2PUKB

Crystal structure of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin m
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
73
structure length
73
Chain Sequence
b'MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
molecule tags Electron transport
source organism Synechocystis sp.
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
total genus 10
structure length 73
sequence length 73
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pukB00
4ZGEB 2CZ0B 1UGSB 1GXIE 1PSEA 2PUKB 4OB1B 3VYGA 2WSFE 1DJ7B 3X26B 4KT0E 3X25B 2ZCFB 3WVEB 3A8LB 3QXEB 1QP3A 3VYHB 2AHJB 2ZPBB 3X24B 2PUOB 3WVDB 2PU9B 2WSEE 4OB3B 1JB0E 4RKUE 2QDYB 3X20B 4OB2B 2PVDB 1UGPB 4Y28E 1QP2A 2ZPFB 3LW5E 2CYZB 1AHJB 1UGQB 4ZGDB 4ZGJB 2DD5A 3QZ9B 3A8MB 2ZZDA 2PVGB 2CZ1B 1PSFA 2ZPHB 5L8RE 2DXCA 3A8HB 2PVOB 4OB0B 2D0QB 2ZPGB 2ZPEB 2ZPIB 1UGRB 2WSCE 3QYHB 4FM4B 2DD4A 3A8GB 1V29B 2CZ7B 3A8OB 3HHTB 3QYGB 3QZ5B 4XK8E 2DXBA 1IREB 2CZ6B 2DPPB 2O01E 4L6V5 3X28B
chains in the Genus database with same CATH superfamily
1OULA 4ELYC 4PL6A 4N0AC 2O88A 3M53A 2OAUA 2LQKA 1ZQ1A 2DL5A 2FPDA 2DZCA 1QVGA 3TU4K 5FWCA 4NL2A 5CKHA 4CI0C 3VUZA 3G6EA 1G5VA 5CKEA 2RJFA 5GAMj 5GANd 3MO8A 5GAOq 1YJ9A 4AT1B 2DO3A 1LOJA 1ZSZC 1WHLA 1A0NB 3FJ5A 4RTUA 3SHWA 1Z9ZA 5A0DA 1IGUA 1CSKA 4X34A 5GAOr 3OYEA 1Y07A 4B9WA 5FU6B 2FB7A 1X2KA 2OI3A 3SB2A 2DD5A 3S3OA 1D09B 3PMIA 4BE2A 2MF2A 1VOMA 3L1AA 1HK9A 4Q5WA 3A8GB 3G71T 2VYTA 2BIVA 1VQ7Q 4DA4A 2MYSA 1K9MC 1BI2A 1Y0MA 3ER0A 2C0IA 1SHGA 2VB6A 3BDUA 1EIFA 4J5YA 2YDLA 3M55A 2DL8A 4PK4A 4BB7A 2RJCA 1MMAA 5IT9E 3MEVA 5L8RE 4DOWA 4E7IA 3OMCA 1WFWA 3NFCA 1U3OA 1D1BA 4E7KA 4C5EA 2KT8A 1KIKA 3G6ET 5IHIA 1UGSB 3EG2A 1W2BS 2HDAA 2KY9A 3QXEB 3OA6A 2AHJB 2ZPBB 3ZL7C 3EG0A 2LMJA 4PLIA 2KT1A 4C92G 2HL3A 2HSEB 1Q81R 1VQ8T 3G4SA 4AFZC 3ASKA 4J83A 5FW9A 4EMKC 1YWPA 2NLUA 1WHKA 4AG2C 1H8KA 3UT1A 1R0BG 2AZVA 2JMAA 1SF9A 3QWYA 2RJEA 1QW1A 2FHDA 2FZCB 1KK7A 3VKIA 1D3BA 4PJOB 1YJWQ 2COWA 2JVVA 3DLLA 2O4XB 3QG1A 1NPRA 4HA8A 2DNUA 4PJOF 1VQKQ 4J6WA 4GBQA 1UE9A 1ABQA 2WSCE 4FM4B 1UGVA 1C6VX 2EJ9A 1UECA 4MDXA 1ZUYA 1H3ZA 1YN8A 3DB4A 1QCOA 2JM8A 2E41A 4Z8AA 3A8LB 3VYHB 2PU9B 2CT4A 4FYYB 2YLBA 2V8JA 4A53A 3QO3A 1Q82R 2XDBA 2A0FB 1M5Q1 2O4XA 1I5LA 1OU8A 3JCMd 2D0QB 5J3BA 3CCMQ 1X69A 2EYQA 2L5QA 1TSFA 2OTLT 2RF0A 3PE0A 3OYMA 4Z02A 1GL5A 5GMKh 1X01A 1N27A 3C0CA 1OU9A 2E6NA 2VGNA 2A37A 3EFOB 5LJ5h 2HSPA 1YIJA 2D8HA 3A8HB 1VQ9T 1N8RC 2EYWA 1D0ZA 2K9GA 2X4JA 2JXBA 1UG1A 4R55A 3HKSA 1N6AA 2O01E 4C0FA 5LJ3e 2YXYA 5KH6A 1P92A 3CBOA 2OTLA 2OJ2A 1M30A 2RA2A 1YJNT 3NTKA 1QWFA 3OY9A 4PNOA 4X1VA 5FLXE 3REAB 1SSFA 2ZAEA 2DTIA 2VV5A 4OGEA 4X9CA 5GAN4 1YJ9Q 1B3QA 5KCOA 3PMTA 1YHQQ 2J05A 2AT1B 5LJ3d 5GAN8 1GCPA 2CSQA 2E10A 1ZBJA 1XOVA 5GAMe 1VIFA 4ZNXA 2EIFA 2PVDB 4M7DC 2K57A 3I5SA 1HSQA 2DBMA 4A4HA 1W1FA 4FL6A 3MPUB 3A8OB 4TVRA 3BY7A 2RD1A 2J06A 4J9CA 5GMKl 4ZN3A 1NPPA 3CPWA 5IXBA 3META 3C12A 3JCMP 1YIJQ 2XI9A 2EJGA 4C8QD 1X6OA 3PT9A 3CC4Q 2X51A 3CMET 2CUDA 3E9FA 4C92A 3OQ5A 1WHMA 5GJVB 4XK8E 1FX7A 2P0PA 4BI8B 2RHIA 2JJ9A 3KXTA 4L5GA 4FW2A 2DIQA 2A08A 4B9XA 1MGQA 2DL4A 3X25B 5KYYA 1VIEA 2DAQA 3M0TA 1N9SA 3JCMV 3HTRA 1ZX6A 4XTYA 2MOXA 3V8JA 1QVGP 3AHUA 1OZ2A 2X35A 3MKDA 1WXUA 3PIOA 1MMDA 2KEAA 1Q82C 1JJ2A 2CZ0B 1S72T 2K5FA 2MWOA 3D7SB 4BDYA 3THKA 3QDRB 1M1GA 4M7AD 2JS0A 4PJJA 2NUTA 2YUQA 2RPNA 3SDZA 2OTLQ 2P4RA 4XTUA 3JCMW 2JTFA 4VUBA 5GAOp 3OYDA 2LP5A 2I2LA 2GQIA 4CC7A 4HT9A 2F2XA 1K76A 2K3BA 2D8JA 4M78E 3HFNA 2F2WA 2EYZA 1YP5A 2AKLA 4FW1A 5KYWB 1D1CA 1IO6A 1RACB 2EVRA 2LQ8A 4M77A 1JU5C 1UUEA 1QMCA 3KUFA 1VQNQ 4M7AB 3JSCA 3CCST 3KBGA 1Q86R 1XTDA 1QLYA 1YITA 1J3TA 3OYBA 2LJ0A 1Q81C 4J9BA 3CEYA 2G3RA 1M90C 1MV0B 4QT7A 1WJRA 1PSEA 3CC4T 1Y57A 2K6DA 1YI2A 1ZSZB 7AT1B 1D0YA 4D6WA 2CYZB 4FT2A 2OTJA 4DQ2A 1ZLMA 2L3SA 3J7AF 1M9SA 3VRZA 4K11A 1K8AU 1HD3A 5A0GA 1S1NA 2ABLA 1VQ5Q 2HCKA 1SSHA 1Y96B 2ROTA 2L3RA 1VQMQ 2V1RA 2KBTA 2V26A 4OMMA 4PJNA 2PTKA 2YRCA 1YJ9T 3NGPA 1KHCA 3L2VA 3QZ5B 5KYNA 3I55Q 3OBWA 1RLQC 3HRTA 1OPKA 4LDYA 1RLPC 2KAFA 4FIBA 2EJFA 2DFUA 4HCZA 1VQ7T 1K0SA 4IUPA 4II1A 4IIMA 4JLIA 3CCVQ 3O8VA 3EGUA 4M7AA 4ZGEB 5GMKm 3EH1A 3CCJQ 4JJBA 4MZTA 3V8KA 1K9MU 4PJOC 4XAXB 4E47A 4MDWA 1BIAA 4M7DG 4C5IA 4CRIA 2ZPIB 2QI2A 2RO0A 3GPLA 4C0DB 1YCYA 1IRXA 2K79A 1IHVA 4NL3A 2EW3A 2P4TA 1YCSB 4JZ4A 2CREA 3VS3A 3GNFB 2E12A 5FU7C 3OB9A 2KDSA 3VRYA 5KE2A 2YLCA 3RIRA 3E19A 4LDWA 4F7UA 1G2BA 3HP9A 1N5ZA 2CSIA 3EFRA 4IUTA 2KYBA 1KQ1A 2EFIA 2QG9B 3E2UA 3EGXA 3EAEA 2E3IA 4Z89A 4PKCC 4PJLA 4C8QA 1TXQA 2CZ6B 2M0OA 2NUPA 3CCQQ 1SPKA 2FEIA 3A98A 2IPOB 1GCQA 1TTHB 2B8AA 3OW2A 5LJ5j 1NJIR 3REBB 3A1PA 3I56T 4EIKA 4QVDA 2RQWA 4OMNA 5I22A 1TOVA 2C0TA 4ME7A 2JT4A 4B6MA 1Q86U 2DK3A 5CQYA 2MAMA 1BCMA 1VQKA 4J9HA 3UA6A 3C4SA 4C92C 1AD5A 2DL3A 1VYTA 1E6HA 5IN1A 1PCXA 1PG5B 2VKNA 4YTLA 3JB9D 4M75C 3TSWA 2ROLA 3OW2S 2HQXA 1XJWB 2LJ3A 2XD0A 2HQHA 1K4US 4KULA 4P5NA 3V7CA 4M75E 1K8AR 4M7DF 4RTVA 1BCOA 3VS4A 3JB9F 3OYCA 2COZA 3RKWA 4XTVA 1PWTA 1FMWA 5GMKi 2CP6A 2M16A 2ED0A 2L0AA 1NLPC 4E7JA 3MJXA 3VUBA 4KGZB 1RUWA 4XU2A 4C8QB 2DERA 2CP7A 3CCJT 2E1HA 5EG2A 3CCMA 1GBRA 1K73C 1HYOA 1WQWA 2YRVA 2QA4Q 1K73U 2LJ1A 2EQKA 3L42A 3SD4A 2GCXA 1JB0E 4J9GA 3X20B 2DILA 1VQ6Q 2CP0A 2YUNA 1D3BB 3JB9I 3RERA 2LCLA 3SEMA 2IVWA 2NWMA 2F2VA 3VS6A 1AOJA 4KUIA 1VQNA 2MIOA 5ECAA 3TQ7P 2KRNA 3OYAA 3MCAB 3CC7A 1QP3A 2RI2A 3FIFA 1X43A 4M77F 4M77B 3CC4A 4CC3A 2K2MA 2K4YA 3RMQA 1K9MR 1B07A 2CP2A 2DEUA 3VS0A 3CCSA 5GAMd 5GANj 3HRUA 1M90U 3VS2A 1X27A 4BY6C 2NUPB 1SRMA 1AZEA 3G1JA 3QZ9B 2DA9A 5I2SA 1ZBXA 4QQ6A 4KGVB 4XQ3A 3EGXB 4M78G 3OMGA 3EHRA 4XU3A 1KQSA 3PTAA 3M0UA 2DX1A 3CC2Q 1T3SA 3F70A 3CCUT 3QUIA 1PC0A 2KK4A 1UHCA 1KSWA 3LWHA 4XTXA 1W70A 2PUKB 3CCLQ 2G6FX 1U8RA 5LJ5g 5IXFA 4KUDK 2RK2A 2E5QA 2FRWA 4C0GA 2WSEE 1IGQA 4NOYA 4C8QC 1T3LA 4LE9A 1N8RU 1KD1R 2CZ1B 2QTXA 3L2QA 4LXCA 2MWPA 1VQLQ 5GAN2 2LDMA 2ZPGB 3QJ6A 3QYHB 4FCYA 1QKWA 3HHTB 2LNVA 5J26A 3ME9A 3VS1A 5DY9A 1YBYA 2EQIA 1W2BP 5IHKA 3QSUA 2M1HA 1Q7YU 2RQUA 1H641 1ZA1B 2AZSA 4CC2A 4ZGDB 5CCAA 4R0KA 5FU6C 2PNIA 1PD0A 3RKXA 1ZUKA 2A7YA 3M4GA 1RAEB 1RL2A 4UC4A 9ATCB 5D7UA 3H0IA 4QVZA 4LDVA 2WACA 4Y91A 3WXMB 5GAN7 3EGDA 3V8LA 1MMGA 4ESRA 1XNIA 3FDRA 5D6YA 1LPLA 1PHTA 1G8XA 1ABOA 4OMLA 1BI1A 2QA4A 4DOVA 1PM3A 1MMNA 2KNBB 4IIOA 1NJIU 2ZPEB 2DM1A 3I56A 4RG2A 4HCBA 2X4XA 4A4KA 2EGEA 3U23A 3OYHA 4J7FA 2D6FA 4QVCA 3I5RA 4IKFA 1NEGA 1NG2A 4C5GA 4WTOB 1QVFP 4J6YA 2LRQA 2H8HA 2KXCA 2O31A 1IZ6A 2XDDA 4EMHA 2GGRA 5CKDA 1G3YA 5D6WA 2MMPA 4HCCA 2FG0A 3OYJA 4IUVA 1JXOA 3R6OA 1FXXA 2FPFA 3TSZA 2DPPB 1AWOA 2JM9A 4M4ZA 4PFZA 3FJPA 4D8DA 3CMAT 1NM7A 1K0XA 4KH1B 4QKUA 4M75D 1VQOQ 2BKDN 5CKFA 3CMEA 1YJWA 5GMKe 2IIMA 1QVGS 5GAN3 2QQSA 2W0ZA 1YHQT 3P8DA 3FEOA 2XK0A 2CKKA 1LVKA 2BE7D 1W4SA 1X6BA 4LD6A 2LCSA 3VV0A 3QPHA 3JCMJ 4BD3A 2HNIA 1U06A 4O6JA 2DRMA 2PQWA 2L89A 3V7SA 5LJ5f 4OMFB 1UJYA 2GBQA 4A4FA 4ELZC 1M2VB 1LNXA 3LGLA 3I56Q 4E7ZA 3RBBB 2E64A 5GANe 3CPFA 2HZYA 4AG1C 5FRNA 1WX6A 4OB2B 3I9QA 2ZPFB 3CQTA 5GAMg 2JTEA 3LH5A 5L23A 4N4GA 1B34A 1KD1U 1KC8C 3C94A 1VQ4T 3GIBA 2HL5C 3QHSA 4HXJA 4HCKA 5D6XA 3M0PA 5EC7A 3EHQA 3IQLA 2D0NA 1C1AA 2LX9A 1TUCA 4C92B 4BACA 1E6GA 2KXDA 4ORZA 2DBKA 1Q7YR 2E70A 4XTWA 1OPLA 1PRMC 5GMKj 1YFNA 2ZZDA 2BZYA 1JEGA 2QEXT 2CZ7B 5GJWB 1OEBA 2E3HA 2M02A 3OS5A 2Y4YA 1M3CA 5GAN5 2GQVA 1VQ4Q 1GFDA 1WJSA 2QGGA 1G3TA 1BI3A 4C92E 4E7LA 4J9DA 1MNEA 5LJ3g 2MK5A 1UEBA 2XIDA 1BK2A 1UGQB 2DTHA 4JPBW 4M77G 1PSFA 3V7RA 1GBQA 2EBPA 2EKOA 3PFSA 4C8QF 4EPCA 2DRKA 2HD0A 1AEYA 4OP0A 1AWJA 3CD6T 2M9UA 5KYXA 1ZHIA 2RH2A 2RN8A 1VQPQ 2XMFA 4RTTA 3FC3A 1V76A 3RUXA 4V2SA 2L2PA 1M27C 4FU6A 1X6GA 2CUBA 1ARKA 2QDYB 2XDPA 2A3LA 2HEQA 3I55T 2M0YA 3HPWA 2RI3A 4M7DE 4RUGA 2YRDA 4M75F 2JW4A 3CCUA 4EMKB 2FVUA 2RM4A 2H3EB 5LJ5e 2OTJT 1MV3A 2RK1A 3M58A 2K3XA 2YHTA 3CD6Q 2X3WD 1OX8A 5AYFA 5CK9A 3G6EQ 2OTJQ 2R57A 2PUOB 1I0CA 1VQ8A 3L2WA 5A2QE 3PIPA 1VQ5T 3M54A 3A8MB 3ZEHA 3CD6A 2Y90A 4N0AA 3GOXA 3CMAQ 1V1CA 1AZGB 3CCVA 1QCFA 5HKCA 2KGTA 4F04B 3CC7T 2DJZA 2VC8A 2XU8A 3G71Q 2NUZA 4HVUA 2DF6A 1T0JA 3OYKA 3PVQA 2VVKA 2LCCA 1WQ7A 1NBEB 1M1KR 2SRCA 3SWNB 4JS4A 2NUTB 4KH0B 5CO7A 3MEAA 4XTZA 2XKOC 3N5BB 1WHJA 3M9QA 4PJOG 2COYA 4AFQC 2K5IA 1M3AA 1JQQA 3MP1A 2M51A 1F1BB 1NJIC 4M78D 3OYFA 3NHNA 1K1ZA 1EZZB 3ULRB 3GF5A 2GFUA 3UATA 2QEXQ 1I4K1 1AWWA 1Y96A 4GLKA 1I5OB 2HBWA 4PJOA 4CC4B 5KYYB 2RHYA 3EGDB 2LQNA 5GAN6 1Q81U 1B7TA 3QYGB 1I1JA 2J6KA 1R8OB 4XU0A 4M7AC 5I11A 3TEEA 2RQRA 1U1TA 3JCMh 5GAOm 4OB1B 4F7UF 1WYXA 1YITT 3J81E 2V1QA 3CPWS 3OYYA 3C95A 1S72Q 4WF2A 4N4IA 1WNLA 2EKHA 1SRLA 2EYYA 4AFSC 2GNCA 1RI9A 1OYXA 1VYVA 2E65A 3VJPA 3JCMb 4BE0A 3TCJA 2CDTA 1MHNA 4FYVB 1PNJA 1OV3A 4NS5A 1VQLT 1GCQC 3WVDB 4DBQA 2RI5A 2QEXA 4JS5A 2KYMA 5CVIA 3JB9G 2KI7A 3M57A 1WLPB 1FMVA 4RMOA 1M8VA 5LJ3f 8ATCB 2RJDA 3CCQA 3M4YA 5I2MA 3I55A 3S3NA 4DEYA 1IXDA 4PLLA 3G7ZA 4AFUC 2YUOA 2HBPA 1VQLA 1G3WA 3UA7A 3OBYA 3JCMf 4L59A 2KRMA 4KRTA 4RTWA 3JCMc 3TVTA 2ESWA 4Z88A 1CKBA 3LGFA 3NTHA 3CCJA 2LVMA 3QWXX 1YI2Q 2HKNA 2K3YA 2E5KA 1RAIB 3DLMA 1G3SA 1Y7XA 3LH0A 2AKKA 3JCMe 4EMGA 3QIIA 1ACMB 2E4HA 2DD4A 2IG0A 2R5MA 1KQ2A 2CGHA 3GBQA 5A0LA 1RABB 1WZOA 4C0ZA 3H41A 1I8FA 1WI7A 2MPXC 2DVJA 3M0SA 4PFPA 2K2VA 1IHWA 3CCEQ 1UB4A 2C06A 4J6XA 1D0XA 3UWNA 1GRIA 3CXCS 1YJNQ 3FB9A 2YUPA 3UF4A 3L2UA 5IAYA 4DBHA 2YWWA 1M90R 2JZ2A 4JRKA 4M78F 4ZGJB 2EQUA 3JCMg 4LDXA 2KE9A 1M2VA 4Y92A 2V8KA 2EGAA 4BUGA 1JXMA 3CMAA 1JBMA 2QQ9A 4JJNK 3GLXA 2EGCA 2VASA 3X26B 2KR3A 2QYZA 5GAOl 1NLOC 2HAXA 1Q95G 1H92A 2LT1A 3CBPA 2X9HA 2QAZA 4DEXA 1UDLA 2DXCA 1GFCA 2QQRA 4O5VA 3CCLT 2J6OA 2ENMA 3CXCP 5GAOn 1PKTA 3Q1JA 4D8KA 4JJCA 3CCRA 3OYNA 4OB3B 3BE3A 3URGA 1B34B 1E7OA 2J7IA 2RQTA 2Z0WA 3KFVA 5FRMA 4OMQA 2CT3A 3LX7A 4IUQA 2XICA 1M1KU 4LUDA 1BKBA 2HMAA 2PZ1A 3EFOA 1DJ7B 2VGMA 3AT1B 1WPYA 3X24B 4A4EA 5KYUB 2GFAA 4Y28E 4JZ3A 1KG1A 4MMLA 2X3XD 5KYXB 4EMKA 3BFMA 3NTIA 1WDXA 4C8QE 2L8DA 3A5ZB 2I0NA 4DBRA 2FPEA 4JRQA 1FMKA 4XU1A 2RHUA 3RNJA 4C92F 1BYMA 2FZGB 2E6ZA 1FYNA 2DXTA 2YT6A 1TUDA 2ECZA 1OI1A 3L2RA 3JAME 4ATOA 5KYUA 1AT1B 4OVAA 2K5LA 4M77D 3G71A 4JJDA 4LNPA 2QA4T 2LT4A 5HK0A 3JB9J 3EFSA 3QDFA 2EQMA 2Y4XA 3RKYA 2BUDA 1UHFA 2GF7A 3JCMQ 1OOTA 1NE8A 3H0HA 3EG1A 4RKUE 1VQOA 4BI3A 1BI0A 1AHJB 2A28A 2QK0A 3HSBA 1PKSA 2DL7A 2JTMA 1JJ2S 3P8BB 2VXFA 4QQGA 3QBYA 1KQSS 4PJMA 2DMOA 3DB3A 3OS1A 1YI2T 1KQSP 1NEBA 3CCVT 4ZN1A 5CIUA 3EH2A 4RTXA 2DXUA 4E7HA 1TH7A 3QKJA 4M75G 3SFMA 2F69A 2BZ8A 4M78B 1QP2A 2VWFA 4ZTFA 2FRYA 3UDCA 1BU1A 3CC7Q 1K9AA 2RQVA 1TWBA 2DZ9A 4HKEA 2VXEA 3I35A 5CR2A 2DVEA 2CH4W 1D1AA 1KJWA 1RI0A 4JLGA 2JNGA 2EQJA 1WIEA 5FWBA 4F7UB 2ZCFB 4PFOA 1M3BA 2QASA 2DKGA 3LW5E 1PRLC 4F14A 1VQ4A 3BDLA 3MP6A 1BB9A 2CS7A 4PJOE 5FU7B 5DLQE 1LCKA 4M78A 2P84A 4KT0E 2F1LA 5DM7R 2RNAA 1LJOA 1Q86C 4JRIA 2KSSA 2AIRB 4HT8A 1NYFA 1QVFA 2BE9B 1TUGB 4LD9K 3H9NA 1VQPT 1MNDA 4M77E 1M2OA 4JUVA 1YJNA 2QQBA 1KC8R 2JOYA 1KHIA 2EYXA 4BE1A 2LNHB 5FROA 5GANh 1CKAA 4M77C 3ZFJA 3CCSQ 5HY6A 4RTZA 1H3HA 2F5TX 3MEUA 2F5KA 3J80E 1JRIA 3H0FA 1HXDA 2EAYA 4AMCA 2EPDA 1YHQA 2R5AA 4J7IA 3M59A 4LDUA 1Q82U 1V29B 4J9FA 2X4WA 4E7SA 1XQHA 4MZPA 2ED1A 1RAHB 3VU3C 1OZ3A 2A36A 3OW2P 3M56A 2OAWA 4HVWA 4RTYA 4M75B 5HK3A 3MP8A 3M0RA 2O2OA 2PVOB 2LX7A 2KMTA 4FYXB 3O5ZA 1WXBA 4FYWB 3WVEB 2AK5A 3OYLA 4IURA 1C0MA 2P0KA 5GANg 4KGXB 3FRNA 4WCIA 2BTTA 1VUBA 1U5SA 1I81A 3E1SA 5C0MA 1UGRB 2DXBA 2H3JA 2QGFB 8AT1B 1VQOT 4A54A 1GXIE 3S6WA 5GAMf 1YNZA 2BZXA 3H8ZA 4GY5A 4ZTJA 2KQWA 2KVQG 1ZA2B 1G83A 5C6SA 3RESA 2XG8D 3OYGA 2QDLA 3INZA 1VQ9A 5KCHA 3JCMX 3CCRQ 3L2ZA 2FYKA 1YIJT 1BIBA 1QVPA 3PNWC 1BBZA 1VQMT 3OSVA 1R0CB 4HVVA 1X75C 2LQWA 4C5HA 1VA7A 4R56A 2QTVA 1Y71A 1QCNA 1NYGA 4FSXA 3EG9B 3CXCA 5IHNA 4C8QG 1JO8A 1Z9QA 1K73R 2VUBA 2RB6A 2HQEA 3NPFA 4C92D 2PVGB 4BY6B 1VQPA 2OX7A 4OB0B 2HKQB 1VQ5A 4PJOD 1QKXA 1M4ZA 2KROA 2DYIA 4FSSA 3GP8A 2L3PA 1WHHA 2DETA 3H6ZA 1RAFB 3CBMA 1T0HA 2QXFA 5AT1B 1VQNT 4LN2A 1OX9A 1N8RR 4F17A 1VQMA 3M0QA 2J6FA 3DKMA 4M78C 1YWOA 4RG8A 2ZGWA 3RDVA 4A63B 1WHGA 3UPUA 4QW2A 1IREB 2DE0X 2QQAA 1KD1C 1W2BA 3HFOA 1IB8A 1OQKA 3MEWA 1VQ9Q 4M7AG 2JN0A 1S72A 1M1FA 3LYIA 1TU0B 3QJYA 3ZBDA 3EG9A 3E9GA 4C0DC 3S3MA 1K8AC 3CCLA 3CPWP 1EX4A 2L3QA 1MUZA 1VQ7A 6AT1B 2FL7A 2DLPA 1TS9A 4M75A 5CKBA 2DIGA 3PVLA 1M1KC 3LLRA 2XHCA 3T9NA 1KFZA 5HCKA 2D9TA 2WSFE 1Q7YC 3SWNA 2YSQA 3CMEQ 1WA7A 4M7AE 1UJ0A 3FLGA 1FWZA 3PGGA 2EWNA 1SG5A 4DBFA 4QQDA 2ZPHB 1O9SA 4ANJA 2D1XA 5LL6S 3RMSA 2CP3A 5DLOA 4BDZA 5M9OA 1SHFA 2FZKB 2CP5A 3LWIA 3GNGA 4MZMA 1VQKT 1KC8U 2O9SA 4OMPA 3RR6A 1ZSZA 1ZUUA 5J39A 3TREA 5CAIA 1VYUA 1AVZC 3CCRT 4F7UE 1HJDA 2DTOA 3HRSA 3CCUQ 3X28B 3CC2T 4FT4A 2NYSA 4A4GA 1N9RA 3EG3A 4E2FB 4KBMB 1VQ8Q 1JJ2P 1QWEA 3HL8A 3VS5A 4BI4A 4IUUA 2KRSA 2P0QA 4F7UG 3SWNC 2FO0A 4JRPA 4E6RA 1RAAB 3VS7A 2RHZA 1VQ6T 5GAMh 4GLMA 2LTOA 1SEMA 3VYGA 4J9IA 4M7AF 1AWXA 5CQXA 3CCET 4M7DB 5I21A 5LJ5d 3OSSC 1ZSGA 2MI6A 1QQJA 2X4YA 3JRZA 4F16A 4M7DA 2RMOA 2JMCA 2V8IA 1I07A 1WGSA 2LZ6B 2JUFA 1R77A 3NMZC 1TG0A 1NZ9A 4L6V5 3CCEA 4EDUA 3CCMT 4MMKA 1SKUB 2K7AA 2DEQA 1VQ6A 1W6XA 3MHXA 3R6NA 2SEMA 2GTJA 4LUEA 4OGCA 1RADB 5LJ3h 5KYWA 3OYIA 4M7DD 2W10A 1WJQA 2GTOA 3JB9H 1UFFA 4J8OA 4OMOA 1RAGB 3OS2A 1WXTA 3BW1A 5LJ3j 5IH2A 3CC2A 4JDSA 1UGPB 2B86A 2C0OA 1UTIA 2R58A 1M8MA 4N4HA 4RCBA 2DYBA 2CH4A 3G4SQ 5GANf 2MCNA 1EFNA 1PD1A 1QVFS 3M5AA 1O75A 1X2QA 3CCQT 3P8HA 2RHXA 2O9VA 5KE3A 2ATCB 2DJQA 1YJWT 2LC4A 2JS2A 3G4ST 3OS0A 1U1SA 3JV3A 1YITQ 4OF1A 4X9DA 4J9EA 4RCCA
chains in the Genus database with same CATH topology
4JLGA 4ZGEB 5GAN5 2GQVA 2EQJA 2JNGA 5GMKm 4ELYC 4PL6A 1WJSA 4N0AC 4F7UB 1G3TA 1BI3A 2ZCFB 1VQ8T 3M53A 4C92E 4E7LA 2OAUA 2LQKA 4MZTA 1ZQ1A 5LJ3g 3V8KA 2DZCA 1K9MU 2DKGA 1UEBA 3LW5E 2XIDA 3TU4K 1UGQB 1QVGA 2DTHA 4PJOC 4NL2A 4XAXB 4MDWA 5CKHA 4E47A 3VUZA 4CI0C 3G6EA 1G5VA 4M77G 1PSFA 1BIAA 5CKEA 3V7RA 2RJFA 1VQ4A 2EKOA 3BDLA 3MP6A 3PFSA 4C8QF 3MO8A 2HD0A 4EPCA 5GAMj 5GANd 2CS7A 4M7DG 4C5IA 4OP0A 4CRIA 2ZPIB 2QI2A 2RO0A 3GPLA 4C0DB 5GAOq 1YJ9A 3CD6T 4PJOE 1YCYA 2M9UA 4NL3A 2DO3A 1ZHIA 2RH2A 1LOJA 5FU7B 2P4TA 5DLQE 3FC3A 4M78A 4KT0E 3RUXA 5A0DA 3GNFB 2E12A 5DM7R 4V2SA 5FU7C 1LJOA 1Q86C 4FU6A 3OB9A 2KDSA 4X34A 4JRIA 5GAOr 5KE2A 1Y07A 4B9WA 5FU6B 2FB7A 2KSSA 2YLCA 3OYEA 2QDYB 2XDPA 3RIRA 4HT8A 1QVFA 3E19A 4LDWA 4F7UA 2A3LA 3HP9A 3SB2A 3I55T 4LD9K 2DD5A 3S3OA 1VQPT 3HPWA 2RI3A 3EFRA 4M7DE 3PMIA 4BE2A 2MF2A 4IUTA 4M75F 3CCUA 3L1AA 4M77E 1HK9A 4EMKB 1KQ1A 2EFIA 2FVUA 4JUVA 4Q5WA 2QQBA 2RM4A 3EAEA 1YJNA 3A8GB 3G71T 5LJ5e 2JOYA 4PKCC 1KHIA 2VYTA 2OTJT 2BIVA 4C8QA 4BE1A 4DA4A 2CZ6B 2RK1A 3M58A 2K3XA 5FROA 2YHTA 5GANh 2M0OA 1K9MC 5AYFA 1BI2A 4M77C 3ZFJA 5CK9A 3ER0A 5HY6A 2R57A 2F5TX 3MEUA 2F5KA 3BDUA 3J80E 1EIFA 1JRIA 4J5YA 2PUOB 2B8AA 3OW2A 1HXDA 2EAYA 3M55A 5LJ5j 1VQ8A 3L2WA 4BB7A 5A2QE 3PIPA 2RJCA 3I56T 4QVDA 5IT9E 3M54A 1VQ5T 3A8MB 1YHQA 2R5AA 3MEVA 5L8RE 3ZEHA 4DOWA 4E7IA 3CD6A 2Y90A 3OMCA 4E7KA 3NFCA 4N0AA 3GOXA 4J7IA 4C5EA 3M59A 4ME7A 4LDUA 1Q82U 1V29B 3G6ET 1Q86U 3CCVA 2X4WA 2DK3A 5CQYA 2MAMA 1VQKA 5HKCA 1UGSB 3CC7T 2DJZA 3C4SA 4C92C 1W2BS 1XQHA 4MZPA 2KY9A 2VC8A 2XU8A 3QXEB 4BDZA 3OA6A 2AHJB 2ZPBB 5IN1A 3OYKA 3VU3C 1OZ3A 2LCCA 1WQ7A 4YTLA 3M56A 3JB9D 4M75C 4PLIA 3OW2S 2HQXA 3SWNB 4JS4A 4C92G 2XD0A 4M75B 5CO7A 3MEAA 3MP8A 4KULA 4P5NA 2XKOC 3N5BB 4XTZA 5HK3A 3V7CA 2PVOB 3G4SA 3ASKA 4J83A 4EMKC 3M9QA 4PJOG 2NLUA 4M75E 2KMTA 2K5IA 4M7DF 3UT1A 3MP1A 3JB9F 3OYCA 1NJIC 4M78D 2RJEA 3RKWA 3OYFA 1QW1A 2FHDA 3WVEB 4XTVA 3VKIA 1D3BA 4PJOB 3OYLA 3GF5A 4IURA 2GFUA 5GMKi 2JVVA 3DLLA 2M16A 1I4K1 2O4XB 1Y96A 2P0KA 3QG1A 4GLKA 1NPRA 5GANg 4E7JA 4PJOA 3FRNA 3VUBA 4HA8A 1VUBA 4XU2A 4C8QB 1I81A 3E1SA 4PJOF 2RHYA 4J6WA 5C0MA 3CCJT 5GAN6 1Q81U 1UGRB 2WSCE 2E1HA 4FM4B 3QYGB 1R8OB 4XU0A 2EJ9A 2DXBA 5EG2A 4MDXA 3CCMA 4M7AC 2H3JA 3TEEA 1VQOT 1U1TA 3JCMh 4A54A 1K73C 1GXIE 5GAOm 1H3ZA 4OB1B 4F7UF 1WQWA 3DB4A 3S6WA 5GAMf 1YITT 2YRVA 2E41A 1K73U 3J81E 2EQKA 3A8LB 3H8ZA 3L42A 4GY5A 3VYHB 3CPWS 2KQWA 3SD4A 2KVQG 4ZTJA 2GCXA 2PU9B 3OYYA 3C95A 5C6SA 1JB0E 3RESA 2XG8D 3X20B 2YLBA 3OYGA 2V8JA 4A53A 3INZA 3QO3A 1VQ9A 4WF2A 2XDBA 1D3BB 1M5Q1 5KCHA 3JCMX 2O4XA 4N4IA 1WNLA 3L2ZA 1N8RC 1I5LA 2FYKA 1YIJT 3JB9I 1OYXA 3RERA 1BIBA 3JCMd 1QVPA 2D0QB 2E65A 2LCLA 3PNWC 5J3BA 3VJPA 3JCMb 2IVWA 4BE0A 1VQMT 2EYQA 3OSVA 3TCJA 1X75C 4C5HA 4KUIA 2L5QA 1VQNA 2OTLT 1MHNA 4R56A 3OYAA 3OYMA 4Z02A 1Y71A 3MCAB 5GMKh 1X01A 1N27A 3CC7A 1QP3A 2RI2A 3FIFA 4FSXA 4M77F 4NS5A 1VQLT 3WVDB 4M77B 2RI5A 3CXCA 4C8QG 2QEXA 2E6NA 2VGNA 3CC4A 4JS5A 2K4YA 5CVIA 3JB9G 2VUBA 2RB6A 5LJ5h 3M57A 3RMQA 1YIJA 2HQEA 4RMOA 4C92D 2PVGB 1M8VA 4BY6B 3CCSA 3A8HB 5GAMd 5LJ3f 5GANj 2RJDA 3CCQA 1VQ9T 1VQPA 3M4YA 4OB0B 3HRUA 5I2MA 3I55A 3S3NA 2X4JA 1VQ5A 4PJOD 1M90U 1M4ZA 4PLLA 4BY6C 3G7ZA 4R55A 3HKSA 1N6AA 2HBPA 3QZ9B 2O01E 1VQLA 3GP8A 4C0FA 5I2SA 1ZBXA 4QQ6A 1G3WA 5LJ3e 4XQ3A 4M78G 3OMGA 3H6ZA 3OBYA 5KH6A 1P92A 3CBOA 3CBMA 3JCMf 4L59A 2OTLA 2QXFA 4XU3A 1VQNT 1KQSA 3JCMc 2RA2A 1VQMA 3LGFA 3NTHA 3DKMA 3NTKA 3PTAA 2LVMA 3CCJA 1YJNT 2K3YA 3F70A 3CCUT 3OY9A 3QUIA 4M78C 3DLMA 4PNOA 1G3SA 4RG8A 1Y7XA 3LH0A 5FLXE 1SSFA 2KK4A 2ZGWA 3JCMe 4EMGA 3QIIA 2VV5A 2DTIA 3UPUA 2DD4A 4OGEA 4X9CA 4QW2A 5GAN4 1IREB 2IG0A 2R5MA 2QQAA 3LWHA 4XTXA 1KD1C 1KQ2A 2CGHA 5KCOA 2PUKB 3HFOA 1W2BA 3PMTA 5A0LA 5LJ5g 1U8RA 4KUDK 5LJ3d 2RK2A 5GAN8 3MEWA 2E10A 2E5QA 1XOVA 4C0ZA 1VIFA 4C0GA 5GAMe 4M7AG 2EIFA 2JN0A 1I8FA 2WSEE 1S72A 2PVDB 4NOYA 4C8QC 4M7DC 2K57A 1M1FA 3LYIA 1N8RU 3QJYA 2CZ1B 2QTXA 3ZBDA 3L2QA 3E9GA 4A4HA 4C0DC 3S3MA 2MWPA 1K8AC 3CCLA 2K2VA 4FL6A 2LDMA 5GAN2 1VQ7A 2FL7A 1UB4A 2ZPGB 3QJ6A 4J6XA 2C06A 3QYHB 3A8OB 3HHTB 4TVRA 3UWNA 3BY7A 2RD1A 4M75A 2LNVA 5J26A 3CXCS 5CKBA 2DIGA 3ME9A 3FB9A 4ZN3A 1NPPA 5GMKl 3CPWA 1M1KC 3LLRA 2XHCA 3T9NA 5DY9A 1YBYA 2D9TA 2WSFE 3C12A 3META 1Q7YC 3L2UA 3SWNA 3JCMP 5IAYA 2XI9A 3QSUA 2EJGA 2M1HA 1X6OA 4C8QD 1Q7YU 4M7AE 3PT9A 3FLGA 1H641 1FWZA 4ZGDB 2JZ2A 3PGGA 4JRKA 2EWNA 4M78F 2EQUA 5FU6C 3JCMg 4ZGJB 5CCAA 3CMET 4QQDA 2ZPHB 4LDXA 3E9FA 4C92A 3OQ5A 1O9SA 5LL6S 3RKXA 2A7YA 3M4GA 2V8KA 1RL2A 4UC4A 4XK8E 3RMSA 4BUGA 1FX7A 2P0PA 4BI8B 2RHIA 1JBMA 5DLOA 3CMAA 2QQ9A 4QVZA 4LDVA 5M9OA 2WACA 4Y91A 3WXMB 5GAN7 4L5GA 3KXTA 4JJNK 3GLXA 2DIQA 3V8LA 4B9XA 1MGQA 3X26B 3X25B 3LWIA 1XNIA 3FDRA 3GNGA 4MZMA 5D6YA 5GAOl 1VQKT 1KC8U 1VIEA 2HAXA 2DAQA 2LT1A 1N9SA 1BI1A 3CBPA 3JCMV 2QA4A 4XTYA 4DOVA 3V8JA 5J39A 2DXCA 3AHUA 3TREA 1OZ2A 2QQRA 2X35A 4O5VA 5CAIA 1NJIU 2ZPEB 3CCLT 3I56A 4RG2A 3CCRT 4F7UE 4HCBA 2X4XA 4A4KA 2DTOA 3HRSA 5GAOn 3OYHA 4J7FA 3PIOA 2D6FA 4QVCA 3Q1JA 3X28B 1Q82C 3CC2T 4IKFA 4C5GA 1JJ2A 2CZ0B 1S72T 2K5FA 2MWOA 4J6YA 4FT4A 3CCRA 4A4GA 1N9RA 4BDYA 2LRQA 3QDRB 1M1GA 4KBMB 1IZ6A 3OYNA 4M7AD 4OB3B 2XDDA 3URGA 1B34B 4EMHA 3SDZA 5CKDA 1G3YA 4XTUA 5D6WA 3JCMW 3HL8A 2MMPA 2JTFA 4HCCA 4BI4A 3OYJA 4IUUA 2P0QA 4F7UG 3SWNC 4IUVA 4VUBA 5GAOp 5FRMA 3OYDA 3LX7A 2I2LA 4JRPA 3R6OA 4IUQA 1FXXA 2XICA 1M1KU 1BKBA 4HT9A 2DPPB 2RHZA 1VQ6T 4M78E 3HFNA 5GAMh 2LTOA 3VYGA 3FJPA 1DJ7B 3CMAT 4M7AF 2VGMA 5CQXA 3X24B 1WPYA 3CCET 5I21A 4M7DB 4A4EA 4M75D 5LJ5d 2GFAA 3OSSC 4Y28E 2BKDN 5CKFA 3CMEA 1YJWA 2MI6A 2X4YA 2LQ8A 3JRZA 4MMLA 4M7DA 1KG1A 4M77A 5GMKe 2V8IA 1WGSA 1QVGS 3KUFA 5GAN3 2JUFA 4EMKA 4M7AB 2QQSA 3BFMA 3JSCA 3NTIA 3KBGA 4C8QE 1XTDA 3CCST 1YITA 3OYBA 1YHQT 2L8DA 3P8DA 1Q81C 3A5ZB 3CEYA 2G3RA 1NZ9A 3FEOA 1M90C 4L6V5 2XK0A 3CCEA 1WJRA 4EDUA 3CCMT 1PSEA 3CC4T 2CKKA 4JRQA 4MMKA 4XU1A 1YI2A 2RHUA 1W4SA 2DEQA 4C92F 1VQ6A 4LD6A 1BYMA 2E6ZA 2DXTA 3VV0A 3MHXA 1OI1A 3L2RA 4D6WA 3JAME 2CYZB 4FT2A 4ATOA 3QPHA 4OGCA 3JCMJ 4BD3A 4OVAA 2HNIA 2OTJA 2K5LA 4DQ2A 4M77D 5LJ3h 3G71A 3OYIA 3J7AF 2QA4T 2LT4A 4O6JA 4M7DD 1M9SA 2PQWA 5HK0A 3JB9J 1WJQA 3JB9H 2L89A 3V7SA 3EFSA 4OMFB 5LJ5f 4A4FA 1K8AU 5A0GA 4ELZC 1LNXA 3LGLA 4J8OA 2EQMA 2Y4XA 3RKYA 2BUDA 2GF7A 3OS2A 1Y96B 3JCMQ 3BW1A 5LJ3j 1NE8A 2L3RA 3CC2A 2E64A 5GANe 3CPFA 4JDSA 4RKUE 5FRNA 4OB2B 1VQOA 1UGPB 4BI3A 2ZPFB 1BI0A 1AHJB 5GAMg 3HSBA 4N4GA 1YJ9T 1B34A 1KD1U 1KC8C 2JTMA 1KHCA 3C94A 2R58A 1JJ2S 3L2VA 3P8BB 1VQ4T 2VXFA 3GIBA 4QQGA 3QBYA 3QZ5B 4N4HA 4RCBA 1KQSS 3OBWA 3QHSA 3DB3A 3HRTA 3OS1A 1YI2T 4LDYA 2KAFA 5D6XA 3CCVT 4ZN1A 5CIUA 4FIBA 5GANf 2LX9A 2DXUA 4E7HA 1QVFS 3M5AA 1O75A 1TH7A 4C92B 3QKJA 2EJFA 4M75G 3CCQT 4BACA 3SFMA 2F69A 3P8HA 4M78B 4HCZA 1QP2A 2E70A 2RHXA 4XTWA 4ZTFA 1VQ7T 3UDCA 5GMKj 5KE3A 2ZZDA 2DZ9A 4IUPA 2QEXT 4HKEA 2VXEA 1YJWT 2LC4A 4II1A 3G4ST 3OS0A 1U1SA 4JLIA 2DVEA 2CZ7B 5CR2A 4OF1A 3O8VA 4X9DA 3OS5A 1RI0A 4RCCA 4M7AA 2Y4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZGE B;  2CZ0 B;  1UGS B;  1GXI E;  1PSE A;  2PUK B;  4OB1 B;  3VYG A;  2WSF E;  1DJ7 B;  3X26 B;  4KT0 E;  3X25 B;  2ZCF B;  3WVE B;  3A8L B;  3QXE B;  1QP3 A;  3VYH B;  2AHJ B;  2ZPB B;  3X24 B;  2PUO B;  3WVD B;  2PU9 B;  2WSE E;  4OB3 B;  1JB0 E;  4RKU E;  2QDY B;  3X20 B;  4OB2 B;  2PVD B;  1UGP B;  4Y28 E;  1QP2 A;  2ZPF B;  3LW5 E;  2CYZ B;  1AHJ B;  1UGQ B;  4ZGD B;  4ZGJ B;  2DD5 A;  3QZ9 B;  3A8M B;  2ZZD A;  2PVG B;  2CZ1 B;  1PSF A;  2ZPH B;  5L8R E;  2DXC A;  3A8H B;  2PVO B;  4OB0 B;  2D0Q B;  2ZPG B;  2ZPE B;  2ZPI B;  1UGR B;  2WSC E;  3QYH B;  4FM4 B;  2DD4 A;  3A8G B;  1V29 B;  2CZ7 B;  3A8O B;  3HHT B;  3QYG B;  3QZ5 B;  4XK8 E;  2DXB A;  1IRE B;  2CZ6 B;  2DPP B;  2O01 E;  4L6V 5;  3X28 B; 
#chains in the Genus database with same CATH topology
 1OUL A;  4ELY C;  4PL6 A;  4N0A C;  2O88 A;  3M53 A;  2OAU A;  2LQK A;  1ZQ1 A;  2DL5 A;  2FPD A;  2DZC A;  1QVG A;  3TU4 K;  5FWC A;  4NL2 A;  5CKH A;  4CI0 C;  3VUZ A;  3G6E A;  1G5V A;  5CKE A;  2RJF A;  5GAM j;  5GAN d;  3MO8 A;  5GAO q;  1YJ9 A;  4AT1 B;  2DO3 A;  1LOJ A;  1ZSZ C;  1WHL A;  1A0N B;  3FJ5 A;  4RTU A;  3SHW A;  1Z9Z A;  5A0D A;  1IGU A;  1CSK A;  4X34 A;  5GAO r;  3OYE A;  1Y07 A;  4B9W A;  5FU6 B;  2FB7 A;  1X2K A;  2OI3 A;  3SB2 A;  2DD5 A;  3S3O A;  1D09 B;  3PMI A;  4BE2 A;  2MF2 A;  1VOM A;  3L1A A;  1HK9 A;  4Q5W A;  3A8G B;  3G71 T;  2VYT A;  2BIV A;  1VQ7 Q;  4DA4 A;  2MYS A;  1K9M C;  1BI2 A;  1Y0M A;  3ER0 A;  2C0I A;  1SHG A;  2VB6 A;  3BDU A;  1EIF A;  4J5Y A;  2YDL A;  3M55 A;  2DL8 A;  4PK4 A;  4BB7 A;  2RJC A;  1MMA A;  5IT9 E;  3MEV A;  5L8R E;  4DOW A;  4E7I A;  3OMC A;  1WFW A;  3NFC A;  1U3O A;  1D1B A;  4E7K A;  4C5E A;  2KT8 A;  1KIK A;  3G6E T;  5IHI A;  1UGS B;  3EG2 A;  1W2B S;  2HDA A;  2KY9 A;  3QXE B;  3OA6 A;  2AHJ B;  2ZPB B;  3ZL7 C;  3EG0 A;  2LMJ A;  4PLI A;  2KT1 A;  4C92 G;  2HL3 A;  2HSE B;  1Q81 R;  1VQ8 T;  3G4S A;  4AFZ C;  3ASK A;  4J83 A;  5FW9 A;  4EMK C;  1YWP A;  2NLU A;  1WHK A;  4AG2 C;  1H8K A;  3UT1 A;  1R0B G;  2AZV A;  2JMA A;  1SF9 A;  3QWY A;  2RJE A;  1QW1 A;  2FHD A;  2FZC B;  1KK7 A;  3VKI A;  1D3B A;  4PJO B;  1YJW Q;  2COW A;  2JVV A;  3DLL A;  2O4X B;  3QG1 A;  1NPR A;  4HA8 A;  2DNU A;  4PJO F;  1VQK Q;  4J6W A;  4GBQ A;  1UE9 A;  1ABQ A;  2WSC E;  4FM4 B;  1UGV A;  1C6V X;  2EJ9 A;  1UEC A;  4MDX A;  1ZUY A;  1H3Z A;  1YN8 A;  3DB4 A;  1QCO A;  2JM8 A;  2E41 A;  4Z8A A;  3A8L B;  3VYH B;  2PU9 B;  2CT4 A;  4FYY B;  2YLB A;  2V8J A;  4A53 A;  3QO3 A;  1Q82 R;  2XDB A;  2A0F B;  1M5Q 1;  2O4X A;  1I5L A;  1OU8 A;  3JCM d;  2D0Q B;  5J3B A;  3CCM Q;  1X69 A;  2EYQ A;  2L5Q A;  1TSF A;  2OTL T;  2RF0 A;  3PE0 A;  3OYM A;  4Z02 A;  1GL5 A;  5GMK h;  1X01 A;  1N27 A;  3C0C A;  1OU9 A;  2E6N A;  2VGN A;  2A37 A;  3EFO B;  5LJ5 h;  2HSP A;  1YIJ A;  2D8H A;  3A8H B;  1VQ9 T;  1N8R C;  2EYW A;  1D0Z A;  2K9G A;  2X4J A;  2JXB A;  1UG1 A;  4R55 A;  3HKS A;  1N6A A;  2O01 E;  4C0F A;  5LJ3 e;  2YXY A;  5KH6 A;  1P92 A;  3CBO A;  2OTL A;  2OJ2 A;  1M30 A;  2RA2 A;  1YJN T;  3NTK A;  1QWF A;  3OY9 A;  4PNO A;  4X1V A;  5FLX E;  3REA B;  1SSF A;  2ZAE A;  2DTI A;  2VV5 A;  4OGE A;  4X9C A;  5GAN 4;  1YJ9 Q;  1B3Q A;  5KCO A;  3PMT A;  1YHQ Q;  2J05 A;  2AT1 B;  5LJ3 d;  5GAN 8;  1GCP A;  2CSQ A;  2E10 A;  1ZBJ A;  1XOV A;  5GAM e;  1VIF A;  4ZNX A;  2EIF A;  2PVD B;  4M7D C;  2K57 A;  3I5S A;  1HSQ A;  2DBM A;  4A4H A;  1W1F A;  4FL6 A;  3MPU B;  3A8O B;  4TVR A;  3BY7 A;  2RD1 A;  2J06 A;  4J9C A;  5GMK l;  4ZN3 A;  1NPP A;  3CPW A;  5IXB A;  3MET A;  3C12 A;  3JCM P;  1YIJ Q;  2XI9 A;  2EJG A;  4C8Q D;  1X6O A;  3PT9 A;  3CC4 Q;  2X51 A;  3CME T;  2CUD A;  3E9F A;  4C92 A;  3OQ5 A;  1WHM A;  5GJV B;  4XK8 E;  1FX7 A;  2P0P A;  4BI8 B;  2RHI A;  2JJ9 A;  3KXT A;  4L5G A;  4FW2 A;  2DIQ A;  2A08 A;  4B9X A;  1MGQ A;  2DL4 A;  3X25 B;  5KYY A;  1VIE A;  2DAQ A;  3M0T A;  1N9S A;  3JCM V;  3HTR A;  1ZX6 A;  4XTY A;  2MOX A;  3V8J A;  1QVG P;  3AHU A;  1OZ2 A;  2X35 A;  3MKD A;  1WXU A;  3PIO A;  1MMD A;  2KEA A;  1Q82 C;  1JJ2 A;  2CZ0 B;  1S72 T;  2K5F A;  2MWO A;  3D7S B;  4BDY A;  3THK A;  3QDR B;  1M1G A;  4M7A D;  2JS0 A;  4PJJ A;  2NUT A;  2YUQ A;  2RPN A;  3SDZ A;  2OTL Q;  2P4R A;  4XTU A;  3JCM W;  2JTF A;  4VUB A;  5GAO p;  3OYD A;  2LP5 A;  2I2L A;  2GQI A;  4CC7 A;  4HT9 A;  2F2X A;  1K76 A;  2K3B A;  2D8J A;  4M78 E;  3HFN A;  2F2W A;  2EYZ A;  1YP5 A;  2AKL A;  4FW1 A;  5KYW B;  1D1C A;  1IO6 A;  1RAC B;  2EVR A;  2LQ8 A;  4M77 A;  1JU5 C;  1UUE A;  1QMC A;  3KUF A;  1VQN Q;  4M7A B;  3JSC A;  3CCS T;  3KBG A;  1Q86 R;  1XTD A;  1QLY A;  1YIT A;  1J3T A;  3OYB A;  2LJ0 A;  1Q81 C;  4J9B A;  3CEY A;  2G3R A;  1M90 C;  1MV0 B;  4QT7 A;  1WJR A;  1PSE A;  3CC4 T;  1Y57 A;  2K6D A;  1YI2 A;  1ZSZ B;  7AT1 B;  1D0Y A;  4D6W A;  2CYZ B;  4FT2 A;  2OTJ A;  4DQ2 A;  1ZLM A;  2L3S A;  3J7A F;  1M9S A;  3VRZ A;  4K11 A;  1K8A U;  1HD3 A;  5A0G A;  1S1N A;  2ABL A;  1VQ5 Q;  2HCK A;  1SSH A;  1Y96 B;  2ROT A;  2L3R A;  1VQM Q;  2V1R A;  2KBT A;  2V26 A;  4OMM A;  4PJN A;  2PTK A;  2YRC A;  1YJ9 T;  3NGP A;  1KHC A;  3L2V A;  3QZ5 B;  5KYN A;  3I55 Q;  3OBW A;  1RLQ C;  3HRT A;  1OPK A;  4LDY A;  1RLP C;  2KAF A;  4FIB A;  2EJF A;  2DFU A;  4HCZ A;  1VQ7 T;  1K0S A;  4IUP A;  4II1 A;  4IIM A;  4JLI A;  3CCV Q;  3O8V A;  3EGU A;  4M7A A;  4ZGE B;  5GMK m;  3EH1 A;  3CCJ Q;  4JJB A;  4MZT A;  3V8K A;  1K9M U;  4PJO C;  4XAX B;  4E47 A;  4MDW A;  1BIA A;  4M7D G;  4C5I A;  4CRI A;  2ZPI B;  2QI2 A;  2RO0 A;  3GPL A;  4C0D B;  1YCY A;  1IRX A;  2K79 A;  1IHV A;  4NL3 A;  2EW3 A;  2P4T A;  1YCS B;  4JZ4 A;  2CRE A;  3VS3 A;  3GNF B;  2E12 A;  5FU7 C;  3OB9 A;  2KDS A;  3VRY A;  5KE2 A;  2YLC A;  3RIR A;  3E19 A;  4LDW A;  4F7U A;  1G2B A;  3HP9 A;  1N5Z A;  2CSI A;  3EFR A;  4IUT A;  2KYB A;  1KQ1 A;  2EFI A;  2QG9 B;  3E2U A;  3EGX A;  3EAE A;  2E3I A;  4Z89 A;  4PKC C;  4PJL A;  4C8Q A;  1TXQ A;  2CZ6 B;  2M0O A;  2NUP A;  3CCQ Q;  1SPK A;  2FEI A;  3A98 A;  2IPO B;  1GCQ A;  1TTH B;  2B8A A;  3OW2 A;  5LJ5 j;  1NJI R;  3REB B;  3A1P A;  3I56 T;  4EIK A;  4QVD A;  2RQW A;  4OMN A;  5I22 A;  1TOV A;  2C0T A;  4ME7 A;  2JT4 A;  4B6M A;  1Q86 U;  2DK3 A;  5CQY A;  2MAM A;  1BCM A;  1VQK A;  4J9H A;  3UA6 A;  3C4S A;  4C92 C;  1AD5 A;  2DL3 A;  1VYT A;  1E6H A;  5IN1 A;  1PCX A;  1PG5 B;  2VKN A;  4YTL A;  3JB9 D;  4M75 C;  3TSW A;  2ROL A;  3OW2 S;  2HQX A;  1XJW B;  2LJ3 A;  2XD0 A;  2HQH A;  1K4U S;  4KUL A;  4P5N A;  3V7C A;  4M75 E;  1K8A R;  4M7D F;  4RTV A;  1BCO A;  3VS4 A;  3JB9 F;  3OYC A;  2COZ A;  3RKW A;  4XTV A;  1PWT A;  1FMW A;  5GMK i;  2CP6 A;  2M16 A;  2ED0 A;  2L0A A;  1NLP C;  4E7J A;  3MJX A;  3VUB A;  4KGZ B;  1RUW A;  4XU2 A;  4C8Q B;  2DER A;  2CP7 A;  3CCJ T;  2E1H A;  5EG2 A;  3CCM A;  1GBR A;  1K73 C;  1HYO A;  1WQW A;  2YRV A;  2QA4 Q;  1K73 U;  2LJ1 A;  2EQK A;  3L42 A;  3SD4 A;  2GCX A;  1JB0 E;  4J9G A;  3X20 B;  2DIL A;  1VQ6 Q;  2CP0 A;  2YUN A;  1D3B B;  3JB9 I;  3RER A;  2LCL A;  3SEM A;  2IVW A;  2NWM A;  2F2V A;  3VS6 A;  1AOJ A;  4KUI A;  1VQN A;  2MIO A;  5ECA A;  3TQ7 P;  2KRN A;  3OYA A;  3MCA B;  3CC7 A;  1QP3 A;  2RI2 A;  3FIF A;  1X43 A;  4M77 F;  4M77 B;  3CC4 A;  4CC3 A;  2K2M A;  2K4Y A;  3RMQ A;  1K9M R;  1B07 A;  2CP2 A;  2DEU A;  3VS0 A;  3CCS A;  5GAM d;  5GAN j;  3HRU A;  1M90 U;  3VS2 A;  1X27 A;  4BY6 C;  2NUP B;  1SRM A;  1AZE A;  3G1J A;  3QZ9 B;  2DA9 A;  5I2S A;  1ZBX A;  4QQ6 A;  4KGV B;  4XQ3 A;  3EGX B;  4M78 G;  3OMG A;  3EHR A;  4XU3 A;  1KQS A;  3PTA A;  3M0U A;  2DX1 A;  3CC2 Q;  1T3S A;  3F70 A;  3CCU T;  3QUI A;  1PC0 A;  2KK4 A;  1UHC A;  1KSW A;  3LWH A;  4XTX A;  1W70 A;  2PUK B;  3CCL Q;  2G6F X;  1U8R A;  5LJ5 g;  5IXF A;  4KUD K;  2RK2 A;  2E5Q A;  2FRW A;  4C0G A;  2WSE E;  1IGQ A;  4NOY A;  4C8Q C;  1T3L A;  4LE9 A;  1N8R U;  1KD1 R;  2CZ1 B;  2QTX A;  3L2Q A;  4LXC A;  2MWP A;  1VQL Q;  5GAN 2;  2LDM A;  2ZPG B;  3QJ6 A;  3QYH B;  4FCY A;  1QKW A;  3HHT B;  2LNV A;  5J26 A;  3ME9 A;  3VS1 A;  5DY9 A;  1YBY A;  2EQI A;  1W2B P;  5IHK A;  3QSU A;  2M1H A;  1Q7Y U;  2RQU A;  1H64 1;  1ZA1 B;  2AZS A;  4CC2 A;  4ZGD B;  5CCA A;  4R0K A;  5FU6 C;  2PNI A;  1PD0 A;  3RKX A;  1ZUK A;  2A7Y A;  3M4G A;  1RAE B;  1RL2 A;  4UC4 A;  9ATC B;  5D7U A;  3H0I A;  4QVZ A;  4LDV A;  2WAC A;  4Y91 A;  3WXM B;  5GAN 7;  3EGD A;  3V8L A;  1MMG A;  4ESR A;  1XNI A;  3FDR A;  5D6Y A;  1LPL A;  1PHT A;  1G8X A;  1ABO A;  4OML A;  1BI1 A;  2QA4 A;  4DOV A;  1PM3 A;  1MMN A;  2KNB B;  4IIO A;  1NJI U;  2ZPE B;  2DM1 A;  3I56 A;  4RG2 A;  4HCB A;  2X4X A;  4A4K A;  2EGE A;  3U23 A;  3OYH A;  4J7F A;  2D6F A;  4QVC A;  3I5R A;  4IKF A;  1NEG A;  1NG2 A;  4C5G A;  4WTO B;  1QVF P;  4J6Y A;  2LRQ A;  2H8H A;  2KXC A;  2O31 A;  1IZ6 A;  2XDD A;  4EMH A;  2GGR A;  5CKD A;  1G3Y A;  5D6W A;  2MMP A;  4HCC A;  2FG0 A;  3OYJ A;  4IUV A;  1JXO A;  3R6O A;  1FXX A;  2FPF A;  3TSZ A;  2DPP B;  1AWO A;  2JM9 A;  4M4Z A;  4PFZ A;  3FJP A;  4D8D A;  3CMA T;  1NM7 A;  1K0X A;  4KH1 B;  4QKU A;  4M75 D;  1VQO Q;  2BKD N;  5CKF A;  3CME A;  1YJW A;  5GMK e;  2IIM A;  1QVG S;  5GAN 3;  2QQS A;  2W0Z A;  1YHQ T;  3P8D A;  3FEO A;  2XK0 A;  2CKK A;  1LVK A;  2BE7 D;  1W4S A;  1X6B A;  4LD6 A;  2LCS A;  3VV0 A;  3QPH A;  3JCM J;  4BD3 A;  2HNI A;  1U06 A;  4O6J A;  2DRM A;  2PQW A;  2L89 A;  3V7S A;  5LJ5 f;  4OMF B;  1UJY A;  2GBQ A;  4A4F A;  4ELZ C;  1M2V B;  1LNX A;  3LGL A;  3I56 Q;  4E7Z A;  3RBB B;  2E64 A;  5GAN e;  3CPF A;  2HZY A;  4AG1 C;  5FRN A;  1WX6 A;  4OB2 B;  3I9Q A;  2ZPF B;  3CQT A;  5GAM g;  2JTE A;  3LH5 A;  5L23 A;  4N4G A;  1B34 A;  1KD1 U;  1KC8 C;  3C94 A;  1VQ4 T;  3GIB A;  2HL5 C;  3QHS A;  4HXJ A;  4HCK A;  5D6X A;  3M0P A;  5EC7 A;  3EHQ A;  3IQL A;  2D0N A;  1C1A A;  2LX9 A;  1TUC A;  4C92 B;  4BAC A;  1E6G A;  2KXD A;  4ORZ A;  2DBK A;  1Q7Y R;  2E70 A;  4XTW A;  1OPL A;  1PRM C;  5GMK j;  1YFN A;  2ZZD A;  2BZY A;  1JEG A;  2QEX T;  2CZ7 B;  5GJW B;  1OEB A;  2E3H A;  2M02 A;  3OS5 A;  2Y4Y A;  1M3C A;  5GAN 5;  2GQV A;  1VQ4 Q;  1GFD A;  1WJS A;  2QGG A;  1G3T A;  1BI3 A;  4C92 E;  4E7L A;  4J9D A;  1MNE A;  5LJ3 g;  2MK5 A;  1UEB A;  2XID A;  1BK2 A;  1UGQ B;  2DTH A;  4JPB W;  4M77 G;  1PSF A;  3V7R A;  1GBQ A;  2EBP A;  2EKO A;  3PFS A;  4C8Q F;  4EPC A;  2DRK A;  2HD0 A;  1AEY A;  4OP0 A;  1AWJ A;  3CD6 T;  2M9U A;  5KYX A;  1ZHI A;  2RH2 A;  2RN8 A;  1VQP Q;  2XMF A;  4RTT A;  3FC3 A;  1V76 A;  3RUX A;  4V2S A;  2L2P A;  1M27 C;  4FU6 A;  1X6G A;  2CUB A;  1ARK A;  2QDY B;  2XDP A;  2A3L A;  2HEQ A;  3I55 T;  2M0Y A;  3HPW A;  2RI3 A;  4M7D E;  4RUG A;  2YRD A;  4M75 F;  2JW4 A;  3CCU A;  4EMK B;  2FVU A;  2RM4 A;  2H3E B;  5LJ5 e;  2OTJ T;  1MV3 A;  2RK1 A;  3M58 A;  2K3X A;  2YHT A;  3CD6 Q;  2X3W D;  1OX8 A;  5AYF A;  5CK9 A;  3G6E Q;  2OTJ Q;  2R57 A;  2PUO B;  1I0C A;  1VQ8 A;  3L2W A;  5A2Q E;  3PIP A;  1VQ5 T;  3M54 A;  3A8M B;  3ZEH A;  3CD6 A;  2Y90 A;  4N0A A;  3GOX A;  3CMA Q;  1V1C A;  1AZG B;  3CCV A;  1QCF A;  5HKC A;  2KGT A;  4F04 B;  3CC7 T;  2DJZ A;  2VC8 A;  2XU8 A;  3G71 Q;  2NUZ A;  4HVU A;  2DF6 A;  1T0J A;  3OYK A;  3PVQ A;  2VVK A;  2LCC A;  1WQ7 A;  1NBE B;  1M1K R;  2SRC A;  3SWN B;  4JS4 A;  2NUT B;  4KH0 B;  5CO7 A;  3MEA A;  4XTZ A;  2XKO C;  3N5B B;  1WHJ A;  3M9Q A;  4PJO G;  2COY A;  4AFQ C;  2K5I A;  1M3A A;  1JQQ A;  3MP1 A;  2M51 A;  1F1B B;  1NJI C;  4M78 D;  3OYF A;  3NHN A;  1K1Z A;  1EZZ B;  3ULR B;  3GF5 A;  2GFU A;  3UAT A;  2QEX Q;  1I4K 1;  1AWW A;  1Y96 A;  4GLK A;  1I5O B;  2HBW A;  4PJO A;  4CC4 B;  5KYY B;  2RHY A;  3EGD B;  2LQN A;  5GAN 6;  1Q81 U;  1B7T A;  3QYG B;  1I1J A;  2J6K A;  1R8O B;  4XU0 A;  4M7A C;  5I11 A;  3TEE A;  2RQR A;  1U1T A;  3JCM h;  5GAO m;  4OB1 B;  4F7U F;  1WYX A;  1YIT T;  3J81 E;  2V1Q A;  3CPW S;  3OYY A;  3C95 A;  1S72 Q;  4WF2 A;  4N4I A;  1WNL A;  2EKH A;  1SRL A;  2EYY A;  4AFS C;  2GNC A;  1RI9 A;  1OYX A;  1VYV A;  2E65 A;  3VJP A;  3JCM b;  4BE0 A;  3TCJ A;  2CDT A;  1MHN A;  4FYV B;  1PNJ A;  1OV3 A;  4NS5 A;  1VQL T;  1GCQ C;  3WVD B;  4DBQ A;  2RI5 A;  2QEX A;  4JS5 A;  2KYM A;  5CVI A;  3JB9 G;  2KI7 A;  3M57 A;  1WLP B;  1FMV A;  4RMO A;  1M8V A;  5LJ3 f;  8ATC B;  2RJD A;  3CCQ A;  3M4Y A;  5I2M A;  3I55 A;  3S3N A;  4DEY A;  1IXD A;  4PLL A;  3G7Z A;  4AFU C;  2YUO A;  2HBP A;  1VQL A;  1G3W A;  3UA7 A;  3OBY A;  3JCM f;  4L59 A;  2KRM A;  4KRT A;  4RTW A;  3JCM c;  3TVT A;  2ESW A;  4Z88 A;  1CKB A;  3LGF A;  3NTH A;  3CCJ A;  2LVM A;  3QWX X;  1YI2 Q;  2HKN A;  2K3Y A;  2E5K A;  1RAI B;  3DLM A;  1G3S A;  1Y7X A;  3LH0 A;  2AKK A;  3JCM e;  4EMG A;  3QII A;  1ACM B;  2E4H A;  2DD4 A;  2IG0 A;  2R5M A;  1KQ2 A;  2CGH A;  3GBQ A;  5A0L A;  1RAB B;  1WZO A;  4C0Z A;  3H41 A;  1I8F A;  1WI7 A;  2MPX C;  2DVJ A;  3M0S A;  4PFP A;  2K2V A;  1IHW A;  3CCE Q;  1UB4 A;  2C06 A;  4J6X A;  1D0X A;  3UWN A;  1GRI A;  3CXC S;  1YJN Q;  3FB9 A;  2YUP A;  3UF4 A;  3L2U A;  5IAY A;  4DBH A;  2YWW A;  1M90 R;  2JZ2 A;  4JRK A;  4M78 F;  4ZGJ B;  2EQU A;  3JCM g;  4LDX A;  2KE9 A;  1M2V A;  4Y92 A;  2V8K A;  2EGA A;  4BUG A;  1JXM A;  3CMA A;  1JBM A;  2QQ9 A;  4JJN K;  3GLX A;  2EGC A;  2VAS A;  3X26 B;  2KR3 A;  2QYZ A;  5GAO l;  1NLO C;  2HAX A;  1Q95 G;  1H92 A;  2LT1 A;  3CBP A;  2X9H A;  2QAZ A;  4DEX A;  1UDL A;  2DXC A;  1GFC A;  2QQR A;  4O5V A;  3CCL T;  2J6O A;  2ENM A;  3CXC P;  5GAO n;  1PKT A;  3Q1J A;  4D8K A;  4JJC A;  3CCR A;  3OYN A;  4OB3 B;  3BE3 A;  3URG A;  1B34 B;  1E7O A;  2J7I A;  2RQT A;  2Z0W A;  3KFV A;  5FRM A;  4OMQ A;  2CT3 A;  3LX7 A;  4IUQ A;  2XIC A;  1M1K U;  4LUD A;  1BKB A;  2HMA A;  2PZ1 A;  3EFO A;  1DJ7 B;  2VGM A;  3AT1 B;  1WPY A;  3X24 B;  4A4E A;  5KYU B;  2GFA A;  4Y28 E;  4JZ3 A;  1KG1 A;  4MML A;  2X3X D;  5KYX B;  4EMK A;  3BFM A;  3NTI A;  1WDX A;  4C8Q E;  2L8D A;  3A5Z B;  2I0N A;  4DBR A;  2FPE A;  4JRQ A;  1FMK A;  4XU1 A;  2RHU A;  3RNJ A;  4C92 F;  1BYM A;  2FZG B;  2E6Z A;  1FYN A;  2DXT A;  2YT6 A;  1TUD A;  2ECZ A;  1OI1 A;  3L2R A;  3JAM E;  4ATO A;  5KYU A;  1AT1 B;  4OVA A;  2K5L A;  4M77 D;  3G71 A;  4JJD A;  4LNP A;  2QA4 T;  2LT4 A;  5HK0 A;  3JB9 J;  3EFS A;  3QDF A;  2EQM A;  2Y4X A;  3RKY A;  2BUD A;  1UHF A;  2GF7 A;  3JCM Q;  1OOT A;  1NE8 A;  3H0H A;  3EG1 A;  4RKU E;  1VQO A;  4BI3 A;  1BI0 A;  1AHJ B;  2A28 A;  2QK0 A;  3HSB A;  1PKS A;  2DL7 A;  2JTM A;  1JJ2 S;  3P8B B;  2VXF A;  4QQG A;  3QBY A;  1KQS S;  4PJM A;  2DMO A;  3DB3 A;  3OS1 A;  1YI2 T;  1KQS P;  1NEB A;  3CCV T;  4ZN1 A;  5CIU A;  3EH2 A;  4RTX A;  2DXU A;  4E7H A;  1TH7 A;  3QKJ A;  4M75 G;  3SFM A;  2F69 A;  2BZ8 A;  4M78 B;  1QP2 A;  2VWF A;  4ZTF A;  2FRY A;  3UDC A;  1BU1 A;  3CC7 Q;  1K9A A;  2RQV A;  1TWB A;  2DZ9 A;  4HKE A;  2VXE A;  3I35 A;  5CR2 A;  2DVE A;  2CH4 W;  1D1A A;  1KJW A;  1RI0 A;  4JLG A;  2JNG A;  2EQJ A;  1WIE A;  5FWB A;  4F7U B;  2ZCF B;  4PFO A;  1M3B A;  2QAS A;  2DKG A;  3LW5 E;  1PRL C;  4F14 A;  1VQ4 A;  3BDL A;  3MP6 A;  1BB9 A;  2CS7 A;  4PJO E;  5FU7 B;  5DLQ E;  1LCK A;  4M78 A;  2P84 A;  4KT0 E;  2F1L A;  5DM7 R;  2RNA A;  1LJO A;  1Q86 C;  4JRI A;  2KSS A;  2AIR B;  4HT8 A;  1NYF A;  1QVF A;  2BE9 B;  1TUG B;  4LD9 K;  3H9N A;  1VQP T;  1MND A;  4M77 E;  1M2O A;  4JUV A;  1YJN A;  2QQB A;  1KC8 R;  2JOY A;  1KHI A;  2EYX A;  4BE1 A;  2LNH B;  5FRO A;  5GAN h;  1CKA A;  4M77 C;  3ZFJ A;  3CCS Q;  5HY6 A;  4RTZ A;  1H3H A;  2F5T X;  3MEU A;  2F5K A;  3J80 E;  1JRI A;  3H0F A;  1HXD A;  2EAY A;  4AMC A;  2EPD A;  1YHQ A;  2R5A A;  4J7I A;  3M59 A;  4LDU A;  1Q82 U;  1V29 B;  4J9F A;  2X4W A;  4E7S A;  1XQH A;  4MZP A;  2ED1 A;  1RAH B;  3VU3 C;  1OZ3 A;  2A36 A;  3OW2 P;  3M56 A;  2OAW A;  4HVW A;  4RTY A;  4M75 B;  5HK3 A;  3MP8 A;  3M0R A;  2O2O A;  2PVO B;  2LX7 A;  2KMT A;  4FYX B;  3O5Z A;  1WXB A;  4FYW B;  3WVE B;  2AK5 A;  3OYL A;  4IUR A;  1C0M A;  2P0K A;  5GAN g;  4KGX B;  3FRN A;  4WCI A;  2BTT A;  1VUB A;  1U5S A;  1I81 A;  3E1S A;  5C0M A;  1UGR B;  2DXB A;  2H3J A;  2QGF B;  8AT1 B;  1VQO T;  4A54 A;  1GXI E;  3S6W A;  5GAM f;  1YNZ A;  2BZX A;  3H8Z A;  4GY5 A;  4ZTJ A;  2KQW A;  2KVQ G;  1ZA2 B;  1G83 A;  5C6S A;  3RES A;  2XG8 D;  3OYG A;  2QDL A;  3INZ A;  1VQ9 A;  5KCH A;  3JCM X;  3CCR Q;  3L2Z A;  2FYK A;  1YIJ T;  1BIB A;  1QVP A;  3PNW C;  1BBZ A;  1VQM T;  3OSV A;  1R0C B;  4HVV A;  1X75 C;  2LQW A;  4C5H A;  1VA7 A;  4R56 A;  2QTV A;  1Y71 A;  1QCN A;  1NYG A;  4FSX A;  3EG9 B;  3CXC A;  5IHN A;  4C8Q G;  1JO8 A;  1Z9Q A;  1K73 R;  2VUB A;  2RB6 A;  2HQE A;  3NPF A;  4C92 D;  2PVG B;  4BY6 B;  1VQP A;  2OX7 A;  4OB0 B;  2HKQ B;  1VQ5 A;  4PJO D;  1QKX A;  1M4Z A;  2KRO A;  2DYI A;  4FSS A;  3GP8 A;  2L3P A;  1WHH A;  2DET A;  3H6Z A;  1RAF B;  3CBM A;  1T0H A;  2QXF A;  5AT1 B;  1VQN T;  4LN2 A;  1OX9 A;  1N8R R;  4F17 A;  1VQM A;  3M0Q A;  2J6F A;  3DKM A;  4M78 C;  1YWO A;  4RG8 A;  2ZGW A;  3RDV A;  4A63 B;  1WHG A;  3UPU A;  4QW2 A;  1IRE B;  2DE0 X;  2QQA A;  1KD1 C;  1W2B A;  3HFO A;  1IB8 A;  1OQK A;  3MEW A;  1VQ9 Q;  4M7A G;  2JN0 A;  1S72 A;  1M1F A;  3LYI A;  1TU0 B;  3QJY A;  3ZBD A;  3EG9 A;  3E9G A;  4C0D C;  3S3M A;  1K8A C;  3CCL A;  3CPW P;  1EX4 A;  2L3Q A;  1MUZ A;  1VQ7 A;  6AT1 B;  2FL7 A;  2DLP A;  1TS9 A;  4M75 A;  5CKB A;  2DIG A;  3PVL A;  1M1K C;  3LLR A;  2XHC A;  3T9N A;  1KFZ A;  5HCK A;  2D9T A;  2WSF E;  1Q7Y C;  3SWN A;  2YSQ A;  3CME Q;  1WA7 A;  4M7A E;  1UJ0 A;  3FLG A;  1FWZ A;  3PGG A;  2EWN A;  1SG5 A;  4DBF A;  4QQD A;  2ZPH B;  1O9S A;  4ANJ A;  2D1X A;  5LL6 S;  3RMS A;  2CP3 A;  5DLO A;  4BDZ A;  5M9O A;  1SHF A;  2FZK B;  2CP5 A;  3LWI A;  3GNG A;  4MZM A;  1VQK T;  1KC8 U;  2O9S A;  4OMP A;  3RR6 A;  1ZSZ A;  1ZUU A;  5J39 A;  3TRE A;  5CAI A;  1VYU A;  1AVZ C;  3CCR T;  4F7U E;  1HJD A;  2DTO A;  3HRS A;  3CCU Q;  3X28 B;  3CC2 T;  4FT4 A;  2NYS A;  4A4G A;  1N9R A;  3EG3 A;  4E2F B;  4KBM B;  1VQ8 Q;  1JJ2 P;  1QWE A;  3HL8 A;  3VS5 A;  4BI4 A;  4IUU A;  2KRS A;  2P0Q A;  4F7U G;  3SWN C;  2FO0 A;  4JRP A;  4E6R A;  1RAA B;  3VS7 A;  2RHZ A;  1VQ6 T;  5GAM h;  4GLM A;  2LTO A;  1SEM A;  3VYG A;  4J9I A;  4M7A F;  1AWX A;  5CQX A;  3CCE T;  4M7D B;  5I21 A;  5LJ5 d;  3OSS C;  1ZSG A;  2MI6 A;  1QQJ A;  2X4Y A;  3JRZ A;  4F16 A;  4M7D A;  2RMO A;  2JMC A;  2V8I A;  1I07 A;  1WGS A;  2LZ6 B;  2JUF A;  1R77 A;  3NMZ C;  1TG0 A;  1NZ9 A;  4L6V 5;  3CCE A;  4EDU A;  3CCM T;  4MMK A;  1SKU B;  2K7A A;  2DEQ A;  1VQ6 A;  1W6X A;  3MHX A;  3R6N A;  2SEM A;  2GTJ A;  4LUE A;  4OGC A;  1RAD B;  5LJ3 h;  5KYW A;  3OYI A;  4M7D D;  2W10 A;  1WJQ A;  2GTO A;  3JB9 H;  1UFF A;  4J8O A;  4OMO A;  1RAG B;  3OS2 A;  1WXT A;  3BW1 A;  5LJ3 j;  5IH2 A;  3CC2 A;  4JDS A;  1UGP B;  2B86 A;  2C0O A;  1UTI A;  2R58 A;  1M8M A;  4N4H A;  4RCB A;  2DYB A;  2CH4 A;  3G4S Q;  5GAN f;  2MCN A;  1EFN A;  1PD1 A;  1QVF S;  3M5A A;  1O75 A;  1X2Q A;  3CCQ T;  3P8H A;  2RHX A;  2O9V A;  5KE3 A;  2ATC B;  2DJQ A;  1YJW T;  2LC4 A;  2JS2 A;  3G4S T;  3OS0 A;  1U1S A;  3JV3 A;  1YIT Q;  4OF1 A;  4X9D A;  4J9E A;  4RCC A; 
#chains in the Genus database with same CATH homology
 4JLG A;  4ZGE B;  5GAN 5;  2GQV A;  2EQJ A;  2JNG A;  5GMK m;  4ELY C;  4PL6 A;  1WJS A;  4N0A C;  4F7U B;  1G3T A;  1BI3 A;  2ZCF B;  1VQ8 T;  3M53 A;  4C92 E;  4E7L A;  2OAU A;  2LQK A;  4MZT A;  1ZQ1 A;  5LJ3 g;  3V8K A;  2DZC A;  1K9M U;  2DKG A;  1UEB A;  3LW5 E;  2XID A;  3TU4 K;  1UGQ B;  1QVG A;  2DTH A;  4PJO C;  4NL2 A;  4XAX B;  4MDW A;  5CKH A;  4E47 A;  3VUZ A;  4CI0 C;  3G6E A;  1G5V A;  4M77 G;  1PSF A;  1BIA A;  5CKE A;  3V7R A;  2RJF A;  1VQ4 A;  2EKO A;  3BDL A;  3MP6 A;  3PFS A;  4C8Q F;  3MO8 A;  2HD0 A;  4EPC A;  5GAM j;  5GAN d;  2CS7 A;  4M7D G;  4C5I A;  4OP0 A;  4CRI A;  2ZPI B;  2QI2 A;  2RO0 A;  3GPL A;  4C0D B;  5GAO q;  1YJ9 A;  3CD6 T;  4PJO E;  1YCY A;  2M9U A;  4NL3 A;  2DO3 A;  1ZHI A;  2RH2 A;  1LOJ A;  5FU7 B;  2P4T A;  5DLQ E;  3FC3 A;  4M78 A;  4KT0 E;  3RUX A;  5A0D A;  3GNF B;  2E12 A;  5DM7 R;  4V2S A;  5FU7 C;  1LJO A;  1Q86 C;  4FU6 A;  3OB9 A;  2KDS A;  4X34 A;  4JRI A;  5GAO r;  5KE2 A;  1Y07 A;  4B9W A;  5FU6 B;  2FB7 A;  2KSS A;  2YLC A;  3OYE A;  2QDY B;  2XDP A;  3RIR A;  4HT8 A;  1QVF A;  3E19 A;  4LDW A;  4F7U A;  2A3L A;  3HP9 A;  3SB2 A;  3I55 T;  4LD9 K;  2DD5 A;  3S3O A;  1VQP T;  3HPW A;  2RI3 A;  3EFR A;  4M7D E;  3PMI A;  4BE2 A;  2MF2 A;  4IUT A;  4M75 F;  3CCU A;  3L1A A;  4M77 E;  1HK9 A;  4EMK B;  1KQ1 A;  2EFI A;  2FVU A;  4JUV A;  4Q5W A;  2QQB A;  2RM4 A;  3EAE A;  1YJN A;  3A8G B;  3G71 T;  5LJ5 e;  2JOY A;  4PKC C;  1KHI A;  2VYT A;  2OTJ T;  2BIV A;  4C8Q A;  4BE1 A;  4DA4 A;  2CZ6 B;  2RK1 A;  3M58 A;  2K3X A;  5FRO A;  2YHT A;  5GAN h;  2M0O A;  1K9M C;  5AYF A;  1BI2 A;  4M77 C;  3ZFJ A;  5CK9 A;  3ER0 A;  5HY6 A;  2R57 A;  2F5T X;  3MEU A;  2F5K A;  3BDU A;  3J80 E;  1EIF A;  1JRI A;  4J5Y A;  2PUO B;  2B8A A;  3OW2 A;  1HXD A;  2EAY A;  3M55 A;  5LJ5 j;  1VQ8 A;  3L2W A;  4BB7 A;  5A2Q E;  3PIP A;  2RJC A;  3I56 T;  4QVD A;  5IT9 E;  3M54 A;  1VQ5 T;  3A8M B;  1YHQ A;  2R5A A;  3MEV A;  5L8R E;  3ZEH A;  4DOW A;  4E7I A;  3CD6 A;  2Y90 A;  3OMC A;  4E7K A;  3NFC A;  4N0A A;  3GOX A;  4J7I A;  4C5E A;  3M59 A;  4ME7 A;  4LDU A;  1Q82 U;  1V29 B;  3G6E T;  1Q86 U;  3CCV A;  2X4W A;  2DK3 A;  5CQY A;  2MAM A;  1VQK A;  5HKC A;  1UGS B;  3CC7 T;  2DJZ A;  3C4S A;  4C92 C;  1W2B S;  1XQH A;  4MZP A;  2KY9 A;  2VC8 A;  2XU8 A;  3QXE B;  4BDZ A;  3OA6 A;  2AHJ B;  2ZPB B;  5IN1 A;  3OYK A;  3VU3 C;  1OZ3 A;  2LCC A;  1WQ7 A;  4YTL A;  3M56 A;  3JB9 D;  4M75 C;  4PLI A;  3OW2 S;  2HQX A;  3SWN B;  4JS4 A;  4C92 G;  2XD0 A;  4M75 B;  5CO7 A;  3MEA A;  3MP8 A;  4KUL A;  4P5N A;  2XKO C;  3N5B B;  4XTZ A;  5HK3 A;  3V7C A;  2PVO B;  3G4S A;  3ASK A;  4J83 A;  4EMK C;  3M9Q A;  4PJO G;  2NLU A;  4M75 E;  2KMT A;  2K5I A;  4M7D F;  3UT1 A;  3MP1 A;  3JB9 F;  3OYC A;  1NJI C;  4M78 D;  2RJE A;  3RKW A;  3OYF A;  1QW1 A;  2FHD A;  3WVE B;  4XTV A;  3VKI A;  1D3B A;  4PJO B;  3OYL A;  3GF5 A;  4IUR A;  2GFU A;  5GMK i;  2JVV A;  3DLL A;  2M16 A;  1I4K 1;  2O4X B;  1Y96 A;  2P0K A;  3QG1 A;  4GLK A;  1NPR A;  5GAN g;  4E7J A;  4PJO A;  3FRN A;  3VUB A;  4HA8 A;  1VUB A;  4XU2 A;  4C8Q B;  1I81 A;  3E1S A;  4PJO F;  2RHY A;  4J6W A;  5C0M A;  3CCJ T;  5GAN 6;  1Q81 U;  1UGR B;  2WSC E;  2E1H A;  4FM4 B;  3QYG B;  1R8O B;  4XU0 A;  2EJ9 A;  2DXB A;  5EG2 A;  4MDX A;  3CCM A;  4M7A C;  2H3J A;  3TEE A;  1VQO T;  1U1T A;  3JCM h;  4A54 A;  1K73 C;  1GXI E;  5GAO m;  1H3Z A;  4OB1 B;  4F7U F;  1WQW A;  3DB4 A;  3S6W A;  5GAM f;  1YIT T;  2YRV A;  2E41 A;  1K73 U;  3J81 E;  2EQK A;  3A8L B;  3H8Z A;  3L42 A;  4GY5 A;  3VYH B;  3CPW S;  2KQW A;  3SD4 A;  2KVQ G;  4ZTJ A;  2GCX A;  2PU9 B;  3OYY A;  3C95 A;  5C6S A;  1JB0 E;  3RES A;  2XG8 D;  3X20 B;  2YLB A;  3OYG A;  2V8J A;  4A53 A;  3INZ A;  3QO3 A;  1VQ9 A;  4WF2 A;  2XDB A;  1D3B B;  1M5Q 1;  5KCH A;  3JCM X;  2O4X A;  4N4I A;  1WNL A;  3L2Z A;  1N8R C;  1I5L A;  2FYK A;  1YIJ T;  3JB9 I;  1OYX A;  3RER A;  1BIB A;  3JCM d;  1QVP A;  2D0Q B;  2E65 A;  2LCL A;  3PNW C;  5J3B A;  3VJP A;  3JCM b;  2IVW A;  4BE0 A;  1VQM T;  2EYQ A;  3OSV A;  3TCJ A;  1X75 C;  4C5H A;  4KUI A;  2L5Q A;  1VQN A;  2OTL T;  1MHN A;  4R56 A;  3OYA A;  3OYM A;  4Z02 A;  1Y71 A;  3MCA B;  5GMK h;  1X01 A;  1N27 A;  3CC7 A;  1QP3 A;  2RI2 A;  3FIF A;  4FSX A;  4M77 F;  4NS5 A;  1VQL T;  3WVD B;  4M77 B;  2RI5 A;  3CXC A;  4C8Q G;  2QEX A;  2E6N A;  2VGN A;  3CC4 A;  4JS5 A;  2K4Y A;  5CVI A;  3JB9 G;  2VUB A;  2RB6 A;  5LJ5 h;  3M57 A;  3RMQ A;  1YIJ A;  2HQE A;  4RMO A;  4C92 D;  2PVG B;  1M8V A;  4BY6 B;  3CCS A;  3A8H B;  5GAM d;  5LJ3 f;  5GAN j;  2RJD A;  3CCQ A;  1VQ9 T;  1VQP A;  3M4Y A;  4OB0 B;  3HRU A;  5I2M A;  3I55 A;  3S3N A;  2X4J A;  1VQ5 A;  4PJO D;  1M90 U;  1M4Z A;  4PLL A;  4BY6 C;  3G7Z A;  4R55 A;  3HKS A;  1N6A A;  2HBP A;  3QZ9 B;  2O01 E;  1VQL A;  3GP8 A;  4C0F A;  5I2S A;  1ZBX A;  4QQ6 A;  1G3W A;  5LJ3 e;  4XQ3 A;  4M78 G;  3OMG A;  3H6Z A;  3OBY A;  5KH6 A;  1P92 A;  3CBO A;  3CBM A;  3JCM f;  4L59 A;  2OTL A;  2QXF A;  4XU3 A;  1VQN T;  1KQS A;  3JCM c;  2RA2 A;  1VQM A;  3LGF A;  3NTH A;  3DKM A;  3NTK A;  3PTA A;  2LVM A;  3CCJ A;  1YJN T;  2K3Y A;  3F70 A;  3CCU T;  3OY9 A;  3QUI A;  4M78 C;  3DLM A;  4PNO A;  1G3S A;  4RG8 A;  1Y7X A;  3LH0 A;  5FLX E;  1SSF A;  2KK4 A;  2ZGW A;  3JCM e;  4EMG A;  3QII A;  2VV5 A;  2DTI A;  3UPU A;  2DD4 A;  4OGE A;  4X9C A;  4QW2 A;  5GAN 4;  1IRE B;  2IG0 A;  2R5M A;  2QQA A;  3LWH A;  4XTX A;  1KD1 C;  1KQ2 A;  2CGH A;  5KCO A;  2PUK B;  3HFO A;  1W2B A;  3PMT A;  5A0L A;  5LJ5 g;  1U8R A;  4KUD K;  5LJ3 d;  2RK2 A;  5GAN 8;  3MEW A;  2E10 A;  2E5Q A;  1XOV A;  4C0Z A;  1VIF A;  4C0G A;  5GAM e;  4M7A G;  2EIF A;  2JN0 A;  1I8F A;  2WSE E;  1S72 A;  2PVD B;  4NOY A;  4C8Q C;  4M7D C;  2K57 A;  1M1F A;  3LYI A;  1N8R U;  3QJY A;  2CZ1 B;  2QTX A;  3ZBD A;  3L2Q A;  3E9G A;  4A4H A;  4C0D C;  3S3M A;  2MWP A;  1K8A C;  3CCL A;  2K2V A;  4FL6 A;  2LDM A;  5GAN 2;  1VQ7 A;  2FL7 A;  1UB4 A;  2ZPG B;  3QJ6 A;  4J6X A;  2C06 A;  3QYH B;  3A8O B;  3HHT B;  4TVR A;  3UWN A;  3BY7 A;  2RD1 A;  4M75 A;  2LNV A;  5J26 A;  3CXC S;  5CKB A;  2DIG A;  3ME9 A;  3FB9 A;  4ZN3 A;  1NPP A;  5GMK l;  3CPW A;  1M1K C;  3LLR A;  2XHC A;  3T9N A;  5DY9 A;  1YBY A;  2D9T A;  2WSF E;  3C12 A;  3MET A;  1Q7Y C;  3L2U A;  3SWN A;  3JCM P;  5IAY A;  2XI9 A;  3QSU A;  2EJG A;  2M1H A;  1X6O A;  4C8Q D;  1Q7Y U;  4M7A E;  3PT9 A;  3FLG A;  1H64 1;  1FWZ A;  4ZGD B;  2JZ2 A;  3PGG A;  4JRK A;  2EWN A;  4M78 F;  2EQU A;  5FU6 C;  3JCM g;  4ZGJ B;  5CCA A;  3CME T;  4QQD A;  2ZPH B;  4LDX A;  3E9F A;  4C92 A;  3OQ5 A;  1O9S A;  5LL6 S;  3RKX A;  2A7Y A;  3M4G A;  2V8K A;  1RL2 A;  4UC4 A;  4XK8 E;  3RMS A;  4BUG A;  1FX7 A;  2P0P A;  4BI8 B;  2RHI A;  1JBM A;  5DLO A;  3CMA A;  2QQ9 A;  4QVZ A;  4LDV A;  5M9O A;  2WAC A;  4Y91 A;  3WXM B;  5GAN 7;  4L5G A;  3KXT A;  4JJN K;  3GLX A;  2DIQ A;  3V8L A;  4B9X A;  1MGQ A;  3X26 B;  3X25 B;  3LWI A;  1XNI A;  3FDR A;  3GNG A;  4MZM A;  5D6Y A;  5GAO l;  1VQK T;  1KC8 U;  1VIE A;  2HAX A;  2DAQ A;  2LT1 A;  1N9S A;  1BI1 A;  3CBP A;  3JCM V;  2QA4 A;  4XTY A;  4DOV A;  3V8J A;  5J39 A;  2DXC A;  3AHU A;  3TRE A;  1OZ2 A;  2QQR A;  2X35 A;  4O5V A;  5CAI A;  1NJI U;  2ZPE B;  3CCL T;  3I56 A;  4RG2 A;  3CCR T;  4F7U E;  4HCB A;  2X4X A;  4A4K A;  2DTO A;  3HRS A;  5GAO n;  3OYH A;  4J7F A;  3PIO A;  2D6F A;  4QVC A;  3Q1J A;  3X28 B;  1Q82 C;  3CC2 T;  4IKF A;  4C5G A;  1JJ2 A;  2CZ0 B;  1S72 T;  2K5F A;  2MWO A;  4J6Y A;  4FT4 A;  3CCR A;  4A4G A;  1N9R A;  4BDY A;  2LRQ A;  3QDR B;  1M1G A;  4KBM B;  1IZ6 A;  3OYN A;  4M7A D;  4OB3 B;  2XDD A;  3URG A;  1B34 B;  4EMH A;  3SDZ A;  5CKD A;  1G3Y A;  4XTU A;  5D6W A;  3JCM W;  3HL8 A;  2MMP A;  2JTF A;  4HCC A;  4BI4 A;  3OYJ A;  4IUU A;  2P0Q A;  4F7U G;  3SWN C;  4IUV A;  4VUB A;  5GAO p;  5FRM A;  3OYD A;  3LX7 A;  2I2L A;  4JRP A;  3R6O A;  4IUQ A;  1FXX A;  2XIC A;  1M1K U;  1BKB A;  4HT9 A;  2DPP B;  2RHZ A;  1VQ6 T;  4M78 E;  3HFN A;  5GAM h;  2LTO A;  3VYG A;  3FJP A;  1DJ7 B;  3CMA T;  4M7A F;  2VGM A;  5CQX A;  3X24 B;  1WPY A;  3CCE T;  5I21 A;  4M7D B;  4A4E A;  4M75 D;  5LJ5 d;  2GFA A;  3OSS C;  4Y28 E;  2BKD N;  5CKF A;  3CME A;  1YJW A;  2MI6 A;  2X4Y A;  2LQ8 A;  3JRZ A;  4MML A;  4M7D A;  1KG1 A;  4M77 A;  5GMK e;  2V8I A;  1WGS A;  1QVG S;  3KUF A;  5GAN 3;  2JUF A;  4EMK A;  4M7A B;  2QQS A;  3BFM A;  3JSC A;  3NTI A;  3KBG A;  4C8Q E;  1XTD A;  3CCS T;  1YIT A;  3OYB A;  1YHQ T;  2L8D A;  3P8D A;  1Q81 C;  3A5Z B;  3CEY A;  2G3R A;  1NZ9 A;  3FEO A;  1M90 C;  4L6V 5;  2XK0 A;  3CCE A;  1WJR A;  4EDU A;  3CCM T;  1PSE A;  3CC4 T;  2CKK A;  4JRQ A;  4MMK A;  4XU1 A;  1YI2 A;  2RHU A;  1W4S A;  2DEQ A;  4C92 F;  1VQ6 A;  4LD6 A;  1BYM A;  2E6Z A;  2DXT A;  3VV0 A;  3MHX A;  1OI1 A;  3L2R A;  4D6W A;  3JAM E;  2CYZ B;  4FT2 A;  4ATO A;  3QPH A;  4OGC A;  3JCM J;  4BD3 A;  4OVA A;  2HNI A;  2OTJ A;  2K5L A;  4DQ2 A;  4M77 D;  5LJ3 h;  3G71 A;  3OYI A;  3J7A F;  2QA4 T;  2LT4 A;  4O6J A;  4M7D D;  1M9S A;  2PQW A;  5HK0 A;  3JB9 J;  1WJQ A;  3JB9 H;  2L89 A;  3V7S A;  3EFS A;  4OMF B;  5LJ5 f;  4A4F A;  1K8A U;  5A0G A;  4ELZ C;  1LNX A;  3LGL A;  4J8O A;  2EQM A;  2Y4X A;  3RKY A;  2BUD A;  2GF7 A;  3OS2 A;  1Y96 B;  3JCM Q;  3BW1 A;  5LJ3 j;  1NE8 A;  2L3R A;  3CC2 A;  2E64 A;  5GAN e;  3CPF A;  4JDS A;  4RKU E;  5FRN A;  4OB2 B;  1VQO A;  1UGP B;  4BI3 A;  2ZPF B;  1BI0 A;  1AHJ B;  5GAM g;  3HSB A;  4N4G A;  1YJ9 T;  1B34 A;  1KD1 U;  1KC8 C;  2JTM A;  1KHC A;  3C94 A;  2R58 A;  1JJ2 S;  3L2V A;  3P8B B;  1VQ4 T;  2VXF A;  3GIB A;  4QQG A;  3QBY A;  3QZ5 B;  4N4H A;  4RCB A;  1KQS S;  3OBW A;  3QHS A;  3DB3 A;  3HRT A;  3OS1 A;  1YI2 T;  4LDY A;  2KAF A;  5D6X A;  3CCV T;  4ZN1 A;  5CIU A;  4FIB A;  5GAN f;  2LX9 A;  2DXU A;  4E7H A;  1QVF S;  3M5A A;  1O75 A;  1TH7 A;  4C92 B;  3QKJ A;  2EJF A;  4M75 G;  3CCQ T;  4BAC A;  3SFM A;  2F69 A;  3P8H A;  4M78 B;  4HCZ A;  1QP2 A;  2E70 A;  2RHX A;  4XTW A;  4ZTF A;  1VQ7 T;  3UDC A;  5GMK j;  5KE3 A;  2ZZD A;  2DZ9 A;  4IUP A;  2QEX T;  4HKE A;  2VXE A;  1YJW T;  2LC4 A;  4II1 A;  3G4S T;  3OS0 A;  1U1S A;  4JLI A;  2DVE A;  2CZ7 B;  5CR2 A;  4OF1 A;  3O8V A;  4X9D A;  3OS5 A;  1RI0 A;  4RCC A;  4M7A A;  2Y4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...