3CCQQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccqQ00
3CC4Q 1VQ4Q 1VQ6Q 3CCMQ 1YIJQ 1Q82R 1W2BP 1VQKQ 1YHQQ 3CPWP 3CCLQ 3CC7Q 3I56Q 2QEXQ 1VQMQ 3CCVQ 3I55Q 1YJWQ 3CD6Q 3CC2Q 1K73R 1VQOQ 1Q81R 1YJ9Q 1VQ5Q 1YI2Q 2OTLQ 1VQ8Q 1KQSP 1VQ7Q 2OTJQ 1Q86R 3G4SQ 1KC8R 3CMAQ 2QA4Q 3CCQQ 1YJNQ 3CCEQ 1Q7YR 1QVFP 1YITQ 3CCSQ 3G6EQ 1VQ9Q 3CCJQ 1VQLQ 1JJ2P 3CCUQ 1K8AR 1VQPQ 1KD1R 1M1KR 1VQNQ 1QVGP 1S72Q 3CMEQ 1NJIR 3CXCP 1M90R 3OW2P 1N8RR 1K9MR 3CCRQ 3G71Q
chains in the Genus database with same CATH superfamily
1RL2A 1VA7A 1VYUA 1U1SA 2K2VA 2O2OA 3RKWA 4M7AD 3PVLA 1WX6A 3CEYA 3E2UA 3BDUA 2DNUA 2A3LA 2J7IA 3FDRA 4GY5A 1YJNQ 2FVUA 8AT1B 2JM9A 2DVEA 3OS5A 3PNWC 4C8QC 2FZGB 1I07A 3QSUA 2RI3A 3EG9A 2RMOA 1IO6A 2OJ2A 2FRWA 2QTVA 4BY6B 4KH1B 4IIOA 1VQKQ 1Y71A 4E7ZA 1ZBXA 3RR6A 2LC4A 1WIEA 4J9GA 1NG2A 1E6HA 1RLQC 1CSKA 3MP8A 1U1TA 2VB6A 1VQKA 4QVZA 8ATCB 4M77G 5GAN7 1D1BA 2D0NA 2BUDA 3RKXA 4Y91A 2F69A 4ZGEB 2E6NA 4E6RA 4ZGJB 5CKDA 5IAYA 1H641 2RB6A 2V8KA 2DZCA 4C5EA 4M7DC 3VS5A 3M59A 4LN2A 4M77B 1K0XA 2VC8A 1YITQ 2LRQA 4OMQA 4HCCA 4J9CA 5EG2A 4M7DG 1IGUA 1K8AU 3EG1A 3CCRA 1N27A 2DXUA 2RQWA 4J6YA 2QGFB 2AZVA 3WVDB 2KAFA 4PJOC 5DLQE 4ME7A 4ANJA 3CCUT 3D7SB 3EH2A 4FW1A 2JZ2A 2MIOA 4OP0A 4AT1B 2XG8D 5FU7B 1D09B 4RG2A 1UGVA 2NUZA 4DBFA 4ZN1A 3QO3A 1K0SA 2CP3A 2GQVA 3CD6A 4FYVB 4RCBA 3QJ6A 5GJWB 4LDWA 5GAN2 4MMLA 2CGHA 1WXBA 2BKDN 2YDLA 1FX7A 2L3PA 5FU7C 1PD1A 2MOXA 1YJWT 1M9SA 1ZHIA 3CPWA 2JTEA 3MPUB 4FT4A 3JCMe 3CCLA 2FHDA 2ZPGB 2P84A 4IIMA 2CT3A 2V8IA 1PHTA 4JRIA 1K9MR 4A53A 2QA4T 1NJIU 2KYMA 2NLUA 4C8QA 1VQ4Q 3MP6A 4ZN3A 2R5MA 4QW2A 4IUVA 4AFZC 5KE2A 5J3BA 4RG8A 2C0IA 5LL6S 1W4SA 1OOTA 4PJLA 5I21A 3OSVA 4DEXA 3LH5A 2RJEA 3ME9A 2QDLA 4OB0B 2CP5A 1PD0A 3DLMA 4Z02A 3V8KA 3M4GA 1AWWA 4Z8AA 5KYUB 3JRZA 3L42A 5HKCA 4FM4B 2HBPA 1UUEA 5LJ5g 2DMOA 1Y07A 1VQOQ 2COZA 4E47A 5LJ3e 1KQSP 2K3YA 3I5RA 4EMGA 5GAMd 2XIDA 1MNDA 2DVJA 3CPWS 3PE0A 5GAOm 3NTKA 2DTHA 2BZYA 3RMSA 2ROTA 1I0CA 3MEAA 1GCQA 3QXEB 2HQEA 1OEBA 2LZ6B 3UATA 2DL3A 2M1HA 4PJOF 1YJ9T 4BDZA 4J9HA 3LGFA 2DL7A 2W10A 2OAWA 1VQ5A 4PK4A 1Q7YR 3I55A 3MCAB 1Y96B 4C92D 1FMVA 4XU2A 3I55T 1M8MA 1N8RU 1ABOA 1VQNQ 1Y96A 2RPNA 3QIIA 6AT1B 3CCJA 4RTUA 1W70A 4OVAA 4MMKA 3TEEA 3G7ZA 1K76A 1VQMT 2DERA 1KQSS 4ZTJA 1VQMA 2DYBA 2K5LA 2DO3A 2O01E 3V7CA 4JJNK 1QCFA 3JB9I 2AT1B 1VQNT 1QVGP 1ZUYA 1F1BB 4J9IA 1KC8C 3CC7Q 3QZ9B 3JSCA 1V76A 1KJWA 5I22A 2ZPIB 1YJ9Q 3GP8A 1LNXA 3G4SQ 3FJ5A 1G3SA 1XNIA 1HYOA 3MEUA 2CSQA 1GBRA 4LDUA 1XJWB 2E6ZA 4M7AF 4PLLA 5GMKm 2QQSA 4HCZA 1M2VB 2EKHA 4OB1B 1KG1A 1MMAA 2JUFA 1VQMQ 1P92A 3LH0A 4B9XA 4OMLA 5C6SA 2WSCE 3URGA 5GAN5 1UECA 1K73U 3EG3A 3JCMP 4LUEA 2VGMA 2LNHB 5C0MA 4PJNA 1LPLA 2XDPA 3EFSA 4OB2B 3O8VA 1QVGA 1I81A 2KRNA 1G5VA 3OBYA 4DOWA 4RTTA 2KROA 3L2VA 5L23A 1RI0A 3VS6A 2K57A 2M0YA 1MNEA 3VUBA 2LT4A 3A8GB 5HK3A 3LWIA 2YWWA 1BU1A 4ORZA 2DAQA 4QQGA 3M5AA 4M78B 4BI4A 3JB9J 1K8AR 1MMDA 1Q86U 2AK5A 3C12A 2DTIA 2ZZDA 1W2BA 3QJYA 5GAMf 4M78C 3G71Q 5FRMA 1AOJA 1WFWA 3G4SA 3AT1B 3RESA 1VQOT 4M7AG 3CCEA 1HXDA 1VQ8A 3G71T 2E5QA 5KCOA 3DKMA 3GIBA 3S3NA 3G71A 3EFOB 1VQ9Q 3L2WA 2CP2A 2FPFA 1GFCA 4XQ3A 1G8XA 3OMCA 3CC4Q 1N9SA 2RN8A 2RQUA 1YI2Q 2EGCA 3V8JA 4A63B 2M9UA 2ZPFB 3CMAQ 2QA4Q 5LJ3f 1QKXA 2YLBA 4RMOA 3OS2A 3LLRA 3CC2T 3M57A 4II1A 2O88A 2EQMA 5DM7R 4FT2A 4M7AC 1M8VA 1JRIA 3EAEA 4F14A 5GMKh 1KHCA 4J7FA 1SHGA 3OYIA 2EYWA 1SG5A 2OTJA 4RTYA 1TOVA 1YJWQ 1YI2A 1CKAA 1ZUUA 3KUFA 1ZA1B 2MF2A 2MWOA 4X34A 2H3EB 1OV3A 1ZBJA 1T0JA 2PU9B 4A4KA 1AWXA 1HD3A 4WCIA 3L2UA 4PKCC 2LT1A 2M0OA 2BE9B 1NYGA 1ARKA 5GANd 3M0RA 4XTWA 2DIQA 5IXFA 3CMAA 3QPHA 2PVDB 3UDCA 2OAUA 2KR3A 1WDXA 1C1AA 1VYTA 2JMAA 3LW5E 1NPRA 2QTXA 2F1LA 3CC4A 1D0XA 4ESRA 2L3QA 4M78F 1M5Q1 1NE8A 1GCQC 3DB3A 4XTYA 1S72A 4QQ6A 1S72T 1D1AA 1VQLA 2E3IA 1WHJA 2AZSA 2ENMA 2KK4A 4OF1A 1QP3A 2DKGA 2RHYA 4DBQA 2DD4A 4OMNA 4C0FA 1YNZA 2CS7A 2P0QA 5CKEA 1LOJA 1G83A 3CXCP 3G6ET 4RTXA 3JCMV 1BCMA 5CKBA 2F2VA 1O9SA 1XOVA 3SWNC 5GAN3 5CKFA 2WACA 3T9NA 1QKWA 3TSWA 5KYYA 3I35A 3BY7A 3E19A 3CBMA 3DLLA 2XICA 4JJBA 1UG1A 1BB9A 2DFUA 3E1SA 4BE2A 2VV5A 5GAOq 3A1PA 4KGXB 2DETA 5IT9E 3JB9F 4JLIA 2MWPA 2NWMA 1UB4A 7AT1B 1GBQA 3CC2Q 2DK3A 2KNBB 2GNCA 3JCMc 2K4YA 1OPLA 3CC7A 1AZGB 2I0NA 1E6GA 2SRCA 2PZ1A 3CXCA 1VIFA 1W2BS 4PNOA 2SEMA 4FYXB 3ZFJA 1OU8A 4BUGA 2QAZA 1YITA 4JJDA 3N5BB 3ZEHA 5KE3A 5GAMe 2EQUA 1BKBA 3OYMA 2VGNA 1AWOA 2RK2A 2EIFA 4M7AA 2RI5A 5FU6B 4LDXA 3VS3A 3I56A 4GBQA 1Q7YU 2PQWA 5GMKi 5A0GA 1YJ9A 4C92G 2RQRA 4L59A 1M1KU 3M58A 2ZPHB 3CCJQ 3RERA 1Q82U 3RNJA 4HT9A 1C6VX 3KBGA 5IHNA 5GANg 4BE1A 2YUNA 1YIJQ 3FB9A 4EDUA 3BE3A 3CCJT 4LD9K 5KCHA 2EVRA 3HKSA 4LXCA 4NL2A 9ATCB 3A8LB 1Y7XA 1QCNA 1DJ7B 2J6FA 1X6BA 2E4HA 3CCMT 1K1ZA 2WSEE 3CC4T 4XK8E 2DIGA 3HHTB 2J05A 1VQNA 3OYNA 4M78D 3TREA 1VQLT 3FEOA 4PJOD 2HD0A 1WHHA 4R56A 3OYHA 1SSFA 2DTOA 1KC8R 5J26A 1W6XA 3A8HB 4ZGDB 1WHLA 1WQ7A 2HQXA 2QI2A 1I1JA 1BI3A 2JW4A 4CRIA 3CMEQ 1QW1A 1OZ3A 2FZCB 3G1JA 1UFFA 4C92E 4PJMA 4NS5A 1QLYA 1M1FA 2BTTA 4A4HA 1RAAB 1N6AA 1SHFA 4GLKA 4M7DF 1SRMA 2ZCFB 4M77C 1SRLA 4EPCA 1ZSZA 4QQDA 3M0PA 1JJ2P 3CCUQ 4M7DE 3CCRQ 2LVMA 4VUBA 1X01A 5DLOA 1Z9ZA 3JB9G 3CCLQ 1IHWA 4K11A 4LUDA 2DE0X 3L1AA 4LE9A 2CZ7B 2ECZA 2F5TX 1HK9A 2IIMA 2V26A 2ZPEB 4LNPA 2MAMA 2R5AA 2FYKA 2EAYA 4M77E 1H3ZA 4V2SA 5KYXA 3EGXB 3SWNA 1TUDA 2ZGWA 5LJ3d 3TU4K 3NGPA 3I55Q 2FL7A 1NBEB 3VYHB 5KYUA 2CT4A 2CP0A 3L2RA 1D3BB 4PFZA 2NUTB 3CBOA 5FLXE 5CVIA 3VYGA 1D3BA 4C0GA 4IKFA 2KRMA 1Y57A 1AWJA 1H3HA 2MI6A 1YHQQ 4M78G 5D6XA 1XTDA 4PJOB 2XKOC 2E41A 4A4EA 2BZXA 1U5SA 2LJ0A 3FIFA 3SFMA 2QXFA 2MK5A 1YHQA 2HNIA 1M90C 4O6JA 2CYZB 1UJYA 1TTHB 3ER0A 1QVFP 3VV0A 1QP2A 1IGQA 1SPKA 4JDSA 2COWA 2RO0A 4KRTA 1TWBA 2D1XA 1IZ6A 2ROLA 2ATCB 1I4K1 4Q5WA 4KT0E 4M75A 5LJ5e 3M55A 5KYWB 3M0SA 2K3BA 3H41A 5GAN8 4N0AC 2OTJT 2AHJB 5GAN6 1YI2T 1AZEA 3P8HA 3OYLA 1ZLMA 1M1KR 3CXCS 2L5QA 1JJ2S 2HBWA 4ELZC 2DBKA 2MCNA 1EZZB 1PKTA 4N4GA 2KYBA 3L2ZA 4LDVA 3H0HA 1R0BG 2X4XA 3INZA 1PSFA 4OMFB 4OGCA 2OTLA 2ABLA 5GANh 3CCQQ 4J6WA 4L5GA 2OTLT 1C0MA 2QGGA 3LWHA 3VS2A 2K9GA 1FXXA 1K9AA 3VRYA 3OW2P 2XD0A 4F7UF 2RHXA 4KGZB 1FMKA 2CREA 4AMCA 3V8LA 5I2MA 1D0YA 4YTLA 3SD4A 4F7UE 4C8QG 1NLOC 2DBMA 3OYCA 4B6MA 4MZTA 2L89A 2DLPA 1B34A 4M4ZA 5CQXA 1BBZA 2DM1A 2D8JA 2LQWA 1N9RA 2JM8A 2VVKA 4IUPA 2EW3A 3HFNA 4F7UG 2EJ9A 1ZA2B 3G6EA 4DA4A 3X25B 3CCVQ 2D0QB 1RLPC 1SKUB 5FRNA 1ZUKA 3C0CA 2DXTA 2O31A 2JS0A 3P8DA 4AG1C 2MYSA 5GAMg 3BFMA 2IPOB 3EHRA 2M02A 5DY9A 1YCYA 3UA6A 1K9MU 2X35A 2VWFA 2GCXA 4XTXA 2KXCA 4C0ZA 2L0AA 3PIPA 1BYMA 3OYEA 1Q81U 4C5HA 1MHNA 2FO0A 2H8HA 3REBB 3J81E 2FPEA 4J6XA 3KXTA 1G2BA 3HRSA 2DA9A 2K5FA 2RHIA 2FEIA 4M7AB 2P0PA 4IUUA 2J6OA 2Y4YA 3QDFA 4E7IA 1VQ6T 2RA2A 2P4RA 4JRKA 4PJOG 3JB9H 3HL8A 1SF9A 2E10A 4L6V5 2VXEA 1W1FA 2X3XD 2H3JA 1YJNA 1EFNA 1MMNA 2BZ8A 4ZNXA 2RJCA 1YJNT 1JEGA 3FC3A 3ULRB 3VRZA 3QHSA 4EIKA 1JQQA 1WZOA 4X1VA 1KK7A 4FL6A 2YRVA 2E1HA 2X4YA 5I2SA 5L8RE 3EGXA 1WXUA 1V1CA 1KSWA 2CZ0B 3OY9A 2R58A 2M51A 2AKLA 4Y92A 4CC7A 4KBMB 4WTOB 1T3SA 3DB4A 2KQWA 1VQ9T 4HCKA 2NUPA 5GMKj 1NPPA 1WA7A 1OPKA 4X9CA 1X75C 3HFOA 1AT1B 3MP1A 1B07A 1I5LA 5AT1B 1Q86R 1VQ7A 2DPPB 2YSQA 3X24B 5KYWA 1EX4A 4JZ3A 4J9FA 3JCMJ 1M90U 4M7DA 2E12A 4HVVA 4M75C 3M56A 4ATOA 3I56Q 1NM7A 1RACB 5LJ5j 3EGDA 1Q81R 1U06A 2F2WA 3H9NA 3M53A 1OULA 4AG2C 2EWNA 2E65A 2RH2A 1OI1A 1T0HA 4M78E 5FW9A 4NL3A 1BI1A 2EQJA 1GL5A 2EFIA 4M75G 1WJSA 4BB7A 5GAOp 3GNFB 2M16A 3GLXA 2DXBA 1BCOA 3GNGA 1RAIB 4J9BA 2JVVA 3GPLA 1X6OA 1WGSA 3CD6T 1WYXA 1JXOA 2QG9B 4FIBA 4M75D 2G6FX 3CQTA 5LJ3g 5GMKe 3CMEA 2YXYA 1D1CA 5M9OA 3EFRA 1VQ6Q 1I5OB 1KD1U 2XI9A 1B34B 3EGUA 4BACA 5A2QE 4Z89A 1QWFA 2DL5A 2HQHA 5GAMh 3CCLT 1M27C 1YJWA 1PM3A 2OTJQ 2EQIA 1BIBA 4QVDA 2JNGA 3JAME 1YN8A 5IHIA 1YP5A 3MEWA 3VKIA 1NYFA 1PNJA 2A08A 1UEBA 3P8BB 1X6GA 3KFVA 2DL8A 1UDLA 3Q1JA 2QQAA 3CCVT 2LQNA 1RAFB 1M90R 3F70A 1QMCA 1VQ9A 4HCBA 2B86A 4M75F 3J7AF 2V8JA 1RABB 3NMZC 4MDXA 2QQ9A 2DRMA 1M4ZA 4EMKA 3X26B 3M4YA 4PJJA 5J39A 4J5YA 3A98A 3HTRA 1MGQA 4RTZA 1OU9A 4N4IA 1AD5A 1M1KC 1UJ0A 2AKKA 3META 4DOVA 1MV3A 2JT4A 4A4FA 1QCOA 1ABQA 4N4HA 3CCQA 5GAOl 5A0LA 3WVEB 1YBYA 3UF4A 3JCMb 1RAHB 3FJPA 4F7UB 5AYFA 2NYSA 1UE9A 3OW2A 1VQ5T 2HAXA 2Y4XA 5FWBA 2DILA 3JCMQ 2P0KA 5EC7A 1M2OA 2DJQA 3CCRT 5A0DA 1B7TA 2DEQA 2ZAEA 1LVKA 3GF5A 2ESWA 2OI3A 1IXDA 2BE7D 2VKNA 4C8QB 3RKYA 1UTIA 5HCKA 3R6OA 4KULA 3CCMA 4OGEA 3EGDB 4PJOA 3JCMh 1VQPT 2V1RA 4C92F 1FYNA 2D6FA 2RJFA 3QZ5B 3VJPA 1X2QA 2RHUA 4FSSA 3PFSA 1NLPC 5IH2A 2F2XA 5IXBA 2CUBA 3GOXA 1WQWA 4JS4A 2QQRA 3I5SA 4O5VA 3OQ5A 1ZSZC 2DD5A 1VQLQ 3UT1A 5GAN4 1KD1R 2RHZA 4C8QD 3H6ZA 2GGRA 1U3OA 1QVFA 1K73C 2L3RA 1TXQA 2VASA 4HVWA 4DQ2A 3CCMQ 3RMQA 4X9DA 1AEYA 2XDDA 5KYYB 1PRMC 2E5KA 1EIFA 1BI2A 1GRIA 4MZPA 5CCAA 1TS9A 4PJOE 4FW2A 4M77F 1SSHA 3VUZA 4XTUA 2Z0WA 4M77A 4UC4A 1YIJT 1TUCA 3X28B 1UHCA 1OX9A 2YLCA 1UGRB 4OMMA 3RBBB 1WJQA 1TUGB 3HRTA 3LX7A 3CPWP 1JJ2A 4JLGA 3UPUA 1S1NA 1KIKA 2JMCA 1FMWA 4J7IA 1K4US 2HCKA 4GLMA 3QDRB 1UGSB 3PIOA 1TSFA 1WHKA 2VUBA 2YRDA 2X4JA 3REAB 2QK0A 1ACMB 4LD6A 3CCST 2GBQA 2VXFA 3NTHA 2FB7A 3VS7A 1JBMA 2QA4A 2JN0A 4FYWB 5CAIA 3CCET 2X51A 4BDYA 2CP6A 1ZSGA 1FWZA 5CR2A 1VQ8T 4C8QF 4ZTFA 3OW2S 3RUXA 2KRSA 2GFUA 2LX7A 2KT8A 2DF6A 3S3MA 4PFOA 1M2VA 3M54A 3PMIA 1N5ZA 2L2PA 2D9TA 2MPXC 3V7SA 5GANj 3SEMA 4Y28E 2RQTA 5HY6A 4HKEA 3CCEQ 1MMGA 3CC2A 5KYXB 3HRUA 1B3QA 2QEXA 2D8HA 2A36A 2EYXA 1Q86C 2LP5A 3OYFA 4C0DC 2LDMA 3IQLA 1Q82R 2PVGB 4R0KA 1MUZA 1HSQA 4ELYC 2KI7A 5FROA 5HK0A 3QYHB 4KUIA 1PKSA 2O9VA 3I56T 3OMGA 2HL3A 2KXDA 3OB9A 3OYDA 4E7LA 1R8OB 2W0ZA 2K2MA 2CKKA 1Q81C 2XHCA 5GMKl 1BK2A 2QEXQ 1BIAA 2CDTA 5CK9A 2A28A 2PTKA 3S6WA 4E7JA 1RUWA 1E7OA 1YCSB 2ED0A 1M3AA 3ZBDA 3CMAT 1PCXA 5LJ3h 1NEBA 4BE0A 2I2LA 2FG0A 3JCMf 2K7AA 1VQPQ 1VYVA 3RDVA 2YUQA 1A0NB 4OMPA 2JTFA 4FYYB 2KE9A 3R6NA 3EG9B 1VQPA 2O9SA 5LJ3j 3SHWA 1KQ2A 3QYGB 3OYJA 1WPYA 2GF7A 4M78A 2LQ8A 1X2KA 1R77A 1ZQ1A 2G3RA 3U23A 4FCYA 1T3LA 4C5IA 2DJZA 3PGGA 2KDSA 3OYBA 2A7YA 2LJ1A 3M0UA 1LCKA 1VUBA 4BD3A 1M30A 3C94A 1NJIR 4OMOA 1VIEA 2GFAA 2O4XB 2XMFA 1JU5C 3OYKA 3CPFA 1G3WA 4C92B 2ZPBB 4MZMA 5D6WA 2NUTA 3C95A 2QYZA 2LMJA 4XU1A 5CQYA 2RM4A 1TH7A 1WLPB 3S3OA 2YUOA 3JV3A 2PUOB 5GANe 1OQKA 4AFUC 2JJ9A 1OX8A 4FU6A 2EGAA 1CKBA 4EMKB 4D6WA 2LNVA 4E7SA 4XTZA 2K3XA 2HL5C 3MJXA 1PC0A 1X43A 1YWOA 5KYNA 2K79A 2JS2A 2GQIA 1VQ5Q 2QDYB 3CC7T 1GXIE 1Z9QA 3PVQA 2HSPA 1N8RC 4J9EA 2XDBA 2O4XA 2X9HA 4XTVA 2XU8A 4QVCA 2QEXT 4F04B 2L3SA 4IUQA 2LTOA 3BW1A 1S72Q 1YITT 3JCMW 1OZ2A 2K6DA 4PLIA 2HSEB 2IVWA 3H0IA 2DL4A 3VS4A 4DEYA 1U8RA 2RD1A 1VQ8Q 2L8DA 2PNIA 3G4ST 1VQ4A 4E7KA 2HMAA 1VQOA 1LJOA 3WXMB 2E70A 4C5GA 3OA6A 1KQ1A 2EPDA 4JRPA 1KHIA 2YRCA 1IHVA 1RAGB 4F16A 1IREB 2BIVA 4E2FB 2R57A 3RIRA 2OX7A 4MDWA 1WXTA 2JXBA 4M77D 4OB3B 3SDZA 2CH4A 1NZ9A 2EGEA 2MMPA 3X20B 4AFQC 4QT7A 2EYYA 1V29B 3HPWA 1QVFS 1GCPA 4JZ4A 3JCMd 3OS1A 4KUDK 1WJRA 3JCMX 1VQ7T 5LJ5h 3HSBA 2B8AA 1XQHA 1PSEA 1G3YA 3AHUA 3M0QA 5CO7A 1QVPA 2KT1A 4HXJA 1ZX6A 4CC2A 3TSZA 1KD1C 4RCCA 2EYQA 2JOYA 1VOMA 5ECAA 1K73R 1IB8A 3A8MB 4BI3A 4NOYA 3O5ZA 3MO8A 4BY6C 4LDYA 3OYAA 3ZL7C 2CUDA 1RADB 4CC4B 3NTIA 4F7UA 3NPFA 2JTMA 3JCMg 2LCCA 3PT9A 5IN1A 4JUVA 3QKJA 3A8OB 1O75A 1M3BA 2PUKB 3J80E 2EQKA 2CSIA 1TG0A 2P4TA 2FZKB 3I9QA 4RKUE 5GAOn 5GAMj 2C06A 2KSSA 3L2QA 1Y0MA 3QWYA 1WI7A 4M7DD 1D0ZA 4RTWA 5I11A 5GJVB 1G3TA 2K5IA 3QG1A 4JPBW 3CBPA 3VS0A 3SWNB 4FSXA 2GTOA 1PWTA 4CC3A 2J6KA 3LGLA 4P5NA 1KC8U 1OYXA 2KMTA 2LX9A 4C92A 2VYTA 2COYA 1K9MC 2CZ1B 3EG0A 2EJFA 2RK1A 1BI0A 2EBPA 3A5ZB 3FRNA 2V1QA 3QBYA 2YHTA 5GAOr 2NUPB 1RI9A 1H8KA 4M75E 1YWPA 3GBQA 2PVOB 2DZ9A 2HEQA 5D7UA 2KVQG 4XU3A 4JRQA 1GFDA 1I8FA 4J83A 4PFPA 3M9QA 1YHQT 2RF0A 2A0FB 5LJ5f 3PMTA 3NFCA 3FLGA 4HVUA 1M3CA 2FRYA 1WHGA 4R55A 3OSSC 4A54A 5D6YA 3BDLA 1MV0B 2X3WD 1UGQB 1AVZC 2DYIA 4CI0C 4F17A 2CZ6B 1W2BP 2F5KA 1RAEB 2E64A 3EFOA 1KFZA 1VQKT 4KGVB 4M75B 5LJ5d 1Q82C 4XU0A 3THKA 4J8OA 5FU6C 2C0TA 3OBWA 2DRKA 1JO8A 4EMKC 3UA7A 3TQ7P 1J3TA 2YT6A 2DXCA 2HKQB 3CCQT 4D8DA 4XAXB 3OS0A 1Q7YC 2KY9A 4TVRA 2CH4W 4RTVA 3EG2A 2ED1A 4E7HA 2HKNA 4M7DB 4A4GA 4PL6A 4IURA 4RUGA 3CCSQ 2IG0A 3V7RA 2HZYA 1PRLC 3EHQA 2EYZA 3CCUA 3JB9D 1JB0E 4D8KA 2QASA 3MHXA 3MKDA 3CD6Q 4KH0B 3EH1A 5FWCA 5KH6A 3H8ZA 4QKUA 2LJ3A 2YUPA 3CMET 1X27A 1PG5B 4C92C 3OYYA 5GANf 4JS5A 1HJDA 2QQBA 1UGPB 2A37A 3UWNA 2AIRB 4IUTA 1KQSA 3SB2A 1NJIC 3LYIA 4B9WA 3H0FA 2LQKA 2X4WA 1IRXA 1TU0B 3TCJA 5CIUA 3VU3C 2EJGA 2E3HA 2XK0A 2C0OA 2CP7A 1AHJB 1YFNA 1WHMA 4JJCA 2KGTA 1WNLA 1X69A 4BI8B 3E9FA 4AFSC 4DBHA 1H92A 2RNAA 2LCLA 3OYGA 1NEGA 1QWEA 2OTLQ 1SEMA 3CCVA 2WSFE 1VQ7Q 2RI2A 1YIJA 1Q95G 4C0DB 5CKHA 4J9DA 3NHNA 3QWXX 2HDAA 1VQ6A 4N0AA 4HA8A 3MEVA 2EKOA 3E9GA 1N8RR 2DEUA 2KEAA 4Z88A 3PTAA 1QQJA 1R0CB 3ASKA 1UHFA 1M1GA 2Y90A 3C4SA 3M0TA 5IHKA 3TVTA 2DX1A 4EMHA 3VS1A 4WF2A 1K8AC 2GTJA 1ZSZB 2J06A 3QUIA 2FPDA 4C8QE 2KBTA 2RJDA 1JXMA 2RQVA 4HT8A 3G6EQ 2LCSA 4M7AE 1VQ4T 1QVGS 3CCSA 4DBRA 3HP9A
chains in the Genus database with same CATH topology
3CC4Q 1VQ4Q 1VQ6Q 3CCMQ 1YIJQ 1Q82R 1W2BP 1VQKQ 1YHQQ 3CPWP 3CCLQ 3CC7Q 3I56Q 2QEXQ 1VQMQ 3CCVQ 3I55Q 1YJWQ 3CD6Q 3CC2Q 1K73R 1VQOQ 1Q81R 1YJ9Q 1VQ5Q 1YI2Q 2OTLQ 1VQ8Q 1KQSP 1VQ7Q 2OTJQ 1Q86R 3G4SQ 1KC8R 3CMAQ 2QA4Q 3CCQQ 1YJNQ 3CCEQ 1Q7YR 1QVFP 1YITQ 3CCSQ 3G6EQ 1VQ9Q 3CCJQ 1VQLQ 1JJ2P 3CCUQ 1K8AR 1VQPQ 1KD1R 1M1KR 1VQNQ 1QVGP 1S72Q 3CMEQ 1NJIR 3CXCP 1M90R 3OW2P 1N8RR 1K9MR 3CCRQ 3G71Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 Q;  1VQ4 Q;  1VQ6 Q;  3CCM Q;  1YIJ Q;  1Q82 R;  1W2B P;  1VQK Q;  1YHQ Q;  3CPW P;  3CCL Q;  3CC7 Q;  3I56 Q;  2QEX Q;  1VQM Q;  3CCV Q;  3I55 Q;  1YJW Q;  3CD6 Q;  3CC2 Q;  1K73 R;  1VQO Q;  1Q81 R;  1YJ9 Q;  1VQ5 Q;  1YI2 Q;  2OTL Q;  1VQ8 Q;  1KQS P;  1VQ7 Q;  2OTJ Q;  1Q86 R;  3G4S Q;  1KC8 R;  3CMA Q;  2QA4 Q;  3CCQ Q;  1YJN Q;  3CCE Q;  1Q7Y R;  1QVF P;  1YIT Q;  3CCS Q;  3G6E Q;  1VQ9 Q;  3CCJ Q;  1VQL Q;  1JJ2 P;  3CCU Q;  1K8A R;  1VQP Q;  1KD1 R;  1M1K R;  1VQN Q;  1QVG P;  1S72 Q;  3CME Q;  1NJI R;  3CXC P;  1M90 R;  3OW2 P;  1N8R R;  1K9M R;  3CCR Q;  3G71 Q; 
#chains in the Genus database with same CATH topology
 1RL2 A;  1VA7 A;  1VYU A;  1U1S A;  2K2V A;  2O2O A;  3RKW A;  4M7A D;  3PVL A;  1WX6 A;  3CEY A;  3E2U A;  3BDU A;  2DNU A;  2A3L A;  2J7I A;  3FDR A;  4GY5 A;  1YJN Q;  2FVU A;  8AT1 B;  2JM9 A;  2DVE A;  3OS5 A;  3PNW C;  4C8Q C;  2FZG B;  1I07 A;  3QSU A;  2RI3 A;  3EG9 A;  2RMO A;  1IO6 A;  2OJ2 A;  2FRW A;  2QTV A;  4BY6 B;  4KH1 B;  4IIO A;  1VQK Q;  1Y71 A;  4E7Z A;  1ZBX A;  3RR6 A;  2LC4 A;  1WIE A;  4J9G A;  1NG2 A;  1E6H A;  1RLQ C;  1CSK A;  3MP8 A;  1U1T A;  2VB6 A;  1VQK A;  4QVZ A;  8ATC B;  4M77 G;  5GAN 7;  1D1B A;  2D0N A;  2BUD A;  3RKX A;  4Y91 A;  2F69 A;  4ZGE B;  2E6N A;  4E6R A;  4ZGJ B;  5CKD A;  5IAY A;  1H64 1;  2RB6 A;  2V8K A;  2DZC A;  4C5E A;  4M7D C;  3VS5 A;  3M59 A;  4LN2 A;  4M77 B;  1K0X A;  2VC8 A;  1YIT Q;  2LRQ A;  4OMQ A;  4HCC A;  4J9C A;  5EG2 A;  4M7D G;  1IGU A;  1K8A U;  3EG1 A;  3CCR A;  1N27 A;  2DXU A;  2RQW A;  4J6Y A;  2QGF B;  2AZV A;  3WVD B;  2KAF A;  4PJO C;  5DLQ E;  4ME7 A;  4ANJ A;  3CCU T;  3D7S B;  3EH2 A;  4FW1 A;  2JZ2 A;  2MIO A;  4OP0 A;  4AT1 B;  2XG8 D;  5FU7 B;  1D09 B;  4RG2 A;  1UGV A;  2NUZ A;  4DBF A;  4ZN1 A;  3QO3 A;  1K0S A;  2CP3 A;  2GQV A;  3CD6 A;  4FYV B;  4RCB A;  3QJ6 A;  5GJW B;  4LDW A;  5GAN 2;  4MML A;  2CGH A;  1WXB A;  2BKD N;  2YDL A;  1FX7 A;  2L3P A;  5FU7 C;  1PD1 A;  2MOX A;  1YJW T;  1M9S A;  1ZHI A;  3CPW A;  2JTE A;  3MPU B;  4FT4 A;  3JCM e;  3CCL A;  2FHD A;  2ZPG B;  2P84 A;  4IIM A;  2CT3 A;  2V8I A;  1PHT A;  4JRI A;  1K9M R;  4A53 A;  2QA4 T;  1NJI U;  2KYM A;  2NLU A;  4C8Q A;  1VQ4 Q;  3MP6 A;  4ZN3 A;  2R5M A;  4QW2 A;  4IUV A;  4AFZ C;  5KE2 A;  5J3B A;  4RG8 A;  2C0I A;  5LL6 S;  1W4S A;  1OOT A;  4PJL A;  5I21 A;  3OSV A;  4DEX A;  3LH5 A;  2RJE A;  3ME9 A;  2QDL A;  4OB0 B;  2CP5 A;  1PD0 A;  3DLM A;  4Z02 A;  3V8K A;  3M4G A;  1AWW A;  4Z8A A;  5KYU B;  3JRZ A;  3L42 A;  5HKC A;  4FM4 B;  2HBP A;  1UUE A;  5LJ5 g;  2DMO A;  1Y07 A;  1VQO Q;  2COZ A;  4E47 A;  5LJ3 e;  1KQS P;  2K3Y A;  3I5R A;  4EMG A;  5GAM d;  2XID A;  1MND A;  2DVJ A;  3CPW S;  3PE0 A;  5GAO m;  3NTK A;  2DTH A;  2BZY A;  3RMS A;  2ROT A;  1I0C A;  3MEA A;  1GCQ A;  3QXE B;  2HQE A;  1OEB A;  2LZ6 B;  3UAT A;  2DL3 A;  2M1H A;  4PJO F;  1YJ9 T;  4BDZ A;  4J9H A;  3LGF A;  2DL7 A;  2W10 A;  2OAW A;  1VQ5 A;  4PK4 A;  1Q7Y R;  3I55 A;  3MCA B;  1Y96 B;  4C92 D;  1FMV A;  4XU2 A;  3I55 T;  1M8M A;  1N8R U;  1ABO A;  1VQN Q;  1Y96 A;  2RPN A;  3QII A;  6AT1 B;  3CCJ A;  4RTU A;  1W70 A;  4OVA A;  4MMK A;  3TEE A;  3G7Z A;  1K76 A;  1VQM T;  2DER A;  1KQS S;  4ZTJ A;  1VQM A;  2DYB A;  2K5L A;  2DO3 A;  2O01 E;  3V7C A;  4JJN K;  1QCF A;  3JB9 I;  2AT1 B;  1VQN T;  1QVG P;  1ZUY A;  1F1B B;  4J9I A;  1KC8 C;  3CC7 Q;  3QZ9 B;  3JSC A;  1V76 A;  1KJW A;  5I22 A;  2ZPI B;  1YJ9 Q;  3GP8 A;  1LNX A;  3G4S Q;  3FJ5 A;  1G3S A;  1XNI A;  1HYO A;  3MEU A;  2CSQ A;  1GBR A;  4LDU A;  1XJW B;  2E6Z A;  4M7A F;  4PLL A;  5GMK m;  2QQS A;  4HCZ A;  1M2V B;  2EKH A;  4OB1 B;  1KG1 A;  1MMA A;  2JUF A;  1VQM Q;  1P92 A;  3LH0 A;  4B9X A;  4OML A;  5C6S A;  2WSC E;  3URG A;  5GAN 5;  1UEC A;  1K73 U;  3EG3 A;  3JCM P;  4LUE A;  2VGM A;  2LNH B;  5C0M A;  4PJN A;  1LPL A;  2XDP A;  3EFS A;  4OB2 B;  3O8V A;  1QVG A;  1I81 A;  2KRN A;  1G5V A;  3OBY A;  4DOW A;  4RTT A;  2KRO A;  3L2V A;  5L23 A;  1RI0 A;  3VS6 A;  2K57 A;  2M0Y A;  1MNE A;  3VUB A;  2LT4 A;  3A8G B;  5HK3 A;  3LWI A;  2YWW A;  1BU1 A;  4ORZ A;  2DAQ A;  4QQG A;  3M5A A;  4M78 B;  4BI4 A;  3JB9 J;  1K8A R;  1MMD A;  1Q86 U;  2AK5 A;  3C12 A;  2DTI A;  2ZZD A;  1W2B A;  3QJY A;  5GAM f;  4M78 C;  3G71 Q;  5FRM A;  1AOJ A;  1WFW A;  3G4S A;  3AT1 B;  3RES A;  1VQO T;  4M7A G;  3CCE A;  1HXD A;  1VQ8 A;  3G71 T;  2E5Q A;  5KCO A;  3DKM A;  3GIB A;  3S3N A;  3G71 A;  3EFO B;  1VQ9 Q;  3L2W A;  2CP2 A;  2FPF A;  1GFC A;  4XQ3 A;  1G8X A;  3OMC A;  3CC4 Q;  1N9S A;  2RN8 A;  2RQU A;  1YI2 Q;  2EGC A;  3V8J A;  4A63 B;  2M9U A;  2ZPF B;  3CMA Q;  2QA4 Q;  5LJ3 f;  1QKX A;  2YLB A;  4RMO A;  3OS2 A;  3LLR A;  3CC2 T;  3M57 A;  4II1 A;  2O88 A;  2EQM A;  5DM7 R;  4FT2 A;  4M7A C;  1M8V A;  1JRI A;  3EAE A;  4F14 A;  5GMK h;  1KHC A;  4J7F A;  1SHG A;  3OYI A;  2EYW A;  1SG5 A;  2OTJ A;  4RTY A;  1TOV A;  1YJW Q;  1YI2 A;  1CKA A;  1ZUU A;  3KUF A;  1ZA1 B;  2MF2 A;  2MWO A;  4X34 A;  2H3E B;  1OV3 A;  1ZBJ A;  1T0J A;  2PU9 B;  4A4K A;  1AWX A;  1HD3 A;  4WCI A;  3L2U A;  4PKC C;  2LT1 A;  2M0O A;  2BE9 B;  1NYG A;  1ARK A;  5GAN d;  3M0R A;  4XTW A;  2DIQ A;  5IXF A;  3CMA A;  3QPH A;  2PVD B;  3UDC A;  2OAU A;  2KR3 A;  1WDX A;  1C1A A;  1VYT A;  2JMA A;  3LW5 E;  1NPR A;  2QTX A;  2F1L A;  3CC4 A;  1D0X A;  4ESR A;  2L3Q A;  4M78 F;  1M5Q 1;  1NE8 A;  1GCQ C;  3DB3 A;  4XTY A;  1S72 A;  4QQ6 A;  1S72 T;  1D1A A;  1VQL A;  2E3I A;  1WHJ A;  2AZS A;  2ENM A;  2KK4 A;  4OF1 A;  1QP3 A;  2DKG A;  2RHY A;  4DBQ A;  2DD4 A;  4OMN A;  4C0F A;  1YNZ A;  2CS7 A;  2P0Q A;  5CKE A;  1LOJ A;  1G83 A;  3CXC P;  3G6E T;  4RTX A;  3JCM V;  1BCM A;  5CKB A;  2F2V A;  1O9S A;  1XOV A;  3SWN C;  5GAN 3;  5CKF A;  2WAC A;  3T9N A;  1QKW A;  3TSW A;  5KYY A;  3I35 A;  3BY7 A;  3E19 A;  3CBM A;  3DLL A;  2XIC A;  4JJB A;  1UG1 A;  1BB9 A;  2DFU A;  3E1S A;  4BE2 A;  2VV5 A;  5GAO q;  3A1P A;  4KGX B;  2DET A;  5IT9 E;  3JB9 F;  4JLI A;  2MWP A;  2NWM A;  1UB4 A;  7AT1 B;  1GBQ A;  3CC2 Q;  2DK3 A;  2KNB B;  2GNC A;  3JCM c;  2K4Y A;  1OPL A;  3CC7 A;  1AZG B;  2I0N A;  1E6G A;  2SRC A;  2PZ1 A;  3CXC A;  1VIF A;  1W2B S;  4PNO A;  2SEM A;  4FYX B;  3ZFJ A;  1OU8 A;  4BUG A;  2QAZ A;  1YIT A;  4JJD A;  3N5B B;  3ZEH A;  5KE3 A;  5GAM e;  2EQU A;  1BKB A;  3OYM A;  2VGN A;  1AWO A;  2RK2 A;  2EIF A;  4M7A A;  2RI5 A;  5FU6 B;  4LDX A;  3VS3 A;  3I56 A;  4GBQ A;  1Q7Y U;  2PQW A;  5GMK i;  5A0G A;  1YJ9 A;  4C92 G;  2RQR A;  4L59 A;  1M1K U;  3M58 A;  2ZPH B;  3CCJ Q;  3RER A;  1Q82 U;  3RNJ A;  4HT9 A;  1C6V X;  3KBG A;  5IHN A;  5GAN g;  4BE1 A;  2YUN A;  1YIJ Q;  3FB9 A;  4EDU A;  3BE3 A;  3CCJ T;  4LD9 K;  5KCH A;  2EVR A;  3HKS A;  4LXC A;  4NL2 A;  9ATC B;  3A8L B;  1Y7X A;  1QCN A;  1DJ7 B;  2J6F A;  1X6B A;  2E4H A;  3CCM T;  1K1Z A;  2WSE E;  3CC4 T;  4XK8 E;  2DIG A;  3HHT B;  2J05 A;  1VQN A;  3OYN A;  4M78 D;  3TRE A;  1VQL T;  3FEO A;  4PJO D;  2HD0 A;  1WHH A;  4R56 A;  3OYH A;  1SSF A;  2DTO A;  1KC8 R;  5J26 A;  1W6X A;  3A8H B;  4ZGD B;  1WHL A;  1WQ7 A;  2HQX A;  2QI2 A;  1I1J A;  1BI3 A;  2JW4 A;  4CRI A;  3CME Q;  1QW1 A;  1OZ3 A;  2FZC B;  3G1J A;  1UFF A;  4C92 E;  4PJM A;  4NS5 A;  1QLY A;  1M1F A;  2BTT A;  4A4H A;  1RAA B;  1N6A A;  1SHF A;  4GLK A;  4M7D F;  1SRM A;  2ZCF B;  4M77 C;  1SRL A;  4EPC A;  1ZSZ A;  4QQD A;  3M0P A;  1JJ2 P;  3CCU Q;  4M7D E;  3CCR Q;  2LVM A;  4VUB A;  1X01 A;  5DLO A;  1Z9Z A;  3JB9 G;  3CCL Q;  1IHW A;  4K11 A;  4LUD A;  2DE0 X;  3L1A A;  4LE9 A;  2CZ7 B;  2ECZ A;  2F5T X;  1HK9 A;  2IIM A;  2V26 A;  2ZPE B;  4LNP A;  2MAM A;  2R5A A;  2FYK A;  2EAY A;  4M77 E;  1H3Z A;  4V2S A;  5KYX A;  3EGX B;  3SWN A;  1TUD A;  2ZGW A;  5LJ3 d;  3TU4 K;  3NGP A;  3I55 Q;  2FL7 A;  1NBE B;  3VYH B;  5KYU A;  2CT4 A;  2CP0 A;  3L2R A;  1D3B B;  4PFZ A;  2NUT B;  3CBO A;  5FLX E;  5CVI A;  3VYG A;  1D3B A;  4C0G A;  4IKF A;  2KRM A;  1Y57 A;  1AWJ A;  1H3H A;  2MI6 A;  1YHQ Q;  4M78 G;  5D6X A;  1XTD A;  4PJO B;  2XKO C;  2E41 A;  4A4E A;  2BZX A;  1U5S A;  2LJ0 A;  3FIF A;  3SFM A;  2QXF A;  2MK5 A;  1YHQ A;  2HNI A;  1M90 C;  4O6J A;  2CYZ B;  1UJY A;  1TTH B;  3ER0 A;  1QVF P;  3VV0 A;  1QP2 A;  1IGQ A;  1SPK A;  4JDS A;  2COW A;  2RO0 A;  4KRT A;  1TWB A;  2D1X A;  1IZ6 A;  2ROL A;  2ATC B;  1I4K 1;  4Q5W A;  4KT0 E;  4M75 A;  5LJ5 e;  3M55 A;  5KYW B;  3M0S A;  2K3B A;  3H41 A;  5GAN 8;  4N0A C;  2OTJ T;  2AHJ B;  5GAN 6;  1YI2 T;  1AZE A;  3P8H A;  3OYL A;  1ZLM A;  1M1K R;  3CXC S;  2L5Q A;  1JJ2 S;  2HBW A;  4ELZ C;  2DBK A;  2MCN A;  1EZZ B;  1PKT A;  4N4G A;  2KYB A;  3L2Z A;  4LDV A;  3H0H A;  1R0B G;  2X4X A;  3INZ A;  1PSF A;  4OMF B;  4OGC A;  2OTL A;  2ABL A;  5GAN h;  3CCQ Q;  4J6W A;  4L5G A;  2OTL T;  1C0M A;  2QGG A;  3LWH A;  3VS2 A;  2K9G A;  1FXX A;  1K9A A;  3VRY A;  3OW2 P;  2XD0 A;  4F7U F;  2RHX A;  4KGZ B;  1FMK A;  2CRE A;  4AMC A;  3V8L A;  5I2M A;  1D0Y A;  4YTL A;  3SD4 A;  4F7U E;  4C8Q G;  1NLO C;  2DBM A;  3OYC A;  4B6M A;  4MZT A;  2L89 A;  2DLP A;  1B34 A;  4M4Z A;  5CQX A;  1BBZ A;  2DM1 A;  2D8J A;  2LQW A;  1N9R A;  2JM8 A;  2VVK A;  4IUP A;  2EW3 A;  3HFN A;  4F7U G;  2EJ9 A;  1ZA2 B;  3G6E A;  4DA4 A;  3X25 B;  3CCV Q;  2D0Q B;  1RLP C;  1SKU B;  5FRN A;  1ZUK A;  3C0C A;  2DXT A;  2O31 A;  2JS0 A;  3P8D A;  4AG1 C;  2MYS A;  5GAM g;  3BFM A;  2IPO B;  3EHR A;  2M02 A;  5DY9 A;  1YCY A;  3UA6 A;  1K9M U;  2X35 A;  2VWF A;  2GCX A;  4XTX A;  2KXC A;  4C0Z A;  2L0A A;  3PIP A;  1BYM A;  3OYE A;  1Q81 U;  4C5H A;  1MHN A;  2FO0 A;  2H8H A;  3REB B;  3J81 E;  2FPE A;  4J6X A;  3KXT A;  1G2B A;  3HRS A;  2DA9 A;  2K5F A;  2RHI A;  2FEI A;  4M7A B;  2P0P A;  4IUU A;  2J6O A;  2Y4Y A;  3QDF A;  4E7I A;  1VQ6 T;  2RA2 A;  2P4R A;  4JRK A;  4PJO G;  3JB9 H;  3HL8 A;  1SF9 A;  2E10 A;  4L6V 5;  2VXE A;  1W1F A;  2X3X D;  2H3J A;  1YJN A;  1EFN A;  1MMN A;  2BZ8 A;  4ZNX A;  2RJC A;  1YJN T;  1JEG A;  3FC3 A;  3ULR B;  3VRZ A;  3QHS A;  4EIK A;  1JQQ A;  1WZO A;  4X1V A;  1KK7 A;  4FL6 A;  2YRV A;  2E1H A;  2X4Y A;  5I2S A;  5L8R E;  3EGX A;  1WXU A;  1V1C A;  1KSW A;  2CZ0 B;  3OY9 A;  2R58 A;  2M51 A;  2AKL A;  4Y92 A;  4CC7 A;  4KBM B;  4WTO B;  1T3S A;  3DB4 A;  2KQW A;  1VQ9 T;  4HCK A;  2NUP A;  5GMK j;  1NPP A;  1WA7 A;  1OPK A;  4X9C A;  1X75 C;  3HFO A;  1AT1 B;  3MP1 A;  1B07 A;  1I5L A;  5AT1 B;  1Q86 R;  1VQ7 A;  2DPP B;  2YSQ A;  3X24 B;  5KYW A;  1EX4 A;  4JZ3 A;  4J9F A;  3JCM J;  1M90 U;  4M7D A;  2E12 A;  4HVV A;  4M75 C;  3M56 A;  4ATO A;  3I56 Q;  1NM7 A;  1RAC B;  5LJ5 j;  3EGD A;  1Q81 R;  1U06 A;  2F2W A;  3H9N A;  3M53 A;  1OUL A;  4AG2 C;  2EWN A;  2E65 A;  2RH2 A;  1OI1 A;  1T0H A;  4M78 E;  5FW9 A;  4NL3 A;  1BI1 A;  2EQJ A;  1GL5 A;  2EFI A;  4M75 G;  1WJS A;  4BB7 A;  5GAO p;  3GNF B;  2M16 A;  3GLX A;  2DXB A;  1BCO A;  3GNG A;  1RAI B;  4J9B A;  2JVV A;  3GPL A;  1X6O A;  1WGS A;  3CD6 T;  1WYX A;  1JXO A;  2QG9 B;  4FIB A;  4M75 D;  2G6F X;  3CQT A;  5LJ3 g;  5GMK e;  3CME A;  2YXY A;  1D1C A;  5M9O A;  3EFR A;  1VQ6 Q;  1I5O B;  1KD1 U;  2XI9 A;  1B34 B;  3EGU A;  4BAC A;  5A2Q E;  4Z89 A;  1QWF A;  2DL5 A;  2HQH A;  5GAM h;  3CCL T;  1M27 C;  1YJW A;  1PM3 A;  2OTJ Q;  2EQI A;  1BIB A;  4QVD A;  2JNG A;  3JAM E;  1YN8 A;  5IHI A;  1YP5 A;  3MEW A;  3VKI A;  1NYF A;  1PNJ A;  2A08 A;  1UEB A;  3P8B B;  1X6G A;  3KFV A;  2DL8 A;  1UDL A;  3Q1J A;  2QQA A;  3CCV T;  2LQN A;  1RAF B;  1M90 R;  3F70 A;  1QMC A;  1VQ9 A;  4HCB A;  2B86 A;  4M75 F;  3J7A F;  2V8J A;  1RAB B;  3NMZ C;  4MDX A;  2QQ9 A;  2DRM A;  1M4Z A;  4EMK A;  3X26 B;  3M4Y A;  4PJJ A;  5J39 A;  4J5Y A;  3A98 A;  3HTR A;  1MGQ A;  4RTZ A;  1OU9 A;  4N4I A;  1AD5 A;  1M1K C;  1UJ0 A;  2AKK A;  3MET A;  4DOV A;  1MV3 A;  2JT4 A;  4A4F A;  1QCO A;  1ABQ A;  4N4H A;  3CCQ A;  5GAO l;  5A0L A;  3WVE B;  1YBY A;  3UF4 A;  3JCM b;  1RAH B;  3FJP A;  4F7U B;  5AYF A;  2NYS A;  1UE9 A;  3OW2 A;  1VQ5 T;  2HAX A;  2Y4X A;  5FWB A;  2DIL A;  3JCM Q;  2P0K A;  5EC7 A;  1M2O A;  2DJQ A;  3CCR T;  5A0D A;  1B7T A;  2DEQ A;  2ZAE A;  1LVK A;  3GF5 A;  2ESW A;  2OI3 A;  1IXD A;  2BE7 D;  2VKN A;  4C8Q B;  3RKY A;  1UTI A;  5HCK A;  3R6O A;  4KUL A;  3CCM A;  4OGE A;  3EGD B;  4PJO A;  3JCM h;  1VQP T;  2V1R A;  4C92 F;  1FYN A;  2D6F A;  2RJF A;  3QZ5 B;  3VJP A;  1X2Q A;  2RHU A;  4FSS A;  3PFS A;  1NLP C;  5IH2 A;  2F2X A;  5IXB A;  2CUB A;  3GOX A;  1WQW A;  4JS4 A;  2QQR A;  3I5S A;  4O5V A;  3OQ5 A;  1ZSZ C;  2DD5 A;  1VQL Q;  3UT1 A;  5GAN 4;  1KD1 R;  2RHZ A;  4C8Q D;  3H6Z A;  2GGR A;  1U3O A;  1QVF A;  1K73 C;  2L3R A;  1TXQ A;  2VAS A;  4HVW A;  4DQ2 A;  3CCM Q;  3RMQ A;  4X9D A;  1AEY A;  2XDD A;  5KYY B;  1PRM C;  2E5K A;  1EIF A;  1BI2 A;  1GRI A;  4MZP A;  5CCA A;  1TS9 A;  4PJO E;  4FW2 A;  4M77 F;  1SSH A;  3VUZ A;  4XTU A;  2Z0W A;  4M77 A;  4UC4 A;  1YIJ T;  1TUC A;  3X28 B;  1UHC A;  1OX9 A;  2YLC A;  1UGR B;  4OMM A;  3RBB B;  1WJQ A;  1TUG B;  3HRT A;  3LX7 A;  3CPW P;  1JJ2 A;  4JLG A;  3UPU A;  1S1N A;  1KIK A;  2JMC A;  1FMW A;  4J7I A;  1K4U S;  2HCK A;  4GLM A;  3QDR B;  1UGS B;  3PIO A;  1TSF A;  1WHK A;  2VUB A;  2YRD A;  2X4J A;  3REA B;  2QK0 A;  1ACM B;  4LD6 A;  3CCS T;  2GBQ A;  2VXF A;  3NTH A;  2FB7 A;  3VS7 A;  1JBM A;  2QA4 A;  2JN0 A;  4FYW B;  5CAI A;  3CCE T;  2X51 A;  4BDY A;  2CP6 A;  1ZSG A;  1FWZ A;  5CR2 A;  1VQ8 T;  4C8Q F;  4ZTF A;  3OW2 S;  3RUX A;  2KRS A;  2GFU A;  2LX7 A;  2KT8 A;  2DF6 A;  3S3M A;  4PFO A;  1M2V A;  3M54 A;  3PMI A;  1N5Z A;  2L2P A;  2D9T A;  2MPX C;  3V7S A;  5GAN j;  3SEM A;  4Y28 E;  2RQT A;  5HY6 A;  4HKE A;  3CCE Q;  1MMG A;  3CC2 A;  5KYX B;  3HRU A;  1B3Q A;  2QEX A;  2D8H A;  2A36 A;  2EYX A;  1Q86 C;  2LP5 A;  3OYF A;  4C0D C;  2LDM A;  3IQL A;  1Q82 R;  2PVG B;  4R0K A;  1MUZ A;  1HSQ A;  4ELY C;  2KI7 A;  5FRO A;  5HK0 A;  3QYH B;  4KUI A;  1PKS A;  2O9V A;  3I56 T;  3OMG A;  2HL3 A;  2KXD A;  3OB9 A;  3OYD A;  4E7L A;  1R8O B;  2W0Z A;  2K2M A;  2CKK A;  1Q81 C;  2XHC A;  5GMK l;  1BK2 A;  2QEX Q;  1BIA A;  2CDT A;  5CK9 A;  2A28 A;  2PTK A;  3S6W A;  4E7J A;  1RUW A;  1E7O A;  1YCS B;  2ED0 A;  1M3A A;  3ZBD A;  3CMA T;  1PCX A;  5LJ3 h;  1NEB A;  4BE0 A;  2I2L A;  2FG0 A;  3JCM f;  2K7A A;  1VQP Q;  1VYV A;  3RDV A;  2YUQ A;  1A0N B;  4OMP A;  2JTF A;  4FYY B;  2KE9 A;  3R6N A;  3EG9 B;  1VQP A;  2O9S A;  5LJ3 j;  3SHW A;  1KQ2 A;  3QYG B;  3OYJ A;  1WPY A;  2GF7 A;  4M78 A;  2LQ8 A;  1X2K A;  1R77 A;  1ZQ1 A;  2G3R A;  3U23 A;  4FCY A;  1T3L A;  4C5I A;  2DJZ A;  3PGG A;  2KDS A;  3OYB A;  2A7Y A;  2LJ1 A;  3M0U A;  1LCK A;  1VUB A;  4BD3 A;  1M30 A;  3C94 A;  1NJI R;  4OMO A;  1VIE A;  2GFA A;  2O4X B;  2XMF A;  1JU5 C;  3OYK A;  3CPF A;  1G3W A;  4C92 B;  2ZPB B;  4MZM A;  5D6W A;  2NUT A;  3C95 A;  2QYZ A;  2LMJ A;  4XU1 A;  5CQY A;  2RM4 A;  1TH7 A;  1WLP B;  3S3O A;  2YUO A;  3JV3 A;  2PUO B;  5GAN e;  1OQK A;  4AFU C;  2JJ9 A;  1OX8 A;  4FU6 A;  2EGA A;  1CKB A;  4EMK B;  4D6W A;  2LNV A;  4E7S A;  4XTZ A;  2K3X A;  2HL5 C;  3MJX A;  1PC0 A;  1X43 A;  1YWO A;  5KYN A;  2K79 A;  2JS2 A;  2GQI A;  1VQ5 Q;  2QDY B;  3CC7 T;  1GXI E;  1Z9Q A;  3PVQ A;  2HSP A;  1N8R C;  4J9E A;  2XDB A;  2O4X A;  2X9H A;  4XTV A;  2XU8 A;  4QVC A;  2QEX T;  4F04 B;  2L3S A;  4IUQ A;  2LTO A;  3BW1 A;  1S72 Q;  1YIT T;  3JCM W;  1OZ2 A;  2K6D A;  4PLI A;  2HSE B;  2IVW A;  3H0I A;  2DL4 A;  3VS4 A;  4DEY A;  1U8R A;  2RD1 A;  1VQ8 Q;  2L8D A;  2PNI A;  3G4S T;  1VQ4 A;  4E7K A;  2HMA A;  1VQO A;  1LJO A;  3WXM B;  2E70 A;  4C5G A;  3OA6 A;  1KQ1 A;  2EPD A;  4JRP A;  1KHI A;  2YRC A;  1IHV A;  1RAG B;  4F16 A;  1IRE B;  2BIV A;  4E2F B;  2R57 A;  3RIR A;  2OX7 A;  4MDW A;  1WXT A;  2JXB A;  4M77 D;  4OB3 B;  3SDZ A;  2CH4 A;  1NZ9 A;  2EGE A;  2MMP A;  3X20 B;  4AFQ C;  4QT7 A;  2EYY A;  1V29 B;  3HPW A;  1QVF S;  1GCP A;  4JZ4 A;  3JCM d;  3OS1 A;  4KUD K;  1WJR A;  3JCM X;  1VQ7 T;  5LJ5 h;  3HSB A;  2B8A A;  1XQH A;  1PSE A;  1G3Y A;  3AHU A;  3M0Q A;  5CO7 A;  1QVP A;  2KT1 A;  4HXJ A;  1ZX6 A;  4CC2 A;  3TSZ A;  1KD1 C;  4RCC A;  2EYQ A;  2JOY A;  1VOM A;  5ECA A;  1K73 R;  1IB8 A;  3A8M B;  4BI3 A;  4NOY A;  3O5Z A;  3MO8 A;  4BY6 C;  4LDY A;  3OYA A;  3ZL7 C;  2CUD A;  1RAD B;  4CC4 B;  3NTI A;  4F7U A;  3NPF A;  2JTM A;  3JCM g;  2LCC A;  3PT9 A;  5IN1 A;  4JUV A;  3QKJ A;  3A8O B;  1O75 A;  1M3B A;  2PUK B;  3J80 E;  2EQK A;  2CSI A;  1TG0 A;  2P4T A;  2FZK B;  3I9Q A;  4RKU E;  5GAO n;  5GAM j;  2C06 A;  2KSS A;  3L2Q A;  1Y0M A;  3QWY A;  1WI7 A;  4M7D D;  1D0Z A;  4RTW A;  5I11 A;  5GJV B;  1G3T A;  2K5I A;  3QG1 A;  4JPB W;  3CBP A;  3VS0 A;  3SWN B;  4FSX A;  2GTO A;  1PWT A;  4CC3 A;  2J6K A;  3LGL A;  4P5N A;  1KC8 U;  1OYX A;  2KMT A;  2LX9 A;  4C92 A;  2VYT A;  2COY A;  1K9M C;  2CZ1 B;  3EG0 A;  2EJF A;  2RK1 A;  1BI0 A;  2EBP A;  3A5Z B;  3FRN A;  2V1Q A;  3QBY A;  2YHT A;  5GAO r;  2NUP B;  1RI9 A;  1H8K A;  4M75 E;  1YWP A;  3GBQ A;  2PVO B;  2DZ9 A;  2HEQ A;  5D7U A;  2KVQ G;  4XU3 A;  4JRQ A;  1GFD A;  1I8F A;  4J83 A;  4PFP A;  3M9Q A;  1YHQ T;  2RF0 A;  2A0F B;  5LJ5 f;  3PMT A;  3NFC A;  3FLG A;  4HVU A;  1M3C A;  2FRY A;  1WHG A;  4R55 A;  3OSS C;  4A54 A;  5D6Y A;  3BDL A;  1MV0 B;  2X3W D;  1UGQ B;  1AVZ C;  2DYI A;  4CI0 C;  4F17 A;  2CZ6 B;  1W2B P;  2F5K A;  1RAE B;  2E64 A;  3EFO A;  1KFZ A;  1VQK T;  4KGV B;  4M75 B;  5LJ5 d;  1Q82 C;  4XU0 A;  3THK A;  4J8O A;  5FU6 C;  2C0T A;  3OBW A;  2DRK A;  1JO8 A;  4EMK C;  3UA7 A;  3TQ7 P;  1J3T A;  2YT6 A;  2DXC A;  2HKQ B;  3CCQ T;  4D8D A;  4XAX B;  3OS0 A;  1Q7Y C;  2KY9 A;  4TVR A;  2CH4 W;  4RTV A;  3EG2 A;  2ED1 A;  4E7H A;  2HKN A;  4M7D B;  4A4G A;  4PL6 A;  4IUR A;  4RUG A;  3CCS Q;  2IG0 A;  3V7R A;  2HZY A;  1PRL C;  3EHQ A;  2EYZ A;  3CCU A;  3JB9 D;  1JB0 E;  4D8K A;  2QAS A;  3MHX A;  3MKD A;  3CD6 Q;  4KH0 B;  3EH1 A;  5FWC A;  5KH6 A;  3H8Z A;  4QKU A;  2LJ3 A;  2YUP A;  3CME T;  1X27 A;  1PG5 B;  4C92 C;  3OYY A;  5GAN f;  4JS5 A;  1HJD A;  2QQB A;  1UGP B;  2A37 A;  3UWN A;  2AIR B;  4IUT A;  1KQS A;  3SB2 A;  1NJI C;  3LYI A;  4B9W A;  3H0F A;  2LQK A;  2X4W A;  1IRX A;  1TU0 B;  3TCJ A;  5CIU A;  3VU3 C;  2EJG A;  2E3H A;  2XK0 A;  2C0O A;  2CP7 A;  1AHJ B;  1YFN A;  1WHM A;  4JJC A;  2KGT A;  1WNL A;  1X69 A;  4BI8 B;  3E9F A;  4AFS C;  4DBH A;  1H92 A;  2RNA A;  2LCL A;  3OYG A;  1NEG A;  1QWE A;  2OTL Q;  1SEM A;  3CCV A;  2WSF E;  1VQ7 Q;  2RI2 A;  1YIJ A;  1Q95 G;  4C0D B;  5CKH A;  4J9D A;  3NHN A;  3QWX X;  2HDA A;  1VQ6 A;  4N0A A;  4HA8 A;  3MEV A;  2EKO A;  3E9G A;  1N8R R;  2DEU A;  2KEA A;  4Z88 A;  3PTA A;  1QQJ A;  1R0C B;  3ASK A;  1UHF A;  1M1G A;  2Y90 A;  3C4S A;  3M0T A;  5IHK A;  3TVT A;  2DX1 A;  4EMH A;  3VS1 A;  4WF2 A;  1K8A C;  2GTJ A;  1ZSZ B;  2J06 A;  3QUI A;  2FPD A;  4C8Q E;  2KBT A;  2RJD A;  1JXM A;  2RQV A;  4HT8 A;  3G6E Q;  2LCS A;  4M7A E;  1VQ4 T;  1QVG S;  3CCS A;  4DBR A;  3HP9 A; 
#chains in the Genus database with same CATH homology
 3CC4 Q;  1VQ4 Q;  1VQ6 Q;  3CCM Q;  1YIJ Q;  1Q82 R;  1W2B P;  1VQK Q;  1YHQ Q;  3CPW P;  3CCL Q;  3CC7 Q;  3I56 Q;  2QEX Q;  1VQM Q;  3CCV Q;  3I55 Q;  1YJW Q;  3CD6 Q;  3CC2 Q;  1K73 R;  1VQO Q;  1Q81 R;  1YJ9 Q;  1VQ5 Q;  1YI2 Q;  2OTL Q;  1VQ8 Q;  1KQS P;  1VQ7 Q;  2OTJ Q;  1Q86 R;  3G4S Q;  1KC8 R;  3CMA Q;  2QA4 Q;  3CCQ Q;  1YJN Q;  3CCE Q;  1Q7Y R;  1QVF P;  1YIT Q;  3CCS Q;  3G6E Q;  1VQ9 Q;  3CCJ Q;  1VQL Q;  1JJ2 P;  3CCU Q;  1K8A R;  1VQP Q;  1KD1 R;  1M1K R;  1VQN Q;  1QVG P;  1S72 Q;  3CME Q;  1NJI R;  3CXC P;  1M90 R;  3OW2 P;  1N8R R;  1K9M R;  3CCR Q;  3G71 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...