4IUUA

Crystal structure of shh1 sawadee domain in complex with h3k9me1 peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
133
structure length
127
Chain Sequence
ADLAFEAKSARDYAWYDVSSFLTYRVLRTGELEVRVRFSGDEWVNVKTSVRERSIPVEPSECGRVNVGDLLLCFQEREQALYCDGHVLNIKRGIHDHARCNCVFLVRYELDNTEESLGLERICRRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Polymerase IV occupancy at RNA-directed DNA methylation sites requires SHH1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
molecule keywords SAWADEE HOMEODOMAIN HOMOLOG 1
total genus 23
structure length 127
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16719 SAWADEE SAWADEE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4iuuA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iuuA01
2MP1A 3E9GA 1RODA 5D6XA 1O7YA 4BE0A 2SDFA 2JZ2A 3E9FA 3FC3A 3META 4IUVA 4NW2A 1G2SA 3O8VA 4RG2A 2WACA 2EQJA 4N4HA 2D9TA 1F2LA 1HFNA 3FPUB 5EPJA 1OZ3A 3C4SA 3ASKA 3P8DA 5EPLA 1O7ZA 1G91A 4C5IA 4IKFA 1ML0D 2IL8A 4BD3A 2R58A 3ONAB 2RJEA 3H8ZA 4U68A 2L3RA 2E5QA 5M9OA 3MEUA 3KUFA 5IN1A 2RI3A 3ME9A 1IKMA 2HQEA 2MWOA 4LD6A 1U4MA 1VMCA 1DONA 2HDMA 3QJ6A 4CJ1B 4BDZA 1JE4A 2BIVA 1NCVA 2RJCA 1WTQA 1BNZA 1JICA 1SDFA 5C0MA 5CIUA 3OS1A 1J9OA 2B2TA 2K05A 2M16A 1HA6A 3OYNA 3LX7A 3BDLA 1Q3LA 3FLGA 4E7LA 3OMCA 5CMDA 3OYAA 2N88A 1X32A 3OA6A 1OYXA 4XT3B 3TZDA 1WVLA 4IUTA 4C5HA 4MN3A 4R8IA 1WD1A 3OYEA 1SSFA 1PFNA 3R93A 2X4XA 2LRQA 1HUNA 2X69A 3MTSA 4A4GA 2P0KA 1TVXA 3FDTA 2MPMA 5T1GA 3Q6SA 3Q1JA 5JJZA 4ZK9B 1H3ZA 2HCIA 4O42A 1ICWA 2F5KA 4B9WA 1X3QA 4BDYA 4E7KA 3FEOA 5D65A 2B2VA 4CJ2C 2RSOA 2H1EA 4NS5A 2LTOA 2NYZD 2Q8TA 1BO0A 5KH6A 1B2TA 1QG7A 1PFMA 2L12A 2EQKA 2KEDA 2L1BA 2B2WC 5E4WC 4BACA 1DOLA 5J39A 2KOLA 4IURA 4QUCA 1J8IA 2RJFA 1S4ZA 1WJSA 3S3MA 3OYFA 1ZXTA 4RAUC 2EPBA 3QKJA 3I90A 2K04A 3L2WA 3NTIA 1XX8A 1ILPA 2X6LA 2RVLA 1RI0A 3L2QA 1KNAA 1U4PA 1WTRA 3IFDA 4DN4M 5D14A 1XNIA 2NZ1D 3MEVA 2XDPA 2RHYA 4C5GA 5FROA 4Q5WA 4PL6A 2K3XA 2MGSA 2RI2A 1MSHA 4X3KA 3NTHA 3PFSA 4QW2A 4ZKBB 2GFUA 3NTKA 2JYOA 4FU6A 4MHEA 1PFBA 1U4LA 3DLMA 1QE6A 2KVMA 3OB9A 5FRMA 2L9HA 5IAYA 4IUPA 2B2UA 3GV3A 2RO0A 1MI2A 4HSVA 2FJ2A 3I8ZA 3SD4A 4PLLA 2GF7A 2CVRA 2FHTA 5D6YA 1WTVA 3LLRA 4A4HA 1WTWA 1AZQA 1ESRA 1MSGA 1CA6A 2PQWA 2R57A 3L2UA 1VMPA 3DEOA 2X35A 4HCZA 2DY8A 4ZTFA 4N4IA 2RJDA 3OYCA 1E0BA 4UAIA 1MGSA 1RJTA 1F9RA 2K03A 4UC4A 3GV6A 2LCCA 4HEDA 1F9SA 1PDQA 2JP1A 3DEPA 1MHNA 4N4GA 1RTNA 5D6WA 5E4XA 3OYIA 4FL6A 4XDXA 2DIGA 1HFGA 1RTOA 2B2YC 1AP0A 3D6WA 3OYKA 2K01A 3H6ZA 3OS2A 2E6NA 2EQUA 1F9PA 1WD0A 2KUMA 3MP8A 2M2LA 1NAPA 4ZKCB 2HDLA 3CEYA 1A15A 2B2WA 2KEEA 2IG0A 3M9QA 5KCHA 2O4XA 5CBAE 4QQGA 1HRJA 2O4XB 1WGSA 2M1HA 4E7HA 2L8DA 4Z02A 4HCSA 2CKKA 2K28A 1B53A 5COYA 2LVMA 2G3RA 2RHZA 2HUGA 3N52A 3QIIA 1WTXA 5T1IA 2BKDN 1F9QA 4E7JA 1HUMA 1IKLA 1M8AA 3MEAA 3IL8A 1B50A 3PMTA 2K3YA 3PMIA 3LWEA 5CBEE 3FDRA 4X3UA 3LH0A 3OYGA 3G7LA 3MEWA 4CRIA 4OIJA 3UT1A 4PLIA 1PLFA 1EIHA 5C6SA 2FHDA 3SVMA 3UWNA 4A4FA 2RA4A 4OIKA 2EE1A 4II1A 2M0OA 4A4EA 2X4YA 3GOXA 3MP6A 1QNKA 1X3PA 4IUQA 1EQTA 4XT1B 2N55A 1EL0A 2RI5A 2L89A 4B9XA 5FRNA 3KUPA 5AFWA 5CORA 3OY9A 2R5MA 1G2TA 2HQXA 5EJWA 2B2TC 3S6WA 2FMMA 1CA5A 5DNFA 2FINB 4QVZA 1N27A 4BE2A 1IL8A 2D9UA 1C8CA 3OS0A 1SAPA 1RHPA 2BDNA 2R5AA 2EFIA 3I91A 3MO8A 3OYHA 3EAEA 1O80A 1U4RA 2R3ZA 2RHIA 3DB3A 5EQ0A 2B2YA 4C5EA 4L59A 2J7ZA 4QQ6A 5KE3A 3OYJA 1WJQA 2EOTA 3DM1A 2HCCA 5KCOA 1XYIA 1B4OA 4ZLTF 2RHXA 4RWSC 4QUFA 5EPKA 4R9WA 4EDUA 2B2VC 5EKIA 1B3AA 3P8HA 4X3TA 1NR4A 2XIWA 3F70A 2MJ8A 3OYBA 3OYDA 3I3CA 4ZAIA 2BUDA 3OMGA 1WTOA 4LMQD 2DAQA 1LV9A 2K1BA 2X4WA 3L2RA 2DY7A 2EKOA 2FFKB 2YRVA 1BF4A 2MWPA 4X34A 1AZPA 3UI2A 2RSNA 1DOKA 2DIQA 2Q8RE 2B2UC 2L11A 1G6ZA 1ILQA 2KECA 4ZTJA 1EIGA 1NR2A 2VXWA 3HP3A 3ZEHA 1DZ1A 4RA8A 1OI1A 4QQDA 1SSOA 4IUUA 1OZ2A 4HAEA 2QQRA 3OQ5A 3OYMA 3LGLA 3F2UA 1GUWA 3DB4A 5KE2A 1G5VA 2VYTA 3TN2A 2L4NA 3PNWC 2XK0A 1KHCA 3P7JA 2QQSA 3KBXA 2B8AA 3OYLA 3QO2A 2NLUA 4E7IA 2X6GA 1KNEA 1EOTA 3MWYW 3H91A 2NWGA 3LGFA 2LDMA 1HHVA 3L2VA 4X3SA 4OVAA 2JTFA 3S3OA 5J26A 3L42A 1WJRA 3S3NA 1WTPA 4GY5A 3MP1A 3LYIA 2RHUA 3QBYA 1CM9A 2EQMA 2GFAA 1BBXC 4BE1A 1DOMA 4CJ0B
chains in the Genus database with same CATH superfamily
1NPPA 1UUPA 1NLPC 3E9GA 3CCRT 3M0SA 1RF2D 4XTYA 3SK4A 4FP5D 4KV6A 1KSWA 3KBGA 1KHIA 4BE0A 1A2TA 2PI2E 1Y1WB 3C46A 5DY9A 4P72A 2IY5B 3KLSA 4HJ5A 1UUEA 2QI2A 3O8VA 4M77B 3VS1A 1BQQT 1SXTA 4FT4A 3VR2A 1VQ6A 1C1AA 4OWWB 1ABQA 3U23A 2LY7A 2WP8J 2VUMH 4RUGA 4LDXA 2C9OA 2GVAA 2RQVA 1PRTB 8AT1B 2E2HB 3CBMA 4KBMB 2EIFA 2F3VA 4LXCA 2PW5A 1K73U 1M1KU 4J1MA 4AFZC 3C4SA 5NUCA 4FW2A 1IBKQ 3PGZA 1G91A 3VV0A 1Q82U 1LTRD 4XQJA 2UXDQ 2FPDA 2IJ0A 1D1CA 4J8OA 2R58A 3QZ9B 3HRSA 4RTWA 2RJEA 3H8ZA 3A8IE 3ONAB 2L3RA 4HCEA 4DNTB 3BYTB 4N8X1 4GZYC 2VXEA 2HSPA 1IXRA 2LMCB 1GXIE 3IFTA 2KT8A 4M78D 1F2YA 7AT1B 1W6XA 4LD6A 1U4MA 4JJNK 1YI2A 2F1MA 3NQTA 2HDMA 1EFID 4IPDA 3SEMA 3OW2S 2UXCL 2JUFA 1MHWC 2N49A 1JE4A 1HXYD 3JRZA 3FMCA 1VQPT 2NVTB 1QP3A 4YY3L 3KFVA 1YHQQ 1CZGA 1X6OA 3GPLA 1M90C 1NLOC 1VQMA 5AJ3Q 4JI4Q 2F2VA 2MOXA 4X1VA 3NBIA 1X9NA 1S3OA 4LAAA 1K76A 1QVFS 1PMRA 5CIUA 5M5WH 5KYUB 4DUZQ 5IWAL 3HL8A 1WOCA 1K83B 2M16A 1HA6A 5M3FH 4E7LA 4P5NA 4KK7A 3OMCA 3DWAA 3NPPA 1NJIR 4C8QC 5IOCA 3RLNA 2KVQG 2A6HD 4A93H 1PRTC 3MVVA 1I6HH 4C92F 2DNUA 2MK5A 3OA6A 1E24A 1Y14B 1T3LA 3O13A 3QB3A 1H3HA 1EFWA 2LJ3A 1IO6A 4M77G 3X28B 4E7SA 4OMNA 4XTXA 1WVLA 5LMNW 1VQHA 4C5HA 2K5HA 1FNUA 4R8IA 3H3VC 2D0QB 3M9BA 1MV0B 3RZDH 2H5XA 2JJ9A 3SE0A 2F0EA 1LCKA 1CHPD 4HKEA 3RMSA 2CWAA 1PFNA 5TSSA 3TQYA 4F16A 1RAHB 1H9MA 3T1YL 2BDOA 1K0RA 2CQAA 2GGRA 2E5KA 4M77A 3CCVA 2NVYB 4LFBL 2RNAA 2QG9B 3OBYA 1HTLD 5IP7H 3EQLC 2R93B 4JI2Q 1EZZB 2J4XA 2CW0C 1HTPA 3OW2A 3O5ZA 3G6EQ 2MPMA 5T1GA 5M3MH 4A3KG 1WA7A 1SYFA 3R3OA 4DPGA 1YNXA 4JI3L 5JJZA 4JBMA 1RAFB 2K2VA 4X9DA 1M8MA 1G51A 4NXMQ 3CQTA 1GCPA 1R77A 3E2UA 2D8JA 3RR6A 2F5KA 2F1LA 1SE4A 2E4HA 3GF5A 4J9EA 4C92B 4JI1Q 2JXMB 3HFNA 2L15A 3T4AC 1UAPA 5KEEA 3J81L 2V8IA 1VDZA 1QILA 1KJWA 4DR4L 1M8VA 1WFQA 5D7UA 5ISRA 4IALA 3WXMB 1QQJA 2KCCA 4JOIC 4L6TB 1J5EL 1GUTA 4NS5A 5L8RE 2EYMA 1X54A 5E1FA 2AWOA 3S2DB 1PNJA 4GN3B 4FCYA 2NYZD 2Q8TA 2YYZA 2OWOA 1B2TA 4M75E 2M9VA 4X66L 1RLPC 4VUBA 4IFDI 2MHVA 2NB0A 4A93G 2EQKA 3HRTA 3G71T 5IGFA 4HVUA 2B2WC 5KGUA 5E4WC 2DLPA 2Z6BA 3ND9A 1BKBA 5AYFA 2AZSA 2QASA 2KYMA 2KOLA 3VR6A 3EFRA 3K58A 4K2LA 2OF1A 2RH2A 3JCMW 4R8NA 1GUSA 3QOLA 4PMWA 3BVZA 2M9UA 3S3MA 5AT1B 4YCVA 2EXDA 4MTKA 1TS3A 4QVCA 2F3WA 3R2TA 1ICFB 2V8KA 4XU2A 3L2WA 2B63B 1LPLA 1UFFA 4DR5Q 1N33L 3H09A 2O2LD 1FYNA 1SNQA 3A8GB 2D8HA 1I50B 5JEAH 4FIBA 5HKCA 1YNJC 3DMUA 4G4KA 1Z9FA 1ILPA 3CQZB 2K5DA 1JJ2P 4TSSA 5C4HA 1HD3A 3TSWA 2FZKB 1XMQL 4M78C 1Y1WH 2L3QA 1OULA 5GMKj 2KI7A 1KNAA 1TWAB 3R8BA 4M78E 1WTRA 2VB3X 1HZBA 4IN3A 2DRMA 2DMOA 4JYAL 4K8IA 3S1QB 2NZ1D 2A28A 3JAML 3HRZC 2EJGA 4RCOA 1SFOB 1OXTA 3RZOH 2CS7A 4K5XA 3A5ZB 2LP5A 3CC2Q 2QCPX 1UB4A 1X43A 3BDOA 4DAYB 2KQWA 3EH2A 4ME3A 3PIOA 1RCVD 2ICEC 1HSQA 3HOVB 5LHY1 3I4NB 1M4VA 3PFSA 2IIMA 5HCKA 2BA0A 2GFUA 4MHEA 1HR0Q 3EGUA 2K57A 4A53A 1LNXA 2K5WA 4FXKC 5IHNA 4AFUC 1SE3A 1U4LA 2KVMA 4ZUIA 3HPWA 3GNFB 2OCEA 1KFZA 2TSSA 1EEFD 4X66Q 4WF2A 3ZL7C 4EMKC 2E2DC 2R7DA 2RHQB 3ERSX 4OL7A 5KIXA 4M75C 2F0FA 3RLFA 2NUPA 4J9IA 2L9HA 4PFPA 4IUPA 1SRLA 1XPUA 4QQBX 3GV3A 3CCMQ 4JI2L 2O31A 1W2BS 2FJ2A 2NVQB 1BCPB 4JBJA 2EJGC 5JAVA 3URGA 1JOOA 2CUDA 3A0JA 2CVRA 1AN8A 3FRPB 2FHTA 4ATOA 4HIKA 3LLRA 1JEGA 1JORA 4A3CG 4L8JA 4BY7G 2GQVA 4RCNA 4P74A 3GDEA 5IYCH 1V29B 4CC7A 3CCEA 1GBRA 3KF6B 1VQ5Q 4QGUA 3JB9G 4M7AG 3ERQA 3PCOB 3IKJA 1WTPA 4POGA 5IY0A 3MXGA 5KNDA 3ZFJA 1GUGA 2X35A 1VQDA 2ZPEB 3I4NG 2FG0A 3VUZA 2XD0A 3A8KE 4KY5A 3K5LA 1JQQA 2EYHA 4Y7NH 3CXCP 3E1SA 4IJLA 2VQEL 1N9WA 1W3SA 2K9GA 4LUZA 1AEXA 1LTTD 3T1YQ 4K0KQ 2YXYA 3CC2A 4C3IG 1JU5C 1DGSA 2LQWA 1XWEA 2JP1A 3DEPA 2XRSD 5CVIA 3ND8A 4A3JG 5EAYA 2KE9A 4N4GA 4DUZL 2XDBA 2P84A 2XMFA 2R93G 3I56T 3RN5A 1HFGA 1K8AU 1STEA 4JI4L 1D2BA 1WQWA 3OYKA 1VQ9Q 3VS3A 3K0XA 3OS2A 3CCJQ 3OTOL 2E6NA 1D5ZC 4HJ7A 1I94L 2YUOA 3I4LA 1Y1VH 4HR7B 3JCMf 2MPXC 4ZKCB 3EGXB 4OB1B 4EPCA 3I4MB 1VUBA 1TS4A 1JBMA 2IG0A 3MFYA 1QLYA 2RF0A 1NE3A 2VGMA 4NOYA 4LDUA 1JJGA 1OV3A 1PKSA 1HRJA 1XTDA 4C0ZA 1TWGB 3H15A 2O4XB 2CQOA 2F0JA 1N9SA 2IHEA 5GJVB 2WAQG 2ZPBB 4Z02A 2LZ6B 2LQ8A 5GMKl 1VQGA 5GAOn 4P2CB 1O9SA 1D5XC 1B53A 2CFMA 5COYA 2UXDL 1JJ2S 4C8QD 1C0MA 1CT1D 2F0UA 4M7AC 3MXNA 2M51A 4A3JB 3HFZB 1SHGA 1ZA2B 2CCZA 1O7LA 3ZBDA 2HQHA 5T1IA 1F9QA 4OMMA 1WHLA 2E65A 1EEID 5A0LA 1HUMA 1LT5D 3A74A 1M8AA 3WOFA 4ZGEB 4KN4C 3GTMH 3D0FA 4C8QE 3I9QA 2PVDB 3IL8A 1WQ7A 2DD5A 3FKIG 3G71A 1PYSB 2Z1CA 4IFDJ 5FLXE 3CXCS 4IFDH 2K14A 1STAA 5C44G 1W1FA 1W4SA 1UNSA 3MAQA 4LF5Q 1Y8NB 3K81C 4LDYA 3Q22A 3TVTA 4KKTA 1Y96A 4FF4A 4IQZA 5C4JH 3UT1A 4PLIA 3VR4A 1PLFA 1WDXA 1EIHA 3G1JA 2EWNA 3MKDA 4IJHA 2JA9A 2DYBA 5IYDH 2FHDA 3EHRA 3KFUA 1STNA 2RHSB 3C95A 5CQXA 2RDGA 4A3MB 5GAN5 3OOCA 1DD2A 2KCTA 5ELNA 2UU9L 3AEVA 4BB7A 1YJNT 1LM0A 2EE1A 4DV0L 2DJGC 5C3EB 1X3PA 3A8MB 4XT1B 1FJGL 2RDHA 4PG3A 3S2HB 2N55A 1RI9A 1B34A 2L89A 2D1XA 5I9OA 1TS9A 3KUPA 4XYOA 1EFNA 3I35A 3R6OA 3E19A 4JJBA 1KDCA 2CZ6B 2Z0SA 3TSZA 2HZYA 1G2TA 2OAUA 5GAOl 4XU3A 2JA7H 4HIDA 5EJWA 2FMCA 3THKA 5GMKi 2K3BA 1AEYA 2CZ7B 1TSFA 2QA4Q 4B3TQ 2F0QA 4IZ8A 2A0FB 1BCPC 2YV5A 4L5QA 5G3LF 2PQAB 3EGDB 3AQQA 4CC2A 4J6HA 1KIKA 2ZM6Q 1ACMB 5GANf 5C4ZA 3F2DA 3U58A 1YJNQ 4X6AH 3VS5A 1TUDA 4JLGA 4DV7L 1D5MC 3QIAA 3GTLB 1FXXA 2R5AA 2I2LA 3RMQA 3OYHA 1GXDC 3FPPA 5C0XH 1QCOA 1U4RA 2LC4A 2AWNA 5CV6A 2RHIA 5CCAA 4KUDK 3NENA 4A3FG 1LLRD 1VQMQ 4L59A 2RCNA 1SRMA 2IWHA 5C4XB 4N9PA 5JPMC 2EOTA 3HHTB 2JE6I 2J06A 4L5SA 2EVBA 1I4K1 1VA7A 1EYDA 1K28A 2MI6A 1M90U 4M78G 1KLUD 5JVG3 5JEAJ 3DXJC 2LXKA 4ZLTF 4QUFA 2GTJA 3KXTA 6AT1B 2Y0SB 1QVFP 4C8QG 2BA1A 3CRLC 1JC7A 5LJ3h 3HZXA 3PUWA 4PQXA 1II3A 1SYCA 4OGQC 5EKIA 2WFWA 3P8HA 4M7DE 1NR4A 3X24B 4X3TA 5GAN6 1YVCA 3HOWG 3I4MH 1GJXA 1ENAA 4F7XA 2KR3A 2GQIA 2IHFA 4J6XA 1Z6HA 3HOUB 2NTTA 2BE9B 1KXLA 3K59A 3I3CA 5CC4A 2BTTA 4D8KA 2EZVA 4A93B 2JMAA 1CTMA 1Q8KA 1LTGD 1LV9A 3GO5A 2AQ1B 2WV6D 4WFN3 1WHHA 5EG2A 1A8VA 2LKVA 4ILWA 1FVIA 1PZID 4N9TA 4FVMA 2JT4A 4M7DB 2IT1A 4JRPA 4ODGA 3DWPA 1T0JA 5FJ8H 3TS0A 2C0TA 3MHXA 2L5TA 1AD5A 2DK3A 1ZUUA 2MWPA 4X34A 5CO7A 3RKWA 5GAOr 4X65L 2DX1A 3E0JA 1VQ6Q 1DOKA 3NK9A 1K73R 1M1KR 2CREA 2RN8A 2DETA 3JCMJ 2W0ZA 1I3QH 2KECA 1KK7A 1EIGA 2LS01 5FLXc 1E2WA 5A2QL 4XU0A 4YWLA 3ZEHA 5BN4A 3ULJA 4FT2A 3K8AA 3UDGA 2HBWA 1STHA 5I6YA 4DOWA 1WHKA 2ZAEA 4CBVA 1Q81U 1V1PB 4UHVA 1YHQA 3J80L 1OI1A 4E47A 1QCBD 2K5LA 1GHJA 2EJMA 4IUUA 1KABA 3BZDB 1ENCA 1XTCD 5GAEC 1MMNA 2PTKA 3OYMA 4C3JG 3LGLA 1GUWA 2CP7A 1X75C 5KE2A 1YJWQ 2DN8A 2D0OA 3TN2A 2F5TX 5I6WA 3L2ZA 5KNBA 3GTOH 3TS2A 2JQOA 3VUBA 4NP5A 2HKNA 5GAMh 3KBXA 2XNAC 1TWAH 4O5VA 1I81A 1PSFA 2RA2A 2VV5A 3OYLA 2XSCA 2MF2A 2NLUA 4E7IA 2X6GA 1KNEA 3QO2A 4EQOA 3HOYG 3NMZC 3GTGB 1AT1B 3MWYW 3V2TA 2ASBA 1SYEA 2A6ED 4E7ZA 3JB9F 4M7AF 3M55A 1HHVA 4A63B 4QB4A 3SEBA 2J7IA 2DE0X 5ELDA 3NGPA 2D0PA 5IYCG 1WLPB 2KXCA 3LNNA 1WI7A 3A8LB 4LFAQ 1H95A 1ZQ1A 2DL7A 2EYJA 2JTFA 3S3OA 4MIUA 2AKKA 1SNCA 3BDUA 4FF1A 4X64L 3GD7A 3LGJA 1X3FA 4DUYQ 4M75F 9ATCB 5KYYA 1U5SA 1YZ6A 1K8OA 3MP1A 1IGUA 3J7AF 2F4IA 4I7ZC 2E2IB 4GN5A 4CKBA 2D0NA 2OX7A 2DERA 1CM9A 3ER0A 4C2MH 2PVGB 2YWWA 1D6EC 1PA6A 1V76A 1O75A 3GTLH 2ESWA 2K5IA 5C44B 2P5ZX 3JAMc 3S2DH 1QVPA 1O7YA 4J9CA 2JZ2A 1H9SA 4DBFA 3FC3A 4IUVA 3Q23A 4NW2A 3HOVG 1LJOA 2ALYB 5I2XA 1I4HA 4X9CA 3KF8A 4RG2A 2F4VQ 4KULA 4N4HA 1S72Q 4HCBA 1F2LA 2OQ0A 3AFQA 1PTOC 1Z9ZA 4QCLA 4FF2A 3EHQA 1HFNA 1RL2A 3FJ5A 2UUCL 2F0TA 1DXMA 1FGUA 1HCZA 5CR3A 5KYYB 1CKNA 1EY7A 1JRIA 2K32A 2KYBA 2XIDA 4IPGA 5C3EH 5EPLA 2N78A 3CCMA 2JS0A 5KYWB 3KDFA 1VQ7Q 1O78A 3D4WA 1OTCA 4OHJA 3ULLA 3CRKC 2HKQB 1ML0D 5GANe 4BD3A 3BU2A 1PTOH 4DR7L 2R7ZH 3GTOB 4RG8A 3HOYB 2E2JH 2KJXA 3CHBD 3VR5A 4KN7C 1I07A 3MEUA 3UDFA 4M78A 3J81j 3ME9A 2HQEA 2QQAA 1G291 1HNWQ 3M58A 3TCJA 2HCKA 1VMCA 1ENFA 1DONA 4F17A 3VS4A 2GNCA 1GKHA 3MZ5A 4CJ1B 1F77A 4F87A 4KGZB 2BIVA 4A3EH 1WTQA 2PUOB 2A73B 4YCUA 1N9RA 2QYZA 4M7DC 3E0EA 3QR8A 3M85A 1EUJA 2DTIA 1WJJA 1S5FD 4OF1A 4F7UG 4A3MG 5C0MA 4CHTB 2NBFA 1PH4A 3GTJB 2PI2A 2K05A 2E2IH 3LX7A 3BDLA 3JSCA 4RKUE 4BY6B 1YITQ 2Q2UA 3S15H 2E3IA 3EFOA 3JB9H 1D7QA 4ESRA 1VQNT 4O0AA 3OYAA 2N88A 2GA4B 3GTPB 1TG0A 5KYXB 2FPEA 1NJIU 2AQ2B 1EQVA 1AW7A 2RKSA 1K9AA 1M1FA 1VQNQ 1ZYRC 4GNXA 2GVBA 3S1RB 1R9TH 1QWYA 2F4VL 1U3OA 1M4ZA 3JCMh 5GAMd 2DD4A 4QKUA 1JWSD 4PJOF 4X64Q 1M90R 4DOVA 4MN3A 3TP8A 1B3QA 2OTJQ 2GCXA 1VQ8A 2COWA 4O1NA 2SOBA 2KRMA 4FYYB 1Q82R 1RIPA 2JTEA 4HCCA 1K8AC 1OXVA 1S5CD 2KHSA 1PD1A 5C4XH 3WVEB 1Y1VG 4E6IA 4DAYA 2JA8H 4QL5A 3F2CA 5IP9H 4NDXA 1RUWA 2RK2A 3V8JA 2E10A 1FWZA 1BU1A 1HUNA 4QF4A 1FYCA 2M00A 1YWOA 1YJ9Q 5L37A 3MTSA 1E22A 4AYBB 2P0KA 1TVXA 1BR9A 3FDTA 3LX0A 2AKWB 2F0SA 3A7LA 1VQAA 3PVLA 3EFXD 4MZ9A 2HAXA 2R92G 1TOVA 2B86A 3CC4A 4ZK9B 4RGTA 4A3FH 1KRSA 2IX1A 4C0DB 1RAIB 2EBPA 4A3JH 1HR0L 2NN6G 1NZ9A 3I4MG 3CCUT 1X3QA 5CKDA 2ZPIB 4BDYA 3STBC 5LJ5e 5IT9c 4UDUC 3RMHA 1IL2A 4OO1H 4F14A 3FEOA 1FNWA 3KDFB 1X2QA 2F0LA 2SEBD 3JB9I 3CC7Q 4GKKQ 2B2VA 3M4OB 4DAMA 1Y57A 2J0TD 4CJ2C 1A3VA 2H1EA 1DM0B 4GOPC 1EWIA 2L2PA 5LMNL 4IOAA 1QWFA 1BO0A 1WCMB 1LT4D 3PO2H 4KUIA 1R4PB 1PFMA 4L63B 1S72T 2ZTCA 1FX7A 3RBBB 1S5DD 1N36L 4UY8C 4XK8E 2JS2A 2L1BA 2MFIA 1MD2D 2NVQH 1ZSGA 3JAMi 4BACA 1BDOA 2VKNA 4DEYA 2F0IA 4MTNA 4A3FB 2G9HD 1N34Q 4HVWA 3JV3A 4CC4B 2P0QA 2O88A 1LTAD 1S4ZA 1STGA 2A69C 2E41A 1WJSA 1KAWA 3WDNA 5I11A 1UWVA 1NYFA 1B9MA 1VQEA 2EPBA 3M7GA 4NXNQ 2IPKD 3CCUQ 3ICEA 1BVSA 1WTHA 3RESA 1N33Q 4AFQC 3NTIA 3JCMd 4G7HC 4OXPA 4HMIA 4LUEA 1XX8A 5FU7B 2EYFA 4KKUA 5GANj 4AIMA 4Y7NB 2ZXPA 5GAMj 2RVLA 4EQPA 1VQ9T 3EFOB 2XRQD 3HOUH 4ALPA 1Q82C 4C3IB 3L2QA 1K8MA 1G83A 2MCNA 4J5YA 1U4PA 5JVH3 1YIJA 4R4IA 4DN4M 4JG2A 1XNIA 3M53A 4GS3A 2K5FA 4J8QA 4HIMA 2KRSA 2KT1A 2FO0A 2CDTA 1SSHA 3MEVA 4C0GA 4C2MB 2RHYA 5DM63 2VGNA 1UEBA 4C3JH 2I5LX 1PD0A 4XTWA 5FU6C 1O7IA 4OMPA 4DQ2A 1MNDA 5IP9G 1NY4A 5M3MB 3K5OA 4M7DA 1PVOA 5KYUA 4MDWA 2CT4A 4PL6A 4HXJA 2DPPB 2WB1G 1I50H 3GTKB 3S1NB 2RI2A 4ULLA 2CSQA 1IREB 4QW2A 1R8OB 1CUKA 2EAYA 3QZ5B 4ANJA 1SNPA 2VW9A 3H0GG 3J81i 4MNOA 3Q24A 2MNAA 1PFBA 5HURA 3DLMA 1ZX6A 4WTOB 1QP2A 3A98A 1BOSA 1NYGA 1L2FA 2K52A 1QVCA 1IHZA 5FRMA 5BN3A 5IAYA 1PZJD 4CKCA 2G6FX 1VF7A 2RCFA 1U1TA 2NVXB 4K14A 2RO0A 2XI9A 3TEEA 5I21A 3M0UA 3I7FA 5IT9L 2M0YA 1E6GA 2DXCA 1SYGA 2ENBA 3G6JB 3H94A 2GF7A 4FYVB 3NWTA 4C1NK 4DV7Q 2WSFE 3M0PA 1AZQA 4LF6L 1JXMA 1ZUYA 3QYHB 1ESRA 1MSGA 2KMTA 1H9SB 2AHJB 2AUJD 2I07B 4C3HH 3CC4Q 2ZXRA 1U06A 1HNXQ 3I56A 1YP5A 4LF4Q 5C0XI 1FMVA 2LQNA 3LWIA 2DY8A 3EGXA 4ZTFA 2I46A 4KH0B 1HH2P 2JA6B 1E0BA 3LWHA 1CSPA 4PJLA 1I5OB 4RMFA 3DM3A 3SXHA 1CSQA 1MGSA 3CU7A 3GP7A 1F9RA 1QCNA 2EYYA 2K03A 2E3HA 4PMCA 4UC4A 4GOPB 1LABA 3S1MB 2XGTA 1PTOB 3IQLA 3QSUA 4KI0A 1F9SA 3J81c 4DBRA 2KRNA 3L3OC 2YU9H 4IIOA 2OTJA 1P92A 3I55Q 5IYBH 5FLXL 4FL6A 2I0NA 2EPDA 3JCMX 1X3GA 4XDXA 1VQ8T 1TH7A 1J3TA 5KNCA 2LX7A 5AJ3L 2DBKA 2I5HA 1NEGA 5ELCA 3D6WA 1FD7D 3V96A 1AP0A 1LVKA 4WJWA 2O9VA 1LT3D 2HEQA 5HK0A 2EQUA 4PNYA 2BZ8A 3HP9A 3MXUA 2GTOA 3MP8A 2M2LA 1A6XA 1NAPA 2AMCB 4J83A 2HDLA 1Q81C 1PKTA 3E6ZX 3QOJA 4M77C 2EJFA 1SNOA 2PNHA 1XJVA 5CBAE 2BE5C 1RLQC 1OX9A 1ZEQX 2IW3A 4QJFA 1AFPA 3K7AB 1WGSA 2M1HA 4E7HA 3TRZA 4LF5L 3H0IA 5GMKm 4P73A 3I4NH 3S16B 2H8HA 3A54A 4JI8Q 4HCSA 4R0KA 1GRIA 4A3IB 1QVGP 1TTHB 1IYUA 2K28A 1RADB 3A55A 4JBKA 1BB9A 1I4QA 5ELEA 3EJIA 5EKLA 1VQ7A 2WINB 1CKMA 1JB0E 3A8JE 3K6OA 1R0BG 1TY2A 4O2DA 3QIIA 1XNRQ 1WZOA 2BKDN 1EY0A 1SF9A 4LK1C 2MMPA 2K33A 5IHKA 1D0YA 1PH1A 3AMUA 1Q8IA 4IPHA 3MEAA 5CV9A 1JOQA 3OTOQ 2KBNA 1HQRD 2O2OA 3PMTA 1CKBA 3D4DA 5CBEE 2A36A 2A3LA 3EG2A 2WB1B 2CUBA 4PFZA 3S16H 3LH0A 2DXTA 2Z6KA 1HZAA 3UA7A 2AIRB 2Y0SG 4CRIA 2A74C 1UHCA 3HKSA 2H4OA 1PYWD 5ECAA 4PJOE 2UXBL 3M4PA 2YHTA 4XTZA 3MEFA 4PJOC 5D3DA 2ZT9C 2PZUA 3SVMA 1MUZA 2CP2A 4BY6C 2LQKA 1E6HA 2B63H 4EX5A 1MNEA 4DNIA 3QUIA 2CKZB 2QDYB 1LTBD 4A4EA 3NUCA 3MP6A 3I73A 4IUQA 3HGBA 1AZGB 1XJWB 3DWQA 1EL0A 1GM5A 2ROTA 3HRUA 5FRNA 4LF6Q 2YTXA 5AFWA 4K0KL 5CORA 1EWHA 4KLKA 1S5ED 3OY9A 5IODA 4FSXA 1CKAA 4OB2B 3PO2B 5GAN8 2HQXA 1L1OA 2E75C 4XXEA 4UP9A 2B2TC 5KYXA 1XNQL 1I3QB 4BUGA 3NPFA 4A3BH 3BW1A 3HS0C 3T1HQ 4CDEC 3TQ7P 3I56Q 2F0PA 3CAMA 3T16A 5BN5A 1I6HB 4KHZA 2E6ZA 1VQLQ 5DNFA 2R7FA 4QVZA 4DK6C 4BE2A 2D9UA 2K5VA 1HZCA 1GFCA 3GTQH 1C8CA 3N6RA 5EBDA 4HSPA 4NPSA 4DA4A 2BDNA 3EA6A 2WAQE 1X01A 3EIVA 3MO8A 4F7UA 4XQNA 1O80A 1N32L 5FJ8G 1MMDA 2R3ZA 5DLOA 5EQ0A 2YT6A 2LMJA 4C5EA 2B2YA 5KE3A 1EZ6A 2QEJC 3QJYA 4FDBA 2B3GA 1WJQA 3PIP3 3KJOA 2HCCA 4FYXB 1XYIA 2AT1B 2DNCA 4A3BG 3QWXX 4JYAQ 2F0VA 3UPUA 1D3BA 3VYRA 3E5SA 1AOJA 1W2BP 4RWSC 2B8GA 2ATCB 1PYBA 2C35B 1STBA 3C12A 3M0QA 2NUPB 4XTUA 3QWNA 4R9WA 2JA7G 1AH9A 4KMUC 3NP8A 1VCIA 1UE5A 3VJPA 3BDCA 3TZUA 2VUMG 3F70A 3JCMc 3X26B 2V8JA 3IAYA 3RUZA 3BJUA 1PFSA 1K1ZA 4J9HA 2DAQA 2E2JB 3A7AB 3L2RA 4ZCKA 3X3MA 4BXXG 2P4TA 5IGDA 1YIJQ 5LJ5g 2KENA 5EBCA 4NXNL 4YHHQ 1Y96B 2N3SA 1BK2A 1CKOA 5C0XG 1QVGS 5GAOm 3PTAA 2YUNA 1OO9B 1UGSB 2A08A 3KF8B 3J7AV 1M2OA 1UHFA 3UI2A 2XDDA 1ARKA 2Q8RE 2NZHA 1M3CA 2Q8IB 2R93H 1PH3A 2BOSA 1PV4A 4QY7A 2VB6A 4ZTJA 1NR2A 3U4VA 2L3SA 3CCRQ 2C5CA 3HP3A 3CCUA 2JXBA 4KRTA 3H6MA 4DR5L 2XWBB 2JA7B 3SK8A 4ZQ3A 1QW1A 1C48A 5LMNQ 4YIJA 2FRYA 1ZUKA 1Z7TA 5C4JB 4QQDA 1UE9A 1SSOA 3CXCA 1J5EQ 2RF4A 1T0HA 4UP8A 2JSOA 2DTHA 4MZMA 2DJFC 4GKKL 3KLSX 4HAEA 3SWNA 1W70A 2QQRA 3FIFA 5LL6X 4M4ZA 5LMUQ 2QGFB 1KQ1A 1SEBD 4B3MQ 4A3LH 1G5VA 4C3JB 4LFCL 4BBRH 1PWTA 1V43A 3S24A 3KOJA 4IIMA 2L4NA 5C0XJ 3PF5A 4C8QF 1YJNA 1SR3A 4JW0A 2XK0A 4AG1C 2K7AA 2QQSA 2R7ZB 2L55A 5C4XG 2E64A 2ATWA 4OMOA 3PUVA 1Y69U 1VIFA 1EQRA 1LTLA 3H91A 2NWGA 2RQWA 3KJPA 5CR2A 3LGFA 4K5VA 4Z89A 4M1UB 1ET9A 2JN4A 4N0AC 3MPUB 2EYOA 1X2KA 2L3PA 1QCFA 4XU1A 3UA6A 2XHCA 4X3SA 1YITT 5FO9B 4OVAA 1GL5A 2A1AA 4UP7A 4RKLA 4NXML 4NKLA 2LCLA 1NJIC 1SROA 1B8AA 4RTVA 4CDCC 3A5UA 4A3CH 5J26A 3CCST 4OO1I 2E70A 4ZN3A 2DZ9A 4FSSA 4RCCA 3JCMb 1UEAB 1CK1A 5HGQA 1SEMA 1SN8A 5IGBA 2F03A 2ED0A 1XNQQ 1TQOA 1FNVA 1Q1EA 2ZTDA 4C1NI 3PSIA 3PO3G 2GFAA 5KYIA 3S15B 4BE1A 2EYQA 1CQFA 1DOMA 2A68D 4EVOA 1MKHA 4CJ0B 3C1FA 4NL3A 3NEMA 2DL3A 1SG5A 5GANg 4J15A 4NL2A 5D6XA 1TWHB 5E3FA 1K83H 3META 4PJNA 4FNFA 4M78B 1Y8PB 1G2SA 1JT8A 1HR0W 1PH6A 4OELB 1WI5A 2YUQA 1VQCA 3EVQA 2EQJA 3HOZB 1B07A 2P0PA 4XIGS 3PIPA 1C0AA 2RD1A 1EY4A 4H13C 3FPUB 5EPJA 4YY3Q 5GAHC 4HJ9A 1GO3E 2EY1A 5LJ3e 1CQVA 1D1KA 1UJ0A 3OWEB 1UECA 3J80i 3W2DA 4DEXA 2A69D 2UXBQ 5IGCA 1D1IA 1TS2A 3ASKA 2EGAA 3P8DA 3NQIA 3CCVT 2PNIA 4LD9K 2HD3A 1O7ZA 4PZ6A 3PO3H 4J9FA 2CZ0B 2QK0A 4C5IA 4IKFA 2A6EC 4CDFC 1NSNS 4ZYSA 4ORZA 4XQ3A 1ZSZA 1SMYC 3NELA 4AYBG 1RAEB 1ZBJA 2MAMA 1Y71A 4IPCA 2Q2IA 2SNMA 4U68A 3VRZA 3M56A 3LH5A 2CP6A 5CV4A 2E5QA 2K75A 2K4YA 3KUFA 2G5DA 4HT9A 2ROLA 4ZUJA 3S9WA 5IHIA 3S14H 3H0HA 5CQYA 3CW2C 3HOZH 1B9NA 1IKMA 1YBYA 3KF6A 4C56C 3M4OH 1HNWL 3H0FA 3QJ6A 3E9IA 2JA6G 1H8KA 1FR3A 1PTOD 4BDZA 2EGEA 1HXDA 4E6RA 1NCVA 2D6FA 1YHAA 4P75A 2R6GA 3MHBA 1BNZA 4AT1B 3CMAQ 4JI5Q 1EY5A 4DBHA 3FKIH 1NPRA 2C06A 3R6NA 5JPNC 2JA6H 2IX3A 4AYBE 3P75A 2OT2A 2D2CC 1NBEB 3OYNA 3H9NA 1PHTA 1IHWA 1Q3LA 2PNRC 4IO9A 4AQYL 2A68C 2OTLQ 1Q1BA 1SHFA 3RZDB 2CH4W 1X32A 1OU9A 4BBSH 5GAN3 4BBRB 4A3GH 1HPCA 1TT2A 4DAVA 4Y91A 1OYXA 1V1QA 4DUYL 4XT3B 3TZDA 4DV2Q 3CD6Q 1ESFA 2PZTA 5GMKe 3PUZA 1JO8A 3P20A 1WD1A 2V1QA 2EYXA 4KT0E 3VA5A 4GLXA 1SSFA 4Y92A 4LFAL 1S1NA 1VQIA 4F7UF 3NBHA 2QQBA 4OB0B 3L2PA 1QZGA 4L5RC 1Y1VB 2UUAQ 3ULRB 2DGYA 1PXUA 4CGYB 1AE3A 3FRNA 2K6AA 2DEUA 4QT7A 2PCFB 3OW7A 1WXUA 5GAOp 2ECZA 1IB8A 1SLJA 3CCSQ 3F2BA 3S1QH 2X69A 1K4US 1VQ4A 1VQJA 5A35A 1BI2A 2CWPA 1IZ6A 4KGXB 4OMQA 3LW5E 3CMAA 4H02A 3CF5A 4DR3Q 2ENMA 2PZ1A 3Q1JA 1HNXL 3PUYA 2HNIA 3OPOA 3NE5B 3PV0A 1VYTA 5CAIA 3BYYB 4L5GA 1H3ZA 1SJED 1W6JA 1X27A 4O42A 2NVTH 4BXXH 4B9WA 4JI7L 4CDDC 2OI3A 1Q46A 1ZSZB 3VS7A 1A2UA 1SBBB 1IGQA 2F0OA 1IBML 1BUVT 3S14B 5D65A 2H3JA 3GBQA 1LOJA 2QTVA 2RSOA 3D6CA 3HG9A 4DV1L 1VQMT 1M3BA 1TXYA 1EQQA 3JCMe 1K9MR 5KH6A 3BG3A 1SE8A 5IXFA 1UE6A 1AE2A 2ES2A 2L12A 2I5MX 4A3GG 1HQMC 4LWCA 4BY1H 2MUYA 2VASA 1ZYRD 4ME5A 1LYLA 3BFMA 4EQ5A 4JV5L 2VWFA 1X6GA 1FL0A 5J39A 2OEOA 4IURA 2DYIA 2X3WD 5I2MA 1U5KA 4TVAB 4QUCA 1Q81R 5K36H 4EMGA 2RJFA 1K0SA 3RD4A 1N8RU 3ZYYX 4RAUC 3QKJA 3I90A 1NE8A 1TY0A 1ZBXA 3RR5A 4DR6Q 4I65A 5FLMH 4LUDA 2F0WA 1J6QA 2KA7A 3D31A 3QYGB 1PH7A 3I55A 2MIOA 3HEJA 1WCMH 2X6LA 4M75G 2JNGA 1OX8A 1K3RA 2C0IA 4YWMA 5GAMg 1UTIA 2ICIA 5CV7A 4BA2I 2YTYA 4ZGDB 1X65A 1XMOQ 1EY6A 5D14A 4OGEA 2FL7A 4R4OA 3BVGA 1OEBA 2NWMA 2V4DA 3AT1B 3GTMB 1GD7A 1YN8A 3KLRA 5A2QE 3BZCA 2R92B 2DVEA 4BWGB 3EBEA 2DTOA 3CCLT 1JWUD 2RQTA 2E74C 4KHPQ 3I2ZA 3UDCA 2QTXA 3I72A 4Q5WA 1W2BA 4A3LG 2Z8LA 1ZA1B 5BR8L 2MGSA 4X3KA 1MSHA 1CHQD 3CMEA 1I1JA 4FXDA 3K7AH 4ZKBB 2DVJA 2JYOA 1WPYA 4DBQA 4PJOA 4R55A 2GBQA 1JE5A 3HOXB 1JXOA 1VF5C 1SKUB 4HVVA 3HOXG 3HOWB 5C5MA 2LXJA 2Y90A 2XN9C 5K36G 4MZPA 2QEXA 3L7ZC 1B34B 3BY7A 2BZXA 2B2UA 2Z6KC 3FEWX 4DV1Q 1N8RC 2KCMA 1BI0A 1K0XA 2LJ0A 1Y0MA 2AKLA 1HZ9A 4Z88A 3I8ZA 3NSWA 5D3IB 5C44H 4BI4A 3Q0AA 1SFOH 4PLLA 2EXZA 1WTVA 5GAN7 4JC0A 2QQ9A 1TR5A 3C94A 4BY7B 3G4ST 1CA6A 2PQWA 1M27C 3VYTA 2EGCA 1H9RA 2WB1E 4FO2A 2DL8A 4K11A 3G6EA 4ID6A 1FGBD 2KDSA 3CCRA 5IYDG 4CKEA 4B3TL 4N4IA 1MIUA 2NUTB 3TREA 2RJDA 4F8MA 3GNGA 4I7AA 1AWOA 2X9HA 4E2FB 1QJOA 4UAIA 3TDQA 4MMLA 1M30A 1LTSD 1GCQA 4K8JA 3VYUA 5I9PA 4DF7A 2UUAL 1QNUA 3GV6A 2LCCA 4PJOD 4IFDG 1I6VC 1KQSA 1UDLA 4HEDA 2XKOC 2FZCB 2HT1A 1M2VA 4BI3A 4LNPA 4DV3Q 1QKWA 4L5TA 3D4RA 2QGGA 3HOYH 1GVPA 1KQSS 4K6DA 4BA1I 3DKMA 5DM73 3C3LA 3MXPA 3U9OA 5FO8B 4DV2L 4KKSA 1VQLT 1KTKA 1R0CB 4C3HB 1N8RR 1B7YB 2EY2A 1BBWA 4J9GA 5CGKA 4GNXB 1F1BB 1F9PA 1QUQB 3BZKA 2KUMA 4GKJL 3OSSC 3TEHB 4AQYQ 4J7IA 4XTVA 3JCMP 3X20B 1HYOA 3CEYA 1A15A 2VB2X 4A3IH 2B2WA 2IVWA 3I5SA 5CKFA 1PZKD 2KEEA 4HMJA 4HTHA 2YRCA 2HD0A 2O4XA 2VC8A 3EG9A 1KD1U 2XU8A 3TP6A 4DK1A 4QQGA 5M5XH 1UE1A 3VU3C 4L6V5 1ONLA 2QEXQ 1NUCA 4MMKA 4JK1C 2A5HA 2L0AA 1M2VB 4JI5L 2CKKA 2QW7A 3OS5A 3STBD 1AWJA 2LVMA 4Z8AA 1SRUA 1X55A 3U4ZA 4PNOA 4LN2A 2QA4A 2HUGA 3JCMV 1Q90A 4U673 4PK4A 3GTPH 2LFNA 3D3RA 3N52A 3T56B 3A8OB 1OOTA 3T53B 1YHBA 2KK4A 2VY3A 2O01E 2KBTA 4JLIA 2KQ3A 1IKLA 3K0YA 5C5LA 1Q12A 4RTUA 4A3EG 4V2SA 2O5JC 1CFMA 1DJRD 3PMIA 4LF8L 3RZOB 3LWEA 4R56A 4Y28E 2CP5A 3OYGA 1EWCA 3EROA 3SWNC 3AFPA 1I4XA 3NHNA 3G7LA 3MEWA 4D6WA 2B63G 4R1JA 1RKNA 2PU9B 1JCKB 1MJCA 3QPHA 1PRLC 1BIBA 2J05A 5C6SA 2UUCQ 2HIXA 2JA5H 2HSEB 1OPLA 4OX9L 3CBPA 1VQ8Q 4RH6A 3ZJYC 1RABB 2Y4YA 1WXTA 4A4FA 1IXDA 2RA4A 2VUBA 2JVVA 4OIKA 3V7SA 4DR2Q 4II1A 2M0OA 1NMGA 4GN4B 2DEQA 1EQTA 4WRDA 3CMET 2LNHB 1TKWB 1VQNA 4TKOB 2CW0D 4LJZC 1UG1A 2RI5A 3M3YB 1TWBA 2ED1A 4JI0L 4B9XA 2G9DA 4K6LA 2FEIA 4A3MH 5K5PA 4LNQA 5M3MG 3RDVA 5JOBA 4A54A 2NUCA 3LWUA 2R5MA 3QHSA 2XTIA 5IT9E 3SGIA 3CCLQ 1SJHD 4ABNA 1VOMA 4BY1B 3S6WA 1KC8U 5M5XB 3AU7A 2JA5B 1I0CA 3H0GB 2HBPA 4Z9CB 4HIOA 1H641 4PJMA 1CA5A 4A3IG 2M02A 3EGDA 2YRDA 4PKCC 2JK8A 4R4TA 3OS0A 3M59A 4F7UB 4LFCQ 1RHPA 4A3DH 2EFIA 3I91A 2OTJT 4OWTB 5LMUL 3EAEA 4GLKA 1TWHH 3GQBA 3P8BB 4RTTA 2R61A 5F2DA 3C2PA 1OXUA 2QEXT 1V9PA 5LJ5j 4GBQA 2JA8B 2J6FA 3OYJA 3QDRB 1Q7YR 4M7DD 1Q7YC 1C4QA 4NMZA 4JDSA 5KCOA 2LNVA 4C92G 4CI0C 2JM9A 1EYCA 1SE2A 1TS5A 1B4OA 1L1OC 5CV5A 5CV8A 5IYBG 2FVUA 3FJPA 4IOCA 1OXSC 2B39A 4K2KA 1BCPD 4PFOA 1GCQC 4YTLA 5FWBA 2FRWA 1IW7D 2B2VC 4B3ML 4FF3A 1WNLA 2RMOA 2DKGA 3M54A 1B3AA 4PZ8A 1XMQQ 5A0GA 2FZGB 2GN5A 1IBLQ 1YNJD 1TXQA 4M75B 2EVRA 3G7ZA 5GJWB 5LL6S 2NN6H 4LW1A 2MJ8A 1I4RA 2DBMA 1WCMG 2TMPA 4A75A 4ZAIA 3EG3A 2BUDA 2F69A 3OMGA 1KLGD 3HOWH 4A3GB 4POFA 4LMQD 4Q5VA 2K2MA 2Y4XA 4JRKA 4O6JA 2X4WA 3OW2P 1A3UA 3TP5A 3VR3A 5M3FG 2EJFC 2EKOA 1VQOT 1PH2A 1FMWA 4C3HG 1E1TA 1K3BC 4DXFA 1F2MA 1BF4A 4A3KB 1KC8R 1XPRA 3J7ZC 1IBLL 1VQ4T 2VQFQ 4ZNXA 2R7ZG 3RLOA 3V05A 2RSNA 1K8AR 4B6MA 5KYNA 2DIQA 1V1OA 3J7YW 4JS5A 1QOHA 4OMLA 2JM8A 1UJYA 2ZZDA 2B2UC 2F0HA 3F1ZA 3JAME 1Y7XA 5CKBA 1JJCB 3M0RA 5EPKA 1VQKT 2XVSA 3V8LA 4KJOA 3M5AA 1V1PA 4HN7A 1EX4A 1L0XB 1SPKA 2V1CC 5J1ZA 1X69A 4RA8A 1DZ1A 2A19A 5KRUA 4BBSG 2PMZE 3VA7A 4RTZA 1YCSB 3Q8DA 1D09B 3PE0A 2LSSA 4M7AE 3F8TA 5ELOA 3DB4A 5J3BA 1PH5A 2PQEA 2QF7A 4XYQA 5LJ5f 4QMGA 5JJKA 3JCMQ 4AG2C 1SMYD 3A8HB 3JC66 3V7CA 2WIIB 3HKZB 1F2ZA 3TP7A 4JI3Q 1IYJB 4JRIA 2RQXA 4ELZC 2LJ1A 2FB7A 1YFNA 2DXUA 2X3XD 1D0ZA 1YNND 5LJ5d 1XXGA 1EY9A 1VYVA 3URYA 3S1MH 4J6WA 4KH1B 1JJ2A 1N32Q 2KROA 4M7DF 5FLMG 4B3SQ 1GUOA 2CP0A 3L2VA 2DILA 2E8GA 1K73C 1M1KC 4DFAA 1K8GA 1WYDA 1NMFA 5ELBA 8ATCB 1Z47A 3D7SB 1CSKA 5FU7C 1CZWA 1X56A 3BE3A 2UUBL 2A37A 2ZM6L 3S1NH 1YJ9T 2VUMB 1BCPF 3GLXA 1HJDA 4RTYA 3L42A 2RQRA 2VXFA 1WJRA 4DR2L 1PRMC 3M4GA 3M4YA 1DCZA 4GY5A 4QVDA 1G3WA 2BZYA 1Y07A 4V0BA 1FMKA 3CP0A 4DK3C 3J81E 1LT6D 5A0DA 3LYIA 1K9MU 4M7DG 1I4GA 3CD6T 2NYSA 1KAAA 1PM3A 1A0IA 3QBYA 3GTJH 4C92D 2EQMA 2ZCFB 2FPFA 2IX0A 3OWFA 4HCKA 4OWXB 3C1EA 4F88A 5IIFA 1KQ2A 4C3IH 3JCMg 4M7AA 4TVRA 4DV4L 3EG1A 4HT8A 2JJQA 4KD3A 4A3DB 2MP1A 2RK1A 1RODA 5M5WB 2YLCA 2D5DA 2LT4A 4JUVA 1DJ7B 3E9FA 3SB2A 2EYLA 2SDFA 1BYMA 4DV0Q 1VS0A 1UGVA 3CPWS 4C8QB 2F0DA 2QGQA 5FW9A 1AHJB 2WACA 4HJ8A 3PIO3 2D9TA 2PUKB 2VZAA 3WVDB 1HJPA 2JEBI 1OZ3A 5IGGA 1KD1C 5C6AA 4DV5L 1SNDA 3HFOA 5I2YA 1HK9A 5FWCA 5LJ3d 1XNRL 4KD4A 2DO3A 3H3VH 1NEBA 3VS6A 5G3LD 3GTGH 4F7UE 5IWAQ 3VS2A 3UDIA 1TU0B 3I4OA 4RCBA 1EYAA 4MDXA 1Y8OB 5KYWA 5CK9A 2IL8A 1QKXA 3GP8A 1JMCA 3UE1A 3PGGA 2Z4IA 3NXWA 4LF9L 3CBOA 3VRYA 1NTGA 2YTVA 5M9OA 3PUXA 5GROA 1B70B 4BI8B 1OPKA 5IN1A 2RI3A 3V7RA 1TWFH 2KHJA 1XOVA 2DFUA 2EKHA 3T51B 2MWOA 3WWVA 5KYLA 4AFSC 4DXGA 5GAMf 4JVZA 4B08A 4QIWE 3CCVQ 3SFMA 4DV5Q 1JB3A 4B3RQ 1BCMA 2RJCA 4A76A 1ZHIA 4M8AA 2C0OA 4KHPL 4JS4A 4WJ3M 4GOPA 4LF9Q 1JICA 1VQ7T 1SDFA 5IH2A 4JI8L 2MO0A 1XQHA 2JN0A 4JRQA 1B7TA 1PG5B 2HDAA 3OS1A 1D0XA 3RERA 1J9OA 1VQFA 2B2TA 2ABLA 2WSEE 4BS9A 1D1BA 4LUVA 3QG1A 2WKCA 1AVZC 3FLGA 4G57A 4DV4Q 3X25B 3FB9A 5CMDA 4DR3L 3DHQA 2NN6I 4KTAA 1VQLA 3VDYA 3RNJA 2KAFA 2ZJPA 4RGMA 1I94Q 3H3VI 1TIID 3PT9A 1U8RA 4EMKA 3R2IA 1D1AA 2ZTEA 1ZKOA 2F2WA 1IW7C 1M3AA 1WYXA 1ET6A 3E9HA 3J80c 1C7YA 5FO7B 2EY5A 4LF7L 4IUTA 3A56A 4LF4L 3HOZG 1NM7A 4JZ4A 2LCSA 3OYEA 4N0AA 2V1RA 3MA2B 1YNNC 1PRTD 1YITA 2L0CA 2Q2HA 4Q0FA 3WOEA 3R93A 2VQEQ 1M5Q1 2B29A 2X4XA 3CC7A 1G3TA 1I5FA 2HQLA 2BE5D 2LRQA 2Y0SE 3GIBA 4M77D 3W1BA 1ZSZC 3AYHB 5LJ3j 2AK5A 2SEMA 1WXBA 2QA4T 4A4GA 2I0QA 2R92H 3PO3B 2ZPHB 4C0DC 1C9OA 5LJ3g 1NBWA 5LJ3f 3CCET 1JB7A 2ID0A 3Q6SA 1E7ZA 3L9AX 3PF4A 2AHOB 4PJOB 4PZ7A 4A3EB 1WFWA 2HCIA 1OXXK 5IP7G 3QWYA 1YCYA 1UE7A 2UUBQ 1ICWA 5GAGC 3S17B 4M77E 4LDVA 3T13A 1YJ9A 1GUNA 4JI6Q 4E7KA 2VL6A 3W1GA 1G8XA 5EKKA 4B3SL 2YUPA 5BR8Q 4DK0A 3VYGA 1TWFB 3K80C 1MJEA 2J6OA 4RMOA 1Q7YU 5L23A 1EU3A 1EY8A 1MMGA 3SWNB 2H3EB 1BBZA 2LTOA 3QO3A 1OQKA 3H41A 4RTXA 4DAPA 5GMKh 1D8LA 3HOUG 1G6PA 5E7NA 4OB3B 1YJWT 1QG7A 1BI1A 1PTOF 2N8NA 4UPAA 2HHHQ 1TWCB 3HSBA 1BBUA 5GANh 2KEDA 3CKIB 4XQQA 2F52A 4V190 1PH8A 3SK6A 1DOLA 4LDWA 1RACB 2VQFL 2RB6A 2QAZA 4M75D 3NFCA 2Z4HA 1J8IA 3OSOA 3U50C 1UGPB 5GQOA 4DV6Q 3OYFA 3CCJA 1ASYA 1ZXTA 4S3SA 2E5LL 3CD6A 2K04A 1Y1WG 3MC0B 3CCLA 2DXBA 1VQBA 1K9MC 2K50A 1RAAB 2DL4A 2EDGA 2ZXOA 3AB9A 2QXFA 2DA9A 4GLAC 3CCEQ 2JA5G 5HY6A 2LT1A 2QDLA 2BH2A 4EMKB 3RKXA 2DUDA 3I70A 1QB5D 2J6KA 3FHWA 1T5XD 4QIWB 1S5BD 1RI0A 2DJQA 1N34L 2JW4A 4JZ3A 1YHQT 3L0OA 4JV5Q 1SYBA 1VQPQ 2Z9HA 3IFDA 5GADC 1WHMA 1W6KA 2VS1A 4JJCA 4LUOA 4GNXC 1PRTF 3RUXA 1N36Q 4OO1G 4J9BA 2O5IC 1Q86R 4KJNA 2XDPA 4C5GA 5FROA 3EG9B 4DA2A 4GLVB 4H0LC 4GLMA 3BVMA 3K5MA 4M77F 3UATA 2OTLA 4JJDA 3TBIB 5J22A 1A0NB 2HIVA 4HA8A 3CPWP 2K3XA 1VQ4Q 1QVFA 3PO2G 2CZ1B 4K5WA 2Q2TA 2CGHA 3G48A 2LX9A 2QDBA 3M4QA 1VQ6T 1C6VX 3NTHA 3G4SA 1P16A 3SHLA 3NTKA 4FU6A 2WAQB 3S1RH 4A4KA 4RGOS 1R9TB 1Q95G 3RKYA 1E3PA 1QE6A 3OB9A 3RNUA 4OEMB 3PMFA 3DUZA 3HKZE 1S72A 3HOVH 1ASZA 1STYA 3VYHB 4DR1Q 2F0NA 1MI2A 4HSVA 4DR4Q 2KHIA 3S2HH 3W3AA 2FXQA 3SD4A 1RAGB 1E1OA 5EC7A 2HL3A 4WORA 5D6YA 4JI1L 4HJAA 2ZPFB 4A4HA 2ZJRA 3OBWA 1WTWA 3OIPA 1LTID 4JI0Q 3MCAB 2R57A 1X3EA 5H1SE 2A7YA 1M9SA 4PJOG 4C92E 3FVQA 1UGRB 3VYSA 2NVXH 3L2UA 2NUZA 1QUQA 2CHBD 4IUNA 1VMPA 2PQAA 4PMBA 2NUTA 2F2XA 4BBRG 4PJJA 2AZVA 4F04B 3DEOA 4RFBA 4HCZA 4A3BB 4XTCS 3OYCA 1TUCA 2YSQA 1BCOA 3CQZH 4OX9Q 1HNZL 5IXBA 1RJTA 4LFBQ 1VQKA 3CCMT 4A3KH 1YIJT 2PO4A 1IHVA 3MEHA 1PDQA 5FOBB 1MHNA 4OMFB 4RHRA 4C0FA 2PZWA 5M5YB 4R4CA 1RTNA 5D6WA 5E4XA 3OYIA 3SK5A 1X6BA 2BE7D 2K6DA 4YWKA 2DIGA 1H9JA 1RTOA 2COYA 4FYDA 2B2YC 2DRKA 1JQYD 1I5LA 5I4DA 2KGTA 4A3DG 2K01A 3H6ZA 3ITPA 3QXEB 1TUGB 3K7UC 3JB9J 1WD0A 4H7BA 3CPWA 3SHWA 4JPBW 1WHJA 4NB3A 1KRTA 3M9QA 5KCHA 3CCQT 4KY7A 3CC2T 1A3TA 4J9DA 1YJWA 4BY1G 4TQUS 2KXDA 1E2ZA 2EYPA 2VNUD 2E12A 2L8DA 5LJ5h 5DM7R 4ELYC 1BI3A 3EG0A 3QDFA 2F0MA 2QKIC 4X62L 4LF8Q 4DR7Q 5CKHA 3I55T 4P71A 5CKEA 4C8QA 2JTMA 3D8GA 3MJXA 4YCWA 3U9SA 3T9NA 2CH4A 2G3RA 3M57A 2RHZA 2COZA 2RQUA 2EQIA 4N8FA 1TWGH 4A4IA 2ZGWA 5C3XA 3OSVA 1EIYB 2V26A 3M7NA 2UXCQ 1WTXA 3ULPA 2IPOB 2K79A 3VS0A 5HK3A 4E7JA 1U0LA 2MO1A 2L5QA 3KK7A 5CYUA 3W5OA 4GKJQ 4EQNA 1KDAA 1B50A 4C92C 3RIRA 1GBQA 3JB9D 3EH1A 4M7AB 3J80E 1Q86C 4M7AD 2YLBA 2JA8G 2K3YA 4G7OC 4X62Q 5GAN2 4M75A 3FDRA 1PH9A 1U9RA 1BIAA 1QMCA 4X3UA 1NG2A 1JOKA 2YU9B 3CMEQ 1MMAA 1SMXA 1GFDA 2F3IA 4JCVE 3FP9A 1IBKL 4OIJA 2NZOA 4J6YA 2P4RA 3CCJT 2HMAA 3MFGA 4JOIA 4PV1C 4KHVA 3BS1A 3MXNB 5EGTA 2PVOB 4OP0A 4RHSA 4DU9A 2DJZA 1HNZQ 2O9SA 4CC3A 3UE0A 3UWNA 4DNRB 2XWJB 2ZJQA 1YWPA 1UGQB 1EZ8A 5C3EG 1N5ZA 1GHKA 2WSCE 2W10A 2X4YA 3GOXA 1QNKA 2K7VA 2RBMA 3NWSA 1PSEA 1B44D 4JBWA 4R4QA 5M5YH 5JJLA 4DV3L 4FM4B 1H9KA 5GAN4 2E76C 4C92A 2EY6A 2F0KA 5ELFA 1VQKQ 2KSSA 1EIFA 4B3RL 2KEAA 3CC4T 2CT3A 1A62A 5HGTA 3PVQA 1L1OB 4J7FA 1YI2Q 3B6YA 4EGVA 1IRXA 2DL5A 1EOVA 1SNMA 5FK9C 1U1SA 3G6ET 4MZTA 3UF4A 1VQ5T 1R4QB 1ABOA 1B1ZA 2FMMA 1IYVA 2OTLT 1WHGA 2MYSA 2NTSA 3G71Q 1P8LA 3I5RA 2PMZB 1QVGA 1XMOL 2JMCA 3J7A5 1QZHA 2HL5C 2XICA 2FINB 1IL8A 1N27A 3OYYA 2OQKA 1G3SA 1V8QA 1LACA 3DLLA 1JR0D 4TRDA 5C3WA 4RGNA 1SAPA 3NHHA 2OXPA 4EMHA 1MV3A 3INZA 3M3YH 2DF6A 1JWMD 4Y52H 1A63A 3CMAT 4H44C 2OAWA 5FU6B 3K57A 3DB3A 4DR1L 5GAOq 1YI2T 2MQHA 3IRBA 1WX6A 2J7ZA 4QQ6A 3OHXC 4OONA 5I22A 2RM4A 3L1AA 1G8ZD 1ZLMA 3DM1A 1LUZA 2AUKA 1VQOA 3OIQA 5FKAC 1PC0A 4LE9A 2OJ2A 1EYGA 3G4SQ 2RPNA 4EIKA 4KGVB 2E2HH 1CKNB 2PPBC 2RHXA 2KY9A 2K5NA 5IGEA 2SNSA 4EDUA 1D3BB 1YEZA 3N5BB 4X65Q 1T3SA 1WIEA 4FYWB 2Z0WA 2XIWA 3K5NA 2A8VA 4RKBA 4BBSB 4WCIA 1VQ9A 2BH8A 3NBHB 2EW3A 4WJ4A 3OYBA 3OYDA 2YDLA 1AWWA 1VYUA 1AZEA 1M1GA 1KDBA 2D62A 4YHHL 1WTOA 3CCSA 2K1BA 3EN2A 2DY7A 1H92A 5I2SA 3REBB 2FFKB 1VQPA 3CC7T 4DV6L 4XAXB 2YRVA 2X4JA 1DYQA 1QWEA 2VVKA 3UDXA 1AWXA 2ZPGB 1EU4A 5DAUA 3KYHC 2QILA 1AZPA 1S40A 1TWCH 3KLWA 2L11A 3P1HA 2WKDA 1V1CA 1TU2B 5JEAG 1VIEA 2SRCA 4KY6A 2HHHL 1G6ZA 1ILQA 2NVYH 4ZGJB 2VXWA 4FXGC 4DR6L 2CSIA 5DLQE 3EFSA 4RG1A 2E5LQ 2DZCA 3RN2A 3HTRA 2F0GA 1Q86U 1G2BA 3H0GH 2EJ9A 3V8KA 3CCQA 1L0WA 5IE8A 1G3YA 1OZ2A 2CYZB 3TU4K 4OGCA 1SYDA 1MGQA 1T9HA 3OQ5A 4AH6A 2CP3A 1KQSP 3F2UA 2KNBB 2BCOA 1PHJA 4JI7Q 2VYTA 4DKAC 2EQSA 3PNWC 2K4KA 1BXTA 2DM1A 3CCQQ 5GAMe 1KIXA 3C0CA 4M78F 1KHCA 3P7JA 2JEAI 1YNZA 2B8AA 1I4PA 3T1HL 4G7ZC 3A1PA 1KG1A 1EOTA 1LO5D 1MBYA 3SR1A 1I8FA 3CPFA 1T5EA 3GTQB 1HA5A 2JOYA 2LDMA 3HOXH 2B8FA 2EYWA 1KD1R 1IBMQ 4JI6L 3E3XA 1E7OA 2K5QA 1VQOQ 3TMEA 2E1HA 4APVA 4AMCA 2DNEA 2PYKA 1PCXA 3GTKH 1E2VA 4ZN1A 5GANd 1L0YB 2AQ3B 1CI3M 3M0TA 2KCNA 4D8DA 2X51A 1FJGQ 1RD9D 4LF7Q 4ME7A 3AHUA 3PQIA 5DEHA 1Z9QA 3S3NA 2PW7A 3TSSA 1N6AA 2UU9Q 2EYZA 1OU8A 5M3FB 3S17H 2RDFA 4ZRZA 3X3NA 4BY7H 2FYKA 2RHUA 4FW1A 3SDZA 1KL9A 1RDPD 1GOZA 1XPOA 1BBXC 1VQ5A 2A6HC 3REAB 3HKZG 3VKIA 4DGZA 5JJIA 2XG8D 1KC8C 3FKIB 1NNXA
chains in the Genus database with same CATH topology
1NPPA 1UUPA 3E9GA 3CCRT 1RF2D 4XTYA 3SK4A 4FP5D 4KV6A 3KBGA 4BE0A 1KHIA 1A2TA 1Y1WB 3C46A 5DY9A 3KLSA 2QI2A 3O8VA 4M77B 1SXTA 1BQQT 4FT4A 3VR2A 1VQ6A 2LY7A 2WP8J 4LDXA 2C9OA 1PRTB 2E2HB 3CBMA 4KBMB 2EIFA 2F3VA 2PW5A 1K73U 1M1KU 4J1MA 3C4SA 5NUCA 1G91A 3VV0A 1Q82U 1LTRD 4XQJA 2IJ0A 4J8OA 2R58A 3QZ9B 3HRSA 3ONAB 2RJEA 3H8ZA 3A8IE 4HCEA 2L3RA 4DNTB 3BYTB 4GZYC 2VXEA 2LMCB 1GXIE 3IFTA 4M78D 1F2YA 4LD6A 1U4MA 4JJNK 1YI2A 2F1MA 3NQTA 2HDMA 1EFID 3OW2S 2JUFA 1JE4A 1HXYD 3JRZA 3FMCA 1VQPT 2NVTB 1QP3A 1CZGA 1X6OA 3GPLA 1M90C 1VQMA 3NBIA 4LAAA 1QVFS 1PMRA 5CIUA 3HL8A 1K83B 2M16A 1HA6A 4E7LA 4P5NA 4KK7A 3OMCA 3DWAA 3NPPA 4C8QC 5IOCA 2KVQG 2A6HD 1PRTC 3MVVA 4C92F 3OA6A 3O13A 3QB3A 3X28B 4M77G 4XTXA 1WVLA 4C5HA 1FNUA 4R8IA 3H3VC 2D0QB 3SE0A 2F0EA 1CHPD 4HKEA 3RMSA 5TSSA 1PFNA 1H9MA 2BDOA 2CQAA 2NVYB 4M77A 3CCVA 3OBYA 1HTLD 2R93B 3EQLC 2J4XA 2CW0C 1HTPA 3OW2A 5T1GA 2MPMA 1SYFA 3R3OA 5JJZA 2K2VA 4X9DA 2F5KA 1SE4A 3GF5A 4C92B 2JXMB 3HFNA 3T4AC 1UAPA 5KEEA 3J81L 2V8IA 1VDZA 1QILA 1M8VA 5ISRA 4IALA 3WXMB 2KCCA 4L6TB 1GUTA 4NS5A 5L8RE 2EYMA 5E1FA 2AWOA 3S2DB 2NYZD 2Q8TA 2YYZA 1B2TA 4M75E 2M9VA 4VUBA 4IFDI 2MHVA 2NB0A 2EQKA 3HRTA 3G71T 5IGFA 5KGUA 2B2WC 5E4WC 3ND9A 1BKBA 5AYFA 2KOLA 3VR6A 3EFRA 3K58A 4K2LA 2OF1A 2RH2A 3JCMW 4R8NA 1GUSA 3QOLA 4PMWA 3BVZA 2M9UA 3S3MA 1TS3A 4QVCA 2F3WA 3R2TA 2V8KA 4XU2A 3L2WA 2B63B 3H09A 2O2LD 1SNQA 3A8GB 1I50B 5JEAH 4FIBA 5HKCA 1YNJC 3DMUA 4G4KA 1ILPA 3CQZB 2K5DA 4TSSA 5C4HA 4M78C 5GMKj 3R8BA 1KNAA 1TWAB 4M78E 1WTRA 2VB3X 4IN3A 4K8IA 3S1QB 2NZ1D 3JAML 3HRZC 2EJGA 4RCOA 1SFOB 1OXTA 2CS7A 4K5XA 3A5ZB 2QCPX 1UB4A 3BDOA 2KQWA 3PIOA 1RCVD 2ICEC 3HOVB 5LHY1 3I4NB 1M4VA 3PFSA 2BA0A 2GFUA 4MHEA 2K57A 4A53A 1LNXA 2K5WA 4FXKC 1SE3A 1U4LA 2KVMA 4ZUIA 3HPWA 3GNFB 2TSSA 1EEFD 4WF2A 2E2DC 4EMKC 4OL7A 5KIXA 2IX3A 4M75C 2F0FA 3RLFA 2L9HA 4IUPA 3GV3A 1W2BS 2FJ2A 2NVQB 1BCPB 2EJGC 5JAVA 3URGA 1JOOA 3FRPB 2CVRA 1AN8A 2FHTA 4ATOA 3LLRA 1JORA 4L8JA 2GQVA 4RCNA 1V29B 3CCEA 3JB9G 4M7AG 3ERQA 3IKJA 5KNDA 3MXGA 3ZFJA 1GUGA 2X35A 2ZPEB 3VUZA 2XD0A 3A8KE 4KY5A 3K5LA 2EYHA 3E1SA 1AEXA 1LTTD 3CC2A 4C3IG 1XWEA 2JP1A 3DEPA 2XRSD 5CVIA 3ND8A 4N4GA 2XDBA 3I56T 1HFGA 1K8AU 1STEA 1D2BA 1WQWA 3OYKA 3OS2A 2E6NA 1D5ZC 3I4LA 4HR7B 3JCMf 4ZKCB 4OB1B 4EPCA 3I4MB 1VUBA 1TS4A 1JBMA 2IG0A 3MFYA 2VGMA 4LDUA 4NOYA 1HRJA 1XTDA 4C0ZA 1TWGB 2O4XB 2F0JA 1N9SA 2ZPBB 4Z02A 2LQ8A 5GMKl 5GAOn 4P2CB 1O9SA 1D5XC 1B53A 5COYA 1JJ2S 4C8QD 1CT1D 2F0UA 3MXNA 4M7AC 4A3JB 1O7LA 3ZBDA 5T1IA 1F9QA 2E65A 1EEID 5A0LA 1HUMA 1LT5D 1M8AA 3WOFA 4ZGEB 4KN4C 4C8QE 3IL8A 2PVDB 1WQ7A 2DD5A 3G71A 2Z1CA 4IFDJ 5FLXE 3CXCS 4IFDH 1STAA 1W4SA 1UNSA 3MAQA 1Y8NB 4LDYA 3Q22A 4KKTA 1Y96A 4FF4A 4IQZA 3UT1A 4PLIA 3VR4A 1PLFA 1EIHA 2EWNA 2FHDA 1STNA 3C95A 5CQXA 2RDGA 4A3MB 5GAN5 3OOCA 1DD2A 4BB7A 1YJNT 2EE1A 5C3EB 1X3PA 3A8MB 4XT1B 2RDHA 3S2HB 2N55A 1B34A 2L89A 5I9OA 3KUPA 4XYOA 3R6OA 3E19A 1KDCA 2CZ6B 1G2TA 2OAUA 5GAOl 4XU3A 5EJWA 2FMCA 5GMKi 2CZ7B 2F0QA 4IZ8A 1BCPC 5G3LF 4J6HA 5GANf 5C4ZA 4JLGA 1D5MC 3QIAA 3GTLB 1FXXA 2R5AA 2I2LA 3RMQA 3OYHA 1GXDC 3FPPA 5C0XH 1U4RA 2LC4A 2AWNA 5CV6A 2RHIA 5CCAA 4KUDK 1LLRD 4L59A 2IWHA 5C4XB 4N9PA 5JPMC 2EOTA 3HHTB 2JE6I 2EVBA 1I4K1 1EYDA 2MI6A 1M90U 4M78G 1KLUD 5JVG3 5JEAJ 3DXJC 4ZLTF 4QUFA 3KXTA 2Y0SB 3CRLC 5EPKA 4C8QG 2BA1A 1JC7A 5LJ3h 3HZXA 3PUWA 4PQXA 1II3A 1SYCA 4OGQC 5EKIA 3P8HA 4M7DE 1NR4A 3X24B 4X3TA 5GAN6 1GJXA 1ENAA 4F7XA 4J6XA 1Z6HA 3HOUB 2NTTA 3K59A 3I3CA 5CC4A 2EZVA 4A93B 1CTMA 1LTGD 1LV9A 3GO5A 2AQ1B 2WV6D 4WFN3 5EG2A 2LKVA 4ILWA 1PZID 4N9TA 4FVMA 4M7DB 2IT1A 4JRPA 4ODGA 3DWPA 3MHXA 2L5TA 2DK3A 2MWPA 4X34A 5CO7A 3RKWA 5GAOr 3E0JA 1DOKA 3NK9A 3JCMJ 2KECA 2LS01 1EIGA 1E2WA 5A2QL 4XU0A 3ZEHA 5BN4A 4FT2A 5I6YA 1STHA 4DOWA 4CBVA 1Q81U 1V1PB 1YHQA 3J80L 1OI1A 4E47A 1QCBD 2K5LA 1GHJA 2EJMA 4IUUA 1KABA 3BZDB 1ENCA 1XTCD 3OYMA 4C3JG 3LGLA 1GUWA 5KE2A 1X75C 2DN8A 3TN2A 2F5TX 5I6WA 3L2ZA 5KNBA 3VUBA 4NP5A 5GAMh 3KBXA 2XNAC 2XSCA 1I81A 1PSFA 2VV5A 3OYLA 2RA2A 4O5VA 3QO2A 2MF2A 2NLUA 4E7IA 2X6GA 1KNEA 4EQOA 3GTGB 3MWYW 3V2TA 1SYEA 2A6ED 3JB9F 4M7AF 3M55A 1HHVA 4QB4A 3SEBA 5ELDA 3LNNA 3A8LB 1ZQ1A 2EYJA 2JTFA 3S3OA 4MIUA 4FF1A 1SNCA 3BDUA 3GD7A 4M75F 1K8OA 3MP1A 3J7AF 2F4IA 4I7ZC 2E2IB 4CKBA 1CM9A 3ER0A 2PVGB 1D6EC 1O75A 2K5IA 5C44B 1QVPA 1O7YA 2JZ2A 1H9SA 3FC3A 4IUVA 3Q23A 4NW2A 1LJOA 5I2XA 1I4HA 4X9CA 3KF8A 4RG2A 4KULA 4N4HA 4HCBA 1F2LA 1PTOC 4QCLA 1HFNA 4FF2A 1RL2A 2F0TA 1DXMA 1HCZA 5CR3A 1EY7A 1JRIA 2K32A 2XIDA 5EPLA 3CCMA 1O78A 3D4WA 4OHJA 3CRKC 1ML0D 5GANe 4BD3A 1PTOH 3GTOB 4RG8A 3HOYB 2KJXA 3CHBD 3VR5A 4KN7C 3MEUA 4M78A 3ME9A 2HQEA 1G291 2QQAA 3M58A 3TCJA 1VMCA 1ENFA 1DONA 3MZ5A 4CJ1B 1F77A 4F87A 2BIVA 1WTQA 2PUOB 2A73B 1N9RA 4M7DC 3M85A 2DTIA 1S5FD 4OF1A 4F7UG 5C0MA 4CHTB 2NBFA 3GTJB 2K05A 3LX7A 3BDLA 3JSCA 4RKUE 4BY6B 3JB9H 1VQNT 3OYAA 2N88A 2GA4B 3GTPB 1NJIU 2AQ2B 1EQVA 1AW7A 2RKSA 1M1FA 1ZYRC 3S1RB 1QWYA 1M4ZA 3JCMh 5GAMd 2DD4A 1JWSD 4PJOF 4DOVA 4MN3A 3TP8A 2GCXA 1VQ8A 4O1NA 2SOBA 4HCCA 1OXVA 1K8AC 1S5CD 2KHSA 3WVEB 4E6IA 4DAYA 4NDXA 2RK2A 3V8JA 2E10A 1FWZA 1HUNA 4QF4A 1FYCA 2M00A 3MTSA 4AYBB 2P0KA 1TVXA 1BR9A 3FDTA 3LX0A 2F0SA 3A7LA 3EFXD 2HAXA 3CC4A 4ZK9B 4RGTA 2IX1A 4C0DB 2NN6G 1NZ9A 3CCUT 1X3QA 5CKDA 2ZPIB 4BDYA 5LJ5e 4UDUC 3RMHA 4OO1H 3FEOA 1FNWA 2F0LA 2SEBD 3JB9I 3M4OB 2B2VA 2J0TD 4CJ2C 1A3VA 2H1EA 1DM0B 1BO0A 1WCMB 1LT4D 4KUIA 1R4PB 1PFMA 4L63B 1S72T 1FX7A 1S5DD 4XK8E 2L1BA 1MD2D 4BACA 1BDOA 2F0IA 4A3FB 2G9HD 2P0QA 1LTAD 1S4ZA 1STGA 2A69C 2E41A 1WJSA 3WDNA 1B9MA 2EPBA 3M7GA 2IPKD 3RESA 3NTIA 3JCMd 4G7HC 4HMIA 1XX8A 5FU7B 2EYFA 4KKUA 5GANj 4Y7NB 2ZXPA 5GAMj 2RVLA 4EQPA 1VQ9T 2XRQD 1Q82C 4C3IB 3L2QA 1K8MA 1U4PA 4J5YA 5JVH3 1YIJA 4DN4M 1XNIA 3M53A 2K5FA 4J8QA 3MEVA 4C0GA 4C2MB 2RHYA 5DM63 2VGNA 1UEBA 4XTWA 5FU6C 4DQ2A 5M3MB 3K5OA 4M7DA 4MDWA 4PL6A 2DPPB 3GTKB 3S1NB 2RI2A 4ULLA 1IREB 4QW2A 1R8OB 2EAYA 3QZ5B 1SNPA 3Q24A 1PFBA 5HURA 3DLMA 1QP2A 1BOSA 5BN3A 1IHZA 5FRMA 5IAYA 1PZJD 4CKCA 1VF7A 1U1TA 2NVXB 4K14A 2RO0A 2XI9A 3TEEA 5I21A 5IT9L 2ENBA 2DXCA 3G6JB 1SYGA 3H94A 2GF7A 3NWTA 4C1NK 2WSFE 1AZQA 3QYHB 1MSGA 1ESRA 1H9SB 2KMTA 2AHJB 2AUJD 2I07B 2ZXRA 3I56A 5C0XI 3LWIA 2DY8A 4ZTFA 2I46A 2JA6B 1E0BA 3LWHA 3SXHA 1MGSA 3CU7A 3GP7A 1F9RA 2K03A 4PMCA 4UC4A 1LABA 3S1MB 1PTOB 3QSUA 4KI0A 1F9SA 3L3OC 2OTJA 1P92A 5FLXL 4FL6A 3JCMX 4XDXA 1VQ8T 1TH7A 5KNCA 5ELCA 3V96A 1AP0A 3D6WA 1FD7D 4WJWA 1LT3D 5HK0A 2EQUA 4PNYA 3HP9A 3MXUA 3MP8A 2M2LA 1A6XA 1NAPA 4J83A 2HDLA 1Q81C 3E6ZX 3QOJA 4M77C 2EJFA 1SNOA 5CBAE 2BE5C 1ZEQX 1AFPA 2IW3A 3K7AB 1WGSA 2M1HA 4E7HA 3S16B 5GMKm 3A54A 4HCSA 4A3IB 1IYUA 2K28A 3A55A 1I4QA 5ELEA 3EJIA 5EKLA 1VQ7A 2WINB 1JB0E 3A8JE 3K6OA 1TY2A 3QIIA 2BKDN 1EY0A 4LK1C 2MMPA 2K33A 3AMUA 1Q8IA 3MEAA 5CV9A 1JOQA 1HQRD 3PMTA 3D4DA 5CBEE 2A3LA 2WB1B 3LH0A 2DXTA 4CRIA 2A74C 3HKSA 2H4OA 1PYWD 4PJOE 2YHTA 4XTZA 4PJOC 5D3DA 2ZT9C 2PZUA 3SVMA 4BY6C 2LQKA 3QUIA 2QDYB 1LTBD 4A4EA 3NUCA 3MP6A 3I73A 4IUQA 3HGBA 3DWQA 1EL0A 3HRUA 5FRNA 5AFWA 5CORA 1EWHA 1S5ED 3OY9A 5IODA 4FSXA 4OB2B 3PO2B 5GAN8 2HQXA 2E75C 4XXEA 2B2TC 1I3QB 4BUGA 3BW1A 3HS0C 2F0PA 3T16A 5BN5A 1I6HB 4KHZA 2E6ZA 5DNFA 4QVZA 4BE2A 2D9UA 1C8CA 3N6RA 5EBDA 4HSPA 4DA4A 2BDNA 3EA6A 1X01A 3MO8A 4F7UA 4XQNA 1O80A 2R3ZA 5DLOA 5EQ0A 2B2YA 4C5EA 5KE3A 1EZ6A 2QEJC 3QJYA 3PIP3 1WJQA 2HCCA 1XYIA 2DNCA 2F0VA 3UPUA 1D3BA 3VYRA 3E5SA 4RWSC 2B8GA 3QWNA 1STBA 3C12A 4XTUA 4R9WA 4KMUC 3NP8A 1VCIA 3VJPA 3BDCA 3TZUA 3F70A 3JCMc 3X26B 2V8JA 3IAYA 3RUZA 2DAQA 2E2JB 3A7AB 3L2RA 3X3MA 2P4TA 5IGDA 5LJ5g 5EBCA 1Y96B 5C0XG 1QVGS 5GAOm 3PTAA 1OO9B 1UGSB 3J7AV 3UI2A 2XDDA 2Q8RE 2Q8IB 2BOSA 4ZTJA 1NR2A 3HP3A 2C5CA 3CCUA 3H6MA 2JA7B 2XWBB 3SK8A 4ZQ3A 1QW1A 1C48A 4YIJA 1Z7TA 5C4JB 4QQDA 1SSOA 3CXCA 2JSOA 2DTHA 4MZMA 3KLSX 4HAEA 3SWNA 2QQRA 3FIFA 5LL6X 1SEBD 1KQ1A 1G5VA 4C3JB 1V43A 2L4NA 5C0XJ 4C8QF 1YJNA 2XK0A 2QQSA 2R7ZB 2L55A 2E64A 3PUVA 1Y69U 1VIFA 3H91A 2NWGA 5CR2A 3LGFA 4K5VA 4M1UB 1ET9A 4N0AC 2EYOA 4XU1A 4X3SA 2XHCA 5FO9B 1YITT 4OVAA 4RKLA 4NKLA 2LCLA 1NJIC 5J26A 3CCST 4OO1I 2E70A 4ZN3A 2DZ9A 4RCCA 3JCMb 1UEAB 1CK1A 2F03A 5IGBA 1TQOA 1FNVA 1Q1EA 4C1NI 2GFAA 5KYIA 3S15B 4BE1A 2EYQA 1DOMA 1CQFA 2A68D 4EVOA 4CJ0B 3C1FA 4NL3A 5GANg 4NL2A 5D6XA 1TWHB 5E3FA 3META 4FNFA 4M78B 1Y8PB 1G2SA 3EVQA 2EQJA 3HOZB 2P0PA 4XIGS 3PIPA 2RD1A 1EY4A 4H13C 3FPUB 5EPJA 2EY1A 5LJ3e 1CQVA 1D1KA 3OWEB 3W2DA 2A69D 5IGCA 1D1IA 1TS2A 3ASKA 3P8DA 3NQIA 3CCVT 4LD9K 1O7ZA 2CZ0B 4C5IA 2A6EC 4IKFA 4ZYSA 1NSNS 1SMYC 4XQ3A 2MAMA 1Y71A 2SNMA 4U68A 3M56A 5CV4A 2E5QA 2K4YA 3KUFA 4HT9A 4ZUJA 3S9WA 1IKMA 5CQYA 1B9NA 1YBYA 4C56C 3QJ6A 1FR3A 1PTOD 4BDZA 1HXDA 1NCVA 2D6FA 2R6GA 3MHBA 1BNZA 1EY5A 1NPRA 2C06A 5JPNC 3P75A 2OT2A 2D2CC 3OYNA 1Q3LA 2PNRC 2A68C 1Q1BA 3RZDB 1X32A 5GAN3 4BBRB 1HPCA 1TT2A 4DAVA 4Y91A 1OYXA 4XT3B 3TZDA 1ESFA 2PZTA 5GMKe 3PUZA 3P20A 1WD1A 4KT0E 3VA5A 1SSFA 4F7UF 3NBHA 2QQBA 4OB0B 1Y1VB 1PXUA 4CGYB 3FRNA 2K6AA 2PCFB 3OW7A 5GAOp 2X69A 1VQ4A 5A35A 1BI2A 1IZ6A 3LW5E 3CMAA 3Q1JA 3PUYA 2HNIA 3OPOA 3NE5B 3PV0A 5CAIA 3BYYB 4L5GA 1H3ZA 1SJED 1W6JA 4O42A 4B9WA 1A2UA 2F0OA 1SBBB 1BUVT 3S14B 5D65A 2H3JA 1LOJA 2RSOA 3D6CA 3HG9A 1VQMT 3JCMe 5KH6A 3BG3A 2L12A 1HQMC 2MUYA 1ZYRD 4ME5A 3BFMA 5J39A 2OEOA 4IURA 5I2MA 4QUCA 5K36H 4EMGA 2RJFA 3RD4A 1N8RU 3ZYYX 4RAUC 3QKJA 3I90A 1NE8A 1TY0A 1ZBXA 4I65A 2F0WA 2KA7A 3D31A 3QYG<