4IUUA

Crystal structure of shh1 sawadee domain in complex with h3k9me1 peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
133
structure length
127
Chain Sequence
ADLAFEAKSARDYAWYDVSSFLTYRVLRTGELEVRVRFSGDEWVNVKTSVRERSIPVEPSECGRVNVGDLLLCFQEREQALYCDGHVLNIKRGIHDHARCNCVFLVRYELDNTEESLGLERICRRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SAWADEE HOMEODOMAIN HOMOLOG 1
publication title Polymerase IV occupancy at RNA-directed DNA methylation sites requires SHH1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
total genus 23
structure length 127
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16719 SAWADEE SAWADEE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4iuuA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iuuA01
2FJ2A 2HUGA 4CJ1B 2R5AA 3BDLA 5JJZA 2PQWA 1G91A 2NWGA 3LYIA 2BKDN 1WD0A 2R58A 4BE1A 3KUPA 1AP0A 2B2YA 3LX7A 2EPBA 5CBAE 3OS1A 2FINB 4RG2A 2FHTA 4X3TA 4N4HA 4X3KA 4Q5WA 1KNEA 3MEAA 3MEUA 2D9UA 1SSFA 3Q1JA 4PLIA 3OS0A 3F2UA 3FDTA 3NTIA 2RSNA 2RJEA 4BDYA 1C8CA 3L2QA 1E0BA 1IKLA 4C5GA 5KE3A 2L8DA 2FFKB 4BDZA 2B2UC 2CVRA 2HCCA 2K01A 3OYJA 2X4WA 5J39A 4MHEA 4BD3A 3D6WA 4XT1B 4QUCA 5EPKA 1F9SA 3MTSA 2LVMA 3OYBA 3QKJA 3R93A 2IL8A 1LV9A 2KEDA 1RTNA 3I90A 3DLMA 3DB3A 4OVAA 2LTOA 3I3CA 2B2WC 1VMPA 2RJFA 1AZPA 4X3SA 1WJRA 3OYFA 2EFIA 2R5MA 2JP1A 1MSHA 1WVLA 1NR4A 5CIUA 3ASKA 2K1BA 1OI1A 1ILQA 1F9QA 2L12A 1HFGA 1QG7A 1QE6A 2NZ1D 3L42A 3OB9A 2GF7A 4QW2A 3OMCA 1HFNA 4RA8A 1MGSA 2DAQA 2B2VA 4A4FA 2MGSA 4X3UA 1G6ZA 4II1A 4QQDA 5KCHA 2X4YA 1G5VA 3OA6A 1O80A 3DEPA 2BUDA 5FRNA 3G7LA 3P7JA 2KEEA 2DY7A 2X4XA 1DOKA 1HUNA 3NTHA 1MI2A 3ZEHA 5C6SA 4FU6A 4C5HA 4CJ0B 3HP3A 2RHXA 2XIWA 4FL6A 2G3RA 3UI2A 3LWEA 1XNIA 2O4XA 1CA6A 1IKMA 5E4WC 1HRJA 5T1IA 1PLFA 3E9GA 1QNKA 4NS5A 2B8AA 2M1HA 2B2TA 2L11A 3META 3MP6A 3I8ZA 2M16A 1OZ3A 2XK0A 2JTFA 1HUMA 3MO8A 4UAIA 3MWYW 4A4GA 1EOTA 4QQ6A 3C4SA 2EQMA 1CM9A 2K3YA 1VMCA 3OYLA 3LLRA 3DB4A 1U4LA 1U4PA 2N55A 2K03A 2IG0A 1Q3LA 3TZDA 2X6LA 4R8IA 1TVXA 3TN2A 3OYMA 3OYDA 3Q6SA 3I91A 3PMTA 4RWSC 1RHPA 5KCOA 4IUUA 2K04A 1WJSA 4OIJA 1SDFA 2BIVA 5EJWA 1BBXC 1O7ZA 2L3RA 2EE1A 2RSOA 2L1BA 4DN4M 2DY8A 1B2TA 2H1EA 4ZKBB 2MJ8A 2M2LA 4IKFA 5FROA 2B2UA 2SDFA 2LCCA 4PLLA 1NR2A 2RHIA 2YRVA 3OY9A 3QIIA 2MP1A 4Z02A 3OYCA 2MWPA 4E7IA 3KUFA 4ZK9B 4B9XA 2RJCA 2HCIA 4A4EA 1SAPA 2B2WA 3UWNA 2L89A 1G2TA 5IAYA 3PMIA 1RJTA 1PDQA 3P8HA 5CORA 3GV3A 4BE0A 2HQXA 5T1GA 3GOXA 2VXWA 3S3NA 2EQKA 5KH6A 2X35A 1OZ2A 5EPJA 5DNFA 1WTWA 5D14A 2MWOA 1RTOA 1WJQA 2L4NA 2M0OA 3OYGA 3S3MA 4C5EA 1XX8A 1WTPA 2K05A 2LDMA 4ZKCB 2RJDA 2X69A 4NW2A 3F70A 2LRQA 5CMDA 2RHUA 4IURA 1WGSA 3H8ZA 1JICA 2QQSA 2JZ2A 2KOLA 1J9OA 3IFDA 3OYEA 4ZTFA 2XDPA 1RODA 3ME9A 1B3AA 1DONA 4ZAIA 4L59A 1U4MA 4C5IA 5KE2A 1NAPA 5M9OA 4LD6A 2DIQA 1KHCA 1KNAA 5COYA 3MEWA 1F9PA 1WTXA 1XYIA 2RI5A 5D6WA 2EQUA 1DOLA 2MPMA 1BNZA 4EDUA 3GV6A 2F5KA 2GFAA 5AFWA 4PL6A 2K28A 5FRMA 1PFBA 3OYKA 5D6XA 1BF4A 4U68A 2Q8TA 3QJ6A 3H91A 1M8AA 3OMGA 4A4HA 3MP1A 4E7HA 4B9WA 3FLGA 1N27A 2E6NA 1G2SA 4IUTA 2NLUA 3L2VA 3FEOA 4E7JA 1EIGA 4BACA 2RVLA 2P0KA 2WACA 1ICWA 5E4XA 1WD1A 4OIKA 2GFUA 2J7ZA 2RI3A 4IUQA 1B4OA 3S6WA 2FMMA 3ONAB 3E9FA 2JYOA 1GUWA 4XT3B 2E5QA 3PFSA 4BE2A 3L2RA 4HCSA 4CRIA 2B2YC 4O42A 3UT1A 1X3QA 1O7YA 2NYZD 5EPLA 1OYXA 5IN1A 1WTRA 2EKOA 5EKIA 1JE4A 1S4ZA 3FPUB 4LMQD 3EAEA 3FDRA 3DM1A 4ZTJA 2KUMA 4GY5A 1F2LA 4E7KA 3N52A 2K3XA 1ESRA 2RHZA 1HHVA 4CJ2C 4IUPA 1CA5A 5CBEE 4HEDA 2FHDA 4HCZA 1EIHA 1B53A 1X3PA 1RI0A 2VYTA 2EOTA 2RA4A 1NCVA 2EQJA 2D9TA 2N88A 1HA6A 3QO2A 4MN3A 3P8DA 3SD4A 4R9WA 3OYAA 2L9HA 4XDXA 3LGFA 2RHYA 1B50A 1X32A 2KVMA 4X34A 3IL8A 5J26A 1DZ1A 4QQGA 2HQEA 3QBYA 2QQRA 4E7LA 4ZLTF 4UC4A 2KECA 1WTVA 3L2WA 2Q8RE 4N4GA 1MSGA 4HSVA 1EQTA 3L2UA 3KBXA 3DEOA 2HDLA 2RI2A 1EL0A 1PFNA 4RAUC 3LGLA 3OYIA 1WTOA 2B2VC 1MHNA 2R57A 4QUFA 1H3ZA 2DIGA 2R3ZA 3OYHA 4IUVA 3SVMA 3OS2A 1PFMA 3OQ5A 3O8VA 1A15A 1U4RA 1SSOA 1ZXTA 3H6ZA 2O4XB 3PNWC 3M9QA 1DOMA 2CKKA 3LH0A 3MEVA 5D6YA 5D65A 1ML0D 2RO0A 4N4IA 2BDNA 2X6GA 1AZQA 4HAEA 3S3OA 2HDMA 1J8IA 1F9RA 5C0MA 3CEYA 1WTQA 3NTKA 3FC3A 1BO0A 2B2TC 3MP8A 5EQ0A 1IL8A 1ILPA 3OYNA 4QVZA
chains in the Genus database with same CATH superfamily
3O5ZA 3S16B 2CP6A 3IAYA 2F0DA 2HQHA 1YHQQ 3BE3A 1QNUA 4DEYA 1GM5A 2IHFA 1LCKA 1S72T 4C8QG 1WD0A 3LYIA 2BKDN 2BOSA 1H8KA 4PMWA 4YHHL 1I50H 3M3YH 4BE1A 1J5EQ 3KF6A 1UGQB 3EFRA 3HHTB 1HJDA 2LX9A 2LQNA 2B2YA 1MMDA 3CCUA 2EPBA 4PQXA 5CBAE 5IYDG 2NUZA 3M0RA 3BU2A 3HOUB 2FINB 4RG2A 2XWJB 1OXVA 4F7UG 5E7NA 4X3TA 2I0QA 5KYYB 5ELCA 1CI3M 3G7ZA 1X56A 3NE5B 3MEUA 4KGXB 1G51A 2D9UA 1MMGA 4M75F 1K0XA 1SSFA 3PUVA 3UE0A 5LJ3g 4OMFB 4BY7G 1QZGA 3FDTA 3HKZG 1BBWA 2RSNA 3J80c 4H0LC 1VDZA 4BBSG 3ZFJA 1AD5A 1HCZA 2Y0SG 3PSIA 1Q8IA 3ER0A 2K5VA 1HZCA 1YEZA 4F04B 1B7TA 2FFKB 2HCCA 3AFPA 2BH2A 3VS4A 1GD7A 3OWFA 2NVYB 2BZXA 1VQKQ 4XQQA 1PM3A 4S3SA 5JEAJ 5J39A 4RG1A 3R8BA 1UFFA 4FW1A 3JSCA 4MHEA 2EVBA 2V1CC 3D6WA 3QG1A 1VQOT 1F9SA 1ZA1B 2A69C 1VQAA 4R0KA 4FIBA 3CCJA 4QGUA 2XD0A 3HL8A 1LV9A 2G6FX 1N36Q 4LF7Q 4XTWA 5I21A 1RTNA 5A0DA 3DLMA 4OVAA 4JI6L 2VV5A 1TWBA 2KNBB 3EG2A 3HRUA 1PTOC 4GKJL 3SR1A 5K36G 3RLFA 2ESWA 3KOJA 3OYFA 3AHUA 4FM4B 5DY9A 4HN7A 2DYBA 2R5MA 4RTUA 4DAVA 1SYBA 3OW7A 3VYGA 1D5ZC 1WCMB 1UB4A 5FLXL 4JOIC 5M3FB 2Y4YA 4GNXB 3G6EQ 1WVLA 1JWSD 1NR4A 1G6PA 2O5IC 3FMCA 3PO3H 1ILQA 1UGRB 1F9QA 3K59A 3KBGA 4QT7A 1HFGA 1SYFA 4H44C 4V2SA 4ZUIA 3G4SA 4KY6A 4R4QA 1SEBD 4A3IH 1QE6A 4XYOA 3I55T 1RIPA 4RUGA 3GTPH 2E5LQ 1T0JA 1KD1R 3W5OA 5C4ZA 1QCOA 2JS2A 5FLMH 4M78F 2JMAA 3T53B 4LFAL 1R0CB 2GF7A 2EQIA 3OMCA 1N34L 4IFDG 1HFNA 1UEAB 4DXFA 4C0ZA 5IHKA 1OO9B 2DAQA 5KYUB 2MGSA 1G6ZA 1I4K1 2QG9B 4QF4A 4II1A 2L3PA 2J0TD 2X4YA 1ZSGA 1D5MC 4J9FA 3OA6A 4PJOA 1O80A 2BUDA 1BB9A 1Z9FA 2EY2A 3M4PA 3GTQH 2DYIA 2JOYA 2F0KA 3G7LA 3P7JA 2KEEA 1VQNQ 2C9OA 1WI7A 2CSIA 4OB2B 3K7AB 3PF5A 1K8GA 3LWIA 2EWNA 4RMOA 3SK8A 2HEQA 1JB7A 3NTHA 5EC7A 1P16A 3ZEHA 1LTGD 1TKWB 4TQUS 1B7YB 2CT4A 5IHNA 5C6SA 1Q86U 2DXBA 1SNMA 1TWFB 2EYOA 1HNZL 4CJ0B 3VKIA 4RHRA 2XIWA 2G3RA 1D0YA 3EH2A 5AJ3L 2A74C 5GAOm 5FLXc 5DLOA 4F88A 4BA2I 2ZT9C 4BY1B 5A35A 4ZNXA 3G71Q 5E4WC 1HRJA 3NPPA 4C92F 2KR3A 2YLCA 3LGJA 2M1HA 2L11A 3TRZA 1FJGL 3META 3G6ET 1PZJD 4A3KH 3EGXA 2AUKA 1OX8A 3RN2A 2JMCA 5IGDA 4ELYC 3J7AV 5JJIA 3PO3G 1EIFA 2HSEB 4DR7L 4JZ4A 1N9RA 1PFSA 4MZPA 3EG3A 1I4HA 3B6YA 1G291 4OX9L 4A3IG 4LF9L 1HTPA 2DBKA 4KKUA 2AQ1B 1JOQA 1Z9ZA 2WIIB 3ITPA 3RBBB 1ESFA 3KDFB 1LT3D 5FLMG 1SKUB 4DV0Q 2DJFC 5GAN5 4MMLA 2HKNA 2KT1A 4M75C 2XI9A 5GANf 3OW2A 2PMZB 4ORZA 2YV5A 2F2WA 2Q2UA 2IG0A 2F0HA 3P1HA 2X4JA 3J7YW 4R8IA 1TQOA 5J1ZA 1QVPA 3U58A 3RDVA 3I4LA 3I91A 3PMTA 5GAOn 1K28A 5KCOA 3THKA 4IUUA 1D1IA 4CDDC 4LNPA 5KYYA 3BVZA 1Y8PB 3GTMH 4A3LH 4KJOA 3AYHB 1TS9A 2DTOA 1U5KA 2ALYB 2K4KA 2E6ZA 1A0IA 1PKTA 2L3RA 4J8QA 3NHHA 2L1BA 3OTOQ 4JI4L 4LN2A 3AMUA 3CPWP 2M2LA 2B2UA 1BCPD 3A54A 2F0NA 3QUIA 1Y1WB 4XU0A 1YJWQ 1E6GA 1ZEQX 3M4OB 3G71T 2PZWA 3H3VC 3CCLQ 3PCOB 4BA1I 1TU0B 3TQ7P 5ELNA 5IE8A 4DV2L 3OY9A 3S2HH 4LAAA 1TTHB 4Y91A 4Y7NB 1R4QB 3PUZA 1EFID 1TT2A 4DR2L 1OOTA 3T1HL 4B9XA 1JWUD 1XPUA 4M77D 4YY3L 3GPLA 1NG2A 2DJZA 3VRYA 4TRDA 1S5ED 1RLQC 4OMLA 1TU2B 1LTLA 3S1RB 1S1NA 1SNOA 1VQ7T 2E2HB 1UE5A 4X62L 2MIOA 3CCSA 5CV8A 2IWHA 3F2CA 3HFOA 3I70A 3VDYA 4CHTB 1YCYA 5CORA 1HR0L 1AEXA 4DR3L 3M0PA 1RLPC 2ZXPA 1WYDA 5HCKA 2QA4T 2FL7A 1CHPD 1IBML 2VGNA 4AFZC 3VR5A 2MWOA 1VQ6A 3JCMe 4G4KA 2KVQG 1JJGA 2JTMA 3C46A 2BA1A 4XQ3A 1YNZA 1WJQA 4M78C 4BI8B 2N78A 4GNXA 1V29B 4BI3A 1MGQA 2OI3A 3E2UA 3GF5A 4OMMA 3CCUQ 2E64A 2KI7A 4K5VA 1TWGH 1X2QA 2XRQD 1BCPB 5EKKA 1VQCA 4C5EA 1XX8A 2B29A 4FDBA 2RK1A 4KH1B 1WTPA 2WSFE 4X64Q 3SHLA 1ZBJA 1ZSZC 4JRPA 4A3LG 4KLKA 2IPKD 4HCCA 2WSCE 3HSBA 1BCOA 4ILWA 4HA8A 3J80E 1LTTD 2KCNA 3RNUA 1EEID 3W1GA 2JJQA 2KE9A 3UDIA 3SEMA 1JXMA 2DVJA 4MTNA 1PH8A 4M77B 2QQSA 1KDCA 3K5NA 3A1PA 3TEHB 2DVEA 1DCZA 1EY9A 1GVPA 1YJWT 1NZ9A 1LVKA 5KYUA 1Q46A 3CC4T 1RF2D 4QB4A 3VR3A 3CCLT 2JQOA 4M75G 2Z6KA 1I94Q 3NPFA 4MZMA 4L59A 1EY0A 3FVQA 4ODGA 1B8AA 1EU3A 2AK5A 3J81L 5GAGC 2E2DC 1QKXA 2O88A 2B63B 1TS4A 1U1SA 4LD6A 2DIQA 4C92C 1TG0A 4AIMA 2JA8B 4ANJA 1TUCA 1K83H 2QEJC 5D6WA 2EQUA 3CCRT 3CCJQ 4DBFA 2XKOC 4DR4L 2MPMA 4PFOA 2KROA 5IP9H 1BNZA 4H7BA 1A8VA 5I11A 1Q8KA 4JRQA 3P8BB 4M7DF 1X3EA 4DBQA 3Q23A 1M8VA 1J3TA 4KULA 1BF4A 4U68A 2RQRA 4JRIA 4JCVE 2NYSA 2Z1CA 1HNXL 4OB1B 3GP8A 2CWAA 4EGVA 1Q82U 4PJOE 1V43A 2G5DA 1PMRA 1NNXA 2EY5A 4IUTA 2EGAA 2Z6BA 2NLUA 3GTOB 2CZ7B 2JM8A 2EJFA 2KBTA 2KK4A 1WHJA 3L2VA 1EIGA 4J6XA 2DEUA 3G4SQ 3R2IA 4GN4B 1ET6A 4M8AA 4E6IA 4X9DA 2WACA 4NL2A 2EJ9A 3GP7A 3BW1A 3K80C 4HR7B 2GGRA 2K2VA 2J7ZA 1D3BB 5C6AA 1YHBA 4E47A 1STYA 1IGQA 4C0GA 1GUWA 4AYBB 5GMKi 3CCMT 2H3EB 1N8RR 2RN8A 1A3UA 3KDFA 3RZOH 1Y8NB 2K4YA 1QJOA 1TS5A 3J81c 5CGKA 4J9BA 4FP5D 1M90U 2M9UA 2Z0WA 2E12A 1S72A 3UT1A 1PH6A 4OGQC 4M78G 3M0QA 3MCAB 3J81i 1KG1A 1OYXA 2D5DA 4P72A 2O9VA 3S9WA 1EUJA 2ZM6Q 4OP0A 3CBPA 4BS9A 1PRMC 2JN0A 3CCJT 3A0JA 3I7FA 3V8KA 1Y14B 1AE2A 5IP9G 3GQBA 3HOWB 4ZTJA 2KUMA 3SK6A 3S17B 1HQMC 1SE4A 2BTTA 2CZ1B 2QEXT 2PI2A 3S2DH 1M1FA 1H3HA 1D8LA 4LXCA 4NKLA 2A0FB 1SN8A 2RHZA 1I07A 5KRUA 3HOXB 1HHVA 3QOLA 4CJ2C 1N36L 2XIDA 4LF7L 4MTKA 2F0FA 5HY6A 5JOBA 2VS1A 2RCNA 3K57A 4V190 3JCMJ 3HOYH 1FNUA 2BZ8A 1F2ZA 4GLXA 4ABNA 3HOZH 3KLRA 2ZPFB 1MJEA 3JC66 3G4ST 4C92G 1C0AA 2QK0A 4LUVA 4CKEA 2JA7B 4A53A 1EY4A 2VYTA 2NB0A 3H41A 1K9MR 1VQOA 5LHY1 5GAMf 1JB0E 5LJ5f 1NCVA 5IHIA 2RA4A 2LP5A 2ZCFB 4B08A 3QO2A 4JS5A 1BQQT 4MN3A 1X2KA 1AVZC 1MMNA 2JVVA 3J80i 3QZ9B 1EY6A 5ISRA 3A8HB 1C0MA 1GL5A 4XTYA 3LGFA 3DWPA 2RHYA 4DR1L 1B50A 2KVMA 3G48A 5A0GA 4OMQA 5C4XH 1DZ1A 1YZ6A 3CD6T 1BUVT 3QBYA 2NZHA 1HD3A 1U3OA 2B86A 4WJ3M 3K6OA 1AOJA 4L6TB 4A3MB 3NEMA 4J6HA 4A3CH 4ESRA 3PTAA 4G7HC 4XYQA 2CYZB 3CQZH 1K0RA 2PUOB 1Z7TA 4ZN1A 4DV4Q 3S1MH 4MZTA 4KT0E 1V8QA 2RI2A 3I55A 4PJMA 3D7SB 3I9QA 3HOVB 4A3KB 4FNFA 3LGLA 3OYIA 2F52A 1W1FA 4M77A 1U5SA 1KL9A 4QL5A 4A75A 1Q86R 1M8MA 4KV6A 4J6YA 2DIGA 5FU7B 3VS2A 2ZPHB 1K4US 1RKNA 2EJGA 4M7DC 3QOJA 4GZYC 5GANg 2XG8D 3O8VA 2YUQA 1A15A 2OF1A 2SNSA 4A3DB 1U4RA 4J7IA 2EY1A 3K5LA 2DETA 2Z9HA 1BCPF 2WB1G 3JCMc 4UP7A 1I4GA 1HNZQ 2YUNA 3UE1A 1KAWA 2WFWA 3PNWC 3M9QA 2PNRC 3KK7A 2ATCB 4LFBQ 2HNIA 3SWNA 4EIKA 2O9SA 1DOMA 4J9IA 2F3VA 3HOZG 1Y1VB 2OX7A 4C3HH 3CCSQ 1EWIA 1ML0D 3PUYA 5ELDA 1NMGA 2BDNA 2F2VA 1NY4A 3HOUG 1ZUYA 2ZZDA 2HDMA 4QIWB 4J9DA 1B44D 1L2FA 1UHFA 3REAB 3CEYA 3RKWA 2VB2X 2HD3A 5C3EB 1VQ6Q 2DILA 4J9CA 3NTKA 1A3TA 3RMSA 4PZ8A 5JPMC 4UY8C 4A3BH 1M9SA 3DWAA 4JZ3A 3MP8A 2B2TC 3MC0B 5EQ0A 2L5QA 2ZJQA 3HP9A 5EBCA 1E22A 2A8VA 5C4XG 3QB3A 1WZOA 1M27C 2FJ2A 2HUGA 2K52A 1JJ2P 1U0LA 4BBRB 1FNVA 4CJ1B 4A3GB 2CGHA 3BDLA 4RTWA 4FXKC 5JJZA 2RNAA 2PQWA 1M5Q1 2E76C 1G91A 1QQJA 5GJVB 1K73R 3CRLC 4JI7Q 1O75A 1D3BA 2NWGA 1A62A 2QGQA 3L3OC 1HR0W 1C9OA 4F16A 4ZGJB 5A2QE 1AP0A 4A54A 5I4DA 1VUBA 1GCQC 2CCZA 3JCMV 5KEEA 1WHLA 4XU2A 3I56T 3I4MH 2JW4A 2FHTA 4RKLA 4KN4C 2F3WA 2P84A 4N4HA 4RCCA 2A5HA 4HVWA 2OQKA 4K5WA 2O31A 2D0NA 1KNEA 4POGA 1AN8A 1L1OC 1JQYD 2VUMB 2UUAQ 1WX6A 1A2TA 3Q1JA 5L23A 4OB0B 2K32A 3F2UA 2YTVA 2ZTEA 2K6AA 2CZ6B 5LMNW 4C0DB 4IIMA 3M0TA 4RTZA 1GO3E 2NN6G 3WXMB 4JI4Q 1N32L 1C1AA 4BDYA 2F1MA 2YDLA 4LFAQ 1IKLA 3M7GA 1H9KA 4ME3A 3CCST 2COYA 2VB6A 4POFA 2D8HA 4AFSC 4B3SQ 2WINB 2CVRA 1SFOB 1K76A 2XICA 3EIVA 3OYYA 3UA6A 3I4NG 4QVCA 1TWGB 4PJOD 4DV2Q 1X55A 2R7ZG 4DR5Q 5M3MH 2KAFA 1YNND 2PMZE 1SPKA 2F2XA 2JT4A 2R93H 1T3LA 2MO0A 3VJPA 4KTAA 5J3BA 1NJIU 1X65A 1KRTA 3T1HQ 3MXUA 2CKZB 3RKYA 2NVTH 3PGGA 4YY3Q 3MTSA 3FJ5A 3OYBA 2A68D 3R93A 4A3BG 2IL8A 4C3JH 4M7DG 2G9HD 5C44B 5GAMh 2IT1A 1ZLMA 3I90A 2LTOA 3I3CA 1R4PB 4N0AA 2HZYA 4MIUA 2JA5G 1WJRA 2R92H 3FRPB 2ZGWA 1D1CA 4DR3Q 2EAYA 1R9TH 3VS5A 2FXQA 2MK5A 2QAZA 1IBMQ 2JP1A 1VQ7A 2MMPA 3URGA 2PI2E 3FJPA 2XVSA 4R4TA 5CIUA 1X3GA 5D7UA 3NENA 3TU4K 1RADB 3VR2A 5KYIA 2CW0D 3AFQA 2IW3A 3J81E 1UTIA 3EBEA 5F2DA 1FXXA 4FYYB 1OPLA 2RQTA 3LWHA 2K5QA 1Q7YC 3D4WA 3QIAA 1QG7A 4WF2A 1K83B 3RZDB 4J83A 2QA4A 1HJPA 3PUWA 2QI2A 2PW5A 4YCVA 4GOPC 1S72Q 1SRLA 2LT4A 3D4RA 3EA6A 5LMNQ 4PKCC 2JNGA 5IXFA 4JBMA 2DNUA 1WXBA 2DGYA 2LNHB 2RQWA 1O78A 2AKLA 1SNPA 2LC4A 4PJJA 5JVG3 2EYQA 1QP3A 3OB9A 4PJOB 1OXUA 1M3AA 2VY3A 4LUEA 4XQJA 4DKAC 1VQLT 1TS3A 2SOBA 3OSVA 3EG9B 1VQPT 1MGSA 2EYHA 4LK1C 4RA8A 1I94L 4ALPA 1M3CA 2FB7A 3NFCA 2HBWA 5KCHA 1BCPC 2L55A 3I2ZA 5C3XA 5CQYA 1Q82C 1M1KU 1L0XB 1B34B 3UF4A 2Q2IA 3DEPA 3E9HA 4LW1A 2E3IA 4EQPA 2F0SA 3JAML 3R3OA 2X4XA 3MKDA 4KKTA 1G8XA 1UGPB 2BZYA 1QVFP 1AEYA 5M3MG 4BBSH 1B9MA 2I07B 3V7RA 2R93G 4HIDA 1GCPA 2JA9A 2YLBA 2K3BA 3CC4A 1TXQA 4KRTA 2P0PA 4C5HA 4HIOA 2P0QA 2RHXA 3UDFA 4FL6A 2LJ3A 1QVFA 2DN8A 1JXOA 2LY7A 4C3JG 1HNWQ 3NWSA 2LXJA 2X3WD 4PMCA 2K7AA 2L0AA 3DKMA 1IHWA 3A5UA 1IKMA 3BY7A 3A8LB 2CP2A 2V8KA 2R92G 1PLFA 3D8GA 1VQOQ 2KQWA 2HBPA 3QWXX 4PFPA 1GFDA 1QNKA 2AT1B 5M5YH 3CMET 3CCRA 2CHBD 4RTXA 1HNXQ 4M77E 4EMGA 4GN3B 3KFUA 1K8AR 2XK0A 4RTVA 1AWJA 2CP0A 1HUMA 5BN5A 3NQIA 5EAYA 1PYSB 4BY6B 4JI5Q 3ICEA 1BIBA 1CK1A 1KSWA 4UAIA 4QVDA 3KYHC 3PIO3 1FWZA 2DTHA 1MNEA 3MWYW 2ZJPA 1EZZB 1EOTA 3OBWA 1HQRD 4KMUC 2LFNA 4FYDA 2VQFQ 4KKSA 1M90R 2DD4A 1M2VB 3X25B 4WTOB 3JCMW 3Q22A 5GAN3 5DM63 1L0YB 2HD0A 1VS0A 4IJHA 5C4JH 2E70A 2F0VA 3E1SA 3CPWS 1G83A 4IALA 2KRSA 2F0TA 2N55A 3JAMc 3I55Q 1Q3LA 3TZDA 1PYWD 2J05A 3TN2A 2V8JA 4AG1C 5LJ5g 5GAMg 4EQNA 2ZM6L 1N33Q 3Q6SA 3HOYB 5CAIA 4X9CA 1D1KA 4GLMA 1MKHA 4IFDH 1BI2A 4M7AB 1RHPA 3X20B 2NWMA 3CCMA 4OIJA 4D8DA 2BIVA 5EJWA 1RAIB 2KDSA 3BFMA 1NTGA 1EYAA 2XGTA 3VYTA 2MUYA 5BN3A 1BBXC 2L15A 4KI0A 2DTIA 4L6V5 2D0PA 2ICEC 2RDHA 3HGBA 5GMKh 2ED0A 4RTTA 2DJQA 3KLSA 3STBD 4DV5Q 1X9NA 4K0KQ 4D8KA 4GLKA 2DZ9A 2MJ8A 4IKFA 1H92A 1STHA 3RNJA 4LDVA 5FO7B 4C1NK 1T9HA 4U673 2IPOB 1KRSA 2FPEA 4PLLA 4MZ9A 1NR2A 2RHIA 3GDEA 3FKIB 2MP1A 4AYBE 1XNQQ 1A63A 4E7IA 3RESA 4MNOA 3HZXA 2CZ0B 3ULLA 3OWEB 3V7CA 4L5TA 2RJCA 2CQAA 1JJCB 4WRDA 1SAPA 2DA9A 2B2WA 4GS3A 4NPSA 5KYNA 3UWNA 2XNAC 3FHWA 2QEXA 1SEMA 4JRKA 5GANe 1B70B 2DZCA 1PD0A 2ABLA 2A6ED 2ENBA 3HEJA 4RKBA 2UXDQ 2RD1A 1UE7A 1NBEB 2DUDA 3T51B 2L5TA 2CDTA 3AEVA 3GV3A 2EW3A 1BKBA 3JCMQ 3M53A 4KHPL 2WV6D 3R6OA 1WFQA 2EQKA 3E3XA 3TCJA 2X35A 1MIUA 1OU9A 4DNTB 1WTWA 5AYFA 1EEFD 4OGCA 1VF7A 1RTOA 1QVCA 2DJGC 2P5ZX 2DPPB 2TMPA 3VS3A 1D0XA 1QLYA 3QDRB 2EQSA 5GAN6 2PO4A 4DR1Q 2M0OA 2EYZA 2VWFA 3JB9D 4HIMA 3OYGA 2PQEA 4O0AA 3H9NA 3OPOA 2R6GA 1W4SA 2KT8A 1II3A 1PTOH 4X1VA 2HIXA 3NBHB 3T13A 3TMEA 3EROA 2X69A 2XTIA 2MPXC 1LT6D 5FWBA 4NW2A 5GAN4 4DV4L 1PH2A 3I5RA 4EMKC 2Q2TA 3GTKH 3F70A 2LRQA 4Y28E 5HK0A 4A3FH 2RHUA 4A3EH 1YNXA 4EMHA 1I4PA 3CD6A 1WGSA 1PH5A 1KQ2A 1H9SB 3J81j 2A08A 2DE0X 3GTLH 4OWWB 2F4VQ 3EG9A 2NBFA 1PD1A 3X24B 2E2JH 1J9OA 5GQOA 4DFAA 1OQKA 1Y96A 3VUZA 5GAHC 4HJ5A 3OYEA 3H0GB 4DA4A 4JBJA 3RLNA 4JUVA 5FOBB 3ME9A 2C0OA 2BE7D 4JDSA 2MO1A 4A3JG 2VQEL 2W10A 1B34A 3JB9I 5KE2A 4C2MB 4GLVB 1NYFA 1FD7D 2UUCQ 4LWCA 4LFBL 5M9OA 2F0MA 2DD5A 2RCFA 1KNAA 1BDOA 4ZGDB 1UECA 1F9PA 1WTXA 5IT9L 1EFNA 1DOLA 4N9PA 3W1BA 3QZ5B 2JA6H 5IODA 1LT5D 2NUPB 5AFWA 2WSEE 3RN5A 3H0FA 2HQLA 1OEBA 4OL7A 3M56A 4PJOF 3I4MB 1SF9A 1AWWA 1M2OA 5D6XA 4G7ZC 2UXCL 4YWLA 2Q8TA 4A93H 4C3IH 2RMOA 4UHVA 1TR5A 1M8AA 5I2SA 3OMGA 4JBWA 1Q12A 4J7FA 1VQ7Q 1SNQA 1FMVA 1LOJA 4B9WA 4RHSA 4DV6Q 2E41A 4R1JA 1QZHA 2N8NA 2E2IB 3C1FA 5GMKm 4IJLA 1G2SA 3MHXA 4XQNA 4DOWA 5HURA 4HKEA 4LDWA 1KC8C 3FEOA 2NVQH 4DBRA 2E5KA 4JI7L 4R4IA 2QA4Q 3J7AF 1IXRA 1ICWA 1FYNA 4NOYA 1GXIE 2GFUA 1D1AA 3JV3A 2RI3A 1JBMA 2XMFA 1CQVA 2E75C 3CF5A 3S6WA 1BI0A 4JJBA 1SROA 4JI1Q 4LDXA 2JYOA 2KHJA 1K9AA 1XNRL 4XK8E 2KY9A 5CCAA 4A3FG 1JCKB 1KAAA 4FVMA 5IY0A 1KLGD 1KK7A 2CWPA 4A3EG 3GTGH 2J6OA 4O5VA 1M2VA 3TSZA 4FO2A 2UUAL 4R8NA 4BE2A 4OGEA 2RQXA 2PYKA 1FYCA 4OO1H 1VYVA 3RMHA 1NJIC 1CUKA 4QIWE 2Z4IA 2B2YC 4HCSA 4O42A 4DXGA 1SYDA 2BE5D 5IT9c 1O7YA 2MCNA 1ZYRD 2NYZD 3K7UC 5EPLA 3M55A 1DJRD 1Q81U 2A6HD 4LF4Q 2RHSB 1WTRA 3C94A 3EFOA 1V1OA 2CREA 4M7AA 1K0SA 3I56A 1ENFA 3EQLC 4NDXA 2KGTA 2QGGA 3NELA 2JA7G 1E3PA 1PV4A 3UDGA 1JU5C 3CC4Q 2ZAEA 4JW0A 4J9EA 4B3SL 3FDRA 4JK1C 4ID6A 1N32Q 1NE3A 3JB9J 2JA6G 1XMQQ 3CPWA 5A2QL 1EFWA 2ZPGB 4DR5L 2J6KA 4IQZA 3VU3C 1FGUA 2MQHA 2B3GA 3MEHA 5CYUA 1F2LA 1UUEA 2K5FA 3RLOA 4E7KA 1JC7A 1T3SA 3SK5A 1GUNA 1ESRA 2I46A 1PRLC 2VVKA 4A93G 1MMAA 1XWEA 4C3IG 1I6HB 3CCRQ 4C8QB 2F0WA 2JJ9A 3K8AA 3VS6A 2JN4A 4KD3A 1S5CD 4C0DC 5CBEE 1ZX6A 2A1AA 6AT1B 3S1QB 9ATCB 1QCBD 3D0FA 1VQMA 3CW2C 2FHDA 2IIMA 1V1PA 1CZWA 1CT1D 4XTCS 4F7UB 4LE9A 1YJ9T 1B53A 1NLPC 3T1YQ 1V1QA 4RH6A 2HAXA 2ENMA 3HKSA 5IYCH 3GTJB 3H3VH 1R77A 2EOTA 3PF4A 2ECZA 1VIEA 4Y52H 3CXCP 2D9TA 2DLPA 3H0IA 3T16A 1RDPD 1I0CA 4CGYB 5GAN2 3HOVG 4BY7B 5HGTA 3HKZB 3QXEB 3BDCA 4J6WA 1M1KC 4TKOB 4R9WA 2H3JA 1QKWA 2XDDA 1HA5A 3JAME 1UHCA 1VQDA 1U9RA 5KNDA 4X34A 3R6NA 4EQOA 5LMNL 2YT6A 5J26A 4QQGA 2JUFA 2B8GA 2D0QB 1CSPA 4L5RC 4OO1G 4NXNL 4E7LA 1IGUA 2EYPA 2RQUA 5FW9A 3N5BB 4NL3A 1I5FA 4UC4A 4RTYA 3CCMQ 3NBHA 3OIQA 4L63B 1WHMA 2Q8RE 3QYGB 1M1KR 2C5CA 3PQIA 5IWAQ 4ULLA 1EQTA 3M54A 5LJ3j 3FEWX 4IN3A 2QASA 3KBXA 1SG5A 1BVSA 1NE8A 2PVGB 2NVXB 4OXPA 4LDYA 1H9SA 2EKHA 1LYLA 2X9HA 3M9BA 3A7LA 4RAUC 2QQBA 1TWCH 3TQYA 4P2CB 1E7OA 1XPRA 1Q7YU 1MHNA 1WHGA 3Q8DA 1VQLA 3LH5A 1VQPA 4IO9A 3SWNB 5LJ5e 5LJ3e 1JRIA 4PJOC 4YCUA 1HNWL 2GN5A 2V26A 4KY5A 4RGMA 1YNNC 3A8IE 4BBRG 1KQ1A 1PC0A 1I50B 4A3GG 3M3YB 3V2TA 2O4XB 2QEXQ 4X66L 2GTJA 3PIOA 4IFDI 1E1TA 4RG8A 2XDBA 2L3SA 1P8LA 2A68C 4FXGC 2CKKA 3LH0A 4ZYSA 2NTTA 3M5AA 4M4ZA 1SMYD 2JK8A 1EOVA 2SNMA 5IYCG 3PVLA 2I5HA 1JJ2S 2NUPA 4XTVA 3S3OA 2ED1A 4HXJA 4ZGEB 3GD7A 1QWYA 1EYDA 1F9RA 4DV7L 3M4YA 4J5YA 4A4KA 4JI2Q 1CKAA 1SNDA 2AZSA 4HVUA 4JI5L 4P74A 5AT1B 1JMCA 4N8FA 2VUMG 4H02A 1ASZA 4K5XA 4CC2A 2DRKA 2GVBA 3LNNA 2HMAA 3PE0A 1I4XA 2VQFL 1MBYA 3CMEA 3OYNA 2ICIA 4QVZA 4G7OC 2A7YA 4Z89A 2R5AA 1IRXA 4APVA 4YCWA 2XWBB 1T5EA 4PV1C 4HVVA 7AT1B 1H95A 4GBQA 1KLUD 4OMPA 4K2LA 3VR6A 2OTLT 2R58A 3SB2A 3CD6Q 3JB9F 1N33L 2CUBA 3KUPA 1PH9A 3OS1A 1G2BA 1RUWA 1TSFA 4FCYA 1ZKOA 1YNJC 2R61A 2M51A 1VQ9A 3MEAA 1D1BA 1WHKA 1LM0A 5I9OA 1FMKA 4DV5L 4K0KL 3C3LA 3MXNB 2V4DA 2HSPA 1SNCA 1KTKA 3VYRA 3WWVA 3S14H 2DRMA 4JLIA 5M5WH 5C0XG 3NTIA 3JCMd 1TWAH 4F14A 3PO2G 3PO3B 2CP3A 1PH4A 4PNYA 1XNQL 2DL7A 2XRSD 4TVRA 4C5GA 3RUZA 1HSQA 5KE3A 1QB5D 2FZGB 1I81A 4A3IB 1PVOA 3K81C 2YHTA 2UXBL 4BDZA 2RQVA 3CC2Q 2B2UC 2K14A 3GTPB 5TSSA 4DNIA 4IFDJ 2X4WA 2UXDL 1ABOA 1YP5A 4FF3A 2L0CA 3E6ZX 4QUCA 5KYXB 2E4HA 5EPKA 4LF5Q 1SJHD 1Y69U 3JAMi 3GTKB 4HCBA 5BN4A 1EZ6A 4C8QA 2QQAA 1IYJB 1TY2A 1WHHA 3QKJA 2KEDA 3GNGA 2M00A 3HOUH 4PJOG 2BA0A 4JI3Q 1CKBA 3DB3A 5GAOl 4M7AE 3KXTA 2PPBC 2OCEA 2JE6I 3RR5A 4ZN3A 1N9SA 5CK9A 1VMPA 3GTQB 3TS2A 3VS1A 1ZA2B 3JCMX 1VQGA 4X3SA 4F7UA 2OTJT 1G3WA 1K1ZA 4AMCA 4ATOA 4P75A 1YHAA 2AMCB 4KHPQ 3WVDB 1IBLL 3VUBA 1RABB 4XTUA 4C56C 2Z4HA 4LF8L 1GHKA 1O9SA 1AW7A 4CKBA 1I8FA 2LQKA 3ASKA 2K1BA 1IW7D 5LJ3d 1PA6A 4IIOA 3BZDB 2UUBL 4F8MA 2KBNA 3TP8A 3MPUB 3V7SA 1IYUA 1NBWA 4WCIA 3NUCA 4GNXC 5IT9E 1XXGA 5FU6B 3M0SA 1EQRA 2NVYH 2EGCA 1QVFS 2F4VL 4K8JA 1GUTA 4B3ML 3BVMA 2AWNA 3I56Q 3P75A 1L0WA 3LWUA 1VQFA 1H9RA 5JEAG 3STBC 2O01E 1YIJA 1GOZA 2B2VA 4A4FA 2G9DA 2QCPX 3D6CA 3A74A 4J1MA 1SE8A 1MJCA 2LKVA 4DR6Q 1K8OA 4QJFA 2V1QA 1I6VC 4JYAQ 2UUCL 4FF2A 2Z0SA 1V9PA 3S15H 1GUOA 3CC2T 4FSXA 4CDCC 4GLAC 4FXDA 1JORA 3UATA 1H9MA 1BXTA 1KD1U 1DXMA 3I73A 3CPFA 4NP5A 2NN6H 2DY7A 2LCLA 1UGVA 3OSSC 1DOKA 5C5LA 2VQEQ 1T5XD 4IPCA 3PIP3 3MAQA 2K50A 2Z6KC 1WCMH 1HUNA 2M9VA 1Z6HA 5M3FH 4NXML 2F0OA 2Y4XA 1N6AA 4FU6A 1VQMQ 2YYZA 3IRBA 4I7ZC 3HP3A 1YFNA 2IVWA 3NK9A 3UI2A 3I4NH 1E24A 1B3QA 1BOSA 3I4OA 2R7ZH 2A6EC 3GTGB 2K9GA 3DM3A 1WQWA 2O4XA 3CKIB 3MEFA 4M77F 3W2DA 3WOEA 3JRZA 4DV6L 3BS1A 5T1IA 1QVGP 3GTMB 3E9GA 2B8AA 2UXCQ 1EWHA 1SE3A 3OBYA 3TS0A 3HRSA 1SMXA 4OF1A 3TVTA 4N8X1 2EIFA 1GBRA 4JVZA 1OZ3A 2M16A 2COZA 2I5MX 4Y92A 4AQYQ 2JA5H 2VW9A 2LSSA 1QP2A 2JTFA 1Q81C 5M5XH 2XSCA 1IREB 1S40A 1K3BC 4JI1L 4M75B 1AZGB 4QQ6A 2OQ0A 3C4SA 5ELFA 3S2HB 2EQMA 1JJ2A 4PK4A 2EJFC 5CKDA 2FZKB 1F2MA 3U4VA 4IOCA 4OELB 5GAOp 3K7AH 2LMJA 4XTXA 4EX5A 1XNRQ 2K3YA 5CKEA 4J15A 1VCIA 3DB4A 3PT9A 1TWFH 1W6KA 1E2VA 1PHJA 2J4XA 2JSOA 3H3VI 4R4OA 1CKMA 2V8IA 5IGBA 1IYVA 2X6LA 1TVXA 3OYMA 3BVGA 4LF4L 1N9WA 4BY1H 1KC8U 2DX1A 1HXDA 4DN4M 4ME5A 4HJAA 1SXTA 5CQXA 1VQLQ 1WJSA 2K04A 5IGFA 1VQPQ 5IXBA 1SDFA 1BIAA 1XMQL 3PGZA 4PMBA 1IXDA 5ECAA 5J22A 1D09B 1WCMG 3MXNA 3JCMh 5M3FG 1VQ8Q 2EE1A 1I3QH 3A98A 4XAXB 1HZ9A 2NZOA 2RSOA 2VB3X 1VQMT 3EN2A 5EBDA 4YTLA 1STAA 1TY0A 4DK3C 5CC4A 5FROA 2KHIA 3PV0A 3VYHB 1W3SA 2LCCA 1OXXK 8AT1B 2D0OA 3E5SA 1T0HA 2YRVA 2AWOA 4UPAA 2VGMA 2AHJB 1SBBB 2MWPA 4HMJA 1EY5A 3KUFA 1VQ5A 4ZK9B 1MNDA 4CKCA 4QCLA 2RF4A 4A4IA 1GJXA 3T1YL 4LUZA 1W70A 3ZBDA 1NYGA 1KIKA 2L89A 3CCQT 4ZUJA 2EYJA 5KYXA 2FO0A 2C06A 4LFCL 5IAYA 4DEXA 3PMIA 2F1LA 1NSNS 1AZEA 1RJTA 3X3MA 3Q0AA 4JI0Q 2CFMA 3CMEQ 3VA5A 1RD9D 1FNWA 1YJNT 4M78B 4JOIA 3RMQA 4BE0A 4EQ5A 2HQXA 1RACB 1IL2A 3S3NA 2I2LA 1EQQA 1OZ2A 5EPJA 2UU9L 2I0NA 5DNFA 1OPKA 2J6FA 3BDOA 3H09A 5D14A 1M3BA 5ELEA 3QO3A 1YJ9A 3TP7A 1IZ6A 1LTID 2QTXA 4DNRB 1X54A 5E3FA 2HIVA 1YI2A 3E0JA 3NXWA 3HPWA 3K5OA 2H8HA 5IWAL 3M4OH 1X75C 4BY1G 1SYCA 3WDNA 2LDMA 4C8QE 1VQ9Q 1EYCA 4XXEA 4ZKCB 3CHBD 2BE9B 5JVH3 1YITA 2E3HA 4EPCA 1PKSA 4JG2A 2CP7A 5FO9B 3KLSX 4Y7NH 1Y96B 3E9IA 3GO5A 1GRIA 1NPRA 2P4RA 1PNJA 4B3RL 2QGFB 1VQ8T 2VASA 3CCVT 1Q7YR 4XU1A 2DNCA 4F7UE 1WLPB 4LD9K 3TEEA 3VA7A 1HPCA 1XTCD 2YUOA 2BCOA 1JICA 2ZXRA 3S1RH 4Q0FA 1UUPA 3K0XA 2AZVA 2JZ2A 2KOLA 4C92B 2OEOA 2YWWA 4HJ8A 3IFDA 4ZTFA 3C12A 1RODA 4HTHA 3HKZE 1B3AA 1DONA 1IB8A 3CQTA 1OX9A 4QMGA 2L2PA 4C5IA 4M77C 1WDXA 3L0OA 2Y0SE 1RCVD 4YIJA 3AU7A 3TREA 5COYA 1Q82R 3U4ZA 5BR8L 3RZOB 1X3FA 4M7AD 2EJGC 2QF7A 1KHIA 2RI5A 5IIFA 5LMUL 3A8MB 1LT4D 1OU8A 4X66Q 2W0ZA 3WVEB 1XTDA 4FYWB 4JPBW 4PL6A 4JI2L 2K28A 3PVQA 1I5LA 5FRMA 2IY5B 2YUPA 1EY8A 1VQ4A 1MV0B 1SYGA 4OWTB 3ULPA 5KGUA 3SWNC 4KUIA 2KXDA 2Z8LA 3RD4A 1FMWA 2D2CC 3EG0A 3FRNA 3QJ6A 5EG2A 1VYTA 3H91A 4DV7Q 4A4HA 1N5ZA 3MP1A 1K3RA 4E7HA 1KFZA 4N9TA 4KHVA 3X28B 1N27A 3REBB 4D6WA 2IX3A 5LL6S 2RPNA 3HTRA 2D1XA 1WOCA 3W3AA 1Y1WG 2RVLA 4BACA 1E7ZA 4CC4B 3S2DB 2P0KA 5DM7R 1VQ9T 2EZVA 1JQQA 4JV5L 1IBKL 4M75A 4IUQA 1B4OA 3J7A5 3A8JE 2QDBA 2AQ2B 2FMMA 3ONAB 2RHQB 2B63H 2KCMA 1P92A 2WB1B 1ZUUA 4DUZQ 1GXDC 2JA8H 2KJXA 4PG3A 1YIJQ 2JXMB 3EFOB 2KHSA 1X69A 2VNUD 3HOZB 3CBOA 2XU8A 4DV3Q 3QPHA 5D3DA 1QILA 4OMNA 4CRIA 2L3QA 4K14A 2ASBA 2OTLA 5IN1A 2LZ6B 1CZGA 3MXGA 1CTMA 4LDUA 2JXBA 1N8RU 3FPUB 3NWTA 4LMQD 2AHOB 5GANj 2IJ0A 1STEA 3DM1A 3KF8A 4A3JH 3O13A 3GTOH 3I72A 5C4XB 2AQ3B 5E1FA 4IPGA 4GY5A 1QCNA 2CS7A 1A3VA 3SDZA 3NGPA 4CBVA 2KRNA 2OXPA 1LO5D 2YRDA 5GAOq 1V1PB 4LF5L 3N52A 2Q8IB 1XMOQ 2ATWA 2UXBQ 4KGZB 1EQVA 1SMYC 4IOAA 3CXCS 4CI0C 4H13C 2COWA 3CQZB 2EBPA 1H641 1LNXA 2ROTA 3HFNA 4IUPA 4PZ6A 4JI3L 3AB9A 3SK4A 5IP7G 4DUYQ 4JS4A 4M7DD 2X51A 1S5FD 4K8IA 3S1MB 1X6OA 4DOVA 3S1NH 4KH0B 1RAHB 2QXFA 4HCZA 1KIXA 4FF1A 2NN6I 4M77G 1GKHA 3T9NA 5IGCA 2QKIC 2F0GA 2DL5A 4FF4A 2PVOB 1JR0D 2RB6A 3C95A 3NMZC 1X3PA 2F0EA 4NMZA 3PMFA 4OEMB 2EQJA 1XQHA 4AFQC 1TIID 3CAMA 2MHVA 1ZHIA 4M78A 3S15B 4N0AC 3P8DA 3SD4A 1JEGA 2QTVA 4OB3B 4UP9A 1ENCA 1D5XC 3H15A 2B63G 4LF8Q 2K75A 1YHQT 4RGOS 2GQIA 2JA8G 3OYAA 1KD1C 1YIJT 4AT1B 4DBHA 1UDLA 2OTJA 1X32A 4RCNA 2UUBQ 1ZSZA 1CFMA 1JOOA 2JEAI 3HOWH 2SEMA 2HQEA 3CCEQ 4C3HB 1X01A 2DMOA 3S17H 3NP8A 4ZLTF 2KEAA 1V1CA 1K9MU 5LL6X 3I4NB 2EVRA 3PIPA 3G6JB 2KECA 1BBZA 2R7ZB 1BBUA 5HK3A 1EX4A 1YVCA 3I35A 4PJNA 2EXZA 3UDXA 1WTVA 2PUKB 3HOXH 3L2WA 5EGTA 2VXFA 2QQ9A 3F2DA 2A19A 4B3MQ 4DR6L 2DKGA 3D4DA 4FYVB 1KQSP 5GAN8 4JYAL 4E2FB 1G3YA 1E6HA 1NPPA 1TUGB 3DEOA 4A3BB 4M7DB 3ND8A 2A36A 3A7AB 2EYFA 2JTEA 5CKFA 3QR8A 1HTLD 1KQSA 2JA5B 5KYLA 2JA7H 2QILA 2VUBA 5FU6C 4RCBA 4C92A 1H3ZA 4E7SA 2RKSA 5I9PA 5M5XB 1YN8A 2LJ1A 1SLJA 3EHQA 3OYHA 4IUVA 4CC3A 3L7ZC 1PFMA 3P20A 1VQ5Q 4NXMQ 2J7IA 1ZBXA 4AYBG 1VQKT 1BK2A 4LF6Q 2RDFA 1Y7XA 3CC2A 1STNA 4HIKA 2O2OA 5FU7C 1PRTD 4HJ7A 4DPGA 3GIBA 2WP8J 2K5HA 1TS2A 1LABA 2RO0A 4N4IA 2B39A 2X6GA 4IPHA 3EGDB 4HAEA 3U9OA 2NUTB 2K79A 2YSQA 1F77A 3TBIB 4AQYL 2OT2A 3T56B 1X43A 3PUXA 5C0MA 4A3MH 2K5LA 4JJNK 1AH9A 5CVIA 5JAVA 3HOYG 1VOMA 4PNOA 2OWOA 1WNLA 1WTQA 1M1GA 5GROA 5GJWB 2DL4A 1YJ9Q 1IHVA 2YTYA 3FC3A 1NEGA 2PNIA 4O2DA 1IW7C 5FO8B 2LX7A 4C8QD 1YI2Q 3CCET 2JS0A 1E1OA 1I3QB 5KNBA 3HOVH 3GNFB 3HOWG 4FT4A 1RAFB 3RIRA 3VYUA 2DO3A 2FPDA 1I5OB 1YWPA 1MHWC 3BZKA 3N6RA 1YITQ 4G57A 5M3MB 2HKQB 1W2BP 2ZTDA 5DM73 5JJKA 3FB9A 5IGEA 2A3LA 3HOXG 2R93B 1QW1A 2C35B 3OW2P 1VQEA 3E0EA 1KC8R 4A3DH 3UA7A 1L1OB 3TDQA 2NVTB 3H0HA 2FPFA 5C4HA 1ZUKA 3M4GA 3FIFA 3LX7A 4C3JB 5GANd 1W2BA 4FSSA 2PQAB 2KCTA 1V76A 2OAWA 1LTBD 1PRTB 1Y1VH 4M1UB 4X3KA 4Q5WA 4JI8Q 2K57A 2R92B 4CC7A 3TP6A 3CP0A 4Z8AA 2O2LD 3VYSA 1R9TB 3C1EA 2ZPBB 1QWEA 4PLIA 3OS0A 2WAQB 1K73U 5IYBH 1NUCA 2ID0A 4RGNA 2F0JA 4WJWA 2RA2A 1PXUA 1VQ5T 1MD2D 4LJZC 3CBMA 2MAMA 1VQNT 1NJIR 3MXPA 3TP5A 5C3EH 4QY7A 2RJEA 3QSUA 4M75E 4ELZC 1BI1A 4RGTA 3ZYYX 2K6DA 1C8CA 1E2ZA 3L2QA 2AIRB 3EGUA 1E0BA 3LX0A 4HMIA 4X65Q 4RFBA 2L8DA 4P73A 3A8GB 1DD2A 1B07A 1RAAB 5L8RE 3QDFA 3U50C 1VQ4Q 1Q1EA 2K01A 4FW2A 3OYJA 1OXTA 5ELOA 4BBRH 2MFIA 4TSSA 1EYGA 1OV3A 4A3GH 1TH7A 5D3IB 4A3MG 1HYOA 4DV1Q 4BD3A 1MV3A 4XT1B 4M7AF 4YWKA 4JI0L 3QWNA 2JM9A 3BG3A 2LQWA 2MYSA 4J8OA 1GUGA 1RAGB 1SRUA 2F0IA 2LVMA 2EDGA 4OMOA 1ZQ1A 1CKNB 4AFUC 4LFCQ 3U9SA 1YI2T 4A3KG 2B2WC 2K2MA 1DYQA 2RJFA 1AZPA 1Q90A 1VA7A 4KD4A 3R2TA 2EFIA 1YITT 1YWOA 2VUMH 2CSQA 4RMFA 4BBSB 1AT1B 2FG0A 2GNCA 2MI6A 3CXCA 3CCQA 1S5DD 2DK3A 1YBYA 1C6VX 2IX0A 2CUDA 2Y0SB 2UU9Q 1G3SA 1R8OB 1MSHA 4GOPB 4DQ2A 2LT1A 4A3DG 2R7FA 1IHZA 3GBQA 3HRZC 3D31A 4DGZA 1YJNA 4UP8A 1OI1A 3RR6A 1XOVA 4KJNA 2L12A 3M0UA 4PZ7A 4KY7A 3TSSA 2GA4B 1WXTA 2CP5A 2P4TA 1VQHA 1Y1VG 2CH4A 2ZPIB 5C5MA 1SE2A 4HJ9A 2NZ1D 4BUGA 2VL6A 1SFOH 5LJ5j 5GAMj 3L42A 2FMCA 4DAYB 4F17A 2OTLQ 1F2YA 4HT9A 2N49A 5M5YB 2WKCA 1WA7A 2V1RA 5IYBG 1UGSB 4JC0A 1TWHH 2F69A 4QW2A 2PCFB 3EJIA 4F87A 4B3RQ 3DMUA 4O1NA 5C3EG 1ONLA 1BYMA 1B1ZA 4O6JA 5A0LA 4X3UA 1PH3A 4M78E 1U06A 1VQJA 1R0BG 2LXKA 4QQDA 5C44H 2HL3A 4Q5VA 5GAMe 1D7QA 1PH7A 4BB7A 4M7DA 1SHFA 1G5VA 5FRNA 1PSFA 1VQ4T 3CCVA 1QVGS 1VQ8A 1CKOA 2FZCB 5C0XH 1UJYA 2GBQA 1I4QA 2FRWA 2WKDA 2IX1A 2A73B 3HFZB 3PO2H 1NM7A 2HHHQ 1TOVA 3ERQA 1Y0MA 1BCMA 2C0IA 5IGGA 3DUZA 1MI2A 2FRYA 3NBIA 5BR8Q 5C4JB 2XN9C 5JJLA 5LMUQ 4C1NI 2AKKA 2EXDA 2CQOA 5KIXA 5FJ8H 3LWEA 1O7LA 1A0NB 1SJED 3MA2B 1XNIA 2KYMA 4RKUE 4X6AH 4L8JA 1CA6A 3RZDH 4DU9A 5GADC 1W6XA 2F5TX 1WXUA 2EYXA 3EHRA 4MMKA 2D62A 4IZ8A 1GHJA 4NS5A 1PSEA 4HT8A 1G3TA 3UDCA 1I4RA 2K5DA 5NUCA 3H6MA 4KHZA 2SEBD 3EGDA 2B2TA 4QKUA 2NUTA 5IOCA 1X6GA 3MP6A 2A69D 3EVQA 3I8ZA 5CR2A 2CW0C 1RAEB 4TVAB 1Q1BA 2N3SA 3Q24A 4OONA 4JBKA 4ZCKA 4C92E 2DF6A 1LTSD 3BYTB 5CV7A 2OTJQ 4NXNQ 1ABQA 3CMAA 1DJ7B 3MO8A 1PTOD 2PZUA 4GKKL 4B3TQ 1PYBA 2SRCA 1N8RC 1PZKD 4RCOA 3C0CA 2YU9H 4A3JB 1QCFA 4PJLA 2KRMA 3CCUT 4A4GA 2D6FA 1NMFA 4DUZL 4L5SA 4JV5Q 1IBKQ 3CC7A 4JJDA 3I5SA 1CM9A 1VF5C 2K5NA 5KYWB 2E8GA 2DL8A 1GCQA 4HCEA 3IFTA 4BY6C 4DV3L 1VMCA 4L5QA 3OYLA 1K8AU 3LLRA 4XTZA 1U4LA 1J5EL 2FEIA 5GANh 1B2TA 2HCKA 1U4PA 3L2PA 2RBMA 2K03A 3NHNA 4JJCA 1L1OA 1LTAD 5C44G 2DXUA 2YXYA 4AH6A 1UE1A 4YHHQ 3S1NB 2HDAA 3OYDA 1A6XA 1ARKA 1LACA 2PQAA 2VKNA 4DA2A 4RWSC 1QMCA 4IPDA 5G3LD 5AJ3Q 1VQIA 5JEAH 5I6YA 2RM4A 4FT2A 2F03A 2GTOA 1TUDA 3QWYA 1QUQB 8ATCB 1ET9A 3K0YA 2DM1A 1NEBA 1GBQA 3JCMf 1O7ZA 2EYLA 1UE9A 3OHXC 3OOCA 2DY8A 3F1ZA 5FKAC 2OAUA 3VRZA 3SFMA 2H1EA 3MZ5A 4ZRZA 4ZKBB 3TZUA 3M57A 4M7AC 5L37A 1XMOL 4HSPA 5FJ8G 2DL3A 2SDFA 3S16H 4DAPA 2DXCA 1PTOB 4QQBX 4CDEC 5CV5A 2F3IA 3CU7A 4DUYL 1EIYB 2AUJD 1RL2A 3CRKC 4WFN3 1WFWA 3QIIA 1I1JA 1UJ0A 4Z02A 5FLXE 3OYCA 2EY6A 2WB1E 4KN7C 1G2TA 4IUNA 4YWMA 5I2YA 4A3FB 5KNCA 4A3EB 1WJJA 2I5LX 2E1HA 1WIEA 2EYYA 1K9MC 4A4EA 2HCIA 3NSWA 1PRTF 3GTLB 2QDYB 5GAN7 1UNSA 2F0QA 2NTSA 2PW7A 3K58A 1C48A 2KENA 5FWCA 5GMKj 4DK6C 1K8MA 2E2JB 1PDQA 4EVOA 1CKNA 1G8ZD 2PNHA 3P8HA 4AG2C 1C4QA 5T1GA 3X3NA 3GOXA 1BR9A 2VXWA 4Z88A 5DEHA 4JI6Q 1LJOA 5KH6A 1UG1A 5LJ5d 5GAMd 1KDAA 4GKJQ 3BJUA 2VZAA 4KBMB 1HH2P 1M4ZA 1RI9A 3OS5A 5GMKe 1YCSB 5LJ3f 3TSWA 2O5JC 5GMKl 4EMKB 4A76A 4C8QF 2L4NA 2JA6B 2B8FA 3F8TA 4R4CA 4GOPA 3MFGA 2Q2HA 1WYXA 1SR3A 3ND9A 3A8KE 3S3MA 4B6MA 1KABA 3M4QA 2GQVA 1U8RA 5EKLA 5CR3A 4F7XA 2K05A 3OSOA 1HXYD 5HGQA 3J7ZC 4BWGB 1XPOA 2RJDA 4F7UF 1U1TA 2E5LL 3DLLA 1J6QA 1YHQA 1Y71A 1M4VA 2TSSA 3FKIH 4UDUC 4A93B 4A63B 4C3IB 2RK2A 2CH4W 2FYKA 4M75D 5CMDA 1OULA 1Z9QA 4C0FA 1Q86C 4DAYA 4IURA 4J9GA 1XJVA 2E65A 3H8ZA 4P71A 3C2PA 1HZAA 2NVQB 1JT8A 1N34Q 3A55A 2K33A 4JLGA 1QOHA 2XDPA 3QJYA 1O7IA 2XHCA 2KQ3A 1FVIA 2LNVA 4E7ZA 1IO6A 4ZAIA 2F4IA 4OO1I 4E6RA 4LF6L 1KJWA 3M7NA 1U4MA 2E74C 2KA7A 1NAPA 1D6EC 3BDUA 2ZXOA 1TXYA 1PH1A 1KHCA 5I22A 2PU9B 2VC8A 3EFSA 2PZ1A 3MEWA 1XYIA 2NUCA 2VXEA 2OJ2A 1CSKA 2EGEA 1PHTA 4EDUA 1E2WA 2F5KA 2EYWA 2GFAA 3GV6A 3VV0A 3SEBA 1W6JA 4LUOA 1D0ZA 1QWFA 3HRTA 1PCXA 1AE3A 1CHQD 1DM0B 3OYKA 3AT1B 2DFUA 1JE5A 1PFBA 4GN5A 4DK1A 2H4OA 4M7AG 1QVGA 4DAMA 1VQKA 1SSHA 4LUDA 1FX7A 3QHSA 4K11A 3VS7A 2IHEA 1B9NA 4K6DA 5DLQE 3CCQQ 2MNAA 1LPLA 1LUZA 3V8JA 2JEBI 4M7DE 5FK9C 2LCSA 5I2MA 1AWOA 4VUBA 3X26B 4K6LA 3FLGA 1JOKA 1FL0A 3IKJA 3K5MA 3S24A 2E6NA 3EFXD 4KGVB 1SYEA 1YJNQ 1PZID 5IH2A 3WOFA 1K73C 3ERSX 4MDWA 1FJGQ 2LJ0A 3G1JA 1H9JA 4E7JA 1CQFA 1JO8A 1S3OA 3JCMP 3H0GH 3UPUA 3T4AC 5E4XA 3BZCA 1WD1A 3IQLA 4HCKA 4OIKA 1PG5B 4J9HA 4DR7Q 1X27A 3FKIG 1OTCA 5CV4A 1AWXA 1STBA 3URYA 5CO7A 4C2MH 2DERA 1Q81R 3E9FA 3M58A 2FVUA 3KF6B 2MOXA 4DV0L 4LF9Q 4OX9Q 3KFVA 5KYWA 3G6EA 1HZBA 3CCEA 1F1BB 4M78D 4PFZA 1S5BD 3H94A 1EU4A 1UEBA 4L5GA 5HKCA 2ZPEB 1FR3A 4JI8L 4A3CG 3HG9A 4NB3A 4XT3B 1UE6A 2E5QA 3PFSA 4ZQ3A 4BXXH 1PWTA 1M30A 4WJ4A 1VIFA 3L2RA 3SE0A 3JB9H 3L1AA 2ZJRA 3KF8B 3A56A 1IBLQ 1X3QA 3CCVQ 1KXLA 2LQ8A 2DXTA 2Y90A 2KXCA 3E19A 1Y8OB 2LS01 2QW7A 3SHWA 3HS0C 2EKOA 4OHJA 2M0YA 5K5PA 4X65L 2CT3A 4R56A 1JE4A 1S4ZA 5EKIA 1STGA 3EAEA 2RDGA 3OTOL 3F2BA 1QUQA 5C3WA 3BYYB 2A37A 2GVAA 2E2IH 3EG1A 1A2UA 4BI4A 1DGSA 3VR4A 2H5XA 1Y57A 2EPDA 2PZTA 3D3RA 4K2KA 3MHBA 2YTXA 1PRTC 5DAUA 4DV1L 4XU3A 3DXJC 3A8OB 4ME7A 3VS0A 5CV6A 2K3XA 3MJXA 3RERA 1GUSA 2KSSA 1VQNA 1JB3A 3QYHB 1WQ7A 1WPYA 1C7YA 1SHGA 4C3HG 4C92D 4XIGS 2F0UA 1CA5A 2K5IA 4MDXA 4HEDA 4KK7A 3RKXA 1KDBA 2DEQA 5C0XI 2GCXA 2KMTA 3RUXA 1TWHB 2F0PA 3NQTA 3ULJA 3CMAQ 4DR2Q 2PTKA 1EIHA 2K7VA 1VQ6T 1TWCB 4C8QC 3G71A 2WAQE 3H0GG 1WTHA 2R7DA 1RI0A 1ACMB 3DWQA 2RF0A 3L2ZA 4LNQA 1BU1A 2HL5C 5LJ5h 2KCCA 3KJOA 1ZSZB 5LJ3h 3CC7Q 2N88A 4X62Q 2DBMA 1HA6A 3V05A 1XJWB 1VQBA 2MF2A 5CKBA 1Y1WH 1KQSS 1EZ8A 1HR0Q 3PO2B 5CKHA 3V96A 1LLRD 1PTOF 2L9HA 4XDXA 1FGBD 1OXSC 2A28A 2KYBA 2EJMA 3INZA 2K5WA 1NLOC 1MUZA 3IL8A 3M85A 1X6BA 1Y07A 4BXXG 4P5NA 4EMKA 3KLWA 2BE5C 3ZJYC 3KJPA 2QQRA 1ZYRC 1SRMA 3JB9G 4X64L 2A6HC 4FYXB 3JCMb 3A5ZB 3MVVA 3I4MG 2ROLA 5CV9A 2F0LA 4DK0A 2HT1A 4N4GA 2E2HH 3SGIA 2ES2A 1I6HH 1MSGA 3AQQA 4HSVA 1EWCA 2PVDB 3S1QH 3L2UA 4KUDK 2J06A 2HDLA 4I65A 5IYDH 4DF7A 1ICFB 3M59A 1AFPA 1HK9A 3GLXA 1ASYA 1EL0A 1PFNA 2LMCB 1WTOA 2HHHL 2BDOA 3DHQA 3MFYA 5G3LF 2B2VC 2R57A 1GFCA 2BH8A 5JPNC 1UWVA 5GAEC 3GTJH 4V0BA 4QUFA 2M02A 1YNJD 2R3ZA 2QDLA 1EY7A 1LTRD 2YU9B 2D8JA 4BY7H 3SVMA 3OS2A 2X3XD 3OQ5A 4I7AA 4CDFC 5GAOr 5I6WA 1ENAA 1SSOA 1ZXTA 3H6ZA 5H1SE 1D2BA 2DNEA 4OWXB 1Q95G 1BI3A 3ZL7C 3CMAT 3LW5E 1JWMD 1YJWA 3MEVA 5D6YA 1CSQA 3CCLA 4WORA 3U23A 5D65A 5I2XA 2RH2A 1K8AC 5IP7H 3J80L 1AZQA 2QYZA 3FPPA 4DR4Q 3CC7T 4Z9CB 3OIPA 5ELBA 1J8IA 3JCMg 1W2BS 5C0XJ 2E10A 1VYUA 3EGXB 3FP9A 3ULRB 3V8LA 1UAPA 3S14B 2ZTCA 3OW2S 4B3TL 5M5WB 2EYMA 2YRCA 1WI5A 1TWAB 2C0TA 1AHJB 4R55A 3EH1A 1BO0A 2WAQG 1M90C 2NVXH 1Z47A 4GKKQ 1IL8A 2AKWB 3L9AX 3SXHA 5K36H 1ILPA
chains in the Genus database with same CATH topology
3S16B 3IAYA 2F0DA 1QNUA 1S72T 4C8QG 1WD0A 3LYIA 2BKDN 2BOSA 4PMWA 4BE1A 1UGQB 3EFRA 3HHTB 2B2YA 2LX9A 2EPBA 4PQXA 3CCUA 5CBAE 3HOUB 2FINB 4RG2A 2XWJB 1OXVA 4F7UG 4X3TA 5ELCA 1CI3M 3G7ZA 3NE5B 3MEUA 2D9UA 4M75F 1SSFA 3PUVA 5LJ3g 4OMFB 3FDTA 2RSNA 4H0LC 1VDZA 3ZFJA 1HCZA 1Q8IA 3ER0A 2FFKB 2HCCA 3OWFA 2NVYB 4XQQA 4S3SA 5JEAJ 5J39A 3R8BA 3JSCA 4MHEA 2EVBA 3D6WA 3QG1A 1VQOT 1F9SA 2A69C 4FIBA 3CCJA 2XD0A 3HL8A 1LV9A 4XTWA 5I21A 1RTNA 5A0DA 3DLMA 4OVAA 2VV5A 3HRUA 1PTOC 3SR1A 5K36G 3RLFA 3OYFA 3AHUA 4FM4B 5DY9A 4HN7A 2R5MA 4DAVA 1SYBA 3OW7A 3VYGA 1D5ZC 1WCMB 1UB4A 5FLXL 5M3FB 2Y4YA 1WVLA 1JWSD 1NR4A 2O5IC 3FMCA 1ILQA 1UGRB 1F9QA 3K59A 3KBGA 1HFGA 1SYFA 4H44C 4V2SA 4ZUIA 3G4SA 4KY6A 1SEBD 1QE6A 4XYOA 3I55T 5C4ZA 4M78F 3T53B 2GF7A 3OMCA 4IFDG 1HFNA 1UEAB 4DXFA 4C0ZA 1OO9B 2DAQA 2MGSA 1G6ZA 1I4K1 4QF4A 4II1A 2J0TD 2X4YA 1D5MC 3OA6A 4PJOA 1O80A 2BUDA 2EY2A 2JOYA 2F0KA 3G7LA 3P7JA 2KEEA 2C9OA 4OB2B 3K7AB 3LWIA 2EWNA 4RMOA 3SK8A 3NTHA 1TKWB 3ZEHA 1LTGD 4TQUS 1TWFB 5C6SA 1Q86U 2DXBA 1SNMA 2EYOA 4CJ0B 3VKIA 4RHRA 2XIWA 2G3RA 2A74C 5GAOm 5DLOA 4F88A 4BA2I 2ZT9C 4BY1B 5A35A 5E4WC 1HRJA 3NPPA 4C92F 2YLCA 2M1HA 2L11A 3META 3G6ET 1PZJD 2AUKA 5IGDA 4ELYC 3J7AV 1EIFA 1N9RA 4MZPA 1I4HA 1G291 1HTPA 4KKUA 1JOQA 2AQ1B 2WIIB 3ITPA 1ESFA 1LT3D 5GAN5 4M75C 3OW2A 4MMLA 2XI9A 5GANf 2PMZB 2IG0A 2F0HA 3P1HA 2X4JA 3J7YW 4R8IA 1TQOA 5J1ZA 1QVPA 3I4LA 3I91A 3PMTA 5GAOn 5KCOA 1D1IA 4IUUA 3BVZA 1Y8PB 4KJOA 2DTOA 2E6ZA 2L3RA 4J8QA 3NHHA 2L1BA 3AMUA 2M2LA 2B2UA 1BCPD 3A54A 2F0NA 3QUIA 1Y1WB 4XU0A 1ZEQX 3M4OB 3G71T 2PZWA 3H3VC 4BA1I 3OY9A 4LAAA 4Y91A 4Y7NB 1R4QB 3PUZA 1EFID 1TT2A 4B9XA 1JWUD 4M77D 3GPLA 4TRDA 2DJZA 3S1RB 1G2TA 1S5ED 1TU2B 2E2HB 1SNOA 1VQ7T 5CV8A 3CCSA 2IWHA 3HFOA 3I70A 4CHTB 1YCYA 5CORA 1AEXA 2ZXPA 2QA4T 2FL7A 1CHPD 2VGNA 3VR5A 2MWOA 1VQ6A 3JCMe 4G4KA 2KVQG 2JTMA 3C46A 2BA1A 4XQ3A 4M78C 1WJQA 4BI8B 1V29B 4BI3A 1MGQA 3GF5A 2E64A 4K5VA 2XRQD 1BCPB 5EKKA 4C5EA 1XX8A 1WTPA 2RK1A 2WSFE 3SHLA 4JRPA 2IPKD 4HCCA 2WSCE 3HSBA 4ILWA 4HA8A 3J80E 1LTTD 2KCNA 1EEID 4M77B 2QQSA 1KDCA 3K5NA 2DVEA 1DCZA 1EY9A 4QB4A 1YJWT 1NZ9A 3VR3A 1RF2D 3CC4T 3CCLT 4M75G 4MZMA 4L59A 1EY0A 3FVQA 4ODGA 1EU3A 3J81L 2E2DC 2B63B 1TS4A 1U1SA 4LD6A 2DIQA 4C92C 2JA8B 2QEJC 5D6WA 2EQUA 3CCRT 2XKOC 2MPMA 1BNZA 4H7BA 4JRQA 3P8BB 4M7DF 3Q23A 1M8VA 4KULA 1BF4A 4U68A 4JRIA 2Z1CA 4OB1B 3GP8A 4EGVA 1Q82U 4PJOE 1V43A 1PMRA 2EY5A 4IUTA 3GTOB 2NLUA 2CZ7B 2EJFA 2KK4A 3L2VA 1EIGA 4J6XA 3R2IA 4E6IA 1ET6A 4M8AA 4X9DA 2WACA 4NL2A 2EJ9A 3GP7A 3BW1A 4HR7B 2K2VA 2J7ZA 1D3BB 5C6AA 4E47A 1STYA 4C0GA 1GUWA 4AYBB 5GMKi 3CCMT 1A3UA 1Y8NB 2K4YA 1QJOA 1TS5A 5CGKA 4FP5D 1M90U 2M9UA 2E12A 1S72A 3UT1A 4OGQC 4M78G 3MCAB 1KG1A 1OYXA 2D5DA 3S9WA 4OP0A 3CBPA 4BS9A 2JN0A 3CCJT 3V8KA 3GQBA 3HOWB 4ZTJA 2KUMA 3SK6A 3S17B 1HQMC 1SE4A 2CZ1B 2QEXT 1M1FA 4NKLA 2RHZA 5KRUA 3HOXB 1HHVA 3QOLA 4CJ2C 2XIDA 2F0FA 5HY6A 5JOBA 3K57A 4V190 3JCMJ 1FNUA 1F2ZA 4ABNA 3KLRA 2ZPFB 3G4ST 4C92G 4CKEA 2JA7B 4A53A 1EY4A 2VYTA 2NB0A 1VQOA 5LHY1 5GAMf 1JB0E 5LJ5f 1NCVA 2RA4A 2ZCFB 4B08A 3QO2A 4JS5A 1BQQT 4MN3A 2JVVA 1EY6A 3QZ9B 5ISRA 3A8HB 4XTYA 3LGFA 3DWPA 2RHYA 1B50A 2KVMA 5A0GA 1DZ1A 3CD6T 1BUVT 3QBYA 3K6OA 4L6TB 4A3MB 4J6HA 3PTAA 4G7HC 4XYQA 2CYZB 2PUOB 1Z7TA 4ZN1A 4MZTA 4KT0E 1V8QA 2RI2A 3I55A 3HOVB 4A3KB 4FNFA 3LGLA 3OYIA 4M77A 4KV6A 4J6YA 2DIGA 5FU7B 2ZPHB 1RKNA 2EJGA 4M7DC 3QOJA 4GZYC 5GANg 2XG8D 3O8VA 1A15A 2OF1A 2SNSA 4A3DB 1U4RA 4J7IA 2EY1A 3K5LA 1BCPF 3JCMc 1I4GA 3KK7A 3PNWC 3M9QA 2PNRC 2HNIA 3SWNA 1DOMA 2F3VA 1Y1VB 1ML0D 3PUYA 5ELDA 2BDNA 2ZZDA 2HDMA 4QIWB 1B44D 3CEYA 3RKWA 2VB2X 5C3EB 3NTKA 1A3TA 3RMSA 5JPMC 1M9SA 3DWAA 2B2TC 3MP8A 3MC0B 5EQ0A 2L5QA 3HP9A 5EBCA 3QB3A 2FJ2A 2HUGA 4CJ1B 4BBRB 1FNVA 4A3GB 2CGHA 3BDLA 4FXKC 5JJZA 2PQWA 1M5Q1 2E76C 1G91A 3CRLC 1O75A 1D3BA 2NWGA 3L3OC 4ZGJB 5A2QE 1AP0A 4A54A 5I4DA 1VUBA 3JCMV 5KEEA 4XU2A 3I56T 2FHTA 4RKLA 4KN4C 2F3WA 4N4HA 4RCCA 2A5HA 4K5WA 1KNEA 1AN8A 1JQYD 2VUMB 1A2TA 3Q1JA 4OB0B 2K32A 3F2UA 2K6AA 2CZ6B 4C0DB 2NN6G 3WXMB 4BDYA 2F1MA 1IKLA 3M7GA 1H9KA 3CCST 2WINB 2CVRA 1SFOB 2XICA 3OYYA 4QVCA 1TWGB 4PJOD 2KAFA 1YNND 4KTAA 3VJPA 5J3BA 1NJIU 3MXUA 3RKYA 3PGGA 3MTSA 3OYBA 2A68D 3R93A 2IL8A 5C44B 4M7DG 2G9HD 5GAMh 2IT1A 3I90A 2LTOA 3I3CA 1R4PB 4N0AA 4MIUA 1WJRA 3FRPB 2ZGWA 2EAYA 2JP1A 1VQ7A 2MMPA 3URGA 3FJPA 2XVSA 5CIUA 3TU4K 5KYIA 3VR2A 2CW0D 5F2DA 2IW3A 3J81E 1FXXA 3LWHA 2K5QA 3D4WA 1Q7YC 3QIAA 1QG7A 4WF2A 1K83B 3RZDB 4J83A 2QA4A 3PUWA 2QI2A 2PW5A 2LT4A 3D4RA 3EA6A 4PKCC 2JNGA 1O78A 1SNPA 2LC4A 5JVG3 2EYQA 1QP3A 3OB9A 4PJOB 1OXUA 4XQJA 1VQLT 1TS3A 2SOBA 3OSVA 4LK1C 1VQPT 1MGSA 2EYHA 4RA8A 3NFCA 2FB7A 5KCHA 2L55A 1BCPC 5C3XA 5CQYA 1Q82C 1M1KU 1L0XB 1B34B 3DEPA 4EQPA 2F0SA 3JAML 3R3OA 2X4XA 4KKTA 1UGPB 1B9MA 2I07B 3V7RA 2YLBA 3CC4A 2P0PA 4C5HA 2P0QA 2RHXA 4FL6A 1QVFA 2DN8A 2LY7A 4C3JG 3NWSA 4PMCA 3DKMA 1IKMA 3BY7A 3A8LB 2V8KA 1PLFA 3D8GA 1QNKA 2KQWA 2HBPA 3CMET 3CCRA 2CHBD 4M77E 4EMGA 2XK0A 5BN5A 1HUMA 3NQIA 4BY6B 1BIBA 1CK1A 4UAIA 3PIO3 4QVDA 1FWZA 2DTHA 3MWYW 1EOTA 1HQRD 3OBWA 4KMUC 2LFNA 4FYDA 4KKSA 2DD4A 3X25B 3JCMW 3Q22A 5GAN3 5DM63 1L0YB 2HD0A 2E70A 2F0VA 3E1SA 3CPWS 4IALA 2F0TA 2N55A 1Q3LA 3TZDA 1PYWD 3TN2A 2V8JA 5LJ5g 5GAMg 4EQNA 3Q6SA 3HOYB 5CAIA 4X9CA 1D1KA 4IFDH 1BI2A 4M7AB 1RHPA 3X20B 4OIJA 3CCMA 2BIVA 5EJWA 2KDSA 3BFMA 1EYAA 3VYTA 2MUYA 5BN3A 1BBXC 4KI0A 2DTIA 4L6V5 2ICEC 3HGBA 2RDHA 3KLSA 5GMKh 4GLKA 2DZ9A 2MJ8A 4IKFA 1STHA 4LDVA 5FO7B 4C1NK 4U673 4PLLA 1NR2A 2RHIA 3FKIB 2MP1A 4E7IA 3RESA 3HZXA 2CZ0B 3OWEB 3V7CA 2RJCA 2CQAA 4WRDA 1SAPA 2B2WA 2XNAC 3UWNA 2QEXA 2ENBA 4JRKA 5GANe 4YIJA 2DZCA 2A6ED 3HEJA 4RKBA 2RD1A 3T51B 2L5TA 3GV3A 1BKBA 3JCMQ 3M53A 2WV6D 3R6OA 2EQKA 3TCJA 2X35A 4DNTB 1WTWA 5AYFA 1EEFD 4OGCA 1VF7A 1RTOA 2DPPB 2TMPA 3QDRB 5GAN6 2PO4A 2M0OA 3JB9D 3OYGA 2PQEA 3OPOA 2R6GA 1W4SA 1II3A 1PTOH 3T13A 3TMEA 3EROA 2X69A 1LT6D 4NW2A 5GAN4 4EMKC 3F70A 2LRQA 4Y28E 5HK0A 2RHUA 4EMHA 1I4PA 3CD6A 1WGSA 1KQ2A 1H9SB 2NBFA 3X24B 1J9OA 4DFAA 1Y96A 3VUZA 3OYEA 3H0GB 4DA4A 5FOBB 4JUVA 3ME9A 4JDSA 1B34A 3JB9I 5KE2A 4C2MB 1FD7D 5M9OA 2F0MA 2DD5A 1KNAA 1BDOA 4ZGDB 1F9PA 1WTXA 5IT9L 4N9PA 1DOLA 3QZ5B 5IODA 1LT5D 5AFWA 2WSEE 4OL7A 3M56A 4PJOF 3I4MB 4G7ZC 5D6XA 2Q8TA 1TR5A 1M8AA 5I2SA 3OMGA 4JBWA 1Q12A 4J7FA 4RHSA 1SNQA 1LOJA 4B9WA 2E41A 2E2IB 3C1FA 5GMKm 1G2SA 3MHXA 4XQNA 4DOWA 5HURA 4HKEA 4LDWA 1KC8C 3FEOA 3J7AF 1ICWA 4NOYA 1GXIE 2GFUA 2RI3A 1JBMA 1CQVA 2E75C 3S6WA 1BI0A 4LDXA 2JYOA 4XK8E 2KY9A 5CCAA 1JCKB 1KAAA 4FVMA 1KLGD 4O5VA 4FO2A 4R8NA 4BE2A 4OGEA 2RQXA 2PYKA 1FYCA 4OO1H 3RMHA 1NJIC 2Z4IA 2B2YC 4HCSA 4O42A 4DXGA 1SYDA 2BE5D 1O7YA 1ZYRD 2NYZD 5EPLA 3M55A 1DJRD 1Q81U 2A6HD 1WTRA 3C94A 3EQLC 1V1OA 4M7AA 1ENFA 4NDXA 3I56A 3FDRA 4JK1C 4ID6A 3JB9J 3CPWA 5A2QL 2ZPGB 4IQZA 3VU3C 3MEHA 5CYUA 1F2LA 2K5FA 4E7KA 1JC7A 3SK5A 1GUNA 1ESRA 2I46A 1XWEA 4C3IG 1I6HB 4C8QB 2F0WA 4KD3A 1S5CD 4C0DC 5CBEE 3S1QB 1QCBD 1VQMA 2FHDA 1V1PA 1CZWA 1CT1D 4XTCS 4F7UB 1YJ9T 1B53A 4RH6A 2HAXA 3HKSA 3GTJB 2EOTA 1VIEA 2D9TA 3T16A 1RDPD 4BY7B 4CGYB 5GAN2 5HGTA 3HKZB 3QXEB 3BDCA 4J6WA 1M1KC 4TKOB 4R9WA 2H3JA 2XDDA 1HA5A 3JAME 1U9RA 5KNDA 4X34A 4EQOA 5J26A 4QQGA 2JUFA 2B8GA 2D0QB 4OO1G 4E7LA 2EYPA 3N5BB 4NL3A 4UC4A 3NBHA 3OIQA 4L63B 2Q8RE 3QYGB 2C5CA 4ULLA 1EQTA 3M54A 5LJ3j 3FEWX 4IN3A 3KBXA 1NE8A 2PVGB 2NVXB 4LDYA 1H9SA 4RAUC 3A7LA 2QQBA 4P2CB 1Q7YU 1MHNA 1VQLA 1VQPA 3SWNB 5LJ5e 5LJ3e 1JRIA 4PJOC 4KY5A 4RGMA 1YNNC 3A8IE 1KQ1A 1I50B 3M3YB 3V2TA 2O4XB 4IFDI 3PIOA 4RG8A 2XDBA 2A68C 4FXGC 2CKKA 3LH0A 4ZYSA 2NTTA 3M5AA 1SMYD 2SNMA 1JJ2S 4XTVA 3S3OA 4ZGEB 3GD7A 1QWYA 1EYDA 1F9RA 3M4YA 4J5YA 4A4KA 1SNDA 4K5XA 3LNNA 1I4XA 1MBYA 3CMEA 3OYNA 2ICIA 4QVZA 4G7OC 2A7YA 2R5AA 2XWBB 1T5EA 4PV1C 1KLUD 4K2LA 3VR6A 2OTLT 2R58A 3SB2A 3JB9F 3KUPA 3OS1A 1ZKOA 1YNJC 2R61A 1VQ9A 3MEAA 5I9OA 3C3LA 2V4DA 1SNCA 1KTKA 3VYRA 4JLIA 5C0XG 3NTIA 3JCMd 3PO3B 4PNYA 2XRSD 4TVRA 4C5GA 3RUZA 5KE3A 1QB5D 4A3IB 1I81A 2YHTA 4BDZA 2B2UC 3GTPB 5TSSA 4IFDJ 2X4WA 4FF3A 2L0CA 3E6ZX 4QUCA 5EPKA 1SJHD 1Y69U 3GTKB 4HCBA 5BN4A 1EZ6A 4C8QA 2QQAA 1TY2A 3QKJA 2KEDA 3GNGA 2M00A 4PJOG 2BA0A 3DB3A 5GAOl 4M7AE 3KXTA 2PPBC 2JE6I 4ZN3A 1N9SA 5CK9A 1VMPA 3GTQB 3JCMX 4X3SA 4F7UA 2OTJT 1G3WA 4ATOA 3WVDB 3VUBA 4XTUA 4C56C 2Z4HA 1GHKA 1O9SA 1AW7A 4CKBA 1I8FA 2LQKA 3ASKA 2K1BA 1IW7D 5LJ3d 3BZDB 4F8MA 3TP8A 3V7SA 1IYUA 3NUCA 5IT9E 1XXGA 5FU6B 1QVFS 4K8JA 1GUTA 3BVMA 2AWNA 3P75A 3LWUA 1H9RA 5JEAG 2O01E 1YIJA 1GOZA 2B2VA 4A4FA 2G9DA 2QCPX 3D6CA 4J1MA 2LKVA 1K8OA 1I6VC 4FF2A 1GUOA 3CC2T 4FSXA 4FXDA 1JORA 1H9MA 1BXTA 1KD1U 1DXMA 3I73A 3CPFA 4NP5A 2NN6H 2DY7A 2LCLA 3OSSC 1DOKA 5C5LA 1T5XD 3PIP3 3MAQA 1HUNA 2M9VA 1Z6HA 2F0OA 2Y4XA 1N6AA 4FU6A 2YYZA 4I7ZC 3HP3A 2IVWA 3NK9A 3UI2A 1BOSA 2A6EC 3GTGB 1WQWA 2O4XA 3CKIB 4M77F 3W2DA 3WOEA 3JRZA 3BS1A 5T1IA 3GTMB 3E9GA 2B8AA 1EWHA 1SE3A 3OBYA 3HRSA 4OF1A 2EIFA 1OZ3A 2M16A 1QP2A 2JTFA 1Q81C 2XSCA 1IREB 4M75B 4QQ6A 3C4SA 5ELFA 3S2HB 2EQMA 1JJ2A 2EJFC 5CKDA 1F2MA 5GAOp 4XTXA 2K3YA 5CKEA 1VCIA 3DB4A 3PT9A 1W6KA 1E2VA 2J4XA 2JSOA 2V8IA 5IGBA 1IYVA 2X6LA 1TVXA 3OYMA 3BVGA 1KC8U 1HXDA 4ME5A 1SXTA 5CQXA 2K04A 1WJSA 5IGFA 1SDFA 1BIAA 4PMBA 5J22A 3MXNA 3JCMh 2EE1A 2RSOA 4XAXB 1B2TA 5EBDA 2VB3X 5CC4A 1VQMT 4YTLA 1STAA 1TY0A 5FROA 3PV0A 3VYHB 2LCCA 1OXXK 3E5SA 2YRVA 2AWOA 2VGMA 2AHJB 1SBBB 2MWPA 4HMJA 1EY5A