3CCQQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488u
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccqQ00
3CD6Q 3G71Q 1VQLQ 2OTLQ 3CCLQ 1YITQ 1QVFP 3OW2P 1VQMQ 3G4SQ 3CPWP 1NJIR 1VQ4Q 1Q81R 1Q7YR 1W2BP 1N8RR 1K73R 1KQSP 1VQ9Q 1K8AR 2QA4Q 2OTJQ 3G6EQ 3CCQQ 1YHQQ 1KD1R 1VQ8Q 3I56Q 3CC4Q 1YI2Q 1S72Q 1JJ2P 1VQKQ 3CMEQ 3CCRQ 3CCVQ 3CC7Q 1VQNQ 1VQPQ 1Q86R 3CMAQ 3CXCP 1Q82R 3CCSQ 3I55Q 1M90R 3CCJQ 2QEXQ 3CCUQ 1K9MR 1QVGP 1YJWQ 1VQOQ 1YJ9Q 1VQ6Q 1M1KR 1KC8R 1VQ7Q 3CC2Q 1YJNQ 1YIJQ 3CCMQ 3CCEQ 1VQ5Q
chains in the Genus database with same CATH superfamily
5AT1B 2QGGA 1BKBA 1LVKA 2VYTA 2KBTA 4JUVA 4CI0C 4C92G 2ZPEB 1VQ5A 1K8AR 2KE9A 2QTVA 4M78D 1KJWA 4JS4A 1D3BA 2JOYA 3UATA 1BI1A 1NYGA 1UGVA 1M5Q1 3CC4A 3WXMB 3GBQA 4E7KA 2FEIA 3EGUA 3CMET 4DA4A 4LDUA 3UWNA 1PNJA 1OX9A 1BI2A 2KYBA 3RKWA 3TCJA 3REAB 3CBPA 3M9QA 3C4SA 4XK8E 3SWNA 1CKAA 1UB4A 3QYGB 1YHQQ 2GF7A 2KNBB 2E41A 3JAME 5GAOp 1UUEA 1W70A 4F16A 1N8RU 1M90R 3TU4K 5CKHA 2EVRA 3ER0A 1RI9A 4M4ZA 4CC3A 4RTWA 1SF9A 4AG2C 1OULA 3CCMQ 2DRMA 2LJ1A 1IHWA 5GAOl 1Q86U 3OW2P 2RQTA 2COZA 3CD6T 4XU1A 4P5NA 3OYNA 4LDWA 4J6WA 4HCZA 4QQDA 2FG0A 5CKDA 2BE7D 5GANe 1N9SA 2DIQA 3V7CA 1BYMA 4LDVA 3WVEB 1QKXA 2COWA 3MPUB 2XG8D 3QDFA 1M1KU 1OPLA 3CCEA 4M75A 2RI5A 5KYXB 2GNCA 4C8QC 3ZBDA 2AHJB 2BZYA 2LCCA 2LX9A 1UJYA 2O4XA 3HPWA 2KR3A 3VS2A 2GBQA 2KT1A 2EQUA 2RK1A 3LH5A 3ZFJA 2DERA 1VQOQ 4OMFB 1JRIA 1YCYA 2XICA 2R5MA 2VVKA 3NGPA 1H92A 1X43A 1SSHA 2HBPA 3QWXX 1WX6A 3JCMW 2RHZA 1VQ5T 3VS5A 5D6YA 4MZMA 2VB6A 4RCBA 1RACB 4M78F 2CUBA 4EMKB 5LJ5h 2L0AA 5LJ3e 1I0CA 1CSKA 5GMKl 1TSFA 1O9SA 3CC4T 3NHNA 4QW2A 3VUBA 1I07A 2HKQB 4RG8A 2EQMA 3LWHA 2JM9A 1IRXA 1YJWA 1YJNA 3SD4A 1B7TA 3AHUA 3JB9J 3CXCA 2BZ8A 3UDCA 1ZBXA 2ZCFB 2R5AA 2O9VA 2QQ9A 1KG1A 2FPDA 1AWWA 4NS5A 2K3XA 2E12A 4ZN3A 3M0UA 4FIBA 2EIFA 3REBB 1QLYA 3FJPA 4QVCA 1NLPC 3BDLA 3VS0A 1IHVA 1ARKA 4FSXA 4FT2A 4PJMA 4A63B 1YJ9A 1M90U 1Z9QA 1TTHB 3CCET 2DNUA 3QG1A 2IIMA 5GAOr 2CP0A 1I81A 1IO6A 1ZUYA 2EYQA 2RF0A 3JV3A 4HKEA 3FC3A 2RQUA 4VUBA 2MI6A 2CH4W 3QJYA 3CC2Q 1JU5C 1K0XA 3A8LB 4M77B 3OYGA 2OTLQ 3BFMA 4N0AC 2CZ0B 2RJFA 4M7AC 1W2BA 4F7UF 2FB7A 3U23A 2X9HA 4ZTJA 1D0XA 2Y90A 2DA9A 4QQ6A 3CC7Q 2F2XA 5HK0A 5IHKA 2EFIA 1YHQA 2DBKA 3QYHB 1N27A 1I1JA 1K76A 3CCRA 1D1BA 4OB1B 4X9DA 3H8ZA 3QBYA 2ZPHB 1YJWT 2E64A 4JJBA 3CCMA 4B6MA 2QDYB 2MOXA 2QA4Q 4C0GA 4C0DB 5EG2A 1Y71A 4X9CA 1I5OB 4C5HA 2FRYA 2J05A 1D0ZA 3M53A 2JUFA 2BUDA 1T0HA 4Y28E 3VS7A 4LNPA 1W6XA 5M9OA 2CT4A 4WTOB 1X27A 3LGFA 2J7IA 2LVMA 3QPHA 3EG9A 3G6EQ 4AT1B 2GFAA 5D6WA 4A53A 1OZ3A 2A28A 1YI2Q 1VQ4A 4J7IA 1QQJA 1N8RC 4ANJA 2CZ1B 2VGMA 1UGRB 1QVGA 3A8GB 2KGTA 3S3MA 1Q95G 2HQXA 1K0SA 8ATCB 1WQ7A 1Q86C 2KROA 4HT9A 1YJ9T 1VA7A 1XJWB 3OYIA 2HDAA 3JCMf 3OMCA 3CCLA 1VUBA 1JB0E 1RADB 2HSPA 2QGFB 4XTZA 3JCMQ 1VQNQ 3FDRA 1Y0MA 4C92B 1PSEA 1Y96A 4J5YA 3M54A 4NL2A 2DJQA 2DL8A 1AWOA 2YUPA 2RB6A 1M2VA 1HK9A 1G2BA 1M1KC 1X75C 3JB9H 1PHTA 1GFDA 2PVDB 5DM7R 3I35A 5EC7A 3CXCS 1T0JA 2V26A 5DLOA 2CUDA 2HL5C 3CCJQ 2C0TA 1YHQT 3X20B 1Y07A 4QQGA 2LCSA 3OYJA 3CCRT 3OS0A 2RI2A 2C06A 4EMKC 5A0DA 3M59A 3CCMT 4M78E 2RNAA 4PJLA 2K3YA 1JJ2P 4JRKA 1NEBA 2EKHA 2WSCE 5KYYA 2PUKB 3UA7A 4PLIA 2QDLA 5GAMe 4OMNA 4JZ3A 1D1AA 2ED1A 5I22A 2FRWA 3MP8A 4BY6C 5GJVB 3V7SA 4AFUC 4AMCA 4E7ZA 2D8JA 3PGGA 2YT6A 3TEEA 2P84A 1VQ4T 4AFZC 1Y57A 4KGVB 2K2VA 1X6OA 3INZA 4PFPA 2E3IA 3CCVA 3GOXA 2EYYA 4FU6A 2E3HA 2MF2A 2KI7A 1D0YA 2F69A 1OV3A 1G3WA 1W2BS 3CC2A 2HEQA 1UGPB 3WVDB 5C6SA 3OS5A 4BUGA 2OTLA 3M55A 3CCLT 2NUPA 4PJOA 5HCKA 3P8DA 5GANf 3JCMd 2E6NA 3KUFA 2EBPA 4C8QB 3PMIA 3CC7A 2RH2A 4Y91A 1F1BB 4E7JA 2ROTA 4OMMA 1M90C 5C0MA 3QDRB 5FROA 2M9UA 3X26B 1OYXA 2X4WA 1M1FA 3M56A 3N5BB 1OPKA 2DMOA 1KD1R 4ZN1A 4D6WA 5KH6A 3HRSA 3L2QA 2DXCA 4N4IA 1Q7YU 3VKIA 2CP6A 4M77C 2FO0A 4F7UA 2JMAA 1NLOC 1YIJQ 2DLPA 1FMKA 2HZYA 3OW2A 3CQTA 2FHDA 2ECZA 1YNZA 1N8RR 1VQ9Q 1M2OA 2J6FA 2RQRA 2VV5A 2M0YA 5FU7C 5LJ3f 4A4FA 3G6EA 5GAN3 1G83A 1RLPC 2QQAA 4HA8A 3RMSA 1YI2A 2FZGB 4HVUA 1OU9A 3L2WA 1NPRA 3EFRA 2XMFA 1VQLQ 5J39A 3JB9F 2LQ8A 5J26A 3PE0A 1M3CA 2ZPFB 3RBBB 3IQLA 1JQQA 1VQPQ 1X69A 3OYFA 4A4EA 3RESA 1IGUA 5GANg 4M7AF 3PT9A 3FJ5A 1M1KR 1P92A 3EGXA 3JSCA 1VQNA 3CCVT 3RUXA 2DL5A 2PNIA 4E47A 1QVFP 3QWYA 1NE8A 1JEGA 2K3BA 3CC2T 1HYOA 2JT4A 4R0KA 5A2QE 3C0CA 2JM8A 4LD9K 1WGSA 1PM3A 3L1AA 3HHTB 1QWFA 4X1VA 3EFOA 1HD3A 3OYYA 2XD0A 1NG2A 2EJFA 1EZZB 2LDMA 3CC7T 4J9EA 2HAXA 1WQWA 4F14A 5GANd 3CCJA 2QEXA 2NYSA 3MEUA 1U1TA 2XU8A 1MNEA 2YRVA 2JVVA 4XTYA 2LRQA 3OYMA 4MDXA 5LJ3g 3OYAA 1QVPA 4C92C 3CMAQ 1LJOA 2K5IA 2EYWA 3UA6A 1G3SA 1G5VA 1OQKA 2DILA 2LC4A 1M30A 1VQ7A 1WA7A 2F2VA 1WHLA 1ZA1B 4XU3A 5GAN5 4JS5A 1SEMA 4O5VA 3HFOA 2BZXA 2EYZA 3G6ET 1WZOA 3J81E 4RTYA 1YI2T 2P0QA 5LJ3d 3OSVA 2IPOB 1KD1U 4IIOA 4DOWA 1KQ2A 2X35A 4M7DC 2L3QA 2D1XA 2F5TX 3I55A 3HL8A 1MV0B 1ZSZC 3MEWA 2K2MA 2FZCB 2RK2A 3JCMh 3FB9A 1TG0A 2DAQA 3I5RA 1U5SA 3VU3C 1VQMA 4C8QA 2CH4A 1N5ZA 4PJJA 4M7DG 4EPCA 2ABLA 4XQ3A 1NEGA 4A54A 5GMKi 3VYGA 1VQNT 2RA2A 1VYUA 3G71Q 4FYYB 1H8KA 1WHMA 4JLIA 4JRQA 4Z89A 4M77D 1J3TA 1BBZA 4FCYA 2YRDA 1TS9A 2L3PA 3EGDA 4IUUA 1OU8A 2DZ9A 2ESWA 2CS7A 2XHCA 4KUDK 3LGLA 2AIRB 3LYIA 4J9DA 4C5GA 5LJ5e 2O9SA 2NWMA 3OS1A 3OYDA 3L42A 4BI3A 2E4HA 4PJOD 2E70A 3OW2S 3OSSC 2YUNA 2QEXT 1X01A 5CVIA 1TH7A 1YIJA 1VIEA 3PNWC 4QT7A 3RDVA 2SRCA 4M75E 1VQ9A 1K73U 4A4HA 5AYFA 3O8VA 2LQWA 1M3BA 1GRIA 3LWIA 2JN0A 4HCKA 2OI3A 1VQ7T 1KQSA 1O75A 2K9GA 1IB8A 1VQLA 2CREA 3EH1A 1G3YA 1Q7YC 2DKGA 1UGQB 2H8HA 3UT1A 4LUDA 3M57A 2YDLA 3TQ7P 3TVTA 1JXOA 2DE0X 3I55T 4RKUE 4PL6A 3CPWA 1YITQ 1X6GA 3OY9A 2KK4A 4OGEA 2KAFA 2CP2A 3EHQA 3RR6A 4B9WA 2P4RA 4RTVA 1QCFA 2E5KA 4JLGA 2DYIA 1VQMT 3LW5E 2A0FB 2RQVA 4BY6B 5GAOm 1I8FA 3LLRA 2QYZA 1WNLA 2YUQA 1PRLC 2EGAA 1AT1B 4OB0B 5L8RE 5GAMf 5I11A 3VS3A 2M16A 3H6ZA 2DXBA 3FLGA 1QMCA 4JJDA 4CC7A 2YXYA 4M75C 2IVWA 3HP9A 2BIVA 4N0AA 4M7AA 4M77F 1BB9A 4MZTA 1RAFB 3UPUA 2HQHA 3I56Q 1B34B 2DK3A 1S72Q 2KMTA 3TREA 1C0MA 3QO3A 2E1HA 4J6XA 1LPLA 1PD0A 4QKUA 1WHHA 2X3XD 1WJQA 3A8OB 4M75G 1OZ2A 3CMAA 3MJXA 2RJCA 3PVQA 4DOVA 4PJOF 1TXQA 2QXFA 4RG2A 2JTFA 3T9NA 2YWWA 3MP1A 3PIPA 4PNOA 4IUTA 1V1CA 1VQ9T 2RN8A 2DPPB 2RHXA 2DETA 2R57A 2XDBA 4LDYA 4KGXB 4C0FA 5FLXE 2DJZA 7AT1B 1LNXA 5GMKm 1VQLT 5GAOn 4QVZA 4HXJA 3BY7A 1IZ6A 2ZPGB 3L2VA 3VS6A 4E7HA 5FU7B 1HJDA 3J7AF 3LH0A 4DQ2A 5GAMg 4OB3B 4IKFA 1M1GA 1KK7A 1Q82U 2A08A 1YJNT 4L5GA 4J9GA 3HRUA 1SRLA 2HNIA 3G71A 2DVJA 3I5SA 3QZ9B 1FMWA 5FU6C 5HY6A 2KRSA 2VWFA 1KQ1A 5A0GA 1YCSB 1FMVA 2G3RA 5CQYA 4QVDA 5GAN7 4PLLA 3JCMb 2GQIA 1KD1C 1PSFA 4C8QD 2MAMA 3VUZA 2P4TA 5KYXA 2VC8A 4C92F 5GAMd 1MUZA 5GJWB 3H0IA 3SEMA 2CT3A 5CKEA 2Y4YA 5A0LA 1VQKQ 4WCIA 1I5LA 2KY9A 4RTXA 3QJ6A 2DF6A 1KC8R 4KUIA 3LX7A 2YLCA 2V8IA 3R6NA 1UHCA 1RABB 1M27C 1VQOA 1Q7YR 1KQSS 3HSBA 3V8KA 2CP3A 2QK0A 4EMKA 2EGEA 5KYUB 2K5FA 1ACMB 3CMEQ 4ELZC 4JJNK 1G8XA 2KXCA 2DXTA 1HXDA 5J3BA 1LOJA 4JJCA 2DD4A 4F04B 4F17A 1QP3A 3RIRA 3CPWS 1E6HA 2VASA 2XDDA 3F70A 1IGQA 3KFVA 4RUGA 1EX4A 1YITA 2LX7A 2WSEE 4J9CA 4LDXA 3A5ZB 1A0NB 3CXCP 1K73C 5KYNA 2D6FA 1KHIA 1R8OB 4HT8A 3CD6Q 3C95A 5KCOA 3EG2A 4DEYA 1ZSGA 1B34A 2MCNA 4J8OA 3L2UA 2C0IA 3FRNA 1XTDA 4BDYA 4M7DB 2CP5A 4MMLA 4RTZA 1PG5B 1ZSZB 1BCOA 1NYFA 2J06A 2LT4A 2RI3A 3GIBA 3I56A 1M9SA 4OMQA 2L89A 4PJNA 4XTWA 3JB9D 2MIOA 4C8QF 5CKFA 3M0SA 4ZGDB 3OYCA 1SRMA 4EMHA 1TOVA 4FSSA 1VQ8Q 3META 2QASA 2ZPBB 3EG0A 2KXDA 4M7AD 3MO8A 4M77A 2RQWA 3OBWA 4CC2A 2YHTA 5IT9E 3VV0A 1TWBA 3NTHA 4LN2A 2VXEA 4RTUA 1PRMC 1VQOT 1XNIA 1UDLA 1W2BP 5FWCA 1BIBA 3BDUA 2YUOA 3MHXA 4E7IA 4FYVB 2V8JA 5LJ5f 1D3BB 3EG1A 2KEAA 2YLBA 5GAN8 4M78C 1M8MA 2B8AA 5I2SA 4PJOE 4RCCA 3KBGA 4J83A 2AKLA 1GBRA 3G7ZA 3EHRA 2GTOA 3M0QA 2LNVA 1VIFA 2BE9B 1KC8U 2HD0A 4FYXB 1K9AA 3P8HA 3SWNB 4M78G 2D0QB 3CCSQ 3H41A 2JNGA 2QA4A 5GAMh 1WI7A 3VJPA 2JTMA 2BTTA 5GMKe 2K7AA 2LJ0A 1V76A 1JBMA 2PZ1A 4F7UE 1OEBA 4J9HA 5KYWB 2EPDA 2Z0WA 1SHGA 3URGA 4FL6A 3ZEHA 4OB2B 1RUWA 4ATOA 3S6WA 2XK0A 2CDTA 5L23A 2DM1A 4ZGJB 2G6FX 2QTXA 1QVGP 3I56T 1VQKA 1OOTA 4A4GA 1Q82C 4LXCA 4E7LA 1H641 3CPFA 4NOYA 3V8LA 1M8VA 4M75B 4BI8B 3M58A 4Z88A 3GNGA 5LJ5g 2LZ6B 2CYZB 4C92A 2NLUA 3GP8A 2PVGB 2O4XB 1ABOA 3J80E 4II1A 2VXFA 3M4GA 2W10A 3HKSA 4PJOG 1WXBA 2V8KA 2ED0A 4BI4A 2ZZDA 4E6RA 2COYA 2DTOA 1K73R 2OTJQ 3VYHB 2F1LA 4KRTA 4L59A 2AZVA 2OTLT 4MMKA 3M4YA 1GCQC 2EW3A 2JZ2A 4J7FA 4EDUA 3X25B 2ATCB 2W0ZA 1NPPA 1ZUUA 5LJ5d 1D1CA 3OB9A 4AG1C 4DEXA 1WYXA 2HKNA 4OP0A 2RPNA 3SHWA 4M7DA 4XU2A 4IIMA 4NL3A 4AFSC 4KT0E 1ZSZA 3CD6A 5IHIA 4F7UG 2RJEA 1ZA2B 1AWJA 1WHKA 2NUZA 3V7RA 5GANj 4FW1A 1CKBA 4RTTA 3X24B 5KE2A 2DTIA 3NPFA 1UGSB 2QA4T 3A8HB 1QP2A 4GBQA 2VUBA 2FPFA 1XOVA 4BACA 1NBEB 2AK5A 4TVRA 3CBOA 2EJGA 2CGHA 2DXUA 2GFUA 1WJSA 2RHIA 1NZ9A 4JZ4A 2HL3A 2F5KA 5CO7A 1TU0B 3FIFA 2GGRA 2VGNA 5KCHA 1VQ8A 4FW2A 1VQKT 2QQSA 5FU6B 5IHNA 3OYLA 3VS4A 5GAN4 1X2QA 1OI1A 1PD1A 1YN8A 2M0OA 1C6VX 1K9MU 2KQWA 2M51A 3DB3A 5FRMA 5LJ3j 4FM4B 1QCNA 2E5QA 1H3ZA 1R0CB 1MGQA 4OGCA 2HSEB 3TSZA 4C8QE 3C12A 4Q5WA 4CC4B 1V29B 1W4SA 4HVVA 3OMGA 2D0NA 2HBWA 5CQXA 1ABQA 1ZHIA 3EAEA 1ZX6A 1UG1A 2WSFE 5IXFA 2E10A 3CCRQ 1W1FA 2RM4A 3A8MB 1Q81C 4X34A 3NMZC 2JS0A 3RERA 1PKTA 1YWOA 5KYWA 3RKYA 3CCSA 3QIIA 2DTHA 3H0FA 3CCJT 2KVQG 2J6OA 2GQVA 1D09B 2DD5A 4MZPA 1GL5A 1LCKA 2X51A 5DY9A 2HMAA 1BCMA 4C5IA 1Q82R 2MK5A 1SHFA 1ZBJA 3M0TA 1IREB 2CSQA 1QW1A 3UF4A 3PTAA 3PMTA 5IN1A 3MEAA 3PIOA 1K1ZA 3OA6A 2DEUA 2IG0A 4N4HA 1MHNA 3THKA 4V2SA 1VOMA 1VQ4Q 5CR2A 4Z02A 4ORZA 1PCXA 3SWNC 1QKWA 2LCLA 4A4KA 3JRZA 1KC8C 2V1QA 3A1PA 4FT4A 4DBQA 5GAN6 1XQHA 1GBQA 2DL3A 1U3OA 2K57A 2PQWA 3EG9B 1M4ZA 3GNFB 3H0HA 3CCUQ 1VQ8T 2MYSA 1GXIE 4OMOA 2LNHB 5D7UA 4D8KA 1X6BA 2X3WD 4LD6A 3JCMP 1VQPA 1ZQ1A 2RO0A 2GCXA 3O5ZA 4C8QG 3OYKA 3CCLQ 1KIKA 1Z9ZA 3DLLA 2L3SA 2DX1A 2KT8A 4J6YA 4GLMA 3X28B 2CKKA 4XAXB 1SSFA 4KGZB 1NJIU 3P8BB 2QQBA 2X4YA 2DL7A 2WACA 2DBMA 3NFCA 2I0NA 2OTJA 5GANh 4BDZA 3A98A 1X2KA 2J6KA 4YTLA 4C92D 3OYHA 1Y96B 1DJ7B 1UJ0A 4J9IA 4DBFA 3DB4A 3CCQQ 4JRPA 1M2VB 3QUIA 1TUCA 2F2WA 3RMQA 1AWXA 4M7AE 1WPYA 3L2RA 1K8AU 2EKOA 2CSIA 3R6OA 1WXUA 3M0PA 4JRIA 1E7OA 3CCST 4OF1A 2K79A 2JXBA 2OX7A 1UECA 3VRYA 3VRZA 2H3JA 3VS1A 4M78B 1YIJT 3HRTA 1BK2A 2HQEA 2KYMA 3L2ZA 1JJ2A 4M7DD 5I21A 4Z8AA 2DO3A 5LJ3h 3HFNA 1EIFA 3S3NA 2ZGWA 3ASKA 2X4JA 2OJ2A 4XU0A 2K6DA 1U1SA 2M1HA 1VQ6Q 3ME9A 4N4GA 5KYYB 4O6JA 2XIDA 2O01E 1T3LA 3PFSA 4BD3A 2V1RA 5CK9A 4ZNXA 2DEQA 5I2MA 1YBYA 2EQKA 3QKJA 4L6V5 3CCVQ 1OX8A 3H9NA 4ME7A 2PVOB 3OBYA 1KSWA 4KH0B 4XTVA 6AT1B 1VQPT 3G4SQ 3JB9G 1WIEA 1Q81R 3RKXA 1SKUB 1PWTA 3MP6A 3I9QA 1NM7A 5GAOq 1C1AA 4WF2A 4R56A 2PU9B 2HCKA 2OTJT 2NUPB 4PJOB 4M7AG 2QQRA 5ECAA 3BE3A 4E2FB 2O2OA 1HSQA 3DLMA 1U8RA 1K9MC 1WLPB 2YRCA 3D7SB 1GFCA 2ZPIB 1WXTA 5FWBA 2L3RA 1I4K1 2DYBA 2Y4XA 3EFSA 2P0PA 2RD1A 3C94A 5GAMj 2NUTB 3OYEA 2K4YA 4IUQA 3DKMA 2BKDN 1BI0A 3S3OA 3CMAT 4F7UB 4FYWB 4D8DA 3EH2A 5IH2A 1RLQC 1AHJB 4GY5A 2PUOB 1YFNA 3BW1A 1KQSP 2A36A 2E6ZA 2XKOC 3HTRA 1UTIA 3M5AA 1MMNA 2MWPA 3KXTA 5IXBA 2R58A 4M7DF 2JTEA 3JCMX 1PC0A 3E9GA 4Y92A 2DIGA 2KRNA 2OAWA 3CCUA 3CPWP 1R77A 2O31A 5GAN2 1B07A 2ENMA 4PFZA 2RMOA 5KE3A 2AZSA 2I2LA 4AFQC 2A3LA 4GLKA 2DRKA 4M75D 1AD5A 2DVEA 1AZGB 9ATCB 3JCMV 1RAEB 2L5QA 2JS2A 1RI0A 4R55A 2VKNA 1RAGB 3V8JA 1QVFA 2L8DA 3EGXB 2LQKA 1YWPA 1BU1A 1WDXA 1T3SA 2YSQA 4PKCC 2EQJA 3G71T 2P0KA 3OQ5A 1S1NA 1BI3A 4K11A 5GMKj 1UE9A 2QEXQ 3CCQA 3E9FA 4DBRA 2XI9A 3Q1JA 2A7YA 3EFOB 1S72A 1WJRA 2LJ3A 4M78A 1WHJA 1VYTA 2O88A 1SPKA 1QCOA 1AOJA 1JJ2S 3FEOA 1RAAB 3QZ5B 1FX7A 1GCPA 1NJIC 4LUEA 2ROLA 1U06A 4EIKA 4BE1A 4CRIA 1Q81U 4HCBA 3GF5A 2EWNA 2PTKA 4IUVA 5CIUA 1VQ7Q 1VYVA 3E1SA 1VQ5Q 4EMGA 1KFZA 4M77E 1VQ6A 2XDPA 1FXXA 1TUGB 5DLQE 5CAIA 1BIAA 2FZKB 3CEYA 3JCMg 3MCAB 1AEYA 1UFFA 3CC4Q 3JCMc 4ELYC 2CZ7B 2SEMA 2CZ6B 3I55Q 2AT1B 1K8AC 1MMDA 2ZAEA 4ZGEB 3NTKA 2KRMA 4PFOA 3CCUT 1Y7XA 2AKKA 3AT1B 3RNJA 1VQMQ 5FW9A 1WHGA 5LL6S 3GLXA 1UEBA 3EG3A 1M3AA 4OMPA 4LE9A 2OAUA 3GPLA 3G4SA 1YITT 1K4US 1JXMA 1N9RA 4DBHA 5FRNA 3ULRB 1RAIB 1IXDA 1WFWA 5D6XA 2K5LA 1K9MR 4M75F 2KDSA 3OS2A 2JW4A 3OYBA 4XTXA 1MV3A 1H3HA 2FL7A 1FWZA 5CKBA 4B9XA 4C5EA 2FPEA 2LP5A 2MPXC 1B3QA 3E19A 4PK4A 1ZUKA 1G3TA 3EGDB 2NUTA 1UHFA 2DZCA 2LT1A 1GCQA 3CCQT 3SB2A 5IAYA 4E7SA 8AT1B 1S72T 3QXEB 3CCEQ 2EJ9A 4OVAA 5KYUA 2MWOA 2DL4A 3ZL7C 2LTOA 4OMLA 2CP7A 4M77G 1KHCA 4PJOC 1Q86R 4HVWA 4UC4A 3SFMA 2QI2A 1QVGS 2LMJA 1MNDA 3CBMA 1PKSA 4KBMB 3CMEA 1YP5A 1R0BG 3NTIA 4C0DC 4C92E 5HK3A 2EQIA 4KULA 2D8HA 2QG9B 3MEVA 1RL2A 1VQ6T 1MMAA 2B86A 3PVLA 2L2PA 2M02A 5HKCA 3JB9I 3TSWA 4J9FA 1RAHB 5GMKh 1YJWQ 2KSSA 4ZTFA 1YJNQ 4JPBW 1AZEA 3E2UA 4KH1B 2DFUA 3JCMJ 1SG5A 4ESRA 1QVFS 2C0OA 2D9TA 2EYXA 3QHSA 2H3EB 1TUDA 2FVUA 4BE2A 2FYKA 2EGCA 1AVZC 4RMOA 4IURA 4M7DE 2QAZA 3G4ST 5LJ5j 3JCMe 3SDZA 4BE0A 2E65A 4MDWA 1N6AA 3MKDA 4J9BA 2JJ9A 2MMPA 4HCCA 2GTJA 4C0ZA 2RHYA 1NJIR 2LQNA 4BB7A 3QSUA 3G1JA 1MMGA 1ZLMA 1E6GA 3M0RA 5CCAA 4M7AB 1JO8A 1FYNA 2A37A 2X4XA 1QWEA 4IUPA 2EAYA 2RHUA 2RJDA 1YJ9Q 4XTUA 1EFNA 2JMCA 4JDSA
chains in the Genus database with same CATH topology
3CD6Q 3G71Q 1VQLQ 2OTLQ 3CCLQ 1YITQ 1QVFP 3OW2P 1VQMQ 3G4SQ 3CPWP 1NJIR 1VQ4Q 1Q81R 1Q7YR 1W2BP 1N8RR 1K73R 1KQSP 1VQ9Q 1K8AR 2QA4Q 2OTJQ 3G6EQ 3CCQQ 1YHQQ 1KD1R 1VQ8Q 3I56Q 3CC4Q 1YI2Q 1S72Q 1JJ2P 1VQKQ 3CMEQ 3CCRQ 3CCVQ 3CC7Q 1VQNQ 1VQPQ 1Q86R 3CMAQ 3CXCP 1Q82R 3CCSQ 3I55Q 1M90R 3CCJQ 2QEXQ 3CCUQ 1K9MR 1QVGP 1YJWQ 1VQOQ 1YJ9Q 1VQ6Q 1M1KR 1KC8R 1VQ7Q 3CC2Q 1YJNQ 1YIJQ 3CCMQ 3CCEQ 1VQ5Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 Q;  3G71 Q;  1VQL Q;  2OTL Q;  3CCL Q;  1YIT Q;  1QVF P;  3OW2 P;  1VQM Q;  3G4S Q;  3CPW P;  1NJI R;  1VQ4 Q;  1Q81 R;  1Q7Y R;  1W2B P;  1N8R R;  1K73 R;  1KQS P;  1VQ9 Q;  1K8A R;  2QA4 Q;  2OTJ Q;  3G6E Q;  3CCQ Q;  1YHQ Q;  1KD1 R;  1VQ8 Q;  3I56 Q;  3CC4 Q;  1YI2 Q;  1S72 Q;  1JJ2 P;  1VQK Q;  3CME Q;  3CCR Q;  3CCV Q;  3CC7 Q;  1VQN Q;  1VQP Q;  1Q86 R;  3CMA Q;  3CXC P;  1Q82 R;  3CCS Q;  3I55 Q;  1M90 R;  3CCJ Q;  2QEX Q;  3CCU Q;  1K9M R;  1QVG P;  1YJW Q;  1VQO Q;  1YJ9 Q;  1VQ6 Q;  1M1K R;  1KC8 R;  1VQ7 Q;  3CC2 Q;  1YJN Q;  1YIJ Q;  3CCM Q;  3CCE Q;  1VQ5 Q; 
#chains in the Genus database with same CATH topology
 5AT1 B;  2QGG A;  1BKB A;  1LVK A;  2VYT A;  2KBT A;  4JUV A;  4CI0 C;  4C92 G;  2ZPE B;  1VQ5 A;  1K8A R;  2KE9 A;  2QTV A;  4M78 D;  1KJW A;  4JS4 A;  1D3B A;  2JOY A;  3UAT A;  1BI1 A;  1NYG A;  1UGV A;  1M5Q 1;  3CC4 A;  3WXM B;  3GBQ A;  4E7K A;  2FEI A;  3EGU A;  3CME T;  4DA4 A;  4LDU A;  3UWN A;  1PNJ A;  1OX9 A;  1BI2 A;  2KYB A;  3RKW A;  3TCJ A;  3REA B;  3CBP A;  3M9Q A;  3C4S A;  4XK8 E;  3SWN A;  1CKA A;  1UB4 A;  3QYG B;  1YHQ Q;  2GF7 A;  2KNB B;  2E41 A;  3JAM E;  5GAO p;  1UUE A;  1W70 A;  4F16 A;  1N8R U;  1M90 R;  3TU4 K;  5CKH A;  2EVR A;  3ER0 A;  1RI9 A;  4M4Z A;  4CC3 A;  4RTW A;  1SF9 A;  4AG2 C;  1OUL A;  3CCM Q;  2DRM A;  2LJ1 A;  1IHW A;  5GAO l;  1Q86 U;  3OW2 P;  2RQT A;  2COZ A;  3CD6 T;  4XU1 A;  4P5N A;  3OYN A;  4LDW A;  4J6W A;  4HCZ A;  4QQD A;  2FG0 A;  5CKD A;  2BE7 D;  5GAN e;  1N9S A;  2DIQ A;  3V7C A;  1BYM A;  4LDV A;  3WVE B;  1QKX A;  2COW A;  3MPU B;  2XG8 D;  3QDF A;  1M1K U;  1OPL A;  3CCE A;  4M75 A;  2RI5 A;  5KYX B;  2GNC A;  4C8Q C;  3ZBD A;  2AHJ B;  2BZY A;  2LCC A;  2LX9 A;  1UJY A;  2O4X A;  3HPW A;  2KR3 A;  3VS2 A;  2GBQ A;  2KT1 A;  2EQU A;  2RK1 A;  3LH5 A;  3ZFJ A;  2DER A;  1VQO Q;  4OMF B;  1JRI A;  1YCY A;  2XIC A;  2R5M A;  2VVK A;  3NGP A;  1H92 A;  1X43 A;  1SSH A;  2HBP A;  3QWX X;  1WX6 A;  3JCM W;  2RHZ A;  1VQ5 T;  3VS5 A;  5D6Y A;  4MZM A;  2VB6 A;  4RCB A;  1RAC B;  4M78 F;  2CUB A;  4EMK B;  5LJ5 h;  2L0A A;  5LJ3 e;  1I0C A;  1CSK A;  5GMK l;  1TSF A;  1O9S A;  3CC4 T;  3NHN A;  4QW2 A;  3VUB A;  1I07 A;  2HKQ B;  4RG8 A;  2EQM A;  3LWH A;  2JM9 A;  1IRX A;  1YJW A;  1YJN A;  3SD4 A;  1B7T A;  3AHU A;  3JB9 J;  3CXC A;  2BZ8 A;  3UDC A;  1ZBX A;  2ZCF B;  2R5A A;  2O9V A;  2QQ9 A;  1KG1 A;  2FPD A;  1AWW A;  4NS5 A;  2K3X A;  2E12 A;  4ZN3 A;  3M0U A;  4FIB A;  2EIF A;  3REB B;  1QLY A;  3FJP A;  4QVC A;  1NLP C;  3BDL A;  3VS0 A;  1IHV A;  1ARK A;  4FSX A;  4FT2 A;  4PJM A;  4A63 B;  1YJ9 A;  1M90 U;  1Z9Q A;  1TTH B;  3CCE T;  2DNU A;  3QG1 A;  2IIM A;  5GAO r;  2CP0 A;  1I81 A;  1IO6 A;  1ZUY A;  2EYQ A;  2RF0 A;  3JV3 A;  4HKE A;  3FC3 A;  2RQU A;  4VUB A;  2MI6 A;  2CH4 W;  3QJY A;  3CC2 Q;  1JU5 C;  1K0X A;  3A8L B;  4M77 B;  3OYG A;  2OTL Q;  3BFM A;  4N0A C;  2CZ0 B;  2RJF A;  4M7A C;  1W2B A;  4F7U F;  2FB7 A;  3U23 A;  2X9H A;  4ZTJ A;  1D0X A;  2Y90 A;  2DA9 A;  4QQ6 A;  3CC7 Q;  2F2X A;  5HK0 A;  5IHK A;  2EFI A;  1YHQ A;  2DBK A;  3QYH B;  1N27 A;  1I1J A;  1K76 A;  3CCR A;  1D1B A;  4OB1 B;  4X9D A;  3H8Z A;  3QBY A;  2ZPH B;  1YJW T;  2E64 A;  4JJB A;  3CCM A;  4B6M A;  2QDY B;  2MOX A;  2QA4 Q;  4C0G A;  4C0D B;  5EG2 A;  1Y71 A;  4X9C A;  1I5O B;  4C5H A;  2FRY A;  2J05 A;  1D0Z A;  3M53 A;  2JUF A;  2BUD A;  1T0H A;  4Y28 E;  3VS7 A;  4LNP A;  1W6X A;  5M9O A;  2CT4 A;  4WTO B;  1X27 A;  3LGF A;  2J7I A;  2LVM A;  3QPH A;  3EG9 A;  3G6E Q;  4AT1 B;  2GFA A;  5D6W A;  4A53 A;  1OZ3 A;  2A28 A;  1YI2 Q;  1VQ4 A;  4J7I A;  1QQJ A;  1N8R C;  4ANJ A;  2CZ1 B;  2VGM A;  1UGR B;  1QVG A;  3A8G B;  2KGT A;  3S3M A;  1Q95 G;  2HQX A;  1K0S A;  8ATC B;  1WQ7 A;  1Q86 C;  2KRO A;  4HT9 A;  1YJ9 T;  1VA7 A;  1XJW B;  3OYI A;  2HDA A;  3JCM f;  3OMC A;  3CCL A;  1VUB A;  1JB0 E;  1RAD B;  2HSP A;  2QGF B;  4XTZ A;  3JCM Q;  1VQN Q;  3FDR A;  1Y0M A;  4C92 B;  1PSE A;  1Y96 A;  4J5Y A;  3M54 A;  4NL2 A;  2DJQ A;  2DL8 A;  1AWO A;  2YUP A;  2RB6 A;  1M2V A;  1HK9 A;  1G2B A;  1M1K C;  1X75 C;  3JB9 H;  1PHT A;  1GFD A;  2PVD B;  5DM7 R;  3I35 A;  5EC7 A;  3CXC S;  1T0J A;  2V26 A;  5DLO A;  2CUD A;  2HL5 C;  3CCJ Q;  2C0T A;  1YHQ T;  3X20 B;  1Y07 A;  4QQG A;  2LCS A;  3OYJ A;  3CCR T;  3OS0 A;  2RI2 A;  2C06 A;  4EMK C;  5A0D A;  3M59 A;  3CCM T;  4M78 E;  2RNA A;  4PJL A;  2K3Y A;  1JJ2 P;  4JRK A;  1NEB A;  2EKH A;  2WSC E;  5KYY A;  2PUK B;  3UA7 A;  4PLI A;  2QDL A;  5GAM e;  4OMN A;  4JZ3 A;  1D1A A;  2ED1 A;  5I22 A;  2FRW A;  3MP8 A;  4BY6 C;  5GJV B;  3V7S A;  4AFU C;  4AMC A;  4E7Z A;  2D8J A;  3PGG A;  2YT6 A;  3TEE A;  2P84 A;  1VQ4 T;  4AFZ C;  1Y57 A;  4KGV B;  2K2V A;  1X6O A;  3INZ A;  4PFP A;  2E3I A;  3CCV A;  3GOX A;  2EYY A;  4FU6 A;  2E3H A;  2MF2 A;  2KI7 A;  1D0Y A;  2F69 A;  1OV3 A;  1G3W A;  1W2B S;  3CC2 A;  2HEQ A;  1UGP B;  3WVD B;  5C6S A;  3OS5 A;  4BUG A;  2OTL A;  3M55 A;  3CCL T;  2NUP A;  4PJO A;  5HCK A;  3P8D A;  5GAN f;  3JCM d;  2E6N A;  3KUF A;  2EBP A;  4C8Q B;  3PMI A;  3CC7 A;  2RH2 A;  4Y91 A;  1F1B B;  4E7J A;  2ROT A;  4OMM A;  1M90 C;  5C0M A;  3QDR B;  5FRO A;  2M9U A;  3X26 B;  1OYX A;  2X4W A;  1M1F A;  3M56 A;  3N5B B;  1OPK A;  2DMO A;  1KD1 R;  4ZN1 A;  4D6W A;  5KH6 A;  3HRS A;  3L2Q A;  2DXC A;  4N4I A;  1Q7Y U;  3VKI A;  2CP6 A;  4M77 C;  2FO0 A;  4F7U A;  2JMA A;  1NLO C;  1YIJ Q;  2DLP A;  1FMK A;  2HZY A;  3OW2 A;  3CQT A;  2FHD A;  2ECZ A;  1YNZ A;  1N8R R;  1VQ9 Q;  1M2O A;  2J6F A;  2RQR A;  2VV5 A;  2M0Y A;  5FU7 C;  5LJ3 f;  4A4F A;  3G6E A;  5GAN 3;  1G83 A;  1RLP C;  2QQA A;  4HA8 A;  3RMS A;  1YI2 A;  2FZG B;  4HVU A;  1OU9 A;  3L2W A;  1NPR A;  3EFR A;  2XMF A;  1VQL Q;  5J39 A;  3JB9 F;  2LQ8 A;  5J26 A;  3PE0 A;  1M3C A;  2ZPF B;  3RBB B;  3IQL A;  1JQQ A;  1VQP Q;  1X69 A;  3OYF A;  4A4E A;  3RES A;  1IGU A;  5GAN g;  4M7A F;  3PT9 A;  3FJ5 A;  1M1K R;  1P92 A;  3EGX A;  3JSC A;  1VQN A;  3CCV T;  3RUX A;  2DL5 A;  2PNI A;  4E47 A;  1QVF P;  3QWY A;  1NE8 A;  1JEG A;  2K3B A;  3CC2 T;  1HYO A;  2JT4 A;  4R0K A;  5A2Q E;  3C0C A;  2JM8 A;  4LD9 K;  1WGS A;  1PM3 A;  3L1A A;  3HHT B;  1QWF A;  4X1V A;  3EFO A;  1HD3 A;  3OYY A;  2XD0 A;  1NG2 A;  2EJF A;  1EZZ B;  2LDM A;  3CC7 T;  4J9E A;  2HAX A;  1WQW A;  4F14 A;  5GAN d;  3CCJ A;  2QEX A;  2NYS A;  3MEU A;  1U1T A;  2XU8 A;  1MNE A;  2YRV A;  2JVV A;  4XTY A;  2LRQ A;  3OYM A;  4MDX A;  5LJ3 g;  3OYA A;  1QVP A;  4C92 C;  3CMA Q;  1LJO A;  2K5I A;  2EYW A;  3UA6 A;  1G3S A;  1G5V A;  1OQK A;  2DIL A;  2LC4 A;  1M30 A;  1VQ7 A;  1WA7 A;  2F2V A;  1WHL A;  1ZA1 B;  4XU3 A;  5GAN 5;  4JS5 A;  1SEM A;  4O5V A;  3HFO A;  2BZX A;  2EYZ A;  3G6E T;  1WZO A;  3J81 E;  4RTY A;  1YI2 T;  2P0Q A;  5LJ3 d;  3OSV A;  2IPO B;  1KD1 U;  4IIO A;  4DOW A;  1KQ2 A;  2X35 A;  4M7D C;  2L3Q A;  2D1X A;  2F5T X;  3I55 A;  3HL8 A;  1MV0 B;  1ZSZ C;  3MEW A;  2K2M A;  2FZC B;  2RK2 A;  3JCM h;  3FB9 A;  1TG0 A;  2DAQ A;  3I5R A;  1U5S A;  3VU3 C;  1VQM A;  4C8Q A;  2CH4 A;  1N5Z A;  4PJJ A;  4M7D G;  4EPC A;  2ABL A;  4XQ3 A;  1NEG A;  4A54 A;  5GMK i;  3VYG A;  1VQN T;  2RA2 A;  1VYU A;  3G71 Q;  4FYY B;  1H8K A;  1WHM A;  4JLI A;  4JRQ A;  4Z89 A;  4M77 D;  1J3T A;  1BBZ A;  4FCY A;  2YRD A;  1TS9 A;  2L3P A;  3EGD A;  4IUU A;  1OU8 A;  2DZ9 A;  2ESW A;  2CS7 A;  2XHC A;  4KUD K;  3LGL A;  2AIR B;  3LYI A;  4J9D A;  4C5G A;  5LJ5 e;  2O9S A;  2NWM A;  3OS1 A;  3OYD A;  3L42 A;  4BI3 A;  2E4H A;  4PJO D;  2E70 A;  3OW2 S;  3OSS C;  2YUN A;  2QEX T;  1X01 A;  5CVI A;  1TH7 A;  1YIJ A;  1VIE A;  3PNW C;  4QT7 A;  3RDV A;  2SRC A;  4M75 E;  1VQ9 A;  1K73 U;  4A4H A;  5AYF A;  3O8V A;  2LQW A;  1M3B A;  1GRI A;  3LWI A;  2JN0 A;  4HCK A;  2OI3 A;  1VQ7 T;  1KQS A;  1O75 A;  2K9G A;  1IB8 A;  1VQL A;  2CRE A;  3EH1 A;  1G3Y A;  1Q7Y C;  2DKG A;  1UGQ B;  2H8H A;  3UT1 A;  4LUD A;  3M57 A;  2YDL A;  3TQ7 P;  3TVT A;  1JXO A;  2DE0 X;  3I55 T;  4RKU E;  4PL6 A;  3CPW A;  1YIT Q;  1X6G A;  3OY9 A;  2KK4 A;  4OGE A;  2KAF A;  2CP2 A;  3EHQ A;  3RR6 A;  4B9W A;  2P4R A;  4RTV A;  1QCF A;  2E5K A;  4JLG A;  2DYI A;  1VQM T;  3LW5 E;  2A0F B;  2RQV A;  4BY6 B;  5GAO m;  1I8F A;  3LLR A;  2QYZ A;  1WNL A;  2YUQ A;  1PRL C;  2EGA A;  1AT1 B;  4OB0 B;  5L8R E;  5GAM f;  5I11 A;  3VS3 A;  2M16 A;  3H6Z A;  2DXB A;  3FLG A;  1QMC A;  4JJD A;  4CC7 A;  2YXY A;  4M75 C;  2IVW A;  3HP9 A;  2BIV A;  4N0A A;  4M7A A;  4M77 F;  1BB9 A;  4MZT A;  1RAF B;  3UPU A;  2HQH A;  3I56 Q;  1B34 B;  2DK3 A;  1S72 Q;  2KMT A;  3TRE A;  1C0M A;  3QO3 A;  2E1H A;  4J6X A;  1LPL A;  1PD0 A;  4QKU A;  1WHH A;  2X3X D;  1WJQ A;  3A8O B;  4M75 G;  1OZ2 A;  3CMA A;  3MJX A;  2RJC A;  3PVQ A;  4DOV A;  4PJO F;  1TXQ A;  2QXF A;  4RG2 A;  2JTF A;  3T9N A;  2YWW A;  3MP1 A;  3PIP A;  4PNO A;  4IUT A;  1V1C A;  1VQ9 T;  2RN8 A;  2DPP B;  2RHX A;  2DET A;  2R57 A;  2XDB A;  4LDY A;  4KGX B;  4C0F A;  5FLX E;  2DJZ A;  7AT1 B;  1LNX A;  5GMK m;  1VQL T;  5GAO n;  4QVZ A;  4HXJ A;  3BY7 A;  1IZ6 A;  2ZPG B;  3L2V A;  3VS6 A;  4E7H A;  5FU7 B;  1HJD A;  3J7A F;  3LH0 A;  4DQ2 A;  5GAM g;  4OB3 B;  4IKF A;  1M1G A;  1KK7 A;  1Q82 U;  2A08 A;  1YJN T;  4L5G A;  4J9G A;  3HRU A;  1SRL A;  2HNI A;  3G71 A;  2DVJ A;  3I5S A;  3QZ9 B;  1FMW A;  5FU6 C;  5HY6 A;  2KRS A;  2VWF A;  1KQ1 A;  5A0G A;  1YCS B;  1FMV A;  2G3R A;  5CQY A;  4QVD A;  5GAN 7;  4PLL A;  3JCM b;  2GQI A;  1KD1 C;  1PSF A;  4C8Q D;  2MAM A;  3VUZ A;  2P4T A;  5KYX A;  2VC8 A;  4C92 F;  5GAM d;  1MUZ A;  5GJW B;  3H0I A;  3SEM A;  2CT3 A;  5CKE A;  2Y4Y A;  5A0L A;  1VQK Q;  4WCI A;  1I5L A;  2KY9 A;  4RTX A;  3QJ6 A;  2DF6 A;  1KC8 R;  4KUI A;  3LX7 A;  2YLC A;  2V8I A;  3R6N A;  1UHC A;  1RAB B;  1M27 C;  1VQO A;  1Q7Y R;  1KQS S;  3HSB A;  3V8K A;  2CP3 A;  2QK0 A;  4EMK A;  2EGE A;  5KYU B;  2K5F A;  1ACM B;  3CME Q;  4ELZ C;  4JJN K;  1G8X A;  2KXC A;  2DXT A;  1HXD A;  5J3B A;  1LOJ A;  4JJC A;  2DD4 A;  4F04 B;  4F17 A;  1QP3 A;  3RIR A;  3CPW S;  1E6H A;  2VAS A;  2XDD A;  3F70 A;  1IGQ A;  3KFV A;  4RUG A;  1EX4 A;  1YIT A;  2LX7 A;  2WSE E;  4J9C A;  4LDX A;  3A5Z B;  1A0N B;  3CXC P;  1K73 C;  5KYN A;  2D6F A;  1KHI A;  1R8O B;  4HT8 A;  3CD6 Q;  3C95 A;  5KCO A;  3EG2 A;  4DEY A;  1ZSG A;  1B34 A;  2MCN A;  4J8O A;  3L2U A;  2C0I A;  3FRN A;  1XTD A;  4BDY A;  4M7D B;  2CP5 A;  4MML A;  4RTZ A;  1PG5 B;  1ZSZ B;  1BCO A;  1NYF A;  2J06 A;  2LT4 A;  2RI3 A;  3GIB A;  3I56 A;  1M9S A;  4OMQ A;  2L89 A;  4PJN A;  4XTW A;  3JB9 D;  2MIO A;  4C8Q F;  5CKF A;  3M0S A;  4ZGD B;  3OYC A;  1SRM A;  4EMH A;  1TOV A;  4FSS A;  1VQ8 Q;  3MET A;  2QAS A;  2ZPB B;  3EG0 A;  2KXD A;  4M7A D;  3MO8 A;  4M77 A;  2RQW A;  3OBW A;  4CC2 A;  2YHT A;  5IT9 E;  3VV0 A;  1TWB A;  3NTH A;  4LN2 A;  2VXE A;  4RTU A;  1PRM C;  1VQO T;  1XNI A;  1UDL A;  1W2B P;  5FWC A;  1BIB A;  3BDU A;  2YUO A;  3MHX A;  4E7I A;  4FYV B;  2V8J A;  5LJ5 f;  1D3B B;  3EG1 A;  2KEA A;  2YLB A;  5GAN 8;  4M78 C;  1M8M A;  2B8A A;  5I2S A;  4PJO E;  4RCC A;  3KBG A;  4J83 A;  2AKL A;  1GBR A;  3G7Z A;  3EHR A;  2GTO A;  3M0Q A;  2LNV A;  1VIF A;  2BE9 B;  1KC8 U;  2HD0 A;  4FYX B;  1K9A A;  3P8H A;  3SWN B;  4M78 G;  2D0Q B;  3CCS Q;  3H41 A;  2JNG A;  2QA4 A;  5GAM h;  1WI7 A;  3VJP A;  2JTM A;  2BTT A;  5GMK e;  2K7A A;  2LJ0 A;  1V76 A;  1JBM A;  2PZ1 A;  4F7U E;  1OEB A;  4J9H A;  5KYW B;  2EPD A;  2Z0W A;  1SHG A;  3URG A;  4FL6 A;  3ZEH A;  4OB2 B;  1RUW A;  4ATO A;  3S6W A;  2XK0 A;  2CDT A;  5L23 A;  2DM1 A;  4ZGJ B;  2G6F X;  2QTX A;  1QVG P;  3I56 T;  1VQK A;  1OOT A;  4A4G A;  1Q82 C;  4LXC A;  4E7L A;  1H64 1;  3CPF A;  4NOY A;  3V8L A;  1M8V A;  4M75 B;  4BI8 B;  3M58 A;  4Z88 A;  3GNG A;  5LJ5 g;  2LZ6 B;  2CYZ B;  4C92 A;  2NLU A;  3GP8 A;  2PVG B;  2O4X B;  1ABO A;  3J80 E;  4II1 A;  2VXF A;  3M4G A;  2W10 A;  3HKS A;  4PJO G;  1WXB A;  2V8K A;  2ED0 A;  4BI4 A;  2ZZD A;  4E6R A;  2COY A;  2DTO A;  1K73 R;  2OTJ Q;  3VYH B;  2F1L A;  4KRT A;  4L59 A;  2AZV A;  2OTL T;  4MMK A;  3M4Y A;  1GCQ C;  2EW3 A;  2JZ2 A;  4J7F A;  4EDU A;  3X25 B;  2ATC B;  2W0Z A;  1NPP A;  1ZUU A;  5LJ5 d;  1D1C A;  3OB9 A;  4AG1 C;  4DEX A;  1WYX A;  2HKN A;  4OP0 A;  2RPN A;  3SHW A;  4M7D A;  4XU2 A;  4IIM A;  4NL3 A;  4AFS C;  4KT0 E;  1ZSZ A;  3CD6 A;  5IHI A;  4F7U G;  2RJE A;  1ZA2 B;  1AWJ A;  1WHK A;  2NUZ A;  3V7R A;  5GAN j;  4FW1 A;  1CKB A;  4RTT A;  3X24 B;  5KE2 A;  2DTI A;  3NPF A;  1UGS B;  2QA4 T;  3A8H B;  1QP2 A;  4GBQ A;  2VUB A;  2FPF A;  1XOV A;  4BAC A;  1NBE B;  2AK5 A;  4TVR A;  3CBO A;  2EJG A;  2CGH A;  2DXU A;  2GFU A;  1WJS A;  2RHI A;  1NZ9 A;  4JZ4 A;  2HL3 A;  2F5K A;  5CO7 A;  1TU0 B;  3FIF A;  2GGR A;  2VGN A;  5KCH A;  1VQ8 A;  4FW2 A;  1VQK T;  2QQS A;  5FU6 B;  5IHN A;  3OYL A;  3VS4 A;  5GAN 4;  1X2Q A;  1OI1 A;  1PD1 A;  1YN8 A;  2M0O A;  1C6V X;  1K9M U;  2KQW A;  2M51 A;  3DB3 A;  5FRM A;  5LJ3 j;  4FM4 B;  1QCN A;  2E5Q A;  1H3Z A;  1R0C B;  1MGQ A;  4OGC A;  2HSE B;  3TSZ A;  4C8Q E;  3C12 A;  4Q5W A;  4CC4 B;  1V29 B;  1W4S A;  4HVV A;  3OMG A;  2D0N A;  2HBW A;  5CQX A;  1ABQ A;  1ZHI A;  3EAE A;  1ZX6 A;  1UG1 A;  2WSF E;  5IXF A;  2E10 A;  3CCR Q;  1W1F A;  2RM4 A;  3A8M B;  1Q81 C;  4X34 A;  3NMZ C;  2JS0 A;  3RER A;  1PKT A;  1YWO A;  5KYW A;  3RKY A;  3CCS A;  3QII A;  2DTH A;  3H0F A;  3CCJ T;  2KVQ G;  2J6O A;  2GQV A;  1D09 B;  2DD5 A;  4MZP A;  1GL5 A;  1LCK A;  2X51 A;  5DY9 A;  2HMA A;  1BCM A;  4C5I A;  1Q82 R;  2MK5 A;  1SHF A;  1ZBJ A;  3M0T A;  1IRE B;  2CSQ A;  1QW1 A;  3UF4 A;  3PTA A;  3PMT A;  5IN1 A;  3MEA A;  3PIO A;  1K1Z A;  3OA6 A;  2DEU A;  2IG0 A;  4N4H A;  1MHN A;  3THK A;  4V2S A;  1VOM A;  1VQ4 Q;  5CR2 A;  4Z02 A;  4ORZ A;  1PCX A;  3SWN C;  1QKW A;  2LCL A;  4A4K A;  3JRZ A;  1KC8 C;  2V1Q A;  3A1P A;  4FT4 A;  4DBQ A;  5GAN 6;  1XQH A;  1GBQ A;  2DL3 A;  1U3O A;  2K57 A;  2PQW A;  3EG9 B;  1M4Z A;  3GNF B;  3H0H A;  3CCU Q;  1VQ8 T;  2MYS A;  1GXI E;  4OMO A;  2LNH B;  5D7U A;  4D8K A;  1X6B A;  2X3W D;  4LD6 A;  3JCM P;  1VQP A;  1ZQ1 A;  2RO0 A;  2GCX A;  3O5Z A;  4C8Q G;  3OYK A;  3CCL Q;  1KIK A;  1Z9Z A;  3DLL A;  2L3S A;  2DX1 A;  2KT8 A;  4J6Y A;  4GLM A;  3X28 B;  2CKK A;  4XAX B;  1SSF A;  4KGZ B;  1NJI U;  3P8B B;  2QQB A;  2X4Y A;  2DL7 A;  2WAC A;  2DBM A;  3NFC A;  2I0N A;  2OTJ A;  5GAN h;  4BDZ A;  3A98 A;  1X2K A;  2J6K A;  4YTL A;  4C92 D;  3OYH A;  1Y96 B;  1DJ7 B;  1UJ0 A;  4J9I A;  4DBF A;  3DB4 A;  3CCQ Q;  4JRP A;  1M2V B;  3QUI A;  1TUC A;  2F2W A;  3RMQ A;  1AWX A;  4M7A E;  1WPY A;  3L2R A;  1K8A U;  2EKO A;  2CSI A;  3R6O A;  1WXU A;  3M0P A;  4JRI A;  1E7O A;  3CCS T;  4OF1 A;  2K79 A;  2JXB A;  2OX7 A;  1UEC A;  3VRY A;  3VRZ A;  2H3J A;  3VS1 A;  4M78 B;  1YIJ T;  3HRT A;  1BK2 A;  2HQE A;  2KYM A;  3L2Z A;  1JJ2 A;  4M7D D;  5I21 A;  4Z8A A;  2DO3 A;  5LJ3 h;  3HFN A;  1EIF A;  3S3N A;  2ZGW A;  3ASK A;  2X4J A;  2OJ2 A;  4XU0 A;  2K6D A;  1U1S A;  2M1H A;  1VQ6 Q;  3ME9 A;  4N4G A;  5KYY B;  4O6J A;  2XID A;  2O01 E;  1T3L A;  3PFS A;  4BD3 A;  2V1R A;  5CK9 A;  4ZNX A;  2DEQ A;  5I2M A;  1YBY A;  2EQK A;  3QKJ A;  4L6V 5;  3CCV Q;  1OX8 A;  3H9N A;  4ME7 A;  2PVO B;  3OBY A;  1KSW A;  4KH0 B;  4XTV A;  6AT1 B;  1VQP T;  3G4S Q;  3JB9 G;  1WIE A;  1Q81 R;  3RKX A;  1SKU B;  1PWT A;  3MP6 A;  3I9Q A;  1NM7 A;  5GAO q;  1C1A A;  4WF2 A;  4R56 A;  2PU9 B;  2HCK A;  2OTJ T;  2NUP B;  4PJO B;  4M7A G;  2QQR A;  5ECA A;  3BE3 A;  4E2F B;  2O2O A;  1HSQ A;  3DLM A;  1U8R A;  1K9M C;  1WLP B;  2YRC A;  3D7S B;  1GFC A;  2ZPI B;  1WXT A;  5FWB A;  2L3R A;  1I4K 1;  2DYB A;  2Y4X A;  3EFS A;  2P0P A;  2RD1 A;  3C94 A;  5GAM j;  2NUT B;  3OYE A;  2K4Y A;  4IUQ A;  3DKM A;  2BKD N;  1BI0 A;  3S3O A;  3CMA T;  4F7U B;  4FYW B;  4D8D A;  3EH2 A;  5IH2 A;  1RLQ C;  1AHJ B;  4GY5 A;  2PUO B;  1YFN A;  3BW1 A;  1KQS P;  2A36 A;  2E6Z A;  2XKO C;  3HTR A;  1UTI A;  3M5A A;  1MMN A;  2MWP A;  3KXT A;  5IXB A;  2R58 A;  4M7D F;  2JTE A;  3JCM X;  1PC0 A;  3E9G A;  4Y92 A;  2DIG A;  2KRN A;  2OAW A;  3CCU A;  3CPW P;  1R77 A;  2O31 A;  5GAN 2;  1B07 A;  2ENM A;  4PFZ A;  2RMO A;  5KE3 A;  2AZS A;  2I2L A;  4AFQ C;  2A3L A;  4GLK A;  2DRK A;  4M75 D;  1AD5 A;  2DVE A;  1AZG B;  9ATC B;  3JCM V;  1RAE B;  2L5Q A;  2JS2 A;  1RI0 A;  4R55 A;  2VKN A;  1RAG B;  3V8J A;  1QVF A;  2L8D A;  3EGX B;  2LQK A;  1YWP A;  1BU1 A;  1WDX A;  1T3S A;  2YSQ A;  4PKC C;  2EQJ A;  3G71 T;  2P0K A;  3OQ5 A;  1S1N A;  1BI3 A;  4K11 A;  5GMK j;  1UE9 A;  2QEX Q;  3CCQ A;  3E9F A;  4DBR A;  2XI9 A;  3Q1J A;  2A7Y A;  3EFO B;  1S72 A;  1WJR A;  2LJ3 A;  4M78 A;  1WHJ A;  1VYT A;  2O88 A;  1SPK A;  1QCO A;  1AOJ A;  1JJ2 S;  3FEO A;  1RAA B;  3QZ5 B;  1FX7 A;  1GCP A;  1NJI C;  4LUE A;  2ROL A;  1U06 A;  4EIK A;  4BE1 A;  4CRI A;  1Q81 U;  4HCB A;  3GF5 A;  2EWN A;  2PTK A;  4IUV A;  5CIU A;  1VQ7 Q;  1VYV A;  3E1S A;  1VQ5 Q;  4EMG A;  1KFZ A;  4M77 E;  1VQ6 A;  2XDP A;  1FXX A;  1TUG B;  5DLQ E;  5CAI A;  1BIA A;  2FZK B;  3CEY A;  3JCM g;  3MCA B;  1AEY A;  1UFF A;  3CC4 Q;  3JCM c;  4ELY C;  2CZ7 B;  2SEM A;  2CZ6 B;  3I55 Q;  2AT1 B;  1K8A C;  1MMD A;  2ZAE A;  4ZGE B;  3NTK A;  2KRM A;  4PFO A;  3CCU T;  1Y7X A;  2AKK A;  3AT1 B;  3RNJ A;  1VQM Q;  5FW9 A;  1WHG A;  5LL6 S;  3GLX A;  1UEB A;  3EG3 A;  1M3A A;  4OMP A;  4LE9 A;  2OAU A;  3GPL A;  3G4S A;  1YIT T;  1K4U S;  1JXM A;  1N9R A;  4DBH A;  5FRN A;  3ULR B;  1RAI B;  1IXD A;  1WFW A;  5D6X A;  2K5L A;  1K9M R;  4M75 F;  2KDS A;  3OS2 A;  2JW4 A;  3OYB A;  4XTX A;  1MV3 A;  1H3H A;  2FL7 A;  1FWZ A;  5CKB A;  4B9X A;  4C5E A;  2FPE A;  2LP5 A;  2MPX C;  1B3Q A;  3E19 A;  4PK4 A;  1ZUK A;  1G3T A;  3EGD B;  2NUT A;  1UHF A;  2DZC A;  2LT1 A;  1GCQ A;  3CCQ T;  3SB2 A;  5IAY A;  4E7S A;  8AT1 B;  1S72 T;  3QXE B;  3CCE Q;  2EJ9 A;  4OVA A;  5KYU A;  2MWO A;  2DL4 A;  3ZL7 C;  2LTO A;  4OML A;  2CP7 A;  4M77 G;  1KHC A;  4PJO C;  1Q86 R;  4HVW A;  4UC4 A;  3SFM A;  2QI2 A;  1QVG S;  2LMJ A;  1MND A;  3CBM A;  1PKS A;  4KBM B;  3CME A;  1YP5 A;  1R0B G;  3NTI A;  4C0D C;  4C92 E;  5HK3 A;  2EQI A;  4KUL A;  2D8H A;  2QG9 B;  3MEV A;  1RL2 A;  1VQ6 T;  1MMA A;  2B86 A;  3PVL A;  2L2P A;  2M02 A;  5HKC A;  3JB9 I;  3TSW A;  4J9F A;  1RAH B;  5GMK h;  1YJW Q;  2KSS A;  4ZTF A;  1YJN Q;  4JPB W;  1AZE A;  3E2U A;  4KH1 B;  2DFU A;  3JCM J;  1SG5 A;  4ESR A;  1QVF S;  2C0O A;  2D9T A;  2EYX A;  3QHS A;  2H3E B;  1TUD A;  2FVU A;  4BE2 A;  2FYK A;  2EGC A;  1AVZ C;  4RMO A;  4IUR A;  4M7D E;  2QAZ A;  3G4S T;  5LJ5 j;  3JCM e;  3SDZ A;  4BE0 A;  2E65 A;  4MDW A;  1N6A A;  3MKD A;  4J9B A;  2JJ9 A;  2MMP A;  4HCC A;  2GTJ A;  4C0Z A;  2RHY A;  1NJI R;  2LQN A;  4BB7 A;  3QSU A;  3G1J A;  1MMG A;  1ZLM A;  1E6G A;  3M0R A;  5CCA A;  4M7A B;  1JO8 A;  1FYN A;  2A37 A;  2X4X A;  1QWE A;  4IUP A;  2EAY A;  2RHU A;  2RJD A;  1YJ9 Q;  4XTU A;  1EFN A;  2JMC A;  4JDS A; 
#chains in the Genus database with same CATH homology
 3CD6 Q;  3G71 Q;  1VQL Q;  2OTL Q;  3CCL Q;  1YIT Q;  1QVF P;  3OW2 P;  1VQM Q;  3G4S Q;  3CPW P;  1NJI R;  1VQ4 Q;  1Q81 R;  1Q7Y R;  1W2B P;  1N8R R;  1K73 R;  1KQS P;  1VQ9 Q;  1K8A R;  2QA4 Q;  2OTJ Q;  3G6E Q;  3CCQ Q;  1YHQ Q;  1KD1 R;  1VQ8 Q;  3I56 Q;  3CC4 Q;  1YI2 Q;  1S72 Q;  1JJ2 P;  1VQK Q;  3CME Q;  3CCR Q;  3CCV Q;  3CC7 Q;  1VQN Q;  1VQP Q;  1Q86 R;  3CMA Q;  3CXC P;  1Q82 R;  3CCS Q;  3I55 Q;  1M90 R;  3CCJ Q;  2QEX Q;  3CCU Q;  1K9M R;  1QVG P;  1YJW Q;  1VQO Q;  1YJ9 Q;  1VQ6 Q;  1M1K R;  1KC8 R;  1VQ7 Q;  3CC2 Q;  1YJN Q;  1YIJ Q;  3CCM Q;  3CCE Q;  1VQ5 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...