2RN8A

Nmr structure note: murine itk sh3 domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
GSPEETLVIALYDYQTNDPQELALRCDEEYYLLDSSEIHWWRVQDKNGHEGYAPSSYLVEKSPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure note: murine Itk SH3 domain
rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Tyrosine-protein kinase ITK/TSK
total genus 9
structure length 64
sequence length 64
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rn8A00
3NHNA 2HEQA 3R6NA 4LN2A 2FEIA 2A08A 1ABOA 1MUZA 1GFCA 4RTUA 1FYNA 2KYBA 2CH4W 2LX7A 1WX6A 3U23A 2RQUA 3NMZC 2A36A 3REAB 1CKAA 2YUQA 4LUEA 1MV0B 4Z8AA 1V1CA 1GL5A 5IHNA 2F2XA 4JPBW 2GQIA 3VS2A 2G6FX 1TG0A 4Y92A 1NYGA 3EGUA 1ARKA 1A0NB 4IIMA 2RQVA 2KT1A 4J9IA 2CSIA 2ROTA 2FPFA 2L3PA 1ZLMA 2DNUA 2EW3A 2DBKA 2CUDA 2M0YA 3PE0A 3NGPA 3VRZA 3EG2A 1YWOA 1OV3A 1UUEA 2VWFA 1T3SA 2EYWA 2KGTA 2HBWA 2K9GA 1U5SA 2YT6A 2V1QA 3I9QA 1T0HA 2IIMA 3TVTA 4HVWA 3M0UA 4K11A 2KR3A 2H8HA 1K9AA 2DLPA 1BK2A 1GCQC 3H0FA 1AVZC 1T0JA 2KROA 2RNAA 5IHIA 2FPDA 3VS7A 1UECA 4HVVA 2KBTA 1WLPB 2JMCA 4GLMA 2KE9A 2SRCA 3VS1A 5GJWB 3VS4A 1UHCA 2MOXA 4JZ4A 1K0XA 2YUNA 2DL3A 1UDLA 4HVUA 1I07A 1AOJA 1Z9QA 2KXDA 2JXBA 1B07A 2F2VA 1GCQA 2EYZA 1RUWA 1X69A 1Y0MA 3SEMA 1K0SA 4J9BA 3VS0A 2C0IA 1ABQA 1UG1A 2W0ZA 2K2MA 2JMAA 1AWWA 2AKKA 1BB9A 2RQTA 1W6XA 2OJ2A 4CC2A 1SHGA 1J3TA 4CC3A 3H0HA 2JS0A 2EKHA 4DEYA 2HDAA 2PTKA 4JJBA 4J9EA 5GJVB 2DILA 1AWJA 4RTWA 2L0AA 1WYXA 2YUOA 2EGCA 2L2PA 1K4US 2QDLA 4RTXA 1NM7A 2ED1A 1M3CA 2O9SA 1E7OA 2JT4A 3A98A 2W10A 3M0PA 2RF0A 2DL5A 2AZVA 1KFZA 4M4ZA 4LUDA 3QWYA 1EFNA 2CREA 1UFFA 2FPEA 5FW9A 1H92A 4HCKA 1YN8A 3O5ZA 5ECAA 4J9DA 1T3LA 2BTTA 1ZUUA 2PZ1A 2FRWA 4JJDA 1GFDA 1YWPA 1FMKA 2CT4A 4OMQA 3KFVA 1KSWA 1GRIA 2D8HA 2ENMA 2KRNA 4CC7A 3RBBB 4A63B 1IO6A 2GTJA 3UA6A 1RI9A 2DM1A 5L23A 2LQWA 5FWBA 1NEBA 3UF4A 2LJ0A 3TSWA 3I5SA 1QKXA 4RTTA 4J9HA 2DX1A 3H41A 3VS3A 1CKBA 1OPLA 1E6HA 1WI7A 2M51A 2AK5A 4OMMA 4ZNXA 2JM8A 2XMFA 4D8DA 1W1FA 3JV3A 1M8MA 1ZUKA 1I1JA 1ZBJA 2C0TA 1QKWA 4Z88A 4J9FA 1SEMA 1G83A 1ZX6A 2K6DA 2CT3A 1ZSGA 2MCNA 3M0RA 1QCFA 2DBMA 2KNBB 3TSZA 1RLQC 2EBPA 3I5RA 2KXCA 3M0SA 3VS5A 2EVRA 2GNCA 2A28A 2DVJA 4Z89A 4F16A 2HCKA 4JJCA 1GBQA 4AFQC 2BZXA 2GTOA 1JO8A 2SEMA 2VVKA 2P4RA 2JW4A 2O31A 2D8JA 1WFWA 1X2KA 1PKSA 1X27A 1AD5A 1NYFA 2A37A 5IH2A 2EGEA 1K1ZA 2EPDA 2KEAA 3VS6A 1M3AA 1AWXA 3IQLA 2O9VA 1E6GA 1BU1A 1SRLA 1YP5A 1VYVA 1S1NA 4KRTA 2OI3A 1JEGA 2DMOA 4EIKA 1VYTA 1YNZA 2GGRA 3M0QA 1HSQA 1WA7A 1JQQA 1W70A 4F17A 1KJWA 2J7IA 2FRYA 2YDLA 3LH5A 5FWCA 1GBRA 1RLPC 3I35A 2DJQA 2B86A 2HSPA 1MV3A 2DF6A 1WIEA 2BZYA 1AEYA 2J6OA 4WCIA 4CC4B 3GBQA 4AFUC 2C0OA 2KRSA 2LQNA 4LE9A 1UJ0A 3UA7A 1PHTA 2RQRA 1SSHA 2J06A 4GBQA 1NLOC 1Z9ZA 4ORZA 2D1XA 2AZSA 3EHQA 3ZL7C 2O88A 1WXTA 1I0CA 5IXBA 2KT8A 1SPKA 1VA7A 1PWTA 2ROLA 2JTEA 2CDTA 3NPFA 2KYMA 2ECZA 4J9GA 2LJ1A 2LCSA 1PKTA 2BZ8A 2MIOA 3EG3A 4RTYA 2FG0A 3PVQA 1UHFA 1OEBA 3QWXX 4RUGA 2YUPA 1KIKA 1PRLC 1N5ZA 1JU5C 1JXMA 2EYYA 4OMLA 3EG0A 2LJ3A 1ZUYA 1WXBA 2EYXA 1UJYA 1OOTA 2DA9A 1WXUA 2OAWA 4X1VA 5IHKA 4D8KA 3REBB 1JXOA 1U06A 2LNHB 2K3BA 2PNIA 4RTVA 2VKNA 1X6GA 1X6BA 5EC7A 2NWMA 2DRKA 2AKLA 4QT7A 4RTZA 3VRYA 5I11A 4AFSC 1NLPC 1LCKA 2D0NA 4HXJA 4E6RA 1AWOA 4AFZC 2YSQA 1HD3A 1M30A 1H3HA 1QWEA 2FO0A 3H0IA 2J6KA 2EGAA 2DYBA 2LZ6B 1PRMC 1TUDA 2X3XD 2RQWA 2DL4A 4AG2C 4IIOA 2RPNA 3ULRB 2V1RA 4F14A 3FJ5A 1BBZA 4OMPA 4J9CA 1QWFA 5HCKA 2CUBA 2JS2A 1AZEA 1B3QA 2F2WA 1QLYA 1Y57A 2L3SA 2KRMA 2O2OA 3M0TA 1NEGA 4OMNA 2LMJA 1GCPA 1CSKA 4OMOA 1UE9A 2K79A 5I22A 1UGVA 1M27C 1YCSB 2ABLA 3PVLA 4LNPA 2J6FA 1UTIA 2K7AA 4R0KA 2CH4A 1HJDA 2RN8A 1TUCA 2LP5A 2DRMA 2I0NA 2EQIA 2DL7A 1X2QA 1NG2A 2J05A 2NUZA 1SHFA 3EG1A 2GBQA 2ESWA 5IXFA 2JM9A 3UATA 3C0CA 4FSSA 1U3OA 2E5KA 1VYUA 4JZ3A 3RNJA 3SHWA 1XOVA 3CQTA 1G2BA 1M3BA 1AZGB 1K76A 1X43A 2RMOA 4ESRA 1OPKA 4DEXA 1SRMA 1WDXA 2ED0A 2L3QA 3EHRA 2DE0X 3THKA 4AG1C 2CSQA 1PNJA 2DL8A 2X3WD 1H8KA
chains in the Genus database with same CATH superfamily
3NHNA 2JN0A 5C0MA 5DLOA 4FYXB 3R6NA 4LN2A 2X4WA 4C8QE 2A08A 2RHXA 2JJ9A 1VQOQ 1WX6A 2KK4A 3RIRA 3META 3EGXA 1CKAA 3V8KA 3RR6A 1Q7YU 2XDPA 1QCOA 2F2XA 1OX9A 4JPBW 1KD1U 2GQIA 3VS2A 4NL2A 3OA6A 3EGUA 4NL3A 4IIMA 2RI5A 2EJ9A 2KT1A 3GPLA 5D7UA 3FRNA 2CSIA 2FPFA 4O6JA 1ZLMA 3UWNA 2CUDA 4BY6C 1LNXA 3NGPA 4FW2A 3VRZA 3JCMW 5FRMA 4MZPA 1TUGB 2VWFA 4LDYA 2EYWA 2HBWA 2ZPHB 4KH0B 4C92G 3FB9A 4XU0A 6AT1B 3SWNA 1YJ9T 3M0UA 2CP0A 2KR3A 2QA4Q 1K9AA 2DLPA 1AT1B 4PKCC 1AVZC 4HCBA 3BDUA 2KI7A 1KK7A 3VV0A 2KBTA 3DB4A 1WLPB 3BFMA 2K5IA 3CC2A 4GLMA 1NE8A 4PJOF 1KQ2A 4J6XA 3VS4A 3EFOA 3E2UA 3JB9D 4YTLA 1Z9QA 1N27A 2NUTB 1EIFA 2JXBA 3BW1A 3M4GA 1O9SA 4ZGEB 1GCQA 3QBYA 4L59A 4MDWA 1WPYA 1Y0MA 2X4YA 2CKKA 3DLMA 1K9MC 3QKJA 3CCVT 1K0SA 4ME7A 1S72A 2C0IA 1ABQA 3ME9A 4A54A 3CCUA 4M75D 2JMAA 2CZ7B 2RO0A 4E47A 4PLIA 1W6XA 5KYUA 4CC3A 2JS0A 2DERA 3PIPA 2EKHA 2PUKB 3V8JA 5GJVB 2DILA 2L0AA 1K73R 2L2PA 1JB0E 3H6ZA 2DEUA 2O9SA 1I81A 3OYJA 1VQMT 2QK0A 1KFZA 5IAYA 1YBYA 4WF2A 4JRQA 3QWYA 4IKFA 4FYYB 2ATCB 3CBPA 3LWHA 3OMGA 2LCLA 1VQ8A 3JCMQ 3CPWS 1M1KR 2IG0A 3O5ZA 4LDUA 1IB8A 5ECAA 4ELYC 2MWOA 4J9DA 1N8RC 5LL6S 1T3LA 2BTTA 2PZ1A 2OAUA 3OYLA 2NUTA 3PT9A 1GFDA 1YIJA 1VQMA 2CT4A 3MEUA 2XKOC 2KQWA 4HT8A 1YHQQ 2D8HA 1ZHIA 4VUBA 4E7LA 2GTJA 1R77A 1RI9A 1RAAB 5J3BA 3OS5A 2RHZA 2NUPB 1K8AC 3OYFA 2QGFB 3UF4A 3I5SA 2QEXT 1QKXA 1KD1C 3CCLQ 3QO3A 4M78E 3VS3A 4IURA 1UGRB 2ZPEB 1E6HA 4M78F 4CRIA 1D09B 2EJFA 3OBWA 4HT9A 2XMFA 1PSFA 3O8VA 2RD1A 4ZTJA 1QKWA 3LGLA 1WJRA 3ZEHA 2RB6A 2ZZDA 4RMOA 1SEMA 1VQKQ 2FZGB 1C0MA 1G83A 1ZX6A 2E64A 2K6DA 1ZSGA 4L5GA 4F7UF 4M75B 3M0SA 3VS5A 2GNCA 1D0YA 3JCMg 3A8MB 2DVJA 4Z89A 4BI8B 2X35A 3E9FA 3PNWC 1LJOA 3A8HB 2DIGA 2VVKA 4JJNK 1BI1A 3JB9J 1VQNT 2JW4A 4QQ6A 1X2KA 1PKSA 5IH2A 3I55A 2EGEA 1E6GA 4QQGA 1S1NA 4KRTA 1JEGA 1B34A 5GANh 5CR2A 2GGRA 2LQ8A 1FMWA 4F17A 2DKGA 1KJWA 2E70A 2FRYA 1VQPA 1MHNA 1RLPC 3I35A 4IUTA 4M7AE 2DJQA 2HSPA 1Y96A 1MMGA 1WHJA 1BKBA 4M77A 1R0CB 4CC4B 2JZ2A 2KRSA 1KC8C 2OTJA 3UA7A 3M58A 2J06A 4M7AB 2D1XA 5D6XA 3QPHA 3ZL7C 5GAN4 2RI3A 2KT8A 1K73U 4ZGDB 4OP0A 2D6FA 2P0QA 5IN1A 3QG1A 3JCMJ 2KYMA 3EGDB 1PKTA 2L5QA 2BZ8A 4ANJA 3CBMA 4JUVA 2HAXA 2YUPA 5KYUB 1KIKA 1N5ZA 1D3BA 2E10A 4C92F 3HFNA 2EYYA 1KQSS 4HA8A 3OYHA 4M77B 4JDSA 2EJGA 1WXUA 2X4XA 2MPXC 1JXOA 4PJNA 3QIIA 3HKSA 1XTDA 2K3BA 3C94A 4XAXB 4PJOC 1Q82U 1R0BG 4RTZA 3OMCA 3DB3A 3QDFA 3VU3C 5I11A 1NLPC 2D0NA 4PJOD 3OYKA 3CMEQ 2JVVA 1AWOA 4AFZC 3OYIA 3H8ZA 2KSSA 3H0IA 3CC7Q 1G3WA 5GMKe 2JUFA 3QYGB 3UT1A 2KMTA 2DYBA 1PRMC 4M7AA 2DL4A 5I2MA 4AG2C 3G71A 4IIOA 3ULRB 3CXCP 4F14A 1VQKT 4OMPA 4C92A 2K5FA 4J9CA 3WVDB 2D9TA 3CXCA 1AZEA 1B3QA 2F2WA 3AT1B 3G4ST 2NYSA 2KRMA 3M0TA 4OMNA 5GAOn 2QQBA 3CBOA 1BCMA 4PLLA 2K79A 3CD6Q 1VQ5Q 1M27C 5A0DA 1B7TA 3RESA 1ZA2B 5J39A 4RG8A 2ABLA 2V26A 3PVLA 4LNPA 2J6FA 9ATCB 3L2QA 4R0KA 3LX7A 3GNGA 3OS1A 1I5OB 2EQMA 2I2LA 2LP5A 3A8LB 3INZA 1OQKA 2EQIA 1MMDA 1YJWT 5HKCA 2OX7A 2HBPA 1WHLA 1WHHA 2IVWA 4M75A 2M9UA 3HTRA 4KUDK 5CKDA 4JZ3A 2DETA 2ZPIB 1XOVA 2ZPBB 1X75C 2A0FB 2JNGA 4FSXA 4C0GA 2HKQB 3C95A 4XU2A 1K76A 3LGFA 2RMOA 4C0DC 4M7DE 1OPKA 1SRMA 1WDXA 1HXDA 5GANe 4LD9K 2CSQA 2V8JA 1VUBA 5GAMg 4PJMA 1M90C 1BIBA 5KH6A 4KT0E 1PSEA 3EH1A 3T9NA 3RMSA 4F04B 1Y71A 2BE7D 2RHIA 1MUZA 1M5Q1 3FC3A 2KYBA 5LJ5f 2CH4W 1Q7YC 2LX7A 2RQUA 2QEXQ 4ZN1A 4NOYA 1Q82C 3REAB 2MAMA 3ER0A 3HRSA 2QQ9A 5A2QE 4LXCA 3ZBDA 1GL5A 1V1CA 5GAN8 2E65A 4J6YA 3OYBA 1NYGA 1A0NB 4J9IA 2JTFA 2LT4A 4FT2A 3FLGA 3TU4K 1K9MU 2M0YA 3PE0A 3C4SA 3KXTA 1M1FA 4E7ZA 1QP3A 2YWWA 3Q1JA 3ASKA 1OX8A 4XU1A 4C8QD 2P0PA 4BACA 1Y96B 1WZOA 2K9GA 3CCET 1U5SA 3RKWA 2YT6A 4RKUE 3M5AA 3A5ZB 3I9QA 3L2VA 3CCRQ 1M1KU 4C92C 1YITA 2IIMA 4GY5A 1WNLA 4JS4A 3CPWA 4II1A 5M9OA 1U1SA 3CEYA 2E4HA 1GCQC 2VXEA 1RADB 5LJ3d 5IHIA 2FPDA 3VS7A 1UECA 3BE3A 3L2ZA 3P8DA 1JJ2A 2RHYA 4HKEA 2COYA 4JLIA 2MOXA 3QYHB 3AHUA 2DL3A 1UDLA 2LCCA 1U8RA 2E6NA 2RK1A 2KXDA 3VKIA 5GMKh 1B07A 5CQYA 2EYZA 5A0LA 3MKDA 3SEMA 4KULA 4J9BA 2LTOA 2LVMA 3VS0A 1LPLA 5J26A 5GAOq 4ATOA 1UG1A 2K2MA 1AWWA 2DXBA 1BB9A 2RQTA 1N6AA 3C12A 3SWNB 4J9EA 3JCMc 4RTWA 1K4US 1ZSZC 4PJOG 2ED1A 2YHTA 1M3CA 1E7OA 3A98A 3GIBA 1WJQA 3I56Q 1WQWA 2PVDB 5GAMf 2CREA 3S3MA 2VGNA 2DXTA 2MF2A 2XK0A 3MP8A 4HCKA 3M9QA 4DOWA 1G8XA 3HFOA 2HKNA 2E12A 4M75E 5LJ5g 3RMQA 4ZGJB 4E7HA 3X24B 5KYXA 1ZUUA 5KCHA 3V7CA 4X34A 3CC2Q 1Q7YR 1YWPA 5GAN3 2FZKB 2CP7A 2KDSA 1TH7A 1IO6A 2HZYA 2QASA 4M7DB 2BKDN 4DA4A 2FVUA 5L23A 2HQHA 4XTYA 1IZ6A 2DXCA 3H41A 1S72Q 1Q86U 2GF7A 2QQAA 1CKBA 3OYYA 1MGQA 1WI7A 2AK5A 4OMMA 4BB7A 2V8KA 3X26B 1DJ7B 2JM8A 4PFZA 2R5MA 2DFUA 1W1FA 1ZUKA 2FB7A 1QVFA 1I1JA 4Z88A 2OTJQ 1UGPB 1I8FA 2K3XA 2DYIA 4A4EA 4Q5WA 5D6WA 2CP2A 2CT3A 2MCNA 3A8OB 2HL5C 2LDMA 4PJOA 3OBYA 3J80E 3MHXA 1Q81U 1VQ4A 2KXCA 2EVRA 4QVCA 1QQJA 2OTJT 3LLRA 3OSSC 1GBQA 2OTLA 5KYWA 4E7IA 4PL6A 2O31A 2DPPB 1WFWA 2G3RA 2QG9B 1G3TA 1AD5A 1NYFA 5KCOA 1N8RR 5KYYA 1YHQA 1K1ZA 3VS6A 3JB9F 3IQLA 5GAMe 5CIUA 2R5AA 4RG2A 4FL6A 1YP5A 3CCVQ 2OI3A 2YRCA 4FT4A 4EIKA 4M7DG 3SDZA 2VASA 3BY7A 4J6WA 2GFAA 5LJ3j 5FWCA 1YFNA 1TWBA 4BI3A 2KVQG 2H3JA 4DBFA 3HPWA 2BZYA 5CVIA 1AEYA 2J6OA 4RCBA 3G71Q 4AFUC 1OU8A 1B34B 3J7AF 4DBRA 4X9DA 5KE2A 1Q86C 1LOJA 1YHQT 3VYHB 2LNVA 1NLOC 1ZBXA 1Z9ZA 4ORZA 2AZSA 2FHDA 2CGHA 5GMKi 3EHQA 1YITT 4FYVB 3I56T 1KQSA 1VQ5A 5IXBA 1SPKA 1WHGA 3TEEA 3CMAQ 4N4IA 2CP6A 1PWTA 2ROLA 4AT1B 2CDTA 1ZA1B 4JRPA 3NPFA 3JRZA 1QCNA 3BDLA 2MIOA 3EG3A 1Q86R 2RJFA 1Q81R 2DAQA 1HYOA 1UHFA 4RUGA 2DXUA 5GAMj 3OSVA 3OS0A 3CCJT 2LJ3A 4OGEA 1WGSA 2COWA 1M1GA 2PVGB 1UJYA 1OOTA 5IHKA 4X1VA 4D8KA 1RAIB 3M54A 2L8DA 2VUBA 1N9RA 2LNHB 1BYMA 2PNIA 1W4SA 3HHTB 1VQNA 3CPWP 2K57A 1UB4A 4KGXB 1X6GA 5KYYB 1FWZA 2H3EB 2DRKA 4LD6A 3CCMT 4C8QA 1PG5B 3GLXA 4AFSC 1LCKA 5GANg 4E6RA 4XK8E 3CCMQ 1H3HA 3CMAT 3OQ5A 2FO0A 4BY6B 1BI0A 1G3SA 2GQVA 1VQLA 5AYFA 2HNIA 1YJNT 5KE3A 2RQWA 2V1RA 2GFUA 1QVGP 2EQJA 1I5LA 1QLYA 3MEWA 4FU6A 1GCPA 4M77G 1UE9A 4ZTFA 3CCEQ 3PIOA 3GF5A 1M9SA 3LH0A 3EG9B 3S3OA 4PJOE 1UTIA 1FX7A 1KG1A 2QGGA 3L2RA 3CCSQ 2P0KA 5HY6A 2DRMA 2I0NA 1Y7XA 2HQEA 1X2QA 1JRIA 2ESWA 5IXFA 3UATA 3C0CA 2DJZA 1VQ6T 1S72T 5HK3A 4M7AG 1KD1R 1D0ZA 2ED0A 2DE0X 5FU7B 4JRKA 2X3WD 4D6WA 2XDBA 1H8KA 3CD6T 2EFIA 4XTWA 1RL2A 2FEIA 3CC7A 2ZCFB 1GXIE 4KGZB 2QA4T 1GFCA 4M78A 3OS2A 1TU0B 5GAN7 3NMZC 2A36A 3M53A 1IHWA 1VQ8T 2YUQA 4LUEA 1MV0B 1SG5A 5CKFA 3E19A 2O01E 4KBMB 4M7DD 4Y92A 4QQDA 3CD6A 1VIFA 2ROTA 2L3PA 3PGGA 2DNUA 2EW3A 3PMIA 4F7UA 2DBKA 2X51A 1O75A 3VUZA 1QVFP 1NBEB 2K2VA 3EG2A 1YWOA 3J81E 1BI2A 1OV3A 2X9HA 1V29B 5KYXB 3EGDA 4M77F 5GAN5 1T3SA 4LDWA 1KC8U 2KGTA 3OW2A 1RAEB 2QI2A 1NPPA 4A4HA 4PJLA 5DLQE 2V1QA 2Z0WA 2RH2A 1IGQA 4MMLA 2EQKA 1T0HA 5LJ5h 3HRUA 5GANj 5LJ5e 3E1SA 3TVTA 1M90R 4V2SA 1YIJT 3OB9A 1SF9A 1U1TA 4DQ2A 1JBMA 2RNAA 1P92A 4A4FA 4EMHA 2AHJB 2MYSA 4HCZA 4N0AA 1G3YA 4IUQA 2PQWA 2KE9A 5GJWB 1UHCA 4JZ4A 1K0XA 2YUNA 4HVUA 5I2SA 1I07A 2DTHA 5GAMh 4PJJA 5GMKl 4M78C 2VYTA 3L2WA 2QEXA 2IPOB 3EFOB 1RUWA 3P8BB 1G5VA 1H3ZA 4BUGA 4EMGA 2W0ZA 4PJOB 3SWNC 4F7UG 2HL3A 1LVKA 1QP2A 1M8VA 2AKKA 2OJ2A 1SHGA 4DEYA 4KUIA 2HDAA 2PTKA 3LW5E 4JJBA 1RAFB 1KQ1A 3JB9I 2M0OA 2QDLA 1YJ9Q 1MNEA 1NM7A 3H9NA 3X28B 2JT4A 2ZAEA 4NS5A 2W10A 3QSUA 4C0FA 2RF0A 2AZVA 5FU7C 1NZ9A 5GAN2 1VQ6Q 1IXDA 4M78G 4M4ZA 4OF1A 1UGQB 4OVAA 1EFNA 3HRTA 2KY9A 1YITQ 2CZ1B 1VQ4Q 1WHMA 2FPEA 1RABB 5FW9A 1H92A 1YN8A 5EG2A 2FZCB 1MMNA 3JCMd 2OTLQ 4OB0B 4E7KA 1QW1A 2FRWA 3QZ9B 2VB6A 4JJDA 1Q82R 1VQ4T 4J5YA 3CC4Q 3GOXA 1PCXA 5FU6B 4DBQA 3KFVA 1KSWA 2KRNA 4CC7A 3RBBB 4J7IA 4A63B 1X6OA 2Y4XA 4JRIA 3CCVA 5FWBA 1BCOA 2DK3A 2XI9A 1BI3A 1VQOT 1NEBA 5FU6C 1X01A 2LJ0A 3TSWA 4J8OA 4RTTA 5CO7A 4J9HA 2RJCA 5DM7R 3HP9A 3MJXA 5FROA 1VQ9Q 2QTXA 3QXEB 4XTZA 3CMET 2DIQA 4C92E 5CKBA 2O4XB 4QKUA 3SD4A 1M8MA 1ZBJA 5GAMd 4J9FA 4P5NA 1KC8R 4Y91A 1C6VX 4F7UE 2CYZB 3I56A 1IRXA 5CQXA 1QCFA 2LRQA 3MO8A 4C92B 3TSZA 3V7SA 4JS5A 4OGCA 1ZSZB 3CMAA 5GAN6 5FLXE 2F69A 5GMKm 4F16A 4AFQC 1OYXA 2Y4YA 2BZXA 2GTOA 3F70A 4O5VA 1JO8A 2P4RA 4C0ZA 2D8JA 2P4TA 2PVOB 1YJWQ 3QDRB 4B6MA 4ZN3A 3R6OA 1ACMB 3G4SA 1YI2A 2EPDA 2KEAA 1M1KC 1M3AA 2AIRB 3MP6A 2O9VA 1VQNQ 2WSEE 3QHSA 4PK4A 1YNZA 1HSQA 4EMKA 4PFOA 5LJ5d 1GBRA 3LH5A 4M7DC 4IUVA 3CCQQ 2LC4A 3UDCA 2B86A 1TXQA 1MV3A 4ELZC 1K73C 1M2VB 5CKHA 1VQLQ 2DZ9A 1WQ7A 5FRNA 5CAIA 5IT9E 3SB2A 1W2BS 3FJPA 3GBQA 4A4GA 1VQLT 4Z02A 3EH2A 1AHJB 4C8QC 3EAEA 1YI2T 3QJ6A 1D0XA 1YJNA 2DD4A 1KHIA 1K9MR 2R57A 2O88A 1WXTA 2HQXA 2MK5A 1VA7A 2VXFA 1W2BP 2LCSA 2ECZA 3MCAB 2LJ1A 2XU8A 3D7SB 1OEBA 5AT1B 1JU5C 1WXBA 2BE9B 2DA9A 3LYIA 1I4K1 2ZGWA 2EWNA 3PFSA 4C8QF 1VQ7A 3CCJA 1U06A 2QQSA 4RTVA 4FYWB 5EC7A 2NWMA 2EIFA 2AKLA 4QT7A 4OMFB 1BIAA 4DOVA 1IREB 1D1BA 1M30A 2QQRA 2EGAA 4C0DB 2EAYA 2X3XD 1TUDA 2XG8D 4J7FA 2CP3A 1VQOA 3RDVA 3JCMV 1NJIC 4XQ3A 3FJ5A 3VJPA 2COZA 4C5HA 3JCMP 4M77E 3X25B 2JS2A 1OZ3A 2VC8A 2WACA 3OYGA 2QTVA 2L3SA 2O2OA 2GCXA 1NEGA 5KYWB 1CSKA 4GLKA 3M4YA 4M75C 1RAGB 1OI1A 2K7AA 2RM4A 2CH4A 1HJDA 4M7AF 1KQSP 1WJSA 2AT1B 2LT1A 2K4YA 3ZFJA 2NUZA 3RKYA 3EG1A 5GANf 5CKEA 4UC4A 4FSSA 1M90U 1U3OA 2BIVA 4XTXA 2E5KA 1VYUA 1PD0A 1M2OA 4C5IA 5LJ3f 1G2BA 1YCYA 4A4KA 1AZGB 3EG9A 4M7AC 2X4JA 2QA4A 2YRVA 2RJDA 3NTHA 1C1AA 2MMPA 3OW2S 2OTLT 1RACB 1PC0A 2DL8A 3G6EQ 2WSFE 1K8AR 3CCRT 4IUPA 5GAOr 3CCMA 2HEQA 2E6ZA 4N0AC 1RAHB 4L6V5 1QVPA 3QUIA 2NUPA 1ABOA 3M59A 2HSEB 2RA2A 1FXXA 4RTUA 1FYNA 3U23A 1IGUA 2F5KA 4KGVB 4Z8AA 5IHNA 2HD0A 4JLGA 4XU3A 2G6FX 1TG0A 1WHKA 3DLLA 1ARKA 3CCEA 2RQVA 3V7RA 1NJIR 3CC4T 2DTIA 1QVGA 3MEAA 3VUBA 3CCQT 3S6WA 4MMKA 5I21A 2E3IA 2RI2A 1YJ9A 2MWPA 1UUEA 3CCSA 5DY9A 1EX4A 1M2VA 1D1CA 1NPRA 4WTOB 2CZ6B 2QDYB 2YXYA 5GAOl 3LWIA 4HVWA 4K11A 2H8HA 3N5BB 4F7UB 5A0GA 5GAOm 1BK2A 3H0FA 2RHUA 3KUFA 1T0JA 2KROA 2DEQA 4R55A 4HVVA 1EZZB 4C8QG 2JOYA 2YLBA 2JMCA 1YIJQ 1VQMQ 1ZQ1A 2SRCA 3VS1A 3HL8A 2LX9A 4FCYA 1AOJA 2ZPGB 2E5QA 2DO3A 2F2VA 1Q95G 5C6SA 2F1LA 1N9SA 1X69A 2CP5A 1FMVA 3CCLA 4EDUA 3FDRA 4RCCA 1IHVA 1VQ5T 3WXMB 1VQ9A 3CC2T 4M7DF 4CC2A 5GAOp 2XD0A 1J3TA 2DD5A 3H0HA 1H641 4C5EA 1XJWB 3L2UA 1AWJA 1WYXA 2YUOA 2EGCA 4RTXA 2PUOB 3M0PA 4N4HA 1VIEA 2DL5A 3NTIA 3OYEA 5GANd 3RKXA 4LUDA 1VOMA 2A3LA 3X20B 2VGMA 3OY9A 1UFFA 2PU9B 3NFCA 4M78D 2R58A 1MNDA 3RERA 4BD3A 2DVEA 4X9CA 4EMKC 3WVEB 4M7DA 1FMKA 2M02A 4OMQA 2HMAA 1GRIA 3G4SQ 1YI2Q 2A7YA 2ENMA 3L1AA 2CZ0B 3UA6A 3FIFA 2YRDA 4M75G 3OYCA 2DM1A 2MI6A 2LQWA 4BE0A 1RI0A 8AT1B 2K3YA 5CK9A 4HCCA 2RK2A 1VQ7T 3P8HA 5CCAA 1JJ2S 2DX1A 3CCUQ 3CCQA 1OPLA 2M51A 3CCLT 1W2BA 1VQPT 3EFSA 1Q81C 4ZNXA 3G6ET 4D8DA 3QZ5B 1R8OB 3JV3A 1Y07A 5LJ3e 4EPCA 5LJ3h 2C0TA 4M78B 1TTHB 3JSCA 4QVZA 2FL7A 5KYNA 3G1JA 4AMCA 1VQ6A 2C06A 3M0RA 3TCJA 2DBMA 4QVDA 4DBHA 1KHCA 4C8QB 2KNBB 4PNOA 4MDXA 1RLQC 2EBPA 3I5RA 2WSCE 1V76A 4OB1B 3A8GB 1N8RU 3JCMX 2A28A 1VQ8Q 2P84A 1PD1A 2HCKA 4JJCA 4M7AD 3CCST 4CI0C 4XTVA 4E2FB 3OYAA 1K8AU 2SEMA 1M4ZA 4C92D 2QAZA 3CC4A 3MP1A 1X27A 2A37A 3EFRA 1MMAA 3E9GA 1AWXA 2ZPFB 2BUDA 2M16A 4QW2A 4BE1A 2XHCA 1BU1A 1SRLA 4B9XA 1VYVA 1HK9A 2DMOA 1VYTA 3M0QA 4TVRA 1WA7A 1JQQA 1W70A 3VYGA 2J7IA 2YDLA 3I55T 1TS9A 3CMEA 4Y28E 3NTKA 1XQHA 2E3HA 4MZMA 2DF6A 5HK0A 1ZSZA 1WIEA 1OZ2A 2DZCA 2JTMA 2M1HA 4WCIA 4J83A 1QVFS 1SKUB 3OW2P 2C0OA 4IUUA 1OU9A 2LQNA 1SSFA 3TQ7P 4FIBA 2F5TX 4LE9A 1UJ0A 5GMKj 3JB9H 1VQKA 1PHTA 5LJ3g 2RQRA 1SSHA 1D3BB 4GBQA 4R56A 4E7JA 2L89A 1I0CA 2Y90A 3QJYA 3CPFA 2EKOA 2DTOA 2JTEA 4J9GA 3TREA 3JCMe 3FEOA 4N4GA 4LDXA 4RTYA 2FG0A 3JCMh 3PVQA 2E41A 1VQ9T 1TOVA 3QWXX 1PRLC 2QXFA 1JXMA 1QMCA 4OMLA 3EG0A 3L42A 1ZUYA 1YJWA 4BI4A 2EYXA 3I55Q 2XICA 2K5LA 1JJ2P 4KH1B 4E7SA 3RUXA 4PFPA 2OAWA 3REBB 3GNFB 4FM4B 4M77C 2QYZA 4M75F 2L3RA 8ATCB 2D0QB 2VKNA 4B9WA 4C5GA 2O4XA 1X6BA 3G71T 3JCMb 1QVGS 4BDZA 3VRYA 3G6EA 4HXJA 2XIDA 1VQPQ 2YSQA 1HD3A 2NLUA 1QWEA 3OYDA 2V8IA 3CCUT 1NJIU 3M57A 2B8AA 2J6KA 5D6YA 2LZ6B 2RPNA 1BBZA 1F1BB 3MEVA 2LQKA 3M56A 1QWFA 5HCKA 2CUBA 3MPUB 2RJEA 3CC7T 1UGSB 1Y57A 4BDYA 2VV5A 2KAFA 2XDDA 2CS7A 1YJNQ 4MZTA 2LMJA 3EGXB 4OMOA 3JAME 5I22A 1UGVA 4LDVA 3OYMA 3DKMA 1TSFA 2EYQA 1YCSB 4OB3B 3M55A 3CXCS 3JB9G 4OB2B 3G7ZA 3A1PA 1XNIA 1PM3A 2RN8A 3OYNA 4FW1A 1TUCA 3SFMA 3PMTA 2DL7A 3V8LA 3HSBA 1NG2A 2J05A 3JCMf 1SHFA 2GBQA 2JM9A 3GP8A 4EMKB 3KBGA 3CCRA 3RNJA 3SHWA 4M77D 3CQTA 4BE2A 1VQ7Q 3CCJQ 1M3BA 1D1AA 1OULA 2FYKA 5L8RE 4XTUA 2YLCA 1X43A 4ESRA 1UEBA 2EQUA 4DEXA 2E1HA 2L3QA 4A53A 3EHRA 3S3NA 3THKA 4AG1C 7AT1B 5LJ5j 3PTAA 1PNJA 3URGA 3UPUA
chains in the Genus database with same CATH topology
3NHNA 2HEQA 3R6NA 4LN2A 2FEIA 2A08A 1ABOA 1MUZA 1GFCA 4RTUA 1FYNA 2KYBA 2CH4W 2LX7A 1WX6A 3U23A 2RQUA 3NMZC 2A36A 3REAB 1CKAA 2YUQA 4LUEA 1MV0B 4Z8AA 1V1CA 1GL5A 5IHNA 2F2XA 4JPBW 2GQIA 3VS2A 2G6FX 1TG0A 4Y92A 1NYGA 3EGUA 1ARKA 1A0NB 4IIMA 2RQVA 2KT1A 4J9IA 2CSIA 2ROTA 2FPFA 2L3PA 1ZLMA 2DNUA 2EW3A 2DBKA 2CUDA 2M0YA 3PE0A 3NGPA 3VRZA 3EG2A 1YWOA 1OV3A 1UUEA 2VWFA 1T3SA 2EYWA 2KGTA 2HBWA 2K9GA 1U5SA 2YT6A 2V1QA 3I9QA 1T0HA 2IIMA 3TVTA 4HVWA 3M0UA 4K11A 2KR3A 2H8HA 1K9AA 2DLPA 1BK2A 1GCQC 3H0FA 1AVZC 1T0JA 2KROA 2RNAA 5IHIA 2FPDA 3VS7A 1UECA 4HVVA 2KBTA 1WLPB 2JMCA 4GLMA 2KE9A 2SRCA 3VS1A 5GJWB 3VS4A 1UHCA 2MOXA 4JZ4A 1K0XA 2YUNA 2DL3A 1UDLA 4HVUA 1I07A 1AOJA 1Z9QA 2KXDA 2JXBA 1B07A 2F2VA 1GCQA 2EYZA 1RUWA 1X69A 1Y0MA 3SEMA 1K0SA 4J9BA 3VS0A 2C0IA 1ABQA 1UG1A 2W0ZA 2K2MA 2JMAA 1AWWA 2AKKA 1BB9A 2RQTA 1W6XA 2OJ2A 4CC2A 1SHGA 1J3TA 4CC3A 3H0HA 2JS0A 2EKHA 4DEYA 2HDAA 2PTKA 4JJBA 4J9EA 5GJVB 2DILA 1AWJA 4RTWA 2L0AA 1WYXA 2YUOA 2EGCA 2L2PA 1K4US 2QDLA 4RTXA 1NM7A 2ED1A 1M3CA 2O9SA 1E7OA 2JT4A 3A98A 2W10A 3M0PA 2RF0A 2DL5A 2AZVA 1KFZA 4M4ZA 4LUDA 3QWYA 1EFNA 2CREA 1UFFA 2FPEA 5FW9A 1H92A 4HCKA 1YN8A 3O5ZA 5ECAA 4J9DA 1T3LA 2BTTA 1ZUUA 2PZ1A 2FRWA 4JJDA 1GFDA 1YWPA 1FMKA 2CT4A 4OMQA 3KFVA 1KSWA 1GRIA 2D8HA 2ENMA 2KRNA 4CC7A 3RBBB 4A63B 1IO6A 2GTJA 3UA6A 1RI9A 2DM1A 5L23A 2LQWA 5FWBA 1NEBA 3UF4A 2LJ0A 3TSWA 3I5SA 1QKXA 4RTTA 4J9HA 2DX1A 3H41A 3VS3A 1CKBA 1OPLA 1E6HA 1WI7A 2M51A 2AK5A 4OMMA 4ZNXA 2JM8A 2XMFA 4D8DA 1W1FA 3JV3A 1M8MA 1ZUKA 1I1JA 1ZBJA 2C0TA 1QKWA 4Z88A 4J9FA 1SEMA 1G83A 1ZX6A 2K6DA 2CT3A 1ZSGA 2MCNA 3M0RA 1QCFA 2DBMA 2KNBB 3TSZA 1RLQC 2EBPA 3I5RA 2KXCA 3M0SA 3VS5A 2EVRA 2GNCA 2A28A 2DVJA 4Z89A 4F16A 2HCKA 4JJCA 1GBQA 4AFQC 2BZXA 2GTOA 1JO8A 2SEMA 2VVKA 2P4RA 2JW4A 2O31A 2D8JA 1WFWA 1X2KA 1PKSA 1X27A 1AD5A 1NYFA 2A37A 5IH2A 2EGEA 1K1ZA 2EPDA 2KEAA 3VS6A 1M3AA 1AWXA 3IQLA 2O9VA 1E6GA 1BU1A 1SRLA 1YP5A 1VYVA 1S1NA 4KRTA 2OI3A 1JEGA 2DMOA 4EIKA 1VYTA 1YNZA 2GGRA 3M0QA 1HSQA 1WA7A 1JQQA 1W70A 4F17A 1KJWA 2J7IA 2FRYA 2YDLA 3LH5A 5FWCA 1GBRA 1RLPC 3I35A 2DJQA 2B86A 2HSPA 1MV3A 2DF6A 1WIEA 2BZYA 1AEYA 2J6OA 4WCIA 4CC4B 3GBQA 4AFUC 2C0OA 2KRSA 2LQNA 4LE9A 1UJ0A 3UA7A 1PHTA 2RQRA 1SSHA 2J06A 4GBQA 1NLOC 1Z9ZA 4ORZA 2D1XA 2AZSA 3EHQA 3ZL7C 2O88A 1WXTA 1I0CA 5IXBA 2KT8A 1SPKA 1VA7A 1PWTA 2ROLA 2JTEA 2CDTA 3NPFA 2KYMA 2ECZA 4J9GA 2LJ1A 2LCSA 1PKTA 2BZ8A 2MIOA 3EG3A 4RTYA 2FG0A 3PVQA 1UHFA 1OEBA 3QWXX 4RUGA 2YUPA 1KIKA 1PRLC 1N5ZA 1JU5C 1JXMA 2EYYA 4OMLA 3EG0A 2LJ3A 1ZUYA 1WXBA 2EYXA 1UJYA 1OOTA 2DA9A 1WXUA 2OAWA 4X1VA 5IHKA 4D8KA 3REBB 1JXOA 1U06A 2LNHB 2K3BA 2PNIA 4RTVA 2VKNA 1X6GA 1X6BA 5EC7A 2NWMA 2DRKA 2AKLA 4QT7A 4RTZA 3VRYA 5I11A 4AFSC 1NLPC 1LCKA 2D0NA 4HXJA 4E6RA 1AWOA 4AFZC 2YSQA 1HD3A 1M30A 1H3HA 1QWEA 2FO0A 3H0IA 2J6KA 2EGAA 2DYBA 2LZ6B 1PRMC 1TUDA 2X3XD 2RQWA 2DL4A 4AG2C 4IIOA 2RPNA 3ULRB 2V1RA 4F14A 3FJ5A 1BBZA 4OMPA 4J9CA 1QWFA 5HCKA 2CUBA 2JS2A 1AZEA 1B3QA 2F2WA 1QLYA 1Y57A 2L3SA 2KRMA 2O2OA 3M0TA 1NEGA 4OMNA 2LMJA 1GCPA 1CSKA 4OMOA 1UE9A 2K79A 5I22A 1UGVA 1M27C 1YCSB 2ABLA 3PVLA 4LNPA 2J6FA 1UTIA 2K7AA 4R0KA 2CH4A 1HJDA 2RN8A 1TUCA 2LP5A 2DRMA 2I0NA 2EQIA 2DL7A 1X2QA 1NG2A 2J05A 2NUZA 1SHFA 3EG1A 2GBQA 2ESWA 5IXFA 2JM9A 3UATA 3C0CA 4FSSA 1U3OA 2E5KA 1VYUA 4JZ3A 3RNJA 3SHWA 1XOVA 3CQTA 1G2BA 1M3BA 1AZGB 1K76A 1X43A 2RMOA 4ESRA 1OPKA 4DEXA 1SRMA 1WDXA 2ED0A 2L3QA 3EHRA 2DE0X 3THKA 4AG1C 2CSQA 1PNJA 2DL8A 2X3WD 1H8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHN A;  2HEQ A;  3R6N A;  4LN2 A;  2FEI A;  2A08 A;  1ABO A;  1MUZ A;  1GFC A;  4RTU A;  1FYN A;  2KYB A;  2CH4 W;  2LX7 A;  1WX6 A;  3U23 A;  2RQU A;  3NMZ C;  2A36 A;  3REA B;  1CKA A;  2YUQ A;  4LUE A;  1MV0 B;  4Z8A A;  1V1C A;  1GL5 A;  5IHN A;  2F2X A;  4JPB W;  2GQI A;  3VS2 A;  2G6F X;  1TG0 A;  4Y92 A;  1NYG A;  3EGU A;  1ARK A;  1A0N B;  4IIM A;  2RQV A;  2KT1 A;  4J9I A;  2CSI A;  2ROT A;  2FPF A;  2L3P A;  1ZLM A;  2DNU A;  2EW3 A;  2DBK A;  2CUD A;  2M0Y A;  3PE0 A;  3NGP A;  3VRZ A;  3EG2 A;  1YWO A;  1OV3 A;  1UUE A;  2VWF A;  1T3S A;  2EYW A;  2KGT A;  2HBW A;  2K9G A;  1U5S A;  2YT6 A;  2V1Q A;  3I9Q A;  1T0H A;  2IIM A;  3TVT A;  4HVW A;  3M0U A;  4K11 A;  2KR3 A;  2H8H A;  1K9A A;  2DLP A;  1BK2 A;  1GCQ C;  3H0F A;  1AVZ C;  1T0J A;  2KRO A;  2RNA A;  5IHI A;  2FPD A;  3VS7 A;  1UEC A;  4HVV A;  2KBT A;  1WLP B;  2JMC A;  4GLM A;  2KE9 A;  2SRC A;  3VS1 A;  5GJW B;  3VS4 A;  1UHC A;  2MOX A;  4JZ4 A;  1K0X A;  2YUN A;  2DL3 A;  1UDL A;  4HVU A;  1I07 A;  1AOJ A;  1Z9Q A;  2KXD A;  2JXB A;  1B07 A;  2F2V A;  1GCQ A;  2EYZ A;  1RUW A;  1X69 A;  1Y0M A;  3SEM A;  1K0S A;  4J9B A;  3VS0 A;  2C0I A;  1ABQ A;  1UG1 A;  2W0Z A;  2K2M A;  2JMA A;  1AWW A;  2AKK A;  1BB9 A;  2RQT A;  1W6X A;  2OJ2 A;  4CC2 A;  1SHG A;  1J3T A;  4CC3 A;  3H0H A;  2JS0 A;  2EKH A;  4DEY A;  2HDA A;  2PTK A;  4JJB A;  4J9E A;  5GJV B;  2DIL A;  1AWJ A;  4RTW A;  2L0A A;  1WYX A;  2YUO A;  2EGC A;  2L2P A;  1K4U S;  2QDL A;  4RTX A;  1NM7 A;  2ED1 A;  1M3C A;  2O9S A;  1E7O A;  2JT4 A;  3A98 A;  2W10 A;  3M0P A;  2RF0 A;  2DL5 A;  2AZV A;  1KFZ A;  4M4Z A;  4LUD A;  3QWY A;  1EFN A;  2CRE A;  1UFF A;  2FPE A;  5FW9 A;  1H92 A;  4HCK A;  1YN8 A;  3O5Z A;  5ECA A;  4J9D A;  1T3L A;  2BTT A;  1ZUU A;  2PZ1 A;  2FRW A;  4JJD A;  1GFD A;  1YWP A;  1FMK A;  2CT4 A;  4OMQ A;  3KFV A;  1KSW A;  1GRI A;  2D8H A;  2ENM A;  2KRN A;  4CC7 A;  3RBB B;  4A63 B;  1IO6 A;  2GTJ A;  3UA6 A;  1RI9 A;  2DM1 A;  5L23 A;  2LQW A;  5FWB A;  1NEB A;  3UF4 A;  2LJ0 A;  3TSW A;  3I5S A;  1QKX A;  4RTT A;  4J9H A;  2DX1 A;  3H41 A;  3VS3 A;  1CKB A;  1OPL A;  1E6H A;  1WI7 A;  2M51 A;  2AK5 A;  4OMM A;  4ZNX A;  2JM8 A;  2XMF A;  4D8D A;  1W1F A;  3JV3 A;  1M8M A;  1ZUK A;  1I1J A;  1ZBJ A;  2C0T A;  1QKW A;  4Z88 A;  4J9F A;  1SEM A;  1G83 A;  1ZX6 A;  2K6D A;  2CT3 A;  1ZSG A;  2MCN A;  3M0R A;  1QCF A;  2DBM A;  2KNB B;  3TSZ A;  1RLQ C;  2EBP A;  3I5R A;  2KXC A;  3M0S A;  3VS5 A;  2EVR A;  2GNC A;  2A28 A;  2DVJ A;  4Z89 A;  4F16 A;  2HCK A;  4JJC A;  1GBQ A;  4AFQ C;  2BZX A;  2GTO A;  1JO8 A;  2SEM A;  2VVK A;  2P4R A;  2JW4 A;  2O31 A;  2D8J A;  1WFW A;  1X2K A;  1PKS A;  1X27 A;  1AD5 A;  1NYF A;  2A37 A;  5IH2 A;  2EGE A;  1K1Z A;  2EPD A;  2KEA A;  3VS6 A;  1M3A A;  1AWX A;  3IQL A;  2O9V A;  1E6G A;  1BU1 A;  1SRL A;  1YP5 A;  1VYV A;  1S1N A;  4KRT A;  2OI3 A;  1JEG A;  2DMO A;  4EIK A;  1VYT A;  1YNZ A;  2GGR A;  3M0Q A;  1HSQ A;  1WA7 A;  1JQQ A;  1W70 A;  4F17 A;  1KJW A;  2J7I A;  2FRY A;  2YDL A;  3LH5 A;  5FWC A;  1GBR A;  1RLP C;  3I35 A;  2DJQ A;  2B86 A;  2HSP A;  1MV3 A;  2DF6 A;  1WIE A;  2BZY A;  1AEY A;  2J6O A;  4WCI A;  4CC4 B;  3GBQ A;  4AFU C;  2C0O A;  2KRS A;  2LQN A;  4LE9 A;  1UJ0 A;  3UA7 A;  1PHT A;  2RQR A;  1SSH A;  2J06 A;  4GBQ A;  1NLO C;  1Z9Z A;  4ORZ A;  2D1X A;  2AZS A;  3EHQ A;  3ZL7 C;  2O88 A;  1WXT A;  1I0C A;  5IXB A;  2KT8 A;  1SPK A;  1VA7 A;  1PWT A;  2ROL A;  2JTE A;  2CDT A;  3NPF A;  2KYM A;  2ECZ A;  4J9G A;  2LJ1 A;  2LCS A;  1PKT A;  2BZ8 A;  2MIO A;  3EG3 A;  4RTY A;  2FG0 A;  3PVQ A;  1UHF A;  1OEB A;  3QWX X;  4RUG A;  2YUP A;  1KIK A;  1PRL C;  1N5Z A;  1JU5 C;  1JXM A;  2EYY A;  4OML A;  3EG0 A;  2LJ3 A;  1ZUY A;  1WXB A;  2EYX A;  1UJY A;  1OOT A;  2DA9 A;  1WXU A;  2OAW A;  4X1V A;  5IHK A;  4D8K A;  3REB B;  1JXO A;  1U06 A;  2LNH B;  2K3B A;  2PNI A;  4RTV A;  2VKN A;  1X6G A;  1X6B A;  5EC7 A;  2NWM A;  2DRK A;  2AKL A;  4QT7 A;  4RTZ A;  3VRY A;  5I11 A;  4AFS C;  1NLP C;  1LCK A;  2D0N A;  4HXJ A;  4E6R A;  1AWO A;  4AFZ C;  2YSQ A;  1HD3 A;  1M30 A;  1H3H A;  1QWE A;  2FO0 A;  3H0I A;  2J6K A;  2EGA A;  2DYB A;  2LZ6 B;  1PRM C;  1TUD A;  2X3X D;  2RQW A;  2DL4 A;  4AG2 C;  4IIO A;  2RPN A;  3ULR B;  2V1R A;  4F14 A;  3FJ5 A;  1BBZ A;  4OMP A;  4J9C A;  1QWF A;  5HCK A;  2CUB A;  2JS2 A;  1AZE A;  1B3Q A;  2F2W A;  1QLY A;  1Y57 A;  2L3S A;  2KRM A;  2O2O A;  3M0T A;  1NEG A;  4OMN A;  2LMJ A;  1GCP A;  1CSK A;  4OMO A;  1UE9 A;  2K79 A;  5I22 A;  1UGV A;  1M27 C;  1YCS B;  2ABL A;  3PVL A;  4LNP A;  2J6F A;  1UTI A;  2K7A A;  4R0K A;  2CH4 A;  1HJD A;  2RN8 A;  1TUC A;  2LP5 A;  2DRM A;  2I0N A;  2EQI A;  2DL7 A;  1X2Q A;  1NG2 A;  2J05 A;  2NUZ A;  1SHF A;  3EG1 A;  2GBQ A;  2ESW A;  5IXF A;  2JM9 A;  3UAT A;  3C0C A;  4FSS A;  1U3O A;  2E5K A;  1VYU A;  4JZ3 A;  3RNJ A;  3SHW A;  1XOV A;  3CQT A;  1G2B A;  1M3B A;  1AZG B;  1K76 A;  1X43 A;  2RMO A;  4ESR A;  1OPK A;  4DEX A;  1SRM A;  1WDX A;  2ED0 A;  2L3Q A;  3EHR A;  2DE0 X;  3THK A;  4AG1 C;  2CSQ A;  1PNJ A;  2DL8 A;  2X3W D;  1H8K A; 
#chains in the Genus database with same CATH topology
 3NHN A;  2JN0 A;  5C0M A;  5DLO A;  4FYX B;  3R6N A;  4LN2 A;  2X4W A;  4C8Q E;  2A08 A;  2RHX A;  2JJ9 A;  1VQO Q;  1WX6 A;  2KK4 A;  3RIR A;  3MET A;  3EGX A;  1CKA A;  3V8K A;  3RR6 A;  1Q7Y U;  2XDP A;  1QCO A;  2F2X A;  1OX9 A;  4JPB W;  1KD1 U;  2GQI A;  3VS2 A;  4NL2 A;  3OA6 A;  3EGU A;  4NL3 A;  4IIM A;  2RI5 A;  2EJ9 A;  2KT1 A;  3GPL A;  5D7U A;  3FRN A;  2CSI A;  2FPF A;  4O6J A;  1ZLM A;  3UWN A;  2CUD A;  4BY6 C;  1LNX A;  3NGP A;  4FW2 A;  3VRZ A;  3JCM W;  5FRM A;  4MZP A;  1TUG B;  2VWF A;  4LDY A;  2EYW A;  2HBW A;  2ZPH B;  4KH0 B;  4C92 G;  3FB9 A;  4XU0 A;  6AT1 B;  3SWN A;  1YJ9 T;  3M0U A;  2CP0 A;  2KR3 A;  2QA4 Q;  1K9A A;  2DLP A;  1AT1 B;  4PKC C;  1AVZ C;  4HCB A;  3BDU A;  2KI7 A;  1KK7 A;  3VV0 A;  2KBT A;  3DB4 A;  1WLP B;  3BFM A;  2K5I A;  3CC2 A;  4GLM A;  1NE8 A;  4PJO F;  1KQ2 A;  4J6X A;  3VS4 A;  3EFO A;  3E2U A;  3JB9 D;  4YTL A;  1Z9Q A;  1N27 A;  2NUT B;  1EIF A;  2JXB A;  3BW1 A;  3M4G A;  1O9S A;  4ZGE B;  1GCQ A;  3QBY A;  4L59 A;  4MDW A;  1WPY A;  1Y0M A;  2X4Y A;  2CKK A;  3DLM A;  1K9M C;  3QKJ A;  3CCV T;  1K0S A;  4ME7 A;  1S72 A;  2C0I A;  1ABQ A;  3ME9 A;  4A54 A;  3CCU A;  4M75 D;  2JMA A;  2CZ7 B;  2RO0 A;  4E47 A;  4PLI A;  1W6X A;  5KYU A;  4CC3 A;  2JS0 A;  2DER A;  3PIP A;  2EKH A;  2PUK B;  3V8J A;  5GJV B;  2DIL A;  2L0A A;  1K73 R;  2L2P A;  1JB0 E;  3H6Z A;  2DEU A;  2O9S A;  1I81 A;  3OYJ A;  1VQM T;  2QK0 A;  1KFZ A;  5IAY A;  1YBY A;  4WF2 A;  4JRQ A;  3QWY A;  4IKF A;  4FYY B;  2ATC B;  3CBP A;  3LWH A;  3OMG A;  2LCL A;  1VQ8 A;  3JCM Q;  3CPW S;  1M1K R;  2IG0 A;  3O5Z A;  4LDU A;  1IB8 A;  5ECA A;  4ELY C;  2MWO A;  4J9D A;  1N8R C;  5LL6 S;  1T3L A;  2BTT A;  2PZ1 A;  2OAU A;  3OYL A;  2NUT A;  3PT9 A;  1GFD A;  1YIJ A;  1VQM A;  2CT4 A;  3MEU A;  2XKO C;  2KQW A;  4HT8 A;  1YHQ Q;  2D8H A;  1ZHI A;  4VUB A;  4E7L A;  2GTJ A;  1R77 A;  1RI9 A;  1RAA B;  5J3B A;  3OS5 A;  2RHZ A;  2NUP B;  1K8A C;  3OYF A;  2QGF B;  3UF4 A;  3I5S A;  2QEX T;  1QKX A;  1KD1 C;  3CCL Q;  3QO3 A;  4M78 E;  3VS3 A;  4IUR A;  1UGR B;  2ZPE B;  1E6H A;  4M78 F;  4CRI A;  1D09 B;  2EJF A;  3OBW A;  4HT9 A;  2XMF A;  1PSF A;  3O8V A;  2RD1 A;  4ZTJ A;  1QKW A;  3LGL A;  1WJR A;  3ZEH A;  2RB6 A;  2ZZD A;  4RMO A;  1SEM A;  1VQK Q;  2FZG B;  1C0M A;  1G83 A;  1ZX6 A;  2E64 A;  2K6D A;  1ZSG A;  4L5G A;  4F7U F;  4M75 B;  3M0S A;  3VS5 A;  2GNC A;  1D0Y A;  3JCM g;  3A8M B;  2DVJ A;  4Z89 A;  4BI8 B;  2X35 A;  3E9F A;  3PNW C;  1LJO A;  3A8H B;  2DIG A;  2VVK A;  4JJN K;  1BI1 A;  3JB9 J;  1VQN T;  2JW4 A;  4QQ6 A;  1X2K A;  1PKS A;  5IH2 A;  3I55 A;  2EGE A;  1E6G A;  4QQG A;  1S1N A;  4KRT A;  1JEG A;  1B34 A;  5GAN h;  5CR2 A;  2GGR A;  2LQ8 A;  1FMW A;  4F17 A;  2DKG A;  1KJW A;  2E70 A;  2FRY A;  1VQP A;  1MHN A;  1RLP C;  3I35 A;  4IUT A;  4M7A E;  2DJQ A;  2HSP A;  1Y96 A;  1MMG A;  1WHJ A;  1BKB A;  4M77 A;  1R0C B;  4CC4 B;  2JZ2 A;  2KRS A;  1KC8 C;  2OTJ A;  3UA7 A;  3M58 A;  2J06 A;  4M7A B;  2D1X A;  5D6X A;  3QPH A;  3ZL7 C;  5GAN 4;  2RI3 A;  2KT8 A;  1K73 U;  4ZGD B;  4OP0 A;  2D6F A;  2P0Q A;  5IN1 A;  3QG1 A;  3JCM J;  2KYM A;  3EGD B;  1PKT A;  2L5Q A;  2BZ8 A;  4ANJ A;  3CBM A;  4JUV A;  2HAX A;  2YUP A;  5KYU B;  1KIK A;  1N5Z A;  1D3B A;  2E10 A;  4C92 F;  3HFN A;  2EYY A;  1KQS S;  4HA8 A;  3OYH A;  4M77 B;  4JDS A;  2EJG A;  1WXU A;  2X4X A;  2MPX C;  1JXO A;  4PJN A;  3QII A;  3HKS A;  1XTD A;  2K3B A;  3C94 A;  4XAX B;  4PJO C;  1Q82 U;  1R0B G;  4RTZ A;  3OMC A;  3DB3 A;  3QDF A;  3VU3 C;  5I11 A;  1NLP C;  2D0N A;  4PJO D;  3OYK A;  3CME Q;  2JVV A;  1AWO A;  4AFZ C;  3OYI A;  3H8Z A;  2KSS A;  3H0I A;  3CC7 Q;  1G3W A;  5GMK e;  2JUF A;  3QYG B;  3UT1 A;  2KMT A;  2DYB A;  1PRM C;  4M7A A;  2DL4 A;  5I2M A;  4AG2 C;  3G71 A;  4IIO A;  3ULR B;  3CXC P;  4F14 A;  1VQK T;  4OMP A;  4C92 A;  2K5F A;  4J9C A;  3WVD B;  2D9T A;  3CXC A;  1AZE A;  1B3Q A;  2F2W A;  3AT1 B;  3G4S T;  2NYS A;  2KRM A;  3M0T A;  4OMN A;  5GAO n;  2QQB A;  3CBO A;  1BCM A;  4PLL A;  2K79 A;  3CD6 Q;  1VQ5 Q;  1M27 C;  5A0D A;  1B7T A;  3RES A;  1ZA2 B;  5J39 A;  4RG8 A;  2ABL A;  2V26 A;  3PVL A;  4LNP A;  2J6F A;  9ATC B;  3L2Q A;  4R0K A;  3LX7 A;  3GNG A;  3OS1 A;  1I5O B;  2EQM A;  2I2L A;  2LP5 A;  3A8L B;  3INZ A;  1OQK A;  2EQI A;  1MMD A;  1YJW T;  5HKC A;  2OX7 A;  2HBP A;  1WHL A;  1WHH A;  2IVW A;  4M75 A;  2M9U A;  3HTR A;  4KUD K;  5CKD A;  4JZ3 A;  2DET A;  2ZPI B;  1XOV A;  2ZPB B;  1X75 C;  2A0F B;  2JNG A;  4FSX A;  4C0G A;  2HKQ B;  3C95 A;  4XU2 A;  1K76 A;  3LGF A;  2RMO A;  4C0D C;  4M7D E;  1OPK A;  1SRM A;  1WDX A;  1HXD A;  5GAN e;  4LD9 K;  2CSQ A;  2V8J A;  1VUB A;  5GAM g;  4PJM A;  1M90 C;  1BIB A;  5KH6 A;  4KT0 E;  1PSE A;  3EH1 A;  3T9N A;  3RMS A;  4F04 B;  1Y71 A;  2BE7 D;  2RHI A;  1MUZ A;  1M5Q 1;  3FC3 A;  2KYB A;  5LJ5 f;  2CH4 W;  1Q7Y C;  2LX7 A;  2RQU A;  2QEX Q;  4ZN1 A;  4NOY A;  1Q82 C;  3REA B;  2MAM A;  3ER0 A;  3HRS A;  2QQ9 A;  5A2Q E;  4LXC A;  3ZBD A;  1GL5 A;  1V1C A;  5GAN 8;  2E65 A;  4J6Y A;  3OYB A;  1NYG A;  1A0N B;  4J9I A;  2JTF A;  2LT4 A;  4FT2 A;  3FLG A;  3TU4 K;  1K9M U;  2M0Y A;  3PE0 A;  3C4S A;  3KXT A;  1M1F A;  4E7Z A;  1QP3 A;  2YWW A;  3Q1J A;  3ASK A;  1OX8 A;  4XU1 A;  4C8Q D;  2P0P A;  4BAC A;  1Y96 B;  1WZO A;  2K9G A;  3CCE T;  1U5S A;  3RKW A;  2YT6 A;  4RKU E;  3M5A A;  3A5Z B;  3I9Q A;  3L2V A;  3CCR Q;  1M1K U;  4C92 C;  1YIT A;  2IIM A;  4GY5 A;  1WNL A;  4JS4 A;  3CPW A;  4II1 A;  5M9O A;  1U1S A;  3CEY A;  2E4H A;  1GCQ C;  2VXE A;  1RAD B;  5LJ3 d;  5IHI A;  2FPD A;  3VS7 A;  1UEC A;  3BE3 A;  3L2Z A;  3P8D A;  1JJ2 A;  2RHY A;  4HKE A;  2COY A;  4JLI A;  2MOX A;  3QYH B;  3AHU A;  2DL3 A;  1UDL A;  2LCC A;  1U8R A;  2E6N A;  2RK1 A;  2KXD A;  3VKI A;  5GMK h;  1B07 A;  5CQY A;  2EYZ A;  5A0L A;  3MKD A;  3SEM A;  4KUL A;  4J9B A;  2LTO A;  2LVM A;  3VS0 A;  1LPL A;  5J26 A;  5GAO q;  4ATO A;  1UG1 A;  2K2M A;  1AWW A;  2DXB A;  1BB9 A;  2RQT A;  1N6A A;  3C12 A;  3SWN B;  4J9E A;  3JCM c;  4RTW A;  1K4U S;  1ZSZ C;  4PJO G;  2ED1 A;  2YHT A;  1M3C A;  1E7O A;  3A98 A;  3GIB A;  1WJQ A;  3I56 Q;  1WQW A;  2PVD B;  5GAM f;  2CRE A;  3S3M A;  2VGN A;  2DXT A;  2MF2 A;  2XK0 A;  3MP8 A;  4HCK A;  3M9Q A;  4DOW A;  1G8X A;  3HFO A;  2HKN A;  2E12 A;  4M75 E;  5LJ5 g;  3RMQ A;  4ZGJ B;  4E7H A;  3X24 B;  5KYX A;  1ZUU A;  5KCH A;  3V7C A;  4X34 A;  3CC2 Q;  1Q7Y R;  1YWP A;  5GAN 3;  2FZK B;  2CP7 A;  2KDS A;  1TH7 A;  1IO6 A;  2HZY A;  2QAS A;  4M7D B;  2BKD N;  4DA4 A;  2FVU A;  5L23 A;  2HQH A;  4XTY A;  1IZ6 A;  2DXC A;  3H41 A;  1S72 Q;  1Q86 U;  2GF7 A;  2QQA A;  1CKB A;  3OYY A;  1MGQ A;  1WI7 A;  2AK5 A;  4OMM A;  4BB7 A;  2V8K A;  3X26 B;  1DJ7 B;  2JM8 A;  4PFZ A;  2R5M A;  2DFU A;  1W1F A;  1ZUK A;  2FB7 A;  1QVF A;  1I1J A;  4Z88 A;  2OTJ Q;  1UGP B;  1I8F A;  2K3X A;  2DYI A;  4A4E A;  4Q5W A;  5D6W A;  2CP2 A;  2CT3 A;  2MCN A;  3A8O B;  2HL5 C;  2LDM A;  4PJO A;  3OBY A;  3J80 E;  3MHX A;  1Q81 U;  1VQ4 A;  2KXC A;  2EVR A;  4QVC A;  1QQJ A;  2OTJ T;  3LLR A;  3OSS C;  1GBQ A;  2OTL A;  5KYW A;  4E7I A;  4PL6 A;  2O31 A;  2DPP B;  1WFW A;  2G3R A;  2QG9 B;  1G3T A;  1AD5 A;  1NYF A;  5KCO A;  1N8R R;  5KYY A;  1YHQ A;  1K1Z A;  3VS6 A;  3JB9 F;  3IQL A;  5GAM e;  5CIU A;  2R5A A;  4RG2 A;  4FL6 A;  1YP5 A;  3CCV Q;  2OI3 A;  2YRC A;  4FT4 A;  4EIK A;  4M7D G;  3SDZ A;  2VAS A;  3BY7 A;  4J6W A;  2GFA A;  5LJ3 j;  5FWC A;  1YFN A;  1TWB A;  4BI3 A;  2KVQ G;  2H3J A;  4DBF A;  3HPW A;  2BZY A;  5CVI A;  1AEY A;  2J6O A;  4RCB A;  3G71 Q;  4AFU C;  1OU8 A;  1B34 B;  3J7A F;  4DBR A;  4X9D A;  5KE2 A;  1Q86 C;  1LOJ A;  1YHQ T;  3VYH B;  2LNV A;  1NLO C;  1ZBX A;  1Z9Z A;  4ORZ A;  2AZS A;  2FHD A;  2CGH A;  5GMK i;  3EHQ A;  1YIT T;  4FYV B;  3I56 T;  1KQS A;  1VQ5 A;  5IXB A;  1SPK A;  1WHG A;  3TEE A;  3CMA Q;  4N4I A;  2CP6 A;  1PWT A;  2ROL A;  4AT1 B;  2CDT A;  1ZA1 B;  4JRP A;  3NPF A;  3JRZ A;  1QCN A;  3BDL A;  2MIO A;  3EG3 A;  1Q86 R;  2RJF A;  1Q81 R;  2DAQ A;  1HYO A;  1UHF A;  4RUG A;  2DXU A;  5GAM j;  3OSV A;  3OS0 A;  3CCJ T;  2LJ3 A;  4OGE A;  1WGS A;  2COW A;  1M1G A;  2PVG B;  1UJY A;  1OOT A;  5IHK A;  4X1V A;  4D8K A;  1RAI B;  3M54 A;  2L8D A;  2VUB A;  1N9R A;  2LNH B;  1BYM A;  2PNI A;  1W4S A;  3HHT B;  1VQN A;  3CPW P;  2K57 A;  1UB4 A;  4KGX B;  1X6G A;  5KYY B;  1FWZ A;  2H3E B;  2DRK A;  4LD6 A;  3CCM T;  4C8Q A;  1PG5 B;  3GLX A;  4AFS C;  1LCK A;  5GAN g;  4E6R A;  4XK8 E;  3CCM Q;  1H3H A;  3CMA T;  3OQ5 A;  2FO0 A;  4BY6 B;  1BI0 A;  1G3S A;  2GQV A;  1VQL A;  5AYF A;  2HNI A;  1YJN T;  5KE3 A;  2RQW A;  2V1R A;  2GFU A;  1QVG P;  2EQJ A;  1I5L A;  1QLY A;  3MEW A;  4FU6 A;  1GCP A;  4M77 G;  1UE9 A;  4ZTF A;  3CCE Q;  3PIO A;  3GF5 A;  1M9S A;  3LH0 A;  3EG9 B;  3S3O A;  4PJO E;  1UTI A;  1FX7 A;  1KG1 A;  2QGG A;  3L2R A;  3CCS Q;  2P0K A;  5HY6 A;  2DRM A;  2I0N A;  1Y7X A;  2HQE A;  1X2Q A;  1JRI A;  2ESW A;  5IXF A;  3UAT A;  3C0C A;  2DJZ A;  1VQ6 T;  1S72 T;  5HK3 A;  4M7A G;  1KD1 R;  1D0Z A;  2ED0 A;  2DE0 X;  5FU7 B;  4JRK A;  2X3W D;  4D6W A;  2XDB A;  1H8K A;  3CD6 T;  2EFI A;  4XTW A;  1RL2 A;  2FEI A;  3CC7 A;  2ZCF B;  1GXI E;  4KGZ B;  2QA4 T;  1GFC A;  4M78 A;  3OS2 A;  1TU0 B;  5GAN 7;  3NMZ C;  2A36 A;  3M53 A;  1IHW A;  1VQ8 T;  2YUQ A;  4LUE A;  1MV0 B;  1SG5 A;  5CKF A;  3E19 A;  2O01 E;  4KBM B;  4M7D D;  4Y92 A;  4QQD A;  3CD6 A;  1VIF A;  2ROT A;  2L3P A;  3PGG A;  2DNU A;  2EW3 A;  3PMI A;  4F7U A;  2DBK A;  2X51 A;  1O75 A;  3VUZ A;  1QVF P;  1NBE B;  2K2V A;  3EG2 A;  1YWO A;  3J81 E;  1BI2 A;  1OV3 A;  2X9H A;  1V29 B;  5KYX B;  3EGD A;  4M77 F;  5GAN 5;  1T3S A;  4LDW A;  1KC8 U;  2KGT A;  3OW2 A;  1RAE B;  2QI2 A;  1NPP A;  4A4H A;  4PJL A;  5DLQ E;  2V1Q A;  2Z0W A;  2RH2 A;  1IGQ A;  4MML A;  2EQK A;  1T0H A;  5LJ5 h;  3HRU A;  5GAN j;  5LJ5 e;  3E1S A;  3TVT A;  1M90 R;  4V2S A;  1YIJ T;  3OB9 A;  1SF9 A;  1U1T A;  4DQ2 A;  1JBM A;  2RNA A;  1P92 A;  4A4F A;  4EMH A;  2AHJ B;  2MYS A;  4HCZ A;  4N0A A;  1G3Y A;  4IUQ A;  2PQW A;  2KE9 A;  5GJW B;  1UHC A;  4JZ4 A;  1K0X A;  2YUN A;  4HVU A;  5I2S A;  1I07 A;  2DTH A;  5GAM h;  4PJJ A;  5GMK l;  4M78 C;  2VYT A;  3L2W A;  2QEX A;  2IPO B;  3EFO B;  1RUW A;  3P8B B;  1G5V A;  1H3Z A;  4BUG A;  4EMG A;  2W0Z A;  4PJO B;  3SWN C;  4F7U G;  2HL3 A;  1LVK A;  1QP2 A;  1M8V A;  2AKK A;  2OJ2 A;  1SHG A;  4DEY A;  4KUI A;  2HDA A;  2PTK A;  3LW5 E;  4JJB A;  1RAF B;  1KQ1 A;  3JB9 I;  2M0O A;  2QDL A;  1YJ9 Q;  1MNE A;  1NM7 A;  3H9N A;  3X28 B;  2JT4 A;  2ZAE A;  4NS5 A;  2W10 A;  3QSU A;  4C0F A;  2RF0 A;  2AZV A;  5FU7 C;  1NZ9 A;  5GAN 2;  1VQ6 Q;  1IXD A;  4M78 G;  4M4Z A;  4OF1 A;  1UGQ B;  4OVA A;  1EFN A;  3HRT A;  2KY9 A;  1YIT Q;  2CZ1 B;  1VQ4 Q;  1WHM A;  2FPE A;  1RAB B;  5FW9 A;  1H92 A;  1YN8 A;  5EG2 A;  2FZC B;  1MMN A;  3JCM d;  2OTL Q;  4OB0 B;  4E7K A;  1QW1 A;  2FRW A;  3QZ9 B;  2VB6 A;  4JJD A;  1Q82 R;  1VQ4 T;  4J5Y A;  3CC4 Q;  3GOX A;  1PCX A;  5FU6 B;  4DBQ A;  3KFV A;  1KSW A;  2KRN A;  4CC7 A;  3RBB B;  4J7I A;  4A63 B;  1X6O A;  2Y4X A;  4JRI A;  3CCV A;  5FWB A;  1BCO A;  2DK3 A;  2XI9 A;  1BI3 A;  1VQO T;  1NEB A;  5FU6 C;  1X01 A;  2LJ0 A;  3TSW A;  4J8O A;  4RTT A;  5CO7 A;  4J9H A;  2RJC A;  5DM7 R;  3HP9 A;  3MJX A;  5FRO A;  1VQ9 Q;  2QTX A;  3QXE B;  4XTZ A;  3CME T;  2DIQ A;  4C92 E;  5CKB A;  2O4X B;  4QKU A;  3SD4 A;  1M8M A;  1ZBJ A;  5GAM d;  4J9F A;  4P5N A;  1KC8 R;  4Y91 A;  1C6V X;  4F7U E;  2CYZ B;  3I56 A;  1IRX A;  5CQX A;  1QCF A;  2LRQ A;  3MO8 A;  4C92 B;  3TSZ A;  3V7S A;  4JS5 A;  4OGC A;  1ZSZ B;  3CMA A;  5GAN 6;  5FLX E;  2F69 A;  5GMK m;  4F16 A;  4AFQ C;  1OYX A;  2Y4Y A;  2BZX A;  2GTO A;  3F70 A;  4O5V A;  1JO8 A;  2P4R A;  4C0Z A;  2D8J A;  2P4T A;  2PVO B;  1YJW Q;  3QDR B;  4B6M A;  4ZN3 A;  3R6O A;  1ACM B;  3G4S A;  1YI2 A;  2EPD A;  2KEA A;  1M1K C;  1M3A A;  2AIR B;  3MP6 A;  2O9V A;  1VQN Q;  2WSE E;  3QHS A;  4PK4 A;  1YNZ A;  1HSQ A;  4EMK A;  4PFO A;  5LJ5 d;  1GBR A;  3LH5 A;  4M7D C;  4IUV A;  3CCQ Q;  2LC4 A;  3UDC A;  2B86 A;  1TXQ A;  1MV3 A;  4ELZ C;  1K73 C;  1M2V B;  5CKH A;  1VQL Q;  2DZ9 A;  1WQ7 A;  5FRN A;  5CAI A;  5IT9 E;  3SB2 A;  1W2B S;  3FJP A;  3GBQ A;  4A4G A;  1VQL T;  4Z02 A;  3EH2 A;  1AHJ B;  4C8Q C;  3EAE A;  1YI2 T;  3QJ6 A;  1D0X A;  1YJN A;  2DD4 A;  1KHI A;  1K9M R;  2R57 A;  2O88 A;  1WXT A;  2HQX A;  2MK5 A;  1VA7 A;  2VXF A;  1W2B P;  2LCS A;  2ECZ A;  3MCA B;  2LJ1 A;  2XU8 A;  3D7S B;  1OEB A;  5AT1 B;  1JU5 C;  1WXB A;  2BE9 B;  2DA9 A;  3LYI A;  1I4K 1;  2ZGW A;  2EWN A;  3PFS A;  4C8Q F;  1VQ7 A;  3CCJ A;  1U06 A;  2QQS A;  4RTV A;  4FYW B;  5EC7 A;  2NWM A;  2EIF A;  2AKL A;  4QT7 A;  4OMF B;  1BIA A;  4DOV A;  1IRE B;  1D1B A;  1M30 A;  2QQR A;  2EGA A;  4C0D B;  2EAY A;  2X3X D;  1TUD A;  2XG8 D;  4J7F A;  2CP3 A;  1VQO A;  3RDV A;  3JCM V;  1NJI C;  4XQ3 A;  3FJ5 A;  3VJP A;  2COZ A;  4C5H A;  3JCM P;  4M77 E;  3X25 B;  2JS2 A;  1OZ3 A;  2VC8 A;  2WAC A;  3OYG A;  2QTV A;  2L3S A;  2O2O A;  2GCX A;  1NEG A;  5KYW B;  1CSK A;  4GLK A;  3M4Y A;  4M75 C;  1RAG B;  1OI1 A;  2K7A A;  2RM4 A;  2CH4 A;  1HJD A;  4M7A F;  1KQS P;  1WJS A;  2AT1 B;  2LT1 A;  2K4Y A;  3ZFJ A;  2NUZ A;  3RKY A;  3EG1 A;  5GAN f;  5CKE A;  4UC4 A;  4FSS A;  1M90 U;  1U3O A;  2BIV A;  4XTX A;  2E5K A;  1VYU A;  1PD0 A;  1M2O A;  4C5I A;  5LJ3 f;  1G2B A;  1YCY A;  4A4K A;  1AZG B;  3EG9 A;  4M7A C;  2X4J A;  2QA4 A;  2YRV A;  2RJD A;  3NTH A;  1C1A A;  2MMP A;  3OW2 S;  2OTL T;  1RAC B;  1PC0 A;  2DL8 A;  3G6E Q;  2WSF E;  1K8A R;  3CCR T;  4IUP A;  5GAO r;  3CCM A;  2HEQ A;  2E6Z A;  4N0A C;  1RAH B;  4L6V 5;  1QVP A;  3QUI A;  2NUP A;  1ABO A;  3M59 A;  2HSE B;  2RA2 A;  1FXX A;  4RTU A;  1FYN A;  3U23 A;  1IGU A;  2F5K A;  4KGV B;  4Z8A A;  5IHN A;  2HD0 A;  4JLG A;  4XU3 A;  2G6F X;  1TG0 A;  1WHK A;  3DLL A;  1ARK A;  3CCE A;  2RQV A;  3V7R A;  1NJI R;  3CC4 T;  2DTI A;  1QVG A;  3MEA A;  3VUB A;  3CCQ T;  3S6W A;  4MMK A;  5I21 A;  2E3I A;  2RI2 A;  1YJ9 A;  2MWP A;  1UUE A;  3CCS A;  5DY9 A;  1EX4 A;  1M2V A;  1D1C A;  1NPR A;  4WTO B;  2CZ6 B;  2QDY B;  2YXY A;  5GAO l;  3LWI A;  4HVW A;  4K11 A;  2H8H A;  3N5B B;  4F7U B;  5A0G A;  5GAO m;  1BK2 A;  3H0F A;  2RHU A;  3KUF A;  1T0J A;  2KRO A;  2DEQ A;  4R55 A;  4HVV A;  1EZZ B;  4C8Q G;  2JOY A;  2YLB A;  2JMC A;  1YIJ Q;  1VQM Q;  1ZQ1 A;  2SRC A;  3VS1 A;  3HL8 A;  2LX9 A;  4FCY A;  1AOJ A;  2ZPG B;  2E5Q A;  2DO3 A;  2F2V A;  1Q95 G;  5C6S A;  2F1L A;  1N9S A;  1X69 A;  2CP5 A;  1FMV A;  3CCL A;  4EDU A;  3FDR A;  4RCC A;  1IHV A;  1VQ5 T;  3WXM B;  1VQ9 A;  3CC2 T;  4M7D F;  4CC2 A;  5GAO p;  2XD0 A;  1J3T A;  2DD5 A;  3H0H A;  1H64 1;  4C5E A;  1XJW B;  3L2U A;  1AWJ A;  1WYX A;  2YUO A;  2EGC A;  4RTX A;  2PUO B;  3M0P A;  4N4H A;  1VIE A;  2DL5 A;  3NTI A;  3OYE A;  5GAN d;  3RKX A;  4LUD A;  1VOM A;  2A3L A;  3X20 B;  2VGM A;  3OY9 A;  1UFF A;  2PU9 B;  3NFC A;  4M78 D;  2R58 A;  1MND A;  3RER A;  4BD3 A;  2DVE A;  4X9C A;  4EMK C;  3WVE B;  4M7D A;  1FMK A;  2M02 A;  4OMQ A;  2HMA A;  1GRI A;  3G4S Q;  1YI2 Q;  2A7Y A;  2ENM A;  3L1A A;  2CZ0 B;  3UA6 A;  3FIF A;  2YRD A;  4M75 G;  3OYC A;  2DM1 A;  2MI6 A;  2LQW A;  4BE0 A;  1RI0 A;  8AT1 B;  2K3Y A;  5CK9 A;  4HCC A;  2RK2 A;  1VQ7 T;  3P8H A;  5CCA A;  1JJ2 S;  2DX1 A;  3CCU Q;  3CCQ A;  1OPL A;  2M51 A;  3CCL T;  1W2B A;  1VQP T;  3EFS A;  1Q81 C;  4ZNX A;  3G6E T;  4D8D A;  3QZ5 B;  1R8O B;  3JV3 A;  1Y07 A;  5LJ3 e;  4EPC A;  5LJ3 h;  2C0T A;  4M78 B;  1TTH B;  3JSC A;  4QVZ A;  2FL7 A;  5KYN A;  3G1J A;  4AMC A;  1VQ6 A;  2C06 A;  3M0R A;  3TCJ A;  2DBM A;  4QVD A;  4DBH A;  1KHC A;  4C8Q B;  2KNB B;  4PNO A;  4MDX A;  1RLQ C;  2EBP A;  3I5R A;  2WSC E;  1V76 A;  4OB1 B;  3A8G B;  1N8R U;  3JCM X;  2A28 A;  1VQ8 Q;  2P84 A;  1PD1 A;  2HCK A;  4JJC A;  4M7A D;  3CCS T;  4CI0 C;  4XTV A;  4E2F B;  3OYA A;  1K8A U;  2SEM A;  1M4Z A;  4C92 D;  2QAZ A;  3CC4 A;  3MP1 A;  1X27 A;  2A37 A;  3EFR A;  1MMA A;  3E9G A;  1AWX A;  2ZPF B;  2BUD A;  2M16 A;  4QW2 A;  4BE1 A;  2XHC A;  1BU1 A;  1SRL A;  4B9X A;  1VYV A;  1HK9 A;  2DMO A;  1VYT A;  3M0Q A;  4TVR A;  1WA7 A;  1JQQ A;  1W70 A;  3VYG A;  2J7I A;  2YDL A;  3I55 T;  1TS9 A;  3CME A;  4Y28 E;  3NTK A;  1XQH A;  2E3H A;  4MZM A;  2DF6 A;  5HK0 A;  1ZSZ A;  1WIE A;  1OZ2 A;  2DZC A;  2JTM A;  2M1H A;  4WCI A;  4J83 A;  1QVF S;  1SKU B;  3OW2 P;  2C0O A;  4IUU A;  1OU9 A;  2LQN A;  1SSF A;  3TQ7 P;  4FIB A;  2F5T X;  4LE9 A;  1UJ0 A;  5GMK j;  3JB9 H;  1VQK A;  1PHT A;  5LJ3 g;  2RQR A;  1SSH A;  1D3B B;  4GBQ A;  4R56 A;  4E7J A;  2L89 A;  1I0C A;  2Y90 A;  3QJY A;  3CPF A;  2EKO A;  2DTO A;  2JTE A;  4J9G A;  3TRE A;  3JCM e;  3FEO A;  4N4G A;  4LDX A;  4RTY A;  2FG0 A;  3JCM h;  3PVQ A;  2E41 A;  1VQ9 T;  1TOV A;  3QWX X;  1PRL C;  2QXF A;  1JXM A;  1QMC A;  4OML A;  3EG0 A;  3L42 A;  1ZUY A;  1YJW A;  4BI4 A;  2EYX A;  3I55 Q;  2XIC A;  2K5L A;  1JJ2 P;  4KH1 B;  4E7S A;  3RUX A;  4PFP A;  2OAW A;  3REB B;  3GNF B;  4FM4 B;  4M77 C;  2QYZ A;  4M75 F;  2L3R A;  8ATC B;  2D0Q B;  2VKN A;  4B9W A;  4C5G A;  2O4X A;  1X6B A;  3G71 T;  3JCM b;  1QVG S;  4BDZ A;  3VRY A;  3G6E A;  4HXJ A;  2XID A;  1VQP Q;  2YSQ A;  1HD3 A;  2NLU A;  1QWE A;  3OYD A;  2V8I A;  3CCU T;  1NJI U;  3M57 A;  2B8A A;  2J6K A;  5D6Y A;  2LZ6 B;  2RPN A;  1BBZ A;  1F1B B;  3MEV A;  2LQK A;  3M56 A;  1QWF A;  5HCK A;  2CUB A;  3MPU B;  2RJE A;  3CC7 T;  1UGS B;  1Y57 A;  4BDY A;  2VV5 A;  2KAF A;  2XDD A;  2CS7 A;  1YJN Q;  4MZT A;  2LMJ A;  3EGX B;  4OMO A;  3JAM E;  5I22 A;  1UGV A;  4LDV A;  3OYM A;  3DKM A;  1TSF A;  2EYQ A;  1YCS B;  4OB3 B;  3M55 A;  3CXC S;  3JB9 G;  4OB2 B;  3G7Z A;  3A1P A;  1XNI A;  1PM3 A;  2RN8 A;  3OYN A;  4FW1 A;  1TUC A;  3SFM A;  3PMT A;  2DL7 A;  3V8L A;  3HSB A;  1NG2 A;  2J05 A;  3JCM f;  1SHF A;  2GBQ A;  2JM9 A;  3GP8 A;  4EMK B;  3KBG A;  3CCR A;  3RNJ A;  3SHW A;  4M77 D;  3CQT A;  4BE2 A;  1VQ7 Q;  3CCJ Q;  1M3B A;  1D1A A;  1OUL A;  2FYK A;  5L8R E;  4XTU A;  2YLC A;  1X43 A;  4ESR A;  1UEB A;  2EQU A;  4DEX A;  2E1H A;  2L3Q A;  4A53 A;  3EHR A;  3S3N A;  3THK A;  4AG1 C;  7AT1 B;  5LJ5 j;  3PTA A;  1PNJ A;  3URG A;  3UPU A; 
#chains in the Genus database with same CATH homology
 3NHN A;  2HEQ A;  3R6N A;  4LN2 A;  2FEI A;  2A08 A;  1ABO A;  1MUZ A;  1GFC A;  4RTU A;  1FYN A;  2KYB A;  2CH4 W;  2LX7 A;  1WX6 A;  3U23 A;  2RQU A;  3NMZ C;  2A36 A;  3REA B;  1CKA A;  2YUQ A;  4LUE A;  1MV0 B;  4Z8A A;  1V1C A;  1GL5 A;  5IHN A;  2F2X A;  4JPB W;  2GQI A;  3VS2 A;  2G6F X;  1TG0 A;  4Y92 A;  1NYG A;  3EGU A;  1ARK A;  1A0N B;  4IIM A;  2RQV A;  2KT1 A;  4J9I A;  2CSI A;  2ROT A;  2FPF A;  2L3P A;  1ZLM A;  2DNU A;  2EW3 A;  2DBK A;  2CUD A;  2M0Y A;  3PE0 A;  3NGP A;  3VRZ A;  3EG2 A;  1YWO A;  1OV3 A;  1UUE A;  2VWF A;  1T3S A;  2EYW A;  2KGT A;  2HBW A;  2K9G A;  1U5S A;  2YT6 A;  2V1Q A;  3I9Q A;  1T0H A;  2IIM A;  3TVT A;  4HVW A;  3M0U A;  4K11 A;  2KR3 A;  2H8H A;  1K9A A;  2DLP A;  1BK2 A;  1GCQ C;  3H0F A;  1AVZ C;  1T0J A;  2KRO A;  2RNA A;  5IHI A;  2FPD A;  3VS7 A;  1UEC A;  4HVV A;  2KBT A;  1WLP B;  2JMC A;  4GLM A;  2KE9 A;  2SRC A;  3VS1 A;  5GJW B;  3VS4 A;  1UHC A;  2MOX A;  4JZ4 A;  1K0X A;  2YUN A;  2DL3 A;  1UDL A;  4HVU A;  1I07 A;  1AOJ A;  1Z9Q A;  2KXD A;  2JXB A;  1B07 A;  2F2V A;  1GCQ A;  2EYZ A;  1RUW A;  1X69 A;  1Y0M A;  3SEM A;  1K0S A;  4J9B A;  3VS0 A;  2C0I A;  1ABQ A;  1UG1 A;  2W0Z A;  2K2M A;  2JMA A;  1AWW A;  2AKK A;  1BB9 A;  2RQT A;  1W6X A;  2OJ2 A;  4CC2 A;  1SHG A;  1J3T A;  4CC3 A;  3H0H A;  2JS0 A;  2EKH A;  4DEY A;  2HDA A;  2PTK A;  4JJB A;  4J9E A;  5GJV B;  2DIL A;  1AWJ A;  4RTW A;  2L0A A;  1WYX A;  2YUO A;  2EGC A;  2L2P A;  1K4U S;  2QDL A;  4RTX A;  1NM7 A;  2ED1 A;  1M3C A;  2O9S A;  1E7O A;  2JT4 A;  3A98 A;  2W10 A;  3M0P A;  2RF0 A;  2DL5 A;  2AZV A;  1KFZ A;  4M4Z A;  4LUD A;  3QWY A;  1EFN A;  2CRE A;  1UFF A;  2FPE A;  5FW9 A;  1H92 A;  4HCK A;  1YN8 A;  3O5Z A;  5ECA A;  4J9D A;  1T3L A;  2BTT A;  1ZUU A;  2PZ1 A;  2FRW A;  4JJD A;  1GFD A;  1YWP A;  1FMK A;  2CT4 A;  4OMQ A;  3KFV A;  1KSW A;  1GRI A;  2D8H A;  2ENM A;  2KRN A;  4CC7 A;  3RBB B;  4A63 B;  1IO6 A;  2GTJ A;  3UA6 A;  1RI9 A;  2DM1 A;  5L23 A;  2LQW A;  5FWB A;  1NEB A;  3UF4 A;  2LJ0 A;  3TSW A;  3I5S A;  1QKX A;  4RTT A;  4J9H A;  2DX1 A;  3H41 A;  3VS3 A;  1CKB A;  1OPL A;  1E6H A;  1WI7 A;  2M51 A;  2AK5 A;  4OMM A;  4ZNX A;  2JM8 A;  2XMF A;  4D8D A;  1W1F A;  3JV3 A;  1M8M A;  1ZUK A;  1I1J A;  1ZBJ A;  2C0T A;  1QKW A;  4Z88 A;  4J9F A;  1SEM A;  1G83 A;  1ZX6 A;  2K6D A;  2CT3 A;  1ZSG A;  2MCN A;  3M0R A;  1QCF A;  2DBM A;  2KNB B;  3TSZ A;  1RLQ C;  2EBP A;  3I5R A;  2KXC A;  3M0S A;  3VS5 A;  2EVR A;  2GNC A;  2A28 A;  2DVJ A;  4Z89 A;  4F16 A;  2HCK A;  4JJC A;  1GBQ A;  4AFQ C;  2BZX A;  2GTO A;  1JO8 A;  2SEM A;  2VVK A;  2P4R A;  2JW4 A;  2O31 A;  2D8J A;  1WFW A;  1X2K A;  1PKS A;  1X27 A;  1AD5 A;  1NYF A;  2A37 A;  5IH2 A;  2EGE A;  1K1Z A;  2EPD A;  2KEA A;  3VS6 A;  1M3A A;  1AWX A;  3IQL A;  2O9V A;  1E6G A;  1BU1 A;  1SRL A;  1YP5 A;  1VYV A;  1S1N A;  4KRT A;  2OI3 A;  1JEG A;  2DMO A;  4EIK A;  1VYT A;  1YNZ A;  2GGR A;  3M0Q A;  1HSQ A;  1WA7 A;  1JQQ A;  1W70 A;  4F17 A;  1KJW A;  2J7I A;  2FRY A;  2YDL A;  3LH5 A;  5FWC A;  1GBR A;  1RLP C;  3I35 A;  2DJQ A;  2B86 A;  2HSP A;  1MV3 A;  2DF6 A;  1WIE A;  2BZY A;  1AEY A;  2J6O A;  4WCI A;  4CC4 B;  3GBQ A;  4AFU C;  2C0O A;  2KRS A;  2LQN A;  4LE9 A;  1UJ0 A;  3UA7 A;  1PHT A;  2RQR A;  1SSH A;  2J06 A;  4GBQ A;  1NLO C;  1Z9Z A;  4ORZ A;  2D1X A;  2AZS A;  3EHQ A;  3ZL7 C;  2O88 A;  1WXT A;  1I0C A;  5IXB A;  2KT8 A;  1SPK A;  1VA7 A;  1PWT A;  2ROL A;  2JTE A;  2CDT A;  3NPF A;  2KYM A;  2ECZ A;  4J9G A;  2LJ1 A;  2LCS A;  1PKT A;  2BZ8 A;  2MIO A;  3EG3 A;  4RTY A;  2FG0 A;  3PVQ A;  1UHF A;  1OEB A;  3QWX X;  4RUG A;  2YUP A;  1KIK A;  1PRL C;  1N5Z A;  1JU5 C;  1JXM A;  2EYY A;  4OML A;  3EG0 A;  2LJ3 A;  1ZUY A;  1WXB A;  2EYX A;  1UJY A;  1OOT A;  2DA9 A;  1WXU A;  2OAW A;  4X1V A;  5IHK A;  4D8K A;  3REB B;  1JXO A;  1U06 A;  2LNH B;  2K3B A;  2PNI A;  4RTV A;  2VKN A;  1X6G A;  1X6B A;  5EC7 A;  2NWM A;  2DRK A;  2AKL A;  4QT7 A;  4RTZ A;  3VRY A;  5I11 A;  4AFS C;  1NLP C;  1LCK A;  2D0N A;  4HXJ A;  4E6R A;  1AWO A;  4AFZ C;  2YSQ A;  1HD3 A;  1M30 A;  1H3H A;  1QWE A;  2FO0 A;  3H0I A;  2J6K A;  2EGA A;  2DYB A;  2LZ6 B;  1PRM C;  1TUD A;  2X3X D;  2RQW A;  2DL4 A;  4AG2 C;  4IIO A;  2RPN A;  3ULR B;  2V1R A;  4F14 A;  3FJ5 A;  1BBZ A;  4OMP A;  4J9C A;  1QWF A;  5HCK A;  2CUB A;  2JS2 A;  1AZE A;  1B3Q A;  2F2W A;  1QLY A;  1Y57 A;  2L3S A;  2KRM A;  2O2O A;  3M0T A;  1NEG A;  4OMN A;  2LMJ A;  1GCP A;  1CSK A;  4OMO A;  1UE9 A;  2K79 A;  5I22 A;  1UGV A;  1M27 C;  1YCS B;  2ABL A;  3PVL A;  4LNP A;  2J6F A;  1UTI A;  2K7A A;  4R0K A;  2CH4 A;  1HJD A;  2RN8 A;  1TUC A;  2LP5 A;  2DRM A;  2I0N A;  2EQI A;  2DL7 A;  1X2Q A;  1NG2 A;  2J05 A;  2NUZ A;  1SHF A;  3EG1 A;  2GBQ A;  2ESW A;  5IXF A;  2JM9 A;  3UAT A;  3C0C A;  4FSS A;  1U3O A;  2E5K A;  1VYU A;  4JZ3 A;  3RNJ A;  3SHW A;  1XOV A;  3CQT A;  1G2B A;  1M3B A;  1AZG B;  1K76 A;  1X43 A;  2RMO A;  4ESR A;  1OPK A;  4DEX A;  1SRM A;  1WDX A;  2ED0 A;  2L3Q A;  3EHR A;  2DE0 X;  3THK A;  4AG1 C;  2CSQ A;  1PNJ A;  2DL8 A;  2X3W D;  1H8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...