4M78F

Crystal structure of lsm2-8 complex, space group p21
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
65
Chain Sequence
ILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 10
structure length 65
sequence length 79
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m78F00
4C92G 4XU3A 3JCMc 5GAN5 3JCMW 4M75E 2K57A 2EJGA 3RERA 4M7AG 2HNIA 4M75C 4DQ2A 3RIRA 1M8VA 4M75G 3JCMe 2VXFA 4N0AC 4EMGA 4XTZA 2YHTA 4J6YA 5GAN8 4M7AC 4M7AE 5DY9A 4C8QD 3V7RA 3FB9A 4C92C 3AHUA 1YCYA 3V8JA 2E65A 3QHSA 1LJOA 1MGQA 1Y96A 4M77F 5LJ3d 4M78G 3JCMb 5LJ5j 1KQ2A 3L2ZA 4M78B 4M77B 4QVDA 4M77D 3JB9H 4M7DA 4M78C 5GAMf 1TH7A 5LJ5d 4M78E 4NL2A 5GMKl 2JN0A 4PJOA 5LJ3f 3RKWA 2VC8A 4C8QE 3RKYA 3V7SA 3L1AA 4M7AB 2EAYA 2Y90A 2RM4A 2QTXA 5CAIA 5GAN3 4PJOE 4J5YA 4JRIA 2E41A 4F7UF 3RUXA 3HFOA 4Y91A 4RCCA 1I4K1 1D3BB 4QVCA 5LJ3e 5GAOn 1Y96B 5GMKh 5GAMj 2DZCA 1HK9A 1U1SA 1WNLA 4MMLA 3JCMX 5GAN7 1JRIA 4JUVA 3PGGA 5GMKi 5GAN2 4C92D 4HA8A 5GANg 4C8QF 3QO3A 3BFMA 3JCMJ 4X9DA 2DTOA 1BIBA 4C92F 4M7DD 1LOJA 3FIFA 5GAN6 3GIBA 2E1HA 3JCMh 2EJ9A 3SWNA 2VXEA 4M75F 2DVEA 1KQ1A 5GAOm 3JB9G 4PJOD 4A53A 4M78A 5GANd 4NL3A 3SWNC 4PJOG 3JCMV 4F7UE 3JB9D 4M77A 5LJ3g 1WPYA 3BW1A 4A54A 5LJ3h 1I5LA 4M7DF 3QUIA 5LJ5e 1X01A 3BY7A 2I2LA 1H641 4XU2A 3V8LA 4XU0A 4M7AA 1B34A 3RKXA 5LJ5h 3M4GA 1HXDA 4C92A 1N9SA 4PJOF 4XU1A 4JLIA 3V8KA 3V7CA 1D3BA 4M7DC 3JB9F 2E64A 2EJFA 1WQWA 4C92E 5GANf 3RESA 4EMHA 1LNXA 3FJPA 4RCBA 5LJ5g 4HT8A 5GAOq 2DZ9A 1M5Q1 1U1TA 4J6WA 3JCMd 5GMKe 4PJOC 2DTHA 4V2SA 4PJOB 4F7UG 4XQ3A 4M75D 4EMKC 5GAOl 1WQ7A 2E10A 3EFRA 4OP0A 3JB9J 4M7DE 4X9CA 4J6XA 5GMKj 2EWNA 5LJ3j 4XTXA 4XTYA 4C8QC 1I81A 2DEQA 4N0AA 4M7DB 2YLBA 2DTIA 2FYKA 5GAMe 3JCMQ 5GAOr 3BDUA 4C92B 4M78D 4MMKA 4C8QA 1N9RA 2ZGWA 3VU3C 3QSUA 4PNOA 5GANe 4M78F 5I21A 2FB7A 1JBMA 4M75B 3SB2A 4C8QB 4EMKA 5GANh 2RB6A 1I8FA 3JCMf 4WF2A 1BIAA 2CGHA 4NOYA 3SWNB 4M7AD 4XTWA 2DXUA 4XTUA 4EMKB 1B34B 2DXTA 4F7UB 5GANj 3HSBA 5LJ5f 5GAMd 5GAMh 2DJZA 4M7AF 4M7DG 2RD1A 5GMKm 4F7UA 5GAMg 4M77E 3INZA 4M77C 3JB9I 2DKGA 2YLCA 3EFSA 5GAN4 4C8QG 4JRKA 2RA2A 3JCMg 4M77G 5GAOp 4HT9A 4M75A 4XTVA 3HFNA 3JCMP
chains in the Genus database with same CATH superfamily
2CP5A 4OB3B 3G1JA 5C0MA 2DMOA 1M8VA 3M0SA 2JJ9A 4X34A 1R0BG 2O4XB 1LCKA 2QGFB 2ENMA 2JS0A 2DM1A 1SG5A 1MGQA 1YFNA 3M5AA 1VQ5T 2ED0A 4J9IA 2LNHB 3I56Q 3OYIA 1X2KA 3M59A 1Q95G 1QWFA 3CXCP 3MEWA 1OV3A 1Q7YC 1HYOA 1PSFA 1SSHA 2RQVA 4MMLA 4RTUA 1M3BA 2V1QA 3UF4A 2E6NA 3LH5A 3CMAQ 2K4YA 5CIUA 1Q86C 1C6VX 2PVOB 3NTIA 2BZXA 2QA4A 4DOWA 2JS2A 3SWNC 4PJOG 4OMPA 3OYLA 1I5OB 2CP7A 3CCST 4ZTFA 1YJNQ 1S1NA 3G4SQ 3V8LA 5HY6A 1HD3A 3RDVA 2DLPA 1WFWA 3V8KA 5L23A 2E12A 1KJWA 3P8DA 4FU6A 1AD5A 1WXBA 4FSSA 3JB9J 2GNCA 1ABQA 1QVGP 2DEQA 3EFOA 2P84A 2WSFE 4BD3A 4NOYA 3CBPA 1U8RA 2KK4A 3CCRQ 3EFSA 3OBWA 1M2OA 2KYMA 5GAOp 2PUKB 2QASA 2DL7A 3OQ5A 1WHJA 2KXCA 4HCKA 3BY7A 2JW4A 3CC4A 4M75E 4BACA 1NG2A 2AIRB 3RIRA 3OYBA 1K9MR 4OMMA 4X1VA 2DL8A 2FHDA 4KUIA 3NTHA 1BI2A 1YJWA 2QEXT 4CRIA 3MEVA 1AZGB 2E5QA 4IUQA 2JMCA 3OYYA 4LE9A 3RMSA 1Q82C 2ZPFB 1NE8A 3RKYA 2BZ8A 2MCNA 2LT1A 5IN1A 3HL8A 3HFOA 1QKXA 1ZUYA 5CO7A 2RJDA 4FW2A 4A63B 1SHGA 1BIBA 3M57A 2ROTA 5ECAA 1MMNA 2OTJQ 1KSWA 5LJ3h 1M1FA 1K0XA 4Z89A 4KT0E 1BI3A 2IVWA 1D1CA 1IRXA 1YJ9Q 4N4HA 4M4ZA 2DJQA 3RESA 3LLRA 3JCMd 3N5BB 2P0KA 1QVFS 2KBTA 2V8KA 3HRUA 2BKDN 2GFUA 2MOXA 3TVTA 2EWNA 4C8QC 5IXBA 1MV3A 2AKKA 4LD6A 2XDDA 1GXIE 1Q81R 3H0IA 2YDLA 2QQ9A 2HSEB 5CKFA 2LQKA 1IB8A 1PHTA 1Q81U 1D0ZA 3OSVA 4FYWB 2B86A 3EGXB 3M0QA 1ACMB 2DXTA 2DIQA 2EGAA 3TCJA 3OYAA 3GF5A 3M56A 3JAME 2PVDB 1W70A 1C0MA 3EFOB 2WACA 2DO3A 3EH2A 5CKBA 3CCRT 2VKNA 4GLMA 4HT9A 1O9SA 2EPDA 4XTVA 5FRNA 5A2QE 3HRSA 5KCOA 2F1LA 4AG1C 4JJNK 1WXUA 3CCUT 2EKOA 1VIEA 2HZYA 3RMQA 3DLLA 2PVGB 2F5TX 2J7IA 4QVDA 4M77D 2FPFA 2IIMA 2EYXA 1LPLA 2NYSA 4R0KA 3OYDA 2EKHA 2NUTA 1PD0A 4J5YA 1T0JA 2JZ2A 4C5EA 5GAN2 1OU8A 4RTZA 1VQMA 4X9DA 3QBYA 3H41A 3GIBA 2QK0A 2P0PA 3PNWC 1YI2A 4L6V5 1QVFA 2ESWA 1BI1A 4M7DF 4A4HA 2KRMA 1K4US 1RUWA 3SDZA 4CI0C 3UT1A 3PE0A 1XQHA 1AWJA 4ORZA 3A8LB 4DA4A 4C92E 1VQ5Q 4HT8A 1AVZC 1RABB 3CCMT 1VQKT 3S3MA 3CCQQ 4OP0A 1TU0B 3CC4T 1PWTA 2DTIA 2OTLQ 1WI7A 1I07A 1TXQA 1YITA 3QYHB 1AZEA 2G6FX 1D1AA 3HSBA 2X3XD 3CMAT 5LL6S 4EIKA 4F7UA 2RHIA 3INZA 2K79A 1YN8A 5GAN4 3OYNA 2C0TA 2DXBA 3MP1A 2CT3A 1AWWA 3HFNA 2HMAA 3JCMP 3ULRB 1RL2A 1WYXA 4EMGA 2BE7D 1TTHB 3AHUA 1ZA2B 4RKUE 5IXFA 5LJ3d 1GFDA 3RR6A 3OA6A 4NS5A 4AFSC 5GMKl 1JU5C 2D1XA 3GLXA 2O31A 4J9FA 5FW9A 3OYGA 2HCKA 3X28B 2MK5A 2FRYA 2CP2A 1D3BB 5IHKA 1UGQB 2W0ZA 2GF7A 1NYFA 1QCNA 1JRIA 4ZNXA 1KHCA 2COWA 4D6WA 2QGGA 3I55Q 4LUDA 3CCEA 1SEMA 3BFMA 5FU7B 5IAYA 3CD6Q 4M7DD 4Y92A 1NLPC 2DYIA 2K5LA 2J6FA 3FRNA 2M51A 4KUDK 3LGLA 1NZ9A 4J8OA 3UPUA 2J05A 3EG9B 1VQPT 5KE2A 4N4IA 4C0FA 3BW1A 4A54A 3M0RA 3A8MB 1B34A 2L2PA 1VQ9A 1TSFA 1UGSB 2EVRA 4A4FA 1AWXA 2P4RA 1N8RC 3M53A 2H3JA 1VIFA 3OB9A 2RJFA 1VQ5A 1XTDA 4E7IA 2ATCB 4JS4A 3VS1A 1VQLT 3TSWA 3VKIA 4ESRA 2X4YA 2JOYA 1I1JA 2D8HA 2YXYA 2E5KA 4AFUC 3FJ5A 4CC7A 3T9NA 2KR3A 4EMKA 5J39A 4E7KA 4ZGDB 3PMTA 3CMEQ 2F2XA 1G83A 4XTUA 1WHGA 5M9OA 1RLPC 4M7DG 2RD1A 4LUEA 1BKBA 4M77E 1BU1A 2HBPA 2E3IA 2LJ3A 2ZPHB 1IO6A 3GPLA 2OTLT 5FROA 1Q86R 2QTVA 2MYSA 3P8HA 3JCMc 2KI7A 3JCMe 1C1AA 4XTZA 2YHTA 3VS3A 1CSKA 5GAN8 1K9MC 4M7AC 3LX7A 5DY9A 2XG8D 1X6GA 2PNIA 5LJ5j 3JB9H 4LD9K 1W4SA 1W2BP 2K9GA 4PJOA 1N5ZA 2PTKA 3OS5A 1M27C 4JZ3A 1QP2A 3I9QA 5GAMj 1WNLA 1RAGB 2DF6A 1ZHIA 1K8AU 1MNEA 3VV0A 2D8JA 2HSPA 2SEMA 1MMGA 3HTRA 1VQMT 5GAN6 2E1HA 2GCXA 1YITQ 2EBPA 5HCKA 4A53A 4MDXA 2J6KA 1B3QA 2FL7A 3GNFB 3CBMA 2D0NA 4M7AA 1ZA1B 2RH2A 2DD4A 3META 3JB9F 4JJCA 1N8RU 3FJPA 1VYUA 2L3PA 2QDYB 3G71A 1EX4A 1QMCA 5GMKe 3VS7A 3CCUQ 3CCUA 2AZSA 4PJOB 9ATCB 3CQTA 5KYWA 1ZQ1A 4KGZB 4XTYA 4ME7A 2ZZDA 1EZZB 2MF2A 3FC3A 2XK0A 7AT1B 3S3NA 2D6FA 1WHKA 4D8KA 2M1HA 1VQ4A 5GANh 2KMTA 3A5ZB 3BE3A 3SWNB 4IURA 4OGEA 1OQKA 3C0CA 1YNZA 2CUDA 1WHHA 2KYBA 4J7IA 1KD1C 4E7HA 2HEQA 1NBEB 1JO8A 3AT1B 3VS0A 5FWCA 2FZKB 4M7AG 2DNUA 4M75C 3QG1A 1NM7A 4M75G 1QWEA 4HXJA 2NUTB 3CCJA 3G71T 4ZGEB 4M78G 1UFFA 3IQLA 2QEXQ 2JM9A 4CC4B 4ZGJB 4KBMB 2JMAA 2A28A 3REAB 2DERA 3L1AA 4QQGA 3J7AF 2K2VA 8AT1B 1GBRA 4CC2A 3GP8A 5EG2A 1NYGA 1BK2A 1G8XA 4OMOA 3CCEQ 2KY9A 3I55A 2CSQA 2L3RA 2A08A 3ZEHA 3MCAB 3PMIA 2EYWA 1QVPA 1KFZA 3SEMA 1SSFA 2KROA 5CKEA 2DK3A 3OS0A 1X01A 3O5ZA 4BDZA 2HQHA 2EQIA 2RQUA 4AFZC 4C0ZA 3LGFA 1AT1B 1IGUA 1D3BA 1UJYA 2QG9B 2LZ6B 2L8DA 1AEYA 3G71Q 4FSXA 1YJWT 2E3HA 4V2SA 2EIFA 1GRIA 4QT7A 2MWOA 2JTMA 2RK2A 1TUCA 1G3YA 5FWBA 1OEBA 3VU3C 4JJBA 1SHFA 1VOMA 2QA4Q 4EPCA 1JEGA 1JBMA 4M75B 3URGA 1UE9A 4DBHA 1PD1A 4JS5A 4JJDA 4MZTA 2QDLA 2DIGA 5HK0A 4JRQA 1JJ2P 4J9BA 1RADB 1V1CA 2V1RA 4C8QG 2VV5A 3VS5A 5AYFA 4F04B 2KEAA 2YUNA 2HNIA 3E19A 2KSSA 4F14A 3NMZC 3V7RA 3CC7A 1VQ8A 1YCYA 2XHCA 2HQEA 4M77F 3PIOA 4OMNA 4M78C 2CH4W 3QKJA 1RAIB 2CZ7B 1YJ9A 3CCSA 1FWZA 4DBQA 2E41A 5GJWB 1KQSS 2RHYA 2FPEA 5LJ3e 4QVCA 3R6NA 5GAOn 5GAN7 1BYMA 1WXTA 1SRLA 3NGPA 4OGCA 2RI3A 2EYYA 1VQMQ 2DFUA 2DTOA 4C92F 1W1FA 5A0LA 3CXCA 3JB9G 4PK4A 4QKUA 2WSEE 2I0NA 4J9GA 2CUBA 2RJEA 3LW5E 3QJ6A 1MUZA 3I5RA 1G3SA 2YRDA 3WVEB 4Z88A 1VQ6Q 1EFNA 1P92A 4DOVA 3H8ZA 1RI0A 3ME9A 1OX9A 1YIJA 1HXDA 1PC0A 3WVDB 2OAUA 2M0YA 4ZN3A 1VQ8T 3CC7T 4XQ3A 2JVVA 1BI0A 2DXCA 3VUZA 5GMKj 1K73C 1MHNA 2X4XA 2ZAEA 1T0HA 1TG0A 2A0FB 2OI3A 2RI5A 2LQNA 1M4ZA 5I21A 1WLPB 3MHXA 2KT1A 1VQ4T 3E2UA 4F7UB 5IHIA 4YTLA 4C0GA 1GFCA 5D7UA 3JB9I 2DKGA 2XIDA 2JTFA 4QVZA 2HD0A 5IT9E 5KYUB 2K6DA 1TOVA 4N0AC 4JDSA 1VQKA 3LH0A 3OYEA 2DETA 4JPBW 3L2QA 3V8JA 4WTOB 5CVIA 1LVKA 1Y71A 2RI2A 2X35A 4C5IA 1PM3A 1U06A 2H8HA 1TH7A 2L5QA 4RTXA 4PL6A 4FT2A 4LDUA 1YI2Q 1YBYA 2XKOC 2QI2A 4C8QE 2OTJA 3CC2T 2RM4A 2QTXA 5CAIA 2CP3A 2FEIA 4EDUA 3EAEA 1V29B 2YRCA 2L0AA 3OYFA 3KBGA 5J3BA 2QAZA 4PJNA 3A8OB 3QO3A 1Z9ZA 4KULA 3FIFA 3I55T 4BI3A 3JCMh 4F17A 1PNJA 4LNPA 1M1KR 1QCFA 2E4HA 2AHJB 5KCHA 4F16A 3A98A 1VQ6A 1UHFA 1I5LA 2Y4XA 3OY9A 2LCSA 1ZSZA 2QEXA 2CKKA 2KXDA 4E7LA 3TREA 3V7CA 5AT1B 1WQWA 5I2SA 1I0CA 4FIBA 3VYGA 3CCJT 2EGEA 2MPXC 3MKDA 5KYXA 3EG0A 2BZYA 1YP5A 2SRCA 1BCOA 2ED1A 2LJ1A 3VRZA 4PFPA 1KG1A 2DILA 2FYKA 4E47A 4PJMA 1Y57A 2K7AA 5CK9A 3CPWS 2YUOA 3EG2A 1QVFP 1M90C 2RB6A 1K9MU 1MNDA 1O75A 2LC4A 3EGDB 4BY6C 3QZ9B 3S3OA 4M77C 2GTOA 1VQLQ 4O6JA 3H0FA 1E6HA 2O9SA 4J83A 1QCOA 4C92G 2LRQA 2DYBA 3R6OA 4DQ2A 5KYYB 4ANJA 1K73U 2KDSA 3CCLQ 4M7AE 4C8QD 3M0PA 1X69A 2K2MA 1PCXA 3OYKA 3EG9A 3CPWP 3G4SA 2B8AA 2ZCFB 4AMCA 1K76A 4OB0B 1UDLA 2YUQA 1VQOA 3LWHA 4JRIA 4BB7A 1Y96B 3MO8A 1U1SA 4MZPA 3HP9A 3EGDA 3JCMJ 1H3ZA 3CD6A 4K11A 2ECZA 2EJ9A 5I11A 3OS1A 1H8KA 2M16A 1SF9A 4M78A 1VQNQ 2NLUA 1VQ8Q 3JB9D 3CC7Q 5KYYA 1WPYA 5EC7A 2O2OA 2FRWA 1VQ9Q 3NTKA 4XU1A 2DPPB 5GANf 2EQMA 1LNXA 1TS9A 1U1TA 1PRMC 4TVRA 4PJOC 4M75D 3DB3A 3EFRA 3JV3A 1PKSA 5L8RE 1Q7YU 1G3WA 4OMFB 3JCMQ 3I5SA 2QQSA 1Q7YR 1YJNA 1T3SA 4JLGA 2KVQG 2LCCA 5D6WA 5GANe 1VQ4Q 2H3EB 4C8QB 4GY5A 5I2MA 1WIEA 1UGPB 3CMEA 4J7FA 4XTWA 1PKTA 2DJZA 5GMKm 4KH1B 4Z02A 2HBWA 2DL3A 2CZ0B 2RA2A 2M02A 4PJJA 3CCMA 3PVLA 5CCAA 3NFCA 1ZBXA 2FVUA 3CCQA 3EG1A 1NJIU 2RQRA 2ZPIB 5IHNA 3RNJA 2E65A 3QHSA 1X6OA 2RNAA 4M7DA 4B9XA 4OF1A 4II1A 2W10A 4AT1B 2JN0A 4PLIA 3DKMA 2QYZA 1Q82U 1N6AA 3V7SA 4M7AB 4GBQA 3CCSQ 1QP3A 4PJOE 1UTIA 2X4WA 1X27A 4F7UF 4E2FB 1VQPA 4Y91A 1NPRA 2DL4A 3MEAA 4RCCA 1Q82R 1OOTA 2X4JA 2QA4T 3QIIA 1KK7A 1ZBJA 4B6MA 4IUUA 1VYVA 2MAMA 1OI1A 1RAEB 3CCET 1K0SA 2VGMA 4M75F 3UWNA 2DVEA 2NWMA 3UDCA 2HKNA 1RLQC 2DRKA 1EIFA 3M0TA 3C95A 1H641 4XU0A 1F1BB 3X20B 3RKXA 5LJ5h 1MMAA 3NHNA 2LJ0A 2G3RA 2KE9A 4ZTJA 3PIPA 1UJ0A 1IREB 1KD1U 5LJ5g 4C5HA 4HCBA 4GLKA 1KQSP 1QVGS 8ATCB 2K5FA 5DM7R 3M58A 2CDTA 2F2VA 4MZMA 2K5IA 1GCQA 4C92B 4MMKA 2P4TA 1MMDA 5D6XA 4FYYB 2K3XA 4R55A 2FB7A 2NUZA 1YCSB 4M7AD 2GBQA 5GAMd 4XAXB 3FDRA 3BDLA 4XK8E 1NJIR 1CKBA 2EGCA 3C94A 1YITT 2OX7A 1AOJA 4RTVA 2AKLA 1D1BA 5KYWB 1VUBA 1BCMA 4WCIA 1IZ6A 4BDYA 2JTEA 3JCMW 1ZUKA 1B07A 1Y96A 3VS2A 1JB0E 2ROLA 2YRVA 1E6GA 2XDBA 3QDRB 4M78E 3OMGA 4NL2A 3HHTB 2AZVA 1IHVA 4HCZA 3M4YA 1IGQA 4BE2A 1VQOQ 1YHQQ 4OVAA 2HL5C 3E1SA 3JCMX 2MIOA 1WHLA 1S72A 4HA8A 2KRNA 3G6EA 3CCJQ 2PZ1A 4KGXB 1Y0MA 4JZ4A 2DL5A 5J26A 2V8JA 3EGUA 2VXEA 4HVVA 3ER0A 3PT9A 2PU9B 5GANd 2F5KA 3M0UA 4A4GA 3CPWA 3QUIA 5D6YA 6AT1B 1N9SA 1H3HA 3A1PA 1M3AA 2BUDA 2EJFA 4R56A 1PRLC 2RPNA 1NJIC 4L5GA 2DTHA 3L42A 4F7UG 5KYNA 3LWIA 2CYZB 2E10A 3MEUA 3CCQT 4ATOA 4HVWA 2LVMA 2DX1A 1GL5A 3M54A 5GAMe 1Y07A 3VS4A 5GAOr 3CC2Q 4J9CA 3VJPA 3H6ZA 4HCCA 4C8QA 2XDPA 2FG0A 1X43A 2QQBA 1M2VA 1PG5B 4DBFA 3CCLT 3RBBB 1VA7A 2KGTA 1Q86U 1WJSA 1VQ7T 2CGHA 1K9AA 5DLOA 5GAMh 4M7AF 2VWFA 1H92A 2RHZA 4N4GA 2CP6A 2YLCA 4J9HA 2J06A 1D0YA 4LN2A 4XU3A 3UA6A 5GAN5 2EJGA 1M9SA 1PSEA 3E9GA 2RMOA 1G5VA 5CQYA 1ZSZC 1QQJA 1VQ9T 1YIJT 2CP0A 4OMLA 5FRMA 4BI8B 4IUVA 4L59A 3CCVQ 4M78B 1FYNA 3VYHB 1VQNT 2YUPA 2NUPB 2LCLA 1OYXA 3OW2A 2KNBB 1KC8R 2EAYA 2KT8A 4FCYA 3RUXA 3H9NA 3C4SA 2VGNA 4JUVA 3CPFA 4C92D 2R58A 5GANg 4IIMA 2CT4A 2EQUA 2VB6A 2VVKA 2ZPEB 1VQKQ 1ZSZB 5C6SA 4ELYC 2MMPA 3VS6A 1ZUUA 2QQRA 4KGVB 5FU6C 1VQOT 2FZCB 2YT6A 1X2QA 5HK3A 4IUPA 4UC4A 2RQWA 2E64A 2E6ZA 3CCVT 1K1ZA 2GQIA 4RCBA 4P5NA 2M9UA 3TEEA 2DZ9A 5GAOq 4QQ6A 1YHQA 2JT4A 2GQVA 4XTXA 4M7DB 2J6OA 4FW1A 2LX7A 4FYVB 4M78D 1E7OA 1OZ2A 2ZGWA 3OYMA 2HDAA 2OJ2A 3SB2A 4BUGA 1UGRB 4FT4A 1R8OB 2DXUA 3CEYA 5LJ5f 4Y28E 1VQ7Q 1VQ7A 5GAMg 4RTYA 3EGXA 3O8VA 1M8MA 3TSZA 4M77G 2LTOA 2QQAA 3L2UA 3CCMQ 1N27A 4M75A 2R5AA 3OS2A 1ABOA 2A36A 2DD5A 1G2BA 3RERA 1QW1A 4DEYA 2VXFA 2IG0A 4J6YA 1FMKA 2PQWA 1WA7A 1GCQC 2CZ1B 1WJRA 3G7ZA 1UEBA 3JCMb 1KQ2A 4M77B 3WXMB 2O4XA 5HKCA 3THKA 1B7TA 5LJ5d 1YI2T 3JRZA 2JXBA 4LDYA 1FMVA 1UECA 2VC8A 1R77A 4J9EA 2D9TA 1D0XA 2YSQA 1I4K1 4A4KA 4E7SA 3L2WA 4DBRA 3KUFA 4OMQA 3A8GB 1YWOA 1JJ2A 1LOJA 3U23A 3G6ET 2NUPA 1QVGA 4HVUA 1GCPA 1KQ1A 5GAOm 5FLXE 1TUDA 4VUBA 3JCMV 2COZA 3GNGA 5LJ3g 3KFVA 2OTJT 1IHWA 4PKCC 4C0DC 3EHRA 3OYJA 1WGSA 1KC8C 2LT4A 1RACB 1WDXA 3M4GA 2EQJA 1W2BA 4JLIA 1M1KU 2IPOB 3EH1A 3CXCS 2COYA 4PFOA 1OPLA 2F2WA 1V76A 3QYGB 2JM8A 3CCRA 5DLQE 1WQ7A 4M7DE 2L89A 4N0AA 1QKWA 2YLBA 2HAXA 1QLYA 2D0QB 2RO0A 1N9RA 2OAWA 4C0DB 2RN8A 4MDWA 3TQ7P 1A0NB 2MWPA 2RHXA 3QWYA 4ZN1A 1YJWQ 1T3LA 2LDMA 1YIJQ 1K73R 2M0OA 2GTJA 4HKEA 1NLOC 2RHUA 3QPHA 4QW2A 3SHWA 1OULA 1YHQT 5IH2A 3LYIA 3EHQA 4RMOA 2K57A 1NPPA 1U5SA 2ZPGB 4PJLA 1S72Q 4B9WA 3FB9A 4C92C 1LJOA 4IIOA 1KC8U 2FO0A 2C06A 3SD4A 5GJVB 5KYUA 4LXCA 3OBYA 4Q5WA 2PUOB 2O88A 1TWBA 5GMKh 3CBOA 1HK9A 1FMWA 4PLLA 5GMKi 1HSQA 2YWWA 4C8QF 1UHCA 3OSSC 1W6XA 4OB2B 3ZBDA 4JRPA 1TUGB 1WJQA 2R57A 1VQNA 2FZGB 2BIVA 3I35A 3OYHA 2BTTA 4BI4A 2I2LA 1RAFB 3M55A 1YJ9T 2DVJA 2A37A 4C92A 4PJOF 1OZ3A 2XI9A 2LX9A 4PFZA 4M7DC 1M1KC 2ABLA 4EMHA 4J6WA 4QQDA 4A4EA 1AWOA 1IXDA 2RJCA 2DAQA 4KH0B 2VASA 1AHJB 1I81A 2HKQB 1WZOA 3F70A 1WHMA 4RUGA 3ZFJA 3QSUA 1WX6A 2DA9A 3PFSA 5CQXA 2P0QA 2HQXA 3I56A 3VRYA 3HPWA 1JXMA 3MP6A 4J9DA 3CCLA 4DEXA 3J81E 5GANj 1Y7XA 1M1GA 3GBQA 3HRTA 2DBKA 2CREA 3A8HB 3QWXX 4JRKA 1VQLA 3JCMg 1YJNT 1D09B 1XJWB 4RTTA 2WSCE 2F69A 1Q81C 1KIKA 1ARKA 3VUBA 2A3LA 3P8BB 2R5MA 1NEBA 1OX8A 2LP5A 3CCVA 5GAMf 2XD0A 3QZ5B 2RQTA 1RI9A 3X25B 3DLMA 2DE0X 2QXFA 5GAN3 3NPFA 3SFMA 1G3TA 1KHIA 3FEOA 3UA7A 2X9HA 4AG2C 2Z0WA 1ZX6A 1S72T 2EW3A 2JUFA 3G6EQ 2XU8A 2EQKA 3CD6T 4RG8A 1SRMA 2DEUA 4BE0A 2BE9B 4PJOD 5CKHA 4F7UE 1GBQA 1RAAB 1OPKA 1VQPQ 2LMJA 5LJ5e 4XU2A 1UUEA 4O5VA 4IUTA 3G4ST 3TU4K 1KQSA 4CC3A 1SPKA 4BY6B 2DBMA 2XICA 3OW2S 3J80E 2V26A 3PTAA 4LDVA 1N8RR 1JJ2S 3D7SB 1NEGA 3M9QA 3L2RA 3E9FA 2KAFA 2KQWA 4J6XA 2X51A 2Y4YA 3BDUA 1JQQA 3CMAA 4E6RA 1KD1R 4PNOA 4M78F 3GOXA 2RF0A 2X3WD 3OMCA 1M30A 4E7JA 4EMKB 1B34B 4FYXB 5CKDA 1M3CA 1K8AC 2CZ6B 2A7YA 2KRSA 5I22A 5KH6A 1CKAA 1XNIA 3QJYA 1FX7A 2C0IA 3I56T 2CSIA 3REBB 1ZSGA 2K3YA 1M2VB 1BB9A 4RG2A 2ZPBB 5KE3A 2VYTA 3CC4Q 1VYTA 3HKSA 5A0DA 5A0GA 4BE1A 3FLGA 4D8DA 1X75C 5CR2A 3UATA 3L2ZA 3X26B 2DRMA 1FXXA 4C5GA 5FU7C 3S6WA 2EYQA 1DJ7B 2K3BA 1M90R 5LJ3f 3QXEB 4LDXA 3RKWA 2Y90A 1SKUB 1VQ6T 1M90U 1BBZA 3L2VA 4FL6A 2DZCA 1U3OA 2O01E 1X6BA 3PGGA 4IKFA 3H0HA 3Q1JA 2AK5A 2EFIA 1XOVA 5FU6B 2GGRA 3PVQA 3SWNA 1J3TA 1UG1A 2FPDA 3OW2P 4NL3A 1R0CB 4M77A 3X24B 1K8AR 2XMFA 3CC2A 2CS7A 2EYZA 2O9VA 3QDFA 3ZL7C 2L3SA 2C0OA 4Z8AA 2LNVA 2LQWA 1M5Q1 3MPUB 3OYCA 4ELZC 2L3QA 4FM4B 4E7ZA 3C12A 4EMKC 1OU9A 1ZLMA 3DB4A 5GAOl 3ASKA 2AT1B 2V8IA 4X9CA 1UB4A 5LJ3j 2RK1A 1W2BS 2GFAA 4LDWA 2CH4A 2JNGA 2OTLA 3MP8A 3EG3A 3CMET 3JSCA 1I8FA 1RAHB 3JCMf 4WF2A 1BIAA 2MI6A 2VUBA 1YWPA 2LQ8A 2E70A 3MJXA 1MV0B 1UGVA 1Z9QA 1JXOA 1HJDA 5KYXB 2HL3A 4RTWA 3KXTA 4OB1B 4AFQC 4KRTA
chains in the Genus database with same CATH topology
3P8HA 4C92G 2LRQA 4OB3B 3JCMc 2DD5A 5C0MA 3RERA 3R6OA 4DQ2A 1QW1A 1M8VA 3JCMe 2VXFA 2IG0A 4XTZA 2YHTA 4J6YA 4X34A 5GAN8 1K9MC 4M7AC 2O4XB 1K73U 2KDSA 2PQWA 4M7AE 3LX7A 5DY9A 4C8QD 2XG8D 2CZ1B 1WJRA 3G7ZA 3M5AA 1VQ5T 1MGQA 1UEBA 3JCMb 5LJ5j 3OYKA 1KQ2A 4M77B 3WXMB 3JB9H 2O4XA 5HKCA 4LD9K 1W4SA 3G4SA 5LJ5d 2B8AA 2ZCFB 3OYIA 1YI2T 3JRZA 4LDYA 4PJOA 3M59A 2VC8A 4OB0B 3MEWA 2D9TA 1Q7YC 1VQOA 3LWHA 3OS5A 4JRIA 1I4K1 1QP2A 4BB7A 1PSFA 4A4KA 3L2WA 1Y96B 3MO8A 5GAMj 1WNLA 1U1SA 3KUFA 4MMLA 3A8GB 4MZPA 1ZHIA 1K8AU 3HP9A 3VV0A 3JCMJ 2E6NA 1H3ZA 3CD6A 1JJ2A 1LOJA 2K4YA 5CIUA 3G6ET 5GAN6 1VQMT 2E1HA 1Q86C 1QVGA 2EJ9A 2GCXA 1KQ1A 2PVOB 3NTIA 5FLXE 5GAOm 3OS1A 2QA4A 4A53A 2M16A 4M78A 4MDXA 4DOWA 3SWNC 4PJOG 4VUBA 3JCMV 2NLUA 3JB9D 3GNGA 1WPYA 5LJ3g 2FL7A 3OYLA 3CCST 3GNFB 2OTJT 3CBMA 4ZTFA 4PKCC 4C0DC 3OYJA 1WGSA 1KC8C 2LT4A 3V8LA 4M7AA 5HY6A 3M4GA 2EQJA 2RH2A 3NTKA 1W2BA 2DD4A 4XU1A 4JLIA 3V8KA 3META 1M1KU 3JB9F 2DPPB 2E12A 1N8RU 5GANf 2EQMA 1LNXA 3FJPA 3G71A 2QDYB 3CXCS 1U1TA 3P8DA 4FU6A 5GMKe 4TVRA 3CCUA 4PJOC 4PJOB 3QYGB 4M75D 3CCRA 5DLQE 1WQ7A 3DB3A 3EFRA 3JB9J 4M7DE 1Q7YU 5L8RE 2L89A 1ZQ1A 1G3WA 4XTYA 4ME7A 2DEQA 4N0AA 2ZZDA 2YLBA 4OMFB 3JCMQ 2HAXA 2D0QB 2MF2A 2RO0A 2QQSA 2XK0A 3FC3A 3S3NA 2D6FA 1YJNA 4JLGA 1N9RA 2KVQG 2LCCA 4C0DB 2M1HA 5D6WA 5GANe 1VQ4A 4MDWA 2WSFE 4C8QB 4BD3A 4GY5A 5GANh 5I2MA 2KMTA 3A5ZB 2MWPA 3L2RA 1UGPB 2RHXA 4J7FA 4IURA 4NOYA 3SWNB 4XTWA 4ZN1A 3CMEA 3CBPA 4OGEA 2DJZA 1U8RA 2KK4A 2LDMA 5GMKm 4Z02A 2M0OA 3EFSA 3OBWA 4HKEA 2RHUA 3QPHA 2CZ0B 2RA2A 5GAOp 2PUKB 4J7IA 3CCMA 1KD1C 4QW2A 5CCAA 3OQ5A 3NFCA 4E7HA 1YHQT 3BY7A 3LYIA 1ZBXA 4RMOA 3CC4A 2FVUA 2K57A 1NPPA 4M75E 4M7AG 4M75C 4BACA 3RIRA 3QG1A 3OYBA 4M75G 3CCQA 1NJIU 2ZPIB 2FHDA 2ZPGB 4KUIA 3NTHA 4B9WA 1BI2A 3FB9A 4C92C 1YJWA 2E65A 3QHSA 1LJOA 1X6OA 3G71T 2QEXT 4ZGEB 3CCJA 4M78G 4CRIA 3MEVA 4M7DA 2E5QA 4IUQA 4ZGJB 1KC8U 3OYYA 4B9XA 4KBMB 4OF1A 2C06A 4II1A 3SD4A 2JN0A 4PLIA 3RMSA 3DKMA 1Q82C 2ZPFB 1NE8A 1Q82U 1N6AA 3RKYA 3V7SA 3CCQT 3L1AA 4M7AB 4QQGA 1QP3A 3J7AF 4PJOE 2X4WA 3OBYA 4Q5WA 4F7UF 2LT1A 2PUOB 5IN1A 3HL8A 3HFOA 1NPRA 3MEAA 4RCCA 2K2VA 4Y91A 1VQPA 5CO7A 5GMKh 3CBOA 2RJDA 2X4JA 1HK9A 2QA4T 3QIIA 3GP8A 5EG2A 4IUUA 4PLLA 5GMKi 4C8QF 2KY9A 3I55A 2MAMA 3OSSC 3M57A 1BIBA 1OI1A 4OB2B 3ZBDA 3CCET 2L3RA 3ZEHA 2VGMA 3MCAB 4M75F 2DVEA 3PMIA 3UWNA 4JRPA 1QVPA 3UDCA 1VQNA 1SSFA 1WJQA 2R57A 5CKEA 2DK3A 2BIVA 5LJ3h 1M1FA 1EIFA 3OYHA 3OS0A 1X01A 4BDZA 4BI4A 2I2LA 1BI3A 2IVWA 1H641 3C95A 3M55A 4KT0E 4XU0A 1YJ9T 3X20B 3RKXA 5LJ5h 4C0ZA 3LGFA 4C92A 4PJOF 1OZ3A 2XI9A 2LX9A 1D3BA 4N4HA 4M7DC 2G3RA 1M1KC 4ZTJA 3PIPA 3RESA 1IREB 2L8DA 4EMHA 1KD1U 5LJ5g 4C5HA 4FSXA 3LLRA 4J6WA 3N5BB 3JCMd 1YJWT 4HCBA 2P0KA 4QQDA 1QVFS 4GLKA 4A4EA 4V2SA 2V8KA 2RJCA 3HRUA 2BKDN 2DAQA 2EIFA 2GFUA 1QVGS 2K5FA 2EWNA 2MWOA 4C8QC 1AHJB 2JTMA 1I81A 2RK2A 5DM7R 4LD6A 3M58A 1G3YA 2XDDA 4MZMA 3F70A 1GXIE 2K5IA 4C92B 4MMKA 2QQ9A 2P4TA 3ZFJA 3VU3C 5CKFA 3QSUA 3PFSA 2LQKA 2P0QA 5CQXA 5D6XA 2K3XA 2HQXA 4R55A 3I56A 2FB7A 3HPWA 4EPCA 1JBMA 4M75B 3URGA 3MP6A 1Q81U 3OSVA 3CCLA 3J81E 4JS5A 4M7AD 5GANj 1Y7XA 4MZTA 1M1GA 2DXTA 5GAMd 2DIGA 2DIQA 4XAXB 3FDRA 3TCJA 5HK0A 4JRQA 3BDLA 4XK8E 3GF5A 3M56A 3OYAA 3HRTA 3JAME 2PVDB 3C94A 2WACA 3A8HB 4C8QG 2DO3A 1YITT 4JRKA 2VV5A 1VQLA 5CKBA 3CCRT 3JCMg 4HT9A 1YJNT 1O9SA 2WSCE 1VUBA 5AYFA 2F69A 4XTVA 1Q81C 1IZ6A 4BDYA 5FRNA 5A2QE 3HRSA 5KCOA 3JCMW 2HNIA 3VUBA 3E19A 2KSSA 2A3LA 3P8BB 4JJNK 2R5MA 3V7RA 3CC7A 3CCUT 1VQ8A 1YCYA 2XHCA 2EKOA 1VIEA 2HQEA 4M77F 3RMQA 1Y96A 2PVGB 3DLLA 2F5TX 3PIOA 1JB0E 2YRVA 3CCVA 4QVDA 4M77D 4M78C 2XDBA 3QDRB 5GAMf 4M78E 2XD0A 3OMGA 3QZ5B 4NL2A 3HHTB 3QKJA 2CZ7B 3X25B 1YJ9A 3DLMA 4HCZA 3OYDA 2QXFA 3CCSA 1FWZA 3M4YA 5GAN3 4BE2A 4J5YA 3SFMA 2E41A 1KQSS 2RHYA 1G3TA 5LJ3e 1KHIA 2JZ2A 3FEOA 4QVCA 4OVAA 5GAOn 5GAN7 4C5EA 1BYMA 3E1SA 3JCMX 1S72T 4OGCA 2JUFA 2RI3A 5GAN2 1S72A 4HA8A 3G6EA 1VQMA 2XU8A 4X9DA 2DTOA 2EQKA 4C92F 3CD6T 3QBYA 5J26A 4RG8A 2V8JA 5A0LA 3GIBA 2P0PA 2VXEA 3ER0A 3CXCA 3PT9A 2PU9B 4BE0A 3JB9G 4OB1B 4PJOD 2WSEE 5GANd 3PNWC 2RJEA 1YI2A 2F5KA 5CKHA 4F7UE 3LW5E 3QJ6A 4L6V5 1QVFA 1G3SA 3WVEB 4A4GA 1BI1A 3CPWA 4M7DF 1P92A 4A4HA 4DOVA 3QUIA 5LJ5e 4XU2A 3H8ZA 5D6YA 1RI0A 3ME9A 3SDZA 4CI0C 3UT1A 1YIJA 1HXDA 4O5VA 1N9SA 4IUTA 1XQHA 3WVDB 2OAUA 3G4ST 3TU4K 2BUDA 3A8LB 1KQSA 4DA4A 2EJFA 4R56A 4C92E 4ZN3A 1NJIC 4BY6B 2XICA 4HT8A 3OW2S 3J80E 4L5GA 1VQ8T 3CC7T 2DTHA 3L42A 4F7UG 3PTAA 4LDVA 4XQ3A 3LWIA 2CYZB 3CCMT 1JJ2S 1VQKT 3S3MA 2JVVA 2E10A 3M9QA 3MEUA 1BI0A 2DXCA 2KAFA 2KQWA 3E9FA 4OP0A 3VUZA 2LVMA 4J6XA 5GMKj 1MHNA 3CC4T 1K73C 2X4XA 3M54A 2DTIA 1Y07A 5GAMe 2Y4YA 5GAOr 3BDUA 3VJPA 3H6ZA 3CMAA 4HCCA 4C8QA 2XDPA 4ATOA 2QQBA 2RI5A 4PNOA 1YITA 4M78F 1M4ZA 5I21A 3GOXA 3CCLT 3QYHB 3MHXA 1Q86U 3OMCA 1VQ4T 1WJSA 4E7JA 1VQ7T 2CGHA 4F7UB 4EMKB 1B34B 5CKDA 3HSBA 5DLOA 5GAMh 1K8AC 4YTLA 2CZ6B 5LL6S 3CMAT 2A7YA 4M7AF 5KH6A 4C0GA 4F7UA 1XNIA 3QJYA 2RHZA 2RHIA 3INZA 4N4GA 1FX7A 3JB9I 2DKGA 2XIDA 2YLCA 5GAN4 3OYNA 3I56T 2JTFA 2DXBA 3MP1A 4QVZA 2K3YA 2HD0A 4RG2A 5IT9E 2ZPBB 3HFNA 3JCMP 5KE3A 4XU3A 2VYTA 5GAN5 1RL2A 2EJGA 1M9SA 1PSEA 3E9GA 3HKSA 4N0AC 5A0DA 4EMGA 4JDSA 1VQKA 3LH0A 3OYEA 1G5VA 5CQYA 5A0GA 1VQ9T 4BE1A 3AHUA 3L2QA 1YIJT 3FLGA 3V8JA 4BI8B 5FRMA 5CVIA 4RKUE 5CR2A 1X75C 1Y71A 2RI2A 5LJ3d 4IUVA 4L59A 2X35A 3L2ZA 4M78B 3X26B 4NS5A 4C5IA 3OA6A 1FXXA 1TH7A 2L5QA 5FU7C 3S6WA 3VYHB 4C5GA 2EYQA 1DJ7B 4FT2A 4LDUA 4PL6A 2LCLA 5GMKl 1VQNT 3GLXA 1YBYA 2XKOC 5LJ3f 2QI2A 3QXEB 3RKWA 1OYXA 4C8QE 3OW2A 4LDXA 2OTJA 3OYGA 2EAYA 3CC2T 2Y90A 2RM4A 2QTXA 3X28B 5CAIA 1VQ6T 1M90U 3L2VA 3RUXA 4EDUA 1D3BB 1UGQB 4FL6A 3EAEA 1V29B 2DZCA 2GF7A 2O01E 3C4SA 3OYFA 1JRIA 2VGNA 1KHCA 3KBGA 3PGGA 4JUVA 3CPFA 5J3BA 2R58A 4C92D 3Q1JA 4D6WA 4IKFA 5GANg 3A8OB 3CCEA 3QO3A 3BFMA 5FU7B 2EFIA 4KULA 5IAYA 1XOVA 5FU6B 4M7DD 3FIFA 3I55T 4BI3A 3JCMh 3SWNA 2EQUA 2K5LA 3FRNA 4KUDK 3LGLA 2ZPEB 1NZ9A 4J8OA 3UPUA 5C6SA 4NL3A 2AHJB 5KCHA 4ELYC 2MMPA 4M77A 3X24B 1VQPT 5KE2A 2QQRA 4N4IA 5FU6C 3BW1A 4C0FA 1VQOT 4A54A 1VQ6A 1I5LA 3CC2A 2Y4XA 2CS7A 3OY9A 3A8MB 2QEXA 2CKKA 4E7LA 1B34A 1VQ9A 5HK3A 1UGSB 3TREA 4A4FA 4IUPA 4UC4A 3V7CA 1N8RC 2E64A 2E6ZA 2H3JA 3M53A 1WQWA 1VIFA 3OB9A 5I2SA 3CCVT 4RCBA 4FIBA 2LNVA 2RJFA 2M9UA 4P5NA 2DZ9A 1M5Q1 3TEEA 4QQ6A 3VYGA 5GAOq 3CCJT 1VQ5A 3OYCA 4ELZC 1YHQA 4FM4B 1XTDA 3C12A 4E7IA 4EMKC 5GAOl 4JS4A 3DB4A 3ASKA 1VQLT 2V8IA 4X9CA 1UB4A 3VKIA 5LJ3j 2GQVA 1KG1A 4XTXA 4M7DB 2FYKA 4E47A 2X4YA 2JOYA 2RK1A 1W2BS 2GFAA 4LDWA 2JNGA 4M78D 2OTLA 5CK9A 1OZ2A 2ZGWA 3MP8A 3OYMA 3CMET 3CPWS 3JSCA 3T9NA 3SB2A 4BUGA 4EMKA 5J39A 4E7KA 1M90C 4ZGDB 2RB6A 1I8FA 3PMTA 1UGRB 3JCMf 4WF2A 1BIAA 2MI6A 2VUBA 4FT4A 1R8OB 2DXUA 4XTUA 5M9OA 3CEYA 5LJ5f 2LQ8A 2E70A 4Y28E 1K9MU 1VQ7A 4M7DG 2RD1A 1O75A 5GAMg 2LC4A 4BY6C 1BKBA 3O8VA 3QZ9B 4M77E 3S3OA 4M77C 2HBPA 2ZPHB 4O6JA 4M77G 2LTOA 2QQAA 3L2UA 3GPLA 2OTLT 5FROA 1N27A 4M75A 3KXTA 4J83A 2R5AA 3OS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 G;  4XU3 A;  3JCM c;  5GAN 5;  3JCM W;  4M75 E;  2K57 A;  2EJG A;  3RER A;  4M7A G;  2HNI A;  4M75 C;  4DQ2 A;  3RIR A;  1M8V A;  4M75 G;  3JCM e;  2VXF A;  4N0A C;  4EMG A;  4XTZ A;  2YHT A;  4J6Y A;  5GAN 8;  4M7A C;  4M7A E;  5DY9 A;  4C8Q D;  3V7R A;  3FB9 A;  4C92 C;  3AHU A;  1YCY A;  3V8J A;  2E65 A;  3QHS A;  1LJO A;  1MGQ A;  1Y96 A;  4M77 F;  5LJ3 d;  4M78 G;  3JCM b;  5LJ5 j;  1KQ2 A;  3L2Z A;  4M78 B;  4M77 B;  4QVD A;  4M77 D;  3JB9 H;  4M7D A;  4M78 C;  5GAM f;  1TH7 A;  5LJ5 d;  4M78 E;  4NL2 A;  5GMK l;  2JN0 A;  4PJO A;  5LJ3 f;  3RKW A;  2VC8 A;  4C8Q E;  3RKY A;  3V7S A;  3L1A A;  4M7A B;  2EAY A;  2Y90 A;  2RM4 A;  2QTX A;  5CAI A;  5GAN 3;  4PJO E;  4J5Y A;  4JRI A;  2E41 A;  4F7U F;  3RUX A;  3HFO A;  4Y91 A;  4RCC A;  1I4K 1;  1D3B B;  4QVC A;  5LJ3 e;  5GAO n;  1Y96 B;  5GMK h;  5GAM j;  2DZC A;  1HK9 A;  1U1S A;  1WNL A;  4MML A;  3JCM X;  5GAN 7;  1JRI A;  4JUV A;  3PGG A;  5GMK i;  5GAN 2;  4C92 D;  4HA8 A;  5GAN g;  4C8Q F;  3QO3 A;  3BFM A;  3JCM J;  4X9D A;  2DTO A;  1BIB A;  4C92 F;  4M7D D;  1LOJ A;  3FIF A;  5GAN 6;  3GIB A;  2E1H A;  3JCM h;  2EJ9 A;  3SWN A;  2VXE A;  4M75 F;  2DVE A;  1KQ1 A;  5GAO m;  3JB9 G;  4PJO D;  4A53 A;  4M78 A;  5GAN d;  4NL3 A;  3SWN C;  4PJO G;  3JCM V;  4F7U E;  3JB9 D;  4M77 A;  5LJ3 g;  1WPY A;  3BW1 A;  4A54 A;  5LJ3 h;  1I5L A;  4M7D F;  3QUI A;  5LJ5 e;  1X01 A;  3BY7 A;  2I2L A;  1H64 1;  4XU2 A;  3V8L A;  4XU0 A;  4M7A A;  1B34 A;  3RKX A;  5LJ5 h;  3M4G A;  1HXD A;  4C92 A;  1N9S A;  4PJO F;  4XU1 A;  4JLI A;  3V8K A;  3V7C A;  1D3B A;  4M7D C;  3JB9 F;  2E64 A;  2EJF A;  1WQW A;  4C92 E;  5GAN f;  3RES A;  4EMH A;  1LNX A;  3FJP A;  4RCB A;  5LJ5 g;  4HT8 A;  5GAO q;  2DZ9 A;  1M5Q 1;  1U1T A;  4J6W A;  3JCM d;  5GMK e;  4PJO C;  2DTH A;  4V2S A;  4PJO B;  4F7U G;  4XQ3 A;  4M75 D;  4EMK C;  5GAO l;  1WQ7 A;  2E10 A;  3EFR A;  4OP0 A;  3JB9 J;  4M7D E;  4X9C A;  4J6X A;  5GMK j;  2EWN A;  5LJ3 j;  4XTX A;  4XTY A;  4C8Q C;  1I81 A;  2DEQ A;  4N0A A;  4M7D B;  2YLB A;  2DTI A;  2FYK A;  5GAM e;  3JCM Q;  5GAO r;  3BDU A;  4C92 B;  4M78 D;  4MMK A;  4C8Q A;  1N9R A;  2ZGW A;  3VU3 C;  3QSU A;  4PNO A;  5GAN e;  4M78 F;  5I21 A;  2FB7 A;  1JBM A;  4M75 B;  3SB2 A;  4C8Q B;  4EMK A;  5GAN h;  2RB6 A;  1I8F A;  3JCM f;  4WF2 A;  1BIA A;  2CGH A;  4NOY A;  3SWN B;  4M7A D;  4XTW A;  2DXU A;  4XTU A;  4EMK B;  1B34 B;  2DXT A;  4F7U B;  5GAN j;  3HSB A;  5LJ5 f;  5GAM d;  5GAM h;  2DJZ A;  4M7A F;  4M7D G;  2RD1 A;  5GMK m;  4F7U A;  5GAM g;  4M77 E;  3INZ A;  4M77 C;  3JB9 I;  2DKG A;  2YLC A;  3EFS A;  5GAN 4;  4C8Q G;  4JRK A;  2RA2 A;  3JCM g;  4M77 G;  5GAO p;  4HT9 A;  4M75 A;  4XTV A;  3HFN A;  3JCM P; 
#chains in the Genus database with same CATH topology
 2CP5 A;  4OB3 B;  3G1J A;  5C0M A;  2DMO A;  1M8V A;  3M0S A;  2JJ9 A;  4X34 A;  1R0B G;  2O4X B;  1LCK A;  2QGF B;  2ENM A;  2JS0 A;  2DM1 A;  1SG5 A;  1MGQ A;  1YFN A;  3M5A A;  1VQ5 T;  2ED0 A;  4J9I A;  2LNH B;  3I56 Q;  3OYI A;  1X2K A;  3M59 A;  1Q95 G;  1QWF A;  3CXC P;  3MEW A;  1OV3 A;  1Q7Y C;  1HYO A;  1PSF A;  1SSH A;  2RQV A;  4MML A;  4RTU A;  1M3B A;  2V1Q A;  3UF4 A;  2E6N A;  3LH5 A;  3CMA Q;  2K4Y A;  5CIU A;  1Q86 C;  1C6V X;  2PVO B;  3NTI A;  2BZX A;  2QA4 A;  4DOW A;  2JS2 A;  3SWN C;  4PJO G;  4OMP A;  3OYL A;  1I5O B;  2CP7 A;  3CCS T;  4ZTF A;  1YJN Q;  1S1N A;  3G4S Q;  3V8L A;  5HY6 A;  1HD3 A;  3RDV A;  2DLP A;  1WFW A;  3V8K A;  5L23 A;  2E12 A;  1KJW A;  3P8D A;  4FU6 A;  1AD5 A;  1WXB A;  4FSS A;  3JB9 J;  2GNC A;  1ABQ A;  1QVG P;  2DEQ A;  3EFO A;  2P84 A;  2WSF E;  4BD3 A;  4NOY A;  3CBP A;  1U8R A;  2KK4 A;  3CCR Q;  3EFS A;  3OBW A;  1M2O A;  2KYM A;  5GAO p;  2PUK B;  2QAS A;  2DL7 A;  3OQ5 A;  1WHJ A;  2KXC A;  4HCK A;  3BY7 A;  2JW4 A;  3CC4 A;  4M75 E;  4BAC A;  1NG2 A;  2AIR B;  3RIR A;  3OYB A;  1K9M R;  4OMM A;  4X1V A;  2DL8 A;  2FHD A;  4KUI A;  3NTH A;  1BI2 A;  1YJW A;  2QEX T;  4CRI A;  3MEV A;  1AZG B;  2E5Q A;  4IUQ A;  2JMC A;  3OYY A;  4LE9 A;  3RMS A;  1Q82 C;  2ZPF B;  1NE8 A;  3RKY A;  2BZ8 A;  2MCN A;  2LT1 A;  5IN1 A;  3HL8 A;  3HFO A;  1QKX A;  1ZUY A;  5CO7 A;  2RJD A;  4FW2 A;  4A63 B;  1SHG A;  1BIB A;  3M57 A;  2ROT A;  5ECA A;  1MMN A;  2OTJ Q;  1KSW A;  5LJ3 h;  1M1F A;  1K0X A;  4Z89 A;  4KT0 E;  1BI3 A;  2IVW A;  1D1C A;  1IRX A;  1YJ9 Q;  4N4H A;  4M4Z A;  2DJQ A;  3RES A;  3LLR A;  3JCM d;  3N5B B;  2P0K A;  1QVF S;  2KBT A;  2V8K A;  3HRU A;  2BKD N;  2GFU A;  2MOX A;  3TVT A;  2EWN A;  4C8Q C;  5IXB A;  1MV3 A;  2AKK A;  4LD6 A;  2XDD A;  1GXI E;  1Q81 R;  3H0I A;  2YDL A;  2QQ9 A;  2HSE B;  5CKF A;  2LQK A;  1IB8 A;  1PHT A;  1Q81 U;  1D0Z A;  3OSV A;  4FYW B;  2B86 A;  3EGX B;  3M0Q A;  1ACM B;  2DXT A;  2DIQ A;  2EGA A;  3TCJ A;  3OYA A;  3GF5 A;  3M56 A;  3JAM E;  2PVD B;  1W70 A;  1C0M A;  3EFO B;  2WAC A;  2DO3 A;  3EH2 A;  5CKB A;  3CCR T;  2VKN A;  4GLM A;  4HT9 A;  1O9S A;  2EPD A;  4XTV A;  5FRN A;  5A2Q E;  3HRS A;  5KCO A;  2F1L A;  4AG1 C;  4JJN K;  1WXU A;  3CCU T;  2EKO A;  1VIE A;  2HZY A;  3RMQ A;  3DLL A;  2PVG B;  2F5T X;  2J7I A;  4QVD A;  4M77 D;  2FPF A;  2IIM A;  2EYX A;  1LPL A;  2NYS A;  4R0K A;  3OYD A;  2EKH A;  2NUT A;  1PD0 A;  4J5Y A;  1T0J A;  2JZ2 A;  4C5E A;  5GAN 2;  1OU8 A;  4RTZ A;  1VQM A;  4X9D A;  3QBY A;  3H41 A;  3GIB A;  2QK0 A;  2P0P A;  3PNW C;  1YI2 A;  4L6V 5;  1QVF A;  2ESW A;  1BI1 A;  4M7D F;  4A4H A;  2KRM A;  1K4U S;  1RUW A;  3SDZ A;  4CI0 C;  3UT1 A;  3PE0 A;  1XQH A;  1AWJ A;  4ORZ A;  3A8L B;  4DA4 A;  4C92 E;  1VQ5 Q;  4HT8 A;  1AVZ C;  1RAB B;  3CCM T;  1VQK T;  3S3M A;  3CCQ Q;  4OP0 A;  1TU0 B;  3CC4 T;  1PWT A;  2DTI A;  2OTL Q;  1WI7 A;  1I07 A;  1TXQ A;  1YIT A;  3QYH B;  1AZE A;  2G6F X;  1D1A A;  3HSB A;  2X3X D;  3CMA T;  5LL6 S;  4EIK A;  4F7U A;  2RHI A;  3INZ A;  2K79 A;  1YN8 A;  5GAN 4;  3OYN A;  2C0T A;  2DXB A;  3MP1 A;  2CT3 A;  1AWW A;  3HFN A;  2HMA A;  3JCM P;  3ULR B;  1RL2 A;  1WYX A;  4EMG A;  2BE7 D;  1TTH B;  3AHU A;  1ZA2 B;  4RKU E;  5IXF A;  5LJ3 d;  1GFD A;  3RR6 A;  3OA6 A;  4NS5 A;  4AFS C;  5GMK l;  1JU5 C;  2D1X A;  3GLX A;  2O31 A;  4J9F A;  5FW9 A;  3OYG A;  2HCK A;  3X28 B;  2MK5 A;  2FRY A;  2CP2 A;  1D3B B;  5IHK A;  1UGQ B;  2W0Z A;  2GF7 A;  1NYF A;  1QCN A;  1JRI A;  4ZNX A;  1KHC A;  2COW A;  4D6W A;  2QGG A;  3I55 Q;  4LUD A;  3CCE A;  1SEM A;  3BFM A;  5FU7 B;  5IAY A;  3CD6 Q;  4M7D D;  4Y92 A;  1NLP C;  2DYI A;  2K5L A;  2J6F A;  3FRN A;  2M51 A;  4KUD K;  3LGL A;  1NZ9 A;  4J8O A;  3UPU A;  2J05 A;  3EG9 B;  1VQP T;  5KE2 A;  4N4I A;  4C0F A;  3BW1 A;  4A54 A;  3M0R A;  3A8M B;  1B34 A;  2L2P A;  1VQ9 A;  1TSF A;  1UGS B;  2EVR A;  4A4F A;  1AWX A;  2P4R A;  1N8R C;  3M53 A;  2H3J A;  1VIF A;  3OB9 A;  2RJF A;  1VQ5 A;  1XTD A;  4E7I A;  2ATC B;  4JS4 A;  3VS1 A;  1VQL T;  3TSW A;  3VKI A;  4ESR A;  2X4Y A;  2JOY A;  1I1J A;  2D8H A;  2YXY A;  2E5K A;  4AFU C;  3FJ5 A;  4CC7 A;  3T9N A;  2KR3 A;  4EMK A;  5J39 A;  4E7K A;  4ZGD B;  3PMT A;  3CME Q;  2F2X A;  1G83 A;  4XTU A;  1WHG A;  5M9O A;  1RLP C;  4M7D G;  2RD1 A;  4LUE A;  1BKB A;  4M77 E;  1BU1 A;  2HBP A;  2E3I A;  2LJ3 A;  2ZPH B;  1IO6 A;  3GPL A;  2OTL T;  5FRO A;  1Q86 R;  2QTV A;  2MYS A;  3P8H A;  3JCM c;  2KI7 A;  3JCM e;  1C1A A;  4XTZ A;  2YHT A;  3VS3 A;  1CSK A;  5GAN 8;  1K9M C;  4M7A C;  3LX7 A;  5DY9 A;  2XG8 D;  1X6G A;  2PNI A;  5LJ5 j;  3JB9 H;  4LD9 K;  1W4S A;  1W2B P;  2K9G A;  4PJO A;  1N5Z A;  2PTK A;  3OS5 A;  1M27 C;  4JZ3 A;  1QP2 A;  3I9Q A;  5GAM j;  1WNL A;  1RAG B;  2DF6 A;  1ZHI A;  1K8A U;  1MNE A;  3VV0 A;  2D8J A;  2HSP A;  2SEM A;  1MMG A;  3HTR A;  1VQM T;  5GAN 6;  2E1H A;  2GCX A;  1YIT Q;  2EBP A;  5HCK A;  4A53 A;  4MDX A;  2J6K A;  1B3Q A;  2FL7 A;  3GNF B;  3CBM A;  2D0N A;  4M7A A;  1ZA1 B;  2RH2 A;  2DD4 A;  3MET A;  3JB9 F;  4JJC A;  1N8R U;  3FJP A;  1VYU A;  2L3P A;  2QDY B;  3G71 A;  1EX4 A;  1QMC A;  5GMK e;  3VS7 A;  3CCU Q;  3CCU A;  2AZS A;  4PJO B;  9ATC B;  3CQT A;  5KYW A;  1ZQ1 A;  4KGZ B;  4XTY A;  4ME7 A;  2ZZD A;  1EZZ B;  2MF2 A;  3FC3 A;  2XK0 A;  7AT1 B;  3S3N A;  2D6F A;  1WHK A;  4D8K A;  2M1H A;  1VQ4 A;  5GAN h;  2KMT A;  3A5Z B;  3BE3 A;  3SWN B;  4IUR A;  4OGE A;  1OQK A;  3C0C A;  1YNZ A;  2CUD A;  1WHH A;  2KYB A;  4J7I A;  1KD1 C;  4E7H A;  2HEQ A;  1NBE B;  1JO8 A;  3AT1 B;  3VS0 A;  5FWC A;  2FZK B;  4M7A G;  2DNU A;  4M75 C;  3QG1 A;  1NM7 A;  4M75 G;  1QWE A;  4HXJ A;  2NUT B;  3CCJ A;  3G71 T;  4ZGE B;  4M78 G;  1UFF A;  3IQL A;  2QEX Q;  2JM9 A;  4CC4 B;  4ZGJ B;  4KBM B;  2JMA A;  2A28 A;  3REA B;  2DER A;  3L1A A;  4QQG A;  3J7A F;  2K2V A;  8AT1 B;  1GBR A;  4CC2 A;  3GP8 A;  5EG2 A;  1NYG A;  1BK2 A;  1G8X A;  4OMO A;  3CCE Q;  2KY9 A;  3I55 A;  2CSQ A;  2L3R A;  2A08 A;  3ZEH A;  3MCA B;  3PMI A;  2EYW A;  1QVP A;  1KFZ A;  3SEM A;  1SSF A;  2KRO A;  5CKE A;  2DK3 A;  3OS0 A;  1X01 A;  3O5Z A;  4BDZ A;  2HQH A;  2EQI A;  2RQU A;  4AFZ C;  4C0Z A;  3LGF A;  1AT1 B;  1IGU A;  1D3B A;  1UJY A;  2QG9 B;  2LZ6 B;  2L8D A;  1AEY A;  3G71 Q;  4FSX A;  1YJW T;  2E3H A;  4V2S A;  2EIF A;  1GRI A;  4QT7 A;  2MWO A;  2JTM A;  2RK2 A;  1TUC A;  1G3Y A;  5FWB A;  1OEB A;  3VU3 C;  4JJB A;  1SHF A;  1VOM A;  2QA4 Q;  4EPC A;  1JEG A;  1JBM A;  4M75 B;  3URG A;  1UE9 A;  4DBH A;  1PD1 A;  4JS5 A;  4JJD A;  4MZT A;  2QDL A;  2DIG A;  5HK0 A;  4JRQ A;  1JJ2 P;  4J9B A;  1RAD B;  1V1C A;  2V1R A;  4C8Q G;  2VV5 A;  3VS5 A;  5AYF A;  4F04 B;  2KEA A;  2YUN A;  2HNI A;  3E19 A;  2KSS A;  4F14 A;  3NMZ C;  3V7R A;  3CC7 A;  1VQ8 A;  1YCY A;  2XHC A;  2HQE A;  4M77 F;  3PIO A;  4OMN A;  4M78 C;  2CH4 W;  3QKJ A;  1RAI B;  2CZ7 B;  1YJ9 A;  3CCS A;  1FWZ A;  4DBQ A;  2E41 A;  5GJW B;  1KQS S;  2RHY A;  2FPE A;  5LJ3 e;  4QVC A;  3R6N A;  5GAO n;  5GAN 7;  1BYM A;  1WXT A;  1SRL A;  3NGP A;  4OGC A;  2RI3 A;  2EYY A;  1VQM Q;  2DFU A;  2DTO A;  4C92 F;  1W1F A;  5A0L A;  3CXC A;  3JB9 G;  4PK4 A;  4QKU A;  2WSE E;  2I0N A;  4J9G A;  2CUB A;  2RJE A;  3LW5 E;  3QJ6 A;  1MUZ A;  3I5R A;  1G3S A;  2YRD A;  3WVE B;  4Z88 A;  1VQ6 Q;  1EFN A;  1P92 A;  4DOV A;  3H8Z A;  1RI0 A;  3ME9 A;  1OX9 A;  1YIJ A;  1HXD A;  1PC0 A;  3WVD B;  2OAU A;  2M0Y A;  4ZN3 A;  1VQ8 T;  3CC7 T;  4XQ3 A;  2JVV A;  1BI0 A;  2DXC A;  3VUZ A;  5GMK j;  1K73 C;  1MHN A;  2X4X A;  2ZAE A;  1T0H A;  1TG0 A;  2A0F B;  2OI3 A;  2RI5 A;  2LQN A;  1M4Z A;  5I21 A;  1WLP B;  3MHX A;  2KT1 A;  1VQ4 T;  3E2U A;  4F7U B;  5IHI A;  4YTL A;  4C0G A;  1GFC A;  5D7U A;  3JB9 I;  2DKG A;  2XID A;  2JTF A;  4QVZ A;  2HD0 A;  5IT9 E;  5KYU B;  2K6D A;  1TOV A;  4N0A C;  4JDS A;  1VQK A;  3LH0 A;  3OYE A;  2DET A;  4JPB W;  3L2Q A;  3V8J A;  4WTO B;  5CVI A;  1LVK A;  1Y71 A;  2RI2 A;  2X35 A;  4C5I A;  1PM3 A;  1U06 A;  2H8H A;  1TH7 A;  2L5Q A;  4RTX A;  4PL6 A;  4FT2 A;  4LDU A;  1YI2 Q;  1YBY A;  2XKO C;  2QI2 A;  4C8Q E;  2OTJ A;  3CC2 T;  2RM4 A;  2QTX A;  5CAI A;  2CP3 A;  2FEI A;  4EDU A;  3EAE A;  1V29 B;  2YRC A;  2L0A A;  3OYF A;  3KBG A;  5J3B A;  2QAZ A;  4PJN A;  3A8O B;  3QO3 A;  1Z9Z A;  4KUL A;  3FIF A;  3I55 T;  4BI3 A;  3JCM h;  4F17 A;  1PNJ A;  4LNP A;  1M1K R;  1QCF A;  2E4H A;  2AHJ B;  5KCH A;  4F16 A;  3A98 A;  1VQ6 A;  1UHF A;  1I5L A;  2Y4X A;  3OY9 A;  2LCS A;  1ZSZ A;  2QEX A;  2CKK A;  2KXD A;  4E7L A;  3TRE A;  3V7C A;  5AT1 B;  1WQW A;  5I2S A;  1I0C A;  4FIB A;  3VYG A;  3CCJ T;  2EGE A;  2MPX C;  3MKD A;  5KYX A;  3EG0 A;  2BZY A;  1YP5 A;  2SRC A;  1BCO A;  2ED1 A;  2LJ1 A;  3VRZ A;  4PFP A;  1KG1 A;  2DIL A;  2FYK A;  4E47 A;  4PJM A;  1Y57 A;  2K7A A;  5CK9 A;  3CPW S;  2YUO A;  3EG2 A;  1QVF P;  1M90 C;  2RB6 A;  1K9M U;  1MND A;  1O75 A;  2LC4 A;  3EGD B;  4BY6 C;  3QZ9 B;  3S3O A;  4M77 C;  2GTO A;  1VQL Q;  4O6J A;  3H0F A;  1E6H A;  2O9S A;  4J83 A;  1QCO A;  4C92 G;  2LRQ A;  2DYB A;  3R6O A;  4DQ2 A;  5KYY B;  4ANJ A;  1K73 U;  2KDS A;  3CCL Q;  4M7A E;  4C8Q D;  3M0P A;  1X69 A;  2K2M A;  1PCX A;  3OYK A;  3EG9 A;  3CPW P;  3G4S A;  2B8A A;  2ZCF B;  4AMC A;  1K76 A;  4OB0 B;  1UDL A;  2YUQ A;  1VQO A;  3LWH A;  4JRI A;  4BB7 A;  1Y96 B;  3MO8 A;  1U1S A;  4MZP A;  3HP9 A;  3EGD A;  3JCM J;  1H3Z A;  3CD6 A;  4K11 A;  2ECZ A;  2EJ9 A;  5I11 A;  3OS1 A;  1H8K A;  2M16 A;  1SF9 A;  4M78 A;  1VQN Q;  2NLU A;  1VQ8 Q;  3JB9 D;  3CC7 Q;  5KYY A;  1WPY A;  5EC7 A;  2O2O A;  2FRW A;  1VQ9 Q;  3NTK A;  4XU1 A;  2DPP B;  5GAN f;  2EQM A;  1LNX A;  1TS9 A;  1U1T A;  1PRM C;  4TVR A;  4PJO C;  4M75 D;  3DB3 A;  3EFR A;  3JV3 A;  1PKS A;  5L8R E;  1Q7Y U;  1G3W A;  4OMF B;  3JCM Q;  3I5S A;  2QQS A;  1Q7Y R;  1YJN A;  1T3S A;  4JLG A;  2KVQ G;  2LCC A;  5D6W A;  5GAN e;  1VQ4 Q;  2H3E B;  4C8Q B;  4GY5 A;  5I2M A;  1WIE A;  1UGP B;  3CME A;  4J7F A;  4XTW A;  1PKT A;  2DJZ A;  5GMK m;  4KH1 B;  4Z02 A;  2HBW A;  2DL3 A;  2CZ0 B;  2RA2 A;  2M02 A;  4PJJ A;  3CCM A;  3PVL A;  5CCA A;  3NFC A;  1ZBX A;  2FVU A;  3CCQ A;  3EG1 A;  1NJI U;  2RQR A;  2ZPI B;  5IHN A;  3RNJ A;  2E65 A;  3QHS A;  1X6O A;  2RNA A;  4M7D A;  4B9X A;  4OF1 A;  4II1 A;  2W10 A;  4AT1 B;  2JN0 A;  4PLI A;  3DKM A;  2QYZ A;  1Q82 U;  1N6A A;  3V7S A;  4M7A B;  4GBQ A;  3CCS Q;  1QP3 A;  4PJO E;  1UTI A;  2X4W A;  1X27 A;  4F7U F;  4E2F B;  1VQP A;  4Y91 A;  1NPR A;  2DL4 A;  3MEA A;  4RCC A;  1Q82 R;  1OOT A;  2X4J A;  2QA4 T;  3QII A;  1KK7 A;  1ZBJ A;  4B6M A;  4IUU A;  1VYV A;  2MAM A;  1OI1 A;  1RAE B;  3CCE T;  1K0S A;  2VGM A;  4M75 F;  3UWN A;  2DVE A;  2NWM A;  3UDC A;  2HKN A;  1RLQ C;  2DRK A;  1EIF A;  3M0T A;  3C95 A;  1H64 1;  4XU0 A;  1F1B B;  3X20 B;  3RKX A;  5LJ5 h;  1MMA A;  3NHN A;  2LJ0 A;  2G3R A;  2KE9 A;  4ZTJ A;  3PIP A;  1UJ0 A;  1IRE B;  1KD1 U;  5LJ5 g;  4C5H A;  4HCB A;  4GLK A;  1KQS P;  1QVG S;  8ATC B;  2K5F A;  5DM7 R;  3M58 A;  2CDT A;  2F2V A;  4MZM A;  2K5I A;  1GCQ A;  4C92 B;  4MMK A;  2P4T A;  1MMD A;  5D6X A;  4FYY B;  2K3X A;  4R55 A;  2FB7 A;  2NUZ A;  1YCS B;  4M7A D;  2GBQ A;  5GAM d;  4XAX B;  3FDR A;  3BDL A;  4XK8 E;  1NJI R;  1CKB A;  2EGC A;  3C94 A;  1YIT T;  2OX7 A;  1AOJ A;  4RTV A;  2AKL A;  1D1B A;  5KYW B;  1VUB A;  1BCM A;  4WCI A;  1IZ6 A;  4BDY A;  2JTE A;  3JCM W;  1ZUK A;  1B07 A;  1Y96 A;  3VS2 A;  1JB0 E;  2ROL A;  2YRV A;  1E6G A;  2XDB A;  3QDR B;  4M78 E;  3OMG A;  4NL2 A;  3HHT B;  2AZV A;  1IHV A;  4HCZ A;  3M4Y A;  1IGQ A;  4BE2 A;  1VQO Q;  1YHQ Q;  4OVA A;  2HL5 C;  3E1S A;  3JCM X;  2MIO A;  1WHL A;  1S72 A;  4HA8 A;  2KRN A;  3G6E A;  3CCJ Q;  2PZ1 A;  4KGX B;  1Y0M A;  4JZ4 A;  2DL5 A;  5J26 A;  2V8J A;  3EGU A;  2VXE A;  4HVV A;  3ER0 A;  3PT9 A;  2PU9 B;  5GAN d;  2F5K A;  3M0U A;  4A4G A;  3CPW A;  3QUI A;  5D6Y A;  6AT1 B;  1N9S A;  1H3H A;  3A1P A;  1M3A A;  2BUD A;  2EJF A;  4R56 A;  1PRL C;  2RPN A;  1NJI C;  4L5G A;  2DTH A;  3L42 A;  4F7U G;  5KYN A;  3LWI A;  2CYZ B;  2E10 A;  3MEU A;  3CCQ T;  4ATO A;  4HVW A;  2LVM A;  2DX1 A;  1GL5 A;  3M54 A;  5GAM e;  1Y07 A;  3VS4 A;  5GAO r;  3CC2 Q;  4J9C A;  3VJP A;  3H6Z A;  4HCC A;  4C8Q A;  2XDP A;  2FG0 A;  1X43 A;  2QQB A;  1M2V A;  1PG5 B;  4DBF A;  3CCL T;  3RBB B;  1VA7 A;  2KGT A;  1Q86 U;  1WJS A;  1VQ7 T;  2CGH A;  1K9A A;  5DLO A;  5GAM h;  4M7A F;  2VWF A;  1H92 A;  2RHZ A;  4N4G A;  2CP6 A;  2YLC A;  4J9H A;  2J06 A;  1D0Y A;  4LN2 A;  4XU3 A;  3UA6 A;  5GAN 5;  2EJG A;  1M9S A;  1PSE A;  3E9G A;  2RMO A;  1G5V A;  5CQY A;  1ZSZ C;  1QQJ A;  1VQ9 T;  1YIJ T;  2CP0 A;  4OML A;  5FRM A;  4BI8 B;  4IUV A;  4L59 A;  3CCV Q;  4M78 B;  1FYN A;  3VYH B;  1VQN T;  2YUP A;  2NUP B;  2LCL A;  1OYX A;  3OW2 A;  2KNB B;  1KC8 R;  2EAY A;  2KT8 A;  4FCY A;  3RUX A;  3H9N A;  3C4S A;  2VGN A;  4JUV A;  3CPF A;  4C92 D;  2R58 A;  5GAN g;  4IIM A;  2CT4 A;  2EQU A;  2VB6 A;  2VVK A;  2ZPE B;  1VQK Q;  1ZSZ B;  5C6S A;  4ELY C;  2MMP A;  3VS6 A;  1ZUU A;  2QQR A;  4KGV B;  5FU6 C;  1VQO T;  2FZC B;  2YT6 A;  1X2Q A;  5HK3 A;  4IUP A;  4UC4 A;  2RQW A;  2E64 A;  2E6Z A;  3CCV T;  1K1Z A;  2GQI A;  4RCB A;  4P5N A;  2M9U A;  3TEE A;  2DZ9 A;  5GAO q;  4QQ6 A;  1YHQ A;  2JT4 A;  2GQV A;  4XTX A;  4M7D B;  2J6O A;  4FW1 A;  2LX7 A;  4FYV B;  4M78 D;  1E7O A;  1OZ2 A;  2ZGW A;  3OYM A;  2HDA A;  2OJ2 A;  3SB2 A;  4BUG A;  1UGR B;  4FT4 A;  1R8O B;  2DXU A;  3CEY A;  5LJ5 f;  4Y28 E;  1VQ7 Q;  1VQ7 A;  5GAM g;  4RTY A;  3EGX A;  3O8V A;  1M8M A;  3TSZ A;  4M77 G;  2LTO A;  2QQA A;  3L2U A;  3CCM Q;  1N27 A;  4M75 A;  2R5A A;  3OS2 A;  1ABO A;  2A36 A;  2DD5 A;  1G2B A;  3RER A;  1QW1 A;  4DEY A;  2VXF A;  2IG0 A;  4J6Y A;  1FMK A;  2PQW A;  1WA7 A;  1GCQ C;  2CZ1 B;  1WJR A;  3G7Z A;  1UEB A;  3JCM b;  1KQ2 A;  4M77 B;  3WXM B;  2O4X A;  5HKC A;  3THK A;  1B7T A;  5LJ5 d;  1YI2 T;  3JRZ A;  2JXB A;  4LDY A;  1FMV A;  1UEC A;  2VC8 A;  1R77 A;  4J9E A;  2D9T A;  1D0X A;  2YSQ A;  1I4K 1;  4A4K A;  4E7S A;  3L2W A;  4DBR A;  3KUF A;  4OMQ A;  3A8G B;  1YWO A;  1JJ2 A;  1LOJ A;  3U23 A;  3G6E T;  2NUP A;  1QVG A;  4HVU A;  1GCP A;  1KQ1 A;  5GAO m;  5FLX E;  1TUD A;  4VUB A;  3JCM V;  2COZ A;  3GNG A;  5LJ3 g;  3KFV A;  2OTJ T;  1IHW A;  4PKC C;  4C0D C;  3EHR A;  3OYJ A;  1WGS A;  1KC8 C;  2LT4 A;  1RAC B;  1WDX A;  3M4G A;  2EQJ A;  1W2B A;  4JLI A;  1M1K U;  2IPO B;  3EH1 A;  3CXC S;  2COY A;  4PFO A;  1OPL A;  2F2W A;  1V76 A;  3QYG B;  2JM8 A;  3CCR A;  5DLQ E;  1WQ7 A;  4M7D E;  2L89 A;  4N0A A;  1QKW A;  2YLB A;  2HAX A;  1QLY A;  2D0Q B;  2RO0 A;  1N9R A;  2OAW A;  4C0D B;  2RN8 A;  4MDW A;  3TQ7 P;  1A0N B;  2MWP A;  2RHX A;  3QWY A;  4ZN1 A;  1YJW Q;  1T3L A;  2LDM A;  1YIJ Q;  1K73 R;  2M0O A;  2GTJ A;  4HKE A;  1NLO C;  2RHU A;  3QPH A;  4QW2 A;  3SHW A;  1OUL A;  1YHQ T;  5IH2 A;  3LYI A;  3EHQ A;  4RMO A;  2K57 A;  1NPP A;  1U5S A;  2ZPG B;  4PJL A;  1S72 Q;  4B9W A;  3FB9 A;  4C92 C;  1LJO A;  4IIO A;  1KC8 U;  2FO0 A;  2C06 A;  3SD4 A;  5GJV B;  5KYU A;  4LXC A;  3OBY A;  4Q5W A;  2PUO B;  2O88 A;  1TWB A;  5GMK h;  3CBO A;  1HK9 A;  1FMW A;  4PLL A;  5GMK i;  1HSQ A;  2YWW A;  4C8Q F;  1UHC A;  3OSS C;  1W6X A;  4OB2 B;  3ZBD A;  4JRP A;  1TUG B;  1WJQ A;  2R57 A;  1VQN A;  2FZG B;  2BIV A;  3I35 A;  3OYH A;  2BTT A;  4BI4 A;  2I2L A;  1RAF B;  3M55 A;  1YJ9 T;  2DVJ A;  2A37 A;  4C92 A;  4PJO F;  1OZ3 A;  2XI9 A;  2LX9 A;  4PFZ A;  4M7D C;  1M1K C;  2ABL A;  4EMH A;  4J6W A;  4QQD A;  4A4E A;  1AWO A;  1IXD A;  2RJC A;  2DAQ A;  4KH0 B;  2VAS A;  1AHJ B;  1I81 A;  2HKQ B;  1WZO A;  3F70 A;  1WHM A;  4RUG A;  3ZFJ A;  3QSU A;  1WX6 A;  2DA9 A;  3PFS A;  5CQX A;  2P0Q A;  2HQX A;  3I56 A;  3VRY A;  3HPW A;  1JXM A;  3MP6 A;  4J9D A;  3CCL A;  4DEX A;  3J81 E;  5GAN j;  1Y7X A;  1M1G A;  3GBQ A;  3HRT A;  2DBK A;  2CRE A;  3A8H B;  3QWX X;  4JRK A;  1VQL A;  3JCM g;  1YJN T;  1D09 B;  1XJW B;  4RTT A;  2WSC E;  2F69 A;  1Q81 C;  1KIK A;  1ARK A;  3VUB A;  2A3L A;  3P8B B;  2R5M A;  1NEB A;  1OX8 A;  2LP5 A;  3CCV A;  5GAM f;  2XD0 A;  3QZ5 B;  2RQT A;  1RI9 A;  3X25 B;  3DLM A;  2DE0 X;  2QXF A;  5GAN 3;  3NPF A;  3SFM A;  1G3T A;  1KHI A;  3FEO A;  3UA7 A;  2X9H A;  4AG2 C;  2Z0W A;  1ZX6 A;  1S72 T;  2EW3 A;  2JUF A;  3G6E Q;  2XU8 A;  2EQK A;  3CD6 T;  4RG8 A;  1SRM A;  2DEU A;  4BE0 A;  2BE9 B;  4PJO D;  5CKH A;  4F7U E;  1GBQ A;  1RAA B;  1OPK A;  1VQP Q;  2LMJ A;  5LJ5 e;  4XU2 A;  1UUE A;  4O5V A;  4IUT A;  3G4S T;  3TU4 K;  1KQS A;  4CC3 A;  1SPK A;  4BY6 B;  2DBM A;  2XIC A;  3OW2 S;  3J80 E;  2V26 A;  3PTA A;  4LDV A;  1N8R R;  1JJ2 S;  3D7S B;  1NEG A;  3M9Q A;  3L2R A;  3E9F A;  2KAF A;  2KQW A;  4J6X A;  2X51 A;  2Y4Y A;  3BDU A;  1JQQ A;  3CMA A;  4E6R A;  1KD1 R;  4PNO A;  4M78 F;  3GOX A;  2RF0 A;  2X3W D;  3OMC A;  1M30 A;  4E7J A;  4EMK B;  1B34 B;  4FYX B;  5CKD A;  1M3C A;  1K8A C;  2CZ6 B;  2A7Y A;  2KRS A;  5I22 A;  5KH6 A;  1CKA A;  1XNI A;  3QJY A;  1FX7 A;  2C0I A;  3I56 T;  2CSI A;  3REB B;  1ZSG A;  2K3Y A;  1M2V B;  1BB9 A;  4RG2 A;  2ZPB B;  5KE3 A;  2VYT A;  3CC4 Q;  1VYT A;  3HKS A;  5A0D A;  5A0G A;  4BE1 A;  3FLG A;  4D8D A;  1X75 C;  5CR2 A;  3UAT A;  3L2Z A;  3X26 B;  2DRM A;  1FXX A;  4C5G A;  5FU7 C;  3S6W A;  2EYQ A;  1DJ7 B;  2K3B A;  1M90 R;  5LJ3 f;  3QXE B;  4LDX A;  3RKW A;  2Y90 A;  1SKU B;  1VQ6 T;  1M90 U;  1BBZ A;  3L2V A;  4FL6 A;  2DZC A;  1U3O A;  2O01 E;  1X6B A;  3PGG A;  4IKF A;  3H0H A;  3Q1J A;  2AK5 A;  2EFI A;  1XOV A;  5FU6 B;  2GGR A;  3PVQ A;  3SWN A;  1J3T A;  1UG1 A;  2FPD A;  3OW2 P;  4NL3 A;  1R0C B;  4M77 A;  3X24 B;  1K8A R;  2XMF A;  3CC2 A;  2CS7 A;  2EYZ A;  2O9V A;  3QDF A;  3ZL7 C;  2L3S A;  2C0O A;  4Z8A A;  2LNV A;  2LQW A;  1M5Q 1;  3MPU B;  3OYC A;  4ELZ C;  2L3Q A;  4FM4 B;  4E7Z A;  3C12 A;  4EMK C;  1OU9 A;  1ZLM A;  3DB4 A;  5GAO l;  3ASK A;  2AT1 B;  2V8I A;  4X9C A;  1UB4 A;  5LJ3 j;  2RK1 A;  1W2B S;  2GFA A;  4LDW A;  2CH4 A;  2JNG A;  2OTL A;  3MP8 A;  3EG3 A;  3CME T;  3JSC A;  1I8F A;  1RAH B;  3JCM f;  4WF2 A;  1BIA A;  2MI6 A;  2VUB A;  1YWP A;  2LQ8 A;  2E70 A;  3MJX A;  1MV0 B;  1UGV A;  1Z9Q A;  1JXO A;  1HJD A;  5KYX B;  2HL3 A;  4RTW A;  3KXT A;  4OB1 B;  4AFQ C;  4KRT A; 
#chains in the Genus database with same CATH homology
 3P8H A;  4C92 G;  2LRQ A;  4OB3 B;  3JCM c;  2DD5 A;  5C0M A;  3RER A;  3R6O A;  4DQ2 A;  1QW1 A;  1M8V A;  3JCM e;  2VXF A;  2IG0 A;  4XTZ A;  2YHT A;  4J6Y A;  4X34 A;  5GAN 8;  1K9M C;  4M7A C;  2O4X B;  1K73 U;  2KDS A;  2PQW A;  4M7A E;  3LX7 A;  5DY9 A;  4C8Q D;  2XG8 D;  2CZ1 B;  1WJR A;  3G7Z A;  3M5A A;  1VQ5 T;  1MGQ A;  1UEB A;  3JCM b;  5LJ5 j;  3OYK A;  1KQ2 A;  4M77 B;  3WXM B;  3JB9 H;  2O4X A;  5HKC A;  4LD9 K;  1W4S A;  3G4S A;  5LJ5 d;  2B8A A;  2ZCF B;  3OYI A;  1YI2 T;  3JRZ A;  4LDY A;  4PJO A;  3M59 A;  2VC8 A;  4OB0 B;  3MEW A;  2D9T A;  1Q7Y C;  1VQO A;  3LWH A;  3OS5 A;  4JRI A;  1I4K 1;  1QP2 A;  4BB7 A;  1PSF A;  4A4K A;  3L2W A;  1Y96 B;  3MO8 A;  5GAM j;  1WNL A;  1U1S A;  3KUF A;  4MML A;  3A8G B;  4MZP A;  1ZHI A;  1K8A U;  3HP9 A;  3VV0 A;  3JCM J;  2E6N A;  1H3Z A;  3CD6 A;  1JJ2 A;  1LOJ A;  2K4Y A;  5CIU A;  3G6E T;  5GAN 6;  1VQM T;  2E1H A;  1Q86 C;  1QVG A;  2EJ9 A;  2GCX A;  1KQ1 A;  2PVO B;  3NTI A;  5FLX E;  5GAO m;  3OS1 A;  2QA4 A;  4A53 A;  2M16 A;  4M78 A;  4MDX A;  4DOW A;  3SWN C;  4PJO G;  4VUB A;  3JCM V;  2NLU A;  3JB9 D;  3GNG A;  1WPY A;  5LJ3 g;  2FL7 A;  3OYL A;  3CCS T;  3GNF B;  2OTJ T;  3CBM A;  4ZTF A;  4PKC C;  4C0D C;  3OYJ A;  1WGS A;  1KC8 C;  2LT4 A;  3V8L A;  4M7A A;  5HY6 A;  3M4G A;  2EQJ A;  2RH2 A;  3NTK A;  1W2B A;  2DD4 A;  4XU1 A;  4JLI A;  3V8K A;  3MET A;  1M1K U;  3JB9 F;  2DPP B;  2E12 A;  1N8R U;  5GAN f;  2EQM A;  1LNX A;  3FJP A;  3G71 A;  2QDY B;  3CXC S;  1U1T A;  3P8D A;  4FU6 A;  5GMK e;  4TVR A;  3CCU A;  4PJO C;  4PJO B;  3QYG B;  4M75 D;  3CCR A;  5DLQ E;  1WQ7 A;  3DB3 A;  3EFR A;  3JB9 J;  4M7D E;  1Q7Y U;  5L8R E;  2L89 A;  1ZQ1 A;  1G3W A;  4XTY A;  4ME7 A;  2DEQ A;  4N0A A;  2ZZD A;  2YLB A;  4OMF B;  3JCM Q;  2HAX A;  2D0Q B;  2MF2 A;  2RO0 A;  2QQS A;  2XK0 A;  3FC3 A;  3S3N A;  2D6F A;  1YJN A;  4JLG A;  1N9R A;  2KVQ G;  2LCC A;  4C0D B;  2M1H A;  5D6W A;  5GAN e;  1VQ4 A;  4MDW A;  2WSF E;  4C8Q B;  4BD3 A;  4GY5 A;  5GAN h;  5I2M A;  2KMT A;  3A5Z B;  2MWP A;  3L2R A;  1UGP B;  2RHX A;  4J7F A;  4IUR A;  4NOY A;  3SWN B;  4XTW A;  4ZN1 A;  3CME A;  3CBP A;  4OGE A;  2DJZ A;  1U8R A;  2KK4 A;  2LDM A;  5GMK m;  4Z02 A;  2M0O A;  3EFS A;  3OBW A;  4HKE A;  2RHU A;  3QPH A;  2CZ0 B;  2RA2 A;  5GAO p;  2PUK B;  4J7I A;  3CCM A;  1KD1 C;  4QW2 A;  5CCA A;  3OQ5 A;  3NFC A;  4E7H A;  1YHQ T;  3BY7 A;  3LYI A;  1ZBX A;  4RMO A;  3CC4 A;  2FVU A;  2K57 A;  1NPP A;  4M75 E;  4M7A G;  4M75 C;  4BAC A;  3RIR A;  3QG1 A;  3OYB A;  4M75 G;  3CCQ A;  1NJI U;  2ZPI B;  2FHD A;  2ZPG B;  4KUI A;  3NTH A;  4B9W A;  1BI2 A;  3FB9 A;  4C92 C;  1YJW A;  2E65 A;  3QHS A;  1LJO A;  1X6O A;  3G71 T;  2QEX T;  4ZGE B;  3CCJ A;  4M78 G;  4CRI A;  3MEV A;  4M7D A;  2E5Q A;  4IUQ A;  4ZGJ B;  1KC8 U;  3OYY A;  4B9X A;  4KBM B;  4OF1 A;  2C06 A;  4II1 A;  3SD4 A;  2JN0 A;  4PLI A;  3RMS A;  3DKM A;  1Q82 C;  2ZPF B;  1NE8 A;  1Q82 U;  1N6A A;  3RKY A;  3V7S A;  3CCQ T;  3L1A A;  4M7A B;  4QQG A;  1QP3 A;  3J7A F;  4PJO E;  2X4W A;  3OBY A;  4Q5W A;  4F7U F;  2LT1 A;  2PUO B;  5IN1 A;  3HL8 A;  3HFO A;  1NPR A;  3MEA A;  4RCC A;  2K2V A;  4Y91 A;  1VQP A;  5CO7 A;  5GMK h;  3CBO A;  2RJD A;  2X4J A;  1HK9 A;  2QA4 T;  3QII A;  3GP8 A;  5EG2 A;  4IUU A;  4PLL A;  5GMK i;  4C8Q F;  2KY9 A;  3I55 A;  2MAM A;  3OSS C;  3M57 A;  1BIB A;  1OI1 A;  4OB2 B;  3ZBD A;  3CCE T;  2L3R A;  3ZEH A;  2VGM A;  3MCA B;  4M75 F;  2DVE A;  3PMI A;  3UWN A;  4JRP A;  1QVP A;  3UDC A;  1VQN A;  1SSF A;  1WJQ A;  2R57 A;  5CKE A;  2DK3 A;  2BIV A;  5LJ3 h;  1M1F A;  1EIF A;  3OYH A;  3OS0 A;  1X01 A;  4BDZ A;  4BI4 A;  2I2L A;  1BI3 A;  2IVW A;  1H64 1;  3C95 A;  3M55 A;  4KT0 E;  4XU0 A;  1YJ9 T;  3X20 B;  3RKX A;  5LJ5 h;  4C0Z A;  3LGF A;  4C92 A;  4PJO F;  1OZ3 A;  2XI9 A;  2LX9 A;  1D3B A;  4N4H A;  4M7D C;  2G3R A;  1M1K C;  4ZTJ A;  3PIP A;  3RES A;  1IRE B;  2L8D A;  4EMH A;  1KD1 U;  5LJ5 g;  4C5H A;  4FSX A;  3LLR A;  4J6W A;  3N5B B;  3JCM d;  1YJW T;  4HCB A;  2P0K A;  4QQD A;  1QVF S;  4GLK A;  4A4E A;  4V2S A;  2V8K A;  2RJC A;  3HRU A;  2BKD N;  2DAQ A;  2EIF A;  2GFU A;  1QVG S;  2K5F A;  2EWN A;  2MWO A;  4C8Q C;  1AHJ B;  2JTM A;  1I81 A;  2RK2 A;  5DM7 R;  4LD6 A;  3M58 A;  1G3Y A;  2XDD A;  4MZM A;  3F70 A;  1GXI E;  2K5I A;  4C92 B;  4MMK A;  2QQ9 A;  2P4T A;  3ZFJ A;  3VU3 C;  5CKF A;  3QSU A;  3PFS A;  2LQK A;  2P0Q A;  5CQX A;  5D6X A;  2K3X A;  2HQX A;  4R55 A;  3I56 A;  2FB7 A;  3HPW A;  4EPC A;  1JBM A;  4M75 B;  3URG A;  3MP6 A;  1Q81 U;  3OSV A;  3CCL A;  3J81 E;  4JS5 A;  4M7A D;  5GAN j;  1Y7X A;  4MZT A;  1M1G A;  2DXT A;  5GAM d;  2DIG A;  2DIQ A;  4XAX B;  3FDR A;  3TCJ A;  5HK0 A;  4JRQ A;  3BDL A;  4XK8 E;  3GF5 A;  3M56 A;  3OYA A;  3HRT A;  3JAM E;  2PVD B;  3C94 A;  2WAC A;  3A8H B;  4C8Q G;  2DO3 A;  1YIT T;  4JRK A;  2VV5 A;  1VQL A;  5CKB A;  3CCR T;  3JCM g;  4HT9 A;  1YJN T;  1O9S A;  2WSC E;  1VUB A;  5AYF A;  2F69 A;  4XTV A;  1Q81 C;  1IZ6 A;  4BDY A;  5FRN A;  5A2Q E;  3HRS A;  5KCO A;  3JCM W;  2HNI A;  3VUB A;  3E19 A;  2KSS A;  2A3L A;  3P8B B;  4JJN K;  2R5M A;  3V7R A;  3CC7 A;  3CCU T;  1VQ8 A;  1YCY A;  2XHC A;  2EKO A;  1VIE A;  2HQE A;  4M77 F;  3RMQ A;  1Y96 A;  2PVG B;  3DLL A;  2F5T X;  3PIO A;  1JB0 E;  2YRV A;  3CCV A;  4QVD A;  4M77 D;  4M78 C;  2XDB A;  3QDR B;  5GAM f;  4M78 E;  2XD0 A;  3OMG A;  3QZ5 B;  4NL2 A;  3HHT B;  3QKJ A;  2CZ7 B;  3X25 B;  1YJ9 A;  3DLM A;  4HCZ A;  3OYD A;  2QXF A;  3CCS A;  1FWZ A;  3M4Y A;  5GAN 3;  4BE2 A;  4J5Y A;  3SFM A;  2E41 A;  1KQS S;  2RHY A;  1G3T A;  5LJ3 e;  1KHI A;  2JZ2 A;  3FEO A;  4QVC A;  4OVA A;  5GAO n;  5GAN 7;  4C5E A;  1BYM A;  3E1S A;  3JCM X;  1S72 T;  4OGC A;  2JUF A;  2RI3 A;  5GAN 2;  1S72 A;  4HA8 A;  3G6E A;  1VQM A;  2XU8 A;  4X9D A;  2DTO A;  2EQK A;  4C92 F;  3CD6 T;  3QBY A;  5J26 A;  4RG8 A;  2V8J A;  5A0L A;  3GIB A;  2P0P A;  2VXE A;  3ER0 A;  3CXC A;  3PT9 A;  2PU9 B;  4BE0 A;  3JB9 G;  4OB1 B;  4PJO D;  2WSE E;  5GAN d;  3PNW C;  2RJE A;  1YI2 A;  2F5K A;  5CKH A;  4F7U E;  3LW5 E;  3QJ6 A;  4L6V 5;  1QVF A;  1G3S A;  3WVE B;  4A4G A;  1BI1 A;  3CPW A;  4M7D F;  1P92 A;  4A4H A;  4DOV A;  3QUI A;  5LJ5 e;  4XU2 A;  3H8Z A;  5D6Y A;  1RI0 A;  3ME9 A;  3SDZ A;  4CI0 C;  3UT1 A;  1YIJ A;  1HXD A;  4O5V A;  1N9S A;  4IUT A;  1XQH A;  3WVD B;  2OAU A;  3G4S T;  3TU4 K;  2BUD A;  3A8L B;  1KQS A;  4DA4 A;  2EJF A;  4R56 A;  4C92 E;  4ZN3 A;  1NJI C;  4BY6 B;  2XIC A;  4HT8 A;  3OW2 S;  3J80 E;  4L5G A;  1VQ8 T;  3CC7 T;  2DTH A;  3L42 A;  4F7U G;  3PTA A;  4LDV A;  4XQ3 A;  3LWI A;  2CYZ B;  3CCM T;  1JJ2 S;  1VQK T;  3S3M A;  2JVV A;  2E10 A;  3M9Q A;  3MEU A;  1BI0 A;  2DXC A;  2KAF A;  2KQW A;  3E9F A;  4OP0 A;  3VUZ A;  2LVM A;  4J6X A;  5GMK j;  1MHN A;  3CC4 T;  1K73 C;  2X4X A;  3M54 A;  2DTI A;  1Y07 A;  5GAM e;  2Y4Y A;  5GAO r;  3BDU A;  3VJP A;  3H6Z A;  3CMA A;  4HCC A;  4C8Q A;  2XDP A;  4ATO A;  2QQB A;  2RI5 A;  4PNO A;  1YIT A;  4M78 F;  1M4Z A;  5I21 A;  3GOX A;  3CCL T;  3QYH B;  3MHX A;  1Q86 U;  3OMC A;  1VQ4 T;  1WJS A;  4E7J A;  1VQ7 T;  2CGH A;  4F7U B;  4EMK B;  1B34 B;  5CKD A;  3HSB A;  5DLO A;  5GAM h;  1K8A C;  4YTL A;  2CZ6 B;  5LL6 S;  3CMA T;  2A7Y A;  4M7A F;  5KH6 A;  4C0G A;  4F7U A;  1XNI A;  3QJY A;  2RHZ A;  2RHI A;  3INZ A;  4N4G A;  1FX7 A;  3JB9 I;  2DKG A;  2XID A;  2YLC A;  5GAN 4;  3OYN A;  3I56 T;  2JTF A;  2DXB A;  3MP1 A;  4QVZ A;  2K3Y A;  2HD0 A;  4RG2 A;  5IT9 E;  2ZPB B;  3HFN A;  3JCM P;  5KE3 A;  4XU3 A;  2VYT A;  5GAN 5;  1RL2 A;  2EJG A;  1M9S A;  1PSE A;  3E9G A;  3HKS A;  4N0A C;  5A0D A;  4EMG A;  4JDS A;  1VQK A;  3LH0 A;  3OYE A;  1G5V A;  5CQY A;  5A0G A;  1VQ9 T;  4BE1 A;  3AHU A;  3L2Q A;  1YIJ T;  3FLG A;  3V8J A;  4BI8 B;  5FRM A;  5CVI A;  4RKU E;  5CR2 A;  1X75 C;  1Y71 A;  2RI2 A;  5LJ3 d;  4IUV A;  4L59 A;  2X35 A;  3L2Z A;  4M78 B;  3X26 B;  4NS5 A;  4C5I A;  3OA6 A;  1FXX A;  1TH7 A;  2L5Q A;  5FU7 C;  3S6W A;  3VYH B;  4C5G A;  2EYQ A;  1DJ7 B;  4FT2 A;  4LDU A;  4PL6 A;  2LCL A;  5GMK l;  1VQN T;  3GLX A;  1YBY A;  2XKO C;  5LJ3 f;  2QI2 A;  3QXE B;  3RKW A;  1OYX A;  4C8Q E;  3OW2 A;  4LDX A;  2OTJ A;  3OYG A;  2EAY A;  3CC2 T;  2Y90 A;  2RM4 A;  2QTX A;  3X28 B;  5CAI A;  1VQ6 T;  1M90 U;  3L2V A;  3RUX A;  4EDU A;  1D3B B;  1UGQ B;  4FL6 A;  3EAE A;  1V29 B;  2DZC A;  2GF7 A;  2O01 E;  3C4S A;  3OYF A;  1JRI A;  2VGN A;  1KHC A;  3KBG A;  3PGG A;  4JUV A;  3CPF A;  5J3B A;  2R58 A;  4C92 D;  3Q1J A;  4D6W A;  4IKF A;  5GAN g;  3A8O B;  3CCE A;  3QO3 A;  3BFM A;  5FU7 B;  2EFI A;  4KUL A;  5IAY A;  1XOV A;  5FU6 B;  4M7D D;  3FIF A;  3I55 T;  4BI3 A;  3JCM h;  3SWN A;  2EQU A;  2K5L A;  3FRN A;  4KUD K;  3LGL A;  2ZPE B;  1NZ9 A;  4J8O A;  3UPU A;  5C6S A;  4NL3 A;  2AHJ B;  5KCH A;  4ELY C;  2MMP A;  4M77 A;  3X24 B;  1VQP T;  5KE2 A;  2QQR A;  4N4I A;  5FU6 C;  3BW1 A;  4C0F A;  1VQO T;  4A54 A;  1VQ6 A;  1I5L A;  3CC2 A;  2Y4X A;  2CS7 A;  3OY9 A;  3A8M B;  2QEX A;  2CKK A;  4E7L A;  1B34 A;  1VQ9 A;  5HK3 A;  1UGS B;  3TRE A;  4A4F A;  4IUP A;  4UC4 A;  3V7C A;  1N8R C;  2E64 A;  2E6Z A;  2H3J A;  3M53 A;  1WQW A;  1VIF A;  3OB9 A;  5I2S A;  3CCV T;  4RCB A;  4FIB A;  2LNV A;  2RJF A;  2M9U A;  4P5N A;  2DZ9 A;  1M5Q 1;  3TEE A;  4QQ6 A;  3VYG A;  5GAO q;  3CCJ T;  1VQ5 A;  3OYC A;  4ELZ C;  1YHQ A;  4FM4 B;  1XTD A;  3C12 A;  4E7I A;  4EMK C;  5GAO l;  4JS4 A;  3DB4 A;  3ASK A;  1VQL T;  2V8I A;  4X9C A;  1UB4 A;  3VKI A;  5LJ3 j;  2GQV A;  1KG1 A;  4XTX A;  4M7D B;  2FYK A;  4E47 A;  2X4Y A;  2JOY A;  2RK1 A;  1W2B S;  2GFA A;  4LDW A;  2JNG A;  4M78 D;  2OTL A;  5CK9 A;  1OZ2 A;  2ZGW A;  3MP8 A;  3OYM A;  3CME T;  3CPW S;  3JSC A;  3T9N A;  3SB2 A;  4BUG A;  4EMK A;  5J39 A;  4E7K A;  1M90 C;  4ZGD B;  2RB6 A;  1I8F A;  3PMT A;  1UGR B;  3JCM f;  4WF2 A;  1BIA A;  2MI6 A;  2VUB A;  4FT4 A;  1R8O B;  2DXU A;  4XTU A;  5M9O A;  3CEY A;  5LJ5 f;  2LQ8 A;  2E70 A;  4Y28 E;  1K9M U;  1VQ7 A;  4M7D G;  2RD1 A;  1O75 A;  5GAM g;  2LC4 A;  4BY6 C;  1BKB A;  3O8V A;  3QZ9 B;  4M77 E;  3S3O A;  4M77 C;  2HBP A;  2ZPH B;  4O6J A;  4M77 G;  2LTO A;  2QQA A;  3L2U A;  3GPL A;  2OTL T;  5FRO A;  1N27 A;  4M75 A;  3KXT A;  4J83 A;  2R5A A;  3OS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...