2J6OA

Atypical polyproline recognition by the cms n-terminal sh3 domain. cms:cd2 heterotrimer
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
b'VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-ASSOCIATED PROTEIN
publication title Atypical Polyproline Recognition by the Cms N-Terminal SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j6oA00
2L3SA 1WXBA 4AFQC 2PTKA 1MUZA 1PWTA 1RUWA 1NG2A 1JU5C 1UHCA 2J6OA 2GTOA 4KRTA 2EYZA 1SRLA 1S1NA 2PZ1A 5IHKA 4RTTA 1X69A 1HSQA 2K3BA 1YCSB 1PNJA 2GBQA 2K2MA 2A37A 2RQWA 1WXTA 1X43A 2JM8A 2P4RA 2C0TA 2DL8A 1KIKA 1RI9A 2BZYA 2BZXA 2FRWA 3THKA 4ZNXA 1H8KA 2MOXA 2HBWA 3NPFA 4OMLA 4LUEA 1YNZA 2L0AA 2HDAA 2KR3A 4LN2A 1E6HA 1WX6A 3REAB 3REBB 1QWEA 2RQUA 3I5RA 1Z9ZA 3VS0A 2V1RA 2EW3A 2KROA 2MCNA 2LX7A 2FPDA 1UUEA 2CUBA 2JS0A 1MV0B 2DVJA 3I35A 2RNAA 1CKBA 3QWXX 4JJBA 2LQNA 3CQTA 4J9FA 1H3HA 1OPKA 2QDLA 2JMCA 4J9CA 2X3XD 2JTEA 2MIOA 2JM9A 2B86A 4WCIA 1GBRA 2OI3A 4F17A 4HVWA 2KEAA 1Z9QA 1BB9A 1HJDA 2L2PA 2DX1A 2D8JA 4RTWA 1KFZA 1A0NB 5GJVB 2KXDA 2EBPA 2C0IA 4Z8AA 2KBTA 2DL4A 4EIKA 2KNBB 2LNHB 3M0TA 1NLOC 3O5ZA 1TUDA 4CC3A 4JJCA 1NYGA 2FPEA 4J9EA 2RPNA 4J9DA 4OMNA 2EVRA 4AFUC 1JXOA 1UTIA 2KE9A 2L3QA 1AOJA 4RTVA 5GJWB 1BK2A 4IIMA 1SEMA 2BTTA 2DBMA 4Z88A 2JS2A 1UGVA 2V1QA 5I11A 4HCKA 2DYBA 2ESWA 4K11A 3VS4A 1ABOA 2LQWA 3ZL7C 2KGTA 2M0YA 2DRMA 3EGUA 1GCQA 1RLPC 2M51A 2FEIA 1BU1A 1T0JA 1I0CA 3SHWA 4RTZA 2YT6A 2L3PA 2K79A 1ZUYA 2FRYA 2RMOA 4Y92A 3UA7A 4D8DA 2HCKA 2GGRA 1AZGB 1V1CA 1WI7A 4DEYA 4LNPA 3RBBB 2H8HA 3EHRA 4F14A 4HVUA 1WYXA 2DL3A 2KXCA 1ZSGA 2EPDA 2ENMA 4LE9A 3PVLA 1UFFA 1XOVA 1GCPA 2J6KA 2LJ0A 1YWPA 1PKTA 1SRMA 4RTXA 1JQQA 1FYNA 3H0HA 1OOTA 3JV3A 1QCFA 4RUGA 5IXBA 1CKAA 2LMJA 3VS1A 1K1ZA 5HCKA 1AWXA 4DEXA 3UATA 1W6XA 2CUDA 2EGCA 4ORZA 1PHTA 1E7OA 1M30A 4JZ4A 2AK5A 1NEBA 1NEGA 2D0NA 2G6FX 1X2KA 4OMOA 1X6GA 2NWMA 1UJYA 2YUNA 1UJ0A 2EGEA 1ZX6A 5FWCA 2CH4A 3M0QA 1MV3A 2FO0A 2DE0X 5FW9A 3VS7A 5IH2A 2F2WA 3TSWA 3IQLA 3EG0A 4GLMA 1K76A 2DRKA 3VS5A 3VS6A 2GTJA 2EYWA 2D8HA 1GBQA 2OJ2A 4J9HA 1AZEA 1QLYA 4OMMA 2CDTA 4GBQA 1N5ZA 4R0KA 5ECAA 4CC7A 3R6NA 1BBZA 2K6DA 4J9IA 4AG1C 1FMKA 3GBQA 2NUZA 3U23A 4CC4B 2EKHA 2F2XA 1WFWA 2YSQA 2ED1A 1WA7A 1W1FA 2J7IA 1W70A 3M0PA 2F2VA 2EYYA 2YDLA 2KRNA 2J06A 3SEMA 2W0ZA 2FG0A 1GCQC 2DA9A 3VRZA 1PKSA 4AFSC 1SHFA 5IXFA 2JT4A 1SSHA 2ECZA 2RQVA 1ABQA 2XMFA 2YUQA 1SPKA 1M3CA 4QT7A 2CT4A 2X3WD 2A08A 1CSKA 2DJQA 1OV3A 2PNIA 3I9QA 3EG1A 1ZUKA 2JMAA 2RN8A 2RF0A 2CSIA 2JXBA 2DMOA 2KT1A 2J6FA 1EFNA 2LZ6B 2K7AA 4HVVA 5L23A 1VYUA 3VRYA 2DNUA 4IIOA 3H0FA 1U3OA 3H41A 4M4ZA 1YN8A 1I07A 4F16A 2DBKA 2J05A 3UA6A 2LJ1A 2VKNA 3M0SA 1YP5A 1K9AA 1QKXA 4OMQA 4HXJA 1NYFA 1NLPC 1WXUA 1T0HA 3EHQA 2EQIA 3UF4A 1M8MA 2AZSA 2SRCA 1OPLA 2CH4W 1SHGA 2RQRA 1HD3A 1G83A 4J9BA 1M3BA 2CT3A 2W10A 1LCKA 1AVZC 1KJWA 1JXMA 2O9SA 1GFDA 2VWFA 1AEYA 1IO6A 3QWYA 2D1XA 5I22A 1U5SA 2KT8A 1B07A 2RQTA 4CC2A 3FJ5A 1UDLA 1I1JA 1T3SA 1Y57A 2JW4A 2KYBA 1WLPB 1OEBA 2A36A 1YWOA 2OAWA 1M27C 3H0IA 1ARKA 2SEMA 2O2OA 2DLPA 4LUDA 3I5SA 2YUPA 1K0SA 2DILA 1ZUUA 4JPBW 2EYXA 2LP5A 1QWFA 1AWOA 1J3TA 4AFZC 2VVKA 1ZLMA 4JJDA 4A63B 1K0XA 2YUOA 3M0UA 3M0RA 1QKWA 1GFCA 1H92A 4FSSA 2HSPA 4X1VA 1UG1A 3RNJA 2KRMA 2AKKA 1X2QA 1U06A 2CSQA 2DL7A 2O9VA 1TUCA 1T3LA 1AWJA 3C0CA 2FPFA 1PRLC 3LH5A 3NGPA 1VYTA 4J9GA 2HEQA 1KSWA 2AKLA 1E6GA 1VA7A 2ABLA 2I0NA 5IHIA 1RLQC 2KYMA 1GRIA 1G2BA 4RTYA 5IHNA 2ROTA 1Y0MA 2LJ3A 3VS3A 2DM1A 5EC7A 2KRSA 3PVQA 4ESRA 1NM7A 1WDXA 2BZ8A 2O88A 2C0OA 4Z89A 1GL5A 3TSZA 1M3AA 2O31A 1TG0A 1X27A 3A98A 4D8KA 2IIMA 3VS2A 1UE9A 1WIEA 1JO8A 1VYVA 2GQIA 2DL5A 1PRMC 4OMPA 3EG2A 1K4US 3PE0A 3EG3A 2ROLA 1AWWA 3KFVA 1X6BA 2ED0A 4E6RA 4AG2C 1UECA 3NHNA 2E5KA 2LCSA 2AZVA 1B3QA 5FWBA 1AD5A 2DF6A 1ZBJA 3ULRB 1JEGA 4JZ3A 2EGAA 4RTUA 1UHFA 3NMZC 2K9GA 2A28A 2CREA 3TVTA 2GNCA
chains in the Genus database with same CATH superfamily
5GAMj 3V8LA 2J6OA 1VQ6Q 1OX8A 5CAIA 2BE7D 2XK0A 5KYXA 4MDXA 3R6OA 3CCST 2OTJQ 2OTLT 2DTIA 3CCRT 2K3YA 1NJIC 1QVFP 4GY5A 2K2MA 5KE3A 4Y28E 2JM8A 1I8FA 2P4RA 1IGQA 4RCCA 3X28B 2P0PA 2FHDA 1VQOT 3EFOA 2LDMA 1RI9A 2ZPEB 2BZXA 4KGVB 2MOXA 1QVGS 4OVAA 5FU6C 3CCMA 1YNZA 3JCMQ 1WZOA 1WX6A 3REBB 1H3ZA 5LJ5j 3VS0A 1TWBA 2XDPA 3I35A 4JJBA 3G4ST 4PJOA 2HKNA 4C8QC 5HKCA 5KYYB 3F70A 1VQNT 4II1A 4WCIA 1GBRA 4HCCA 1LOJA 4LDVA 1KFZA 1A0NB 5GJVB 4EMKB 2EBPA 2CGHA 4PFZA 2GFAA 5GAN4 1VQPQ 2DL4A 4MZMA 1JB0E 2HNIA 1NLOC 1Q86C 1KQSP 1Q7YC 1TUDA 3OSVA 4JJCA 3G71T 5KE2A 2FPEA 1S72A 4J9EA 4OMNA 2QG9B 3D7SB 3SB2A 1AOJA 2DBMA 1Q95G 3A8GB 2RI2A 3RKWA 5IN1A 2JS2A 1UGVA 3QZ9B 3E1SA 3TU4K 5C0MA 4F7UF 3JCMc 2EKOA 3CCLT 1BU1A 2JUFA 1D1AA 5M9OA 1YBYA 1RAEB 3HFNA 4PJOG 2HCKA 2YHTA 3CMET 1QVGA 2GGRA 2PVGB 5FU6B 4DEYA 4B6MA 2K2VA 4HVUA 1G3SA 2DL3A 1OYXA 4LXCA 1YJNQ 4FT2A 4LE9A 4IKFA 2LRQA 2DZ9A 1MMNA 4M75F 4RTXA 2KMTA 1OOTA 1QP2A 2E4HA 5GMKh 3OBWA 3G6EQ 4RUGA 1YIJQ 1VQLT 2LMJA 2RA2A 2MYSA 1WHMA 1W6XA 5DLQE 4B9XA 4JZ4A 2AK5A 1YHQA 4M7AB 1NEBA 4OMOA 5LJ3j 2E6ZA 3OMCA 2CS7A 1KHIA 2K5FA 1K9MU 3HSBA 1UJ0A 1ZX6A 2QEXT 2CH4A 1NPPA 4XU1A 2R57A 1MV3A 1KK7A 1W2BP 5FW9A 3OY9A 2JTFA 1FWZA 2KY9A 1NE8A 3VS7A 2D6FA 4ZGEB 2QTVA 3CCVQ 2KAFA 2RI3A 2O01E 3VS5A 3RERA 2D8HA 4J9HA 3M53A 4NL3A 1ZA1B 4OMMA 2CDTA 3L2ZA 2ZCFB 4GBQA 1N5ZA 1G3YA 4C0FA 3R6NA 3I55T 1JBMA 1OULA 1G5VA 2YXYA 2P0KA 3C4SA 1NBEB 2HQEA 2LVMA 4FYXB 4C92B 5KYWB 2ED1A 1WA7A 3OS2A 2YRDA 3HKSA 2EYYA 3GLXA 1G3WA 1QVPA 1LVKA 1FX7A 4M7AE 1TS9A 4ATOA 2P84A 2VV5A 2J06A 3SEMA 1VQ8T 3RR6A 1GCQC 3CCMQ 2DA9A 1QW1A 4AFSC 1SHFA 4C8QA 2JT4A 2RQVA 2D0QB 3OS5A 2RJFA 4J83A 3AHUA 4QT7A 1D3BA 2WSEE 2CT4A 1EX4A 4YTLA 1SKUB 1VQMA 2IVWA 3EG1A 5GAN2 1HK9A 4KULA 3CCUA 1LPLA 5CCAA 5L8RE 2FZGB 2CP0A 3QYGB 2RJCA 2J6FA 3L2VA 3FC3A 5KH6A 4HVVA 3FLGA 3Q1JA 1VYUA 3VRYA 1BI3A 3JRZA 4N0AC 4C92E 3FB9A 1YN8A 3I56Q 4F16A 2DBKA 3UA6A 1S72Q 3MJXA 4OF1A 2MF2A 1K9AA 3OYHA 3GPLA 3HPWA 1NYFA 4M75C 3A8MB 1D0YA 4A4KA 2QK0A 1O75A 1K9MR 1KG1A 1WHHA 2DXCA 2SRCA 1OPLA 3UT1A 3CCSA 2OTLA 2RQRA 1HD3A 3CCRA 1M8VA 1TXQA 2CT3A 2DERA 2W10A 1AVZC 4C8QG 3HRUA 2HMAA 1GFDA 2VWFA 1VQOA 1G8XA 2D1XA 5GAOq 5GAOr 4LD6A 2FYKA 1UGSB 2QQSA 3QZ5B 9ATCB 4HCBA 4HKEA 1OEBA 2A36A 1X01A 1OI1A 2KVQG 5GANe 4E2FB 4PNOA 4QKUA 3G4SA 2GF7A 1K0SA 4JPBW 1AWOA 2VVKA 8AT1B 4JJDA 1OX9A 2CP7A 1VQNA 4A63B 2RJDA 3HFOA 2XKOC 4M78F 3BY7A 4F7UB 1Y71A 1UGRB 1FMVA 1GFCA 1H92A 2HSPA 1VIEA 1BCOA 3PIPA 3QHSA 1YHQQ 1U06A 2O9VA 3X20B 3C0CA 3S6WA 1MGQA 3LGFA 3MEUA 4OB2B 2PUOB 3M5AA 4J9GA 1Q82C 1YI2Q 2LX9A 2AKLA 3G71A 1YITT 1TTHB 1VA7A 4C0GA 1WHJA 5KYUB 5HK3A 2KYMA 1G2BA 4M75B 2XU8A 1Y0MA 4M78D 4A4FA 2XDDA 1NM7A 1IZ6A 3MPUB 4J6XA 4FYWB 1GL5A 1M3AA 1X27A 3M57A 1R77A 1KC8U 4OB3B 4C0ZA 2BIVA 1PRMC 2D9TA 3CCLA 3CCET 1ZSZC 5GANh 5CR2A 1AWWA 1TU0B 4JJNK 1V76A 3FEOA 2ZGWA 2QA4Q 2AHJB 3NHNA 4F7UE 5GANf 3CMEA 4DA4A 3HTRA 5FWBA 1D09B 2DF6A 1ZBJA 1JEGA 1RAFB 4C5IA 4JZ3A 2EGAA 1VQ9Q 4RTUA 1UHFA 3NMZC 3S3OA 4BE1A 1UB4A 2HD0A 2CZ6B 2L3SA 3JB9J 4IUVA 1MUZA 1UHCA 1JU5C 4IUUA 2RH2A 1VQLA 3MHXA 4M75E 2CYZB 2X9HA 1VQMQ 5IHKA 1BIAA 4V2SA 1HSQA 3JCMg 2K3BA 3WXMB 5CVIA 4LDYA 5CKFA 4PLLA 1PNJA 2GBQA 2VASA 2RQWA 3OMGA 4KGZB 4N0AA 1DJ7B 1X43A 2QEXA 2DL8A 5IT9E 1KIKA 4VUBA 2Z0WA 1TUGB 3QXEB 5GAOp 3LH0A 5EG2A 4LUEA 2DD5A 2R5MA 3KXTA 1QWEA 5D6WA 1Z9ZA 2MCNA 1VQ7T 2JS0A 1MV0B 3CQTA 4J9FA 2K57A 1H3HA 1OPKA 2JMCA 1KD1R 3CCSQ 1ZSZB 4BE2A 2OTLQ 5GAMg 3PIOA 3I55A 2BUDA 4MZTA 2OI3A 4KH0B 4M78C 4F17A 5CK9A 2KEAA 1B7TA 3ME9A 1Z9QA 1BB9A 1HXDA 1VQOQ 2L2PA 2DX1A 3HRSA 1PCXA 2C0IA 3CMAT 1VQ8A 4QQ6A 4IUPA 1M2VA 2LNHB 3M0TA 1UEBA 3H6ZA 1C0MA 1KC8R 5KCHA 4WTOB 3OYGA 3OBYA 3OYYA 3G4SQ 2RPNA 2EVRA 5DLOA 1UTIA 3QUIA 1XTDA 4J5YA 4IIMA 2BTTA 2VXEA 3E9FA 4Z88A 4M7DF 1NZ9A 4M7AD 1VQNQ 3QBYA 4HCKA 2ESWA 3QJ6A 4K11A 5LJ5g 2WSFE 3V7RA 3VS4A 1ABOA 1V29B 3EGUA 2KSSA 1RLPC 3MEVA 2FEIA 2E70A 2M02A 2O4XA 4ZTFA 4LDWA 2K79A 2JZ2A 2YWWA 5HK0A 2RHXA 3CC2Q 1AZGB 2AT1B 2QTXA 1M9SA 3S3MA 4HA8A 1B34A 3EHRA 3QKJA 3G71Q 1RACB 2KXCA 5GMKm 2EPDA 1M1GA 2ENMA 1UFFA 2ZAEA 1XOVA 1GCPA 2LJ0A 1YWPA 1PKTA 8ATCB 1LJOA 3HHTB 2PVDB 2V26A 3H0HA 1QCFA 3PNWC 4M78B 1WQ7A 4C92D 1Y07A 4O6JA 5A0DA 4PLIA 3CCLQ 5HCKA 3JCMe 3UATA 2CUDA 5A2QE 3CMEQ 2NYSA 3L1AA 5GMKj 2MK5A 3EGXA 2RK1A 1UJYA 4ZGDB 5I21A 3CCJQ 3LW5E 3CCQT 2RJEA 2DE0X 2COZA 3FJPA 3SWNC 1WJSA 4XTXA 1N8RR 3SFMA 4XK8E 2F2WA 4DQ2A 1QVFS 3TSWA 3EG0A 4GLMA 1K8AC 3UPUA 1VQ4T 1K76A 1UGPB 2LCLA 3INZA 2GTJA 3FIFA 5GANd 2OJ2A 3EGDB 1ZQ1A 1YJWQ 4ZGJB 3BE3A 2RB6A 2FZKB 4JRIA 4R0KA 3S3NA 1BBZA 2K6DA 1FMKA 3U23A 4M78E 1OZ3A 4M7AC 4BI4A 4CC4B 3CD6T 2EKHA 1WFWA 2EJFA 2F2VA 4M77F 2DIQA 1VQKQ 4FU6A 1RL2A 1YITA 3TREA 5LJ3g 5GAOl 1N9SA 2QQ9A 3J7AF 3X26B 4L5GA 2XMFA 4O5VA 2YUQA 1SPKA 1K73U 4Y91A 2A3LA 4FCYA 2A08A 1CSKA 2DJZA 1OV3A 1ZA2B 4EDUA 2EQUA 2M16A 1KQSS 1H641 2M1HA 3CCEA 3OYIA 3P8HA 2A0FB 1VIFA 4RKUE 4M77D 1I4K1 1VQ6T 4X9DA 2X4XA 4HT8A 2RI5A 4C92C 1TH7A 5LL6S 4BY6C 2LZ6B 1BI2A 1VQ8Q 3SWNB 3V7SA 2ZZDA 4E7HA 1IXDA 4EMHA 3BFMA 3PT9A 3JSCA 1QVFA 2DTOA 4FW1A 4FT4A 5KYYA 2VKNA 1RADB 2JNGA 2EQMA 2NUPB 2ZPGB 2Y90A 4HXJA 2F1LA 3JB9G 3OYMA 1WXUA 1T0HA 1M1KC 2EQIA 3UF4A 2LQ8A 1Q81C 2AZSA 5HY6A 4EMKA 4RG8A 1VQ5T 1G83A 4J9BA 1M3BA 2HKQB 4BDZA 4JS5A 2MPXC 4KBMB 1JJ2P 1IO6A 4NS5A 4ZN3A 5I22A 3J80E 3CEYA 3TEEA 4M75D 3OYJA 3OQ5A 3SD4A 2X4JA 3A8OB 5FLXE 2KT8A 4CC2A 3RUXA 1Y57A 2KYBA 5I2SA 1M27C 3RDVA 3JCMX 1R8OB 3G1JA 2O2OA 2DLPA 2RO0A 2F5TX 1VQ7A 4KUDK 2YUPA 2E10A 2MWOA 4M7DB 2EYXA 3OYKA 3LWHA 1YJ9T 1KQSA 3RMSA 3EH1A 3H8ZA 5J39A 2A7YA 4BDYA 4TVRA 1W2BS 3VKIA 1RAIB 3RIRA 1ZHIA 2Y4XA 3M0UA 4EPCA 5GAN3 3MEAA 3O8VA 4X1VA 2NLUA 2XIDA 4PJJA 5A0LA 3MCAB 3DB3A 2CSQA 2DL7A 4BY6B 3CMAA 1TUCA 1XJWB 2CP6A 1T3LA 2LQKA 3LX7A 1K73R 2FPFA 3ZFJA 3OS1A 4M77C 3E19A 5LJ3e 3MP1A 3A1PA 2EWNA 2I0NA 1GRIA 2YLBA 2OAUA 4RMOA 4AMCA 2DM1A 2KRSA 3TCJA 2BZ8A 4PKCC 3NTHA 1YJNT 2C0OA 4M7AA 2O31A 4D8KA 4A4HA 2XHCA 3MP6A 1N6AA 2GQIA 2DVEA 3EG3A 3KBGA 3QG1A 3KFVA 1OU8A 5GAN7 1BIBA 3JCMW 2EAYA 1YIJT 1XQHA 3H9NA 1NPRA 2E5KA 4BE0A 1KQ2A 3OB9A 2CZ0B 3GNFB 1B3QA 3EFSA 1AD5A 3RESA 3UWNA 3JB9H 5GANj 3VV0A 3EG9A 3GNGA 2K9GA 2DPPB 2GNCA 3CPFA 2X4WA 1JJ2A 1PWTA 2FL7A 1G3TA 2GTOA 4ME7A 2EYZA 1W2BA 4MMLA 4JS4A 3CC7T 4JRPA 1S1NA 4C92A 5KYWA 1PC0A 3KUFA 4JRKA 1SSFA 1WQWA 2WSCE 2LCCA 2HAXA 2QGFB 5LJ3f 1YCSB 4PJOF 1WXTA 1PM3A 3JB9I 4M77B 1IGUA 2C0TA 4DBHA 3CCQA 4XAXB 3VU3C 2FRWA 1H8KA 2DEQA 4M7AG 1ZBXA 4DBQA 2HBWA 3NPFA 4OMLA 1QQJA 4A4GA 2KR3A 1VQ4A 4LN2A 2KK4A 5GMKi 4Z02A 3REAB 2RQUA 3I5RA 2V1RA 5AT1B 5CKDA 2EW3A 2KROA 2LX7A 1Y96B 2FPDA 3CC4T 3QWXX 2DVJA 2RNAA 2LQNA 1N9RA 1Y7XA 2QDLA 2H3JA 4A53A 3OYEA 4PJOD 4X9CA 3JAME 2RHIA 2JTEA 2M9UA 3PTAA 2MIOA 2L8DA 3NFCA 3MP8A 3CD6A 4C5HA 1HJDA 2RHYA 1KD1U 2PVOB 2K5IA 4BI8B 5DM7R 1BI0A 4IURA 4N4IA 4EIKA 3LLRA 4KUIA 2KNBB 3LWIA 3O5ZA 5J26A 3MO8A 4C92G 4M77E 2I2LA 3VJPA 3MKDA 1NYGA 1VQ7Q 2F5KA 2EJ9A 4HCZA 4N4HA 1I81A 3VYHB 3A8LB 4RTVA 5GJWB 3X24B 3DB4A 4J7FA 1SEMA 4OB1B 3I56T 1MMDA 2V1QA 5I11A 2DYBA 4NL2A 2GFUA 2HL3A 2YRCA 4UC4A 1VQ6A 3C95A 1GCQA 1W4SA 2M51A 1BCMA 2V8JA 2DKGA 4DOVA 1I0CA 3CMAQ 3SHWA 3VUZA 2YT6A 2L3PA 1ZUYA 2FRYA 2RMOA 1IB8A 4Y92A 4OGCA 2ZPHB 2E3HA 3NTKA 2H8HA 3PMIA 2DFUA 1ZSGA 3HL8A 5D7UA 1N27A 4F7UA 2YRVA 2PQWA 2V8IA 4BI3A 4OMFB 2CZ1B 1VOMA 2VGNA 1VQ5A 5FU7B 3QDRB 1CKAA 3PFSA 4QQDA 4C5EA 3VS1A 4C0DB 1K1ZA 3CCUQ 4P5NA 5KYNA 2ATCB 4DEXA 2EGCA 4ORZA 1M30A 3A5ZB 4E7SA 2D0NA 1FXXA 4PJOC 4ELZC 2XICA 2QQAA 1MNEA 3LYIA 5KYUA 4E7ZA 2YUNA 4M75A 2E6NA 3META 3WVDB 4BACA 1BI1A 2EQKA 5IH2A 2NUTB 1YJ9A 2O4XB 1U1SA 2DRKA 2COWA 4JDSA 1YI2T 2E12A 2M0OA 3VS6A 3CCRQ 1LNXA 1RAGB 1N8RU 3OS0A 4CRIA 4OB0B 1AZEA 4C8QF 1B34B 2K5LA 1JRIA 1K9MC 2JVVA 2HSEB 4CC7A 5IAYA 4ELYC 3GBQA 4EMGA 2H3EB 2QYZA 3L42A 1D1CA 4F7UG 3M9QA 2F2XA 1RAHB 2X51A 5KYXB 2EQJA 5GAN5 2YSQA 3M0PA 4R55A 2E41A 1X6OA 1X75C 2QA4T 2FG0A 5AYFA 2XDBA 3VRZA 1PKSA 3WVEB 1VQ4Q 1SSHA 2ECZA 2QI2A 3EFOB 2HBPA 4OGEA 1WJRA 1YJNA 5LJ3d 2RD1A 2X3WD 2RHZA 1VQ9T 1MNDA 1SF9A 3BW1A 4M75G 3URGA 2QQRA 5D6YA 3OYLA 2FZCB 4LDUA 2DETA 2MAMA 2AIRB 2PNIA 3M58A 1ZUKA 2JMAA 3CD6Q 1YIJA 4PJOB 2X35A 4JUVA 2RF0A 2JXBA 3P8DA 3UDCA 1PG5B 3FRNA 4XU2A 4A4EA 2DMOA 2KT1A 2K7AA 5L23A 4M7DD 2DNUA 4IIOA 1U3OA 2QQBA 5CKHA 1IREB 1O9SA 2VGMA 2DO3A 2QGGA 1IRXA 2LJ1A 4PJMA 5D6XA 1ZSZA 1YP5A 2ZPBB 3RKYA 3CC7A 1QKXA 1NLPC 3EHQA 1WJQA 1M8MA 1TSFA 2EJGA 2CH4W 1QVGP 5CQXA 2MI6A 3OYNA 2LNVA 2COYA 2O9SA 1AEYA 3QWYA 3ZBDA 2DXUA 4PJOE 3DLLA 4FYVB 3VYGA 4QW2A 1IHWA 4IUTA 3FJ5A 1UDLA 1GXIE 1I1JA 1T3SA 5FRNA 1YWOA 3H0IA 3JCMb 2SEMA 4DOWA 4LUDA 4E7LA 1VQLQ 3QPHA 3AT1B 3CC4A 2JJ9A 4XTYA 2DILA 1ZUUA 4FIBA 7AT1B 1Q82U 1QWFA 5GAMe 2QDYB 4HT9A 2CP3A 4JLIA 1VQ5Q 2DZCA 2YUOA 2K3XA 1QKWA 4XTWA 1UG1A 3RNJA 2XG8D 2KRMA 2QEXQ 2AKKA 1X2QA 2B8AA 3M56A 3CBOA 2DK3A 3RMQA 1M90U 4ZTJA 1M4ZA 3FDRA 1VUBA 2L3RA 3L2WA 2BE9B 3JCMh 1WNLA 4KH1B 2HEQA 5GMKe 3JCMf 1E6GA 4PK4A 4M78A 2QAZA 5IHNA 1YJ9Q 4RTYA 2ROTA 3CC2T 1EIFA 2EIFA 1OQKA 2HL5C 3VS3A 1R0BG 3I56A 4M7DC 5EC7A 5LJ5e 4ESRA 3I55Q 1YCYA 4ANJA 3QSUA 1WDXA 4Z89A 2DAQA 2DD4A 3TSZA 2HZYA 4X34A 4DBRA 3VS2A 1UE9A 4BUGA 1WIEA 1JO8A 2DXBA 4FM4B 2DL5A 1KD1C 3EG2A 1K4US 3PE0A 2ROLA 4L59A 4XU0A 1X6BA 2ED0A 4E6RA 3PMTA 1UECA 4JRQA 2OTJT 3BDLA 3ZEHA 1AHJB 2LCSA 1IHVA 4GLKA 5GAMh 5GAMf 3OYFA 3TQ7P 2L5QA 3RKXA 3EGDA 1KQ1A 1QCOA 4QVZA 3GOXA 1KC8C 3CCJT 4PJLA 1WXBA 4AFQC 2PTKA 1RUWA 1NG2A 4KRTA 4J8OA 1SRLA 1D0ZA 5GMKl 4C8QB 2PZ1A 2DTHA 4C5GA 5CQYA 4J6YA 1R0CB 4JLGA 4RTTA 4XTUA 1X69A 1D3BB 4DBFA 2CP5A 3L2RA 4AT1B 3BDUA 1WHGA 3C12A 4FW2A 4M78G 2EYQA 3DLMA 2A37A 3EFRA 1YJWT 3LGLA 1RI0A 5LJ5h 1Q82R 2VXFA 2BZYA 3THKA 5LJ5f 2FB7A 4FL6A 4ZNXA 4PJNA 4QVDA 1EZZB 1VQPT 2L0AA 2HDAA 1F1BB 1PD1A 2DXTA 1E6HA 2E3IA 3V7CA 1JJ2S 1YI2A 1VQKT 5GAN8 3CC7Q 5A0GA 3CXCP 5GANg 1UUEA 2CUBA 1CKBA 2ZPFB 1M90R 4D6WA 2E5QA 4J9CA 2E1HA 2VB6A 5CKEA 4ZN1A 2X3XD 5FRMA 2JM9A 2B86A 1M1FA 3EG9B 5J3BA 1OZ2A 4QQGA 3SWNA 4HVWA 3JCMJ 4C8QE 3OYBA 4E7JA 2D8JA 4RTWA 2KXDA 3JCMV 3J81E 4Z8AA 3CXCS 2KBTA 1I5OB 2DIGA 1WHLA 4LD9K 2QA4A 2NUPA 2K4YA 1BKBA 4E7IA 2DEUA 4CC3A 1XNIA 3CBMA 3OSSC 3L2QA 4MMKA 3C94A 3CC4Q 2HQHA 2R58A 4J9DA 4AFUC 1JXOA 2KE9A 1N8RC 1VQ9A 2L3QA 1WPYA 2YLCA 1BK2A 2OX7A 3P8BB 4M7DE 3CPWP 2IG0A 2LQWA 3ZL7C 3G6ET 2KGTA 2M0YA 2DRMA 2X4YA 1T0JA 4RTZA 2JTMA 1YITQ 3UA7A 4D8DA 2Y4YA 1NJIU 2E64A 5CO7A 1V1CA 1WI7A 2CZ7B 4LNPA 3RBBB 4M7DA 4F14A 3CPWS 1WYXA 4KGXB 1RABB 5DY9A 3PVLA 4KT0E 4F04B 2J6KA 5I2MA 1SRMA 3E9GA 1JQQA 3CCVT 3CCEQ 1M2OA 1FYNA 1PD0A 3JV3A 4R56A 4CI0C 5LJ3h 3V8KA 4XTZA 5IXBA 4A54A 2KI7A 1M5Q1 2WACA 1K8AU 3OYDA 1AWXA 1C1AA 2GCXA 3GP8A 2JOYA 3JCMP 1PHTA 1E7OA 3JCMd 1NEGA 2G6FX 3CXCA 1X2KA 2MMPA 1X6GA 4RG2A 2NWMA 3OA6A 3GIBA 1I5LA 2EGEA 5FWCA 3M0QA 3V8JA 2FO0A 3X25B 3OYAA 2VUBA 1C6VX 1U1TA 3JB9F 5KCOA 1Q86U 3IQLA 3CCMT 1Q7YU 2XD0A 3QJYA 2HQXA 1QCNA 4FSXA 2EYWA 1GBQA 3DKMA 5FU7C 4NOYA 1QLYA 3SDZA 4C0DC 2XI9A 4M7DG 2F69A 2DYIA 5ECAA 4L6V5 5GAMd 4AG1C 4J9IA 3L2UA 2NUZA 1P92A 2VC8A 1UGQB 2FVUA 2LTOA 3EAEA 1OU9A 3M55A 4XQ3A 1PSEA 1W1FA 2J7IA 1W70A 4XU3A 3JB9D 2YDLA 3MEWA 3CPWA 4PFOA 2KRNA 2G3RA 2W0ZA 1PSFA 3CC2A 5IXFA 3M59A 1ABQA 4MDWA 2QASA 1S72T 1M3CA 3QDFA 2V8KA 3M4GA 1SG5A 2DJQA 1NJIR 2LC4A 5C6SA 2PUKB 1U8RA 4IUQA 2L89A 4M77A 4RCBA 1BYMA 3I9QA 5LJ5d 1MMGA 2OTJA 1D0XA 2RN8A 1M90C 2CSIA 1M1KU 1Q81U 3OW2P 4Q5WA 4LDXA 2EFIA 1EFNA 1QP3A 2BKDN 2P4TA 3H0FA 1K73C 5GAN6 1Y96A 2MWPA 3QO3A 3H41A 4M4ZA 3CBPA 1I07A 3CCJA 2LT1A 1K8AR 6AT1B 2J05A 3QYHB 3NTIA 4J7IA 3ASKA 3M0SA 1M2VB 2RK2A 4OMQA 3OW2S 3M4YA 1SHGA 4E47A 2LT4A 1LCKA 1KJWA 1JXMA 1YJWA 2C06A 3QIIA 4J6WA 1Q86R 1Q7YR 2JN0A 2KQWA 1WHKA 1YHQT 2R5AA 3T9NA 1U5SA 4MZPA 1B07A 2RQTA 4XTVA 4B9WA 1VQPA 2JW4A 1HYOA 1WLPB 1FMWA 5GAOn 4BB7A 2OAWA 1ARKA 4M77G 1VQKA 2QXFA 2ZPIB 1MHNA 4BD3A 3I5SA 1QMCA 1ACMB 3N5BB 2LP5A 1J3TA 4AFZC 1ZLMA 4PL6A 3HRTA 1RAAB 2RM4A 3ER0A 1K0XA 4N4GA 3M0RA 1MMAA 4FSSA 3OYCA 2RHUA 3CCQQ 5GAOm 4M7AF 1AWJA 1PRLC 3LH5A 3NGPA 1VYTA 1KSWA 5CKBA 4C8QD 3EGXB 4E7KA 2ABLA 2KDSA 4QVCA 5IHIA 1RLQC 3VUBA 2LJ3A 1M1KR 3OW2A 2IPOB 3E2UA 1Q81R 3PVQA 2O88A 1KHCA 1AT1B 3G6EA 1D1BA 1TG0A 3A98A 1YFNA 3PGGA 2IIMA 1WGSA 2P0QA 4OP0A 1VYVA 3M54A 4FYYB 4OMPA 1VQMT 2VYTA 3GF5A 4AG2C 3HP9A 3CCUT 2AZVA 4C92F 3A8HB 2PU9B 2NUTA 2CP2A 4EMKC 1TOVA 4PFPA 2E65A 4WF2A 3ULRB 5CIUA 2CKKA 2GQVA 5FROA 3G7ZA 2A28A 3CCVA 2CREA 3EH2A 3TVTA
chains in the Genus database with same CATH topology
2L3SA 1WXBA 4AFQC 2PTKA 1MUZA 1PWTA 1RUWA 1NG2A 1JU5C 1UHCA 2J6OA 2GTOA 4KRTA 2EYZA 1SRLA 1S1NA 2PZ1A 5IHKA 4RTTA 1X69A 1HSQA 2K3BA 1YCSB 1PNJA 2GBQA 2K2MA 2A37A 2RQWA 1WXTA 1X43A 2JM8A 2P4RA 2C0TA 2DL8A 1KIKA 1RI9A 2BZYA 2BZXA 2FRWA 3THKA 4ZNXA 1H8KA 2MOXA 2HBWA 3NPFA 4OMLA 4LUEA 1YNZA 2L0AA 2HDAA 2KR3A 4LN2A 1E6HA 1WX6A 3REAB 3REBB 1QWEA 2RQUA 3I5RA 1Z9ZA 3VS0A 2V1RA 2EW3A 2KROA 2MCNA 2LX7A 2FPDA 1UUEA 2CUBA 2JS0A 1MV0B 2DVJA 3I35A 2RNAA 1CKBA 3QWXX 4JJBA 2LQNA 3CQTA 4J9FA 1H3HA 1OPKA 2QDLA 2JMCA 4J9CA 2X3XD 2JTEA 2MIOA 2JM9A 2B86A 4WCIA 1GBRA 2OI3A 4F17A 4HVWA 2KEAA 1Z9QA 1BB9A 1HJDA 2L2PA 2DX1A 2D8JA 4RTWA 1KFZA 1A0NB 5GJVB 2KXDA 2EBPA 2C0IA 4Z8AA 2KBTA 2DL4A 4EIKA 2KNBB 2LNHB 3M0TA 1NLOC 3O5ZA 1TUDA 4CC3A 4JJCA 1NYGA 2FPEA 4J9EA 2RPNA 4J9DA 4OMNA 2EVRA 4AFUC 1JXOA 1UTIA 2KE9A 2L3QA 1AOJA 4RTVA 5GJWB 1BK2A 4IIMA 1SEMA 2BTTA 2DBMA 4Z88A 2JS2A 1UGVA 2V1QA 5I11A 4HCKA 2DYBA 2ESWA 4K11A 3VS4A 1ABOA 2LQWA 3ZL7C 2KGTA 2M0YA 2DRMA 3EGUA 1GCQA 1RLPC 2M51A 2FEIA 1BU1A 1T0JA 1I0CA 3SHWA 4RTZA 2YT6A 2L3PA 2K79A 1ZUYA 2FRYA 2RMOA 4Y92A 3UA7A 4D8DA 2HCKA 2GGRA 1AZGB 1V1CA 1WI7A 4DEYA 4LNPA 3RBBB 2H8HA 3EHRA 4F14A 4HVUA 1WYXA 2DL3A 2KXCA 1ZSGA 2EPDA 2ENMA 4LE9A 3PVLA 1UFFA 1XOVA 1GCPA 2J6KA 2LJ0A 1YWPA 1PKTA 1SRMA 4RTXA 1JQQA 1FYNA 3H0HA 1OOTA 3JV3A 1QCFA 4RUGA 5IXBA 1CKAA 2LMJA 3VS1A 1K1ZA 5HCKA 1AWXA 4DEXA 3UATA 1W6XA 2CUDA 2EGCA 4ORZA 1PHTA 1E7OA 1M30A 4JZ4A 2AK5A 1NEBA 1NEGA 2D0NA 2G6FX 1X2KA 4OMOA 1X6GA 2NWMA 1UJYA 2YUNA 1UJ0A 2EGEA 1ZX6A 5FWCA 2CH4A 3M0QA 1MV3A 2FO0A 2DE0X 5FW9A 3VS7A 5IH2A 2F2WA 3TSWA 3IQLA 3EG0A 4GLMA 1K76A 2DRKA 3VS5A 3VS6A 2GTJA 2EYWA 2D8HA 1GBQA 2OJ2A 4J9HA 1AZEA 1QLYA 4OMMA 2CDTA 4GBQA 1N5ZA 4R0KA 5ECAA 4CC7A 3R6NA 1BBZA 2K6DA 4J9IA 4AG1C 1FMKA 3GBQA 2NUZA 3U23A 4CC4B 2EKHA 2F2XA 1WFWA 2YSQA 2ED1A 1WA7A 1W1FA 2J7IA 1W70A 3M0PA 2F2VA 2EYYA 2YDLA 2KRNA 2J06A 3SEMA 2W0ZA 2FG0A 1GCQC 2DA9A 3VRZA 1PKSA 4AFSC 1SHFA 5IXFA 2JT4A 1SSHA 2ECZA 2RQVA 1ABQA 2XMFA 2YUQA 1SPKA 1M3CA 4QT7A 2CT4A 2X3WD 2A08A 1CSKA 2DJQA 1OV3A 2PNIA 3I9QA 3EG1A 1ZUKA 2JMAA 2RN8A 2RF0A 2CSIA 2JXBA 2DMOA 2KT1A 2J6FA 1EFNA 2LZ6B 2K7AA 4HVVA 5L23A 1VYUA 3VRYA 2DNUA 4IIOA 3H0FA 1U3OA 3H41A 4M4ZA 1YN8A 1I07A 4F16A 2DBKA 2J05A 3UA6A 2LJ1A 2VKNA 3M0SA 1YP5A 1K9AA 1QKXA 4OMQA 4HXJA 1NYFA 1NLPC 1WXUA 1T0HA 3EHQA 2EQIA 3UF4A 1M8MA 2AZSA 2SRCA 1OPLA 2CH4W 1SHGA 2RQRA 1HD3A 1G83A 4J9BA 1M3BA 2CT3A 2W10A 1LCKA 1AVZC 1KJWA 1JXMA 2O9SA 1GFDA 2VWFA 1AEYA 1IO6A 3QWYA 2D1XA 5I22A 1U5SA 2KT8A 1B07A 2RQTA 4CC2A 3FJ5A 1UDLA 1I1JA 1T3SA 1Y57A 2JW4A 2KYBA 1WLPB 1OEBA 2A36A 1YWOA 2OAWA 1M27C 3H0IA 1ARKA 2SEMA 2O2OA 2DLPA 4LUDA 3I5SA 2YUPA 1K0SA 2DILA 1ZUUA 4JPBW 2EYXA 2LP5A 1QWFA 1AWOA 1J3TA 4AFZC 2VVKA 1ZLMA 4JJDA 4A63B 1K0XA 2YUOA 3M0UA 3M0RA 1QKWA 1GFCA 1H92A 4FSSA 2HSPA 4X1VA 1UG1A 3RNJA 2KRMA 2AKKA 1X2QA 1U06A 2CSQA 2DL7A 2O9VA 1TUCA 1T3LA 1AWJA 3C0CA 2FPFA 1PRLC 3LH5A 3NGPA 1VYTA 4J9GA 2HEQA 1KSWA 2AKLA 1E6GA 1VA7A 2ABLA 2I0NA 5IHIA 1RLQC 2KYMA 1GRIA 1G2BA 4RTYA 5IHNA 2ROTA 1Y0MA 2LJ3A 3VS3A 2DM1A 5EC7A 2KRSA 3PVQA 4ESRA 1NM7A 1WDXA 2BZ8A 2O88A 2C0OA 4Z89A 1GL5A 3TSZA 1M3AA 2O31A 1TG0A 1X27A 3A98A 4D8KA 2IIMA 3VS2A 1UE9A 1WIEA 1JO8A 1VYVA 2GQIA 2DL5A 1PRMC 4OMPA 3EG2A 1K4US 3PE0A 3EG3A 2ROLA 1AWWA 3KFVA 1X6BA 2ED0A 4E6RA 4AG2C 1UECA 3NHNA 2E5KA 2LCSA 2AZVA 1B3QA 5FWBA 1AD5A 2DF6A 1ZBJA 3ULRB 1JEGA 4JZ3A 2EGAA 4RTUA 1UHFA 3NMZC 2K9GA 2A28A 2CREA 3TVTA 2GNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3S A;  1WXB A;  4AFQ C;  2PTK A;  1MUZ A;  1PWT A;  1RUW A;  1NG2 A;  1JU5 C;  1UHC A;  2J6O A;  2GTO A;  4KRT A;  2EYZ A;  1SRL A;  1S1N A;  2PZ1 A;  5IHK A;  4RTT A;  1X69 A;  1HSQ A;  2K3B A;  1YCS B;  1PNJ A;  2GBQ A;  2K2M A;  2A37 A;  2RQW A;  1WXT A;  1X43 A;  2JM8 A;  2P4R A;  2C0T A;  2DL8 A;  1KIK A;  1RI9 A;  2BZY A;  2BZX A;  2FRW A;  3THK A;  4ZNX A;  1H8K A;  2MOX A;  2HBW A;  3NPF A;  4OML A;  4LUE A;  1YNZ A;  2L0A A;  2HDA A;  2KR3 A;  4LN2 A;  1E6H A;  1WX6 A;  3REA B;  3REB B;  1QWE A;  2RQU A;  3I5R A;  1Z9Z A;  3VS0 A;  2V1R A;  2EW3 A;  2KRO A;  2MCN A;  2LX7 A;  2FPD A;  1UUE A;  2CUB A;  2JS0 A;  1MV0 B;  2DVJ A;  3I35 A;  2RNA A;  1CKB A;  3QWX X;  4JJB A;  2LQN A;  3CQT A;  4J9F A;  1H3H A;  1OPK A;  2QDL A;  2JMC A;  4J9C A;  2X3X D;  2JTE A;  2MIO A;  2JM9 A;  2B86 A;  4WCI A;  1GBR A;  2OI3 A;  4F17 A;  4HVW A;  2KEA A;  1Z9Q A;  1BB9 A;  1HJD A;  2L2P A;  2DX1 A;  2D8J A;  4RTW A;  1KFZ A;  1A0N B;  5GJV B;  2KXD A;  2EBP A;  2C0I A;  4Z8A A;  2KBT A;  2DL4 A;  4EIK A;  2KNB B;  2LNH B;  3M0T A;  1NLO C;  3O5Z A;  1TUD A;  4CC3 A;  4JJC A;  1NYG A;  2FPE A;  4J9E A;  2RPN A;  4J9D A;  4OMN A;  2EVR A;  4AFU C;  1JXO A;  1UTI A;  2KE9 A;  2L3Q A;  1AOJ A;  4RTV A;  5GJW B;  1BK2 A;  4IIM A;  1SEM A;  2BTT A;  2DBM A;  4Z88 A;  2JS2 A;  1UGV A;  2V1Q A;  5I11 A;  4HCK A;  2DYB A;  2ESW A;  4K11 A;  3VS4 A;  1ABO A;  2LQW A;  3ZL7 C;  2KGT A;  2M0Y A;  2DRM A;  3EGU A;  1GCQ A;  1RLP C;  2M51 A;  2FEI A;  1BU1 A;  1T0J A;  1I0C A;  3SHW A;  4RTZ A;  2YT6 A;  2L3P A;  2K79 A;  1ZUY A;  2FRY A;  2RMO A;  4Y92 A;  3UA7 A;  4D8D A;  2HCK A;  2GGR A;  1AZG B;  1V1C A;  1WI7 A;  4DEY A;  4LNP A;  3RBB B;  2H8H A;  3EHR A;  4F14 A;  4HVU A;  1WYX A;  2DL3 A;  2KXC A;  1ZSG A;  2EPD A;  2ENM A;  4LE9 A;  3PVL A;  1UFF A;  1XOV A;  1GCP A;  2J6K A;  2LJ0 A;  1YWP A;  1PKT A;  1SRM A;  4RTX A;  1JQQ A;  1FYN A;  3H0H A;  1OOT A;  3JV3 A;  1QCF A;  4RUG A;  5IXB A;  1CKA A;  2LMJ A;  3VS1 A;  1K1Z A;  5HCK A;  1AWX A;  4DEX A;  3UAT A;  1W6X A;  2CUD A;  2EGC A;  4ORZ A;  1PHT A;  1E7O A;  1M30 A;  4JZ4 A;  2AK5 A;  1NEB A;  1NEG A;  2D0N A;  2G6F X;  1X2K A;  4OMO A;  1X6G A;  2NWM A;  1UJY A;  2YUN A;  1UJ0 A;  2EGE A;  1ZX6 A;  5FWC A;  2CH4 A;  3M0Q A;  1MV3 A;  2FO0 A;  2DE0 X;  5FW9 A;  3VS7 A;  5IH2 A;  2F2W A;  3TSW A;  3IQL A;  3EG0 A;  4GLM A;  1K76 A;  2DRK A;  3VS5 A;  3VS6 A;  2GTJ A;  2EYW A;  2D8H A;  1GBQ A;  2OJ2 A;  4J9H A;  1AZE A;  1QLY A;  4OMM A;  2CDT A;  4GBQ A;  1N5Z A;  4R0K A;  5ECA A;  4CC7 A;  3R6N A;  1BBZ A;  2K6D A;  4J9I A;  4AG1 C;  1FMK A;  3GBQ A;  2NUZ A;  3U23 A;  4CC4 B;  2EKH A;  2F2X A;  1WFW A;  2YSQ A;  2ED1 A;  1WA7 A;  1W1F A;  2J7I A;  1W70 A;  3M0P A;  2F2V A;  2EYY A;  2YDL A;  2KRN A;  2J06 A;  3SEM A;  2W0Z A;  2FG0 A;  1GCQ C;  2DA9 A;  3VRZ A;  1PKS A;  4AFS C;  1SHF A;  5IXF A;  2JT4 A;  1SSH A;  2ECZ A;  2RQV A;  1ABQ A;  2XMF A;  2YUQ A;  1SPK A;  1M3C A;  4QT7 A;  2CT4 A;  2X3W D;  2A08 A;  1CSK A;  2DJQ A;  1OV3 A;  2PNI A;  3I9Q A;  3EG1 A;  1ZUK A;  2JMA A;  2RN8 A;  2RF0 A;  2CSI A;  2JXB A;  2DMO A;  2KT1 A;  2J6F A;  1EFN A;  2LZ6 B;  2K7A A;  4HVV A;  5L23 A;  1VYU A;  3VRY A;  2DNU A;  4IIO A;  3H0F A;  1U3O A;  3H41 A;  4M4Z A;  1YN8 A;  1I07 A;  4F16 A;  2DBK A;  2J05 A;  3UA6 A;  2LJ1 A;  2VKN A;  3M0S A;  1YP5 A;  1K9A A;  1QKX A;  4OMQ A;  4HXJ A;  1NYF A;  1NLP C;  1WXU A;  1T0H A;  3EHQ A;  2EQI A;  3UF4 A;  1M8M A;  2AZS A;  2SRC A;  1OPL A;  2CH4 W;  1SHG A;  2RQR A;  1HD3 A;  1G83 A;  4J9B A;  1M3B A;  2CT3 A;  2W10 A;  1LCK A;  1AVZ C;  1KJW A;  1JXM A;  2O9S A;  1GFD A;  2VWF A;  1AEY A;  1IO6 A;  3QWY A;  2D1X A;  5I22 A;  1U5S A;  2KT8 A;  1B07 A;  2RQT A;  4CC2 A;  3FJ5 A;  1UDL A;  1I1J A;  1T3S A;  1Y57 A;  2JW4 A;  2KYB A;  1WLP B;  1OEB A;  2A36 A;  1YWO A;  2OAW A;  1M27 C;  3H0I A;  1ARK A;  2SEM A;  2O2O A;  2DLP A;  4LUD A;  3I5S A;  2YUP A;  1K0S A;  2DIL A;  1ZUU A;  4JPB W;  2EYX A;  2LP5 A;  1QWF A;  1AWO A;  1J3T A;  4AFZ C;  2VVK A;  1ZLM A;  4JJD A;  4A63 B;  1K0X A;  2YUO A;  3M0U A;  3M0R A;  1QKW A;  1GFC A;  1H92 A;  4FSS A;  2HSP A;  4X1V A;  1UG1 A;  3RNJ A;  2KRM A;  2AKK A;  1X2Q A;  1U06 A;  2CSQ A;  2DL7 A;  2O9V A;  1TUC A;  1T3L A;  1AWJ A;  3C0C A;  2FPF A;  1PRL C;  3LH5 A;  3NGP A;  1VYT A;  4J9G A;  2HEQ A;  1KSW A;  2AKL A;  1E6G A;  1VA7 A;  2ABL A;  2I0N A;  5IHI A;  1RLQ C;  2KYM A;  1GRI A;  1G2B A;  4RTY A;  5IHN A;  2ROT A;  1Y0M A;  2LJ3 A;  3VS3 A;  2DM1 A;  5EC7 A;  2KRS A;  3PVQ A;  4ESR A;  1NM7 A;  1WDX A;  2BZ8 A;  2O88 A;  2C0O A;  4Z89 A;  1GL5 A;  3TSZ A;  1M3A A;  2O31 A;  1TG0 A;  1X27 A;  3A98 A;  4D8K A;  2IIM A;  3VS2 A;  1UE9 A;  1WIE A;  1JO8 A;  1VYV A;  2GQI A;  2DL5 A;  1PRM C;  4OMP A;  3EG2 A;  1K4U S;  3PE0 A;  3EG3 A;  2ROL A;  1AWW A;  3KFV A;  1X6B A;  2ED0 A;  4E6R A;  4AG2 C;  1UEC A;  3NHN A;  2E5K A;  2LCS A;  2AZV A;  1B3Q A;  5FWB A;  1AD5 A;  2DF6 A;  1ZBJ A;  3ULR B;  1JEG A;  4JZ3 A;  2EGA A;  4RTU A;  1UHF A;  3NMZ C;  2K9G A;  2A28 A;  2CRE A;  3TVT A;  2GNC A; 
#chains in the Genus database with same CATH topology
 5GAM j;  3V8L A;  2J6O A;  1VQ6 Q;  1OX8 A;  5CAI A;  2BE7 D;  2XK0 A;  5KYX A;  4MDX A;  3R6O A;  3CCS T;  2OTJ Q;  2OTL T;  2DTI A;  3CCR T;  2K3Y A;  1NJI C;  1QVF P;  4GY5 A;  2K2M A;  5KE3 A;  4Y28 E;  2JM8 A;  1I8F A;  2P4R A;  1IGQ A;  4RCC A;  3X28 B;  2P0P A;  2FHD A;  1VQO T;  3EFO A;  2LDM A;  1RI9 A;  2ZPE B;  2BZX A;  4KGV B;  2MOX A;  1QVG S;  4OVA A;  5FU6 C;  3CCM A;  1YNZ A;  3JCM Q;  1WZO A;  1WX6 A;  3REB B;  1H3Z A;  5LJ5 j;  3VS0 A;  1TWB A;  2XDP A;  3I35 A;  4JJB A;  3G4S T;  4PJO A;  2HKN A;  4C8Q C;  5HKC A;  5KYY B;  3F70 A;  1VQN T;  4II1 A;  4WCI A;  1GBR A;  4HCC A;  1LOJ A;  4LDV A;  1KFZ A;  1A0N B;  5GJV B;  4EMK B;  2EBP A;  2CGH A;  4PFZ A;  2GFA A;  5GAN 4;  1VQP Q;  2DL4 A;  4MZM A;  1JB0 E;  2HNI A;  1NLO C;  1Q86 C;  1KQS P;  1Q7Y C;  1TUD A;  3OSV A;  4JJC A;  3G71 T;  5KE2 A;  2FPE A;  1S72 A;  4J9E A;  4OMN A;  2QG9 B;  3D7S B;  3SB2 A;  1AOJ A;  2DBM A;  1Q95 G;  3A8G B;  2RI2 A;  3RKW A;  5IN1 A;  2JS2 A;  1UGV A;  3QZ9 B;  3E1S A;  3TU4 K;  5C0M A;  4F7U F;  3JCM c;  2EKO A;  3CCL T;  1BU1 A;  2JUF A;  1D1A A;  5M9O A;  1YBY A;  1RAE B;  3HFN A;  4PJO G;  2HCK A;  2YHT A;  3CME T;  1QVG A;  2GGR A;  2PVG B;  5FU6 B;  4DEY A;  4B6M A;  2K2V A;  4HVU A;  1G3S A;  2DL3 A;  1OYX A;  4LXC A;  1YJN Q;  4FT2 A;  4LE9 A;  4IKF A;  2LRQ A;  2DZ9 A;  1MMN A;  4M75 F;  4RTX A;  2KMT A;  1OOT A;  1QP2 A;  2E4H A;  5GMK h;  3OBW A;  3G6E Q;  4RUG A;  1YIJ Q;  1VQL T;  2LMJ A;  2RA2 A;  2MYS A;  1WHM A;  1W6X A;  5DLQ E;  4B9X A;  4JZ4 A;  2AK5 A;  1YHQ A;  4M7A B;  1NEB A;  4OMO A;  5LJ3 j;  2E6Z A;  3OMC A;  2CS7 A;  1KHI A;  2K5F A;  1K9M U;  3HSB A;  1UJ0 A;  1ZX6 A;  2QEX T;  2CH4 A;  1NPP A;  4XU1 A;  2R57 A;  1MV3 A;  1KK7 A;  1W2B P;  5FW9 A;  3OY9 A;  2JTF A;  1FWZ A;  2KY9 A;  1NE8 A;  3VS7 A;  2D6F A;  4ZGE B;  2QTV A;  3CCV Q;  2KAF A;  2RI3 A;  2O01 E;  3VS5 A;  3RER A;  2D8H A;  4J9H A;  3M53 A;  4NL3 A;  1ZA1 B;  4OMM A;  2CDT A;  3L2Z A;  2ZCF B;  4GBQ A;  1N5Z A;  1G3Y A;  4C0F A;  3R6N A;  3I55 T;  1JBM A;  1OUL A;  1G5V A;  2YXY A;  2P0K A;  3C4S A;  1NBE B;  2HQE A;  2LVM A;  4FYX B;  4C92 B;  5KYW B;  2ED1 A;  1WA7 A;  3OS2 A;  2YRD A;  3HKS A;  2EYY A;  3GLX A;  1G3W A;  1QVP A;  1LVK A;  1FX7 A;  4M7A E;  1TS9 A;  4ATO A;  2P84 A;  2VV5 A;  2J06 A;  3SEM A;  1VQ8 T;  3RR6 A;  1GCQ C;  3CCM Q;  2DA9 A;  1QW1 A;  4AFS C;  1SHF A;  4C8Q A;  2JT4 A;  2RQV A;  2D0Q B;  3OS5 A;  2RJF A;  4J83 A;  3AHU A;  4QT7 A;  1D3B A;  2WSE E;  2CT4 A;  1EX4 A;  4YTL A;  1SKU B;  1VQM A;  2IVW A;  3EG1 A;  5GAN 2;  1HK9 A;  4KUL A;  3CCU A;  1LPL A;  5CCA A;  5L8R E;  2FZG B;  2CP0 A;  3QYG B;  2RJC A;  2J6F A;  3L2V A;  3FC3 A;  5KH6 A;  4HVV A;  3FLG A;  3Q1J A;  1VYU A;  3VRY A;  1BI3 A;  3JRZ A;  4N0A C;  4C92 E;  3FB9 A;  1YN8 A;  3I56 Q;  4F16 A;  2DBK A;  3UA6 A;  1S72 Q;  3MJX A;  4OF1 A;  2MF2 A;  1K9A A;  3OYH A;  3GPL A;  3HPW A;  1NYF A;  4M75 C;  3A8M B;  1D0Y A;  4A4K A;  2QK0 A;  1O75 A;  1K9M R;  1KG1 A;  1WHH A;  2DXC A;  2SRC A;  1OPL A;  3UT1 A;  3CCS A;  2OTL A;  2RQR A;  1HD3 A;  3CCR A;  1M8V A;  1TXQ A;  2CT3 A;  2DER A;  2W10 A;  1AVZ C;  4C8Q G;  3HRU A;  2HMA A;  1GFD A;  2VWF A;  1VQO A;  1G8X A;  2D1X A;  5GAO q;  5GAO r;  4LD6 A;  2FYK A;  1UGS B;  2QQS A;  3QZ5 B;  9ATC B;  4HCB A;  4HKE A;  1OEB A;  2A36 A;  1X01 A;  1OI1 A;  2KVQ G;  5GAN e;  4E2F B;  4PNO A;  4QKU A;  3G4S A;  2GF7 A;  1K0S A;  4JPB W;  1AWO A;  2VVK A;  8AT1 B;  4JJD A;  1OX9 A;  2CP7 A;  1VQN A;  4A63 B;  2RJD A;  3HFO A;  2XKO C;  4M78 F;  3BY7 A;  4F7U B;  1Y71 A;  1UGR B;  1FMV A;  1GFC A;  1H92 A;  2HSP A;  1VIE A;  1BCO A;  3PIP A;  3QHS A;  1YHQ Q;  1U06 A;  2O9V A;  3X20 B;  3C0C A;  3S6W A;  1MGQ A;  3LGF A;  3MEU A;  4OB2 B;  2PUO B;  3M5A A;  4J9G A;  1Q82 C;  1YI2 Q;  2LX9 A;  2AKL A;  3G71 A;  1YIT T;  1TTH B;  1VA7 A;  4C0G A;  1WHJ A;  5KYU B;  5HK3 A;  2KYM A;  1G2B A;  4M75 B;  2XU8 A;  1Y0M A;  4M78 D;  4A4F A;  2XDD A;  1NM7 A;  1IZ6 A;  3MPU B;  4J6X A;  4FYW B;  1GL5 A;  1M3A A;  1X27 A;  3M57 A;  1R77 A;  1KC8 U;  4OB3 B;  4C0Z A;  2BIV A;  1PRM C;  2D9T A;  3CCL A;  3CCE T;  1ZSZ C;  5GAN h;  5CR2 A;  1AWW A;  1TU0 B;  4JJN K;  1V76 A;  3FEO A;  2ZGW A;  2QA4 Q;  2AHJ B;  3NHN A;  4F7U E;  5GAN f;  3CME A;  4DA4 A;  3HTR A;  5FWB A;  1D09 B;  2DF6 A;  1ZBJ A;  1JEG A;  1RAF B;  4C5I A;  4JZ3 A;  2EGA A;  1VQ9 Q;  4RTU A;  1UHF A;  3NMZ C;  3S3O A;  4BE1 A;  1UB4 A;  2HD0 A;  2CZ6 B;  2L3S A;  3JB9 J;  4IUV A;  1MUZ A;  1UHC A;  1JU5 C;  4IUU A;  2RH2 A;  1VQL A;  3MHX A;  4M75 E;  2CYZ B;  2X9H A;  1VQM Q;  5IHK A;  1BIA A;  4V2S A;  1HSQ A;  3JCM g;  2K3B A;  3WXM B;  5CVI A;  4LDY A;  5CKF A;  4PLL A;  1PNJ A;  2GBQ A;  2VAS A;  2RQW A;  3OMG A;  4KGZ B;  4N0A A;  1DJ7 B;  1X43 A;  2QEX A;  2DL8 A;  5IT9 E;  1KIK A;  4VUB A;  2Z0W A;  1TUG B;  3QXE B;  5GAO p;  3LH0 A;  5EG2 A;  4LUE A;  2DD5 A;  2R5M A;  3KXT A;  1QWE A;  5D6W A;  1Z9Z A;  2MCN A;  1VQ7 T;  2JS0 A;  1MV0 B;  3CQT A;  4J9F A;  2K57 A;  1H3H A;  1OPK A;  2JMC A;  1KD1 R;  3CCS Q;  1ZSZ B;  4BE2 A;  2OTL Q;  5GAM g;  3PIO A;  3I55 A;  2BUD A;  4MZT A;  2OI3 A;  4KH0 B;  4M78 C;  4F17 A;  5CK9 A;  2KEA A;  1B7T A;  3ME9 A;  1Z9Q A;  1BB9 A;  1HXD A;  1VQO Q;  2L2P A;  2DX1 A;  3HRS A;  1PCX A;  2C0I A;  3CMA T;  1VQ8 A;  4QQ6 A;  4IUP A;  1M2V A;  2LNH B;  3M0T A;  1UEB A;  3H6Z A;  1C0M A;  1KC8 R;  5KCH A;  4WTO B;  3OYG A;  3OBY A;  3OYY A;  3G4S Q;  2RPN A;  2EVR A;  5DLO A;  1UTI A;  3QUI A;  1XTD A;  4J5Y A;  4IIM A;  2BTT A;  2VXE A;  3E9F A;  4Z88 A;  4M7D F;  1NZ9 A;  4M7A D;  1VQN Q;  3QBY A;  4HCK A;  2ESW A;  3QJ6 A;  4K11 A;  5LJ5 g;  2WSF E;  3V7R A;  3VS4 A;  1ABO A;  1V29 B;  3EGU A;  2KSS A;  1RLP C;  3MEV A;  2FEI A;  2E70 A;  2M02 A;  2O4X A;  4ZTF A;  4LDW A;  2K79 A;  2JZ2 A;  2YWW A;  5HK0 A;  2RHX A;  3CC2 Q;  1AZG B;  2AT1 B;  2QTX A;  1M9S A;  3S3M A;  4HA8 A;  1B34 A;  3EHR A;  3QKJ A;  3G71 Q;  1RAC B;  2KXC A;  5GMK m;  2EPD A;  1M1G A;  2ENM A;  1UFF A;  2ZAE A;  1XOV A;  1GCP A;  2LJ0 A;  1YWP A;  1PKT A;  8ATC B;  1LJO A;  3HHT B;  2PVD B;  2V26 A;  3H0H A;  1QCF A;  3PNW C;  4M78 B;  1WQ7 A;  4C92 D;  1Y07 A;  4O6J A;  5A0D A;  4PLI A;  3CCL Q;  5HCK A;  3JCM e;  3UAT A;  2CUD A;  5A2Q E;  3CME Q;  2NYS A;  3L1A A;  5GMK j;  2MK5 A;  3EGX A;  2RK1 A;  1UJY A;  4ZGD B;  5I21 A;  3CCJ Q;  3LW5 E;  3CCQ T;  2RJE A;  2DE0 X;  2COZ A;  3FJP A;  3SWN C;  1WJS A;  4XTX A;  1N8R R;  3SFM A;  4XK8 E;  2F2W A;  4DQ2 A;  1QVF S;  3TSW A;  3EG0 A;  4GLM A;  1K8A C;  3UPU A;  1VQ4 T;  1K76 A;  1UGP B;  2LCL A;  3INZ A;  2GTJ A;  3FIF A;  5GAN d;  2OJ2 A;  3EGD B;  1ZQ1 A;  1YJW Q;  4ZGJ B;  3BE3 A;  2RB6 A;  2FZK B;  4JRI A;  4R0K A;  3S3N A;  1BBZ A;  2K6D A;  1FMK A;  3U23 A;  4M78 E;  1OZ3 A;  4M7A C;  4BI4 A;  4CC4 B;  3CD6 T;  2EKH A;  1WFW A;  2EJF A;  2F2V A;  4M77 F;  2DIQ A;  1VQK Q;  4FU6 A;  1RL2 A;  1YIT A;  3TRE A;  5LJ3 g;  5GAO l;  1N9S A;  2QQ9 A;  3J7A F;  3X26 B;  4L5G A;  2XMF A;  4O5V A;  2YUQ A;  1SPK A;  1K73 U;  4Y91 A;  2A3L A;  4FCY A;  2A08 A;  1CSK A;  2DJZ A;  1OV3 A;  1ZA2 B;  4EDU A;  2EQU A;  2M16 A;  1KQS S;  1H64 1;  2M1H A;  3CCE A;  3OYI A;  3P8H A;  2A0F B;  1VIF A;  4RKU E;  4M77 D;  1I4K 1;  1VQ6 T;  4X9D A;  2X4X A;  4HT8 A;  2RI5 A;  4C92 C;  1TH7 A;  5LL6 S;  4BY6 C;  2LZ6 B;  1BI2 A;  1VQ8 Q;  3SWN B;  3V7S A;  2ZZD A;  4E7H A;  1IXD A;  4EMH A;  3BFM A;  3PT9 A;  3JSC A;  1QVF A;  2DTO A;  4FW1 A;  4FT4 A;  5KYY A;  2VKN A;  1RAD B;  2JNG A;  2EQM A;  2NUP B;  2ZPG B;  2Y90 A;  4HXJ A;  2F1L A;  3JB9 G;  3OYM A;  1WXU A;  1T0H A;  1M1K C;  2EQI A;  3UF4 A;  2LQ8 A;  1Q81 C;  2AZS A;  5HY6 A;  4EMK A;  4RG8 A;  1VQ5 T;  1G83 A;  4J9B A;  1M3B A;  2HKQ B;  4BDZ A;  4JS5 A;  2MPX C;  4KBM B;  1JJ2 P;  1IO6 A;  4NS5 A;  4ZN3 A;  5I22 A;  3J80 E;  3CEY A;  3TEE A;  4M75 D;  3OYJ A;  3OQ5 A;  3SD4 A;  2X4J A;  3A8O B;  5FLX E;  2KT8 A;  4CC2 A;  3RUX A;  1Y57 A;  2KYB A;  5I2S A;  1M27 C;  3RDV A;  3JCM X;  1R8O B;  3G1J A;  2O2O A;  2DLP A;  2RO0 A;  2F5T X;  1VQ7 A;  4KUD K;  2YUP A;  2E10 A;  2MWO A;  4M7D B;  2EYX A;  3OYK A;  3LWH A;  1YJ9 T;  1KQS A;  3RMS A;  3EH1 A;  3H8Z A;  5J39 A;  2A7Y A;  4BDY A;  4TVR A;  1W2B S;  3VKI A;  1RAI B;  3RIR A;  1ZHI A;  2Y4X A;  3M0U A;  4EPC A;  5GAN 3;  3MEA A;  3O8V A;  4X1V A;  2NLU A;  2XID A;  4PJJ A;  5A0L A;  3MCA B;  3DB3 A;  2CSQ A;  2DL7 A;  4BY6 B;  3CMA A;  1TUC A;  1XJW B;  2CP6 A;  1T3L A;  2LQK A;  3LX7 A;  1K73 R;  2FPF A;  3ZFJ A;  3OS1 A;  4M77 C;  3E19 A;  5LJ3 e;  3MP1 A;  3A1P A;  2EWN A;  2I0N A;  1GRI A;  2YLB A;  2OAU A;  4RMO A;  4AMC A;  2DM1 A;  2KRS A;  3TCJ A;  2BZ8 A;  4PKC C;  3NTH A;  1YJN T;  2C0O A;  4M7A A;  2O31 A;  4D8K A;  4A4H A;  2XHC A;  3MP6 A;  1N6A A;  2GQI A;  2DVE A;  3EG3 A;  3KBG A;  3QG1 A;  3KFV A;  1OU8 A;  5GAN 7;  1BIB A;  3JCM W;  2EAY A;  1YIJ T;  1XQH A;  3H9N A;  1NPR A;  2E5K A;  4BE0 A;  1KQ2 A;  3OB9 A;  2CZ0 B;  3GNF B;  1B3Q A;  3EFS A;  1AD5 A;  3RES A;  3UWN A;  3JB9 H;  5GAN j;  3VV0 A;  3EG9 A;  3GNG A;  2K9G A;  2DPP B;  2GNC A;  3CPF A;  2X4W A;  1JJ2 A;  1PWT A;  2FL7 A;  1G3T A;  2GTO A;  4ME7 A;  2EYZ A;  1W2B A;  4MML A;  4JS4 A;  3CC7 T;  4JRP A;  1S1N A;  4C92 A;  5KYW A;  1PC0 A;  3KUF A;  4JRK A;  1SSF A;  1WQW A;  2WSC E;  2LCC A;  2HAX A;  2QGF B;  5LJ3 f;  1YCS B;  4PJO F;  1WXT A;  1PM3 A;  3JB9 I;  4M77 B;  1IGU A;  2C0T A;  4DBH A;  3CCQ A;  4XAX B;  3VU3 C;  2FRW A;  1H8K A;  2DEQ A;  4M7A G;  1ZBX A;  4DBQ A;  2HBW A;  3NPF A;  4OML A;  1QQJ A;  4A4G A;  2KR3 A;  1VQ4 A;  4LN2 A;  2KK4 A;  5GMK i;  4Z02 A;  3REA B;  2RQU A;  3I5R A;  2V1R A;  5AT1 B;  5CKD A;  2EW3 A;  2KRO A;  2LX7 A;  1Y96 B;  2FPD A;  3CC4 T;  3QWX X;  2DVJ A;  2RNA A;  2LQN A;  1N9R A;  1Y7X A;  2QDL A;  2H3J A;  4A53 A;  3OYE A;  4PJO D;  4X9C A;  3JAM E;  2RHI A;  2JTE A;  2M9U A;  3PTA A;  2MIO A;  2L8D A;  3NFC A;  3MP8 A;  3CD6 A;  4C5H A;  1HJD A;  2RHY A;  1KD1 U;  2PVO B;  2K5I A;  4BI8 B;  5DM7 R;  1BI0 A;  4IUR A;  4N4I A;  4EIK A;  3LLR A;  4KUI A;  2KNB B;  3LWI A;  3O5Z A;  5J26 A;  3MO8 A;  4C92 G;  4M77 E;  2I2L A;  3VJP A;  3MKD A;  1NYG A;  1VQ7 Q;  2F5K A;  2EJ9 A;  4HCZ A;  4N4H A;  1I81 A;  3VYH B;  3A8L B;  4RTV A;  5GJW B;  3X24 B;  3DB4 A;  4J7F A;  1SEM A;  4OB1 B;  3I56 T;  1MMD A;  2V1Q A;  5I11 A;  2DYB A;  4NL2 A;  2GFU A;  2HL3 A;  2YRC A;  4UC4 A;  1VQ6 A;  3C95 A;  1GCQ A;  1W4S A;  2M51 A;  1BCM A;  2V8J A;  2DKG A;  4DOV A;  1I0C A;  3CMA Q;  3SHW A;  3VUZ A;  2YT6 A;  2L3P A;  1ZUY A;  2FRY A;  2RMO A;  1IB8 A;  4Y92 A;  4OGC A;  2ZPH B;  2E3H A;  3NTK A;  2H8H A;  3PMI A;  2DFU A;  1ZSG A;  3HL8 A;  5D7U A;  1N27 A;  4F7U A;  2YRV A;  2PQW A;  2V8I A;  4BI3 A;  4OMF B;  2CZ1 B;  1VOM A;  2VGN A;  1VQ5 A;  5FU7 B;  3QDR B;  1CKA A;  3PFS A;  4QQD A;  4C5E A;  3VS1 A;  4C0D B;  1K1Z A;  3CCU Q;  4P5N A;  5KYN A;  2ATC B;  4DEX A;  2EGC A;  4ORZ A;  1M30 A;  3A5Z B;  4E7S A;  2D0N A;  1FXX A;  4PJO C;  4ELZ C;  2XIC A;  2QQA A;  1MNE A;  3LYI A;  5KYU A;  4E7Z A;  2YUN A;  4M75 A;  2E6N A;  3MET A;  3WVD B;  4BAC A;  1BI1 A;  2EQK A;  5IH2 A;  2NUT B;  1YJ9 A;  2O4X B;  1U1S A;  2DRK A;  2COW A;  4JDS A;  1YI2 T;  2E12 A;  2M0O A;  3VS6 A;  3CCR Q;  1LNX A;  1RAG B;  1N8R U;  3OS0 A;  4CRI A;  4OB0 B;  1AZE A;  4C8Q F;  1B34 B;  2K5L A;  1JRI A;  1K9M C;  2JVV A;  2HSE B;  4CC7 A;  5IAY A;  4ELY C;  3GBQ A;  4EMG A;  2H3E B;  2QYZ A;  3L42 A;  1D1C A;  4F7U G;  3M9Q A;  2F2X A;  1RAH B;  2X51 A;  5KYX B;  2EQJ A;  5GAN 5;  2YSQ A;  3M0P A;  4R55 A;  2E41 A;  1X6O A;  1X75 C;  2QA4 T;  2FG0 A;  5AYF A;  2XDB A;  3VRZ A;  1PKS A;  3WVE B;  1VQ4 Q;  1SSH A;  2ECZ A;  2QI2 A;  3EFO B;  2HBP A;  4OGE A;  1WJR A;  1YJN A;  5LJ3 d;  2RD1 A;  2X3W D;  2RHZ A;  1VQ9 T;  1MND A;  1SF9 A;  3BW1 A;  4M75 G;  3URG A;  2QQR A;  5D6Y A;  3OYL A;  2FZC B;  4LDU A;  2DET A;  2MAM A;  2AIR B;  2PNI A;  3M58 A;  1ZUK A;  2JMA A;  3CD6 Q;  1YIJ A;  4PJO B;  2X35 A;  4JUV A;  2RF0 A;  2JXB A;  3P8D A;  3UDC A;  1PG5 B;  3FRN A;  4XU2 A;  4A4E A;  2DMO A;  2KT1 A;  2K7A A;  5L23 A;  4M7D D;  2DNU A;  4IIO A;  1U3O A;  2QQB A;  5CKH A;  1IRE B;  1O9S A;  2VGM A;  2DO3 A;  2QGG A;  1IRX A;  2LJ1 A;  4PJM A;  5D6X A;  1ZSZ A;  1YP5 A;  2ZPB B;  3RKY A;  3CC7 A;  1QKX A;  1NLP C;  3EHQ A;  1WJQ A;  1M8M A;  1TSF A;  2EJG A;  2CH4 W;  1QVG P;  5CQX A;  2MI6 A;  3OYN A;  2LNV A;  2COY A;  2O9S A;  1AEY A;  3QWY A;  3ZBD A;  2DXU A;  4PJO E;  3DLL A;  4FYV B;  3VYG A;  4QW2 A;  1IHW A;  4IUT A;  3FJ5 A;  1UDL A;  1GXI E;  1I1J A;  1T3S A;  5FRN A;  1YWO A;  3H0I A;  3JCM b;  2SEM A;  4DOW A;  4LUD A;  4E7L A;  1VQL Q;  3QPH A;  3AT1 B;  3CC4 A;  2JJ9 A;  4XTY A;  2DIL A;  1ZUU A;  4FIB A;  7AT1 B;  1Q82 U;  1QWF A;  5GAM e;  2QDY B;  4HT9 A;  2CP3 A;  4JLI A;  1VQ5 Q;  2DZC A;  2YUO A;  2K3X A;  1QKW A;  4XTW A;  1UG1 A;  3RNJ A;  2XG8 D;  2KRM A;  2QEX Q;  2AKK A;  1X2Q A;  2B8A A;  3M56 A;  3CBO A;  2DK3 A;  3RMQ A;  1M90 U;  4ZTJ A;  1M4Z A;  3FDR A;  1VUB A;  2L3R A;  3L2W A;  2BE9 B;  3JCM h;  1WNL A;  4KH1 B;  2HEQ A;  5GMK e;  3JCM f;  1E6G A;  4PK4 A;  4M78 A;  2QAZ A;  5IHN A;  1YJ9 Q;  4RTY A;  2ROT A;  3CC2 T;  1EIF A;  2EIF A;  1OQK A;  2HL5 C;  3VS3 A;  1R0B G;  3I56 A;  4M7D C;  5EC7 A;  5LJ5 e;  4ESR A;  3I55 Q;  1YCY A;  4ANJ A;  3QSU A;  1WDX A;  4Z89 A;  2DAQ A;  2DD4 A;  3TSZ A;  2HZY A;  4X34 A;  4DBR A;  3VS2 A;  1UE9 A;  4BUG A;  1WIE A;  1JO8 A;  2DXB A;  4FM4 B;  2DL5 A;  1KD1 C;  3EG2 A;  1K4U S;  3PE0 A;  2ROL A;  4L59 A;  4XU0 A;  1X6B A;  2ED0 A;  4E6R A;  3PMT A;  1UEC A;  4JRQ A;  2OTJ T;  3BDL A;  3ZEH A;  1AHJ B;  2LCS A;  1IHV A;  4GLK A;  5GAM h;  5GAM f;  3OYF A;  3TQ7 P;  2L5Q A;  3RKX A;  3EGD A;  1KQ1 A;  1QCO A;  4QVZ A;  3GOX A;  1KC8 C;  3CCJ T;  4PJL A;  1WXB A;  4AFQ C;  2PTK A;  1RUW A;  1NG2 A;  4KRT A;  4J8O A;  1SRL A;  1D0Z A;  5GMK l;  4C8Q B;  2PZ1 A;  2DTH A;  4C5G A;  5CQY A;  4J6Y A;  1R0C B;  4JLG A;  4RTT A;  4XTU A;  1X69 A;  1D3B B;  4DBF A;  2CP5 A;  3L2R A;  4AT1 B;  3BDU A;  1WHG A;  3C12 A;  4FW2 A;  4M78 G;  2EYQ A;  3DLM A;  2A37 A;  3EFR A;  1YJW T;  3LGL A;  1RI0 A;  5LJ5 h;  1Q82 R;  2VXF A;  2BZY A;  3THK A;  5LJ5 f;  2FB7 A;  4FL6 A;  4ZNX A;  4PJN A;  4QVD A;  1EZZ B;  1VQP T;  2L0A A;  2HDA A;  1F1B B;  1PD1 A;  2DXT A;  1E6H A;  2E3I A;  3V7C A;  1JJ2 S;  1YI2 A;  1VQK T;  5GAN 8;  3CC7 Q;  5A0G A;  3CXC P;  5GAN g;  1UUE A;  2CUB A;  1CKB A;  2ZPF B;  1M90 R;  4D6W A;  2E5Q A;  4J9C A;  2E1H A;  2VB6 A;  5CKE A;  4ZN1 A;  2X3X D;  5FRM A;  2JM9 A;  2B86 A;  1M1F A;  3EG9 B;  5J3B A;  1OZ2 A;  4QQG A;  3SWN A;  4HVW A;  3JCM J;  4C8Q E;  3OYB A;  4E7J A;  2D8J A;  4RTW A;  2KXD A;  3JCM V;  3J81 E;  4Z8A A;  3CXC S;  2KBT A;  1I5O B;  2DIG A;  1WHL A;  4LD9 K;  2QA4 A;  2NUP A;  2K4Y A;  1BKB A;  4E7I A;  2DEU A;  4CC3 A;  1XNI A;  3CBM A;  3OSS C;  3L2Q A;  4MMK A;  3C94 A;  3CC4 Q;  2HQH A;  2R58 A;  4J9D A;  4AFU C;  1JXO A;  2KE9 A;  1N8R C;  1VQ9 A;  2L3Q A;  1WPY A;  2YLC A;  1BK2 A;  2OX7 A;  3P8B B;  4M7D E;  3CPW P;  2IG0 A;  2LQW A;  3ZL7 C;  3G6E T;  2KGT A;  2M0Y A;  2DRM A;  2X4Y A;  1T0J A;  4RTZ A;  2JTM A;  1YIT Q;  3UA7 A;  4D8D A;  2Y4Y A;  1NJI U;  2E64 A;  5CO7 A;  1V1C A;  1WI7 A;  2CZ7 B;  4LNP A;  3RBB B;  4M7D A;  4F14 A;  3CPW S;  1WYX A;  4KGX B;  1RAB B;  5DY9 A;  3PVL A;  4KT0 E;  4F04 B;  2J6K A;  5I2M A;  1SRM A;  3E9G A;  1JQQ A;  3CCV T;  3CCE Q;  1M2O A;  1FYN A;  1PD0 A;  3JV3 A;  4R56 A;  4CI0 C;  5LJ3 h;  3V8K A;  4XTZ A;  5IXB A;  4A54 A;  2KI7 A;  1M5Q 1;  2WAC A;  1K8A U;  3OYD A;  1AWX A;  1C1A A;  2GCX A;  3GP8 A;  2JOY A;  3JCM P;  1PHT A;  1E7O A;  3JCM d;  1NEG A;  2G6F X;  3CXC A;  1X2K A;  2MMP A;  1X6G A;  4RG2 A;  2NWM A;  3OA6 A;  3GIB A;  1I5L A;  2EGE A;  5FWC A;  3M0Q A;  3V8J A;  2FO0 A;  3X25 B;  3OYA A;  2VUB A;  1C6V X;  1U1T A;  3JB9 F;  5KCO A;  1Q86 U;  3IQL A;  3CCM T;  1Q7Y U;  2XD0 A;  3QJY A;  2HQX A;  1QCN A;  4FSX A;  2EYW A;  1GBQ A;  3DKM A;  5FU7 C;  4NOY A;  1QLY A;  3SDZ A;  4C0D C;  2XI9 A;  4M7D G;  2F69 A;  2DYI A;  5ECA A;  4L6V 5;  5GAM d;  4AG1 C;  4J9I A;  3L2U A;  2NUZ A;  1P92 A;  2VC8 A;  1UGQ B;  2FVU A;  2LTO A;  3EAE A;  1OU9 A;  3M55 A;  4XQ3 A;  1PSE A;  1W1F A;  2J7I A;  1W70 A;  4XU3 A;  3JB9 D;  2YDL A;  3MEW A;  3CPW A;  4PFO A;  2KRN A;  2G3R A;  2W0Z A;  1PSF A;  3CC2 A;  5IXF A;  3M59 A;  1ABQ A;  4MDW A;  2QAS A;  1S72 T;  1M3C A;  3QDF A;  2V8K A;  3M4G A;  1SG5 A;  2DJQ A;  1NJI R;  2LC4 A;  5C6S A;  2PUK B;  1U8R A;  4IUQ A;  2L89 A;  4M77 A;  4RCB A;  1BYM A;  3I9Q A;  5LJ5 d;  1MMG A;  2OTJ A;  1D0X A;  2RN8 A;  1M90 C;  2CSI A;  1M1K U;  1Q81 U;  3OW2 P;  4Q5W A;  4LDX A;  2EFI A;  1EFN A;  1QP3 A;  2BKD N;  2P4T A;  3H0F A;  1K73 C;  5GAN 6;  1Y96 A;  2MWP A;  3QO3 A;  3H41 A;  4M4Z A;  3CBP A;  1I07 A;  3CCJ A;  2LT1 A;  1K8A R;  6AT1 B;  2J05 A;  3QYH B;  3NTI A;  4J7I A;  3ASK A;  3M0S A;  1M2V B;  2RK2 A;  4OMQ A;  3OW2 S;  3M4Y A;  1SHG A;  4E47 A;  2LT4 A;  1LCK A;  1KJW A;  1JXM A;  1YJW A;  2C06 A;  3QII A;  4J6W A;  1Q86 R;  1Q7Y R;  2JN0 A;  2KQW A;  1WHK A;  1YHQ T;  2R5A A;  3T9N A;  1U5S A;  4MZP A;  1B07 A;  2RQT A;  4XTV A;  4B9W A;  1VQP A;  2JW4 A;  1HYO A;  1WLP B;  1FMW A;  5GAO n;  4BB7 A;  2OAW A;  1ARK A;  4M77 G;  1VQK A;  2QXF A;  2ZPI B;  1MHN A;  4BD3 A;  3I5S A;  1QMC A;  1ACM B;  3N5B B;  2LP5 A;  1J3T A;  4AFZ C;  1ZLM A;  4PL6 A;  3HRT A;  1RAA B;  2RM4 A;  3ER0 A;  1K0X A;  4N4G A;  3M0R A;  1MMA A;  4FSS A;  3OYC A;  2RHU A;  3CCQ Q;  5GAO m;  4M7A F;  1AWJ A;  1PRL C;  3LH5 A;  3NGP A;  1VYT A;  1KSW A;  5CKB A;  4C8Q D;  3EGX B;  4E7K A;  2ABL A;  2KDS A;  4QVC A;  5IHI A;  1RLQ C;  3VUB A;  2LJ3 A;  1M1K R;  3OW2 A;  2IPO B;  3E2U A;  1Q81 R;  3PVQ A;  2O88 A;  1KHC A;  1AT1 B;  3G6E A;  1D1B A;  1TG0 A;  3A98 A;  1YFN A;  3PGG A;  2IIM A;  1WGS A;  2P0Q A;  4OP0 A;  1VYV A;  3M54 A;  4FYY B;  4OMP A;  1VQM T;  2VYT A;  3GF5 A;  4AG2 C;  3HP9 A;  3CCU T;  2AZV A;  4C92 F;  3A8H B;  2PU9 B;  2NUT A;  2CP2 A;  4EMK C;  1TOV A;  4PFP A;  2E65 A;  4WF2 A;  3ULR B;  5CIU A;  2CKK A;  2GQV A;  5FRO A;  3G7Z A;  2A28 A;  3CCV A;  2CRE A;  3EH2 A;  3TVT A; 
#chains in the Genus database with same CATH homology
 2L3S A;  1WXB A;  4AFQ C;  2PTK A;  1MUZ A;  1PWT A;  1RUW A;  1NG2 A;  1JU5 C;  1UHC A;  2J6O A;  2GTO A;  4KRT A;  2EYZ A;  1SRL A;  1S1N A;  2PZ1 A;  5IHK A;  4RTT A;  1X69 A;  1HSQ A;  2K3B A;  1YCS B;  1PNJ A;  2GBQ A;  2K2M A;  2A37 A;  2RQW A;  1WXT A;  1X43 A;  2JM8 A;  2P4R A;  2C0T A;  2DL8 A;  1KIK A;  1RI9 A;  2BZY A;  2BZX A;  2FRW A;  3THK A;  4ZNX A;  1H8K A;  2MOX A;  2HBW A;  3NPF A;  4OML A;  4LUE A;  1YNZ A;  2L0A A;  2HDA A;  2KR3 A;  4LN2 A;  1E6H A;  1WX6 A;  3REA B;  3REB B;  1QWE A;  2RQU A;  3I5R A;  1Z9Z A;  3VS0 A;  2V1R A;  2EW3 A;  2KRO A;  2MCN A;  2LX7 A;  2FPD A;  1UUE A;  2CUB A;  2JS0 A;  1MV0 B;  2DVJ A;  3I35 A;  2RNA A;  1CKB A;  3QWX X;  4JJB A;  2LQN A;  3CQT A;  4J9F A;  1H3H A;  1OPK A;  2QDL A;  2JMC A;  4J9C A;  2X3X D;  2JTE A;  2MIO A;  2JM9 A;  2B86 A;  4WCI A;  1GBR A;  2OI3 A;  4F17 A;  4HVW A;  2KEA A;  1Z9Q A;  1BB9 A;  1HJD A;  2L2P A;  2DX1 A;  2D8J A;  4RTW A;  1KFZ A;  1A0N B;  5GJV B;  2KXD A;  2EBP A;  2C0I A;  4Z8A A;  2KBT A;  2DL4 A;  4EIK A;  2KNB B;  2LNH B;  3M0T A;  1NLO C;  3O5Z A;  1TUD A;  4CC3 A;  4JJC A;  1NYG A;  2FPE A;  4J9E A;  2RPN A;  4J9D A;  4OMN A;  2EVR A;  4AFU C;  1JXO A;  1UTI A;  2KE9 A;  2L3Q A;  1AOJ A;  4RTV A;  5GJW B;  1BK2 A;  4IIM A;  1SEM A;  2BTT A;  2DBM A;  4Z88 A;  2JS2 A;  1UGV A;  2V1Q A;  5I11 A;  4HCK A;  2DYB A;  2ESW A;  4K11 A;  3VS4 A;  1ABO A;  2LQW A;  3ZL7 C;  2KGT A;  2M0Y A;  2DRM A;  3EGU A;  1GCQ A;  1RLP C;  2M51 A;  2FEI A;  1BU1 A;  1T0J A;  1I0C A;  3SHW A;  4RTZ A;  2YT6 A;  2L3P A;  2K79 A;  1ZUY A;  2FRY A;  2RMO A;  4Y92 A;  3UA7 A;  4D8D A;  2HCK A;  2GGR A;  1AZG B;  1V1C A;  1WI7 A;  4DEY A;  4LNP A;  3RBB B;  2H8H A;  3EHR A;  4F14 A;  4HVU A;  1WYX A;  2DL3 A;  2KXC A;  1ZSG A;  2EPD A;  2ENM A;  4LE9 A;  3PVL A;  1UFF A;  1XOV A;  1GCP A;  2J6K A;  2LJ0 A;  1YWP A;  1PKT A;  1SRM A;  4RTX A;  1JQQ A;  1FYN A;  3H0H A;  1OOT A;  3JV3 A;  1QCF A;  4RUG A;  5IXB A;  1CKA A;  2LMJ A;  3VS1 A;  1K1Z A;  5HCK A;  1AWX A;  4DEX A;  3UAT A;  1W6X A;  2CUD A;  2EGC A;  4ORZ A;  1PHT A;  1E7O A;  1M30 A;  4JZ4 A;  2AK5 A;  1NEB A;  1NEG A;  2D0N A;  2G6F X;  1X2K A;  4OMO A;  1X6G A;  2NWM A;  1UJY A;  2YUN A;  1UJ0 A;  2EGE A;  1ZX6 A;  5FWC A;  2CH4 A;  3M0Q A;  1MV3 A;  2FO0 A;  2DE0 X;  5FW9 A;  3VS7 A;  5IH2 A;  2F2W A;  3TSW A;  3IQL A;  3EG0 A;  4GLM A;  1K76 A;  2DRK A;  3VS5 A;  3VS6 A;  2GTJ A;  2EYW A;  2D8H A;  1GBQ A;  2OJ2 A;  4J9H A;  1AZE A;  1QLY A;  4OMM A;  2CDT A;  4GBQ A;  1N5Z A;  4R0K A;  5ECA A;  4CC7 A;  3R6N A;  1BBZ A;  2K6D A;  4J9I A;  4AG1 C;  1FMK A;  3GBQ A;  2NUZ A;  3U23 A;  4CC4 B;  2EKH A;  2F2X A;  1WFW A;  2YSQ A;  2ED1 A;  1WA7 A;  1W1F A;  2J7I A;  1W70 A;  3M0P A;  2F2V A;  2EYY A;  2YDL A;  2KRN A;  2J06 A;  3SEM A;  2W0Z A;  2FG0 A;  1GCQ C;  2DA9 A;  3VRZ A;  1PKS A;  4AFS C;  1SHF A;  5IXF A;  2JT4 A;  1SSH A;  2ECZ A;  2RQV A;  1ABQ A;  2XMF A;  2YUQ A;  1SPK A;  1M3C A;  4QT7 A;  2CT4 A;  2X3W D;  2A08 A;  1CSK A;  2DJQ A;  1OV3 A;  2PNI A;  3I9Q A;  3EG1 A;  1ZUK A;  2JMA A;  2RN8 A;  2RF0 A;  2CSI A;  2JXB A;  2DMO A;  2KT1 A;  2J6F A;  1EFN A;  2LZ6 B;  2K7A A;  4HVV A;  5L23 A;  1VYU A;  3VRY A;  2DNU A;  4IIO A;  3H0F A;  1U3O A;  3H41 A;  4M4Z A;  1YN8 A;  1I07 A;  4F16 A;  2DBK A;  2J05 A;  3UA6 A;  2LJ1 A;  2VKN A;  3M0S A;  1YP5 A;  1K9A A;  1QKX A;  4OMQ A;  4HXJ A;  1NYF A;  1NLP C;  1WXU A;  1T0H A;  3EHQ A;  2EQI A;  3UF4 A;  1M8M A;  2AZS A;  2SRC A;  1OPL A;  2CH4 W;  1SHG A;  2RQR A;  1HD3 A;  1G83 A;  4J9B A;  1M3B A;  2CT3 A;  2W10 A;  1LCK A;  1AVZ C;  1KJW A;  1JXM A;  2O9S A;  1GFD A;  2VWF A;  1AEY A;  1IO6 A;  3QWY A;  2D1X A;  5I22 A;  1U5S A;  2KT8 A;  1B07 A;  2RQT A;  4CC2 A;  3FJ5 A;  1UDL A;  1I1J A;  1T3S A;  1Y57 A;  2JW4 A;  2KYB A;  1WLP B;  1OEB A;  2A36 A;  1YWO A;  2OAW A;  1M27 C;  3H0I A;  1ARK A;  2SEM A;  2O2O A;  2DLP A;  4LUD A;  3I5S A;  2YUP A;  1K0S A;  2DIL A;  1ZUU A;  4JPB W;  2EYX A;  2LP5 A;  1QWF A;  1AWO A;  1J3T A;  4AFZ C;  2VVK A;  1ZLM A;  4JJD A;  4A63 B;  1K0X A;  2YUO A;  3M0U A;  3M0R A;  1QKW A;  1GFC A;  1H92 A;  4FSS A;  2HSP A;  4X1V A;  1UG1 A;  3RNJ A;  2KRM A;  2AKK A;  1X2Q A;  1U06 A;  2CSQ A;  2DL7 A;  2O9V A;  1TUC A;  1T3L A;  1AWJ A;  3C0C A;  2FPF A;  1PRL C;  3LH5 A;  3NGP A;  1VYT A;  4J9G A;  2HEQ A;  1KSW A;  2AKL A;  1E6G A;  1VA7 A;  2ABL A;  2I0N A;  5IHI A;  1RLQ C;  2KYM A;  1GRI A;  1G2B A;  4RTY A;  5IHN A;  2ROT A;  1Y0M A;  2LJ3 A;  3VS3 A;  2DM1 A;  5EC7 A;  2KRS A;  3PVQ A;  4ESR A;  1NM7 A;  1WDX A;  2BZ8 A;  2O88 A;  2C0O A;  4Z89 A;  1GL5 A;  3TSZ A;  1M3A A;  2O31 A;  1TG0 A;  1X27 A;  3A98 A;  4D8K A;  2IIM A;  3VS2 A;  1UE9 A;  1WIE A;  1JO8 A;  1VYV A;  2GQI A;  2DL5 A;  1PRM C;  4OMP A;  3EG2 A;  1K4U S;  3PE0 A;  3EG3 A;  2ROL A;  1AWW A;  3KFV A;  1X6B A;  2ED0 A;  4E6R A;  4AG2 C;  1UEC A;  3NHN A;  2E5K A;  2LCS A;  2AZV A;  1B3Q A;  5FWB A;  1AD5 A;  2DF6 A;  1ZBJ A;  3ULR B;  1JEG A;  4JZ3 A;  2EGA A;  4RTU A;  1UHF A;  3NMZ C;  2K9G A;  2A28 A;  2CRE A;  3TVT A;  2GNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...