2RN8A

Nmr structure note: murine itk sh3 domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
GSPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAPSSYLVEKSPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title NMR structure note: murine Itk SH3 domain
rcsb
source organism Mus musculus
total genus 9
structure length 64
sequence length 64
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rn8A00
2DNUA 1SSHA 2YUNA 2DX1A 1PWTA 2D0NA 2LP5A 4JZ4A 2CH4A 2CT4A 1WIEA 4K11A 4E6RA 2FRYA 3A98A 4OMQA 3RBBB 4JZ3A 1Y57A 2JS2A 4QT7A 2YUQA 2JM9A 2FPEA 2A08A 2KXCA 1ABQA 2CSQA 1MV0B 1LCKA 2GGRA 4F14A 1WLPB 2KRSA 2L0AA 2JM8A 2FPFA 1YWPA 2KRNA 3U23A 1M27C 1UGVA 1YP5A 2KT8A 2RQVA 1B3QA 4HVUA 3I5SA 2I0NA 3UATA 2JXBA 2D8HA 2MIOA 4GBQA 1NG2A 2DL3A 1SPKA 2NWMA 1GCPA 1TUDA 1UFFA 2J7IA 1U5SA 2LZ6B 2DYBA 2DA9A 2HEQA 2DRMA 4A63B 1JXOA 2JTEA 2JS0A 3VRYA 1U06A 4OMOA 1ABOA 2O2OA 3TSZA 1W1FA 3O5ZA 4RTWA 2HSPA 2LJ0A 2SRCA 2E5KA 2JMAA 2D8JA 2AZSA 3EG3A 1V1CA 2EQIA 1K0SA 1WI7A 2ROTA 3H0IA 4RTVA 1XOVA 2EGEA 2C0TA 3VS1A 2EBPA 2BTTA 2M51A 1T0JA 2J05A 2AKLA 3H0FA 1WDXA 4OMPA 3EG2A 4J9FA 1M30A 1VYUA 1ZUYA 5IHKA 2KBTA 3QWYA 2EYYA 1AOJA 4Z89A 1OEBA 2KR3A 2CT3A 4ZNXA 4AFSC 2DF6A 2KEAA 2DL8A 4J9EA 1GBRA 1T3SA 3TSWA 3ZL7C 1RI9A 2F2XA 2QDLA 4LUEA 2CUBA 3EHQA 2OAWA 1G83A 2JMCA 5GJVB 2IIMA 3ULRB 2AZVA 2GBQA 2PZ1A 4Y92A 4D8DA 1ZUKA 1FYNA 3IQLA 1X6GA 4ORZA 3SHWA 1WXBA 2A36A 2YT6A 1H8KA 4RUGA 3VS5A 2K3BA 2RNAA 2JW4A 4F16A 4FSSA 2EYWA 1QCFA 1QKXA 3RNJA 4JPBW 1JO8A 1YCSB 2BZXA 2KROA 3UF4A 3NHNA 1NLOC 2LQNA 3UA7A 4J9CA 1ZBJA 1M3BA 2DBMA 2K79A 2AKKA 2K9GA 1AWJA 3FJ5A 3LH5A 1JU5C 2F2VA 1OPLA 3QWXX 1E6HA 2V1RA 1HD3A 2F2WA 2KYBA 1BU1A 5ECAA 2PTKA 1GL5A 4AG2C 4JJCA 4J9HA 2VVKA 1GRIA 3PE0A 2RQWA 2BZ8A 4DEYA 2CREA 1SEMA 1E6GA 2J6OA 1AEYA 2ABLA 5IH2A 2YUPA 4LNPA 1BB9A 2VWFA 4RTYA 1TUCA 2A37A 2YSQA 1WXUA 3M0QA 2YUOA 5IHNA 2EVRA 2ROLA 1KJWA 1X2KA 3EG0A 4OMMA 4Z8AA 5FW9A 2ESWA 2XMFA 1OV3A 2KYMA 1M8MA 1CKAA 1U3OA 1RUWA 1EFNA 2HBWA 1JXMA 4CC4B 3C0CA 2DM1A 4AFUC 1GBQA 1B07A 1AWWA 1AD5A 3M0PA 1J3TA 3TVTA 1KSWA 2DL4A 1M3CA 2RQRA 4CC2A 1UECA 2CDTA 4CC7A 2O9SA 2AK5A 2DVJA 4X1VA 2RMOA 1QWEA 5GJWB 1K4US 1PRMC 2DJQA 1PKSA 4LN2A 2W0ZA 4IIOA 1FMKA 4ESRA 2GTOA 4HVWA 3I9QA 1AWXA 2FO0A 1K0XA 1UUEA 1VA7A 4DEXA 2DLPA 1G2BA 2X3XD 4KRTA 2K2MA 4AFQC 2EYXA 2EGAA 1I07A 3R6NA 2MCNA 1A0NB 4RTXA 2GTJA 3PVQA 1RLPC 3GBQA 1UE9A 2FPDA 1GFDA 2HCKA 1AZGB 2FEIA 2KXDA 2DL7A 4M4ZA 5IXBA 1SRLA 1N5ZA 4HXJA 1NYGA 2RF0A 2J06A 1WYXA 4LE9A 4GLMA 3I35A 3JV3A 4HCKA 3UA6A 2LX7A 3REAB 5I22A 1CKBA 1YN8A 1UJ0A 2C0IA 1SHFA 2J6FA 2VKNA 2J6KA 2OI3A 3M0SA 1ZX6A 4J9IA 1UHFA 3PVLA 1PHTA 1UG1A 2O31A 4AFZC 4R0KA 1BBZA 1X43A 2L3QA 1K76A 3VS4A 1QWFA 1ZSGA 2DL5A 3EGUA 1K9AA 1AVZC 2L2PA 4HVVA 4EIKA 1OPKA 1X2QA 2JT4A 1H92A 1UJYA 2LMJA 2BZYA 1WXTA 1WX6A 2GNCA 2HDAA 1I1JA 3H41A 1Y0MA 2B86A 3EG1A 2ED1A 2V1QA 1PNJA 3VS2A 1ARKA 4AG1C 2KRMA 2DE0X 3NMZC 3H0HA 1VYTA 2H8HA 2FG0A 4J9BA 1GFCA 5I11A 2W10A 4RTZA 1W70A 2G6FX 1PKTA 2KNBB 1UDLA 4JJBA 2FRWA 1ZLMA 4OMLA 1NEGA 2C0OA 2LQWA 3REBB 2ED0A 3VS3A 4IIMA 2P4RA 2KE9A 1YWOA 3NGPA 1JEGA 4CC3A 2OJ2A 3VS6A 3NPFA 2CUDA 3M0TA 1HSQA 3EHRA 3KFVA 1WA7A 4F17A 2KGTA 2EW3A 4Z88A 2K7AA 1X27A 4LUDA 2RQTA 5FWCA 4J9GA 3THKA 2GQIA 2X3WD 2LJ3A 2L3SA 2RPNA 1ZUUA 3M0RA 1YNZA 1X69A 3CQTA 1SRMA 2A28A 1H3HA 1Z9QA 4WCIA 1GCQA 2O9VA 2MOXA 2K6DA 2RN8A 1OOTA 1T0HA 5HCKA 1SHGA 2YDLA 1KFZA 1NLPC 5FWBA 1MV3A 3SEMA 5L23A 1MUZA 2O88A 1IO6A 1WFWA 3VS7A 5IXFA 2EPDA 1KIKA 5IHIA 1X6BA 4RTUA 2LJ1A 1T3LA 1RLQC 2DBKA 1K1ZA 1S1NA 1BK2A 4JJDA 2L3PA 2CSIA 2M0YA 1AZEA 1TG0A 1QLYA 3I5RA 1NYFA 2DMOA 4J9DA 4RTTA 1UTIA 2EKHA 2KT1A 2RQUA 4D8KA 1GCQC 2LNHB 1E7OA 3VS0A 1M3AA 2CH4W 2NUZA 1W6XA 1UHCA 2DILA 2EYZA 1AWOA 1HJDA 1JQQA 1NM7A 5EC7A 2D1XA 2EGCA 2ECZA 2DRKA 3VRZA 1NEBA 1Z9ZA 4OMNA 3M0UA 2SEMA 1PRLC 2ENMA 2PNIA 1CSKA 1QKWA 1I0CA 1VYVA 2LCSA
chains in the Genus database with same CATH superfamily
3A8HB 4C0FA 1YJNQ 4M77G 2YUNA 2CH4A 4OMQA 3CCRQ 2K5IA 3I56A 4QT7A 4WF2A 4LXCA 2CSQA 1LCKA 4P5NA 2GGRA 3CCST 2DAQA 3CCEQ 3JB9I 2YRCA 5CQXA 3EGDB 1M1FA 2X4YA 1YCYA 4E2FB 3LGFA 2KRNA 1M27C 3EGXA 2KT8A 2QA4Q 1B3QA 3I5SA 4V2SA 4E7KA 1Q7YR 2I0NA 1KQ1A 4GBQA 2XIDA 1NG2A 5CKEA 4JS4A 1Y71A 2DERA 1BCOA 2DA9A 3VRYA 4C92B 1WJSA 4OMOA 3CC4T 2O2OA 3TSZA 1B34A 1W1FA 4F7UG 3O5ZA 2E5KA 3EG3A 2AZSA 4LDUA 3CCLA 1KC8C 3J7AF 4F7UF 2QQSA 3OS5A 2EQKA 1XOVA 2MI6A 2LVMA 2YXYA 2BTTA 1YI2A 2EIFA 4HT8A 4XTWA 3CCLQ 1XTDA 3G6ET 1M30A 1VYUA 2RI2A 5FLXE 2DK3A 1ZUYA 1KC8U 4ELYC 4OP0A 2LTOA 4N4GA 4BI3A 1OEBA 1LNXA 1VQLQ 3PIPA 4XQ3A 2KI7A 4AFSC 1EZZB 1YFNA 3JCMP 3TSWA 2Y90A 4C5HA 3ZL7C 1WZOA 2EFIA 2PVOB 2QDLA 4XU1A 5IN1A 4BY6B 2XDDA 1N27A 3MEVA 1RL2A 1G83A 4M75D 3VJPA 3CMEA 5GJVB 2V8IA 2E64A 2XK0A 4BY6C 3TQ7P 3G4ST 5KYNA 3LX7A 5LJ3e 3CMEQ 4RUGA 1OQKA 2JW4A 4HCCA 2RHYA 2EYWA 3OYCA 3WVEB 3EG9A 4J9CA 2DBMA 1M3BA 2DPPB 4EDUA 4IUVA 1AWJA 4X34A 3SFMA 1Q7YC 1JU5C 2F2VA 4QKUA 1WHMA 3ZFJA 2CZ7B 2V1RA 3GIBA 3MHXA 3MP6A 1M2VB 1VQ5A 3T9NA 4AG2C 3O8VA 1QVFP 4MDXA 2RO0A 1YBYA 1Q7YU 2RQWA 4N0AA 2G3RA 2RD1A 1M5Q1 1SEMA 2YUPA 2RJEA 2A0FB 4LNPA 1BB9A 2E1HA 2GF7A 3TU4K 4KH1B 3LH0A 2A37A 4DBRA 1WXUA 3M0QA 3QYHB 1OYXA 1KQSP 1KJWA 5KCHA 1VQ7Q 2VGNA 2ESWA 2Y4YA 2FZGB 2MF2A 1EFNA 1D1BA 4CC4B 4J6YA 3A8MB 5GANe 2XKOC 1WHLA 2E65A 4IUPA 1C0MA 4C92D 2DIGA 1AD5A 1J3TA 1FXXA 1IGUA 4CC7A 3EAEA 3RIRA 4N4HA 3CD6Q 5GJWB 4Y28E 2CZ1B 4BE0A 4OVAA 3OA6A 4ZGJB 3CC2A 1IREB 1Q86R 2PQWA 2GTOA 3I9QA 2FO0A 3AHUA 1V76A 1UUEA 1VA7A 2XD0A 2ZPGB 5GAMg 1I07A 1TOVA 3R6NA 2RB6A 1UGRB 2XI9A 2F5TX 6AT1B 3RKWA 4FSXA 1UE9A 3OYAA 1AZGB 4XAXB 2FEIA 2KXDA 2DL7A 3CCRT 1NYGA 3X25B 4FT2A 4A4HA 2K3XA 3KBGA 1WYXA 2V8KA 1JJ2S 3TREA 2DXCA 4KUDK 3JV3A 3CCET 4HCKA 1BI1A 1SF9A 2LX7A 2RH2A 1UJ0A 5C0MA 1ACMB 2QA4T 3C95A 4CI0C 2J6KA 3M0SA 3C4SA 4J9IA 3OYEA 3ER0A 5LJ5g 4E47A 5KCOA 1UG1A 2YLCA 2CP5A 2Y4XA 5L8RE 2L3QA 3LLRA 3G71A 3VS4A 3OY9A 1QWFA 2ZPIB 2E6NA 2ZPEB 3EGUA 1K9AA 4ZGEB 2MYSA 1AVZC 3OYKA 2L2PA 4NL2A 1TS9A 4HVVA 4EIKA 3CC7A 4RG8A 3OW2P 3JB9H 3RMQA 2E10A 4C8QF 2GNCA 3RUXA 3CCQQ 2HD0A 3SWNB 2FHDA 3CC7Q 4DOVA 4OB0B 3SWNC 2KRMA 3HKSA 2YRVA 1M1KR 3CCLT 2FG0A 1ZSZA 1VQ9Q 2W10A 4RTZA 2G6FX 3QZ5B 2KNBB 1Q86C 1UDLA 4OF1A 4L59A 2MK5A 1VQLT 1NEGA 3OYBA 4A53A 4XU3A 2CP2A 3CXCP 1BI0A 1WNLA 2E5QA 1YWOA 1Q86U 5CKBA 2DEUA 3HFOA 1PSEA 3GF5A 1WA7A 4PFOA 3CCSA 4PNOA 1MHNA 2OTLA 3L2WA 2QGFB 2K7AA 4C8QB 3CMET 3V8JA 4M7AD 2OAUA 1D1AA 4C5GA 3CBPA 4C8QC 1G8XA 1YNZA 1O75A 1SRMA 2R58A 3M57A 4M75A 1H3HA 2LC4A 1Z9QA 5DLOA 1I5OB 1YITQ 2AIRB 4WCIA 3JSCA 3QBYA 1T0HA 4II1A 5HCKA 1SHGA 2YDLA 1NLPC 5FWBA 4MZTA 3ZEHA 5L23A 1MUZA 4M7DD 1KIKA 1WHGA 4L5GA 2LJ1A 3H6ZA 1T3LA 3JCMW 1S1NA 4M75E 4PL6A 3F70A 1VQ5T 1AZEA 2WACA 5GAMj 1M2OA 2JN0A 3V7RA 2DMOA 3A8LB 2QTVA 2XU8A 1BI2A 1W2BA 4D8KA 1PC0A 3G6EA 1JBMA 1GCQC 1VQ7T 3L2RA 1I81A 2LNHB 2JJ9A 1M1KC 1M3AA 2A7YA 1UGSB 2DILA 1AWOA 3OS1A 1MMNA 1JQQA 4LD9K 3QSUA 4OB3B 1QVGA 1KHIA 3EGDA 2HAXA 3M0UA 2PNIA 1WJRA 5GAMh 1QKWA 2GQVA 4NL3A 2VXFA 3FIFA 1M1KU 4ATOA 1VQMQ 3CD6T 4B9XA 1QCOA 1VQKQ 2VXEA 4JZ3A 1Y57A 3G4SA 2JS2A 2RI3A 3OS2A 2JM9A 2FPEA 1ABQA 2L89A 1MV0B 5KYXA 3JCMg 4R56A 4F14A 1UEBA 3QXEB 3ME9A 4ME7A 2KRSA 1Q82R 2PVGB 2IVWA 4C92A 2FPFA 4BI4A 5GANd 1YP5A 1UGVA 2RQVA 2MMPA 3OYLA 3DB3A 4EMHA 3RKYA 2COYA 4FW2A 2D0QB 2JXBA 2D8HA 2DL3A 2RK1A 5LJ3f 1SPKA 5LJ5h 1UFFA 3HRUA 2ATCB 2MWOA 1OZ2A 4C92E 2PUKB 3GPLA 2LT4A 2HEQA 2LCLA 1FMWA 1U06A 1LPLA 4PFPA 4AT1B 1ABOA 5GAN3 4OMFB 2KK4A 4M75G 2E12A 4PLIA 2SRCA 2LNVA 2D8JA 1V1CA 2EQIA 2NYSA 1YHQQ 2KAFA 3H0IA 3JB9D 2A3LA 4XK8E 3OBYA 2CYZB 4IUUA 3V7CA 4QVZA 4PJOB 5IHKA 5GMKj 2F69A 2EYYA 2EAYA 1AOJA 3E1SA 3QZ9B 3M4YA 1RAHB 3CCQT 1RAAB 3CC7T 2DF6A 4FYYB 3EHQA 2OAWA 1VQ6Q 3BY7A 1QMCA 2IIMA 2HKQB 2RHIA 3JCMV 3ULRB 3UWNA 1G3SA 1VQ9T 4D8DA 2QXFA 4GY5A 5GANf 4E7LA 1WXBA 1M2VA 2YT6A 3EH2A 2QQ9A 1YJWQ 1D09B 2K3BA 1YJNA 4O6JA 2QQAA 1ZQ1A 1Q82C 4PJNA 1YCSB 1AT1B 3UF4A 3NHNA 1NLOC 2LQNA 2EQJA 2K5LA 2QQBA 4A54A 2X4XA 1BYMA 2DZCA 1N9SA 2AKKA 5DM7R 3FJ5A 1Y07A 2RM4A 1S72Q 1JB0E 4M77F 4J5YA 3QWXX 3CCEA 1Q82U 1VOMA 1G5VA 5FROA 2QG9B 3OYMA 4LDYA 4C92G 2VB6A 1BU1A 2DTHA 3MEWA 1WHJA 3OYGA 3LWHA 2QA4A 2P4TA 2OTLT 4J9HA 1OI1A 1W4SA 3QHSA 5IH2A 4E7ZA 1TTHB 5D6YA 4C5IA 2QK0A 1DJ7B 1PCXA 1HK9A 2VWFA 1RAIB 2OX7A 2YUOA 5IHNA 4M7AA 2BE7D 3UT1A 1X2KA 3EG0A 4Z8AA 2L8DA 5D6WA 2VUBA 2FZKB 2BKDN 4M78B 2KYMA 1CKAA 1G3WA 2VC8A 1RUWA 3PT9A 1K9MR 1JXMA 4KT0E 4M78C 4EMGA 3H8ZA 1B07A 3MO8A 2CZ6B 1I5LA 3OS0A 1M3CA 4M7AE 1P92A 2DJQA 1PKSA 1VQ8Q 4ESRA 4DOWA 4M7DA 4HVWA 1FX7A 1VQLA 1AWXA 1K0XA 2O4XB 4DEXA 2K2MA 3OSVA 4PJOD 2EGAA 3JCMh 4JJNK 1IHWA 1A0NB 1QQJA 2LX9A 1VQMT 3GBQA 3CPFA 1VQKT 3M56A 1GFDA 3L2UA 5IXBA 4M7DE 1X75C 1Q95G 4J6XA 4JUVA 2J06A 4EPCA 5DLQE 1X6OA 4QQDA 5GMKi 4OB1B 5FRNA 1BI3A 2P0QA 1H641 2BUDA 2QQRA 2IG0A 2H3EB 4F7UB 2VKNA 2ZGWA 2EWNA 4JDSA 2B8AA 5IT9E 3P8BB 1BBZA 1F1BB 1IXDA 4IUQA 3LW5E 1TXQA 1M1GA 1OPKA 2JT4A 2YLBA 1WXTA 1WX6A 2EJFA 4ZN1A 2C06A 1VQNQ 4E7HA 1K9MC 2HDAA 1WHHA 3H41A 4AMCA 4BDYA 4JLGA 3EG1A 2KY9A 3A8GB 1UB4A 1UGPB 2V1QA 3VS2A 4KH0B 2RHZA 3A5ZB 1ARKA 1VQ7A 1LVKA 3NTHA 2DE0X 4M7AG 3NMZC 4BUGA 3BFMA 2H8HA 1K9MU 4J9BA 1GFCA 4HKEA 1JRIA 3A1PA 3JRZA 1ZLMA 4FYXB 3S3NA 2C0OA 4M78D 2E70A 4J83A 4BI8B 3CD6A 2KE9A 2M16A 3HTRA 4MZPA 4JRPA 1VQ6T 1TUGB 1Y96B 2DZ9A 4CC3A 2JVVA 4M7DG 3NPFA 1HSQA 4FM4B 1W2BS 2KGTA 4RMOA 2EW3A 1MNDA 1YJWT 1WQ7A 2RQTA 2V8JA 2JUFA 3MCAB 3X26B 2NUPB 2L3SA 3EFOB 2RPNA 3M0RA 1QVGS 1X69A 1RI0A 1YJNT 2LT1A 5C6SA 2FYKA 1S72T 1GCQA 2O9VA 3EFRA 5GAMe 2RN8A 4PKCC 1KK7A 4C0GA 2X51A 3SEMA 2O88A 3M55A 2EPDA 1B34B 3C12A 5KE2A 1VQ4Q 4A4FA 1H3ZA 2DBKA 5KYYB 1PM3A 2L3PA 2CSIA 2M0YA 2HMAA 1EX4A 4NS5A 3META 1QCNA 1NYFA 2K57A 4FU6A 4OGCA 1QVPA 2EKHA 2EJ9A 2RQUA 3JB9J 4XU0A 4YTLA 1W6XA 3MEAA 5CQYA 3DLLA 1KD1R 3CCQA 3JCMQ 1NM7A 5EC7A 5LJ5e 4E7IA 2E3HA 4Q5WA 1XNIA 4RCBA 2SEMA 2M1HA 5HK3A 1VYVA 2LCSA 1JJ2P 1R77A 2DX1A 1PWTA 2D0NA 4JZ4A 1RABB 1WIEA 3KXTA 4LDVA 4E6RA 1VQ9A 1FMVA 3E9GA 2RJCA 3RBBB 3CXCS 1VQ8T 2DETA 3SDZA 2YUQA 5IAYA 5GAOm 2A08A 2KXCA 3GLXA 4XTZA 4FYVB 1WLPB 2XHCA 2L0AA 2KQWA 3X20B 3X28B 4BE1A 2K3YA 4XTUA 3JB9G 3U23A 2CP6A 2P84A 3CCUA 4HVUA 2VASA 3TEEA 4LDXA 1QVFA 2RJDA 3CCVQ 4A4KA 4RG2A 3UATA 3RKXA 2MIOA 2X35A 2NWMA 3CCUQ 2HL3A 1GCPA 2J7IA 2LZ6B 3MP1A 4ZGDB 1QP3A 4PJOA 5I2MA 1WQWA 1JXOA 2JS0A 3P8DA 2E6ZA 2KVQG 3RESA 1YITA 3OYJA 2HSPA 2CP7A 2ZCFB 2LJ0A 1YIJQ 1PSFA 1MNEA 3VYHB 2H3JA 4JRQA 1BIAA 1WI7A 1C6VX 2ROTA 1RADB 4RTVA 3VS1A 2EGEA 2EBPA 3CMAQ 4PJOE 1T0JA 2J05A 2AKLA 3H0FA 4OMPA 3C94A 3JAME 3EG2A 5J26A 1D3BB 2KSSA 3QJYA 2CKKA 3V8KA 3HSBA 3QKJA 2KBTA 1VQNT 4Z89A 4PK4A 1KD1C 2KR3A 1B7TA 4ZNXA 5LJ3d 3HPWA 1RAEB 4J9EA 3OYIA 1T3SA 4PJLA 3I55Q 1RI9A 2F2XA 2CUBA 1VUBA 3PTAA 4HA8A 1KD1U 2AZVA 2GBQA 4Y92A 3INZA 1ZUKA 1FYNA 2LCCA 3E9FA 3IQLA 3SHWA 2PVDB 3RMSA 5GAOl 3BDLA 2K2VA 1H8KA 4HCZA 1MGQA 2RNAA 3CPWS 1VQMA 4F16A 4PLLA 3HRSA 1QCFA 3RNJA 2X9HA 1VQKA 1JO8A 2BZXA 2KROA 3LWIA 4DBQA 2HQEA 2K79A 4C0DB 3WVDB 2K9GA 3GNFB 4IURA 4FCYA 3S3MA 4C0DC 2VGMA 1OPLA 4RCCA 5M9OA 3RDVA 1E6HA 4R55A 3BW1A 1BCMA 2F2WA 4O5VA 4M78A 5ECAA 1GL5A 1N6AA 3PE0A 4DEYA 2CREA 4ZN3A 1E6GA 2J6OA 3OW2A 4PFZA 5CO7A 4IUTA 3JCMe 4LDWA 5CR2A 2EQUA 3CCJQ 1TUCA 2YSQA 4M78E 4PJOG 2EVRA 2ROLA 3NTIA 5FW9A 4OMMA 2BE9B 3L42A 2XMFA 4C5EA 1VQ4T 1OV3A 1U3OA 2O4XA 2EQMA 3PMIA 2VYTA 3C0CA 2AHJB 4C8QD 1YHQA 4KGVB 1VIEA 1GBQA 1U1TA 3MJXA 1AWWA 3SD4A 4GLKA 4QVCA 4CC2A 1UECA 2CDTA 2O9SA 2DVJA 4X1VA 2RMOA 4M75F 1QWEA 3CXCA 1K4US 3M53A 2EJGA 1ZSZB 3H9NA 1WHKA 4EMKB 1ZSZC 4X9CA 1O9SA 4PJJA 3M54A 3PMTA 2DLPA 4EMKC 4DBHA 1G2BA 2X3XD 4KRTA 4MMKA 4AFQC 3OYNA 4L6V5 2RA2A 1AHJB 1KHCA 5CKFA 2DVEA 1VQ6A 3QIIA 2E41A 2GTJA 3PVQA 2FPDA 4DA4A 4HT9A 4M4ZA 1VQOQ 2EYQA 1Q81R 2RF0A 2O01E 3GNGA 1YJWA 3VYGA 1G3YA 3FLGA 3PNWC 5I22A 1YN8A 2XG8D 5GMKh 2RJFA 2C0IA 3MPUB 3CCMA 4FL6A 1SHFA 3WXMB 5LJ5d 2J6FA 4M75B 1YJ9Q 2X4WA 4X9DA 2AT1B 2YWWA 1S72A 1ZX6A 3FDRA 3CCVT 4M75C 1UHFA 4BDZA 1PHTA 4AFZC 4R0KA 4XTVA 3CCMQ 3PFSA 3CCUT 1K76A 2HSEB 3M59A 2ZAEA 4M78G 1ZSGA 2DL5A 1VQPQ 5GAOr 1K73R 1R0BG 3AT1B 1PG5B 5FU6B 1X2QA 2WSFE 2BZYA 1TU0B 5FU6C 3QDFA 4J8OA 5KYUB 1YIJT 5HKCA 1Y0MA 2B86A 3QJ6A 4C92F 5GAMf 2ED1A 1K8AR 5KYWB 1PNJA 1YITT 2K4YA 4XU2A 3CMAT 4AG1C 1BIBA 1PD1A 1OULA 3PIOA 1Y96A 3H0HA 2D6FA 1MMGA 5GMKl 2VV5A 2R5AA 5I11A 2PUOB 1W70A 3Q1JA 4XTXA 3I56Q 4JJBA 7AT1B 2FRWA 2FVUA 3CPWA 5CIUA 1NJIR 3BDUA 2P0PA 2NUPA 1SSFA 3VUBA 1U1SA 2MPXC 2ED0A 3EFOA 4IIMA 2P4RA 3I55T 5LL6S 1D0ZA 4KULA 3NGPA 1VQ8A 3DLMA 4M77B 3VU3C 3CBMA 2OJ2A 3VS6A 2CUDA 2K5FA 1N9RA 4OB2B 3M0TA 4LD6A 4M77C 5KYXB 5A0DA 1U8RA 1Q81C 3QDRB 5LJ5f 4JS5A 1RAFB 5D7UA 1X27A 4J7FA 4LUDA 2DTOA 3HRTA 3L2ZA 4J9GA 3OYDA 3THKA 2GQIA 4ELZC 2X3WD 5KYYA 4C92C 4NOYA 1ZUUA 2QTXA 1Q81U 4ZTFA 3CQTA 5GAN6 1D0YA 4IKFA 3R6OA 3OMGA 2QDYB 3HHTB 2RHUA 5GAOp 5CVIA 1C1AA 2MOXA 2K6DA 3OQ5A 2NUTB 3V7SA 1MV3A 3MP8A 1IO6A 5IXFA 2QASA 1YI2Q 1X6BA 2EKOA 2LQ8A 1K73C 2DTIA 1BK2A 5GAN5 4JJDA 5GAN7 1TG0A 1QLYA 5LJ3g 2DD4A 3I5RA 3CCJT 5GAN4 5GAOq 4J9DA 3SWNA 1K8AC 2KT1A 1NE8A 1QVFS 4ZTJA 3PGGA 1K73U 4B6MA 3DB4A 5GAOn 9ATCB 1I4K1 1E7OA 3VS0A 1ZA1B 2DKGA 1VQNA 4DBFA 2CH4W 2NUZA 2HZYA 3P8HA 2EYZA 2XICA 4PJMA 1OX8A 1K8AU 3MEUA 1RACB 1HYOA 2FL7A 2DXUA 4OMNA 1KQSS 1NJIC 1CSKA 1R0CB 1I0CA 2DNUA 1SSHA 2D9TA 2LP5A 2CT4A 4XTYA 4K11A 1YHQT 1VIFA 2FRYA 3A98A 1UGQB 5J3BA 3HFNA 3JCMd 3GP8A 1NJIU 2QI2A 2Z0WA 1XQHA 4M7AF 2RK2A 4C8QA 4TVRA 2FB7A 2JM8A 1N8RR 1VQ5Q 1YWPA 1I8FA 2DJZA 2DXTA 2QEXA 1VQOT 1GXIE 2YHTA 5GANg 5A2QE 5EG2A 3HP9A 2JTMA 2LRQA 4M77D 2L3RA 8AT1B 3QUIA 4C8QE 2QEXQ 3X24B 1TUDA 2ZPHB 4QQ6A 3D7SB 1U5SA 2DYBA 2HBPA 3A8OB 2WSEE 4M7DF 1D3BA 2R57A 2DRMA 4A63B 2JTEA 3E2UA 4N4IA 4QQGA 1YJ9T 4BB7A 3KUFA 2RHXA 2DIQA 5A0GA 3EGXB 4MDWA 1NPPA 4RTWA 2JMAA 1BKBA 1D1CA 3RR6A 1K0SA 2L5QA 3CCMT 2C0TA 1MMDA 4M7AB 2P0KA 2M51A 2M0OA 4B9WA 1WDXA 2E4HA 1VQPT 2CP0A 1VQ4A 3VUZA 4M7AC 4J9FA 3M5AA 5CK9A 1KQ2A 3CC2Q 3QWYA 4QVDA 2CT3A 5AT1B 3JCMf 2V26A 1W2BP 2KEAA 1ZA2B 2DL8A 3QG1A 4KUIA 1GBRA 2JTFA 4LUEA 3OW2S 3UPUA 2JMCA 4M7DB 2PZ1A 1X6GA 4ORZA 2DO3A 3I56T 1QVGP 4M7DC 5CKDA 2A36A 4C0ZA 5HY6A 5A0LA 3VS5A 1V29B 4JRKA 4QW2A 4FSSA 2DXBA 1QKXA 1M90R 2CS7A 4JPBW 1NPRA 1OX9A 3UA7A 1N8RC 1ZBJA 1FWZA 4D6WA 3NTKA 3LH5A 3FEOA 1IGQA 3FRNA 5LJ3j 1R8OB 3ASKA 1HD3A 4C8QG 2KYBA 2OTJA 1N8RU 1WGSA 2PTKA 1NZ9A 3M4GA 3G71Q 4JJCA 3FJPA 4Y91A 3L1AA 2VVKA 1GRIA 3EH1A 4BE2A 2BZ8A 3EG9B 3NFCA 2HNIA 3CCVA 2OTJQ 1AEYA 2ABLA 3V8LA 1IB8A 3CBOA 2WSCE 5CAIA 1WJQA 1SG5A 4RTYA 5HK0A 3JB9F 5LJ3h 3FB9A 1D0XA 2ZPFB 2GFAA 1YI2T 4EMKA 1X01A 5KH6A 4E7SA 3JCMJ 1M8MA 2HKNA 4A4EA 1YIJA 2HBWA 1OZ3A 4FIBA 2DM1A 2DEQA 1KQSA 4AFUC 4FW1A 3CMAA 3M0PA 4N0AC 4MZMA 3TVTA 1HXDA 3UDCA 1KSWA 5GMKe 2DL4A 2RQRA 2AK5A 3JCMX 3QPHA 1PRMC 1TH7A 1RAGB 4LN2A 2W0ZA 4IIOA 1FMKA 5FU7B 5GANj 1M4ZA 4BD3A 2M9UA 5FU7C 1MMAA 3CCSQ 3JCMc 2OTLQ 1M8VA 1XJWB 2EYXA 3BE3A 3I55A 3OYYA 2MCNA 3E19A 5CKHA 4RTXA 1RLPC 1M90C 2DFUA 2HCKA 3LGLA 2ZZDA 3OYHA 4JLIA 4A4GA 1SRLA 4Z02A 1N5ZA 3CEYA 4HXJA 3SB2A 2XDBA 4LE9A 5GANh 2F1LA 2ZPBB 4F04B 3CC4A 4GLMA 1M90U 3I35A 3QYGB 3UA6A 5GAN8 1KG1A 3REAB 1CKBA 3OBWA 2GCXA 2JZ2A 5FRMA 1EIFA 2BIVA 5I21A 3CC4Q 3JCMb 5KYUA 1IZ6A 3DKMA 2OI3A 4UC4A 3OYFA 1PD0A 2R5MA 3OMCA 5KYWA 3LYIA 3PVLA 2O31A 2QAZA 3M58A 4VUBA 5GAN2 3VV0A 1X43A 2QEXT 2QYZA 2HQXA 1QW1A 1NBEB 4ANJA 2DD5A 2RI5A 3G6EQ 1ZHIA 1H92A 1UJYA 2LMJA 2F5KA 4E7JA 1I1JA 3CCJA 3VKIA 1M9SA 2COWA 1WPYA 4FYWB 1G3TA 2MWPA 2LQKA 2X4JA 2XDPA 4M77A 4DQ2A 4BACA 1JJ2A 2COZA 3CPWP 5LJ5j 1VYTA 2HL5C 4OGEA 1QP2A 1PKTA 3S6WA 2CGHA 2YRDA 3CC2T 3G4SQ 3OB9A 3MKDA 2MAMA 3J81E 4RKUE 4KBMB 4MMLA 4PJOF 4OMLA 2LQWA 1SKUB 3REBB 2JNGA 4M77E 3VS3A 1OU8A 1LOJA 2I2LA 2GFUA 1JEGA 2M02A 5D6XA 5AYFA 2DYIA 5I2SA 4J7IA 5KE3A 3EHRA 3KFVA 2CZ0B 2NUTA 4F17A 5GMKm 4Z88A 2QGGA 5GAMd 3N5BB 2NLUA 5FWCA 3G1JA 3J80E 2LJ3A 1VQOA 4KGZB 4HCBA 3FC3A 2HQHA 1TWBA 2A28A 4F7UA 2PU9B 1TSFA 3QO3A 1LJOA 8ATCB 1OOTA 1KFZA 5CCAA 1IHVA 4JRIA 5DY9A 3URGA 1WFWA 3VS7A 3G71T 1YJ9A 4PJOC 5IHIA 4RTUA 1RLQC 1K1ZA 4F7UE 1Y7XA 2OTJT 3TCJA 1KC8R 3GOXA 3EFSA 2KMTA 4KGXB 3M9QA 4CRIA 3G7ZA 4RTTA 1UTIA 3ZBDA 1VQPA 3RERA 1ZBXA 3L2VA 2E3IA 2JOYA 1IRXA 4FT4A 2KDSA 1OU9A 1UHCA 2IPOB 1HJDA 2D1XA 2CP3A 2ECZA 2EGCA 2LDMA 2DRKA 5J39A 3S3OA 1NEBA 1Z9ZA 4M78F 3HL8A 3CCRA 3L2QA 2FZCB 4WTOB 4J6WA 1PRLC 2ENMA 3OSSC 3VRZA
chains in the Genus database with same CATH topology
2DNUA 1SSHA 2YUNA 2DX1A 1PWTA 2D0NA 2LP5A 4JZ4A 2CH4A 2CT4A 1WIEA 4K11A 4E6RA 2FRYA 3A98A 4OMQA 3RBBB 4JZ3A 1Y57A 2JS2A 4QT7A 2YUQA 2JM9A 2FPEA 2A08A 2KXCA 1ABQA 2CSQA 1MV0B 1LCKA 2GGRA 4F14A 1WLPB 2KRSA 2L0AA 2JM8A 2FPFA 1YWPA 2KRNA 3U23A 1M27C 1UGVA 1YP5A 2KT8A 2RQVA 1B3QA 4HVUA 3I5SA 2I0NA 3UATA 2JXBA 2D8HA 2MIOA 4GBQA 1NG2A 2DL3A 1SPKA 2NWMA 1GCPA 1TUDA 1UFFA 2J7IA 1U5SA 2LZ6B 2DYBA 2DA9A 2HEQA 2DRMA 4A63B 1JXOA 2JTEA 2JS0A 3VRYA 1U06A 4OMOA 1ABOA 2O2OA 3TSZA 1W1FA 3O5ZA 4RTWA 2HSPA 2LJ0A 2SRCA 2E5KA 2JMAA 2D8JA 2AZSA 3EG3A 1V1CA 2EQIA 1K0SA 1WI7A 2ROTA 3H0IA 4RTVA 1XOVA 2EGEA 2C0TA 3VS1A 2EBPA 2BTTA 2M51A 1T0JA 2J05A 2AKLA 3H0FA 1WDXA 4OMPA 3EG2A 4J9FA 1M30A 1VYUA 1ZUYA 5IHKA 2KBTA 3QWYA 2EYYA 1AOJA 4Z89A 1OEBA 2KR3A 2CT3A 4ZNXA 4AFSC 2DF6A 2KEAA 2DL8A 4J9EA 1GBRA 1T3SA 3TSWA 3ZL7C 1RI9A 2F2XA 2QDLA 4LUEA 2CUBA 3EHQA 2OAWA 1G83A 2JMCA 5GJVB 2IIMA 3ULRB 2AZVA 2GBQA 2PZ1A 4Y92A 4D8DA 1ZUKA 1FYNA 3IQLA 1X6GA 4ORZA 3SHWA 1WXBA 2A36A 2YT6A 1H8KA 4RUGA 3VS5A 2K3BA 2RNAA 2JW4A 4F16A 4FSSA 2EYWA 1QCFA 1QKXA 3RNJA 4JPBW 1JO8A 1YCSB 2BZXA 2KROA 3UF4A 3NHNA 1NLOC 2LQNA 3UA7A 4J9CA 1ZBJA 1M3BA 2DBMA 2K79A 2AKKA 2K9GA 1AWJA 3FJ5A 3LH5A 1JU5C 2F2VA 1OPLA 3QWXX 1E6HA 2V1RA 1HD3A 2F2WA 2KYBA 1BU1A 5ECAA 2PTKA 1GL5A 4AG2C 4JJCA 4J9HA 2VVKA 1GRIA 3PE0A 2RQWA 2BZ8A 4DEYA 2CREA 1SEMA 1E6GA 2J6OA 1AEYA 2ABLA 5IH2A 2YUPA 4LNPA 1BB9A 2VWFA 4RTYA 1TUCA 2A37A 2YSQA 1WXUA 3M0QA 2YUOA 5IHNA 2EVRA 2ROLA 1KJWA 1X2KA 3EG0A 4OMMA 4Z8AA 5FW9A 2ESWA 2XMFA 1OV3A 2KYMA 1M8MA 1CKAA 1U3OA 1RUWA 1EFNA 2HBWA 1JXMA 4CC4B 3C0CA 2DM1A 4AFUC 1GBQA 1B07A 1AWWA 1AD5A 3M0PA 1J3TA 3TVTA 1KSWA 2DL4A 1M3CA 2RQRA 4CC2A 1UECA 2CDTA 4CC7A 2O9SA 2AK5A 2DVJA 4X1VA 2RMOA 1QWEA 5GJWB 1K4US 1PRMC 2DJQA 1PKSA 4LN2A 2W0ZA 4IIOA 1FMKA 4ESRA 2GTOA 4HVWA 3I9QA 1AWXA 2FO0A 1K0XA 1UUEA 1VA7A 4DEXA 2DLPA 1G2BA 2X3XD 4KRTA 2K2MA 4AFQC 2EYXA 2EGAA 1I07A 3R6NA 2MCNA 1A0NB 4RTXA 2GTJA 3PVQA 1RLPC 3GBQA 1UE9A 2FPDA 1GFDA 2HCKA 1AZGB 2FEIA 2KXDA 2DL7A 4M4ZA 5IXBA 1SRLA 1N5ZA 4HXJA 1NYGA 2RF0A 2J06A 1WYXA 4LE9A 4GLMA 3I35A 3JV3A 4HCKA 3UA6A 2LX7A 3REAB 5I22A 1CKBA 1YN8A 1UJ0A 2C0IA 1SHFA 2J6FA 2VKNA 2J6KA 2OI3A 3M0SA 1ZX6A 4J9IA 1UHFA 3PVLA 1PHTA 1UG1A 2O31A 4AFZC 4R0KA 1BBZA 1X43A 2L3QA 1K76A 3VS4A 1QWFA 1ZSGA 2DL5A 3EGUA 1K9AA 1AVZC 2L2PA 4HVVA 4EIKA 1OPKA 1X2QA 2JT4A 1H92A 1UJYA 2LMJA 2BZYA 1WXTA 1WX6A 2GNCA 2HDAA 1I1JA 3H41A 1Y0MA 2B86A 3EG1A 2ED1A 2V1QA 1PNJA 3VS2A 1ARKA 4AG1C 2KRMA 2DE0X 3NMZC 3H0HA 1VYTA 2H8HA 2FG0A 4J9BA 1GFCA 5I11A 2W10A 4RTZA 1W70A 2G6FX 1PKTA 2KNBB 1UDLA 4JJBA 2FRWA 1ZLMA 4OMLA 1NEGA 2C0OA 2LQWA 3REBB 2ED0A 3VS3A 4IIMA 2P4RA 2KE9A 1YWOA 3NGPA 1JEGA 4CC3A 2OJ2A 3VS6A 3NPFA 2CUDA 3M0TA 1HSQA 3EHRA 3KFVA 1WA7A 4F17A 2KGTA 2EW3A 4Z88A 2K7AA 1X27A 4LUDA 2RQTA 5FWCA 4J9GA 3THKA 2GQIA 2X3WD 2LJ3A 2L3SA 2RPNA 1ZUUA 3M0RA 1YNZA 1X69A 3CQTA 1SRMA 2A28A 1H3HA 1Z9QA 4WCIA 1GCQA 2O9VA 2MOXA 2K6DA 2RN8A 1OOTA 1T0HA 5HCKA 1SHGA 2YDLA 1KFZA 1NLPC 5FWBA 1MV3A 3SEMA 5L23A 1MUZA 2O88A 1IO6A 1WFWA 3VS7A 5IXFA 2EPDA 1KIKA 5IHIA 1X6BA 4RTUA 2LJ1A 1T3LA 1RLQC 2DBKA 1K1ZA 1S1NA 1BK2A 4JJDA 2L3PA 2CSIA 2M0YA 1AZEA 1TG0A 1QLYA 3I5RA 1NYFA 2DMOA 4J9DA 4RTTA 1UTIA 2EKHA 2KT1A 2RQUA 4D8KA 1GCQC 2LNHB 1E7OA 3VS0A 1M3AA 2CH4W 2NUZA 1W6XA 1UHCA 2DILA 2EYZA 1AWOA 1HJDA 1JQQA 1NM7A 5EC7A 2D1XA 2EGCA 2ECZA 2DRKA 3VRZA 1NEBA 1Z9ZA 4OMNA 3M0UA 2SEMA 1PRLC 2ENMA 2PNIA 1CSKA 1QKWA 1I0CA 1VYVA 2LCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNU A;  1SSH A;  2YUN A;  2DX1 A;  1PWT A;  2D0N A;  2LP5 A;  4JZ4 A;  2CH4 A;  2CT4 A;  1WIE A;  4K11 A;  4E6R A;  2FRY A;  3A98 A;  4OMQ A;  3RBB B;  4JZ3 A;  1Y57 A;  2JS2 A;  4QT7 A;  2YUQ A;  2JM9 A;  2FPE A;  2A08 A;  2KXC A;  1ABQ A;  2CSQ A;  1MV0 B;  1LCK A;  2GGR A;  4F14 A;  1WLP B;  2KRS A;  2L0A A;  2JM8 A;  2FPF A;  1YWP A;  2KRN A;  3U23 A;  1M27 C;  1UGV A;  1YP5 A;  2KT8 A;  2RQV A;  1B3Q A;  4HVU A;  3I5S A;  2I0N A;  3UAT A;  2JXB A;  2D8H A;  2MIO A;  4GBQ A;  1NG2 A;  2DL3 A;  1SPK A;  2NWM A;  1GCP A;  1TUD A;  1UFF A;  2J7I A;  1U5S A;  2LZ6 B;  2DYB A;  2DA9 A;  2HEQ A;  2DRM A;  4A63 B;  1JXO A;  2JTE A;  2JS0 A;  3VRY A;  1U06 A;  4OMO A;  1ABO A;  2O2O A;  3TSZ A;  1W1F A;  3O5Z A;  4RTW A;  2HSP A;  2LJ0 A;  2SRC A;  2E5K A;  2JMA A;  2D8J A;  2AZS A;  3EG3 A;  1V1C A;  2EQI A;  1K0S A;  1WI7 A;  2ROT A;  3H0I A;  4RTV A;  1XOV A;  2EGE A;  2C0T A;  3VS1 A;  2EBP A;  2BTT A;  2M51 A;  1T0J A;  2J05 A;  2AKL A;  3H0F A;  1WDX A;  4OMP A;  3EG2 A;  4J9F A;  1M30 A;  1VYU A;  1ZUY A;  5IHK A;  2KBT A;  3QWY A;  2EYY A;  1AOJ A;  4Z89 A;  1OEB A;  2KR3 A;  2CT3 A;  4ZNX A;  4AFS C;  2DF6 A;  2KEA A;  2DL8 A;  4J9E A;  1GBR A;  1T3S A;  3TSW A;  3ZL7 C;  1RI9 A;  2F2X A;  2QDL A;  4LUE A;  2CUB A;  3EHQ A;  2OAW A;  1G83 A;  2JMC A;  5GJV B;  2IIM A;  3ULR B;  2AZV A;  2GBQ A;  2PZ1 A;  4Y92 A;  4D8D A;  1ZUK A;  1FYN A;  3IQL A;  1X6G A;  4ORZ A;  3SHW A;  1WXB A;  2A36 A;  2YT6 A;  1H8K A;  4RUG A;  3VS5 A;  2K3B A;  2RNA A;  2JW4 A;  4F16 A;  4FSS A;  2EYW A;  1QCF A;  1QKX A;  3RNJ A;  4JPB W;  1JO8 A;  1YCS B;  2BZX A;  2KRO A;  3UF4 A;  3NHN A;  1NLO C;  2LQN A;  3UA7 A;  4J9C A;  1ZBJ A;  1M3B A;  2DBM A;  2K79 A;  2AKK A;  2K9G A;  1AWJ A;  3FJ5 A;  3LH5 A;  1JU5 C;  2F2V A;  1OPL A;  3QWX X;  1E6H A;  2V1R A;  1HD3 A;  2F2W A;  2KYB A;  1BU1 A;  5ECA A;  2PTK A;  1GL5 A;  4AG2 C;  4JJC A;  4J9H A;  2VVK A;  1GRI A;  3PE0 A;  2RQW A;  2BZ8 A;  4DEY A;  2CRE A;  1SEM A;  1E6G A;  2J6O A;  1AEY A;  2ABL A;  5IH2 A;  2YUP A;  4LNP A;  1BB9 A;  2VWF A;  4RTY A;  1TUC A;  2A37 A;  2YSQ A;  1WXU A;  3M0Q A;  2YUO A;  5IHN A;  2EVR A;  2ROL A;  1KJW A;  1X2K A;  3EG0 A;  4OMM A;  4Z8A A;  5FW9 A;  2ESW A;  2XMF A;  1OV3 A;  2KYM A;  1M8M A;  1CKA A;  1U3O A;  1RUW A;  1EFN A;  2HBW A;  1JXM A;  4CC4 B;  3C0C A;  2DM1 A;  4AFU C;  1GBQ A;  1B07 A;  1AWW A;  1AD5 A;  3M0P A;  1J3T A;  3TVT A;  1KSW A;  2DL4 A;  1M3C A;  2RQR A;  4CC2 A;  1UEC A;  2CDT A;  4CC7 A;  2O9S A;  2AK5 A;  2DVJ A;  4X1V A;  2RMO A;  1QWE A;  5GJW B;  1K4U S;  1PRM C;  2DJQ A;  1PKS A;  4LN2 A;  2W0Z A;  4IIO A;  1FMK A;  4ESR A;  2GTO A;  4HVW A;  3I9Q A;  1AWX A;  2FO0 A;  1K0X A;  1UUE A;  1VA7 A;  4DEX A;  2DLP A;  1G2B A;  2X3X D;  4KRT A;  2K2M A;  4AFQ C;  2EYX A;  2EGA A;  1I07 A;  3R6N A;  2MCN A;  1A0N B;  4RTX A;  2GTJ A;  3PVQ A;  1RLP C;  3GBQ A;  1UE9 A;  2FPD A;  1GFD A;  2HCK A;  1AZG B;  2FEI A;  2KXD A;  2DL7 A;  4M4Z A;  5IXB A;  1SRL A;  1N5Z A;  4HXJ A;  1NYG A;  2RF0 A;  2J06 A;  1WYX A;  4LE9 A;  4GLM A;  3I35 A;  3JV3 A;  4HCK A;  3UA6 A;  2LX7 A;  3REA B;  5I22 A;  1CKB A;  1YN8 A;  1UJ0 A;  2C0I A;  1SHF A;  2J6F A;  2VKN A;  2J6K A;  2OI3 A;  3M0S A;  1ZX6 A;  4J9I A;  1UHF A;  3PVL A;  1PHT A;  1UG1 A;  2O31 A;  4AFZ C;  4R0K A;  1BBZ A;  1X43 A;  2L3Q A;  1K76 A;  3VS4 A;  1QWF A;  1ZSG A;  2DL5 A;  3EGU A;  1K9A A;  1AVZ C;  2L2P A;  4HVV A;  4EIK A;  1OPK A;  1X2Q A;  2JT4 A;  1H92 A;  1UJY A;  2LMJ A;  2BZY A;  1WXT A;  1WX6 A;  2GNC A;  2HDA A;  1I1J A;  3H41 A;  1Y0M A;  2B86 A;  3EG1 A;  2ED1 A;  2V1Q A;  1PNJ A;  3VS2 A;  1ARK A;  4AG1 C;  2KRM A;  2DE0 X;  3NMZ C;  3H0H A;  1VYT A;  2H8H A;  2FG0 A;  4J9B A;  1GFC A;  5I11 A;  2W10 A;  4RTZ A;  1W70 A;  2G6F X;  1PKT A;  2KNB B;  1UDL A;  4JJB A;  2FRW A;  1ZLM A;  4OML A;  1NEG A;  2C0O A;  2LQW A;  3REB B;  2ED0 A;  3VS3 A;  4IIM A;  2P4R A;  2KE9 A;  1YWO A;  3NGP A;  1JEG A;  4CC3 A;  2OJ2 A;  3VS6 A;  3NPF A;  2CUD A;  3M0T A;  1HSQ A;  3EHR A;  3KFV A;  1WA7 A;  4F17 A;  2KGT A;  2EW3 A;  4Z88 A;  2K7A A;  1X27 A;  4LUD A;  2RQT A;  5FWC A;  4J9G A;  3THK A;  2GQI A;  2X3W D;  2LJ3 A;  2L3S A;  2RPN A;  1ZUU A;  3M0R A;  1YNZ A;  1X69 A;  3CQT A;  1SRM A;  2A28 A;  1H3H A;  1Z9Q A;  4WCI A;  1GCQ A;  2O9V A;  2MOX A;  2K6D A;  2RN8 A;  1OOT A;  1T0H A;  5HCK A;  1SHG A;  2YDL A;  1KFZ A;  1NLP C;  5FWB A;  1MV3 A;  3SEM A;  5L23 A;  1MUZ A;  2O88 A;  1IO6 A;  1WFW A;  3VS7 A;  5IXF A;  2EPD A;  1KIK A;  5IHI A;  1X6B A;  4RTU A;  2LJ1 A;  1T3L A;  1RLQ C;  2DBK A;  1K1Z A;  1S1N A;  1BK2 A;  4JJD A;  2L3P A;  2CSI A;  2M0Y A;  1AZE A;  1TG0 A;  1QLY A;  3I5R A;  1NYF A;  2DMO A;  4J9D A;  4RTT A;  1UTI A;  2EKH A;  2KT1 A;  2RQU A;  4D8K A;  1GCQ C;  2LNH B;  1E7O A;  3VS0 A;  1M3A A;  2CH4 W;  2NUZ A;  1W6X A;  1UHC A;  2DIL A;  2EYZ A;  1AWO A;  1HJD A;  1JQQ A;  1NM7 A;  5EC7 A;  2D1X A;  2EGC A;  2ECZ A;  2DRK A;  3VRZ A;  1NEB A;  1Z9Z A;  4OMN A;  3M0U A;  2SEM A;  1PRL C;  2ENM A;  2PNI A;  1CSK A;  1QKW A;  1I0C A;  1VYV A;  2LCS A; 
#chains in the Genus database with same CATH topology
 3A8H B;  4C0F A;  1YJN Q;  4M77 G;  2YUN A;  2CH4 A;  4OMQ A;  3CCR Q;  2K5I A;  3I56 A;  4QT7 A;  4WF2 A;  4LXC A;  2CSQ A;  1LCK A;  4P5N A;  2GGR A;  3CCS T;  2DAQ A;  3CCE Q;  3JB9 I;  2YRC A;  5CQX A;  3EGD B;  1M1F A;  2X4Y A;  1YCY A;  4E2F B;  3LGF A;  2KRN A;  1M27 C;  3EGX A;  2KT8 A;  2QA4 Q;  1B3Q A;  3I5S A;  4V2S A;  4E7K A;  1Q7Y R;  2I0N A;  1KQ1 A;  4GBQ A;  2XID A;  1NG2 A;  5CKE A;  4JS4 A;  1Y71 A;  2DER A;  1BCO A;  2DA9 A;  3VRY A;  4C92 B;  1WJS A;  4OMO A;  3CC4 T;  2O2O A;  3TSZ A;  1B34 A;  1W1F A;  4F7U G;  3O5Z A;  2E5K A;  3EG3 A;  2AZS A;  4LDU A;  3CCL A;  1KC8 C;  3J7A F;  4F7U F;  2QQS A;  3OS5 A;  2EQK A;  1XOV A;  2MI6 A;  2LVM A;  2YXY A;  2BTT A;  1YI2 A;  2EIF A;  4HT8 A;  4XTW A;  3CCL Q;  1XTD A;  3G6E T;  1M30 A;  1VYU A;  2RI2 A;  5FLX E;  2DK3 A;  1ZUY A;  1KC8 U;  4ELY C;  4OP0 A;  2LTO A;  4N4G A;  4BI3 A;  1OEB A;  1LNX A;  1VQL Q;  3PIP A;  4XQ3 A;  2KI7 A;  4AFS C;  1EZZ B;  1YFN A;  3JCM P;  3TSW A;  2Y90 A;  4C5H A;  3ZL7 C;  1WZO A;  2EFI A;  2PVO B;  2QDL A;  4XU1 A;  5IN1 A;  4BY6 B;  2XDD A;  1N27 A;  3MEV A;  1RL2 A;  1G83 A;  4M75 D;  3VJP A;  3CME A;  5GJV B;  2V8I A;  2E64 A;  2XK0 A;  4BY6 C;  3TQ7 P;  3G4S T;  5KYN A;  3LX7 A;  5LJ3 e;  3CME Q;  4RUG A;  1OQK A;  2JW4 A;  4HCC A;  2RHY A;  2EYW A;  3OYC A;  3WVE B;  3EG9 A;  4J9C A;  2DBM A;  1M3B A;  2DPP B;  4EDU A;  4IUV A;  1AWJ A;  4X34 A;  3SFM A;  1Q7Y C;  1JU5 C;  2F2V A;  4QKU A;  1WHM A;  3ZFJ A;  2CZ7 B;  2V1R A;  3GIB A;  3MHX A;  3MP6 A;  1M2V B;  1VQ5 A;  3T9N A;  4AG2 C;  3O8V A;  1QVF P;  4MDX A;  2RO0 A;  1YBY A;  1Q7Y U;  2RQW A;  4N0A A;  2G3R A;  2RD1 A;  1M5Q 1;  1SEM A;  2YUP A;  2RJE A;  2A0F B;  4LNP A;  1BB9 A;  2E1H A;  2GF7 A;  3TU4 K;  4KH1 B;  3LH0 A;  2A37 A;  4DBR A;  1WXU A;  3M0Q A;  3QYH B;  1OYX A;  1KQS P;  1KJW A;  5KCH A;  1VQ7 Q;  2VGN A;  2ESW A;  2Y4Y A;  2FZG B;  2MF2 A;  1EFN A;  1D1B A;  4CC4 B;  4J6Y A;  3A8M B;  5GAN e;  2XKO C;  1WHL A;  2E65 A;  4IUP A;  1C0M A;  4C92 D;  2DIG A;  1AD5 A;  1J3T A;  1FXX A;  1IGU A;  4CC7 A;  3EAE A;  3RIR A;  4N4H A;  3CD6 Q;  5GJW B;  4Y28 E;  2CZ1 B;  4BE0 A;  4OVA A;  3OA6 A;  4ZGJ B;  3CC2 A;  1IRE B;  1Q86 R;  2PQW A;  2GTO A;  3I9Q A;  2FO0 A;  3AHU A;  1V76 A;  1UUE A;  1VA7 A;  2XD0 A;  2ZPG B;  5GAM g;  1I07 A;  1TOV A;  3R6N A;  2RB6 A;  1UGR B;  2XI9 A;  2F5T X;  6AT1 B;  3RKW A;  4FSX A;  1UE9 A;  3OYA A;  1AZG B;  4XAX B;  2FEI A;  2KXD A;  2DL7 A;  3CCR T;  1NYG A;  3X25 B;  4FT2 A;  4A4H A;  2K3X A;  3KBG A;  1WYX A;  2V8K A;  1JJ2 S;  3TRE A;  2DXC A;  4KUD K;  3JV3 A;  3CCE T;  4HCK A;  1BI1 A;  1SF9 A;  2LX7 A;  2RH2 A;  1UJ0 A;  5C0M A;  1ACM B;  2QA4 T;  3C95 A;  4CI0 C;  2J6K A;  3M0S A;  3C4S A;  4J9I A;  3OYE A;  3ER0 A;  5LJ5 g;  4E47 A;  5KCO A;  1UG1 A;  2YLC A;  2CP5 A;  2Y4X A;  5L8R E;  2L3Q A;  3LLR A;  3G71 A;  3VS4 A;  3OY9 A;  1QWF A;  2ZPI B;  2E6N A;  2ZPE B;  3EGU A;  1K9A A;  4ZGE B;  2MYS A;  1AVZ C;  3OYK A;  2L2P A;  4NL2 A;  1TS9 A;  4HVV A;  4EIK A;  3CC7 A;  4RG8 A;  3OW2 P;  3JB9 H;  3RMQ A;  2E10 A;  4C8Q F;  2GNC A;  3RUX A;  3CCQ Q;  2HD0 A;  3SWN B;  2FHD A;  3CC7 Q;  4DOV A;  4OB0 B;  3SWN C;  2KRM A;  3HKS A;  2YRV A;  1M1K R;  3CCL T;  2FG0 A;  1ZSZ A;  1VQ9 Q;  2W10 A;  4RTZ A;  2G6F X;  3QZ5 B;  2KNB B;  1Q86 C;  1UDL A;  4OF1 A;  4L59 A;  2MK5 A;  1VQL T;  1NEG A;  3OYB A;  4A53 A;  4XU3 A;  2CP2 A;  3CXC P;  1BI0 A;  1WNL A;  2E5Q A;  1YWO A;  1Q86 U;  5CKB A;  2DEU A;  3HFO A;  1PSE A;  3GF5 A;  1WA7 A;  4PFO A;  3CCS A;  4PNO A;  1MHN A;  2OTL A;  3L2W A;  2QGF B;  2K7A A;  4C8Q B;  3CME T;  3V8J A;  4M7A D;  2OAU A;  1D1A A;  4C5G A;  3CBP A;  4C8Q C;  1G8X A;  1YNZ A;  1O75 A;  1SRM A;  2R58 A;  3M57 A;  4M75 A;  1H3H A;  2LC4 A;  1Z9Q A;  5DLO A;  1I5O B;  1YIT Q;  2AIR B;  4WCI A;  3JSC A;  3QBY A;  1T0H A;  4II1 A;  5HCK A;  1SHG A;  2YDL A;  1NLP C;  5FWB A;  4MZT A;  3ZEH A;  5L23 A;  1MUZ A;  4M7D D;  1KIK A;  1WHG A;  4L5G A;  2LJ1 A;  3H6Z A;  1T3L A;  3JCM W;  1S1N A;  4M75 E;  4PL6 A;  3F70 A;  1VQ5 T;  1AZE A;  2WAC A;  5GAM j;  1M2O A;  2JN0 A;  3V7R A;  2DMO A;  3A8L B;  2QTV A;  2XU8 A;  1BI2 A;  1W2B A;  4D8K A;  1PC0 A;  3G6E A;  1JBM A;  1GCQ C;  1VQ7 T;  3L2R A;  1I81 A;  2LNH B;  2JJ9 A;  1M1K C;  1M3A A;  2A7Y A;  1UGS B;  2DIL A;  1AWO A;  3OS1 A;  1MMN A;  1JQQ A;  4LD9 K;  3QSU A;  4OB3 B;  1QVG A;  1KHI A;  3EGD A;  2HAX A;  3M0U A;  2PNI A;  1WJR A;  5GAM h;  1QKW A;  2GQV A;  4NL3 A;  2VXF A;  3FIF A;  1M1K U;  4ATO A;  1VQM Q;  3CD6 T;  4B9X A;  1QCO A;  1VQK Q;  2VXE A;  4JZ3 A;  1Y57 A;  3G4S A;  2JS2 A;  2RI3 A;  3OS2 A;  2JM9 A;  2FPE A;  1ABQ A;  2L89 A;  1MV0 B;  5KYX A;  3JCM g;  4R56 A;  4F14 A;  1UEB A;  3QXE B;  3ME9 A;  4ME7 A;  2KRS A;  1Q82 R;  2PVG B;  2IVW A;  4C92 A;  2FPF A;  4BI4 A;  5GAN d;  1YP5 A;  1UGV A;  2RQV A;  2MMP A;  3OYL A;  3DB3 A;  4EMH A;  3RKY A;  2COY A;  4FW2 A;  2D0Q B;  2JXB A;  2D8H A;  2DL3 A;  2RK1 A;  5LJ3 f;  1SPK A;  5LJ5 h;  1UFF A;  3HRU A;  2ATC B;  2MWO A;  1OZ2 A;  4C92 E;  2PUK B;  3GPL A;  2LT4 A;  2HEQ A;  2LCL A;  1FMW A;  1U06 A;  1LPL A;  4PFP A;  4AT1 B;  1ABO A;  5GAN 3;  4OMF B;  2KK4 A;  4M75 G;  2E12 A;  4PLI A;  2SRC A;  2LNV A;  2D8J A;  1V1C A;  2EQI A;  2NYS A;  1YHQ Q;  2KAF A;  3H0I A;  3JB9 D;  2A3L A;  4XK8 E;  3OBY A;  2CYZ B;  4IUU A;  3V7C A;  4QVZ A;  4PJO B;  5IHK A;  5GMK j;  2F69 A;  2EYY A;  2EAY A;  1AOJ A;  3E1S A;  3QZ9 B;  3M4Y A;  1RAH B;  3CCQ T;  1RAA B;  3CC7 T;  2DF6 A;  4FYY B;  3EHQ A;  2OAW A;  1VQ6 Q;  3BY7 A;  1QMC A;  2IIM A;  2HKQ B;  2RHI A;  3JCM V;  3ULR B;  3UWN A;  1G3S A;  1VQ9 T;  4D8D A;  2QXF A;  4GY5 A;  5GAN f;  4E7L A;  1WXB A;  1M2V A;  2YT6 A;  3EH2 A;  2QQ9 A;  1YJW Q;  1D09 B;  2K3B A;  1YJN A;  4O6J A;  2QQA A;  1ZQ1 A;  1Q82 C;  4PJN A;  1YCS B;  1AT1 B;  3UF4 A;  3NHN A;  1NLO C;  2LQN A;  2EQJ A;  2K5L A;  2QQB A;  4A54 A;  2X4X A;  1BYM A;  2DZC A;  1N9S A;  2AKK A;  5DM7 R;  3FJ5 A;  1Y07 A;  2RM4 A;  1S72 Q;  1JB0 E;  4M77 F;  4J5Y A;  3QWX X;  3CCE A;  1Q82 U;  1VOM A;  1G5V A;  5FRO A;  2QG9 B;  3OYM A;  4LDY A;  4C92 G;  2VB6 A;  1BU1 A;  2DTH A;  3MEW A;  1WHJ A;  3OYG A;  3LWH A;  2QA4 A;  2P4T A;  2OTL T;  4J9H A;  1OI1 A;  1W4S A;  3QHS A;  5IH2 A;  4E7Z A;  1TTH B;  5D6Y A;  4C5I A;  2QK0 A;  1DJ7 B;  1PCX A;  1HK9 A;  2VWF A;  1RAI B;  2OX7 A;  2YUO A;  5IHN A;  4M7A A;  2BE7 D;  3UT1 A;  1X2K A;  3EG0 A;  4Z8A A;  2L8D A;  5D6W A;  2VUB A;  2FZK B;  2BKD N;  4M78 B;  2KYM A;  1CKA A;  1G3W A;  2VC8 A;  1RUW A;  3PT9 A;  1K9M R;  1JXM A;  4KT0 E;  4M78 C;  4EMG A;  3H8Z A;  1B07 A;  3MO8 A;  2CZ6 B;  1I5L A;  3OS0 A;  1M3C A;  4M7A E;  1P92 A;  2DJQ A;  1PKS A;  1VQ8 Q;  4ESR A;  4DOW A;  4M7D A;  4HVW A;  1FX7 A;  1VQL A;  1AWX A;  1K0X A;  2O4X B;  4DEX A;  2K2M A;  3OSV A;  4PJO D;  2EGA A;  3JCM h;  4JJN K;  1IHW A;  1A0N B;  1QQJ A;  2LX9 A;  1VQM T;  3GBQ A;  3CPF A;  1VQK T;  3M56 A;  1GFD A;  3L2U A;  5IXB A;  4M7D E;  1X75 C;  1Q95 G;  4J6X A;  4JUV A;  2J06 A;  4EPC A;  5DLQ E;  1X6O A;  4QQD A;  5GMK i;  4OB1 B;  5FRN A;  1BI3 A;  2P0Q A;  1H64 1;  2BUD A;  2QQR A;  2IG0 A;  2H3E B;  4F7U B;  2VKN A;  2ZGW A;  2EWN A;  4JDS A;  2B8A A;  5IT9 E;  3P8B B;  1BBZ A;  1F1B B;  1IXD A;  4IUQ A;  3LW5 E;  1TXQ A;  1M1G A;  1OPK A;  2JT4 A;  2YLB A;  1WXT A;  1WX6 A;  2EJF A;  4ZN1 A;  2C06 A;  1VQN Q;  4E7H A;  1K9M C;  2HDA A;  1WHH A;  3H41 A;  4AMC A;  4BDY A;  4JLG A;  3EG1 A;  2KY9 A;  3A8G B;  1UB4 A;  1UGP B;  2V1Q A;  3VS2 A;  4KH0 B;  2RHZ A;  3A5Z B;  1ARK A;  1VQ7 A;  1LVK A;  3NTH A;  2DE0 X;  4M7A G;  3NMZ C;  4BUG A;  3BFM A;  2H8H A;  1K9M U;  4J9B A;  1GFC A;  4HKE A;  1JRI A;  3A1P A;  3JRZ A;  1ZLM A;  4FYX B;  3S3N A;  2C0O A;  4M78 D;  2E70 A;  4J83 A;  4BI8 B;  3CD6 A;  2KE9 A;  2M16 A;  3HTR A;  4MZP A;  4JRP A;  1VQ6 T;  1TUG B;  1Y96 B;  2DZ9 A;  4CC3 A;  2JVV A;  4M7D G;  3NPF A;  1HSQ A;  4FM4 B;  1W2B S;  2KGT A;  4RMO A;  2EW3 A;  1MND A;  1YJW T;  1WQ7 A;  2RQT A;  2V8J A;  2JUF A;  3MCA B;  3X26 B;  2NUP B;  2L3S A;  3EFO B;  2RPN A;  3M0R A;  1QVG S;  1X69 A;  1RI0 A;  1YJN T;  2LT1 A;  5C6S A;  2FYK A;  1S72 T;  1GCQ A;  2O9V A;  3EFR A;  5GAM e;  2RN8 A;  4PKC C;  1KK7 A;  4C0G A;  2X51 A;  3SEM A;  2O88 A;  3M55 A;  2EPD A;  1B34 B;  3C12 A;  5KE2 A;  1VQ4 Q;  4A4F A;  1H3Z A;  2DBK A;  5KYY B;  1PM3 A;  2L3P A;  2CSI A;  2M0Y A;  2HMA A;  1EX4 A;  4NS5 A;  3MET A;  1QCN A;  1NYF A;  2K57 A;  4FU6 A;  4OGC A;  1QVP A;  2EKH A;  2EJ9 A;  2RQU A;  3JB9 J;  4XU0 A;  4YTL A;  1W6X A;  3MEA A;  5CQY A;  3DLL A;  1KD1 R;  3CCQ A;  3JCM Q;  1NM7 A;  5EC7 A;  5LJ5 e;  4E7I A;  2E3H A;  4Q5W A;  1XNI A;  4RCB A;  2SEM A;  2M1H A;  5HK3 A;  1VYV A;  2LCS A;  1JJ2 P;  1R77 A;  2DX1 A;  1PWT A;  2D0N A;  4JZ4 A;  1RAB B;  1WIE A;  3KXT A;  4LDV A;  4E6R A;  1VQ9 A;  1FMV A;  3E9G A;  2RJC A;  3RBB B;  3CXC S;  1VQ8 T;  2DET A;  3SDZ A;  2YUQ A;  5IAY A;  5GAO m;  2A08 A;  2KXC A;  3GLX A;  4XTZ A;  4FYV B;  1WLP B;  2XHC A;  2L0A A;  2KQW A;  3X20 B;  3X28 B;  4BE1 A;  2K3Y A;  4XTU A;  3JB9 G;  3U23 A;  2CP6 A;  2P84 A;  3CCU A;  4HVU A;  2VAS A;  3TEE A;  4LDX A;  1QVF A;  2RJD A;  3CCV Q;  4A4K A;  4RG2 A;  3UAT A;  3RKX A;  2MIO A;  2X35 A;  2NWM A;  3CCU Q;  2HL3 A;  1GCP A;  2J7I A;  2LZ6 B;  3MP1 A;  4ZGD B;  1QP3 A;  4PJO A;  5I2M A;  1WQW A;  1JXO A;  2JS0 A;  3P8D A;  2E6Z A;  2KVQ G;  3RES A;  1YIT A;  3OYJ A;  2HSP A;  2CP7 A;  2ZCF B;  2LJ0 A;  1YIJ Q;  1PSF A;  1MNE A;  3VYH B;  2H3J A;  4JRQ A;  1BIA A;  1WI7 A;  1C6V X;  2ROT A;  1RAD B;  4RTV A;  3VS1 A;  2EGE A;  2EBP A;  3CMA Q;  4PJO E;  1T0J A;  2J05 A;  2AKL A;  3H0F A;  4OMP A;  3C94 A;  3JAM E;  3EG2 A;  5J26 A;  1D3B B;  2KSS A;  3QJY A;  2CKK A;  3V8K A;  3HSB A;  3QKJ A;  2KBT A;  1VQN T;  4Z89 A;  4PK4 A;  1KD1 C;  2KR3 A;  1B7T A;  4ZNX A;  5LJ3 d;  3HPW A;  1RAE B;  4J9E A;  3OYI A;  1T3S A;  4PJL A;  3I55 Q;  1RI9 A;  2F2X A;  2CUB A;  1VUB A;  3PTA A;  4HA8 A;  1KD1 U;  2AZV A;  2GBQ A;  4Y92 A;  3INZ A;  1ZUK A;  1FYN A;  2LCC A;  3E9F A;  3IQL A;  3SHW A;  2PVD B;  3RMS A;  5GAO l;  3BDL A;  2K2V A;  1H8K A;  4HCZ A;  1MGQ A;  2RNA A;  3CPW S;  1VQM A;  4F16 A;  4PLL A;  3HRS A;  1QCF A;  3RNJ A;  2X9H A;  1VQK A;  1JO8 A;  2BZX A;  2KRO A;  3LWI A;  4DBQ A;  2HQE A;  2K79 A;  4C0D B;  3WVD B;  2K9G A;  3GNF B;  4IUR A;  4FCY A;  3S3M A;  4C0D C;  2VGM A;  1OPL A;  4RCC A;  5M9O A;  3RDV A;  1E6H A;  4R55 A;  3BW1 A;  1BCM A;  2F2W A;  4O5V A;  4M78 A;  5ECA A;  1GL5 A;  1N6A A;  3PE0 A;  4DEY A;  2CRE A;  4ZN3 A;  1E6G A;  2J6O A;  3OW2 A;  4PFZ A;  5CO7 A;  4IUT A;  3JCM e;  4LDW A;  5CR2 A;  2EQU A;  3CCJ Q;  1TUC A;  2YSQ A;  4M78 E;  4PJO G;  2EVR A;  2ROL A;  3NTI A;  5FW9 A;  4OMM A;  2BE9 B;  3L42 A;  2XMF A;  4C5E A;  1VQ4 T;  1OV3 A;  1U3O A;  2O4X A;  2EQM A;  3PMI A;  2VYT A;  3C0C A;  2AHJ B;  4C8Q D;  1YHQ A;  4KGV B;  1VIE A;  1GBQ A;  1U1T A;  3MJX A;  1AWW A;  3SD4 A;  4GLK A;  4QVC A;  4CC2 A;  1UEC A;  2CDT A;  2O9S A;  2DVJ A;  4X1V A;  2RMO A;  4M75 F;  1QWE A;  3CXC A;  1K4U S;  3M53 A;  2EJG A;  1ZSZ B;  3H9N A;  1WHK A;  4EMK B;  1ZSZ C;  4X9C A;  1O9S A;  4PJJ A;  3M54 A;  3PMT A;  2DLP A;  4EMK C;  4DBH A;  1G2B A;  2X3X D;  4KRT A;  4MMK A;  4AFQ C;  3OYN A;  4L6V 5;  2RA2 A;  1AHJ B;  1KHC A;  5CKF A;  2DVE A;  1VQ6 A;  3QII A;  2E41 A;  2GTJ A;  3PVQ A;  2FPD A;  4DA4 A;  4HT9 A;  4M4Z A;  1VQO Q;  2EYQ A;  1Q81 R;  2RF0 A;  2O01 E;  3GNG A;  1YJW A;  3VYG A;  1G3Y A;  3FLG A;  3PNW C;  5I22 A;  1YN8 A;  2XG8 D;  5GMK h;  2RJF A;  2C0I A;  3MPU B;  3CCM A;  4FL6 A;  1SHF A;  3WXM B;  5LJ5 d;  2J6F A;  4M75 B;  1YJ9 Q;  2X4W A;  4X9D A;  2AT1 B;  2YWW A;  1S72 A;  1ZX6 A;  3FDR A;  3CCV T;  4M75 C;  1UHF A;  4BDZ A;  1PHT A;  4AFZ C;  4R0K A;  4XTV A;  3CCM Q;  3PFS A;  3CCU T;  1K76 A;  2HSE B;  3M59 A;  2ZAE A;  4M78 G;  1ZSG A;  2DL5 A;  1VQP Q;  5GAO r;  1K73 R;  1R0B G;  3AT1 B;  1PG5 B;  5FU6 B;  1X2Q A;  2WSF E;  2BZY A;  1TU0 B;  5FU6 C;  3QDF A;  4J8O A;  5KYU B;  1YIJ T;  5HKC A;  1Y0M A;  2B86 A;  3QJ6 A;  4C92 F;  5GAM f;  2ED1 A;  1K8A R;  5KYW B;  1PNJ A;  1YIT T;  2K4Y A;  4XU2 A;  3CMA T;  4AG1 C;  1BIB A;  1PD1 A;  1OUL A;  3PIO A;  1Y96 A;  3H0H A;  2D6F A;  1MMG A;  5GMK l;  2VV5 A;  2R5A A;  5I11 A;  2PUO B;  1W70 A;  3Q1J A;  4XTX A;  3I56 Q;  4JJB A;  7AT1 B;  2FRW A;  2FVU A;  3CPW A;  5CIU A;  1NJI R;  3BDU A;  2P0P A;  2NUP A;  1SSF A;  3VUB A;  1U1S A;  2MPX C;  2ED0 A;  3EFO A;  4IIM A;  2P4R A;  3I55 T;  5LL6 S;  1D0Z A;  4KUL A;  3NGP A;  1VQ8 A;  3DLM A;  4M77 B;  3VU3 C;  3CBM A;  2OJ2 A;  3VS6 A;  2CUD A;  2K5F A;  1N9R A;  4OB2 B;  3M0T A;  4LD6 A;  4M77 C;  5KYX B;  5A0D A;  1U8R A;  1Q81 C;  3QDR B;  5LJ5 f;  4JS5 A;  1RAF B;  5D7U A;  1X27 A;  4J7F A;  4LUD A;  2DTO A;  3HRT A;  3L2Z A;  4J9G A;  3OYD A;  3THK A;  2GQI A;  4ELZ C;  2X3W D;  5KYY A;  4C92 C;  4NOY A;  1ZUU A;  2QTX A;  1Q81 U;  4ZTF A;  3CQT A;  5GAN 6;  1D0Y A;  4IKF A;  3R6O A;  3OMG A;  2QDY B;  3HHT B;  2RHU A;  5GAO p;  5CVI A;  1C1A A;  2MOX A;  2K6D A;  3OQ5 A;  2NUT B;  3V7S A;  1MV3 A;  3MP8 A;  1IO6 A;  5IXF A;  2QAS A;  1YI2 Q;  1X6B A;  2EKO A;  2LQ8 A;  1K73 C;  2DTI A;  1BK2 A;  5GAN 5;  4JJD A;  5GAN 7;  1TG0 A;  1QLY A;  5LJ3 g;  2DD4 A;  3I5R A;  3CCJ T;  5GAN 4;  5GAO q;  4J9D A;  3SWN A;  1K8A C;  2KT1 A;  1NE8 A;  1QVF S;  4ZTJ A;  3PGG A;  1K73 U;  4B6M A;  3DB4 A;  5GAO n;  9ATC B;  1I4K 1;  1E7O A;  3VS0 A;  1ZA1 B;  2DKG A;  1VQN A;  4DBF A;  2CH4 W;  2NUZ A;  2HZY A;  3P8H A;  2EYZ A;  2XIC A;  4PJM A;  1OX8 A;  1K8A U;  3MEU A;  1RAC B;  1HYO A;  2FL7 A;  2DXU A;  4OMN A;  1KQS S;  1NJI C;  1CSK A;  1R0C B;  1I0C A;  2DNU A;  1SSH A;  2D9T A;  2LP5 A;  2CT4 A;  4XTY A;  4K11 A;  1YHQ T;  1VIF A;  2FRY A;  3A98 A;  1UGQ B;  5J3B A;  3HFN A;  3JCM d;  3GP8 A;  1NJI U;  2QI2 A;  2Z0W A;  1XQH A;  4M7A F;  2RK2 A;  4C8Q A;  4TVR A;  2FB7 A;  2JM8 A;  1N8R R;  1VQ5 Q;  1YWP A;  1I8F A;  2DJZ A;  2DXT A;  2QEX A;  1VQO T;  1GXI E;  2YHT A;  5GAN g;  5A2Q E;  5EG2 A;  3HP9 A;  2JTM A;  2LRQ A;  4M77 D;  2L3R A;  8AT1 B;  3QUI A;  4C8Q E;  2QEX Q;  3X24 B;  1TUD A;  2ZPH B;  4QQ6 A;  3D7S B;  1U5S A;  2DYB A;  2HBP A;  3A8O B;  2WSE E;  4M7D F;  1D3B A;  2R57 A;  2DRM A;  4A63 B;  2JTE A;  3E2U A;  4N4I A;  4QQG A;  1YJ9 T;  4BB7 A;  3KUF A;  2RHX A;  2DIQ A;  5A0G A;  3EGX B;  4MDW A;  1NPP A;  4RTW A;  2JMA A;  1BKB A;  1D1C A;  3RR6 A;  1K0S A;  2L5Q A;  3CCM T;  2C0T A;  1MMD A;  4M7A B;  2P0K A;  2M51 A;  2M0O A;  4B9W A;  1WDX A;  2E4H A;  1VQP T;  2CP0 A;  1VQ4 A;  3VUZ A;  4M7A C;  4J9F A;  3M5A A;  5CK9 A;  1KQ2 A;  3CC2 Q;  3QWY A;  4QVD A;  2CT3 A;  5AT1 B;  3JCM f;  2V26 A;  1W2B P;  2KEA A;  1ZA2 B;  2DL8 A;  3QG1 A;  4KUI A;  1GBR A;  2JTF A;  4LUE A;  3OW2 S;  3UPU A;  2JMC A;  4M7D B;  2PZ1 A;  1X6G A;  4ORZ A;  2DO3 A;  3I56 T;  1QVG P;  4M7D C;  5CKD A;  2A36 A;  4C0Z A;  5HY6 A;  5A0L A;  3VS5 A;  1V29 B;  4JRK A;  4QW2 A;  4FSS A;  2DXB A;  1QKX A;  1M90 R;  2CS7 A;  4JPB W;  1NPR A;  1OX9 A;  3UA7 A;  1N8R C;  1ZBJ A;  1FWZ A;  4D6W A;  3NTK A;  3LH5 A;  3FEO A;  1IGQ A;  3FRN A;  5LJ3 j;  1R8O B;  3ASK A;  1HD3 A;  4C8Q G;  2KYB A;  2OTJ A;  1N8R U;  1WGS A;  2PTK A;  1NZ9 A;  3M4G A;  3G71 Q;  4JJC A;  3FJP A;  4Y91 A;  3L1A A;  2VVK A;  1GRI A;  3EH1 A;  4BE2 A;  2BZ8 A;  3EG9 B;  3NFC A;  2HNI A;  3CCV A;  2OTJ Q;  1AEY A;  2ABL A;  3V8L A;  1IB8 A;  3CBO A;  2WSC E;  5CAI A;  1WJQ A;  1SG5 A;  4RTY A;  5HK0 A;  3JB9 F;  5LJ3 h;  3FB9 A;  1D0X A;  2ZPF B;  2GFA A;  1YI2 T;  4EMK A;  1X01 A;  5KH6 A;  4E7S A;  3JCM J;  1M8M A;  2HKN A;  4A4E A;  1YIJ A;  2HBW A;  1OZ3 A;  4FIB A;  2DM1 A;  2DEQ A;  1KQS A;  4AFU C;  4FW1 A;  3CMA A;  3M0P A;  4N0A C;  4MZM A;  3TVT A;  1HXD A;  3UDC A;  1KSW A;  5GMK e;  2DL4 A;  2RQR A;  2AK5 A;  3JCM X;  3QPH A;  1PRM C;  1TH7 A;  1RAG B;  4LN2 A;  2W0Z A;  4IIO A;  1FMK A;  5FU7 B;  5GAN j;  1M4Z A;  4BD3 A;  2M9U A;  5FU7 C;  1MMA A;  3CCS Q;  3JCM c;  2OTL Q;  1M8V A;  1XJW B;  2EYX A;  3BE3 A;  3I55 A;  3OYY A;  2MCN A;  3E19 A;  5CKH A;  4RTX A;  1RLP C;  1M90 C;  2DFU A;  2HCK A;  3LGL A;  2ZZD A;  3OYH A;  4JLI A;  4A4G A;  1SRL A;  4Z02 A;  1N5Z A;  3CEY A;  4HXJ A;  3SB2 A;  2XDB A;  4LE9 A;  5GAN h;  2F1L A;  2ZPB B;  4F04 B;  3CC4 A;  4GLM A;  1M90 U;  3I35 A;  3QYG B;  3UA6 A;  5GAN 8;  1KG1 A;  3REA B;  1CKB A;  3OBW A;  2GCX A;  2JZ2 A;  5FRM A;  1EIF A;  2BIV A;  5I21 A;  3CC4 Q;  3JCM b;  5KYU A;  1IZ6 A;  3DKM A;  2OI3 A;  4UC4 A;  3OYF A;  1PD0 A;  2R5M A;  3OMC A;  5KYW A;  3LYI A;  3PVL A;  2O31 A;  2QAZ A;  3M58 A;  4VUB A;  5GAN 2;  3VV0 A;  1X43 A;  2QEX T;  2QYZ A;  2HQX A;  1QW1 A;  1NBE B;  4ANJ A;  2DD5 A;  2RI5 A;  3G6E Q;  1ZHI A;  1H92 A;  1UJY A;  2LMJ A;  2F5K A;  4E7J A;  1I1J A;  3CCJ A;  3VKI A;  1M9S A;  2COW A;  1WPY A;  4FYW B;  1G3T A;  2MWP A;  2LQK A;  2X4J A;  2XDP A;  4M77 A;  4DQ2 A;  4BAC A;  1JJ2 A;  2COZ A;  3CPW P;  5LJ5 j;  1VYT A;  2HL5 C;  4OGE A;  1QP2 A;  1PKT A;  3S6W A;  2CGH A;  2YRD A;  3CC2 T;  3G4S Q;  3OB9 A;  3MKD A;  2MAM A;  3J81 E;  4RKU E;  4KBM B;  4MML A;  4PJO F;  4OML A;  2LQW A;  1SKU B;  3REB B;  2JNG A;  4M77 E;  3VS3 A;  1OU8 A;  1LOJ A;  2I2L A;  2GFU A;  1JEG A;  2M02 A;  5D6X A;  5AYF A;  2DYI A;  5I2S A;  4J7I A;  5KE3 A;  3EHR A;  3KFV A;  2CZ0 B;  2NUT A;  4F17 A;  5GMK m;  4Z88 A;  2QGG A;  5GAM d;  3N5B B;  2NLU A;  5FWC A;  3G1J A;  3J80 E;  2LJ3 A;  1VQO A;  4KGZ B;  4HCB A;  3FC3 A;  2HQH A;  1TWB A;  2A28 A;  4F7U A;  2PU9 B;  1TSF A;  3QO3 A;  1LJO A;  8ATC B;  1OOT A;  1KFZ A;  5CCA A;  1IHV A;  4JRI A;  5DY9 A;  3URG A;  1WFW A;  3VS7 A;  3G71 T;  1YJ9 A;  4PJO C;  5IHI A;  4RTU A;  1RLQ C;  1K1Z A;  4F7U E;  1Y7X A;  2OTJ T;  3TCJ A;  1KC8 R;  3GOX A;  3EFS A;  2KMT A;  4KGX B;  3M9Q A;  4CRI A;  3G7Z A;  4RTT A;  1UTI A;  3ZBD A;  1VQP A;  3RER A;  1ZBX A;  3L2V A;  2E3I A;  2JOY A;  1IRX A;  4FT4 A;  2KDS A;  1OU9 A;  1UHC A;  2IPO B;  1HJD A;  2D1X A;  2CP3 A;  2ECZ A;  2EGC A;  2LDM A;  2DRK A;  5J39 A;  3S3O A;  1NEB A;  1Z9Z A;  4M78 F;  3HL8 A;  3CCR A;  3L2Q A;  2FZC B;  4WTO B;  4J6W A;  1PRL C;  2ENM A;  3OSS C;  3VRZ A; 
#chains in the Genus database with same CATH homology
 2DNU A;  1SSH A;  2YUN A;  2DX1 A;  1PWT A;  2D0N A;  2LP5 A;  4JZ4 A;  2CH4 A;  2CT4 A;  1WIE A;  4K11 A;  4E6R A;  2FRY A;  3A98 A;  4OMQ A;  3RBB B;  4JZ3 A;  1Y57 A;  2JS2 A;  4QT7 A;  2YUQ A;  2JM9 A;  2FPE A;  2A08 A;  2KXC A;  1ABQ A;  2CSQ A;  1MV0 B;  1LCK A;  2GGR A;  4F14 A;  1WLP B;  2KRS A;  2L0A A;  2JM8 A;  2FPF A;  1YWP A;  2KRN A;  3U23 A;  1M27 C;  1UGV A;  1YP5 A;  2KT8 A;  2RQV A;  1B3Q A;  4HVU A;  3I5S A;  2I0N A;  3UAT A;  2JXB A;  2D8H A;  2MIO A;  4GBQ A;  1NG2 A;  2DL3 A;  1SPK A;  2NWM A;  1GCP A;  1TUD A;  1UFF A;  2J7I A;  1U5S A;  2LZ6 B;  2DYB A;  2DA9 A;  2HEQ A;  2DRM A;  4A63 B;  1JXO A;  2JTE A;  2JS0 A;  3VRY A;  1U06 A;  4OMO A;  1ABO A;  2O2O A;  3TSZ A;  1W1F A;  3O5Z A;  4RTW A;  2HSP A;  2LJ0 A;  2SRC A;  2E5K A;  2JMA A;  2D8J A;  2AZS A;  3EG3 A;  1V1C A;  2EQI A;  1K0S A;  1WI7 A;  2ROT A;  3H0I A;  4RTV A;  1XOV A;  2EGE A;  2C0T A;  3VS1 A;  2EBP A;  2BTT A;  2M51 A;  1T0J A;  2J05 A;  2AKL A;  3H0F A;  1WDX A;  4OMP A;  3EG2 A;  4J9F A;  1M30 A;  1VYU A;  1ZUY A;  5IHK A;  2KBT A;  3QWY A;  2EYY A;  1AOJ A;  4Z89 A;  1OEB A;  2KR3 A;  2CT3 A;  4ZNX A;  4AFS C;  2DF6 A;  2KEA A;  2DL8 A;  4J9E A;  1GBR A;  1T3S A;  3TSW A;  3ZL7 C;  1RI9 A;  2F2X A;  2QDL A;  4LUE A;  2CUB A;  3EHQ A;  2OAW A;  1G83 A;  2JMC A;  5GJV B;  2IIM A;  3ULR B;  2AZV A;  2GBQ A;  2PZ1 A;  4Y92 A;  4D8D A;  1ZUK A;  1FYN A;  3IQL A;  1X6G A;  4ORZ A;  3SHW A;  1WXB A;  2A36 A;  2YT6 A;  1H8K A;  4RUG A;  3VS5 A;  2K3B A;  2RNA A;  2JW4 A;  4F16 A;  4FSS A;  2EYW A;  1QCF A;  1QKX A;  3RNJ A;  4JPB W;  1JO8 A;  1YCS B;  2BZX A;  2KRO A;  3UF4 A;  3NHN A;  1NLO C;  2LQN A;  3UA7 A;  4J9C A;  1ZBJ A;  1M3B A;  2DBM A;  2K79 A;  2AKK A;  2K9G A;  1AWJ A;  3FJ5 A;  3LH5 A;  1JU5 C;  2F2V A;  1OPL A;  3QWX X;  1E6H A;  2V1R A;  1HD3 A;  2F2W A;  2KYB A;  1BU1 A;  5ECA A;  2PTK A;  1GL5 A;  4AG2 C;  4JJC A;  4J9H A;  2VVK A;  1GRI A;  3PE0 A;  2RQW A;  2BZ8 A;  4DEY A;  2CRE A;  1SEM A;  1E6G A;  2J6O A;  1AEY A;  2ABL A;  5IH2 A;  2YUP A;  4LNP A;  1BB9 A;  2VWF A;  4RTY A;  1TUC A;  2A37 A;  2YSQ A;  1WXU A;  3M0Q A;  2YUO A;  5IHN A;  2EVR A;  2ROL A;  1KJW A;  1X2K A;  3EG0 A;  4OMM A;  4Z8A A;  5FW9 A;  2ESW A;  2XMF A;  1OV3 A;  2KYM A;  1M8M A;  1CKA A;  1U3O A;  1RUW A;  1EFN A;  2HBW A;  1JXM A;  4CC4 B;  3C0C A;  2DM1 A;  4AFU C;  1GBQ A;  1B07 A;  1AWW A;  1AD5 A;  3M0P A;  1J3T A;  3TVT A;  1KSW A;  2DL4 A;  1M3C A;  2RQR A;  4CC2 A;  1UEC A;  2CDT A;  4CC7 A;  2O9S A;  2AK5 A;  2DVJ A;  4X1V A;  2RMO A;  1QWE A;  5GJW B;  1K4U S;  1PRM C;  2DJQ A;  1PKS A;  4LN2 A;  2W0Z A;  4IIO A;  1FMK A;  4ESR A;  2GTO A;  4HVW A;  3I9Q A;  1AWX A;  2FO0 A;  1K0X A;  1UUE A;  1VA7 A;  4DEX A;  2DLP A;  1G2B A;  2X3X D;  4KRT A;  2K2M A;  4AFQ C;  2EYX A;  2EGA A;  1I07 A;  3R6N A;  2MCN A;  1A0N B;  4RTX A;  2GTJ A;  3PVQ A;  1RLP C;  3GBQ A;  1UE9 A;  2FPD A;  1GFD A;  2HCK A;  1AZG B;  2FEI A;  2KXD A;  2DL7 A;  4M4Z A;  5IXB A;  1SRL A;  1N5Z A;  4HXJ A;  1NYG A;  2RF0 A;  2J06 A;  1WYX A;  4LE9 A;  4GLM A;  3I35 A;  3JV3 A;  4HCK A;  3UA6 A;  2LX7 A;  3REA B;  5I22 A;  1CKB A;  1YN8 A;  1UJ0 A;  2C0I A;  1SHF A;  2J6F A;  2VKN A;  2J6K A;  2OI3 A;  3M0S A;  1ZX6 A;  4J9I A;  1UHF A;  3PVL A;  1PHT A;  1UG1 A;  2O31 A;  4AFZ C;  4R0K A;  1BBZ A;  1X43 A;  2L3Q A;  1K76 A;  3VS4 A;  1QWF A;  1ZSG A;  2DL5 A;  3EGU A;  1K9A A;  1AVZ C;  2L2P A;  4HVV A;  4EIK A;  1OPK A;  1X2Q A;  2JT4 A;  1H92 A;  1UJY A;  2LMJ A;  2BZY A;  1WXT A;  1WX6 A;  2GNC A;  2HDA A;  1I1J A;  3H41 A;  1Y0M A;  2B86 A;  3EG1 A;  2ED1 A;  2V1Q A;  1PNJ A;  3VS2 A;  1ARK A;  4AG1 C;  2KRM A;  2DE0 X;  3NMZ C;  3H0H A;  1VYT A;  2H8H A;  2FG0 A;  4J9B A;  1GFC A;  5I11 A;  2W10 A;  4RTZ A;  1W70 A;  2G6F X;  1PKT A;  2KNB B;  1UDL A;  4JJB A;  2FRW A;  1ZLM A;  4OML A;  1NEG A;  2C0O A;  2LQW A;  3REB B;  2ED0 A;  3VS3 A;  4IIM A;  2P4R A;  2KE9 A;  1YWO A;  3NGP A;  1JEG A;  4CC3 A;  2OJ2 A;  3VS6 A;  3NPF A;  2CUD A;  3M0T A;  1HSQ A;  3EHR A;  3KFV A;  1WA7 A;  4F17 A;  2KGT A;  2EW3 A;  4Z88 A;  2K7A A;  1X27 A;  4LUD A;  2RQT A;  5FWC A;  4J9G A;  3THK A;  2GQI A;  2X3W D;  2LJ3 A;  2L3S A;  2RPN A;  1ZUU A;  3M0R A;  1YNZ A;  1X69 A;  3CQT A;  1SRM A;  2A28 A;  1H3H A;  1Z9Q A;  4WCI A;  1GCQ A;  2O9V A;  2MOX A;  2K6D A;  2RN8 A;  1OOT A;  1T0H A;  5HCK A;  1SHG A;  2YDL A;  1KFZ A;  1NLP C;  5FWB A;  1MV3 A;  3SEM A;  5L23 A;  1MUZ A;  2O88 A;  1IO6 A;  1WFW A;  3VS7 A;  5IXF A;  2EPD A;  1KIK A;  5IHI A;  1X6B A;  4RTU A;  2LJ1 A;  1T3L A;  1RLQ C;  2DBK A;  1K1Z A;  1S1N A;  1BK2 A;  4JJD A;  2L3P A;  2CSI A;  2M0Y A;  1AZE A;  1TG0 A;  1QLY A;  3I5R A;  1NYF A;  2DMO A;  4J9D A;  4RTT A;  1UTI A;  2EKH A;  2KT1 A;  2RQU A;  4D8K A;  1GCQ C;  2LNH B;  1E7O A;  3VS0 A;  1M3A A;  2CH4 W;  2NUZ A;  1W6X A;  1UHC A;  2DIL A;  2EYZ A;  1AWO A;  1HJD A;  1JQQ A;  1NM7 A;  5EC7 A;  2D1X A;  2EGC A;  2ECZ A;  2DRK A;  3VRZ A;  1NEB A;  1Z9Z A;  4OMN A;  3M0U A;  2SEM A;  1PRL C;  2ENM A;  2PNI A;  1CSK A;  1QKW A;  1I0C A;  1VYV A;  2LCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...