2KQWA

Sars coronavirus-unique domain (sud): three-domain molecular architecture in solution and rna binding. ii: structure of the sud-c domain of sud-mc
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
TSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title SARS coronavirus unique domain: three-domain molecular architecture in solution and RNA binding.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords Non-structural protein 3
total genus 13
structure length 67
sequence length 67
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12124 Nsp3_PL2pro Coronavirus polyprotein cleavage domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.590 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kqwA00
2KQWA 2KAFA
chains in the Genus database with same CATH superfamily
4LNPA 3QBYA 1UE9A 3H0FA 4F04B 4PJOC 2J6KA 2DE0X 4X1VA 1MUZA 4Z8AA 1VOMA 2DLPA 5CAIA 1ZA2B 3CCLQ 1FMKA 4A4GA 3QO3A 6AT1B 4J7FA 4PFOA 2BE7D 4BACA 4MDXA 2LCLA 2HBPA 3VV0A 3CD6A 3G4ST 2MI6A 1CSKA 2QGFB 1KHIA 2IPOB 2C0OA 1YI2T 2O31A 2AKLA 4XQ3A 3AHUA 3HFOA 2OTJT 1N9RA 2E64A 2O9SA 2FRWA 4Z88A 1YBYA 3HP9A 2DERA 3VRZA 3M4YA 3M56A 5FWCA 4ZN1A 3OS1A 5CR2A 3OW2A 1M1FA 2CZ7B 3MP8A 1NBEB 3JCMh 3FJ5A 4IUVA 1VQKA 2KGTA 4E47A 5DY9A 1EX4A 1NEGA 1M2OA 2RO0A 4N0AA 5HCKA 1X43A 4LE9A 3QG1A 2JT4A 2K6DA 3GIBA 1ZSGA 2YUOA 3N5BB 2LP5A 3ZL7C 5IXFA 4C8QD 3QUIA 3GF5A 2Z0WA 4FYVB 3G71Q 1YIJA 1A0NB 4MZTA 4XTVA 3X26B 2D0QB 2HSPA 4NL2A 1DJ7B 1X6OA 4VUBA 4LXCA 4OB1B 3GLXA 1GL5A 2DYBA 2HNIA 2RD1A 1M5Q1 1ZHIA 2CREA 1K73C 1VYUA 4PFPA 2DYIA 4JDSA 1AZEA 2QDLA 4A53A 3QZ5B 4PJOG 1X27A 4KUDK 2R5AA 4GBQA 4X9CA 4EMKC 4KRTA 2JTMA 4JJBA 3G4SQ 3DB4A 1Q7YU 1M4ZA 3EFOA 1T0HA 1N9SA 1K1ZA 1OPLA 3HTRA 1NYFA 5D6WA 2L3QA 4M78E 4J9DA 5LJ3f 3I55T 1V76A 1YI2A 1YJ9Q 5GAOn 3QYHB 3CC7T 2JUFA 2CSQA 4JJCA 1KC8R 2D8HA 1UJ0A 2F5TX 1M8MA 2P84A 1RACB 2M0YA 1AD5A 2GNCA 2RJFA 5A0GA 4RTUA 2EGAA 2XDDA 3FB9A 1YJ9T 1D1CA 3CC4A 1VQPT 2A0FB 2ZPEB 1YNZA 2L0AA 5I2SA 2XI9A 1NPRA 3EGDB 2ESWA 4C0GA 2LMJA 2KY9A 1YITT 4C0ZA 2MIOA 3HSBA 1U1TA 1VQ4Q 3OSSC 3VUBA 1X01A 4N4GA 4AFQC 1QLYA 3PMTA 1W2BS 2YDLA 5GAN8 4PL6A 2HAXA 5LJ5f 4DBQA 3QIIA 3C94A 3TCJA 1WIEA 2NUPB 4IUPA 1PCXA 1RADB 1RAEB 2XICA 3OYCA 3OA6A 1YJNT 1P92A 1UECA 2E12A 4M75D 3J80E 2O88A 3CPWP 3CXCA 3L2ZA 4ORZA 4PK4A 3PFSA 3EG9A 3CCJT 2VASA 1FX7A 1GXIE 2VUBA 3EH1A 5FU7B 2LCCA 3JSCA 1KC8U 4MMLA 2R58A 4M75C 3QWYA 1ZSZA 2QQSA 4RKUE 1OULA 3V7CA 1S72T 2DF6A 2QTVA 2E6NA 1H8KA 5DLQE 5I11A 1WFWA 3Q1JA 3CCVA 2OAUA 3FIFA 2YWWA 4HA8A 2OTLQ 4FYYB 1H3ZA 1M2VA 3OS5A 4M78C 3OMGA 1VQOA 5A0DA 3J7AF 5GANe 1MNEA 3QDRB 3CCMQ 1W1FA 4BE1A 1ACMB 2EJ9A 3V7SA 1WLPB 2CUDA 3L42A 2RHXA 1KSWA 2M51A 3MKDA 2F2VA 4CC3A 4JUVA 4BDZA 1KIKA 2OI3A 4R56A 1BBZA 1VQ8Q 2DJZA 4XU1A 2LJ1A 1YWPA 5EC7A 4LD9K 4OP0A 2D0NA 2WACA 1IRXA 1SHFA 1K9MR 2E10A 1VQNT 5I21A 1WPYA 1ZX6A 2JZ2A 2L8DA 2KDSA 3RKXA 1V1CA 2DL4A 5I2MA 4BY6B 4DBFA 1N8RC 3CBOA 1WJSA 4DEXA 1M90U 2D9TA 4M78B 2C0TA 4EPCA 4C92G 3OW2P 2M16A 3CPWA 3VS6A 3VRYA 3QZ9B 2RH2A 4A4FA 5KYYA 3SWNB 5GJWB 4C92F 2K5LA 4P5NA 1RLQC 1HJDA 3QWXX 3OYDA 5LJ3g 2HDAA 2RQTA 4RTTA 3ER0A 2RI3A 1YHQQ 2AKKA 1WA7A 5M9OA 2L5QA 2VGMA 2KMTA 2FL7A 3ME9A 3VS7A 4N4HA 3DLLA 1AWXA 3P8HA 3E9GA 3E19A 3TSWA 2QYZA 1Q82C 4C0FA 4C92A 1W70A 1B3QA 1NLOC 2QASA 1D09B 2X35A 2IG0A 3CCET 4L6V5 2K7AA 4FT4A 1VQOT 1WXBA 4M78G 3JCMf 2CP6A 5KYNA 2QK0A 2QQBA 2NYSA 1VQ9Q 4KT0E 1U5SA 4C0DB 2X9HA 3EG3A 3QJ6A 2KI7A 4II1A 2DK3A 3G71T 1KD1C 4E7HA 1XTDA 4FT2A 1Y96A 4M7DD 3UA7A 1SEMA 5CVIA 3JCMX 1HSQA 2JXBA 2EYWA 5CO7A 3CCSQ 1RI9A 1MMGA 2QI2A 4M78A 1VQ6T 1FYNA 3CC4Q 4C5GA 4E7SA 2FEIA 2KRSA 2RPNA 4BI4A 3EGXA 4C5EA 1WYXA 1QKXA 2JS2A 1TU0B 3NGPA 1GCQA 4PKCC 3PTAA 1EFNA 1RAAB 2L3SA 4DEYA 2X4YA 5IXBA 1RABB 2OTJQ 1TXQA 4J9GA 2M02A 5GAN7 1VQPA 5J3BA 2EIFA 1YI2Q 1AWOA 2RQWA 3M0TA 2C0IA 2DJQA 1KQSA 1ZSZB 4KH1B 1XOVA 2HD0A 1O75A 3VS4A 4XU3A 2V8KA 4J83A 2KBTA 2JTFA 1NM7A 1OV3A 1UFFA 2YSQA 2PVOB 1VQ6Q 2LVMA 3O8VA 2MK5A 2XDPA 4OVAA 3H41A 3M53A 2RK2A 1BKBA 1LJOA 1OU8A 3R6NA 3CXCP 1I5LA 5LJ5e 3RESA 1SF9A 2KYMA 2H3JA 1M90R 2ZZDA 3CD6T 1M3CA 3NTKA 2E3IA 3SWNA 3G71A 4F7UE 1OPKA 4CC4B 3MP1A 2OTJA 1VQLQ 2ZPIB 4A4KA 4FSXA 4C0DC 1QWFA 1U8RA 3RKYA 1GBRA 5KCHA 2X4XA 5HK3A 5KYWA 5FRMA 1MNDA 4M75F 2E41A 2ABLA 2GF7A 3S6WA 4XU2A 2CGHA 1B34A 3MEAA 2DX1A 3SDZA 4JS4A 2EFIA 3LWHA 4PJNA 2O2OA 1UUEA 1VQ9T 1QCNA 3JCMc 1JJ2A 2E3HA 3FJPA 3SHWA 2X4WA 3OS0A 2KE9A 4C8QB 1IREB 2DD4A 1IGQA 1GRIA 1RLPC 3I5RA 2EW3A 1AOJA 1KFZA 1YITQ 4M77A 2RHUA 5CKBA 1LPLA 5GAMj 1OZ3A 2G6FX 2ZPHB 4J6YA 2JM9A 2LRQA 1VQPQ 2DBMA 1RUWA 2GTJA 1RAGB 3CCQQ 1TOVA 1VUBA 2EQIA 3BDLA 4EMGA 1QVFP 2CP0A 4PJJA 4NL3A 2COWA 4C92C 1K9AA 4F14A 2EKHA 3OYYA 2JM8A 4JLIA 1ARKA 1BCOA 1JJ2S 1OYXA 4M7DF 2M1HA 2RJEA 2CH4W 2KT1A 2RN8A 3GNFB 4JZ4A 1BIBA 3OYNA 2LQKA 3MEUA 2XMFA 4OF1A 2H3EB 3OYEA 2LQWA 3HKSA 1NE8A 3S3NA 2DTIA 3RDVA 3ZEHA 2ATCB 4QVCA 3VS5A 1VYVA 4EDUA 1KQ1A 1NEBA 2OTLT 5CIUA 1WHGA 1H92A 4PJOA 2K4YA 2DIGA 4C8QA 4B9WA 2PQWA 1VQ9A 2EYXA 2KYBA 4D6WA 2EYYA 4PJOE 3JCMQ 1IZ6A 2DXUA 1G5VA 5IAYA 3RUXA 5GAMd 4AG2C 1SPKA 5GANj 5EG2A 1AWJA 2FPEA 3INZA 3THKA 3CCST 1IHWA 2CP7A 2KNBB 4RMOA 2HQXA 2DL7A 1KC8C 1ZLMA 3IQLA 4EMKA 1VQOQ 5GMKi 2CH4A 1VQMT 3RMQA 2JS0A 4IIMA 2EQKA 4ME7A 3EHQA 1PSFA 1Q81R 2QQRA 1JQQA 4F7UF 4AFZC 3RNJA 3EGUA 3HRTA 2ZGWA 1D0ZA 2EQUA 3OMCA 4JPBW 1K76A 1I5OB 2LNHB 2KR3A 2RJDA 3V7RA 4BE0A 3C12A 1X2KA 1VQ4T 2KRNA 2V1RA 3PGGA 1M3BA 4XK8E 1YJWQ 4M75E 1HK9A 2ZCFB 2Y4YA 2B86A 1Q7YR 2QA4Q 3CCVT 2XG8D 5KYWB 2EQJA 4QW2A 1N8RU 1LVKA 3NTHA 2LQ8A 2YLCA 3JB9I 3JRZA 2HMAA 9ATCB 4WTOB 1KK7A 2K3BA 4GLMA 2JVVA 2K3XA 2COYA 3NHNA 3NPFA 2BE9B 4FYWB 1Y71A 5LJ5d 5D6XA 1TUCA 2EYQA 4RUGA 1KD1R 3MO8A 3OYAA 5LJ3d 3TSZA 3CMAA 1TTHB 3LH0A 1MHNA 3JCMJ 2E5KA 2I2LA 4J9FA 4ELZC 2P0KA 3U23A 2DPPB 1X75C 2DAQA 2OX7A 2DXTA 1D3BB 1VQMA 4PJOB 3CC7A 1Z9ZA 3M59A 4XU0A 1KQSP 1QVPA 4ESRA 3UATA 2F69A 4DOWA 2QDYB 1K0SA 4J9EA 2GBQA 2ZPBB 1Q86U 4LUEA 2XD0A 4M7DE 1TH7A 1YCSB 2FVUA 4IURA 4BE2A 3DKMA 3CPFA 3CCQA 5LJ3e 1UGVA 3CC4T 1YJ9A 3A98A 4J6WA 1C1AA 2ED0A 3V8KA 5J39A 2QA4A 1KQSS 1YHQA 1YITA 1UJYA 2P0PA 4RG2A 4Y91A 1TUGB 3A8HB 4EIKA 1UGPB 2ED1A 3VKIA 3CMEA 2O9VA 3S3OA 2PVGB 4O6JA 1VQMQ 2LZ6B 4NS5A 4X9DA 2L3RA 2P4RA 5LJ3h 2KXCA 1WQ7A 3PIOA 2V1QA 3M0RA 4J9IA 3M4GA 4N4IA 2GQIA 2A3LA 1PD1A 3H8ZA 4JRKA 4E7KA 1YIJQ 4ZGDB 3FEOA 1R0CB 1JJ2P 2E4HA 4QQDA 1NJIR 1QVFA 3L2QA 1RAIB 1QMCA 1FWZA 1JXMA 1G2BA 2D1XA 4M7AA 2EPDA 1G3TA 1HYOA 3JCMg 4ANJA 5GAN2 4EMHA 1TSFA 2RNAA 2FG0A 1UHFA 2D8JA 1YJWA 3LX7A 2KRMA 4KUIA 4ZGJB 2GCXA 1ZUKA 2WSCE 2YT6A 3EH2A 2CUBA 2K79A 5GJVB 1KG1A 4C5IA 4E2FB 3HRUA 4M7AG 5HKCA 5GAMe 2DKGA 3CCVQ 2QA4T 4XTUA 4OGCA 1VIEA 2QQ9A 3X20B 3CMET 4BB7A 3M58A 2MF2A 2W0ZA 2O01E 2A7YA 4LD6A 3A8MB 5IN1A 5KE3A 5L8RE 4M7DC 1JBMA 5KH6A 2KT8A 1G3YA 1E6GA 4OMPA 4JJDA 3G6EA 1D1AA 5GAMh 2NUPA 5FROA 1MV3A 1IB8A 4E7IA 3F70A 5ECAA 3OYFA 2F1LA 2VYTA 2CZ0B 1ZUUA 3ZBDA 5GMKj 4M7AF 3C4SA 1QQJA 3FRNA 1UGRB 3CCUA 1ZA1B 4OGEA 3M0SA 1BCMA 1KJWA 2HEQA 1KHCA 3NMZC 2QXFA 3E1SA 1SG5A 3JCMb 2KXDA 1K4US 2EGEA 4J6XA 2NWMA 5C0MA 5CK9A 2DVEA 1VQ4A 2LJ3A 3GBQA 3UWNA 3CCUQ 3RBBB 3I9QA 3URGA 3X24B 2YRCA 2HBWA 1UGSB 2NUZA 1YN8A 4QVDA 5D7UA 2HSEB 2P4TA 1VQLT 3ZFJA 3SD4A 1N8RR 2VVKA 1M9SA 1Y07A 2DVJA 4LDUA 5AT1B 1Q7YC 1AZGB 4J5YA 1T0JA 3CCEA 2QGGA 4M77E 1M1KC 1QP2A 3BFMA 2QEXA 3S3MA 1Q81U 4C8QE 5IH2A 2JW4A 4RTZA 3EHRA 2RB6A 4DOVA 2DL5A 2BZXA 1R0BG 5GAOq 4QQ6A 1G3SA 2DL3A 3M0UA 3A1PA 2BZYA 5CQXA 3WVEB 3X28B 3BW1A 4D8DA 2K3YA 2LDMA 1Y57A 3I5SA 4PLIA 2YHTA 4OMOA 3QJYA 3TEEA 2LX9A 1QVFS 4DBRA 1VQ6A 4OMLA 1OQKA 1BK2A 1BI0A 3V8LA 4HVVA 4RCBA 2VXEA 2E70A 1GCQC 4F7UB 3JCMP 5FW9A 1VQ5Q 4XTXA 4FCYA 4N0AC 1D1BA 4RG8A 4M77B 3CCUT 2AZSA 4M77G 4XTWA 3CCQT 2AK5A 2J7IA 2VWFA 2K5FA 5AYFA 4C5HA 2Y4XA 1X6GA 2LQNA 2RK1A 3M9QA 3PVLA 1WDXA 3LW5E 2V8JA 5GMKe 2AIRB 3OYIA 4JRPA 1K9MC 3H6ZA 2FZGB 5DM7R 2OJ2A 5FLXE 5I22A 2HQEA 3MEWA 4C8QC 4M77D 3JB9D 2E5QA 1WHKA 4JZ3A 1I1JA 2J05A 3RMSA 3CCSA 4MMKA 4CC2A 2HKQB 2QEXT 2DIQA 3HRSA 4L59A 2GGRA 5GMKh 3OYHA 3M0PA 3CBMA 5KCOA 2QG9B 5CCAA 2AZVA 3CD6Q 3CPWS 2QAZA 3CMEQ 3G1JA 2H8HA 1ZBXA 2CT4A 2DTOA 3GNGA 4C8QG 3BE3A 1XQHA 1PG5B 2PZ1A 4BY6C 2XU8A 1MV0B 4GLKA 2KQWA 1SHGA 3UF4A 1SRMA 3LH5A 4OMQA 4PLLA 4M7AE 2FPDA 2CSIA 2COZA 1WNLA 1GBQA 2A36A 1N5ZA 1JEGA 1M90C 1C6VX 4AG1C 2DILA 2RA2A 2WSEE 3ULRB 1FXXA 3TU4K 4C92B 2MMPA 3E9FA 4DQ2A 3VYHB 5CQYA 1XJWB 3OSVA 2LT4A 3H0HA 1B07A 3PVQA 1VQ7T 3OBYA 1K73U 3CC7Q 4ZNXA 4WF2A 3CEYA 3DB3A 4ATOA 3CC2T 1R77A 1W4SA 3UA6A 8ATCB 3META 2XK0A 1SRLA 4FW1A 2YUQA 5GAMf 1GFCA 4HXJA 3M0QA 3LGLA 4CC7A 5GAN3 2V26A 4PJOD 2D6FA 2LX7A 1BI3A 4B9XA 4Z89A 1WXUA 2QQAA 1T3SA 3C95A 4XTYA 1ABOA 1I0CA 2EYZA 4M75B 2DXCA 1YCYA 2CZ6B 3CQTA 4RTVA 3L2WA 1VQ8A 1QVGP 3VUZA 2X51A 4HVUA 1X2QA 3QXEB 2L2PA 2FYKA 4OB3B 1G83A 2DNUA 1CKBA 2FB7A 4HVWA 4ZGEB 1K8AU 5KYXA 5LJ5h 2X3WD 3CCJQ 3H9NA 2OTLA 4Y28E 3EG2A 1K73R 4R0KA 3VS2A 1UTIA 1K9MU 1Y7XA 5A2QE 2YUNA 1UGQB 5FWBA 2WSFE 2LCSA 1NZ9A 2ROLA 4XTZA 1SKUB 2JTEA 4FIBA 1QWEA 3MJXA 1RL2A 2EVRA 4KH0B 2M0OA 4X34A 1M30A 3GPLA 4CRIA 3EFOB 1OEBA 1D3BA 2HZYA 3UPUA 4HT9A 1JU5C 3CC2A 1J3TA 5FU6C 4FM4B 1QW1A 1C0MA 4O5VA 1NJIU 3I56Q 1XNIA 2SEMA 2JNGA 5CKHA 2VB6A 2RQRA 1V29B 1ABQA 2JMCA 2CT3A 4DBHA 1UEBA 4M75A 3JCMW 1JRIA 3MCAB 2PUKB 4A63B 5J26A 4RTYA 4HCZA 3CXCS 2QTXA 4KGZB 2BKDN 1ZUYA 2XKOC 3LYIA 3CCMA 4BD3A 3EG9B 2LNVA 1VQ5T 4KGXB 5IHKA 1VQKT 1W2BP 1VIFA 4A54A 5GAOp 4LDXA 2FHDA 2YLBA 2PTKA 4BUGA 3OS2A 2A28A 3R6OA 4C92E 5GANf 1PRMC 1UHCA 2DZCA 1YJWT 3JB9F 1H3HA 4ELYC 3RERA 2JN0A 5L23A 5KYUB 5C6SA 4F16A 4J8OA 4OMMA 1NG2A 3I35A 3DLMA 5GAOr 1OX9A 2NUTB 3LGFA 1S72Q 1U1SA 3JAME 4E7JA 2CS7A 3EG0A 2DD5A 1M2VB 2DM1A 2OAWA 2VV5A 3HHTB 3OYGA 3GOXA 1M1KR 2IVWA 3MEVA 4JRQA 1F1BB 1I8FA 1I4K1 1PWTA 1TS9A 1OZ2A 3TVTA 3CMAT 2KVQG 1VA7A 2JMAA 1B34B 3A8LB 4UC4A 3FLGA 3A8GB 1BI1A 1PHTA 2L3PA 4OMFB 2MAMA 3T9NA 5LJ3j 3I55A 5GMKm 3J81E 2CZ1B 1NPPA 2YRDA 5GAMg 2CDTA 4A4EA 1CKAA 3KXTA 1BB9A 3EFRA 2EAYA 1PRLC 3OB9A 3SWNC 4IUQA 3JCMV 1BYMA 1W6XA 2HCKA 3OYKA 3M55A 2R5MA 2F2XA 4HT8A 1QVGS 2HL5C 1MGQA 1OOTA 3PT9A 2DTHA 2BZ8A 3CBPA 4FL6A 1QCFA 1AEYA 4OMNA 2DO3A 2EWNA 1WI7A 1IGUA 2FZKB 4IKFA 3A5ZB 1IO6A 5D6YA 1YHQT 4PJLA 2CP2A 2EQMA 2FPFA 1U3OA 4BI3A 5KYXB 1VQLA 1QCOA 2FRYA 1WXTA 4RCCA 1BI2A 3EGXB 1UB4A 2X4JA 1VQKQ 3P8DA 2DRMA 2K2VA 5IHIA 3KUFA 5IT9E 1EIFA 2E65A 2YUPA 1YJNA 1Q82R 2RQUA 2B8AA 3OYJA 1QVGA 4NOYA 2ZPGB 5IHNA 2K57A 3MPUB 3UDCA 2MPXC 1K8AC 8AT1B 1ZSZC 3REAB 4HCKA 3JV3A 2RQVA 4IUTA 1K8AR 1EZZB 1M1KU 3OYMA 2EKOA 2A37A 3JB9H 4KULA 1Q86R 2J6OA 4LDVA 3CCLA 1NYGA 3E2UA 1M8VA 1Y0MA 1Q86C 3QPHA 4BI8B 1M27C 1VQ8T 1H641 3VS1A 1I07A 2K9GA 1PSEA 3I55Q 2RHIA 4PNOA 4R55A 2P0QA 2F2WA 3RKWA 1WHHA 4OB0B 1WGSA 3OYBA 4J9BA 3QDFA 4RTXA 4AMCA 1GFDA 1B7TA 1E7OA 4F17A 4HKEA 5FU7C 1S1NA 2K5IA 2AHJB 2DEUA 2DA9A 1WJQA 1YIJT 1JO8A 1WHJA 3VYGA 3CCRA 1N6AA 3G7ZA 1MMDA 2ZPFB 3G6EQ 3MP6A 1W2BA 4MZPA 1JB0E 3I56A 2RI2A 2YRVA 5LL6S 2DRKA 5GMKl 4TVRA 3QSUA 2VGNA 3D7SB 1Q81C 1PNJA 3H0IA 2O4XB 2DFUA 1G3WA 2DZ9A 2AT1B 3HFNA 4RTWA 1R8OB 2HKNA 2CP5A 2DXBA 2VKNA 4F7UA 4Q5WA 4M7DB 3HL8A 2EJFA 3AT1B 4M4ZA 4FSSA 2JOYA 3LLRA 3G6ET 1FMWA 1FMVA 1X69A 1AWWA 2BIVA 1QP3A 2KROA 4IIOA 4K11A 4YTLA 1UG1A 2Y90A 2RMOA 1YJNQ 1MMAA 4M7AD 3L2VA 3CCLT 2MWPA 2M9UA 1T3LA 2F5KA 4F7UG 1OX8A 3GP8A 2XIDA 2EJGA 2E6ZA 1G8XA 3M54A 4QT7A 4IUUA 2ECZA 4M77C 1IHVA 2NLUA 4M7DG 3JCMe 1PC0A 1UDLA 4M77F 1WQWA 4QVZA 3L1AA 2PUOB 1NLPC 3CC2Q 2J06A 4C8QF 1D0YA 4B6MA 3EAEA 4E7LA 4FU6A 1VQ7A 4PJOF 2RI5A 4D8KA 1ZBJA 2A08A 3HPWA 4FW2A 1K0XA 3UT1A 2DETA 5KE2A 2GTOA 1M3AA 3I56T 3JCMd 4M78D 2PVDB 2R57A 2JJ9A 1PD0A 2YXYA 3PMIA 4LDWA 5GAN6 4ZN3A 1TUDA 4HCBA 4M7DA 1QKWA 4PJMA 1I81A 5GAOl 1X6BA 1M1GA 5HY6A 1OI1A 3CCJA 3C0CA 2GFAA 3EFSA 3L2UA 5GANg 2ZAEA 5FRNA 4GY5A 5GAN5 2EBPA 2CKKA 2I0NA 4WCIA 1E6HA 3OY9A 2DMOA 2DEQA 2FO0A 5FU6B 2J6FA 3OQ5A 5LJ5j 1KD1U 3BY7A 2HQHA 2MCNA 2KAFA 1S72A 4KGVB 4J9HA 2IIMA 2DBKA 3KFVA 1OU9A 2FZCB 2MWOA 2O4XA 4AFUC 4L5GA 1N27A 4J7IA 5GANh 1BIAA 2MOXA 3SEMA 2RM4A 2RHYA 1WJRA 1SSHA 2VC8A 4JLGA 2KK4A 1YFNA 2XHCA 3RIRA 3WXMB 4JRIA 5GAOm 3A8OB 3NFCA 4M7AB 4ZTFA 4Z02A 3O5ZA 3CMAQ 3CCRQ 4CI0C 3WVDB 3OBWA 2LT1A 1VQNQ 1TG0A 1PKTA 5CKFA 5CKEA 1VQNA 2VXFA 4MZMA 3OW2S 3JB9J 4A4HA 2X3XD 2BTTA 1U06A 2GFUA 1RAHB 2K2MA 4Y92A 4XAXB 2E1HA 4PFZA 1JXOA 2CYZB 4JS5A 3CCMT 4QQGA 3L2RA 4LUDA 1VQ5A 3JB9G 1LCKA 1AVZC 2CP3A 2ENMA 3P8BB 4J9CA 3QHSA 1WZOA 3EG1A 1WHLA 1GCPA 4ZTJA 1VQ7Q 2PNIA 4FYXB 1LNXA 3REBB 7AT1B 1Y96B 5KYYB 1YWOA 4OB2B 3RR6A 2MYSA 4MDWA 1PM3A 3X25B 1Z9QA 2NUTA 4M7AC 1D0XA 3MHXA 3CCRT 3VS3A 1WX6A 2C06A 2EGCA 2GQVA 4LDYA 3V8JA 4DA4A 4M75G 1PKSA 4EMKB 4V2SA 1RAFB 4BDYA 3M5AA 3OYLA 2RHZA 2QEXQ 3VU3C 1BU1A 2W10A 1IXDA 2KSSA 3CCEQ 2LC4A 2RJCA 2ROTA 1HXDA 3G4SA 3PIPA 2KEAA 5GAN4 1O9SA 3SFMA 4E6RA 3FC3A 4M78F 4C92D 3BDUA 3ASKA 1RI0A 1HD3A 3PNWC 2L89A 1YP5A 4KBMB 1Q82U 2V8IA 3KBGA 1TWBA 4AFSC 4JJNK 1AT1B 2LJ0A 4HCCA 3QKJA 5KYUA 5A0LA 1VYTA 5HK0A 4AT1B 2DL8A 3PE0A 3EGDA 3SB2A 1MMNA 3M57A 2RF0A 1AHJB 1Q95G 4LN2A 1LOJA 5LJ5g 1WHMA 3LWIA 4E7ZA 3FDRA 3TREA 2BUDA 3VJPA 2SRCA 1NJIC 1SSFA 2G3RA 5DLOA 3QYGB 5GANd 4QKUA 2XDBA 2HL3A 5CKDA 2PU9B 3VS0A 1KQ2A 3TQ7P 1ZQ1A 2LTOA 3NTIA
chains in the Genus database with same CATH topology
3M53A 1MGQA 3QBYA 2RK2A 3PT9A 1BKBA 1LJOA 2DTHA 3CBPA 1I5LA 4FL6A 3ZBDA 5GMKj 5LJ5e 3RESA 4M7AF 4PJOC 3C4SA 2DO3A 2EWNA 3FRNA 2H3JA 2ZZDA 1UGRB 3CD6T 3NTKA 4IKFA 3A5ZB 3CCUA 4OGEA 5D6YA 3SWNA 5CAIA 1YHQT 3G71A 4F7UE 1KHCA 2EQMA 4A4GA 2QXFA 3E1SA 3MP1A 3QO3A 4J7FA 2OTJA 2ZPIB 4A4KA 4BI3A 3JCMb 1VQLA 4BACA 4FSXA 4MDXA 2LCLA 2HBPA 4J6XA 3VV0A 4C0DC 5C0MA 1U8RA 5CK9A 3RKYA 2DVEA 3CD6A 3G4ST 2MI6A 1VQ4A 4RCCA 1BI2A 1KHIA 1UB4A 5KCHA 2X4JA 2X4XA 3UWNA 1YI2T 3URGA 3X24B 5HK3A 3P8DA 4XQ3A 2K2VA 3AHUA 5FRMA 1UGSB 3KUFA 5IT9E 1EIFA 2E65A 3HFOA 4M75F 1N9RA 2E41A 2E64A 4QVDA 2GF7A 3S6WA 4XU2A 1YJNA 2CGHA 2P4TA 2B8AA 3ZFJA 3OYJA 1VQLT 1B34A 1YBYA 3HP9A 3MEAA 4NOYA 3M4YA 3M56A 2ZPGB 3SD4A 4ZN1A 3SDZA 2K57A 4JS4A 2EFIA 3OS1A 3LWHA 5CR2A 3OW2A 1M1FA 2CZ7B 3MP8A 3UDCA 1VQ9T 1M9SA 1Y07A 4LDUA 3JCMh 3JCMc 1K8AC 4IUVA 1Q7YC 4J5YA 1JJ2A 1VQKA 3FJPA 3CCEA 4M77E 1M1KC 2X4WA 4E47A 1QP2A 3BFMA 3OS0A 5DY9A 4IUTA 4C8QB 2QEXA 3S3MA 1M1KU 1Q81U 4C8QE 3OYMA 2EKOA 3JB9H 4KULA 4DOVA 2RB6A 2RO0A 4N0AA 1IREB 2DD4A 4LDVA 3CCLA 5GAOq 3QG1A 4QQ6A 1G3SA 1M8VA 1Q86C 3GIBA 3QPHA 4BI8B 3N5BB 1VQ8T 5CQXA 4M77A 2RHUA 5CKBA 5GAMj 1OZ3A 1H641 3WVEB 4C8QD 3QUIA 2ZPHB 3X28B 3GF5A 3BW1A 1PSEA 2K3YA 2LDMA 2RHIA 4J6YA 4PNOA 2P0QA 4MZTA 4XTVA 4R55A 1YIJA 3X26B 3RKWA 2D0QB 4PLIA 4NL2A 4OB0B 1WGSA 1DJ7B 2LRQA 1X6OA 4VUBA 3OYBA 2YHTA 4OB1B 3GLXA 2OTJT 3QJYA 3TEEA 2LX9A 2HNIA 1QVFS 1VUBA 4HKEA 3BDLA 2RD1A 5FU7C 2K5IA 2AHJB 4EMGA 1VQ6A 1M5Q1 1BI0A 1WJQA 1ZHIA 1YIJT 3V8LA 1K73C 4JDSA 4RCBA 4NL3A 2VXEA 2E70A 3VYGA 4F7UB 1N6AA 4A53A 3QZ5B 3CCRA 4PJOG 3JCMP 3G7ZA 4XTXA 2ZPFB 4C92C 4KUDK 4N0AC 2R5AA 4X9CA 4RG8A 4M77B 4EMKC 3OYYA 3CCUT 4JLIA 2JTMA 4M77G 3MP6A 1W2BA 4MZPA 1JB0E 3DB4A 1M4ZA 3I56A 1Q7YU 1JJ2S 4XTWA 2RI2A 2YRVA 1OYXA 5LL6S 5GMKl 3CCQT 1N9SA 2M1HA 4M7DF 4TVRA 3QSUA 2RJEA 3GNFB 2VGNA 5D6WA 2K5FA 5AYFA 1Q81C 1BIBA 4C5HA 3OYNA 2O4XB 2LQKA 3MEUA 4M78E 2Y4XA 1G3WA 4OF1A 2DZ9A 3OYEA 3HKSA 2RK1A 1NE8A 3HFNA 3M9QA 2DTIA 3S3NA 3LW5E 5LJ3f 3ZEHA 1R8OB 2V8JA 5GMKe 3I55T 3OYIA 4JRPA 1YI2A 4QVCA 1K9MC 3H6ZA 5GAOn 3QYHB 4EDUA 1KQ1A 5DM7R 2JUFA 2DXBA 3CC7T 4F7UA 5FLXE 2OTLT 4Q5WA 5CIUA 4M7DB 3HL8A 2EJFA 4PJOA 2HQEA 2K4YA 2DIGA 2JOYA 3LLRA 3G6ET 4C8QA 3MEWA 4B9WA 2F5TX 2PQWA 4C8QC 4M77D 1VQ9A 3JB9D 5A0GA 2RJFA 2E5QA 4D6WA 3RMSA 2BIVA 3CCSA 4PJOE 3JCMQ 2XDDA 1QP3A 1IZ6A 2DXUA 1G5VA 3FB9A 5IAYA 4MMKA 2QEXT 3RUXA 1YJ9T 5GAMd 1VQPT 3CC4A 4YTLA 2DIQA 2ZPEB 3HRSA 4L59A 5GANj 5I2SA 2XI9A 1NPRA 2Y90A 5EG2A 4M7AD 3L2VA 3CCLT 2MWPA 4C0GA 5GMKh 3OYHA 2M9UA 2F5KA 2KY9A 3CBMA 3INZA 4F7UG 5KCOA 3CCST 4C0ZA 1YITT 5CCAA 3HSBA 1U1TA 3OSSC 3GP8A 2XIDA 3VUBA 2EJGA 3CPWS 1X01A 2E6ZA 2HQXA 1ZBXA 4N4GA 4RMOA 3GNGA 2DTOA 3PMTA 4C8QG 1KC8C 1W2BS 1XQHA 3M54A 4EMKA 5GAN8 4IUUA 4BY6C 4PL6A 2HAXA 2XU8A 4M77C 5LJ5f 5GMKi 3QIIA 4GLKA 2KQWA 3C94A 3TCJA 2NLUA 4M7DG 3JCMe 4IUPA 1VQMT 4M77F 1WQWA 4PLLA 4QVZA 4M7AE 3L1AA 3RMQA 2PUOB 2XICA 3OYCA 4C8QF 3OA6A 1YJNT 1P92A 1WNLA 2EQKA 3EAEA 4FU6A 4E7LA 1VQ7A 2E12A 4ME7A 4PJOF 2RI5A 1PSFA 4M75D 2QQRA 1M90C 2WSEE 2RA2A 3HPWA 3J80E 4F7UF 1FXXA 3CXCA 3UT1A 3TU4K 3L2ZA 3HRTA 5KE2A 3PFSA 2ZGWA 2MMPA 3E9FA 4C92B 3VYHB 4DQ2A 5CQYA 2EQUA 3OMCA 3I56T 3JCMd 3OSVA 3CCJT 2LT4A 4M78D 1FX7A 2PVDB 2R57A 1GXIE 2VUBA 1VQ7T 2RJDA 3V7RA 3OBYA 1K73U 4BE0A 5FU7B 3C12A 3PMIA 4LDWA 5GAN6 4ZN3A 2LCCA 1VQ4T 4HCBA 4M7DA 4WF2A 3CEYA 3JSCA 3PGGA 1I81A 5GAOl 4XK8E 3DB3A 1KC8U 4M75E 4MMLA 3CC2T 1M1GA 1W4SA 4ATOA 1HK9A 2ZCFB 5HY6A 3META 1OI1A 2XK0A 2Y4YA 3CCJA 2R58A 3CCVT 2XG8D 4M75C 5GAMf 2EQJA 2GFAA 2QQSA 3EFSA 3L2UA 4QW2A 5GANg 4RKUE 1N8RU 3LGLA 3V7CA 5GAN3 3NTHA 1S72T 5FRNA 2LQ8A 4PJOD 4GY5A 2YLCA 3JB9I 2D6FA 5GAN5 1BI3A 2E6NA 2CKKA 4B9XA 3JRZA 5DLQE 3OY9A 2DEQA 5FU6B 2QQAA 3OQ5A 3Q1JA 3CCVA 5LJ5j 2OAUA 1KD1U 3BY7A 3C95A 3FIFA 4XTYA 2JVVA 2K3XA 4HA8A 2KAFA 1Y71A 5LJ5d 4M75B 5D6XA 1S72A 2DXCA 2EYQA 1H3ZA 3MO8A 3OYAA 5LJ3d 3OS5A 4M78C 1YCYA 3CMAA 3OMGA 1VQOA 5A0DA 3LH0A 2CZ6B 1MHNA 5GANe 3QDRB 3L2WA 3JCMJ 1VQ8A 3J7AF 4BE1A 2MWOA 2EJ9A 2O4XA 2I2LA 4L5GA 1N27A 4J7IA 5GANh 1BIAA 3V7SA 1QVGA 3L42A 3VUZA 2RHXA 4ELZC 2P0KA 2RM4A 2RHYA 3QXEB 1WJRA 2DPPB 4JUVA 1X75C 2DAQA 2FYKA 4OB3B 4BDZA 4R56A 2VC8A 4JLGA 2DXTA 2FB7A 2DJZA 2KK4A 4XU1A 1D3BB 4ZGEB 5LJ5h 1VQMA 1K8AU 2XHCA 4LD9K 4PJOB 4OP0A 3CC7A 3RIRA 3WXMB 3M59A 4JRIA 4XU0A 5GAOm 1QVPA 2OTLA 3A8OB 4Y28E 2WACA 3NFCA 4M7AB 4ZTFA 2F69A 4Z02A 4DOWA 2QDYB 2E10A 1VQNT 1K9MU 1Y7XA 2ZPBB 5A2QE 1UGQB 1WPYA 5I21A 1Q86U 2WSFE 2XD0A 4CI0C 2JZ2A 2L8DA 3WVDB 3OBWA 2KDSA 4M7DE 1TH7A 2FVUA 1NZ9A 2LT1A 4IURA 4XTZA 4FIBA 4BE2A 3DKMA 3CPFA 3RKXA 3CCQA 5LJ3e 1RL2A 2M0OA 4X34A 3GPLA 4BY6B 5I2MA 4CRIA 3CC4T 1YJ9A 1N8RC 3CBOA 1WJSA 4J6WA 5CKFA 1M90U 5CKEA 2D9TA 4M78B 3V8KA 1D3BA 1VQNA 2VXFA 5J39A 2QA4A 4EPCA 4C92G 1Q82U 3UPUA 1KQSS 4HT9A 2M16A 3CPWA 4MZMA 3CC2A 3OW2S 1YHQA 5FU6C 4FM4B 3JB9J 4A4HA 3QZ9B 1QW1A 1YITA 2P0PA 2RH2A 4RG2A 4Y91A 3A8HB 4A4FA 3SWNB 1UGPB 3VKIA 4O5VA 2GFUA 4C92F 2K5LA 3CMEA 1NJIU 4P5NA 4XAXB 1XNIA 5CKHA 2JNGA 3S3OA 2E1HA 2PVGB 4O6JA 2CYZB 4JS5A 3OYDA 3CCMT 4NS5A 1V29B 4X9DA 5LJ3g 4QQGA 3L2RA 2L3RA 1VQ5A 3ER0A 2RI3A 3JB9G 1UEBA 4M75A 3JCMW 1JRIA 3MCAB 5M9OA 2L5QA 2PUKB 2VGMA 3P8BB 5LJ3h 2KMTA 5J26A 2FL7A 3ME9A 3DLLA 4N4HA 1WQ7A 3P8HA 3PIOA 3E9GA 3E19A 2QTXA 3QHSA 4HCZA 3CXCS 1Q82C 3M4GA 4C0FA 4ZTJA 2BKDN 2XKOC 3LYIA 3CCMA 4C92A 4BD3A 1LNXA 2LNVA 4N4IA 1VQ5T 2X35A 2A3LA 1Y96B 2IG0A 1VQKT 4L6V5 3CCET 3H8ZA 4JRKA 1VIFA 4FT4A 4A54A 5GAOp 4E7KA 1VQOT 4OB2B 2FHDA 2YLBA 4LDXA 4BUGA 4M78G 4ZGDB 3JCMf 3OS2A 4MDWA 3FEOA 3X25B 2QQBA 4QQDA 1QVFA 4KT0E 3L2QA 4M7AC 3MHXA 3CCRT 3R6OA 4C0DB 1FWZA 4C92E 5GANf 2C06A 2GQVA 4LDYA 3V8JA 3QJ6A 4DA4A 4M75G 4M7AA 1G3TA 2DZCA 4II1A 2DK3A 4EMKB 1YJWT 3JB9F 4V2SA 3G71T 4BDYA 3M5AA 3OYLA 2RHZA 1KD1C 4ELYC 4E7HA 2JN0A 3RERA 3JCMg 3VU3C 1XTDA 4FT2A 5GAN2 2KSSA 1Y96A 4EMHA 5C6SA 4M7DD 2LC4A 2RJCA 3G4SA 1HXDA 4J8OA 5CVIA 3JCMX 3PIPA 5GAN4 5CO7A 1YJWA 1O9SA 3SFMA 3DLMA 3FC3A 2QI2A 3LX7A 4M78F 4M78A 3BDUA 4C92D 5GAOr 3ASKA 4KUIA 4ZGJB 2GCXA 1VQ6T 1RI0A 3LGFA 3PNWC 2WSCE 4C5GA 2L89A 1KG1A 4KBMB 1U1SA 4BI4A 2V8IA 3JAME 4E7JA 2CS7A 4C5EA 3KBGA 2DD5A 3HHTB 4C5IA 2VV5A 3GOXA 3OYGA 3HRUA 2IVWA 3MEVA 4JJNK 4JRQA 1I8FA 5GAMe 2DKGA 5HKCA 4M7AG 1I4K1 4PKCC 3PTAA 2QA4T 4XTUA 1OZ2A 3CMAT 2KVQG 1B34B 4HCCA 4OGCA 2X4YA 3A8LB 3QKJA 3FLGA 4UC4A 5A0LA 1VIEA 3A8GB 2QQ9A 1BI1A 5HK0A 3X20B 5GAN7 3CMET 4BB7A 5J3BA 1VQPA 2EIFA 3SB2A 3M58A 4OMFB 2MF2A 3M57A 2MAMA 3T9NA 1AHJB 2O01E 5LJ3j 1KQSA 1LOJA 3I55A 5GMKm 5LJ5g 3J81E 2A7YA 4LD6A 3A8MB 1XOVA 2CZ1B 2HD0A 1O75A 5IN1A 5L8RE 1NPPA 5KE3A 3LWIA 4XU3A 4M7DC 5GAMg 1JBMA 2V8KA 3FDRA 4J83A 2BUDA 3TREA 4A4EA 5KH6A 3KXTA 3EFRA 2EAYA 3VJPA 1G3YA 2JTFA 3OB9A 3SWNC 4IUQA 1NJIC 3JCMV 1BYMA 3G6EA 1SSFA 2G3RA 3OYKA 5GAMh 3M55A 5DLOA 3QYGB 5GANd 2R5MA 5FROA 4E7IA 2XDBA 2PVOB 3F70A 5CKDA 2PU9B 4HT8A 1QVGS 2LVMA 1KQ2A 3O8VA 1ZQ1A 3OYFA 2XDPA 2VYTA 2LTOA 3NTIA 4OVAA 2CZ0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQW A;  2KAF A; 
#chains in the Genus database with same CATH topology
 4LNP A;  3QBY A;  1UE9 A;  3H0F A;  4F04 B;  4PJO C;  2J6K A;  2DE0 X;  4X1V A;  1MUZ A;  4Z8A A;  1VOM A;  2DLP A;  5CAI A;  1ZA2 B;  3CCL Q;  1FMK A;  4A4G A;  3QO3 A;  6AT1 B;  4J7F A;  4PFO A;  2BE7 D;  4BAC A;  4MDX A;  2LCL A;  2HBP A;  3VV0 A;  3CD6 A;  3G4S T;  2MI6 A;  1CSK A;  2QGF B;  1KHI A;  2IPO B;  2C0O A;  1YI2 T;  2O31 A;  2AKL A;  4XQ3 A;  3AHU A;  3HFO A;  2OTJ T;  1N9R A;  2E64 A;  2O9S A;  2FRW A;  4Z88 A;  1YBY A;  3HP9 A;  2DER A;  3VRZ A;  3M4Y A;  3M56 A;  5FWC A;  4ZN1 A;  3OS1 A;  5CR2 A;  3OW2 A;  1M1F A;  2CZ7 B;  3MP8 A;  1NBE B;  3JCM h;  3FJ5 A;  4IUV A;  1VQK A;  2KGT A;  4E47 A;  5DY9 A;  1EX4 A;  1NEG A;  1M2O A;  2RO0 A;  4N0A A;  5HCK A;  1X43 A;  4LE9 A;  3QG1 A;  2JT4 A;  2K6D A;  3GIB A;  1ZSG A;  2YUO A;  3N5B B;  2LP5 A;  3ZL7 C;  5IXF A;  4C8Q D;  3QUI A;  3GF5 A;  2Z0W A;  4FYV B;  3G71 Q;  1YIJ A;  1A0N B;  4MZT A;  4XTV A;  3X26 B;  2D0Q B;  2HSP A;  4NL2 A;  1DJ7 B;  1X6O A;  4VUB A;  4LXC A;  4OB1 B;  3GLX A;  1GL5 A;  2DYB A;  2HNI A;  2RD1 A;  1M5Q 1;  1ZHI A;  2CRE A;  1K73 C;  1VYU A;  4PFP A;  2DYI A;  4JDS A;  1AZE A;  2QDL A;  4A53 A;  3QZ5 B;  4PJO G;  1X27 A;  4KUD K;  2R5A A;  4GBQ A;  4X9C A;  4EMK C;  4KRT A;  2JTM A;  4JJB A;  3G4S Q;  3DB4 A;  1Q7Y U;  1M4Z A;  3EFO A;  1T0H A;  1N9S A;  1K1Z A;  1OPL A;  3HTR A;  1NYF A;  5D6W A;  2L3Q A;  4M78 E;  4J9D A;  5LJ3 f;  3I55 T;  1V76 A;  1YI2 A;  1YJ9 Q;  5GAO n;  3QYH B;  3CC7 T;  2JUF A;  2CSQ A;  4JJC A;  1KC8 R;  2D8H A;  1UJ0 A;  2F5T X;  1M8M A;  2P84 A;  1RAC B;  2M0Y A;  1AD5 A;  2GNC A;  2RJF A;  5A0G A;  4RTU A;  2EGA A;  2XDD A;  3FB9 A;  1YJ9 T;  1D1C A;  3CC4 A;  1VQP T;  2A0F B;  2ZPE B;  1YNZ A;  2L0A A;  5I2S A;  2XI9 A;  1NPR A;  3EGD B;  2ESW A;  4C0G A;  2LMJ A;  2KY9 A;  1YIT T;  4C0Z A;  2MIO A;  3HSB A;  1U1T A;  1VQ4 Q;  3OSS C;  3VUB A;  1X01 A;  4N4G A;  4AFQ C;  1QLY A;  3PMT A;  1W2B S;  2YDL A;  5GAN 8;  4PL6 A;  2HAX A;  5LJ5 f;  4DBQ A;  3QII A;  3C94 A;  3TCJ A;  1WIE A;  2NUP B;  4IUP A;  1PCX A;  1RAD B;  1RAE B;  2XIC A;  3OYC A;  3OA6 A;  1YJN T;  1P92 A;  1UEC A;  2E12 A;  4M75 D;  3J80 E;  2O88 A;  3CPW P;  3CXC A;  3L2Z A;  4ORZ A;  4PK4 A;  3PFS A;  3EG9 A;  3CCJ T;  2VAS A;  1FX7 A;  1GXI E;  2VUB A;  3EH1 A;  5FU7 B;  2LCC A;  3JSC A;  1KC8 U;  4MML A;  2R58 A;  4M75 C;  3QWY A;  1ZSZ A;  2QQS A;  4RKU E;  1OUL A;  3V7C A;  1S72 T;  2DF6 A;  2QTV A;  2E6N A;  1H8K A;  5DLQ E;  5I11 A;  1WFW A;  3Q1J A;  3CCV A;  2OAU A;  3FIF A;  2YWW A;  4HA8 A;  2OTL Q;  4FYY B;  1H3Z A;  1M2V A;  3OS5 A;  4M78 C;  3OMG A;  1VQO A;  5A0D A;  3J7A F;  5GAN e;  1MNE A;  3QDR B;  3CCM Q;  1W1F A;  4BE1 A;  1ACM B;  2EJ9 A;  3V7S A;  1WLP B;  2CUD A;  3L42 A;  2RHX A;  1KSW A;  2M51 A;  3MKD A;  2F2V A;  4CC3 A;  4JUV A;  4BDZ A;  1KIK A;  2OI3 A;  4R56 A;  1BBZ A;  1VQ8 Q;  2DJZ A;  4XU1 A;  2LJ1 A;  1YWP A;  5EC7 A;  4LD9 K;  4OP0 A;  2D0N A;  2WAC A;  1IRX A;  1SHF A;  1K9M R;  2E10 A;  1VQN T;  5I21 A;  1WPY A;  1ZX6 A;  2JZ2 A;  2L8D A;  2KDS A;  3RKX A;  1V1C A;  2DL4 A;  5I2M A;  4BY6 B;  4DBF A;  1N8R C;  3CBO A;  1WJS A;  4DEX A;  1M90 U;  2D9T A;  4M78 B;  2C0T A;  4EPC A;  4C92 G;  3OW2 P;  2M16 A;  3CPW A;  3VS6 A;  3VRY A;  3QZ9 B;  2RH2 A;  4A4F A;  5KYY A;  3SWN B;  5GJW B;  4C92 F;  2K5L A;  4P5N A;  1RLQ C;  1HJD A;  3QWX X;  3OYD A;  5LJ3 g;  2HDA A;  2RQT A;  4RTT A;  3ER0 A;  2RI3 A;  1YHQ Q;  2AKK A;  1WA7 A;  5M9O A;  2L5Q A;  2VGM A;  2KMT A;  2FL7 A;  3ME9 A;  3VS7 A;  4N4H A;  3DLL A;  1AWX A;  3P8H A;  3E9G A;  3E19 A;  3TSW A;  2QYZ A;  1Q82 C;  4C0F A;  4C92 A;  1W70 A;  1B3Q A;  1NLO C;  2QAS A;  1D09 B;  2X35 A;  2IG0 A;  3CCE T;  4L6V 5;  2K7A A;  4FT4 A;  1VQO T;  1WXB A;  4M78 G;  3JCM f;  2CP6 A;  5KYN A;  2QK0 A;  2QQB A;  2NYS A;  1VQ9 Q;  4KT0 E;  1U5S A;  4C0D B;  2X9H A;  3EG3 A;  3QJ6 A;  2KI7 A;  4II1 A;  2DK3 A;  3G71 T;  1KD1 C;  4E7H A;  1XTD A;  4FT2 A;  1Y96 A;  4M7D D;  3UA7 A;  1SEM A;  5CVI A;  3JCM X;  1HSQ A;  2JXB A;  2EYW A;  5CO7 A;  3CCS Q;  1RI9 A;  1MMG A;  2QI2 A;  4M78 A;  1VQ6 T;  1FYN A;  3CC4 Q;  4C5G A;  4E7S A;  2FEI A;  2KRS A;  2RPN A;  4BI4 A;  3EGX A;  4C5E A;  1WYX A;  1QKX A;  2JS2 A;  1TU0 B;  3NGP A;  1GCQ A;  4PKC C;  3PTA A;  1EFN A;  1RAA B;  2L3S A;  4DEY A;  2X4Y A;  5IXB A;  1RAB B;  2OTJ Q;  1TXQ A;  4J9G A;  2M02 A;  5GAN 7;  1VQP A;  5J3B A;  2EIF A;  1YI2 Q;  1AWO A;  2RQW A;  3M0T A;  2C0I A;  2DJQ A;  1KQS A;  1ZSZ B;  4KH1 B;  1XOV A;  2HD0 A;  1O75 A;  3VS4 A;  4XU3 A;  2V8K A;  4J83 A;  2KBT A;  2JTF A;  1NM7 A;  1OV3 A;  1UFF A;  2YSQ A;  2PVO B;  1VQ6 Q;  2LVM A;  3O8V A;  2MK5 A;  2XDP A;  4OVA A;  3H41 A;  3M53 A;  2RK2 A;  1BKB A;  1LJO A;  1OU8 A;  3R6N A;  3CXC P;  1I5L A;  5LJ5 e;  3RES A;  1SF9 A;  2KYM A;  2H3J A;  1M90 R;  2ZZD A;  3CD6 T;  1M3C A;  3NTK A;  2E3I A;  3SWN A;  3G71 A;  4F7U E;  1OPK A;  4CC4 B;  3MP1 A;  2OTJ A;  1VQL Q;  2ZPI B;  4A4K A;  4FSX A;  4C0D C;  1QWF A;  1U8R A;  3RKY A;  1GBR A;  5KCH A;  2X4X A;  5HK3 A;  5KYW A;  5FRM A;  1MND A;  4M75 F;  2E41 A;  2ABL A;  2GF7 A;  3S6W A;  4XU2 A;  2CGH A;  1B34 A;  3MEA A;  2DX1 A;  3SDZ A;  4JS4 A;  2EFI A;  3LWH A;  4PJN A;  2O2O A;  1UUE A;  1VQ9 T;  1QCN A;  3JCM c;  1JJ2 A;  2E3H A;  3FJP A;  3SHW A;  2X4W A;  3OS0 A;  2KE9 A;  4C8Q B;  1IRE B;  2DD4 A;  1IGQ A;  1GRI A;  1RLP C;  3I5R A;  2EW3 A;  1AOJ A;  1KFZ A;  1YIT Q;  4M77 A;  2RHU A;  5CKB A;  1LPL A;  5GAM j;  1OZ3 A;  2G6F X;  2ZPH B;  4J6Y A;  2JM9 A;  2LRQ A;  1VQP Q;  2DBM A;  1RUW A;  2GTJ A;  1RAG B;  3CCQ Q;  1TOV A;  1VUB A;  2EQI A;  3BDL A;  4EMG A;  1QVF P;  2CP0 A;  4PJJ A;  4NL3 A;  2COW A;  4C92 C;  1K9A A;  4F14 A;  2EKH A;  3OYY A;  2JM8 A;  4JLI A;  1ARK A;  1BCO A;  1JJ2 S;  1OYX A;  4M7D F;  2M1H A;  2RJE A;  2CH4 W;  2KT1 A;  2RN8 A;  3GNF B;  4JZ4 A;  1BIB A;  3OYN A;  2LQK A;  3MEU A;  2XMF A;  4OF1 A;  2H3E B;  3OYE A;  2LQW A;  3HKS A;  1NE8 A;  3S3N A;  2DTI A;  3RDV A;  3ZEH A;  2ATC B;  4QVC A;  3VS5 A;  1VYV A;  4EDU A;  1KQ1 A;  1NEB A;  2OTL T;  5CIU A;  1WHG A;  1H92 A;  4PJO A;  2K4Y A;  2DIG A;  4C8Q A;  4B9W A;  2PQW A;  1VQ9 A;  2EYX A;  2KYB A;  4D6W A;  2EYY A;  4PJO E;  3JCM Q;  1IZ6 A;  2DXU A;  1G5V A;  5IAY A;  3RUX A;  5GAM d;  4AG2 C;  1SPK A;  5GAN j;  5EG2 A;  1AWJ A;  2FPE A;  3INZ A;  3THK A;  3CCS T;  1IHW A;  2CP7 A;  2KNB B;  4RMO A;  2HQX A;  2DL7 A;  1KC8 C;  1ZLM A;  3IQL A;  4EMK A;  1VQO Q;  5GMK i;  2CH4 A;  1VQM T;  3RMQ A;  2JS0 A;  4IIM A;  2EQK A;  4ME7 A;  3EHQ A;  1PSF A;  1Q81 R;  2QQR A;  1JQQ A;  4F7U F;  4AFZ C;  3RNJ A;  3EGU A;  3HRT A;  2ZGW A;  1D0Z A;  2EQU A;  3OMC A;  4JPB W;  1K76 A;  1I5O B;  2LNH B;  2KR3 A;  2RJD A;  3V7R A;  4BE0 A;  3C12 A;  1X2K A;  1VQ4 T;  2KRN A;  2V1R A;  3PGG A;  1M3B A;  4XK8 E;  1YJW Q;  4M75 E;  1HK9 A;  2ZCF B;  2Y4Y A;  2B86 A;  1Q7Y R;  2QA4 Q;  3CCV T;  2XG8 D;  5KYW B;  2EQJ A;  4QW2 A;  1N8R U;  1LVK A;  3NTH A;  2LQ8 A;  2YLC A;  3JB9 I;  3JRZ A;  2HMA A;  9ATC B;  4WTO B;  1KK7 A;  2K3B A;  4GLM A;  2JVV A;  2K3X A;  2COY A;  3NHN A;  3NPF A;  2BE9 B;  4FYW B;  1Y71 A;  5LJ5 d;  5D6X A;  1TUC A;  2EYQ A;  4RUG A;  1KD1 R;  3MO8 A;  3OYA A;  5LJ3 d;  3TSZ A;  3CMA A;  1TTH B;  3LH0 A;  1MHN A;  3JCM J;  2E5K A;  2I2L A;  4J9F A;  4ELZ C;  2P0K A;  3U23 A;  2DPP B;  1X75 C;  2DAQ A;  2OX7 A;  2DXT A;  1D3B B;  1VQM A;  4PJO B;  3CC7 A;  1Z9Z A;  3M59 A;  4XU0 A;  1KQS P;  1QVP A;  4ESR A;  3UAT A;  2F69 A;  4DOW A;  2QDY B;  1K0S A;  4J9E A;  2GBQ A;  2ZPB B;  1Q86 U;  4LUE A;  2XD0 A;  4M7D E;  1TH7 A;  1YCS B;  2FVU A;  4IUR A;  4BE2 A;  3DKM A;  3CPF A;  3CCQ A;  5LJ3 e;  1UGV A;  3CC4 T;  1YJ9 A;  3A98 A;  4J6W A;  1C1A A;  2ED0 A;  3V8K A;  5J39 A;  2QA4 A;  1KQS S;  1YHQ A;  1YIT A;  1UJY A;  2P0P A;  4RG2 A;  4Y91 A;  1TUG B;  3A8H B;  4EIK A;  1UGP B;  2ED1 A;  3VKI A;  3CME A;  2O9V A;  3S3O A;  2PVG B;  4O6J A;  1VQM Q;  2LZ6 B;  4NS5 A;  4X9D A;  2L3R A;  2P4R A;  5LJ3 h;  2KXC A;  1WQ7 A;  3PIO A;  2V1Q A;  3M0R A;  4J9I A;  3M4G A;  4N4I A;  2GQI A;  2A3L A;  1PD1 A;  3H8Z A;  4JRK A;  4E7K A;  1YIJ Q;  4ZGD B;  3FEO A;  1R0C B;  1JJ2 P;  2E4H A;  4QQD A;  1NJI R;  1QVF A;  3L2Q A;  1RAI B;  1QMC A;  1FWZ A;  1JXM A;  1G2B A;  2D1X A;  4M7A A;  2EPD A;  1G3T A;  1HYO A;  3JCM g;  4ANJ A;  5GAN 2;  4EMH A;  1TSF A;  2RNA A;  2FG0 A;  1UHF A;  2D8J A;  1YJW A;  3LX7 A;  2KRM A;  4KUI A;  4ZGJ B;  2GCX A;  1ZUK A;  2WSC E;  2YT6 A;  3EH2 A;  2CUB A;  2K79 A;  5GJV B;  1KG1 A;  4C5I A;  4E2F B;  3HRU A;  4M7A G;  5HKC A;  5GAM e;  2DKG A;  3CCV Q;  2QA4 T;  4XTU A;  4OGC A;  1VIE A;  2QQ9 A;  3X20 B;  3CME T;  4BB7 A;  3M58 A;  2MF2 A;  2W0Z A;  2O01 E;  2A7Y A;  4LD6 A;  3A8M B;  5IN1 A;  5KE3 A;  5L8R E;  4M7D C;  1JBM A;  5KH6 A;  2KT8 A;  1G3Y A;  1E6G A;  4OMP A;  4JJD A;  3G6E A;  1D1A A;  5GAM h;  2NUP A;  5FRO A;  1MV3 A;  1IB8 A;  4E7I A;  3F70 A;  5ECA A;  3OYF A;  2F1L A;  2VYT A;  2CZ0 B;  1ZUU A;  3ZBD A;  5GMK j;  4M7A F;  3C4S A;  1QQJ A;  3FRN A;  1UGR B;  3CCU A;  1ZA1 B;  4OGE A;  3M0S A;  1BCM A;  1KJW A;  2HEQ A;  1KHC A;  3NMZ C;  2QXF A;  3E1S A;  1SG5 A;  3JCM b;  2KXD A;  1K4U S;  2EGE A;  4J6X A;  2NWM A;  5C0M A;  5CK9 A;  2DVE A;  1VQ4 A;  2LJ3 A;  3GBQ A;  3UWN A;  3CCU Q;  3RBB B;  3I9Q A;  3URG A;  3X24 B;  2YRC A;  2HBW A;  1UGS B;  2NUZ A;  1YN8 A;  4QVD A;  5D7U A;  2HSE B;  2P4T A;  1VQL T;  3ZFJ A;  3SD4 A;  1N8R R;  2VVK A;  1M9S A;  1Y07 A;  2DVJ A;  4LDU A;  5AT1 B;  1Q7Y C;  1AZG B;  4J5Y A;  1T0J A;  3CCE A;  2QGG A;  4M77 E;  1M1K C;  1QP2 A;  3BFM A;  2QEX A;  3S3M A;  1Q81 U;  4C8Q E;  5IH2 A;  2JW4 A;  4RTZ A;  3EHR A;  2RB6 A;  4DOV A;  2DL5 A;  2BZX A;  1R0B G;  5GAO q;  4QQ6 A;  1G3S A;  2DL3 A;  3M0U A;  3A1P A;  2BZY A;  5CQX A;  3WVE B;  3X28 B;  3BW1 A;  4D8D A;  2K3Y A;  2LDM A;  1Y57 A;  3I5S A;  4PLI A;  2YHT A;  4OMO A;  3QJY A;  3TEE A;  2LX9 A;  1QVF S;  4DBR A;  1VQ6 A;  4OML A;  1OQK A;  1BK2 A;  1BI0 A;  3V8L A;  4HVV A;  4RCB A;  2VXE A;  2E70 A;  1GCQ C;  4F7U B;  3JCM P;  5FW9 A;  1VQ5 Q;  4XTX A;  4FCY A;  4N0A C;  1D1B A;  4RG8 A;  4M77 B;  3CCU T;  2AZS A;  4M77 G;  4XTW A;  3CCQ T;  2AK5 A;  2J7I A;  2VWF A;  2K5F A;  5AYF A;  4C5H A;  2Y4X A;  1X6G A;  2LQN A;  2RK1 A;  3M9Q A;  3PVL A;  1WDX A;  3LW5 E;  2V8J A;  5GMK e;  2AIR B;  3OYI A;  4JRP A;  1K9M C;  3H6Z A;  2FZG B;  5DM7 R;  2OJ2 A;  5FLX E;  5I22 A;  2HQE A;  3MEW A;  4C8Q C;  4M77 D;  3JB9 D;  2E5Q A;  1WHK A;  4JZ3 A;  1I1J A;  2J05 A;  3RMS A;  3CCS A;  4MMK A;  4CC2 A;  2HKQ B;  2QEX T;  2DIQ A;  3HRS A;  4L59 A;  2GGR A;  5GMK h;  3OYH A;  3M0P A;  3CBM A;  5KCO A;  2QG9 B;  5CCA A;  2AZV A;  3CD6 Q;  3CPW S;  2QAZ A;  3CME Q;  3G1J A;  2H8H A;  1ZBX A;  2CT4 A;  2DTO A;  3GNG A;  4C8Q G;  3BE3 A;  1XQH A;  1PG5 B;  2PZ1 A;  4BY6 C;  2XU8 A;  1MV0 B;  4GLK A;  2KQW A;  1SHG A;  3UF4 A;  1SRM A;  3LH5 A;  4OMQ A;  4PLL A;  4M7A E;  2FPD A;  2CSI A;  2COZ A;  1WNL A;  1GBQ A;  2A36 A;  1N5Z A;  1JEG A;  1M90 C;  1C6V X;  4AG1 C;  2DIL A;  2RA2 A;  2WSE E;  3ULR B;  1FXX A;  3TU4 K;  4C92 B;  2MMP A;  3E9F A;  4DQ2 A;  3VYH B;  5CQY A;  1XJW B;  3OSV A;  2LT4 A;  3H0H A;  1B07 A;  3PVQ A;  1VQ7 T;  3OBY A;  1K73 U;  3CC7 Q;  4ZNX A;  4WF2 A;  3CEY A;  3DB3 A;  4ATO A;  3CC2 T;  1R77 A;  1W4S A;  3UA6 A;  8ATC B;  3MET A;  2XK0 A;  1SRL A;  4FW1 A;  2YUQ A;  5GAM f;  1GFC A;  4HXJ A;  3M0Q A;  3LGL A;  4CC7 A;  5GAN 3;  2V26 A;  4PJO D;  2D6F A;  2LX7 A;  1BI3 A;  4B9X A;  4Z89 A;  1WXU A;  2QQA A;  1T3S A;  3C95 A;  4XTY A;  1ABO A;  1I0C A;  2EYZ A;  4M75 B;  2DXC A;  1YCY A;  2CZ6 B;  3CQT A;  4RTV A;  3L2W A;  1VQ8 A;  1QVG P;  3VUZ A;  2X51 A;  4HVU A;  1X2Q A;  3QXE B;  2L2P A;  2FYK A;  4OB3 B;  1G83 A;  2DNU A;  1CKB A;  2FB7 A;  4HVW A;  4ZGE B;  1K8A U;  5KYX A;  5LJ5 h;  2X3W D;  3CCJ Q;  3H9N A;  2OTL A;  4Y28 E;  3EG2 A;  1K73 R;  4R0K A;  3VS2 A;  1UTI A;  1K9M U;  1Y7X A;  5A2Q E;  2YUN A;  1UGQ B;  5FWB A;  2WSF E;  2LCS A;  1NZ9 A;  2ROL A;  4XTZ A;  1SKU B;  2JTE A;  4FIB A;  1QWE A;  3MJX A;  1RL2 A;  2EVR A;  4KH0 B;  2M0O A;  4X34 A;  1M30 A;  3GPL A;  4CRI A;  3EFO B;  1OEB A;  1D3B A;  2HZY A;  3UPU A;  4HT9 A;  1JU5 C;  3CC2 A;  1J3T A;  5FU6 C;  4FM4 B;  1QW1 A;  1C0M A;  4O5V A;  1NJI U;  3I56 Q;  1XNI A;  2SEM A;  2JNG A;  5CKH A;  2VB6 A;  2RQR A;  1V29 B;  1ABQ A;  2JMC A;  2CT3 A;  4DBH A;  1UEB A;  4M75 A;  3JCM W;  1JRI A;  3MCA B;  2PUK B;  4A63 B;  5J26 A;  4RTY A;  4HCZ A;  3CXC S;  2QTX A;  4KGZ B;  2BKD N;  1ZUY A;  2XKO C;  3LYI A;  3CCM A;  4BD3 A;  3EG9 B;  2LNV A;  1VQ5 T;  4KGX B;  5IHK A;  1VQK T;  1W2B P;  1VIF A;  4A54 A;  5GAO p;  4LDX A;  2FHD A;  2YLB A;  2PTK A;  4BUG A;  3OS2 A;  2A28 A;  3R6O A;  4C92 E;  5GAN f;  1PRM C;  1UHC A;  2DZC A;  1YJW T;  3JB9 F;  1H3H A;  4ELY C;  3RER A;  2JN0 A;  5L23 A;  5KYU B;  5C6S A;  4F16 A;  4J8O A;  4OMM A;  1NG2 A;  3I35 A;  3DLM A;  5GAO r;  1OX9 A;  2NUT B;  3LGF A;  1S72 Q;  1U1S A;  3JAM E;  4E7J A;  2CS7 A;  3EG0 A;  2DD5 A;  1M2V B;  2DM1 A;  2OAW A;  2VV5 A;  3HHT B;  3OYG A;  3GOX A;  1M1K R;  2IVW A;  3MEV A;  4JRQ A;  1F1B B;  1I8F A;  1I4K 1;  1PWT A;  1TS9 A;  1OZ2 A;  3TVT A;  3CMA T;  2KVQ G;  1VA7 A;  2JMA A;  1B34 B;  3A8L B;  4UC4 A;  3FLG A;  3A8G B;  1BI1 A;  1PHT A;  2L3P A;  4OMF B;  2MAM A;  3T9N A;  5LJ3 j;  3I55 A;  5GMK m;  3J81 E;  2CZ1 B;  1NPP A;  2YRD A;  5GAM g;  2CDT A;  4A4E A;  1CKA A;  3KXT A;  1BB9 A;  3EFR A;  2EAY A;  1PRL C;  3OB9 A;  3SWN C;  4IUQ A;  3JCM V;  1BYM A;  1W6X A;  2HCK A;  3OYK A;  3M55 A;  2R5M A;  2F2X A;  4HT8 A;  1QVG S;  2HL5 C;  1MGQ A;  1OOT A;  3PT9 A;  2DTH A;  2BZ8 A;  3CBP A;  4FL6 A;  1QCF A;  1AEY A;  4OMN A;  2DO3 A;  2EWN A;  1WI7 A;  1IGU A;  2FZK B;  4IKF A;  3A5Z B;  1IO6 A;  5D6Y A;  1YHQ T;  4PJL A;  2CP2 A;  2EQM A;  2FPF A;  1U3O A;  4BI3 A;  5KYX B;  1VQL A;  1QCO A;  2FRY A;  1WXT A;  4RCC A;  1BI2 A;  3EGX B;  1UB4 A;  2X4J A;  1VQK Q;  3P8D A;  2DRM A;  2K2V A;  5IHI A;  3KUF A;  5IT9 E;  1EIF A;  2E65 A;  2YUP A;  1YJN A;  1Q82 R;  2RQU A;  2B8A A;  3OYJ A;  1QVG A;  4NOY A;  2ZPG B;  5IHN A;  2K57 A;  3MPU B;  3UDC A;  2MPX C;  1K8A C;  8AT1 B;  1ZSZ C;  3REA B;  4HCK A;  3JV3 A;  2RQV A;  4IUT A;  1K8A R;  1EZZ B;  1M1K U;  3OYM A;  2EKO A;  2A37 A;  3JB9 H;  4KUL A;  1Q86 R;  2J6O A;  4LDV A;  3CCL A;  1NYG A;  3E2U A;  1M8V A;  1Y0M A;  1Q86 C;  3QPH A;  4BI8 B;  1M27 C;  1VQ8 T;  1H64 1;  3VS1 A;  1I07 A;  2K9G A;  1PSE A;  3I55 Q;  2RHI A;  4PNO A;  4R55 A;  2P0Q A;  2F2W A;  3RKW A;  1WHH A;  4OB0 B;  1WGS A;  3OYB A;  4J9B A;  3QDF A;  4RTX A;  4AMC A;  1GFD A;  1B7T A;  1E7O A;  4F17 A;  4HKE A;  5FU7 C;  1S1N A;  2K5I A;  2AHJ B;  2DEU A;  2DA9 A;  1WJQ A;  1YIJ T;  1JO8 A;  1WHJ A;  3VYG A;  3CCR A;  1N6A A;  3G7Z A;  1MMD A;  2ZPF B;  3G6E Q;  3MP6 A;  1W2B A;  4MZP A;  1JB0 E;  3I56 A;  2RI2 A;  2YRV A;  5LL6 S;  2DRK A;  5GMK l;  4TVR A;  3QSU A;  2VGN A;  3D7S B;  1Q81 C;  1PNJ A;  3H0I A;  2O4X B;  2DFU A;  1G3W A;  2DZ9 A;  2AT1 B;  3HFN A;  4RTW A;  1R8O B;  2HKN A;  2CP5 A;  2DXB A;  2VKN A;  4F7U A;  4Q5W A;  4M7D B;  3HL8 A;  2EJF A;  3AT1 B;  4M4Z A;  4FSS A;  2JOY A;  3LLR A;  3G6E T;  1FMW A;  1FMV A;  1X69 A;  1AWW A;  2BIV A;  1QP3 A;  2KRO A;  4IIO A;  4K11 A;  4YTL A;  1UG1 A;  2Y90 A;  2RMO A;  1YJN Q;  1MMA A;  4M7A D;  3L2V A;  3CCL T;  2MWP A;  2M9U A;  1T3L A;  2F5K A;  4F7U G;  1OX8 A;  3GP8 A;  2XID A;  2EJG A;  2E6Z A;  1G8X A;  3M54 A;  4QT7 A;  4IUU A;  2ECZ A;  4M77 C;  1IHV A;  2NLU A;  4M7D G;  3JCM e;  1PC0 A;  1UDL A;  4M77 F;  1WQW A;  4QVZ A;  3L1A A;  2PUO B;  1NLP C;  3CC2 Q;  2J06 A;  4C8Q F;  1D0Y A;  4B6M A;  3EAE A;  4E7L A;  4FU6 A;  1VQ7 A;  4PJO F;  2RI5 A;  4D8K A;  1ZBJ A;  2A08 A;  3HPW A;  4FW2 A;  1K0X A;  3UT1 A;  2DET A;  5KE2 A;  2GTO A;  1M3A A;  3I56 T;  3JCM d;  4M78 D;  2PVD B;  2R57 A;  2JJ9 A;  1PD0 A;  2YXY A;  3PMI A;  4LDW A;  5GAN 6;  4ZN3 A;  1TUD A;  4HCB A;  4M7D A;  1QKW A;  4PJM A;  1I81 A;  5GAO l;  1X6B A;  1M1G A;  5HY6 A;  1OI1 A;  3CCJ A;  3C0C A;  2GFA A;  3EFS A;  3L2U A;  5GAN g;  2ZAE A;  5FRN A;  4GY5 A;  5GAN 5;  2EBP A;  2CKK A;  2I0N A;  4WCI A;  1E6H A;  3OY9 A;  2DMO A;  2DEQ A;  2FO0 A;  5FU6 B;  2J6F A;  3OQ5 A;  5LJ5 j;  1KD1 U;  3BY7 A;  2HQH A;  2MCN A;  2KAF A;  1S72 A;  4KGV B;  4J9H A;  2IIM A;  2DBK A;  3KFV A;  1OU9 A;  2FZC B;  2MWO A;  2O4X A;  4AFU C;  4L5G A;  1N27 A;  4J7I A;  5GAN h;  1BIA A;  2MOX A;  3SEM A;  2RM4 A;  2RHY A;  1WJR A;  1SSH A;  2VC8 A;  4JLG A;  2KK4 A;  1YFN A;  2XHC A;  3RIR A;  3WXM B;  4JRI A;  5GAO m;  3A8O B;  3NFC A;  4M7A B;  4ZTF A;  4Z02 A;  3O5Z A;  3CMA Q;  3CCR Q;  4CI0 C;  3WVD B;  3OBW A;  2LT1 A;  1VQN Q;  1TG0 A;  1PKT A;  5CKF A;  5CKE A;  1VQN A;  2VXF A;  4MZM A;  3OW2 S;  3JB9 J;  4A4H A;  2X3X D;  2BTT A;  1U06 A;  2GFU A;  1RAH B;  2K2M A;  4Y92 A;  4XAX B;  2E1H A;  4PFZ A;  1JXO A;  2CYZ B;  4JS5 A;  3CCM T;  4QQG A;  3L2R A;  4LUD A;  1VQ5 A;  3JB9 G;  1LCK A;  1AVZ C;  2CP3 A;  2ENM A;  3P8B B;  4J9C A;  3QHS A;  1WZO A;  3EG1 A;  1WHL A;  1GCP A;  4ZTJ A;  1VQ7 Q;  2PNI A;  4FYX B;  1LNX A;  3REB B;  7AT1 B;  1Y96 B;  5KYY B;  1YWO A;  4OB2 B;  3RR6 A;  2MYS A;  4MDW A;  1PM3 A;  3X25 B;  1Z9Q A;  2NUT A;  4M7A C;  1D0X A;  3MHX A;  3CCR T;  3VS3 A;  1WX6 A;  2C06 A;  2EGC A;  2GQV A;  4LDY A;  3V8J A;  4DA4 A;  4M75 G;  1PKS A;  4EMK B;  4V2S A;  1RAF B;  4BDY A;  3M5A A;  3OYL A;  2RHZ A;  2QEX Q;  3VU3 C;  1BU1 A;  2W10 A;  1IXD A;  2KSS A;  3CCE Q;  2LC4 A;  2RJC A;  2ROT A;  1HXD A;  3G4S A;  3PIP A;  2KEA A;  5GAN 4;  1O9S A;  3SFM A;  4E6R A;  3FC3 A;  4M78 F;  4C92 D;  3BDU A;  3ASK A;  1RI0 A;  1HD3 A;  3PNW C;  2L89 A;  1YP5 A;  4KBM B;  1Q82 U;  2V8I A;  3KBG A;  1TWB A;  4AFS C;  4JJN K;  1AT1 B;  2LJ0 A;  4HCC A;  3QKJ A;  5KYU A;  5A0L A;  1VYT A;  5HK0 A;  4AT1 B;  2DL8 A;  3PE0 A;  3EGD A;  3SB2 A;  1MMN A;  3M57 A;  2RF0 A;  1AHJ B;  1Q95 G;  4LN2 A;  1LOJ A;  5LJ5 g;  1WHM A;  3LWI A;  4E7Z A;  3FDR A;  3TRE A;  2BUD A;  3VJP A;  2SRC A;  1NJI C;  1SSF A;  2G3R A;  5DLO A;  3QYG B;  5GAN d;  4QKU A;  2XDB A;  2HL3 A;  5CKD A;  2PU9 B;  3VS0 A;  1KQ2 A;  3TQ7 P;  1ZQ1 A;  2LTO A;  3NTI A; 
#chains in the Genus database with same CATH homology
 3M53 A;  1MGQ A;  3QBY A;  2RK2 A;  3PT9 A;  1BKB A;  1LJO A;  2DTH A;  3CBP A;  1I5L A;  4FL6 A;  3ZBD A;  5GMK j;  5LJ5 e;  3RES A;  4M7A F;  4PJO C;  3C4S A;  2DO3 A;  2EWN A;  3FRN A;  2H3J A;  2ZZD A;  1UGR B;  3CD6 T;  3NTK A;  4IKF A;  3A5Z B;  3CCU A;  4OGE A;  5D6Y A;  3SWN A;  5CAI A;  1YHQ T;  3G71 A;  4F7U E;  1KHC A;  2EQM A;  4A4G A;  2QXF A;  3E1S A;  3MP1 A;  3QO3 A;  4J7F A;  2OTJ A;  2ZPI B;  4A4K A;  4BI3 A;  3JCM b;  1VQL A;  4BAC A;  4FSX A;  4MDX A;  2LCL A;  2HBP A;  4J6X A;  3VV0 A;  4C0D C;  5C0M A;  1U8R A;  5CK9 A;  3RKY A;  2DVE A;  3CD6 A;  3G4S T;  2MI6 A;  1VQ4 A;  4RCC A;  1BI2 A;  1KHI A;  1UB4 A;  5KCH A;  2X4J A;  2X4X A;  3UWN A;  1YI2 T;  3URG A;  3X24 B;  5HK3 A;  3P8D A;  4XQ3 A;  2K2V A;  3AHU A;  5FRM A;  1UGS B;  3KUF A;  5IT9 E;  1EIF A;  2E65 A;  3HFO A;  4M75 F;  1N9R A;  2E41 A;  2E64 A;  4QVD A;  2GF7 A;  3S6W A;  4XU2 A;  1YJN A;  2CGH A;  2P4T A;  2B8A A;  3ZFJ A;  3OYJ A;  1VQL T;  1B34 A;  1YBY A;  3HP9 A;  3MEA A;  4NOY A;  3M4Y A;  3M56 A;  2ZPG B;  3SD4 A;  4ZN1 A;  3SDZ A;  2K57 A;  4JS4 A;  2EFI A;  3OS1 A;  3LWH A;  5CR2 A;  3OW2 A;  1M1F A;  2CZ7 B;  3MP8 A;  3UDC A;  1VQ9 T;  1M9S A;  1Y07 A;  4LDU A;  3JCM h;  3JCM c;  1K8A C;  4IUV A;  1Q7Y C;  4J5Y A;  1JJ2 A;  1VQK A;  3FJP A;  3CCE A;  4M77 E;  1M1K C;  2X4W A;  4E47 A;  1QP2 A;  3BFM A;  3OS0 A;  5DY9 A;  4IUT A;  4C8Q B;  2QEX A;  3S3M A;  1M1K U;  1Q81 U;  4C8Q E;  3OYM A;  2EKO A;  3JB9 H;  4KUL A;  4DOV A;  2RB6 A;  2RO0 A;  4N0A A;  1IRE B;  2DD4 A;  4LDV A;  3CCL A;  5GAO q;  3QG1 A;  4QQ6 A;  1G3S A;  1M8V A;  1Q86 C;  3GIB A;  3QPH A;  4BI8 B;  3N5B B;  1VQ8 T;  5CQX A;  4M77 A;  2RHU A;  5CKB A;  5GAM j;  1OZ3 A;  1H64 1;  3WVE B;  4C8Q D;  3QUI A;  2ZPH B;  3X28 B;  3GF5 A;  3BW1 A;  1PSE A;  2K3Y A;  2LDM A;  2RHI A;  4J6Y A;  4PNO A;  2P0Q A;  4MZT A;  4XTV A;  4R55 A;  1YIJ A;  3X26 B;  3RKW A;  2D0Q B;  4PLI A;  4NL2 A;  4OB0 B;  1WGS A;  1DJ7 B;  2LRQ A;  1X6O A;  4VUB A;  3OYB A;  2YHT A;  4OB1 B;  3GLX A;  2OTJ T;  3QJY A;  3TEE A;  2LX9 A;  2HNI A;  1QVF S;  1VUB A;  4HKE A;  3BDL A;  2RD1 A;  5FU7 C;  2K5I A;  2AHJ B;  4EMG A;  1VQ6 A;  1M5Q 1;  1BI0 A;  1WJQ A;  1ZHI A;  1YIJ T;  3V8L A;  1K73 C;  4JDS A;  4RCB A;  4NL3 A;  2VXE A;  2E70 A;  3VYG A;  4F7U B;  1N6A A;  4A53 A;  3QZ5 B;  3CCR A;  4PJO G;  3JCM P;  3G7Z A;  4XTX A;  2ZPF B;  4C92 C;  4KUD K;  4N0A C;  2R5A A;  4X9C A;  4RG8 A;  4M77 B;  4EMK C;  3OYY A;  3CCU T;  4JLI A;  2JTM A;  4M77 G;  3MP6 A;  1W2B A;  4MZP A;  1JB0 E;  3DB4 A;  1M4Z A;  3I56 A;  1Q7Y U;  1JJ2 S;  4XTW A;  2RI2 A;  2YRV A;  1OYX A;  5LL6 S;  5GMK l;  3CCQ T;  1N9S A;  2M1H A;  4M7D F;  4TVR A;  3QSU A;  2RJE A;  3GNF B;  2VGN A;  5D6W A;  2K5F A;  5AYF A;  1Q81 C;  1BIB A;  4C5H A;  3OYN A;  2O4X B;  2LQK A;  3MEU A;  4M78 E;  2Y4X A;  1G3W A;  4OF1 A;  2DZ9 A;  3OYE A;  3HKS A;  2RK1 A;  1NE8 A;  3HFN A;  3M9Q A;  2DTI A;  3S3N A;  3LW5 E;  5LJ3 f;  3ZEH A;  1R8O B;  2V8J A;  5GMK e;  3I55 T;  3OYI A;  4JRP A;  1YI2 A;  4QVC A;  1K9M C;  3H6Z A;  5GAO n;  3QYH B;  4EDU A;  1KQ1 A;  5DM7 R;  2JUF A;  2DXB A;  3CC7 T;  4F7U A;  5FLX E;  2OTL T;  4Q5W A;  5CIU A;  4M7D B;  3HL8 A;  2EJF A;  4PJO A;  2HQE A;  2K4Y A;  2DIG A;  2JOY A;  3LLR A;  3G6E T;  4C8Q A;  3MEW A;  4B9W A;  2F5T X;  2PQW A;  4C8Q C;  4M77 D;  1VQ9 A;  3JB9 D;  5A0G A;  2RJF A;  2E5Q A;  4D6W A;  3RMS A;  2BIV A;  3CCS A;  4PJO E;  3JCM Q;  2XDD A;  1QP3 A;  1IZ6 A;  2DXU A;  1G5V A;  3FB9 A;  5IAY A;  4MMK A;  2QEX T;  3RUX A;  1YJ9 T;  5GAM d;  1VQP T;  3CC4 A;  4YTL A;  2DIQ A;  2ZPE B;  3HRS A;  4L59 A;  5GAN j;  5I2S A;  2XI9 A;  1NPR A;  2Y90 A;  5EG2 A;  4M7A D;  3L2V A;  3CCL T;  2MWP A;  4C0G A;  5GMK h;  3OYH A;  2M9U A;  2F5K A;  2KY9 A;  3CBM A;  3INZ A;  4F7U G;  5KCO A;  3CCS T;  4C0Z A;  1YIT T;  5CCA A;  3HSB A;  1U1T A;  3OSS C;  3GP8 A;  2XID A;  3VUB A;  2EJG A;  3CPW S;  1X01 A;  2E6Z A;  2HQX A;  1ZBX A;  4N4G A;  4RMO A;  3GNG A;  2DTO A;  3PMT A;  4C8Q G;  1KC8 C;  1W2B S;  1XQH A;  3M54 A;  4EMK A;  5GAN 8;  4IUU A;  4BY6 C;  4PL6 A;  2HAX A;  2XU8 A;  4M77 C;  5LJ5 f;  5GMK i;  3QII A;  4GLK A;  2KQW A;  3C94 A;  3TCJ A;  2NLU A;  4M7D G;  3JCM e;  4IUP A;  1VQM T;  4M77 F;  1WQW A;  4PLL A;  4QVZ A;  4M7A E;  3L1A A;  3RMQ A;  2PUO B;  2XIC A;  3OYC A;  4C8Q F;  3OA6 A;  1YJN T;  1P92 A;  1WNL A;  2EQK A;  3EAE A;  4FU6 A;  4E7L A;  1VQ7 A;  2E12 A;  4ME7 A;  4PJO F;  2RI5 A;  1PSF A;  4M75 D;  2QQR A;  1M90 C;  2WSE E;  2RA2 A;  3HPW A;  3J80 E;  4F7U F;  1FXX A;  3CXC A;  3UT1 A;  3TU4 K;  3L2Z A;  3HRT A;  5KE2 A;  3PFS A;  2ZGW A;  2MMP A;  3E9F A;  4C92 B;  3VYH B;  4DQ2 A;  5CQY A;  2EQU A;  3OMC A;  3I56 T;  3JCM d;  3OSV A;  3CCJ T;  2LT4 A;  4M78 D;  1FX7 A;  2PVD B;  2R57 A;  1GXI E;  2VUB A;  1VQ7 T;  2RJD A;  3V7R A;  3OBY A;  1K73 U;  4BE0 A;  5FU7 B;  3C12 A;  3PMI A;  4LDW A;  5GAN 6;  4ZN3 A;  2LCC A;  1VQ4 T;  4HCB A;  4M7D A;  4WF2 A;  3CEY A;  3JSC A;  3PGG A;  1I81 A;  5GAO l;  4XK8 E;  3DB3 A;  1KC8 U;  4M75 E;  4MML A;  3CC2 T;  1M1G A;  1W4S A;  4ATO A;  1HK9 A;  2ZCF B;  5HY6 A;  3MET A;  1OI1 A;  2XK0 A;  2Y4Y A;  3CCJ A;  2R58 A;  3CCV T;  2XG8 D;  4M75 C;  5GAM f;  2EQJ A;  2GFA A;  2QQS A;  3EFS A;  3L2U A;  4QW2 A;  5GAN g;  4RKU E;  1N8R U;  3LGL A;  3V7C A;  5GAN 3;  3NTH A;  1S72 T;  5FRN A;  2LQ8 A;  4PJO D;  4GY5 A;  2YLC A;  3JB9 I;  2D6F A;  5GAN 5;  1BI3 A;  2E6N A;  2CKK A;  4B9X A;  3JRZ A;  5DLQ E;  3OY9 A;  2DEQ A;  5FU6 B;  2QQA A;  3OQ5 A;  3Q1J A;  3CCV A;  5LJ5 j;  2OAU A;  1KD1 U;  3BY7 A;  3C95 A;  3FIF A;  4XTY A;  2JVV A;  2K3X A;  4HA8 A;  2KAF A;  1Y71 A;  5LJ5 d;  4M75 B;  5D6X A;  1S72 A;  2DXC A;  2EYQ A;  1H3Z A;  3MO8 A;  3OYA A;  5LJ3 d;  3OS5 A;  4M78 C;  1YCY A;  3CMA A;  3OMG A;  1VQO A;  5A0D A;  3LH0 A;  2CZ6 B;  1MHN A;  5GAN e;  3QDR B;  3L2W A;  3JCM J;  1VQ8 A;  3J7A F;  4BE1 A;  2MWO A;  2EJ9 A;  2O4X A;  2I2L A;  4L5G A;  1N27 A;  4J7I A;  5GAN h;  1BIA A;  3V7S A;  1QVG A;  3L42 A;  3VUZ A;  2RHX A;  4ELZ C;  2P0K A;  2RM4 A;  2RHY A;  3QXE B;  1WJR A;  2DPP B;  4JUV A;  1X75 C;  2DAQ A;  2FYK A;  4OB3 B;  4BDZ A;  4R56 A;  2VC8 A;  4JLG A;  2DXT A;  2FB7 A;  2DJZ A;  2KK4 A;  4XU1 A;  1D3B B;  4ZGE B;  5LJ5 h;  1VQM A;  1K8A U;  2XHC A;  4LD9 K;  4PJO B;  4OP0 A;  3CC7 A;  3RIR A;  3WXM B;  3M59 A;  4JRI A;  4XU0 A;  5GAO m;  1QVP A;  2OTL A;  3A8O B;  4Y28 E;  2WAC A;  3NFC A;  4M7A B;  4ZTF A;  2F69 A;  4Z02 A;  4DOW A;  2QDY B;  2E10 A;  1VQN T;  1K9M U;  1Y7X A;  2ZPB B;  5A2Q E;  1UGQ B;  1WPY A;  5I21 A;  1Q86 U;  2WSF E;  2XD0 A;  4CI0 C;  2JZ2 A;  2L8D A;  3WVD B;  3OBW A;  2KDS A;  4M7D E;  1TH7 A;  2FVU A;  1NZ9 A;  2LT1 A;  4IUR A;  4XTZ A;  4FIB A;  4BE2 A;  3DKM A;  3CPF A;  3RKX A;  3CCQ A;  5LJ3 e;  1RL2 A;  2M0O A;  4X34 A;  3GPL A;  4BY6 B;  5I2M A;  4CRI A;  3CC4 T;  1YJ9 A;  1N8R C;  3CBO A;  1WJS A;  4J6W A;  5CKF A;  1M90 U;  5CKE A;  2D9T A;  4M78 B;  3V8K A;  1D3B A;  1VQN A;  2VXF A;  5J39 A;  2QA4 A;  4EPC A;  4C92 G;  1Q82 U;  3UPU A;  1KQS S;  4HT9 A;  2M16 A;  3CPW A;  4MZM A;  3CC2 A;  3OW2 S;  1YHQ A;  5FU6 C;  4FM4 B;  3JB9 J;  4A4H A;  3QZ9 B;  1QW1 A;  1YIT A;  2P0P A;  2RH2 A;  4RG2 A;  4Y91 A;  3A8H B;  4A4F A;  3SWN B;  1UGP B;  3VKI A;  4O5V A;  2GFU A;  4C92 F;  2K5L A;  3CME A;  1NJI U;  4P5N A;  4XAX B;  1XNI A;  5CKH A;  2JNG A;  3S3O A;  2E1H A;  2PVG B;  4O6J A;  2CYZ B;  4JS5 A;  3OYD A;  3CCM T;  4NS5 A;  1V29 B;  4X9D A;  5LJ3 g;  4QQG A;  3L2R A;  2L3R A;  1VQ5 A;  3ER0 A;  2RI3 A;  3JB9 G;  1UEB A;  4M75 A;  3JCM W;  1JRI A;  3MCA B;  5M9O A;  2L5Q A;  2PUK B;  2VGM A;  3P8B B;  5LJ3 h;  2KMT A;  5J26 A;  2FL7 A;  3ME9 A;  3DLL A;  4N4H A;  1WQ7 A;  3P8H A;  3PIO A;  3E9G A;  3E19 A;  2QTX A;  3QHS A;  4HCZ A;  3CXC S;  1Q82 C;  3M4G A;  4C0F A;  4ZTJ A;  2BKD N;  2XKO C;  3LYI A;  3CCM A;  4C92 A;  4BD3 A;  1LNX A;  2LNV A;  4N4I A;  1VQ5 T;  2X35 A;  2A3L A;  1Y96 B;  2IG0 A;  1VQK T;  4L6V 5;  3CCE T;  3H8Z A;  4JRK A;  1VIF A;  4FT4 A;  4A54 A;  5GAO p;  4E7K A;  1VQO T;  4OB2 B;  2FHD A;  2YLB A;  4LDX A;  4BUG A;  4M78 G;  4ZGD B;  3JCM f;  3OS2 A;  4MDW A;  3FEO A;  3X25 B;  2QQB A;  4QQD A;  1QVF A;  4KT0 E;  3L2Q A;  4M7A C;  3MHX A;  3CCR T;  3R6O A;  4C0D B;  1FWZ A;  4C92 E;  5GAN f;  2C06 A;  2GQV A;  4LDY A;  3V8J A;  3QJ6 A;  4DA4 A;  4M75 G;  4M7A A;  1G3T A;  2DZC A;  4II1 A;  2DK3 A;  4EMK B;  1YJW T;  3JB9 F;  4V2S A;  3G71 T;  4BDY A;  3M5A A;  3OYL A;  2RHZ A;  1KD1 C;  4ELY C;  4E7H A;  2JN0 A;  3RER A;  3JCM g;  3VU3 C;  1XTD A;  4FT2 A;  5GAN 2;  2KSS A;  1Y96 A;  4EMH A;  5C6S A;  4M7D D;  2LC4 A;  2RJC A;  3G4S A;  1HXD A;  4J8O A;  5CVI A;  3JCM X;  3PIP A;  5GAN 4;  5CO7 A;  1YJW A;  1O9S A;  3SFM A;  3DLM A;  3FC3 A;  2QI2 A;  3LX7 A;  4M78 F;  4M78 A;  3BDU A;  4C92 D;  5GAO r;  3ASK A;  4KUI A;  4ZGJ B;  2GCX A;  1VQ6 T;  1RI0 A;  3LGF A;  3PNW C;  2WSC E;  4C5G A;  2L89 A;  1KG1 A;  4KBM B;  1U1S A;  4BI4 A;  2V8I A;  3JAM E;  4E7J A;  2CS7 A;  4C5E A;  3KBG A;  2DD5 A;  3HHT B;  4C5I A;  2VV5 A;  3GOX A;  3OYG A;  3HRU A;  2IVW A;  3MEV A;  4JJN K;  4JRQ A;  1I8F A;  5GAM e;  2DKG A;  5HKC A;  4M7A G;  1I4K 1;  4PKC C;  3PTA A;  2QA4 T;  4XTU A;  1OZ2 A;  3CMA T;  2KVQ G;  1B34 B;  4HCC A;  4OGC A;  2X4Y A;  3A8L B;  3QKJ A;  3FLG A;  4UC4 A;  5A0L A;  1VIE A;  3A8G B;  2QQ9 A;  1BI1 A;  5HK0 A;  3X20 B;  5GAN 7;  3CME T;  4BB7 A;  5J3B A;  1VQP A;  2EIF A;  3SB2 A;  3M58 A;  4OMF B;  2MF2 A;  3M57 A;  2MAM A;  3T9N A;  1AHJ B;  2O01 E;  5LJ3 j;  1KQS A;  1LOJ A;  3I55 A;  5GMK m;  5LJ5 g;  3J81 E;  2A7Y A;  4LD6 A;  3A8M B;  1XOV A;  2CZ1 B;  2HD0 A;  1O75 A;  5IN1 A;  5L8R E;  1NPP A;  5KE3 A;  3LWI A;  4XU3 A;  4M7D C;  5GAM g;  1JBM A;  2V8K A;  3FDR A;  4J83 A;  2BUD A;  3TRE A;  4A4E A;  5KH6 A;  3KXT A;  3EFR A;  2EAY A;  3VJP A;  1G3Y A;  2JTF A;  3OB9 A;  3SWN C;  4IUQ A;  1NJI C;  3JCM V;  1BYM A;  3G6E A;  1SSF A;  2G3R A;  3OYK A;  5GAM h;  3M55 A;  5DLO A;  3QYG B;  5GAN d;  2R5M A;  5FRO A;  4E7I A;  2XDB A;  2PVO B;  3F70 A;  5CKD A;  2PU9 B;  4HT8 A;  1QVG S;  2LVM A;  1KQ2 A;  3O8V A;  1ZQ1 A;  3OYF A;  2XDP A;  2VYT A;  2LTO A;  3NTI A;  4OVA A;  2CZ0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...