2J6OA

Atypical polyproline recognition by the cms n-terminal sh3 domain. cms:cd2 heterotrimer
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords CD2-ASSOCIATED PROTEIN
publication title Atypical Polyproline Recognition by the Cms N-Terminal SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j6oA00
1RUWA 2O2OA 2JMAA 3LH5A 3NPFA 2YUQA 2YSQA 2PTKA 2JW4A 1UDLA 2JS2A 4X1VA 1U06A 1BB9A 2CSQA 2A36A 4LUEA 2DL4A 1QWFA 1QLYA 2O31A 4EIKA 1OOTA 2ECZA 1SRLA 2QDLA 1M27C 2O88A 3O5ZA 1M3AA 1AWWA 3TSZA 4RTWA 2DX1A 2J6OA 2J6KA 1UE9A 5I22A 3GBQA 4GLMA 2AK5A 4RTUA 2ROLA 4JZ4A 2RNAA 1JXMA 4AFSC 1IO6A 2RF0A 2EGCA 2W10A 1QKWA 2JS0A 3VS7A 1RLQC 2YDLA 2J06A 3FJ5A 3REAB 1SPKA 4JJDA 2FG0A 3QWYA 1M3BA 2DE0X 2EYZA 2F2VA 1SEMA 1N5ZA 1TG0A 1GCPA 2HEQA 2JMCA 2RQRA 2IIMA 2HCKA 3C0CA 2JXBA 2ROTA 1M30A 4R0KA 1FMKA 3SEMA 1I0CA 1E6GA 1T0HA 2KBTA 4Z8AA 1H8KA 1ZUYA 2D1XA 3JV3A 5IH2A 1GRIA 2C0IA 1BK2A 1UJYA 1U5SA 2J7IA 4RTTA 4RUGA 2DA9A 1K0SA 1FYNA 2PZ1A 3PE0A 4HVUA 4HVVA 3IQLA 4CC7A 4JJCA 1JO8A 2VVKA 2JT4A 2K79A 1X6BA 4E6RA 2GTOA 2FO0A 1AWJA 4HXJA 2KROA 2KGTA 4Z88A 1ZUUA 2FEIA 3EG3A 2C0TA 4JZ3A 3A98A 1X6GA 2LNHB 3EG1A 4J9CA 1UJ0A 1GL5A 2G6FX 2L3PA 3THKA 1WI7A 2RPNA 2KXDA 4A63B 1LCKA 2I0NA 2DLPA 2AZVA 1WLPB 2EYYA 3U23A 1VYVA 2K3BA 1UHFA 1J3TA 2E5KA 2OAWA 1TUCA 1GCQC 1JQQA 2CT4A 4K11A 1X27A 1YN8A 1ABOA 4RTVA 1NEBA 4DEYA 1T3SA 5FWBA 3RNJA 5IHNA 1AWOA 4JJBA 1CSKA 3M0QA 1PWTA 2DVJA 2ED0A 4IIOA 3KFVA 2A37A 2DL3A 3H41A 3VS5A 4OMLA 2VKNA 3I9QA 5GJWB 3ULRB 2DJQA 2KRMA 1GCQA 2GBQA 2KR3A 1B07A 2LP5A 1TUDA 2W0ZA 1E7OA 3H0IA 1W6XA 1Z9QA 1XOVA 1ZUKA 1HSQA 2DL7A 5IHKA 2SRCA 1AZGB 4AG2C 2RQVA 4F17A 2AKLA 3VS0A 2CDTA 2AZSA 2M0YA 3SHWA 3I5RA 2CT3A 2CH4A 2K7AA 2YUPA 2P4RA 1Y0MA 2RQWA 3UA7A 1MV0B 1SHFA 3VS2A 2CSIA 2ENMA 1K1ZA 1UG1A 2JTEA 3R6NA 1QCFA 1UHCA 1WXBA 3M0TA 4LN2A 4LNPA 4QT7A 2VWFA 2FRYA 3PVQA 2DRKA 3EHRA 2LJ1A 3UA6A 2YUNA 2NWMA 2NUZA 5ECAA 2KE9A 4ESRA 4CC2A 2KYBA 1NG2A 1BBZA 2FPDA 2J6FA 5IXBA 2KRSA 2KYMA 3EG0A 2RQUA 4OMQA 2GTJA 3M0SA 3EHQA 2C0OA 2EYXA 2MOXA 2X3WD 1VYUA 4J9FA 1WA7A 1WX6A 3RBBB 2DNUA 1QKXA 1KSWA 2ABLA 1T3LA 4ORZA 1K4US 2ED1A 1RI9A 3TVTA 1HD3A 1YWPA 2YUOA 2MCNA 2GQIA 1KFZA 1OEBA 4AFUC 1Z9ZA 1PHTA 2H8HA 1SSHA 4M4ZA 1NYFA 3REBB 4Y92A 1PKTA 1X43A 4KRTA 5GJVB 1NYGA 4IIMA 1RLPC 5EC7A 5IXFA 2HBWA 1K76A 2PNIA 3VS3A 4RTXA 4F16A 2DF6A 4J9DA 1H92A 4RTYA 1I1JA 1VYTA 2OJ2A 4D8DA 4JPBW 3NHNA 2F2WA 1ZBJA 2CH4W 2L0AA 2LJ0A 2JM8A 4OMMA 1UECA 2A28A 4CC3A 1JU5C 2LX7A 4FSSA 2D8JA 2V1RA 1A0NB 1U3OA 1OV3A 1Y57A 2K9GA 3M0PA 1UGVA 2O9VA 3QWXX 3UF4A 2DL5A 5FW9A 4ZNXA 2KEAA 1X2QA 3M0RA 2KXCA 3VS6A 2DILA 1SHGA 1YNZA 4GBQA 1JXOA 2D0NA 1NLOC 1H3HA 1PRMC 1MUZA 2LCSA 4RTZA 2DL8A 2KT8A 2EVRA 2MIOA 2RN8A 5FWCA 1WXTA 1X2KA 1PKSA 1G2BA 2DM1A 3NGPA 1EFNA 1UFFA 1B3QA 2RQTA 1ARKA 4J9BA 1E6HA 2DYBA 2LZ6B 4J9IA 3NMZC 1W70A 3VS4A 1OPLA 2M51A 1X69A 3ZL7C 3H0HA 2B86A 4AFZC 3VS1A 2DBMA 2GNCA 1UTIA 2J05A 4WCIA 1AD5A 1BU1A 2EYWA 1KIKA 4J9GA 3EGUA 1GFDA 4HVWA 1YP5A 2GGRA 2BZ8A 1NLPC 1YCSB 4Z89A 1CKBA 3VRYA 4HCKA 1M3CA 2EPDA 1WYXA 1CKAA 2HSPA 1WFWA 4CC4B 1NEGA 2L3SA 1S1NA 1GBRA 2EKHA 2D8HA 1AEYA 1M8MA 2V1QA 4D8KA 1MV3A 2A08A 1ZLMA 2BTTA 1AOJA 1HJDA 1ZX6A 3CQTA 2LJ3A 2EW3A 1PRLC 5IHIA 1SRMA 2LMJA 2KRNA 4J9EA 1ZSGA 4F14A 1V1CA 2EGEA 1UUEA 2FRWA 2KNBB 2FPFA 2FPEA 1AZEA 2CUDA 2YT6A 2EBPA 2ESWA 3I35A 2DRMA 2LQWA 2O9SA 3PVLA 4LUDA 3EG2A 4AG1C 4J9HA 2K6DA 1AVZC 2F2XA 4AFQC 2XMFA 1T0JA 2KT1A 2X3XD 1AWXA 2DBKA 1GBQA 1WXUA 2OI3A 5I11A 4OMNA 3I5SA 1KJWA 2JM9A 4OMPA 1K9AA 2EQIA 2L3QA 2SEMA 3UATA 1OPKA 1W1FA 4OMOA 5HCKA 1QWEA 1GFCA 1VA7A 1WIEA 2BZYA 2RMOA 2AKKA 2HDAA 4DEXA 3TSWA 3VRZA 4LE9A 2L2PA 1YWOA 1K0XA 1JEGA 1I07A 1ABQA 2CUBA 2K2MA 2BZXA 1NM7A 1G83A 3H0FA 5L23A 2CREA 3M0UA 2DMOA 2EGAA 1WDXA 1PNJA 2LQNA
chains in the Genus database with same CATH superfamily
3G4ST 3NPFA 1KHCA 2PTKA 2JW4A 1NPPA 5DY9A 1UDLA 4X1VA 3CC4A 4M7AC 1BB9A 1RAGB 1KD1R 1H3ZA 2ZPHB 2O31A 2F5KA 3DLMA 2ECZA 3CMAT 2QDLA 2DERA 2O88A 1P92A 1M3AA 5I22A 3OS5A 2ROLA 4DBQA 4JZ4A 4AFSC 3LGFA 2DJZA 2L8DA 1VIFA 3E19A 4C92C 1H641 1KQ1A 1WHHA 2XDBA 4M75A 3CXCS 3X28B 2J06A 1YI2T 3FJ5A 5HY6A 1M90C 3M4YA 1N6AA 3KUFA 1YITQ 2RI3A 2FG0A 4XTUA 3CCVQ 3QKJA 1VQ7Q 1I5LA 2BE7D 2EYZA 2F2VA 1ZQ1A 1VQ4A 1FXXA 4N0AC 1Q86C 4M77A 1M30A 1YCYA 2XIDA 4R0KA 4HCZA 3CCRQ 3A8HB 1E6GA 2DYIA 6AT1B 2X4WA 3O8VA 2QGFB 2J7IA 2JTMA 3PE0A 3M58A 4LDWA 2F5TX 4FSXA 3SFMA 4HVVA 4FM4B 2YLBA 2QEXQ 2ZAEA 2X9HA 1VQPT 4XAXB 3TREA 4IUPA 2JT4A 4M75B 2CP0A 1YIJQ 4E6RA 1TOVA 2FO0A 1TWBA 4HXJA 4KUDK 1HYOA 2KGTA 2XDPA 2C0TA 3JCMf 2M02A 3A98A 3EG1A 3L2ZA 3CC2T 1GL5A 2RO0A 1IHVA 3OYAA 1SF9A 3FIFA 4M77B 5CK9A 1VQNA 1D0YA 2HKQB 4M75E 1J3TA 4RMOA 1TUCA 3AHUA 1NJIU 2LQ8A 1T3SA 3ZFJA 3RNJA 3OY9A 1AWOA 4JJBA 2HAXA 2DPPB 4BY6C 1BIBA 2EQUA 5CQXA 2Y90A 2XK0A 4B9XA 4OVAA 3KFVA 2BKDN 3QYGB 3C94A 3H41A 4OB0B 4M77E 4OMLA 2Z0WA 2DJQA 4ZGJB 2KRMA 2HSEB 5CKHA 5KYYA 1K9MR 2KR3A 2LP5A 1TUDA 1K8AR 3QXEB 1M1KR 3H0IA 1IZ6A 2YXYA 4B6MA 1R8OB 1ZUKA 1KHIA 3FRNA 3C95A 2GCXA 2AT1B 5FU6C 5FROA 3HTRA 1BCOA 2LCCA 2RQVA 4JLGA 3UDCA 3G4SQ 4FYWB 2AKLA 2CDTA 2ZPFB 4FYVB 5CIUA 3JAME 1M8VA 1KC8C 2QASA 2LCLA 2CT3A 4X34A 1VQ9A 4JRIA 2RQWA 4IURA 1VQOT 3RKWA 2ENMA 1K1ZA 2JTEA 3N5BB 4HT8A 4PJNA 1WNLA 3R6NA 1GXIE 3S3MA 3MJXA 4QKUA 5CKBA 1VQKA 3VUZA 2FYKA 2FRYA 5LJ3f 4XU3A 3OYIA 4L6V5 1VQLT 9ATCB 3UA6A 4PJOF 5KYYB 4ESRA 4JRPA 3CCEQ 2KYBA 3I56Q 1YI2Q 1NG2A 2FPDA 2CP7A 3CMEQ 3DB4A 4E7ZA 5IXBA 2R58A 2KRSA 1RAHB 3EG0A 2GTJA 3M0SA 3J80E 2QQBA 1Y71A 4AMCA 4N0AA 1KSWA 2ABLA 1YBYA 4M7AB 3TVTA 1HD3A 1G3WA 4F7UF 4Z02A 5CR2A 1Z9ZA 3OYFA 4M4ZA 4ZN3A 1NYFA 4V2SA 2PVDB 5HKCA 1V29B 2K2VA 4WF2A 2K5IA 4M7DF 3VYHB 4C92B 3VS3A 2DF6A 1H92A 4RTYA 1I1JA 2OJ2A 4M7AE 3NHNA 2F2WA 2EIFA 3WVEB 2CH4W 3OYMA 3BY7A 1WHMA 3TCJA 2QTXA 5C0MA 3FLGA 2NLUA 2EAYA 3EAEA 4VUBA 1QCNA 2DL5A 3UPUA 1X2QA 3EH1A 3M54A 4C92E 1I4K1 4C0DB 2D0NA 1H3HA 1PRMC 4OP0A 1MNEA 3G71T 3RUXA 3HHTB 2MIOA 5FWCA 4ELYC 1NJIR 3HRTA 3PNWC 4LDYA 2E6ZA 3D7SB 4M75D 3X25B 1JRIA 3I55Q 3NMZC 2CKKA 1W70A 2RA2A 1OPLA 4J7IA 1PD0A 2B86A 1Q7YU 1BI0A 2BE9B 2DBMA 2EQJA 3JRZA 2GNCA 2J05A 1QVGA 2EYWA 4M75G 4FYYB 2HL5C 1YCSB 2A0FB 4M78A 1C1AA 1N9SA 1O9SA 1S1NA 4EDUA 3J81E 3RERA 3PMIA 1GBRA 5FU7C 1U1TA 4M77G 2RHXA 1IHWA 4BY6B 4XU2A 1BIAA 2EW3A 3CCQQ 2CP2A 1VQLQ 1SRMA 2QA4A 1Q95G 2ZPEB 4E7SA 3CCLT 1ZSGA 2EGEA 2FRWA 1UUEA 2XU8A 3OQ5A 3FEOA 1VQ8A 4KH0B 2EBPA 3TQ7P 2E5QA 1BI2A 3OYHA 3JCMd 3HKSA 2O9SA 5IN1A 4LUDA 4A4GA 4M78B 2F2XA 3RKXA 3JCMg 3V7RA 1W2BP 4QQGA 3CC7T 5D7UA 3MEAA 2X3XD 4IUVA 2P84A 3HPWA 1OULA 1EIFA 2V8JA 1IXDA 3QO3A 2OTJT 4BDYA 2SEMA 5GAOp 1OPKA 1W1FA 3QDRB 1KQSS 5HCKA 3EGDB 1GFCA 1UB4A 2EJ9A 3CCUT 2HDAA 4ZTFA 3M5AA 1I07A 5GANf 2EQMA 3KXTA 2CUBA 1NM7A 4M78E 1C6VX 3PMTA 2E12A 4ME7A 4ZTJA 2DZ9A 4L59A 3M59A 3H0FA 2X4JA 3M0UA 2DMOA 2XHCA 1PNJA 2IVWA 4F04B 2XI9A 3RDVA 1RUWA 1TXQA 4NS5A 3AT1B 2X4XA 3JB9F 3OMCA 1BI3A 2JOYA 2A36A 2CS7A 1YJWA 1FWZA 2FL7A 2WSFE 5GAOm 1M27C 3CCST 3G1JA 3SB2A 4RTWA 2DX1A 1UE9A 4M7AG 2Y4XA 4GLMA 3S3OA 4RTUA 4E47A 1WHKA 2MPXC 2RNAA 1JXMA 3OW2P 2RF0A 2JS0A 3VS7A 1X6OA 2YDLA 3JCMh 2QYZA 5LJ3d 3BW1A 3MO8A 3NTKA 1Q7YR 4JJDA 2OX7A 5LJ3g 1RI0A 4C92G 3X26B 5GAOr 2XICA 2DE0X 3GNGA 2QI2A 2RQRA 5IT9E 2HCKA 3A5ZB 3C0CA 2JXBA 1I0CA 1T0HA 5C6SA 1IB8A 1H8KA 4QW2A 4FT4A 5D6XA 1ZUYA 3JV3A 1SKUB 5IH2A 2C0IA 1U5SA 4C5EA 4FW2A 4RTTA 4RUGA 2DA9A 1YITA 2PZ1A 3UWNA 1YHQT 3M4GA 1VQ7A 3CCVA 4WTOB 3S6WA 5L8RE 1D1BA 4JJCA 1JO8A 2XD0A 2VVKA 4N4IA 4QVDA 3CCRA 4BDZA 2K79A 4PLLA 2COWA 3NTIA 7AT1B 3RR6A 2VYTA 1MMDA 2GQVA 4MZPA 3FJPA 2WSEE 2X4YA 3JCMW 4JZ3A 3A1PA 2ZPBB 3JSCA 2YWWA 3V8JA 3A8GB 3CPWP 1N8RC 1LVKA 1UJ0A 5I21A 3GNFB 1WI7A 4PJJA 2QEXA 2RPNA 2KXDA 4FIBA 4EPCA 1VQ5T 3CC4T 4R56A 1WLPB 2FVUA 1YIJA 1VYVA 5FU7B 2DXTA 2RHZA 4JS4A 2MK5A 2OTJQ 1BI1A 4TVRA 2HBPA 1X27A 1YN8A 1ABOA 1AHJB 5J3BA 3QZ9B 1ZA2B 4DEYA 5FWBA 5CAIA 5LJ3h 3GLXA 5IHNA 4X9DA 3CCUQ 1CSKA 3OS1A 3M0QA 1PWTA 2ED0A 2E6NA 1PSFA 2DL3A 2EFIA 2LRQA 3VS5A 2VKNA 3I9QA 5GJWB 3ULRB 1B07A 1WZOA 4JRKA 4PL6A 1VQ6Q 3MP8A 2W0ZA 1Z9QA 3PFSA 1HSQA 2ZZDA 2X51A 1OX9A 2DL7A 5IHKA 3L1AA 1SG5A 4JLIA 1QVGP 5LJ5e 2E1HA 3GIBA 4AG2C 4M78D 4XK8E 5KE2A 4F17A 2AZSA 2M0YA 3SHWA 2VXFA 3OYJA 1RAAB 4RCBA 3WVDB 5GAMe 1MV0B 1N27A 5GAOl 3BDLA 4M78G 3CCSQ 3PT9A 4OMFB 4LNPA 3LX7A 4LN2A 1FMVA 2VWFA 3PVQA 1LNXA 3G4SA 3ER0A 5KYNA 4A4EA 1VUBA 1M9SA 4PFPA 1BBZA 2GF7A 4NL3A 4C0DC 1EX4A 2PVOB 2RQUA 4OMQA 1X75C 3EHQA 2C0OA 2MOXA 2X3WD 3G6EQ 1OZ2A 2MWPA 4BI4A 3OYYA 1WHLA 1T3LA 4ORZA 4HCCA 2HQXA 1RI9A 2PVGB 2NUTA 1YWPA 2YUOA 3P8HA 1OEBA 4AFUC 1PHTA 2H8HA 5LJ5f 3CCEA 3I56A 1YI2A 3HFOA 1WPYA 3REBB 3CMEA 1PKTA 2DTIA 5FLXE 1YHQQ 1KD1C 4IIMA 1K73R 4MMKA 2LX9A 2MMPA 1W2BA 2CP3A 2DZCA 2JVVA 4J9DA 4BE0A 1VOMA 1VYTA 5GANd 2RK2A 4O6JA 4NL2A 1Q81U 2E41A 4KGXB 5GANg 3OB9A 2QXFA 4CC3A 3PIPA 4FU6A 3L2UA 2D8JA 3HRSA 1Y57A 2O9VA 3G7ZA 1YJNQ 1VQ5Q 4FYXB 1M2VA 2KEAA 5KH6A 1SHGA 1RAEB 1JXOA 3JCMQ 3M53A 1NLOC 1TSFA 1NZ9A 1WQ7A 3EFOA 2ZCFB 2RN8A 2KK4A 3MKDA 2KY9A 2RQTA 2CP5A 3JB9H 3HP9A 1IGQA 1G3TA 1PCXA 4J9IA 4M78C 1OQKA 3VS4A 5GMKj 2LVMA 3QSUA 3H0HA 2A7YA 2QDYB 4PJLA 1JJ2P 5HK0A 1O75A 3CMAQ 1BU1A 5J39A 1RAFB 2L3RA 3JB9I 3OW2A 3WXMB 3CCJT 2C06A 2PU9B 3I55A 2EQKA 4PFZA 2EPDA 1WYXA 4RCCA 1WFWA 4OB3B 2LT4A 2OTLT 1AEYA 3X24B 3QG1A 4J8OA 4D8KA 4FCYA 3EFOB 1N9RA 3EH2A 1WGSA 4E7LA 3QIIA 2BTTA 1AOJA 2CP6A 1QVPA 5GANh 1ZX6A 3E9FA 3LWIA 4KGZB 4BE2A 3CQTA 3QUIA 2E64A 2RI2A 1PRLC 5IHIA 1JBMA 2M1HA 3PIOA 5LJ5j 2QAZA 2FPFA 1S72T 3ASKA 3I35A 2DRMA 4J6WA 2DIGA 1K9MC 1Q82U 2HZYA 2DVEA 2E65A 3EG2A 4AG1C 2MI6A 1K8AC 1M1KC 1BCMA 5CKFA 4KUIA 2LTOA 3CCQA 1VQLA 1QVFS 1VQPQ 3MPUB 1AWXA 2JM9A 4OMPA 2KMTA 3JCMb 8AT1B 3CPWA 1Y07A 4KULA 4J7FA 3CCMT 4E7HA 2RJDA 2MF2A 1YJ9T 1D0ZA 3CC2Q 3VRZA 3RESA 4EMGA 1YWOA 3E9GA 4MZTA 4RG8A 2K2MA 2BZXA 2LT1A 2F1LA 4EMKA 5CO7A 4O5VA 3T9NA 5KYWA 5A2QE 5L23A 2I2LA 2CREA 1RACB 3RMQA 3QJYA 1WDXA 1Q81R 3HRUA 4C8QF 2JZ2A 1WJSA 2O2OA 4CI0C 2VV5A 2JMAA 2YUQA 1ZHIA 1N8RU 4DA4A 1B34A 2CSQA 2PUOB 2VC8A 4LUEA 3SDZA 1AT1B 4EIKA 3L2RA 2VGMA 1OOTA 3JCMX 3O5ZA 3JCMP 1AWWA 3A8OB 3JB9D 3VUBA 2AK5A 5I2SA 2B8AA 4XTXA 1IO6A 2MYSA 4DQ2A 4OGCA 2K3YA 2EGCA 2DFUA 4XTYA 5GAOq 4EMKB 2QQRA 3REAB 4A53A 5KYWB 1VQ8T 1TTHB 4LDVA 4XU1A 1VQMT 3QDFA 1SPKA 4A4HA 2HQEA 2Y4YA 1VQOQ 4RG2A 2V26A 1OU8A 2JMCA 3CCJQ 2KQWA 4DOWA 2DAQA 1B34B 3DKMA 4Z8AA 2D1XA 1GRIA 1BK2A 2OTLQ 1TU0B 1UJYA 2HQHA 4OF1A 5DLOA 1FYNA 3L2QA 1W2BS 3C4SA 5IAYA 4HVUA 4EMHA 1M90U 4E7KA 4X9CA 2RB6A 1KK7A 3ME9A 4ATOA 4JS5A 3EFRA 1X6BA 2VB6A 4FL6A 4PNOA 4PJOA 5GAN8 2EWNA 3VKIA 2FEIA 1Q86U 1FX7A 1HK9A 1S72Q 3EFSA 3V8LA 1X6GA 4KBMB 3OYGA 2DTOA 4J9CA 3GOXA 1ZBXA 2ZGWA 3OBWA 3BDUA 4P5NA 1DJ7B 3THKA 4D6WA 1KG1A 1Q82R 4BD3A 5GMKl 5GAN6 1LCKA 4J83A 2DLPA 2AZVA 5GMKh 2EYYA 5FRNA 3U23A 4F7UA 4JJNK 2QQSA 1YJWT 5A0GA 1UHFA 2E5KA 2VXEA 2X35A 3HFNA 4K11A 4J6XA 4OB1B 3CCMQ 3E2UA 4JUVA 1V76A 5GMKi 1YJ9Q 5EG2A 4M7DA 4BE1A 4OB2B 3JB9J 4PJOB 5DM7R 4M75F 1G8XA 1GCQA 3JCMc 2OTJA 2BIVA 4FT2A 3S3NA 5I2MA 1W6XA 2M16A 2XKOC 2E3HA 3G71Q 4LXCA 3CCUA 3OYEA 4ANJA 1AZGB 3URGA 4F7UB 4M77F 3I5RA 3X20B 1N8RR 3OYNA 1JJ2A 1YITT 1VQ6A 1Y0MA 2CSIA 2QTVA 4C8QA 4BI3A 4M7DB 4QT7A 4QVZA 3CCRT 1D1AA 3EHRA 5AT1B 1QW1A 2YUNA 2NWMA 3NFCA 2RD1A 4XU0A 3BFMA 2MAMA 5KE3A 4CC2A 4BB7A 3RKYA 2J6FA 1VQMQ 4A4FA 3HL8A 2RH2A 2KYMA 3CCSA 3JCMV 5KCHA 1KC8U 1M5Q1 2EYXA 4ZN1A 1VYUA 3RBBB 2DNUA 3CD6T 1YIJT 5KYUA 2ED1A 4M7DE 3CPFA 1G3SA 2GQIA 1KFZA 1SSHA 2HKNA 1R0CB 3INZA 3CCLQ 5CCAA 1RABB 5CVIA 4Y92A 2YRVA 1X43A 4C8QB 1W4SA 1KQ2A 4KRTA 2ATCB 5GJVB 3SWNC 3RIRA 1RLPC 1YFNA 2L89A 1M90R 3G6EA 2HBWA 1RAIB 2PNIA 3M55A 4RTXA 4F16A 1MMNA 3CC7Q 3CBMA 4MMLA 2EKOA 3QZ5B 2JNGA 3MP1A 4D8DA 4JPBW 2L0AA 1Q86R 1NBEB 4OMMA 4PKCC 2RK1A 1YHQA 4YTLA 1UECA 2CZ1B 4JRQA 3FB9A 3R6OA 2M0OA 2LX7A 4N4HA 2MWOA 2V1RA 1Q7YC 1OV3A 5KYUB 3M0PA 2K9GA 1UGVA 3KBGA 3UF4A 3H9NA 4E7IA 4ZNXA 4M7AF 2KXCA 3VS6A 2KDSA 3UT1A 2FHDA 1QVGS 2V8IA 4DOVA 3M57A 2PUKB 1NPRA 2KT8A 2EVRA 4C5GA 4PK4A 1G2BA 1VQ4T 1G5VA 3F70A 1UFFA 3NGPA 1B3QA 4J9BA 1E6HA 2DYBA 5GAN4 4R55A 2LZ6B 1YJNA 4C92F 1M1GA 1VQ5A 3VJPA 1Y96A 1X69A 1R0BG 2E10A 3EGXA 4ELZC 3VS1A 4QQ6A 2RI5A 1WJQA 4WCIA 1AD5A 4MDXA 4L5GA 2IG0A 1GFDA 4HVWA 1YP5A 2BZ8A 1TS9A 3JCMe 2H3JA 3L42A 1CKBA 4HCKA 4C5HA 2VGNA 1M3CA 3CCET 2XG8D 5GAN2 2HSPA 4CC4B 1NEGA 3I56T 3MEUA 2L3SA 4RKUE 3CMET 2V1QA 2LDMA 1XJWB 2E4HA 3CMAA 2FZGB 3CXCP 2D6FA 1ZLMA 4HA8A 3V7SA 2D0QB 1I81A 3BE3A 1OU9A 3MHXA 2LJ3A 1I8FA 1Y96B 4PJOD 1VQNT 3OS2A 1F1BB 4A4KA 2LMJA 2KRNA 3EGXB 1U8RA 1V1CA 3ZEHA 2FPEA 2R5MA 3MEVA 1AZEA 2YT6A 3M9QA 4ZGEB 3CBPA 1U1SA 1VIEA 2DEQA 2LNVA 4PJOG 1KC8R 3PVLA 1WHGA 2ZPIB 4J9HA 2K6DA 3DLLA 1TH7A 4IUQA 3CD6Q 5GAMf 2XMFA 2KT1A 4C0FA 2DBKA 1GBQA 1WXUA 4IKFA 1OYXA 2OI3A 2BUDA 4MDWA 1KJWA 1K9AA 3L2WA 2EQIA 3UATA 4OMOA 4EMKC 1M1FA 4UC4A 1NE8A 3SWNA 1VA7A 1WIEA 4F7UG 2RMOA 2AKKA 2CZ6B 4M7DD 2O4XA 1K0XA 5KCOA 1UGQB 3Q1JA 2NUTB 1D1CA 1ABQA 1VQPA 1TUGB 3CC4Q 1SSFA 1G83A 3OYKA 2K5LA 1VQ9T 3QPHA 2XDDA 3J7AF 2JN0A 1IGUA 5LJ3e 4XTVA 2YLCA 4M7DG 2COYA 1ZSZC 2EGAA 2DKGA 2P0QA 1OI1A 2LQNA 1KQSA 1VQKT 5GAN7 3CC2A 3OYDA 2AIRB 3LH5A 3I55T 1JJ2S 2YSQA 1PM3A 4M78F 4AT1B 2JS2A 3OS0A 1U06A 2HL3A 2DK3A 2DL4A 3PTAA 1QWFA 1QLYA 1UGSB 3VV0A 1QP3A 3MEWA 2DETA 1SRLA 1X01A 3SWNB 3OA6A 3OBYA 4C8QD 3TSZA 2J6OA 3A8LB 2J6KA 5AYFA 3GBQA 2M9UA 1MMAA 3EG9A 2O4XB 1VQ4Q 1B7TA 4DBFA 3QHSA 2W10A 1QKWA 4M7AA 1M2VB 4E7JA 1QCOA 1RLQC 2H3EB 1K73C 4C8QG 1QQJA 2E3IA 2G3RA 1HXDA 1IREB 3QWYA 1M3BA 5DLQE 1BYMA 1SEMA 1N5ZA 1TG0A 1GCPA 4CRIA 1MGQA 2HEQA 3CCQT 2IIMA 3TU4K 4C92A 2ROTA 2DXCA 4BUGA 1FMKA 2V8KA 3M56A 2RHUA 3SEMA 2FZKB 2KBTA 4PJOC 2YHTA 4B9WA 3LGLA 2YRCA 4OGEA 4DBRA 1K0SA 2P0PA 1VQOA 1PSEA 3EG9B 1M4ZA 2JUFA 3IQLA 1MMGA 4IUUA 4CC7A 5GMKm 3C12A 5GAMj 3OSSC 3CCJA 2GTOA 1VQNQ 1AWJA 2KROA 5D6WA 4Z88A 1JB0E 2OTLA 1ZUUA 3EG3A 2LNHB 3OYBA 3FDRA 2VUBA 2G6FX 2L3PA 2CYZB 2YRDA 1UGRB 3A8MB 5D6YA 4A63B 4M7DC 2I0NA 2R5AA 3FC3A 5CKDA 1ACMB 1BKBA 2K3BA 3CBOA 2F69A 2K4YA 2OAWA 2DIQA 1GCQC 1JQQA 1S72A 1QVFP 2CT4A 2OAUA 4RTVA 2GFUA 4NOYA 1NEBA 3SD4A 1Y7XA 2DVJA 2HD0A 4IIOA 1M2OA 2A37A 2RJCA 2DXBA 2GBQA 2CZ7B 1VQ9Q 1LPLA 3OMGA 1E7OA 3LW5E 1ZSZA 4LD6A 3OYCA 1XOVA 4Y28E 1XQHA 3P8BB 3CCMA 4A54A 4C8QC 5CKEA 1YJ9A 1VQKQ 2SRCA 1ZA1B 1WQWA 3VYGA 1OZ3A 3VS0A 2L5QA 4N4GA 1D3BA 2QA4T 2IPOB 2KVQG 2CH4A 2K7AA 3JB9G 2YUPA 2P4RA 3LLRA 3UA7A 1WJRA 3LYIA 2RM4A 1SHFA 3VS2A 1I5OB 1OX8A 2FZCB 3G71A 1UG1A 4XTWA 1QCFA 1UHCA 1WXBA 2R57A 3M0TA 4FW1A 4M77D 5LJ3j 2DRKA 2LJ1A 2GFAA 4KGVB 2NUZA 2JJ9A 1XTDA 2QG9B 5ECAA 2KE9A 4PJMA 4DBHA 2WSCE 3DB3A 3MCAB 1ZSZB 3V8KA 2LC4A 3CXCA 4HCBA 5GANe 2QK0A 3EGDA 5LJ5d 4Q5WA 3HSBA 4J9FA 1WA7A 4MZMA 1WX6A 1UEBA 5FRMA 5LJ5g 3E1SA 1QKXA 4QVCA 1D3BB 2NUPA 1K4US 2D9TA 2CGHA 2MCNA 1Q81C 1NJIC 2FB7A 5GAMd 3QJ6A 1VQMA 4GY5A 2QQAA 5FU6B 2EJFA 5GAMg 1NYGA 2DXUA 2EYQA 3GP8A 5A0DA 1D0XA 4C0GA 2DEUA 5EC7A 5IXFA 4J6YA 1K76A 4JDSA 4BI8B 4II1A 4LDXA 4PLIA 3CCLA 1ZBJA 2LJ0A 2JM8A 3LWHA 3JCMJ 1UGPB 1XNIA 2A28A 1JU5C 4FSSA 2O01E 3MP6A 1A0NB 1U3OA 2NUPB 1KQSP 4XTZA 2HNIA 3QWXX 2DD4A 1QMCA 5FW9A 1KD1U 3M0RA 3OSVA 2DO3A 3CC7A 3META 1VQ6T 2DILA 2K57A 1YNZA 4GBQA 5GAOn 1MUZA 3OW2S 1MHNA 2LCSA 3PGGA 1MNDA 4RTZA 5KYXA 4GLKA 2DL8A 2JTFA 1WXTA 1X2KA 1PKSA 2DM1A 8ATCB 5GAN3 3V7CA 1PD1A 1EFNA 2RJEA 1ARKA 4M7AD 3QBYA 1C0MA 2A3LA 2NYSA 1PG5B 1PC0A 5LJ5h 3GF5A 4M75C 1IRXA 1LOJA 2KAFA 2M51A 3ZL7C 2QQ9A 4AFZC 4IUTA 2HMAA 4PJOE 2ZPGB 4KT0E 1VQ7T 3CCVT 1UTIA 2QGGA 1KIKA 3H6ZA 4J9GA 3EGUA 3GPLA 5GAMh 2GGRA 4C92D 4HT9A 1NLPC 2K5FA 4Z89A 4QQDA 3P8DA 4M77C 3VRYA 2QA4Q 1CKAA 4LDUA 4PFOA 2EKHA 2K3XA 2D8HA 4F7UE 1Q82C 2PQWA 5HK3A 5KYXB 1VQ8Q 1M8MA 1MV3A 2A08A 3RMSA 1FMWA 2COZA 1EZZB 4HKEA 2P4TA 3LH0A 2EJGA 4ZGDB 3G6ET 1HJDA 3VU3C 2QEXT 4J5YA 2P0KA 2LQKA 3TEEA 2RJFA 4C0ZA 3OYLA 4J9EA 1G3YA 3CPWS 1LJOA 4BACA 4F14A 2KNBB 4KH1B 4XQ3A 2CUDA 1RADB 1D09B 2ESWA 5A0LA 1K73U 2LQWA 3ZBDA 2RHIA 5CQYA 1AVZC 4AFQC 1T0JA 3QYHB 5I11A 1R77A 4OMNA 3I5SA 2KI7A 2L3QA 3L2VA 1QWEA 2AHJB 2BZYA 5GMKe 5J26A 4DEXA 3TSWA 4E2FB 5M9OA 4LE9A 2L2PA 2RHYA 1WHJA 4C8QE 2DD5A 1RL2A 2KSSA 5GANj 1YJNT 1JEGA 3CD6A 3NTHA 2E70A 1K9MU 4LD9K 2DTHA 1YJWQ 1K8AU 1QVFA 5LL6S 3CEYA 1M1KU 2CZ0B 2WACA 4C5IA 1QP2A 2VASA 5GAN5 4Y91A 3H8ZA
chains in the Genus database with same CATH topology
1RUWA 2O2OA 2JMAA 3LH5A 3NPFA 2YUQA 2YSQA 2PTKA 2JW4A 1UDLA 2JS2A 4X1VA 1U06A 1BB9A 2CSQA 2A36A 4LUEA 2DL4A 1QWFA 1QLYA 2O31A 4EIKA 1OOTA 2ECZA 1SRLA 2QDLA 1M27C 2O88A 3O5ZA 1M3AA 1AWWA 3TSZA 4RTWA 2DX1A 2J6OA 2J6KA 1UE9A 5I22A 3GBQA 4GLMA 2AK5A 4RTUA 2ROLA 4JZ4A 2RNAA 1JXMA 4AFSC 1IO6A 2RF0A 2EGCA 2W10A 1QKWA 2JS0A 3VS7A 1RLQC 2YDLA 2J06A 3FJ5A 3REAB 1SPKA 4JJDA 2FG0A 3QWYA 1M3BA 2DE0X 2EYZA 2F2VA 1SEMA 1N5ZA 1TG0A 1GCPA 2HEQA 2JMCA 2RQRA 2IIMA 2HCKA 3C0CA 2JXBA 2ROTA 1M30A 4R0KA 1FMKA 3SEMA 1I0CA 1E6GA 1T0HA 2KBTA 4Z8AA 1H8KA 1ZUYA 2D1XA 3JV3A 5IH2A 1GRIA 2C0IA 1BK2A 1UJYA 1U5SA 2J7IA 4RTTA 4RUGA 2DA9A 1K0SA 1FYNA 2PZ1A 3PE0A 4HVUA 4HVVA 3IQLA 4CC7A 4JJCA 1JO8A 2VVKA 2JT4A 2K79A 1X6BA 4E6RA 2GTOA 2FO0A 1AWJA 4HXJA 2KROA 2KGTA 4Z88A 1ZUUA 2FEIA 3EG3A 2C0TA 4JZ3A 3A98A 1X6GA 2LNHB 3EG1A 4J9CA 1UJ0A 1GL5A 2G6FX 2L3PA 3THKA 1WI7A 2RPNA 2KXDA 4A63B 1LCKA 2I0NA 2DLPA 2AZVA 1WLPB 2EYYA 3U23A 1VYVA 2K3BA 1UHFA 1J3TA 2E5KA 2OAWA 1TUCA 1GCQC 1JQQA 2CT4A 4K11A 1X27A 1YN8A 1ABOA 4RTVA 1NEBA 4DEYA 1T3SA 5FWBA 3RNJA 5IHNA 1AWOA 4JJBA 1CSKA 3M0QA 1PWTA 2DVJA 2ED0A 4IIOA 3KFVA 2A37A 2DL3A 3H41A 3VS5A 4OMLA 2VKNA 3I9QA 5GJWB 3ULRB 2DJQA 2KRMA 1GCQA 2GBQA 2KR3A 1B07A 2LP5A 1TUDA 2W0ZA 1E7OA 3H0IA 1W6XA 1Z9QA 1XOVA 1ZUKA 1HSQA 2DL7A 5IHKA 2SRCA 1AZGB 4AG2C 2RQVA 4F17A 2AKLA 3VS0A 2CDTA 2AZSA 2M0YA 3SHWA 3I5RA 2CT3A 2CH4A 2K7AA 2YUPA 2P4RA 1Y0MA 2RQWA 3UA7A 1MV0B 1SHFA 3VS2A 2CSIA 2ENMA 1K1ZA 1UG1A 2JTEA 3R6NA 1QCFA 1UHCA 1WXBA 3M0TA 4LN2A 4LNPA 4QT7A 2VWFA 2FRYA 3PVQA 2DRKA 3EHRA 2LJ1A 3UA6A 2YUNA 2NWMA 2NUZA 5ECAA 2KE9A 4ESRA 4CC2A 2KYBA 1NG2A 1BBZA 2FPDA 2J6FA 5IXBA 2KRSA 2KYMA 3EG0A 2RQUA 4OMQA 2GTJA 3M0SA 3EHQA 2C0OA 2EYXA 2MOXA 2X3WD 1VYUA 4J9FA 1WA7A 1WX6A 3RBBB 2DNUA 1QKXA 1KSWA 2ABLA 1T3LA 4ORZA 1K4US 2ED1A 1RI9A 3TVTA 1HD3A 1YWPA 2YUOA 2MCNA 2GQIA 1KFZA 1OEBA 4AFUC 1Z9ZA 1PHTA 2H8HA 1SSHA 4M4ZA 1NYFA 3REBB 4Y92A 1PKTA 1X43A 4KRTA 5GJVB 1NYGA 4IIMA 1RLPC 5EC7A 5IXFA 2HBWA 1K76A 2PNIA 3VS3A 4RTXA 4F16A 2DF6A 4J9DA 1H92A 4RTYA 1I1JA 1VYTA 2OJ2A 4D8DA 4JPBW 3NHNA 2F2WA 1ZBJA 2CH4W 2L0AA 2LJ0A 2JM8A 4OMMA 1UECA 2A28A 4CC3A 1JU5C 2LX7A 4FSSA 2D8JA 2V1RA 1A0NB 1U3OA 1OV3A 1Y57A 2K9GA 3M0PA 1UGVA 2O9VA 3QWXX 3UF4A 2DL5A 5FW9A 4ZNXA 2KEAA 1X2QA 3M0RA 2KXCA 3VS6A 2DILA 1SHGA 1YNZA 4GBQA 1JXOA 2D0NA 1NLOC 1H3HA 1PRMC 1MUZA 2LCSA 4RTZA 2DL8A 2KT8A 2EVRA 2MIOA 2RN8A 5FWCA 1WXTA 1X2KA 1PKSA 1G2BA 2DM1A 3NGPA 1EFNA 1UFFA 1B3QA 2RQTA 1ARKA 4J9BA 1E6HA 2DYBA 2LZ6B 4J9IA 3NMZC 1W70A 3VS4A 1OPLA 2M51A 1X69A 3ZL7C 3H0HA 2B86A 4AFZC 3VS1A 2DBMA 2GNCA 1UTIA 2J05A 4WCIA 1AD5A 1BU1A 2EYWA 1KIKA 4J9GA 3EGUA 1GFDA 4HVWA 1YP5A 2GGRA 2BZ8A 1NLPC 1YCSB 4Z89A 1CKBA 3VRYA 4HCKA 1M3CA 2EPDA 1WYXA 1CKAA 2HSPA 1WFWA 4CC4B 1NEGA 2L3SA 1S1NA 1GBRA 2EKHA 2D8HA 1AEYA 1M8MA 2V1QA 4D8KA 1MV3A 2A08A 1ZLMA 2BTTA 1AOJA 1HJDA 1ZX6A 3CQTA 2LJ3A 2EW3A 1PRLC 5IHIA 1SRMA 2LMJA 2KRNA 4J9EA 1ZSGA 4F14A 1V1CA 2EGEA 1UUEA 2FRWA 2KNBB 2FPFA 2FPEA 1AZEA 2CUDA 2YT6A 2EBPA 2ESWA 3I35A 2DRMA 2LQWA 2O9SA 3PVLA 4LUDA 3EG2A 4AG1C 4J9HA 2K6DA 1AVZC 2F2XA 4AFQC 2XMFA 1T0JA 2KT1A 2X3XD 1AWXA 2DBKA 1GBQA 1WXUA 2OI3A 5I11A 4OMNA 3I5SA 1KJWA 2JM9A 4OMPA 1K9AA 2EQIA 2L3QA 2SEMA 3UATA 1OPKA 1W1FA 4OMOA 5HCKA 1QWEA 1GFCA 1VA7A 1WIEA 2BZYA 2RMOA 2AKKA 2HDAA 4DEXA 3TSWA 3VRZA 4LE9A 2L2PA 1YWOA 1K0XA 1JEGA 1I07A 1ABQA 2CUBA 2K2MA 2BZXA 1NM7A 1G83A 3H0FA 5L23A 2CREA 3M0UA 2DMOA 2EGAA 1WDXA 1PNJA 2LQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RUW A;  2O2O A;  2JMA A;  3LH5 A;  3NPF A;  2YUQ A;  2YSQ A;  2PTK A;  2JW4 A;  1UDL A;  2JS2 A;  4X1V A;  1U06 A;  1BB9 A;  2CSQ A;  2A36 A;  4LUE A;  2DL4 A;  1QWF A;  1QLY A;  2O31 A;  4EIK A;  1OOT A;  2ECZ A;  1SRL A;  2QDL A;  1M27 C;  2O88 A;  3O5Z A;  1M3A A;  1AWW A;  3TSZ A;  4RTW A;  2DX1 A;  2J6O A;  2J6K A;  1UE9 A;  5I22 A;  3GBQ A;  4GLM A;  2AK5 A;  4RTU A;  2ROL A;  4JZ4 A;  2RNA A;  1JXM A;  4AFS C;  1IO6 A;  2RF0 A;  2EGC A;  2W10 A;  1QKW A;  2JS0 A;  3VS7 A;  1RLQ C;  2YDL A;  2J06 A;  3FJ5 A;  3REA B;  1SPK A;  4JJD A;  2FG0 A;  3QWY A;  1M3B A;  2DE0 X;  2EYZ A;  2F2V A;  1SEM A;  1N5Z A;  1TG0 A;  1GCP A;  2HEQ A;  2JMC A;  2RQR A;  2IIM A;  2HCK A;  3C0C A;  2JXB A;  2ROT A;  1M30 A;  4R0K A;  1FMK A;  3SEM A;  1I0C A;  1E6G A;  1T0H A;  2KBT A;  4Z8A A;  1H8K A;  1ZUY A;  2D1X A;  3JV3 A;  5IH2 A;  1GRI A;  2C0I A;  1BK2 A;  1UJY A;  1U5S A;  2J7I A;  4RTT A;  4RUG A;  2DA9 A;  1K0S A;  1FYN A;  2PZ1 A;  3PE0 A;  4HVU A;  4HVV A;  3IQL A;  4CC7 A;  4JJC A;  1JO8 A;  2VVK A;  2JT4 A;  2K79 A;  1X6B A;  4E6R A;  2GTO A;  2FO0 A;  1AWJ A;  4HXJ A;  2KRO A;  2KGT A;  4Z88 A;  1ZUU A;  2FEI A;  3EG3 A;  2C0T A;  4JZ3 A;  3A98 A;  1X6G A;  2LNH B;  3EG1 A;  4J9C A;  1UJ0 A;  1GL5 A;  2G6F X;  2L3P A;  3THK A;  1WI7 A;  2RPN A;  2KXD A;  4A63 B;  1LCK A;  2I0N A;  2DLP A;  2AZV A;  1WLP B;  2EYY A;  3U23 A;  1VYV A;  2K3B A;  1UHF A;  1J3T A;  2E5K A;  2OAW A;  1TUC A;  1GCQ C;  1JQQ A;  2CT4 A;  4K11 A;  1X27 A;  1YN8 A;  1ABO A;  4RTV A;  1NEB A;  4DEY A;  1T3S A;  5FWB A;  3RNJ A;  5IHN A;  1AWO A;  4JJB A;  1CSK A;  3M0Q A;  1PWT A;  2DVJ A;  2ED0 A;  4IIO A;  3KFV A;  2A37 A;  2DL3 A;  3H41 A;  3VS5 A;  4OML A;  2VKN A;  3I9Q A;  5GJW B;  3ULR B;  2DJQ A;  2KRM A;  1GCQ A;  2GBQ A;  2KR3 A;  1B07 A;  2LP5 A;  1TUD A;  2W0Z A;  1E7O A;  3H0I A;  1W6X A;  1Z9Q A;  1XOV A;  1ZUK A;  1HSQ A;  2DL7 A;  5IHK A;  2SRC A;  1AZG B;  4AG2 C;  2RQV A;  4F17 A;  2AKL A;  3VS0 A;  2CDT A;  2AZS A;  2M0Y A;  3SHW A;  3I5R A;  2CT3 A;  2CH4 A;  2K7A A;  2YUP A;  2P4R A;  1Y0M A;  2RQW A;  3UA7 A;  1MV0 B;  1SHF A;  3VS2 A;  2CSI A;  2ENM A;  1K1Z A;  1UG1 A;  2JTE A;  3R6N A;  1QCF A;  1UHC A;  1WXB A;  3M0T A;  4LN2 A;  4LNP A;  4QT7 A;  2VWF A;  2FRY A;  3PVQ A;  2DRK A;  3EHR A;  2LJ1 A;  3UA6 A;  2YUN A;  2NWM A;  2NUZ A;  5ECA A;  2KE9 A;  4ESR A;  4CC2 A;  2KYB A;  1NG2 A;  1BBZ A;  2FPD A;  2J6F A;  5IXB A;  2KRS A;  2KYM A;  3EG0 A;  2RQU A;  4OMQ A;  2GTJ A;  3M0S A;  3EHQ A;  2C0O A;  2EYX A;  2MOX A;  2X3W D;  1VYU A;  4J9F A;  1WA7 A;  1WX6 A;  3RBB B;  2DNU A;  1QKX A;  1KSW A;  2ABL A;  1T3L A;  4ORZ A;  1K4U S;  2ED1 A;  1RI9 A;  3TVT A;  1HD3 A;  1YWP A;  2YUO A;  2MCN A;  2GQI A;  1KFZ A;  1OEB A;  4AFU C;  1Z9Z A;  1PHT A;  2H8H A;  1SSH A;  4M4Z A;  1NYF A;  3REB B;  4Y92 A;  1PKT A;  1X43 A;  4KRT A;  5GJV B;  1NYG A;  4IIM A;  1RLP C;  5EC7 A;  5IXF A;  2HBW A;  1K76 A;  2PNI A;  3VS3 A;  4RTX A;  4F16 A;  2DF6 A;  4J9D A;  1H92 A;  4RTY A;  1I1J A;  1VYT A;  2OJ2 A;  4D8D A;  4JPB W;  3NHN A;  2F2W A;  1ZBJ A;  2CH4 W;  2L0A A;  2LJ0 A;  2JM8 A;  4OMM A;  1UEC A;  2A28 A;  4CC3 A;  1JU5 C;  2LX7 A;  4FSS A;  2D8J A;  2V1R A;  1A0N B;  1U3O A;  1OV3 A;  1Y57 A;  2K9G A;  3M0P A;  1UGV A;  2O9V A;  3QWX X;  3UF4 A;  2DL5 A;  5FW9 A;  4ZNX A;  2KEA A;  1X2Q A;  3M0R A;  2KXC A;  3VS6 A;  2DIL A;  1SHG A;  1YNZ A;  4GBQ A;  1JXO A;  2D0N A;  1NLO C;  1H3H A;  1PRM C;  1MUZ A;  2LCS A;  4RTZ A;  2DL8 A;  2KT8 A;  2EVR A;  2MIO A;  2RN8 A;  5FWC A;  1WXT A;  1X2K A;  1PKS A;  1G2B A;  2DM1 A;  3NGP A;  1EFN A;  1UFF A;  1B3Q A;  2RQT A;  1ARK A;  4J9B A;  1E6H A;  2DYB A;  2LZ6 B;  4J9I A;  3NMZ C;  1W70 A;  3VS4 A;  1OPL A;  2M51 A;  1X69 A;  3ZL7 C;  3H0H A;  2B86 A;  4AFZ C;  3VS1 A;  2DBM A;  2GNC A;  1UTI A;  2J05 A;  4WCI A;  1AD5 A;  1BU1 A;  2EYW A;  1KIK A;  4J9G A;  3EGU A;  1GFD A;  4HVW A;  1YP5 A;  2GGR A;  2BZ8 A;  1NLP C;  1YCS B;  4Z89 A;  1CKB A;  3VRY A;  4HCK A;  1M3C A;  2EPD A;  1WYX A;  1CKA A;  2HSP A;  1WFW A;  4CC4 B;  1NEG A;  2L3S A;  1S1N A;  1GBR A;  2EKH A;  2D8H A;  1AEY A;  1M8M A;  2V1Q A;  4D8K A;  1MV3 A;  2A08 A;  1ZLM A;  2BTT A;  1AOJ A;  1HJD A;  1ZX6 A;  3CQT A;  2LJ3 A;  2EW3 A;  1PRL C;  5IHI A;  1SRM A;  2LMJ A;  2KRN A;  4J9E A;  1ZSG A;  4F14 A;  1V1C A;  2EGE A;  1UUE A;  2FRW A;  2KNB B;  2FPF A;  2FPE A;  1AZE A;  2CUD A;  2YT6 A;  2EBP A;  2ESW A;  3I35 A;  2DRM A;  2LQW A;  2O9S A;  3PVL A;  4LUD A;  3EG2 A;  4AG1 C;  4J9H A;  2K6D A;  1AVZ C;  2F2X A;  4AFQ C;  2XMF A;  1T0J A;  2KT1 A;  2X3X D;  1AWX A;  2DBK A;  1GBQ A;  1WXU A;  2OI3 A;  5I11 A;  4OMN A;  3I5S A;  1KJW A;  2JM9 A;  4OMP A;  1K9A A;  2EQI A;  2L3Q A;  2SEM A;  3UAT A;  1OPK A;  1W1F A;  4OMO A;  5HCK A;  1QWE A;  1GFC A;  1VA7 A;  1WIE A;  2BZY A;  2RMO A;  2AKK A;  2HDA A;  4DEX A;  3TSW A;  3VRZ A;  4LE9 A;  2L2P A;  1YWO A;  1K0X A;  1JEG A;  1I07 A;  1ABQ A;  2CUB A;  2K2M A;  2BZX A;  1NM7 A;  1G83 A;  3H0F A;  5L23 A;  2CRE A;  3M0U A;  2DMO A;  2EGA A;  1WDX A;  1PNJ A;  2LQN A; 
#chains in the Genus database with same CATH topology
 3G4S T;  3NPF A;  1KHC A;  2PTK A;  2JW4 A;  1NPP A;  5DY9 A;  1UDL A;  4X1V A;  3CC4 A;  4M7A C;  1BB9 A;  1RAG B;  1KD1 R;  1H3Z A;  2ZPH B;  2O31 A;  2F5K A;  3DLM A;  2ECZ A;  3CMA T;  2QDL A;  2DER A;  2O88 A;  1P92 A;  1M3A A;  5I22 A;  3OS5 A;  2ROL A;  4DBQ A;  4JZ4 A;  4AFS C;  3LGF A;  2DJZ A;  2L8D A;  1VIF A;  3E19 A;  4C92 C;  1H64 1;  1KQ1 A;  1WHH A;  2XDB A;  4M75 A;  3CXC S;  3X28 B;  2J06 A;  1YI2 T;  3FJ5 A;  5HY6 A;  1M90 C;  3M4Y A;  1N6A A;  3KUF A;  1YIT Q;  2RI3 A;  2FG0 A;  4XTU A;  3CCV Q;  3QKJ A;  1VQ7 Q;  1I5L A;  2BE7 D;  2EYZ A;  2F2V A;  1ZQ1 A;  1VQ4 A;  1FXX A;  4N0A C;  1Q86 C;  4M77 A;  1M30 A;  1YCY A;  2XID A;  4R0K A;  4HCZ A;  3CCR Q;  3A8H B;  1E6G A;  2DYI A;  6AT1 B;  2X4W A;  3O8V A;  2QGF B;  2J7I A;  2JTM A;  3PE0 A;  3M58 A;  4LDW A;  2F5T X;  4FSX A;  3SFM A;  4HVV A;  4FM4 B;  2YLB A;  2QEX Q;  2ZAE A;  2X9H A;  1VQP T;  4XAX B;  3TRE A;  4IUP A;  2JT4 A;  4M75 B;  2CP0 A;  1YIJ Q;  4E6R A;  1TOV A;  2FO0 A;  1TWB A;  4HXJ A;  4KUD K;  1HYO A;  2KGT A;  2XDP A;  2C0T A;  3JCM f;  2M02 A;  3A98 A;  3EG1 A;  3L2Z A;  3CC2 T;  1GL5 A;  2RO0 A;  1IHV A;  3OYA A;  1SF9 A;  3FIF A;  4M77 B;  5CK9 A;  1VQN A;  1D0Y A;  2HKQ B;  4M75 E;  1J3T A;  4RMO A;  1TUC A;  3AHU A;  1NJI U;  2LQ8 A;  1T3S A;  3ZFJ A;  3RNJ A;  3OY9 A;  1AWO A;  4JJB A;  2HAX A;  2DPP B;  4BY6 C;  1BIB A;  2EQU A;  5CQX A;  2Y90 A;  2XK0 A;  4B9X A;  4OVA A;  3KFV A;  2BKD N;  3QYG B;  3C94 A;  3H41 A;  4OB0 B;  4M77 E;  4OML A;  2Z0W A;  2DJQ A;  4ZGJ B;  2KRM A;  2HSE B;  5CKH A;  5KYY A;  1K9M R;  2KR3 A;  2LP5 A;  1TUD A;  1K8A R;  3QXE B;  1M1K R;  3H0I A;  1IZ6 A;  2YXY A;  4B6M A;  1R8O B;  1ZUK A;  1KHI A;  3FRN A;  3C95 A;  2GCX A;  2AT1 B;  5FU6 C;  5FRO A;  3HTR A;  1BCO A;  2LCC A;  2RQV A;  4JLG A;  3UDC A;  3G4S Q;  4FYW B;  2AKL A;  2CDT A;  2ZPF B;  4FYV B;  5CIU A;  3JAM E;  1M8V A;  1KC8 C;  2QAS A;  2LCL A;  2CT3 A;  4X34 A;  1VQ9 A;  4JRI A;  2RQW A;  4IUR A;  1VQO T;  3RKW A;  2ENM A;  1K1Z A;  2JTE A;  3N5B B;  4HT8 A;  4PJN A;  1WNL A;  3R6N A;  1GXI E;  3S3M A;  3MJX A;  4QKU A;  5CKB A;  1VQK A;  3VUZ A;  2FYK A;  2FRY A;  5LJ3 f;  4XU3 A;  3OYI A;  4L6V 5;  1VQL T;  9ATC B;  3UA6 A;  4PJO F;  5KYY B;  4ESR A;  4JRP A;  3CCE Q;  2KYB A;  3I56 Q;  1YI2 Q;  1NG2 A;  2FPD A;  2CP7 A;  3CME Q;  3DB4 A;  4E7Z A;  5IXB A;  2R58 A;  2KRS A;  1RAH B;  3EG0 A;  2GTJ A;  3M0S A;  3J80 E;  2QQB A;  1Y71 A;  4AMC A;  4N0A A;  1KSW A;  2ABL A;  1YBY A;  4M7A B;  3TVT A;  1HD3 A;  1G3W A;  4F7U F;  4Z02 A;  5CR2 A;  1Z9Z A;  3OYF A;  4M4Z A;  4ZN3 A;  1NYF A;  4V2S A;  2PVD B;  5HKC A;  1V29 B;  2K2V A;  4WF2 A;  2K5I A;  4M7D F;  3VYH B;  4C92 B;  3VS3 A;  2DF6 A;  1H92 A;  4RTY A;  1I1J A;  2OJ2 A;  4M7A E;  3NHN A;  2F2W A;  2EIF A;  3WVE B;  2CH4 W;  3OYM A;  3BY7 A;  1WHM A;  3TCJ A;  2QTX A;  5C0M A;  3FLG A;  2NLU A;  2EAY A;  3EAE A;  4VUB A;  1QCN A;  2DL5 A;  3UPU A;  1X2Q A;  3EH1 A;  3M54 A;  4C92 E;  1I4K 1;  4C0D B;  2D0N A;  1H3H A;  1PRM C;  4OP0 A;  1MNE A;  3G71 T;  3RUX A;  3HHT B;  2MIO A;  5FWC A;  4ELY C;  1NJI R;  3HRT A;  3PNW C;  4LDY A;  2E6Z A;  3D7S B;  4M75 D;  3X25 B;  1JRI A;  3I55 Q;  3NMZ C;  2CKK A;  1W70 A;  2RA2 A;  1OPL A;  4J7I A;  1PD0 A;  2B86 A;  1Q7Y U;  1BI0 A;  2BE9 B;  2DBM A;  2EQJ A;  3JRZ A;  2GNC A;  2J05 A;  1QVG A;  2EYW A;  4M75 G;  4FYY B;  2HL5 C;  1YCS B;  2A0F B;  4M78 A;  1C1A A;  1N9S A;  1O9S A;  1S1N A;  4EDU A;  3J81 E;  3RER A;  3PMI A;  1GBR A;  5FU7 C;  1U1T A;  4M77 G;  2RHX A;  1IHW A;  4BY6 B;  4XU2 A;  1BIA A;  2EW3 A;  3CCQ Q;  2CP2 A;  1VQL Q;  1SRM A;  2QA4 A;  1Q95 G;  2ZPE B;  4E7S A;  3CCL T;  1ZSG A;  2EGE A;  2FRW A;  1UUE A;  2XU8 A;  3OQ5 A;  3FEO A;  1VQ8 A;  4KH0 B;  2EBP A;  3TQ7 P;  2E5Q A;  1BI2 A;  3OYH A;  3JCM d;  3HKS A;  2O9S A;  5IN1 A;  4LUD A;  4A4G A;  4M78 B;  2F2X A;  3RKX A;  3JCM g;  3V7R A;  1W2B P;  4QQG A;  3CC7 T;  5D7U A;  3MEA A;  2X3X D;  4IUV A;  2P84 A;  3HPW A;  1OUL A;  1EIF A;  2V8J A;  1IXD A;  3QO3 A;  2OTJ T;  4BDY A;  2SEM A;  5GAO p;  1OPK A;  1W1F A;  3QDR B;  1KQS S;  5HCK A;  3EGD B;  1GFC A;  1UB4 A;  2EJ9 A;  3CCU T;  2HDA A;  4ZTF A;  3M5A A;  1I07 A;  5GAN f;  2EQM A;  3KXT A;  2CUB A;  1NM7 A;  4M78 E;  1C6V X;  3PMT A;  2E12 A;  4ME7 A;  4ZTJ A;  2DZ9 A;  4L59 A;  3M59 A;  3H0F A;  2X4J A;  3M0U A;  2DMO A;  2XHC A;  1PNJ A;  2IVW A;  4F04 B;  2XI9 A;  3RDV A;  1RUW A;  1TXQ A;  4NS5 A;  3AT1 B;  2X4X A;  3JB9 F;  3OMC A;  1BI3 A;  2JOY A;  2A36 A;  2CS7 A;  1YJW A;  1FWZ A;  2FL7 A;  2WSF E;  5GAO m;  1M27 C;  3CCS T;  3G1J A;  3SB2 A;  4RTW A;  2DX1 A;  1UE9 A;  4M7A G;  2Y4X A;  4GLM A;  3S3O A;  4RTU A;  4E47 A;  1WHK A;  2MPX C;  2RNA A;  1JXM A;  3OW2 P;  2RF0 A;  2JS0 A;  3VS7 A;  1X6O A;  2YDL A;  3JCM h;  2QYZ A;  5LJ3 d;  3BW1 A;  3MO8 A;  3NTK A;  1Q7Y R;  4JJD A;  2OX7 A;  5LJ3 g;  1RI0 A;  4C92 G;  3X26 B;  5GAO r;  2XIC A;  2DE0 X;  3GNG A;  2QI2 A;  2RQR A;  5IT9 E;  2HCK A;  3A5Z B;  3C0C A;  2JXB A;  1I0C A;  1T0H A;  5C6S A;  1IB8 A;  1H8K A;  4QW2 A;  4FT4 A;  5D6X A;  1ZUY A;  3JV3 A;  1SKU B;  5IH2 A;  2C0I A;  1U5S A;  4C5E A;  4FW2 A;  4RTT A;  4RUG A;  2DA9 A;  1YIT A;  2PZ1 A;  3UWN A;  1YHQ T;  3M4G A;  1VQ7 A;  3CCV A;  4WTO B;  3S6W A;  5L8R E;  1D1B A;  4JJC A;  1JO8 A;  2XD0 A;  2VVK A;  4N4I A;  4QVD A;  3CCR A;  4BDZ A;  2K79 A;  4PLL A;  2COW A;  3NTI A;  7AT1 B;  3RR6 A;  2VYT A;  1MMD A;  2GQV A;  4MZP A;  3FJP A;  2WSE E;  2X4Y A;  3JCM W;  4JZ3 A;  3A1P A;  2ZPB B;  3JSC A;  2YWW A;  3V8J A;  3A8G B;  3CPW P;  1N8R C;  1LVK A;  1UJ0 A;  5I21 A;  3GNF B;  1WI7 A;  4PJJ A;  2QEX A;  2RPN A;  2KXD A;  4FIB A;  4EPC A;  1VQ5 T;  3CC4 T;  4R56 A;  1WLP B;  2FVU A;  1YIJ A;  1VYV A;  5FU7 B;  2DXT A;  2RHZ A;  4JS4 A;  2MK5 A;  2OTJ Q;  1BI1 A;  4TVR A;  2HBP A;  1X27 A;  1YN8 A;  1ABO A;  1AHJ B;  5J3B A;  3QZ9 B;  1ZA2 B;  4DEY A;  5FWB A;  5CAI A;  5LJ3 h;  3GLX A;  5IHN A;  4X9D A;  3CCU Q;  1CSK A;  3OS1 A;  3M0Q A;  1PWT A;  2ED0 A;  2E6N A;  1PSF A;  2DL3 A;  2EFI A;  2LRQ A;  3VS5 A;  2VKN A;  3I9Q A;  5GJW B;  3ULR B;  1B07 A;  1WZO A;  4JRK A;  4PL6 A;  1VQ6 Q;  3MP8 A;  2W0Z A;  1Z9Q A;  3PFS A;  1HSQ A;  2ZZD A;  2X51 A;  1OX9 A;  2DL7 A;  5IHK A;  3L1A A;  1SG5 A;  4JLI A;  1QVG P;  5LJ5 e;  2E1H A;  3GIB A;  4AG2 C;  4M78 D;  4XK8 E;  5KE2 A;  4F17 A;  2AZS A;  2M0Y A;  3SHW A;  2VXF A;  3OYJ A;  1RAA B;  4RCB A;  3WVD B;  5GAM e;  1MV0 B;  1N27 A;  5GAO l;  3BDL A;  4M78 G;  3CCS Q;  3PT9 A;  4OMF B;  4LNP A;  3LX7 A;  4LN2 A;  1FMV A;  2VWF A;  3PVQ A;  1LNX A;  3G4S A;  3ER0 A;  5KYN A;  4A4E A;  1VUB A;  1M9S A;  4PFP A;  1BBZ A;  2GF7 A;  4NL3 A;  4C0D C;  1EX4 A;  2PVO B;  2RQU A;  4OMQ A;  1X75 C;  3EHQ A;  2C0O A;  2MOX A;  2X3W D;  3G6E Q;  1OZ2 A;  2MWP A;  4BI4 A;  3OYY A;  1WHL A;  1T3L A;  4ORZ A;  4HCC A;  2HQX A;  1RI9 A;  2PVG B;  2NUT A;  1YWP A;  2YUO A;  3P8H A;  1OEB A;  4AFU C;  1PHT A;  2H8H A;  5LJ5 f;  3CCE A;  3I56 A;  1YI2 A;  3HFO A;  1WPY A;  3REB B;  3CME A;  1PKT A;  2DTI A;  5FLX E;  1YHQ Q;  1KD1 C;  4IIM A;  1K73 R;  4MMK A;  2LX9 A;  2MMP A;  1W2B A;  2CP3 A;  2DZC A;  2JVV A;  4J9D A;  4BE0 A;  1VOM A;  1VYT A;  5GAN d;  2RK2 A;  4O6J A;  4NL2 A;  1Q81 U;  2E41 A;  4KGX B;  5GAN g;  3OB9 A;  2QXF A;  4CC3 A;  3PIP A;  4FU6 A;  3L2U A;  2D8J A;  3HRS A;  1Y57 A;  2O9V A;  3G7Z A;  1YJN Q;  1VQ5 Q;  4FYX B;  1M2V A;  2KEA A;  5KH6 A;  1SHG A;  1RAE B;  1JXO A;  3JCM Q;  3M53 A;  1NLO C;  1TSF A;  1NZ9 A;  1WQ7 A;  3EFO A;  2ZCF B;  2RN8 A;  2KK4 A;  3MKD A;  2KY9 A;  2RQT A;  2CP5 A;  3JB9 H;  3HP9 A;  1IGQ A;  1G3T A;  1PCX A;  4J9I A;  4M78 C;  1OQK A;  3VS4 A;  5GMK j;  2LVM A;  3QSU A;  3H0H A;  2A7Y A;  2QDY B;  4PJL A;  1JJ2 P;  5HK0 A;  1O75 A;  3CMA Q;  1BU1 A;  5J39 A;  1RAF B;  2L3R A;  3JB9 I;  3OW2 A;  3WXM B;  3CCJ T;  2C06 A;  2PU9 B;  3I55 A;  2EQK A;  4PFZ A;  2EPD A;  1WYX A;  4RCC A;  1WFW A;  4OB3 B;  2LT4 A;  2OTL T;  1AEY A;  3X24 B;  3QG1 A;  4J8O A;  4D8K A;  4FCY A;  3EFO B;  1N9R A;  3EH2 A;  1WGS A;  4E7L A;  3QII A;  2BTT A;  1AOJ A;  2CP6 A;  1QVP A;  5GAN h;  1ZX6 A;  3E9F A;  3LWI A;  4KGZ B;  4BE2 A;  3CQT A;  3QUI A;  2E64 A;  2RI2 A;  1PRL C;  5IHI A;  1JBM A;  2M1H A;  3PIO A;  5LJ5 j;  2QAZ A;  2FPF A;  1S72 T;  3ASK A;  3I35 A;  2DRM A;  4J6W A;  2DIG A;  1K9M C;  1Q82 U;  2HZY A;  2DVE A;  2E65 A;  3EG2 A;  4AG1 C;  2MI6 A;  1K8A C;  1M1K C;  1BCM A;  5CKF A;  4KUI A;  2LTO A;  3CCQ A;  1VQL A;  1QVF S;  1VQP Q;  3MPU B;  1AWX A;  2JM9 A;  4OMP A;  2KMT A;  3JCM b;  8AT1 B;  3CPW A;  1Y07 A;  4KUL A;  4J7F A;  3CCM T;  4E7H A;  2RJD A;  2MF2 A;  1YJ9 T;  1D0Z A;  3CC2 Q;  3VRZ A;  3RES A;  4EMG A;  1YWO A;  3E9G A;  4MZT A;  4RG8 A;  2K2M A;  2BZX A;  2LT1 A;  2F1L A;  4EMK A;  5CO7 A;  4O5V A;  3T9N A;  5KYW A;  5A2Q E;  5L23 A;  2I2L A;  2CRE A;  1RAC B;  3RMQ A;  3QJY A;  1WDX A;  1Q81 R;  3HRU A;  4C8Q F;  2JZ2 A;  1WJS A;  2O2O A;  4CI0 C;  2VV5 A;  2JMA A;  2YUQ A;  1ZHI A;  1N8R U;  4DA4 A;  1B34 A;  2CSQ A;  2PUO B;  2VC8 A;  4LUE A;  3SDZ A;  1AT1 B;  4EIK A;  3L2R A;  2VGM A;  1OOT A;  3JCM X;  3O5Z A;  3JCM P;  1AWW A;  3A8O B;  3JB9 D;  3VUB A;  2AK5 A;  5I2S A;  2B8A A;  4XTX A;  1IO6 A;  2MYS A;  4DQ2 A;  4OGC A;  2K3Y A;  2EGC A;  2DFU A;  4XTY A;  5GAO q;  4EMK B;  2QQR A;  3REA B;  4A53 A;  5KYW B;  1VQ8 T;  1TTH B;  4LDV A;  4XU1 A;  1VQM T;  3QDF A;  1SPK A;  4A4H A;  2HQE A;  2Y4Y A;  1VQO Q;  4RG2 A;  2V26 A;  1OU8 A;  2JMC A;  3CCJ Q;  2KQW A;  4DOW A;  2DAQ A;  1B34 B;  3DKM A;  4Z8A A;  2D1X A;  1GRI A;  1BK2 A;  2OTL Q;  1TU0 B;  1UJY A;  2HQH A;  4OF1 A;  5DLO A;  1FYN A;  3L2Q A;  1W2B S;  3C4S A;  5IAY A;  4HVU A;  4EMH A;  1M90 U;  4E7K A;  4X9C A;  2RB6 A;  1KK7 A;  3ME9 A;  4ATO A;  4JS5 A;  3EFR A;  1X6B A;  2VB6 A;  4FL6 A;  4PNO A;  4PJO A;  5GAN 8;  2EWN A;  3VKI A;  2FEI A;  1Q86 U;  1FX7 A;  1HK9 A;  1S72 Q;  3EFS A;  3V8L A;  1X6G A;  4KBM B;  3OYG A;  2DTO A;  4J9C A;  3GOX A;  1ZBX A;  2ZGW A;  3OBW A;  3BDU A;  4P5N A;  1DJ7 B;  3THK A;  4D6W A;  1KG1 A;  1Q82 R;  4BD3 A;  5GMK l;  5GAN 6;  1LCK A;  4J83 A;  2DLP A;  2AZV A;  5GMK h;  2EYY A;  5FRN A;  3U23 A;  4F7U A;  4JJN K;  2QQS A;  1YJW T;  5A0G A;  1UHF A;  2E5K A;  2VXE A;  2X35 A;  3HFN A;  4K11 A;  4J6X A;  4OB1 B;  3CCM Q;  3E2U A;  4JUV A;  1V76 A;  5GMK i;  1YJ9 Q;  5EG2 A;  4M7D A;  4BE1 A;  4OB2 B;  3JB9 J;  4PJO B;  5DM7 R;  4M75 F;  1G8X A;  1GCQ A;  3JCM c;  2OTJ A;  2BIV A;  4FT2 A;  3S3N A;  5I2M A;  1W6X A;  2M16 A;  2XKO C;  2E3H A;  3G71 Q;  4LXC A;  3CCU A;  3OYE A;  4ANJ A;  1AZG B;  3URG A;  4F7U B;  4M77 F;  3I5R A;  3X20 B;  1N8R R;  3OYN A;  1JJ2 A;  1YIT T;  1VQ6 A;  1Y0M A;  2CSI A;  2QTV A;  4C8Q A;  4BI3 A;  4M7D B;  4QT7 A;  4QVZ A;  3CCR T;  1D1A A;  3EHR A;  5AT1 B;  1QW1 A;  2YUN A;  2NWM A;  3NFC A;  2RD1 A;  4XU0 A;  3BFM A;  2MAM A;  5KE3 A;  4CC2 A;  4BB7 A;  3RKY A;  2J6F A;  1VQM Q;  4A4F A;  3HL8 A;  2RH2 A;  2KYM A;  3CCS A;  3JCM V;  5KCH A;  1KC8 U;  1M5Q 1;  2EYX A;  4ZN1 A;  1VYU A;  3RBB B;  2DNU A;  3CD6 T;  1YIJ T;  5KYU A;  2ED1 A;  4M7D E;  3CPF A;  1G3S A;  2GQI A;  1KFZ A;  1SSH A;  2HKN A;  1R0C B;  3INZ A;  3CCL Q;  5CCA A;  1RAB B;  5CVI A;  4Y92 A;  2YRV A;  1X43 A;  4C8Q B;  1W4S A;  1KQ2 A;  4KRT A;  2ATC B;  5GJV B;  3SWN C;  3RIR A;  1RLP C;  1YFN A;  2L89 A;  1M90 R;  3G6E A;  2HBW A;  1RAI B;  2PNI A;  3M55 A;  4RTX A;  4F16 A;  1MMN A;  3CC7 Q;  3CBM A;  4MML A;  2EKO A;  3QZ5 B;  2JNG A;  3MP1 A;  4D8D A;  4JPB W;  2L0A A;  1Q86 R;  1NBE B;  4OMM A;  4PKC C;  2RK1 A;  1YHQ A;  4YTL A;  1UEC A;  2CZ1 B;  4JRQ A;  3FB9 A;  3R6O A;  2M0O A;  2LX7 A;  4N4H A;  2MWO A;  2V1R A;  1Q7Y C;  1OV3 A;  5KYU B;  3M0P A;  2K9G A;  1UGV A;  3KBG A;  3UF4 A;  3H9N A;  4E7I A;  4ZNX A;  4M7A F;  2KXC A;  3VS6 A;  2KDS A;  3UT1 A;  2FHD A;  1QVG S;  2V8I A;  4DOV A;  3M57 A;  2PUK B;  1NPR A;  2KT8 A;  2EVR A;  4C5G A;  4PK4 A;  1G2B A;  1VQ4 T;  1G5V A;  3F70 A;  1UFF A;  3NGP A;  1B3Q A;  4J9B A;  1E6H A;  2DYB A;  5GAN 4;  4R55 A;  2LZ6 B;  1YJN A;  4C92 F;  1M1G A;  1VQ5 A;  3VJP A;  1Y96 A;  1X69 A;  1R0B G;  2E10 A;  3EGX A;  4ELZ C;  3VS1 A;  4QQ6 A;  2RI5 A;  1WJQ A;  4WCI A;  1AD5 A;  4MDX A;  4L5G A;  2IG0 A;  1GFD A;  4HVW A;  1YP5 A;  2BZ8 A;  1TS9 A;  3JCM e;  2H3J A;  3L42 A;  1CKB A;  4HCK A;  4C5H A;  2VGN A;  1M3C A;  3CCE T;  2XG8 D;  5GAN 2;  2HSP A;  4CC4 B;  1NEG A;  3I56 T;  3MEU A;  2L3S A;  4RKU E;  3CME T;  2V1Q A;  2LDM A;  1XJW B;  2E4H A;  3CMA A;  2FZG B;  3CXC P;  2D6F A;  1ZLM A;  4HA8 A;  3V7S A;  2D0Q B;  1I81 A;  3BE3 A;  1OU9 A;  3MHX A;  2LJ3 A;  1I8F A;  1Y96 B;  4PJO D;  1VQN T;  3OS2 A;  1F1B B;  4A4K A;  2LMJ A;  2KRN A;  3EGX B;  1U8R A;  1V1C A;  3ZEH A;  2FPE A;  2R5M A;  3MEV A;  1AZE A;  2YT6 A;  3M9Q A;  4ZGE B;  3CBP A;  1U1S A;  1VIE A;  2DEQ A;  2LNV A;  4PJO G;  1KC8 R;  3PVL A;  1WHG A;  2ZPI B;  4J9H A;  2K6D A;  3DLL A;  1TH7 A;  4IUQ A;  3CD6 Q;  5GAM f;  2XMF A;  2KT1 A;  4C0F A;  2DBK A;  1GBQ A;  1WXU A;  4IKF A;  1OYX A;  2OI3 A;  2BUD A;  4MDW A;  1KJW A;  1K9A A;  3L2W A;  2EQI A;  3UAT A;  4OMO A;  4EMK C;  1M1F A;  4UC4 A;  1NE8 A;  3SWN A;  1VA7 A;  1WIE A;  4F7U G;  2RMO A;  2AKK A;  2CZ6 B;  4M7D D;  2O4X A;  1K0X A;  5KCO A;  1UGQ B;  3Q1J A;  2NUT B;  1D1C A;  1ABQ A;  1VQP A;  1TUG B;  3CC4 Q;  1SSF A;  1G83 A;  3OYK A;  2K5L A;  1VQ9 T;  3QPH A;  2XDD A;  3J7A F;  2JN0 A;  1IGU A;  5LJ3 e;  4XTV A;  2YLC A;  4M7D G;  2COY A;  1ZSZ C;  2EGA A;  2DKG A;  2P0Q A;  1OI1 A;  2LQN A;  1KQS A;  1VQK T;  5GAN 7;  3CC2 A;  3OYD A;  2AIR B;  3LH5 A;  3I55 T;  1JJ2 S;  2YSQ A;  1PM3 A;  4M78 F;  4AT1 B;  2JS2 A;  3OS0 A;  1U06 A;  2HL3 A;  2DK3 A;  2DL4 A;  3PTA A;  1QWF A;  1QLY A;  1UGS B;  3VV0 A;  1QP3 A;  3MEW A;  2DET A;  1SRL A;  1X01 A;  3SWN B;  3OA6 A;  3OBY A;  4C8Q D;  3TSZ A;  2J6O A;  3A8L B;  2J6K A;  5AYF A;  3GBQ A;  2M9U A;  1MMA A;  3EG9 A;  2O4X B;  1VQ4 Q;  1B7T A;  4DBF A;  3QHS A;  2W10 A;  1QKW A;  4M7A A;  1M2V B;  4E7J A;  1QCO A;  1RLQ C;  2H3E B;  1K73 C;  4C8Q G;  1QQJ A;  2E3I A;  2G3R A;  1HXD A;  1IRE B;  3QWY A;  1M3B A;  5DLQ E;  1BYM A;  1SEM A;  1N5Z A;  1TG0 A;  1GCP A;  4CRI A;  1MGQ A;  2HEQ A;  3CCQ T;  2IIM A;  3TU4 K;  4C92 A;  2ROT A;  2DXC A;  4BUG A;  1FMK A;  2V8K A;  3M56 A;  2RHU A;  3SEM A;  2FZK B;  2KBT A;  4PJO C;  2YHT A;  4B9W A;  3LGL A;  2YRC A;  4OGE A;  4DBR A;  1K0S A;  2P0P A;  1VQO A;  1PSE A;  3EG9 B;  1M4Z A;  2JUF A;  3IQL A;  1MMG A;  4IUU A;  4CC7 A;  5GMK m;  3C12 A;  5GAM j;  3OSS C;  3CCJ A;  2GTO A;  1VQN Q;  1AWJ A;  2KRO A;  5D6W A;  4Z88 A;  1JB0 E;  2OTL A;  1ZUU A;  3EG3 A;  2LNH B;  3OYB A;  3FDR A;  2VUB A;  2G6F X;  2L3P A;  2CYZ B;  2YRD A;  1UGR B;  3A8M B;  5D6Y A;  4A63 B;  4M7D C;  2I0N A;  2R5A A;  3FC3 A;  5CKD A;  1ACM B;  1BKB A;  2K3B A;  3CBO A;  2F69 A;  2K4Y A;  2OAW A;  2DIQ A;  1GCQ C;  1JQQ A;  1S72 A;  1QVF P;  2CT4 A;  2OAU A;  4RTV A;  2GFU A;  4NOY A;  1NEB A;  3SD4 A;  1Y7X A;  2DVJ A;  2HD0 A;  4IIO A;  1M2O A;  2A37 A;  2RJC A;  2DXB A;  2GBQ A;  2CZ7 B;  1VQ9 Q;  1LPL A;  3OMG A;  1E7O A;  3LW5 E;  1ZSZ A;  4LD6 A;  3OYC A;  1XOV A;  4Y28 E;  1XQH A;  3P8B B;  3CCM A;  4A54 A;  4C8Q C;  5CKE A;  1YJ9 A;  1VQK Q;  2SRC A;  1ZA1 B;  1WQW A;  3VYG A;  1OZ3 A;  3VS0 A;  2L5Q A;  4N4G A;  1D3B A;  2QA4 T;  2IPO B;  2KVQ G;  2CH4 A;  2K7A A;  3JB9 G;  2YUP A;  2P4R A;  3LLR A;  3UA7 A;  1WJR A;  3LYI A;  2RM4 A;  1SHF A;  3VS2 A;  1I5O B;  1OX8 A;  2FZC B;  3G71 A;  1UG1 A;  4XTW A;  1QCF A;  1UHC A;  1WXB A;  2R57 A;  3M0T A;  4FW1 A;  4M77 D;  5LJ3 j;  2DRK A;  2LJ1 A;  2GFA A;  4KGV B;  2NUZ A;  2JJ9 A;  1XTD A;  2QG9 B;  5ECA A;  2KE9 A;  4PJM A;  4DBH A;  2WSC E;  3DB3 A;  3MCA B;  1ZSZ B;  3V8K A;  2LC4 A;  3CXC A;  4HCB A;  5GAN e;  2QK0 A;  3EGD A;  5LJ5 d;  4Q5W A;  3HSB A;  4J9F A;  1WA7 A;  4MZM A;  1WX6 A;  1UEB A;  5FRM A;  5LJ5 g;  3E1S A;  1QKX A;  4QVC A;  1D3B B;  2NUP A;  1K4U S;  2D9T A;  2CGH A;  2MCN A;  1Q81 C;  1NJI C;  2FB7 A;  5GAM d;  3QJ6 A;  1VQM A;  4GY5 A;  2QQA A;  5FU6 B;  2EJF A;  5GAM g;  1NYG A;  2DXU A;  2EYQ A;  3GP8 A;  5A0D A;  1D0X A;  4C0G A;  2DEU A;  5EC7 A;  5IXF A;  4J6Y A;  1K76 A;  4JDS A;  4BI8 B;  4II1 A;  4LDX A;  4PLI A;  3CCL A;  1ZBJ A;  2LJ0 A;  2JM8 A;  3LWH A;  3JCM J;  1UGP B;  1XNI A;  2A28 A;  1JU5 C;  4FSS A;  2O01 E;  3MP6 A;  1A0N B;  1U3O A;  2NUP B;  1KQS P;  4XTZ A;  2HNI A;  3QWX X;  2DD4 A;  1QMC A;  5FW9 A;  1KD1 U;  3M0R A;  3OSV A;  2DO3 A;  3CC7 A;  3MET A;  1VQ6 T;  2DIL A;  2K57 A;  1YNZ A;  4GBQ A;  5GAO n;  1MUZ A;  3OW2 S;  1MHN A;  2LCS A;  3PGG A;  1MND A;  4RTZ A;  5KYX A;  4GLK A;  2DL8 A;  2JTF A;  1WXT A;  1X2K A;  1PKS A;  2DM1 A;  8ATC B;  5GAN 3;  3V7C A;  1PD1 A;  1EFN A;  2RJE A;  1ARK A;  4M7A D;  3QBY A;  1C0M A;  2A3L A;  2NYS A;  1PG5 B;  1PC0 A;  5LJ5 h;  3GF5 A;  4M75 C;  1IRX A;  1LOJ A;  2KAF A;  2M51 A;  3ZL7 C;  2QQ9 A;  4AFZ C;  4IUT A;  2HMA A;  4PJO E;  2ZPG B;  4KT0 E;  1VQ7 T;  3CCV T;  1UTI A;  2QGG A;  1KIK A;  3H6Z A;  4J9G A;  3EGU A;  3GPL A;  5GAM h;  2GGR A;  4C92 D;  4HT9 A;  1NLP C;  2K5F A;  4Z89 A;  4QQD A;  3P8D A;  4M77 C;  3VRY A;  2QA4 Q;  1CKA A;  4LDU A;  4PFO A;  2EKH A;  2K3X A;  2D8H A;  4F7U E;  1Q82 C;  2PQW A;  5HK3 A;  5KYX B;  1VQ8 Q;  1M8M A;  1MV3 A;  2A08 A;  3RMS A;  1FMW A;  2COZ A;  1EZZ B;  4HKE A;  2P4T A;  3LH0 A;  2EJG A;  4ZGD B;  3G6E T;  1HJD A;  3VU3 C;  2QEX T;  4J5Y A;  2P0K A;  2LQK A;  3TEE A;  2RJF A;  4C0Z A;  3OYL A;  4J9E A;  1G3Y A;  3CPW S;  1LJO A;  4BAC A;  4F14 A;  2KNB B;  4KH1 B;  4XQ3 A;  2CUD A;  1RAD B;  1D09 B;  2ESW A;  5A0L A;  1K73 U;  2LQW A;  3ZBD A;  2RHI A;  5CQY A;  1AVZ C;  4AFQ C;  1T0J A;  3QYH B;  5I11 A;  1R77 A;  4OMN A;  3I5S A;  2KI7 A;  2L3Q A;  3L2V A;  1QWE A;  2AHJ B;  2BZY A;  5GMK e;  5J26 A;  4DEX A;  3TSW A;  4E2F B;  5M9O A;  4LE9 A;  2L2P A;  2RHY A;  1WHJ A;  4C8Q E;  2DD5 A;  1RL2 A;  2KSS A;  5GAN j;  1YJN T;  1JEG A;  3CD6 A;  3NTH A;  2E70 A;  1K9M U;  4LD9 K;  2DTH A;  1YJW Q;  1K8A U;  1QVF A;  5LL6 S;  3CEY A;  1M1K U;  2CZ0 B;  2WAC A;  4C5I A;  1QP2 A;  2VAS A;  5GAN 5;  4Y91 A;  3H8Z A; 
#chains in the Genus database with same CATH homology
 1RUW A;  2O2O A;  2JMA A;  3LH5 A;  3NPF A;  2YUQ A;  2YSQ A;  2PTK A;  2JW4 A;  1UDL A;  2JS2 A;  4X1V A;  1U06 A;  1BB9 A;  2CSQ A;  2A36 A;  4LUE A;  2DL4 A;  1QWF A;  1QLY A;  2O31 A;  4EIK A;  1OOT A;  2ECZ A;  1SRL A;  2QDL A;  1M27 C;  2O88 A;  3O5Z A;  1M3A A;  1AWW A;  3TSZ A;  4RTW A;  2DX1 A;  2J6O A;  2J6K A;  1UE9 A;  5I22 A;  3GBQ A;  4GLM A;  2AK5 A;  4RTU A;  2ROL A;  4JZ4 A;  2RNA A;  1JXM A;  4AFS C;  1IO6 A;  2RF0 A;  2EGC A;  2W10 A;  1QKW A;  2JS0 A;  3VS7 A;  1RLQ C;  2YDL A;  2J06 A;  3FJ5 A;  3REA B;  1SPK A;  4JJD A;  2FG0 A;  3QWY A;  1M3B A;  2DE0 X;  2EYZ A;  2F2V A;  1SEM A;  1N5Z A;  1TG0 A;  1GCP A;  2HEQ A;  2JMC A;  2RQR A;  2IIM A;  2HCK A;  3C0C A;  2JXB A;  2ROT A;  1M30 A;  4R0K A;  1FMK A;  3SEM A;  1I0C A;  1E6G A;  1T0H A;  2KBT A;  4Z8A A;  1H8K A;  1ZUY A;  2D1X A;  3JV3 A;  5IH2 A;  1GRI A;  2C0I A;  1BK2 A;  1UJY A;  1U5S A;  2J7I A;  4RTT A;  4RUG A;  2DA9 A;  1K0S A;  1FYN A;  2PZ1 A;  3PE0 A;  4HVU A;  4HVV A;  3IQL A;  4CC7 A;  4JJC A;  1JO8 A;  2VVK A;  2JT4 A;  2K79 A;  1X6B A;  4E6R A;  2GTO A;  2FO0 A;  1AWJ A;  4HXJ A;  2KRO A;  2KGT A;  4Z88 A;  1ZUU A;  2FEI A;  3EG3 A;  2C0T A;  4JZ3 A;  3A98 A;  1X6G A;  2LNH B;  3EG1 A;  4J9C A;  1UJ0 A;  1GL5 A;  2G6F X;  2L3P A;  3THK A;  1WI7 A;  2RPN A;  2KXD A;  4A63 B;  1LCK A;  2I0N A;  2DLP A;  2AZV A;  1WLP B;  2EYY A;  3U23 A;  1VYV A;  2K3B A;  1UHF A;  1J3T A;  2E5K A;  2OAW A;  1TUC A;  1GCQ C;  1JQQ A;  2CT4 A;  4K11 A;  1X27 A;  1YN8 A;  1ABO A;  4RTV A;  1NEB A;  4DEY A;  1T3S A;  5FWB A;  3RNJ A;  5IHN A;  1AWO A;  4JJB A;  1CSK A;  3M0Q A;  1PWT A;  2DVJ A;  2ED0 A;  4IIO A;  3KFV A;  2A37 A;  2DL3 A;  3H41 A;  3VS5 A;  4OML A;  2VKN A;  3I9Q A;  5GJW B;  3ULR B;  2DJQ A;  2KRM A;  1GCQ A;  2GBQ A;  2KR3 A;  1B07 A;  2LP5 A;  1TUD A;  2W0Z A;  1E7O A;  3H0I A;  1W6X A;  1Z9Q A;  1XOV A;  1ZUK A;  1HSQ A;  2DL7 A;  5IHK A;  2SRC A;  1AZG B;  4AG2 C;  2RQV A;  4F17 A;  2AKL A;  3VS0 A;  2CDT A;  2AZS A;  2M0Y A;  3SHW A;  3I5R A;  2CT3 A;  2CH4 A;  2K7A A;  2YUP A;  2P4R A;  1Y0M A;  2RQW A;  3UA7 A;  1MV0 B;  1SHF A;  3VS2 A;  2CSI A;  2ENM A;  1K1Z A;  1UG1 A;  2JTE A;  3R6N A;  1QCF A;  1UHC A;  1WXB A;  3M0T A;  4LN2 A;  4LNP A;  4QT7 A;  2VWF A;  2FRY A;  3PVQ A;  2DRK A;  3EHR A;  2LJ1 A;  3UA6 A;  2YUN A;  2NWM A;  2NUZ A;  5ECA A;  2KE9 A;  4ESR A;  4CC2 A;  2KYB A;  1NG2 A;  1BBZ A;  2FPD A;  2J6F A;  5IXB A;  2KRS A;  2KYM A;  3EG0 A;  2RQU A;  4OMQ A;  2GTJ A;  3M0S A;  3EHQ A;  2C0O A;  2EYX A;  2MOX A;  2X3W D;  1VYU A;  4J9F A;  1WA7 A;  1WX6 A;  3RBB B;  2DNU A;  1QKX A;  1KSW A;  2ABL A;  1T3L A;  4ORZ A;  1K4U S;  2ED1 A;  1RI9 A;  3TVT A;  1HD3 A;  1YWP A;  2YUO A;  2MCN A;  2GQI A;  1KFZ A;  1OEB A;  4AFU C;  1Z9Z A;  1PHT A;  2H8H A;  1SSH A;  4M4Z A;  1NYF A;  3REB B;  4Y92 A;  1PKT A;  1X43 A;  4KRT A;  5GJV B;  1NYG A;  4IIM A;  1RLP C;  5EC7 A;  5IXF A;  2HBW A;  1K76 A;  2PNI A;  3VS3 A;  4RTX A;  4F16 A;  2DF6 A;  4J9D A;  1H92 A;  4RTY A;  1I1J A;  1VYT A;  2OJ2 A;  4D8D A;  4JPB W;  3NHN A;  2F2W A;  1ZBJ A;  2CH4 W;  2L0A A;  2LJ0 A;  2JM8 A;  4OMM A;  1UEC A;  2A28 A;  4CC3 A;  1JU5 C;  2LX7 A;  4FSS A;  2D8J A;  2V1R A;  1A0N B;  1U3O A;  1OV3 A;  1Y57 A;  2K9G A;  3M0P A;  1UGV A;  2O9V A;  3QWX X;  3UF4 A;  2DL5 A;  5FW9 A;  4ZNX A;  2KEA A;  1X2Q A;  3M0R A;  2KXC A;  3VS6 A;  2DIL A;  1SHG A;  1YNZ A;  4GBQ A;  1JXO A;  2D0N A;  1NLO C;  1H3H A;  1PRM C;  1MUZ A;  2LCS A;  4RTZ A;  2DL8 A;  2KT8 A;  2EVR A;  2MIO A;  2RN8 A;  5FWC A;  1WXT A;  1X2K A;  1PKS A;  1G2B A;  2DM1 A;  3NGP A;  1EFN A;  1UFF A;  1B3Q A;  2RQT A;  1ARK A;  4J9B A;  1E6H A;  2DYB A;  2LZ6 B;  4J9I A;  3NMZ C;  1W70 A;  3VS4 A;  1OPL A;  2M51 A;  1X69 A;  3ZL7 C;  3H0H A;  2B86 A;  4AFZ C;  3VS1 A;  2DBM A;  2GNC A;  1UTI A;  2J05 A;  4WCI A;  1AD5 A;  1BU1 A;  2EYW A;  1KIK A;  4J9G A;  3EGU A;  1GFD A;  4HVW A;  1YP5 A;  2GGR A;  2BZ8 A;  1NLP C;  1YCS B;  4Z89 A;  1CKB A;  3VRY A;  4HCK A;  1M3C A;  2EPD A;  1WYX A;  1CKA A;  2HSP A;  1WFW A;  4CC4 B;  1NEG A;  2L3S A;  1S1N A;  1GBR A;  2EKH A;  2D8H A;  1AEY A;  1M8M A;  2V1Q A;  4D8K A;  1MV3 A;  2A08 A;  1ZLM A;  2BTT A;  1AOJ A;  1HJD A;  1ZX6 A;  3CQT A;  2LJ3 A;  2EW3 A;  1PRL C;  5IHI A;  1SRM A;  2LMJ A;  2KRN A;  4J9E A;  1ZSG A;  4F14 A;  1V1C A;  2EGE A;  1UUE A;  2FRW A;  2KNB B;  2FPF A;  2FPE A;  1AZE A;  2CUD A;  2YT6 A;  2EBP A;  2ESW A;  3I35 A;  2DRM A;  2LQW A;  2O9S A;  3PVL A;  4LUD A;  3EG2 A;  4AG1 C;  4J9H A;  2K6D A;  1AVZ C;  2F2X A;  4AFQ C;  2XMF A;  1T0J A;  2KT1 A;  2X3X D;  1AWX A;  2DBK A;  1GBQ A;  1WXU A;  2OI3 A;  5I11 A;  4OMN A;  3I5S A;  1KJW A;  2JM9 A;  4OMP A;  1K9A A;  2EQI A;  2L3Q A;  2SEM A;  3UAT A;  1OPK A;  1W1F A;  4OMO A;  5HCK A;  1QWE A;  1GFC A;  1VA7 A;  1WIE A;  2BZY A;  2RMO A;  2AKK A;  2HDA A;  4DEX A;  3TSW A;  3VRZ A;  4LE9 A;  2L2P A;  1YWO A;  1K0X A;  1JEG A;  1I07 A;  1ABQ A;  2CUB A;  2K2M A;  2BZX A;  1NM7 A;  1G83 A;  3H0F A;  5L23 A;  2CRE A;  3M0U A;  2DMO A;  2EGA A;  1WDX A;  1PNJ A;  2LQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...