3CCQQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccqQ00
1YJNQ 1K73R 1VQ4Q 1QVFP 1VQ5Q 3CC7Q 2QEXQ 1VQ6Q 1N8RR 3I56Q 1VQOQ 3CC4Q 3CMEQ 1VQMQ 1YI2Q 1YJ9Q 3CMAQ 1M90R 1Q7YR 3CCUQ 3CCRQ 1VQPQ 1NJIR 3CCEQ 1Q86R 1S72Q 1Q82R 3G4SQ 3CCQQ 1K8AR 3CCLQ 1YIJQ 1VQ8Q 3I55Q 1VQLQ 1YHQQ 1YITQ 3CCSQ 1KD1R 2OTLQ 3G6EQ 1VQ9Q 2OTJQ 1YJWQ 3CD6Q 1M1KR 1KQSP 3OW2P 2QA4Q 3CCMQ 1K9MR 3CC2Q 1KC8R 1W2BP 1Q81R 1VQ7Q 3G71Q 3CXCP 1VQKQ 1VQNQ 3CCVQ 1QVGP 3CPWP 1JJ2P 3CCJQ
chains in the Genus database with same CATH superfamily
2P0KA 5I2SA 1U1TA 5M9OA 4B6MA 3OBWA 2Y90A 3EAEA 2IPOB 2HCKA 3RBBB 3JAME 3SD4A 1ZSZA 4EMKA 1YIJQ 2V8IA 2KI7A 2RQVA 3HRTA 1KK7A 4FT4A 5HK3A 3OYEA 2ZGWA 3H9NA 3INZA 1W4SA 2K6DA 4AFSC 2DTHA 5IHKA 3RNJA 2KYBA 5LJ3e 4M7DA 2KDSA 4RTYA 1C0MA 4OMOA 4J9CA 1F1BB 1M8VA 2CH4W 3CC4A 2A3LA 2FVUA 1MGQA 2D8HA 2JM9A 2JMAA 4C5HA 4EDUA 1YIJA 2CP6A 5IAYA 1VQMT 1D0ZA 2DK3A 1YI2A 1K73U 3RERA 2E65A 2E4HA 4C0ZA 5KYNA 1VYTA 2DVEA 3OY9A 3J80E 4M77B 5I11A 3QBYA 4FCYA 2RQWA 8AT1B 5DY9A 1AWXA 4A4KA 1VQ8Q 4HA8A 1K76A 1K73C 1M5Q1 2E5QA 4ZGDB 2OTLQ 1IREB 1JB0E 2XDDA 1RACB 1Z9ZA 3M4GA 4KGXB 1X2QA 2LC4A 3O8VA 2LNVA 2DL4A 1M27C 2YRVA 3CCLT 3VJPA 2COYA 4FM4B 4OP0A 1BCMA 4XK8E 5DLOA 3QXEB 1SSFA 4K11A 5CO7A 3CCEA 1ZX6A 2F2VA 5HCKA 1U8RA 4LDYA 2LT1A 1OPKA 4ZGJB 3LGLA 3EFOB 4XTWA 5L8RE 2YDLA 3I56T 1OU9A 3OYGA 4DBQA 2V26A 3JCMb 3FEOA 5IHNA 4M7DD 4M77G 2VGNA 4LUEA 4BI4A 3S3NA 1PSEA 4M7AD 5ECAA 3RESA 5D6WA 2CYZB 3LYIA 2O4XB 2LVMA 1MMDA 1Y96A 4BY6B 2YUOA 2DKGA 4HVWA 1VQ7T 1KSWA 3VUBA 2MF2A 5LJ5j 3UDCA 3HHTB 1ZBJA 5KYWB 3CC2Q 1SKUB 4KT0E 2OJ2A 1IHWA 2PVOB 3VYHB 2CREA 3E1SA 2YLBA 3EG9A 3NGPA 4Y92A 4CC7A 2OX7A 3U23A 1Q81U 4LXCA 2RM4A 4HVUA 3VYGA 1G3SA 1ZSZB 3RIRA 1ACMB 1WX6A 2HKQB 3URGA 2CUDA 1M90C 4MZTA 4C8QG 1R77A 2O88A 1Q81C 2DVJA 4IURA 3OW2A 5GAMh 2EYXA 3META 1OX8A 4E7KA 2LP5A 1QVFS 5CCAA 5GAOn 4A4EA 2CGHA 1RL2A 2XMFA 1WIEA 4HCKA 5GJWB 2RHYA 5GAN7 2A7YA 2I0NA 3FJ5A 3M0UA 4M75A 5LJ3h 1KHCA 1E6HA 4KUDK 1D09B 3CCJQ 2HEQA 2A36A 4F7UA 3CC7Q 1T0JA 3L2UA 1OQKA 5LL6S 4Y28E 4B9WA 3SEMA 3GNFB 1TU0B 4ORZA 2F2XA 1N8RC 2RHUA 2M1HA 1C6VX 1XNIA 1BI1A 1ZQ1A 3JCMX 3OYIA 2JJ9A 4F16A 1A0NB 1VQKA 2QGFB 2X9HA 3UWNA 6AT1B 4OVAA 4J6WA 2PU9B 1IHVA 2LCSA 1M1GA 3JCMV 2HL5C 1KQ1A 4AG2C 4A4FA 3VS6A 2KQWA 3FRNA 5GAOl 3F70A 2FYKA 2K3YA 1U06A 3THKA 3EGXA 3JB9H 1YITA 1WLPB 3A8GB 3G7ZA 5J39A 3REAB 3ULRB 1B7TA 3CCLQ 2ZPFB 2DE0X 1GRIA 1AWJA 3RR6A 2LJ3A 2X4JA 3OSSC 1K8AU 2HBPA 2E41A 3CCUT 3BDLA 2CH4A 3M0RA 4AG1C 4X9CA 2KYMA 1YN8A 1MUZA 2COZA 4ATOA 1MHNA 5KYYA 2LQ8A 3KUFA 1VQ5Q 1K8AC 3PMTA 5GMKh 4F14A 2P4TA 5KH6A 1FMKA 4MMKA 3JB9D 4ZTFA 1EX4A 2ED0A 2FG0A 4IUQA 5CK9A 2D1XA 5LJ5h 1NYGA 1VUBA 1KQ2A 4C8QE 1KC8R 2LRQA 1WXTA 2FPFA 2XIDA 1QVGP 5A0DA 4JJBA 2PNIA 1AHJB 2MPXC 3OYDA 2VGMA 2Y4XA 1NJIR 5EC7A 2EGEA 3E9FA 2KSSA 1ZUYA 2QQSA 2CS7A 2J06A 1QWEA 4LD6A 2YUNA 3V8JA 4PK4A 1OEBA 2BZXA 4C8QC 3KFVA 1PRLC 4A63B 4O5VA 3A98A 1VQ7A 2YRCA 2G3RA 2DL3A 1W6XA 1PD0A 3OYJA 1UGPB 1YITQ 4CC3A 2X4WA 3M54A 2MWPA 1SSHA 2EYQA 5A0LA 2QQBA 5LJ5d 3MCAB 5GMKl 2YHTA 5I22A 3M53A 3NHNA 3FJPA 2AZVA 1VQMA 1N6AA 1SHGA 1UE9A 4IUPA 4DBHA 4M7AB 2D0NA 4C92D 2VC8A 2K4YA 2M16A 3CCRQ 1MV3A 2JTEA 5LJ5f 3VS0A 5CQYA 1NZ9A 1LJOA 2VKNA 3MEVA 3P8BB 1IGQA 2GGRA 1YWPA 2M0OA 2DIGA 3CXCS 5GANe 1BCOA 4DBFA 1T3SA 5FWBA 3G71Q 1SEMA 2A08A 2R58A 5GAOp 1BKBA 4JZ4A 2E5KA 4ESRA 4PJOD 4OMFB 5FU6C 2FB7A 4FYVB 1YJNT 2X51A 5GANd 2K79A 2RD1A 2OTJQ 3H41A 4A53A 1AWWA 1M1KU 3I56A 2KK4A 3R6OA 3S3MA 2B86A 3E9GA 2AKLA 2DD5A 4II1A 2L3RA 1YHQT 1GBRA 1YI2Q 1H92A 4M7AG 1NG2A 4RUGA 2DYBA 2VUBA 1M1KC 1KIKA 4PLIA 4RTWA 2K2MA 1WQ7A 1VQLQ 3EG9B 2LJ0A 3SDZA 2G6FX 1KD1U 2E6NA 2K57A 2QEXT 2E3IA 1ZUUA 3PNWC 5GAMd 3ER0A 1YITT 3CPWP 1C1AA 2B8AA 3WVDB 2RNAA 3A8HB 2DBKA 1QLYA 3E19A 5FRMA 1UHCA 3CCEQ 4OF1A 1WJQA 4C8QF 2LZ6B 3C95A 5C6SA 4PJOA 3P8DA 5FROA 2BZ8A 1M1KR 2HSPA 1YFNA 2J05A 4EPCA 4JJCA 1VQLA 1PKSA 2AIRB 4Z02A 3OS1A 3G4ST 4M4ZA 3GOXA 4DEYA 3QJ6A 3I55T 4M78B 4J9DA 2EJ9A 3V7RA 4XAXB 1KC8C 2EIFA 2QI2A 2HD0A 2NWMA 1WQWA 4E47A 4RG8A 2NUPB 5CKBA 4AT1B 5AYFA 2OAWA 2XU8A 2IVWA 2GNCA 2DXCA 3UA7A 3RMSA 4Y91A 2FO0A 3WXMB 3MP1A 4C8QA 1GFDA 2E10A 2MYSA 3BE3A 1Q82R 2P4RA 4PJLA 5GAOm 3E2UA 3PGGA 1YHQQ 2O31A 1HD3A 3JSCA 3CCVA 1I81A 1WHJA 4NOYA 2KE9A 1OYXA 1RAGB 3H8ZA 4BDYA 4N0AA 4A54A 2LTOA 2QEXQ 2X4YA 2DF6A 3BDUA 1RADB 1K9MU 1YWOA 1SPKA 1ZHIA 1B34A 1QCOA 2CT4A 1N8RU 1VQ4T 3MEAA 1AEYA 4J8OA 2GFAA 4TVRA 3CCRT 4N4GA 1D0YA 4ZN1A 1Q82C 3NTHA 1VQOT 2DLPA 2IG0A 1Q81R 1YJ9A 2KBTA 1ZUKA 3QKJA 4FIBA 5IT9E 1VQ6A 3CCVQ 5IN1A 3JCMJ 5J3BA 3MP6A 1I07A 3H6ZA 5IHIA 2F69A 2E3HA 1JBMA 2FL7A 4EMKB 1TS9A 2FZKB 3GNGA 3CEYA 2EQIA 4LDVA 4AMCA 4CRIA 4IUTA 2CSIA 5KYXA 1NLPC 4KH0B 4JRPA 1M3CA 2L3PA 3CPFA 1VQKQ 1FX7A 2DXUA 4YTLA 4Z89A 1JJ2P 2KNBB 2WSEE 4QQDA 1NM7A 2RQUA 1TTHB 2ZAEA 2ZPBB 4QVZA 3UF4A 1UG1A 1M4ZA 5GANg 3M0QA 3UT1A 4PLLA 2HL3A 3EGXB 2GTJA 4F7UG 4RTXA 1H641 1YI2T 3QSUA 3MKDA 3MPUB 1D3BA 3QZ5B 1X69A 4PFOA 3JB9F 1SF9A 1SRMA 3QDRB 1EZZB 1K1ZA 1MMNA 1HYOA 1M30A 2XDPA 2K5IA 3VU3C 2DIQA 1S72Q 2MOXA 3I55A 2VVKA 2KROA 4RTZA 4PJMA 1X6BA 2F5TX 3NTIA 5GMKm 4QQGA 5KYUA 3BW1A 3JCMg 2O9VA 2RK2A 3A8LB 4R56A 2RI5A 1FXXA 1SG5A 1PG5B 2RK1A 2F2WA 2QK0A 1UDLA 5GMKe 1I0CA 3TSZA 1QWFA 2EGCA 1IXDA 2WSCE 2EAYA 2QQAA 4QT7A 1PWTA 2V8JA 2OTJA 1Q86R 2EJGA 4M75E 1VQ5A 5CKEA 4D6WA 3I55Q 3X26B 1TUDA 2LT4A 3OA6A 1VQNT 3DKMA 4J9IA 3CD6Q 2HKNA 4KRTA 3QZ9B 2AKKA 4HVVA 3VS7A 1QQJA 3NMZC 3CCQT 3OYKA 1VQ9T 2CDTA 4J9BA 4OB0B 3L42A 3CCJA 1E7OA 3TVTA 2X4XA 1ZSGA 3PIOA 3CCLA 2RB6A 2J6KA 2KAFA 1MMAA 5GAOr 1B34B 5GAOq 4JRKA 2RJDA 1M2VA 1W70A 1ARKA 4OGCA 1G8XA 1KJWA 5GAMg 3OYAA 2GCXA 3C0CA 5FU7B 3CCSA 5CQXA 2MWOA 2OAUA 1UGSB 2E64A 2BUDA 3CC2A 1K0SA 2FEIA 1FYNA 4XU2A 2QTXA 2SEMA 3CBOA 4ZNXA 2C06A 2AHJB 2J6FA 2JVVA 1QKXA 2DD4A 1M3BA 3EG1A 1JEGA 2CP7A 5GAN6 1S1NA 1VQOQ 4PKCC 1DJ7B 1EIFA 1Q7YC 1KQSA 2K2VA 2LCLA 1RABB 2JN0A 3CCVT 1ABQA 3A5ZB 5A0GA 3CC7A 2ZPHB 4N0AC 3M58A 2JS0A 3RDVA 2EW3A 4ME7A 1I5OB 1N5ZA 1MNDA 1WNLA 4BI3A 2H8HA 3CMAT 4BDZA 1IGUA 1TWBA 2QQ9A 3JCMP 3CPWS 2FZGB 4M78G 3UA6A 4XTUA 3PIPA 2XG8D 3TU4K 2EPDA 1OX9A 1MMGA 4C92A 5KYYB 1TUGB 3L2RA 2W0ZA 1VQ8T 3C12A 2DJZA 1O75A 1QW1A 3FDRA 2LMJA 5D6YA 5GJVB 3KXTA 4N4HA 3EFOA 2RF0A 2VV5A 3EFSA 3H0HA 1BI3A 4ZGEB 3RKXA 4P5NA 4X9DA 2D8JA 1OOTA 3RUXA 3HKSA 1K9MR 5AT1B 1W2BP 1CKBA 1PRMC 4J83A 2CSQA 2RA2A 1VQOA 3ZFJA 1K4US 3VS5A 2EYWA 1M90U 1RI0A 2LQWA 3GPLA 4PL6A 3MEWA 4AFQC 4PJJA 1S72A 1PC0A 2OTLA 2JW4A 2QDYB 2JM8A 3ZBDA 1AT1B 1W2BS 1VQNQ 3CD6T 2DEQA 2FZCB 5GANj 3PT9A 1KG1A 3CMAQ 2XICA 4O6JA 4A4GA 1Q86U 3KBGA 2OI3A 2MAMA 3V7CA 1X6GA 2HMAA 1GBQA 3GF5A 4R0KA 2K5LA 4M75G 5CR2A 4M7AA 2DTIA 3X25B 4QKUA 3X24B 3OMGA 4KGVB 3OSVA 3HL8A 2A0FB 1YBYA 2D0QB 5HY6A 3OQ5A 5LJ3d 3MO8A 1U1SA 2V1QA 2DERA 1VA7A 5KYUB 3CPWA 4E7HA 2SRCA 1U3OA 3R6NA 4J6YA 5D7UA 1OULA 1UJ0A 2E12A 1NPRA 4JDSA 3SWNC 3JV3A 1UJYA 2ABLA 4X1VA 3S6WA 1BB9A 2JXBA 3QHSA 4DA4A 4C5EA 3I56Q 1Y96B 2L5QA 2LDMA 3HTRA 5CKFA 1WJRA 1WPYA 2GBQA 4WF2A 1KD1R 2JTMA 2D9TA 3QPHA 1H3ZA 3RKYA 1M9SA 3OMCA 5GANh 2QG9B 1UTIA 3C94A 4LN2A 4R55A 1EFNA 1VIEA 2MIOA 1VYUA 3TEEA 1UB4A 3CC2T 3TSWA 3CMAA 1BK2A 3HFOA 4FSSA 2AK5A 2ROLA 3PVLA 3OW2P 4AFZC 3CQTA 2Z0WA 1VQPT 3OS2A 2PQWA 3T9NA 1N8RR 3BFMA 3M57A 2CP2A 2W10A 2GQIA 1M90R 1BYMA 2FRWA 4EIKA 9ATCB 4PJOF 4XTYA 1JJ2A 5KE2A 3EG0A 2DAQA 2JT4A 3I5SA 4IIMA 4C5GA 3CCMA 4UC4A 1PCXA 1NJIC 4BE2A 5I2MA 2CZ0B 2P0PA 1PD1A 3MHXA 1X01A 3OS0A 2KXDA 4XTZA 1JXMA 1M2VB 1I4K1 2JMCA 4RTVA 2KRSA 2P0QA 2EQMA 1RAAB 4BB7A 1M3AA 3CCUQ 2ZPIB 4EMHA 2HQHA 4HT8A 5DM7R 2HNIA 1JRIA 1XTDA 3M59A 3CC7T 1AD5A 1LOJA 1YCSB 3V7SA 2DNUA 1UGRB 1W1FA 4JRQA 3FB9A 2EKOA 2Y4YA 1N27A 2M9UA 3LW5E 1GL5A 4WCIA 2KR3A 1N9RA 2JTFA 2VWFA 2A28A 1R0CB 3PMIA 4KGZB 1KFZA 1KQSP 2QTVA 1WHGA 3ASKA 3G4SA 1PSFA 4J6XA 4M77A 3GLXA 1BU1A 4Z88A 4IUUA 2DZCA 3P8HA 5LJ5e 5FW9A 5GMKj 1JXOA 2PVDB 1AOJA 4E7LA 3LX7A 3VRYA 1YJ9Q 1YCYA 1QKWA 1VQPQ 3D7SB 2ENMA 2KXCA 1NPPA 2RJFA 3I35A 1QVGA 1XOVA 5GAN4 2PZ1A 2BE7D 2GFUA 2QDLA 2FHDA 3SWNA 2QXFA 5GAN2 4VUBA 2JNGA 1E6GA 3BY7A 2EQUA 4M77E 4ELYC 3OYMA 3NPFA 2BIVA 2CKKA 3CCSQ 3JCMW 1VQ5T 3L2QA 3QWXX 2COWA 1QVGS 2RJCA 1Y07A 2YRDA 3LLRA 1WZOA 2GF7A 2KEAA 1KD1C 3VS1A 2YUQA 1WHHA 4DQ2A 3ZEHA 1W2BA 3FC3A 4LE9A 5IH2A 2F1LA 4XU3A 3LH5A 3JCMh 4C8QB 4RMOA 4ANJA 2RI3A 4M77D 2O9SA 4M7DC 3G1JA 1V29B 3CC4T 5HKCA 1YJWA 3H0IA 4EMKC 2EYYA 2M51A 3TQ7P 4M7DF 4JUVA 4PJOE 1N9SA 1VQMQ 3A8MB 2DL7A 2NLUA 2BE9B 2DM1A 3FIFA 4JRIA 5LJ3j 2HQXA 2LNHB 3EHQA 1VQPA 3QYGB 3LWHA 2KGTA 4C92B 2O2OA 3CBPA 2RJEA 4XQ3A 4M75B 2OTLT 3MJXA 1WYXA 4C0FA 4L6V5 1RAIB 4J7FA 4J9EA 3GIBA 2XKOC 1K8AR 2RMOA 4MDWA 4F7UE 3OYLA 4IKFA 4JJNK 1K9AA 1PKTA 3CCRA 1PM3A 1ZBXA 2X3WD 1GXIE 1R8OB 1QVFP 4OB3B 4OMMA 4WTOB 4D8DA 1QCFA 4ZTJA 1V76A 4NL2A 2RN8A 2VXFA 3V8LA 3CMEA 1B07A 4OMNA 2HDAA 1HK9A 2HQEA 2QA4A 4PFPA 1PHTA 2DXBA 2R57A 2HAXA 3OYBA 1K9MC 1VQ7Q 3I9QA 2FPEA 3L2WA 2XDBA 1YJNQ 1K73R 2YSQA 2WACA 2ED1A 1LPLA 2YLCA 1SHFA 3OBYA 4CC2A 4B9XA 1YJ9T 5IXFA 4OB1B 2KT1A 1GCQC 5LJ5g 2DFUA 5GMKi 2E70A 3VS2A 1CKAA 1D0XA 3WVEB 2DXTA 2DO3A 1VQLT 4BE1A 2KRNA 3JRZA 2ROTA 2QYZA 3LGFA 5FU6B 1R0BG 3JB9G 2YXYA 1JQQA 1UGQB 3N5BB 3UATA 1VQNA 4M75F 4E7JA 3CCET 3EHRA 4BUGA 4BACA 3CCST 4GY5A 3L2VA 1HSQA 1WHKA 2VASA 4XTVA 1VQ4A 1WXUA 3PFSA 2K7AA 3CCJT 4M75D 4HCCA 1JO8A 1AWOA 3VS3A 1IB8A 4E7SA 4RCCA 4OGEA 3X28B 2DRMA 4XTXA 2EQKA 1KC8U 4RCBA 5KCHA 5A2QE 3QIIA 1RUWA 2EBPA 1I1JA 4KULA 2NUPA 1UEBA 4BD3A 4QW2A 3CC4Q 2DX1A 5J26A 1BI0A 2L3QA 3LWIA 1TSFA 3HRUA 1IZ6A 1VQKT 3M4YA 2J6OA 2E6ZA 1WXBA 2BZYA 1WJSA 2DTOA 4HKEA 1D3BB 2DBMA 1WFWA 3EH2A 2RO0A 1G3YA 1H8KA 2EKHA 1NBEB 4Z8AA 1AZEA 2XD0A 1QCNA 2DPPB 2ZPEB 1Q7YR 1UFFA 4J7IA 4RTTA 3EFRA 2XK0A 1VOMA 2QQRA 4PNOA 3OYYA 2BTTA 3MP8A 4Q5WA 4M78A 5KYWA 3EGDB 2RQTA 4DBRA 3SWNB 3VUZA 1VQ4Q 1TG0A 1Q82U 1HJDA 3VRZA 3A1PA 4CC4B 2FRYA 1MV0B 1UUEA 1M2OA 1WI7A 1OPLA 3JCMf 3DLLA 2AZSA 4KH1B 1GFCA 1IO6A 1X27A 1BI2A 2ECZA 2K9GA 4FYWB 4OMQA 5KYXB 1I5LA 4GLMA 4CI0C 4BY6C 3RKWA 3G71T 4ELZC 4V2SA 1V1CA 2PUKB 2NUTA 3OW2S 1GCPA 2CT3A 2L3SA 1VQ9Q 1YNZA 4FU6A 3EG3A 1TH7A 4JJDA 1X2KA 3SB2A 3J7AF 2J7IA 3PE0A 4GBQA 4KUIA 2CZ1B 1NYFA 1WGSA 2DJQA 2LJ1A 4QVCA 1YJNA 3NTKA 4M7AC 2QA4T 1X75C 2RI2A 3EG2A 5GAN5 1HXDA 1G3TA 1K0XA 1Y71A 2KMTA 2CZ6B 4M7DG 2GQVA 4E2FB 2LQNA 2ZCFB 1S72T 2KT8A 2DEUA 3TREA 3VS4A 2NYSA 3JCMc 4JS4A 1QVPA 2PUOB 3G6ET 1LCKA 2HZYA 4LD9K 3DLMA 2DMOA 2XHCA 2QASA 2O01E 1ZA2B 2AT1B 1Y7XA 2QAZA 1Y57A 2CP0A 1ZLMA 3OYFA 5GAMj 3JCMe 2K5FA 3S3OA 4RG2A 1JJ2S 5FLXE 1RLPC 1VQ9A 3CD6A 3DB4A 4FYXB 4C8QD 1T3LA 1QVFA 1NEBA 2JS2A 2P84A 2ZZDA 2DL8A 1AVZC 2EFIA 3RMQA 3OYHA 3EGUA 3L2ZA 1RLQC 2L2PA 2H3EB 4GLKA 4C92F 2OTJT 2NUZA 3CBMA 3EH1A 1RI9A 3H0FA 4C0GA 3AHUA 2MMPA 4X34A 8ATCB 4DOWA 1ABOA 2HSEB 5DLQE 5C0MA 2YWWA 4LUDA 4FT2A 5CIUA 2LX9A 1H3HA 2MK5A 3CCQA 4OMPA 2QA4Q 2L89A 4F17A 4OB2B 1FWZA 3M56A 4FL6A 4J5YA 4IUVA 4C92C 1OZ3A 1NLOC 4FW2A 2KY9A 3A8OB 2ATCB 2M02A 2CUBA 3M9QA 3M0SA 3ME9A 4J9GA 5GAN8 3PTAA 3QYHB 5CVIA 1J3TA 5HK0A 2HBWA 3OYNA 2RQRA 3QG1A 4LNPA 1XJWB 3G71A 1YJWQ 1D1BA 1I8FA 2YT6A 4XU1A 1NE8A 1Y0MA 4C92G 2EYZA 3M0PA 2DRKA 2A37A 4PJOC 2RPNA 4F04B 2ESWA 3HFNA 3LH0A 5LJ3g 3G4SQ 5GAMf 4M7DE 2O4XA 2L8DA 1OV3A 3Q1JA 3OB9A 4BE0A 2DILA 3I5RA 1VQ6T 3O5ZA 2X3XD 1WDXA 4DOVA 5GAMe 2X35A 4OMLA 1B3QA 2F5KA 4HXJA 7AT1B 5LJ3f 1Q95G 2EVRA 3IQLA 3REBB 2M0YA 2NUTB 1G5VA 5GAN3 3CXCA 1RAFB 1OI1A 3M5AA 5CKDA 3G6EA 4AFUC 4JLIA 3JB9J 4LDUA 2R5AA 4KBMB 4M7AF 3AT1B 4ZN3A 1ZSZC 5EG2A 4C5IA 4M77C 5KE3A 1QP3A 4F7UF 3GP8A 1SRLA 2LCCA 2K3BA 1M8MA 3QO3A 4J9HA 4M78E 3HP9A 4M75C 5D6XA 3CMEQ 2C0TA 3OYCA 1LVKA 1VYVA 2XI9A 4JPBW 2MI6A 1WHLA 1IRXA 1X43A 3JCMd 3G6EQ 1X6OA 3M55A 2FPDA 3DB3A 4BI8B 4HCZA 2D6FA 4F7UB 2JUFA 1YIJT 3J81E 3HSBA 2YUPA 1NJIU 4LDWA 4E7ZA 1TOVA 4QVDA 1PNJA 2DL5A 3CCMT 4HT9A 4XU0A 5FU7C 2C0IA 1D1AA 4C92E 5FRNA 1YP5A 4M7DB 1G83A 4L5GA 5I21A 1Q86C 2V1RA 1G3WA 5FWCA 2DETA 4FYYB 1ZA1B 4PJNA 1G2BA 1VQ6Q 3UPUA 4C0DB 2EWNA 1WA7A 1UECA 2JOYA 3JB9I 4PFZA 4PJOB 3PVQA 1YHQA 2DZ9A 5L23A 4A4HA 1LNXA 4IIOA 2R5MA 2L0AA 2EGAA 2C0OA 2CP5A 2VB6A 4M77F 1M1FA 5GANf 1RAEB 3CCUA 3FLGA 4FSXA 2QEXA 2EQJA 3SHWA 1D1CA 4N4IA 1MNEA 4QQ6A 4JLGA 1RAHB 2PTKA 1KQSS 3MEUA 1KHIA 1BIBA 4JZ3A 1BIAA 3VV0A 3QJYA 2RHZA 3QWYA 4DEXA 2VYTA 3V8KA 4D8KA 2LX7A 1VIFA 2LQKA 1UHFA 3NFCA 2H3JA 4PJOG 1YJWT 3C4SA 1T0HA 4MZPA 2BKDN 2PVGB 4E6RA 2V8KA 1JU5C 1P92A 2VXEA 4EMGA 2WSFE 4M78C 1QMCA 2RHIA 2RHXA 4MDXA 1Q7YU 4L59A 1OU8A 2KRMA 4MZMA 3HPWA 3CCMQ 2JZ2A 5CKHA 3CXCP 3M0TA 3QUIA 3X20B 1FMWA 1Z9QA 3OS5A 2E1HA 4M78D 2CZ7B 3VKIA 4NL3A 1XQHA 4M7AE 3L1AA 2GTOA 1AZGB 3CCQQ 5KCOA 1OZ2A 2I2LA 4RTUA 1BBZA 1U5SA 4FW1A 3GBQA 3EGDA 4M78F 4HCBA 2K3XA 2ZPGB 1TUCA 3JCMQ 2DYIA 3TCJA 1WHMA 1QP2A 2EJFA 3HRSA 4J9FA 1TXQA 2MCNA 1GCQA 1O9SA 4JS5A 1UGVA 1CSKA 3CMET 4MMLA 2IIMA 2KVQG 2QGGA 3SFMA 5CAIA 4E7IA 1VQ8A 3ZL7C 4C0DC 2DA9A 4RKUE 1FMVA 3QDFA 2RH2A 4NS5A 2CP3A 4LDXA 5IXBA 1NEGA
chains in the Genus database with same CATH topology
1YJNQ 1K73R 1VQ4Q 1QVFP 1VQ5Q 3CC7Q 2QEXQ 1VQ6Q 1N8RR 3I56Q 1VQOQ 3CC4Q 3CMEQ 1VQMQ 1YI2Q 1YJ9Q 3CMAQ 1M90R 1Q7YR 3CCUQ 3CCRQ 1VQPQ 1NJIR 3CCEQ 1Q86R 1S72Q 1Q82R 3G4SQ 3CCQQ 1K8AR 3CCLQ 1YIJQ 1VQ8Q 3I55Q 1VQLQ 1YHQQ 1YITQ 3CCSQ 1KD1R 2OTLQ 3G6EQ 1VQ9Q 2OTJQ 1YJWQ 3CD6Q 1M1KR 1KQSP 3OW2P 2QA4Q 3CCMQ 1K9MR 3CC2Q 1KC8R 1W2BP 1Q81R 1VQ7Q 3G71Q 3CXCP 1VQKQ 1VQNQ 3CCVQ 1QVGP 3CPWP 1JJ2P 3CCJQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN Q;  1K73 R;  1VQ4 Q;  1QVF P;  1VQ5 Q;  3CC7 Q;  2QEX Q;  1VQ6 Q;  1N8R R;  3I56 Q;  1VQO Q;  3CC4 Q;  3CME Q;  1VQM Q;  1YI2 Q;  1YJ9 Q;  3CMA Q;  1M90 R;  1Q7Y R;  3CCU Q;  3CCR Q;  1VQP Q;  1NJI R;  3CCE Q;  1Q86 R;  1S72 Q;  1Q82 R;  3G4S Q;  3CCQ Q;  1K8A R;  3CCL Q;  1YIJ Q;  1VQ8 Q;  3I55 Q;  1VQL Q;  1YHQ Q;  1YIT Q;  3CCS Q;  1KD1 R;  2OTL Q;  3G6E Q;  1VQ9 Q;  2OTJ Q;  1YJW Q;  3CD6 Q;  1M1K R;  1KQS P;  3OW2 P;  2QA4 Q;  3CCM Q;  1K9M R;  3CC2 Q;  1KC8 R;  1W2B P;  1Q81 R;  1VQ7 Q;  3G71 Q;  3CXC P;  1VQK Q;  1VQN Q;  3CCV Q;  1QVG P;  3CPW P;  1JJ2 P;  3CCJ Q; 
#chains in the Genus database with same CATH topology
 2P0K A;  5I2S A;  1U1T A;  5M9O A;  4B6M A;  3OBW A;  2Y90 A;  3EAE A;  2IPO B;  2HCK A;  3RBB B;  3JAM E;  3SD4 A;  1ZSZ A;  4EMK A;  1YIJ Q;  2V8I A;  2KI7 A;  2RQV A;  3HRT A;  1KK7 A;  4FT4 A;  5HK3 A;  3OYE A;  2ZGW A;  3H9N A;  3INZ A;  1W4S A;  2K6D A;  4AFS C;  2DTH A;  5IHK A;  3RNJ A;  2KYB A;  5LJ3 e;  4M7D A;  2KDS A;  4RTY A;  1C0M A;  4OMO A;  4J9C A;  1F1B B;  1M8V A;  2CH4 W;  3CC4 A;  2A3L A;  2FVU A;  1MGQ A;  2D8H A;  2JM9 A;  2JMA A;  4C5H A;  4EDU A;  1YIJ A;  2CP6 A;  5IAY A;  1VQM T;  1D0Z A;  2DK3 A;  1YI2 A;  1K73 U;  3RER A;  2E65 A;  2E4H A;  4C0Z A;  5KYN A;  1VYT A;  2DVE A;  3OY9 A;  3J80 E;  4M77 B;  5I11 A;  3QBY A;  4FCY A;  2RQW A;  8AT1 B;  5DY9 A;  1AWX A;  4A4K A;  1VQ8 Q;  4HA8 A;  1K76 A;  1K73 C;  1M5Q 1;  2E5Q A;  4ZGD B;  2OTL Q;  1IRE B;  1JB0 E;  2XDD A;  1RAC B;  1Z9Z A;  3M4G A;  4KGX B;  1X2Q A;  2LC4 A;  3O8V A;  2LNV A;  2DL4 A;  1M27 C;  2YRV A;  3CCL T;  3VJP A;  2COY A;  4FM4 B;  4OP0 A;  1BCM A;  4XK8 E;  5DLO A;  3QXE B;  1SSF A;  4K11 A;  5CO7 A;  3CCE A;  1ZX6 A;  2F2V A;  5HCK A;  1U8R A;  4LDY A;  2LT1 A;  1OPK A;  4ZGJ B;  3LGL A;  3EFO B;  4XTW A;  5L8R E;  2YDL A;  3I56 T;  1OU9 A;  3OYG A;  4DBQ A;  2V26 A;  3JCM b;  3FEO A;  5IHN A;  4M7D D;  4M77 G;  2VGN A;  4LUE A;  4BI4 A;  3S3N A;  1PSE A;  4M7A D;  5ECA A;  3RES A;  5D6W A;  2CYZ B;  3LYI A;  2O4X B;  2LVM A;  1MMD A;  1Y96 A;  4BY6 B;  2YUO A;  2DKG A;  4HVW A;  1VQ7 T;  1KSW A;  3VUB A;  2MF2 A;  5LJ5 j;  3UDC A;  3HHT B;  1ZBJ A;  5KYW B;  3CC2 Q;  1SKU B;  4KT0 E;  2OJ2 A;  1IHW A;  2PVO B;  3VYH B;  2CRE A;  3E1S A;  2YLB A;  3EG9 A;  3NGP A;  4Y92 A;  4CC7 A;  2OX7 A;  3U23 A;  1Q81 U;  4LXC A;  2RM4 A;  4HVU A;  3VYG A;  1G3S A;  1ZSZ B;  3RIR A;  1ACM B;  1WX6 A;  2HKQ B;  3URG A;  2CUD A;  1M90 C;  4MZT A;  4C8Q G;  1R77 A;  2O88 A;  1Q81 C;  2DVJ A;  4IUR A;  3OW2 A;  5GAM h;  2EYX A;  3MET A;  1OX8 A;  4E7K A;  2LP5 A;  1QVF S;  5CCA A;  5GAO n;  4A4E A;  2CGH A;  1RL2 A;  2XMF A;  1WIE A;  4HCK A;  5GJW B;  2RHY A;  5GAN 7;  2A7Y A;  2I0N A;  3FJ5 A;  3M0U A;  4M75 A;  5LJ3 h;  1KHC A;  1E6H A;  4KUD K;  1D09 B;  3CCJ Q;  2HEQ A;  2A36 A;  4F7U A;  3CC7 Q;  1T0J A;  3L2U A;  1OQK A;  5LL6 S;  4Y28 E;  4B9W A;  3SEM A;  3GNF B;  1TU0 B;  4ORZ A;  2F2X A;  1N8R C;  2RHU A;  2M1H A;  1C6V X;  1XNI A;  1BI1 A;  1ZQ1 A;  3JCM X;  3OYI A;  2JJ9 A;  4F16 A;  1A0N B;  1VQK A;  2QGF B;  2X9H A;  3UWN A;  6AT1 B;  4OVA A;  4J6W A;  2PU9 B;  1IHV A;  2LCS A;  1M1G A;  3JCM V;  2HL5 C;  1KQ1 A;  4AG2 C;  4A4F A;  3VS6 A;  2KQW A;  3FRN A;  5GAO l;  3F70 A;  2FYK A;  2K3Y A;  1U06 A;  3THK A;  3EGX A;  3JB9 H;  1YIT A;  1WLP B;  3A8G B;  3G7Z A;  5J39 A;  3REA B;  3ULR B;  1B7T A;  3CCL Q;  2ZPF B;  2DE0 X;  1GRI A;  1AWJ A;  3RR6 A;  2LJ3 A;  2X4J A;  3OSS C;  1K8A U;  2HBP A;  2E41 A;  3CCU T;  3BDL A;  2CH4 A;  3M0R A;  4AG1 C;  4X9C A;  2KYM A;  1YN8 A;  1MUZ A;  2COZ A;  4ATO A;  1MHN A;  5KYY A;  2LQ8 A;  3KUF A;  1VQ5 Q;  1K8A C;  3PMT A;  5GMK h;  4F14 A;  2P4T A;  5KH6 A;  1FMK A;  4MMK A;  3JB9 D;  4ZTF A;  1EX4 A;  2ED0 A;  2FG0 A;  4IUQ A;  5CK9 A;  2D1X A;  5LJ5 h;  1NYG A;  1VUB A;  1KQ2 A;  4C8Q E;  1KC8 R;  2LRQ A;  1WXT A;  2FPF A;  2XID A;  1QVG P;  5A0D A;  4JJB A;  2PNI A;  1AHJ B;  2MPX C;  3OYD A;  2VGM A;  2Y4X A;  1NJI R;  5EC7 A;  2EGE A;  3E9F A;  2KSS A;  1ZUY A;  2QQS A;  2CS7 A;  2J06 A;  1QWE A;  4LD6 A;  2YUN A;  3V8J A;  4PK4 A;  1OEB A;  2BZX A;  4C8Q C;  3KFV A;  1PRL C;  4A63 B;  4O5V A;  3A98 A;  1VQ7 A;  2YRC A;  2G3R A;  2DL3 A;  1W6X A;  1PD0 A;  3OYJ A;  1UGP B;  1YIT Q;  4CC3 A;  2X4W A;  3M54 A;  2MWP A;  1SSH A;  2EYQ A;  5A0L A;  2QQB A;  5LJ5 d;  3MCA B;  5GMK l;  2YHT A;  5I22 A;  3M53 A;  3NHN A;  3FJP A;  2AZV A;  1VQM A;  1N6A A;  1SHG A;  1UE9 A;  4IUP A;  4DBH A;  4M7A B;  2D0N A;  4C92 D;  2VC8 A;  2K4Y A;  2M16 A;  3CCR Q;  1MV3 A;  2JTE A;  5LJ5 f;  3VS0 A;  5CQY A;  1NZ9 A;  1LJO A;  2VKN A;  3MEV A;  3P8B B;  1IGQ A;  2GGR A;  1YWP A;  2M0O A;  2DIG A;  3CXC S;  5GAN e;  1BCO A;  4DBF A;  1T3S A;  5FWB A;  3G71 Q;  1SEM A;  2A08 A;  2R58 A;  5GAO p;  1BKB A;  4JZ4 A;  2E5K A;  4ESR A;  4PJO D;  4OMF B;  5FU6 C;  2FB7 A;  4FYV B;  1YJN T;  2X51 A;  5GAN d;  2K79 A;  2RD1 A;  2OTJ Q;  3H41 A;  4A53 A;  1AWW A;  1M1K U;  3I56 A;  2KK4 A;  3R6O A;  3S3M A;  2B86 A;  3E9G A;  2AKL A;  2DD5 A;  4II1 A;  2L3R A;  1YHQ T;  1GBR A;  1YI2 Q;  1H92 A;  4M7A G;  1NG2 A;  4RUG A;  2DYB A;  2VUB A;  1M1K C;  1KIK A;  4PLI A;  4RTW A;  2K2M A;  1WQ7 A;  1VQL Q;  3EG9 B;  2LJ0 A;  3SDZ A;  2G6F X;  1KD1 U;  2E6N A;  2K57 A;  2QEX T;  2E3I A;  1ZUU A;  3PNW C;  5GAM d;  3ER0 A;  1YIT T;  3CPW P;  1C1A A;  2B8A A;  3WVD B;  2RNA A;  3A8H B;  2DBK A;  1QLY A;  3E19 A;  5FRM A;  1UHC A;  3CCE Q;  4OF1 A;  1WJQ A;  4C8Q F;  2LZ6 B;  3C95 A;  5C6S A;  4PJO A;  3P8D A;  5FRO A;  2BZ8 A;  1M1K R;  2HSP A;  1YFN A;  2J05 A;  4EPC A;  4JJC A;  1VQL A;  1PKS A;  2AIR B;  4Z02 A;  3OS1 A;  3G4S T;  4M4Z A;  3GOX A;  4DEY A;  3QJ6 A;  3I55 T;  4M78 B;  4J9D A;  2EJ9 A;  3V7R A;  4XAX B;  1KC8 C;  2EIF A;  2QI2 A;  2HD0 A;  2NWM A;  1WQW A;  4E47 A;  4RG8 A;  2NUP B;  5CKB A;  4AT1 B;  5AYF A;  2OAW A;  2XU8 A;  2IVW A;  2GNC A;  2DXC A;  3UA7 A;  3RMS A;  4Y91 A;  2FO0 A;  3WXM B;  3MP1 A;  4C8Q A;  1GFD A;  2E10 A;  2MYS A;  3BE3 A;  1Q82 R;  2P4R A;  4PJL A;  5GAO m;  3E2U A;  3PGG A;  1YHQ Q;  2O31 A;  1HD3 A;  3JSC A;  3CCV A;  1I81 A;  1WHJ A;  4NOY A;  2KE9 A;  1OYX A;  1RAG B;  3H8Z A;  4BDY A;  4N0A A;  4A54 A;  2LTO A;  2QEX Q;  2X4Y A;  2DF6 A;  3BDU A;  1RAD B;  1K9M U;  1YWO A;  1SPK A;  1ZHI A;  1B34 A;  1QCO A;  2CT4 A;  1N8R U;  1VQ4 T;  3MEA A;  1AEY A;  4J8O A;  2GFA A;  4TVR A;  3CCR T;  4N4G A;  1D0Y A;  4ZN1 A;  1Q82 C;  3NTH A;  1VQO T;  2DLP A;  2IG0 A;  1Q81 R;  1YJ9 A;  2KBT A;  1ZUK A;  3QKJ A;  4FIB A;  5IT9 E;  1VQ6 A;  3CCV Q;  5IN1 A;  3JCM J;  5J3B A;  3MP6 A;  1I07 A;  3H6Z A;  5IHI A;  2F69 A;  2E3H A;  1JBM A;  2FL7 A;  4EMK B;  1TS9 A;  2FZK B;  3GNG A;  3CEY A;  2EQI A;  4LDV A;  4AMC A;  4CRI A;  4IUT A;  2CSI A;  5KYX A;  1NLP C;  4KH0 B;  4JRP A;  1M3C A;  2L3P A;  3CPF A;  1VQK Q;  1FX7 A;  2DXU A;  4YTL A;  4Z89 A;  1JJ2 P;  2KNB B;  2WSE E;  4QQD A;  1NM7 A;  2RQU A;  1TTH B;  2ZAE A;  2ZPB B;  4QVZ A;  3UF4 A;  1UG1 A;  1M4Z A;  5GAN g;  3M0Q A;  3UT1 A;  4PLL A;  2HL3 A;  3EGX B;  2GTJ A;  4F7U G;  4RTX A;  1H64 1;  1YI2 T;  3QSU A;  3MKD A;  3MPU B;  1D3B A;  3QZ5 B;  1X69 A;  4PFO A;  3JB9 F;  1SF9 A;  1SRM A;  3QDR B;  1EZZ B;  1K1Z A;  1MMN A;  1HYO A;  1M30 A;  2XDP A;  2K5I A;  3VU3 C;  2DIQ A;  1S72 Q;  2MOX A;  3I55 A;  2VVK A;  2KRO A;  4RTZ A;  4PJM A;  1X6B A;  2F5T X;  3NTI A;  5GMK m;  4QQG A;  5KYU A;  3BW1 A;  3JCM g;  2O9V A;  2RK2 A;  3A8L B;  4R56 A;  2RI5 A;  1FXX A;  1SG5 A;  1PG5 B;  2RK1 A;  2F2W A;  2QK0 A;  1UDL A;  5GMK e;  1I0C A;  3TSZ A;  1QWF A;  2EGC A;  1IXD A;  2WSC E;  2EAY A;  2QQA A;  4QT7 A;  1PWT A;  2V8J A;  2OTJ A;  1Q86 R;  2EJG A;  4M75 E;  1VQ5 A;  5CKE A;  4D6W A;  3I55 Q;  3X26 B;  1TUD A;  2LT4 A;  3OA6 A;  1VQN T;  3DKM A;  4J9I A;  3CD6 Q;  2HKN A;  4KRT A;  3QZ9 B;  2AKK A;  4HVV A;  3VS7 A;  1QQJ A;  3NMZ C;  3CCQ T;  3OYK A;  1VQ9 T;  2CDT A;  4J9B A;  4OB0 B;  3L42 A;  3CCJ A;  1E7O A;  3TVT A;  2X4X A;  1ZSG A;  3PIO A;  3CCL A;  2RB6 A;  2J6K A;  2KAF A;  1MMA A;  5GAO r;  1B34 B;  5GAO q;  4JRK A;  2RJD A;  1M2V A;  1W70 A;  1ARK A;  4OGC A;  1G8X A;  1KJW A;  5GAM g;  3OYA A;  2GCX A;  3C0C A;  5FU7 B;  3CCS A;  5CQX A;  2MWO A;  2OAU A;  1UGS B;  2E64 A;  2BUD A;  3CC2 A;  1K0S A;  2FEI A;  1FYN A;  4XU2 A;  2QTX A;  2SEM A;  3CBO A;  4ZNX A;  2C06 A;  2AHJ B;  2J6F A;  2JVV A;  1QKX A;  2DD4 A;  1M3B A;  3EG1 A;  1JEG A;  2CP7 A;  5GAN 6;  1S1N A;  1VQO Q;  4PKC C;  1DJ7 B;  1EIF A;  1Q7Y C;  1KQS A;  2K2V A;  2LCL A;  1RAB B;  2JN0 A;  3CCV T;  1ABQ A;  3A5Z B;  5A0G A;  3CC7 A;  2ZPH B;  4N0A C;  3M58 A;  2JS0 A;  3RDV A;  2EW3 A;  4ME7 A;  1I5O B;  1N5Z A;  1MND A;  1WNL A;  4BI3 A;  2H8H A;  3CMA T;  4BDZ A;  1IGU A;  1TWB A;  2QQ9 A;  3JCM P;  3CPW S;  2FZG B;  4M78 G;  3UA6 A;  4XTU A;  3PIP A;  2XG8 D;  3TU4 K;  2EPD A;  1OX9 A;  1MMG A;  4C92 A;  5KYY B;  1TUG B;  3L2R A;  2W0Z A;  1VQ8 T;  3C12 A;  2DJZ A;  1O75 A;  1QW1 A;  3FDR A;  2LMJ A;  5D6Y A;  5GJV B;  3KXT A;  4N4H A;  3EFO A;  2RF0 A;  2VV5 A;  3EFS A;  3H0H A;  1BI3 A;  4ZGE B;  3RKX A;  4P5N A;  4X9D A;  2D8J A;  1OOT A;  3RUX A;  3HKS A;  1K9M R;  5AT1 B;  1W2B P;  1CKB A;  1PRM C;  4J83 A;  2CSQ A;  2RA2 A;  1VQO A;  3ZFJ A;  1K4U S;  3VS5 A;  2EYW A;  1M90 U;  1RI0 A;  2LQW A;  3GPL A;  4PL6 A;  3MEW A;  4AFQ C;  4PJJ A;  1S72 A;  1PC0 A;  2OTL A;  2JW4 A;  2QDY B;  2JM8 A;  3ZBD A;  1AT1 B;  1W2B S;  1VQN Q;  3CD6 T;  2DEQ A;  2FZC B;  5GAN j;  3PT9 A;  1KG1 A;  3CMA Q;  2XIC A;  4O6J A;  4A4G A;  1Q86 U;  3KBG A;  2OI3 A;  2MAM A;  3V7C A;  1X6G A;  2HMA A;  1GBQ A;  3GF5 A;  4R0K A;  2K5L A;  4M75 G;  5CR2 A;  4M7A A;  2DTI A;  3X25 B;  4QKU A;  3X24 B;  3OMG A;  4KGV B;  3OSV A;  3HL8 A;  2A0F B;  1YBY A;  2D0Q B;  5HY6 A;  3OQ5 A;  5LJ3 d;  3MO8 A;  1U1S A;  2V1Q A;  2DER A;  1VA7 A;  5KYU B;  3CPW A;  4E7H A;  2SRC A;  1U3O A;  3R6N A;  4J6Y A;  5D7U A;  1OUL A;  1UJ0 A;  2E12 A;  1NPR A;  4JDS A;  3SWN C;  3JV3 A;  1UJY A;  2ABL A;  4X1V A;  3S6W A;  1BB9 A;  2JXB A;  3QHS A;  4DA4 A;  4C5E A;  3I56 Q;  1Y96 B;  2L5Q A;  2LDM A;  3HTR A;  5CKF A;  1WJR A;  1WPY A;  2GBQ A;  4WF2 A;  1KD1 R;  2JTM A;  2D9T A;  3QPH A;  1H3Z A;  3RKY A;  1M9S A;  3OMC A;  5GAN h;  2QG9 B;  1UTI A;  3C94 A;  4LN2 A;  4R55 A;  1EFN A;  1VIE A;  2MIO A;  1VYU A;  3TEE A;  1UB4 A;  3CC2 T;  3TSW A;  3CMA A;  1BK2 A;  3HFO A;  4FSS A;  2AK5 A;  2ROL A;  3PVL A;  3OW2 P;  4AFZ C;  3CQT A;  2Z0W A;  1VQP T;  3OS2 A;  2PQW A;  3T9N A;  1N8R R;  3BFM A;  3M57 A;  2CP2 A;  2W10 A;  2GQI A;  1M90 R;  1BYM A;  2FRW A;  4EIK A;  9ATC B;  4PJO F;  4XTY A;  1JJ2 A;  5KE2 A;  3EG0 A;  2DAQ A;  2JT4 A;  3I5S A;  4IIM A;  4C5G A;  3CCM A;  4UC4 A;  1PCX A;  1NJI C;  4BE2 A;  5I2M A;  2CZ0 B;  2P0P A;  1PD1 A;  3MHX A;  1X01 A;  3OS0 A;  2KXD A;  4XTZ A;  1JXM A;  1M2V B;  1I4K 1;  2JMC A;  4RTV A;  2KRS A;  2P0Q A;  2EQM A;  1RAA B;  4BB7 A;  1M3A A;  3CCU Q;  2ZPI B;  4EMH A;  2HQH A;  4HT8 A;  5DM7 R;  2HNI A;  1JRI A;  1XTD A;  3M59 A;  3CC7 T;  1AD5 A;  1LOJ A;  1YCS B;  3V7S A;  2DNU A;  1UGR B;  1W1F A;  4JRQ A;  3FB9 A;  2EKO A;  2Y4Y A;  1N27 A;  2M9U A;  3LW5 E;  1GL5 A;  4WCI A;  2KR3 A;  1N9R A;  2JTF A;  2VWF A;  2A28 A;  1R0C B;  3PMI A;  4KGZ B;  1KFZ A;  1KQS P;  2QTV A;  1WHG A;  3ASK A;  3G4S A;  1PSF A;  4J6X A;  4M77 A;  3GLX A;  1BU1 A;  4Z88 A;  4IUU A;  2DZC A;  3P8H A;  5LJ5 e;  5FW9 A;  5GMK j;  1JXO A;  2PVD B;  1AOJ A;  4E7L A;  3LX7 A;  3VRY A;  1YJ9 Q;  1YCY A;  1QKW A;  1VQP Q;  3D7S B;  2ENM A;  2KXC A;  1NPP A;  2RJF A;  3I35 A;  1QVG A;  1XOV A;  5GAN 4;  2PZ1 A;  2BE7 D;  2GFU A;  2QDL A;  2FHD A;  3SWN A;  2QXF A;  5GAN 2;  4VUB A;  2JNG A;  1E6G A;  3BY7 A;  2EQU A;  4M77 E;  4ELY C;  3OYM A;  3NPF A;  2BIV A;  2CKK A;  3CCS Q;  3JCM W;  1VQ5 T;  3L2Q A;  3QWX X;  2COW A;  1QVG S;  2RJC A;  1Y07 A;  2YRD A;  3LLR A;  1WZO A;  2GF7 A;  2KEA A;  1KD1 C;  3VS1 A;  2YUQ A;  1WHH A;  4DQ2 A;  3ZEH A;  1W2B A;  3FC3 A;  4LE9 A;  5IH2 A;  2F1L A;  4XU3 A;  3LH5 A;  3JCM h;  4C8Q B;  4RMO A;  4ANJ A;  2RI3 A;  4M77 D;  2O9S A;  4M7D C;  3G1J A;  1V29 B;  3CC4 T;  5HKC A;  1YJW A;  3H0I A;  4EMK C;  2EYY A;  2M51 A;  3TQ7 P;  4M7D F;  4JUV A;  4PJO E;  1N9S A;  1VQM Q;  3A8M B;  2DL7 A;  2NLU A;  2BE9 B;  2DM1 A;  3FIF A;  4JRI A;  5LJ3 j;  2HQX A;  2LNH B;  3EHQ A;  1VQP A;  3QYG B;  3LWH A;  2KGT A;  4C92 B;  2O2O A;  3CBP A;  2RJE A;  4XQ3 A;  4M75 B;  2OTL T;  3MJX A;  1WYX A;  4C0F A;  4L6V 5;  1RAI B;  4J7F A;  4J9E A;  3GIB A;  2XKO C;  1K8A R;  2RMO A;  4MDW A;  4F7U E;  3OYL A;  4IKF A;  4JJN K;  1K9A A;  1PKT A;  3CCR A;  1PM3 A;  1ZBX A;  2X3W D;  1GXI E;  1R8O B;  1QVF P;  4OB3 B;  4OMM A;  4WTO B;  4D8D A;  1QCF A;  4ZTJ A;  1V76 A;  4NL2 A;  2RN8 A;  2VXF A;  3V8L A;  3CME A;  1B07 A;  4OMN A;  2HDA A;  1HK9 A;  2HQE A;  2QA4 A;  4PFP A;  1PHT A;  2DXB A;  2R57 A;  2HAX A;  3OYB A;  1K9M C;  1VQ7 Q;  3I9Q A;  2FPE A;  3L2W A;  2XDB A;  1YJN Q;  1K73 R;  2YSQ A;  2WAC A;  2ED1 A;  1LPL A;  2YLC A;  1SHF A;  3OBY A;  4CC2 A;  4B9X A;  1YJ9 T;  5IXF A;  4OB1 B;  2KT1 A;  1GCQ C;  5LJ5 g;  2DFU A;  5GMK i;  2E70 A;  3VS2 A;  1CKA A;  1D0X A;  3WVE B;  2DXT A;  2DO3 A;  1VQL T;  4BE1 A;  2KRN A;  3JRZ A;  2ROT A;  2QYZ A;  3LGF A;  5FU6 B;  1R0B G;  3JB9 G;  2YXY A;  1JQQ A;  1UGQ B;  3N5B B;  3UAT A;  1VQN A;  4M75 F;  4E7J A;  3CCE T;  3EHR A;  4BUG A;  4BAC A;  3CCS T;  4GY5 A;  3L2V A;  1HSQ A;  1WHK A;  2VAS A;  4XTV A;  1VQ4 A;  1WXU A;  3PFS A;  2K7A A;  3CCJ T;  4M75 D;  4HCC A;  1JO8 A;  1AWO A;  3VS3 A;  1IB8 A;  4E7S A;  4RCC A;  4OGE A;  3X28 B;  2DRM A;  4XTX A;  2EQK A;  1KC8 U;  4RCB A;  5KCH A;  5A2Q E;  3QII A;  1RUW A;  2EBP A;  1I1J A;  4KUL A;  2NUP A;  1UEB A;  4BD3 A;  4QW2 A;  3CC4 Q;  2DX1 A;  5J26 A;  1BI0 A;  2L3Q A;  3LWI A;  1TSF A;  3HRU A;  1IZ6 A;  1VQK T;  3M4Y A;  2J6O A;  2E6Z A;  1WXB A;  2BZY A;  1WJS A;  2DTO A;  4HKE A;  1D3B B;  2DBM A;  1WFW A;  3EH2 A;  2RO0 A;  1G3Y A;  1H8K A;  2EKH A;  1NBE B;  4Z8A A;  1AZE A;  2XD0 A;  1QCN A;  2DPP B;  2ZPE B;  1Q7Y R;  1UFF A;  4J7I A;  4RTT A;  3EFR A;  2XK0 A;  1VOM A;  2QQR A;  4PNO A;  3OYY A;  2BTT A;  3MP8 A;  4Q5W A;  4M78 A;  5KYW A;  3EGD B;  2RQT A;  4DBR A;  3SWN B;  3VUZ A;  1VQ4 Q;  1TG0 A;  1Q82 U;  1HJD A;  3VRZ A;  3A1P A;  4CC4 B;  2FRY A;  1MV0 B;  1UUE A;  1M2O A;  1WI7 A;  1OPL A;  3JCM f;  3DLL A;  2AZS A;  4KH1 B;  1GFC A;  1IO6 A;  1X27 A;  1BI2 A;  2ECZ A;  2K9G A;  4FYW B;  4OMQ A;  5KYX B;  1I5L A;  4GLM A;  4CI0 C;  4BY6 C;  3RKW A;  3G71 T;  4ELZ C;  4V2S A;  1V1C A;  2PUK B;  2NUT A;  3OW2 S;  1GCP A;  2CT3 A;  2L3S A;  1VQ9 Q;  1YNZ A;  4FU6 A;  3EG3 A;  1TH7 A;  4JJD A;  1X2K A;  3SB2 A;  3J7A F;  2J7I A;  3PE0 A;  4GBQ A;  4KUI A;  2CZ1 B;  1NYF A;  1WGS A;  2DJQ A;  2LJ1 A;  4QVC A;  1YJN A;  3NTK A;  4M7A C;  2QA4 T;  1X75 C;  2RI2 A;  3EG2 A;  5GAN 5;  1HXD A;  1G3T A;  1K0X A;  1Y71 A;  2KMT A;  2CZ6 B;  4M7D G;  2GQV A;  4E2F B;  2LQN A;  2ZCF B;  1S72 T;  2KT8 A;  2DEU A;  3TRE A;  3VS4 A;  2NYS A;  3JCM c;  4JS4 A;  1QVP A;  2PUO B;  3G6E T;  1LCK A;  2HZY A;  4LD9 K;  3DLM A;  2DMO A;  2XHC A;  2QAS A;  2O01 E;  1ZA2 B;  2AT1 B;  1Y7X A;  2QAZ A;  1Y57 A;  2CP0 A;  1ZLM A;  3OYF A;  5GAM j;  3JCM e;  2K5F A;  3S3O A;  4RG2 A;  1JJ2 S;  5FLX E;  1RLP C;  1VQ9 A;  3CD6 A;  3DB4 A;  4FYX B;  4C8Q D;  1T3L A;  1QVF A;  1NEB A;  2JS2 A;  2P84 A;  2ZZD A;  2DL8 A;  1AVZ C;  2EFI A;  3RMQ A;  3OYH A;  3EGU A;  3L2Z A;  1RLQ C;  2L2P A;  2H3E B;  4GLK A;  4C92 F;  2OTJ T;  2NUZ A;  3CBM A;  3EH1 A;  1RI9 A;  3H0F A;  4C0G A;  3AHU A;  2MMP A;  4X34 A;  8ATC B;  4DOW A;  1ABO A;  2HSE B;  5DLQ E;  5C0M A;  2YWW A;  4LUD A;  4FT2 A;  5CIU A;  2LX9 A;  1H3H A;  2MK5 A;  3CCQ A;  4OMP A;  2QA4 Q;  2L89 A;  4F17 A;  4OB2 B;  1FWZ A;  3M56 A;  4FL6 A;  4J5Y A;  4IUV A;  4C92 C;  1OZ3 A;  1NLO C;  4FW2 A;  2KY9 A;  3A8O B;  2ATC B;  2M02 A;  2CUB A;  3M9Q A;  3M0S A;  3ME9 A;  4J9G A;  5GAN 8;  3PTA A;  3QYH B;  5CVI A;  1J3T A;  5HK0 A;  2HBW A;  3OYN A;  2RQR A;  3QG1 A;  4LNP A;  1XJW B;  3G71 A;  1YJW Q;  1D1B A;  1I8F A;  2YT6 A;  4XU1 A;  1NE8 A;  1Y0M A;  4C92 G;  2EYZ A;  3M0P A;  2DRK A;  2A37 A;  4PJO C;  2RPN A;  4F04 B;  2ESW A;  3HFN A;  3LH0 A;  5LJ3 g;  3G4S Q;  5GAM f;  4M7D E;  2O4X A;  2L8D A;  1OV3 A;  3Q1J A;  3OB9 A;  4BE0 A;  2DIL A;  3I5R A;  1VQ6 T;  3O5Z A;  2X3X D;  1WDX A;  4DOV A;  5GAM e;  2X35 A;  4OML A;  1B3Q A;  2F5K A;  4HXJ A;  7AT1 B;  5LJ3 f;  1Q95 G;  2EVR A;  3IQL A;  3REB B;  2M0Y A;  2NUT B;  1G5V A;  5GAN 3;  3CXC A;  1RAF B;  1OI1 A;  3M5A A;  5CKD A;  3G6E A;  4AFU C;  4JLI A;  3JB9 J;  4LDU A;  2R5A A;  4KBM B;  4M7A F;  3AT1 B;  4ZN3 A;  1ZSZ C;  5EG2 A;  4C5I A;  4M77 C;  5KE3 A;  1QP3 A;  4F7U F;  3GP8 A;  1SRL A;  2LCC A;  2K3B A;  1M8M A;  3QO3 A;  4J9H A;  4M78 E;  3HP9 A;  4M75 C;  5D6X A;  3CME Q;  2C0T A;  3OYC A;  1LVK A;  1VYV A;  2XI9 A;  4JPB W;  2MI6 A;  1WHL A;  1IRX A;  1X43 A;  3JCM d;  3G6E Q;  1X6O A;  3M55 A;  2FPD A;  3DB3 A;  4BI8 B;  4HCZ A;  2D6F A;  4F7U B;  2JUF A;  1YIJ T;  3J81 E;  3HSB A;  2YUP A;  1NJI U;  4LDW A;  4E7Z A;  1TOV A;  4QVD A;  1PNJ A;  2DL5 A;  3CCM T;  4HT9 A;  4XU0 A;  5FU7 C;  2C0I A;  1D1A A;  4C92 E;  5FRN A;  1YP5 A;  4M7D B;  1G83 A;  4L5G A;  5I21 A;  1Q86 C;  2V1R A;  1G3W A;  5FWC A;  2DET A;  4FYY B;  1ZA1 B;  4PJN A;  1G2B A;  1VQ6 Q;  3UPU A;  4C0D B;  2EWN A;  1WA7 A;  1UEC A;  2JOY A;  3JB9 I;  4PFZ A;  4PJO B;  3PVQ A;  1YHQ A;  2DZ9 A;  5L23 A;  4A4H A;  1LNX A;  4IIO A;  2R5M A;  2L0A A;  2EGA A;  2C0O A;  2CP5 A;  2VB6 A;  4M77 F;  1M1F A;  5GAN f;  1RAE B;  3CCU A;  3FLG A;  4FSX A;  2QEX A;  2EQJ A;  3SHW A;  1D1C A;  4N4I A;  1MNE A;  4QQ6 A;  4JLG A;  1RAH B;  2PTK A;  1KQS S;  3MEU A;  1KHI A;  1BIB A;  4JZ3 A;  1BIA A;  3VV0 A;  3QJY A;  2RHZ A;  3QWY A;  4DEX A;  2VYT A;  3V8K A;  4D8K A;  2LX7 A;  1VIF A;  2LQK A;  1UHF A;  3NFC A;  2H3J A;  4PJO G;  1YJW T;  3C4S A;  1T0H A;  4MZP A;  2BKD N;  2PVG B;  4E6R A;  2V8K A;  1JU5 C;  1P92 A;  2VXE A;  4EMG A;  2WSF E;  4M78 C;  1QMC A;  2RHI A;  2RHX A;  4MDX A;  1Q7Y U;  4L59 A;  1OU8 A;  2KRM A;  4MZM A;  3HPW A;  3CCM Q;  2JZ2 A;  5CKH A;  3CXC P;  3M0T A;  3QUI A;  3X20 B;  1FMW A;  1Z9Q A;  3OS5 A;  2E1H A;  4M78 D;  2CZ7 B;  3VKI A;  4NL3 A;  1XQH A;  4M7A E;  3L1A A;  2GTO A;  1AZG B;  3CCQ Q;  5KCO A;  1OZ2 A;  2I2L A;  4RTU A;  1BBZ A;  1U5S A;  4FW1 A;  3GBQ A;  3EGD A;  4M78 F;  4HCB A;  2K3X A;  2ZPG B;  1TUC A;  3JCM Q;  2DYI A;  3TCJ A;  1WHM A;  1QP2 A;  2EJF A;  3HRS A;  4J9F A;  1TXQ A;  2MCN A;  1GCQ A;  1O9S A;  4JS5 A;  1UGV A;  1CSK A;  3CME T;  4MML A;  2IIM A;  2KVQ G;  2QGG A;  3SFM A;  5CAI A;  4E7I A;  1VQ8 A;  3ZL7 C;  4C0D C;  2DA9 A;  4RKU E;  1FMV A;  3QDF A;  2RH2 A;  4NS5 A;  2CP3 A;  4LDX A;  5IXB A;  1NEG A; 
#chains in the Genus database with same CATH homology
 1YJN Q;  1K73 R;  1VQ4 Q;  1QVF P;  1VQ5 Q;  3CC7 Q;  2QEX Q;  1VQ6 Q;  1N8R R;  3I56 Q;  1VQO Q;  3CC4 Q;  3CME Q;  1VQM Q;  1YI2 Q;  1YJ9 Q;  3CMA Q;  1M90 R;  1Q7Y R;  3CCU Q;  3CCR Q;  1VQP Q;  1NJI R;  3CCE Q;  1Q86 R;  1S72 Q;  1Q82 R;  3G4S Q;  3CCQ Q;  1K8A R;  3CCL Q;  1YIJ Q;  1VQ8 Q;  3I55 Q;  1VQL Q;  1YHQ Q;  1YIT Q;  3CCS Q;  1KD1 R;  2OTL Q;  3G6E Q;  1VQ9 Q;  2OTJ Q;  1YJW Q;  3CD6 Q;  1M1K R;  1KQS P;  3OW2 P;  2QA4 Q;  3CCM Q;  1K9M R;  3CC2 Q;  1KC8 R;  1W2B P;  1Q81 R;  1VQ7 Q;  3G71 Q;  3CXC P;  1VQK Q;  1VQN Q;  3CCV Q;  1QVG P;  3CPW P;  1JJ2 P;  3CCJ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...