4IUUA

Crystal structure of shh1 sawadee domain in complex with h3k9me1 peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
133
structure length
127
Chain Sequence
ADLAFEAKSARDYAWYDVSSFLTYRVLRTGELEVRVRFSGDEWVNVKTSVRERSIPVEPSECGRVNVGDLLLCFQEREQALYCDGHVLNIKRGIHDHARCNCVFLVRYELDNTEESLGLERICRRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords SAWADEE HOMEODOMAIN HOMOLOG 1
publication title Polymerase IV occupancy at RNA-directed DNA methylation sites requires SHH1.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 23
structure length 127
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16719 SAWADEE SAWADEE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4iuuA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iuuA01
2DY7A 1AP0A 1GUWA 4ZK9B 2Q8TA 2RHXA 3S3MA 1U4MA 5J26A 5KCHA 4QUCA 1HFNA 4HCZA 1QNKA 1OZ3A 3H91A 2N55A 2B2TA 2EOTA 5CORA 4MHEA 2Q8RE 1WTOA 2RHYA 3H8ZA 3OS0A 4BDYA 2J7ZA 3ONAB 1X3QA 1IKMA 2KECA 2L1BA 3GV3A 5J39A 1OYXA 3OYKA 1XX8A 2RJEA 5KH6A 4A4HA 1EIGA 2HCCA 3PFSA 2VXWA 2X69A 2M2LA 3OY9A 4MN3A 1U4LA 1OZ2A 1CM9A 1VMPA 2MPMA 3NTHA 2K01A 4QUFA 5KCOA 1WGSA 4LD6A 3OYLA 1RODA 2EQKA 5D6XA 1ILPA 3OYEA 3G7LA 2H1EA 3LGLA 2BDNA 2K28A 5KE2A 4X3TA 3F70A 2BUDA 3I90A 1G2SA 2EE1A 1BF4A 1BNZA 4QQ6A 1G5VA 4NW2A 3KBXA 3FLGA 5IAYA 3F2UA 3L2VA 1EL0A 2RA4A 1F2LA 1WTPA 4FL6A 2JP1A 5EPJA 4RA8A 2RI5A 4OIJA 1WTVA 3MP1A 3MEWA 1NAPA 4ZAIA 2DAQA 4L59A 2K04A 2KEDA 2EQJA 3C4SA 4B9XA 2KVMA 1H3ZA 2GFUA 1DOKA 1PFBA 3DB4A 4ZKBB 4RWSC 1IL8A 2L11A 4LMQD 3QO2A 3P8DA 4UC4A 4A4GA 1KNAA 3UI2A 4R9WA 3LX7A 5COYA 1F9SA 2DIGA 2M0OA 3MEVA 4A4EA 1X32A 3FDRA 3OS1A 1JICA 2B2UC 1WJRA 4CJ1B 2NYZD 2KUMA 1AZQA 3M9QA 4PLLA 5D14A 3I3CA 2F5KA 1DOMA 1U4PA 4CJ0B 3OMGA 1X3PA 2B2YC 5CBEE 3Q1JA 1F9RA 4C5HA 3MEUA 3S6WA 1HRJA 3MEAA 3OYBA 1WD0A 3GV6A 1E0BA 4PLIA 1WJSA 3KUPA 3OYNA 2XDPA 1WJQA 5E4XA 1MI2A 2K3XA 5CMDA 2X6LA 1WTQA 4IUTA 2X4XA 2RHUA 2DIQA 1G6ZA 2RHIA 4E7JA 5DNFA 2JZ2A 4EDUA 2HDLA 2PQWA 3L2QA 2MP1A 2QQRA 2FJ2A 3DM1A 4HEDA 5EPLA 3QKJA 1S4ZA 1PFMA 2NZ1D 1Q3LA 2R57A 3IL8A 5EQ0A 4N4GA 1RJTA 1B2TA 1ESRA 2LRQA 3FC3A 3LWEA 4XT3B 2LDMA 2RSNA 4FU6A 4IUVA 2N88A 2CKKA 2GFAA 3OQ5A 4GY5A 2EKOA 3TN2A 4N4HA 3PMIA 1QG7A 5FRMA 4Z02A 3ME9A 4E7IA 3FDTA 4Q5WA 2X4WA 1EQTA 3R93A 2E6NA 1O7ZA 2L12A 2L8DA 2WACA 3NTIA 5EKIA 1SSFA 2MGSA 2L89A 4HSVA 4X3UA 3S3NA 3L2RA 1EIHA 1O7YA 3GOXA 3SD4A 1M8AA 2IL8A 2K05A 1NR2A 4PL6A 2R5MA 2HQXA 1BO0A 3MTSA 2K3YA 4BE2A 1JE4A 3OB9A 4IKFA 2O4XA 1SSOA 4IUQA 3P7JA 4X3KA 1J9OA 2HDMA 3E9FA 1WD1A 1MHNA 2M16A 3D6WA 4IURA 4OIKA 3S3OA 1SDFA 1NR4A 2B2VC 2RJFA 2EQMA 2BIVA 3LGFA 3OYFA 3PMTA 3FEOA 2B2WC 2RO0A 2JYOA 2RJCA 4OVAA 5M9OA 4RG2A 2DY8A 1KNEA 2O4XB 3EAEA 1NCVA 4CJ2C 1B3AA 3OYDA 3OYMA 1RI0A 2G3RA 3MP8A 2MWPA 4ZTJA 1G91A 2HQEA 4XDXA 4B9WA 4R8IA 3HP3A 1C8CA 3OA6A 5T1IA 3MO8A 2SDFA 1SAPA 2MJ8A 1KHCA 3OYJA 3OYGA 2KOLA 2X35A 2X4YA 5EPKA 5FROA 3H6ZA 2RI3A 2NWGA 3P8HA 3FPUB 5JJZA 4U68A 4HAEA 2GF7A 2RJDA 2X6GA 3L2WA 3OYHA 1CA5A 5EJWA 5IN1A 5C6SA 3OYAA 1CA6A 1ZXTA 1B4OA 4E7LA 1PLFA 1B50A 2RI2A 2RSOA 4CRIA 2B2UA 1WTWA 1VMCA 2B2TC 4C5GA 2FHTA 4X34A 3DB3A 2LTOA 4IUPA 3DLMA 2XIWA 2RVLA 2JTFA 3META 2E5QA 4HCSA 1F9PA 2B2YA 3O8VA 2R58A 2HCIA 3E9GA 2K03A 1HA6A 4QW2A 1HUMA 4XT1B 2BKDN 3OYCA 4ZKCB 2HUGA 3L42A 5T1GA 1RTNA 3IFDA 1N27A 1RTOA 1WTXA 1IKLA 2FINB 4ZTFA 3LLRA 3NTKA 2LCCA 4QQGA 3UT1A 5CIUA 4IUUA 5D65A 2QQSA 5E4WC 2IG0A 4RAUC 3SVMA 5D6YA 1WVLA 1QE6A 1HUNA 3DEPA 1RHPA 3OYIA 1DOLA 1MSHA 3I91A 3BDLA 3KUFA 2B8AA 3UWNA 2D9UA 2EPBA 2KEEA 4BE1A 3I8ZA 2YRVA 2R5AA 2VYTA 1G2TA 4N4IA 2P0KA 1U4RA 3QBYA 5KE3A 5FRNA 1EOTA 2K1BA 1O80A 5D6WA 1OI1A 3LYIA 4BDZA 4X3SA 4DN4M 3L2UA 4UAIA 4QVZA 1PFNA 3TZDA 2NLUA 4BE0A 5CBAE 1ICWA 4E7KA 1ILQA 4C5IA 3QJ6A 1MGSA 4BD3A 2RHZA 3PNWC 3OS2A 1ML0D 2EQUA 2R3ZA 1LV9A 3DEOA 4A4FA 1BBXC 2L4NA 4BACA 2L3RA 5AFWA 2B2VA 3ASKA 1A15A 2XK0A 4NS5A 2B2WA 1TVXA 2FHDA 1J8IA 1XYIA 3ZEHA 3OMCA 1HFGA 2FFKB 2EFIA 1XNIA 3MP6A 3QIIA 4II1A 1PDQA 2MWOA 3MWYW 5C0MA 4E7HA 2L9HA 1AZPA 4QQDA 3N52A 4O42A 4ZLTF 3Q6SA 3CEYA 2CVRA 3LH0A 2M1HA 1F9QA 1WTRA 1MSGA 1DZ1A 2LVMA 2FMMA 1B53A 1HHVA 1DONA 2D9TA 4C5EA
chains in the Genus database with same CATH superfamily
4BI8B 3FP9A 4RTUA 1WHJA 2J4XA 3NSWA 4UDUC 2A8VA 1QP3A 2D5DA 1MJCA 2MO1A 4A93G 2E3HA 3D8GA 3OW7A 3TP8A 1AN8A 2QGGA 1K9MR 2K5HA 5CV9A 1PMRA 3CC4Q 4OMNA 1C0AA 3MC0B 2AMCB 5KYNA 1PH6A 1ZYRD 3EG2A 2AT1B 1HFNA 2LCSA 5I11A 5GJWB 5IYBG 2CP3A 5DLOA 1QNKA 3JCMg 3GNFB 4C3IH 1NY4A 4D8KA 2PW7A 2DL4A 1TWHH 4J7FA 5AYFA 3JB9F 1NJIU 2VNUD 1Y14B 2ENBA 5KYXA 1UE7A 2E10A 1RD9D 2COYA 2DYBA 1Q86C 4DR2Q 4IFDG 4BDYA 2J7ZA 3J7A5 2DL5A 3G71A 4YCVA 1W6JA 1BXTA 2KR3A 2GVAA 5D3IB 5KYYA 1K0SA 2KECA 1GXDC 1AEXA 1S3OA 2SNSA 1QKWA 1KDBA 1STHA 3OYKA 4DR3Q 1GFDA 3HOXB 3RMHA 4FT4A 2A1AA 4NXNL 2Z1CA 5IXFA 3BVZA 4P2CB 5FO9B 2RQTA 1TUCA 5M3FB 4LE9A 1K8MA 4IFDI 4LFCL 4GNXC 3QSUA 3SWNB 3K7AH 3VS6A 4MN3A 5GAMd 3GF5A 2E3IA 4FXKC 1K9MU 3MXNB 3U9SA 1TWFB 1MMNA 3CCQQ 1PRLC 1EUJA 1XNRQ 2F0WA 3UE0A 4XXEA 4R4OA 1TUDA 4V0BA 1VQPQ 4AYBE 4IOAA 4P74A 4JS4A 4QUFA 3A1PA 5L23A 2VZAA 5IYCH 1IHWA 3BZCA 2EQKA 1LM0A 3K0XA 3LWUA 3OYEA 2K5LA 2DJQA 3G7LA 3I72A 3MXPA 5FU7B 4PNYA 3LGLA 1QKXA 1WDXA 1G291 3I4OA 1M3CA 3U50C 1LT4D 4P5NA 4J1MA 1G2SA 2YU9H 4IPCA 4R4IA 1KLUD 1BF4A 3CCJQ 3LNNA 1M90U 1WPYA 2BA0A 4RCNA 1Z47A 2CCZA 3HTRA 4KKSA 3CCUT 1MBYA 3JCMW 3BG3A 2LJ1A 4A63B 4GN4B 4DBHA 1PYBA 1KQ1A 1XJWB 2ATWA 2RA2A 3PGZA 1GHJA 4XQNA 1MIUA 4DF7A 3AHUA 2C35B 2MUYA 1H641 4RA8A 2UXCQ 2RI5A 4HMIA 3KF6B 3M0UA 4LDVA 3BVMA 3JAMc 5JVG3 2DZCA 3QUIA 4LF5Q 1M27C 3C1FA 2YV5A 3U4ZA 2RDFA 3NFCA 1W2BA 4K2LA 2DRMA 1BDOA 2UU9L 2O9SA 4UP9A 4M77A 3RUXA 3HOWH 5BN5A 3QWYA 1FNVA 1H3ZA 1STYA 3VR6A 4UP7A 2O2LD 3EGUA 4KBMB 2R7ZG 2EQSA 1DGSA 2EBPA 3M0TA 4JRQA 2HQHA 3GD7A 2B63H 1OO9B 3OW2A 2PYKA 1LCKA 4JUVA 4EPCA 1D5XC 3P1HA 3EG9B 5IHKA 3CCRT 1M2VB 2KYMA 3P8DA 4UC4A 4M7DC 2ICIA 3OWFA 1UFFA 3X3MA 1AT1B 1JQQA 3CCST 2BH8A 3MZ5A 1LNXA 2ZGWA 1VQGA 4R9WA 4R4TA 4A3FB 1K73C 1PH1A 3RNUA 3BY7A 1SLJA 3VR4A 1Y57A 2DIGA 1I0CA 2GQVA 3EG3A 3QG1A 4QL5A 3SEBA 5C3WA 4LF9Q 2M0OA 2YWWA 2QF7A 4BBRH 1PH9A 2JA7B 4OMFB 1Q7YC 3FDRA 1KFZA 1VS0A 2DXTA 3G6ET 2IIMA 4AFZC 5G3LF 1I5FA 4O5VA 4WCIA 3RBBB 2DXCA 2MAMA 3HRZC 2C0OA 4LWCA 4LUZA 1QLYA 2K50A 3OOCA 3CMAT 1UJ0A 1EEFD 2F5KA 4JBWA 3TREA 4JYAQ 5GAN2 1ZUYA 3ERQA 4S3SA 3VDYA 1IB8A 3M0SA 3JCMd 3C2PA 3OMGA 3LH5A 1X3PA 2XWBB 3QIAA 2V26A 2PVDB 5CBEE 4M7DA 1F9RA 4KKTA 1KABA 1Z6HA 3VJPA 1NTGA 3MEHA 3EVQA 3SDZA 2CP0A 1WD0A 3GV6A 3S17H 1TH7A 1OXTA 1QUQA 2OT2A 2AK5A 1M8MA 4RTTA 3DM3A 4QQBX 4MIUA 1K1ZA 3KUPA 3OYNA 1U0LA 2Z9HA 3RIRA 4BBSH 4GZYC 3HSBA 2XI9A 4LN2A 3OTOL 1Q95G 3I73A 5LMUL 1A6XA 5I2YA 5I9PA 3PGGA 4CKCA 4IUTA 4FDBA 1VQKA 1KG1A 3EROA 2DIQA 2F0FA 4RKLA 5C3EB 3GP8A 1VQ5A 4BY1G 4A3DG 2BE7D 4DQ2A 1Y8PB 1YHAA 3CMEA 2N49A 2OAWA 3A8JE 4KV6A 2CSQA 2WKCA 3PUVA 4P75A 5IIFA 1XMQL 1G51A 2KDSA 1JC7A 4XQJA 2E5LL 2ENMA 1Q86R 2M00A 3EA6A 2EYMA 4LK1C 2QQRA 3P20A 1SKUB 4DUYL 2F0EA 4A3KH 3CBOA 5JEAG 2FJ2A 1UHFA 3DM1A 4HEDA 3JCMV 3J7ZC 1S4ZA 4RFBA 2ZTEA 2QQBA 2NZ1D 4NKLA 3LWIA 1IGQA 3WVEB 4FCYA 1Q3LA 3A8OB 2RF4A 1Z9ZA 4ZQ3A 5EQ0A 4C56C 1NSNS 4J8QA 3VS3A 1R9TH 2C06A 1YJNQ 5I21A 1ESRA 1YP5A 4R4QA 4JI8L 1N34L 5CR2A 1VYVA 3CC4A 4DA4A 4QIWB 4FU6A 4IUVA 1TWGH 3T1YQ 2CKKA 1K8AU 4I7ZC 3S16H 2EKOA 4AMCA 3EFOB 2JA6G 1VQ7T 4M78C 3G7ZA 1UUPA 2E8GA 4ZRZA 1IBKQ 4C0ZA 2YDLA 4FNFA 4E7IA 2PPBC 4M7AB 4ME3A 4APVA 3R93A 2Z0WA 1YJWT 2JA8B 4Y91A 3I55T 2WSFE 4HCBA 2LXKA 2CP7A 2MOXA 2L8DA 1TY2A 2OAUA 1YN8A 1U5SA 3NTIA 2EYZA 3CRLC 2W10A 2EJFC 3H0IA 1S72Q 3KDFB 2L55A 3TZUA 5K36H 1FGBD 4BS9A 4HSVA 2MYSA 4DV7L 3S3NA 1VIFA 3L2RA 4A3MB 1EIHA 2JUFA 5FK9C 1WLPB 2EIFA 1M8AA 2IL8A 2K05A 1K0RA 1Q86U 1NR2A 3A0JA 4RGTA 2VQFQ 1PH4A 3URYA 2P5ZX 2HQXA 3OW2S 1BO0A 7AT1B 1ESFA 1PRTB 1YNNC 3L3OC 5FLXc 3Q22A 3BZKA 2PZWA 3HKSA 4MNOA 4KMUC 4BE2A 3F8TA 1FGUA 2VL6A 4IUQA 3RKYA 4X3KA 1BK2A 4EQPA 4JI7L 2I0QA 3KK7A 3HOVH 3EBEA 3CCQA 1MHWC 3C0CA 2JA5G 3A8HB 3NGPA 2IY5B 4EMKC 3CCLQ 4HJAA 1WD1A 1VQPA 3PIPA 1MHNA 2EJFA 4GN5A 3STBD 1RDPD 4GKKL 4XTUA 5CAIA 3HL8A 5DM63 3VYTA 3L0OA 2NUTA 1BIBA 5KEEA 2B2VC 1N36Q 2RJFA 1T3SA 2EQMA 4M7AF 1K0XA 3D3RA 5DM7R 3OYFA 2A6HD 1QZGA 3HOUG 3GTKB 4KHPQ 2OTLT 1I6HB 4UHVA 2GQIA 3FMCA 2RJCA 1OXSC 5IGFA 4RG2A 1Y07A 4GLAC 3CBPA 3CCJA 1AZGB 5FU6B 4LFAQ 1KNEA 4C92G 1UE6A 3EAEA 4EVOA 4LW1A 4CJ2C 1EZ8A 2LMJA 1I4QA 3UDGA 3OYMA 3RLNA 4Q5VA 4C8QB 1PRTF 1LTAD 1X65A 3MAQA 3S1NB 2E1HA 3VS0A 1V9PA 2XNAC 1GBQA 3K8AA 2MWPA 4EMKA 4ZNXA 2EGAA 2IWHA 4QGUA 3PCOB 4RCCA 1G91A 1K73R 1VQ6T 3MFGA 4XDXA 3HOZG 2WAQG 3NXWA 4JBMA 1AFPA 2MIOA 1C8CA 2ABLA 3KOJA 3OA6A 3MJXA 1YJ9Q 1Q7YR 5LMNL 1SAPA 2VXEA 1KHCA 1C0MA 2VUMH 2JS0A 1F1BB 4XU1A 2QEXT 3WXMB 2LS01 3DWQA 5EPKA 1VQJA 3JB9G 3FB9A 2NUPB 4DEYA 4ILWA 4CC3A 1Y1VH 5M5YH 2Y0SG 2NWGA 4E47A 5C4HA 3C3LA 3I4MG 5M5XH 4ODGA 4MZ9A 3QZ5B 1X9NA 4J9CA 5JJZA 1BCPD 1VQ4T 4XU3A 4HAEA 2GF7A 1RLQC 3BS1A 4KGXB 2Y4XA 2PUKB 1IXRA 4RMOA 1S5ED 4L8JA 1BKBA 1B4OA 1TR5A 1RAIB 3TMEA 3JB9I 5CQYA 2ALYB 3I35A 1HH2P 1XPOA 2A68C 4IPDA 1CKNB 2HMAA 4K5VA 2XTIA 4C8QF 4A4IA 2MI6A 1E7ZA 1XNQL 3KLSA 3M85A 4A3JB 1RAHB 1V1QA 1HK9A 2LTOA 3OW2P 2R7DA 3TU4K 1HNXL 4L5QA 5ELBA 3DLMA 2MHVA 1GJXA 2QA4Q 4F17A 4FSSA 1Q7YU 4WJWA 3U4VA 3META 4C3IB 2ZPIB 3MPUB 2E5QA 5LL6S 1TWHB 1V29B 1JB3A 2HAXA 3JC66 3E9GA 2K03A 1E22A 4NXNQ 2NVQH 4F7XA 3VYSA 5EBDA 3K5OA 1M30A 4QW2A 1VUBA 1UGRB 1G8ZD 2QASA 1PXUA 5FOBB 3TEEA 1YHQQ 1E6GA 3M0PA 3VRYA 3G4ST 4NDXA 3C1EA 3E0JA 1W6XA 3EJIA 5CV5A 4LFCQ 1VQIA 2GN5A 5CKBA 5LJ3f 2HUGA 5C0XJ 4HT8A 5I22A 2ZPHB 5JOBA 5HKCA 2EPDA 1KC8C 2ASBA 2A6ED 2BE5D 3FRPB 3BZDB 1WA7A 1EY4A 1UHCA 5I6WA 2Q2HA 3K59A 1WFQA 2UUBL 2OF1A 4FF4A 4ZTFA 3LLRA 4DAMA 5GMKh 2IX3A 3HOXG 4DR4L 3NTKA 3UT1A 3K7AB 1ZYRC 4C0DC 5IP9G 1LTBD 3DKMA 1PC0A 2WKDA 5D65A 4G7HC 5M3FG 4OGEA 3RMSA 4F7UG 2IG0A 4X62L 2MF2A 3RZOB 1JORA 3H41A 3TQYA 5T1GA 4MDXA 3SB2A 2H3EB 1F2YA 4IPGA 2IJ0A 1YIJT 3DMUA 3NENA 5IP7G 1WVLA 1EU4A 1RHPA 2GVBA 2IX1A 4V190 1OPKA 1J6QA 1BQQT 3BDLA 3PIOA 1XOVA 1YJNA 3R2TA 1NLPC 4CC7A 2B8AA 5KYXB 3UWNA 2DN8A 2WINB 2EY6A 2JEBI 1GCQC 4MDWA 2IVWA 4DKAC 1I5OB 4Y92A 3QDRB 2YRVA 1YI2T 2H3JA 1DM0B 3K80C 3HP9A 5KYYB 1K3BC 4RHSA 1GUNA 2UU9Q 1H9RA 2NN6I 5LJ5f 4KH0B 3CW2C 4LF4L 5KE3A 3Q8DA 2K1BA 1O80A 2EZVA 1S72A 2A28A 3M3YH 2JMCA 4L6V5 3OS5A 5JJKA 4TKOB 3CC7T 4PG3A 4LMQD 4K0KL 4J15A 1A8VA 4X3SA 4DN4M 2E2IB 4UAIA 2BZYA 2HQLA 4ZUJA 3TZDA 2NLUA 4BE0A 3WOFA 3HOWB 5CBAE 2WB1E 4AG1C 1ILQA 1I3QB 2A0FB 2GGRA 2K3BA 1YITQ 2HL5C 1E1OA 3NQIA 4AQYL 3QJ6A 4HIKA 2AHOB 1N6AA 2RHZA 3L9AX 5GAOq 3QZ9B 4J8OA 5FLXL 3S1QH 5C4XH 2AKKA 1OV3A 3CCLA 2DVJA 2F3IA 5AFWA 1Q82C 2F4IA 4E7SA 4JW0A 1SE4A 2KY9A 2MNAA 3ASKA 1KLGD 1A15A 3F2CA 4A3LH 2XK0A 3SK4A 4BBRB 2RHSB 1RLPC 4CDCC 4MMKA 4A3FG 1KHIA 4QVCA 3VYGA 4DV5L 3OSOA 4FXDA 3CC2T 4RMFA 1WYDA 4LNPA 2R61A 2CDTA 1ET6A 2FZKB 3J80i 2JA7G 2PZUA 3OPOA 1XNIA 1K3RA 3QIIA 3HRTA 4C0FA 4QB4A 3OTOQ 3CP0A 5D7UA 5LMUQ 3S1MB 3MWYW 4D6WA 3OIPA 3TQ7P 2LJ3A 2L9HA 3S17B 1GVPA 1QQJA 4M77B 2RQUA 3X3NA 2ATCB 3N52A 1JWSD 2QDYB 3Q23A 3HZXA 1XMQQ 3Q6SA 2DZ9A 3K5NA 4XTZA 4G7OC 1BBWA 1S5DD 1YJ9A 2XG8D 2E5LQ 1DZ1A 1YHBA 4AG2C 1LTRD 2H4OA 1EFWA 2F69A 5TSSA 4DUYQ 3A5UA 2XU8A 5GANh 3M54A 1HHVA 2DLPA 3CQTA 1PCXA 4UP8A 4JI5L 1DONA 1D1CA 5CKHA 4O1NA 3H3VC 2SNMA 3UE1A 5C3EG 2F0JA 4BA2I 3TVTA 2B29A 3J7YW 4X6AH 1G83A 3JCMX 1X3EA 5C44H 2OTJQ 2R93H 2L5QA 3S3MA 1ENFA 1YCSB 4JJDA 1VQ8Q 1EQVA 1ZKOA 4ID6A 1N34Q 5J26A 4C92E 4D8DA 4A3KB 4YIJA 5IT9E 2DMOA 1M1FA 3RZDB 1SSHA 1WYXA 3QHSA 1PM3A 4A4KA 1PH5A 2VV5A 1KC8R 1R9TB 4F04B 2B2TA 3EH2A 5CORA 1JOQA 4C92D 4MHEA 2WB1B 2NVTH 1B34A 2DJGC 2WAQE 3PUYA 4M77F 1TWGB 1OX8A 2RQVA 2WSCE 4DV7Q 1QVGS 1K8GA 3S16B 4WF2A 2JMAA 3RR6A 1G3SA 2QA4A 1X43A 3ONAB 1MKHA 1Q1EA 1FYNA 4C3HH 1QUQB 2E12A 3G6JB 3GO5A 4CHTB 1C6VX 5FWCA 1EWIA 2EYLA 2L1BA 5J39A 1OYXA 5C0XG 2DD5A 2RJEA 3H6MA 4PJOB 1SN8A 1K4US 2R6GA 2Y0SE 4A4HA 2LQWA 1Y1WG 2B86A 1Y96B 2JA8G 3RUZA 2BOSA 1YHQA 1S5BD 4CKBA 2M2LA 3TCJA 1VQMT 1A62A 2DO3A 1ARKA 2ZAEA 3QB3A 1UECA 3JB9D 1VQ9T 4ELZC 4JI7Q 3VS7A 3CAMA 1NBWA 2NUCA 1VMPA 2PNIA 2F0SA 2MPMA 4MTKA 4A3MG 1ASZA 4JRIA 4RKBA 4DXGA 4GKKQ 4FT2A 5KCOA 3M4OB 5C0XI 4JI1L 1M3AA 1WGSA 4LD6A 3OYLA 3CCUQ 3PF5A 1LTTD 2PVOB 1ZSGA 3PO2G 1YVCA 2BDNA 2K28A 3HOVB 1EOVA 3J81L 1W6KA 4YCUA 2NZHA 4OO1I 2G5DA 4AFQC 2UUAL 1HJDA 1PSFA 2K32A 2JA9A 1LOJA 4M7DF 2EE1A 2EGCA 1G5VA 1EYGA 4WJ4A 1KAWA 2XRSD 1O7LA 4OB1B 4P73A 1WXUA 1WFWA 2SEMA 2CW0D 3NBHA 1VQLT 2VS1A 1IHZA 1WZOA 1HXDA 3L2VA 1NM7A 5IGDA 2RA4A 5LJ3e 2LSSA 1WTPA 3K81C 4PJOF 4IALA 2JP1A 4TSSA 5EPJA 3E9HA 4DAYB 3CPWA 1SRMA 4ABNA 1V1CA 1E2ZA 3X20B 3PF4A 3WVDB 3QR8A 4OIJA 4H44C 5LMNQ 3PT9A 1QNUA 3CCRQ 2EYPA 2OX7A 2DAQA 3I5SA 4L59A 1EQRA 4OL7A 5CV8A 1HNWL 3CCSQ 2XICA 4HTHA 4B9XA 2I5HA 4RTVA 2DERA 1NMFA 4C8QG 2KVMA 2QW7A 1R4PB 1BCOA 4J9HA 4K5WA 1B3QA 2EY2A 1KQ2A 1EWHA 3STBC 4RWSC 3FIFA 3NELA 2EYFA 2H5XA 3T13A 2VUMB 2EVBA 1CTMA 1X6BA 1KAAA 5ELFA 1AWOA 5GMKl 1ET9A 1JJCB 2VUBA 5M5YB 5IYDH 3ERSX 2CZ7B 3LX7A 4HR7B 1YITA 1QVGP 4FVMA 2DUDA 4ZN1A 2NUTB 2LT1A 3EGXA 1ZSZC 4QCLA 3ZL7C 1WI5A 4LNQA 1XNQQ 3TRZA 2B2UC 1JICA 1ZA1B 1NYGA 4KH1B 3CQZH 1HNXQ 1IL2A 2ECZA 5LJ5e 1SYBA 4PLLA 5IHIA 1JEGA 2QILA 3FKIH 2DE0X 4HJ9A 5D14A 4FIBA 1KD1U 2TSSA 4M1UB 1MMDA 1N32L 1DOMA 3NHNA 1KDCA 5EBCA 1AH9A 3ZBDA 4OX9L 3QOLA 1CK1A 2EJMA 1MGQA 4JJNK 1G2BA 2Q2IA 2B2YC 3M4PA 3Q1JA 9ATCB 1NZ9A 4C1NI 4A3EB 4HA8A 5IGBA 3JCMJ 3S6WA 1KRSA 1HRJA 2RN8A 4EMKB 1WXBA 1C4QA 2CQAA 2XGTA 5CV6A 5IH2A 4DPGA 5BN3A 4A3JG 2DJZA 1JCKB 3AFQA 2HDAA 4A75A 4DV2L 1EQQA 4YTLA 4F16A 3H94A 3J81E 1IXDA 1WJSA 5JEAJ 3THKA 4QMGA 2NVQB 2XDPA 3D31A 1QWYA 2TMPA 4C3IG 4OGCA 1I50H 4DOWA 3CKIB 2V1QA 5G3LD 4J7IA 1BCPC 4LF6L 2X6LA 2PZ1A 1WTQA 2UUBQ 2NVXB 4JOIA 2EYWA 3PVLA 4DR4Q 3RZDH 1G6ZA 3I56T 4E7JA 2CP2A 1TS5A 3PTAA 2P0PA 1L2FA 4LD9K 2F0GA 4ME7A 2JZ2A 1UDLA 1KSWA 1NE3A 3A54A 4X62Q 2HBPA 1NYFA 1QCBD 1LPLA 3H0FA 2MP1A 1PH2A 2XDDA 4KD4A 3GTJH 2P84A 1VA7A 1OTCA 4GLMA 4C3JH 2E41A 3MHBA 1SFOH 1MMGA 4G7ZC 2DILA 3G71T 1RCVD 4J83A 1TT2A 2CFMA 4A93H 1KIXA 3R6OA 3H9NA 2A19A 3NP8A 3M7GA 2OTJA 5GAHC 3L1AA 2LNVA 2N78A 1VQ8A 1SYEA 2P4RA 1A2UA 4C1NK 2OI3A 1VQBA 2CUBA 3PQIA 2GTJA 1EZ6A 3NBIA 3OQ5A 4FYYB 1N8RC 3CPWS 1M1KC 3TN2A 5ELEA 2J6FA 4N4HA 5IYBH 5IYCG 2G9HD 1QG7A 3J7AF 4ZGJB 5FRMA 3O13A 3ME9A 3FDTA 3UATA 4Q5WA 2X4WA 5H1SE 4QT7A 2E6NA 1W3SA 1Y8NB 4LF4Q 3GTGH 1T5XD 1CKBA 5GAN7 2A6EC 2WACA 5EKIA 2PU9B 2F0HA 1SSFA 2M02A 2MGSA 4XQQA 5KNDA 3R2IA 3M59A 3CD6Q 4BXXG 3HGBA 1R77A 5LJ3j 1TIID 2EY1A 2E70A 4K0KQ 1E24A 3AMUA 3NWTA 1O78A 1SF9A 2NWMA 3RDVA 1E2WA 3URGA 1BI0A 2D8HA 2X3WD 4PFZA 3VV0A 3S24A 4JBKA 2FB7A 2LJ0A 1KTKA 4GNXA 3M3YB 2ROTA 4DNTB 1JE4A 4IKFA 1E2VA 4AQYQ 2F0MA 3K5LA 5GROA 5EKLA 5BR8L 3D4RA 2EY5A 5A35A 3NUCA 2O2OA 2OTLQ 3FHWA 3DLLA 2QEJC 4ZN3A 2CS7A 4XIGS 1V1OA 4IIMA 1VQNT 2Q2UA 2CZ1B 3E9FA 5GAOm 3T9NA 4RG1A 2D0OA 1XPRA 4BY7B 2M16A 3BU2A 5C4ZA 1U3OA 3D6WA 5DLQE 1SJED 3CCUA 4PZ8A 3SFMA 4MTNA 4OP0A 3V7SA 3S1RB 5I2XA 4DR5L 2EXDA 1DD2A 1D7QA 2L0AA 2BE9B 2I0NA 3BW1A 5NUCA 2KA7A 4CDDC 2B2WC 4DV5Q 3S1QB 5C4XB 3I4NB 2XVSA 2DJFC 4NPSA 3F2BA 2SRCA 1BI1A 3JAMi 4KHZA 2DY8A 4QIWE 2O4XB 5GAMh 1N9RA 2PCFB 1CT1D 3JCMc 1NCVA 2J7IA 3JB9J 2CQOA 4C0DB 3J80E 2E4HA 3HPWA 4M7AE 1D0YA 5LJ5j 3K7UC 4HIDA 4BBRG 3MP8A 1PD0A 4GBQA 1MV3A 1R0BG 2PO4A 4DR7L 2ESWA 1RACB 2LQNA 1LUZA 4WJ3M 5T1IA 1VQ4Q 3GTQH 2QDBA 3WOEA 3BFMA 2V8IA 2SDFA 4X66L 3CCRA 2MJ8A 3ZJYC 4GOPB 3TSZA 2RDHA 3EN2A 2X4YA 3CCSA 4JI5Q 5FROA 3X28B 1D1BA 1VYTA 4RTZA 1SMYD 4L5RC 2IHEA 1Q81C 3TP6A 2KHIA 4HMJA 2D6FA 1SYDA 5FWBA 3CPWP 4M77G 4U68A 2N3SA 2DA9A 1JU5C 1PRTD 5E3FA 2W0ZA 1EWCA 4KN4C 2X6GA 3KBGA 3PO3B 2F0KA 4DUZL 2CGHA 3E1SA 4B3ML 5CVIA 4QVDA 1CA6A 3WWVA 1CZWA 2ZJQA 3JV3A 1PLFA 3EG1A 2RI2A 1FL0A 1UB4A 4CRIA 1WTWA 4ELYC 3VR2A 2A73B 1VMCA 2D0QB 4AT1B 1CQVA 2FHTA 4FXGC 1M4VA 2DL3A 2AWOA 1I4GA 2D1XA 2HHHL 1W4SA 3DB3A 2LCLA 2A3LA 3K58A 1NEBA 2GTOA 2F0DA 4H0LC 2XIWA 1PVOA 2YUQA 1HR0W 1U1TA 4A3KG 1I6VC 1VQKT 4HCSA 1UTIA 3A7AB 5GAN5 5E7NA 1F9PA 3M56A 1G3TA 3O8VA 4WFN3 2HCIA 2WV6D 4DV6L 2A69D 1ZQ1A 2NVTB 4C8QE 5KYWB 5HY6A 4AH6A 1GHKA 1TWBA 1TKWB 4K5XA 3AQQA 1XJVA 2WB1G 1AZEA 3OYCA 4YWMA 3LX0A 1BYMA 4J5YA 3IRBA 3NHHA 4ZKCB 2O5IC 6AT1B 4PJLA 2L5TA 3L42A 1F77A 3E2UA 3IFTA 5I2SA 3NPPA 4JCVE 4TVAB 2DEQA 5FW9A 4C8QD 1N27A 1WTXA 1IKLA 5EG2A 2DM1A 2F4VL 1IZ6A 1U5KA 4OB2B 4IPHA 4JI1Q 1YIJQ 1M1KR 4J9FA 1N8RR 1VDZA 5IT9c 4RGOS 1K83H 2HBWA 4PJNA 5J3BA 3JCMh 4PJOG 3VYHB 4QQGA 4KJOA 5K36G 1I94L 2JJQA 1TTHB 2QQSA 1Q1BA 5E4WC 2UUAQ 4RAUC 1RL2A 1UEAB 1IREB 1UGQB 3N5BB 3HEJA 5CQXA 2JXMB 3SK6A 4FSXA 4Y52H 2EQIA 2RQXA 2KT1A 5GJVB 1D8LA 4OGQC 4FF1A 3GTLH 2IT1A 2AUKA 1C7YA 1JOKA 1MMAA 1HTLD 1LTGD 2QQ9A 1UGPB 3OYIA 1MSHA 2FRYA 1VF7A 4KY5A 5DM73 1AE2A 3QXEB 4JLIA 2VVKA 5I2MA 1WQWA 1GKHA 2K52A 5AJ3L 4X9CA 2EYXA 5C6AA 5I4DA 1B34B 4LXCA 2D9UA 5GAMj 1JXMA 4ZYSA 2L3PA 2EPBA 4M78A 2AQ1B 2Z6KC 1DXMA 3I8ZA 3V7RA 2PI2E 2QYZA 2VYTA 2AQ2B 2PQAA 2JW4A 3CCVT 4KLKA 4N4IA 4YHHL 3M7NA 2E2JH 2JJ9A 3EG0A 3RN5A 1QJOA 1U4RA 5GANf 1HNWQ 1A3TA 1ZA2B 1L0YB 1OU8A 4J9EA 5FRNA 1ZUKA 1EOTA 2IW3A 3M55A 3CCQT 2V1CC 1OI1A 3VR3A 3C94A 1VQPT 3CD6A 1OOTA 1EYAA 2M9UA 2KCMA 3ULLA 4EQOA 1QOHA 4A3BB 1A0IA 1GRIA 4BY6C 2O9VA 3L2UA 1IRXA 4DFAA 3UA6A 1WQ7A 5IHNA 1V1PA 4PQXA 4J9IA 1FXXA 1UUEA 4JPBW 1VQAA 4E7KA 5GAOn 2WIIB 4M75C 2NZOA 2RBMA 3TP5A 4C0GA 4JI6L 4HJ5A 5IGGA 1FMVA 1H9SB 1JRIA 1ABQA 1CQFA 2OTLA 2CW0C 1I4HA 2D2CC 3PNWC 3CC2Q 2EGEA 4R55A 1JOOA 2EQUA 4PK4A 1LV9A 1ML0D 2EXZA 2R3ZA 3CCMQ 4KD3A 2JA5H 4A3CH 2L4NA 2VUMG 1HYOA 4L6TB 3MFYA 3HKZE 4RH6A 3ICEA 5CR3A 4PJMA 2B2VA 2Z4IA 4KKUA 1N32Q 3OIQA 3CBMA 2K33A 1EY0A 2KVQG 4NS5A 4IJLA 3NBHB 4EIKA 4JBJA 4FW2A 5KYUA 4OX9Q 5ISRA 2LMCB 1WHHA 4FYVB 1MUZA 2DNUA 3GIBA 3RNJA 3A98A 2FHDA 3CQZB 1AVZC 1X2KA 3CXCS 1YBYA 3FKIB 2KQWA 3FVQA 1HFGA 1Q81R 4FO2A 1CKAA 3HRSA 2EFIA 4M75A 4EMGA 1IW7D 1ZX6A 1EYCA 3SK8A 4DV2Q 1STGA 4II1A 3D4WA 1Y0MA 4O2DA 1PDQA 3SR1A 1RKNA 1SEBD 4EQ5A 4LF6Q 4X65L 1SRLA 4WTOB 2NB0A 5CYUA 2KNBB 3RKWA 1QVFS 3KFVA 4QQDA 1HZAA 3MCAB 2LKVA 2ZZDA 1WHGA 2DEUA 4CDEC 3HOZH 2F2WA 3C46A 4A3EG 3DXJC 2YLCA 1OXVA 4IUNA 4ZLTF 4IIOA 3SWNC 1NPPA 2CVRA 1STBA 2PMZE 1VQ4A 3S2DH 2RCNA 1GUGA 1I50B 1K73U 1MSGA 1UGVA 2LVMA 4PNOA 4L5GA 3CU7A 4DBQA 4IOCA 3A7LA 4G4KA 2FMMA 2VB3X 2D9TA 2CWPA 4N8FA 3DHQA 3I4MH 2HSEB 1GUWA 4A3IH 4K6LA 3T56B 5KRUA 5FJ8G 4KGVB 4L63B 3J7AV 3D7SB 2Q8TA 2C0TA 3H0GH 3OWEB 3GTJB 3PIP3 1HSQA 1F2ZA 3TSSA 4N8X1 1U4MA 4N0AC 5KCHA 4MZPA 5GMKe 4LDXA 1IBLL 4KUDK 4LJZC 5CKEA 4F7UA 1SFOB 4L5SA 4PFPA 3PUWA 1OZ3A 2YXYA 3SWNA 2BZ8A 3IKJA 1C48A 4CGYB 3J81c 3CCEQ 2HNIA 1KK7A 2A5HA 3NE5B 4KN7C 1ONLA 1HD3A 2Q8RE 1WTOA 1PTOD 2RHYA 3BDCA 4DNRB 1YNJD 4FYXB 3U23A 1VQMQ 1B8AA 2EYOA 3EQLC 1VQ9Q 2VQEL 2F0PA 1IKMA 1MNDA 1P92A 2V8JA 1TY0A 3GTGB 2DNCA 4RUGA 3E19A 2KCTA 3JCMP 2JEAI 3HKZB 4LF8L 1IYVA 5KH6A 3H15A 1MV0B 1PKTA 2HCCA 4N0AA 5C4JH 2FZGB 3PFSA 4JVZA 1GCPA 1EX4A 4M77E 2VXWA 2X69A 5BR8Q 2NN6G 2ZPBB 3OY9A 2ZM6L 1OU9A 4IJHA 3GTOH 2YU9B 2QDLA 1U4LA 1QCOA 4XTVA 3L7ZC 3NTHA 4POGA 2CP5A 1LT5D 2R7FA 3T16A 3W2DA 2PTKA 3ULPA 4K8IA 4M77D 1AEYA 1Q8IA 1V43A 1DJ7B 3CXCP 4JI3L 1YJNT 2DBKA 3HOXH 5E1FA 1RODA 5D6XA 1ILPA 2LQKA 3KF6A 4DR5Q 5IP9H 2F0LA 2H1EA 5J22A 5IXBA 5HK0A 4PJJA 2BUDA 1QVGA 1KRTA 3VU3C 1NPRA 3FJPA 1HTPA 2KYBA 1NNXA 2BDOA 5AT1B 4DOVA 1K28A 1TXQA 4QQ6A 1BCPB 5IT9L 3EFRA 5JVH3 4DV4L 1FR3A 5ECAA 1QVFP 2CWAA 2KT8A 5IAYA 2PMZB 3BDUA 3WDNA 4BY7G 1FVIA 2CT3A 3ULJA 3F2UA 4JV5Q 2DYIA 1VCIA 4LUOA 1EL0A 3OBYA 1H3HA 3JAME 1Q90A 3U9OA 2KXCA 1QB5D 4LUDA 1LT6D 2B39A 1T0HA 2X51A 5GAN8 3AYHB 5HURA 5LJ3g 1M2VA 1GCQA 1F2MA 1ZHIA 1Q12A 4M7DE 1JXOA 2AUJD 4GS3A 4DR7Q 4PKCC 1SXTA 4LDWA 5C4XG 3MXUA 2JM9A 3I4NG 1TU0B 2B63B 3HHTB 1WTVA 2OJ2A 3BYTB 4OEMB 1SNPA 1D2BA 1I4RA 4X66Q 3MEWA 1TWAH 2MQHA 1NAPA 4A3LG 2E75C 3HS0C 1SMXA 3Q24A 2DFUA 1WHLA 3I9QA 5EC7A 4KUIA 3T53B 2VGNA 2K04A 2KEDA 4PJOE 4YY3L 4N9PA 1EFNA 2VW9A 1B9NA 1UGSB 1D5MC 2RH2A 2GFUA 3UF4A 2CUDA 4LDYA 1DOKA 1PFBA 4GNXB 1UWVA 3GTQB 3UDXA 4XTYA 1XXGA 3E9IA 1S5FD 3SXHA 1BI3A 2R92H 4PJOD 1I1JA 2RPNA 2KSSA 4E6RA 1JJGA 3ULRB 1BCPF 1KNAA 2QGFB 2XMFA 4DUZQ 1IBML 4GN3B 4B3MQ 1RAFB 1BOSA 1PH8A 1K9AA 2UXDQ 2C5CA 3GQBA 4KK7A 5COYA 2EJGC 1F9SA 3EGDA 2JVVA 3SK5A 4LF7L 4RCOA 4JI2L 2D8JA 3J80c 2F2XA 1JQYD 1WJRA 4VUBA 4AIMA 3M9QA 5GANe 3CCMA 2DGYA 1AZQA 2HHHQ 4XU0A 4TVRA 4O0AA 4Z9CB 5LJ5g 1BBUA 3PO3G 2EDGA 4BBSB 3S15H 2OQ0A 2PVGB 3PIO3 1X55A 1SNCA 4DV6Q 4A3FH 2C0IA 5FO8B 3A55A 1HPCA 5GMKj 2KK4A 3MEUA 4C5HA 1YJ9T 2JA7H 3I56Q 2J0TD 5HCKA 2O5JC 1M2OA 1D0XA 4PFOA 1NJIC 4ZCKA 2K6DA 1AWJA 1SMYC 4DR6L 1D1AA 3PE0A 2COWA 3ER0A 2DETA 5JAVA 2ZPGB 1WNLA 4HN7A 4OWXB 3KXTA 4RTWA 2WP8J 2F4VQ 3HOYH 2ED1A 2SOBA 3IAYA 2K3XA 1CKMA 4DBRA 3B6YA 1EY6A 1PRTC 3KLWA 3MEFA 2BTTA 4H13C 2YRDA 3PVQA 1CZGA 4RGNA 5FLMG 1GL5A 3K6OA 1I94Q 1HQRD 2UXBL 4HCKA 4M8AA 3G71Q 3V8LA 1FWZA 5A2QE 5CCAA 2K5IA 1N9WA 4EDUA 2KMTA 1XWEA 3VKIA 2E6ZA 4M7DB 1VIEA 3RR5A 1WXTA 2DF6A 1X69A 2V4DA 2YTXA 5GAMf 3JCMb 2K6AA 3DUZA 1S1NA 1KQSS 1OEBA 1K83B 1H9KA 1SROA 3GTPH 5KYLA 1MD2D 3ZYYX 2L3QA 4HVWA 2JSOA 1TOVA 2PQEA 3PSIA 2R57A 3G48A 1GUSA 1CSQA 1SE3A 5AJ3Q 4DAVA 1B2TA 5JPNC 2F3VA 4WRDA 4M7AG 4Z8AA 2MFIA 4XT3B 1HXYD 1GUTA 1UE1A 2A69C 2XIDA 1DCZA 2RSNA 2ZTDA 4I7AA 3GTLB 1AOJA 5FU6C 2N88A 4OO1G 1MJEA 1BU1A 4BB7A 1SBBB 4K2KA 4X64L 4YHHQ 3BYYB 3PMIA 5IODA 2DTIA 1YHQT 2ICEC 3MXGA 3M0QA 1M90C 1CFMA 1EQTA 3CCEA 1OXXK 1O7ZA 2L12A 4C8QC 2F0QA 2K57A 1YNND 5CO7A 4XTXA 5ELOA 1KC8U 5LJ3d 4DK1A 1X75C 3SEMA 1JB7A 1VQMA 4X3UA 1B44D 1SYCA 2YRCA 4G57A 1O7YA 1VQ9A 4DA2A 2E2JB 4NL2A 3H0HA 4QJFA 1IYUA 1VQNQ 1V8QA 1R0CB 4PL6A 3TSWA 2K2VA 2R5MA 3NPFA 3F1ZA 3T51B 5GAGC 1Y1WH 5M5WH 4A53A 1WCMH 3E3XA 2M0YA 4XYOA 4R8NA 3MTSA 3R8BA 1HCZA 4JI6Q 5GAN4 5CV7A 3J81j 3H3VH 3OBWA 4OB0B 4UPAA 1FYCA 5KNBA 1J9OA 2D0NA 1EY5A 3GBQA 3DWPA 1CHPD 3LW5E 5LL6X 3KJPA 2Q8IB 4A3BG 3MVVA 2J6OA 3KJOA 4CC2A 1QVCA 3UA7A 2BA1A 2XWJB 4IURA 4OIKA 3GP7A 3S3OA 3PO2H 1NR4A 4UY8C 2RMOA 1T9HA 1VQOT 5ELNA 2BIVA 5GAMg 3FEOA 1O7IA 1Q82R 4A54A 2JYOA 1V76A 2F0UA 2QG9B 4FP5D 1HQMC 1ICFB 4B3SL 4OVAA 5GADC 5M3MH 2QTXA 4NMZA 1B9MA 2F0TA 4J6XA 4M78B 4J9GA 3G6EQ 5LJ5d 5GAEC 1PYSB 2CKZB 1X2QA 2QK0A 4A76A 3M53A 3OYDA 1H95A 4B3RL 2A6HC 2FG0A 5GANj 3A74A 4X65Q 1Y71A 4DU9A 4ALPA 1QCFA 3PUZA 3V8KA 5KIXA 4HJ8A 3JCMf 3CMAQ 1Y1VB 2BCOA 1I6HH 1UG1A 1X6GA 5M5XB 3JCMQ 4ME5A 1JR0D 4H02A 1U1SA 1VOMA 2CHBD 3AT1B 4B9WA 1KQSP 5CV4A 1D1IA 3FKIG 2C9OA 2N8NA 1SNDA 3I7FA 3MO8A 1DYQA 1CKNA 1RUWA 3V8JA 1HNZL 5DAUA 4A3GH 2X35A 2LXJA 1VF5C 4XQ3A 4FYDA 4Y7NH 1VYUA 5A0DA 1L1OC 3P8HA 1NE8A 2YUPA 1Q82U 1WHMA 5IOCA 1U9RA 2LZ6B 4EMHA 2QKIC 2YT6A 1XMOL 1WJJA 4KULA 1EY7A 1PWTA 3OYHA 1NJIR 1CA5A 1ACMB 1NBEB 3QWXX 5IN1A 3I4MB 1IBLQ 1JBMA 4F8MA 3OYAA 4M78F 1VQKQ 1ZXTA 4POFA 4E7LA 4DV1L 4A3IB 3S2HH 4JLGA 1ZSZA 1IW7C 2RSOA 3VR5A 2B2UA 2AZVA 2DK3A 5KYUB 2F03A 3H0GB 2J05A 4JI4L 3OSVA 1VQCA 4C5GA 1E6HA 4LUVA 3K0YA 2QI2A 4JJCA 2CP6A 2DXUA 1TU2B 4RKUE 2VQEQ 4OHJA 1L1OA 2JTFA 4M75B 4OMMA 4HVVA 1EU3A 4DNIA 4ATOA 3J80L 3S9WA 2RB6A 1UNSA 4B08A 2B2YA 4DK3C 2R58A 2ED0A 2OWOA 4LF8Q 2PZTA 3OHXC 2HT1A 1K8AC 1HA6A 1VQ7Q 3QDFA 1SYFA 2VB6A 3I56A 5J1ZA 3T4AC 4A3JH 2BKDN 4RG8A 1VQEA 5HK3A 2ZM6Q 3W5OA 2VGMA 1YJWQ 3KLSX 4HCEA 1T0JA 3I55Q 1TG0A 3LWHA 1QWFA 1D09B 5CK9A 1RTOA 2F3WA 2FINB 2AWNA 5C4JB 1JB0E 3A8MB 4JI3Q 4XTWA 1A0NB 2CH4A 3V7CA 2OTJT 3HKZG 2VKNA 4RTYA 1BR9A 1EYDA 1VQ8T 1KL9A 2F1MA 2G9DA 2L0CA 5CIUA 3GDEA 3I4LA 3GPLA 1J5EQ 3GTOB 1M90R 3VS1A 5I6YA 2LT4A 3V05A 4B3TL 4IFDH 1FMKA 2BE5C 1RADB 3SVMA 4XAXB 5D6YA 4DV4Q 2X3XD 2D0PA 3AB9A 2I5MX 1PTOC 2KJXA 4M75F 3CCVQ 1WOCA 4OELB 3HG9A 1YNJC 1KDAA 1SEMA 4R0KA 4F7UB 1DOLA 3RMQA 3REBB 3I91A 4P72A 3TBIB 2A37A 3M4YA 1FNUA 2WSEE 2KBNA 2DBMA 3KUFA 5LMNW 3A8IE 2H8HA 1ENCA 1UE9A 3RZOH 1U8RA 3UPUA 3INZA 3QYHB 2YYZA 2K4KA 4P71A 4BE1A 1PFSA 2R5AA 2DTHA 3GLXA 3SHWA 1O75A 3BE3A 1L0XB 3ITPA 5IY0A 4LFBL 3F2DA 2UXDL 2P0KA 1JWMD 2HKQB 1D5ZC 1UEBA 1XQHA 1ZUUA 2EKHA 4PZ6A 1AWXA 2RD1A 3QBYA 4DBFA 3UDIA 4YY3Q 2KCCA 4GLKA 1W70A 2LP5A 4K6DA 3HOWG 4R4CA 5GAMe 4M77C 2P4TA 2QAZA 1B7YB 1I07A 4BI3A 2XDBA 4BXXH 1AHJB 1TWAB 3CRKC 3HFOA 3RERA 4BDZA 1SNQA 4WORA 2B63G 1VQNA 3TS2A 1VQ6Q 3EH1A 1G3YA 1IBMQ 1Q46A 3U58A 1PV4A 2E74C 5DEHA 1ICWA 1JMCA 2VASA 5EAYA 4LF7Q 4FW1A 4C5IA 4JV5L 4F7UF 2QEXQ 4JI2Q 1MGSA 4KT0E 4Y28E 2PUOB 2R92B 4BD3A 2M51A 3EHRA 3O5ZA 3OYYA 2HD0A 2VC8A 2FL7A 3DEOA 2XRQD 3VA5A 2E2IH 2L3RA 3E6ZX 2NYSA 1SG5A 2K2MA 1A3VA 2K7VA 4M7AD 1Z9FA 4QY7A 2FPDA 2F5TX 2JOYA 3M4GA 2B2WA 1WI7A 3SHLA 1I3QH 2V1RA 1HZCA 2KRSA 2E64A 2F0OA 2KEAA 2F1LA 1J8IA 4LUEA 1XYIA 3ZEHA 2HCKA 3VS2A 2R7ZH 1AWWA 2Z6BA 3CPFA 3S15B 3AU7A 4DR6Q 3RKXA 1TS4A 3EFXD 3G6EA 1PTOH 1FX7A 4BBSG 2MWOA 3RESA 2JE6I 2HZYA 1X3FA 4PJOC 3CMAA 3NQTA 5CKFA 2ZXOA 1AZPA 5KGUA 2PW5A 2AZSA 2XD0A 2RF0A 4K8JA 2UXBQ 4O42A 1GM5A 5C44B 3CEYA 4PZ7A 4CI0C 1GOZA 2R93B 3LH0A 3HOYB 1R8OB 2YSQA 2ZTCA 4ESRA 3G4SQ 2CZ0B 4DR1L 4AYBB 2FEIA 2KROA 1B53A 1K8OA 1BB9A 2YTVA 1ZLMA 1CSPA 3S1MH 2DY7A 1NG2A 1A3UA 3KF8A 1AP0A 2K5VA 4K14A 1RAGB 8AT1B 1IO6A 3CXCA 1VQ5T 2DKGA 3EGDB 1LTID 4ZK9B 3CMET 1S5CD 1K8AR 5GAOl 3BJUA 4DEXA 3K57A 2K4YA 2RHXA 4PMCA 3VUZA 4GKJL 3ND9A 1HZBA 2HL3A 4CC4B 4PJOA 1CHQD 2E2DC 4C3HB 3GTPB 4M7DG 4QUCA 1Y96A 3JCMe 2KGTA 2ZCFB 4HCZA 4E7ZA 2RK2A 1LTLA 4JRPA 1Z9QA 1RAEB 3I5RA 2ZPFB 1OQKA 3H91A 2N55A 5C3XA 2OCEA 3D4DA 1QVFA 1LABA 4C2MH 1UJYA 2EOTA 2DTOA 2FYKA 5F2DA 4K11A 3H8ZA 3OS0A 2K79A 4RHRA 2ES2A 4BY1H 4A3DH 1DJRD 3CC4T 4LDUA 1X3QA 3QPHA 4OMLA 1STEA 1PG5B 2B8FA 3GTMH 5CKDA 3GV3A 4NB3A 2AKWB 2KI7A 2K5WA 3W1BA 4C92C 2XSCA 1XX8A 1EIYB 3VS5A 5JEAH 3FRNA 3GNGA 4E2FB 1EIGA 1YI2Q 2WFWA 1VQ7A 1A2TA 4NXML 4ZGEB 3H09A 3UDCA 4JDSA 2RCFA 2ZXRA 4F88A 2E65A 8ATCB 1YJWA 4ORZA 3E5SA 5K5PA 2FO0A 3I55A 4QKUA 3RD4A 1OZ2A 2ZJRA 3M58A 1CM9A 1EZZB 1Y1WB 1ASYA 5M5WB 1WCMB 2K01A 3C95A 2NBFA 3HOVG 5C5MA 1M4ZA 4X9DA 1G3WA 3KLRA 2JA6H 3CC7Q 1W2BS 1RAAB 3RLOA 5JJIA 4YWKA 3RN2A 2YUOA 3W3AA 2Z4HA 2NUZA 2L15A 5KE2A 1N8RU 1M1KU 4X3TA 5IWAL 3F70A 1TWCH 1GFCA 3I90A 4C92A 4HIOA 2LQ8A 4B3SQ 4ULLA 1BNZA 4HSPA 2K75A 4NW2A 4NL3A 3KBXA 3FLGA 1BCMA 2EAYA 4HCCA 1X3GA 3PO2B 3REAB 2JS2A 3CCVA 4ZGDB 3M4OH 1H9JA 1EIFA 3EIVA 4B3RQ 3P8BB 1F2LA 3MHXA 3CD6T 5IGEA 2SEBD 2IPOB 1FMWA 2KE9A 4FL6A 4XU2A 1H92A 4JI0L 5M3MB 4KJNA 1G8XA 2Y4YA 4DV3L 2Z6KA 3CHBD 3CCJT 4A3CG 4XK8E 2D62A 4AFUC 3W1GA 3ZFJA 4KI0A 1PNJA 2GNCA 2K14A 2NVYH 3MP1A 3I2ZA 1SJHD 1O9SA 3A5ZB 2RHQB 5GMKi 4ZAIA 1HNZQ 4M78G 1JWUD 5GAOr 1BI2A 3VS4A 1NUCA 2EQJA 3C4SA 1RABB 5JPMC 4DV0L 1VQDA 1VQHA 1WHKA 2Z0SA 3X25B 1HR0L 1Y1VG 1LACA 3DB4A 4ZKBB 1KXLA 2F2VA 1PYWD 1S40A 2JT4A 3HOUH 2I2LA 4LAAA 3A8LB 4OONA 1PKSA 3RLFA 4HIMA 4OWWB 4A3GB 5L8RE 1IL8A 2L11A 3QO2A 1XMOQ 1VQ6A 4A4GA 2ZXPA 1HZ9A 3FPPA 3UI2A 4Y7NB 1PSEA 1D3BA 1RF2D 1GXIE 4DV1Q 2CSIA 4HVUA 1PZKD 1IHVA 5I9OA 2ZT9C 2KBTA 1K76A 2DVEA 1YWOA 2QEXA 1Z7TA 1TS3A 3MEVA 4CDFC 4JI4Q 4A4EA 2RNAA 1X32A 2K5QA 3OS1A 4ANJA 4CJ1B 1C1AA 2NYZD 2KUMA 3S14H 3KYHC 3D6CA 4NOYA 1R4QB 5GANg 1SR3A 3S2HB 2JN0A 1YWPA 1B70B 3I3CA 3X24B 2GBQA 3JAML 2A7YA 1PHTA 3T1HL 1FJGL 1U4PA 4J6WA 1IYJB 1GD7A 4CJ0B 4A3IG 2L2PA 1PHJA 3FJ5A 3JB9H 1J3TA 2DD4A 1M1GA 2F0IA 1MNEA 2K5DA 5D3DA 2O31A 3MEAA 2AKLA 3H0GG 1BBZA 3OYBA 1JJ2A 2E2HH 1JT8A 2YUNA 1PH3A 2MMPA 2FZCB 1STAA 5FU7C 1I5LA 1P16A 3M4QA 1E0BA 2ID0A 1W2BP 4PMBA 3EGXB 2RQWA 4PLIA 5ELCA 1H9MA 1Q81U 1WJQA 4HKEA 2Y90A 4M75G 3ND8A 3DWAA 4PV1C 1OULA 1MI2A 5E4XA 4C3JB 5CMDA 2DXBA 2Z8LA 3SE0A 1I81A 2X4XA 2RHUA 2RHIA 4BA1I 4A3EH 2UUCL 2BH2A 2J6KA 5DNFA 4X1VA 4A93B 2G6FX 4H7BA 4KY6A 1YNXA 1IGUA 3MXNA 4B3TQ 2XKOC 2HDLA 5FO7B 1N33L 2DRKA 2PQWA 3QYGB 1YNZA 3L2QA 1ABOA 3G1JA 3G4SA 4KY7A 4CBVA 2K5FA 3LGJA 3V2TA 4TQUS 3J81i 2NVXH 1G6PA 2QXFA 2YHTA 5EPLA 3MA2B 2DL7A 3QKJA 4NP5A 1PFMA 4KHVA 1QP2A 3IL8A 5FJ8H 1ZSZB 3A8GB 4JZ3A 3PUXA 4N4GA 4RCBA 1RJTA 5L37A 2LRQA 3FC3A 3LWEA 2LDMA 2JXBA 2V8KA 1VQFA 4FYWB 3AFPA 2AIRB 2GFAA 4GY5A 1EEID 2KHSA 2LY7A 2X9HA 1L1OB 4LFBQ 2EVRA 4EX5A 2KRNA 5GAN6 4Z02A 4BUGA 3TS0A 1RI9A 2HSPA 1YIJA 1GBRA 1EFID 5IGCA 4JG2A 1VQLQ 1ZBXA 4DR2L 5IE8A 2CZ6B 1XTDA 2L89A 2RKSA 3X26B 1AW7A 1J5EL 4XYQA 5M3FH 5KNCA 3GOXA 2I46A 3SD4A 5ELDA 1WIEA 2P0QA 3KFUA 3HRUA 1CSKA 1KQSA 3TP7A 2K7AA 3BVGA 2QTVA 1TS9A 4GOPC 1TWFH 4IQZA 4DR3L 1SNMA 4F87A 1YI2A 5IP7H 2K3YA 2NN6H 3OB9A 5BN4A 2O4XA 2RQRA 1S72T 1VQOQ 4V2SA 1SSOA 2HIVA 1BIAA 1E1TA 5A2QL 1KIKA 3P7JA 2HDMA 4C3JG 3EG9A 5GAOp 5FKAC 1WX6A 2KCNA 2CREA 3UDFA 2YTYA 1SYGA 1XNRL 1GO3E 5HGTA 4U673 4X64Q 3BDOA 3CC7A 1TQOA 4YCWA 3Q0AA 2XHCA 4J9DA 1SDFA 4HT9A 3QOJA 3QWNA 4HJ7A 1NLOC 4M7DD 3LGFA 2FXQA 3L2ZA 2I07B 1QW1A 3PMTA 1FD7D 4R1JA 5CC4A 2IHFA 2HEQA 2ZJPA 1AE3A 4GOPA 2DX1A 2RO0A 2R92G 3VRZA 5M9OA 4JK1C 2KHJA 5A0LA 2HKNA 3CCLT 1HJPA 2K9GA 2LX9A 4OWTB 5GANd 4BY7H 1JJ2S 3TEHB 2KQ3A 1C9OA 1T3LA 1B3AA 1TS2A 5JJLA 2LFNA 3R3OA 4OXPA 4JZ4A 1ZEQX 3SGIA 1PZID 3K5MA 3S1RH 3NEMA 1STNA 1LVKA 1RI0A 1KD1C 4RGMA 2G3RA 1SHGA 3VYRA 1JO8A 4ZTJA 2R7ZB 2LNHB 1EY8A 2EYHA 2HQEA 1I4K1 3I4NH 1OPLA 2A74C 3QO3A 2UXCL 2JNGA 4R8IA 1PTOB 3HP3A 3MKDA 1D1KA 2RM4A 2HIXA 3I70A 3CC2A 3P75A 4LF5L 4DR1Q 3OYJA 3OYGA 2IX0A 2KOLA 2YLBA 3QJYA 2GCXA 3H6ZA 1L0WA 2RI3A 2BZXA 3NWSA 3CCMT 2CYZB 3FPUB 1OX9A 4M7AC 1Y8OB 4JS5A 2FPEA 2VB2X 2VY3A 1ZBJA 2KENA 3EHQA 1HA5A 5C44G 2EWNA 1QZHA 1SE2A 4GKJQ 2R93G 2LC4A 4DAPA 2RJDA 3HFNA 5KYWA 3L2WA 1B1ZA 4IN3A 3HOYG 2QGQA 5EJWA 2EJGA 5C6SA 2FRWA 2JK8A 4AYBG 4DXFA 4JJBA 1B50A 3A8KE 1PA6A 1UAPA 1QMCA 4LF9L 3EFSA 5LHY1 2F52A 2KXDA 2B2TC 4X34A 2F0VA 4BWGB 2J06A 3A56A 4IUPA 2EYQA 1N5ZA 3EFOA 3R6NA 4OB3B 1PTOF 2RVLA 3PO3H 1W1FA 4XTCS 4C3HG 4M78E 2ZPEB 4C2MB 4JYAL 3CF5A 4M7AA 2A08A 4IFDJ 1LJOA 2EJ9A 3VUBA 1A63A 2AHJB 3M9BA 1CI3M 4BY1B 2O01E 1XTCD 4JI8Q 3KDFA 2PNRC 1K9MC 4NXMQ 1M3BA 4A3DB 1HUMA 4M78D 4XT1B 1I4PA 4DAYA 1SE8A 3JSCA 1YZ6A 3N6RA 5C3EH 4FF2A 3GTMB 1H8KA 4Z88A 2QA4T 1RTNA 2A36A 5GQOA 4YWLA 1N9SA 4F14A 1M9SA 3IFDA 4DGZA 1D0ZA 1X27A 5GAN3 1AD5A 4N9TA 5CGKA 2EW3A 1I8FA 1B07A 2QCPX 3VYUA 5FLMH 5GMKm 1LTSD 4FF3A 4IZ8A 2LCCA 3TDQA 1BVSA 4IUUA 1E7OA 1Y7XA 2JN4A 3KF8B 5IWAQ 2K5NA 1E3PA 1JJ2P 2OQKA 1YEZA 2FVUA 1QCNA 2O88A 3V96A 5FLXE 2JA6B 5DY9A 3CCET 2B3GA 2JQOA 4KRTA 1WCMG 1QWEA 1YCYA 2X4JA 1QE6A 1HUNA 3HFZB 3DEPA 5C0XH 1B7TA 1TWCB 2VWFA 1UE5A 2LX7A 1X01A 4DV3Q 1PRMC 2MK5A 4JI0Q 2JA8H 4J6YA 2EYJA 2DNEA 2F0NA 2MO0A 1M8VA 1II3A 2HD3A 3L2PA 4B6MA 4OO1H 1TUGB 2KEEA 4L5TA 2PNHA 3T1YL 1NEGA 4M75E 1G2TA 4A3MH 1PZJD 1H9SA 4GLXA 4AFSC 1IBKL 4C8QA 2IPKD 3E0EA 2EYYA 4E6IA 3M5AA 2JTEA 1T5EA 1BUVT 2XN9C 3H3VI 1U06A 4GLVB 4KTAA 4DV0Q 2AQ3B 2L3SA 1D6EC 1HR0Q 1VQLA 1X56A 4M75D 5HGQA 5D6WA 2NVYB 3LYIA 4QF4A 5M3MG 1KJWA 2JA5B 1SHFA 4IO9A 2VQFL 2MPXC 4O6JA 2FPFA 4QVZA 1PFNA 1CKOA 3JRZA 2QQAA 4OMOA 2RDGA 2NUPA 2RK1A 3VA7A 1PD1A 5KYIA 1P8LA 2PQAB 5EKKA 5IYDG 4MZTA 1ENAA 3HOUB 1SNOA 1GUOA 1Q8KA 1VQOA 3OSSC 1NMGA 1FNWA 2JTMA 2E5KA 1OXUA 2OEOA 1RIPA 4DK0A 2Q2TA 1KD1R 3OS2A 1SPKA 1LT3D 5LJ3h 2E76C 1Y69U 3GTKH 4A3BH 4A4FA 1BBXC 4C92B 4ZUIA 2CT4A 1LLRD 4BACA 2ROLA 4A3GG 4DK6C 2KAFA 4JRKA 3FEWX 1M5Q1 1SRUA 1WTHA 4PMWA 4Q0FA 3T1HQ 1FJGQ 1YITT 4Z89A 2COZA 3PV0A 1XPUA 4F7UE 1I4XA 3C12A 1N36L 4OMQA 1TVXA 4J6HA 4KHPL 1V1PB 2NTSA 3HOZB 3S14B 2OXPA 1LO5D 2WAQB 3S1NH 4MZMA 3OMCA 1JE5A 2NTTA 2FFKB 1X54A 2PI2A 4LFAL 2A68D 3S2DB 3IQLA 3MP6A 2CH4W 2JM8A 4R56A 3NK9A 1YFNA 3NMZC 4OF1A 4I65A 4EQNA 4EGVA 4M4ZA 5C5LA 2Y0SB 4FM4B 5C0MA 4E7HA 2E2HB 3M57A 2FMCA 2I5LX 4JC0A 2UUCQ 2M9VA 5A0GA 3D0FA 1VQ5Q 4JOIC 4OMPA 4MMLA 1EY9A 4CKEA 3CMEQ 1LYLA 1QILA 2KRMA 4J9BA 1N33Q 2DL8A 4BY6B 1F9QA 2M1HA 1TXYA 3M0RA 1WTRA 1QVPA 3PMFA 4BI4A 4TRDA 3AEVA 2VXFA 4KGZB 1CUKA 4RTXA 4C92F 1PH7A 5EGTA 1X6OA 2B8GA 2MCNA 2GA4B 1TSFA 2DPPB 5LJ5h 4C5EA 4HXJA 1D3BB
chains in the Genus database with same CATH topology
4BI8B 3NSWA 2J4XA 4UDUC 1QP3A 2D5DA 3D8GA 3OW7A 3TP8A 1AN8A 5CV9A 1PMRA 3MC0B 1ZYRD 1HFNA 5DLOA 1QNKA 3JCMg 3GNFB 2PW7A 4J7FA 5AYFA 3JB9F 1NJIU 2VNUD 2ENBA 2E10A 1RD9D 1Q86C 4IFDG 4BDYA 2J7ZA 3G71A 1W6JA 1BXTA 5D3IB 2SNSA 2KECA 1GXDC 1AEXA 1KDBA 1STHA 3OYKA 3HOXB 3RMHA 4FT4A 2Z1CA 3BVZA 4P2CB 5FO9B 5M3FB 1K8MA 4IFDI 3QSUA 3SWNB 4MN3A 5GAMd 3GF5A 4FXKC 1K9MU 3U9SA 1TWFB 2F0WA 4XXEA 4V0BA 4QUFA 4JS4A 2EQKA 3LWUA 3OYEA 2K5LA 3G7LA 3MXPA 3I72A 4PNYA 5FU7B 3LGLA 1G291 1LT4D 4P5NA 4J1MA 1G2SA 1KLUD 1BF4A 3LNNA 1M90U 1WPYA 2BA0A 4RCNA 1Z47A 4KKSA 3CCUT 1MBYA 3JCMW 3BG3A 1KQ1A 2RA2A 1GHJA 4XQNA 4DF7A 3AHUA 2MUYA 1H641 4RA8A 2RI5A 4HMIA 4LDVA 3BVMA 5JVG3 2DZCA 3QUIA 3C1FA 2RDFA 3NFCA 1W2BA 4K2LA 1BDOA 4M77A 3RUXA 5BN5A 1FNVA 1H3ZA 1STYA 3VR6A 2O2LD 4KBMB 4JRQA 3GD7A 1OO9B 3OW2A 2PYKA 1D5XC 4JUVA 4EPCA 4LMQD 3P1HA 3CCRT 3OWFA 4M7DC 3X3MA 3P8DA 4UC4A 2ICIA 3CCST 3MZ5A 1LNXA 2ZGWA 4A3FB 4R9WA 1K73C 3BY7A 3VR4A 3SEBA 2DIGA 2GQVA 3QG1A 5C3WA 2M0OA 2QF7A 2JA7B 4OMFB 1Q7YC 3FDRA 2DXTA 3G6ET 5G3LF 4O5VA 2DXCA 2MAMA 3HRZC 3OOCA 3CMAT 1EEFD 2F5KA 4JBWA 3TREA 5GAN2 3ERQA 4S3SA 3JCMd 3C2PA 3OMGA 1X3PA 2XWBB 3QIAA 2PVDB 5CBEE 4M7DA 1F9RA 4KKTA 1KABA 1Z6HA 3VJPA 3MEHA 3EVQA 3SDZA 1WD0A 3GV6A 1TH7A 1OXTA 2OT2A 4MIUA 3KUPA 3OYNA 4GZYC 3RIRA 3HSBA 2XI9A 3I73A 1A6XA 5I2YA 5I9PA 3PGGA 4CKCA 4IUTA 1VQKA 1KG1A 3EROA 2DIQA 2F0FA 4RKLA 5C3EB 3GP8A 1VQ5A 4DQ2A 1Y8PB 3CMEA 3A8JE 4KV6A 2WKCA 5IIFA 3PUVA 2KDSA 1JC7A 4XQJA 2M00A 3EA6A 2EYMA 4LK1C 2QQRA 3P20A 2F0EA 3CBOA 5JEAG 2FJ2A 3DM1A 4HEDA 3JCMV 1S4ZA 4RFBA 2QQBA 2NZ1D 4NKLA 3LWIA 1Q3LA 3WVEB 4ZQ3A 5EQ0A 3A8OB 4C56C 1NSNS 4J8QA 2C06A 5I21A 1ESRA 5CR2A 3CC4A 4DA4A 4QIWB 4FU6A 4IUVA 2CKKA 1K8AU 4I7ZC 2EKOA 1VQ7T 4M78C 3G7ZA 1UUPA 4ZRZA 4C0ZA 4FNFA 2PPBC 4E7IA 4M7AB 3R93A 1YJWT 2JA8B 4Y91A 3I55T 2WSFE 4HCBA 3C1EA 4DAYA 2L8DA 1TY2A 2OAUA 3NTIA 3CRLC 2EJFC 5K36H 3TZUA 2L55A 1FGBD 4BS9A 4HSVA 3S3NA 1VIFA 3L2RA 4A3MB 1EIHA 2JUFA 5FK9C 2EIFA 1M8AA 2IL8A 2K05A 1Q86U 1NR2A 4RGTA 3URYA 3L3OC 2HQXA 3OW2S 1BO0A 1ESFA 1PRTB 1YNNC 3Q22A 2PZWA 3HKSA 4KMUC 4BE2A 4IUQA 3RKYA 4X3KA 4EQPA 3KK7A 3CCQA 3A8HB 4EMKC 1WD1A 1VQPA 3PIPA 1MHNA 2EJFA 1RDPD 4XTUA 5CAIA 3HL8A 5DM63 3VYTA 1BIBA 5KEEA 2B2VC 2RJFA 2EQMA 4M7AF 3D3RA 3GTKB 5DM7R 3OYFA 2A6HD 1I6HB 2OTLT 3FMCA 2RJCA 1OXSC 5IGFA 4RG2A 1Y07A 3CBPA 3CCJA 5FU6B 1KNEA 4C92G 3EAEA 4EVOA 4CJ2C 1EZ8A 1I4QA 3OYMA 4Q5VA 4C8QB 1PRTF 1LTAD 3MAQA 3S1NB 2E1HA 2XNAC 2MWPA 4EMKA 2IWHA 1G91A 4RCCA 3MFGA 1VQ6T 4XDXA 3NXWA 1AFPA 1C8CA 3OA6A 1SAPA 2VXEA 1KHCA 4XU1A 2QEXT 3WXMB 2LS01 3DWQA 5EPKA 3JB9G 3FB9A 4ILWA 2NWGA 4E47A 5C4HA 3C3LA 4ODGA 3QZ5B 5JJZA 1BCPD 1VQ4T 4XU3A 4HAEA 2GF7A 3BS1A 2Y4XA 2PUKB 4RMOA 1S5ED 4L8JA 1BKBA 1B4OA 1TR5A 3TMEA 3JB9I 5CQYA 2A68C 4K5VA 4C8QF 2MI6A 3KLSA 3M85A 4A3JB 1HK9A 2LTOA 1GJXA 3TU4K 5ELBA 3DLMA 2MHVA 1Q7YU 4WJWA 4C3IB 3META 2ZPIB 2E5QA 5LL6S 1TWHB 1V29B 1JB3A 2HAXA 3E9GA 2K03A 4F7XA 3VYSA 5EBDA 3K5OA 4QW2A 1VUBA 1UGRB 1G8ZD 1PXUA 5FOBB 3TEEA 3G4ST 4NDXA 3EJIA 3E0JA 5CV5A 5C0XJ 5CKBA 5LJ3f 2HUGA 4HT8A 2ZPHB 5JOBA 5HKCA 1KC8C 2A6ED 2BE5D 3FRPB 3BZDB 1EY4A 5I6WA 3K59A 2OF1A 4FF4A 4ZTFA 3LLRA 5GMKh 2IX3A 3NTKA 3UT1A 3K7AB 1ZYRC 4C0DC 1LTBD 3DKMA 2WKDA 5D65A 4G7HC 4OGEA 3RMSA 4F7UG 2IG0A 2MF2A 3RZOB 1JORA 4MDXA 3SB2A 1F2YA 2IJ0A 1YIJT 3DMUA 1WVLA 1EU4A 1RHPA 2IX1A 4V190 1BQQT 3BDLA 3PIOA 1XOVA 1YJNA 3R2TA 2DN8A 2B8AA 2WINB 3UWNA 2EY6A 2JEBI 4MDWA 2IVWA 3QDRB 2YRVA 1YI2T 2H3JA 1DM0B 3HP9A 4RHSA 1GUNA 1H9RA 2NN6I 5LJ5f 5KE3A 2K1BA 1O80A 2EZVA 1S72A 4L6V5 3OS5A 4TKOB 3CC7T 4X3SA 4DN4M 2E2IB 4UAIA 4ZUJA 3TZDA 2NLUA 4BE0A 3WOFA 3HOWB 5CBAE 1ILQA 1I3QB 3NQIA 3QJ6A 1N6AA 2RHZA 3L9AX 5GAOq 3QZ9B 4J8OA 5FLXL 3CCLA 5AFWA 1Q82C 2F4IA 1SE4A 2KY9A 3ASKA 1KLGD 1A15A 2XK0A 3SK4A 4BBRB 4MMKA 1KHIA 4QVCA 3VYGA 3OSOA 4FXDA 3CC2T 2R61A 1ET6A 2PZUA 3OPOA 1XNIA 3QIIA 3HRTA 4C0FA 4QB4A 3S1MB 3MWYW 4D6WA 3OIPA 2L9HA 3S17B 4M77B 3X3NA 3N52A 1JWSD 2QDYB 3Q23A 3HZXA 3Q6SA 2DZ9A 3K5NA 4XTZA 4G7OC 1S5DD 1YJ9A 2XG8D 1DZ1A 2H4OA 1LTRD 2F69A 5TSSA 2XU8A 5GANh 3M54A 1HHVA 1DONA 4O1NA 5CKHA 3H3VC 2SNMA 2F0JA 4BA2I 3J7YW 3JCMX 2L5QA 3S3MA 1ENFA 1EQVA 1ZKOA 4ID6A 5J26A 4C92E 4A3KB 4YIJA 5IT9E 1M1FA 3RZDB 3QHSA 4A4KA 2VV5A 1R9TB 2B2TA 5CORA 1JOQA 4C92D 4MHEA 2WB1B 1B34A 3PUYA 4M77F 1TWGB 2WSCE 3S16B 1QVGS 4WF2A 3ONAB 1G3SA 2QA4A 1Q1EA 2E12A 3G6JB 3GO5A 4CHTB 2EYLA 2L1BA 5J39A 1OYXA 5C0XG 2DD5A 2RJEA 3H6MA 4PJOB 2R6GA 4A4HA 1Y96B 3RUZA 2BOSA 1YHQA 1S5BD 4CKBA 2M2LA 3TCJA 1VQMT 2DO3A 3QB3A 3JB9D 1VQ9T 4ELZC 2NUCA 1VMPA 2F0SA 2MPMA 4JRIA 4RKBA 4DXGA 4FT2A 5KCOA 3M4OB 5C0XI 1WGSA 4LD6A 3OYLA 1LTTD 2PVOB 2BDNA 2K28A 3HOVB 3J81L 1W6KA 4OO1I 1PSFA 2K32A 1LOJA 4M7DF 2EE1A 1G5VA 2XRSD 1O7LA 4OB1B 3NBHA 2CW0D 1VQLT 1IHZA 1HXDA 3L2VA 5IGDA 2RA4A 5LJ3e 1WTPA 4PJOF 4IALA 2JP1A 4TSSA 5EPJA 3CPWA 4ABNA 1E2ZA 3X20B 3WVDB 4OIJA 4H44C 3PT9A 1QNUA 2EYPA 2DAQA 4L59A 4OL7A 5CV8A 2XICA 4HTHA 4B9XA 2KVMA 4C8QG 1R4PB 4K5WA 2EY2A 1KQ2A 1EWHA 4RWSC 3FIFA 2EYFA 3T13A 2VUMB 2EVBA 1CTMA 1KAAA 5ELFA 1ET9A 5GMKl 2VUBA 5M5YB 2CZ7B 3LX7A 4HR7B 1YITA 4FVMA 4ZN1A 2LT1A 4QCLA 2B2UC 1JICA 5LJ5e 1SYBA 4PLLA 2QILA 5D14A 4FIBA 1KD1U 2TSSA 4M1UB 1DOMA 1KDCA 5EBCA 3ZBDA 3QOLA 1CK1A 2EJMA 1MGQA 4JJNK 2B2YC 3Q1JA 1NZ9A 4C1NI 4A3EB 4HA8A 5IGBA 3JCMJ 3S6WA 1HRJA 4EMKB 1C4QA 5BN3A 2CQAA 5CV6A 2DJZA 1JCKB 4YTLA 3H94A 3J81E 5JEAJ 1WJSA 4QMGA 2NVQB 2XDPA 3D31A 1QWYA 2TMPA 4C3IG 4OGCA 4DOWA 3CKIB 5G3LD 4J7IA 1BCPC 2NVXB 2X6LA 1WTQA 1G6ZA 3I56T 4E7JA 1TS5A 3PTAA 2P0PA 4LD9K 2F0GA 4ME7A 2JZ2A 3A54A 2HBPA 1QCBD 2MP1A 2XDDA 4KD4A 2E41A 3MHBA 4G7ZC 3G71T 1RCVD 4J83A 1TT2A 3R6OA 3NP8A 3M7GA 2OTJA 3L1AA 2LNVA 1VQ8A 1SYEA 1A2UA 4C1NK 1EZ6A 3NBIA 3OQ5A 1N8RC 1M1KC 3CPWS 3TN2A 5ELEA 4N4HA 2G9HD 1QG7A 3J7AF 4ZGJB 5FRMA 3O13A 3ME9A 3FDTA 4Q5WA 2X4WA 2E6NA 1Y8NB 1T5XD 5GAN7 2A6EC 2WACA 5EKIA 2PU9B 2F0HA 1SSFA 2MGSA 4XQQA 5KNDA 3R2IA 3M59A 3HGBA 5LJ3j 1TIID 2EY1A 2E70A 3AMUA 3NWTA 1O78A 1E2WA 3URGA 1BI0A 3VV0A 2FB7A 1KTKA 3M3YB 4DNTB 1JE4A 4IKFA 1E2VA 2F0MA 3K5LA 5EKLA 3D4RA 2EY5A 5A35A 3NUCA 3DLLA 2QEJC 4ZN3A 2CS7A 4XIGS 1V1OA 1VQNT 2CZ1B 3E9FA 5GAOm 3T9NA 4BY7B 2M16A 5C4ZA 3D6WA 5DLQE 1SJED 3CCUA 3SFMA 4OP0A 3V7SA 3S1RB 5I2XA 1DD2A 3BW1A 5NUCA 2KA7A 2B2WC 3S1QB 5C4XB 3I4NB 2XVSA 1BI1A 4KHZA 2DY8A 2O4XB 5GAMh 1N9RA 2PCFB 1CT1D 3JCMc 1NCVA 3JB9J 4C0DB 3J80E 3HPWA 4M7AE 5LJ5j 3MP8A 2PO4A 5T1IA 2QDBA 3WOEA 3BFMA 2V8IA 2SDFA 3CCRA 2MJ8A 2RDHA 2X4YA 3CCSA 5FROA 3X28B 1SMYD 1Q81C 3TP6A 2D6FA 1SYDA 4M77G 4U68A 1PRTD 5E3FA 1EWCA 4KN4C 2X6GA 3KBGA 3PO3B 2F0KA 2CGHA 3E1SA 5CVIA 4QVDA 1CA6A 1CZWA 1PLFA 2RI2A 1UB4A 4CRIA 1WTWA 4ELYC 3VR2A 2A73B 1VMCA 2D0QB 1CQVA 2FHTA 4FXGC 1M4VA 2AWOA 1I4GA 1W4SA 3DB3A 2LCLA 2A3LA 3K58A 2F0DA 4H0LC 2XIWA 1U1TA 1I6VC 1VQKT 4HCSA 3A7AB 5GAN5 1F9PA 3M56A 1G3TA 3O8VA 4WFN3 2HCIA 2WV6D 2A69D 1ZQ1A 2NVTB 4C8QE 5HY6A 1GHKA 1TKWB 4K5XA 3OYCA 3LX0A 1BYMA 4J5YA 3NHHA 4ZKCB 2O5IC 4DAPA 2L5TA 3L42A 1F77A 5T1GA 3IFTA 5I2SA 3NPPA 2DEQA 4C8QD 1N27A 1WTXA 1IKLA 5EG2A 1IZ6A 4OB2B 1VDZA 4RGOS 5J3BA 3JCMh 4PJOG 3VYHB 4QQGA 4KJOA 5K36G 1Q1BA 2QQSA 5E4WC 4RAUC 1RL2A 1UEAB 1IREB 1UGQB 3N5BB 3HEJA 5CQXA 2JXMB 3SK6A 4FSXA 2RQXA 4FF1A 4OGQC 2IT1A 2AUKA 1JOKA 1LTGD 1HTLD 2QQ9A 1UGPB 3OYIA 1MSHA 4KY5A 1VF7A 5DM73 3QXEB 4JLIA 5I2MA 1WQWA 4X9CA 5C6AA 5I4DA 1B34B 2D9UA 5GAMj 4ZYSA 2EPBA 4M78A 2AQ1B 1DXMA 3I8ZA 3V7RA 2VYTA 2AQ2B 3M7NA 3CCVT 4N4IA 1QJOA 1U4RA 5GANf 1A3TA 1L0YB 5FRNA 1EOTA 2IW3A 3M55A 3CCQT 1OI1A 3VR3A 3C94A 1VQPT 3CD6A 1EYAA 2M9UA 4EQOA 1QOHA 4A3BB 4BY6C 3L2UA 4DFAA 1WQ7A 1V1PA 4PQXA 1FXXA 4E7KA 5GAOn 2WIIB 4M75C 2RBMA 3TP5A 4C0GA 5IGGA 1H9SB 1JRIA 1CQFA 2OTLA 2CW0C 1I4HA 2D2CC 3PNWC 1JOOA 4R55A 1ML0D 2EXZA 2EQUA 2R3ZA 1LV9A 4KD3A 2L4NA 4L6TB 3MFYA 4RH6A 5CR3A 2B2VA 2Z4IA 4KKUA 3OIQA 3CBMA 2K33A 1EY0A 2KVQG 4NS5A 5ISRA 2LMCB 3GIBA 3CQZB 2FHDA 3CXCS 1YBYA 3FKIB 2KQWA 3FVQA 1HFGA 4FO2A 4EMGA 3HRSA 2EFIA 4M75A 1IW7D 1EYCA 3SK8A 1STGA 4II1A 3D4WA 1PDQA 3SR1A 1RKNA 1SEBD 5CYUA 2NB0A 3RKWA 1QVFS 4QQDA 2LKVA 3MCAB 2ZZDA 3C46A 3DXJC 2YLCA 1OXVA 4IUNA 4ZLTF 3SWNC 1NPPA 2CVRA 1STBA 1VQ4A 1GUGA 1I50B 1K73U 1MSGA 2LVMA 4PNOA 4L5GA 3CU7A 3A7LA 4G4KA 2FMMA 2VB3X 2D9TA 3DHQA 1GUWA 4K6LA 3T56B 5KRUA 4L63B 3J7AV 2Q8TA 3OWEB 3GTJB 3PIP3 1F2ZA 3TSSA 1U4MA 4N0AC 5KCHA 4MZPA 5GMKe 4LDXA 4KUDK 4LJZC 5CKEA 4F7UA 1SFOB 3PUWA 1OZ3A 3SWNA 3IKJA 1C48A 4CGYB 2HNIA 2A5HA 3NE5B 4KN7C 1ONLA 2Q8RE 1WTOA 1PTOD 2RHYA 3BDCA 4DNRB 1YNJD 2EYOA 3EQLC 2F0PA 1IKMA 1P92A 2V8JA 1TY0A 3GTGB 2DNCA 3E19A 3JCMP 2JEAI 3HKZB 1IYVA 5KH6A 2HCCA 4N0AA 3PFSA 4M77E 2VXWA 2X69A 2NN6G 2ZPBB 3OY9A 2YU9B 1U4LA 4XTVA 3L7ZC 3NTHA 1LT5D 3T16A 3W2DA 4K8IA 4M77D 1Q8IA 1V43A 1DJ7B 1YJNT 5E1FA 1RODA 5D6XA 1ILPA 2LQKA 2F0LA 2H1EA 5J22A 5HK0A 1QVGA 2BUDA 3VU3C 1NPRA 3FJPA 1HTPA 2BDOA 4DOVA 5IT9L 4QQ6A 1BCPB 3EFRA 5JVH3 1FR3A 5IAYA 2PMZB 3WDNA 3BDUA 3F2UA 1VCIA 1EL0A 3OBYA 3JAME 1Q90A 3U9OA 1QB5D 2B39A 1LT6D 5GAN8 5LJ3g 1Q12A 1F2MA 1ZHIA 4M7DE 2AUJD 4PKCC 1SXTA 4LDWA 3MXUA 2B63B 3HHTB 1WTVA 3BYTB 1D2BA 1SNPA 1I4RA 3MEWA 1NAPA 2E75C 3HS0C 3Q24A 4KUIA 3T53B 2VGNA 2K04A 2KEDA 4PJOE 4N9PA 1B9NA 1UGSB 1D5MC 2RH2A 2GFUA 4LDYA 1DOKA 1PFBA 3GTQB 4XTYA 1XXGA 1S5FD 3SXHA 1BI3A 4PJOD 2KSSA 1BCPF 1KNAA 1BOSA 2C5CA 3GQBA 4KK7A 5COYA 2EJGC 1F9SA 2JVVA 3SK5A 4RCOA 1JQYD 1WJRA 4VUBA