2J6OA

Atypical polyproline recognition by the cms n-terminal sh3 domain. cms:cd2 heterotrimer
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atypical Polyproline Recognition by the Cms N-Terminal SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords CD2-ASSOCIATED PROTEIN
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j6oA00
2F2VA 4ESRA 4CC2A 3VRZA 2L0AA 2K79A 1GFDA 1NEBA 2G6FX 2NUZA 2EYXA 1HD3A 1OOTA 5I11A 2HCKA 2OAWA 1JXMA 3VRYA 1VYUA 2HSPA 2J6OA 1WDXA 1AOJA 3EG1A 4HVVA 5IHIA 2KRMA 1EFNA 1S1NA 4LE9A 2RNAA 1M8MA 3U23A 3NHNA 4FSSA 2W10A 3C0CA 1K1ZA 2BZ8A 1ZBJA 1SHGA 2JM8A 1PKSA 3VS5A 2DX1A 1M3BA 2M51A 1NLPC 2RPNA 4D8DA 2KBTA 2HDAA 4JJBA 4IIMA 3TSZA 2VKNA 1ZLMA 1E6HA 1GCQA 2K7AA 1U06A 4KRTA 1K9AA 1NYFA 4X1VA 2P4RA 1K4US 1X6GA 4JPBW 1UG1A 3UATA 4LN2A 1WLPB 3EG0A 3R6NA 3JV3A 2JM9A 1Y0MA 3PVQA 1NLOC 1T3LA 2D8JA 1GRIA 2ROLA 1QKWA 1YN8A 2C0OA 2DM1A 1T3SA 3UA7A 2H8HA 2OI3A 1W70A 1AWOA 2KT8A 1MV0B 2I0NA 2DYBA 1WIEA 4J9GA 4CC7A 1HJDA 2K9GA 4A63B 2F2XA 4DEXA 2L2PA 2FEIA 2CDTA 2LZ6B 2KE9A 1B3QA 1UHCA 2BZXA 2GTJA 1KIKA 1NG2A 1W6XA 2BTTA 4Y92A 3TSWA 1QKXA 3EGUA 2CT3A 2ENMA 4LUDA 2JW4A 4RTXA 3GBQA 3O5ZA 5I22A 1AWJA 3LH5A 1NYGA 1ZSGA 2D0NA 1TUDA 1WYXA 2MIOA 3TVTA 2QDLA 5HCKA 1UECA 1QLYA 5IHNA 2DLPA 1ZUYA 4EIKA 2CSIA 1JO8A 1NEGA 4GBQA 2CUDA 2JS2A 2K2MA 3KFVA 2VWFA 4CC3A 2KNBB 2JMCA 2KRNA 1JQQA 1E6GA 1SHFA 5IXFA 2FPFA 2BZYA 2AKLA 2LQWA 4JJDA 1AVZC 3VS4A 1XOVA 2B86A 1OEBA 4OMMA 5FWCA 1UJYA 2J6KA 2EGCA 1FMKA 2EW3A 2LX7A 2J05A 3VS1A 5L23A 1BBZA 1AZEA 2HBWA 1Y57A 1YWOA 4LNPA 2O31A 1TG0A 1SEMA 1N5ZA 3UF4A 2PNIA 2YUNA 3NMZC 4OMNA 1X43A 1U3OA 2LJ3A 2LCSA 4CC4B 3M0TA 3H0HA 1H3HA 4ORZA 2MCNA 1GBRA 2W0ZA 1AWXA 2AZVA 2YUQA 1PKTA 4QT7A 2DMOA 3QWXX 2HEQA 2LJ1A 4HVUA 1X6BA 2GTOA 2DL5A 2CH4W 1QWFA 2EPDA 3EG2A 2AKKA 2A36A 2JS0A 2DL8A 5EC7A 4J9CA 1ZUUA 1K0XA 1J3TA 2J6FA 2JMAA 2GNCA 2DBKA 2GGRA 1TUCA 4RTYA 1PRLC 1UUEA 2CUBA 3A98A 1T0HA 2V1QA 2KYBA 2ABLA 1A0NB 2RQWA 1Z9QA 1G83A 1NM7A 2O9SA 2M0YA 4J9DA 1OV3A 3NGPA 2KEAA 3RBBB 1KSWA 2EYWA 1B07A 2J06A 4AFSC 2D1XA 3IQLA 3I35A 3REAB 3REBB 2DBMA 1LCKA 1I1JA 2DL3A 2DE0X 4OMLA 3M0PA 2K6DA 4AG2C 2KT1A 1I07A 1KFZA 1OPLA 4F14A 2FPDA 2KROA 4LUEA 5FW9A 1CSKA 2DRKA 1VA7A 1WXTA 3H0FA 2J7IA 1SSHA 1WFWA 2E5KA 4AFUC 1X2KA 5ECAA 2SEMA 2ECZA 2L3QA 2RN8A 2YT6A 3EHQA 1MUZA 2KYMA 4JZ4A 2EKHA 4M4ZA 4GLMA 2LMJA 1PRMC 1WX6A 3H41A 1GCPA 3SEMA 1I0CA 1W1FA 4IIOA 2K3BA 5IH2A 1M3CA 2YDLA 2CT4A 1Z9ZA 1SRLA 3CQTA 1BB9A 3M0RA 1ABOA 1UFFA 1X69A 2CREA 2C0IA 4R0KA 1U5SA 3PE0A 3VS0A 4DEYA 1MV3A 2YSQA 1AZGB 2DJQA 2GBQA 1WXUA 1HSQA 2RQUA 4HVWA 4HCKA 4F16A 1GFCA 4RTZA 1T0JA 1M30A 1ARKA 4J9EA 1K0SA 3THKA 3ZL7C 2FO0A 4OMPA 1AD5A 1WI7A 2JXBA 3UA6A 4AG1C 2FG0A 2YUPA 2KGTA 2LJ0A 4Z8AA 2EYZA 2DL4A 2AZSA 4RTVA 5GJVB 4RTTA 1AWWA 1GL5A 1H8KA 3NPFA 1SPKA 1GCQC 3VS6A 3H0IA 3VS7A 1RLQC 2FRWA 5GJWB 2FPEA 4F17A 1QWEA 2RQTA 4Z89A 3EG3A 1UGVA 4OMQA 1KJWA 3I5RA 2KXDA 1M27C 3EHRA 3M0SA 2KRSA 4J9BA 1VYTA 3QWYA 2LQNA 1ZUKA 2CH4A 3SHWA 5IHKA 2SRCA 2EQIA 4JJCA 2X3XD 1UE9A 2OJ2A 1VYVA 2LP5A 2VVKA 1YCSB 2DNUA 2DL7A 1SRMA 3I9QA 2C0TA 2ESWA 1X2QA 1RUWA 1JXOA 2EGEA 2D8HA 2DVJA 1ABQA 1BU1A 4K11A 1UHFA 2A37A 2RQVA 4J9FA 2EYYA 1YP5A 1WXBA 2AK5A 1YNZA 1M3AA 1RI9A 2O88A 1OPKA 2KR3A 4AFZC 1AEYA 1UTIA 5IXBA 2ROTA 4J9HA 2L3PA 3VS3A 2X3WD 4RTWA 3M0UA 1V1CA 1X27A 2XMFA 1ZX6A 3I5SA 2FRYA 2V1RA 4JZ3A 3PVLA 4D8KA 2ED0A 4RUGA 3FJ5A 2RF0A 1IO6A 4AFQC 4RTUA 2DA9A 1RLPC 2O2OA 2MOXA 3M0QA 1G2BA 2PTKA 3VS2A 4OMOA 4E6RA 2EGAA 2F2WA 1PNJA 2A08A 1H92A 2NWMA 3RNJA 2ED1A 1UDLA 2JTEA 2CSQA 2PZ1A 1E7OA 1JU5C 2GQIA 2O9VA 2RMOA 1PWTA 2EVRA 2L3SA 4HXJA 2DRMA 3ULRB 4J9IA 1FYNA 1K76A 1PHTA 4WCIA 2RQRA 5FWBA 2EBPA 1YWPA 4Z88A 1UJ0A 2IIMA 2KXCA 1BK2A 1QCFA 2DILA 2YUOA 2DF6A 1JEGA 4ZNXA 1WA7A 1CKAA 2LNHB 2A28A 2JT4A 1GBQA 1CKBA
chains in the Genus database with same CATH superfamily
5KYYA 4BE0A 5I21A 2DIGA 3CCQQ 1NEBA 3OW2P 2NUZA 3QKJA 1OOTA 4NL2A 4ANJA 2LT1A 2RHYA 3G4ST 5GAN4 1QVFP 1QMCA 2NLUA 2J6OA 1Y71A 3JCMf 1WDXA 1AOJA 5GANh 2ZPHB 1K73U 4ZGJB 2KRMA 1EFNA 1BI2A 1FXXA 4BDZA 3MEUA 3U23A 2JJ9A 3JCMb 1BIAA 3NHNA 3HFNA 2F5KA 1Q82U 4C92G 1K1ZA 3H9NA 4PNOA 2A0FB 2JM8A 4E7LA 2DX1A 2KBTA 4E7IA 3CXCA 4FCYA 1W2BA 4IIMA 4YTLA 4OB2B 3TSZA 5FU7B 4DA4A 1ZLMA 1GCQA 2HKQB 1N6AA 1U06A 4KRTA 3CCLT 3OYFA 2R58A 2K57A 2KAFA 4BUGA 4BY6B 2P4RA 1K4US 1K9MC 1UG1A 3CCRQ 1Q82R 3R6NA 2DYIA 1Y0MA 3WXMB 2DEQA 4M77B 5D7UA 1RAGB 1LPLA 1QKWA 2C0OA 3UA7A 1T3SA 2K5FA 5GAOn 2YRCA 3J7AF 2DYBA 3E2UA 4QQGA 4M77G 3CMEA 3ZEHA 2DTOA 4CC7A 2F2XA 1ZSZC 2FEIA 2IPOB 2M02A 3L42A 2LZ6B 1UHCA 5KH6A 3RMQA 2BZXA 1KIKA 1NG2A 2BTTA 4M7AG 3L2VA 1JJ2P 1V76A 1R77A 1YJNQ 4BI3A 5FU6B 1AWJA 1RADB 4C92A 5GAMj 3TVTA 2QDLA 2DXBA 1UECA 1QLYA 3HL8A 4LD9K 5GANg 4BE1A 3GLXA 1NEGA 4XU1A 2O4XA 2K2MA 4IKFA 4J8OA 2KNBB 3MHXA 2E10A 1JQQA 2OTLQ 4E47A 2JTMA 2LQWA 1Q7YC 2B86A 2DO3A 1U1TA 2FHDA 5FWCA 3PIPA 2RJCA 2VYTA 2J05A 3VS1A 2MK5A 2JVVA 3V8LA 2HBWA 2VUBA 1KC8U 1Y57A 3N5BB 3CCSA 3H8ZA 3OSSC 3X26B 4PJNA 3X24B 1M90R 3HPWA 2HAXA 1X43A 2XG8D 2Y4YA 4CC4B 2ZPEB 1GXIE 3M0TA 2KMTA 3H0HA 3BE3A 2HKNA 2HEQA 2LJ1A 3JCMX 1QWFA 3CCVT 3QZ9B 4J9CA 3CEYA 1ZUUA 3QXEB 3CD6A 2DBKA 2CUBA 5GAOq 2OAUA 3OYDA 4NOYA 1RAIB 1YI2A 2EYQA 3A98A 3JCMV 4C92E 2RQWA 2O9SA 1UGPB 4J9DA 1OV3A 3NGPA 2KEAA 3RBBB 2EYWA 2COYA 1B07A 1VQMA 2J06A 1I4K1 5GAOl 2D1XA 2RI5A 3REAB 5GANd 2H3JA 2QQ9A 3FRNA 3HFOA 2F69A 1M1KR 2E64A 4AG2C 1JRIA 1R0CB 3JCMe 1I07A 1KFZA 3PMIA 5FW9A 1VQ6Q 1CSKA 1VA7A 1WXTA 4A53A 3H0FA 1M5Q1 2DZCA 2K3YA 2K2VA 2XHCA 5ECAA 2ZPBB 3EHQA 1H3ZA 2KYMA 3EG9A 3QG1A 1YBYA 1D09B 1M9SA 1KD1U 3V8JA 5GAMf 1GCPA 1MMNA 1I0CA 1W1FA 3R6OA 1NJIR 3CC7T 1BYMA 1VQ5A 2YDLA 2CT4A 4BE2A 1VQ6A 3CBOA 1X69A 2CREA 4CI0C 4OB0B 1G8XA 4PJLA 2LT4A 8AT1B 3CXCS 1AZGB 4M75C 4QQ6A 4E7ZA 1WXUA 4FT2A 3CPWA 1BIBA 4F7UG 1GFCA 1QP2A 1T0JA 1YFNA 5D6YA 1VQOA 4NL3A 4A4HA 4L59A 4TVRA 3EFSA 3M53A 3CC2Q 1HYOA 3KBGA 2K5LA 4XU0A 3HRTA 2FG0A 2KGTA 2FZKB 3V7CA 2RK2A 5GAN7 2V8JA 2QG9B 4RTVA 1GL5A 3NPFA 1GCQC 1SKUB 1VQ4A 1UGSB 3VS6A 4O5VA 3A5ZB 2FRWA 4LDUA 4M77F 2VB6A 4OB3B 1QVGP 3M58A 2NYSA 5LJ3h 1IREB 1M27C 4X9CA 2PUKB 3VUBA 1YJ9T 1ZUKA 1JBMA 3OYCA 4LDVA 1UE9A 1K73C 2OJ2A 2LP5A 2VVKA 3M59A 2E1HA 1VQ7T 2DL7A 2CZ7B 2C0TA 3JB9H 2YHTA 2JTFA 2FZCB 4C0DC 4DBQA 2NUPB 1JXOA 1TSFA 3LWIA 1ZQ1A 2EGEA 1VQPT 2RA2A 1I8FA 1BU1A 1UHFA 2RQVA 3JCMg 4EDUA 1WXBA 2GQVA 4M7DB 3OW2S 1M3AA 4HCBA 2DPPB 2O88A 4JRKA 1YJNT 4AFZC 3CCMA 3PTAA 5GAMh 3CCUQ 1O9SA 1P92A 3JSCA 2VV5A 1WHGA 3MEWA 1W2BP 4J9HA 2Z0WA 1JB0E 2QDYB 4RTWA 4EMKA 1QCNA 3CPFA 2FRYA 1ACMB 4JZ3A 3PVLA 1O75A 3CCJT 5A0DA 1IO6A 3JCMQ 1RLPC 2O2OA 2NUPA 2ZCFB 3LW5E 3BDLA 1BI3A 2D0QB 4RMOA 2B8AA 1ZA2B 5GAN2 3G6ET 4OF1A 2LC4A 4E6RA 1U8RA 2DIQA 2RD1A 4FU6A 2E4HA 1IGQA 5GAMe 1JU5C 4B6MA 2E41A 3S3OA 4B9XA 3ULRB 2KK4A 1M1KU 4WCIA 1D0XA 2RQRA 4EMHA 1UJ0A 1ZHIA 3LYIA 1D1CA 5KCOA 4XAXB 4Y28E 3OBWA 1FX7A 4M78B 2LVMA 1GBQA 3G6EA 2VC8A 4QVCA 4ESRA 3MP1A 4LD6A 3DLMA 2L0AA 2CP7A 3QO3A 2K79A 4KH0B 1V29B 2G6FX 2EYXA 3M57A 1VYUA 2HQXA 5GAOr 1IRXA 5GANe 1S1NA 5KYXB 2RNAA 1M8MA 2CZ1B 1LJOA 4FSSA 5CKHA 3C0CA 1NZ9A 4PJOF 3SD4A 4V2SA 5CR2A 2V26A 4N4GA 5IN1A 3RUXA 3RESA 2FYKA 1SHGA 3JB9F 4ELZC 3PFSA 3RMSA 1OYXA 4XK8E 4JJBA 5DLOA 4JRIA 4KGVB 1VQ6T 2MPXC 5KYYB 3TCJA 3VYGA 1IXDA 1TOVA 1NYFA 2EFIA 3AHUA 4BACA 1UGQB 4PJOD 1IB8A 2O01E 1SG5A 3LX7A 1YI2T 5GAOm 4LN2A 1QVGS 2XDPA 4C0FA 1NLOC 2KQWA 4J7IA 1T3LA 2PVDB 4JRPA 4JS5A 1D1BA 2H8HA 2OI3A 2QQAA 1RL2A 4OMFB 1W70A 2RM4A 1MV0B 1WJQA 1WIEA 4J9GA 4E2FB 3INZA 1HJDA 2PUOB 2K9GA 2HL3A 4DEXA 2LNVA 2MYSA 2VXEA 4QKUA 2CDTA 1LNXA 4L5GA 4QVZA 3SWNA 4GY5A 1RAHB 4Y92A 3EGUA 1VUBA 4ME7A 2F5TX 3DB4A 2PU9B 3WVDB 4C5IA 3L2ZA 2YRVA 1NYGA 1ZSGA 2D0NA 3CC2T 4BI4A 2MIOA 1KC8R 2EQUA 4GLKA 5IHNA 3LWHA 1YJ9A 2E65A 2R5AA 2EJFA 1KD1C 2VGMA 4M7DF 3M9QA 3PT9A 2OX7A 4GBQA 2CUDA 3OB9A 2CP0A 5GAMg 5GAN3 5J39A 4M75B 3RKWA 5CK9A 1YIJQ 2QAZA 2FPFA 4LDWA 2BZYA 2AKLA 2FL7A 3QHSA 4M7DD 4OMMA 1VQ9A 3RR6A 1UJYA 2GCXA 4AT1B 3CCLQ 5I2MA 1YJ9Q 3KUFA 3A8OB 1AZEA 1EZZB 2RJFA 4LNPA 1TG0A 3JCMJ 2ATCB 4F7UE 4OMNA 4FSXA 4ORZA 4KULA 3RERA 1GBRA 2M1HA 2YUQA 1QW1A 3QWXX 3QUIA 5LJ3g 2GTOA 2OTJQ 2EPDA 2EQKA 2YWWA 3LH0A 2JS0A 2DL8A 5EC7A 3CCEA 1YITQ 2EJGA 4KT0E 3P8HA 2LDMA 5IT9E 4JDSA 1VQOT 2GGRA 4OGCA 1PRLC 3MEVA 1X6OA 2V1QA 2KYBA 2X9HA 4IUUA 1A0NB 1G83A 2M0YA 4MZMA 1VQ8Q 4MZPA 3HRSA 4C0DB 2GF7A 3BDUA 3C95A 4ZTFA 2DL3A 5A0LA 4KBMB 4MZTA 4PJOA 4FYVB 1KK7A 2JOYA 4IUTA 3I55A 3G6EQ 2X4WA 5GAMd 3MP6A 3PIOA 1MMDA 3ASKA 4E7JA 1ZSZB 2HZYA 1M4ZA 1B34A 1WHJA 2J7IA 2OTLT 1SSHA 2E5KA 4AFUC 4R55A 1X2KA 2DXTA 1IHVA 1G3SA 3CMEQ 1M90U 1G5VA 3FLGA 5GMKj 3JB9I 4A4GA 2OTJA 4GLMA 2M9UA 2QI2A 2AT1B 1BKBA 1VQ7A 1QVGA 2EKOA 3SEMA 4IIOA 2QTVA 3I56A 3GPLA 3CQTA 1BB9A 3QDRB 1ABOA 3CCMQ 4J83A 2C0IA 3BW1A 5GANf 4DEYA 3T9NA 3VS0A 1W2BS 3WVEB 1VQMT 1AT1B 2AHJB 1H641 1HSQA 4XTYA 2RQUA 4PFOA 5LJ3d 2KVQG 1YJWA 4M78G 1D1AA 3FEOA 4A4KA 5GMKe 3ZL7C 4OMPA 1OQKA 3JB9D 2JXBA 3UA6A 2DK3A 5CAIA 1LOJA 4J7FA 2DXUA 2LJ0A 4M75E 4M7AE 4Z8AA 2EYZA 3M54A 4PJJA 1IGUA 1WPYA 2AZSA 1XQHA 3M4YA 5LJ3f 5C6SA 1H8KA 2RH2A 5CCAA 3URGA 2ZPIB 3JCMP 4HT8A 1I81A 5HY6A 1TXQA 3L2WA 5FLXE 3EG3A 1UGVA 4OMQA 2PVGB 3I5RA 4M75A 2KXDA 2EWNA 4M78A 3EHRA 3OQ5A 3M0SA 3SFMA 4J9BA 1VYTA 5M9OA 1K9MU 3E9GA 3V7SA 5KE3A 3SHWA 5IHKA 2SRCA 2ZPFB 4M7AA 1S72Q 3FDRA 2X3XD 3OYYA 4C92D 4OGEA 1SRMA 3I9QA 1XNIA 3CCVA 3J80E 1X2QA 2EAYA 1RUWA 2HD0A 2HMAA 2D8HA 1ABQA 4XQ3A 2KDSA 5FU7C 2YRDA 3NTIA 1MGQA 1YP5A 3FJPA 1OX9A 5GAN5 5C0MA 4HCZA 4JS4A 2EJ9A 4Y91A 3VU3C 4PLLA 3LGFA 1PCXA 2QEXA 2HBPA 5IXBA 2ROTA 2L3PA 3L2UA 2XD0A 4AMCA 3CD6Q 3M0UA 4C0GA 3EFOA 1X27A 2XMFA 1ZX6A 3I5SA 5D6WA 3E1SA 3VKIA 3OS5A 1M1GA 2CS7A 4M77D 1G3YA 1K8AC 4RTUA 3HHTB 3MPUB 6AT1B 4IUPA 2NUTA 2JZ2A 2MOXA 3ZBDA 1S72A 1YIJT 4OB1B 2CP3A 4PJOB 3F70A 2F2WA 1H92A 3A8HB 4PLIA 2G3RA 2ED1A 2DJZA 2AIRB 1I5OB 1PWTA 2V8KA 3MJXA 1B34B 4J9IA 1FYNA 1PHTA 4XTZA 5FWBA 3RKXA 2BUDA 3AT1B 3A8GB 1YWPA 4Z88A 1WHMA 4ELYC 4M7AF 2KXCA 2YUOA 4EMKB 1JEGA 5AYFA 2X4YA 4PFPA 4A54A 2LNHB 2A28A 1YCYA 1KHCA 1EX4A 1CKBA 1RAAB 3M4GA 3RKYA 2DTIA 1PG5B 4E7HA 4X9DA 3OS0A 2BKDN 4PFZA 1VQPQ 2OTJT 4CC2A 5LL6S 3VRZA 2RHXA 1KQSS 4DOWA 1YITT 4DBHA 3V7RA 3G71A 3JCMd 4C5GA 3GOXA 3OS1A 1LVKA 1I5LA 3NFCA 2OAWA 1JXMA 5GMKh 5D6XA 3MP8A 1WZOA 2HSPA 4ZN3A 1OULA 3OYKA 3CCUT 2OTLA 3EG1A 5IHIA 1AHJB 5KCHA 1VQ8T 4FIBA 4RCCA 1QVFS 4C8QD 2E3IA 3OS2A 3KXTA 2W10A 1RAEB 3OBYA 2XI9A 4KUIA 1XTDA 1BI0A 4RG8A 2FVUA 1K73R 5DY9A 3CCJQ 1M2VB 2BZ8A 4EPCA 1PKSA 3VS5A 2RHZA 2RPNA 1OI1A 2PVOB 1QP3A 2JNGA 3I56T 2K5IA 1R0BG 1VQ4Q 4JLGA 1KHIA 1E6HA 4N4HA 1RABB 4X1VA 3O8VA 4JPBW 2VXFA 3CC4Q 5GAN6 3UATA 3CMET 1M1FA 3SDZA 3EG0A 3JV3A 3PVQA 4Z02A 2Y90A 2D8JA 2ROLA 1Q7YR 1YN8A 3VV0A 2DM1A 1G3WA 1M1KC 3CCEQ 5FROA 5GAN8 1YHQA 4M7AC 1VOMA 3VJPA 1D0ZA 1Q86R 3QYGB 1VQPA 1VQMQ 1BCOA 2FB7A 4KH1B 4MMLA 3FC3A 4RKUE 1WJRA 1WHHA 3TSWA 5HK3A 2JW4A 3MCAB 4RTXA 3GBQA 3O5ZA 2QQSA 4J5YA 2XIDA 3Q1JA 1PSEA 1TUDA 1WYXA 1Y7XA 3OYNA 5FRMA 1KG1A 1TH7A 1U1SA 4EIKA 1KQ1A 3OW2A 3OSVA 2CSIA 2DAQA 4C92B 3TEEA 2QTXA 4VUBA 4EMKC 2JS2A 3KFVA 2VWFA 4IURA 4M78C 4QQDA 2QEXT 2KRNA 4PJOE 5A2QE 3C94A 1TU0B 2X4XA 1E6GA 5GANj 4DQ2A 2P0KA 1FMVA 3A1PA 1AVZC 2HL5C 5KYWA 3I55T 3OYAA 4BB7A 1OEBA 2E5QA 5CQYA 2J6KA 2EW3A 2LX7A 2H3EB 4J6XA 4PL6A 1S72T 1WHLA 1SEMA 2KY9A 2NUTB 2HQEA 2YLCA 2YUNA 2KSSA 3NMZC 1U3OA 2QQBA 2LJ3A 3OY9A 3JB9G 2XDBA 2MCNA 2W0ZA 2HQHA 2DMOA 1R8OB 4HVUA 1X6BA 3G1JA 1VQ9Q 4M75G 2DL5A 2A36A 4O6JA 5KYWB 4PK4A 1K0XA 2DTHA 2J6FA 2JMAA 2ZPGB 1TUCA 4B9WA 4RTYA 4M78D 3GF5A 4ZGDB 4BY6C 2QQRA 3CMAA 1Z9QA 3CD6T 1NM7A 3JRZA 3OYHA 1UEBA 1KSWA 4JUVA 3EH1A 3I35A 2DBMA 1LCKA 2RHIA 1M90C 1XJWB 1I1JA 3SB2A 5LJ5j 3PMTA 3OYMA 1Q95G 2LQKA 3HRUA 2X51A 3M0PA 2QGGA 4M7AB 4M7DC 4QW2A 3JCMh 1OPLA 4F14A 2FPDA 2KROA 3OYLA 4Q5WA 1FWZA 3DLLA 3CC4A 5J26A 1RI0A 5CKBA 4FYXB 3QJ6A 2SEMA 2ECZA 2L3QA 2RN8A 2YT6A 1MUZA 4JZ4A 2EKHA 4LDYA 3QPHA 4M4ZA 4C5HA 4PJOG 2DEUA 2CKKA 1PRMC 1HK9A 1WX6A 4C0ZA 3C4SA 3H41A 8ATCB 1TWBA 1OZ3A 5IH2A 1M3CA 1Z9ZA 1SRLA 2BIVA 2MI6A 4C92C 3CXCP 2QASA 3M0RA 1UFFA 3NTHA 2XDDA 3ZFJA 4R0KA 1VQLT 1U5SA 3PE0A 1YIJA 1B7TA 1MV3A 1K8AR 2YSQA 2K4YA 2GBQA 3EGDB 3CCSQ 4HVWA 4HCKA 2QA4T 4C8QE 4RTZA 1D0YA 2LQ8A 2CP6A 4KGXB 4M7DE 3THKA 1VQOQ 2KI7A 1AD5A 1WI7A 1OX8A 4N0AA 4AG1C 3JCMc 3EFOB 5LJ5f 2DL4A 5GJVB 3G4SA 2L89A 4RTTA 5CKEA 3ME9A 4FYWB 2EQJA 4LDXA 1NJIU 2JN0A 1X75C 7AT1B 3H0IA 1YJWT 1RLQC 5GJWB 4F17A 1QWEA 1JJ2A 2ZGWA 2RQTA 1PD0A 4Z89A 3G71T 1VQNQ 2VGNA 2EQMA 1BCMA 2CP2A 2LQNA 1N9RA 3A8MB 2CH4A 3QIIA 2V8IA 1WHKA 4XTXA 2EQIA 4JJCA 3JB9J 4HCCA 1YCSB 2DNUA 3UDCA 3X25B 2ESWA 2RHUA 3HP9A 1N27A 3M55A 4RCBA 2DVJA 4M7AD 4K11A 5KYUB 3CCQT 3CCMT 1TS9A 1KQSP 5KYNA 4WTOB 2BE9B 2WSEE 1RI9A 5HK0A 5GMKm 2ZAEA 5CKDA 3QBYA 1N8RR 1OPKA 1SSFA 1M2VA 3CCRA 3S3NA 3EH2A 4M7DA 4F7UA 5IAYA 2X3WD 1V1CA 2V1RA 3OMGA 4JRQA 3QJYA 1VQ5T 4RUGA 2RF0A 4C8QG 3PNWC 2XKOC 4AFQC 2P4TA 1YHQT 1PC0A 1X01A 2CP5A 3M0QA 3M5AA 1G2BA 2PTKA 3OA6A 3VS2A 4XU2A 1PSFA 4OMOA 4DBRA 4NS5A 2EGAA 4FW1A 1PNJA 2A08A 3I55Q 2NWMA 4FM4B 5FU6C 3PGGA 2RK1A 1W4SA 2CSQA 2JTEA 2PZ1A 2RJDA 2O9VA 3RDVA 1KQSA 2EVRA 2DRMA 2D9TA 5LJ3e 5EG2A 4F7UB 1MMGA 2DXCA 1BK2A 1QCFA 4E7SA 2DF6A 4WF2A 4ZNXA 1WA7A 1CKAA 2CZ0B 4A4FA 2RI3A 3GNGA 2F2VA 1NJIC 1WQWA 1Q82C 3GIBA 1VQ9T 3CPWS 4MMKA 1VQKQ 1RACB 4EMGA 4M7DG 1GFDA 4JJNK 1HD3A 5I11A 2HCKA 3ER0A 4FYYB 2A7YA 5A0GA 3VRYA 5J3BA 3MKDA 4HVVA 2DD4A 4LE9A 2MF2A 1N9SA 2RI2A 4OVAA 3LLRA 9ATCB 3QZ5B 1ZBJA 5KYXA 4F04B 2XU8A 3EGDA 3X20B 5LJ5d 1IZ6A 1M3BA 2M51A 4X34A 1NLPC 3CBMA 4D8DA 1HXDA 2HDAA 2E70A 2VKNA 4D6WA 4R56A 4PKCC 2K7AA 2CYZB 1K9AA 2E6ZA 1YJNA 1VQ8A 1MHNA 3HKSA 2PQWA 1X6GA 4ZTJA 1K9MR 2COWA 2L3RA 2I2LA 2X35A 1WLPB 2QA4A 2LCCA 2JM9A 5CVIA 3FB9A 1QQJA 1GRIA 4C8QA 5I2SA 1AWOA 4KGZB 1UGRB 2KT8A 2LRQA 2I0NA 4M78E 5AT1B 3SWNB 2IG0A 4A63B 2L2PA 3GNFB 1VQLQ 3CCVQ 2RB6A 1WNLA 2KE9A 1IHWA 1B3QA 2GTJA 3L1AA 1W6XA 2DZ9A 1QKXA 2QA4Q 4P5NA 3JCMW 2CT3A 2ENMA 4LUDA 5L8RE 3S3MA 5I22A 2C06A 2MWPA 4II1A 1VQNA 2FZGB 3LH5A 4OP0A 2DETA 3UPUA 4XTVA 5HCKA 5GMKi 4LXCA 2DLPA 1ZUYA 1JO8A 1EIFA 1N8RU 5KYUA 5CO7A 3CMAQ 4C8QC 2MMPA 1M2OA 3FIFA 1YJWQ 1WJSA 4CC3A 2D6FA 2QGFB 1ZA1B 2JMCA 2LX9A 3OMCA 3J81E 3VUZA 1SHFA 5IXFA 4IUVA 2RO0A 4JJDA 3CCLA 3HSBA 4HKEA 3VS4A 3I56Q 1XOVA 1WGSA 3G71Q 1VQNT 4DBFA 1VQ4T 4L6V5 2EGCA 1FMKA 3UT1A 3GP8A 5L23A 1BBZA 2M0OA 2P84A 3BY7A 3CC4T 1N8RC 1YWOA 2DERA 2O31A 1C1AA 1N5ZA 4M77A 3CC7Q 3UF4A 4XTUA 3QDFA 2PNIA 4J6YA 2XK0A 3EGXA 2LCSA 1H3HA 2DFUA 2E12A 3V8KA 1KD1R 5FRNA 3CCET 1AWXA 2AZVA 2QK0A 4C8QF 1PKTA 1TTHB 5GMKl 4QT7A 1VQLA 4MDWA 1PM3A 3EG2A 2CH4W 2X4JA 1KQ2A 3S6WA 2L5QA 2AKKA 3META 1J3TA 1K8AU 2GNCA 3G4SQ 1UUEA 3A8LB 2YLBA 2WACA 1SF9A 2DD5A 3CCJA 3P8DA 1T0HA 4N0AC 3TREA 2ABLA 5CQXA 2BE7D 5LJ3j 1OU8A 2GFAA 3D7SB 4AFSC 4M77C 3IQLA 3REBB 1JJ2S 1VQ5Q 2DVEA 4N4IA 2XICA 4ZN1A 1OZ2A 4BDYA 2O4XB 4ZGEB 2R57A 3TQ7P 1YHQQ 4HA8A 1NPPA 3L2QA 1FMWA 2DE0X 4OMLA 4CRIA 2K6DA 2VASA 2KT1A 2QEXQ 1C0MA 4E7KA 3H6ZA 4LUEA 2DRKA 1VQKA 1WFWA 3CBPA 3CCRT 1RAFB 3TU4K 1Q86C 1VQ7Q 4M77E 2LMJA 1ZBXA 3CC2A 2LCLA 5CKFA 2K3BA 1WQ7A 1Y07A 2E3HA 3LGLA 3L2RA 4J6WA 2YXYA 4C8QB 4BD3A 3E9FA 4PJOC 3QYHB 3OYBA 1Q81C 1VQKT 2DJQA 2R5MA 4F16A 3NTKA 5DM7R 4DOVA 3VYHB 1M30A 4QVDA 1ARKA 4J9EA 2LTOA 4BI8B 1K0SA 3MO8A 1UB4A 2A3LA 2FO0A 4FL6A 1D3BB 2YUPA 1DJ7B 1F1BB 4XU3A 2CZ6B 4HT9A 5LJ5e 4KUDK 1AWWA 1MNEA 3HTRA 3E19A 1SPKA 4UC4A 2K3XA 3VS7A 5DLQE 1G3TA 2FPEA 1MMAA 3C12A 3DB3A 1Q86U 1KJWA 1OU9A 4IUQA 2DKGA 2MWOA 2KRSA 3QWYA 5HKCA 2QYZA 2RJEA 4FW2A 1D3BA 3CC7A 1M8VA 3CCUA 1NBEB 3BFMA 3CPWP 1VYVA 1PD1A 1Q81U 5CIUA 3OYIA 1NPRA 2HSEB 3EAEA 2P0QA 2F1LA 4ATOA 3EGXB 1QVFA 2HNIA 3EG9B 2A37A 4J9FA 4PJMA 4C5EA 2EYYA 5LJ5g 3OYJA 3DKMA 2AK5A 1YNZA 4RG2A 4C92F 4FT4A 1VIFA 2L8DA 4MDXA 3CCST 4M75D 2KR3A 1AEYA 1C6VX 1UTIA 2WSFE 2M16A 2JUFA 2CGHA 2ZZDA 3VS3A 4A4EA 2Y4XA 3X28B 1VIEA 1ZSZA 1NE8A 1Q7YU 3G7ZA 1Y96B 4D8KA 2ED0A 3FJ5A 3OYEA 3SWNC 3P8BB 4M78F 3CMAT 3EFRA 2DA9A 4M75F 5LJ5h 1QCOA 1KC8C 3JAME 3QSUA 1BI1A 4F7UF 2COZA 2MAMA 1YI2Q 3RNJA 1UDLA 2IVWA 1E7OA 2WSCE 2GQIA 3MEAA 2RMOA 2L3SA 4HXJA 2E6NA 3CCQA 3M56A 3OYGA 2EIFA 5GAOp 1K76A 4XTWA 1MNDA 1Q81R 2EBPA 2P0PA 2IIMA 3UWNA 2QXFA 4JLIA 2DILA 5KE2A 1Y96A 1QVPA 3RIRA 2JT4A 2GFUA 1YITA 1TUGB
chains in the Genus database with same CATH topology
2F2VA 4ESRA 4CC2A 3VRZA 2L0AA 2K79A 1GFDA 1NEBA 2G6FX 2NUZA 2EYXA 1HD3A 1OOTA 5I11A 2HCKA 2OAWA 1JXMA 3VRYA 1VYUA 2HSPA 2J6OA 1WDXA 1AOJA 3EG1A 4HVVA 5IHIA 2KRMA 1EFNA 1S1NA 4LE9A 2RNAA 1M8MA 3U23A 3NHNA 4FSSA 2W10A 3C0CA 1K1ZA 2BZ8A 1ZBJA 1SHGA 2JM8A 1PKSA 3VS5A 2DX1A 1M3BA 2M51A 1NLPC 2RPNA 4D8DA 2KBTA 2HDAA 4JJBA 4IIMA 3TSZA 2VKNA 1ZLMA 1E6HA 1GCQA 2K7AA 1U06A 4KRTA 1K9AA 1NYFA 4X1VA 2P4RA 1K4US 1X6GA 4JPBW 1UG1A 3UATA 4LN2A 1WLPB 3EG0A 3R6NA 3JV3A 2JM9A 1Y0MA 3PVQA 1NLOC 1T3LA 2D8JA 1GRIA 2ROLA 1QKWA 1YN8A 2C0OA 2DM1A 1T3SA 3UA7A 2H8HA 2OI3A 1W70A 1AWOA 2KT8A 1MV0B 2I0NA 2DYBA 1WIEA 4J9GA 4CC7A 1HJDA 2K9GA 4A63B 2F2XA 4DEXA 2L2PA 2FEIA 2CDTA 2LZ6B 2KE9A 1B3QA 1UHCA 2BZXA 2GTJA 1KIKA 1NG2A 1W6XA 2BTTA 4Y92A 3TSWA 1QKXA 3EGUA 2CT3A 2ENMA 4LUDA 2JW4A 4RTXA 3GBQA 3O5ZA 5I22A 1AWJA 3LH5A 1NYGA 1ZSGA 2D0NA 1TUDA 1WYXA 2MIOA 3TVTA 2QDLA 5HCKA 1UECA 1QLYA 5IHNA 2DLPA 1ZUYA 4EIKA 2CSIA 1JO8A 1NEGA 4GBQA 2CUDA 2JS2A 2K2MA 3KFVA 2VWFA 4CC3A 2KNBB 2JMCA 2KRNA 1JQQA 1E6GA 1SHFA 5IXFA 2FPFA 2BZYA 2AKLA 2LQWA 4JJDA 1AVZC 3VS4A 1XOVA 2B86A 1OEBA 4OMMA 5FWCA 1UJYA 2J6KA 2EGCA 1FMKA 2EW3A 2LX7A 2J05A 3VS1A 5L23A 1BBZA 1AZEA 2HBWA 1Y57A 1YWOA 4LNPA 2O31A 1TG0A 1SEMA 1N5ZA 3UF4A 2PNIA 2YUNA 3NMZC 4OMNA 1X43A 1U3OA 2LJ3A 2LCSA 4CC4B 3M0TA 3H0HA 1H3HA 4ORZA 2MCNA 1GBRA 2W0ZA 1AWXA 2AZVA 2YUQA 1PKTA 4QT7A 2DMOA 3QWXX 2HEQA 2LJ1A 4HVUA 1X6BA 2GTOA 2DL5A 2CH4W 1QWFA 2EPDA 3EG2A 2AKKA 2A36A 2JS0A 2DL8A 5EC7A 4J9CA 1ZUUA 1K0XA 1J3TA 2J6FA 2JMAA 2GNCA 2DBKA 2GGRA 1TUCA 4RTYA 1PRLC 1UUEA 2CUBA 3A98A 1T0HA 2V1QA 2KYBA 2ABLA 1A0NB 2RQWA 1Z9QA 1G83A 1NM7A 2O9SA 2M0YA 4J9DA 1OV3A 3NGPA 2KEAA 3RBBB 1KSWA 2EYWA 1B07A 2J06A 4AFSC 2D1XA 3IQLA 3I35A 3REAB 3REBB 2DBMA 1LCKA 1I1JA 2DL3A 2DE0X 4OMLA 3M0PA 2K6DA 4AG2C 2KT1A 1I07A 1KFZA 1OPLA 4F14A 2FPDA 2KROA 4LUEA 5FW9A 1CSKA 2DRKA 1VA7A 1WXTA 3H0FA 2J7IA 1SSHA 1WFWA 2E5KA 4AFUC 1X2KA 5ECAA 2SEMA 2ECZA 2L3QA 2RN8A 2YT6A 3EHQA 1MUZA 2KYMA 4JZ4A 2EKHA 4M4ZA 4GLMA 2LMJA 1PRMC 1WX6A 3H41A 1GCPA 3SEMA 1I0CA 1W1FA 4IIOA 2K3BA 5IH2A 1M3CA 2YDLA 2CT4A 1Z9ZA 1SRLA 3CQTA 1BB9A 3M0RA 1ABOA 1UFFA 1X69A 2CREA 2C0IA 4R0KA 1U5SA 3PE0A 3VS0A 4DEYA 1MV3A 2YSQA 1AZGB 2DJQA 2GBQA 1WXUA 1HSQA 2RQUA 4HVWA 4HCKA 4F16A 1GFCA 4RTZA 1T0JA 1M30A 1ARKA 4J9EA 1K0SA 3THKA 3ZL7C 2FO0A 4OMPA 1AD5A 1WI7A 2JXBA 3UA6A 4AG1C 2FG0A 2YUPA 2KGTA 2LJ0A 4Z8AA 2EYZA 2DL4A 2AZSA 4RTVA 5GJVB 4RTTA 1AWWA 1GL5A 1H8KA 3NPFA 1SPKA 1GCQC 3VS6A 3H0IA 3VS7A 1RLQC 2FRWA 5GJWB 2FPEA 4F17A 1QWEA 2RQTA 4Z89A 3EG3A 1UGVA 4OMQA 1KJWA 3I5RA 2KXDA 1M27C 3EHRA 3M0SA 2KRSA 4J9BA 1VYTA 3QWYA 2LQNA 1ZUKA 2CH4A 3SHWA 5IHKA 2SRCA 2EQIA 4JJCA 2X3XD 1UE9A 2OJ2A 1VYVA 2LP5A 2VVKA 1YCSB 2DNUA 2DL7A 1SRMA 3I9QA 2C0TA 2ESWA 1X2QA 1RUWA 1JXOA 2EGEA 2D8HA 2DVJA 1ABQA 1BU1A 4K11A 1UHFA 2A37A 2RQVA 4J9FA 2EYYA 1YP5A 1WXBA 2AK5A 1YNZA 1M3AA 1RI9A 2O88A 1OPKA 2KR3A 4AFZC 1AEYA 1UTIA 5IXBA 2ROTA 4J9HA 2L3PA 3VS3A 2X3WD 4RTWA 3M0UA 1V1CA 1X27A 2XMFA 1ZX6A 3I5SA 2FRYA 2V1RA 4JZ3A 3PVLA 4D8KA 2ED0A 4RUGA 3FJ5A 2RF0A 1IO6A 4AFQC 4RTUA 2DA9A 1RLPC 2O2OA 2MOXA 3M0QA 1G2BA 2PTKA 3VS2A 4OMOA 4E6RA 2EGAA 2F2WA 1PNJA 2A08A 1H92A 2NWMA 3RNJA 2ED1A 1UDLA 2JTEA 2CSQA 2PZ1A 1E7OA 1JU5C 2GQIA 2O9VA 2RMOA 1PWTA 2EVRA 2L3SA 4HXJA 2DRMA 3ULRB 4J9IA 1FYNA 1K76A 1PHTA 4WCIA 2RQRA 5FWBA 2EBPA 1YWPA 4Z88A 1UJ0A 2IIMA 2KXCA 1BK2A 1QCFA 2DILA 2YUOA 2DF6A 1JEGA 4ZNXA 1WA7A 1CKAA 2LNHB 2A28A 2JT4A 1GBQA 1CKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F2V A;  4ESR A;  4CC2 A;  3VRZ A;  2L0A A;  2K79 A;  1GFD A;  1NEB A;  2G6F X;  2NUZ A;  2EYX A;  1HD3 A;  1OOT A;  5I11 A;  2HCK A;  2OAW A;  1JXM A;  3VRY A;  1VYU A;  2HSP A;  2J6O A;  1WDX A;  1AOJ A;  3EG1 A;  4HVV A;  5IHI A;  2KRM A;  1EFN A;  1S1N A;  4LE9 A;  2RNA A;  1M8M A;  3U23 A;  3NHN A;  4FSS A;  2W10 A;  3C0C A;  1K1Z A;  2BZ8 A;  1ZBJ A;  1SHG A;  2JM8 A;  1PKS A;  3VS5 A;  2DX1 A;  1M3B A;  2M51 A;  1NLP C;  2RPN A;  4D8D A;  2KBT A;  2HDA A;  4JJB A;  4IIM A;  3TSZ A;  2VKN A;  1ZLM A;  1E6H A;  1GCQ A;  2K7A A;  1U06 A;  4KRT A;  1K9A A;  1NYF A;  4X1V A;  2P4R A;  1K4U S;  1X6G A;  4JPB W;  1UG1 A;  3UAT A;  4LN2 A;  1WLP B;  3EG0 A;  3R6N A;  3JV3 A;  2JM9 A;  1Y0M A;  3PVQ A;  1NLO C;  1T3L A;  2D8J A;  1GRI A;  2ROL A;  1QKW A;  1YN8 A;  2C0O A;  2DM1 A;  1T3S A;  3UA7 A;  2H8H A;  2OI3 A;  1W70 A;  1AWO A;  2KT8 A;  1MV0 B;  2I0N A;  2DYB A;  1WIE A;  4J9G A;  4CC7 A;  1HJD A;  2K9G A;  4A63 B;  2F2X A;  4DEX A;  2L2P A;  2FEI A;  2CDT A;  2LZ6 B;  2KE9 A;  1B3Q A;  1UHC A;  2BZX A;  2GTJ A;  1KIK A;  1NG2 A;  1W6X A;  2BTT A;  4Y92 A;  3TSW A;  1QKX A;  3EGU A;  2CT3 A;  2ENM A;  4LUD A;  2JW4 A;  4RTX A;  3GBQ A;  3O5Z A;  5I22 A;  1AWJ A;  3LH5 A;  1NYG A;  1ZSG A;  2D0N A;  1TUD A;  1WYX A;  2MIO A;  3TVT A;  2QDL A;  5HCK A;  1UEC A;  1QLY A;  5IHN A;  2DLP A;  1ZUY A;  4EIK A;  2CSI A;  1JO8 A;  1NEG A;  4GBQ A;  2CUD A;  2JS2 A;  2K2M A;  3KFV A;  2VWF A;  4CC3 A;  2KNB B;  2JMC A;  2KRN A;  1JQQ A;  1E6G A;  1SHF A;  5IXF A;  2FPF A;  2BZY A;  2AKL A;  2LQW A;  4JJD A;  1AVZ C;  3VS4 A;  1XOV A;  2B86 A;  1OEB A;  4OMM A;  5FWC A;  1UJY A;  2J6K A;  2EGC A;  1FMK A;  2EW3 A;  2LX7 A;  2J05 A;  3VS1 A;  5L23 A;  1BBZ A;  1AZE A;  2HBW A;  1Y57 A;  1YWO A;  4LNP A;  2O31 A;  1TG0 A;  1SEM A;  1N5Z A;  3UF4 A;  2PNI A;  2YUN A;  3NMZ C;  4OMN A;  1X43 A;  1U3O A;  2LJ3 A;  2LCS A;  4CC4 B;  3M0T A;  3H0H A;  1H3H A;  4ORZ A;  2MCN A;  1GBR A;  2W0Z A;  1AWX A;  2AZV A;  2YUQ A;  1PKT A;  4QT7 A;  2DMO A;  3QWX X;  2HEQ A;  2LJ1 A;  4HVU A;  1X6B A;  2GTO A;  2DL5 A;  2CH4 W;  1QWF A;  2EPD A;  3EG2 A;  2AKK A;  2A36 A;  2JS0 A;  2DL8 A;  5EC7 A;  4J9C A;  1ZUU A;  1K0X A;  1J3T A;  2J6F A;  2JMA A;  2GNC A;  2DBK A;  2GGR A;  1TUC A;  4RTY A;  1PRL C;  1UUE A;  2CUB A;  3A98 A;  1T0H A;  2V1Q A;  2KYB A;  2ABL A;  1A0N B;  2RQW A;  1Z9Q A;  1G83 A;  1NM7 A;  2O9S A;  2M0Y A;  4J9D A;  1OV3 A;  3NGP A;  2KEA A;  3RBB B;  1KSW A;  2EYW A;  1B07 A;  2J06 A;  4AFS C;  2D1X A;  3IQL A;  3I35 A;  3REA B;  3REB B;  2DBM A;  1LCK A;  1I1J A;  2DL3 A;  2DE0 X;  4OML A;  3M0P A;  2K6D A;  4AG2 C;  2KT1 A;  1I07 A;  1KFZ A;  1OPL A;  4F14 A;  2FPD A;  2KRO A;  4LUE A;  5FW9 A;  1CSK A;  2DRK A;  1VA7 A;  1WXT A;  3H0F A;  2J7I A;  1SSH A;  1WFW A;  2E5K A;  4AFU C;  1X2K A;  5ECA A;  2SEM A;  2ECZ A;  2L3Q A;  2RN8 A;  2YT6 A;  3EHQ A;  1MUZ A;  2KYM A;  4JZ4 A;  2EKH A;  4M4Z A;  4GLM A;  2LMJ A;  1PRM C;  1WX6 A;  3H41 A;  1GCP A;  3SEM A;  1I0C A;  1W1F A;  4IIO A;  2K3B A;  5IH2 A;  1M3C A;  2YDL A;  2CT4 A;  1Z9Z A;  1SRL A;  3CQT A;  1BB9 A;  3M0R A;  1ABO A;  1UFF A;  1X69 A;  2CRE A;  2C0I A;  4R0K A;  1U5S A;  3PE0 A;  3VS0 A;  4DEY A;  1MV3 A;  2YSQ A;  1AZG B;  2DJQ A;  2GBQ A;  1WXU A;  1HSQ A;  2RQU A;  4HVW A;  4HCK A;  4F16 A;  1GFC A;  4RTZ A;  1T0J A;  1M30 A;  1ARK A;  4J9E A;  1K0S A;  3THK A;  3ZL7 C;  2FO0 A;  4OMP A;  1AD5 A;  1WI7 A;  2JXB A;  3UA6 A;  4AG1 C;  2FG0 A;  2YUP A;  2KGT A;  2LJ0 A;  4Z8A A;  2EYZ A;  2DL4 A;  2AZS A;  4RTV A;  5GJV B;  4RTT A;  1AWW A;  1GL5 A;  1H8K A;  3NPF A;  1SPK A;  1GCQ C;  3VS6 A;  3H0I A;  3VS7 A;  1RLQ C;  2FRW A;  5GJW B;  2FPE A;  4F17 A;  1QWE A;  2RQT A;  4Z89 A;  3EG3 A;  1UGV A;  4OMQ A;  1KJW A;  3I5R A;  2KXD A;  1M27 C;  3EHR A;  3M0S A;  2KRS A;  4J9B A;  1VYT A;  3QWY A;  2LQN A;  1ZUK A;  2CH4 A;  3SHW A;  5IHK A;  2SRC A;  2EQI A;  4JJC A;  2X3X D;  1UE9 A;  2OJ2 A;  1VYV A;  2LP5 A;  2VVK A;  1YCS B;  2DNU A;  2DL7 A;  1SRM A;  3I9Q A;  2C0T A;  2ESW A;  1X2Q A;  1RUW A;  1JXO A;  2EGE A;  2D8H A;  2DVJ A;  1ABQ A;  1BU1 A;  4K11 A;  1UHF A;  2A37 A;  2RQV A;  4J9F A;  2EYY A;  1YP5 A;  1WXB A;  2AK5 A;  1YNZ A;  1M3A A;  1RI9 A;  2O88 A;  1OPK A;  2KR3 A;  4AFZ C;  1AEY A;  1UTI A;  5IXB A;  2ROT A;  4J9H A;  2L3P A;  3VS3 A;  2X3W D;  4RTW A;  3M0U A;  1V1C A;  1X27 A;  2XMF A;  1ZX6 A;  3I5S A;  2FRY A;  2V1R A;  4JZ3 A;  3PVL A;  4D8K A;  2ED0 A;  4RUG A;  3FJ5 A;  2RF0 A;  1IO6 A;  4AFQ C;  4RTU A;  2DA9 A;  1RLP C;  2O2O A;  2MOX A;  3M0Q A;  1G2B A;  2PTK A;  3VS2 A;  4OMO A;  4E6R A;  2EGA A;  2F2W A;  1PNJ A;  2A08 A;  1H92 A;  2NWM A;  3RNJ A;  2ED1 A;  1UDL A;  2JTE A;  2CSQ A;  2PZ1 A;  1E7O A;  1JU5 C;  2GQI A;  2O9V A;  2RMO A;  1PWT A;  2EVR A;  2L3S A;  4HXJ A;  2DRM A;  3ULR B;  4J9I A;  1FYN A;  1K76 A;  1PHT A;  4WCI A;  2RQR A;  5FWB A;  2EBP A;  1YWP A;  4Z88 A;  1UJ0 A;  2IIM A;  2KXC A;  1BK2 A;  1QCF A;  2DIL A;  2YUO A;  2DF6 A;  1JEG A;  4ZNX A;  1WA7 A;  1CKA A;  2LNH B;  2A28 A;  2JT4 A;  1GBQ A;  1CKB A; 
#chains in the Genus database with same CATH topology
 5KYY A;  4BE0 A;  5I21 A;  2DIG A;  3CCQ Q;  1NEB A;  3OW2 P;  2NUZ A;  3QKJ A;  1OOT A;  4NL2 A;  4ANJ A;  2LT1 A;  2RHY A;  3G4S T;  5GAN 4;  1QVF P;  1QMC A;  2NLU A;  2J6O A;  1Y71 A;  3JCM f;  1WDX A;  1AOJ A;  5GAN h;  2ZPH B;  1K73 U;  4ZGJ B;  2KRM A;  1EFN A;  1BI2 A;  1FXX A;  4BDZ A;  3MEU A;  3U23 A;  2JJ9 A;  3JCM b;  1BIA A;  3NHN A;  3HFN A;  2F5K A;  1Q82 U;  4C92 G;  1K1Z A;  3H9N A;  4PNO A;  2A0F B;  2JM8 A;  4E7L A;  2DX1 A;  2KBT A;  4E7I A;  3CXC A;  4FCY A;  1W2B A;  4IIM A;  4YTL A;  4OB2 B;  3TSZ A;  5FU7 B;  4DA4 A;  1ZLM A;  1GCQ A;  2HKQ B;  1N6A A;  1U06 A;  4KRT A;  3CCL T;  3OYF A;  2R58 A;  2K57 A;  2KAF A;  4BUG A;  4BY6 B;  2P4R A;  1K4U S;  1K9M C;  1UG1 A;  3CCR Q;  1Q82 R;  3R6N A;  2DYI A;  1Y0M A;  3WXM B;  2DEQ A;  4M77 B;  5D7U A;  1RAG B;  1LPL A;  1QKW A;  2C0O A;  3UA7 A;  1T3S A;  2K5F A;  5GAO n;  2YRC A;  3J7A F;  2DYB A;  3E2U A;  4QQG A;  4M77 G;  3CME A;  3ZEH A;  2DTO A;  4CC7 A;  2F2X A;  1ZSZ C;  2FEI A;  2IPO B;  2M02 A;  3L42 A;  2LZ6 B;  1UHC A;  5KH6 A;  3RMQ A;  2BZX A;  1KIK A;  1NG2 A;  2BTT A;  4M7A G;  3L2V A;  1JJ2 P;  1V76 A;  1R77 A;  1YJN Q;  4BI3 A;  5FU6 B;  1AWJ A;  1RAD B;  4C92 A;  5GAM j;  3TVT A;  2QDL A;  2DXB A;  1UEC A;  1QLY A;  3HL8 A;  4LD9 K;  5GAN g;  4BE1 A;  3GLX A;  1NEG A;  4XU1 A;  2O4X A;  2K2M A;  4IKF A;  4J8O A;  2KNB B;  3MHX A;  2E10 A;  1JQQ A;  2OTL Q;  4E47 A;  2JTM A;  2LQW A;  1Q7Y C;  2B86 A;  2DO3 A;  1U1T A;  2FHD A;  5FWC A;  3PIP A;  2RJC A;  2VYT A;  2J05 A;  3VS1 A;  2MK5 A;  2JVV A;  3V8L A;  2HBW A;  2VUB A;  1KC8 U;  1Y57 A;  3N5B B;  3CCS A;  3H8Z A;  3OSS C;  3X26 B;  4PJN A;  3X24 B;  1M90 R;  3HPW A;  2HAX A;  1X43 A;  2XG8 D;  2Y4Y A;  4CC4 B;  2ZPE B;  1GXI E;  3M0T A;  2KMT A;  3H0H A;  3BE3 A;  2HKN A;  2HEQ A;  2LJ1 A;  3JCM X;  1QWF A;  3CCV T;  3QZ9 B;  4J9C A;  3CEY A;  1ZUU A;  3QXE B;  3CD6 A;  2DBK A;  2CUB A;  5GAO q;  2OAU A;  3OYD A;  4NOY A;  1RAI B;  1YI2 A;  2EYQ A;  3A98 A;  3JCM V;  4C92 E;  2RQW A;  2O9S A;  1UGP B;  4J9D A;  1OV3 A;  3NGP A;  2KEA A;  3RBB B;  2EYW A;  2COY A;  1B07 A;  1VQM A;  2J06 A;  1I4K 1;  5GAO l;  2D1X A;  2RI5 A;  3REA B;  5GAN d;  2H3J A;  2QQ9 A;  3FRN A;  3HFO A;  2F69 A;  1M1K R;  2E64 A;  4AG2 C;  1JRI A;  1R0C B;  3JCM e;  1I07 A;  1KFZ A;  3PMI A;  5FW9 A;  1VQ6 Q;  1CSK A;  1VA7 A;  1WXT A;  4A53 A;  3H0F A;  1M5Q 1;  2DZC A;  2K3Y A;  2K2V A;  2XHC A;  5ECA A;  2ZPB B;  3EHQ A;  1H3Z A;  2KYM A;  3EG9 A;  3QG1 A;  1YBY A;  1D09 B;  1M9S A;  1KD1 U;  3V8J A;  5GAM f;  1GCP A;  1MMN A;  1I0C A;  1W1F A;  3R6O A;  1NJI R;  3CC7 T;  1BYM A;  1VQ5 A;  2YDL A;  2CT4 A;  4BE2 A;  1VQ6 A;  3CBO A;  1X69 A;  2CRE A;  4CI0 C;  4OB0 B;  1G8X A;  4PJL A;  2LT4 A;  8AT1 B;  3CXC S;  1AZG B;  4M75 C;  4QQ6 A;  4E7Z A;  1WXU A;  4FT2 A;  3CPW A;  1BIB A;  4F7U G;  1GFC A;  1QP2 A;  1T0J A;  1YFN A;  5D6Y A;  1VQO A;  4NL3 A;  4A4H A;  4L59 A;  4TVR A;  3EFS A;  3M53 A;  3CC2 Q;  1HYO A;  3KBG A;  2K5L A;  4XU0 A;  3HRT A;  2FG0 A;  2KGT A;  2FZK B;  3V7C A;  2RK2 A;  5GAN 7;  2V8J A;  2QG9 B;  4RTV A;  1GL5 A;  3NPF A;  1GCQ C;  1SKU B;  1VQ4 A;  1UGS B;  3VS6 A;  4O5V A;  3A5Z B;  2FRW A;  4LDU A;  4M77 F;  2VB6 A;  4OB3 B;  1QVG P;  3M58 A;  2NYS A;  5LJ3 h;  1IRE B;  1M27 C;  4X9C A;  2PUK B;  3VUB A;  1YJ9 T;  1ZUK A;  1JBM A;  3OYC A;  4LDV A;  1UE9 A;  1K73 C;  2OJ2 A;  2LP5 A;  2VVK A;  3M59 A;  2E1H A;  1VQ7 T;  2DL7 A;  2CZ7 B;  2C0T A;  3JB9 H;  2YHT A;  2JTF A;  2FZC B;  4C0D C;  4DBQ A;  2NUP B;  1JXO A;  1TSF A;  3LWI A;  1ZQ1 A;  2EGE A;  1VQP T;  2RA2 A;  1I8F A;  1BU1 A;  1UHF A;  2RQV A;  3JCM g;  4EDU A;  1WXB A;  2GQV A;  4M7D B;  3OW2 S;  1M3A A;  4HCB A;  2DPP B;  2O88 A;  4JRK A;  1YJN T;  4AFZ C;  3CCM A;  3PTA A;  5GAM h;  3CCU Q;  1O9S A;  1P92 A;  3JSC A;  2VV5 A;  1WHG A;  3MEW A;  1W2B P;  4J9H A;  2Z0W A;  1JB0 E;  2QDY B;  4RTW A;  4EMK A;  1QCN A;  3CPF A;  2FRY A;  1ACM B;  4JZ3 A;  3PVL A;  1O75 A;  3CCJ T;  5A0D A;  1IO6 A;  3JCM Q;  1RLP C;  2O2O A;  2NUP A;  2ZCF B;  3LW5 E;  3BDL A;  1BI3 A;  2D0Q B;  4RMO A;  2B8A A;  1ZA2 B;  5GAN 2;  3G6E T;  4OF1 A;  2LC4 A;  4E6R A;  1U8R A;  2DIQ A;  2RD1 A;  4FU6 A;  2E4H A;  1IGQ A;  5GAM e;  1JU5 C;  4B6M A;  2E41 A;  3S3O A;  4B9X A;  3ULR B;  2KK4 A;  1M1K U;  4WCI A;  1D0X A;  2RQR A;  4EMH A;  1UJ0 A;  1ZHI A;  3LYI A;  1D1C A;  5KCO A;  4XAX B;  4Y28 E;  3OBW A;  1FX7 A;  4M78 B;  2LVM A;  1GBQ A;  3G6E A;  2VC8 A;  4QVC A;  4ESR A;  3MP1 A;  4LD6 A;  3DLM A;  2L0A A;  2CP7 A;  3QO3 A;  2K79 A;  4KH0 B;  1V29 B;  2G6F X;  2EYX A;  3M57 A;  1VYU A;  2HQX A;  5GAO r;  1IRX A;  5GAN e;  1S1N A;  5KYX B;  2RNA A;  1M8M A;  2CZ1 B;  1LJO A;  4FSS A;  5CKH A;  3C0C A;  1NZ9 A;  4PJO F;  3SD4 A;  4V2S A;  5CR2 A;  2V26 A;  4N4G A;  5IN1 A;  3RUX A;  3RES A;  2FYK A;  1SHG A;  3JB9 F;  4ELZ C;  3PFS A;  3RMS A;  1OYX A;  4XK8 E;  4JJB A;  5DLO A;  4JRI A;  4KGV B;  1VQ6 T;  2MPX C;  5KYY B;  3TCJ A;  3VYG A;  1IXD A;  1TOV A;  1NYF A;  2EFI A;  3AHU A;  4BAC A;  1UGQ B;  4PJO D;  1IB8 A;  2O01 E;  1SG5 A;  3LX7 A;  1YI2 T;  5GAO m;  4LN2 A;  1QVG S;  2XDP A;  4C0F A;  1NLO C;  2KQW A;  4J7I A;  1T3L A;  2PVD B;  4JRP A;  4JS5 A;  1D1B A;  2H8H A;  2OI3 A;  2QQA A;  1RL2 A;  4OMF B;  1W70 A;  2RM4 A;  1MV0 B;  1WJQ A;  1WIE A;  4J9G A;  4E2F B;  3INZ A;  1HJD A;  2PUO B;  2K9G A;  2HL3 A;  4DEX A;  2LNV A;  2MYS A;  2VXE A;  4QKU A;  2CDT A;  1LNX A;  4L5G A;  4QVZ A;  3SWN A;  4GY5 A;  1RAH B;  4Y92 A;  3EGU A;  1VUB A;  4ME7 A;  2F5T X;  3DB4 A;  2PU9 B;  3WVD B;  4C5I A;  3L2Z A;  2YRV A;  1NYG A;  1ZSG A;  2D0N A;  3CC2 T;  4BI4 A;  2MIO A;  1KC8 R;  2EQU A;  4GLK A;  5IHN A;  3LWH A;  1YJ9 A;  2E65 A;  2R5A A;  2EJF A;  1KD1 C;  2VGM A;  4M7D F;  3M9Q A;  3PT9 A;  2OX7 A;  4GBQ A;  2CUD A;  3OB9 A;  2CP0 A;  5GAM g;  5GAN 3;  5J39 A;  4M75 B;  3RKW A;  5CK9 A;  1YIJ Q;  2QAZ A;  2FPF A;  4LDW A;  2BZY A;  2AKL A;  2FL7 A;  3QHS A;  4M7D D;  4OMM A;  1VQ9 A;  3RR6 A;  1UJY A;  2GCX A;  4AT1 B;  3CCL Q;  5I2M A;  1YJ9 Q;  3KUF A;  3A8O B;  1AZE A;  1EZZ B;  2RJF A;  4LNP A;  1TG0 A;  3JCM J;  2ATC B;  4F7U E;  4OMN A;  4FSX A;  4ORZ A;  4KUL A;  3RER A;  1GBR A;  2M1H A;  2YUQ A;  1QW1 A;  3QWX X;  3QUI A;  5LJ3 g;  2GTO A;  2OTJ Q;  2EPD A;  2EQK A;  2YWW A;  3LH0 A;  2JS0 A;  2DL8 A;  5EC7 A;  3CCE A;  1YIT Q;  2EJG A;  4KT0 E;  3P8H A;  2LDM A;  5IT9 E;  4JDS A;  1VQO T;  2GGR A;  4OGC A;  1PRL C;  3MEV A;  1X6O A;  2V1Q A;  2KYB A;  2X9H A;  4IUU A;  1A0N B;  1G83 A;  2M0Y A;  4MZM A;  1VQ8 Q;  4MZP A;  3HRS A;  4C0D B;  2GF7 A;  3BDU A;  3C95 A;  4ZTF A;  2DL3 A;  5A0L A;  4KBM B;  4MZT A;  4PJO A;  4FYV B;  1KK7 A;  2JOY A;  4IUT A;  3I55 A;  3G6E Q;  2X4W A;  5GAM d;  3MP6 A;  3PIO A;  1MMD A;  3ASK A;  4E7J A;  1ZSZ B;  2HZY A;  1M4Z A;  1B34 A;  1WHJ A;  2J7I A;  2OTL T;  1SSH A;  2E5K A;  4AFU C;  4R55 A;  1X2K A;  2DXT A;  1IHV A;  1G3S A;  3CME Q;  1M90 U;  1G5V A;  3FLG A;  5GMK j;  3JB9 I;  4A4G A;  2OTJ A;  4GLM A;  2M9U A;  2QI2 A;  2AT1 B;  1BKB A;  1VQ7 A;  1QVG A;  2EKO A;  3SEM A;  4IIO A;  2QTV A;  3I56 A;  3GPL A;  3CQT A;  1BB9 A;  3QDR B;  1ABO A;  3CCM Q;  4J83 A;  2C0I A;  3BW1 A;  5GAN f;  4DEY A;  3T9N A;  3VS0 A;  1W2B S;  3WVE B;  1VQM T;  1AT1 B;  2AHJ B;  1H64 1;  1HSQ A;  4XTY A;  2RQU A;  4PFO A;  5LJ3 d;  2KVQ G;  1YJW A;  4M78 G;  1D1A A;  3FEO A;  4A4K A;  5GMK e;  3ZL7 C;  4OMP A;  1OQK A;  3JB9 D;  2JXB A;  3UA6 A;  2DK3 A;  5CAI A;  1LOJ A;  4J7F A;  2DXU A;  2LJ0 A;  4M75 E;  4M7A E;  4Z8A A;  2EYZ A;  3M54 A;  4PJJ A;  1IGU A;  1WPY A;  2AZS A;  1XQH A;  3M4Y A;  5LJ3 f;  5C6S A;  1H8K A;  2RH2 A;  5CCA A;  3URG A;  2ZPI B;  3JCM P;  4HT8 A;  1I81 A;  5HY6 A;  1TXQ A;  3L2W A;  5FLX E;  3EG3 A;  1UGV A;  4OMQ A;  2PVG B;  3I5R A;  4M75 A;  2KXD A;  2EWN A;  4M78 A;  3EHR A;  3OQ5 A;  3M0S A;  3SFM A;  4J9B A;  1VYT A;  5M9O A;  1K9M U;  3E9G A;  3V7S A;  5KE3 A;  3SHW A;  5IHK A;  2SRC A;  2ZPF B;  4M7A A;  1S72 Q;  3FDR A;  2X3X D;  3OYY A;  4C92 D;  4OGE A;  1SRM A;  3I9Q A;  1XNI A;  3CCV A;  3J80 E;  1X2Q A;  2EAY A;  1RUW A;  2HD0 A;  2HMA A;  2D8H A;  1ABQ A;  4XQ3 A;  2KDS A;  5FU7 C;  2YRD A;  3NTI A;  1MGQ A;  1YP5 A;  3FJP A;  1OX9 A;  5GAN 5;  5C0M A;  4HCZ A;  4JS4 A;  2EJ9 A;  4Y91 A;  3VU3 C;  4PLL A;  3LGF A;  1PCX A;  2QEX A;  2HBP A;  5IXB A;  2ROT A;  2L3P A;  3L2U A;  2XD0 A;  4AMC A;  3CD6 Q;  3M0U A;  4C0G A;  3EFO A;  1X27 A;  2XMF A;  1ZX6 A;  3I5S A;  5D6W A;  3E1S A;  3VKI A;  3OS5 A;  1M1G A;  2CS7 A;  4M77 D;  1G3Y A;  1K8A C;  4RTU A;  3HHT B;  3MPU B;  6AT1 B;  4IUP A;  2NUT A;  2JZ2 A;  2MOX A;  3ZBD A;  1S72 A;  1YIJ T;  4OB1 B;  2CP3 A;  4PJO B;  3F70 A;  2F2W A;  1H92 A;  3A8H B;  4PLI A;  2G3R A;  2ED1 A;  2DJZ A;  2AIR B;  1I5O B;  1PWT A;  2V8K A;  3MJX A;  1B34 B;  4J9I A;  1FYN A;  1PHT A;  4XTZ A;  5FWB A;  3RKX A;  2BUD A;  3AT1 B;  3A8G B;  1YWP A;  4Z88 A;  1WHM A;  4ELY C;  4M7A F;  2KXC A;  2YUO A;  4EMK B;  1JEG A;  5AYF A;  2X4Y A;  4PFP A;  4A54 A;  2LNH B;  2A28 A;  1YCY A;  1KHC A;  1EX4 A;  1CKB A;  1RAA B;  3M4G A;  3RKY A;  2DTI A;  1PG5 B;  4E7H A;  4X9D A;  3OS0 A;  2BKD N;  4PFZ A;  1VQP Q;  2OTJ T;  4CC2 A;  5LL6 S;  3VRZ A;  2RHX A;  1KQS S;  4DOW A;  1YIT T;  4DBH A;  3V7R A;  3G71 A;  3JCM d;  4C5G A;  3GOX A;  3OS1 A;  1LVK A;  1I5L A;  3NFC A;  2OAW A;  1JXM A;  5GMK h;  5D6X A;  3MP8 A;  1WZO A;  2HSP A;  4ZN3 A;  1OUL A;  3OYK A;  3CCU T;  2OTL A;  3EG1 A;  5IHI A;  1AHJ B;  5KCH A;  1VQ8 T;  4FIB A;  4RCC A;  1QVF S;  4C8Q D;  2E3I A;  3OS2 A;  3KXT A;  2W10 A;  1RAE B;  3OBY A;  2XI9 A;  4KUI A;  1XTD A;  1BI0 A;  4RG8 A;  2FVU A;  1K73 R;  5DY9 A;  3CCJ Q;  1M2V B;  2BZ8 A;  4EPC A;  1PKS A;  3VS5 A;  2RHZ A;  2RPN A;  1OI1 A;  2PVO B;  1QP3 A;  2JNG A;  3I56 T;  2K5I A;  1R0B G;  1VQ4 Q;  4JLG A;  1KHI A;  1E6H A;  4N4H A;  1RAB B;  4X1V A;  3O8V A;  4JPB W;  2VXF A;  3CC4 Q;  5GAN 6;  3UAT A;  3CME T;  1M1F A;  3SDZ A;  3EG0 A;  3JV3 A;  3PVQ A;  4Z02 A;  2Y90 A;  2D8J A;  2ROL A;  1Q7Y R;  1YN8 A;  3VV0 A;  2DM1 A;  1G3W A;  1M1K C;  3CCE Q;  5FRO A;  5GAN 8;  1YHQ A;  4M7A C;  1VOM A;  3VJP A;  1D0Z A;  1Q86 R;  3QYG B;  1VQP A;  1VQM Q;  1BCO A;  2FB7 A;  4KH1 B;  4MML A;  3FC3 A;  4RKU E;  1WJR A;  1WHH A;  3TSW A;  5HK3 A;  2JW4 A;  3MCA B;  4RTX A;  3GBQ A;  3O5Z A;  2QQS A;  4J5Y A;  2XID A;  3Q1J A;  1PSE A;  1TUD A;  1WYX A;  1Y7X A;  3OYN A;  5FRM A;  1KG1 A;  1TH7 A;  1U1S A;  4EIK A;  1KQ1 A;  3OW2 A;  3OSV A;  2CSI A;  2DAQ A;  4C92 B;  3TEE A;  2QTX A;  4VUB A;  4EMK C;  2JS2 A;  3KFV A;  2VWF A;  4IUR A;  4M78 C;  4QQD A;  2QEX T;  2KRN A;  4PJO E;  5A2Q E;  3C94 A;  1TU0 B;  2X4X A;  1E6G A;  5GAN j;  4DQ2 A;  2P0K A;  1FMV A;  3A1P A;  1AVZ C;  2HL5 C;  5KYW A;  3I55 T;  3OYA A;  4BB7 A;  1OEB A;  2E5Q A;  5CQY A;  2J6K A;  2EW3 A;  2LX7 A;  2H3E B;  4J6X A;  4PL6 A;  1S72 T;  1WHL A;  1SEM A;  2KY9 A;  2NUT B;  2HQE A;  2YLC A;  2YUN A;  2KSS A;  3NMZ C;  1U3O A;  2QQB A;  2LJ3 A;  3OY9 A;  3JB9 G;  2XDB A;  2MCN A;  2W0Z A;  2HQH A;  2DMO A;  1R8O B;  4HVU A;  1X6B A;  3G1J A;  1VQ9 Q;  4M75 G;  2DL5 A;  2A36 A;  4O6J A;  5KYW B;  4PK4 A;  1K0X A;  2DTH A;  2J6F A;  2JMA A;  2ZPG B;  1TUC A;  4B9W A;  4RTY A;  4M78 D;  3GF5 A;  4ZGD B;  4BY6 C;  2QQR A;  3CMA A;  1Z9Q A;  3CD6 T;  1NM7 A;  3JRZ A;  3OYH A;  1UEB A;  1KSW A;  4JUV A;  3EH1 A;  3I35 A;  2DBM A;  1LCK A;  2RHI A;  1M90 C;  1XJW B;  1I1J A;  3SB2 A;  5LJ5 j;  3PMT A;  3OYM A;  1Q95 G;  2LQK A;  3HRU A;  2X51 A;  3M0P A;  2QGG A;  4M7A B;  4M7D C;  4QW2 A;  3JCM h;  1OPL A;  4F14 A;  2FPD A;  2KRO A;  3OYL A;  4Q5W A;  1FWZ A;  3DLL A;  3CC4 A;  5J26 A;  1RI0 A;  5CKB A;  4FYX B;  3QJ6 A;  2SEM A;  2ECZ A;  2L3Q A;  2RN8 A;  2YT6 A;  1MUZ A;  4JZ4 A;  2EKH A;  4LDY A;  3QPH A;  4M4Z A;  4C5H A;  4PJO G;  2DEU A;  2CKK A;  1PRM C;  1HK9 A;  1WX6 A;  4C0Z A;  3C4S A;  3H41 A;  8ATC B;  1TWB A;  1OZ3 A;  5IH2 A;  1M3C A;  1Z9Z A;  1SRL A;  2BIV A;  2MI6 A;  4C92 C;  3CXC P;  2QAS A;  3M0R A;  1UFF A;  3NTH A;  2XDD A;  3ZFJ A;  4R0K A;  1VQL T;  1U5S A;  3PE0 A;  1YIJ A;  1B7T A;  1MV3 A;  1K8A R;  2YSQ A;  2K4Y A;  2GBQ A;  3EGD B;  3CCS Q;  4HVW A;  4HCK A;  2QA4 T;  4C8Q E;  4RTZ A;  1D0Y A;  2LQ8 A;  2CP6 A;  4KGX B;  4M7D E;  3THK A;  1VQO Q;  2KI7 A;  1AD5 A;  1WI7 A;  1OX8 A;  4N0A A;  4AG1 C;  3JCM c;  3EFO B;  5LJ5 f;  2DL4 A;  5GJV B;  3G4S A;  2L89 A;  4RTT A;  5CKE A;  3ME9 A;  4FYW B;  2EQJ A;  4LDX A;  1NJI U;  2JN0 A;  1X75 C;  7AT1 B;  3H0I A;  1YJW T;  1RLQ C;  5GJW B;  4F17 A;  1QWE A;  1JJ2 A;  2ZGW A;  2RQT A;  1PD0 A;  4Z89 A;  3G71 T;  1VQN Q;  2VGN A;  2EQM A;  1BCM A;  2CP2 A;  2LQN A;  1N9R A;  3A8M B;  2CH4 A;  3QII A;  2V8I A;  1WHK A;  4XTX A;  2EQI A;  4JJC A;  3JB9 J;  4HCC A;  1YCS B;  2DNU A;  3UDC A;  3X25 B;  2ESW A;  2RHU A;  3HP9 A;  1N27 A;  3M55 A;  4RCB A;  2DVJ A;  4M7A D;  4K11 A;  5KYU B;  3CCQ T;  3CCM T;  1TS9 A;  1KQS P;  5KYN A;  4WTO B;  2BE9 B;  2WSE E;  1RI9 A;  5HK0 A;  5GMK m;  2ZAE A;  5CKD A;  3QBY A;  1N8R R;  1OPK A;  1SSF A;  1M2V A;  3CCR A;  3S3N A;  3EH2 A;  4M7D A;  4F7U A;  5IAY A;  2X3W D;  1V1C A;  2V1R A;  3OMG A;  4JRQ A;  3QJY A;  1VQ5 T;  4RUG A;  2RF0 A;  4C8Q G;  3PNW C;  2XKO C;  4AFQ C;  2P4T A;  1YHQ T;  1PC0 A;  1X01 A;  2CP5 A;  3M0Q A;  3M5A A;  1G2B A;  2PTK A;  3OA6 A;  3VS2 A;  4XU2 A;  1PSF A;  4OMO A;  4DBR A;  4NS5 A;  2EGA A;  4FW1 A;  1PNJ A;  2A08 A;  3I55 Q;  2NWM A;  4FM4 B;  5FU6 C;  3PGG A;  2RK1 A;  1W4S A;  2CSQ A;  2JTE A;  2PZ1 A;  2RJD A;  2O9V A;  3RDV A;  1KQS A;  2EVR A;  2DRM A;  2D9T A;  5LJ3 e;  5EG2 A;  4F7U B;  1MMG A;  2DXC A;  1BK2 A;  1QCF A;  4E7S A;  2DF6 A;  4WF2 A;  4ZNX A;  1WA7 A;  1CKA A;  2CZ0 B;  4A4F A;  2RI3 A;  3GNG A;  2F2V A;  1NJI C;  1WQW A;  1Q82 C;  3GIB A;  1VQ9 T;  3CPW S;  4MMK A;  1VQK Q;  1RAC B;  4EMG A;  4M7D G;  1GFD A;  4JJN K;  1HD3 A;  5I11 A;  2HCK A;  3ER0 A;  4FYY B;  2A7Y A;  5A0G A;  3VRY A;  5J3B A;  3MKD A;  4HVV A;  2DD4 A;  4LE9 A;  2MF2 A;  1N9S A;  2RI2 A;  4OVA A;  3LLR A;  9ATC B;  3QZ5 B;  1ZBJ A;  5KYX A;  4F04 B;  2XU8 A;  3EGD A;  3X20 B;  5LJ5 d;  1IZ6 A;  1M3B A;  2M51 A;  4X34 A;  1NLP C;  3CBM A;  4D8D A;  1HXD A;  2HDA A;  2E70 A;  2VKN A;  4D6W A;  4R56 A;  4PKC C;  2K7A A;  2CYZ B;  1K9A A;  2E6Z A;  1YJN A;  1VQ8 A;  1MHN A;  3HKS A;  2PQW A;  1X6G A;  4ZTJ A;  1K9M R;  2COW A;  2L3R A;  2I2L A;  2X35 A;  1WLP B;  2QA4 A;  2LCC A;  2JM9 A;  5CVI A;  3FB9 A;  1QQJ A;  1GRI A;  4C8Q A;  5I2S A;  1AWO A;  4KGZ B;  1UGR B;  2KT8 A;  2LRQ A;  2I0N A;  4M78 E;  5AT1 B;  3SWN B;  2IG0 A;  4A63 B;  2L2P A;  3GNF B;  1VQL Q;  3CCV Q;  2RB6 A;  1WNL A;  2KE9 A;  1IHW A;  1B3Q A;  2GTJ A;  3L1A A;  1W6X A;  2DZ9 A;  1QKX A;  2QA4 Q;  4P5N A;  3JCM W;  2CT3 A;  2ENM A;  4LUD A;  5L8R E;  3S3M A;  5I22 A;  2C06 A;  2MWP A;  4II1 A;  1VQN A;  2FZG B;  3LH5 A;  4OP0 A;  2DET A;  3UPU A;  4XTV A;  5HCK A;  5GMK i;  4LXC A;  2DLP A;  1ZUY A;  1JO8 A;  1EIF A;  1N8R U;  5KYU A;  5CO7 A;  3CMA Q;  4C8Q C;  2MMP A;  1M2O A;  3FIF A;  1YJW Q;  1WJS A;  4CC3 A;  2D6F A;  2QGF B;  1ZA1 B;  2JMC A;  2LX9 A;  3OMC A;  3J81 E;  3VUZ A;  1SHF A;  5IXF A;  4IUV A;  2RO0 A;  4JJD A;  3CCL A;  3HSB A;  4HKE A;  3VS4 A;  3I56 Q;  1XOV A;  1WGS A;  3G71 Q;  1VQN T;  4DBF A;  1VQ4 T;  4L6V 5;  2EGC A;  1FMK A;  3UT1 A;  3GP8 A;  5L23 A;  1BBZ A;  2M0O A;  2P84 A;  3BY7 A;  3CC4 T;  1N8R C;  1YWO A;  2DER A;  2O31 A;  1C1A A;  1N5Z A;  4M77 A;  3CC7 Q;  3UF4 A;  4XTU A;  3QDF A;  2PNI A;  4J6Y A;  2XK0 A;  3EGX A;  2LCS A;  1H3H A;  2DFU A;  2E12 A;  3V8K A;  1KD1 R;  5FRN A;  3CCE T;  1AWX A;  2AZV A;  2QK0 A;  4C8Q F;  1PKT A;  1TTH B;  5GMK l;  4QT7 A;  1VQL A;  4MDW A;  1PM3 A;  3EG2 A;  2CH4 W;  2X4J A;  1KQ2 A;  3S6W A;  2L5Q A;  2AKK A;  3MET A;  1J3T A;  1K8A U;  2GNC A;  3G4S Q;  1UUE A;  3A8L B;  2YLB A;  2WAC A;  1SF9 A;  2DD5 A;  3CCJ A;  3P8D A;  1T0H A;  4N0A C;  3TRE A;  2ABL A;  5CQX A;  2BE7 D;  5LJ3 j;  1OU8 A;  2GFA A;  3D7S B;  4AFS C;  4M77 C;  3IQL A;  3REB B;  1JJ2 S;  1VQ5 Q;  2DVE A;  4N4I A;  2XIC A;  4ZN1 A;  1OZ2 A;  4BDY A;  2O4X B;  4ZGE B;  2R57 A;  3TQ7 P;  1YHQ Q;  4HA8 A;  1NPP A;  3L2Q A;  1FMW A;  2DE0 X;  4OML A;  4CRI A;  2K6D A;  2VAS A;  2KT1 A;  2QEX Q;  1C0M A;  4E7K A;  3H6Z A;  4LUE A;  2DRK A;  1VQK A;  1WFW A;  3CBP A;  3CCR T;  1RAF B;  3TU4 K;  1Q86 C;  1VQ7 Q;  4M77 E;  2LMJ A;  1ZBX A;  3CC2 A;  2LCL A;  5CKF A;  2K3B A;  1WQ7 A;  1Y07 A;  2E3H A;  3LGL A;  3L2R A;  4J6W A;  2YXY A;  4C8Q B;  4BD3 A;  3E9F A;  4PJO C;  3QYH B;  3OYB A;  1Q81 C;  1VQK T;  2DJQ A;  2R5M A;  4F16 A;  3NTK A;  5DM7 R;  4DOV A;  3VYH B;  1M30 A;  4QVD A;  1ARK A;  4J9E A;  2LTO A;  4BI8 B;  1K0S A;  3MO8 A;  1UB4 A;  2A3L A;  2FO0 A;  4FL6 A;  1D3B B;  2YUP A;  1DJ7 B;  1F1B B;  4XU3 A;  2CZ6 B;  4HT9 A;  5LJ5 e;  4KUD K;  1AWW A;  1MNE A;  3HTR A;  3E19 A;  1SPK A;  4UC4 A;  2K3X A;  3VS7 A;  5DLQ E;  1G3T A;  2FPE A;  1MMA A;  3C12 A;  3DB3 A;  1Q86 U;  1KJW A;  1OU9 A;  4IUQ A;  2DKG A;  2MWO A;  2KRS A;  3QWY A;  5HKC A;  2QYZ A;  2RJE A;  4FW2 A;  1D3B A;  3CC7 A;  1M8V A;  3CCU A;  1NBE B;  3BFM A;  3CPW P;  1VYV A;  1PD1 A;  1Q81 U;  5CIU A;  3OYI A;  1NPR A;  2HSE B;  3EAE A;  2P0Q A;  2F1L A;  4ATO A;  3EGX B;  1QVF A;  2HNI A;  3EG9 B;  2A37 A;  4J9F A;  4PJM A;  4C5E A;  2EYY A;  5LJ5 g;  3OYJ A;  3DKM A;  2AK5 A;  1YNZ A;  4RG2 A;  4C92 F;  4FT4 A;  1VIF A;  2L8D A;  4MDX A;  3CCS T;  4M75 D;  2KR3 A;  1AEY A;  1C6V X;  1UTI A;  2WSF E;  2M16 A;  2JUF A;  2CGH A;  2ZZD A;  3VS3 A;  4A4E A;  2Y4X A;  3X28 B;  1VIE A;  1ZSZ A;  1NE8 A;  1Q7Y U;  3G7Z A;  1Y96 B;  4D8K A;  2ED0 A;  3FJ5 A;  3OYE A;  3SWN C;  3P8B B;  4M78 F;  3CMA T;  3EFR A;  2DA9 A;  4M75 F;  5LJ5 h;  1QCO A;  1KC8 C;  3JAM E;  3QSU A;  1BI1 A;  4F7U F;  2COZ A;  2MAM A;  1YI2 Q;  3RNJ A;  1UDL A;  2IVW A;  1E7O A;  2WSC E;  2GQI A;  3MEA A;  2RMO A;  2L3S A;  4HXJ A;  2E6N A;  3CCQ A;  3M56 A;  3OYG A;  2EIF A;  5GAO p;  1K76 A;  4XTW A;  1MND A;  1Q81 R;  2EBP A;  2P0P A;  2IIM A;  3UWN A;  2QXF A;  4JLI A;  2DIL A;  5KE2 A;  1Y96 A;  1QVP A;  3RIR A;  2JT4 A;  2GFU A;  1YIT A;  1TUG B; 
#chains in the Genus database with same CATH homology
 2F2V A;  4ESR A;  4CC2 A;  3VRZ A;  2L0A A;  2K79 A;  1GFD A;  1NEB A;  2G6F X;  2NUZ A;  2EYX A;  1HD3 A;  1OOT A;  5I11 A;  2HCK A;  2OAW A;  1JXM A;  3VRY A;  1VYU A;  2HSP A;  2J6O A;  1WDX A;  1AOJ A;  3EG1 A;  4HVV A;  5IHI A;  2KRM A;  1EFN A;  1S1N A;  4LE9 A;  2RNA A;  1M8M A;  3U23 A;  3NHN A;  4FSS A;  2W10 A;  3C0C A;  1K1Z A;  2BZ8 A;  1ZBJ A;  1SHG A;  2JM8 A;  1PKS A;  3VS5 A;  2DX1 A;  1M3B A;  2M51 A;  1NLP C;  2RPN A;  4D8D A;  2KBT A;  2HDA A;  4JJB A;  4IIM A;  3TSZ A;  2VKN A;  1ZLM A;  1E6H A;  1GCQ A;  2K7A A;  1U06 A;  4KRT A;  1K9A A;  1NYF A;  4X1V A;  2P4R A;  1K4U S;  1X6G A;  4JPB W;  1UG1 A;  3UAT A;  4LN2 A;  1WLP B;  3EG0 A;  3R6N A;  3JV3 A;  2JM9 A;  1Y0M A;  3PVQ A;  1NLO C;  1T3L A;  2D8J A;  1GRI A;  2ROL A;  1QKW A;  1YN8 A;  2C0O A;  2DM1 A;  1T3S A;  3UA7 A;  2H8H A;  2OI3 A;  1W70 A;  1AWO A;  2KT8 A;  1MV0 B;  2I0N A;  2DYB A;  1WIE A;  4J9G A;  4CC7 A;  1HJD A;  2K9G A;  4A63 B;  2F2X A;  4DEX A;  2L2P A;  2FEI A;  2CDT A;  2LZ6 B;  2KE9 A;  1B3Q A;  1UHC A;  2BZX A;  2GTJ A;  1KIK A;  1NG2 A;  1W6X A;  2BTT A;  4Y92 A;  3TSW A;  1QKX A;  3EGU A;  2CT3 A;  2ENM A;  4LUD A;  2JW4 A;  4RTX A;  3GBQ A;  3O5Z A;  5I22 A;  1AWJ A;  3LH5 A;  1NYG A;  1ZSG A;  2D0N A;  1TUD A;  1WYX A;  2MIO A;  3TVT A;  2QDL A;  5HCK A;  1UEC A;  1QLY A;  5IHN A;  2DLP A;  1ZUY A;  4EIK A;  2CSI A;  1JO8 A;  1NEG A;  4GBQ A;  2CUD A;  2JS2 A;  2K2M A;  3KFV A;  2VWF A;  4CC3 A;  2KNB B;  2JMC A;  2KRN A;  1JQQ A;  1E6G A;  1SHF A;  5IXF A;  2FPF A;  2BZY A;  2AKL A;  2LQW A;  4JJD A;  1AVZ C;  3VS4 A;  1XOV A;  2B86 A;  1OEB A;  4OMM A;  5FWC A;  1UJY A;  2J6K A;  2EGC A;  1FMK A;  2EW3 A;  2LX7 A;  2J05 A;  3VS1 A;  5L23 A;  1BBZ A;  1AZE A;  2HBW A;  1Y57 A;  1YWO A;  4LNP A;  2O31 A;  1TG0 A;  1SEM A;  1N5Z A;  3UF4 A;  2PNI A;  2YUN A;  3NMZ C;  4OMN A;  1X43 A;  1U3O A;  2LJ3 A;  2LCS A;  4CC4 B;  3M0T A;  3H0H A;  1H3H A;  4ORZ A;  2MCN A;  1GBR A;  2W0Z A;  1AWX A;  2AZV A;  2YUQ A;  1PKT A;  4QT7 A;  2DMO A;  3QWX X;  2HEQ A;  2LJ1 A;  4HVU A;  1X6B A;  2GTO A;  2DL5 A;  2CH4 W;  1QWF A;  2EPD A;  3EG2 A;  2AKK A;  2A36 A;  2JS0 A;  2DL8 A;  5EC7 A;  4J9C A;  1ZUU A;  1K0X A;  1J3T A;  2J6F A;  2JMA A;  2GNC A;  2DBK A;  2GGR A;  1TUC A;  4RTY A;  1PRL C;  1UUE A;  2CUB A;  3A98 A;  1T0H A;  2V1Q A;  2KYB A;  2ABL A;  1A0N B;  2RQW A;  1Z9Q A;  1G83 A;  1NM7 A;  2O9S A;  2M0Y A;  4J9D A;  1OV3 A;  3NGP A;  2KEA A;  3RBB B;  1KSW A;  2EYW A;  1B07 A;  2J06 A;  4AFS C;  2D1X A;  3IQL A;  3I35 A;  3REA B;  3REB B;  2DBM A;  1LCK A;  1I1J A;  2DL3 A;  2DE0 X;  4OML A;  3M0P A;  2K6D A;  4AG2 C;  2KT1 A;  1I07 A;  1KFZ A;  1OPL A;  4F14 A;  2FPD A;  2KRO A;  4LUE A;  5FW9 A;  1CSK A;  2DRK A;  1VA7 A;  1WXT A;  3H0F A;  2J7I A;  1SSH A;  1WFW A;  2E5K A;  4AFU C;  1X2K A;  5ECA A;  2SEM A;  2ECZ A;  2L3Q A;  2RN8 A;  2YT6 A;  3EHQ A;  1MUZ A;  2KYM A;  4JZ4 A;  2EKH A;  4M4Z A;  4GLM A;  2LMJ A;  1PRM C;  1WX6 A;  3H41 A;  1GCP A;  3SEM A;  1I0C A;  1W1F A;  4IIO A;  2K3B A;  5IH2 A;  1M3C A;  2YDL A;  2CT4 A;  1Z9Z A;  1SRL A;  3CQT A;  1BB9 A;  3M0R A;  1ABO A;  1UFF A;  1X69 A;  2CRE A;  2C0I A;  4R0K A;  1U5S A;  3PE0 A;  3VS0 A;  4DEY A;  1MV3 A;  2YSQ A;  1AZG B;  2DJQ A;  2GBQ A;  1WXU A;  1HSQ A;  2RQU A;  4HVW A;  4HCK A;  4F16 A;  1GFC A;  4RTZ A;  1T0J A;  1M30 A;  1ARK A;  4J9E A;  1K0S A;  3THK A;  3ZL7 C;  2FO0 A;  4OMP A;  1AD5 A;  1WI7 A;  2JXB A;  3UA6 A;  4AG1 C;  2FG0 A;  2YUP A;  2KGT A;  2LJ0 A;  4Z8A A;  2EYZ A;  2DL4 A;  2AZS A;  4RTV A;  5GJV B;  4RTT A;  1AWW A;  1GL5 A;  1H8K A;  3NPF A;  1SPK A;  1GCQ C;  3VS6 A;  3H0I A;  3VS7 A;  1RLQ C;  2FRW A;  5GJW B;  2FPE A;  4F17 A;  1QWE A;  2RQT A;  4Z89 A;  3EG3 A;  1UGV A;  4OMQ A;  1KJW A;  3I5R A;  2KXD A;  1M27 C;  3EHR A;  3M0S A;  2KRS A;  4J9B A;  1VYT A;  3QWY A;  2LQN A;  1ZUK A;  2CH4 A;  3SHW A;  5IHK A;  2SRC A;  2EQI A;  4JJC A;  2X3X D;  1UE9 A;  2OJ2 A;  1VYV A;  2LP5 A;  2VVK A;  1YCS B;  2DNU A;  2DL7 A;  1SRM A;  3I9Q A;  2C0T A;  2ESW A;  1X2Q A;  1RUW A;  1JXO A;  2EGE A;  2D8H A;  2DVJ A;  1ABQ A;  1BU1 A;  4K11 A;  1UHF A;  2A37 A;  2RQV A;  4J9F A;  2EYY A;  1YP5 A;  1WXB A;  2AK5 A;  1YNZ A;  1M3A A;  1RI9 A;  2O88 A;  1OPK A;  2KR3 A;  4AFZ C;  1AEY A;  1UTI A;  5IXB A;  2ROT A;  4J9H A;  2L3P A;  3VS3 A;  2X3W D;  4RTW A;  3M0U A;  1V1C A;  1X27 A;  2XMF A;  1ZX6 A;  3I5S A;  2FRY A;  2V1R A;  4JZ3 A;  3PVL A;  4D8K A;  2ED0 A;  4RUG A;  3FJ5 A;  2RF0 A;  1IO6 A;  4AFQ C;  4RTU A;  2DA9 A;  1RLP C;  2O2O A;  2MOX A;  3M0Q A;  1G2B A;  2PTK A;  3VS2 A;  4OMO A;  4E6R A;  2EGA A;  2F2W A;  1PNJ A;  2A08 A;  1H92 A;  2NWM A;  3RNJ A;  2ED1 A;  1UDL A;  2JTE A;  2CSQ A;  2PZ1 A;  1E7O A;  1JU5 C;  2GQI A;  2O9V A;  2RMO A;  1PWT A;  2EVR A;  2L3S A;  4HXJ A;  2DRM A;  3ULR B;  4J9I A;  1FYN A;  1K76 A;  1PHT A;  4WCI A;  2RQR A;  5FWB A;  2EBP A;  1YWP A;  4Z88 A;  1UJ0 A;  2IIM A;  2KXC A;  1BK2 A;  1QCF A;  2DIL A;  2YUO A;  2DF6 A;  1JEG A;  4ZNX A;  1WA7 A;  1CKA A;  2LNH B;  2A28 A;  2JT4 A;  1GBQ A;  1CKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...