3CCQQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccqQ00
3I55Q 1KD1R 3G71Q 3G4SQ 3CD6Q 1NJIR 3CCJQ 1QVGP 3CC4Q 3CCLQ 1YI2Q 1JJ2P 1K73R 1VQ8Q 1K8AR 1KC8R 1VQLQ 1YJWQ 3CXCP 3CCEQ 1YJNQ 1VQ9Q 1VQKQ 1YJ9Q 1M1KR 3CCRQ 1VQNQ 1VQPQ 1Q82R 2OTLQ 3G6EQ 3CCUQ 3CMAQ 3CC2Q 3CC7Q 3CCQQ 1YIJQ 1VQ6Q 1Q7YR 2OTJQ 1W2BP 1VQOQ 1VQ7Q 3CPWP 1K9MR 2QEXQ 1S72Q 3CMEQ 1KQSP 1VQ4Q 1M90R 1VQMQ 3CCMQ 1YHQQ 3I56Q 2QA4Q 1Q86R 3CCSQ 1N8RR 1QVFP 3OW2P 1VQ5Q 1Q81R 1YITQ 3CCVQ
chains in the Genus database with same CATH superfamily
2F1LA 2H3EB 1NYFA 2DVJA 4OP0A 1LNXA 1K9AA 1UHFA 4C8QA 4R56A 2YWWA 3V8KA 3CCUQ 1XTDA 3FLGA 2CP3A 2QEXQ 3JB9I 4PJMA 1UUEA 1X2KA 3VS1A 4BDYA 1VQ5Q 2ED1A 1ZSGA 1PRLC 4BACA 5GANf 3CCJA 1PC0A 1EZZB 2KVQG 1SSHA 3QJYA 2XIDA 1AVZC 2D0NA 4M75B 2XI9A 4AFUC 3RNJA 1BCOA 2LX7A 3FJ5A 4C5EA 3GBQA 3DB4A 1G3TA 4ZGJB 1C0MA 1VYVA 2QTXA 3LH0A 1Z9QA 2W0ZA 4NL2A 3J81E 1VQMA 1OYXA 1QP3A 2KMTA 3IQLA 1MUZA 2V8KA 5LJ5f 1OQKA 4CRIA 2LJ3A 2QAZA 4F17A 1YITA 4J9FA 2E5KA 3JCMX 2F5TX 4FL6A 2D6FA 2DTHA 2KT8A 4BE2A 3PE0A 3EH2A 1VQ9T 2RI2A 3EGXB 3VS2A 3LW5E 4M7AE 3TSWA 1R0CB 4A54A 4M77E 1G8XA 5FROA 2E1HA 5GANh 3CD6Q 2NUPB 5CKHA 4M7DG 3OYAA 1N6AA 2DIQA 4FW2A 1YFNA 2P4TA 1FWZA 2RO0A 1G83A 3SWNC 3KUFA 2X35A 4BE1A 1H92A 3VS3A 2BTTA 3LGFA 4J6YA 2CH4A 4JLIA 3OA6A 1RLQC 2DAQA 1BYMA 3PIOA 4MZTA 1SSFA 4PFPA 1UGRB 5LJ5h 1M90U 2K5FA 4RMOA 4A4KA 2LZ6B 2RK2A 3HP9A 2ZPBB 4DBRA 1N27A 3SB2A 3PT9A 2P84A 3L2RA 2YUPA 2CZ0B 1VQ8T 1YJWT 4OGCA 3CC2Q 4F14A 4AFQC 3UF4A 2VV5A 1OU8A 2DL3A 2K5LA 3NMZC 4J9DA 1SHGA 2Y4YA 2RHUA 1GCQC 2FB7A 1KQ1A 3NTIA 2CZ1B 1I4K1 4LD6A 4A63B 3GF5A 3OYCA 1M90C 1YJNQ 5L23A 1YJ9Q 2L3PA 2P4RA 2EBPA 3GNFB 4O5VA 4RTVA 1JJ2S 1KQ2A 2K2MA 2CKKA 1NLOC 2X9HA 2RNAA 4PJOD 4J6WA 1VQKA 3EGDB 4DEXA 1M30A 1Z9ZA 1Y96B 2DRMA 4M7AC 2XDPA 4M77C 5CIUA 2RM4A 3OYNA 1VQ4A 3I5SA 1QWEA 2XICA 3CCVQ 3A8GB 2FO0A 3BW1A 4L59A 2BZ8A 2EPDA 4LE9A 1TS9A 1AWOA 1T0JA 4C92F 2EJFA 3MO8A 4HKEA 3PTAA 3AT1B 2PVOB 4BUGA 4CI0C 2EQKA 5DY9A 4E7JA 1QVFS 2CYZB 1IHVA 4GBQA 1BCMA 2CT4A 2HCKA 4J83A 1VQ4T 4KGXB 2LX9A 1RACB 5FU7C 3G71A 3V8LA 3I55A 1ZA1B 1VUBA 1K73R 2CH4W 1LJOA 2HKNA 3QPHA 1VQPQ 4OMLA 3CBPA 2OTJT 2QQRA 3EFOB 3I56A 3X25B 4Y92A 1V76A 2M1HA 1Q86U 3OYYA 3CCLA 3VYGA 4M78G 3G71T 1LPLA 4M77D 4RCCA 4VUBA 2HEQA 2OI3A 5KCHA 2JVVA 4WF2A 1BKBA 2CUDA 1UDLA 2AK5A 3SWNA 5IHIA 1QVGS 4QQGA 3L1AA 2A0FB 1WHJA 2DL4A 3L2VA 4FYVB 1M3AA 2YLCA 3T9NA 1KD1R 3TVTA 2QDYB 3ER0A 1X69A 1V29B 5LJ3j 3OB9A 4OGEA 1Q86C 1T3LA 4E2FB 4ORZA 4C92B 1JRIA 3HRUA 4JS5A 1OZ2A 1I5OB 1G3WA 4AFSC 1VQOT 5ECAA 1GRIA 4CC2A 5KYWA 3JAME 3JSCA 2YRCA 3OS5A 4WCIA 4BI4A 2RJDA 3G4SA 5A0GA 1KSWA 4LDUA 1RAHB 3REBB 1FX7A 4OMNA 2KK4A 1UJYA 3MHXA 1XOVA 4C0FA 1IHWA 4N4HA 7AT1B 2DTIA 5I2MA 5FWBA 5EG2A 2D9TA 4PKCC 3UPUA 4E47A 1HXDA 1KHIA 2ZPGB 4D8DA 3CCJQ 2EYYA 2O31A 5GAOq 2XG8D 3CCET 1X27A 1R77A 4LDWA 2MF2A 3LWHA 1M1GA 4PFOA 5KYWB 2E65A 2EIFA 2K2VA 1UHCA 2DEUA 2FZGB 4JZ3A 3QUIA 1QW1A 3GPLA 3EAEA 2DIGA 1QP2A 2FRYA 2KQWA 2QA4A 2V1RA 1YITQ 4QVDA 1I1JA 3VS0A 1GXIE 3HSBA 4DOVA 1IGQA 4FSXA 2DYBA 4PNOA 1M27C 1WXUA 1C6VX 2JZ2A 3LH5A 3L2UA 1QQJA 4JZ4A 5KYXA 1JBMA 3HRTA 4CC3A 2RHXA 3URGA 1MMAA 2GGRA 1ABQA 3HFNA 1M90R 2PZ1A 3ASKA 1VA7A 1TUCA 4WTOB 4C5HA 5KCOA 3A8HB 3BE3A 4RTXA 3OSVA 2NUTA 2A36A 2BE9B 5FWCA 3OYJA 2E3HA 5GAMd 4BDZA 4BI8B 3PMIA 5KYUB 2EQJA 2AZVA 2COZA 1YCYA 3EG9A 2WSEE 5FU6C 4M7DF 2BZXA 2J6KA 2ZPFB 1VIEA 2ZPHB 2R5AA 1N9SA 2X3XD 3DLLA 3WVDB 2J7IA 2KY9A 3RBBB 2EW3A 3HKSA 2JTFA 5HK0A 2YHTA 1AZGB 1W6XA 4ZGEB 2L5QA 1YIJT 4EMHA 3CMEA 1VQ6T 3MEVA 1BI3A 2JMAA 1R0BG 1V1CA 4IUPA 3CCMT 2EFIA 2DZ9A 4CC4B 3M0PA 3OYEA 4KT0E 3N5BB 5I11A 2KRSA 4A4GA 2NWMA 1SG5A 3M4GA 2H3JA 3WVEB 3HHTB 4FCYA 2EYQA 1QCFA 4LDXA 3VKIA 1U3OA 3M0SA 2HSEB 2QQ9A 1IO6A 1QVPA 1T3SA 3CMET 2QK0A 3OW2P 3G1JA 4HCKA 4JLGA 1RL2A 5J3BA 1I07A 2RA2A 2O4XB 3MEWA 1H3HA 1WXBA 4RUGA 1VQKQ 2KAFA 2EJ9A 2O01E 2OTLA 3GOXA 1PSFA 1KFZA 3CCQQ 2JM8A 2KE9A 2KNBB 4R55A 4QW2A 4C8QD 3G7ZA 4XAXB 2LQ8A 3CPFA 1KK7A 3F70A 2DTOA 4M7DB 2VXFA 3M59A 1D0ZA 4MMKA 2K3BA 2KYMA 2O9SA 4Z88A 1ABOA 5DLOA 5IHKA 1GFCA 2FYKA 3PIPA 2HQXA 2CREA 4IUUA 4JRKA 2V8JA 2COWA 2ED0A 3EHRA 3HFOA 2HNIA 2DMOA 3V7SA 5KYYB 3A1PA 4PJOG 1Q86R 3ZEHA 3CCSA 3I55Q 2DYIA 2F5KA 2LQWA 1N9RA 5GMKj 2G3RA 2HD0A 2D8JA 1K73U 4M75F 2L89A 4JJBA 5GAN2 3QDFA 3OW2A 2VC8A 3C4SA 2O88A 2E3IA 3C0CA 1K9MR 4ANJA 3TCJA 3RKXA 1D1BA 1E7OA 1W2BP 5GAMj 4C92E 2RN8A 2GNCA 1QKXA 3NPFA 3C95A 3CCLQ 1MNDA 3M54A 4F7UG 4AT1B 1VQLA 3OSSC 2XU8A 2RJCA 1WHKA 2QTVA 4XTZA 3CMAT 2PUKB 3S6WA 1K73C 4V2SA 3E9GA 2LQKA 1QCOA 2FPDA 3FB9A 4M78F 1NBEB 1ZSZB 2DL5A 1I8FA 1ZQ1A 2MWOA 4M75A 5FRMA 1K0SA 3H0IA 4EMKB 2KEAA 2RI5A 3QHSA 1KD1U 4Y91A 2QDLA 2E5QA 1VQLT 2IPOB 3MP6A 2X3WD 2LNVA 5GAOp 3I5RA 3RUXA 3THKA 1M4ZA 3JCMc 2CUBA 3OBWA 3M4YA 1YHQQ 3BFMA 2RB6A 1R8OB 1UGVA 4XQ3A 3S3MA 5FW9A 1X75C 4UC4A 3G4SQ 2XHCA 1SEMA 2JW4A 3A5ZB 2MPXC 3EGXA 2M0YA 4BI3A 3A8MB 4IURA 4KGVB 3D7SB 1WX6A 4FW1A 2GCXA 1VQ9A 1EX4A 1WHMA 4JUVA 2MYSA 1KD1C 2NUPA 2OJ2A 3BDLA 5GMKi 2CT3A 2JN0A 1TU0B 2K5IA 1WJQA 3JB9J 1ZUUA 2X4YA 4KBMB 3CC4Q 3DB3A 1B07A 1OV3A 4PL6A 4E7IA 4IUVA 4J9EA 1W1FA 1M3CA 1SRLA 2K79A 4NOYA 1EFNA 2JOYA 3QO3A 4C92C 2FZKB 1WQ7A 2EWNA 2QA4Q 2COYA 1WHLA 1MMDA 4M78B 2F2WA 3OYGA 3RERA 4C5GA 4EIKA 3VYHB 1PKTA 1D0XA 1VQ8A 1YJWA 1YP5A 2DK3A 4C0DB 3O5ZA 2LMJA 5I21A 1NEGA 1X6OA 2JS0A 4XTUA 2X4WA 4F04B 5J39A 1NEBA 5CAIA 5A0LA 4MZMA 3L2QA 1WJRA 4NL3A 2VYTA 1CKAA 2DF6A 2E10A 3CQTA 1O75A 2FRWA 2RF0A 6AT1B 3E19A 3C94A 2DRKA 4BY6C 1JXMA 1WQWA 2M9UA 1SKUB 1XQHA 2DKGA 5LJ3d 3QZ9B 1IXDA 3O8VA 1OU9A 2RQVA 1D3BB 1IGUA 4Z8AA 2IVWA 3JCMd 3PGGA 2DPPB 3EGDA 2VXEA 1HYOA 1Y96A 1WNLA 2LCSA 2KBTA 4J9BA 2HMAA 5L8RE 2LRQA 2SEMA 1K8AU 1FMKA 1AEYA 1M1FA 2DO3A 2CSIA 4Y28E 4C5IA 1PM3A 3PFSA 2O2OA 4RTZA 4HA8A 5LJ3g 2YRDA 1ARKA 1VQ7T 3RKWA 2SRCA 2R58A 5AYFA 2LCCA 2GTOA 2DD4A 3EGUA 2L3QA 3M0RA 4M7DE 1YI2T 2CP0A 2DILA 2A7YA 2L8DA 1TOVA 1WHHA 2LTOA 1X01A 2QGFB 1PD1A 2L3SA 1VQNT 5CR2A 2V26A 4JJDA 1UFFA 1UJ0A 2EKHA 3BDUA 2HL5C 1Y07A 3FIFA 1D0YA 2F2VA 2IG0A 2OAWA 3M9QA 2MOXA 1WFWA 3EG1A 1KG1A 3QWXX 4LXCA 2PVGB 2KRMA 1OOTA 3EFOA 5GMKl 3QKJA 5KE3A 5CKDA 1QWFA 4E7KA 2OTJA 1KQSP 2JTEA 2FPEA 1Y0MA 2X4JA 2XDBA 2LC4A 4JDSA 1SPKA 4LDYA 4KGZB 3QYHB 4XU0A 1K4US 1YCSB 1ZA2B 1LCKA 1Y7XA 1RAFB 3P8DA 1Q7YR 4LD9K 2E41A 3CCQT 3V8JA 1M2OA 3GP8A 2WSCE 2ZAEA 2DXCA 2YLBA 4LUEA 2KXDA 2YUQA 3H0HA 2DETA 4DQ2A 4C8QG 1SF9A 4C92A 3OY9A 4M7AD 3VRZA 2VWFA 2KROA 3NHNA 3QBYA 5D7UA 3VS7A 5IT9E 1K1ZA 2K7AA 2YUNA 3CCRT 1RUWA 3CC7T 4A53A 1VQOA 5D6XA 3OMCA 1H3ZA 2PU9B 1K9MU 3KFVA 4M7DC 2J05A 1JQQA 4XTWA 2JXBA 4XU1A 1KQSA 5I22A 3CXCP 3JCMV 1G2BA 4GLKA 1OPKA 3EFRA 1NM7A 4X1VA 3MKDA 3ZL7C 1S72T 5LJ3e 5GAOl 4M75E 4MZPA 3CCEA 1ZBJA 2CP5A 2NLUA 1WI7A 4HCBA 1K9MC 1TH7A 3UATA 4XTXA 1RI9A 5CVIA 3V7CA 5GANd 3BY7A 2G6FX 8ATCB 3G6ET 2FVUA 1G3YA 1HJDA 3J80E 1UEBA 3PVLA 5C6SA 3RKYA 4D6WA 1C1AA 1RAIB 4QVZA 3V7RA 1NPRA 2ECZA 1AD5A 3REAB 3L42A 4FT2A 3TSZA 1GBQA 5LJ5d 4ZGDB 2H8HA 2EYZA 3X20B 1VQ9Q 2P0QA 5DLQE 2M16A 4M78E 4PJJA 4IKFA 1MV0B 1OEBA 5GANg 1W70A 3QXEB 4J7IA 4PJOB 2DXBA 2EYXA 3CCUT 2LT4A 1VQMQ 3TEEA 2E70A 4OMPA 3OQ5A 3CXCA 2QEXT 1WJSA 1OX9A 2D8HA 1KJWA 1ZSZC 5CQXA 4D8KA 5KYUA 4EDUA 1VQ5T 1M2VB 1XJWB 2JJ9A 4EMKC 2LJ1A 3OS0A 3OYLA 4JS4A 4IUQA 1M1KR 3U23A 2MIOA 2MAMA 2LP5A 4M4ZA 5GJVB 4PK4A 3VU3C 2KXCA 4BE0A 1U5SA 2VB6A 8AT1B 2VASA 2OAUA 4F7UB 5I2SA 3JCMP 3FEOA 1ZUKA 2GQVA 1JEGA 4LUDA 4DBQA 3CD6A 1NJIR 4PLLA 1B34B 1VQ8Q 1YJWQ 4RTWA 4N4GA 5GAOn 2RQUA 1K0XA 3DLMA 1NG2A 1NLPC 4DEYA 4K11A 2CP6A 1YIJA 1VQ6A 1QMCA 1A0NB 1LVKA 2E6NA 4HVVA 4M75C 2VVKA 4J8OA 4J9IA 2DZCA 3MCAB 3CCMA 1QVFP 2J06A 2J6OA 3OYHA 3VV0A 1K8AR 4OMQA 2DA9A 3CD6T 5GAN4 2CSQA 2K57A 2ZCFB 3OBYA 1W4SA 4M77B 1I81A 3ULRB 2QQAA 4ZTFA 2ZGWA 5GAMg 1X6GA 1UGSB 3CPWP 4YTLA 1S1NA 3OMGA 1LOJA 2O4XA 2RMOA 1TWBA 2RH2A 2MWPA 1Q81R 3JB9D 4GY5A 4DBHA 4M78C 1WIEA 1I0CA 1TXQA 2A37A 4M7DA 1YJ9A 2PVDB 1Q82R 2RHIA 4C0DC 2E64A 3L2WA 1OPLA 3CC2T 3JB9H 1UG1A 4ESRA 4LNPA 1WDXA 1RABB 1J3TA 1QVGP 5GANj 4M75D 2HL3A 5KYYA 4N0AA 3VS4A 3QJ6A 1FMWA 1YJNT 1YJ9T 3UWNA 1M8VA 5GANe 2L2PA 1VQ4Q 2LJ0A 5LJ5j 1OI1A 4MDWA 1RAEB 1I5LA 1WYXA 5LJ3h 1VYUA 3CPWA 1BI0A 4KULA 2B86A 2JM9A 3CBOA 4P5NA 5LL6S 2OTJQ 4QT7A 1EIFA 1ZBXA 4HCCA 1WZOA 3UT1A 1GCPA 4AG2C 1TUGB 2X4XA 2CP7A 3EFSA 5J26A 1FXXA 2HBPA 3G71Q 2C06A 2LCLA 3LWIA 2EJGA 3CCVT 2PNIA 2YRVA 3ZFJA 5CO7A 1IZ6A 1WLPB 3NTKA 4KH0B 2QQBA 2PQWA 1VQPA 1ZSZA 2RQWA 1BK2A 2FPFA 3CMAA 2QI2A 1QVGA 3R6OA 2YSQA 4EMKA 3JCMJ 1M5Q1 1Q7YU 1H8KA 2ABLA 3I56Q 2ENMA 4GLMA 2FG0A 3PNWC 5GMKe 1RLPC 4L5GA 4HVUA 4ZN3A 1N8RU 1WHGA 3H0FA 3P8BB 2HAXA 1VQPT 1VQOQ 5GAMe 4C8QF 3E2UA 3OYIA 4X34A 3LYIA 4AMCA 4IIOA 1RADB 1UGQB 1MV3A 5M9OA 1Y71A 1Q7YC 5A2QE 3JCMW 3M56A 3RDVA 2BIVA 3QDRB 2FZCB 4OMMA 1N8RC 5GAN7 3RIRA 5GJWB 3GNGA 2MK5A 2K3YA 2FHDA 4M7AG 3SDZA 1D1CA 3KBGA 4M77G 2P0PA 1BI2A 2GQIA 1NZ9A 2GFAA 3CCEQ 2NYSA 3M0QA 4PJOE 1T0HA 2L0AA 1KIKA 3ZBDA 4AG1C 2FEIA 3UDCA 1MGQA 2PUOB 4BD3A 1KQSS 1YNZA 4M78A 4RKUE 3HL8A 1VOMA 1W2BA 4HXJA 1BB9A 1AWXA 1TSFA 3SD4A 2K6DA 4KRTA 2DX1A 4B9XA 2GTJA 1JXOA 1RI0A 1U1TA 1BIAA 2DJQA 4XK8E 3FDRA 2QXFA 2MCNA 3L2ZA 4F7UE 4LDVA 5FU6B 4FU6A 3VUZA 3UA7A 1PD0A 3QG1A 2EQUA 1AZEA 4KUIA 4C8QB 5CKFA 3M53A 4J9CA 1JO8A 3I9QA 2C0OA 4QKUA 2MI6A 1WXTA 4IUTA 3RMSA 1G5VA 3CCJT 2V1QA 2JNGA 3NGPA 2D0QB 4RTYA 1D3BA 5IAYA 1WA7A 1M1KU 1SHFA 4ZTJA 2VGMA 3QSUA 2E6ZA 4PJNA 2EKOA 2CP2A 1VQMT 1TTHB 3CXCS 2BE7D 3VS5A 2AKLA 4ME7A 5HKCA 1YITT 2DERA 4C0GA 1NJIU 2KDSA 2E4HA 4A4EA 2GF7A 2X51A 1VIFA 1MNEA 1YIJQ 1VQ6Q 2NUZA 5CKEA 1NYGA 4N4IA 1VQ7A 4PJOC 3CCMQ 4JPBW 2EGCA 2EQMA 1M1KC 2K3XA 4RG2A 5GAMf 1CSKA 4J9GA 5EC7A 3LLRA 2DD5A 3TREA 1YI2A 1QCNA 2I0NA 4J9HA 4XU3A 1PSEA 1TUDA 2M0OA 4C92D 1VQNA 2JMCA 4HCZA 4OMOA 1AWJA 4PLIA 2DXTA 2ESWA 2BZYA 2ZPIB 1NJIC 2LQNA 4ELZC 3CMEQ 2GBQA 4OB0B 2AHJB 5CKBA 1TG0A 1M3BA 2DNUA 4E7ZA 4FYXB 2FL7A 3JCMg 4MMLA 1KC8R 1Q81U 5GMKh 4FM4B 3X24B 3JCMQ 3LGLA 2DM1A 4NS5A 2IIMA 4E7SA 1UE9A 4Z02A 4OB1B 1Q82U 4EMGA 3MP8A 2KRNA 2ROTA 1PRMC 1K8AC 2F69A 5GAMh 1B7TA 2RHZA 5IN1A 1FYNA 4ZN1A 2K9GA 4X9CA 2D1XA 4QQ6A 1UTIA 3INZA 1P92A 4DOWA 2OTLQ 3QZ5B 3JB9G 4CC7A 3CCQA 1Q81C 1ACMB 4BB7A 4II1A 4JRIA 4KH1B 1U06A 1O9SA 2CGHA 1Q82C 1YBYA 2LDMA 2DE0X 3RR6A 3GIBA 1B3QA 4A4FA 2DL8A 2ROLA 2DFUA 3OS1A 4ELYC 2AT1B 5GAN8 3CCRA 2J6FA 3Q1JA 3OYFA 3CC7A 1VQKT 2KI7A 1HK9A 1PCXA 3OYBA 1SRMA 4ZNXA 4M75G 4E7HA 5HK3A 1UECA 3CCSQ 1N8RR 2XDDA 1BU1A 1F1BB 1AT1B 4RTUA 4FYYB 1K76A 2HSPA 3MEUA 3CPWS 2KYBA 3OYMA 3CMAQ 4PJOF 3S3OA 2KSSA 1RAAB 3H41A 3VUBA 4AFZC 3NFCA 2RQRA 2AKKA 1ZX6A 2WSFE 1S72A 3E9FA 3SHWA 4FIBA 1JB0E 2HQHA 3A8OB 2JTMA 3M55A 3VJPA 4LN2A 3I55T 1VQLQ 3C12A 3HRSA 2RI3A 3MEAA 3H9NA 2VUBA 4O6JA 3EH1A 4OF1A 2BKDN 3H6ZA 4DA4A 3G6EA 2KR3A 2YXYA 3M57A 3M0TA 3OW2S 4QQDA 4E6RA 2HBWA 4F7UF 2R57A 3PMTA 5KE2A 2Z0WA 4N0AC 3I56T 4QVCA 4PJOA 2QG9B 5HCKA 3JCMe 5CQYA 4OB3B 3CCLT 1CKBA 2C0TA 1HSQA 3VS6A 4R0KA 1XNIA 3CCUA 1NE8A 2XK0A 2R5MA 1E6GA 2DBMA 1OZ3A 2QEXA 1M2VA 1VYTA 1YHQA 3META 3QIIA 3X28B 1H641 2EQIA 3J7AF 1VQ5A 2CS7A 2O9VA 5A0DA 3GLXA 1GCQA 3SWNB 5IXFA 4M7AF 3M0UA 4C8QE 5D6YA 1PG5B 2L3RA 4M77F 2EVRA 1JU5C 2BUDA 3ME9A 2XMFA 4F7UA 1M8MA 1PHTA 1Y57A 4M7DD 3EHQA 4X9DA 2DVEA 1B34A 3OYKA 5IXBA 2ZZDA 2OX7A 2YDLA 1QLYA 2AZSA 2W10A 1YHQT 5DM7R 3KXTA 3CC4A 1D09B 1JJ2P 1QKWA 3G4ST 4BY6B 1GBRA 2YUOA 3EG2A 1U8RA 2MMPA 2LT1A 3MJXA 4XTYA 5LJ5g 4TVRA 3UA6A 4L6V5 5C0MA 2I2LA 2EAYA 3R6NA 2DBKA 1AWWA 5FRNA 2PTKA 1W2BS 1OULA 4M7AA 1Q95G 5GAN6 1M9SA 2E12A 4M77A 3M58A 1AHJB 4XU2A 3TU4K 4OB2B 2HKQB 3CC4T 3E1SA 2M51A 2WACA 2RK1A 3EG0A 3OYDA 2P0KA 3A8LB 1D1AA 2Y90A 2RHYA 4Z89A 2DEQA 2GFUA 2CZ6B 1ZUYA 2Y4XA 2QA4T 2AIRB 3JV3A 1OX8A 2VGNA 4JRPA 3FC3A 3OS2A 2JS2A 4M7AB 3P8HA 3M5AA 4RCBA 3CC2A 4PFZA 1WPYA 2C0IA 1VQ7Q 2QGGA 2A3LA 2HZYA 1JJ2A 4MDXA 4A4HA 2JT4A 2YT6A 3HTRA 2VKNA 4FT4A 4C8QC 4OVAA 5KYXB 3I35A 1KHCA 3CEYA 4B6MA 1YI2Q 2RJEA 1GFDA 2QQSA 4FSSA 1AOJA 5GAN5 5LJ3f 1PWTA 1YJNA 1VQNQ 1YWPA 4HVWA 1ZLMA 4J7FA 3LX7A 3JCMf 2M02A 4DBFA 1MHNA 1E6HA 4OMFB 2NUTB 1YN8A 2RPNA 4HT9A 1G3SA 3SFMA 5FU7B 5HY6A 5GMKm 5CCAA 2XD0A 3FJPA 1PNJA 2A08A 5GAN3 3EG9B 3QWYA 2K4YA 4RTTA 4F16A 2RJFA 3MP1A 2DXUA 3RMQA 3VRYA 1KC8U 1GL5A 5KYNA 1PKSA 1IREB 5D6WA 1QVFA 4XTVA 4KUDK 2A28A 2RD1A 4C92G 1DJ7B 4HT8A 5KH6A 3CCVA 4J6XA 4C0ZA 2KT1A 4RG8A 3EG3A 4PJLA 5AT1B 3JCMh 1N5ZA 2EGAA 5LJ5e 3S3NA 3PVQA 3RESA 5IH2A 4M78D 2DJZA 4JJNK 1KC8C 1BBZA 5IHNA 3X26B 2KGTA 3JB9F 2RQTA 2B8AA 2QASA 1HD3A 3JCMb 2QYZA 3CCRQ 3FRNA 1MMGA 1MMNA 3NTHA 3CC7Q 5GAOr 2OTLT 2DL7A 5FLXE 1WGSA 2EYWA 3SEMA 3HPWA 2DLPA 4J5YA 1IRXA 1NPPA 2EGEA 1IB8A 3QYGB 1UGPB 1RAGB 1X43A 3TQ7P 2JUFA 1BI1A 3WXMB 4B9WA 1U1SA 2CDTA 4E7LA 1ZHIA 1X6BA 5GAOm 2LNHB 2LVMA 4EPCA 1S72Q 2ATCB 2HQEA 2V8IA 4Q5WA 2HDAA 2F2XA 1X2QA 4IIMA 1BIBA 3DKMA 2CZ7B 3JRZA 3CCST 4JJCA 1YWOA 3MPUB 3A98A 3AHUA 3G6EQ 4ATOA 3H8ZA 5CK9A 9ATCB 2XKOC 1UB4A 4FYWB 1FMVA 2ZPEB 4JRQA 3CBMA
chains in the Genus database with same CATH topology
3I55Q 1KD1R 3G71Q 3G4SQ 3CD6Q 1NJIR 3CCJQ 1QVGP 3CC4Q 3CCLQ 1YI2Q 1JJ2P 1K73R 1VQ8Q 1K8AR 1KC8R 1VQLQ 1YJWQ 3CXCP 3CCEQ 1YJNQ 1VQ9Q 1VQKQ 1YJ9Q 1M1KR 3CCRQ 1VQNQ 1VQPQ 1Q82R 2OTLQ 3G6EQ 3CCUQ 3CMAQ 3CC2Q 3CC7Q 3CCQQ 1YIJQ 1VQ6Q 1Q7YR 2OTJQ 1W2BP 1VQOQ 1VQ7Q 3CPWP 1K9MR 2QEXQ 1S72Q 3CMEQ 1KQSP 1VQ4Q 1M90R 1VQMQ 3CCMQ 1YHQQ 3I56Q 2QA4Q 1Q86R 3CCSQ 1N8RR 1QVFP 3OW2P 1VQ5Q 1Q81R 1YITQ 3CCVQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 Q;  1KD1 R;  3G71 Q;  3G4S Q;  3CD6 Q;  1NJI R;  3CCJ Q;  1QVG P;  3CC4 Q;  3CCL Q;  1YI2 Q;  1JJ2 P;  1K73 R;  1VQ8 Q;  1K8A R;  1KC8 R;  1VQL Q;  1YJW Q;  3CXC P;  3CCE Q;  1YJN Q;  1VQ9 Q;  1VQK Q;  1YJ9 Q;  1M1K R;  3CCR Q;  1VQN Q;  1VQP Q;  1Q82 R;  2OTL Q;  3G6E Q;  3CCU Q;  3CMA Q;  3CC2 Q;  3CC7 Q;  3CCQ Q;  1YIJ Q;  1VQ6 Q;  1Q7Y R;  2OTJ Q;  1W2B P;  1VQO Q;  1VQ7 Q;  3CPW P;  1K9M R;  2QEX Q;  1S72 Q;  3CME Q;  1KQS P;  1VQ4 Q;  1M90 R;  1VQM Q;  3CCM Q;  1YHQ Q;  3I56 Q;  2QA4 Q;  1Q86 R;  3CCS Q;  1N8R R;  1QVF P;  3OW2 P;  1VQ5 Q;  1Q81 R;  1YIT Q;  3CCV Q; 
#chains in the Genus database with same CATH topology
 2F1L A;  2H3E B;  1NYF A;  2DVJ A;  4OP0 A;  1LNX A;  1K9A A;  1UHF A;  4C8Q A;  4R56 A;  2YWW A;  3V8K A;  3CCU Q;  1XTD A;  3FLG A;  2CP3 A;  2QEX Q;  3JB9 I;  4PJM A;  1UUE A;  1X2K A;  3VS1 A;  4BDY A;  1VQ5 Q;  2ED1 A;  1ZSG A;  1PRL C;  4BAC A;  5GAN f;  3CCJ A;  1PC0 A;  1EZZ B;  2KVQ G;  1SSH A;  3QJY A;  2XID A;  1AVZ C;  2D0N A;  4M75 B;  2XI9 A;  4AFU C;  3RNJ A;  1BCO A;  2LX7 A;  3FJ5 A;  4C5E A;  3GBQ A;  3DB4 A;  1G3T A;  4ZGJ B;  1C0M A;  1VYV A;  2QTX A;  3LH0 A;  1Z9Q A;  2W0Z A;  4NL2 A;  3J81 E;  1VQM A;  1OYX A;  1QP3 A;  2KMT A;  3IQL A;  1MUZ A;  2V8K A;  5LJ5 f;  1OQK A;  4CRI A;  2LJ3 A;  2QAZ A;  4F17 A;  1YIT A;  4J9F A;  2E5K A;  3JCM X;  2F5T X;  4FL6 A;  2D6F A;  2DTH A;  2KT8 A;  4BE2 A;  3PE0 A;  3EH2 A;  1VQ9 T;  2RI2 A;  3EGX B;  3VS2 A;  3LW5 E;  4M7A E;  3TSW A;  1R0C B;  4A54 A;  4M77 E;  1G8X A;  5FRO A;  2E1H A;  5GAN h;  3CD6 Q;  2NUP B;  5CKH A;  4M7D G;  3OYA A;  1N6A A;  2DIQ A;  4FW2 A;  1YFN A;  2P4T A;  1FWZ A;  2RO0 A;  1G83 A;  3SWN C;  3KUF A;  2X35 A;  4BE1 A;  1H92 A;  3VS3 A;  2BTT A;  3LGF A;  4J6Y A;  2CH4 A;  4JLI A;  3OA6 A;  1RLQ C;  2DAQ A;  1BYM A;  3PIO A;  4MZT A;  1SSF A;  4PFP A;  1UGR B;  5LJ5 h;  1M90 U;  2K5F A;  4RMO A;  4A4K A;  2LZ6 B;  2RK2 A;  3HP9 A;  2ZPB B;  4DBR A;  1N27 A;  3SB2 A;  3PT9 A;  2P84 A;  3L2R A;  2YUP A;  2CZ0 B;  1VQ8 T;  1YJW T;  4OGC A;  3CC2 Q;  4F14 A;  4AFQ C;  3UF4 A;  2VV5 A;  1OU8 A;  2DL3 A;  2K5L A;  3NMZ C;  4J9D A;  1SHG A;  2Y4Y A;  2RHU A;  1GCQ C;  2FB7 A;  1KQ1 A;  3NTI A;  2CZ1 B;  1I4K 1;  4LD6 A;  4A63 B;  3GF5 A;  3OYC A;  1M90 C;  1YJN Q;  5L23 A;  1YJ9 Q;  2L3P A;  2P4R A;  2EBP A;  3GNF B;  4O5V A;  4RTV A;  1JJ2 S;  1KQ2 A;  2K2M A;  2CKK A;  1NLO C;  2X9H A;  2RNA A;  4PJO D;  4J6W A;  1VQK A;  3EGD B;  4DEX A;  1M30 A;  1Z9Z A;  1Y96 B;  2DRM A;  4M7A C;  2XDP A;  4M77 C;  5CIU A;  2RM4 A;  3OYN A;  1VQ4 A;  3I5S A;  1QWE A;  2XIC A;  3CCV Q;  3A8G B;  2FO0 A;  3BW1 A;  4L59 A;  2BZ8 A;  2EPD A;  4LE9 A;  1TS9 A;  1AWO A;  1T0J A;  4C92 F;  2EJF A;  3MO8 A;  4HKE A;  3PTA A;  3AT1 B;  2PVO B;  4BUG A;  4CI0 C;  2EQK A;  5DY9 A;  4E7J A;  1QVF S;  2CYZ B;  1IHV A;  4GBQ A;  1BCM A;  2CT4 A;  2HCK A;  4J83 A;  1VQ4 T;  4KGX B;  2LX9 A;  1RAC B;  5FU7 C;  3G71 A;  3V8L A;  3I55 A;  1ZA1 B;  1VUB A;  1K73 R;  2CH4 W;  1LJO A;  2HKN A;  3QPH A;  1VQP Q;  4OML A;  3CBP A;  2OTJ T;  2QQR A;  3EFO B;  3I56 A;  3X25 B;  4Y92 A;  1V76 A;  2M1H A;  1Q86 U;  3OYY A;  3CCL A;  3VYG A;  4M78 G;  3G71 T;  1LPL A;  4M77 D;  4RCC A;  4VUB A;  2HEQ A;  2OI3 A;  5KCH A;  2JVV A;  4WF2 A;  1BKB A;  2CUD A;  1UDL A;  2AK5 A;  3SWN A;  5IHI A;  1QVG S;  4QQG A;  3L1A A;  2A0F B;  1WHJ A;  2DL4 A;  3L2V A;  4FYV B;  1M3A A;  2YLC A;  3T9N A;  1KD1 R;  3TVT A;  2QDY B;  3ER0 A;  1X69 A;  1V29 B;  5LJ3 j;  3OB9 A;  4OGE A;  1Q86 C;  1T3L A;  4E2F B;  4ORZ A;  4C92 B;  1JRI A;  3HRU A;  4JS5 A;  1OZ2 A;  1I5O B;  1G3W A;  4AFS C;  1VQO T;  5ECA A;  1GRI A;  4CC2 A;  5KYW A;  3JAM E;  3JSC A;  2YRC A;  3OS5 A;  4WCI A;  4BI4 A;  2RJD A;  3G4S A;  5A0G A;  1KSW A;  4LDU A;  1RAH B;  3REB B;  1FX7 A;  4OMN A;  2KK4 A;  1UJY A;  3MHX A;  1XOV A;  4C0F A;  1IHW A;  4N4H A;  7AT1 B;  2DTI A;  5I2M A;  5FWB A;  5EG2 A;  2D9T A;  4PKC C;  3UPU A;  4E47 A;  1HXD A;  1KHI A;  2ZPG B;  4D8D A;  3CCJ Q;  2EYY A;  2O31 A;  5GAO q;  2XG8 D;  3CCE T;  1X27 A;  1R77 A;  4LDW A;  2MF2 A;  3LWH A;  1M1G A;  4PFO A;  5KYW B;  2E65 A;  2EIF A;  2K2V A;  1UHC A;  2DEU A;  2FZG B;  4JZ3 A;  3QUI A;  1QW1 A;  3GPL A;  3EAE A;  2DIG A;  1QP2 A;  2FRY A;  2KQW A;  2QA4 A;  2V1R A;  1YIT Q;  4QVD A;  1I1J A;  3VS0 A;  1GXI E;  3HSB A;  4DOV A;  1IGQ A;  4FSX A;  2DYB A;  4PNO A;  1M27 C;  1WXU A;  1C6V X;  2JZ2 A;  3LH5 A;  3L2U A;  1QQJ A;  4JZ4 A;  5KYX A;  1JBM A;  3HRT A;  4CC3 A;  2RHX A;  3URG A;  1MMA A;  2GGR A;  1ABQ A;  3HFN A;  1M90 R;  2PZ1 A;  3ASK A;  1VA7 A;  1TUC A;  4WTO B;  4C5H A;  5KCO A;  3A8H B;  3BE3 A;  4RTX A;  3OSV A;  2NUT A;  2A36 A;  2BE9 B;  5FWC A;  3OYJ A;  2E3H A;  5GAM d;  4BDZ A;  4BI8 B;  3PMI A;  5KYU B;  2EQJ A;  2AZV A;  2COZ A;  1YCY A;  3EG9 A;  2WSE E;  5FU6 C;  4M7D F;  2BZX A;  2J6K A;  2ZPF B;  1VIE A;  2ZPH B;  2R5A A;  1N9S A;  2X3X D;  3DLL A;  3WVD B;  2J7I A;  2KY9 A;  3RBB B;  2EW3 A;  3HKS A;  2JTF A;  5HK0 A;  2YHT A;  1AZG B;  1W6X A;  4ZGE B;  2L5Q A;  1YIJ T;  4EMH A;  3CME A;  1VQ6 T;  3MEV A;  1BI3 A;  2JMA A;  1R0B G;  1V1C A;  4IUP A;  3CCM T;  2EFI A;  2DZ9 A;  4CC4 B;  3M0P A;  3OYE A;  4KT0 E;  3N5B B;  5I11 A;  2KRS A;  4A4G A;  2NWM A;  1SG5 A;  3M4G A;  2H3J A;  3WVE B;  3HHT B;  4FCY A;  2EYQ A;  1QCF A;  4LDX A;  3VKI A;  1U3O A;  3M0S A;  2HSE B;  2QQ9 A;  1IO6 A;  1QVP A;  1T3S A;  3CME T;  2QK0 A;  3OW2 P;  3G1J A;  4HCK A;  4JLG A;  1RL2 A;  5J3B A;  1I07 A;  2RA2 A;  2O4X B;  3MEW A;  1H3H A;  1WXB A;  4RUG A;  1VQK Q;  2KAF A;  2EJ9 A;  2O01 E;  2OTL A;  3GOX A;  1PSF A;  1KFZ A;  3CCQ Q;  2JM8 A;  2KE9 A;  2KNB B;  4R55 A;  4QW2 A;  4C8Q D;  3G7Z A;  4XAX B;  2LQ8 A;  3CPF A;  1KK7 A;  3F70 A;  2DTO A;  4M7D B;  2VXF A;  3M59 A;  1D0Z A;  4MMK A;  2K3B A;  2KYM A;  2O9S A;  4Z88 A;  1ABO A;  5DLO A;  5IHK A;  1GFC A;  2FYK A;  3PIP A;  2HQX A;  2CRE A;  4IUU A;  4JRK A;  2V8J A;  2COW A;  2ED0 A;  3EHR A;  3HFO A;  2HNI A;  2DMO A;  3V7S A;  5KYY B;  3A1P A;  4PJO G;  1Q86 R;  3ZEH A;  3CCS A;  3I55 Q;  2DYI A;  2F5K A;  2LQW A;  1N9R A;  5GMK j;  2G3R A;  2HD0 A;  2D8J A;  1K73 U;  4M75 F;  2L89 A;  4JJB A;  5GAN 2;  3QDF A;  3OW2 A;  2VC8 A;  3C4S A;  2O88 A;  2E3I A;  3C0C A;  1K9M R;  4ANJ A;  3TCJ A;  3RKX A;  1D1B A;  1E7O A;  1W2B P;  5GAM j;  4C92 E;  2RN8 A;  2GNC A;  1QKX A;  3NPF A;  3C95 A;  3CCL Q;  1MND A;  3M54 A;  4F7U G;  4AT1 B;  1VQL A;  3OSS C;  2XU8 A;  2RJC A;  1WHK A;  2QTV A;  4XTZ A;  3CMA T;  2PUK B;  3S6W A;  1K73 C;  4V2S A;  3E9G A;  2LQK A;  1QCO A;  2FPD A;  3FB9 A;  4M78 F;  1NBE B;  1ZSZ B;  2DL5 A;  1I8F A;  1ZQ1 A;  2MWO A;  4M75 A;  5FRM A;  1K0S A;  3H0I A;  4EMK B;  2KEA A;  2RI5 A;  3QHS A;  1KD1 U;  4Y91 A;  2QDL A;  2E5Q A;  1VQL T;  2IPO B;  3MP6 A;  2X3W D;  2LNV A;  5GAO p;  3I5R A;  3RUX A;  3THK A;  1M4Z A;  3JCM c;  2CUB A;  3OBW A;  3M4Y A;  1YHQ Q;  3BFM A;  2RB6 A;  1R8O B;  1UGV A;  4XQ3 A;  3S3M A;  5FW9 A;  1X75 C;  4UC4 A;  3G4S Q;  2XHC A;  1SEM A;  2JW4 A;  3A5Z B;  2MPX C;  3EGX A;  2M0Y A;  4BI3 A;  3A8M B;  4IUR A;  4KGV B;  3D7S B;  1WX6 A;  4FW1 A;  2GCX A;  1VQ9 A;  1EX4 A;  1WHM A;  4JUV A;  2MYS A;  1KD1 C;  2NUP A;  2OJ2 A;  3BDL A;  5GMK i;  2CT3 A;  2JN0 A;  1TU0 B;  2K5I A;  1WJQ A;  3JB9 J;  1ZUU A;  2X4Y A;  4KBM B;  3CC4 Q;  3DB3 A;  1B07 A;  1OV3 A;  4PL6 A;  4E7I A;  4IUV A;  4J9E A;  1W1F A;  1M3C A;  1SRL A;  2K79 A;  4NOY A;  1EFN A;  2JOY A;  3QO3 A;  4C92 C;  2FZK B;  1WQ7 A;  2EWN A;  2QA4 Q;  2COY A;  1WHL A;  1MMD A;  4M78 B;  2F2W A;  3OYG A;  3RER A;  4C5G A;  4EIK A;  3VYH B;  1PKT A;  1D0X A;  1VQ8 A;  1YJW A;  1YP5 A;  2DK3 A;  4C0D B;  3O5Z A;  2LMJ A;  5I21 A;  1NEG A;  1X6O A;  2JS0 A;  4XTU A;  2X4W A;  4F04 B;  5J39 A;  1NEB A;  5CAI A;  5A0L A;  4MZM A;  3L2Q A;  1WJR A;  4NL3 A;  2VYT A;  1CKA A;  2DF6 A;  2E10 A;  3CQT A;  1O75 A;  2FRW A;  2RF0 A;  6AT1 B;  3E19 A;  3C94 A;  2DRK A;  4BY6 C;  1JXM A;  1WQW A;  2M9U A;  1SKU B;  1XQH A;  2DKG A;  5LJ3 d;  3QZ9 B;  1IXD A;  3O8V A;  1OU9 A;  2RQV A;  1D3B B;  1IGU A;  4Z8A A;  2IVW A;  3JCM d;  3PGG A;  2DPP B;  3EGD A;  2VXE A;  1HYO A;  1Y96 A;  1WNL A;  2LCS A;  2KBT A;  4J9B A;  2HMA A;  5L8R E;  2LRQ A;  2SEM A;  1K8A U;  1FMK A;  1AEY A;  1M1F A;  2DO3 A;  2CSI A;  4Y28 E;  4C5I A;  1PM3 A;  3PFS A;  2O2O A;  4RTZ A;  4HA8 A;  5LJ3 g;  2YRD A;  1ARK A;  1VQ7 T;  3RKW A;  2SRC A;  2R58 A;  5AYF A;  2LCC A;  2GTO A;  2DD4 A;  3EGU A;  2L3Q A;  3M0R A;  4M7D E;  1YI2 T;  2CP0 A;  2DIL A;  2A7Y A;  2L8D A;  1TOV A;  1WHH A;  2LTO A;  1X01 A;  2QGF B;  1PD1 A;  2L3S A;  1VQN T;  5CR2 A;  2V26 A;  4JJD A;  1UFF A;  1UJ0 A;  2EKH A;  3BDU A;  2HL5 C;  1Y07 A;  3FIF A;  1D0Y A;  2F2V A;  2IG0 A;  2OAW A;  3M9Q A;  2MOX A;  1WFW A;  3EG1 A;  1KG1 A;  3QWX X;  4LXC A;  2PVG B;  2KRM A;  1OOT A;  3EFO A;  5GMK l;  3QKJ A;  5KE3 A;  5CKD A;  1QWF A;  4E7K A;  2OTJ A;  1KQS P;  2JTE A;  2FPE A;  1Y0M A;  2X4J A;  2XDB A;  2LC4 A;  4JDS A;  1SPK A;  4LDY A;  4KGZ B;  3QYH B;  4XU0 A;  1K4U S;  1YCS B;  1ZA2 B;  1LCK A;  1Y7X A;  1RAF B;  3P8D A;  1Q7Y R;  4LD9 K;  2E41 A;  3CCQ T;  3V8J A;  1M2O A;  3GP8 A;  2WSC E;  2ZAE A;  2DXC A;  2YLB A;  4LUE A;  2KXD A;  2YUQ A;  3H0H A;  2DET A;  4DQ2 A;  4C8Q G;  1SF9 A;  4C92 A;  3OY9 A;  4M7A D;  3VRZ A;  2VWF A;  2KRO A;  3NHN A;  3QBY A;  5D7U A;  3VS7 A;  5IT9 E;  1K1Z A;  2K7A A;  2YUN A;  3CCR T;  1RUW A;  3CC7 T;  4A53 A;  1VQO A;  5D6X A;  3OMC A;  1H3Z A;  2PU9 B;  1K9M U;  3KFV A;  4M7D C;  2J05 A;  1JQQ A;  4XTW A;  2JXB A;  4XU1 A;  1KQS A;  5I22 A;  3CXC P;  3JCM V;  1G2B A;  4GLK A;  1OPK A;  3EFR A;  1NM7 A;  4X1V A;  3MKD A;  3ZL7 C;  1S72 T;  5LJ3 e;  5GAO l;  4M75 E;  4MZP A;  3CCE A;  1ZBJ A;  2CP5 A;  2NLU A;  1WI7 A;  4HCB A;  1K9M C;  1TH7 A;  3UAT A;  4XTX A;  1RI9 A;  5CVI A;  3V7C A;  5GAN d;  3BY7 A;  2G6F X;  8ATC B;  3G6E T;  2FVU A;  1G3Y A;  1HJD A;  3J80 E;  1UEB A;  3PVL A;  5C6S A;  3RKY A;  4D6W A;  1C1A A;  1RAI B;  4QVZ A;  3V7R A;  1NPR A;  2ECZ A;  1AD5 A;  3REA B;  3L42 A;  4FT2 A;  3TSZ A;  1GBQ A;  5LJ5 d;  4ZGD B;  2H8H A;  2EYZ A;  3X20 B;  1VQ9 Q;  2P0Q A;  5DLQ E;  2M16 A;  4M78 E;  4PJJ A;  4IKF A;  1MV0 B;  1OEB A;  5GAN g;  1W70 A;  3QXE B;  4J7I A;  4PJO B;  2DXB A;  2EYX A;  3CCU T;  2LT4 A;  1VQM Q;  3TEE A;  2E70 A;  4OMP A;  3OQ5 A;  3CXC A;  2QEX T;  1WJS A;  1OX9 A;  2D8H A;  1KJW A;  1ZSZ C;  5CQX A;  4D8K A;  5KYU A;  4EDU A;  1VQ5 T;  1M2V B;  1XJW B;  2JJ9 A;  4EMK C;  2LJ1 A;  3OS0 A;  3OYL A;  4JS4 A;  4IUQ A;  1M1K R;  3U23 A;  2MIO A;  2MAM A;  2LP5 A;  4M4Z A;  5GJV B;  4PK4 A;  3VU3 C;  2KXC A;  4BE0 A;  1U5S A;  2VB6 A;  8AT1 B;  2VAS A;  2OAU A;  4F7U B;  5I2S A;  3JCM P;  3FEO A;  1ZUK A;  2GQV A;  1JEG A;  4LUD A;  4DBQ A;  3CD6 A;  1NJI R;  4PLL A;  1B34 B;  1VQ8 Q;  1YJW Q;  4RTW A;  4N4G A;  5GAO n;  2RQU A;  1K0X A;  3DLM A;  1NG2 A;  1NLP C;  4DEY A;  4K11 A;  2CP6 A;  1YIJ A;  1VQ6 A;  1QMC A;  1A0N B;  1LVK A;  2E6N A;  4HVV A;  4M75 C;  2VVK A;  4J8O A;  4J9I A;  2DZC A;  3MCA B;  3CCM A;  1QVF P;  2J06 A;  2J6O A;  3OYH A;  3VV0 A;  1K8A R;  4OMQ A;  2DA9 A;  3CD6 T;  5GAN 4;  2CSQ A;  2K57 A;  2ZCF B;  3OBY A;  1W4S A;  4M77 B;  1I81 A;  3ULR B;  2QQA A;  4ZTF A;  2ZGW A;  5GAM g;  1X6G A;  1UGS B;  3CPW P;  4YTL A;  1S1N A;  3OMG A;  1LOJ A;  2O4X A;  2RMO A;  1TWB A;  2RH2 A;  2MWP A;  1Q81 R;  3JB9 D;  4GY5 A;  4DBH A;  4M78 C;  1WIE A;  1I0C A;  1TXQ A;  2A37 A;  4M7D A;  1YJ9 A;  2PVD B;  1Q82 R;  2RHI A;  4C0D C;  2E64 A;  3L2W A;  1OPL A;  3CC2 T;  3JB9 H;  1UG1 A;  4ESR A;  4LNP A;  1WDX A;  1RAB B;  1J3T A;  1QVG P;  5GAN j;  4M75 D;  2HL3 A;  5KYY A;  4N0A A;  3VS4 A;  3QJ6 A;  1FMW A;  1YJN T;  1YJ9 T;  3UWN A;  1M8V A;  5GAN e;  2L2P A;  1VQ4 Q;  2LJ0 A;  5LJ5 j;  1OI1 A;  4MDW A;  1RAE B;  1I5L A;  1WYX A;  5LJ3 h;  1VYU A;  3CPW A;  1BI0 A;  4KUL A;  2B86 A;  2JM9 A;  3CBO A;  4P5N A;  5LL6 S;  2OTJ Q;  4QT7 A;  1EIF A;  1ZBX A;  4HCC A;  1WZO A;  3UT1 A;  1GCP A;  4AG2 C;  1TUG B;  2X4X A;  2CP7 A;  3EFS A;  5J26 A;  1FXX A;  2HBP A;  3G71 Q;  2C06 A;  2LCL A;  3LWI A;  2EJG A;  3CCV T;  2PNI A;  2YRV A;  3ZFJ A;  5CO7 A;  1IZ6 A;  1WLP B;  3NTK A;  4KH0 B;  2QQB A;  2PQW A;  1VQP A;  1ZSZ A;  2RQW A;  1BK2 A;  2FPF A;  3CMA A;  2QI2 A;  1QVG A;  3R6O A;  2YSQ A;  4EMK A;  3JCM J;  1M5Q 1;  1Q7Y U;  1H8K A;  2ABL A;  3I56 Q;  2ENM A;  4GLM A;  2FG0 A;  3PNW C;  5GMK e;  1RLP C;  4L5G A;  4HVU A;  4ZN3 A;  1N8R U;  1WHG A;  3H0F A;  3P8B B;  2HAX A;  1VQP T;  1VQO Q;  5GAM e;  4C8Q F;  3E2U A;  3OYI A;  4X34 A;  3LYI A;  4AMC A;  4IIO A;  1RAD B;  1UGQ B;  1MV3 A;  5M9O A;  1Y71 A;  1Q7Y C;  5A2Q E;  3JCM W;  3M56 A;  3RDV A;  2BIV A;  3QDR B;  2FZC B;  4OMM A;  1N8R C;  5GAN 7;  3RIR A;  5GJW B;  3GNG A;  2MK5 A;  2K3Y A;  2FHD A;  4M7A G;  3SDZ A;  1D1C A;  3KBG A;  4M77 G;  2P0P A;  1BI2 A;  2GQI A;  1NZ9 A;  2GFA A;  3CCE Q;  2NYS A;  3M0Q A;  4PJO E;  1T0H A;  2L0A A;  1KIK A;  3ZBD A;  4AG1 C;  2FEI A;  3UDC A;  1MGQ A;  2PUO B;  4BD3 A;  1KQS S;  1YNZ A;  4M78 A;  4RKU E;  3HL8 A;  1VOM A;  1W2B A;  4HXJ A;  1BB9 A;  1AWX A;  1TSF A;  3SD4 A;  2K6D A;  4KRT A;  2DX1 A;  4B9X A;  2GTJ A;  1JXO A;  1RI0 A;  1U1T A;  1BIA A;  2DJQ A;  4XK8 E;  3FDR A;  2QXF A;  2MCN A;  3L2Z A;  4F7U E;  4LDV A;  5FU6 B;  4FU6 A;  3VUZ A;  3UA7 A;  1PD0 A;  3QG1 A;  2EQU A;  1AZE A;  4KUI A;  4C8Q B;  5CKF A;  3M53 A;  4J9C A;  1JO8 A;  3I9Q A;  2C0O A;  4QKU A;  2MI6 A;  1WXT A;  4IUT A;  3RMS A;  1G5V A;  3CCJ T;  2V1Q A;  2JNG A;  3NGP A;  2D0Q B;  4RTY A;  1D3B A;  5IAY A;  1WA7 A;  1M1K U;  1SHF A;  4ZTJ A;  2VGM A;  3QSU A;  2E6Z A;  4PJN A;  2EKO A;  2CP2 A;  1VQM T;  1TTH B;  3CXC S;  2BE7 D;  3VS5 A;  2AKL A;  4ME7 A;  5HKC A;  1YIT T;  2DER A;  4C0G A;  1NJI U;  2KDS A;  2E4H A;  4A4E A;  2GF7 A;  2X51 A;  1VIF A;  1MNE A;  1YIJ Q;  1VQ6 Q;  2NUZ A;  5CKE A;  1NYG A;  4N4I A;  1VQ7 A;  4PJO C;  3CCM Q;  4JPB W;  2EGC A;  2EQM A;  1M1K C;  2K3X A;  4RG2 A;  5GAM f;  1CSK A;  4J9G A;  5EC7 A;  3LLR A;  2DD5 A;  3TRE A;  1YI2 A;  1QCN A;  2I0N A;  4J9H A;  4XU3 A;  1PSE A;  1TUD A;  2M0O A;  4C92 D;  1VQN A;  2JMC A;  4HCZ A;  4OMO A;  1AWJ A;  4PLI A;  2DXT A;  2ESW A;  2BZY A;  2ZPI B;  1NJI C;  2LQN A;  4ELZ C;  3CME Q;  2GBQ A;  4OB0 B;  2AHJ B;  5CKB A;  1TG0 A;  1M3B A;  2DNU A;  4E7Z A;  4FYX B;  2FL7 A;  3JCM g;  4MML A;  1KC8 R;  1Q81 U;  5GMK h;  4FM4 B;  3X24 B;  3JCM Q;  3LGL A;  2DM1 A;  4NS5 A;  2IIM A;  4E7S A;  1UE9 A;  4Z02 A;  4OB1 B;  1Q82 U;  4EMG A;  3MP8 A;  2KRN A;  2ROT A;  1PRM C;  1K8A C;  2F69 A;  5GAM h;  1B7T A;  2RHZ A;  5IN1 A;  1FYN A;  4ZN1 A;  2K9G A;  4X9C A;  2D1X A;  4QQ6 A;  1UTI A;  3INZ A;  1P92 A;  4DOW A;  2OTL Q;  3QZ5 B;  3JB9 G;  4CC7 A;  3CCQ A;  1Q81 C;  1ACM B;  4BB7 A;  4II1 A;  4JRI A;  4KH1 B;  1U06 A;  1O9S A;  2CGH A;  1Q82 C;  1YBY A;  2LDM A;  2DE0 X;  3RR6 A;  3GIB A;  1B3Q A;  4A4F A;  2DL8 A;  2ROL A;  2DFU A;  3OS1 A;  4ELY C;  2AT1 B;  5GAN 8;  3CCR A;  2J6F A;  3Q1J A;  3OYF A;  3CC7 A;  1VQK T;  2KI7 A;  1HK9 A;  1PCX A;  3OYB A;  1SRM A;  4ZNX A;  4M75 G;  4E7H A;  5HK3 A;  1UEC A;  3CCS Q;  1N8R R;  2XDD A;  1BU1 A;  1F1B B;  1AT1 B;  4RTU A;  4FYY B;  1K76 A;  2HSP A;  3MEU A;  3CPW S;  2KYB A;  3OYM A;  3CMA Q;  4PJO F;  3S3O A;  2KSS A;  1RAA B;  3H41 A;  3VUB A;  4AFZ C;  3NFC A;  2RQR A;  2AKK A;  1ZX6 A;  2WSF E;  1S72 A;  3E9F A;  3SHW A;  4FIB A;  1JB0 E;  2HQH A;  3A8O B;  2JTM A;  3M55 A;  3VJP A;  4LN2 A;  3I55 T;  1VQL Q;  3C12 A;  3HRS A;  2RI3 A;  3MEA A;  3H9N A;  2VUB A;  4O6J A;  3EH1 A;  4OF1 A;  2BKD N;  3H6Z A;  4DA4 A;  3G6E A;  2KR3 A;  2YXY A;  3M57 A;  3M0T A;  3OW2 S;  4QQD A;  4E6R A;  2HBW A;  4F7U F;  2R57 A;  3PMT A;  5KE2 A;  2Z0W A;  4N0A C;  3I56 T;  4QVC A;  4PJO A;  2QG9 B;  5HCK A;  3JCM e;  5CQY A;  4OB3 B;  3CCL T;  1CKB A;  2C0T A;  1HSQ A;  3VS6 A;  4R0K A;  1XNI A;  3CCU A;  1NE8 A;  2XK0 A;  2R5M A;  1E6G A;  2DBM A;  1OZ3 A;  2QEX A;  1M2V A;  1VYT A;  1YHQ A;  3MET A;  3QII A;  3X28 B;  1H64 1;  2EQI A;  3J7A F;  1VQ5 A;  2CS7 A;  2O9V A;  5A0D A;  3GLX A;  1GCQ A;  3SWN B;  5IXF A;  4M7A F;  3M0U A;  4C8Q E;  5D6Y A;  1PG5 B;  2L3R A;  4M77 F;  2EVR A;  1JU5 C;  2BUD A;  3ME9 A;  2XMF A;  4F7U A;  1M8M A;  1PHT A;  1Y57 A;  4M7D D;  3EHQ A;  4X9D A;  2DVE A;  1B34 A;  3OYK A;  5IXB A;  2ZZD A;  2OX7 A;  2YDL A;  1QLY A;  2AZS A;  2W10 A;  1YHQ T;  5DM7 R;  3KXT A;  3CC4 A;  1D09 B;  1JJ2 P;  1QKW A;  3G4S T;  4BY6 B;  1GBR A;  2YUO A;  3EG2 A;  1U8R A;  2MMP A;  2LT1 A;  3MJX A;  4XTY A;  5LJ5 g;  4TVR A;  3UA6 A;  4L6V 5;  5C0M A;  2I2L A;  2EAY A;  3R6N A;  2DBK A;  1AWW A;  5FRN A;  2PTK A;  1W2B S;  1OUL A;  4M7A A;  1Q95 G;  5GAN 6;  1M9S A;  2E12 A;  4M77 A;  3M58 A;  1AHJ B;  4XU2 A;  3TU4 K;  4OB2 B;  2HKQ B;  3CC4 T;  3E1S A;  2M51 A;  2WAC A;  2RK1 A;  3EG0 A;  3OYD A;  2P0K A;  3A8L B;  1D1A A;  2Y90 A;  2RHY A;  4Z89 A;  2DEQ A;  2GFU A;  2CZ6 B;  1ZUY A;  2Y4X A;  2QA4 T;  2AIR B;  3JV3 A;  1OX8 A;  2VGN A;  4JRP A;  3FC3 A;  3OS2 A;  2JS2 A;  4M7A B;  3P8H A;  3M5A A;  4RCB A;  3CC2 A;  4PFZ A;  1WPY A;  2C0I A;  1VQ7 Q;  2QGG A;  2A3L A;  2HZY A;  1JJ2 A;  4MDX A;  4A4H A;  2JT4 A;  2YT6 A;  3HTR A;  2VKN A;  4FT4 A;  4C8Q C;  4OVA A;  5KYX B;  3I35 A;  1KHC A;  3CEY A;  4B6M A;  1YI2 Q;  2RJE A;  1GFD A;  2QQS A;  4FSS A;  1AOJ A;  5GAN 5;  5LJ3 f;  1PWT A;  1YJN A;  1VQN Q;  1YWP A;  4HVW A;  1ZLM A;  4J7F A;  3LX7 A;  3JCM f;  2M02 A;  4DBF A;  1MHN A;  1E6H A;  4OMF B;  2NUT B;  1YN8 A;  2RPN A;  4HT9 A;  1G3S A;  3SFM A;  5FU7 B;  5HY6 A;  5GMK m;  5CCA A;  2XD0 A;  3FJP A;  1PNJ A;  2A08 A;  5GAN 3;  3EG9 B;  3QWY A;  2K4Y A;  4RTT A;  4F16 A;  2RJF A;  3MP1 A;  2DXU A;  3RMQ A;  3VRY A;  1KC8 U;  1GL5 A;  5KYN A;  1PKS A;  1IRE B;  5D6W A;  1QVF A;  4XTV A;  4KUD K;  2A28 A;  2RD1 A;  4C92 G;  1DJ7 B;  4HT8 A;  5KH6 A;  3CCV A;  4J6X A;  4C0Z A;  2KT1 A;  4RG8 A;  3EG3 A;  4PJL A;  5AT1 B;  3JCM h;  1N5Z A;  2EGA A;  5LJ5 e;  3S3N A;  3PVQ A;  3RES A;  5IH2 A;  4M78 D;  2DJZ A;  4JJN K;  1KC8 C;  1BBZ A;  5IHN A;  3X26 B;  2KGT A;  3JB9 F;  2RQT A;  2B8A A;  2QAS A;  1HD3 A;  3JCM b;  2QYZ A;  3CCR Q;  3FRN A;  1MMG A;  1MMN A;  3NTH A;  3CC7 Q;  5GAO r;  2OTL T;  2DL7 A;  5FLX E;  1WGS A;  2EYW A;  3SEM A;  3HPW A;  2DLP A;  4J5Y A;  1IRX A;  1NPP A;  2EGE A;  1IB8 A;  3QYG B;  1UGP B;  1RAG B;  1X43 A;  3TQ7 P;  2JUF A;  1BI1 A;  3WXM B;  4B9W A;  1U1S A;  2CDT A;  4E7L A;  1ZHI A;  1X6B A;  5GAO m;  2LNH B;  2LVM A;  4EPC A;  1S72 Q;  2ATC B;  2HQE A;  2V8I A;  4Q5W A;  2HDA A;  2F2X A;  1X2Q A;  4IIM A;  1BIB A;  3DKM A;  2CZ7 B;  3JRZ A;  3CCS T;  4JJC A;  1YWO A;  3MPU B;  3A98 A;  3AHU A;  3G6E Q;  4ATO A;  3H8Z A;  5CK9 A;  9ATC B;  2XKO C;  1UB4 A;  4FYW B;  1FMV A;  2ZPE B;  4JRQ A;  3CBM A; 
#chains in the Genus database with same CATH homology
 3I55 Q;  1KD1 R;  3G71 Q;  3G4S Q;  3CD6 Q;  1NJI R;  3CCJ Q;  1QVG P;  3CC4 Q;  3CCL Q;  1YI2 Q;  1JJ2 P;  1K73 R;  1VQ8 Q;  1K8A R;  1KC8 R;  1VQL Q;  1YJW Q;  3CXC P;  3CCE Q;  1YJN Q;  1VQ9 Q;  1VQK Q;  1YJ9 Q;  1M1K R;  3CCR Q;  1VQN Q;  1VQP Q;  1Q82 R;  2OTL Q;  3G6E Q;  3CCU Q;  3CMA Q;  3CC2 Q;  3CC7 Q;  3CCQ Q;  1YIJ Q;  1VQ6 Q;  1Q7Y R;  2OTJ Q;  1W2B P;  1VQO Q;  1VQ7 Q;  3CPW P;  1K9M R;  2QEX Q;  1S72 Q;  3CME Q;  1KQS P;  1VQ4 Q;  1M90 R;  1VQM Q;  3CCM Q;  1YHQ Q;  3I56 Q;  2QA4 Q;  1Q86 R;  3CCS Q;  1N8R R;  1QVF P;  3OW2 P;  1VQ5 Q;  1Q81 R;  1YIT Q;  3CCV Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...