4IUUA

Crystal structure of shh1 sawadee domain in complex with h3k9me1 peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
133
structure length
127
Chain Sequence
b'ADLAFEAKSARDYAWYDVSSFLTYRVLRTGELEVRVRFSGDEWVNVKTSVRERSIPVEPSECGRVNVGDLLLCFQEREQALYCDGHVLNIKRGIHDHARCNCVFLVRYELDNTEESLGLERICRRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SAWADEE HOMEODOMAIN HOMOLOG 1
publication title Polymerase IV occupancy at RNA-directed DNA methylation sites requires SHH1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
total genus 23
structure length 127
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16719 SAWADEE SAWADEE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4iuuA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iuuA01
1B53A 2DY7A 2Q8RE 4UC4A 2R57A 4HCZA 5EPKA 5IN1A 1U4PA 2EFIA 1MGSA 1IKLA 4LD6A 4IUQA 4E7JA 4OVAA 2JZ2A 4IUUA 2MJ8A 3CEYA 4BACA 1KHCA 3OYFA 3S3NA 3OS1A 3DEPA 3LWEA 5D14A 1U4RA 1RJTA 2K1BA 3S3OA 2HDMA 4MN3A 2B2YC 1O80A 1O7YA 3OYJA 3OYEA 2YRVA 3TZDA 3DLMA 4XT3B 4E7LA 1NCVA 4HCSA 4OIKA 3OA6A 1WJSA 2H1EA 4CJ2C 2X4WA 3L2RA 1HRJA 3S3MA 2NLUA 3DB3A 2RI5A 3META 1B2TA 1PDQA 4OIJA 4X34A 4BE2A 2BKDN 3LX7A 3E9GA 1Q3LA 1J8IA 2L11A 4A4EA 3OYLA 1G2TA 4QVZA 1HFNA 4ZKBB 4HEDA 2EQJA 4R9WA 3UT1A 5D6WA 3Q6SA 1RODA 3OYCA 2HCCA 3OYHA 3P8DA 2K3XA 5KCOA 1PFNA 2P0KA 1PFMA 3GOXA 4QQGA 3F2UA 3OQ5A 1F9SA 5JJZA 1LV9A 1AZQA 5FROA 2B2UA 2NWGA 2J7ZA 4BDZA 3OYDA 5C6SA 3LGFA 1XYIA 4FL6A 2FJ2A 4IUPA 3Q1JA 1XX8A 2JTFA 3QBYA 2RJEA 4Z02A 3ASKA 3L2QA 1WJRA 3MEWA 2CKKA 1X3PA 1NAPA 4X3UA 1G2SA 1OYXA 1BO0A 1ZXTA 2EPBA 2BUDA 3KUPA 2F5KA 2DIGA 3P8HA 3MTSA 5CMDA 2LTOA 3ME9A 3ZEHA 4B9XA 1NR2A 4LMQD 2LCCA 1HA6A 2KECA 4RG2A 1F9PA 2JP1A 4QQDA 2RO0A 1RHPA 4E7HA 2HQXA 2RVLA 2MPMA 2RHIA 1ESRA 5E4WC 2B2UC 3IFDA 3FPUB 2EOTA 2LDMA 1H3ZA 2G3RA 2X4YA 1IL8A 4QUFA 2EE1A 2L8DA 2D9TA 2FHTA 4A4FA 1MI2A 2L1BA 1PFBA 1U4LA 2B2WA 1HUNA 3GV6A 1WTWA 1X3QA 3OYBA 2M1HA 3L2WA 2FINB 3OS0A 2L4NA 4NS5A 4BD3A 4XDXA 2MGSA 3DEOA 2FFKB 1WTRA 3O8VA 3OY9A 2K3YA 5IAYA 2O4XB 2XIWA 1VMCA 4ZK9B 3E9FA 5EQ0A 2WACA 3LYIA 3H6ZA 3FDTA 2RJCA 1WTOA 1NR4A 4X3KA 2R3ZA 3FLGA 3NTKA 2B2VA 1EL0A 2KEDA 2RHYA 1WVLA 4X3TA 4C5EA 3MP8A 2X6LA 2GF7A 1CA5A 1B3AA 1JICA 2L89A 4RA8A 2VYTA 1OZ2A 2FMMA 1GUWA 4CJ0B 2R58A 2CVRA 4R8IA 3PNWC 1WJQA 1CM9A 3OYAA 1O7ZA 1N27A 2Q8TA 3I90A 3SVMA 2RI3A 5KH6A 1QNKA 4BDYA 1EQTA 2RSNA 3OYGA 3MO8A 2R5MA 3FEOA 3PFSA 1DZ1A 2QQRA 4C5GA 3OB9A 1AZPA 4PLIA 3TN2A 1DOMA 2B2TA 3MWYW 5EJWA 3BDLA 2HUGA 2MP1A 2B2VC 4N4GA 1EIHA 4BE0A 4NW2A 2O4XA 1EOTA 1ML0D 4FU6A 1SDFA 1J9OA 2R5AA 2LVMA 1KNEA 1QE6A 1MHNA 4IURA 1EIGA 4RWSC 3QJ6A 3EAEA 3LH0A 4IUTA 4L59A 1XNIA 3D6WA 5KE3A 1QG7A 1WD1A 5D6XA 4HAEA 4O42A 1RTNA 3OS2A 2EQUA 2B2TC 1IKMA 2RSOA 3ONAB 4EDUA 2PQWA 5AFWA 2VXWA 4PLLA 4E7IA 2RHUA 2E6NA 2KOLA 2L12A 1OI1A 3N52A 4X3SA 3LGLA 3OYMA 4ZTFA 1WTXA 2BIVA 3LLRA 1JE4A 2RI2A 5FRMA 5CBEE 3QKJA 1F9RA 3OYIA 1ILPA 5CORA 3R93A 2K04A 3H8ZA 3GV3A 5KCHA 2HQEA 2XDPA 2E5QA 3MP6A 2RHXA 4MHEA 2GFUA 5D65A 4HSVA 1MSGA 1WGSA 4ZLTF 5T1IA 1CA6A 1DOKA 2HDLA 2KEEA 3DB4A 4IUVA 2IG0A 2M0OA 1U4MA 4QUCA 2B8AA 3UWNA 1B50A 5C0MA 2DIQA 3C4SA 1B4OA 4CJ1B 1A15A 1E0BA 1BF4A 5D6YA 3FDRA 4UAIA 3QIIA 5KE2A 5DNFA 3OMGA 3HP3A 2L9HA 2NZ1D 5T1GA 2K03A 2B2WC 2KUMA 3KBXA 3QO2A 3NTHA 5E4XA 3UI2A 2MWPA 1F9QA 4CRIA 3L2UA 2K05A 3L2VA 2X4XA 4C5IA 4GY5A 1ILQA 3P7JA 1WD0A 2DAQA 1HUMA 2X69A 2RJFA 1RTOA 1M8AA 4IKFA 1OZ3A 4II1A 1BBXC 4PL6A 3I91A 3L42A 2D9UA 2NYZD 3PMTA 5EPLA 5CIUA 2K28A 4A4GA 2LRQA 1AP0A 2RA4A 5EKIA 1X32A 2RHZA 4QW2A 3SD4A 1SSFA 3F70A 3NTIA 2BDNA 2N55A 4BE1A 1HHVA 4RAUC 3MP1A 4C5HA 4E7KA 1PLFA 1VMPA 3DM1A 5CBAE 3FC3A 2XK0A 1WTPA 1G5VA 5EPJA 2FHDA 2QQSA 1F2LA 5J39A 1KNAA 3M9QA 2X35A 5J26A 1S4ZA 4U68A 5M9OA 2RJDA 1WTVA 4ZAIA 2X6GA 3MEAA 1WTQA 4QQ6A 1RI0A 1MSHA 4B9WA 2N88A 1C8CA 2DY8A 3S6WA 1HFGA 5FRNA 3OYNA 1BNZA 1G6ZA 2GFAA 2SDFA 4N4HA 1ICWA 4ZKCB 5COYA 1SAPA 2EQMA 4N4IA 2IL8A 2M2LA 3KUFA 2L3RA 3MEVA 3OYKA 4XT1B 2KVMA 3OMCA 1DOLA 3MEUA 4DN4M 2HCIA 3I8ZA 3PMIA 1DONA 2B2YA 1G91A 2EQKA 2K01A 4Q5WA 3I3CA 1TVXA 1SSOA 2M16A 4ZTJA 3G7LA 2MWOA 2JYOA 3IL8A 2EKOA 3H91A 4A4HA
chains in the Genus database with same CATH superfamily
2XDDA 1B53A 2MUYA 3K5NA 2GGRA 1HCZA 4FSSA 2PQEA 1SPKA 4IN3A 3HOVB 4KMUC 5IE8A 4QT7A 4LDVA 1L1OC 5LJ5d 2ECZA 5D7UA 5K36H 1WHJA 3DM3A 3NELA 4OEMB 1KXLA 4JW0A 5J3BA 5KYXB 2F0HA 1M30A 4C0DB 3GTLB 2DL5A 2KGTA 3PO2B 3CCJT 3M3YH 2JZ2A 4IUUA 2ZPIB 1GBRA 4RTVA 4OGQC 3TP7A 4LF5Q 1BDOA 2VXEA 1UGVA 1NNXA 4JOIA 1WHLA 1GRIA 3EGXB 5GAOr 1U1SA 2EPDA 1DGSA 5CV7A 1GJXA 5D14A 1XPRA 3HOWH 1UE9A 3GTMH 2DXTA 4PFZA 3CCLA 1W4SA 1SNQA 3S3OA 4JRKA 2DERA 3CCSQ 4M75B 1OXTA 5M3MG 4DA2A 4M77D 3OYEA 2YRVA 1VQMA 1GO3E 3RD4A 4XTZA 4XT3B 2KBNA 1VQ9T 4HCSA 3OA6A 1ENCA 2R7ZB 1BCPD 2X4WA 5I9PA 2IX3A 4OMQA 3S3MA 1SF9A 3TS0A 3C0CA 3SWNC 4OL7A 2BE9B 4A3EH 3QR8A 3VRZA 4BY6B 2DNUA 5A0LA 4OIJA 2A37A 3LX0A 5M5YH 4TVRA 1YJNT 1O7IA 1HNXL 2P4RA 3JCMg 1Q82U 4PJOD 4F7UE 1XPUA 2A28A 3V96A 4E7ZA 1E2ZA 5LJ3j 3AQQA 3PCOB 3J80i 4R56A 1NSNS 1YHAA 2HHHL 4IIOA 5C0XJ 2Y90A 1F2MA 3BDOA 2MHVA 4C2MB 3FP9A 2EQJA 2FL7A 5C4JH 5GJVB 3UT1A 1YJWA 4KY7A 1TXQA 2F1LA 5D6WA 3Q6SA 2VS1A 1BCMA 1VQNQ 2PCFB 3UPUA 1WA7A 4P2CB 2CCZA 4C3JH 1EQRA 1OX9A 3L0OA 2IIMA 2LNHB 3M4QA 3MEHA 3ZL7C 5KYXA 3P8DA 2K3XA 1T3SA 3V7RA 5KCOA 3CMEA 3VYSA 2R93G 2DD4A 1XMQQ 2ZJRA 1HA5A 4BI8B 1WXTA 1T5XD 3Q24A 2P0KA 4C1NI 2DETA 5LJ3e 4P74A 2CWPA 3F2UA 3RR5A 5JPNC 4A3BG 3JCMJ 1SNMA 3EGXA 1A62A 3S17H 2EIFA 1Q8IA 1TUDA 1ENFA 1B8AA 4M75A 2ID0A 1M3CA 3QJYA 5CKBA 4LFBL 1SYEA 2GN5A 1D5XC 4KKTA 3JCMX 4PJLA 1B1ZA 1E24A 5EC7A 5GAOm 1X3GA 4IUPA 4DPGA 1WOCA 3M4PA 5IGEA 4PFPA 1PH9A 2HQHA 1AZEA 3SK8A 2JTFA 3D7SB 2N8NA 3CC2Q 1KHIA 3QPHA 4C8QG 3L2QA 1IW7D 1KJWA 1VDZA 1X3PA 3AMUA 4HT8A 1WX6A 2CZ7B 4J8QA 1JWUD 3PUYA 4IQZA 4A3GH 2BUDA 1CI3M 3NHHA 3J81c 1EIYB 1Y7XA 3A98A 2EJGA 5CMDA 4A3JH 5LJ5f 4XTWA 4IPDA 1TWHH 3I70A 3VS4A 1JQQA 1SRMA 2JS2A 3A54A 1NY4A 4RG2A 4RFBA 4POFA 4AMCA 2LX9A 1AEXA 3MPUB 2EYWA 3JCMQ 4K6DA 1D0YA 2X9HA 4X9DA 1GXIE 1QCNA 2HQXA 1D1CA 4K2LA 2RHIA 3P8BB 1FR3A 2EYZA 5E4WC 2B2UC 3PUVA 3HRSA 3IFDA 4PK4A 1GBQA 1KD1C 3NP8A 2ZJPA 2I0QA 2EOTA 2EVRA 4CDEC 2BA0A 3VS2A 1H9SB 4RTTA 1Q12A 1TU2B 4GNXC 2DXCA 2GQVA 1H9JA 4DR7Q 2FHTA 1JC7A 4FIBA 1EY5A 1PFBA 1A8VA 3G6EA 1PH2A 4DV4Q 2KHIA 4J8OA 3H6MA 3GV6A 4A3LG 4ME7A 4ESRA 5KRUA 2DEUA 2M1HA 1YHQA 4A53A 3OS0A 1FNUA 5JEAJ 4NS5A 2KCNA 4FXGC 4XDXA 4IPGA 3CCLQ 1WQ7A 2E65A 1HZBA 2RF4A 1QZGA 2UXCQ 1Q81C 2E2DC 3T13A 2D5DA 3AYHB 2K3YA 4KULA 1VQMQ 2O4XB 1NJIR 2XIWA 4IFDI 1R0CB 4J6XA 3NXWA 4XYQA 3S16B 1D5ZC 4CKEA 4OMOA 1FX7A 2MK5A 1E2WA 4ZK9B 5H1SE 4KJOA 1ZYRC 3CPFA 3BE3A 2WACA 5IGCA 3I73A 4J9CA 2DX1A 5CQXA 5GAEC 2J7IA 3TSWA 1XXGA 1WNLA 5GMKj 3M53A 4EMKC 1ASZA 1ET9A 1PA6A 3I4MG 3FJ5A 1E22A 2LQWA 2CKZB 1WYDA 4M7AF 2DLPA 3QDFA 3HKZG 2KEDA 2EDGA 2RHYA 4C8QD 2KRMA 2F03A 4JZ3A 3RNJA 1EEID 2E76C 5C4HA 3W3AA 1PTOC 2KEAA 3K7UC 4Z89A 1B3AA 4X9CA 2L3PA 4DUYL 1CA5A 4J15A 3PO3H 2E2IB 1YJWQ 4DXGA 1I6HB 3OSVA 2TSSA 1OZ2A 5K5PA 1GUWA 1YFNA 1B7YB 2QKIC 3K7AH 2IWHA 1W6XA 1QZHA 5GAOp 4DR4Q 3GTJH 2K5WA 1PD1A 1WJQA 2DO3A 2WAQG 1N27A 2WINB 1H9SA 5GANg 3I4LA 2RI3A 5KH6A 5I22A 4DR6L 1AZGB 2NWMA 5GMKe 3JAME 4HCKA 4M75E 1JOOA 1WXBA 3K0XA 4E47A 5TSSA 1NLOC 4DV3L 1PSFA 3RZDB 4JYAL 3O5ZA 1NYGA 5FWBA 2DVJA 2YHTA 4UP8A 1NEGA 1STGA 4HJAA 1I3QH 4KUIA 1QW1A 2HUGA 4ZGEB 2MP1A 5GAOn 4K8IA 1K73R 2B2VC 1NE3A 4V2SA 3U4VA 3A55A 2XRQD 3EG9A 7AT1B 2CW0D 1WCMH 4FM4B 1D09B 2O4XA 1HPCA 4MMKA 1XNRQ 4DF7A 1EOTA 3Q0AA 1W2BP 5LJ3f 5HY6A 1UE7A 1C0MA 4KHPQ 4B3TL 3U50C 4RTXA 1J5EQ 2IY5B 2X51A 1TWAH 2LJ1A 1TY2A 1M4ZA 2BZ8A 2QDYB 5KYYB 1JJ2P 2LVMA 1BIBA 1II3A 1P8LA 2JA7G 4RUGA 1M2OA 4BUGA 3NUCA 4LF5L 4IUTA 1KAAA 1C7YA 1XNIA 5GAMg 3D6WA 2R92B 2XI9A 2E74C 2F5TX 1SE3A 5KE3A 2JA6H 4XK8E 1W1FA 4LUEA 1QG7A 1M1KU 1QVPA 2K5FA 4O42A 1B9NA 2JXMB 3J7A5 1RTNA 2K9GA 1WQWA 1I81A 4IOAA 3I56A 1D1BA 1X2KA 1Q81R 2B2TC 1IKMA 4DK0A 1HSQA 5IHIA 2F0UA 1TWGB 4NL2A 4POGA 1H641 5KYIA 4FT2A 1FNWA 1JR0D 3CCMT 5AFWA 3U4ZA 4PLLA 1A63A 2LCSA 1EY8A 4M7AG 1VQ4T 2JK8A 3IAYA 2GVAA 2L12A 1UAPA 4OWWB 1UJ0A 1OI1A 1YIJQ 2FMCA 3LGLA 2QASA 4BXXH 4ZTFA 4TRDA 1WTXA 2DRKA 4IALA 3KLWA 2Z9HA 2G5DA 2VASA 2B8FA 3S1RH 4M75C 1OEBA 3SEBA 3H0IA 3G6EQ 4LWCA 4PZ7A 3TEEA 3TU4K 4N9TA 1V76A 1XMOL 3QKJA 4RGOS 2JMAA 1K9MU 1ZBXA 4JI0Q 3M7NA 3QZ9B 1YHQQ 2CGHA 3K58A 1ILPA 1VQBA 2OTJQ 2AQ2B 3A8IE 2I07B 2CP6A 3H8ZA 4JI6Q 3GV3A 4K2KA 4DUZQ 4J9IA 3HS0C 4LFAL 4MHEA 3F2DA 2NUCA 1JJCB 3T4AC 4X65L 1MSGA 4F88A 1NM7A 2BTTA 1S5ED 2EJGC 5KYYA 1DCZA 2OAWA 3CW2C 4S3SA 1Y1VG 4JLIA 3VR4A 5BN3A 5C5MA 4IIMA 2KEEA 1PYWD 4HMIA 2Q2IA 1I50B 2EYYA 4Y28E 4MDXA 2F0NA 2YTVA 1E7ZA 2IPKD 5M3FG 1RLQC 1IBMQ 1N9SA 2WB1G 5ELBA 2K14A 1X75C 1YITT 2MMPA 5LJ5h 1IO6A 3HFNA 1M3BA 1EYDA 2MO1A 4IFDH 2VUMG 1A15A 1E0BA 1FGBD 5C44G 2HCKA 3FDRA 3NHNA 4BA2I 1PZJD 4H7BA 3CCUA 2NN6I 3DXJC 4KGZB 1SE4A 2D0NA 3ZJYC 1QVGS 1K0RA 1LCKA 2DK3A 2F0DA 4CDFC 2LQKA 2AZSA 2EWNA 2RQRA 2F0VA 3RESA 4BBSG 1IYJB 2QILA 4CC2A 2BH2A 5CC4A 1VQDA 2MWPA 4O1NA 4A3BH 2LC4A 3EH1A 1F9QA 2I2LA 3OBYA 2CUBA 2X4XA 3H9NA 4C5IA 1LT4D 2COWA 1X2QA 4G7ZC 3P7JA 2P84A 4XTVA 2PNRC 2DAQA 2W10A 3MEFA 1LT6D 4ZUIA 5IXBA 1HUMA 4M78B 3GP7A 5CQYA 1PNJA 1N34Q 3NK9A 2ESWA 3G4ST 1OXVA 1RTOA 1NZ9A 4R8NA 4OGCA 4EVOA 4GKJQ 4DNIA 1TWFB 3KBGA 4B3RQ 2HT1A 2X3WD 1EY7A 3ULPA 4PL6A 3L42A 3E1SA 2D9UA 3PMTA 1LOJA 1L1OB 1LO5D 1N32Q 1QWFA 4G7OC 4K11A 1VQLT 5K36G 3H0HA 3FKIB 2QAZA 4DV7Q 1AP0A 3PIO3 3MZ5A 3D4RA 3QYGB 4JJCA 3PTAA 2D0PA 1T0HA 4XAXB 1RD9D 2QEXT 1KAWA 1PM3A 1H95A 3SD4A 3A56A 3A5ZB 3NTIA 3REBB 1YNJD 2PUOB 2WB1E 3A8KE 3K59A 5CV5A 1I07A 1HK9A 1JXMA 1BB9A 2F0JA 4M7DB 2K6DA 4HVUA 1EY9A 1YNND 3I55T 1HR0L 1M2VB 3OWFA 4RAUC 2RCFA 5IXFA 4ZRZA 4C5HA 2L15A 2A3LA 2LCLA 2QA4A 3GTKB 3I56Q 3VA7A 5CBAE 3FC3A 4A3DG 1STHA 4KGXB 3BY7A 2EGEA 2RDHA 1IYVA 4A3LH 1Q82R 5EG2A 3SWNB 4UP9A 2FHDA 1F2LA 4PMBA 5J39A 1KNAA 3HGBA 3QXEB 3GPLA 4M7AC 2KA7A 4OMLA 5AYFA 4XU1A 5I6YA 2KAFA 1JO8A 2KY9A 3SB2A 1YVCA 4C92B 1ACMB 1YCSB 1NUCA 1QUQB 5GMKl 4OMFB 1PYSB 4M78A 1E7OA 1UECA 2NZOA 1XWEA 2QQ9A 2P4TA 4DU9A 4QQ6A 1RI0A 3J81E 1GUTA 4A63B 1IRXA 4LDYA 3S6WA 3RLOA 2JOYA 4HIMA 4L5SA 1Y69U 2RKSA 2YYZA 1G6ZA 2LZ6B 1STYA 2R7ZH 1ICWA 1DM0B 2KT1A 1QKWA 4ZKCB 1SAPA 1I5OB 2AT1B 4J7IA 2GNCA 4F04B 1EOVA 2EYMA 5IGDA 4BWGB 3I4MH 2F0MA 3H3VI 1V43A 1K3BC 1HZCA 2RQXA 2M02A 1QVFP 2V8JA 2A1AA 3RUZA 4R4IA 3CCVA 2HHHQ 3OYKA 2WFWA 2ZM6L 1STNA 5CKHA 2KVMA 3S1NB 4KH0B 1Y14B 1OPLA 3OOCA 5L23A 2CHBD 4IPCA 4NOYA 4FW2A 4M7DA 1FJGL 2ATCB 8AT1B 3VYRA 3WOFA 1DONA 1M2VA 5GAN5 1RIPA 3JAML 1G91A 1MV3A 9ATCB 2K01A 1UWVA 3VV0A 3K81C 3VR3A 3OW7A 4JI2Q 3STBD 1KQSA 3GTOH 2L3QA 3G7LA 1V9PA 3S1MH 2JA8G 3IL8A 4R0KA 3CCUQ 2EKOA 4Z88A 3NBIA 3HKSA 4A4HA 4KHPL 1H92A 2C9OA 3RNUA 1J5EL 3VUBA 4UC4A 5ELFA 3CCRT 3WDNA 1YNZA 1EZZB 3SWNA 5A0DA 2R57A 2PZ1A 4HCZA 3LWIA 3CCET 1VQOT 2PNHA 4ODGA 2ZPGB 4DBQA 1SMYC 2A5HA 2JMCA 4H13C 2JN0A 2HNIA 4M77F 4C0FA 3WWVA 2B63G 2Z4HA 4IO9A 3OTOQ 5E7NA 2LKVA 1RAIB 1UJYA 4C92A 2QW7A 3KF8B 4JI3L 4A3JG 1BCPF 2MJ8A 4J9EA 4BACA 4F7UB 4DAYB 2PZUA 1UGQB 5I2YA 3LWEA 3PVQA 4ZUJA 1XQHA 3M4GA 4A54A 1JE5A 2FRYA 1U4RA 3H94A 5D3IB 4DAVA 3HFZB 3KJPA 4HJ5A 4A3FH 1LTAD 2K1BA 2HDMA 1I4GA 3EN2A 1U5KA 1VQPT 4MN3A 4ZYSA 2VB6A 4HCBA 1WPYA 1QJOA 3TZDA 3DLMA 4Y7NB 5CR3A 4DBFA 1BU1A 4E7LA 1KD1U 2HZYA 4PJOF 2PW7A 1EFNA 1Q95G 3MXNB 3W2DA 4GNXB 3EG0A 3KYHC 1WJSA 2COYA 1PKSA 2HMAA 4CJ2C 3CCQQ 2VGMA 3HL8A 3CBOA 1M1KC 3L2ZA 1EUJA 2KENA 3CCST 2CT4A 2NLUA 1K3RA 3RKWA 3M55A 3DB3A 2DNCA 2YUQA 5GAMd 3A7LA 5GROA 2CP0A 3CMAA 2DFUA 4ZGDB 4X34A 2ALYB 1D1IA 1ZEQX 2H4OA 3HOXH 4BS9A 5G3LD 4JI6L 2O5JC 2A6ED 2K6AA 5M3MB 4K5WA 1Q3LA 1LPLA 2HAXA 3QWYA 4Y52H 5FK9C 1V1OA 1PYBA 2L11A 1Q81U 4EQ5A 2JTEA 4QVZA 4EMHA 1HFNA 2QA4Q 3VS5A 1CSQA 4R9WA 4ZKBB 1R9TH 5C4XH 3A8GB 4L5RC 2BA1A 3OYCA 1C0AA 3RERA 1I8FA 5ELNA 5AJ3L 1PHJA 1CK1A 2RB6A 3QSUA 1LTLA 1KRSA 2ZPFB 2XNAC 2NVQB 1JWMD 1D1KA 4EMKB 4M8AA 1SN8A 2DRMA 3OYHA 5CV4A 2VQEQ 4A3IB 4P75A 4A3CH 3KF8A 1JEGA 5FKAC 1YWOA 1VQNT 2FPEA 1GKHA 3BVZA 2E41A 2V8IA 3E9HA 1GHKA 2BE7D 3GOXA 4F7UA 2NZHA 4ULLA 4CGYB 4DKAC 1F9SA 1PTOB 3X25B 3A8JE 3PO3G 4E2FB 2EY2A 1Y1VH 2XWBB 2KQWA 3E9IA 5FROA 2B2UA 1AOJA 2DILA 2H8HA 1DJRD 2JSOA 4M77G 2WSEE 3JB9D 3MFGA 2A68D 4FL6A 3CC4A 3ITPA 4AIMA 2FJ2A 3CD6A 2RQWA 3MXNA 4BBRH 4GNXA 1JOKA 4M7DE 3EGDB 2K33A 4CKCA 2I0NA 4ZN3A 4K0KL 4GLKA 2KVQG 3QBYA 4FF1A 2PVGB 1BI1A 4Z02A 3OIQA 2NTTA 4LF6Q 3D0FA 1LNXA 2R93B 3CCVQ 1WJRA 5C44H 2KK4A 3RZOH 4XIGS 1B3QA 3JB9I 1QCOA 3M58A 2XDBA 2IT1A 4CC3A 1G2SA 1UB4A 5C3EG 4FNFA 3X26B 5I4DA 4DUYQ 3FJPA 3A8LB 2O31A 1PH8A 1QLYA 5LJ5e 4GS3A 4YWLA 1T5EA 4L5QA 3NWTA 3CP0A 4PJOG 3MXGA 3CF5A 1PRTD 1ZA2B 4ZCKA 4BBSH 1S72Q 4LMQD 1X56A 1TS3A 1HA6A 3M9BA 3BFMA 2JP1A 2RD1A 2R7FA 5C4ZA 3BDCA 4IZ8A 2RO0A 3MCAB 1WCMG 3EROA 4DK3C 3RMSA 2A7YA 4C92E 2RVLA 2ZAEA 2BCOA 4DV3Q 3SK4A 4DV7L 4X64Q 1ICFB 3I5SA 2DJQA 2YLCA 2F52A 4UHVA 4FT4A 1AT1B 5ELDA 4JYAQ 3VYTA 2VKNA 4N0AC 1M1KR 4LAAA 1HZAA 1N8RC 1G8ZD 4C0GA 2EYXA 5CKDA 2AHOB 2CS7A 2X4YA 2HKNA 1FXXA 4EMKA 1KQSS 2D6FA 3EG3A 2A69C 4X62Q 3QUIA 2F0OA 2L1BA 3FB9A 1AVZC 3CPWA 2JE6I 2RCNA 2LY7A 1ENAA 2JA6G 2EYPA 2B2WA 1HUNA 1Z9ZA 4AG2C 5A2QE 3G71A 1VQ7A 3PGZA 5JVH3 1WTWA 1E2VA 2A74C 2JA9A 2V8KA 2XVSA 3GLXA 2CZ0B 4L6TB 2QTXA 4HKEA 4DBRA 1C48A 2L4NA 4QF4A 3VS6A 1D0XA 5KYWB 4B3TQ 2M51A 1ZSZC 3DEOA 4HMJA 4PJMA 4M77E 4XTUA 3VS3A 2D62A 3TCJA 1G51A 3VS1A 3EQLC 4KH1B 3CU7A 1PH5A 5JJIA 4BY7B 3OY9A 3PUZA 2ED0A 2PMZB 3E0JA 1SHGA 1TG0A 1WI7A 5KEEA 1H9KA 1VMCA 5I9OA 3EGDA 1D5MC 1C6VX 4C8QF 2Y0SG 1K9MR 2HL5C 1TR5A 3QG1A 4C1NK 3K80C 4DNTB 1XJVA 3E9FA 4C56C 4M7DC 3M56A 2P0PA 2K75A 4CDDC 3J7YW 5IP9H 4BXXG 3LYIA 2RJCA 1A2TA 2MI6A 1YJ9Q 3O13A 3CBPA 1Y96B 1WTOA 1FWZA 3OW2A 2Z0WA 3EHRA 3D31A 1S5BD 3C3LA 3NTKA 3ND8A 3CMAQ 2L3SA 4R4OA 4A3DH 4PJOE 2A19A 3R8BA 4GBQA 1UHFA 2B2VA 1ZLMA 3H0FA 3CCJA 2CSIA 3ZFJA 4DR2L 2XKOC 4ILWA 2P0QA 2X4JA 1FMKA 4OHJA 3WVDB 1WVLA 4C5EA 3MP8A 1I0CA 2GF7A 1SXTA 4L5TA 5EGTA 1L0WA 1L0YB 1SJED 1TWBA 2L89A 5IH2A 3J81L 4RA8A 2KMTA 4QQBX 2PVOB 1HQMC 5JVG3 2CUDA 4C92C 2FMMA 5IP7H 1QILA 2CVRA 4QKUA 4A3MG 2UUBL 1XMOQ 1X01A 2JA5H 1O7ZA 4C3IH 3VR2A 3Q22A 1GXDC 2O01E 4BDYA 1EQTA 4P5NA 2FB7A 2RSNA 3W1BA 2LQNA 2O9SA 3OYGA 4A3KG 4YIJA 1YJWT 2DJZA 1TY0A 4YCVA 3PFSA 1S5DD 3HKZB 2J06A 2QQRA 2DL7A 5LL6X 4IFDG 4ATOA 4LFAQ 4J1MA 2IPOB 3QWXX 4PLIA 3TN2A 4JI2L 1DOMA 3VUZA 1TS5A 2B2TA 1I5FA 5IT9E 3MWYW 1YJNA 1PXUA 2EXZA 4K6LA 2QQAA 4X65Q 1GHJA 5KYWA 1B70B 1UGPB 3ZBDA 3UA6A 4DV6Q 4CC7A 3JCMW 2YV5A 4HN7A 1JOQA 4N4GA 4RTYA 4R55A 4C3HB 4LNPA 4LK1C 1TS2A 3HOYH 5FU6C 2E2JB 4M77C 4HR7B 3CC4Q 1F77A 3I4NH 3S14H 5BN4A 3C46A 4D6WA 1SDFA 3JSCA 1LT5D 1BCPC 1I94L 3BVGA 2F0QA 3OTOL 3TP6A 2R5AA 2RHSB 1YCYA 4FYDA 1MJCA 1G291 1Y96A 1JORA 2CP5A 3QJ6A 1VQ8T 3EAEA 3LH0A 2JA8H 2F0KA 2R7DA 4L59A 4X6AH 2I5MX 3HOUB 2DEQA 3RMQA 4ID6A 2OTLA 3TRZA 4AYBG 4JCVE 1LABA 4PJOC 2NVTH 4R4TA 3T56B 1NMGA 1X3FA 2J6KA 1BCOA 5LL6S 3FHWA 2B63H 1SNCA 1SNOA 1AE3A 2DZ9A 2PQWA 4F16A 3JB9H 2KCCA 2NVYB 1H8KA 3H0GH 4CKBA 4PMCA 2YU9H 3QO3A 1PFSA 2KI7A 2XWJB 2QXFA 2E6NA 1WXUA 2BE5D 1RUWA 2JA7B 1U5SA 3J80c 1B34B 3THKA 1ARKA 4RCNA 3BZDB 4OONA 4YY3L 1X9NA 1GCQC 2H5XA 3ND9A 4LUZA 2AQ1B 2E5KA 1JE4A 1KL9A 4OMNA 4JS5A 4OB1B 5FRMA 1I4XA 3G71Q 1KLGD 5KNCA 2ICEC 1VQ7Q 1SHFA 1IXRA 1F9RA 3LWUA 3VYGA 5C0XI 5ELEA 4B08A 1IB8A 4ZQ3A 1YIJT 5CORA 3J7AV 1EQQA 3V7CA 1K83H 3VRYA 1VQJA 1JB3A 5KCHA 1G3YA 3M54A 3MXUA 4RCCA 2HQEA 3CPWS 3MP6A 3CC7A 2NBFA 2K5VA 2KHJA 3URYA 4KV6A 1MV0B 4M7AB 3UE0A 4OELB 1VQCA 1X3EA 2E64A 1EEFD 2VQEL 4UDUC 4F7XA 2OTJT 3LNNA 1DYQA 5T1IA 4XQQA 1CA6A 1HR0Q 1DOKA 2HDLA 2DTIA 1A0NB 3EG9B 1IW7C 1O7LA 3CQZH 4F8MA 2F0WA 5DM63 1M1FA 4LDUA 3QIAA 4QJFA 5EAYA 4M4ZA 2OF1A 4FO2A 3T53B 4DXFA 4XQJA 1K0XA 2EAYA 5C0MA 2K5QA 4C8QE 2C35B 3CCJQ 1B4OA 1NMFA 1JB7A 5BR8Q 1M5Q1 3PE0A 2RM4A 1P92A 4KBMB 4ELYC 2K7VA 3DWPA 3PUXA 2OWOA 4HJ7A 2R7ZG 4EX5A 4HA8A 5IYDG 3QIIA 4OGEA 5CKEA 5KE2A 3OW2S 1X55A 1QVGA 5DNFA 4B3SQ 3GTGH 1SBBB 4WF2A 4HIOA 2AUJD 3OMGA 1HD3A 2WSFE 3JCMV 5T1GA 1YBYA 4LF6L 3RDVA 2B2WC 2KUMA 2JXBA 3UDXA 2DE0X 1Q8KA 1SNPA 1WHKA 3L2UA 1E6GA 2EYJA 1Y1WB 1VQ5T 3E2UA 4GY5A 1B34A 1CTMA 2Q8IB 2QG9B 2BOSA 2WSCE 3PIPA 2WB1B 2NVXH 2PMZE 4GLMA 2UXDL 1MIUA 1SE2A 1PH6A 3MVVA 4DV2Q 2C5CA 2VUMB 3VKIA 2X69A 2ZPBB 1Y57A 2RJFA 1W3SA 1A6XA 2CZ1B 3A8OB 1HYOA 3EFRA 4IKFA 5M5WB 4II1A 4AG1C 2KCMA 1SFOB 1YJNQ 4PQXA 3VS0A 2A08A 5GAMh 4X64L 3CMEQ 2KE9A 4KI0A 4JI1Q 3I91A 2NYZD 2ZM6Q 5EPLA 5C3EH 4O5VA 3SHLA 1Q1BA 3T9NA 4M7AA 2D1XA 2OI3A 1ONLA 2DA9A 3X28B 5GAOl 2LP5A 5GAN3 4JS4A 1TS4A 2RA4A 4FYWB 4JK1C 1KSWA 4X62L 1FJGQ 2FZGB 3GTPH 3KLRA 3VS7A 3HFOA 1YP5A 4DR6Q 2NN6G 1SRUA 4OP0A 2ZXPA 4LF9Q 4QIWE 4BI3A 1KD1R 4WORA 3M59A 3R2TA 8ATCB 3VR6A 4RGNA 1CZGA 2IJ0A 4AFQC 2OTLQ 4L6V5 4A3FG 4NPSA 1HHVA 1DD2A 1YEZA 1QQJA 2BH8A 2NB0A 4C8QC 2VXFA 1YI2T 5GAHC 2EZVA 4BY1H 1PLFA 3UDFA 3S2DH 5IWAQ 3PF4A 5A2QL 3HKZE 2CQAA 4M75D 4JI3Q 2KROA 4AFZC 1MMDA 1FNVA 2QDLA 2F0GA 1FL0A 5M5XB 2X35A 4NB3A 5J26A 3M3YB 3I56T 4RH6A 4DV5L 1I4RA 2VB3X 1IGUA 5DM7R 1GFDA 1SNDA 3UATA 2CQOA 2RJDA 4NP5A 2CH4A 1M4VA 3HOXG 2V4DA 3HOWB 3GTMB 5LMNL 3UA7A 2WAQE 1WTQA 2DBMA 1TSFA 3D6CA 1BI3A 3T1HL 5IYBH 1M8VA 1HFGA 5FRNA 2EY5A 5LMUL 4HIKA 1CKAA 2ABLA 3OYNA 1L0XB 1BNZA 2EQSA 4YCWA 5C4XG 2GFAA 4K5XA 3I5RA 4FCYA 4PZ8A 1HNZL 2ZPHB 4RKLA 1N6AA 3VYHB 3CC7Q 4KTAA 3R6OA 2EQMA 4APVA 1KQ2A 2KXDA 2I5LX 1R8OB 2A6HD 1TQOA 3L9AX 3A8HB 1SROA 4HCEA 3UDIA 4WJ4A 3CCMA 2G9HD 4LDXA 2IL8A 4A3EB 5C0XH 3RLNA 3KUFA 4A3CG 2L3RA 3EG2A 4FXDA 5CGKA 5M5YB 2HD3A 1VQ4A 4M1UB 4A93H 4XT1B 5CYUA 2E4HA 2AHJB 1GL5A 3R3OA 2L2PA 4FYVB 3S1QB 5IGFA 2YT6A 3SGIA 4DN4M 3S2HH 2VNUD 4DV0Q 1FMWA 1BBZA 3PMIA 3URGA 1TUCA 2ENBA 2KHSA 5C4JB 4DV6L 4R4CA 4TQUS 4FSXA 3NGPA 4RMOA 2EQKA 4PMWA 5AJ3Q 2VW9A 4A3MH 1KIXA 3I3CA 1MBYA 2D0QB 2V1CC 2VZAA 2GBQA 3S24A 1U9RA 2MWOA 1Q46A 1UE5A 3H91A 4PJNA 2JYOA 4FDBA 4A3KH 2ZXRA 4BBRG 3JCMd 3PV0A 4C3JB 5FLXc 3GTQH 1PD0A 2DY7A 1EIFA 2QGQA 4XXEA 1PV4A 3TS2A 2YRDA 1N36L 2X3XD 3ULRB 1KFZA 2OXPA 3E0EA 5IN1A 1U4PA 4XYOA 1CHQD 3UDGA 2EFIA 2JW4A 1FD7D 1MGSA 5FJ8G 1IKLA 1M90C 3E6ZX 3HG9A 1UUPA 3OSOA 2UXBQ 4CHTB 3QB3A 1K28A 4IUQA 4E7JA 5D3DA 1TXYA 2IVWA 3S17B 3HP9A 2OJ2A 2WKCA 5IYCG 1GUSA 4L5GA 4M7AE 5GJWB 1RL2A 4QY7A 1BBWA 1KHCA 3EHQA 3OYFA 1KRTA 2RNAA 1A3TA 3PGGA 1YITA 4K0KQ 3S15H 3OS1A 1D3BB 3SDZA 3DEPA 4KD4A 4QL5A 2E2HH 2YDLA 1LTID 1PZKD 1UEBA 1PH1A 2B2YC 1O7YA 1C9OA 3MKDA 3OYJA 2EXDA 4J5YA 1TWCH 4DAMA 4GOPC 3KDFB 5G3LF 1JQYD 4FXKC 1N8RU 2AUKA 2HBPA 2MF2A 1SEBD 1YHBA 2H1EA 1TOVA 3L2RA 3KF6B 1KG1A 4A3GB 2H3JA 1HRJA 4Z9CB 1Q7YU 1S5FD 1E6HA 1U0LA 3DMUA 2BDOA 4A3JB 3META 1TWHB 1R0BG 2JQOA 5HK3A 5FO9B 4DOWA 3JV3A 3EBEA 4XU3A 4LE9A 3CCQT 2HD0A 1VQGA 5JPMC 5KYLA 3SR1A 2CP7A 5I2MA 2F3VA 1ZSZB 2WP8J 1G2BA 3W1GA 2UU9L 1G83A 2BKDN 1C1AA 3LX7A 3G4SA 3E9GA 2XG8D 1TUGB 1A2UA 1LTTD 3DKMA 3V2TA 3IKJA 2RF0A 3OYLA 4AFUC 2MIOA 1NG2A 3HOZH 3UF4A 6AT1B 2EYHA 2NUTA 2AQ3B 4UPAA 1RODA 5IT9c 3INZA 1JJ2A 1K1ZA 2IW3A 2J0TD 2OQ0A 3M5AA 1SEMA 5IP9G 3T51B 2HCCA 5EBDA 5JEAH 3NQIA 3V8JA 3NFCA 1VQLA 3IRBA 1OO9B 3PSIA 2QA4T 3JB9F 1E3PA 3HOVH 1FYCA 2P5ZX 1UGRB 4FYXB 2QEXA 2MAMA 3P75A 4AQYL 3GNFB 1VQ6A 2EQIA 2AIRB 4NKLA 2QGGA 3KOJA 5BR8L 3I4OA 3MXPA 1BOSA 1PFMA 4KLKA 4QQGA 2EW3A 2MYSA 3OQ5A 5GANj 1SYBA 3GTLH 1RAHB 1VYTA 3PO2H 1D3BA 2RK1A 4B3SL 5JJZA 3LGJA 1X27A 1LV9A 1AZQA 1WHHA 2NWGA 1ZHIA 2J7ZA 4BDZA 4DFAA 4OB3B 4N0AA 3OYDA 3REAB 3PMFA 5C6SA 5IP7G 2QYZA 2DKGA 2SRCA 3EH2A 3L1AA 3LGFA 5FW9A 2B29A 3K5OA 1I6VC 2PI2A 3VJPA 1PRTF 3KDFA 2JA5G 4PNYA 5FO7B 2N49A 4C3IG 1RF2D 2RDFA 1GFCA 1HTLD 3KF6A 3GD7A 4H0LC 2DPPB 1A3UA 3ASKA 3HSBA 5CV6A 2EYOA 1QP3A 1IYUA 3L2PA 3F2CA 1JU5C 4DR2Q 4DV2L 1JT8A 2CKKA 3BZKA 3NPFA 3JCMf 3J80E 3GIBA 5IYDH 1Z7TA 1OYXA 1PRLC 1BO0A 1ZXTA 1YNJC 2EPBA 4X3UA 3KUPA 3M0TA 2L55A 2N3SA 2DIGA 4JG2A 3TP8A 1VCIA 4JI4L 1M27C 3P8HA 3MTSA 1ZSZA 2LTOA 3X24B 1YNNC 1NR2A 1BQQT 5J1ZA 3PO3B 1WHGA 2KJXA 4JI1L 1IHZA 2UUBQ 5FU6B 4WJ3M 3HOYG 4M77B 4QQDA 2F4VL 4MIUA 4JV5L 3K7AB 5KYNA 2XTIA 3RBBB 3BJUA 3NENA 2M9UA 5GAMj 1MMGA 2ENMA 4E7HA 3BS1A 3GTJB 4OO1I 4L63B 4NXMQ 1KLUD 4JI5L 1KK7A 4NL3A 1BCPB 1LTGD 2D0OA 2MPXC 3BVMA 2NUPB 1K4US 2CDTA 3M85A 1K8MA 1WZOA 4RTZA 1SYDA 1S72T 1ZKOA 1FGUA 3CQTA 4C2MH 3IQLA 4FP5D 3OS5A 3I7FA 2LQ8A 4LF9L 2H3EB 3H41A 1M1GA 4QUFA 3CXCP 2L8DA 3KFVA 2K52A 3ERSX 2ROLA 1I3QB 1QOHA 2AKWB 1S5CD 1VQKT 1M3AA 2BZYA 3M0RA 4PJOB 1HJDA 5GANd 3RLFA 3L2WA 3FVQA 3JAMi 5IWAL 1ZUUA 3ULJA 4C3HH 1YITQ 5HGTA 1KIKA 1WCMB 5GAMe 1MHWC 1I94Q 2PNIA 1WFQA 3QHSA 2FFKB 1MNDA 1STBA 4QB4A 3JB9G 1OTCA 1D1AA 2NN6H 3NE5B 3C95A 1VYUA 1TWAB 1Q86C 3H0GG 1G6PA 2KBTA 1OULA 2K2MA 2ZPEB 3JCMP 3P20A 5A0GA 1SKUB 4GLVB 4JI7L 3GNGA 5IHKA 4Y91A 1OX8A 3CCRA 2K5LA 2F4IA 3CCEA 1U3OA 3H6ZA 1QNUA 1VQOA 4OF1A 2XRSD 3FDTA 5LJ3g 5C3XA 1G3SA 1G8XA 2F0FA 2OCEA 1PH3A 2JA6B 1NR4A 2VV5A 1RAAB 3OHXC 4X3KA 3FLGA 3QOJA 3D3RA 5CK9A 1Z6HA 3DWAA 1EFWA 1CZWA 1PCXA 2TMPA 2VGNA 3CAMA 2F1MA 3G4SQ 1YJ9T 2ICIA 4M77A 1CKMA 5FO8B 1Y8NB 4X3TA 3STBC 2ATWA 1I1JA 2X6LA 2RDGA 2QK0A 4DK6C 4G7HC 4JVZA 4DNRB 4YY3Q 1NLPC 2Y0SB 1VQPA 1D8LA 3NQTA 1VIEA 2NUPA 4IOCA 4KKUA 2VYTA 1F2ZA 3PNWC 1KDBA 4YWMA 2KYBA 2ED1A 3OYAA 3S1RB 4OMPA 3I90A 2PO4A 1QNKA 2E6ZA 3U23A 3CRLC 1PKTA 4LFCQ 1W2BS 4DV0L 4X66L 4N8X1 2QEXQ 3FEOA 2E8GA 1DZ1A 4PJOA 1VQ6Q 2HSEB 2PI2E 4C5GA 2HSPA 2NTSA 1JJ2S 1V1PB 5C5LA 3S9WA 3KJOA 2EYLA 2J4XA 2G6FX 1EY0A 3BDLA 4ABNA 2C0IA 1D6EC 1UGSB 1X43A 1EIHA 3TP5A 2QI2A 3M0UA 4V190 1ZA1B 4ME3A 1NTGA 4FU6A 3RR6A 5L8RE 3J7AF 1BR9A 1XYIA 3M7GA 3LWHA 1HZ9A 2C06A 2M9VA 2UXBL 1JRIA 3FMCA 1GCQA 5FU7C 1QE6A 3S16H 3J81j 4WCIA 1MHNA 1AWOA 1EIGA 5DLOA 2EY1A 3OPOA 2FYKA 4XTYA 4KRTA 2LT1A 1AW7A 3KLSA 3DUZA 3V7SA 1PH4A 1VQNA 4M78D 3V8LA 1KDCA 4MTNA 4HAEA 2A6EC 4P71A 2IX0A 1KDAA 5FJ8H 1DXMA 2SEBD 4J9FA 1AFPA 3UDCA 2DF6A 3ONAB 1LACA 1VQAA 4LN2A 3KK7A 1CKNB 4EQNA 4A3BB 1BYMA 4EDUA 2EYQA 5GANf 3CC2T 1GUGA 2VXWA 2UXDQ 2RQVA 1QVFA 1MKHA 5IYCH 2DTOA 1CQVA 3H3VH 4E7IA 1JXOA 4F17A 1S40A 2E2IH 2RHUA 2KOLA 2LT4A 1I6HH 2PU9B 5C3WA 2UUCQ 3TREA 1VYVA 4X3SA 4BA1I 2K57A 2UUAL 2AWNA 1X6GA 2BIVA 2ASBA 3LLRA 4XQNA 3M4YA 4GN4B 5FWCA 3ER0A 4AYBB 2A73B 4C8QB 4XU2A 1V1PA 3OBWA 4J9BA 4NMZA 3RZDH 4BY1G 4LUDA 1BKBA 1IBKL 1H3HA 1B44D 2PW5A 3V8KA 5I11A 4M7DD 1AN8A 2E75C 3SK6A 1Q7YC 2K04A 4FW1A 2Z4IA 2RPNA 4O0AA 2WV6D 3Q23A 1UFFA 3I9QA 4B3ML 1N5ZA 2XDPA 2RHXA 3G71T 2A68C 1VQ7T 5NUCA 2GFUA 3DWQA 2RA2A 2C0OA 4P73A 5FLXE 2EYFA 1IHWA 1VOMA 2B39A 3RUXA 1WGSA 5AT1B 1HXDA 3CCRQ 3GP8A 5GAMf 2LFNA 2K3BA 1BI0A 3DB4A 1RKNA 1PH7A 1NBEB 3JCMh 3D4WA 2IG0A 2M0OA 4JI8L 5KYUB 2LJ0A 5J22A 5IYBG 3NMZC 1LVKA 1B50A 4C92D 4BI4A 2DIQA 3C4SA 2O9VA 1O75A 3CCLT 1PRTC 3BYYB 2Z6BA 1E1OA 1QCBD 1BF4A 3I35A 5D6YA 1V29B 1EY4A 4KJNA 4Q5VA 2R92H 2E3IA 1VQMT 1N9RA 1R77A 1YWPA 4J9DA 3ULLA 3HRTA 2DMOA 4DV5Q 1CKNA 1RI9A 3HP3A 5M5XH 2W0ZA 1VQPQ 2NZ1D 2Z0SA 3N5BB 3JCMb 5C0XG 5HCKA 5CCAA 2K03A 3OYYA 1TWGH 3UI2A 5LMNQ 1XNQL 4EPCA 1CKOA 2LNVA 4A93G 4CRIA 1N33Q 3T1HQ 2ZZDA 1TIID 2I46A 1ILQA 5LMUQ 3I72A 4QIWB 4KGVB 1MNEA 2YUNA 2F0SA 4GLAC 5A35A 1HNZQ 2ZTEA 2PTKA 2VC8A 5DM73 5CVIA 4C8QA 4J83A 1VQ9A 4EQOA 1M8AA 1OZ3A 3MHXA 5HGQA 3KLSX 2MFIA 4P72A 1QVGP 1U06A 2KXCA 2K7AA 2F0PA 2K5IA 3J80L 1NPRA 1OQKA 5HURA 4NXML 3I4MB 4FYYB 4ZNXA 4DQ2A 3J81i 1WJJA 3EFXD 1OU9A 2K28A 4A3IG 1ZX6A 2QF7A 4A4GA 4C0ZA 1M90U 1AH9A 2GA4B 5C6AA 1CFMA 4KN7C 1ZBJA 1X32A 3CMET 2RHZA 1LLRD 3E5SA 4QMGA 4YTLA 1R4QB 4QW2A 3HRUA 4DBHA 3K57A 1EQVA 4KHVA 2B8GA 1ASYA 3F70A 3M57A 4M75F 5KYUA 2Y0SE 3BW1A 3CD6Q 1AWWA 1W6KA 4H44C 2WAQB 4NDXA 4DR3L 1ABOA 1EFID 1N8RR 2BDNA 3K0YA 2JVVA 2YRCA 4PNOA 1P16A 1I50H 3GTOB 1N9WA 3S1MB 4BE1A 1NJIC 5IOCA 1N36Q 4OX9L 4LXCA 1ET6A 1RLPC 1RABB 1ESFA 1Q7YR 3D8GA 4TKOB 1PVOA 4GOPB 2MNAA 4HTHA 5ELCA 3DM1A 3TZUA 2YU9B 3G1JA 2KT8A 3PUWA 1D0ZA 1IBLL 2EJMA 3E3XA 4CBVA 1UHCA 2OTLT 2RBMA 2FPFA 1G5VA 1FVIA 5KNBA 4RMFA 4IFDJ 1T0JA 2XHCA 2B3GA 4PV1C 5LHY1 1HR0W 1S4ZA 5KIXA 3TMEA 4RCBA 4WRDA 1H9RA 2KNBB 5M9OA 2MCNA 1WIEA 1RAGB 2ZTCA 2CREA 2HBWA 2DVEA 4LUOA 1WTVA 2ROTA 4JRQA 1TH7A 2IX1A 1VQ8A 5GAN6 4A3FB 1QVFS 3M4OB 1MSHA 3V05A 2KRNA 4B9WA 4JRPA 1K8AU 4E7SA 3A7AB 4DR1Q 3GO5A 2DTHA 1Z47A 2MOXA 2DD5A 1C4QA 4LNQA 3HOZG 1U1TA 2DYIA 2CYZB 2RN8A 3VDYA 3C12A 1D2BA 1S3OA 4RTUA 2PVDB 4N4HA 2HIVA 1WLPB 5GADC 5COYA 1NE8A 1TWFH 4J9GA 5JEAG 2YSQA 3HHTB 2DNEA 1BK2A 2DJFC 3MA2B 3Q8DA 4N4IA 4LFCL 1ZYRD 5FOBB 4DGZA 5LJ3d 3CXCS 2E3HA 4V0BA 3HOVG 2UU9Q 2CP2A 2DXBA 3FKIH 3G6ET 2VQFL 3HOXB 3BZCA 4O2DA 1L2FA 2OAUA 3OMCA 1OOTA 1K73C 2XICA 3CC7T 4PJJA 1I4HA 2PZWA 3MEUA 1PZID 2HCIA 1YHQT 1EY6A 1IGQA 2SNSA 4KKSA 4JBWA 2D8HA 3UE1A 4HJ9A 3PO2G 4BY7G 2E12A 3HZXA 4YWKA 2YWWA 2B2YA 4YHHQ 2MO0A 1R9TB 5C4XB 4GOPA 4LF7L 3AEVA 2M16A 1PTOD 2J6FA 1YIJA 1PRMC 3R6NA 5GANh 4M75G 4G4KA 4HSPA 4AYBE 2Q8RE 3GQBA 4AQYQ 2EBPA 1IL2A 1FMVA 3GTKH 4HVWA 1MMAA 1YN8A 2JT4A 3RKYA 4AFSC 5EPKA 4R4QA 2BE5C 4QVCA 4K5VA 3BYTB 1EWIA 4OB0B 2OTJA 1K8GA 1AHJB 4UP7A 3CBMA 2RHQB 2XSCA 4LD6A 3FEWX 1O78A 1GUOA 2JS0A 4OVAA 1HH2P 1ZUKA 1SYCA 2Z6KC 5DY9A 3CEYA 1Y1VB 1VQ9Q 1TT2A 4GKKL 5GAGC 3S3NA 5M3FB 4JPBW 4J6HA 4RKBA 1RJTA 2DBKA 4I65A 4BBRB 4HXJA 4MMLA 1O80A 3AB9A 2R6GA 1CKBA 4OB2B 2KSSA 1Z9QA 3JC66 2L0CA 4QVDA 5IGBA 1NCVA 1SE8A 1YZ6A 4OIKA 1KC8U 3N6RA 4H02A 2LMCB 5C44B 2UUCL 5I21A 3I4NG 2F2VA 3RZOB 1IZ6A 4ZGJB 2XGTA 2QTVA 4JI4Q 1BIAA 2NYSA 1AEYA 3EGUA 1LYLA 1EWCA 4KY6A 2RI5A 4BBSB 2F4VQ 1HNWL 1VQ5A 4JV5Q 1B2TA 5E3FA 1PDQA 1ZUYA 1A3VA 3SXHA 4C3HG 4JI5Q 2FG0A 4LJZC 3S1NH 1PMRA 1BXTA 1UG1A 5FLMG 2ZTDA 4BE2A 3VR5A 4U673 4ZN1A 2EGCA 4X1VA 2GTOA 2I5HA 2QGFB 5E1FA 1WDXA 1W6JA 1J8IA 2DL3A 4MDWA 4A4EA 1G2TA 1MJEA 2CWAA 1Y71A 2A0FB 1Q86U 3MHBA 2GTJA 4HEDA 4JOIC 4KHZA 4LF4Q 2V1RA 2RMOA 3C94A 4DA4A 3BG3A 3NWSA 1JMCA 3OWEB 4WJWA 1TTHB 1VA7A 4RGTA 2M0YA 2J6OA 2ZCFB 2K50A 4QCLA 3QYHB 3EG1A 4DK1A 1AWXA 1NBWA 1Q1EA 3HOUG 5IODA 1Y0MA 4FF3A 3SHWA 1CQFA 2LSSA 4DEXA 2VWFA 4L8JA 3AHUA 3TQYA 2PPBC 1IHVA 1RCVD 1I4K1 1X54A 5FLXL 3QWNA 3KXTA 1PFNA 5GAN2 5ELOA 1VQ8Q 4IJHA 4NXNQ 2AKLA 2HL3A 3M0QA 4LF8Q 4G57A 3MFYA 4JI7Q 1B9MA 3TEHB 1A0IA 4J7FA 1CSKA 1SLJA 2Q2HA 3T1YQ 4WTOB 2FPDA 1YI2A 2E5LQ 5GAN4 2K4YA 1X69A 1ABQA 1TS9A 3OIPA 4I7AA 5JOBA 1K0SA 1XX8A 1MMNA 3Q1JA 3A0JA 4KN4C 1UNSA 3ZYYX 1N33L 3MAQA 3PIP3 4PKCC 2PUKB 3JRZA 2GCXA 5EKKA 4Y7NH 2RJEA 1I4QA 1F2YA 4A3DB 1RAFB 3JCMe 1I5LA 3MEWA 3G48A 2CW0C 3KFUA 1NAPA 1JJGA 2F2WA 2F5KA 1SMXA 4FF2A 3EFOB 4C0DC 1GVPA 2F0EA 5GQOA 3ME9A 3ZEHA 4B9XA 1V8QA 2DM1A 2JTMA 2LCCA 2KECA 3H09A 1F9PA 4B6MA 4JZ4A 5DLQE 2HQLA 1RHPA 2OT2A 2MPMA 2JA5B 5M3MH 4AH6A 1ESRA 4C3IB 2AK5A 3GBQA 2Q2TA 4X66Q 1JBMA 2RK2A 4MZPA 2WKDA 2XN9C 5CKFA 5FU7B 4F14A 4DV1Q 3FPUB 1B7TA 2GVBA 3A1PA 4R1JA 3HTRA 2EJFA 1VQHA 4HJ8A 1QKXA 2LDMA 1H3ZA 1EYAA 1RACB 2G3RA 1WI5A 2FVUA 1IL8A 4JBJA 2EE1A 3B6YA 2D9TA 5GMKm 4A4FA 2NUTB 1MI2A 4TVAB 3K5MA 4UY8C 3PIOA 2NUZA 1U4LA 1PWTA 5IT9L 2Z8LA 2NVQH 1F1BB 3RKXA 4FVMA 4A3IH 2CP3A 1X3QA 2F2XA 1TU0B 3OYBA 1AE2A 4BY6C 3TQ7P 1V1QA 5GMKi 1Z9FA 3VA5A 3HOYB 2FINB 2EGAA 2YUPA 1J3TA 2K5HA 2N78A 1LM0A 3CCUT 1Q82C 3I4NB 3S14B 2K32A 1XOVA 4JJBA 4BD3A 2MGSA 3MC0B 3U9SA 4KY5A 4PG3A 1WTRA 3O8VA 1FYNA 1PTOH 1Y1WG 5IAYA 1EZ6A 1KQSP 3CHBD 1PSEA 1Y8OB 2F3WA 3EFSA 2A6HC 4E6IA 2JA8B 1R4PB 5EQ0A 1PG5B 4JRIA 1EU3A 4D8KA 5DEHA 4EGVA 4OO1G 2OX7A 1LTRD 2F0TA 2JJ9A 1VQ5Q 2R3ZA 2CH4W 2JJQA 4JBKA 2R93H 4DR1L 2XIDA 2NVTB 1BI2A 4N8FA 2C0TA 3L3OC 3EFOA 3DHQA 1HJPA 1EL0A 1CHPD 2KCTA 5CV9A 2B63B 1BUVT 4OWTB 5CR2A 1MGQA 4I7ZC 3LH5A 2EKHA 2JEBI 2YLBA 5IHNA 3H0GB 2O5IC 1JICA 2FZKB 3PT9A 2UUAQ 4ANJA 1UEAB 5BN5A 4OMMA 4DEYA 1SRLA 2K2VA 4CJ0B 2FEIA 2R58A 2B86A 1T3LA 4J9HA 4R8IA 1CM9A 1K8AC 3AT1B 2Q8TA 4M7AD 4K14A 4CDCC 4OWXB 1LUZA 3SVMA 1W2BA 5LJ5g 3RN5A 1IBKQ 2RH2A 1TKWB 2FXQA 3MO8A 2JM8A 2R5MA 3WXMB 1QWEA 1STAA 2FZCB 3BDUA 1RDPD 1PRTB 2LS01 3FPPA 4YHHL 4D8DA 2JUFA 1H9MA 1EX4A 4DR5Q 1OU8A 3SK5A 3OB9A 3GF5A 1AZPA 3TBIB 4B3MQ 1EWHA 1K83B 4PZ6A 1EYCA 1HXYD 2R92G 5IGGA 2XU8A 1SYGA 2YTXA 4IPHA 3T16A 3CCQA 5EJWA 4DR7L 2DN8A 4Q0FA 2PQAB 2LXKA 2VY3A 2AKKA 4BE0A 1HTPA 1X65A 1YI2Q 3VU3C 1VQ6T 4DV4L 1ZSGA 2COZA 4NW2A 5EBCA 3WOEA 1QCFA 2ES2A 5L37A 1QP2A 5CAIA 1ML0D 4M78F 4JI8Q 2RQUA 3RIRA 2PZTA 1J9OA 3CQZB 3EVQA 4BY7H 1OV3A 2QCPX 1XTCD 4RKUE 3EIVA 3I55A 1OXUA 3HOWG 4MTKA 2DJGC 4EIKA 3NBHB 4GLXA 1KNEA 3EA6A 2K79A 4RG8A 3RMHA 2UXCL 4IURA 4PFOA 4XQ3A 4RWSC 2DUDA 2LMJA 1VF5C 2HIXA 4DOVA 2G9DA 2OEOA 2V26A 3K6OA 1Y8PB 1LT3D 1WHMA 3CCMQ 1M90R 1CSPA 1WD1A 5D6XA 5GAN8 4N9PA 3GTGB 1BVSA 2F0LA 3VYUA 2AMCB 2F69A 4EMGA 3M0PA 1XNQQ 1VQ4Q 4ME5A 3OS2A 2EQUA 1UUEA 1SJHD 3NEMA 4A3EG 4A4KA 4CC4B 2RSOA 5GANe 2Y4XA 1MD2D 2WIIB 1W70A 3M0SA 2GQIA 2AZVA 1K76A 4MZ9A 3TSSA 4M7DF 3CCVT 3CKIB 3AU7A 2NVXB 1SMYD 1T9HA 3JCMc 3PF5A 3K8AA 4F87A 4KUDK 1PC0A 3N52A 5KGUA 1I4PA 4DAPA 2V1QA 3OYMA 4HCCA 3C1FA 1OXSC 1SYFA 4HVVA 2ZXOA 3BU2A 3QOLA 4RHSA 2ZJQA 2O2OA 2RI2A 1NJIU 4Y92A 1L1OA 5CBEE 3A5UA 5I6WA 4DR4L 1KC8C 5LJ3h 3OYIA 4C3JG 1M9SA 4LDWA 3S1QH 4LF4L 1HNXQ 1Y07A 1UDLA 5F2DA 5C3EB 1EU4A 3R93A 2PQAA 2Y4YA 1VIFA 2IHFA 1NEBA 5KNDA 3G6JB 3WVEB 2MQHA 1QB5D 5I2SA 2E5QA 4C92F 3A74A 1IREB 3GTPB 1YNXA 2DL8A 5D65A 4DR3Q 2F0IA 3H3VC 1K8AR 4HSVA 3AFPA 2E2JH 1S1NA 3X20B 4ZLTF 1QVCA 5FLMH 2A8VA 1XTDA 1S72A 1JCKB 3G7ZA 1OXXK 4HT9A 3F8TA 3NBHA 4OX9Q 4LD9K 2YUOA 3LW5E 2M00A 4YCUA 1WTHA 1VQEA 4NXNL 4EQPA 4IUVA 3ERQA 2D8JA 2KQ3A 1U4MA 2L5TA 1XNRL 4QUCA 2B8AA 3UWNA 4A4IA 5ISRA 4LF8L 3F1ZA 4BY1B 3L7ZC 3W5OA 2XMFA 3S2DB 1IBLQ 1VQKA 2DL4A 4M78G 3CPWP 4CJ1B 4QGUA 4JBMA 3SFMA 1LTBD 3K5LA 3T1YL 3HOUH 4RG1A 4WFN3 1RAEB 4UAIA 2D2CC 2EJFC 3EJIA 4MNOA 1G3TA 4FF4A 2HDAA 5ECAA 5HK0A 1VQIA 3P1HA 3I2ZA 4OXPA 4A3GG 3J7ZC 3RN2A 1CUKA 2K5NA 1ZQ1A 1QUQA 2L9HA 1SSHA 4LFBQ 1JB0E 2DXUA 1D7QA 5E4XA 3KBXA 1J6QA 3C1EA 3NTHA 3QO2A 3SEMA 3FKIG 2L5QA 4HIDA 2K05A 2NVYH 3L2VA 4MZMA 1CT1D 2F3IA 1K73U 2FRWA 2KYMA 2CZ6B 4LUVA 3CMAT 4A75A 2JM9A 4J6WA 1WD0A 2OQKA 2JA7H 1AD5A 1IXDA 2FO0A 4KT0E 3SE0A 1UE1A 1QWYA 3FRPB 3QDRB 3R2IA 3OW2P 3JB9J 3PQIA 2K5DA 1VQLQ 1SR3A 2PYKA 3TSZA 4M7DG 3HRZC 1VQFA 5JJKA 3FIFA 1VS0A 3F2BA 3CCSA 1BBXC 5IY0A 2JEAI 3H15A 3NSWA 1YJ9A 5DAUA 3E19A 4DV1L 1GOZA 2VQFQ 4JC0A 4GN5A 5CIUA 2QDBA 1B07A 1RADB 4K8JA 1E1TA 4JJNK 4JI0L 2E70A 1GD7A 1KTKA 4A93B 4XU0A 3PVLA 2LRQA 2EVBA 2YTYA 4F7UF 4RHRA 1V1CA 5EKIA 1LJOA 3FRNA 3TVTA 4IJLA 3I55Q 4KD3A 2R61A 5IIFA 3JAMc 2QEJC 4J6YA 4ORZA 1HQRD 2VL6A 4DUZL 3S2HB 2QQBA 2IHEA 3HEJA 1NYFA 4O6JA 1SSFA 2XD0A 4RGMA 4LF7Q 1U8RA 2VVKA 3ICEA 3CRKC 1SG5A 4A3MB 1O9SA 4RTWA 4XTCS 1KC8R 4VUBA 4C92G 4M78E 3QZ5B 4MZTA 1NPPA 5GAOq 2N55A 4JLGA 4RCOA 3A8MB 5HKCA 4A76A 1XMQL 4XTXA 2SEMA 1JWSD 4A3KB 3MP1A 3GTQB 2LXJA 1X6OA 4E7KA 1K9MC 3CC4T 1XJWB 1GCPA 1VMPA 1IBML 3CD6T 1UTIA 2E10A 2KR3A 4ELZC 2XK0A 4JJDA 1WTPA 1LTSD 2KRSA 4GN3B 5GAN7 2DYBA 5EPJA 2JNGA 1XPOA 2QQSA 4Z8AA 2VB2X 4DAYA 5JAVA 1WFWA 3M9QA 3U58A 3DLLA 4GKKQ 5LJ5j 1OPKA 3MJXA 1Q86R 3C2PA 2A69D 1Q90A 3AFQA 5GMKh 4U68A 1PHTA 1MUZA 2RQTA 4ZAIA 4GZYC 3S15B 2K4KA 2X6GA 3MEAA 3D4DA 1Y1WH 4KK7A 2ZGWA 2A36A 2CFMA 5M3FH 2E2HB 2CSQA 2Q2UA 2N88A 1C8CA 1EYGA 4BB7A 2DY8A 3TDQA 2EJ9A 1EZ8A 1X6BA 1TWCB 4IUNA 2VUMH 3U9OA 2CT3A 1VUBA 4TSSA 3OSSC 4E6RA 2SDFA 4JUVA 1G3WA 5M5WH 1GM5A 1SFOH 4OO1H 1WYXA 2O2LD 3HPWA 4ALPA 2LX7A 2DZCA 2EY6A 1N34L 1HNWQ 5JJLA 3IFTA 2YXYA 4AT1B 5CO7A 5LMNW 3CXCA 4GKJL 2HKQB 3CC2A 4LW1A 2M2LA 1PTOF 4B3RL 1KQ1A 2E1HA 3MEVA 4DR5L 2L0AA 5I2XA 2KDSA 1K8OA 2Z6KA 3GDEA 1KABA 2AWOA 1DOLA 1N32L 1AWJA 3M4OH 3X3NA 1VF7A 2LJ3A 2VUBA 1UE6A 3I8ZA 3NPPA 1DJ7B 2E5LL 1VQKQ 1STEA 2HEQA 3HOZB 4M78C 2ZT9C 3CCEQ 2SOBA 5EKLA 4F7UG 4Q5WA 1VQOQ 2DGYA 1M8MA 1BBUA 1QMCA 1SSOA 1TVXA 2JN4A 1K9AA 2BZXA 4ZTJA 5CV8A 2Z1CA 2J05A 2SNMA 3X3MA 1GUNA 2O88A 4CI0C 4JDSA
chains in the Genus database with same CATH topology
2XDDA 1B53A 2MUYA 3K5NA 1HCZA 2PQEA 4IN3A 3HOVB 4KMUC 4LDVA 5LJ5d 5K36H 5J3BA 2F0HA 4C0DB 3GTLB 3PO2B 3CCJT 2JZ2A 4IUUA 2ZPIB 3TP7A 4OGQC 1BDOA 2VXEA 5GAOr 1U1SA 5CV7A 1GJXA 5D14A 2DXTA 3CCLA 1W4SA 1SNQA 3S3OA 4JRKA 1OXTA 4M75B 4DA2A 4M77D 3OYEA 2YRVA 1VQMA 3RD4A 4XTZA 4XT3B 1VQ9T 4HCSA 3OA6A 1ENCA 2R7ZB 1BCPD 2X4WA 5I9PA 2IX3A 3S3MA 3SWNC 4OL7A 4BY6B 5A0LA 4OIJA 3LX0A 4TVRA 1YJNT 3JCMg 1Q82U 4PJOD 4F7UE 3V96A 1E2ZA 5LJ3j 4R56A 1NSNS 5C0XJ 2Y90A 1F2MA 3BDOA 2MHVA 4C2MB 2EQJA 2FL7A 3UT1A 1YJWA 4KY7A 5D6WA 3Q6SA 2PCFB 3UPUA 4P2CB 3MEHA 3P8DA 2K3XA 3V7RA 5KCOA 3CMEA 3VYSA 2DD4A 1HA5A 4BI8B 1T5XD 3Q24A 2P0KA 4C1NI 5LJ3e 3F2UA 5JPNC 3JCMJ 1SNMA 2EIFA 1Q8IA 1ENFA 4M75A 2ID0A 3QJYA 5CKBA 1SYEA 1D5XC 4KKTA 3JCMX 1B1ZA 5IGEA 5GAOm 4IUPA 3SK8A 2JTFA 1KHIA 3QPHA 4C8QG 3L2QA 1IW7D 1VDZA 1X3PA 3AMUA 4HT8A 2CZ7B 4J8QA 1JWUD 3PUYA 4IQZA 2BUDA 1CI3M 3NHHA 1Y7XA 2EJGA 5CMDA 5LJ5f 4XTWA 3I70A 3A54A 4RG2A 4RFBA 2LX9A 1AEXA 4K6DA 3JCMQ 1GXIE 4X9DA 2HQXA 4K2LA 2RHIA 3P8BB 1FR3A 5E4WC 2B2UC 3PUVA 3HRSA 3IFDA 1KD1C 3NP8A 2EOTA 2BA0A 1H9SB 1Q12A 1TU2B 2DXCA 2GQVA 1H9JA 2FHTA 1JC7A 4FIBA 1EY5A 1PFBA 3G6EA 4J8OA 3H6MA 3GV6A 4ME7A 5KRUA 2M1HA 1YHQA 4A53A 3OS0A 1FNUA 5JEAJ 4NS5A 2KCNA 4FXGC 4XDXA 1WQ7A 2E65A 1Q81C 2E2DC 3T13A 2D5DA 2K3YA 4KULA 2O4XB 2XIWA 4IFDI 4J6XA 3NXWA 4XYQA 3S16B 1D5ZC 4CKEA 1FX7A 1E2WA 4ZK9B 4KJOA 1ZYRC 3CPFA 2WACA 5IGCA 3I73A 5CQXA 1XXGA 1WNLA 5GMKj 3M53A 4EMKC 1ET9A 4M7AF 2KEDA 2EDGA 2RHYA 4C8QD 2F03A 1EEID 5C4HA 2E76C 3W3AA 1PTOC 1CA5A 1B3AA 4X9CA 2E2IB 4DXGA 1I6HB 3OSVA 2TSSA 1OZ2A 5K5PA 1GUWA 2IWHA 2QKIC 5GAOp 2K5WA 1WJQA 2DO3A 1N27A 2WINB 1H9SA 5GANg 3I4LA 2RI3A 5KH6A 5GMKe 3JAME 1JOOA 4M75E 4E47A 5TSSA 1PSFA 3RZDB 2YHTA 1STGA 4KUIA 1QW1A 2HUGA 4ZGEB 2MP1A 5GAOn 4K8IA 2B2VC 4V2SA 3A55A 2XRQD 2CW0D 4FM4B 2O4XA 1HPCA 4MMKA 4DF7A 1EOTA 3Q0AA 5LJ3f 5HY6A 1TY2A 1M4ZA 2QDYB 2LVMA 1BIBA 1II3A 4BUGA 3NUCA 4IUTA 1KAAA 1XNIA 5GAMg 3D6WA 2R92B 2XI9A 2E74C 2F5TX 1SE3A 5KE3A 4XK8E 1QG7A 1M1KU 1QVPA 2K5FA 4O42A 1B9NA 2JXMB 1RTNA 1WQWA 1I81A 3I56A 2B2TC 1IKMA 4DK0A 2F0UA 1TWGB 4NL2A 1H641 5KYIA 4FT2A 1FNWA 1JR0D 3CCMT 5AFWA 4PLLA 1EY8A 4M7AG 1VQ4T 3IAYA 2L12A 1UAPA 1OI1A 2FMCA 3LGLA 4ZTFA 4TRDA 1WTXA 4IALA 2B8FA 4M75C 3SEBA 3TEEA 3TU4K 4N9TA 3QKJA 4RGOS 1K9MU 1ZBXA 3M7NA 3QZ9B 2CGHA 3K58A 1ILPA 2AQ2B 3A8IE 2I07B 3H8ZA 3GV3A 4K2KA 3HS0C 4MHEA 2NUCA 3T4AC 1MSGA 4F88A 1S5ED 2EJGC 4S3SA 3VR4A 1DCZA 5BN3A 4JLIA 5C5MA 2KEEA 1PYWD 4HMIA 1I50B 2F0NA 4Y28E 4MDXA 2IPKD 1N9SA 1X75C 1YITT 2MMPA 5LJ5h 3HFNA 1EYDA 4IFDH 1A15A 1E0BA 1FGBD 3FDRA 1PZJD 4H7BA 3CCUA 2NN6I 3DXJC 1SE4A 1QVGS 2DK3A 2F0DA 2LQKA 2EWNA 2F0VA 3RESA 2QILA 5CC4A 4O1NA 2MWPA 1F9QA 2LC4A 2I2LA 3OBYA 2X4XA 4C5IA 1LT4D 4G7ZC 3P7JA 4XTVA 2PNRC 2DAQA 1LT6D 4ZUIA 1HUMA 4M78B 3GP7A 5CQYA 3NK9A 3G4ST 1OXVA 1RTOA 1NZ9A 4R8NA 4OGCA 4EVOA 1TWFB 3KBGA 1EY7A 4PL6A 3L42A 3E1SA 2D9UA 3PMTA 1LOJA 1LO5D 4G7OC 1VQLT 5K36G 3FKIB 1AP0A 3PIO3 3MZ5A 3D4RA 3QYGB 3PTAA 4XAXB 1RD9D 2QEXT 3SD4A 3A56A 3A5ZB 3NTIA 1YNJD 2PUOB 3A8KE 3K59A 5CV5A 1HK9A 2F0JA 4M7DB 1EY9A 1YNND 3I55T 3OWFA 4RAUC 4ZRZA 4C5HA 2A3LA 2LCLA 2QA4A 3GTKB 3VA7A 5CBAE 3FC3A 1STHA 3BY7A 2RDHA 1IYVA 5EG2A 3SWNB 2FHDA 1F2LA 4PMBA 5J39A 1KNAA 3HGBA 3QXEB 3GPLA 4M7AC 2KA7A 5AYFA 4XU1A 5I6YA 2KAFA 2KY9A 3SB2A 4C92B 1NUCA 5GMKl 4OMFB 4M78A 1XWEA 2QQ9A 2P4TA 4DU9A 4QQ6A 1RI0A 3J81E 1GUTA 4LDYA 3S6WA 2JOYA 1Y69U 2RKSA 2YYZA 1G6ZA 1STYA 1ICWA 1DM0B 4ZKCB 1SAPA 4J7IA 2EYMA 5IGDA 4BWGB 2F0MA 1V43A 2RQXA 2V8JA 3RUZA 3CCVA 3OYKA 1STNA 5CKHA 2KVMA 3S1NB 3OOCA 2CHBD 4NOYA 4M7DA 3VYRA 3WOFA 1DONA 5GAN5 3JAML 1G91A 2K01A 3VR3A 3VV0A 3OW7A 1KQSA 3G7LA 3IL8A 3NBIA 2EKOA 3HKSA 4A4HA 2C9OA 3VUBA 4UC4A 5ELFA 3CCRT 3WDNA 3SWNA 5A0DA 2R57A 4HCZA 3LWIA 3CCET 4ODGA 1VQOT 2ZPGB 1SMYC 2A5HA 4H13C 2JN0A 2HNIA 4M77F 4C0FA 2Z4HA 2LKVA 4C92A 1BCPF 2MJ8A 4BACA 4F7UB 2PZUA 1UGQB 5I2YA 3LWEA 4ZUJA 1XQHA 3M4GA 4A54A 1U4RA 3H94A 5D3IB 4DAVA 1LTAD 2K1BA 2HDMA 1I4GA 4MN3A 4ZYSA 1VQPT 4HCBA 1WPYA 1QJOA 3TZDA 3DLMA 4Y7NB 5CR3A 4E7LA 1KD1U 4PJOF 2PW7A 3W2DA 1WJSA 4CJ2C 2VGMA 3HL8A 3CBOA 1M1KC 3L2ZA 3CCST 2NLUA 3RKWA 3M55A 3DB3A 2DNCA 5GAMd 3A7LA 3CMAA 4ZGDB 4X34A 1D1IA 1ZEQX 2H4OA 4BS9A 5G3LD 2O5JC 2A6ED 2K6AA 5M3MB 4K5WA 1Q3LA 2HAXA 5FK9C 1V1OA 2L11A 1Q81U 4QVZA 4EMHA 1HFNA 4ZKBB 4R9WA 3A8GB 2BA1A 3OYCA 3RERA 1I8FA 1CK1A 2RB6A 3QSUA 2ZPFB 2XNAC 2NVQB 1JWMD 1D1KA 4EMKB 4M8AA 3OYHA 5CV4A 4A3IB 3KF8A 5FKAC 1VQNT 3BVZA 2E41A 2V8IA 1GHKA 3GOXA 4F7UA 4ULLA 4CGYB 1F9SA 1PTOB 3X25B 3A8JE 2EY2A 2XWBB 2KQWA 5FROA 2B2UA 2JSOA 1DJRD 4M77G 2WSEE 3JB9D 3MFGA 2A68D 4FL6A 3CC4A 3ITPA 2FJ2A 3CD6A 3MXNA 1JOKA 4M7DE 2K33A 4CKCA 4ZN3A 4GLKA 2KVQG 3QBYA 4FF1A 2PVGB 1BI1A 4Z02A 3OIQA 2NTTA 2R93B 1LNXA 1WJRA 2KK4A 4XIGS 2XDBA 3JB9I 3M58A 2IT1A 1G2SA 1UB4A 4FNFA 3X26B 5I4DA 3FJPA 3A8LB 5LJ5e 1T5EA 3NWTA 3MXGA 4PJOG 1PRTD 4LMQD 1TS3A 1HA6A 3BFMA 2JP1A 2RD1A 5C4ZA 3BDCA 4IZ8A 2RO0A 3MCAB 3EROA 3RMSA 2A7YA 4C92E 2RVLA 2BCOA 3SK4A 2YLCA 4FT4A 5ELDA 3VYTA 4N0AC 4LAAA 1N8RC 1G8ZD 4C0GA 5CKDA 2CS7A 2X4YA 1FXXA 4EMKA 1KQSS 2D6FA 2A69C 3QUIA 2F0OA 2L1BA 3FB9A 3CPWA 2JE6I 2LY7A 1ENAA 2EYPA 2B2WA 1HUNA 5A2QE 3G71A 5JVH3 1VQ7A 1WTWA 1E2VA 2A74C 2XVSA 2V8KA 3GLXA 2CZ0B 4L6TB 2QTXA 4HKEA 1C48A 2L4NA 4QF4A 3DEOA 4HMJA 4M77E 4XTUA 2D62A 3TCJA 3EQLC 3CU7A 4BY7B 3OY9A 3PUZA 2PMZB 3E0JA 5KEEA 1H9KA 1VMCA 5I9OA 1D5MC 4C8QF 1TR5A 3QG1A 4C1NK 4DNTB 3E9FA 4C56C 4M7DC 3M56A 2P0PA 3J7YW 3LYIA 2RJCA 1A2TA 2MI6A 3O13A 3CBPA 1Y96B 1WTOA 1FWZA 3OW2A 3D31A 1S5BD 3C3LA 3NTKA 3ND8A 4PJOE 3R8BA 2B2VA 3CCJA 3ZFJA 2XKOC 4ILWA 2P0QA 2X4JA 4OHJA 1WVLA 3WVDB 4C5EA 3MP8A 1SXTA 2GF7A 5EGTA 1L0YB 1SJED 2L89A 3J81L 4RA8A 2KMTA 2PVOB 1HQMC 5JVG3 4C92C 2FMMA 1QILA 2CVRA 1X01A 1O7ZA 3VR2A 3Q22A 1GXDC 2O01E 4BDYA 1EQTA 4P5NA 2FB7A 2RSNA 3OYGA 4YIJA 1YJWT 2DJZA 1TY0A 3PFSA 1S5DD 3HKZB 2QQRA 4IFDG 5LL6X 4ATOA 4J1MA 4PLIA 3TN2A 1DOMA 3VUZA 1TS5A 2B2TA 5IT9E 3MWYW 1YJNA 1PXUA 2EXZA 4K6LA 2QQAA 1GHJA 1UGPB 3ZBDA 3JCMW 4HN7A 1JOQA 4N4GA 4R55A 4C3HB 4LK1C 2E2JB 1TS2A 5FU6C 4M77C 4HR7B 1F77A 5BN4A 3C46A 4D6WA 1SDFA 3JSCA 1LT5D 1BCPC 3BVGA 2F0QA 3TP6A 2R5AA 1YCYA 4FYDA 1G291 1Y96A 1JORA 3QJ6A 1VQ8T 3EAEA 3LH0A 2F0KA 4L59A 3HOUB 2DEQA 3RMQA 4ID6A 2OTLA 1LABA 4PJOC 3T56B 5LL6S 1SNCA 1SNOA 2DZ9A 2PQWA 3JB9H 2KCCA 2NVYB 4CKBA 4PMCA 3QO3A 2XWJB 2QXFA 2E6NA 2BE5D 2JA7B 1B34B 4RCNA 3BZDB 3ND9A 2AQ1B 1JE4A 4JS5A 4OB1B 5FRMA 1I4XA 1KLGD 5KNCA 2ICEC 1F9RA 5C0XI 3LWUA 3VYGA 5ELEA 4B08A 4ZQ3A 1YIJT 5CORA 3J7AV 3V7CA 1JB3A 5KCHA 1G3YA 3M54A 3MXUA 4RCCA 2HQEA 3CPWS 3MP6A 3CC7A 2NBFA 3URYA 4KV6A 4M7AB 2E64A 1EEFD 4UDUC 4F7XA 2OTJT 3LNNA 1DYQA 5T1IA 4XQQA 1CA6A 1DOKA 2HDLA 2DTIA 1IW7C 1O7LA 4F8MA 2F0WA 5DM63 1M1FA 4LDUA 3QIAA 4DXFA 2OF1A 4FO2A 3T53B 4XQJA 2EAYA 5C0MA 2K5QA 4C8QE 1B4OA 1M5Q1 4KBMB 2RM4A 1P92A 4ELYC 2K7VA 3DWPA 3PUXA 4HA8A 3QIIA 4OGEA 5CKEA 5KE2A 3OW2S 5DNFA 1QVGA 1SBBB 4WF2A 2AUJD 3OMGA 2WSFE 3JCMV 5T1GA 1YBYA 2B2WC 2KUMA 1SNPA 3L2UA 2EYJA 1Y1WB 1VQ5T 4GY5A 1B34A 1CTMA 2Q8IB 2BOSA 2WSCE 3PIPA 2WB1B 1SE2A 3MVVA 2C5CA 2VUMB 3VKIA 2X69A 2ZPBB 2RJFA 1A6XA 2CZ1B 3A8OB 3EFRA 4IKFA 5M5WB 4II1A 1SFOB 4PQXA 5GAMh 4KI0A 3I91A 2NYZD 5EPLA 4O5VA 3SHLA 1Q1BA 3T9NA 4M7AA 1ONLA 1TS4A 3X28B 5GAOl 5GAN3 4JS4A 2RA4A 4JK1C 3KLRA 3HFOA 2NN6G 4OP0A 2ZXPA 4BI3A 4WORA 3M59A 3R2TA 3VR6A 4RGNA 1CZGA 2IJ0A 4L6V5 1HHVA 1DD2A 2NB0A 2EZVA 4C8QC 2VXFA 1YI2T 1PLFA 5A2QL 2CQAA 4M75D 1FNVA 2F0GA 5M5XB 2X35A 3M3YB 5J26A 3I56T 4RH6A 1I4RA 2VB3X 5DM7R 1SNDA 2RJDA 4NP5A 1M4VA 2V4DA 3HOWB 3GTMB 1WTQA 3D6CA 1BI3A 1M8VA 1HFGA 5FRNA 2EY5A 3OYNA 1L0XB 1BNZA 2GFAA 4K5XA 2ZPHB 4RKLA 1N6AA 3VYHB 4KTAA 3R6OA 2EQMA 1KQ2A 1R8OB 2A6HD 1TQOA 3L9AX 3A8HB 4HCEA 3CCMA 2G9HD 4LDXA 2IL8A 4A3EB 5C0XH 3KUFA 2L3RA 4FXDA 5CGKA 5M5YB 1VQ4A 4M1UB 4XT1B 5CYUA 2AHJB 3R3OA 3S1QB 5IGFA 4DN4M 2VNUD 3PMIA 3URGA 2ENBA 2KHSA 5C4JB 4TQUS 4FSXA 4RMOA 2EQKA 4PMWA 3I3CA 1MBYA 2D0QB 1U9RA 2MWOA 3H91A 2JYOA 2ZXRA 3JCMd 3PV0A 4C3JB 2DY7A 1EIFA 4XXEA 2OXPA 5IN1A 1U4PA 4XYOA 1CHQD 2EFIA 1FD7D 1MGSA 1IKLA 1M90C 3E6ZX 3HG9A 1UUPA 3OSOA 4CHTB 3QB3A 4IUQA 4E7JA 5D3DA 2IVWA 3S17B 3HP9A 2WKCA 1GUSA 4L5GA 4M7AE 1RL2A 1KHCA 3OYFA 1A3TA 3PGGA 1YITA 3OS1A 1D3BB 3SDZA 3DEPA 4KD4A 1LTID 1PZKD 1UEBA 2B2YC 1O7YA 3OYJA 4J5YA 5G3LF 1JQYD 4FXKC 1N8RU 2AUKA 2HBPA 2MF2A 1SEBD 2H1EA 3L2RA 1KG1A 4A3GB 2H3JA 1HRJA 4Z9CB 1Q7YU 1S5FD 3DMUA 2BDOA 4A3JB 3META 1TWHB 5HK3A 5FO9B 4DOWA 4XU3A 3CCQT 2HD0A 5JPMC 5KYLA 3SR1A 5I2MA 2F3VA 2WP8J 2BKDN 3LX7A 1LTTD 3G4SA 3E9GA 2XG8D 1A2UA 3V2TA 3DKMA 3IKJA 3OYLA 2EYHA 2AQ3B 1RODA 3INZA 1JJ2A 2IW3A 2J0TD 3M5AA 3T51B 2HCCA 5EBDA 5JEAH 3NQIA 3V8JA 3NFCA 1VQLA 1OO9B 2QA4T 3JB9F 1FYCA 1UGRB 2QEXA 2MAMA 3P75A 3GNFB 1VQ6A 4NKLA 3MXPA 1BOSA 1PFMA 4QQGA 3OQ5A 5GANj 1SYBA 1D3BA 2RK1A 5JJZA 1LV9A 1AZQA 2NWGA 1ZHIA 2J7ZA 4BDZA 4DFAA 4OB3B 4N0AA 3OYDA 3PMFA 5C6SA 3L1AA 2DKGA 3LGFA 4WRDA 1XYIA 3K5OA 1I6VC 3VJPA 1PRTF 4PNYA 5FO7B 4C3IG 1RF2D 2RDFA 1HTLD 3GD7A 4H0LC 2DPPB 1A3UA 3ASKA 3HSBA 5CV6A 2EYOA 1QP3A 1IYUA 2CKKA 3JCMf 3J80E 3GIBA 1Z7TA 1OYXA 1BO0A 1YNJC 1ZXTA 2EPBA 4X3UA 3KUPA 2L55A 2DIGA 3TP8A 1VCIA 3P8HA 3MTSA 2LTOA 3X24B 1YNNC 1NR2A 1BQQT 5J1ZA 3PO3B 2KJXA 1IHZA 5FU6B 4M77B 4QQDA 4MIUA 3K7AB 3BS1A 2M9UA 5GAMj 4E7HA 4OO1I 3GTJB 4L63B 1KLUD 3WOEA 1BCPB 4NL3A 1LTGD 3BVMA 3M85A <