1VQ8Q

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq8Q00
2QA4Q 1S72Q 3CCQQ 1QVGP 1VQ8Q 1VQLQ 1VQ6Q 1Q7YR 1JJ2P 1YIJQ 1VQ5Q 3I56Q 3CC2Q 1VQ4Q 1YITQ 3CMEQ 3CCEQ 2QEXQ 3CCMQ 3CPWP 3CC4Q 3OW2P 3CCSQ 3CCUQ 1YJNQ 1K73R 3CCJQ 1KD1R 1VQKQ 1YJWQ 1Q82R 1N8RR 1YI2Q 1YJ9Q 1W2BP 3CCLQ 3CXCP 1M90R 3CCRQ 1K8AR 1VQ9Q 2OTJQ 3CD6Q 2OTLQ 3G71Q 3CCVQ 1VQOQ 1K9MR 1VQNQ 1KQSP 3CC7Q 1Q81R 1VQPQ 1VQ7Q 1Q86R 1NJIR 3I55Q 3G4SQ 3CMAQ 1QVFP 1KC8R 3G6EQ 1M1KR 1YHQQ 1VQMQ
chains in the Genus database with same CATH superfamily
3M9QA 4HVWA 5LJ5d 2DEQA 2K3BA 1WFWA 3QYGB 3CXCS 1VQ4T 3LH5A 4IUQA 1G8XA 4C5GA 5KYUB 2RHXA 1QP3A 2COYA 3CQTA 1OV3A 2JW4A 3JB9H 4Y92A 2PTKA 2KT1A 1VQOT 2VC8A 3URGA 4M7AB 1H92A 1AD5A 4E7ZA 1KJWA 1NPRA 1AZEA 2DBKA 3OYNA 2I0NA 4X34A 4OMOA 4DEYA 3UA7A 2V8IA 2EPDA 3M0TA 2R5AA 3E2UA 1U1TA 1VQ5Q 1JO8A 5GAMd 5A0DA 1K73R 1MMAA 1PC0A 3CCVA 2ZPEB 1Z9ZA 1K8AR 2A7YA 2BZYA 3A5ZB 2KAFA 1WHKA 4PJOF 5CQYA 5LJ3h 5I2MA 3L2ZA 3SB2A 1O75A 5GMKj 2SRCA 2QASA 1ZX6A 3CCSQ 2F1LA 2PUKB 3H9NA 4M4ZA 3AT1B 2G6FX 1WZOA 4UC4A 1K9MC 3EG0A 1E7OA 2YUQA 1U06A 5IN1A 1KQ2A 3I56A 1M3BA 3RKWA 2DO3A 3EFOB 4KH1B 1KC8R 2RQWA 4C92F 3CCLA 3OY9A 4LD6A 4M7AD 2QTXA 1N8RR 2H3EB 4ZN3A 1NLOC 4D8DA 1Y0MA 3E1SA 3LYIA 3M5AA 3QJYA 5DLOA 2HQXA 1N6AA 1U1SA 2Y4XA 5FW9A 5FRMA 4RTYA 2YLBA 1SSHA 2LMJA 3CCUA 3OB9A 3VS0A 4C8QA 4PJOA 1VQKA 1M2VB 1OZ3A 1NE8A 2ED0A 3C95A 2K5LA 4KT0E 3J80E 1RADB 1NJIU 3GNFB 2J06A 4RTUA 3RKYA 1KHCA 2DIGA 3EG3A 3CPWA 2J6OA 5AT1B 1QVGS 3UATA 4M77A 3L2WA 3CCEA 2LQNA 3RERA 1OYXA 4IUUA 1M1GA 1TUGB 1C0MA 3CCRA 4GY5A 4M75A 1YJWQ 2F5KA 1FXXA 2R5MA 2LJ0A 3MEUA 2DVEA 2CH4W 3FB9A 3PT9A 4GLKA 3OYDA 1VOMA 2K2VA 2JMCA 3X20B 2LNVA 4DOWA 2QEXA 3LWIA 3TU4K 1K9AA 2IPOB 4EDUA 3FLGA 3A98A 1QLYA 2E4HA 5DY9A 2ZCFB 2KK4A 2QDYB 1D3BA 4ZGDB 1X6BA 1TG0A 1M9SA 2OTJT 4J9GA 2KXDA 5LJ5g 4Z02A 1IZ6A 2JVVA 3PIPA 2JM9A 2DLPA 2JT4A 2FPEA 5FU6C 1I4K1 2KROA 4BD3A 4E47A 1OPLA 1K9MU 2KMTA 2D8HA 2M0YA 2CGHA 1IRXA 4A4KA 2DTOA 1YJ9T 5A0LA 1UGPB 3LX7A 1X27A 5GAMg 1Q86R 2E65A 1KC8C 2LQWA 1VQ4A 1M2OA 3EHRA 4XTZA 5KYYB 2AZSA 3C0CA 1S72Q 4OMPA 1I5OB 2ROTA 4M7DB 1N8RC 2OTLA 1WQWA 2L0AA 3UPUA 2RQUA 1MUZA 1EIFA 3NFCA 1T3LA 2EAYA 1VQ9T 3NMZC 3G6EA 3JCMW 3DKMA 4R55A 2K5IA 4N0AA 1BI3A 2KR3A 4C0GA 4XTYA 1P92A 3RMSA 4KUDK 3JB9G 4L5GA 4J9FA 2YLCA 4BB7A 3P8HA 4FCYA 1YJNQ 3INZA 3SWNB 2X4WA 3U23A 3SDZA 4B6MA 1IHWA 4GBQA 5ECAA 3MKDA 1B3QA 3KXTA 3L2UA 4PJMA 2CKKA 1RAAB 2HKNA 3OYJA 2HMAA 1M1KR 1VQMQ 4LUEA 1VQ5T 5IAYA 1C1AA 1Q7YR 4EMKC 2RH2A 5GANj 3FJPA 1I5LA 2XDDA 4M7AF 3MP8A 3NHNA 4J9IA 4OMQA 4PFPA 2O88A 3QXEB 2EJFA 3OMCA 2DXCA 2LDMA 4M78C 3AHUA 3GPLA 3I5RA 4M7DD 4LE9A 1ZBXA 1ABOA 3FDRA 3KFVA 4N4IA 2D6FA 1BYMA 1YHQT 1K0SA 1X01A 2RJDA 4A53A 2CS7A 5GAN5 2MWOA 3CCST 2OAWA 4C0DB 3CC7T 5HKCA 1AWWA 4KGZB 2XMFA 3ULRB 2LRQA 2DVJA 2FVUA 3SFMA 2YUNA 3CPFA 3CD6Q 1H3ZA 1N27A 3X24B 3V8KA 1T0HA 3ZBDA 5KYXB 1X69A 1TH7A 4ATOA 4F7UB 3E9FA 5I11A 1ZA2B 4JZ4A 3OBYA 3NTKA 2KDSA 1R77A 2LX7A 3FEOA 3M0SA 5GAOm 2MWPA 5DM7R 2B86A 1KC8U 1BK2A 4KBMB 1QW1A 3JCMd 1Q86C 1BCMA 1IGUA 2BE9B 1CKBA 1VIEA 3CMEA 2DK3A 1N8RU 1AWJA 2VXFA 5GAOl 1WQ7A 3PVLA 1D09B 3G71A 4C5EA 2B8AA 3EFRA 4LXCA 1D0XA 2IG0A 2RI3A 1VQPT 4TVRA 4F14A 4JZ3A 1KFZA 5D6YA 2VVKA 4FL6A 2VGNA 1WNLA 3L2QA 1PKTA 2OTJA 4NL3A 1X2QA 4E7KA 1IHVA 1PRLC 2VKNA 1RL2A 4E2FB 3UWNA 2ZPHB 4XQ3A 2RQTA 2E6ZA 4FYXB 2A08A 1JXMA 3EFOA 4XAXB 2XK0A 2V1RA 3MP1A 4ME7A 1M1KC 2EJ9A 4P5NA 1M4ZA 3CBPA 1VQ8T 4XU1A 2L3RA 2K7AA 4EPCA 5D7UA 2HSPA 2BE7D 3LWHA 2L8DA 1M90R 1WJQA 2PVGB 5GAMe 1QVFS 4RTWA 4WTOB 5C6SA 2ZAEA 3HL8A 2QXFA 1RABB 4N4HA 5FU7C 2MCNA 2FZKB 5KE2A 3MCAB 4BUGA 3I56T 2JS2A 4J9HA 1WJSA 3N5BB 7AT1B 3CC4Q 1GFCA 2JM8A 4LNPA 3H6ZA 3CCLT 2HKQB 5FLXE 2FL7A 1Q81C 3ZFJA 4D8KA 5M9OA 4LDXA 2NWMA 1S72T 4JS4A 1M30A 1FX7A 1W2BS 3CCUT 2C0TA 1Q86U 2RQRA 3C94A 3E19A 3RR6A 3RESA 2DJQA 1MMGA 3SEMA 3PFSA 1VQ5A 4M7DF 1JEGA 4OGCA 1XNIA 3CCQQ 2AHJB 1OX9A 3TQ7P 2K5FA 4BE2A 5GANd 3V7RA 3I35A 4OMFB 1KHIA 2DERA 3VS2A 5J3BA 2VXEA 4JJCA 1BB9A 3CCRT 4D6WA 2YDLA 2EGEA 4AG1C 1YHQA 2KI7A 4L6V5 2O9VA 4ORZA 1MGQA 2O4XB 3CMAQ 3CCSA 4XTVA 3THKA 3CC7A 2CP3A 1WDXA 4XU3A 4C8QC 3UA6A 4PJOC 5IHIA 4Q5WA 4Z88A 3JCMg 2QEXT 4EMHA 2ABLA 2HBWA 1R0BG 2WSFE 4BY6B 1S1NA 2DX1A 3EGXA 2DMOA 5LJ5h 2FPDA 3T9NA 2O2OA 5GAN7 2A37A 2EBPA 2FO0A 3QKJA 4C8QG 4M77C 1TS9A 2JTEA 5IXFA 3FRNA 5GAN8 1HJDA 2F69A 5C0MA 2A36A 4M75C 1M90C 2CP7A 2YUOA 1R0CB 1NLPC 2MMPA 2J05A 2RPNA 2FPFA 1XQHA 4M77G 2CZ7B 1QMCA 5KCOA 2P0QA 3PVQA 4M75G 4OB0B 4LDWA 1Q81U 1NEGA 2EYYA 1T0JA 3RMQA 2KBTA 1QKXA 2K3YA 1VQPA 4A4EA 3NTIA 4F7UF 4HVVA 2OTLT 3QHSA 1VQNQ 4BACA 4C8QE 4CC7A 2EQKA 2ECZA 2AT1B 3G6ET 3HTRA 1YJWA 3JB9J 1AZGB 1UHCA 3MJXA 4FYVB 1D1AA 1DJ7B 3TSZA 2DTHA 2HEQA 4XTXA 1K4US 1HSQA 4FSSA 1AWOA 4KUIA 1YP5A 3LW5E 3JCMQ 1YCYA 2PNIA 1U3OA 4M77E 1QCOA 1BI0A 1G3SA 1RAHB 2MPXC 2RHZA 1VQ8A 4E6RA 3PE0A 4NL2A 3CBOA 3VS1A 1YI2Q 2GBQA 5FU6B 3LLRA 4JRKA 4M75E 4J83A 2K57A 4RTTA 2J7IA 3OQ5A 3CCJQ 2X4XA 1H3HA 1D0YA 2FEIA 2PQWA 1GBQA 4OP0A 1Z9QA 5A2QE 1IREB 2MK5A 2J6KA 4CC2A 1QKWA 1RAEB 2M51A 4N0AC 1GFDA 4HCKA 4R0KA 3V8JA 2QAZA 3EH1A 4MDXA 4AG2C 2HNIA 1FMKA 1KD1R 3VS5A 2D9TA 5I22A 1NG2A 3OS5A 1VYVA 4X9DA 2COZA 2BKDN 1KQSP 4PJJA 4CC3A 3P8BB 1S72A 1EZZB 3MEWA 4O6JA 5GANg 3G1JA 5GMKm 1AT1B 1HYOA 1W4SA 4J9EA 1M90U 2LCLA 3JCMJ 1YIJQ 1NPPA 1FMVA 2O31A 4DQ2A 4MDWA 2JN0A 2YRDA 1X43A 1UTIA 2Z0WA 2YWWA 5IHKA 2OJ2A 3S6WA 2L2PA 1OU8A 3A8GB 2GTOA 1YJNA 2XDPA 2DETA 1WJRA 4FM4B 5J26A 3IQLA 4PK4A 1RI0A 2AK5A 4ANJA 3CMET 1MHNA 3CCMQ 4EMKB 3GNGA 4C92A 4ZTFA 1SRMA 4IUTA 5D6XA 5GAN6 2DZCA 2EYQA 3G71T 2KXCA 1Y07A 1VQMA 3LGLA 2P84A 3JB9D 3PNWC 5I2SA 1ZHIA 3OYHA 1K76A 2E5KA 2JOYA 3MEVA 2X3XD 4J9BA 1UB4A 4PFOA 4RUGA 4QVDA 1K73C 1SHFA 1I07A 3EGUA 1Y96B 5LJ3f 3EFSA 2NUTA 4RG8A 1K8AC 2DYIA 3OS1A 3CCVQ 4AMCA 2LX9A 4FW1A 4OVAA 2LJ1A 4E7SA 1PSEA 2L3SA 1N9SA 3I5SA 2O01E 3H41A 2RA2A 3CD6A 3OA6A 3ZEHA 2WACA 2DXUA 2QDLA 2ZPFB 1UGQB 4QVZA 3QIIA 2RO0A 1W2BA 3I55T 3G4ST 1JJ2S 2HD0A 5KYWA 3OW2S 2ENMA 2K79A 1SRLA 2QA4Q 2HAXA 3L2RA 1AEYA 4OB1B 1KD1C 2RB6A 1GCPA 3GBQA 1VYUA 4E7IA 1TXQA 1UE9A 2CZ1B 4J5YA 1YFNA 3NGPA 2MI6A 2DD5A 1SSFA 2DM1A 1V29B 2EYXA 1PKSA 2KNBB 2JNGA 4J7IA 3EGDA 5GMKh 1B34A 2QI2A 1KQSA 1VQLQ 2CYZB 2C0IA 4AT1B 2NYSA 3BDLA 3HKSA 3LH0A 1VQKQ 2JTFA 2XICA 4NOYA 2GFAA 2V8KA 1WI7A 3OYEA 2O4XA 2DD4A 4BDZA 5FROA 1ZA1B 2QQAA 2DILA 2P4TA 1GL5A 1ZSGA 3J7AF 1UDLA 3OSSC 1GXIE 4C0ZA 2JTMA 1PRMC 3CC2Q 1WGSA 3CCEQ 3OBWA 2BIVA 2AZVA 1OEBA 3QJ6A 1UJYA 1I0CA 2WSEE 1QCNA 1SG5A 3O8VA 1CKAA 2M9UA 5GJWB 1K73U 2OI3A 4BI8B 5FU7B 1QCFA 2HDAA 3M57A 4JRQA 1QVGP 4L59A 4QW2A 3WVDB 5GAOq 1K8AU 4V2SA 4JUVA 4MZTA 2DA9A 1UEBA 3CCJT 5KCHA 3JCMh 2LZ6B 2CP5A 3M0QA 4AFUC 2L3QA 3X26B 2V26A 3H0FA 1XOVA 2YT6A 3RUXA 5CO7A 1ZSZA 4M78G 2L89A 5GANe 4HT8A 1PNJA 3CXCA 3CEYA 2H8HA 1YCSB 3HFOA 1SHGA 1B07A 2HL5C 2DL5A 2RI5A 3TCJA 5L23A 5KYUA 4Y28E 1YITQ 1J3TA 3H0IA 1UGSB 3MPUB 3D7SB 4OMMA 3JAME 2I2LA 4M7AA 3H8ZA 1TOVA 1N5ZA 2D8JA 2ROLA 4FSXA 2XU8A 2OAUA 4F17A 2MIOA 2RN8A 2RF0A 2SEMA 1KD1U 2K6DA 4FT2A 2LCCA 3JB9F 2LT4A 2RMOA 2NUZA 4J7FA 2HQHA 1YIJT 1VQ6Q 3M56A 1VQ4Q 1MV3A 2DE0X 2KQWA 1UFFA 4B9WA 1G3WA 3HSBA 4M78E 1G2BA 4DBFA 5KE3A 2YXYA 1IB8A 1VQOQ 2VV5A 3OS0A 1X6GA 3A8HB 4FU6A 2ESWA 5GJVB 1RLQC 4PKCC 1PSFA 2HSEB 4C8QB 1NYGA 2GFUA 3QPHA 1YJWT 3L42A 3NPFA 2GF7A 5LJ5e 4NS5A 3HRSA 4PLLA 3VRYA 1U8RA 4PL6A 3ER0A 1PM3A 1VQ7Q 5DLQE 1LVKA 4JJBA 2XKOC 2YUPA 5IH2A 3OYFA 3CPWS 4M77B 4ZNXA 5GAMj 1Q7YC 3BY7A 3JSCA 4HCCA 2ZZDA 2RK2A 1TU0B 1ZLMA 4RTZA 4OB3B 3OSVA 2DJZA 3A8MB 2YHTA 4M75B 2A3LA 2RHUA 2VWFA 3I55A 3G4SA 2K9GA 2JS0A 1NEBA 4ZN1A 4HT9A 3M59A 2DL7A 4VUBA 4BDYA 1UUEA 3RNJA 2DL3A 1M2VA 2GNCA 2KEAA 4E7JA 1UGRB 1TUDA 2CZ0B 1GCQA 4QT7A 4JLIA 1ACMB 3REBB 3TEEA 1BU1A 1QVGA 1O9SA 2AKKA 4C8QD 1BIBA 3C12A 2W10A 5GANh 2X9HA 2YSQA 2RK1A 3QZ5B 3TVTA 1B7TA 5L8RE 4KGVB 5LJ3j 2EW3A 1OOTA 4E7LA 1VQNA 4BE1A 4XTWA 2VGMA 2Y4YA 3R6OA 2X3WD 2CSQA 2WSCE 1WLPB 4ELYC 1SPKA 2F2WA 3EG9B 5CKHA 2KSSA 4ZTJA 4PNOA 5GMKi 2M0OA 5GAOr 2F2VA 1HXDA 3VV0A 1ZBJA 4M75D 2QQ9A 2H3JA 1YJNT 3HRTA 2YRCA 1H8KA 2E5QA 1FWZA 3M0UA 2LC4A 2FB7A 1YI2A 3FC3A 2OX7A 3GP8A 1D1CA 2QGGA 2KRSA 3QG1A 4KULA 1WX6A 3ME9A 3UT1A 3CCJA 3GLXA 1VQMT 3MEAA 3HRUA 2QGFB 5A0GA 1U5SA 2MF2A 2EQUA 2LP5A 2EGAA 4J6WA 3A8OB 2X4YA 4KRTA 1RAFB 1M1KU 3ZL7C 1X75C 2HQEA 1K9MR 2LQ8A 2IVWA 4DOVA 1QWFA 1Q7YU 1QQJA 4RMOA 2QYZA 5KYYA 1RAIB 2IIMA 1IO6A 4PJOG 2A0FB 4J6XA 1VUBA 4M7DA 4MZPA 1ZUYA 4C92C 3S3NA 3S3OA 1RI9A 2DZ9A 4II1A 2CP6A 1YJ9Q 2E3HA 1TUCA 5HY6A 4BE0A 3CD6T 5CVIA 2M1HA 1W6XA 5EC7A 1YIJA 4ELZC 4OGEA 2O9SA 1UJ0A 4MZMA 3S3MA 5GAOp 3SWNA 1YITT 1M27C 2NUPB 1G3YA 4C92G 4EMGA 8ATCB 4J9DA 2R57A 3HPWA 2JUFA 1VQ9Q 2QG9B 2GTJA 1YNZA 1OX8A 2D0NA 3BW1A 3R6NA 3X28B 4PJOE 5I21A 1XJWB 3CCMA 1QVFP 2M16A 2CUDA 1ZUUA 4GLMA 2KVQG 1VQ6T 1WXUA 2EFIA 1BKBA 1V1CA 1OPKA 2HBPA 4CC4B 1BI1A 1HK9A 3PGGA 1LOJA 1Y57A 2JXBA 2L5QA 5FWBA 3M4GA 4QQ6A 3M0PA 1E6GA 2LCSA 3VS7A 1WXTA 2AKLA 2COWA 3M4YA 3GOXA 4E7HA 3X25B 3VS3A 4Y91A 2RI2A 2X4JA 2VB6A 1AWXA 4C92E 4LDUA 1FMWA 1IGQA 4PFZA 3QDRB 1G83A 3C4SA 4A4GA 4DEXA 2QTVA 1Q82R 2CT3A 1JBMA 3VS6A 5HCKA 5KYXA 1W2BP 3OYIA 1WHMA 3GIBA 2JZ2A 1VQ7T 4C8QF 1Y7XA 4F7UA 1M3CA 3LGFA 1E6HA 2DXBA 2M02A 1YHQQ 3UDCA 3F70A 5IHNA 2BUDA 1M8MA 5LJ5f 3CC7Q 1MMDA 2XIDA 2XD0A 3JCMV 1Q95G 1AHJB 1UHFA 4M77F 2DIQA 4JRPA 3RKXA 2QA4A 1M1FA 5GMKe 2EQIA 4OMLA 4MMKA 4WCIA 2V1QA 2DF6A 1ABQA 1EFNA 1BBZA 3KBGA 1VIFA 1C6VX 2EIFA 4M75F 5LJ3d 4BY6C 1LPLA 3EG1A 5IXBA 3CC4T 3OYCA 5GAMf 5GMKl 1VYTA 2EQMA 4F16A 4XK8E 1NZ9A 3PMTA 2PZ1A 3DLMA 3OYBA 2RD1A 4FT4A 1VQLA 1WXBA 4LN2A 1D1BA 3VS4A 2RNAA 2KT8A 4RG2A 2MYSA 2X35A 2FYKA 4QKUA 2DRKA 3QYHB 3PMIA 4Z8AA 2PU9B 4QQGA 2PUOB 1ZSZC 4RTVA 2F2XA 1OZ2A 1VQPQ 4MMLA 2GGRA 3VYGA 3HHTB 5HK0A 3CC2A 4M78B 4F04B 1PWTA 3CCQT 4R56A 2E12A 4CI0C 3JCMe 2GQIA 1AVZC 2RHYA 2EJGA 1QVFA 2LQKA 4AFQC 2GCXA 1MNDA 1MNEA 3CXCP 2ZPIB 4M7AC 1WYXA 3DB4A 2EWNA 4C5IA 4OB2B 1PD0A 3CMAT 1JU5C 1R8OB 3PIOA 1F1BB 2ATCB 1VQ8Q 3JCMb 1G3TA 4BI4A 1IXDA 3QDFA 4RKUE 1Q82C 1MV0B 1LCKA 1AOJA 4WF2A 2KRNA 4M7AG 1M5Q1 2DL8A 4ESRA 3V8LA 3VUBA 3QSUA 3EG2A 2P4RA 4FIBA 1OQKA 2X51A 2EYWA 4HXJA 1QVPA 2VYTA 2XHCA 1YITA 3OYYA 3HFNA 4HA8A 4ZGJB 5CKEA 3I56Q 1YWPA 3WXMB 2ED1A 1T3SA 5KH6A 3EG9A 4M78D 3VKIA 1I81A 3CCLQ 3MO8A 3EGXB 4JS5A 1VQ6A 1BIAA 2HCKA 2BZ8A 2KYMA 2PVDB 1N9RA 5CKFA 3L1AA 4IUPA 2KYBA 2DYBA 3CCUQ 2RHIA 2DRMA 3EH2A 1VQOA 4M7AE 4PJNA 2R58A 4J8OA 3MHXA 2CP0A 2EVRA 1VQNT 1WA7A 3FJ5A 1VA7A 5AYFA 2XI9A 1V76A 1WPYA 1EX4A 4IIMA 2YRVA 4EIKA 3H0HA 4QVCA 1A0NB 1SKUB 1WHHA 3VRZA 1GRIA 3QZ9B 4IIOA 3I9QA 5CKBA 1GCQC 2W0ZA 2FHDA 3ASKA 1PD1A 4JLGA 1VQ7A 4RCCA 1UECA 2DBMA 3JRZA 4AFSC 3CCRQ 2HZYA 2VASA 2FZCB 1X2KA 2LTOA 5LJ3g 9ATCB 1I8FA 1SEMA 2EQJA 3SHWA 1YI2T 2L3PA 1WHGA 2E41A 2E3IA 4PJLA 3JCMX 3RBBB 2QEXQ 4XU0A 1G5VA 3BFMA 1TWBA 3O5ZA 1OULA 4DBHA 2XDBA 1QWEA 3OYLA 4HKEA 1KG1A 1Q82U 1JXOA 4LDVA 2NUPA 2DPPB 3CC4A 2RJCA 3DB3A 1H641 1LJOA 3REAB 3JCMc 4IUVA 1JRIA 1KIKA 4RTXA 3A1PA 2Y90A 3VU3C 3BE3A 1QP2A 1I1JA 2LNHB 1Q81R 4Z89A 3L2VA 2K4YA 3JCMP 4HCBA 3VYHB 4FYYB 5IT9E 2DXTA 5CCAA 2FG0A 1LNXA 1TTHB 4A63B 4JJNK 1RACB 2JJ9A 1W1FA 3MP6A 4XU2A 4X9CA 3OYAA 2D1XA 4JJDA 3P8DA 2OTLQ 3OYKA 4QQDA 2A28A 3DLLA 3CCQA 4O5VA 1YWOA 2ZGWA 5HK3A 3TSWA 3G6EQ 5LJ5j 2DFUA 2DTIA 4M7DC 3Q1JA 4A54A 1JJ2P 1RAGB 1KSWA 3SD4A 3CCMT 4PJOB 3EAEA 4AFZC 3OW2P 1UGVA 4OMNA 4N4GA 2MAMA 4FYWB 2VUBA 3OYMA 1NM7A 3CMAA 1WIEA 4YTLA 2QQBA 1GBRA 2CH4A 3QUIA 4M7DG 2FRWA 3FIFA 3EHQA 1XTDA 2E64A 3SWNC 2J6FA 1OU9A 3E9GA 1BCOA 1X6OA 3A8LB 3META 4M78F 4C92B 4LUDA 3CCVT 3PTAA 2KE9A 3JV3A 2GQVA 5CR2A 2KRMA 5CK9A 5CQXA 1SF9A 4J6YA 1K0XA 3JCMf 3KUFA 2CDTA 2ZPBB 2DAQA 2RM4A 2XG8D 3V7CA 1YJ9A 2E10A 2LT1A 2HL3A 2P0KA 3V7SA 5CAIA 5LL6S 4JDSA 1RLPC 1OI1A 2EKOA 3TREA 3OS2A 2NUTB 1ZQ1A 1D3BB 2C0OA 4K11A 4PJOD 1NJIR 4A4HA 2CT4A 3M53A 4M7DE 3RIRA 4FW2A 1MMNA 3QWXX 1WHLA 2E6NA 2QA4T 2BTTA 4C0DC 4EMKA 4ZGEB 2CZ6B 3QO3A 1VQ9A 2RJFA 5GAN4 3M58A 2EKHA 3GF5A 5GAN3 4A4FA 3M55A 1BI2A 1M3AA 5D6WA 1PHTA 2P0PA 3OMGA 4M77D 4M78A 2PVOB 5J39A 2FRYA 1HD3A 1NBEB 1Y71A 3RDVA 4B9XA 2CREA 1YBYA 3G7ZA 4KH0B 2QQSA 4C92D 1VQLT 4JRIA 2KY9A 4PLIA 1Y96A 5EG2A 5KYWB 3CMEQ 2E1HA 5CKDA 1VQKT 1CSKA 1D0ZA 4JPBW 2D0QB 2EYZA 4J9CA 4LDYA 3G71Q 5LJ3e 4F7UG 1W70A 2RQVA 4IKFA 1PG5B 3OYGA 4HCZA 2RJEA 3QWYA 1ARKA 4XTUA 2CP2A 3WVEB 2DKGA 3JB9I 3EGDB 1B34B 1JB0E 3CC2T 3CCET 1RUWA 1K1ZA 2CSIA 1M8VA 2DNUA 1KQSS 1KQ1A 1JJ2A 2OTJQ 2KGTA 2NLUA 3OW2A 1YN8A 2DL4A 3CBMA 5CIUA 2G3RA 2JMAA 2F5TX 2K3XA 5FWCA 3HP9A 4RCBA 3M0RA 3UF4A 4C5HA 5KYNA 1ZUKA 1FYNA 2E70A 4F7UE 4X1VA 3NTHA 1PCXA 3M54A 4IURA 4KGXB 1WHJA 4DBQA 5FRNA 3I55Q 3G4SQ 1JQQA 3QBYA 2K2MA 2CUBA 2DEUA 2V8JA 4OF1A 4HVUA 1NYFA 3VUZA 1TSFA 2LJ3A 4C0FA 3CPWP 3J81E 3VJPA 4DBRA 5GANf 4BI3A 8AT1B 2LVMA 2ZPGB 2BZXA 1UG1A 2AIRB 4DA4A 6AT1B 2EGCA 2FZGB 2MOXA 1NJIC 2QQRA 3BDUA 5GAMh 4LD9K 1ZSZB 4CRIA 1KK7A 5GAOn 2QK0A 5GAN2 2C06A
chains in the Genus database with same CATH topology
2QA4Q 1S72Q 3CCQQ 1QVGP 1VQ8Q 1VQLQ 1VQ6Q 1Q7YR 1JJ2P 1YIJQ 1VQ5Q 3I56Q 3CC2Q 1VQ4Q 1YITQ 3CMEQ 3CCEQ 2QEXQ 3CCMQ 3CPWP 3CC4Q 3OW2P 3CCSQ 3CCUQ 1YJNQ 1K73R 3CCJQ 1KD1R 1VQKQ 1YJWQ 1Q82R 1N8RR 1YI2Q 1YJ9Q 1W2BP 3CCLQ 3CXCP 1M90R 3CCRQ 1K8AR 1VQ9Q 2OTJQ 3CD6Q 2OTLQ 3G71Q 3CCVQ 1VQOQ 1K9MR 1VQNQ 1KQSP 3CC7Q 1Q81R 1VQPQ 1VQ7Q 1Q86R 1NJIR 3I55Q 3G4SQ 3CMAQ 1QVFP 1KC8R 3G6EQ 1M1KR 1YHQQ 1VQMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 Q;  1S72 Q;  3CCQ Q;  1QVG P;  1VQ8 Q;  1VQL Q;  1VQ6 Q;  1Q7Y R;  1JJ2 P;  1YIJ Q;  1VQ5 Q;  3I56 Q;  3CC2 Q;  1VQ4 Q;  1YIT Q;  3CME Q;  3CCE Q;  2QEX Q;  3CCM Q;  3CPW P;  3CC4 Q;  3OW2 P;  3CCS Q;  3CCU Q;  1YJN Q;  1K73 R;  3CCJ Q;  1KD1 R;  1VQK Q;  1YJW Q;  1Q82 R;  1N8R R;  1YI2 Q;  1YJ9 Q;  1W2B P;  3CCL Q;  3CXC P;  1M90 R;  3CCR Q;  1K8A R;  1VQ9 Q;  2OTJ Q;  3CD6 Q;  2OTL Q;  3G71 Q;  3CCV Q;  1VQO Q;  1K9M R;  1VQN Q;  1KQS P;  3CC7 Q;  1Q81 R;  1VQP Q;  1VQ7 Q;  1Q86 R;  1NJI R;  3I55 Q;  3G4S Q;  3CMA Q;  1QVF P;  1KC8 R;  3G6E Q;  1M1K R;  1YHQ Q;  1VQM Q; 
#chains in the Genus database with same CATH topology
 3M9Q A;  4HVW A;  5LJ5 d;  2DEQ A;  2K3B A;  1WFW A;  3QYG B;  3CXC S;  1VQ4 T;  3LH5 A;  4IUQ A;  1G8X A;  4C5G A;  5KYU B;  2RHX A;  1QP3 A;  2COY A;  3CQT A;  1OV3 A;  2JW4 A;  3JB9 H;  4Y92 A;  2PTK A;  2KT1 A;  1VQO T;  2VC8 A;  3URG A;  4M7A B;  1H92 A;  1AD5 A;  4E7Z A;  1KJW A;  1NPR A;  1AZE A;  2DBK A;  3OYN A;  2I0N A;  4X34 A;  4OMO A;  4DEY A;  3UA7 A;  2V8I A;  2EPD A;  3M0T A;  2R5A A;  3E2U A;  1U1T A;  1VQ5 Q;  1JO8 A;  5GAM d;  5A0D A;  1K73 R;  1MMA A;  1PC0 A;  3CCV A;  2ZPE B;  1Z9Z A;  1K8A R;  2A7Y A;  2BZY A;  3A5Z B;  2KAF A;  1WHK A;  4PJO F;  5CQY A;  5LJ3 h;  5I2M A;  3L2Z A;  3SB2 A;  1O75 A;  5GMK j;  2SRC A;  2QAS A;  1ZX6 A;  3CCS Q;  2F1L A;  2PUK B;  3H9N A;  4M4Z A;  3AT1 B;  2G6F X;  1WZO A;  4UC4 A;  1K9M C;  3EG0 A;  1E7O A;  2YUQ A;  1U06 A;  5IN1 A;  1KQ2 A;  3I56 A;  1M3B A;  3RKW A;  2DO3 A;  3EFO B;  4KH1 B;  1KC8 R;  2RQW A;  4C92 F;  3CCL A;  3OY9 A;  4LD6 A;  4M7A D;  2QTX A;  1N8R R;  2H3E B;  4ZN3 A;  1NLO C;  4D8D A;  1Y0M A;  3E1S A;  3LYI A;  3M5A A;  3QJY A;  5DLO A;  2HQX A;  1N6A A;  1U1S A;  2Y4X A;  5FW9 A;  5FRM A;  4RTY A;  2YLB A;  1SSH A;  2LMJ A;  3CCU A;  3OB9 A;  3VS0 A;  4C8Q A;  4PJO A;  1VQK A;  1M2V B;  1OZ3 A;  1NE8 A;  2ED0 A;  3C95 A;  2K5L A;  4KT0 E;  3J80 E;  1RAD B;  1NJI U;  3GNF B;  2J06 A;  4RTU A;  3RKY A;  1KHC A;  2DIG A;  3EG3 A;  3CPW A;  2J6O A;  5AT1 B;  1QVG S;  3UAT A;  4M77 A;  3L2W A;  3CCE A;  2LQN A;  3RER A;  1OYX A;  4IUU A;  1M1G A;  1TUG B;  1C0M A;  3CCR A;  4GY5 A;  4M75 A;  1YJW Q;  2F5K A;  1FXX A;  2R5M A;  2LJ0 A;  3MEU A;  2DVE A;  2CH4 W;  3FB9 A;  3PT9 A;  4GLK A;  3OYD A;  1VOM A;  2K2V A;  2JMC A;  3X20 B;  2LNV A;  4DOW A;  2QEX A;  3LWI A;  3TU4 K;  1K9A A;  2IPO B;  4EDU A;  3FLG A;  3A98 A;  1QLY A;  2E4H A;  5DY9 A;  2ZCF B;  2KK4 A;  2QDY B;  1D3B A;  4ZGD B;  1X6B A;  1TG0 A;  1M9S A;  2OTJ T;  4J9G A;  2KXD A;  5LJ5 g;  4Z02 A;  1IZ6 A;  2JVV A;  3PIP A;  2JM9 A;  2DLP A;  2JT4 A;  2FPE A;  5FU6 C;  1I4K 1;  2KRO A;  4BD3 A;  4E47 A;  1OPL A;  1K9M U;  2KMT A;  2D8H A;  2M0Y A;  2CGH A;  1IRX A;  4A4K A;  2DTO A;  1YJ9 T;  5A0L A;  1UGP B;  3LX7 A;  1X27 A;  5GAM g;  1Q86 R;  2E65 A;  1KC8 C;  2LQW A;  1VQ4 A;  1M2O A;  3EHR A;  4XTZ A;  5KYY B;  2AZS A;  3C0C A;  1S72 Q;  4OMP A;  1I5O B;  2ROT A;  4M7D B;  1N8R C;  2OTL A;  1WQW A;  2L0A A;  3UPU A;  2RQU A;  1MUZ A;  1EIF A;  3NFC A;  1T3L A;  2EAY A;  1VQ9 T;  3NMZ C;  3G6E A;  3JCM W;  3DKM A;  4R55 A;  2K5I A;  4N0A A;  1BI3 A;  2KR3 A;  4C0G A;  4XTY A;  1P92 A;  3RMS A;  4KUD K;  3JB9 G;  4L5G A;  4J9F A;  2YLC A;  4BB7 A;  3P8H A;  4FCY A;  1YJN Q;  3INZ A;  3SWN B;  2X4W A;  3U23 A;  3SDZ A;  4B6M A;  1IHW A;  4GBQ A;  5ECA A;  3MKD A;  1B3Q A;  3KXT A;  3L2U A;  4PJM A;  2CKK A;  1RAA B;  2HKN A;  3OYJ A;  2HMA A;  1M1K R;  1VQM Q;  4LUE A;  1VQ5 T;  5IAY A;  1C1A A;  1Q7Y R;  4EMK C;  2RH2 A;  5GAN j;  3FJP A;  1I5L A;  2XDD A;  4M7A F;  3MP8 A;  3NHN A;  4J9I A;  4OMQ A;  4PFP A;  2O88 A;  3QXE B;  2EJF A;  3OMC A;  2DXC A;  2LDM A;  4M78 C;  3AHU A;  3GPL A;  3I5R A;  4M7D D;  4LE9 A;  1ZBX A;  1ABO A;  3FDR A;  3KFV A;  4N4I A;  2D6F A;  1BYM A;  1YHQ T;  1K0S A;  1X01 A;  2RJD A;  4A53 A;  2CS7 A;  5GAN 5;  2MWO A;  3CCS T;  2OAW A;  4C0D B;  3CC7 T;  5HKC A;  1AWW A;  4KGZ B;  2XMF A;  3ULR B;  2LRQ A;  2DVJ A;  2FVU A;  3SFM A;  2YUN A;  3CPF A;  3CD6 Q;  1H3Z A;  1N27 A;  3X24 B;  3V8K A;  1T0H A;  3ZBD A;  5KYX B;  1X69 A;  1TH7 A;  4ATO A;  4F7U B;  3E9F A;  5I11 A;  1ZA2 B;  4JZ4 A;  3OBY A;  3NTK A;  2KDS A;  1R77 A;  2LX7 A;  3FEO A;  3M0S A;  5GAO m;  2MWP A;  5DM7 R;  2B86 A;  1KC8 U;  1BK2 A;  4KBM B;  1QW1 A;  3JCM d;  1Q86 C;  1BCM A;  1IGU A;  2BE9 B;  1CKB A;  1VIE A;  3CME A;  2DK3 A;  1N8R U;  1AWJ A;  2VXF A;  5GAO l;  1WQ7 A;  3PVL A;  1D09 B;  3G71 A;  4C5E A;  2B8A A;  3EFR A;  4LXC A;  1D0X A;  2IG0 A;  2RI3 A;  1VQP T;  4TVR A;  4F14 A;  4JZ3 A;  1KFZ A;  5D6Y A;  2VVK A;  4FL6 A;  2VGN A;  1WNL A;  3L2Q A;  1PKT A;  2OTJ A;  4NL3 A;  1X2Q A;  4E7K A;  1IHV A;  1PRL C;  2VKN A;  1RL2 A;  4E2F B;  3UWN A;  2ZPH B;  4XQ3 A;  2RQT A;  2E6Z A;  4FYX B;  2A08 A;  1JXM A;  3EFO A;  4XAX B;  2XK0 A;  2V1R A;  3MP1 A;  4ME7 A;  1M1K C;  2EJ9 A;  4P5N A;  1M4Z A;  3CBP A;  1VQ8 T;  4XU1 A;  2L3R A;  2K7A A;  4EPC A;  5D7U A;  2HSP A;  2BE7 D;  3LWH A;  2L8D A;  1M90 R;  1WJQ A;  2PVG B;  5GAM e;  1QVF S;  4RTW A;  4WTO B;  5C6S A;  2ZAE A;  3HL8 A;  2QXF A;  1RAB B;  4N4H A;  5FU7 C;  2MCN A;  2FZK B;  5KE2 A;  3MCA B;  4BUG A;  3I56 T;  2JS2 A;  4J9H A;  1WJS A;  3N5B B;  7AT1 B;  3CC4 Q;  1GFC A;  2JM8 A;  4LNP A;  3H6Z A;  3CCL T;  2HKQ B;  5FLX E;  2FL7 A;  1Q81 C;  3ZFJ A;  4D8K A;  5M9O A;  4LDX A;  2NWM A;  1S72 T;  4JS4 A;  1M30 A;  1FX7 A;  1W2B S;  3CCU T;  2C0T A;  1Q86 U;  2RQR A;  3C94 A;  3E19 A;  3RR6 A;  3RES A;  2DJQ A;  1MMG A;  3SEM A;  3PFS A;  1VQ5 A;  4M7D F;  1JEG A;  4OGC A;  1XNI A;  3CCQ Q;  2AHJ B;  1OX9 A;  3TQ7 P;  2K5F A;  4BE2 A;  5GAN d;  3V7R A;  3I35 A;  4OMF B;  1KHI A;  2DER A;  3VS2 A;  5J3B A;  2VXE A;  4JJC A;  1BB9 A;  3CCR T;  4D6W A;  2YDL A;  2EGE A;  4AG1 C;  1YHQ A;  2KI7 A;  4L6V 5;  2O9V A;  4ORZ A;  1MGQ A;  2O4X B;  3CMA Q;  3CCS A;  4XTV A;  3THK A;  3CC7 A;  2CP3 A;  1WDX A;  4XU3 A;  4C8Q C;  3UA6 A;  4PJO C;  5IHI A;  4Q5W A;  4Z88 A;  3JCM g;  2QEX T;  4EMH A;  2ABL A;  2HBW A;  1R0B G;  2WSF E;  4BY6 B;  1S1N A;  2DX1 A;  3EGX A;  2DMO A;  5LJ5 h;  2FPD A;  3T9N A;  2O2O A;  5GAN 7;  2A37 A;  2EBP A;  2FO0 A;  3QKJ A;  4C8Q G;  4M77 C;  1TS9 A;  2JTE A;  5IXF A;  3FRN A;  5GAN 8;  1HJD A;  2F69 A;  5C0M A;  2A36 A;  4M75 C;  1M90 C;  2CP7 A;  2YUO A;  1R0C B;  1NLP C;  2MMP A;  2J05 A;  2RPN A;  2FPF A;  1XQH A;  4M77 G;  2CZ7 B;  1QMC A;  5KCO A;  2P0Q A;  3PVQ A;  4M75 G;  4OB0 B;  4LDW A;  1Q81 U;  1NEG A;  2EYY A;  1T0J A;  3RMQ A;  2KBT A;  1QKX A;  2K3Y A;  1VQP A;  4A4E A;  3NTI A;  4F7U F;  4HVV A;  2OTL T;  3QHS A;  1VQN Q;  4BAC A;  4C8Q E;  4CC7 A;  2EQK A;  2ECZ A;  2AT1 B;  3G6E T;  3HTR A;  1YJW A;  3JB9 J;  1AZG B;  1UHC A;  3MJX A;  4FYV B;  1D1A A;  1DJ7 B;  3TSZ A;  2DTH A;  2HEQ A;  4XTX A;  1K4U S;  1HSQ A;  4FSS A;  1AWO A;  4KUI A;  1YP5 A;  3LW5 E;  3JCM Q;  1YCY A;  2PNI A;  1U3O A;  4M77 E;  1QCO A;  1BI0 A;  1G3S A;  1RAH B;  2MPX C;  2RHZ A;  1VQ8 A;  4E6R A;  3PE0 A;  4NL2 A;  3CBO A;  3VS1 A;  1YI2 Q;  2GBQ A;  5FU6 B;  3LLR A;  4JRK A;  4M75 E;  4J83 A;  2K57 A;  4RTT A;  2J7I A;  3OQ5 A;  3CCJ Q;  2X4X A;  1H3H A;  1D0Y A;  2FEI A;  2PQW A;  1GBQ A;  4OP0 A;  1Z9Q A;  5A2Q E;  1IRE B;  2MK5 A;  2J6K A;  4CC2 A;  1QKW A;  1RAE B;  2M51 A;  4N0A C;  1GFD A;  4HCK A;  4R0K A;  3V8J A;  2QAZ A;  3EH1 A;  4MDX A;  4AG2 C;  2HNI A;  1FMK A;  1KD1 R;  3VS5 A;  2D9T A;  5I22 A;  1NG2 A;  3OS5 A;  1VYV A;  4X9D A;  2COZ A;  2BKD N;  1KQS P;  4PJJ A;  4CC3 A;  3P8B B;  1S72 A;  1EZZ B;  3MEW A;  4O6J A;  5GAN g;  3G1J A;  5GMK m;  1AT1 B;  1HYO A;  1W4S A;  4J9E A;  1M90 U;  2LCL A;  3JCM J;  1YIJ Q;  1NPP A;  1FMV A;  2O31 A;  4DQ2 A;  4MDW A;  2JN0 A;  2YRD A;  1X43 A;  1UTI A;  2Z0W A;  2YWW A;  5IHK A;  2OJ2 A;  3S6W A;  2L2P A;  1OU8 A;  3A8G B;  2GTO A;  1YJN A;  2XDP A;  2DET A;  1WJR A;  4FM4 B;  5J26 A;  3IQL A;  4PK4 A;  1RI0 A;  2AK5 A;  4ANJ A;  3CME T;  1MHN A;  3CCM Q;  4EMK B;  3GNG A;  4C92 A;  4ZTF A;  1SRM A;  4IUT A;  5D6X A;  5GAN 6;  2DZC A;  2EYQ A;  3G71 T;  2KXC A;  1Y07 A;  1VQM A;  3LGL A;  2P84 A;  3JB9 D;  3PNW C;  5I2S A;  1ZHI A;  3OYH A;  1K76 A;  2E5K A;  2JOY A;  3MEV A;  2X3X D;  4J9B A;  1UB4 A;  4PFO A;  4RUG A;  4QVD A;  1K73 C;  1SHF A;  1I07 A;  3EGU A;  1Y96 B;  5LJ3 f;  3EFS A;  2NUT A;  4RG8 A;  1K8A C;  2DYI A;  3OS1 A;  3CCV Q;  4AMC A;  2LX9 A;  4FW1 A;  4OVA A;  2LJ1 A;  4E7S A;  1PSE A;  2L3S A;  1N9S A;  3I5S A;  2O01 E;  3H41 A;  2RA2 A;  3CD6 A;  3OA6 A;  3ZEH A;  2WAC A;  2DXU A;  2QDL A;  2ZPF B;  1UGQ B;  4QVZ A;  3QII A;  2RO0 A;  1W2B A;  3I55 T;  3G4S T;  1JJ2 S;  2HD0 A;  5KYW A;  3OW2 S;  2ENM A;  2K79 A;  1SRL A;  2QA4 Q;  2HAX A;  3L2R A;  1AEY A;  4OB1 B;  1KD1 C;  2RB6 A;  1GCP A;  3GBQ A;  1VYU A;  4E7I A;  1TXQ A;  1UE9 A;  2CZ1 B;  4J5Y A;  1YFN A;  3NGP A;  2MI6 A;  2DD5 A;  1SSF A;  2DM1 A;  1V29 B;  2EYX A;  1PKS A;  2KNB B;  2JNG A;  4J7I A;  3EGD A;  5GMK h;  1B34 A;  2QI2 A;  1KQS A;  1VQL Q;  2CYZ B;  2C0I A;  4AT1 B;  2NYS A;  3BDL A;  3HKS A;  3LH0 A;  1VQK Q;  2JTF A;  2XIC A;  4NOY A;  2GFA A;  2V8K A;  1WI7 A;  3OYE A;  2O4X A;  2DD4 A;  4BDZ A;  5FRO A;  1ZA1 B;  2QQA A;  2DIL A;  2P4T A;  1GL5 A;  1ZSG A;  3J7A F;  1UDL A;  3OSS C;  1GXI E;  4C0Z A;  2JTM A;  1PRM C;  3CC2 Q;  1WGS A;  3CCE Q;  3OBW A;  2BIV A;  2AZV A;  1OEB A;  3QJ6 A;  1UJY A;  1I0C A;  2WSE E;  1QCN A;  1SG5 A;  3O8V A;  1CKA A;  2M9U A;  5GJW B;  1K73 U;  2OI3 A;  4BI8 B;  5FU7 B;  1QCF A;  2HDA A;  3M57 A;  4JRQ A;  1QVG P;  4L59 A;  4QW2 A;  3WVD B;  5GAO q;  1K8A U;  4V2S A;  4JUV A;  4MZT A;  2DA9 A;  1UEB A;  3CCJ T;  5KCH A;  3JCM h;  2LZ6 B;  2CP5 A;  3M0Q A;  4AFU C;  2L3Q A;  3X26 B;  2V26 A;  3H0F A;  1XOV A;  2YT6 A;  3RUX A;  5CO7 A;  1ZSZ A;  4M78 G;  2L89 A;  5GAN e;  4HT8 A;  1PNJ A;  3CXC A;  3CEY A;  2H8H A;  1YCS B;  3HFO A;  1SHG A;  1B07 A;  2HL5 C;  2DL5 A;  2RI5 A;  3TCJ A;  5L23 A;  5KYU A;  4Y28 E;  1YIT Q;  1J3T A;  3H0I A;  1UGS B;  3MPU B;  3D7S B;  4OMM A;  3JAM E;  2I2L A;  4M7A A;  3H8Z A;  1TOV A;  1N5Z A;  2D8J A;  2ROL A;  4FSX A;  2XU8 A;  2OAU A;  4F17 A;  2MIO A;  2RN8 A;  2RF0 A;  2SEM A;  1KD1 U;  2K6D A;  4FT2 A;  2LCC A;  3JB9 F;  2LT4 A;  2RMO A;  2NUZ A;  4J7F A;  2HQH A;  1YIJ T;  1VQ6 Q;  3M56 A;  1VQ4 Q;  1MV3 A;  2DE0 X;  2KQW A;  1UFF A;  4B9W A;  1G3W A;  3HSB A;  4M78 E;  1G2B A;  4DBF A;  5KE3 A;  2YXY A;  1IB8 A;  1VQO Q;  2VV5 A;  3OS0 A;  1X6G A;  3A8H B;  4FU6 A;  2ESW A;  5GJV B;  1RLQ C;  4PKC C;  1PSF A;  2HSE B;  4C8Q B;  1NYG A;  2GFU A;  3QPH A;  1YJW T;  3L42 A;  3NPF A;  2GF7 A;  5LJ5 e;  4NS5 A;  3HRS A;  4PLL A;  3VRY A;  1U8R A;  4PL6 A;  3ER0 A;  1PM3 A;  1VQ7 Q;  5DLQ E;  1LVK A;  4JJB A;  2XKO C;  2YUP A;  5IH2 A;  3OYF A;  3CPW S;  4M77 B;  4ZNX A;  5GAM j;  1Q7Y C;  3BY7 A;  3JSC A;  4HCC A;  2ZZD A;  2RK2 A;  1TU0 B;  1ZLM A;  4RTZ A;  4OB3 B;  3OSV A;  2DJZ A;  3A8M B;  2YHT A;  4M75 B;  2A3L A;  2RHU A;  2VWF A;  3I55 A;  3G4S A;  2K9G A;  2JS0 A;  1NEB A;  4ZN1 A;  4HT9 A;  3M59 A;  2DL7 A;  4VUB A;  4BDY A;  1UUE A;  3RNJ A;  2DL3 A;  1M2V A;  2GNC A;  2KEA A;  4E7J A;  1UGR B;  1TUD A;  2CZ0 B;  1GCQ A;  4QT7 A;  4JLI A;  1ACM B;  3REB B;  3TEE A;  1BU1 A;  1QVG A;  1O9S A;  2AKK A;  4C8Q D;  1BIB A;  3C12 A;  2W10 A;  5GAN h;  2X9H A;  2YSQ A;  2RK1 A;  3QZ5 B;  3TVT A;  1B7T A;  5L8R E;  4KGV B;  5LJ3 j;  2EW3 A;  1OOT A;  4E7L A;  1VQN A;  4BE1 A;  4XTW A;  2VGM A;  2Y4Y A;  3R6O A;  2X3W D;  2CSQ A;  2WSC E;  1WLP B;  4ELY C;  1SPK A;  2F2W A;  3EG9 B;  5CKH A;  2KSS A;  4ZTJ A;  4PNO A;  5GMK i;  2M0O A;  5GAO r;  2F2V A;  1HXD A;  3VV0 A;  1ZBJ A;  4M75 D;  2QQ9 A;  2H3J A;  1YJN T;  3HRT A;  2YRC A;  1H8K A;  2E5Q A;  1FWZ A;  3M0U A;  2LC4 A;  2FB7 A;  1YI2 A;  3FC3 A;  2OX7 A;  3GP8 A;  1D1C A;  2QGG A;  2KRS A;  3QG1 A;  4KUL A;  1WX6 A;  3ME9 A;  3UT1 A;  3CCJ A;  3GLX A;  1VQM T;  3MEA A;  3HRU A;  2QGF B;  5A0G A;  1U5S A;  2MF2 A;  2EQU A;  2LP5 A;  2EGA A;  4J6W A;  3A8O B;  2X4Y A;  4KRT A;  1RAF B;  1M1K U;  3ZL7 C;  1X75 C;  2HQE A;  1K9M R;  2LQ8 A;  2IVW A;  4DOV A;  1QWF A;  1Q7Y U;  1QQJ A;  4RMO A;  2QYZ A;  5KYY A;  1RAI B;  2IIM A;  1IO6 A;  4PJO G;  2A0F B;  4J6X A;  1VUB A;  4M7D A;  4MZP A;  1ZUY A;  4C92 C;  3S3N A;  3S3O A;  1RI9 A;  2DZ9 A;  4II1 A;  2CP6 A;  1YJ9 Q;  2E3H A;  1TUC A;  5HY6 A;  4BE0 A;  3CD6 T;  5CVI A;  2M1H A;  1W6X A;  5EC7 A;  1YIJ A;  4ELZ C;  4OGE A;  2O9S A;  1UJ0 A;  4MZM A;  3S3M A;  5GAO p;  3SWN A;  1YIT T;  1M27 C;  2NUP B;  1G3Y A;  4C92 G;  4EMG A;  8ATC B;  4J9D A;  2R57 A;  3HPW A;  2JUF A;  1VQ9 Q;  2QG9 B;  2GTJ A;  1YNZ A;  1OX8 A;  2D0N A;  3BW1 A;  3R6N A;  3X28 B;  4PJO E;  5I21 A;  1XJW B;  3CCM A;  1QVF P;  2M16 A;  2CUD A;  1ZUU A;  4GLM A;  2KVQ G;  1VQ6 T;  1WXU A;  2EFI A;  1BKB A;  1V1C A;  1OPK A;  2HBP A;  4CC4 B;  1BI1 A;  1HK9 A;  3PGG A;  1LOJ A;  1Y57 A;  2JXB A;  2L5Q A;  5FWB A;  3M4G A;  4QQ6 A;  3M0P A;  1E6G A;  2LCS A;  3VS7 A;  1WXT A;  2AKL A;  2COW A;  3M4Y A;  3GOX A;  4E7H A;  3X25 B;  3VS3 A;  4Y91 A;  2RI2 A;  2X4J A;  2VB6 A;  1AWX A;  4C92 E;  4LDU A;  1FMW A;  1IGQ A;  4PFZ A;  3QDR B;  1G83 A;  3C4S A;  4A4G A;  4DEX A;  2QTV A;  1Q82 R;  2CT3 A;  1JBM A;  3VS6 A;  5HCK A;  5KYX A;  1W2B P;  3OYI A;  1WHM A;  3GIB A;  2JZ2 A;  1VQ7 T;  4C8Q F;  1Y7X A;  4F7U A;  1M3C A;  3LGF A;  1E6H A;  2DXB A;  2M02 A;  1YHQ Q;  3UDC A;  3F70 A;  5IHN A;  2BUD A;  1M8M A;  5LJ5 f;  3CC7 Q;  1MMD A;  2XID A;  2XD0 A;  3JCM V;  1Q95 G;  1AHJ B;  1UHF A;  4M77 F;  2DIQ A;  4JRP A;  3RKX A;  2QA4 A;  1M1F A;  5GMK e;  2EQI A;  4OML A;  4MMK A;  4WCI A;  2V1Q A;  2DF6 A;  1ABQ A;  1EFN A;  1BBZ A;  3KBG A;  1VIF A;  1C6V X;  2EIF A;  4M75 F;  5LJ3 d;  4BY6 C;  1LPL A;  3EG1 A;  5IXB A;  3CC4 T;  3OYC A;  5GAM f;  5GMK l;  1VYT A;  2EQM A;  4F16 A;  4XK8 E;  1NZ9 A;  3PMT A;  2PZ1 A;  3DLM A;  3OYB A;  2RD1 A;  4FT4 A;  1VQL A;  1WXB A;  4LN2 A;  1D1B A;  3VS4 A;  2RNA A;  2KT8 A;  4RG2 A;  2MYS A;  2X35 A;  2FYK A;  4QKU A;  2DRK A;  3QYH B;  3PMI A;  4Z8A A;  2PU9 B;  4QQG A;  2PUO B;  1ZSZ C;  4RTV A;  2F2X A;  1OZ2 A;  1VQP Q;  4MML A;  2GGR A;  3VYG A;  3HHT B;  5HK0 A;  3CC2 A;  4M78 B;  4F04 B;  1PWT A;  3CCQ T;  4R56 A;  2E12 A;  4CI0 C;  3JCM e;  2GQI A;  1AVZ C;  2RHY A;  2EJG A;  1QVF A;  2LQK A;  4AFQ C;  2GCX A;  1MND A;  1MNE A;  3CXC P;  2ZPI B;  4M7A C;  1WYX A;  3DB4 A;  2EWN A;  4C5I A;  4OB2 B;  1PD0 A;  3CMA T;  1JU5 C;  1R8O B;  3PIO A;  1F1B B;  2ATC B;  1VQ8 Q;  3JCM b;  1G3T A;  4BI4 A;  1IXD A;  3QDF A;  4RKU E;  1Q82 C;  1MV0 B;  1LCK A;  1AOJ A;  4WF2 A;  2KRN A;  4M7A G;  1M5Q 1;  2DL8 A;  4ESR A;  3V8L A;  3VUB A;  3QSU A;  3EG2 A;  2P4R A;  4FIB A;  1OQK A;  2X51 A;  2EYW A;  4HXJ A;  1QVP A;  2VYT A;  2XHC A;  1YIT A;  3OYY A;  3HFN A;  4HA8 A;  4ZGJ B;  5CKE A;  3I56 Q;  1YWP A;  3WXM B;  2ED1 A;  1T3S A;  5KH6 A;  3EG9 A;  4M78 D;  3VKI A;  1I81 A;  3CCL Q;  3MO8 A;  3EGX B;  4JS5 A;  1VQ6 A;  1BIA A;  2HCK A;  2BZ8 A;  2KYM A;  2PVD B;  1N9R A;  5CKF A;  3L1A A;  4IUP A;  2KYB A;  2DYB A;  3CCU Q;  2RHI A;  2DRM A;  3EH2 A;  1VQO A;  4M7A E;  4PJN A;  2R58 A;  4J8O A;  3MHX A;  2CP0 A;  2EVR A;  1VQN T;  1WA7 A;  3FJ5 A;  1VA7 A;  5AYF A;  2XI9 A;  1V76 A;  1WPY A;  1EX4 A;  4IIM A;  2YRV A;  4EIK A;  3H0H A;  4QVC A;  1A0N B;  1SKU B;  1WHH A;  3VRZ A;  1GRI A;  3QZ9 B;  4IIO A;  3I9Q A;  5CKB A;  1GCQ C;  2W0Z A;  2FHD A;  3ASK A;  1PD1 A;  4JLG A;  1VQ7 A;  4RCC A;  1UEC A;  2DBM A;  3JRZ A;  4AFS C;  3CCR Q;  2HZY A;  2VAS A;  2FZC B;  1X2K A;  2LTO A;  5LJ3 g;  9ATC B;  1I8F A;  1SEM A;  2EQJ A;  3SHW A;  1YI2 T;  2L3P A;  1WHG A;  2E41 A;  2E3I A;  4PJL A;  3JCM X;  3RBB B;  2QEX Q;  4XU0 A;  1G5V A;  3BFM A;  1TWB A;  3O5Z A;  1OUL A;  4DBH A;  2XDB A;  1QWE A;  3OYL A;  4HKE A;  1KG1 A;  1Q82 U;  1JXO A;  4LDV A;  2NUP A;  2DPP B;  3CC4 A;  2RJC A;  3DB3 A;  1H64 1;  1LJO A;  3REA B;  3JCM c;  4IUV A;  1JRI A;  1KIK A;  4RTX A;  3A1P A;  2Y90 A;  3VU3 C;  3BE3 A;  1QP2 A;  1I1J A;  2LNH B;  1Q81 R;  4Z89 A;  3L2V A;  2K4Y A;  3JCM P;  4HCB A;  3VYH B;  4FYY B;  5IT9 E;  2DXT A;  5CCA A;  2FG0 A;  1LNX A;  1TTH B;  4A63 B;  4JJN K;  1RAC B;  2JJ9 A;  1W1F A;  3MP6 A;  4XU2 A;  4X9C A;  3OYA A;  2D1X A;  4JJD A;  3P8D A;  2OTL Q;  3OYK A;  4QQD A;  2A28 A;  3DLL A;  3CCQ A;  4O5V A;  1YWO A;  2ZGW A;  5HK3 A;  3TSW A;  3G6E Q;  5LJ5 j;  2DFU A;  2DTI A;  4M7D C;  3Q1J A;  4A54 A;  1JJ2 P;  1RAG B;  1KSW A;  3SD4 A;  3CCM T;  4PJO B;  3EAE A;  4AFZ C;  3OW2 P;  1UGV A;  4OMN A;  4N4G A;  2MAM A;  4FYW B;  2VUB A;  3OYM A;  1NM7 A;  3CMA A;  1WIE A;  4YTL A;  2QQB A;  1GBR A;  2CH4 A;  3QUI A;  4M7D G;  2FRW A;  3FIF A;  3EHQ A;  1XTD A;  2E64 A;  3SWN C;  2J6F A;  1OU9 A;  3E9G A;  1BCO A;  1X6O A;  3A8L B;  3MET A;  4M78 F;  4C92 B;  4LUD A;  3CCV T;  3PTA A;  2KE9 A;  3JV3 A;  2GQV A;  5CR2 A;  2KRM A;  5CK9 A;  5CQX A;  1SF9 A;  4J6Y A;  1K0X A;  3JCM f;  3KUF A;  2CDT A;  2ZPB B;  2DAQ A;  2RM4 A;  2XG8 D;  3V7C A;  1YJ9 A;  2E10 A;  2LT1 A;  2HL3 A;  2P0K A;  3V7S A;  5CAI A;  5LL6 S;  4JDS A;  1RLP C;  1OI1 A;  2EKO A;  3TRE A;  3OS2 A;  2NUT B;  1ZQ1 A;  1D3B B;  2C0O A;  4K11 A;  4PJO D;  1NJI R;  4A4H A;  2CT4 A;  3M53 A;  4M7D E;  3RIR A;  4FW2 A;  1MMN A;  3QWX X;  1WHL A;  2E6N A;  2QA4 T;  2BTT A;  4C0D C;  4EMK A;  4ZGE B;  2CZ6 B;  3QO3 A;  1VQ9 A;  2RJF A;  5GAN 4;  3M58 A;  2EKH A;  3GF5 A;  5GAN 3;  4A4F A;  3M55 A;  1BI2 A;  1M3A A;  5D6W A;  1PHT A;  2P0P A;  3OMG A;  4M77 D;  4M78 A;  2PVO B;  5J39 A;  2FRY A;  1HD3 A;  1NBE B;  1Y71 A;  3RDV A;  4B9X A;  2CRE A;  1YBY A;  3G7Z A;  4KH0 B;  2QQS A;  4C92 D;  1VQL T;  4JRI A;  2KY9 A;  4PLI A;  1Y96 A;  5EG2 A;  5KYW B;  3CME Q;  2E1H A;  5CKD A;  1VQK T;  1CSK A;  1D0Z A;  4JPB W;  2D0Q B;  2EYZ A;  4J9C A;  4LDY A;  3G71 Q;  5LJ3 e;  4F7U G;  1W70 A;  2RQV A;  4IKF A;  1PG5 B;  3OYG A;  4HCZ A;  2RJE A;  3QWY A;  1ARK A;  4XTU A;  2CP2 A;  3WVE B;  2DKG A;  3JB9 I;  3EGD B;  1B34 B;  1JB0 E;  3CC2 T;  3CCE T;  1RUW A;  1K1Z A;  2CSI A;  1M8V A;  2DNU A;  1KQS S;  1KQ1 A;  1JJ2 A;  2OTJ Q;  2KGT A;  2NLU A;  3OW2 A;  1YN8 A;  2DL4 A;  3CBM A;  5CIU A;  2G3R A;  2JMA A;  2F5T X;  2K3X A;  5FWC A;  3HP9 A;  4RCB A;  3M0R A;  3UF4 A;  4C5H A;  5KYN A;  1ZUK A;  1FYN A;  2E70 A;  4F7U E;  4X1V A;  3NTH A;  1PCX A;  3M54 A;  4IUR A;  4KGX B;  1WHJ A;  4DBQ A;  5FRN A;  3I55 Q;  3G4S Q;  1JQQ A;  3QBY A;  2K2M A;  2CUB A;  2DEU A;  2V8J A;  4OF1 A;  4HVU A;  1NYF A;  3VUZ A;  1TSF A;  2LJ3 A;  4C0F A;  3CPW P;  3J81 E;  3VJP A;  4DBR A;  5GAN f;  4BI3 A;  8AT1 B;  2LVM A;  2ZPG B;  2BZX A;  1UG1 A;  2AIR B;  4DA4 A;  6AT1 B;  2EGC A;  2FZG B;  2MOX A;  1NJI C;  2QQR A;  3BDU A;  5GAM h;  4LD9 K;  1ZSZ B;  4CRI A;  1KK7 A;  5GAO n;  2QK0 A;  5GAN 2;  2C06 A; 
#chains in the Genus database with same CATH homology
 2QA4 Q;  1S72 Q;  3CCQ Q;  1QVG P;  1VQ8 Q;  1VQL Q;  1VQ6 Q;  1Q7Y R;  1JJ2 P;  1YIJ Q;  1VQ5 Q;  3I56 Q;  3CC2 Q;  1VQ4 Q;  1YIT Q;  3CME Q;  3CCE Q;  2QEX Q;  3CCM Q;  3CPW P;  3CC4 Q;  3OW2 P;  3CCS Q;  3CCU Q;  1YJN Q;  1K73 R;  3CCJ Q;  1KD1 R;  1VQK Q;  1YJW Q;  1Q82 R;  1N8R R;  1YI2 Q;  1YJ9 Q;  1W2B P;  3CCL Q;  3CXC P;  1M90 R;  3CCR Q;  1K8A R;  1VQ9 Q;  2OTJ Q;  3CD6 Q;  2OTL Q;  3G71 Q;  3CCV Q;  1VQO Q;  1K9M R;  1VQN Q;  1KQS P;  3CC7 Q;  1Q81 R;  1VQP Q;  1VQ7 Q;  1Q86 R;  1NJI R;  3I55 Q;  3G4S Q;  3CMA Q;  1QVF P;  1KC8 R;  3G6E Q;  1M1K R;  1YHQ Q;  1VQM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...