2KQWA

Sars coronavirus-unique domain (sud): three-domain molecular architecture in solution and rna binding. ii: structure of the sud-c domain of sud-mc
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
TSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-structural protein 3
publication title SARS coronavirus unique domain: three-domain molecular architecture in solution and RNA binding.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 13
structure length 67
sequence length 67
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12124 Nsp3_PL2pro Coronavirus polyprotein cleavage domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.590 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kqwA00
2KAFA 2KQWA
chains in the Genus database with same CATH superfamily
5GAMj 1NJIR 4C8QC 5KYNA 4TVRA 2MYSA 5D7UA 3S3MA 4Y91A 1GRIA 2GCXA 2EQMA 3I9QA 2DLPA 3JCMV 1IGQA 1VA7A 2ED1A 3QWYA 4KGVB 3L2UA 4KGXB 2O88A 4M7AG 3M0QA 1NLPC 1M8VA 3H0HA 3R6OA 3OSSC 3VS5A 1VQNA 2FPFA 2BE9B 2JTFA 1PHTA 1OEBA 3QHSA 3EG9B 1W2BA 2E5QA 1VQOT 1N9RA 3I56Q 5LJ5g 2YWWA 1WLPB 1KQ2A 4FSSA 4RMOA 3OYKA 1M9SA 4J7IA 1LCKA 3SWNB 2KSSA 3NTHA 4A4KA 2FB7A 4C92E 2NUTA 2E3HA 2OAUA 3FIFA 4PJOD 1GXIE 4M75A 4J9IA 4JPBW 2L5QA 2DKGA 2X4WA 4M7AB 1VQ9A 3R6NA 2FRWA 2DF6A 3CC2Q 4FCYA 2CUBA 4FSXA 4FL6A 1M2OA 3EG0A 4J9GA 2D0NA 4M7DE 1V29B 2DEQA 4FYWB 1UDLA 5D6YA 3OY9A 3M56A 5CK9A 3MEWA 2F2VA 4HVVA 1WHGA 3H8ZA 2QDLA 4LUDA 1TUGB 1M3CA 4NOYA 2ZGWA 3WVEB 1XTDA 2LVMA 3HPWA 2AHJB 1WHMA 2F69A 2K2MA 5DM7R 2B8AA 3INZA 5DLOA 1BYMA 5CQYA 3A1PA 1O75A 1IGUA 5CIUA 3VRZA 3CCQA 1RACB 4LDXA 4C0GA 4IIMA 1KC8R 5LJ3d 5DY9A 1QVGP 1RLPC 5D6XA 1KK7A 4DOWA 2KYMA 2KT1A 1PD0A 1SRMA 3RUXA 2RHXA 4HVWA 4RTYA 1D3BB 1TWBA 3X28B 4BD3A 3HSBA 3GPLA 4HCBA 3I56T 2ZPHB 4M77C 3OYMA 1WHLA 4FT4A 3I5SA 1WJRA 1E7OA 4M75E 2QA4Q 1AEYA 3CPWA 4C0DC 5GANh 1MV3A 1WNLA 4MZPA 1KJWA 3RERA 4ZTFA 1YITQ 2YXYA 3F70A 4QQGA 1Q81U 1N8RC 4MDXA 4LN2A 3KFVA 4XTVA 3CC2T 4FW1A 2BE7D 4F14A 5J26A 1YN8A 2DRMA 2KRSA 1W1FA 1W70A 2OJ2A 4PJOG 4K11A 4E47A 3CBMA 2DJQA 2J6KA 1KIKA 1H8KA 3J7AF 1JO8A 3OYYA 1WIEA 1AWWA 3RKYA 1S1NA 4ZN1A 1UG1A 4RTUA 4BUGA 1EIFA 2MMPA 2C0OA 2RQUA 1R77A 3ER0A 3X20B 3U23A 3EFOA 3BW1A 3QJ6A 3NFCA 3VS7A 1UGQB 4JJDA 5GAN5 2DD5A 3QXEB 3OS0A 3EAEA 3QG1A 3E1SA 1WQWA 3JCMc 4C8QF 1JEGA 2K2VA 4HT8A 4QW2A 1QKXA 5CQXA 4PJOB 5GMKj 5LJ3f 4J7FA 2NUPB 4X1VA 2OTJA 2CSIA 2KDSA 3CMAQ 4KUDK 2GBQA 4BDZA 2CZ0B 9ATCB 3QSUA 2EYQA 1FYNA 5FRNA 2QA4T 3CQTA 1VQLA 2LCLA 4OF1A 1VQ6A 2ED0A 2LP5A 1X01A 1YITT 4J6WA 3SEMA 2DAQA 3PMTA 5IHKA 3JV3A 1IREB 1PNJA 1VQKQ 2DYIA 2EGCA 2RJFA 4ZN3A 2OX7A 4KT0E 4N4GA 3EG3A 5LJ3e 1A0NB 1IXDA 1ZSGA 1N9SA 5GAMg 3MO8A 3VKIA 1O9SA 4A53A 1M90R 4IKFA 4CC3A 3E9GA 2HSEB 2MWOA 4E7SA 2X3WD 2EQJA 1BBZA 2RO0A 4IURA 1TTHB 4FW2A 3JCMQ 3CCRQ 1HYOA 2MF2A 2PNIA 2EQKA 2F2WA 3ZBDA 1M5Q1 4VUBA 3CC4Q 1PKTA 3MEAA 4J9HA 4O5VA 1YJWQ 4M78A 4J83A 2HSPA 2JM8A 1C1AA 2GQIA 2XU8A 3P8BB 4BY6C 5LJ5f 3TQ7P 5KYYA 1YCSB 3PMIA 4LDYA 1V76A 5HCKA 3OQ5A 4J9CA 4EPCA 5KH6A 8AT1B 4KUIA 3V7RA 1RI0A 1PSEA 2PVOB 2M1HA 4C8QD 1PC0A 1Q81C 3OYNA 4M77F 4J9FA 1AZEA 1OULA 4L5GA 4AFZC 3CCEQ 3GF5A 2FHDA 2CP7A 4ZNXA 1Q7YU 4OVAA 4M7DC 1VQKT 2J6FA 2A36A 1B34B 3HRTA 4R56A 2XI9A 4NL3A 1SRLA 1G3WA 4DQ2A 2KI7A 1HK9A 2X51A 1D1AA 5A2QE 2HCKA 3NHNA 5LJ5e 4PJLA 2FL7A 4XTYA 3CCUA 3V8KA 2VKNA 2DJZA 3UATA 3A8OB 3EG9A 2D9TA 1ZHIA 1N5ZA 1WI7A 4J9DA 1RUWA 5CKBA 3M53A 3CCSA 1Q95G 2ZCFB 3SWNA 5KYUB 4M78E 1TSFA 1NEGA 1NE8A 3GIBA 5GAN6 2K6DA 2HBPA 3CC4T 2LX7A 1JB0E 4OMMA 3M0UA 4Y92A 1UGVA 4M7AA 2WSEE 1YJWT 5I2SA 4ANJA 4PFPA 4C5IA 5CAIA 3CD6A 2CGHA 5CKDA 2MAMA 4FM4B 4BI3A 3JSCA 2Y4YA 2KEAA 1I1JA 3MJXA 1YJ9A 1UHCA 2DD4A 3CMEQ 5CKFA 2D0QB 2K9GA 2DK3A 2XDPA 4DBQA 2RHYA 1ZSZC 2P4TA 2RB6A 1WHHA 2NUZA 1PD1A 3I55A 1VQMA 2YSQA 2LNHB 5KYWB 2B86A 2JVVA 1NLOC 4QT7A 2PQWA 1YWPA 2Z0WA 2GTJA 2DIQA 1VQ8A 4HCZA 4X9CA 3JCMf 4C5HA 1Z9ZA 1WFWA 2QASA 2V1QA 4C8QG 2LT1A 3BFMA 1BCMA 4PJJA 2DVJA 2LZ6B 5J3BA 3VUZA 2F2XA 1U1SA 1VQPA 4M77D 2XKOC 4FYYB 1D3BA 2CZ7B 2JNGA 2QEXA 1VQ4A 4JZ3A 3ZL7C 4IUQA 3OMGA 2SEMA 2HMAA 1S72Q 2E6NA 2BTTA 2KR3A 1K9MR 4M7AE 1WYXA 1KD1U 4GBQA 4RG2A 3D7SB 1I5OB 4XAXB 1AOJA 3MEUA 2OI3A 3H41A 1OPKA 1DJ7B 4C8QB 2DXBA 1KC8C 3JCMe 2CKKA 2RNAA 2O4XB 2VUBA 4ZGJB 2KYBA 4F16A 3VS6A 3CMET 3UA7A 3QWXX 4OB0B 1K76A 1KQ1A 2O9VA 4C5EA 2DZCA 1Y07A 1VQNQ 4EIKA 1YHQA 3CC7A 2AZVA 3P8DA 1Q7YC 2A0FB 4QVCA 2LC4A 4CC4B 4KH0B 1JJ2S 4F7UF 2MIOA 2DL7A 2DL4A 2EPDA 2FEIA 2VC8A 1NM7A 2KBTA 1PCXA 2K3BA 3LW5E 5GAMf 3OYCA 4ELZC 3MHXA 2QTVA 1K0XA 4EDUA 1JJ2A 5C0MA 4PJOA 3OW2S 5IXBA 1D1BA 2CH4W 2NUPA 1K73U 2KY9A 1NYFA 1QCFA 2RI2A 3VS1A 2C0TA 1S72T 5GJVB 3OS2A 2RD1A 3G4SQ 1SKUB 1MNDA 4AFSC 2M51A 2VYTA 2CP0A 3E9FA 4OMNA 3S3OA 1PSFA 4M77G 3A8HB 3CCLQ 2RHUA 2LCCA 3EHRA 4MZMA 2LJ3A 4RTTA 2DILA 1K4US 2O9SA 2DX1A 3VS2A 1UTIA 3TSWA 1W2BS 2RPNA 2COYA 2HKNA 5GAMe 4JJCA 1WXTA 4N0AC 3V7CA 4PJMA 3OYFA 4HT9A 1SPKA 2OAWA 2KRMA 2RHIA 2LQKA 2CP2A 6AT1B 2KAFA 4AG2C 3S3NA 2E70A 1ZA1B 4J9EA 3VRYA 4M77B 4FYVB 1HD3A 1VQOA 1X2KA 4Z88A 2VWFA 3I5RA 3M55A 1ABQA 4E7HA 1AHJB 4E7KA 4E6RA 4LDWA 2ZPIB 4PJOE 1FX7A 3TVTA 1UE9A 2BZXA 4L6V5 1OQKA 1WPYA 4C0DB 3ULRB 2LDMA 5A0LA 2RQRA 1RAIB 2GNCA 1IHWA 2DMOA 1VIFA 2DIGA 1GFDA 3A8GB 4F17A 5DLQE 4XTZA 2ZPEB 2ZZDA 2QDYB 1M90C 1GCQA 4M78C 4KH1B 1WXUA 3QO3A 3CCJQ 4QVZA 4BE0A 1KD1C 3G4ST 7AT1B 5IT9E 3G6EA 1JRIA 2E3IA 5IN1A 5GMKl 3CCLT 1MV0B 1SF9A 1WZOA 2GTOA 1LPLA 1KHCA 2M02A 3QKJA 2KE9A 3CXCA 1YWOA 1Q82U 4RG8A 3QZ5B 1G2BA 2BIVA 1B34A 5FRMA 2PUKB 2YRDA 4DBFA 4UC4A 1GBQA 2QQAA 3EHQA 1PKSA 1JJ2P 3PIPA 2CZ6B 3BY7A 3CPWS 2PVDB 2EJ9A 2ROTA 3NTKA 1KSWA 2FPDA 4C0ZA 3OSVA 4QVDA 2O2OA 2YLCA 5GANj 4GY5A 3QUIA 3LWHA 1K8AR 1MNEA 3V7SA 4WTOB 3OW2P 4RKUE 2X9HA 4OMPA 3JB9H 2X35A 5I11A 4JRQA 5KYUA 5IHIA 2CT4A 1XNIA 2VGMA 5KYXB 1VYVA 3SB2A 2KXCA 4II1A 1X2QA 1K73C 2VVKA 3QDRB 3M57A 1VQ6Q 1VQ7Q 4EMKA 1WJSA 2E4HA 3CC2A 2J06A 2CUDA 4E7IA 2A28A 3CCJT 4RCBA 1AVZC 4E7ZA 1YIJQ 1W2BP 2LX9A 1MMDA 1JXOA 1HSQA 1G3TA 1WHKA 1H641 2EQIA 4PLIA 2EVRA 4JZ4A 1ABOA 5GMKi 1U1TA 2I0NA 1RAAB 5KYWA 1BB9A 4F7UG 1G83A 3L1AA 5GAOr 1NJIU 1WDXA 2KNBB 2K3XA 1Q86R 1RABB 2M0OA 2IVWA 4MZTA 1BK2A 3PTAA 1R0CB 3LLRA 1IRXA 1WA7A 1BI2A 1EFNA 4Z8AA 1OOTA 1SSHA 4QQDA 2RJDA 3H9NA 1HJDA 4IIOA 1ZBJA 2DYBA 2M9UA 1TUCA 2A3LA 3H0IA 1QVPA 5GMKe 2EGAA 5IHNA 4F7UB 2GGRA 3G71A 3KUFA 4AT1B 1OYXA 4OGEA 3O8VA 1YJNA 1M1FA 2CS7A 1X69A 5KE3A 3C4SA 1LJOA 4FU6A 2EYYA 3HTRA 2JS0A 1IO6A 1GBRA 1MHNA 4C8QA 1BCOA 3L2VA 2DM1A 3UDCA 5D6WA 1VQ6T 1YITA 1UGSB 1VQ7T 3JCMW 1R0BG 2KVQG 2EW3A 2DETA 3MCAB 2O4XA 1OU9A 1QLYA 5KE2A 4RTZA 1BI3A 1ZQ1A 2D6FA 1XJWB 1YIJT 3NGPA 1I0CA 4BE1A 2E41A 2R57A 3CCVQ 4XTUA 3PE0A 1VQ5Q 2MCNA 5LJ3h 2QQ9A 3VU3C 1ZUYA 4A4FA 1OX8A 4M78F 1Q82C 2JTMA 2ZPFB 4ORZA 2HZYA 1NEBA 4JDSA 1UB4A 2X4YA 3CPWP 3OYBA 4Q5WA 4BE2A 2K7AA 4A4HA 2CZ1B 4IUVA 3FDRA 2JTEA 3GLXA 3X24B 2KGTA 2MK5A 8ATCB 5HK3A 2A7YA 2XD0A 1BU1A 1AWOA 4BI4A 1KC8U 3CMAT 5GAOm 2CP3A 3N5BB 3NTIA 1AT1B 1N27A 1EX4A 2L3QA 3EGDB 4C92C 3LH0A 2HAXA 4PJOC 1QW1A 2E10A 3CD6Q 1Y96B 2BZYA 4RUGA 4FYXB 4JRPA 4C8QE 1D1CA 1TS9A 2F5KA 2YRVA 4YTLA 3PIOA 1YJ9Q 4A63B 3OYGA 3CCMQ 3OMCA 1UGPB 1NBEB 4O6JA 3OA6A 3QYGB 1ZSZB 1ZA2B 4ZGDB 3M5AA 2JS2A 2OTLQ 5A0GA 2DEUA 2E12A 1ACMB 2PU9B 2ESWA 3I55Q 3MP6A 1KQSA 2RQWA 3JCMX 1VQKA 2I2LA 2CT3A 2DRKA 3CCVT 2FG0A 2H3EB 5IH2A 3HFOA 2EYXA 3M4GA 4D6WA 1VQ5T 3BDLA 4PKCC 4KBMB 1N8RR 3J80E 3MPUB 3M58A 2V8JA 5LJ5h 1G3SA 4M77A 1NJIC 4FIBA 3CCRT 2K5LA 2LQ8A 2FVUA 2XDDA 1VQ4Q 3JCMJ 2L89A 1VIEA 2DTHA 4B9WA 2RK2A 2RQVA 3IQLA 1UEBA 5GAN4 1BIBA 1B07A 3CC4A 5GANg 2JMCA 3URGA 4RTWA 4M75C 1XOVA 4X9DA 1M27C 1YJWA 3TU4K 3ZFJA 2RQTA 3PFSA 1G3YA 2QXFA 4XTXA 4OB2B 3HL8A 4JRIA 2VASA 1YBYA 2DO3A 1ARKA 4XK8E 4WF2A 1YJ9T 3RR6A 4LNPA 3CCMT 1J3TA 1OU8A 1D09B 2ATCB 2HQEA 3CCET 1T3LA 2LTOA 3HHTB 1U06A 2OTLT 1WQ7A 1UJYA 4LXCA 1CSKA 3RNJA 1YFNA 3X26B 2AT1B 2SRCA 2JT4A 1YI2Q 1N6AA 4D8DA 1GFCA 2JOYA 5CKHA 3SFMA 3I55T 4JS4A 3HRSA 2DERA 1D0XA 1BI1A 1Y57A 3QPHA 2QG9B 3J81E 3FJ5A 3M59A 1YNZA 2ABLA 2G3RA 2EIFA 2ZPBB 4M77E 4JS5A 1B7TA 2AKLA 1WXBA 2XG8D 4J6YA 5EG2A 3T9NA 3EGXB 5CR2A 4A4EA 2NWMA 3HP9A 2COWA 2K5IA 4B6MA 3JB9F 2BZ8A 1M90U 2EAYA 3GNFB 3BE3A 2EJGA 2DFUA 2ZAEA 4J6XA 5I2MA 3C0CA 4NL2A 2NLUA 2XMFA 3MKDA 4ESRA 1TG0A 3A8MB 4EMHA 1RADB 2VGNA 4E7LA 3JCMb 1VYTA 3RMQA 3OYJA 1QCOA 2AZSA 2DBMA 1UFFA 3A5ZB 3THKA 1KQSP 4BDYA 2EGEA 2P4RA 2RHZA 3LH5A 3TEEA 2P0KA 1NPPA 3JCMh 1UJ0A 3L42A 1W4SA 3MEVA 1SSFA 3DLLA 4EMKC 1P92A 2KMTA 1M2VB 4JLIA 1LOJA 4MMKA 2AK5A 4LUEA 3QIIA 1H92A 5FU6C 5L8RE 2F5TX 4IUTA 1UHFA 4C92F 4DA4A 4M78G 1OZ2A 4MMLA 4JLGA 4OGCA 1YI2T 4KGZB 3V8JA 2DZ9A 5GAOq 3UPUA 1NPRA 4N4IA 2DNUA 1IB8A 3RIRA 1JU5C 3TSZA 4M7DF 4GLMA 1MMNA 1VQ9Q 4CC2A 1SHGA 4KRTA 3C95A 3NMZC 1I4K1 1HXDA 2KQWA 1QVGA 2V8KA 2M16A 2O01E 4M78B 1QP3A 1MUZA 2BUDA 2MWPA 1M3BA 4F7UA 2V8IA 5KYYB 3OS1A 1S72A 5GANd 1QWFA 1MGQA 3UWNA 3G6EQ 2XDBA 2HKQB 1ZLMA 1E6HA 2RI3A 2X3XD 5EC7A 3OBWA 4QKUA 1Y0MA 3QZ9B 2LQWA 3QDFA 2JW4A 1KG1A 1R8OB 2M0YA 4AFUC 2ZPGB 2DXCA 5I21A 4JJNK 3CCQQ 1G5VA 2RJCA 2RN8A 2LRQA 2LCSA 1Y7XA 5GAMh 1VQNT 4M75F 2L3PA 2PVGB 2RA2A 5FU7C 2YT6A 3HFNA 3CEYA 2O31A 5GJWB 3L2WA 2DPPB 5ECAA 4C0FA 2FZCB 1X6OA 4R55A 5CO7A 3GOXA 2LNVA 4PJNA 1OI1A 2GFUA 1KFZA 4A4GA 2R5MA 3EG2A 2X4JA 5J39A 2LMJA 2CP6A 1IZ6A 1VYUA 1VQ9T 4C92D 4F7UE 2VV5A 2KT8A 3EGDA 3VJPA 4XQ3A 2JN0A 3CXCS 2QQBA 2E1HA 4DOVA 3JRZA 4OMLA 1Y96A 1NG2A 1K0SA 3S6WA 4CRIA 4XU3A 1WX6A 2HQXA 4XU0A 4LDVA 2ECZA 2QI2A 4RTVA 1QWEA 2MOXA 3G4SA 3PVQA 4Z02A 3AHUA 3G6ET 2HNIA 4M7DD 1K9MU 1M1KR 2XIDA 5GANf 3WXMB 1ZSZA 2JMAA 3CCLA 1TU0B 5GAN2 3OB9A 3RKWA 1TXQA 2EWNA 2CH4A 3GBQA 2J05A 3C12A 4BACA 1NZ9A 2CDTA 3DB3A 3QBYA 3CCQT 3VUBA 1U5SA 2K79A 4OB3B 2GQVA 2EKHA 1RLQC 5CCAA 1JQQA 2EYZA 2EJFA 2L8DA 1E6GA 1PWTA 2OTJQ 1X6GA 3JB9G 2J7IA 5GAN3 1OZ3A 3I56A 2DL5A 2CREA 1PRMC 1AWJA 4CC7A 5FWBA 3VS3A 2EBPA 2QGFB 4A54A 4E2FB 2ROLA 3NPFA 1QMCA 1WJQA 2P0QA 5GANe 3META 4PLLA 3I35A 5FW9A 2YUQA 5FROA 4ZTJA 3M54A 3SWNC 4OP0A 2YRCA 3EH2A 3LYIA 3G71Q 4BI8B 1EZZB 1VQLQ 2DE0X 4M75D 1YJNQ 3AT1B 1VUBA 2L2PA 3GP8A 1Q7YR 3UA6A 3CBOA 4M7AC 3SHWA 5HKCA 1M30A 2HD0A 1T0JA 2GF7A 3ZEHA 4WCIA 2COZA 2BKDN 4XTWA 2P0PA 3CCJA 4J5YA 2CP5A 3OBYA 3PVLA 3TCJA 3M0SA 4C92G 5LL6S 3JCMg 4OMQA 4QQ6A 1YP5A 3X25B 2FRYA 4V2SA 3M9QA 5HK0A 1QP2A 5KCOA 2DL3A 2AIRB 2IIMA 1V1CA 4Y28E 4AFQC 2RK1A 3G1JA 3LWIA 4M7DG 4C5GA 2XICA 2IG0A 4BY6B 1Y71A 3PGGA 3EGXA 2V26A 2OTJT 2VXFA 3E19A 4LD6A 1H3ZA 2QK0A 1BKBA 2FPEA 4C92B 5LJ5d 2H8HA 2HL3A 5I22A 4EMGA 2X4XA 3KBGA 3G7ZA 4PK4A 2QA4A 2FZKB 2PUOB 4OB1B 3OYHA 5GMKh 5FWCA 3CXCP 1T3SA 4HCKA 3G71T 2RM4A 1VQLT 1GL5A 1YJNT 2QTXA 2QAZA 3L2RA 4M7DB 1SG5A 4AG1C 3HRUA 3OYLA 5IAYA 2RF0A 2JM9A 2C0IA 1VQ7A 2DXTA 5LJ3j 4N0AA 5CKEA 3A8LB 2VB6A 1LNXA 2W0ZA 1M2VA 4M75G 2PTKA 2HBWA 3M4YA 1K9MC 4R0KA 1YIJA 2CSQA 1MMAA 2K4YA 2Y90A 3CCUQ 2LJ0A 4ATOA 1H3HA 1CKAA 2H3JA 3L2QA 4DEXA 1B3QA 2FYKA 2HL5C 1W6XA 1FMKA 2DBKA 3VS0A 2QQRA 1ZUUA 2HDAA 2EYWA 1M1KU 3OYDA 4B9XA 2R5AA 3CCSQ 1KD1R 5AYFA 2PZ1A 3FC3A 4DEYA 3QYHB 4HKEA 3RBBB 3JAME 2ENMA 4HCCA 2NUTB 2R58A 2E65A 3JB9I 3EFRA 3H0FA 4M75B 3DB4A 3CMAA 3EG1A 4OMOA 1AWXA 3VV0A 3OYEA 3UF4A 3L2ZA 1FMWA 1U8RA 1X43A 4XU1A 4X34A 2JJ9A 1KQSS 1K8AU 5IXFA 3WVDB 3ASKA 1M1GA 2VXEA 3Q1JA 1AZGB 1JBMA 1OPLA 3FJPA 2LT4A 1NYGA 1VQMQ 1G8XA 1D0ZA 4LDUA 3KXTA 3FRNA 2DA9A 1RAHB 1VQ8Q 3DLMA 1FMVA 4P5NA 1K9AA 3JCMd 4OMFB 5LJ5j 3CPFA 3MP1A 2KXDA 2MI6A 1WGSA 3CCUT 3CCVA 4M7AF 1M3AA 2QQSA 1VQPQ 1XQHA 1K73R 4M4ZA 3EFSA 1VQ5A 1C6VX 4CI0C 2QEXQ 2D8JA 2XHCA 1AD5A 3M0PA 1PM3A 1QVFS 2HEQA 3RDVA 3CCRA 3CCST 2E5KA 2L3SA 2WSFE 3VYGA 5KCHA 1FWZA 2K3YA 4PL6A 4HA8A 1QCNA 1ZUKA 1I07A 1X75C 1Q86U 2KROA 4HXJA 1UECA 2CYZB 1QVFA 2FO0A 4M78D 4J8OA 1JXMA 1TH7A 3REAB 3CD6T 2DXUA 4Z89A 1I81A 2MPXC 2DTOA 3PNWC 3BDUA 3OYAA 1QQJA 3M0RA 3OYIA 2YHTA 4EMKB 3PT9A 5A0DA 1GCQC 2YUPA 4XU2A 5GAOn 2AKKA 3P8HA 3H6ZA 5FU6B 2YUOA 2D1XA 4LD9K 3CCMA 5FLXE 2NYSA 3CCEA 2E6ZA 1YHQQ 1T0HA 2J6OA 5L23A 3CC7Q 1VQMT 4D8KA 5GAN7 5AT1B 2OTLA 1I5LA 3REBB 2JXBA 4GLKA 1SHFA 4PNOA 2QGGA 1VQ8T 2IPOB 4E7JA 3GNGA 2QYZA 2E64A 2GFAA 4FT2A 3A98A 3EFOB 1F1BB 1X27A 3OS5A 1LVKA 1VOMA 4ELYC 5GAMd 4ZGEB 2Y4XA 4MDWA 1VQPT 3EH1A 1C0MA 2QEXT 1BI0A 1VQ4T 3C94A 5C6SA 3FEOA 1TOVA 1M1KC 3MP8A 4ME7A 4PFOA 4DBHA 1BIAA 1RL2A 2DVEA 1KHIA 1X6BA 4PFZA 5GMKm 1IHVA 3E2UA 5KYXA 2DL8A 3EGUA 2RH2A 2F1LA 1QKWA 5HY6A 5CVIA 4M7AD 1UUEA 3DKMA 1ZBXA 1Q82R 2DTIA 1FXXA 3JB9J 4N4HA 4IUPA 4RCCA 5GAOl 2V1RA 1SEMA 3VYHB 1YCYA 2K57A 3CMEA 1K8AC 1MMGA 2RMOA 3RKXA 2XK0A 2RJEA 3HKSA 5FU7B 1I8FA 3RESA 4PJOF 3UT1A 2D8HA 3ME9A 1YHQT 2JUFA 4JRKA 2KRNA 3LX7A 4JUVA 4L59A 4NS5A 2KK4A 4F04B 2LJ1A 3CC7T 1Z9QA 5LJ3g 5GAOp 1UGRB 3SD4A 3JCMP 4RTXA 1VQOQ 3FB9A 1YI2A 1GCPA 1PG5B 2EKOA 2LQNA 1QVGS 1K1ZA 1RAFB 2W10A 3V8LA 3RMSA 4JJBA 1TUDA 1Q81R 2HQHA 3CBPA 3LGFA 1QVFP 5M9OA 1PRLC 2C06A 2A08A 2JZ2A 1RI9A 2L3RA 2RI5A 1WHJA 1OV3A 4LE9A 2YDLA 3O5ZA 1RAGB 4AMCA 4C92A 3TREA 3QJYA 2YLBA 2A37A 3M0TA 3VS4A 5GAN8 2G6FX 1N8RU 3FLGA 1OX9A 2EQUA 2EFIA 3LGLA 2K5FA 4IUUA 2WACA 4DBRA 1M8MA 1Q86C 1U3OA 2YUNA 1RAEB 4HVUA 4BB7A 1CKBA 2L0AA 1D0YA 4J9BA 3OW2A 1ZX6A 1M4ZA 2WSCE 4KULA 3SDZA 4M7DA 2FZGB 2P84A 3JB9D
chains in the Genus database with same CATH topology
4M75D 5GAMj 4IUVA 3FDRA 4C8QC 3GLXA 3X24B 2DIQA 1VQ8A 1VUBA 4TVRA 3GP8A 4HCZA 4X9CA 3JCMf 5HK3A 4C5HA 2A7YA 2XD0A 3S3MA 3CBOA 4Y91A 4M7AC 4C8QG 2GCXA 2LT1A 3BFMA 2EQMA 4BI4A 3JCMV 5HKCA 5GAOm 2HD0A 1KC8U 3CMAT 3N5BB 3L2UA 2GF7A 5J3BA 3NTIA 3VUZA 1N27A 4M7AG 3ZEHA 4C92C 1U1SA 1VQPA 1M8VA 4M77D 3LH0A 2BKDN 2XKOC 3OSSC 3R6OA 4XTWA 2HAXA 4PJOC 1VQNA 2P0PA 1D3BA 2CZ7B 2JNGA 1QW1A 2E10A 4J5YA 2QEXA 3CCJA 3OBYA 1VQ4A 1Y96B 3TCJA 2JTFA 4C92G 3QHSA 4IUQA 5LL6S 3OMGA 4C8QE 3JCMg 4JRPA 1W2BA 2F5KA 2YRVA 2E5QA 4YTLA 3PIOA 4QQ6A 1VQOT 3X25B 3OYGA 1N9RA 2E6NA 3OMCA 5LJ5g 1UGPB 4V2SA 3M9QA 4O6JA 5HK0A 4M7AE 1QP2A 3OA6A 1KQ2A 3QYGB 1KD1U 4RG2A 5KCOA 4RMOA 3OYKA 1M9SA 4ZGDB 4J7IA 5LJ5h 3M5AA 3SWNB 2KSSA 3NTHA 5A0GA 4A4KA 2FB7A 4XAXB 2E12A 4C92E 3MEUA 4Y28E 2PU9B 2RK1A 2OAUA 1DJ7B 4C8QB 2DXBA 3FIFA 3LWIA 4PJOD 1KC8C 3MP6A 4M7DG 1GXIE 1KQSA 3JCMe 3JCMX 2CKKA 4M75A 4C5GA 1VQKA 2I2LA 2L5QA 2DKGA 2IG0A 2O4XB 2X4WA 2VUBA 2XICA 4M7AB 4BY6B 4ZGJB 1VQ9A 1Y71A 3CCVT 3PGGA 2OTJT 2VXFA 3E19A 3HFOA 4LD6A 1H3ZA 3CMET 4FSXA 3M4GA 4D6WA 1BKBA 4C92B 1VQ5T 3BDLA 4FL6A 4OB0B 5LJ5d 4PKCC 4KBMB 4M7DE 3J80E 1V29B 4EMGA 1KQ1A 2DEQA 3M58A 3PTAA 2V8JA 5D6YA 4C5EA 1G3SA 2X4XA 3M56A 2DZCA 3KBGA 3MEWA 4M77A 1Y07A 5CK9A 1NJIC 4FIBA 3G7ZA 2K5LA 2LQ8A 3CCRT 2FVUA 2QA4A 2XDDA 1YHQA 3H8ZA 2PUOB 4OB1B 3JCMJ 3OYHA 2L89A 5GMKh 3CC7A 3P8DA 1Q7YC 4NOYA 1VIEA 2ZGWA 3G71T 2RM4A 2DTHA 2LC4A 3WVEB 4QVCA 4B9WA 1VQLT 2RK2A 1JJ2S 1YJNT 1XTDA 2LVMA 3HPWA 4F7UF 2QTXA 2AHJB 2F69A 3L2RA 4M7DB 1UEBA 5GAN4 3HRUA 1BIBA 3OYLA 2VC8A 5IAYA 5DM7R 2B8AA 3INZA 5DLOA 1BYMA 3CC4A 5CQYA 5GANg 1O75A 3LW5E 5GAMf 5CIUA 1VQ7A 2DXTA 3URGA 4ELZC 3OYCA 4M75C 1XOVA 3MHXA 4X9DA 5LJ3j 3CCQA 4N0AA 4LDXA 5CKEA 4EDUA 1YJWA 1JJ2A 5C0MA 3TU4K 3ZFJA 3A8LB 4C0GA 3OW2S 4PJOA 5LJ3d 1LNXA 5DY9A 3PFSA 5D6XA 4M75G 2KY9A 1K73U 1G3YA 2QXFA 4XTXA 4DOWA 3M4YA 4OB2B 1YIJA 3HL8A 4JRIA 1K9MC 1YBYA 2DO3A 2K4YA 2Y90A 2RI2A 3RUXA 4XK8E 4ATOA 2RHXA 4WF2A 1D3BB 1YJ9T 3X28B 4BD3A 3HSBA 2H3JA 3L2QA 3CCMT 3GPLA 1S72T 4HCBA 3I56T 2ZPHB 4M77C 3OS2A 2FYKA 2HQEA 2RD1A 3CCET 3OYMA 2VYTA 4FT4A 1WJRA 2LTOA 2QQRA 3HHTB 3E9FA 4M75E 3S3OA 1M1KU 1PSFA 1WQ7A 4M77G 3A8HB 4B9XA 3OYDA 2OTLT 3X26B 2RHUA 2R5AA 2LCCA 1N6AA 4MZMA 2JOYA 5CKHA 5AYFA 3SFMA 3I55T 3CPWA 4C0DC 5GANh 4JS4A 3HRSA 3FC3A 1BI1A 3QYHB 1WNLA 4HKEA 4MZPA 1W2BS 3RERA 3JAME 3QPHA 4ZTFA 3J81E 4HCCA 3F70A 3M59A 2R58A 2E65A 4QQGA 1Q81U 1N8RC 3JB9I 4MDXA 4XTVA 5GAMe 3EFRA 2G3RA 3CC2T 2EIFA 2ZPBB 4M75B 4M77E 4N0AC 3V7CA 4JS5A 3DB4A 3CMAA 3OYFA 2XG8D 4J6YA 3VV0A 3OYEA 4HT9A 5EG2A 3L2ZA 3T9NA 5J26A 5CR2A 1U8RA 2RHIA 4XU1A 4X34A 4A4EA 2LQKA 4PJOG 2KAFA 3HP9A 2K5IA 3S3NA 2E70A 3JB9F 1M90U 1KQSS 4E47A 3CBMA 2EAYA 1K8AU 3GNFB 3J7AF 2EJGA 3OYYA 4M77B 3WVDB 3RKYA 3ASKA 1VQOA 1M1GA 2VXEA 4J6XA 4NL2A 2NLUA 3M55A 5I2MA 4ZN1A 3Q1JA 4BUGA 1EIFA 1JBMA 2MMPA 3FJPA 2LT4A 1AHJB 4E7HA 4E7KA 4LDWA 2ZPIB 3A8MB 4PJOE 1FX7A 4EMHA 4L6V5 2VGNA 3ER0A 4LDUA 3X20B 4E7LA 3JCMb 3OYJA 3RMQA 1WPYA 4C0DB 3KXTA 3FRNA 3BW1A 3QJ6A 3NFCA 1UGQB 2LDMA 5A0LA 5GAN5 3DLMA 2DD5A 3A5ZB 3QXEB 4BDYA 3OS0A 4P5NA 3EAEA 3QG1A 3JCMd 4OMFB 2RHZA 3E1SA 1WQWA 5LJ5j 1VIFA 2DIGA 3CPFA 3JCMc 4C8QF 3TEEA 2P0KA 2K2VA 3A8GB 3MP1A 4HT8A 1NPPA 3JCMh 4QW2A 5CQXA 5DLQE 3L42A 4PJOB 4XTZA 2MI6A 5GMKj 1W4SA 1WGSA 1SSFA 2ZPEB 2ZZDA 3MEVA 4J7FA 1P92A 2QDYB 5LJ3f 4EMKC 3DLLA 2QQSA 3CCUT 2KMTA 1M90C 4M7AF 2OTJA 1XQHA 4JLIA 4M78C 4KUDK 2KDSA 1LOJA 3EFSA 4MMKA 3QO3A 1VQ5A 3QIIA 4CI0C 4QVZA 4BE0A 1KD1C 5FU6C 5L8RE 3G4ST 4BDZA 2F5TX 2XHCA 4IUTA 5IT9E 3G6EA 4C92F 2CZ0B 4DA4A 4M78G 3QSUA 1OZ2A 2EYQA 5FRNA 1JRIA 4MMLA 5IN1A 5GMKl 1QVFS 3CCRA 3CCLT 4JLGA 2QA4T 4OGCA 3CCST 1YI2T 1KHCA 2WSFE 3VYGA 5KCHA 1FWZA 3QKJA 3V8JA 2DZ9A 2K3YA 4PL6A 3CXCA 4HA8A 5GAOq 1VQLA 3UPUA 2LCLA 4OF1A 1VQ6A 1NPRA 4N4IA 1X75C 1Q86U 1X01A 1YITT 4RG8A 1Q82U 4J6WA 3QZ5B 2CYZB 2DAQA 2BIVA 1QVFA 1B34A 3PMTA 3RIRA 4M78D 5FRMA 4J8OA 4M7DF 1TH7A 2PUKB 1IREB 4UC4A 2QQAA 3CD6T 2DXUA 1I81A 2RJFA 4ZN3A 3PIPA 2CZ6B 2DTOA 3BDUA 3BY7A 3PNWC 4KT0E 4N4GA 3OYAA 3C95A 5LJ3e 1I4K1 2YHTA 3OYIA 3CPWS 1HXDA 2KQWA 2PVDB 2EJ9A 3NTKA 4EMKB 3PT9A 1QVGA 1N9SA 5A0DA 4C0ZA 2V8KA 3OSVA 2M16A 4XU2A 2O01E 5GAMg 5GAOn 4M78B 1QP3A 3MO8A 3P8HA 3VKIA 2BUDA 4QVDA 1O9SA 2MWPA 2YLCA 3H6ZA 5GANj 3AHUA 5FU6B 4A53A 4F7UA 4GY5A 2V8IA 3QUIA 3OS1A 3LWHA 4LD9K 3CCMA 1S72A 4IKFA 5GANd 3E9GA 3V7SA 5FLXE 3CCEA 2E6ZA 4RKUE 1MGQA 3UWNA 2MWOA 1VQMT 2EQJA 3JB9H 2X35A 2XDBA 4JRQA 5GAN7 2RO0A 4IURA 2RI3A 2OTLA 1XNIA 3JCMQ 1I5LA 2MF2A 4GLKA 3OBWA 4PNOA 2EQKA 2VGMA 1VQ8T 3ZBDA 3QZ9B 3SB2A 3GNGA 4E7JA 1M5Q1 2E64A 2GFAA 4II1A 4FT2A 1K73C 3QDRB 4VUBA 3OS5A 1KG1A 3M57A 1R8OB 2ZPGB 3MEAA 2DXCA 4EMKA 4ELYC 5I21A 4JJNK 1WJSA 5GAMd 3CC2A 2RJCA 4O5VA 2Y4XA 4M78A 4ZGEB 1G5VA 2LRQA 1Y7XA 4J83A 4MDWA 1VQPT 4E7IA 5GAMh 4BY6C 3P8BB 2XU8A 5LJ5f 1VQNT 4M75F 2QEXT 1BI0A 3CCJT 4RCBA 2PVGB 2RA2A 5FU7C 1VQ4T 3C94A 5C6SA 3FEOA 3PMIA 1M1KC 2LX9A 3MP8A 4LDYA 3HFNA 4ME7A 3OQ5A 3CEYA 3L2WA 1G3TA 2DPPB 1H641 4C0FA 1BIAA 2DVEA 1RL2A 1X6OA 4PLIA 1KHIA 4EPCA 5KH6A 4KUIA 5GMKm 3V7RA 5GMKi 1U1TA 4R55A 1RI0A 1PSEA 2PVOB 2M1HA 5CO7A 3GOXA 2LNVA 4C8QD 3JB9D 4F7UG 2RH2A 1OI1A 2GFUA 3OYNA 1Q81C 4M77F 3L1AA 4L5GA 5HY6A 5GAOr 3GF5A 5CVIA 1NJIU 4M7AD 4A4GA 3DKMA 2R5MA 2FHDA 1ZBXA 2K3XA 1Q7YU 4OVAA 2X4JA 4M7DC 3OY9A 2M0OA 2IVWA 5J39A 4MZTA 2DTIA 1VQKT 1B34B 1IZ6A 1FXXA 3HRTA 3LLRA 4N4HA 4C92D 4IUPA 4R56A 2XI9A 4RCCA 1BI2A 1VQ9T 4NL3A 5GAOl 4F7UE 1G3WA 2VV5A 4DQ2A 4QQDA 1HK9A 2RJDA 3VYHB 1YCYA 2K57A 3CMEA 1K8AC 3VJPA 4XQ3A 2JN0A 3CXCS 3RKXA 5A2QE 2QQBA 2XK0A 2E1HA 4DOVA 3JRZA 5LJ5e 2M9UA 2FL7A 4XTYA 2A3LA 3CCUA 1Y96A 3V8KA 3S6WA 4CRIA 4XU3A 2DJZA 2RJEA 3HKSA 5FU7B 1I8FA 2HQXA 4XU0A 3A8OB 4LDVA 1QVPA 4PJOF 3RESA 3UT1A 5GMKe 2QI2A 2D9TA 3G4SA 3ME9A 1YHQT 4Z02A 2JUFA 4JRKA 3LX7A 4L59A 4JUVA 1ZHIA 2HNIA 2KK4A 4NS5A 4F7UB 3G6ET 3G71A 1K9MU 3CC7T 4M7DD 5LJ3g 2XIDA 5GAOp 1UGRB 3KUFA 3SD4A 5GANf 1OYXA 4OGEA 3O8VA 3WXMB 3JCMP 1M1FA 3JB9J 1YJNA 3CCLA 5CKBA 3M53A 2CS7A 5GAN2 3FB9A 3OB9A 3C4SA 3RKWA 1LJOA 5KE3A 2ZCFB 4FU6A 3SWNA 3CCSA 1YI2A 2EWNA 2EKOA 4M78E 1QVGS 3V8LA 1NE8A 3GIBA 3C12A 1MHNA 3RMSA 4C8QA 5GAN6 3L2VA 2HBPA 3CC4T 4BACA 3UDCA 1VQ6T 1NZ9A 5D6WA 3CBPA 1YITA 1JB0E 1UGSB 3LGFA 3DB3A 1VQ7T 3JCMW 2KVQG 3QBYA 3CCQT 5M9OA 3VUBA 2C06A 3MCAB 2O4XA 4OB3B 4M7AA 2JZ2A 2WSEE 1YJWT 5I2SA 4C5IA 5KE2A 2GQVA 2L3RA 1BI3A 5CAIA 2RI5A 3CD6A 5CCAA 1ZQ1A 2CGHA 2D6FA 5CKDA 2MAMA 4FM4B 4BI3A 3JSCA 4C92A 1YIJT 3TREA 2EJFA 2Y4YA 3QJYA 2L8DA 2YLBA 5GAN8 2E41A 2R57A 4BE1A 1N8RU 1YJ9A 4XTUA 3FLGA 3CCVA 2DD4A 3JB9G 3I56A 5GAN3 1OZ3A 2EQUA 2EFIA 3LGLA 5CKFA 5LJ3h 2K5FA 4IUUA 2D0QB 2QQ9A 3VU3C 2WACA 2DK3A 4A4FA 4A54A 2XDPA 1Q86C 4M78F 1Q82C 4BB7A 2JTMA 2RHYA 2ZPFB 1WJQA 2P0QA 5GANe 1UB4A 2RB6A 2P4TA 2X4YA 3META 4JDSA 4PLLA 3OYBA 3OW2A 2WSCE 1M4ZA 4KULA 4Q5WA 5FROA 4BE2A 3I55A 4ZTJA 3SDZA 3M54A 1VQMA 3SWNC 4OP0A 4A4HA 4M7DA 3LYIA 2CZ1B 2JVVA 4BI8B 2PQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAF A;  2KQW A; 
#chains in the Genus database with same CATH topology
 5GAM j;  1NJI R;  4C8Q C;  5KYN A;  4TVR A;  2MYS A;  5D7U A;  3S3M A;  4Y91 A;  1GRI A;  2GCX A;  2EQM A;  3I9Q A;  2DLP A;  3JCM V;  1IGQ A;  1VA7 A;  2ED1 A;  3QWY A;  4KGV B;  3L2U A;  4KGX B;  2O88 A;  4M7A G;  3M0Q A;  1NLP C;  1M8V A;  3H0H A;  3R6O A;  3OSS C;  3VS5 A;  1VQN A;  2FPF A;  2BE9 B;  2JTF A;  1PHT A;  1OEB A;  3QHS A;  3EG9 B;  1W2B A;  2E5Q A;  1VQO T;  1N9R A;  3I56 Q;  5LJ5 g;  2YWW A;  1WLP B;  1KQ2 A;  4FSS A;  4RMO A;  3OYK A;  1M9S A;  4J7I A;  1LCK A;  3SWN B;  2KSS A;  3NTH A;  4A4K A;  2FB7 A;  4C92 E;  2NUT A;  2E3H A;  2OAU A;  3FIF A;  4PJO D;  1GXI E;  4M75 A;  4J9I A;  4JPB W;  2L5Q A;  2DKG A;  2X4W A;  4M7A B;  1VQ9 A;  3R6N A;  2FRW A;  2DF6 A;  3CC2 Q;  4FCY A;  2CUB A;  4FSX A;  4FL6 A;  1M2O A;  3EG0 A;  4J9G A;  2D0N A;  4M7D E;  1V29 B;  2DEQ A;  4FYW B;  1UDL A;  5D6Y A;  3OY9 A;  3M56 A;  5CK9 A;  3MEW A;  2F2V A;  4HVV A;  1WHG A;  3H8Z A;  2QDL A;  4LUD A;  1TUG B;  1M3C A;  4NOY A;  2ZGW A;  3WVE B;  1XTD A;  2LVM A;  3HPW A;  2AHJ B;  1WHM A;  2F69 A;  2K2M A;  5DM7 R;  2B8A A;  3INZ A;  5DLO A;  1BYM A;  5CQY A;  3A1P A;  1O75 A;  1IGU A;  5CIU A;  3VRZ A;  3CCQ A;  1RAC B;  4LDX A;  4C0G A;  4IIM A;  1KC8 R;  5LJ3 d;  5DY9 A;  1QVG P;  1RLP C;  5D6X A;  1KK7 A;  4DOW A;  2KYM A;  2KT1 A;  1PD0 A;  1SRM A;  3RUX A;  2RHX A;  4HVW A;  4RTY A;  1D3B B;  1TWB A;  3X28 B;  4BD3 A;  3HSB A;  3GPL A;  4HCB A;  3I56 T;  2ZPH B;  4M77 C;  3OYM A;  1WHL A;  4FT4 A;  3I5S A;  1WJR A;  1E7O A;  4M75 E;  2QA4 Q;  1AEY A;  3CPW A;  4C0D C;  5GAN h;  1MV3 A;  1WNL A;  4MZP A;  1KJW A;  3RER A;  4ZTF A;  1YIT Q;  2YXY A;  3F70 A;  4QQG A;  1Q81 U;  1N8R C;  4MDX A;  4LN2 A;  3KFV A;  4XTV A;  3CC2 T;  4FW1 A;  2BE7 D;  4F14 A;  5J26 A;  1YN8 A;  2DRM A;  2KRS A;  1W1F A;  1W70 A;  2OJ2 A;  4PJO G;  4K11 A;  4E47 A;  3CBM A;  2DJQ A;  2J6K A;  1KIK A;  1H8K A;  3J7A F;  1JO8 A;  3OYY A;  1WIE A;  1AWW A;  3RKY A;  1S1N A;  4ZN1 A;  1UG1 A;  4RTU A;  4BUG A;  1EIF A;  2MMP A;  2C0O A;  2RQU A;  1R77 A;  3ER0 A;  3X20 B;  3U23 A;  3EFO A;  3BW1 A;  3QJ6 A;  3NFC A;  3VS7 A;  1UGQ B;  4JJD A;  5GAN 5;  2DD5 A;  3QXE B;  3OS0 A;  3EAE A;  3QG1 A;  3E1S A;  1WQW A;  3JCM c;  4C8Q F;  1JEG A;  2K2V A;  4HT8 A;  4QW2 A;  1QKX A;  5CQX A;  4PJO B;  5GMK j;  5LJ3 f;  4J7F A;  2NUP B;  4X1V A;  2OTJ A;  2CSI A;  2KDS A;  3CMA Q;  4KUD K;  2GBQ A;  4BDZ A;  2CZ0 B;  9ATC B;  3QSU A;  2EYQ A;  1FYN A;  5FRN A;  2QA4 T;  3CQT A;  1VQL A;  2LCL A;  4OF1 A;  1VQ6 A;  2ED0 A;  2LP5 A;  1X01 A;  1YIT T;  4J6W A;  3SEM A;  2DAQ A;  3PMT A;  5IHK A;  3JV3 A;  1IRE B;  1PNJ A;  1VQK Q;  2DYI A;  2EGC A;  2RJF A;  4ZN3 A;  2OX7 A;  4KT0 E;  4N4G A;  3EG3 A;  5LJ3 e;  1A0N B;  1IXD A;  1ZSG A;  1N9S A;  5GAM g;  3MO8 A;  3VKI A;  1O9S A;  4A53 A;  1M90 R;  4IKF A;  4CC3 A;  3E9G A;  2HSE B;  2MWO A;  4E7S A;  2X3W D;  2EQJ A;  1BBZ A;  2RO0 A;  4IUR A;  1TTH B;  4FW2 A;  3JCM Q;  3CCR Q;  1HYO A;  2MF2 A;  2PNI A;  2EQK A;  2F2W A;  3ZBD A;  1M5Q 1;  4VUB A;  3CC4 Q;  1PKT A;  3MEA A;  4J9H A;  4O5V A;  1YJW Q;  4M78 A;  4J83 A;  2HSP A;  2JM8 A;  1C1A A;  2GQI A;  2XU8 A;  3P8B B;  4BY6 C;  5LJ5 f;  3TQ7 P;  5KYY A;  1YCS B;  3PMI A;  4LDY A;  1V76 A;  5HCK A;  3OQ5 A;  4J9C A;  4EPC A;  5KH6 A;  8AT1 B;  4KUI A;  3V7R A;  1RI0 A;  1PSE A;  2PVO B;  2M1H A;  4C8Q D;  1PC0 A;  1Q81 C;  3OYN A;  4M77 F;  4J9F A;  1AZE A;  1OUL A;  4L5G A;  4AFZ C;  3CCE Q;  3GF5 A;  2FHD A;  2CP7 A;  4ZNX A;  1Q7Y U;  4OVA A;  4M7D C;  1VQK T;  2J6F A;  2A36 A;  1B34 B;  3HRT A;  4R56 A;  2XI9 A;  4NL3 A;  1SRL A;  1G3W A;  4DQ2 A;  2KI7 A;  1HK9 A;  2X51 A;  1D1A A;  5A2Q E;  2HCK A;  3NHN A;  5LJ5 e;  4PJL A;  2FL7 A;  4XTY A;  3CCU A;  3V8K A;  2VKN A;  2DJZ A;  3UAT A;  3A8O B;  3EG9 A;  2D9T A;  1ZHI A;  1N5Z A;  1WI7 A;  4J9D A;  1RUW A;  5CKB A;  3M53 A;  3CCS A;  1Q95 G;  2ZCF B;  3SWN A;  5KYU B;  4M78 E;  1TSF A;  1NEG A;  1NE8 A;  3GIB A;  5GAN 6;  2K6D A;  2HBP A;  3CC4 T;  2LX7 A;  1JB0 E;  4OMM A;  3M0U A;  4Y92 A;  1UGV A;  4M7A A;  2WSE E;  1YJW T;  5I2S A;  4ANJ A;  4PFP A;  4C5I A;  5CAI A;  3CD6 A;  2CGH A;  5CKD A;  2MAM A;  4FM4 B;  4BI3 A;  3JSC A;  2Y4Y A;  2KEA A;  1I1J A;  3MJX A;  1YJ9 A;  1UHC A;  2DD4 A;  3CME Q;  5CKF A;  2D0Q B;  2K9G A;  2DK3 A;  2XDP A;  4DBQ A;  2RHY A;  1ZSZ C;  2P4T A;  2RB6 A;  1WHH A;  2NUZ A;  1PD1 A;  3I55 A;  1VQM A;  2YSQ A;  2LNH B;  5KYW B;  2B86 A;  2JVV A;  1NLO C;  4QT7 A;  2PQW A;  1YWP A;  2Z0W A;  2GTJ A;  2DIQ A;  1VQ8 A;  4HCZ A;  4X9C A;  3JCM f;  4C5H A;  1Z9Z A;  1WFW A;  2QAS A;  2V1Q A;  4C8Q G;  2LT1 A;  3BFM A;  1BCM A;  4PJJ A;  2DVJ A;  2LZ6 B;  5J3B A;  3VUZ A;  2F2X A;  1U1S A;  1VQP A;  4M77 D;  2XKO C;  4FYY B;  1D3B A;  2CZ7 B;  2JNG A;  2QEX A;  1VQ4 A;  4JZ3 A;  3ZL7 C;  4IUQ A;  3OMG A;  2SEM A;  2HMA A;  1S72 Q;  2E6N A;  2BTT A;  2KR3 A;  1K9M R;  4M7A E;  1WYX A;  1KD1 U;  4GBQ A;  4RG2 A;  3D7S B;  1I5O B;  4XAX B;  1AOJ A;  3MEU A;  2OI3 A;  3H41 A;  1OPK A;  1DJ7 B;  4C8Q B;  2DXB A;  1KC8 C;  3JCM e;  2CKK A;  2RNA A;  2O4X B;  2VUB A;  4ZGJ B;  2KYB A;  4F16 A;  3VS6 A;  3CME T;  3UA7 A;  3QWX X;  4OB0 B;  1K76 A;  1KQ1 A;  2O9V A;  4C5E A;  2DZC A;  1Y07 A;  1VQN Q;  4EIK A;  1YHQ A;  3CC7 A;  2AZV A;  3P8D A;  1Q7Y C;  2A0F B;  4QVC A;  2LC4 A;  4CC4 B;  4KH0 B;  1JJ2 S;  4F7U F;  2MIO A;  2DL7 A;  2DL4 A;  2EPD A;  2FEI A;  2VC8 A;  1NM7 A;  2KBT A;  1PCX A;  2K3B A;  3LW5 E;  5GAM f;  3OYC A;  4ELZ C;  3MHX A;  2QTV A;  1K0X A;  4EDU A;  1JJ2 A;  5C0M A;  4PJO A;  3OW2 S;  5IXB A;  1D1B A;  2CH4 W;  2NUP A;  1K73 U;  2KY9 A;  1NYF A;  1QCF A;  2RI2 A;  3VS1 A;  2C0T A;  1S72 T;  5GJV B;  3OS2 A;  2RD1 A;  3G4S Q;  1SKU B;  1MND A;  4AFS C;  2M51 A;  2VYT A;  2CP0 A;  3E9F A;  4OMN A;  3S3O A;  1PSF A;  4M77 G;  3A8H B;  3CCL Q;  2RHU A;  2LCC A;  3EHR A;  4MZM A;  2LJ3 A;  4RTT A;  2DIL A;  1K4U S;  2O9S A;  2DX1 A;  3VS2 A;  1UTI A;  3TSW A;  1W2B S;  2RPN A;  2COY A;  2HKN A;  5GAM e;  4JJC A;  1WXT A;  4N0A C;  3V7C A;  4PJM A;  3OYF A;  4HT9 A;  1SPK A;  2OAW A;  2KRM A;  2RHI A;  2LQK A;  2CP2 A;  6AT1 B;  2KAF A;  4AG2 C;  3S3N A;  2E70 A;  1ZA1 B;  4J9E A;  3VRY A;  4M77 B;  4FYV B;  1HD3 A;  1VQO A;  1X2K A;  4Z88 A;  2VWF A;  3I5R A;  3M55 A;  1ABQ A;  4E7H A;  1AHJ B;  4E7K A;  4E6R A;  4LDW A;  2ZPI B;  4PJO E;  1FX7 A;  3TVT A;  1UE9 A;  2BZX A;  4L6V 5;  1OQK A;  1WPY A;  4C0D B;  3ULR B;  2LDM A;  5A0L A;  2RQR A;  1RAI B;  2GNC A;  1IHW A;  2DMO A;  1VIF A;  2DIG A;  1GFD A;  3A8G B;  4F17 A;  5DLQ E;  4XTZ A;  2ZPE B;  2ZZD A;  2QDY B;  1M90 C;  1GCQ A;  4M78 C;  4KH1 B;  1WXU A;  3QO3 A;  3CCJ Q;  4QVZ A;  4BE0 A;  1KD1 C;  3G4S T;  7AT1 B;  5IT9 E;  3G6E A;  1JRI A;  2E3I A;  5IN1 A;  5GMK l;  3CCL T;  1MV0 B;  1SF9 A;  1WZO A;  2GTO A;  1LPL A;  1KHC A;  2M02 A;  3QKJ A;  2KE9 A;  3CXC A;  1YWO A;  1Q82 U;  4RG8 A;  3QZ5 B;  1G2B A;  2BIV A;  1B34 A;  5FRM A;  2PUK B;  2YRD A;  4DBF A;  4UC4 A;  1GBQ A;  2QQA A;  3EHQ A;  1PKS A;  1JJ2 P;  3PIP A;  2CZ6 B;  3BY7 A;  3CPW S;  2PVD B;  2EJ9 A;  2ROT A;  3NTK A;  1KSW A;  2FPD A;  4C0Z A;  3OSV A;  4QVD A;  2O2O A;  2YLC A;  5GAN j;  4GY5 A;  3QUI A;  3LWH A;  1K8A R;  1MNE A;  3V7S A;  4WTO B;  3OW2 P;  4RKU E;  2X9H A;  4OMP A;  3JB9 H;  2X35 A;  5I11 A;  4JRQ A;  5KYU A;  5IHI A;  2CT4 A;  1XNI A;  2VGM A;  5KYX B;  1VYV A;  3SB2 A;  2KXC A;  4II1 A;  1X2Q A;  1K73 C;  2VVK A;  3QDR B;  3M57 A;  1VQ6 Q;  1VQ7 Q;  4EMK A;  1WJS A;  2E4H A;  3CC2 A;  2J06 A;  2CUD A;  4E7I A;  2A28 A;  3CCJ T;  4RCB A;  1AVZ C;  4E7Z A;  1YIJ Q;  1W2B P;  2LX9 A;  1MMD A;  1JXO A;  1HSQ A;  1G3T A;  1WHK A;  1H64 1;  2EQI A;  4PLI A;  2EVR A;  4JZ4 A;  1ABO A;  5GMK i;  1U1T A;  2I0N A;  1RAA B;  5KYW A;  1BB9 A;  4F7U G;  1G83 A;  3L1A A;  5GAO r;  1NJI U;  1WDX A;  2KNB B;  2K3X A;  1Q86 R;  1RAB B;  2M0O A;  2IVW A;  4MZT A;  1BK2 A;  3PTA A;  1R0C B;  3LLR A;  1IRX A;  1WA7 A;  1BI2 A;  1EFN A;  4Z8A A;  1OOT A;  1SSH A;  4QQD A;  2RJD A;  3H9N A;  1HJD A;  4IIO A;  1ZBJ A;  2DYB A;  2M9U A;  1TUC A;  2A3L A;  3H0I A;  1QVP A;  5GMK e;  2EGA A;  5IHN A;  4F7U B;  2GGR A;  3G71 A;  3KUF A;  4AT1 B;  1OYX A;  4OGE A;  3O8V A;  1YJN A;  1M1F A;  2CS7 A;  1X69 A;  5KE3 A;  3C4S A;  1LJO A;  4FU6 A;  2EYY A;  3HTR A;  2JS0 A;  1IO6 A;  1GBR A;  1MHN A;  4C8Q A;  1BCO A;  3L2V A;  2DM1 A;  3UDC A;  5D6W A;  1VQ6 T;  1YIT A;  1UGS B;  1VQ7 T;  3JCM W;  1R0B G;  2KVQ G;  2EW3 A;  2DET A;  3MCA B;  2O4X A;  1OU9 A;  1QLY A;  5KE2 A;  4RTZ A;  1BI3 A;  1ZQ1 A;  2D6F A;  1XJW B;  1YIJ T;  3NGP A;  1I0C A;  4BE1 A;  2E41 A;  2R57 A;  3CCV Q;  4XTU A;  3PE0 A;  1VQ5 Q;  2MCN A;  5LJ3 h;  2QQ9 A;  3VU3 C;  1ZUY A;  4A4F A;  1OX8 A;  4M78 F;  1Q82 C;  2JTM A;  2ZPF B;  4ORZ A;  2HZY A;  1NEB A;  4JDS A;  1UB4 A;  2X4Y A;  3CPW P;  3OYB A;  4Q5W A;  4BE2 A;  2K7A A;  4A4H A;  2CZ1 B;  4IUV A;  3FDR A;  2JTE A;  3GLX A;  3X24 B;  2KGT A;  2MK5 A;  8ATC B;  5HK3 A;  2A7Y A;  2XD0 A;  1BU1 A;  1AWO A;  4BI4 A;  1KC8 U;  3CMA T;  5GAO m;  2CP3 A;  3N5B B;  3NTI A;  1AT1 B;  1N27 A;  1EX4 A;  2L3Q A;  3EGD B;  4C92 C;  3LH0 A;  2HAX A;  4PJO C;  1QW1 A;  2E10 A;  3CD6 Q;  1Y96 B;  2BZY A;  4RUG A;  4FYX B;  4JRP A;  4C8Q E;  1D1C A;  1TS9 A;  2F5K A;  2YRV A;  4YTL A;  3PIO A;  1YJ9 Q;  4A63 B;  3OYG A;  3CCM Q;  3OMC A;  1UGP B;  1NBE B;  4O6J A;  3OA6 A;  3QYG B;  1ZSZ B;  1ZA2 B;  4ZGD B;  3M5A A;  2JS2 A;  2OTL Q;  5A0G A;  2DEU A;  2E12 A;  1ACM B;  2PU9 B;  2ESW A;  3I55 Q;  3MP6 A;  1KQS A;  2RQW A;  3JCM X;  1VQK A;  2I2L A;  2CT3 A;  2DRK A;  3CCV T;  2FG0 A;  2H3E B;  5IH2 A;  3HFO A;  2EYX A;  3M4G A;  4D6W A;  1VQ5 T;  3BDL A;  4PKC C;  4KBM B;  1N8R R;  3J80 E;  3MPU B;  3M58 A;  2V8J A;  5LJ5 h;  1G3S A;  4M77 A;  1NJI C;  4FIB A;  3CCR T;  2K5L A;  2LQ8 A;  2FVU A;  2XDD A;  1VQ4 Q;  3JCM J;  2L89 A;  1VIE A;  2DTH A;  4B9W A;  2RK2 A;  2RQV A;  3IQL A;  1UEB A;  5GAN 4;  1BIB A;  1B07 A;  3CC4 A;  5GAN g;  2JMC A;  3URG A;  4RTW A;  4M75 C;  1XOV A;  4X9D A;  1M27 C;  1YJW A;  3TU4 K;  3ZFJ A;  2RQT A;  3PFS A;  1G3Y A;  2QXF A;  4XTX A;  4OB2 B;  3HL8 A;  4JRI A;  2VAS A;  1YBY A;  2DO3 A;  1ARK A;  4XK8 E;  4WF2 A;  1YJ9 T;  3RR6 A;  4LNP A;  3CCM T;  1J3T A;  1OU8 A;  1D09 B;  2ATC B;  2HQE A;  3CCE T;  1T3L A;  2LTO A;  3HHT B;  1U06 A;  2OTL T;  1WQ7 A;  1UJY A;  4LXC A;  1CSK A;  3RNJ A;  1YFN A;  3X26 B;  2AT1 B;  2SRC A;  2JT4 A;  1YI2 Q;  1N6A A;  4D8D A;  1GFC A;  2JOY A;  5CKH A;  3SFM A;  3I55 T;  4JS4 A;  3HRS A;  2DER A;  1D0X A;  1BI1 A;  1Y57 A;  3QPH A;  2QG9 B;  3J81 E;  3FJ5 A;  3M59 A;  1YNZ A;  2ABL A;  2G3R A;  2EIF A;  2ZPB B;  4M77 E;  4JS5 A;  1B7T A;  2AKL A;  1WXB A;  2XG8 D;  4J6Y A;  5EG2 A;  3T9N A;  3EGX B;  5CR2 A;  4A4E A;  2NWM A;  3HP9 A;  2COW A;  2K5I A;  4B6M A;  3JB9 F;  2BZ8 A;  1M90 U;  2EAY A;  3GNF B;  3BE3 A;  2EJG A;  2DFU A;  2ZAE A;  4J6X A;  5I2M A;  3C0C A;  4NL2 A;  2NLU A;  2XMF A;  3MKD A;  4ESR A;  1TG0 A;  3A8M B;  4EMH A;  1RAD B;  2VGN A;  4E7L A;  3JCM b;  1VYT A;  3RMQ A;  3OYJ A;  1QCO A;  2AZS A;  2DBM A;  1UFF A;  3A5Z B;  3THK A;  1KQS P;  4BDY A;  2EGE A;  2P4R A;  2RHZ A;  3LH5 A;  3TEE A;  2P0K A;  1NPP A;  3JCM h;  1UJ0 A;  3L42 A;  1W4S A;  3MEV A;  1SSF A;  3DLL A;  4EMK C;  1P92 A;  2KMT A;  1M2V B;  4JLI A;  1LOJ A;  4MMK A;  2AK5 A;  4LUE A;  3QII A;  1H92 A;  5FU6 C;  5L8R E;  2F5T X;  4IUT A;  1UHF A;  4C92 F;  4DA4 A;  4M78 G;  1OZ2 A;  4MML A;  4JLG A;  4OGC A;  1YI2 T;  4KGZ B;  3V8J A;  2DZ9 A;  5GAO q;  3UPU A;  1NPR A;  4N4I A;  2DNU A;  1IB8 A;  3RIR A;  1JU5 C;  3TSZ A;  4M7D F;  4GLM A;  1MMN A;  1VQ9 Q;  4CC2 A;  1SHG A;  4KRT A;  3C95 A;  3NMZ C;  1I4K 1;  1HXD A;  2KQW A;  1QVG A;  2V8K A;  2M16 A;  2O01 E;  4M78 B;  1QP3 A;  1MUZ A;  2BUD A;  2MWP A;  1M3B A;  4F7U A;  2V8I A;  5KYY B;  3OS1 A;  1S72 A;  5GAN d;  1QWF A;  1MGQ A;  3UWN A;  3G6E Q;  2XDB A;  2HKQ B;  1ZLM A;  1E6H A;  2RI3 A;  2X3X D;  5EC7 A;  3OBW A;  4QKU A;  1Y0M A;  3QZ9 B;  2LQW A;  3QDF A;  2JW4 A;  1KG1 A;  1R8O B;  2M0Y A;  4AFU C;  2ZPG B;  2DXC A;  5I21 A;  4JJN K;  3CCQ Q;  1G5V A;  2RJC A;  2RN8 A;  2LRQ A;  2LCS A;  1Y7X A;  5GAM h;  1VQN T;  4M75 F;  2L3P A;  2PVG B;  2RA2 A;  5FU7 C;  2YT6 A;  3HFN A;  3CEY A;  2O31 A;  5GJW B;  3L2W A;  2DPP B;  5ECA A;  4C0F A;  2FZC B;  1X6O A;  4R55 A;  5CO7 A;  3GOX A;  2LNV A;  4PJN A;  1OI1 A;  2GFU A;  1KFZ A;  4A4G A;  2R5M A;  3EG2 A;  2X4J A;  5J39 A;  2LMJ A;  2CP6 A;  1IZ6 A;  1VYU A;  1VQ9 T;  4C92 D;  4F7U E;  2VV5 A;  2KT8 A;  3EGD A;  3VJP A;  4XQ3 A;  2JN0 A;  3CXC S;  2QQB A;  2E1H A;  4DOV A;  3JRZ A;  4OML A;  1Y96 A;  1NG2 A;  1K0S A;  3S6W A;  4CRI A;  4XU3 A;  1WX6 A;  2HQX A;  4XU0 A;  4LDV A;  2ECZ A;  2QI2 A;  4RTV A;  1QWE A;  2MOX A;  3G4S A;  3PVQ A;  4Z02 A;  3AHU A;  3G6E T;  2HNI A;  4M7D D;  1K9M U;  1M1K R;  2XID A;  5GAN f;  3WXM B;  1ZSZ A;  2JMA A;  3CCL A;  1TU0 B;  5GAN 2;  3OB9 A;  3RKW A;  1TXQ A;  2EWN A;  2CH4 A;  3GBQ A;  2J05 A;  3C12 A;  4BAC A;  1NZ9 A;  2CDT A;  3DB3 A;  3QBY A;  3CCQ T;  3VUB A;  1U5S A;  2K79 A;  4OB3 B;  2GQV A;  2EKH A;  1RLQ C;  5CCA A;  1JQQ A;  2EYZ A;  2EJF A;  2L8D A;  1E6G A;  1PWT A;  2OTJ Q;  1X6G A;  3JB9 G;  2J7I A;  5GAN 3;  1OZ3 A;  3I56 A;  2DL5 A;  2CRE A;  1PRM C;  1AWJ A;  4CC7 A;  5FWB A;  3VS3 A;  2EBP A;  2QGF B;  4A54 A;  4E2F B;  2ROL A;  3NPF A;  1QMC A;  1WJQ A;  2P0Q A;  5GAN e;  3MET A;  4PLL A;  3I35 A;  5FW9 A;  2YUQ A;  5FRO A;  4ZTJ A;  3M54 A;  3SWN C;  4OP0 A;  2YRC A;  3EH2 A;  3LYI A;  3G71 Q;  4BI8 B;  1EZZ B;  1VQL Q;  2DE0 X;  4M75 D;  1YJN Q;  3AT1 B;  1VUB A;  2L2P A;  3GP8 A;  1Q7Y R;  3UA6 A;  3CBO A;  4M7A C;  3SHW A;  5HKC A;  1M30 A;  2HD0 A;  1T0J A;  2GF7 A;  3ZEH A;  4WCI A;  2COZ A;  2BKD N;  4XTW A;  2P0P A;  3CCJ A;  4J5Y A;  2CP5 A;  3OBY A;  3PVL A;  3TCJ A;  3M0S A;  4C92 G;  5LL6 S;  3JCM g;  4OMQ A;  4QQ6 A;  1YP5 A;  3X25 B;  2FRY A;  4V2S A;  3M9Q A;  5HK0 A;  1QP2 A;  5KCO A;  2DL3 A;  2AIR B;  2IIM A;  1V1C A;  4Y28 E;  4AFQ C;  2RK1 A;  3G1J A;  3LWI A;  4M7D G;  4C5G A;  2XIC A;  2IG0 A;  4BY6 B;  1Y71 A;  3PGG A;  3EGX A;  2V26 A;  2OTJ T;  2VXF A;  3E19 A;  4LD6 A;  1H3Z A;  2QK0 A;  1BKB A;  2FPE A;  4C92 B;  5LJ5 d;  2H8H A;  2HL3 A;  5I22 A;  4EMG A;  2X4X A;  3KBG A;  3G7Z A;  4PK4 A;  2QA4 A;  2FZK B;  2PUO B;  4OB1 B;  3OYH A;  5GMK h;  5FWC A;  3CXC P;  1T3S A;  4HCK A;  3G71 T;  2RM4 A;  1VQL T;  1GL5 A;  1YJN T;  2QTX A;  2QAZ A;  3L2R A;  4M7D B;  1SG5 A;  4AG1 C;  3HRU A;  3OYL A;  5IAY A;  2RF0 A;  2JM9 A;  2C0I A;  1VQ7 A;  2DXT A;  5LJ3 j;  4N0A A;  5CKE A;  3A8L B;  2VB6 A;  1LNX A;  2W0Z A;  1M2V A;  4M75 G;  2PTK A;  2HBW A;  3M4Y A;  1K9M C;  4R0K A;  1YIJ A;  2CSQ A;  1MMA A;  2K4Y A;  2Y90 A;  3CCU Q;  2LJ0 A;  4ATO A;  1H3H A;  1CKA A;  2H3J A;  3L2Q A;  4DEX A;  1B3Q A;  2FYK A;  2HL5 C;  1W6X A;  1FMK A;  2DBK A;  3VS0 A;  2QQR A;  1ZUU A;  2HDA A;  2EYW A;  1M1K U;  3OYD A;  4B9X A;  2R5A A;  3CCS Q;  1KD1 R;  5AYF A;  2PZ1 A;  3FC3 A;  4DEY A;  3QYH B;  4HKE A;  3RBB B;  3JAM E;  2ENM A;  4HCC A;  2NUT B;  2R58 A;  2E65 A;  3JB9 I;  3EFR A;  3H0F A;  4M75 B;  3DB4 A;  3CMA A;  3EG1 A;  4OMO A;  1AWX A;  3VV0 A;  3OYE A;  3UF4 A;  3L2Z A;  1FMW A;  1U8R A;  1X43 A;  4XU1 A;  4X34 A;  2JJ9 A;  1KQS S;  1K8A U;  5IXF A;  3WVD B;  3ASK A;  1M1G A;  2VXE A;  3Q1J A;  1AZG B;  1JBM A;  1OPL A;  3FJP A;  2LT4 A;  1NYG A;  1VQM Q;  1G8X A;  1D0Z A;  4LDU A;  3KXT A;  3FRN A;  2DA9 A;  1RAH B;  1VQ8 Q;  3DLM A;  1FMV A;  4P5N A;  1K9A A;  3JCM d;  4OMF B;  5LJ5 j;  3CPF A;  3MP1 A;  2KXD A;  2MI6 A;  1WGS A;  3CCU T;  3CCV A;  4M7A F;  1M3A A;  2QQS A;  1VQP Q;  1XQH A;  1K73 R;  4M4Z A;  3EFS A;  1VQ5 A;  1C6V X;  4CI0 C;  2QEX Q;  2D8J A;  2XHC A;  1AD5 A;  3M0P A;  1PM3 A;  1QVF S;  2HEQ A;  3RDV A;  3CCR A;  3CCS T;  2E5K A;  2L3S A;  2WSF E;  3VYG A;  5KCH A;  1FWZ A;  2K3Y A;  4PL6 A;  4HA8 A;  1QCN A;  1ZUK A;  1I07 A;  1X75 C;  1Q86 U;  2KRO A;  4HXJ A;  1UEC A;  2CYZ B;  1QVF A;  2FO0 A;  4M78 D;  4J8O A;  1JXM A;  1TH7 A;  3REA B;  3CD6 T;  2DXU A;  4Z89 A;  1I81 A;  2MPX C;  2DTO A;  3PNW C;  3BDU A;  3OYA A;  1QQJ A;  3M0R A;  3OYI A;  2YHT A;  4EMK B;  3PT9 A;  5A0D A;  1GCQ C;  2YUP A;  4XU2 A;  5GAO n;  2AKK A;  3P8H A;  3H6Z A;  5FU6 B;  2YUO A;  2D1X A;  4LD9 K;  3CCM A;  5FLX E;  2NYS A;  3CCE A;  2E6Z A;  1YHQ Q;  1T0H A;  2J6O A;  5L23 A;  3CC7 Q;  1VQM T;  4D8K A;  5GAN 7;  5AT1 B;  2OTL A;  1I5L A;  3REB B;  2JXB A;  4GLK A;  1SHF A;  4PNO A;  2QGG A;  1VQ8 T;  2IPO B;  4E7J A;  3GNG A;  2QYZ A;  2E64 A;  2GFA A;  4FT2 A;  3A98 A;  3EFO B;  1F1B B;  1X27 A;  3OS5 A;  1LVK A;  1VOM A;  4ELY C;  5GAM d;  4ZGE B;  2Y4X A;  4MDW A;  1VQP T;  3EH1 A;  1C0M A;  2QEX T;  1BI0 A;  1VQ4 T;  3C94 A;  5C6S A;  3FEO A;  1TOV A;  1M1K C;  3MP8 A;  4ME7 A;  4PFO A;  4DBH A;  1BIA A;  1RL2 A;  2DVE A;  1KHI A;  1X6B A;  4PFZ A;  5GMK m;  1IHV A;  3E2U A;  5KYX A;  2DL8 A;  3EGU A;  2RH2 A;  2F1L A;  1QKW A;  5HY6 A;  5CVI A;  4M7A D;  1UUE A;  3DKM A;  1ZBX A;  1Q82 R;  2DTI A;  1FXX A;  3JB9 J;  4N4H A;  4IUP A;  4RCC A;  5GAO l;  2V1R A;  1SEM A;  3VYH B;  1YCY A;  2K57 A;  3CME A;  1K8A C;  1MMG A;  2RMO A;  3RKX A;  2XK0 A;  2RJE A;  3HKS A;  5FU7 B;  1I8F A;  3RES A;  4PJO F;  3UT1 A;  2D8H A;  3ME9 A;  1YHQ T;  2JUF A;  4JRK A;  2KRN A;  3LX7 A;  4JUV A;  4L59 A;  4NS5 A;  2KK4 A;  4F04 B;  2LJ1 A;  3CC7 T;  1Z9Q A;  5LJ3 g;  5GAO p;  1UGR B;  3SD4 A;  3JCM P;  4RTX A;  1VQO Q;  3FB9 A;  1YI2 A;  1GCP A;  1PG5 B;  2EKO A;  2LQN A;  1QVG S;  1K1Z A;  1RAF B;  2W10 A;  3V8L A;  3RMS A;  4JJB A;  1TUD A;  1Q81 R;  2HQH A;  3CBP A;  3LGF A;  1QVF P;  5M9O A;  1PRL C;  2C06 A;  2A08 A;  2JZ2 A;  1RI9 A;  2L3R A;  2RI5 A;  1WHJ A;  1OV3 A;  4LE9 A;  2YDL A;  3O5Z A;  1RAG B;  4AMC A;  4C92 A;  3TRE A;  3QJY A;  2YLB A;  2A37 A;  3M0T A;  3VS4 A;  5GAN 8;  2G6F X;  1N8R U;  3FLG A;  1OX9 A;  2EQU A;  2EFI A;  3LGL A;  2K5F A;  4IUU A;  2WAC A;  4DBR A;  1M8M A;  1Q86 C;  1U3O A;  2YUN A;  1RAE B;  4HVU A;  4BB7 A;  1CKB A;  2L0A A;  1D0Y A;  4J9B A;  3OW2 A;  1ZX6 A;  1M4Z A;  2WSC E;  4KUL A;  3SDZ A;  4M7D A;  2FZG B;  2P84 A;  3JB9 D; 
#chains in the Genus database with same CATH homology
 4M75 D;  5GAM j;  4IUV A;  3FDR A;  4C8Q C;  3GLX A;  3X24 B;  2DIQ A;  1VQ8 A;  1VUB A;  4TVR A;  3GP8 A;  4HCZ A;  4X9C A;  3JCM f;  5HK3 A;  4C5H A;  2A7Y A;  2XD0 A;  3S3M A;  3CBO A;  4Y91 A;  4M7A C;  4C8Q G;  2GCX A;  2LT1 A;  3BFM A;  2EQM A;  4BI4 A;  3JCM V;  5HKC A;  5GAO m;  2HD0 A;  1KC8 U;  3CMA T;  3N5B B;  3L2U A;  2GF7 A;  5J3B A;  3NTI A;  3VUZ A;  1N27 A;  4M7A G;  3ZEH A;  4C92 C;  1U1S A;  1VQP A;  1M8V A;  4M77 D;  3LH0 A;  2BKD N;  2XKO C;  3OSS C;  3R6O A;  4XTW A;  2HAX A;  4PJO C;  1VQN A;  2P0P A;  1D3B A;  2CZ7 B;  2JNG A;  1QW1 A;  2E10 A;  4J5Y A;  2QEX A;  3CCJ A;  3OBY A;  1VQ4 A;  1Y96 B;  3TCJ A;  2JTF A;  4C92 G;  3QHS A;  4IUQ A;  5LL6 S;  3OMG A;  4C8Q E;  3JCM g;  4JRP A;  1W2B A;  2F5K A;  2YRV A;  2E5Q A;  4YTL A;  3PIO A;  4QQ6 A;  1VQO T;  3X25 B;  3OYG A;  1N9R A;  2E6N A;  3OMC A;  5LJ5 g;  1UGP B;  4V2S A;  3M9Q A;  4O6J A;  5HK0 A;  4M7A E;  1QP2 A;  3OA6 A;  1KQ2 A;  3QYG B;  1KD1 U;  4RG2 A;  5KCO A;  4RMO A;  3OYK A;  1M9S A;  4ZGD B;  4J7I A;  5LJ5 h;  3M5A A;  3SWN B;  2KSS A;  3NTH A;  5A0G A;  4A4K A;  2FB7 A;  4XAX B;  2E12 A;  4C92 E;  3MEU A;  4Y28 E;  2PU9 B;  2RK1 A;  2OAU A;  1DJ7 B;  4C8Q B;  2DXB A;  3FIF A;  3LWI A;  4PJO D;  1KC8 C;  3MP6 A;  4M7D G;  1GXI E;  1KQS A;  3JCM e;  3JCM X;  2CKK A;  4M75 A;  4C5G A;  1VQK A;  2I2L A;  2L5Q A;  2DKG A;  2IG0 A;  2O4X B;  2X4W A;  2VUB A;  2XIC A;  4M7A B;  4BY6 B;  4ZGJ B;  1VQ9 A;  1Y71 A;  3CCV T;  3PGG A;  2OTJ T;  2VXF A;  3E19 A;  3HFO A;  4LD6 A;  1H3Z A;  3CME T;  4FSX A;  3M4G A;  4D6W A;  1BKB A;  4C92 B;  1VQ5 T;  3BDL A;  4FL6 A;  4OB0 B;  5LJ5 d;  4PKC C;  4KBM B;  4M7D E;  3J80 E;  1V29 B;  4EMG A;  1KQ1 A;  2DEQ A;  3M58 A;  3PTA A;  2V8J A;  5D6Y A;  4C5E A;  1G3S A;  2X4X A;  3M56 A;  2DZC A;  3KBG A;  3MEW A;  4M77 A;  1Y07 A;  5CK9 A;  1NJI C;  4FIB A;  3G7Z A;  2K5L A;  2LQ8 A;  3CCR T;  2FVU A;  2QA4 A;  2XDD A;  1YHQ A;  3H8Z A;  2PUO B;  4OB1 B;  3JCM J;  3OYH A;  2L89 A;  5GMK h;  3CC7 A;  3P8D A;  1Q7Y C;  4NOY A;  1VIE A;  2ZGW A;  3G71 T;  2RM4 A;  2DTH A;  2LC4 A;  3WVE B;  4QVC A;  4B9W A;  1VQL T;  2RK2 A;  1JJ2 S;  1YJN T;  1XTD A;  2LVM A;  3HPW A;  4F7U F;  2QTX A;  2AHJ B;  2F69 A;  3L2R A;  4M7D B;  1UEB A;  5GAN 4;  3HRU A;  1BIB A;  3OYL A;  2VC8 A;  5IAY A;  5DM7 R;  2B8A A;  3INZ A;  5DLO A;  1BYM A;  3CC4 A;  5CQY A;  5GAN g;  1O75 A;  3LW5 E;  5GAM f;  5CIU A;  1VQ7 A;  2DXT A;  3URG A;  4ELZ C;  3OYC A;  4M75 C;  1XOV A;  3MHX A;  4X9D A;  5LJ3 j;  3CCQ A;  4N0A A;  4LDX A;  5CKE A;  4EDU A;  1YJW A;  1JJ2 A;  5C0M A;  3TU4 K;  3ZFJ A;  3A8L B;  4C0G A;  3OW2 S;  4PJO A;  5LJ3 d;  1LNX A;  5DY9 A;  3PFS A;  5D6X A;  4M75 G;  2KY9 A;  1K73 U;  1G3Y A;  2QXF A;  4XTX A;  4DOW A;  3M4Y A;  4OB2 B;  1YIJ A;  3HL8 A;  4JRI A;  1K9M C;  1YBY A;  2DO3 A;  2K4Y A;  2Y90 A;  2RI2 A;  3RUX A;  4XK8 E;  4ATO A;  2RHX A;  4WF2 A;  1D3B B;  1YJ9 T;  3X28 B;  4BD3 A;  3HSB A;  2H3J A;  3L2Q A;  3CCM T;  3GPL A;  1S72 T;  4HCB A;  3I56 T;  2ZPH B;  4M77 C;  3OS2 A;  2FYK A;  2HQE A;  2RD1 A;  3CCE T;  3OYM A;  2VYT A;  4FT4 A;  1WJR A;  2LTO A;  2QQR A;  3HHT B;  3E9F A;  4M75 E;  3S3O A;  1M1K U;  1PSF A;  1WQ7 A;  4M77 G;  3A8H B;  4B9X A;  3OYD A;  2OTL T;  3X26 B;  2RHU A;  2R5A A;  2LCC A;  1N6A A;  4MZM A;  2JOY A;  5CKH A;  5AYF A;  3SFM A;  3I55 T;  3CPW A;  4C0D C;  5GAN h;  4JS4 A;  3HRS A;  3FC3 A;  1BI1 A;  3QYH B;  1WNL A;  4HKE A;  4MZP A;  1W2B S;  3RER A;  3JAM E;  3QPH A;  4ZTF A;  3J81 E;  4HCC A;  3F70 A;  3M59 A;  2R58 A;  2E65 A;  4QQG A;  1Q81 U;  1N8R C;  3JB9 I;  4MDX A;  4XTV A;  5GAM e;  3EFR A;  2G3R A;  3CC2 T;  2EIF A;  2ZPB B;  4M75 B;  4M77 E;  4N0A C;  3V7C A;  4JS5 A;  3DB4 A;  3CMA A;  3OYF A;  2XG8 D;  4J6Y A;  3VV0 A;  3OYE A;  4HT9 A;  5EG2 A;  3L2Z A;  3T9N A;  5J26 A;  5CR2 A;  1U8R A;  2RHI A;  4XU1 A;  4X34 A;  4A4E A;  2LQK A;  4PJO G;  2KAF A;  3HP9 A;  2K5I A;  3S3N A;  2E70 A;  3JB9 F;  1M90 U;  1KQS S;  4E47 A;  3CBM A;  2EAY A;  1K8A U;  3GNF B;  3J7A F;  2EJG A;  3OYY A;  4M77 B;  3WVD B;  3RKY A;  3ASK A;  1VQO A;  1M1G A;  2VXE A;  4J6X A;  4NL2 A;  2NLU A;  3M55 A;  5I2M A;  4ZN1 A;  3Q1J A;  4BUG A;  1EIF A;  1JBM A;  2MMP A;  3FJP A;  2LT4 A;  1AHJ B;  4E7H A;  4E7K A;  4LDW A;  2ZPI B;  3A8M B;  4PJO E;  1FX7 A;  4EMH A;  4L6V 5;  2VGN A;  3ER0 A;  4LDU A;  3X20 B;  4E7L A;  3JCM b;  3OYJ A;  3RMQ A;  1WPY A;  4C0D B;  3KXT A;  3FRN A;  3BW1 A;  3QJ6 A;  3NFC A;  1UGQ B;  2LDM A;  5A0L A;  5GAN 5;  3DLM A;  2DD5 A;  3A5Z B;  3QXE B;  4BDY A;  3OS0 A;  4P5N A;  3EAE A;  3QG1 A;  3JCM d;  4OMF B;  2RHZ A;  3E1S A;  1WQW A;  5LJ5 j;  1VIF A;  2DIG A;  3CPF A;  3JCM c;  4C8Q F;  3TEE A;  2P0K A;  2K2V A;  3A8G B;  3MP1 A;  4HT8 A;  1NPP A;  3JCM h;  4QW2 A;  5CQX A;  5DLQ E;  3L42 A;  4PJO B;  4XTZ A;  2MI6 A;  5GMK j;  1W4S A;  1WGS A;  1SSF A;  2ZPE B;  2ZZD A;  3MEV A;  4J7F A;  1P92 A;  2QDY B;  5LJ3 f;  4EMK C;  3DLL A;  2QQS A;  3CCU T;  2KMT A;  1M90 C;  4M7A F;  2OTJ A;  1XQH A;  4JLI A;  4M78 C;  4KUD K;  2KDS A;  1LOJ A;  3EFS A;  4MMK A;  3QO3 A;  1VQ5 A;  3QII A;  4CI0 C;  4QVZ A;  4BE0 A;  1KD1 C;  5FU6 C;  5L8R E;  3G4S T;  4BDZ A;  2F5T X;  2XHC A;  4IUT A;  5IT9 E;  3G6E A;  4C92 F;  2CZ0 B;  4DA4 A;  4M78 G;  3QSU A;  1OZ2 A;  2EYQ A;  5FRN A;  1JRI A;  4MML A;  5IN1 A;  5GMK l;  1QVF S;  3CCR A;  3CCL T;  4JLG A;  2QA4 T;  4OGC A;  3CCS T;  1YI2 T;  1KHC A;  2WSF E;  3VYG A;  5KCH A;  1FWZ A;  3QKJ A;  3V8J A;  2DZ9 A;  2K3Y A;  4PL6 A;  3CXC A;  4HA8 A;  5GAO q;  1VQL A;  3UPU A;  2LCL A;  4OF1 A;  1VQ6 A;  1NPR A;  4N4I A;  1X75 C;  1Q86 U;  1X01 A;  1YIT T;  4RG8 A;  1Q82 U;  4J6W A;  3QZ5 B;  2CYZ B;  2DAQ A;  2BIV A;  1QVF A;  1B34 A;  3PMT A;  3RIR A;  4M78 D;  5FRM A;  4J8O A;  4M7D F;  1TH7 A;  2PUK B;  1IRE B;  4UC4 A;  2QQA A;  3CD6 T;  2DXU A;  1I81 A;  2RJF A;  4ZN3 A;  3PIP A;  2CZ6 B;  2DTO A;  3BDU A;  3BY7 A;  3PNW C;  4KT0 E;  4N4G A;  3OYA A;  3C95 A;  5LJ3 e;  1I4K 1;  2YHT A;  3OYI A;  3CPW S;  1HXD A;  2KQW A;  2PVD B;  2EJ9 A;  3NTK A;  4EMK B;  3PT9 A;  1QVG A;  1N9S A;  5A0D A;  4C0Z A;  2V8K A;  3OSV A;  2M16 A;  4XU2 A;  2O01 E;  5GAM g;  5GAO n;  4M78 B;  1QP3 A;  3MO8 A;  3P8H A;  3VKI A;  2BUD A;  4QVD A;  1O9S A;  2MWP A;  2YLC A;  3H6Z A;  5GAN j;  3AHU A;  5FU6 B;  4A53 A;  4F7U A;  4GY5 A;  2V8I A;  3QUI A;  3OS1 A;  3LWH A;  4LD9 K;  3CCM A;  1S72 A;  4IKF A;  5GAN d;  3E9G A;  3V7S A;  5FLX E;  3CCE A;  2E6Z A;  4RKU E;  1MGQ A;  3UWN A;  2MWO A;  1VQM T;  2EQJ A;  3JB9 H;  2X35 A;  2XDB A;  4JRQ A;  5GAN 7;  2RO0 A;  4IUR A;  2RI3 A;  2OTL A;  1XNI A;  3JCM Q;  1I5L A;  2MF2 A;  4GLK A;  3OBW A;  4PNO A;  2EQK A;  2VGM A;  1VQ8 T;  3ZBD A;  3QZ9 B;  3SB2 A;  3GNG A;  4E7J A;  1M5Q 1;  2E64 A;  2GFA A;  4II1 A;  4FT2 A;  1K73 C;  3QDR B;  4VUB A;  3OS5 A;  1KG1 A;  3M57 A;  1R8O B;  2ZPG B;  3MEA A;  2DXC A;  4EMK A;  4ELY C;  5I21 A;  4JJN K;  1WJS A;  5GAM d;  3CC2 A;  2RJC A;  4O5V A;  2Y4X A;  4M78 A;  4ZGE B;  1G5V A;  2LRQ A;  1Y7X A;  4J83 A;  4MDW A;  1VQP T;  4E7I A;  5GAM h;  4BY6 C;  3P8B B;  2XU8 A;  5LJ5 f;  1VQN T;  4M75 F;  2QEX T;  1BI0 A;  3CCJ T;  4RCB A;  2PVG B;  2RA2 A;  5FU7 C;  1VQ4 T;  3C94 A;  5C6S A;  3FEO A;  3PMI A;  1M1K C;  2LX9 A;  3MP8 A;  4LDY A;  3HFN A;  4ME7 A;  3OQ5 A;  3CEY A;  3L2W A;  1G3T A;  2DPP B;  1H64 1;  4C0F A;  1BIA A;  2DVE A;  1RL2 A;  1X6O A;  4PLI A;  1KHI A;  4EPC A;  5KH6 A;  4KUI A;  5GMK m;  3V7R A;  5GMK i;  1U1T A;  4R55 A;  1RI0 A;  1PSE A;  2PVO B;  2M1H A;  5CO7 A;  3GOX A;  2LNV A;  4C8Q D;  3JB9 D;  4F7U G;  2RH2 A;  1OI1 A;  2GFU A;  3OYN A;  1Q81 C;  4M77 F;  3L1A A;  4L5G A;  5HY6 A;  5GAO r;  3GF5 A;  5CVI A;  1NJI U;  4M7A D;  4A4G A;  3DKM A;  2R5M A;  2FHD A;  1ZBX A;  2K3X A;  1Q7Y U;  4OVA A;  2X4J A;  4M7D C;  3OY9 A;  2M0O A;  2IVW A;  5J39 A;  4MZT A;  2DTI A;  1VQK T;  1B34 B;  1IZ6 A;  1FXX A;  3HRT A;  3LLR A;  4N4H A;  4C92 D;  4IUP A;  4R56 A;  2XI9 A;  4RCC A;  1BI2 A;  1VQ9 T;  4NL3 A;  5GAO l;  4F7U E;  1G3W A;  2VV5 A;  4DQ2 A;  4QQD A;  1HK9 A;  2RJD A;  3VYH B;  1YCY A;  2K57 A;  3CME A;  1K8A C;  3VJP A;  4XQ3 A;  2JN0 A;  3CXC S;  3RKX A;  5A2Q E;  2QQB A;  2XK0 A;  2E1H A;  4DOV A;  3JRZ A;  5LJ5 e;  2M9U A;  2FL7 A;  4XTY A;  2A3L A;  3CCU A;  1Y96 A;  3V8K A;  3S6W A;  4CRI A;  4XU3 A;  2DJZ A;  2RJE A;  3HKS A;  5FU7 B;  1I8F A;  2HQX A;  4XU0 A;  3A8O B;  4LDV A;  1QVP A;  4PJO F;  3RES A;  3UT1 A;  5GMK e;  2QI2 A;  2D9T A;  3G4S A;  3ME9 A;  1YHQ T;  4Z02 A;  2JUF A;  4JRK A;  3LX7 A;  4L59 A;  4JUV A;  1ZHI A;  2HNI A;  2KK4 A;  4NS5 A;  4F7U B;  3G6E T;  3G71 A;  1K9M U;  3CC7 T;  4M7D D;  5LJ3 g;  2XID A;  5GAO p;  1UGR B;  3KUF A;  3SD4 A;  5GAN f;  1OYX A;  4OGE A;  3O8V A;  3WXM B;  3JCM P;  1M1F A;  3JB9 J;  1YJN A;  3CCL A;  5CKB A;  3M53 A;  2CS7 A;  5GAN 2;  3FB9 A;  3OB9 A;  3C4S A;  3RKW A;  1LJO A;  5KE3 A;  2ZCF B;  4FU6 A;  3SWN A;  3CCS A;  1YI2 A;  2EWN A;  2EKO A;  4M78 E;  1QVG S;  3V8L A;  1NE8 A;  3GIB A;  3C12 A;  1MHN A;  3RMS A;  4C8Q A;  5GAN 6;  3L2V A;  2HBP A;  3CC4 T;  4BAC A;  3UDC A;  1VQ6 T;  1NZ9 A;  5D6W A;  3CBP A;  1YIT A;  1JB0 E;  1UGS B;  3LGF A;  3DB3 A;  1VQ7 T;  3JCM W;  2KVQ G;  3QBY A;  3CCQ T;  5M9O A;  3VUB A;  2C06 A;  3MCA B;  2O4X A;  4OB3 B;  4M7A A;  2JZ2 A;  2WSE E;  1YJW T;  5I2S A;  4C5I A;  5KE2 A;  2GQV A;  2L3R A;  1BI3 A;  5CAI A;  2RI5 A;  3CD6 A;  5CCA A;  1ZQ1 A;  2CGH A;  2D6F A;  5CKD A;  2MAM A;  4FM4 B;  4BI3 A;  3JSC A;  4C92 A;  1YIJ T;  3TRE A;  2EJF A;  2Y4Y A;  3QJY A;  2L8D A;  2YLB A;  5GAN 8;  2E41 A;  2R57 A;  4BE1 A;  1N8R U;  1YJ9 A;  4XTU A;  3FLG A;  3CCV A;  2DD4 A;  3JB9 G;  3I56 A;  5GAN 3;  1OZ3 A;  2EQU A;  2EFI A;  3LGL A;  5CKF A;  5LJ3 h;  2K5F A;  4IUU A;  2D0Q B;  2QQ9 A;  3VU3 C;  2WAC A;  2DK3 A;  4A4F A;  4A54 A;  2XDP A;  1Q86 C;  4M78 F;  1Q82 C;  4BB7 A;  2JTM A;  2RHY A;  2ZPF B;  1WJQ A;  2P0Q A;  5GAN e;  1UB4 A;  2RB6 A;  2P4T A;  2X4Y A;  3MET A;  4JDS A;  4PLL A;  3OYB A;  3OW2 A;  2WSC E;  1M4Z A;  4KUL A;  4Q5W A;  5FRO A;  4BE2 A;  3I55 A;  4ZTJ A;  3SDZ A;  3M54 A;  1VQM A;  3SWN C;  4OP0 A;  4A4H A;  4M7D A;  3LYI A;  2CZ1 B;  2JVV A;  4BI8 B;  2PQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...