1VQ8Q

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq8Q00
2QEXQ 1YHQQ 1VQNQ 2OTLQ 3CPWP 1Q86R 1VQ6Q 3I55Q 3CCEQ 1YJNQ 1YJ9Q 3CD6Q 1M90R 1S72Q 1JJ2P 1K9MR 1VQ8Q 3CCQQ 2QA4Q 2OTJQ 3CCSQ 3CCMQ 1Q81R 1QVGP 1W2BP 1VQ9Q 3CCVQ 1VQMQ 1Q82R 1KC8R 1VQ5Q 3CC4Q 3CCUQ 1YITQ 3CCLQ 3CCRQ 1VQOQ 3G4SQ 3I56Q 3OW2P 1YI2Q 1VQPQ 1K73R 1N8RR 1NJIR 3CMEQ 1KQSP 1VQ4Q 1KD1R 1QVFP 1M1KR 3CXCP 1VQ7Q 1VQKQ 1YJWQ 3G71Q 3G6EQ 3CCJQ 3CC2Q 3CC7Q 1YIJQ 1Q7YR 1K8AR 1VQLQ 3CMAQ
chains in the Genus database with same CATH superfamily
1X6GA 4M78A 4C92F 2DL4A 2RM4A 4LDXA 3FIFA 2F69A 2K5FA 4EMKC 2X35A 1SEMA 4EMKA 3M9QA 1G83A 1OQKA 4C5EA 1RAEB 1WNLA 2E65A 1KK7A 1MV0B 2IIMA 3UA6A 2QI2A 4FT2A 5KYWB 2QTVA 2E1HA 1ZX6A 4Q5WA 4XTWA 2ZPFB 4J6WA 5HK0A 3I56T 2R5AA 1VQ7T 3CD6Q 3BDLA 1FWZA 1I5OB 1YWOA 2FVUA 4M75G 5GAN8 2JW4A 3JCMg 3R6OA 2E70A 2MWPA 5CVIA 2E12A 3EG9B 2FPFA 2HL3A 3MEUA 1YIJT 4XU0A 3CXCP 2YRCA 3QYHB 1I0CA 1IGQA 1BI1A 1JXOA 2HQEA 1OI1A 3URGA 3UT1A 4FYVB 4GLMA 4E7LA 2QQBA 2JS0A 4DBRA 1I4K1 3CCLA 2ZPIB 1YCSB 1NLOC 2K3XA 2HQXA 3D7SB 2FRYA 4JS5A 3BW1A 2BKDN 1D1AA 3QSUA 5I2SA 3EGXA 2AK5A 1YP5A 1X27A 4PJJA 3EFSA 5A0DA 1UHFA 4J9BA 3PMTA 2F2VA 5GMKm 3CCEQ 1YJ9Q 3LWHA 3VS6A 4AG2C 1VQ8Q 2DA9A 3QJYA 5FRMA 5DY9A 2GFAA 4KH0B 4JLGA 3VRYA 4QQ6A 3OW2P 4JDSA 2K2MA 3H0IA 1W4SA 3E9FA 3CCST 3OMCA 3IQLA 2J6FA 3G4SA 6AT1B 3RUXA 2FZGB 2KK4A 1D1CA 3FLGA 3INZA 2GCXA 2K5IA 2AT1B 5GAOr 2OTJT 4C8QF 3JCMd 2OTLA 5FRNA 1PKSA 1UTIA 1WHGA 3CCMT 4AG1C 2X4WA 1C6VX 2R5MA 2RD1A 3JCMX 5CK9A 1WPYA 2AHJB 1N9RA 1MUZA 2SEMA 2CZ6B 1QVGA 1YN8A 4J8OA 1F1BB 3M0RA 3MKDA 1ACMB 4E7ZA 3SWNC 5HK3A 2KBTA 2RPNA 5FU7C 2EVRA 4C8QD 5AYFA 2CP2A 5KYWA 1ABQA 2KYBA 2V8IA 2I2LA 3QG1A 1K8AC 3X28B 1W1FA 2DL5A 4JS4A 2K7AA 1MV3A 2RA2A 4Z89A 1JBMA 3QWXX 2RQRA 3L2RA 4C8QA 3DKMA 4BI3A 1SHGA 1G3TA 3CMAT 3QWYA 1X69A 2DE0X 3EG3A 2ESWA 1AWXA 4JZ4A 1NPPA 1AWOA 2QDYB 3CCJA 3L42A 1UECA 1B7TA 5GAOm 1ZBXA 4LD9K 1OYXA 2ABLA 1OU9A 3VRZA 2ZGWA 2M0OA 4V2SA 2PQWA 4X1VA 1I8FA 2GGRA 3PVQA 3REAB 1QVPA 4FIBA 5GAN4 3L1AA 1RUWA 3CPWS 5LJ3g 5CKEA 2HD0A 1Y07A 2JTEA 5C6SA 2NUZA 2RO0A 1WYXA 1M1GA 4JJDA 2D8JA 3CPWP 2EJFA 2JT4A 3M58A 2KMTA 5CCAA 3CCRA 4C0ZA 2LCLA 2HNIA 3PT9A 2KY9A 4XK8E 3CCQA 2NWMA 3TVTA 4M78G 1QVFA 1WJSA 3RKXA 2CS7A 3E1SA 5D6WA 1M90C 2MMPA 5GMKe 1TS9A 3HTRA 4BY6B 3TCJA 1G5VA 5CAIA 1GRIA 2QYZA 4CC3A 2RF0A 5LJ5h 3CC7T 3M0SA 3OYMA 1U8RA 3G71T 3UA7A 3CCQT 2DO3A 2M16A 3CC4Q 2EGAA 2X9HA 4QKUA 1YHQT 4QVZA 5IAYA 2ECZA 2V1QA 1NEBA 1UUEA 1QKXA 4J9CA 3QDFA 4QVDA 1WXUA 1Q7YR 4EMGA 4F17A 2SRCA 3E9GA 3FC3A 1XTDA 1KQ2A 1X2QA 3CCQQ 1HJDA 4AFUC 2IVWA 2NUPA 2KXDA 2Z0WA 3LGLA 2ED1A 2NUTB 2ROLA 4MZTA 1R0CB 1IB8A 3LH5A 1EIFA 1Y0MA 4GLKA 3NPFA 3MP6A 3OW2A 1TOVA 4XU3A 3C4SA 1YJWA 3SWNB 3CCRT 4E2FB 3EG1A 3L2ZA 2DXUA 2M51A 4E7IA 3A8LB 2OTJA 4EDUA 4LDUA 1NJIU 1QW1A 3HHTB 4OMLA 4EIKA 3VKIA 1JEGA 4DBHA 3ZBDA 4WF2A 5GJWB 1TUGB 3OB9A 3OS5A 2LZ6B 2DL7A 5FW9A 3X25B 3OW2S 4QT7A 2PUKB 1K4US 2KI7A 2ZPGB 5GAN7 1OU8A 1VYTA 4RTWA 1BIAA 2EBPA 4EMKB 2XG8D 1GXIE 2IPOB 2EJ9A 4X9CA 5CKHA 2DXCA 1H641 2PNIA 4KUIA 3FRNA 2WSEE 2YRDA 5GAN6 1K73C 1Z9QA 4M78E 3EHRA 1OULA 4RTTA 1T0JA 8ATCB 4HCCA 2J6OA 1AHJB 3HL8A 4HCZA 3CCMQ 2XKOC 2DEUA 1Q81U 3FEOA 2QEXT 3MPUB 2ENMA 2EQJA 3P8BB 1VQKQ 5KCHA 3LGFA 2ED0A 2DETA 1UB4A 1RAIB 2LJ0A 2WSFE 2O31A 4BE0A 4M7DD 3AHUA 4B9XA 3VYHB 2P0QA 4C8QC 1OPKA 3VS2A 3JCMP 1X6OA 4RG8A 1CSKA 2EJGA 4JUVA 1D0ZA 3CCVQ 1BBZA 2YUOA 2KRSA 5GMKi 2LNVA 2JS2A 4PKCC 3OYJA 4ZGDB 1VQ9T 3EH1A 3G4ST 1ZSGA 2HKNA 2YSQA 1GL5A 1QVGS 1OZ2A 3CCJT 1WZOA 4Z02A 5LL6S 3RMSA 4F7UA 4M7DF 1EZZB 2VYTA 3BDUA 3PFSA 1UGVA 3CBMA 4FW2A 2DRMA 2DZCA 3C95A 2JTMA 4N4IA 3M0TA 3BFMA 2AKLA 2MIOA 3RDVA 2E3IA 1Q82R 2E6NA 3T9NA 3JV3A 4LN2A 3GBQA 4VUBA 1KHCA 3HPWA 4LNPA 2FEIA 4BE2A 1KHIA 2FG0A 4R55A 1FMKA 5GMKj 3VU3C 4M77D 1UFFA 5GANg 3C0CA 1MNDA 3QPHA 4PLIA 4Y91A 2HDAA 1WHMA 2LJ1A 8AT1B 2E64A 5GAN5 1M2VA 2IG0A 4OB2B 2DXTA 2PVOB 3TEEA 1LPLA 1BI3A 1V29B 4OB0B 2DMOA 3EGDB 4LDVA 3RR6A 1FMWA 4M78F 1Z9ZA 2HBPA 3MJXA 3I56A 3AT1B 3L2UA 1QVFS 4F04B 3H9NA 3OYKA 2CZ1B 2M02A 1YJWT 3I55A 4OB3B 1WX6A 4FSSA 2OAWA 5LJ3d 2XDBA 4K11A 1UG1A 1PNJA 4FYWB 5D6YA 2EGEA 2P4RA 1D0XA 2KRNA 1K0XA 1SSHA 2EKOA 3JB9F 3OYLA 1I5LA 4M7AB 1ZUKA 1NLPC 2P0KA 4M7AA 1WLPB 4GY5A 3S3NA 1S72A 2OI3A 1KD1R 2KYMA 1HD3A 1Q81C 1JU5C 3H41A 4M77E 5FROA 3ER0A 3GP8A 4OMNA 3G6EA 3CMAQ 3QBYA 2YLBA 1NBEB 2E6ZA 3VS7A 3QKJA 2FPDA 2WACA 4HA8A 2QQ9A 2X51A 4J9DA 3NMZC 4PJOC 4CC2A 2FZCB 2JXBA 3OYAA 2R58A 4LXCA 5GANd 2K5LA 4PJMA 2P4TA 4PNOA 2RI3A 2ZPHB 1MMGA 2XDPA 3CC2Q 2JTFA 4MDWA 4M7DG 4Y28E 4D6WA 3HKSA 1N8RU 4C92C 3VS3A 2YUQA 4JRKA 5KYXB 1KQSS 2BZXA 2JOYA 3CCVT 2ZAEA 2QQSA 2MAMA 3PMIA 3RNJA 2E5QA 1QCFA 4PJOG 1K73R 1LVKA 2VKNA 3OS1A 1H3HA 4HVVA 1AWWA 2KVQG 5GAMf 3JCMb 2VUBA 4C5IA 4FW1A 1RI9A 2H3JA 2VV5A 1RAHB 2DD4A 1IHVA 2ZCFB 4E7KA 3NGPA 3PVLA 4N4HA 1S72T 4M78B 4J9HA 2CYZB 2GFUA 2VGNA 1VQ5T 2C0TA 1ZSZC 4JRPA 2QQRA 2MCNA 1WIEA 2HSPA 3EAEA 5A2QE 1KQ1A 1M2VB 2GTOA 4J7FA 4HT9A 2JM8A 4A53A 1LJOA 3HRSA 4C92A 2CUBA 2RI2A 1E7OA 3QXEB 1D0YA 2K3BA 2OTJQ 3CCSQ 1OEBA 3WVEB 2X4YA 1WJRA 1JJ2S 2DNUA 2RB6A 2EPDA 3VS5A 2GF7A 3RERA 4WTOB 2JVVA 1YJWQ 4KH1B 1ZQ1A 2K4YA 1GBRA 2VC8A 4C5GA 1K9MU 5KCOA 1OX8A 3M53A 4F7UG 1KQSA 3CBPA 3CCUA 1IREB 4EMHA 1Q82U 2QASA 4M77G 1OZ3A 1RAGB 5KYUA 2DAQA 1CKAA 1IO6A 1CKBA 2QGFB 4J6XA 2XK0A 3HSBA 2LX7A 3CC7A 5GMKh 1ZSZB 2EFIA 3M57A 3JCMe 2KEAA 2QXFA 1MNEA 4BUGA 3SFMA 1W70A 3V7SA 5GMKl 1WHJA 1B07A 2AKKA 2DTOA 2W0ZA 1GFDA 2RQWA 3HRTA 3U23A 2MI6A 3VS4A 3ZL7C 3OS2A 3A1PA 4BD3A 3OYYA 3UPUA 4J9FA 4PL6A 2PU9B 2M1HA 3FJPA 3QHSA 1GBQA 4M77F 5EG2A 1MHNA 1VQKA 1UGPB 4JJBA 2L8DA 2AZSA 4FT4A 3RBBB 1YJNQ 1VQ4A 1AWJA 1PRMC 1ZLMA 1VQMA 4M77B 4MMLA 1C0MA 4HVUA 4ZN3A 1YITQ 1M1KU 2LQWA 1TXQA 5FWBA 4RCCA 1VQNT 1YHQA 2DL8A 3I5SA 4ZN1A 4J83A 3EGDA 2FYKA 1TUCA 3PNWC 4C0GA 5CQYA 2BZYA 3WVDB 2L89A 1VQ6A 3HFOA 3H6ZA 1K8AU 1VQKT 4F14A 5KYYB 1KC8R 4KUDK 1W2BA 2AIRB 4QW2A 2BTTA 4NOYA 4P5NA 3BY7A 1VQMT 1PKTA 2HBWA 4C8QG 4BB7A 2XICA 1PD0A 4J5YA 4N0AA 3CQTA 1M8VA 2QEXQ 2QTXA 1VQ7A 1KIKA 2JUFA 3CCVA 5LJ5e 2BE7D 5FLXE 1H92A 4X9DA 3G6ET 1U5SA 4BDZA 4KGZB 1WA7A 2CP6A 1Y7XA 2COYA 2BIVA 3CCET 2EWNA 4C0DB 3CBOA 2HCKA 3A8MB 4M75E 5LJ3h 3S3OA 2HMAA 2L2PA 5KE3A 3N5BB 5GAMg 1AZGB 2L3QA 2XMFA 2Y4YA 3ME9A 4M75A 2FHDA 4QVCA 2EQMA 2P0PA 1Y96A 4RTVA 4HCBA 2DBMA 1YJ9T 1JO8A 3LX7A 3L2WA 5GAMj 4C0FA 4PK4A 3G71Q 4KULA 4OGEA 1ZA2B 5L8RE 4ESRA 4HKEA 3LYIA 2RJDA 2AZVA 2M0YA 1LCKA 2DYBA 4IUTA 4FM4B 1I81A 2LQKA 1YCYA 3JAME 4M78D 2DEQA 1M1KR 2DJZA 1UGQB 3M59A 1M27C 2K79A 3SDZA 4BACA 4Z88A 2CT4A 1M4ZA 5GAOn 3J81E 4L5GA 2M9UA 2CDTA 5FU6B 4ZTFA 2QK0A 2VWFA 1YWPA 4MDXA 1JJ2P 1PD1A 2XD0A 2BZ8A 2E3HA 4ATOA 3X26B 4KGVB 3ZEHA 4ELYC 4RTYA 4M7DB 3RKYA 1K1ZA 1LOJA 3ZFJA 2RJEA 1UJYA 4DOVA 1WHHA 3QZ5B 2RK1A 4PJLA 5GAMd 2L3SA 5GAOl 3L2QA 1VQOT 4PFPA 2K6DA 3HRUA 2JJ9A 3QO3A 1JQQA 1UJ0A 3CCLQ 3A8HB 5FU6C 4AMCA 4AFSC 5DLOA 2CGHA 3JSCA 1VOMA 1RAAB 3CPWA 1OOTA 1WXBA 4JLIA 1VQPT 2OX7A 4IUQA 2DX1A 2LX9A 5GAN3 4O5VA 2EQIA 4LUDA 3RMQA 1K9MC 4A54A 2KT1A 2YHTA 4E7HA 1M1KC 1KD1C 3NTHA 1U3OA 3CC4A 3V7CA 1YITT 5GAMh 4LE9A 4XTYA 1I1JA 4M75D 3VYGA 4DBQA 2FPEA 4HCKA 3PIPA 1SF9A 1PWTA 4E7JA 3THKA 3OSVA 5M9OA 3SEMA 3CMEA 5FU7B 1FMVA 5LJ3j 2PUOB 2CUDA 1WGSA 4IKFA 3CC4T 2FB7A 2EYZA 4QQDA 1G3SA 2MF2A 4PJNA 2DFUA 4M75C 4JRIA 1V1CA 1YI2Q 1M8MA 1NPRA 1SRLA 2D0QB 3NHNA 2CT3A 4PFOA 4OGCA 1TTHB 2RHIA 1WQ7A 5D7UA 4E47A 1M90U 1UHCA 3O8VA 2D6FA 1ZUYA 2DKGA 4C8QE 1PHTA 2ZZDA 3CC2T 1TH7A 4M75F 1QVGP 1RLPC 3CMET 2DVEA 5IXBA 3I5RA 3SWNA 4XAXB 4OP0A 1IRXA 4LUEA 5IHNA 2F1LA 2RMOA 3UF4A 4J7IA 1AOJA 3M5AA 1NG2A 3BE3A 1ZUUA 2FO0A 4JZ3A 1QKWA 3PGGA 1FYNA 1T3LA 3EGXB 4J9IA 5C0MA 2PVGB 1UGRB 1YJ9A 3S3MA 2Y4XA 5GANf 1GFCA 2LT4A 5A0LA 4F7UF 5ECAA 3OYCA 1G2BA 1N5ZA 3DB3A 1BI2A 3CXCS 3LLRA 1Q86C 2HL5C 3PIOA 4AFZC 3CCMA 1W2BS 3WXMB 3DLLA 4ZTJA 1BKBA 2RHYA 1SRMA 2R57A 4RMOA 1YBYA 2EKHA 2LCCA 3A8OB 1BIBA 4NS5A 4MZMA 4EPCA 2D8HA 1VQ6T 2LQ8A 1VIFA 1J3TA 3META 3JCMc 1BK2A 2E41A 3JRZA 4M77C 5KYUB 2VXFA 2FZKB 3I9QA 4M7AD 1PRLC 5HKCA 1N27A 3X20B 2KDSA 3VJPA 3TSWA 1IGUA 3QYGB 3TREA 1K73U 1VQ7Q 3CD6T 1JRIA 4B9WA 1M30A 3OYHA 4J6YA 1YIJA 4AT1B 3P8HA 3C12A 5D6XA 3M4GA 2CH4W 3OYGA 2EQKA 4M7AC 3CCLT 3M0UA 3UATA 3UWNA 4F16A 4A4EA 4HT8A 4RG2A 3CCEA 2O9VA 1TG0A 1N8RC 1VQNA 1MMDA 1WHKA 3JCMf 3V8JA 2E4HA 1FX7A 2HEQA 1I07A 3H8ZA 1QP3A 1YI2A 2ZPEB 1ARKA 1YITA 2RN8A 2YLCA 3NTKA 3G7ZA 5KYNA 1R0BG 1VQMQ 3MEAA 5CO7A 3CMEQ 2J05A 4XTXA 4FL6A 1X6BA 4XTVA 2JNGA 3CCJQ 1YIJQ 2LC4A 3OA6A 5GANe 3P8DA 2YUNA 2DXBA 3F70A 4M78C 1VQPA 1RACB 3EHQA 1H3ZA 4A4FA 2EYWA 4CI0C 2LMJA 4DA4A 3I55T 5GAOp 2DPPB 1KJWA 2EYQA 3CD6A 2GQVA 3J7AF 1VQ4T 3L2VA 3MCAB 5LJ5f 2JZ2A 2LQNA 2VASA 1NYFA 3FJ5A 1SG5A 1GCPA 2EGCA 2KT8A 2RJCA 2EYXA 2EYYA 1QCNA 1U1TA 4LDWA 3JCMh 1Y71A 1PSFA 1E6GA 3VUZA 4PJOF 1FXXA 5GJVB 1Q7YC 1WXTA 4B6MA 1YI2T 1WDXA 3OYIA 3A8GB 3A5ZB 4OMMA 5FWCA 2PTKA 3OQ5A 4L59A 3RESA 1VQOQ 2D1XA 3OMGA 2HZYA 3X24B 2GNCA 3CXCA 4A63B 3GLXA 2OAUA 1UDLA 3M0QA 5I11A 2A3LA 2K9GA 1RADB 2HKQB 2JM9A 2KE9A 3JB9I 1Q7YU 3EG0A 2CSIA 2MYSA 1K76A 1VQ8A 2YDLA 3FDRA 4PJOA 1OPLA 3QIIA 3V8LA 2A37A 2RK2A 1KQSP 2LDMA 2XU8A 2V8JA 2RI5A 2W10A 3LH0A 4MMKA 2EAYA 3HP9A 2ATCB 1KC8U 2HSEB 2VGMA 1X01A 3O5ZA 1JXMA 1X75C 1QLYA 1QP2A 4RTZA 2G3RA 3KBGA 4BE1A 2D0NA 1RL2A 4KBMB 3NFCA 1NJIR 2CP5A 1QVFP 4IUVA 2RQTA 4J9EA 1SHFA 2OTLQ 1Q86R 1SKUB 1KC8C 2O01E 4MZPA 4OB1B 4NL2A 1W6XA 3SB2A 5CKDA 2DM1A 1HYOA 3KFVA 1VQ9Q 2RHXA 4DQ2A 3EGUA 3G4SQ 1AT1B 4JPBW 4CC4B 3CC7Q 1AZEA 1V76A 3OYNA 1QMCA 4E6RA 3GOXA 3EG9A 2CP7A 3CCUT 2DVJA 3DLMA 3UDCA 3A98A 1R8OB 1S72Q 4OMOA 2QAZA 3KUFA 3V8KA 5GAOq 1PG5B 1VQ5Q 3OYEA 1M3BA 1RAFB 2F5TX 4C92B 7AT1B 4M7AF 4A4GA 5LJ3e 2DBKA 1PCXA 4FSXA 4ZNXA 3G71A 1XJWB 4C0DC 1YHQQ 2VB6A 5HY6A 3OBWA 4C5HA 2L5QA 2QA4Q 2A0FB 1VQLT 4M7DE 2V26A 4HVWA 3M54A 2CZ0B 4F7UE 2O88A 2RJFA 1VQ4Q 1X2KA 2J6KA 1TSFA 1GCQA 3VUBA 1PC0A 1JJ2A 4RKUE 2F2XA 4BI8B 1YFNA 3VV0A 4M7DA 1PM3A 3GPLA 4N4GA 4ELZC 1Y96B 1X43A 4IIOA 2DYIA 1UGSB 1XQHA 2MOXA 3M55A 4KRTA 4ME7A 4GBQA 4ORZA 3ASKA 3JB9D 1JB0E 4XTZA 1EX4A 1WFWA 2QG9B 4C92G 2KR3A 1VQLA 1SSFA 3E2UA 1B34B 2K57A 3EFOB 2P84A 2DZ9A 2KNBB 2NLUA 1OX9A 3DB4A 3V7RA 4ANJA 2QGGA 5GAN2 3Q1JA 3RIRA 1YNZA 1WI7A 3JCMV 3KXTA 2EQUA 1BCOA 1O75A 3OYFA 4XU1A 3MO8A 2WSCE 2XDDA 4FYXB 1BCMA 5IXFA 1QWFA 2MPXC 2X3WD 2O2OA 1HSQA 3CC2A 3RKWA 2C0IA 1MMAA 1UE9A 2JN0A 2RNAA 4CC7A 1EFNA 1U06A 3OSSC 3GF5A 2LNHB 5KYYA 2YXYA 2OTLT 4M75B 2CP0A 3QUIA 4DOWA 2XHCA 4UC4A 1G3YA 1BI0A 1H8KA 1W2BP 5GANh 2O4XB 5KYXA 5J39A 3I56Q 1TUDA 2COWA 1YJNA 2H8HA 5KE2A 3M56A 3OBYA 5A0GA 1ZA1B 5LJ5g 2GBQA 4PLLA 2DRKA 2GQIA 1K0SA 3CPFA 2LP5A 4M77A 2NUPB 5IH2A 2KSSA 3JB9G 1O9SA 1VQ6Q 4D8DA 3JB9J 3TQ7P 2L0AA 1HK9A 2I0NA 5IHKA 1VQ8T 2DERA 1NE8A 4FU6A 1B34A 1NYGA 4FCYA 1VUBA 4F7UB 5DLQE 4PFZA 4RTXA 3E19A 1E6HA 5L23A 3S6WA 4M4ZA 4R56A 4XQ3A 3OS0A 1NZ9A 4XTUA 5CQXA 4BY6C 2X3XD 2KGTA 1OV3A 5LJ5j 2KAFA 2LJ3A 2MK5A 1RLQC 2V8KA 1NEGA 1VA7A 2KXCA 4IIMA 4A4KA 2BUDA 2DIGA 2C0OA 5IT9E 1AD5A 4M7DC 1KD1U 1IXDA 2LRQA 4DEYA 4C92E 4ZGJB 1M90R 1VQ5A 3MP1A 3PTAA 9ATCB 1N9SA 4DEXA 1C1AA 3QZ9B 1M1FA 1N8RR 3M0PA 5GANj 2QEXA 1M9SA 2V1RA 2J06A 4LDYA 5EC7A 3G6EQ 3CMAA 2A7YA 1M3AA 1BU1A 5I22A 4AFQC 2C06A 4DBFA 2FL7A 2KQWA 1VYVA 2LT1A 5CR2A 1VQOA 2J7IA 3HFNA 2QA4A 2CKKA 4RTUA 1AVZC 2QQAA 3CCUQ 2DTHA 3C94A 3FB9A 2CH4A 3LW5E 1Q95G 2CZ7B 3CEYA 1UEBA 2RHUA 4RUGA 3NTIA 2XI9A 4M7AE 2YUPA 1WHLA 4HXJA 1BYMA 4LD6A 4PJOB 2LTOA 4TVRA 2D9TA 1NJIC 2O9SA 1R77A 1QWEA 5CKBA 2DL3A 2XIDA 4RCBA 4C92D 2QA4T 4IURA 4X34A 3H0HA 1MGQA 4OMPA 2A08A 2CSQA 2Y90A 1VIEA 1PSEA 1Q82C 1D3BB 4IUUA 4NL3A 4FYYB 2E10A 2LCSA 4OMQA 2G6FX 1Y57A 1VQPQ 4O6JA 1IZ6A 2PVDB 3G1JA 2OJ2A 4BDYA 3JCMW 4J9GA 3J80E 2K2VA 2DK3A 1A0NB 2NYSA 4QQGA 3JB9H 2B8AA 1ZBJA 2EW3A 3TSZA 2K3YA 1RABB 1YJNT 1Q86U 2QDLA 2F2WA 1ZHIA 4ZGEB 2DILA 3M4YA 1K8AR 2DLPA 1VQNQ 1VYUA 3I35A 2O4XA 4CRIA 2YT6A 2DJQA 2LVMA 2L3PA 3QJ6A 3MP8A 1U1SA 1TWBA 1XNIA 5KH6A 5IHIA 1WJQA 5CIUA 3CCSA 2CP3A 2E5KA 4Z8AA 2DIQA 3VS1A 4OF1A 1GCQC 3GNFB 2YWWA 4XU2A 2RQUA 2YRVA 3OYDA 5J3BA 1IHWA 2HQHA 1MMNA 2NUTA 3JCMJ 2GTJA 2KRMA 1S1NA 1QCOA 2RH2A 2DF6A 1Q81R 3SD4A 3TU4K 4M7AG 2PZ1A 4R0KA 4KT0E 5I21A 2DTIA 3EFOA 1TU0B 1D09B 2B86A 2A28A 2EIFA 3MEVA 3PE0A 1N6AA 1AEYA 3MHXA 4PJOE 3I55Q 4OMFB 5HCKA 4JRQA 3EG2A 3GNGA 4OVAA 5AT1B 1T0HA 1M2OA 3OYBA 5GAMe 2MWOA 5LJ3f 1D3BA 3CCRQ 3ULRB 3H0FA 5DM7R 4A4HA 1ZSZA 1BB9A 3QDRB 2BE9B 1KG1A 1T3SA 5I2MA 3EH2A 3OY9A 4L6V5 4N0AC 1VQLQ 4KGXB 2ROTA 2RHZA 2A36A 2RQVA 1P92A 1KSWA 4IUPA 2JMAA 2FRWA 4Y92A 1K9MR 3LWIA 1XOVA 3REBB 2VXEA 4C8QB 1ABOA 3JCMQ 4WCIA 5CKFA 2KROA 2X4XA 4YTLA 2HAXA 2VVKA 4D8KA 1D1BA 2CREA 1B3QA 2L3RA 1K9AA 4BI4A 2COZA 1LNXA 4E7SA 3VS0A 3R6NA 2DD5A 3EFRA 2X4JA 5LJ5d 1WQWA 1RI0A 1DJ7B 1VQ9A 2JMCA 4JJCA 5IN1A 1HXDA 1G3WA 1M3CA 4JJNK 4PJOD 1NM7A 1SPKA 1G8XA 1QQJA 3SHWA 1KFZA 2ZPBB 2F5KA 5J26A 3GIBA 1M5Q1 2H3EB 4II1A 3MEWA
chains in the Genus database with same CATH topology
2QEXQ 1YHQQ 1VQNQ 2OTLQ 3CPWP 1Q86R 1VQ6Q 3I55Q 3CCEQ 1YJNQ 1YJ9Q 3CD6Q 1M90R 1S72Q 1JJ2P 1K9MR 1VQ8Q 3CCQQ 2QA4Q 2OTJQ 3CCSQ 3CCMQ 1Q81R 1QVGP 1W2BP 1VQ9Q 3CCVQ 1VQMQ 1Q82R 1KC8R 1VQ5Q 3CC4Q 3CCUQ 1YITQ 3CCLQ 3CCRQ 1VQOQ 3G4SQ 3I56Q 3OW2P 1YI2Q 1VQPQ 1K73R 1N8RR 1NJIR 3CMEQ 1KQSP 1VQ4Q 1KD1R 1QVFP 1M1KR 3CXCP 1VQ7Q 1VQKQ 1YJWQ 3G71Q 3G6EQ 3CCJQ 3CC2Q 3CC7Q 1YIJQ 1Q7YR 1K8AR 1VQLQ 3CMAQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX Q;  1YHQ Q;  1VQN Q;  2OTL Q;  3CPW P;  1Q86 R;  1VQ6 Q;  3I55 Q;  3CCE Q;  1YJN Q;  1YJ9 Q;  3CD6 Q;  1M90 R;  1S72 Q;  1JJ2 P;  1K9M R;  1VQ8 Q;  3CCQ Q;  2QA4 Q;  2OTJ Q;  3CCS Q;  3CCM Q;  1Q81 R;  1QVG P;  1W2B P;  1VQ9 Q;  3CCV Q;  1VQM Q;  1Q82 R;  1KC8 R;  1VQ5 Q;  3CC4 Q;  3CCU Q;  1YIT Q;  3CCL Q;  3CCR Q;  1VQO Q;  3G4S Q;  3I56 Q;  3OW2 P;  1YI2 Q;  1VQP Q;  1K73 R;  1N8R R;  1NJI R;  3CME Q;  1KQS P;  1VQ4 Q;  1KD1 R;  1QVF P;  1M1K R;  3CXC P;  1VQ7 Q;  1VQK Q;  1YJW Q;  3G71 Q;  3G6E Q;  3CCJ Q;  3CC2 Q;  3CC7 Q;  1YIJ Q;  1Q7Y R;  1K8A R;  1VQL Q;  3CMA Q; 
#chains in the Genus database with same CATH topology
 1X6G A;  4M78 A;  4C92 F;  2DL4 A;  2RM4 A;  4LDX A;  3FIF A;  2F69 A;  2K5F A;  4EMK C;  2X35 A;  1SEM A;  4EMK A;  3M9Q A;  1G83 A;  1OQK A;  4C5E A;  1RAE B;  1WNL A;  2E65 A;  1KK7 A;  1MV0 B;  2IIM A;  3UA6 A;  2QI2 A;  4FT2 A;  5KYW B;  2QTV A;  2E1H A;  1ZX6 A;  4Q5W A;  4XTW A;  2ZPF B;  4J6W A;  5HK0 A;  3I56 T;  2R5A A;  1VQ7 T;  3CD6 Q;  3BDL A;  1FWZ A;  1I5O B;  1YWO A;  2FVU A;  4M75 G;  5GAN 8;  2JW4 A;  3JCM g;  3R6O A;  2E70 A;  2MWP A;  5CVI A;  2E12 A;  3EG9 B;  2FPF A;  2HL3 A;  3MEU A;  1YIJ T;  4XU0 A;  3CXC P;  2YRC A;  3QYH B;  1I0C A;  1IGQ A;  1BI1 A;  1JXO A;  2HQE A;  1OI1 A;  3URG A;  3UT1 A;  4FYV B;  4GLM A;  4E7L A;  2QQB A;  2JS0 A;  4DBR A;  1I4K 1;  3CCL A;  2ZPI B;  1YCS B;  1NLO C;  2K3X A;  2HQX A;  3D7S B;  2FRY A;  4JS5 A;  3BW1 A;  2BKD N;  1D1A A;  3QSU A;  5I2S A;  3EGX A;  2AK5 A;  1YP5 A;  1X27 A;  4PJJ A;  3EFS A;  5A0D A;  1UHF A;  4J9B A;  3PMT A;  2F2V A;  5GMK m;  3CCE Q;  1YJ9 Q;  3LWH A;  3VS6 A;  4AG2 C;  1VQ8 Q;  2DA9 A;  3QJY A;  5FRM A;  5DY9 A;  2GFA A;  4KH0 B;  4JLG A;  3VRY A;  4QQ6 A;  3OW2 P;  4JDS A;  2K2M A;  3H0I A;  1W4S A;  3E9F A;  3CCS T;  3OMC A;  3IQL A;  2J6F A;  3G4S A;  6AT1 B;  3RUX A;  2FZG B;  2KK4 A;  1D1C A;  3FLG A;  3INZ A;  2GCX A;  2K5I A;  2AT1 B;  5GAO r;  2OTJ T;  4C8Q F;  3JCM d;  2OTL A;  5FRN A;  1PKS A;  1UTI A;  1WHG A;  3CCM T;  4AG1 C;  2X4W A;  1C6V X;  2R5M A;  2RD1 A;  3JCM X;  5CK9 A;  1WPY A;  2AHJ B;  1N9R A;  1MUZ A;  2SEM A;  2CZ6 B;  1QVG A;  1YN8 A;  4J8O A;  1F1B B;  3M0R A;  3MKD A;  1ACM B;  4E7Z A;  3SWN C;  5HK3 A;  2KBT A;  2RPN A;  5FU7 C;  2EVR A;  4C8Q D;  5AYF A;  2CP2 A;  5KYW A;  1ABQ A;  2KYB A;  2V8I A;  2I2L A;  3QG1 A;  1K8A C;  3X28 B;  1W1F A;  2DL5 A;  4JS4 A;  2K7A A;  1MV3 A;  2RA2 A;  4Z89 A;  1JBM A;  3QWX X;  2RQR A;  3L2R A;  4C8Q A;  3DKM A;  4BI3 A;  1SHG A;  1G3T A;  3CMA T;  3QWY A;  1X69 A;  2DE0 X;  3EG3 A;  2ESW A;  1AWX A;  4JZ4 A;  1NPP A;  1AWO A;  2QDY B;  3CCJ A;  3L42 A;  1UEC A;  1B7T A;  5GAO m;  1ZBX A;  4LD9 K;  1OYX A;  2ABL A;  1OU9 A;  3VRZ A;  2ZGW A;  2M0O A;  4V2S A;  2PQW A;  4X1V A;  1I8F A;  2GGR A;  3PVQ A;  3REA B;  1QVP A;  4FIB A;  5GAN 4;  3L1A A;  1RUW A;  3CPW S;  5LJ3 g;  5CKE A;  2HD0 A;  1Y07 A;  2JTE A;  5C6S A;  2NUZ A;  2RO0 A;  1WYX A;  1M1G A;  4JJD A;  2D8J A;  3CPW P;  2EJF A;  2JT4 A;  3M58 A;  2KMT A;  5CCA A;  3CCR A;  4C0Z A;  2LCL A;  2HNI A;  3PT9 A;  2KY9 A;  4XK8 E;  3CCQ A;  2NWM A;  3TVT A;  4M78 G;  1QVF A;  1WJS A;  3RKX A;  2CS7 A;  3E1S A;  5D6W A;  1M90 C;  2MMP A;  5GMK e;  1TS9 A;  3HTR A;  4BY6 B;  3TCJ A;  1G5V A;  5CAI A;  1GRI A;  2QYZ A;  4CC3 A;  2RF0 A;  5LJ5 h;  3CC7 T;  3M0S A;  3OYM A;  1U8R A;  3G71 T;  3UA7 A;  3CCQ T;  2DO3 A;  2M16 A;  3CC4 Q;  2EGA A;  2X9H A;  4QKU A;  1YHQ T;  4QVZ A;  5IAY A;  2ECZ A;  2V1Q A;  1NEB A;  1UUE A;  1QKX A;  4J9C A;  3QDF A;  4QVD A;  1WXU A;  1Q7Y R;  4EMG A;  4F17 A;  2SRC A;  3E9G A;  3FC3 A;  1XTD A;  1KQ2 A;  1X2Q A;  3CCQ Q;  1HJD A;  4AFU C;  2IVW A;  2NUP A;  2KXD A;  2Z0W A;  3LGL A;  2ED1 A;  2NUT B;  2ROL A;  4MZT A;  1R0C B;  1IB8 A;  3LH5 A;  1EIF A;  1Y0M A;  4GLK A;  3NPF A;  3MP6 A;  3OW2 A;  1TOV A;  4XU3 A;  3C4S A;  1YJW A;  3SWN B;  3CCR T;  4E2F B;  3EG1 A;  3L2Z A;  2DXU A;  2M51 A;  4E7I A;  3A8L B;  2OTJ A;  4EDU A;  4LDU A;  1NJI U;  1QW1 A;  3HHT B;  4OML A;  4EIK A;  3VKI A;  1JEG A;  4DBH A;  3ZBD A;  4WF2 A;  5GJW B;  1TUG B;  3OB9 A;  3OS5 A;  2LZ6 B;  2DL7 A;  5FW9 A;  3X25 B;  3OW2 S;  4QT7 A;  2PUK B;  1K4U S;  2KI7 A;  2ZPG B;  5GAN 7;  1OU8 A;  1VYT A;  4RTW A;  1BIA A;  2EBP A;  4EMK B;  2XG8 D;  1GXI E;  2IPO B;  2EJ9 A;  4X9C A;  5CKH A;  2DXC A;  1H64 1;  2PNI A;  4KUI A;  3FRN A;  2WSE E;  2YRD A;  5GAN 6;  1K73 C;  1Z9Q A;  4M78 E;  3EHR A;  1OUL A;  4RTT A;  1T0J A;  8ATC B;  4HCC A;  2J6O A;  1AHJ B;  3HL8 A;  4HCZ A;  3CCM Q;  2XKO C;  2DEU A;  1Q81 U;  3FEO A;  2QEX T;  3MPU B;  2ENM A;  2EQJ A;  3P8B B;  1VQK Q;  5KCH A;  3LGF A;  2ED0 A;  2DET A;  1UB4 A;  1RAI B;  2LJ0 A;  2WSF E;  2O31 A;  4BE0 A;  4M7D D;  3AHU A;  4B9X A;  3VYH B;  2P0Q A;  4C8Q C;  1OPK A;  3VS2 A;  3JCM P;  1X6O A;  4RG8 A;  1CSK A;  2EJG A;  4JUV A;  1D0Z A;  3CCV Q;  1BBZ A;  2YUO A;  2KRS A;  5GMK i;  2LNV A;  2JS2 A;  4PKC C;  3OYJ A;  4ZGD B;  1VQ9 T;  3EH1 A;  3G4S T;  1ZSG A;  2HKN A;  2YSQ A;  1GL5 A;  1QVG S;  1OZ2 A;  3CCJ T;  1WZO A;  4Z02 A;  5LL6 S;  3RMS A;  4F7U A;  4M7D F;  1EZZ B;  2VYT A;  3BDU A;  3PFS A;  1UGV A;  3CBM A;  4FW2 A;  2DRM A;  2DZC A;  3C95 A;  2JTM A;  4N4I A;  3M0T A;  3BFM A;  2AKL A;  2MIO A;  3RDV A;  2E3I A;  1Q82 R;  2E6N A;  3T9N A;  3JV3 A;  4LN2 A;  3GBQ A;  4VUB A;  1KHC A;  3HPW A;  4LNP A;  2FEI A;  4BE2 A;  1KHI A;  2FG0 A;  4R55 A;  1FMK A;  5GMK j;  3VU3 C;  4M77 D;  1UFF A;  5GAN g;  3C0C A;  1MND A;  3QPH A;  4PLI A;  4Y91 A;  2HDA A;  1WHM A;  2LJ1 A;  8AT1 B;  2E64 A;  5GAN 5;  1M2V A;  2IG0 A;  4OB2 B;  2DXT A;  2PVO B;  3TEE A;  1LPL A;  1BI3 A;  1V29 B;  4OB0 B;  2DMO A;  3EGD B;  4LDV A;  3RR6 A;  1FMW A;  4M78 F;  1Z9Z A;  2HBP A;  3MJX A;  3I56 A;  3AT1 B;  3L2U A;  1QVF S;  4F04 B;  3H9N A;  3OYK A;  2CZ1 B;  2M02 A;  1YJW T;  3I55 A;  4OB3 B;  1WX6 A;  4FSS A;  2OAW A;  5LJ3 d;  2XDB A;  4K11 A;  1UG1 A;  1PNJ A;  4FYW B;  5D6Y A;  2EGE A;  2P4R A;  1D0X A;  2KRN A;  1K0X A;  1SSH A;  2EKO A;  3JB9 F;  3OYL A;  1I5L A;  4M7A B;  1ZUK A;  1NLP C;  2P0K A;  4M7A A;  1WLP B;  4GY5 A;  3S3N A;  1S72 A;  2OI3 A;  1KD1 R;  2KYM A;  1HD3 A;  1Q81 C;  1JU5 C;  3H41 A;  4M77 E;  5FRO A;  3ER0 A;  3GP8 A;  4OMN A;  3G6E A;  3CMA Q;  3QBY A;  2YLB A;  1NBE B;  2E6Z A;  3VS7 A;  3QKJ A;  2FPD A;  2WAC A;  4HA8 A;  2QQ9 A;  2X51 A;  4J9D A;  3NMZ C;  4PJO C;  4CC2 A;  2FZC B;  2JXB A;  3OYA A;  2R58 A;  4LXC A;  5GAN d;  2K5L A;  4PJM A;  2P4T A;  4PNO A;  2RI3 A;  2ZPH B;  1MMG A;  2XDP A;  3CC2 Q;  2JTF A;  4MDW A;  4M7D G;  4Y28 E;  4D6W A;  3HKS A;  1N8R U;  4C92 C;  3VS3 A;  2YUQ A;  4JRK A;  5KYX B;  1KQS S;  2BZX A;  2JOY A;  3CCV T;  2ZAE A;  2QQS A;  2MAM A;  3PMI A;  3RNJ A;  2E5Q A;  1QCF A;  4PJO G;  1K73 R;  1LVK A;  2VKN A;  3OS1 A;  1H3H A;  4HVV A;  1AWW A;  2KVQ G;  5GAM f;  3JCM b;  2VUB A;  4C5I A;  4FW1 A;  1RI9 A;  2H3J A;  2VV5 A;  1RAH B;  2DD4 A;  1IHV A;  2ZCF B;  4E7K A;  3NGP A;  3PVL A;  4N4H A;  1S72 T;  4M78 B;  4J9H A;  2CYZ B;  2GFU A;  2VGN A;  1VQ5 T;  2C0T A;  1ZSZ C;  4JRP A;  2QQR A;  2MCN A;  1WIE A;  2HSP A;  3EAE A;  5A2Q E;  1KQ1 A;  1M2V B;  2GTO A;  4J7F A;  4HT9 A;  2JM8 A;  4A53 A;  1LJO A;  3HRS A;  4C92 A;  2CUB A;  2RI2 A;  1E7O A;  3QXE B;  1D0Y A;  2K3B A;  2OTJ Q;  3CCS Q;  1OEB A;  3WVE B;  2X4Y A;  1WJR A;  1JJ2 S;  2DNU A;  2RB6 A;  2EPD A;  3VS5 A;  2GF7 A;  3RER A;  4WTO B;  2JVV A;  1YJW Q;  4KH1 B;  1ZQ1 A;  2K4Y A;  1GBR A;  2VC8 A;  4C5G A;  1K9M U;  5KCO A;  1OX8 A;  3M53 A;  4F7U G;  1KQS A;  3CBP A;  3CCU A;  1IRE B;  4EMH A;  1Q82 U;  2QAS A;  4M77 G;  1OZ3 A;  1RAG B;  5KYU A;  2DAQ A;  1CKA A;  1IO6 A;  1CKB A;  2QGF B;  4J6X A;  2XK0 A;  3HSB A;  2LX7 A;  3CC7 A;  5GMK h;  1ZSZ B;  2EFI A;  3M57 A;  3JCM e;  2KEA A;  2QXF A;  1MNE A;  4BUG A;  3SFM A;  1W70 A;  3V7S A;  5GMK l;  1WHJ A;  1B07 A;  2AKK A;  2DTO A;  2W0Z A;  1GFD A;  2RQW A;  3HRT A;  3U23 A;  2MI6 A;  3VS4 A;  3ZL7 C;  3OS2 A;  3A1P A;  4BD3 A;  3OYY A;  3UPU A;  4J9F A;  4PL6 A;  2PU9 B;  2M1H A;  3FJP A;  3QHS A;  1GBQ A;  4M77 F;  5EG2 A;  1MHN A;  1VQK A;  1UGP B;  4JJB A;  2L8D A;  2AZS A;  4FT4 A;  3RBB B;  1YJN Q;  1VQ4 A;  1AWJ A;  1PRM C;  1ZLM A;  1VQM A;  4M77 B;  4MML A;  1C0M A;  4HVU A;  4ZN3 A;  1YIT Q;  1M1K U;  2LQW A;  1TXQ A;  5FWB A;  4RCC A;  1VQN T;  1YHQ A;  2DL8 A;  3I5S A;  4ZN1 A;  4J83 A;  3EGD A;  2FYK A;  1TUC A;  3PNW C;  4C0G A;  5CQY A;  2BZY A;  3WVD B;  2L89 A;  1VQ6 A;  3HFO A;  3H6Z A;  1K8A U;  1VQK T;  4F14 A;  5KYY B;  1KC8 R;  4KUD K;  1W2B A;  2AIR B;  4QW2 A;  2BTT A;  4NOY A;  4P5N A;  3BY7 A;  1VQM T;  1PKT A;  2HBW A;  4C8Q G;  4BB7 A;  2XIC A;  1PD0 A;  4J5Y A;  4N0A A;  3CQT A;  1M8V A;  2QEX Q;  2QTX A;  1VQ7 A;  1KIK A;  2JUF A;  3CCV A;  5LJ5 e;  2BE7 D;  5FLX E;  1H92 A;  4X9D A;  3G6E T;  1U5S A;  4BDZ A;  4KGZ B;  1WA7 A;  2CP6 A;  1Y7X A;  2COY A;  2BIV A;  3CCE T;  2EWN A;  4C0D B;  3CBO A;  2HCK A;  3A8M B;  4M75 E;  5LJ3 h;  3S3O A;  2HMA A;  2L2P A;  5KE3 A;  3N5B B;  5GAM g;  1AZG B;  2L3Q A;  2XMF A;  2Y4Y A;  3ME9 A;  4M75 A;  2FHD A;  4QVC A;  2EQM A;  2P0P A;  1Y96 A;  4RTV A;  4HCB A;  2DBM A;  1YJ9 T;  1JO8 A;  3LX7 A;  3L2W A;  5GAM j;  4C0F A;  4PK4 A;  3G71 Q;  4KUL A;  4OGE A;  1ZA2 B;  5L8R E;  4ESR A;  4HKE A;  3LYI A;  2RJD A;  2AZV A;  2M0Y A;  1LCK A;  2DYB A;  4IUT A;  4FM4 B;  1I81 A;  2LQK A;  1YCY A;  3JAM E;  4M78 D;  2DEQ A;  1M1K R;  2DJZ A;  1UGQ B;  3M59 A;  1M27 C;  2K79 A;  3SDZ A;  4BAC A;  4Z88 A;  2CT4 A;  1M4Z A;  5GAO n;  3J81 E;  4L5G A;  2M9U A;  2CDT A;  5FU6 B;  4ZTF A;  2QK0 A;  2VWF A;  1YWP A;  4MDX A;  1JJ2 P;  1PD1 A;  2XD0 A;  2BZ8 A;  2E3H A;  4ATO A;  3X26 B;  4KGV B;  3ZEH A;  4ELY C;  4RTY A;  4M7D B;  3RKY A;  1K1Z A;  1LOJ A;  3ZFJ A;  2RJE A;  1UJY A;  4DOV A;  1WHH A;  3QZ5 B;  2RK1 A;  4PJL A;  5GAM d;  2L3S A;  5GAO l;  3L2Q A;  1VQO T;  4PFP A;  2K6D A;  3HRU A;  2JJ9 A;  3QO3 A;  1JQQ A;  1UJ0 A;  3CCL Q;  3A8H B;  5FU6 C;  4AMC A;  4AFS C;  5DLO A;  2CGH A;  3JSC A;  1VOM A;  1RAA B;  3CPW A;  1OOT A;  1WXB A;  4JLI A;  1VQP T;  2OX7 A;  4IUQ A;  2DX1 A;  2LX9 A;  5GAN 3;  4O5V A;  2EQI A;  4LUD A;  3RMQ A;  1K9M C;  4A54 A;  2KT1 A;  2YHT A;  4E7H A;  1M1K C;  1KD1 C;  3NTH A;  1U3O A;  3CC4 A;  3V7C A;  1YIT T;  5GAM h;  4LE9 A;  4XTY A;  1I1J A;  4M75 D;  3VYG A;  4DBQ A;  2FPE A;  4HCK A;  3PIP A;  1SF9 A;  1PWT A;  4E7J A;  3THK A;  3OSV A;  5M9O A;  3SEM A;  3CME A;  5FU7 B;  1FMV A;  5LJ3 j;  2PUO B;  2CUD A;  1WGS A;  4IKF A;  3CC4 T;  2FB7 A;  2EYZ A;  4QQD A;  1G3S A;  2MF2 A;  4PJN A;  2DFU A;  4M75 C;  4JRI A;  1V1C A;  1YI2 Q;  1M8M A;  1NPR A;  1SRL A;  2D0Q B;  3NHN A;  2CT3 A;  4PFO A;  4OGC A;  1TTH B;  2RHI A;  1WQ7 A;  5D7U A;  4E47 A;  1M90 U;  1UHC A;  3O8V A;  2D6F A;  1ZUY A;  2DKG A;  4C8Q E;  1PHT A;  2ZZD A;  3CC2 T;  1TH7 A;  4M75 F;  1QVG P;  1RLP C;  3CME T;  2DVE A;  5IXB A;  3I5R A;  3SWN A;  4XAX B;  4OP0 A;  1IRX A;  4LUE A;  5IHN A;  2F1L A;  2RMO A;  3UF4 A;  4J7I A;  1AOJ A;  3M5A A;  1NG2 A;  3BE3 A;  1ZUU A;  2FO0 A;  4JZ3 A;  1QKW A;  3PGG A;  1FYN A;  1T3L A;  3EGX B;  4J9I A;  5C0M A;  2PVG B;  1UGR B;  1YJ9 A;  3S3M A;  2Y4X A;  5GAN f;  1GFC A;  2LT4 A;  5A0L A;  4F7U F;  5ECA A;  3OYC A;  1G2B A;  1N5Z A;  3DB3 A;  1BI2 A;  3CXC S;  3LLR A;  1Q86 C;  2HL5 C;  3PIO A;  4AFZ C;  3CCM A;  1W2B S;  3WXM B;  3DLL A;  4ZTJ A;  1BKB A;  2RHY A;  1SRM A;  2R57 A;  4RMO A;  1YBY A;  2EKH A;  2LCC A;  3A8O B;  1BIB A;  4NS5 A;  4MZM A;  4EPC A;  2D8H A;  1VQ6 T;  2LQ8 A;  1VIF A;  1J3T A;  3MET A;  3JCM c;  1BK2 A;  2E41 A;  3JRZ A;  4M77 C;  5KYU B;  2VXF A;  2FZK B;  3I9Q A;  4M7A D;  1PRL C;  5HKC A;  1N27 A;  3X20 B;  2KDS A;  3VJP A;  3TSW A;  1IGU A;  3QYG B;  3TRE A;  1K73 U;  1VQ7 Q;  3CD6 T;  1JRI A;  4B9W A;  1M30 A;  3OYH A;  4J6Y A;  1YIJ A;  4AT1 B;  3P8H A;  3C12 A;  5D6X A;  3M4G A;  2CH4 W;  3OYG A;  2EQK A;  4M7A C;  3CCL T;  3M0U A;  3UAT A;  3UWN A;  4F16 A;  4A4E A;  4HT8 A;  4RG2 A;  3CCE A;  2O9V A;  1TG0 A;  1N8R C;  1VQN A;  1MMD A;  1WHK A;  3JCM f;  3V8J A;  2E4H A;  1FX7 A;  2HEQ A;  1I07 A;  3H8Z A;  1QP3 A;  1YI2 A;  2ZPE B;  1ARK A;  1YIT A;  2RN8 A;  2YLC A;  3NTK A;  3G7Z A;  5KYN A;  1R0B G;  1VQM Q;  3MEA A;  5CO7 A;  3CME Q;  2J05 A;  4XTX A;  4FL6 A;  1X6B A;  4XTV A;  2JNG A;  3CCJ Q;  1YIJ Q;  2LC4 A;  3OA6 A;  5GAN e;  3P8D A;  2YUN A;  2DXB A;  3F70 A;  4M78 C;  1VQP A;  1RAC B;  3EHQ A;  1H3Z A;  4A4F A;  2EYW A;  4CI0 C;  2LMJ A;  4DA4 A;  3I55 T;  5GAO p;  2DPP B;  1KJW A;  2EYQ A;  3CD6 A;  2GQV A;  3J7A F;  1VQ4 T;  3L2V A;  3MCA B;  5LJ5 f;  2JZ2 A;  2LQN A;  2VAS A;  1NYF A;  3FJ5 A;  1SG5 A;  1GCP A;  2EGC A;  2KT8 A;  2RJC A;  2EYX A;  2EYY A;  1QCN A;  1U1T A;  4LDW A;  3JCM h;  1Y71 A;  1PSF A;  1E6G A;  3VUZ A;  4PJO F;  1FXX A;  5GJV B;  1Q7Y C;  1WXT A;  4B6M A;  1YI2 T;  1WDX A;  3OYI A;  3A8G B;  3A5Z B;  4OMM A;  5FWC A;  2PTK A;  3OQ5 A;  4L59 A;  3RES A;  1VQO Q;  2D1X A;  3OMG A;  2HZY A;  3X24 B;  2GNC A;  3CXC A;  4A63 B;  3GLX A;  2OAU A;  1UDL A;  3M0Q A;  5I11 A;  2A3L A;  2K9G A;  1RAD B;  2HKQ B;  2JM9 A;  2KE9 A;  3JB9 I;  1Q7Y U;  3EG0 A;  2CSI A;  2MYS A;  1K76 A;  1VQ8 A;  2YDL A;  3FDR A;  4PJO A;  1OPL A;  3QII A;  3V8L A;  2A37 A;  2RK2 A;  1KQS P;  2LDM A;  2XU8 A;  2V8J A;  2RI5 A;  2W10 A;  3LH0 A;  4MMK A;  2EAY A;  3HP9 A;  2ATC B;  1KC8 U;  2HSE B;  2VGM A;  1X01 A;  3O5Z A;  1JXM A;  1X75 C;  1QLY A;  1QP2 A;  4RTZ A;  2G3R A;  3KBG A;  4BE1 A;  2D0N A;  1RL2 A;  4KBM B;  3NFC A;  1NJI R;  2CP5 A;  1QVF P;  4IUV A;  2RQT A;  4J9E A;  1SHF A;  2OTL Q;  1Q86 R;  1SKU B;  1KC8 C;  2O01 E;  4MZP A;  4OB1 B;  4NL2 A;  1W6X A;  3SB2 A;  5CKD A;  2DM1 A;  1HYO A;  3KFV A;  1VQ9 Q;  2RHX A;  4DQ2 A;  3EGU A;  3G4S Q;  1AT1 B;  4JPB W;  4CC4 B;  3CC7 Q;  1AZE A;  1V76 A;  3OYN A;  1QMC A;  4E6R A;  3GOX A;  3EG9 A;  2CP7 A;  3CCU T;  2DVJ A;  3DLM A;  3UDC A;  3A98 A;  1R8O B;  1S72 Q;  4OMO A;  2QAZ A;  3KUF A;  3V8K A;  5GAO q;  1PG5 B;  1VQ5 Q;  3OYE A;  1M3B A;  1RAF B;  2F5T X;  4C92 B;  7AT1 B;  4M7A F;  4A4G A;  5LJ3 e;  2DBK A;  1PCX A;  4FSX A;  4ZNX A;  3G71 A;  1XJW B;  4C0D C;  1YHQ Q;  2VB6 A;  5HY6 A;  3OBW A;  4C5H A;  2L5Q A;  2QA4 Q;  2A0F B;  1VQL T;  4M7D E;  2V26 A;  4HVW A;  3M54 A;  2CZ0 B;  4F7U E;  2O88 A;  2RJF A;  1VQ4 Q;  1X2K A;  2J6K A;  1TSF A;  1GCQ A;  3VUB A;  1PC0 A;  1JJ2 A;  4RKU E;  2F2X A;  4BI8 B;  1YFN A;  3VV0 A;  4M7D A;  1PM3 A;  3GPL A;  4N4G A;  4ELZ C;  1Y96 B;  1X43 A;  4IIO A;  2DYI A;  1UGS B;  1XQH A;  2MOX A;  3M55 A;  4KRT A;  4ME7 A;  4GBQ A;  4ORZ A;  3ASK A;  3JB9 D;  1JB0 E;  4XTZ A;  1EX4 A;  1WFW A;  2QG9 B;  4C92 G;  2KR3 A;  1VQL A;  1SSF A;  3E2U A;  1B34 B;  2K57 A;  3EFO B;  2P84 A;  2DZ9 A;  2KNB B;  2NLU A;  1OX9 A;  3DB4 A;  3V7R A;  4ANJ A;  2QGG A;  5GAN 2;  3Q1J A;  3RIR A;  1YNZ A;  1WI7 A;  3JCM V;  3KXT A;  2EQU A;  1BCO A;  1O75 A;  3OYF A;  4XU1 A;  3MO8 A;  2WSC E;  2XDD A;  4FYX B;  1BCM A;  5IXF A;  1QWF A;  2MPX C;  2X3W D;  2O2O A;  1HSQ A;  3CC2 A;  3RKW A;  2C0I A;  1MMA A;  1UE9 A;  2JN0 A;  2RNA A;  4CC7 A;  1EFN A;  1U06 A;  3OSS C;  3GF5 A;  2LNH B;  5KYY A;  2YXY A;  2OTL T;  4M75 B;  2CP0 A;  3QUI A;  4DOW A;  2XHC A;  4UC4 A;  1G3Y A;  1BI0 A;  1H8K A;  1W2B P;  5GAN h;  2O4X B;  5KYX A;  5J39 A;  3I56 Q;  1TUD A;  2COW A;  1YJN A;  2H8H A;  5KE2 A;  3M56 A;  3OBY A;  5A0G A;  1ZA1 B;  5LJ5 g;  2GBQ A;  4PLL A;  2DRK A;  2GQI A;  1K0S A;  3CPF A;  2LP5 A;  4M77 A;  2NUP B;  5IH2 A;  2KSS A;  3JB9 G;  1O9S A;  1VQ6 Q;  4D8D A;  3JB9 J;  3TQ7 P;  2L0A A;  1HK9 A;  2I0N A;  5IHK A;  1VQ8 T;  2DER A;  1NE8 A;  4FU6 A;  1B34 A;  1NYG A;  4FCY A;  1VUB A;  4F7U B;  5DLQ E;  4PFZ A;  4RTX A;  3E19 A;  1E6H A;  5L23 A;  3S6W A;  4M4Z A;  4R56 A;  4XQ3 A;  3OS0 A;  1NZ9 A;  4XTU A;  5CQX A;  4BY6 C;  2X3X D;  2KGT A;  1OV3 A;  5LJ5 j;  2KAF A;  2LJ3 A;  2MK5 A;  1RLQ C;  2V8K A;  1NEG A;  1VA7 A;  2KXC A;  4IIM A;  4A4K A;  2BUD A;  2DIG A;  2C0O A;  5IT9 E;  1AD5 A;  4M7D C;  1KD1 U;  1IXD A;  2LRQ A;  4DEY A;  4C92 E;  4ZGJ B;  1M90 R;  1VQ5 A;  3MP1 A;  3PTA A;  9ATC B;  1N9S A;  4DEX A;  1C1A A;  3QZ9 B;  1M1F A;  1N8R R;  3M0P A;  5GAN j;  2QEX A;  1M9S A;  2V1R A;  2J06 A;  4LDY A;  5EC7 A;  3G6E Q;  3CMA A;  2A7Y A;  1M3A A;  1BU1 A;  5I22 A;  4AFQ C;  2C06 A;  4DBF A;  2FL7 A;  2KQW A;  1VYV A;  2LT1 A;  5CR2 A;  1VQO A;  2J7I A;  3HFN A;  2QA4 A;  2CKK A;  4RTU A;  1AVZ C;  2QQA A;  3CCU Q;  2DTH A;  3C94 A;  3FB9 A;  2CH4 A;  3LW5 E;  1Q95 G;  2CZ7 B;  3CEY A;  1UEB A;  2RHU A;  4RUG A;  3NTI A;  2XI9 A;  4M7A E;  2YUP A;  1WHL A;  4HXJ A;  1BYM A;  4LD6 A;  4PJO B;  2LTO A;  4TVR A;  2D9T A;  1NJI C;  2O9S A;  1R77 A;  1QWE A;  5CKB A;  2DL3 A;  2XID A;  4RCB A;  4C92 D;  2QA4 T;  4IUR A;  4X34 A;  3H0H A;  1MGQ A;  4OMP A;  2A08 A;  2CSQ A;  2Y90 A;  1VIE A;  1PSE A;  1Q82 C;  1D3B B;  4IUU A;  4NL3 A;  4FYY B;  2E10 A;  2LCS A;  4OMQ A;  2G6F X;  1Y57 A;  1VQP Q;  4O6J A;  1IZ6 A;  2PVD B;  3G1J A;  2OJ2 A;  4BDY A;  3JCM W;  4J9G A;  3J80 E;  2K2V A;  2DK3 A;  1A0N B;  2NYS A;  4QQG A;  3JB9 H;  2B8A A;  1ZBJ A;  2EW3 A;  3TSZ A;  2K3Y A;  1RAB B;  1YJN T;  1Q86 U;  2QDL A;  2F2W A;  1ZHI A;  4ZGE B;  2DIL A;  3M4Y A;  1K8A R;  2DLP A;  1VQN Q;  1VYU A;  3I35 A;  2O4X A;  4CRI A;  2YT6 A;  2DJQ A;  2LVM A;  2L3P A;  3QJ6 A;  3MP8 A;  1U1S A;  1TWB A;  1XNI A;  5KH6 A;  5IHI A;  1WJQ A;  5CIU A;  3CCS A;  2CP3 A;  2E5K A;  4Z8A A;  2DIQ A;  3VS1 A;  4OF1 A;  1GCQ C;  3GNF B;  2YWW A;  4XU2 A;  2RQU A;  2YRV A;  3OYD A;  5J3B A;  1IHW A;  2HQH A;  1MMN A;  2NUT A;  3JCM J;  2GTJ A;  2KRM A;  1S1N A;  1QCO A;  2RH2 A;  2DF6 A;  1Q81 R;  3SD4 A;  3TU4 K;  4M7A G;  2PZ1 A;  4R0K A;  4KT0 E;  5I21 A;  2DTI A;  3EFO A;  1TU0 B;  1D09 B;  2B86 A;  2A28 A;  2EIF A;  3MEV A;  3PE0 A;  1N6A A;  1AEY A;  3MHX A;  4PJO E;  3I55 Q;  4OMF B;  5HCK A;  4JRQ A;  3EG2 A;  3GNG A;  4OVA A;  5AT1 B;  1T0H A;  1M2O A;  3OYB A;  5GAM e;  2MWO A;  5LJ3 f;  1D3B A;  3CCR Q;  3ULR B;  3H0F A;  5DM7 R;  4A4H A;  1ZSZ A;  1BB9 A;  3QDR B;  2BE9 B;  1KG1 A;  1T3S A;  5I2M A;  3EH2 A;  3OY9 A;  4L6V 5;  4N0A C;  1VQL Q;  4KGX B;  2ROT A;  2RHZ A;  2A36 A;  2RQV A;  1P92 A;  1KSW A;  4IUP A;  2JMA A;  2FRW A;  4Y92 A;  1K9M R;  3LWI A;  1XOV A;  3REB B;  2VXE A;  4C8Q B;  1ABO A;  3JCM Q;  4WCI A;  5CKF A;  2KRO A;  2X4X A;  4YTL A;  2HAX A;  2VVK A;  4D8K A;  1D1B A;  2CRE A;  1B3Q A;  2L3R A;  1K9A A;  4BI4 A;  2COZ A;  1LNX A;  4E7S A;  3VS0 A;  3R6N A;  2DD5 A;  3EFR A;  2X4J A;  5LJ5 d;  1WQW A;  1RI0 A;  1DJ7 B;  1VQ9 A;  2JMC A;  4JJC A;  5IN1 A;  1HXD A;  1G3W A;  1M3C A;  4JJN K;  4PJO D;  1NM7 A;  1SPK A;  1G8X A;  1QQJ A;  3SHW A;  1KFZ A;  2ZPB B;  2F5K A;  5J26 A;  3GIB A;  1M5Q 1;  2H3E B;  4II1 A;  3MEW A; 
#chains in the Genus database with same CATH homology
 2QEX Q;  1YHQ Q;  1VQN Q;  2OTL Q;  3CPW P;  1Q86 R;  1VQ6 Q;  3I55 Q;  3CCE Q;  1YJN Q;  1YJ9 Q;  3CD6 Q;  1M90 R;  1S72 Q;  1JJ2 P;  1K9M R;  1VQ8 Q;  3CCQ Q;  2QA4 Q;  2OTJ Q;  3CCS Q;  3CCM Q;  1Q81 R;  1QVG P;  1W2B P;  1VQ9 Q;  3CCV Q;  1VQM Q;  1Q82 R;  1KC8 R;  1VQ5 Q;  3CC4 Q;  3CCU Q;  1YIT Q;  3CCL Q;  3CCR Q;  1VQO Q;  3G4S Q;  3I56 Q;  3OW2 P;  1YI2 Q;  1VQP Q;  1K73 R;  1N8R R;  1NJI R;  3CME Q;  1KQS P;  1VQ4 Q;  1KD1 R;  1QVF P;  1M1K R;  3CXC P;  1VQ7 Q;  1VQK Q;  1YJW Q;  3G71 Q;  3G6E Q;  3CCJ Q;  3CC2 Q;  3CC7 Q;  1YIJ Q;  1Q7Y R;  1K8A R;  1VQL Q;  3CMA Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...