2D1XA

The crystal structure of the cortactin-sh3 domain and amap1-peptide complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
b'NDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cortactin isoform a
molecule tags Cell invasion
source organism Homo sapiens
publication title Targeting AMAP1 and cortactin binding bearing an atypical src homology 3/proline interface for prevention of breast cancer invasion and metastasis.
pubmed doi rcsb
total genus 13
structure length 60
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2d1xA00
2EYXA 1TUCA 1PKSA 2CDTA 1T3SA 1WA7A 2ABLA 4ESRA 1NYGA 1TUDA 2DF6A 2K9GA 4RTWA 2DA9A 2M0YA 1CKBA 4RTTA 2X3WD 3NGPA 1X27A 2KRSA 3REBB 2LNHB 3M0UA 2KRMA 1UJ0A 3EG0A 3GBQA 3JV3A 2VWFA 2QDLA 2RQWA 3LH5A 2RQUA 2A08A 2L0AA 3O5ZA 2DILA 3H0IA 4ORZA 1UDLA 2F2WA 1B07A 1BB9A 1ZUUA 2KEAA 2L3QA 1M3CA 4J9FA 1WFWA 5IHIA 1M3AA 3EHRA 2J6FA 5EC7A 5I22A 1Y57A 1SHGA 3CQTA 3EG1A 2LP5A 4K11A 2KRNA 4CC4B 4J9CA 1A0NB 1X43A 1BU1A 4GBQA 1NM7A 4EIKA 2YSQA 2V1RA 3UA6A 2J7IA 2GTOA 2V1QA 4Y92A 1GBQA 2SEMA 2W10A 1T0JA 3H41A 2BZXA 3THKA 3EG3A 4RTUA 4FSSA 1UECA 4JPBW 1BBZA 1W70A 1WXTA 3NMZC 1QKXA 4DEYA 1GCQA 2LX7A 1K9AA 2B86A 1I1JA 1QWFA 3VS3A 2PNIA 2I0NA 2RQVA 2XMFA 1NLOC 1FYNA 2DL8A 1GFCA 1SRLA 2ED1A 2EGEA 1V1CA 3VS4A 1WXBA 4LNPA 1EFNA 2BZ8A 1QLYA 1H92A 1VYTA 3C0CA 2AK5A 1CKAA 1FMKA 2RF0A 1KIKA 4CC7A 1UTIA 2A37A 4HVVA 2CSIA 2IIMA 2A28A 4OMLA 2KT1A 1U5SA 1Z9ZA 1X2KA 3FJ5A 1SPKA 1HJDA 2RQRA 2YDLA 1MV0B 1KJWA 3VS6A 2D1XA 2MCNA 2F2XA 3TSZA 2CUBA 2KXCA 2VVKA 2CUDA 2EYYA 5IHNA 2D8JA 2VKNA 4Z88A 1JXMA 1OEBA 1YWOA 4OMPA 2KR3A 3KFVA 1QCFA 1AWXA 4LUDA 1GCQC 2DJQA 1HD3A 2G6FX 1KFZA 2FEIA 1YN8A 1NG2A 4GLMA 2GTJA 2CSQA 4AG2C 3VRYA 4HVUA 1AZEA 2F2VA 2CT4A 4F17A 2CH4W 2JS0A 2RPNA 4OMNA 1YP5A 1N5ZA 2C0IA 2OJ2A 1AWWA 4AFSC 1E6HA 1T0HA 4IIMA 1OPKA 3VS2A 2GBQA 2ENMA 1AEYA 2FRYA 1WLPB 1I0CA 1WIEA 2FPEA 2JS2A 3M0SA 2KBTA 1B3QA 2CREA 2DL4A 2O9SA 1OPLA 2EBPA 4LE9A 2LZ6B 2A36A 2HCKA 1ZUYA 2DYBA 2L3SA 1YNZA 2NWMA 3M0RA 4OMOA 4QT7A 2LJ0A 2DL3A 4LN2A 4JJBA 2X3XD 1XOVA 1W6XA 1UUEA 1AZGB 4D8KA 1K4US 1I07A 1K0SA 3TVTA 3QWXX 1SHFA 1X6GA 2YUQA 1E6GA 2YUOA 4J9IA 3ULRB 1RLQC 4OMMA 2CT3A 2DLPA 4RTVA 1U06A 1ABOA 2J6KA 2KYBA 2GNCA 1M30A 2ROLA 1X6BA 2LQWA 2KROA 3EG2A 2HEQA 1UJYA 5GJWB 5FW9A 4A63B 2AKLA 3UF4A 3QWYA 2K2MA 1M27C 2DL5A 1VA7A 2EPDA 2H8HA 2LCSA 1Z9QA 5L23A 1GBRA 3PVLA 2ED0A 1VYVA 1PHTA 4DEXA 1Y0MA 3I5RA 1ARKA 1OV3A 1H8KA 2SRCA 1GCPA 3RBBB 1AWJA 2DRKA 1GFDA 2KT8A 2K7AA 4HVWA 5FWCA 4M4ZA 1NLPC 3VS5A 5ECAA 1GL5A 4ZNXA 1UHCA 2W0ZA 2K6DA 4Z8AA 2L3PA 1MUZA 1NEGA 1ZLMA 2KE9A 2EVRA 2JXBA 3SEMA 1UFFA 2KGTA 2FPFA 1U3OA 2RN8A 1IO6A 1X69A 3VRZA 1RLPC 2DMOA 5IHKA 3ZL7C 4HXJA 2JMCA 2EQIA 1SSHA 4J9GA 1WDXA 2BZYA 3EHQA 2RQTA 2EYZA 4RUGA 5GJVB 1OOTA 2EKHA 2YT6A 3I5SA 3UATA 2EGCA 4AFQC 1LCKA 1TG0A 2LJ3A 2NUZA 2LJ1A 2CH4A 1W1FA 2P4RA 4RTYA 1AWOA 3A98A 2EYWA 4RTZA 2JM8A 2JTEA 2LMJA 2DVJA 1S1NA 1PRLC 4HCKA 2PTKA 4OMQA 1QWEA 1BK2A 2DX1A 1WXUA 4J9EA 4F14A 4F16A 1HSQA 2OI3A 1NYFA 2K79A 3M0TA 3H0FA 2O2OA 1ABQA 2ESWA 2GGRA 1PWTA 2FPDA 2K3BA 2KXDA 2FRWA 3M0QA 1H3HA 4LUEA 2YUPA 1JO8A 1JQQA 1G83A 1SEMA 2J05A 3VS0A 1K76A 2MOXA 2ROTA 1M8MA 5IXFA 5IH2A 4E6RA 3IQLA 1K0XA 2DM1A 4RTXA 2LQNA 5FWBA 1ZX6A 1AD5A 2ECZA 1WYXA 4D8DA 4IIOA 2L2PA 2JMAA 2EGAA 2YUNA 3H0HA 1GRIA 4JZ4A 4J9BA 4X1VA 3VS1A 1G2BA 3M0PA 1PKTA 4CC3A 1M3BA 2D0NA 1UE9A 2KNBB 1JU5C 1T3LA 4CC2A 5IXBA 4KRTA 3PE0A 2DBMA 2HSPA 3RNJA 3U23A 2OAWA 4J9DA 1CSKA 2BTTA 3R6NA 1X2QA 2MIOA 2C0OA 3NHNA 2E5KA 1YCSB 4AG1C 2AZSA 2PZ1A 1RI9A 3I35A 1J3TA 1AVZC 4AFZC 1RUWA 1SRMA 2FG0A 2J06A 2JW4A 1JXOA 2FO0A 2RMOA 1UGVA 2DRMA 2DL7A 1E7OA 4JJDA 4Z89A 1WI7A 2J6OA 1AOJA 2RNAA 3I9QA 2DNUA 1ZBJA 3NPFA 1QKWA 2DE0X 1WX6A 1VYUA 1PNJA 4JJCA 2AKKA 1PRMC 2HBWA 1K1ZA 2GQIA 1KSWA 4R0KA 2JM9A 1UG1A 3SHWA 3PVQA 3REAB 1MV3A 2O9VA 2HDAA 4J9HA 1JEGA 2M51A 4JZ3A 1UHFA 2D8HA 3EGUA 2O88A 2C0TA 2DBKA 2EW3A 2KYMA 4AFUC 5HCKA 5I11A 2O31A 1NEBA 1ZSGA 2JT4A 3VS7A 2AZVA 3UA7A 3TSWA 1ZUKA 4WCIA 1YWPA
chains in the Genus database with same CATH superfamily
3AT1B 1Q86C 3CBOA 3S3MA 4M75B 2CDTA 3FC3A 1R77A 2ABLA 1SSFA 4ESRA 1NE8A 3QYGB 1MHNA 2XDPA 2QAZA 3LWIA 5GAOr 1X27A 5GAMe 2QXFA 1W2BP 5GMKh 2KVQG 2FZKB 2QTXA 2M9UA 1C0MA 4FT4A 2PVDB 2WSEE 5LJ5f 1KQ2A 2BIVA 3EG0A 3NTIA 3OSVA 4MDWA 2KI7A 1VQOQ 2QDLA 2RQWA 3EG9B 3MEWA 2DTHA 1WHGA 2ZPGB 5KE3A 2L3QA 4J9FA 5KE2A 2C06A 3EHRA 4F7UB 4ME7A 2K3YA 1YHQT 1SHGA 3JRZA 5GANg 1VQ4Q 1ZSZB 4DOWA 3GIBA 2AT1B 2L5QA 4J9CA 3V8JA 2F5TX 2ZPIB 4CC4B 3L1AA 3OYCA 3DLMA 4QQGA 4EIKA 3UA6A 3ME9A 3OW2A 2CP6A 4Y92A 1T0JA 5LL6S 2QYZA 2NUPB 4FSSA 1UECA 1W70A 2GQVA 1QKXA 2B86A 2PNIA 2I0NA 1NLOC 4M7DA 1N27A 4A54A 1FYNA 2DL8A 2QEXQ 2ED1A 2E3HA 3OBWA 3VS4A 1WXBA 4FW2A 4IKFA 1VQLT 4QW2A 4EMGA 4PJNA 2AK5A 4ELYC 4E7LA 1CKAA 2D9TA 3JCMg 2A37A 1EZZB 3DB3A 4HVVA 3GP8A 2A28A 3RMSA 3CCVA 1U5SA 1X2KA 3C12A 4JLGA 1SPKA 3H6ZA 4A53A 2JTFA 1TXQA 4N4HA 1MV0B 1QCOA 2DETA 1TWBA 3TSZA 1OX8A 2F2XA 2CUBA 2XI9A 3CMAT 3VYGA 4JUVA 3JCMV 4LD6A 1AWXA 2EAYA 2DJQA 2PVOB 4DBRA 1WNLA 3C95A 1KFZA 2EQUA 5GMKj 1Q81C 1YN8A 4FT2A 2X4WA 1VQNA 4PJJA 4KGXB 4HVUA 2CH4W 2JS0A 4PJOD 2F1LA 4OMNA 4FM4B 4M78A 1D09B 3CCMA 4OP0A 5LJ3j 1R0BG 5GMKm 4HCZA 3T9NA 4Y28E 1ZA2B 1I81A 2CZ0B 1Y07A 4YTLA 4Y91A 2P0QA 2P0KA 4CRIA 3M55A 1OI1A 2JS2A 2KBTA 4M78B 2CREA 5I2SA 2O9SA 5D7UA 4LE9A 1M1KR 2A36A 2DK3A 4A4KA 2RHXA 4LDWA 4QT7A 4M77B 5DLOA 2LJ0A 4LN2A 5FU6C 4JJBA 1XOVA 1AZGB 4D8KA 3MP6A 1X75C 1ACMB 3QSUA 2VGNA 1E6GA 3EH2A 2QQAA 4M77A 4J9IA 2DO3A 3ULRB 4OMMA 3I55Q 5KCHA 2FZCB 4RTVA 2J6KA 1Q95G 1M30A 1X6BA 2KROA 2LQWA 2ROLA 3EG2A 1UJYA 4PFPA 1Q86U 3S3OA 1K73R 4M75D 3UF4A 5LJ3g 2QQ9A 3R6OA 1PM3A 2DL5A 3HSBA 4JRIA 4O5VA 4WF2A 4C5IA 3JB9J 2EPDA 4R55A 2KY9A 3A8MB 4KUDK 4RG2A 1Z9QA 1VQ6A 2XDBA 2ED0A 3KUFA 4DEXA 1N8RU 3X26B 1YITT 2SRCA 3JCMe 1GCPA 1AWJA 3QO3A 5A0DA 3CCSA 4BDYA 3LX7A 4M4ZA 3CC4T 3QZ5B 3H8ZA 4ZNXA 2W0ZA 2JN0A 4M78G 4A4GA 3CCRQ 3CCVQ 2VXFA 1I5OB 3UWNA 1BI1A 2YXYA 4C0ZA 3OYAA 3M56A 2VXEA 3BW1A 1IREB 2Y4XA 3G4SA 4UC4A 2JJ9A 3CMEQ 2DMOA 2CS7A 4FIBA 2COYA 1SSHA 1WDXA 2BZYA 4A4HA 3LGLA 2YLBA 2OTJT 2EYZA 1VQPT 5CQXA 5GJVB 2QDYB 1VIFA 3I5SA 2LC4A 2EGCA 3JCMQ 4KUIA 2P0PA 1TG0A 1KC8R 2NUZA 2LJ1A 1H641 2MK5A 1WHJA 4RTYA 1AWOA 4C8QD 4HCBA 2RHUA 4RTZA 4NL3A 1KHIA 2LMJA 2DVJA 2LCCA 1X01A 1YJWQ 2RHYA 3HRSA 1XQHA 4C92C 1QWEA 2YRCA 4F16A 1XNIA 2OI3A 4OGCA 1XTDA 3HL8A 1K73U 3MHXA 3H0FA 2EJFA 2KXDA 2KK4A 1PWTA 2GGRA 1H3HA 2DXBA 4BI4A 4LUEA 2RA2A 4B6MA 4DA4A 4M75A 2MOXA 5IXFA 1PSEA 3DKMA 1IHWA 4XTYA 1AD5A 4PJOF 1WYXA 2MMPA 1M90C 2JMAA 4M77D 1NPRA 2LVMA 1N8RC 2P4TA 1GRIA 5AT1B 3A8LB 4JZ4A 4J9BA 4X34A 2GFUA 3E2UA 3EGXB 2HAXA 2MI6A 1UE9A 5C6SA 4AMCA 1H3ZA 2RK2A 1YHQA 4C8QG 1K73C 5KYXB 2EIFA 4MZMA 2QGFB 2DBMA 3P8DA 2HSPA 1UEBA 2LTOA 3CCJT 2A3LA 2OAWA 4ZGJB 1CSKA 2BTTA 2MIOA 2VC8A 3RUXA 5GAN5 1M1FA 2C0OA 4NL2A 3JCMh 2PVGB 4AG1C 2AZSA 2PZ1A 5GAN7 5FU7B 4E7JA 1ZBXA 4ZTFA 3ZBDA 3CCRT 2J06A 1VQ5Q 1YBYA 2RMOA 4N0AC 4XU3A 2M16A 5GAOq 3GLXA 1M90U 3GPLA 4HCCA 2BKDN 2RNAA 4DOVA 2NUTA 3UDCA 3NPFA 3PMTA 1M2VA 1IXDA 5LJ5e 3QIIA 3RERA 5KYYB 5GMKl 2DE0X 3A5ZB 3FIFA 2K2VA 1PNJA 1M5Q1 1VQ5A 3QG1A 4DBQA 2V26A 1PRMC 2X4XA 2EFIA 5GAMd 2GQIA 2XU8A 1VQ8A 3CMEA 3E9GA 1KSWA 4C8QE 2JM9A 3H9NA 3JCMX 2LQ8A 3REAB 2KDSA 4E7HA 4M77C 3G71A 3M4GA 1MV3A 1V76A 2F69A 1S72A 2O9VA 4MMLA 1VQOA 4OB3B 2HKNA 4JZ3A 3EGUA 2XK0A 2DBKA 4Z02A 1ZSGA 3UA7A 1BCOA 3OYFA 4IUUA 5I2MA 1YJNT 2X9HA 2EYXA 1W4SA 2FVUA 2HD0A 1TUDA 3E1SA 2CP2A 3HRUA 2DERA 2DF6A 2K9GA 4RTWA 4BE2A 2M0YA 5KYYA 3CD6Q 2X3WD 3NGPA 1SG5A 4M7AG 4JRKA 2KRSA 3OYBA 3C94A 1QVFP 4ZGEB 2WSCE 3CC2T 2KRMA 1BCMA 4N4GA 1YIJT 3GBQA 3JV3A 2VWFA 1KQSA 8AT1B 4ORZA 1UDLA 3CXCP 3OS0A 2QA4T 3CXCS 3ZFJA 4FW1A 1VIEA 1M9SA 1Y71A 1WFWA 3LW5E 4KBMB 1M3AA 2J6FA 5I22A 1Y57A 3EG1A 4JLIA 2XKOC 3QDRB 4M7AE 2KRNA 1M4ZA 2HQXA 3M53A 1MNDA 2P84A 3E9FA 1N9RA 3OS5A 3OYNA 1BU1A 1ZSZC 3QYHB 5CAIA 5GANf 4IUTA 2K5LA 1VQ4T 2YHTA 1GBQA 2SEMA 2W10A 3JB9F 1VQ7T 5HY6A 1OYXA 4FYYB 4C0GA 2D0QB 2ATCB 2FYKA 2GCXA 4JPBW 3NMZC 4DEYA 1KK7A 5I21A 4RCCA 1UGSB 4M7AD 3HHTB 3QJ6A 3L2ZA 4F7UF 5KH6A 2EGEA 4XTZA 1B34A 1WJRA 4KGZB 1EFNA 2BZ8A 3L2QA 1OULA 2K3XA 1ZHIA 3C0CA 3V8LA 4HT8A 4J7IA 2OX7A 3CCUA 4M7DF 1KIKA 1D3BB 1UTIA 2E70A 3MEUA 1QVGA 5FROA 1KC8C 4OMLA 4M78D 2KT1A 2OAUA 5LJ5h 4XQ3A 4M7DE 2DIQA 3X20B 1O75A 2YDLA 2DKGA 2RI5A 2D1XA 2MCNA 2KXCA 8ATCB 2EYYA 2RJEA 5J3BA 4E7SA 4M7AC 3OMGA 3QDFA 2HBPA 4PNOA 1G3TA 4OMPA 3KFVA 5C0MA 1VQ9Q 1I8FA 2G6FX 2E5QA 2HQEA 1D1CA 1RAHB 2R57A 1ZQ1A 1IRXA 2F2VA 4F17A 4M75G 4AT1B 3SDZA 4C5EA 3A8GB 1YP5A 1PD0A 4J6XA 4EMHA 2C0IA 2OJ2A 1AWWA 3OYMA 3PIOA 3JCMf 1B7TA 1VQKT 1T0HA 1QVPA 1S72Q 3VS2A 4QVZA 5EG2A 2CP3A 3SB2A 2FRYA 1WLPB 2QK0A 3M0SA 2BE7D 4RCBA 3PT9A 3PIPA 3O8VA 1OPLA 2EBPA 2PUOB 3JB9I 2HCKA 1ZUYA 1QVFA 3CC7T 2L3SA 3V7SA 2NWMA 2CP5A 4LXCA 5GAN8 2DL3A 5A0GA 4PJOE 4J5YA 3EGDB 4JS4A 4KH0B 3JCMW 3CPWA 5FRNA 2JVVA 2FZGB 1M90R 4C8QB 2RHZA 1SHFA 5LJ5d 1X6GA 1OX9A 5M9OA 2CYZB 1U06A 1ABOA 4EDUA 2K5IA 1D0YA 1O9SA 5A2QE 1M27C 1YI2Q 5CKDA 2H3EB 2CGHA 1ZSZA 1VA7A 2WACA 2OTJQ 5L23A 1GBRA 3INZA 1VYVA 1WGSA 3I5RA 2FL7A 3G6ET 3LYIA 1GFDA 2LT1A 5LJ5g 2Y90A 1NLPC 3VS5A 1QCNA 4OB1B 4Z8AA 1MUZA 1UGQB 1NEGA 1NZ9A 2DAQA 3I56A 1Y96A 4J6WA 5KYXA 2JNGA 1HXDA 1VQ9T 3OBYA 1U3OA 2R5AA 1D0XA 3QJYA 1X69A 3VRZA 1RLPC 1VQNQ 1QVGP 1N9SA 2DXCA 2EQIA 3EHQA 3EFOB 3QBYA 3BDUA 4XU2A 3HRTA 3CC4A 5GMKe 4EMKB 4AFQC 2LDMA 1QP2A 3S6WA 4QKUA 4F04B 1S72T 1JBMA 4VUBA 3MO8A 4HCKA 2NUTB 2YWWA 4E47A 1M2VB 2V8IA 2PTKA 4M7AF 3G4ST 4OMQA 5DM7R 2DTIA 4J9EA 4F14A 1KHCA 2JZ2A 1FXXA 2O4XA 2K79A 4J6YA 4N4IA 5KYWB 2O2OA 1ABQA 3NFCA 1IGUA 3PGGA 2MF2A 4M7DD 1JO8A 1YJ9Q 1JQQA 1SEMA 2J05A 3VS0A 1HYOA 2ROTA 5IH2A 4E6RA 1K0XA 3I55A 2LQNA 2V8JA 1I5LA 4BACA 3OYHA 2ZZDA 3JCMJ 1YIJA 1SKUB 4IIOA 4FL6A 2YUNA 1YI2A 2PQWA 3OYLA 4DQ2A 5GAOp 3MP8A 2E4HA 2QA4A 5HKCA 1PKTA 1M3BA 2D0NA 3KXTA 2RM4A 1VUBA 2WSFE 5KYUB 1C1AA 3EAEA 4C92A 4CC2A 4MZPA 3CCSQ 3OYKA 4O6JA 3RNJA 5IAYA 4M7DC 1MMNA 4PFOA 3ZEHA 3MPUB 1WPYA 2XD0A 3VUBA 2E5KA 4C92B 1YCSB 1VQ7A 2DXUA 1YCYA 1RAGB 4EMKC 2JTMA 1J3TA 4AFZC 2FG0A 4C8QA 3CXCA 2FO0A 2JOYA 2VASA 3GNGA 1UGVA 4X9CA 1VOMA 4M7DG 2DL7A 1E7OA 1HK9A 4JJDA 2ZPBB 3PMIA 1WI7A 3I9QA 1AOJA 1LOJA 2E6NA 2DNUA 2RJCA 2CZ1B 4B9XA 1BYMA 1ZBJA 1VQMA 4KULA 1KD1R 1VQLA 1WX6A 2O01E 3M54A 2Y4YA 2LQKA 1VQ6Q 2DJZA 3E19A 2YLCA 3VJPA 3HFNA 2BUDA 3CBPA 2ZPFB 1UG1A 3JCMP 5IT9E 2M0OA 1QW1A 2HDAA 5FLXE 2DD5A 3S3NA 1JEGA 2VYTA 2D8HA 4AFUC 1M8VA 3CCEA 1NEBA 1Q82C 2JT4A 3L2VA 4QQ6A 4E7ZA 1TUCA 2KAFA 1UB4A 1WA7A 1NYGA 5CCAA 3CMET 5D6YA 2DA9A 1D1AA 1CKBA 2CKKA 3CCLA 4F7UA 1YJNQ 2QQRA 4KGVB 2QQSA 3OMCA 3REBB 2LNHB 2DD4A 2R5MA 4C0FA 5CIUA 4L5GA 4PLLA 5AYFA 3SD4A 3LH5A 2RQUA 3O5ZA 3CC2Q 2DILA 3H0IA 3VKIA 1M2OA 1B07A 1BB9A 2MYSA 2KEAA 4QVCA 3M58A 4IURA 4PK4A 4RKUE 1Q82U 1M3CA 5IHIA 4BD3A 3CC7A 5EC7A 1UGRB 2QG9B 4TVRA 3CQTA 2HSEB 3L2UA 3META 2FB7A 2G3RA 4IUQA 1KC8U 2KSSA 4K11A 2NLUA 1BI0A 4ZGDB 2QI2A 4MZTA 3L2WA 3PNWC 2YSQA 4C5HA 2J7IA 2EQJA 4FU6A 1TUGB 2NYSA 4N0AA 3BDLA 3H41A 2BZXA 3THKA 3EG3A 3QZ9B 5GAN2 4RTUA 4C8QF 1LNXA 1BBZA 2MAMA 1IB8A 2LX7A 1K9AA 9ATCB 2RJFA 3VS3A 2XMFA 3V7CA 2HZYA 4M7AA 3VV0A 1SRLA 1D1BA 2XIDA 4LNPA 3CEYA 1W2BA 3M5AA 3P8HA 1QLYA 2RH2A 1H92A 1VYTA 5GANh 2GF7A 3OS1A 1FMKA 2RF0A 2IVWA 3SWNB 1G5VA 2IIMA 2PU9B 1LPLA 1MMAA 4CI0C 1RI0A 3JSCA 1RABB 2VV5A 2VGMA 3TCJA 1Q86R 1KJWA 4LDUA 3VS6A 1FMWA 1WHHA 2RI3A 2CUDA 4FYXB 1WQWA 3PFSA 5IHNA 3RESA 2VKNA 4Z88A 1JXMA 1OEBA 3CC7Q 1YWOA 4M78C 1SF9A 1TOVA 3L42A 1GCQC 2XDDA 1HD3A 4A4FA 1BIAA 3OW2P 2FEIA 1PCXA 4GLMA 4V2SA 4AG2C 3VRYA 1NJIR 3OYDA 4OGEA 2EWNA 4QQDA 1N5ZA 1PD1A 3JAME 4F7UG 3TU4K 1VQ8Q 4IUPA 3CMAA 4C0DB 3JB9D 4AFSC 3X25B 3CCMQ 2GBQA 2ENMA 3G1JA 4XAXB 1AEYA 4M75F 1I0CA 1RL2A 4J8OA 2DL4A 4R56A 2DYBA 4C5GA 3M0RA 4OMOA 3J7AF 4FYWB 2MWPA 2X3XD 1W6XA 5KCOA 1K0SA 3TVTA 4GY5A 2OTLA 1DJ7B 5CQYA 1K9MR 1F1BB 2BE9B 2YUOA 2CZ6B 2EQKA 2CT3A 2DLPA 1K9MC 3MKDA 2GNCA 2HL5C 2HEQA 5GJWB 5FW9A 1BI2A 2K2MA 1BI3A 3OSSC 1WJSA 2LCSA 3X28B 2HKQB 5DLQE 1PHTA 5GAMh 1Y0MA 1ARKA 1OV3A 4BY6B 1G8XA 3BE3A 4LDVA 2OTJA 5HK0A 1YFNA 1YITQ 2LCLA 1KG1A 5ECAA 4BY6C 1QMCA 1VQMQ 1UHCA 3CPWS 2L3PA 2XICA 1R8OB 3MCAB 2KE9A 2E41A 2HL3A 2RK1A 1UFFA 1K9MU 5GMKi 1VQ6T 1WHMA 2RN8A 4HXJA 3JCMd 4J9GA 2RQTA 3NTKA 1WHKA 1U8RA 4XU1A 7AT1B 2A0FB 5FU7C 3SWNA 3CBMA 1VQ8T 4JRPA 1VQPQ 1W1FA 3EG9A 3A98A 2EYWA 3JCMb 3M9QA 4IUVA 1VQOT 2JTEA 1PRLC 1VQ9A 5L8RE 3CCET 3NTHA 2DX1A 1EIFA 2DVEA 2JUFA 3CPFA 1YJNA 1G3SA 1YJWA 1N6AA 1D3BA 1VQPA 1NYFA 1IZ6A 4PJOB 2RD1A 4XK8E 3DLLA 3M0TA 3G4SQ 2ESWA 2NUPA 2K3BA 1JRIA 2FRWA 3MEAA 3JCMc 2YUPA 5GAN4 4DBHA 2E64A 3SFMA 1K76A 4C0DC 2HMAA 3BFMA 2DM1A 4RTXA 3OA6A 1ZX6A 1RAFB 2L3RA 1RADB 1PSFA 4M78F 4D6WA 4C8QC 3H0HA 3G7ZA 4X1VA 3VS1A 4CC3A 1W2BS 3L2RA 3BY7A 3OYGA 3DB4A 1WHLA 2KNBB 4PJOA 3GNFB 3OYYA 3EFSA 3G6EQ 2E6ZA 1LJOA 2DEQA 3I55T 1FWZA 3EGDA 1G3WA 2LRQA 3QKJA 2X51A 2DZCA 2RI2A 1TU0B 1QVGS 1VQ5T 1Q81R 3NHNA 3A8OB 3CCQA 4ZTJA 2OTLQ 1AVZC 1RUWA 4II1A 2JW4A 4L6V5 2F5KA 2QGGA 4C92E 4Z89A 3MP1A 1IGQA 2YRVA 5GANj 2J6OA 2HNIA 3LLRA 1NJIU 3CCJA 3WVEB 4XTUA 3CD6A 2LNVA 2V8KA 1VYUA 5LJ5j 2AKKA 2K5FA 2HBWA 5GAMj 5GAN6 1BKBA 2DPPB 3TQ7P 4BDZA 3CCRA 1VQLQ 3SHWA 3PVQA 1V29B 2B8AA 3FB9A 3QPHA 4ELZC 2EYQA 2EW3A 3CC2A 5LJ3d 1JJ2A 3Q1JA 2O31A 1KD1C 3VS7A 2AZVA 3G71Q 3TSWA 4WCIA 2QASA 3GOXA 2X4JA 3I56Q 1YJ9T 1PKSA 1T3SA 1Y96B 2K4YA 1Q82R 3EH1A 3MJXA 3ASKA 1Q7YC 3SWNC 2DFUA 3OY9A 4MDXA 4OB0B 1WZOA 4RTTA 1NJIC 2E12A 4LDYA 3EGXA 1R0CB 3V7RA 5KYNA 4PL6A 3WVDB 3LWHA 1OU9A 2PUKB 3M0UA 1K8AR 1UJ0A 1TTHB 2D6FA 4X9DA 5GANe 2QA4Q 1OZ2A 4M75C 1K8AC 2R58A 4RMOA 2A08A 2L0AA 2F2WA 2A7YA 1ZUUA 2Z0WA 4OMFB 4LD9K 4L59A 4LDXA 2K57A 2DTOA 2DEUA 2LP5A 2X35A 5CKFA 1A0NB 1X6OA 2DYIA 2EKOA 1X43A 2IPOB 2MPXC 4PKCC 1Q7YU 4GBQA 1NM7A 1JJ2S 2V1RA 2GTOA 1JJ2P 2V1QA 1JB0E 3JB9H 2RB6A 4JS5A 5KYWA 2QEXT 1WXTA 3N5BB 1NBEB 1GCQA 5CR2A 3CCVT 2QTVA 1I1JA 1QWFA 2RQVA 2E65A 2RO0A 2LT4A 1KQ1A 1GFCA 1Q7YR 3X24B 1V1CA 1WQ7A 5D6XA 3C4SA 5LJ3f 4PJOC 1VQ4A 4PJMA 4J7FA 3F70A 4KH1B 1LVKA 3EFRA 4CC7A 4BB7A 1RAEB 3A1PA 2E3IA 3WXMB 1KQSP 2CSIA 2MWOA 4ANJA 3LGFA 1MGQA 1VQNT 5CO7A 5CKEA 1Z9ZA 3RKYA 1KQSS 3FJ5A 4PJOG 3QXEB 4M77F 1HJDA 2RQRA 3OYEA 3CCQQ 2VVKA 2IG0A 3I56T 1AT1B 2D8JA 5LJ3e 2KR3A 3M57A 1QCFA 4LUDA 1NG2A 2GTJA 2CSQA 4PFZA 1AZEA 2CT4A 2H3JA 5FRMA 3UT1A 2RPNA 3RKXA 3M59A 1QP3A 5KYUA 3ER0A 1MNEA 1U1SA 2KQWA 1E6HA 4IIMA 1OPKA 3J81E 1EX4A 3FLGA 3OYJA 2EJGA 1WIEA 2FPEA 1MMGA 4PJLA 1MMDA 3CMAQ 1B3QA 1VQKQ 3OS2A 2LZ6B 3LH0A 4EMKA 4F7UE 1YNZA 1PC0A 3PTAA 4M78E 4MMKA 2EJ9A 4ATOA 1OQKA 1BIBA 4ZN1A 4HKEA 1UUEA 1K4US 1VQKA 1I07A 5CKBA 5CK9A 2DIGA 1U1TA 2DZ9A 1YHQQ 3QWXX 2CZ7B 3VUZA 4XTXA 1Q81U 4RG8A 2YUQA 1RAIB 2O4XB 4GLKA 4BI3A 3FRNA 1RLQC 3CCST 2KYBA 3TEEA 1YI2T 4JDSA 4A63B 2AKLA 4C92D 3QWYA 1UGPB 1AHJB 5GAOl 4QVDA 2M1HA 5CVIA 2H8HA 2E10A 2EQMA 2OTLT 4P5NA 3PVLA 4WTOB 2CP0A 3CCUT 4Q5WA 1M1KC 1C6VX 1H8KA 5CKHA 2COWA 4XTVA 3RBBB 3VYHB 2DRKA 2KT8A 4A4EA 2K7AA 4HVWA 5FWCA 3FEOA 3OW2S 3CCQT 1GL5A 1ZA1B 3UPUA 2L89A 2K6DA 1GXIE 1I4K1 2LX9A 3OYIA 1ZLMA 5A0LA 4E2FB 2EVRA 2AHJB 2JXBA 3SEMA 4BE0A 1XJWB 2FPFA 2KGTA 1IO6A 5LJ3h 2YRDA 5IHKA 3ZL7C 3CD6T 2JMCA 1TSFA 3URGA 4M7AB 4NOYA 4XTWA 1N8RR 3G6EA 4BI8B 4RUGA 1OOTA 3FDRA 3QHSA 2EKHA 2YT6A 5IN1A 3KBGA 4HA8A 3UATA 3D7SB 1QQJA 4DBFA 1FX7A 1LCKA 2LJ3A 2ZAEA 2CH4A 3RDVA 3CCMT 2P4RA 1RAAB 5J39A 2M02A 2RJDA 2JM8A 3CC4Q 5DY9A 1S1NA 3HFOA 3CCLQ 3HP9A 6AT1B 3QUIA 2RHIA 1BK2A 1WXUA 5GAMf 1HSQA 4J83A 1YJ9A 3TREA 4OB2B 1WJQA 5GAOn 2DXTA 1TS9A 2FPDA 2KMTA 2XHCA 3M0QA 2COZA 4C92G 2ZPEB 4FYVB 1IHVA 1G83A 5GAMg 2XG8D 3HKSA 1M8MA 5GANd 3IQLA 2QQBA 1VQ7Q 5FWBA 3OB9A 2VUBA 1TH7A 3AHUA 3HTRA 2ECZA 2L8DA 4D8DA 1YJWT 4M7DB 5GAN3 5GAOm 2ZPHB 2L2PA 2EGAA 2FHDA 4FSXA 3GF5A 3HPWA 1YIJQ 3RIRA 1M1KU 4B9WA 1G2BA 4XU0A 3M0PA 3P8BB 4HT9A 1M1GA 5FU6B 1QVFS 4PLIA 4M75E 2GFAA 3CPWP 1JU5C 1D0ZA 2CP7A 1T3LA 3CCUQ 1B34B 5IXBA 4KRTA 3PE0A 1NPPA 2ZCFB 3U23A 1YITA 1PG5B 4J9DA 3R6NA 1X2QA 4M77E 3OQ5A 4JRQA 1KD1U 3EFOA 2I2LA 3JB9G 3A8HB 2HQHA 1RI9A 2QEXA 4OF1A 5J26A 3I35A 4E7IA 4BUGA 4E7KA 1SRMA 1OZ3A 1JXOA 3G71T 2DRMA 3M4YA 4NS5A 2E1HA 2VB6A 4KT0E 3J80E 1RACB 1QKWA 1G3YA 4EPCA 4M77G 4C92F 3RMQA 3RKWA 4JJCA 5HK3A 4OVAA 3V8KA 1K1ZA 3CCJQ 1OU8A 1K8AU 1Y7XA 3VU3C 4R0KA 4BE1A 3CCEQ 3CCLT 3RR6A 1FMVA 4J9HA 2M51A 1UHFA 4JJNK 2O88A 2AIRB 2C0TA 3MEVA 2KYMA 3FJPA 4ZN3A 5D6WA 5HCKA 5I11A 4FCYA 1VQMT 2ZGWA 2X4YA 1ZUKA 1YWPA 1P92A
chains in the Genus database with same CATH topology
2EYXA 1TUCA 1PKSA 2CDTA 1T3SA 1WA7A 2ABLA 4ESRA 1NYGA 1TUDA 2DF6A 2K9GA 4RTWA 2DA9A 2M0YA 1CKBA 4RTTA 2X3WD 3NGPA 1X27A 2KRSA 3REBB 2LNHB 3M0UA 2KRMA 1UJ0A 3EG0A 3GBQA 3JV3A 2VWFA 2QDLA 2RQWA 3LH5A 2RQUA 2A08A 2L0AA 3O5ZA 2DILA 3H0IA 4ORZA 1UDLA 2F2WA 1B07A 1BB9A 1ZUUA 2KEAA 2L3QA 1M3CA 4J9FA 1WFWA 5IHIA 1M3AA 3EHRA 2J6FA 5EC7A 5I22A 1Y57A 1SHGA 3CQTA 3EG1A 2LP5A 4K11A 2KRNA 4CC4B 4J9CA 1A0NB 1X43A 1BU1A 4GBQA 1NM7A 4EIKA 2YSQA 2V1RA 3UA6A 2J7IA 2GTOA 2V1QA 4Y92A 1GBQA 2SEMA 2W10A 1T0JA 3H41A 2BZXA 3THKA 3EG3A 4RTUA 4FSSA 1UECA 4JPBW 1BBZA 1W70A 1WXTA 3NMZC 1QKXA 4DEYA 1GCQA 2LX7A 1K9AA 2B86A 1I1JA 1QWFA 3VS3A 2PNIA 2I0NA 2RQVA 2XMFA 1NLOC 1FYNA 2DL8A 1GFCA 1SRLA 2ED1A 2EGEA 1V1CA 3VS4A 1WXBA 4LNPA 1EFNA 2BZ8A 1QLYA 1H92A 1VYTA 3C0CA 2AK5A 1CKAA 1FMKA 2RF0A 1KIKA 4CC7A 1UTIA 2A37A 4HVVA 2CSIA 2IIMA 2A28A 4OMLA 2KT1A 1U5SA 1Z9ZA 1X2KA 3FJ5A 1SPKA 1HJDA 2RQRA 2YDLA 1MV0B 1KJWA 3VS6A 2D1XA 2MCNA 2F2XA 3TSZA 2CUBA 2KXCA 2VVKA 2CUDA 2EYYA 5IHNA 2D8JA 2VKNA 4Z88A 1JXMA 1OEBA 1YWOA 4OMPA 2KR3A 3KFVA 1QCFA 1AWXA 4LUDA 1GCQC 2DJQA 1HD3A 2G6FX 1KFZA 2FEIA 1YN8A 1NG2A 4GLMA 2GTJA 2CSQA 4AG2C 3VRYA 4HVUA 1AZEA 2F2VA 2CT4A 4F17A 2CH4W 2JS0A 2RPNA 4OMNA 1YP5A 1N5ZA 2C0IA 2OJ2A 1AWWA 4AFSC 1E6HA 1T0HA 4IIMA 1OPKA 3VS2A 2GBQA 2ENMA 1AEYA 2FRYA 1WLPB 1I0CA 1WIEA 2FPEA 2JS2A 3M0SA 2KBTA 1B3QA 2CREA 2DL4A 2O9SA 1OPLA 2EBPA 4LE9A 2LZ6B 2A36A 2HCKA 1ZUYA 2DYBA 2L3SA 1YNZA 2NWMA 3M0RA 4OMOA 4QT7A 2LJ0A 2DL3A 4LN2A 4JJBA 2X3XD 1XOVA 1W6XA 1UUEA 1AZGB 4D8KA 1K4US 1I07A 1K0SA 3TVTA 3QWXX 1SHFA 1X6GA 2YUQA 1E6GA 2YUOA 4J9IA 3ULRB 1RLQC 4OMMA 2CT3A 2DLPA 4RTVA 1U06A 1ABOA 2J6KA 2KYBA 2GNCA 1M30A 2ROLA 1X6BA 2LQWA 2KROA 3EG2A 2HEQA 1UJYA 5GJWB 5FW9A 4A63B 2AKLA 3UF4A 3QWYA 2K2MA 1M27C 2DL5A 1VA7A 2EPDA 2H8HA 2LCSA 1Z9QA 5L23A 1GBRA 3PVLA 2ED0A 1VYVA 1PHTA 4DEXA 1Y0MA 3I5RA 1ARKA 1OV3A 1H8KA 2SRCA 1GCPA 3RBBB 1AWJA 2DRKA 1GFDA 2KT8A 2K7AA 4HVWA 5FWCA 4M4ZA 1NLPC 3VS5A 5ECAA 1GL5A 4ZNXA 1UHCA 2W0ZA 2K6DA 4Z8AA 2L3PA 1MUZA 1NEGA 1ZLMA 2KE9A 2EVRA 2JXBA 3SEMA 1UFFA 2KGTA 2FPFA 1U3OA 2RN8A 1IO6A 1X69A 3VRZA 1RLPC 2DMOA 5IHKA 3ZL7C 4HXJA 2JMCA 2EQIA 1SSHA 4J9GA 1WDXA 2BZYA 3EHQA 2RQTA 2EYZA 4RUGA 5GJVB 1OOTA 2EKHA 2YT6A 3I5SA 3UATA 2EGCA 4AFQC 1LCKA 1TG0A 2LJ3A 2NUZA 2LJ1A 2CH4A 1W1FA 2P4RA 4RTYA 1AWOA 3A98A 2EYWA 4RTZA 2JM8A 2JTEA 2LMJA 2DVJA 1S1NA 1PRLC 4HCKA 2PTKA 4OMQA 1QWEA 1BK2A 2DX1A 1WXUA 4J9EA 4F14A 4F16A 1HSQA 2OI3A 1NYFA 2K79A 3M0TA 3H0FA 2O2OA 1ABQA 2ESWA 2GGRA 1PWTA 2FPDA 2K3BA 2KXDA 2FRWA 3M0QA 1H3HA 4LUEA 2YUPA 1JO8A 1JQQA 1G83A 1SEMA 2J05A 3VS0A 1K76A 2MOXA 2ROTA 1M8MA 5IXFA 5IH2A 4E6RA 3IQLA 1K0XA 2DM1A 4RTXA 2LQNA 5FWBA 1ZX6A 1AD5A 2ECZA 1WYXA 4D8DA 4IIOA 2L2PA 2JMAA 2EGAA 2YUNA 3H0HA 1GRIA 4JZ4A 4J9BA 4X1VA 3VS1A 1G2BA 3M0PA 1PKTA 4CC3A 1M3BA 2D0NA 1UE9A 2KNBB 1JU5C 1T3LA 4CC2A 5IXBA 4KRTA 3PE0A 2DBMA 2HSPA 3RNJA 3U23A 2OAWA 4J9DA 1CSKA 2BTTA 3R6NA 1X2QA 2MIOA 2C0OA 3NHNA 2E5KA 1YCSB 4AG1C 2AZSA 2PZ1A 1RI9A 3I35A 1J3TA 1AVZC 4AFZC 1RUWA 1SRMA 2FG0A 2J06A 2JW4A 1JXOA 2FO0A 2RMOA 1UGVA 2DRMA 2DL7A 1E7OA 4JJDA 4Z89A 1WI7A 2J6OA 1AOJA 2RNAA 3I9QA 2DNUA 1ZBJA 3NPFA 1QKWA 2DE0X 1WX6A 1VYUA 1PNJA 4JJCA 2AKKA 1PRMC 2HBWA 1K1ZA 2GQIA 1KSWA 4R0KA 2JM9A 1UG1A 3SHWA 3PVQA 3REAB 1MV3A 2O9VA 2HDAA 4J9HA 1JEGA 2M51A 4JZ3A 1UHFA 2D8HA 3EGUA 2O88A 2C0TA 2DBKA 2EW3A 2KYMA 4AFUC 5HCKA 5I11A 2O31A 1NEBA 1ZSGA 2JT4A 3VS7A 2AZVA 3UA7A 3TSWA 1ZUKA 4WCIA 1YWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYX A;  1TUC A;  1PKS A;  2CDT A;  1T3S A;  1WA7 A;  2ABL A;  4ESR A;  1NYG A;  1TUD A;  2DF6 A;  2K9G A;  4RTW A;  2DA9 A;  2M0Y A;  1CKB A;  4RTT A;  2X3W D;  3NGP A;  1X27 A;  2KRS A;  3REB B;  2LNH B;  3M0U A;  2KRM A;  1UJ0 A;  3EG0 A;  3GBQ A;  3JV3 A;  2VWF A;  2QDL A;  2RQW A;  3LH5 A;  2RQU A;  2A08 A;  2L0A A;  3O5Z A;  2DIL A;  3H0I A;  4ORZ A;  1UDL A;  2F2W A;  1B07 A;  1BB9 A;  1ZUU A;  2KEA A;  2L3Q A;  1M3C A;  4J9F A;  1WFW A;  5IHI A;  1M3A A;  3EHR A;  2J6F A;  5EC7 A;  5I22 A;  1Y57 A;  1SHG A;  3CQT A;  3EG1 A;  2LP5 A;  4K11 A;  2KRN A;  4CC4 B;  4J9C A;  1A0N B;  1X43 A;  1BU1 A;  4GBQ A;  1NM7 A;  4EIK A;  2YSQ A;  2V1R A;  3UA6 A;  2J7I A;  2GTO A;  2V1Q A;  4Y92 A;  1GBQ A;  2SEM A;  2W10 A;  1T0J A;  3H41 A;  2BZX A;  3THK A;  3EG3 A;  4RTU A;  4FSS A;  1UEC A;  4JPB W;  1BBZ A;  1W70 A;  1WXT A;  3NMZ C;  1QKX A;  4DEY A;  1GCQ A;  2LX7 A;  1K9A A;  2B86 A;  1I1J A;  1QWF A;  3VS3 A;  2PNI A;  2I0N A;  2RQV A;  2XMF A;  1NLO C;  1FYN A;  2DL8 A;  1GFC A;  1SRL A;  2ED1 A;  2EGE A;  1V1C A;  3VS4 A;  1WXB A;  4LNP A;  1EFN A;  2BZ8 A;  1QLY A;  1H92 A;  1VYT A;  3C0C A;  2AK5 A;  1CKA A;  1FMK A;  2RF0 A;  1KIK A;  4CC7 A;  1UTI A;  2A37 A;  4HVV A;  2CSI A;  2IIM A;  2A28 A;  4OML A;  2KT1 A;  1U5S A;  1Z9Z A;  1X2K A;  3FJ5 A;  1SPK A;  1HJD A;  2RQR A;  2YDL A;  1MV0 B;  1KJW A;  3VS6 A;  2D1X A;  2MCN A;  2F2X A;  3TSZ A;  2CUB A;  2KXC A;  2VVK A;  2CUD A;  2EYY A;  5IHN A;  2D8J A;  2VKN A;  4Z88 A;  1JXM A;  1OEB A;  1YWO A;  4OMP A;  2KR3 A;  3KFV A;  1QCF A;  1AWX A;  4LUD A;  1GCQ C;  2DJQ A;  1HD3 A;  2G6F X;  1KFZ A;  2FEI A;  1YN8 A;  1NG2 A;  4GLM A;  2GTJ A;  2CSQ A;  4AG2 C;  3VRY A;  4HVU A;  1AZE A;  2F2V A;  2CT4 A;  4F17 A;  2CH4 W;  2JS0 A;  2RPN A;  4OMN A;  1YP5 A;  1N5Z A;  2C0I A;  2OJ2 A;  1AWW A;  4AFS C;  1E6H A;  1T0H A;  4IIM A;  1OPK A;  3VS2 A;  2GBQ A;  2ENM A;  1AEY A;  2FRY A;  1WLP B;  1I0C A;  1WIE A;  2FPE A;  2JS2 A;  3M0S A;  2KBT A;  1B3Q A;  2CRE A;  2DL4 A;  2O9S A;  1OPL A;  2EBP A;  4LE9 A;  2LZ6 B;  2A36 A;  2HCK A;  1ZUY A;  2DYB A;  2L3S A;  1YNZ A;  2NWM A;  3M0R A;  4OMO A;  4QT7 A;  2LJ0 A;  2DL3 A;  4LN2 A;  4JJB A;  2X3X D;  1XOV A;  1W6X A;  1UUE A;  1AZG B;  4D8K A;  1K4U S;  1I07 A;  1K0S A;  3TVT A;  3QWX X;  1SHF A;  1X6G A;  2YUQ A;  1E6G A;  2YUO A;  4J9I A;  3ULR B;  1RLQ C;  4OMM A;  2CT3 A;  2DLP A;  4RTV A;  1U06 A;  1ABO A;  2J6K A;  2KYB A;  2GNC A;  1M30 A;  2ROL A;  1X6B A;  2LQW A;  2KRO A;  3EG2 A;  2HEQ A;  1UJY A;  5GJW B;  5FW9 A;  4A63 B;  2AKL A;  3UF4 A;  3QWY A;  2K2M A;  1M27 C;  2DL5 A;  1VA7 A;  2EPD A;  2H8H A;  2LCS A;  1Z9Q A;  5L23 A;  1GBR A;  3PVL A;  2ED0 A;  1VYV A;  1PHT A;  4DEX A;  1Y0M A;  3I5R A;  1ARK A;  1OV3 A;  1H8K A;  2SRC A;  1GCP A;  3RBB B;  1AWJ A;  2DRK A;  1GFD A;  2KT8 A;  2K7A A;  4HVW A;  5FWC A;  4M4Z A;  1NLP C;  3VS5 A;  5ECA A;  1GL5 A;  4ZNX A;  1UHC A;  2W0Z A;  2K6D A;  4Z8A A;  2L3P A;  1MUZ A;  1NEG A;  1ZLM A;  2KE9 A;  2EVR A;  2JXB A;  3SEM A;  1UFF A;  2KGT A;  2FPF A;  1U3O A;  2RN8 A;  1IO6 A;  1X69 A;  3VRZ A;  1RLP C;  2DMO A;  5IHK A;  3ZL7 C;  4HXJ A;  2JMC A;  2EQI A;  1SSH A;  4J9G A;  1WDX A;  2BZY A;  3EHQ A;  2RQT A;  2EYZ A;  4RUG A;  5GJV B;  1OOT A;  2EKH A;  2YT6 A;  3I5S A;  3UAT A;  2EGC A;  4AFQ C;  1LCK A;  1TG0 A;  2LJ3 A;  2NUZ A;  2LJ1 A;  2CH4 A;  1W1F A;  2P4R A;  4RTY A;  1AWO A;  3A98 A;  2EYW A;  4RTZ A;  2JM8 A;  2JTE A;  2LMJ A;  2DVJ A;  1S1N A;  1PRL C;  4HCK A;  2PTK A;  4OMQ A;  1QWE A;  1BK2 A;  2DX1 A;  1WXU A;  4J9E A;  4F14 A;  4F16 A;  1HSQ A;  2OI3 A;  1NYF A;  2K79 A;  3M0T A;  3H0F A;  2O2O A;  1ABQ A;  2ESW A;  2GGR A;  1PWT A;  2FPD A;  2K3B A;  2KXD A;  2FRW A;  3M0Q A;  1H3H A;  4LUE A;  2YUP A;  1JO8 A;  1JQQ A;  1G83 A;  1SEM A;  2J05 A;  3VS0 A;  1K76 A;  2MOX A;  2ROT A;  1M8M A;  5IXF A;  5IH2 A;  4E6R A;  3IQL A;  1K0X A;  2DM1 A;  4RTX A;  2LQN A;  5FWB A;  1ZX6 A;  1AD5 A;  2ECZ A;  1WYX A;  4D8D A;  4IIO A;  2L2P A;  2JMA A;  2EGA A;  2YUN A;  3H0H A;  1GRI A;  4JZ4 A;  4J9B A;  4X1V A;  3VS1 A;  1G2B A;  3M0P A;  1PKT A;  4CC3 A;  1M3B A;  2D0N A;  1UE9 A;  2KNB B;  1JU5 C;  1T3L A;  4CC2 A;  5IXB A;  4KRT A;  3PE0 A;  2DBM A;  2HSP A;  3RNJ A;  3U23 A;  2OAW A;  4J9D A;  1CSK A;  2BTT A;  3R6N A;  1X2Q A;  2MIO A;  2C0O A;  3NHN A;  2E5K A;  1YCS B;  4AG1 C;  2AZS A;  2PZ1 A;  1RI9 A;  3I35 A;  1J3T A;  1AVZ C;  4AFZ C;  1RUW A;  1SRM A;  2FG0 A;  2J06 A;  2JW4 A;  1JXO A;  2FO0 A;  2RMO A;  1UGV A;  2DRM A;  2DL7 A;  1E7O A;  4JJD A;  4Z89 A;  1WI7 A;  2J6O A;  1AOJ A;  2RNA A;  3I9Q A;  2DNU A;  1ZBJ A;  3NPF A;  1QKW A;  2DE0 X;  1WX6 A;  1VYU A;  1PNJ A;  4JJC A;  2AKK A;  1PRM C;  2HBW A;  1K1Z A;  2GQI A;  1KSW A;  4R0K A;  2JM9 A;  1UG1 A;  3SHW A;  3PVQ A;  3REA B;  1MV3 A;  2O9V A;  2HDA A;  4J9H A;  1JEG A;  2M51 A;  4JZ3 A;  1UHF A;  2D8H A;  3EGU A;  2O88 A;  2C0T A;  2DBK A;  2EW3 A;  2KYM A;  4AFU C;  5HCK A;  5I11 A;  2O31 A;  1NEB A;  1ZSG A;  2JT4 A;  3VS7 A;  2AZV A;  3UA7 A;  3TSW A;  1ZUK A;  4WCI A;  1YWP A; 
#chains in the Genus database with same CATH topology
 3AT1 B;  1Q86 C;  3CBO A;  3S3M A;  4M75 B;  2CDT A;  3FC3 A;  1R77 A;  2ABL A;  1SSF A;  4ESR A;  1NE8 A;  3QYG B;  1MHN A;  2XDP A;  2QAZ A;  3LWI A;  5GAO r;  1X27 A;  5GAM e;  2QXF A;  1W2B P;  5GMK h;  2KVQ G;  2FZK B;  2QTX A;  2M9U A;  1C0M A;  4FT4 A;  2PVD B;  2WSE E;  5LJ5 f;  1KQ2 A;  2BIV A;  3EG0 A;  3NTI A;  3OSV A;  4MDW A;  2KI7 A;  1VQO Q;  2QDL A;  2RQW A;  3EG9 B;  3MEW A;  2DTH A;  1WHG A;  2ZPG B;  5KE3 A;  2L3Q A;  4J9F A;  5KE2 A;  2C06 A;  3EHR A;  4F7U B;  4ME7 A;  2K3Y A;  1YHQ T;  1SHG A;  3JRZ A;  5GAN g;  1VQ4 Q;  1ZSZ B;  4DOW A;  3GIB A;  2AT1 B;  2L5Q A;  4J9C A;  3V8J A;  2F5T X;  2ZPI B;  4CC4 B;  3L1A A;  3OYC A;  3DLM A;  4QQG A;  4EIK A;  3UA6 A;  3ME9 A;  3OW2 A;  2CP6 A;  4Y92 A;  1T0J A;  5LL6 S;  2QYZ A;  2NUP B;  4FSS A;  1UEC A;  1W70 A;  2GQV A;  1QKX A;  2B86 A;  2PNI A;  2I0N A;  1NLO C;  4M7D A;  1N27 A;  4A54 A;  1FYN A;  2DL8 A;  2QEX Q;  2ED1 A;  2E3H A;  3OBW A;  3VS4 A;  1WXB A;  4FW2 A;  4IKF A;  1VQL T;  4QW2 A;  4EMG A;  4PJN A;  2AK5 A;  4ELY C;  4E7L A;  1CKA A;  2D9T A;  3JCM g;  2A37 A;  1EZZ B;  3DB3 A;  4HVV A;  3GP8 A;  2A28 A;  3RMS A;  3CCV A;  1U5S A;  1X2K A;  3C12 A;  4JLG A;  1SPK A;  3H6Z A;  4A53 A;  2JTF A;  1TXQ A;  4N4H A;  1MV0 B;  1QCO A;  2DET A;  1TWB A;  3TSZ A;  1OX8 A;  2F2X A;  2CUB A;  2XI9 A;  3CMA T;  3VYG A;  4JUV A;  3JCM V;  4LD6 A;  1AWX A;  2EAY A;  2DJQ A;  2PVO B;  4DBR A;  1WNL A;  3C95 A;  1KFZ A;  2EQU A;  5GMK j;  1Q81 C;  1YN8 A;  4FT2 A;  2X4W A;  1VQN A;  4PJJ A;  4KGX B;  4HVU A;  2CH4 W;  2JS0 A;  4PJO D;  2F1L A;  4OMN A;  4FM4 B;  4M78 A;  1D09 B;  3CCM A;  4OP0 A;  5LJ3 j;  1R0B G;  5GMK m;  4HCZ A;  3T9N A;  4Y28 E;  1ZA2 B;  1I81 A;  2CZ0 B;  1Y07 A;  4YTL A;  4Y91 A;  2P0Q A;  2P0K A;  4CRI A;  3M55 A;  1OI1 A;  2JS2 A;  2KBT A;  4M78 B;  2CRE A;  5I2S A;  2O9S A;  5D7U A;  4LE9 A;  1M1K R;  2A36 A;  2DK3 A;  4A4K A;  2RHX A;  4LDW A;  4QT7 A;  4M77 B;  5DLO A;  2LJ0 A;  4LN2 A;  5FU6 C;  4JJB A;  1XOV A;  1AZG B;  4D8K A;  3MP6 A;  1X75 C;  1ACM B;  3QSU A;  2VGN A;  1E6G A;  3EH2 A;  2QQA A;  4M77 A;  4J9I A;  2DO3 A;  3ULR B;  4OMM A;  3I55 Q;  5KCH A;  2FZC B;  4RTV A;  2J6K A;  1Q95 G;  1M30 A;  1X6B A;  2KRO A;  2LQW A;  2ROL A;  3EG2 A;  1UJY A;  4PFP A;  1Q86 U;  3S3O A;  1K73 R;  4M75 D;  3UF4 A;  5LJ3 g;  2QQ9 A;  3R6O A;  1PM3 A;  2DL5 A;  3HSB A;  4JRI A;  4O5V A;  4WF2 A;  4C5I A;  3JB9 J;  2EPD A;  4R55 A;  2KY9 A;  3A8M B;  4KUD K;  4RG2 A;  1Z9Q A;  1VQ6 A;  2XDB A;  2ED0 A;  3KUF A;  4DEX A;  1N8R U;  3X26 B;  1YIT T;  2SRC A;  3JCM e;  1GCP A;  1AWJ A;  3QO3 A;  5A0D A;  3CCS A;  4BDY A;  3LX7 A;  4M4Z A;  3CC4 T;  3QZ5 B;  3H8Z A;  4ZNX A;  2W0Z A;  2JN0 A;  4M78 G;  4A4G A;  3CCR Q;  3CCV Q;  2VXF A;  1I5O B;  3UWN A;  1BI1 A;  2YXY A;  4C0Z A;  3OYA A;  3M56 A;  2VXE A;  3BW1 A;  1IRE B;  2Y4X A;  3G4S A;  4UC4 A;  2JJ9 A;  3CME Q;  2DMO A;  2CS7 A;  4FIB A;  2COY A;  1SSH A;  1WDX A;  2BZY A;  4A4H A;  3LGL A;  2YLB A;  2OTJ T;  2EYZ A;  1VQP T;  5CQX A;  5GJV B;  2QDY B;  1VIF A;  3I5S A;  2LC4 A;  2EGC A;  3JCM Q;  4KUI A;  2P0P A;  1TG0 A;  1KC8 R;  2NUZ A;  2LJ1 A;  1H64 1;  2MK5 A;  1WHJ A;  4RTY A;  1AWO A;  4C8Q D;  4HCB A;  2RHU A;  4RTZ A;  4NL3 A;  1KHI A;  2LMJ A;  2DVJ A;  2LCC A;  1X01 A;  1YJW Q;  2RHY A;  3HRS A;  1XQH A;  4C92 C;  1QWE A;  2YRC A;  4F16 A;  1XNI A;  2OI3 A;  4OGC A;  1XTD A;  3HL8 A;  1K73 U;  3MHX A;  3H0F A;  2EJF A;  2KXD A;  2KK4 A;  1PWT A;  2GGR A;  1H3H A;  2DXB A;  4BI4 A;  4LUE A;  2RA2 A;  4B6M A;  4DA4 A;  4M75 A;  2MOX A;  5IXF A;  1PSE A;  3DKM A;  1IHW A;  4XTY A;  1AD5 A;  4PJO F;  1WYX A;  2MMP A;  1M90 C;  2JMA A;  4M77 D;  1NPR A;  2LVM A;  1N8R C;  2P4T A;  1GRI A;  5AT1 B;  3A8L B;  4JZ4 A;  4J9B A;  4X34 A;  2GFU A;  3E2U A;  3EGX B;  2HAX A;  2MI6 A;  1UE9 A;  5C6S A;  4AMC A;  1H3Z A;  2RK2 A;  1YHQ A;  4C8Q G;  1K73 C;  5KYX B;  2EIF A;  4MZM A;  2QGF B;  2DBM A;  3P8D A;  2HSP A;  1UEB A;  2LTO A;  3CCJ T;  2A3L A;  2OAW A;  4ZGJ B;  1CSK A;  2BTT A;  2MIO A;  2VC8 A;  3RUX A;  5GAN 5;  1M1F A;  2C0O A;  4NL2 A;  3JCM h;  2PVG B;  4AG1 C;  2AZS A;  2PZ1 A;  5GAN 7;  5FU7 B;  4E7J A;  1ZBX A;  4ZTF A;  3ZBD A;  3CCR T;  2J06 A;  1VQ5 Q;  1YBY A;  2RMO A;  4N0A C;  4XU3 A;  2M16 A;  5GAO q;  3GLX A;  1M90 U;  3GPL A;  4HCC A;  2BKD N;  2RNA A;  4DOV A;  2NUT A;  3UDC A;  3NPF A;  3PMT A;  1M2V A;  1IXD A;  5LJ5 e;  3QII A;  3RER A;  5KYY B;  5GMK l;  2DE0 X;  3A5Z B;  3FIF A;  2K2V A;  1PNJ A;  1M5Q 1;  1VQ5 A;  3QG1 A;  4DBQ A;  2V26 A;  1PRM C;  2X4X A;  2EFI A;  5GAM d;  2GQI A;  2XU8 A;  1VQ8 A;  3CME A;  3E9G A;  1KSW A;  4C8Q E;  2JM9 A;  3H9N A;  3JCM X;  2LQ8 A;  3REA B;  2KDS A;  4E7H A;  4M77 C;  3G71 A;  3M4G A;  1MV3 A;  1V76 A;  2F69 A;  1S72 A;  2O9V A;  4MML A;  1VQO A;  4OB3 B;  2HKN A;  4JZ3 A;  3EGU A;  2XK0 A;  2DBK A;  4Z02 A;  1ZSG A;  3UA7 A;  1BCO A;  3OYF A;  4IUU A;  5I2M A;  1YJN T;  2X9H A;  2EYX A;  1W4S A;  2FVU A;  2HD0 A;  1TUD A;  3E1S A;  2CP2 A;  3HRU A;  2DER A;  2DF6 A;  2K9G A;  4RTW A;  4BE2 A;  2M0Y A;  5KYY A;  3CD6 Q;  2X3W D;  3NGP A;  1SG5 A;  4M7A G;  4JRK A;  2KRS A;  3OYB A;  3C94 A;  1QVF P;  4ZGE B;  2WSC E;  3CC2 T;  2KRM A;  1BCM A;  4N4G A;  1YIJ T;  3GBQ A;  3JV3 A;  2VWF A;  1KQS A;  8AT1 B;  4ORZ A;  1UDL A;  3CXC P;  3OS0 A;  2QA4 T;  3CXC S;  3ZFJ A;  4FW1 A;  1VIE A;  1M9S A;  1Y71 A;  1WFW A;  3LW5 E;  4KBM B;  1M3A A;  2J6F A;  5I22 A;  1Y57 A;  3EG1 A;  4JLI A;  2XKO C;  3QDR B;  4M7A E;  2KRN A;  1M4Z A;  2HQX A;  3M53 A;  1MND A;  2P84 A;  3E9F A;  1N9R A;  3OS5 A;  3OYN A;  1BU1 A;  1ZSZ C;  3QYH B;  5CAI A;  5GAN f;  4IUT A;  2K5L A;  1VQ4 T;  2YHT A;  1GBQ A;  2SEM A;  2W10 A;  3JB9 F;  1VQ7 T;  5HY6 A;  1OYX A;  4FYY B;  4C0G A;  2D0Q B;  2ATC B;  2FYK A;  2GCX A;  4JPB W;  3NMZ C;  4DEY A;  1KK7 A;  5I21 A;  4RCC A;  1UGS B;  4M7A D;  3HHT B;  3QJ6 A;  3L2Z A;  4F7U F;  5KH6 A;  2EGE A;  4XTZ A;  1B34 A;  1WJR A;  4KGZ B;  1EFN A;  2BZ8 A;  3L2Q A;  1OUL A;  2K3X A;  1ZHI A;  3C0C A;  3V8L A;  4HT8 A;  4J7I A;  2OX7 A;  3CCU A;  4M7D F;  1KIK A;  1D3B B;  1UTI A;  2E70 A;  3MEU A;  1QVG A;  5FRO A;  1KC8 C;  4OML A;  4M78 D;  2KT1 A;  2OAU A;  5LJ5 h;  4XQ3 A;  4M7D E;  2DIQ A;  3X20 B;  1O75 A;  2YDL A;  2DKG A;  2RI5 A;  2D1X A;  2MCN A;  2KXC A;  8ATC B;  2EYY A;  2RJE A;  5J3B A;  4E7S A;  4M7A C;  3OMG A;  3QDF A;  2HBP A;  4PNO A;  1G3T A;  4OMP A;  3KFV A;  5C0M A;  1VQ9 Q;  1I8F A;  2G6F X;  2E5Q A;  2HQE A;  1D1C A;  1RAH B;  2R57 A;  1ZQ1 A;  1IRX A;  2F2V A;  4F17 A;  4M75 G;  4AT1 B;  3SDZ A;  4C5E A;  3A8G B;  1YP5 A;  1PD0 A;  4J6X A;  4EMH A;  2C0I A;  2OJ2 A;  1AWW A;  3OYM A;  3PIO A;  3JCM f;  1B7T A;  1VQK T;  1T0H A;  1QVP A;  1S72 Q;  3VS2 A;  4QVZ A;  5EG2 A;  2CP3 A;  3SB2 A;  2FRY A;  1WLP B;  2QK0 A;  3M0S A;  2BE7 D;  4RCB A;  3PT9 A;  3PIP A;  3O8V A;  1OPL A;  2EBP A;  2PUO B;  3JB9 I;  2HCK A;  1ZUY A;  1QVF A;  3CC7 T;  2L3S A;  3V7S A;  2NWM A;  2CP5 A;  4LXC A;  5GAN 8;  2DL3 A;  5A0G A;  4PJO E;  4J5Y A;  3EGD B;  4JS4 A;  4KH0 B;  3JCM W;  3CPW A;  5FRN A;  2JVV A;  2FZG B;  1M90 R;  4C8Q B;  2RHZ A;  1SHF A;  5LJ5 d;  1X6G A;  1OX9 A;  5M9O A;  2CYZ B;  1U06 A;  1ABO A;  4EDU A;  2K5I A;  1D0Y A;  1O9S A;  5A2Q E;  1M27 C;  1YI2 Q;  5CKD A;  2H3E B;  2CGH A;  1ZSZ A;  1VA7 A;  2WAC A;  2OTJ Q;  5L23 A;  1GBR A;  3INZ A;  1VYV A;  1WGS A;  3I5R A;  2FL7 A;  3G6E T;  3LYI A;  1GFD A;  2LT1 A;  5LJ5 g;  2Y90 A;  1NLP C;  3VS5 A;  1QCN A;  4OB1 B;  4Z8A A;  1MUZ A;  1UGQ B;  1NEG A;  1NZ9 A;  2DAQ A;  3I56 A;  1Y96 A;  4J6W A;  5KYX A;  2JNG A;  1HXD A;  1VQ9 T;  3OBY A;  1U3O A;  2R5A A;  1D0X A;  3QJY A;  1X69 A;  3VRZ A;  1RLP C;  1VQN Q;  1QVG P;  1N9S A;  2DXC A;  2EQI A;  3EHQ A;  3EFO B;  3QBY A;  3BDU A;  4XU2 A;  3HRT A;  3CC4 A;  5GMK e;  4EMK B;  4AFQ C;  2LDM A;  1QP2 A;  3S6W A;  4QKU A;  4F04 B;  1S72 T;  1JBM A;  4VUB A;  3MO8 A;  4HCK A;  2NUT B;  2YWW A;  4E47 A;  1M2V B;  2V8I A;  2PTK A;  4M7A F;  3G4S T;  4OMQ A;  5DM7 R;  2DTI A;  4J9E A;  4F14 A;  1KHC A;  2JZ2 A;  1FXX A;  2O4X A;  2K79 A;  4J6Y A;  4N4I A;  5KYW B;  2O2O A;  1ABQ A;  3NFC A;  1IGU A;  3PGG A;  2MF2 A;  4M7D D;  1JO8 A;  1YJ9 Q;  1JQQ A;  1SEM A;  2J05 A;  3VS0 A;  1HYO A;  2ROT A;  5IH2 A;  4E6R A;  1K0X A;  3I55 A;  2LQN A;  2V8J A;  1I5L A;  4BAC A;  3OYH A;  2ZZD A;  3JCM J;  1YIJ A;  1SKU B;  4IIO A;  4FL6 A;  2YUN A;  1YI2 A;  2PQW A;  3OYL A;  4DQ2 A;  5GAO p;  3MP8 A;  2E4H A;  2QA4 A;  5HKC A;  1PKT A;  1M3B A;  2D0N A;  3KXT A;  2RM4 A;  1VUB A;  2WSF E;  5KYU B;  1C1A A;  3EAE A;  4C92 A;  4CC2 A;  4MZP A;  3CCS Q;  3OYK A;  4O6J A;  3RNJ A;  5IAY A;  4M7D C;  1MMN A;  4PFO A;  3ZEH A;  3MPU B;  1WPY A;  2XD0 A;  3VUB A;  2E5K A;  4C92 B;  1YCS B;  1VQ7 A;  2DXU A;  1YCY A;  1RAG B;  4EMK C;  2JTM A;  1J3T A;  4AFZ C;  2FG0 A;  4C8Q A;  3CXC A;  2FO0 A;  2JOY A;  2VAS A;  3GNG A;  1UGV A;  4X9C A;  1VOM A;  4M7D G;  2DL7 A;  1E7O A;  1HK9 A;  4JJD A;  2ZPB B;  3PMI A;  1WI7 A;  3I9Q A;  1AOJ A;  1LOJ A;  2E6N A;  2DNU A;  2RJC A;  2CZ1 B;  4B9X A;  1BYM A;  1ZBJ A;  1VQM A;  4KUL A;  1KD1 R;  1VQL A;  1WX6 A;  2O01 E;  3M54 A;  2Y4Y A;  2LQK A;  1VQ6 Q;  2DJZ A;  3E19 A;  2YLC A;  3VJP A;  3HFN A;  2BUD A;  3CBP A;  2ZPF B;  1UG1 A;  3JCM P;  5IT9 E;  2M0O A;  1QW1 A;  2HDA A;  5FLX E;  2DD5 A;  3S3N A;  1JEG A;  2VYT A;  2D8H A;  4AFU C;  1M8V A;  3CCE A;  1NEB A;  1Q82 C;  2JT4 A;  3L2V A;  4QQ6 A;  4E7Z A;  1TUC A;  2KAF A;  1UB4 A;  1WA7 A;  1NYG A;  5CCA A;  3CME T;  5D6Y A;  2DA9 A;  1D1A A;  1CKB A;  2CKK A;  3CCL A;  4F7U A;  1YJN Q;  2QQR A;  4KGV B;  2QQS A;  3OMC A;  3REB B;  2LNH B;  2DD4 A;  2R5M A;  4C0F A;  5CIU A;  4L5G A;  4PLL A;  5AYF A;  3SD4 A;  3LH5 A;  2RQU A;  3O5Z A;  3CC2 Q;  2DIL A;  3H0I A;  3VKI A;  1M2O A;  1B07 A;  1BB9 A;  2MYS A;  2KEA A;  4QVC A;  3M58 A;  4IUR A;  4PK4 A;  4RKU E;  1Q82 U;  1M3C A;  5IHI A;  4BD3 A;  3CC7 A;  5EC7 A;  1UGR B;  2QG9 B;  4TVR A;  3CQT A;  2HSE B;  3L2U A;  3MET A;  2FB7 A;  2G3R A;  4IUQ A;  1KC8 U;  2KSS A;  4K11 A;  2NLU A;  1BI0 A;  4ZGD B;  2QI2 A;  4MZT A;  3L2W A;  3PNW C;  2YSQ A;  4C5H A;  2J7I A;  2EQJ A;  4FU6 A;  1TUG B;  2NYS A;  4N0A A;  3BDL A;  3H41 A;  2BZX A;  3THK A;  3EG3 A;  3QZ9 B;  5GAN 2;  4RTU A;  4C8Q F;  1LNX A;  1BBZ A;  2MAM A;  1IB8 A;  2LX7 A;  1K9A A;  9ATC B;  2RJF A;  3VS3 A;  2XMF A;  3V7C A;  2HZY A;  4M7A A;  3VV0 A;  1SRL A;  1D1B A;  2XID A;  4LNP A;  3CEY A;  1W2B A;  3M5A A;  3P8H A;  1QLY A;  2RH2 A;  1H92 A;  1VYT A;  5GAN h;  2GF7 A;  3OS1 A;  1FMK A;  2RF0 A;  2IVW A;  3SWN B;  1G5V A;  2IIM A;  2PU9 B;  1LPL A;  1MMA A;  4CI0 C;  1RI0 A;  3JSC A;  1RAB B;  2VV5 A;  2VGM A;  3TCJ A;  1Q86 R;  1KJW A;  4LDU A;  3VS6 A;  1FMW A;  1WHH A;  2RI3 A;  2CUD A;  4FYX B;  1WQW A;  3PFS A;  5IHN A;  3RES A;  2VKN A;  4Z88 A;  1JXM A;  1OEB A;  3CC7 Q;  1YWO A;  4M78 C;  1SF9 A;  1TOV A;  3L42 A;  1GCQ C;  2XDD A;  1HD3 A;  4A4F A;  1BIA A;  3OW2 P;  2FEI A;  1PCX A;  4GLM A;  4V2S A;  4AG2 C;  3VRY A;  1NJI R;  3OYD A;  4OGE A;  2EWN A;  4QQD A;  1N5Z A;  1PD1 A;  3JAM E;  4F7U G;  3TU4 K;  1VQ8 Q;  4IUP A;  3CMA A;  4C0D B;  3JB9 D;  4AFS C;  3X25 B;  3CCM Q;  2GBQ A;  2ENM A;  3G1J A;  4XAX B;  1AEY A;  4M75 F;  1I0C A;  1RL2 A;  4J8O A;  2DL4 A;  4R56 A;  2DYB A;  4C5G A;  3M0R A;  4OMO A;  3J7A F;  4FYW B;  2MWP A;  2X3X D;  1W6X A;  5KCO A;  1K0S A;  3TVT A;  4GY5 A;  2OTL A;  1DJ7 B;  5CQY A;  1K9M R;  1F1B B;  2BE9 B;  2YUO A;  2CZ6 B;  2EQK A;  2CT3 A;  2DLP A;  1K9M C;  3MKD A;  2GNC A;  2HL5 C;  2HEQ A;  5GJW B;  5FW9 A;  1BI2 A;  2K2M A;  1BI3 A;  3OSS C;  1WJS A;  2LCS A;  3X28 B;  2HKQ B;  5DLQ E;  1PHT A;  5GAM h;  1Y0M A;  1ARK A;  1OV3 A;  4BY6 B;  1G8X A;  3BE3 A;  4LDV A;  2OTJ A;  5HK0 A;  1YFN A;  1YIT Q;  2LCL A;  1KG1 A;  5ECA A;  4BY6 C;  1QMC A;  1VQM Q;  1UHC A;  3CPW S;  2L3P A;  2XIC A;  1R8O B;  3MCA B;  2KE9 A;  2E41 A;  2HL3 A;  2RK1 A;  1UFF A;  1K9M U;  5GMK i;  1VQ6 T;  1WHM A;  2RN8 A;  4HXJ A;  3JCM d;  4J9G A;  2RQT A;  3NTK A;  1WHK A;  1U8R A;  4XU1 A;  7AT1 B;  2A0F B;  5FU7 C;  3SWN A;  3CBM A;  1VQ8 T;  4JRP A;  1VQP Q;  1W1F A;  3EG9 A;  3A98 A;  2EYW A;  3JCM b;  3M9Q A;  4IUV A;  1VQO T;  2JTE A;  1PRL C;  1VQ9 A;  5L8R E;  3CCE T;  3NTH A;  2DX1 A;  1EIF A;  2DVE A;  2JUF A;  3CPF A;  1YJN A;  1G3S A;  1YJW A;  1N6A A;  1D3B A;  1VQP A;  1NYF A;  1IZ6 A;  4PJO B;  2RD1 A;  4XK8 E;  3DLL A;  3M0T A;  3G4S Q;  2ESW A;  2NUP A;  2K3B A;  1JRI A;  2FRW A;  3MEA A;  3JCM c;  2YUP A;  5GAN 4;  4DBH A;  2E64 A;  3SFM A;  1K76 A;  4C0D C;  2HMA A;  3BFM A;  2DM1 A;  4RTX A;  3OA6 A;  1ZX6 A;  1RAF B;  2L3R A;  1RAD B;  1PSF A;  4M78 F;  4D6W A;  4C8Q C;  3H0H A;  3G7Z A;  4X1V A;  3VS1 A;  4CC3 A;  1W2B S;  3L2R A;  3BY7 A;  3OYG A;  3DB4 A;  1WHL A;  2KNB B;  4PJO A;  3GNF B;  3OYY A;  3EFS A;  3G6E Q;  2E6Z A;  1LJO A;  2DEQ A;  3I55 T;  1FWZ A;  3EGD A;  1G3W A;  2LRQ A;  3QKJ A;  2X51 A;  2DZC A;  2RI2 A;  1TU0 B;  1QVG S;  1VQ5 T;  1Q81 R;  3NHN A;  3A8O B;  3CCQ A;  4ZTJ A;  2OTL Q;  1AVZ C;  1RUW A;  4II1 A;  2JW4 A;  4L6V 5;  2F5K A;  2QGG A;  4C92 E;  4Z89 A;  3MP1 A;  1IGQ A;  2YRV A;  5GAN j;  2J6O A;  2HNI A;  3LLR A;  1NJI U;  3CCJ A;  3WVE B;  4XTU A;  3CD6 A;  2LNV A;  2V8K A;  1VYU A;  5LJ5 j;  2AKK A;  2K5F A;  2HBW A;  5GAM j;  5GAN 6;  1BKB A;  2DPP B;  3TQ7 P;  4BDZ A;  3CCR A;  1VQL Q;  3SHW A;  3PVQ A;  1V29 B;  2B8A A;  3FB9 A;  3QPH A;  4ELZ C;  2EYQ A;  2EW3 A;  3CC2 A;  5LJ3 d;  1JJ2 A;  3Q1J A;  2O31 A;  1KD1 C;  3VS7 A;  2AZV A;  3G71 Q;  3TSW A;  4WCI A;  2QAS A;  3GOX A;  2X4J A;  3I56 Q;  1YJ9 T;  1PKS A;  1T3S A;  1Y96 B;  2K4Y A;  1Q82 R;  3EH1 A;  3MJX A;  3ASK A;  1Q7Y C;  3SWN C;  2DFU A;  3OY9 A;  4MDX A;  4OB0 B;  1WZO A;  4RTT A;  1NJI C;  2E12 A;  4LDY A;  3EGX A;  1R0C B;  3V7R A;  5KYN A;  4PL6 A;  3WVD B;  3LWH A;  1OU9 A;  2PUK B;  3M0U A;  1K8A R;  1UJ0 A;  1TTH B;  2D6F A;  4X9D A;  5GAN e;  2QA4 Q;  1OZ2 A;  4M75 C;  1K8A C;  2R58 A;  4RMO A;  2A08 A;  2L0A A;  2F2W A;  2A7Y A;  1ZUU A;  2Z0W A;  4OMF B;  4LD9 K;  4L59 A;  4LDX A;  2K57 A;  2DTO A;  2DEU A;  2LP5 A;  2X35 A;  5CKF A;  1A0N B;  1X6O A;  2DYI A;  2EKO A;  1X43 A;  2IPO B;  2MPX C;  4PKC C;  1Q7Y U;  4GBQ A;  1NM7 A;  1JJ2 S;  2V1R A;  2GTO A;  1JJ2 P;  2V1Q A;  1JB0 E;  3JB9 H;  2RB6 A;  4JS5 A;  5KYW A;  2QEX T;  1WXT A;  3N5B B;  1NBE B;  1GCQ A;  5CR2 A;  3CCV T;  2QTV A;  1I1J A;  1QWF A;  2RQV A;  2E65 A;  2RO0 A;  2LT4 A;  1KQ1 A;  1GFC A;  1Q7Y R;  3X24 B;  1V1C A;  1WQ7 A;  5D6X A;  3C4S A;  5LJ3 f;  4PJO C;  1VQ4 A;  4PJM A;  4J7F A;  3F70 A;  4KH1 B;  1LVK A;  3EFR A;  4CC7 A;  4BB7 A;  1RAE B;  3A1P A;  2E3I A;  3WXM B;  1KQS P;  2CSI A;  2MWO A;  4ANJ A;  3LGF A;  1MGQ A;  1VQN T;  5CO7 A;  5CKE A;  1Z9Z A;  3RKY A;  1KQS S;  3FJ5 A;  4PJO G;  3QXE B;  4M77 F;  1HJD A;  2RQR A;  3OYE A;  3CCQ Q;  2VVK A;  2IG0 A;  3I56 T;  1AT1 B;  2D8J A;  5LJ3 e;  2KR3 A;  3M57 A;  1QCF A;  4LUD A;  1NG2 A;  2GTJ A;  2CSQ A;  4PFZ A;  1AZE A;  2CT4 A;  2H3J A;  5FRM A;  3UT1 A;  2RPN A;  3RKX A;  3M59 A;  1QP3 A;  5KYU A;  3ER0 A;  1MNE A;  1U1S A;  2KQW A;  1E6H A;  4IIM A;  1OPK A;  3J81 E;  1EX4 A;  3FLG A;  3OYJ A;  2EJG A;  1WIE A;  2FPE A;  1MMG A;  4PJL A;  1MMD A;  3CMA Q;  1B3Q A;  1VQK Q;  3OS2 A;  2LZ6 B;  3LH0 A;  4EMK A;  4F7U E;  1YNZ A;  1PC0 A;  3PTA A;  4M78 E;  4MMK A;  2EJ9 A;  4ATO A;  1OQK A;  1BIB A;  4ZN1 A;  4HKE A;  1UUE A;  1K4U S;  1VQK A;  1I07 A;  5CKB A;  5CK9 A;  2DIG A;  1U1T A;  2DZ9 A;  1YHQ Q;  3QWX X;  2CZ7 B;  3VUZ A;  4XTX A;  1Q81 U;  4RG8 A;  2YUQ A;  1RAI B;  2O4X B;  4GLK A;  4BI3 A;  3FRN A;  1RLQ C;  3CCS T;  2KYB A;  3TEE A;  1YI2 T;  4JDS A;  4A63 B;  2AKL A;  4C92 D;  3QWY A;  1UGP B;  1AHJ B;  5GAO l;  4QVD A;  2M1H A;  5CVI A;  2H8H A;  2E10 A;  2EQM A;  2OTL T;  4P5N A;  3PVL A;  4WTO B;  2CP0 A;  3CCU T;  4Q5W A;  1M1K C;  1C6V X;  1H8K A;  5CKH A;  2COW A;  4XTV A;  3RBB B;  3VYH B;  2DRK A;  2KT8 A;  4A4E A;  2K7A A;  4HVW A;  5FWC A;  3FEO A;  3OW2 S;  3CCQ T;  1GL5 A;  1ZA1 B;  3UPU A;  2L89 A;  2K6D A;  1GXI E;  1I4K 1;  2LX9 A;  3OYI A;  1ZLM A;  5A0L A;  4E2F B;  2EVR A;  2AHJ B;  2JXB A;  3SEM A;  4BE0 A;  1XJW B;  2FPF A;  2KGT A;  1IO6 A;  5LJ3 h;  2YRD A;  5IHK A;  3ZL7 C;  3CD6 T;  2JMC A;  1TSF A;  3URG A;  4M7A B;  4NOY A;  4XTW A;  1N8R R;  3G6E A;  4BI8 B;  4RUG A;  1OOT A;  3FDR A;  3QHS A;  2EKH A;  2YT6 A;  5IN1 A;  3KBG A;  4HA8 A;  3UAT A;  3D7S B;  1QQJ A;  4DBF A;  1FX7 A;  1LCK A;  2LJ3 A;  2ZAE A;  2CH4 A;  3RDV A;  3CCM T;  2P4R A;  1RAA B;  5J39 A;  2M02 A;  2RJD A;  2JM8 A;  3CC4 Q;  5DY9 A;  1S1N A;  3HFO A;  3CCL Q;  3HP9 A;  6AT1 B;  3QUI A;  2RHI A;  1BK2 A;  1WXU A;  5GAM f;  1HSQ A;  4J83 A;  1YJ9 A;  3TRE A;  4OB2 B;  1WJQ A;  5GAO n;  2DXT A;  1TS9 A;  2FPD A;  2KMT A;  2XHC A;  3M0Q A;  2COZ A;  4C92 G;  2ZPE B;  4FYV B;  1IHV A;  1G83 A;  5GAM g;  2XG8 D;  3HKS A;  1M8M A;  5GAN d;  3IQL A;  2QQB A;  1VQ7 Q;  5FWB A;  3OB9 A;  2VUB A;  1TH7 A;  3AHU A;  3HTR A;  2ECZ A;  2L8D A;  4D8D A;  1YJW T;  4M7D B;  5GAN 3;  5GAO m;  2ZPH B;  2L2P A;  2EGA A;  2FHD A;  4FSX A;  3GF5 A;  3HPW A;  1YIJ Q;  3RIR A;  1M1K U;  4B9W A;  1G2B A;  4XU0 A;  3M0P A;  3P8B B;  4HT9 A;  1M1G A;  5FU6 B;  1QVF S;  4PLI A;  4M75 E;  2GFA A;  3CPW P;  1JU5 C;  1D0Z A;  2CP7 A;  1T3L A;  3CCU Q;  1B34 B;  5IXB A;  4KRT A;  3PE0 A;  1NPP A;  2ZCF B;  3U23 A;  1YIT A;  1PG5 B;  4J9D A;  3R6N A;  1X2Q A;  4M77 E;  3OQ5 A;  4JRQ A;  1KD1 U;  3EFO A;  2I2L A;  3JB9 G;  3A8H B;  2HQH A;  1RI9 A;  2QEX A;  4OF1 A;  5J26 A;  3I35 A;  4E7I A;  4BUG A;  4E7K A;  1SRM A;  1OZ3 A;  1JXO A;  3G71 T;  2DRM A;  3M4Y A;  4NS5 A;  2E1H A;  2VB6 A;  4KT0 E;  3J80 E;  1RAC B;  1QKW A;  1G3Y A;  4EPC A;  4M77 G;  4C92 F;  3RMQ A;  3RKW A;  4JJC A;  5HK3 A;  4OVA A;  3V8K A;  1K1Z A;  3CCJ Q;  1OU8 A;  1K8A U;  1Y7X A;  3VU3 C;  4R0K A;  4BE1 A;  3CCE Q;  3CCL T;  3RR6 A;  1FMV A;  4J9H A;  2M51 A;  1UHF A;  4JJN K;  2O88 A;  2AIR B;  2C0T A;  3MEV A;  2KYM A;  3FJP A;  4ZN3 A;  5D6W A;  5HCK A;  5I11 A;  4FCY A;  1VQM T;  2ZGW A;  2X4Y A;  1ZUK A;  1YWP A;  1P92 A; 
#chains in the Genus database with same CATH homology
 2EYX A;  1TUC A;  1PKS A;  2CDT A;  1T3S A;  1WA7 A;  2ABL A;  4ESR A;  1NYG A;  1TUD A;  2DF6 A;  2K9G A;  4RTW A;  2DA9 A;  2M0Y A;  1CKB A;  4RTT A;  2X3W D;  3NGP A;  1X27 A;  2KRS A;  3REB B;  2LNH B;  3M0U A;  2KRM A;  1UJ0 A;  3EG0 A;  3GBQ A;  3JV3 A;  2VWF A;  2QDL A;  2RQW A;  3LH5 A;  2RQU A;  2A08 A;  2L0A A;  3O5Z A;  2DIL A;  3H0I A;  4ORZ A;  1UDL A;  2F2W A;  1B07 A;  1BB9 A;  1ZUU A;  2KEA A;  2L3Q A;  1M3C A;  4J9F A;  1WFW A;  5IHI A;  1M3A A;  3EHR A;  2J6F A;  5EC7 A;  5I22 A;  1Y57 A;  1SHG A;  3CQT A;  3EG1 A;  2LP5 A;  4K11 A;  2KRN A;  4CC4 B;  4J9C A;  1A0N B;  1X43 A;  1BU1 A;  4GBQ A;  1NM7 A;  4EIK A;  2YSQ A;  2V1R A;  3UA6 A;  2J7I A;  2GTO A;  2V1Q A;  4Y92 A;  1GBQ A;  2SEM A;  2W10 A;  1T0J A;  3H41 A;  2BZX A;  3THK A;  3EG3 A;  4RTU A;  4FSS A;  1UEC A;  4JPB W;  1BBZ A;  1W70 A;  1WXT A;  3NMZ C;  1QKX A;  4DEY A;  1GCQ A;  2LX7 A;  1K9A A;  2B86 A;  1I1J A;  1QWF A;  3VS3 A;  2PNI A;  2I0N A;  2RQV A;  2XMF A;  1NLO C;  1FYN A;  2DL8 A;  1GFC A;  1SRL A;  2ED1 A;  2EGE A;  1V1C A;  3VS4 A;  1WXB A;  4LNP A;  1EFN A;  2BZ8 A;  1QLY A;  1H92 A;  1VYT A;  3C0C A;  2AK5 A;  1CKA A;  1FMK A;  2RF0 A;  1KIK A;  4CC7 A;  1UTI A;  2A37 A;  4HVV A;  2CSI A;  2IIM A;  2A28 A;  4OML A;  2KT1 A;  1U5S A;  1Z9Z A;  1X2K A;  3FJ5 A;  1SPK A;  1HJD A;  2RQR A;  2YDL A;  1MV0 B;  1KJW A;  3VS6 A;  2D1X A;  2MCN A;  2F2X A;  3TSZ A;  2CUB A;  2KXC A;  2VVK A;  2CUD A;  2EYY A;  5IHN A;  2D8J A;  2VKN A;  4Z88 A;  1JXM A;  1OEB A;  1YWO A;  4OMP A;  2KR3 A;  3KFV A;  1QCF A;  1AWX A;  4LUD A;  1GCQ C;  2DJQ A;  1HD3 A;  2G6F X;  1KFZ A;  2FEI A;  1YN8 A;  1NG2 A;  4GLM A;  2GTJ A;  2CSQ A;  4AG2 C;  3VRY A;  4HVU A;  1AZE A;  2F2V A;  2CT4 A;  4F17 A;  2CH4 W;  2JS0 A;  2RPN A;  4OMN A;  1YP5 A;  1N5Z A;  2C0I A;  2OJ2 A;  1AWW A;  4AFS C;  1E6H A;  1T0H A;  4IIM A;  1OPK A;  3VS2 A;  2GBQ A;  2ENM A;  1AEY A;  2FRY A;  1WLP B;  1I0C A;  1WIE A;  2FPE A;  2JS2 A;  3M0S A;  2KBT A;  1B3Q A;  2CRE A;  2DL4 A;  2O9S A;  1OPL A;  2EBP A;  4LE9 A;  2LZ6 B;  2A36 A;  2HCK A;  1ZUY A;  2DYB A;  2L3S A;  1YNZ A;  2NWM A;  3M0R A;  4OMO A;  4QT7 A;  2LJ0 A;  2DL3 A;  4LN2 A;  4JJB A;  2X3X D;  1XOV A;  1W6X A;  1UUE A;  1AZG B;  4D8K A;  1K4U S;  1I07 A;  1K0S A;  3TVT A;  3QWX X;  1SHF A;  1X6G A;  2YUQ A;  1E6G A;  2YUO A;  4J9I A;  3ULR B;  1RLQ C;  4OMM A;  2CT3 A;  2DLP A;  4RTV A;  1U06 A;  1ABO A;  2J6K A;  2KYB A;  2GNC A;  1M30 A;  2ROL A;  1X6B A;  2LQW A;  2KRO A;  3EG2 A;  2HEQ A;  1UJY A;  5GJW B;  5FW9 A;  4A63 B;  2AKL A;  3UF4 A;  3QWY A;  2K2M A;  1M27 C;  2DL5 A;  1VA7 A;  2EPD A;  2H8H A;  2LCS A;  1Z9Q A;  5L23 A;  1GBR A;  3PVL A;  2ED0 A;  1VYV A;  1PHT A;  4DEX A;  1Y0M A;  3I5R A;  1ARK A;  1OV3 A;  1H8K A;  2SRC A;  1GCP A;  3RBB B;  1AWJ A;  2DRK A;  1GFD A;  2KT8 A;  2K7A A;  4HVW A;  5FWC A;  4M4Z A;  1NLP C;  3VS5 A;  5ECA A;  1GL5 A;  4ZNX A;  1UHC A;  2W0Z A;  2K6D A;  4Z8A A;  2L3P A;  1MUZ A;  1NEG A;  1ZLM A;  2KE9 A;  2EVR A;  2JXB A;  3SEM A;  1UFF A;  2KGT A;  2FPF A;  1U3O A;  2RN8 A;  1IO6 A;  1X69 A;  3VRZ A;  1RLP C;  2DMO A;  5IHK A;  3ZL7 C;  4HXJ A;  2JMC A;  2EQI A;  1SSH A;  4J9G A;  1WDX A;  2BZY A;  3EHQ A;  2RQT A;  2EYZ A;  4RUG A;  5GJV B;  1OOT A;  2EKH A;  2YT6 A;  3I5S A;  3UAT A;  2EGC A;  4AFQ C;  1LCK A;  1TG0 A;  2LJ3 A;  2NUZ A;  2LJ1 A;  2CH4 A;  1W1F A;  2P4R A;  4RTY A;  1AWO A;  3A98 A;  2EYW A;  4RTZ A;  2JM8 A;  2JTE A;  2LMJ A;  2DVJ A;  1S1N A;  1PRL C;  4HCK A;  2PTK A;  4OMQ A;  1QWE A;  1BK2 A;  2DX1 A;  1WXU A;  4J9E A;  4F14 A;  4F16 A;  1HSQ A;  2OI3 A;  1NYF A;  2K79 A;  3M0T A;  3H0F A;  2O2O A;  1ABQ A;  2ESW A;  2GGR A;  1PWT A;  2FPD A;  2K3B A;  2KXD A;  2FRW A;  3M0Q A;  1H3H A;  4LUE A;  2YUP A;  1JO8 A;  1JQQ A;  1G83 A;  1SEM A;  2J05 A;  3VS0 A;  1K76 A;  2MOX A;  2ROT A;  1M8M A;  5IXF A;  5IH2 A;  4E6R A;  3IQL A;  1K0X A;  2DM1 A;  4RTX A;  2LQN A;  5FWB A;  1ZX6 A;  1AD5 A;  2ECZ A;  1WYX A;  4D8D A;  4IIO A;  2L2P A;  2JMA A;  2EGA A;  2YUN A;  3H0H A;  1GRI A;  4JZ4 A;  4J9B A;  4X1V A;  3VS1 A;  1G2B A;  3M0P A;  1PKT A;  4CC3 A;  1M3B A;  2D0N A;  1UE9 A;  2KNB B;  1JU5 C;  1T3L A;  4CC2 A;  5IXB A;  4KRT A;  3PE0 A;  2DBM A;  2HSP A;  3RNJ A;  3U23 A;  2OAW A;  4J9D A;  1CSK A;  2BTT A;  3R6N A;  1X2Q A;  2MIO A;  2C0O A;  3NHN A;  2E5K A;  1YCS B;  4AG1 C;  2AZS A;  2PZ1 A;  1RI9 A;  3I35 A;  1J3T A;  1AVZ C;  4AFZ C;  1RUW A;  1SRM A;  2FG0 A;  2J06 A;  2JW4 A;  1JXO A;  2FO0 A;  2RMO A;  1UGV A;  2DRM A;  2DL7 A;  1E7O A;  4JJD A;  4Z89 A;  1WI7 A;  2J6O A;  1AOJ A;  2RNA A;  3I9Q A;  2DNU A;  1ZBJ A;  3NPF A;  1QKW A;  2DE0 X;  1WX6 A;  1VYU A;  1PNJ A;  4JJC A;  2AKK A;  1PRM C;  2HBW A;  1K1Z A;  2GQI A;  1KSW A;  4R0K A;  2JM9 A;  1UG1 A;  3SHW A;  3PVQ A;  3REA B;  1MV3 A;  2O9V A;  2HDA A;  4J9H A;  1JEG A;  2M51 A;  4JZ3 A;  1UHF A;  2D8H A;  3EGU A;  2O88 A;  2C0T A;  2DBK A;  2EW3 A;  2KYM A;  4AFU C;  5HCK A;  5I11 A;  2O31 A;  1NEB A;  1ZSG A;  2JT4 A;  3VS7 A;  2AZV A;  3UA7 A;  3TSW A;  1ZUK A;  4WCI A;  1YWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...