2D1XA

The crystal structure of the cortactin-sh3 domain and amap1-peptide complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
b'NDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cortactin isoform a
publication title Targeting AMAP1 and cortactin binding bearing an atypical src homology 3/proline interface for prevention of breast cancer invasion and metastasis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell invasion
total genus 13
structure length 60
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2d1xA00
3VRZA 2BZ8A 2FPDA 4J9BA 2GBQA 4E6RA 4CC3A 2JTEA 2ESWA 1B3QA 2LNHB 3TSWA 1M3BA 5IHNA 1WFWA 1HSQA 1YP5A 4Z89A 4RTXA 2O9SA 1NEBA 4R0KA 1ABQA 4J9HA 1M27C 1T3LA 2KRSA 1AWOA 2CH4A 4JPBW 1G2BA 1X6BA 2DVJA 4HVVA 1E6GA 2DX1A 2KXDA 1QLYA 1X27A 2CSQA 1K1ZA 2AZSA 1HD3A 1UUEA 2DMOA 2NUZA 1K76A 2J6FA 3THKA 4LUDA 1AVZC 2OAWA 3VS2A 2KRMA 2CUBA 1GCQC 1ZBJA 4AG2C 2KYBA 2FPEA 4LUEA 1M3CA 2RQTA 2J06A 4LNPA 2HDAA 1KJWA 1NLPC 2K79A 1GFCA 1UGVA 3NMZC 1ZSGA 2RQUA 1VA7A 4OMQA 3M0UA 1H92A 3NGPA 2QDLA 2DL7A 2PZ1A 2YUPA 4RTVA 4OMPA 4Z8AA 1QWEA 2C0TA 2KR3A 2L3QA 3IQLA 2DBKA 2DL8A 5IXBA 4HCKA 1PWTA 2L0AA 4WCIA 1X6GA 2YUQA 1WX6A 4RTTA 2FG0A 4GLMA 1SSHA 1PKSA 4X1VA 3EG0A 1WDXA 5GJVB 3TVTA 4J9FA 4RTUA 2LQWA 1NYGA 1K9AA 1WXBA 2JT4A 5L23A 4DEXA 2L2PA 3TSZA 2FPFA 1AD5A 1UG1A 1ZX6A 1WXTA 1TUCA 4OMLA 3KFVA 2SRCA 2KGTA 1M3AA 2KNBB 3H41A 1WXUA 2FO0A 1YNZA 1VYVA 2PNIA 2SEMA 1X2QA 1T0JA 4F16A 5I22A 3I5SA 2L3PA 4KRTA 2JXBA 2KT8A 2ROTA 2JW4A 1GBRA 1PRLC 2CH4W 2EW3A 4Y92A 4ORZA 2O9VA 1CKAA 2ENMA 4J9DA 1UHFA 2BTTA 5GJWB 2DNUA 1WIEA 4J9EA 1OEBA 2J6OA 3EHRA 2DA9A 1U06A 2CT4A 3VS4A 2ED0A 3H0HA 1G83A 5EC7A 5IXFA 2LQNA 2JM9A 1I1JA 1JXMA 1X43A 3A98A 2JM8A 3M0TA 2YDLA 2DBMA 2RMOA 2H8HA 2K9GA 1SRLA 1X69A 2LP5A 4HXJA 1GFDA 3M0QA 1JXOA 1SPKA 1H3HA 4F14A 2ABLA 2JS0A 1TG0A 2RNAA 5FWCA 1K4US 1SHGA 2D0NA 1ABOA 3EGUA 2DF6A 2FRWA 2AK5A 4D8DA 2LJ0A 2LCSA 1GBQA 3VS1A 1W70A 1BK2A 2AZVA 1OPLA 2OI3A 1K0SA 2MOXA 3RNJA 1QKWA 2JMCA 2F2VA 1GL5A 1IO6A 3ULRB 2V1RA 4RUGA 2EPDA 3VS5A 1AWWA 1CSKA 2DRKA 1AZGB 1Z9QA 2GTJA 2VKNA 2RQVA 1WI7A 4GBQA 2GQIA 5IHIA 2DLPA 2AKLA 1LCKA 1VYTA 2JS2A 3UA6A 1GRIA 2B86A 2HCKA 1PHTA 1I0CA 4RTYA 2MIOA 1JO8A 3VS0A 1UHCA 1SEMA 1H8KA 1M8MA 1FMKA 2LZ6B 2C0IA 4CC2A 4HVWA 2FEIA 1E6HA 5ECAA 4DEYA 3VRYA 1U3OA 1A0NB 2J05A 4JZ3A 2DL3A 2J6KA 3ZL7C 3SHWA 1BU1A 2F2WA 2CDTA 1AZEA 4JZ4A 2VVKA 4LE9A 2GGRA 2LJ1A 1QKXA 5IH2A 3NHNA 5IHKA 2YUNA 2OJ2A 1ZLMA 2K7AA 1MV0B 4JJBA 2KEAA 2EGCA 1T0HA 1VYUA 4OMOA 3C0CA 2FRYA 2GNCA 1SHFA 2EYXA 1BBZA 2G6FX 1B07A 2DILA 4J9IA 4JJDA 2KYMA 1QWFA 2KRNA 3UATA 1RLQC 3UF4A 1UTIA 2YSQA 2V1QA 2A08A 2O88A 4QT7A 2MCNA 1RI9A 2K6DA 3PE0A 2KXCA 1NG2A 2RF0A 2D1XA 2DL5A 2HSPA 1YWPA 2LMJA 1U5SA 1PRMC 2RQWA 4OMMA 2YT6A 1T3SA 2X3WD 4FSSA 1WLPB 2EQIA 1OOTA 3H0FA 1ZUKA 1JQQA 2HEQA 1M30A 3VS7A 1V1CA 2GTOA 2O2OA 2ED1A 3PVLA 1NM7A 1UE9A 2ECZA 4Z88A 1EFNA 3I5RA 3EG2A 2EYZA 1E7OA 4J9GA 1W6XA 3CQTA 2EYWA 4IIMA 4J9CA 4M4ZA 2HBWA 3I9QA 2F2XA 3GBQA 1MV3A 1UJ0A 3QWYA 1AEYA 5FW9A 5I11A 1JU5C 1OV3A 4LN2A 2LX7A 4A63B 1Z9ZA 3M0SA 3UA7A 2D8JA 2I0NA 2K2MA 4AG1C 1JEGA 2DE0X 1S1NA 1YN8A 2RPNA 1SRMA 4ESRA 1YWOA 3VS6A 4F17A 2EVRA 4IIOA 1I07A 2W0ZA 1ZUUA 2LJ3A 2DRMA 3M0RA 2KT1A 3SEMA 2PTKA 1KFZA 3R6NA 1GCPA 4OMNA 4CC4B 2A36A 2RQRA 4JJCA 4D8KA 2A37A 1NYFA 2P4RA 1J3TA 3NPFA 1PKTA 2CREA 1BB9A 1KIKA 2VWFA 4AFZC 1UDLA 1PNJA 1TUDA 2NWMA 3PVQA 2DM1A 2DYBA 2BZXA 1X2KA 1AOJA 1GCQA 2KBTA 3RBBB 1Y57A 3U23A 2D8HA 5HCKA 2O31A 2E5KA 2EBPA 2A28A 3O5ZA 3LH5A 4RTZA 4RTWA 2RN8A 1AWXA 2M0YA 1AWJA 1KSWA 1Y0MA 2KE9A 3JV3A 2CSIA 3QWXX 2AKKA 2DJQA 1HJDA 2ROLA 4EIKA 5FWBA 2DL4A 2EYYA 2EKHA 2X3XD 3EG3A 4AFSC 1UECA 2J7IA 4AFUC 2JMAA 3EG1A 2W10A 2YUOA 1OPKA 3FJ5A 3H0IA 1YCSB 1FYNA 2CUDA 1WYXA 2IIMA 1K0XA 1UJYA 2K3BA 2M51A 4AFQC 1ARKA 3I35A 1RLPC 1WA7A 3REAB 2BZYA 1CKBA 4ZNXA 2L3SA 3M0PA 3EHQA 1NLOC 1MUZA 2EGEA 2CT3A 1NEGA 2EGAA 4CC7A 1QCFA 1RUWA 1W1FA 1ZUYA 1UFFA 2C0OA 3REBB 1N5ZA 3VS3A 2KROA 4HVUA 1XOVA 2XMFA 4K11A
chains in the Genus database with same CATH superfamily
4J6XA 1IZ6A 4C5IA 2FZGB 3L2QA 2OTLA 4CC3A 1VQPT 2QQAA 4M7AF 4IUUA 1VQKT 2HBPA 3CMET 1B3QA 3H8ZA 4M78G 2M0OA 3FEOA 1JJ2A 4PL6A 4YTLA 2PQWA 1MNEA 1WFWA 4NL2A 4RTXA 2O9SA 1GXIE 1QVGS 5A2QE 1EIFA 2KRSA 1G3YA 3PIOA 4IURA 3LW5E 2DX1A 1K9MU 4E7HA 1HD3A 2YLCA 3X28B 2LDMA 2NUZA 2X51A 3THKA 4Y91A 2OAWA 1RL2A 2CUBA 1GCQC 4M78C 5FROA 1N27A 1VQ8T 4KGZB 1M2VA 3BW1A 2A7YA 1M3CA 1O75A 3JB9H 2EJFA 2V26A 5DLQE 4XU2A 4FYYB 4EMHA 2K79A 5LJ3g 4PJOC 1UGVA 3OMGA 1ZSGA 1VA7A 4DBHA 4NL3A 4ZGJB 3NGPA 2QDLA 3CD6Q 4IUPA 1XJWB 3J80E 3V8KA 3OYLA 1NJIR 4Z8AA 5GANe 1QWEA 2KR3A 1OX8A 3SWNA 2RHXA 2DBKA 1UGPB 2JJ9A 2DL8A 2M02A 2BE9B 2L8DA 1OULA 4M78E 4M7DD 3VV0A 4M77F 4RTTA 3A8GB 3M53A 4X1VA 3CD6A 2IG0A 5GJVB 1VQ4T 2E12A 2QG9B 3CBMA 2LQWA 2X4YA 1NYGA 4RTUA 4WF2A 1K9AA 5EG2A 4PJOE 5L23A 4DEXA 1D0XA 1XTDA 5LJ3f 1MMNA 1TUCA 3BDLA 4EMKB 3KFVA 3FRNA 1M3AA 1YNZA 2LNVA 4M75F 4BY6C 4F16A 2LRQA 3I5SA 2L3PA 2JXBA 2FL7A 3NTIA 2QYZA 1CKAA 4KULA 2K2VA 4FU6A 4J9DA 1MHNA 2BTTA 3ER0A 2P0PA 1NBEB 5GAN3 1KC8U 1VQ5T 1SKUB 1OI1A 3V8JA 3CCLT 1LPLA 3LX7A 2LQNA 4BUGA 2OAUA 3OYAA 1JXMA 1M5Q1 1M1KR 3A98A 2DKGA 3M0TA 4XQ3A 3JB9J 5GAMe 2DBMA 2DEUA 3G4SQ 3JB9G 3RMQA 1HYOA 3M4YA 3M0QA 2RB6A 4J83A 3OS2A 3CXCA 4E7SA 1YHQT 1VQ9Q 2RNAA 5IN1A 1YI2Q 2FRWA 3QZ5B 3CCQA 2EQJA 3WVEB 2L3RA 1IHVA 1RAHB 2ZPHB 4AMCA 3OYHA 1W70A 1BK2A 4E7ZA 1RADB 4R56A 2QK0A 2JMCA 2K3XA 2F2VA 4BACA 3OYDA 3CCUT 2EWNA 5GAOn 2V1RA 2CKKA 3CC7Q 1VQ6A 4RUGA 3OYGA 4FW1A 1Y96B 3SWNC 3GF5A 4QVCA 2F5KA 5GAOp 1SG5A 1G3WA 1IGUA 1WI7A 3EFSA 4C92F 3WXMB 2DLPA 4F7UF 4LD6A 3CC7A 2HCKA 2DTOA 1RAGB 2KI7A 2DJZA 1JO8A 1VQOQ 2HD0A 2LZ6B 1Q81U 2DK3A 4CC2A 4KGVB 4PFOA 2FEIA 1E6HA 2K57A 3VRYA 2MAMA 1U3OA 1VQOA 2J05A 4JZ3A 4A4FA 4R55A 2F1LA 1BCOA 4E7KA 3M4GA 2D6FA 2F2WA 4JZ4A 1H3ZA 2LJ1A 4OVAA 4J6WA 3CMAQ 2YUNA 3ASKA 2OJ2A 4JRKA 3JAME 2BUDA 1M9SA 2DYIA 4N4HA 5LJ5h 3MP8A 2MI6A 4JJBA 2WACA 3M57A 3GIBA 1T0HA 3OS5A 4OMOA 5GANh 4C0DC 2G6FX 2ZPBB 2PUKB 4HA8A 2E10A 4JS5A 3UATA 5GAN7 2JTMA 2FB7A 1B7TA 1N8RR 2MCNA 1RI9A 3PE0A 1HK9A 5AYFA 2HSPA 5IAYA 5HK0A 1IHWA 1R77A 3QYHB 2GCXA 1OOTA 3H0FA 1JQQA 2YRCA 1JB0E 3AHUA 4QQGA 3OW2A 2EJGA 4WTOB 5KYUB 1VQPQ 5GAOr 2ED1A 1WJRA 3PMTA 3LH0A 2RHZA 1VQKQ 5GANd 2QQ9A 3I5RA 2XU8A 3CMEQ 4IUVA 1YJ9T 3VKIA 3NTKA 3RERA 2EYZA 3CQTA 4M4ZA 3META 4IIMA 3GBQA 3HRTA 3OBYA 1UJ0A 5KYNA 5I11A 4L59A 3CCVT 1NJIU 3LWHA 4B9XA 3MEUA 1Q82R 1V76A 4MZPA 3CMEA 1RI0A 3L2ZA 5CQXA 5FRNA 1Y71A 2LQ8A 3SD4A 3UWNA 4NS5A 1S1NA 2LCLA 1M2OA 1SRMA 4FM4B 1YWOA 3G6ET 1I07A 1ZUUA 3P8BB 1M1FA 1VQ8Q 3OYFA 1QW1A 3ZFJA 1PSEA 4OMNA 3V7CA 2LCCA 3TU4K 2ZGWA 4D8KA 5GMKi 1NYFA 1QVFS 2P4RA 2GFAA 1PKTA 1M2VB 3LGLA 2CREA 2M16A 3JCMf 4C8QA 2E5QA 2DYBA 3OBWA 5GAMd 3RBBB 2QI2A 1YCYA 4IUTA 2EBPA 2A28A 1VQ4Q 2XKOC 2ZZDA 3LH5A 1M1KU 4RTZA 1KC8C 4M77D 2L5QA 5KYXB 3QWXX 2DJQA 2K4YA 3UDCA 2DIQA 5GAOl 4JLGA 1VQMT 4MMLA 4FYXB 4M7AB 2EKHA 2X3XD 4XTVA 2CZ1B 4MZMA 4DBQA 1YJNT 2E3HA 3EH1A 3G7ZA 3FJ5A 1K73C 3M56A 2QEXT 3CPFA 4JJNK 5CKEA 1WYXA 3C95A 1PCXA 5FLXE 5HY6A 1VQ5Q 2OTJT 1UJYA 3CCLQ 4M78F 3I35A 5KE3A 3FC3A 1EZZB 2B8AA 3M0PA 1KG1A 3FB9A 1U1TA 2P4TA 1RUWA 1ZUYA 3REBB 3E9GA 2E41A 4K11A 2FPDA 5GAN6 5CKFA 1UB4A 1VQ7A 4FW2A 1YHQQ 4C0DB 4E6RA 1D1BA 2KAFA 4C8QG 1M90C 3H6ZA 1F1BB 2LNHB 1M3BA 5IHNA 5KCHA 2CYZB 1R8OB 4Z89A 1NEBA 2YLBA 1YHQA 1ZA1B 2P0KA 1QVGP 3MO8A 4N4IA 1QLYA 5CK9A 2CSQA 3QDRB 2QTVA 1FMWA 1K73R 3DLMA 1K8AC 3CCUQ 3P8HA 2QXFA 5J3BA 2XK0A 4LUDA 4A4KA 4C8QC 1AVZC 3VUBA 1S72T 5FU6C 5D6WA 4HCBA 4AG2C 4NOYA 4XU0A 1YITT 2J06A 3BFMA 1VUBA 2JOYA 4M75B 2RQUA 2GF7A 3M0UA 2V8JA 1KQ1A 2WSEE 3EFOA 2A3LA 1NE8A 4OGEA 3DB4A 1MMAA 4C8QE 1M90R 4PLIA 5LL6S 5IXBA 4HCKA 1PWTA 2L0AA 2YUQA 2FG0A 4X34A 2MYSA 4GLMA 4QQ6A 1PKSA 1Q86R 4J9FA 1N8RU 3EGDA 1RAIB 1OX9A 4L5GA 5GANj 3M5AA 3CCRQ 1K8AR 5LJ3h 1WXTA 1V29B 4OMLA 3DLLA 2SRCA 4ZN1A 1VYVA 2SEMA 4QQDA 1T0JA 1Q7YR 2KT8A 2JW4A 2EW3A 3FJPA 1M4ZA 4Y92A 2RK1A 4ORZA 3URGA 1MMGA 3CXCP 2ENMA 1UHFA 2ZCFB 2F69A 2VB6A 4PNOA 1QCNA 5GJWB 4OMFB 4GLKA 2DA9A 2ED0A 1G83A 5IXFA 1NPRA 2RH2A 1Q82U 1ZQ1A 2NUPA 2RMOA 2H8HA 2C06A 2FVUA 2JZ2A 2QGFB 2DERA 1C1AA 1GFDA 1NJIC 1JXOA 1H3HA 4F14A 4BDZA 2ABLA 2JS0A 4C92B 3KXTA 4XU1A 4F7UB 2D0NA 4RCBA 1RAFB 4BE0A 1U1SA 1YJ9Q 5GAMj 3OYMA 3A8MB 3JCMJ 2AK5A 4PJOG 4M7DE 2LJ0A 3VS1A 1GBQA 2Z0WA 3L2WA 4C0GA 4B9WA 1OPLA 5D6YA 3CCVQ 1VIEA 3LWIA 3QBYA 2HMAA 3G71Q 1QKWA 1YJ9A 1GL5A 4ZTFA 3ULRB 3CPWS 3VS5A 1MMDA 2ZPIB 2HL3A 3CCJT 2DRKA 3G6EQ 1AZGB 1U8RA 3L1AA 3OSSC 1OZ3A 3M58A 3CCVA 5DY9A 3VUZA 3HRSA 2GQIA 2P84A 2JVVA 2HL5C 2JS2A 1WHLA 5LJ5e 1QVGA 4RG2A 3L2UA 3MEWA 3QYGB 1I0CA 1M1KC 3MP6A 1LOJA 3KBGA 3VJPA 5GAN8 2O4XB 3VS0A 2EQMA 1VOMA 5CR2A 5GAN4 4PLLA 1W2BS 1WQWA 2CP6A 4OF1A 5FU7B 4A4GA 1TSFA 4DEYA 1A0NB 2KVQG 2XG8D 4CI0C 2J6KA 2JNGA 2ZAEA 5KYYA 2CDTA 1AZEA 2VVKA 4LE9A 3I56T 2GGRA 2HQXA 5IH2A 3NHNA 1YJWT 3X25B 1X6OA 1VQNT 1VQMQ 3TREA 3OMCA 3CC4T 2RHUA 1LNXA 4E7JA 3C0CA 1BYMA 4E47A 2DO3A 3I55T 1YJNQ 1P92A 1D3BB 3OW2P 2MMPA 5I21A 4FCYA 3MPUB 4J9IA 2QEXQ 1LJOA 1QWFA 4ANJA 2VYTA 3E19A 1RLQC 3EGXA 1VQMA 4LDYA 1KHIA 2OTJQ 2V1QA 4PK4A 1YBYA 2O88A 4QT7A 2Y4YA 1YJNA 2KXCA 1YWPA 1K73U 1U5SA 1PRMC 2IPOB 3VU3C 2RQWA 4Q5WA 1KQSS 2KSSA 4PJMA 5C6SA 1T3SA 2X3WD 2DZ9A 4N0AA 2EQIA 2XHCA 1ZUKA 2FHDA 4ZTJA 2WSCE 1M30A 4XTYA 3G4SA 4HCZA 4J6YA 1I5LA 3CCET 3UPUA 4Z02A 4PJNA 3PVLA 1NM7A 1UE9A 2P0QA 2X4JA 4XTZA 4BDYA 4ATOA 2EYQA 1EFNA 4RMOA 2XICA 1E7OA 1VQ9A 1ZSZB 1IRXA 1W6XA 4JS4A 1BIBA 2F2XA 3I9QA 2JTFA 3NTHA 5FW9A 2QDYB 1YI2A 8ATCB 4PJJA 3JCMV 2X4WA 5CIUA 4J8OA 3M0SA 2Y90A 1M90U 2D8JA 2D0QB 2DE0X 4M77A 1YN8A 3MHXA 1ZA2B 3F70A 4ESRA 3QHSA 1Q86U 2A0FB 1S72Q 3PGGA 4IIOA 3OYYA 2W0ZA 5GMKh 1YITQ 2PTKA 3QJ6A 3R6NA 2DZCA 2A36A 3JCMc 1K8AU 1D1AA 4KT0E 5KYWB 1N8RC 6AT1B 1J3TA 3NPFA 4F04B 4ELZC 1QVFP 1MNDA 4FL6A 1ZHIA 1Q7YU 3PTAA 3INZA 2RHYA 3PVQA 1IREB 2DM1A 1WHKA 2QQSA 1X2KA 1I4K1 1Y57A 1D0YA 3RKWA 3U23A 2D8HA 4M78B 4Y28E 1WGSA 4D6WA 2NYSA 3CCRT 4HKEA 4RTWA 1WHMA 1B34A 1TWBA 2RN8A 4PJOB 2M0YA 1AWJA 1KSWA 3JV3A 4FYVB 4OP0A 2CSIA 3EGDB 3V7SA 1HJDA 1Q82C 2LT4A 3CMAA 1KQ2A 2CS7A 4A54A 1N9RA 2IVWA 3EG3A 3R6OA 4N0AC 2J7IA 4AFUC 5KCOA 3EG1A 3GPLA 1YCSB 1PD1A 3X20B 2AT1B 1WHHA 4MZTA 4C8QF 2YWWA 3E2UA 2IIMA 2M51A 1RLPC 5DLOA 2E70A 2HQEA 2M9UA 3REAB 1CKBA 1FWZA 2L89A 2V8KA 1KD1C 3EHQA 2LT1A 2CT3A 3EH2A 2OTLT 1WHJA 2DIGA 3VS3A 5I2SA 4BY6B 4HVUA 2XDDA 5LJ5d 4LDVA 3C4SA 2XI9A 3SFMA 4BI3A 1VIFA 4J9BA 4C5EA 1XNIA 3S3NA 5HKCA 1M8VA 2JTEA 4M77C 3FDRA 4PFPA 3TSWA 4M7AD 2MPXC 4KBMB 1VQPA 1HSQA 1YP5A 1VQKA 3G71T 4R0KA 3MJXA 4J9HA 1M27C 1T3LA 1AWOA 2CH4A 3JCMg 2DVJA 4HVVA 4L6V5 4DA4A 1X27A 3CCST 2E4HA 4ZGEB 1UUEA 2XDBA 4LDXA 2DMOA 4M77E 2J6FA 3CCJQ 2EAYA 1QVPA 3TEEA 2KRMA 3JSCA 3JCMP 4GY5A 2CP2A 2DAQA 3G1JA 3FLGA 1KD1R 5LJ3e 2FPEA 4JRQA 1TOVA 2HAXA 2RQTA 4LNPA 4BB7A 1KJWA 1NLPC 3CBPA 1VQ8A 1H92A 3DB3A 1IXDA 4LXCA 2DL7A 2YUPA 1BI3A 1UEBA 2C0TA 3IQLA 1AHJB 1W4SA 3SWNB 1BI2A 4N4GA 1X6GA 1WX6A 3EG0A 3TVTA 3PFSA 2M1HA 3QIIA 4PJLA 2L2PA 4HT8A 1QVFA 2PUOB 3I56Q 4EMKA 5GMKm 3QO3A 1AD5A 4J7IA 1UG1A 1YJWQ 4FSXA 1VQ4A 2QQBA 2KNBB 1WXUA 1VQNQ 2PNIA 3CC4Q 3BY7A 2RA2A 3A1PA 4KRTA 2ROTA 3C94A 5GANf 1PRLC 3I55Q 4M75D 2O9VA 2X4XA 1NZ9A 5GAOq 1WZOA 1HXDA 1VQNA 2E3IA 4J9EA 1OEBA 2J6OA 3MEAA 1U06A 3H0HA 2CZ7B 3CEYA 4DQ2A 2G3RA 2JM9A 1I1JA 1X43A 2KDSA 4PJOF 1O9SA 1VQ5A 1BI1A 1RAAB 1WPYA 2YDLA 3EGXB 5M9OA 3CCLA 1SRLA 2BIVA 4PFZA 5GAMg 2LP5A 3J7AF 4FIBA 3QG1A 4HXJA 4ELYC 3RDVA 3Q1JA 1SPKA 2I2LA 3CCQT 1TG0A 3CCEQ 2DXCA 4RCCA 2HNIA 5FWCA 2E6ZA 3HSBA 4M7DA 3EGUA 3HPWA 2DF6A 1Q86C 1G8XA 3P8DA 2LCSA 4DBFA 3GOXA 2AZVA 1VQ6T 4QKUA 2COWA 5GAMf 3OYCA 8AT1B 3ME9A 2K5LA 1IO6A 2QA4T 3D7SB 1D09B 4DOWA 1Y96A 1Q7YC 2EPDA 1ZBXA 4EPCA 1CSKA 1C0MA 1RAEB 1Z9QA 4KH0B 3CCUA 3QXEB 5GAN5 1QP2A 1Y07A 2YRDA 5IHIA 3A5ZB 1D0ZA 2AKLA 1LCKA 1UGRB 1VYTA 2JN0A 3QZ9B 1BI0A 3UA6A 5GAN2 3MEVA 4C92D 1Q95G 4O5VA 4EMKC 2KY9A 1M8MA 1FMKA 3JRZA 1TU0B 2LX9A 4HVWA 3PT9A 2EQKA 4A4EA 1I81A 4XAXB 1JBMA 2MK5A 5LJ5j 2PVOB 3HTRA 3OA6A 2DL3A 3ZL7C 9ATCB 5KH6A 1N9SA 4C5HA 3PIPA 2LVMA 3CC2T 3S3OA 3SDZA 1QMCA 4M7DG 5IHKA 3JB9F 4JRIA 2KEAA 2RI5A 1VYUA 2K5FA 2LTOA 3CCRA 2GNCA 1QQJA 1SHFA 2DILA 2VGNA 2DPPB 1I5OB 4EDUA 2X9HA 3KUFA 2KRNA 3JCMX 4OB0B 3CCMT 2DXBA 1UTIA 2A08A 3E1SA 4M7DC 2PVDB 1JJ2S 1WNLA 2RF0A 2LQKA 2DL5A 2COYA 2LMJA 2OTLQ 5LJ3d 4FYWB 1WLPB 2XDPA 1R0CB 5KYUA 3VS7A 1WJQA 4E7IA 1V1CA 5GMKe 2O2OA 2VXFA 1M1GA 3ZEHA 1KD1U 3HFOA 3EG2A 3GNFB 2HKQB 4J9GA 1IB8A 2HBWA 2HKNA 1YIJT 4J7FA 1ACMB 2FZCB 2GQVA 2YHTA 3QWYA 4E2FB 2O01E 4LN2A 2LX7A 4DOVA 4LDUA 3JCMe 3HL8A 1SSFA 3UA7A 2I0NA 4OB2B 4AG1C 3CCSQ 1JEGA 3HKSA 3G71A 3JCMb 3VS6A 1BKBA 1PC0A 3TCJA 4RG8A 2DRMA 3M0RA 3G6EA 4BD3A 3CCSA 1GCPA 2RQRA 4A4HA 3BE3A 4JJCA 4C0FA 3EFRA 2RK2A 2COZA 2XIDA 2AIRB 1BB9A 1KIKA 2VWFA 2K3YA 2ZPGB 3CPWA 4AFZC 4HCCA 1UDLA 1PNJA 3OYKA 2CP3A 2RI3A 2NWMA 3OYJA 1RACB 1AOJA 4C8QB 4HT9A 5FU6B 4OB1B 3HRUA 3O5ZA 4TVRA 4VUBA 5KYXA 2NLUA 2AKKA 3CBOA 2DTHA 4UC4A 2DD5A 2R5AA 1W2BA 4M7AA 5FWBA 3VYHB 3RUXA 4V2SA 2F5TX 1UECA 4FT2A 3SB2A 4IKFA 1DJ7B 2YUOA 3H0IA 3CXCS 1FYNA 4A53A 3OQ5A 4ME7A 1K0XA 3OS1A 2Y4XA 2QEXA 2BZYA 3M59A 2RI2A 4M78D 2L3SA 4BI4A 2VC8A 1NEGA 2OTJA 1W1FA 1VQ7T 2C0OA 1UFFA 2KROA 1XOVA 2RJCA 3VRZA 2BZ8A 3A8OB 3J81E 4PJOD 5IT9E 2QGGA 1N6AA 2GBQA 3CCQQ 2YXYA 3A8LB 2CP5A 2QQRA 3EG9A 4QVDA 4AT1B 1OQKA 2ESWA 1OU8A 5L8RE 5J39A 3RR6A 3HFNA 4JRPA 3QPHA 2RM4A 5A0GA 3FIFA 4MDXA 1RABB 1PD0A 1KQSA 4M7DB 1EX4A 1ABQA 2KMTA 1VQ6Q 4JPBW 4OGCA 1G2BA 1X6BA 1UGQB 1TUGB 1E6GA 2KXDA 1PSFA 1IGQA 1K1ZA 2AZSA 2QA4Q 1UGSB 1K76A 3QJYA 4M7AG 4II1A 2JUFA 5CAIA 3VS2A 1ZBJA 2H3EB 2KYBA 3OSVA 4LUEA 2NUTA 2RJFA 2QA4A 3TQ7P 1S72A 2HDAA 2OX7A 4M75A 1GFCA 3NMZC 4XU3A 4OMQA 1YITA 1TH7A 2PZ1A 3RKXA 4RTVA 1JRIA 2RO0A 3N5BB 4KUIA 3S3MA 3JCMh 4OMPA 2EKOA 2L3QA 3EFOB 2E64A 4M7AC 5LJ3j 2LC4A 4WCIA 4ZN3A 1SSHA 3RESA 1WDXA 4JLIA 2DTIA 4JUVA 5CKHA 1WXBA 3MP1A 2JT4A 3TSZA 3CC2Q 2FPFA 1BCMA 1G3TA 1BIAA 3GP8A 1ZX6A 4OB3B 2KGTA 2QAZA 3H41A 2XD0A 2FO0A 4M7AE 4J5YA 4P5NA 1X2QA 5I22A 3M55A 1GBRA 2CH4W 2DXTA 1VQLT 3CC2A 4M77G 3JB9D 1H641 3VYGA 3JCMd 3OW2S 4O6JA 2DNUA 1WIEA 4C0ZA 3CCMQ 3EHRA 2KK4A 5HK3A 2CT4A 3VS4A 5EC7A 4MDWA 1OZ2A 5CO7A 4LDWA 4CRIA 2JM8A 1YFNA 3OY9A 3QKJA 5CQYA 2GFUA 2K9GA 4M75G 2NUPB 5CCAA 1G5VA 1FX7A 1X69A 2FYKA 3CCMA 4C92A 4F7UA 2EIFA 1K4US 4BE1A 1SHGA 1K9MC 1ABOA 2CP7A 3L2RA 2HQHA 1WQ7A 2K5IA 1OU9A 4D8DA 1YIJQ 2DXUA 2YRVA 1LVKA 2OI3A 4M75C 1K0SA 2MOXA 3RNJA 3X26B 2VASA 1SF9A 4MMKA 5GAMh 4C5GA 2MF2A 1YIJA 1AWWA 3OYBA 1X75C 2MWPA 2GTJA 2PVGB 3GLXA 3RKYA 2VKNA 2RQVA 4FT4A 4GBQA 2V8IA 2DETA 2CGHA 3CCJA 2R58A 2E1HA 3A8HB 4M75E 1GRIA 2B86A 2ATCB 1PHTA 3BDUA 2E6NA 2O4XA 4RTYA 5LJ5g 4M7DF 3NFCA 2MIOA 3CD6T 5GANg 1UHCA 1SEMA 1H8KA 3EAEA 2VGMA 3MKDA 2C0IA 4QW2A 1K9MR 2VUBA 2HZYA 3OB9A 5GMKl 5CVIA 1TTHB 5ECAA 5I2MA 4C92G 3C12A 4JDSA 2PU9B 2ZPEB 4F7UG 1TXQA 2CP0A 4LD9K 3SHWA 2R5MA 1BU1A 5CKBA 1QKXA 5KYYB 5LJ5f 4X9CA 3QDFA 1AT1B 1I8FA 1ZLMA 2K7AA 1MV0B 4KGXB 2EGCA 1KHCA 3I56A 1YJWA 2FRYA 1D3BA 2EYXA 1BBZA 1NPPA 3GNGA 3T9NA 1B07A 2VXEA 4EMGA 3M54A 4C92C 3CC4A 4JJDA 3O8VA 2KYMA 5GAOm 2D9TA 2DD4A 3UF4A 3I55A 2YSQA 5DM7R 1WHGA 2K6DA 3RMSA 1TS9A 1NG2A 1JJ2P 2D1XA 3G4ST 1VQ7Q 2X35A 4OMMA 2YT6A 4FSSA 1MGQA 2HEQA 4BE2A 2ZPFB 3WVDB 4C92E 3OYNA 4RKUE 4F7UE 2GTOA 3S6WA 1VQ9T 1C6VX 2FZKB 4KUDK 3L2VA 4IUQA 4XTXA 2ECZA 3E9FA 4Z88A 3JCMW 1ZSZA 1YI2T 3CCEA 5A0LA 4ZGDB 2EYWA 4J9CA 3EG9B 1KC8R 4XTUA 1MV3A 1AEYA 5FRMA 1JU5C 1OV3A 4XK8E 5J26A 5GMKj 2QASA 4A63B 4BI8B 3QSUA 1Z9ZA 3AT1B 1FMVA 3CPWP 2K2MA 4DBRA 3X24B 3CC7T 2DVEA 4QVZA 2RPNA 1Y7XA 3V8LA 4B6MA 4M77B 3ZBDA 4F17A 5FU7C 2BE7D 2EVRA 3PMIA 2LJ3A 2R57A 2KT1A 1Q81C 3SEMA 1PG5B 2RJDA 1KFZA 3HP9A 4XTWA 3LLRA 4CC4B 5KYWA 3QUIA 3LYIA 2VV5A 3OYEA 1R0BG 2A37A 3PNWC 3H9NA 4X9DA 2NUTB 1VQOT 1WJSA 1W2BP 3HHTB 1TUDA 3JCMQ 2KQWA 4E7LA 3OYIA 2WSFE 2EJ9A 2BZXA 2RD1A 4KH1B 3M9QA 5CKDA 1GCQA 2KBTA 4M78A 2QTXA 5HCKA 2O31A 1QP3A 2E5KA 1KK7A 2RJEA 2DEQA 1D1CA 4PJOA 3OS0A 1AWXA 4PKCC 1Y0MA 2AHJB 2KE9A 1B34B 3CMAT 3DKMA 3UT1A 1G3SA 5AT1B 7AT1B 2ROLA 4EIKA 2RHIA 2H3JA 3MCAB 2EFIA 2CZ6B 3RIRA 2BKDN 1OYXA 2DFUA 2DL4A 2EYYA 5KE2A 1QCOA 2CZ0B 4AFSC 1VQLQ 1Q81R 2MWOA 2JMAA 2W10A 1OPKA 2HSEB 3JB9I 2CUDA 1FXXA 5D7UA 1X01A 1PM3A 2EQUA 2E65A 2K3BA 4AFQC 1XQHA 1ARKA 1ZSZC 1WA7A 5A0DA 4C8QD 1VQLA 5C0MA 3V7RA 4ZNXA 1NLOC 1MUZA 1KQSP 2EGEA 2EGAA 4CC7A 5D6XA 1QCFA 3LGFA 3L42A 1N5ZA 2XMFA
chains in the Genus database with same CATH topology
3VRZA 2BZ8A 2FPDA 4J9BA 2GBQA 4E6RA 4CC3A 2JTEA 2ESWA 1B3QA 2LNHB 3TSWA 1M3BA 5IHNA 1WFWA 1HSQA 1YP5A 4Z89A 4RTXA 2O9SA 1NEBA 4R0KA 1ABQA 4J9HA 1M27C 1T3LA 2KRSA 1AWOA 2CH4A 4JPBW 1G2BA 1X6BA 2DVJA 4HVVA 1E6GA 2DX1A 2KXDA 1QLYA 1X27A 2CSQA 1K1ZA 2AZSA 1HD3A 1UUEA 2DMOA 2NUZA 1K76A 2J6FA 3THKA 4LUDA 1AVZC 2OAWA 3VS2A 2KRMA 2CUBA 1GCQC 1ZBJA 4AG2C 2KYBA 2FPEA 4LUEA 1M3CA 2RQTA 2J06A 4LNPA 2HDAA 1KJWA 1NLPC 2K79A 1GFCA 1UGVA 3NMZC 1ZSGA 2RQUA 1VA7A 4OMQA 3M0UA 1H92A 3NGPA 2QDLA 2DL7A 2PZ1A 2YUPA 4RTVA 4OMPA 4Z8AA 1QWEA 2C0TA 2KR3A 2L3QA 3IQLA 2DBKA 2DL8A 5IXBA 4HCKA 1PWTA 2L0AA 4WCIA 1X6GA 2YUQA 1WX6A 4RTTA 2FG0A 4GLMA 1SSHA 1PKSA 4X1VA 3EG0A 1WDXA 5GJVB 3TVTA 4J9FA 4RTUA 2LQWA 1NYGA 1K9AA 1WXBA 2JT4A 5L23A 4DEXA 2L2PA 3TSZA 2FPFA 1AD5A 1UG1A 1ZX6A 1WXTA 1TUCA 4OMLA 3KFVA 2SRCA 2KGTA 1M3AA 2KNBB 3H41A 1WXUA 2FO0A 1YNZA 1VYVA 2PNIA 2SEMA 1X2QA 1T0JA 4F16A 5I22A 3I5SA 2L3PA 4KRTA 2JXBA 2KT8A 2ROTA 2JW4A 1GBRA 1PRLC 2CH4W 2EW3A 4Y92A 4ORZA 2O9VA 1CKAA 2ENMA 4J9DA 1UHFA 2BTTA 5GJWB 2DNUA 1WIEA 4J9EA 1OEBA 2J6OA 3EHRA 2DA9A 1U06A 2CT4A 3VS4A 2ED0A 3H0HA 1G83A 5EC7A 5IXFA 2LQNA 2JM9A 1I1JA 1JXMA 1X43A 3A98A 2JM8A 3M0TA 2YDLA 2DBMA 2RMOA 2H8HA 2K9GA 1SRLA 1X69A 2LP5A 4HXJA 1GFDA 3M0QA 1JXOA 1SPKA 1H3HA 4F14A 2ABLA 2JS0A 1TG0A 2RNAA 5FWCA 1K4US 1SHGA 2D0NA 1ABOA 3EGUA 2DF6A 2FRWA 2AK5A 4D8DA 2LJ0A 2LCSA 1GBQA 3VS1A 1W70A 1BK2A 2AZVA 1OPLA 2OI3A 1K0SA 2MOXA 3RNJA 1QKWA 2JMCA 2F2VA 1GL5A 1IO6A 3ULRB 2V1RA 4RUGA 2EPDA 3VS5A 1AWWA 1CSKA 2DRKA 1AZGB 1Z9QA 2GTJA 2VKNA 2RQVA 1WI7A 4GBQA 2GQIA 5IHIA 2DLPA 2AKLA 1LCKA 1VYTA 2JS2A 3UA6A 1GRIA 2B86A 2HCKA 1PHTA 1I0CA 4RTYA 2MIOA 1JO8A 3VS0A 1UHCA 1SEMA 1H8KA 1M8MA 1FMKA 2LZ6B 2C0IA 4CC2A 4HVWA 2FEIA 1E6HA 5ECAA 4DEYA 3VRYA 1U3OA 1A0NB 2J05A 4JZ3A 2DL3A 2J6KA 3ZL7C 3SHWA 1BU1A 2F2WA 2CDTA 1AZEA 4JZ4A 2VVKA 4LE9A 2GGRA 2LJ1A 1QKXA 5IH2A 3NHNA 5IHKA 2YUNA 2OJ2A 1ZLMA 2K7AA 1MV0B 4JJBA 2KEAA 2EGCA 1T0HA 1VYUA 4OMOA 3C0CA 2FRYA 2GNCA 1SHFA 2EYXA 1BBZA 2G6FX 1B07A 2DILA 4J9IA 4JJDA 2KYMA 1QWFA 2KRNA 3UATA 1RLQC 3UF4A 1UTIA 2YSQA 2V1QA 2A08A 2O88A 4QT7A 2MCNA 1RI9A 2K6DA 3PE0A 2KXCA 1NG2A 2RF0A 2D1XA 2DL5A 2HSPA 1YWPA 2LMJA 1U5SA 1PRMC 2RQWA 4OMMA 2YT6A 1T3SA 2X3WD 4FSSA 1WLPB 2EQIA 1OOTA 3H0FA 1ZUKA 1JQQA 2HEQA 1M30A 3VS7A 1V1CA 2GTOA 2O2OA 2ED1A 3PVLA 1NM7A 1UE9A 2ECZA 4Z88A 1EFNA 3I5RA 3EG2A 2EYZA 1E7OA 4J9GA 1W6XA 3CQTA 2EYWA 4IIMA 4J9CA 4M4ZA 2HBWA 3I9QA 2F2XA 3GBQA 1MV3A 1UJ0A 3QWYA 1AEYA 5FW9A 5I11A 1JU5C 1OV3A 4LN2A 2LX7A 4A63B 1Z9ZA 3M0SA 3UA7A 2D8JA 2I0NA 2K2MA 4AG1C 1JEGA 2DE0X 1S1NA 1YN8A 2RPNA 1SRMA 4ESRA 1YWOA 3VS6A 4F17A 2EVRA 4IIOA 1I07A 2W0ZA 1ZUUA 2LJ3A 2DRMA 3M0RA 2KT1A 3SEMA 2PTKA 1KFZA 3R6NA 1GCPA 4OMNA 4CC4B 2A36A 2RQRA 4JJCA 4D8KA 2A37A 1NYFA 2P4RA 1J3TA 3NPFA 1PKTA 2CREA 1BB9A 1KIKA 2VWFA 4AFZC 1UDLA 1PNJA 1TUDA 2NWMA 3PVQA 2DM1A 2DYBA 2BZXA 1X2KA 1AOJA 1GCQA 2KBTA 3RBBB 1Y57A 3U23A 2D8HA 5HCKA 2O31A 2E5KA 2EBPA 2A28A 3O5ZA 3LH5A 4RTZA 4RTWA 2RN8A 1AWXA 2M0YA 1AWJA 1KSWA 1Y0MA 2KE9A 3JV3A 2CSIA 3QWXX 2AKKA 2DJQA 1HJDA 2ROLA 4EIKA 5FWBA 2DL4A 2EYYA 2EKHA 2X3XD 3EG3A 4AFSC 1UECA 2J7IA 4AFUC 2JMAA 3EG1A 2W10A 2YUOA 1OPKA 3FJ5A 3H0IA 1YCSB 1FYNA 2CUDA 1WYXA 2IIMA 1K0XA 1UJYA 2K3BA 2M51A 4AFQC 1ARKA 3I35A 1RLPC 1WA7A 3REAB 2BZYA 1CKBA 4ZNXA 2L3SA 3M0PA 3EHQA 1NLOC 1MUZA 2EGEA 2CT3A 1NEGA 2EGAA 4CC7A 1QCFA 1RUWA 1W1FA 1ZUYA 1UFFA 2C0OA 3REBB 1N5ZA 3VS3A 2KROA 4HVUA 1XOVA 2XMFA 4K11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRZ A;  2BZ8 A;  2FPD A;  4J9B A;  2GBQ A;  4E6R A;  4CC3 A;  2JTE A;  2ESW A;  1B3Q A;  2LNH B;  3TSW A;  1M3B A;  5IHN A;  1WFW A;  1HSQ A;  1YP5 A;  4Z89 A;  4RTX A;  2O9S A;  1NEB A;  4R0K A;  1ABQ A;  4J9H A;  1M27 C;  1T3L A;  2KRS A;  1AWO A;  2CH4 A;  4JPB W;  1G2B A;  1X6B A;  2DVJ A;  4HVV A;  1E6G A;  2DX1 A;  2KXD A;  1QLY A;  1X27 A;  2CSQ A;  1K1Z A;  2AZS A;  1HD3 A;  1UUE A;  2DMO A;  2NUZ A;  1K76 A;  2J6F A;  3THK A;  4LUD A;  1AVZ C;  2OAW A;  3VS2 A;  2KRM A;  2CUB A;  1GCQ C;  1ZBJ A;  4AG2 C;  2KYB A;  2FPE A;  4LUE A;  1M3C A;  2RQT A;  2J06 A;  4LNP A;  2HDA A;  1KJW A;  1NLP C;  2K79 A;  1GFC A;  1UGV A;  3NMZ C;  1ZSG A;  2RQU A;  1VA7 A;  4OMQ A;  3M0U A;  1H92 A;  3NGP A;  2QDL A;  2DL7 A;  2PZ1 A;  2YUP A;  4RTV A;  4OMP A;  4Z8A A;  1QWE A;  2C0T A;  2KR3 A;  2L3Q A;  3IQL A;  2DBK A;  2DL8 A;  5IXB A;  4HCK A;  1PWT A;  2L0A A;  4WCI A;  1X6G A;  2YUQ A;  1WX6 A;  4RTT A;  2FG0 A;  4GLM A;  1SSH A;  1PKS A;  4X1V A;  3EG0 A;  1WDX A;  5GJV B;  3TVT A;  4J9F A;  4RTU A;  2LQW A;  1NYG A;  1K9A A;  1WXB A;  2JT4 A;  5L23 A;  4DEX A;  2L2P A;  3TSZ A;  2FPF A;  1AD5 A;  1UG1 A;  1ZX6 A;  1WXT A;  1TUC A;  4OML A;  3KFV A;  2SRC A;  2KGT A;  1M3A A;  2KNB B;  3H41 A;  1WXU A;  2FO0 A;  1YNZ A;  1VYV A;  2PNI A;  2SEM A;  1X2Q A;  1T0J A;  4F16 A;  5I22 A;  3I5S A;  2L3P A;  4KRT A;  2JXB A;  2KT8 A;  2ROT A;  2JW4 A;  1GBR A;  1PRL C;  2CH4 W;  2EW3 A;  4Y92 A;  4ORZ A;  2O9V A;  1CKA A;  2ENM A;  4J9D A;  1UHF A;  2BTT A;  5GJW B;  2DNU A;  1WIE A;  4J9E A;  1OEB A;  2J6O A;  3EHR A;  2DA9 A;  1U06 A;  2CT4 A;  3VS4 A;  2ED0 A;  3H0H A;  1G83 A;  5EC7 A;  5IXF A;  2LQN A;  2JM9 A;  1I1J A;  1JXM A;  1X43 A;  3A98 A;  2JM8 A;  3M0T A;  2YDL A;  2DBM A;  2RMO A;  2H8H A;  2K9G A;  1SRL A;  1X69 A;  2LP5 A;  4HXJ A;  1GFD A;  3M0Q A;  1JXO A;  1SPK A;  1H3H A;  4F14 A;  2ABL A;  2JS0 A;  1TG0 A;  2RNA A;  5FWC A;  1K4U S;  1SHG A;  2D0N A;  1ABO A;  3EGU A;  2DF6 A;  2FRW A;  2AK5 A;  4D8D A;  2LJ0 A;  2LCS A;  1GBQ A;  3VS1 A;  1W70 A;  1BK2 A;  2AZV A;  1OPL A;  2OI3 A;  1K0S A;  2MOX A;  3RNJ A;  1QKW A;  2JMC A;  2F2V A;  1GL5 A;  1IO6 A;  3ULR B;  2V1R A;  4RUG A;  2EPD A;  3VS5 A;  1AWW A;  1CSK A;  2DRK A;  1AZG B;  1Z9Q A;  2GTJ A;  2VKN A;  2RQV A;  1WI7 A;  4GBQ A;  2GQI A;  5IHI A;  2DLP A;  2AKL A;  1LCK A;  1VYT A;  2JS2 A;  3UA6 A;  1GRI A;  2B86 A;  2HCK A;  1PHT A;  1I0C A;  4RTY A;  2MIO A;  1JO8 A;  3VS0 A;  1UHC A;  1SEM A;  1H8K A;  1M8M A;  1FMK A;  2LZ6 B;  2C0I A;  4CC2 A;  4HVW A;  2FEI A;  1E6H A;  5ECA A;  4DEY A;  3VRY A;  1U3O A;  1A0N B;  2J05 A;  4JZ3 A;  2DL3 A;  2J6K A;  3ZL7 C;  3SHW A;  1BU1 A;  2F2W A;  2CDT A;  1AZE A;  4JZ4 A;  2VVK A;  4LE9 A;  2GGR A;  2LJ1 A;  1QKX A;  5IH2 A;  3NHN A;  5IHK A;  2YUN A;  2OJ2 A;  1ZLM A;  2K7A A;  1MV0 B;  4JJB A;  2KEA A;  2EGC A;  1T0H A;  1VYU A;  4OMO A;  3C0C A;  2FRY A;  2GNC A;  1SHF A;  2EYX A;  1BBZ A;  2G6F X;  1B07 A;  2DIL A;  4J9I A;  4JJD A;  2KYM A;  1QWF A;  2KRN A;  3UAT A;  1RLQ C;  3UF4 A;  1UTI A;  2YSQ A;  2V1Q A;  2A08 A;  2O88 A;  4QT7 A;  2MCN A;  1RI9 A;  2K6D A;  3PE0 A;  2KXC A;  1NG2 A;  2RF0 A;  2D1X A;  2DL5 A;  2HSP A;  1YWP A;  2LMJ A;  1U5S A;  1PRM C;  2RQW A;  4OMM A;  2YT6 A;  1T3S A;  2X3W D;  4FSS A;  1WLP B;  2EQI A;  1OOT A;  3H0F A;  1ZUK A;  1JQQ A;  2HEQ A;  1M30 A;  3VS7 A;  1V1C A;  2GTO A;  2O2O A;  2ED1 A;  3PVL A;  1NM7 A;  1UE9 A;  2ECZ A;  4Z88 A;  1EFN A;  3I5R A;  3EG2 A;  2EYZ A;  1E7O A;  4J9G A;  1W6X A;  3CQT A;  2EYW A;  4IIM A;  4J9C A;  4M4Z A;  2HBW A;  3I9Q A;  2F2X A;  3GBQ A;  1MV3 A;  1UJ0 A;  3QWY A;  1AEY A;  5FW9 A;  5I11 A;  1JU5 C;  1OV3 A;  4LN2 A;  2LX7 A;  4A63 B;  1Z9Z A;  3M0S A;  3UA7 A;  2D8J A;  2I0N A;  2K2M A;  4AG1 C;  1JEG A;  2DE0 X;  1S1N A;  1YN8 A;  2RPN A;  1SRM A;  4ESR A;  1YWO A;  3VS6 A;  4F17 A;  2EVR A;  4IIO A;  1I07 A;  2W0Z A;  1ZUU A;  2LJ3 A;  2DRM A;  3M0R A;  2KT1 A;  3SEM A;  2PTK A;  1KFZ A;  3R6N A;  1GCP A;  4OMN A;  4CC4 B;  2A36 A;  2RQR A;  4JJC A;  4D8K A;  2A37 A;  1NYF A;  2P4R A;  1J3T A;  3NPF A;  1PKT A;  2CRE A;  1BB9 A;  1KIK A;  2VWF A;  4AFZ C;  1UDL A;  1PNJ A;  1TUD A;  2NWM A;  3PVQ A;  2DM1 A;  2DYB A;  2BZX A;  1X2K A;  1AOJ A;  1GCQ A;  2KBT A;  3RBB B;  1Y57 A;  3U23 A;  2D8H A;  5HCK A;  2O31 A;  2E5K A;  2EBP A;  2A28 A;  3O5Z A;  3LH5 A;  4RTZ A;  4RTW A;  2RN8 A;  1AWX A;  2M0Y A;  1AWJ A;  1KSW A;  1Y0M A;  2KE9 A;  3JV3 A;  2CSI A;  3QWX X;  2AKK A;  2DJQ A;  1HJD A;  2ROL A;  4EIK A;  5FWB A;  2DL4 A;  2EYY A;  2EKH A;  2X3X D;  3EG3 A;  4AFS C;  1UEC A;  2J7I A;  4AFU C;  2JMA A;  3EG1 A;  2W10 A;  2YUO A;  1OPK A;  3FJ5 A;  3H0I A;  1YCS B;  1FYN A;  2CUD A;  1WYX A;  2IIM A;  1K0X A;  1UJY A;  2K3B A;  2M51 A;  4AFQ C;  1ARK A;  3I35 A;  1RLP C;  1WA7 A;  3REA B;  2BZY A;  1CKB A;  4ZNX A;  2L3S A;  3M0P A;  3EHQ A;  1NLO C;  1MUZ A;  2EGE A;  2CT3 A;  1NEG A;  2EGA A;  4CC7 A;  1QCF A;  1RUW A;  1W1F A;  1ZUY A;  1UFF A;  2C0O A;  3REB B;  1N5Z A;  3VS3 A;  2KRO A;  4HVU A;  1XOV A;  2XMF A;  4K11 A; 
#chains in the Genus database with same CATH topology
 4J6X A;  1IZ6 A;  4C5I A;  2FZG B;  3L2Q A;  2OTL A;  4CC3 A;  1VQP T;  2QQA A;  4M7A F;  4IUU A;  1VQK T;  2HBP A;  3CME T;  1B3Q A;  3H8Z A;  4M78 G;  2M0O A;  3FEO A;  1JJ2 A;  4PL6 A;  4YTL A;  2PQW A;  1MNE A;  1WFW A;  4NL2 A;  4RTX A;  2O9S A;  1GXI E;  1QVG S;  5A2Q E;  1EIF A;  2KRS A;  1G3Y A;  3PIO A;  4IUR A;  3LW5 E;  2DX1 A;  1K9M U;  4E7H A;  1HD3 A;  2YLC A;  3X28 B;  2LDM A;  2NUZ A;  2X51 A;  3THK A;  4Y91 A;  2OAW A;  1RL2 A;  2CUB A;  1GCQ C;  4M78 C;  5FRO A;  1N27 A;  1VQ8 T;  4KGZ B;  1M2V A;  3BW1 A;  2A7Y A;  1M3C A;  1O75 A;  3JB9 H;  2EJF A;  2V26 A;  5DLQ E;  4XU2 A;  4FYY B;  4EMH A;  2K79 A;  5LJ3 g;  4PJO C;  1UGV A;  3OMG A;  1ZSG A;  1VA7 A;  4DBH A;  4NL3 A;  4ZGJ B;  3NGP A;  2QDL A;  3CD6 Q;  4IUP A;  1XJW B;  3J80 E;  3V8K A;  3OYL A;  1NJI R;  4Z8A A;  5GAN e;  1QWE A;  2KR3 A;  1OX8 A;  3SWN A;  2RHX A;  2DBK A;  1UGP B;  2JJ9 A;  2DL8 A;  2M02 A;  2BE9 B;  2L8D A;  1OUL A;  4M78 E;  4M7D D;  3VV0 A;  4M77 F;  4RTT A;  3A8G B;  3M53 A;  4X1V A;  3CD6 A;  2IG0 A;  5GJV B;  1VQ4 T;  2E12 A;  2QG9 B;  3CBM A;  2LQW A;  2X4Y A;  1NYG A;  4RTU A;  4WF2 A;  1K9A A;  5EG2 A;  4PJO E;  5L23 A;  4DEX A;  1D0X A;  1XTD A;  5LJ3 f;  1MMN A;  1TUC A;  3BDL A;  4EMK B;  3KFV A;  3FRN A;  1M3A A;  1YNZ A;  2LNV A;  4M75 F;  4BY6 C;  4F16 A;  2LRQ A;  3I5S A;  2L3P A;  2JXB A;  2FL7 A;  3NTI A;  2QYZ A;  1CKA A;  4KUL A;  2K2V A;  4FU6 A;  4J9D A;  1MHN A;  2BTT A;  3ER0 A;  2P0P A;  1NBE B;  5GAN 3;  1KC8 U;  1VQ5 T;  1SKU B;  1OI1 A;  3V8J A;  3CCL T;  1LPL A;  3LX7 A;  2LQN A;  4BUG A;  2OAU A;  3OYA A;  1JXM A;  1M5Q 1;  1M1K R;  3A98 A;  2DKG A;  3M0T A;  4XQ3 A;  3JB9 J;  5GAM e;  2DBM A;  2DEU A;  3G4S Q;  3JB9 G;  3RMQ A;  1HYO A;  3M4Y A;  3M0Q A;  2RB6 A;  4J83 A;  3OS2 A;  3CXC A;  4E7S A;  1YHQ T;  1VQ9 Q;  2RNA A;  5IN1 A;  1YI2 Q;  2FRW A;  3QZ5 B;  3CCQ A;  2EQJ A;  3WVE B;  2L3R A;  1IHV A;  1RAH B;  2ZPH B;  4AMC A;  3OYH A;  1W70 A;  1BK2 A;  4E7Z A;  1RAD B;  4R56 A;  2QK0 A;  2JMC A;  2K3X A;  2F2V A;  4BAC A;  3OYD A;  3CCU T;  2EWN A;  5GAO n;  2V1R A;  2CKK A;  3CC7 Q;  1VQ6 A;  4RUG A;  3OYG A;  4FW1 A;  1Y96 B;  3SWN C;  3GF5 A;  4QVC A;  2F5K A;  5GAO p;  1SG5 A;  1G3W A;  1IGU A;  1WI7 A;  3EFS A;  4C92 F;  3WXM B;  2DLP A;  4F7U F;  4LD6 A;  3CC7 A;  2HCK A;  2DTO A;  1RAG B;  2KI7 A;  2DJZ A;  1JO8 A;  1VQO Q;  2HD0 A;  2LZ6 B;  1Q81 U;  2DK3 A;  4CC2 A;  4KGV B;  4PFO A;  2FEI A;  1E6H A;  2K57 A;  3VRY A;  2MAM A;  1U3O A;  1VQO A;  2J05 A;  4JZ3 A;  4A4F A;  4R55 A;  2F1L A;  1BCO A;  4E7K A;  3M4G A;  2D6F A;  2F2W A;  4JZ4 A;  1H3Z A;  2LJ1 A;  4OVA A;  4J6W A;  3CMA Q;  2YUN A;  3ASK A;  2OJ2 A;  4JRK A;  3JAM E;  2BUD A;  1M9S A;  2DYI A;  4N4H A;  5LJ5 h;  3MP8 A;  2MI6 A;  4JJB A;  2WAC A;  3M57 A;  3GIB A;  1T0H A;  3OS5 A;  4OMO A;  5GAN h;  4C0D C;  2G6F X;  2ZPB B;  2PUK B;  4HA8 A;  2E10 A;  4JS5 A;  3UAT A;  5GAN 7;  2JTM A;  2FB7 A;  1B7T A;  1N8R R;  2MCN A;  1RI9 A;  3PE0 A;  1HK9 A;  5AYF A;  2HSP A;  5IAY A;  5HK0 A;  1IHW A;  1R77 A;  3QYH B;  2GCX A;  1OOT A;  3H0F A;  1JQQ A;  2YRC A;  1JB0 E;  3AHU A;  4QQG A;  3OW2 A;  2EJG A;  4WTO B;  5KYU B;  1VQP Q;  5GAO r;  2ED1 A;  1WJR A;  3PMT A;  3LH0 A;  2RHZ A;  1VQK Q;  5GAN d;  2QQ9 A;  3I5R A;  2XU8 A;  3CME Q;  4IUV A;  1YJ9 T;  3VKI A;  3NTK A;  3RER A;  2EYZ A;  3CQT A;  4M4Z A;  3MET A;  4IIM A;  3GBQ A;  3HRT A;  3OBY A;  1UJ0 A;  5KYN A;  5I11 A;  4L59 A;  3CCV T;  1NJI U;  3LWH A;  4B9X A;  3MEU A;  1Q82 R;  1V76 A;  4MZP A;  3CME A;  1RI0 A;  3L2Z A;  5CQX A;  5FRN A;  1Y71 A;  2LQ8 A;  3SD4 A;  3UWN A;  4NS5 A;  1S1N A;  2LCL A;  1M2O A;  1SRM A;  4FM4 B;  1YWO A;  3G6E T;  1I07 A;  1ZUU A;  3P8B B;  1M1F A;  1VQ8 Q;  3OYF A;  1QW1 A;  3ZFJ A;  1PSE A;  4OMN A;  3V7C A;  2LCC A;  3TU4 K;  2ZGW A;  4D8K A;  5GMK i;  1NYF A;  1QVF S;  2P4R A;  2GFA A;  1PKT A;  1M2V B;  3LGL A;  2CRE A;  2M16 A;  3JCM f;  4C8Q A;  2E5Q A;  2DYB A;  3OBW A;  5GAM d;  3RBB B;  2QI2 A;  1YCY A;  4IUT A;  2EBP A;  2A28 A;  1VQ4 Q;  2XKO C;  2ZZD A;  3LH5 A;  1M1K U;  4RTZ A;  1KC8 C;  4M77 D;  2L5Q A;  5KYX B;  3QWX X;  2DJQ A;  2K4Y A;  3UDC A;  2DIQ A;  5GAO l;  4JLG A;  1VQM T;  4MML A;  4FYX B;  4M7A B;  2EKH A;  2X3X D;  4XTV A;  2CZ1 B;  4MZM A;  4DBQ A;  1YJN T;  2E3H A;  3EH1 A;  3G7Z A;  3FJ5 A;  1K73 C;  3M56 A;  2QEX T;  3CPF A;  4JJN K;  5CKE A;  1WYX A;  3C95 A;  1PCX A;  5FLX E;  5HY6 A;  1VQ5 Q;  2OTJ T;  1UJY A;  3CCL Q;  4M78 F;  3I35 A;  5KE3 A;  3FC3 A;  1EZZ B;  2B8A A;  3M0P A;  1KG1 A;  3FB9 A;  1U1T A;  2P4T A;  1RUW A;  1ZUY A;  3REB B;  3E9G A;  2E41 A;  4K11 A;  2FPD A;  5GAN 6;  5CKF A;  1UB4 A;  1VQ7 A;  4FW2 A;  1YHQ Q;  4C0D B;  4E6R A;  1D1B A;  2KAF A;  4C8Q G;  1M90 C;  3H6Z A;  1F1B B;  2LNH B;  1M3B A;  5IHN A;  5KCH A;  2CYZ B;  1R8O B;  4Z89 A;  1NEB A;  2YLB A;  1YHQ A;  1ZA1 B;  2P0K A;  1QVG P;  3MO8 A;  4N4I A;  1QLY A;  5CK9 A;  2CSQ A;  3QDR B;  2QTV A;  1FMW A;  1K73 R;  3DLM A;  1K8A C;  3CCU Q;  3P8H A;  2QXF A;  5J3B A;  2XK0 A;  4LUD A;  4A4K A;  4C8Q C;  1AVZ C;  3VUB A;  1S72 T;  5FU6 C;  5D6W A;  4HCB A;  4AG2 C;  4NOY A;  4XU0 A;  1YIT T;  2J06 A;  3BFM A;  1VUB A;  2JOY A;  4M75 B;  2RQU A;  2GF7 A;  3M0U A;  2V8J A;  1KQ1 A;  2WSE E;  3EFO A;  2A3L A;  1NE8 A;  4OGE A;  3DB4 A;  1MMA A;  4C8Q E;  1M90 R;  4PLI A;  5LL6 S;  5IXB A;  4HCK A;  1PWT A;  2L0A A;  2YUQ A;  2FG0 A;  4X34 A;  2MYS A;  4GLM A;  4QQ6 A;  1PKS A;  1Q86 R;  4J9F A;  1N8R U;  3EGD A;  1RAI B;  1OX9 A;  4L5G A;  5GAN j;  3M5A A;  3CCR Q;  1K8A R;  5LJ3 h;  1WXT A;  1V29 B;  4OML A;  3DLL A;  2SRC A;  4ZN1 A;  1VYV A;  2SEM A;  4QQD A;  1T0J A;  1Q7Y R;  2KT8 A;  2JW4 A;  2EW3 A;  3FJP A;  1M4Z A;  4Y92 A;  2RK1 A;  4ORZ A;  3URG A;  1MMG A;  3CXC P;  2ENM A;  1UHF A;  2ZCF B;  2F69 A;  2VB6 A;  4PNO A;  1QCN A;  5GJW B;  4OMF B;  4GLK A;  2DA9 A;  2ED0 A;  1G83 A;  5IXF A;  1NPR A;  2RH2 A;  1Q82 U;  1ZQ1 A;  2NUP A;  2RMO A;  2H8H A;  2C06 A;  2FVU A;  2JZ2 A;  2QGF B;  2DER A;  1C1A A;  1GFD A;  1NJI C;  1JXO A;  1H3H A;  4F14 A;  4BDZ A;  2ABL A;  2JS0 A;  4C92 B;  3KXT A;  4XU1 A;  4F7U B;  2D0N A;  4RCB A;  1RAF B;  4BE0 A;  1U1S A;  1YJ9 Q;  5GAM j;  3OYM A;  3A8M B;  3JCM J;  2AK5 A;  4PJO G;  4M7D E;  2LJ0 A;  3VS1 A;  1GBQ A;  2Z0W A;  3L2W A;  4C0G A;  4B9W A;  1OPL A;  5D6Y A;  3CCV Q;  1VIE A;  3LWI A;  3QBY A;  2HMA A;  3G71 Q;  1QKW A;  1YJ9 A;  1GL5 A;  4ZTF A;  3ULR B;  3CPW S;  3VS5 A;  1MMD A;  2ZPI B;  2HL3 A;  3CCJ T;  2DRK A;  3G6E Q;  1AZG B;  1U8R A;  3L1A A;  3OSS C;  1OZ3 A;  3M58 A;  3CCV A;  5DY9 A;  3VUZ A;  3HRS A;  2GQI A;  2P84 A;  2JVV A;  2HL5 C;  2JS2 A;  1WHL A;  5LJ5 e;  1QVG A;  4RG2 A;  3L2U A;  3MEW A;  3QYG B;  1I0C A;  1M1K C;  3MP6 A;  1LOJ A;  3KBG A;  3VJP A;  5GAN 8;  2O4X B;  3VS0 A;  2EQM A;  1VOM A;  5CR2 A;  5GAN 4;  4PLL A;  1W2B S;  1WQW A;  2CP6 A;  4OF1 A;  5FU7 B;  4A4G A;  1TSF A;  4DEY A;  1A0N B;  2KVQ G;  2XG8 D;  4CI0 C;  2J6K A;  2JNG A;  2ZAE A;  5KYY A;  2CDT A;  1AZE A;  2VVK A;  4LE9 A;  3I56 T;  2GGR A;  2HQX A;  5IH2 A;  3NHN A;  1YJW T;  3X25 B;  1X6O A;  1VQN T;  1VQM Q;  3TRE A;  3OMC A;  3CC4 T;  2RHU A;  1LNX A;  4E7J A;  3C0C A;  1BYM A;  4E47 A;  2DO3 A;  3I55 T;  1YJN Q;  1P92 A;  1D3B B;  3OW2 P;  2MMP A;  5I21 A;  4FCY A;  3MPU B;  4J9I A;  2QEX Q;  1LJO A;  1QWF A;  4ANJ A;  2VYT A;  3E19 A;  1RLQ C;  3EGX A;  1VQM A;  4LDY A;  1KHI A;  2OTJ Q;  2V1Q A;  4PK4 A;  1YBY A;  2O88 A;  4QT7 A;  2Y4Y A;  1YJN A;  2KXC A;  1YWP A;  1K73 U;  1U5S A;  1PRM C;  2IPO B;  3VU3 C;  2RQW A;  4Q5W A;  1KQS S;  2KSS A;  4PJM A;  5C6S A;  1T3S A;  2X3W D;  2DZ9 A;  4N0A A;  2EQI A;  2XHC A;  1ZUK A;  2FHD A;  4ZTJ A;  2WSC E;  1M30 A;  4XTY A;  3G4S A;  4HCZ A;  4J6Y A;  1I5L A;  3CCE T;  3UPU A;  4Z02 A;  4PJN A;  3PVL A;  1NM7 A;  1UE9 A;  2P0Q A;  2X4J A;  4XTZ A;  4BDY A;  4ATO A;  2EYQ A;  1EFN A;  4RMO A;  2XIC A;  1E7O A;  1VQ9 A;  1ZSZ B;  1IRX A;  1W6X A;  4JS4 A;  1BIB A;  2F2X A;  3I9Q A;  2JTF A;  3NTH A;  5FW9 A;  2QDY B;  1YI2 A;  8ATC B;  4PJJ A;  3JCM V;  2X4W A;  5CIU A;  4J8O A;  3M0S A;  2Y90 A;  1M90 U;  2D8J A;  2D0Q B;  2DE0 X;  4M77 A;  1YN8 A;  3MHX A;  1ZA2 B;  3F70 A;  4ESR A;  3QHS A;  1Q86 U;  2A0F B;  1S72 Q;  3PGG A;  4IIO A;  3OYY A;  2W0Z A;  5GMK h;  1YIT Q;  2PTK A;  3QJ6 A;  3R6N A;  2DZC A;  2A36 A;  3JCM c;  1K8A U;  1D1A A;  4KT0 E;  5KYW B;  1N8R C;  6AT1 B;  1J3T A;  3NPF A;  4F04 B;  4ELZ C;  1QVF P;  1MND A;  4FL6 A;  1ZHI A;  1Q7Y U;  3PTA A;  3INZ A;  2RHY A;  3PVQ A;  1IRE B;  2DM1 A;  1WHK A;  2QQS A;  1X2K A;  1I4K 1;  1Y57 A;  1D0Y A;  3RKW A;  3U23 A;  2D8H A;  4M78 B;  4Y28 E;  1WGS A;  4D6W A;  2NYS A;  3CCR T;  4HKE A;  4RTW A;  1WHM A;  1B34 A;  1TWB A;  2RN8 A;  4PJO B;  2M0Y A;  1AWJ A;  1KSW A;  3JV3 A;  4FYV B;  4OP0 A;  2CSI A;  3EGD B;  3V7S A;  1HJD A;  1Q82 C;  2LT4 A;  3CMA A;  1KQ2 A;  2CS7 A;  4A54 A;  1N9R A;  2IVW A;  3EG3 A;  3R6O A;  4N0A C;  2J7I A;  4AFU C;  5KCO A;  3EG1 A;  3GPL A;  1YCS B;  1PD1 A;  3X20 B;  2AT1 B;  1WHH A;  4MZT A;  4C8Q F;  2YWW A;  3E2U A;  2IIM A;  2M51 A;  1RLP C;  5DLO A;  2E70 A;  2HQE A;  2M9U A;  3REA B;  1CKB A;  1FWZ A;  2L89 A;  2V8K A;  1KD1 C;  3EHQ A;  2LT1 A;  2CT3 A;  3EH2 A;  2OTL T;  1WHJ A;  2DIG A;  3VS3 A;  5I2S A;  4BY6 B;  4HVU A;  2XDD A;  5LJ5 d;  4LDV A;  3C4S A;  2XI9 A;  3SFM A;  4BI3 A;  1VIF A;  4J9B A;  4C5E A;  1XNI A;  3S3N A;  5HKC A;  1M8V A;  2JTE A;  4M77 C;  3FDR A;  4PFP A;  3TSW A;  4M7A D;  2MPX C;  4KBM B;  1VQP A;  1HSQ A;  1YP5 A;  1VQK A;  3G71 T;  4R0K A;  3MJX A;  4J9H A;  1M27 C;  1T3L A;  1AWO A;  2CH4 A;  3JCM g;  2DVJ A;  4HVV A;  4L6V 5;  4DA4 A;  1X27 A;  3CCS T;  2E4H A;  4ZGE B;  1UUE A;  2XDB A;  4LDX A;  2DMO A;  4M77 E;  2J6F A;  3CCJ Q;  2EAY A;  1QVP A;  3TEE A;  2KRM A;  3JSC A;  3JCM P;  4GY5 A;  2CP2 A;  2DAQ A;  3G1J A;  3FLG A;  1KD1 R;  5LJ3 e;  2FPE A;  4JRQ A;  1TOV A;  2HAX A;  2RQT A;  4LNP A;  4BB7 A;  1KJW A;  1NLP C;  3CBP A;  1VQ8 A;  1H92 A;  3DB3 A;  1IXD A;  4LXC A;  2DL7 A;  2YUP A;  1BI3 A;  1UEB A;  2C0T A;  3IQL A;  1AHJ B;  1W4S A;  3SWN B;  1BI2 A;  4N4G A;  1X6G A;  1WX6 A;  3EG0 A;  3TVT A;  3PFS A;  2M1H A;  3QII A;  4PJL A;  2L2P A;  4HT8 A;  1QVF A;  2PUO B;  3I56 Q;  4EMK A;  5GMK m;  3QO3 A;  1AD5 A;  4J7I A;  1UG1 A;  1YJW Q;  4FSX A;  1VQ4 A;  2QQB A;  2KNB B;  1WXU A;  1VQN Q;  2PNI A;  3CC4 Q;  3BY7 A;  2RA2 A;  3A1P A;  4KRT A;  2ROT A;  3C94 A;  5GAN f;  1PRL C;  3I55 Q;  4M75 D;  2O9V A;  2X4X A;  1NZ9 A;  5GAO q;  1WZO A;  1HXD A;  1VQN A;  2E3I A;  4J9E A;  1OEB A;  2J6O A;  3MEA A;  1U06 A;  3H0H A;  2CZ7 B;  3CEY A;  4DQ2 A;  2G3R A;  2JM9 A;  1I1J A;  1X43 A;  2KDS A;  4PJO F;  1O9S A;  1VQ5 A;  1BI1 A;  1RAA B;  1WPY A;  2YDL A;  3EGX B;  5M9O A;  3CCL A;  1SRL A;  2BIV A;  4PFZ A;  5GAM g;  2LP5 A;  3J7A F;  4FIB A;  3QG1 A;  4HXJ A;  4ELY C;  3RDV A;  3Q1J A;  1SPK A;  2I2L A;  3CCQ T;  1TG0 A;  3CCE Q;  2DXC A;  4RCC A;  2HNI A;  5FWC A;  2E6Z A;  3HSB A;  4M7D A;  3EGU A;  3HPW A;  2DF6 A;  1Q86 C;  1G8X A;  3P8D A;  2LCS A;  4DBF A;  3GOX A;  2AZV A;  1VQ6 T;  4QKU A;  2COW A;  5GAM f;  3OYC A;  8AT1 B;  3ME9 A;  2K5L A;  1IO6 A;  2QA4 T;  3D7S B;  1D09 B;  4DOW A;  1Y96 A;  1Q7Y C;  2EPD A;  1ZBX A;  4EPC A;  1CSK A;  1C0M A;  1RAE B;  1Z9Q A;  4KH0 B;  3CCU A;  3QXE B;  5GAN 5;  1QP2 A;  1Y07 A;  2YRD A;  5IHI A;  3A5Z B;  1D0Z A;  2AKL A;  1LCK A;  1UGR B;  1VYT A;  2JN0 A;  3QZ9 B;  1BI0 A;  3UA6 A;  5GAN 2;  3MEV A;  4C92 D;  1Q95 G;  4O5V A;  4EMK C;  2KY9 A;  1M8M A;  1FMK A;  3JRZ A;  1TU0 B;  2LX9 A;  4HVW A;  3PT9 A;  2EQK A;  4A4E A;  1I81 A;  4XAX B;  1JBM A;  2MK5 A;  5LJ5 j;  2PVO B;  3HTR A;  3OA6 A;  2DL3 A;  3ZL7 C;  9ATC B;  5KH6 A;  1N9S A;  4C5H A;  3PIP A;  2LVM A;  3CC2 T;  3S3O A;  3SDZ A;  1QMC A;  4M7D G;  5IHK A;  3JB9 F;  4JRI A;  2KEA A;  2RI5 A;  1VYU A;  2K5F A;  2LTO A;  3CCR A;  2GNC A;  1QQJ A;  1SHF A;  2DIL A;  2VGN A;  2DPP B;  1I5O B;  4EDU A;  2X9H A;  3KUF A;  2KRN A;  3JCM X;  4OB0 B;  3CCM T;  2DXB A;  1UTI A;  2A08 A;  3E1S A;  4M7D C;  2PVD B;  1JJ2 S;  1WNL A;  2RF0 A;  2LQK A;  2DL5 A;  2COY A;  2LMJ A;  2OTL Q;  5LJ3 d;  4FYW B;  1WLP B;  2XDP A;  1R0C B;  5KYU A;  3VS7 A;  1WJQ A;  4E7I A;  1V1C A;  5GMK e;  2O2O A;  2VXF A;  1M1G A;  3ZEH A;  1KD1 U;  3HFO A;  3EG2 A;  3GNF B;  2HKQ B;  4J9G A;  1IB8 A;  2HBW A;  2HKN A;  1YIJ T;  4J7F A;  1ACM B;  2FZC B;  2GQV A;  2YHT A;  3QWY A;  4E2F B;  2O01 E;  4LN2 A;  2LX7 A;  4DOV A;  4LDU A;  3JCM e;  3HL8 A;  1SSF A;  3UA7 A;  2I0N A;  4OB2 B;  4AG1 C;  3CCS Q;  1JEG A;  3HKS A;  3G71 A;  3JCM b;  3VS6 A;  1BKB A;  1PC0 A;  3TCJ A;  4RG8 A;  2DRM A;  3M0R A;  3G6E A;  4BD3 A;  3CCS A;  1GCP A;  2RQR A;  4A4H A;  3BE3 A;  4JJC A;  4C0F A;  3EFR A;  2RK2 A;  2COZ A;  2XID A;  2AIR B;  1BB9 A;  1KIK A;  2VWF A;  2K3Y A;  2ZPG B;  3CPW A;  4AFZ C;  4HCC A;  1UDL A;  1PNJ A;  3OYK A;  2CP3 A;  2RI3 A;  2NWM A;  3OYJ A;  1RAC B;  1AOJ A;  4C8Q B;  4HT9 A;  5FU6 B;  4OB1 B;  3HRU A;  3O5Z A;  4TVR A;  4VUB A;  5KYX A;  2NLU A;  2AKK A;  3CBO A;  2DTH A;  4UC4 A;  2DD5 A;  2R5A A;  1W2B A;  4M7A A;  5FWB A;  3VYH B;  3RUX A;  4V2S A;  2F5T X;  1UEC A;  4FT2 A;  3SB2 A;  4IKF A;  1DJ7 B;  2YUO A;  3H0I A;  3CXC S;  1FYN A;  4A53 A;  3OQ5 A;  4ME7 A;  1K0X A;  3OS1 A;  2Y4X A;  2QEX A;  2BZY A;  3M59 A;  2RI2 A;  4M78 D;  2L3S A;  4BI4 A;  2VC8 A;  1NEG A;  2OTJ A;  1W1F A;  1VQ7 T;  2C0O A;  1UFF A;  2KRO A;  1XOV A;  2RJC A;  3VRZ A;  2BZ8 A;  3A8O B;  3J81 E;  4PJO D;  5IT9 E;  2QGG A;  1N6A A;  2GBQ A;  3CCQ Q;  2YXY A;  3A8L B;  2CP5 A;  2QQR A;  3EG9 A;  4QVD A;  4AT1 B;  1OQK A;  2ESW A;  1OU8 A;  5L8R E;  5J39 A;  3RR6 A;  3HFN A;  4JRP A;  3QPH A;  2RM4 A;  5A0G A;  3FIF A;  4MDX A;  1RAB B;  1PD0 A;  1KQS A;  4M7D B;  1EX4 A;  1ABQ A;  2KMT A;  1VQ6 Q;  4JPB W;  4OGC A;  1G2B A;  1X6B A;  1UGQ B;  1TUG B;  1E6G A;  2KXD A;  1PSF A;  1IGQ A;  1K1Z A;  2AZS A;  2QA4 Q;  1UGS B;  1K76 A;  3QJY A;  4M7A G;  4II1 A;  2JUF A;  5CAI A;  3VS2 A;  1ZBJ A;  2H3E B;  2KYB A;  3OSV A;  4LUE A;  2NUT A;  2RJF A;  2QA4 A;  3TQ7 P;  1S72 A;  2HDA A;  2OX7 A;  4M75 A;  1GFC A;  3NMZ C;  4XU3 A;  4OMQ A;  1YIT A;  1TH7 A;  2PZ1 A;  3RKX A;  4RTV A;  1JRI A;  2RO0 A;  3N5B B;  4KUI A;  3S3M A;  3JCM h;  4OMP A;  2EKO A;  2L3Q A;  3EFO B;  2E64 A;  4M7A C;  5LJ3 j;  2LC4 A;  4WCI A;  4ZN3 A;  1SSH A;  3RES A;  1WDX A;  4JLI A;  2DTI A;  4JUV A;  5CKH A;  1WXB A;  3MP1 A;  2JT4 A;  3TSZ A;  3CC2 Q;  2FPF A;  1BCM A;  1G3T A;  1BIA A;  3GP8 A;  1ZX6 A;  4OB3 B;  2KGT A;  2QAZ A;  3H41 A;  2XD0 A;  2FO0 A;  4M7A E;  4J5Y A;  4P5N A;  1X2Q A;  5I22 A;  3M55 A;  1GBR A;  2CH4 W;  2DXT A;  1VQL T;  3CC2 A;  4M77 G;  3JB9 D;  1H64 1;  3VYG A;  3JCM d;  3OW2 S;  4O6J A;  2DNU A;  1WIE A;  4C0Z A;  3CCM Q;  3EHR A;  2KK4 A;  5HK3 A;  2CT4 A;  3VS4 A;  5EC7 A;  4MDW A;  1OZ2 A;  5CO7 A;  4LDW A;  4CRI A;  2JM8 A;  1YFN A;  3OY9 A;  3QKJ A;  5CQY A;  2GFU A;  2K9G A;  4M75 G;  2NUP B;  5CCA A;  1G5V A;  1FX7 A;  1X69 A;  2FYK A;  3CCM A;  4C92 A;  4F7U A;  2EIF A;  1K4U S;  4BE1 A;  1SHG A;  1K9M C;  1ABO A;  2CP7 A;  3L2R A;  2HQH A;  1WQ7 A;  2K5I A;  1OU9 A;  4D8D A;  1YIJ Q;  2DXU A;  2YRV A;  1LVK A;  2OI3 A;  4M75 C;  1K0S A;  2MOX A;  3RNJ A;  3X26 B;  2VAS A;  1SF9 A;  4MMK A;  5GAM h;  4C5G A;  2MF2 A;  1YIJ A;  1AWW A;  3OYB A;  1X75 C;  2MWP A;  2GTJ A;  2PVG B;  3GLX A;  3RKY A;  2VKN A;  2RQV A;  4FT4 A;  4GBQ A;  2V8I A;  2DET A;  2CGH A;  3CCJ A;  2R58 A;  2E1H A;  3A8H B;  4M75 E;  1GRI A;  2B86 A;  2ATC B;  1PHT A;  3BDU A;  2E6N A;  2O4X A;  4RTY A;  5LJ5 g;  4M7D F;  3NFC A;  2MIO A;  3CD6 T;  5GAN g;  1UHC A;  1SEM A;  1H8K A;  3EAE A;  2VGM A;  3MKD A;  2C0I A;  4QW2 A;  1K9M R;  2VUB A;  2HZY A;  3OB9 A;  5GMK l;  5CVI A;  1TTH B;  5ECA A;  5I2M A;  4C92 G;  3C12 A;  4JDS A;  2PU9 B;  2ZPE B;  4F7U G;  1TXQ A;  2CP0 A;  4LD9 K;  3SHW A;  2R5M A;  1BU1 A;  5CKB A;  1QKX A;  5KYY B;  5LJ5 f;  4X9C A;  3QDF A;  1AT1 B;  1I8F A;  1ZLM A;  2K7A A;  1MV0 B;  4KGX B;  2EGC A;  1KHC A;  3I56 A;  1YJW A;  2FRY A;  1D3B A;  2EYX A;  1BBZ A;  1NPP A;  3GNG A;  3T9N A;  1B07 A;  2VXE A;  4EMG A;  3M54 A;  4C92 C;  3CC4 A;  4JJD A;  3O8V A;  2KYM A;  5GAO m;  2D9T A;  2DD4 A;  3UF4 A;  3I55 A;  2YSQ A;  5DM7 R;  1WHG A;  2K6D A;  3RMS A;  1TS9 A;  1NG2 A;  1JJ2 P;  2D1X A;  3G4S T;  1VQ7 Q;  2X35 A;  4OMM A;  2YT6 A;  4FSS A;  1MGQ A;  2HEQ A;  4BE2 A;  2ZPF B;  3WVD B;  4C92 E;  3OYN A;  4RKU E;  4F7U E;  2GTO A;  3S6W A;  1VQ9 T;  1C6V X;  2FZK B;  4KUD K;  3L2V A;  4IUQ A;  4XTX A;  2ECZ A;  3E9F A;  4Z88 A;  3JCM W;  1ZSZ A;  1YI2 T;  3CCE A;  5A0L A;  4ZGD B;  2EYW A;  4J9C A;  3EG9 B;  1KC8 R;  4XTU A;  1MV3 A;  1AEY A;  5FRM A;  1JU5 C;  1OV3 A;  4XK8 E;  5J26 A;  5GMK j;  2QAS A;  4A63 B;  4BI8 B;  3QSU A;  1Z9Z A;  3AT1 B;  1FMV A;  3CPW P;  2K2M A;  4DBR A;  3X24 B;  3CC7 T;  2DVE A;  4QVZ A;  2RPN A;  1Y7X A;  3V8L A;  4B6M A;  4M77 B;  3ZBD A;  4F17 A;  5FU7 C;  2BE7 D;  2EVR A;  3PMI A;  2LJ3 A;  2R57 A;  2KT1 A;  1Q81 C;  3SEM A;  1PG5 B;  2RJD A;  1KFZ A;  3HP9 A;  4XTW A;  3LLR A;  4CC4 B;  5KYW A;  3QUI A;  3LYI A;  2VV5 A;  3OYE A;  1R0B G;  2A37 A;  3PNW C;  3H9N A;  4X9D A;  2NUT B;  1VQO T;  1WJS A;  1W2B P;  3HHT B;  1TUD A;  3JCM Q;  2KQW A;  4E7L A;  3OYI A;  2WSF E;  2EJ9 A;  2BZX A;  2RD1 A;  4KH1 B;  3M9Q A;  5CKD A;  1GCQ A;  2KBT A;  4M78 A;  2QTX A;  5HCK A;  2O31 A;  1QP3 A;  2E5K A;  1KK7 A;  2RJE A;  2DEQ A;  1D1C A;  4PJO A;  3OS0 A;  1AWX A;  4PKC C;  1Y0M A;  2AHJ B;  2KE9 A;  1B34 B;  3CMA T;  3DKM A;  3UT1 A;  1G3S A;  5AT1 B;  7AT1 B;  2ROL A;  4EIK A;  2RHI A;  2H3J A;  3MCA B;  2EFI A;  2CZ6 B;  3RIR A;  2BKD N;  1OYX A;  2DFU A;  2DL4 A;  2EYY A;  5KE2 A;  1QCO A;  2CZ0 B;  4AFS C;  1VQL Q;  1Q81 R;  2MWO A;  2JMA A;  2W10 A;  1OPK A;  2HSE B;  3JB9 I;  2CUD A;  1FXX A;  5D7U A;  1X01 A;  1PM3 A;  2EQU A;  2E65 A;  2K3B A;  4AFQ C;  1XQH A;  1ARK A;  1ZSZ C;  1WA7 A;  5A0D A;  4C8Q D;  1VQL A;  5C0M A;  3V7R A;  4ZNX A;  1NLO C;  1MUZ A;  1KQS P;  2EGE A;  2EGA A;  4CC7 A;  5D6X A;  1QCF A;  3LGF A;  3L42 A;  1N5Z A;  2XMF A; 
#chains in the Genus database with same CATH homology
 3VRZ A;  2BZ8 A;  2FPD A;  4J9B A;  2GBQ A;  4E6R A;  4CC3 A;  2JTE A;  2ESW A;  1B3Q A;  2LNH B;  3TSW A;  1M3B A;  5IHN A;  1WFW A;  1HSQ A;  1YP5 A;  4Z89 A;  4RTX A;  2O9S A;  1NEB A;  4R0K A;  1ABQ A;  4J9H A;  1M27 C;  1T3L A;  2KRS A;  1AWO A;  2CH4 A;  4JPB W;  1G2B A;  1X6B A;  2DVJ A;  4HVV A;  1E6G A;  2DX1 A;  2KXD A;  1QLY A;  1X27 A;  2CSQ A;  1K1Z A;  2AZS A;  1HD3 A;  1UUE A;  2DMO A;  2NUZ A;  1K76 A;  2J6F A;  3THK A;  4LUD A;  1AVZ C;  2OAW A;  3VS2 A;  2KRM A;  2CUB A;  1GCQ C;  1ZBJ A;  4AG2 C;  2KYB A;  2FPE A;  4LUE A;  1M3C A;  2RQT A;  2J06 A;  4LNP A;  2HDA A;  1KJW A;  1NLP C;  2K79 A;  1GFC A;  1UGV A;  3NMZ C;  1ZSG A;  2RQU A;  1VA7 A;  4OMQ A;  3M0U A;  1H92 A;  3NGP A;  2QDL A;  2DL7 A;  2PZ1 A;  2YUP A;  4RTV A;  4OMP A;  4Z8A A;  1QWE A;  2C0T A;  2KR3 A;  2L3Q A;  3IQL A;  2DBK A;  2DL8 A;  5IXB A;  4HCK A;  1PWT A;  2L0A A;  4WCI A;  1X6G A;  2YUQ A;  1WX6 A;  4RTT A;  2FG0 A;  4GLM A;  1SSH A;  1PKS A;  4X1V A;  3EG0 A;  1WDX A;  5GJV B;  3TVT A;  4J9F A;  4RTU A;  2LQW A;  1NYG A;  1K9A A;  1WXB A;  2JT4 A;  5L23 A;  4DEX A;  2L2P A;  3TSZ A;  2FPF A;  1AD5 A;  1UG1 A;  1ZX6 A;  1WXT A;  1TUC A;  4OML A;  3KFV A;  2SRC A;  2KGT A;  1M3A A;  2KNB B;  3H41 A;  1WXU A;  2FO0 A;  1YNZ A;  1VYV A;  2PNI A;  2SEM A;  1X2Q A;  1T0J A;  4F16 A;  5I22 A;  3I5S A;  2L3P A;  4KRT A;  2JXB A;  2KT8 A;  2ROT A;  2JW4 A;  1GBR A;  1PRL C;  2CH4 W;  2EW3 A;  4Y92 A;  4ORZ A;  2O9V A;  1CKA A;  2ENM A;  4J9D A;  1UHF A;  2BTT A;  5GJW B;  2DNU A;  1WIE A;  4J9E A;  1OEB A;  2J6O A;  3EHR A;  2DA9 A;  1U06 A;  2CT4 A;  3VS4 A;  2ED0 A;  3H0H A;  1G83 A;  5EC7 A;  5IXF A;  2LQN A;  2JM9 A;  1I1J A;  1JXM A;  1X43 A;  3A98 A;  2JM8 A;  3M0T A;  2YDL A;  2DBM A;  2RMO A;  2H8H A;  2K9G A;  1SRL A;  1X69 A;  2LP5 A;  4HXJ A;  1GFD A;  3M0Q A;  1JXO A;  1SPK A;  1H3H A;  4F14 A;  2ABL A;  2JS0 A;  1TG0 A;  2RNA A;  5FWC A;  1K4U S;  1SHG A;  2D0N A;  1ABO A;  3EGU A;  2DF6 A;  2FRW A;  2AK5 A;  4D8D A;  2LJ0 A;  2LCS A;  1GBQ A;  3VS1 A;  1W70 A;  1BK2 A;  2AZV A;  1OPL A;  2OI3 A;  1K0S A;  2MOX A;  3RNJ A;  1QKW A;  2JMC A;  2F2V A;  1GL5 A;  1IO6 A;  3ULR B;  2V1R A;  4RUG A;  2EPD A;  3VS5 A;  1AWW A;  1CSK A;  2DRK A;  1AZG B;  1Z9Q A;  2GTJ A;  2VKN A;  2RQV A;  1WI7 A;  4GBQ A;  2GQI A;  5IHI A;  2DLP A;  2AKL A;  1LCK A;  1VYT A;  2JS2 A;  3UA6 A;  1GRI A;  2B86 A;  2HCK A;  1PHT A;  1I0C A;  4RTY A;  2MIO A;  1JO8 A;  3VS0 A;  1UHC A;  1SEM A;  1H8K A;  1M8M A;  1FMK A;  2LZ6 B;  2C0I A;  4CC2 A;  4HVW A;  2FEI A;  1E6H A;  5ECA A;  4DEY A;  3VRY A;  1U3O A;  1A0N B;  2J05 A;  4JZ3 A;  2DL3 A;  2J6K A;  3ZL7 C;  3SHW A;  1BU1 A;  2F2W A;  2CDT A;  1AZE A;  4JZ4 A;  2VVK A;  4LE9 A;  2GGR A;  2LJ1 A;  1QKX A;  5IH2 A;  3NHN A;  5IHK A;  2YUN A;  2OJ2 A;  1ZLM A;  2K7A A;  1MV0 B;  4JJB A;  2KEA A;  2EGC A;  1T0H A;  1VYU A;  4OMO A;  3C0C A;  2FRY A;  2GNC A;  1SHF A;  2EYX A;  1BBZ A;  2G6F X;  1B07 A;  2DIL A;  4J9I A;  4JJD A;  2KYM A;  1QWF A;  2KRN A;  3UAT A;  1RLQ C;  3UF4 A;  1UTI A;  2YSQ A;  2V1Q A;  2A08 A;  2O88 A;  4QT7 A;  2MCN A;  1RI9 A;  2K6D A;  3PE0 A;  2KXC A;  1NG2 A;  2RF0 A;  2D1X A;  2DL5 A;  2HSP A;  1YWP A;  2LMJ A;  1U5S A;  1PRM C;  2RQW A;  4OMM A;  2YT6 A;  1T3S A;  2X3W D;  4FSS A;  1WLP B;  2EQI A;  1OOT A;  3H0F A;  1ZUK A;  1JQQ A;  2HEQ A;  1M30 A;  3VS7 A;  1V1C A;  2GTO A;  2O2O A;  2ED1 A;  3PVL A;  1NM7 A;  1UE9 A;  2ECZ A;  4Z88 A;  1EFN A;  3I5R A;  3EG2 A;  2EYZ A;  1E7O A;  4J9G A;  1W6X A;  3CQT A;  2EYW A;  4IIM A;  4J9C A;  4M4Z A;  2HBW A;  3I9Q A;  2F2X A;  3GBQ A;  1MV3 A;  1UJ0 A;  3QWY A;  1AEY A;  5FW9 A;  5I11 A;  1JU5 C;  1OV3 A;  4LN2 A;  2LX7 A;  4A63 B;  1Z9Z A;  3M0S A;  3UA7 A;  2D8J A;  2I0N A;  2K2M A;  4AG1 C;  1JEG A;  2DE0 X;  1S1N A;  1YN8 A;  2RPN A;  1SRM A;  4ESR A;  1YWO A;  3VS6 A;  4F17 A;  2EVR A;  4IIO A;  1I07 A;  2W0Z A;  1ZUU A;  2LJ3 A;  2DRM A;  3M0R A;  2KT1 A;  3SEM A;  2PTK A;  1KFZ A;  3R6N A;  1GCP A;  4OMN A;  4CC4 B;  2A36 A;  2RQR A;  4JJC A;  4D8K A;  2A37 A;  1NYF A;  2P4R A;  1J3T A;  3NPF A;  1PKT A;  2CRE A;  1BB9 A;  1KIK A;  2VWF A;  4AFZ C;  1UDL A;  1PNJ A;  1TUD A;  2NWM A;  3PVQ A;  2DM1 A;  2DYB A;  2BZX A;  1X2K A;  1AOJ A;  1GCQ A;  2KBT A;  3RBB B;  1Y57 A;  3U23 A;  2D8H A;  5HCK A;  2O31 A;  2E5K A;  2EBP A;  2A28 A;  3O5Z A;  3LH5 A;  4RTZ A;  4RTW A;  2RN8 A;  1AWX A;  2M0Y A;  1AWJ A;  1KSW A;  1Y0M A;  2KE9 A;  3JV3 A;  2CSI A;  3QWX X;  2AKK A;  2DJQ A;  1HJD A;  2ROL A;  4EIK A;  5FWB A;  2DL4 A;  2EYY A;  2EKH A;  2X3X D;  3EG3 A;  4AFS C;  1UEC A;  2J7I A;  4AFU C;  2JMA A;  3EG1 A;  2W10 A;  2YUO A;  1OPK A;  3FJ5 A;  3H0I A;  1YCS B;  1FYN A;  2CUD A;  1WYX A;  2IIM A;  1K0X A;  1UJY A;  2K3B A;  2M51 A;  4AFQ C;  1ARK A;  3I35 A;  1RLP C;  1WA7 A;  3REA B;  2BZY A;  1CKB A;  4ZNX A;  2L3S A;  3M0P A;  3EHQ A;  1NLO C;  1MUZ A;  2EGE A;  2CT3 A;  1NEG A;  2EGA A;  4CC7 A;  1QCF A;  1RUW A;  1W1F A;  1ZUY A;  1UFF A;  2C0O A;  3REB B;  1N5Z A;  3VS3 A;  2KRO A;  4HVU A;  1XOV A;  2XMF A;  4K11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...