2RN8A

Nmr structure note: murine itk sh3 domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
b'GSPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAPSSYLVEKSPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ITK/TSK
publication title NMR structure note: murine Itk SH3 domain
rcsb
source organism Mus musculus
molecule tags Transferase
total genus 9
structure length 64
sequence length 64
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rn8A00
1M8MA 3KFVA 2O88A 4F17A 3PVLA 1AWOA 4HXJA 2J6FA 2RF0A 2RQVA 1LCKA 4CC2A 4F16A 1E6HA 1NM7A 4IIMA 3EHRA 2D8JA 2K9GA 2AK5A 1S1NA 4HCKA 3VRYA 1SRMA 2L2PA 4OMOA 3UATA 3REBB 1UGVA 1KIKA 3EG0A 2BZ8A 1X27A 2DRKA 2JW4A 4JZ4A 4Z88A 1GRIA 2D0NA 1UJYA 4HVVA 3QWXX 2YUPA 3I5RA 2RMOA 2LZ6B 1X69A 3VS2A 1AEYA 1NYGA 3NMZC 3ZL7C 1TG0A 2KNBB 4ESRA 1W70A 1KFZA 2RN8A 1GBRA 1E6GA 2HSPA 2PNIA 1J3TA 5I22A 3THKA 4LE9A 5IHKA 2DBKA 4J9GA 1WFWA 1AWWA 2RNAA 2KYBA 1MUZA 4RTWA 4RUGA 1AVZC 2NWMA 1WYXA 3M0TA 3EHQA 5HCKA 4DEYA 3PE0A 3U23A 1UECA 1YN8A 1WDXA 1AWJA 3C0CA 2GTJA 2JS0A 2LJ0A 2O9SA 3TSZA 1TUCA 3EGUA 2EPDA 4IIOA 1U06A 2KT1A 1X2QA 2KRMA 2LJ1A 1SPKA 2LQWA 1RLPC 1PKSA 2JMAA 4JJCA 1KJWA 2HEQA 1JO8A 2D1XA 1UUEA 3NPFA 1AOJA 5L23A 2BZYA 1UHFA 1UHCA 2A08A 4A63B 1PNJA 1H92A 4AG2C 1GL5A 3TSWA 2ENMA 2B86A 2J7IA 2RQUA 2YDLA 1K0XA 1BU1A 4RTVA 2GGRA 2F2VA 1T0HA 4RTYA 1NLOC 1CKBA 4HVWA 2V1RA 2A28A 2JM9A 1OEBA 3VS7A 1UTIA 1JXMA 4Z89A 2DL4A 3RNJA 5ECAA 1Z9QA 3ULRB 5IXBA 2FRWA 2EYYA 2IIMA 3M0PA 3VS6A 3R6NA 2CDTA 4J9CA 1RI9A 1IO6A 2F2XA 4CC3A 2AKKA 2M51A 4F14A 2K79A 2AZSA 2K7AA 2DL3A 4JZ3A 1VYVA 2GTOA 4Z8AA 3IQLA 4J9IA 3M0SA 1FYNA 4LUEA 2LMJA 1B07A 5I11A 4R0KA 1X6BA 1UG1A 2DMOA 1M3AA 2J05A 1JU5C 1E7OA 4QT7A 4AFUC 2KYMA 3PVQA 1HD3A 1X2KA 4GLMA 4CC4B 2DVJA 1FMKA 1M27C 2ABLA 2E5KA 3O5ZA 2EGEA 2MCNA 2EQIA 1U3OA 1H8KA 1AZEA 2DLPA 1Y0MA 2KR3A 2JS2A 4LUDA 2C0OA 2DILA 2L0AA 2GBQA 2ROTA 2L3PA 2BTTA 1K1ZA 1TUDA 1I1JA 1QKWA 1JXOA 2DNUA 2L3SA 5FWCA 1ZLMA 1WI7A 4M4ZA 2DL5A 2MOXA 2DF6A 1K76A 1X43A 1I0CA 2RQWA 2YUOA 2K2MA 2D8HA 1OPKA 2CUDA 1BB9A 4JJDA 2DM1A 1K4US 4J9BA 2VVKA 3SEMA 2KXDA 1ABOA 2BZXA 1YWOA 2FEIA 2LQNA 1JEGA 1VYTA 2F2WA 1H3HA 2KRNA 1WX6A 2C0IA 2PZ1A 1X6GA 1QCFA 1M3CA 2M0YA 1CKAA 1A0NB 2JMCA 2O31A 1HSQA 2MIOA 3H0IA 2KGTA 1I07A 2YUQA 1JQQA 2FPEA 1QWEA 4Y92A 1U5SA 2JXBA 2RPNA 4HVUA 1HJDA 2PTKA 4WCIA 1N5ZA 2DL7A 2W10A 1GCQA 4ORZA 2P4RA 2EKHA 2EYWA 1MV3A 2DL8A 2CUBA 2SEMA 2DJQA 2LNHB 1GCQC 4ZNXA 1QWFA 2LP5A 3EG2A 4AG1C 4AFZC 3M0QA 2RQTA 1V1CA 4D8KA 1WA7A 3I35A 1Y57A 2OI3A 1ABQA 1MV0B 5IHIA 1AZGB 2K6DA 4OMLA 1T3LA 4J9FA 2HBWA 4LNPA 2G6FX 2LX7A 4J9HA 1NG2A 3GBQA 1RUWA 3VS1A 4GBQA 1W6XA 5FWBA 1GFCA 4OMQA 2NUZA 4RTXA 4E6RA 4X1VA 5IXFA 2O9VA 3VS3A 1SRLA 4CC7A 1PWTA 5FW9A 1WXBA 2X3XD 3SHWA 1SHFA 2ED0A 1VA7A 2KE9A 1BBZA 2KRSA 1SEMA 2AKLA 2DA9A 2DE0X 2LJ3A 1K0SA 2EVRA 2A37A 3JV3A 1UJ0A 1PHTA 3UF4A 1PRLC 2CT4A 2DBMA 2I0NA 2KBTA 1M30A 1GCPA 1YP5A 2FG0A 4EIKA 2O2OA 2OAWA 3REAB 1ARKA 1Z9ZA 2OJ2A 2J6OA 2V1QA 3RBBB 1YWPA 1WLPB 3EG1A 2HCKA 3UA7A 2FO0A 2SRCA 3FJ5A 4DEXA 1XOVA 4JPBW 1SSHA 1QLYA 3QWYA 1OV3A 1ZSGA 2J06A 3NHNA 2GNCA 1NEBA 3CQTA 5EC7A 2GQIA 1AWXA 2EGCA 1UE9A 1BK2A 1QKXA 1ZUYA 1CSKA 1G83A 4RTUA 2LCSA 1ZBJA 3LH5A 2YT6A 1UFFA 3TVTA 2ROLA 1OPLA 3VRZA 2CH4A 1YCSB 1GFDA 2CH4W 2H8HA 2C0TA 2EYZA 4KRTA 4K11A 5GJVB 2ESWA 3NGPA 2AZVA 2XMFA 2CSIA 3H41A 2RQRA 4FSSA 4RTTA 3M0UA 1T3SA 2QDLA 2VKNA 3H0FA 1ZUUA 2FPFA 2HDAA 3A98A 1PKTA 4LN2A 3VS5A 1VYUA 4OMMA 2EYXA 2W0ZA 3I5SA 4AFSC 3VS0A 1T0JA 4OMNA 2CREA 1W1FA 2A36A 4JJBA 3M0RA 2J6KA 2CSQA 1M3BA 2KEAA 4RTZA 1EFNA 2YUNA 2KT8A 4J9DA 4OMPA 1WXUA 2KXCA 3I9QA 4J9EA 4AFQC 4D8DA 2KROA 1SHGA 2FRYA 2FPDA 2DYBA 2YSQA 2JM8A 1WXTA 3VS4A 3EG3A 1K9AA 1ZUKA 1YNZA 3UA6A 2ED1A 2JT4A 1UDLA 1WIEA 1NYFA 1RLQC 2JTEA 2L3QA 2DRMA 1PRMC 5IHNA 1B3QA 2K3BA 2CT3A 1OOTA 2VWFA 5IH2A 1GBQA 1KSWA 2DX1A 1AD5A 1G2BA 2EBPA 1NEGA 2ECZA 5GJWB 1ZX6A 2X3WD 1NLPC 2EGAA 3H0HA 2EW3A
chains in the Genus database with same CATH superfamily
4PLIA 1UGPB 2V8IA 4C8QG 3CPWA 3I56Q 5GMKm 4CC2A 1UGQB 4IIMA 2D8JA 3VRYA 1YIJT 4X9DA 3OYDA 3PIPA 2L2PA 4MMLA 1TWBA 3REBB 3CCLA 4NL3A 3CCRA 1KIKA 4IUUA 1B7TA 1X27A 2DRKA 4C0GA 1MGQA 3CCUQ 2D0NA 1IZ6A 4HVVA 2YUPA 3PIOA 3NFCA 2COYA 2K5LA 3JCMX 3M57A 2QXFA 4J83A 1YI2A 1OQKA 2RN8A 1KQSA 5CO7A 1PC0A 4PJOA 1GBRA 4VUBA 3OYEA 2HSPA 1J3TA 3THKA 2IPOB 2XI9A 1BIAA 2DBKA 3UWNA 2O4XA 4J9GA 4N4GA 3OS0A 1YJWT 4LD9K 1ZBXA 3GNFB 3QJYA 5GMKe 1MUZA 3KUFA 3OS5A 1M2OA 3CCVA 4C0ZA 3DB4A 4L5GA 2E6ZA 1MNDA 3X24B 4LDVA 3EHQA 2BE7D 1B34B 3U23A 2DAQA 1VQOA 2HD0A 1WDXA 3CMAQ 2HAXA 1VQ9Q 1AWJA 4KGVB 5J39A 4ZTJA 3I55T 3JCMV 2P0QA 1PKSA 2LVMA 1KJWA 2HEQA 2D1XA 3HSBA 2MPXC 4M75G 2BZYA 4YTLA 4HA8A 4BACA 5LJ5j 2ZCFB 1H92A 1WHKA 2LT4A 5GANj 1IRXA 2YDLA 1K0XA 2RJCA 2GGRA 5FU7B 2QEXQ 5KCOA 1TU0B 3CC7A 1VQKA 1OEBA 2OTLA 3BFMA 1UTIA 4M77B 3M53A 4JJNK 4Z89A 4Q5WA 4IUVA 3META 2L8DA 3BDUA 2FRWA 5CKEA 3VS6A 3QDFA 3R6NA 2E10A 2VYTA 2QGGA 1IO6A 2F2XA 2KVQG 3VJPA 4CC3A 2P0KA 1WJQA 3VV0A 2JJ9A 4F14A 1ZSZA 1YBYA 4JZ3A 1VYVA 1OZ2A 4Z8AA 4F7UE 2EYQA 4IUPA 3NTIA 1M90R 5AT1B 3OBWA 1M3AA 1K8AU 3JCMc 2DYIA 1VQMQ 2C06A 4GLMA 1WGSA 4QQDA 2DVJA 2DFUA 3ZBDA 3QIIA 2ABLA 3UPUA 3O5ZA 2EQIA 1U3OA 3QG1A 3KXTA 7AT1B 3HRTA 2COWA 2ZPEB 3RKYA 2C0OA 2DILA 1KD1R 1Y71A 1W4SA 3CC4A 1HXDA 1OU8A 3OYAA 1WI7A 4L6V5 3GF5A 3EFOB 2OAUA 2RQWA 4PJOG 4M75E 4QW2A 4BE1A 1I5OB 1K9MR 2K2MA 2CUDA 2CZ7B 2RB6A 3G71A 2KK4A 1KQ2A 1YHQT 4HCZA 2CP5A 5GMKh 3JB9G 1Q86U 5DY9A 4GLKA 3NTHA 1I07A 5GAN3 2Z0WA 2M1HA 3HFNA 3OYMA 1QWEA 2JXBA 2ZGWA 3QBYA 4WCIA 2LC4A 3OMCA 5GAN6 2W10A 4ORZA 2L3RA 1M2VA 2P4RA 2EQMA 1NJIU 2EYWA 4FW1A 2CGHA 1I4K1 5KYUA 2HL3A 1NPRA 3CC2A 3F70A 4MZPA 5LJ3e 4C92B 2V26A 5GAMh 1VQ6A 4FU6A 4M78D 4AFZC 1R0BG 2RQTA 3EH1A 3CMEQ 2RJEA 3JCMh 2OI3A 2OTJA 3WVDB 2HSEB 1RADB 3GBQA 1MHNA 1RUWA 1W6XA 4XTYA 4OMQA 4NOYA 1VQPA 2NUZA 1XNIA 2XK0A 4PFPA 4IKFA 2CP6A 2O9VA 2VUBA 3CCQQ 3CCSQ 5EG2A 2CKKA 3FJPA 3PT9A 1SHFA 3G6EA 2X4WA 1YITA 2KI7A 2GF7A 3OYGA 1LVKA 2KQWA 2MWPA 4JDSA 3GNGA 1SEMA 2DTOA 1LJOA 3FB9A 2EVRA 2ZZDA 1VUBA 3CCEQ 1PHTA 3QPHA 2KBTA 3S6WA 4ELZC 1YP5A 3QYHB 3QYGB 4M77D 4M7DB 5CKBA 3V8KA 1ARKA 4FIBA 2E6NA 4C92F 4AMCA 1Q82R 1BI3A 3RBBB 2PUOB 3EG1A 2SRCA 4DEXA 1QLYA 3NHNA 1LPLA 5GMKj 1ZHIA 3R6OA 1NEBA 4P5NA 4XK8E 3JB9J 3OBYA 1XQHA 2EGCA 1M1KR 4JRQA 4IUQA 2LQ8A 1CSKA 1G83A 2LCSA 3LGLA 2CH4W 3SWNB 4KRTA 5CKHA 2ESWA 1QCNA 2AZVA 2XMFA 1QP2A 4A53A 1RABB 2RQRA 4FSSA 4RTTA 4EDUA 2L5QA 3MP6A 1T3SA 1QQJA 2VKNA 3H0FA 2NUPA 2GFUA 1ZA1B 5GAMj 2QQSA 4C0DB 5D6YA 5A0GA 4OMMA 5GANe 1SKUB 2FL7A 1T0JA 4PNOA 4EMHA 5LJ5g 4M7DF 2O01E 5D7UA 4J9DA 1TUGB 2JTFA 5GANg 1WXUA 2DETA 2K5IA 4J9EA 4OB1B 1YIJQ 1RL2A 3LH0A 2FPDA 4BI3A 1M90C 4O5VA 1VQ7A 3EG9B 2ED1A 4XU2A 1RLQC 1VQNA 2QDYB 5LJ3h 4M7AA 5IHNA 4RCCA 5FU7C 4ME7A 2CT3A 4KBMB 1N9SA 2VWFA 2DX1A 3CBOA 5I2MA 1VQLA 8ATCB 1NEGA 3PGGA 5GJWB 4LDUA 1IB8A 3G4ST 2EW3A 2O88A 4F17A 3A8MB 1KD1C 1AWOA 1Y7XA 2MWOA 1YJWQ 3EGXA 3CXCS 3WVEB 2E65A 4EMKB 2K9GA 2AK5A 1MMDA 3CMET 2K3XA 4OMOA 4PKCC 3UATA 4F7UA 3LWHA 4BE2A 1RAHB 4E2FB 1SG5A 2RJFA 1K9MC 2JW4A 4JZ4A 2E3IA 2Y90A 2ZPFB 1IHWA 3QWXX 2DKGA 2RMOA 1K73R 2LZ6B 5LJ5f 5FU6B 1AEYA 3V8LA 3I55Q 3NMZC 2DTIA 1R77A 3JCMQ 4MDXA 4PJOB 2KNBB 4KH0B 1E6GA 3HRUA 5I22A 5DM7R 4QKUA 1R8OB 4C8QD 1MMNA 2YRDA 1AWWA 2Y4YA 3JCMP 2KYBA 1WHLA 2B8AA 2YRVA 2P0PA 2HKNA 2RI2A 5HCKA 2COZA 2XKOC 1N27A 3URGA 1D3BB 1YN8A 1BCOA 4OB0B 4DBRA 2D6FA 3RUXA 3M59A 1WQWA 2LJ0A 1YJNQ 3TSZA 5KE3A 5IT9E 2GQVA 4IIOA 1U06A 1N9RA 1JJ2A 1X2QA 2XHCA 4CRIA 1SPKA 4ZGJB 2CP7A 4JJCA 3CXCP 1UUEA 2HQEA 5GAN8 2L89A 4XTXA 1HYOA 3DKMA 4F04B 5L23A 1UHCA 2A08A 1O75A 4A63B 4FSXA 1AHJB 1QVGA 5FLXE 2RQUA 2JUFA 1VIFA 5CAIA 5LJ3j 2XDPA 1T0HA 1NLOC 2DD5A 2V1RA 2A28A 2XU8A 3LLRA 2DXTA 1PSFA 1EZZB 3VS7A 3OB9A 2JNGA 1VQ8T 4J6XA 1VQ5Q 2DL4A 2K4YA 3RNJA 1IXDA 2JN0A 3ULRB 4ZN3A 5IXBA 4C92C 2IVWA 2CDTA 2KDSA 1QP3A 5D6XA 4M75D 3OYKA 2M51A 1KC8R 4M7AG 4E7LA 3IQLA 1Q82C 2CZ1B 5GAOq 2XG8D 4OF1A 1FYNA 3QZ9B 3CD6T 2DERA 4A4GA 2LMJA 1X6BA 4PJNA 2J05A 4BB7A 1EIFA 4JUVA 1I5LA 1E7OA 2KYMA 3PVQA 2GFAA 1FMKA 4J6WA 4DOVA 1YHQQ 1M1KC 2MCNA 4ZTFA 2JTMA 3VKIA 1H8KA 3QHSA 1AZEA 3MEAA 2MI6A 1Y0MA 3OW2S 4F7UG 4E47A 4X34A 2ROTA 2E64A 2L3PA 1K1ZA 3MP8A 1SSFA 3EGDA 1QKWA 5CQYA 4C5IA 3X20B 2VASA 3RDVA 1JXOA 2DNUA 3L2ZA 2R57A 3CCJT 4M78B 4M4ZA 1YJ9T 2MOXA 4RG8A 4M7DC 1K76A 3CCUA 3INZA 6AT1B 2HZYA 4WF2A 2CZ6B 2CS7A 2YUOA 4D6WA 1SF9A 3JCMW 4NL2A 4JS5A 2E1HA 2VVKA 2DEQA 3M55A 1ABOA 1S72T 3TEEA 2BZXA 2FEIA 1G3SA 2F2WA 4LDWA 1RAEB 3HPWA 2C0IA 1X6GA 4J7IA 1M3CA 5HK3A 1CKAA 2HL5C 1A0NB 1HSQA 2KGTA 2YUQA 2BKDN 4KULA 1HK9A 1KHCA 2FPEA 4OB3B 4Y92A 5GAMe 3RESA 4HVUA 3CC7Q 1VQKQ 3SWNC 1FX7A 3C12A 1X6OA 3L2VA 4PJOD 2EKHA 5GAMg 3CMAA 1VQ9A 3JCMe 3EH2A 2LNHB 4M7AE 1GCQC 4OMFB 3DLMA 3JCMg 3NTKA 1YJNT 2F69A 1W2BS 4PJJA 3OW2P 4C0DC 4DBFA 5KYWB 1WHHA 1PD1A 4M78F 2EFIA 2V8KA 1ABQA 2QAZA 1G3WA 2JVVA 1PD0A 4LNPA 3HFOA 2G6FX 1G8XA 2QQBA 3GOXA 2DXBA 2DVEA 2QEXA 1K73C 1IGQA 3QO3A 1Y96A 5IXFA 4JS4A 4CC7A 2QA4A 3E1SA 5FW9A 5LL6S 1WXBA 3SHWA 3VUBA 2ED0A 1PG5B 2G3RA 2QASA 3HKSA 3C95A 5KYYA 1XTDA 1VQ5T 2KE9A 3PNWC 1VOMA 2H3EB 4KGXB 5GAOp 4PL6A 3AHUA 3GLXA 3CC4Q 5FROA 4QVCA 1M5Q1 1M30A 4EMKC 4EIKA 3SB2A 5IN1A 2YWWA 3CCLT 5LJ5d 4M77F 4OGCA 3VUZA 3CCRT 5CCAA 2RHUA 2DPPB 1YWPA 3H6ZA 3QKJA 3UA7A 3TU4K 3FJ5A 2RA2A 3CCMA 1VQMA 4IUTA 3QWYA 1ZSGA 1W2BP 1G3TA 3JRZA 2DTHA 1Q81U 1AWXA 4J6YA 1YI2T 2XD0A 3L42A 1M9SA 5KYXB 1QKXA 1ZUYA 1JBMA 2NUTB 2PU9B 1F1BB 3M4YA 2HQXA 3ER0A 3TVTA 2ROLA 2E3HA 2CH4A 2X4YA 1GFDA 2H8HA 3CCVT 4K11A 5GJVB 2DO3A 1B34A 3H41A 4XU1A 5DLOA 4NS5A 2VC8A 2PQWA 3G1JA 4PFOA 1VQOT 4LDXA 5D6WA 2FPFA 4RMOA 2QQRA 4BY6C 3A98A 1PKTA 3VS5A 1VYUA 2EYXA 2W0ZA 2WSEE 3G4SQ 4OMNA 3DLLA 1XJWB 1KC8C 2A36A 4JJBA 2J6KA 2CSQA 2FYKA 3LYIA 4OMPA 2I2LA 3I9QA 5LJ3g 2ZPHB 2KROA 1SHGA 4AT1B 3A8OB 2DYBA 2YSQA 2JM8A 1WXTA 4FL6A 3EG3A 3FEOA 1YNZA 4C8QB 2EJGA 1BIBA 3UA6A 3PFSA 3A8GB 1NYFA 2WSCE 2GCXA 3M56A 4M77A 3CC7T 1VQKT 1M8VA 2OTLT 1OOTA 3G6EQ 1N8RR 3SD4A 3OYCA 1AD5A 2ECZA 2RK1A 4OVAA 4UC4A 1IREB 5GAOl 3MCAB 3KFVA 1LOJA 5GAN4 5J26A 4LXCA 2E12A 2CP0A 2WACA 2RQVA 4F16A 1S1NA 1SRMA 3RMSA 4N0AC 4E7HA 4PLLA 5J3BA 1UGVA 3ZEHA 3E2UA 2BZ8A 1ZQ1A 3HTRA 3S3MA 1Q7YR 3JB9H 4OGEA 1OX9A 2QA4T 2K57A 3CCQA 4LD6A 4L59A 3CCSA 2RK2A 4MZMA 4ESRA 3FC3A 3UDCA 1QCOA 1KFZA 2VV5A 5LJ3f 2YRCA 3RERA 4FYWB 4DQ2A 3ME9A 2PNIA 3JAME 4LE9A 5IHKA 3MHXA 3LWIA 2PVOB 5AYFA 4C8QF 1MMAA 5HY6A 3CCEA 2RNAA 2A3LA 2OX7A 2QG9B 3A5ZB 4N4IA 4RUGA 1AVZC 2NWMA 3CC4T 1BI1A 1WYXA 3M0TA 1OULA 3EFOA 3A8LB 3SDZA 4HT9A 4DEYA 1NPPA 3PE0A 4M78C 1UECA 4M75B 4B6MA 2X9HA 1VQ8Q 1WHGA 2GTJA 1OU9A 3G71T 2ZPGB 4XTUA 4JRKA 3OQ5A 1VQ4A 2X51A 1WHMA 2CZ0B 2LJ1A 2LQWA 1RLPC 3M9QA 2JMAA 4FYXB 1NE8A 3V7CA 1JO8A 3L2UA 2K5FA 1AOJA 1VQ7Q 2ENMA 2B86A 2J7IA 1VQNQ 1BU1A 2VB6A 5L8RE 2F2VA 1YCYA 3CD6Q 1M90U 2PVDB 4E7SA 2EQUA 1RACB 3VYGA 5KCHA 1JXMA 3E9FA 4MDWA 3CC2T 5HKCA 4C92A 5C0MA 4M77C 2IIMA 2EYYA 3DB3A 2CP2A 4DBQA 1VQ6T 1EX4A 4KUIA 1RI9A 4E7KA 3JB9I 1G5VA 1JJ2S 3OYIA 2RH2A 4M75F 1YIJA 2OTJT 2AZSA 2K7AA 1KD1U 1UGRB 1D1CA 3M5AA 1GXIE 3PMIA 4ZN1A 4FW2A 3CCJQ 2RJDA 1YJ9Q 3M0SA 5KH6A 4LUEA 2DIGA 2F1LA 1I8FA 4C5GA 1B07A 4O6JA 4R0KA 1C6VX 1VQPT 1UG1A 2DMOA 4ZGEB 1RAFB 2DZCA 1JU5C 1QVGS 1K9MU 4AFUC 5CIUA 1FXXA 4OB2B 2JOYA 3LGFA 1S72Q 2E41A 3G6ET 1YITT 2E5KA 3FRNA 2EGEA 3JSCA 1QVFA 5GANf 2DLPA 1YJWA 2JS2A 2O4XB 4LUDA 4XTZA 3L2QA 3G7ZA 2YHTA 4M7AD 2BTTA 1TUDA 1I1JA 2EKOA 2RI5A 1KG1A 4M7DA 2L3SA 4XTWA 3HL8A 4ELYC 1ZLMA 2QTVA 3CEYA 3OYYA 2KMTA 4RKUE 3OA6A 2DL5A 2DF6A 2EQKA 2DXUA 3V7RA 3CPWS 1OX8A 1K8AR 3RR6A 2EIFA 2D8HA 3I55A 3PMTA 4E7IA 4JJDA 4RG2A 3SEMA 2DZ9A 2KY9A 2LTOA 4EMGA 1N6AA 1JEGA 1FMVA 1MNEA 1WZOA 3RMQA 2KRNA 1JJ2P 4QQGA 2FZKB 2JMCA 2VGNA 3SWNA 1JQQA 2M9UA 4QVZA 1WJSA 4PJMA 2HBPA 4MZTA 3L1AA 2RPNA 1KQSS 2PTKA 4HCBA 1X01A 3LX7A 1N5ZA 1GCQA 4DBHA 2M02A 5GAN2 1D1BA 1QVGP 1N8RC 2DL8A 4X9CA 2CUBA 1M1FA 2SEMA 4PJOF 2LRQA 5HK0A 4M77E 1VQ4T 2M0OA 1FMWA 1AT1B 2LP5A 3H9NA 2ZPBB 3EG2A 1Q86R 5FRMA 1V1CA 1WA7A 3I35A 1Y57A 4FT2A 1MV0B 1AZGB 2K6DA 1ZSZB 3C4SA 2HMAA 2HBWA 4J9HA 1NG2A 3CCLQ 1Q7YC 1R0CB 3EG9A 1VQ7T 3MPUB 4C92G 4GBQA 3CCRQ 3CPWP 1GFCA 1NJIR 4BUGA 1VQNT 2XDDA 4C8QC 1Q82U 4RTXA 1OZ3A 4E6RA 3VS3A 1SRLA 1C0MA 3OYJA 2HNIA 5DLQE 1VQLT 2PUKB 1YI2Q 1VA7A 2VGMA 3CBMA 1IHVA 2DA9A 2DE0X 1M1KU 2LJ3A 4HCCA 4EMKA 3CPFA 1UJ0A 3I56A 2K3YA 3UF4A 2CT4A 1KQSP 2DBMA 3CCVQ 2FG0A 2M16A 2O2OA 2OAWA 5M9OA 1O9SA 4R56A 1Z9ZA 2OJ2A 2J6OA 2XICA 1VQOQ 3LW5E 5LJ3d 2HKQB 3V8JA 3T9NA 2FO0A 2RD1A 1TS9A 1BCMA 4JPBW 1RAAB 4PK4A 1OV3A 2DK3A 2J06A 2R5MA 3PTAA 1RAIB 2GNCA 4ZGDB 1YHQA 3AT1B 3CQTA 4B9XA 5EC7A 4OP0A 2GQIA 2EWNA 1D0YA 1UE9A 4M7DG 1BK2A 4Y28E 4RTUA 1ZBJA 3SFMA 2YT6A 2MK5A 3HRSA 3N5BB 1OPLA 3VRZA 4A4FA 2C0TA 3NGPA 2DJZA 1P92A 3MEWA 1D3BA 1D0ZA 2QI2A 3RIRA 1M2VB 3FIFA 5GMKl 2OTLQ 1D1AA 5KYUB 4M75C 2QDLA 1ZUUA 2FHDA 2HDAA 2MAMA 4XU0A 4LN2A 4WTOB 1G3YA 2FVUA 3V7SA 4C92E 1U1SA 2CREA 1W1FA 2R58A 4DOWA 2EJFA 5GMKi 3QUIA 1M3BA 4RCBA 4RTZA 1EFNA 3JB9D 1UEBA 2KT8A 4XTVA 4J7FA 4AFQC 2FRYA 2VXEA 4C8QE 2F5KA 3OY9A 3VS4A 1K9AA 2LT1A 1RAGB 2FZGB 2JT4A 3OW2A 2EQJA 2JTEA 2QA4Q 2L3QA 2DRMA 1PRMC 4FCYA 1B3QA 2K3BA 2D0QB 2EAYA 1K73U 4QQ6A 2AIRB 1U1TA 3OS2A 1G2BA 9ATCB 4J5YA 5CKDA 4A54A 2X3WD 1NLPC 2EGAA 1M8MA 3PVLA 1H641 4HXJA 2J6FA 2RF0A 4N0AA 1V29B 1LCKA 1E6HA 1NM7A 3EHRA 4HCKA 2E4HA 1DJ7B 5GAMf 4N4HA 4M7DE 3EG0A 2P4TA 4XQ3A 4A4HA 1K8AC 3CCMQ 3QXEB 4Z88A 1GRIA 3S3NA 3JCMf 1UJYA 3I5RA 1X69A 3VS2A 5GANd 1NYGA 2XDBA 3ZL7C 3G71Q 1TG0A 1NBEB 1YFNA 1W70A 3MKDA 2LX9A 4FYYB 2RO0A 4KGZB 5FU6C 1TH7A 2JZ2A 3BE3A 3OS1A 4KUDK 1KHIA 1WFWA 4A4EA 4PJOC 1TOVA 3I56T 1BI2A 4V2SA 2RHIA 2DXCA 4LDYA 3JCMJ 4RTWA 3J7AF 3JCMb 4M78A 1W2BA 2ZPIB 3OYBA 2XIDA 3TQ7P 2LCLA 4EPCA 5GAOm 1Q81C 2BIVA 3CCUT 2MF2A 3C0CA 3E19A 4JRIA 2JS0A 2O9SA 2CYZB 1TUCA 4HKEA 3EGUA 2EPDA 3CC2Q 1TXQA 2NUPB 1WQ7A 4Z02A 1BKBA 2WSFE 2KT1A 1OI1A 2DIQA 3L2WA 1Q86C 3Q1JA 2V8JA 2KRMA 3A1PA 1VQ6Q 3MO8A 3MJXA 4ATOA 4GY5A 3NPFA 3MP1A 1UHFA 2OTJQ 1TSFA 1KC8U 5A0LA 1PNJA 5CVIA 4AG2C 1GL5A 3TSWA 1NJIC 4RTVA 3GPLA 4RTYA 1CKBA 4HVWA 3EAEA 1VQPQ 2JM9A 3CMAT 2X35A 1VQ9T 4M7AB 2EJ9A 2ATCB 1Q95G 1M4ZA 5ECAA 2IG0A 3KBGA 1Z9QA 5C6SA 1YITQ 2LDMA 3G4SA 3M0PA 5CK9A 5KYWA 2LQKA 4J9CA 2QQAA 5KE2A 2AKKA 5IAYA 3EGXB 3OYFA 3CMEA 1M1GA 2RHXA 2K79A 2DL3A 3OYLA 2GTOA 4J9IA 1ZSZC 4F7UB 3OSVA 2QEXT 2QGFB 2YLBA 5I11A 4CI0C 4KH1B 4QT7A 2YLCA 1HD3A 1X2KA 4CC4B 3FLGA 1OYXA 3O8VA 4BDZA 5GAOr 1M27C 4IURA 4PJOE 1UGSB 3J80E 3P8BB 2NLUA 3X28B 1NZ9A 4BDYA 4FT4A 2A7YA 2KR3A 2E5QA 3QJ6A 4BI4A 2L0AA 3M54A 2GBQA 1U8RA 1WJRA 4M7AF 2RI3A 5I21A 5KYNA 5FWCA 3X26B 3P8DA 2BE9B 8AT1B 1RI0A 4C5EA 1X43A 1I0CA 5GAN5 1OPKA 1BB9A 3RKWA 3CCMT 2QQ9A 4KT0E 1VQMT 1VQ4Q 1K4US 2DM1A 4J9BA 2KXDA 1KQ1A 4J8OA 1UB4A 4E7ZA 1YWOA 2DEUA 2LQNA 1VYTA 5I2SA 5KYXA 1H3HA 4M78G 2NUTA 2PZ1A 1WX6A 1QCFA 3M58A 2M0YA 4F7UF 4PJLA 2O31A 2MIOA 2KAFA 3H0IA 1IGUA 3BW1A 3H8ZA 1QVFS 4ANJA 3OMGA 1U5SA 1C1AA 3TREA 1HJDA 2DL7A 2KSSA 1H3ZA 2HQHA 1MV3A 2DJQA 1VQ8A 4B9WA 5LJ5e 1KK7A 2QTXA 4ZNXA 1VQLQ 1QW1A 3VYHB 1V76A 2FB7A 1PCXA 2DD4A 5A2QE 1QWFA 4AG1C 1X75C 3RKXA 3M0QA 1D0XA 4D8KA 3HHTB 3QZ5B 4BI8B 2MMPA 2X4JA 2D9TA 5IHIA 4OMLA 5A0DA 1T3LA 3WXMB 4J9FA 4E7JA 2LX7A 1WHJA 4M77G 4C8QA 3VS1A 2RM4A 3CD6A 3VU3C 5FWBA 4JRPA 5CKFA 2QYZA 3S3OA 4QVDA 2CP3A 4X1VA 3BDLA 1PWTA 4TVRA 4XU3A 1PM3A 2NYSA 2X3XD 3EFRA 1BI0A 1WPYA 3C94A 2E70A 3HP9A 2LCCA 1BBZA 2KRSA 2AKLA 3MEUA 3M4GA 2VXFA 1K0SA 1TTHB 3UT1A 5GAMd 1ACMB 2A37A 3JV3A 1QVFP 2QK0A 4DA4A 1PRLC 2Y4XA 2I0NA 2H3JA 1GCPA 3CCJA 2AHJB 3EGDB 4Y91A 3JCMd 2MYSA 1YJ9A 3REAB 4C92D 3L2RA 4M78E 3EFSA 4JLIA 2V1QA 5FRNA 4C0FA 1WNLA 1WLPB 1I81A 2HCKA 3X25B 5GAN7 3CCQT 1XOVA 2PVGB 1SSHA 3CCST 3MEVA 2P84A 4BD3A 1S72A 3D7SB 1JRIA 2ZAEA 3BY7A 2YXYA 5CQXA 4JLGA 2F5TX 1Y07A 3LH5A 3QDRB 3ASKA 1UFFA 1ZA2B 3CBPA 4FYVB 2LNVA 3CCET 1YCSB 2EYZA 3E9GA 2CSIA 4M75A 3GIBA 4BY6B 1QMCA 3M0UA 3OYHA 3FDRA 5GAOn 3OYNA 2RHZA 4II1A 1LNXA 1N8RU 3CXCA 1YJNA 2FZCB 1Q81R 1MMGA 4XAXB 3I5SA 4AFSC 3VS0A 2BUDA 4M7DD 4HT8A 4A4KA 2A0FB 4C5HA 3M0RA 2KEAA 4FM4B 2YUNA 3QSUA 2R5AA 2KXCA 3JB9F 3A8HB 3P8HA 2RHYA 4D8DA 4MMKA 3GP8A 1JB0E 3OSSC 5LJ5h 3J81E 1ZUKA 4BE0A 1FWZA 5CR2A 5GANh 1UDLA 1WIEA 1VIEA 1D09B 1Q7YU 1PSEA 4R55A 3ZFJA 1Y96B 2K2VA 1BYMA 2AT1B 5IH2A 3TCJA 1GBQA 1KSWA 4M7AC 4PFZA 2EBPA 1QVPA 2X4XA 1ZX6A 1VQ5A 5KYYB 3H0HA
chains in the Genus database with same CATH topology
1M8MA 3KFVA 2O88A 4F17A 3PVLA 1AWOA 4HXJA 2J6FA 2RF0A 2RQVA 1LCKA 4CC2A 4F16A 1E6HA 1NM7A 4IIMA 3EHRA 2D8JA 2K9GA 2AK5A 1S1NA 4HCKA 3VRYA 1SRMA 2L2PA 4OMOA 3UATA 3REBB 1UGVA 1KIKA 3EG0A 2BZ8A 1X27A 2DRKA 2JW4A 4JZ4A 4Z88A 1GRIA 2D0NA 1UJYA 4HVVA 3QWXX 2YUPA 3I5RA 2RMOA 2LZ6B 1X69A 3VS2A 1AEYA 1NYGA 3NMZC 3ZL7C 1TG0A 2KNBB 4ESRA 1W70A 1KFZA 2RN8A 1GBRA 1E6GA 2HSPA 2PNIA 1J3TA 5I22A 3THKA 4LE9A 5IHKA 2DBKA 4J9GA 1WFWA 1AWWA 2RNAA 2KYBA 1MUZA 4RTWA 4RUGA 1AVZC 2NWMA 1WYXA 3M0TA 3EHQA 5HCKA 4DEYA 3PE0A 3U23A 1UECA 1YN8A 1WDXA 1AWJA 3C0CA 2GTJA 2JS0A 2LJ0A 2O9SA 3TSZA 1TUCA 3EGUA 2EPDA 4IIOA 1U06A 2KT1A 1X2QA 2KRMA 2LJ1A 1SPKA 2LQWA 1RLPC 1PKSA 2JMAA 4JJCA 1KJWA 2HEQA 1JO8A 2D1XA 1UUEA 3NPFA 1AOJA 5L23A 2BZYA 1UHFA 1UHCA 2A08A 4A63B 1PNJA 1H92A 4AG2C 1GL5A 3TSWA 2ENMA 2B86A 2J7IA 2RQUA 2YDLA 1K0XA 1BU1A 4RTVA 2GGRA 2F2VA 1T0HA 4RTYA 1NLOC 1CKBA 4HVWA 2V1RA 2A28A 2JM9A 1OEBA 3VS7A 1UTIA 1JXMA 4Z89A 2DL4A 3RNJA 5ECAA 1Z9QA 3ULRB 5IXBA 2FRWA 2EYYA 2IIMA 3M0PA 3VS6A 3R6NA 2CDTA 4J9CA 1RI9A 1IO6A 2F2XA 4CC3A 2AKKA 2M51A 4F14A 2K79A 2AZSA 2K7AA 2DL3A 4JZ3A 1VYVA 2GTOA 4Z8AA 3IQLA 4J9IA 3M0SA 1FYNA 4LUEA 2LMJA 1B07A 5I11A 4R0KA 1X6BA 1UG1A 2DMOA 1M3AA 2J05A 1JU5C 1E7OA 4QT7A 4AFUC 2KYMA 3PVQA 1HD3A 1X2KA 4GLMA 4CC4B 2DVJA 1FMKA 1M27C 2ABLA 2E5KA 3O5ZA 2EGEA 2MCNA 2EQIA 1U3OA 1H8KA 1AZEA 2DLPA 1Y0MA 2KR3A 2JS2A 4LUDA 2C0OA 2DILA 2L0AA 2GBQA 2ROTA 2L3PA 2BTTA 1K1ZA 1TUDA 1I1JA 1QKWA 1JXOA 2DNUA 2L3SA 5FWCA 1ZLMA 1WI7A 4M4ZA 2DL5A 2MOXA 2DF6A 1K76A 1X43A 1I0CA 2RQWA 2YUOA 2K2MA 2D8HA 1OPKA 2CUDA 1BB9A 4JJDA 2DM1A 1K4US 4J9BA 2VVKA 3SEMA 2KXDA 1ABOA 2BZXA 1YWOA 2FEIA 2LQNA 1JEGA 1VYTA 2F2WA 1H3HA 2KRNA 1WX6A 2C0IA 2PZ1A 1X6GA 1QCFA 1M3CA 2M0YA 1CKAA 1A0NB 2JMCA 2O31A 1HSQA 2MIOA 3H0IA 2KGTA 1I07A 2YUQA 1JQQA 2FPEA 1QWEA 4Y92A 1U5SA 2JXBA 2RPNA 4HVUA 1HJDA 2PTKA 4WCIA 1N5ZA 2DL7A 2W10A 1GCQA 4ORZA 2P4RA 2EKHA 2EYWA 1MV3A 2DL8A 2CUBA 2SEMA 2DJQA 2LNHB 1GCQC 4ZNXA 1QWFA 2LP5A 3EG2A 4AG1C 4AFZC 3M0QA 2RQTA 1V1CA 4D8KA 1WA7A 3I35A 1Y57A 2OI3A 1ABQA 1MV0B 5IHIA 1AZGB 2K6DA 4OMLA 1T3LA 4J9FA 2HBWA 4LNPA 2G6FX 2LX7A 4J9HA 1NG2A 3GBQA 1RUWA 3VS1A 4GBQA 1W6XA 5FWBA 1GFCA 4OMQA 2NUZA 4RTXA 4E6RA 4X1VA 5IXFA 2O9VA 3VS3A 1SRLA 4CC7A 1PWTA 5FW9A 1WXBA 2X3XD 3SHWA 1SHFA 2ED0A 1VA7A 2KE9A 1BBZA 2KRSA 1SEMA 2AKLA 2DA9A 2DE0X 2LJ3A 1K0SA 2EVRA 2A37A 3JV3A 1UJ0A 1PHTA 3UF4A 1PRLC 2CT4A 2DBMA 2I0NA 2KBTA 1M30A 1GCPA 1YP5A 2FG0A 4EIKA 2O2OA 2OAWA 3REAB 1ARKA 1Z9ZA 2OJ2A 2J6OA 2V1QA 3RBBB 1YWPA 1WLPB 3EG1A 2HCKA 3UA7A 2FO0A 2SRCA 3FJ5A 4DEXA 1XOVA 4JPBW 1SSHA 1QLYA 3QWYA 1OV3A 1ZSGA 2J06A 3NHNA 2GNCA 1NEBA 3CQTA 5EC7A 2GQIA 1AWXA 2EGCA 1UE9A 1BK2A 1QKXA 1ZUYA 1CSKA 1G83A 4RTUA 2LCSA 1ZBJA 3LH5A 2YT6A 1UFFA 3TVTA 2ROLA 1OPLA 3VRZA 2CH4A 1YCSB 1GFDA 2CH4W 2H8HA 2C0TA 2EYZA 4KRTA 4K11A 5GJVB 2ESWA 3NGPA 2AZVA 2XMFA 2CSIA 3H41A 2RQRA 4FSSA 4RTTA 3M0UA 1T3SA 2QDLA 2VKNA 3H0FA 1ZUUA 2FPFA 2HDAA 3A98A 1PKTA 4LN2A 3VS5A 1VYUA 4OMMA 2EYXA 2W0ZA 3I5SA 4AFSC 3VS0A 1T0JA 4OMNA 2CREA 1W1FA 2A36A 4JJBA 3M0RA 2J6KA 2CSQA 1M3BA 2KEAA 4RTZA 1EFNA 2YUNA 2KT8A 4J9DA 4OMPA 1WXUA 2KXCA 3I9QA 4J9EA 4AFQC 4D8DA 2KROA 1SHGA 2FRYA 2FPDA 2DYBA 2YSQA 2JM8A 1WXTA 3VS4A 3EG3A 1K9AA 1ZUKA 1YNZA 3UA6A 2ED1A 2JT4A 1UDLA 1WIEA 1NYFA 1RLQC 2JTEA 2L3QA 2DRMA 1PRMC 5IHNA 1B3QA 2K3BA 2CT3A 1OOTA 2VWFA 5IH2A 1GBQA 1KSWA 2DX1A 1AD5A 1G2BA 2EBPA 1NEGA 2ECZA 5GJWB 1ZX6A 2X3WD 1NLPC 2EGAA 3H0HA 2EW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8M A;  3KFV A;  2O88 A;  4F17 A;  3PVL A;  1AWO A;  4HXJ A;  2J6F A;  2RF0 A;  2RQV A;  1LCK A;  4CC2 A;  4F16 A;  1E6H A;  1NM7 A;  4IIM A;  3EHR A;  2D8J A;  2K9G A;  2AK5 A;  1S1N A;  4HCK A;  3VRY A;  1SRM A;  2L2P A;  4OMO A;  3UAT A;  3REB B;  1UGV A;  1KIK A;  3EG0 A;  2BZ8 A;  1X27 A;  2DRK A;  2JW4 A;  4JZ4 A;  4Z88 A;  1GRI A;  2D0N A;  1UJY A;  4HVV A;  3QWX X;  2YUP A;  3I5R A;  2RMO A;  2LZ6 B;  1X69 A;  3VS2 A;  1AEY A;  1NYG A;  3NMZ C;  3ZL7 C;  1TG0 A;  2KNB B;  4ESR A;  1W70 A;  1KFZ A;  2RN8 A;  1GBR A;  1E6G A;  2HSP A;  2PNI A;  1J3T A;  5I22 A;  3THK A;  4LE9 A;  5IHK A;  2DBK A;  4J9G A;  1WFW A;  1AWW A;  2RNA A;  2KYB A;  1MUZ A;  4RTW A;  4RUG A;  1AVZ C;  2NWM A;  1WYX A;  3M0T A;  3EHQ A;  5HCK A;  4DEY A;  3PE0 A;  3U23 A;  1UEC A;  1YN8 A;  1WDX A;  1AWJ A;  3C0C A;  2GTJ A;  2JS0 A;  2LJ0 A;  2O9S A;  3TSZ A;  1TUC A;  3EGU A;  2EPD A;  4IIO A;  1U06 A;  2KT1 A;  1X2Q A;  2KRM A;  2LJ1 A;  1SPK A;  2LQW A;  1RLP C;  1PKS A;  2JMA A;  4JJC A;  1KJW A;  2HEQ A;  1JO8 A;  2D1X A;  1UUE A;  3NPF A;  1AOJ A;  5L23 A;  2BZY A;  1UHF A;  1UHC A;  2A08 A;  4A63 B;  1PNJ A;  1H92 A;  4AG2 C;  1GL5 A;  3TSW A;  2ENM A;  2B86 A;  2J7I A;  2RQU A;  2YDL A;  1K0X A;  1BU1 A;  4RTV A;  2GGR A;  2F2V A;  1T0H A;  4RTY A;  1NLO C;  1CKB A;  4HVW A;  2V1R A;  2A28 A;  2JM9 A;  1OEB A;  3VS7 A;  1UTI A;  1JXM A;  4Z89 A;  2DL4 A;  3RNJ A;  5ECA A;  1Z9Q A;  3ULR B;  5IXB A;  2FRW A;  2EYY A;  2IIM A;  3M0P A;  3VS6 A;  3R6N A;  2CDT A;  4J9C A;  1RI9 A;  1IO6 A;  2F2X A;  4CC3 A;  2AKK A;  2M51 A;  4F14 A;  2K79 A;  2AZS A;  2K7A A;  2DL3 A;  4JZ3 A;  1VYV A;  2GTO A;  4Z8A A;  3IQL A;  4J9I A;  3M0S A;  1FYN A;  4LUE A;  2LMJ A;  1B07 A;  5I11 A;  4R0K A;  1X6B A;  1UG1 A;  2DMO A;  1M3A A;  2J05 A;  1JU5 C;  1E7O A;  4QT7 A;  4AFU C;  2KYM A;  3PVQ A;  1HD3 A;  1X2K A;  4GLM A;  4CC4 B;  2DVJ A;  1FMK A;  1M27 C;  2ABL A;  2E5K A;  3O5Z A;  2EGE A;  2MCN A;  2EQI A;  1U3O A;  1H8K A;  1AZE A;  2DLP A;  1Y0M A;  2KR3 A;  2JS2 A;  4LUD A;  2C0O A;  2DIL A;  2L0A A;  2GBQ A;  2ROT A;  2L3P A;  2BTT A;  1K1Z A;  1TUD A;  1I1J A;  1QKW A;  1JXO A;  2DNU A;  2L3S A;  5FWC A;  1ZLM A;  1WI7 A;  4M4Z A;  2DL5 A;  2MOX A;  2DF6 A;  1K76 A;  1X43 A;  1I0C A;  2RQW A;  2YUO A;  2K2M A;  2D8H A;  1OPK A;  2CUD A;  1BB9 A;  4JJD A;  2DM1 A;  1K4U S;  4J9B A;  2VVK A;  3SEM A;  2KXD A;  1ABO A;  2BZX A;  1YWO A;  2FEI A;  2LQN A;  1JEG A;  1VYT A;  2F2W A;  1H3H A;  2KRN A;  1WX6 A;  2C0I A;  2PZ1 A;  1X6G A;  1QCF A;  1M3C A;  2M0Y A;  1CKA A;  1A0N B;  2JMC A;  2O31 A;  1HSQ A;  2MIO A;  3H0I A;  2KGT A;  1I07 A;  2YUQ A;  1JQQ A;  2FPE A;  1QWE A;  4Y92 A;  1U5S A;  2JXB A;  2RPN A;  4HVU A;  1HJD A;  2PTK A;  4WCI A;  1N5Z A;  2DL7 A;  2W10 A;  1GCQ A;  4ORZ A;  2P4R A;  2EKH A;  2EYW A;  1MV3 A;  2DL8 A;  2CUB A;  2SEM A;  2DJQ A;  2LNH B;  1GCQ C;  4ZNX A;  1QWF A;  2LP5 A;  3EG2 A;  4AG1 C;  4AFZ C;  3M0Q A;  2RQT A;  1V1C A;  4D8K A;  1WA7 A;  3I35 A;  1Y57 A;  2OI3 A;  1ABQ A;  1MV0 B;  5IHI A;  1AZG B;  2K6D A;  4OML A;  1T3L A;  4J9F A;  2HBW A;  4LNP A;  2G6F X;  2LX7 A;  4J9H A;  1NG2 A;  3GBQ A;  1RUW A;  3VS1 A;  4GBQ A;  1W6X A;  5FWB A;  1GFC A;  4OMQ A;  2NUZ A;  4RTX A;  4E6R A;  4X1V A;  5IXF A;  2O9V A;  3VS3 A;  1SRL A;  4CC7 A;  1PWT A;  5FW9 A;  1WXB A;  2X3X D;  3SHW A;  1SHF A;  2ED0 A;  1VA7 A;  2KE9 A;  1BBZ A;  2KRS A;  1SEM A;  2AKL A;  2DA9 A;  2DE0 X;  2LJ3 A;  1K0S A;  2EVR A;  2A37 A;  3JV3 A;  1UJ0 A;  1PHT A;  3UF4 A;  1PRL C;  2CT4 A;  2DBM A;  2I0N A;  2KBT A;  1M30 A;  1GCP A;  1YP5 A;  2FG0 A;  4EIK A;  2O2O A;  2OAW A;  3REA B;  1ARK A;  1Z9Z A;  2OJ2 A;  2J6O A;  2V1Q A;  3RBB B;  1YWP A;  1WLP B;  3EG1 A;  2HCK A;  3UA7 A;  2FO0 A;  2SRC A;  3FJ5 A;  4DEX A;  1XOV A;  4JPB W;  1SSH A;  1QLY A;  3QWY A;  1OV3 A;  1ZSG A;  2J06 A;  3NHN A;  2GNC A;  1NEB A;  3CQT A;  5EC7 A;  2GQI A;  1AWX A;  2EGC A;  1UE9 A;  1BK2 A;  1QKX A;  1ZUY A;  1CSK A;  1G83 A;  4RTU A;  2LCS A;  1ZBJ A;  3LH5 A;  2YT6 A;  1UFF A;  3TVT A;  2ROL A;  1OPL A;  3VRZ A;  2CH4 A;  1YCS B;  1GFD A;  2CH4 W;  2H8H A;  2C0T A;  2EYZ A;  4KRT A;  4K11 A;  5GJV B;  2ESW A;  3NGP A;  2AZV A;  2XMF A;  2CSI A;  3H41 A;  2RQR A;  4FSS A;  4RTT A;  3M0U A;  1T3S A;  2QDL A;  2VKN A;  3H0F A;  1ZUU A;  2FPF A;  2HDA A;  3A98 A;  1PKT A;  4LN2 A;  3VS5 A;  1VYU A;  4OMM A;  2EYX A;  2W0Z A;  3I5S A;  4AFS C;  3VS0 A;  1T0J A;  4OMN A;  2CRE A;  1W1F A;  2A36 A;  4JJB A;  3M0R A;  2J6K A;  2CSQ A;  1M3B A;  2KEA A;  4RTZ A;  1EFN A;  2YUN A;  2KT8 A;  4J9D A;  4OMP A;  1WXU A;  2KXC A;  3I9Q A;  4J9E A;  4AFQ C;  4D8D A;  2KRO A;  1SHG A;  2FRY A;  2FPD A;  2DYB A;  2YSQ A;  2JM8 A;  1WXT A;  3VS4 A;  3EG3 A;  1K9A A;  1ZUK A;  1YNZ A;  3UA6 A;  2ED1 A;  2JT4 A;  1UDL A;  1WIE A;  1NYF A;  1RLQ C;  2JTE A;  2L3Q A;  2DRM A;  1PRM C;  5IHN A;  1B3Q A;  2K3B A;  2CT3 A;  1OOT A;  2VWF A;  5IH2 A;  1GBQ A;  1KSW A;  2DX1 A;  1AD5 A;  1G2B A;  2EBP A;  1NEG A;  2ECZ A;  5GJW B;  1ZX6 A;  2X3W D;  1NLP C;  2EGA A;  3H0H A;  2EW3 A; 
#chains in the Genus database with same CATH topology
 4PLI A;  1UGP B;  2V8I A;  4C8Q G;  3CPW A;  3I56 Q;  5GMK m;  4CC2 A;  1UGQ B;  4IIM A;  2D8J A;  3VRY A;  1YIJ T;  4X9D A;  3OYD A;  3PIP A;  2L2P A;  4MML A;  1TWB A;  3REB B;  3CCL A;  4NL3 A;  3CCR A;  1KIK A;  4IUU A;  1B7T A;  1X27 A;  2DRK A;  4C0G A;  1MGQ A;  3CCU Q;  2D0N A;  1IZ6 A;  4HVV A;  2YUP A;  3PIO A;  3NFC A;  2COY A;  2K5L A;  3JCM X;  3M57 A;  2QXF A;  4J83 A;  1YI2 A;  1OQK A;  2RN8 A;  1KQS A;  5CO7 A;  1PC0 A;  4PJO A;  1GBR A;  4VUB A;  3OYE A;  2HSP A;  1J3T A;  3THK A;  2IPO B;  2XI9 A;  1BIA A;  2DBK A;  3UWN A;  2O4X A;  4J9G A;  4N4G A;  3OS0 A;  1YJW T;  4LD9 K;  1ZBX A;  3GNF B;  3QJY A;  5GMK e;  1MUZ A;  3KUF A;  3OS5 A;  1M2O A;  3CCV A;  4C0Z A;  3DB4 A;  4L5G A;  2E6Z A;  1MND A;  3X24 B;  4LDV A;  3EHQ A;  2BE7 D;  1B34 B;  3U23 A;  2DAQ A;  1VQO A;  2HD0 A;  1WDX A;  3CMA Q;  2HAX A;  1VQ9 Q;  1AWJ A;  4KGV B;  5J39 A;  4ZTJ A;  3I55 T;  3JCM V;  2P0Q A;  1PKS A;  2LVM A;  1KJW A;  2HEQ A;  2D1X A;  3HSB A;  2MPX C;  4M75 G;  2BZY A;  4YTL A;  4HA8 A;  4BAC A;  5LJ5 j;  2ZCF B;  1H92 A;  1WHK A;  2LT4 A;  5GAN j;  1IRX A;  2YDL A;  1K0X A;  2RJC A;  2GGR A;  5FU7 B;  2QEX Q;  5KCO A;  1TU0 B;  3CC7 A;  1VQK A;  1OEB A;  2OTL A;  3BFM A;  1UTI A;  4M77 B;  3M53 A;  4JJN K;  4Z89 A;  4Q5W A;  4IUV A;  3MET A;  2L8D A;  3BDU A;  2FRW A;  5CKE A;  3VS6 A;  3QDF A;  3R6N A;  2E10 A;  2VYT A;  2QGG A;  1IO6 A;  2F2X A;  2KVQ G;  3VJP A;  4CC3 A;  2P0K A;  1WJQ A;  3VV0 A;  2JJ9 A;  4F14 A;  1ZSZ A;  1YBY A;  4JZ3 A;  1VYV A;  1OZ2 A;  4Z8A A;  4F7U E;  2EYQ A;  4IUP A;  3NTI A;  1M90 R;  5AT1 B;  3OBW A;  1M3A A;  1K8A U;  3JCM c;  2DYI A;  1VQM Q;  2C06 A;  4GLM A;  1WGS A;  4QQD A;  2DVJ A;  2DFU A;  3ZBD A;  3QII A;  2ABL A;  3UPU A;  3O5Z A;  2EQI A;  1U3O A;  3QG1 A;  3KXT A;  7AT1 B;  3HRT A;  2COW A;  2ZPE B;  3RKY A;  2C0O A;  2DIL A;  1KD1 R;  1Y71 A;  1W4S A;  3CC4 A;  1HXD A;  1OU8 A;  3OYA A;  1WI7 A;  4L6V 5;  3GF5 A;  3EFO B;  2OAU A;  2RQW A;  4PJO G;  4M75 E;  4QW2 A;  4BE1 A;  1I5O B;  1K9M R;  2K2M A;  2CUD A;  2CZ7 B;  2RB6 A;  3G71 A;  2KK4 A;  1KQ2 A;  1YHQ T;  4HCZ A;  2CP5 A;  5GMK h;  3JB9 G;  1Q86 U;  5DY9 A;  4GLK A;  3NTH A;  1I07 A;  5GAN 3;  2Z0W A;  2M1H A;  3HFN A;  3OYM A;  1QWE A;  2JXB A;  2ZGW A;  3QBY A;  4WCI A;  2LC4 A;  3OMC A;  5GAN 6;  2W10 A;  4ORZ A;  2L3R A;  1M2V A;  2P4R A;  2EQM A;  1NJI U;  2EYW A;  4FW1 A;  2CGH A;  1I4K 1;  5KYU A;  2HL3 A;  1NPR A;  3CC2 A;  3F70 A;  4MZP A;  5LJ3 e;  4C92 B;  2V26 A;  5GAM h;  1VQ6 A;  4FU6 A;  4M78 D;  4AFZ C;  1R0B G;  2RQT A;  3EH1 A;  3CME Q;  2RJE A;  3JCM h;  2OI3 A;  2OTJ A;  3WVD B;  2HSE B;  1RAD B;  3GBQ A;  1MHN A;  1RUW A;  1W6X A;  4XTY A;  4OMQ A;  4NOY A;  1VQP A;  2NUZ A;  1XNI A;  2XK0 A;  4PFP A;  4IKF A;  2CP6 A;  2O9V A;  2VUB A;  3CCQ Q;  3CCS Q;  5EG2 A;  2CKK A;  3FJP A;  3PT9 A;  1SHF A;  3G6E A;  2X4W A;  1YIT A;  2KI7 A;  2GF7 A;  3OYG A;  1LVK A;  2KQW A;  2MWP A;  4JDS A;  3GNG A;  1SEM A;  2DTO A;  1LJO A;  3FB9 A;  2EVR A;  2ZZD A;  1VUB A;  3CCE Q;  1PHT A;  3QPH A;  2KBT A;  3S6W A;  4ELZ C;  1YP5 A;  3QYH B;  3QYG B;  4M77 D;  4M7D B;  5CKB A;  3V8K A;  1ARK A;  4FIB A;  2E6N A;  4C92 F;  4AMC A;  1Q82 R;  1BI3 A;  3RBB B;  2PUO B;  3EG1 A;  2SRC A;  4DEX A;  1QLY A;  3NHN A;  1LPL A;  5GMK j;  1ZHI A;  3R6O A;  1NEB A;  4P5N A;  4XK8 E;  3JB9 J;  3OBY A;  1XQH A;  2EGC A;  1M1K R;  4JRQ A;  4IUQ A;  2LQ8 A;  1CSK A;  1G83 A;  2LCS A;  3LGL A;  2CH4 W;  3SWN B;  4KRT A;  5CKH A;  2ESW A;  1QCN A;  2AZV A;  2XMF A;  1QP2 A;  4A53 A;  1RAB B;  2RQR A;  4FSS A;  4RTT A;  4EDU A;  2L5Q A;  3MP6 A;  1T3S A;  1QQJ A;  2VKN A;  3H0F A;  2NUP A;  2GFU A;  1ZA1 B;  5GAM j;  2QQS A;  4C0D B;  5D6Y A;  5A0G A;  4OMM A;  5GAN e;  1SKU B;  2FL7 A;  1T0J A;  4PNO A;  4EMH A;  5LJ5 g;  4M7D F;  2O01 E;  5D7U A;  4J9D A;  1TUG B;  2JTF A;  5GAN g;  1WXU A;  2DET A;  2K5I A;  4J9E A;  4OB1 B;  1YIJ Q;  1RL2 A;  3LH0 A;  2FPD A;  4BI3 A;  1M90 C;  4O5V A;  1VQ7 A;  3EG9 B;  2ED1 A;  4XU2 A;  1RLQ C;  1VQN A;  2QDY B;  5LJ3 h;  4M7A A;  5IHN A;  4RCC A;  5FU7 C;  4ME7 A;  2CT3 A;  4KBM B;  1N9S A;  2VWF A;  2DX1 A;  3CBO A;  5I2M A;  1VQL A;  8ATC B;  1NEG A;  3PGG A;  5GJW B;  4LDU A;  1IB8 A;  3G4S T;  2EW3 A;  2O88 A;  4F17 A;  3A8M B;  1KD1 C;  1AWO A;  1Y7X A;  2MWO A;  1YJW Q;  3EGX A;  3CXC S;  3WVE B;  2E65 A;  4EMK B;  2K9G A;  2AK5 A;  1MMD A;  3CME T;  2K3X A;  4OMO A;  4PKC C;  3UAT A;  4F7U A;  3LWH A;  4BE2 A;  1RAH B;  4E2F B;  1SG5 A;  2RJF A;  1K9M C;  2JW4 A;  4JZ4 A;  2E3I A;  2Y90 A;  2ZPF B;  1IHW A;  3QWX X;  2DKG A;  2RMO A;  1K73 R;  2LZ6 B;  5LJ5 f;  5FU6 B;  1AEY A;  3V8L A;  3I55 Q;  3NMZ C;  2DTI A;  1R77 A;  3JCM Q;  4MDX A;  4PJO B;  2KNB B;  4KH0 B;  1E6G A;  3HRU A;  5I22 A;  5DM7 R;  4QKU A;  1R8O B;  4C8Q D;  1MMN A;  2YRD A;  1AWW A;  2Y4Y A;  3JCM P;  2KYB A;  1WHL A;  2B8A A;  2YRV A;  2P0P A;  2HKN A;  2RI2 A;  5HCK A;  2COZ A;  2XKO C;  1N27 A;  3URG A;  1D3B B;  1YN8 A;  1BCO A;  4OB0 B;  4DBR A;  2D6F A;  3RUX A;  3M59 A;  1WQW A;  2LJ0 A;  1YJN Q;  3TSZ A;  5KE3 A;  5IT9 E;  2GQV A;  4IIO A;  1U06 A;  1N9R A;  1JJ2 A;  1X2Q A;  2XHC A;  4CRI A;  1SPK A;  4ZGJ B;  2CP7 A;  4JJC A;  3CXC P;  1UUE A;  2HQE A;  5GAN 8;  2L89 A;  4XTX A;  1HYO A;  3DKM A;  4F04 B;  5L23 A;  1UHC A;  2A08 A;  1O75 A;  4A63 B;  4FSX A;  1AHJ B;  1QVG A;  5FLX E;  2RQU A;  2JUF A;  1VIF A;  5CAI A;  5LJ3 j;  2XDP A;  1T0H A;  1NLO C;  2DD5 A;  2V1R A;  2A28 A;  2XU8 A;  3LLR A;  2DXT A;  1PSF A;  1EZZ B;  3VS7 A;  3OB9 A;  2JNG A;  1VQ8 T;  4J6X A;  1VQ5 Q;  2DL4 A;  2K4Y A;  3RNJ A;  1IXD A;  2JN0 A;  3ULR B;  4ZN3 A;  5IXB A;  4C92 C;  2IVW A;  2CDT A;  2KDS A;  1QP3 A;  5D6X A;  4M75 D;  3OYK A;  2M51 A;  1KC8 R;  4M7A G;  4E7L A;  3IQL A;  1Q82 C;  2CZ1 B;  5GAO q;  2XG8 D;  4OF1 A;  1FYN A;  3QZ9 B;  3CD6 T;  2DER A;  4A4G A;  2LMJ A;  1X6B A;  4PJN A;  2J05 A;  4BB7 A;  1EIF A;  4JUV A;  1I5L A;  1E7O A;  2KYM A;  3PVQ A;  2GFA A;  1FMK A;  4J6W A;  4DOV A;  1YHQ Q;  1M1K C;  2MCN A;  4ZTF A;  2JTM A;  3VKI A;  1H8K A;  3QHS A;  1AZE A;  3MEA A;  2MI6 A;  1Y0M A;  3OW2 S;  4F7U G;  4E47 A;  4X34 A;  2ROT A;  2E64 A;  2L3P A;  1K1Z A;  3MP8 A;  1SSF A;  3EGD A;  1QKW A;  5CQY A;  4C5I A;  3X20 B;  2VAS A;  3RDV A;  1JXO A;  2DNU A;  3L2Z A;  2R57 A;  3CCJ T;  4M78 B;  4M4Z A;  1YJ9 T;  2MOX A;  4RG8 A;  4M7D C;  1K76 A;  3CCU A;  3INZ A;  6AT1 B;  2HZY A;  4WF2 A;  2CZ6 B;  2CS7 A;  2YUO A;  4D6W A;  1SF9 A;  3JCM W;  4NL2 A;  4JS5 A;  2E1H A;  2VVK A;  2DEQ A;  3M55 A;  1ABO A;  1S72 T;  3TEE A;  2BZX A;  2FEI A;  1G3S A;  2F2W A;  4LDW A;  1RAE B;  3HPW A;  2C0I A;  1X6G A;  4J7I A;  1M3C A;  5HK3 A;  1CKA A;  2HL5 C;  1A0N B;  1HSQ A;  2KGT A;  2YUQ A;  2BKD N;  4KUL A;  1HK9 A;  1KHC A;  2FPE A;  4OB3 B;  4Y92 A;  5GAM e;  3RES A;  4HVU A;  3CC7 Q;  1VQK Q;  3SWN C;  1FX7 A;  3C12 A;  1X6O A;  3L2V A;  4PJO D;  2EKH A;  5GAM g;  3CMA A;  1VQ9 A;  3JCM e;  3EH2 A;  2LNH B;  4M7A E;  1GCQ C;  4OMF B;  3DLM A;  3JCM g;  3NTK A;  1YJN T;  2F69 A;  1W2B S;  4PJJ A;  3OW2 P;  4C0D C;  4DBF A;  5KYW B;  1WHH A;  1PD1 A;  4M78 F;  2EFI A;  2V8K A;  1ABQ A;  2QAZ A;  1G3W A;  2JVV A;  1PD0 A;  4LNP A;  3HFO A;  2G6F X;  1G8X A;  2QQB A;  3GOX A;  2DXB A;  2DVE A;  2QEX A;  1K73 C;  1IGQ A;  3QO3 A;  1Y96 A;  5IXF A;  4JS4 A;  4CC7 A;  2QA4 A;  3E1S A;  5FW9 A;  5LL6 S;  1WXB A;  3SHW A;  3VUB A;  2ED0 A;  1PG5 B;  2G3R A;  2QAS A;  3HKS A;  3C95 A;  5KYY A;  1XTD A;  1VQ5 T;  2KE9 A;  3PNW C;  1VOM A;  2H3E B;  4KGX B;  5GAO p;  4PL6 A;  3AHU A;  3GLX A;  3CC4 Q;  5FRO A;  4QVC A;  1M5Q 1;  1M30 A;  4EMK C;  4EIK A;  3SB2 A;  5IN1 A;  2YWW A;  3CCL T;  5LJ5 d;  4M77 F;  4OGC A;  3VUZ A;  3CCR T;  5CCA A;  2RHU A;  2DPP B;  1YWP A;  3H6Z A;  3QKJ A;  3UA7 A;  3TU4 K;  3FJ5 A;  2RA2 A;  3CCM A;  1VQM A;  4IUT A;  3QWY A;  1ZSG A;  1W2B P;  1G3T A;  3JRZ A;  2DTH A;  1Q81 U;  1AWX A;  4J6Y A;  1YI2 T;  2XD0 A;  3L42 A;  1M9S A;  5KYX B;  1QKX A;  1ZUY A;  1JBM A;  2NUT B;  2PU9 B;  1F1B B;  3M4Y A;  2HQX A;  3ER0 A;  3TVT A;  2ROL A;  2E3H A;  2CH4 A;  2X4Y A;  1GFD A;  2H8H A;  3CCV T;  4K11 A;  5GJV B;  2DO3 A;  1B34 A;  3H41 A;  4XU1 A;  5DLO A;  4NS5 A;  2VC8 A;  2PQW A;  3G1J A;  4PFO A;  1VQO T;  4LDX A;  5D6W A;  2FPF A;  4RMO A;  2QQR A;  4BY6 C;  3A98 A;  1PKT A;  3VS5 A;  1VYU A;  2EYX A;  2W0Z A;  2WSE E;  3G4S Q;  4OMN A;  3DLL A;  1XJW B;  1KC8 C;  2A36 A;  4JJB A;  2J6K A;  2CSQ A;  2FYK A;  3LYI A;  4OMP A;  2I2L A;  3I9Q A;  5LJ3 g;  2ZPH B;  2KRO A;  1SHG A;  4AT1 B;  3A8O B;  2DYB A;  2YSQ A;  2JM8 A;  1WXT A;  4FL6 A;  3EG3 A;  3FEO A;  1YNZ A;  4C8Q B;  2EJG A;  1BIB A;  3UA6 A;  3PFS A;  3A8G B;  1NYF A;  2WSC E;  2GCX A;  3M56 A;  4M77 A;  3CC7 T;  1VQK T;  1M8V A;  2OTL T;  1OOT A;  3G6E Q;  1N8R R;  3SD4 A;  3OYC A;  1AD5 A;  2ECZ A;  2RK1 A;  4OVA A;  4UC4 A;  1IRE B;  5GAO l;  3MCA B;  3KFV A;  1LOJ A;  5GAN 4;  5J26 A;  4LXC A;  2E12 A;  2CP0 A;  2WAC A;  2RQV A;  4F16 A;  1S1N A;  1SRM A;  3RMS A;  4N0A C;  4E7H A;  4PLL A;  5J3B A;  1UGV A;  3ZEH A;  3E2U A;  2BZ8 A;  1ZQ1 A;  3HTR A;  3S3M A;  1Q7Y R;  3JB9 H;  4OGE A;  1OX9 A;  2QA4 T;  2K57 A;  3CCQ A;  4LD6 A;  4L59 A;  3CCS A;  2RK2 A;  4MZM A;  4ESR A;  3FC3 A;  3UDC A;  1QCO A;  1KFZ A;  2VV5 A;  5LJ3 f;  2YRC A;  3RER A;  4FYW B;  4DQ2 A;  3ME9 A;  2PNI A;  3JAM E;  4LE9 A;  5IHK A;  3MHX A;  3LWI A;  2PVO B;  5AYF A;  4C8Q F;  1MMA A;  5HY6 A;  3CCE A;  2RNA A;  2A3L A;  2OX7 A;  2QG9 B;  3A5Z B;  4N4I A;  4RUG A;  1AVZ C;  2NWM A;  3CC4 T;  1BI1 A;  1WYX A;  3M0T A;  1OUL A;  3EFO A;  3A8L B;  3SDZ A;  4HT9 A;  4DEY A;  1NPP A;  3PE0 A;  4M78 C;  1UEC A;  4M75 B;  4B6M A;  2X9H A;  1VQ8 Q;  1WHG A;  2GTJ A;  1OU9 A;  3G71 T;  2ZPG B;  4XTU A;  4JRK A;  3OQ5 A;  1VQ4 A;  2X51 A;  1WHM A;  2CZ0 B;  2LJ1 A;  2LQW A;  1RLP C;  3M9Q A;  2JMA A;  4FYX B;  1NE8 A;  3V7C A;  1JO8 A;  3L2U A;  2K5F A;  1AOJ A;  1VQ7 Q;  2ENM A;  2B86 A;  2J7I A;  1VQN Q;  1BU1 A;  2VB6 A;  5L8R E;  2F2V A;  1YCY A;  3CD6 Q;  1M90 U;  2PVD B;  4E7S A;  2EQU A;  1RAC B;  3VYG A;  5KCH A;  1JXM A;  3E9F A;  4MDW A;  3CC2 T;  5HKC A;  4C92 A;  5C0M A;  4M77 C;  2IIM A;  2EYY A;  3DB3 A;  2CP2 A;  4DBQ A;  1VQ6 T;  1EX4 A;  4KUI A;  1RI9 A;  4E7K A;  3JB9 I;  1G5V A;  1JJ2 S;  3OYI A;  2RH2 A;  4M75 F;  1YIJ A;  2OTJ T;  2AZS A;  2K7A A;  1KD1 U;  1UGR B;  1D1C A;  3M5A A;  1GXI E;  3PMI A;  4ZN1 A;  4FW2 A;  3CCJ Q;  2RJD A;  1YJ9 Q;  3M0S A;  5KH6 A;  4LUE A;  2DIG A;  2F1L A;  1I8F A;  4C5G A;  1B07 A;  4O6J A;  4R0K A;  1C6V X;  1VQP T;  1UG1 A;  2DMO A;  4ZGE B;  1RAF B;  2DZC A;  1JU5 C;  1QVG S;  1K9M U;  4AFU C;  5CIU A;  1FXX A;  4OB2 B;  2JOY A;  3LGF A;  1S72 Q;  2E41 A;  3G6E T;  1YIT T;  2E5K A;  3FRN A;  2EGE A;  3JSC A;  1QVF A;  5GAN f;  2DLP A;  1YJW A;  2JS2 A;  2O4X B;  4LUD A;  4XTZ A;  3L2Q A;  3G7Z A;  2YHT A;  4M7A D;  2BTT A;  1TUD A;  1I1J A;  2EKO A;  2RI5 A;  1KG1 A;  4M7D A;  2L3S A;  4XTW A;  3HL8 A;  4ELY C;  1ZLM A;  2QTV A;  3CEY A;  3OYY A;  2KMT A;  4RKU E;  3OA6 A;  2DL5 A;  2DF6 A;  2EQK A;  2DXU A;  3V7R A;  3CPW S;  1OX8 A;  1K8A R;  3RR6 A;  2EIF A;  2D8H A;  3I55 A;  3PMT A;  4E7I A;  4JJD A;  4RG2 A;  3SEM A;  2DZ9 A;  2KY9 A;  2LTO A;  4EMG A;  1N6A A;  1JEG A;  1FMV A;  1MNE A;  1WZO A;  3RMQ A;  2KRN A;  1JJ2 P;  4QQG A;  2FZK B;  2JMC A;  2VGN A;  3SWN A;  1JQQ A;  2M9U A;  4QVZ A;  1WJS A;  4PJM A;  2HBP A;  4MZT A;  3L1A A;  2RPN A;  1KQS S;  2PTK A;  4HCB A;  1X01 A;  3LX7 A;  1N5Z A;  1GCQ A;  4DBH A;  2M02 A;  5GAN 2;  1D1B A;  1QVG P;  1N8R C;  2DL8 A;  4X9C A;  2CUB A;  1M1F A;  2SEM A;  4PJO F;  2LRQ A;  5HK0 A;  4M77 E;  1VQ4 T;  2M0O A;  1FMW A;  1AT1 B;  2LP5 A;  3H9N A;  2ZPB B;  3EG2 A;  1Q86 R;  5FRM A;  1V1C A;  1WA7 A;  3I35 A;  1Y57 A;  4FT2 A;  1MV0 B;  1AZG B;  2K6D A;  1ZSZ B;  3C4S A;  2HMA A;  2HBW A;  4J9H A;  1NG2 A;  3CCL Q;  1Q7Y C;  1R0C B;  3EG9 A;  1VQ7 T;  3MPU B;  4C92 G;  4GBQ A;  3CCR Q;  3CPW P;  1GFC A;  1NJI R;  4BUG A;  1VQN T;  2XDD A;  4C8Q C;  1Q82 U;  4RTX A;  1OZ3 A;  4E6R A;  3VS3 A;  1SRL A;  1C0M A;  3OYJ A;  2HNI A;  5DLQ E;  1VQL T;  2PUK B;  1YI2 Q;  1VA7 A;  2VGM A;  3CBM A;  1IHV A;  2DA9 A;  2DE0 X;  1M1K U;  2LJ3 A;  4HCC A;  4EMK A;  3CPF A;  1UJ0 A;  3I56 A;  2K3Y A;  3UF4 A;  2CT4 A;  1KQS P;  2DBM A;  3CCV Q;  2FG0 A;  2M16 A;  2O2O A;  2OAW A;  5M9O A;  1O9S A;  4R56 A;  1Z9Z A;  2OJ2 A;  2J6O A;  2XIC A;  1VQO Q;  3LW5 E;  5LJ3 d;  2HKQ B;  3V8J A;  3T9N A;  2FO0 A;  2RD1 A;  1TS9 A;  1BCM A;  4JPB W;  1RAA B;  4PK4 A;  1OV3 A;  2DK3 A;  2J06 A;  2R5M A;  3PTA A;  1RAI B;  2GNC A;  4ZGD B;  1YHQ A;  3AT1 B;  3CQT A;  4B9X A;  5EC7 A;  4OP0 A;  2GQI A;  2EWN A;  1D0Y A;  1UE9 A;  4M7D G;  1BK2 A;  4Y28 E;  4RTU A;  1ZBJ A;  3SFM A;  2YT6 A;  2MK5 A;  3HRS A;  3N5B B;  1OPL A;  3VRZ A;  4A4F A;  2C0T A;  3NGP A;  2DJZ A;  1P92 A;  3MEW A;  1D3B A;  1D0Z A;  2QI2 A;  3RIR A;  1M2V B;  3FIF A;  5GMK l;  2OTL Q;  1D1A A;  5KYU B;  4M75 C;  2QDL A;  1ZUU A;  2FHD A;  2HDA A;  2MAM A;  4XU0 A;  4LN2 A;  4WTO B;  1G3Y A;  2FVU A;  3V7S A;  4C92 E;  1U1S A;  2CRE A;  1W1F A;  2R58 A;  4DOW A;  2EJF A;  5GMK i;  3QUI A;  1M3B A;  4RCB A;  4RTZ A;  1EFN A;  3JB9 D;  1UEB A;  2KT8 A;  4XTV A;  4J7F A;  4AFQ C;  2FRY A;  2VXE A;  4C8Q E;  2F5K A;  3OY9 A;  3VS4 A;  1K9A A;  2LT1 A;  1RAG B;  2FZG B;  2JT4 A;  3OW2 A;  2EQJ A;  2JTE A;  2QA4 Q;  2L3Q A;  2DRM A;  1PRM C;  4FCY A;  1B3Q A;  2K3B A;  2D0Q B;  2EAY A;  1K73 U;  4QQ6 A;  2AIR B;  1U1T A;  3OS2 A;  1G2B A;  9ATC B;  4J5Y A;  5CKD A;  4A54 A;  2X3W D;  1NLP C;  2EGA A;  1M8M A;  3PVL A;  1H64 1;  4HXJ A;  2J6F A;  2RF0 A;  4N0A A;  1V29 B;  1LCK A;  1E6H A;  1NM7 A;  3EHR A;  4HCK A;  2E4H A;  1DJ7 B;  5GAM f;  4N4H A;  4M7D E;  3EG0 A;  2P4T A;  4XQ3 A;  4A4H A;  1K8A C;  3CCM Q;  3QXE B;  4Z88 A;  1GRI A;  3S3N A;  3JCM f;  1UJY A;  3I5R A;  1X69 A;  3VS2 A;  5GAN d;  1NYG A;  2XDB A;  3ZL7 C;  3G71 Q;  1TG0 A;  1NBE B;  1YFN A;  1W70 A;  3MKD A;  2LX9 A;  4FYY B;  2RO0 A;  4KGZ B;  5FU6 C;  1TH7 A;  2JZ2 A;  3BE3 A;  3OS1 A;  4KUD K;  1KHI A;  1WFW A;  4A4E A;  4PJO C;  1TOV A;  3I56 T;  1BI2 A;  4V2S A;  2RHI A;  2DXC A;  4LDY A;  3JCM J;  4RTW A;  3J7A F;  3JCM b;  4M78 A;  1W2B A;  2ZPI B;  3OYB A;  2XID A;  3TQ7 P;  2LCL A;  4EPC A;  5GAO m;  1Q81 C;  2BIV A;  3CCU T;  2MF2 A;  3C0C A;  3E19 A;  4JRI A;  2JS0 A;  2O9S A;  2CYZ B;  1TUC A;  4HKE A;  3EGU A;  2EPD A;  3CC2 Q;  1TXQ A;  2NUP B;  1WQ7 A;  4Z02 A;  1BKB A;  2WSF E;  2KT1 A;  1OI1 A;  2DIQ A;  3L2W A;  1Q86 C;  3Q1J A;  2V8J A;  2KRM A;  3A1P A;  1VQ6 Q;  3MO8 A;  3MJX A;  4ATO A;  4GY5 A;  3NPF A;  3MP1 A;  1UHF A;  2OTJ Q;  1TSF A;  1KC8 U;  5A0L A;  1PNJ A;  5CVI A;  4AG2 C;  1GL5 A;  3TSW A;  1NJI C;  4RTV A;  3GPL A;  4RTY A;  1CKB A;  4HVW A;  3EAE A;  1VQP Q;  2JM9 A;  3CMA T;  2X35 A;  1VQ9 T;  4M7A B;  2EJ9 A;  2ATC B;  1Q95 G;  1M4Z A;  5ECA A;  2IG0 A;  3KBG A;  1Z9Q A;  5C6S A;  1YIT Q;  2LDM A;  3G4S A;  3M0P A;  5CK9 A;  5KYW A;  2LQK A;  4J9C A;  2QQA A;  5KE2 A;  2AKK A;  5IAY A;  3EGX B;  3OYF A;  3CME A;  1M1G A;  2RHX A;  2K79 A;  2DL3 A;  3OYL A;  2GTO A;  4J9I A;  1ZSZ C;  4F7U B;  3OSV A;  2QEX T;  2QGF B;  2YLB A;  5I11 A;  4CI0 C;  4KH1 B;  4QT7 A;  2YLC A;  1HD3 A;  1X2K A;  4CC4 B;  3FLG A;  1OYX A;  3O8V A;  4BDZ A;  5GAO r;  1M27 C;  4IUR A;  4PJO E;  1UGS B;  3J80 E;  3P8B B;  2NLU A;  3X28 B;  1NZ9 A;  4BDY A;  4FT4 A;  2A7Y A;  2KR3 A;  2E5Q A;  3QJ6 A;  4BI4 A;  2L0A A;  3M54 A;  2GBQ A;  1U8R A;  1WJR A;  4M7A F;  2RI3 A;  5I21 A;  5KYN A;  5FWC A;  3X26 B;  3P8D A;  2BE9 B;  8AT1 B;  1RI0 A;  4C5E A;  1X43 A;  1I0C A;  5GAN 5;  1OPK A;  1BB9 A;  3RKW A;  3CCM T;  2QQ9 A;  4KT0 E;  1VQM T;  1VQ4 Q;  1K4U S;  2DM1 A;  4J9B A;  2KXD A;  1KQ1 A;  4J8O A;  1UB4 A;  4E7Z A;  1YWO A;  2DEU A;  2LQN A;  1VYT A;  5I2S A;  5KYX A;  1H3H A;  4M78 G;  2NUT A;  2PZ1 A;  1WX6 A;  1QCF A;  3M58 A;  2M0Y A;  4F7U F;  4PJL A;  2O31 A;  2MIO A;  2KAF A;  3H0I A;  1IGU A;  3BW1 A;  3H8Z A;  1QVF S;  4ANJ A;  3OMG A;  1U5S A;  1C1A A;  3TRE A;  1HJD A;  2DL7 A;  2KSS A;  1H3Z A;  2HQH A;  1MV3 A;  2DJQ A;  1VQ8 A;  4B9W A;  5LJ5 e;  1KK7 A;  2QTX A;  4ZNX A;  1VQL Q;  1QW1 A;  3VYH B;  1V76 A;  2FB7 A;  1PCX A;  2DD4 A;  5A2Q E;  1QWF A;  4AG1 C;  1X75 C;  3RKX A;  3M0Q A;  1D0X A;  4D8K A;  3HHT B;  3QZ5 B;  4BI8 B;  2MMP A;  2X4J A;  2D9T A;  5IHI A;  4OML A;  5A0D A;  1T3L A;  3WXM B;  4J9F A;  4E7J A;  2LX7 A;  1WHJ A;  4M77 G;  4C8Q A;  3VS1 A;  2RM4 A;  3CD6 A;  3VU3 C;  5FWB A;  4JRP A;  5CKF A;  2QYZ A;  3S3O A;  4QVD A;  2CP3 A;  4X1V A;  3BDL A;  1PWT A;  4TVR A;  4XU3 A;  1PM3 A;  2NYS A;  2X3X D;  3EFR A;  1BI0 A;  1WPY A;  3C94 A;  2E70 A;  3HP9 A;  2LCC A;  1BBZ A;  2KRS A;  2AKL A;  3MEU A;  3M4G A;  2VXF A;  1K0S A;  1TTH B;  3UT1 A;  5GAM d;  1ACM B;  2A37 A;  3JV3 A;  1QVF P;  2QK0 A;  4DA4 A;  1PRL C;  2Y4X A;  2I0N A;  2H3J A;  1GCP A;  3CCJ A;  2AHJ B;  3EGD B;  4Y91 A;  3JCM d;  2MYS A;  1YJ9 A;  3REA B;  4C92 D;  3L2R A;  4M78 E;  3EFS A;  4JLI A;  2V1Q A;  5FRN A;  4C0F A;  1WNL A;  1WLP B;  1I81 A;  2HCK A;  3X25 B;  5GAN 7;  3CCQ T;  1XOV A;  2PVG B;  1SSH A;  3CCS T;  3MEV A;  2P84 A;  4BD3 A;  1S72 A;  3D7S B;  1JRI A;  2ZAE A;  3BY7 A;  2YXY A;  5CQX A;  4JLG A;  2F5T X;  1Y07 A;  3LH5 A;  3QDR B;  3ASK A;  1UFF A;  1ZA2 B;  3CBP A;  4FYV B;  2LNV A;  3CCE T;  1YCS B;  2EYZ A;  3E9G A;  2CSI A;  4M75 A;  3GIB A;  4BY6 B;  1QMC A;  3M0U A;  3OYH A;  3FDR A;  5GAO n;  3OYN A;  2RHZ A;  4II1 A;  1LNX A;  1N8R U;  3CXC A;  1YJN A;  2FZC B;  1Q81 R;  1MMG A;  4XAX B;  3I5S A;  4AFS C;  3VS0 A;  2BUD A;  4M7D D;  4HT8 A;  4A4K A;  2A0F B;  4C5H A;  3M0R A;  2KEA A;  4FM4 B;  2YUN A;  3QSU A;  2R5A A;  2KXC A;  3JB9 F;  3A8H B;  3P8H A;  2RHY A;  4D8D A;  4MMK A;  3GP8 A;  1JB0 E;  3OSS C;  5LJ5 h;  3J81 E;  1ZUK A;  4BE0 A;  1FWZ A;  5CR2 A;  5GAN h;  1UDL A;  1WIE A;  1VIE A;  1D09 B;  1Q7Y U;  1PSE A;  4R55 A;  3ZFJ A;  1Y96 B;  2K2V A;  1BYM A;  2AT1 B;  5IH2 A;  3TCJ A;  1GBQ A;  1KSW A;  4M7A C;  4PFZ A;  2EBP A;  1QVP A;  2X4X A;  1ZX6 A;  1VQ5 A;  5KYY B;  3H0H A; 
#chains in the Genus database with same CATH homology
 1M8M A;  3KFV A;  2O88 A;  4F17 A;  3PVL A;  1AWO A;  4HXJ A;  2J6F A;  2RF0 A;  2RQV A;  1LCK A;  4CC2 A;  4F16 A;  1E6H A;  1NM7 A;  4IIM A;  3EHR A;  2D8J A;  2K9G A;  2AK5 A;  1S1N A;  4HCK A;  3VRY A;  1SRM A;  2L2P A;  4OMO A;  3UAT A;  3REB B;  1UGV A;  1KIK A;  3EG0 A;  2BZ8 A;  1X27 A;  2DRK A;  2JW4 A;  4JZ4 A;  4Z88 A;  1GRI A;  2D0N A;  1UJY A;  4HVV A;  3QWX X;  2YUP A;  3I5R A;  2RMO A;  2LZ6 B;  1X69 A;  3VS2 A;  1AEY A;  1NYG A;  3NMZ C;  3ZL7 C;  1TG0 A;  2KNB B;  4ESR A;  1W70 A;  1KFZ A;  2RN8 A;  1GBR A;  1E6G A;  2HSP A;  2PNI A;  1J3T A;  5I22 A;  3THK A;  4LE9 A;  5IHK A;  2DBK A;  4J9G A;  1WFW A;  1AWW A;  2RNA A;  2KYB A;  1MUZ A;  4RTW A;  4RUG A;  1AVZ C;  2NWM A;  1WYX A;  3M0T A;  3EHQ A;  5HCK A;  4DEY A;  3PE0 A;  3U23 A;  1UEC A;  1YN8 A;  1WDX A;  1AWJ A;  3C0C A;  2GTJ A;  2JS0 A;  2LJ0 A;  2O9S A;  3TSZ A;  1TUC A;  3EGU A;  2EPD A;  4IIO A;  1U06 A;  2KT1 A;  1X2Q A;  2KRM A;  2LJ1 A;  1SPK A;  2LQW A;  1RLP C;  1PKS A;  2JMA A;  4JJC A;  1KJW A;  2HEQ A;  1JO8 A;  2D1X A;  1UUE A;  3NPF A;  1AOJ A;  5L23 A;  2BZY A;  1UHF A;  1UHC A;  2A08 A;  4A63 B;  1PNJ A;  1H92 A;  4AG2 C;  1GL5 A;  3TSW A;  2ENM A;  2B86 A;  2J7I A;  2RQU A;  2YDL A;  1K0X A;  1BU1 A;  4RTV A;  2GGR A;  2F2V A;  1T0H A;  4RTY A;  1NLO C;  1CKB A;  4HVW A;  2V1R A;  2A28 A;  2JM9 A;  1OEB A;  3VS7 A;  1UTI A;  1JXM A;  4Z89 A;  2DL4 A;  3RNJ A;  5ECA A;  1Z9Q A;  3ULR B;  5IXB A;  2FRW A;  2EYY A;  2IIM A;  3M0P A;  3VS6 A;  3R6N A;  2CDT A;  4J9C A;  1RI9 A;  1IO6 A;  2F2X A;  4CC3 A;  2AKK A;  2M51 A;  4F14 A;  2K79 A;  2AZS A;  2K7A A;  2DL3 A;  4JZ3 A;  1VYV A;  2GTO A;  4Z8A A;  3IQL A;  4J9I A;  3M0S A;  1FYN A;  4LUE A;  2LMJ A;  1B07 A;  5I11 A;  4R0K A;  1X6B A;  1UG1 A;  2DMO A;  1M3A A;  2J05 A;  1JU5 C;  1E7O A;  4QT7 A;  4AFU C;  2KYM A;  3PVQ A;  1HD3 A;  1X2K A;  4GLM A;  4CC4 B;  2DVJ A;  1FMK A;  1M27 C;  2ABL A;  2E5K A;  3O5Z A;  2EGE A;  2MCN A;  2EQI A;  1U3O A;  1H8K A;  1AZE A;  2DLP A;  1Y0M A;  2KR3 A;  2JS2 A;  4LUD A;  2C0O A;  2DIL A;  2L0A A;  2GBQ A;  2ROT A;  2L3P A;  2BTT A;  1K1Z A;  1TUD A;  1I1J A;  1QKW A;  1JXO A;  2DNU A;  2L3S A;  5FWC A;  1ZLM A;  1WI7 A;  4M4Z A;  2DL5 A;  2MOX A;  2DF6 A;  1K76 A;  1X43 A;  1I0C A;  2RQW A;  2YUO A;  2K2M A;  2D8H A;  1OPK A;  2CUD A;  1BB9 A;  4JJD A;  2DM1 A;  1K4U S;  4J9B A;  2VVK A;  3SEM A;  2KXD A;  1ABO A;  2BZX A;  1YWO A;  2FEI A;  2LQN A;  1JEG A;  1VYT A;  2F2W A;  1H3H A;  2KRN A;  1WX6 A;  2C0I A;  2PZ1 A;  1X6G A;  1QCF A;  1M3C A;  2M0Y A;  1CKA A;  1A0N B;  2JMC A;  2O31 A;  1HSQ A;  2MIO A;  3H0I A;  2KGT A;  1I07 A;  2YUQ A;  1JQQ A;  2FPE A;  1QWE A;  4Y92 A;  1U5S A;  2JXB A;  2RPN A;  4HVU A;  1HJD A;  2PTK A;  4WCI A;  1N5Z A;  2DL7 A;  2W10 A;  1GCQ A;  4ORZ A;  2P4R A;  2EKH A;  2EYW A;  1MV3 A;  2DL8 A;  2CUB A;  2SEM A;  2DJQ A;  2LNH B;  1GCQ C;  4ZNX A;  1QWF A;  2LP5 A;  3EG2 A;  4AG1 C;  4AFZ C;  3M0Q A;  2RQT A;  1V1C A;  4D8K A;  1WA7 A;  3I35 A;  1Y57 A;  2OI3 A;  1ABQ A;  1MV0 B;  5IHI A;  1AZG B;  2K6D A;  4OML A;  1T3L A;  4J9F A;  2HBW A;  4LNP A;  2G6F X;  2LX7 A;  4J9H A;  1NG2 A;  3GBQ A;  1RUW A;  3VS1 A;  4GBQ A;  1W6X A;  5FWB A;  1GFC A;  4OMQ A;  2NUZ A;  4RTX A;  4E6R A;  4X1V A;  5IXF A;  2O9V A;  3VS3 A;  1SRL A;  4CC7 A;  1PWT A;  5FW9 A;  1WXB A;  2X3X D;  3SHW A;  1SHF A;  2ED0 A;  1VA7 A;  2KE9 A;  1BBZ A;  2KRS A;  1SEM A;  2AKL A;  2DA9 A;  2DE0 X;  2LJ3 A;  1K0S A;  2EVR A;  2A37 A;  3JV3 A;  1UJ0 A;  1PHT A;  3UF4 A;  1PRL C;  2CT4 A;  2DBM A;  2I0N A;  2KBT A;  1M30 A;  1GCP A;  1YP5 A;  2FG0 A;  4EIK A;  2O2O A;  2OAW A;  3REA B;  1ARK A;  1Z9Z A;  2OJ2 A;  2J6O A;  2V1Q A;  3RBB B;  1YWP A;  1WLP B;  3EG1 A;  2HCK A;  3UA7 A;  2FO0 A;  2SRC A;  3FJ5 A;  4DEX A;  1XOV A;  4JPB W;  1SSH A;  1QLY A;  3QWY A;  1OV3 A;  1ZSG A;  2J06 A;  3NHN A;  2GNC A;  1NEB A;  3CQT A;  5EC7 A;  2GQI A;  1AWX A;  2EGC A;  1UE9 A;  1BK2 A;  1QKX A;  1ZUY A;  1CSK A;  1G83 A;  4RTU A;  2LCS A;  1ZBJ A;  3LH5 A;  2YT6 A;  1UFF A;  3TVT A;  2ROL A;  1OPL A;  3VRZ A;  2CH4 A;  1YCS B;  1GFD A;  2CH4 W;  2H8H A;  2C0T A;  2EYZ A;  4KRT A;  4K11 A;  5GJV B;  2ESW A;  3NGP A;  2AZV A;  2XMF A;  2CSI A;  3H41 A;  2RQR A;  4FSS A;  4RTT A;  3M0U A;  1T3S A;  2QDL A;  2VKN A;  3H0F A;  1ZUU A;  2FPF A;  2HDA A;  3A98 A;  1PKT A;  4LN2 A;  3VS5 A;  1VYU A;  4OMM A;  2EYX A;  2W0Z A;  3I5S A;  4AFS C;  3VS0 A;  1T0J A;  4OMN A;  2CRE A;  1W1F A;  2A36 A;  4JJB A;  3M0R A;  2J6K A;  2CSQ A;  1M3B A;  2KEA A;  4RTZ A;  1EFN A;  2YUN A;  2KT8 A;  4J9D A;  4OMP A;  1WXU A;  2KXC A;  3I9Q A;  4J9E A;  4AFQ C;  4D8D A;  2KRO A;  1SHG A;  2FRY A;  2FPD A;  2DYB A;  2YSQ A;  2JM8 A;  1WXT A;  3VS4 A;  3EG3 A;  1K9A A;  1ZUK A;  1YNZ A;  3UA6 A;  2ED1 A;  2JT4 A;  1UDL A;  1WIE A;  1NYF A;  1RLQ C;  2JTE A;  2L3Q A;  2DRM A;  1PRM C;  5IHN A;  1B3Q A;  2K3B A;  2CT3 A;  1OOT A;  2VWF A;  5IH2 A;  1GBQ A;  1KSW A;  2DX1 A;  1AD5 A;  1G2B A;  2EBP A;  1NEG A;  2ECZ A;  5GJW B;  1ZX6 A;  2X3W D;  1NLP C;  2EGA A;  3H0H A;  2EW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...