2J6OA

Atypical polyproline recognition by the cms n-terminal sh3 domain. cms:cd2 heterotrimer
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-ASSOCIATED PROTEIN
publication title Atypical Polyproline Recognition by the Cms N-Terminal SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j6oA00
1A0NB 2FPFA 2XMFA 1WYXA 2J7IA 3I5RA 2EGEA 1GFDA 1WXTA 2JM9A 2YSQA 2MCNA 2ABLA 1X43A 2OAWA 3H0IA 4LUDA 2NWMA 1CSKA 3VS0A 1EFNA 3IQLA 1UFFA 5IHIA 1Z9QA 3C0CA 1QWFA 4WCIA 4AFSC 1K76A 2MIOA 2LNHB 3VS2A 4OMOA 1ABQA 1KIKA 1UJYA 4RTXA 3I35A 4JJBA 2KT8A 3A98A 3PE0A 1M3AA 2CT4A 2EYWA 2JT4A 4Z88A 1GCQC 1KFZA 1M8MA 4K11A 3M0TA 1E6GA 2DM1A 1GCPA 2RQUA 3CQTA 4F16A 2C0IA 1TUCA 2KRNA 2ESWA 2DL8A 2CDTA 2HBWA 2JM8A 1K1ZA 1AZGB 1NYFA 1UJ0A 2CUDA 4DEYA 2DBKA 4RUGA 2PNIA 2SRCA 1FYNA 3M0RA 2VWFA 3JV3A 3O5ZA 4ESRA 5IHKA 4HVWA 5IXFA 2DL7A 1GFCA 1AZEA 2F2XA 1CKAA 4M4ZA 3UA7A 2JMCA 2C0TA 3QWXX 2V1QA 2YUPA 2H8HA 1AEYA 1WFWA 2DL4A 2ED0A 2OJ2A 3H0HA 4AFUC 2K79A 2AKKA 1UTIA 2EGCA 1Y57A 4J9EA 2BZYA 2O9SA 1X6GA 2E5KA 1UECA 3R6NA 2KEAA 1WXBA 1BB9A 4RTVA 1GCQA 5IHNA 2LQWA 1YNZA 1SHFA 1JXOA 2EYXA 1H92A 1PKSA 2FEIA 3I5SA 2KR3A 4FSSA 2J6OA 1VA7A 3NGPA 2K2MA 1RUWA 4IIOA 1HD3A 4OMMA 4RTTA 3SEMA 2JS0A 2EKHA 5I11A 2YUNA 5EC7A 4HVVA 1K4US 1WXUA 4RTWA 1ARKA 4J9IA 2LX7A 2JTEA 2F2WA 2A08A 2GGRA 2O31A 2ROTA 1GRIA 4OMNA 2K7AA 2SEMA 1UUEA 1QCFA 1UG1A 2P4RA 1AOJA 2CSQA 1WIEA 1G2BA 4CC2A 3VRYA 2EW3A 2PTKA 1U3OA 1ABOA 1OV3A 4X1VA 1I07A 1NEGA 3H41A 3UA6A 1ZSGA 2FPEA 2DA9A 4Z89A 3SHWA 1XOVA 2A36A 1ZUUA 1H3HA 2K6DA 2AKLA 4LNPA 1PRLC 1WDXA 2YT6A 4AFQC 4OMQA 2OI3A 1SSHA 2LJ3A 1E6HA 2J05A 1RLPC 2RN8A 4JPBW 3ZL7C 1RLQC 4J9BA 2FG0A 2LP5A 2W10A 2GBQA 2LQNA 2DNUA 1BBZA 4KRTA 4D8DA 4HVUA 1NYGA 1X69A 4J9FA 4D8KA 2GQIA 1BU1A 1SRMA 2V1RA 5FWCA 4AG2C 1JXMA 2RNAA 4F17A 2KRSA 1JO8A 2EVRA 2RMOA 3TVTA 2K3BA 5ECAA 3GBQA 1NLPC 2EYZA 1RI9A 4LUEA 5IXBA 4CC3A 3REAB 5I22A 1WX6A 2FPDA 4GLMA 2BZXA 1QKXA 2FRYA 1X2QA 1N5ZA 1T0JA 2DE0X 1B07A 2CH4A 1I0CA 2LMJA 2EGAA 1IO6A 2EPDA 1AD5A 3EG1A 2VVKA 1X27A 1W6XA 2KGTA 4IIMA 1OOTA 2KRMA 2HCKA 5FWBA 2C0OA 2VKNA 1YWOA 2O2OA 2J06A 4JJCA 3LH5A 2LCSA 3VRZA 4AFZC 3EGUA 3ULRB 1ZX6A 4ZNXA 3I9QA 3EHQA 2D1XA 3M0PA 2LZ6B 3NPFA 4JJDA 1I1JA 3EG3A 1QKWA 2KROA 5FW9A 1E7OA 1PNJA 1U5SA 2M0YA 2KBTA 2JMAA 5HCKA 4HXJA 2DVJA 3H0FA 3VS7A 1K0XA 2D8HA 4R0KA 2RF0A 2O88A 3U23A 1ZUKA 4LE9A 3M0QA 1HSQA 2GTJA 5L23A 2RQRA 1YP5A 1WA7A 3QWYA 1AWOA 1AWXA 1JU5C 3M0UA 2M51A 5GJVB 2X3XD 5IH2A 1T3LA 1X2KA 1G83A 1AVZC 2YDLA 4J9HA 2A37A 2DMOA 1UDLA 1JQQA 1UHFA 2RPNA 4DEXA 2KE9A 3EG2A 2GNCA 2ED1A 2ROLA 2RQWA 4E6RA 2KXCA 3EHRA 2J6KA 1U06A 2L0AA 2D8JA 3UF4A 2FO0A 2CREA 1V1CA 1WLPB 3VS1A 1FMKA 4RTZA 1B3QA 1TUDA 1T0HA 4OMLA 3UATA 2RQTA 2LJ1A 3EG0A 2HSPA 2BZ8A 2PZ1A 2FRWA 2DBMA 1MUZA 2EQIA 4AG1C 2LJ0A 1YWPA 1NEBA 4GBQA 2DRKA 3RBBB 2RQVA 2KT1A 2MOXA 3VS4A 2DILA 1AWWA 1NLOC 3REBB 2CT3A 2KYMA 2A28A 2JW4A 2KYBA 1Z9ZA 4RTYA 1SPKA 1ZLMA 2DL3A 3KFVA 2DLPA 4J9GA 4JZ3A 1T3SA 1JEGA 1TG0A 3NHNA 2ECZA 1PKTA 1ZBJA 2DRMA 2AZSA 3PVLA 2HEQA 4HCKA 1PRMC 4J9CA 1SHGA 1K0SA 3PVQA 1X6BA 4LN2A 3RNJA 2BTTA 4RTUA 2W0ZA 2EBPA 1VYTA 4J9DA 2L3QA 4F14A 2YUQA 1S1NA 1VYUA 2F2VA 1OEBA 1PWTA 1MV0B 3VS3A 1M27C 2JS2A 2L3PA 1GL5A 1Y0MA 3FJ5A 4ORZA 1W1FA 1UGVA 1SEMA 3TSWA 2NUZA 1BK2A 1GBRA 1HJDA 1OPLA 1ZUYA 2I0NA 3NMZC 1WI7A 1J3TA 2DL5A 1UE9A 2CH4W 1OPKA 4Y92A 1YN8A 4Z8AA 2GTOA 1AWJA 2G6FX 1CKBA 4CC4B 2CSIA 2X3WD 4CC7A 1PHTA 1YCSB 5GJWB 2D0NA 2IIMA 2B86A 2L2PA 1GBQA 2YUOA 2KXDA 1QLYA 2AK5A 2DX1A 2CUBA 1M3CA 1K9AA 1W70A 1KSWA 3M0SA 1QWEA 1M3BA 1SRLA 2EYYA 3TSZA 1UHCA 1LCKA 2ENMA 1VYVA 2O9VA 2J6FA 2K9GA 3VS6A 4EIKA 1M30A 4OMPA 2JXBA 3THKA 2KNBB 1MV3A 2L3SA 1H8KA 2AZVA 2DF6A 3VS5A 4JZ4A 2DJQA 1NM7A 2HDAA 2QDLA 1KJWA 1NG2A 4A63B 4QT7A 2DYBA
chains in the Genus database with same CATH superfamily
2YLCA 1QCNA 2J7IA 3X26B 3TU4K 3QBYA 2RHXA 2OAWA 3H0IA 3RESA 1X75C 4E7LA 1KQ2A 4BI4A 4C8QE 2RK2A 1PM3A 3AHUA 5IHIA 1IRXA 3VV0A 2E64A 1YJNQ 2LNHB 4JLGA 2CP3A 4JS4A 2NYSA 2Z0WA 1BCMA 3C94A 4M7DB 4JJBA 2JT4A 4Z88A 1KFZA 4M78A 3OS5A 2QASA 2R58A 1ZBXA 5LJ5f 2C0IA 1TUCA 1MMDA 3RDVA 2KRNA 1K1ZA 2CZ7B 1KG1A 1AZGB 2CUDA 2RO0A 2GFAA 4RUGA 1VQPQ 2SRCA 3M0RA 3JV3A 2DIQA 1GFCA 5HK0A 4ZTFA 1AZEA 2CZ6B 3OYKA 1M2VB 1TXQA 3D7SB 3M58A 2B8AA 4PJOC 2COZA 2X4YA 2M02A 5CQYA 2ED0A 4AFUC 1BI1A 3HPWA 4M77F 2O9SA 3CC7Q 1M2OA 4J7IA 3OYEA 3OBYA 1EIFA 4ME7A 1UECA 4UC4A 3FDRA 3PTAA 1BB9A 4M78D 1BIBA 4M78G 2EYXA 1PKSA 2KR3A 4FSSA 4JDSA 1VA7A 1VQNA 1QMCA 4Q5WA 1HD3A 4ZN1A 3I55A 3MEAA 1OX8A 4C8QA 2JS0A 3HSBA 1NJIR 1UGRB 5CQXA 2WSFE 4PJJA 5EC7A 2P0PA 4J9IA 2LX7A 2JTEA 1K8AR 3EG9A 3OY9A 2F2WA 1VOMA 2GGRA 1OU8A 4FYXB 2ROTA 2DEQA 1X6OA 2K7AA 1RAFB 4PJOB 2SEMA 5IAYA 1UG1A 2YLBA 5GMKm 4BI8B 1AOJA 5LJ3g 2QEXQ 1C6VX 2EQKA 4HCCA 2RD1A 1Q86C 2QTVA 3META 3PGGA 2AT1B 2KK4A 1VQ9T 1WHGA 2FPEA 3QZ5B 3SHWA 5GANf 1W2BA 1XOVA 4KGVB 2AKLA 4C8QD 3CPWS 1WDXA 2NUPA 2LJ3A 4EMGA 1K73U 1VQ6Q 2WSCE 5FRMA 4KT0E 2FG0A 5GAN7 1VQKT 2LP5A 1Q86R 2GBQA 2LQNA 4OGEA 1VQ5T 4J9FA 4D8KA 4BY6C 1BU1A 1QVPA 3CCEA 1SRMA 4AG2C 1JXMA 3A5ZB 2XDPA 4KUIA 4C5IA 3TVTA 2K3BA 2K4YA 5ECAA 3JSCA 3N5BB 3OYBA 3OYYA 4O5VA 3CCQQ 2EYZA 4LUEA 3CCJQ 2ZPFB 1RL2A 5I22A 1QVFP 3QYHB 1WX6A 1G3SA 4QVZA 1B7TA 1NZ9A 5D6YA 5CKHA 2VXEA 1U1TA 1N5ZA 3EFOA 3X28B 2RHUA 3EG1A 1XQHA 2VVKA 1WHKA 4M7AF 3WVEB 2D9TA 1OOTA 2XU8A 4BB7A 5FWBA 2CP7A 1YWOA 2O2OA 4FL6A 2LCSA 2L8DA 3HFNA 4BY6B 2QYZA 4HA8A 3NTIA 4C5HA 4XTXA 4M7AE 2CYZB 1VQ4T 2DTIA 2DXBA 3EGXA 4M75E 5LJ5g 2EFIA 2HMAA 4R56A 1N8RC 5FRNA 1LPLA 2EJGA 3QSUA 3FLGA 4JRKA 1BKBA 2DVJA 3CCRA 2R5AA 2CKKA 5KCHA 2RF0A 2O88A 5CK9A 1HSQA 1Q81R 1FX7A 2XKOC 4XU2A 4XTYA 5FLXE 4XTWA 3QWYA 3CD6A 1I81A 3BE3A 3M0UA 1MMNA 2X3XD 2WACA 1AVZC 2HD0A 1YIJQ 3HFOA 3LGLA 2A37A 2RHZA 1UDLA 1D1BA 1M90R 1YJNT 3EG2A 1VQOA 1QP3A 5HY6A 1IREB 2J6KA 1Q82C 1U06A 4BD3A 2E70A 3VS1A 1KC8C 1B3QA 1TUDA 3VYHB 1T0HA 2RHIA 4OMLA 3JCMP 2RQTA 2DBMA 1MUZA 1YWPA 4M7AA 2DRKA 2RQVA 2LRQA 5LJ3e 4E7SA 2DILA 5CCAA 5GMKj 5GAMf 1VQPT 4M75A 3CCSQ 1NLOC 3CCUA 2A28A 3UPUA 3CCVQ 3J7AF 1M1FA 4RCCA 3G4SQ 2M9UA 5CIUA 4FM4B 1PKTA 3UWNA 3A8MB 2HEQA 4BUGA 4R55A 4HT9A 2YRVA 3OQ5A 5L8RE 3CC4T 1K0SA 2VASA 4LN2A 4A54A 2BTTA 4RTUA 1ACMB 5GAMd 1TSFA 3M56A 1W2BP 1PWTA 1MV0B 2LQKA 5GMKh 3GOXA 3QUIA 1GL5A 1G3WA 2QGGA 4ORZA 1ZSZA 1N27A 3MEWA 3CPFA 1M4ZA 2NUZA 3TQ7P 1BK2A 1OPLA 3PMIA 1R8OB 3V8KA 2JJ9A 2E1HA 1VQOQ 1WI7A 2V8IA 2KVQG 2KI7A 1TH7A 4N4HA 2VUBA 3CMEQ 1YITA 1YN8A 1X01A 3M53A 2QA4Q 3CC2A 1VUBA 2D0NA 3CBPA 3QKJA 2X35A 1JJ2S 3OA6A 2EQJA 1VQ9A 3CXCA 3LWIA 4XU0A 2DX1A 3E9GA 2PUOB 2CUBA 1M3CA 1K9AA 4OF1A 1W70A 1KSWA 1YI2Q 2F5TX 3GLXA 1NE8A 1IXDA 4PFOA 3TSZA 4P5NA 1VQKA 2ENMA 1VYVA 4BE2A 3VS6A 2EJFA 3G71Q 1VQ6T 2EQUA 2COYA 1MV3A 4BI3A 2I2LA 3JCMd 3OYHA 5GMKe 1BI2A 1NM7A 4M77C 1NG2A 4II1A 3EFRA 2E5QA 3BY7A 1A0NB 1WHLA 2XMFA 2EKOA 1KQSA 1WXTA 2YSQA 2MCNA 3OSSC 3DLLA 1X43A 4HCBA 1IB8A 3V8LA 2LVMA 4EMKA 1CSKA 1LVKA 3IQLA 2MK5A 1Q7YU 1UFFA 3CCJT 3C0CA 2F5KA 2Y4XA 1YITQ 3JAME 3VS2A 1RI0A 4FT4A 4PJNA 4F04B 1MNEA 1KIKA 4QW2A 3I35A 2GCXA 1BI0A 2LT1A 4L6V5 3DKMA 1K73C 4C92D 4C92G 1O9SA 1M8MA 4K11A 3M0TA 1E6GA 2RQUA 1YJ9A 3CQTA 2ZGWA 4LDVA 3SDZA 3QZ9B 5KH6A 2DL8A 4M77B 3EH1A 1NYFA 1UJ0A 2H3EB 4JUVA 4DEYA 1Q95G 2PNIA 4ESRA 2VWFA 4HVWA 4J5YA 5IXFA 4ZTJA 2PQWA 1K73R 1SG5A 4M4ZA 3UA7A 3MJXA 2JMCA 2C0TA 3OYIA 2BE9B 2V26A 1QVGS 1VQMQ 3SWNC 3BFMA 2K3YA 2DTHA 4M78F 3M4GA 3M55A 2FZGB 1D09B 1AEYA 2DL4A 3H0HA 2A7YA 3L2QA 2K79A 5GAMg 2BZYA 4L59A 4DOWA 3C95A 2QGFB 1GCQA 1YNZA 3OBWA 4JLIA 4PFPA 1H92A 3I5SA 1M1GA 2K2MA 1RUWA 2XICA 1YHQT 2HKNA 3TEEA 2CP6A 2E6NA 3H8ZA 1K4US 3MEVA 2JTMA 1ARKA 4JRQA 1PG5B 4N0AC 2A08A 1OU9A 2O31A 2BE7D 4OMNA 3SWNB 3UDCA 2CP0A 1QVFA 2O4XB 1G5VA 2P4RA 1WIEA 2P0QA 3CCMQ 4JRPA 3VRYA 2ZPGB 5CR2A 4KULA 4NL2A 1U3OA 4C8QF 1VQ8Q 1ABOA 2JVVA 2NLUA 1M5Q1 8ATCB 3HHTB 2M0OA 3MP6A 4MZTA 1Y96A 2DTOA 1XNIA 3JCMX 3I56T 1ZSGA 2RH2A 4Z02A 2MF2A 5KYXA 4A53A 2A36A 3RKWA 1H641 2HSEB 4MDWA 3CCST 2YT6A 3HRUA 4OMQA 2EYQA 1SSHA 3CC4A 1E6HA 3JCMg 3G4ST 1RLPC 4JPBW 3ZEHA 5KE2A 4J9BA 2VYTA 3CXCP 1KHCA 2W10A 2DYIA 4KRTA 4MMKA 3CCLQ 2DVEA 1OI1A 2GQIA 2HBPA 9ATCB 2XDBA 1UGPB 2R5MA 3L2UA 1VQ7A 2QXFA 3HL8A 4RG2A 2RMOA 1RAHB 1R77A 4E7KA 1YJWT 1JB0E 2OAUA 4XQ3A 2DIGA 2JZ2A 3FEOA 1JBMA 4FYYB 3L42A 1N9RA 5DLOA 3JB9D 2CH4A 1I0CA 1M1KU 3CMET 3JB9G 1SF9A 2EPDA 4OB2B 2V8KA 4OGCA 5LJ5d 3ASKA 5IT9E 1KQSP 3PNWC 7AT1B 3RMSA 4JJCA 2J06A 4A4KA 4AFZC 3VRZA 2OTJA 5AT1B 2D1XA 1S72A 1DJ7B 2K5IA 1RADB 3NPFA 5FW9A 1QKWA 2KROA 2MPXC 1UGQB 2AHJB 1E7OA 1YFNA 4F7UG 1U5SA 5EG2A 2M0YA 2A3LA 4MZMA 4PK4A 2KBTA 3JB9H 1D3BA 2JMAA 2EWNA 5KYYA 3KUFA 3G71T 4X9DA 4HXJA 4XAXB 5CKBA 1KQ1A 3QXEB 2D8HA 4R0KA 3RKYA 2OTLA 1ZUKA 2GTJA 2XD0A 2RQRA 5KYWA 2RA2A 1WA7A 4C5GA 3OYMA 5GAMe 2M51A 3ER0A 5GAOr 2P0KA 3G6ET 3OYFA 1WGSA 3JCMh 1G83A 2FYKA 5M9OA 4LXCA 2RPNA 1Y71A 1D1AA 2ROLA 3CMAA 3HRSA 4E6RA 3EHRA 3OW2A 2L0AA 1FXXA 4A4HA 2D8JA 5GAN4 1WLPB 4TVRA 1NPPA 1W4SA 1BYMA 3BDLA 2L3RA 2OTJQ 4J8OA 3Q1JA 4ELYC 5GAN2 2DO3A 4X34A 2E65A 1K9MU 4AMCA 1U8RA 3MO8A 5GANd 3O8VA 1VQNQ 4PJLA 2K5FA 3I55Q 1KD1U 2KQWA 2KT1A 3E9FA 1RABB 2MOXA 4RCBA 3VS4A 1G3YA 2ZPBB 2CT3A 2KYMA 2P4TA 2JW4A 3M5AA 1Z9ZA 1SPKA 1ZLMA 3A1PA 2DLPA 2LCLA 4JZ3A 1H3ZA 1OULA 1JEGA 1TG0A 5GAN3 3BW1A 3J80E 1IHWA 1Q7YC 3NHNA 2ECZA 1VQMT 2DRMA 2H3JA 1PRMC 1FMVA 3FJPA 3FC3A 1X6BA 4A4FA 2IG0A 1I5OB 2HZYA 2A0FB 2YRDA 5CKEA 3L2RA 3HP9A 1HK9A 2W0ZA 5LJ3j 2YWWA 2YUQA 1N9SA 1YHQA 3JCMe 1VQLT 4B6MA 1GXIE 1OEBA 2RI2A 4M75F 5FROA 3A8HB 2JS2A 1Y0MA 1UGVA 1UEBA 2DXTA 1GBRA 1HJDA 3TCJA 2PVOB 2I0NA 4NOYA 2NUTB 4CI0C 4IUUA 2CH4W 4Y92A 5KYUA 3OYAA 2QQ9A 2GTOA 4CC4B 5LJ3h 2CSIA 2P84A 4XU3A 3QJYA 4PL6A 2YUOA 3CCEQ 2KXDA 4XTUA 3PFSA 2RJEA 2E3HA 4BE0A 2EQMA 1M3BA 1SRLA 2EYYA 3JCMW 1UHCA 1N8RR 3QJ6A 3SFMA 2CGHA 4GLKA 2QDYB 2O9VA 3THKA 2CS7A 4M78C 1H8KA 2AZVA 2DF6A 3VS5A 2DJQA 2CZ1B 1V76A 1SSFA 3QIIA 1Y96B 2QTXA 3EFSA 4FW2A 1YJWA 2DYBA 3ZFJA 8AT1B 3GP8A 2JM9A 2ABLA 2V8JA 3M54A 4LUDA 3VS0A 1EFNA 5FU6C 1WQ7A 4C92F 3OYNA 1Z9QA 5GAOl 1QWFA 3OSVA 4WCIA 1Q82R 5LJ5j 1K76A 2MIOA 2RJDA 2R57A 2DETA 1HYOA 2FL7A 4OMOA 1Y7XA 1KC8R 4RMOA 2ZPIB 1KHIA 1UJYA 4RTXA 4QKUA 2KT8A 3A98A 5I21A 2E4HA 3PE0A 2MI6A 1M3AA 2ZZDA 4PJOE 2CT4A 3CCRQ 2LNVA 4RG8A 2RK1A 4M78B 2DM1A 5GANg 4C92E 1GCPA 4F16A 3H6ZA 2VXFA 3GNFB 3CC7T 4FYWB 2JM8A 3CPWA 4C8QC 4PLIA 1IHVA 3CD6Q 4FT2A 1ZQ1A 3PMTA 1WHHA 3MCAB 1FYNA 5LJ5h 1OZ2A 1PCXA 3V7RA 5IHKA 2PVGB 1NJIU 3LX7A 3OW2P 2F2XA 3URGA 3V8JA 4C0DC 1M2VA 5FU6B 1K8AU 3E2UA 4VUBA 3WVDB 3DLMA 3QWXX 4JJNK 1WJQA 2FZKB 2OJ2A 3OS2A 3RUXA 1UTIA 1Y57A 4M7DD 2X4WA 4J9EA 1M1KC 1X6GA 4M7DG 3FRNA 1QVFS 3R6NA 2KEAA 1WXBA 5KCOA 3C4SA 5IHNA 2M1HA 3G6EA 4EMHA 2FEIA 3V7CA 3NGPA 4PJMA 4WF2A 2QEXT 4IIOA 2XG8D 4OMMA 3SEMA 4C8QB 2YUNA 3SD4A 4HVVA 3CCUQ 1WZOA 5DY9A 1EZZB 3EG9B 5KYYB 3RMQA 6AT1B 4C0DB 4HT8A 1U1SA 1VQ5A 1JRIA 1UUEA 5GANj 2X4JA 1QCFA 3E19A 4C92A 4RKUE 3M57A 2CSQA 1G2BA 5KYWB 2PTKA 3OYDA 4N4IA 5LJ5e 1OV3A 3OMCA 1I07A 1WPYA 4BACA 1WHMA 4OMFB 1G8XA 1VQNT 3LWHA 3UA6A 2VB6A 4Z89A 3I55T 4DA4A 1LNXA 2LTOA 5DM7R 3GIBA 2NUPB 4AFQC 3CCQT 4E7JA 2OI3A 3KXTA 5I2SA 2J05A 5GANh 2RN8A 2OX7A 3ZL7C 1RLQC 1VQLA 4KUDK 4DOVA 1G3TA 5I2MA 3UT1A 3CC2Q 2DNUA 4PJOD 1NYGA 2K3XA 5C6SA 4PJOG 1C1AA 4PNOA 5GMKi 1X69A 3JRZA 2LX9A 1VQ9Q 3P8HA 1V29B 2ZAEA 3TREA 2KRSA 1JO8A 4O6JA 2EVRA 4JS5A 1K9MC 3SB2A 3GBQA 3LGFA 2BIVA 5GAOn 1VQ4A 3QHSA 4N4GA 1OZ3A 1O75A 2QI2A 5IXBA 1RI9A 5GAN8 2RHYA 4CC3A 5A0LA 3REAB 1PD0A 2DFUA 2FPDA 1KD1C 2FHDA 2FRYA 1VQKQ 4HCZA 4A4GA 3LYIA 1WHJA 3EFOB 1MMAA 3VYGA 1T0JA 1VQ5Q 2DE0X 2DKGA 1MGQA 2LMJA 2EGAA 4GY5A 1IO6A 1WQWA 3MHXA 3L2VA 1X27A 2Y4YA 1W6XA 2KGTA 4FW1A 5C0MA 2KRMA 2E10A 2HCKA 2C0OA 2CP5A 2LDMA 3LH5A 3EGUA 3EGDA 2XK0A 1Q81U 4F7UF 3OS1A 1Y07A 1ZX6A 3A8OB 2PU9B 3QDRB 3I9QA 5J39A 2DAQA 5GANe 3OS0A 3EGXB 1I1JA 2JN0A 3EG3A 4OB1B 4D6WA 1YJNA 1WJRA 1M90U 1PNJA 3LH0A 4NL3A 1R0BG 1W2BS 4F7UE 4LD9K 1YIJT 1IZ6A 2HKQB 2HL5C 4OB3B 3H0FA 3JCMJ 3VS7A 3E1SA 3QYGB 3CPWP 1OX9A 3M0QA 1YJ9Q 2K2VA 5L23A 4M7AC 3P8DA 2E3IA 1AWOA 4M75C 4E7HA 2X4XA 1VQPA 1T3LA 1UGSB 5A2QE 2XHCA 2D0QB 2QG9B 1QW1A 5LL6S 1PSFA 4J7FA 4QQ6A 1JJ2A 3G7ZA 4EDUA 3CCVT 2L89A 3FIFA 4KBMB 2ATCB 1V1CA 2CREA 1I8FA 3RERA 5GAMj 3CC7A 4RTZA 1RAAB 4IURA 4J6XA 2DXCA 3UATA 2DD4A 2LJ1A 3EG0A 2HSPA 2BZ8A 2PZ1A 1NPRA 4KH0B 2RM4A 1ZSZC 1XJWB 2EQIA 2IPOB 4M7AB 3CD6T 3RBBB 5CVIA 1AWWA 4OVAA 4M75B 3REBB 3HTRA 4E7ZA 2KYBA 2DZCA 1T3SA 2GFUA 4F7UA 5CKDA 4PLLA 4KGZB 2AZSA 5GAMh 3PVLA 2CP2A 4HCKA 4LDUA 4V2SA 2KY9A 1VQOT 4DBHA 4J9CA 1SHGA 3PVQA 1BIAA 3R6OA 3QO3A 4FYVB 2QEXA 3HRTA 4J6YA 2QA4T 1AHJB 4XK8E 2RI3A 5A0GA 3VS3A 3A8LB 2HL3A 5GAN5 3FJ5A 1ZSZB 1W1FA 5D7UA 1SEMA 3OYCA 4FIBA 1YI2T 3NMZC 3CCUT 4OB0B 1NJIC 4C92C 1J3TA 3CC4Q 2DL5A 2DERA 1VQ6A 4Z8AA 1K8AC 1AWJA 1CKBA 1OQKA 5GJWB 2IIMA 3GF5A 2B86A 2XI9A 1I5LA 1GBQA 1VIFA 2KSSA 3H9NA 5GAOq 1QLYA 2EAYA 1P92A 1BCOA 1D0XA 1VQ7Q 3MP8A 4EMKC 4M77E 3ME9A 3M0SA 4Y28E 5D6XA 3CCQA 1QVGA 1QWEA 4CRIA 2RB6A 3CCJA 3M59A 4LDWA 2XIDA 2HAXA 1TTHB 2VV5A 5GAOp 2K9GA 3RKXA 2CZ0B 4C92B 1R0CB 4WTOB 1YITT 3JB9I 2L3SA 3DB4A 4IUQA 2GQVA 3CC2T 2HDAA 2BKDN 2O01E 5CO7A 1KJWA 2ZCFB 1LOJA 4MZPA 5J26A 3VKIA 2FPFA 1WYXA 3I5RA 3M4YA 2BUDA 4J6WA 2EGEA 1GFDA 3HKSA 3KBGA 5AYFA 4C8QG 1S72Q 2NWMA 4EMKB 1RAIB 2IVWA 1QCOA 3X25B 3JCMQ 4AFSC 1MNDA 3PIPA 1TS9A 2C06A 4L5GA 4X9CA 2MWOA 1ABQA 3LLRA 1XTDA 2K5LA 3JCMb 1NBEB 2EYWA 4AT1B 1GCQC 4QQDA 2OTLQ 2PVDB 5GMKl 1ZA2B 4IUVA 2ESWA 2CDTA 2HBWA 4M77A 2YXYA 2DBKA 4ANJA 4DBQA 3VUZA 3S3OA 3CXCS 2DJZA 3O5ZA 4DBFA 1YIJA 1Q7YR 2DL7A 1JJ2P 4C0FA 4M7DF 1CKAA 3OB9A 1IGQA 3DB3A 2V1QA 2YUPA 4NS5A 3CMAQ 1D0ZA 2H8HA 2DD5A 1WFWA 1QP2A 4BDZA 2AKKA 2EGCA 1SKUB 3CEYA 1B34A 5CAIA 3EGDB 1MMGA 2E5KA 2YHTA 4M7DE 4RTVA 2LQWA 2VGNA 3G1JA 1SHFA 1YJ9T 1JXOA 2J6OA 4BE1A 1YBYA 3I56A 3CCMT 4M77D 3INZA 1Q81C 2VC8A 4RTTA 1VQ8T 3MKDA 4M77G 3OYJA 2EKHA 5I11A 3CCSA 5GAOm 1TWBA 3RR6A 1WXUA 4RTWA 5FU7C 1ZA1B 1KQSS 3CCVA 2F1LA 3G4SA 1LJOA 3L2ZA 1M8VA 2DK3A 1GRIA 2DPPB 1M90C 3SWNA 3RIRA 4QVCA 3CBOA 1RAGB 2VGMA 2O4XA 5CKFA 4MMLA 2L5QA 1MHNA 2E12A 3EAEA 4B9XA 4CC2A 2Y90A 2EW3A 2JOYA 4E47A 1YHQQ 4FSXA 4X1VA 3CCLT 3L1AA 1NEGA 2KDSA 2MWPA 3H41A 2DA9A 2JUFA 5KYXB 1ZUUA 1H3HA 2K6DA 5D6WA 4FU6A 4LNPA 1PRLC 4PJOF 3JCMV 3S3NA 3PIOA 5FU7B 1C0MA 3CMEA 3S3MA 4N0AA 2HQHA 5HKCA 2QA4A 1BBZA 4D8DA 4HVUA 4XTZA 4M7DA 5J3BA 3X20B 1N6AA 2V1RA 1M9SA 1AT1B 2FVUA 5FWCA 3I56Q 1QVGP 2RNAA 4F17A 4BDYA 1D1CA 1YI2A 5GAN6 2LC4A 2LCCA 2QQBA 4E2FB 1NLPC 4DBRA 4F7UB 2MYSA 4GLMA 2BZXA 3CBMA 1QKXA 4XU1A 4ZGDB 1X2QA 3MPUB 3X24B 2QQRA 3G71A 3F70A 1B07A 1AD5A 1PD1A 4ZGJB 4IIMA 2EIFA 1I4K1 2VKNA 2AIRB 3OMGA 4EPCA 2ZPEB 3ULRB 1YJWQ 4ZNXA 2DXUA 4M7AD 4LD6A 1VQ7T 2WSEE 3EHQA 4M7AG 3M0PA 4M75D 4QVDA 4M75G 3J81E 4JRIA 2LZ6B 4JJDA 4C0ZA 2ZPHB 2KAFA 2HQEA 4C0GA 2XDDA 1D3BB 1M1KR 4ZN3A 4ZGEB 5HCKA 2GF7A 4PFZA 1YCYA 1K0XA 2YRCA 4PJOA 4KGXB 3U23A 4LE9A 1Q86U 1WNLA 1VIEA 3JCMf 2LQ8A 2COWA 2OTJT 1YP5A 1KK7A 5DLQE 3S6WA 4LDXA 3P8BB 1AWXA 3NTHA 1JU5C 5GJVB 5IH2A 1X2KA 1IGUA 3PT9A 1S72T 2YDLA 4J9HA 2DMOA 3LW5E 2JTFA 2X9HA 2G3RA 2RJCA 1JQQA 1UHFA 1BI3A 4YTLA 2DEUA 4DEXA 1VQMA 2KE9A 2GNCA 2ED1A 4IKFA 2RQWA 2KXCA 3NFCA 4QQGA 1FMWA 1ZHIA 2QK0A 3UF4A 2FO0A 3VU3C 3BDUA 2DZ9A 1FMKA 4IUPA 1TUGB 2FB7A 2PUKB 2F69A 5HK3A 2OTLT 2JNGA 4E7IA 5IN1A 3G6EQ 2RI5A 3JB9J 2FRWA 4AG1C 2LJ0A 1NEBA 4GBQA 1EX4A 1UB4A 3EH2A 2QAZA 3QPHA 4KH1B 3JB9F 4RTYA 2DL3A 3KFVA 4MDXA 4J9GA 3MEUA 3OYLA 2MAMA 5A0DA 1ZBJA 3FB9A 3CMAT 3QDFA 1PC0A 3QG1A 3RNJA 2D6FA 3CCMA 2EBPA 1VYTA 4J9DA 2L3QA 1K9MR 4F14A 1VQ8A 1S1NA 1VYUA 2E41A 2F2VA 1OYXA 1M27C 1FWZA 2X51A 1KD1R 2MMPA 4Y91A 2L3PA 2EJ9A 3NTKA 3CCET 1QQJA 4A4EA 2FZCB 2KMTA 3TSWA 3WXMB 3OYGA 4PKCC 1ZUYA 3A8GB 1N8RU 5LJ3f 2NUTA 1RAEB 2QQSA 1UE9A 1OPKA 2K57A 3AT1B 2E6ZA 3VUBA 5KYUB 1B34B 4C5EA 2RJFA 2G6FX 1PSEA 1VQLQ 2X3WD 4CC7A 1PHTA 2QQAA 4DQ2A 1YCSB 3CCLA 2HQXA 1HXDA 3OW2S 2L2PA 4M78E 5KYNA 3GPLA 2AK5A 4ATOA 5LJ3d 3GNGA 1RACB 3L2WA 3JCMc 1WJSA 1VQ4Q 1TU0B 4B9WA 2LT4A 2HNIA 4ELZC 3MP1A 3VJPA 1LCKA 2M16A 1Q82U 3ZBDA 4J83A 4M7DC 2J6FA 4EIKA 1M30A 3M9QA 4OMPA 1KC8U 4FCYA 2JXBA 3V7SA 3C12A 4XTVA 2KNBB 4IUTA 4JZ4A 1F1BB 4OP0A 3T9NA 4LDYA 2QDLA 5KE3A 1D0YA 4HKEA 4A63B 1TOVA 3CCRT 4QT7A
chains in the Genus database with same CATH topology
1A0NB 2FPFA 2XMFA 1WYXA 2J7IA 3I5RA 2EGEA 1GFDA 1WXTA 2JM9A 2YSQA 2MCNA 2ABLA 1X43A 2OAWA 3H0IA 4LUDA 2NWMA 1CSKA 3VS0A 1EFNA 3IQLA 1UFFA 5IHIA 1Z9QA 3C0CA 1QWFA 4WCIA 4AFSC 1K76A 2MIOA 2LNHB 3VS2A 4OMOA 1ABQA 1KIKA 1UJYA 4RTXA 3I35A 4JJBA 2KT8A 3A98A 3PE0A 1M3AA 2CT4A 2EYWA 2JT4A 4Z88A 1GCQC 1KFZA 1M8MA 4K11A 3M0TA 1E6GA 2DM1A 1GCPA 2RQUA 3CQTA 4F16A 2C0IA 1TUCA 2KRNA 2ESWA 2DL8A 2CDTA 2HBWA 2JM8A 1K1ZA 1AZGB 1NYFA 1UJ0A 2CUDA 4DEYA 2DBKA 4RUGA 2PNIA 2SRCA 1FYNA 3M0RA 2VWFA 3JV3A 3O5ZA 4ESRA 5IHKA 4HVWA 5IXFA 2DL7A 1GFCA 1AZEA 2F2XA 1CKAA 4M4ZA 3UA7A 2JMCA 2C0TA 3QWXX 2V1QA 2YUPA 2H8HA 1AEYA 1WFWA 2DL4A 2ED0A 2OJ2A 3H0HA 4AFUC 2K79A 2AKKA 1UTIA 2EGCA 1Y57A 4J9EA 2BZYA 2O9SA 1X6GA 2E5KA 1UECA 3R6NA 2KEAA 1WXBA 1BB9A 4RTVA 1GCQA 5IHNA 2LQWA 1YNZA 1SHFA 1JXOA 2EYXA 1H92A 1PKSA 2FEIA 3I5SA 2KR3A 4FSSA 2J6OA 1VA7A 3NGPA 2K2MA 1RUWA 4IIOA 1HD3A 4OMMA 4RTTA 3SEMA 2JS0A 2EKHA 5I11A 2YUNA 5EC7A 4HVVA 1K4US 1WXUA 4RTWA 1ARKA 4J9IA 2LX7A 2JTEA 2F2WA 2A08A 2GGRA 2O31A 2ROTA 1GRIA 4OMNA 2K7AA 2SEMA 1UUEA 1QCFA 1UG1A 2P4RA 1AOJA 2CSQA 1WIEA 1G2BA 4CC2A 3VRYA 2EW3A 2PTKA 1U3OA 1ABOA 1OV3A 4X1VA 1I07A 1NEGA 3H41A 3UA6A 1ZSGA 2FPEA 2DA9A 4Z89A 3SHWA 1XOVA 2A36A 1ZUUA 1H3HA 2K6DA 2AKLA 4LNPA 1PRLC 1WDXA 2YT6A 4AFQC 4OMQA 2OI3A 1SSHA 2LJ3A 1E6HA 2J05A 1RLPC 2RN8A 4JPBW 3ZL7C 1RLQC 4J9BA 2FG0A 2LP5A 2W10A 2GBQA 2LQNA 2DNUA 1BBZA 4KRTA 4D8DA 4HVUA 1NYGA 1X69A 4J9FA 4D8KA 2GQIA 1BU1A 1SRMA 2V1RA 5FWCA 4AG2C 1JXMA 2RNAA 4F17A 2KRSA 1JO8A 2EVRA 2RMOA 3TVTA 2K3BA 5ECAA 3GBQA 1NLPC 2EYZA 1RI9A 4LUEA 5IXBA 4CC3A 3REAB 5I22A 1WX6A 2FPDA 4GLMA 2BZXA 1QKXA 2FRYA 1X2QA 1N5ZA 1T0JA 2DE0X 1B07A 2CH4A 1I0CA 2LMJA 2EGAA 1IO6A 2EPDA 1AD5A 3EG1A 2VVKA 1X27A 1W6XA 2KGTA 4IIMA 1OOTA 2KRMA 2HCKA 5FWBA 2C0OA 2VKNA 1YWOA 2O2OA 2J06A 4JJCA 3LH5A 2LCSA 3VRZA 4AFZC 3EGUA 3ULRB 1ZX6A 4ZNXA 3I9QA 3EHQA 2D1XA 3M0PA 2LZ6B 3NPFA 4JJDA 1I1JA 3EG3A 1QKWA 2KROA 5FW9A 1E7OA 1PNJA 1U5SA 2M0YA 2KBTA 2JMAA 5HCKA 4HXJA 2DVJA 3H0FA 3VS7A 1K0XA 2D8HA 4R0KA 2RF0A 2O88A 3U23A 1ZUKA 4LE9A 3M0QA 1HSQA 2GTJA 5L23A 2RQRA 1YP5A 1WA7A 3QWYA 1AWOA 1AWXA 1JU5C 3M0UA 2M51A 5GJVB 2X3XD 5IH2A 1T3LA 1X2KA 1G83A 1AVZC 2YDLA 4J9HA 2A37A 2DMOA 1UDLA 1JQQA 1UHFA 2RPNA 4DEXA 2KE9A 3EG2A 2GNCA 2ED1A 2ROLA 2RQWA 4E6RA 2KXCA 3EHRA 2J6KA 1U06A 2L0AA 2D8JA 3UF4A 2FO0A 2CREA 1V1CA 1WLPB 3VS1A 1FMKA 4RTZA 1B3QA 1TUDA 1T0HA 4OMLA 3UATA 2RQTA 2LJ1A 3EG0A 2HSPA 2BZ8A 2PZ1A 2FRWA 2DBMA 1MUZA 2EQIA 4AG1C 2LJ0A 1YWPA 1NEBA 4GBQA 2DRKA 3RBBB 2RQVA 2KT1A 2MOXA 3VS4A 2DILA 1AWWA 1NLOC 3REBB 2CT3A 2KYMA 2A28A 2JW4A 2KYBA 1Z9ZA 4RTYA 1SPKA 1ZLMA 2DL3A 3KFVA 2DLPA 4J9GA 4JZ3A 1T3SA 1JEGA 1TG0A 3NHNA 2ECZA 1PKTA 1ZBJA 2DRMA 2AZSA 3PVLA 2HEQA 4HCKA 1PRMC 4J9CA 1SHGA 1K0SA 3PVQA 1X6BA 4LN2A 3RNJA 2BTTA 4RTUA 2W0ZA 2EBPA 1VYTA 4J9DA 2L3QA 4F14A 2YUQA 1S1NA 1VYUA 2F2VA 1OEBA 1PWTA 1MV0B 3VS3A 1M27C 2JS2A 2L3PA 1GL5A 1Y0MA 3FJ5A 4ORZA 1W1FA 1UGVA 1SEMA 3TSWA 2NUZA 1BK2A 1GBRA 1HJDA 1OPLA 1ZUYA 2I0NA 3NMZC 1WI7A 1J3TA 2DL5A 1UE9A 2CH4W 1OPKA 4Y92A 1YN8A 4Z8AA 2GTOA 1AWJA 2G6FX 1CKBA 4CC4B 2CSIA 2X3WD 4CC7A 1PHTA 1YCSB 5GJWB 2D0NA 2IIMA 2B86A 2L2PA 1GBQA 2YUOA 2KXDA 1QLYA 2AK5A 2DX1A 2CUBA 1M3CA 1K9AA 1W70A 1KSWA 3M0SA 1QWEA 1M3BA 1SRLA 2EYYA 3TSZA 1UHCA 1LCKA 2ENMA 1VYVA 2O9VA 2J6FA 2K9GA 3VS6A 4EIKA 1M30A 4OMPA 2JXBA 3THKA 2KNBB 1MV3A 2L3SA 1H8KA 2AZVA 2DF6A 3VS5A 4JZ4A 2DJQA 1NM7A 2HDAA 2QDLA 1KJWA 1NG2A 4A63B 4QT7A 2DYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0N B;  2FPF A;  2XMF A;  1WYX A;  2J7I A;  3I5R A;  2EGE A;  1GFD A;  1WXT A;  2JM9 A;  2YSQ A;  2MCN A;  2ABL A;  1X43 A;  2OAW A;  3H0I A;  4LUD A;  2NWM A;  1CSK A;  3VS0 A;  1EFN A;  3IQL A;  1UFF A;  5IHI A;  1Z9Q A;  3C0C A;  1QWF A;  4WCI A;  4AFS C;  1K76 A;  2MIO A;  2LNH B;  3VS2 A;  4OMO A;  1ABQ A;  1KIK A;  1UJY A;  4RTX A;  3I35 A;  4JJB A;  2KT8 A;  3A98 A;  3PE0 A;  1M3A A;  2CT4 A;  2EYW A;  2JT4 A;  4Z88 A;  1GCQ C;  1KFZ A;  1M8M A;  4K11 A;  3M0T A;  1E6G A;  2DM1 A;  1GCP A;  2RQU A;  3CQT A;  4F16 A;  2C0I A;  1TUC A;  2KRN A;  2ESW A;  2DL8 A;  2CDT A;  2HBW A;  2JM8 A;  1K1Z A;  1AZG B;  1NYF A;  1UJ0 A;  2CUD A;  4DEY A;  2DBK A;  4RUG A;  2PNI A;  2SRC A;  1FYN A;  3M0R A;  2VWF A;  3JV3 A;  3O5Z A;  4ESR A;  5IHK A;  4HVW A;  5IXF A;  2DL7 A;  1GFC A;  1AZE A;  2F2X A;  1CKA A;  4M4Z A;  3UA7 A;  2JMC A;  2C0T A;  3QWX X;  2V1Q A;  2YUP A;  2H8H A;  1AEY A;  1WFW A;  2DL4 A;  2ED0 A;  2OJ2 A;  3H0H A;  4AFU C;  2K79 A;  2AKK A;  1UTI A;  2EGC A;  1Y57 A;  4J9E A;  2BZY A;  2O9S A;  1X6G A;  2E5K A;  1UEC A;  3R6N A;  2KEA A;  1WXB A;  1BB9 A;  4RTV A;  1GCQ A;  5IHN A;  2LQW A;  1YNZ A;  1SHF A;  1JXO A;  2EYX A;  1H92 A;  1PKS A;  2FEI A;  3I5S A;  2KR3 A;  4FSS A;  2J6O A;  1VA7 A;  3NGP A;  2K2M A;  1RUW A;  4IIO A;  1HD3 A;  4OMM A;  4RTT A;  3SEM A;  2JS0 A;  2EKH A;  5I11 A;  2YUN A;  5EC7 A;  4HVV A;  1K4U S;  1WXU A;  4RTW A;  1ARK A;  4J9I A;  2LX7 A;  2JTE A;  2F2W A;  2A08 A;  2GGR A;  2O31 A;  2ROT A;  1GRI A;  4OMN A;  2K7A A;  2SEM A;  1UUE A;  1QCF A;  1UG1 A;  2P4R A;  1AOJ A;  2CSQ A;  1WIE A;  1G2B A;  4CC2 A;  3VRY A;  2EW3 A;  2PTK A;  1U3O A;  1ABO A;  1OV3 A;  4X1V A;  1I07 A;  1NEG A;  3H41 A;  3UA6 A;  1ZSG A;  2FPE A;  2DA9 A;  4Z89 A;  3SHW A;  1XOV A;  2A36 A;  1ZUU A;  1H3H A;  2K6D A;  2AKL A;  4LNP A;  1PRL C;  1WDX A;  2YT6 A;  4AFQ C;  4OMQ A;  2OI3 A;  1SSH A;  2LJ3 A;  1E6H A;  2J05 A;  1RLP C;  2RN8 A;  4JPB W;  3ZL7 C;  1RLQ C;  4J9B A;  2FG0 A;  2LP5 A;  2W10 A;  2GBQ A;  2LQN A;  2DNU A;  1BBZ A;  4KRT A;  4D8D A;  4HVU A;  1NYG A;  1X69 A;  4J9F A;  4D8K A;  2GQI A;  1BU1 A;  1SRM A;  2V1R A;  5FWC A;  4AG2 C;  1JXM A;  2RNA A;  4F17 A;  2KRS A;  1JO8 A;  2EVR A;  2RMO A;  3TVT A;  2K3B A;  5ECA A;  3GBQ A;  1NLP C;  2EYZ A;  1RI9 A;  4LUE A;  5IXB A;  4CC3 A;  3REA B;  5I22 A;  1WX6 A;  2FPD A;  4GLM A;  2BZX A;  1QKX A;  2FRY A;  1X2Q A;  1N5Z A;  1T0J A;  2DE0 X;  1B07 A;  2CH4 A;  1I0C A;  2LMJ A;  2EGA A;  1IO6 A;  2EPD A;  1AD5 A;  3EG1 A;  2VVK A;  1X27 A;  1W6X A;  2KGT A;  4IIM A;  1OOT A;  2KRM A;  2HCK A;  5FWB A;  2C0O A;  2VKN A;  1YWO A;  2O2O A;  2J06 A;  4JJC A;  3LH5 A;  2LCS A;  3VRZ A;  4AFZ C;  3EGU A;  3ULR B;  1ZX6 A;  4ZNX A;  3I9Q A;  3EHQ A;  2D1X A;  3M0P A;  2LZ6 B;  3NPF A;  4JJD A;  1I1J A;  3EG3 A;  1QKW A;  2KRO A;  5FW9 A;  1E7O A;  1PNJ A;  1U5S A;  2M0Y A;  2KBT A;  2JMA A;  5HCK A;  4HXJ A;  2DVJ A;  3H0F A;  3VS7 A;  1K0X A;  2D8H A;  4R0K A;  2RF0 A;  2O88 A;  3U23 A;  1ZUK A;  4LE9 A;  3M0Q A;  1HSQ A;  2GTJ A;  5L23 A;  2RQR A;  1YP5 A;  1WA7 A;  3QWY A;  1AWO A;  1AWX A;  1JU5 C;  3M0U A;  2M51 A;  5GJV B;  2X3X D;  5IH2 A;  1T3L A;  1X2K A;  1G83 A;  1AVZ C;  2YDL A;  4J9H A;  2A37 A;  2DMO A;  1UDL A;  1JQQ A;  1UHF A;  2RPN A;  4DEX A;  2KE9 A;  3EG2 A;  2GNC A;  2ED1 A;  2ROL A;  2RQW A;  4E6R A;  2KXC A;  3EHR A;  2J6K A;  1U06 A;  2L0A A;  2D8J A;  3UF4 A;  2FO0 A;  2CRE A;  1V1C A;  1WLP B;  3VS1 A;  1FMK A;  4RTZ A;  1B3Q A;  1TUD A;  1T0H A;  4OML A;  3UAT A;  2RQT A;  2LJ1 A;  3EG0 A;  2HSP A;  2BZ8 A;  2PZ1 A;  2FRW A;  2DBM A;  1MUZ A;  2EQI A;  4AG1 C;  2LJ0 A;  1YWP A;  1NEB A;  4GBQ A;  2DRK A;  3RBB B;  2RQV A;  2KT1 A;  2MOX A;  3VS4 A;  2DIL A;  1AWW A;  1NLO C;  3REB B;  2CT3 A;  2KYM A;  2A28 A;  2JW4 A;  2KYB A;  1Z9Z A;  4RTY A;  1SPK A;  1ZLM A;  2DL3 A;  3KFV A;  2DLP A;  4J9G A;  4JZ3 A;  1T3S A;  1JEG A;  1TG0 A;  3NHN A;  2ECZ A;  1PKT A;  1ZBJ A;  2DRM A;  2AZS A;  3PVL A;  2HEQ A;  4HCK A;  1PRM C;  4J9C A;  1SHG A;  1K0S A;  3PVQ A;  1X6B A;  4LN2 A;  3RNJ A;  2BTT A;  4RTU A;  2W0Z A;  2EBP A;  1VYT A;  4J9D A;  2L3Q A;  4F14 A;  2YUQ A;  1S1N A;  1VYU A;  2F2V A;  1OEB A;  1PWT A;  1MV0 B;  3VS3 A;  1M27 C;  2JS2 A;  2L3P A;  1GL5 A;  1Y0M A;  3FJ5 A;  4ORZ A;  1W1F A;  1UGV A;  1SEM A;  3TSW A;  2NUZ A;  1BK2 A;  1GBR A;  1HJD A;  1OPL A;  1ZUY A;  2I0N A;  3NMZ C;  1WI7 A;  1J3T A;  2DL5 A;  1UE9 A;  2CH4 W;  1OPK A;  4Y92 A;  1YN8 A;  4Z8A A;  2GTO A;  1AWJ A;  2G6F X;  1CKB A;  4CC4 B;  2CSI A;  2X3W D;  4CC7 A;  1PHT A;  1YCS B;  5GJW B;  2D0N A;  2IIM A;  2B86 A;  2L2P A;  1GBQ A;  2YUO A;  2KXD A;  1QLY A;  2AK5 A;  2DX1 A;  2CUB A;  1M3C A;  1K9A A;  1W70 A;  1KSW A;  3M0S A;  1QWE A;  1M3B A;  1SRL A;  2EYY A;  3TSZ A;  1UHC A;  1LCK A;  2ENM A;  1VYV A;  2O9V A;  2J6F A;  2K9G A;  3VS6 A;  4EIK A;  1M30 A;  4OMP A;  2JXB A;  3THK A;  2KNB B;  1MV3 A;  2L3S A;  1H8K A;  2AZV A;  2DF6 A;  3VS5 A;  4JZ4 A;  2DJQ A;  1NM7 A;  2HDA A;  2QDL A;  1KJW A;  1NG2 A;  4A63 B;  4QT7 A;  2DYB A; 
#chains in the Genus database with same CATH topology
 2YLC A;  1QCN A;  2J7I A;  3X26 B;  3TU4 K;  3QBY A;  2RHX A;  2OAW A;  3H0I A;  3RES A;  1X75 C;  4E7L A;  1KQ2 A;  4BI4 A;  4C8Q E;  2RK2 A;  1PM3 A;  3AHU A;  5IHI A;  1IRX A;  3VV0 A;  2E64 A;  1YJN Q;  2LNH B;  4JLG A;  2CP3 A;  4JS4 A;  2NYS A;  2Z0W A;  1BCM A;  3C94 A;  4M7D B;  4JJB A;  2JT4 A;  4Z88 A;  1KFZ A;  4M78 A;  3OS5 A;  2QAS A;  2R58 A;  1ZBX A;  5LJ5 f;  2C0I A;  1TUC A;  1MMD A;  3RDV A;  2KRN A;  1K1Z A;  2CZ7 B;  1KG1 A;  1AZG B;  2CUD A;  2RO0 A;  2GFA A;  4RUG A;  1VQP Q;  2SRC A;  3M0R A;  3JV3 A;  2DIQ A;  1GFC A;  5HK0 A;  4ZTF A;  1AZE A;  2CZ6 B;  3OYK A;  1M2V B;  1TXQ A;  3D7S B;  3M58 A;  2B8A A;  4PJO C;  2COZ A;  2X4Y A;  2M02 A;  5CQY A;  2ED0 A;  4AFU C;  1BI1 A;  3HPW A;  4M77 F;  2O9S A;  3CC7 Q;  1M2O A;  4J7I A;  3OYE A;  3OBY A;  1EIF A;  4ME7 A;  1UEC A;  4UC4 A;  3FDR A;  3PTA A;  1BB9 A;  4M78 D;  1BIB A;  4M78 G;  2EYX A;  1PKS A;  2KR3 A;  4FSS A;  4JDS A;  1VA7 A;  1VQN A;  1QMC A;  4Q5W A;  1HD3 A;  4ZN1 A;  3I55 A;  3MEA A;  1OX8 A;  4C8Q A;  2JS0 A;  3HSB A;  1NJI R;  1UGR B;  5CQX A;  2WSF E;  4PJJ A;  5EC7 A;  2P0P A;  4J9I A;  2LX7 A;  2JTE A;  1K8A R;  3EG9 A;  3OY9 A;  2F2W A;  1VOM A;  2GGR A;  1OU8 A;  4FYX B;  2ROT A;  2DEQ A;  1X6O A;  2K7A A;  1RAF B;  4PJO B;  2SEM A;  5IAY A;  1UG1 A;  2YLB A;  5GMK m;  4BI8 B;  1AOJ A;  5LJ3 g;  2QEX Q;  1C6V X;  2EQK A;  4HCC A;  2RD1 A;  1Q86 C;  2QTV A;  3MET A;  3PGG A;  2AT1 B;  2KK4 A;  1VQ9 T;  1WHG A;  2FPE A;  3QZ5 B;  3SHW A;  5GAN f;  1W2B A;  1XOV A;  4KGV B;  2AKL A;  4C8Q D;  3CPW S;  1WDX A;  2NUP A;  2LJ3 A;  4EMG A;  1K73 U;  1VQ6 Q;  2WSC E;  5FRM A;  4KT0 E;  2FG0 A;  5GAN 7;  1VQK T;  2LP5 A;  1Q86 R;  2GBQ A;  2LQN A;  4OGE A;  1VQ5 T;  4J9F A;  4D8K A;  4BY6 C;  1BU1 A;  1QVP A;  3CCE A;  1SRM A;  4AG2 C;  1JXM A;  3A5Z B;  2XDP A;  4KUI A;  4C5I A;  3TVT A;  2K3B A;  2K4Y A;  5ECA A;  3JSC A;  3N5B B;  3OYB A;  3OYY A;  4O5V A;  3CCQ Q;  2EYZ A;  4LUE A;  3CCJ Q;  2ZPF B;  1RL2 A;  5I22 A;  1QVF P;  3QYH B;  1WX6 A;  1G3S A;  4QVZ A;  1B7T A;  1NZ9 A;  5D6Y A;  5CKH A;  2VXE A;  1U1T A;  1N5Z A;  3EFO A;  3X28 B;  2RHU A;  3EG1 A;  1XQH A;  2VVK A;  1WHK A;  4M7A F;  3WVE B;  2D9T A;  1OOT A;  2XU8 A;  4BB7 A;  5FWB A;  2CP7 A;  1YWO A;  2O2O A;  4FL6 A;  2LCS A;  2L8D A;  3HFN A;  4BY6 B;  2QYZ A;  4HA8 A;  3NTI A;  4C5H A;  4XTX A;  4M7A E;  2CYZ B;  1VQ4 T;  2DTI A;  2DXB A;  3EGX A;  4M75 E;  5LJ5 g;  2EFI A;  2HMA A;  4R56 A;  1N8R C;  5FRN A;  1LPL A;  2EJG A;  3QSU A;  3FLG A;  4JRK A;  1BKB A;  2DVJ A;  3CCR A;  2R5A A;  2CKK A;  5KCH A;  2RF0 A;  2O88 A;  5CK9 A;  1HSQ A;  1Q81 R;  1FX7 A;  2XKO C;  4XU2 A;  4XTY A;  5FLX E;  4XTW A;  3QWY A;  3CD6 A;  1I81 A;  3BE3 A;  3M0U A;  1MMN A;  2X3X D;  2WAC A;  1AVZ C;  2HD0 A;  1YIJ Q;  3HFO A;  3LGL A;  2A37 A;  2RHZ A;  1UDL A;  1D1B A;  1M90 R;  1YJN T;  3EG2 A;  1VQO A;  1QP3 A;  5HY6 A;  1IRE B;  2J6K A;  1Q82 C;  1U06 A;  4BD3 A;  2E70 A;  3VS1 A;  1KC8 C;  1B3Q A;  1TUD A;  3VYH B;  1T0H A;  2RHI A;  4OML A;  3JCM P;  2RQT A;  2DBM A;  1MUZ A;  1YWP A;  4M7A A;  2DRK A;  2RQV A;  2LRQ A;  5LJ3 e;  4E7S A;  2DIL A;  5CCA A;  5GMK j;  5GAM f;  1VQP T;  4M75 A;  3CCS Q;  1NLO C;  3CCU A;  2A28 A;  3UPU A;  3CCV Q;  3J7A F;  1M1F A;  4RCC A;  3G4S Q;  2M9U A;  5CIU A;  4FM4 B;  1PKT A;  3UWN A;  3A8M B;  2HEQ A;  4BUG A;  4R55 A;  4HT9 A;  2YRV A;  3OQ5 A;  5L8R E;  3CC4 T;  1K0S A;  2VAS A;  4LN2 A;  4A54 A;  2BTT A;  4RTU A;  1ACM B;  5GAM d;  1TSF A;  3M56 A;  1W2B P;  1PWT A;  1MV0 B;  2LQK A;  5GMK h;  3GOX A;  3QUI A;  1GL5 A;  1G3W A;  2QGG A;  4ORZ A;  1ZSZ A;  1N27 A;  3MEW A;  3CPF A;  1M4Z A;  2NUZ A;  3TQ7 P;  1BK2 A;  1OPL A;  3PMI A;  1R8O B;  3V8K A;  2JJ9 A;  2E1H A;  1VQO Q;  1WI7 A;  2V8I A;  2KVQ G;  2KI7 A;  1TH7 A;  4N4H A;  2VUB A;  3CME Q;  1YIT A;  1YN8 A;  1X01 A;  3M53 A;  2QA4 Q;  3CC2 A;  1VUB A;  2D0N A;  3CBP A;  3QKJ A;  2X35 A;  1JJ2 S;  3OA6 A;  2EQJ A;  1VQ9 A;  3CXC A;  3LWI A;  4XU0 A;  2DX1 A;  3E9G A;  2PUO B;  2CUB A;  1M3C A;  1K9A A;  4OF1 A;  1W70 A;  1KSW A;  1YI2 Q;  2F5T X;  3GLX A;  1NE8 A;  1IXD A;  4PFO A;  3TSZ A;  4P5N A;  1VQK A;  2ENM A;  1VYV A;  4BE2 A;  3VS6 A;  2EJF A;  3G71 Q;  1VQ6 T;  2EQU A;  2COY A;  1MV3 A;  4BI3 A;  2I2L A;  3JCM d;  3OYH A;  5GMK e;  1BI2 A;  1NM7 A;  4M77 C;  1NG2 A;  4II1 A;  3EFR A;  2E5Q A;  3BY7 A;  1A0N B;  1WHL A;  2XMF A;  2EKO A;  1KQS A;  1WXT A;  2YSQ A;  2MCN A;  3OSS C;  3DLL A;  1X43 A;  4HCB A;  1IB8 A;  3V8L A;  2LVM A;  4EMK A;  1CSK A;  1LVK A;  3IQL A;  2MK5 A;  1Q7Y U;  1UFF A;  3CCJ T;  3C0C A;  2F5K A;  2Y4X A;  1YIT Q;  3JAM E;  3VS2 A;  1RI0 A;  4FT4 A;  4PJN A;  4F04 B;  1MNE A;  1KIK A;  4QW2 A;  3I35 A;  2GCX A;  1BI0 A;  2LT1 A;  4L6V 5;  3DKM A;  1K73 C;  4C92 D;  4C92 G;  1O9S A;  1M8M A;  4K11 A;  3M0T A;  1E6G A;  2RQU A;  1YJ9 A;  3CQT A;  2ZGW A;  4LDV A;  3SDZ A;  3QZ9 B;  5KH6 A;  2DL8 A;  4M77 B;  3EH1 A;  1NYF A;  1UJ0 A;  2H3E B;  4JUV A;  4DEY A;  1Q95 G;  2PNI A;  4ESR A;  2VWF A;  4HVW A;  4J5Y A;  5IXF A;  4ZTJ A;  2PQW A;  1K73 R;  1SG5 A;  4M4Z A;  3UA7 A;  3MJX A;  2JMC A;  2C0T A;  3OYI A;  2BE9 B;  2V26 A;  1QVG S;  1VQM Q;  3SWN C;  3BFM A;  2K3Y A;  2DTH A;  4M78 F;  3M4G A;  3M55 A;  2FZG B;  1D09 B;  1AEY A;  2DL4 A;  3H0H A;  2A7Y A;  3L2Q A;  2K79 A;  5GAM g;  2BZY A;  4L59 A;  4DOW A;  3C95 A;  2QGF B;  1GCQ A;  1YNZ A;  3OBW A;  4JLI A;  4PFP A;  1H92 A;  3I5S A;  1M1G A;  2K2M A;  1RUW A;  2XIC A;  1YHQ T;  2HKN A;  3TEE A;  2CP6 A;  2E6N A;  3H8Z A;  1K4U S;  3MEV A;  2JTM A;  1ARK A;  4JRQ A;  1PG5 B;  4N0A C;  2A08 A;  1OU9 A;  2O31 A;  2BE7 D;  4OMN A;  3SWN B;  3UDC A;  2CP0 A;  1QVF A;  2O4X B;  1G5V A;  2P4R A;  1WIE A;  2P0Q A;  3CCM Q;  4JRP A;  3VRY A;  2ZPG B;  5CR2 A;  4KUL A;  4NL2 A;  1U3O A;  4C8Q F;  1VQ8 Q;  1ABO A;  2JVV A;  2NLU A;  1M5Q 1;  8ATC B;  3HHT B;  2M0O A;  3MP6 A;  4MZT A;  1Y96 A;  2DTO A;  1XNI A;  3JCM X;  3I56 T;  1ZSG A;  2RH2 A;  4Z02 A;  2MF2 A;  5KYX A;  4A53 A;  2A36 A;  3RKW A;  1H64 1;  2HSE B;  4MDW A;  3CCS T;  2YT6 A;  3HRU A;  4OMQ A;  2EYQ A;  1SSH A;  3CC4 A;  1E6H A;  3JCM g;  3G4S T;  1RLP C;  4JPB W;  3ZEH A;  5KE2 A;  4J9B A;  2VYT A;  3CXC P;  1KHC A;  2W10 A;  2DYI A;  4KRT A;  4MMK A;  3CCL Q;  2DVE A;  1OI1 A;  2GQI A;  2HBP A;  9ATC B;  2XDB A;  1UGP B;  2R5M A;  3L2U A;  1VQ7 A;  2QXF A;  3HL8 A;  4RG2 A;  2RMO A;  1RAH B;  1R77 A;  4E7K A;  1YJW T;  1JB0 E;  2OAU A;  4XQ3 A;  2DIG A;  2JZ2 A;  3FEO A;  1JBM A;  4FYY B;  3L42 A;  1N9R A;  5DLO A;  3JB9 D;  2CH4 A;  1I0C A;  1M1K U;  3CME T;  3JB9 G;  1SF9 A;  2EPD A;  4OB2 B;  2V8K A;  4OGC A;  5LJ5 d;  3ASK A;  5IT9 E;  1KQS P;  3PNW C;  7AT1 B;  3RMS A;  4JJC A;  2J06 A;  4A4K A;  4AFZ C;  3VRZ A;  2OTJ A;  5AT1 B;  2D1X A;  1S72 A;  1DJ7 B;  2K5I A;  1RAD B;  3NPF A;  5FW9 A;  1QKW A;  2KRO A;  2MPX C;  1UGQ B;  2AHJ B;  1E7O A;  1YFN A;  4F7U G;  1U5S A;  5EG2 A;  2M0Y A;  2A3L A;  4MZM A;  4PK4 A;  2KBT A;  3JB9 H;  1D3B A;  2JMA A;  2EWN A;  5KYY A;  3KUF A;  3G71 T;  4X9D A;  4HXJ A;  4XAX B;  5CKB A;  1KQ1 A;  3QXE B;  2D8H A;  4R0K A;  3RKY A;  2OTL A;  1ZUK A;  2GTJ A;  2XD0 A;  2RQR A;  5KYW A;  2RA2 A;  1WA7 A;  4C5G A;  3OYM A;  5GAM e;  2M51 A;  3ER0 A;  5GAO r;  2P0K A;  3G6E T;  3OYF A;  1WGS A;  3JCM h;  1G83 A;  2FYK A;  5M9O A;  4LXC A;  2RPN A;  1Y71 A;  1D1A A;  2ROL A;  3CMA A;  3HRS A;  4E6R A;  3EHR A;  3OW2 A;  2L0A A;  1FXX A;  4A4H A;  2D8J A;  5GAN 4;  1WLP B;  4TVR A;  1NPP A;  1W4S A;  1BYM A;  3BDL A;  2L3R A;  2OTJ Q;  4J8O A;  3Q1J A;  4ELY C;  5GAN 2;  2DO3 A;  4X34 A;  2E65 A;  1K9M U;  4AMC A;  1U8R A;  3MO8 A;  5GAN d;  3O8V A;  1VQN Q;  4PJL A;  2K5F A;  3I55 Q;  1KD1 U;  2KQW A;  2KT1 A;  3E9F A;  1RAB B;  2MOX A;  4RCB A;  3VS4 A;  1G3Y A;  2ZPB B;  2CT3 A;  2KYM A;  2P4T A;  2JW4 A;  3M5A A;  1Z9Z A;  1SPK A;  1ZLM A;  3A1P A;  2DLP A;  2LCL A;  4JZ3 A;  1H3Z A;  1OUL A;  1JEG A;  1TG0 A;  5GAN 3;  3BW1 A;  3J80 E;  1IHW A;  1Q7Y C;  3NHN A;  2ECZ A;  1VQM T;  2DRM A;  2H3J A;  1PRM C;  1FMV A;  3FJP A;  3FC3 A;  1X6B A;  4A4F A;  2IG0 A;  1I5O B;  2HZY A;  2A0F B;  2YRD A;  5CKE A;  3L2R A;  3HP9 A;  1HK9 A;  2W0Z A;  5LJ3 j;  2YWW A;  2YUQ A;  1N9S A;  1YHQ A;  3JCM e;  1VQL T;  4B6M A;  1GXI E;  1OEB A;  2RI2 A;  4M75 F;  5FRO A;  3A8H B;  2JS2 A;  1Y0M A;  1UGV A;  1UEB A;  2DXT A;  1GBR A;  1HJD A;  3TCJ A;  2PVO B;  2I0N A;  4NOY A;  2NUT B;  4CI0 C;  4IUU A;  2CH4 W;  4Y92 A;  5KYU A;  3OYA A;  2QQ9 A;  2GTO A;  4CC4 B;  5LJ3 h;  2CSI A;  2P84 A;  4XU3 A;  3QJY A;  4PL6 A;  2YUO A;  3CCE Q;  2KXD A;  4XTU A;  3PFS A;  2RJE A;  2E3H A;  4BE0 A;  2EQM A;  1M3B A;  1SRL A;  2EYY A;  3JCM W;  1UHC A;  1N8R R;  3QJ6 A;  3SFM A;  2CGH A;  4GLK A;  2QDY B;  2O9V A;  3THK A;  2CS7 A;  4M78 C;  1H8K A;  2AZV A;  2DF6 A;  3VS5 A;  2DJQ A;  2CZ1 B;  1V76 A;  1SSF A;  3QII A;  1Y96 B;  2QTX A;  3EFS A;  4FW2 A;  1YJW A;  2DYB A;  3ZFJ A;  8AT1 B;  3GP8 A;  2JM9 A;  2ABL A;  2V8J A;  3M54 A;  4LUD A;  3VS0 A;  1EFN A;  5FU6 C;  1WQ7 A;  4C92 F;  3OYN A;  1Z9Q A;  5GAO l;  1QWF A;  3OSV A;  4WCI A;  1Q82 R;  5LJ5 j;  1K76 A;  2MIO A;  2RJD A;  2R57 A;  2DET A;  1HYO A;  2FL7 A;  4OMO A;  1Y7X A;  1KC8 R;  4RMO A;  2ZPI B;  1KHI A;  1UJY A;  4RTX A;  4QKU A;  2KT8 A;  3A98 A;  5I21 A;  2E4H A;  3PE0 A;  2MI6 A;  1M3A A;  2ZZD A;  4PJO E;  2CT4 A;  3CCR Q;  2LNV A;  4RG8 A;  2RK1 A;  4M78 B;  2DM1 A;  5GAN g;  4C92 E;  1GCP A;  4F16 A;  3H6Z A;  2VXF A;  3GNF B;  3CC7 T;  4FYW B;  2JM8 A;  3CPW A;  4C8Q C;  4PLI A;  1IHV A;  3CD6 Q;  4FT2 A;  1ZQ1 A;  3PMT A;  1WHH A;  3MCA B;  1FYN A;  5LJ5 h;  1OZ2 A;  1PCX A;  3V7R A;  5IHK A;  2PVG B;  1NJI U;  3LX7 A;  3OW2 P;  2F2X A;  3URG A;  3V8J A;  4C0D C;  1M2V A;  5FU6 B;  1K8A U;  3E2U A;  4VUB A;  3WVD B;  3DLM A;  3QWX X;  4JJN K;  1WJQ A;  2FZK B;  2OJ2 A;  3OS2 A;  3RUX A;  1UTI A;  1Y57 A;  4M7D D;  2X4W A;  4J9E A;  1M1K C;  1X6G A;  4M7D G;  3FRN A;  1QVF S;  3R6N A;  2KEA A;  1WXB A;  5KCO A;  3C4S A;  5IHN A;  2M1H A;  3G6E A;  4EMH A;  2FEI A;  3V7C A;  3NGP A;  4PJM A;  4WF2 A;  2QEX T;  4IIO A;  2XG8 D;  4OMM A;  3SEM A;  4C8Q B;  2YUN A;  3SD4 A;  4HVV A;  3CCU Q;  1WZO A;  5DY9 A;  1EZZ B;  3EG9 B;  5KYY B;  3RMQ A;  6AT1 B;  4C0D B;  4HT8 A;  1U1S A;  1VQ5 A;  1JRI A;  1UUE A;  5GAN j;  2X4J A;  1QCF A;  3E19 A;  4C92 A;  4RKU E;  3M57 A;  2CSQ A;  1G2B A;  5KYW B;  2PTK A;  3OYD A;  4N4I A;  5LJ5 e;  1OV3 A;  3OMC A;  1I07 A;  1WPY A;  4BAC A;  1WHM A;  4OMF B;  1G8X A;  1VQN T;  3LWH A;  3UA6 A;  2VB6 A;  4Z89 A;  3I55 T;  4DA4 A;  1LNX A;  2LTO A;  5DM7 R;  3GIB A;  2NUP B;  4AFQ C;  3CCQ T;  4E7J A;  2OI3 A;  3KXT A;  5I2S A;  2J05 A;  5GAN h;  2RN8 A;  2OX7 A;  3ZL7 C;  1RLQ C;  1VQL A;  4KUD K;  4DOV A;  1G3T A;  5I2M A;  3UT1 A;  3CC2 Q;  2DNU A;  4PJO D;  1NYG A;  2K3X A;  5C6S A;  4PJO G;  1C1A A;  4PNO A;  5GMK i;  1X69 A;  3JRZ A;  2LX9 A;  1VQ9 Q;  3P8H A;  1V29 B;  2ZAE A;  3TRE A;  2KRS A;  1JO8 A;  4O6J A;  2EVR A;  4JS5 A;  1K9M C;  3SB2 A;  3GBQ A;  3LGF A;  2BIV A;  5GAO n;  1VQ4 A;  3QHS A;  4N4G A;  1OZ3 A;  1O75 A;  2QI2 A;  5IXB A;  1RI9 A;  5GAN 8;  2RHY A;  4CC3 A;  5A0L A;  3REA B;  1PD0 A;  2DFU A;  2FPD A;  1KD1 C;  2FHD A;  2FRY A;  1VQK Q;  4HCZ A;  4A4G A;  3LYI A;  1WHJ A;  3EFO B;  1MMA A;  3VYG A;  1T0J A;  1VQ5 Q;  2DE0 X;  2DKG A;  1MGQ A;  2LMJ A;  2EGA A;  4GY5 A;  1IO6 A;  1WQW A;  3MHX A;  3L2V A;  1X27 A;  2Y4Y A;  1W6X A;  2KGT A;  4FW1 A;  5C0M A;  2KRM A;  2E10 A;  2HCK A;  2C0O A;  2CP5 A;  2LDM A;  3LH5 A;  3EGU A;  3EGD A;  2XK0 A;  1Q81 U;  4F7U F;  3OS1 A;  1Y07 A;  1ZX6 A;  3A8O B;  2PU9 B;  3QDR B;  3I9Q A;  5J39 A;  2DAQ A;  5GAN e;  3OS0 A;  3EGX B;  1I1J A;  2JN0 A;  3EG3 A;  4OB1 B;  4D6W A;  1YJN A;  1WJR A;  1M90 U;  1PNJ A;  3LH0 A;  4NL3 A;  1R0B G;  1W2B S;  4F7U E;  4LD9 K;  1YIJ T;  1IZ6 A;  2HKQ B;  2HL5 C;  4OB3 B;  3H0F A;  3JCM J;  3VS7 A;  3E1S A;  3QYG B;  3CPW P;  1OX9 A;  3M0Q A;  1YJ9 Q;  2K2V A;  5L23 A;  4M7A C;  3P8D A;  2E3I A;  1AWO A;  4M75 C;  4E7H A;  2X4X A;  1VQP A;  1T3L A;  1UGS B;  5A2Q E;  2XHC A;  2D0Q B;  2QG9 B;  1QW1 A;  5LL6 S;  1PSF A;  4J7F A;  4QQ6 A;  1JJ2 A;  3G7Z A;  4EDU A;  3CCV T;  2L89 A;  3FIF A;  4KBM B;  2ATC B;  1V1C A;  2CRE A;  1I8F A;  3RER A;  5GAM j;  3CC7 A;  4RTZ A;  1RAA B;  4IUR A;  4J6X A;  2DXC A;  3UAT A;  2DD4 A;  2LJ1 A;  3EG0 A;  2HSP A;  2BZ8 A;  2PZ1 A;  1NPR A;  4KH0 B;  2RM4 A;  1ZSZ C;  1XJW B;  2EQI A;  2IPO B;  4M7A B;  3CD6 T;  3RBB B;  5CVI A;  1AWW A;  4OVA A;  4M75 B;  3REB B;  3HTR A;  4E7Z A;  2KYB A;  2DZC A;  1T3S A;  2GFU A;  4F7U A;  5CKD A;  4PLL A;  4KGZ B;  2AZS A;  5GAM h;  3PVL A;  2CP2 A;  4HCK A;  4LDU A;  4V2S A;  2KY9 A;  1VQO T;  4DBH A;  4J9C A;  1SHG A;  3PVQ A;  1BIA A;  3R6O A;  3QO3 A;  4FYV B;  2QEX A;  3HRT A;  4J6Y A;  2QA4 T;  1AHJ B;  4XK8 E;  2RI3 A;  5A0G A;  3VS3 A;  3A8L B;  2HL3 A;  5GAN 5;  3FJ5 A;  1ZSZ B;  1W1F A;  5D7U A;  1SEM A;  3OYC A;  4FIB A;  1YI2 T;  3NMZ C;  3CCU T;  4OB0 B;  1NJI C;  4C92 C;  1J3T A;  3CC4 Q;  2DL5 A;  2DER A;  1VQ6 A;  4Z8A A;  1K8A C;  1AWJ A;  1CKB A;  1OQK A;  5GJW B;  2IIM A;  3GF5 A;  2B86 A;  2XI9 A;  1I5L A;  1GBQ A;  1VIF A;  2KSS A;  3H9N A;  5GAO q;  1QLY A;  2EAY A;  1P92 A;  1BCO A;  1D0X A;  1VQ7 Q;  3MP8 A;  4EMK C;  4M77 E;  3ME9 A;  3M0S A;  4Y28 E;  5D6X A;  3CCQ A;  1QVG A;  1QWE A;  4CRI A;  2RB6 A;  3CCJ A;  3M59 A;  4LDW A;  2XID A;  2HAX A;  1TTH B;  2VV5 A;  5GAO p;  2K9G A;  3RKX A;  2CZ0 B;  4C92 B;  1R0C B;  4WTO B;  1YIT T;  3JB9 I;  2L3S A;  3DB4 A;  4IUQ A;  2GQV A;  3CC2 T;  2HDA A;  2BKD N;  2O01 E;  5CO7 A;  1KJW A;  2ZCF B;  1LOJ A;  4MZP A;  5J26 A;  3VKI A;  2FPF A;  1WYX A;  3I5R A;  3M4Y A;  2BUD A;  4J6W A;  2EGE A;  1GFD A;  3HKS A;  3KBG A;  5AYF A;  4C8Q G;  1S72 Q;  2NWM A;  4EMK B;  1RAI B;  2IVW A;  1QCO A;  3X25 B;  3JCM Q;  4AFS C;  1MND A;  3PIP A;  1TS9 A;  2C06 A;  4L5G A;  4X9C A;  2MWO A;  1ABQ A;  3LLR A;  1XTD A;  2K5L A;  3JCM b;  1NBE B;  2EYW A;  4AT1 B;  1GCQ C;  4QQD A;  2OTL Q;  2PVD B;  5GMK l;  1ZA2 B;  4IUV A;  2ESW A;  2CDT A;  2HBW A;  4M77 A;  2YXY A;  2DBK A;  4ANJ A;  4DBQ A;  3VUZ A;  3S3O A;  3CXC S;  2DJZ A;  3O5Z A;  4DBF A;  1YIJ A;  1Q7Y R;  2DL7 A;  1JJ2 P;  4C0F A;  4M7D F;  1CKA A;  3OB9 A;  1IGQ A;  3DB3 A;  2V1Q A;  2YUP A;  4NS5 A;  3CMA Q;  1D0Z A;  2H8H A;  2DD5 A;  1WFW A;  1QP2 A;  4BDZ A;  2AKK A;  2EGC A;  1SKU B;  3CEY A;  1B34 A;  5CAI A;  3EGD B;  1MMG A;  2E5K A;  2YHT A;  4M7D E;  4RTV A;  2LQW A;  2VGN A;  3G1J A;  1SHF A;  1YJ9 T;  1JXO A;  2J6O A;  4BE1 A;  1YBY A;  3I56 A;  3CCM T;  4M77 D;  3INZ A;  1Q81 C;  2VC8 A;  4RTT A;  1VQ8 T;  3MKD A;  4M77 G;  3OYJ A;  2EKH A;  5I11 A;  3CCS A;  5GAO m;  1TWB A;  3RR6 A;  1WXU A;  4RTW A;  5FU7 C;  1ZA1 B;  1KQS S;  3CCV A;  2F1L A;  3G4S A;  1LJO A;  3L2Z A;  1M8V A;  2DK3 A;  1GRI A;  2DPP B;  1M90 C;  3SWN A;  3RIR A;  4QVC A;  3CBO A;  1RAG B;  2VGM A;  2O4X A;  5CKF A;  4MML A;  2L5Q A;  1MHN A;  2E12 A;  3EAE A;  4B9X A;  4CC2 A;  2Y90 A;  2EW3 A;  2JOY A;  4E47 A;  1YHQ Q;  4FSX A;  4X1V A;  3CCL T;  3L1A A;  1NEG A;  2KDS A;  2MWP A;  3H41 A;  2DA9 A;  2JUF A;  5KYX B;  1ZUU A;  1H3H A;  2K6D A;  5D6W A;  4FU6 A;  4LNP A;  1PRL C;  4PJO F;  3JCM V;  3S3N A;  3PIO A;  5FU7 B;  1C0M A;  3CME A;  3S3M A;  4N0A A;  2HQH A;  5HKC A;  2QA4 A;  1BBZ A;  4D8D A;  4HVU A;  4XTZ A;  4M7D A;  5J3B A;  3X20 B;  1N6A A;  2V1R A;  1M9S A;  1AT1 B;  2FVU A;  5FWC A;  3I56 Q;  1QVG P;  2RNA A;  4F17 A;  4BDY A;  1D1C A;  1YI2 A;  5GAN 6;  2LC4 A;  2LCC A;  2QQB A;  4E2F B;  1NLP C;  4DBR A;  4F7U B;  2MYS A;  4GLM A;  2BZX A;  3CBM A;  1QKX A;  4XU1 A;  4ZGD B;  1X2Q A;  3MPU B;  3X24 B;  2QQR A;  3G71 A;  3F70 A;  1B07 A;  1AD5 A;  1PD1 A;  4ZGJ B;  4IIM A;  2EIF A;  1I4K 1;  2VKN A;  2AIR B;  3OMG A;  4EPC A;  2ZPE B;  3ULR B;  1YJW Q;  4ZNX A;  2DXU A;  4M7A D;  4LD6 A;  1VQ7 T;  2WSE E;  3EHQ A;  4M7A G;  3M0P A;  4M75 D;  4QVD A;  4M75 G;  3J81 E;  4JRI A;  2LZ6 B;  4JJD A;  4C0Z A;  2ZPH B;  2KAF A;  2HQE A;  4C0G A;  2XDD A;  1D3B B;  1M1K R;  4ZN3 A;  4ZGE B;  5HCK A;  2GF7 A;  4PFZ A;  1YCY A;  1K0X A;  2YRC A;  4PJO A;  4KGX B;  3U23 A;  4LE9 A;  1Q86 U;  1WNL A;  1VIE A;  3JCM f;  2LQ8 A;  2COW A;  2OTJ T;  1YP5 A;  1KK7 A;  5DLQ E;  3S6W A;  4LDX A;  3P8B B;  1AWX A;  3NTH A;  1JU5 C;  5GJV B;  5IH2 A;  1X2K A;  1IGU A;  3PT9 A;  1S72 T;  2YDL A;  4J9H A;  2DMO A;  3LW5 E;  2JTF A;  2X9H A;  2G3R A;  2RJC A;  1JQQ A;  1UHF A;  1BI3 A;  4YTL A;  2DEU A;  4DEX A;  1VQM A;  2KE9 A;  2GNC A;  2ED1 A;  4IKF A;  2RQW A;  2KXC A;  3NFC A;  4QQG A;  1FMW A;  1ZHI A;  2QK0 A;  3UF4 A;  2FO0 A;  3VU3 C;  3BDU A;  2DZ9 A;  1FMK A;  4IUP A;  1TUG B;  2FB7 A;  2PUK B;  2F69 A;  5HK3 A;  2OTL T;  2JNG A;  4E7I A;  5IN1 A;  3G6E Q;  2RI5 A;  3JB9 J;  2FRW A;  4AG1 C;  2LJ0 A;  1NEB A;  4GBQ A;  1EX4 A;  1UB4 A;  3EH2 A;  2QAZ A;  3QPH A;  4KH1 B;  3JB9 F;  4RTY A;  2DL3 A;  3KFV A;  4MDX A;  4J9G A;  3MEU A;  3OYL A;  2MAM A;  5A0D A;  1ZBJ A;  3FB9 A;  3CMA T;  3QDF A;  1PC0 A;  3QG1 A;  3RNJ A;  2D6F A;  3CCM A;  2EBP A;  1VYT A;  4J9D A;  2L3Q A;  1K9M R;  4F14 A;  1VQ8 A;  1S1N A;  1VYU A;  2E41 A;  2F2V A;  1OYX A;  1M27 C;  1FWZ A;  2X51 A;  1KD1 R;  2MMP A;  4Y91 A;  2L3P A;  2EJ9 A;  3NTK A;  3CCE T;  1QQJ A;  4A4E A;  2FZC B;  2KMT A;  3TSW A;  3WXM B;  3OYG A;  4PKC C;  1ZUY A;  3A8G B;  1N8R U;  5LJ3 f;  2NUT A;  1RAE B;  2QQS A;  1UE9 A;  1OPK A;  2K57 A;  3AT1 B;  2E6Z A;  3VUB A;  5KYU B;  1B34 B;  4C5E A;  2RJF A;  2G6F X;  1PSE A;  1VQL Q;  2X3W D;  4CC7 A;  1PHT A;  2QQA A;  4DQ2 A;  1YCS B;  3CCL A;  2HQX A;  1HXD A;  3OW2 S;  2L2P A;  4M78 E;  5KYN A;  3GPL A;  2AK5 A;  4ATO A;  5LJ3 d;  3GNG A;  1RAC B;  3L2W A;  3JCM c;  1WJS A;  1VQ4 Q;  1TU0 B;  4B9W A;  2LT4 A;  2HNI A;  4ELZ C;  3MP1 A;  3VJP A;  1LCK A;  2M16 A;  1Q82 U;  3ZBD A;  4J83 A;  4M7D C;  2J6F A;  4EIK A;  1M30 A;  3M9Q A;  4OMP A;  1KC8 U;  4FCY A;  2JXB A;  3V7S A;  3C12 A;  4XTV A;  2KNB B;  4IUT A;  4JZ4 A;  1F1B B;  4OP0 A;  3T9N A;  4LDY A;  2QDL A;  5KE3 A;  1D0Y A;  4HKE A;  4A63 B;  1TOV A;  3CCR T;  4QT7 A; 
#chains in the Genus database with same CATH homology
 1A0N B;  2FPF A;  2XMF A;  1WYX A;  2J7I A;  3I5R A;  2EGE A;  1GFD A;  1WXT A;  2JM9 A;  2YSQ A;  2MCN A;  2ABL A;  1X43 A;  2OAW A;  3H0I A;  4LUD A;  2NWM A;  1CSK A;  3VS0 A;  1EFN A;  3IQL A;  1UFF A;  5IHI A;  1Z9Q A;  3C0C A;  1QWF A;  4WCI A;  4AFS C;  1K76 A;  2MIO A;  2LNH B;  3VS2 A;  4OMO A;  1ABQ A;  1KIK A;  1UJY A;  4RTX A;  3I35 A;  4JJB A;  2KT8 A;  3A98 A;  3PE0 A;  1M3A A;  2CT4 A;  2EYW A;  2JT4 A;  4Z88 A;  1GCQ C;  1KFZ A;  1M8M A;  4K11 A;  3M0T A;  1E6G A;  2DM1 A;  1GCP A;  2RQU A;  3CQT A;  4F16 A;  2C0I A;  1TUC A;  2KRN A;  2ESW A;  2DL8 A;  2CDT A;  2HBW A;  2JM8 A;  1K1Z A;  1AZG B;  1NYF A;  1UJ0 A;  2CUD A;  4DEY A;  2DBK A;  4RUG A;  2PNI A;  2SRC A;  1FYN A;  3M0R A;  2VWF A;  3JV3 A;  3O5Z A;  4ESR A;  5IHK A;  4HVW A;  5IXF A;  2DL7 A;  1GFC A;  1AZE A;  2F2X A;  1CKA A;  4M4Z A;  3UA7 A;  2JMC A;  2C0T A;  3QWX X;  2V1Q A;  2YUP A;  2H8H A;  1AEY A;  1WFW A;  2DL4 A;  2ED0 A;  2OJ2 A;  3H0H A;  4AFU C;  2K79 A;  2AKK A;  1UTI A;  2EGC A;  1Y57 A;  4J9E A;  2BZY A;  2O9S A;  1X6G A;  2E5K A;  1UEC A;  3R6N A;  2KEA A;  1WXB A;  1BB9 A;  4RTV A;  1GCQ A;  5IHN A;  2LQW A;  1YNZ A;  1SHF A;  1JXO A;  2EYX A;  1H92 A;  1PKS A;  2FEI A;  3I5S A;  2KR3 A;  4FSS A;  2J6O A;  1VA7 A;  3NGP A;  2K2M A;  1RUW A;  4IIO A;  1HD3 A;  4OMM A;  4RTT A;  3SEM A;  2JS0 A;  2EKH A;  5I11 A;  2YUN A;  5EC7 A;  4HVV A;  1K4U S;  1WXU A;  4RTW A;  1ARK A;  4J9I A;  2LX7 A;  2JTE A;  2F2W A;  2A08 A;  2GGR A;  2O31 A;  2ROT A;  1GRI A;  4OMN A;  2K7A A;  2SEM A;  1UUE A;  1QCF A;  1UG1 A;  2P4R A;  1AOJ A;  2CSQ A;  1WIE A;  1G2B A;  4CC2 A;  3VRY A;  2EW3 A;  2PTK A;  1U3O A;  1ABO A;  1OV3 A;  4X1V A;  1I07 A;  1NEG A;  3H41 A;  3UA6 A;  1ZSG A;  2FPE A;  2DA9 A;  4Z89 A;  3SHW A;  1XOV A;  2A36 A;  1ZUU A;  1H3H A;  2K6D A;  2AKL A;  4LNP A;  1PRL C;  1WDX A;  2YT6 A;  4AFQ C;  4OMQ A;  2OI3 A;  1SSH A;  2LJ3 A;  1E6H A;  2J05 A;  1RLP C;  2RN8 A;  4JPB W;  3ZL7 C;  1RLQ C;  4J9B A;  2FG0 A;  2LP5 A;  2W10 A;  2GBQ A;  2LQN A;  2DNU A;  1BBZ A;  4KRT A;  4D8D A;  4HVU A;  1NYG A;  1X69 A;  4J9F A;  4D8K A;  2GQI A;  1BU1 A;  1SRM A;  2V1R A;  5FWC A;  4AG2 C;  1JXM A;  2RNA A;  4F17 A;  2KRS A;  1JO8 A;  2EVR A;  2RMO A;  3TVT A;  2K3B A;  5ECA A;  3GBQ A;  1NLP C;  2EYZ A;  1RI9 A;  4LUE A;  5IXB A;  4CC3 A;  3REA B;  5I22 A;  1WX6 A;  2FPD A;  4GLM A;  2BZX A;  1QKX A;  2FRY A;  1X2Q A;  1N5Z A;  1T0J A;  2DE0 X;  1B07 A;  2CH4 A;  1I0C A;  2LMJ A;  2EGA A;  1IO6 A;  2EPD A;  1AD5 A;  3EG1 A;  2VVK A;  1X27 A;  1W6X A;  2KGT A;  4IIM A;  1OOT A;  2KRM A;  2HCK A;  5FWB A;  2C0O A;  2VKN A;  1YWO A;  2O2O A;  2J06 A;  4JJC A;  3LH5 A;  2LCS A;  3VRZ A;  4AFZ C;  3EGU A;  3ULR B;  1ZX6 A;  4ZNX A;  3I9Q A;  3EHQ A;  2D1X A;  3M0P A;  2LZ6 B;  3NPF A;  4JJD A;  1I1J A;  3EG3 A;  1QKW A;  2KRO A;  5FW9 A;  1E7O A;  1PNJ A;  1U5S A;  2M0Y A;  2KBT A;  2JMA A;  5HCK A;  4HXJ A;  2DVJ A;  3H0F A;  3VS7 A;  1K0X A;  2D8H A;  4R0K A;  2RF0 A;  2O88 A;  3U23 A;  1ZUK A;  4LE9 A;  3M0Q A;  1HSQ A;  2GTJ A;  5L23 A;  2RQR A;  1YP5 A;  1WA7 A;  3QWY A;  1AWO A;  1AWX A;  1JU5 C;  3M0U A;  2M51 A;  5GJV B;  2X3X D;  5IH2 A;  1T3L A;  1X2K A;  1G83 A;  1AVZ C;  2YDL A;  4J9H A;  2A37 A;  2DMO A;  1UDL A;  1JQQ A;  1UHF A;  2RPN A;  4DEX A;  2KE9 A;  3EG2 A;  2GNC A;  2ED1 A;  2ROL A;  2RQW A;  4E6R A;  2KXC A;  3EHR A;  2J6K A;  1U06 A;  2L0A A;  2D8J A;  3UF4 A;  2FO0 A;  2CRE A;  1V1C A;  1WLP B;  3VS1 A;  1FMK A;  4RTZ A;  1B3Q A;  1TUD A;  1T0H A;  4OML A;  3UAT A;  2RQT A;  2LJ1 A;  3EG0 A;  2HSP A;  2BZ8 A;  2PZ1 A;  2FRW A;  2DBM A;  1MUZ A;  2EQI A;  4AG1 C;  2LJ0 A;  1YWP A;  1NEB A;  4GBQ A;  2DRK A;  3RBB B;  2RQV A;  2KT1 A;  2MOX A;  3VS4 A;  2DIL A;  1AWW A;  1NLO C;  3REB B;  2CT3 A;  2KYM A;  2A28 A;  2JW4 A;  2KYB A;  1Z9Z A;  4RTY A;  1SPK A;  1ZLM A;  2DL3 A;  3KFV A;  2DLP A;  4J9G A;  4JZ3 A;  1T3S A;  1JEG A;  1TG0 A;  3NHN A;  2ECZ A;  1PKT A;  1ZBJ A;  2DRM A;  2AZS A;  3PVL A;  2HEQ A;  4HCK A;  1PRM C;  4J9C A;  1SHG A;  1K0S A;  3PVQ A;  1X6B A;  4LN2 A;  3RNJ A;  2BTT A;  4RTU A;  2W0Z A;  2EBP A;  1VYT A;  4J9D A;  2L3Q A;  4F14 A;  2YUQ A;  1S1N A;  1VYU A;  2F2V A;  1OEB A;  1PWT A;  1MV0 B;  3VS3 A;  1M27 C;  2JS2 A;  2L3P A;  1GL5 A;  1Y0M A;  3FJ5 A;  4ORZ A;  1W1F A;  1UGV A;  1SEM A;  3TSW A;  2NUZ A;  1BK2 A;  1GBR A;  1HJD A;  1OPL A;  1ZUY A;  2I0N A;  3NMZ C;  1WI7 A;  1J3T A;  2DL5 A;  1UE9 A;  2CH4 W;  1OPK A;  4Y92 A;  1YN8 A;  4Z8A A;  2GTO A;  1AWJ A;  2G6F X;  1CKB A;  4CC4 B;  2CSI A;  2X3W D;  4CC7 A;  1PHT A;  1YCS B;  5GJW B;  2D0N A;  2IIM A;  2B86 A;  2L2P A;  1GBQ A;  2YUO A;  2KXD A;  1QLY A;  2AK5 A;  2DX1 A;  2CUB A;  1M3C A;  1K9A A;  1W70 A;  1KSW A;  3M0S A;  1QWE A;  1M3B A;  1SRL A;  2EYY A;  3TSZ A;  1UHC A;  1LCK A;  2ENM A;  1VYV A;  2O9V A;  2J6F A;  2K9G A;  3VS6 A;  4EIK A;  1M30 A;  4OMP A;  2JXB A;  3THK A;  2KNB B;  1MV3 A;  2L3S A;  1H8K A;  2AZV A;  2DF6 A;  3VS5 A;  4JZ4 A;  2DJQ A;  1NM7 A;  2HDA A;  2QDL A;  1KJW A;  1NG2 A;  4A63 B;  4QT7 A;  2DYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...