1VQ8Q

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq8Q00
3CCVQ 1K8AR 3CC4Q 1VQ8Q 3CCRQ 3CCMQ 3CCSQ 1QVFP 3CCEQ 1S72Q 1VQKQ 1Q86R 3CMAQ 1VQLQ 1Q7YR 1KQSP 1KD1R 1VQ4Q 3G6EQ 1VQ6Q 1YJWQ 1K9MR 1YIJQ 1K73R 2QEXQ 3CMEQ 3CD6Q 3G4SQ 1VQOQ 1Q81R 2OTJQ 2QA4Q 3CXCP 1M1KR 1KC8R 3CCJQ 3CC2Q 3G71Q 3CC7Q 1VQPQ 1YJNQ 1Q82R 1N8RR 3CCQQ 1VQNQ 1JJ2P 1VQ5Q 3CCLQ 1W2BP 1YI2Q 1QVGP 3CPWP 1VQ9Q 3I55Q 1NJIR 1YITQ 1YJ9Q 1VQ7Q 2OTLQ 3I56Q 1YHQQ 1M90R 3CCUQ 3OW2P 1VQMQ
chains in the Genus database with same CATH superfamily
4A4FA 4DBHA 4RCBA 1YI2A 3SHWA 2RA2A 1YJ9A 2DF6A 2ZGWA 1I4K1 1GFDA 3OB9A 3REAB 5CKBA 3SFMA 4J5YA 4HKEA 4M77D 1QVFA 1QVGS 4C92F 1SSHA 3QWYA 4KH1B 5LJ5f 3WVEB 2HNIA 4PJOC 1SKUB 1U06A 3LLRA 2ATCB 2BE7D 1Y96A 4PLIA 3OS0A 1YN8A 2A0FB 3OYCA 1OEBA 2VWFA 4FCYA 2ABLA 1OYXA 4XTXA 2J6KA 3VS6A 4ELYC 1BYMA 2JOYA 1IREB 2DRKA 5IXFA 4J6XA 1YITQ 3M0RA 1VQ6T 5HK0A 1NEBA 4NS5A 1FWZA 1OU8A 4M78G 1Q81U 4JDSA 3CEYA 3CCRA 4O6JA 4F7UG 2DL5A 3WXMB 2RO0A 1SSFA 3M0PA 1BIBA 4MZMA 4HT8A 1E6GA 2HBPA 2JM9A 1VQ6A 4PFOA 2RI2A 3A98A 4XU3A 2CUBA 1RI0A 3JCMb 2RQUA 1WDXA 4KUDK 4FW1A 1X75C 2L3QA 2FEIA 1QVGA 5J39A 1TU0B 5KE2A 2PUKB 2KQWA 3NHNA 2XK0A 1EIFA 2NUPB 2ZZDA 1S72T 2XDBA 2WSCE 2M0OA 1I07A 3RMSA 3J81E 2DL3A 2BE9B 1SF9A 2KRNA 1MV0B 3CCMQ 8AT1B 3HP9A 4MMKA 1QKWA 1BI3A 3SEMA 2J7IA 2AK5A 2H3JA 3J80E 2K4YA 3VJPA 2XHCA 4PFPA 2M16A 1WFWA 3BY7A 4OP0A 5IN1A 1WHHA 2E5KA 2ZPBB 1OU9A 3X28B 1R77A 5GAMj 2AT1B 1VQKQ 4HCZA 3MP8A 1N6AA 3CCSA 2DXTA 2DA9A 4FSSA 1JXMA 4M75A 3MEWA 4FYYB 3P8HA 5C0MA 1I1JA 4M78B 1B34B 1WQWA 2OAUA 2HL5C 1JB0E 1EZZB 4F7UB 1JXOA 3G71A 1G8XA 3C95A 4C92G 1VQMQ 4GY5A 5IHKA 4PJOE 4JZ3A 4WCIA 2EYWA 5GAN4 2F2WA 1YJWQ 3I5SA 1RAIB 1M2VA 3DLMA 3OYNA 1ZBXA 3D7SB 3CBOA 3OW2S 1W4SA 5GAMh 3C94A 1VQNA 5GAOn 2RMOA 3CCLA 1K8AC 4MDXA 2DEQA 3NTIA 4C8QG 2F5TX 3CBPA 2YUOA 3EG1A 4L6V5 4HCCA 2EPDA 1PSEA 4HVVA 3A8LB 1RAGB 5LL6S 4QQGA 1G83A 4GLKA 2CH4A 1QLYA 2CKKA 3RDVA 5CK9A 2LVMA 4E2FB 2J06A 1I8FA 1LCKA 4IUTA 2OTLA 5KE3A 4J9BA 1X2KA 3V8JA 4E47A 3KBGA 5A0GA 2FZGB 3BE3A 5LJ5j 2COYA 3OMCA 1M90C 3X20B 1NEGA 3CCUQ 4OF1A 2HQHA 3SB2A 5D6XA 3R6NA 2FPDA 2QQAA 4C92B 3OW2A 4BUGA 1NE8A 4RTZA 3FEOA 3CD6Q 1XOVA 4C8QE 4QQ6A 2H3EB 3CC2Q 2MF2A 1QCFA 4OMQA 4OB1B 1TXQA 3JCMQ 2X51A 1P92A 3MEAA 2RHZA 3QKJA 2O9SA 5FLXE 2VYTA 2ECZA 5C6SA 3S3OA 2CP5A 4MMLA 5IT9E 3PVQA 1M3AA 4FW2A 1U3OA 3V7RA 5LJ5h 3JV3A 2HQXA 2QA4Q 2EGEA 4K11A 2FPEA 4GBQA 4LDVA 1ABQA 2RI3A 1K0XA 4M7AF 3VS2A 1UGPB 1M2OA 4EMKC 2XG8D 1XNIA 3OW2P 2GQIA 4E7IA 2EFIA 2VGNA 2DPPB 1VQ7A 2HMAA 2DYBA 2RJEA 4OVAA 3V8LA 3RR6A 2J05A 1HYOA 4F16A 4OMMA 3F70A 5GAMe 3M54A 4FIBA 1BI2A 2DXUA 4C0ZA 2HSPA 1ZSZB 2LDMA 1W1FA 4ZGEB 1YI2Q 1W6XA 4J9GA 4JLIA 4ZGDB 4M4ZA 1H3HA 2G3RA 4RTXA 1VYTA 3JCMh 3QJ6A 2VC8A 2Y4YA 4JRPA 2V8JA 3NPFA 1VYVA 3CMAQ 1H8KA 3CC4A 1K9MC 4XTZA 4JS5A 3CCVT 2VVKA 2PU9B 2JN0A 5GJVB 3LWIA 4OMOA 1UFFA 3SWNB 3ZFJA 4M75D 1ARKA 1G3YA 1FMKA 2CP6A 2P0QA 4XAXB 2E3HA 4N0AA 1K8AR 3NTHA 3ZEHA 3CCVA 2LTOA 1HD3A 2ZPIB 4RTTA 2CP3A 4Y91A 4J9FA 3QIIA 4PK4A 2PNIA 3NFCA 5DLOA 3OY9A 2R57A 4FYVB 1D1CA 4NOYA 3EGDA 1R0CB 1JBMA 2VUBA 3TEEA 3A8MB 4D8KA 2NYSA 5LJ3g 2F2XA 2PVDB 2X3XD 2NUTA 2A36A 2A3LA 2KYBA 2KE9A 3H0HA 4M77A 1YP5A 1D1AA 4J9IA 1VQ6Q 3DB3A 1Q82C 5I11A 1PD1A 4AFSC 1WXBA 1M1FA 3U23A 3DLLA 2RHUA 5GAOp 5LJ5e 1JEGA 3TSWA 3JB9J 4RTUA 1N9RA 1BK2A 1BKBA 1X6OA 2JW4A 2EQJA 3QSUA 1SHGA 1Y7XA 5LJ3d 2D9TA 2BZYA 3M53A 2MOXA 1VQ4A 2L89A 1LNXA 3C0CA 2NWMA 2XI9A 2CH4W 3QZ5B 4AG1C 2CT3A 4XK8E 2CZ0B 1YHQA 4ELZC 3GNGA 2HCKA 1S72Q 4X1VA 3LGFA 2ZCFB 2RHIA 3G1JA 3LH0A 1MUZA 1M3BA 3H9NA 4KT0E 3E19A 1M1KR 1HSQA 3CQTA 4J6YA 3JCMe 5KYXB 2QEXA 2RJCA 3M56A 4ORZA 4EMGA 1YIJT 2EGCA 7AT1B 2ROLA 4BY6B 1FYNA 5IHIA 1O75A 1AD5A 2RF0A 4LDWA 1AT1B 4ZTFA 2O9VA 1K73C 1IXDA 3M55A 2FPFA 3RKWA 1FMWA 2V8KA 2GFUA 4RMOA 1I5LA 1YIJA 2DEUA 1NJIR 5CKEA 3VS1A 1WZOA 1YJNA 1HXDA 4ANJA 3TCJA 1OULA 2DMOA 2KYMA 2DL7A 3RBBB 4DA4A 1OX9A 4HA8A 4Z89A 4MZTA 4DOWA 4F7UF 2CZ1B 4X34A 5J26A 4A54A 2HL3A 4E7HA 3NTKA 4JJDA 1YBYA 2JT4A 2HKNA 2DRMA 3CXCP 2YDLA 4LDXA 2GTJA 3LH5A 1N8RR 2EJ9A 4F17A 4A4GA 1PKSA 5CQYA 1VQOT 4HCBA 3CCJT 2JS0A 2O88A 5DM7R 2YLCA 1X6BA 4M7AB 2MWPA 4QVZA 3I56T 3M58A 4JRQA 4E7LA 3MP1A 2X9HA 1UGQB 3I9QA 5A0DA 4PJOF 3RKXA 2KVQG 2L0AA 4M75C 5IXBA 1VQ9A 3L2VA 1RABB 1OQKA 3EFSA 1D0XA 2MWOA 1V29B 1YJ9T 2HSEB 2JNGA 1R0BG 4LNPA 2L3RA 1RAHB 3A8OB 3X24B 2MCNA 2NUZA 1RL2A 2KGTA 1NPRA 4J7FA 1FMVA 1MHNA 2OTJA 3FC3A 1D09B 2GNCA 3EG9A 4XTUA 4BE0A 1JRIA 2QGGA 4QKUA 3X26B 3A8HB 2NLUA 5FU7C 4C0FA 1KD1C 2QQRA 4J8OA 1ACMB 4DOVA 3R6OA 5HY6A 3EG2A 4IURA 5KYUB 1KHCA 4E6RA 2O4XA 5EG2A 1K8AU 2XDPA 3HKSA 3EGXB 3RESA 4P5NA 2HD0A 1KSWA 3G4ST 1Y96B 2B8AA 2E41A 4FSXA 1WNLA 2VASA 1WJQA 4M7DA 2JTEA 4CC3A 4LUEA 4B9WA 1PRLC 4PL6A 2PVOB 1GRIA 5FRMA 2DNUA 3UA7A 4V2SA 3CCRT 2EVRA 2DIQA 5GMKj 3G4SA 1QW1A 3THKA 1Y57A 3VUZA 3H6ZA 1NZ9A 2QYZA 1Q95G 2JMCA 1KK7A 2CS7A 3QBYA 4C8QF 1QVFP 3I55T 1AVZC 3H41A 2IG0A 1TSFA 3OQ5A 1UB4A 1LPLA 2EKOA 2AHJB 2QASA 2EQKA 4MZPA 1K73R 2E3IA 4DBQA 3JSCA 1QQJA 2CSIA 1QP3A 1PKTA 3QYHB 5IHNA 2YRDA 2LP5A 3FRNA 1M8MA 3H8ZA 1OZ2A 2GF7A 1CKBA 3I55A 1NYGA 2DD5A 1Q7YC 1Q86C 3JB9D 5IAYA 4KULA 1UGVA 4GLMA 5CCAA 2CZ7B 2W0ZA 3ZL7C 1X43A 1OV3A 3EFOB 3BDLA 2D1XA 3OS5A 4PJOG 5FU6B 3CCVQ 2YLBA 4M75E 3CCQT 2A7YA 4C0DC 3MEUA 3OS1A 1M1KU 2KXCA 4LDUA 2K6DA 3OS2A 5KH6A 1KC8C 3CCST 3MPUB 2VB6A 3BFMA 2DO3A 1AZEA 1Z9ZA 1QVGP 2AZVA 4OB0B 3FLGA 5HKCA 1C0MA 3CCQA 3G71T 3ER0A 4TVRA 4J9EA 3TQ7P 3C12A 4D6WA 1X6GA 1OX8A 2QQSA 4E7ZA 1AOJA 1SRMA 2O2OA 1QP2A 1NJIU 4YTLA 3L2UA 2KAFA 3FJ5A 2BIVA 4A4KA 2F69A 3FDRA 1G3TA 1MMAA 1B07A 2FB7A 1VQ5A 1WHJA 2DTOA 1VQNT 1LJOA 2RK1A 3CCLT 2FRWA 2AIRB 3OYMA 3RNJA 1N8RU 2K3BA 1OPLA 4N0AC 1BIAA 3BDUA 1M4ZA 4ZTJA 4M7AD 4J9CA 3SDZA 4M78A 1B34A 1CKAA 1TUCA 1WXTA 3HL8A 4F7UA 2KMTA 1ZUKA 2RQTA 4UC4A 3KFVA 3HFNA 1M8VA 2COZA 2QDLA 2P84A 4PJOB 4J6WA 4RTWA 2BZXA 2OTLT 2XICA 2OJ2A 2C0TA 2C06A 4JRKA 1BI0A 3I5RA 3PIPA 1IB8A 3VS0A 4M77C 1VQPA 2ZAEA 4KUIA 1IO6A 2K5IA 2LX7A 1EFNA 1BBZA 4QVCA 2RQVA 2K9GA 1ZA1B 2FRYA 4CRIA 1QVPA 4FM4B 4IIMA 4M7DD 2AZSA 2AKKA 2MAMA 1YIJQ 2DZ9A 3KUFA 5GAN5 1JJ2S 2L5QA 4N4GA 5CKFA 4BI3A 2ED1A 2FVUA 3CPWS 1K76A 2LT4A 3VU3C 2HQEA 2L3PA 1GL5A 2CP7A 4LN2A 3L2ZA 5GAOq 2XMFA 3PE0A 1Q86R 3L1AA 2YRCA 3VS5A 1Q81C 4OB2B 3REBB 4BI4A 1KG1A 2LC4A 3A5ZB 4L5GA 2D6FA 2EYXA 1GXIE 4A63B 5FWBA 1HK9A 2COWA 1ZSGA 3CC7A 3P8DA 4QVDA 4OMNA 4RTYA 1PSFA 2YUQA 3S3MA 2IVWA 2RQWA 3VRZA 3EG3A 4RCCA 1ZA2B 1M3CA 1SHFA 1VQ7T 4C92A 2MMPA 1VQOQ 4KGXB 4NL2A 1K1ZA 1WPYA 3UT1A 3CCJQ 2W10A 4C8QB 2QTXA 3QG1A 4M77G 2IPOB 2K57A 3VYHB 3I56Q 1JJ2A 2GGRA 1K73U 4PJJA 3CPWA 1M1GA 1N9SA 1NBEB 1NG2A 4JJBA 1VA7A 5ECAA 4BD3A 4EIKA 3CC4T 1OI1A 1VQ8T 5LJ3f 2V1RA 1MMDA 5GANf 2EYQA 2I0NA 1UECA 4FT4A 2YRVA 2JS2A 1PWTA 1YJ9Q 1JU5C 2AKLA 1YITA 1SEMA 4XTWA 2M0YA 3OYAA 4F04B 2I2LA 5CKDA 3KXTA 1VQ8A 2KI7A 2YT6A 3MEVA 3UA6A 3CPWP 3GF5A 1UG1A 2K3YA 5KYYA 1ZSZA 4E7JA 2GFAA 2R5MA 4M77E 2RPNA 2E6ZA 2GCXA 5KCHA 4EMHA 1WHGA 3UF4A 3H0FA 2FG0A 3EHRA 2RJFA 1YCYA 3QUIA 2CUDA 1D1BA 4OGEA 2B86A 1G5VA 1U1TA 4N4IA 3OYEA 2J6OA 3SWNA 1R8OB 1WLPB 4M78D 2CGHA 5GANg 1VUBA 3CCRQ 2LQKA 1KQSS 2XDDA 2A28A 2GTOA 2VV5A 3CCMA 3G7ZA 4XQ3A 2DIGA 3VS3A 3GP8A 1W2BS 1ABOA 2H8HA 1LVKA 1RLQC 3I55Q 2KROA 3VS7A 2L3SA 4KGVB 1VQ4T 1M90R 4D8DA 4HCKA 1TUGB 1GCQA 4Z88A 1LOJA 2C0IA 2FHDA 3L42A 3VUBA 1U1SA 2DD4A 2PZ1A 1YHQT 5I21A 1X2QA 4AFZC 4BDYA 5GANd 4AT1B 2ZPGB 5KYWB 3X25B 2K5FA 4M7DC 9ATCB 1NM7A 1YWOA 1D3BB 2QEXT 2D8JA 2OI3A 3LW5E 1I0CA 2E6NA 2V8IA 2KT1A 3OYJA 2LZ6B 4FYXB 3HTRA 2LQWA 3C4SA 2FZKB 4J9HA 4L59A 4VUBA 2KK4A 3L2QA 3E2UA 3FIFA 1G3WA 3CCQQ 3JCMV 1YJWA 4RKUE 1A0NB 1KQSA 4A4EA 3SD4A 3CBMA 4XU2A 4Q5WA 1YJNT 3CCSQ 5EC7A 1W2BA 4EMKB 2MPXC 4DEYA 4Z02A 1PG5B 3MJXA 4JJCA 3PMIA 3LYIA 5D6YA 2G6FX 4II1A 1IZ6A 1W70A 3A8GB 1AWXA 3G71Q 2K7AA 2SRCA 3V8KA 2DBKA 4C92D 4M75F 3Q1JA 1YNZA 3JCMJ 5KYXA 2CSQA 3CMET 2E1HA 4PJNA 1Q7YU 1Q86U 5DLQE 2QG9B 2V1QA 2WACA 1T3SA 3N5BB 2HBWA 4QT7A 1WJRA 2XU8A 3CCUT 4QQDA 1K9MR 1PM3A 4ZGJB 2YUPA 2QAZA 1VQNQ 2LJ0A 2VXFA 1HJDA 3CCLQ 1J3TA 3CMEA 5GAOm 3PIOA 3I35A 1SG5A 1UJYA 2RHXA 3FJPA 2M51A 4C8QD 4BB7A 3CCUA 3JB9H 1VQ9T 5CAIA 1VYUA 1F1BB 5LJ3j 1AHJB 4OGCA 5AYFA 4BE2A 5GANj 3EAEA 3MCAB 3ASKA 3RKYA 1UE9A 2QDYB 4A4HA 1G3SA 2YHTA 1O9SA 1BI1A 3LX7A 3CD6A 1WHLA 4FL6A 4AFQC 3CC2A 2OTLQ 1TUDA 1WX6A 2OTJT 1UHFA 1XJWB 3VV0A 3QJYA 1VOMA 2LCSA 3OYGA 2CYZB 2CP0A 4M7AA 2O01E 2ZPHB 4J83A 3NMZC 2EKHA 4X9DA 2WSFE 1Q82R 4IUQA 1AWJA 2EAYA 4JJNK 4M7DE 1UUEA 1WGSA 2QA4A 2XIDA 3NGPA 3OYDA 4RG8A 2P4TA 4R0KA 2F2VA 1GFCA 5LJ3h 4CC4B 3OYYA 5GANh 1C6VX 3M57A 2VKNA 5A0LA 4M78C 1Z9QA 1VIFA 3HSBA 2KSSA 3M0SA 4AFUC 2YXYA 4EPCA 2DJQA 2DILA 1U8RA 1S1NA 3LGLA 4MDWA 4PFZA 3PFSA 3MO8A 3QHSA 5GAMg 1RADB 3M59A 1V1CA 3MKDA 1K0SA 2RJDA 3IQLA 4JRIA 1X69A 1SRLA 4XU1A 3QO3A 5CKHA 3V7SA 2K2VA 1UDLA 2ED0A 5GAN7 3HPWA 4CC2A 3CMAA 2GBQA 3JCMc 2LQ8A 5KYUA 3M9QA 3TU4K 6AT1B 3TREA 4HVUA 2YWWA 1VQ7Q 3M0UA 4M75G 3S6WA 2EYZA 3EGXA 5FW9A 4BI8B 2K2MA 4RTVA 4O5VA 5GAMd 2MIOA 3M4GA 2X4JA 1RAEB 1D0YA 4OMLA 5GMKm 1M9SA 1M90U 1QWEA 2X35A 5CIUA 2DE0X 3CC4Q 2DAQA 1VQ8Q 3HRSA 2E4HA 4DEXA 1K4US 2EQUA 4KGZB 5IH2A 3PTAA 4LXCA 3P8BB 2E10A 1N27A 4ZNXA 1AWOA 4XU0A 5GMKh 3JCMf 2L8DA 8ATCB 5GJWB 3PT9A 1VQLT 1WA7A 1M30A 3TVTA 2KDSA 1I5OB 4C92C 1H92A 2DBMA 4KRTA 1IGUA 5I2MA 1T0HA 1TG0A 5GAOr 3GNFB 3JB9I 3S3NA 1RAFB 4QW2A 1MNDA 1M5Q1 1Y71A 5LJ5g 5AT1B 3PMTA 5L23A 4ZN1A 3T9NA 1YFNA 1YWPA 4AMCA 1GCPA 3HRUA 4E7SA 1ZBJA 2X3WD 1VQLA 5LJ3e 4R56A 2LCCA 5GANe 1KFZA 2NUPA 2DVJA 2HDAA 3OYHA 5HK3A 5GAN8 4XTYA 3EFOA 3OYLA 1B3QA 3EG0A 1ZLMA 2RN8A 1UTIA 3M0QA 1VQ5T 4M75B 2K5LA 2JTFA 2RNAA 4PLLA 4M78E 4LD9K 1RACB 4C8QC 1CSKA 1S72A 3RMQA 4WTOB 1UEBA 2EJFA 4F7UE 4M77F 5LJ5d 4DBFA 1T3LA 2RQRA 4RG2A 3G6ET 1TH7A 1MNEA 2DETA 4XTVA 3VRYA 4B6MA 3GIBA 4HXJA 1T0JA 3JCMg 2FYKA 3HFOA 1K9MU 1YCSB 1E7OA 2RM4A 1ZQ1A 1KD1R 3INZA 1VQ4Q 2YSQA 1M2VB 1ZSZC 4IUVA 3LWHA 5FU7B 1KQ1A 3QDRB 3EH2A 4C0GA 2E70A 2QK0A 3VS4A 3G6EA 3HRTA 2CT4A 1FX7A 1NLOC 4NL3A 1YHQQ 1EX4A 3TSZA 2J6FA 3JCMW 1VQPT 2RH2A 1QWFA 1AWWA 2KRMA 3L2RA 2DXCA 3EGUA 3EHQA 2QQ9A 5FRNA 2D0QB 2LNVA 5L8RE 3SWNC 5FWCA 2QEXQ 3JCMd 1UHCA 3OYFA 4IIOA 4LD6A 5GAOl 3PVLA 4IKFA 2HEQA 2Y4XA 2DZCA 5I22A 2ESWA 5GMKe 3EH1A 1IGQA 3V7CA 3BW1A 1M27C 3JB9F 1Q82U 1FXXA 2P0KA 1ZX6A 2EGAA 4PJOA 3DKMA 1KHIA 3MHXA 1QKXA 1YJNQ 3CCET 1GCQC 2DL4A 1H641 1AZGB 2F5KA 4Y28E 1XTDA 2BTTA 2FZCB 4C92E 3CC7T 2ZPFB 4JPBW 5HCKA 1Y07A 2M02A 2RK2A 2BZ8A 1Q7YR 2LNHB 3CMEQ 2EIFA 4B9XA 3CCEA 3WVDB 4X9CA 2DERA 1MV3A 1PHTA 3OBYA 1OZ3A 2PVGB 5D6WA 2DXBA 3PGGA 5DY9A 2DKGA 3ME9A 4C5HA 2CREA 2P0PA 1SPKA 2OAWA 4KH0B 1UGRB 4JLGA 1AEYA 4C0DB 1RAAB 1KC8R 2LX9A 4JUVA 2DVEA 1VQ9Q 3AHUA 3QXEB 2ENMA 2X4XA 4Y92A 5FROA 1BCOA 2EQMA 2JM8A 1X01A 2XKOC 2MK5A 4LUDA 3O8VA 1YITT 3J7AF 4PJMA 4LE9A 4J7IA 3EFRA 3AT1B 1M1KC 2OTJQ 2LT1A 4OB3B 1C1AA 4C5GA 3ULRB 2DLPA 1B7TA 2PTKA 4BY6C 2DFUA 2KBTA 2LJ1A 1OOTA 4C8QA 2EYYA 4ATOA 1MGQA 5KCOA 2O31A 4BDZA 1VIEA 2CZ6B 4JS4A 1Y0MA 1WQ7A 5GMKl 1PC0A 1WIEA 2M1HA 2EW3A 3URGA 2E12A 5J3BA 5I2SA 5KYYB 1RLPC 2E64A 4DQ2A 1JJ2P 4CI0C 1NJIC 1D0ZA 4DBRA 3OYBA 5M9OA 2Z0WA 2BKDN 1KIKA 3JRZA 3META 1K9AA 3UATA 1JQQA 4M7DF 3MP6A 1QMCA 1IHWA 2C0OA 1TWBA 3QZ9B 3G4SQ 3JB9G 1N8RC 1KQ2A 4Z8AA 3CCMT 3EGDB 1BB9A 3OSVA 4ME7A 4BE1A 2HZYA 4PKCC 2DTHA 2NUTB 2FL7A 2HAXA 3OYKA 4M7AC 1PNJA 1PCXA 2Y90A 2K79A 4M77B 3GOXA 2DK3A 3PNWC 2QGFB 3QYGB 4R55A 2KRSA 5GAN6 1KJWA 2A08A 2LMJA 3FB9A 5CVIA 1VQKT 2KXDA 2RB6A 2OX7A 4ESRA 4HT9A 2LCLA 1KD1U 2F1LA 2RI5A 4IUPA 1PRMC 3ZBDA 4WF2A 1E6HA 4KBMB 2MYSA 3CXCS 4N4HA 1RUWA 1VQMT 4C5EA 2QQBA 2RD1A 2ROTA 1Q81R 1VQKA 3DB4A 2X4WA 3QPHA 4FU6A 1IHVA 4PJOD 2D8HA 2EQIA 2JXBA 4E7KA 1BCMA 3HHTB 1YJWT 1ZUYA 2VXEA 5GMKi 2XD0A 2QI2A 4CC7A 2BUDA 1X27A 2RHYA 1GBQA 4OMFB 2JMAA 1TOVA 1VQMA 1VQLQ 3GBQA 1ZUUA 2LJ3A 2CDTA 4F14A 2KEAA 2EJGA 4AG2C 3OA6A 3RUXA 2KNBB 4JZ4A 1TS9A 1WJSA 1OPKA 2ZPEB 5KYWA 3E9FA 1V76A 1WXUA 3L2WA 4M7AG 1QCNA 2YUNA 2DM1A 1WHKA 2R5AA 3E1SA 1DJ7B 1D3BA 2M9UA 4BACA 3H0IA 5GAN3 4IUUA 1QCOA 3M0TA 2WSEE 3VYGA 4EDUA 3QDFA 1NPPA 1RI9A 2IIMA 4FYWB 3UDCA 2K3XA 3RIRA 1VQ5Q 2L2PA 1BU1A 4PNOA 2JVVA 3M5AA 3CXCA 3O5ZA 2EBPA 2QXFA 1N5ZA 1IRXA 3M4YA 3GLXA 1TTHB 1KQSP 2KY9A 4EMKA 3G6EQ 1NLPC 1MMNA 1GBRA 2MI6A 2A37A 2PUOB 4OMPA 4M7DG 2JJ9A 1ZHIA 2DTIA 2QTVA 1W2BP 2VGMA 5GAN2 3CD6T 4ZN3A 4M78F 4J9DA 3CC2T 1U5SA 4M7AE 2DYIA 3UWNA 3VKIA 3JAME 2KR3A 1NYFA 5CR2A 1KC8U 1MMGA 4FT2A 2LQNA 5CQXA 2SEMA 1WHMA 5GAMf 4LDYA 5CO7A 1G2BA 1XQHA 1VQPQ 1JO8A 2LRQA 3JCMX 5FU6C 1WYXA 2DJZA 3OYIA 3OMGA 2DX1A 2JZ2A 1H3ZA 3OSSC 2QA4T 1QVFS 2KT8A 2E5QA 1UJ0A 1WI7A 2PQWA 4C5IA 1I81A 4RUGA 2CP2A 2X4YA 3UPUA 2E65A 4HVWA 1VQOA 3EG9B 3CCJA 3GPLA 2P4RA 2JTMA 4A53A 5A2QE 3QWXX 2R58A 2EWNA 2JUFA 2D0NA 3CPFA 5KYNA 3I56A 3CCEQ 1YI2T 3A1PA 1UGSB 1PD0A 5D7UA 2O4XB 3OBWA 4PJLA 3JCMP 2GQVA 3CC7Q 2FO0A 2HKQB 3CMAT 2V26A 3E9GA 3RERA 4M7DB 2DL8A
chains in the Genus database with same CATH topology
3CCVQ 1K8AR 3CC4Q 1VQ8Q 3CCRQ 3CCMQ 3CCSQ 1QVFP 3CCEQ 1S72Q 1VQKQ 1Q86R 3CMAQ 1VQLQ 1Q7YR 1KQSP 1KD1R 1VQ4Q 3G6EQ 1VQ6Q 1YJWQ 1K9MR 1YIJQ 1K73R 2QEXQ 3CMEQ 3CD6Q 3G4SQ 1VQOQ 1Q81R 2OTJQ 2QA4Q 3CXCP 1M1KR 1KC8R 3CCJQ 3CC2Q 3G71Q 3CC7Q 1VQPQ 1YJNQ 1Q82R 1N8RR 3CCQQ 1VQNQ 1JJ2P 1VQ5Q 3CCLQ 1W2BP 1YI2Q 1QVGP 3CPWP 1VQ9Q 3I55Q 1NJIR 1YITQ 1YJ9Q 1VQ7Q 2OTLQ 3I56Q 1YHQQ 1M90R 3CCUQ 3OW2P 1VQMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV Q;  1K8A R;  3CC4 Q;  1VQ8 Q;  3CCR Q;  3CCM Q;  3CCS Q;  1QVF P;  3CCE Q;  1S72 Q;  1VQK Q;  1Q86 R;  3CMA Q;  1VQL Q;  1Q7Y R;  1KQS P;  1KD1 R;  1VQ4 Q;  3G6E Q;  1VQ6 Q;  1YJW Q;  1K9M R;  1YIJ Q;  1K73 R;  2QEX Q;  3CME Q;  3CD6 Q;  3G4S Q;  1VQO Q;  1Q81 R;  2OTJ Q;  2QA4 Q;  3CXC P;  1M1K R;  1KC8 R;  3CCJ Q;  3CC2 Q;  3G71 Q;  3CC7 Q;  1VQP Q;  1YJN Q;  1Q82 R;  1N8R R;  3CCQ Q;  1VQN Q;  1JJ2 P;  1VQ5 Q;  3CCL Q;  1W2B P;  1YI2 Q;  1QVG P;  3CPW P;  1VQ9 Q;  3I55 Q;  1NJI R;  1YIT Q;  1YJ9 Q;  1VQ7 Q;  2OTL Q;  3I56 Q;  1YHQ Q;  1M90 R;  3CCU Q;  3OW2 P;  1VQM Q; 
#chains in the Genus database with same CATH topology
 4A4F A;  4DBH A;  4RCB A;  1YI2 A;  3SHW A;  2RA2 A;  1YJ9 A;  2DF6 A;  2ZGW A;  1I4K 1;  1GFD A;  3OB9 A;  3REA B;  5CKB A;  3SFM A;  4J5Y A;  4HKE A;  4M77 D;  1QVF A;  1QVG S;  4C92 F;  1SSH A;  3QWY A;  4KH1 B;  5LJ5 f;  3WVE B;  2HNI A;  4PJO C;  1SKU B;  1U06 A;  3LLR A;  2ATC B;  2BE7 D;  1Y96 A;  4PLI A;  3OS0 A;  1YN8 A;  2A0F B;  3OYC A;  1OEB A;  2VWF A;  4FCY A;  2ABL A;  1OYX A;  4XTX A;  2J6K A;  3VS6 A;  4ELY C;  1BYM A;  2JOY A;  1IRE B;  2DRK A;  5IXF A;  4J6X A;  1YIT Q;  3M0R A;  1VQ6 T;  5HK0 A;  1NEB A;  4NS5 A;  1FWZ A;  1OU8 A;  4M78 G;  1Q81 U;  4JDS A;  3CEY A;  3CCR A;  4O6J A;  4F7U G;  2DL5 A;  3WXM B;  2RO0 A;  1SSF A;  3M0P A;  1BIB A;  4MZM A;  4HT8 A;  1E6G A;  2HBP A;  2JM9 A;  1VQ6 A;  4PFO A;  2RI2 A;  3A98 A;  4XU3 A;  2CUB A;  1RI0 A;  3JCM b;  2RQU A;  1WDX A;  4KUD K;  4FW1 A;  1X75 C;  2L3Q A;  2FEI A;  1QVG A;  5J39 A;  1TU0 B;  5KE2 A;  2PUK B;  2KQW A;  3NHN A;  2XK0 A;  1EIF A;  2NUP B;  2ZZD A;  1S72 T;  2XDB A;  2WSC E;  2M0O A;  1I07 A;  3RMS A;  3J81 E;  2DL3 A;  2BE9 B;  1SF9 A;  2KRN A;  1MV0 B;  3CCM Q;  8AT1 B;  3HP9 A;  4MMK A;  1QKW A;  1BI3 A;  3SEM A;  2J7I A;  2AK5 A;  2H3J A;  3J80 E;  2K4Y A;  3VJP A;  2XHC A;  4PFP A;  2M16 A;  1WFW A;  3BY7 A;  4OP0 A;  5IN1 A;  1WHH A;  2E5K A;  2ZPB B;  1OU9 A;  3X28 B;  1R77 A;  5GAM j;  2AT1 B;  1VQK Q;  4HCZ A;  3MP8 A;  1N6A A;  3CCS A;  2DXT A;  2DA9 A;  4FSS A;  1JXM A;  4M75 A;  3MEW A;  4FYY B;  3P8H A;  5C0M A;  1I1J A;  4M78 B;  1B34 B;  1WQW A;  2OAU A;  2HL5 C;  1JB0 E;  1EZZ B;  4F7U B;  1JXO A;  3G71 A;  1G8X A;  3C95 A;  4C92 G;  1VQM Q;  4GY5 A;  5IHK A;  4PJO E;  4JZ3 A;  4WCI A;  2EYW A;  5GAN 4;  2F2W A;  1YJW Q;  3I5S A;  1RAI B;  1M2V A;  3DLM A;  3OYN A;  1ZBX A;  3D7S B;  3CBO A;  3OW2 S;  1W4S A;  5GAM h;  3C94 A;  1VQN A;  5GAO n;  2RMO A;  3CCL A;  1K8A C;  4MDX A;  2DEQ A;  3NTI A;  4C8Q G;  2F5T X;  3CBP A;  2YUO A;  3EG1 A;  4L6V 5;  4HCC A;  2EPD A;  1PSE A;  4HVV A;  3A8L B;  1RAG B;  5LL6 S;  4QQG A;  1G83 A;  4GLK A;  2CH4 A;  1QLY A;  2CKK A;  3RDV A;  5CK9 A;  2LVM A;  4E2F B;  2J06 A;  1I8F A;  1LCK A;  4IUT A;  2OTL A;  5KE3 A;  4J9B A;  1X2K A;  3V8J A;  4E47 A;  3KBG A;  5A0G A;  2FZG B;  3BE3 A;  5LJ5 j;  2COY A;  3OMC A;  1M90 C;  3X20 B;  1NEG A;  3CCU Q;  4OF1 A;  2HQH A;  3SB2 A;  5D6X A;  3R6N A;  2FPD A;  2QQA A;  4C92 B;  3OW2 A;  4BUG A;  1NE8 A;  4RTZ A;  3FEO A;  3CD6 Q;  1XOV A;  4C8Q E;  4QQ6 A;  2H3E B;  3CC2 Q;  2MF2 A;  1QCF A;  4OMQ A;  4OB1 B;  1TXQ A;  3JCM Q;  2X51 A;  1P92 A;  3MEA A;  2RHZ A;  3QKJ A;  2O9S A;  5FLX E;  2VYT A;  2ECZ A;  5C6S A;  3S3O A;  2CP5 A;  4MML A;  5IT9 E;  3PVQ A;  1M3A A;  4FW2 A;  1U3O A;  3V7R A;  5LJ5 h;  3JV3 A;  2HQX A;  2QA4 Q;  2EGE A;  4K11 A;  2FPE A;  4GBQ A;  4LDV A;  1ABQ A;  2RI3 A;  1K0X A;  4M7A F;  3VS2 A;  1UGP B;  1M2O A;  4EMK C;  2XG8 D;  1XNI A;  3OW2 P;  2GQI A;  4E7I A;  2EFI A;  2VGN A;  2DPP B;  1VQ7 A;  2HMA A;  2DYB A;  2RJE A;  4OVA A;  3V8L A;  3RR6 A;  2J05 A;  1HYO A;  4F16 A;  4OMM A;  3F70 A;  5GAM e;  3M54 A;  4FIB A;  1BI2 A;  2DXU A;  4C0Z A;  2HSP A;  1ZSZ B;  2LDM A;  1W1F A;  4ZGE B;  1YI2 Q;  1W6X A;  4J9G A;  4JLI A;  4ZGD B;  4M4Z A;  1H3H A;  2G3R A;  4RTX A;  1VYT A;  3JCM h;  3QJ6 A;  2VC8 A;  2Y4Y A;  4JRP A;  2V8J A;  3NPF A;  1VYV A;  3CMA Q;  1H8K A;  3CC4 A;  1K9M C;  4XTZ A;  4JS5 A;  3CCV T;  2VVK A;  2PU9 B;  2JN0 A;  5GJV B;  3LWI A;  4OMO A;  1UFF A;  3SWN B;  3ZFJ A;  4M75 D;  1ARK A;  1G3Y A;  1FMK A;  2CP6 A;  2P0Q A;  4XAX B;  2E3H A;  4N0A A;  1K8A R;  3NTH A;  3ZEH A;  3CCV A;  2LTO A;  1HD3 A;  2ZPI B;  4RTT A;  2CP3 A;  4Y91 A;  4J9F A;  3QII A;  4PK4 A;  2PNI A;  3NFC A;  5DLO A;  3OY9 A;  2R57 A;  4FYV B;  1D1C A;  4NOY A;  3EGD A;  1R0C B;  1JBM A;  2VUB A;  3TEE A;  3A8M B;  4D8K A;  2NYS A;  5LJ3 g;  2F2X A;  2PVD B;  2X3X D;  2NUT A;  2A36 A;  2A3L A;  2KYB A;  2KE9 A;  3H0H A;  4M77 A;  1YP5 A;  1D1A A;  4J9I A;  1VQ6 Q;  3DB3 A;  1Q82 C;  5I11 A;  1PD1 A;  4AFS C;  1WXB A;  1M1F A;  3U23 A;  3DLL A;  2RHU A;  5GAO p;  5LJ5 e;  1JEG A;  3TSW A;  3JB9 J;  4RTU A;  1N9R A;  1BK2 A;  1BKB A;  1X6O A;  2JW4 A;  2EQJ A;  3QSU A;  1SHG A;  1Y7X A;  5LJ3 d;  2D9T A;  2BZY A;  3M53 A;  2MOX A;  1VQ4 A;  2L89 A;  1LNX A;  3C0C A;  2NWM A;  2XI9 A;  2CH4 W;  3QZ5 B;  4AG1 C;  2CT3 A;  4XK8 E;  2CZ0 B;  1YHQ A;  4ELZ C;  3GNG A;  2HCK A;  1S72 Q;  4X1V A;  3LGF A;  2ZCF B;  2RHI A;  3G1J A;  3LH0 A;  1MUZ A;  1M3B A;  3H9N A;  4KT0 E;  3E19 A;  1M1K R;  1HSQ A;  3CQT A;  4J6Y A;  3JCM e;  5KYX B;  2QEX A;  2RJC A;  3M56 A;  4ORZ A;  4EMG A;  1YIJ T;  2EGC A;  7AT1 B;  2ROL A;  4BY6 B;  1FYN A;  5IHI A;  1O75 A;  1AD5 A;  2RF0 A;  4LDW A;  1AT1 B;  4ZTF A;  2O9V A;  1K73 C;  1IXD A;  3M55 A;  2FPF A;  3RKW A;  1FMW A;  2V8K A;  2GFU A;  4RMO A;  1I5L A;  1YIJ A;  2DEU A;  1NJI R;  5CKE A;  3VS1 A;  1WZO A;  1YJN A;  1HXD A;  4ANJ A;  3TCJ A;  1OUL A;  2DMO A;  2KYM A;  2DL7 A;  3RBB B;  4DA4 A;  1OX9 A;  4HA8 A;  4Z89 A;  4MZT A;  4DOW A;  4F7U F;  2CZ1 B;  4X34 A;  5J26 A;  4A54 A;  2HL3 A;  4E7H A;  3NTK A;  4JJD A;  1YBY A;  2JT4 A;  2HKN A;  2DRM A;  3CXC P;  2YDL A;  4LDX A;  2GTJ A;  3LH5 A;  1N8R R;  2EJ9 A;  4F17 A;  4A4G A;  1PKS A;  5CQY A;  1VQO T;  4HCB A;  3CCJ T;  2JS0 A;  2O88 A;  5DM7 R;  2YLC A;  1X6B A;  4M7A B;  2MWP A;  4QVZ A;  3I56 T;  3M58 A;  4JRQ A;  4E7L A;  3MP1 A;  2X9H A;  1UGQ B;  3I9Q A;  5A0D A;  4PJO F;  3RKX A;  2KVQ G;  2L0A A;  4M75 C;  5IXB A;  1VQ9 A;  3L2V A;  1RAB B;  1OQK A;  3EFS A;  1D0X A;  2MWO A;  1V29 B;  1YJ9 T;  2HSE B;  2JNG A;  1R0B G;  4LNP A;  2L3R A;  1RAH B;  3A8O B;  3X24 B;  2MCN A;  2NUZ A;  1RL2 A;  2KGT A;  1NPR A;  4J7F A;  1FMV A;  1MHN A;  2OTJ A;  3FC3 A;  1D09 B;  2GNC A;  3EG9 A;  4XTU A;  4BE0 A;  1JRI A;  2QGG A;  4QKU A;  3X26 B;  3A8H B;  2NLU A;  5FU7 C;  4C0F A;  1KD1 C;  2QQR A;  4J8O A;  1ACM B;  4DOV A;  3R6O A;  5HY6 A;  3EG2 A;  4IUR A;  5KYU B;  1KHC A;  4E6R A;  2O4X A;  5EG2 A;  1K8A U;  2XDP A;  3HKS A;  3EGX B;  3RES A;  4P5N A;  2HD0 A;  1KSW A;  3G4S T;  1Y96 B;  2B8A A;  2E41 A;  4FSX A;  1WNL A;  2VAS A;  1WJQ A;  4M7D A;  2JTE A;  4CC3 A;  4LUE A;  4B9W A;  1PRL C;  4PL6 A;  2PVO B;  1GRI A;  5FRM A;  2DNU A;  3UA7 A;  4V2S A;  3CCR T;  2EVR A;  2DIQ A;  5GMK j;  3G4S A;  1QW1 A;  3THK A;  1Y57 A;  3VUZ A;  3H6Z A;  1NZ9 A;  2QYZ A;  1Q95 G;  2JMC A;  1KK7 A;  2CS7 A;  3QBY A;  4C8Q F;  1QVF P;  3I55 T;  1AVZ C;  3H41 A;  2IG0 A;  1TSF A;  3OQ5 A;  1UB4 A;  1LPL A;  2EKO A;  2AHJ B;  2QAS A;  2EQK A;  4MZP A;  1K73 R;  2E3I A;  4DBQ A;  3JSC A;  1QQJ A;  2CSI A;  1QP3 A;  1PKT A;  3QYH B;  5IHN A;  2YRD A;  2LP5 A;  3FRN A;  1M8M A;  3H8Z A;  1OZ2 A;  2GF7 A;  1CKB A;  3I55 A;  1NYG A;  2DD5 A;  1Q7Y C;  1Q86 C;  3JB9 D;  5IAY A;  4KUL A;  1UGV A;  4GLM A;  5CCA A;  2CZ7 B;  2W0Z A;  3ZL7 C;  1X43 A;  1OV3 A;  3EFO B;  3BDL A;  2D1X A;  3OS5 A;  4PJO G;  5FU6 B;  3CCV Q;  2YLB A;  4M75 E;  3CCQ T;  2A7Y A;  4C0D C;  3MEU A;  3OS1 A;  1M1K U;  2KXC A;  4LDU A;  2K6D A;  3OS2 A;  5KH6 A;  1KC8 C;  3CCS T;  3MPU B;  2VB6 A;  3BFM A;  2DO3 A;  1AZE A;  1Z9Z A;  1QVG P;  2AZV A;  4OB0 B;  3FLG A;  5HKC A;  1C0M A;  3CCQ A;  3G71 T;  3ER0 A;  4TVR A;  4J9E A;  3TQ7 P;  3C12 A;  4D6W A;  1X6G A;  1OX8 A;  2QQS A;  4E7Z A;  1AOJ A;  1SRM A;  2O2O A;  1QP2 A;  1NJI U;  4YTL A;  3L2U A;  2KAF A;  3FJ5 A;  2BIV A;  4A4K A;  2F69 A;  3FDR A;  1G3T A;  1MMA A;  1B07 A;  2FB7 A;  1VQ5 A;  1WHJ A;  2DTO A;  1VQN T;  1LJO A;  2RK1 A;  3CCL T;  2FRW A;  2AIR B;  3OYM A;  3RNJ A;  1N8R U;  2K3B A;  1OPL A;  4N0A C;  1BIA A;  3BDU A;  1M4Z A;  4ZTJ A;  4M7A D;  4J9C A;  3SDZ A;  4M78 A;  1B34 A;  1CKA A;  1TUC A;  1WXT A;  3HL8 A;  4F7U A;  2KMT A;  1ZUK A;  2RQT A;  4UC4 A;  3KFV A;  3HFN A;  1M8V A;  2COZ A;  2QDL A;  2P84 A;  4PJO B;  4J6W A;  4RTW A;  2BZX A;  2OTL T;  2XIC A;  2OJ2 A;  2C0T A;  2C06 A;  4JRK A;  1BI0 A;  3I5R A;  3PIP A;  1IB8 A;  3VS0 A;  4M77 C;  1VQP A;  2ZAE A;  4KUI A;  1IO6 A;  2K5I A;  2LX7 A;  1EFN A;  1BBZ A;  4QVC A;  2RQV A;  2K9G A;  1ZA1 B;  2FRY A;  4CRI A;  1QVP A;  4FM4 B;  4IIM A;  4M7D D;  2AZS A;  2AKK A;  2MAM A;  1YIJ Q;  2DZ9 A;  3KUF A;  5GAN 5;  1JJ2 S;  2L5Q A;  4N4G A;  5CKF A;  4BI3 A;  2ED1 A;  2FVU A;  3CPW S;  1K76 A;  2LT4 A;  3VU3 C;  2HQE A;  2L3P A;  1GL5 A;  2CP7 A;  4LN2 A;  3L2Z A;  5GAO q;  2XMF A;  3PE0 A;  1Q86 R;  3L1A A;  2YRC A;  3VS5 A;  1Q81 C;  4OB2 B;  3REB B;  4BI4 A;  1KG1 A;  2LC4 A;  3A5Z B;  4L5G A;  2D6F A;  2EYX A;  1GXI E;  4A63 B;  5FWB A;  1HK9 A;  2COW A;  1ZSG A;  3CC7 A;  3P8D A;  4QVD A;  4OMN A;  4RTY A;  1PSF A;  2YUQ A;  3S3M A;  2IVW A;  2RQW A;  3VRZ A;  3EG3 A;  4RCC A;  1ZA2 B;  1M3C A;  1SHF A;  1VQ7 T;  4C92 A;  2MMP A;  1VQO Q;  4KGX B;  4NL2 A;  1K1Z A;  1WPY A;  3UT1 A;  3CCJ Q;  2W10 A;  4C8Q B;  2QTX A;  3QG1 A;  4M77 G;  2IPO B;  2K57 A;  3VYH B;  3I56 Q;  1JJ2 A;  2GGR A;  1K73 U;  4PJJ A;  3CPW A;  1M1G A;  1N9S A;  1NBE B;  1NG2 A;  4JJB A;  1VA7 A;  5ECA A;  4BD3 A;  4EIK A;  3CC4 T;  1OI1 A;  1VQ8 T;  5LJ3 f;  2V1R A;  1MMD A;  5GAN f;  2EYQ A;  2I0N A;  1UEC A;  4FT4 A;  2YRV A;  2JS2 A;  1PWT A;  1YJ9 Q;  1JU5 C;  2AKL A;  1YIT A;  1SEM A;  4XTW A;  2M0Y A;  3OYA A;  4F04 B;  2I2L A;  5CKD A;  3KXT A;  1VQ8 A;  2KI7 A;  2YT6 A;  3MEV A;  3UA6 A;  3CPW P;  3GF5 A;  1UG1 A;  2K3Y A;  5KYY A;  1ZSZ A;  4E7J A;  2GFA A;  2R5M A;  4M77 E;  2RPN A;  2E6Z A;  2GCX A;  5KCH A;  4EMH A;  1WHG A;  3UF4 A;  3H0F A;  2FG0 A;  3EHR A;  2RJF A;  1YCY A;  3QUI A;  2CUD A;  1D1B A;  4OGE A;  2B86 A;  1G5V A;  1U1T A;  4N4I A;  3OYE A;  2J6O A;  3SWN A;  1R8O B;  1WLP B;  4M78 D;  2CGH A;  5GAN g;  1VUB A;  3CCR Q;  2LQK A;  1KQS S;  2XDD A;  2A28 A;  2GTO A;  2VV5 A;  3CCM A;  3G7Z A;  4XQ3 A;  2DIG A;  3VS3 A;  3GP8 A;  1W2B S;  1ABO A;  2H8H A;  1LVK A;  1RLQ C;  3I55 Q;  2KRO A;  3VS7 A;  2L3S A;  4KGV B;  1VQ4 T;  1M90 R;  4D8D A;  4HCK A;  1TUG B;  1GCQ A;  4Z88 A;  1LOJ A;  2C0I A;  2FHD A;  3L42 A;  3VUB A;  1U1S A;  2DD4 A;  2PZ1 A;  1YHQ T;  5I21 A;  1X2Q A;  4AFZ C;  4BDY A;  5GAN d;  4AT1 B;  2ZPG B;  5KYW B;  3X25 B;  2K5F A;  4M7D C;  9ATC B;  1NM7 A;  1YWO A;  1D3B B;  2QEX T;  2D8J A;  2OI3 A;  3LW5 E;  1I0C A;  2E6N A;  2V8I A;  2KT1 A;  3OYJ A;  2LZ6 B;  4FYX B;  3HTR A;  2LQW A;  3C4S A;  2FZK B;  4J9H A;  4L59 A;  4VUB A;  2KK4 A;  3L2Q A;  3E2U A;  3FIF A;  1G3W A;  3CCQ Q;  3JCM V;  1YJW A;  4RKU E;  1A0N B;  1KQS A;  4A4E A;  3SD4 A;  3CBM A;  4XU2 A;  4Q5W A;  1YJN T;  3CCS Q;  5EC7 A;  1W2B A;  4EMK B;  2MPX C;  4DEY A;  4Z02 A;  1PG5 B;  3MJX A;  4JJC A;  3PMI A;  3LYI A;  5D6Y A;  2G6F X;  4II1 A;  1IZ6 A;  1W70 A;  3A8G B;  1AWX A;  3G71 Q;  2K7A A;  2SRC A;  3V8K A;  2DBK A;  4C92 D;  4M75 F;  3Q1J A;  1YNZ A;  3JCM J;  5KYX A;  2CSQ A;  3CME T;  2E1H A;  4PJN A;  1Q7Y U;  1Q86 U;  5DLQ E;  2QG9 B;  2V1Q A;  2WAC A;  1T3S A;  3N5B B;  2HBW A;  4QT7 A;  1WJR A;  2XU8 A;  3CCU T;  4QQD A;  1K9M R;  1PM3 A;  4ZGJ B;  2YUP A;  2QAZ A;  1VQN Q;  2LJ0 A;  2VXF A;  1HJD A;  3CCL Q;  1J3T A;  3CME A;  5GAO m;  3PIO A;  3I35 A;  1SG5 A;  1UJY A;  2RHX A;  3FJP A;  2M51 A;  4C8Q D;  4BB7 A;  3CCU A;  3JB9 H;  1VQ9 T;  5CAI A;  1VYU A;  1F1B B;  5LJ3 j;  1AHJ B;  4OGC A;  5AYF A;  4BE2 A;  5GAN j;  3EAE A;  3MCA B;  3ASK A;  3RKY A;  1UE9 A;  2QDY B;  4A4H A;  1G3S A;  2YHT A;  1O9S A;  1BI1 A;  3LX7 A;  3CD6 A;  1WHL A;  4FL6 A;  4AFQ C;  3CC2 A;  2OTL Q;  1TUD A;  1WX6 A;  2OTJ T;  1UHF A;  1XJW B;  3VV0 A;  3QJY A;  1VOM A;  2LCS A;  3OYG A;  2CYZ B;  2CP0 A;  4M7A A;  2O01 E;  2ZPH B;  4J83 A;  3NMZ C;  2EKH A;  4X9D A;  2WSF E;  1Q82 R;  4IUQ A;  1AWJ A;  2EAY A;  4JJN K;  4M7D E;  1UUE A;  1WGS A;  2QA4 A;  2XID A;  3NGP A;  3OYD A;  4RG8 A;  2P4T A;  4R0K A;  2F2V A;  1GFC A;  5LJ3 h;  4CC4 B;  3OYY A;  5GAN h;  1C6V X;  3M57 A;  2VKN A;  5A0L A;  4M78 C;  1Z9Q A;  1VIF A;  3HSB A;  2KSS A;  3M0S A;  4AFU C;  2YXY A;  4EPC A;  2DJQ A;  2DIL A;  1U8R A;  1S1N A;  3LGL A;  4MDW A;  4PFZ A;  3PFS A;  3MO8 A;  3QHS A;  5GAM g;  1RAD B;  3M59 A;  1V1C A;  3MKD A;  1K0S A;  2RJD A;  3IQL A;  4JRI A;  1X69 A;  1SRL A;  4XU1 A;  3QO3 A;  5CKH A;  3V7S A;  2K2V A;  1UDL A;  2ED0 A;  5GAN 7;  3HPW A;  4CC2 A;  3CMA A;  2GBQ A;  3JCM c;  2LQ8 A;  5KYU A;  3M9Q A;  3TU4 K;  6AT1 B;  3TRE A;  4HVU A;  2YWW A;  1VQ7 Q;  3M0U A;  4M75 G;  3S6W A;  2EYZ A;  3EGX A;  5FW9 A;  4BI8 B;  2K2M A;  4RTV A;  4O5V A;  5GAM d;  2MIO A;  3M4G A;  2X4J A;  1RAE B;  1D0Y A;  4OML A;  5GMK m;  1M9S A;  1M90 U;  1QWE A;  2X35 A;  5CIU A;  2DE0 X;  3CC4 Q;  2DAQ A;  1VQ8 Q;  3HRS A;  2E4H A;  4DEX A;  1K4U S;  2EQU A;  4KGZ B;  5IH2 A;  3PTA A;  4LXC A;  3P8B B;  2E10 A;  1N27 A;  4ZNX A;  1AWO A;  4XU0 A;  5GMK h;  3JCM f;  2L8D A;  8ATC B;  5GJW B;  3PT9 A;  1VQL T;  1WA7 A;  1M30 A;  3TVT A;  2KDS A;  1I5O B;  4C92 C;  1H92 A;  2DBM A;  4KRT A;  1IGU A;  5I2M A;  1T0H A;  1TG0 A;  5GAO r;  3GNF B;  3JB9 I;  3S3N A;  1RAF B;  4QW2 A;  1MND A;  1M5Q 1;  1Y71 A;  5LJ5 g;  5AT1 B;  3PMT A;  5L23 A;  4ZN1 A;  3T9N A;  1YFN A;  1YWP A;  4AMC A;  1GCP A;  3HRU A;  4E7S A;  1ZBJ A;  2X3W D;  1VQL A;  5LJ3 e;  4R56 A;  2LCC A;  5GAN e;  1KFZ A;  2NUP A;  2DVJ A;  2HDA A;  3OYH A;  5HK3 A;  5GAN 8;  4XTY A;  3EFO A;  3OYL A;  1B3Q A;  3EG0 A;  1ZLM A;  2RN8 A;  1UTI A;  3M0Q A;  1VQ5 T;  4M75 B;  2K5L A;  2JTF A;  2RNA A;  4PLL A;  4M78 E;  4LD9 K;  1RAC B;  4C8Q C;  1CSK A;  1S72 A;  3RMQ A;  4WTO B;  1UEB A;  2EJF A;  4F7U E;  4M77 F;  5LJ5 d;  4DBF A;  1T3L A;  2RQR A;  4RG2 A;  3G6E T;  1TH7 A;  1MNE A;  2DET A;  4XTV A;  3VRY A;  4B6M A;  3GIB A;  4HXJ A;  1T0J A;  3JCM g;  2FYK A;  3HFO A;  1K9M U;  1YCS B;  1E7O A;  2RM4 A;  1ZQ1 A;  1KD1 R;  3INZ A;  1VQ4 Q;  2YSQ A;  1M2V B;  1ZSZ C;  4IUV A;  3LWH A;  5FU7 B;  1KQ1 A;  3QDR B;  3EH2 A;  4C0G A;  2E70 A;  2QK0 A;  3VS4 A;  3G6E A;  3HRT A;  2CT4 A;  1FX7 A;  1NLO C;  4NL3 A;  1YHQ Q;  1EX4 A;  3TSZ A;  2J6F A;  3JCM W;  1VQP T;  2RH2 A;  1QWF A;  1AWW A;  2KRM A;  3L2R A;  2DXC A;  3EGU A;  3EHQ A;  2QQ9 A;  5FRN A;  2D0Q B;  2LNV A;  5L8R E;  3SWN C;  5FWC A;  2QEX Q;  3JCM d;  1UHC A;  3OYF A;  4IIO A;  4LD6 A;  5GAO l;  3PVL A;  4IKF A;  2HEQ A;  2Y4X A;  2DZC A;  5I22 A;  2ESW A;  5GMK e;  3EH1 A;  1IGQ A;  3V7C A;  3BW1 A;  1M27 C;  3JB9 F;  1Q82 U;  1FXX A;  2P0K A;  1ZX6 A;  2EGA A;  4PJO A;  3DKM A;  1KHI A;  3MHX A;  1QKX A;  1YJN Q;  3CCE T;  1GCQ C;  2DL4 A;  1H64 1;  1AZG B;  2F5K A;  4Y28 E;  1XTD A;  2BTT A;  2FZC B;  4C92 E;  3CC7 T;  2ZPF B;  4JPB W;  5HCK A;  1Y07 A;  2M02 A;  2RK2 A;  2BZ8 A;  1Q7Y R;  2LNH B;  3CME Q;  2EIF A;  4B9X A;  3CCE A;  3WVD B;  4X9C A;  2DER A;  1MV3 A;  1PHT A;  3OBY A;  1OZ3 A;  2PVG B;  5D6W A;  2DXB A;  3PGG A;  5DY9 A;  2DKG A;  3ME9 A;  4C5H A;  2CRE A;  2P0P A;  1SPK A;  2OAW A;  4KH0 B;  1UGR B;  4JLG A;  1AEY A;  4C0D B;  1RAA B;  1KC8 R;  2LX9 A;  4JUV A;  2DVE A;  1VQ9 Q;  3AHU A;  3QXE B;  2ENM A;  2X4X A;  4Y92 A;  5FRO A;  1BCO A;  2EQM A;  2JM8 A;  1X01 A;  2XKO C;  2MK5 A;  4LUD A;  3O8V A;  1YIT T;  3J7A F;  4PJM A;  4LE9 A;  4J7I A;  3EFR A;  3AT1 B;  1M1K C;  2OTJ Q;  2LT1 A;  4OB3 B;  1C1A A;  4C5G A;  3ULR B;  2DLP A;  1B7T A;  2PTK A;  4BY6 C;  2DFU A;  2KBT A;  2LJ1 A;  1OOT A;  4C8Q A;  2EYY A;  4ATO A;  1MGQ A;  5KCO A;  2O31 A;  4BDZ A;  1VIE A;  2CZ6 B;  4JS4 A;  1Y0M A;  1WQ7 A;  5GMK l;  1PC0 A;  1WIE A;  2M1H A;  2EW3 A;  3URG A;  2E12 A;  5J3B A;  5I2S A;  5KYY B;  1RLP C;  2E64 A;  4DQ2 A;  1JJ2 P;  4CI0 C;  1NJI C;  1D0Z A;  4DBR A;  3OYB A;  5M9O A;  2Z0W A;  2BKD N;  1KIK A;  3JRZ A;  3MET A;  1K9A A;  3UAT A;  1JQQ A;  4M7D F;  3MP6 A;  1QMC A;  1IHW A;  2C0O A;  1TWB A;  3QZ9 B;  3G4S Q;  3JB9 G;  1N8R C;  1KQ2 A;  4Z8A A;  3CCM T;  3EGD B;  1BB9 A;  3OSV A;  4ME7 A;  4BE1 A;  2HZY A;  4PKC C;  2DTH A;  2NUT B;  2FL7 A;  2HAX A;  3OYK A;  4M7A C;  1PNJ A;  1PCX A;  2Y90 A;  2K79 A;  4M77 B;  3GOX A;  2DK3 A;  3PNW C;  2QGF B;  3QYG B;  4R55 A;  2KRS A;  5GAN 6;  1KJW A;  2A08 A;  2LMJ A;  3FB9 A;  5CVI A;  1VQK T;  2KXD A;  2RB6 A;  2OX7 A;  4ESR A;  4HT9 A;  2LCL A;  1KD1 U;  2F1L A;  2RI5 A;  4IUP A;  1PRM C;  3ZBD A;  4WF2 A;  1E6H A;  4KBM B;  2MYS A;  3CXC S;  4N4H A;  1RUW A;  1VQM T;  4C5E A;  2QQB A;  2RD1 A;  2ROT A;  1Q81 R;  1VQK A;  3DB4 A;  2X4W A;  3QPH A;  4FU6 A;  1IHV A;  4PJO D;  2D8H A;  2EQI A;  2JXB A;  4E7K A;  1BCM A;  3HHT B;  1YJW T;  1ZUY A;  2VXE A;  5GMK i;  2XD0 A;  2QI2 A;  4CC7 A;  2BUD A;  1X27 A;  2RHY A;  1GBQ A;  4OMF B;  2JMA A;  1TOV A;  1VQM A;  1VQL Q;  3GBQ A;  1ZUU A;  2LJ3 A;  2CDT A;  4F14 A;  2KEA A;  2EJG A;  4AG2 C;  3OA6 A;  3RUX A;  2KNB B;  4JZ4 A;  1TS9 A;  1WJS A;  1OPK A;  2ZPE B;  5KYW A;  3E9F A;  1V76 A;  1WXU A;  3L2W A;  4M7A G;  1QCN A;  2YUN A;  2DM1 A;  1WHK A;  2R5A A;  3E1S A;  1DJ7 B;  1D3B A;  2M9U A;  4BAC A;  3H0I A;  5GAN 3;  4IUU A;  1QCO A;  3M0T A;  2WSE E;  3VYG A;  4EDU A;  3QDF A;  1NPP A;  1RI9 A;  2IIM A;  4FYW B;  3UDC A;  2K3X A;  3RIR A;  1VQ5 Q;  2L2P A;  1BU1 A;  4PNO A;  2JVV A;  3M5A A;  3CXC A;  3O5Z A;  2EBP A;  2QXF A;  1N5Z A;  1IRX A;  3M4Y A;  3GLX A;  1TTH B;  1KQS P;  2KY9 A;  4EMK A;  3G6E Q;  1NLP C;  1MMN A;  1GBR A;  2MI6 A;  2A37 A;  2PUO B;  4OMP A;  4M7D G;  2JJ9 A;  1ZHI A;  2DTI A;  2QTV A;  1W2B P;  2VGM A;  5GAN 2;  3CD6 T;  4ZN3 A;  4M78 F;  4J9D A;  3CC2 T;  1U5S A;  4M7A E;  2DYI A;  3UWN A;  3VKI A;  3JAM E;  2KR3 A;  1NYF A;  5CR2 A;  1KC8 U;  1MMG A;  4FT2 A;  2LQN A;  5CQX A;  2SEM A;  1WHM A;  5GAM f;  4LDY A;  5CO7 A;  1G2B A;  1XQH A;  1VQP Q;  1JO8 A;  2LRQ A;  3JCM X;  5FU6 C;  1WYX A;  2DJZ A;  3OYI A;  3OMG A;  2DX1 A;  2JZ2 A;  1H3Z A;  3OSS C;  2QA4 T;  1QVF S;  2KT8 A;  2E5Q A;  1UJ0 A;  1WI7 A;  2PQW A;  4C5I A;  1I81 A;  4RUG A;  2CP2 A;  2X4Y A;  3UPU A;  2E65 A;  4HVW A;  1VQO A;  3EG9 B;  3CCJ A;  3GPL A;  2P4R A;  2JTM A;  4A53 A;  5A2Q E;  3QWX X;  2R58 A;  2EWN A;  2JUF A;  2D0N A;  3CPF A;  5KYN A;  3I56 A;  3CCE Q;  1YI2 T;  3A1P A;  1UGS B;  1PD0 A;  5D7U A;  2O4X B;  3OBW A;  4PJL A;  3JCM P;  2GQV A;  3CC7 Q;  2FO0 A;  2HKQ B;  3CMA T;  2V26 A;  3E9G A;  3RER A;  4M7D B;  2DL8 A; 
#chains in the Genus database with same CATH homology
 3CCV Q;  1K8A R;  3CC4 Q;  1VQ8 Q;  3CCR Q;  3CCM Q;  3CCS Q;  1QVF P;  3CCE Q;  1S72 Q;  1VQK Q;  1Q86 R;  3CMA Q;  1VQL Q;  1Q7Y R;  1KQS P;  1KD1 R;  1VQ4 Q;  3G6E Q;  1VQ6 Q;  1YJW Q;  1K9M R;  1YIJ Q;  1K73 R;  2QEX Q;  3CME Q;  3CD6 Q;  3G4S Q;  1VQO Q;  1Q81 R;  2OTJ Q;  2QA4 Q;  3CXC P;  1M1K R;  1KC8 R;  3CCJ Q;  3CC2 Q;  3G71 Q;  3CC7 Q;  1VQP Q;  1YJN Q;  1Q82 R;  1N8R R;  3CCQ Q;  1VQN Q;  1JJ2 P;  1VQ5 Q;  3CCL Q;  1W2B P;  1YI2 Q;  1QVG P;  3CPW P;  1VQ9 Q;  3I55 Q;  1NJI R;  1YIT Q;  1YJ9 Q;  1VQ7 Q;  2OTL Q;  3I56 Q;  1YHQ Q;  1M90 R;  3CCU Q;  3OW2 P;  1VQM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...