2PUKB

Crystal structure of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin m
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
73
structure length
73
Chain Sequence
b'MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 10
structure length 73
sequence length 73
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pukB00
1UGPB 2D0QB 3WVDB 3LW5E 1QP3A 2DXBA 3QYHB 3X28B 1UGSB 1JB0E 4FM4B 4L6V5 4RKUE 1QP2A 1PSEA 2QDYB 2ZPBB 2ZPGB 1AHJB 2PU9B 3A8OB 2DD4A 4KT0E 3VYHB 3VYGA 4OB2B 2CZ7B 2AHJB 4ZGDB 3QZ5B 5L8RE 4ZGEB 3A8MB 3QZ9B 3HHTB 2PVGB 3QXEB 1V29B 3X25B 2DD5A 2ZPFB 3A8HB 2CZ6B 2ZZDA 2WSFE 3WVEB 2CZ1B 3X26B 4Y28E 2ZPEB 1DJ7B 3A8GB 2DPPB 4ZGJB 3QYGB 2ZPHB 1IREB 4XK8E 2WSEE 1UGRB 1UGQB 3A8LB 2CYZB 2PVOB 2WSCE 3X20B 2PUOB 2PUKB 4OB1B 3X24B 2ZPIB 1PSFA 4OB3B 2ZCFB 2DXCA 2PVDB 2O01E 4OB0B 2CZ0B 1GXIE
chains in the Genus database with same CATH superfamily
1D3BA 5IHKA 3OMCA 2K79A 1Y96A 5A2QE 2CP7A 3PVLA 2LT1A 2JMAA 3O8VA 3TCJA 1Q86R 4FT2A 4B6MA 3CCSA 2LNVA 4L59A 2DA9A 1S72Q 2ZPGB 4JPBW 2B8AA 2RJCA 2YWWA 4KT0E 4PNOA 3CCMT 3CCRA 2E5KA 2JN0A 2Z0WA 2IVWA 3EGUA 3G4SA 3CC7Q 3PIPA 3CCET 3A8MB 3AT1B 4C8QF 2YSQA 2OAWA 1UGVA 1N5ZA 4C5HA 5FLXE 1UJYA 3V7SA 2EBPA 1XJWB 1EFNA 3A8HB 3DKMA 2PNIA 1U3OA 1YJNQ 3V8KA 1WA7A 4B9XA 1G3YA 3OW2P 3SEMA 3I55T 4HKEA 1RAAB 4XTXA 3VJPA 3VKIA 4ZNXA 2HBPA 1WXUA 3C94A 4XK8E 4CRIA 1K9MU 1F1BB 1B3QA 4C0ZA 2QEXT 1UGQB 2LQNA 4WCIA 1VOMA 1VQ4T 1N9RA 3VS6A 1Q82C 2J6KA 3O5ZA 4PJMA 2O9SA 2FB7A 2RH2A 1AT1B 5FRMA 4FCYA 2COZA 2YUQA 4LDYA 3EG3A 1GCPA 1G83A 1OZ2A 1CKAA 3CMEQ 2F5KA 3G6ET 1YI2A 4M78C 3NHNA 3EFOA 3JCMh 2P4TA 4O6JA 4AFQC 3QDFA 1JJ2P 2DL3A 2OTLQ 3OS0A 3LLRA 2A0FB 1H3HA 4E7HA 1M3BA 1ZUUA 3HFNA 1M90U 3J7AF 5GAOq 1QCOA 5IHNA 5GMKh 4KUIA 1WHJA 2E10A 1MMNA 5GAOm 2E65A 2VXFA 3G71Q 1M8VA 3QWYA 1TUDA 1G3WA 5GAN5 3HRTA 2M16A 3JCMc 4ELYC 1AHJB 3OQ5A 3OYFA 2DILA 4CC2A 3GLXA 3P8BB 2A36A 4OMMA 3CCLQ 4VUBA 3EG9A 3VYHB 2DZCA 2AZVA 2HNIA 1WJQA 2CH4W 1XNIA 2CP0A 4ZGEB 1M2VB 3QPHA 2X35A 2KEAA 2AZSA 3LWHA 2RO0A 4J6XA 3ZBDA 5GAN3 2QA4A 1LPLA 4NL3A 1VQPA 3HRSA 3CC2A 4FSXA 1ZSGA 2DPPB 3CCVA 4ZN1A 2QTVA 2F2VA 2P0QA 1UE9A 1WIEA 3C0CA 5IAYA 1YJWA 4EMKB 1OU8A 4RTYA 4MDXA 3EH2A 5FW9A 1TTHB 4RCCA 2KNBB 2KRSA 2CS7A 5LJ5e 2KK4A 3QKJA 1VQ5T 1SHFA 3ASKA 4Q5WA 3S3NA 1HK9A 4A54A 2EKHA 4GLMA 2K3YA 2RHIA 2PUKB 2E6NA 1IB8A 1RLQC 2RK2A 3JCMW 3PMIA 5LJ3e 2KXCA 1IGUA 2C0IA 4C0DB 1MV3A 1PWTA 1D0YA 1NG2A 1JRIA 2NUPA 3SDZA 3HP9A 3ZFJA 1WGSA 3C4SA 2CKKA 1YJ9Q 5KYXB 3MPUB 3QHSA 4UC4A 2AKKA 2QG9B 2YRVA 4C92C 5GANe 4DQ2A 2GBQA 1Q81U 2HKNA 1MHNA 3H0FA 2XHCA 4M75E 4E7ZA 1MUZA 1PM3A 1BIAA 2K9GA 1VQMT 5I2SA 4X34A 1AOJA 2EQJA 3OYEA 4DEYA 2EJGA 3RERA 2K7AA 2L3SA 3BY7A 1I0CA 3E2UA 2V8JA 3V7CA 1QWFA 2RK1A 1RI0A 4AG2C 3SWNB 4F17A 3M0SA 1VQNT 2DZ9A 3EG0A 4PJOC 8ATCB 3QJYA 3ZEHA 1OPLA 1LJOA 2XU8A 1S72T 3CCMA 3CCJT 4F7UG 4M75B 4XU0A 2XI9A 4WTOB 1FX7A 2RJEA 4Y28E 4M78D 3I9QA 1K0SA 4JDSA 2BZ8A 3JCMV 3OW2S 4XTVA 4PLLA 4M78A 4C92G 1D3BB 3CC7T 1H92A 2ZGWA 1JO8A 4XU3A 4J9IA 1Y96B 4GLKA 2V8KA 4JRIA 1IHWA 3M59A 3I55A 1AWXA 2K2VA 2CYZB 3RBBB 1EIFA 1WZOA 1ARKA 2BE7D 4N4GA 5CKEA 2BIVA 1PKTA 1G3SA 1KD1R 2QEXA 2KSSA 4Z8AA 1AEYA 2F2WA 2KVQG 2QDLA 2D6FA 4IURA 3LWIA 3L2VA 2FG0A 2QQBA 1JJ2S 3QDRB 3OYCA 4PJLA 3VUBA 1XTDA 1VYUA 2E41A 1K0XA 2P4RA 3RR6A 4M4ZA 2EQKA 4J83A 4D8DA 3DLLA 1ZA2B 2GTJA 1KHCA 3CBOA 1NPPA 2A7YA 1QLYA 5EG2A 1UHFA 4FM4B 4RKUE 1VQ8Q 3FJ5A 4HCZA 3OW2A 2E64A 1YHQQ 3H6ZA 4OMPA 3T9NA 5KYNA 1GBQA 3REAB 3RDVA 1Q95G 4PJJA 5GAMe 1C1AA 2R58A 1M1GA 3N5BB 4M7DE 2DKGA 1M2OA 1WI7A 2CH4A 4MMKA 4FYVB 2KGTA 2GQIA 1U1TA 4ORZA 3QZ5B 3JCMf 1ZX6A 3G71T 1QMCA 1RI9A 4N0AC 4E6RA 1B07A 1KG1A 4BB7A 2E3IA 3EFOB 2DTIA 4E47A 2JXBA 3E9GA 4PFOA 5FWBA 4ATOA 3DLMA 4PJNA 3EH1A 4EPCA 1JJ2A 1DJ7B 3MO8A 4M7DB 1I8FA 4M7AC 4ZGJB 4BD3A 2YT6A 3JAME 4C92F 3OA6A 1Q7YC 3D7SB 4CI0C 4A4EA 5GAOl 1PD1A 2QQ9A 1SHGA 2YLBA 1VYTA 2D8HA 5I11A 2HSPA 1H3ZA 5KCHA 3OBWA 2NYSA 1TG0A 1VQLA 4C5GA 2VB6A 2ZPIB 2LZ6B 1O9SA 2NUZA 2EW3A 3M0QA 3TSWA 1YI2T 4DOVA 1VQ5A 4LUEA 1AWWA 3C95A 1K73C 4JLGA 3H8ZA 1VQ9Q 3CPWP 3VS1A 3M0TA 1YWPA 1QP3A 3QYHB 5GANh 1TOVA 2RJDA 4PJOD 3M55A 3M57A 1KQSP 2IIMA 3RKYA 2K57A 1C0MA 2YDLA 5CQXA 3L1AA 4V2SA 2EAYA 4C8QC 1QP2A 2MYSA 1UFFA 1UDLA 1T3SA 1Q86C 4PJOA 3UA7A 1MV0B 4FYWB 1YJ9T 2HL5C 3MHXA 3GIBA 1OX8A 3A1PA 2KBTA 4A63B 2F1LA 4AG1C 1FMVA 2DL7A 4E2FB 4JS5A 3OBYA 2PQWA 4BUGA 5IH2A 1VQMA 2MAMA 1IZ6A 3HHTB 4FSSA 3UWNA 4FYYB 1V29B 2V26A 1SF9A 4J9DA 5IHIA 2DRKA 1A0NB 3NTHA 1VQOQ 2QGFB 3WVEB 2EYQA 1SG5A 2ENMA 1D1CA 3OYDA 4FYXB 4DA4A 4Y92A 1S72A 3CCJA 2ZPHB 3VRYA 4KBMB 3JRZA 3MEUA 1SRLA 2OI3A 3JB9G 3A8LB 1GRIA 4BI4A 2E1HA 3L42A 2FVUA 3VS0A 5FU7C 1VQKT 2HQXA 2HBWA 3CC7A 4FW2A 3ULRB 2LX7A 1U1SA 1VQ7T 1OEBA 2H3JA 4JS4A 2RQRA 1LNXA 5CKDA 4JJCA 1Q7YU 4PFPA 2P84A 2O4XA 3CXCS 3SB2A 4M78E 1KC8U 5HK3A 3FJPA 1M1KR 3SWNA 4KUDK 2FZCB 2CREA 2AIRB 4A53A 2ESWA 4F04B 1JB0E 4BY6C 1PRLC 1RAGB 1OX9A 3EFSA 4E7SA 4RTUA 4A4HA 3LGLA 2X4XA 5KE2A 1K73U 2PU9B 2EJ9A 2F5TX 4M78B 5GAMh 3NPFA 3CMEA 3JB9H 7AT1B 5AT1B 5DM7R 2L0AA 1BU1A 5FRNA 3WXMB 3VYGA 4BI3A 5C0MA 4J9CA 1W6XA 3EG1A 3EAEA 2X51A 2BTTA 1N8RR 2OTJT 1Q86U 3PTAA 2DL5A 3OYKA 2ZZDA 3L2WA 4JRKA 3UA6A 4QVCA 1QCFA 2DL8A 3CCUT 2EYZA 2ZPEB 3CXCA 1GL5A 2P0KA 2YUNA 3CCQQ 3HSBA 3G71A 2KY9A 5CO7A 2E3HA 1TWBA 1QVGP 2J6OA 1WHKA 1X75C 3CC4Q 1U5SA 3CMAQ 2FO0A 2J05A 1PG5B 1ZUKA 2RQWA 3JCMd 2E6ZA 5CAIA 4LUDA 1KIKA 5EC7A 3JB9F 2PVOB 1M4ZA 3VS4A 1XOVA 5IT9E 4J5YA 4JRQA 2LX9A 3A5ZB 3X24B 4C8QD 1RADB 1NJIR 1RACB 1T0HA 5GMKj 4J7FA 4D8KA 1I5OB 1RAIB 2CT4A 5GMKm 4C8QA 4IUQA 4RUGA 2ABLA 4OGEA 2RQTA 1XQHA 2FHDA 3GF5A 4C5EA 3L2ZA 1QWEA 4M77G 2DF6A 3VRZA 2JMCA 4DBQA 3CPWS 5GAOp 4F7UE 2L2PA 1WX6A 1YIJT 2EIFA 2CDTA 2EVRA 3TEEA 2ZAEA 4M7DD 1Q81C 1KQSS 2VGMA 4RTZA 3ZL7C 3GP8A 1IHVA 3G1JA 4M7DA 1MMAA 3OSVA 4YTLA 2BE9B 2EGCA 1X43A 2H8HA 2EQMA 3JB9J 3SHWA 1GBRA 5CVIA 1W2BS 1YWOA 1JXMA 2VASA 1VA7A 2M0OA 1AD5A 1NE8A 2YHTA 3JCMg 2DVEA 1YJ9A 4DEXA 3THKA 4PJOE 3HPWA 2VXEA 4MZTA 3EGXA 1X2KA 4QT7A 3CCRQ 5GANf 4IKFA 3I5RA 2J7IA 2KT1A 3CPWA 2CSQA 2D0NA 1JBMA 2HCKA 2DK3A 4OMNA 2JVVA 2KXDA 4B9WA 3C12A 4DBHA 2DYIA 4JJNK 1VQOT 5I21A 2WACA 1KQSA 3ME9A 4PJOB 1YNZA 5KCOA 2XDDA 1WHHA 2X4WA 1QVFP 4GBQA 4PK4A 2K3XA 4OB3B 3UATA 1VQLT 2MOXA 3LX7A 2EPDA 5CCAA 2EQUA 2C0OA 2RQUA 1W2BA 2CP2A 3H0HA 1VQKA 4LDUA 1VQ7A 3FEOA 3JCMX 4AMCA 3REBB 1TSFA 4M77F 4XQ3A 3WVDB 2M1HA 4CC4B 4JJDA 2FEIA 2RB6A 2XMFA 1H641 1KQ1A 4LDXA 2L3RA 2DNUA 4XTZA 1FXXA 4EMHA 1QCNA 1R77A 2O88A 5D6XA 3M0RA 3A8OB 2M0YA 2LJ3A 3OYAA 4DBFA 2EYYA 1V1CA 4OB2B 2GFUA 4J6YA 3M9QA 3RMSA 3DB4A 5GAN4 2ECZA 1Q82R 2MK5A 1VUBA 2PVGB 3VV0A 4QQDA 4HA8A 3BW1A 2X4YA 3LYIA 1BCOA 4HCBA 2K2MA 1BIBA 4X9CA 2O4XB 1CKBA 1K76A 2ED1A 1WJRA 1VQ6Q 2RM4A 1D0XA 2OTJA 1M30A 1WHLA 1YCSB 4ZTFA 5KH6A 1YHQA 1UJ0A 3CBPA 1O75A 1GFDA 2JM8A 3OYIA 2RHXA 3M5AA 3CCUA 3RKXA 4Z89A 4M7AE 5GAMf 2VVKA 3URGA 2QQAA 3P8HA 4RTTA 1HXDA 4AT1B 2QA4Q 1ZA1B 4QQGA 3CC2Q 2HEQA 3M0PA 3CCVQ 4KH0B 1JEGA 3NGPA 3FIFA 1YJWQ 1TH7A 2LP5A 1I07A 2K4YA 2RHYA 4ESRA 3DB3A 2NLUA 5FU6B 1PKSA 1K4US 2DJZA 2E70A 4P5NA 2W0ZA 2JTEA 5CKFA 2HAXA 1YJNT 1GFCA 3CBMA 2DXBA 2DIQA 1G2BA 2RMOA 2LJ1A 3RIRA 1ZLMA 3QWXX 1KD1U 2LVMA 2EQIA 1OOTA 1G8XA 1WDXA 4GY5A 3GPLA 2KRNA 4IUPA 1TXQA 2DD4A 4C8QE 1R8OB 3LH5A 1YIJA 1FYNA 1KHIA 2G6FX 2E5QA 3CMET 3MEVA 5FWCA 2FRYA 4QW2A 2OTLT 2KMTA 2ROTA 2MPXC 1H8KA 3BDLA 4J8OA 4JJBA 4RMOA 3CD6Q 4FL6A 2D1XA 3MEAA 4C8QB 2HZYA 3BFMA 3FB9A 2JUFA 4EIKA 1W70A 2O2OA 3FC3A 1OV3A 4RG2A 1BCMA 2DEQA 2I0NA 4OVAA 3QG1A 4Z02A 3CCMQ 3RMQA 1RABB 4DBRA 4J9FA 3CCLT 1N27A 4HCKA 5HY6A 5KYWA 1FWZA 3CCEQ 2VKNA 4XTUA 2W10A 4L5GA 1QVFS 5LJ5h 5GANj 3META 4XAXB 1ZBXA 1VQOA 1M5Q1 1R0BG 1BI1A 4J9BA 2JZ2A 1KC8C 4KULA 1PNJA 3HKSA 1TU0B 4XU2A 4II1A 2KYBA 1AZGB 5D6YA 2HQEA 4AFSC 4F7UA 5A0LA 3OYMA 3I55Q 4JRPA 2Y4XA 1M1KC 5LJ3h 3X28B 5D6WA 2GFAA 4C92D 3OS1A 4OP0A 2DBMA 2V1QA 2QEXQ 1VQ4Q 2RI5A 3EGXB 4C92A 1U06A 4OMFB 3OYYA 1CSKA 3M58A 1YN8A 4M75G 2DEUA 3G6EQ 1V76A 1X6OA 4ZGDB 3OS5A 1EX4A 2CT3A 4HT8A 3QO3A 3OS2A 2M51A 4JZ4A 1QVFA 2FL7A 1QKXA 2ROLA 3JB9I 5CIUA 1SRMA 1WFWA 2F69A 1QKWA 4QVDA 2D8JA 4CC7A 2O9VA 3GBQA 3JCMJ 2HMAA 2JTFA 2DJQA 3UT1A 5GANg 3JCMe 4LNPA 6AT1B 1W4SA 2HSEB 3E19A 4E7LA 1R0CB 1NLPC 1NBEB 1D1AA 1M9SA 1Y07A 1VQ6T 4ME7A 1WQ7A 5GAOn 5A0DA 5GAN2 1YITQ 2DXCA 2DXTA 1M8MA 5LL6S 2X4JA 2ATCB 4OB0B 3PGGA 3CCQA 3HFOA 2QTXA 3S3OA 2QXFA 1MMDA 5GAMj 3PIOA 1KQ2A 2QGGA 1NYGA 3OYLA 2BUDA 4HVUA 1I81A 1VIFA 4DOWA 3JCMQ 3M53A 3BDUA 2QASA 3A98A 3MP6A 1YJNA 2V1RA 1JQQA 1I5LA 1RAHB 5CKHA 5KE3A 3M54A 2K3BA 2RHZA 1VQ5Q 1OU9A 2C0TA 4M75F 5KYUA 1M1KU 3EG2A 2CZ7B 1IRXA 4HVVA 1T3LA 2LRQA 2MMPA 1K8AR 3J81E 2COYA 4M7DG 1FMKA 2CP3A 2QQSA 1M3CA 2KRMA 1OZ3A 4N0AA 3PT9A 2LMJA 3MEWA 3QJ6A 1LOJA 2L89A 2DVJA 3X26B 2PZ1A 2HKQB 4A4KA 4LDWA 2O31A 4M7AD 3MP1A 2EKOA 1ZSZC 3ER0A 4J9GA 2SRCA 5L23A 2DETA 2KQWA 3QYGB 3V7RA 2OTLA 2K5FA 1RUWA 4M7AA 4MMLA 1VQ8T 3SD4A 1UGRB 1VIEA 1PHTA 4FT4A 1VQMQ 3QBYA 2A37A 4IUUA 4OMOA 1N8RU 2R5MA 1YHQT 2LCSA 3CD6T 1OULA 1MMGA 5IXBA 4ANJA 3L2UA 4BE0A 4M77C 5GAMg 1BK2A 1VQNQ 3M56A 1U8RA 4IUTA 3JSCA 3CCJQ 1HJDA 4RTWA 4XTYA 3CCLA 1RLPC 2CZ0B 2DTOA 1ZQ1A 1YFNA 1YCYA 1FMWA 3F70A 2M9UA 2DFUA 4WF2A 3LW5E 4OF1A 4X9DA 3CPFA 1OPKA 1PCXA 3M4YA 5IXFA 2XKOC 1G5VA 1NYFA 4ZTJA 4LN2A 2VV5A 3FLGA 2GNCA 2MCNA 3VS5A 2EFIA 1BKBA 3E1SA 2YUPA 1NJIU 3JB9D 3Q1JA 2MI6A 3VS7A 3NTKA 1AWOA 1C6VX 4AFUC 2J6FA 5J26A 3VS2A 4FIBA 2YRCA 3QSUA 2RN8A 2VYTA 3E9FA 1X27A 2JS2A 2L5QA 4E7IA 1K9MR 2RD1A 2K5IA 2JS0A 4J6WA 1AWJA 5LJ5f 3OY9A 5KYWB 1BBZA 4M7DF 4QKUA 3TQ7P 1BI3A 2KE9A 2CZ6B 1HYOA 1VQ9T 2QYZA 3I56Q 3QIIA 2PTKA 4C92E 4R56A 3UPUA 1NLOC 1UB4A 1BB9A 2RHUA 1RAEB 5LJ3f 4KGXB 1WJSA 2X3XD 3KBGA 2EJFA 4F7UB 5J3BA 2RI3A 5HK0A 1KK7A 1D0ZA 2RF0A 4KH1B 3UDCA 3OYHA 4BE2A 1K1ZA 1M90R 1SSHA 4HT9A 3CCSQ 3KFVA 3VU3C 4HXJA 2WSCE 3I5SA 3LH0A 3R6OA 4KRTA 2FZKB 4C92B 4OMQA 4LDVA 2JJ9A 1WLPB 4KGVB 4E7JA 2XK0A 1PSFA 1BYMA 1UEBA 2ZCFB 5AYFA 2VC8A 2R57A 2YLCA 2AKLA 1ABOA 2GQVA 3G4SQ 3JCMP 3NTIA 3S3MA 4N4HA 1VQ6A 1UGPB 1SPKA 1UECA 4M78G 4Y91A 3RUXA 4RTXA 2A08A 2LC4A 5HKCA 3FRNA 3MP8A 1KD1C 4L6V5 4A4GA 1YITT 2FRWA 1E6GA 1MNDA 2XDPA 4PL6A 2ZPBB 1PC0A 2MIOA 1WQWA 1ZHIA 4EDUA 2EYXA 4ELZC 2COWA 1TUCA 2YRDA 2OX7A 3GNFB 3JCMb 1WPYA 5GJVB 4QVZA 5I2MA 1ZSZA 2ED0A 1YI2Q 3QZ9B 5DLQE 1QQJA 1UHCA 1RAFB 3MKDA 1NEGA 2GCXA 2J06A 2ZPFB 1X01A 2EGEA 4RTVA 3EGDB 2NUTB 1WHGA 3I35A 4LE9A 2DM1A 3OMGA 2WSFE 2YXYA 4M77D 1GCQC 2CZ1B 2CUDA 5M9OA 2R5AA 4TVRA 4M77A 4QQ6A 3OYBA 4ZN3A 1IXDA 4BDYA 2GTOA 2EGAA 2IPOB 4AFZC 1N9SA 1Q82U 3OYGA 3CEYA 2CP6A 1TUGB 3PVQA 4BACA 2LCCA 1KFZA 4JLIA 3RESA 4X1VA 4FU6A 2FPFA 1VQ8A 4RG8A 1Q81R 2DBKA 2QI2A 2PVDB 5KYUB 1QVGS 5IN1A 3EFRA 3CD6A 3IQLA 1NPRA 1HSQA 2JW4A 2KROA 1X2QA 1MGQA 1IGQA 1D1BA 2DE0X 2L8DA 2RQVA 2QAZA 2RPNA 4BDZA 4C0FA 2HL3A 1WNLA 4M78F 3CCQT 3CQTA 1M3AA 2DIGA 3TU4K 1VQPQ 1B34B 1X69A 2CSIA 2LCLA 3CC4T 1T0JA 5C6SA 2Y4YA 4MDWA 5DY9A 3CMAT 4R0KA 2BZXA 5KYYA 4FW1A 2FYKA 1WXTA 1NZ9A 2DL4A 4EMKC 4C5IA 3S6WA 2FZGB 4M7AB 1VQKQ 4J9EA 3OB9A 3CCEA 1VQ7Q 3M4GA 2BKDN 2NWMA 2LQ8A 2LQKA 4OMLA 3R6NA 3QUIA 5D7UA 2EYWA 1LCKA 5GAN6 4XU1A 3TSZA 2X3WD 2MF2A 5GAOr 1I1JA 3PMTA 3TVTA 4C0DC 1QVGA 4MZPA 3EHQA 4F16A 3G7ZA 2A28A 2KI7A 2VWFA 2DLPA 3H0IA 2JM9A 4LD6A 2DO3A 1G3TA 2YUOA 1VQ4A 1TS9A 2F2XA 1E7OA 3RKWA 2AK5A 1S1NA 4PJOG 3CXCP 1VQ9A 4PKCC 1M27C 5LJ5j 2QK0A 4F14A 1X6GA 5LJ5d 1BI0A 2OAUA 1E6HA 2HDAA 3G6EA 3I56T 2G3RA 2D9TA 5GMKl 3X20B 4JUVA 4IIMA 3LGFA 3RNJA 3M0UA 2K5LA 1J3TA 5LJ3j 1I4K1 1Y57A 5CK9A 1W1FA 5LJ3d 2LT4A 1N6AA 2OTJQ 1EZZB 5CR2A 1ZUYA 3SWNC 2DAQA 3NMZC 3CCST 1GXIE 1PRMC 3CCUQ 2FPDA 2M02A 2LNHB 3HRUA 4C0GA 1UGSB 5ECAA 4M75C 2E4HA 1KSWA 3BE3A 4JZ3A 3CCRT 2BZYA 4K11A 2GGRA 2JT4A 3G4ST 5GANd 1KJWA 5HCKA 1OYXA 2RJFA 5FROA 4EMGA 4F7UF 1Y7XA 3EHRA 3KUFA 5DLOA 3U23A 1GCQA 3NFCA 1BI2A 5FU6C 1YITA 2X9HA 2KT8A 3AHUA 2DXUA 2AHJB 4PLIA 5CQYA 2V8IA 5L8RE 4XTWA 2XIDA 3PFSA 3PE0A 5FU7B 2B86A 1K8AC 2DD5A 2RA2A 5LJ5g 2CGHA 3KXTA 1VYVA 4N4IA 2Y90A 4Z88A 2L3PA 2GF7A 1JU5C 3JV3A 3UF4A 2H3EB 4D6WA 8AT1B 3FDRA 1YIJQ 3HTRA 3P8DA 3EG9B 4PFZA 5LJ3g 3TREA 4PJOF 1IREB 2JNGA 3OSSC 2JTMA 2L3QA 2WSEE 1LVKA 4MZMA 1WXBA 2K6DA 1YBYA 1N8RC 4HCCA 4BY6B 1M2VA 4O5VA 1JXOA 4M7AG 1HD3A 2DYBA 2LJ0A 3GNGA 1SSFA 1QW1A 2SEMA 4KGZB 3V8LA 1ACMB 2QQRA 4M77E 4OGCA 2RNAA 2DERA 4CC3A 2P0PA 1ZSZB 2VUBA 3INZA 4R55A 3SFMA 4EMKA 2D0QB 1W2BP 4NOYA 2RI2A 2FPEA 1P92A 1ZBJA 2AT1B 1OI1A 2XDBA 5GAN7 3L2RA 5CKBA 1M1FA 1B7TA 3EGDA 1IO6A 2CP5A 2NUTA 2DTHA 5GMKe 3L2QA 1PSEA 2QDYB 1SEMA 1Y0MA 4A4FA 4M77B 1NJIC 4M7DC 3VS3A 5J39A 9ATCB 3OYNA 1AVZC 2CUBA 1VQNA 1WYXA 2HD0A 2NUPB 3CC4A 1UG1A 3GOXA 1NEBA 2QA4T 2KAFA 3CMAA 5GAMd 1VQPT 1PD0A 1VQLQ 2HQHA 3CC2T 4C8QG 3OYJA 3CCVT 1K9MC 3QXEB 2MWPA 4HVWA 1YJWT 3X25B 5KYXA 2DRMA 1UTIA 4E7KA 2OJ2A 2MWOA 4LXCA 1OQKA 2LQWA 3MCAB 1K9AA 1UUEA 3PNWC 2DMOA 3MJXA 3VUZA 4BI8B 3A8GB 2DX1A 5I22A 1Z9QA 1Q7YR 5GJWB 1Y71A 3HL8A 3H41A 3H9NA 1KC8R 1RL2A 1WHMA 1NM7A 1K8AU 2EWNA 1X6BA 1QVPA 4J9HA 2XICA 4LD9K 2JOYA 2KDSA 1B34A 1M90C 2E12A 3V8JA 4M75D 1Z9ZA 5KYYB 1MNEA 2PUOB 5GAN8 1AZEA 5GMKi 5A0GA 2C06A 4OB1B 4J7IA 4M7AF 2IG0A 4IUVA 2KYMA 2KR3A 2VGNA 4M75A 1SKUB 2XD0A 2LDMA 4RCBA 2I2LA 2LTOA 4NS5A 2A3LA 1K73R 2O01E 1ABQA 3I56A 1YP5A 3J80E 4NL2A 4BE1A 4IIOA 2XG8D 1D09B
chains in the Genus database with same CATH topology
1UGPB 1YJNT 1D3BA 3OMCA 3CBMA 1QP3A 1Y96A 2DXBA 4M78G 4Y91A 3QYHB 5A2QE 2DIQA 3RUXA 5GANh 2LC4A 2LT1A 5HKCA 2RJDA 3O8VA 4PJOD 3M55A 3TCJA 3RIRA 3M57A 3FRNA 1KD1U 2LVMA 3MP8A 1KD1C 3RKYA 2K57A 5CQXA 3L1AA 4FT2A 4L6V5 4A4GA 1YITT 2EAYA 4V2SA 4C8QC 1QP2A 3CCSA 4PL6A 2LNVA 2XDPA 4L59A 2ZPBB 1Q86C 4PJOA 2ZPGB 1WQWA 4GY5A 2B8AA 3GPLA 1ZHIA 4IUPA 2RJCA 4EDUA 2DD4A 4ELZC 4KT0E 3GNFB 3JCMb 4PNOA 4C8QE 1R8OB 3CCMT 1YJ9T 1WPYA 3MHXA 3CCRA 3GIBA 4JS5A 4QVZA 1YIJA 1I5LA 1KHIA 2JN0A 3OBYA 2IVWA 2E5QA 3CMET 5I2MA 2PQWA 3G4SA 3PIPA 4BUGA 3CCET 1VQMA 2MAMA 3A8MB 1IZ6A 4C8QF 3QZ9B 5DLQE 3HHTB 3MEVA 3UWNA 4C5HA 1V29B 5FLXE 2GCXA 2ZPFB 4QW2A 2KMTA 1X01A 3V7SA 2OTLT 3A8HB 3DKMA 3BDLA 3NTHA 3OMGA 4J8OA 4RMOA 2WSFE 4M77D 3WVEB 2CZ1B 3V8KA 2EYQA 4FL6A 4B9XA 1G3YA 3MEAA 5M9OA 3I55T 4C8QB 2R5AA 4HKEA 4XTXA 3VJPA 4TVRA 3BFMA 4M77A 4QQ6A 3OYBA 3OYDA 3FB9A 3VKIA 4ZN3A 2HBPA 2JUFA 4DA4A 1S72A 3C94A 3CCJA 2ZPHB 4BDYA 3FC3A 4XK8E 4CRIA 1K9MU 4C0ZA 4RG2A 4KBMB 2QEXT 1UGQB 3JRZA 1N9SA 3MEUA 1VQ4T 1N9RA 1Q82U 3OYGA 1Q82C 2DEQA 5CKFA 3CEYA 2FB7A 3A8LB 2RH2A 3JB9G 4OVAA 3QG1A 4BI4A 5FRMA 4Z02A 4LDYA 2E1HA 3L42A 3RMQA 2FVUA 4BACA 5FU7C 1VQKT 2HQXA 2LCCA 3CCLT 3CC7A 1N27A 1OZ2A 1U1SA 1VQ7T 4JLIA 2H3JA 5HY6A 1YI2A 2F5KA 3RESA 3G6ET 4M78C 4JS4A 1FWZA 4FU6A 1VQ8A 4RG8A 1LNXA 5CKDA 3JCMh 4XTUA 2P4TA 4O6JA 4L5GA 2QI2A 1QVFS 5LJ5h 5GANj 1Q7YU 2PVDB 3META 4XAXB 4M7DG 1ZBXA 1QVGS 5IN1A 2O4XA 1M5Q1 3EFRA 1BI1A 3OS0A 1VQOA 3CD6A 2JZ2A 3LLRA 1NPRA 3CXCS 3SB2A 4M78E 1KC8U 4E7HA 1KC8C 4KULA 1MGQA 3HFNA 3FJPA 5HK3A 3HKSA 3SWNA 4XU2A 1M90U 2L8DA 4II1A 5D6YA 4F7UA 5GAOq 2HQEA 5A0LA 4JRPA 3OYMA 4KUDK 2Y4XA 4BDZA 4C0FA 1M1KC 5LJ3h 3X28B 1WNLA 4A53A 5D6WA 4M78F 3CCQT 2GFAA 5GMKh 3TU4K 2DIGA 4KUIA 4C92D 3OS1A 1B34B 2E10A 4OP0A 1JB0E 4BY6C 5GAOm 2E65A 2LCLA 3CC4T 3EFSA 2VXFA 1M8VA 5C6SA 2Y4YA 4MDWA 4A4HA 5DY9A 3CMAT 1G3WA 3LGLA 5GAN5 3HRTA 2M16A 3JCMc 2RI5A 2FYKA 4C92A 2X4XA 1NZ9A 4ELYC 1AHJB 3OQ5A 4OMFB 2PU9B 5KE2A 2EJ9A 3OYFA 1K73U 2F5TX 3OYYA 4M78B 4EMKC 4C5IA 3S6WA 5GAMh 4M7AB 3GLXA 3M58A 3CMEA 3P8BB 3OB9A 3JB9H 5DM7R 3CCEA 4VUBA 4M75G 3M4GA 3VYHB 2BKDN 5FRNA 3WXMB 3VYGA 2DZCA 2LQ8A 2LQKA 2HNIA 3QUIA 1X6OA 4BI3A 1WJQA 4ZGDB 5C0MA 1XNIA 3OS5A 5GAN6 4ZGEB 3EAEA 3QPHA 4XU1A 4HT8A 2X35A 2MF2A 3QO3A 3OS2A 2OTJT 3LWHA 2RO0A 1Q86U 5GAOr 1QVFA 2FL7A 3PTAA 3OYKA 4J6XA 3ZBDA 3PMTA 5GAN3 2ZZDA 3JB9I 4C0DC 3L2WA 1QVGA 2QA4A 4JRKA 4QVCA 5CIUA 4NL3A 1VQPA 3CCUT 3HRSA 4MZPA 2ZPEB 3CXCA 2F69A 3CC2A 2P0KA 4FSXA 3HSBA 3G7ZA 2DPPB 3G71A 3CCVA 4QVDA 2KY9A 5CO7A 2DO3A 4LD6A 1G3TA 4ZN1A 2P0QA 1VQ4A 1YJWA 4MDXA 5IAYA 4EMKB 3RKWA 1X75C 3JCMJ 4PJOG 2JTFA 4RCCA 3UT1A 5GANg 3JCMe 1VQ9A 4PKCC 1W4SA 2CS7A 3E19A 5LJ5e 3JCMd 5LJ5j 4E7LA 2E6ZA 5CAIA 5LJ5d 1BI0A 2OAUA 3JB9F 2KK4A 3G6EA 3QKJA 2PVOB 1VQ5T 3I56T 2G3RA 1M4ZA 2D9TA 3ASKA 4Q5WA 3X20B 5GMKl 1XOVA 3S3NA 5IT9E 1HK9A 1M9SA 4A54A 1Y07A 4J5YA 4JRQA 2K3YA 2RHIA 4JUVA 1VQ6T 2PUKB 2LX9A 2E6NA 3A5ZB 3LGFA 1WQ7A 4ME7A 3X24B 2RK2A 5GAOn 4C8QD 3JCMW 3PMIA 2K5LA 5LJ3e 5LJ3j 1I4K1 5A0DA 5GAN2 5CK9A 4C0DB 2DXCA 2DXTA 5GMKj 5LJ3d 2LT4A 1N6AA 5LL6S 4J7FA 2X4JA 5GMKm 5CR2A 4C8QA 4IUQA 1JRIA 3SWNC 3SDZA 3HP9A 3PGGA 4OB0B 2DAQA 4OGEA 3CCQA 3CCST 1XQHA 3HFOA 1GXIE 2FHDA 3ZFJA 2QTXA 3GF5A 3S3OA 2QXFA 1WGSA 3C4SA 2CKKA 3L2ZA 4C5EA 4M77G 3HRUA 4C0GA 5GAMj 3QHSA 3PIOA 3CPWS 1KQ2A 1UGSB 4M75C 4UC4A 5GAOp 3OYLA 4F7UE 2BUDA 3CCRT 1YIJT 1I81A 2YRVA 2EIFA 1VIFA 4C92C 3TEEA 5GANe 4DQ2A 4DOWA 3JCMQ 4M7DD 3M53A 3BDUA 1Q81U 1Q81C 1KQSS 3G4ST 1MHNA 3MP6A 5GANd 1YJNA 1OYXA 2XHCA 4M75E 1BIAA 2RJFA 2VGMA 5FROA 4EMGA 1Y7XA 5CKHA 3M54A 4F7UF 3KUFA 4X34A 5I2SA 2RHZA 5KE3A 3GP8A 5DLOA 2EQJA 3OYEA 2EJGA 3RERA 4M7DA 3OSVA 4YTLA 3BY7A 3NFCA 1BI2A 2V8JA 4M75F 5FU6C 2EQMA 3JB9J 1YITA 3V7CA 1M1KU 3AHUA 2DXUA 2RK1A 1RI0A 2AHJB 2CZ7B 4PLIA 5CQYA 5CVIA 3SWNB 1W2BS 2LRQA 1VQNT 2MMPA 2V8IA 3J81E 2DZ9A 5L8RE 4XTWA 2XIDA 4PJOC 2M0OA 3QJYA 3PFSA 1NE8A 2YHTA 5FU7B 1LJOA 2QQSA 3JCMg 2DD5A 3ZEHA 2DVEA 1K8AC 1OZ3A 2XU8A 2RA2A 3CCMA 1S72T 4N0AA 3PT9A 4F7UG 4M75B 5LJ5g 3CCJT 4XU0A 1YJ9A 2XI9A 3MEWA 3QJ6A 1FX7A 1LOJA 2CGHA 2L89A 2RJEA 3KXTA 4N4IA 2Y90A 3X26B 4Y28E 4PJOE 4M78D 3HPWA 2GF7A 4A4KA 4LDWA 2VXEA 1VQMT 4M7AD 4MZTA 4JDSA 3J7AF 3MP1A 2EKOA 4D6WA 3ER0A 3JCMV 3OW2S 4XTVA 3FDRA 4PLLA 5GANf 4IKFA 2KQWA 3QYGB 4M78A 4C92G 1D3BB 3P8DA 3V7RA 2OTLA 3CC7T 2ZGWA 5LJ3g 3TREA 4PJOF 1IREB 2JNGA 2K5FA 4XU3A 3CPWA 1Y96B 3OSSC 4GLKA 2JTMA 4M7AA 2V8KA 1JBMA 2WSEE 4JRIA 2DK3A 4MMLA 3SD4A 1UGRB 2JVVA 4MZMA 1VQ8T 1VIEA 4B9WA 3C12A 4FT4A 3QBYA 4IUUA 1YBYA 3M59A 3I55A 4JJNK 2K2VA 1N8RU 2CYZB 2R5MA 1YHQT 1N8RC 4HCCA 1EIFA 1VQOT 3CD6T 5I21A 2WACA 4BY6B 1KQSA 3ME9A 4N4GA 3L2UA 4O5VA 5CKEA 4PJOB 2BIVA 4BE0A 5KCOA 1G3SA 4M77C 2XDDA 5GAMg 4M7AG 2X4WA 2QEXA 2KSSA 3M56A 2K3XA 4OB3B 1U8RA 3LX7A 1VQLT 3GNGA 5CCAA 2KVQG 2EQUA 4IUTA 1SSFA 2D6FA 4IURA 3LWIA 1QW1A 3L2VA 3V8LA 4M77E 2QQRA 2QQBA 1W2BA 3JSCA 4OGCA 1VQKA 4XTYA 2P0PA 2VUBA 3INZA 4R55A 1JJ2S 3CCLA 3QDRB 2CZ0B 2DTOA 4LDUA 3SFMA 1ZQ1A 1VQ7A 3FEOA 3OYCA 1YCYA 4EMKA 3JCMX 2D0QB 3F70A 2M9UA 4NOYA 3VUBA 1XTDA 2E41A 2RI2A 4M77F 4WF2A 4XQ3A 3LW5E 4OF1A 3WVDB 1P92A 2EQKA 1OI1A 2XDBA 5GAN7 2M1HA 4J83A 4X9DA 3DLLA 3CPFA 1KHCA 3CBOA 1NPPA 2A7YA 2RB6A 3M4YA 3L2RA 2XKOC 1G5VA 5CKBA 5EG2A 1M1FA 2VV5A 1H641 3FLGA 4FM4B 1KQ1A 4ZTJA 4RKUE 4LDXA 2L3RA 2DTHA 5GMKe 2EFIA 1BKBA 3E1SA 4XTZA 1FXXA 4EMHA 1PSEA 2QDYB 4HCZA 3L2QA 3OW2A 1NJIU 2E64A 4A4FA 4M77B 3JB9D 1NJIC 3Q1JA 4M7DC 2MI6A 5D6XA 5J39A 3NTKA 3H6ZA 3A8OB 3OYNA 3T9NA 5J26A 3OYAA 4FIBA 1VQNA 3QSUA 2HD0A 2VYTA 5GAMe 3E9FA 3CC4A 2R58A 3GOXA 4OB2B 1M1GA 2L5QA 3N5BB 4M7DE 2GFUA 2QA4T 2KAFA 4J6YA 5GAMd 3M9QA 3CMAA 2DKGA 4E7IA 3RMSA 3DB4A 1VQPT 2RD1A 2K5IA 4MMKA 3CC2T 5GAN4 1U1TA 4J6WA 3QZ5B 3JCMf 4C8QG 3OYJA 3G71T 3CCVT 1K9MC 4N0AC 1VUBA 2PVGB 2MWPA 3QXEB 3VV0A 5LJ5f 3OY9A 1YJWT 4QQDA 3X25B 4BB7A 1KG1A 4M7DF 4E7KA 2DTIA 2MWOA 1BI3A 4HA8A 4E47A 3BW1A 2CZ6B 3E9GA 1VQ9T 4ATOA 2X4YA 3LYIA 3DLMA 3MCAB 4HCBA 4X9CA 1BIBA 3QIIA 4C92E 4R56A 3UPUA 2O4XB 1UB4A 3PNWC 4EPCA 3VUZA 4BI8B 1DJ7B 3A8GB 1JJ2A 2RHUA 1WJRA 3MO8A 2RM4A 5LJ3f 4M7DB 1I8FA 4M7AC 1Y71A 2OTJA 4ZGJB 4BD3A 1WJSA 3JAME 3KBGA 2EJFA 4F7UB 3HL8A 5J3BA 4C92F 3OA6A 1Q7YC 2RI3A 5HK0A 4ZTFA 5KH6A 1YHQA 1RL2A 4CI0C 3CBPA 1O75A 4A4EA 3OYIA 1K8AU 2EWNA 2RHXA 5GAOl 3UDCA 1QVPA 3M5AA 3CCUA 2XICA 2QQ9A 3RKXA 3OYHA 4BE2A 4LD9K 4M7AE 2JOYA 4HT9A 2YLBA 3VU3C 2KDSA 1B34A 1M90C 2E12A 3V8JA 3URGA 2WSCE 4M75D 3LH0A 3OBWA 5GAMf 5KCHA 1H3ZA 3R6OA 4C92B 1VQLA 2QQAA 2PUOB 5GAN8 3P8HA 4C5GA 1HXDA 4LDVA 5A0GA 5GMKi 2C06A 4OB1B 4J7IA 4M7AF 4QQGA 2IG0A 4E7JA 4IUVA 2XK0A 2ZPIB 1O9SA 2VGNA 4M75A 1PSFA 2XD0A 1BYMA 1UEBA 2ZCFB 2LDMA 5AYFA 4RCBA 2I2LA 2VC8A 2LTOA 2R57A 4NS5A 2A3LA 2YLCA 3FIFA 1TH7A 2O01E 1YI2T 4DOVA 2GQVA 1VQ5A 2K4YA 3I56A 2RHYA 3JCMP 3C95A 1K73C 4JLGA 3H8ZA 3DB3A 3J80E 2NLUA 5FU6B 4NL2A 3NTIA 4BE1A 3S3MA 4N4HA 2DJZA 2XG8D 1VQ6A 2E70A 4P5NA 2HAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGP B;  2D0Q B;  3WVD B;  3LW5 E;  1QP3 A;  2DXB A;  3QYH B;  3X28 B;  1UGS B;  1JB0 E;  4FM4 B;  4L6V 5;  4RKU E;  1QP2 A;  1PSE A;  2QDY B;  2ZPB B;  2ZPG B;  1AHJ B;  2PU9 B;  3A8O B;  2DD4 A;  4KT0 E;  3VYH B;  3VYG A;  4OB2 B;  2CZ7 B;  2AHJ B;  4ZGD B;  3QZ5 B;  5L8R E;  4ZGE B;  3A8M B;  3QZ9 B;  3HHT B;  2PVG B;  3QXE B;  1V29 B;  3X25 B;  2DD5 A;  2ZPF B;  3A8H B;  2CZ6 B;  2ZZD A;  2WSF E;  3WVE B;  2CZ1 B;  3X26 B;  4Y28 E;  2ZPE B;  1DJ7 B;  3A8G B;  2DPP B;  4ZGJ B;  3QYG B;  2ZPH B;  1IRE B;  4XK8 E;  2WSE E;  1UGR B;  1UGQ B;  3A8L B;  2CYZ B;  2PVO B;  2WSC E;  3X20 B;  2PUO B;  2PUK B;  4OB1 B;  3X24 B;  2ZPI B;  1PSF A;  4OB3 B;  2ZCF B;  2DXC A;  2PVD B;  2O01 E;  4OB0 B;  2CZ0 B;  1GXI E; 
#chains in the Genus database with same CATH topology
 1D3B A;  5IHK A;  3OMC A;  2K79 A;  1Y96 A;  5A2Q E;  2CP7 A;  3PVL A;  2LT1 A;  2JMA A;  3O8V A;  3TCJ A;  1Q86 R;  4FT2 A;  4B6M A;  3CCS A;  2LNV A;  4L59 A;  2DA9 A;  1S72 Q;  2ZPG B;  4JPB W;  2B8A A;  2RJC A;  2YWW A;  4KT0 E;  4PNO A;  3CCM T;  3CCR A;  2E5K A;  2JN0 A;  2Z0W A;  2IVW A;  3EGU A;  3G4S A;  3CC7 Q;  3PIP A;  3CCE T;  3A8M B;  3AT1 B;  4C8Q F;  2YSQ A;  2OAW A;  1UGV A;  1N5Z A;  4C5H A;  5FLX E;  1UJY A;  3V7S A;  2EBP A;  1XJW B;  1EFN A;  3A8H B;  3DKM A;  2PNI A;  1U3O A;  1YJN Q;  3V8K A;  1WA7 A;  4B9X A;  1G3Y A;  3OW2 P;  3SEM A;  3I55 T;  4HKE A;  1RAA B;  4XTX A;  3VJP A;  3VKI A;  4ZNX A;  2HBP A;  1WXU A;  3C94 A;  4XK8 E;  4CRI A;  1K9M U;  1F1B B;  1B3Q A;  4C0Z A;  2QEX T;  1UGQ B;  2LQN A;  4WCI A;  1VOM A;  1VQ4 T;  1N9R A;  3VS6 A;  1Q82 C;  2J6K A;  3O5Z A;  4PJM A;  2O9S A;  2FB7 A;  2RH2 A;  1AT1 B;  5FRM A;  4FCY A;  2COZ A;  2YUQ A;  4LDY A;  3EG3 A;  1GCP A;  1G83 A;  1OZ2 A;  1CKA A;  3CME Q;  2F5K A;  3G6E T;  1YI2 A;  4M78 C;  3NHN A;  3EFO A;  3JCM h;  2P4T A;  4O6J A;  4AFQ C;  3QDF A;  1JJ2 P;  2DL3 A;  2OTL Q;  3OS0 A;  3LLR A;  2A0F B;  1H3H A;  4E7H A;  1M3B A;  1ZUU A;  3HFN A;  1M90 U;  3J7A F;  5GAO q;  1QCO A;  5IHN A;  5GMK h;  4KUI A;  1WHJ A;  2E10 A;  1MMN A;  5GAO m;  2E65 A;  2VXF A;  3G71 Q;  1M8V A;  3QWY A;  1TUD A;  1G3W A;  5GAN 5;  3HRT A;  2M16 A;  3JCM c;  4ELY C;  1AHJ B;  3OQ5 A;  3OYF A;  2DIL A;  4CC2 A;  3GLX A;  3P8B B;  2A36 A;  4OMM A;  3CCL Q;  4VUB A;  3EG9 A;  3VYH B;  2DZC A;  2AZV A;  2HNI A;  1WJQ A;  2CH4 W;  1XNI A;  2CP0 A;  4ZGE B;  1M2V B;  3QPH A;  2X35 A;  2KEA A;  2AZS A;  3LWH A;  2RO0 A;  4J6X A;  3ZBD A;  5GAN 3;  2QA4 A;  1LPL A;  4NL3 A;  1VQP A;  3HRS A;  3CC2 A;  4FSX A;  1ZSG A;  2DPP B;  3CCV A;  4ZN1 A;  2QTV A;  2F2V A;  2P0Q A;  1UE9 A;  1WIE A;  3C0C A;  5IAY A;  1YJW A;  4EMK B;  1OU8 A;  4RTY A;  4MDX A;  3EH2 A;  5FW9 A;  1TTH B;  4RCC A;  2KNB B;  2KRS A;  2CS7 A;  5LJ5 e;  2KK4 A;  3QKJ A;  1VQ5 T;  1SHF A;  3ASK A;  4Q5W A;  3S3N A;  1HK9 A;  4A54 A;  2EKH A;  4GLM A;  2K3Y A;  2RHI A;  2PUK B;  2E6N A;  1IB8 A;  1RLQ C;  2RK2 A;  3JCM W;  3PMI A;  5LJ3 e;  2KXC A;  1IGU A;  2C0I A;  4C0D B;  1MV3 A;  1PWT A;  1D0Y A;  1NG2 A;  1JRI A;  2NUP A;  3SDZ A;  3HP9 A;  3ZFJ A;  1WGS A;  3C4S A;  2CKK A;  1YJ9 Q;  5KYX B;  3MPU B;  3QHS A;  4UC4 A;  2AKK A;  2QG9 B;  2YRV A;  4C92 C;  5GAN e;  4DQ2 A;  2GBQ A;  1Q81 U;  2HKN A;  1MHN A;  3H0F A;  2XHC A;  4M75 E;  4E7Z A;  1MUZ A;  1PM3 A;  1BIA A;  2K9G A;  1VQM T;  5I2S A;  4X34 A;  1AOJ A;  2EQJ A;  3OYE A;  4DEY A;  2EJG A;  3RER A;  2K7A A;  2L3S A;  3BY7 A;  1I0C A;  3E2U A;  2V8J A;  3V7C A;  1QWF A;  2RK1 A;  1RI0 A;  4AG2 C;  3SWN B;  4F17 A;  3M0S A;  1VQN T;  2DZ9 A;  3EG0 A;  4PJO C;  8ATC B;  3QJY A;  3ZEH A;  1OPL A;  1LJO A;  2XU8 A;  1S72 T;  3CCM A;  3CCJ T;  4F7U G;  4M75 B;  4XU0 A;  2XI9 A;  4WTO B;  1FX7 A;  2RJE A;  4Y28 E;  4M78 D;  3I9Q A;  1K0S A;  4JDS A;  2BZ8 A;  3JCM V;  3OW2 S;  4XTV A;  4PLL A;  4M78 A;  4C92 G;  1D3B B;  3CC7 T;  1H92 A;  2ZGW A;  1JO8 A;  4XU3 A;  4J9I A;  1Y96 B;  4GLK A;  2V8K A;  4JRI A;  1IHW A;  3M59 A;  3I55 A;  1AWX A;  2K2V A;  2CYZ B;  3RBB B;  1EIF A;  1WZO A;  1ARK A;  2BE7 D;  4N4G A;  5CKE A;  2BIV A;  1PKT A;  1G3S A;  1KD1 R;  2QEX A;  2KSS A;  4Z8A A;  1AEY A;  2F2W A;  2KVQ G;  2QDL A;  2D6F A;  4IUR A;  3LWI A;  3L2V A;  2FG0 A;  2QQB A;  1JJ2 S;  3QDR B;  3OYC A;  4PJL A;  3VUB A;  1XTD A;  1VYU A;  2E41 A;  1K0X A;  2P4R A;  3RR6 A;  4M4Z A;  2EQK A;  4J83 A;  4D8D A;  3DLL A;  1ZA2 B;  2GTJ A;  1KHC A;  3CBO A;  1NPP A;  2A7Y A;  1QLY A;  5EG2 A;  1UHF A;  4FM4 B;  4RKU E;  1VQ8 Q;  3FJ5 A;  4HCZ A;  3OW2 A;  2E64 A;  1YHQ Q;  3H6Z A;  4OMP A;  3T9N A;  5KYN A;  1GBQ A;  3REA B;  3RDV A;  1Q95 G;  4PJJ A;  5GAM e;  1C1A A;  2R58 A;  1M1G A;  3N5B B;  4M7D E;  2DKG A;  1M2O A;  1WI7 A;  2CH4 A;  4MMK A;  4FYV B;  2KGT A;  2GQI A;  1U1T A;  4ORZ A;  3QZ5 B;  3JCM f;  1ZX6 A;  3G71 T;  1QMC A;  1RI9 A;  4N0A C;  4E6R A;  1B07 A;  1KG1 A;  4BB7 A;  2E3I A;  3EFO B;  2DTI A;  4E47 A;  2JXB A;  3E9G A;  4PFO A;  5FWB A;  4ATO A;  3DLM A;  4PJN A;  3EH1 A;  4EPC A;  1JJ2 A;  1DJ7 B;  3MO8 A;  4M7D B;  1I8F A;  4M7A C;  4ZGJ B;  4BD3 A;  2YT6 A;  3JAM E;  4C92 F;  3OA6 A;  1Q7Y C;  3D7S B;  4CI0 C;  4A4E A;  5GAO l;  1PD1 A;  2QQ9 A;  1SHG A;  2YLB A;  1VYT A;  2D8H A;  5I11 A;  2HSP A;  1H3Z A;  5KCH A;  3OBW A;  2NYS A;  1TG0 A;  1VQL A;  4C5G A;  2VB6 A;  2ZPI B;  2LZ6 B;  1O9S A;  2NUZ A;  2EW3 A;  3M0Q A;  3TSW A;  1YI2 T;  4DOV A;  1VQ5 A;  4LUE A;  1AWW A;  3C95 A;  1K73 C;  4JLG A;  3H8Z A;  1VQ9 Q;  3CPW P;  3VS1 A;  3M0T A;  1YWP A;  1QP3 A;  3QYH B;  5GAN h;  1TOV A;  2RJD A;  4PJO D;  3M55 A;  3M57 A;  1KQS P;  2IIM A;  3RKY A;  2K57 A;  1C0M A;  2YDL A;  5CQX A;  3L1A A;  4V2S A;  2EAY A;  4C8Q C;  1QP2 A;  2MYS A;  1UFF A;  1UDL A;  1T3S A;  1Q86 C;  4PJO A;  3UA7 A;  1MV0 B;  4FYW B;  1YJ9 T;  2HL5 C;  3MHX A;  3GIB A;  1OX8 A;  3A1P A;  2KBT A;  4A63 B;  2F1L A;  4AG1 C;  1FMV A;  2DL7 A;  4E2F B;  4JS5 A;  3OBY A;  2PQW A;  4BUG A;  5IH2 A;  1VQM A;  2MAM A;  1IZ6 A;  3HHT B;  4FSS A;  3UWN A;  4FYY B;  1V29 B;  2V26 A;  1SF9 A;  4J9D A;  5IHI A;  2DRK A;  1A0N B;  3NTH A;  1VQO Q;  2QGF B;  3WVE B;  2EYQ A;  1SG5 A;  2ENM A;  1D1C A;  3OYD A;  4FYX B;  4DA4 A;  4Y92 A;  1S72 A;  3CCJ A;  2ZPH B;  3VRY A;  4KBM B;  3JRZ A;  3MEU A;  1SRL A;  2OI3 A;  3JB9 G;  3A8L B;  1GRI A;  4BI4 A;  2E1H A;  3L42 A;  2FVU A;  3VS0 A;  5FU7 C;  1VQK T;  2HQX A;  2HBW A;  3CC7 A;  4FW2 A;  3ULR B;  2LX7 A;  1U1S A;  1VQ7 T;  1OEB A;  2H3J A;  4JS4 A;  2RQR A;  1LNX A;  5CKD A;  4JJC A;  1Q7Y U;  4PFP A;  2P84 A;  2O4X A;  3CXC S;  3SB2 A;  4M78 E;  1KC8 U;  5HK3 A;  3FJP A;  1M1K R;  3SWN A;  4KUD K;  2FZC B;  2CRE A;  2AIR B;  4A53 A;  2ESW A;  4F04 B;  1JB0 E;  4BY6 C;  1PRL C;  1RAG B;  1OX9 A;  3EFS A;  4E7S A;  4RTU A;  4A4H A;  3LGL A;  2X4X A;  5KE2 A;  1K73 U;  2PU9 B;  2EJ9 A;  2F5T X;  4M78 B;  5GAM h;  3NPF A;  3CME A;  3JB9 H;  7AT1 B;  5AT1 B;  5DM7 R;  2L0A A;  1BU1 A;  5FRN A;  3WXM B;  3VYG A;  4BI3 A;  5C0M A;  4J9C A;  1W6X A;  3EG1 A;  3EAE A;  2X51 A;  2BTT A;  1N8R R;  2OTJ T;  1Q86 U;  3PTA A;  2DL5 A;  3OYK A;  2ZZD A;  3L2W A;  4JRK A;  3UA6 A;  4QVC A;  1QCF A;  2DL8 A;  3CCU T;  2EYZ A;  2ZPE B;  3CXC A;  1GL5 A;  2P0K A;  2YUN A;  3CCQ Q;  3HSB A;  3G71 A;  2KY9 A;  5CO7 A;  2E3H A;  1TWB A;  1QVG P;  2J6O A;  1WHK A;  1X75 C;  3CC4 Q;  1U5S A;  3CMA Q;  2FO0 A;  2J05 A;  1PG5 B;  1ZUK A;  2RQW A;  3JCM d;  2E6Z A;  5CAI A;  4LUD A;  1KIK A;  5EC7 A;  3JB9 F;  2PVO B;  1M4Z A;  3VS4 A;  1XOV A;  5IT9 E;  4J5Y A;  4JRQ A;  2LX9 A;  3A5Z B;  3X24 B;  4C8Q D;  1RAD B;  1NJI R;  1RAC B;  1T0H A;  5GMK j;  4J7F A;  4D8K A;  1I5O B;  1RAI B;  2CT4 A;  5GMK m;  4C8Q A;  4IUQ A;  4RUG A;  2ABL A;  4OGE A;  2RQT A;  1XQH A;  2FHD A;  3GF5 A;  4C5E A;  3L2Z A;  1QWE A;  4M77 G;  2DF6 A;  3VRZ A;  2JMC A;  4DBQ A;  3CPW S;  5GAO p;  4F7U E;  2L2P A;  1WX6 A;  1YIJ T;  2EIF A;  2CDT A;  2EVR A;  3TEE A;  2ZAE A;  4M7D D;  1Q81 C;  1KQS S;  2VGM A;  4RTZ A;  3ZL7 C;  3GP8 A;  1IHV A;  3G1J A;  4M7D A;  1MMA A;  3OSV A;  4YTL A;  2BE9 B;  2EGC A;  1X43 A;  2H8H A;  2EQM A;  3JB9 J;  3SHW A;  1GBR A;  5CVI A;  1W2B S;  1YWO A;  1JXM A;  2VAS A;  1VA7 A;  2M0O A;  1AD5 A;  1NE8 A;  2YHT A;  3JCM g;  2DVE A;  1YJ9 A;  4DEX A;  3THK A;  4PJO E;  3HPW A;  2VXE A;  4MZT A;  3EGX A;  1X2K A;  4QT7 A;  3CCR Q;  5GAN f;  4IKF A;  3I5R A;  2J7I A;  2KT1 A;  3CPW A;  2CSQ A;  2D0N A;  1JBM A;  2HCK A;  2DK3 A;  4OMN A;  2JVV A;  2KXD A;  4B9W A;  3C12 A;  4DBH A;  2DYI A;  4JJN K;  1VQO T;  5I21 A;  2WAC A;  1KQS A;  3ME9 A;  4PJO B;  1YNZ A;  5KCO A;  2XDD A;  1WHH A;  2X4W A;  1QVF P;  4GBQ A;  4PK4 A;  2K3X A;  4OB3 B;  3UAT A;  1VQL T;  2MOX A;  3LX7 A;  2EPD A;  5CCA A;  2EQU A;  2C0O A;  2RQU A;  1W2B A;  2CP2 A;  3H0H A;  1VQK A;  4LDU A;  1VQ7 A;  3FEO A;  3JCM X;  4AMC A;  3REB B;  1TSF A;  4M77 F;  4XQ3 A;  3WVD B;  2M1H A;  4CC4 B;  4JJD A;  2FEI A;  2RB6 A;  2XMF A;  1H64 1;  1KQ1 A;  4LDX A;  2L3R A;  2DNU A;  4XTZ A;  1FXX A;  4EMH A;  1QCN A;  1R77 A;  2O88 A;  5D6X A;  3M0R A;  3A8O B;  2M0Y A;  2LJ3 A;  3OYA A;  4DBF A;  2EYY A;  1V1C A;  4OB2 B;  2GFU A;  4J6Y A;  3M9Q A;  3RMS A;  3DB4 A;  5GAN 4;  2ECZ A;  1Q82 R;  2MK5 A;  1VUB A;  2PVG B;  3VV0 A;  4QQD A;  4HA8 A;  3BW1 A;  2X4Y A;  3LYI A;  1BCO A;  4HCB A;  2K2M A;  1BIB A;  4X9C A;  2O4X B;  1CKB A;  1K76 A;  2ED1 A;  1WJR A;  1VQ6 Q;  2RM4 A;  1D0X A;  2OTJ A;  1M30 A;  1WHL A;  1YCS B;  4ZTF A;  5KH6 A;  1YHQ A;  1UJ0 A;  3CBP A;  1O75 A;  1GFD A;  2JM8 A;  3OYI A;  2RHX A;  3M5A A;  3CCU A;  3RKX A;  4Z89 A;  4M7A E;  5GAM f;  2VVK A;  3URG A;  2QQA A;  3P8H A;  4RTT A;  1HXD A;  4AT1 B;  2QA4 Q;  1ZA1 B;  4QQG A;  3CC2 Q;  2HEQ A;  3M0P A;  3CCV Q;  4KH0 B;  1JEG A;  3NGP A;  3FIF A;  1YJW Q;  1TH7 A;  2LP5 A;  1I07 A;  2K4Y A;  2RHY A;  4ESR A;  3DB3 A;  2NLU A;  5FU6 B;  1PKS A;  1K4U S;  2DJZ A;  2E70 A;  4P5N A;  2W0Z A;  2JTE A;  5CKF A;  2HAX A;  1YJN T;  1GFC A;  3CBM A;  2DXB A;  2DIQ A;  1G2B A;  2RMO A;  2LJ1 A;  3RIR A;  1ZLM A;  3QWX X;  1KD1 U;  2LVM A;  2EQI A;  1OOT A;  1G8X A;  1WDX A;  4GY5 A;  3GPL A;  2KRN A;  4IUP A;  1TXQ A;  2DD4 A;  4C8Q E;  1R8O B;  3LH5 A;  1YIJ A;  1FYN A;  1KHI A;  2G6F X;  2E5Q A;  3CME T;  3MEV A;  5FWC A;  2FRY A;  4QW2 A;  2OTL T;  2KMT A;  2ROT A;  2MPX C;  1H8K A;  3BDL A;  4J8O A;  4JJB A;  4RMO A;  3CD6 Q;  4FL6 A;  2D1X A;  3MEA A;  4C8Q B;  2HZY A;  3BFM A;  3FB9 A;  2JUF A;  4EIK A;  1W70 A;  2O2O A;  3FC3 A;  1OV3 A;  4RG2 A;  1BCM A;  2DEQ A;  2I0N A;  4OVA A;  3QG1 A;  4Z02 A;  3CCM Q;  3RMQ A;  1RAB B;  4DBR A;  4J9F A;  3CCL T;  1N27 A;  4HCK A;  5HY6 A;  5KYW A;  1FWZ A;  3CCE Q;  2VKN A;  4XTU A;  2W10 A;  4L5G A;  1QVF S;  5LJ5 h;  5GAN j;  3MET A;  4XAX B;  1ZBX A;  1VQO A;  1M5Q 1;  1R0B G;  1BI1 A;  4J9B A;  2JZ2 A;  1KC8 C;  4KUL A;  1PNJ A;  3HKS A;  1TU0 B;  4XU2 A;  4II1 A;  2KYB A;  1AZG B;  5D6Y A;  2HQE A;  4AFS C;  4F7U A;  5A0L A;  3OYM A;  3I55 Q;  4JRP A;  2Y4X A;  1M1K C;  5LJ3 h;  3X28 B;  5D6W A;  2GFA A;  4C92 D;  3OS1 A;  4OP0 A;  2DBM A;  2V1Q A;  2QEX Q;  1VQ4 Q;  2RI5 A;  3EGX B;  4C92 A;  1U06 A;  4OMF B;  3OYY A;  1CSK A;  3M58 A;  1YN8 A;  4M75 G;  2DEU A;  3G6E Q;  1V76 A;  1X6O A;  4ZGD B;  3OS5 A;  1EX4 A;  2CT3 A;  4HT8 A;  3QO3 A;  3OS2 A;  2M51 A;  4JZ4 A;  1QVF A;  2FL7 A;  1QKX A;  2ROL A;  3JB9 I;  5CIU A;  1SRM A;  1WFW A;  2F69 A;  1QKW A;  4QVD A;  2D8J A;  4CC7 A;  2O9V A;  3GBQ A;  3JCM J;  2HMA A;  2JTF A;  2DJQ A;  3UT1 A;  5GAN g;  3JCM e;  4LNP A;  6AT1 B;  1W4S A;  2HSE B;  3E19 A;  4E7L A;  1R0C B;  1NLP C;  1NBE B;  1D1A A;  1M9S A;  1Y07 A;  1VQ6 T;  4ME7 A;  1WQ7 A;  5GAO n;  5A0D A;  5GAN 2;  1YIT Q;  2DXC A;  2DXT A;  1M8M A;  5LL6 S;  2X4J A;  2ATC B;  4OB0 B;  3PGG A;  3CCQ A;  3HFO A;  2QTX A;  3S3O A;  2QXF A;  1MMD A;  5GAM j;  3PIO A;  1KQ2 A;  2QGG A;  1NYG A;  3OYL A;  2BUD A;  4HVU A;  1I81 A;  1VIF A;  4DOW A;  3JCM Q;  3M53 A;  3BDU A;  2QAS A;  3A98 A;  3MP6 A;  1YJN A;  2V1R A;  1JQQ A;  1I5L A;  1RAH B;  5CKH A;  5KE3 A;  3M54 A;  2K3B A;  2RHZ A;  1VQ5 Q;  1OU9 A;  2C0T A;  4M75 F;  5KYU A;  1M1K U;  3EG2 A;  2CZ7 B;  1IRX A;  4HVV A;  1T3L A;  2LRQ A;  2MMP A;  1K8A R;  3J81 E;  2COY A;  4M7D G;  1FMK A;  2CP3 A;  2QQS A;  1M3C A;  2KRM A;  1OZ3 A;  4N0A A;  3PT9 A;  2LMJ A;  3MEW A;  3QJ6 A;  1LOJ A;  2L89 A;  2DVJ A;  3X26 B;  2PZ1 A;  2HKQ B;  4A4K A;  4LDW A;  2O31 A;  4M7A D;  3MP1 A;  2EKO A;  1ZSZ C;  3ER0 A;  4J9G A;  2SRC A;  5L23 A;  2DET A;  2KQW A;  3QYG B;  3V7R A;  2OTL A;  2K5F A;  1RUW A;  4M7A A;  4MML A;  1VQ8 T;  3SD4 A;  1UGR B;  1VIE A;  1PHT A;  4FT4 A;  1VQM Q;  3QBY A;  2A37 A;  4IUU A;  4OMO A;  1N8R U;  2R5M A;  1YHQ T;  2LCS A;  3CD6 T;  1OUL A;  1MMG A;  5IXB A;  4ANJ A;  3L2U A;  4BE0 A;  4M77 C;  5GAM g;  1BK2 A;  1VQN Q;  3M56 A;  1U8R A;  4IUT A;  3JSC A;  3CCJ Q;  1HJD A;  4RTW A;  4XTY A;  3CCL A;  1RLP C;  2CZ0 B;  2DTO A;  1ZQ1 A;  1YFN A;  1YCY A;  1FMW A;  3F70 A;  2M9U A;  2DFU A;  4WF2 A;  3LW5 E;  4OF1 A;  4X9D A;  3CPF A;  1OPK A;  1PCX A;  3M4Y A;  5IXF A;  2XKO C;  1G5V A;  1NYF A;  4ZTJ A;  4LN2 A;  2VV5 A;  3FLG A;  2GNC A;  2MCN A;  3VS5 A;  2EFI A;  1BKB A;  3E1S A;  2YUP A;  1NJI U;  3JB9 D;  3Q1J A;  2MI6 A;  3VS7 A;  3NTK A;  1AWO A;  1C6V X;  4AFU C;  2J6F A;  5J26 A;  3VS2 A;  4FIB A;  2YRC A;  3QSU A;  2RN8 A;  2VYT A;  3E9F A;  1X27 A;  2JS2 A;  2L5Q A;  4E7I A;  1K9M R;  2RD1 A;  2K5I A;  2JS0 A;  4J6W A;  1AWJ A;  5LJ5 f;  3OY9 A;  5KYW B;  1BBZ A;  4M7D F;  4QKU A;  3TQ7 P;  1BI3 A;  2KE9 A;  2CZ6 B;  1HYO A;  1VQ9 T;  2QYZ A;  3I56 Q;  3QII A;  2PTK A;  4C92 E;  4R56 A;  3UPU A;  1NLO C;  1UB4 A;  1BB9 A;  2RHU A;  1RAE B;  5LJ3 f;  4KGX B;  1WJS A;  2X3X D;  3KBG A;  2EJF A;  4F7U B;  5J3B A;  2RI3 A;  5HK0 A;  1KK7 A;  1D0Z A;  2RF0 A;  4KH1 B;  3UDC A;  3OYH A;  4BE2 A;  1K1Z A;  1M90 R;  1SSH A;  4HT9 A;  3CCS Q;  3KFV A;  3VU3 C;  4HXJ A;  2WSC E;  3I5S A;  3LH0 A;  3R6O A;  4KRT A;  2FZK B;  4C92 B;  4OMQ A;  4LDV A;  2JJ9 A;  1WLP B;  4KGV B;  4E7J A;  2XK0 A;  1PSF A;  1BYM A;  1UEB A;  2ZCF B;  5AYF A;  2VC8 A;  2R57 A;  2YLC A;  2AKL A;  1ABO A;  2GQV A;  3G4S Q;  3JCM P;  3NTI A;  3S3M A;  4N4H A;  1VQ6 A;  1UGP B;  1SPK A;  1UEC A;  4M78 G;  4Y91 A;  3RUX A;  4RTX A;  2A08 A;  2LC4 A;  5HKC A;  3FRN A;  3MP8 A;  1KD1 C;  4L6V 5;  4A4G A;  1YIT T;  2FRW A;  1E6G A;  1MND A;  2XDP A;  4PL6 A;  2ZPB B;  1PC0 A;  2MIO A;  1WQW A;  1ZHI A;  4EDU A;  2EYX A;  4ELZ C;  2COW A;  1TUC A;  2YRD A;  2OX7 A;  3GNF B;  3JCM b;  1WPY A;  5GJV B;  4QVZ A;  5I2M A;  1ZSZ A;  2ED0 A;  1YI2 Q;  3QZ9 B;  5DLQ E;  1QQJ A;  1UHC A;  1RAF B;  3MKD A;  1NEG A;  2GCX A;  2J06 A;  2ZPF B;  1X01 A;  2EGE A;  4RTV A;  3EGD B;  2NUT B;  1WHG A;  3I35 A;  4LE9 A;  2DM1 A;  3OMG A;  2WSF E;  2YXY A;  4M77 D;  1GCQ C;  2CZ1 B;  2CUD A;  5M9O A;  2R5A A;  4TVR A;  4M77 A;  4QQ6 A;  3OYB A;  4ZN3 A;  1IXD A;  4BDY A;  2GTO A;  2EGA A;  2IPO B;  4AFZ C;  1N9S A;  1Q82 U;  3OYG A;  3CEY A;  2CP6 A;  1TUG B;  3PVQ A;  4BAC A;  2LCC A;  1KFZ A;  4JLI A;  3RES A;  4X1V A;  4FU6 A;  2FPF A;  1VQ8 A;  4RG8 A;  1Q81 R;  2DBK A;  2QI2 A;  2PVD B;  5KYU B;  1QVG S;  5IN1 A;  3EFR A;  3CD6 A;  3IQL A;  1NPR A;  1HSQ A;  2JW4 A;  2KRO A;  1X2Q A;  1MGQ A;  1IGQ A;  1D1B A;  2DE0 X;  2L8D A;  2RQV A;  2QAZ A;  2RPN A;  4BDZ A;  4C0F A;  2HL3 A;  1WNL A;  4M78 F;  3CCQ T;  3CQT A;  1M3A A;  2DIG A;  3TU4 K;  1VQP Q;  1B34 B;  1X69 A;  2CSI A;  2LCL A;  3CC4 T;  1T0J A;  5C6S A;  2Y4Y A;  4MDW A;  5DY9 A;  3CMA T;  4R0K A;  2BZX A;  5KYY A;  4FW1 A;  2FYK A;  1WXT A;  1NZ9 A;  2DL4 A;  4EMK C;  4C5I A;  3S6W A;  2FZG B;  4M7A B;  1VQK Q;  4J9E A;  3OB9 A;  3CCE A;  1VQ7 Q;  3M4G A;  2BKD N;  2NWM A;  2LQ8 A;  2LQK A;  4OML A;  3R6N A;  3QUI A;  5D7U A;  2EYW A;  1LCK A;  5GAN 6;  4XU1 A;  3TSZ A;  2X3W D;  2MF2 A;  5GAO r;  1I1J A;  3PMT A;  3TVT A;  4C0D C;  1QVG A;  4MZP A;  3EHQ A;  4F16 A;  3G7Z A;  2A28 A;  2KI7 A;  2VWF A;  2DLP A;  3H0I A;  2JM9 A;  4LD6 A;  2DO3 A;  1G3T A;  2YUO A;  1VQ4 A;  1TS9 A;  2F2X A;  1E7O A;  3RKW A;  2AK5 A;  1S1N A;  4PJO G;  3CXC P;  1VQ9 A;  4PKC C;  1M27 C;  5LJ5 j;  2QK0 A;  4F14 A;  1X6G A;  5LJ5 d;  1BI0 A;  2OAU A;  1E6H A;  2HDA A;  3G6E A;  3I56 T;  2G3R A;  2D9T A;  5GMK l;  3X20 B;  4JUV A;  4IIM A;  3LGF A;  3RNJ A;  3M0U A;  2K5L A;  1J3T A;  5LJ3 j;  1I4K 1;  1Y57 A;  5CK9 A;  1W1F A;  5LJ3 d;  2LT4 A;  1N6A A;  2OTJ Q;  1EZZ B;  5CR2 A;  1ZUY A;  3SWN C;  2DAQ A;  3NMZ C;  3CCS T;  1GXI E;  1PRM C;  3CCU Q;  2FPD A;  2M02 A;  2LNH B;  3HRU A;  4C0G A;  1UGS B;  5ECA A;  4M75 C;  2E4H A;  1KSW A;  3BE3 A;  4JZ3 A;  3CCR T;  2BZY A;  4K11 A;  2GGR A;  2JT4 A;  3G4S T;  5GAN d;  1KJW A;  5HCK A;  1OYX A;  2RJF A;  5FRO A;  4EMG A;  4F7U F;  1Y7X A;  3EHR A;  3KUF A;  5DLO A;  3U23 A;  1GCQ A;  3NFC A;  1BI2 A;  5FU6 C;  1YIT A;  2X9H A;  2KT8 A;  3AHU A;  2DXU A;  2AHJ B;  4PLI A;  5CQY A;  2V8I A;  5L8R E;  4XTW A;  2XID A;  3PFS A;  3PE0 A;  5FU7 B;  2B86 A;  1K8A C;  2DD5 A;  2RA2 A;  5LJ5 g;  2CGH A;  3KXT A;  1VYV A;  4N4I A;  2Y90 A;  4Z88 A;  2L3P A;  2GF7 A;  1JU5 C;  3JV3 A;  3UF4 A;  2H3E B;  4D6W A;  8AT1 B;  3FDR A;  1YIJ Q;  3HTR A;  3P8D A;  3EG9 B;  4PFZ A;  5LJ3 g;  3TRE A;  4PJO F;  1IRE B;  2JNG A;  3OSS C;  2JTM A;  2L3Q A;  2WSE E;  1LVK A;  4MZM A;  1WXB A;  2K6D A;  1YBY A;  1N8R C;  4HCC A;  4BY6 B;  1M2V A;  4O5V A;  1JXO A;  4M7A G;  1HD3 A;  2DYB A;  2LJ0 A;  3GNG A;  1SSF A;  1QW1 A;  2SEM A;  4KGZ B;  3V8L A;  1ACM B;  2QQR A;  4M77 E;  4OGC A;  2RNA A;  2DER A;  4CC3 A;  2P0P A;  1ZSZ B;  2VUB A;  3INZ A;  4R55 A;  3SFM A;  4EMK A;  2D0Q B;  1W2B P;  4NOY A;  2RI2 A;  2FPE A;  1P92 A;  1ZBJ A;  2AT1 B;  1OI1 A;  2XDB A;  5GAN 7;  3L2R A;  5CKB A;  1M1F A;  1B7T A;  3EGD A;  1IO6 A;  2CP5 A;  2NUT A;  2DTH A;  5GMK e;  3L2Q A;  1PSE A;  2QDY B;  1SEM A;  1Y0M A;  4A4F A;  4M77 B;  1NJI C;  4M7D C;  3VS3 A;  5J39 A;  9ATC B;  3OYN A;  1AVZ C;  2CUB A;  1VQN A;  1WYX A;  2HD0 A;  2NUP B;  3CC4 A;  1UG1 A;  3GOX A;  1NEB A;  2QA4 T;  2KAF A;  3CMA A;  5GAM d;  1VQP T;  1PD0 A;  1VQL Q;  2HQH A;  3CC2 T;  4C8Q G;  3OYJ A;  3CCV T;  1K9M C;  3QXE B;  2MWP A;  4HVW A;  1YJW T;  3X25 B;  5KYX A;  2DRM A;  1UTI A;  4E7K A;  2OJ2 A;  2MWO A;  4LXC A;  1OQK A;  2LQW A;  3MCA B;  1K9A A;  1UUE A;  3PNW C;  2DMO A;  3MJX A;  3VUZ A;  4BI8 B;  3A8G B;  2DX1 A;  5I22 A;  1Z9Q A;  1Q7Y R;  5GJW B;  1Y71 A;  3HL8 A;  3H41 A;  3H9N A;  1KC8 R;  1RL2 A;  1WHM A;  1NM7 A;  1K8A U;  2EWN A;  1X6B A;  1QVP A;  4J9H A;  2XIC A;  4LD9 K;  2JOY A;  2KDS A;  1B34 A;  1M90 C;  2E12 A;  3V8J A;  4M75 D;  1Z9Z A;  5KYY B;  1MNE A;  2PUO B;  5GAN 8;  1AZE A;  5GMK i;  5A0G A;  2C06 A;  4OB1 B;  4J7I A;  4M7A F;  2IG0 A;  4IUV A;  2KYM A;  2KR3 A;  2VGN A;  4M75 A;  1SKU B;  2XD0 A;  2LDM A;  4RCB A;  2I2L A;  2LTO A;  4NS5 A;  2A3L A;  1K73 R;  2O01 E;  1ABQ A;  3I56 A;  1YP5 A;  3J80 E;  4NL2 A;  4BE1 A;  4IIO A;  2XG8 D;  1D09 B; 
#chains in the Genus database with same CATH homology
 1UGP B;  1YJN T;  1D3B A;  3OMC A;  3CBM A;  1QP3 A;  1Y96 A;  2DXB A;  4M78 G;  4Y91 A;  3QYH B;  5A2Q E;  2DIQ A;  3RUX A;  5GAN h;  2LC4 A;  2LT1 A;  5HKC A;  2RJD A;  3O8V A;  4PJO D;  3M55 A;  3TCJ A;  3RIR A;  3M57 A;  3FRN A;  1KD1 U;  2LVM A;  3MP8 A;  1KD1 C;  3RKY A;  2K57 A;  5CQX A;  3L1A A;  4FT2 A;  4L6V 5;  4A4G A;  1YIT T;  2EAY A;  4V2S A;  4C8Q C;  1QP2 A;  3CCS A;  4PL6 A;  2LNV A;  2XDP A;  4L59 A;  2ZPB B;  1Q86 C;  4PJO A;  2ZPG B;  1WQW A;  4GY5 A;  2B8A A;  3GPL A;  1ZHI A;  4IUP A;  2RJC A;  4EDU A;  2DD4 A;  4ELZ C;  4KT0 E;  3GNF B;  3JCM b;  4PNO A;  4C8Q E;  1R8O B;  3CCM T;  1YJ9 T;  1WPY A;  3MHX A;  3CCR A;  3GIB A;  4JS5 A;  4QVZ A;  1YIJ A;  1I5L A;  1KHI A;  2JN0 A;  3OBY A;  2IVW A;  2E5Q A;  3CME T;  5I2M A;  2PQW A;  3G4S A;  3PIP A;  4BUG A;  3CCE T;  1VQM A;  2MAM A;  3A8M B;  1IZ6 A;  4C8Q F;  3QZ9 B;  5DLQ E;  3HHT B;  3MEV A;  3UWN A;  4C5H A;  1V29 B;  5FLX E;  2GCX A;  2ZPF B;  4QW2 A;  2KMT A;  1X01 A;  3V7S A;  2OTL T;  3A8H B;  3DKM A;  3BDL A;  3NTH A;  3OMG A;  4J8O A;  4RMO A;  2WSF E;  4M77 D;  3WVE B;  2CZ1 B;  3V8K A;  2EYQ A;  4FL6 A;  4B9X A;  1G3Y A;  3MEA A;  5M9O A;  3I55 T;  4C8Q B;  2R5A A;  4HKE A;  4XTX A;  3VJP A;  4TVR A;  3BFM A;  4M77 A;  4QQ6 A;  3OYB A;  3OYD A;  3FB9 A;  3VKI A;  4ZN3 A;  2HBP A;  2JUF A;  4DA4 A;  1S72 A;  3C94 A;  3CCJ A;  2ZPH B;  4BDY A;  3FC3 A;  4XK8 E;  4CRI A;  1K9M U;  4C0Z A;  4RG2 A;  4KBM B;  2QEX T;  1UGQ B;  3JRZ A;  1N9S A;  3MEU A;  1VQ4 T;  1N9R A;  1Q82 U;  3OYG A;  1Q82 C;  2DEQ A;  5CKF A;  3CEY A;  2FB7 A;  3A8L B;  2RH2 A;  3JB9 G;  4OVA A;  3QG1 A;  4BI4 A;  5FRM A;  4Z02 A;  4LDY A;  2E1H A;  3L42 A;  3RMQ A;  2FVU A;  4BAC A;  5FU7 C;  1VQK T;  2HQX A;  2LCC A;  3CCL T;  3CC7 A;  1N27 A;  1OZ2 A;  1U1S A;  1VQ7 T;  4JLI A;  2H3J A;  5HY6 A;  1YI2 A;  2F5K A;  3RES A;  3G6E T;  4M78 C;  4JS4 A;  1FWZ A;  4FU6 A;  1VQ8 A;  4RG8 A;  1LNX A;  5CKD A;  3JCM h;  4XTU A;  2P4T A;  4O6J A;  4L5G A;  2QI2 A;  1QVF S;  5LJ5 h;  5GAN j;  1Q7Y U;  2PVD B;  3MET A;  4XAX B;  4M7D G;  1ZBX A;  1QVG S;  5IN1 A;  2O4X A;  1M5Q 1;  3EFR A;  1BI1 A;  3OS0 A;  1VQO A;  3CD6 A;  2JZ2 A;  3LLR A;  1NPR A;  3CXC S;  3SB2 A;  4M78 E;  1KC8 U;  4E7H A;  1KC8 C;  4KUL A;  1MGQ A;  3HFN A;  3FJP A;  5HK3 A;  3HKS A;  3SWN A;  4XU2 A;  1M90 U;  2L8D A;  4II1 A;  5D6Y A;  4F7U A;  5GAO q;  2HQE A;  5A0L A;  4JRP A;  3OYM A;  4KUD K;  2Y4X A;  4BDZ A;  4C0F A;  1M1K C;  5LJ3 h;  3X28 B;  1WNL A;  4A53 A;  5D6W A;  4M78 F;  3CCQ T;  2GFA A;  5GMK h;  3TU4 K;  2DIG A;  4KUI A;  4C92 D;  3OS1 A;  1B34 B;  2E10 A;  4OP0 A;  1JB0 E;  4BY6 C;  5GAO m;  2E65 A;  2LCL A;  3CC4 T;  3EFS A;  2VXF A;  1M8V A;  5C6S A;  2Y4Y A;  4MDW A;  4A4H A;  5DY9 A;  3CMA T;  1G3W A;  3LGL A;  5GAN 5;  3HRT A;  2M16 A;  3JCM c;  2RI5 A;  2FYK A;  4C92 A;  2X4X A;  1NZ9 A;  4ELY C;  1AHJ B;  3OQ5 A;  4OMF B;  2PU9 B;  5KE2 A;  2EJ9 A;  3OYF A;  1K73 U;  2F5T X;  3OYY A;  4M78 B;  4EMK C;  4C5I A;  3S6W A;  5GAM h;  4M7A B;  3GLX A;  3M58 A;  3CME A;  3P8B B;  3OB9 A;  3JB9 H;  5DM7 R;  3CCE A;  4VUB A;  4M75 G;  3M4G A;  3VYH B;  2BKD N;  5FRN A;  3WXM B;  3VYG A;  2DZC A;  2LQ8 A;  2LQK A;  2HNI A;  3QUI A;  1X6O A;  4BI3 A;  1WJQ A;  4ZGD B;  5C0M A;  1XNI A;  3OS5 A;  5GAN 6;  4ZGE B;  3EAE A;  3QPH A;  4XU1 A;  4HT8 A;  2X35 A;  2MF2 A;  3QO3 A;  3OS2 A;  2OTJ T;  3LWH A;  2RO0 A;  1Q86 U;  5GAO r;  1QVF A;  2FL7 A;  3PTA A;  3OYK A;  4J6X A;  3ZBD A;  3PMT A;  5GAN 3;  2ZZD A;  3JB9 I;  4C0D C;  3L2W A;  1QVG A;  2QA4 A;  4JRK A;  4QVC A;  5CIU A;  4NL3 A;  1VQP A;  3CCU T;  3HRS A;  4MZP A;  2ZPE B;  3CXC A;  2F69 A;  3CC2 A;  2P0K A;  4FSX A;  3HSB A;  3G7Z A;  2DPP B;  3G71 A;  3CCV A;  4QVD A;  2KY9 A;  5CO7 A;  2DO3 A;  4LD6 A;  1G3T A;  4ZN1 A;  2P0Q A;  1VQ4 A;  1YJW A;  4MDX A;  5IAY A;  4EMK B;  3RKW A;  1X75 C;  3JCM J;  4PJO G;  2JTF A;  4RCC A;  3UT1 A;  5GAN g;  3JCM e;  1VQ9 A;  4PKC C;  1W4S A;  2CS7 A;  3E19 A;  5LJ5 e;  3JCM d;  5LJ5 j;  4E7L A;  2E6Z A;  5CAI A;  5LJ5 d;  1BI0 A;  2OAU A;  3JB9 F;  2KK4 A;  3G6E A;  3QKJ A;  2PVO B;  1VQ5 T;  3I56 T;  2G3R A;  1M4Z A;  2D9T A;  3ASK A;  4Q5W A;  3X20 B;  5GMK l;  1XOV A;  3S3N A;  5IT9 E;  1HK9 A;  1M9S A;  4A54 A;  1Y07 A;  4J5Y A;  4JRQ A;  2K3Y A;  2RHI A;  4JUV A;  1VQ6 T;  2PUK B;  2LX9 A;  2E6N A;  3A5Z B;  3LGF A;  1WQ7 A;  4ME7 A;  3X24 B;  2RK2 A;  5GAO n;  4C8Q D;  3JCM W;  3PMI A;  2K5L A;  5LJ3 e;  5LJ3 j;  1I4K 1;  5A0D A;  5GAN 2;  5CK9 A;  4C0D B;  2DXC A;  2DXT A;  5GMK j;  5LJ3 d;  2LT4 A;  1N6A A;  5LL6 S;  4J7F A;  2X4J A;  5GMK m;  5CR2 A;  4C8Q A;  4IUQ A;  1JRI A;  3SWN C;  3SDZ A;  3HP9 A;  3PGG A;  4OB0 B;  2DAQ A;  4OGE A;  3CCQ A;  3CCS T;  1XQH A;  3HFO A;  1GXI E;  2FHD A;  3ZFJ A;  2QTX A;  3GF5 A;  3S3O A;  2QXF A;  1WGS A;  3C4S A;  2CKK A;  3L2Z A;  4C5E A;  4M77 G;  3HRU A;  4C0G A;  5GAM j;  3QHS A;  3PIO A;  3CPW S;  1KQ2 A;  1UGS B;  4M75 C;  4UC4 A;  5GAO p;  3OYL A;  4F7U E;  2BUD A;  3CCR T;  1YIJ T;  1I81 A;  2YRV A;  2EIF A;  1VIF A;  4C92 C;  3TEE A;  5GAN e;  4DQ2 A;  4DOW A;  3JCM Q;  4M7D D;  3M53 A;  3BDU A;  1Q81 U;  1Q81 C;  1KQS S;  3G4S T;  1MHN A;  3MP6 A;  5GAN d;  1YJN A;  1OYX A;  2XHC A;  4M75 E;  1BIA A;  2RJF A;  2VGM A;  5FRO A;  4EMG A;  1Y7X A;  5CKH A;  3M54 A;  4F7U F;  3KUF A;  4X34 A;  5I2S A;  2RHZ A;  5KE3 A;  3GP8 A;  5DLO A;  2EQJ A;  3OYE A;  2EJG A;  3RER A;  4M7D A;  3OSV A;  4YTL A;  3BY7 A;  3NFC A;  1BI2 A;  2V8J A;  4M75 F;  5FU6 C;  2EQM A;  3JB9 J;  1YIT A;  3V7C A;  1M1K U;  3AHU A;  2DXU A;  2RK1 A;  1RI0 A;  2AHJ B;  2CZ7 B;  4PLI A;  5CQY A;  5CVI A;  3SWN B;  1W2B S;  2LRQ A;  1VQN T;  2MMP A;  2V8I A;  3J81 E;  2DZ9 A;  5L8R E;  4XTW A;  2XID A;  4PJO C;  2M0O A;  3QJY A;  3PFS A;  1NE8 A;  2YHT A;  5FU7 B;  1LJO A;  2QQS A;  3JCM g;  2DD5 A;  3ZEH A;  2DVE A;  1K8A C;  1OZ3 A;  2XU8 A;  2RA2 A;  3CCM A;  1S72 T;  4N0A A;  3PT9 A;  4F7U G;  4M75 B;  5LJ5 g;  3CCJ T;  4XU0 A;  1YJ9 A;  2XI9 A;  3MEW A;  3QJ6 A;  1FX7 A;  1LOJ A;  2CGH A;  2L89 A;  2RJE A;  3KXT A;  4N4I A;  2Y90 A;  3X26 B;  4Y28 E;  4PJO E;  4M78 D;  3HPW A;  2GF7 A;  4A4K A;  4LDW A;  2VXE A;  1VQM T;  4M7A D;  4MZT A;  4JDS A;  3J7A F;  3MP1 A;  2EKO A;  4D6W A;  3ER0 A;  3JCM V;  3OW2 S;  4XTV A;  3FDR A;  4PLL A;  5GAN f;  4IKF A;  2KQW A;  3QYG B;  4M78 A;  4C92 G;  1D3B B;  3P8D A;  3V7R A;  2OTL A;  3CC7 T;  2ZGW A;  5LJ3 g;  3TRE A;  4PJO F;  1IRE B;  2JNG A;  2K5F A;  4XU3 A;  3CPW A;  1Y96 B;  3OSS C;  4GLK A;  2JTM A;  4M7A A;  2V8K A;  1JBM A;  2WSE E;  4JRI A;  2DK3 A;  4MML A;  3SD4 A;  1UGR B;  2JVV A;  4MZM A;  1VQ8 T;  1VIE A;  4B9W A;  3C12 A;  4FT4 A;  3QBY A;  4IUU A;  1YBY A;  3M59 A;  3I55 A;  4JJN K;  2K2V A;  1N8R U;  2CYZ B;  2R5M A;  1YHQ T;  1N8R C;  4HCC A;  1EIF A;  1VQO T;  3CD6 T;  5I21 A;  2WAC A;  4BY6 B;  1KQS A;  3ME9 A;  4N4G A;  3L2U A;  4O5V A;  5CKE A;  4PJO B;  2BIV A;  4BE0 A;  5KCO A;  1G3S A;  4M77 C;  2XDD A;  5GAM g;  4M7A G;  2X4W A;  2QEX A;  2KSS A;  3M56 A;  2K3X A;  4OB3 B;  1U8R A;  3LX7 A;  1VQL T;  3GNG A;  5CCA A;  2KVQ G;  2EQU A;  4IUT A;  1SSF A;  2D6F A;  4IUR A;  3LWI A;  1QW1 A;  3L2V A;  3V8L A;  4M77 E;  2QQR A;  2QQB A;  1W2B A;  3JSC A;  4OGC A;  1VQK A;  4XTY A;  2P0P A;  2VUB A;  3INZ A;  4R55 A;  1JJ2 S;  3CCL A;  3QDR B;  2CZ0 B;  2DTO A;  4LDU A;  3SFM A;  1ZQ1 A;  1VQ7 A;  3FEO A;  3OYC A;  1YCY A;  4EMK A;  3JCM X;  2D0Q B;  3F70 A;  2M9U A;  4NOY A;  3VUB A;  1XTD A;  2E41 A;  2RI2 A;  4M77 F;  4WF2 A;  4XQ3 A;  3LW5 E;  4OF1 A;  3WVD B;  1P92 A;  2EQK A;  1OI1 A;  2XDB A;  5GAN 7;  2M1H A;  4J83 A;  4X9D A;  3DLL A;  3CPF A;  1KHC A;  3CBO A;  1NPP A;  2A7Y A;  2RB6 A;  3M4Y A;  3L2R A;  2XKO C;  1G5V A;  5CKB A;  5EG2 A;  1M1F A;  2VV5 A;  1H64 1;  3FLG A;  4FM4 B;  1KQ1 A;  4ZTJ A;  4RKU E;  4LDX A;  2L3R A;  2DTH A;  5GMK e;  2EFI A;  1BKB A;  3E1S A;  4XTZ A;  1FXX A;  4EMH A;  1PSE A;  2QDY B;  4HCZ A;  3L2Q A;  3OW2 A;  1NJI U;  2E64 A;  4A4F A;  4M77 B;  3JB9 D;  1NJI C;  3Q1J A;  4M7D C;  2MI6 A;  5D6X A;  5J39 A;  3NTK A;  3H6Z A;  3A8O B;  3OYN A;  3T9N A;  5J26 A;  3OYA A;  4FIB A;  1VQN A;  3QSU A;  2HD0 A;  2VYT A;  5GAM e;  3E9F A;  3CC4 A;  2R58 A;  3GOX A;  4OB2 B;  1M1G A;  2L5Q A;  3N5B B;  4M7D E;  2GFU A;  2QA4 T;  2KAF A;  4J6Y A;  5GAM d;  3M9Q A;  3CMA A;  2DKG A;  4E7I A;  3RMS A;  3DB4 A;  1VQP T;  2RD1 A;  2K5I A;  4MMK A;  3CC2 T;  5GAN 4;  1U1T A;  4J6W A;  3QZ5 B;  3JCM f;  4C8Q G;  3OYJ A;  3G71 T;  3CCV T;  1K9M C;  4N0A C;  1VUB A;  2PVG B;  2MWP A;  3QXE B;  3VV0 A;  5LJ5 f;  3OY9 A;  1YJW T;  4QQD A;  3X25 B;  4BB7 A;  1KG1 A;  4M7D F;  4E7K A;  2DTI A;  2MWO A;  1BI3 A;  4HA8 A;  4E47 A;  3BW1 A;  2CZ6 B;  3E9G A;  1VQ9 T;  4ATO A;  2X4Y A;  3LYI A;  3DLM A;  3MCA B;  4HCB A;  4X9C A;  1BIB A;  3QII A;  4C92 E;  4R56 A;  3UPU A;  2O4X B;  1UB4 A;  3PNW C;  4EPC A;  3VUZ A;  4BI8 B;  1DJ7 B;  3A8G B;  1JJ2 A;  2RHU A;  1WJR A;  3MO8 A;  2RM4 A;  5LJ3 f;  4M7D B;  1I8F A;  4M7A C;  1Y71 A;  2OTJ A;  4ZGJ B;  4BD3 A;  1WJS A;  3JAM E;  3KBG A;  2EJF A;  4F7U B;  3HL8 A;  5J3B A;  4C92 F;  3OA6 A;  1Q7Y C;  2RI3 A;  5HK0 A;  4ZTF A;  5KH6 A;  1YHQ A;  1RL2 A;  4CI0 C;  3CBP A;  1O75 A;  4A4E A;  3OYI A;  1K8A U;  2EWN A;  2RHX A;  5GAO l;  3UDC A;  1QVP A;  3M5A A;  3CCU A;  2XIC A;  2QQ9 A;  3RKX A;  3OYH A;  4BE2 A;  4LD9 K;  4M7A E;  2JOY A;  4HT9 A;  2YLB A;  3VU3 C;  2KDS A;  1B34 A;  1M90 C;  2E12 A;  3V8J A;  3URG A;  2WSC E;  4M75 D;  3LH0 A;  3OBW A;  5GAM f;  5KCH A;  1H3Z A;  3R6O A;  4C92 B;  1VQL A;  2QQA A;  2PUO B;  5GAN 8;  3P8H A;  4C5G A;  1HXD A;  4LDV A;  5A0G A;  5GMK i;  2C06 A;  4OB1 B;  4J7I A;  4M7A F;  4QQG A;  2IG0 A;  4E7J A;  4IUV A;  2XK0 A;  2ZPI B;  1O9S A;  2VGN A;  4M75 A;  1PSF A;  2XD0 A;  1BYM A;  1UEB A;  2ZCF B;  2LDM A;  5AYF A;  4RCB A;  2I2L A;  2VC8 A;  2LTO A;  2R57 A;  4NS5 A;  2A3L A;  2YLC A;  3FIF A;  1TH7 A;  2O01 E;  1YI2 T;  4DOV A;  2GQV A;  1VQ5 A;  2K4Y A;  3I56 A;  2RHY A;  3JCM P;  3C95 A;  1K73 C;  4JLG A;  3H8Z A;  3DB3 A;  3J80 E;  2NLU A;  5FU6 B;  4NL2 A;  3NTI A;  4BE1 A;  3S3M A;  4N4H A;  2DJZ A;  2XG8 D;  1VQ6 A;  2E70 A;  4P5N A;  2HAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...