4IUUA

Crystal structure of shh1 sawadee domain in complex with h3k9me1 peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
133
structure length
127
Chain Sequence
ADLAFEAKSARDYAWYDVSSFLTYRVLRTGELEVRVRFSGDEWVNVKTSVRERSIPVEPSECGRVNVGDLLLCFQEREQALYCDGHVLNIKRGIHDHARCNCVFLVRYELDNTEESLGLERICRRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SAWADEE HOMEODOMAIN HOMOLOG 1
publication title Polymerase IV occupancy at RNA-directed DNA methylation sites requires SHH1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
total genus 23
structure length 127
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16719 SAWADEE SAWADEE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4iuuA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iuuA01
1PDQA 1B53A 4BDZA 1WTVA 2R58A 2K01A 2B2VA 2CKKA 4XT1B 4X3UA 1O80A 3GV3A 2JYOA 3C4SA 5EKIA 2KOLA 2IG0A 2B2TA 4Q5WA 4X34A 4X3TA 2LRQA 1RJTA 2E5QA 5KH6A 1U4MA 4HEDA 3MTSA 2DIGA 3S3MA 1SSOA 1C8CA 4E7KA 2L9HA 1JE4A 2G3RA 4RA8A 3FLGA 2M16A 1KNEA 2KEEA 5AFWA 1XNIA 3H91A 1N27A 2RJFA 3LWEA 3OS1A 1F9PA 4O42A 2MWPA 3MP6A 2J7ZA 2QQRA 1BBXC 3MP8A 2B2YC 4X3SA 4X3KA 1E0BA 3LLRA 1MSHA 1XX8A 4BDYA 1U4PA 3OYMA 2QQSA 4CRIA 1J9OA 2GFAA 1RODA 2DY7A 2NLUA 4ZKCB 3L2QA 1OZ2A 1B4OA 4C5IA 4L59A 1NAPA 2HQXA 5C6SA 2B2VC 3Q1JA 4IUQA 2K04A 1G5VA 3TZDA 4QUFA 2EQJA 3OA6A 1WJRA 3EAEA 3ZEHA 4MHEA 1X3PA 3LGLA 1ZXTA 1M8AA 4CJ0B 4Z02A 4XDXA 2B2TC 3OB9A 5D6YA 4B9WA 4E7IA 2WACA 2R3ZA 1AZPA 1WJSA 3M9QA 1ILPA 1HRJA 3I90A 1ESRA 3MEUA 3LGFA 4PLIA 4R8IA 1BNZA 5CBAE 1CM9A 1PLFA 1PFBA 3FDRA 4IUTA 3L2UA 1NCVA 3OYIA 2HCCA 1WTRA 4BE2A 3OYHA 1CA6A 1JICA 4OIKA 1MI2A 1TVXA 1U4RA 5EPJA 2HDLA 2N55A 1ILQA 5C0MA 2FHDA 1B50A 3QO2A 1MSGA 3MP1A 2FMMA 1O7ZA 2BUDA 1IL8A 1WGSA 2NZ1D 5CORA 1NR4A 3P8DA 3QKJA 3GOXA 3F2UA 3MEWA 3LH0A 3OYFA 3OMCA 3I3CA 4QQDA 3OYLA 1ICWA 2L1BA 1X3QA 2IL8A 2NWGA 4R9WA 5EPLA 3R93A 1WD1A 1MGSA 1IKLA 5T1GA 2M0OA 1G2SA 3N52A 3TN2A 4OVAA 2X4WA 1EL0A 1WTWA 2HDMA 2EE1A 2BDNA 4IUVA 2P0KA 3LYIA 4N4GA 2LTOA 2KEDA 2RVLA 2YRVA 1QE6A 4DN4M 4C5HA 2R5AA 3OS2A 2RJEA 3PFSA 3OYEA 2KUMA 4ZAIA 2X69A 2O4XB 3Q6SA 3PNWC 4A4EA 2K3XA 2K05A 1AP0A 5KCHA 1RTOA 3QIIA 4MN3A 1CA5A 3PMTA 1B2TA 1G6ZA 4EDUA 3OYJA 1EQTA 4ZKBB 1HUMA 1VMCA 2EQMA 1AZQA 2VYTA 2X4XA 3FEOA 3F70A 4QQGA 3I91A 4PLLA 1DOKA 4RAUC 3NTIA 1H3ZA 4XT3B 3DEPA 1WVLA 1X32A 3MWYW 1HHVA 4ZLTF 2B2UC 2RJCA 3CEYA 3E9FA 2VXWA 5D14A 3QJ6A 4FU6A 4A4FA 4A4GA 1PFNA 3DB4A 3OMGA 5KE2A 1WTPA 1DOLA 2X35A 1HFGA 2EFIA 3UI2A 4N4IA 1KHCA 2KVMA 2BIVA 4NS5A 1EIGA 4QVZA 1VMPA 1F9QA 2JTFA 3E9GA 4A4HA 4II1A 4N4HA 5JJZA 3SD4A 2RI5A 2RO0A 2HUGA 2RI2A 2RSOA 4IUUA 3IFDA 4BACA 3FC3A 5J26A 3S3OA 2FFKB 3QBYA 3P7JA 2H1EA 1G2TA 3DLMA 2HQEA 3MEAA 4GY5A 1WTOA 3D6WA 1BF4A 4BD3A 1G91A 5FRMA 4E7LA 1RI0A 1A15A 3IL8A 2K3YA 5FRNA 2K03A 3OYAA 3GV6A 5D65A 1MHNA 1BO0A 1OI1A 2RHZA 2RHXA 3OY9A 4E7HA 5E4XA 3MEVA 1WD0A 1PFMA 3L2WA 5CIUA 2X4YA 1DOMA 1OZ3A 2D9TA 3OQ5A 3S3NA 1EOTA 2L4NA 2N88A 2RA4A 1LV9A 4BE0A 1S4ZA 2XDPA 5T1IA 2O4XA 3L2RA 3OYBA 1U4LA 5CBEE 4UAIA 5D6XA 5M9OA 3OYDA 1WTQA 2PQWA 3OYCA 1HUNA 3L42A 2L8DA 4ZTFA 4CJ2C 3DM1A 5CMDA 3DEOA 1QG7A 1EIHA 5FROA 2R57A 3KUFA 5DNFA 3OYNA 2X6GA 1OYXA 4HCZA 5IN1A 3OYGA 1DZ1A 2L89A 2FJ2A 2RHYA 1SAPA 2EPBA 2FHTA 1HA6A 2RI3A 2Q8TA 3KUPA 4E7JA 3G7LA 1B3AA 4LMQD 2B8AA 2RJDA 2CVRA 4NW2A 4IURA 3UWNA 2RSNA 3H6ZA 2K28A 1F2LA 3P8HA 2X6LA 2EKOA 1KNAA 2KECA 2Q8RE 2D9UA 5EQ0A 4LD6A 4RWSC 3META 1F9RA 4OIJA 2GF7A 4B9XA 2HCIA 4RG2A 4C5EA 3H8ZA 5KE3A 2MPMA 1O7YA 3KBXA 3DB3A 2B2WA 5COYA 2MJ8A 1DONA 3O8VA 2RHUA 2JZ2A 2LDMA 3PMIA 2BKDN 2F5KA 2K1BA 4FL6A 2LCCA 2XK0A 4IKFA 4QQ6A 2EQUA 4HAEA 4UC4A 4ZTJA 5E4WC 2GFUA 3LX7A 1IKMA 3NTKA 2DIQA 2JP1A 3S6WA 2EQKA 2M1HA 1RHPA 2EOTA 4BE1A 3FPUB 2M2LA 5D6WA 1SDFA 5J39A 2MP1A 1XYIA 4HSVA 1SSFA 2FINB 1GUWA 4C5GA 4PL6A 4QW2A 3OS0A 2E6NA 2L3RA 3MO8A 1ML0D 4HCSA 1QNKA 1NR2A 1J8IA 4U68A 2L12A 3I8ZA 3BDLA 1RTNA 5IAYA 4QUCA 2MGSA 1WTXA 2L11A 5EPKA 4CJ1B 2XIWA 2RHIA 2SDFA 2LVMA 2B2YA 3ONAB 3ASKA 3SVMA 3HP3A 1F9SA 2B2WC 2MWOA 3FDTA 2R5MA 5KCOA 1WJQA 3NTHA 1HFNA 4IUPA 3OYKA 3L2VA 2NYZD 3ME9A 4ZK9B 3UT1A 1Q3LA 2B2UA 2DAQA 2DY8A 5EJWA
chains in the Genus database with same CATH superfamily
1ZSZC 2NVTH 1S5CD 4YHHL 2KRMA 1UJ0A 4GNXA 2R58A 5J1ZA 4PQXA 1PH3A 3H3VH 4RTYA 4XT1B 5L23A 5IXFA 3GV3A 3BY7A 1E7ZA 4BXXH 1D5ZC 2IG0A 2ZCFB 4EMKC 1HR0L 4JS5A 3CMEQ 4R1JA 2R93G 4BI8B 3A98A 2JMAA 2B2TA 4LUEA 1KC8U 3BW1A 1EQRA 1KK7A 3PUYA 4CKCA 2JA5H 2YU9H 2C0TA 2YT6A 4MMKA 5FWBA 4PFOA 2DYIA 1RJTA 1Z9ZA 2HKNA 2JK8A 1LLRD 1D5XC 1VCIA 3M54A 1SNOA 1EU4A 2O01E 4DEYA 2ZPIB 3HOVH 4FCYA 3JB9D 3CD6T 4R55A 2ZGWA 1AWWA 3GLXA 2NUPB 3CCRA 3KDFA 3D7SB 2PQAB 2DETA 4KULA 2DTOA 1SSHA 3F1ZA 4RA8A 1VIEA 4RTXA 1SNDA 5I9PA 3H91A 4NP5A 1IYVA 1K76A 2NVYH 3GTLB 2WV6D 2RCNA 2XMFA 4ZQ3A 1E24A 2WKDA 2MWPA 5ELDA 2LJ0A 5LJ5h 1Q7YR 1S72A 3S2HB 5LJ3d 1HR0Q 1F1BB 4M7AD 2JTEA 1UGPB 3D8GA 2EQIA 4X3SA 3TZUA 2VGMA 2OCEA 4L5SA 2E4HA 1P8LA 4A76A 2XKOC 1FX7A 4BDYA 4OB1B 2V26A 3JCMb 1J9OA 2OTLT 2D0OA 4XQ3A 3H94A 2GFAA 2N8NA 4RKBA 2BOSA 5GMKj 1KRSA 3G7ZA 2VUBA 3QDFA 4LF5L 4C0DB 3AU7A 3BVGA 1VQ5T 2TMPA 4J83A 1VQLT 2O31A 1VQNQ 4IFDJ 1BI3A 2E10A 3CCMA 1TWHB 1VQFA 2KR3A 2LJ1A 3RDVA 1TU2B 2XGTA 2X4JA 2KXCA 4GNXC 3CC4A 1KJWA 4A4KA 2X51A 2FPDA 2DERA 5JOBA 4IUQA 3NFCA 2J4XA 2KNBB 2E65A 1ET9A 4AT1B 1I0CA 4DGZA 5M5WH 2B63G 2CW0D 1Y07A 3H0IA 4JZ3A 1ENAA 4IJHA 1JJCB 2NVQB 1YN8A 1PA6A 2LJ3A 5M5XB 4LDVA 2B2TC 3QDRB 4A93B 3S1RH 1PH2A 3ITPA 3R8BA 5C4XH 5IYBH 4FYDA 4MZ9A 4B3TL 4P2CB 4FF4A 3S1QH 4PV1C 1AZPA 1BCOA 2RM4A 2DGYA 3PIPA 5IGBA 2EZVA 2CHBD 2E2HH 1YEZA 3I90A 3K80C 1HRJA 4V190 4F7XA 4RFBA 3PE0A 1MV3A 1YNNC 2EYJA 4R8IA 4M7DG 2WAQE 3GD7A 2EYMA 4DEXA 2NUZA 2XWJB 2FO0A 1RI9A 4FYXB 1GUTA 1PFBA 3FDRA 1EY9A 1PLFA 3GTMH 2K52A 3L2UA 4JRIA 3V7SA 3OYIA 3HG9A 4F7UE 4N8X1 3W1BA 5M5YH 2EYPA 1TWFB 5KYYB 3J80c 4A3KB 2N78A 2MAMA 2DZCA 3A8MB 1TVXA 2QILA 5CQYA 2K5WA 3CBPA 3TEHB 5LJ5f 4B3TQ 2N55A 5C0MA 5ECAA 4E6IA 4FF1A 3ERQA 1RLQC 1O7ZA 2K6AA 1IL8A 3I56T 4C2MB 2NZ1D 1BCMA 1BYMA 3A74A 2O5IC 3F2UA 3P20A 1SE2A 4L8JA 1YCYA 3LH0A 1UGSB 2N49A 4LNPA 1LPLA 3OYFA 2E2DC 3T1HL 5FLXL 2A69C 4IFDI 3GDEA 4I7AA 3I3CA 1VQ8A 4QQDA 2K57A 4EQ5A 2LY7A 2F0QA 2R92G 1VQMQ 3HOWH 1G3WA 3K5MA 1PM3A 3EG0A 1MMNA 4F7UA 2BE7D 2QDYB 4XTWA 2CP5A 2C06A 2DK3A 2HIXA 4DAYA 2F4VL 2O5JC 1ABOA 3TU4K 1X27A 2PQAA 3GQBA 3R93A 3CMAT 2K5HA 2R93H 4FW2A 1L0YB 1IBLQ 4F7UF 5T1GA 3BZKA 1G2SA 4GN4B 4Q0FA 2AKKA 2LFNA 4A75A 1PZJD 4K8JA 3VUBA 1TY0A 1EEFD 1WFQA 5GMKl 3W1GA 2X4WA 2NN6I 3K5NA 2KY9A 5G3LD 5IP9G 5ELEA 3EG1A 2KVQG 1K73U 3SK5A 2KHJA 3HZXA 3H15A 1ASZA 2DNCA 2XTIA 5FJ8G 4DV4L 3T1HQ 4B3SL 1VQDA 2LTOA 2KEDA 3CAMA 3ULRB 3U9SA 3HOXG 3I4MB 5CKDA 1X43A 2DX1A 2XWBB 3NQTA 2YRVA 5C44G 4MZMA 2ZXPA 2F0TA 1BQQT 2R5AA 4ZNXA 2R7FA 1VYTA 1EU3A 1FNVA 3OS2A 4XTCS 4BWGB 2YXYA 3OYEA 2KUMA 2OT2A 3L0OA 4ZAIA 2OF1A 3PNWC 1Y1WG 1ZBXA 4ULLA 2K05A 2D0QB 2ATCB 1AP0A 3A8OB 1OV3A 1YITA 5IODA 5FLXE 4KH1B 1VQ4Q 4LD9K 1BBWA 2A3LA 3G6JB 3PMTA 2EW3A 5IGEA 3KLRA 4LK1C 4LFCL 4EDUA 1VQ7A 2HQLA 3AFQA 2P5ZX 1KQSP 1N6AA 1RABB 2FPFA 3X25B 5K36G 5GAMe 4B3SQ 3JB9G 1BCPD 4G57A 4ZN1A 1QVCA 4RAUC 1G8ZD 1YP5A 4RKUE 4F16A 4KGZB 2BDOA 1OEBA 3JCMh 1X32A 1Q82R 4MTNA 5LL6X 2ESWA 3JRZA 4DV2L 2B2UC 1TXQA 1I50H 4C1NI 3O5ZA 3JSCA 1KQSA 1XWEA 1VQKQ 4K2KA 4J15A 2DTIA 2DXUA 3GNFB 3E9FA 1JWUD 4M7AG 3L2ZA 3QJ6A 2F0KA 5IP7G 4NL3A 1JWSD 4A4GA 3M58A 3GTPH 3OMGA 1TWAB 2KE9A 2ZJPA 1WTPA 1KQ1A 1VQPA 2E70A 1N32L 1GKHA 1TSFA 1LTID 2X35A 3T51B 4GKJL 1B9NA 2SEBD 1RAEB 1Y1VG 1NM7A 3CCUT 2XVSA 1PTOD 5C5MA 2QA4T 3VR3A 5BR8L 3KFVA 5KYXB 2A37A 2DKGA 1TS2A 5KYWA 2B8GA 5IXBA 1LTLA 3C3LA 4F87A 5LJ3j 4IOAA 4QVZA 1LYLA 1EWHA 2I0NA 1VMPA 3SHLA 4TQUS 1NBWA 2Q2TA 4F14A 4F17A 5TSSA 3I4NG 3RZOB 4A4HA 4II1A 4DV2Q 1GOZA 3EGXA 3PQIA 4A3DB 1ZUUA 2EY6A 4H7BA 1MMDA 1S5FD 5EBCA 4P74A 2LT1A 3JV3A 2YUQA 5IGGA 4AYBB 2X3XD 2RSOA 3IFDA 3HOUH 3GTJB 4PJMA 3S3OA 1HNZL 3RESA 2G6FX 1G2TA 4P5NA 2P84A 4UY8C 4FIBA 2YTXA 2YU9B 1TWCH 4ORZA 4FM4B 1WTOA 1N8RU 4GKJQ 1WHKA 4JZ4A 1LVKA 5BR8Q 3U58A 1WA7A 3S14H 1C1AA 2EJGA 4E7LA 1QCFA 2K03A 1BI1A 5GANd 5IYCG 3ICEA 3E5SA 3GV6A 4CKEA 3HS0C 2R92B 5M3MH 2IVWA 5CKBA 3UF4A 4OEMB 3VR6A 2FG0A 2N3SA 1MHNA 3D3RA 1OI1A 2RHZA 2RH2A 2XG8D 1JOKA 1O7LA 5KEEA 3C1FA 1Q1EA 4ABNA 3CKIB 4E7HA 2M02A 2O2OA 3P75A 2HD0A 5HK0A 4LAAA 2COWA 1Z9QA 4C92D 1MD2D 5LJ5g 2EQSA 4JRKA 3KJOA 4JBKA 1Q90A 1YHQQ 5KYUB 3RMQA 1OZ3A 3JCMf 3C95A 4GLVB 3CCLT 1W6JA 1HNZQ 1BU1A 1YCSB 4A3JG 3CCET 1MHWC 1EOTA 4IOCA 4QGUA 5C3WA 2L4NA 2N88A 1OX8A 3DLLA 5LMNQ 1P92A 2FL7A 1LV9A 3HFNA 4BE0A 3PUVA 2RQRA 3HRZC 4AFUC 1CUKA 1QNUA 5T1IA 3VA7A 1DXMA 1U4LA 3CCJA 2Q8IB 5CBEE 4N9TA 1TS9A 2VXEA 3OW2P 3THKA 3OTOL 2D62A 1C8CA 4D6WA 2IX0A 2OTLQ 5IP9H 4BI3A 1Z6HA 4JVZA 4DNRB 1PH9A 4X64Q 3OYCA 5FJ8H 1DJ7B 3M57A 1HUNA 3HOXH 1FWZA 5CKEA 2UUAL 1HYOA 1VUBA 1I4RA 3OWFA 2RQWA 3I55A 5C44H 1LTAD 1K8MA 1VQLQ 4KK7A 3UDGA 2F0PA 4IPCA 3S2DH 1Q86C 1N9WA 3PO2G 5GAOn 2OX7A 4O5VA 3OW2A 2VB3X 5GQOA 1Y1WH 3TEEA 4GN3B 2F0JA 2IWHA 1Y8OB 2HSEB 2HMAA 2ENMA 3OYNA 1SRLA 2RHSB 5A0GA 1EY7A 1LTSD 2X6GA 2Z6BA 2EYXA 5IN1A 3OYGA 4EQOA 2EJFA 3CD6A 3S1NH 5HURA 3V7RA 4HT9A 1HA5A 4AYBE 2KBTA 2CH4A 2RHYA 3DM3A 1K8OA 1U5SA 2CSIA 2LNVA 3V8LA 3K8AA 3PO3B 2FHTA 2EJGC 5DAUA 2ZT9C 5K36H 1H8KA 3JB9H 1EIYB 2R7ZG 6AT1B 1SXTA 2F0NA 1B3AA 3G7LA 3NE5B 4DK1A 5IWAQ 2UUAQ 3EFRA 2L3SA 2RJDA 1NJIR 4J6WA 1PFSA 2K4KA 2SNMA 4NW2A 3X24B 3E9IA 2EYOA 3OSOA 3C46A 1W2BP 4M7DA 3OHXC 4RH6A 3J80i 5LMNW 4R8NA 2BA0A 1K28A 3EROA 3TS0A 3CXCS 1F2LA 1UE5A 2RK1A 4D8DA 2VC8A 2KRSA 1FJGL 2FEIA 3UDFA 3RD4A 4PJLA 2CQAA 5CK9A 3IFTA 5IP7H 5EQ0A 1YJWA 4WFN3 1PRMC 5C4HA 2KROA 2A8VA 3J7YW 1VQ5A 4LF4L 4OB2B 4J9EA 4PZ7A 3META 4RWSC 4A3MG 4DBQA 3JC66 1W2BA 3AMUA 2F3VA 4M1UB 1AVZC 1K4US 3FKIG 4B9XA 2E5LQ 2VQEL 4TVAB 5DM7R 3VRYA 2MPMA 2F1LA 1VQBA 2ZXRA 3CMET 3OWEB 1SR3A 2OEOA 3O8VA 3I4NH 1EUJA 1B7YB 2JZ2A 1Q46A 2WFWA 3PMIA 1I6HH 1ZYRC 4Y91A 2E2JH 4DR7L 2F5KA 4FL6A 2HAXA 1KHIA 5IH2A 2KSSA 2A6HD 3M0QA 4LN2A 1FJGQ 2H3JA 3RLOA 2WKCA 5IT9c 2F1MA 3IQLA 2RQUA 2SEMA 1H9JA 4H02A 2L55A 3HRTA 3A8IE 3WOFA 2LSSA 2IX3A 4OMPA 1I07A 4LF4Q 2GFUA 3OBYA 1N33L 2EJFC 2DIQA 2JP1A 4RG1A 4LUZA 3S6WA 1TS4A 2M1HA 3D0FA 2VQEQ 2XU8A 2F0MA 1SROA 2G9DA 1ZQ1A 2Y0SB 3PUWA 1GCPA 2CZ1B 4JRQA 3PUXA 5IYCH 1XPUA 1PNJA 3JCMQ 2XRSD 4UP7A 1CKBA 2NWMA 1D3BA 2MP1A 4HSVA 4EVOA 2AKWB 5I2YA 3A56A 4M7DC 4C5GA 4X6AH 1M27C 3OS0A 5E3FA 2DO3A 4B6MA 3MO8A 3HFOA 1B34B 1NR2A 4JJBA 2CZ6B 4BA1I 4A3JH 3CU7A 4QT7A 1PXUA 2L12A 3I56A 3H0GB 3I8ZA 3BDLA 3VKIA 2A7YA 4HJ9A 3ULJA 3STBC 1AWXA 5IAYA 4RKLA 1STGA 4QUCA 3QJYA 4ESRA 1WTXA 2CP0A 5CV9A 5EPKA 1UGQB 1ZA2B 2HHHL 1E3PA 5ELFA 4TSSA 1OQKA 1PD1A 1TWGH 2LVMA 2B2YA 3PF4A 2VB2X 3ASKA 3SVMA 4PJNA 4HJAA 1D0YA 3E6ZX 1F9SA 4FYYB 4UPAA 1PH5A 2R5MA 4MDXA 1QOHA 5KCOA 4PJOD 3QG1A 4DAPA 1L2FA 2YUOA 3JCMg 2RDFA 2EY2A 3HGBA 4RHRA 4O6JA 4O0AA 3DMUA 4V0BA 2PMZE 3JB9F 4QKUA 4RTWA 2ZTCA 2NYZD 4LF9L 1WI5A 5IHKA 2A68C 1SEMA 2EJMA 3PSIA 3K57A 4A3BB 2DAQA 1R0CB 5GANj 1Q81C 4A3IG 4RGMA 3PTAA 3K58A 2X3WD 3PVQA 1B53A 1PDQA 4BDZA 2EDGA 3JCMW 1G3YA 1M5Q1 4M7AA 1R9TH 4NXML 2CKKA 1M8VA 1UEBA 1NYFA 3WXMB 2HHHQ 2QQAA 4XIGS 1B44D 1RADB 4NL2A 1O80A 4H13C 3G6EQ 2JYOA 3C4SA 3GF5A 1OU9A 3V8KA 4B3RL 3MKDA 4JI4L 2E75C 1MNEA 3D31A 2JUFA 1RAHB 3RUZA 3WWVA 3CCUQ 2QA4Q 4X34A 2F0SA 1QILA 2IW3A 1ZHIA 2CGHA 2LRQA 1SNCA 1SYDA 2Z6KC 4DPGA 2E5QA 4BY1G 2J05A 5KH6A 1GXDC 1I4QA 4KH0B 3PIOA 2VASA 4NKLA 4A3CH 4PFZA 1EWCA 4LF9Q 3K59A 4FF2A 2C0IA 2RQVA 4PZ6A 1ZUKA 2LQNA 2L0CA 1JO8A 1JMCA 2L9HA 2HIVA 3T1YQ 1HNXL 4NXMQ 1V29B 3MVVA 1SJED 2M16A 2MIOA 5AFWA 1N27A 1VQMT 4NMZA 4O42A 1PSEA 2O88A 4A3MH 2QQRA 1JRIA 1PHJA 4B3RQ 2EXDA 3GP7A 4JI4Q 1GJXA 2JVVA 2B2YC 3FKIH 1I5LA 4HA8A 3H0HA 2Y4XA 1KD1C 1H9SB 1CZGA 4X3KA 3RZDH 1E0BA 1MSHA 2C5CA 1N8RC 1SE8A 3FRPB 4LF7Q 1WXBA 3CQZB 1T3SA 1RODA 2DY7A 1X3FA 2L0AA 4MMLA 4DOWA 1IHWA 1IYUA 2ICEC 2E3IA 1MGQA 2D6FA 1AW7A 1G3TA 1XOVA 2HDAA 4XTXA 5GMKm 2J7IA 2AKLA 5HK3A 1EYDA 1M4VA 2AQ2B 2WSCE 3AYHB 1TUCA 3MXPA 3TDQA 3RN2A 1M1KR 1HQMC 1HJPA 3FJ5A 1JJ2S 1NAPA 1PTOB 4IO9A 4M7AC 5KNBA 2M0YA 1C0AA 2GVBA 5NUCA 4ELYC 2DD5A 1G5VA 5BN4A 2VKNA 2HEQA 3GIBA 4RHSA 2HSPA 3REAB 1ENCA 2KCNA 3OA6A 1P16A 1WJRA 5CVIA 3EAEA 4CC3A 1YIJQ 1X3PA 4MHEA 1BIBA 4HCBA 4CJ0B 4Z02A 2NZHA 5ISRA 3TRZA 1FYNA 1WX6A 2YUPA 3W5OA 1VQ4T 1DM0B 3FVQA 1Z7TA 1KAWA 2DXBA 4KUIA 1GBQA 1W6XA 3E1SA 5FU7C 4B9WA 4QIWB 2E1HA 4NXNL 3G48A 2QEJC 2JE6I 1YJNA 4BBRB 3KLWA 4B3ML 3EG3A 1NTGA 2Z4IA 2NVXB 1EY5A 2K6DA 5ELCA 4OWXB 3MEUA 1M90U 2JA6B 1D1AA 4IZ8A 4A93G 1CKNB 3V2TA 3DWQA 1FNUA 2PI2E 1D5MC 2PNHA 4GLKA 2K75A 4JV5L 4JRPA 2CW0C 2PCFB 3VYRA 3K5LA 2AUJD 9ATCB 3NWTA 2ATWA 3A7AB 5GANf 5GAN7 4OO1I 3OSSC 4RCOA 4C1NK 1JICA 1PSFA 5GROA 1M3CA 3G71A 2DEQA 3F2BA 4K5VA 1AZEA 5EPJA 1J6QA 4QVDA 1AWOA 1ILQA 2JSOA 2KHIA 2FHDA 4C92B 1W6KA 1UB4A 5JEAG 3CC7T 4NXNQ 2JA7B 1B50A 3MXNA 2A6ED 5JPNC 2BUDA 3CCEA 1WGSA 4EMHA 4B08A 4A3KG 4B3MQ 5G3LF 5CORA 1NR4A 4K11A 3EQLC 3S17H 2EKHA 1M30A 4JV5Q 4EMGA 1B07A 4ODGA 1WI7A 4Z89A 4A3IH 3S15H 1HZAA 3IAYA 2PUKB 1R4PB 4DR6L 2MO0A 2L5QA 2G5DA 4HCCA 4F88A 2E12A 2L1BA 2UUCQ 2F0FA 3CCQA 1SYFA 1X6BA 1X3QA 1JR0D 3HOYB 1XPOA 3X20B 2QXFA 3X26B 3SB2A 4L6TB 3S16B 3P1HA 5EPLA 3E0EA 1YJ9A 2PVDB 4GBQA 1IKLA 1V1CA 4CKBA 1EYAA 4H44C 1FVIA 4BY1B 1KLGD 2AQ1B 4BY7B 2JS2A 1UGRB 3NHHA 3VYSA 1OO9B 1VQ9A 4FF3A 2M0OA 1UHCA 4Y7NB 5KRUA 4HT8A 4RTTA 3N52A 1S72Q 4OVAA 5FU6C 2JN4A 2NVTB 2ALYB 2P4RA 3SWNA 1MJEA 2LMJA 1ARKA 4R4OA 4U673 3LYIA 4QCLA 1BCPF 4C3JH 3RLFA 5CR2A 2K50A 4QIWE 4DR6Q 4BY6C 4C5HA 3VDYA 5GAMd 3GTQB 2A1AA 2RJEA 4VUBA 3LW5E 1STEA 3K7AB 3EFOA 3VS4A 4BUGA 1PRLC 2AZVA 2O4XB 1Q12A 2X69A 3TP7A 4K5WA 4Q5VA 2ROTA 5DLQE 3GTKB 3PGZA 3I4MG 1YHQT 5GAN4 3UPUA 4MN3A 4PMBA 4TKOB 3JAML 2VQFL 1B2TA 2YV5A 1MIUA 3CC4Q 1DJRD 1UTIA 2DA9A 2NTSA 3BJUA 4M77D 1EQTA 1EWIA 3LWHA 3A54A 1HUMA 4ZKBB 3LX0A 4FP5D 1VMCA 2EQMA 3T1YL 3GTLH 2NBFA 2QG9B 1GFCA 1VQGA 1I5OB 1MNDA 1YFNA 1JEGA 1PTOF 4C3HB 2FMCA 5IY0A 4Z88A 1XPRA 1J5EQ 4JUVA 4C0FA 4J1MA 3FEOA 5JAVA 2CUBA 3I91A 1ENFA 4C92E 4RCBA 1X3EA 4FT4A 1H9KA 1FGBD 3FEWX 3NTIA 1Q86U 2KT8A 1H3ZA 3KOJA 1X2QA 1D0ZA 2BE5D 2M00A 4NB3A 1Y7XA 4ZGEB 2PO4A 3MWYW 1WVLA 3OPOA 1HHVA 4ZLTF 2RF4A 3M0PA 3PT9A 5C4JH 3VS0A 1DCZA 3G4SA 1HJDA 2EYZA 2P0PA 1CSQA 1SYCA 3QR8A 3U4ZA 1N9SA 2D8HA 1WHMA 1M3BA 4V2SA 2VQFQ 4FU6A 4KKSA 2Z1CA 3NUCA 4JLIA 2XSCA 4LUOA 4J5YA 3DB4A 2H8HA 5CO7A 3TVTA 5KE2A 1TWHH 1PCXA 5E7NA 1UUEA 1YNJD 2DL8A 5I9OA 4Z8AA 2A74C 1BCPC 2CS7A 2E5KA 1DOLA 5KNCA 3FRNA 3T4AC 4DV6L 3K6OA 3UI2A 2I5MX 3L2PA 1BUVT 4D8KA 3SWNC 2BIVA 4NS5A 2ZTEA 4P73A 1TUDA 1GL5A 5M5XH 3S1MB 3JAME 1C6VX 1JCKB 5GMKh 1FD7D 1ZBJA 3KLSX 1JJGA 5M5WB 2JM8A 3QWXX 3F2CA 5JJZA 3TQYA 5C0XG 1VQOA 1S1NA 2KEAA 2HUGA 1BDOA 3CC2T 3H9NA 4C92F 1UE6A 2LCSA 1NPPA 3CXCP 2QEXA 4R4IA 4M75B 4DKAC 4BACA 2IPOB 3P7JA 3QBYA 1PTOC 1IW7D 4ID6A 2DNUA 5FLXc 1ZA1B 4NDXA 2EIFA 4GY5A 5DLOA 1R77A 1LOJA 5JEAH 3TS2A 3QYGB 1CSKA 1YBYA 1BF4A 2HKQB 4A3DG 3FIFA 4DV6Q 1K9MC 4ZUJA 2HT1A 1EY0A 1KRTA 4ZUIA 1KC8R 1LUZA 1VQNA 4AYBG 4A3KH 1A15A 1E1TA 1IGUA 1LNXA 1IBLL 2DJFC 2QW7A 2E74C 3OYAA 3CXCA 3ERSX 3NBHB 3I70A 1IBKQ 2RF0A 3PGGA 4C0GA 4OMFB 1GUOA 2QF7A 5A2QL 5M5YB 2M9VA 5HGTA 1BO0A 2DLPA 2RHXA 4GOPB 3T56B 2HZYA 1WD0A 5GJVB 2F0VA 4GZYC 4C2MH 3NWSA 1NE3A 3QOLA 1EX4A 5AJ3Q 3MPUB 1QCOA 5CV7A 1DOMA 4CDDC 1I8FA 2D9TA 4QL5A 4PJOB 2QASA 4DAVA 3S3NA 1MUZA 3MHXA 3M0TA 2K7AA 2XIDA 3TSWA 1IGQA 4WORA 1K83H 1S4ZA 2L5TA 2NUPA 3Q22A 1XTCD 2O4XA 4L5GA 3ZJYC 4JPBW 3NK9A 3J7ZC 1X69A 5IE8A 5M9OA 3OYDA 1BXTA 1I4PA 1WTQA 2JNGA 2OAWA 5I6YA 2K9GA 3CQTA 1EEID 1YITQ 3MHBA 2HNIA 2C9OA 1C4QA 4CGYB 4HJ8A 3HOWB 1RUWA 3ND8A 4KN7C 4IPGA 1K1ZA 2NUTB 2KQWA 2CYZB 3DM1A 4DF7A 2UXBL 2IHEA 3EH1A 1WCMB 4M78B 3K5OA 3ER0A 3DEOA 1YI2T 3CCVA 4Y28E 3QB3A 1YNXA 1SRMA 5I6WA 1SMYD 1ET6A 1FYCA 4PK4A 1K8AC 1LT6D 5IGFA 2HBPA 4JJDA 4EIKA 1SN8A 3A8GB 4IALA 1NZ9A 1F77A 1EIHA 3HKZG 3CPFA 2D0NA 1G6PA 3KUFA 3JCMe 1VA7A 1EY4A 1V1OA 3OIQA 3VR2A 4KGXB 3I4MH 1OYXA 2QTVA 4FDBA 1I81A 1JT8A 2L89A 2UUBL 2Q2HA 5CQXA 2FJ2A 2XN9C 5FO8B 4A3GG 1PRTB 1LM0A 1CFMA 4ZGDB 2EPBA 2GA4B 2MHVA 4OL7A 1HA6A 2DRKA 4PKCC 4F8MA 4X65L 1NY4A 4OGEA 3E9HA 1I4HA 2B8AA 2HL3A 2PNIA 2CWPA 2DJZA 2E3HA 2EAYA 2JW4A 2GVAA 2NB0A 5GAOq 4LW1A 2B39A 2RSNA 4XYOA 3RR5A 3DHQA 3EJIA 1WLPB 4EGVA 3TSSA 2AT1B 5ELBA 4Z9CB 3PO3G 3HOUB 3PIP3 2EYLA 1PKTA 2VUMB 1T0HA 1M90C 1Q81U 2FPEA 1KNAA 2KECA 5A35A 1UNSA 1Y96B 3T13A 1U06A 3H3VI 2JA8B 3PF5A 1VQ6T 1CKMA 1HCZA 4XQJA 1D6EC 2UUBQ 4HCEA 4M77G 4LD6A 3GTGB 4J7IA 2EYQA 2B63H 1Q7YC 3QIAA 2K5NA 2ED0A 3ZBDA 1RF2D 4DNIA 5GAMj 4KGVB 2OTJT 1LT4D 4KD4A 3M7GA 1V76A 4JLGA 3CC7Q 4PJOE 3VYUA 2GF7A 3G6ET 1OXUA 2HCIA 4NOYA 1X6GA 4X65Q 5KE3A 5GAN3 2PPBC 4J9DA 5KYYA 4DR4L 1M2OA 2ABLA 4LDUA 1IYJB 4KV6A 5COYA 2K14A 1TWAH 4OMLA 2LXJA 3A8KE 4CDCC 4ALPA 3OS5A 2CDTA 1FMKA 1TT2A 3TP6A 3AFPA 4BBSB 5C0XH 5AT1B 2BKDN 1YWOA 2I46A 1GFDA 1X01A 3HRUA 1NLPC 1H641 1SPKA 2XK0A 3GNGA 3QO3A 4CDFC 1G8XA 2KRNA 2F0DA 2EQUA 3K7UC 4L5TA 2JEAI 1AD5A 3CCST 3BVMA 1WHGA 4C0DC 2YHTA 3A1PA 3UATA 4UC4A 3QYHB 2L3QA 4DNTB 1FR3A 4GOPA 3RZOH 3HOZB 1WFWA 3NTKA 1G83A 1NE8A 5CYUA 3HKSA 2A08A 3R2TA 4A3DH 2V1RA 5GAMh 4KJOA 2ZJRA 1KD1U 4CC4B 2WP8J 2WSEE 4XK8E 1OXXK 5IHNA 5IOCA 5LMNL 1BIAA 1E7OA 1SFOB 4DR4Q 3NBIA 3EG9B 1EY8A 2DBMA 2A6HC 4G4KA 3RNUA 5J39A 1XYIA 1WYXA 2EYYA 1T0JA 3N5BB 1QUQB 4CC7A 1K73R 3NEMA 1HK9A 4PJOF 1EZZB 5LJ3h 1VQKA 3M53A 3RKWA 1ESFA 3OIPA 2QDLA 2FYKA 1E1OA 3I2ZA 5F2DA 4AIMA 2MQHA 3C1EA 4X64L 2JMCA 4BI4A 2X9HA 3TQ7P 2Y0SG 3FHWA 3RMHA 3MFGA 4HCSA 1QNKA 2R92H 2VXFA 2XDDA 1KABA 3J7AF 3I55Q 2JTMA 4U68A 1W1FA 2VZAA 4DK6C 3PV0A 1XJWB 1S5DD 1JJ2P 4KRTA 2MGSA 1J3TA 5I2SA 1NMGA 1HSQA 4I65A 2RHIA 3SXHA 3NELA 2F03A 5C3EB 2OQ0A 1K3RA 1YIJT 1BBUA 4AG1C 3H0GG 4DV0L 2MWOA 3UDXA 2K5QA 1RAIB 3FDTA 1N34Q 2F2VA 1SE4A 1YNZA 3HKZB 2KCCA 1JJ2A 1RKNA 2F0IA 3J81L 5IWAL 4RUGA 1Y71A 2R61A 3OYKA 2RDHA 3L2VA 4L63B 3ME9A 4LFAL 1UWVA 2E2IB 5CR3A 1BBZA 1TQOA 2QGQA 2PTKA 3NMZC 3C12A 3MAQA 4DR2Q 1WTVA 2K01A 1YWPA 4RCNA 1A3UA 2E41A 4A3GH 4LF8L 2R7DA 1EZ6A 2KOLA 2LS01 3CPWS 2Z0SA 1EFWA 4A3BG 4DV0Q 3JCMX 3S2DB 5GAMf 2AHOB 1O7IA 1VIFA 4X3TA 2I0QA 1T3LA 3V7CA 3SR1A 2DVEA 2F0LA 3PMFA 1E2VA 1N9RA 3HL8A 3CBMA 2DUDA 4RGTA 3U9OA 2DF6A 5GADC 2E5LL 3GTOB 5CKHA 1U4MA 4HVWA 3MZ5A 4YTLA 2IIMA 1KG1A 3PO3H 1AH9A 4LFAQ 2DIGA 1PYSB 4HIDA 4M77B 5LJ3f 2FRYA 1G2BA 1M2VB 3S3MA 3CC2Q 2P0QA 1CT1D 4E7KA 1SSOA 1TR5A 1VF5C 2QCPX 5KYXA 2WB1G 2G3RA 4KMUC 5D3DA 1XMOL 2J6FA 1OTCA 1AN8A 3FLGA 2KEEA 1XNIA 3EGDB 2CT3A 2OTLA 1BI2A 1V1PB 1L0WA 2KI7A 2RJFA 4WJ3M 4HCKA 3J81E 4LF8Q 3MP6A 2CH4W 1PVOA 4P72A 3MP8A 5GAN8 4JI2Q 1E6GA 2UU9Q 1PHTA 1B70B 3EA6A 1T5XD 1N8RR 3CCRT 2CFMA 2VWFA 3RR6A 1VQLA 4XTVA 1WNLA 2PZUA 2SOBA 5J22A 3O13A 1Y1VH 1XX8A 5CGKA 3OYMA 3RERA 2QQSA 5L37A 1HXYD 3CRKC 1WDXA 1WXUA 1E6HA 3OW7A 1K0XA 1QWFA 2BTTA 4LUDA 2BH2A 3H0FA 1S72T 2NLUA 3NQIA 1GBRA 3UA7A 1FGUA 2ROLA 1XMOQ 1B4OA 2XD0A 3BZCA 1A3VA 1ZKOA 3K0YA 5EBDA 1Q82C 1SF9A 4C5IA 4L59A 3I72A 1H92A 3HKZE 1QWEA 3IRBA 4J6HA 2HQXA 2WSFE 1XJVA 2GNCA 1STAA 1RAFB 1HPCA 2K04A 3OYYA 3TZDA 1D2BA 1T5EA 4QUFA 4IIMA 4C8QB 2DJQA 1AEYA 3LGLA 1ZXTA 4AFQC 2BH8A 4Y92A 3WVEB 1UE9A 3X28B 3CCMT 5KYUA 1STBA 1WHJA 2QK0A 3EFXD 5D6YA 2MCNA 3QPHA 2A5HA 2KJXA 3TBIB 3TP8A 3CC4T 5GAOr 4HIKA 2J6OA 4E7IA 1QVFP 1PV4A 1BB9A 4KN4C 5FWCA 1QKXA 2A73B 1N36L 1WJSA 1TIID 4NPSA 1JXMA 2MO1A 4OB0B 4IJLA 4M75D 1YI2Q 1CKAA 1ZX6A 2WIIB 2YRCA 1KLUD 1BNZA 5EAYA 5CBAE 1Q1BA 1CM9A 2PYKA 4L5QA 2E64A 1JC7A 2AK5A 4DA4A 1GHKA 2Y4YA 1F2ZA 3GP8A 1NCVA 2ID0A 4BBRG 4IFDG 3A55A 3P8BB 5IHIA 3VS6A 3W3AA 3M5AA 5GAGC 3LH5A 4M77E 8AT1B 3EIVA 4BE2A 1I3QB 1AWJA 3OYHA 4J9BA 2JA6G 3EFSA 4OIKA 1MI2A 3J7A5 1U4RA 5I11A 2HDLA 1M8MA 2EXZA 3L3OC 3BS1A 4E2FB 3QO2A 4HVUA 1MSGA 3MP1A 5IT9L 2HBWA 2WINB 2FMMA 3JCMP 1N36Q 1TUGB 4DR3L 3BU2A 2JS0A 4QB4A 4E7ZA 2F0HA 1H9MA 3HTRA 1UDLA 1ZSZB 3CW2C 2QTXA 2NN6G 3MEWA 1X55A 5E1FA 3CMAA 3L9AX 4LDYA 4A3FB 1KXLA 2XICA 2OI3A 4C92G 3UDCA 4AFSC 4N8FA 4JI6L 2JA7G 1HZBA 4XU1A 1WTHA 1OULA 3E0JA 2YYZA 3PO2H 4IUNA 1ICWA 1VQ6Q 4JC0A 2NWGA 4M77A 5FW9A 4R9WA 1TOVA 2A6EC 4UDUC 1QB5D 1WD1A 1STHA 2OTJQ 4A3BH 4OHJA 4R4QA 2BZXA 1K9MU 1VQ8T 2CP3A 4M78D 4HMIA 1EIFA 4M77F 3ZYYX 3U4VA 4GN5A 3JB9J 4C8QE 4DR3Q 2F69A 3TN2A 2R7ZH 2B86A 1VOMA 3D4DA 1EL0A 4K8IA 3HOYG 2WB1B 4FVMA 2HDMA 4BA2I 1GHJA 1LTTD 2BDNA 4IUVA 2F0WA 4DR1L 2D0PA 1M3AA 3X3NA 5IGDA 2JA5B 2ZJQA 1TU0B 4BY7G 2V1QA 4I7ZC 2RVLA 2Y0SE 4JI6Q 4LF7L 4HSPA 4DXFA 1QE6A 2W0ZA 4DN4M 3URGA 5IT9E 5I21A 1MMGA 3CCSQ 4OELB 2NUCA 1XMQL 2Z9HA 3LWIA 3PFSA 5GANh 1PRTD 3Q6SA 3U50C 2QQ9A 3M85A 2O9VA 2ZPEB 4CI0C 4A4EA 4J9FA 1PKSA 2ZPBB 1OXSC 5KCHA 3EG2A 2I2LA 1EQVA 4ELZC 2PW5A 3NPPA 1TG0A 3MJXA 1AFPA 5GAOp 3M55A 2LQKA 2NZOA 5LJ3g 4CBVA 3C2PA 2AWOA 4DR1Q 4JI7L 4PZ8A 4HTHA 1A63A 3BYYB 1W3SA 3SK4A 1NJIC 1BR9A 4QQGA 2XRQD 1YITT 4HIOA 1DOKA 5JJKA 4C8QF 3BDOA 2YWWA 2F2WA 3BDUA 1VQ7T 4C3IB 4AH6A 3G6EA 4N0AA 1K8AU 3DEPA 1XMQQ 1MJCA 1I94L 3RUXA 2RCFA 3CQZH 2F52A 2ZXOA 4KKUA 4C3HG 2I5LX 2CZ0B 4DBFA 2B3GA 3E3XA 3CCUA 4M77C 2QA4A 4PJJA 2DL5A 1PMRA 4LE9A 1RAGB 3CEYA 4J8QA 5CV5A 5D14A 1CTMA 2EYHA 4YIJA 5ELOA 1I4GA 1QP2A 2K5LA 1B34A 1PTOH 1FMVA 1SNMA 3AB9A 4LUVA 4JI0L 4JYAQ 3IKJA 2C0OA 1RL2A 3JB9I 4EQNA 1HFGA 2ZPHB 3ND9A 4JI7Q 2EFIA 5LMUL 3CP0A 2BE5C 1JQQA 2COZA 1KHCA 3EHQA 3G71Q 1A8VA 2Z4HA 3KDFB 2DVJA 3UE0A 1NEBA 3S9WA 2PW7A 1BI0A 1C9OA 4BB7A 4ZN3A 1F9QA 4XQQA 4A3EB 1I94Q 4KHPQ 3E9GA 4FXDA 4N4HA 1VQPT 2WB1E 2LC4A 5JJLA 2KK4A 2RO0A 3REBB 5HKCA 4BBRH 2JN0A 4IFDH 4EX5A 3M4YA 4X1VA 1NNXA 2HCKA 1YNJC 2KHSA 3HFZB 2QGFB 1TS5A 2LCLA 2NVXH 1F2YA 2RI2A 4IUUA 2I5HA 2VS1A 3FC3A 2FFKB 3BFMA 1SHFA 1Q7YU 4J8OA 2UUCL 4JI0Q 1UEAB 2KBNA 3F8TA 1XNRL 3A7LA 4YCWA 2YRDA 2IT1A 3D6WA 4MZPA 1G91A 3Q8DA 5LMUQ 4N9PA 4RGNA 5IYBG 3VU3C 2K32A 1RI0A 4JI5L 1FXXA 4M75G 2PQEA 2K3YA 2EGAA 2NN6H 2GQIA 2KYMA 1HH2P 3CCLA 4WJ4A 1RDPD 1VQ9Q 4PFPA 5ELNA 1X75C 2E6ZA 1NEGA 5M3FB 2JA7H 2FZGB 4N0AC 3R6NA 1RCVD 1IW7C 1YIJA 3MEVA 3FPPA 3V8JA 5E4XA 1W4SA 2AHJB 2D8JA 2DM1A 3L2WA 2C35B 2MFIA 2K5IA 3PIO3 2PI2A 1QP3A 2X4YA 1NBEB 1T9HA 3M3YB 2V8IA 4GLAC 4DAMA 1Y8NB 1G3SA 2YTYA 4K0KQ 2ZM6L 4PMWA 1XNRQ 4E47A 3NGPA 1A62A 4KTAA 3QZ5B 1K3BC 1XNQQ 3CCRQ 3L2RA 3DWAA 3KF6B 3OYBA 1WQWA 3AEVA 1LO5D 4UAIA 4PG3A 2OXPA 4JI5Q 1VS0A 1XXGA 3JCMd 1PZKD 3HOYH 3S16H 2MOXA 1EY6A 3CBOA 5LJ5e 2YLBA 3KF8B 4PJOG 4DQ2A 2DD4A 3UDIA 4IN3A 1B1ZA 4BY1H 2HD3A 3L42A 1IXDA 2L8DA 4BY7H 5CMDA 3TCJA 1J5EL 3VR4A 2K3BA 1H9SA 4Y7NH 5C4ZA 3VUZA 1G291 3CCJT 1E2ZA 1U5KA 4G7OC 1SKUB 4JBWA 2CP6A 3GPLA 2OWOA 1SNPA 3NP8A 1PH6A 2UXDL 3FB9A 3UA6A 4KY7A 1Y0MA 5FROA 3HOWG 2ZM6Q 5FLMG 5EKKA 5DNFA 2AUKA 3VV0A 4OWTB 4HCZA 3QUIA 1QW1A 5LJ5j 4KBMB 2KXDA 4M78G 3I55T 1WCMG 5CV6A 3GTQH 3RN5A 1SNQA 3K7AH 3G4SQ 5KYNA 3CCMQ 4C3JB 1Y57A 4DBRA 1JWMD 3LGJA 1A2UA 1SAPA 4UP9A 1FMWA 3HOVB 4K2LA 3GTKH 2RI3A 2WAQB 2Q8TA 3KUPA 1QVFS 4E7JA 1JORA 2GQVA 1SMYC 4MNOA 3HP9A 1XQHA 2RQXA 5FK9C 3M0UA 3BZDB 2H5XA 4F7UB 4DAYB 4JI3Q 1AOJA 3H6ZA 2NVYB 1M90R 2K28A 4ZYSA 2UXDQ 3EVQA 2EGEA 4C3HH 4YHHQ 5LHY1 4ME5A 1V9PA 5GMKe 4POGA 2ASBA 1WPYA 2L15A 2EKOA 5EG2A 5GAOl 2E8GA 1D09B 3VJPA 1OXTA 3C94A 3NPFA 2Q8RE 1PYBA 3CMEA 2GCXA 4YCUA 4BS9A 2DFUA 2KYBA 1VQOQ 1CKNA 1PG5B 2QKIC 3I4OA 2FZKB 3QSUA 5HGQA 3HOUG 1F9RA 3HPWA 1SMXA 2DXTA 2JEBI 2QEXQ 4JK1C 4LJZC 2VUMG 3S2HH 2KENA 3K81C 1DYQA 2EY5A 2VW9A 3H8ZA 4A54A 3CPWP 1O7YA 1U9RA 3KBXA 2RBMA 2JA8G 1S5ED 4POFA 2B2WA 5C4JB 3M4OH 1YJWT 1OXVA 1JU5C 4DV5L 2MJ8A 5C5LA 4L5RC 1DONA 1AHJB 4KI0A 4E6RA 2NVQH 2RHUA 2EJ9A 4OMQA 4HR7B 2A28A 1JB3A 4C92A 1B9MA 4A93H 1D7QA 4C8QD 1GUSA 2DL7A 2W10A 2K1BA 1F2MA 1N5ZA 1IBKL 2F0EA 1M1KC 2CCZA 4HAEA 3S1MH 3KXTA 3CPWA 2DMOA 4ZTJA 1NMFA 1KTKA 3CRLC 3S1RB 1HXDA 1Q95G 5C4XB 3LX7A 1IKMA 1I4K1 3E19A 5AJ3L 5GJWB 4BBSG 1OPLA 3S1QB 4J7FA 1VQ8Q 4F04B 1IXRA 1KFZA 2GTOA 4CHTB 3BE3A 1KL9A 4BE1A 2E2HB 1UG1A 3FPUB 3RLNA 3VYGA 4CDEC 2M2LA 2CSQA 2DPPB 1H9RA 1I4XA 2I07B 4PNYA 4DV5Q 3X3MA 4LF5Q 3HOZG 1IO6A 1TWFH 3KF6A 4AMCA 5IYDG 2DILA 1ICFB 4KLKA 2J6KA 3LWUA 3GTMB 4E7SA 4ME7A 1NSNS 1KIKA 2E76C 4O2DA 1HR0W 2DXCA 1GUWA 4PL6A 3KF8A 5KYIA 5GANg 4FO2A 2E6NA 3RMSA 2L3RA 1Q82U 4FXGC 3J81j 2HL5C 4X62L 3E2UA 3QHSA 1SE3A 1J8IA 1FL0A 2F2XA 2RQTA 4X9DA 1RTNA 3CCVQ 5JPMC 4XTUA 1IL2A 1PZID 3J7AV 1R0BG 5KYWB 2L11A 4R4CA 1JBMA 1X65A 4OMMA 1IRXA 3M0RA 4AFZC 1AZGB 3H09A 2COYA 4FXKC 1SBBB 2B2WC 3EGXB 1U3OA 4MTKA 4K14A 2Z0WA 1IBML 1KDAA 5M3MG 2RA2A 1WJQA 2AMCB 3NTHA 2F3IA 4YCVA 4Y52H 1HFNA 3A8HB 1VQ7Q 4C92C 5BN5A 1H3HA 1SYGA 3J80L 5C3EG 3M4GA 1K83B 4KUDK 3BYTB 1Q86R 4DR2L 3ZL7C 4X62Q 2H4OA 3WVDB 1Q3LA 3M9BA 2B2UA 4A3LG 5FLMH 3CF5A 5EJWA 2R93B 1UHFA 2V8JA 1PC0A 4IPDA 4UHVA 1K8GA 1WCMH 2B2VA 2BE9B 1VYUA 2V8KA 4X3UA 2QDBA 4JI1L 3MA2B 5A2QE 4JJNK 5EKIA 2RDGA 1AE2A 1GUGA 3A8JE 4DXGA 2F0UA 5EGTA 4Q5WA 4M75E 2YLCA 3FP9A 1II3A 1IBMQ 2HQHA 3GO5A 3F2DA 3A8LB 3WDNA 3QZ9B 2PNRC 3QWNA 2YSQA 2K2VA 4IQZA 5I4DA 1VQMA 5I2MA 3UE1A 4RTVA 4J9HA 4HEDA 2LZ6B 1VQPQ 3MTSA 3D4RA 2EPDA 1QVGS 2K79A 4JBMA 5CAIA 1WZOA 2F4VQ 2MK5A 1JE4A 1VDZA 2KDSA 1YHAA 1LTRD 2EYFA 2JA9A 3H3VC 4AQYL 1KNEA 4JI1Q 5K5PA 1LJOA 2R6GA 1NUCA 3LWEA 4XTZA 3OS1A 1F9PA 5H1SE 1BBXC 2J7ZA 2AIRB 4M4ZA 3EN2A 3J80E 1GO3E 4J9IA 2DRMA 2K7VA 2OQKA 4DUZL 2VUMH 3KFUA 2RKSA 1KDCA 2J0TD 3SHWA 4OX9L 4WTOB 4IIOA 4ANJA 1A3TA 1UAPA 2PZ1A 2JA8H 2JT4A 3LLRA 4M75A 2FVUA 1A0IA 1GCQA 1U4PA 2LQ8A 4DV4Q 3SK8A 4RGOS 3GTGH 4CRIA 3MCAB 3KLSA 4HMJA 4UP8A 5CV8A 1QMCA 1I50B 1MKHA 4R56A 3RKXA 4ZKCB 4M75F 3K0XA 1Q8KA 2B63B 3L2QA 3LNNA 1OZ2A 1SYEA 1TTHB 5LJ3e 3PUZA 4K5XA 3GTPB 4AQYQ 2GBQA 4RTUA 4DUYL 1LTGD 1VQ4A 4J9GA 4QY7A 3NBHA 2IPKD 4GLXA 5C6SA 2B2VC 1VQJA 3NSWA 4BBSH 3Q1JA 2JXBA 4ZGJB 4LFCQ 4DUZQ 4M78E 1YNND 3BDCA 4DR5L 5I2XA 2EQJA 4A53A 1AT1B 1S3OA 1U0LA 2RD1A 3I4LA 3JAMi 2JXMB 4OX9Q 3ZEHA 5JEAJ 4YWLA 4OMNA 4EQPA 1M8AA 1JB7A 3R6OA 1U1TA 3MEHA 4XDXA 4OO1G 4OMOA 1NG2A 3OB9A 4M7DB 1HQRD 1VQHA 3HOZH 4FYWB 1OOTA 1TKWB 1VQIA 4PMCA 4PJOA 5DEHA 5BN3A 5IYDH 3AHUA 2YUNA 1LT3D 2K5VA 2PUOB 4FSSA 2YTVA 1C48A 3GTJH 2WACA 2R3ZA 3VS7A 1NJIU 2KT1A 4C8QG 3HEJA 1R8OB 3W2DA 3M9QA 1TY2A 3CCJQ 1ILPA 1YVCA 1SFOH 1ESRA 2LNHB 3LGFA 1N34L 4PLIA 1GRIA 4DUYQ 1Y8PB 3U23A 2QAZA 1IZ6A 2Q2IA 4LFBL 2F3WA 2ZTDA 4TRDA 3A5UA 2SRCA 3EHRA 1TWCB 4IUTA 2ZPGB 3CC7A 3C0CA 2NUTA 1QJOA 1C0MA 4DR5Q 3R3OA 1YJNT 1XTDA 2HCCA 1STNA 3J81c 4M78A 1WTRA 1WHLA 2K5FA 3S14B 2A69D 1CA6A 1WIEA 1ABQA 1WQ7A 1N32Q 2DE0X 4XTYA 2K4YA 2JM9A 1K0SA 3M4PA 2UXBQ 4KHZA 5M3MB 4ME3A 4LNQA 4K6DA 3EBEA 2FXQA 1E22A 4M75C 3KJPA 5HCKA 1GCQC 4M78F 3M59A 4OWWB 2H3EB 4FW1A 2J06A 5JJIA 1LABA 1BOSA 1BKBA 1KC8C 1LT5D 4QMGA 5EKLA 4KHVA 3Q0AA 4DA2A 4OXPA 2CKZB 3CD6Q 2MUYA 2DL4A 3P8DA 3QKJA 3ZFJA 3GOXA 2DJGC 5C3EH 1SHGA 5GAN5 3G71T 2ZAEA 4DK0A 1TS3A 4LFBQ 4A3LH 4QJFA 3OMCA 2VGNA 1Y69U 3OYLA 2Z8LA 4R0KA 2D5DA 3QWYA 1Q81R 4OP0A 3TP5A 2F0GA 1FNWA 2O9SA 4J6XA 3RNJA 1PRTF 2IJ0A 2IL8A 3SK6A 1K0RA 1WOCA 4GOPC 3EH2A 4RG8A 4MZTA 3I35A 1MGSA 3M4OB 4A3FG 1D3BB 4JW0A 2E2IH 3PVLA 4J6YA 4LF6L 3HOXB 1M9SA 1QCNA 3DKMA 2F0OA 3I73A 1QLYA 2BCOA 2XNAC 1SG5A 4A3GB 2CUDA 1RAAB 1D1BA 1Y96A 4PJOC 4A4IA 5C44B 4K6LA 2DBKA 1HD3A 4DV1L 3VR5A 2MNAA 1YJWQ 4JI2L 3CCQT 1AEXA 3JCMV 2UU9L 2A19A 1WTWA 3TSZA 1VQ5Q 2EE1A 2D1XA 1Y1WB 2CZ7B 1YJ9T 4M7DE 3T9NA 2P0KA 2K33A 4N4GA 4QVCA 2K5DA 3MC0B 1YHQA 1KSWA 4JS4A 2K2MA 1STYA 1VQEA 2YDLA 4J9CA 1JB0E 2EBPA 1VQ9T 4YY3L 1EYGA 1JXOA 4YWKA 5IGCA 3S1NB 4RCCA 4DFAA 2IX1A 3V05A 3GTOH 1HNWL 2XHCA 1VQCA 3JCMc 4M78C 1GUNA 3KK7A 2GTJA 2K3XA 4LF6Q 3OTOQ 4DV7L 1CSPA 2CP2A 2LT4A 1RTOA 2IY5B 2IHFA 1KIXA 3QIIA 3I5RA 3RKYA 2KAFA 1CA5A 1PH1A 1G6ZA 1L0XB 4DV1Q 3WOEA 3EGUA 3OYJA 1KD1R 2JQOA 2RPNA 2DN8A 2DZ9A 4G7HC 4LDXA 1QZHA 5CKFA 4CC2A 4HVVA 4KD3A 4WRDA 2QI2A 4XAXB 3Q24A 4XU2A 1AZQA 2VB6A 2GN5A 2DEUA 4QF4A 4DBHA 2LMCB 2VYTA 2X4XA 3SEMA 4YWMA 3F70A 1PRTC 4PLLA 4M7AB 4FT2A 1IHZA 1YHBA 4JCVE 4YY3Q 5C0XJ 4A3CG 1SYBA 1EZ8A 4FNFA 3EG9A 1IREB 2KCMA 1RD9D 2VY3A 4XT3B 4LXCA 2VV5A 3KYHC 3DUZA 1HNWQ 2OAUA 4M7DF 3RBBB 5EC7A 2CT4A 1QUQA 3D4WA 3SEBA 1LCKA 1Y1VB 2RJCA 2PZWA 3MXUA 4DV7Q 1JOOA 2ZZDA 3VS3A 1B3QA 4QQBX 2VXWA 3TMEA 5C3XA 1NLOC 4A4FA 1PFNA 4S3SA 4OO1H 5FU7B 4HJ5A 4C3IG 1S5BD 1UUPA 3VS2A 1X54A 4JG2A 4ZCKA 3I4NB 2EYWA 1LTBD 3BVZA 1D1IA 1M4ZA 3I56Q 4KY5A 1TH7A 2PMZB 1I6HB 1X6OA 3HRSA 3CC2A 2E2JB 3G4ST 1CK1A 4N4IA 1X56A 4GKKL 5KYLA 2KVMA 3TREA 1ONLA 4GLMA 1EIGA 2NTTA 1U8RA 4JBJA 4M8AA 4XU3A 2JTFA 3AT1B 2UXCL 4OGQC 1GM5A 1JE5A 2PZTA 1GXIE 1X9NA 1KDBA 3SD4A 3URYA 2RHQB 2RI5A 2CQOA 2L3PA 1A6XA 1HZ9A 2GGRA 5FO9B 3VS1A 3CMAQ 4WCIA 2QQBA 4DOVA 1NYGA 3I9QA 5J26A 1ACMB 2H1EA 4A3EG 4ILWA 3DLMA 1KAAA 2LX9A 2HQEA 3MEAA 1QVFA 3OSVA 1CI3M 1G51A 4IPHA 2XDBA 3T16A 5GAOm 1KQ2A 2BA1A 2EVBA 3OOCA 4BD3A 1DD2A 1VQOT 2DTHA 5FRMA 1I3QH 1MV0B 7AT1B 3H0GH 2Z6KA 1EFID 4P75A 4GKKQ 2QEXT 3IL8A 3L7ZC 2DYBA 3HSBA 5FRNA 1L1OB 2LQWA 3M0SA 4X9CA 3VRZA 2KGTA 1CZWA 1UECA 2AQ3B 4DR7Q 1VF7A 2UXCQ 1K73C 5A0DA 4A3JB 5C0XI 5D65A 5D3IB 2NYSA 4HKEA 2B8FA 1MMAA 1WXTA 1A2TA 4APVA 2BZYA 1E2WA 1WJJA 4OGCA 3OY9A 1IB8A 1OU8A 4EPCA 5LJ5d 5AYFA 1RIPA 3MEFA 1PFMA 2P4TA 1M1KU 1VQNT 2O2LD 1N33Q 1Q8IA 4M7AE 5CIUA 3BG3A 1TWGB 2FB7A 1DGSA 2G9HD 1Z9FA 1C7YA 1HTLD 3OQ5A 1MBYA 4A3FH 4EMKB 1TXYA 1SRUA 4ZRZA 5M3FG 2QGGA 1R4QB 2RA4A 5FU6B 1M2VA 5GANe 2CREA 3PCOB 3S24A 1KQSS 2XDPA 2Y90A 1ZUYA 1JOQA 1YI2A 2KA7A 2F4IA 1CHQD 5D6XA 5GMKi 1RLPC 3EGDA 2PQWA 1V1PA 3PO2B 1K9AA 4JI8L 4AG2C 4BY6B 5HY6A 2LKVA 4MDWA 4L6V5 4DV3L 1B8AA 3FMCA 4ZTFA 3NXWA 4CJ2C 1SLJA 2L2PA 1R9TB 3ULPA 2Q2UA 1TWBA 1O75A 1O78A 1QG7A 2ZPFB 4KY6A 2EWNA 2ENBA 3VS5A 2R57A 1QZGA 2V1CC 5KNDA 1D1CA 3JCMJ 1HZCA 4XXEA 2ES2A 2R7ZB 3AQQA 3MXNB 1QKWA 5GAMg 4O1NA 4PNOA 3SGIA 5D7UA 5JVG3 3FJPA 1EQQA 1DZ1A 4FYVB 2SNSA 5GAN6 3CCVT 4M7AF 1GD7A 2MMPA 2JJQA 2B29A 4OF1A 2ED1A 2RK2A 4GS3A 2ECZA 4BXXG 4JI8Q 2DL3A 5JVH3 3SFMA 1I5FA 1X3GA 1PD0A 4RMFA 4DV3Q 4JYAL 3H41A 3NENA 1PH8A 4C8QA 4LMQD 2JA5G 1VQ6A 1RACB 2CVRA 4IURA 5GAEC 3UWNA 3SDZA 2LXKA 3RIRA 1CKOA 1EFNA 2RN8A 1CQVA 3A0JA 3J81i 4C3JG 5J3BA 4JDSA 4MIUA 1X2KA 2VVKA 4JJCA 4FSXA 2A36A 4XU0A 8ATCB 1UE1A 2EY1A 4GNXB 4HJ7A 2OTJA 4A3MB 4WF2A 3HOVG 4ATOA 2WAQG 3P8HA 1A0NB 2X6LA 2PVGB 3FKIB 1O9SA 2M9UA 1YJNQ 4P71A 1EYCA 4KHPL 1BCPB 2D9UA 3RZDB 5DY9A 1ZYRD 4HXJA 2D2CC 3Q23A 2DNEA 4C3IH 2FRWA 4F7UG 5CC4A 3V96A 1OPKA 5I22A 1SJHD 3SWNB 2KQ3A 4OIJA 4LWCA 3VYHB 3N6RA 2MYSA 2JJ9A 1BK2A 4RG2A 4C5EA 2PVOB 4RMOA 3DB3A 3D6CA 1PWTA 3VYTA 3CCSA 1QWYA 1WYDA 4KKTA 3T53B 4X66L 5KIXA 2PU9B 4JOIA 1IHVA 2MF2A 3EFOB 1EOVA 2EGCA 1ZEQX 1UGVA 3M4QA 1LACA 1HNXQ 4HN7A 2LDMA 1BVSA 1L1OA 3H6MA 2LCCA 1NPRA 1OX9A 3CCLQ 2RNAA 4IKFA 2KCTA 3QOJA 3CCEQ 4LDWA 4QQ6A 1QVGP 3R2IA 4KJNA 5FO7B 1VYVA 2MI6A 4A63B 4M7DD 5FKAC 2FZCB 1I6VC 1PH4A 1ZSZA 3MXGA 4A3EH 4H0LC 1D0XA 5E4WC 3SE0A 1D1KA 2JA6H 5CCAA 3INZA 3OBWA 3OW2S 1D8LA 1V8QA 1B7TA 1YZ6A 3MFYA 4G7ZC 2EQKA 4XYQA 1RHPA 5FOBB 5GAN2 4K0KL 1Y14B 2EOTA 2EVRA 1K9MR 4EMKA 1UFFA 4C0ZA 3CCQQ 2AWNA 3STBD 3VA5A 1M1FA 1XNQL 3I5SA 3B6YA 4X66Q 4C8QC 5KGUA 3M56A 1CHPD 3A5ZB 3GBQA 1QVGA 5D6WA 5IIFA 1SDFA 3NHNA 3KBGA 2JOYA 1YJ9Q 5C4XG 2TSSA 2V4DA 4R4TA 3QXEB 1SSFA 2FINB 1JQYD 5DM73 4QW2A 2CP7A 5C6AA 1I1JA 3CHBD 5LL6S 1ML0D 4OONA 2RB6A 1PYWD 3L1AA 1CQFA 3I7FA 3DWPA 1QQJA 4C56C 5M3FH 2A0FB 5GAHC 2RMOA 1VQKT 1AE3A 2QYZA 1ASYA 1ZLMA 1UE7A 4RTZA 2A68D 4OB3B 1V1QA 2VL6A 4DK3C 4CJ1B 2XIWA 2CWAA 1M1GA 2SDFA 2ICIA 4TVRA 3ONAB 5CV4A 3M3YH 1WHHA 1S40A 1V43A 3S17B 1H95A 1HTPA 2F5TX 1VQAA 3HP3A 1SEBD 4DU9A 2KMTA 1Z47A 1GVPA 4JOIC 4A3IB 4HIMA 1W70A 1PH7A 3S15B 1W2BS 3G1JA 2MPXC 1ZSGA 3ULLA 4KT0E 5A0LA 2LX7A 5L8RE 3HHTB 1QCBD 3DXJC 4WJWA 4XQNA 3JAMc 1L1OC 1UJYA 2AZSA 4IUPA 2XI9A 1U1SA 2OJ2A 2VNUD 1QVPA 2M51A 4ZK9B 3M7NA 3UT1A 1K8AR 2BZ8A 5DM63 2LP5A 4JI3L 2DY8A
chains in the Genus database with same CATH topology
1S5CD 2R58A 5J1ZA 4PQXA 4XT1B 3GV3A 3BY7A 1D5ZC 2IG0A 2ZCFB 4EMKC 4JS5A 4BI8B 2B2TA 3PUYA 1KC8U 3BW1A 4CKCA 4MMKA 1RJTA 1LLRD 1D5XC 1VCIA 3M54A 1SNOA 1EU4A 2O01E 2ZPIB 3JB9D 3CD6T 4R55A 2ZGWA 3GLXA 3CCRA 4KULA 2DTOA 4RA8A 1VIEA 1SNDA 5I9PA 3H91A 4NP5A 1IYVA 3GTLB 2WV6D 4ZQ3A 5ELDA 2WKDA 2MWPA 5LJ5h 3S2HB 1S72A 5LJ3d 4M7AD 1UGPB 3D8GA 4X3SA 3TZUA 2VGMA 2XKOC 1FX7A 4BDYA 4OB1B 3JCMb 1J9OA 2OTLT 4XQ3A 3H94A 2GFAA 4RKBA 2BOSA 5GMKj 3G7ZA 2VUBA 4C0DB 3AU7A 3BVGA 1VQ5T 2TMPA 4J83A 1VQLT 4IFDJ 1BI3A 2E10A 3CCMA 1TWHB 1TU2B 2X4JA 3CC4A 4A4KA 5JOBA 4IUQA 3NFCA 2J4XA 2E65A 1ET9A 4DGZA 2CW0D 1Y07A 1ENAA 2NVQB 5M5XB 4LDVA 2B2TC 3QDRB 4A93B 3ITPA 3R8BA 4FYDA 4P2CB 4FF4A 4PV1C 1AZPA 2RM4A 3PIPA 5IGBA 2EZVA 2CHBD 1HRJA 3I90A 4V190 4F7XA 4RFBA 1YNNC 2EYJA 4R8IA 4M7DG 3GD7A 2EYMA 2XWJB 1GUTA 1PLFA 1PFBA 3FDRA 1EY9A 3L2UA 4JRIA 3V7SA 3OYIA 3HG9A 4F7UE 2EYPA 1TWFB 4A3KB 2MAMA 2DZCA 3A8MB 1TVXA 2QILA 5CQYA 2K5WA 3CBPA 5LJ5f 2N55A 5C0MA 4E6IA 4FF1A 3ERQA 1O7ZA 2K6AA 1IL8A 3I56T 4C2MB 2NZ1D 1BYMA 2O5IC 3F2UA 3P20A 1SE2A 4L8JA 1YCYA 3LH0A 1UGSB 2E2DC 3OYFA 5FLXL 2A69C 4IFDI 3I3CA 1VQ8A 4QQDA 2K57A 2LY7A 2F0QA 1G3WA 3K5MA 4F7UA 4XTWA 2QDYB 2C06A 4DAYA 2O5JC 2DK3A 3TU4K 3GQBA 3R93A 3CMAT 1L0YB 4F7UF 5T1GA 1G2SA 4Q0FA 2LFNA 1PZJD 4K8JA 3VUBA 1TY0A 1EEFD 5GMKl 2X4WA 2NN6I 3K5NA 2KY9A 5G3LD 5ELEA 1K73U 2KVQG 3SK5A 3HZXA 2DNCA 2KEDA 2LTOA 3U9SA 3I4MB 5CKDA 2XWBB 3NQTA 2YRVA 4MZMA 2ZXPA 2F0TA 1BQQT 2R5AA 1FNVA 1EU3A 3OS2A 4XTCS 4BWGB 3OYEA 2KUMA 2OT2A 4ZAIA 2OF1A 3PNWC 1ZBXA 4ULLA 2K05A 2D0QB 1AP0A 3A8OB 5IODA 1YITA 5FLXE 4LD9K 2A3LA 5IGEA 3PMTA 3KLRA 4LK1C 4EDUA 1VQ7A 1N6AA 3X25B 5K36G 5GAMe 3JB9G 1BCPD 4G57A 4ZN1A 4RAUC 1G8ZD 4RKUE 2BDOA 3JCMh 1X32A 5LL6X 3JRZA 2B2UC 4C1NI 3JSCA 1KQSA 1XWEA 4K2KA 2DTIA 2DXUA 3GNFB 3E9FA 1JWUD 4M7AG 3L2ZA 3QJ6A 2F0KA 4NL3A 1JWSD 4A4GA 3M58A 3OMGA 1TWAB 1WTPA 1KQ1A 1VQPA 2E70A 1LTID 2X35A 3T51B 1B9NA 2SEBD 2XVSA 3CCUT 5C5MA 1PTOD 3VR3A 2QA4T 2DKGA 1TS2A 2B8GA 3C3LA 4F87A 5LJ3j 4QVZA 3SHLA 1EWHA 1VMPA 4TQUS 5TSSA 3RZOB 4A4HA 4II1A 1GOZA 4A3DB 2EY6A 4H7BA 5EBCA 1S5FD 2LT1A 5IGGA 4AYBB 2RSOA 3IFDA 3GTJB 3S3OA 3RESA 1G2TA 4P5NA 4FIBA 2YU9B 4FM4B 1WTOA 1N8RU 2EJGA 4E7LA 2K03A 1BI1A 5GANd 3E5SA 3GV6A 4CKEA 3HS0C 2R92B 2IVWA 5CKBA 3VR6A 1MHNA 3D3RA 1OI1A 2RHZA 2RH2A 2XG8D 1JOKA 1O7LA 5KEEA 3C1FA 1Q1EA 4ABNA 3CKIB 4E7HA 3P75A 2HD0A 5HK0A 4LAAA 4C92D 1MD2D 5LJ5g 4JRKA 1Q90A 3RMQA 1OZ3A 3JCMf 3C95A 3CCLT 1W6JA 3CCET 1EOTA 5C3WA 2L4NA 2N88A 3DLLA 1P92A 2FL7A 1LV9A 3HFNA 4BE0A 3PUVA 3HRZC 1QNUA 3VA7A 5T1IA 1DXMA 1U4LA 3CCJA 2Q8IB 5CBEE 4N9TA 2VXEA 2D62A 4D6WA 2IX0A 4BI3A 1Z6HA 4DNRB 3OYCA 1DJ7B 3M57A 1HUNA 1FWZA 5CKEA 1VUBA 1I4RA 3OWFA 3I55A 1LTAD 1K8MA 4KK7A 2F0PA 1Q86C 4A3GB 5GAOn 4O5VA 3OW2A 2VB3X 3TEEA 2F0JA 2IWHA 1Y8OB 3OYNA 5A0GA 1EY7A 1LTSD 2X6GA 5IN1A 3OYGA 4EQOA 2EJFA 3CD6A 5HURA 3V7RA 4HT9A 1HA5A 2RHYA 1K8OA 2LNVA 3V8LA 3PO3B 2FHTA 2EJGC 5DAUA 2ZT9C 5K36H 3JB9H 1SXTA 2F0NA 1B3AA 3G7LA 3NE5B 4DK1A 3EFRA 2RJDA 4J6WA 2SNMA 4NW2A 3X24B 2EYOA 3OSOA 3C46A 4M7DA 3OHXC 4RH6A 4R8NA 2BA0A 3EROA 3CXCS 1F2LA 2RK1A 2VC8A 3RD4A 2CQAA 5CK9A 3IFTA 5EQ0A 1YJWA 4WFN3 5C4HA 3J7YW 1VQ5A 4OB2B 4RWSC 3META 1W2BA 3AMUA 2F3VA 4M1UB 4B9XA 5DM7R 2MPMA 2ZXRA 3CMET 3OWEB 2OEOA 3O8VA 2JZ2A 3PMIA 1ZYRC 4Y91A 2F5KA 4FL6A 2HAXA 1KHIA 2A6HD 2KSSA 2H3JA 2WKCA 2F1MA 1H9JA 2L55A 3HRTA 3A8IE 3WOFA 2IX3A 2GFUA 3OBYA 2EJFC 2DIQA 2JP1A 3S6WA 1TS4A 2M1HA 2XU8A 2F0MA 2G9DA 1ZQ1A 2Y0SB 3PUWA 2CZ1B 4JRQA 3PUXA 3JCMQ 2XRSD 2MP1A 1D3BA 4HSVA 4EVOA 5I2YA 3A56A 4M7DC 4C5GA 3OS0A 5E3FA 2DO3A 3MO8A 3HFOA 1B34B 1NR2A 2CZ6B 4BA1I 3CU7A 1PXUA 2L12A 3I56A 3H0GB 3I8ZA 3BDLA 3VKIA 2A7YA 4RKLA 5IAYA 1STGA 4QUCA 3QJYA 1WTXA 5CV9A 5EPKA 1UGQB 5ELFA 4TSSA 2LVMA 2B2YA 2VB2X 3ASKA 3SVMA 3E6ZX 1F9SA 2R5MA 4MDXA 1QOHA 5KCOA 4PJOD 3QG1A 4DAPA 3JCMg 2RDFA 3HGBA 2EY2A 4RHRA 4O6JA 3DMUA 4V0BA 3JB9F 2NYZD 2A68C 2EJMA 3K57A 4A3BB 2DAQA 1Q81C 5GANj 4RGMA 3PTAA 3K58A 1PDQA 1B53A 4BDZA 2EDGA 3JCMW 1G3YA 1M5Q1 4M7AA 2CKKA 1M8VA 1UEBA 3WXMB 2QQAA 4XIGS 1B44D 4NL2A 1O80A 4H13C 2JYOA 3C4SA 3GF5A 3V8KA 2E75C 3D31A 3RUZA 2JUFA 4X34A 2F0SA 1QILA 2IW3A 1ZHIA 2CGHA 2LRQA 1SNCA 1SYDA 2E5QA 5KH6A 1GXDC 1I4QA 3PIOA 4NKLA 1EWCA 3K59A 4FF2A 2L0CA 2L9HA 1V29B 3MVVA 1SJED 2M16A 5AFWA 1N27A 1VQMT 4NMZA 4O42A 1PSEA 2QQRA 1JRIA 3GP7A 1GJXA 2JVVA 2B2YC 1I5LA 4HA8A 2Y4XA 1KD1C 1H9SB 1CZGA 4X3KA 1E0BA 1MSHA 2C5CA 1N8RC 3FRPB 3CQZB 1RODA 2DY7A 4DOWA 4MMLA 1IYUA 2ICEC 2D6FA 1MGQA 1AW7A 1G3TA 1XOVA 4XTXA 5GMKm 1M4VA 5HK3A 1EYDA 2AQ2B 3TDQA 2WSCE 3MXPA 1NAPA 1HQMC 1PTOB 1JJ2S 4M7AC 5KNBA 5NUCA 4ELYC 2DD5A 1G5VA 5BN4A 3GIBA 4RHSA 1ENCA 2KCNA 3OA6A 1WJRA 5CVIA 3EAEA 4MHEA 1X3PA 1BIBA 4HCBA 4CJ0B 4Z02A 5ISRA 1VQ4T 1DM0B 3FVQA 1Z7TA 2DXBA 4KUIA 5FU7C 4B9WA 3E1SA 4QIWB 2E1HA 2QEJC 2JE6I 1YJNA 4BBRB 2Z4IA 2NVXB 1EY5A 2JA6B 5ELCA 3MEUA 1M90U 4IZ8A 3V2TA 3DWQA 1FNUA 1D5MC 4GLKA 4JRPA 2CW0C 2PCFB 3VYRA 3K5LA 2AUJD 3NWTA 3A7AB 5GANf 5GAN7 4OO1I 3OSSC 4RCOA 4C1NK 1JICA 1PSFA 3G71A 2DEQA 4K5VA 5EPJA 4QVDA 1ILQA 2JSOA 5JEAG 2FHDA 4C92B 1W6KA 1UB4A 2JA7B 3CC7T 1B50A 3MXNA 2A6ED 5JPNC 2BUDA 3CCEA 1WGSA 4EMHA 4B08A 5G3LF 5CORA 1NR4A 3EQLC 4EMGA 4ODGA 3IAYA 2PUKB 1R4PB 2L5QA 4HCCA 4F88A 2E12A 2L1BA 2F0FA 3CCQA 1SYFA 1X3QA 1JR0D 3HOYB 3S16B 3X20B 2QXFA 3X26B 3SB2A 4L6TB 3P1HA 5EPLA 1YJ9A 2PVDB 1IKLA 4CKBA 1EYAA 4H44C 4BY1B 1KLGD 2AQ1B 4BY7B 1UGRB 3NHHA 3VYSA 1OO9B 1VQ9A 4FF3A 2M0OA 4Y7NB 5KRUA 4HT8A 3N52A 4OVAA 5FU6C 2NVTB 3SWNA 4U673 3LYIA 4QCLA 1BCPF 3RLFA 5CR2A 4BY6C 4C5HA 3GTQB 5GAMd 2RJEA 4VUBA 3LW5E 1STEA 3K7AB 4BUGA 1Q12A 2X69A 2O4XB 3TP7A 4K5WA 4Q5VA 5DLQE 3GTKB 1YHQT 5GAN4 3UPUA 4MN3A 4PMBA 4TKOB 3JAML 1B2TA 2NTSA 1DJRD 4M77D 1EQTA 4ZKBB 3LWHA 3A54A 1HUMA 3LX0A 4FP5D 1VMCA 2EQMA 2NBFA 4C3HB 1PTOF 2FMCA 4JUVA 4C0FA 4J1MA 3FEOA 5JAVA 3I91A 1ENFA 4C92E 4RCBA 4FT4A 1H9KA 1FGBD 3FEWX 3NTIA 1Q86U 1H3ZA 2M00A 2BE5D 1Y7XA 4ZGEB 2PO4A 3MWYW 1WVLA 3OPOA 1HHVA 4ZLTF 3PT9A 1DCZA 3G4SA 2P0PA 1SYCA 1N9SA 4V2SA 4FU6A 4KKSA 2Z1CA 3NUCA 4JLIA 2XSCA 4J5YA 3DB4A 5CO7A 3M4OB 5KE2A 1YNJD 5I9OA 2A74C 1BCPC 2CS7A 1DOLA 5KNCA 3FRNA 3T4AC 3K6OA 3UI2A 1BUVT 3SWNC 2BIVA 4NS5A 3S1MB 3JAME 1JCKB 5GMKh 1FD7D 3KLSX 5M5WB 5JJZA 5C0XG 1VQOA 2HUGA 1BDOA 3CC2T 4C92F 1NPPA 2QEXA 4M75B 4BACA 3P7JA 3QBYA 1PTOC 1IW7D 4ID6A 4NDXA 2EIFA 4GY5A 5DLOA 1LOJA 5JEAH 3QYGB 1YBYA 1BF4A 3FIFA 1K9MC 4ZUJA 1EY0A 4ZUIA 1VQNA 1A15A 1LNXA 2E74C 3OYAA 3CXCA 3I70A 4C0GA 3PGGA 5M5YB 4OMFB 1GUOA 2QF7A 5A2QL 2M9VA 5HGTA 1BO0A 2RHXA 3T56B 1WD0A 2F0VA 4GZYC 3NWSA 3QOLA 5CV7A 1DOMA 1I8FA 2D9TA 4PJOB 4DAVA 3S3NA 3MHXA 2XIDA 4WORA 1S4ZA 2L5TA 3Q22A 1XTCD 2O4XA 4L5GA 3NK9A 5M9OA 3OYDA 1BXTA 1I4PA 1WTQA 2JNGA 5I6YA 1EEID 3MHBA 2HNIA 2C9OA 1C4QA 4CGYB 3HOWB 3ND8A 4KN7C 2KQWA 2CYZB 3DM1A 4DF7A 1WCMB 4M78B 3K5OA 3ER0A 3DEOA 1YI2T 3CCVA 4Y28E 3QB3A 5I6WA 1SMYD 1ET6A 1FYCA 1K8AC 1LT6D 5IGFA 2HBPA 4IALA 1EIHA 3A8GB 1NZ9A 1F77A 3CPFA 3KUFA 3JCMe 1EY4A 1V1OA 3OIQA 3VR2A 1OYXA 1I81A 2L89A 5CQXA 2FJ2A 2XN9C 5FO8B 1PRTB 1CFMA 4ZGDB 2EPBA 2GA4B 2MHVA 4OL7A 1HA6A 4PKCC 4F8MA 4OGEA 1I4HA 2B8AA 2DJZA 2EAYA 2NB0A 5GAOq 2B39A 2RSNA 4XYOA 3DHQA 3EJIA 4EGVA 3TSSA 5ELBA 4Z9CB 3HOUB 3PIP3 2EYLA 2VUMB 1M90C 1Q81U 1KNAA 2KECA 1UNSA 1Y96B 3T13A 2JA8B 1VQ6T 1HCZA 4XQJA 1D6EC 4HCEA 4M77G 4LD6A 3GTGB 4J7IA 2EYQA 1Q7YC 3QIAA 3ZBDA 1RF2D 5GAMj 2OTJT 4KD4A 1LT4D 3VYUA 3M7GA 4PJOE 4JLGA 2GF7A 3G6ET 1OXUA 2HCIA 4NOYA 5KE3A 5GAN3 2PPBC 4KV6A 4LDUA 5COYA 3A8KE 3OS5A 1TT2A 3TP6A 4BBSB 5C0XH 2BKDN 2I46A 1X01A 3HRUA 2XK0A 1H641 3GNGA 3QO3A 2F0DA 2EQUA 2JEAI 3CCST 3BVMA 4C0DC 2YHTA 4DNTB 4UC4A 3QYHB 1FR3A 3HOZB 3NTKA 5CYUA 1NE8A 3HKSA 3R2TA 5GAMh 4KJOA 1KD1U 2WP8J 2WSEE 4XK8E 1OXXK 5IOCA 1BIAA 1SFOB 3NBIA 1EY8A 2A6HC 4G4KA 5J39A 1XYIA 3N5BB 1HK9A 4PJOF 1VQKA 5LJ3h 1ESFA 3M53A 3RKWA 3OIPA 2FYKA 5F2DA 3C1EA 4BI4A 3RMHA 3MFGA 4HCSA 1QNKA 2VXFA 2XDDA 1KABA 3J7AF 2JTMA 4U68A 3PV0A 1S5DD 2MGSA 5I2SA 4I65A 2RHIA 3SXHA 2F03A 5C3EB 1YIJT 2MWOA 2K5QA 3FDTA 1SE4A 3HKZB 2KCCA 1JJ2A 1RKNA 2F0IA 3J81L 1Y71A 2R61A 3OYKA 2RDHA 3L2VA 4L63B 3ME9A 2E2IB 5CR3A 1TQOA 3MAQA 3C12A 1WTVA 2K01A 4RCNA 1A3UA 2E41A 1EZ6A 2KOLA 2LS01 3CPWS 3JCMX 3S2DB 5GAMf 1VIFA 4X3TA 3V7CA 3SR1A 2DVEA 2F0LA 3PMFA 1E2VA 1N9RA 3HL8A 3CBMA 4RGTA 3U9OA 3GTOB 5CKHA 1U4MA 3MZ5A 4YTLA 1KG1A 2DIGA 4M77B 5LJ3f 3S3MA 1SSOA 1VF5C 1CT1D 1TR5A 2P0QA 3G6JB 4E7KA 2QCPX 5A35A 1C8CA 4KMUC 2G3RA 5D3DA 1AN8A 3FLGA 2KEEA 1XNIA 2OTLA 1BI2A 1V1PB 2RJFA 3J81E 3MP6A 3MP8A 5GAN8 3EA6A 1T5XD 3CCRT 1VQLA 4XTVA 1WNLA 2PZUA 2SOBA 5J22A 3O13A 1XX8A 5CGKA 3OYMA 3RERA 2QQSA 1HXYD 3CRKC 3OW7A 1S72T 2NLUA 3NQIA 1B4OA 2XD0A 1A3VA 1ZKOA 3K0YA 5EBDA 1Q82C 4C5IA 4L59A 3I72A 4J6HA 2HQXA 2WSFE 1STAA 1HPCA 2K04A 3OYYA 3TZDA 1D2BA 1T5EA 4QUFA 4C8QB 3LGLA 1ZXTA 3WVEB 3X28B 3CCMT 1STBA 3EFXD 5D6YA 2KJXA 3QPHA 2A5HA 3TBIB 3TP8A 3CC4T 5GAOr 4E7IA 4KN4C 2A73B 1WJSA 1TIID 4OB0B 4M75D 2WIIB 1KLUD 1BNZA 5CBAE 1Q1BA 1CM9A 2PYKA 2E64A 1JC7A 4DA4A 1GHKA 2Y4YA 1F2ZA 3GP8A 1NCVA 2ID0A 4IFDG 3A55A 3P8BB 3W3AA 3M5AA 4M77E 4BE2A 1I3QB 3OYHA 3EFSA 4OIKA 1MI2A 1U4RA 2HDLA 3L3OC 2EXZA 3BS1A 3QO2A 1MSGA 3MP1A 5IT9L 2WINB 2FMMA 3JCMP 4QB4A 2F0HA 1H9MA 2QTXA 2NN6G 3MEWA 5E1FA 3CMAA 3L9AX 4LDYA 4A3FB 2XICA 4C92G 3UDCA 4XU1A 3E0JA 2YYZA 4IUNA 1ICWA 2NWGA 4M77A 4R9WA 4UDUC 2A6EC 1QB5D