2PUKB

Crystal structure of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin m
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
73
structure length
73
Chain Sequence
MNVGDRVRVTSSVVVYHHPEHKKTAFDLQGMEGEVAAVLTEWQGRPISANLPVLVKFEQRFKAHFRPDEVTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 10
structure length 73
sequence length 73
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02941 FeThRed_A Ferredoxin thioredoxin reductase variable alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2pukB00
2DPPB 3VYHB 1GXIE 1UGSB 2DD4A 4FM4B 3QYGB 3WVEB 3QZ5B 3QXEB 3X25B 2O01E 1AHJB 2D0QB 3QYHB 2ZCFB 3LW5E 4OB2B 3HHTB 3X24B 1QP3A 3QZ9B 2CZ0B 2WSFE 2PUOB 2PU9B 3A8MB 3VYGA 1UGQB 2ZPBB 1JB0E 3A8GB 4RKUE 1UGRB 4XK8E 4KT0E 1IREB 3A8LB 1DJ7B 2DXBA 3WVDB 2WSEE 2CZ7B 2PVOB 2DD5A 4OB3B 2PUKB 2ZZDA 3A8HB 1PSFA 2PVDB 1QP2A 2ZPIB 3X26B 3X20B 1UGPB 2CYZB 5L8RE 2CZ6B 2PVGB 2QDYB 2ZPGB 1V29B 4OB1B 1PSEA 2DXCA 4ZGEB 2ZPHB 3A8OB 2ZPEB 4Y28E 3X28B 4L6V5 2CZ1B 4ZGDB 2AHJB 4OB0B 2ZPFB 4ZGJB 2WSCE
chains in the Genus database with same CATH superfamily
5HK0A 2BZYA 4DOVA 1UHCA 3TVTA 3REAB 5I2SA 1Q7YC 4JRIA 5FLXE 1YCSB 4DBHA 2D0NA 3CMAQ 2GQVA 1M3CA 3SWNA 4QW2A 2DEQA 3L2UA 1QVPA 2COZA 4PFZA 4FYYB 1ZSZA 4OB2B 4MDWA 2DRKA 1UJYA 4XU2A 4HCKA 1TXQA 3G6EQ 1RI9A 2AKLA 2XU8A 3OYNA 2PU9B 2DLPA 4C8QC 1KFZA 2Y90A 3VYGA 1YNZA 4RTVA 4ORZA 4HCBA 1ZBXA 1Q82R 3JRZA 3M5AA 2LQNA 4P5NA 4C92C 3H9NA 2KEAA 5IHKA 5A2QE 2OI3A 1Q95G 3CC4T 3OW2S 4M75C 3TU4K 3RNJA 4C8QB 1I07A 1BU1A 4CI0C 5A0GA 2DILA 2EYXA 3M0PA 1VQNQ 1MV0B 4C92B 3R6OA 3P8BB 2JVVA 2K2MA 2ENMA 1X69A 5KYXA 4GLMA 3ULRB 2CYZB 2RI5A 3QSUA 2DL7A 1ZUYA 5GMKm 3CC2A 2BUDA 3M0QA 2A28A 4M7DE 4PK4A 2M16A 3E9FA 2YRDA 4IUPA 4PLIA 3I9QA 3JB9H 2ZPEB 3J80E 3CCST 1VQ9A 4M7AG 2EFIA 1TTHB 5D6WA 3CMEA 2GQIA 2NUTA 2YHTA 4BDZA 4LDUA 2EAYA 4DEYA 1YI2Q 4XU1A 4C5GA 2GF7A 4C5EA 1UB4A 1W1FA 1X43A 1KHIA 1FMKA 4PJOA 3CXCS 4FIBA 4HT8A 1KHCA 4JLIA 1FWZA 1GXIE 3PMTA 2LVMA 3GF5A 2DD4A 2ED0A 3QYGB 2QQRA 3CD6T 4E7LA 1R8OB 2RPNA 1Q81R 3QWYA 3QWXX 3I56T 2JMAA 1Q82U 2A7YA 1ZA2B 4J9CA 2ESWA 3D7SB 4B9XA 4XTWA 3ER0A 2A36A 4NL2A 2C0OA 1N5ZA 5KYNA 2QXFA 2PUOB 2VUBA 4HT9A 5HCKA 2QI2A 1MGQA 3TEEA 3CC7T 4LDYA 5GAOp 2IVWA 1RAIB 1MNEA 4LN2A 3H0FA 4O5VA 2JM9A 3EGDB 3E19A 3EG9B 2LP5A 2PVOB 4FSXA 3KFVA 5GAOq 1KSWA 4CC2A 2W10A 1GCQA 4GBQA 3NPFA 2DXTA 2L3SA 3MEUA 2PVGB 1PRMC 1MNDA 2F69A 3M4YA 2DXCA 2JTEA 2DEUA 1IB8A 4ELYC 5GAOm 2HSPA 4ATOA 4F7UF 2PZ1A 5LJ3g 3A8OB 1SSFA 1KD1C 2M02A 1SSHA 2KQWA 3QKJA 1OYXA 4JZ3A 3CC4A 4LE9A 1Q81U 4C8QG 4Z89A 2D9TA 2YUQA 3OYJA 1WYXA 1X6GA 4OMPA 6AT1B 3JCMV 3MP8A 1K76A 1N6AA 1QCOA 2HZYA 1EIFA 2EYQA 4M75G 5LJ5f 2P4RA 2X3WD 2X51A 4BD3A 3CCRT 2W0ZA 2A37A 3EFSA 2RQRA 4JZ4A 3CCVQ 4ESRA 1YP5A 2MWPA 3CCSA 4IUUA 1UGVA 4HXJA 1BKBA 1YJNA 4N4GA 1OX8A 4MZMA 2K3BA 1YWOA 2CZ0B 2K6DA 1JXOA 1LOJA 5GANf 1BK2A 4C5HA 1WHHA 3A8MB 3OS5A 4RTYA 3JCMf 2EGCA 2GNCA 2X4JA 5LJ5g 1K8AU 1IXDA 2ZPBB 4KUIA 3MP1A 3A8GB 1UDLA 3RKXA 2NUZA 1W70A 1LPLA 2QA4T 1NPRA 1LJOA 2DYIA 3O5ZA 4RCCA 3CD6A 5LJ3j 1WHGA 2GGRA 2FPFA 4KGVB 3I56A 1NPPA 3M0UA 1B3QA 4UC4A 5GANg 1PSFA 3JCMg 2E64A 3C0CA 4J9HA 1Q86C 1QP2A 4RTZA 1M1KU 1N8RC 2LDMA 1OU8A 1BBZA 5LJ3e 1OZ3A 4O6JA 1M8MA 5CKFA 3CC7A 1BYMA 2P0KA 3CCJQ 3MKDA 4LDVA 2L3RA 2RHYA 1QWEA 3OYHA 1GL5A 4FSSA 3M58A 2DBMA 2FZCB 1TOVA 1BCMA 1HJDA 1K0XA 3M55A 3OBWA 4E7KA 4J9BA 3H41A 2HL5C 1A0NB 2CH4A 1M5Q1 4L5GA 1K4US 2NUPB 3M53A 3WVEB 1YFNA 5KH6A 1B7TA 1QCNA 5GAMf 5LJ5j 4PJMA 4R55A 2G3RA 3U23A 2EKHA 2ROTA 2J6OA 4ZN1A 2V8KA 2JT4A 2JJ9A 1VQ6T 2D0QB 2MOXA 3RKYA 1M9SA 2XDPA 3QUIA 1Q7YR 3VS7A 2VXFA 1NJIU 1HYOA 1C6VX 4N0AC 1QKXA 4C8QE 5LJ5e 1YIJT 2J6FA 1WXUA 4E6RA 5GANj 3GNFB 1AZEA 1RAAB 4C92E 1H3HA 1WQ7A 1VQKQ 4NL3A 2EWNA 2CREA 2YSQA 1T0HA 1QVFA 3OS1A 1V76A 2ATCB 5GJVB 3J81E 5DM7R 1T0JA 3ZL7C 1ZA1B 2FYKA 4EPCA 1VQ7T 1G83A 2QGFB 2V8IA 3JCMe 2K3XA 2PUKB 4M78C 2EQMA 1NBEB 2DL4A 4OMMA 2LX9A 4KULA 2E10A 2DRMA 2DL8A 1D1CA 2O88A 1WJSA 1K73U 3EHRA 3G1JA 3QHSA 4M7DD 3CCLT 3G71Q 2HBPA 4C0ZA 2CGHA 3CCEQ 3O8VA 2QEXQ 2QA4A 5M9OA 2EJ9A 2P84A 4C0FA 1UFFA 2BZXA 2CSQA 1TG0A 4AFSC 2PNIA 2EJGA 2DX1A 4IKFA 1U3OA 1OV3A 1D3BA 1KG1A 3I55Q 1D0YA 2V1RA 2C0IA 4JRQA 2R5AA 1ARKA 1OPKA 4OMOA 1X6OA 2B8AA 3CPWA 4J9IA 1YJ9T 1AHJB 3C4SA 4M77G 1VQLQ 3V8KA 3JB9I 1G3SA 3OYAA 3LW5E 1VQOT 1FX7A 1LNXA 1UECA 4GY5A 2Y4YA 3FIFA 3A5ZB 1ZHIA 3OB9A 4BY6C 1VQ4Q 2JS0A 1PNJA 2LJ0A 2LT1A 4XK8E 2EGEA 2JMCA 3G7ZA 2NUPA 2DL3A 2F5TX 4IUTA 3DB4A 3KBGA 4BY6B 1AWJA 4QKUA 2XG8D 1Z9ZA 1ZSGA 3WXMB 4E2FB 3GBQA 4M7DF 1OPLA 1VQ6A 2CH4W 1JRIA 3OYFA 4M7DA 5CIUA 2DYBA 3EGUA 2ZPIB 3VS3A 1SKUB 1TSFA 4JRKA 1YIJA 4M7AB 1V29B 3OS2A 4CC4B 2E3IA 1WZOA 4EMHA 2YUOA 2MPXC 1YITT 2AHJB 1RI0A 5GAN3 3PVLA 2HSEB 1S1NA 4JUVA 4C0DC 1VQ7A 2RO0A 1GRIA 1HK9A 2DPPB 4A4KA 2RQWA 3BDLA 1AWOA 3CCQT 3LH5A 1KD1R 2JTMA 1MUZA 3V8JA 3V7SA 5FU6C 4Y92A 3PMIA 1M2VA 1RAEB 3CCLA 1Y07A 4M78G 1N27A 3G4ST 2XIDA 2CP7A 2FZGB 2XKOC 1MMNA 2K5FA 1FXXA 5FU6B 1S72T 4AG1C 5CKBA 5HKCA 4PJOD 1VQ9Q 2XDBA 2JW4A 4JS5A 3CMEQ 2KDSA 4ZTFA 2E1HA 5EC7A 2RB6A 3GPLA 2XD0A 2WSFE 1AZGB 3MHXA 2V1QA 4RKUE 2RM4A 2RQVA 4FU6A 1V1CA 2RJEA 5GMKl 4JJBA 3A8LB 2KRSA 3SD4A 3NTKA 1YJ9A 4J9FA 5D6XA 2ECZA 4KGZB 4RCBA 2YRVA 1GBQA 1ZX6A 2K57A 1VQOA 3V7RA 1K9AA 1W6XA 4OGCA 3VKIA 2Y4XA 2QTVA 2DK3A 5FU7C 1OU9A 1T3SA 5KE2A 3CBMA 2EQUA 1O9SA 4J6YA 3I5RA 2C06A 3VRYA 3E1SA 1RLPC 4ZGEB 3REBB 1QVFP 3EGXA 3EAEA 3NHNA 3S6WA 2B86A 9ATCB 1Q86R 3UA6A 1N8RR 5IH2A 1AWXA 3PNWC 2DIGA 3ZEHA 4F7UB 2HL3A 4M75B 2RHUA 2DE0X 2X4WA 2O4XB 1WHLA 4J7IA 4QVZA 3OYMA 4EMKC 1XTDA 1U06A 3H0HA 4MZTA 2AZSA 2MWOA 2ZGWA 4PJOF 4ME7A 1JBMA 3HRTA 1QVFS 3FJPA 4EMKB 3S3OA 1SRMA 1BIAA 3HL8A 3PT9A 4PKCC 2VB6A 1MMAA 1BI2A 2RF0A 4HVWA 1PD1A 4D8DA 2A3LA 3OYGA 1UJ0A 3CC4Q 3CQTA 1PG5B 1UGQB 4QQDA 2KR3A 3IQLA 4HVUA 4PJOG 3CCQA 1WLPB 3H8ZA 1FYNA 4KT0E 1M90R 5LJ5d 2L2PA 1TUGB 1DJ7B 2KSSA 2MMPA 4JPBW 3CPWP 3P8DA 3HTRA 4BB7A 5I21A 5GAOl 1KIKA 1C1AA 3MCAB 4M78E 2L0AA 3G4SA 3KUFA 5DLQE 4J5YA 1MMGA 5LJ5h 1S72A 1ZUUA 3CCSQ 4JJNK 5GANd 1YHQT 1VQPT 1YJNQ 2EGAA 1QW1A 1KC8C 3MP6A 3JCMd 1IGUA 4PFOA 2CDTA 2KXDA 2HAXA 4JJDA 1JO8A 1NZ9A 1VIEA 2DF6A 2DL5A 5LJ3f 3CPWS 2ZPHB 2LMJA 2O2OA 5GANh 4QVCA 5IXFA 4OMQA 4ZGDB 4J7FA 3BW1A 1Z9QA 4A53A 4PJJA 1QMCA 1RABB 3CD6Q 3GLXA 2BE9B 2OTLT 3I56Q 3VU3C 4ZNXA 1G5VA 5IHIA 1OULA 2CT3A 4OMLA 2RQTA 1MV3A 2WACA 2BTTA 3EH1A 2F1LA 2IIMA 4J9DA 5GMKj 4XTZA 4A4EA 2E41A 1E6HA 2CSIA 3SHWA 5L23A 2EQJA 4BI8B 2VGMA 3OYKA 2GFAA 2G6FX 2XHCA 3QYHB 4C8QA 3CC7Q 3C94A 1SF9A 5D6YA 2MYSA 1M90U 4GLKA 3HPWA 5A0DA 4MZPA 3L2RA 2DAQA 5GMKe 4C92A 1JEGA 1TUCA 1YN8A 4F7UG 4AT1B 2E5QA 2VVKA 2EVRA 1IZ6A 4C5IA 4XTUA 2YXYA 5GAOr 2RK1A 2QGGA 2RK2A 1E6GA 2FZKB 5GAMd 4F17A 2O9VA 4M7AE 3S3NA 2RJFA 1P92A 2HQEA 2YUNA 5ECAA 5KYUB 1CSKA 2YDLA 3BE3A 2MCNA 3RBBB 2DTHA 1MHNA 2KY9A 1PRLC 5D7UA 5GAMh 2E6NA 3QBYA 4D6WA 3RIRA 1D1AA 2QG9B 5DY9A 1PC0A 2F5KA 3M0RA 8ATCB 4X9DA 3VJPA 3VV0A 4OB1B 1VQMQ 4C0GA 4RG8A 2FPEA 2VGNA 3VS2A 4PJNA 2DTIA 4RTTA 4E7JA 4L6V5 2DFUA 1ZBJA 2X9HA 3LWIA 3RERA 4J9EA 5I22A 2LTOA 2LZ6B 4M77C 2HQHA 4ZGJB 2DO3A 3OYIA 3QPHA 1Q82C 1QKWA 2KT8A 1H92A 2P4TA 4FT4A 5KYWB 2QYZA 3QG1A 2K9GA 4XQ3A 1R77A 4J6XA 4AG2C 4M77B 2JS2A 1D1BA 2YRCA 2FEIA 1YHQA 3JB9D 1VQPA 4EMGA 3FB9A 2MAMA 3CCUT 3FJ5A 2V26A 3BFMA 4J6WA 3OSVA 5CVIA 1WA7A 2LNHB 4DBRA 4N4IA 3EGDA 3EFOB 4KBMB 3EG9A 4BE1A 4DBQA 3VS0A 2KYMA 3X24B 4PLLA 2D8JA 2QA4Q 2HEQA 2JXBA 5CQYA 2LX7A 2VWFA 4BE0A 3MJXA 2GTOA 2M0YA 3LYIA 2H3JA 2OTLA 1YBYA 3TSZA 4DBFA 4E47A 3LGLA 1U1TA 4FW2A 3L2QA 5CKDA 2RI2A 1KQSA 2GFUA 3VS1A 2CZ7B 3CBOA 3HFOA 3V8LA 2IG0A 1OI1A 2YT6A 3AHUA 1G3YA 1RLQC 1BI1A 1YJWT 3FEOA 3G71T 1M2OA 2NLUA 3CBPA 4A4GA 4OMNA 3X26B 4X9CA 2QEXT 1WNLA 2ZPGB 2HKNA 2RJCA 4F7UE 4M75E 2DJZA 1IGQA 2DBKA 3HRSA 1KJWA 3PGGA 1JQQA 3JCMP 2RHZA 3CCRA 3THKA 2HCKA 3RUXA 3TQ7P 2OTJT 1GFCA 2K7AA 2RHIA 2M0OA 3L2ZA 4XTXA 5CCAA 1EZZB 3LGFA 3S3MA 3JB9F 2F2XA 5GJWB 4QQ6A 3VYHB 1FMVA 2D6FA 2RA2A 1VQ6Q 4LNPA 3JV3A 4OVAA 4M78B 1TU0B 2NYSA 3JCMb 4B6MA 1H641 2ROLA 3ME9A 3X25B 2XI9A 1YIJQ 1K8AC 2DVEA 4F16A 4XAXB 4A4FA 1QCFA 2JUFA 2EJFA 3HFNA 3JB9G 1Y0MA 1VQ4T 3URGA 1Q7YU 3OYDA 3SWNC 4LUEA 1D0ZA 2YUPA 3GOXA 4KGXB 1N9RA 4CC7A 2LJ3A 2K2VA 3SB2A 1UEBA 2P0QA 1VQ7Q 1ZSZC 1GCPA 5CO7A 5FWBA 1PM3A 2FPDA 1CKAA 3CCMT 5A0LA 1M1KC 3I35A 3SWNB 1IREB 3H0IA 4RUGA 4A63B 4AFQC 3CCUA 4DA4A 1ZSZB 5CKEA 2JZ2A 3CCLQ 1HSQA 2K5LA 2YWWA 2VV5A 2EBPA 4ANJA 1VQ8T 2JM8A 3JCMX 3V7CA 1JJ2A 1BI0A 5C0MA 3INZA 4D8KA 2OAWA 3A98A 1X27A 2HQXA 1VQ5T 4NOYA 2CUBA 1M4ZA 3UATA 1H8KA 1X2KA 4HA8A 2RMOA 1KC8R 4BDYA 1KK7A 4BUGA 2JOYA 1FMWA 4PNOA 4KRTA 1YJ9Q 1G2BA 2EYWA 1NJIC 1YJWA 5FWCA 3G71A 2DNUA 3M59A 1J3TA 2KMTA 1VQOQ 1OX9A 4PJOC 4BI3A 4M7DG 2QEXA 5IN1A 3J7AF 2HKQB 4PL6A 4N0AA 3JAME 2KNBB 5C6SA 3EG2A 1OQKA 4LDXA 2ZCFB 1R0CB 2OTJA 4MMLA 1BCOA 3HHTB 4WTOB 2DETA 3CMAT 2RJDA 3META 4PJOB 4OMFB 2EYYA 2KGTA 5FRNA 5I11A 1CKBA 5GMKi 4M4ZA 4J8OA 2CKKA 2QQSA 3SEMA 4C0DB 4V2SA 3CPFA 3UA7A 5GAN4 2E6ZA 3FC3A 2AIRB 3CC2Q 4OF1A 3MO8A 1BI3A 1BB9A 4M78A 5KYYB 3G6ET 4M7AD 1K73C 2VC8A 3MPUB 5CR2A 2LQ8A 2WSEE 2E70A 4OP0A 1RUWA 8AT1B 4LD9K 1WI7A 3HP9A 1XQHA 1ABOA 1VQ4A 2PQWA 2XMFA 1NE8A 2X4YA 2JTFA 1IHWA 2AZVA 1EX4A 2QDYB 3L1AA 5IXBA 1VQNT 1GCQC 4JLGA 2J06A 4FT2A 4J83A 3CCMA 2VKNA 3CCQQ 2HMAA 2R57A 4M77E 1KQSP 3E9GA 3EH2A 3OA6A 3UPUA 2PTKA 3JCMQ 1UHFA 1Y71A 1I5LA 2O9SA 2EPDA 4JDSA 1NYGA 2ABLA 1AOJA 2EKOA 2LC4A 3OW2P 3OYYA 3R6NA 3OMCA 4Z8AA 5CAIA 5I2MA 3G4SQ 7AT1B 3Q1JA 1VQ8A 2LCSA 4QQGA 1NM7A 4BE2A 1KD1U 1UGSB 1YI2T 1S72Q 2K79A 2DKGA 3QZ5B 1G3WA 3HKSA 5FU7B 1VQ5A 1KQSS 5LJ3d 2K3YA 2O01E 3PIOA 3LWHA 1AT1B 1I1JA 1K9MC 4E7SA 4HCZA 3BDUA 1SG5A 1QVGA 4E7HA 1N9SA 3HRUA 2RNAA 1AWWA 2CS7A 4KH0B 4M7AF 5LJ3h 3DLMA 2KYBA 1ABQA 1M8VA 2KI7A 3PIPA 4FCYA 1JXMA 1X75C 1OOTA 3CXCP 2E65A 4M7AA 4LXCA 4MDXA 3M9QA 2KE9A 3EHQA 2KXCA 2COYA 2MI6A 2LQWA 2DTOA 2A0FB 1I5OB 1YITA 4WCIA 3OBYA 4C8QD 2QASA 4CRIA 4EIKA 1X2QA 2DD5A 2V8JA 4OB3B 2ZZDA 4NS5A 1YJNT 4J9GA 1NLPC 4C92D 2CP6A 4X34A 1Y7XA 3JB9J 3CMAA 2JNGA 4YTLA 1XNIA 2C0TA 2KT1A 4M75D 3EFRA 5IHNA 1NYFA 1VYUA 4II1A 2K5IA 2DZCA 1M3AA 3VS4A 1B34B 1PCXA 3LX7A 1GBRA 1VIFA 2YLBA 4Y28E 1WJRA 2L89A 4LUDA 4LD6A 3G6EA 4IUQA 5KYYA 1R0BG 1WXTA 2O31A 4X1VA 1K1ZA 5J26A 5EG2A 2X3XD 5GAN8 1Q86U 1OZ2A 3M4GA 1N8RU 2HBWA 4BI4A 5GAN6 1AD5A 1JJ2P 4QVDA 4MMKA 2DVJA 4FYVB 1XJWB 2COWA 3SDZA 1ZQ1A 3FRNA 1PKSA 1I81A 3RESA 3OYLA 2R5MA 4AFUC 4AFZC 3JCMh 2AT1B 2VYTA 3PTAA 1RAFB 1SEMA 1VQNA 4IURA 2ED1A 4DQ2A 2H3EB 3RR6A 1RACB 1LCKA 5GAN7 5IT9E 3OSSC 1I0CA 1M27C 1PKTA 1JJ2S 3DKMA 1K8AR 3OS0A 2RI3A 1ACMB 1Y96B 4C8QF 3CCVT 1B07A 3C12A 2DM1A 1JB0E 1WXBA 2GTJA 1UGRB 2BIVA 2KBTA 4C92F 1RL2A 2EW3A 2DXUA 3OQ5A 1YI2A 2RD1A 2YLCA 3WVDB 1YHQQ 4M75F 1VQPQ 1UG1A 1F1BB 1M3BA 1SHGA 1WGSA 3N5BB 2RN8A 1VQMT 4F7UA 4M75A 2KROA 3JCMc 2XDDA 1U8RA 1M1KR 2O4XA 4QT7A 4K11A 2I0NA 2J05A 3NGPA 1UGPB 3RKWA 2CZ6B 2GBQA 3UF4A 3UDCA 1AEYA 1WDXA 4C92G 4VUBA 3JSCA 2XICA 1VYTA 1UE9A 4JJCA 2QQ9A 2R58A 3X28B 2OTLQ 1T3LA 2FL7A 4RG2A 4EMKA 4PJLA 3OY9A 4N4HA 5CKHA 3SFMA 1YWPA 1PD0A 2WSCE 3DLLA 3CCJT 2VXEA 3LLRA 3M0TA 1WQWA 4HKEA 1WHJA 4EDUA 4PJOE 3PFSA 1ZLMA 1WPYA 1RAGB 1UTIA 3TREA 2QDLA 1NG2A 2DERA 2HD0A 2KRNA 3RMQA 1B34A 4Z88A 2KVQG 2XK0A 5AT1B 2KRMA 3FLGA 1NJIR 3VRZA 3CCRQ 3CEYA 1W2BA 2BZ8A 1KQ1A 1QP3A 1WIEA 2NWMA 3I5SA 3ZBDA 3JCMW 3L2VA 3VS6A 4RTUA 2OX7A 1D3BB 2FRYA 2MIOA 5GAN5 2LCLA 1G8XA 2CT4A 2E12A 1D09B 1E7OA 3GP8A 5KCHA 1TWBA 4JRPA 2RHXA 1HXDA 3NFCA 3FDRA 4BACA 2AKKA 1VQKT 4RTXA 1QVGP 4Z02A 3QJ6A 3A8HB 2E5KA 5HY6A 2LJ1A 4B9WA 2DA9A 1K73R 1AVZC 1TS9A 4DEXA 5KE3A 3NTHA 3VUZA 4R56A 5L8RE 2F2VA 4IIOA 5CQXA 3CCVA 4ZN3A 3OYBA 2CP3A 3MEVA 1Y96A 3ZFJA 4A4HA 4M7DC 2J6KA 3AT1B 4M77D 1NLOC 2F2WA 1VUBA 4XU0A 2QTXA 3QJYA 3OYCA 2QQAA 3F70A 3OW2A 2BE7D 2OAUA 2E3HA 1QVGS 4IUVA 4A54A 3M57A 1X6BA 4WF2A 2L3QA 1Q81C 3CCET 3CCUQ 4M7DB 2QAZA 1M90C 1VQMA 2AK5A 4ZTJA 4FL6A 3QIIA 2KK4A 4FM4B 2MK5A 1NEGA 1I8FA 2H8HA 4XU3A 5GAMg 4FYWB 3QXEB 2D8HA 2K4YA 1QWFA 2RQUA 3UT1A 2GCXA 1SRLA 1IRXA 3E2UA 5KYUA 1W4SA 3I55T 5J39A 1GFDA 3EG1A 4LDWA 3NTIA 5GANe 3MEWA 3QDRB 2L3PA 2D1XA 2FG0A 2DZ9A 3VS5A 1G3TA 1XOVA 3CXCA 1IHVA 1WFWA 2CP0A 2FRWA 1M1GA 3JCMJ 3CCJA 4HVVA 1VQLT 4IIMA 5HK3A 4E7ZA 3EG3A 1YCYA 1C0MA 1K9MR 1M2VB 4FW1A 2LQKA 3UWNA 4E7IA 2HDAA 3GNGA 1KQ2A 1VOMA 2BKDN 1YJWQ 2Z0WA 5IAYA 2EIFA 2M9UA 2LCCA 2FHDA 5GAN2 3A1PA 3PVQA 3L2WA 1QLYA 1VA7A 1O75A 1U1SA 1ZUKA 1UUEA 4M77F 2SRCA 4Q5WA 3OYEA 1BIBA 4XTVA 2J7IA 1WHMA 2OTJQ 2DIQA 5KYWA 1WHKA 3TSWA 1X01A 4RTWA 1WJQA 3X20B 3QO3A 1U5SA 2EQIA 3RDVA 2I2LA 3H6ZA 2X35A 1K0SA 5GAOn 1PSEA 4M77A 4M78D 2FVUA 1PWTA 3ASKA 4F14A 2LRQA 5FRMA 1TH7A 1D0XA 3L42A 4CC3A 2CZ1B 3EFOA 5GAMj 1LVKA 3BY7A 4OGEA 4ELZC 2ZPFB 4RMOA 2RH2A 4XTYA 2L8DA 1VQKA 1EFNA 2FO0A 3RMSA 3EG0A 3KXTA 4Y91A 2DJQA 1HD3A 5GAMe 3EGXB 4PFPA 1MMDA 1WX6A 2LNVA 2FB7A 1K9MU 1NEBA 2CUDA 3MEAA 3NMZC 2IPOB 5AYFA 4JS4A 4KUDK 1TUDA 2M1HA 3M0SA 5KYXB 3CCMQ 4M7AC 2P0PA 1M30A 3QZ9B 1Y57A 2QQBA 3C95A 1VYVA 3QDFA 1RADB 4TVRA 3CC2T 5FW9A 3CCEA 3DB3A 2M51A 1SPKA 5LL6S 2DMOA 1IO6A 3HSBA 5J3BA 2CP5A 2NUTB 1VQ9T 3CMET 1VQ8Q 2KAFA 4DOWA 1QQJA 3T9NA 2X4XA 2DXBA 1PHTA 2VASA 4KH1B 2CP2A 2EQKA 1VQ5Q 1W2BP 4L59A 1JU5C 4M78F 2QK0A 5CK9A 3P8HA 5DLOA 3I55A 2JN0A 2E4HA 3OMGA 2PVDB 1H3ZA 2SEMA 3TCJA 1RAHB 4R0KA 4FYXB 3GIBA 2OJ2A 5FROA 2A08A 2ZAEA 1VQLA 3PE0A 5KCOA 4HCCA 1I4K1 2L5QA 2LT4A 2HNIA 4F04B 5GMKh 2EYZA 1W2BS 1OEBA 4OB0B 1SHFA 3LH0A 4AMCA 1M1FA 2MF2A 3M56A 1YITQ 1KC8U 3VUBA 3M54A
chains in the Genus database with same CATH topology
2EJGA 5GAN6 4IKFA 2P4TA 5HK0A 4FT4A 4DOVA 4QVDA 4MMKA 3QG1A 3SDZA 1ZQ1A 3FRNA 4XQ3A 5I2SA 1Q7YC 1D3BA 4JRIA 4J6XA 1KG1A 4M77B 5FLXE 1YHQA 4JRQA 3JB9D 1I81A 1VQPA 3RESA 4EMGA 2R5AA 3OYLA 3FB9A 2GQVA 2R5MA 2MAMA 3CCUT 3JCMh 3BFMA 2VYTA 4J6WA 3OSVA 5CVIA 3SWNA 3PTAA 1X6OA 4QW2A 2B8AA 3CPWA 4N4IA 2DEQA 4KBMB 3L2UA 1QVPA 1YJ9T 1AHJB 4IURA 3C4SA 4M77G 1VQNA 3V8KA 3JB9I 1G3SA 4BE1A 4DQ2A 3OYAA 3LW5E 1VQOT 4OB2B 5GAN7 3X24B 4MDWA 1FX7A 3OSSC 5IT9E 4PLLA 4XU2A 1LNXA 3QSUA 5CQYA 4GY5A 2Y4YA 4BE0A 3FIFA 3A5ZB 1ZHIA 3OB9A 1JJ2S 4BY6C 2XU8A 3DKMA 3OYNA 2PU9B 3OS0A 4C8QC 2RI3A 3LYIA 1Y96B 3CCVT 4C8QF 2Y90A 3C12A 3VYGA 2H3JA 2OTLA 1YBYA 4HCBA 1JB0E 1ZBXA 3JRZA 1UGRB 2LT1A 3M5AA 4XK8E 4E47A 4P5NA 3G7ZA 1U1TA 3LGLA 4C92C 2BIVA 4C92F 1RL2A 1YI2A 2DXUA 3OQ5A 3L2QA 2F5TX 2RD1A 5A2QE 5CKDA 4IUTA 2RI2A 3DB4A 3KBGA 4BY6B 3CC4T 2XG8D 1KQSA 3OW2S 2YLCA 4M75C 3WVDB 3WXMB 2GFUA 3TU4K 4M75F 4C8QB 2CZ7B 4CI0C 5A0GA 4M7DF 3CBOA 3HFOA 3V8LA 1VQ6A 2IG0A 1WGSA 1OI1A 3N5BB 3AHUA 1JRIA 1G3YA 4C92B 1VQMT 3R6OA 4F7UA 1BI1A 4M75A 3JCMc 1YJWT 3FEOA 2JVVA 3P8BB 2XDDA 3OYFA 3G71T 2O4XA 1U8RA 4M7DA 2NLUA 3CBPA 5CIUA 4A4GA 3X26B 2ZPIB 3RKWA 1UGPB 2CYZB 2CZ6B 4JRKA 4X9CA 2QEXT 1WNLA 1V29B 2RI5A 2RJCA 2ZPGB 4M7AB 3UDCA 4F7UE 4M75E 2DJZA 4C92G 4VUBA 5GMKm 3CC2A 2BUDA 3HRSA 3OS2A 3JSCA 4M7DE 2XICA 2M16A 4EMHA 3E9FA 3PGGA 2QQ9A 2RHZA 3CCRA 2R58A 4IUPA 3JCMP 4PJOB 4PLIA 3RUXA 3JB9H 2ZPEB 3J80E 3X28B 2OTJT 2FL7A 3CCST 1VQ9A 4M7AG 2EFIA 1YITT 4RG2A 5D6WA 3CMEA 2AHJB 4EMKA 1RI0A 2RHIA 2YHTA 2M0OA 4LDUA 2EAYA 3L2ZA 4XTXA 5CCAA 5GAN3 3OY9A 4N4HA 5CKHA 4XU1A 4C5GA 3SFMA 2GF7A 4C5EA 4JUVA 3LGFA 1UB4A 3S3MA 3JB9F 2WSCE 4C0DC 1KHIA 3DLLA 1VQ7A 4PJOA 3CCJT 3CXCS 4FIBA 2VXEA 2RO0A 1HK9A 2DPPB 3LLRA 4QQ6A 3VYHB 3BDLA 4A4KA 4HT8A 1KHCA 3CCQT 2D6FA 1WQWA 2RA2A 4JLIA 2JTMA 4HKEA 1FWZA 4OVAA 4M78B 3V8JA 4EDUA 3PMTA 4PJOE 3V7SA 1GXIE 3PFSA 2LVMA 3GF5A 5FU6C 2DD4A 3JCMb 3PMIA 3QYGB 4BDZA 2QQRA 1WPYA 3CD6T 4E7LA 1H641 1R8OB 3TREA 3CCLA 3ME9A 3X25B 2XI9A 1Y07A 2HD0A 4M78G 1K8AC 1N27A 3G4ST 2DVEA 2XIDA 3I56T 3RMQA 1B34A 1Q82U 4XAXB 4A4FA 2XKOC 2JUFA 2A7YA 2KVQG 2XK0A 2EJFA 3HFNA 3JB9G 3FLGA 2K5FA 4B9XA 1FXXA 4XTWA 3CEYA 5FU6B 1VQ4T 1S72T 1W2BA 1KQ1A 5CKBA 3URGA 3ER0A 5HKCA 4PJOD 2XDBA 1QP3A 4JS5A 1Q7YU 3OYDA 3SWNC 2KDSA 3ZBDA 4ZTFA 2E1HA 4NL2A 2RB6A 3GPLA 3GOXA 3L2VA 3JCMW 2QXFA 2WSFE 2PUOB 2VUBA 2XD0A 4HT9A 1N9RA 2QI2A 3MHXA 1MGQA 3TEEA 2K2VA 3SB2A 1UEBA 2P0QA 1D3BB 3CC7T 4LDYA 5GAN5 5GAOp 2IVWA 4RKUE 5CO7A 2LCLA 2RM4A 3CCMT 4FU6A 4O5VA 5A0LA 2E12A 1M1KC 3SWNB 1IREB 2RJEA 5GMKl 3E19A 3A8LB 3GP8A 5KCHA 4JRPA 2RHXA 3CCUA 4DA4A 1HXDA 3SD4A 2PVOB 4FSXA 3NFCA 3FDRA 3NTKA 4BACA 5CKEA 2JZ2A 1YJ9A 5D6XA 1VQKT 4RCBA 5GAOq 4Z02A 2K5LA 3QJ6A 2YRVA 3A8HB 2VV5A 5HY6A 2K57A 1VQOA 1VQ8T 3V7RA 4OGCA 3VKIA 4B9WA 3JCMX 3V7CA 1JJ2A 2Y4XA 1BI0A 5C0MA 2DXTA 2DK3A 5KE3A 5FU7C 3INZA 3NTHA 3VUZA 3MEUA 5L8RE 2PVGB 3CBMA 5KE2A 4R56A 5CQXA 2EQUA 1O9SA 2HQXA 2F69A 3M4YA 4J6YA 1VQ5T 2DXCA 3CCVA 4ZN3A 2C06A 3OYBA 3MEVA 1Y96A 4ELYC 5GAOm 3ZFJA 4A4HA 4ATOA 4F7UF 3E1SA 4NOYA 4ZGEB 5LJ3g 3A8OB 4M7DC 4M77D 1SSFA 1M4ZA 1KD1C 3EAEA 3S6WA 2KQWA 1YIJA 1VUBA 4XU0A 2QTXA 3QKJA 3QJYA 1OYXA 2QQAA 3F70A 3OYCA 3OW2A 2OAUA 1QVGS 4IUVA 4A54A 3CC4A 4HA8A 1Q81U 3M57A 4C8QG 4BDYA 3PNWC 2DIGA 4WF2A 3ZEHA 1Q81C 2D9TA 3OYJA 4F7UB 3CCET 4M75B 2RHUA 2X4WA 2O4XB 4M7DB 4BUGA 1K9MU 2JOYA 4PNOA 3JCMV 3MP8A 1M90C 4J7IA 4QVZA 1VQMA 3OYMA 4EMKC 4ZTJA 1NJIC 1N6AA 1YJWA 3G71A 4FL6A 1XTDA 3M59A 4MZTA 2KMTA 1EIFA 3QIIA 2MWOA 2KK4A 2EYQA 4FM4B 2ZGWA 4M75G 4PJOC 4BI3A 4PJOF 4M7DG 5LJ5f 4ME7A 1JBMA 3HRTA 2QEXA 1QVFS 1I8FA 5GAMg 4XU3A 5IN1A 3J7AF 4PL6A 4BD3A 3CCRT 4N0AA 3QXEB 3EFSA 3JAME 2K4YA 5C6SA 3FJPA 3UT1A 4EMKB 2GCXA 3S3OA 4LDXA 1BIAA 2MWPA 2ZCFB 2OTJA 3HL8A 3PT9A 4MMLA 4PKCC 3CCSA 4IUUA 1W4SA 3I55T 5J39A 3HHTB 1BKBA 4LDWA 3NTIA 1YJNA 2RJDA 1BI2A 3META 3MEWA 4MZMA 4N4GA 5GANe 3CMAT 4OMFB 3QDRB 2DZ9A 5FRNA 1G3TA 2CZ0B 1XOVA 2A3LA 3CXCA 3OYGA 1LOJA 5GMKi 5GANf 4J8OA 1M1GA 2CKKA 4C5HA 3JCMJ 2QQSA 3A8MB 3CCJA 1VQLT 3OS5A 5HK3A 3JCMf 4C0DB 4V2SA 5LJ5g 1UGQB 2X4JA 3CPFA 4QQDA 4PJOG 1YCYA 1K8AU 2ZPBB 3CCQA 3MP1A 4KUIA 3A8GB 5GAN4 2E6ZA 3H8ZA 2LQKA 3RKXA 3UWNA 3FC3A 4E7IA 2QA4T 4KT0E 4OF1A 3MO8A 1BI3A 3GNGA 4M78A 1KQ2A 1NPRA 3G6ET 2BKDN 1LJOA 2VC8A 5LJ5d 1K73C 4M7AD 5IAYA 2EIFA 2M9UA 4RCCA 1DJ7B 2KSSA 2MMPA 3CD6A 2LCCA 2LQ8A 2WSEE 2E70A 5CR2A 3P8DA 5I21A 4BB7A 5LJ3j 2FHDA 4OP0A 5GAOl 3MCAB 4M78E 5GAN2 3G4SA 3I56A 3L2WA 1NPPA 3KUFA 5DLQE 4J5YA 4LD9K 3HP9A 4UC4A 5GANg 5LJ5h 3JCMe 1O75A 1PSFA 1XQHA 1U1SA 1VQ4A 2PQWA 4M77F 4Q5WA 3JCMg 3OYEA 1BIBA 1S72A 4XTVA 1NE8A 2E64A 2X4YA 2DIQA 4JJNK 2JTFA 1X01A 1Q86C 1QP2A 1WJQA 5GANd 1YHQT 3X20B 1M1KU 3QO3A 1VQPT 1N8RC 1QW1A 2I2LA 2LDMA 2QDYB 3H6ZA 1KC8C 3MP6A 2X35A 3L1AA 3JCMd 5LJ3e 5GAOn 1OZ3A 1PSEA 4O6JA 4M77A 5CKFA 3CC7A 1BYMA 2P0KA 2FVUA 4M78D 1VQNT 2HAXA 4FT2A 4JLGA 1NZ9A 1VIEA 2L3RA 4LDVA 5LJ3f 3ASKA 4J83A 2ZPHB 3CPWS 2LRQA 5FRMA 2RHYA 1TH7A 3OYHA 5GANh 3CCMA 2R57A 4QVCA 4M77E 3L42A 5GAMj 2CZ1B 3M58A 4ZGDB 4J7FA 3BW1A 3E9GA 3OA6A 3UPUA 3BY7A 4A53A 4OGEA 3JCMQ 1Y71A 1I5LA 4ELZC 2ZPFB 4JDSA 4RMOA 3M55A 3OBWA 2RH2A 2EKOA 4E7KA 2LC4A 4XTYA 3OYYA 3GLXA 3OMCA 2L8DA 5CAIA 5I2MA 1VQKA 3RMSA 2OTLT 3KXTA 3VU3C 1M5Q1 4L5GA 4Y91A 3Q1JA 1G5VA 1VQ8A 4QQGA 5GAMe 4BE2A 1KD1U 1UGSB 1YI2T 2WACA 2DKGA 5GMKj 3M53A 3WVEB 3QZ5B 1G3WA 3HKSA 5KH6A 4XTZA 5GAMf 5LJ5j 4R55A 4A4EA 2G3RA 2E41A 5FU7B 1VQ5A 1KQSS 2LNVA 5LJ3d 2EQJA 2FB7A 2K3YA 2O01E 4BI8B 2VGMA 2V8KA 4ZN1A 3PIOA 3OYKA 2GFAA 3LWHA 1VQ6T 2XHCA 2D0QB 3MEAA 1K9MC 3QYHB 3RKYA 4C8QA 4HCZA 3C94A 5D6YA 1M90U 3BDUA 4GLKA 3HPWA 5AYFA 1M9SA 2XDPA 3QUIA 5A0DA 1QVGA 4MZPA 2VXFA 3L2RA 4JS4A 1N9SA 4E7HA 1NJIU 2DAQA 2M1HA 3HRUA 4KUDK 4M7AC 4N0AC 2CS7A 5GMKe 2P0PA 4M7AF 3QZ9B 5LJ3h 4C92A 2QQBA 3C95A 3DLMA 4C8QE 5LJ5e 1YIJT 5GANj 4F7UG 1M8VA 4TVRA 2E5QA 3CC2T 3GNFB 3CCEA 3PIPA 3DB3A 1IZ6A 1X75C 4C5IA 4XTUA 2E65A 5LL6S 4C92E 4M7AA 3HSBA 1WQ7A 5GAOr 2RK1A 4MDXA 2RK2A 3M9QA 4NL3A 2EWNA 5J3BA 1VQ9T 2MI6A 2DTOA 3CMET 1QVFA 5GAMd 3OS1A 2KAFA 4DOWA 4M7AE 3T9NA 1YITA 3J81E 5DM7R 2X4XA 3S3NA 2RJFA 2DXBA 3OBYA 1P92A 2HQEA 4C8QD 4EPCA 2FYKA 4CRIA 1VQ7T 2V8IA 2DD5A 2V8JA 2EQKA 2K3XA 2PUKB 2ZZDA 4OB3B 2DTHA 1MHNA 2KY9A 4L59A 4M78C 4NS5A 4M78F 1YJNT 5GAMh 2E6NA 5CK9A 3P8HA 2EQMA 3QBYA 3RIRA 4C92D 4D6WA 5DLOA 3I55A 2JN0A 2LX9A 3OMGA 2PVDB 4KULA 1Y7XA 2E10A 4X34A 3CMAA 3JB9J 1H3ZA 5DY9A 3TCJA 2F5KA 2JNGA 4YTLA 1XNIA 1WJSA 1K73U 4X9DA 4M75D 3GIBA 3VJPA 3EFRA 3QHSA 4OB1B 3VV0A 4M7DD 5FROA 4C0GA 4II1A 2K5IA 2DZCA 1VQLA 4RG8A 3CCLT 2HBPA 5KCOA 4HCCA 1B34B 4C0ZA 3LX7A 2VGNA 1VIFA 2YLBA 1I4K1 2CGHA 2L5QA 3O8VA 2DTIA 4E7JA 2LT4A 2HNIA 4Y28E 1WJRA 4L6V5 2QA4A 2L89A 5GMKh 4LD6A 5M9OA 4IUQA 3G6EA 3LWIA 3RERA 2EJ9A 4C0FA 1W2BS 2LTOA 4M77C 4OB0B 5J26A 5EG2A 5GAN8 3LH0A 1M1FA 4ZGJB 2DO3A 3OYIA 2MF2A 1Q86U 1OZ2A 3M56A 3M4GA 3QPHA 1N8RU 1Q82C 1KC8U 3VUBA 4BI4A 3M54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DPP B;  3VYH B;  1GXI E;  1UGS B;  2DD4 A;  4FM4 B;  3QYG B;  3WVE B;  3QZ5 B;  3QXE B;  3X25 B;  2O01 E;  1AHJ B;  2D0Q B;  3QYH B;  2ZCF B;  3LW5 E;  4OB2 B;  3HHT B;  3X24 B;  1QP3 A;  3QZ9 B;  2CZ0 B;  2WSF E;  2PUO B;  2PU9 B;  3A8M B;  3VYG A;  1UGQ B;  2ZPB B;  1JB0 E;  3A8G B;  4RKU E;  1UGR B;  4XK8 E;  4KT0 E;  1IRE B;  3A8L B;  1DJ7 B;  2DXB A;  3WVD B;  2WSE E;  2CZ7 B;  2PVO B;  2DD5 A;  4OB3 B;  2PUK B;  2ZZD A;  3A8H B;  1PSF A;  2PVD B;  1QP2 A;  2ZPI B;  3X26 B;  3X20 B;  1UGP B;  2CYZ B;  5L8R E;  2CZ6 B;  2PVG B;  2QDY B;  2ZPG B;  1V29 B;  4OB1 B;  1PSE A;  2DXC A;  4ZGE B;  2ZPH B;  3A8O B;  2ZPE B;  4Y28 E;  3X28 B;  4L6V 5;  2CZ1 B;  4ZGD B;  2AHJ B;  4OB0 B;  2ZPF B;  4ZGJ B;  2WSC E; 
#chains in the Genus database with same CATH topology
 5HK0 A;  2BZY A;  4DOV A;  1UHC A;  3TVT A;  3REA B;  5I2S A;  1Q7Y C;  4JRI A;  5FLX E;  1YCS B;  4DBH A;  2D0N A;  3CMA Q;  2GQV A;  1M3C A;  3SWN A;  4QW2 A;  2DEQ A;  3L2U A;  1QVP A;  2COZ A;  4PFZ A;  4FYY B;  1ZSZ A;  4OB2 B;  4MDW A;  2DRK A;  1UJY A;  4XU2 A;  4HCK A;  1TXQ A;  3G6E Q;  1RI9 A;  2AKL A;  2XU8 A;  3OYN A;  2PU9 B;  2DLP A;  4C8Q C;  1KFZ A;  2Y90 A;  3VYG A;  1YNZ A;  4RTV A;  4ORZ A;  4HCB A;  1ZBX A;  1Q82 R;  3JRZ A;  3M5A A;  2LQN A;  4P5N A;  4C92 C;  3H9N A;  2KEA A;  5IHK A;  5A2Q E;  2OI3 A;  1Q95 G;  3CC4 T;  3OW2 S;  4M75 C;  3TU4 K;  3RNJ A;  4C8Q B;  1I07 A;  1BU1 A;  4CI0 C;  5A0G A;  2DIL A;  2EYX A;  3M0P A;  1VQN Q;  1MV0 B;  4C92 B;  3R6O A;  3P8B B;  2JVV A;  2K2M A;  2ENM A;  1X69 A;  5KYX A;  4GLM A;  3ULR B;  2CYZ B;  2RI5 A;  3QSU A;  2DL7 A;  1ZUY A;  5GMK m;  3CC2 A;  2BUD A;  3M0Q A;  2A28 A;  4M7D E;  4PK4 A;  2M16 A;  3E9F A;  2YRD A;  4IUP A;  4PLI A;  3I9Q A;  3JB9 H;  2ZPE B;  3J80 E;  3CCS T;  1VQ9 A;  4M7A G;  2EFI A;  1TTH B;  5D6W A;  3CME A;  2GQI A;  2NUT A;  2YHT A;  4BDZ A;  4LDU A;  2EAY A;  4DEY A;  1YI2 Q;  4XU1 A;  4C5G A;  2GF7 A;  4C5E A;  1UB4 A;  1W1F A;  1X43 A;  1KHI A;  1FMK A;  4PJO A;  3CXC S;  4FIB A;  4HT8 A;  1KHC A;  4JLI A;  1FWZ A;  1GXI E;  3PMT A;  2LVM A;  3GF5 A;  2DD4 A;  2ED0 A;  3QYG B;  2QQR A;  3CD6 T;  4E7L A;  1R8O B;  2RPN A;  1Q81 R;  3QWY A;  3QWX X;  3I56 T;  2JMA A;  1Q82 U;  2A7Y A;  1ZA2 B;  4J9C A;  2ESW A;  3D7S B;  4B9X A;  4XTW A;  3ER0 A;  2A36 A;  4NL2 A;  2C0O A;  1N5Z A;  5KYN A;  2QXF A;  2PUO B;  2VUB A;  4HT9 A;  5HCK A;  2QI2 A;  1MGQ A;  3TEE A;  3CC7 T;  4LDY A;  5GAO p;  2IVW A;  1RAI B;  1MNE A;  4LN2 A;  3H0F A;  4O5V A;  2JM9 A;  3EGD B;  3E19 A;  3EG9 B;  2LP5 A;  2PVO B;  4FSX A;  3KFV A;  5GAO q;  1KSW A;  4CC2 A;  2W10 A;  1GCQ A;  4GBQ A;  3NPF A;  2DXT A;  2L3S A;  3MEU A;  2PVG B;  1PRM C;  1MND A;  2F69 A;  3M4Y A;  2DXC A;  2JTE A;  2DEU A;  1IB8 A;  4ELY C;  5GAO m;  2HSP A;  4ATO A;  4F7U F;  2PZ1 A;  5LJ3 g;  3A8O B;  1SSF A;  1KD1 C;  2M02 A;  1SSH A;  2KQW A;  3QKJ A;  1OYX A;  4JZ3 A;  3CC4 A;  4LE9 A;  1Q81 U;  4C8Q G;  4Z89 A;  2D9T A;  2YUQ A;  3OYJ A;  1WYX A;  1X6G A;  4OMP A;  6AT1 B;  3JCM V;  3MP8 A;  1K76 A;  1N6A A;  1QCO A;  2HZY A;  1EIF A;  2EYQ A;  4M75 G;  5LJ5 f;  2P4R A;  2X3W D;  2X51 A;  4BD3 A;  3CCR T;  2W0Z A;  2A37 A;  3EFS A;  2RQR A;  4JZ4 A;  3CCV Q;  4ESR A;  1YP5 A;  2MWP A;  3CCS A;  4IUU A;  1UGV A;  4HXJ A;  1BKB A;  1YJN A;  4N4G A;  1OX8 A;  4MZM A;  2K3B A;  1YWO A;  2CZ0 B;  2K6D A;  1JXO A;  1LOJ A;  5GAN f;  1BK2 A;  4C5H A;  1WHH A;  3A8M B;  3OS5 A;  4RTY A;  3JCM f;  2EGC A;  2GNC A;  2X4J A;  5LJ5 g;  1K8A U;  1IXD A;  2ZPB B;  4KUI A;  3MP1 A;  3A8G B;  1UDL A;  3RKX A;  2NUZ A;  1W70 A;  1LPL A;  2QA4 T;  1NPR A;  1LJO A;  2DYI A;  3O5Z A;  4RCC A;  3CD6 A;  5LJ3 j;  1WHG A;  2GGR A;  2FPF A;  4KGV B;  3I56 A;  1NPP A;  3M0U A;  1B3Q A;  4UC4 A;  5GAN g;  1PSF A;  3JCM g;  2E64 A;  3C0C A;  4J9H A;  1Q86 C;  1QP2 A;  4RTZ A;  1M1K U;  1N8R C;  2LDM A;  1OU8 A;  1BBZ A;  5LJ3 e;  1OZ3 A;  4O6J A;  1M8M A;  5CKF A;  3CC7 A;  1BYM A;  2P0K A;  3CCJ Q;  3MKD A;  4LDV A;  2L3R A;  2RHY A;  1QWE A;  3OYH A;  1GL5 A;  4FSS A;  3M58 A;  2DBM A;  2FZC B;  1TOV A;  1BCM A;  1HJD A;  1K0X A;  3M55 A;  3OBW A;  4E7K A;  4J9B A;  3H41 A;  2HL5 C;  1A0N B;  2CH4 A;  1M5Q 1;  4L5G A;  1K4U S;  2NUP B;  3M53 A;  3WVE B;  1YFN A;  5KH6 A;  1B7T A;  1QCN A;  5GAM f;  5LJ5 j;  4PJM A;  4R55 A;  2G3R A;  3U23 A;  2EKH A;  2ROT A;  2J6O A;  4ZN1 A;  2V8K A;  2JT4 A;  2JJ9 A;  1VQ6 T;  2D0Q B;  2MOX A;  3RKY A;  1M9S A;  2XDP A;  3QUI A;  1Q7Y R;  3VS7 A;  2VXF A;  1NJI U;  1HYO A;  1C6V X;  4N0A C;  1QKX A;  4C8Q E;  5LJ5 e;  1YIJ T;  2J6F A;  1WXU A;  4E6R A;  5GAN j;  3GNF B;  1AZE A;  1RAA B;  4C92 E;  1H3H A;  1WQ7 A;  1VQK Q;  4NL3 A;  2EWN A;  2CRE A;  2YSQ A;  1T0H A;  1QVF A;  3OS1 A;  1V76 A;  2ATC B;  5GJV B;  3J81 E;  5DM7 R;  1T0J A;  3ZL7 C;  1ZA1 B;  2FYK A;  4EPC A;  1VQ7 T;  1G83 A;  2QGF B;  2V8I A;  3JCM e;  2K3X A;  2PUK B;  4M78 C;  2EQM A;  1NBE B;  2DL4 A;  4OMM A;  2LX9 A;  4KUL A;  2E10 A;  2DRM A;  2DL8 A;  1D1C A;  2O88 A;  1WJS A;  1K73 U;  3EHR A;  3G1J A;  3QHS A;  4M7D D;  3CCL T;  3G71 Q;  2HBP A;  4C0Z A;  2CGH A;  3CCE Q;  3O8V A;  2QEX Q;  2QA4 A;  5M9O A;  2EJ9 A;  2P84 A;  4C0F A;  1UFF A;  2BZX A;  2CSQ A;  1TG0 A;  4AFS C;  2PNI A;  2EJG A;  2DX1 A;  4IKF A;  1U3O A;  1OV3 A;  1D3B A;  1KG1 A;  3I55 Q;  1D0Y A;  2V1R A;  2C0I A;  4JRQ A;  2R5A A;  1ARK A;  1OPK A;  4OMO A;  1X6O A;  2B8A A;  3CPW A;  4J9I A;  1YJ9 T;  1AHJ B;  3C4S A;  4M77 G;  1VQL Q;  3V8K A;  3JB9 I;  1G3S A;  3OYA A;  3LW5 E;  1VQO T;  1FX7 A;  1LNX A;  1UEC A;  4GY5 A;  2Y4Y A;  3FIF A;  3A5Z B;  1ZHI A;  3OB9 A;  4BY6 C;  1VQ4 Q;  2JS0 A;  1PNJ A;  2LJ0 A;  2LT1 A;  4XK8 E;  2EGE A;  2JMC A;  3G7Z A;  2NUP A;  2DL3 A;  2F5T X;  4IUT A;  3DB4 A;  3KBG A;  4BY6 B;  1AWJ A;  4QKU A;  2XG8 D;  1Z9Z A;  1ZSG A;  3WXM B;  4E2F B;  3GBQ A;  4M7D F;  1OPL A;  1VQ6 A;  2CH4 W;  1JRI A;  3OYF A;  4M7D A;  5CIU A;  2DYB A;  3EGU A;  2ZPI B;  3VS3 A;  1SKU B;  1TSF A;  4JRK A;  1YIJ A;  4M7A B;  1V29 B;  3OS2 A;  4CC4 B;  2E3I A;  1WZO A;  4EMH A;  2YUO A;  2MPX C;  1YIT T;  2AHJ B;  1RI0 A;  5GAN 3;  3PVL A;  2HSE B;  1S1N A;  4JUV A;  4C0D C;  1VQ7 A;  2RO0 A;  1GRI A;  1HK9 A;  2DPP B;  4A4K A;  2RQW A;  3BDL A;  1AWO A;  3CCQ T;  3LH5 A;  1KD1 R;  2JTM A;  1MUZ A;  3V8J A;  3V7S A;  5FU6 C;  4Y92 A;  3PMI A;  1M2V A;  1RAE B;  3CCL A;  1Y07 A;  4M78 G;  1N27 A;  3G4S T;  2XID A;  2CP7 A;  2FZG B;  2XKO C;  1MMN A;  2K5F A;  1FXX A;  5FU6 B;  1S72 T;  4AG1 C;  5CKB A;  5HKC A;  4PJO D;  1VQ9 Q;  2XDB A;  2JW4 A;  4JS5 A;  3CME Q;  2KDS A;  4ZTF A;  2E1H A;  5EC7 A;  2RB6 A;  3GPL A;  2XD0 A;  2WSF E;  1AZG B;  3MHX A;  2V1Q A;  4RKU E;  2RM4 A;  2RQV A;  4FU6 A;  1V1C A;  2RJE A;  5GMK l;  4JJB A;  3A8L B;  2KRS A;  3SD4 A;  3NTK A;  1YJ9 A;  4J9F A;  5D6X A;  2ECZ A;  4KGZ B;  4RCB A;  2YRV A;  1GBQ A;  1ZX6 A;  2K57 A;  1VQO A;  3V7R A;  1K9A A;  1W6X A;  4OGC A;  3VKI A;  2Y4X A;  2QTV A;  2DK3 A;  5FU7 C;  1OU9 A;  1T3S A;  5KE2 A;  3CBM A;  2EQU A;  1O9S A;  4J6Y A;  3I5R A;  2C06 A;  3VRY A;  3E1S A;  1RLP C;  4ZGE B;  3REB B;  1QVF P;  3EGX A;  3EAE A;  3NHN A;  3S6W A;  2B86 A;  9ATC B;  1Q86 R;  3UA6 A;  1N8R R;  5IH2 A;  1AWX A;  3PNW C;  2DIG A;  3ZEH A;  4F7U B;  2HL3 A;  4M75 B;  2RHU A;  2DE0 X;  2X4W A;  2O4X B;  1WHL A;  4J7I A;  4QVZ A;  3OYM A;  4EMK C;  1XTD A;  1U06 A;  3H0H A;  4MZT A;  2AZS A;  2MWO A;  2ZGW A;  4PJO F;  4ME7 A;  1JBM A;  3HRT A;  1QVF S;  3FJP A;  4EMK B;  3S3O A;  1SRM A;  1BIA A;  3HL8 A;  3PT9 A;  4PKC C;  2VB6 A;  1MMA A;  1BI2 A;  2RF0 A;  4HVW A;  1PD1 A;  4D8D A;  2A3L A;  3OYG A;  1UJ0 A;  3CC4 Q;  3CQT A;  1PG5 B;  1UGQ B;  4QQD A;  2KR3 A;  3IQL A;  4HVU A;  4PJO G;  3CCQ A;  1WLP B;  3H8Z A;  1FYN A;  4KT0 E;  1M90 R;  5LJ5 d;  2L2P A;  1TUG B;  1DJ7 B;  2KSS A;  2MMP A;  4JPB W;  3CPW P;  3P8D A;  3HTR A;  4BB7 A;  5I21 A;  5GAO l;  1KIK A;  1C1A A;  3MCA B;  4M78 E;  2L0A A;  3G4S A;  3KUF A;  5DLQ E;  4J5Y A;  1MMG A;  5LJ5 h;  1S72 A;  1ZUU A;  3CCS Q;  4JJN K;  5GAN d;  1YHQ T;  1VQP T;  1YJN Q;  2EGA A;  1QW1 A;  1KC8 C;  3MP6 A;  3JCM d;  1IGU A;  4PFO A;  2CDT A;  2KXD A;  2HAX A;  4JJD A;  1JO8 A;  1NZ9 A;  1VIE A;  2DF6 A;  2DL5 A;  5LJ3 f;  3CPW S;  2ZPH B;  2LMJ A;  2O2O A;  5GAN h;  4QVC A;  5IXF A;  4OMQ A;  4ZGD B;  4J7F A;  3BW1 A;  1Z9Q A;  4A53 A;  4PJJ A;  1QMC A;  1RAB B;  3CD6 Q;  3GLX A;  2BE9 B;  2OTL T;  3I56 Q;  3VU3 C;  4ZNX A;  1G5V A;  5IHI A;  1OUL A;  2CT3 A;  4OML A;  2RQT A;  1MV3 A;  2WAC A;  2BTT A;  3EH1 A;  2F1L A;  2IIM A;  4J9D A;  5GMK j;  4XTZ A;  4A4E A;  2E41 A;  1E6H A;  2CSI A;  3SHW A;  5L23 A;  2EQJ A;  4BI8 B;  2VGM A;  3OYK A;  2GFA A;  2G6F X;  2XHC A;  3QYH B;  4C8Q A;  3CC7 Q;  3C94 A;  1SF9 A;  5D6Y A;  2MYS A;  1M90 U;  4GLK A;  3HPW A;  5A0D A;  4MZP A;  3L2R A;  2DAQ A;  5GMK e;  4C92 A;  1JEG A;  1TUC A;  1YN8 A;  4F7U G;  4AT1 B;  2E5Q A;  2VVK A;  2EVR A;  1IZ6 A;  4C5I A;  4XTU A;  2YXY A;  5GAO r;  2RK1 A;  2QGG A;  2RK2 A;  1E6G A;  2FZK B;  5GAM d;  4F17 A;  2O9V A;  4M7A E;  3S3N A;  2RJF A;  1P92 A;  2HQE A;  2YUN A;  5ECA A;  5KYU B;  1CSK A;  2YDL A;  3BE3 A;  2MCN A;  3RBB B;  2DTH A;  1MHN A;  2KY9 A;  1PRL C;  5D7U A;  5GAM h;  2E6N A;  3QBY A;  4D6W A;  3RIR A;  1D1A A;  2QG9 B;  5DY9 A;  1PC0 A;  2F5K A;  3M0R A;  8ATC B;  4X9D A;  3VJP A;  3VV0 A;  4OB1 B;  1VQM Q;  4C0G A;  4RG8 A;  2FPE A;  2VGN A;  3VS2 A;  4PJN A;  2DTI A;  4RTT A;  4E7J A;  4L6V 5;  2DFU A;  1ZBJ A;  2X9H A;  3LWI A;  3RER A;  4J9E A;  5I22 A;  2LTO A;  2LZ6 B;  4M77 C;  2HQH A;  4ZGJ B;  2DO3 A;  3OYI A;  3QPH A;  1Q82 C;  1QKW A;  2KT8 A;  1H92 A;  2P4T A;  4FT4 A;  5KYW B;  2QYZ A;  3QG1 A;  2K9G A;  4XQ3 A;  1R77 A;  4J6X A;  4AG2 C;  4M77 B;  2JS2 A;  1D1B A;  2YRC A;  2FEI A;  1YHQ A;  3JB9 D;  1VQP A;  4EMG A;  3FB9 A;  2MAM A;  3CCU T;  3FJ5 A;  2V26 A;  3BFM A;  4J6W A;  3OSV A;  5CVI A;  1WA7 A;  2LNH B;  4DBR A;  4N4I A;  3EGD A;  3EFO B;  4KBM B;  3EG9 A;  4BE1 A;  4DBQ A;  3VS0 A;  2KYM A;  3X24 B;  4PLL A;  2D8J A;  2QA4 Q;  2HEQ A;  2JXB A;  5CQY A;  2LX7 A;  2VWF A;  4BE0 A;  3MJX A;  2GTO A;  2M0Y A;  3LYI A;  2H3J A;  2OTL A;  1YBY A;  3TSZ A;  4DBF A;  4E47 A;  3LGL A;  1U1T A;  4FW2 A;  3L2Q A;  5CKD A;  2RI2 A;  1KQS A;  2GFU A;  3VS1 A;  2CZ7 B;  3CBO A;  3HFO A;  3V8L A;  2IG0 A;  1OI1 A;  2YT6 A;  3AHU A;  1G3Y A;  1RLQ C;  1BI1 A;  1YJW T;  3FEO A;  3G71 T;  1M2O A;  2NLU A;  3CBP A;  4A4G A;  4OMN A;  3X26 B;  4X9C A;  2QEX T;  1WNL A;  2ZPG B;  2HKN A;  2RJC A;  4F7U E;  4M75 E;  2DJZ A;  1IGQ A;  2DBK A;  3HRS A;  1KJW A;  3PGG A;  1JQQ A;  3JCM P;  2RHZ A;  3CCR A;  3THK A;  2HCK A;  3RUX A;  3TQ7 P;  2OTJ T;  1GFC A;  2K7A A;  2RHI A;  2M0O A;  3L2Z A;  4XTX A;  5CCA A;  1EZZ B;  3LGF A;  3S3M A;  3JB9 F;  2F2X A;  5GJW B;  4QQ6 A;  3VYH B;  1FMV A;  2D6F A;  2RA2 A;  1VQ6 Q;  4LNP A;  3JV3 A;  4OVA A;  4M78 B;  1TU0 B;  2NYS A;  3JCM b;  4B6M A;  1H64 1;  2ROL A;  3ME9 A;  3X25 B;  2XI9 A;  1YIJ Q;  1K8A C;  2DVE A;  4F16 A;  4XAX B;  4A4F A;  1QCF A;  2JUF A;  2EJF A;  3HFN A;  3JB9 G;  1Y0M A;  1VQ4 T;  3URG A;  1Q7Y U;  3OYD A;  3SWN C;  4LUE A;  1D0Z A;  2YUP A;  3GOX A;  4KGX B;  1N9R A;  4CC7 A;  2LJ3 A;  2K2V A;  3SB2 A;  1UEB A;  2P0Q A;  1VQ7 Q;  1ZSZ C;  1GCP A;  5CO7 A;  5FWB A;  1PM3 A;  2FPD A;  1CKA A;  3CCM T;  5A0L A;  1M1K C;  3I35 A;  3SWN B;  1IRE B;  3H0I A;  4RUG A;  4A63 B;  4AFQ C;  3CCU A;  4DA4 A;  1ZSZ B;  5CKE A;  2JZ2 A;  3CCL Q;  1HSQ A;  2K5L A;  2YWW A;  2VV5 A;  2EBP A;  4ANJ A;  1VQ8 T;  2JM8 A;  3JCM X;  3V7C A;  1JJ2 A;  1BI0 A;  5C0M A;  3INZ A;  4D8K A;  2OAW A;  3A98 A;  1X27 A;  2HQX A;  1VQ5 T;  4NOY A;  2CUB A;  1M4Z A;  3UAT A;  1H8K A;  1X2K A;  4HA8 A;  2RMO A;  1KC8 R;  4BDY A;  1KK7 A;  4BUG A;  2JOY A;  1FMW A;  4PNO A;  4KRT A;  1YJ9 Q;  1G2B A;  2EYW A;  1NJI C;  1YJW A;  5FWC A;  3G71 A;  2DNU A;  3M59 A;  1J3T A;  2KMT A;  1VQO Q;  1OX9 A;  4PJO C;  4BI3 A;  4M7D G;  2QEX A;  5IN1 A;  3J7A F;  2HKQ B;  4PL6 A;  4N0A A;  3JAM E;  2KNB B;  5C6S A;  3EG2 A;  1OQK A;  4LDX A;  2ZCF B;  1R0C B;  2OTJ A;  4MML A;  1BCO A;  3HHT B;  4WTO B;  2DET A;  3CMA T;  2RJD A;  3MET A;  4PJO B;  4OMF B;  2EYY A;  2KGT A;  5FRN A;  5I11 A;  1CKB A;  5GMK i;  4M4Z A;  4J8O A;  2CKK A;  2QQS A;  3SEM A;  4C0D B;  4V2S A;  3CPF A;  3UA7 A;  5GAN 4;  2E6Z A;  3FC3 A;  2AIR B;  3CC2 Q;  4OF1 A;  3MO8 A;  1BI3 A;  1BB9 A;  4M78 A;  5KYY B;  3G6E T;  4M7A D;  1K73 C;  2VC8 A;  3MPU B;  5CR2 A;  2LQ8 A;  2WSE E;  2E70 A;  4OP0 A;  1RUW A;  8AT1 B;  4LD9 K;  1WI7 A;  3HP9 A;  1XQH A;  1ABO A;  1VQ4 A;  2PQW A;  2XMF A;  1NE8 A;  2X4Y A;  2JTF A;  1IHW A;  2AZV A;  1EX4 A;  2QDY B;  3L1A A;  5IXB A;  1VQN T;  1GCQ C;  4JLG A;  2J06 A;  4FT2 A;  4J83 A;  3CCM A;  2VKN A;  3CCQ Q;  2HMA A;  2R57 A;  4M77 E;  1KQS P;  3E9G A;  3EH2 A;  3OA6 A;  3UPU A;  2PTK A;  3JCM Q;  1UHF A;  1Y71 A;  1I5L A;  2O9S A;  2EPD A;  4JDS A;  1NYG A;  2ABL A;  1AOJ A;  2EKO A;  2LC4 A;  3OW2 P;  3OYY A;  3R6N A;  3OMC A;  4Z8A A;  5CAI A;  5I2M A;  3G4S Q;  7AT1 B;  3Q1J A;  1VQ8 A;  2LCS A;  4QQG A;  1NM7 A;  4BE2 A;  1KD1 U;  1UGS B;  1YI2 T;  1S72 Q;  2K79 A;  2DKG A;  3QZ5 B;  1G3W A;  3HKS A;  5FU7 B;  1VQ5 A;  1KQS S;  5LJ3 d;  2K3Y A;  2O01 E;  3PIO A;  3LWH A;  1AT1 B;  1I1J A;  1K9M C;  4E7S A;  4HCZ A;  3BDU A;  1SG5 A;  1QVG A;  4E7H A;  1N9S A;  3HRU A;  2RNA A;  1AWW A;  2CS7 A;  4KH0 B;  4M7A F;  5LJ3 h;  3DLM A;  2KYB A;  1ABQ A;  1M8V A;  2KI7 A;  3PIP A;  4FCY A;  1JXM A;  1X75 C;  1OOT A;  3CXC P;  2E65 A;  4M7A A;  4LXC A;  4MDX A;  3M9Q A;  2KE9 A;  3EHQ A;  2KXC A;  2COY A;  2MI6 A;  2LQW A;  2DTO A;  2A0F B;  1I5O B;  1YIT A;  4WCI A;  3OBY A;  4C8Q D;  2QAS A;  4CRI A;  4EIK A;  1X2Q A;  2DD5 A;  2V8J A;  4OB3 B;  2ZZD A;  4NS5 A;  1YJN T;  4J9G A;  1NLP C;  4C92 D;  2CP6 A;  4X34 A;  1Y7X A;  3JB9 J;  3CMA A;  2JNG A;  4YTL A;  1XNI A;  2C0T A;  2KT1 A;  4M75 D;  3EFR A;  5IHN A;  1NYF A;  1VYU A;  4II1 A;  2K5I A;  2DZC A;  1M3A A;  3VS4 A;  1B34 B;  1PCX A;  3LX7 A;  1GBR A;  1VIF A;  2YLB A;  4Y28 E;  1WJR A;  2L89 A;  4LUD A;  4LD6 A;  3G6E A;  4IUQ A;  5KYY A;  1R0B G;  1WXT A;  2O31 A;  4X1V A;  1K1Z A;  5J26 A;  5EG2 A;  2X3X D;  5GAN 8;  1Q86 U;  1OZ2 A;  3M4G A;  1N8R U;  2HBW A;  4BI4 A;  5GAN 6;  1AD5 A;  1JJ2 P;  4QVD A;  4MMK A;  2DVJ A;  4FYV B;  1XJW B;  2COW A;  3SDZ A;  1ZQ1 A;  3FRN A;  1PKS A;  1I81 A;  3RES A;  3OYL A;  2R5M A;  4AFU C;  4AFZ C;  3JCM h;  2AT1 B;  2VYT A;  3PTA A;  1RAF B;  1SEM A;  1VQN A;  4IUR A;  2ED1 A;  4DQ2 A;  2H3E B;  3RR6 A;  1RAC B;  1LCK A;  5GAN 7;  5IT9 E;  3OSS C;  1I0C A;  1M27 C;  1PKT A;  1JJ2 S;  3DKM A;  1K8A R;  3OS0 A;  2RI3 A;  1ACM B;  1Y96 B;  4C8Q F;  3CCV T;  1B07 A;  3C12 A;  2DM1 A;  1JB0 E;  1WXB A;  2GTJ A;  1UGR B;  2BIV A;  2KBT A;  4C92 F;  1RL2 A;  2EW3 A;  2DXU A;  3OQ5 A;  1YI2 A;  2RD1 A;  2YLC A;  3WVD B;  1YHQ Q;  4M75 F;  1VQP Q;  1UG1 A;  1F1B B;  1M3B A;  1SHG A;  1WGS A;  3N5B B;  2RN8 A;  1VQM T;  4F7U A;  4M75 A;  2KRO A;  3JCM c;  2XDD A;  1U8R A;  1M1K R;  2O4X A;  4QT7 A;  4K11 A;  2I0N A;  2J05 A;  3NGP A;  1UGP B;  3RKW A;  2CZ6 B;  2GBQ A;  3UF4 A;  3UDC A;  1AEY A;  1WDX A;  4C92 G;  4VUB A;  3JSC A;  2XIC A;  1VYT A;  1UE9 A;  4JJC A;  2QQ9 A;  2R58 A;  3X28 B;  2OTL Q;  1T3L A;  2FL7 A;  4RG2 A;  4EMK A;  4PJL A;  3OY9 A;  4N4H A;  5CKH A;  3SFM A;  1YWP A;  1PD0 A;  2WSC E;  3DLL A;  3CCJ T;  2VXE A;  3LLR A;  3M0T A;  1WQW A;  4HKE A;  1WHJ A;  4EDU A;  4PJO E;  3PFS A;  1ZLM A;  1WPY A;  1RAG B;  1UTI A;  3TRE A;  2QDL A;  1NG2 A;  2DER A;  2HD0 A;  2KRN A;  3RMQ A;  1B34 A;  4Z88 A;  2KVQ G;  2XK0 A;  5AT1 B;  2KRM A;  3FLG A;  1NJI R;  3VRZ A;  3CCR Q;  3CEY A;  1W2B A;  2BZ8 A;  1KQ1 A;  1QP3 A;  1WIE A;  2NWM A;  3I5S A;  3ZBD A;  3JCM W;  3L2V A;  3VS6 A;  4RTU A;  2OX7 A;  1D3B B;  2FRY A;  2MIO A;  5GAN 5;  2LCL A;  1G8X A;  2CT4 A;  2E12 A;  1D09 B;  1E7O A;  3GP8 A;  5KCH A;  1TWB A;  4JRP A;  2RHX A;  1HXD A;  3NFC A;  3FDR A;  4BAC A;  2AKK A;  1VQK T;  4RTX A;  1QVG P;  4Z02 A;  3QJ6 A;  3A8H B;  2E5K A;  5HY6 A;  2LJ1 A;  4B9W A;  2DA9 A;  1K73 R;  1AVZ C;  1TS9 A;  4DEX A;  5KE3 A;  3NTH A;  3VUZ A;  4R56 A;  5L8R E;  2F2V A;  4IIO A;  5CQX A;  3CCV A;  4ZN3 A;  3OYB A;  2CP3 A;  3MEV A;  1Y96 A;  3ZFJ A;  4A4H A;  4M7D C;  2J6K A;  3AT1 B;  4M77 D;  1NLO C;  2F2W A;  1VUB A;  4XU0 A;  2QTX A;  3QJY A;  3OYC A;  2QQA A;  3F70 A;  3OW2 A;  2BE7 D;  2OAU A;  2E3H A;  1QVG S;  4IUV A;  4A54 A;  3M57 A;  1X6B A;  4WF2 A;  2L3Q A;  1Q81 C;  3CCE T;  3CCU Q;  4M7D B;  2QAZ A;  1M90 C;  1VQM A;  2AK5 A;  4ZTJ A;  4FL6 A;  3QII A;  2KK4 A;  4FM4 B;  2MK5 A;  1NEG A;  1I8F A;  2H8H A;  4XU3 A;  5GAM g;  4FYW B;  3QXE B;  2D8H A;  2K4Y A;  1QWF A;  2RQU A;  3UT1 A;  2GCX A;  1SRL A;  1IRX A;  3E2U A;  5KYU A;  1W4S A;  3I55 T;  5J39 A;  1GFD A;  3EG1 A;  4LDW A;  3NTI A;  5GAN e;  3MEW A;  3QDR B;  2L3P A;  2D1X A;  2FG0 A;  2DZ9 A;  3VS5 A;  1G3T A;  1XOV A;  3CXC A;  1IHV A;  1WFW A;  2CP0 A;  2FRW A;  1M1G A;  3JCM J;  3CCJ A;  4HVV A;  1VQL T;  4IIM A;  5HK3 A;  4E7Z A;  3EG3 A;  1YCY A;  1C0M A;  1K9M R;  1M2V B;  4FW1 A;  2LQK A;  3UWN A;  4E7I A;  2HDA A;  3GNG A;  1KQ2 A;  1VOM A;  2BKD N;  1YJW Q;  2Z0W A;  5IAY A;  2EIF A;  2M9U A;  2LCC A;  2FHD A;  5GAN 2;  3A1P A;  3PVQ A;  3L2W A;  1QLY A;  1VA7 A;  1O75 A;  1U1S A;  1ZUK A;  1UUE A;  4M77 F;  2SRC A;  4Q5W A;  3OYE A;  1BIB A;  4XTV A;  2J7I A;  1WHM A;  2OTJ Q;  2DIQ A;  5KYW A;  1WHK A;  3TSW A;  1X01 A;  4RTW A;  1WJQ A;  3X20 B;  3QO3 A;  1U5S A;  2EQI A;  3RDV A;  2I2L A;  3H6Z A;  2X35 A;  1K0S A;  5GAO n;  1PSE A;  4M77 A;  4M78 D;  2FVU A;  1PWT A;  3ASK A;  4F14 A;  2LRQ A;  5FRM A;  1TH7 A;  1D0X A;  3L42 A;  4CC3 A;  2CZ1 B;  3EFO A;  5GAM j;  1LVK A;  3BY7 A;  4OGE A;  4ELZ C;  2ZPF B;  4RMO A;  2RH2 A;  4XTY A;  2L8D A;  1VQK A;  1EFN A;  2FO0 A;  3RMS A;  3EG0 A;  3KXT A;  4Y91 A;  2DJQ A;  1HD3 A;  5GAM e;  3EGX B;  4PFP A;  1MMD A;  1WX6 A;  2LNV A;  2FB7 A;  1K9M U;  1NEB A;  2CUD A;  3MEA A;  3NMZ C;  2IPO B;  5AYF A;  4JS4 A;  4KUD K;  1TUD A;  2M1H A;  3M0S A;  5KYX B;  3CCM Q;  4M7A C;  2P0P A;  1M30 A;  3QZ9 B;  1Y57 A;  2QQB A;  3C95 A;  1VYV A;  3QDF A;  1RAD B;  4TVR A;  3CC2 T;  5FW9 A;  3CCE A;  3DB3 A;  2M51 A;  1SPK A;  5LL6 S;  2DMO A;  1IO6 A;  3HSB A;  5J3B A;  2CP5 A;  2NUT B;  1VQ9 T;  3CME T;  1VQ8 Q;  2KAF A;  4DOW A;  1QQJ A;  3T9N A;  2X4X A;  2DXB A;  1PHT A;  2VAS A;  4KH1 B;  2CP2 A;  2EQK A;  1VQ5 Q;  1W2B P;  4L59 A;  1JU5 C;  4M78 F;  2QK0 A;  5CK9 A;  3P8H A;  5DLO A;  3I55 A;  2JN0 A;  2E4H A;  3OMG A;  2PVD B;  1H3Z A;  2SEM A;  3TCJ A;  1RAH B;  4R0K A;  4FYX B;  3GIB A;  2OJ2 A;  5FRO A;  2A08 A;  2ZAE A;  1VQL A;  3PE0 A;  5KCO A;  4HCC A;  1I4K 1;  2L5Q A;  2LT4 A;  2HNI A;  4F04 B;  5GMK h;  2EYZ A;  1W2B S;  1OEB A;  4OB0 B;  1SHF A;  3LH0 A;  4AMC A;  1M1F A;  2MF2 A;  3M56 A;  1YIT Q;  1KC8 U;  3VUB A;  3M54 A; 
#chains in the Genus database with same CATH homology
 2EJG A;  5GAN 6;  4IKF A;  2P4T A;  5HK0 A;  4FT4 A;  4DOV A;  4QVD A;  4MMK A;  3QG1 A;  3SDZ A;  1ZQ1 A;  3FRN A;  4XQ3 A;  5I2S A;  1Q7Y C;  1D3B A;  4JRI A;  4J6X A;  1KG1 A;  4M77 B;  5FLX E;  1YHQ A;  4JRQ A;  3JB9 D;  1I81 A;  1VQP A;  3RES A;  4EMG A;  2R5A A;  3OYL A;  3FB9 A;  2GQV A;  2R5M A;  2MAM A;  3CCU T;  3JCM h;  3BFM A;  2VYT A;  4J6W A;  3OSV A;  5CVI A;  3SWN A;  3PTA A;  1X6O A;  4QW2 A;  2B8A A;  3CPW A;  4N4I A;  2DEQ A;  4KBM B;  3L2U A;  1QVP A;  1YJ9 T;  1AHJ B;  4IUR A;  3C4S A;  4M77 G;  1VQN A;  3V8K A;  3JB9 I;  1G3S A;  4BE1 A;  4DQ2 A;  3OYA A;  3LW5 E;  1VQO T;  4OB2 B;  5GAN 7;  3X24 B;  4MDW A;  1FX7 A;  3OSS C;  5IT9 E;  4PLL A;  4XU2 A;  1LNX A;  3QSU A;  5CQY A;  4GY5 A;  2Y4Y A;  4BE0 A;  3FIF A;  3A5Z B;  1ZHI A;  3OB9 A;  1JJ2 S;  4BY6 C;  2XU8 A;  3DKM A;  3OYN A;  2PU9 B;  3OS0 A;  4C8Q C;  2RI3 A;  3LYI A;  1Y96 B;  3CCV T;  4C8Q F;  2Y90 A;  3C12 A;  3VYG A;  2H3J A;  2OTL A;  1YBY A;  4HCB A;  1JB0 E;  1ZBX A;  3JRZ A;  1UGR B;  2LT1 A;  3M5A A;  4XK8 E;  4E47 A;  4P5N A;  3G7Z A;  1U1T A;  3LGL A;  4C92 C;  2BIV A;  4C92 F;  1RL2 A;  1YI2 A;  2DXU A;  3OQ5 A;  3L2Q A;  2F5T X;  2RD1 A;  5A2Q E;  5CKD A;  4IUT A;  2RI2 A;  3DB4 A;  3KBG A;  4BY6 B;  3CC4 T;  2XG8 D;  1KQS A;  3OW2 S;  2YLC A;  4M75 C;  3WVD B;  3WXM B;  2GFU A;  3TU4 K;  4M75 F;  4C8Q B;  2CZ7 B;  4CI0 C;  5A0G A;  4M7D F;  3CBO A;  3HFO A;  3V8L A;  1VQ6 A;  2IG0 A;  1WGS A;  1OI1 A;  3N5B B;  3AHU A;  1JRI A;  1G3Y A;  4C92 B;  1VQM T;  3R6O A;  4F7U A;  1BI1 A;  4M75 A;  3JCM c;  1YJW T;  3FEO A;  2JVV A;  3P8B B;  2XDD A;  3OYF A;  3G71 T;  2O4X A;  1U8R A;  4M7D A;  2NLU A;  3CBP A;  5CIU A;  4A4G A;  3X26 B;  2ZPI B;  3RKW A;  1UGP B;  2CYZ B;  2CZ6 B;  4JRK A;  4X9C A;  2QEX T;  1WNL A;  1V29 B;  2RI5 A;  2RJC A;  2ZPG B;  4M7A B;  3UDC A;  4F7U E;  4M75 E;  2DJZ A;  4C92 G;  4VUB A;  5GMK m;  3CC2 A;  2BUD A;  3HRS A;  3OS2 A;  3JSC A;  4M7D E;  2XIC A;  2M16 A;  4EMH A;  3E9F A;  3PGG A;  2QQ9 A;  2RHZ A;  3CCR A;  2R58 A;  4IUP A;  3JCM P;  4PJO B;  4PLI A;  3RUX A;  3JB9 H;  2ZPE B;  3J80 E;  3X28 B;  2OTJ T;  2FL7 A;  3CCS T;  1VQ9 A;  4M7A G;  2EFI A;  1YIT T;  4RG2 A;  5D6W A;  3CME A;  2AHJ B;  4EMK A;  1RI0 A;  2RHI A;  2YHT A;  2M0O A;  4LDU A;  2EAY A;  3L2Z A;  4XTX A;  5CCA A;  5GAN 3;  3OY9 A;  4N4H A;  5CKH A;  4XU1 A;  4C5G A;  3SFM A;  2GF7 A;  4C5E A;  4JUV A;  3LGF A;  1UB4 A;  3S3M A;  3JB9 F;  2WSC E;  4C0D C;  1KHI A;  3DLL A;  1VQ7 A;  4PJO A;  3CCJ T;  3CXC S;  4FIB A;  2VXE A;  2RO0 A;  1HK9 A;  2DPP B;  3LLR A;  4QQ6 A;  3VYH B;  3BDL A;  4A4K A;  4HT8 A;  1KHC A;  3CCQ T;  2D6F A;  1WQW A;  2RA2 A;  4JLI A;  2JTM A;  4HKE A;  1FWZ A;  4OVA A;  4M78 B;  3V8J A;  4EDU A;  3PMT A;  4PJO E;  3V7S A;  1GXI E;  3PFS A;  2LVM A;  3GF5 A;  5FU6 C;  2DD4 A;  3JCM b;  3PMI A;  3QYG B;  4BDZ A;  2QQR A;  1WPY A;  3CD6 T;  4E7L A;  1H64 1;  1R8O B;  3TRE A;  3CCL A;  3ME9 A;  3X25 B;  2XI9 A;  1Y07 A;  2HD0 A;  4M78 G;  1K8A C;  1N27 A;  3G4S T;  2DVE A;  2XID A;  3I56 T;  3RMQ A;  1B34 A;  1Q82 U;  4XAX B;  4A4F A;  2XKO C;  2JUF A;  2A7Y A;  2KVQ G;  2XK0 A;  2EJF A;  3HFN A;  3JB9 G;  3FLG A;  2K5F A;  4B9X A;  1FXX A;  4XTW A;  3CEY A;  5FU6 B;  1VQ4 T;  1S72 T;  1W2B A;  1KQ1 A;  5CKB A;  3URG A;  3ER0 A;  5HKC A;  4PJO D;  2XDB A;  1QP3 A;  4JS5 A;  1Q7Y U;  3OYD A;  3SWN C;  2KDS A;  3ZBD A;  4ZTF A;  2E1H A;  4NL2 A;  2RB6 A;  3GPL A;  3GOX A;  3L2V A;  3JCM W;  2QXF A;  2WSF E;  2PUO B;  2VUB A;  2XD0 A;  4HT9 A;  1N9R A;  2QI2 A;  3MHX A;  1MGQ A;  3TEE A;  2K2V A;  3SB2 A;  1UEB A;  2P0Q A;  1D3B B;  3CC7 T;  4LDY A;  5GAN 5;  5GAO p;  2IVW A;  4RKU E;  5CO7 A;  2LCL A;  2RM4 A;  3CCM T;  4FU6 A;  4O5V A;  5A0L A;  2E12 A;  1M1K C;  3SWN B;  1IRE B;  2RJE A;  5GMK l;  3E19 A;  3A8L B;  3GP8 A;  5KCH A;  4JRP A;  2RHX A;  3CCU A;  4DA4 A;  1HXD A;  3SD4 A;  2PVO B;  4FSX A;  3NFC A;  3FDR A;  3NTK A;  4BAC A;  5CKE A;  2JZ2 A;  1YJ9 A;  5D6X A;  1VQK T;  4RCB A;  5GAO q;  4Z02 A;  2K5L A;  3QJ6 A;  2YRV A;  3A8H B;  2VV5 A;  5HY6 A;  2K57 A;  1VQO A;  1VQ8 T;  3V7R A;  4OGC A;  3VKI A;  4B9W A;  3JCM X;  3V7C A;  1JJ2 A;  2Y4X A;  1BI0 A;  5C0M A;  2DXT A;  2DK3 A;  5KE3 A;  5FU7 C;  3INZ A;  3NTH A;  3VUZ A;  3MEU A;  5L8R E;  2PVG B;  3CBM A;  5KE2 A;  4R56 A;  5CQX A;  2EQU A;  1O9S A;  2HQX A;  2F69 A;  3M4Y A;  4J6Y A;  1VQ5 T;  2DXC A;  3CCV A;  4ZN3 A;  2C06 A;  3OYB A;  3MEV A;  1Y96 A;  4ELY C;  5GAO m;  3ZFJ A;  4A4H A;  4ATO A;  4F7U F;  3E1S A;  4NOY A;  4ZGE B;  5LJ3 g;  3A8O B;  4M7D C;  4M77 D;  1SSF A;  1M4Z A;  1KD1 C;  3EAE A;  3S6W A;  2KQW A;  1YIJ A;  1VUB A;  4XU0 A;  2QTX A;  3QKJ A;  3QJY A;  1OYX A;  2QQA A;  3F70 A;  3OYC A;  3OW2 A;  2OAU A;  1QVG S;  4IUV A;  4A54 A;  3CC4 A;  4HA8 A;  1Q81 U;  3M57 A;  4C8Q G;  4BDY A;  3PNW C;  2DIG A;  4WF2 A;  3ZEH A;  1Q81 C;  2D9T A;  3OYJ A;  4F7U B;  3CCE T;  4M75 B;  2RHU A;  2X4W A;  2O4X B;  4M7D B;  4BUG A;  1K9M U;  2JOY A;  4PNO A;  3JCM V;  3MP8 A;  1M90 C;  4J7I A;  4QVZ A;  1VQM A;  3OYM A;  4EMK C;  4ZTJ A;  1NJI C;  1N6A A;  1YJW A;  3G71 A;  4FL6 A;  1XTD A;  3M59 A;  4MZT A;  2KMT A;  1EIF A;  3QII A;  2MWO A;  2KK4 A;  2EYQ A;  4FM4 B;  2ZGW A;  4M75 G;  4PJO C;  4BI3 A;  4PJO F;  4M7D G;  5LJ5 f;  4ME7 A;  1JBM A;  3HRT A;  2QEX A;  1QVF S;  1I8F A;  5GAM g;  4XU3 A;  5IN1 A;  3J7A F;  4PL6 A;  4BD3 A;  3CCR T;  4N0A A;  3QXE B;  3EFS A;  3JAM E;  2K4Y A;  5C6S A;  3FJP A;  3UT1 A;  4EMK B;  2GCX A;  3S3O A;  4LDX A;  1BIA A;  2MWP A;  2ZCF B;  2OTJ A;  3HL8 A;  3PT9 A;  4MML A;  4PKC C;  3CCS A;  4IUU A;  1W4S A;  3I55 T;  5J39 A;  3HHT B;  1BKB A;  4LDW A;  3NTI A;  1YJN A;  2RJD A;  1BI2 A;  3MET A;  3MEW A;  4MZM A;  4N4G A;  5GAN e;  3CMA T;  4OMF B;  3QDR B;  2DZ9 A;  5FRN A;  1G3T A;  2CZ0 B;  1XOV A;  2A3L A;  3CXC A;  3OYG A;  1LOJ A;  5GMK i;  5GAN f;  4J8O A;  1M1G A;  2CKK A;  4C5H A;  3JCM J;  2QQS A;  3A8M B;  3CCJ A;  1VQL T;  3OS5 A;  5HK3 A;  3JCM f;  4C0D B;  4V2S A;  5LJ5 g;  1UGQ B;  2X4J A;  3CPF A;  4QQD A;  4PJO G;  1YCY A;  1K8A U;  2ZPB B;  3CCQ A;  3MP1 A;  4KUI A;  3A8G B;  5GAN 4;  2E6Z A;  3H8Z A;  2LQK A;  3RKX A;  3UWN A;  3FC3 A;  4E7I A;  2QA4 T;  4KT0 E;  4OF1 A;  3MO8 A;  1BI3 A;  3GNG A;  4M78 A;  1KQ2 A;  1NPR A;  3G6E T;  2BKD N;  1LJO A;  2VC8 A;  5LJ5 d;  1K73 C;  4M7A D;  5IAY A;  2EIF A;  2M9U A;  4RCC A;  1DJ7 B;  2KSS A;  2MMP A;  3CD6 A;  2LCC A;  2LQ8 A;  2WSE E;  2E70 A;  5CR2 A;  3P8D A;  5I21 A;  4BB7 A;  5LJ3 j;  2FHD A;  4OP0 A;  5GAO l;  3MCA B;  4M78 E;  5GAN 2;  3G4S A;  3I56 A;  3L2W A;  1NPP A;  3KUF A;  5DLQ E;  4J5Y A;  4LD9 K;  3HP9 A;  4UC4 A;  5GAN g;  5LJ5 h;  3JCM e;  1O75 A;  1PSF A;  1XQH A;  1U1S A;  1VQ4 A;  2PQW A;  4M77 F;  4Q5W A;  3JCM g;  3OYE A;  1BIB A;  1S72 A;  4XTV A;  1NE8 A;  2E64 A;  2X4Y A;  2DIQ A;  4JJN K;  2JTF A;  1X01 A;  1Q86 C;  1QP2 A;  1WJQ A;  5GAN d;  1YHQ T;  3X20 B;  1M1K U;  3QO3 A;  1VQP T;  1N8R C;  1QW1 A;  2I2L A;  2LDM A;  2QDY B;  3H6Z A;  1KC8 C;  3MP6 A;  2X35 A;  3L1A A;  3JCM d;  5LJ3 e;  5GAO n;  1OZ3 A;  1PSE A;  4O6J A;  4M77 A;  5CKF A;  3CC7 A;  1BYM A;  2P0K A;  2FVU A;  4M78 D;  1VQN T;  2HAX A;  4FT2 A;  4JLG A;  1NZ9 A;  1VIE A;  2L3R A;  4LDV A;  5LJ3 f;  3ASK A;  4J83 A;  2ZPH B;  3CPW S;  2LRQ A;  5FRM A;  2RHY A;  1TH7 A;  3OYH A;  5GAN h;  3CCM A;  2R57 A;  4QVC A;  4M77 E;  3L42 A;  5GAM j;  2CZ1 B;  3M58 A;  4ZGD B;  4J7F A;  3BW1 A;  3E9G A;  3OA6 A;  3UPU A;  3BY7 A;  4A53 A;  4OGE A;  3JCM Q;  1Y71 A;  1I5L A;  4ELZ C;  2ZPF B;  4JDS A;  4RMO A;  3M55 A;  3OBW A;  2RH2 A;  2EKO A;  4E7K A;  2LC4 A;  4XTY A;  3OYY A;  3GLX A;  3OMC A;  2L8D A;  5CAI A;  5I2M A;  1VQK A;  3RMS A;  2OTL T;  3KXT A;  3VU3 C;  1M5Q 1;  4L5G A;  4Y91 A;  3Q1J A;  1G5V A;  1VQ8 A;  4QQG A;  5GAM e;  4BE2 A;  1KD1 U;  1UGS B;  1YI2 T;  2WAC A;  2DKG A;  5GMK j;  3M53 A;  3WVE B;  3QZ5 B;  1G3W A;  3HKS A;  5KH6 A;  4XTZ A;  5GAM f;  5LJ5 j;  4R55 A;  4A4E A;  2G3R A;  2E41 A;  5FU7 B;  1VQ5 A;  1KQS S;  2LNV A;  5LJ3 d;  2EQJ A;  2FB7 A;  2K3Y A;  2O01 E;  4BI8 B;  2VGM A;  2V8K A;  4ZN1 A;  3PIO A;  3OYK A;  2GFA A;  3LWH A;  1VQ6 T;  2XHC A;  2D0Q B;  3MEA A;  1K9M C;  3QYH B;  3RKY A;  4C8Q A;  4HCZ A;  3C94 A;  5D6Y A;  1M90 U;  3BDU A;  4GLK A;  3HPW A;  5AYF A;  1M9S A;  2XDP A;  3QUI A;  5A0D A;  1QVG A;  4MZP A;  2VXF A;  3L2R A;  4JS4 A;  1N9S A;  4E7H A;  1NJI U;  2DAQ A;  2M1H A;  3HRU A;  4KUD K;  4M7A C;  4N0A C;  2CS7 A;  5GMK e;  2P0P A;  4M7A F;  3QZ9 B;  5LJ3 h;  4C92 A;  2QQB A;  3C95 A;  3DLM A;  4C8Q E;  5LJ5 e;  1YIJ T;  5GAN j;  4F7U G;  1M8V A;  4TVR A;  2E5Q A;  3CC2 T;  3GNF B;  3CCE A;  3PIP A;  3DB3 A;  1IZ6 A;  1X75 C;  4C5I A;  4XTU A;  2E65 A;  5LL6 S;  4C92 E;  4M7A A;  3HSB A;  1WQ7 A;  5GAO r;  2RK1 A;  4MDX A;  2RK2 A;  3M9Q A;  4NL3 A;  2EWN A;  5J3B A;  1VQ9 T;  2MI6 A;  2DTO A;  3CME T;  1QVF A;  5GAM d;  3OS1 A;  2KAF A;  4DOW A;  4M7A E;  3T9N A;  1YIT A;  3J81 E;  5DM7 R;  2X4X A;  3S3N A;  2RJF A;  2DXB A;  3OBY A;  1P92 A;  2HQE A;  4C8Q D;  4EPC A;  2FYK A;  4CRI A;  1VQ7 T;  2V8I A;  2DD5 A;  2V8J A;  2EQK A;  2K3X A;  2PUK B;  2ZZD A;  4OB3 B;  2DTH A;  1MHN A;  2KY9 A;  4L59 A;  4M78 C;  4NS5 A;  4M78 F;  1YJN T;  5GAM h;  2E6N A;  5CK9 A;  3P8H A;  2EQM A;  3QBY A;  3RIR A;  4C92 D;  4D6W A;  5DLO A;  3I55 A;  2JN0 A;  2LX9 A;  3OMG A;  2PVD B;  4KUL A;  1Y7X A;  2E10 A;  4X34 A;  3CMA A;  3JB9 J;  1H3Z A;  5DY9 A;  3TCJ A;  2F5K A;  2JNG A;  4YTL A;  1XNI A;  1WJS A;  1K73 U;  4X9D A;  4M75 D;  3GIB A;  3VJP A;  3EFR A;  3QHS A;  4OB1 B;  3VV0 A;  4M7D D;  5FRO A;  4C0G A;  4II1 A;  2K5I A;  2DZC A;  1VQL A;  4RG8 A;  3CCL T;  2HBP A;  5KCO A;  4HCC A;  1B34 B;  4C0Z A;  3LX7 A;  2VGN A;  1VIF A;  2YLB A;  1I4K 1;  2CGH A;  2L5Q A;  3O8V A;  2DTI A;  4E7J A;  2LT4 A;  2HNI A;  4Y28 E;  1WJR A;  4L6V 5;  2QA4 A;  2L89 A;  5GMK h;  4LD6 A;  5M9O A;  4IUQ A;  3G6E A;  3LWI A;  3RER A;  2EJ9 A;  4C0F A;  1W2B S;  2LTO A;  4M77 C;  4OB0 B;  5J26 A;  5EG2 A;  5GAN 8;  3LH0 A;  1M1F A;  4ZGJ B;  2DO3 A;  3OYI A;  2MF2 A;  1Q86 U;  1OZ2 A;  3M56 A;  3M4G A;  3QPH A;  1N8R U;  1Q82 C;  1KC8 U;  3VUB A;  4BI4 A;  3M54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...