4IUUA

Crystal structure of shh1 sawadee domain in complex with h3k9me1 peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
133
structure length
127
Chain Sequence
ADLAFEAKSARDYAWYDVSSFLTYRVLRTGELEVRVRFSGDEWVNVKTSVRERSIPVEPSECGRVNVGDLLLCFQEREQALYCDGHVLNIKRGIHDHARCNCVFLVRYELDNTEESLGLERICRRPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Polymerase IV occupancy at RNA-directed DNA methylation sites requires SHH1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
molecule keywords SAWADEE HOMEODOMAIN HOMOLOG 1
total genus 23
structure length 127
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16719 SAWADEE SAWADEE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4iuuA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iuuA01
1EQTA 1J8IA 1ILPA 3G7LA 4R8IA 4RA8A 3L2QA 1WVLA 2DIGA 3S3NA 5M9OA 1U4PA 2JP1A 1CM9A 4E7LA 4C5EA 1X3PA 1BNZA 5CIUA 4BE2A 5C6SA 4EDUA 1O7YA 3ONAB 1PLFA 4LMQD 1A15A 2VXWA 2XDPA 1O80A 3MTSA 1WTXA 1HFGA 3SD4A 3OYDA 1F2LA 2YRVA 4QUFA 2L8DA 1PFNA 3OA6A 1F9PA 2PQWA 2B2UC 2GF7A 1HRJA 1F9SA 5E4XA 1OI1A 3M9QA 1F9RA 2CVRA 1RODA 2F5KA 2EQMA 2SDFA 4FU6A 3OYCA 3H6ZA 2GFAA 3QKJA 3IL8A 3MWYW 2HCIA 2FINB 1G2TA 2N88A 1QE6A 2QQSA 3OYBA 1WTWA 2EQKA 5FROA 1GUWA 4LD6A 3BDLA 2M1HA 5KCHA 2BDNA 3P8DA 5KCOA 3OS0A 5IN1A 2HDMA 2L12A 2JYOA 1G5VA 2B2VC 1NR4A 2BIVA 2BKDN 4IUQA 3DEPA 1DOKA 4GY5A 2DIQA 1RI0A 1WTPA 3I3CA 2H1EA 3META 4CJ1B 2MPMA 3P7JA 2D9TA 2O4XA 1HFNA 4CRIA 2B2YA 4IUVA 4ZLTF 3QIIA 1O7ZA 4Q5WA 2B8AA 2RHUA 1AZQA 4ZK9B 1BO0A 1PFBA 3LGFA 5E4WC 1G6ZA 2X6LA 5JJZA 4BDZA 4E7KA 3HP3A 1OYXA 5D6YA 1EOTA 1SSOA 4BE1A 3OYFA 3GOXA 1G2SA 2L11A 1M8AA 2EPBA 2FJ2A 4RG2A 4B9XA 3FDTA 3UT1A 2K03A 3KBXA 2HQXA 2MP1A 4X3KA 3N52A 4ZAIA 3FPUB 1NR2A 1BBXC 4PLLA 2R3ZA 2NZ1D 1RTNA 2KEEA 1OZ3A 1MI2A 2O4XB 2EOTA 2RJDA 2R58A 1WJRA 3ASKA 3FDRA 2DY7A 4MN3A 2FHTA 2RI5A 5KH6A 2Q8TA 1H3ZA 5CMDA 3OYHA 3H8ZA 3E9GA 2NWGA 2KOLA 4E7IA 1DONA 3MP8A 2HQEA 4XT1B 3OYLA 5EJWA 3OYEA 5COYA 5EQ0A 4N4IA 3FLGA 1WD0A 4QQDA 1DZ1A 3L42A 4N4GA 1MGSA 1MSGA 4UC4A 1RTOA 3LLRA 3OS1A 2MWPA 3DB3A 4HEDA 2BUDA 3LX7A 1J9OA 5J39A 1JE4A 1U4LA 3OY9A 1ML0D 3D6WA 4IUPA 1ESRA 1XNIA 4HCZA 2EQUA 1U4MA 3S3OA 3OYJA 1OZ2A 4A4GA 2L4NA 2R5MA 5CORA 1HUMA 3OMCA 2RI2A 3UWNA 2HDLA 1PDQA 1MHNA 3DB4A 3R93A 2WACA 1HA6A 2RJCA 3UI2A 1ILQA 3NTIA 2RSOA 2X69A 2LTOA 4HCSA 2IG0A 4L59A 1B53A 1TVXA 4HAEA 4IKFA 2JZ2A 2K3XA 1QG7A 3Q6SA 3MEAA 4II1A 1LV9A 3DEOA 2KEDA 3LWEA 2FHDA 1EL0A 5J26A 3LYIA 3L2UA 3FC3A 2LCCA 3F70A 5EPLA 4PLIA 1CA6A 4C5HA 3OYMA 1KHCA 1KNAA 1AZPA 1PFMA 1WTQA 4OVAA 3DLMA 1HHVA 1RJTA 4BE0A 4C5IA 3H91A 5FRNA 1NCVA 2L9HA 3MP1A 2X4YA 4QQGA 1B2TA 5AFWA 2RHYA 2MGSA 1IKMA 1Q3LA 4ZKCB 2EE1A 1WTOA 3EAEA 2EKOA 4NS5A 3GV3A 5KE3A 3IFDA 2RI3A 2K01A 2HUGA 4A4EA 1WJQA 3MO8A 3PMIA 1KNEA 5EPJA 2MJ8A 1XYIA 2X35A 2L89A 1U4RA 2K04A 1EIGA 2B2TA 1IKLA 1F9QA 2R57A 3NTKA 4BD3A 1XX8A 2RO0A 3I8ZA 4UAIA 1QNKA 4NW2A 2KUMA 2LVMA 4ZKBB 3C4SA 5IAYA 4RAUC 2J7ZA 2X4XA 4MHEA 1NAPA 3F2UA 3SVMA 4PL6A 1SAPA 3TN2A 3PMTA 2HCCA 3NTHA 1RHPA 4ZTJA 1X32A 3OB9A 1HUNA 3OMGA 5FRMA 4B9WA 3OYKA 4OIJA 3S3MA 4O42A 3TZDA 3GV6A 3QO2A 3QBYA 4IUUA 4QUCA 1WTVA 4ZTFA 1MSHA 5CBEE 4HSVA 2QQRA 4XDXA 2DY8A 3MP6A 2L3RA 2RHXA 3Q1JA 1B50A 5DNFA 2KECA 4E7HA 2RA4A 3OQ5A 2B2VA 2K1BA 1AP0A 2X4WA 3LGLA 2M0OA 2Q8RE 2B2WA 4RWSC 4A4FA 2K3YA 2XK0A 1B4OA 3FEOA 3CEYA 1EIHA 1S4ZA 2GFUA 1X3QA 2EQJA 2KVMA 3LH0A 2N55A 2VYTA 4U68A 3P8HA 4E7JA 5T1IA 4R9WA 2L1BA 5D14A 2EFIA 5C0MA 4OIKA 3L2RA 2B2WC 2FMMA 3MEWA 3I91A 4Z02A 2K28A 2LDMA 3KUFA 4QQ6A 2RHZA 4CJ2C 1WTRA 2NLUA 2B2TC 3OYAA 3L2VA 3L2WA 4DN4M 4N4HA 3OS2A 1B3AA 3E9FA 1C8CA 2M2LA 1WD1A 2LRQA 1WJSA 3PNWC 1E0BA 4IURA 3MEVA 3KUPA 2P0KA 4C5GA 2FFKB 2IL8A 2RVLA 5EPKA 4BDYA 4QVZA 5D6WA 2B2UA 2X6GA 4BACA 1IL8A 1DOLA 5EKIA 3OYNA 1VMPA 3PFSA 3ME9A 5T1GA 1SDFA 3DM1A 1SSFA 3S6WA 4X3TA 4X3SA 2JTFA 4FL6A 2G3RA 3OYGA 4X34A 4CJ0B 3I90A 2R5AA 2RSNA 2RJEA 3OYIA 1WGSA 1CA5A 2RJFA 2D9UA 2E5QA 5KE2A 4QW2A 1JICA 3QJ6A 2DAQA 2K05A 4IUTA 3O8VA 4A4HA 2E6NA 2M16A 5D65A 2MWOA 1ICWA 1VMCA 2NYZD 1ZXTA 2CKKA 2XIWA 4XT3B 5CBAE 1DOMA 2RHIA 3MEUA 5D6XA 3ZEHA 4X3UA 1G91A 2B2YC 1BF4A 1N27A
chains in the Genus database with same CATH superfamily
2BZ8A 2V8JA 1NE8A 2KVQG 5IGEA 1SHGA 2B63G 4ABNA 2RN8A 3TQYA 5FWCA 4OO1I 3L2QA 1WVLA 4L5RC 4DV2Q 3S3NA 1IYJB 2BOSA 5FLXc 1WHMA 1YJ9T 5LJ3d 3HRSA 4JI3L 2VUBA 4HIKA 3BVGA 2EY2A 3I4NH 2ROLA 2YLBA 1STAA 3I72A 2D6FA 3SXHA 2K7AA 4KULA 4MDWA 2K5IA 1GFDA 1UHCA 1QVFA 1HA5A 4LMQD 1YFNA 1FMVA 2J06A 1KC8R 1PLFA 3TZUA 1A15A 5M3MH 5IYCG 3M7NA 3HRZC 3NPPA 4H7BA 1H3HA 3IKJA 1JRIA 1SNQA 1H8KA 1SNDA 4ZGEB 1RAFB 4Q0FA 1X6OA 1EY5A 4HJ5A 1IXDA 3TVTA 4JYAL 3MXNA 4FSXA 1OU9A 4HIMA 2EGEA 1A62A 3OYDA 3J80L 3U58A 2NN6G 1IW7C 2LMJA 2MO1A 2EJ9A 2PQWA 2B2UC 4FF1A 1HRJA 1SYDA 1YHQT 1M27C 1JWMD 3FKIH 1KSWA 2DE0X 1UEBA 2SEBD 4IUNA 3SK8A 3M9QA 4U673 2VUMH 3PIP3 1F9RA 4KLKA 4IFDG 1KAAA 5LJ5g 2P0PA 1ZLMA 2NWMA 4C0FA 4C92F 1M8MA 4NL3A 2F0TA 1SF9A 2EBPA 3VS7A 1TWGH 1ZYRC 3OYCA 1PSEA 3SK5A 1BUVT 2KCCA 1TY0A 2SEMA 4QIWE 4GKJQ 1VQMQ 3M9BA 2QASA 4K2KA 3PIOA 4AMCA 1HH2P 1D0YA 2IT1A 2N88A 3OYBA 5HKCA 4PJOF 3HOVB 2IWHA 3RZOB 1TXYA 4EMGA 2OTLA 4PNOA 2I2LA 2EQKA 5L37A 2MNAA 3VR3A 4PJLA 2WSFE 2LCLA 3N6RA 3CBPA 3CD6T 5KCHA 4OGCA 4NB3A 1M90U 4GKKQ 1RADB 2JYOA 3A74A 5GANf 1QVCA 1G5VA 1STBA 4BY7H 4LUEA 2NVQH 1K3BC 1TR5A 4F17A 4PKCC 2BIVA 1EZZB 2VKNA 4C3IG 4BI3A 3TP8A 4IUQA 1N8RC 2VGMA 5TSSA 2O9SA 5HGTA 1LTBD 2BE5C 5KYXB 2DIQA 1RI0A 2QGFB 3I3CA 2FB7A 1BKBA 3META 2MPMA 1UJ0A 1XPRA 3PVQA 1PTOB 3G6EQ 4YIJA 2D9TA 1R0BG 1HFNA 1K76A 2QGGA 1W4SA 2FG0A 4O5VA 1YJNA 3R2IA 2EVRA 4A3LG 5DM7R 4A3EH 4ZLTF 2E76C 3RKYA 1O7ZA 4NXNL 2GQIA 1RLQC 4KKSA 2PZWA 4Y91A 2RHUA 1JJGA 1AZQA 3CCLT 1AW7A 4KH0B 1VQKA 4Q5VA 5IXBA 1VQNA 4ALPA 3PO3H 3LGFA 2WV6D 1LTID 1AD5A 3A8GB 2PTKA 5E4WC 3J7ZC 4PQXA 1EFID 1ZQ1A 2MIOA 3REAB 2UUCQ 2OT2A 3EFSA 4UHVA 1OYXA 4DUYL 4B3SL 1WLPB 1V9PA 3E0EA 4KD3A 4XXEA 3H3VC 1HK9A 3K57A 1AFPA 2L11A 3SK6A 5JJKA 2R92B 2EPBA 1Y1WH 4RG2A 2QEJC 2VASA 3FDTA 3JCMW 3UT1A 1F2ZA 1ZX6A 2QILA 1K8AC 3OTOL 2XICA 4DR2Q 2CSQA 2DNUA 1D5XC 3EFOB 2X9HA 3D4RA 1R0CB 2BE5D 4GN3B 4HJAA 4ZUJA 1PM3A 4X3KA 2DTOA 2EAYA 1YITT 3BZCA 5BN4A 2H3JA 4RCBA 1NR2A 4JCVE 2AK5A 1UNSA 1WHLA 2I0QA 3GTKH 1BBXC 4PLLA 2R7ZG 3RD4A 3SWNB 1Y96B 3CCEQ 3QOJA 4X9CA 2KEEA 2SRCA 3FKIG 1II3A 2O4XB 5LMNW 2RJDA 3E6ZX 2P4RA 2XWBB 4E6RA 4WF2A 4M7DG 1WHHA 1U0LA 1UGPB 1I4K1 1W6KA 2NZHA 2OJ2A 3I4OA 4DU9A 2CQAA 2RI5A 3ND8A 2COYA 2L3QA 2Q8TA 1H3ZA 5CMDA 5GAOl 1E1OA 3K81C 5CC4A 5M3MG 3E9GA 3M4GA 5IYCH 5IP7G 4PJOE 1RIPA 3EGDB 4A3KG 3QJYA 1JCKB 1K4US 4CDFC 5GAMd 2CYZB 4M77E 4XT1B 4EQOA 3PO3G 3UE0A 4K14A 3OYEA 1N32L 1VQ9Q 3OTOQ 1C0MA 1OXXK 1T5XD 1PYWD 1S5DD 3L42A 1P8LA 1NUCA 2CREA 2A7YA 5C4XB 1RTOA 4A3LH 1YJNQ 1OXVA 2EJFA 1X65A 2K14A 1L2FA 3CCJA 2MWPA 1W3SA 3VYSA 2OAUA 2J4XA 2HZYA 4MTNA 3J7A5 4X1VA 8ATCB 3CMET 5FO8B 5C4JH 3LX7A 4DBFA 2KYBA 4GLMA 1AN8A 1U5KA 5J39A 1N5ZA 3M0QA 2CUBA 1YI2Q 2Z0SA 1C9OA 2K79A 4QJFA 1HNZL 1HXYD 1XNIA 2E75C 2EGAA 4C3JH 1I6HH 2WFWA 4G7ZC 3S3OA 1KJWA 4LF4L 1K9MC 1OZ2A 3FRNA 1Q7YU 4PG3A 2L4NA 2YV5A 1XTDA 2A1AA 1A3UA 3VS2A 1RACB 3Q24A 2UUBQ 4RKBA 1S5ED 4EMKA 4BY7G 2DGYA 3UPUA 5KYLA 4E7SA 4B3RQ 1ZSZA 3BDCA 4RKUE 2QEXA 1UE9A 2ABLA 1M9SA 2RI2A 2DD5A 2HDLA 3EJIA 3DB4A 2HL3A 1PZID 3F8TA 4R1JA 1PRLC 1ONLA 2CP0A 2BCOA 5IY0A 3E3XA 4ZCKA 3UI2A 3W5OA 2P84A 3NTIA 2E65A 4L5GA 4JDSA 4P5NA 5KYNA 1I5FA 2BA0A 1RAEB 3WVEB 3AYHB 1B53A 1VQ6A 5IGDA 4HAEA 4IKFA 2JZ2A 3HL8A 2J0TD 1M1FA 4YHHL 5I4DA 1PA6A 4HJ7A 4A3DG 1NPPA 3DEOA 3JRZA 3UE1A 4A3DH 1QZGA 1X3GA 2FPFA 1I07A 2LCCA 2LSSA 2JW4A 2VUMG 1JR0D 3F70A 5EPLA 2JS2A 2HKNA 5LMNQ 1KDCA 2UXCQ 4PLIA 3JB9G 1CQFA 1R9TH 4NDXA 4LUDA 2C5CA 3HOZG 4A76A 1STEA 1PD0A 4NXNQ 2JA6G 1WX6A 1GCPA 4OVAA 4OMLA 1HHVA 1RJTA 1SMXA 4A3BB 2LNVA 2HD3A 4C5IA 5LJ3j 2ID0A 2CSIA 3M54A 3MKDA 1RCVD 5FRNA 5C0XG 2CCZA 1K8GA 2AT1B 3MP1A 2X4YA 3CD6A 4EQ5A 3K5NA 1B2TA 4ZUIA 3JCMb 4L5TA 4DNIA 4KV6A 2L0AA 1VQ8Q 4J9HA 1V1OA 1VYVA 2ES2A 1IREB 3URGA 1Q82C 1WXBA 1HSQA 4HR7B 4DUZQ 2OTJA 3FPPA 3CAMA 3J7YW 2EE1A 4XTCS 3DLLA 2EKOA 4KRTA 4NS5A 3GV3A 5FO9B 3S1NH 2VQFL 1VQKT 5ELFA 2YUNA 1Z47A 2M02A 4A4EA 4YCUA 5I9PA 2L5TA 5C6AA 3TEEA 2DM1A 5LJ3e 1V8QA 4HA8A 4UP8A 1WJQA 3MO8A 5LL6X 4J6HA 3GTGH 1FYNA 3TP5A 2MJ8A 4IOAA 2CZ0B 2CP3A 4BWGB 1XPUA 2N3SA 2RM4A 1E1TA 1I4XA 4BBRG 2IY5B 1IHVA 1KC8C 2JEBI 4BD3A 1EZ6A 5IP7H 2RO0A 3I8ZA 4DUZL 1WQWA 4BY7B 1QNKA 2E2IB 5CV6A 2LVMA 4ZKBB 2D5DA 2QTXA 4IJHA 3IFTA 5IAYA 2C35B 3CC4T 3KLSX 4DV1L 4IFDH 2RF0A 3BVZA 4F7UB 1XMQQ 4CC4B 2K5NA 1D1BA 1VYUA 2A6EC 3DHQA 3HS0C 1YITA 2CH4A 1RAIB 4C92B 3F2UA 1I50B 1K8AU 3ULLA 1EWHA 3TN2A 4FT2A 4M7AB 3K5LA 3CMEA 1SN8A 4KJOA 2JJ9A 3UDIA 1X32A 2N8NA 1HUNA 4YWKA 5C4XH 3QDRB 2ZPHB 3V7RA 3KF6B 1SFOB 3CBOA 2NUTA 4K6DA 4RCOA 4FXDA 4QUCA 3A8OB 1H9MA 2JTMA 5GAN4 1AE2A 4GS3A 2K75A 1WTVA 1GBQA 1WZOA 4Z89A 4PJOA 1PMRA 3AFPA 4BS9A 1SPKA 5CBEE 4HSVA 1G8ZD 1YNZA 3MJXA 1N8RU 3G48A 1Y1WG 4GN5A 1NPRA 1WJJA 3NENA 1LABA 3HHTB 3MP6A 1QKXA 2CT3A 2RHXA 4C0DC 5E7NA 3M3YB 1NEGA 5DNFA 5I11A 4QB4A 3HOUG 3RZDH 1M2OA 4EMKC 1AWJA 9ATCB 2ATWA 3TRZA 1WIEA 1VQJA 2KT8A 1U3OA 2X4WA 2XG8D 3LGLA 1VQ8A 3GBQA 3TSSA 1N8RR 1TSFA 4H0LC 1X55A 3S24A 1LJOA 4RWSC 1VQBA 3QO3A 5GMKl 2F4VQ 2OTJQ 3G4ST 3HOYB 1B4OA 3AU7A 3BW1A 1W2BS 1BDOA 5JJLA 1PVOA 2VUMB 1EIHA 2C9OA 4A3EG 4ZYSA 5A0GA 3EN2A 4E7JA 3H3VI 3VV0A 1M90C 2LQ8A 1QVFP 3AHUA 1SEBD 5GAMh 3U4VA 1UE1A 1KXLA 1LT4D 2IPOB 4J9GA 2EIFA 4OELB 4DAYA 3CCLQ 2IX1A 5IGGA 1E7ZA 1C6VX 1K28A 2RK2A 1CFMA 2B2WC 2KXDA 3MEWA 4JI1Q 2HIXA 1GUNA 3PIPA 4AFZC 3HKZB 1EYGA 1Y71A 3VS3A 3SHLA 3SDZA 2MO0A 1VQLT 1VQ4Q 2N49A 3KUFA 2ZPEB 4IO9A 1B34A 1EY7A 1TWAH 4DR4Q 1U06A 2YTYA 5FU6C 4DN4M 2AHOB 1NEBA 3HFZB 1M2VB 1K8AR 1SE4A 5FWBA 3E9IA 2DXCA 2R7DA 3NSWA 2GTJA 4F88A 4XQNA 4G7HC 4HKEA 1GKHA 2NTSA 4EMHA 2QEXT 1GOZA 4OO1G 1WD1A 2OTJT 3PNWC 2RDFA 1EIFA 1GHJA 1LOJA 1UG1A 4ANJA 4LUZA 4LJZC 1KD1R 3HOWH 2R61A 2OTLQ 2PW7A 3UATA 1HR0W 4PJJA 3A8LB 3V2TA 2V8KA 4BDYA 3G7ZA 1X01A 2WAQE 1YZ6A 2M9VA 2HEQA 3DXJC 5D6WA 4DR1L 2ZM6L 1DD2A 2LX7A 5FLXL 2FO0A 2NN6H 2KI7A 1PH7A 1IL8A 1I6HB 4MNOA 2PVOB 2BDOA 3BDOA 4IJLA 1VA7A 3REBB 1GM5A 1HQRD 1P92A 3S15B 4HCCA 3V8KA 3LWIA 3DM1A 1VQ5T 2XD0A 3R3OA 3S6WA 1VF5C 3DUZA 4EIKA 4X3TA 3S9WA 1K0XA 4WJ4A 4ODGA 5I2YA 4BY1B 4FL6A 4Y92A 1YHQQ 1DJ7B 2DVEA 2G3RA 4EGVA 4LF4Q 2WIIB 4CJ0B 3KJOA 1N33L 2KENA 5ISRA 2RSNA 4DNRB 2K5LA 3OYIA 1GFCA 3AB9A 3SHWA 2NUTB 2Y0SE 4YCVA 2DJZA 4FO2A 1AEXA 1E3PA 2ZXPA 4PJOD 4HIOA 1PRTF 1NM7A 4QW2A 1EWIA 1JICA 3OWEB 5CKHA 2DAQA 4RTXA 3I4MH 2E6ZA 2MWOA 3VYUA 2CFMA 1VMCA 1X6GA 3VS4A 4R55A 1PH6A 4JV5Q 1AOJA 2CKKA 1BVSA 4DA4A 1ZXTA 3RUZA 1EQVA 4XT3B 1GHKA 1YI2T 2HD0A 4M7AD 1CKMA 2EJGC 3KBGA 3MEUA 1PRTB 3GTOB 3S1QH 4M78E 2E5LL 5LJ5f 4JI6L 1JE5A 1VQ8T 3U9OA 4JBWA 1IZ6A 2XTIA 3D8GA 4PFOA 2VZAA 2DYBA 3S2DH 5GJVB 2A37A 1PD1A 1SNPA 2V4DA 3M4OB 4QY7A 2YWWA 4BY1H 2LX9A 2NTTA 1N27A 5CR3A 2O88A 1SBBB 4MMLA 4C8QF 1JQQA 4DV5L 1TWHH 5CKFA 1IHWA 4M77A 5LJ3f 3G7LA 4QMGA 2JA7H 2K5VA 1L0YB 5GAOp 1E6HA 2Q2IA 3CCST 2QA4A 4KN7C 2DIGA 1V1PA 1TWBA 2CGHA 1Q86U 2BH2A 3D7SB 1U4PA 3CQTA 4C1NK 2K5DA 2ICEC 4R4TA 4A93G 1VDZA 1D0ZA 3GP7A 2JM9A 3JCMc 5CIUA 1J5EL 4JI6Q 3NHHA 1EYDA 1KLGD 2E5LQ 2EYMA 1ABQA 5GAN6 1AHJB 3CCUQ 5KYXA 1O7YA 2JM8A 3D6CA 3ONAB 1S3OA 1AE3A 4AG1C 2I5MX 2K7VA 3LWHA 2VXWA 4N9TA 1M5Q1 1BCPB 1O80A 3RLFA 2G9DA 1JB0E 4GNXB 1JB3A 3BDUA 3S1QB 3MTSA 1X2QA 3FVQA 3D3RA 1QUQA 2KCMA 2FRYA 2LY7A 4PJOG 4OEMB 3V96A 2QQBA 3I4NB 1QCFA 3QWXX 1QP2A 4C0DB 2I46A 3JCMQ 4RH6A 2F0MA 4NL2A 3A5UA 1F2LA 3S2DB 5IWAL 4QUFA 3JAMc 1NYFA 1PKTA 1F9PA 2GF7A 2ZTCA 3TP6A 2EYFA 1LCKA 1W2BP 3E5SA 1EIYB 3M56A 1JOQA 2CWPA 3UDCA 2CVRA 4YHHQ 2SDFA 3V05A 1YN8A 1KLUD 2PNIA 2F4IA 2XSCA 1QVPA 4H44C 4LK1C 3M53A 3X24B 1EEID 4OL7A 4LF8Q 3A0JA 3CU7A 4A3IB 5DY9A 1WYDA 1T0HA 4FXGC 1ACMB 1STGA 1KL9A 2QQSA 1QE6A 3HOXH 1HJDA 2ED1A 3KOJA 2NUPB 2YTVA 4X65Q 1KRSA 3S17H 1KQSA 2CKZB 2F0QA 3OSOA 1GUWA 2ENBA 1RF2D 3BDLA 2IIMA 2F52A 2M1HA 1BIBA 3CCJT 4JS4A 5EGTA 2AUJD 3T56B 2K2VA 2BDNA 3P8DA 5LJ5e 4KK7A 4NPSA 4RTTA 1X54A 2EYYA 3TREA 4KGXB 3WXMB 3OBYA 3BVMA 2B2VC 1M3CA 3CCSA 3RZOH 5ECAA 1WTHA 1Z7TA 1ABOA 1ZSZB 3A98A 4FIBA 5GAOq 4ME7A 1E22A 2ZTDA 2L2PA 3DEPA 1EYCA 5CV7A 4X64L 2NVXH 4B3ML 3QXEB 5C3EG 1WTPA 2KROA 3ULPA 2CZ6B 3UA6A 1XTCD 2KRMA 4CJ1B 5DLOA 3I55Q 2E2DC 2XRSD 1V1QA 5FO7B 4AYBE 1OU8A 1K9MU 4J15A 4QVDA 1Q7YC 3PT9A 1JEGA 1KD1C 4OF1A 1SYEA 1VQEA 4M75E 2ZXOA 3NBHB 2C06A 2Q2UA 2O5IC 4A3CG 2HBWA 2F0UA 4WFN3 1ZUUA 3GO5A 3PUYA 1OPLA 1HJPA 4XU2A 2B8AA 4LDYA 1PH3A 2PUOB 3S1RH 3DWAA 4B3TL 3QPHA 3T9NA 1CZGA 1LPLA 3A8HB 2GQVA 1QILA 1UE6A 2PYKA 2X6LA 4KI0A 3SK4A 1E6GA 4EMKB 3F2BA 4DV4L 2A8VA 1AZEA 5JJZA 4JBKA 2OI3A 4BDZA 3HP3A 4AH6A 1UAPA 5EBCA 4B08A 3NBIA 5D6YA 1CTMA 5KYWA 3HRTA 3SB2A 1S5FD 2L3PA 4DEYA 2VS1A 2OAWA 4BE1A 3LX0A 1UGRB 3OYFA 4L6V5 3GOXA 1G2SA 2KE9A 3EG3A 1M8AA 1QW1A 1B7YB 2IPKD 4F87A 2COWA 2DTHA 4ELZC 2EGCA 1TS4A 3GTPB 2QF7A 2R6GA 3CCMQ 2RB6A 2PU9B 4K0KQ 1YCYA 4DV0Q 3KBXA 2E10A 4A3BG 1D09B 4JK1C 1SKUB 5GMKm 3N52A 5LJ5h 1BI0A 1S72T 5FLMH 1H95A 4JI8L 4LF5Q 1QOHA 1K73R 1S1NA 4CDCC 1FXXA 4KH1B 1KTKA 5FLMG 4JI2L 4E6IA 3NP8A 2JXMB 4DR7L 1RI9A 5GROA 4MMKA 1VQ5A 3A55A 3Q0AA 2JS0A 3JB9F 1SSHA 2PW5A 3PV0A 3AT1B 1VQPT 3TSZA 4GBQA 1Q81R 2DL8A 2R58A 1WJRA 1UGQB 1K73C 1TS3A 3ASKA 1QCNA 5KYYA 2DY7A 1M90R 2UUCL 3URYA 2FHTA 4OWTB 2AUKA 5KH6A 3BG3A 4J5YA 2R93H 2RDHA 4RGTA 1B1ZA 2E3IA 2XKOC 2ZXRA 1O9SA 4C3HG 5IH2A 1M4ZA 1Y7XA 4N0AC 5IT9L 5DM63 4DAVA 5C3XA 5HK3A 1IBMQ 1FJGQ 2A74C 3MP8A 2HQEA 2LT1A 5IT9E 3D31A 3C95A 1QWEA 1VUBA 2F69A 3OYLA 2LXJA 2KK4A 4UP7A 1FNUA 5EQ0A 1AVZC 3T13A 4HCEA 2NN6I 1S40A 3EROA 4N4GA 1PH2A 1MSGA 3RZDB 4DR3Q 4C1NI 1IXRA 1IO6A 1IBLL 1PH8A 4RGOS 4APVA 2D1XA 2AQ1B 3EFOA 4DV7Q 1YNXA 3L3OC 1HPCA 1CSPA 3JSCA 1FMWA 3CKIB 4OGEA 2RD1A 1AEYA 2ZT9C 3JAME 3I7FA 4KJNA 2YSQA 1JE4A 1QMCA 2BTTA 3BS1A 3D6WA 1Z9QA 3D4WA 1U4MA 2WKDA 2CP6A 1RKNA 3T51B 2OTLT 3SFMA 4A4GA 4M7DC 1T3SA 4J9BA 2LQKA 3PMFA 5GMKi 5CORA 3CPFA 3CC4A 1FVIA 1Y57A 3SWNC 4JS5A 4M7DE 1HUMA 1SJHD 2LC4A 3C1FA 1RL2A 3OMCA 3CCMT 1CT1D 1Q1BA 1NYGA 1BQQT 3KLWA 2ESWA 2EJFC 1MHNA 4JOIC 3R93A 3VYGA 1HA6A 3K6OA 4KY7A 5G3LF 2UXDL 1OXTA 4K0KL 3CCRT 3M5AA 5CKDA 2RQUA 5LL6S 3QSUA 2X69A 3OIQA 1KG1A 3K0XA 2A3LA 3M4OH 2LJ3A 2LTOA 5M3MB 2IG0A 4OXPA 3C46A 1LNXA 4D8KA 1M3AA 1S72Q 1SRMA 2WSEE 2RHSB 4HMJA 3KK7A 2DZ9A 3Q6SA 3MEAA 3U50C 4II1A 5G3LD 1D1KA 3JCMf 3PO2G 1GD7A 4X62Q 5J26A 3LYIA 4XIGS 5JJIA 2F0FA 1A0NB 2HMAA 3FKIB 1BCPF 3E19A 3SGIA 3GTJB 2NB0A 2RH2A 4PJMA 2W0ZA 4C5HA 5GAMe 3OYMA 2XWJB 1CSKA 4IALA 4LUOA 1LTAD 4N8X1 2UUAQ 1KNAA 3TCJA 3NPFA 4CC3A 4A3DB 2Y0SG 3L2ZA 4OWXB 5LJ5j 2L3SA 2LQNA 1HZCA 1XMOL 1VQHA 3CRKC 1JJCB 1HNXQ 2Z1CA 4XTZA 1O78A 5GMKh 1O7LA 1NCVA 2ZPFB 3WOFA 3M59A 4QQGA 3ER0A 1WI7A 3EG1A 2DL7A 3QG1A 2PZTA 4J9FA 2KMTA 4C8QB 2GA4B 3OW7A 2YU9B 3GTMH 1NMFA 3H0GH 1WTOA 3K0YA 1Y1VB 4M7AE 2D0PA 3EAEA 4PV1C 2UU9L 4RHRA 5KEEA 4AQYL 4QF4A 3EQLC 4LF9Q 4G7OC 1BCPC 2RI3A 2AWNA 4CKCA 1I8FA 3GTQB 1W2BA 1HCZA 4OP0A 1C7YA 3QIAA 3NGPA 1WCMB 2IX3A 4X65L 1TQOA 2EY1A 1KNEA 4JI4L 8AT1B 1MBYA 5GAEC 2B2TA 2EYLA 4O0AA 3HOZB 1R4PB 1TU2B 1IKLA 4EQNA 1F9QA 4J1MA 4ATOA 2H5XA 4Y28E 4H02A 2K5WA 4NW2A 2KUMA 2A6HD 2HSPA 2FYKA 3CCQQ 2YLCA 1VQOA 1VQ4A 2PCFB 4RAUC 1OOTA 1N36Q 2CT4A 4LF7Q 3LGJA 4OONA 4A4IA 4DPGA 4MHEA 1FYCA 4RTZA 1FGUA 2B86A 4PMCA 1YIJA 2AQ3B 1S72A 1YBYA 3RNUA 3GTMB 1C1AA 4OMOA 2CH4W 1SAPA 4BY6C 2OF1A 3S16B 1RHPA 1N9RA 2CZ7B 4LE9A 3EH1A 4B9WA 3G6ET 2RHQB 2XMFA 4OIJA 5GAMg 4A3MB 4XTWA 4OB1B 2R92H 3GV6A 1HTPA 4F7UG 3S14H 3QBYA 4FP5D 1RD9D 4OGQC 2E2JB 3NFCA 3HOUH 2JA8B 3U23A 5J3BA 4ZTFA 1B70B 2ICIA 1X6BA 4BBSH 3KXTA 2F0OA 1B34B 2QQRA 1FX7A 5LJ3h 4XDXA 5JPNC 4XQ3A 3CC4Q 2JA5G 4RFBA 2TMPA 1EY0A 3Q1JA 4F16A 4JI7L 4M7DA 4E7HA 2Z6KA 4PJNA 4UY8C 1VQ7Q 2B2VA 2DNCA 4R4QA 4BA1I 2M0OA 3G71A 2PMZB 4C0GA 1W70A 2DRKA 1Q46A 2V26A 3W1BA 1NSNS 3K5MA 4HVVA 4OMPA 2AKKA 2A73B 4LNQA 1X43A 2I5LX 5C4XG 2BA1A 3M55A 3M3YH 3TDQA 3RMSA 2A19A 4V0BA 1EQQA 1PKSA 3FEOA 3CEYA 4QCLA 4OMNA 2LXKA 3L7ZC 1EU3A 1X3QA 4A3CH 2EQJA 1Q7YR 2KQ3A 5IGBA 2N55A 1PRTD 4M7AA 4KUDK 2IX0A 3K80C 4CBVA 3CC2T 3JCMP 1G51A 4U68A 5IYBG 4DR5Q 3S2HH 2O5JC 1H9SB 5T1IA 2O31A 4C92C 2ZPIB 2DJGC 5D14A 4KUIA 2EFIA 3M4YA 3P8BB 4JZ3A 4LNPA 2L55A 4DBHA 5C0MA 3FIFA 2BE9B 1CKNB 2OEOA 3TS2A 2PQAA 4DV7L 3CCVQ 4PJOB 4P74A 1B9NA 4LFAQ 3INZA 2MMPA 4IN3A 4D8DA 1MKHA 1N33Q 2LDMA 2X3WD 1PXUA 3MC0B 1L1OC 4PMBA 3BYTB 2J6FA 1BBWA 1SYBA 1EY6A 2LKVA 3PCOB 1G6PA 2A6ED 1ET6A 4CJ2C 1N9WA 4KKTA 3M4PA 2B2TC 4C3JB 4BI8B 4C2MH 3I4MG 3L2WA 1FJGL 2ZJPA 4C92D 1KD1U 1PH4A 4N4HA 5C44G 4YY3Q 1RLPC 4DKAC 1B3AA 3CMEQ 1OX8A 5BN3A 2HCKA 1VQAA 1HD3A 2M2LA 4M7AG 2A69D 2ZTEA 4DR1Q 2ALYB 4LDXA 2G5DA 1B9MA 4RTYA 1Q90A 4C5GA 5GQOA 1WDXA 2AIRB 3VYHB 1MJCA 1E2WA 3TP7A 5FOBB 2FFKB 1I0CA 2IL8A 1UUEA 4F14A 2XIDA 1UJYA 4IPHA 1ZEQX 2KR3A 4PZ8A 5JEAJ 1DJRD 3FPUB 3BZKA 1R8OB 2B2UA 1HQMC 4M78C 1L0XB 1SYGA 3S1RB 1BU1A 4GZYC 1DYQA 4TQUS 4FF4A 1A3TA 5LMUL 1PTOD 1STHA 3HKSA 2NVYB 2UXDQ 2QCPX 5FU7C 4KD4A 3HOZH 3CC7T 5T1GA 4BXXH 2EVBA 1NNXA 2WAQG 1CKAA 4M75B 1HZ9A 4DV0L 3JC66 4DR4L 3ICEA 5LMUQ 4ULLA 2JTFA 1PNJA 4JZ4A 3HOVH 5IXFA 3BU2A 3RN5A 1R9TB 4JLIA 3OYGA 1M30A 3QOLA 5GAGC 3G6EA 3HOWG 1ZKOA 2AWOA 3I90A 2R5AA 4TVRA 3HPWA 4OB3B 5LJ5d 1YJ9Q 1YJWA 2RJEA 4IZ8A 4DK0A 1G291 3EG2A 1O7IA 4GLVB 2QDYB 2JA9A 2KGTA 1EQRA 3C2PA 2DRMA 1MV3A 1N36L 4FYXB 1Q8KA 1BCOA 2RQTA 5KE2A 1K83B 3L0OA 1SNMA 3STBD 5C3WA 3J80E 1GUSA 1ZA2B 4KN4C 4IUTA 3JCMJ 2I5HA 5CV9A 1MJEA 2E6NA 1V29B 1N9SA 2E41A 1ICWA 2XHCA 2FPDA 2NYZD 3A7LA 1WQ7A 2YUPA 1DOMA 1EY9A 3KFVA 2B39A 4DXGA 2KHSA 3MFYA 3S1NB 2NVYH 1IBML 5D6XA 2LP5A 3G71T 4K5VA 4LDWA 3WWVA 4M7DB 4Z8AA 4C92A 4NMZA 5M3FG 1VCIA 1RAAB 1BF4A 1BI1A 4IFDI 4OX9L 4EX5A 5IE8A 4A3JG 2NVQB 3EGDA 3U9SA 3HOYG 1XNRL 3VUZA 1S5CD 2R7ZB 1D2BA 1M4VA 1E2VA 2E5KA 4XU0A 4BI4A 4M75A 2GBQA 5CK9A 4R4CA 4RA8A 3NE5B 1DGSA 4HIDA 2VC8A 5GAOn 1EUJA 1VQFA 4CHTB 2EJGA 4H13C 1QUQB 1YWOA 4R4IA 7AT1B 1NZ9A 1BNZA 4GNXC 2PNHA 2EWNA 1BI2A 2B8FA 3QWNA 1HNWL 3IRBA 2ENMA 2ZGWA 1F1BB 2DERA 2CP5A 3PF5A 1WCMH 1BCMA 2XDPA 1LM0A 2K57A 2VW9A 5K36H 1CKNA 1VQGA 1A63A 5D7UA 1PFSA 4PFPA 3GP8A 3IAYA 4F7UF 2K33A 1KFZA 3KYHC 1YWPA 3SD4A 1UGVA 3EGXA 2A08A 1M1KU 5CAIA 1RDPD 1SNOA 4HCKA 5KRUA 5AJ3L 1JBMA 2YRVA 4X66Q 3G6JB 1IYVA 1C0AA 4AYBG 1MGQA 3RESA 3NQTA 1L1OA 1OI1A 1QZHA 1W1FA 2CS7A 1G3YA 5ELDA 4DV1Q 2AKWB 1XPOA 4DR6L 2ASBA 5E3FA 2EQMA 3A8KE 4HJ8A 4CKBA 3LH5A 3I73A 2GFAA 3OPOA 3EVQA 3Q8DA 4ID6A 4A53A 2XN9C 1OULA 3CXCA 1QNUA 4V2SA 2A68D 1Y07A 3CCEA 4JRIA 3JB9D 1VQ5Q 2KA7A 1NY4A 2KRSA 2F0SA 1WTWA 1PV4A 2R7ZH 1QQJA 5FROA 3EHRA 4LD6A 2DYIA 1JB7A 3KJPA 4C3IB 2UXCL 2KJXA 1FR3A 3VJPA 4XTUA 3H0FA 2K3BA 5KCOA 2CW0D 1BB9A 1EYAA 2HNIA 4CGYB 2DKGA 3OS0A 2L12A 2E70A 1ZSZC 4M77F 2NZOA 4RCNA 4A3IH 2LT4A 4A54A 4PZ6A 4LF7L 3W2DA 4QT7A 2DXUA 2D2CC 1I1JA 2EY6A 3C12A 3X20B 1ENFA 4L63B 4M78A 3SR1A 2MFIA 5KGUA 3ZYYX 4BBRH 1I4HA 4X64Q 3T1YQ 2BKDN 4BY6B 4DV5Q 4JBMA 4O1NA 2E8GA 2FPEA 2VGNA 1UUPA 2K50A 3K7AB 4WCIA 2DK3A 2RQWA 4C3JG 4ZN3A 3HEJA 2F2WA 3TSWA 5DEHA 4ELYC 1SEMA 5C4JB 2H1EA 1M8VA 4OX9Q 4C92E 5FKAC 1YHQA 2EYOA 1PYSB 3MXUA 4XK8E 3P7JA 4HMIA 1Q81C 2O4XA 1VS0A 4CRIA 1U9RA 3HTRA 1YHAA 5KNDA 2VL6A 4JI4Q 2GGRA 2JT4A 3LW5E 2FVUA 3J80i 1EWCA 2B2YA 4M75F 2XNAC 3QIIA 2GNCA 1JOOA 4ME3A 2A69C 4M1UB 3D0FA 4ZK9B 1M1GA 1BO0A 4AYBB 1PFBA 2EYXA 4QGUA 4LF6L 3TEHB 1G6ZA 4F8MA 3RKXA 4JG2A 4A3KH 5C0XH 2F0EA 1QCBD 3NXWA 3E0JA 2K4KA 2RQXA 1VQLA 2CUDA 4UP9A 3MXPA 1SRLA 2N78A 4A3IG 2KT1A 2DEQA 3R8BA 3PUVA 1BOSA 5IHNA 1PTOC 1EL0A 1HNXL 3RKWA 2FJ2A 2ECZA 4B9XA 3JB9J 2E74C 3OYYA 3RR5A 4M7DF 5IHKA 3ERSX 4DR7Q 3JB9H 1I4QA 3AMUA 1N32Q 2BH8A 2EYJA 2K52A 4GLAC 4LXCA 1WHJA 3CXCS 3M85A 2MP1A 1SRUA 2MHVA 4XQQA 1X3EA 1TG0A 2X51A 4ZAIA 1F77A 2NUZA 2PVGB 4EPCA 2MYSA 1S5BD 1UE5A 2PNRC 1H641 3CC7A 2EYHA 1J5EQ 1E7OA 3FB9A 1VIFA 4JRQA 3PUXA 2DL5A 2NZ1D 1RTNA 3GQBA 3EFRA 3ZJYC 1OZ3A 3M58A 2G6FX 3JCMd 1UEAB 1VQCA 1MI2A 4K11A 1Y8NB 2EOTA 3MVVA 4JI0L 4LFBQ 2KY9A 2ATCB 3C1EA 3S1MB 3RBBB 3FDRA 1TWGB 1G2BA 3CCRQ 2RBMA 2DA9A 2O2LD 3FEWX 2M9UA 4JI5Q 1GCQC 2PVDB 3ERQA 1N6AA 3JCMe 3OSSC 4R8NA 2RDGA 1VQ9T 4V190 3TQ7P 1I4PA 2KOLA 5CR2A 1MNDA 2CQOA 5H1SE 1PTOH 2F0LA 2CP2A 3VA5A 3H41A 2JQOA 1QLYA 1LTLA 5CV5A 4JLGA 3VUBA 1GUTA 1LTRD 5COYA 4DR2L 1JXOA 4N4IA 1YITQ 2LMCB 2HL5C 5NUCA 1WD0A 4QQDA 2G9HD 4JV5L 5CVIA 2AMCB 2PQAB 2K4YA 1BCPD 3GTGB 4UC4A 3M0RA 1NJIU 3WVDB 1SHFA 3LLRA 2QTVA 3GLXA 3OS1A 2B63H 2VXEA 5GANj 3CC2Q 1IRXA 3DB3A 4HEDA 2BUDA 4CDEC 2V1RA 5GAHC 3C0CA 4JRKA 3VS0A 4JC0A 1XNQQ 3L9AX 4M75G 1IB8A 3NQIA 1TS5A 1TTHB 2HHHL 2K5FA 1Q95G 1ML0D 1U4LA 4IUPA 2GVBA 3W3AA 1IBLQ 5JEAH 5CV8A 3HKZE 1JJ2A 3OYJA 1TWHB 5EBDA 2QK0A 4DR5L 2X4JA 1QJOA 1TKWB 4FSSA 5IGFA 2IHFA 2QA4T 3THKA 3CCSQ 1VQ7T 3M0TA 2OQKA 4M78B 3UWNA 4MZPA 1YIJT 1JC7A 3H9NA 3TMEA 3M0SA 1PSFA 2QW7A 1N34L 3I56Q 2RJCA 2LCSA 3E1SA 5FJ8H 4AQYQ 1X2KA 5FLXE 3FJ5A 2F1LA 1ILQA 4LF8L 3GTKB 4J9IA 3T16A 3I2ZA 1BR9A 2ZM6Q 4HCSA 1EEFD 2K3XA 4Z88A 1KABA 1Z6HA 2I0NA 3T1YL 1QG7A 2E3HA 1AWOA 2SNSA 3NUCA 1YNNC 4P72A 3CPWA 5C44B 3MCAB 1MNEA 1TS9A 2FHDA 3ZL7C 2Q8IB 2DTIA 3L2UA 1DXMA 2A68C 3HOVG 3SWNA 4KY5A 5ELNA 2KHIA 4MTKA 3UDFA 3T1HL 3ULJA 1VF7A 4A3JB 4J9CA 1XJWB 1FNWA 2XVSA 3MXNB 4ZQ3A 1ZBJA 4OB2B 5M3FB 2FEIA 2HDAA 3RDVA 1KHCA 2RMOA 4PFZA 4NOYA 2ZCFB 2DX1A 5FJ8G 4A93B 3CCVA 1FGBD 2A0FB 4Y7NB 1AZPA 1T9HA 5K36G 1PFMA 3CCQT 3PTAA 4JJNK 3DLMA 5J22A 2M0YA 2LS01 4GLKA 4O6JA 2ZZDA 3H91A 2E2HH 1QKWA 4X62L 4JI1L 3KDFA 1Y69U 2OWOA 4DR6Q 4GN4B 2KXCA 3M57A 1WOCA 2RKSA 2JUFA 2VY3A 2RNAA 5JEAG 2RHYA 4X66L 2K32A 2F2VA 3MA2B 2OCEA 4J7FA 4XYQA 1IKMA 3NHNA 4ZKCB 5LHY1 1VQ6T 4YCWA 2AKLA 4UPAA 4J8OA 1I3QH 2DVJA 2YXYA 1EY4A 1WXUA 1SMYC 4CDDC 3IFDA 2MPXC 2M51A 3MHBA 5D3DA 4ZNXA 4X6AH 2OXPA 3OW2P 2K01A 4K2LA 3HOYH 3RR6A 4JBJA 2MF2A 4C56C 1SXTA 2J6OA 4A3GB 2F5TX 1SE3A 5M3FH 1YNJC 2E64A 3H0GB 4LW1A 1A3VA 5EPJA 1NLOC 2ZPBB 3VRYA 1P16A 3F2DA 4P2CB 1M1KR 2L89A 4XAXB 3M0PA 1K83H 1EIGA 1STNA 1U4RA 2K04A 1YHBA 4BA2I 3Q23A 5I22A 4P71A 4LF9L 3EG0A 2R57A 5CKEA 2QEXQ 3C3LA 2DD4A 2VQEL 4UAIA 1FD7D 4OMFB 2DBKA 2E12A 4FCYA 1IHZA 1MD2D 3CP0A 1PH1A 4KHZA 5C4HA 2QI2A 2B8GA 1ZA1B 3GNGA 1EZ8A 1NBEB 2X4XA 1YVCA 2F0HA 5I2MA 3MFGA 4E2FB 4F04B 4RUGA 1NAPA 2BZXA 4DNTB 3HOWB 4IIOA 4ESRA 1QCOA 1EOVA 5AJ3Q 1XJVA 1VQ6Q 1VQ4T 4PL6A 5HCKA 3QZ9B 2DJFC 5I2SA 2NVTB 2F0IA 2AZSA 2J6KA 3NTHA 2HCCA 3VR2A 1XMOQ 4ZTJA 5C4ZA 1J3TA 2QQ9A 3OB9A 1NTGA 3BY7A 3CC2A 1TWAB 3OMGA 5FRMA 3OYKA 2WKCA 4OMQA 3CW2C 3J81L 4J8QA 4O42A 3W1GA 3DKMA 2R7FA 2FZKB 1FNVA 5IT9c 1HR0Q 3LWUA 4IUUA 3DMUA 3V8LA 3TS0A 1G3SA 2DPPB 2NBFA 1ZSGA 4C8QC 2K6AA 3KF8B 4N9PA 4HSPA 1B3QA 4ZN1A 1CHQD 2NUCA 1NG2A 4JI3Q 3V7SA 3I9QA 5IYDG 4DOWA 3CQZH 4M7AF 4YWLA 1TU0B 3VU3C 2A36A 5GAOm 1D8LA 1F2YA 2DY8A 1UHFA 4A3KB 3HP9A 1R77A 5GAMj 1VQDA 3GTPH 2L3RA 4C0ZA 2Z6BA 4WJ3M 5IWAQ 1B50A 2KECA 3X25B 4BBSG 1WCMG 1Y8OB 1KQSP 4RHSA 1D3BA 4M78F 4MZTA 1AP0A 4DV3Q 3UDXA 2WB1B 1Q81U 4XYOA 1AH9A 3QUIA 5C0XI 4J83A 4C8QD 1N34Q 2E1HA 2X3XD 4AT1B 5GANg 2AQ2B 3I4NG 4A4FA 4JW0A 1W6JA 1MMDA 2XK0A 3ULRB 2D8JA 5KYYB 1CZWA 2UUBL 4FYVB 3JAMi 4I7AA 1S4ZA 1LUZA 2KVMA 1V76A 4DAMA 4KHPQ 3LH0A 4RGMA 2VYTA 2KCTA 4AFSC 1KQ2A 4OWWB 3G4SQ 2KEAA 2K6DA 5K5PA 1Q82R 1NBWA 1I4RA 5GMKj 5C5MA 3GNFB 1GUOA 3NWTA 2Z4IA 4TVAB 2GVAA 4JUVA 2F0GA 2L1BA 1D5MC 4P73A 4F7UE 1HYOA 5EKKA 4DAPA 2Y0SB 5KNBA 1NLPC 3CQZB 2XI9A 2KQWA 3B6YA 1CI3M 3F1ZA 2VV5A 4RMFA 2VNUD 1W6XA 3L2RA 3NK9A 2H8HA 4C3IH 5GADC 1SYCA 3ZFJA 3M0UA 4IQZA 3CHBD 4PZ7A 2K28A 4A3EB 3DWQA 3EFXD 5A2QL 1Q86C 4E47A 3OWFA 4YY3L 1QVGP 1YCSB 3QB3A 2YDLA 3CCQA 4QQ6A 2RHZA 3E2UA 4RG8A 4HTHA 2WINB 2NLUA 2JK8A 3OYAA 3H09A 1G83A 2EXZA 2E2HB 5KYWB 3MHXA 5IYBH 3PO2B 1SFOH 5CCAA 3CCUT 2CZ1B 1PHJA 1ZUKA 4KT0E 3OS2A 3K7AH 2O9VA 1C8CA 5FK9C 4J6YA 4XTYA 1TUGB 2D8HA 3VR5A 1WJSA 5C0XJ 3EG9B 4X9DA 1E0BA 4DV3L 2F03A 2W10A 3MEVA 1TS2A 4B3MQ 2P0KA 4C2MB 1U5SA 4FXKC 3NELA 3FJPA 1D0XA 1B8AA 1H9RA 3GIBA 2RCNA 4Z9CB 5EPKA 4P75A 2LJ1A 3T4AC 3I35A 1I4GA 2OQ0A 5CV4A 4Y52H 1Q82U 3A5ZB 1AT1B 1LYLA 2JA8G 5JVG3 2X6GA 1EY8A 3OHXC 5JVH3 1TUCA 1ENAA 4IPCA 1JJ2S 1X75C 5EKIA 4JI2Q 1C4QA 4QVCA 4K8IA 3OSVA 2PO4A 1EU4A 4DK1A 1LTGD 1H9SA 4C8QA 2KSSA 1HR0L 3H6MA 2QDBA 3ND9A 2I07B 2PZ1A 3HFOA 4LUVA 1SSFA 2KYMA 4LWCA 5IOCA 4B3RL 4X3SA 1M3BA 4C92G 4LDVA 1BXTA 1NJIC 1JORA 1V1CA 3QYGB 1PZKD 1SLJA 4ZGJB 2DMOA 2QKIC 3PO2H 3HSBA 1WFQA 3RNJA 1JMCA 5CGKA 1IBKL 2Q2HA 2D0NA 4PK4A 1ASZA 3AQQA 1TWFB 2JMAA 2FL7A 1WXTA 3ZBDA 5CQXA 2YRCA 5I2XA 4I65A 4L8JA 1IL2A 1NJIR 4XU3A 2RJFA 2D9UA 2EYPA 1ASYA 1SROA 5KYIA 5C44H 1WI5A 2YYZA 3AFQA 3QJ6A 5HY6A 4CKEA 2F0VA 1VQNQ 4DV4Q 4A4HA 1OEBA 4RGNA 3EGUA 5D65A 5IP9G 3IQLA 2BE7D 3P20A 3UF4A 4DXFA 1CSQA 4A3JH 2P5ZX 3I55T 1JU5C 1YNJD 3HOXB 3J7AF 3C94A 4PJOC 1VQLQ 5IODA 2GN5A 1SNCA 2PPBC 2UXBQ 4HT8A 2C0TA 2PZUA 4A75A 3ZEHA 1L1OB 1OX9A 3NWSA 3VYTA 3VKIA 1V1PB 4G57A 3J7AV 4S3SA 3GTLB 3KFUA 3K7UC 1PWTA 2DXBA 1I5LA 1B07A 5KIXA 3J81c 1Y1VG 1QP3A 5GAN2 3GPLA 4M78D 2YHTA 1JWSD 2QDLA 3L1AA 4M77G 2EYQA 3H94A 3M4QA 3SE0A 2RQVA 3A8MB 5KNCA 2Z4HA 1EQTA 1PTOF 1TWCB 1J8IA 3CPWS 1TIID 1VQMT 1ILPA 1OPKA 1D7QA 4JI7Q 2V1CC 2J05A 4FVMA 5GAN8 3OIPA 4R8IA 3HG9A 4HJ9A 2C0IA 2WSCE 4M75D 3E9HA 1CK1A 4ORZA 3LNNA 4QIWB 1K1ZA 5M9OA 1NMGA 2EQSA 2L5QA 1CKOA 1OXUA 3I56T 1WA7A 1CM9A 2JP1A 4TRDA 1T3LA 1PRTC 4E7LA 4C5EA 1RAHB 2TSSA 1X3PA 4BE2A 4KKUA 2B63B 1K8MA 1G3WA 2HQHA 4ILWA 5C6SA 2MK5A 4EDUA 3OBWA 2YTXA 1PH5A 4F7UA 4GKJL 2RCFA 4PMWA 2KNBB 3BYYB 3OOCA 4LAAA 4BXXG 1WTXA 4WJWA 4IIMA 1GXIE 1HFGA 3P75A 4RG1A 2JA5H 2UU9Q 4LD9K 4M75C 2KBTA 4A3MG 2F3VA 3S14B 1KC8U 4LDUA 2L8DA 1PFNA 3CRLC 3OA6A 2CP7A 1XXGA 2XGTA 5C3EH 3F2CA 3OS5A 1F9SA 1D5ZC 1LT3D 1Z9FA 5CYUA 4C8QE 1VQ9A 5E4XA 2AZVA 2KAFA 5GAN5 2EXDA 3Q22A 4RTWA 1OTCA 2HIVA 1TWCH 1RODA 5GJWB 2F5KA 4GNXA 4JYAQ 4FU6A 2Y90A 1LVKA 3BFMA 1YJWQ 1STYA 4MZ9A 5M5YB 3H6ZA 3QKJA 4J9EA 3IL8A 3MWYW 3S15H 4IFDJ 1ZBXA 3CC7Q 2HCIA 2FINB 3CCJQ 5I9OA 2QG9B 2KCNA 3K58A 2NVTH 1YP5A 1SJED 4A3BH 2DL3A 3STBC 2R93B 1G2TA 5CKBA 3KDFB 2NYSA 2HKQB 4ME5A 1I94Q 4DAYB 2HQLA 3A8JE 2EPDA 4XQJA 4FF3A 1VQPA 4IPGA 4XU1A 5IN1A 2HDMA 3SEMA 4C3HB 5GAN7 1Q86R 1ESFA 4RTUA 1X69A 2WAQB 1NR4A 1PH9A 2DXTA 1LTTD 2F0NA 2IW3A 2KHJA 1BIAA 3MZ5A 4HN7A 3I56A 1DOKA 3QDFA 4GY5A 3EBEA 1Y96A 2JA7B 2EKHA 2KDSA 5CQYA 2DETA 2H4OA 4A3FH 4JJBA 5HGQA 3CF5A 3GTOH 2DNEA 1TT2A 3BE3A 3VA7A 1ARKA 2BZYA 3PE0A 4BBRB 1KIKA 4KMUC 4KY6A 1Y14B 1T0JA 1MMGA 3PSIA 2LQWA 2Y4YA 4IUVA 4XTXA 2RA2A 2XDBA 5FU7B 4Q5WA 4FNFA 4QL5A 2E2IH 3A1PA 4HVWA 1WHKA 4AFUC 2IHEA 2VQFQ 2M00A 2QXFA 2VWFA 5A2QE 1WNLA 4M77C 2FRWA 1JJ2P 3CCUA 1I50H 1AWWA 5BR8L 4C3HH 4E7KA 1D1IA 1GVPA 1EOTA 4A3GH 1FMKA 4J6XA 1E2ZA 1HZBA 1UGSB 1SSOA 1TH7A 3HZXA 1CKBA 2LJ0A 4HCBA 1QWYA 4DR3L 3A56A 1KK7A 3CD6Q 3GTLH 4QQBX 3QYHB 4KGVB 1GCQA 2K03A 2RK1A 3EGXB 2P0QA 2HQXA 2JXBA 1MHWC 2A6HC 6AT1B 4POFA 3HRUA 4NP5A 2KBNA 2R92G 1PG5B 2MI6A 3PGGA 1VQMA 4GOPA 2R3ZA 3SEBA 5GANh 3JB9I 1TUDA 4CC7A 5E1FA 1JT8A 4KGZB 4R56A 2D62A 4LFCQ 1MIUA 1KDAA 5C5LA 1RUWA 3RUXA 3A54A 3FRPB 2WP8J 1VQNT 4MN3A 5M5YH 2HT1A 2NVXB 4M77D 5AYFA 3OYHA 3H8ZA 3MPUB 1Q8IA 1GO3E 2DN8A 1PYBA 5GAMf 4WRDA 1G8XA 2F0JA 2NWGA 4JI8Q 3S17B 2DLPA 3RMHA 5EAYA 3EH2A 1X56A 1K3RA 1Q1EA 5IIFA 3DWPA 3S1MH 4E7IA 1DONA 2JA5B 1EX4A 2L15A 3MEFA 3H0IA 3MEHA 5EJWA 5I6YA 1SE8A 1JOKA 3I55A 3FLGA 5I21A 1QB5D 3K59A 1KRTA 5JAVA 4R4OA 1DZ1A 1MGSA 5A0LA 2GCXA 4QKUA 1EFWA 2SNMA 1HNZQ 3J80c 2JA7G 1KQ1A 5A0DA 4LFAL 3K8AA 2ZJRA 2HHHQ 1WPYA 1H9KA 1XMQL 3QHSA 2JSOA 4JJCA 4OB0B 1TWFH 2QGQA 4E7ZA 1K8OA 1WFWA 3NBHA 4HT9A 3EA6A 1M2VA 4BY1G 3H0GG 1J9OA 1VQKQ 4DK3C 2VQEQ 3JCMg 3H15A 3R2TA 2K5QA 1Y1VH 4DK6C 3PF4A 3GF5A 3OY9A 4LFCL 1KIXA 4XTVA 4HCZA 2EQUA 5L8RE 1ESRA 4JJDA 5FW9A 3CCVT 5HURA 1HZAA 1VQPQ 3PIO3 5CO7A 2WB1E 5ELBA 2CW0C 4GKKL 1Z9ZA 2R5MA 3G1JA 3WDNA 2J7IA 4IPDA 3MAQA 3NEMA 1LTSD 5A35A 2MUYA 4KTAA 1HTLD 3S16H 2FXQA 1B7TA 4JRPA 1PDQA 5HK0A 1LT6D 1GRIA 2WACA 1VQOQ 1KDBA 1PRMC 4M7DD 1YJNT 2JE6I 2Z8LA 1BI3A 2L0CA 1AZGB 2EYZA 3K5OA 2RSOA 4CC2A 1V43A 4JI5L 3A7AB 1YIJQ 3CMAT 1J6QA 3I5RA 4L59A 1TVXA 1YEZA 1F2MA 2HBPA 2E4HA 4A3FB 1CQVA 1UDLA 3GDEA 1I81A 2VVKA 4N8FA 2F0KA 4M7AC 2B3GA 1LV9A 3VR4A 1OQKA 2LZ6B 3H0HA 2KEDA 3LWEA 1R4QB 1FWZA 4KBMB 4MIUA 1K9MR 1GBRA 1ENCA 3FC3A 5BR8Q 1L0WA 5M5XB 4GOPB 4G4KA 1I6VC 3JV3A 1JO8A 2COZA 2HAXA 5LJ3g 4DBQA 4FW2A 1ICFB 2RPNA 2Z6KC 5FU6B 4DEXA 3I70A 3CCRA 5DM73 4B3TQ 3PGZA 3J81i 1PZJD 1CA6A 2Z0WA 4M4ZA 2K5HA 2O2OA 3QWYA 1VIEA 4DF7A 1HNWQ 2LNHB 3PVLA 2E2JH 5LMNL 4JVZA 1WTQA 2K9GA 1IGUA 1QVGA 2DF6A 1PCXA 1A2TA 3CXCP 4J7IA 3T1HQ 3JAML 4VUBA 4BE0A 3VS6A 2L9HA 2MQHA 1BK2A 3I4MB 1XOVA 1K73U 1HXDA 5AFWA 3G71Q 5J1ZA 2EYWA 1KHIA 3S2HB 1VQIA 4A93H 1H9JA 4B6MA 2MGSA 2MAMA 3X28B 4DV6Q 3X3NA 4OO1H 4AFQC 4J6WA 1Q3LA 2ZPGB 4N0AA 4FYWB 2SOBA 3X3MA 5EC7A 1U1TA 1X9NA 1XNRQ 2FZGB 1D6EC 1X3FA 5KE3A 1BBUA 3R6NA 3RERA 1T5EA 4RMOA 4RKLA 5M5XH 1AWXA 1VQOT 1LT5D 3KLSA 2KRNA 1EFNA 5ELOA 2HUGA 4DA2A 3RN2A 2OX7A 5M5WH 4A3FG 3D4DA 1PC0A 3PMIA 1I94L 2DJQA 4NXML 2DZCA 2JVVA 1UFFA 1XYIA 1I3QB 2X35A 2MCNA 5JPMC 5EG2A 5IHIA 5JOBA 1Y0MA 1D1AA 2DO3A 5ELEA 1Y1WB 3O13A 3M7GA 1TXQA 1H92A 3L2PA 2IJ0A 4BUGA 4IOCA 3NTKA 1SE2A 5D3IB 2EW3A 1XX8A 4PNYA 3FP9A 2XU8A 1GUGA 3RLOA 3A8IE 3ITPA 4DV6L 2V1QA 1XNQL 1E24A 4F7XA 2R93G 1BYMA 2Z9HA 3J81j 3C4SA 5IP9H 1K0RA 2EZVA 1X27A 1RABB 2J7ZA 3U4ZA 1XWEA 2EJMA 4OHJA 1TOVA 5GANd 3KLRA 1DM0B 4DBRA 1UWVA 3SVMA 2XDDA 4CI0C 2JMCA 1MMAA 3VS1A 1ZUYA 4FDBA 3PMTA 3NMZC 1I5OB 1IGQA 2JN4A 1ZHIA 3GTJH 1CHPD 3VDYA 5GANe 2YUQA 2B29A 3FMCA 2UUAL 3S3MA 4DOVA 3TZDA 5KYUA 4MZMA 4D6WA 3I4LA 3QO2A 4A4KA 4LN2A 2K2MA 3BJUA 3CCET 3GD7A 1RAGB 2CDTA 1YI2A 2VB3X 3CBMA 1QVGS 4TSSA 2C0OA 3PUWA 2ROTA 1SMYD 1MSHA 5C3EB 3HKZG 4MDXA 2HSEB 3RLNA 2Y4XA 1MMNA 4I7ZC 4L6TB 1WYXA 3TBIB 5IYDH 4A3GG 2F3WA 4YWMA 5KYUB 2RA4A 1IW7D 1Q12A 3FHWA 4R0KA 3OQ5A 3CMAA 2VB6A 2JJQA 2K1BA 3EG9A 3BZDB 2F0WA 4O2DA 2Q8RE 3HGBA 4JOIA 2A5HA 2B2WA 1LO5D 3WOEA 3H3VH 1VYTA 1CUKA 2H3EB 4FW1A 1GL5A 2K3YA 1OO9B 4ZGDB 4OMMA 1GXDC 4NXMQ 4M77B 1D1CA 4RCCA 1K9AA 1YJ9A 5EKLA 4JPBW 2ZJQA 2UXBL 1UB4A 4HVUA 4J9DA 4YTLA 1LLRD 2GFUA 2Q2TA 4M8AA 1D3BB 2ZAEA 5DLQE 1A0IA 1KAWA 2GTOA 2DUDA 3RMQA 3V7CA 3HFNA 3P8HA 3R6OA 1IYUA 2YU9H 4FT4A 2YRDA 4R9WA 1U8RA 2DEUA 1GJXA 4DUYQ 5IGCA 3KF6A 4B3SQ 2YT6A 5ELCA 2NUPA 4FYYB 4OIKA 2LFNA 1G3TA 3QZ5B 2JA6B 2QQAA 2FMMA 3KF8A 2V8IA 1ET9A 5F2DA 2D0QB 3I91A 4Z02A 3JCMX 3GTQH 4EVOA 1IBKQ 2RQRA 1XQHA 5I6WA 2FZCB 3UDGA 4EQPA 4C8QG 3VRZA 1JXMA 1WTRA 1DCZA 3L2VA 2D0OA 2RF4A 5AT1B 1UE7A 4UDUC 2P4TA 3UA7A 1JWUD 2JEAI 2DBMA 3O5ZA 2F0DA 3OW2S 2WB1G 2QYZA 4POGA 3HOXG 4FYDA 3E9FA 1UECA 2XRQD 3RIRA 2JN0A 4DQ2A 2EDGA 3T53B 2LRQA 2QA4Q 4K5WA 1PHTA 2FMCA 1VOMA 4IURA 3P1HA 3KUPA 1QWFA 2F3IA 4DFAA 2A28A 3X26B 1M1KC 4K6LA 1TY2A 3JCMV 4GOPC 3TU4K 1SR3A 2JOYA 1FL0A 1O75A 3VYRA 2O01E 2RVLA 3AEVA 4WORA 2DL4A 1K0SA 4M78G 5M5WB 4QVZA 2DILA 1Y8PB 4JI0Q 1OV3A 4LFBL 4FF2A 2PMZE 4BACA 1DOLA 4A3MH 4K5XA 1OXSC 4K8JA 4HXJA 4LF5L 2JA6H 3OYNA 4TKOB 3J81E 1VMPA 3PFSA 3CPWP 1QVFS 2PUKB 3ME9A 5GMKe 1NE3A 2PI2A 1A2UA 1SDFA 2F4VL 2JA8H 3HOUB 3VR6A 4BBSB 4A63B 3VS5A 4L5SA 2IVWA 4WTOB 1A6XA 4AIMA 2F2XA 4X34A 5GAN3 2PQEA 1WHGA 3V8JA 1JQYD 4ZRZA 4RTVA 2MOXA 2EY5A 5L23A 4Y7NH 3EIVA 1MV0B 4L5QA 1WGSA 1CA5A 2CWAA 3PO3B 2PI2E 1U1SA 1UTIA 2E5QA 2YUOA 3DM3A 3G4SA 2AHJB 4BB7A 3QR8A 2VXFA 1MUZA 2K05A 3O8VA 4NKLA 4LF6Q 3MXGA 2M16A 4AG2C 4FM4B 1LACA 1C48A 3CCLA 1B44D 2VB2X 3I5SA 2QAZA 2XIWA 4KHPL 1A8VA 3EHQA 1YNND 5CBAE 4GLXA 1KQSS 2RHIA 5GAOr 3JCMh 3PUZA 1YJWT 5BN5A 2EQIA 2F0PA 1SG5A 2ED0A 2F1MA 3PQIA 4KHVA 4X3UA 4DGZA 2CHBD 2JNGA 1G91A 1VQ7A 1SYFA 3OW2A 5DAUA 3CMAQ 3N5BB 2B2YC 2JTEA 3CCMA 4DV2L 1ZYRD 1BBZA 2DFUA
chains in the Genus database with same CATH topology
2V8JA 1NE8A 2KVQG 5IGEA 4ABNA 4OO1I 3L2QA 1WVLA 3S3NA 2BOSA 1YJ9T 5LJ3d 3HRSA 2VUBA 3BVGA 2EY2A 2YLBA 1STAA 3I72A 2D6FA 3SXHA 4KULA 4MDWA 2K5IA 1QVFA 1HA5A 4LMQD 3TZUA 3M7NA 1PLFA 1A15A 3HRZC 3NPPA 4H7BA 3IKJA 1JRIA 1SNQA 1SNDA 4ZGEB 4Q0FA 1X6OA 1EY5A 3MXNA 4FSXA 3J80L 3OYDA 2NN6G 1IW7C 4FF1A 2EJ9A 2PQWA 2B2UC 1HRJA 1SYDA 1YHQT 1JWMD 4U673 3SK8A 1UEBA 2SEBD 4IUNA 3M9QA 3PIP3 1F9RA 4IFDG 1KAAA 5LJ5g 2P0PA 4C0FA 4C92F 4NL3A 2F0TA 1ZYRC 3OYCA 1PSEA 3SK5A 1BUVT 2KCCA 1TY0A 4K2KA 3PIOA 2IT1A 2N88A 3OYBA 5HKCA 4PJOF 3HOVB 2IWHA 3RZOB 4EMGA 2OTLA 4PNOA 2I2LA 2EQKA 3VR3A 2WSFE 2LCLA 3N6RA 3CBPA 3CD6T 5KCHA 4OGCA 1M90U 2JYOA 5GANf 1G5VA 1STBA 1TR5A 4PKCC 2BIVA 4C3IG 4BI3A 3TP8A 4IUQA 1N8RC 2VGMA 5TSSA 5HGTA 1LTBD 2BE5C 2DIQA 1RI0A 3I3CA 2FB7A 1BKBA 3META 2MPMA 1PTOB 4YIJA 2D9TA 1HFNA 4O5VA 1W4SA 1YJNA 3R2IA 5DM7R 4ZLTF 2E76C 3RKYA 1O7ZA 4KKSA 2PZWA 4Y91A 2RHUA 1AZQA 3CCLT 1AW7A 1VQKA 4Q5VA 1VQNA 3LGFA 2WV6D 1LTID 3A8GB 5E4WC 4PQXA 1EFID 1ZQ1A 2OT2A 3EFSA 1OYXA 3H3VC 4KD3A 4XXEA 1HK9A 3K57A 1AFPA 2L11A 3SK6A 2R92B 2EPBA 4RG2A 2QEJC 3FDTA 3JCMW 3UT1A 1F2ZA 2QILA 1K8AC 2XICA 1D5XC 3D4RA 2BE5D 4ZUJA 4X3KA 2DTOA 2EAYA 1YITT 5BN4A 2H3JA 4RCBA 1NR2A 1UNSA 1BBXC 4PLLA 3RD4A 3SWNB 1Y96B 3QOJA 4X9CA 2KEEA 1II3A 2O4XB 2RJDA 3E6ZX 2XWBB 4WF2A 4M7DG 1UGPB 1I4K1 1W6KA 4DU9A 2CQAA 2RI5A 3ND8A 2Q8TA 1H3ZA 5CMDA 5GAOl 5CC4A 3E9GA 3M4GA 4PJOE 3QJYA 1JCKB 5GAMd 2CYZB 4M77E 4XT1B 4EQOA 4K14A 3OYEA 1OXXK 1T5XD 1PYWD 1S5DD 3L42A 1NUCA 2A7YA 5C4XB 1RTOA 1OXVA 2EJFA 3CCJA 2MWPA 3VYSA 2OAUA 2J4XA 3CMET 5FO8B 3LX7A 1AN8A 5J39A 1HXYD 1XNIA 2E75C 4G7ZC 3S3OA 1K9MC 1OZ2A 3FRNA 1Q7YU 2L4NA 1XTDA 1A3UA 3Q24A 4RKBA 1S5ED 4EMKA 3UPUA 5KYLA 3BDCA 4RKUE 2QEXA 2RI2A 1M9SA 2DD5A 2HDLA 3EJIA 3DB4A 1PZID 1ONLA 2BCOA 3UI2A 3NTIA 2E65A 4L5GA 4JDSA 4P5NA 2BA0A 3WVEB 1B53A 1VQ6A 5IGDA 4HAEA 4IKFA 2JZ2A 3HL8A 2J0TD 1M1FA 5I4DA 1NPPA 3DEOA 3JRZA 2LCCA 1JR0D 3F70A 5EPLA 1KDCA 4PLIA 3JB9G 1CQFA 4NDXA 2C5CA 1STEA 4OVAA 1HHVA 1RJTA 4A3BB 2LNVA 2ID0A 4C5IA 5LJ3j 3M54A 1RCVD 5FRNA 5C0XG 3MP1A 3K5NA 2X4YA 3CD6A 1B2TA 4ZUIA 3JCMb 4KV6A 1V1OA 1IREB 3URGA 1Q82C 4HR7B 2OTJA 3FPPA 3J7YW 2EE1A 4XTCS 3DLLA 2EKOA 4NS5A 3GV3A 5FO9B 1VQKT 5ELFA 1Z47A 4A4EA 5I9PA 2L5TA 5C6AA 3TEEA 5LJ3e 1V8QA 4HA8A 1WJQA 3MO8A 5LL6X 4J6HA 3TP5A 2MJ8A 2CZ0B 4BWGB 2RM4A 1I4XA 1KC8C 2JEBI 4BD3A 1EZ6A 2RO0A 3I8ZA 1WQWA 4BY7B 1QNKA 2E2IB 5CV6A 2LVMA 4ZKBB 2D5DA 2QTXA 3IFTA 5IAYA 3CC4T 3KLSX 3BVZA 4F7UB 2A6EC 3HS0C 3DHQA 1YITA 4C92B 3F2UA 1I50B 1K8AU 1EWHA 3TN2A 4FT2A 4M7AB 3K5LA 3CMEA 4KJOA 1X32A 1HUNA 3QDRB 2ZPHB 3V7RA 1SFOB 3CBOA 4K6DA 4RCOA 4FXDA 4QUCA 3A8OB 1H9MA 2JTMA 5GAN4 1WTVA 4PJOA 1PMRA 4BS9A 5CBEE 4HSVA 1G8ZD 1N8RU 1NPRA 1LABA 3HHTB 3MP6A 2RHXA 4C0DC 3M3YB 5DNFA 4QB4A 4EMKC 2X4WA 2XG8D 3LGLA 1VQ8A 3TSSA 4H0LC 1LJOA 4RWSC 3QO3A 5GMKl 3G4ST 3HOYB 1B4OA 3AU7A 3BW1A 1W2BS 1BDOA 2VUMB 1EIHA 2C9OA 4ZYSA 5A0GA 4E7JA 3VV0A 1M90C 2LQ8A 3AHUA 1SEBD 5GAMh 1LT4D 2EIFA 4DAYA 2IX1A 5IGGA 2RK2A 1CFMA 2B2WC 3MEWA 1GUNA 3PIPA 3HKZB 1Y71A 3SHLA 3SDZA 1VQLT 3KUFA 2ZPEB 1B34A 1EY7A 5FU6C 4DN4M 1SE4A 4F88A 2DXCA 3NSWA 4XQNA 4G7HC 4HKEA 2NTSA 4EMHA 2QEXT 1GOZA 4OO1G 1WD1A 2OTJT 3PNWC 2RDFA 1EIFA 1GHJA 1LOJA 4LJZC 2R61A 2PW7A 3A8LB 3V2TA 2V8KA 4BDYA 3G7ZA 1X01A 1DD2A 2M9VA 3DXJC 5D6WA 5FLXL 1I6HB 2NN6H 1IL8A 2PVOB 2BDOA 3BDOA 1HQRD 1P92A 3S15B 4HCCA 3V8KA 3LWIA 3DM1A 1VQ5T 2XD0A 3R3OA 3S6WA 1VF5C 3DUZA 4X3TA 3S9WA 4ODGA 5I2YA 4BY1B 4FL6A 1DJ7B 2DVEA 2G3RA 4EGVA 2WIIB 4CJ0B 5ISRA 2RSNA 4DNRB 2K5LA 3OYIA 3AB9A 2DJZA 4FO2A 1AEXA 2ZXPA 4PJOD 1PRTF 4QW2A 1JICA 3OWEB 5CKHA 2DAQA 2E6ZA 2MWOA 3VYUA 1VMCA 4R55A 1ZXTA 2CKKA 4DA4A 3RUZA 1EQVA 4XT3B 1GHKA 1YI2T 2HD0A 4M7AD 2EJGC 3KBGA 3MEUA 1PRTB 3GTOB 4M78E 5LJ5f 1VQ8T 3U9OA 4JBWA 1IZ6A 3D8GA 2V4DA 1SNPA 3M4OB 2LX9A 2NTTA 1N27A 5CR3A 1SBBB 4MMLA 4C8QF 5CKFA 4M77A 5LJ3f 3G7LA 4QMGA 1L0YB 5GAOp 3CCST 2QA4A 4KN7C 2DIGA 1V1PA 2CGHA 1Q86U 1U4PA 4C1NK 2K5DA 2ICEC 1VDZA 3GP7A 3JCMc 5CIUA 3NHHA 1EYDA 1KLGD 2EYMA 5GAN6 1AHJB 3D6CA 1O7YA 3ONAB 2K7VA 2VXWA 4N9TA 3LWHA 1M5Q1 1BCPB 1O80A 3RLFA 2G9DA 1JB0E 1JB3A 3BDUA 3S1QB 3MTSA 3FVQA 3D3RA 2LY7A 3V96A 4PJOG 3I4NB 2QQBA 1QP2A 4C0DB 2I46A 3JCMQ 4RH6A 2F0MA 4NL2A 3S2DB 1F2LA 4QUFA 1F9PA 2GF7A 3TP6A 2EYFA 3E5SA 3M56A 1JOQA 3UDCA 2CVRA 2SDFA 3V05A 1KLUD 2XSCA 2F4IA 4H44C 4LK1C 1QVPA 3M53A 3X24B 1EEID 4OL7A 4A3IB 3CU7A 5DY9A 4FXGC 1STGA 1QE6A 2QQSA 1KQSA 2F0QA 1GUWA 3OSOA 2ENBA 1RF2D 3BDLA 2M1HA 1BIBA 3CCJT 4JS4A 5EGTA 2AUJD 3T56B 2K2VA 2BDNA 3P8DA 5LJ5e 4KK7A 3TREA 3WXMB 3OBYA 3BVMA 2B2VC 3CCSA 1Z7TA 4FIBA 5GAOq 4ME7A 5M5YB 5CV7A 3DEPA 1EYCA 3QXEB 1WTPA 2CZ6B 1XTCD 4CJ1B 5DLOA 2E2DC 2XRSD 5FO7B 1K9MU 4QVDA 1Q7YC 3PT9A 1KD1C 4OF1A 1SYEA 2ZXOA 4M75E 2C06A 2O5IC 4WFN3 2F0UA 3GO5A 3PUYA 4XU2A 2B8AA 4LDYA 2PUOB 3DWAA 3QPHA 3T9NA 1CZGA 3A8HB 2GQVA 1QILA 2PYKA 2X6LA 4KI0A 3SK4A 4EMKB 5JJZA 4BDZA 3HP3A 1UAPA 5EBCA 4B08A 3NBIA 5D6YA 1CTMA 3HRTA 3SB2A 1S5FD 4BE1A 3LX0A 1UGRB 3OYFA 4L6V5 3GOXA 1G2SA 4F87A 1M8AA 1QW1A 2IPKD 2DTHA 4ELZC 1TS4A 3GTPB 2QF7A 2R6GA 2RB6A 2PU9B 1YCYA 3KBXA 2E10A 4JK1C 3N52A 5GMKm 5LJ5h 1BI0A 1S72T 1QOHA 1FXXA 1KTKA 4E6IA 3NP8A 2JXMB 4MMKA 1VQ5A 3A55A 3Q0AA 3JB9F 2PW5A 3PV0A 1VQPT 2R58A 1WJRA 1UGQB 1K73C 1TS3A 3ASKA 2DY7A 3URYA 2FHTA 2AUKA 5KH6A 3BG3A 4J5YA 2RDHA 4RGTA 1B1ZA 2XKOC 2ZXRA 1O9SA 4C3HG 1M4ZA 1Y7XA 4N0AC 5IT9L 5DM63 4DAVA 5C3XA 5HK3A 2A74C 3MP8A 2HQEA 2LT1A 5IT9E 3D31A 3C95A 1VUBA 2F69A 3OYLA 2KK4A 1FNUA 5EQ0A 3T13A 4HCEA 2NN6I 3EROA 4N4GA 1MSGA 3RZDB 4C1NI 4RGOS 2AQ1B 3L3OC 1HPCA 3JSCA 3CKIB 4OGEA 2RD1A 2ZT9C 3JAME 4KJNA 1JE4A 3BS1A 3D6WA 3D4WA 1U4MA 2WKDA 3T51B 1RKNA 2OTLT 3SFMA 4A4GA 4M7DC 3PMFA 2LQKA 5GMKi 5CORA 3CPFA 3CC4A 1HUMA 3SWNC 4JS5A 4M7DE 1SJHD 2LC4A 3C1FA 1RL2A 1Q1BA 3OMCA 3CCMT 1CT1D 1BQQT 2EJFC 1MHNA 3R93A 3VYGA 1HA6A 3K6OA 4KY7A 5G3LF 1OXTA 3CCRT 3M5AA 5CKDA 5LL6S 3QSUA 2X69A 3OIQA 1KG1A 2A3LA 5M3MB 2LTOA 3C46A 2IG0A 1LNXA 2WSEE 4HMJA 3KK7A 2DZ9A 3Q6SA 3MEAA 4II1A 5G3LD 1D1KA 3JCMf 5J26A 3LYIA 4XIGS 2F0FA 3FKIB 1BCPF 3E19A 3GTJB 2NB0A 2RH2A 5I2XA 4C5HA 3OYMA 5GAMe 2XWJB 4IALA 1LTAD 1KNAA 3TCJA 4A3DB 3L2ZA 5LJ5j 3CRKC 2Z1CA 4XTZA 1O78A 5GMKh 1O7LA 1NCVA 2ZPFB 3WOFA 3M59A 4QQGA 3ER0A 2PZTA 3QG1A 2KMTA 4C8QB 2GA4B 3OW7A 2YU9B 1WTOA 3K0YA 1Y1VB 4M7AE 4PV1C 3EAEA 4RHRA 5KEEA 4QF4A 3EQLC 4G7OC 1BCPC 2RI3A 2AWNA 4CKCA 1I8FA 3GTQB 1W2BA 1HCZA 4OP0A 3QIAA 1WCMB 2IX3A 1TQOA 2EY1A 1KNEA 1MBYA 2B2TA 2EYLA 3HOZB 1R4PB 1TU2B 1IKLA 4EQNA 1F9QA 4J1MA 4ATOA 4Y28E 2K5WA 4NW2A 2KUMA 2A6HD 2FYKA 1VQOA 2YLCA 2PCFB 1VQ4A 4RAUC 4MHEA 1FYCA 4PMCA 1YIJA 2AQ3B 1S72A 1YBYA 3GTMB 1SAPA 2OF1A 4BY6C 3S16B 1RHPA 1N9RA 2CZ7B 3G6ET 4B9WA 4OIJA 5GAMg 4A3MB 4XTWA 4OB1B 3GV6A 1HTPA 4F7UG 3QBYA 4FP5D 1RD9D 4OGQC 2E2JB 3NFCA 2JA8B 4ZTFA 5J3BA 2ICIA 3KXTA 2F0OA 1B34B 2QQRA 1FX7A 5LJ3h 4XDXA 5JPNC 4XQ3A 4RFBA 2TMPA 1EY0A 3Q1JA 4M7DA 4E7HA 2B2VA 2DNCA 4BA1I 2M0OA 3G71A 2PMZB 4C0GA 1NSNS 3K5MA 2A73B 2BA1A 3M55A 3TDQA 3RMSA 4V0BA 4QCLA 3FEOA 3CEYA 3L7ZC 1EU3A 1X3QA 2EQJA 2KQ3A 5IGBA 2N55A 1PRTD 4M7AA 4KUDK 2IX0A 4CBVA 3CC2T 3JCMP 4U68A 2O5JC 1H9SB 5T1IA 4C92C 2ZPIB 5D14A 4KUIA 2EFIA 3M4YA 3P8BB 2L55A 5C0MA 3FIFA 2OEOA 4PJOB 1B9NA 3INZA 2MMPA 4IN3A 2LDMA 1PXUA 3MC0B 4PMBA 3BYTB 1SYBA 1EY6A 2LKVA 2A6ED 1ET6A 4CJ2C 4KKTA 2B2TC 4C3JB 4BI8B 3L2WA 4C92D 1KD1U 4N4HA 1B3AA 5BN3A 2M2LA 4M7AG 2A69D 4LDXA 1B9MA 1Q90A 4C5GA 3VYHB 1E2WA 3TP7A 5FOBB 2FFKB 2IL8A 5JEAJ 2XIDA 1ZEQX 1DJRD 1R8OB 2B2UA 1HQMC 4M78C 1L0XB 1SYGA 3S1RB 4GZYC 1DYQA 4TQUS 4FF4A 1A3TA 1PTOD 1STHA 3HKSA 2NVYB 2QCPX 5FU7C 4KD4A 3CC7T 5T1GA 2EVBA 4M75B 4ULLA 2JTFA 1R9TB 4JLIA 3OYGA 3QOLA 3G6EA 1ZKOA 2AWOA 3I90A 2R5AA 4TVRA 3HPWA 4OB3B 5LJ5d 1YJWA 4IZ8A 2RJEA 4DK0A 1G291 2QDYB 3C2PA 5KE2A 1K83B 1SNMA 5C3WA 3J80E 1GUSA 4KN4C 4IUTA 3JCMJ 5CV9A 2E6NA 1V29B 1N9SA 2E41A 1ICWA 2XHCA 2NYZD 3A7LA 1WQ7A 1EY9A 1DOMA 4DXGA 2B39A 2KHSA 3MFYA 3S1NB 5D6XA 3G71T 4LDWA 4M7DB 4NMZA 4C92A 1VCIA 1BF4A 1BI1A 4IFDI 2NVQB 3U9SA 3VUZA 1S5CD 2R7ZB 1D2BA 1M4VA 1E2VA 4XU0A 4BI4A 4M75A 5CK9A 4RA8A 3NE5B 2VC8A 5GAOn 4CHTB 2EJGA 4H13C 1NZ9A 1BNZA 2EWNA 1BI2A 2B8FA 3QWNA 2ZGWA 2XDPA 2K57A 5K36H 3GP8A 3IAYA 4F7UF 2K33A 3SD4A 1M1KU 1RDPD 1SNOA 5CAIA 5KRUA 1JBMA 2YRVA 3G6JB 1IYVA 1MGQA 3RESA 3NQTA 1OI1A 2CS7A 1G3YA 5ELDA 5E3FA 2EQMA 3A8KE 4CKBA 3I73A 2GFAA 3OPOA 3EVQA 4ID6A 4A53A 2XN9C 3CXCA 1QNUA 4V2SA 2A68D 1Y07A 3CCEA 4JRIA 3JB9D 2KA7A 2F0SA 1WTWA 5FROA 4LD6A 4C3IB 2KJXA 1FR3A 3VJPA 4XTUA 5KCOA 2CW0D 1EYAA 4CGYB 2HNIA 2DKGA 3OS0A 2L12A 2E70A 4RCNA 4M77F 2LT4A 4A54A 3W2DA 2DXUA 2D2CC 2EY6A 3SR1A 3C12A 3X20B 1ENFA 4L63B 4M78A 5KGUA 3ZYYX 1I4HA 2BKDN 4BY6B 4O1NA 2VGNA 1UUPA 3K7AB 2DK3A 4C3JG 4ZN3A 3HEJA 5DEHA 4ELYC 5C4JB 2H1EA 1M8VA 4C92E 5FKAC 1YHQA 2EYOA 3MXUA 4XK8E 3P7JA 4HMIA 1Q81C 2O4XA 4CRIA 1U9RA 5KNDA 3LW5E 2FVUA 1EWCA 2B2YA 4M75F 2XNAC 3QIIA 1JOOA 2A69C 4M1UB 4ZK9B 1M1GA 1BO0A 4AYBB 1PFBA 1G6ZA 4F8MA 3RKXA 5C0XH 2F0EA 1QCBD 3NXWA 3E0JA 2RQXA 1VQLA 3MXPA 2DEQA 3R8BA 3PUVA 1BOSA 1PTOC 3RKWA 2FJ2A 4B9XA 3JB9J 2E74C 3OYYA 4M7DF 3JB9H 1I4QA 3AMUA 2EYJA 3CXCS 3M85A 2MP1A 2MHVA 4XQQA 4ZAIA 1F77A 3FPUB 2PVGB 4EPCA 2PNRC 1S5BD 1H641 3CC7A 2EYHA 3FB9A 1VIFA 4JRQA 3PUXA 2NZ1D 1RTNA 3GQBA 3EFRA 1OZ3A 3M58A 3JCMd 1UEAB 1Y8NB 1MI2A 3MVVA 2EOTA 2KY9A 3C1EA 3S1MB 1TWGB 3FDRA 2RBMA 2O2LD 3FEW<