2J6OA

Atypical polyproline recognition by the cms n-terminal sh3 domain. cms:cd2 heterotrimer
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atypical Polyproline Recognition by the Cms N-Terminal SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords CD2-ASSOCIATED PROTEIN
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2j6oA00
1T3SA 1K76A 1K4US 2LCSA 2SRCA 2FPFA 2K7AA 1GCQC 4OMMA 1CSKA 1KJWA 5HCKA 1BU1A 1J3TA 3VS1A 1Y57A 2RQRA 1NYFA 2EKHA 4J9HA 4OMPA 2ECZA 3NHNA 2D8HA 1M3CA 2EGCA 1N5ZA 2EYXA 1JXMA 2RN8A 1G83A 2KRSA 2YUQA 2EYZA 4JZ4A 2FG0A 1BBZA 1WA7A 2H8HA 2CH4A 1KFZA 1UDLA 2DA9A 2FPDA 2PTKA 1PRLC 3M0SA 4J9FA 3EHRA 2DJQA 1MUZA 3REAB 1AOJA 3R6NA 2VWFA 3PVLA 1WIEA 1G2BA 1M8MA 3H0IA 2X3XD 1AZEA 2EYYA 3M0QA 2HSPA 5I11A 1WXUA 4M4ZA 4AG1C 2NUZA 2YUNA 2BZ8A 2YSQA 5IHIA 1JQQA 1E7OA 1GL5A 1YWOA 1E6HA 2O31A 4ZNXA 2V1RA 2KXDA 4AFSC 1PKTA 4J9IA 1HD3A 4A63B 3RBBB 2JS0A 4QT7A 2GGRA 1HSQA 1GFDA 1W70A 1GRIA 1AWJA 1I0CA 1VYTA 2JW4A 1UE9A 2GBQA 1T0HA 2GNCA 1AVZC 1UECA 1PRMC 2HEQA 2RPNA 1H8KA 3THKA 2LZ6B 2RNAA 2F2XA 2LJ0A 4LNPA 2JS2A 5IH2A 1NM7A 4OMOA 3M0UA 4HVWA 4HXJA 2A37A 1UHFA 1NLOC 3VS2A 1M27C 3I9QA 1RI9A 2DX1A 1ZUKA 2JMAA 3KFVA 2C0OA 2DBMA 3I5RA 4GBQA 1BK2A 3EG3A 3TSWA 1WYXA 2J06A 2F2VA 2E5KA 1ZBJA 2O2OA 2MOXA 2RQUA 1SSHA 2YUOA 2KRNA 4DEXA 1HJDA 2CSIA 3RNJA 1FMKA 1Y0MA 4J9CA 1S1NA 1K0SA 1OPKA 2RMOA 1OV3A 4RUGA 2DRMA 2YDLA 2LMJA 1U5SA 3M0TA 4AG2C 1ARKA 4R0KA 1WFWA 2M0YA 2JM8A 4J9GA 2D0NA 1JU5C 2CT4A 2RQTA 3CQTA 4RTZA 3VS4A 3UA7A 2DBKA 2C0TA 2L3QA 2CH4W 1A0NB 4J9EA 4IIMA 1M3AA 4CC2A 2A36A 4ORZA 3VS6A 1WXBA 3SEMA 1WDXA 1NEGA 2B86A 3VS7A 2AZVA 3REBB 2HBWA 2YT6A 2BZXA 1H3HA 1JXOA 3TSZA 2I0NA 1CKAA 3QWXX 1VYVA 2PNIA 1H92A 2KRMA 1KIKA 1TUDA 3PVQA 2HDAA 2D1XA 1GCQA 1K0XA 2FRWA 3SHWA 1MV3A 1T0JA 1ABQA 3NGPA 2DILA 2AK5A 2O9SA 1WLPB 2ED1A 2KNBB 2W10A 2X3WD 3QWYA 2A28A 4HCKA 2DL8A 2ENMA 2HCKA 4AFQC 1NG2A 2DE0X 2J6KA 1JEGA 1B07A 5FWCA 1QCFA 2L3PA 4CC7A 2ROTA 3PE0A 2MIOA 1I07A 4FSSA 2LQNA 4LN2A 4F16A 3LH5A 2FPEA 2KBTA 2ESWA 2BTTA 3TVTA 3NPFA 1TG0A 2K2MA 2OAWA 2J05A 1Z9QA 2J6FA 2KXCA 2EBPA 2D8JA 1EFNA 1WXTA 4E6RA 3C0CA 1RLPC 2P4RA 4OMNA 1E6GA 2CSQA 1PWTA 2L0AA 1AZGB 1VA7A 2KEAA 1TUCA 1K1ZA 2KYBA 2EGAA 1CKBA 2F2WA 1UJ0A 4CC3A 2RQVA 1ZUYA 1QKXA 1VYUA 2CREA 2CUDA 4OMLA 1UFFA 2DNUA 1UTIA 4JZ3A 2EQIA 5FWBA 1YWPA 2GTJA 2KYMA 1GFCA 1FYNA 4LE9A 5EC7A 2DL7A 1NYGA 2OJ2A 3VRYA 4AFZC 1WI7A 2CT3A 1T3LA 1X6BA 2DLPA 1M3BA 2FEIA 2PZ1A 5IXFA 2AKLA 4F17A 2YUPA 1UGVA 2VKNA 1JO8A 2G6FX 4RTYA 2O88A 1SHGA 2AZSA 1U3OA 4X1VA 2ROLA 4Z8AA 5I22A 4D8KA 1QWFA 2GQIA 3IQLA 4J9BA 4GLMA 2ABLA 4IIOA 4JPBW 1W1FA 2CDTA 3EG2A 1XOVA 3VS3A 4ESRA 1NEBA 3VS5A 2JXBA 3O5ZA 2IIMA 2AKKA 5L23A 1SRMA 1PNJA 1ABOA 2M51A 2QDLA 2DYBA 2SEMA 5IHKA 2BZYA 1YNZA 2K6DA 2O9VA 2JTEA 2DL3A 4DEYA 4RTVA 2EGEA 1UHCA 3I35A 2J7IA 1OPLA 2LX7A 2EYWA 5FW9A 1RLQC 2DF6A 2K79A 3GBQA 2FO0A 3U23A 3ZL7C 2W0ZA 4EIKA 4Z89A 1K9AA 1SRLA 1SHFA 1OOTA 4CC4B 4LUEA 2RQWA 2CUBA 2JT4A 1V1CA 2KE9A 1B3QA 1ZUUA 1AWXA 2ED0A 1PHTA 2FRYA 1KSWA 3H0FA 1Z9ZA 2LP5A 3JV3A 5GJWB 3UATA 2DRKA 3UF4A 2MCNA 5IHNA 2DL4A 1M30A 1W6XA 1GCPA 1QLYA 2DVJA 2NWMA 2V1QA 1AD5A 3EG0A 3I5SA 4Y92A 5IXBA 4JJCA 2KR3A 4HVVA 4Z88A 4RTUA 2KT1A 1SPKA 1UUEA 4JJDA 1X43A 3NMZC 1X6GA 3M0RA 2LJ3A 1IO6A 2J6OA 4JJBA 1AWOA 1AEYA 1YP5A 2DM1A 1X2KA 2VVKA 3H41A 3ULRB 1I1JA 4RTXA 2C0IA 4OMQA 2K3BA 4RTTA 1LCKA 3VRZA 3A98A 1GBRA 2EVRA 1PKSA 1AWWA 4HVUA 1SEMA 1YCSB 2KROA 2KT8A 5ECAA 4KRTA 1UJYA 2L3SA 3H0HA 4F14A 1RUWA 2L2PA 2GTOA 1QWEA 2DMOA 2KGTA 2LQWA 1ZSGA 2JM9A 4WCIA 3M0PA 2K9GA 4D8DA 1UG1A 2A08A 2EW3A 2JMCA 5GJVB 1U06A 1X27A 1QKWA 3FJ5A 1ZLMA 1NLPC 3EGUA 4RTWA 3EG1A 2EPDA 2LNHB 1GBQA 2DL5A 1X2QA 4K11A 3UA6A 4LUDA 1OEBA 4J9DA 1YN8A 1MV0B 1X69A 3EHQA 4AFUC 2LJ1A 2OI3A 2XMFA 3VS0A 1WX6A 1ZX6A 2RF0A 1BB9A
chains in the Genus database with same CATH superfamily
1TOVA 3MEWA 1T3SA 1K76A 4L6V5 4C8QD 1K8AU 1G3TA 2SRCA 2E10A 4OMMA 1QVFS 1WJQA 1OI1A 3TCJA 1P92A 2I2LA 1WHMA 3PGGA 1OYXA 2YLBA 4J7FA 2HZYA 2COWA 4OMPA 5LL6S 2ECZA 2Y4XA 4F7UB 3CMAA 1EIFA 5GANe 3C95A 4XTYA 2EYQA 2YUQA 1XJWB 3JB9H 4OB0B 1KFZA 2PTKA 1YJNA 1VQKA 3CC2A 2DXCA 3CCQQ 5GAN2 3A5ZB 2K2VA 2VXFA 3PVLA 2NYSA 2CZ1B 1G2BA 2JNGA 1M8MA 1KC8C 1WGSA 1S72T 2EYYA 3OQ5A 2HSPA 5I11A 2K4YA 2DERA 2JVVA 2YSQA 2DKGA 4C8QG 2QQRA 4B6MA 2KXDA 2M16A 5CKDA 2BUDA 3TREA 3RBBB 1RL2A 1AWJA 3JCMd 1UE9A 4C0DB 5HKCA 1T0HA 4C8QA 4QKUA 2RPNA 4M7AE 2XDPA 1M90C 2F2XA 2LZ6B 4FW2A 5IH2A 2DXBA 1NM7A 1G5VA 3VKIA 1M27C 3LGLA 1RI9A 4RCCA 2DXUA 2R5AA 2JMAA 3KFVA 5GAOq 2C0OA 4GBQA 1B7TA 1Q82U 3M57A 2HD0A 1WYXA 2J06A 2OTJT 3HTRA 2MOXA 1TTHB 2YUOA 4R55A 4PJMA 1MNDA 2ZPIB 1HJDA 3OYGA 5LJ3f 2LVMA 4M78E 1I81A 4XU0A 2RMOA 2LMJA 1TXQA 4AG2C 3MEVA 4R0KA 1M1KR 1WFWA 4DOWA 3V7RA 1QCNA 1W2BA 4J9GA 1VQ6T 2M02A 3OYMA 2D0NA 2XIDA 4M7DE 4V2SA 1VQ9A 4PFOA 3PTAA 2E12A 3CQTA 4RTZA 3MEAA 1YI2T 3UA7A 5CO7A 4Y28E 3JAME 2DBKA 4KUDK 3OW2S 2L3QA 4M75D 4XQ3A 1Q95G 5GAN6 4IIMA 4X9DA 3RR6A 4WTOB 1Q81C 1N9RA 2F5KA 5CCAA 1R8OB 5LJ3e 2AZVA 1BKBA 1WHHA 2YT6A 4P5NA 3KBGA 2I0NA 5CQYA 2L5QA 3HFNA 1H92A 2KRMA 2P0KA 1KIKA 1B34A 3PVQA 3BW1A 1SKUB 2FZCB 4E7LA 3QHSA 1VQKQ 5GANh 1YFNA 4ELZC 1LJOA 3SHWA 2E6ZA 4M77B 1ABQA 2CP0A 1VQ5T 4PJOA 1WLPB 3C12A 3G4SA 2ED1A 4C92E 1ZHIA 2X3WD 3QWYA 4E2FB 2GQVA 5IN1A 4HCKA 3M54A 2VB6A 1JB0E 5KCHA 1Y71A 2DIGA 2L3RA 4AFQC 2DE0X 1JEGA 4OGCA 2DETA 1QCFA 3AHUA 5FU6B 1SSFA 1HK9A 2X4WA 1I07A 1YIJQ 1TU0B 4HCZA 4C92F 4F16A 3LH5A 5KE2A 2ESWA 1VQ4Q 5LJ3d 2HNIA 2K2MA 4JJNK 1KC8R 1XNIA 1EFNA 4XU3A 1WXTA 4KBMB 3RMQA 4E6RA 1K9MU 1RLPC 3J80E 3RKWA 1H3ZA 1M9SA 2L0AA 3O8VA 4Q5WA 3AT1B 1TUCA 2EGAA 2ZPFB 1VQOT 1RAFB 3SDZA 2QK0A 4BY6C 3MKDA 1KK7A 5A0DA 5EG2A 2CUDA 1UFFA 1UTIA 4JZ3A 3G6ET 2YRCA 4JRPA 1FYNA 1VQ9Q 2M1HA 4KUIA 1NYGA 2OJ2A 4QVDA 2CT3A 5GMKe 2LT4A 3I55A 1ZQ1A 2ZPEB 3GPLA 1YITT 1W2BP 4ZGEB 4MDXA 1KQSA 5KYUB 5GANj 2AKLA 2WACA 2RJFA 2QEXA 2G6FX 1SHGA 4X1VA 2MI6A 2KY9A 3BY7A 1IB8A 1QWFA 1R0BG 3E9GA 3FRNA 3RERA 1RABB 3IQLA 1YJ9Q 4J9BA 4GLMA 2E3IA 1VQNA 1XOVA 2HKNA 4FW1A 1ZBXA 2JXBA 5A0LA 2XKOC 1KG1A 2AKKA 3EFSA 1QVGP 1K8AR 1ABOA 2M51A 2QDLA 1VQMT 2ZPHB 3CMAQ 4M77G 4OB3B 1VQNQ 2K6DA 1KQ2A 2DL3A 3FIFA 3EH1A 1OPLA 2EQUA 1BIAA 5AYFA 3GBQA 1EX4A 1PC0A 3F70A 2W0ZA 1I4K1 4Z89A 4NS5A 2JN0A 3HSBA 3CCQA 4M7DC 1SHFA 4RG8A 4E7KA 2HQHA 2O01E 1VQPA 3CCJA 2RI3A 3OYNA 5GAOm 2CUBA 2JT4A 5KCOA 3HP9A 2FZGB 2CS7A 2ED0A 2Y4YA 1KSWA 3QUIA 3CCEQ 3H0FA 1D0YA 4FYWB 3G7ZA 1M90R 1FMWA 2RK2A 1Q82R 3HRTA 3UF4A 4J8OA 1VQPQ 4A4HA 4WF2A 2MCNA 2RJDA 3J81E 1M2OA 1YIJT 5DY9A 4UC4A 2V1QA 3CMEQ 5IXBA 3CC7Q 1VOMA 3CCUA 4X9CA 1IREB 3L1AA 4LXCA 3OS1A 1X43A 3CD6A 5CKEA 1X6GA 4C8QC 3CXCS 3G71A 2K3YA 2DM1A 3CC4A 3CC4T 1WZOA 3ME9A 4C5HA 1Q86R 3G71T 3CD6Q 1RAIB 4MZPA 1D3BA 1LCKA 3VRZA 3CD6T 4DA4A 1D1AA 1AWWA 8AT1B 3CPFA 4HVUA 2K5IA 3A8LB 5CKFA 2KT8A 1M1KC 3CCUT 4PLLA 1YCYA 1QCOA 2EAYA 2L2PA 5DM7R 1QQJA 2CP7A 1YJ9T 3FC3A 2RH2A 1NE8A 2V8JA 1QVPA 2A08A 3CC7T 2ATCB 2ZGWA 4KH1B 2QTVA 3WVDB 3VU3C 1VQPT 3OYBA 4LDVA 4PJNA 4C8QB 1IGQA 5KYYA 1D1BA 3UA6A 1OEBA 1MV0B 1O9SA 2V8KA 4JLGA 4JUVA 1JJ2A 4AFUC 2LJ1A 2XMFA 1WX6A 1M1KU 4HKEA 3JCMf 2HKQB 5KYWB 2ZCFB 1XTDA 3QJ6A 2QYZA 1ZSZB 1CSKA 3OYYA 3JB9I 1BU1A 1KD1U 1JBMA 3CBOA 1VQNT 1U1TA 3MJXA 3LLRA 2OTLQ 1RAHB 1KC8U 4IKFA 2EYXA 4XTZA 1U1SA 1K9MR 3TU4K 1WA7A 2F5TX 2CH4A 1UDLA 2DA9A 2HL5C 2X51A 2LT1A 4J9FA 4EMGA 3EHRA 3R6NA 2VWFA 4D6WA 1WIEA 1V29B 5DLQE 4QVCA 2EQMA 3G6EA 2DEUA 3E9FA 1AZEA 5FROA 1WXUA 4LDWA 4M4ZA 3M4GA 4AG1C 9ATCB 2BZ8A 2QASA 1JQQA 1WHLA 1GL5A 1YWOA 3CC7A 4E7SA 2V8IA 2V1RA 2L89A 4M7DA 3Q1JA 2YWWA 1VQ4A 1HSQA 1GFDA 2ZZDA 1QVGA 1WNLA 2V26A 4M7DF 1TH7A 4XAXB 2MMPA 2HEQA 1PRMC 5FU7B 4LNPA 1UB4A 2DD5A 4KH0B 4OMOA 4HVWA 3LX7A 3V7CA 4KGVB 1YJWQ 1VUBA 1Y7XA 4M75F 4BUGA 5KYXA 3OW2A 1BK2A 1RAAB 5GANf 3EG3A 3TSWA 2XD0A 2NUTA 2F69A 3JCMg 3OYCA 2LRQA 4A4GA 1YI2Q 3EGXA 2DJZA 3OSSC 1VQ5A 4M7DB 1FMKA 1ZSZA 1O75A 3EFOB 3OYKA 2QXFA 4ANJA 1MMNA 3VYHB 1XQHA 2DPPB 2WSCE 4RUGA 2DRMA 1U5SA 3M0TA 4J6YA 5FRNA 1ARKA 4PKCC 1UGPB 3CBPA 4BE1A 5I2MA 2Z0WA 2GFAA 4FYVB 4B9WA 1JU5C 5AT1B 3HRSA 2RQTA 4A54A 3VS4A 5IT9E 2ZAEA 2YHTA 2LDMA 2RD1A 1JJ2P 4M7AF 1M3AA 4CC2A 4ORZA 3VS6A 3VUBA 2A7YA 3JCMX 3M53A 2HQEA 1WDXA 1I5OB 3UPUA 1G3SA 2LCLA 2HBWA 1EZZB 4NL3A 1H3HA 3CCJQ 1JXOA 3JRZA 2EFIA 3BE3A 3QBYA 3M56A 3MP6A 3SB2A 1NJIR 3I56Q 2D1XA 3A8HB 4ZTJA 2RK1A 4C92A 1K0XA 2FRWA 1M5Q1 3OBYA 3NFCA 3NGPA 2VXEA 2AK5A 1OULA 4TVRA 4M7AD 2FYKA 2W10A 1C0MA 4C0DC 3D7SB 2A28A 1M1FA 2OTJA 1YITA 3I55T 2ENMA 1FMVA 1NG2A 4QQ6A 1B07A 5FWCA 3DKMA 4CC7A 2ROTA 2MIOA 1VQOQ 3CPWA 4PJOF 2GF7A 2LQNA 2FPEA 2KBTA 3DLMA 2GCXA 4N0AA 8ATCB 4QQDA 3A8OB 1VQOA 1Z9QA 2J6FA 2QA4T 1Q7YC 2EBPA 3ER0A 5GAMh 3L2WA 4M7AB 4OMNA 2JUFA 1E6GA 4OF1A 5GAN7 4EMHA 4O5VA 1Q86U 2KEAA 2KYBA 2F2WA 3CEYA 3S3OA 5GANg 2RQVA 1KD1R 1BI1A 1ZUYA 1QKXA 2WSEE 4FCYA 3C94A 4J6WA 5LJ5d 2CREA 2NUTB 1VQ6Q 2E41A 2FZKB 1G3WA 1GFCA 4OP0A 5J26A 3PFSA 2P0PA 4KULA 1VQ5Q 3UT1A 1M2VB 3VRYA 4AFZC 1VQLQ 1T3LA 5A0GA 4ME7A 5CK9A 2ZPGB 1VQKT 2VGMA 5GMKm 5HY6A 5IXFA 2YUPA 1UGVA 3S6WA 3CMAT 1PSEA 4M7AA 2ROLA 5KYUA 5GAMd 4FU6A 1K73R 3EG2A 3VS3A 4ESRA 3VS5A 2FHDA 4N4GA 3JB9F 2IIMA 2PUOB 4RKUE 3RUXA 1TSFA 2BZYA 2O9VA 2JTEA 4PK4A 3CCSQ 2EGEA 3V8KA 5FW9A 2KAFA 3RDVA 2G3RA 2QA4A 1YITQ 1MMGA 3X26B 4LD6A 1OOTA 4O6JA 4OVAA 1VQ9T 4C5EA 5KYWA 1B3QA 2QA4Q 1PHTA 3NTKA 3HL8A 4PL6A 3JV3A 2X35A 5GJWB 2CZ0B 4NL2A 3R6OA 3EGXB 3HPWA 1BYMA 5D6YA 1M30A 3FEOA 4F04B 4AMCA 4M75A 1KHCA 4L5GA 2EWNA 4VUBA 4HVVA 4RTUA 3INZA 2KT1A 1SPKA 5GAN3 1FXXA 4M78B 2B8AA 1PD1A 4C0GA 2J6OA 3OA6A 3JCMe 2COYA 1MNEA 3X25B 1PCXA 2BE7D 5CAIA 4OMQA 4IUVA 1D09B 3A98A 2CP2A 1PKSA 2XU8A 5KE3A 1B34B 1PG5B 1SEMA 3RIRA 4YTLA 3CPWS 1OU8A 4F7UE 1UJYA 2PQWA 5CVIA 4F14A 3JB9J 1VQ7A 1QVFP 2LQWA 4WCIA 4XTWA 1F1BB 1UG1A 2VASA 2PVDB 4KT0E 4J83A 2EW3A 2X4JA 3M5AA 3FJ5A 1ZLMA 3CCMQ 2EPDA 2DIQA 3LGFA 2DL5A 4BDZA 3VJPA 1YN8A 1X69A 4C8QF 2RO0A 4JRKA 1RADB 3CCSA 2K5LA 3EHQA 2OX7A 1Y07A 4XK8E 1OZ3A 4M75G 3OYIA 5I21A 3CC2T 5C6SA 2LCSA 1BI2A 2L8DA 2RHXA 1KJWA 2HL3A 5HCKA 1TWBA 1MMAA 2CGHA 3JCMJ 1J3TA 1Y57A 1D3BB 1VIEA 3M58A 1NYFA 3CCVQ 2DZ9A 2RHZA 4DQ2A 2X4XA 1N5ZA 2RN8A 1JXMA 3URGA 2KRSA 2M9UA 3VV0A 3OS0A 5LJ5j 2FG0A 4MMLA 3QJYA 4JLIA 2H8HA 3PMTA 4DBHA 5LJ5e 3QYHB 3SWNC 2DJQA 1MUZA 1AOJA 2E65A 4M78G 2DTIA 3CCMT 1NJIU 3EGDA 3G4SQ 3H0IA 1MHNA 1IHWA 1OZ2A 2X3XD 1PD0A 3M0QA 4BB7A 2NUZA 2EQJA 2DXTA 1X01A 5IHIA 5FU6C 4ELYC 4AFSC 1PKTA 4BD3A 3TEEA 3M55A 4A63B 4XU2A 3OYHA 1YHQT 2JS0A 2GGRA 1VYTA 1I0CA 2JW4A 2RJCA 4FYXB 5GAN4 3L2VA 1H8KA 3THKA 1UGQB 2RNAA 1Q82C 3L42A 2JS2A 3PIPA 4M7AG 3M0UA 1VQ8Q 2A37A 1AT1B 1NLOC 3VS2A 4E7IA 3I9QA 3P8HA 3OS5A 3X28B 1ZUKA 1IGUA 2PVOB 3OBWA 3GNGA 4F7UF 2CP5A 1PSFA 4IUPA 3SWNB 2DTOA 3X20B 4F7UA 4IUQA 3ASKA 2YRVA 2F2VA 4LDYA 4ZGDB 1ZBJA 2O2OA 3CXCA 2BE9B 4BDYA 3JCMW 1K73C 4DEXA 2CP6A 1Y0MA 4J9CA 2E64A 1OPKA 1C6VX 4C0ZA 3FLGA 2DTHA 1IRXA 1OV3A 1K8AC 2YXYA 2E4HA 2X4YA 3OSVA 3CCVT 2RHYA 2JM8A 1WHGA 2FVUA 4PFZA 1NPRA 3OB9A 3DB3A 2IPOB 1ACMB 2KK4A 1QMCA 1RACB 1UGSB 3MP8A 2RJEA 2C0TA 5GAN5 1W4SA 1A0NB 3CC2Q 3J7AF 1D0ZA 2KDSA 1BI0A 2EKOA 2VGNA 2ZPBB 4QVZA 1R0CB 1WXBA 3REBB 1VIFA 2EIFA 2QQ9A 5LJ3j 2DVEA 1CKAA 2DZCA 1VYVA 2PNIA 1TUDA 2HDAA 5GAOp 2A3LA 4EDUA 1MV3A 3A8MB 1VQLT 1Y96B 4BACA 5GAOn 4OB2B 2KNBB 5LJ5h 2H3JA 1NZ9A 1UEBA 2HCKA 1VQ4T 3T9NA 2CP3A 3A1PA 2YLCA 3PE0A 5CR2A 2QTXA 2CZ7B 3OMCA 2MPXC 4J5YA 4FSSA 2K5FA 4LN2A 3CCJT 5J3BA 3G1JA 2BTTA 3TVTA 1YJWT 4HCBA 2OAWA 2J05A 5HK3A 1X6OA 2KXCA 3EH2A 4MZTA 2D8JA 2QQAA 2EJ9A 3MO8A 2K57A 3OYFA 4M7AC 2LTOA 2CSQA 4FSXA 1PWTA 1AZGB 1VA7A 5GMKi 1LPLA 1UJ0A 4E47A 5GAOr 5GMKl 3I55Q 2LQ8A 4OMLA 2JTMA 1PM3A 2EQIA 5FWBA 5LJ5f 2RB6A 2KYMA 5EC7A 3HRUA 2QEXT 4FT4A 4BI4A 1X6BA 2D0QB 2LCCA 3PT9A 5GMKj 3CMET 4M78C 2FEIA 2PZ1A 2NLUA 2VYTA 3CBMA 2X9HA 3QO3A 4F17A 2HMAA 2VKNA 1U3OA 2GQIA 3CCET 2KVQG 2ABLA 3QG1A 4IIOA 4JPBW 3LWIA 4PJJA 2MF2A 2QG9B 1NEBA 4LDUA 3O5ZA 3L2QA 1SRMA 4QQGA 3CCRT 1WQWA 4HT9A 3S3MA 2EQKA 1YJ9A 2SEMA 1WJSA 3CCLT 4RTVA 3I35A 4DBFA 4QW2A 2LX7A 3DB4A 1RLQC 2DF6A 2K79A 3U23A 3ZL7C 3CCLQ 5CIUA 3HHTB 2LQKA 5CKHA 2R58A 2PU9B 1NPPA 4BE0A 4PJOD 2BIVA 5KH6A 3M9QA 2RQWA 4EMKC 4X34A 3V8LA 1V1CA 2JTFA 1MGQA 1ZUUA 1RAEB 1AWXA 2JZ2A 3I56A 3KXTA 1Z9ZA 3QPHA 1N8RU 3LYIA 5IHNA 3ZFJA 3V7SA 2VUBA 5GMKh 1W6XA 1GCPA 1QLYA 2DVJA 2NWMA 3EG0A 3I5SA 5FRMA 3OYAA 2KR3A 4Z88A 4ZTFA 2QI2A 2RI2A 4JJDA 4C8QE 4KGZB 1TUGB 1X75C 1U8RA 3NMZC 1YIJA 3ZEHA 2LJ3A 5I2SA 1RI0A 3SFMA 4A4EA 1M1GA 4JJBA 1AWOA 4BY6B 1AEYA 3MP1A 2KSSA 5D6WA 1YP5A 4N4IA 1I1JA 7AT1B 2C0IA 2QQSA 5GAMj 3EG9A 5A2QE 3G71Q 4FL6A 4JS5A 2VV5A 4LD9K 2DK3A 2O4XA 3N5BB 3CCQT 2IG0A 1YCSB 1VQMQ 3GOXA 1BCMA 4KRTA 4BI3A 5M9OA 1YI2A 1KQSP 3JCMV 1RUWA 2HQXA 1ZA2B 2DMOA 2KGTA 1VQMA 3I56T 3JB9D 4CI0C 3QDFA 1LVKA 1X27A 1QKWA 1NLPC 1BCOA 3EG1A 1WQ7A 2LNHB 3EFRA 1Q81R 1GBQA 1R77A 4PJLA 2XK0A 2IVWA 5KYXB 3FJPA 3H6ZA 1HYOA 2VC8A 1IZ6A 3VS0A 2QEXQ 2KQWA 1ZX6A 4JRIA 4A4KA 3CPWP 3BDLA 5LJ5g 3H8ZA 2C06A 3LW5E 3RKXA 1K4US 3MCAB 2FPFA 2K7AA 4M75B 2DAQA 1GCQC 4C5IA 4MMKA 1D0XA 2DD4A 3EG9B 4DBQA 1FWZA 3VS1A 2P84A 4RG2A 1NBEB 5D7UA 4N4HA 2RQRA 6AT1B 2MYSA 3M4YA 2EKHA 4J9HA 5HK0A 3CCRQ 4OGEA 3NHNA 2D8HA 4Y91A 3PMIA 1M3CA 3VYGA 1QW1A 2EGCA 3JSCA 1LOJA 1QP3A 1G83A 3A8GB 4XTUA 1JJ2S 3FB9A 2EYZA 4JZ4A 1BBZA 3CMEA 2XDBA 2FPDA 4J6XA 1N9SA 1QVFA 1PRLC 3M0SA 1UGRB 4C92B 3REAB 4IUUA 2RHUA 1GXIE 2LC4A 5GAOl 4J7IA 4M77C 1N6AA 2YUNA 3MHXA 2JJ9A 1S72A 4XTXA 1E7OA 3E19A 1E6HA 2O31A 4M77A 3P8DA 4ZNXA 3G6EQ 2O4XB 4J9IA 1HD3A 4M75E 3BFMA 4QT7A 4M77F 1W70A 1KD1C 2E1HA 2AIRB 1GRIA 4E7HA 1S72Q 2GBQA 1LNXA 2RA2A 2GNCA 2PVGB 1AVZC 1UECA 2CKKA 3G4ST 3QZ9B 4A53A 2LJ0A 1N27A 1YJWA 4HXJA 1UHFA 2HSEB 1W2BS 4PFPA 2AHJB 2FL7A 3GP8A 2DX1A 3TQ7P 5L8RE 1WHKA 3GF5A 1KQ1A 4MZMA 2DBMA 1M4ZA 3I5RA 3RMSA 1M8VA 3WVEB 4M78D 1ZSZC 4F7UG 5KYNA 3S3NA 3LWHA 1Q7YU 2XHCA 3JCMP 2CYZB 3OYLA 4HT8A 1TS9A 4JDSA 2E5KA 2NUPB 4C92D 4EMKB 2RQUA 1SSHA 1WPYA 2KRNA 3DLLA 2CSIA 3RNJA 2CZ6B 3OYJA 3L2ZA 1S1NA 4PNOA 3X24B 1K0SA 2YDLA 3JCMh 5KYYB 3JB9G 2M0YA 1VQ6A 3OMGA 1I5LA 1N8RR 4B9XA 3ZBDA 2CT4A 3JCMQ 2HAXA 2XICA 3RKYA 2HBPA 2EJGA 2RM4A 3QDRB 4ZN1A 2CH4W 2KI7A 4J9EA 3KUFA 4A4FA 5DLOA 3GIBA 2A36A 1H641 3V8JA 4OB1B 3CCLA 3SEMA 1SF9A 1C1AA 1NEGA 2B86A 4RCBA 3VS7A 2LNVA 4M7DD 4E7JA 3CCRA 3FDRA 2XI9A 2BZXA 3E2UA 1VQ8T 3TSZA 3QWXX 4BI8B 3WXMB 2XDDA 2XG8D 3CCEA 3HKSA 2H3EB 5C0MA 1GCQA 2E6NA 1YJNQ 1T0JA 1G8XA 3UDCA 2DILA 2O9SA 4M78A 1OQKA 2DO3A 3CCUQ 1Q86C 1D1CA 4PJOE 3META 2DL8A 3QYGB 2QGFB 2P4TA 4ZGJB 5LJ3g 2J6KA 3RESA 4C5GA 2L3PA 2DYIA 4M77E 1BIBA 5GAMg 4Z02A 4PJOG 3CC4Q 1KQSS 2GFUA 5GAMf 3L2UA 3L2RA 3H9NA 3NPFA 2R57A 1TG0A 3NTIA 4M75C 2MWOA 3OS2A 2QQBA 3PIOA 3GLXA 2DFUA 4CRIA 3HFOA 3C0CA 1V76A 2P4RA 2P0QA 2QDYB 1YJNT 2MWPA 4C0FA 4XU1A 5GANd 1YHQA 1OX8A 1K1ZA 1CKBA 3JCMb 3BDUA 4CC3A 1G3YA 4RMOA 5CKBA 1VYUA 2A0FB 2E3HA 3QXEB 4IURA 3LH0A 2DNUA 2D9TA 1YWPA 2GTJA 3CXCP 4L59A 4LE9A 4E7ZA 2COZA 2DL7A 4PJOB 5GAMe 1WI7A 3GNFB 2AT1B 3QSUA 1WJRA 1OX9A 2DLPA 2E5QA 1M3BA 4XTVA 2NUPA 4EMKA 5LJ3h 1FX7A 1VQLA 1VQ7Q 4RTYA 1JO8A 1YBYA 2O88A 4AT1B 2AZSA 4Z8AA 5I22A 4D8KA 4JS4A 1K9MC 4HA8A 1BI3A 1W1FA 2CDTA 2MAMA 3PNWC 2LX9A 3UWNA 4HCCA 5FU7C 5L23A 3OY9A 1PNJA 3JCMc 2OTLA 2DYBA 5IHKA 1YNZA 1QP2A 4DEYA 1UHCA 4C92C 2J7IA 2EYWA 1KHIA 1HXDA 3EGDB 2FO0A 3CCST 4EIKA 4FIBA 1K9AA 3P8BB 4FM4B 4C92G 1SRLA 3MEUA 4CC4B 1WHJA 4LUEA 1QVGS 2KMTA 2OAUA 4MDWA 3MPUB 4R56A 2WSFE 4FYYB 2E70A 2KE9A 5D6XA 2FRYA 1AHJB 1M90U 3CCVA 2LP5A 3UATA 2DRKA 1DJ7B 1JRIA 1SG5A 1VQ7T 2JOYA 2DL4A 1IHVA 5J39A 3OW2P 4Y92A 2OTJQ 1AD5A 4JJCA 3M59A 2YRDA 1MMDA 1ZA1B 2F1LA 1NJIC 1UUEA 2FB7A 2QAZA 3M0RA 5CQXA 1IO6A 2RHIA 4EPCA 5GAN8 3QIIA 3NTHA 4M77D 4NOYA 1X2KA 2VVKA 1VQ8A 3H41A 3ULRB 2K3XA 4RTXA 4LDXA 4M7DG 2M0OA 3EAEA 3SD4A 2Y90A 2K3BA 4RTTA 2D6FA 1IXDA 5IAYA 1GBRA 2EVRA 4ZN3A 4II1A 3C4SA 1YHQQ 4GY5A 2KROA 1I8FA 1K73U 5ECAA 5FLXE 2EJFA 4BE2A 1N8RC 2L3SA 3H0HA 1Y96A 2RI5A 4IUTA 3OYEA 2GTOA 2PUKB 1QWEA 1ZSGA 2JM9A 3M0PA 1Q7YR 2K9GA 4D8DA 3E1SA 3OYDA 2MK5A 2OTLT 2JMCA 4N0AC 5GJVB 1U06A 3QZ5B 4ATOA 3EGUA 4RTWA 4PJOC 4DOVA 4M78F 4PLIA 2R5MA 4DBRA 1OU9A 1Q81U 1X2QA 4K11A 2DEQA 2BKDN 4KGXB 4LUDA 4JRQA 4J9DA 3VUZA 2QGGA 3SWNA 4GLKA 1RAGB 3QKJA 3CCMA 2OI3A 3EFOA 4FT2A 1M2VA 2RF0A 4OMFB 1BB9A
chains in the Genus database with same CATH topology
1T3SA 1K76A 1K4US 2LCSA 2SRCA 2FPFA 2K7AA 1GCQC 4OMMA 1CSKA 1KJWA 5HCKA 1BU1A 1J3TA 3VS1A 1Y57A 2RQRA 1NYFA 2EKHA 4J9HA 4OMPA 2ECZA 3NHNA 2D8HA 1M3CA 2EGCA 1N5ZA 2EYXA 1JXMA 2RN8A 1G83A 2KRSA 2YUQA 2EYZA 4JZ4A 2FG0A 1BBZA 1WA7A 2H8HA 2CH4A 1KFZA 1UDLA 2DA9A 2FPDA 2PTKA 1PRLC 3M0SA 4J9FA 3EHRA 2DJQA 1MUZA 3REAB 1AOJA 3R6NA 2VWFA 3PVLA 1WIEA 1G2BA 1M8MA 3H0IA 2X3XD 1AZEA 2EYYA 3M0QA 2HSPA 5I11A 1WXUA 4M4ZA 4AG1C 2NUZA 2YUNA 2BZ8A 2YSQA 5IHIA 1JQQA 1E7OA 1GL5A 1YWOA 1E6HA 2O31A 4ZNXA 2V1RA 2KXDA 4AFSC 1PKTA 4J9IA 1HD3A 4A63B 3RBBB 2JS0A 4QT7A 2GGRA 1HSQA 1GFDA 1W70A 1GRIA 1AWJA 1I0CA 1VYTA 2JW4A 1UE9A 2GBQA 1T0HA 2GNCA 1AVZC 1UECA 1PRMC 2HEQA 2RPNA 1H8KA 3THKA 2LZ6B 2RNAA 2F2XA 2LJ0A 4LNPA 2JS2A 5IH2A 1NM7A 4OMOA 3M0UA 4HVWA 4HXJA 2A37A 1UHFA 1NLOC 3VS2A 1M27C 3I9QA 1RI9A 2DX1A 1ZUKA 2JMAA 3KFVA 2C0OA 2DBMA 3I5RA 4GBQA 1BK2A 3EG3A 3TSWA 1WYXA 2J06A 2F2VA 2E5KA 1ZBJA 2O2OA 2MOXA 2RQUA 1SSHA 2YUOA 2KRNA 4DEXA 1HJDA 2CSIA 3RNJA 1FMKA 1Y0MA 4J9CA 1S1NA 1K0SA 1OPKA 2RMOA 1OV3A 4RUGA 2DRMA 2YDLA 2LMJA 1U5SA 3M0TA 4AG2C 1ARKA 4R0KA 1WFWA 2M0YA 2JM8A 4J9GA 2D0NA 1JU5C 2CT4A 2RQTA 3CQTA 4RTZA 3VS4A 3UA7A 2DBKA 2C0TA 2L3QA 2CH4W 1A0NB 4J9EA 4IIMA 1M3AA 4CC2A 2A36A 4ORZA 3VS6A 1WXBA 3SEMA 1WDXA 1NEGA 2B86A 3VS7A 2AZVA 3REBB 2HBWA 2YT6A 2BZXA 1H3HA 1JXOA 3TSZA 2I0NA 1CKAA 3QWXX 1VYVA 2PNIA 1H92A 2KRMA 1KIKA 1TUDA 3PVQA 2HDAA 2D1XA 1GCQA 1K0XA 2FRWA 3SHWA 1MV3A 1T0JA 1ABQA 3NGPA 2DILA 2AK5A 2O9SA 1WLPB 2ED1A 2KNBB 2W10A 2X3WD 3QWYA 2A28A 4HCKA 2DL8A 2ENMA 2HCKA 4AFQC 1NG2A 2DE0X 2J6KA 1JEGA 1B07A 5FWCA 1QCFA 2L3PA 4CC7A 2ROTA 3PE0A 2MIOA 1I07A 4FSSA 2LQNA 4LN2A 4F16A 3LH5A 2FPEA 2KBTA 2ESWA 2BTTA 3TVTA 3NPFA 1TG0A 2K2MA 2OAWA 2J05A 1Z9QA 2J6FA 2KXCA 2EBPA 2D8JA 1EFNA 1WXTA 4E6RA 3C0CA 1RLPC 2P4RA 4OMNA 1E6GA 2CSQA 1PWTA 2L0AA 1AZGB 1VA7A 2KEAA 1TUCA 1K1ZA 2KYBA 2EGAA 1CKBA 2F2WA 1UJ0A 4CC3A 2RQVA 1ZUYA 1QKXA 1VYUA 2CREA 2CUDA 4OMLA 1UFFA 2DNUA 1UTIA 4JZ3A 2EQIA 5FWBA 1YWPA 2GTJA 2KYMA 1GFCA 1FYNA 4LE9A 5EC7A 2DL7A 1NYGA 2OJ2A 3VRYA 4AFZC 1WI7A 2CT3A 1T3LA 1X6BA 2DLPA 1M3BA 2FEIA 2PZ1A 5IXFA 2AKLA 4F17A 2YUPA 1UGVA 2VKNA 1JO8A 2G6FX 4RTYA 2O88A 1SHGA 2AZSA 1U3OA 4X1VA 2ROLA 4Z8AA 5I22A 4D8KA 1QWFA 2GQIA 3IQLA 4J9BA 4GLMA 2ABLA 4IIOA 4JPBW 1W1FA 2CDTA 3EG2A 1XOVA 3VS3A 4ESRA 1NEBA 3VS5A 2JXBA 3O5ZA 2IIMA 2AKKA 5L23A 1SRMA 1PNJA 1ABOA 2M51A 2QDLA 2DYBA 2SEMA 5IHKA 2BZYA 1YNZA 2K6DA 2O9VA 2JTEA 2DL3A 4DEYA 4RTVA 2EGEA 1UHCA 3I35A 2J7IA 1OPLA 2LX7A 2EYWA 5FW9A 1RLQC 2DF6A 2K79A 3GBQA 2FO0A 3U23A 3ZL7C 2W0ZA 4EIKA 4Z89A 1K9AA 1SRLA 1SHFA 1OOTA 4CC4B 4LUEA 2RQWA 2CUBA 2JT4A 1V1CA 2KE9A 1B3QA 1ZUUA 1AWXA 2ED0A 1PHTA 2FRYA 1KSWA 3H0FA 1Z9ZA 2LP5A 3JV3A 5GJWB 3UATA 2DRKA 3UF4A 2MCNA 5IHNA 2DL4A 1M30A 1W6XA 1GCPA 1QLYA 2DVJA 2NWMA 2V1QA 1AD5A 3EG0A 3I5SA 4Y92A 5IXBA 4JJCA 2KR3A 4HVVA 4Z88A 4RTUA 2KT1A 1SPKA 1UUEA 4JJDA 1X43A 3NMZC 1X6GA 3M0RA 2LJ3A 1IO6A 2J6OA 4JJBA 1AWOA 1AEYA 1YP5A 2DM1A 1X2KA 2VVKA 3H41A 3ULRB 1I1JA 4RTXA 2C0IA 4OMQA 2K3BA 4RTTA 1LCKA 3VRZA 3A98A 1GBRA 2EVRA 1PKSA 1AWWA 4HVUA 1SEMA 1YCSB 2KROA 2KT8A 5ECAA 4KRTA 1UJYA 2L3SA 3H0HA 4F14A 1RUWA 2L2PA 2GTOA 1QWEA 2DMOA 2KGTA 2LQWA 1ZSGA 2JM9A 4WCIA 3M0PA 2K9GA 4D8DA 1UG1A 2A08A 2EW3A 2JMCA 5GJVB 1U06A 1X27A 1QKWA 3FJ5A 1ZLMA 1NLPC 3EGUA 4RTWA 3EG1A 2EPDA 2LNHB 1GBQA 2DL5A 1X2QA 4K11A 3UA6A 4LUDA 1OEBA 4J9DA 1YN8A 1MV0B 1X69A 3EHQA 4AFUC 2LJ1A 2OI3A 2XMFA 3VS0A 1WX6A 1ZX6A 2RF0A 1BB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3S A;  1K76 A;  1K4U S;  2LCS A;  2SRC A;  2FPF A;  2K7A A;  1GCQ C;  4OMM A;  1CSK A;  1KJW A;  5HCK A;  1BU1 A;  1J3T A;  3VS1 A;  1Y57 A;  2RQR A;  1NYF A;  2EKH A;  4J9H A;  4OMP A;  2ECZ A;  3NHN A;  2D8H A;  1M3C A;  2EGC A;  1N5Z A;  2EYX A;  1JXM A;  2RN8 A;  1G83 A;  2KRS A;  2YUQ A;  2EYZ A;  4JZ4 A;  2FG0 A;  1BBZ A;  1WA7 A;  2H8H A;  2CH4 A;  1KFZ A;  1UDL A;  2DA9 A;  2FPD A;  2PTK A;  1PRL C;  3M0S A;  4J9F A;  3EHR A;  2DJQ A;  1MUZ A;  3REA B;  1AOJ A;  3R6N A;  2VWF A;  3PVL A;  1WIE A;  1G2B A;  1M8M A;  3H0I A;  2X3X D;  1AZE A;  2EYY A;  3M0Q A;  2HSP A;  5I11 A;  1WXU A;  4M4Z A;  4AG1 C;  2NUZ A;  2YUN A;  2BZ8 A;  2YSQ A;  5IHI A;  1JQQ A;  1E7O A;  1GL5 A;  1YWO A;  1E6H A;  2O31 A;  4ZNX A;  2V1R A;  2KXD A;  4AFS C;  1PKT A;  4J9I A;  1HD3 A;  4A63 B;  3RBB B;  2JS0 A;  4QT7 A;  2GGR A;  1HSQ A;  1GFD A;  1W70 A;  1GRI A;  1AWJ A;  1I0C A;  1VYT A;  2JW4 A;  1UE9 A;  2GBQ A;  1T0H A;  2GNC A;  1AVZ C;  1UEC A;  1PRM C;  2HEQ A;  2RPN A;  1H8K A;  3THK A;  2LZ6 B;  2RNA A;  2F2X A;  2LJ0 A;  4LNP A;  2JS2 A;  5IH2 A;  1NM7 A;  4OMO A;  3M0U A;  4HVW A;  4HXJ A;  2A37 A;  1UHF A;  1NLO C;  3VS2 A;  1M27 C;  3I9Q A;  1RI9 A;  2DX1 A;  1ZUK A;  2JMA A;  3KFV A;  2C0O A;  2DBM A;  3I5R A;  4GBQ A;  1BK2 A;  3EG3 A;  3TSW A;  1WYX A;  2J06 A;  2F2V A;  2E5K A;  1ZBJ A;  2O2O A;  2MOX A;  2RQU A;  1SSH A;  2YUO A;  2KRN A;  4DEX A;  1HJD A;  2CSI A;  3RNJ A;  1FMK A;  1Y0M A;  4J9C A;  1S1N A;  1K0S A;  1OPK A;  2RMO A;  1OV3 A;  4RUG A;  2DRM A;  2YDL A;  2LMJ A;  1U5S A;  3M0T A;  4AG2 C;  1ARK A;  4R0K A;  1WFW A;  2M0Y A;  2JM8 A;  4J9G A;  2D0N A;  1JU5 C;  2CT4 A;  2RQT A;  3CQT A;  4RTZ A;  3VS4 A;  3UA7 A;  2DBK A;  2C0T A;  2L3Q A;  2CH4 W;  1A0N B;  4J9E A;  4IIM A;  1M3A A;  4CC2 A;  2A36 A;  4ORZ A;  3VS6 A;  1WXB A;  3SEM A;  1WDX A;  1NEG A;  2B86 A;  3VS7 A;  2AZV A;  3REB B;  2HBW A;  2YT6 A;  2BZX A;  1H3H A;  1JXO A;  3TSZ A;  2I0N A;  1CKA A;  3QWX X;  1VYV A;  2PNI A;  1H92 A;  2KRM A;  1KIK A;  1TUD A;  3PVQ A;  2HDA A;  2D1X A;  1GCQ A;  1K0X A;  2FRW A;  3SHW A;  1MV3 A;  1T0J A;  1ABQ A;  3NGP A;  2DIL A;  2AK5 A;  2O9S A;  1WLP B;  2ED1 A;  2KNB B;  2W10 A;  2X3W D;  3QWY A;  2A28 A;  4HCK A;  2DL8 A;  2ENM A;  2HCK A;  4AFQ C;  1NG2 A;  2DE0 X;  2J6K A;  1JEG A;  1B07 A;  5FWC A;  1QCF A;  2L3P A;  4CC7 A;  2ROT A;  3PE0 A;  2MIO A;  1I07 A;  4FSS A;  2LQN A;  4LN2 A;  4F16 A;  3LH5 A;  2FPE A;  2KBT A;  2ESW A;  2BTT A;  3TVT A;  3NPF A;  1TG0 A;  2K2M A;  2OAW A;  2J05 A;  1Z9Q A;  2J6F A;  2KXC A;  2EBP A;  2D8J A;  1EFN A;  1WXT A;  4E6R A;  3C0C A;  1RLP C;  2P4R A;  4OMN A;  1E6G A;  2CSQ A;  1PWT A;  2L0A A;  1AZG B;  1VA7 A;  2KEA A;  1TUC A;  1K1Z A;  2KYB A;  2EGA A;  1CKB A;  2F2W A;  1UJ0 A;  4CC3 A;  2RQV A;  1ZUY A;  1QKX A;  1VYU A;  2CRE A;  2CUD A;  4OML A;  1UFF A;  2DNU A;  1UTI A;  4JZ3 A;  2EQI A;  5FWB A;  1YWP A;  2GTJ A;  2KYM A;  1GFC A;  1FYN A;  4LE9 A;  5EC7 A;  2DL7 A;  1NYG A;  2OJ2 A;  3VRY A;  4AFZ C;  1WI7 A;  2CT3 A;  1T3L A;  1X6B A;  2DLP A;  1M3B A;  2FEI A;  2PZ1 A;  5IXF A;  2AKL A;  4F17 A;  2YUP A;  1UGV A;  2VKN A;  1JO8 A;  2G6F X;  4RTY A;  2O88 A;  1SHG A;  2AZS A;  1U3O A;  4X1V A;  2ROL A;  4Z8A A;  5I22 A;  4D8K A;  1QWF A;  2GQI A;  3IQL A;  4J9B A;  4GLM A;  2ABL A;  4IIO A;  4JPB W;  1W1F A;  2CDT A;  3EG2 A;  1XOV A;  3VS3 A;  4ESR A;  1NEB A;  3VS5 A;  2JXB A;  3O5Z A;  2IIM A;  2AKK A;  5L23 A;  1SRM A;  1PNJ A;  1ABO A;  2M51 A;  2QDL A;  2DYB A;  2SEM A;  5IHK A;  2BZY A;  1YNZ A;  2K6D A;  2O9V A;  2JTE A;  2DL3 A;  4DEY A;  4RTV A;  2EGE A;  1UHC A;  3I35 A;  2J7I A;  1OPL A;  2LX7 A;  2EYW A;  5FW9 A;  1RLQ C;  2DF6 A;  2K79 A;  3GBQ A;  2FO0 A;  3U23 A;  3ZL7 C;  2W0Z A;  4EIK A;  4Z89 A;  1K9A A;  1SRL A;  1SHF A;  1OOT A;  4CC4 B;  4LUE A;  2RQW A;  2CUB A;  2JT4 A;  1V1C A;  2KE9 A;  1B3Q A;  1ZUU A;  1AWX A;  2ED0 A;  1PHT A;  2FRY A;  1KSW A;  3H0F A;  1Z9Z A;  2LP5 A;  3JV3 A;  5GJW B;  3UAT A;  2DRK A;  3UF4 A;  2MCN A;  5IHN A;  2DL4 A;  1M30 A;  1W6X A;  1GCP A;  1QLY A;  2DVJ A;  2NWM A;  2V1Q A;  1AD5 A;  3EG0 A;  3I5S A;  4Y92 A;  5IXB A;  4JJC A;  2KR3 A;  4HVV A;  4Z88 A;  4RTU A;  2KT1 A;  1SPK A;  1UUE A;  4JJD A;  1X43 A;  3NMZ C;  1X6G A;  3M0R A;  2LJ3 A;  1IO6 A;  2J6O A;  4JJB A;  1AWO A;  1AEY A;  1YP5 A;  2DM1 A;  1X2K A;  2VVK A;  3H41 A;  3ULR B;  1I1J A;  4RTX A;  2C0I A;  4OMQ A;  2K3B A;  4RTT A;  1LCK A;  3VRZ A;  3A98 A;  1GBR A;  2EVR A;  1PKS A;  1AWW A;  4HVU A;  1SEM A;  1YCS B;  2KRO A;  2KT8 A;  5ECA A;  4KRT A;  1UJY A;  2L3S A;  3H0H A;  4F14 A;  1RUW A;  2L2P A;  2GTO A;  1QWE A;  2DMO A;  2KGT A;  2LQW A;  1ZSG A;  2JM9 A;  4WCI A;  3M0P A;  2K9G A;  4D8D A;  1UG1 A;  2A08 A;  2EW3 A;  2JMC A;  5GJV B;  1U06 A;  1X27 A;  1QKW A;  3FJ5 A;  1ZLM A;  1NLP C;  3EGU A;  4RTW A;  3EG1 A;  2EPD A;  2LNH B;  1GBQ A;  2DL5 A;  1X2Q A;  4K11 A;  3UA6 A;  4LUD A;  1OEB A;  4J9D A;  1YN8 A;  1MV0 B;  1X69 A;  3EHQ A;  4AFU C;  2LJ1 A;  2OI3 A;  2XMF A;  3VS0 A;  1WX6 A;  1ZX6 A;  2RF0 A;  1BB9 A; 
#chains in the Genus database with same CATH topology
 1TOV A;  3MEW A;  1T3S A;  1K76 A;  4L6V 5;  4C8Q D;  1K8A U;  1G3T A;  2SRC A;  2E10 A;  4OMM A;  1QVF S;  1WJQ A;  1OI1 A;  3TCJ A;  1P92 A;  2I2L A;  1WHM A;  3PGG A;  1OYX A;  2YLB A;  4J7F A;  2HZY A;  2COW A;  4OMP A;  5LL6 S;  2ECZ A;  2Y4X A;  4F7U B;  3CMA A;  1EIF A;  5GAN e;  3C95 A;  4XTY A;  2EYQ A;  2YUQ A;  1XJW B;  3JB9 H;  4OB0 B;  1KFZ A;  2PTK A;  1YJN A;  1VQK A;  3CC2 A;  2DXC A;  3CCQ Q;  5GAN 2;  3A5Z B;  2K2V A;  2VXF A;  3PVL A;  2NYS A;  2CZ1 B;  1G2B A;  2JNG A;  1M8M A;  1KC8 C;  1WGS A;  1S72 T;  2EYY A;  3OQ5 A;  2HSP A;  5I11 A;  2K4Y A;  2DER A;  2JVV A;  2YSQ A;  2DKG A;  4C8Q G;  2QQR A;  4B6M A;  2KXD A;  2M16 A;  5CKD A;  2BUD A;  3TRE A;  3RBB B;  1RL2 A;  1AWJ A;  3JCM d;  1UE9 A;  4C0D B;  5HKC A;  1T0H A;  4C8Q A;  4QKU A;  2RPN A;  4M7A E;  2XDP A;  1M90 C;  2F2X A;  2LZ6 B;  4FW2 A;  5IH2 A;  2DXB A;  1NM7 A;  1G5V A;  3VKI A;  1M27 C;  3LGL A;  1RI9 A;  4RCC A;  2DXU A;  2R5A A;  2JMA A;  3KFV A;  5GAO q;  2C0O A;  4GBQ A;  1B7T A;  1Q82 U;  3M57 A;  2HD0 A;  1WYX A;  2J06 A;  2OTJ T;  3HTR A;  2MOX A;  1TTH B;  2YUO A;  4R55 A;  4PJM A;  1MND A;  2ZPI B;  1HJD A;  3OYG A;  5LJ3 f;  2LVM A;  4M78 E;  1I81 A;  4XU0 A;  2RMO A;  2LMJ A;  1TXQ A;  4AG2 C;  3MEV A;  4R0K A;  1M1K R;  1WFW A;  4DOW A;  3V7R A;  1QCN A;  1W2B A;  4J9G A;  1VQ6 T;  2M02 A;  3OYM A;  2D0N A;  2XID A;  4M7D E;  4V2S A;  1VQ9 A;  4PFO A;  3PTA A;  2E12 A;  3CQT A;  4RTZ A;  3MEA A;  1YI2 T;  3UA7 A;  5CO7 A;  4Y28 E;  3JAM E;  2DBK A;  4KUD K;  3OW2 S;  2L3Q A;  4M75 D;  4XQ3 A;  1Q95 G;  5GAN 6;  4IIM A;  4X9D A;  3RR6 A;  4WTO B;  1Q81 C;  1N9R A;  2F5K A;  5CCA A;  1R8O B;  5LJ3 e;  2AZV A;  1BKB A;  1WHH A;  2YT6 A;  4P5N A;  3KBG A;  2I0N A;  5CQY A;  2L5Q A;  3HFN A;  1H92 A;  2KRM A;  2P0K A;  1KIK A;  1B34 A;  3PVQ A;  3BW1 A;  1SKU B;  2FZC B;  4E7L A;  3QHS A;  1VQK Q;  5GAN h;  1YFN A;  4ELZ C;  1LJO A;  3SHW A;  2E6Z A;  4M77 B;  1ABQ A;  2CP0 A;  1VQ5 T;  4PJO A;  1WLP B;  3C12 A;  3G4S A;  2ED1 A;  4C92 E;  1ZHI A;  2X3W D;  3QWY A;  4E2F B;  2GQV A;  5IN1 A;  4HCK A;  3M54 A;  2VB6 A;  1JB0 E;  5KCH A;  1Y71 A;  2DIG A;  2L3R A;  4AFQ C;  2DE0 X;  1JEG A;  4OGC A;  2DET A;  1QCF A;  3AHU A;  5FU6 B;  1SSF A;  1HK9 A;  2X4W A;  1I07 A;  1YIJ Q;  1TU0 B;  4HCZ A;  4C92 F;  4F16 A;  3LH5 A;  5KE2 A;  2ESW A;  1VQ4 Q;  5LJ3 d;  2HNI A;  2K2M A;  4JJN K;  1KC8 R;  1XNI A;  1EFN A;  4XU3 A;  1WXT A;  4KBM B;  3RMQ A;  4E6R A;  1K9M U;  1RLP C;  3J80 E;  3RKW A;  1H3Z A;  1M9S A;  2L0A A;  3O8V A;  4Q5W A;  3AT1 B;  1TUC A;  2EGA A;  2ZPF B;  1VQO T;  1RAF B;  3SDZ A;  2QK0 A;  4BY6 C;  3MKD A;  1KK7 A;  5A0D A;  5EG2 A;  2CUD A;  1UFF A;  1UTI A;  4JZ3 A;  3G6E T;  2YRC A;  4JRP A;  1FYN A;  1VQ9 Q;  2M1H A;  4KUI A;  1NYG A;  2OJ2 A;  4QVD A;  2CT3 A;  5GMK e;  2LT4 A;  3I55 A;  1ZQ1 A;  2ZPE B;  3GPL A;  1YIT T;  1W2B P;  4ZGE B;  4MDX A;  1KQS A;  5KYU B;  5GAN j;  2AKL A;  2WAC A;  2RJF A;  2QEX A;  2G6F X;  1SHG A;  4X1V A;  2MI6 A;  2KY9 A;  3BY7 A;  1IB8 A;  1QWF A;  1R0B G;  3E9G A;  3FRN A;  3RER A;  1RAB B;  3IQL A;  1YJ9 Q;  4J9B A;  4GLM A;  2E3I A;  1VQN A;  1XOV A;  2HKN A;  4FW1 A;  1ZBX A;  2JXB A;  5A0L A;  2XKO C;  1KG1 A;  2AKK A;  3EFS A;  1QVG P;  1K8A R;  1ABO A;  2M51 A;  2QDL A;  1VQM T;  2ZPH B;  3CMA Q;  4M77 G;  4OB3 B;  1VQN Q;  2K6D A;  1KQ2 A;  2DL3 A;  3FIF A;  3EH1 A;  1OPL A;  2EQU A;  1BIA A;  5AYF A;  3GBQ A;  1EX4 A;  1PC0 A;  3F70 A;  2W0Z A;  1I4K 1;  4Z89 A;  4NS5 A;  2JN0 A;  3HSB A;  3CCQ A;  4M7D C;  1SHF A;  4RG8 A;  4E7K A;  2HQH A;  2O01 E;  1VQP A;  3CCJ A;  2RI3 A;  3OYN A;  5GAO m;  2CUB A;  2JT4 A;  5KCO A;  3HP9 A;  2FZG B;  2CS7 A;  2ED0 A;  2Y4Y A;  1KSW A;  3QUI A;  3CCE Q;  3H0F A;  1D0Y A;  4FYW B;  3G7Z A;  1M90 R;  1FMW A;  2RK2 A;  1Q82 R;  3HRT A;  3UF4 A;  4J8O A;  1VQP Q;  4A4H A;  4WF2 A;  2MCN A;  2RJD A;  3J81 E;  1M2O A;  1YIJ T;  5DY9 A;  4UC4 A;  2V1Q A;  3CME Q;  5IXB A;  3CC7 Q;  1VOM A;  3CCU A;  4X9C A;  1IRE B;  3L1A A;  4LXC A;  3OS1 A;  1X43 A;  3CD6 A;  5CKE A;  1X6G A;  4C8Q C;  3CXC S;  3G71 A;  2K3Y A;  2DM1 A;  3CC4 A;  3CC4 T;  1WZO A;  3ME9 A;  4C5H A;  1Q86 R;  3G71 T;  3CD6 Q;  1RAI B;  4MZP A;  1D3B A;  1LCK A;  3VRZ A;  3CD6 T;  4DA4 A;  1D1A A;  1AWW A;  8AT1 B;  3CPF A;  4HVU A;  2K5I A;  3A8L B;  5CKF A;  2KT8 A;  1M1K C;  3CCU T;  4PLL A;  1YCY A;  1QCO A;  2EAY A;  2L2P A;  5DM7 R;  1QQJ A;  2CP7 A;  1YJ9 T;  3FC3 A;  2RH2 A;  1NE8 A;  2V8J A;  1QVP A;  2A08 A;  3CC7 T;  2ATC B;  2ZGW A;  4KH1 B;  2QTV A;  3WVD B;  3VU3 C;  1VQP T;  3OYB A;  4LDV A;  4PJN A;  4C8Q B;  1IGQ A;  5KYY A;  1D1B A;  3UA6 A;  1OEB A;  1MV0 B;  1O9S A;  2V8K A;  4JLG A;  4JUV A;  1JJ2 A;  4AFU C;  2LJ1 A;  2XMF A;  1WX6 A;  1M1K U;  4HKE A;  3JCM f;  2HKQ B;  5KYW B;  2ZCF B;  1XTD A;  3QJ6 A;  2QYZ A;  1ZSZ B;  1CSK A;  3OYY A;  3JB9 I;  1BU1 A;  1KD1 U;  1JBM A;  3CBO A;  1VQN T;  1U1T A;  3MJX A;  3LLR A;  2OTL Q;  1RAH B;  1KC8 U;  4IKF A;  2EYX A;  4XTZ A;  1U1S A;  1K9M R;  3TU4 K;  1WA7 A;  2F5T X;  2CH4 A;  1UDL A;  2DA9 A;  2HL5 C;  2X51 A;  2LT1 A;  4J9F A;  4EMG A;  3EHR A;  3R6N A;  2VWF A;  4D6W A;  1WIE A;  1V29 B;  5DLQ E;  4QVC A;  2EQM A;  3G6E A;  2DEU A;  3E9F A;  1AZE A;  5FRO A;  1WXU A;  4LDW A;  4M4Z A;  3M4G A;  4AG1 C;  9ATC B;  2BZ8 A;  2QAS A;  1JQQ A;  1WHL A;  1GL5 A;  1YWO A;  3CC7 A;  4E7S A;  2V8I A;  2V1R A;  2L89 A;  4M7D A;  3Q1J A;  2YWW A;  1VQ4 A;  1HSQ A;  1GFD A;  2ZZD A;  1QVG A;  1WNL A;  2V26 A;  4M7D F;  1TH7 A;  4XAX B;  2MMP A;  2HEQ A;  1PRM C;  5FU7 B;  4LNP A;  1UB4 A;  2DD5 A;  4KH0 B;  4OMO A;  4HVW A;  3LX7 A;  3V7C A;  4KGV B;  1YJW Q;  1VUB A;  1Y7X A;  4M75 F;  4BUG A;  5KYX A;  3OW2 A;  1BK2 A;  1RAA B;  5GAN f;  3EG3 A;  3TSW A;  2XD0 A;  2NUT A;  2F69 A;  3JCM g;  3OYC A;  2LRQ A;  4A4G A;  1YI2 Q;  3EGX A;  2DJZ A;  3OSS C;  1VQ5 A;  4M7D B;  1FMK A;  1ZSZ A;  1O75 A;  3EFO B;  3OYK A;  2QXF A;  4ANJ A;  1MMN A;  3VYH B;  1XQH A;  2DPP B;  2WSC E;  4RUG A;  2DRM A;  1U5S A;  3M0T A;  4J6Y A;  5FRN A;  1ARK A;  4PKC C;  1UGP B;  3CBP A;  4BE1 A;  5I2M A;  2Z0W A;  2GFA A;  4FYV B;  4B9W A;  1JU5 C;  5AT1 B;  3HRS A;  2RQT A;  4A54 A;  3VS4 A;  5IT9 E;  2ZAE A;  2YHT A;  2LDM A;  2RD1 A;  1JJ2 P;  4M7A F;  1M3A A;  4CC2 A;  4ORZ A;  3VS6 A;  3VUB A;  2A7Y A;  3JCM X;  3M53 A;  2HQE A;  1WDX A;  1I5O B;  3UPU A;  1G3S A;  2LCL A;  2HBW A;  1EZZ B;  4NL3 A;  1H3H A;  3CCJ Q;  1JXO A;  3JRZ A;  2EFI A;  3BE3 A;  3QBY A;  3M56 A;  3MP6 A;  3SB2 A;  1NJI R;  3I56 Q;  2D1X A;  3A8H B;  4ZTJ A;  2RK1 A;  4C92 A;  1K0X A;  2FRW A;  1M5Q 1;  3OBY A;  3NFC A;  3NGP A;  2VXE A;  2AK5 A;  1OUL A;  4TVR A;  4M7A D;  2FYK A;  2W10 A;  1C0M A;  4C0D C;  3D7S B;  2A28 A;  1M1F A;  2OTJ A;  1YIT A;  3I55 T;  2ENM A;  1FMV A;  1NG2 A;  4QQ6 A;  1B07 A;  5FWC A;  3DKM A;  4CC7 A;  2ROT A;  2MIO A;  1VQO Q;  3CPW A;  4PJO F;  2GF7 A;  2LQN A;  2FPE A;  2KBT A;  3DLM A;  2GCX A;  4N0A A;  8ATC B;  4QQD A;  3A8O B;  1VQO A;  1Z9Q A;  2J6F A;  2QA4 T;  1Q7Y C;  2EBP A;  3ER0 A;  5GAM h;  3L2W A;  4M7A B;  4OMN A;  2JUF A;  1E6G A;  4OF1 A;  5GAN 7;  4EMH A;  4O5V A;  1Q86 U;  2KEA A;  2KYB A;  2F2W A;  3CEY A;  3S3O A;  5GAN g;  2RQV A;  1KD1 R;  1BI1 A;  1ZUY A;  1QKX A;  2WSE E;  4FCY A;  3C94 A;  4J6W A;  5LJ5 d;  2CRE A;  2NUT B;  1VQ6 Q;  2E41 A;  2FZK B;  1G3W A;  1GFC A;  4OP0 A;  5J26 A;  3PFS A;  2P0P A;  4KUL A;  1VQ5 Q;  3UT1 A;  1M2V B;  3VRY A;  4AFZ C;  1VQL Q;  1T3L A;  5A0G A;  4ME7 A;  5CK9 A;  2ZPG B;  1VQK T;  2VGM A;  5GMK m;  5HY6 A;  5IXF A;  2YUP A;  1UGV A;  3S6W A;  3CMA T;  1PSE A;  4M7A A;  2ROL A;  5KYU A;  5GAM d;  4FU6 A;  1K73 R;  3EG2 A;  3VS3 A;  4ESR A;  3VS5 A;  2FHD A;  4N4G A;  3JB9 F;  2IIM A;  2PUO B;  4RKU E;  3RUX A;  1TSF A;  2BZY A;  2O9V A;  2JTE A;  4PK4 A;  3CCS Q;  2EGE A;  3V8K A;  5FW9 A;  2KAF A;  3RDV A;  2G3R A;  2QA4 A;  1YIT Q;  1MMG A;  3X26 B;  4LD6 A;  1OOT A;  4O6J A;  4OVA A;  1VQ9 T;  4C5E A;  5KYW A;  1B3Q A;  2QA4 Q;  1PHT A;  3NTK A;  3HL8 A;  4PL6 A;  3JV3 A;  2X35 A;  5GJW B;  2CZ0 B;  4NL2 A;  3R6O A;  3EGX B;  3HPW A;  1BYM A;  5D6Y A;  1M30 A;  3FEO A;  4F04 B;  4AMC A;  4M75 A;  1KHC A;  4L5G A;  2EWN A;  4VUB A;  4HVV A;  4RTU A;  3INZ A;  2KT1 A;  1SPK A;  5GAN 3;  1FXX A;  4M78 B;  2B8A A;  1PD1 A;  4C0G A;  2J6O A;  3OA6 A;  3JCM e;  2COY A;  1MNE A;  3X25 B;  1PCX A;  2BE7 D;  5CAI A;  4OMQ A;  4IUV A;  1D09 B;  3A98 A;  2CP2 A;  1PKS A;  2XU8 A;  5KE3 A;  1B34 B;  1PG5 B;  1SEM A;  3RIR A;  4YTL A;  3CPW S;  1OU8 A;  4F7U E;  1UJY A;  2PQW A;  5CVI A;  4F14 A;  3JB9 J;  1VQ7 A;  1QVF P;  2LQW A;  4WCI A;  4XTW A;  1F1B B;  1UG1 A;  2VAS A;  2PVD B;  4KT0 E;  4J83 A;  2EW3 A;  2X4J A;  3M5A A;  3FJ5 A;  1ZLM A;  3CCM Q;  2EPD A;  2DIQ A;  3LGF A;  2DL5 A;  4BDZ A;  3VJP A;  1YN8 A;  1X69 A;  4C8Q F;  2RO0 A;  4JRK A;  1RAD B;  3CCS A;  2K5L A;  3EHQ A;  2OX7 A;  1Y07 A;  4XK8 E;  1OZ3 A;  4M75 G;  3OYI A;  5I21 A;  3CC2 T;  5C6S A;  2LCS A;  1BI2 A;  2L8D A;  2RHX A;  1KJW A;  2HL3 A;  5HCK A;  1TWB A;  1MMA A;  2CGH A;  3JCM J;  1J3T A;  1Y57 A;  1D3B B;  1VIE A;  3M58 A;  1NYF A;  3CCV Q;  2DZ9 A;  2RHZ A;  4DQ2 A;  2X4X A;  1N5Z A;  2RN8 A;  1JXM A;  3URG A;  2KRS A;  2M9U A;  3VV0 A;  3OS0 A;  5LJ5 j;  2FG0 A;  4MML A;  3QJY A;  4JLI A;  2H8H A;  3PMT A;  4DBH A;  5LJ5 e;  3QYH B;  3SWN C;  2DJQ A;  1MUZ A;  1AOJ A;  2E65 A;  4M78 G;  2DTI A;  3CCM T;  1NJI U;  3EGD A;  3G4S Q;  3H0I A;  1MHN A;  1IHW A;  1OZ2 A;  2X3X D;  1PD0 A;  3M0Q A;  4BB7 A;  2NUZ A;  2EQJ A;  2DXT A;  1X01 A;  5IHI A;  5FU6 C;  4ELY C;  4AFS C;  1PKT A;  4BD3 A;  3TEE A;  3M55 A;  4A63 B;  4XU2 A;  3OYH A;  1YHQ T;  2JS0 A;  2GGR A;  1VYT A;  1I0C A;  2JW4 A;  2RJC A;  4FYX B;  5GAN 4;  3L2V A;  1H8K A;  3THK A;  1UGQ B;  2RNA A;  1Q82 C;  3L42 A;  2JS2 A;  3PIP A;  4M7A G;  3M0U A;  1VQ8 Q;  2A37 A;  1AT1 B;  1NLO C;  3VS2 A;  4E7I A;  3I9Q A;  3P8H A;  3OS5 A;  3X28 B;  1ZUK A;  1IGU A;  2PVO B;  3OBW A;  3GNG A;  4F7U F;  2CP5 A;  1PSF A;  4IUP A;  3SWN B;  2DTO A;  3X20 B;  4F7U A;  4IUQ A;  3ASK A;  2YRV A;  2F2V A;  4LDY A;  4ZGD B;  1ZBJ A;  2O2O A;  3CXC A;  2BE9 B;  4BDY A;  3JCM W;  1K73 C;  4DEX A;  2CP6 A;  1Y0M A;  4J9C A;  2E64 A;  1OPK A;  1C6V X;  4C0Z A;  3FLG A;  2DTH A;  1IRX A;  1OV3 A;  1K8A C;  2YXY A;  2E4H A;  2X4Y A;  3OSV A;  3CCV T;  2RHY A;  2JM8 A;  1WHG A;  2FVU A;  4PFZ A;  1NPR A;  3OB9 A;  3DB3 A;  2IPO B;  1ACM B;  2KK4 A;  1QMC A;  1RAC B;  1UGS B;  3MP8 A;  2RJE A;  2C0T A;  5GAN 5;  1W4S A;  1A0N B;  3CC2 Q;  3J7A F;  1D0Z A;  2KDS A;  1BI0 A;  2EKO A;  2VGN A;  2ZPB B;  4QVZ A;  1R0C B;  1WXB A;  3REB B;  1VIF A;  2EIF A;  2QQ9 A;  5LJ3 j;  2DVE A;  1CKA A;  2DZC A;  1VYV A;  2PNI A;  1TUD A;  2HDA A;  5GAO p;  2A3L A;  4EDU A;  1MV3 A;  3A8M B;  1VQL T;  1Y96 B;  4BAC A;  5GAO n;  4OB2 B;  2KNB B;  5LJ5 h;  2H3J A;  1NZ9 A;  1UEB A;  2HCK A;  1VQ4 T;  3T9N A;  2CP3 A;  3A1P A;  2YLC A;  3PE0 A;  5CR2 A;  2QTX A;  2CZ7 B;  3OMC A;  2MPX C;  4J5Y A;  4FSS A;  2K5F A;  4LN2 A;  3CCJ T;  5J3B A;  3G1J A;  2BTT A;  3TVT A;  1YJW T;  4HCB A;  2OAW A;  2J05 A;  5HK3 A;  1X6O A;  2KXC A;  3EH2 A;  4MZT A;  2D8J A;  2QQA A;  2EJ9 A;  3MO8 A;  2K57 A;  3OYF A;  4M7A C;  2LTO A;  2CSQ A;  4FSX A;  1PWT A;  1AZG B;  1VA7 A;  5GMK i;  1LPL A;  1UJ0 A;  4E47 A;  5GAO r;  5GMK l;  3I55 Q;  2LQ8 A;  4OML A;  2JTM A;  1PM3 A;  2EQI A;  5FWB A;  5LJ5 f;  2RB6 A;  2KYM A;  5EC7 A;  3HRU A;  2QEX T;  4FT4 A;  4BI4 A;  1X6B A;  2D0Q B;  2LCC A;  3PT9 A;  5GMK j;  3CME T;  4M78 C;  2FEI A;  2PZ1 A;  2NLU A;  2VYT A;  3CBM A;  2X9H A;  3QO3 A;  4F17 A;  2HMA A;  2VKN A;  1U3O A;  2GQI A;  3CCE T;  2KVQ G;  2ABL A;  3QG1 A;  4IIO A;  4JPB W;  3LWI A;  4PJJ A;  2MF2 A;  2QG9 B;  1NEB A;  4LDU A;  3O5Z A;  3L2Q A;  1SRM A;  4QQG A;  3CCR T;  1WQW A;  4HT9 A;  3S3M A;  2EQK A;  1YJ9 A;  2SEM A;  1WJS A;  3CCL T;  4RTV A;  3I35 A;  4DBF A;  4QW2 A;  2LX7 A;  3DB4 A;  1RLQ C;  2DF6 A;  2K79 A;  3U23 A;  3ZL7 C;  3CCL Q;  5CIU A;  3HHT B;  2LQK A;  5CKH A;  2R58 A;  2PU9 B;  1NPP A;  4BE0 A;  4PJO D;  2BIV A;  5KH6 A;  3M9Q A;  2RQW A;  4EMK C;  4X34 A;  3V8L A;  1V1C A;  2JTF A;  1MGQ A;  1ZUU A;  1RAE B;  1AWX A;  2JZ2 A;  3I56 A;  3KXT A;  1Z9Z A;  3QPH A;  1N8R U;  3LYI A;  5IHN A;  3ZFJ A;  3V7S A;  2VUB A;  5GMK h;  1W6X A;  1GCP A;  1QLY A;  2DVJ A;  2NWM A;  3EG0 A;  3I5S A;  5FRM A;  3OYA A;  2KR3 A;  4Z88 A;  4ZTF A;  2QI2 A;  2RI2 A;  4JJD A;  4C8Q E;  4KGZ B;  1TUG B;  1X75 C;  1U8R A;  3NMZ C;  1YIJ A;  3ZEH A;  2LJ3 A;  5I2S A;  1RI0 A;  3SFM A;  4A4E A;  1M1G A;  4JJB A;  1AWO A;  4BY6 B;  1AEY A;  3MP1 A;  2KSS A;  5D6W A;  1YP5 A;  4N4I A;  1I1J A;  7AT1 B;  2C0I A;  2QQS A;  5GAM j;  3EG9 A;  5A2Q E;  3G71 Q;  4FL6 A;  4JS5 A;  2VV5 A;  4LD9 K;  2DK3 A;  2O4X A;  3N5B B;  3CCQ T;  2IG0 A;  1YCS B;  1VQM Q;  3GOX A;  1BCM A;  4KRT A;  4BI3 A;  5M9O A;  1YI2 A;  1KQS P;  3JCM V;  1RUW A;  2HQX A;  1ZA2 B;  2DMO A;  2KGT A;  1VQM A;  3I56 T;  3JB9 D;  4CI0 C;  3QDF A;  1LVK A;  1X27 A;  1QKW A;  1NLP C;  1BCO A;  3EG1 A;  1WQ7 A;  2LNH B;  3EFR A;  1Q81 R;  1GBQ A;  1R77 A;  4PJL A;  2XK0 A;  2IVW A;  5KYX B;  3FJP A;  3H6Z A;  1HYO A;  2VC8 A;  1IZ6 A;  3VS0 A;  2QEX Q;  2KQW A;  1ZX6 A;  4JRI A;  4A4K A;  3CPW P;  3BDL A;  5LJ5 g;  3H8Z A;  2C06 A;  3LW5 E;  3RKX A;  1K4U S;  3MCA B;  2FPF A;  2K7A A;  4M75 B;  2DAQ A;  1GCQ C;  4C5I A;  4MMK A;  1D0X A;  2DD4 A;  3EG9 B;  4DBQ A;  1FWZ A;  3VS1 A;  2P84 A;  4RG2 A;  1NBE B;  5D7U A;  4N4H A;  2RQR A;  6AT1 B;  2MYS A;  3M4Y A;  2EKH A;  4J9H A;  5HK0 A;  3CCR Q;  4OGE A;  3NHN A;  2D8H A;  4Y91 A;  3PMI A;  1M3C A;  3VYG A;  1QW1 A;  2EGC A;  3JSC A;  1LOJ A;  1QP3 A;  1G83 A;  3A8G B;  4XTU A;  1JJ2 S;  3FB9 A;  2EYZ A;  4JZ4 A;  1BBZ A;  3CME A;  2XDB A;  2FPD A;  4J6X A;  1N9S A;  1QVF A;  1PRL C;  3M0S A;  1UGR B;  4C92 B;  3REA B;  4IUU A;  2RHU A;  1GXI E;  2LC4 A;  5GAO l;  4J7I A;  4M77 C;  1N6A A;  2YUN A;  3MHX A;  2JJ9 A;  1S72 A;  4XTX A;  1E7O A;  3E19 A;  1E6H A;  2O31 A;  4M77 A;  3P8D A;  4ZNX A;  3G6E Q;  2O4X B;  4J9I A;  1HD3 A;  4M75 E;  3BFM A;  4QT7 A;  4M77 F;  1W70 A;  1KD1 C;  2E1H A;  2AIR B;  1GRI A;  4E7H A;  1S72 Q;  2GBQ A;  1LNX A;  2RA2 A;  2GNC A;  2PVG B;  1AVZ C;  1UEC A;  2CKK A;  3G4S T;  3QZ9 B;  4A53 A;  2LJ0 A;  1N27 A;  1YJW A;  4HXJ A;  1UHF A;  2HSE B;  1W2B S;  4PFP A;  2AHJ B;  2FL7 A;  3GP8 A;  2DX1 A;  3TQ7 P;  5L8R E;  1WHK A;  3GF5 A;  1KQ1 A;  4MZM A;  2DBM A;  1M4Z A;  3I5R A;  3RMS A;  1M8V A;  3WVE B;  4M78 D;  1ZSZ C;  4F7U G;  5KYN A;  3S3N A;  3LWH A;  1Q7Y U;  2XHC A;  3JCM P;  2CYZ B;  3OYL A;  4HT8 A;  1TS9 A;  4JDS A;  2E5K A;  2NUP B;  4C92 D;  4EMK B;  2RQU A;  1SSH A;  1WPY A;  2KRN A;  3DLL A;  2CSI A;  3RNJ A;  2CZ6 B;  3OYJ A;  3L2Z A;  1S1N A;  4PNO A;  3X24 B;  1K0S A;  2YDL A;  3JCM h;  5KYY B;  3JB9 G;  2M0Y A;  1VQ6 A;  3OMG A;  1I5L A;  1N8R R;  4B9X A;  3ZBD A;  2CT4 A;  3JCM Q;  2HAX A;  2XIC A;  3RKY A;  2HBP A;  2EJG A;  2RM4 A;  3QDR B;  4ZN1 A;  2CH4 W;  2KI7 A;  4J9E A;  3KUF A;  4A4F A;  5DLO A;  3GIB A;  2A36 A;  1H64 1;  3V8J A;  4OB1 B;  3CCL A;  3SEM A;  1SF9 A;  1C1A A;  1NEG A;  2B86 A;  4RCB A;  3VS7 A;  2LNV A;  4M7D D;  4E7J A;  3CCR A;  3FDR A;  2XI9 A;  2BZX A;  3E2U A;  1VQ8 T;  3TSZ A;  3QWX X;  4BI8 B;  3WXM B;  2XDD A;  2XG8 D;  3CCE A;  3HKS A;  2H3E B;  5C0M A;  1GCQ A;  2E6N A;  1YJN Q;  1T0J A;  1G8X A;  3UDC A;  2DIL A;  2O9S A;  4M78 A;  1OQK A;  2DO3 A;  3CCU Q;  1Q86 C;  1D1C A;  4PJO E;  3MET A;  2DL8 A;  3QYG B;  2QGF B;  2P4T A;  4ZGJ B;  5LJ3 g;  2J6K A;  3RES A;  4C5G A;  2L3P A;  2DYI A;  4M77 E;  1BIB A;  5GAM g;  4Z02 A;  4PJO G;  3CC4 Q;  1KQS S;  2GFU A;  5GAM f;  3L2U A;  3L2R A;  3H9N A;  3NPF A;  2R57 A;  1TG0 A;  3NTI A;  4M75 C;  2MWO A;  3OS2 A;  2QQB A;  3PIO A;  3GLX A;  2DFU A;  4CRI A;  3HFO A;  3C0C A;  1V76 A;  2P4R A;  2P0Q A;  2QDY B;  1YJN T;  2MWP A;  4C0F A;  4XU1 A;  5GAN d;  1YHQ A;  1OX8 A;  1K1Z A;  1CKB A;  3JCM b;  3BDU A;  4CC3 A;  1G3Y A;  4RMO A;  5CKB A;  1VYU A;  2A0F B;  2E3H A;  3QXE B;  4IUR A;  3LH0 A;  2DNU A;  2D9T A;  1YWP A;  2GTJ A;  3CXC P;  4L59 A;  4LE9 A;  4E7Z A;  2COZ A;  2DL7 A;  4PJO B;  5GAM e;  1WI7 A;  3GNF B;  2AT1 B;  3QSU A;  1WJR A;  1OX9 A;  2DLP A;  2E5Q A;  1M3B A;  4XTV A;  2NUP A;  4EMK A;  5LJ3 h;  1FX7 A;  1VQL A;  1VQ7 Q;  4RTY A;  1JO8 A;  1YBY A;  2O88 A;  4AT1 B;  2AZS A;  4Z8A A;  5I22 A;  4D8K A;  4JS4 A;  1K9M C;  4HA8 A;  1BI3 A;  1W1F A;  2CDT A;  2MAM A;  3PNW C;  2LX9 A;  3UWN A;  4HCC A;  5FU7 C;  5L23 A;  3OY9 A;  1PNJ A;  3JCM c;  2OTL A;  2DYB A;  5IHK A;  1YNZ A;  1QP2 A;  4DEY A;  1UHC A;  4C92 C;  2J7I A;  2EYW A;  1KHI A;  1HXD A;  3EGD B;  2FO0 A;  3CCS T;  4EIK A;  4FIB A;  1K9A A;  3P8B B;  4FM4 B;  4C92 G;  1SRL A;  3MEU A;  4CC4 B;  1WHJ A;  4LUE A;  1QVG S;  2KMT A;  2OAU A;  4MDW A;  3MPU B;  4R56 A;  2WSF E;  4FYY B;  2E70 A;  2KE9 A;  5D6X A;  2FRY A;  1AHJ B;  1M90 U;  3CCV A;  2LP5 A;  3UAT A;  2DRK A;  1DJ7 B;  1JRI A;  1SG5 A;  1VQ7 T;  2JOY A;  2DL4 A;  1IHV A;  5J39 A;  3OW2 P;  4Y92 A;  2OTJ Q;  1AD5 A;  4JJC A;  3M59 A;  2YRD A;  1MMD A;  1ZA1 B;  2F1L A;  1NJI C;  1UUE A;  2FB7 A;  2QAZ A;  3M0R A;  5CQX A;  1IO6 A;  2RHI A;  4EPC A;  5GAN 8;  3QII A;  3NTH A;  4M77 D;  4NOY A;  1X2K A;  2VVK A;  1VQ8 A;  3H41 A;  3ULR B;  2K3X A;  4RTX A;  4LDX A;  4M7D G;  2M0O A;  3EAE A;  3SD4 A;  2Y90 A;  2K3B A;  4RTT A;  2D6F A;  1IXD A;  5IAY A;  1GBR A;  2EVR A;  4ZN3 A;  4II1 A;  3C4S A;  1YHQ Q;  4GY5 A;  2KRO A;  1I8F A;  1K73 U;  5ECA A;  5FLX E;  2EJF A;  4BE2 A;  1N8R C;  2L3S A;  3H0H A;  1Y96 A;  2RI5 A;  4IUT A;  3OYE A;  2GTO A;  2PUK B;  1QWE A;  1ZSG A;  2JM9 A;  3M0P A;  1Q7Y R;  2K9G A;  4D8D A;  3E1S A;  3OYD A;  2MK5 A;  2OTL T;  2JMC A;  4N0A C;  5GJV B;  1U06 A;  3QZ5 B;  4ATO A;  3EGU A;  4RTW A;  4PJO C;  4DOV A;  4M78 F;  4PLI A;  2R5M A;  4DBR A;  1OU9 A;  1Q81 U;  1X2Q A;  4K11 A;  2DEQ A;  2BKD N;  4KGX B;  4LUD A;  4JRQ A;  4J9D A;  3VUZ A;  2QGG A;  3SWN A;  4GLK A;  1RAG B;  3QKJ A;  3CCM A;  2OI3 A;  3EFO A;  4FT2 A;  1M2V A;  2RF0 A;  4OMF B;  1BB9 A; 
#chains in the Genus database with same CATH homology
 1T3S A;  1K76 A;  1K4U S;  2LCS A;  2SRC A;  2FPF A;  2K7A A;  1GCQ C;  4OMM A;  1CSK A;  1KJW A;  5HCK A;  1BU1 A;  1J3T A;  3VS1 A;  1Y57 A;  2RQR A;  1NYF A;  2EKH A;  4J9H A;  4OMP A;  2ECZ A;  3NHN A;  2D8H A;  1M3C A;  2EGC A;  1N5Z A;  2EYX A;  1JXM A;  2RN8 A;  1G83 A;  2KRS A;  2YUQ A;  2EYZ A;  4JZ4 A;  2FG0 A;  1BBZ A;  1WA7 A;  2H8H A;  2CH4 A;  1KFZ A;  1UDL A;  2DA9 A;  2FPD A;  2PTK A;  1PRL C;  3M0S A;  4J9F A;  3EHR A;  2DJQ A;  1MUZ A;  3REA B;  1AOJ A;  3R6N A;  2VWF A;  3PVL A;  1WIE A;  1G2B A;  1M8M A;  3H0I A;  2X3X D;  1AZE A;  2EYY A;  3M0Q A;  2HSP A;  5I11 A;  1WXU A;  4M4Z A;  4AG1 C;  2NUZ A;  2YUN A;  2BZ8 A;  2YSQ A;  5IHI A;  1JQQ A;  1E7O A;  1GL5 A;  1YWO A;  1E6H A;  2O31 A;  4ZNX A;  2V1R A;  2KXD A;  4AFS C;  1PKT A;  4J9I A;  1HD3 A;  4A63 B;  3RBB B;  2JS0 A;  4QT7 A;  2GGR A;  1HSQ A;  1GFD A;  1W70 A;  1GRI A;  1AWJ A;  1I0C A;  1VYT A;  2JW4 A;  1UE9 A;  2GBQ A;  1T0H A;  2GNC A;  1AVZ C;  1UEC A;  1PRM C;  2HEQ A;  2RPN A;  1H8K A;  3THK A;  2LZ6 B;  2RNA A;  2F2X A;  2LJ0 A;  4LNP A;  2JS2 A;  5IH2 A;  1NM7 A;  4OMO A;  3M0U A;  4HVW A;  4HXJ A;  2A37 A;  1UHF A;  1NLO C;  3VS2 A;  1M27 C;  3I9Q A;  1RI9 A;  2DX1 A;  1ZUK A;  2JMA A;  3KFV A;  2C0O A;  2DBM A;  3I5R A;  4GBQ A;  1BK2 A;  3EG3 A;  3TSW A;  1WYX A;  2J06 A;  2F2V A;  2E5K A;  1ZBJ A;  2O2O A;  2MOX A;  2RQU A;  1SSH A;  2YUO A;  2KRN A;  4DEX A;  1HJD A;  2CSI A;  3RNJ A;  1FMK A;  1Y0M A;  4J9C A;  1S1N A;  1K0S A;  1OPK A;  2RMO A;  1OV3 A;  4RUG A;  2DRM A;  2YDL A;  2LMJ A;  1U5S A;  3M0T A;  4AG2 C;  1ARK A;  4R0K A;  1WFW A;  2M0Y A;  2JM8 A;  4J9G A;  2D0N A;  1JU5 C;  2CT4 A;  2RQT A;  3CQT A;  4RTZ A;  3VS4 A;  3UA7 A;  2DBK A;  2C0T A;  2L3Q A;  2CH4 W;  1A0N B;  4J9E A;  4IIM A;  1M3A A;  4CC2 A;  2A36 A;  4ORZ A;  3VS6 A;  1WXB A;  3SEM A;  1WDX A;  1NEG A;  2B86 A;  3VS7 A;  2AZV A;  3REB B;  2HBW A;  2YT6 A;  2BZX A;  1H3H A;  1JXO A;  3TSZ A;  2I0N A;  1CKA A;  3QWX X;  1VYV A;  2PNI A;  1H92 A;  2KRM A;  1KIK A;  1TUD A;  3PVQ A;  2HDA A;  2D1X A;  1GCQ A;  1K0X A;  2FRW A;  3SHW A;  1MV3 A;  1T0J A;  1ABQ A;  3NGP A;  2DIL A;  2AK5 A;  2O9S A;  1WLP B;  2ED1 A;  2KNB B;  2W10 A;  2X3W D;  3QWY A;  2A28 A;  4HCK A;  2DL8 A;  2ENM A;  2HCK A;  4AFQ C;  1NG2 A;  2DE0 X;  2J6K A;  1JEG A;  1B07 A;  5FWC A;  1QCF A;  2L3P A;  4CC7 A;  2ROT A;  3PE0 A;  2MIO A;  1I07 A;  4FSS A;  2LQN A;  4LN2 A;  4F16 A;  3LH5 A;  2FPE A;  2KBT A;  2ESW A;  2BTT A;  3TVT A;  3NPF A;  1TG0 A;  2K2M A;  2OAW A;  2J05 A;  1Z9Q A;  2J6F A;  2KXC A;  2EBP A;  2D8J A;  1EFN A;  1WXT A;  4E6R A;  3C0C A;  1RLP C;  2P4R A;  4OMN A;  1E6G A;  2CSQ A;  1PWT A;  2L0A A;  1AZG B;  1VA7 A;  2KEA A;  1TUC A;  1K1Z A;  2KYB A;  2EGA A;  1CKB A;  2F2W A;  1UJ0 A;  4CC3 A;  2RQV A;  1ZUY A;  1QKX A;  1VYU A;  2CRE A;  2CUD A;  4OML A;  1UFF A;  2DNU A;  1UTI A;  4JZ3 A;  2EQI A;  5FWB A;  1YWP A;  2GTJ A;  2KYM A;  1GFC A;  1FYN A;  4LE9 A;  5EC7 A;  2DL7 A;  1NYG A;  2OJ2 A;  3VRY A;  4AFZ C;  1WI7 A;  2CT3 A;  1T3L A;  1X6B A;  2DLP A;  1M3B A;  2FEI A;  2PZ1 A;  5IXF A;  2AKL A;  4F17 A;  2YUP A;  1UGV A;  2VKN A;  1JO8 A;  2G6F X;  4RTY A;  2O88 A;  1SHG A;  2AZS A;  1U3O A;  4X1V A;  2ROL A;  4Z8A A;  5I22 A;  4D8K A;  1QWF A;  2GQI A;  3IQL A;  4J9B A;  4GLM A;  2ABL A;  4IIO A;  4JPB W;  1W1F A;  2CDT A;  3EG2 A;  1XOV A;  3VS3 A;  4ESR A;  1NEB A;  3VS5 A;  2JXB A;  3O5Z A;  2IIM A;  2AKK A;  5L23 A;  1SRM A;  1PNJ A;  1ABO A;  2M51 A;  2QDL A;  2DYB A;  2SEM A;  5IHK A;  2BZY A;  1YNZ A;  2K6D A;  2O9V A;  2JTE A;  2DL3 A;  4DEY A;  4RTV A;  2EGE A;  1UHC A;  3I35 A;  2J7I A;  1OPL A;  2LX7 A;  2EYW A;  5FW9 A;  1RLQ C;  2DF6 A;  2K79 A;  3GBQ A;  2FO0 A;  3U23 A;  3ZL7 C;  2W0Z A;  4EIK A;  4Z89 A;  1K9A A;  1SRL A;  1SHF A;  1OOT A;  4CC4 B;  4LUE A;  2RQW A;  2CUB A;  2JT4 A;  1V1C A;  2KE9 A;  1B3Q A;  1ZUU A;  1AWX A;  2ED0 A;  1PHT A;  2FRY A;  1KSW A;  3H0F A;  1Z9Z A;  2LP5 A;  3JV3 A;  5GJW B;  3UAT A;  2DRK A;  3UF4 A;  2MCN A;  5IHN A;  2DL4 A;  1M30 A;  1W6X A;  1GCP A;  1QLY A;  2DVJ A;  2NWM A;  2V1Q A;  1AD5 A;  3EG0 A;  3I5S A;  4Y92 A;  5IXB A;  4JJC A;  2KR3 A;  4HVV A;  4Z88 A;  4RTU A;  2KT1 A;  1SPK A;  1UUE A;  4JJD A;  1X43 A;  3NMZ C;  1X6G A;  3M0R A;  2LJ3 A;  1IO6 A;  2J6O A;  4JJB A;  1AWO A;  1AEY A;  1YP5 A;  2DM1 A;  1X2K A;  2VVK A;  3H41 A;  3ULR B;  1I1J A;  4RTX A;  2C0I A;  4OMQ A;  2K3B A;  4RTT A;  1LCK A;  3VRZ A;  3A98 A;  1GBR A;  2EVR A;  1PKS A;  1AWW A;  4HVU A;  1SEM A;  1YCS B;  2KRO A;  2KT8 A;  5ECA A;  4KRT A;  1UJY A;  2L3S A;  3H0H A;  4F14 A;  1RUW A;  2L2P A;  2GTO A;  1QWE A;  2DMO A;  2KGT A;  2LQW A;  1ZSG A;  2JM9 A;  4WCI A;  3M0P A;  2K9G A;  4D8D A;  1UG1 A;  2A08 A;  2EW3 A;  2JMC A;  5GJV B;  1U06 A;  1X27 A;  1QKW A;  3FJ5 A;  1ZLM A;  1NLP C;  3EGU A;  4RTW A;  3EG1 A;  2EPD A;  2LNH B;  1GBQ A;  2DL5 A;  1X2Q A;  4K11 A;  3UA6 A;  4LUD A;  1OEB A;  4J9D A;  1YN8 A;  1MV0 B;  1X69 A;  3EHQ A;  4AFU C;  2LJ1 A;  2OI3 A;  2XMF A;  3VS0 A;  1WX6 A;  1ZX6 A;  2RF0 A;  1BB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...