA 5FROA 4PJOD 2MI6A 4F04B 1D1CA 1VOMA 5GAMj 3H0FA 3JB9G 1YJ9Q 4NS5A 3FRNA 3OS2A 2KXCA 3OW2S 2W0ZA 2KYMA 2QXFA 1HXDA 2LTOA 4M7AF 1X43A 2BE9B 1XTDA 4J9FA 1VQNT 5GANd 1M90R 1I81A 1NEGA 3JB9J 3GLXA 1N8RR 5KYWA 2M51A 4KGXB 3MP1A 3I55Q 4JJCA 2JTEA 2RHYA 3M0RA 2DL4A 5FRMA 2ZCFB 1TXQA 3NTIA 3BE3A 3JCMf 3M5AA 2FPDA 1T3SA 1W70A 8ATCB 3G71T 3GP8A 2M0YA 3SFMA 1VQKT 1AOJA 3A8GB 1OX8A 4L5GA 1VQPA 4RUGA 1M27C 3H9NA 3NPFA 1OPKA 5A0LA 3QWXX 4X9DA 3EHQA 5HKCA 1VQNQ 1Q86U 2OI3A 2EGAA 4JLGA 2OTJT 1W1FA 2R5MA 4LDUA 1UHFA 2RPNA 1YCYA 4JS5A 1Y96B 2DVEA 1PD1A 2L8DA 2A28A 1E6GA 1VQMQ 1R77A 3G1JA 1YP5A 2KI7A 1XOVA 3G4ST 1N27A 1X6OA 2HL3A 3G7ZA 3OS0A 3CCJQ 4C5IA 1K9MU 3OYAA 4MDXA 2D0QB 1QKXA 3FJ5A 1VQKQ 2K3BA 3J7AF 4EMKB 2KRNA 1OZ3A 3A8LB 2RJEA 3J81E 4M78F 1TUDA 2OAUA 2KE9A 3TEEA 4HCBA 1KJWA 3JB9I 4C8QF 3SWNC 4FYYB 3EH1A 3CQTA 3H6ZA 1N5ZA 1KHCA 2FB7A 2Y4XA 3HRTA 5GAN4 3GNFB 4ZGDB 2C0IA 4PJOB 2MOXA 4ESRA 3QYHB 5LJ5f 3G4SQ 2AZVA 1KQSP 2AKKA 4X9CA 1V1CA 1WDXA 1PWTA 1ZHIA 4XU2A 1RAAB 2ED1A 2WSFE 2FPFA 4HCZA 1IZ6A 4GY5A 1LPLA 2E5KA 2QA4T 1X27A 4JJBA 2EJGA 4XTXA 1S72T 3JCMP 4KH1B 2FZKB 4J8OA 2WSEE 3DKMA 2F5KA 2RHIA 3L2WA 2DBKA 1VQLA 4LUEA 2KR3A 1M2VA 1RAGB 2DRKA 2PUOB 1VQ6T 6AT1B 2CP3A 2JTFA 1PSFA 2PZ1A 2YRCA 2CH4A 2P4TA 1O9SA 1ZQ1A 2EPDA 3U23A 2BZXA 5IHIA 2YUNA 2H8HA 3TU4K 1KC8R 1VQ5T 3A98A 2RHXA 2RO0A 3OBYA 4TVRA 3MEUA 2DEUA 1OU8A 3IQLA 5LJ3f 4C0FA 4M75G 1S72Q 2LZ6B 4VUBA 2KMTA 2X9HA 1AWWA 4RTZA 3CC7Q 1Y07A 3UDCA 2D8JA 3EFOB 2P4RA 2RF0A 2HSEB 4B9WA 1QKWA 4M7DG 2LNHB 1S1NA 4J9DA 2OTLA 4J9EA 1FYNA 4C92G 4A63B 1GL5A 3LGLA 4AFSC 1VQOA 4IUTA 1Y0MA 2GFUA 3KXTA 4E7LA 3CCST 5KCHA 2QYZA 4MZMA 2LC4A 4LE9A 3HRSA 2KEAA 3CCVA 3EFOA 2QQRA 1WI7A 3PTAA 3JCMe 1Y7XA 1C0MA 2PTKA 1NPPA 2J6OA 2OX7A 2YUOA 1VQPT 2JXBA 2PVOB 2X51A 2F2VA 1YFNA 2HD0A 4ZGEB 2LP5A 1Z9ZA 4ZTJA 1YHQA 5DLQE 4PJOE 4IUPA 1KQ1A 1YITA 4C0DC 1YN8A 1OULA 2KVQG 3CCSQ 3CCET 5GAN5 1BI3A 2M02A 5C0MA 3L2VA 2CT3A 2EQMA 5J26A 1UB4A 3OW2A 4PLIA 5A0DA 1QVFS 2RQUA 3VS3A 2DTIA 2EJFA 3JCMc 2NUPB 3OS5A 1VQ4A 1QW1A 5DY9A 3GIBA 3EGXB 4JZ3A 5DLOA 2CSQA 2RK1A 4QVCA 4BY6B 1NM7A 2PU9B 1K76A 2CS7A 2DTHA 2DBMA 3ER0A 2DAQA 4OVAA 1A0NB 3GOXA 1WHGA 1I5OB 4HT9A 1R0BG 4OMMA 1AD5A 2DA9A 3H8ZA 2R58A 1KD1R 1ARKA 3CCEQ 2NUPA 4F7UG 1WHLA 2BE7D 3F70A 3EGXA 2EBPA 4L6V5 4R0KA 1EIFA 1AZGB 3MHXA 1VQ8Q 2DYBA 1QVFP 3OYIA 2CP5A 2DRMA 5LJ5e 4HVVA 1ZSZA 2FPEA 3P8BB 2RHZA 1YBYA 1OV3A 2EKHA 4FYWB 5GAMd 4AT1B 1WHHA 4M7DF 3HFNA 3V8LA 2JVVA 2DJQA 4ZNXA 1M90C 1UDLA 4DBFA 1M8VA 1N8RC 2AKLA 2LT1A 4E7KA 2KROA 3C95A 4JUVA 5CQXA 1OYXA 3DLMA 4ZTFA 1K0XA 3S6WA 4ATOA 3VUBA 3VJPA 4A4GA 2X35A 3CMAA 1YIJA 3MP6A 4BI3A 3WXMB 3VS6A 1KQSA 1RI0A 2DVJA 1I4K1 2RM4A 4RTTA 4M75C 2COYA 1B3QA 1EZZB 2GBQA 4CC2A 4C5GA 1U3OA 3LLRA 3SWNB 2HQEA 4C0ZA 4GLMA 1QMCA 1I07A 3CMET 2I2LA 4M7DC 2J06A 2CP2A 2YRVA 5LJ3e 3HHTB 3CPWP 1EFNA 3G6EA 4C92C 2XICA 2CP7A 3CCRA 3C12A 4J6WA 2EVRA 2X3WD 3MEVA 1NJIR 1QCFA 2JOYA 3MEAA 3EAEA 3KFVA 3MP8A 2EIFA 1ACMB 3FC3A 1W2BP 2NUTB 4JZ4A 2E70A 5GJVB 2E41A 3BDLA 2RI5A 2RQWA 1VQOT 3I35A 1O75A 1ZUUA 2O4XB 5GAMg 1QVGS 3BW1A 3PMIA 1VQ9A 3MCAB 3CMEQ 2VVKA 3LH0A 2VXFA 2EYWA 3O8VA 5D6YA 4IKFA 1JXOA 1K8AC 1V29B 2E3IA 2L5QA 1PM3A 5GAOr 1XQHA 1BCOA 3M4GA 2Z0WA 3PVLA 2QQBA 4KULA 2GQVA 5CCAA 1T0JA 3RKXA 3CCUA 5GANh 2QASA 4KH0B 2AZSA 4DQ2A 3A8MB 1X2QA 4N0AA 5LJ3h 3OYBA 4IIMA 4M4ZA 3JB9H 4M7AG 1VA7A 4IUVA 2ED0A 3EFSA 1LVKA 2VGMA 1YHQT 3M59A 3SDZA 2B8AA 3EGUA 3EGDA 4RG2A 1WGSA 4C0GA 4LDYA 3OYEA 4PJMA 4J7FA 4QVZA 1XJWB 3NMZC 4LD6A 5FU6C 3EG9A 1YJNQ
chains in the Genus database with same CATH topology
2RJFA 2JUFA 1R8OB 4M77A 2BUDA 2ZPHB 4M77C 1N9SA 3G71T 3VYGA 3GP8A 3CMEA 5CKEA 2Y90A 3SFMA 3EFRA 1M4ZA 2H3JA 1VQKT 3A8GB 2RI3A 4L5GA 4M7DE 1VQPA 2DXUA 4E47A 4KT0E 3RMSA 1TH7A 1VQLT 2E65A 5A0LA 4RKUE 3CC4A 1YJ9A 2E5QA 4C92E 4F7UA 4X9DA 4ELZC 5HKCA 4R56A 3INZA 1Q86U 4JLGA 2OTJT 2VC8A 1X75C 2R5MA 3A5ZB 3PT9A 4LDUA 1B34A 4J6XA 4OGCA 3CCQA 2EQUA 3UT1A 4MMLA 2HAXA 4M75D 3RKYA 2XG8D 4HA8A 1UEBA 1KC8C 4XU1A 1YCYA 4JS5A 1Y96B 2CZ6B 2DVEA 3META 4N4HA 2L8DA 3E9FA 2LCCA 4LDVA 3CD6T 5KE2A 2DK3A 2IG0A 3SB2A 5CKFA 1U1TA 2MWOA 3LYIA 2DXBA 2K4YA 4BE0A 1XOVA 2MWPA 3OYCA 3G4ST 1N27A 1X6OA 3CXCS 3G7ZA 4XQ3A 3OS0A 3HPWA 4E7IA 1N6AA 2M9UA 5GANe 4QW2A 3I55A 1YI2A 1KQ2A 1G3TA 2LCLA 3LW5E 4C5IA 3OYDA 1K9MU 3OYAA 5CKHA 4MDXA 2D0QB 4NOYA 4C0DB 4HCCA 2DTOA 4XAXB 2BIVA 5FU7B 3OSVA 1YJNA 2LNVA 2KDSA 3VV0A 1GXIE 2CZ0B 3QIIA 3JAME 4EMKB 3J7AF 2RH2A 1OZ3A 1KHIA 2E12A 3A8LB 2RJEA 4RCCA 3J81E 4M78F 2ZPEB 2WSCE 1X01A 2OAUA 4M78G 4XU3A 2ZPGB 3CBMA 1M1KU 2DO3A 2RD1A 3L1AA 3TEEA 4HCBA 3OMCA 3JB9I 3SWNA 3OYMA 3TREA 2XKOC 4C8QF 2OTLT 3SWNC 4C8QG 4PJOF 5GANj 1Q82C 3H6ZA 2YHTA 4FIBA 2CYZB 1KHCA 2FB7A 2Y4XA 3HRTA 4IUUA 3QO3A 1NE8A 1VQNA 5GAN4 2MMPA 4FT2A 3JCMg 3GNFB 4M78D 2EQKA 2V8JA 4ZGDB 2EKOA 5IT9E 4PJOB 1QVFA 1YIJT 3CMAT 4II1A 1K9MC 3QYHB 3LGFA 5LJ5f 5HY6A 5LL6S 1FWZA 3OBWA 5FU7C 4C8QD 3V8KA 4NL2A 1VQMA 4X9CA 3CCMT 2XD0A 5IN1A 1M1FA 3CCVT 2PVGB 2RB6A 2D9TA 1ZHIA 3QBYA 2XI9A 4OB1B 3FIFA 5CIUA 1KG1A 4XU2A 4WF2A 2WSFE 3M56A 4HCZA 1XNIA 1IZ6A 2L89A 3JCMW 2PVDB 4GY5A 3CCJA 1VQ8T 2DXTA 1H641 4J5YA 2QA4T 2EJGA 4XTXA 1S72T 3JCMP 4M77E 5GAN3 2E1HA 5GMKh 1G5VA 2VYTA 4J8OA 1UGSB 2WSEE 3DKMA 2F5KA 3VYHB 1VQKA 2E64A 2X4XA 2RHIA 3L2WA 3FLGA 2CZ1B 2VXEA 2O4XA 3ZFJA 3JRZA 1VQLA 4PJOC 3ZEHA 3CCRT 5EG2A 2PUOB 3X24B 1VQ6T 3CCLT 1ZBXA 4M7AB 3OA6A 4YTLA 4E7JA 2KK4A 2JTFA 1PSFA 1YITT 2P0KA 2K5FA 3I56T 5D6XA 3A8HB 2GCXA 4F7UE 1WQ7A 2P4TA 1O9SA 1ZQ1A 2G3RA 4XK8E 2ZGWA 3JCMh 1Q81U 3DLLA 1NPRA 3CEYA 2EQJA 2V8IA 1BI2A 3JCMd 2QQSA 3TU4K 1M90U 2JNGA 3FEOA 2GF7A 1VQ5T 3RMQA 3PIPA 2RHXA 2RO0A 3OBYA 2EWNA 3OYKA 3PIOA 3G4SA 4M77D 4TVRA 3MEUA 1N8RU 3WVDB 3CPWA 5LJ3f 2BKDN 1UGQB 2HNIA 1VQ4T 4M75F 3L2QA 2ZPFB 2Y4YA 4C0FA 3LWIA 4M75G 4Y91A 2QQAA 3HL8A 4M7AA 4PKCC 2WACA 3BFMA 4M7AC 2O01E 3P8DA 3DB4A 4M75B 4VUBA 4V2SA 4DOWA 4BB7A 3J80E 1Q7YU 2KMTA 1U1SA 1IREB 3M53A 4J83A 1NZ9A 3CPFA 3RUXA 1G3YA 3X25B 4Y28E 3L2UA 1W2BA 3OY9A 4GLKA 1Y07A 3QHSA 3UDCA 5GAMf 5KE3A 2CKKA 2K5LA 4JRPA 4Q5WA 3QJ6A 1OI1A 4B9WA 5LJ5g 3CPWS 1YJWT 3M54A 3M9QA 4M7DG 1KD1C 5GAN7 1LNXA 3V7CA 4C92F 3OYHA 1K73U 3OQ5A 4FU6A 2OTLA 4C92G 4KBMB 4ME7A 3LGLA 1LOJA 2LDMA 3OS1A 1VQOA 3PGGA 1VIEA 4IUTA 3L2RA 4BDZA 5J3BA 4C5EA 2XDDA 4C92B 3M58A 2D6FA 3S3NA 5CVIA 3QDRB 4A4KA 2GFUA 5CO7A 3KXTA 4E7LA 3JCMJ 1W2BS 5GMKe 4M7DD 3CCST 4P5NA 3VU3C 4UC4A 1MHNA 2V8KA 3BY7A 5GMKl 3V8JA 3QPHA 3RESA 4C92D 2F5TX 4MZMA 5KCHA 5KCOA 1VQ7A 3OMGA 4LD9K 4PNOA 4OMFB 3JCMV 5HK0A 4O5VA 2LC4A 1Q86C 3CCMA 2E10A 3HRSA 3CCVA 1G3WA 2HQXA 5CQYA 1BI0A 2KAFA 2VUBA 3RERA 5J39A 4E7HA 3AHUA 2QQRA 2LVMA 3V7SA 3PTAA 1JB0E 3C4SA 2FL7A 4ZN1A 3JCMe 4JRQA 1Y7XA 2EFIA 1Y96A 4JLIA 3V7RA 3GPLA 3RKWA 4M78B 1S72A 3CC2T 1NPPA 4NL3A 4ZN3A 1VQPT 2FYKA 2PVOB 5GMKj 4Z02A 3UPUA 2XHCA 4QQDA 3LWHA 2HD0A 4XU0A 3QUIA 4ZGEB 5LJ5h 3CC4T 3CC7A 1YJ9T 2C06A 4C8QB 2LX9A 2X4YA 1JBMA 2R57A 1NJIU 4ZTJA 4KUDK 4OP0A 3HSBA 1YHQA 5DLQE 5GAOl 4PJOE 3QJYA 1UGRB 4IUPA 4B9XA 1KQ1A 1M5Q1 5LJ5d 1YITA 3JCMX 1M9SA 3MO8A 3E1SA 4XTWA 1K8AU 4C0DC 3VKIA 1QVPA 4EMKA 2KVQG 2R5AA 4FM4B 2KSSA 3VUZA 1QP2A 4EMKC 5L8RE 3CBOA 3P8HA 4PL6A 5GAN5 1BI3A 5C0MA 3CCET 1WNLA 3JCMb 1UGPB 4PLLA 3L2VA 2QEXT 3E9GA 4BE1A 2EQMA 5J26A 2RJDA 3FB9A 4BI8B 1M1KC 4EMHA 3HP9A 1VUBA 1WQWA 2KY9A 1WPYA 1UB4A 3HFOA 1LJOA 3QZ5B 4M78A 4A54A 4M78C 3OW2A 2LT4A 4PLIA 5A0DA 1QVFS 4D6WA 1YI2T 3G71A 3OB9A 1AHJB 2QTXA 2DTIA 2EJFA 3JCMc 3OS5A 2IVWA 5HK3A 1VQ4A 1VIFA 1QW1A 2PQWA 3KBGA 5DY9A 3GIBA 2DXCA 4C8QA 5C6SA 4JRKA 5DLOA 2P0PA 4QVDA 3G6ET 4C8QC 4JJNK 3S3MA 3NTKA 1NJIC 1YJNT 4PJOA 5D6WA 4BUGA 2RK1A 1FX7A 2KQWA 4OF1A 5DM7R 3A8OB 2K3YA 1P92A 2M0OA 4QVCA 4M7AE 3ME9A 4BY6B 2PU9B 2X4JA 3E19A 3QSUA 3OYLA 4N4GA 4FSXA 2FHDA 2EYQA 4M77F 2OTJA 1N9RA 3FDRA 2CS7A 2DTHA 3NTHA 5FU6B 1JJ2A 4M77G 5GAN2 4LDXA 3ER0A 2DAQA 4OVAA 5FRNA 3ASKA 3GOXA 4C5HA 5A2QE 4M77B 3S3OA 4MZTA 2GFAA 3NFCA 2EAYA 2E6ZA 4HT9A 4BD3A 4CRIA 3CD6A 4X34A 3H8ZA 2R58A 5CKBA 3X26B 4O6JA 2VV5A 4F7UF 4R55A 4XTYA 5GANf 4F7UG 5LJ3d 2DEQA 3C94A 3DB3A 3F70A 5A0GA 3JCMQ 5GAOq 2PUKB 1PSEA 3OYNA 3GNGA 4QQGA 4RG8A 1VQ9T 2E6NA 4L6V5 5M9OA 1JJ2S 2XDPA 3CCSA 1EIFA 3MHXA 1OZ2A 3M55A 3OYIA 1VQMT 5LJ5e 3RIRA 1SSFA 4XTVA 4BY6C 2K2VA 1QP3A 1YIJA 4OB3B 4EMGA 2MF2A 3MEWA 3FJPA 3P8BB 1BI1A 2RHZA 1YBYA 2DPPB 2A3LA 3R6OA 5GAMd 2YLBA 1BYMA 3CCJT 1Q81C 2LQKA 2P0QA 4CI0C 3BDUA 4M7DF 3KUFA 4IURA 3HFNA 4HT8A 3V8LA 3T9NA 2JVVA 3CCUT 2DJZA 2NLUA 3JSCA 5CKDA 3CC2A 1WJSA 4QQ6A 1M90C 2HBPA 3PMTA 3OYYA 2M1HA 5GAOp 4M7DB 1M8VA 1H3ZA 1DJ7B 1N8RC 4E7KA 2LT1A 3C95A 4JUVA 5CQXA 1OYXA 3DLMA 4ZTFA 5AYFA 3QYGB 3S6WA 4IUQA 4ATOA 3OSSC 5LJ5j 3CXCA 3VUBA 3VJPA 2AHJB 4A4FA 4A4GA 4J6YA 2X35A 1BIBA 2RA2A 3MP6A 3OYGA 4BI3A 3WXMB 5IAYA 3CMAA 1I8FA 1KQSA 1RI0A 2EJ9A 3HRUA 4M75A 4A4EA 2RM4A 1I4K1 3M57A 2RI2A 3CBPA 2ZZDA 4M75C 1Q7YC 4RCBA 4OB2B 2K3XA 2YLCA 1JRIA 4C5GA 2XIDA 2RJCA 3CCEA 3LLRA 1WJRA 2VGNA 2RK2A 2X4WA 3SWNB 3ZBDA 2HQEA 2QEXA 4JS4A 2F69A 4DOVA 4BDYA 4C0ZA 1D3BB 1Q82U 3PFSA 5CR2A 5GAOn 2DD5A 4MZPA 1MGQA 2A7YA 3CMET 1K73C 2QA4A 1VQ8A 2I2LA 4M78E 3OYJA 4M7DA 2DKGA 4RMOA 1KQSS 4M7DC 2DZCA 2YRVA 4BI4A 5LJ3e 3HHTB 1FXXA 4C92A 3L2ZA 4JDSA 4C92C 2XICA 3G6EA 5GMKm 2XDBA 1HK9A 1M1GA 4C8QE 3QXEB 3CCRA 3C12A 4J6WA 1VQ6A 4L59A 3CCLA 3MEVA 5GAN8 1QVGA 5GANg 2JOYA 3MEAA 4FT4A 3EAEA 4N4IA 2CGHA 5KH6A 2M16A 2QI2A 3I56A 2JTMA 3Q1JA 5LJ3g 4HKEA 3CCQT 1U8RA 2JZ2A 2QQ9A 3MP8A 4BACA 2EIFA 3FC3A 2XU8A 1RL2A 5FLXE 4A4HA 5GAMe 2E70A 5GAN6 2E41A 3BDLA 3L42A 4MDWA 4EDUA 2RI5A 4FL6A 1D3BA 2DIGA 2ZPIB 3URGA 4MMKA 4ELYC 1VQOT 3M4YA 4PJOG 5CAIA 1O75A 5LJ3j 3QKJA 2DIQA 1VQ5A 5CK9A 3X28B 4JRIA 4XTZA 2ZPBB 2O4XB 5GAMg 3I55T 1QVGS 3BW1A 1Y71A 5I2SA 5GAOm 4ZGJB 5GMKi 4OB0B 3PMIA 1VQ9A 2K57A 3QZ9B 1VQ7T 3MCAB 1G3SA 4KUIA 3LX7A 3LH0A 2VXFA 3WVEB 2L3RA 5FROA 4PJOD 2LQ8A 2MI6A 2MAMA 3O8VA 5D6YA 4IKFA 4BE2A 3JB9F 5GAMj 1K8AC 1V29B 3GF5A 2XK0A 2L5QA 4J7IA 5GAOr 3JB9G 1BIAA 1XQHA 2DD4A 4NS5A 3FRNA 3M4GA 3OS2A 3TCJA 4A53A 3OYFA 3OW2S 4LDWA 2QQBA 4KULA 2GQVA 5I2MA 5CCAA 1BKBA 1W4SA 3SD4A 3UWNA 2QXFA 5I21A 1YJWA 1HXDA 3RKXA 3CCUA 5GANh 2LTOA 4DQ2A 3A8MB 4M7AF 1WJQA 2K5IA 4N0AA 5LJ3h 3OYBA 3JB9H 4M7AG 2CZ7B 1XTDA 4IUVA 4N0AC 4OGEA 3JB9D 3CC7T 5GANd 1VQNT 3EFSA 2VGMA 1YHQT 3M59A 1I5LA 3SDZA 1I81A 3JB9J 3PNWC 3GLXA 2RHUA 4EPCA 2B8AA 4XTUA 2QDYB 4F7UB 3MP1A 3N5BB 4RG2A 1WGSA 2RHYA 4C0GA 1B34B 3HKSA 4M7AD 2FVUA 2LRQA 4LDYA 5GAMh 3OYEA 4J7FA 4M75E 3QG1A 2ZCFB 5FRMA 3X20B 2JN0A 2DZ9A 3NTIA 4QVZA 4DA4A 1KD1U 4LD6A 5FU6C 1KC8U 3JCMf 3M5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJO E;  4M75 C;  5GAO l;  4M77 A;  2E64 A;  1KQ1 A;  1M5Q 1;  2YLC A;  4OP0 A;  4RCB A;  5LJ5 d;  4M77 C;  1JRI A;  1N9S A;  4XTW A;  3JCM X;  2VXE A;  4PJO C;  3SWN B;  2Y90 A;  3EFR A;  4EMK A;  4M7A B;  4EMK C;  1D3B B;  4M7D E;  5GAO n;  2DXU A;  5GAN 5;  1MGQ A;  1WNL A;  4F7U E;  1TH7 A;  1WQ7 A;  2E65 A;  2I2L A;  4M78 E;  3JCM b;  4M7D A;  2ZGW A;  4C92 E;  2DKG A;  4M7D C;  3FB9 A;  3JCM h;  4F7U A;  2DZC A;  4EMH A;  4X9D A;  1WQW A;  4M78 A;  1WPY A;  5LJ3 e;  3HFO A;  1LJO A;  3INZ A;  4A54 A;  4C92 A;  4M78 C;  3L2Z A;  2VC8 A;  4C92 C;  5GMK m;  1B34 A;  1HK9 A;  4J6X A;  4C8Q E;  3JCM d;  2QTX A;  2EJF A;  2DTI A;  4MML A;  3JCM c;  4J6W A;  4M75 D;  3RKY A;  5DY9 A;  5GAN 8;  4HA8 A;  5GAN g;  4C8Q A;  3GIB A;  4JRK A;  2EWN A;  4XU1 A;  4QVD A;  1YCY A;  4M77 D;  4C8Q C;  1Y96 B;  2CGH A;  2DVE A;  4PJO A;  5LJ3 g;  5LJ3 f;  2HNI A;  3SB2 A;  1U1T A;  4QVC A;  4M7A E;  4M75 F;  5GAM e;  3QSU A;  5GAN 6;  2E41 A;  4M75 G;  4Y91 A;  4M77 F;  1N9R A;  4M7A A;  2DTH A;  4XQ3 A;  3BFM A;  1D3B A;  4M7A C;  4M77 G;  5GAN 2;  4MMK A;  5GAN e;  4M75 B;  4V2S A;  4PJO G;  5CAI A;  1KQ2 A;  1U1S A;  5LJ3 j;  4M77 B;  3RUX A;  4JRI A;  4NOY A;  4XTZ A;  2DTO A;  2EAY A;  5GAM g;  3QHS A;  5GAM f;  4HT9 A;  3BW1 A;  5GAO m;  4EMK B;  5GMK i;  5LJ5 g;  2K57 A;  4M7D G;  4F7U F;  4RCC A;  4XTY A;  5GAN 7;  5GAN f;  1LNX A;  4M78 F;  3V7C A;  4C92 F;  4F7U G;  2VXF A;  5LJ3 d;  1X01 A;  2DEQ A;  4M78 G;  4XU3 A;  3JCM Q;  4C92 G;  5GAO q;  4PJO D;  1LOJ A;  3PGG A;  3JB9 F;  5GAM j;  2RD1 A;  3L1A A;  4C92 B;  3JB9 I;  3SWN A;  5GAO r;  3JB9 G;  1BIA A;  4C8Q F;  3SWN C;  5LJ5 e;  3M4G A;  3RIR A;  4A53 A;  4C8Q G;  4XTV A;  3JCM J;  4PJO F;  5GAN j;  5GMK e;  4M7D D;  4EMG A;  2YHT A;  2FB7 A;  3VU3 C;  3FJP A;  3QO3 A;  5I21 A;  5GAN 4;  3BY7 A;  1HXD A;  3JCM g;  4M78 D;  3RKX A;  3V8J A;  5GMK l;  3RES A;  4C92 D;  5GAN h;  5GAM d;  4DQ2 A;  4PJO B;  2YLB A;  4PNO A;  4M7A F;  3JCM V;  5LJ3 h;  4N0A A;  3JB9 H;  3BDU A;  4M7A G;  4M7D F;  4N0A C;  3HFN A;  5LJ5 f;  3JB9 D;  3V8L A;  2E10 A;  4HT8 A;  5GAN d;  2DJZ A;  3EFS A;  3RER A;  4C8Q D;  3JCM f;  4NL2 A;  3V8K A;  1I5L A;  1I81 A;  3JB9 J;  5GAO p;  3AHU A;  4M7D B;  4X9C A;  3V7S A;  1M8V A;  3JCM e;  4XTU A;  4JLI A;  1Y96 A;  4F7U B;  3V7R A;  3RKW A;  4JUV A;  2RB6 A;  4M78 B;  3FIF A;  5LJ5 j;  4NL3 A;  4XU2 A;  4WF2 A;  1B34 B;  2FYK A;  4M7A D;  3JCM W;  5GAM h;  4J6Y A;  5GMK j;  1BIB A;  2RA2 A;  4M75 E;  2DXT A;  1H64 1;  4J5Y A;  2JN0 A;  1I8F A;  2DZ9 A;  2EJG A;  3QUI A;  4XTX A;  4XU0 A;  2EJ9 A;  5LJ5 h;  4C8Q B;  3JCM P;  4M77 E;  5GAN 3;  1JBM A;  3HSB A;  4M75 A;  2E1H A;  5GMK h;  2RM4 A;  1I4K 1; 
#chains in the Genus database with same CATH topology
 2RJF A;  1D1B A;  4M77 A;  2BUD A;  2ZPH B;  4D8D A;  3EG3 A;  5CKE A;  3EFR A;  2H3J A;  4F16 A;  1UHC A;  3RMS A;  2A37 A;  4RKU E;  3CC4 A;  2E5Q A;  4JPB W;  2QDL A;  4Y92 A;  1SEM A;  4R56 A;  2DYI A;  1X75 C;  3UA7 A;  4OGC A;  3CCQ A;  2EQU A;  3UT1 A;  3TSW A;  4M75 D;  2XG8 D;  4HA8 A;  1KC8 C;  4N4H A;  5KE2 A;  5CKF A;  2FZG B;  2MWO A;  1ZX6 A;  2K4Y A;  3OYC A;  2V26 A;  2D0N A;  1N6A A;  2M9U A;  1YI2 A;  1KQ2 A;  1G3T A;  4OMP A;  1I1J A;  3OYD A;  1RAH B;  4NOY A;  4C0D B;  3OSV A;  1GXI E;  1KHI A;  2LQW A;  5HCK A;  1HSQ A;  2ZPE B;  4DBH A;  2WSC E;  2NYS A;  4M78 G;  2COZ A;  4Z89 A;  2RMO A;  2RD1 A;  2F2W A;  3M0P A;  1WLP B;  4C8Q G;  3EH2 A;  4FIB A;  2CYZ B;  1NE8 A;  3JCM g;  1WFW A;  4RTU A;  5IT9 E;  2HCK A;  1QVF A;  1YIJ T;  3CMA T;  2DM1 A;  3LGF A;  2LMJ A;  5HY6 A;  5FU7 C;  4NL2 A;  3CCM T;  5KYX B;  2PVG B;  2D9T A;  4FYX B;  3FIF A;  1XNI A;  3D7S B;  2L89 A;  4DBR A;  1M2O A;  2DXT A;  4M77 E;  5GAN 3;  8AT1 B;  5GMK h;  1G5V A;  3VYH B;  2X4X A;  1OOT A;  1HYO A;  3ZFJ A;  3ZEH A;  1D0X A;  1WHJ A;  3CCR T;  2EW3 A;  3OA6 A;  1ZA2 B;  3A8H B;  1U06 A;  2GCX A;  1WQ7 A;  2QAZ A;  2ZGW A;  4WTO B;  1B7T A;  5D7U A;  2EQJ A;  1BK2 A;  1M90 U;  2KXD A;  1IXD A;  3RMQ A;  3PIP A;  3CCM Q;  1N8R U;  3PIO A;  1SG5 A;  3CPW A;  4RTY A;  3OW2 P;  4HVW A;  2B86 A;  3HL8 A;  3BFM A;  1TU0 B;  4M7A C;  1G8X A;  1IHW A;  4M75 B;  4V2S A;  4DOW A;  2LQN A;  3J80 E;  1ZSZ C;  2RQT A;  2V1R A;  1W2B A;  1G3Y A;  3L2U A;  1PC0 A;  1WYX A;  4GLK A;  2K5L A;  4JRP A;  4Q5W A;  5LJ5 g;  1OI1 A;  3M9Q A;  1KD1 C;  3V7C A;  3OQ5 A;  4FU6 A;  1F1B B;  4RTX A;  3PGG A;  1VYT A;  2BZY A;  2C0T A;  2AT1 B;  5J3B A;  1RAI B;  4C92 B;  3S3N A;  4P5N A;  2HBW A;  3G71 Q;  1VQ7 A;  1K9M R;  4LD9 K;  4PNO A;  1K4U S;  1IGU A;  4OMF B;  3UA6 A;  4O5V A;  1X6G A;  1WIE A;  2A0F B;  1G3W A;  2HQX A;  5CQY A;  3RER A;  5FW9 A;  1YCS B;  2LVM A;  1JB0 E;  1Y96 A;  3GPL A;  1IO6 A;  2OTJ Q;  2CSI A;  3CC2 T;  2KNB B;  4AMC A;  1GRI A;  2V1Q A;  5KYU B;  1T3L A;  3CC4 T;  3HSB A;  4KUD K;  2R57 A;  4OP0 A;  1WZO A;  1ZLM A;  3THK A;  2DFU A;  1IB8 A;  4B9X A;  1YWO A;  1M9S A;  3MO8 A;  4XTW A;  1K8A U;  4EMK A;  2R5A A;  4FM4 B;  1QP2 A;  5L8R E;  1NBE B;  2SEM A;  1WNL A;  3LH5 A;  2QEX T;  4BI8 B;  2RJD A;  1VUB A;  2KY9 A;  1WPY A;  3HFO A;  2FRY A;  4M78 C;  2LT4 A;  5KYU A;  2L3P A;  4D6W A;  1YI2 T;  2L0A A;  2PQW A;  5C6S A;  2P0P A;  1NJI C;  4C8Q C;  4JJN K;  3CC2 Q;  1SHG A;  4PJO A;  4BUG A;  1E7O A;  1WXU A;  4OF1 A;  5DM7 R;  3A8O B;  2K3Y A;  1P92 A;  2M0O A;  3ME9 A;  3E19 A;  2LCS A;  4FSX A;  4M77 F;  4E7S A;  5FU6 B;  2KT8 A;  4MZT A;  2OJ2 A;  2LJ1 A;  2EAY A;  2E6Z A;  3QDF A;  4BD3 A;  3CD6 A;  2VV5 A;  5GAN f;  1J3T A;  2QEX Q;  2FEI A;  3OYN A;  1K9A A;  2QGG A;  1JJ2 S;  2QA4 Q;  2MIO A;  2KT1 A;  4XTV A;  1MV0 B;  2DLP A;  2MF2 A;  3QWY A;  3FJP A;  1CKA A;  1VQ6 Q;  2LQK A;  4CI0 C;  3KUF A;  3UAT A;  2DJZ A;  3JSC A;  1WJS A;  2DL7 A;  4QQ6 A;  2HBP A;  2M1H A;  1X6B A;  1MMN A;  2HKN A;  2E4H A;  4IUQ A;  5LJ5 j;  2AHJ B;  2RNA A;  4J6Y A;  1SRL A;  1VQ5 Q;  2CH4 W;  2EJ9 A;  2J7I A;  2RI2 A;  4HVU A;  4FW1 A;  4EIK A;  2RJC A;  1VYU A;  2A36 A;  2VGN A;  1OEB A;  3ZBD A;  2X4W A;  4JS4 A;  2F69 A;  4BDY A;  3PFS A;  4MZP A;  4GBQ A;  1MGQ A;  2A7Y A;  4AFQ C;  4FW2 A;  1GCQ A;  1M1K R;  3OYJ A;  4RMO A;  2YUP A;  2DZC A;  2VB6 A;  4IIO A;  4BI4 A;  1FXX A;  1ABQ A;  2XDB A;  9ATC B;  3C0C A;  4L59 A;  3CCL A;  1FMK A;  3I56 A;  4N4I A;  1U8R A;  4HKE A;  4BAC A;  3RR6 A;  2GNC A;  1RL2 A;  4A4H A;  2HZY A;  4FL6 A;  3RDV A;  4MMK A;  3M4Y A;  2YXY A;  4PJO G;  5LJ3 j;  5KYY B;  4CC4 B;  4RTW A;  4ZGJ B;  1VQ7 T;  2YWW A;  1VQP Q;  1I0C A;  4BE2 A;  3GF5 A;  4J7I A;  4QT7 A;  2XK0 A;  3VS1 A;  2DD4 A;  1Q95 G;  3TCJ A;  4A53 A;  3OYF A;  1NYF A;  1BKB A;  1W4S A;  1YJW A;  3GBQ A;  2O2O A;  1Q81 R;  1IHV A;  5KYY A;  1PRL C;  1MV3 A;  2K5I A;  4QKU A;  4PFP A;  3JB9 D;  4OGE A;  2MK5 A;  1M30 A;  1I5L A;  3PNW C;  2RHU A;  4XTU A;  2QDY B;  4F14 A;  1D1A A;  1MUZ A;  1B34 B;  3HKS A;  2LRQ A;  3X20 B;  4RTV A;  1KD1 U;  1Q7Y R;  3L2R A;  2K9G A;  3R6N A;  2ZAE A;  1D0Z A;  3VYG A;  5I11 A;  4Z88 A;  2RQR A;  1KIK A;  2RI3 A;  2IPO B;  4J9B A;  1K73 R;  2DXU A;  1VQL T;  4KT0 E;  1FMW A;  2KBT A;  2E65 A;  1YJ9 A;  1QCN A;  3INZ A;  2FZC B;  1B34 A;  4J6X A;  3RKY A;  1UEC A;  1UEB A;  4XU1 A;  1MMG A;  2CZ6 B;  2E3H A;  3MET A;  2DER A;  2LCC A;  3CD6 T;  2DK3 A;  2IG0 A;  1ABO A;  1QCO A;  1U1T A;  3LYI A;  2DXB A;  4BE0 A;  1KFZ A;  3CXC S;  4E7I A;  4J9G A;  3I55 A;  5GAN e;  4QW2 A;  1ZA1 B;  2LCL A;  4KGZ B;  5CKH A;  2DTO A;  2IIM A;  2BIV A;  4AG1 C;  3E2U A;  3VV0 A;  3EHR A;  3QII A;  2C0O A;  3REA B;  2E12 A;  2J6K A;  3H0H A;  1VQL Q;  1X01 A;  2KGT A;  2CUD A;  1LCK A;  3L1A A;  1JXM A;  3OYM A;  3SWN A;  3NHN A;  2XKO C;  2OTL T;  1NLP C;  4PJO F;  1IRX A;  4AFZ C;  2JM8 A;  3M0U A;  3QO3 A;  1VQN A;  1RAE B;  2EQK A;  2V8J A;  3AT1 B;  4KGV B;  1JQQ A;  4II1 A;  1K9M C;  3CXC P;  1FWZ A;  2QTV A;  3OBW A;  2NUZ A;  3V8K A;  2JMC A;  1VQM A;  4JJD A;  3CCV T;  4ANJ A;  3QBY A;  4OB1 B;  1KG1 A;  4WF2 A;  2NUT A;  3JCM W;  2PVD B;  3CCJ A;  1W6X A;  1H64 1;  1SHF A;  1ZUY A;  2E1H A;  3PVQ A;  1VQK A;  1MMA A;  2P84 A;  2CZ1 B;  2O4X A;  2OTL Q;  4PJO C;  1WXT A;  5EG2 A;  3NGP A;  3CCL T;  4YTL A;  3VRY A;  1VQO Q;  2KK4 A;  1TSF A;  1YIT T;  2P0K A;  2K5F A;  2FRW A;  3TSZ A;  3I56 T;  1UTI A;  1UE9 A;  1WXB A;  2CP6 A;  2ESW A;  1QVG P;  2DIL A;  3RNJ A;  1RAF B;  2D1X A;  1NPR A;  1X2K A;  3CEY A;  2V8I A;  3JCM d;  2QQS A;  1D0Y A;  2JNG A;  2DNU A;  3OYK A;  3CCV Q;  3G4S A;  1UG1 A;  2BKD N;  1UGQ B;  1OPL A;  2X3X D;  1VQ4 T;  2ZPF B;  2Y4Y A;  3LWI A;  2HSP A;  4Y91 A;  1SRM A;  2QQA A;  3MJX A;  4PKC C;  2WAC A;  3P8D A;  4OMO A;  3DB4 A;  5IH2 A;  4BB7 A;  2K6D A;  1U1S A;  3RUX A;  4J83 A;  4PFZ A;  5KE3 A;  3QHS A;  5GAM f;  1YHQ Q;  2CT4 A;  1WHK A;  4E7Z A;  3H0I A;  1YIT Q;  1PKT A;  2HQH A;  1YJW T;  3M54 A;  1LNX A;  4KBM B;  4KRT A;  4BDZ A;  1RAB B;  1SPK A;  5CVI A;  3QDR B;  1Q82 R;  2DF6 A;  4A4K A;  1UJY A;  2AK5 A;  3JCM J;  5GMK e;  4M7D D;  3VU3 C;  1MHN A;  1RLP C;  3BY7 A;  3V8J A;  3QPH A;  4C92 D;  2F5T X;  4OML A;  3OMG A;  1VQ4 Q;  1E6H A;  1PD0 A;  2E10 A;  1VYV A;  1BI0 A;  5J39 A;  4E7H A;  4OMN A;  3AHU A;  3C4S A;  2FL7 A;  4JRQ A;  4JLI A;  3V7R A;  3RKW A;  1S72 A;  1GCQ C;  4NL3 A;  1K1Z A;  2FYK A;  4AFU C;  4Z02 A;  2C06 A;  4J9C A;  1YJ9 T;  3CC7 A;  2LX9 A;  2JS2 A;  1M3B A;  5GAO l;  1UGR B;  1M5Q 1;  5LJ5 d;  3JCM X;  2MYS A;  3E1S A;  1MNE A;  1QVP A;  1T0H A;  3CBO A;  5IXB A;  4PL6 A;  1CKB A;  1PG5 B;  4BE1 A;  1M1K C;  3FB9 A;  3HP9 A;  4AG2 C;  1LJO A;  1RAD B;  2QTX A;  3REB B;  2KRM A;  2IVW A;  1VIF A;  3KBG A;  4LN2 A;  2J6F A;  4JRK A;  3G6E T;  4QVD A;  3NTK A;  1YNZ A;  1FX7 A;  2KQW A;  4LUD A;  3SHW A;  3TQ7 P;  2X4J A;  3QSU A;  3OYL A;  4N4G A;  1IGQ A;  2HDA A;  3NTH A;  1G2B A;  4M77 G;  4LDX A;  5FRN A;  5KYX A;  3CMA Q;  1YIJ Q;  5A2Q E;  1M3A A;  1PNJ A;  2K7A A;  2GFA A;  3NFC A;  4CRI A;  4X34 A;  2LX7 A;  3X26 B;  4O6J A;  2YT6 A;  4R55 A;  1HD3 A;  2K79 A;  1JO8 A;  5LJ3 d;  2DEQ A;  3C94 A;  5A0G A;  3JCM Q;  1K0S A;  2PUK B;  1PSE A;  3VS7 A;  2EYZ A;  1VQ9 T;  2CUB A;  2E6N A;  1UUE A;  2XDP A;  3CCS A;  2YDL A;  1VQM T;  5L23 A;  1GCP A;  2L3Q A;  4BY6 C;  2K2V A;  4OB3 B;  4EMG A;  3MEW A;  4WCI A;  3G6E Q;  3UF4 A;  3R6O A;  3EG1 A;  3CCR Q;  2YLB A;  1Q86 R;  3CCJ T;  1Q81 C;  3BDU A;  3ULR B;  2DL3 A;  2DMO A;  4HT8 A;  5KYN A;  3T9N A;  3CCU T;  2CDT A;  5CKD A;  1H92 A;  2F2X A;  5GAO p;  4M7D B;  3VRZ A;  1DJ7 B;  2DX1 A;  3PE0 A;  5AYF A;  3QYG B;  1SKU B;  3CXC A;  2L2P A;  2RN8 A;  4X1V A;  3HRU A;  4M75 A;  4A4E A;  3M57 A;  1NYG A;  1Q7Y C;  1VQ9 Q;  3CCE A;  2SRC A;  1WJR A;  4FCY A;  4DOV A;  1AT1 B;  1TUG B;  2DD5 A;  1K73 C;  1VQ8 A;  4M7D A;  2XMF A;  1KQS S;  4C92 A;  3L2Z A;  4JDS A;  4DEY A;  3CCU Q;  1HK9 A;  1M1G A;  3QXE B;  5IHN A;  1QVG A;  5GAN g;  4FT4 A;  5IHK A;  1WA7 A;  2CGH A;  2M16 A;  2QI2 A;  5ECA A;  2JTM A;  3Q1J A;  5KH6 A;  5LJ3 g;  3CCQ T;  2J05 A;  1K8A R;  2CP0 A;  5FLX E;  5GAM e;  2DL5 A;  1AVZ C;  2DIG A;  3URG A;  4CC3 A;  4ELY C;  5CAI A;  3QKJ A;  2DIQ A;  5CK9 A;  3X28 B;  4JRI A;  2ZPB B;  2CRE A;  1M2V B;  1Y71 A;  2ROL A;  5GAO m;  3QZ9 B;  1G3S A;  2LQ8 A;  2MAM A;  4HXJ A;  3JB9 F;  1OQK A;  2OAW A;  2W10 A;  5IXF A;  3CC4 Q;  1BIA A;  1M3C A;  1GFC A;  4LDW A;  5I2M A;  3VS2 A;  3SD4 A;  3UWN A;  5I21 A;  3CCQ Q;  1WJQ A;  2A08 A;  2AIR B;  2CZ7 B;  4N0A C;  5FWC A;  3CC7 T;  3VS0 A;  2MCN A;  4EPC A;  2ABL A;  4F7U B;  2KRS A;  3MKD A;  3N5B B;  1YI2 Q;  4ORZ A;  1QWE A;  4M7A D;  2FVU A;  5GAM h;  4FYV B;  3EG0 A;  4M75 E;  3QG1 A;  1D09 B;  2JN0 A;  2DZ9 A;  4DA4 A;  1KC8 U;  1MND A;  3M0Q A;  2JUF A;  1R8O B;  2RQV A;  2HMA A;  4M77 C;  1N9S A;  4PFO A;  3CME A;  2Y90 A;  1M4Z A;  4M7D E;  4HCK A;  4E47 A;  1TH7 A;  1RAC B;  4C92 E;  2LJ3 A;  1H8K A;  4PJL A;  4F7U A;  1Z9Q A;  4ELZ C;  4B6M A;  4DBQ A;  2DET A;  2VC8 A;  3A5Z B;  2F1L A;  3PT9 A;  1OU9 A;  1TOV A;  2GTO A;  4MML A;  2HAX A;  1PKS A;  5EC7 A;  1JJ2 P;  1GBQ A;  2ATC B;  1RUW A;  2EGC A;  3O5Z A;  3E9F A;  4LDV A;  2JW4 A;  3SB2 A;  2G6F X;  2MWP A;  2VKN A;  3EG2 A;  4XQ3 A;  3HPW A;  4E2F B;  1ZSG A;  3LW5 E;  1HJD A;  4HCC A;  4E6R A;  4XAX B;  5FU7 B;  1YJN A;  1TTH B;  2LNV A;  2KDS A;  2CZ0 B;  3JAM E;  4LXC A;  2RH2 A;  4RCC A;  4XU3 A;  2ZPG B;  3CBM A;  1M1K U;  7AT1 B;  2ECZ A;  2DO3 A;  3OMC A;  4DEX A;  1BB9 A;  3TRE A;  1M8M A;  2DE0 X;  5GAN j;  1Q82 C;  1OX9 A;  2YHT A;  4IUU A;  1TG0 A;  3TVT A;  2MMP A;  4FT2 A;  4M78 D;  2EKO A;  2D8H A;  2YSQ A;  5LL6 S;  3M0S A;  4C8Q D;  1U5S A;  1V76 A;  2XD0 A;  5IN1 A;  1M1F A;  3I5R A;  2QGF B;  2RB6 A;  4Z8A A;  5CIU A;  2XI9 A;  3M56 A;  1AZE A;  2O88 A;  1VQ8 T;  4J5Y A;  2K2M A;  2VYT A;  1SSH A;  1UGS B;  1KK7 A;  2E64 A;  2GQI A;  3FLG A;  2VXE A;  3JRZ A;  1B07 A;  3X24 B;  1ZBX A;  4M7A B;  4E7J A;  1C1A A;  1ZSZ B;  5D6X A;  4F7U E;  2O9S A;  2G3R A;  4XK8 E;  3JCM h;  4J9H A;  2QG9 B;  1Q81 U;  3DLL A;  2YRD A;  1TWB A;  1VQ7 Q;  1BI2 A;  3I5S A;  3FEO A;  2GF7 A;  4D8K A;  2EWN A;  4M77 D;  3WVD B;  2HNI A;  4K11 A;  4M75 F;  3L2Q A;  1ZUK A;  1CSK A;  2BTT A;  2JMA A;  4M7A A;  1JU5 C;  1MMD A;  1RLQ C;  2ENM A;  2O01 E;  3M0T A;  2JM9 A;  2MPX C;  1Q7Y U;  1IRE B;  3M53 A;  1NZ9 A;  2YUQ A;  3CPF A;  3X25 B;  4Y28 E;  1JEG A;  3OY9 A;  1AWX A;  1SF9 A;  2CKK A;  4F17 A;  1EX4 A;  3QJ6 A;  3CPW S;  5GAN 7;  4C92 F;  3OYH A;  1K73 U;  4ME7 A;  1LOJ A;  2LDM A;  3OS1 A;  1VIE A;  2VAS A;  3VS5 A;  2XDD A;  4C5E A;  3M58 A;  2D6F A;  2NWM A;  1WX6 A;  2EGE A;  1UJ0 A;  5CO7 A;  1W2B S;  1X69 A;  1QWF A;  4UC4 A;  2V8K A;  5GMK l;  2I0N A;  3RES A;  1Y57 A;  5KCO A;  1UGV A;  1TS9 A;  3JCM V;  5HK0 A;  2HKQ B;  1Q86 C;  3CCM A;  2EQI A;  1C6V X;  1QLY A;  2KAF A;  2VUB A;  4PJN A;  1H3H A;  2JS0 A;  3V7S A;  4ZN1 A;  1BBZ A;  2EFI A;  3ZL7 C;  4M78 B;  4ZN3 A;  5GMK j;  3UPU A;  2XHC A;  1GBR A;  4QQD A;  3LWH A;  4XU0 A;  3QUI A;  5LJ5 h;  2PNI A;  4C8Q B;  2X4Y A;  1NJI U;  1JBM A;  3CD6 Q;  3QJY A;  1PHT A;  5GJW B;  2KYB A;  3VKI A;  2KSS A;  3VUZ A;  4EMK C;  2QK0 A;  3P8H A;  1ZBJ A;  3JCM b;  1UGP B;  4PLL A;  3E9G A;  4EMH A;  1WQW A;  4M78 A;  3QZ5 B;  4A54 A;  1R0C B;  3G71 A;  3OB9 A;  1AHJ B;  5HK3 A;  2FG0 A;  1BU1 A;  2DXC A;  4C8Q A;  3S3M A;  2H3E B;  1YJN T;  5D6W A;  3EGD B;  2HEQ A;  2FO0 A;  4M7A E;  1UFF A;  2FHD A;  2EYQ A;  2OTJ A;  1N9R A;  3FDR A;  1JJ2 A;  5GAN 2;  3EG9 B;  3ASK A;  4CC7 A;  4C5H A;  4M77 B;  3S3O A;  2LJ0 A;  2JJ9 A;  5CKB A;  4F7U F;  4XTY A;  3DB3 A;  2HL5 C;  2L3S A;  5GAO q;  3GNG A;  4QQG A;  4RG8 A;  5M9O A;  1OZ2 A;  3M55 A;  2ROT A;  1AWO A;  3RIR A;  1SSF A;  1QP3 A;  2BZ8 A;  5I22 A;  1BI1 A;  1PRM C;  2DPP B;  2A3L A;  1BYM A;  3CCL Q;  4J9I A;  2P0Q A;  1AWJ A;  4IUR A;  3I56 Q;  2NLU A;  4PK4 A;  3CC2 A;  3PMT A;  3H41 A;  3OYY A;  3I9Q A;  1H3Z A;  5AT1 B;  3OSS C;  1PCX A;  1YWP A;  4A4F A;  3RBB B;  1BIB A;  2RA2 A;  3OYG A;  5IAY A;  2DL8 A;  1I8F A;  1TUC A;  5FWB A;  3CBP A;  2ZZD A;  3JV3 A;  4RCB A;  4OB2 B;  2K3X A;  2YLC A;  1JRI A;  1KSW A;  2XID A;  2RK2 A;  2QEX A;  1QQJ A;  1D3B B;  1Q82 U;  2GTJ A;  5CR2 A;  2JT4 A;  5GAO n;  2QA4 A;  1BCM A;  4M78 E;  3VS4 A;  2EYX A;  2DKG A;  2VWF A;  1YJW Q;  1NEB A;  3MPU B;  5GMK m;  4C8Q E;  1G83 A;  1NG2 A;  2O31 A;  1VQ6 A;  5GAN 8;  1FMV A;  2JZ2 A;  2QQ9 A;  2XU8 A;  3A1P A;  1WHM A;  5GAN 6;  1AEY A;  4MDW A;  3L42 A;  4EDU A;  1D3B A;  2ZPI B;  4OMQ A;  4FSS A;  2EYY A;  2O9V A;  1RI9 A;  1VQ5 A;  4XTZ A;  3I55 T;  5I2S A;  5GMK i;  4OB0 B;  3SEM A;  1NLO C;  2K57 A;  1GFD A;  2COW A;  3HTR A;  4KUI A;  3LX7 A;  4LNP A;  4PJJ A;  5KYW B;  2GGR A;  3WVE B;  2L3R A;  5FRO A;  4PJO D;  2MI6 A;  4F04 B;  1D1C A;  1VOM A;  5GAM j;  3H0F A;  3JB9 G;  1YJ9 Q;  4NS5 A;  3FRN A;  3OS2 A;  2KXC A;  3OW2 S;  2W0Z A;  2KYM A;  2QXF A;  1HXD A;  2LTO A;  4M7A F;  1X43 A;  2BE9 B;  1XTD A;  4J9F A;  1VQN T;  5GAN d;  1M90 R;  1I81 A;  1NEG A;  3JB9 J;  3GLX A;  1N8R R;  5KYW A;  2M51 A;  4KGX B;  3MP1 A;  3I55 Q;  4JJC A;  2JTE A;  2RHY A;  3M0R A;  2DL4 A;  5FRM A;  2ZCF B;  1TXQ A;  3NTI A;  3BE3 A;  3JCM f;  3M5A A;  2FPD A;  1T3S A;  1W70 A;  8ATC B;  3G71 T;  3GP8 A;  2M0Y A;  3SFM A;  1VQK T;  1AOJ A;  3A8G B;  1OX8 A;  4L5G A;  1VQP A;  4RUG A;  1M27 C;  3H9N A;  3NPF A;  1OPK A;  5A0L A;  3QWX X;  4X9D A;  3EHQ A;  5HKC A;  1VQN Q;  1Q86 U;  2OI3 A;  2EGA A;  4JLG A;  2OTJ T;  1W1F A;  2R5M A;  4LDU A;  1UHF A;  2RPN A;  1YCY A;  4JS5 A;  1Y96 B;  2DVE A;  1PD1 A;  2L8D A;  2A28 A;  1E6G A;  1VQM Q;  1R77 A;  3G1J A;  1YP5 A;  2KI7 A;  1XOV A;  3G4S T;  1N27 A;  1X6O A;  2HL3 A;  3G7Z A;  3OS0 A;  3CCJ Q;  4C5I A;  1K9M U;  3OYA A;  4MDX A;  2D0Q B;  1QKX A;  3FJ5 A;  1VQK Q;  2K3B A;  3J7A F;  4EMK B;  2KRN A;  1OZ3 A;  3A8L B;  2RJE A;  3J81 E;  4M78 F;  1TUD A;  2OAU A;  2KE9 A;  3TEE A;  4HCB A;  1KJW A;  3JB9 I;  4C8Q F;  3SWN C;  4FYY B;  3EH1 A;  3CQT A;  3H6Z A;  1N5Z A;  1KHC A;  2FB7 A;  2Y4X A;  3HRT A;  5GAN 4;  3GNF B;  4ZGD B;  2C0I A;  4PJO B;  2MOX A;  4ESR A;  3QYH B;  5LJ5 f;  3G4S Q;  2AZV A;  1KQS P;  2AKK A;  4X9C A;  1V1C A;  1WDX A;  1PWT A;  1ZHI A;  4XU2 A;  1RAA B;  2ED1 A;  2WSF E;  2FPF A;  4HCZ A;  1IZ6 A;  4GY5 A;  1LPL A;  2E5K A;  2QA4 T;  1X27 A;  4JJB A;  2EJG A;  4XTX A;  1S72 T;  3JCM P;  4KH1 B;  2FZK B;  4J8O A;  2WSE E;  3DKM A;  2F5K A;  2RHI A;  3L2W A;  2DBK A;  1VQL A;  4LUE A;  2KR3 A;  1M2V A;  1RAG B;  2DRK A;  2PUO B;  1VQ6 T;  6AT1 B;  2CP3 A;  2JTF A;  1PSF A;  2PZ1 A;  2YRC A;  2CH4 A;  2P4T A;  1O9S A;  1ZQ1 A;  2EPD A;  3U23 A;  2BZX A;  5IHI A;  2YUN A;  2H8H A;  3TU4 K;  1KC8 R;  1VQ5 T;  3A98 A;  2RHX A;  2RO0 A;  3OBY A;  4TVR A;  3MEU A;  2DEU A;  1OU8 A;  3IQL A;  5LJ3 f;  4C0F A;  4M75 G;  1S72 Q;  2LZ6 B;  4VUB A;  2KMT A;  2X9H A;  1AWW A;  4RTZ A;  3CC7 Q;  1Y07 A;  3UDC A;  2D8J A;  3EFO B;  2P4R A;  2RF0 A;  2HSE B;  4B9W A;  1QKW A;  4M7D G;  2LNH B;  1S1N A;  4J9D A;  2OTL A;  4J9E A;  1FYN A;  4C92 G;  4A63 B;  1GL5 A;  3LGL A;  4AFS C;  1VQO A;  4IUT A;  1Y0M A;  2GFU A;  3KXT A;  4E7L A;  3CCS T;  5KCH A;  2QYZ A;  4MZM A;  2LC4 A;  4LE9 A;  3HRS A;  2KEA A;  3CCV A;  3EFO A;  2QQR A;  1WI7 A;  3PTA A;  3JCM e;  1Y7X A;  1C0M A;  2PTK A;  1NPP A;  2J6O A;  2OX7 A;  2YUO A;  1VQP T;  2JXB A;  2PVO B;  2X51 A;  2F2V A;  1YFN A;  2HD0 A;  4ZGE B;  2LP5 A;  1Z9Z A;  4ZTJ A;  1YHQ A;  5DLQ E;  4PJO E;  4IUP A;  1KQ1 A;  1YIT A;  4C0D C;  1YN8 A;  1OUL A;  2KVQ G;  3CCS Q;  3CCE T;  5GAN 5;  1BI3 A;  2M02 A;  5C0M A;  3L2V A;  2CT3 A;  2EQM A;  5J26 A;  1UB4 A;  3OW2 A;  4PLI A;  5A0D A;  1QVF S;  2RQU A;  3VS3 A;  2DTI A;  2EJF A;  3JCM c;  2NUP B;  3OS5 A;  1VQ4 A;  1QW1 A;  5DY9 A;  3GIB A;  3EGX B;  4JZ3 A;  5DLO A;  2CSQ A;  2RK1 A;  4QVC A;  4BY6 B;  1NM7 A;  2PU9 B;  1K76 A;  2CS7 A;  2DTH A;  2DBM A;  3ER0 A;  2DAQ A;  4OVA A;  1A0N B;  3GOX A;  1WHG A;  1I5O B;  4HT9 A;  1R0B G;  4OMM A;  1AD5 A;  2DA9 A;  3H8Z A;  2R58 A;  1KD1 R;  1ARK A;  3CCE Q;  2NUP A;  4F7U G;  1WHL A;  2BE7 D;  3F70 A;  3EGX A;  2EBP A;  4L6V 5;  4R0K A;  1EIF A;  1AZG B;  3MHX A;  1VQ8 Q;  2DYB A;  1QVF P;  3OYI A;  2CP5 A;  2DRM A;  5LJ5 e;  4HVV A;  1ZSZ A;  2FPE A;  3P8B B;  2RHZ A;  1YBY A;  1OV3 A;  2EKH A;  4FYW B;  5GAM d;  4AT1 B;  1WHH A;  4M7D F;  3HFN A;  3V8L A;  2JVV A;  2DJQ A;  4ZNX A;  1M90 C;  1UDL A;  4DBF A;  1M8V A;  1N8R C;  2AKL A;  2LT1 A;  4E7K A;  2KRO A;  3C95 A;  4JUV A;  5CQX A;  1OYX A;  3DLM A;  4ZTF A;  1K0X A;  3S6W A;  4ATO A;  3VUB A;  3VJP A;  4A4G A;  2X35 A;  3CMA A;  1YIJ A;  3MP6 A;  4BI3 A;  3WXM B;  3VS6 A;  1KQS A;  1RI0 A;  2DVJ A;  1I4K 1;  2RM4 A;  4RTT A;  4M75 C;  2COY A;  1B3Q A;  1EZZ B;  2GBQ A;  4CC2 A;  4C5G A;  1U3O A;  3LLR A;  3SWN B;  2HQE A;  4C0Z A;  4GLM A;  1QMC A;  1I07 A;  3CME T;  2I2L A;  4M7D C;  2J06 A;  2CP2 A;  2YRV A;  5LJ3 e;  3HHT B;  3CPW P;  1EFN A;  3G6E A;  4C92 C;  2XIC A;  2CP7 A;  3CCR A;  3C12 A;  4J6W A;  2EVR A;  2X3W D;  3MEV A;  1NJI R;  1QCF A;  2JOY A;  3MEA A;  3EAE A;  3KFV A;  3MP8 A;  2EIF A;  1ACM B;  3FC3 A;  1W2B P;  2NUT B;  4JZ4 A;  2E70 A;  5GJV B;  2E41 A;  3BDL A;  2RI5 A;  2RQW A;  1VQO T;  3I35 A;  1O75 A;  1ZUU A;  2O4X B;  5GAM g;  1QVG S;  3BW1 A;  3PMI A;  1VQ9 A;  3MCA B;  3CME Q;  2VVK A;  3LH0 A;  2VXF A;  2EYW A;  3O8V A;  5D6Y A;  4IKF A;  1JXO A;  1K8A C;  1V29 B;  2E3I A;  2L5Q A;  1PM3 A;  5GAO r;  1XQH A;  1BCO A;  3M4G A;  2Z0W A;  3PVL A;  2QQB A;  4KUL A;  2GQV A;  5CCA A;  1T0J A;  3RKX A;  3CCU A;  5GAN h;  2QAS A;  4KH0 B;  2AZS A;  4DQ2 A;  3A8M B;  1X2Q A;  4N0A A;  5LJ3 h;  3OYB A;  4IIM A;  4M4Z A;  3JB9 H;  4M7A G;  1VA7 A;  4IUV A;  2ED0 A;  3EFS A;  1LVK A;  2VGM A;  1YHQ T;  3M59 A;  3SDZ A;  2B8A A;  3EGU A;  3EGD A;  4RG2 A;  1WGS A;  4C0G A;  4LDY A;  3OYE A;  4PJM A;  4J7F A;  4QVZ A;  1XJW B;  3NMZ C;  4LD6 A;  5FU6 C;  3EG9 A;  1YJN Q; 
#chains in the Genus database with same CATH homology
 2RJF A;  2JUF A;  1R8O B;  4M77 A;  2BUD A;  2ZPH B;  4M77 C;  1N9S A;  3G71 T;  3VYG A;  3GP8 A;  3CME A;  5CKE A;  2Y90 A;  3SFM A;  3EFR A;  1M4Z A;  2H3J A;  1VQK T;  3A8G B;  2RI3 A;  4L5G A;  4M7D E;  1VQP A;  2DXU A;  4E47 A;  4KT0 E;  3RMS A;  1TH7 A;  1VQL T;  2E65 A;  5A0L A;  4RKU E;  3CC4 A;  1YJ9 A;  2E5Q A;  4C92 E;  4F7U A;  4X9D A;  4ELZ C;  5HKC A;  4R56 A;  3INZ A;  1Q86 U;  4JLG A;  2OTJ T;  2VC8 A;  1X75 C;  2R5M A;  3A5Z B;  3PT9 A;  4LDU A;  1B34 A;  4J6X A;  4OGC A;  3CCQ A;  2EQU A;  3UT1 A;  4MML A;  2HAX A;  4M75 D;  3RKY A;  2XG8 D;  4HA8 A;  1UEB A;  1KC8 C;  4XU1 A;  1YCY A;  4JS5 A;  1Y96 B;  2CZ6 B;  2DVE A;  3MET A;  4N4H A;  2L8D A;  3E9F A;  2LCC A;  4LDV A;  3CD6 T;  5KE2 A;  2DK3 A;  2IG0 A;  3SB2 A;  5CKF A;  1U1T A;  2MWO A;  3LYI A;  2DXB A;  2K4Y A;  4BE0 A;  1XOV A;  2MWP A;  3OYC A;  3G4S T;  1N27 A;  1X6O A;  3CXC S;  3G7Z A;  4XQ3 A;  3OS0 A;  3HPW A;  4E7I A;  1N6A A;  2M9U A;  5GAN e;  4QW2 A;  3I55 A;  1YI2 A;  1KQ2 A;  1G3T A;  2LCL A;  3LW5 E;  4C5I A;  3OYD A;  1K9M U;  3OYA A;  5CKH A;  4MDX A;  2D0Q B;  4NOY A;  4C0D B;  4HCC A;  2DTO A;  4XAX B;  2BIV A;  5FU7 B;  3OSV A;  1YJN A;  2LNV A;  2KDS A;  3VV0 A;  1GXI E;  2CZ0 B;  3QII A;  3JAM E;  4EMK B;  3J7A F;  2RH2 A;  1OZ3 A;  1KHI A;  2E12 A;  3A8L B;  2RJE A;  4RCC A;  3J81 E;  4M78 F;  2ZPE B;  2WSC E;  1X01 A;  2OAU A;  4M78 G;  4XU3 A;  2ZPG B;  3CBM A;  1M1K U;  2DO3 A;  2RD1 A;  3L1A A;  3TEE A;  4HCB A;  3OMC A;  3JB9 I;  3SWN A;  3OYM A;  3TRE A;  2XKO C;  4C8Q F;  2OTL T;  3SWN C;  4C8Q G;  4PJO F;  5GAN j;  1Q82 C;  3H6Z A;  2YHT A;  4FIB A;  2CYZ B;  1KHC A;  2FB7 A;  2Y4X A;  3HRT A;  4IUU A;  3QO3 A;  1NE8 A;  1VQN A;  5GAN 4;  2MMP A;  4FT2 A;  3JCM g;  3GNF B;  4M78 D;  2EQK A;  2V8J A;  4ZGD B;  2EKO A;  5IT9 E;  4PJO B;  1QVF A;  1YIJ T;  3CMA T;  4II1 A;  1K9M C;  3QYH B;  3LGF A;  5LJ5 f;  5HY6 A;  5LL6 S;  1FWZ A;  3OBW A;  5FU7 C;  4C8Q D;  3V8K A;  4NL2 A;  1VQM A;  4X9C A;  3CCM T;  2XD0 A;  5IN1 A;  1M1F A;  3CCV T;  2PVG B;  2RB6 A;  2D9T A;  1ZHI A;  3QBY A;  2XI9 A;  4OB1 B;  3FIF A;  5CIU A;  1KG1 A;  4XU2 A;  4WF2 A;  2WSF E;  3M56 A;  4HCZ A;  1XNI A;  1IZ6 A;  2L89 A;  3JCM W;  2PVD B;  4GY5 A;  3CCJ A;  1VQ8 T;  2DXT A;  1H64 1;  4J5Y A;  2QA4 T;  2EJG A;  4XTX A;  1S72 T;  3JCM P;  4M77 E;  5GAN 3;  2E1H A;  5GMK h;  1G5V A;  2VYT A;  4J8O A;  1UGS B;  2WSE E;  3DKM A;  2F5K A;  3VYH B;  1VQK A;  2E64 A;  2X4X A;  2RHI A;  3L2W A;  3FLG A;  2CZ1 B;  2VXE A;  2O4X A;  3ZFJ A;  3JRZ A;  1VQL A;  4PJO C;  3ZEH A;  3CCR T;  5EG2 A;  2PUO B;  3X24 B;  1VQ6 T;  3CCL T;  1ZBX A;  4M7A B;  3OA6 A;  4YTL A;  4E7J A;  2KK4 A;  2JTF A;  1PSF A;  1YIT T;  2P0K A;  2K5F A;  3I56 T;  5D6X A;  3A8H B;  2GCX A;  4F7U E;  1WQ7 A;  2P4T A;  1O9S A;  1ZQ1 A;  2G3R A;  4XK8 E;  2ZGW A;  3JCM h;  1Q81 U;  3DLL A;  1NPR A;  3CEY A;  2EQJ A;  2V8I A;  1BI2 A;  3JCM d;  2QQS A;  3TU4 K;  1M90 U;  2JNG A;  3FEO A;  2GF7 A;  1VQ5 T;  3RMQ A;  3PIP A;  2RHX A;  2RO0 A;  3OBY A;  2EWN A;  3OYK A;  3PIO A;  3G4S A;  4M77 D;  4TVR A;  3MEU A;  1N8R U;  3WVD B;  3CPW A;  5LJ3 f;  2BKD N;  1UGQ B;  2HNI A;  1VQ4 T;  4M75 F;  3L2Q A;  2ZPF B;  2Y4Y A;  4C0F A;  3LWI A;  4M75 G;  4Y91 A;  2QQA A;  3HL8 A;  4M7A A;  4PKC C;  2WAC A;  3BFM A;  4M7A C;  2O01 E;  3P8D A;  3DB4 A;  4M75 B;  4VUB A;  4V2S A;  4DOW A;  4BB7 A;  3J80 E;  1Q7Y U;  2KMT A;  1U1S A;  1IRE B;  3M53 A;  4J83 A;  1NZ9 A;  3CPF A;  3RUX A;  1G3Y A;  3X25 B;  4Y28 E;  3L2U A;  1W2B A;  3OY9 A;  4GLK A;  1Y07 A;  3QHS A;  3UDC A;  5GAM f;  5KE3 A;  2CKK A;  2K5L A;  4JRP A;  4Q5W A;  3QJ6 A;  1OI1 A;  4B9W A;  5LJ5 g;  3CPW S;  1YJW T;  3M54 A;  3M9Q A;  4M7D G;  1KD1 C;  5GAN 7;  1LNX A;  3V7C A;  4C92 F;  3OYH A;  1K73 U;  3OQ5 A;  4FU6 A;  2OTL A;  4C92 G;  4KBM B;  4ME7 A;  3LGL A;  1LOJ A;  2LDM A;  3OS1 A;  1VQO A;  3PGG A;  1VIE A;  4IUT A;  3L2R A;  4BDZ A;  5J3B A;  4C5E A;  2XDD A;  4C92 B;  3M58 A;  2D6F A;  3S3N A;  5CVI A;  3QDR B;  4A4K A;  2GFU A;  5CO7 A;  3KXT A;  4E7L A;  3JCM J;  1W2B S;  5GMK e;  4M7D D;  3CCS T;  4P5N A;  3VU3 C;  4UC4 A;  1MHN A;  2V8K A;  3BY7 A;  5GMK l;  3V8J A;  3QPH A;  3RES A;  4C92 D;  2F5T X;  4MZM A;  5KCH A;  5KCO A;  1VQ7 A;  3OMG A;  4LD9 K;  4PNO A;  4OMF B;  3JCM V;  5HK0 A;  4O5V A;  2LC4 A;  1Q86 C;  3CCM A;  2E10 A;  3HRS A;  3CCV A;  1G3W A;  2HQX A;  5CQY A;  1BI0 A;  2KAF A;  2VUB A;  3RER A;  5J39 A;  4E7H A;  3AHU A;  2QQR A;  2LVM A;  3V7S A;  3PTA A;  1JB0 E;  3C4S A;  2FL7 A;  4ZN1 A;  3JCM e;  4JRQ A;  1Y7X A;  2EFI A;  1Y96 A;  4JLI A;  3V7R A;  3GPL A;  3RKW A;  4M78 B;  1S72 A;  3CC2 T;  1NPP A;  4NL3 A;  4ZN3 A;  1VQP T;  2FYK A;  2PVO B;  5GMK j;  4Z02 A;  3UPU A;  2XHC A;  4QQD A;  3LWH A;  2HD0 A;  4XU0 A;  3QUI A;  4ZGE B;  5LJ5 h;  3CC4 T;  3CC7 A;  1YJ9 T;  2C06 A;  4C8Q B;  2LX9 A;  2X4Y A;  1JBM A;  2R57 A;  1NJI U;  4ZTJ A;  4KUD K;  4OP0 A;  3HSB A;  1YHQ A;  5DLQ E;  5GAO l;  4PJO E;  3QJY A;  1UGR B;  4IUP A;  4B9X A;  1KQ1 A;  1M5Q 1;  5LJ5 d;  1YIT A;  3JCM X;  1M9S A;  3MO8 A;  3E1S A;  4XTW A;  1K8A U;  4C0D C;  3VKI A;  1QVP A;  4EMK A;  2KVQ G;  2R5A A;  4FM4 B;  2KSS A;  3VUZ A;  1QP2 A;  4EMK C;  5L8R E;  3CBO A;  3P8H A;  4PL6 A;  5GAN 5;  1BI3 A;  5C0M A;  3CCE T;  1WNL A;  3JCM b;  1UGP B;  4PLL A;  3L2V A;  2QEX T;  3E9G A;  4BE1 A;  2EQM A;  5J26 A;  2RJD A;  3FB9 A;  4BI8 B;  1M1K C;  4EMH A;  3HP9 A;  1VUB A;  1WQW A;  2KY9 A;  1WPY A;  1UB4 A;  3HFO A;  1LJO A;  3QZ5 B;  4M78 A;  4A54 A;  4M78 C;  3OW2 A;  2LT4 A;  4PLI A;  5A0D A;  1QVF S;  4D6W A;  1YI2 T;  3G71 A;  3OB9 A;  1AHJ B;  2QTX A;  2DTI A;  2EJF A;  3JCM c;  3OS5 A;  2IVW A;  5HK3 A;  1VQ4 A;  1VIF A;  1QW1 A;  2PQW A;  3KBG A;  5DY9 A;  3GIB A;  2DXC A;  4C8Q A;  5C6S A;  4JRK A;  5DLO A;  2P0P A;  4QVD A;  3G6E T;  4C8Q C;  4JJN K;  3S3M A;  3NTK A;  1NJI C;  1YJN T;  4PJO A;  5D6W A;  4BUG A;  2RK1 A;  1FX7 A;  2KQW A;  4OF1 A;  5DM7 R;  3A8O B;  2K3Y A;  1P92 A;  2M0O A;  4QVC A;  4M7A E;  3ME9 A;  4BY6 B;  2PU9 B;  2X4J A;  3E19 A;  3QSU A;  3OYL A;  4N4G A;  4FSX A;  2FHD A;  2EYQ A;  4M77 F;  2OTJ A;  1N9R A;  3FDR A;  2CS7 A;  2DTH A;  3NTH A;  5FU6 B;  1JJ2 A;  4M77 G;  5GAN 2;  4LDX A;  3ER0 A;  2DAQ A;  4OVA A;  5FRN A;  3ASK A;  3GOX A;  4C5H A;  5A2Q E;  4M77 B;  3S3O A;  4MZT A;  2GFA A;  3NFC A;  2EAY A;  2E6Z A;  4HT9 A;  4BD3 A;  4CRI A;  3CD6 A;  4X34 A;  3H8Z A;  2R58 A;  5CKB A;  3X26 B;  4O6J A;  2VV5 A;  4F7U F;  4R55 A;  4XTY A;  5GAN f;  4F7U G;  5LJ3 d;  2DEQ A;  3C94 A;  3DB3 A;  3F70 A;  5A0G A;  3JCM Q;  5GAO q;  2PUK B;  1PSE A;  3OYN A;  3GNG A;  4QQG A;  4RG8 A;  1VQ9 T;  2E6N A;  4L6V 5;  5M9O A;  1JJ2 S;  2XDP A;  3CCS A;  1EIF A;  3MHX A;  1OZ2 A;  3M55 A;  3OYI A;  1VQM T;  5LJ5 e;  3RIR A;  1SSF A;  4XTV A;  4BY6 C;  2K2V A;  1QP3 A;  1YIJ A;  4OB3 B;  4EMG A;  2MF2 A;  3MEW A;  3FJP A;  3P8B B;  1BI1 A;  2RHZ A;  1YBY A;  2DPP B;  2A3L A;  3R6O A;  5GAM d;  2YLB A;  1BYM A;  3CCJ T;  1Q81 C;  2LQK A;  2P0Q A;  4CI0 C;  3BDU A;  4M7D F;  3KUF A;  4IUR A;  3HFN A;  4HT8 A;  3V8L A;  3T9N A;  2JVV A;  3CCU T;  2DJZ A;  2NLU A;  3JSC A;  5CKD A;  3CC2 A;  1WJS A;  4QQ6 A;  1M90 C;  2HBP A;  3PMT A;  3OYY A;  2M1H A;  5GAO p;  4M7D B;  1M8V A;  1H3Z A;  1DJ7 B;  1N8R C;  4E7K A;  2LT1 A;  3C95 A;  4JUV A;  5CQX A;  1OYX A;  3DLM A;  4ZTF A;  5AYF A;  3QYG B;  3S6W A;  4IUQ A;  4ATO A;  3OSS C;  5LJ5 j;  3CXC A;  3VUB A;  3VJP A;  2AHJ B;  4A4F A;  4A4G A;  4J6Y A;  2X35 A;  1BIB A;  2RA2 A;  3MP6 A;  3OYG A;  4BI3 A;  3WXM B;  5IAY A;  3CMA A;  1I8F A;  1KQS A;  1RI0 A;  2EJ9 A;  3HRU A;  4M75 A;  4A4E A;  2RM4 A;  1I4K 1;  3M57 A;  2RI2 A;  3CBP A;  2ZZD A;  4M75 C;  1Q7Y C;  4RCB A;  4OB2 B;  2K3X A;  2YLC A;  1JRI A;  4C5G A;  2XID A;  2RJC A;  3CCE A;  3LLR A;  1WJR A;  2VGN A;  2RK2 A;  2X4W A;  3SWN B;  3ZBD A;  2HQE A;  2QEX A;  4JS4 A;  2F69 A;  4DOV A;  4BDY A;  4C0Z A;  1D3B B;  1Q82 U;  3PFS A;  5CR2 A;  5GAO n;  2DD5 A;  4MZP A;  1MGQ A;  2A7Y A;  3CME T;  1K73 C;  2QA4 A;  1VQ8 A;  2I2L A;  4M78 E;  3OYJ A;  4M7D A;  2DKG A;  4RMO A;  1KQS S;  4M7D C;  2DZC A;  2YRV A;  4BI4 A;  5LJ3 e;  3HHT B;  1FXX A;  4C92 A;  3L2Z A;  4JDS A;  4C92 C;  2XIC A;  3G6E A;  5GMK m;  2XDB A;  1HK9 A;  1M1G A;  4C8Q E;  3QXE B;  3CCR A;  3C12 A;  4J6W A;  1VQ6 A;  4L59 A;  3CCL A;  3MEV A;  5GAN 8;  1QVG A;  5GAN g;  2JOY A;  3MEA A;  4FT4 A;  3EAE A;  4N4I A;  2CGH A;  5KH6 A;  2M16 A;  2QI2 A;  3I56 A;  2JTM A;  3Q1J A;  5LJ3 g;  4HKE A;  3CCQ T;  1U8R A;  2JZ2 A;  2QQ9 A;  3MP8 A;  4BAC A;  2EIF A;  3FC3 A;  2XU8 A;  1RL2 A;  5FLX E;  4A4H A;  5GAM e;  2E70 A;  5GAN 6;  2E41 A;  3BDL A;  3L42 A;  4MDW A;  4EDU A;  2RI5 A;  4FL6 A;  1D3B A;  2DIG A;  2ZPI B;  3URG A;  4MMK A;  4ELY C;  1VQO T;  3M4Y A;  4PJO G;  5CAI A;  1O75 A;  5LJ3 j;  3QKJ A;  2DIQ A;  1VQ5 A;  5CK9 A;  3X28 B;  4JRI A;  4XTZ A;  2ZPB B;  2O4X B;  5GAM g;  3I55 T;  1QVG S;  3BW1 A;  1Y71 A;  5I2S A;  5GAO m;  4ZGJ B;  5GMK i;  4OB0 B;  3PMI A;  1VQ9 A;  2K57 A;  3QZ9 B;  1VQ7 T;  3MCA B;  1G3S A;  4KUI A;  3LX7 A;  3LH0 A;  2VXF A;  3WVE B;  2L3R A;  5FRO A;  4PJO D;  2LQ8 A;  2MI6 A;  2MAM A;  3O8V A;  5D6Y A;  4IKF A;  4BE2 A;  3JB9 F;  5GAM j;  1K8A C;  1V29 B;  3GF5 A;  2XK0 A;  2L5Q A;  4J7I A;  5GAO r;  3JB9 G;  1BIA A;  1XQH A;  2DD4 A;  4NS5 A;  3FRN A;  3M4G A;  3OS2 A;  3TCJ A;  4A53 A;  3OYF A;  3OW2 S;  4LDW A;  2QQB A;  4KUL A;  2GQV A;  5I2M A;  5CCA A;  1BKB A;  1W4S A;  3SD4 A;  3UWN A;  2QXF A;  5I21 A;  1YJW A;  1HXD A;  3RKX A;  3CCU A;  5GAN h;  2LTO A;  4DQ2 A;  3A8M B;  4M7A F;  1WJQ A;  2K5I A;  4N0A A;  5LJ3 h;  3OYB A;  3JB9 H;  4M7A G;  2CZ7 B;  1XTD A;  4IUV A;  4N0A C;  4OGE A;  3JB9 D;  3CC7 T;  5GAN d;  1VQN T;  3EFS A;  2VGM A;  1YHQ T;  3M59 A;  1I5L A;  3SDZ A;  1I81 A;  3JB9 J;  3PNW C;  3GLX A;  2RHU A;  4EPC A;  2B8A A;  4XTU A;  2QDY B;  4F7U B;  3MP1 A;  3N5B B;  4RG2 A;  1WGS A;  2RHY A;  4C0G A;  1B34 B;  3HKS A;  4M7A D;  2FVU A;  2LRQ A;  4LDY A;  5GAM h;  3OYE A;  4J7F A;  4M75 E;  3QG1 A;  2ZCF B;  5FRM A;  3X20 B;  2JN0 A;  2DZ9 A;  3NTI A;  4QVZ A;  4DA4 A;  1KD1 U;  4LD6 A;  5FU6 C;  1KC8 U;  3JCM f;  3M5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...