2D1XA

The crystal structure of the cortactin-sh3 domain and amap1-peptide complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
NDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords cortactin isoform a
publication title Targeting AMAP1 and cortactin binding bearing an atypical src homology 3/proline interface for prevention of breast cancer invasion and metastasis.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 60
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2d1xA00
4RTZA 2HSPA 2JMCA 2G6FX 2MOXA 2LCSA 2LJ3A 4D8KA 4FSSA 1E6HA 2JXBA 1PHTA 1WX6A 1AZEA 2K6DA 3UF4A 2EVRA 1K0XA 2BZXA 2AZSA 2FEIA 1ABQA 2J06A 2OI3A 5IHNA 2DVJA 1JU5C 2EGAA 2F2WA 4HXJA 4X1VA 2KRMA 5IHIA 1G2BA 2YUNA 3I5RA 1ZUKA 3NGPA 4RTVA 2K3BA 1X69A 1CKBA 4OMLA 1EFNA 1T3LA 1K1ZA 3H0FA 1KSWA 2CUDA 4Z8AA 1UDLA 1PWTA 2RQRA 2CREA 2EGEA 2BZ8A 3U23A 2M0YA 3EG0A 2K7AA 1NEBA 4F14A 2KT1A 2DILA 2V1QA 1JQQA 2A08A 2FO0A 3I35A 2DA9A 1E6GA 1TG0A 1OPLA 4RTWA 5GJWB 1NLOC 2D8HA 2L3SA 2O2OA 4HCKA 1W1FA 2C0OA 4QT7A 1ZX6A 1NLPC 4LUDA 1ZBJA 2IIMA 1WYXA 2HDAA 1HSQA 1AWOA 5IH2A 1SRMA 1H3HA 2P4RA 2RQUA 1PKTA 2D1XA 1M3BA 1X2QA 1M3CA 2YSQA 3REAB 2D8JA 1PKSA 2GQIA 3H41A 2EYZA 2EYXA 4D8DA 4CC2A 2CT4A 4JPBW 1UG1A 4K11A 2EYWA 1ZUUA 1PNJA 3VS5A 3QWXX 2KNBB 2F2VA 5IXFA 2LP5A 2DMOA 3PVLA 1QWEA 2GNCA 3H0IA 3VS1A 2PTKA 1VA7A 4IIOA 1YWOA 3M0PA 3M0QA 2KEAA 2NUZA 3VS6A 1UHFA 2RQTA 4Z89A 1TUCA 2JT4A 1SRLA 4HVUA 2GBQA 2B86A 1T0JA 3EHRA 4AFUC 2I0NA 3SEMA 3NHNA 2A37A 2YUOA 1AVZC 1OPKA 5FW9A 3TVTA 1NYGA 1A0NB 2EGCA 1E7OA 2LQNA 4RTYA 1ABOA 2OJ2A 3M0RA 1M8MA 3REBB 2K9GA 3NMZC 1LCKA 1S1NA 3RNJA 2DRMA 2VKNA 3M0TA 1T0HA 3EG2A 2CSIA 1BBZA 2OAWA 2MIOA 2F2XA 2J6FA 2GTOA 1KJWA 3R6NA 1MV0B 2LJ1A 2YT6A 1WFWA 2YUQA 1BU1A 2DYBA 3EGUA 1H8KA 4ORZA 2EW3A 2O88A 2FPEA 3EHQA 2ECZA 1GFCA 4RTTA 1M3AA 2SEMA 4RTUA 1QKXA 2ROTA 4AFSC 3PE0A 1TUDA 3VRYA 4R0KA 2BZYA 2DM1A 2DRKA 2BTTA 2DL4A 3C0CA 5FWBA 1NM7A 1AD5A 4A63B 1Y57A 1WXBA 2DL5A 4OMMA 3VS7A 1JEGA 1CKAA 4AG1C 2KXDA 3EG1A 2DL7A 2KRSA 5ECAA 2EQIA 1W6XA 2KE9A 1Z9QA 2DF6A 1CSKA 3TSWA 2JM8A 3UATA 2VWFA 1WI7A 2L0AA 5HCKA 3M0UA 1JO8A 4JZ4A 4KRTA 4J9IA 1SSHA 1ZUYA 3TSZA 1GCQA 4Z88A 2L3PA 2A36A 2ED0A 4E6RA 1PRMC 2D0NA 1N5ZA 3THKA 4LN2A 1RI9A 4DEXA 2J6KA 2RF0A 1KIKA 3ZL7C 2AK5A 1IO6A 1HD3A 2DNUA 4J9HA 1GCPA 1QLYA 1V1CA 1YWPA 2GGRA 1WXTA 1K76A 1UJYA 3I9QA 2CT3A 1QKWA 1NYFA 1ZSGA 1M30A 2DE0X 2HEQA 2EPDA 2FG0A 4J9DA 4WCIA 1VYTA 1Y0MA 3NPFA 2CH4W 1GBQA 2JMAA 2RQVA 2FRWA 4J9BA 3A98A 3ULRB 5EC7A 2SRCA 2KT8A 2FPFA 2DBKA 4Y92A 2KROA 2X3XD 1ZLMA 1UJ0A 1X6GA 2LNHB 2DL3A 2M51A 3UA7A 4DEYA 1Z9ZA 2RMOA 1UFFA 1OEBA 2V1RA 3VS0A 2RPNA 1UUEA 1B07A 1GRIA 1RLPC 1GCQC 1OOTA 1BK2A 4OMPA 5IHKA 3VRZA 1AWWA 2KGTA 2KR3A 2EBPA 3VS4A 2PZ1A 1K0SA 4LNPA 1JXOA 1SPKA 2QDLA 5GJVB 2PNIA 3I5SA 1KFZA 2O9VA 2ROLA 2GTJA 2KBTA 4M4ZA 1X6BA 2NWMA 2W10A 2RN8A 4J9CA 2CDTA 1YN8A 4CC4B 1WIEA 4J9EA 4RUGA 1ARKA 1AEYA 1YP5A 2L2PA 4LE9A 2JM9A 1RLQC 3GBQA 1B3QA 1YCSB 1MV3A 1SHFA 2O9SA 1WA7A 2X3WD 1WXUA 1UECA 2EKHA 4HVVA 1I1JA 2HBWA 2J05A 5L23A 4AG2C 2DX1A 4F16A 1K4US 2CH4A 2ESWA 3PVQA 1AWXA 4J9GA 1I0CA 2DL8A 2MCNA 3IQLA 1UE9A 2E5KA 1UHCA 1MUZA 2KYMA 2LJ0A 1W70A 2JS2A 1K9AA 3M0SA 4CC3A 2LQWA 4OMOA 2KXCA 4JJBA 2YUPA 3QWYA 1I07A 4JJDA 2VVKA 1GFDA 3FJ5A 1VYUA 2DLPA 2RQWA 1JXMA 2AKKA 2JS0A 2KYBA 2FPDA 4F17A 3UA6A 4OMQA 2CSQA 2ENMA 1J3TA 3SHWA 2J7IA 2K79A 1AOJA 1PRLC 1U5SA 1WLPB 4AFQC 1U3OA 1H92A 1NG2A 3LH5A 3VS3A 2C0TA 5FWCA 2ED1A 1UTIA 1XOVA 1QCFA 5I22A 2ABLA 1X27A 2L3QA 1OV3A 4JJCA 2K2MA 4IIMA 4EIKA 2J6OA 1M27C 1YNZA 3H0HA 2DJQA 4LUEA 2JTEA 1UGVA 1SHGA 3O5ZA 4GLMA 1VYVA 4RTXA 1RUWA 2LX7A 1HJDA 3VS2A 1G83A 3RBBB 1SEMA 2EYYA 2H8HA 3KFVA 4OMNA 5IXBA 1AZGB 1FYNA 2HCKA 1X2KA 2LMJA 1FMKA 3CQTA 5I11A 4HVWA 4JZ3A 2DBMA 1GL5A 2CUBA 1T3SA 2W0ZA 1GBRA 1U06A 1AWJA 1X43A 2RNAA 2JW4A 3EG3A 4J9FA 1BB9A 4ZNXA 2YDLA 3JV3A 2AZVA 2XMFA 2A28A 4CC7A 2KRNA 1WDXA 2AKLA 4AFZC 2C0IA 2O31A 2LZ6B 4ESRA 4GBQA 1QWFA 1NEGA 2FRYA
chains in the Genus database with same CATH superfamily
3OYGA 2JXBA 2DYIA 1KD1U 2KMTA 2YWWA 2AZSA 2J06A 1ABQA 3OYHA 4FT4A 1BIBA 2M1HA 3JB9G 5DLQE 3OBYA 2P0PA 4J8OA 2O01E 3NGPA 5GAN3 2DIGA 3M57A 2MI6A 4ELZC 3AT1B 4FT2A 2KDSA 2CUDA 4Z8AA 1UDLA 2QQAA 3QKJA 2KT1A 4QQ6A 4XU1A 2A08A 1FX7A 3BDLA 1NE8A 4KH1B 4ZGJB 1KC8R 2QTVA 3CCVT 3VYGA 1NLOC 2B8AA 2L3SA 2O2OA 3H8ZA 5D6XA 4WTOB 1R0BG 1GXIE 1ZX6A 5FU7B 2KQWA 3LYIA 3DLMA 4M7DE 2EQUA 3LWHA 4M7AE 2HDAA 1AWOA 5IH2A 1SRMA 3CCQT 1D3BA 1M90R 4J6WA 3LGLA 1PG5B 5LJ3j 3CBMA 1PKSA 3JCMP 1I81A 2EYXA 5GAOr 5A0LA 3CXCS 3M58A 2EAYA 1UG1A 1QVGS 4KGVB 2KNBB 2LP5A 2M02A 5KYXB 3I56Q 3VS1A 2GNCA 3HP9A 4E7JA 4ZTJA 1YWOA 2RK1A 3M0PA 1QVPA 3MKDA 5KYUB 1Q81R 4OVAA 2L5QA 3OS0A 1YI2T 4Z89A 1B34B 4O6JA 1SRLA 3QSUA 2GBQA 3OYKA 2PUOB 1S72A 2QQRA 3DB3A 2I0NA 5GAMh 2YUOA 5FW9A 2QXFA 1NYGA 1YJ9Q 1PC0A 2X51A 1E7OA 1D0XA 2XKOC 3GNFB 3CCMA 1VIEA 2XG8D 2RHIA 2YHTA 4N4IA 1WJRA 1S1NA 3CCJA 2MYSA 1ZA1B 2DRMA 2LRQA 2VKNA 2QYZA 2DKGA 1WQWA 3OS1A 3OYFA 2E3IA 2GTOA 4PJOF 3R6NA 3X24B 2DFUA 4BI8B 5CKBA 2LTOA 3EGUA 1H8KA 1IGUA 2HNIA 2COZA 3EHQA 4Z02A 2F69A 1H641 1N9SA 2Y4XA 1Q82C 3CC4A 3VRYA 3UT1A 4R0KA 2DRKA 1LPLA 3G71T 1NM7A 4A63B 5L8RE 4LXCA 3MEUA 1YIJA 3VS7A 3MJXA 2KXDA 3QO3A 1LNXA 3CCLA 1VQ7A 3QZ9B 1W6XA 3P8DA 2KE9A 1X6OA 2FL7A 2DF6A 2JM8A 3DLLA 4XK8E 3M0UA 2WSEE 1ZUYA 4HCZA 4Z88A 4C92B 2A36A 4PJJA 1XNIA 2NUPB 4C8QD 1W2BP 2RJCA 3INZA 2LT1A 3CMEQ 2X4JA 1KIKA 2CP2A 4M78A 2D0QB 1IO6A 1KK7A 2DNUA 5FLXE 1QLYA 1TSFA 4A53A 1K76A 1WXTA 2XDDA 2QEXQ 1UJYA 3CD6Q 2MWPA 2WACA 4QVDA 2CGHA 3M54A 1KQSA 2CH4W 1N9RA 3V7SA 5LJ3d 4J9BA 1SF9A 1Y96A 5EC7A 3CMAA 2SRCA 2FPFA 4Y92A 4PFPA 1UJ0A 5GAN4 4DEYA 2RH2A 4F7UE 3C12A 2LQ8A 1NZ9A 2YRDA 3I55T 1YCYA 3CC2A 3VUZA 1I5LA 2AT1B 1JJ2A 3WVDB 3RMSA 2PZ1A 2ZPGB 4QVCA 2K3YA 3LGFA 4M78C 1JXOA 3SB2A 3EGDA 4IURA 5GANg 2EJ9A 3I5SA 3HKSA 3E19A 4C92A 1K73C 2LQKA 2HBPA 4E7ZA 4OB0B 1C0MA 1U1TA 2QG9B 4M4ZA 3CCRT 4M75A 3CCEA 4M7DD 2QGFB 4M7AD 4C5EA 4J9EA 4BD3A 1RI0A 5GMKj 3A8LB 5CQYA 4LE9A 4M77B 1KD1R 1PSFA 4RCBA 5C0MA 4DOVA 1WA7A 5GAN2 2X3WD 3D7SB 4QQGA 2DD4A 3VU3C 2HBWA 4AG2C 2DX1A 4F16A 4LDVA 5A0DA 1YITQ 4J9GA 2DL8A 2DXUA 5IAYA 3V7CA 5GAN6 1N8RC 1IREB 5GANf 2DO3A 2FZCB 2CP5A 1Y71A 2LJ0A 1IRXA 5GAOm 1M9SA 2EYQA 2LQWA 2KXCA 2YUPA 1Q82U 1KQ2A 4FW1A 4J5YA 1VQ9A 2AKKA 3X25B 1TU0B 3L2ZA 4F17A 3UA6A 4C0FA 2HQEA 1DJ7B 4OMQA 2ENMA 2GQVA 2FVUA 3M53A 3MEAA 4XU0A 2G3RA 2K79A 3EGXB 2P84A 4AFQC 4PJMA 1S72Q 1H92A 3L2QA 2EFIA 1NG2A 2K2VA 1AT1B 4OB3B 5I22A 1X27A 3C95A 4MDXA 3FIFA 1OV3A 4LD9K 4JJCA 2K2MA 5CKDA 2DETA 3OYJA 3OYDA 2HQHA 3CCMQ 4EIKA 2ZCFB 3CCJQ 4EDUA 5LJ5g 2LVMA 2HAXA 1UGVA 4XAXB 1WHJA 1PCXA 3O5ZA 4GLMA 1VYVA 1JB0E 2ZPIB 3VYHB 5GANh 4FIBA 1AHJB 2XI9A 1VQLQ 1HJDA 3HSBA 1RAFB 2QAZA 2BKDN 2M16A 4C8QF 4N0AC 2RJDA 4J6XA 2H8HA 2DVEA 1IB8A 3H9NA 3SWNB 1FYNA 3MPUB 3FDRA 3OW2A 2VGMA 3CC4Q 2X4XA 4JJNK 4E7LA 1K9MC 1GBRA 3LX7A 3PIOA 1AWJA 2D9TA 3PT9A 1YIJQ 3ZBDA 2YDLA 3JV3A 2DZCA 2AZVA 3QPHA 2XMFA 3CCLQ 1TS9A 4C8QG 1WDXA 2X35A 4AFZC 1VQ7Q 2C0IA 5LJ5f 2O31A 1VQ6T 3G4ST 4GBQA 3CCVA 3HPWA 1K8AU 1NEGA 2FRYA 3CMAT 1C1AA 4N4HA 4VUBA 2G6FX 2MOXA 3OYYA 2Y90A 2LCSA 2LJ3A 4D8KA 1VQKA 1WX6A 2K6DA 4ZGEB 4QVZA 1RABB 1K0XA 3OSVA 2OTLT 2FEIA 2OI3A 1ZQ1A 3CC2T 1K73U 4X1VA 5D7UA 2AIRB 3HHTB 2A0FB 4E47A 1ZA2B 2LC4A 3PTAA 1EFNA 1T3LA 1K1ZA 3H0FA 3CC7A 4M7DF 4M7AF 2E64A 2CREA 2JJ9A 2YRCA 1YI2A 5LJ5h 1IHWA 3RKYA 3TU4K 2FO0A 1QVFS 3I35A 4MMKA 5I21A 3Q1JA 1TG0A 4RTWA 2H3EB 4PFOA 5GMKh 1NPPA 3V7RA 4LDXA 1N8RU 2YLCA 4QT7A 4XU2A 1NLPC 4LUDA 1Y7XA 1ZBJA 3RERA 2QTXA 1KQSP 1H3HA 2P4RA 3VUBA 2JZ2A 4M7AG 1PKTA 2D1XA 1M3CA 3JCMd 3MEWA 2R5AA 1Q86C 2QI2A 3H41A 2KI7A 3TQ7P 2RHXA 2XHCA 2DTIA 3EFRA 2CT4A 4JPBW 1WPYA 4PFZA 5D6WA 2F2VA 3EFSA 3TREA 5CVIA 3CCEQ 1QWEA 1QVGA 4FM4B 1WJQA 2F5KA 1JJ2P 3M0QA 2VV5A 4HT8A 3OYAA 2EJGA 3VS6A 4E7SA 4XQ3A 4X9CA 2RQTA 6AT1B 4DBRA 3L2UA 3G71A 4HKEA 1PM3A 4GY5A 2OX7A 2DXCA 5HY6A 1G3YA 3OSSC 2A37A 1OPKA 4C92E 4PLLA 3BDUA 1U1SA 2MF2A 1FMWA 4Q5WA 4RTYA 2O4XB 1D3BB 2VASA 2DJZA 1YHQA 3MO8A 3L2RA 1Q7YC 1XTDA 1ZBXA 3EG2A 2CSIA 3CCSQ 2MIOA 1D1BA 1Y07A 4IUUA 1MNDA 2J6FA 2X4WA 1VQNT 5GAMg 1K9MU 1EZZB 1VQ9Q 2LJ1A 2YT6A 3WVEB 1OX8A 3CCUT 2O88A 2XDBA 3NTKA 1X75C 2SEMA 4FCYA 1NJIC 2P0KA 3HFOA 4KH0B 2IPOB 3PE0A 1TUDA 4PNOA 4DBFA 3J81E 2BTTA 2DL4A 1VQ8A 1AD5A 1TOVA 1WXBA 4NOYA 3L2WA 3JCMX 5A0GA 3DB4A 5KYYA 2DL7A 3NFCA 1BI2A 4JRPA 1VQMQ 1WHHA 2EQIA 2X4YA 5GMKl 2OTJT 1Q82R 3JCMQ 3OYEA 4PJLA 3UATA 2VWFA 1WI7A 4XTUA 1WHMA 2CP3A 2E4HA 5GAMf 1UB4A 4YTLA 2MWOA 4KUDK 4J9IA 4PJOA 3CBOA 3TSZA 3J80E 3I55A 2DXBA 1ZSZA 2ZPBB 5CO7A 3BY7A 1PRMC 1VQKT 3THKA 1IGQA 2CZ1B 4DEXA 1YJNT 1EX4A 2O4XA 3OYLA 5HK0A 3ZL7C 4M77E 2HZYA 1HD3A 4J7FA 3QYHB 1M2OA 3TEEA 3I9QA 3OYBA 2CT3A 5GANe 1QKWA 4F7UF 2LNVA 4N4GA 1NYFA 2E12A 1M5Q1 3CCRA 3QHSA 3QIIA 2HEQA 1MNEA 2EPDA 4WCIA 1LJOA 1GBQA 3MP6A 3CC7T 2RQVA 2FRWA 3CBPA 3A98A 3OW2P 2HMAA 2L89A 2NUTA 3L2VA 2KT8A 2DBKA 3CCVQ 1I8FA 2LNHB 2JNGA 2M51A 4EMKC 1RACB 3ASKA 1Q86U 3CCQQ 3A8MB 4F7UG 4PJOC 1B07A 1OOTA 3MP1A 1ZSZC 2ATCB 4C5GA 5KCHA 1KQ1A 1R8OB 3RKWA 2M0OA 4M78B 2V8IA 1QQJA 4ZN1A 2EKOA 4FSXA 5M9OA 5GJVB 4A4GA 2PNIA 1KFZA 4ATOA 2O9VA 5CR2A 2GTJA 2W10A 2RN8A 2R57A 4J9CA 4B9XA 1K8AR 2FB7A 9ATCB 2V26A 1YI2Q 1YP5A 3HTRA 4EMHA 2JM9A 4KBMB 1Y96B 1YCSB 3GP8A 2LT4A 3FRNA 1UECA 4HVVA 1I1JA 1K73R 2KVQG 1Q7YU 5LJ3g 4PJOG 4BACA 2EQKA 2EQMA 1I0CA 3N5BB 2OAUA 1UE9A 8ATCB 1UGRB 2RO0A 5GAOq 1MUZA 2KYMA 2CZ6B 4A4HA 3OY9A 2JS2A 3EFOA 1YHQT 4EPCA 1RAGB 3M0SA 5J3BA 1M2VA 3EGDB 4CC3A 4JJBA 4L6V5 1NJIU 4JJDA 4C92D 2RQWA 3CPWA 4OGCA 2KYBA 2NYSA 3X26B 4M75B 4DA4A 1M90C 3PMTA 4XTWA 4BI4A 3E9FA 2CS7A 3OS2A 1N8RR 4J83A 2E1HA 3G71Q 1MMGA 5A2QE 4LD6A 5LJ3f 2ED1A 2VXFA 4AT1B 3GOXA 3S3NA 1MHNA 1VQ8T 3JCMV 1ACMB 5FU7C 1N6AA 3E9GA 1QVGP 2DEUA 4XTXA 2QA4T 2J6OA 1VQ6A 3HRUA 3G4SA 2K57A 2EIFA 4LUEA 4DOWA 2BE9B 2RD1A 1WHLA 3LH0A 2QASA 2CYZB 4RTXA 3FLGA 3VS2A 1SEMA 2OTLA 1QW1A 3OYIA 3KFVA 4LDWA 4MZTA 4FYWB 5KE3A 4E7HA 3M56A 3JB9I 5I11A 3EH1A 2KSSA 2CUBA 1V29B 1LOJA 1U06A 3A8OB 1X43A 2RNAA 2JW4A 2DTHA 2CZ0B 3RDVA 8AT1B 1RADB 1D09B 5LJ3h 4V2SA 2HD0A 2A28A 3UWNA 2AKLA 2AHJB 3MEVA 2JTMA 4M77D 3ZFJA 2E65A 1K9MR 1VQ4A 4RTZA 4FSSA 2V8KA 3I55Q 1E6HA 2HL5C 4C8QA 4XTZA 4XTVA 4B6MA 4ELYC 2BZXA 5EG2A 5IHNA 2DVJA 1JU5C 2LX9A 3A1PA 5KYWA 2F2WA 5D6YA 2GCXA 4NS5A 5IHIA 1D0YA 1XJWB 4BDYA 2YUNA 2HKQB 1X69A 4JRKA 3V8JA 4P5NA 1CKBA 3SDZA 3PIPA 1VQOA 3CCRQ 3E2UA 3SFMA 4N0AA 3UPUA 1N27A 2XICA 3U23A 2M0YA 3EG0A 2K7AA 1YBYA 1M1KC 1TWBA 2V1QA 1JQQA 5CCAA 3MCAB 3URGA 5GAN8 2DA9A 1E6GA 4OGEA 1OPLA 3EH2A 3JCMb 3DKMA 3G6ET 1QVFA 3MP8A 4RKUE 1W1FA 1R77A 4C8QC 1WYXA 4IUQA 2CP7A 1X2QA 4XTYA 5HKCA 2XD0A 1I4K1 2EYZA 4IUPA 5CIUA 2KAFA 3X20B 1KQSS 1MGQA 4K11A 2EYWA 1ZUUA 1VQNA 1PNJA 3VS5A 3QWXX 3GPLA 4C92F 3GLXA 2DMOA 3PFSA 5GAMe 4M7DA 2JOYA 3PVLA 3CCUA 4M7AA 3H0IA 1OULA 4IIOA 3JB9D 4JLGA 1OX9A 3M4YA 1OQKA 1Q86R 1X01A 1MMNA 4HVUA 2BIVA 1RAHB 4AFUC 3HRTA 2FZGB 3SEMA 3NHNA 1JJ2S 1IHVA 1HYOA 1G3WA 3FEOA 1WGSA 4C0DB 2LQNA 2OTJA 4RMOA 3OQ5A 1KD1C 1LCKA 3RNJA 2HKNA 3TCJA 3M0TA 3QBYA 4JS5A 2RI3A 1G5VA 3GIBA 1BU1A 1YJNA 2DYBA 3JCMg 2RM4A 2MK5A 4ORZA 4M7DC 3RR6A 2EW3A 4M7AC 2GF7A 2ECZA 1BCOA 1GFCA 3G7ZA 5I2SA 2JTFA 1M3AA 5KE2A 2CP0A 5IN1A 4RTUA 4TVRA 1BKBA 1QKXA 1Q7YR 3M5AA 3VV0A 4LDYA 3SD4A 4AFSC 2DM1A 4DBHA 3S6WA 5FWBA 5KH6A 4E7KA 4OMFB 5FRNA 1KHCA 2R5MA 3QYGB 5FU6C 1MMDA 4F04B 3CPWP 3EG1A 2KRSA 1YJ9A 5ECAA 1F1BB 2RI2A 1VQ6Q 3F70A 3G4SQ 2DIQA 3OBWA 4M77F 3EG9A 1OYXA 3CMAQ 1NJIR 2F1LA 4M78E 1CSKA 3BE3A 3TSWA 4JUVA 4HCBA 2L0AA 1JO8A 2VXEA 4KRTA 1VQ4T 2OTLQ 2RI5A 3JCMf 2WSFE 3V8KA 2L3PA 4E6RA 3CC2Q 1NPRA 2D0NA 5DY9A 4BDZA 1RI9A 2J6KA 4M7DG 2VC8A 5KYNA 1QMCA 2DD5A 4J9HA 4KGXB 2ZPHB 1EIFA 1GCPA 4DQ2A 4M77G 3META 1WHKA 2GGRA 2L8DA 4PLIA 4QW2A 4D6WA 4E2FB 1M1KU 3QZ5B 5GMKi 2CZ7B 1VQPA 2ZPFB 1ZSGA 1SSFA 1M30A 1VQOT 2DE0X 3CXCA 3CEYA 4J9DA 5C6SA 4KGZB 1WHGA 5KYYB 1D1CA 3ULRB 4A4KA 4R56A 4ZGDB 1VQ5T 4BI3A 1VQ4Q 3AHUA 1HXDA 1X6GA 3OYMA 3M59A 4FU6A 4ZTFA 1Z9ZA 2DEQA 3VJPA 3RKXA 1OEBA 2BUDA 2COYA 4PJOB 3OW2S 1RLPC 2KK4A 1BK2A 1ZSZB 4OMPA 3JCMh 5IHKA 3FC3A 4M75E 3VRZA 2KR3A 2EBPA 2CP6A 2MPXC 2WSCE 4MDWA 4NL2A 2FYKA 1V76A 1SPKA 1BYMA 4F7UA 5FROA 1BCMA 1IZ6A 4C5IA 2KBTA 2A7YA 4CC4B 3JB9F 1YN8A 1WIEA 4WF2A 2E5QA 3JRZA 3L42A 5DLOA 2PVOB 4J7IA 5CK9A 2JUFA 5J26A 3GBQA 2NUTB 1H3ZA 4UC4A 4BY6C 3E1SA 2O9SA 2ZZDA 1OI1A 2EKHA 2PVGB 2YLBA 2DERA 3EAEA 2J05A 1FXXA 1RAEB 2QA4A 5DM7R 1K4US 3PVQA 1AWXA 2QQ9A 2ZPEB 3FB9A 2MCNA 1UHCA 4FYXB 2YRVA 4R55A 2DK3A 1RL2A 4EMGA 1W70A 4PK4A 1VQNQ 4EMKA 1BIAA 3NTHA 1QVFP 2RHUA 3HL8A 1I07A 2VVKA 3CCUQ 1JRIA 3FJ5A 1VYUA 1BI0A 3QDFA 2FPDA 3I56T 4RCCA 1J3TA 5CQXA 3SHWA 4ANJA 2ZAEA 3A8GB 1AOJA 1WLPB 1ZHIA 4IUTA 1U3OA 3LH5A 2C0TA 5FWCA 1W2BS 1UTIA 3OMGA 1P92A 1WJSA 2A3LA 2DTOA 2L3QA 3CPFA 3BFMA 1M4ZA 2E41A 1WNLA 4B9WA 5GAMd 2OTJQ 1YITA 3OYCA 1M27C 2EQJA 1YJ9T 3H0HA 3X28B 5GAN5 1JBMA 3ZEHA 2RHZA 2FZKB 1SHGA 1RUWA 2HSEB 2LX7A 3NTIA 4FW2A 3EFOB 3GNGA 1IXDA 2C06A 1VQKQ 1M2VB 1G83A 1WQ7A 2K5IA 3RBBB 4CRIA 5LL6S 2E6ZA 1TTHB 4J6YA 1YJNQ 1BI1A 4KULA 4OMNA 5CKFA 5J39A 4JDSA 1YJWA 2HCKA 2EJFA 1X2KA 2LMJA 4JS4A 1KHIA 2D6FA 4HVWA 4JZ3A 2DBMA 2PVDB 1PSEA 4M78D 4L5GA 2H3JA 5GMKm 1OZ3A 3H6ZA 3P8HA 3QG1A 3CC7Q 1VQPT 5I2MA 4CC7A 2XU8A 4A4EA 4C5HA 2XDPA 1UEBA 1QWFA 4IKFA 2HSPA 2JMCA 3PNWC 3G6EA 4A54A 1VQLA 3JCMc 1PHTA 1AZEA 3UF4A 4OB1B 2EVRA 1QP2A 4OP0A 5KCOA 2VYTA 2EGAA 3QDRB 4HXJA 4NL3A 2KRMA 3JCMW 1G2BA 3L1AA 3CMET 5LJ5e 3I5RA 2RB6A 1ZUKA 4ME7A 4RG2A 5GAOn 4RTVA 1KC8C 2K3BA 1VQPQ 5KYXA 4OMLA 5GMKe 2QEXT 1VUBA 3CD6T 1KSWA 1G3TA 3A5ZB 3ME9A 4O5VA 5GANj 1PWTA 2RQRA 2EGEA 5KYUA 3R6OA 2BZ8A 4M75D 1NEBA 4F14A 5AT1B 2DILA 3OB9A 1B34A 2QQBA 1FMVA 1HK9A 2R58A 3HFNA 3PGGA 5GJWB 2D8HA 4HCKA 2C0OA 1Q95G 3CXCP 4C8QB 2CKKA 2E10A 2IIMA 1R0CB 1UGSB 1HSQA 2RQUA 4JRIA 1M3BA 1M1KR 1Q81C 2YSQA 5KYWB 4MZPA 3REAB 1YHQQ 2D8JA 2GQIA 1FWZA 4CI0C 4PJNA 4D8DA 4CC2A 7AT1B 1XQHA 2DPPB 3T9NA 1KG1A 2LCLA 2DZ9A 5IXFA 3O8VA 3QJ6A 2PTKA 3JCMe 1VA7A 4HA8A 2KEAA 2NUZA 5GAOl 1UHFA 1YFNA 1TUCA 3JSCA 5CKEA 2JT4A 2VUBA 3A8HB 1G3SA 3JAME 2X9HA 1VQ8Q 2B86A 2ZGWA 2GFAA 1T0JA 3EHRA 4PL6A 3RESA 4LDUA 1UGQB 1AVZC 3TVTA 2QA4Q 1A0NB 4BE0A 1K8AC 1D1AA 2EGCA 4JRQA 2FHDA 1ABOA 2OJ2A 3M0RA 1M8MA 3QUIA 3REBB 2K9GA 3NMZC 1YITT 2P0QA 1T0HA 1TXQA 2OAWA 1BBZA 4C0GA 2F2XA 2Y4YA 3WXMB 5LJ5j 3UDCA 2QDYB 1KJWA 2NUPA 3VKIA 1MV0B 1WFWA 2YUQA 2LDMA 3ER0A 4M7DB 4M7AB 1W4SA 2FPEA 4RTTA 3C94A 4M78F 1YJWT 2ROTA 3QXEB 2BZYA 4BUGA 2LCCA 3C0CA 1Y57A 1S72T 5FU6B 2DL5A 4PJOE 4BE1A 4OMMA 1G8XA 1JEGA 1CKAA 1M8VA 2COWA 4AG1C 5AYFA 4FYYB 1UGPB 2IVWA 3GF5A 1SKUB 2GFUA 1VQ5A 4QQDA 3CCMT 1Z9QA 3S3MA 2PUKB 3CCJT 4M78G 3CCSA 5HCKA 3CPWS 4JZ4A 1TUGB 1SSHA 2PU9B 3OA6A 1OU8A 3JCMJ 1GCQA 4BB7A 5GANd 4C92C 1VQLT 2ED0A 3C4SA 1N5ZA 1KC8U 3OS5A 4M75C 4FL6A 4LN2A 1YJWQ 2PQWA 2RF0A 3J7AF 2L3RA 1VIFA 2AK5A 1D0ZA 4OB2B 2JVVA 1YWPA 1V1CA 3CC4T 2QK0A 1M90U 3M55A 2FG0A 4PKCC 1VYTA 1Y0MA 3NPFA 4M75F 1YIJT 2JN0A 4ZN3A 2JMAA 1C6VX 2EWNA 1PD1A 1M1GA 3CCLT 1VQMA 4M77A 3RIRA 4E7IA 1VQ7T 2KROA 3EG9B 1QCOA 2VGNA 2X3XD 1MMAA 1ZLMA 3G6EQ 1OZ2A 2DL3A 4A4FA 2Z0WA 3UA7A 2RMOA 1Q81U 1UFFA 2KY9A 2V1RA 2M9UA 3JB9H 2NLUA 3RUXA 3VS0A 3LW5E 2RPNA 1UUEA 1GRIA 1GCQC 4C92G 4FYVB 1AWWA 4M75G 2KGTA 3VS4A 4AMCA 1K0SA 4LNPA 5GAOp 1RAIB 1O75A 3MHXA 2QDLA 4DBQA 2ROLA 1PD0A 2DXTA 1O9SA 4X34A 1X6BA 3I56A 2NWMA 2CDTA 3G1JA 2F5TX 2RJFA 2BE7D 4RUGA 1ARKA 4HCCA 1AEYA 2MAMA 1LVKA 1QCNA 2L2PA 2P4TA 3EGXA 3JB9J 4M77C 1RLQC 1QP3A 1B3QA 4BY6B 4XU3A 1MV3A 1SHFA 5LJ5d 3LWIA 1WXUA 4KUIA 2K5FA 3KXTA 3CCQA 5L23A 1WZOA 2CH4A 2ESWA 2XIDA 3IQLA 1M1FA 2E5KA 3S3OA 3PMIA 1U8RA 4Y28E 2E3HA 2HQXA 1K9AA 3BW1A 3OYNA 4OF1A 4OMOA 4F7UB 3QWYA 4QKUA 1GFDA 2XK0A 3SWNA 2DLPA 1JXMA 2JS0A 4MMLA 4BE2A 3CCET 1NBEB 4L59A 2E70A 2CSQA 5GAMj 2J7IA 1BI3A 4X9DA 1PRLC 1U5SA 2QGGA 1OU9A 3VS3A 1XOVA 1QCFA 2ABLA 2IG0A 1VOMA 4IIMA 1SG5A 4HT9A 1W2BA 2RA2A 3V8LA 3OMCA 1YNZA 2I2LA 2DJQA 3RMQA 2JTEA 2V8JA 2YXYA 2RJEA 4RG8A 4JLIA 3LLRA 4EMKB 3KUFA 3CCST 3KBGA 4KT0E 2EYYA 3HRSA 4PJOD 5HK3A 5LJ3e 5GAN7 2HL3A 2QQSA 2K5LA 5IXBA 3SWNC 1AZGB 1VQ9T 2E6NA 3CMEA 1FMKA 2RHYA 3CQTA 2K3XA 4II1A 1GL5A 5IT9E 4GLKA 1T3SA 1I5OB 2W0ZA 1RAAB 5FRMA 3P8BB 2QEXA 3M4GA 2RK2A 3EG3A 1VQOQ 3CD6A 4J9FA 1BB9A 4ZNXA 4C8QE 2VB6A 2DAQA 4Y91A 2KRNA 4MZMA 4C0DC 2LZ6B 5CKHA 1VQ5Q 2K4YA 3FJPA 4C0ZA 1B7TA 1VQMT 4ESRA 2MMPA 3QJYA 1TH7A 4IUVA 5CAIA 3M9QA
chains in the Genus database with same CATH topology
4RTZA 2HSPA 2JMCA 2G6FX 2MOXA 2LCSA 2LJ3A 4D8KA 4FSSA 1E6HA 2JXBA 1PHTA 1WX6A 1AZEA 2K6DA 3UF4A 2EVRA 1K0XA 2BZXA 2AZSA 2FEIA 1ABQA 2J06A 2OI3A 5IHNA 2DVJA 1JU5C 2EGAA 2F2WA 4HXJA 4X1VA 2KRMA 5IHIA 1G2BA 2YUNA 3I5RA 1ZUKA 3NGPA 4RTVA 2K3BA 1X69A 1CKBA 4OMLA 1EFNA 1T3LA 1K1ZA 3H0FA 1KSWA 2CUDA 4Z8AA 1UDLA 1PWTA 2RQRA 2CREA 2EGEA 2BZ8A 3U23A 2M0YA 3EG0A 2K7AA 1NEBA 4F14A 2KT1A 2DILA 2V1QA 1JQQA 2A08A 2FO0A 3I35A 2DA9A 1E6GA 1TG0A 1OPLA 4RTWA 5GJWB 1NLOC 2D8HA 2L3SA 2O2OA 4HCKA 1W1FA 2C0OA 4QT7A 1ZX6A 1NLPC 4LUDA 1ZBJA 2IIMA 1WYXA 2HDAA 1HSQA 1AWOA 5IH2A 1SRMA 1H3HA 2P4RA 2RQUA 1PKTA 2D1XA 1M3BA 1X2QA 1M3CA 2YSQA 3REAB 2D8JA 1PKSA 2GQIA 3H41A 2EYZA 2EYXA 4D8DA 4CC2A 2CT4A 4JPBW 1UG1A 4K11A 2EYWA 1ZUUA 1PNJA 3VS5A 3QWXX 2KNBB 2F2VA 5IXFA 2LP5A 2DMOA 3PVLA 1QWEA 2GNCA 3H0IA 3VS1A 2PTKA 1VA7A 4IIOA 1YWOA 3M0PA 3M0QA 2KEAA 2NUZA 3VS6A 1UHFA 2RQTA 4Z89A 1TUCA 2JT4A 1SRLA 4HVUA 2GBQA 2B86A 1T0JA 3EHRA 4AFUC 2I0NA 3SEMA 3NHNA 2A37A 2YUOA 1AVZC 1OPKA 5FW9A 3TVTA 1NYGA 1A0NB 2EGCA 1E7OA 2LQNA 4RTYA 1ABOA 2OJ2A 3M0RA 1M8MA 3REBB 2K9GA 3NMZC 1LCKA 1S1NA 3RNJA 2DRMA 2VKNA 3M0TA 1T0HA 3EG2A 2CSIA 1BBZA 2OAWA 2MIOA 2F2XA 2J6FA 2GTOA 1KJWA 3R6NA 1MV0B 2LJ1A 2YT6A 1WFWA 2YUQA 1BU1A 2DYBA 3EGUA 1H8KA 4ORZA 2EW3A 2O88A 2FPEA 3EHQA 2ECZA 1GFCA 4RTTA 1M3AA 2SEMA 4RTUA 1QKXA 2ROTA 4AFSC 3PE0A 1TUDA 3VRYA 4R0KA 2BZYA 2DM1A 2DRKA 2BTTA 2DL4A 3C0CA 5FWBA 1NM7A 1AD5A 4A63B 1Y57A 1WXBA 2DL5A 4OMMA 3VS7A 1JEGA 1CKAA 4AG1C 2KXDA 3EG1A 2DL7A 2KRSA 5ECAA 2EQIA 1W6XA 2KE9A 1Z9QA 2DF6A 1CSKA 3TSWA 2JM8A 3UATA 2VWFA 1WI7A 2L0AA 5HCKA 3M0UA 1JO8A 4JZ4A 4KRTA 4J9IA 1SSHA 1ZUYA 3TSZA 1GCQA 4Z88A 2L3PA 2A36A 2ED0A 4E6RA 1PRMC 2D0NA 1N5ZA 3THKA 4LN2A 1RI9A 4DEXA 2J6KA 2RF0A 1KIKA 3ZL7C 2AK5A 1IO6A 1HD3A 2DNUA 4J9HA 1GCPA 1QLYA 1V1CA 1YWPA 2GGRA 1WXTA 1K76A 1UJYA 3I9QA 2CT3A 1QKWA 1NYFA 1ZSGA 1M30A 2DE0X 2HEQA 2EPDA 2FG0A 4J9DA 4WCIA 1VYTA 1Y0MA 3NPFA 2CH4W 1GBQA 2JMAA 2RQVA 2FRWA 4J9BA 3A98A 3ULRB 5EC7A 2SRCA 2KT8A 2FPFA 2DBKA 4Y92A 2KROA 2X3XD 1ZLMA 1UJ0A 1X6GA 2LNHB 2DL3A 2M51A 3UA7A 4DEYA 1Z9ZA 2RMOA 1UFFA 1OEBA 2V1RA 3VS0A 2RPNA 1UUEA 1B07A 1GRIA 1RLPC 1GCQC 1OOTA 1BK2A 4OMPA 5IHKA 3VRZA 1AWWA 2KGTA 2KR3A 2EBPA 3VS4A 2PZ1A 1K0SA 4LNPA 1JXOA 1SPKA 2QDLA 5GJVB 2PNIA 3I5SA 1KFZA 2O9VA 2ROLA 2GTJA 2KBTA 4M4ZA 1X6BA 2NWMA 2W10A 2RN8A 4J9CA 2CDTA 1YN8A 4CC4B 1WIEA 4J9EA 4RUGA 1ARKA 1AEYA 1YP5A 2L2PA 4LE9A 2JM9A 1RLQC 3GBQA 1B3QA 1YCSB 1MV3A 1SHFA 2O9SA 1WA7A 2X3WD 1WXUA 1UECA 2EKHA 4HVVA 1I1JA 2HBWA 2J05A 5L23A 4AG2C 2DX1A 4F16A 1K4US 2CH4A 2ESWA 3PVQA 1AWXA 4J9GA 1I0CA 2DL8A 2MCNA 3IQLA 1UE9A 2E5KA 1UHCA 1MUZA 2KYMA 2LJ0A 1W70A 2JS2A 1K9AA 3M0SA 4CC3A 2LQWA 4OMOA 2KXCA 4JJBA 2YUPA 3QWYA 1I07A 4JJDA 2VVKA 1GFDA 3FJ5A 1VYUA 2DLPA 2RQWA 1JXMA 2AKKA 2JS0A 2KYBA 2FPDA 4F17A 3UA6A 4OMQA 2CSQA 2ENMA 1J3TA 3SHWA 2J7IA 2K79A 1AOJA 1PRLC 1U5SA 1WLPB 4AFQC 1U3OA 1H92A 1NG2A 3LH5A 3VS3A 2C0TA 5FWCA 2ED1A 1UTIA 1XOVA 1QCFA 5I22A 2ABLA 1X27A 2L3QA 1OV3A 4JJCA 2K2MA 4IIMA 4EIKA 2J6OA 1M27C 1YNZA 3H0HA 2DJQA 4LUEA 2JTEA 1UGVA 1SHGA 3O5ZA 4GLMA 1VYVA 4RTXA 1RUWA 2LX7A 1HJDA 3VS2A 1G83A 3RBBB 1SEMA 2EYYA 2H8HA 3KFVA 4OMNA 5IXBA 1AZGB 1FYNA 2HCKA 1X2KA 2LMJA 1FMKA 3CQTA 5I11A 4HVWA 4JZ3A 2DBMA 1GL5A 2CUBA 1T3SA 2W0ZA 1GBRA 1U06A 1AWJA 1X43A 2RNAA 2JW4A 3EG3A 4J9FA 1BB9A 4ZNXA 2YDLA 3JV3A 2AZVA 2XMFA 2A28A 4CC7A 2KRNA 1WDXA 2AKLA 4AFZC 2C0IA 2O31A 2LZ6B 4ESRA 4GBQA 1QWFA 1NEGA 2FRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RTZ A;  2HSP A;  2JMC A;  2G6F X;  2MOX A;  2LCS A;  2LJ3 A;  4D8K A;  4FSS A;  1E6H A;  2JXB A;  1PHT A;  1WX6 A;  1AZE A;  2K6D A;  3UF4 A;  2EVR A;  1K0X A;  2BZX A;  2AZS A;  2FEI A;  1ABQ A;  2J06 A;  2OI3 A;  5IHN A;  2DVJ A;  1JU5 C;  2EGA A;  2F2W A;  4HXJ A;  4X1V A;  2KRM A;  5IHI A;  1G2B A;  2YUN A;  3I5R A;  1ZUK A;  3NGP A;  4RTV A;  2K3B A;  1X69 A;  1CKB A;  4OML A;  1EFN A;  1T3L A;  1K1Z A;  3H0F A;  1KSW A;  2CUD A;  4Z8A A;  1UDL A;  1PWT A;  2RQR A;  2CRE A;  2EGE A;  2BZ8 A;  3U23 A;  2M0Y A;  3EG0 A;  2K7A A;  1NEB A;  4F14 A;  2KT1 A;  2DIL A;  2V1Q A;  1JQQ A;  2A08 A;  2FO0 A;  3I35 A;  2DA9 A;  1E6G A;  1TG0 A;  1OPL A;  4RTW A;  5GJW B;  1NLO C;  2D8H A;  2L3S A;  2O2O A;  4HCK A;  1W1F A;  2C0O A;  4QT7 A;  1ZX6 A;  1NLP C;  4LUD A;  1ZBJ A;  2IIM A;  1WYX A;  2HDA A;  1HSQ A;  1AWO A;  5IH2 A;  1SRM A;  1H3H A;  2P4R A;  2RQU A;  1PKT A;  2D1X A;  1M3B A;  1X2Q A;  1M3C A;  2YSQ A;  3REA B;  2D8J A;  1PKS A;  2GQI A;  3H41 A;  2EYZ A;  2EYX A;  4D8D A;  4CC2 A;  2CT4 A;  4JPB W;  1UG1 A;  4K11 A;  2EYW A;  1ZUU A;  1PNJ A;  3VS5 A;  3QWX X;  2KNB B;  2F2V A;  5IXF A;  2LP5 A;  2DMO A;  3PVL A;  1QWE A;  2GNC A;  3H0I A;  3VS1 A;  2PTK A;  1VA7 A;  4IIO A;  1YWO A;  3M0P A;  3M0Q A;  2KEA A;  2NUZ A;  3VS6 A;  1UHF A;  2RQT A;  4Z89 A;  1TUC A;  2JT4 A;  1SRL A;  4HVU A;  2GBQ A;  2B86 A;  1T0J A;  3EHR A;  4AFU C;  2I0N A;  3SEM A;  3NHN A;  2A37 A;  2YUO A;  1AVZ C;  1OPK A;  5FW9 A;  3TVT A;  1NYG A;  1A0N B;  2EGC A;  1E7O A;  2LQN A;  4RTY A;  1ABO A;  2OJ2 A;  3M0R A;  1M8M A;  3REB B;  2K9G A;  3NMZ C;  1LCK A;  1S1N A;  3RNJ A;  2DRM A;  2VKN A;  3M0T A;  1T0H A;  3EG2 A;  2CSI A;  1BBZ A;  2OAW A;  2MIO A;  2F2X A;  2J6F A;  2GTO A;  1KJW A;  3R6N A;  1MV0 B;  2LJ1 A;  2YT6 A;  1WFW A;  2YUQ A;  1BU1 A;  2DYB A;  3EGU A;  1H8K A;  4ORZ A;  2EW3 A;  2O88 A;  2FPE A;  3EHQ A;  2ECZ A;  1GFC A;  4RTT A;  1M3A A;  2SEM A;  4RTU A;  1QKX A;  2ROT A;  4AFS C;  3PE0 A;  1TUD A;  3VRY A;  4R0K A;  2BZY A;  2DM1 A;  2DRK A;  2BTT A;  2DL4 A;  3C0C A;  5FWB A;  1NM7 A;  1AD5 A;  4A63 B;  1Y57 A;  1WXB A;  2DL5 A;  4OMM A;  3VS7 A;  1JEG A;  1CKA A;  4AG1 C;  2KXD A;  3EG1 A;  2DL7 A;  2KRS A;  5ECA A;  2EQI A;  1W6X A;  2KE9 A;  1Z9Q A;  2DF6 A;  1CSK A;  3TSW A;  2JM8 A;  3UAT A;  2VWF A;  1WI7 A;  2L0A A;  5HCK A;  3M0U A;  1JO8 A;  4JZ4 A;  4KRT A;  4J9I A;  1SSH A;  1ZUY A;  3TSZ A;  1GCQ A;  4Z88 A;  2L3P A;  2A36 A;  2ED0 A;  4E6R A;  1PRM C;  2D0N A;  1N5Z A;  3THK A;  4LN2 A;  1RI9 A;  4DEX A;  2J6K A;  2RF0 A;  1KIK A;  3ZL7 C;  2AK5 A;  1IO6 A;  1HD3 A;  2DNU A;  4J9H A;  1GCP A;  1QLY A;  1V1C A;  1YWP A;  2GGR A;  1WXT A;  1K76 A;  1UJY A;  3I9Q A;  2CT3 A;  1QKW A;  1NYF A;  1ZSG A;  1M30 A;  2DE0 X;  2HEQ A;  2EPD A;  2FG0 A;  4J9D A;  4WCI A;  1VYT A;  1Y0M A;  3NPF A;  2CH4 W;  1GBQ A;  2JMA A;  2RQV A;  2FRW A;  4J9B A;  3A98 A;  3ULR B;  5EC7 A;  2SRC A;  2KT8 A;  2FPF A;  2DBK A;  4Y92 A;  2KRO A;  2X3X D;  1ZLM A;  1UJ0 A;  1X6G A;  2LNH B;  2DL3 A;  2M51 A;  3UA7 A;  4DEY A;  1Z9Z A;  2RMO A;  1UFF A;  1OEB A;  2V1R A;  3VS0 A;  2RPN A;  1UUE A;  1B07 A;  1GRI A;  1RLP C;  1GCQ C;  1OOT A;  1BK2 A;  4OMP A;  5IHK A;  3VRZ A;  1AWW A;  2KGT A;  2KR3 A;  2EBP A;  3VS4 A;  2PZ1 A;  1K0S A;  4LNP A;  1JXO A;  1SPK A;  2QDL A;  5GJV B;  2PNI A;  3I5S A;  1KFZ A;  2O9V A;  2ROL A;  2GTJ A;  2KBT A;  4M4Z A;  1X6B A;  2NWM A;  2W10 A;  2RN8 A;  4J9C A;  2CDT A;  1YN8 A;  4CC4 B;  1WIE A;  4J9E A;  4RUG A;  1ARK A;  1AEY A;  1YP5 A;  2L2P A;  4LE9 A;  2JM9 A;  1RLQ C;  3GBQ A;  1B3Q A;  1YCS B;  1MV3 A;  1SHF A;  2O9S A;  1WA7 A;  2X3W D;  1WXU A;  1UEC A;  2EKH A;  4HVV A;  1I1J A;  2HBW A;  2J05 A;  5L23 A;  4AG2 C;  2DX1 A;  4F16 A;  1K4U S;  2CH4 A;  2ESW A;  3PVQ A;  1AWX A;  4J9G A;  1I0C A;  2DL8 A;  2MCN A;  3IQL A;  1UE9 A;  2E5K A;  1UHC A;  1MUZ A;  2KYM A;  2LJ0 A;  1W70 A;  2JS2 A;  1K9A A;  3M0S A;  4CC3 A;  2LQW A;  4OMO A;  2KXC A;  4JJB A;  2YUP A;  3QWY A;  1I07 A;  4JJD A;  2VVK A;  1GFD A;  3FJ5 A;  1VYU A;  2DLP A;  2RQW A;  1JXM A;  2AKK A;  2JS0 A;  2KYB A;  2FPD A;  4F17 A;  3UA6 A;  4OMQ A;  2CSQ A;  2ENM A;  1J3T A;  3SHW A;  2J7I A;  2K79 A;  1AOJ A;  1PRL C;  1U5S A;  1WLP B;  4AFQ C;  1U3O A;  1H92 A;  1NG2 A;  3LH5 A;  3VS3 A;  2C0T A;  5FWC A;  2ED1 A;  1UTI A;  1XOV A;  1QCF A;  5I22 A;  2ABL A;  1X27 A;  2L3Q A;  1OV3 A;  4JJC A;  2K2M A;  4IIM A;  4EIK A;  2J6O A;  1M27 C;  1YNZ A;  3H0H A;  2DJQ A;  4LUE A;  2JTE A;  1UGV A;  1SHG A;  3O5Z A;  4GLM A;  1VYV A;  4RTX A;  1RUW A;  2LX7 A;  1HJD A;  3VS2 A;  1G83 A;  3RBB B;  1SEM A;  2EYY A;  2H8H A;  3KFV A;  4OMN A;  5IXB A;  1AZG B;  1FYN A;  2HCK A;  1X2K A;  2LMJ A;  1FMK A;  3CQT A;  5I11 A;  4HVW A;  4JZ3 A;  2DBM A;  1GL5 A;  2CUB A;  1T3S A;  2W0Z A;  1GBR A;  1U06 A;  1AWJ A;  1X43 A;  2RNA A;  2JW4 A;  3EG3 A;  4J9F A;  1BB9 A;  4ZNX A;  2YDL A;  3JV3 A;  2AZV A;  2XMF A;  2A28 A;  4CC7 A;  2KRN A;  1WDX A;  2AKL A;  4AFZ C;  2C0I A;  2O31 A;  2LZ6 B;  4ESR A;  4GBQ A;  1QWF A;  1NEG A;  2FRY A; 
#chains in the Genus database with same CATH topology
 3OYG A;  2JXB A;  2DYI A;  1KD1 U;  2KMT A;  2YWW A;  2AZS A;  2J06 A;  1ABQ A;  3OYH A;  4FT4 A;  1BIB A;  2M1H A;  3JB9 G;  5DLQ E;  3OBY A;  2P0P A;  4J8O A;  2O01 E;  3NGP A;  5GAN 3;  2DIG A;  3M57 A;  2MI6 A;  4ELZ C;  3AT1 B;  4FT2 A;  2KDS A;  2CUD A;  4Z8A A;  1UDL A;  2QQA A;  3QKJ A;  2KT1 A;  4QQ6 A;  4XU1 A;  2A08 A;  1FX7 A;  3BDL A;  1NE8 A;  4KH1 B;  4ZGJ B;  1KC8 R;  2QTV A;  3CCV T;  3VYG A;  1NLO C;  2B8A A;  2L3S A;  2O2O A;  3H8Z A;  5D6X A;  4WTO B;  1R0B G;  1GXI E;  1ZX6 A;  5FU7 B;  2KQW A;  3LYI A;  3DLM A;  4M7D E;  2EQU A;  3LWH A;  4M7A E;  2HDA A;  1AWO A;  5IH2 A;  1SRM A;  3CCQ T;  1D3B A;  1M90 R;  4J6W A;  3LGL A;  1PG5 B;  5LJ3 j;  3CBM A;  1PKS A;  3JCM P;  1I81 A;  2EYX A;  5GAO r;  5A0L A;  3CXC S;  3M58 A;  2EAY A;  1UG1 A;  1QVG S;  4KGV B;  2KNB B;  2LP5 A;  2M02 A;  5KYX B;  3I56 Q;  3VS1 A;  2GNC A;  3HP9 A;  4E7J A;  4ZTJ A;  1YWO A;  2RK1 A;  3M0P A;  1QVP A;  3MKD A;  5KYU B;  1Q81 R;  4OVA A;  2L5Q A;  3OS0 A;  1YI2 T;  4Z89 A;  1B34 B;  4O6J A;  1SRL A;  3QSU A;  2GBQ A;  3OYK A;  2PUO B;  1S72 A;  2QQR A;  3DB3 A;  2I0N A;  5GAM h;  2YUO A;  5FW9 A;  2QXF A;  1NYG A;  1YJ9 Q;  1PC0 A;  2X51 A;  1E7O A;  1D0X A;  2XKO C;  3GNF B;  3CCM A;  1VIE A;  2XG8 D;  2RHI A;  2YHT A;  4N4I A;  1WJR A;  1S1N A;  3CCJ A;  2MYS A;  1ZA1 B;  2DRM A;  2LRQ A;  2VKN A;  2QYZ A;  2DKG A;  1WQW A;  3OS1 A;  3OYF A;  2E3I A;  2GTO A;  4PJO F;  3R6N A;  3X24 B;  2DFU A;  4BI8 B;  5CKB A;  2LTO A;  3EGU A;  1H8K A;  1IGU A;  2HNI A;  2COZ A;  3EHQ A;  4Z02 A;  2F69 A;  1H64 1;  1N9S A;  2Y4X A;  1Q82 C;  3CC4 A;  3VRY A;  3UT1 A;  4R0K A;  2DRK A;  1LPL A;  3G71 T;  1NM7 A;  4A63 B;  5L8R E;  4LXC A;  3MEU A;  1YIJ A;  3VS7 A;  3MJX A;  2KXD A;  3QO3 A;  1LNX A;  3CCL A;  1VQ7 A;  3QZ9 B;  1W6X A;  3P8D A;  2KE9 A;  1X6O A;  2FL7 A;  2DF6 A;  2JM8 A;  3DLL A;  4XK8 E;  3M0U A;  2WSE E;  1ZUY A;  4HCZ A;  4Z88 A;  4C92 B;  2A36 A;  4PJJ A;  1XNI A;  2NUP B;  4C8Q D;  1W2B P;  2RJC A;  3INZ A;  2LT1 A;  3CME Q;  2X4J A;  1KIK A;  2CP2 A;  4M78 A;  2D0Q B;  1IO6 A;  1KK7 A;  2DNU A;  5FLX E;  1QLY A;  1TSF A;  4A53 A;  1K76 A;  1WXT A;  2XDD A;  2QEX Q;  1UJY A;  3CD6 Q;  2MWP A;  2WAC A;  4QVD A;  2CGH A;  3M54 A;  1KQS A;  2CH4 W;  1N9R A;  3V7S A;  5LJ3 d;  4J9B A;  1SF9 A;  1Y96 A;  5EC7 A;  3CMA A;  2SRC A;  2FPF A;  4Y92 A;  4PFP A;  1UJ0 A;  5GAN 4;  4DEY A;  2RH2 A;  4F7U E;  3C12 A;  2LQ8 A;  1NZ9 A;  2YRD A;  3I55 T;  1YCY A;  3CC2 A;  3VUZ A;  1I5L A;  2AT1 B;  1JJ2 A;  3WVD B;  3RMS A;  2PZ1 A;  2ZPG B;  4QVC A;  2K3Y A;  3LGF A;  4M78 C;  1JXO A;  3SB2 A;  3EGD A;  4IUR A;  5GAN g;  2EJ9 A;  3I5S A;  3HKS A;  3E19 A;  4C92 A;  1K73 C;  2LQK A;  2HBP A;  4E7Z A;  4OB0 B;  1C0M A;  1U1T A;  2QG9 B;  4M4Z A;  3CCR T;  4M75 A;  3CCE A;  4M7D D;  2QGF B;  4M7A D;  4C5E A;  4J9E A;  4BD3 A;  1RI0 A;  5GMK j;  3A8L B;  5CQY A;  4LE9 A;  4M77 B;  1KD1 R;  1PSF A;  4RCB A;  5C0M A;  4DOV A;  1WA7 A;  5GAN 2;  2X3W D;  3D7S B;  4QQG A;  2DD4 A;  3VU3 C;  2HBW A;  4AG2 C;  2DX1 A;  4F16 A;  4LDV A;  5A0D A;  1YIT Q;  4J9G A;  2DL8 A;  2DXU A;  5IAY A;  3V7C A;  5GAN 6;  1N8R C;  1IRE B;  5GAN f;  2DO3 A;  2FZC B;  2CP5 A;  1Y71 A;  2LJ0 A;  1IRX A;  5GAO m;  1M9S A;  2EYQ A;  2LQW A;  2KXC A;  2YUP A;  1Q82 U;  1KQ2 A;  4FW1 A;  4J5Y A;  1VQ9 A;  2AKK A;  3X25 B;  1TU0 B;  3L2Z A;  4F17 A;  3UA6 A;  4C0F A;  2HQE A;  1DJ7 B;  4OMQ A;  2ENM A;  2GQV A;  2FVU A;  3M53 A;  3MEA A;  4XU0 A;  2G3R A;  2K79 A;  3EGX B;  2P84 A;  4AFQ C;  4PJM A;  1S72 Q;  1H92 A;  3L2Q A;  2EFI A;  1NG2 A;  2K2V A;  1AT1 B;  4OB3 B;  5I22 A;  1X27 A;  3C95 A;  4MDX A;  3FIF A;  1OV3 A;  4LD9 K;  4JJC A;  2K2M A;  5CKD A;  2DET A;  3OYJ A;  3OYD A;  2HQH A;  3CCM Q;  4EIK A;  2ZCF B;  3CCJ Q;  4EDU A;  5LJ5 g;  2LVM A;  2HAX A;  1UGV A;  4XAX B;  1WHJ A;  1PCX A;  3O5Z A;  4GLM A;  1VYV A;  1JB0 E;  2ZPI B;  3VYH B;  5GAN h;  4FIB A;  1AHJ B;  2XI9 A;  1VQL Q;  1HJD A;  3HSB A;  1RAF B;  2QAZ A;  2BKD N;  2M16 A;  4C8Q F;  4N0A C;  2RJD A;  4J6X A;  2H8H A;  2DVE A;  1IB8 A;  3H9N A;  3SWN B;  1FYN A;  3MPU B;  3FDR A;  3OW2 A;  2VGM A;  3CC4 Q;  2X4X A;  4JJN K;  4E7L A;  1K9M C;  1GBR A;  3LX7 A;  3PIO A;  1AWJ A;  2D9T A;  3PT9 A;  1YIJ Q;  3ZBD A;  2YDL A;  3JV3 A;  2DZC A;  2AZV A;  3QPH A;  2XMF A;  3CCL Q;  1TS9 A;  4C8Q G;  1WDX A;  2X35 A;  4AFZ C;  1VQ7 Q;  2C0I A;  5LJ5 f;  2O31 A;  1VQ6 T;  3G4S T;  4GBQ A;  3CCV A;  3HPW A;  1K8A U;  1NEG A;  2FRY A;  3CMA T;  1C1A A;  4N4H A;  4VUB A;  2G6F X;  2MOX A;  3OYY A;  2Y90 A;  2LCS A;  2LJ3 A;  4D8K A;  1VQK A;  1WX6 A;  2K6D A;  4ZGE B;  4QVZ A;  1RAB B;  1K0X A;  3OSV A;  2OTL T;  2FEI A;  2OI3 A;  1ZQ1 A;  3CC2 T;  1K73 U;  4X1V A;  5D7U A;  2AIR B;  3HHT B;  2A0F B;  4E47 A;  1ZA2 B;  2LC4 A;  3PTA A;  1EFN A;  1T3L A;  1K1Z A;  3H0F A;  3CC7 A;  4M7D F;  4M7A F;  2E64 A;  2CRE A;  2JJ9 A;  2YRC A;  1YI2 A;  5LJ5 h;  1IHW A;  3RKY A;  3TU4 K;  2FO0 A;  1QVF S;  3I35 A;  4MMK A;  5I21 A;  3Q1J A;  1TG0 A;  4RTW A;  2H3E B;  4PFO A;  5GMK h;  1NPP A;  3V7R A;  4LDX A;  1N8R U;  2YLC A;  4QT7 A;  4XU2 A;  1NLP C;  4LUD A;  1Y7X A;  1ZBJ A;  3RER A;  2QTX A;  1KQS P;  1H3H A;  2P4R A;  3VUB A;  2JZ2 A;  4M7A G;  1PKT A;  2D1X A;  1M3C A;  3JCM d;  3MEW A;  2R5A A;  1Q86 C;  2QI2 A;  3H41 A;  2KI7 A;  3TQ7 P;  2RHX A;  2XHC A;  2DTI A;  3EFR A;  2CT4 A;  4JPB W;  1WPY A;  4PFZ A;  5D6W A;  2F2V A;  3EFS A;  3TRE A;  5CVI A;  3CCE Q;  1QWE A;  1QVG A;  4FM4 B;  1WJQ A;  2F5K A;  1JJ2 P;  3M0Q A;  2VV5 A;  4HT8 A;  3OYA A;  2EJG A;  3VS6 A;  4E7S A;  4XQ3 A;  4X9C A;  2RQT A;  6AT1 B;  4DBR A;  3L2U A;  3G71 A;  4HKE A;  1PM3 A;  4GY5 A;  2OX7 A;  2DXC A;  5HY6 A;  1G3Y A;  3OSS C;  2A37 A;  1OPK A;  4C92 E;  4PLL A;  3BDU A;  1U1S A;  2MF2 A;  1FMW A;  4Q5W A;  4RTY A;  2O4X B;  1D3B B;  2VAS A;  2DJZ A;  1YHQ A;  3MO8 A;  3L2R A;  1Q7Y C;  1XTD A;  1ZBX A;  3EG2 A;  2CSI A;  3CCS Q;  2MIO A;  1D1B A;  1Y07 A;  4IUU A;  1MND A;  2J6F A;  2X4W A;  1VQN T;  5GAM g;  1K9M U;  1EZZ B;  1VQ9 Q;  2LJ1 A;  2YT6 A;  3WVE B;  1OX8 A;  3CCU T;  2O88 A;  2XDB A;  3NTK A;  1X75 C;  2SEM A;  4FCY A;  1NJI C;  2P0K A;  3HFO A;  4KH0 B;  2IPO B;  3PE0 A;  1TUD A;  4PNO A;  4DBF A;  3J81 E;  2BTT A;  2DL4 A;  1VQ8 A;  1AD5 A;  1TOV A;  1WXB A;  4NOY A;  3L2W A;  3JCM X;  5A0G A;  3DB4 A;  5KYY A;  2DL7 A;  3NFC A;  1BI2 A;  4JRP A;  1VQM Q;  1WHH A;  2EQI A;  2X4Y A;  5GMK l;  2OTJ T;  1Q82 R;  3JCM Q;  3OYE A;  4PJL A;  3UAT A;  2VWF A;  1WI7 A;  4XTU A;  1WHM A;  2CP3 A;  2E4H A;  5GAM f;  1UB4 A;  4YTL A;  2MWO A;  4KUD K;  4J9I A;  4PJO A;  3CBO A;  3TSZ A;  3J80 E;  3I55 A;  2DXB A;  1ZSZ A;  2ZPB B;  5CO7 A;  3BY7 A;  1PRM C;  1VQK T;  3THK A;  1IGQ A;  2CZ1 B;  4DEX A;  1YJN T;  1EX4 A;  2O4X A;  3OYL A;  5HK0 A;  3ZL7 C;  4M77 E;  2HZY A;  1HD3 A;  4J7F A;  3QYH B;  1M2O A;  3TEE A;  3I9Q A;  3OYB A;  2CT3 A;  5GAN e;  1QKW A;  4F7U F;  2LNV A;  4N4G A;  1NYF A;  2E12 A;  1M5Q 1;  3CCR A;  3QHS A;  3QII A;  2HEQ A;  1MNE A;  2EPD A;  4WCI A;  1LJO A;  1GBQ A;  3MP6 A;  3CC7 T;  2RQV A;  2FRW A;  3CBP A;  3A98 A;  3OW2 P;  2HMA A;  2L89 A;  2NUT A;  3L2V A;  2KT8 A;  2DBK A;  3CCV Q;  1I8F A;  2LNH B;  2JNG A;  2M51 A;  4EMK C;  1RAC B;  3ASK A;  1Q86 U;  3CCQ Q;  3A8M B;  4F7U G;  4PJO C;  1B07 A;  1OOT A;  3MP1 A;  1ZSZ C;  2ATC B;  4C5G A;  5KCH A;  1KQ1 A;  1R8O B;  3RKW A;  2M0O A;  4M78 B;  2V8I A;  1QQJ A;  4ZN1 A;  2EKO A;  4FSX A;  5M9O A;  5GJV B;  4A4G A;  2PNI A;  1KFZ A;  4ATO A;  2O9V A;  5CR2 A;  2GTJ A;  2W10 A;  2RN8 A;  2R57 A;  4J9C A;  4B9X A;  1K8A R;  2FB7 A;  9ATC B;  2V26 A;  1YI2 Q;  1YP5 A;  3HTR A;  4EMH A;  2JM9 A;  4KBM B;  1Y96 B;  1YCS B;  3GP8 A;  2LT4 A;  3FRN A;  1UEC A;  4HVV A;  1I1J A;  1K73 R;  2KVQ G;  1Q7Y U;  5LJ3 g;  4PJO G;  4BAC A;  2EQK A;  2EQM A;  1I0C A;  3N5B B;  2OAU A;  1UE9 A;  8ATC B;  1UGR B;  2RO0 A;  5GAO q;  1MUZ A;  2KYM A;  2CZ6 B;  4A4H A;  3OY9 A;  2JS2 A;  3EFO A;  1YHQ T;  4EPC A;  1RAG B;  3M0S A;  5J3B A;  1M2V A;  3EGD B;  4CC3 A;  4JJB A;  4L6V 5;  1NJI U;  4JJD A;  4C92 D;  2RQW A;  3CPW A;  4OGC A;  2KYB A;  2NYS A;  3X26 B;  4M75 B;  4DA4 A;  1M90 C;  3PMT A;  4XTW A;  4BI4 A;  3E9F A;  2CS7 A;  3OS2 A;  1N8R R;  4J83 A;  2E1H A;  3G71 Q;  1MMG A;  5A2Q E;  4LD6 A;  5LJ3 f;  2ED1 A;  2VXF A;  4AT1 B;  3GOX A;  3S3N A;  1MHN A;  1VQ8 T;  3JCM V;  1ACM B;  5FU7 C;  1N6A A;  3E9G A;  1QVG P;  2DEU A;  4XTX A;  2QA4 T;  2J6O A;  1VQ6 A;  3HRU A;  3G4S A;  2K57 A;  2EIF A;  4LUE A;  4DOW A;  2BE9 B;  2RD1 A;  1WHL A;  3LH0 A;  2QAS A;  2CYZ B;  4RTX A;  3FLG A;  3VS2 A;  1SEM A;  2OTL A;  1QW1 A;  3OYI A;  3KFV A;  4LDW A;  4MZT A;  4FYW B;  5KE3 A;  4E7H A;  3M56 A;  3JB9 I;  5I11 A;  3EH1 A;  2KSS A;  2CUB A;  1V29 B;  1LOJ A;  1U06 A;  3A8O B;  1X43 A;  2RNA A;  2JW4 A;  2DTH A;  2CZ0 B;  3RDV A;  8AT1 B;  1RAD B;  1D09 B;  5LJ3 h;  4V2S A;  2HD0 A;  2A28 A;  3UWN A;  2AKL A;  2AHJ B;  3MEV A;  2JTM A;  4M77 D;  3ZFJ A;  2E65 A;  1K9M R;  1VQ4 A;  4RTZ A;  4FSS A;  2V8K A;  3I55 Q;  1E6H A;  2HL5 C;  4C8Q A;  4XTZ A;  4XTV A;  4B6M A;  4ELY C;  2BZX A;  5EG2 A;  5IHN A;  2DVJ A;  1JU5 C;  2LX9 A;  3A1P A;  5KYW A;  2F2W A;  5D6Y A;  2GCX A;  4NS5 A;  5IHI A;  1D0Y A;  1XJW B;  4BDY A;  2YUN A;  2HKQ B;  1X69 A;  4JRK A;  3V8J A;  4P5N A;  1CKB A;  3SDZ A;  3PIP A;  1VQO A;  3CCR Q;  3E2U A;  3SFM A;  4N0A A;  3UPU A;  1N27 A;  2XIC A;  3U23 A;  2M0Y A;  3EG0 A;  2K7A A;  1YBY A;  1M1K C;  1TWB A;  2V1Q A;  1JQQ A;  5CCA A;  3MCA B;  3URG A;  5GAN 8;  2DA9 A;  1E6G A;  4OGE A;  1OPL A;  3EH2 A;  3JCM b;  3DKM A;  3G6E T;  1QVF A;  3MP8 A;  4RKU E;  1W1F A;  1R77 A;  4C8Q C;  1WYX A;  4IUQ A;  2CP7 A;  1X2Q A;  4XTY A;  5HKC A;  2XD0 A;  1I4K 1;  2EYZ A;  4IUP A;  5CIU A;  2KAF A;  3X20 B;  1KQS S;  1MGQ A;  4K11 A;  2EYW A;  1ZUU A;  1VQN A;  1PNJ A;  3VS5 A;  3QWX X;  3GPL A;  4C92 F;  3GLX A;  2DMO A;  3PFS A;  5GAM e;  4M7D A;  2JOY A;  3PVL A;  3CCU A;  4M7A A;  3H0I A;  1OUL A;  4IIO A;  3JB9 D;  4JLG A;  1OX9 A;  3M4Y A;  1OQK A;  1Q86 R;  1X01 A;  1MMN A;  4HVU A;  2BIV A;  1RAH B;  4AFU C;  3HRT A;  2FZG B;  3SEM A;  3NHN A;  1JJ2 S;  1IHV A;  1HYO A;  1G3W A;  3FEO A;  1WGS A;  4C0D B;  2LQN A;  2OTJ A;  4RMO A;  3OQ5 A;  1KD1 C;  1LCK A;  3RNJ A;  2HKN A;  3TCJ A;  3M0T A;  3QBY A;  4JS5 A;  2RI3 A;  1G5V A;  3GIB A;  1BU1 A;  1YJN A;  2DYB A;  3JCM g;  2RM4 A;  2MK5 A;  4ORZ A;  4M7D C;  3RR6 A;  2EW3 A;  4M7A C;  2GF7 A;  2ECZ A;  1BCO A;  1GFC A;  3G7Z A;  5I2S A;  2JTF A;  1M3A A;  5KE2 A;  2CP0 A;  5IN1 A;  4RTU A;  4TVR A;  1BKB A;  1QKX A;  1Q7Y R;  3M5A A;  3VV0 A;  4LDY A;  3SD4 A;  4AFS C;  2DM1 A;  4DBH A;  3S6W A;  5FWB A;  5KH6 A;  4E7K A;  4OMF B;  5FRN A;  1KHC A;  2R5M A;  3QYG B;  5FU6 C;  1MMD A;  4F04 B;  3CPW P;  3EG1 A;  2KRS A;  1YJ9 A;  5ECA A;  1F1B B;  2RI2 A;  1VQ6 Q;  3F70 A;  3G4S Q;  2DIQ A;  3OBW A;  4M77 F;  3EG9 A;  1OYX A;  3CMA Q;  1NJI R;  2F1L A;  4M78 E;  1CSK A;  3BE3 A;  3TSW A;  4JUV A;  4HCB A;  2L0A A;  1JO8 A;  2VXE A;  4KRT A;  1VQ4 T;  2OTL Q;  2RI5 A;  3JCM f;  2WSF E;  3V8K A;  2L3P A;  4E6R A;  3CC2 Q;  1NPR A;  2D0N A;  5DY9 A;  4BDZ A;  1RI9 A;  2J6K A;  4M7D G;  2VC8 A;  5KYN A;  1QMC A;  2DD5 A;  4J9H A;  4KGX B;  2ZPH B;  1EIF A;  1GCP A;  4DQ2 A;  4M77 G;  3MET A;  1WHK A;  2GGR A;  2L8D A;  4PLI A;  4QW2 A;  4D6W A;  4E2F B;  1M1K U;  3QZ5 B;  5GMK i;  2CZ7 B;  1VQP A;  2ZPF B;  1ZSG A;  1SSF A;  1M30 A;  1VQO T;  2DE0 X;  3CXC A;  3CEY A;  4J9D A;  5C6S A;  4KGZ B;  1WHG A;  5KYY B;  1D1C A;  3ULR B;  4A4K A;  4R56 A;  4ZGD B;  1VQ5 T;  4BI3 A;  1VQ4 Q;  3AHU A;  1HXD A;  1X6G A;  3OYM A;  3M59 A;  4FU6 A;  4ZTF A;  1Z9Z A;  2DEQ A;  3VJP A;  3RKX A;  1OEB A;  2BUD A;  2COY A;  4PJO B;  3OW2 S;  1RLP C;  2KK4 A;  1BK2 A;  1ZSZ B;  4OMP A;  3JCM h;  5IHK A;  3FC3 A;  4M75 E;  3VRZ A;  2KR3 A;  2EBP A;  2CP6 A;  2MPX C;  2WSC E;  4MDW A;  4NL2 A;  2FYK A;  1V76 A;  1SPK A;  1BYM A;  4F7U A;  5FRO A;  1BCM A;  1IZ6 A;  4C5I A;  2KBT A;  2A7Y A;  4CC4 B;  3JB9 F;  1YN8 A;  1WIE A;  4WF2 A;  2E5Q A;  3JRZ A;  3L42 A;  5DLO A;  2PVO B;  4J7I A;  5CK9 A;  2JUF A;  5J26 A;  3GBQ A;  2NUT B;  1H3Z A;  4UC4 A;  4BY6 C;  3E1S A;  2O9S A;  2ZZD A;  1OI1 A;  2EKH A;  2PVG B;  2YLB A;  2DER A;  3EAE A;  2J05 A;  1FXX A;  1RAE B;  2QA4 A;  5DM7 R;  1K4U S;  3PVQ A;  1AWX A;  2QQ9 A;  2ZPE B;  3FB9 A;  2MCN A;  1UHC A;  4FYX B;  2YRV A;  4R55 A;  2DK3 A;  1RL2 A;  4EMG A;  1W70 A;  4PK4 A;  1VQN Q;  4EMK A;  1BIA A;  3NTH A;  1QVF P;  2RHU A;  3HL8 A;  1I07 A;  2VVK A;  3CCU Q;  1JRI A;  3FJ5 A;  1VYU A;  1BI0 A;  3QDF A;  2FPD A;  3I56 T;  4RCC A;  1J3T A;  5CQX A;  3SHW A;  4ANJ A;  2ZAE A;  3A8G B;  1AOJ A;  1WLP B;  1ZHI A;  4IUT A;  1U3O A;  3LH5 A;  2C0T A;  5FWC A;  1W2B S;  1UTI A;  3OMG A;  1P92 A;  1WJS A;  2A3L A;  2DTO A;  2L3Q A;  3CPF A;  3BFM A;  1M4Z A;  2E41 A;  1WNL A;  4B9W A;  5GAM d;  2OTJ Q;  1YIT A;  3OYC A;  1M27 C;  2EQJ A;  1YJ9 T;  3H0H A;  3X28 B;  5GAN 5;  1JBM A;  3ZEH A;  2RHZ A;  2FZK B;  1SHG A;  1RUW A;  2HSE B;  2LX7 A;  3NTI A;  4FW2 A;  3EFO B;  3GNG A;  1IXD A;  2C06 A;  1VQK Q;  1M2V B;  1G83 A;  1WQ7 A;  2K5I A;  3RBB B;  4CRI A;  5LL6 S;  2E6Z A;  1TTH B;  4J6Y A;  1YJN Q;  1BI1 A;  4KUL A;  4OMN A;  5CKF A;  5J39 A;  4JDS A;  1YJW A;  2HCK A;  2EJF A;  1X2K A;  2LMJ A;  4JS4 A;  1KHI A;  2D6F A;  4HVW A;  4JZ3 A;  2DBM A;  2PVD B;  1PSE A;  4M78 D;  4L5G A;  2H3J A;  5GMK m;  1OZ3 A;  3H6Z A;  3P8H A;  3QG1 A;  3CC7 Q;  1VQP T;  5I2M A;  4CC7 A;  2XU8 A;  4A4E A;  4C5H A;  2XDP A;  1UEB A;  1QWF A;  4IKF A;  2HSP A;  2JMC A;  3PNW C;  3G6E A;  4A54 A;  1VQL A;  3JCM c;  1PHT A;  1AZE A;  3UF4 A;  4OB1 B;  2EVR A;  1QP2 A;  4OP0 A;  5KCO A;  2VYT A;  2EGA A;  3QDR B;  4HXJ A;  4NL3 A;  2KRM A;  3JCM W;  1G2B A;  3L1A A;  3CME T;  5LJ5 e;  3I5R A;  2RB6 A;  1ZUK A;  4ME7 A;  4RG2 A;  5GAO n;  4RTV A;  1KC8 C;  2K3B A;  1VQP Q;  5KYX A;  4OML A;  5GMK e;  2QEX T;  1VUB A;  3CD6 T;  1KSW A;  1G3T A;  3A5Z B;  3ME9 A;  4O5V A;  5GAN j;  1PWT A;  2RQR A;  2EGE A;  5KYU A;  3R6O A;  2BZ8 A;  4M75 D;  1NEB A;  4F14 A;  5AT1 B;  2DIL A;  3OB9 A;  1B34 A;  2QQB A;  1FMV A;  1HK9 A;  2R58 A;  3HFN A;  3PGG A;  5GJW B;  2D8H A;  4HCK A;  2C0O A;  1Q95 G;  3CXC P;  4C8Q B;  2CKK A;  2E10 A;  2IIM A;  1R0C B;  1UGS B;  1HSQ A;  2RQU A;  4JRI A;  1M3B A;  1M1K R;  1Q81 C;  2YSQ A;  5KYW B;  4MZP A;  3REA B;  1YHQ Q;  2D8J A;  2GQI A;  1FWZ A;  4CI0 C;  4PJN A;  4D8D A;  4CC2 A;  7AT1 B;  1XQH A;  2DPP B;  3T9N A;  1KG1 A;  2LCL A;  2DZ9 A;  5IXF A;  3O8V A;  3QJ6 A;  2PTK A;  3JCM e;  1VA7 A;  4HA8 A;  2KEA A;  2NUZ A;  5GAO l;  1UHF A;  1YFN A;  1TUC A;  3JSC A;  5CKE A;  2JT4 A;  2VUB A;  3A8H B;  1G3S A;  3JAM E;  2X9H A;  1VQ8 Q;  2B86 A;  2ZGW A;  2GFA A;  1T0J A;  3EHR A;  4PL6 A;  3RES A;  4LDU A;  1UGQ B;  1AVZ C;  3TVT A;  2QA4 Q;  1A0N B;  4BE0 A;  1K8A C;  1D1A A;  2EGC A;  4JRQ A;  2FHD A;  1ABO A;  2OJ2 A;  3M0R A;  1M8M A;  3QUI A;  3REB B;  2K9G A;  3NMZ C;  1YIT T;  2P0Q A;  1T0H A;  1TXQ A;  2OAW A;  1BBZ A;  4C0G A;  2F2X A;  2Y4Y A;  3WXM B;  5LJ5 j;  3UDC A;  2QDY B;  1KJW A;  2NUP A;  3VKI A;  1MV0 B;  1WFW A;  2YUQ A;  2LDM A;  3ER0 A;  4M7D B;  4M7A B;  1W4S A;  2FPE A;  4RTT A;  3C94 A;  4M78 F;  1YJW T;  2ROT A;  3QXE B;  2BZY A;  4BUG A;  2LCC A;  3C0C A;  1Y57 A;  1S72 T;  5FU6 B;  2DL5 A;  4PJO E;  4BE1 A;  4OMM A;  1G8X A;  1JEG A;  1CKA A;  1M8V A;  2COW A;  4AG1 C;  5AYF A;  4FYY B;  1UGP B;  2IVW A;  3GF5 A;  1SKU B;  2GFU A;  1VQ5 A;  4QQD A;  3CCM T;  1Z9Q A;  3S3M A;  2PUK B;  3CCJ T;  4M78 G;  3CCS A;  5HCK A;  3CPW S;  4JZ4 A;  1TUG B;  1SSH A;  2PU9 B;  3OA6 A;  1OU8 A;  3JCM J;  1GCQ A;  4BB7 A;  5GAN d;  4C92 C;  1VQL T;  2ED0 A;  3C4S A;  1N5Z A;  1KC8 U;  3OS5 A;  4M75 C;  4FL6 A;  4LN2 A;  1YJW Q;  2PQW A;  2RF0 A;  3J7A F;  2L3R A;  1VIF A;  2AK5 A;  1D0Z A;  4OB2 B;  2JVV A;  1YWP A;  1V1C A;  3CC4 T;  2QK0 A;  1M90 U;  3M55 A;  2FG0 A;  4PKC C;  1VYT A;  1Y0M A;  3NPF A;  4M75 F;  1YIJ T;  2JN0 A;  4ZN3 A;  2JMA A;  1C6V X;  2EWN A;  1PD1 A;  1M1G A;  3CCL T;  1VQM A;  4M77 A;  3RIR A;  4E7I A;  1VQ7 T;  2KRO A;  3EG9 B;  1QCO A;  2VGN A;  2X3X D;  1MMA A;  1ZLM A;  3G6E Q;  1OZ2 A;  2DL3 A;  4A4F A;  2Z0W A;  3UA7 A;  2RMO A;  1Q81 U;  1UFF A;  2KY9 A;  2V1R A;  2M9U A;  3JB9 H;  2NLU A;  3RUX A;  3VS0 A;  3LW5 E;  2RPN A;  1UUE A;  1GRI A;  1GCQ C;  4C92 G;  4FYV B;  1AWW A;  4M75 G;  2KGT A;  3VS4 A;  4AMC A;  1K0S A;  4LNP A;  5GAO p;  1RAI B;  1O75 A;  3MHX A;  2QDL A;  4DBQ A;  2ROL A;  1PD0 A;  2DXT A;  1O9S A;  4X34 A;  1X6B A;  3I56 A;  2NWM A;  2CDT A;  3G1J A;  2F5T X;  2RJF A;  2BE7 D;  4RUG A;  1ARK A;  4HCC A;  1AEY A;  2MAM A;  1LVK A;  1QCN A;  2L2P A;  2P4T A;  3EGX A;  3JB9 J;  4M77 C;  1RLQ C;  1QP3 A;  1B3Q A;  4BY6 B;  4XU3 A;  1MV3 A;  1SHF A;  5LJ5 d;  3LWI A;  1WXU A;  4KUI A;  2K5F A;  3KXT A;  3CCQ A;  5L23 A;  1WZO A;  2CH4 A;  2ESW A;  2XID A;  3IQL A;  1M1F A;  2E5K A;  3S3O A;  3PMI A;  1U8R A;  4Y28 E;  2E3H A;  2HQX A;  1K9A A;  3BW1 A;  3OYN A;  4OF1 A;  4OMO A;  4F7U B;  3QWY A;  4QKU A;  1GFD A;  2XK0 A;  3SWN A;  2DLP A;  1JXM A;  2JS0 A;  4MML A;  4BE2 A;  3CCE T;  1NBE B;  4L59 A;  2E70 A;  2CSQ A;  5GAM j;  2J7I A;  1BI3 A;  4X9D A;  1PRL C;  1U5S A;  2QGG A;  1OU9 A;  3VS3 A;  1XOV A;  1QCF A;  2ABL A;  2IG0 A;  1VOM A;  4IIM A;  1SG5 A;  4HT9 A;  1W2B A;  2RA2 A;  3V8L A;  3OMC A;  1YNZ A;  2I2L A;  2DJQ A;  3RMQ A;  2JTE A;  2V8J A;  2YXY A;  2RJE A;  4RG8 A;  4JLI A;  3LLR A;  4EMK B;  3KUF A;  3CCS T;  3KBG A;  4KT0 E;  2EYY A;  3HRS A;  4PJO D;  5HK3 A;  5LJ3 e;  5GAN 7;  2HL3 A;  2QQS A;  2K5L A;  5IXB A;  3SWN C;  1AZG B;  1VQ9 T;  2E6N A;  3CME A;  1FMK A;  2RHY A;  3CQT A;  2K3X A;  4II1 A;  1GL5 A;  5IT9 E;  4GLK A;  1T3S A;  1I5O B;  2W0Z A;  1RAA B;  5FRM A;  3P8B B;  2QEX A;  3M4G A;  2RK2 A;  3EG3 A;  1VQO Q;  3CD6 A;  4J9F A;  1BB9 A;  4ZNX A;  4C8Q E;  2VB6 A;  2DAQ A;  4Y91 A;  2KRN A;  4MZM A;  4C0D C;  2LZ6 B;  5CKH A;  1VQ5 Q;  2K4Y A;  3FJP A;  4C0Z A;  1B7T A;  1VQM T;  4ESR A;  2MMP A;  3QJY A;  1TH7 A;  4IUV A;  5CAI A;  3M9Q A; 
#chains in the Genus database with same CATH homology
 4RTZ A;  2HSP A;  2JMC A;  2G6F X;  2MOX A;  2LCS A;  2LJ3 A;  4D8K A;  4FSS A;  1E6H A;  2JXB A;  1PHT A;  1WX6 A;  1AZE A;  2K6D A;  3UF4 A;  2EVR A;  1K0X A;  2BZX A;  2AZS A;  2FEI A;  1ABQ A;  2J06 A;  2OI3 A;  5IHN A;  2DVJ A;  1JU5 C;  2EGA A;  2F2W A;  4HXJ A;  4X1V A;  2KRM A;  5IHI A;  1G2B A;  2YUN A;  3I5R A;  1ZUK A;  3NGP A;  4RTV A;  2K3B A;  1X69 A;  1CKB A;  4OML A;  1EFN A;  1T3L A;  1K1Z A;  3H0F A;  1KSW A;  2CUD A;  4Z8A A;  1UDL A;  1PWT A;  2RQR A;  2CRE A;  2EGE A;  2BZ8 A;  3U23 A;  2M0Y A;  3EG0 A;  2K7A A;  1NEB A;  4F14 A;  2KT1 A;  2DIL A;  2V1Q A;  1JQQ A;  2A08 A;  2FO0 A;  3I35 A;  2DA9 A;  1E6G A;  1TG0 A;  1OPL A;  4RTW A;  5GJW B;  1NLO C;  2D8H A;  2L3S A;  2O2O A;  4HCK A;  1W1F A;  2C0O A;  4QT7 A;  1ZX6 A;  1NLP C;  4LUD A;  1ZBJ A;  2IIM A;  1WYX A;  2HDA A;  1HSQ A;  1AWO A;  5IH2 A;  1SRM A;  1H3H A;  2P4R A;  2RQU A;  1PKT A;  2D1X A;  1M3B A;  1X2Q A;  1M3C A;  2YSQ A;  3REA B;  2D8J A;  1PKS A;  2GQI A;  3H41 A;  2EYZ A;  2EYX A;  4D8D A;  4CC2 A;  2CT4 A;  4JPB W;  1UG1 A;  4K11 A;  2EYW A;  1ZUU A;  1PNJ A;  3VS5 A;  3QWX X;  2KNB B;  2F2V A;  5IXF A;  2LP5 A;  2DMO A;  3PVL A;  1QWE A;  2GNC A;  3H0I A;  3VS1 A;  2PTK A;  1VA7 A;  4IIO A;  1YWO A;  3M0P A;  3M0Q A;  2KEA A;  2NUZ A;  3VS6 A;  1UHF A;  2RQT A;  4Z89 A;  1TUC A;  2JT4 A;  1SRL A;  4HVU A;  2GBQ A;  2B86 A;  1T0J A;  3EHR A;  4AFU C;  2I0N A;  3SEM A;  3NHN A;  2A37 A;  2YUO A;  1AVZ C;  1OPK A;  5FW9 A;  3TVT A;  1NYG A;  1A0N B;  2EGC A;  1E7O A;  2LQN A;  4RTY A;  1ABO A;  2OJ2 A;  3M0R A;  1M8M A;  3REB B;  2K9G A;  3NMZ C;  1LCK A;  1S1N A;  3RNJ A;  2DRM A;  2VKN A;  3M0T A;  1T0H A;  3EG2 A;  2CSI A;  1BBZ A;  2OAW A;  2MIO A;  2F2X A;  2J6F A;  2GTO A;  1KJW A;  3R6N A;  1MV0 B;  2LJ1 A;  2YT6 A;  1WFW A;  2YUQ A;  1BU1 A;  2DYB A;  3EGU A;  1H8K A;  4ORZ A;  2EW3 A;  2O88 A;  2FPE A;  3EHQ A;  2ECZ A;  1GFC A;  4RTT A;  1M3A A;  2SEM A;  4RTU A;  1QKX A;  2ROT A;  4AFS C;  3PE0 A;  1TUD A;  3VRY A;  4R0K A;  2BZY A;  2DM1 A;  2DRK A;  2BTT A;  2DL4 A;  3C0C A;  5FWB A;  1NM7 A;  1AD5 A;  4A63 B;  1Y57 A;  1WXB A;  2DL5 A;  4OMM A;  3VS7 A;  1JEG A;  1CKA A;  4AG1 C;  2KXD A;  3EG1 A;  2DL7 A;  2KRS A;  5ECA A;  2EQI A;  1W6X A;  2KE9 A;  1Z9Q A;  2DF6 A;  1CSK A;  3TSW A;  2JM8 A;  3UAT A;  2VWF A;  1WI7 A;  2L0A A;  5HCK A;  3M0U A;  1JO8 A;  4JZ4 A;  4KRT A;  4J9I A;  1SSH A;  1ZUY A;  3TSZ A;  1GCQ A;  4Z88 A;  2L3P A;  2A36 A;  2ED0 A;  4E6R A;  1PRM C;  2D0N A;  1N5Z A;  3THK A;  4LN2 A;  1RI9 A;  4DEX A;  2J6K A;  2RF0 A;  1KIK A;  3ZL7 C;  2AK5 A;  1IO6 A;  1HD3 A;  2DNU A;  4J9H A;  1GCP A;  1QLY A;  1V1C A;  1YWP A;  2GGR A;  1WXT A;  1K76 A;  1UJY A;  3I9Q A;  2CT3 A;  1QKW A;  1NYF A;  1ZSG A;  1M30 A;  2DE0 X;  2HEQ A;  2EPD A;  2FG0 A;  4J9D A;  4WCI A;  1VYT A;  1Y0M A;  3NPF A;  2CH4 W;  1GBQ A;  2JMA A;  2RQV A;  2FRW A;  4J9B A;  3A98 A;  3ULR B;  5EC7 A;  2SRC A;  2KT8 A;  2FPF A;  2DBK A;  4Y92 A;  2KRO A;  2X3X D;  1ZLM A;  1UJ0 A;  1X6G A;  2LNH B;  2DL3 A;  2M51 A;  3UA7 A;  4DEY A;  1Z9Z A;  2RMO A;  1UFF A;  1OEB A;  2V1R A;  3VS0 A;  2RPN A;  1UUE A;  1B07 A;  1GRI A;  1RLP C;  1GCQ C;  1OOT A;  1BK2 A;  4OMP A;  5IHK A;  3VRZ A;  1AWW A;  2KGT A;  2KR3 A;  2EBP A;  3VS4 A;  2PZ1 A;  1K0S A;  4LNP A;  1JXO A;  1SPK A;  2QDL A;  5GJV B;  2PNI A;  3I5S A;  1KFZ A;  2O9V A;  2ROL A;  2GTJ A;  2KBT A;  4M4Z A;  1X6B A;  2NWM A;  2W10 A;  2RN8 A;  4J9C A;  2CDT A;  1YN8 A;  4CC4 B;  1WIE A;  4J9E A;  4RUG A;  1ARK A;  1AEY A;  1YP5 A;  2L2P A;  4LE9 A;  2JM9 A;  1RLQ C;  3GBQ A;  1B3Q A;  1YCS B;  1MV3 A;  1SHF A;  2O9S A;  1WA7 A;  2X3W D;  1WXU A;  1UEC A;  2EKH A;  4HVV A;  1I1J A;  2HBW A;  2J05 A;  5L23 A;  4AG2 C;  2DX1 A;  4F16 A;  1K4U S;  2CH4 A;  2ESW A;  3PVQ A;  1AWX A;  4J9G A;  1I0C A;  2DL8 A;  2MCN A;  3IQL A;  1UE9 A;  2E5K A;  1UHC A;  1MUZ A;  2KYM A;  2LJ0 A;  1W70 A;  2JS2 A;  1K9A A;  3M0S A;  4CC3 A;  2LQW A;  4OMO A;  2KXC A;  4JJB A;  2YUP A;  3QWY A;  1I07 A;  4JJD A;  2VVK A;  1GFD A;  3FJ5 A;  1VYU A;  2DLP A;  2RQW A;  1JXM A;  2AKK A;  2JS0 A;  2KYB A;  2FPD A;  4F17 A;  3UA6 A;  4OMQ A;  2CSQ A;  2ENM A;  1J3T A;  3SHW A;  2J7I A;  2K79 A;  1AOJ A;  1PRL C;  1U5S A;  1WLP B;  4AFQ C;  1U3O A;  1H92 A;  1NG2 A;  3LH5 A;  3VS3 A;  2C0T A;  5FWC A;  2ED1 A;  1UTI A;  1XOV A;  1QCF A;  5I22 A;  2ABL A;  1X27 A;  2L3Q A;  1OV3 A;  4JJC A;  2K2M A;  4IIM A;  4EIK A;  2J6O A;  1M27 C;  1YNZ A;  3H0H A;  2DJQ A;  4LUE A;  2JTE A;  1UGV A;  1SHG A;  3O5Z A;  4GLM A;  1VYV A;  4RTX A;  1RUW A;  2LX7 A;  1HJD A;  3VS2 A;  1G83 A;  3RBB B;  1SEM A;  2EYY A;  2H8H A;  3KFV A;  4OMN A;  5IXB A;  1AZG B;  1FYN A;  2HCK A;  1X2K A;  2LMJ A;  1FMK A;  3CQT A;  5I11 A;  4HVW A;  4JZ3 A;  2DBM A;  1GL5 A;  2CUB A;  1T3S A;  2W0Z A;  1GBR A;  1U06 A;  1AWJ A;  1X43 A;  2RNA A;  2JW4 A;  3EG3 A;  4J9F A;  1BB9 A;  4ZNX A;  2YDL A;  3JV3 A;  2AZV A;  2XMF A;  2A28 A;  4CC7 A;  2KRN A;  1WDX A;  2AKL A;  4AFZ C;  2C0I A;  2O31 A;  2LZ6 B;  4ESR A;  4GBQ A;  1QWF A;  1NEG A;  2FRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...