2KQWA

Sars coronavirus-unique domain (sud): three-domain molecular architecture in solution and rna binding. ii: structure of the sud-c domain of sud-mc
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
b'TSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-structural protein 3
publication title SARS coronavirus unique domain: three-domain molecular architecture in solution and RNA binding.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 13
structure length 67
sequence length 67
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12124 Nsp3_PL2pro Coronavirus polyprotein cleavage domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.590 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kqwA00
2KQWA 2KAFA
chains in the Genus database with same CATH superfamily
4XTZA 4F17A 5C0MA 2GQVA 4JJDA 1WA7A 3QXEB 2EKOA 4B9WA 2A7YA 3KXTA 1O9SA 2FRYA 1C1AA 2K79A 1RAGB 3QIIA 5GJWB 5LJ3g 3CC4T 4J6YA 1W2BS 5GAMe 3L1AA 4ZTFA 5I21A 3QDRB 1BI0A 4E7KA 1JXMA 1WIEA 3OY9A 4M75D 2B8AA 4HA8A 3G6EA 2BZXA 2YSQA 5GMKj 4GBQA 2QAZA 1NPRA 3TREA 2D8HA 4F7UF 5J39A 2EGAA 3M9QA 1YJWQ 1M2OA 4M78E 3JCMh 2QK0A 2EJ9A 1XTDA 1TUGB 1G8XA 1RACB 2LQWA 2EJFA 3OYAA 1K8AC 2EQKA 4MDXA 5GAMf 2KRNA 3RUXA 1D1BA 1RAAB 2PUOB 4A4KA 1PRLC 2H3JA 3M54A 3VYGA 2YHTA 2SEMA 3N5BB 5AT1B 4XTUA 4F7UG 1IRXA 2AKLA 4X34A 4KBMB 4AFUC 1VYVA 2YDLA 3HP9A 4FW2A 4OMPA 2O4XB 3CCLQ 4M7AC 4FSXA 1YJ9A 2CH4A 3ZFJA 1B3QA 4M77A 1TOVA 3VJPA 4M7DB 1SPKA 2D0NA 2HSEB 2LVMA 4LNPA 5KYWA 1PG5B 3EG2A 1LNXA 3CCMA 2QDLA 2FEIA 2VASA 4M7AF 4IUPA 1UFFA 4QVDA 2QQRA 4IUUA 1PKSA 4A4FA 1N8RC 1WJSA 3I56A 2P4TA 1T3LA 2IIMA 1M2VB 2GTJA 2P4RA 2QTXA 4JRQA 4FYWB 2BIVA 2DNUA 2RO0A 4YTLA 2EFIA 3X28B 2QA4Q 3FB9A 2CP2A 1WQWA 1YI2Q 2YLBA 3TU4K 4PJOD 2CT4A 4NS5A 2IVWA 2EQMA 2MOXA 4M75E 3CPWA 4NOYA 3OSSC 1UGPB 4GLKA 4F14A 3L2RA 1FX7A 3EFSA 1M1KU 1AD5A 5CO7A 1G3TA 2KAFA 1ZA2B 1MV3A 1BI2A 5GAOm 2YT6A 4R0KA 4JS5A 1ZSZB 2OAUA 3M4YA 2DXCA 4DBQA 4ESRA 3CCVT 1VQ5A 3CCUA 4Y28E 4CC2A 4BE2A 4DQ2A 2K6DA 1ZLMA 1R8OB 4AMCA 3CXCP 1NM7A 4M7AB 3KFVA 3CC2A 2J6OA 3CCRQ 2OAWA 4QT7A 2LZ6B 1K8AR 5HKCA 1QCFA 3VS4A 1R0BG 4C92D 4AT1B 3GP8A 3J7AF 3OW2P 2RMOA 4B6MA 3NFCA 4C0ZA 5KH6A 3FJ5A 3I5RA 3CBOA 4N4GA 3HKSA 1UTIA 3QPHA 3AT1B 2D8JA 2OTJQ 2A36A 2YUOA 1MMDA 4X9DA 1Q81R 4F16A 3H6ZA 2JOYA 1WJQA 2KY9A 1VQNQ 3UDCA 4JRKA 1NJIC 1JJ2S 1SG5A 2K4YA 3MP6A 2K9GA 2PZ1A 3KUFA 3TSZA 1SRMA 2HKNA 2L3QA 1YJNQ 4C8QC 2YUQA 3FC3A 1JU5C 3PT9A 3G4SA 2V1RA 5LJ5d 1K0XA 3JCMW 4M7DD 4E7SA 1GCPA 4PJOE 1BU1A 3ZL7C 1N8RR 4PNOA 1W2BA 5CQXA 2R58A 1WXUA 1S72A 3META 4MZTA 3RKWA 1XNIA 5GAN2 1HD3A 1AWXA 2ECZA 2RN8A 3REBB 1OZ2A 4C8QF 2V8IA 2DM1A 3M55A 4HT9A 2RQRA 3GIBA 4J9IA 3EFOB 3JCMX 2IPOB 1VQ7T 3QUIA 2C0TA 2EYQA 2XDDA 3OS2A 2EWNA 1I4K1 3FLGA 1M5Q1 4ELYC 2DE0X 4DA4A 1GRIA 2QEXQ 2FPFA 4OMLA 4GY5A 2F2XA 1F1BB 2KR3A 2KVQG 1BIBA 1U8RA 3A8LB 4HVVA 3JB9I 2M51A 2DRMA 9ATCB 1M4ZA 2L8DA 4C92E 4IUQA 3UF4A 1EX4A 2LC4A 3RBBB 5KYXA 1M3AA 2CGHA 2K3YA 2MPXC 3IQLA 3PMIA 2VVKA 4FSSA 4PJMA 4JJBA 3OQ5A 2F2WA 2LTOA 2RD1A 3E9GA 4E6RA 2KT8A 4FU6A 3VS0A 2KQWA 3MPUB 3J80E 4N0AC 2KT1A 4C8QB 4BI4A 3E1SA 3LH5A 4RCBA 2E64A 3ULRB 2O9VA 1M8MA 4BDYA 1AHJB 4J83A 1V1CA 1AZEA 2RH2A 5DM7R 4BDZA 4VUBA 4M78C 3G1JA 3QO3A 4M7DE 4J6WA 1QCOA 2EYZA 1NJIR 3M58A 3X20B 1RAHB 1IGUA 3INZA 4E7IA 4KGZB 1VQOT 2M9UA 2Y90A 1YCSB 2CP0A 4KULA 3CC4Q 4Z89A 4EMHA 2DTOA 1YJWA 1VQ4T 2SRCA 1AVZC 1XQHA 4KGXB 1MGQA 3JCMd 3JB9G 4M7AA 5CCAA 2CZ6B 2RB6A 4CC3A 1WJRA 2COYA 2PVGB 2L3PA 1G3WA 2QQBA 4LD9K 1VIFA 4LE9A 3LW5E 3EH1A 3DKMA 5LJ3j 1NZ9A 4ZN3A 1B07A 3CCLA 1D1AA 3CCJT 1SSHA 1VQ6T 1TU0B 4X9CA 3RESA 3QHSA 2GFUA 2E1HA 2D6FA 1T0HA 1R77A 3EG9B 1Q7YU 1ZUYA 1QKWA 1RAEB 2E6NA 1JBMA 2ZPGB 2DL3A 5GAN5 3ZBDA 1SEMA 1KG1A 3NGPA 1V29B 2V8KA 4DEYA 4M75C 2EKHA 4M78B 2QA4A 1GFDA 2GFAA 4O5VA 2LQKA 2EW3A 1YI2A 3H0IA 2JMAA 4EPCA 1R0CB 3M53A 1JJ2A 2OI3A 2WSEE 3OYLA 3HRTA 1Q95G 1BI3A 2RHXA 3EFOA 3RERA 5GMKi 4AG1C 2DL7A 4K11A 4M75F 2ED1A 2ZAEA 3LWIA 1K9AA 1KHIA 1VQ8T 1H3ZA 2AK5A 3E2UA 4XU0A 5A0GA 2PNIA 1FXXA 2LMJA 3P8BB 2VXEA 1MMNA 5HK0A 3CCST 1WXTA 3MCAB 5GAMj 1X6OA 1IZ6A 2YWWA 3L2WA 4QQDA 1A0NB 1VQLT 5M9OA 4Z02A 5KYNA 4HVWA 2DD4A 3REAB 1KC8C 1WHKA 3CCRA 2ROLA 2RQWA 4JDSA 1K73C 2DAQA 2EYXA 2O88A 1K8AU 2HEQA 2BZ8A 4M77G 3CCVQ 2LQ8A 2HQHA 2CP3A 2JVVA 2CREA 2RA2A 4KT0E 2YUPA 4Q5WA 4C8QA 3EAEA 4E7ZA 2LP5A 3V7RA 2OTJA 3LGLA 3QYGB 2FB7A 2GTOA 1PD0A 5LJ5j 4AG2C 1YITT 3KBGA 3JAME 3GNFB 1KSWA 4PJOC 2E10A 1VQNA 1LPLA 3OBYA 2D1XA 1I0CA 3QSUA 2L89A 2DA9A 4A4EA 4OGCA 2A08A 3G71T 1KQSP 4LDVA 1AWOA 2P0QA 1YJNA 5CKBA 5FWCA 1YN8A 1D0YA 1NBEB 2KXDA 3D7SB 2K2VA 3CQTA 2X4XA 2ZPIB 2GCXA 4XTVA 3OYFA 4E7LA 2PTKA 1AOJA 5GANf 2X4WA 2XG8D 2CUBA 3AHUA 3FJPA 3MEVA 4XTXA 5L23A 5GAN7 4LDYA 3EH2A 3VS2A 1PKTA 2K5FA 4IKFA 4KUDK 1T3SA 1I5LA 4ZGJB 1TH7A 3MO8A 3EFRA 3WVDB 2X9HA 3QJ6A 3C12A 2JZ2A 4C92C 3JSCA 4J7FA 2QEXA 2RK1A 4CI0C 3CD6A 3CXCS 2DX1A 5IHNA 2C0IA 1D3BB 1WZOA 3MJXA 3ZEHA 4N0AA 1Q86U 1VQ7Q 1Q7YC 1Q82C 2XU8A 4RTVA 4C92F 1NLOC 1ARKA 3OW2S 4RG2A 1AT1B 1VQMT 3A8GB 4XQ3A 5J26A 3UA7A 4PJOB 4M78A 1K73R 2M1HA 2RJFA 4OF1A 4ZNXA 4RMOA 2RI3A 5IH2A 4JZ3A 1WHMA 2NUPA 3CCEA 2ATCB 4M7DC 1DJ7B 4B9XA 2COZA 2LCCA 1JQQA 1AWJA 1UJ0A 4XU1A 1UB4A 1OI1A 3QZ9B 2CH4W 4EMGA 1X6BA 2MF2A 2RI2A 2HMAA 3EGXA 2FVUA 1OQKA 4M7DF 1UDLA 1V76A 1NJIU 3CC4A 3G6ET 1WI7A 3SDZA 4R56A 4BI8B 2DBMA 1O75A 4C0GA 1M1GA 4C92B 2KXCA 1M3CA 2RF0A 2DEUA 2CZ0B 1QWEA 5FLXE 3I9QA 4BD3A 5GANd 2XD0A 2GBQA 1RI0A 1UG1A 1VQOQ 4Z88A 4BB7A 3HL8A 1ZSZC 2EVRA 3HRUA 3T9NA 2KRSA 5LJ5e 1VQ4Q 2YLCA 4C5EA 2G6FX 2ESWA 3M0RA 1JRIA 4M75A 5GJVB 1VQ9A 1JO8A 3GOXA 5GMKh 3CPFA 4J9BA 4P5NA 3VRZA 4RG8A 1T0JA 1YJ9T 1VA7A 3OMGA 4HT8A 3QZ5B 3M56A 1GL5A 1G83A 3SB2A 2A37A 1Q7YR 1UGVA 5GAMg 2YUNA 3QKJA 2JJ9A 3CCJQ 5LJ5f 1VQ6Q 4LXCA 2XDBA 5ECAA 3M0QA 4BY6C 4J9HA 3CBPA 2G3RA 1SRLA 2DTIA 3UATA 4EMKB 3V8LA 2VGMA 3M5AA 1P92A 3PNWC 5EG2A 1WXBA 3UA6A 2KE9A 2RQUA 3BFMA 2HSPA 1UEBA 4JPBW 2CUDA 1B34B 4RKUE 3MP1A 2EYYA 2KYBA 1W4SA 4CRIA 2LX7A 2GF7A 4JJNK 4M7AG 3H41A 3HFNA 4LD6A 1XJWB 3TVTA 1Y07A 3THKA 1I81A 1TUCA 5LJ5g 3OYKA 2R57A 1D3BA 1OULA 1Q86C 4AFZC 2DL8A 3CMAT 2DYBA 2JW4A 3S3OA 4OB1B 1YHQA 5CKEA 3C0CA 2QI2A 1IREB 1VQ8Q 2A0FB 2RQVA 3BDUA 3MKDA 2DL4A 1YWOA 1KQ1A 3TQ7P 4PJOA 2QQSA 1UECA 3PIOA 3A5ZB 3CCSQ 1QVFP 2M16A 1UE9A 2MK5A 3M57A 3FDRA 3CXCA 2CS7A 2BTTA 1VQLQ 3SD4A 3SFMA 1H641 2WACA 3P8HA 1ZHIA 2EGEA 3OYDA 1E6GA 3H0FA 3JCMe 2A3LA 2DD5A 2CZ7B 2JT4A 2EPDA 5A0DA 1I8FA 2LCLA 4BY6B 1W6XA 3OYBA 2EQUA 3OW2A 2KEAA 1NYFA 5KYYB 1LCKA 5FU6B 2HDAA 3LH0A 4ZN1A 2QG9B 4J9GA 2D0QB 3S6WA 1PNJA 1N6AA 4J9FA 2O31A 1QMCA 4IIOA 4MZPA 4PLIA 4E7HA 4J8OA 1ACMB 1TUDA 4N4IA 2NUTB 1YITQ 4ORZA 4C92A 3JCMf 2PQWA 4BE1A 3TEEA 2FZGB 2RPNA 2DETA 1X69A 1ZBXA 2O2OA 3G71Q 2LX9A 2LDMA 3I5SA 2FO0A 1MMGA 3FRNA 2LNVA 3VS3A 1M1FA 1ABOA 1X2KA 1Y57A 3A1PA 3CC7A 1UUEA 4CC7A 4QQ6A 4FYVB 4XTWA 4PJLA 5DLQE 2V8JA 4JRIA 2HL3A 1ZX6A 4C0FA 1Y0MA 2QGGA 4FT4A 3V8JA 2MAMA 1UGRB 1KD1C 1QCNA 3NPFA 1MHNA 3QWXX 2EGCA 4QVCA 4XAXB 2JNGA 2O4XA 3OYJA 2QQ9A 3L2VA 3VUZA 1S1NA 2JTEA 2F1LA 3JCMg 1ZUKA 3SHWA 1SKUB 1VQ7A 1Q86R 3LWHA 5FRMA 4M7DA 5GAN3 4C8QG 3I55T 5J3BA 2E70A 2X35A 1HK9A 3HTRA 4DEXA 5FROA 3ER0A 2LCSA 1KC8U 4DBFA 3MHXA 1Y96B 1N9SA 1M2VA 1RL2A 4L6V5 1D0XA 1K73U 3URGA 1RAIB 4NL2A 1W70A 3JCMP 5I22A 2MMPA 3U23A 2K5IA 4C5HA 1VQMQ 2PVDB 1Z9QA 1OPLA 4J9DA 1KIKA 4HCCA 1KQSS 2DTHA 2DMOA 2X51A 1PWTA 1FMWA 4J6XA 1E7OA 4D8DA 1QLYA 2Y4XA 4WTOB 1QP3A 2WSCE 4M4ZA 5GANj 1ZSZA 2AZVA 3BE3A 5FU7C 4MZMA 1MNDA 5IHIA 1HYOA 1D09B 3JCMc 3HHTB 5GMKl 2FZKB 4M78F 2E3IA 3EG1A 3Q1JA 1WPYA 1SF9A 2X3WD 2XKOC 1LVKA 3PVQA 2DF6A 3VS5A 3M0TA 3G6EQ 2FRWA 1YFNA 3FIFA 1VQ4A 2DRKA 4F7UE 3PFSA 5CQYA 2BUDA 2DPPB 4LDWA 2JS2A 2E41A 2MWPA 4RUGA 2EQJA 2CZ1B 3EGDB 4ZTJA 1KD1R 4ZGEB 3GF5A 2HBPA 3H8ZA 5I2SA 4IUVA 2VGNA 8AT1B 5D6WA 5KYYA 2DYIA 4JUVA 1G2BA 1X43A 1K9MC 1WHLA 2DK3A 4ZGDB 1M3BA 3M0UA 1BKBA 1IB8A 3RIRA 2ZPEB 4FYXB 3CCJA 1Q82U 4Z8AA 2FYKA 1BCMA 2QDYB 1NEBA 4XK8E 3QYHB 3S3NA 2HD0A 2PUKB 1IHVA 1YJ9Q 3X25B 4RTWA 1HSQA 4E47A 5LJ3h 3VS1A 2JTFA 1KJWA 5FU7B 2KYMA 2W0ZA 3OYYA 5GAOn 2GGRA 1KK7A 1AWWA 2K57A 2DIGA 4ME7A 1M90C 4II1A 4QW2A 1QVGP 2ZCFB 2EAYA 1TSFA 2V26A 2VKNA 1B7TA 4EIKA 2W10A 2OTLT 1VQKT 3O8VA 1HXDA 2CSQA 1VQ8A 3OSVA 1N5ZA 4PLLA 4M75G 3OA6A 5EC7A 2VB6A 3C4SA 2H3EB 2JM8A 2RHZA 1PM3A 4FIBA 4HCKA 3A8MB 1TWBA 1Y96A 3UT1A 4XU3A 3EGUA 1YIJT 3VUBA 3CMAQ 3J81E 2MIOA 3RMSA 4PKCC 3C95A 1N9RA 2I0NA 5GANe 5CKHA 2KK4A 3L2ZA 2DVEA 3WXMB 5GAMh 2B86A 3M0PA 4A4GA 2XIDA 4XU2A 3QJYA 4OMOA 2LRQA 3QBYA 1K9MR 3WVEB 1RAFB 2DXBA 4J9CA 3RMQA 1RLPC 2RK2A 1RABB 2KMTA 4OMMA 3V8KA 1OX8A 5GAOr 4MDWA 1ZQ1A 5D6XA 1OU8A 1YITA 1I07A 2DJZA 2DXUA 2DFUA 3PE0A 4PJOF 1CKAA 1KQSA 3SWNC 4KUIA 4LUDA 4O6JA 1WHHA 3G71A 4M77B 3JB9D 2VXFA 2RNAA 4JLGA 4OB3B 5KCOA 5KYWB 4OMNA 3CMET 2J6KA 2PU9B 1TXQA 2AZSA 1GCQC 4C5GA 1RADB 2E5KA 1VQPT 2JS0A 3HRSA 5IN1A 4FW1A 1FMKA 5HK3A 4RTTA 3EGDA 4IIMA 1U1SA 3A98A 1RLQC 4LDUA 1BI1A 1KFZA 2AKKA 1LJOA 3CD6T 2DVJA 2RJCA 3RKXA 4FT2A 1QQJA 4PFZA 2QYZA 4DBHA 1JB0E 5GANg 4PFOA 4GLMA 2WSFE 3MEWA 3JB9H 1UHFA 1RUWA 4JRPA 1QVFS 3EG9A 1VOMA 4JLIA 3M0SA 3CCQT 1KC8R 2R5AA 1BK2A 1YCYA 1AEYA 1AZGB 2E6ZA 1X6GA 4ELZC 2HZYA 2Y4YA 2L2PA 3I55Q 2CKKA 2X3XD 1VQMA 1TG0A 1XOVA 3CCET 4RTUA 2RHYA 3DLLA 1EZZB 1M30A 3DB3A 1CSKA 4C92G 3SWNB 3OYIA 5I2MA 3JCMQ 2DEQA 2EQIA 2ED0A 4ATOA 4WF2A 6AT1B 4EMKC 1YWPA 2CP6A 1MV0B 5CAIA 2JUFA 1MNEA 4D8KA 3LYIA 4DBRA 1X75C 1EFNA 2O9SA 3L2UA 2RJDA 2CSIA 3JCMb 3LLRA 5KYUB 4Y91A 3HSBA 3MEUA 2C0OA 4M7DG 3NTKA 2J05A 5LL6S 2YRCA 1GXIE 4M77D 3A8HB 2QXFA 2KNBB 1FYNA 3OS1A 5GAN6 4TVRA 1C0MA 4FL6A 7AT1B 1TS9A 3SEMA 4PJNA 3VYHB 4HVUA 1KD1U 4J5YA 1BYMA 4AFQC 2FL7A 1VQ9T 3LX7A 1IHWA 1TTHB 3VV0A 1VYUA 3R6OA 2BE7D 2P0PA 1YNZA 3RNJA 1Q82R 3JV3A 3L42A 2QQAA 3CEYA 3CCMT 1QVPA 3EHRA 1PSFA 2QTVA 2ABLA 1Q81C 2EYWA 5CKDA 1JXOA 4KH0B 5I11A 2AHJB 3I56T 5LJ3d 4HCZA 5FU6C 2KROA 3E9FA 4QKUA 4PJJA 2E65A 1U1TA 4BUGA 5KYXB 4F7UB 1QWFA 1ZUUA 2K3BA 2GNCA 3OBWA 3NTHA 2QASA 1YP5A 3G7ZA 3CPWP 1ZA1B 2BE9B 2ZPFB 2F5TX 1Z9ZA 1H8KA 5GAOp 3X24B 3PGGA 1KQ2A 1H92A 4HCBA 1J3TA 1VQ5T 1NPPA 3UPUA 4N4HA 3CCUT 1YHQT 2YRVA 1GBRA 2CT3A 3BW1A 5GAN4 4M77E 2E12A 5FW9A 2MYSA 1K1ZA 1VYTA 1ZBJA 3CC2T 3EG3A 3CCVA 3CMAA 1GFCA 1UGSB 3VU3C 2VV5A 2OTLQ 1VQKQ 3VS7A 4OMQA 2LNHB 2YRDA 2JTMA 4XTYA 1BB9A 2BZYA 4A63B 2FPEA 2X4YA 2EJGA 1QVFA 2VUBA 4HKEA 2J7IA 2E5QA 3GBQA 3SWNA 4OGEA 1YIJQ 1Y7XA 1NEGA 1WDXA 5DLOA 3CBMA 5GAMd 4C5IA 2HL5C 2RHUA 4ANJA 2K2MA 4A53A 2VYTA 4AFSC 5C6SA 2P84A 1GCQA 1K9MU 4OMFB 1U3OA 5IXBA 2D9TA 4KH1B 1X2QA 5GAOl 1WHGA 4LDXA 1N27A 2E4HA 5GMKe 3H9NA 2J6FA 1PC0A 2M0OA 1K0SA 3O5ZA 3G4ST 3VRYA 3X26B 3ME9A 2JM9A 2DLPA 1U06A 5KYUA 1W2BP 1S72T 3HFOA 1IXDA 2DL5A 3RDVA 4RTYA 1QVGS 1MMAA 3CC7T 4FCYA 3F70A 4FM4B 3NHNA 1WYXA 1UJYA 2RHIA 1FMVA 3CMEQ 1LOJA 5D6YA 1M90U 1YBYA 4QQGA 3MEAA 3PMTA 2AIRB 1G5VA 1VQPQ 1WGSA 2OX7A 3PVLA 4BACA 2LT4A 3BY7A 3V7SA 2CP7A 4KRTA 2ZGWA 2HQEA 2DKGA 4KGVB 2FHDA 2DZCA 4MMLA 4X1VA 2VWFA 2KBTA 5CIUA 4PFPA 1QP2A 1MUZA 4E2FB 1M27C 3CD6Q 3S3MA 3UWNA 4EMKA 2XI9A 3OYNA 1I1JA 2C06A 4PK4A 2BKDN 3I55A 2JXBA 2EBPA 2QGFB 5GMKm 4D6WA 2FZCB 3CCQQ 1B34A 3OYCA 4NL3A 2J06A 1BIAA 4F7UA 2RJEA 3ASKA 4V2SA 1G3SA 1HJDA 5IXFA 3DLMA 1WHJA 3JCMJ 4MMKA 5D7UA 2JMCA 2NUZA 4M7AD 2K3XA 2CDTA 3QG1A 3CCEQ 1JEGA 2KDSA 1SSFA 4F04B 2OJ2A 2Z0WA 1OOTA 2K7AA 3FEOA 2E3HA 3GNGA 3RR6A 4JS4A 3JB9F 3MP8A 2CYZB 2RM4A 1M1KC 2HAXA 1YJWT 1W1FA 3P8DA 2HBWA 2IG0A 1VQOA 4DOWA 4OVAA 2LQNA 3TCJA 2KSSA 4IURA 4JZ4A 5AYFA 5CR2A 1UHCA 2A28A 4EDUA 1WLPB 4A54A 1C6VX 2XK0A 3I35A 2L3RA 2CP5A 2HCKA 2HQXA 4BE0A 1EIFA 2F2VA 4E7JA 1VUBA 5GANh 2K5LA 4OP0A 3PIPA 1OU9A 4M78G 2ZPBB 5DY9A 2DJQA 3CCLT 2GQIA 2F5KA 1K4US 5HY6A 1OZ3A 3OS0A 4L5GA 3GPLA 1OV3A 3OYMA 1QKXA 5IT9E 2L3SA 5CKFA 1VQ6A 2RQTA 1KHCA 1BBZA 2NUTA 1VQ9Q 1BCOA 1PD1A 2F69A 1GBQA 1OEBA 1Y71A 1CKBA 4WCIA 1E6HA 5KE3A 3VKIA 5GAN8 2QA4T 5KCHA 1YI2T 3QWYA 3CCMQ 4M7AE 3OS5A 1JJ2P 5IHKA 4L59A 3I56Q 2JN0A 1H3HA 1FWZA 4LUEA 2DBKA 4C0DC 3HPWA 3R6NA 1NG2A 2NUPB 3VS6A 4M77C 2DZ9A 2ZZDA 4DOVA 2H8HA 2EIFA 1X27A 4FYYB 1SHGA 1NYGA 5HCKA 2MCNA 1QVGA 2KI7A 2L0AA 2I2LA 1M1KR 3H0HA 4C8QD 1M8VA 1OYXA 4OB0B 1OPKA 2NLUA 1WQ7A 3EGXB 4UC4A 3JRZA 4RTXA 4M77F 2XICA 2COWA 3OMCA 2MI6A 3NTIA 5L8RE 3CCSA 3CCRT 2DO3A 5FRNA 1PCXA 2HNIA 2OTLA 1VQKA 4HXJA 1NLPC 1ZSGA 4QVZA 1VQLA 2DERA 3JCMV 1VQ5Q 4IUTA 3CCUQ 1YHQQ 2P0KA 2DXTA 1ABQA 4Y92A 4J9EA 2XHCA 1D1CA 5IAYA 5CK9A 1YIJA 2V1QA 3EHQA 8ATCB 3CC2Q 1X01A 5A2QE 2OTJT 2LJ1A 5A0LA 2R5MA 2HKQB 2O01E 3QDFA 2ROTA 3A8OB 3NMZC 5KE2A 1VQNT 2KGTA 2DILA 2RI5A 4JJCA 2MWOA 2PVOB 1YJNT 4M75B 2M0YA 5GAOq 2XMFA 1K76A 1I5OB 3M59A 3M4GA 3OYGA 5FWBA 1WX6A 1IO6A 3TSWA 2FG0A 1U5SA 1Q81U 4C0DB 2DIQA 1G3YA 3OYHA 3C94A 3L2QA 1PRMC 4BI3A 1NE8A 3CPWS 1IGQA 2M02A 3OB9A 5LJ5h 1VIEA 4R55A 4LN2A 3G4SQ 2FPDA 4RCCA 5CVIA 1N8RU 2L5QA 3BDLA 4PJOG 5LJ3e 3CMEA 1S72Q 1OX9A 1M90R 1D0ZA 3GLXA 2QEXT 3E19A 4PL6A 4C8QE 3DB4A 2AT1B 4M78D 1VQPA 3RKYA 3CC7Q 1QW1A 2ZPHB 3LGFA 4CC4B 3EG0A 1WFWA 2X4JA 2LJ0A 4RTZA 1M9SA 1SHFA 2LT1A 4A4HA 3JB9J 3OYEA 2NYSA 1PSEA 1WNLA 1RI9A 1PHTA 4OB2B 2LJ3A 5LJ3f 3PTAA 2VC8A 2NWMA 1UGQB 2YXYA 2XDPA 3CCQA 2ENMA 3V7CA 4J7IA 2KRMA
chains in the Genus database with same CATH topology
4XTZA 3JCMP 5C0MA 4XU0A 5A0GA 4HCBA 2MMPA 2GQVA 1FXXA 1VQ5T 1NPPA 3P8BB 3UPUA 2K5IA 2VXEA 4N4HA 3CCUT 5HK0A 1YHQT 2YRVA 4C5HA 3CCST 3MCAB 2PVDB 3BW1A 5GAMj 5GAN4 1X6OA 1IZ6A 3L2WA 1YHQA 4M77E 3QXEB 2E12A 4HCCA 4QQDA 1KQSS 2DTHA 2EKOA 1VQLT 4B9WA 5M9OA 4Z02A 3CC2T 3CCVA 2A7YA 3KXTA 1O9SA 3CMAA 1UGSB 2DD4A 4J6XA 1KC8C 3VU3C 2VV5A 2Y4XA 3CCRA 3QIIA 1QP3A 2WSCE 5LJ3g 3CC4T 4J6YA 2JTMA 4JDSA 1W2BS 4XTYA 5GANj 1K73C 5GAMe 2DAQA 3L1AA 4ZTFA 1K8AU 4M77G 5I21A 2LQ8A 2X4YA 2EJGA 1QVFA 5FU7C 3QDRB 1BI0A 2VUBA 2JVVA 4HKEA 4MZMA 2RA2A 4E7KA 4KT0E 2E5QA 3OY9A 3SWNA 4OGEA 4M75D 4Q5WA 3JCMc 4C8QA 2B8AA 4HA8A 1Y7XA 3HHTB 3G6EA 5DLOA 3CBMA 5GMKj 5GAMd 5GMKl 3EAEA 4M78F 4C5IA 1NPRA 2RHUA 3TREA 4A53A 3V7RA 2OTJA 3LGLA 3Q1JA 1WPYA 2VYTA 4F7UF 3QYGB 2FB7A 5J39A 5C6SA 3M9QA 1K9MU 2XKOC 4OMFB 5LJ5j 1YITT 3KBGA 2D9TA 3JAME 3GNFB 4M78E 3JCMh 4PJOC 2E10A 5GAOl 2EJ9A 1XTDA 4LDXA 1VQNA 3FIFA 3OBYA 1VQ4A 4F7UE 1N27A 2EJFA 2L89A 3PFSA 3OYAA 5CQYA 4OGCA 4A4EA 5GMKe 3QSUA 1K8AC 3G71T 2EQKA 2BUDA 4LDVA 2DPPB 4MDXA 2M0OA 5GAMf 4LDWA 2P0QA 3G4ST 1YJNA 2E41A 5CKBA 2MWPA 3RUXA 2EQJA 2CZ1B 4ZTJA 3X26B 3ME9A 2PUOB 4A4KA 4ZGEB 2H3JA 3GF5A 3M54A 2HBPA 2K2VA 3H8ZA 3VYGA 2X4XA 2YHTA 5I2SA 2ZPIB 4IUVA 1S72T 2GCXA 2VGNA 3HFOA 3N5BB 4XTVA 5D6WA 3OYFA 4XTUA 4F7UG 4E7LA 4X34A 4JUVA 5GANf 4KBMB 1K9MC 2X4WA 2XG8D 1QVGS 3HP9A 3AHUA 3FJPA 2DK3A 3MEVA 4XTXA 2O4XB 4ZGDB 5GAN7 3CC7T 4M7AC 4LDYA 1BKBA 3F70A 4FSXA 1YJ9A 3RIRA 3ZFJA 2ZPEB 3CCJA 4FM4B 1Q82U 2K5FA 4IKFA 4M77A 3VJPA 4KUDK 2RHIA 4M7DB 2FYKA 2LVMA 2QDYB 4XK8E 1I5LA 3QYHB 3S3NA 1LOJA 4ZGJB 1TH7A 5D6YA 1M90U 1YBYA 2HD0A 2PUKB 1LNXA 3EFRA 3MEAA 3MO8A 3PMTA 4QQGA 3WVDB 3CCMA 3QJ6A 3C12A 3X25B 2JZ2A 1G5VA 4C92C 3JSCA 4J7FA 4M7AF 1WGSA 2QEXA 4BACA 1VQ8T 2RK1A 4IUPA 5LJ3h 4E47A 2LT4A 4QVDA 4CI0C 3CD6A 2QQRA 4IUUA 3BY7A 3V7SA 4A4FA 1N8RC 2JTFA 1WJSA 5FU7B 2P4TA 2QTXA 3I56A 3CXCS 4JRQA 2BIVA 2RO0A 1D3BB 3OYYA 2EFIA 4YTLA 3X28B 5GAOn 3ZEHA 2ZGWA 2HQEA 2DKGA 3FB9A 2FHDA 2DZCA 4MMLA 4N0AA 1WQWA 5CIUA 1Q86U 1QP2A 2K57A 1Q7YC 3S3MA 2YLBA 3UWNA 3TU4K 4PJOD 1Q82C 2XU8A 4EMKA 4C92F 2DIGA 4NS5A 2XI9A 3OYNA 2C06A 3OW2S 2BKDN 2IVWA 2EQMA 4ME7A 4RG2A 3I55A 1VQMT 3A8GB 1M90C 4II1A 4QW2A 4M75E 4XQ3A 3CPWA 4NOYA 5J26A 3OSSC 1UGPB 4GLKA 4D6WA 2ZCFB 5GMKm 2EAYA 4PJOB 4M78A 3L2RA 1FX7A 2M1HA 3EFSA 2RJFA 1B34A 4OF1A 4RMOA 5CR2A 3OYCA 2RI3A 4NL3A 1M1KU 1BIAA 4F7UA 5CO7A 2RJEA 1G3TA 2KAFA 3ASKA 4V2SA 1G3SA 2OTLT 1VQKT 3O8VA 1BI2A 5GAOm 3CCEA 1HXDA 1VQ8A 3DLMA 3JCMJ 4JS5A 4M7DC 2OAUA 3OSVA 1DJ7B 4MMKA 3M4YA 2DXCA 4PLLA 4M75G 2LCCA 4B9XA 3OA6A 3CCVT 1VQ5A 4M7AD 4XU1A 3C4SA 2K3XA 2RHZA 4FIBA 3CCUA 1UB4A 3A8MB 4Y28E 1Y96A 4BE2A 3UT1A 1OI1A 4XU3A 4DQ2A 3QG1A 1R8OB 3QZ9B 1YIJT 4EMGA 2MF2A 3VUBA 2KDSA 2RI2A 1SSFA 4M7AB 3J81E 3FEOA 3GNGA 3CC2A 2FVUA 4JS4A 3RMSA 4PKCC 3JB9F 4M7DF 3MP8A 2CYZB 2RM4A 1M1KC 1NJIU 5HKCA 2HAXA 3C95A 1YJWT 1N9RA 4C92D 3CC4A 3G6ET 3GP8A 3J7AF 3P8DA 3SDZA 5GANe 4R56A 3NFCA 4BI8B 5CKHA 2IG0A 4C0ZA 1O75A 2KK4A 1VQOA 4C0GA 1M1GA 5KH6A 4DOWA 4OVAA 3CBOA 3L2ZA 2DVEA 4N4GA 2KSSA 3HKSA 4IURA 5AYFA 3TCJA 3WXMB 4C92B 2CZ0B 4A4GA 3QPHA 5FLXE 5GAMh 4EDUA 2XIDA 4XU2A 3QJYA 4BD3A 4A54A 2LRQA 3QBYA 5GANd 2XD0A 3WVEB 1RI0A 2DXBA 3RMQA 2RK2A 2XK0A 2KMTA 2L3RA 3V8KA 4X9DA 3H6ZA 2JOYA 5GAOr 4MDWA 2HQXA 1WJQA 4BB7A 2KY9A 1ZQ1A 4BE0A 1EIFA 3HL8A 5D6XA 4E7JA 3HRUA 1VUBA 3UDCA 4JRKA 3T9NA 5LJ5e 5GANh 1YITA 1NJIC 1JJ2S 2K5LA 2K4YA 2DJZA 2DXUA 3MP6A 4OP0A 3PIPA 2YLCA 4M78G 4C5EA 2ZPBB 5DY9A 3CCLT 3KUFA 4PJOF 1KQSA 3SWNC 2F5KA 4KUIA 4O6JA 5HY6A 1JRIA 4C8QC 3FC3A 4M77B 1OZ3A 3G71A 4M75A 3OS0A 3PT9A 1VQ9A 3G4SA 5LJ5d 3GOXA 3JCMW 3JB9D 2VXFA 4M7DD 4OB3B 4JLGA 4L5GA 5KCOA 3CPFA 5GMKh 3GPLA 4PJOE 4P5NA 3OYMA 3CMET 2PU9B 4PNOA 1W2BA 4RG8A 5IT9E 5CQXA 5CKFA 4C5GA 1YJ9T 1VQ6A 2R58A 1S72A 3META 1VQPT 3OMGA 1KHCA 4MZTA 3HRSA 3RKWA 3QZ5B 1XNIA 5IN1A 3M56A 5GAN2 4HT8A 3SB2A 2F69A 5HK3A 5GAMg 1OZ2A 4C8QF 2V8IA 1Y71A 3M55A 4HT9A 3QKJA 5KE3A 1U1SA 3VKIA 3GIBA 5GAN8 5LJ5f 4LDUA 2QA4T 5KCHA 1BI1A 2XDBA 3JCMX 1YI2T 1VQ7T 1LJOA 4BY6C 3CBPA 3QUIA 2G3RA 2EYQA 2XDDA 3OS2A 3CD6T 2EWNA 2DTIA 2RJCA 3RKXA 4EMKB 4FT2A 3V8LA 2VGMA 3M5AA 1I4K1 1P92A 3FLGA 1M5Q1 4M7AE 3OS5A 3PNWC 5EG2A 4ELYC 1JB0E 4DA4A 5GANg 2WSFE 3MEWA 3JB9H 3BFMA 1UEBA 4GY5A 4L59A 4JRPA 1QVFS 2KVQG 1BIBA 1B34B 2JN0A 4JLIA 4RKUE 3CCQT 3MP1A 1FWZA 1W4SA 4CRIA 1U8RA 3A8LB 2R5AA 4C0DC 3JB9I 3HPWA 2GF7A 4M77C 2DZ9A 2ZZDA 4DOVA 1YCYA 4JJNK 1M4ZA 4M7AG 2L8DA 4C92E 2E6ZA 3HFNA 4IUQA 4ELZC 4LD6A 2Y4YA 2LC4A 1Y07A 2EIFA 1I81A 2CGHA 2CKKA 5LJ5g 3OYKA 2K3YA 2R57A 1QVGA 3PMIA 2I2LA 1VQMA 1XOVA 4C8QD 3CCET 1D3BA 1M8VA 1OYXA 4OB0B 2RHYA 3OQ5A 3DLLA 2NLUA 1Q86C 1WQ7A 2LTOA 3DB3A 2RD1A 3JRZA 4UC4A 3CMAT 3S3OA 4OB1B 4M77F 2XICA 3E9GA 4C92G 4FU6A 3OMCA 3SWNB 2MI6A 3NTIA 2KQWA 5CKEA 5L8RE 3J80E 3OYIA 3CCRT 3CCSA 2DO3A 4N0AC 5I2MA 4C8QB 2DEQA 2QI2A 3JCMQ 5FRNA 1IREB 2HNIA 2OTLA 1VQKA 4BI4A 3E1SA 4RCBA 3BDUA 4QVZA 1VQLA 4ATOA 2E64A 4WF2A 3JCMV 1KQ1A 4EMKC 4PJOA 2QQSA 4IUTA 4BDYA 1AHJB 5CAIA 2P0KA 2DXTA 3A5ZB 3PIOA 4J83A 2RH2A 2M16A 2JUFA 5DM7R 3M57A 3FDRA 4BDZA 4VUBA 3CXCA 2XHCA 5IAYA 2CS7A 4M78C 3LYIA 3QO3A 5CK9A 1YIJA 4M7DE 3SD4A 3SFMA 4J6WA 1X75C 1H641 2WACA 3P8HA 1ZHIA 3M58A 1X01A 3X20B 5A2QE 3OYDA 2OTJT 3INZA 3JCMe 4E7IA 1VQOT 2M9UA 2A3LA 2Y90A 2DD5A 5A0LA 2CZ7B 2R5MA 5A0DA 4KULA 3L2UA 2O01E 1I8FA 2LCLA 4BY6B 2RJDA 4EMHA 3OYBA 3A8OB 2DTOA 5KE2A 2EQUA 3OW2A 1YJWA 1VQNT 3JCMb 1VQ4T 3LLRA 4Y91A 3HSBA 3MEUA 1XQHA 2RI5A 1MGQA 3JCMd 3JB9G 4M7DG 5FU6B 2MWOA 5CCAA 4M7AA 2PVOB 3NTKA 3LH0A 4ZN1A 1YJNT 4M75B 5LL6S 5GAOq 1GXIE 2CZ6B 2RB6A 4M77D 2D0QB 3S6WA 3M59A 3M4GA 3OYGA 1WJRA 1N6AA 2QXFA 3A8HB 2PVGB 3OS1A 5GAN6 4TVRA 4FL6A 4MZPA 1G3WA 2QQBA 4PLIA 4C0DB 1Q81U 4E7HA 2DIQA 4J8OA 4LD9K 4N4IA 1G3YA 1VIFA 3VYHB 3LW5E 3OYHA 1KD1U 3C94A 4J5YA 1BYMA 3DKMA 2FL7A 4C92A 5LJ3j 1VQ9T 1NZ9A 3JCMf 3L2QA 3LX7A 4ZN3A 4BI3A 1NE8A 2PQWA 3TEEA 4BE1A 3CPWS 1ZBXA 3CCLA 3OB9A 5LJ5h 2LX9A 3CCJT 1VIEA 3VV0A 2LDMA 4R55A 1VQ6T 4X9CA 3FRNA 3RESA 3QHSA 3R6OA 2P0PA 2GFUA 2LNVA 2E1HA 4RCCA 5CVIA 1N8RU 1M1FA 2D6FA 3L42A 2L5QA 2QQAA 3BDLA 3CEYA 3CC7A 3CCMT 1QVPA 4PJOG 5LJ3e 4QQ6A 3CMEA 1H3ZA 1PSFA 4XTWA 5DLQE 3GLXA 2V8JA 1Q81C 2QEXT 3E19A 4JRIA 4PL6A 4C0FA 4C8QE 1Q7YU 3DB4A 4FT4A 3V8JA 5CKDA 1VQPA 4M78D 2E6NA 2MAMA 1UGRB 1JBMA 2AHJB 2ZPGB 3I56T 5GAN5 1KD1C 3RKYA 1MHNA 3ZBDA 4QVCA 5LJ3d 1KG1A 1QW1A 2JNGA 2O4XA 4HCZA 2ZPHB 4XAXB 5FU6C 3OYJA 1V29B 2QQ9A 3E9FA 3L2VA 2V8KA 3VUZA 3LGFA 4M75C 4M78B 3JCMg 2E65A 2QA4A 1U1TA 2GFAA 2X4JA 4O5VA 4BUGA 2LQKA 1M9SA 4F7UB 1YI2A 2LT1A 1VQ7A 3LWHA 5FRMA 4M7DA 4A4HA 5GAN3 3JB9J 4C8QG 4EPCA 3OYEA 3I55T 1PSEA 3M53A 1JJ2A 1WNLA 2WSEE 5J3BA 3OYLA 3HRTA 3OBWA 1KQ2A 2E70A 2X35A 1BI3A 1HK9A 3G7ZA 3NTHA 4OB2B 5FROA 2RHXA 3ER0A 5LJ3f 5GMKi 3RERA 2ZPFB 2F5TX 1KC8U 3PTAA 4M75F 2VC8A 3MHXA 1UGQB 1Y96B 2XDPA 1N9SA 3CCQA 3LWIA 3V7CA 1RL2A 4J7IA 4L6V5 3X24B 5GAOp 1K73U 3URGA 1KHIA 4NL2A 3PGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQW A;  2KAF A; 
#chains in the Genus database with same CATH topology
 4XTZ A;  4F17 A;  5C0M A;  2GQV A;  4JJD A;  1WA7 A;  3QXE B;  2EKO A;  4B9W A;  2A7Y A;  3KXT A;  1O9S A;  2FRY A;  1C1A A;  2K79 A;  1RAG B;  3QII A;  5GJW B;  5LJ3 g;  3CC4 T;  4J6Y A;  1W2B S;  5GAM e;  3L1A A;  4ZTF A;  5I21 A;  3QDR B;  1BI0 A;  4E7K A;  1JXM A;  1WIE A;  3OY9 A;  4M75 D;  2B8A A;  4HA8 A;  3G6E A;  2BZX A;  2YSQ A;  5GMK j;  4GBQ A;  2QAZ A;  1NPR A;  3TRE A;  2D8H A;  4F7U F;  5J39 A;  2EGA A;  3M9Q A;  1YJW Q;  1M2O A;  4M78 E;  3JCM h;  2QK0 A;  2EJ9 A;  1XTD A;  1TUG B;  1G8X A;  1RAC B;  2LQW A;  2EJF A;  3OYA A;  1K8A C;  2EQK A;  4MDX A;  5GAM f;  2KRN A;  3RUX A;  1D1B A;  1RAA B;  2PUO B;  4A4K A;  1PRL C;  2H3J A;  3M54 A;  3VYG A;  2YHT A;  2SEM A;  3N5B B;  5AT1 B;  4XTU A;  4F7U G;  1IRX A;  2AKL A;  4X34 A;  4KBM B;  4AFU C;  1VYV A;  2YDL A;  3HP9 A;  4FW2 A;  4OMP A;  2O4X B;  3CCL Q;  4M7A C;  4FSX A;  1YJ9 A;  2CH4 A;  3ZFJ A;  1B3Q A;  4M77 A;  1TOV A;  3VJP A;  4M7D B;  1SPK A;  2D0N A;  2HSE B;  2LVM A;  4LNP A;  5KYW A;  1PG5 B;  3EG2 A;  1LNX A;  3CCM A;  2QDL A;  2FEI A;  2VAS A;  4M7A F;  4IUP A;  1UFF A;  4QVD A;  2QQR A;  4IUU A;  1PKS A;  4A4F A;  1N8R C;  1WJS A;  3I56 A;  2P4T A;  1T3L A;  2IIM A;  1M2V B;  2GTJ A;  2P4R A;  2QTX A;  4JRQ A;  4FYW B;  2BIV A;  2DNU A;  2RO0 A;  4YTL A;  2EFI A;  3X28 B;  2QA4 Q;  3FB9 A;  2CP2 A;  1WQW A;  1YI2 Q;  2YLB A;  3TU4 K;  4PJO D;  2CT4 A;  4NS5 A;  2IVW A;  2EQM A;  2MOX A;  4M75 E;  3CPW A;  4NOY A;  3OSS C;  1UGP B;  4GLK A;  4F14 A;  3L2R A;  1FX7 A;  3EFS A;  1M1K U;  1AD5 A;  5CO7 A;  1G3T A;  2KAF A;  1ZA2 B;  1MV3 A;  1BI2 A;  5GAO m;  2YT6 A;  4R0K A;  4JS5 A;  1ZSZ B;  2OAU A;  3M4Y A;  2DXC A;  4DBQ A;  4ESR A;  3CCV T;  1VQ5 A;  3CCU A;  4Y28 E;  4CC2 A;  4BE2 A;  4DQ2 A;  2K6D A;  1ZLM A;  1R8O B;  4AMC A;  3CXC P;  1NM7 A;  4M7A B;  3KFV A;  3CC2 A;  2J6O A;  3CCR Q;  2OAW A;  4QT7 A;  2LZ6 B;  1K8A R;  5HKC A;  1QCF A;  3VS4 A;  1R0B G;  4C92 D;  4AT1 B;  3GP8 A;  3J7A F;  3OW2 P;  2RMO A;  4B6M A;  3NFC A;  4C0Z A;  5KH6 A;  3FJ5 A;  3I5R A;  3CBO A;  4N4G A;  3HKS A;  1UTI A;  3QPH A;  3AT1 B;  2D8J A;  2OTJ Q;  2A36 A;  2YUO A;  1MMD A;  4X9D A;  1Q81 R;  4F16 A;  3H6Z A;  2JOY A;  1WJQ A;  2KY9 A;  1VQN Q;  3UDC A;  4JRK A;  1NJI C;  1JJ2 S;  1SG5 A;  2K4Y A;  3MP6 A;  2K9G A;  2PZ1 A;  3KUF A;  3TSZ A;  1SRM A;  2HKN A;  2L3Q A;  1YJN Q;  4C8Q C;  2YUQ A;  3FC3 A;  1JU5 C;  3PT9 A;  3G4S A;  2V1R A;  5LJ5 d;  1K0X A;  3JCM W;  4M7D D;  4E7S A;  1GCP A;  4PJO E;  1BU1 A;  3ZL7 C;  1N8R R;  4PNO A;  1W2B A;  5CQX A;  2R58 A;  1WXU A;  1S72 A;  3MET A;  4MZT A;  3RKW A;  1XNI A;  5GAN 2;  1HD3 A;  1AWX A;  2ECZ A;  2RN8 A;  3REB B;  1OZ2 A;  4C8Q F;  2V8I A;  2DM1 A;  3M55 A;  4HT9 A;  2RQR A;  3GIB A;  4J9I A;  3EFO B;  3JCM X;  2IPO B;  1VQ7 T;  3QUI A;  2C0T A;  2EYQ A;  2XDD A;  3OS2 A;  2EWN A;  1I4K 1;  3FLG A;  1M5Q 1;  4ELY C;  2DE0 X;  4DA4 A;  1GRI A;  2QEX Q;  2FPF A;  4OML A;  4GY5 A;  2F2X A;  1F1B B;  2KR3 A;  2KVQ G;  1BIB A;  1U8R A;  3A8L B;  4HVV A;  3JB9 I;  2M51 A;  2DRM A;  9ATC B;  1M4Z A;  2L8D A;  4C92 E;  4IUQ A;  3UF4 A;  1EX4 A;  2LC4 A;  3RBB B;  5KYX A;  1M3A A;  2CGH A;  2K3Y A;  2MPX C;  3IQL A;  3PMI A;  2VVK A;  4FSS A;  4PJM A;  4JJB A;  3OQ5 A;  2F2W A;  2LTO A;  2RD1 A;  3E9G A;  4E6R A;  2KT8 A;  4FU6 A;  3VS0 A;  2KQW A;  3MPU B;  3J80 E;  4N0A C;  2KT1 A;  4C8Q B;  4BI4 A;  3E1S A;  3LH5 A;  4RCB A;  2E64 A;  3ULR B;  2O9V A;  1M8M A;  4BDY A;  1AHJ B;  4J83 A;  1V1C A;  1AZE A;  2RH2 A;  5DM7 R;  4BDZ A;  4VUB A;  4M78 C;  3G1J A;  3QO3 A;  4M7D E;  4J6W A;  1QCO A;  2EYZ A;  1NJI R;  3M58 A;  3X20 B;  1RAH B;  1IGU A;  3INZ A;  4E7I A;  4KGZ B;  1VQO T;  2M9U A;  2Y90 A;  1YCS B;  2CP0 A;  4KUL A;  3CC4 Q;  4Z89 A;  4EMH A;  2DTO A;  1YJW A;  1VQ4 T;  2SRC A;  1AVZ C;  1XQH A;  4KGX B;  1MGQ A;  3JCM d;  3JB9 G;  4M7A A;  5CCA A;  2CZ6 B;  2RB6 A;  4CC3 A;  1WJR A;  2COY A;  2PVG B;  2L3P A;  1G3W A;  2QQB A;  4LD9 K;  1VIF A;  4LE9 A;  3LW5 E;  3EH1 A;  3DKM A;  5LJ3 j;  1NZ9 A;  4ZN3 A;  1B07 A;  3CCL A;  1D1A A;  3CCJ T;  1SSH A;  1VQ6 T;  1TU0 B;  4X9C A;  3RES A;  3QHS A;  2GFU A;  2E1H A;  2D6F A;  1T0H A;  1R77 A;  3EG9 B;  1Q7Y U;  1ZUY A;  1QKW A;  1RAE B;  2E6N A;  1JBM A;  2ZPG B;  2DL3 A;  5GAN 5;  3ZBD A;  1SEM A;  1KG1 A;  3NGP A;  1V29 B;  2V8K A;  4DEY A;  4M75 C;  2EKH A;  4M78 B;  2QA4 A;  1GFD A;  2GFA A;  4O5V A;  2LQK A;  2EW3 A;  1YI2 A;  3H0I A;  2JMA A;  4EPC A;  1R0C B;  3M53 A;  1JJ2 A;  2OI3 A;  2WSE E;  3OYL A;  3HRT A;  1Q95 G;  1BI3 A;  2RHX A;  3EFO A;  3RER A;  5GMK i;  4AG1 C;  2DL7 A;  4K11 A;  4M75 F;  2ED1 A;  2ZAE A;  3LWI A;  1K9A A;  1KHI A;  1VQ8 T;  1H3Z A;  2AK5 A;  3E2U A;  4XU0 A;  5A0G A;  2PNI A;  1FXX A;  2LMJ A;  3P8B B;  2VXE A;  1MMN A;  5HK0 A;  3CCS T;  1WXT A;  3MCA B;  5GAM j;  1X6O A;  1IZ6 A;  2YWW A;  3L2W A;  4QQD A;  1A0N B;  1VQL T;  5M9O A;  4Z02 A;  5KYN A;  4HVW A;  2DD4 A;  3REA B;  1KC8 C;  1WHK A;  3CCR A;  2ROL A;  2RQW A;  4JDS A;  1K73 C;  2DAQ A;  2EYX A;  2O88 A;  1K8A U;  2HEQ A;  2BZ8 A;  4M77 G;  3CCV Q;  2LQ8 A;  2HQH A;  2CP3 A;  2JVV A;  2CRE A;  2RA2 A;  4KT0 E;  2YUP A;  4Q5W A;  4C8Q A;  3EAE A;  4E7Z A;  2LP5 A;  3V7R A;  2OTJ A;  3LGL A;  3QYG B;  2FB7 A;  2GTO A;  1PD0 A;  5LJ5 j;  4AG2 C;  1YIT T;  3KBG A;  3JAM E;  3GNF B;  1KSW A;  4PJO C;  2E10 A;  1VQN A;  1LPL A;  3OBY A;  2D1X A;  1I0C A;  3QSU A;  2L89 A;  2DA9 A;  4A4E A;  4OGC A;  2A08 A;  3G71 T;  1KQS P;  4LDV A;  1AWO A;  2P0Q A;  1YJN A;  5CKB A;  5FWC A;  1YN8 A;  1D0Y A;  1NBE B;  2KXD A;  3D7S B;  2K2V A;  3CQT A;  2X4X A;  2ZPI B;  2GCX A;  4XTV A;  3OYF A;  4E7L A;  2PTK A;  1AOJ A;  5GAN f;  2X4W A;  2XG8 D;  2CUB A;  3AHU A;  3FJP A;  3MEV A;  4XTX A;  5L23 A;  5GAN 7;  4LDY A;  3EH2 A;  3VS2 A;  1PKT A;  2K5F A;  4IKF A;  4KUD K;  1T3S A;  1I5L A;  4ZGJ B;  1TH7 A;  3MO8 A;  3EFR A;  3WVD B;  2X9H A;  3QJ6 A;  3C12 A;  2JZ2 A;  4C92 C;  3JSC A;  4J7F A;  2QEX A;  2RK1 A;  4CI0 C;  3CD6 A;  3CXC S;  2DX1 A;  5IHN A;  2C0I A;  1D3B B;  1WZO A;  3MJX A;  3ZEH A;  4N0A A;  1Q86 U;  1VQ7 Q;  1Q7Y C;  1Q82 C;  2XU8 A;  4RTV A;  4C92 F;  1NLO C;  1ARK A;  3OW2 S;  4RG2 A;  1AT1 B;  1VQM T;  3A8G B;  4XQ3 A;  5J26 A;  3UA7 A;  4PJO B;  4M78 A;  1K73 R;  2M1H A;  2RJF A;  4OF1 A;  4ZNX A;  4RMO A;  2RI3 A;  5IH2 A;  4JZ3 A;  1WHM A;  2NUP A;  3CCE A;  2ATC B;  4M7D C;  1DJ7 B;  4B9X A;  2COZ A;  2LCC A;  1JQQ A;  1AWJ A;  1UJ0 A;  4XU1 A;  1UB4 A;  1OI1 A;  3QZ9 B;  2CH4 W;  4EMG A;  1X6B A;  2MF2 A;  2RI2 A;  2HMA A;  3EGX A;  2FVU A;  1OQK A;  4M7D F;  1UDL A;  1V76 A;  1NJI U;  3CC4 A;  3G6E T;  1WI7 A;  3SDZ A;  4R56 A;  4BI8 B;  2DBM A;  1O75 A;  4C0G A;  1M1G A;  4C92 B;  2KXC A;  1M3C A;  2RF0 A;  2DEU A;  2CZ0 B;  1QWE A;  5FLX E;  3I9Q A;  4BD3 A;  5GAN d;  2XD0 A;  2GBQ A;  1RI0 A;  1UG1 A;  1VQO Q;  4Z88 A;  4BB7 A;  3HL8 A;  1ZSZ C;  2EVR A;  3HRU A;  3T9N A;  2KRS A;  5LJ5 e;  1VQ4 Q;  2YLC A;  4C5E A;  2G6F X;  2ESW A;  3M0R A;  1JRI A;  4M75 A;  5GJV B;  1VQ9 A;  1JO8 A;  3GOX A;  5GMK h;  3CPF A;  4J9B A;  4P5N A;  3VRZ A;  4RG8 A;  1T0J A;  1YJ9 T;  1VA7 A;  3OMG A;  4HT8 A;  3QZ5 B;  3M56 A;  1GL5 A;  1G83 A;  3SB2 A;  2A37 A;  1Q7Y R;  1UGV A;  5GAM g;  2YUN A;  3QKJ A;  2JJ9 A;  3CCJ Q;  5LJ5 f;  1VQ6 Q;  4LXC A;  2XDB A;  5ECA A;  3M0Q A;  4BY6 C;  4J9H A;  3CBP A;  2G3R A;  1SRL A;  2DTI A;  3UAT A;  4EMK B;  3V8L A;  2VGM A;  3M5A A;  1P92 A;  3PNW C;  5EG2 A;  1WXB A;  3UA6 A;  2KE9 A;  2RQU A;  3BFM A;  2HSP A;  1UEB A;  4JPB W;  2CUD A;  1B34 B;  4RKU E;  3MP1 A;  2EYY A;  2KYB A;  1W4S A;  4CRI A;  2LX7 A;  2GF7 A;  4JJN K;  4M7A G;  3H41 A;  3HFN A;  4LD6 A;  1XJW B;  3TVT A;  1Y07 A;  3THK A;  1I81 A;  1TUC A;  5LJ5 g;  3OYK A;  2R57 A;  1D3B A;  1OUL A;  1Q86 C;  4AFZ C;  2DL8 A;  3CMA T;  2DYB A;  2JW4 A;  3S3O A;  4OB1 B;  1YHQ A;  5CKE A;  3C0C A;  2QI2 A;  1IRE B;  1VQ8 Q;  2A0F B;  2RQV A;  3BDU A;  3MKD A;  2DL4 A;  1YWO A;  1KQ1 A;  3TQ7 P;  4PJO A;  2QQS A;  1UEC A;  3PIO A;  3A5Z B;  3CCS Q;  1QVF P;  2M16 A;  1UE9 A;  2MK5 A;  3M57 A;  3FDR A;  3CXC A;  2CS7 A;  2BTT A;  1VQL Q;  3SD4 A;  3SFM A;  1H64 1;  2WAC A;  3P8H A;  1ZHI A;  2EGE A;  3OYD A;  1E6G A;  3H0F A;  3JCM e;  2A3L A;  2DD5 A;  2CZ7 B;  2JT4 A;  2EPD A;  5A0D A;  1I8F A;  2LCL A;  4BY6 B;  1W6X A;  3OYB A;  2EQU A;  3OW2 A;  2KEA A;  1NYF A;  5KYY B;  1LCK A;  5FU6 B;  2HDA A;  3LH0 A;  4ZN1 A;  2QG9 B;  4J9G A;  2D0Q B;  3S6W A;  1PNJ A;  1N6A A;  4J9F A;  2O31 A;  1QMC A;  4IIO A;  4MZP A;  4PLI A;  4E7H A;  4J8O A;  1ACM B;  1TUD A;  4N4I A;  2NUT B;  1YIT Q;  4ORZ A;  4C92 A;  3JCM f;  2PQW A;  4BE1 A;  3TEE A;  2FZG B;  2RPN A;  2DET A;  1X69 A;  1ZBX A;  2O2O A;  3G71 Q;  2LX9 A;  2LDM A;  3I5S A;  2FO0 A;  1MMG A;  3FRN A;  2LNV A;  3VS3 A;  1M1F A;  1ABO A;  1X2K A;  1Y57 A;  3A1P A;  3CC7 A;  1UUE A;  4CC7 A;  4QQ6 A;  4FYV B;  4XTW A;  4PJL A;  5DLQ E;  2V8J A;  4JRI A;  2HL3 A;  1ZX6 A;  4C0F A;  1Y0M A;  2QGG A;  4FT4 A;  3V8J A;  2MAM A;  1UGR B;  1KD1 C;  1QCN A;  3NPF A;  1MHN A;  3QWX X;  2EGC A;  4QVC A;  4XAX B;  2JNG A;  2O4X A;  3OYJ A;  2QQ9 A;  3L2V A;  3VUZ A;  1S1N A;  2JTE A;  2F1L A;  3JCM g;  1ZUK A;  3SHW A;  1SKU B;  1VQ7 A;  1Q86 R;  3LWH A;  5FRM A;  4M7D A;  5GAN 3;  4C8Q G;  3I55 T;  5J3B A;  2E70 A;  2X35 A;  1HK9 A;  3HTR A;  4DEX A;  5FRO A;  3ER0 A;  2LCS A;  1KC8 U;  4DBF A;  3MHX A;  1Y96 B;  1N9S A;  1M2V A;  1RL2 A;  4L6V 5;  1D0X A;  1K73 U;  3URG A;  1RAI B;  4NL2 A;  1W70 A;  3JCM P;  5I22 A;  2MMP A;  3U23 A;  2K5I A;  4C5H A;  1VQM Q;  2PVD B;  1Z9Q A;  1OPL A;  4J9D A;  1KIK A;  4HCC A;  1KQS S;  2DTH A;  2DMO A;  2X51 A;  1PWT A;  1FMW A;  4J6X A;  1E7O A;  4D8D A;  1QLY A;  2Y4X A;  4WTO B;  1QP3 A;  2WSC E;  4M4Z A;  5GAN j;  1ZSZ A;  2AZV A;  3BE3 A;  5FU7 C;  4MZM A;  1MND A;  5IHI A;  1HYO A;  1D09 B;  3JCM c;  3HHT B;  5GMK l;  2FZK B;  4M78 F;  2E3I A;  3EG1 A;  3Q1J A;  1WPY A;  1SF9 A;  2X3W D;  2XKO C;  1LVK A;  3PVQ A;  2DF6 A;  3VS5 A;  3M0T A;  3G6E Q;  2FRW A;  1YFN A;  3FIF A;  1VQ4 A;  2DRK A;  4F7U E;  3PFS A;  5CQY A;  2BUD A;  2DPP B;  4LDW A;  2JS2 A;  2E41 A;  2MWP A;  4RUG A;  2EQJ A;  2CZ1 B;  3EGD B;  4ZTJ A;  1KD1 R;  4ZGE B;  3GF5 A;  2HBP A;  3H8Z A;  5I2S A;  4IUV A;  2VGN A;  8AT1 B;  5D6W A;  5KYY A;  2DYI A;  4JUV A;  1G2B A;  1X43 A;  1K9M C;  1WHL A;  2DK3 A;  4ZGD B;  1M3B A;  3M0U A;  1BKB A;  1IB8 A;  3RIR A;  2ZPE B;  4FYX B;  3CCJ A;  1Q82 U;  4Z8A A;  2FYK A;  1BCM A;  2QDY B;  1NEB A;  4XK8 E;  3QYH B;  3S3N A;  2HD0 A;  2PUK B;  1IHV A;  1YJ9 Q;  3X25 B;  4RTW A;  1HSQ A;  4E47 A;  5LJ3 h;  3VS1 A;  2JTF A;  1KJW A;  5FU7 B;  2KYM A;  2W0Z A;  3OYY A;  5GAO n;  2GGR A;  1KK7 A;  1AWW A;  2K57 A;  2DIG A;  4ME7 A;  1M90 C;  4II1 A;  4QW2 A;  1QVG P;  2ZCF B;  2EAY A;  1TSF A;  2V26 A;  2VKN A;  1B7T A;  4EIK A;  2W10 A;  2OTL T;  1VQK T;  3O8V A;  1HXD A;  2CSQ A;  1VQ8 A;  3OSV A;  1N5Z A;  4PLL A;  4M75 G;  3OA6 A;  5EC7 A;  2VB6 A;  3C4S A;  2H3E B;  2JM8 A;  2RHZ A;  1PM3 A;  4FIB A;  4HCK A;  3A8M B;  1TWB A;  1Y96 A;  3UT1 A;  4XU3 A;  3EGU A;  1YIJ T;  3VUB A;  3CMA Q;  3J81 E;  2MIO A;  3RMS A;  4PKC C;  3C95 A;  1N9R A;  2I0N A;  5GAN e;  5CKH A;  2KK4 A;  3L2Z A;  2DVE A;  3WXM B;  5GAM h;  2B86 A;  3M0P A;  4A4G A;  2XID A;  4XU2 A;  3QJY A;  4OMO A;  2LRQ A;  3QBY A;  1K9M R;  3WVE B;  1RAF B;  2DXB A;  4J9C A;  3RMQ A;  1RLP C;  2RK2 A;  1RAB B;  2KMT A;  4OMM A;  3V8K A;  1OX8 A;  5GAO r;  4MDW A;  1ZQ1 A;  5D6X A;  1OU8 A;  1YIT A;  1I07 A;  2DJZ A;  2DXU A;  2DFU A;  3PE0 A;  4PJO F;  1CKA A;  1KQS A;  3SWN C;  4KUI A;  4LUD A;  4O6J A;  1WHH A;  3G71 A;  4M77 B;  3JB9 D;  2VXF A;  2RNA A;  4JLG A;  4OB3 B;  5KCO A;  5KYW B;  4OMN A;  3CME T;  2J6K A;  2PU9 B;  1TXQ A;  2AZS A;  1GCQ C;  4C5G A;  1RAD B;  2E5K A;  1VQP T;  2JS0 A;  3HRS A;  5IN1 A;  4FW1 A;  1FMK A;  5HK3 A;  4RTT A;  3EGD A;  4IIM A;  1U1S A;  3A98 A;  1RLQ C;  4LDU A;  1BI1 A;  1KFZ A;  2AKK A;  1LJO A;  3CD6 T;  2DVJ A;  2RJC A;  3RKX A;  4FT2 A;  1QQJ A;  4PFZ A;  2QYZ A;  4DBH A;  1JB0 E;  5GAN g;  4PFO A;  4GLM A;  2WSF E;  3MEW A;  3JB9 H;  1UHF A;  1RUW A;  4JRP A;  1QVF S;  3EG9 A;  1VOM A;  4JLI A;  3M0S A;  3CCQ T;  1KC8 R;  2R5A A;  1BK2 A;  1YCY A;  1AEY A;  1AZG B;  2E6Z A;  1X6G A;  4ELZ C;  2HZY A;  2Y4Y A;  2L2P A;  3I55 Q;  2CKK A;  2X3X D;  1VQM A;  1TG0 A;  1XOV A;  3CCE T;  4RTU A;  2RHY A;  3DLL A;  1EZZ B;  1M30 A;  3DB3 A;  1CSK A;  4C92 G;  3SWN B;  3OYI A;  5I2M A;  3JCM Q;  2DEQ A;  2EQI A;  2ED0 A;  4ATO A;  4WF2 A;  6AT1 B;  4EMK C;  1YWP A;  2CP6 A;  1MV0 B;  5CAI A;  2JUF A;  1MNE A;  4D8K A;  3LYI A;  4DBR A;  1X75 C;  1EFN A;  2O9S A;  3L2U A;  2RJD A;  2CSI A;  3JCM b;  3LLR A;  5KYU B;  4Y91 A;  3HSB A;  3MEU A;  2C0O A;  4M7D G;  3NTK A;  2J05 A;  5LL6 S;  2YRC A;  1GXI E;  4M77 D;  3A8H B;  2QXF A;  2KNB B;  1FYN A;  3OS1 A;  5GAN 6;  4TVR A;  1C0M A;  4FL6 A;  7AT1 B;  1TS9 A;  3SEM A;  4PJN A;  3VYH B;  4HVU A;  1KD1 U;  4J5Y A;  1BYM A;  4AFQ C;  2FL7 A;  1VQ9 T;  3LX7 A;  1IHW A;  1TTH B;  3VV0 A;  1VYU A;  3R6O A;  2BE7 D;  2P0P A;  1YNZ A;  3RNJ A;  1Q82 R;  3JV3 A;  3L42 A;  2QQA A;  3CEY A;  3CCM T;  1QVP A;  3EHR A;  1PSF A;  2QTV A;  2ABL A;  1Q81 C;  2EYW A;  5CKD A;  1JXO A;  4KH0 B;  5I11 A;  2AHJ B;  3I56 T;  5LJ3 d;  4HCZ A;  5FU6 C;  2KRO A;  3E9F A;  4QKU A;  4PJJ A;  2E65 A;  1U1T A;  4BUG A;  5KYX B;  4F7U B;  1QWF A;  1ZUU A;  2K3B A;  2GNC A;  3OBW A;  3NTH A;  2QAS A;  1YP5 A;  3G7Z A;  3CPW P;  1ZA1 B;  2BE9 B;  2ZPF B;  2F5T X;  1Z9Z A;  1H8K A;  5GAO p;  3X24 B;  3PGG A;  1KQ2 A;  1H92 A;  4HCB A;  1J3T A;  1VQ5 T;  1NPP A;  3UPU A;  4N4H A;  3CCU T;  1YHQ T;  2YRV A;  1GBR A;  2CT3 A;  3BW1 A;  5GAN 4;  4M77 E;  2E12 A;  5FW9 A;  2MYS A;  1K1Z A;  1VYT A;  1ZBJ A;  3CC2 T;  3EG3 A;  3CCV A;  3CMA A;  1GFC A;  1UGS B;  3VU3 C;  2VV5 A;  2OTL Q;  1VQK Q;  3VS7 A;  4OMQ A;  2LNH B;  2YRD A;  2JTM A;  4XTY A;  1BB9 A;  2BZY A;  4A63 B;  2FPE A;  2X4Y A;  2EJG A;  1QVF A;  2VUB A;  4HKE A;  2J7I A;  2E5Q A;  3GBQ A;  3SWN A;  4OGE A;  1YIJ Q;  1Y7X A;  1NEG A;  1WDX A;  5DLO A;  3CBM A;  5GAM d;  4C5I A;  2HL5 C;  2RHU A;  4ANJ A;  2K2M A;  4A53 A;  2VYT A;  4AFS C;  5C6S A;  2P84 A;  1GCQ A;  1K9M U;  4OMF B;  1U3O A;  5IXB A;  2D9T A;  4KH1 B;  1X2Q A;  5GAO l;  1WHG A;  4LDX A;  1N27 A;  2E4H A;  5GMK e;  3H9N A;  2J6F A;  1PC0 A;  2M0O A;  1K0S A;  3O5Z A;  3G4S T;  3VRY A;  3X26 B;  3ME9 A;  2JM9 A;  2DLP A;  1U06 A;  5KYU A;  1W2B P;  1S72 T;  3HFO A;  1IXD A;  2DL5 A;  3RDV A;  4RTY A;  1QVG S;  1MMA A;  3CC7 T;  4FCY A;  3F70 A;  4FM4 B;  3NHN A;  1WYX A;  1UJY A;  2RHI A;  1FMV A;  3CME Q;  1LOJ A;  5D6Y A;  1M90 U;  1YBY A;  4QQG A;  3MEA A;  3PMT A;  2AIR B;  1G5V A;  1VQP Q;  1WGS A;  2OX7 A;  3PVL A;  4BAC A;  2LT4 A;  3BY7 A;  3V7S A;  2CP7 A;  4KRT A;  2ZGW A;  2HQE A;  2DKG A;  4KGV B;  2FHD A;  2DZC A;  4MML A;  4X1V A;  2VWF A;  2KBT A;  5CIU A;  4PFP A;  1QP2 A;  1MUZ A;  4E2F B;  1M27 C;  3CD6 Q;  3S3M A;  3UWN A;  4EMK A;  2XI9 A;  3OYN A;  1I1J A;  2C06 A;  4PK4 A;  2BKD N;  3I55 A;  2JXB A;  2EBP A;  2QGF B;  5GMK m;  4D6W A;  2FZC B;  3CCQ Q;  1B34 A;  3OYC A;  4NL3 A;  2J06 A;  1BIA A;  4F7U A;  2RJE A;  3ASK A;  4V2S A;  1G3S A;  1HJD A;  5IXF A;  3DLM A;  1WHJ A;  3JCM J;  4MMK A;  5D7U A;  2JMC A;  2NUZ A;  4M7A D;  2K3X A;  2CDT A;  3QG1 A;  3CCE Q;  1JEG A;  2KDS A;  1SSF A;  4F04 B;  2OJ2 A;  2Z0W A;  1OOT A;  2K7A A;  3FEO A;  2E3H A;  3GNG A;  3RR6 A;  4JS4 A;  3JB9 F;  3MP8 A;  2CYZ B;  2RM4 A;  1M1K C;  2HAX A;  1YJW T;  1W1F A;  3P8D A;  2HBW A;  2IG0 A;  1VQO A;  4DOW A;  4OVA A;  2LQN A;  3TCJ A;  2KSS A;  4IUR A;  4JZ4 A;  5AYF A;  5CR2 A;  1UHC A;  2A28 A;  4EDU A;  1WLP B;  4A54 A;  1C6V X;  2XK0 A;  3I35 A;  2L3R A;  2CP5 A;  2HCK A;  2HQX A;  4BE0 A;  1EIF A;  2F2V A;  4E7J A;  1VUB A;  5GAN h;  2K5L A;  4OP0 A;  3PIP A;  1OU9 A;  4M78 G;  2ZPB B;  5DY9 A;  2DJQ A;  3CCL T;  2GQI A;  2F5K A;  1K4U S;  5HY6 A;  1OZ3 A;  3OS0 A;  4L5G A;  3GPL A;  1OV3 A;  3OYM A;  1QKX A;  5IT9 E;  2L3S A;  5CKF A;  1VQ6 A;  2RQT A;  1KHC A;  1BBZ A;  2NUT A;  1VQ9 Q;  1BCO A;  1PD1 A;  2F69 A;  1GBQ A;  1OEB A;  1Y71 A;  1CKB A;  4WCI A;  1E6H A;  5KE3 A;  3VKI A;  5GAN 8;  2QA4 T;  5KCH A;  1YI2 T;  3QWY A;  3CCM Q;  4M7A E;  3OS5 A;  1JJ2 P;  5IHK A;  4L59 A;  3I56 Q;  2JN0 A;  1H3H A;  1FWZ A;  4LUE A;  2DBK A;  4C0D C;  3HPW A;  3R6N A;  1NG2 A;  2NUP B;  3VS6 A;  4M77 C;  2DZ9 A;  2ZZD A;  4DOV A;  2H8H A;  2EIF A;  1X27 A;  4FYY B;  1SHG A;  1NYG A;  5HCK A;  2MCN A;  1QVG A;  2KI7 A;  2L0A A;  2I2L A;  1M1K R;  3H0H A;  4C8Q D;  1M8V A;  1OYX A;  4OB0 B;  1OPK A;  2NLU A;  1WQ7 A;  3EGX B;  4UC4 A;  3JRZ A;  4RTX A;  4M77 F;  2XIC A;  2COW A;  3OMC A;  2MI6 A;  3NTI A;  5L8R E;  3CCS A;  3CCR T;  2DO3 A;  5FRN A;  1PCX A;  2HNI A;  2OTL A;  1VQK A;  4HXJ A;  1NLP C;  1ZSG A;  4QVZ A;  1VQL A;  2DER A;  3JCM V;  1VQ5 Q;  4IUT A;  3CCU Q;  1YHQ Q;  2P0K A;  2DXT A;  1ABQ A;  4Y92 A;  4J9E A;  2XHC A;  1D1C A;  5IAY A;  5CK9 A;  1YIJ A;  2V1Q A;  3EHQ A;  8ATC B;  3CC2 Q;  1X01 A;  5A2Q E;  2OTJ T;  2LJ1 A;  5A0L A;  2R5M A;  2HKQ B;  2O01 E;  3QDF A;  2ROT A;  3A8O B;  3NMZ C;  5KE2 A;  1VQN T;  2KGT A;  2DIL A;  2RI5 A;  4JJC A;  2MWO A;  2PVO B;  1YJN T;  4M75 B;  2M0Y A;  5GAO q;  2XMF A;  1K76 A;  1I5O B;  3M59 A;  3M4G A;  3OYG A;  5FWB A;  1WX6 A;  1IO6 A;  3TSW A;  2FG0 A;  1U5S A;  1Q81 U;  4C0D B;  2DIQ A;  1G3Y A;  3OYH A;  3C94 A;  3L2Q A;  1PRM C;  4BI3 A;  1NE8 A;  3CPW S;  1IGQ A;  2M02 A;  3OB9 A;  5LJ5 h;  1VIE A;  4R55 A;  4LN2 A;  3G4S Q;  2FPD A;  4RCC A;  5CVI A;  1N8R U;  2L5Q A;  3BDL A;  4PJO G;  5LJ3 e;  3CME A;  1S72 Q;  1OX9 A;  1M90 R;  1D0Z A;  3GLX A;  2QEX T;  3E19 A;  4PL6 A;  4C8Q E;  3DB4 A;  2AT1 B;  4M78 D;  1VQP A;  3RKY A;  3CC7 Q;  1QW1 A;  2ZPH B;  3LGF A;  4CC4 B;  3EG0 A;  1WFW A;  2X4J A;  2LJ0 A;  4RTZ A;  1M9S A;  1SHF A;  2LT1 A;  4A4H A;  3JB9 J;  3OYE A;  2NYS A;  1PSE A;  1WNL A;  1RI9 A;  1PHT A;  4OB2 B;  2LJ3 A;  5LJ3 f;  3PTA A;  2VC8 A;  2NWM A;  1UGQ B;  2YXY A;  2XDP A;  3CCQ A;  2ENM A;  3V7C A;  4J7I A;  2KRM A; 
#chains in the Genus database with same CATH homology
 4XTZ A;  3JCM P;  5C0M A;  4XU0 A;  5A0G A;  4HCB A;  2MMP A;  2GQV A;  1FXX A;  1VQ5 T;  1NPP A;  3P8B B;  3UPU A;  2K5I A;  2VXE A;  4N4H A;  3CCU T;  5HK0 A;  1YHQ T;  2YRV A;  4C5H A;  3CCS T;  3MCA B;  2PVD B;  3BW1 A;  5GAM j;  5GAN 4;  1X6O A;  1IZ6 A;  3L2W A;  1YHQ A;  4M77 E;  3QXE B;  2E12 A;  4HCC A;  4QQD A;  1KQS S;  2DTH A;  2EKO A;  1VQL T;  4B9W A;  5M9O A;  4Z02 A;  3CC2 T;  3CCV A;  2A7Y A;  3KXT A;  1O9S A;  3CMA A;  1UGS B;  2DD4 A;  4J6X A;  1KC8 C;  3VU3 C;  2VV5 A;  2Y4X A;  3CCR A;  3QII A;  1QP3 A;  2WSC E;  5LJ3 g;  3CC4 T;  4J6Y A;  2JTM A;  4JDS A;  1W2B S;  4XTY A;  5GAN j;  1K73 C;  5GAM e;  2DAQ A;  3L1A A;  4ZTF A;  1K8A U;  4M77 G;  5I21 A;  2LQ8 A;  2X4Y A;  2EJG A;  1QVF A;  5FU7 C;  3QDR B;  1BI0 A;  2VUB A;  2JVV A;  4HKE A;  4MZM A;  2RA2 A;  4E7K A;  4KT0 E;  2E5Q A;  3OY9 A;  3SWN A;  4OGE A;  4M75 D;  4Q5W A;  3JCM c;  4C8Q A;  2B8A A;  4HA8 A;  1Y7X A;  3HHT B;  3G6E A;  5DLO A;  3CBM A;  5GMK j;  5GAM d;  5GMK l;  3EAE A;  4M78 F;  4C5I A;  1NPR A;  2RHU A;  3TRE A;  4A53 A;  3V7R A;  2OTJ A;  3LGL A;  3Q1J A;  1WPY A;  2VYT A;  4F7U F;  3QYG B;  2FB7 A;  5J39 A;  5C6S A;  3M9Q A;  1K9M U;  2XKO C;  4OMF B;  5LJ5 j;  1YIT T;  3KBG A;  2D9T A;  3JAM E;  3GNF B;  4M78 E;  3JCM h;  4PJO C;  2E10 A;  5GAO l;  2EJ9 A;  1XTD A;  4LDX A;  1VQN A;  3FIF A;  3OBY A;  1VQ4 A;  4F7U E;  1N27 A;  2EJF A;  2L89 A;  3PFS A;  3OYA A;  5CQY A;  4OGC A;  4A4E A;  5GMK e;  3QSU A;  1K8A C;  3G71 T;  2EQK A;  2BUD A;  4LDV A;  2DPP B;  4MDX A;  2M0O A;  5GAM f;  4LDW A;  2P0Q A;  3G4S T;  1YJN A;  2E41 A;  5CKB A;  2MWP A;  3RUX A;  2EQJ A;  2CZ1 B;  4ZTJ A;  3X26 B;  3ME9 A;  2PUO B;  4A4K A;  4ZGE B;  2H3J A;  3GF5 A;  3M54 A;  2HBP A;  2K2V A;  3H8Z A;  3VYG A;  2X4X A;  2YHT A;  5I2S A;  2ZPI B;  4IUV A;  1S72 T;  2GCX A;  2VGN A;  3HFO A;  3N5B B;  4XTV A;  5D6W A;  3OYF A;  4XTU A;  4F7U G;  4E7L A;  4X34 A;  4JUV A;  5GAN f;  4KBM B;  1K9M C;  2X4W A;  2XG8 D;  1QVG S;  3HP9 A;  3AHU A;  3FJP A;  2DK3 A;  3MEV A;  4XTX A;  2O4X B;  4ZGD B;  5GAN 7;  3CC7 T;  4M7A C;  4LDY A;  1BKB A;  3F70 A;  4FSX A;  1YJ9 A;  3RIR A;  3ZFJ A;  2ZPE B;  3CCJ A;  4FM4 B;  1Q82 U;  2K5F A;  4IKF A;  4M77 A;  3VJP A;  4KUD K;  2RHI A;  4M7D B;  2FYK A;  2LVM A;  2QDY B;  4XK8 E;  1I5L A;  3QYH B;  3S3N A;  1LOJ A;  4ZGJ B;  1TH7 A;  5D6Y A;  1M90 U;  1YBY A;  2HD0 A;  2PUK B;  1LNX A;  3EFR A;  3MEA A;  3MO8 A;  3PMT A;  4QQG A;  3WVD B;  3CCM A;  3QJ6 A;  3C12 A;  3X25 B;  2JZ2 A;  1G5V A;  4C92 C;  3JSC A;  4J7F A;  4M7A F;  1WGS A;  2QEX A;  4BAC A;  1VQ8 T;  2RK1 A;  4IUP A;  5LJ3 h;  4E47 A;  2LT4 A;  4QVD A;  4CI0 C;  3CD6 A;  2QQR A;  4IUU A;  3BY7 A;  3V7S A;  4A4F A;  1N8R C;  2JTF A;  1WJS A;  5FU7 B;  2P4T A;  2QTX A;  3I56 A;  3CXC S;  4JRQ A;  2BIV A;  2RO0 A;  1D3B B;  3OYY A;  2EFI A;  4YTL A;  3X28 B;  5GAO n;  3ZEH A;  2ZGW A;  2HQE A;  2DKG A;  3FB9 A;  2FHD A;  2DZC A;  4MML A;  4N0A A;  1WQW A;  5CIU A;  1Q86 U;  1QP2 A;  2K57 A;  1Q7Y C;  3S3M A;  2YLB A;  3UWN A;  3TU4 K;  4PJO D;  1Q82 C;  2XU8 A;  4EMK A;  4C92 F;  2DIG A;  4NS5 A;  2XI9 A;  3OYN A;  2C06 A;  3OW2 S;  2BKD N;  2IVW A;  2EQM A;  4ME7 A;  4RG2 A;  3I55 A;  1VQM T;  3A8G B;  1M90 C;  4II1 A;  4QW2 A;  4M75 E;  4XQ3 A;  3CPW A;  4NOY A;  5J26 A;  3OSS C;  1UGP B;  4GLK A;  4D6W A;  2ZCF B;  5GMK m;  2EAY A;  4PJO B;  4M78 A;  3L2R A;  1FX7 A;  2M1H A;  3EFS A;  2RJF A;  1B34 A;  4OF1 A;  4RMO A;  5CR2 A;  3OYC A;  2RI3 A;  4NL3 A;  1M1K U;  1BIA A;  4F7U A;  5CO7 A;  2RJE A;  1G3T A;  2KAF A;  3ASK A;  4V2S A;  1G3S A;  2OTL T;  1VQK T;  3O8V A;  1BI2 A;  5GAO m;  3CCE A;  1HXD A;  1VQ8 A;  3DLM A;  3JCM J;  4JS5 A;  4M7D C;  2OAU A;  3OSV A;  1DJ7 B;  4MMK A;  3M4Y A;  2DXC A;  4PLL A;  4M75 G;  2LCC A;  4B9X A;  3OA6 A;  3CCV T;  1VQ5 A;  4M7A D;  4XU1 A;  3C4S A;  2K3X A;  2RHZ A;  4FIB A;  3CCU A;  1UB4 A;  3A8M B;  4Y28 E;  1Y96 A;  4BE2 A;  3UT1 A;  1OI1 A;  4XU3 A;  4DQ2 A;  3QG1 A;  1R8O B;  3QZ9 B;  1YIJ T;  4EMG A;  2MF2 A;  3VUB A;  2KDS A;  2RI2 A;  1SSF A;  4M7A B;  3J81 E;  3FEO A;  3GNG A;  3CC2 A;  2FVU A;  4JS4 A;  3RMS A;  4PKC C;  3JB9 F;  4M7D F;  3MP8 A;  2CYZ B;  2RM4 A;  1M1K C;  1NJI U;  5HKC A;  2HAX A;  3C95 A;  1YJW T;  1N9R A;  4C92 D;  3CC4 A;  3G6E T;  3GP8 A;  3J7A F;  3P8D A;  3SDZ A;  5GAN e;  4R56 A;  3NFC A;  4BI8 B;  5CKH A;  2IG0 A;  4C0Z A;  1O75 A;  2KK4 A;  1VQO A;  4C0G A;  1M1G A;  5KH6 A;  4DOW A;  4OVA A;  3CBO A;  3L2Z A;  2DVE A;  4N4G A;  2KSS A;  3HKS A;  4IUR A;  5AYF A;  3TCJ A;  3WXM B;  4C92 B;  2CZ0 B;  4A4G A;  3QPH A;  5FLX E;  5GAM h;  4EDU A;  2XID A;  4XU2 A;  3QJY A;  4BD3 A;  4A54 A;  2LRQ A;  3QBY A;  5GAN d;  2XD0 A;  3WVE B;  1RI0 A;  2DXB A;  3RMQ A;  2RK2 A;  2XK0 A;  2KMT A;  2L3R A;  3V8K A;  4X9D A;  3H6Z A;  2JOY A;  5GAO r;  4MDW A;  2HQX A;  1WJQ A;  4BB7 A;  2KY9 A;  1ZQ1 A;  4BE0 A;  1EIF A;  3HL8 A;  5D6X A;  4E7J A;  3HRU A;  1VUB A;  3UDC A;  4JRK A;  3T9N A;  5LJ5 e;  5GAN h;  1YIT A;  1NJI C;  1JJ2 S;  2K5L A;  2K4Y A;  2DJZ A;  2DXU A;  3MP6 A;  4OP0 A;  3PIP A;  2YLC A;  4M78 G;  4C5E A;  2ZPB B;  5DY9 A;  3CCL T;  3KUF A;  4PJO F;  1KQS A;  3SWN C;  2F5K A;  4KUI A;  4O6J A;  5HY6 A;  1JRI A;  4C8Q C;  3FC3 A;  4M77 B;  1OZ3 A;  3G71 A;  4M75 A;  3OS0 A;  3PT9 A;  1VQ9 A;  3G4S A;  5LJ5 d;  3GOX A;  3JCM W;  3JB9 D;  2VXF A;  4M7D D;  4OB3 B;  4JLG A;  4L5G A;  5KCO A;  3CPF A;  5GMK h;  3GPL A;  4PJO E;  4P5N A;  3OYM A;  3CME T;  2PU9 B;  4PNO A;  1W2B A;  4RG8 A;  5IT9 E;  5CQX A;  5CKF A;  4C5G A;  1YJ9 T;  1VQ6 A;  2R58 A;  1S72 A;  3MET A;  1VQP T;  3OMG A;  1KHC A;  4MZT A;  3HRS A;  3RKW A;  3QZ5 B;  1XNI A;  5IN1 A;  3M56 A;  5GAN 2;  4HT8 A;  3SB2 A;  2F69 A;  5HK3 A;  5GAM g;  1OZ2 A;  4C8Q F;  2V8I A;  1Y71 A;  3M55 A;  4HT9 A;  3QKJ A;  5KE3 A;  1U1S A;  3VKI A;  3GIB A;  5GAN 8;  5LJ5 f;  4LDU A;  2QA4 T;  5KCH A;  1BI1 A;  2XDB A;  3JCM X;  1YI2 T;  1VQ7 T;  1LJO A;  4BY6 C;  3CBP A;  3QUI A;  2G3R A;  2EYQ A;  2XDD A;  3OS2 A;  3CD6 T;  2EWN A;  2DTI A;  2RJC A;  3RKX A;  4EMK B;  4FT2 A;  3V8L A;  2VGM A;  3M5A A;  1I4K 1;  1P92 A;  3FLG A;  1M5Q 1;  4M7A E;  3OS5 A;  3PNW C;  5EG2 A;  4ELY C;  1JB0 E;  4DA4 A;  5GAN g;  2WSF E;  3MEW A;  3JB9 H;  3BFM A;  1UEB A;  4GY5 A;  4L59 A;  4JRP A;  1QVF S;  2KVQ G;  1BIB A;  1B34 B;  2JN0 A;  4JLI A;  4RKU E;  3CCQ T;  3MP1 A;  1FWZ A;  1W4S A;  4CRI A;  1U8R A;  3A8L B;  2R5A A;  4C0D C;  3JB9 I;  3HPW A;  2GF7 A;  4M77 C;  2DZ9 A;  2ZZD A;  4DOV A;  1YCY A;  4JJN K;  1M4Z A;  4M7A G;  2L8D A;  4C92 E;  2E6Z A;  3HFN A;  4IUQ A;  4ELZ C;  4LD6 A;  2Y4Y A;  2LC4 A;  1Y07 A;  2EIF A;  1I81 A;  2CGH A;  2CKK A;  5LJ5 g;  3OYK A;  2K3Y A;  2R57 A;  1QVG A;  3PMI A;  2I2L A;  1VQM A;  1XOV A;  4C8Q D;  3CCE T;  1D3B A;  1M8V A;  1OYX A;  4OB0 B;  2RHY A;  3OQ5 A;  3DLL A;  2NLU A;  1Q86 C;  1WQ7 A;  2LTO A;  3DB3 A;  2RD1 A;  3JRZ A;  4UC4 A;  3CMA T;  3S3O A;  4OB1 B;  4M77 F;  2XIC A;  3E9G A;  4C92 G;  4FU6 A;  3OMC A;  3SWN B;  2MI6 A;  3NTI A;  2KQW A;  5CKE A;  5L8R E;  3J80 E;  3OYI A;  3CCR T;  3CCS A;  2DO3 A;  4N0A C;  5I2M A;  4C8Q B;  2DEQ A;  2QI2 A;  3JCM Q;  5FRN A;  1IRE B;  2HNI A;  2OTL A;  1VQK A;  4BI4 A;  3E1S A;  4RCB A;  3BDU A;  4QVZ A;  1VQL A;  4ATO A;  2E64 A;  4WF2 A;  3JCM V;  1KQ1 A;  4EMK C;  4PJO A;  2QQS A;  4IUT A;  4BDY A;  1AHJ B;  5CAI A;  2P0K A;  2DXT A;  3A5Z B;  3PIO A;  4J83 A;  2RH2 A;  2M16 A;  2JUF A;  5DM7 R;  3M57 A;  3FDR A;  4BDZ A;  4VUB A;  3CXC A;  2XHC A;  5IAY A;  2CS7 A;  4M78 C;  3LYI A;  3QO3 A;  5CK9 A;  1YIJ A;  4M7D E;  3SD4 A;  3SFM A;  4J6W A;  1X75 C;  1H64 1;  2WAC A;  3P8H A;  1ZHI A;  3M58 A;  1X01 A;  3X20 B;  5A2Q E;  3OYD A;  2OTJ T;  3INZ A;  3JCM e;  4E7I A;  1VQO T;  2M9U A;  2A3L A;  2Y90 A;  2DD5 A;  5A0L A;  2CZ7 B;  2R5M A;  5A0D A;  4KUL A;  3L2U A;  2O01 E;  1I8F A;  2LCL A;  4BY6 B;  2RJD A;  4EMH A;  3OYB A;  3A8O B;  2DTO A;  5KE2 A;  2EQU A;  3OW2 A;  1YJW A;  1VQN T;  3JCM b;  1VQ4 T;  3LLR A;  4Y91 A;  3HSB A;  3MEU A;  1XQH A;  2RI5 A;  1MGQ A;  3JCM d;  3JB9 G;  4M7D G;  5FU6 B;  2MWO A;  5CCA A;  4M7A A;  2PVO B;  3NTK A;  3LH0 A;  4ZN1 A;  1YJN T;  4M75 B;  5LL6 S;  5GAO q;  1GXI E;  2CZ6 B;  2RB6 A;  4M77 D;  2D0Q B;  3S6W A;  3M59 A;  3M4G A;  3OYG A;  1WJR A;  1N6A A;  2QXF A;  3A8H B;  2PVG B;  3OS1 A;  5GAN 6;  4TVR A;  4FL6 A;  4MZP A;  1G3W A;  2QQB A;  4PLI A;  4C0D B;  1Q81 U;  4E7H A;  2DIQ A;  4J8O A;  4LD9 K;  4N4I A;  1G3Y A;  1VIF A;  3VYH B;  3LW5 E;  3OYH A;  1KD1 U;  3C94 A;  4J5Y A;  1BYM A;  3DKM A;  2FL7 A;  4C92 A;  5LJ3 j;  1VQ9 T;  1NZ9 A;  3JCM f;  3L2Q A;  3LX7 A;  4ZN3 A;  4BI3 A;  1NE8 A;  2PQW A;  3TEE A;  4BE1 A;  3CPW S;  1ZBX A;  3CCL A;  3OB9 A;  5LJ5 h;  2LX9 A;  3CCJ T;  1VIE A;  3VV0 A;  2LDM A;  4R55 A;  1VQ6 T;  4X9C A;  3FRN A;  3RES A;  3QHS A;  3R6O A;  2P0P A;  2GFU A;  2LNV A;  2E1H A;  4RCC A;  5CVI A;  1N8R U;  1M1F A;  2D6F A;  3L42 A;  2L5Q A;  2QQA A;  3BDL A;  3CEY A;  3CC7 A;  3CCM T;  1QVP A;  4PJO G;  5LJ3 e;  4QQ6 A;  3CME A;  1H3Z A;  1PSF A;  4XTW A;  5DLQ E;  3GLX A;  2V8J A;  1Q81 C;  2QEX T;  3E19 A;  4JRI A;  4PL6 A;  4C0F A;  4C8Q E;  1Q7Y U;  3DB4 A;  4FT4 A;  3V8J A;  5CKD A;  1VQP A;  4M78 D;  2E6N A;  2MAM A;  1UGR B;  1JBM A;  2AHJ B;  2ZPG B;  3I56 T;  5GAN 5;  1KD1 C;  3RKY A;  1MHN A;  3ZBD A;  4QVC A;  5LJ3 d;  1KG1 A;  1QW1 A;  2JNG A;  2O4X A;  4HCZ A;  2ZPH B;  4XAX B;  5FU6 C;  3OYJ A;  1V29 B;  2QQ9 A;  3E9F A;  3L2V A;  2V8K A;  3VUZ A;  3LGF A;  4M75 C;  4M78 B;  3JCM g;  2E65 A;  2QA4 A;  1U1T A;  2GFA A;  2X4J A;  4O5V A;  4BUG A;  2LQK A;  1M9S A;  4F7U B;  1YI2 A;  2LT1 A;  1VQ7 A;  3LWH A;  5FRM A;  4M7D A;  4A4H A;  5GAN 3;  3JB9 J;  4C8Q G;  4EPC A;  3OYE A;  3I55 T;  1PSE A;  3M53 A;  1JJ2 A;  1WNL A;  2WSE E;  5J3B A;  3OYL A;  3HRT A;  3OBW A;  1KQ2 A;  2E70 A;  2X35 A;  1BI3 A;  1HK9 A;  3G7Z A;  3NTH A;  4OB2 B;  5FRO A;  2RHX A;  3ER0 A;  5LJ3 f;  5GMK i;  3RER A;  2ZPF B;  2F5T X;  1KC8 U;  3PTA A;  4M75 F;  2VC8 A;  3MHX A;  1UGQ B;  1Y96 B;  2XDP A;  1N9S A;  3CCQ A;  3LWI A;  3V7C A;  1RL2 A;  4J7I A;  4L6V 5;  3X24 B;  5GAO p;  1K73 U;  3URG A;  1KHI A;  4NL2 A;  3PGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...