2KE9A

Nmr solution structure of the caskin sh3 domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
67
structure length
67
Chain Sequence
GSLKVRALKDFWNLHDPTALNVRAGDVITVLEQHPDGRWKGHIHESQRGTDRIGYFPPGIVEVVSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Caskin-2
publication title NMR solution structure of the CASKIN SH3 domain
rcsb
source organism Homo sapiens
total genus 9
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ke9A00
2GQIA 1GFCA 3JV3A 4LE9A 4E6RA 2LCSA 3QWYA 1TUCA 1E7OA 1AWXA 2KRMA 2K7AA 4IIMA 3NHNA 3PVQA 2YUPA 4OMMA 4CC4B 2GTOA 2EYXA 2PTKA 3EG1A 1GCPA 1JU5C 3M0RA 3RNJA 2O9SA 2A36A 2KR3A 1ARKA 2AZSA 1K76A 1YCSB 2DL7A 2JW4A 1RLPC 3IQLA 2HBWA 1JXOA 1ABQA 2O9VA 4HVWA 4AFUC 2L0AA 1T0JA 2A37A 3TVTA 2A28A 4OMQA 2CSIA 2VVKA 2RQUA 1WYXA 1TUDA 2X3WD 1U3OA 2KYMA 4J9DA 1E6HA 1CSKA 2DF6A 2PNIA 1NYGA 1SSHA 4K11A 1MV0B 2L3PA 4LUDA 2DX1A 2RN8A 3NGPA 4J9HA 1XOVA 5FWBA 1M30A 1UDLA 2YT6A 1ZUKA 2DLPA 4X1VA 3PE0A 1KJWA 1T3LA 4JJCA 4IIOA 4EIKA 3RBBB 3M0TA 1W70A 3VRYA 2RQVA 1NLPC 2DNUA 2MIOA 1NM7A 1U5SA 2KE9A 1SEMA 2HEQA 1T3SA 2OI3A 1S1NA 4J9GA 3ZL7C 1T0HA 2AKLA 2RF0A 4OMPA 3C0CA 4DEXA 2D8JA 1AZGB 2J6OA 1RLQC 2AK5A 3THKA 4CC3A 1K9AA 2DBMA 2K2MA 2LMJA 3LH5A 3VS3A 2DVJA 4HVVA 4DEYA 2CH4W 2DBKA 2ABLA 1H8KA 1X27A 1PWTA 1UJYA 1UHCA 1GBRA 3PVLA 4JZ3A 4GBQA 2MCNA 2HSPA 3VS4A 5I22A 2EPDA 2JMCA 4CC2A 2CT4A 2C0OA 4HVUA 2GGRA 4Y92A 1AD5A 4QT7A 1JQQA 2W0ZA 1SHFA 2V1QA 4AFQC 1CKAA 2FRYA 1G2BA 3NPFA 2DL4A 2FPDA 2LQWA 2VKNA 1Z9QA 4ORZA 3I35A 1K1ZA 1KSWA 5IH2A 3VS5A 3R6NA 2O2OA 2YSQA 1SHGA 1MV3A 1UHFA 2SRCA 5FW9A 3I9QA 4RTWA 2E5KA 1AOJA 4J9CA 2FRWA 1AWOA 1GRIA 1SPKA 2GNCA 3M0SA 1NEGA 2DL3A 2K6DA 1PHTA 2EYYA 2M51A 2EKHA 1NEBA 3FJ5A 1UTIA 1UG1A 2VWFA 2CREA 4D8KA 1X6GA 2K79A 3VS2A 4F16A 1AEYA 1X2KA 3SHWA 4HCKA 5GJWB 2HCKA 1OOTA 1W6XA 1HJDA 2GTJA 3H0HA 1PKTA 1ABOA 5ECAA 5I11A 1MUZA 1SRLA 2GBQA 4RUGA 2G6FX 2LJ0A 2BZ8A 2P4RA 1HD3A 2EYZA 4F17A 1GFDA 4ZNXA 3EG3A 2KT8A 2FO0A 1ZUUA 2EGCA 2F2VA 4JJDA 4LUEA 2HDAA 2JM9A 2KXDA 1VYVA 2JM8A 1ZBJA 2EGEA 1YWOA 2X3XD 2RNAA 1W1FA 2J7IA 1BBZA 1I07A 1ZLMA 2O31A 1Y0MA 4KRTA 1X6BA 2O88A 2ED0A 1BB9A 2CSQA 1NYFA 1FMKA 4HXJA 2ESWA 2LZ6B 4RTXA 3EHRA 3H0FA 2EVRA 3TSZA 5FWCA 3I5RA 1UUEA 1PNJA 4GLMA 4OMLA 4RTUA 3H0IA 2BZYA 1RUWA 1RI9A 2YUOA 1B3QA 1WXTA 2KRNA 2DL5A 1OV3A 1UECA 3U23A 1K4US 2LJ3A 2NWMA 1AVZC 1M3CA 3CQTA 4OMNA 1AZEA 2J6KA 2K9GA 1YWPA 2JMAA 2RQTA 3M0UA 1X43A 5IXBA 2F2XA 2KGTA 1WX6A 3EHQA 1ZSGA 2LJ1A 1QCFA 1OEBA 3NMZC 1PKSA 2DM1A 4J9BA 3EG0A 2EW3A 1Z9ZA 2C0IA 1JO8A 4Z89A 4RTZA 2ENMA 2L2PA 5HCKA 1I1JA 2DMOA 1YN8A 2CDTA 2DRKA 2FPFA 4AG2C 1A0NB 4D8DA 2JT4A 1EFNA 2CT3A 2JS2A 4A63B 1VYTA 4AFZC 4WCIA 4OMOA 4RTYA 4Z88A 3REBB 3UA7A 1GL5A 2L3SA 3QWXX 4JZ4A 1BK2A 2NUZA 1UJ0A 2SEMA 2J6FA 2W10A 3VS0A 2DRMA 4FSSA 1WI7A 2RQRA 2J06A 1J3TA 2YDLA 1LCKA 3SEMA 3VS1A 1WDXA 2KT1A 2YUQA 1QLYA 1VYUA 2RPNA 4Z8AA 1PRLC 1E6GA 4J9EA 2F2WA 1JXMA 2BZXA 2XMFA 1M27C 1GCQC 2ROTA 3UA6A 3GBQA 1HSQA 1SRMA 1M3AA 2BTTA 2CH4A 2EYWA 2JXBA 5EC7A 1M8MA 1IO6A 2LP5A 1BU1A 2M0YA 2EGAA 1UFFA 1TG0A 2DJQA 1QWFA 1K0SA 4ESRA 2ED1A 2QDLA 2KYBA 1AWJA 2CUDA 1U06A 1UGVA 2LQNA 2KBTA 2OJ2A 3VS6A 2I0NA 2K3BA 4J9IA 2RMOA 2KNBB 1CKBA 5IHNA 2DILA 3VRZA 1H3HA 2FEIA 2A08A 1GCQA 1WIEA 4LNPA 3I5SA 1H92A 2KROA 1WA7A 2D0NA 1NG2A 5IHKA 1KFZA 1KIKA 3O5ZA 3EG2A 1WXUA 1OPKA 3TSWA 4M4ZA 2V1RA 5IXFA 4RTVA 1WXBA 4AG1C 2JS0A 2C0TA 2FPEA 1I0CA 1VA7A 3EGUA 1GBQA 2IIMA 1M3BA 2KEAA 2LX7A 4AFSC 2B86A 4LN2A 1WLPB 1X2QA 4CC7A 1WFWA 3H41A 2L3QA 3M0QA 4JPBW 4R0KA 4RTTA 4JJBA 2OAWA 2PZ1A 1ZX6A 3VS7A 1NLOC 2EQIA 1OPLA 1YNZA 2FG0A 1B07A 1N5ZA 2ROLA 2DE0X 3UF4A 4J9FA 1YP5A 1JEGA 1Y57A 3REAB 2CUBA 2JTEA 1QWEA 3KFVA 2RQWA 2EBPA 5L23A 2DL8A 1FYNA 3ULRB 2DYBA 3M0PA 1AWWA 1QKWA 2D1XA 1QKXA 2MOXA 3UATA 1V1CA 5IHIA 1K0XA 2J05A 2AZVA 5GJVB 1G83A 2ECZA 1PRMC 1UE9A 2KXCA 2AKKA 4F14A 2D8HA 2DA9A 2YUNA 3A98A 1ZUYA 2H8HA 2KRSA 1X69A 2LNHB
chains in the Genus database with same CATH superfamily
2GQIA 1K8AU 1S72Q 3JV3A 4E6RA 2BE9B 2LCSA 5J26A 1TUCA 2RD1A 4M75B 1NE8A 1M2VA 4HKEA 4XTXA 4M75A 2V8KA 2RHYA 2HKQB 4X9DA 1WHLA 5GAMh 3CC4A 2MAMA 2YUPA 1LNXA 1G3YA 2PVOB 4PLLA 2FZCB 3EG1A 1PD0A 2F69A 1VQ4Q 4PJOB 2KR3A 2AZSA 1K76A 2DL7A 1UGPB 2DFUA 3PNWC 1ABQA 4HVWA 3VU3C 1Y71A 2RK1A 2VC8A 3META 2JVVA 5DY9A 1UEBA 3FLGA 3TVTA 5CCAA 1ZHIA 2D6FA 3CPWS 4X34A 2VVKA 3OYGA 3JCMh 1TUDA 1BI1A 2KYMA 2X9HA 3ASKA 3LLRA 3SWNA 1KK7A 1E6HA 2DF6A 4LUDA 5LL6S 3UDCA 3R6OA 2YLCA 5CQYA 1I8FA 2DXCA 2V8JA 2YRVA 1YITA 3PMIA 2DLPA 1Q7YU 1PSEA 1TH7A 2RI2A 3EH2A 3VRYA 2FZGB 2MIOA 4XTZA 2EQUA 1PC0A 1ZSZB 4FM4B 2HEQA 3LWIA 1S1NA 1G3SA 1SKUB 1T0HA 1YHQQ 5LJ3h 3RMSA 1BIBA 4GY5A 2YXYA 5C6SA 2QTVA 5GAN7 4C0DB 4CC3A 1N8RU 2DBMA 3DLMA 2CH4W 1UJYA 3OYFA 5HY6A 2Z0WA 4JZ3A 2FYKA 4GBQA 3JCMe 4LDUA 4ELZC 3G71A 4HVUA 8ATCB 2E6NA 4PLIA 1PM3A 2MK5A 1WJRA 3MP1A 3EFRA 2FRYA 1G2BA 2KVQG 2DL4A 2GFAA 2XDBA 1BCMA 4C0FA 1Z9QA 3I35A 4QVZA 4PK4A 5CAIA 2O2OA 2MYSA 3KUFA 3JCMQ 5FW9A 1M90C 3CCSQ 4F7UG 1AOJA 3OYHA 4XU0A 1AWOA 4M78G 2KQWA 3GPLA 1Q86C 2QASA 1W2BA 3OBYA 2DZ9A 1KQSP 2OTLA 1XJWB 4IUVA 3HRTA 5LJ3e 4M7DE 2M9UA 4ZTJA 4M7AD 2EJ9A 3OS2A 2LTOA 1X6GA 2K79A 3VS2A 1ZA1B 4HCKA 4C8QG 5GJWB 2LT4A 1QMCA 2HCKA 1W6XA 2GCXA 3CCVT 1HJDA 1TXQA 1VQOA 1ABOA 4LDXA 5ECAA 2RJCA 4A54A 2G6FX 2LJ0A 1IGUA 3URGA 4M7DA 2RA2A 4XU2A 3EG3A 1YI2Q 2EGCA 4JJDA 2HDAA 2HNIA 2JM9A 2VGNA 3E9GA 4FCYA 3CCMQ 4PJOG 3CPWP 5GAOm 3TU4K 4LDWA 1W1FA 2J7IA 2O31A 4BACA 2FZKB 1YJNQ 1X6BA 2XI9A 4Y91A 2E4HA 3I55Q 1WHKA 1XNIA 2CSQA 4HXJA 1M1FA 2ESWA 2LZ6B 5KYWB 1IREB 4KUDK 1QCNA 4M7AF 4RTXA 3CC7T 3EHRA 3TSZA 2L8DA 2PVDB 5CQXA 3NTKA 2LNVA 3QIIA 3I56A 3AT1B 2K2VA 2YUOA 1B3QA 1WXTA 2DL5A 3M4GA 1MMDA 1K4US 1AVZC 3HRSA 1AZEA 2DXBA 2YWWA 1YWPA 2R5MA 4M78D 4XU1A 3CMAA 4C5EA 1MGQA 2LJ1A 4BB7A 1PKSA 2DZCA 3OSVA 5FU7B 3CXCP 2MWPA 2EW3A 3JCMc 3JB9J 1JO8A 4C5GA 4Z89A 4OB1B 3M4YA 1YN8A 2CDTA 5CKHA 4AG2C 2VXEA 3JCMg 3QDFA 1M1GA 1QCOA 1OZ3A 2VUBA 3WXMB 4LXCA 3LGFA 1KQ1A 2JS2A 1N8RR 3QUIA 4O5VA 4AFZC 2YLBA 1Q82U 4M75D 2HL3A 3LWHA 4II1A 4DQ2A 3QWXX 2W10A 3VS0A 4QQGA 4FSSA 4EMHA 2YDLA 3VS1A 2YUQA 3A8LB 4Z8AA 4PJOD 3EFOB 2ZPGB 4E2FB 5GAN2 1E6GA 2F1LA 3EFOA 4D6WA 4J9EA 4FYWB 2RJEA 2BZXA 2OTJT 4ZTFA 2X4WA 5GANf 3JB9I 5LJ3g 3GBQA 2R57A 1SRMA 5FU6C 2EYWA 1B34B 4EMKB 4ZN3A 1NJIU 3RESA 3EAEA 4MZTA 1BU1A 2B8AA 3FIFA 2M0YA 2EGAA 4J6WA 4KBMB 1QWFA 4M77C 4MZPA 1BI3A 2QDLA 2X4JA 1FWZA 1VQ4A 1UGVA 2LQNA 4PJLA 1C0MA 3VS6A 2K3BA 2KNBB 1YITQ 1CKBA 1K73R 5CKEA 3VRZA 3CCQQ 4M75F 4LD6A 3OS5A 1GCQA 3G6ET 5GAN8 1D3BA 3I5SA 3JCMV 1H92A 3H9NA 3SB2A 4EDUA 4HT9A 3EFSA 4C92G 1KIKA 3O5ZA 5A0DA 1OPKA 4RG8A 3OYDA 2V1RA 3HHTB 3OYIA 2MMPA 5CKDA 2VV5A 5J3BA 2VASA 4L6V5 4R56A 1SG5A 2YRCA 5KYNA 3PTAA 4J83A 1M5Q1 2M02A 1K8AC 3ER0A 3SDZA 1NPPA 2QQAA 2EWNA 3M58A 1UB4A 4JPBW 2BUDA 1ZA2B 1N9SA 1NLOC 1QVFP 1KHIA 1VQLT 1OX9A 2VGMA 2DE0X 1YHQA 1YP5A 3CCRT 2CUBA 4QKUA 2EBPA 3KXTA 3CCLT 1VIEA 1QW1A 2HBPA 4NL3A 3CCJT 4B9WA 2DVEA 1VQMA 5LJ5f 4KT0E 1QKXA 2A3LA 3UATA 1K0XA 2JJ9A 5GJVB 1R0CB 2ECZA 2OTLQ 3CCUA 4XK8E 1EIFA 4F14A 2BKDN 1TTHB 1WJSA 2D8HA 3LYIA 3J80E 2DA9A 1RACB 3A98A 2KRSA 4N0AA 2QA4T 4JRIA 3QZ9B 1LJOA 3OSSC 4BE0A 2H3JA 1VQOQ 3CCSA 2DYIA 4ZGEB 1VQ7T 1AWXA 1Q82R 4M7DD 5GAMf 1N27A 3VJPA 4IIMA 2QK0A 4ANJA 3PVQA 4A4HA 2EYXA 2K5LA 2PTKA 3RKYA 3RNJA 1OQKA 2CP6A 4J6YA 1WHMA 1AHJB 1YJ9T 3F70A 1I5OB 3MPUB 2HBWA 1JXOA 2RI3A 1N8RC 1T0JA 4KH0B 1QVPA 4OMQA 2CSIA 2QEXT 2RQUA 2X3WD 1M9SA 3QJ6A 5CIUA 2C06A 2HAXA 3RIRA 1YI2A 1CSKA 2DERA 2E6ZA 4F04B 4K11A 1MV0B 2R58A 2RN8A 5FROA 4P5NA 4B6MA 2YT6A 1ZUKA 3UWNA 1KJWA 4ZGDB 4IIOA 1M90R 4M7DF 1YJNA 1UGQB 3M0TA 4RMOA 1W70A 5GANe 2RQVA 2PVGB 3CMAQ 3I55A 1Q86R 4PNOA 2EAYA 4F7UE 4BE1A 2VYTA 1U5SA 6AT1B 1SEMA 2OI3A 1T3SA 2AT1B 2AKLA 4M78E 3S3MA 2RM4A 1K9MU 3MJXA 3JCMW 4BI4A 3C0CA 4DEXA 2H3EB 4ZN1A 3BW1A 3HP9A 1RLQC 1D09B 1K9AA 2K2MA 3M5AA 3P8HA 2M0OA 3VS3A 2ABLA 1PWTA 4F7UB 1GBRA 3PVLA 4OVAA 3M55A 4C8QE 3OYBA 4F7UA 1YBYA 2JMCA 2CT4A 2RHXA 4E7LA 3H6ZA 4M78A 4QT7A 1JQQA 2W0ZA 5KH6A 3HTRA 5L8RE 4CRIA 4E7IA 2FPDA 3VKIA 4C5HA 3V7SA 5M9OA 1K1ZA 2NUPB 5IH2A 4C8QB 2YSQA 2NUPA 2Y4XA 4C8QA 2A0FB 2RK2A 3VUZA 3WVDB 2Y4YA 1M1KU 4RTWA 4PJOE 2RO0A 4DA4A 1VQ8A 5D6XA 5FRNA 1I4K1 1WQWA 4PFOA 3OYJA 3C12A 1SPKA 2DL3A 5GAOq 2K6DA 3RKWA 2QQ9A 2M51A 3WVEB 2QTXA 2P0PA 5GAN5 2CREA 4D8KA 4JJNK 1G3TA 4F16A 2KMTA 3QXEB 3SHWA 1AEYA 3ME9A 4PJOA 1OOTA 4E7JA 1PKTA 3CC2A 1D0ZA 4A53A 1MUZA 4RUGA 1BI0A 5CO7A 3QHSA 9ATCB 1MMNA 2P4RA 4J7FA 5LJ5e 1HD3A 2EYZA 4F17A 4ZNXA 1VQKA 2KT8A 2FO0A 1ZUUA 2F2VA 2DD4A 4LUEA 3CD6A 1JJ2P 2EGEA 4QVDA 4DBRA 1KC8U 2RNAA 5KYUB 2FL7A 5KYUA 3SD4A 1Y0MA 3CCQA 3MCAB 4KRTA 5FU6B 2O88A 1BIAA 3PGGA 3PMTA 1BB9A 4ELYC 1Q82C 1NYFA 3X25B 4IURA 4M77B 5GAMe 2DEUA 4M77A 3CC7Q 2EVRA 3I56T 3X24B 1ZSZA 1PNJA 4GLMA 4RTUA 3H0IA 1YIJA 1M2OA 2K57A 1RUWA 5DLQE 5GANg 4RCBA 3HKSA 2KRNA 4DBHA 1OV3A 3CBOA 1UECA 3P8DA 4OMNA 4BE2A 2J6KA 4DBQA 2EJFA 3M0UA 4MZMA 1I81A 5J39A 1XTDA 3OW2P 1VQMQ 1WQ7A 1VQ9Q 1QCFA 1OEBA 3NMZC 2K5IA 2DM1A 3EG0A 3S3NA 1Z9ZA 2CZ1B 2C0IA 3CCUQ 3QPHA 3ZFJA 1TOVA 2COWA 2FPFA 2HQHA 1A0NB 1VQNT 1QVGS 3A1PA 3OYCA 1TUGB 3QKJA 3CBPA 3OMGA 2O4XB 5DM7R 3JCMJ 4WCIA 1GL5A 3UA7A 3TREA 1UJ0A 2HQXA 4JUVA 1NBEB 1WI7A 4JRKA 1ACMB 1J3TA 1KD1U 1LCKA 4M7AC 1QLYA 3Q1JA 1FMVA 2DPPB 4C92E 4E7ZA 1NPRA 2RI5A 4O6JA 1EX4A 3J81E 2OTJQ 2XICA 1WJQA 4Y28E 1S72T 4R55A 1RAGB 1FXXA 3UA6A 2ROTA 3NTIA 3EGXB 1K8AR 1R8OB 3JB9G 5LJ3j 3MP8A 3VUBA 3JSCA 3L2RA 1M8MA 4BI3A 1IO6A 1LOJA 2EFIA 5EG2A 2NLUA 4AT1B 4C92B 1TG0A 1DJ7B 2QQRA 4C92A 1I5LA 4ESRA 2QAZA 2M1HA 1Q81U 1U06A 2P84A 2KBTA 4PFPA 2I0NA 4BY6B 3JCMP 4KUIA 5LJ5g 2XHCA 4QQ6A 2K4YA 3OYMA 5IHNA 2LQKA 1H3HA 3FDRA 2A08A 1R0BG 1SF9A 5IN1A 1WA7A 4JS5A 2ATCB 1NG2A 1KQ2A 1OYXA 2E1HA 5IT9E 3N5BB 1OULA 3CMET 2DETA 5KYWA 3OYLA 3OY9A 4AG1C 4MMLA 2JS0A 2C0TA 3EGUA 4OF1A 2KEAA 1M3BA 3HFOA 5GMKm 5GAMg 3MEWA 2E64A 1R77A 1H3ZA 4DOVA 2DK3A 1Q7YR 3H41A 2HZYA 1VQ5T 2L3QA 4JRQA 2ZPEB 2ZCFB 4RTTA 2MF2A 2ZPBB 4M77G 2PZ1A 1QQJA 2QGFB 3MHXA 1YNZA 4OP0A 1N5ZA 2EJGA 1O9SA 3CCRQ 3LW5E 4C8QD 3G4ST 4FL6A 2DL8A 3CCLQ 2DYBA 3M0PA 4L59A 1QKWA 4FW2A 4QQDA 3JB9D 2ZAEA 4M75C 1VQ8Q 5GAOr 1G5VA 5GAOl 1G83A 2QG9B 1WHJA 2KXCA 4KH1B 5CK9A 1JBMA 3QBYA 3QG1A 4L5GA 2YUNA 1RAHB 1WPYA 2YRDA 2QA4Q 1X69A 2LNHB 4DBFA 4F7UF 3C4SA 2WACA 3CC2Q 2MI6A 4M78F 3JAME 1VQ7Q 3G1JA 3NHNA 1B34A 4CC4B 4EMKA 1VQKQ 2GTOA 3SWNC 2L89A 1GCPA 1JU5C 2CP7A 1AT1B 2PUOB 3CD6Q 4XTWA 2LCLA 4C8QF 3M54A 1YJ9Q 1W2BS 2RHZA 3EG9B 2JW4A 3IQLA 1K9MC 2O9VA 2EYQA 2CZ6B 1TS9A 3CCVA 2OX7A 1V76A 4OGCA 5FRMA 3PIOA 2A28A 2QEXQ 4A4GA 5A2QE 4N4IA 1UGRB 4M77D 4J9DA 5GMKh 2E10A 3MO8A 3CCMT 4PJOF 1MNEA 2VXFA 3A8HB 2L3PA 2DX1A 3PFSA 4J9HA 3JCMd 1VQPT 1YIJQ 5FWBA 1PG5B 3RR6A 4C0DC 5AYFA 5GMKi 3PE0A 1T3LA 2V26A 3ZBDA 5KCHA 5CR2A 4EIKA 1VQ6T 3CCET 3M57A 4OB3B 1M1KC 2CP0A 2HKNA 4FIBA 1NLPC 2DNUA 4KGZB 4LDVA 1NM7A 1N9RA 4J9GA 1RAAB 3ZL7C 1RABB 3CBMA 3CC7A 3HRUA 4NL2A 2CKKA 1OI1A 2RF0A 5GAN4 3TEEA 4OMPA 2P4TA 2D8JA 1AZGB 2J6OA 3LH5A 1IHWA 5IAYA 4DEYA 2XDDA 2DBKA 1H8KA 5LJ3d 1X27A 2XDPA 1UHCA 2JZ2A 1KG1A 1UGSB 3V8JA 2MCNA 3VS4A 2FVUA 2HSPA 2EPDA 2COYA 4M77F 3OQ5A 4PL6A 2C0OA 2LT1A 2GGRA 4MMKA 3L2VA 2QQSA 1VQ9A 1KQSA 4TVRA 4AFQC 3EH1A 3BE3A 1CKAA 3TCJA 5A0LA 4ME7A 2LQWA 3M56A 1YJWQ 2VKNA 4ORZA 2E12A 1KSWA 4IUTA 5C0MA 3R6NA 1WHHA 1MV3A 2E5QA 1UHFA 2SRCA 1KC8C 3I9QA 3E2UA 3S6WA 3P8BB 4B9XA 5I21A 2E5KA 2M16A 4J9CA 1Q7YC 4M7DC 1GRIA 4QVCA 2GFUA 3CC4T 3NTHA 2DJZA 1RI0A 1NEBA 3FJ5A 4C92D 1UG1A 2VWFA 3LH0A 3LGLA 4GLKA 3HL8A 2K3YA 3CPWA 1X2KA 2GTJA 3RERA 3H0HA 2OTJA 1LPLA 2GBQA 4N4HA 1MNDA 3BFMA 2QDYB 1W2BP 1Q95G 4CI0C 1NJIR 1D0YA 4M7AB 2KXDA 1VYVA 1ZBJA 3DLLA 3DB4A 3L2WA 4FYVB 4PJNA 5D7UA 1YITT 4IUPA 1I07A 5KCOA 1D1AA 1HK9A 2HQEA 1VIFA 2ED0A 3G6EA 4C92F 2HD0A 3LX7A 3CXCA 2PQWA 4BDZA 3V8KA 1UUEA 1KD1C 3V7CA 2DTOA 1RI9A 2VB6A 1MMGA 5GANj 4EMGA 3U23A 4XU3A 2LJ3A 2NWMA 1M3CA 3CQTA 5IXBA 2RQTA 2V8IA 3OB9A 3M53A 5GAOn 2GQVA 2KGTA 3G71T 3EHQA 1ZSGA 4IUUA 2CZ0B 2EQMA 4J9BA 3QYHB 5CKBA 4RTZA 2ENMA 1VQLA 2QXFA 2AHJB 3H8ZA 4OMFB 3X28B 3M9QA 1VQNQ 4D8DA 3CCRA 3MKDA 2JT4A 1Q81C 3OS0A 3JCMX 1Y96B 3GOXA 2IVWA 3GLXA 3CCLA 1Y96A 3QO3A 5HKCA 3CCJA 4RTYA 3REBB 1U1TA 4JZ4A 4LD9K 2DXUA 2SEMA 2OTLT 2DIGA 1C6VX 1RAFB 2RQRA 1M8VA 4JRPA 4JS4A 4A4EA 5CVIA 3SEMA 1WDXA 2KT1A 2WSFE 3OA6A 2RPNA 1KQSS 1IHVA 3QJYA 2E3IA 2EIFA 2O01E 1IXDA 1JXMA 2QA4A 2XKOC 3FEOA 1VQOT 3CCVQ 1M2VB 4FU6A 1GCQC 1M3AA 2BTTA 2CH4A 1VQ7A 2CGHA 2JXBA 4JLIA 2ZZDA 3L42A 4HT8A 1UFFA 1D1CA 4RG2A 2LX9A 4EPCA 2KYBA 3HPWA 2CUDA 1YJ9A 2OJ2A 4M77E 4J9IA 1PD1A 4PKCC 1OU8A 5LJ5j 2FEIA 3T9NA 1WIEA 4LNPA 2QEXA 3RDVA 1SSFA 2D0NA 4FYXB 1RADB 4BI8B 1JB0E 4FT2A 5D6YA 3SWNB 1H641 3EG2A 3CMEQ 3TSWA 1QVFA 4M7AG 4M4ZA 2NUTB 2P0QA 4RTVA 2NUTA 4FT4A 4E7KA 1WXBA 3UPUA 2FPEA 1VA7A 2CZ7B 2LX7A 5GAOp 2IG0A 2B86A 2RHUA 5GAMj 2CP3A 2KAFA 1WFWA 2JNGA 3CMAT 3MEVA 1VQ5Q 2DO3A 4VUBA 2DKGA 4X9CA 3VYHB 4N4GA 3L1AA 4JJBA 2OAWA 2QYZA 4E7HA 1NJIC 1B07A 2FB7A 1FMWA 3UF4A 4J9FA 3CXCS 3D7SB 4N0AC 1K9MR 3G4SQ 2OAUA 5L23A 2KSSA 1WGSA 3ULRB 3L2QA 2E41A 1AWWA 2LC4A 2D1XA 3QSUA 3JCMb 4WTOB 2MOXA 5I2SA 3O8VA 4OB2B 2O4XA 5IHIA 3TQ7P 2DTIA 2J05A 2AZVA 2JTMA 1YCYA 1PRMC 4E7SA 2AKKA 5HK0A 4V2SA 3OYEA 2ZGWA 1YJWA 3DKMA 2DD5A 1GFCA 1WZOA 2BIVA 4LE9A 5KYXB 3QWYA 4HCZA 5KYXA 3V8LA 3DB3A 1E7OA 1M1KR 2G3RA 2KRMA 5HK3A 2K7AA 3HFNA 3EGXA 1HYOA 4OMMA 1Y07A 5CKFA 2DIQA 3M0RA 2O9SA 1VQ4T 2A36A 1ARKA 2ZPIB 1YFNA 1K73U 1YCSB 3OYNA 5GANd 1GXIE 1RLPC 4KULA 2QQBA 1P92A 4AFUC 3RKXA 3OMCA 2L0AA 2A37A 4M7DB 4M75G 2XG8D 1FX7A 4J8OA 3G6EQ 1WYXA 3S3OA 3L2ZA 4A4KA 4ZGJB 1U3OA 4UC4A 1NZ9A 1X75C 2K3XA 2CP5A 2ZPHB 1C1AA 2JTFA 2PNIA 1JRIA 1NYGA 1SSHA 4OGEA 1ZBXA 3NGPA 8AT1B 1VQPQ 1BI2A 1XOVA 2KDSA 5A0GA 1MHNA 4XTVA 5KE3A 1BCOA 1M30A 2RJFA 1UDLA 3M59A 4X1VA 1TU0B 3C95A 1KC8R 4JJCA 3RBBB 1VQ6Q 3V7RA 3CCEQ 4FSXA 1U1SA 4PFZA 4M78C 1PCXA 2RH2A 2KE9A 2XIDA 3BY7A 1YHQT 4FYYB 1VQLQ 2QGGA 3JB9H 1IRXA 2X35A 1QVFS 2WSEE 2PUKB 4BDYA 2AK5A 2LDMA 3THKA 4C8QC 2LMJA 2DVJA 2DEQA 4HVVA 1OU9A 1XQHA 1VQMT 1O75A 3HSBA 3CCJQ 3CPFA 3GF5A 5I22A 1VQ9T 4CC2A 1WNLA 4Y92A 1AD5A 3L2UA 1SHFA 1EZZB 2V1QA 3AHUA 3CCUT 1QVGP 2E70A 3NPFA 2EKOA 1VOMA 2MWOA 4WF2A 1X01A 4PJOC 1VQNA 3VS5A 5LJ5d 1U8RA 1SHGA 5GAN3 3A8MB 3CCST 4QW2A 2E3HA 2FRWA 3A8GB 2GNCA 3M0SA 1NEGA 2LRQA 4JDSA 2WSCE 4NS5A 5KYYB 3CC4Q 1PHTA 5GAN6 2EYYA 5KYYA 2EKHA 1MMAA 1M4ZA 4XTUA 4DOWA 1F1BB 1UTIA 5GMKl 3MP6A 1JJ2A 3VYGA 3PIPA 1KD1R 2HL5C 3E19A 2YHTA 3EG9A 5GAMd 2JUFA 3C94A 1S72A 3X20B 2IPOB 5I11A 3JB9F 1Y7XA 1SRLA 1ZQ1A 3X26B 1G8XA 5AT1B 2BZ8A 4IKFA 1KHCA 1GFDA 1YI2T 1IB8A 1ZSZC 2JM8A 2LQ8A 4ATOA 1YWOA 2X3XD 3A5ZB 2HMAA 2CS7A 1M90U 1Q81R 1RL2A 1BBZA 4HCCA 1N6AA 1PSFA 1LVKA 1ZLMA 1D3BB 3QDRB 2GF7A 1YJNT 1Q86U 3OW2A 4M7DG 4RCCA 1D0XA 2CYZB 3I55T 2JOYA 3MEUA 1FMKA 4NOYA 3KBGA 5FLXE 3H0FA 3CMEA 2NYSA 5FWCA 2DXTA 2D0QB 3UT1A 3I5RA 2QI2A 1X6OA 2DTHA 4FW1A 4OMLA 3VV0A 2BZYA 2CP2A 1BYMA 1IGQA 4J5YA 4PJMA 2K9GA 2JMAA 1X43A 2F2XA 3G71Q 3E1SA 1WX6A 1VQ5A 2XK0A 4LDYA 5GMKe 1W4SA 3J7AF 2EQJA 2L2PA 5HCKA 1I1JA 2DMOA 3QZ5B 2DRKA 4AMCA 1IZ6A 3SFMA 4C0GA 1EFNA 2CT3A 2HSEB 3EGDB 3G4SA 3EGDA 4J7IA 4A63B 3FB9A 1VYTA 2LCCA 3FRNA 5GMKj 2MPXC 3G7ZA 2X51A 1VQ8T 4OMOA 4Z88A 2L3SA 1BK2A 2NUZA 4YTLA 4RKUE 4XQ3A 2J6FA 2KI7A 4Z02A 4A4FA 4E47A 2DRMA 2J06A 2D9TA 4C92C 1G3WA 3A8OB 1VYUA 1PRLC 3GNGA 2LVMA 3GNFB 2F2WA 3BDLA 2AIRB 1VUBA 4BY6C 4M7AE 3CC2T 3OBWA 3RMQA 2XMFA 1M27C 1QP2A 2KY9A 1HXDA 1HSQA 5GANh 3OS1A 3PT9A 3RUXA 5KE2A 2A7YA 5EC7A 2LP5A 1VQKT 2I2LA 2DJQA 3CD6T 1K0SA 3INZA 1RAIB 2ED1A 1TSFA 3GP8A 1AWJA 4M7AA 2RB6A 4HCBA 2XU8A 2E65A 2RMOA 2Y90A 1JJ2S 4MDXA 4OB0B 3OYKA 4IUQA 2DILA 2KK4A 3E9FA 3CCQT 3JCMf 3JRZA 1RAEB 4XAXB 2KROA 2X4XA 2R5AA 1TWBA 3QYGB 5IHKA 1KFZA 2K5FA 1WXUA 5FU7C 4PJJA 2JN0A 3I56Q 3CCMA 5IXFA 3OYAA 3MEAA 1YIJT 2EQKA 1VQPA 3NFCA 1D1BA 1I0CA 2PU9B 1GBQA 2IIMA 4C0ZA 3OYYA 4AFSC 4C5IA 5DLOA 2L3RA 4BUGA 4LN2A 2FHDA 2L5QA 1WLPB 2RJDA 2F5KA 1X2QA 4CC7A 1VQ6A 3CCEA 1BKBA 2P0KA 4J6XA 3M0QA 5LJ3f 1QVGA 4R0KA 2XD0A 3OW2S 1ZX6A 3VS7A 2EQIA 1OPLA 2FG0A 3BDUA 2ROLA 4Q5WA 1JEGA 1Y57A 1QP3A 3REAB 7AT1B 2JTEA 1QWEA 3KFVA 1K73C 2RQWA 1FYNA 2BE7D 5I2MA 1OZ2A 1OX8A 3GIBA 4M78B 4MDWA 4BD3A 1V1CA 5LJ5h 1WHGA 4EMKC 2DAQA 4XTYA 4JLGA 3ZEHA 4M75E 4KGXB 1UE9A 1B7TA 5D6WA 1YJWT 2ZPFB 3FC3A 4KGVB 4HA8A 3FJPA 2X4YA 3CEYA 2F5TX 1ZUYA 2COZA 2H8HA 1V29B 2RHIA
chains in the Genus database with same CATH topology
2GQIA 1GFCA 3JV3A 4LE9A 4E6RA 2LCSA 3QWYA 1TUCA 1E7OA 1AWXA 2KRMA 2K7AA 4IIMA 3NHNA 3PVQA 2YUPA 4OMMA 4CC4B 2GTOA 2EYXA 2PTKA 3EG1A 1GCPA 1JU5C 3M0RA 3RNJA 2O9SA 2A36A 2KR3A 1ARKA 2AZSA 1K76A 1YCSB 2DL7A 2JW4A 1RLPC 3IQLA 2HBWA 1JXOA 1ABQA 2O9VA 4HVWA 4AFUC 2L0AA 1T0JA 2A37A 3TVTA 2A28A 4OMQA 2CSIA 2VVKA 2RQUA 1WYXA 1TUDA 2X3WD 1U3OA 2KYMA 4J9DA 1E6HA 1CSKA 2DF6A 2PNIA 1NYGA 1SSHA 4K11A 1MV0B 2L3PA 4LUDA 2DX1A 2RN8A 3NGPA 4J9HA 1XOVA 5FWBA 1M30A 1UDLA 2YT6A 1ZUKA 2DLPA 4X1VA 3PE0A 1KJWA 1T3LA 4JJCA 4IIOA 4EIKA 3RBBB 3M0TA 1W70A 3VRYA 2RQVA 1NLPC 2DNUA 2MIOA 1NM7A 1U5SA 2KE9A 1SEMA 2HEQA 1T3SA 2OI3A 1S1NA 4J9GA 3ZL7C 1T0HA 2AKLA 2RF0A 4OMPA 3C0CA 4DEXA 2D8JA 1AZGB 2J6OA 1RLQC 2AK5A 3THKA 4CC3A 1K9AA 2DBMA 2K2MA 2LMJA 3LH5A 3VS3A 2DVJA 4HVVA 4DEYA 2CH4W 2DBKA 2ABLA 1H8KA 1X27A 1PWTA 1UJYA 1UHCA 1GBRA 3PVLA 4JZ3A 4GBQA 2MCNA 2HSPA 3VS4A 5I22A 2EPDA 2JMCA 4CC2A 2CT4A 2C0OA 4HVUA 2GGRA 4Y92A 1AD5A 4QT7A 1JQQA 2W0ZA 1SHFA 2V1QA 4AFQC 1CKAA 2FRYA 1G2BA 3NPFA 2DL4A 2FPDA 2LQWA 2VKNA 1Z9QA 4ORZA 3I35A 1K1ZA 1KSWA 5IH2A 3VS5A 3R6NA 2O2OA 2YSQA 1SHGA 1MV3A 1UHFA 2SRCA 5FW9A 3I9QA 4RTWA 2E5KA 1AOJA 4J9CA 2FRWA 1AWOA 1GRIA 1SPKA 2GNCA 3M0SA 1NEGA 2DL3A 2K6DA 1PHTA 2EYYA 2M51A 2EKHA 1NEBA 3FJ5A 1UTIA 1UG1A 2VWFA 2CREA 4D8KA 1X6GA 2K79A 3VS2A 4F16A 1AEYA 1X2KA 3SHWA 4HCKA 5GJWB 2HCKA 1OOTA 1W6XA 1HJDA 2GTJA 3H0HA 1PKTA 1ABOA 5ECAA 5I11A 1MUZA 1SRLA 2GBQA 4RUGA 2G6FX 2LJ0A 2BZ8A 2P4RA 1HD3A 2EYZA 4F17A 1GFDA 4ZNXA 3EG3A 2KT8A 2FO0A 1ZUUA 2EGCA 2F2VA 4JJDA 4LUEA 2HDAA 2JM9A 2KXDA 1VYVA 2JM8A 1ZBJA 2EGEA 1YWOA 2X3XD 2RNAA 1W1FA 2J7IA 1BBZA 1I07A 1ZLMA 2O31A 1Y0MA 4KRTA 1X6BA 2O88A 2ED0A 1BB9A 2CSQA 1NYFA 1FMKA 4HXJA 2ESWA 2LZ6B 4RTXA 3EHRA 3H0FA 2EVRA 3TSZA 5FWCA 3I5RA 1UUEA 1PNJA 4GLMA 4OMLA 4RTUA 3H0IA 2BZYA 1RUWA 1RI9A 2YUOA 1B3QA 1WXTA 2KRNA 2DL5A 1OV3A 1UECA 3U23A 1K4US 2LJ3A 2NWMA 1AVZC 1M3CA 3CQTA 4OMNA 1AZEA 2J6KA 2K9GA 1YWPA 2JMAA 2RQTA 3M0UA 1X43A 5IXBA 2F2XA 2KGTA 1WX6A 3EHQA 1ZSGA 2LJ1A 1QCFA 1OEBA 3NMZC 1PKSA 2DM1A 4J9BA 3EG0A 2EW3A 1Z9ZA 2C0IA 1JO8A 4Z89A 4RTZA 2ENMA 2L2PA 5HCKA 1I1JA 2DMOA 1YN8A 2CDTA 2DRKA 2FPFA 4AG2C 1A0NB 4D8DA 2JT4A 1EFNA 2CT3A 2JS2A 4A63B 1VYTA 4AFZC 4WCIA 4OMOA 4RTYA 4Z88A 3REBB 3UA7A 1GL5A 2L3SA 3QWXX 4JZ4A 1BK2A 2NUZA 1UJ0A 2SEMA 2J6FA 2W10A 3VS0A 2DRMA 4FSSA 1WI7A 2RQRA 2J06A 1J3TA 2YDLA 1LCKA 3SEMA 3VS1A 1WDXA 2KT1A 2YUQA 1QLYA 1VYUA 2RPNA 4Z8AA 1PRLC 1E6GA 4J9EA 2F2WA 1JXMA 2BZXA 2XMFA 1M27C 1GCQC 2ROTA 3UA6A 3GBQA 1HSQA 1SRMA 1M3AA 2BTTA 2CH4A 2EYWA 2JXBA 5EC7A 1M8MA 1IO6A 2LP5A 1BU1A 2M0YA 2EGAA 1UFFA 1TG0A 2DJQA 1QWFA 1K0SA 4ESRA 2ED1A 2QDLA 2KYBA 1AWJA 2CUDA 1U06A 1UGVA 2LQNA 2KBTA 2OJ2A 3VS6A 2I0NA 2K3BA 4J9IA 2RMOA 2KNBB 1CKBA 5IHNA 2DILA 3VRZA 1H3HA 2FEIA 2A08A 1GCQA 1WIEA 4LNPA 3I5SA 1H92A 2KROA 1WA7A 2D0NA 1NG2A 5IHKA 1KFZA 1KIKA 3O5ZA 3EG2A 1WXUA 1OPKA 3TSWA 4M4ZA 2V1RA 5IXFA 4RTVA 1WXBA 4AG1C 2JS0A 2C0TA 2FPEA 1I0CA 1VA7A 3EGUA 1GBQA 2IIMA 1M3BA 2KEAA 2LX7A 4AFSC 2B86A 4LN2A 1WLPB 1X2QA 4CC7A 1WFWA 3H41A 2L3QA 3M0QA 4JPBW 4R0KA 4RTTA 4JJBA 2OAWA 2PZ1A 1ZX6A 3VS7A 1NLOC 2EQIA 1OPLA 1YNZA 2FG0A 1B07A 1N5ZA 2ROLA 2DE0X 3UF4A 4J9FA 1YP5A 1JEGA 1Y57A 3REAB 2CUBA 2JTEA 1QWEA 3KFVA 2RQWA 2EBPA 5L23A 2DL8A 1FYNA 3ULRB 2DYBA 3M0PA 1AWWA 1QKWA 2D1XA 1QKXA 2MOXA 3UATA 1V1CA 5IHIA 1K0XA 2J05A 2AZVA 5GJVB 1G83A 2ECZA 1PRMC 1UE9A 2KXCA 2AKKA 4F14A 2D8HA 2DA9A 2YUNA 3A98A 1ZUYA 2H8HA 2KRSA 1X69A 2LNHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQI A;  1GFC A;  3JV3 A;  4LE9 A;  4E6R A;  2LCS A;  3QWY A;  1TUC A;  1E7O A;  1AWX A;  2KRM A;  2K7A A;  4IIM A;  3NHN A;  3PVQ A;  2YUP A;  4OMM A;  4CC4 B;  2GTO A;  2EYX A;  2PTK A;  3EG1 A;  1GCP A;  1JU5 C;  3M0R A;  3RNJ A;  2O9S A;  2A36 A;  2KR3 A;  1ARK A;  2AZS A;  1K76 A;  1YCS B;  2DL7 A;  2JW4 A;  1RLP C;  3IQL A;  2HBW A;  1JXO A;  1ABQ A;  2O9V A;  4HVW A;  4AFU C;  2L0A A;  1T0J A;  2A37 A;  3TVT A;  2A28 A;  4OMQ A;  2CSI A;  2VVK A;  2RQU A;  1WYX A;  1TUD A;  2X3W D;  1U3O A;  2KYM A;  4J9D A;  1E6H A;  1CSK A;  2DF6 A;  2PNI A;  1NYG A;  1SSH A;  4K11 A;  1MV0 B;  2L3P A;  4LUD A;  2DX1 A;  2RN8 A;  3NGP A;  4J9H A;  1XOV A;  5FWB A;  1M30 A;  1UDL A;  2YT6 A;  1ZUK A;  2DLP A;  4X1V A;  3PE0 A;  1KJW A;  1T3L A;  4JJC A;  4IIO A;  4EIK A;  3RBB B;  3M0T A;  1W70 A;  3VRY A;  2RQV A;  1NLP C;  2DNU A;  2MIO A;  1NM7 A;  1U5S A;  2KE9 A;  1SEM A;  2HEQ A;  1T3S A;  2OI3 A;  1S1N A;  4J9G A;  3ZL7 C;  1T0H A;  2AKL A;  2RF0 A;  4OMP A;  3C0C A;  4DEX A;  2D8J A;  1AZG B;  2J6O A;  1RLQ C;  2AK5 A;  3THK A;  4CC3 A;  1K9A A;  2DBM A;  2K2M A;  2LMJ A;  3LH5 A;  3VS3 A;  2DVJ A;  4HVV A;  4DEY A;  2CH4 W;  2DBK A;  2ABL A;  1H8K A;  1X27 A;  1PWT A;  1UJY A;  1UHC A;  1GBR A;  3PVL A;  4JZ3 A;  4GBQ A;  2MCN A;  2HSP A;  3VS4 A;  5I22 A;  2EPD A;  2JMC A;  4CC2 A;  2CT4 A;  2C0O A;  4HVU A;  2GGR A;  4Y92 A;  1AD5 A;  4QT7 A;  1JQQ A;  2W0Z A;  1SHF A;  2V1Q A;  4AFQ C;  1CKA A;  2FRY A;  1G2B A;  3NPF A;  2DL4 A;  2FPD A;  2LQW A;  2VKN A;  1Z9Q A;  4ORZ A;  3I35 A;  1K1Z A;  1KSW A;  5IH2 A;  3VS5 A;  3R6N A;  2O2O A;  2YSQ A;  1SHG A;  1MV3 A;  1UHF A;  2SRC A;  5FW9 A;  3I9Q A;  4RTW A;  2E5K A;  1AOJ A;  4J9C A;  2FRW A;  1AWO A;  1GRI A;  1SPK A;  2GNC A;  3M0S A;  1NEG A;  2DL3 A;  2K6D A;  1PHT A;  2EYY A;  2M51 A;  2EKH A;  1NEB A;  3FJ5 A;  1UTI A;  1UG1 A;  2VWF A;  2CRE A;  4D8K A;  1X6G A;  2K79 A;  3VS2 A;  4F16 A;  1AEY A;  1X2K A;  3SHW A;  4HCK A;  5GJW B;  2HCK A;  1OOT A;  1W6X A;  1HJD A;  2GTJ A;  3H0H A;  1PKT A;  1ABO A;  5ECA A;  5I11 A;  1MUZ A;  1SRL A;  2GBQ A;  4RUG A;  2G6F X;  2LJ0 A;  2BZ8 A;  2P4R A;  1HD3 A;  2EYZ A;  4F17 A;  1GFD A;  4ZNX A;  3EG3 A;  2KT8 A;  2FO0 A;  1ZUU A;  2EGC A;  2F2V A;  4JJD A;  4LUE A;  2HDA A;  2JM9 A;  2KXD A;  1VYV A;  2JM8 A;  1ZBJ A;  2EGE A;  1YWO A;  2X3X D;  2RNA A;  1W1F A;  2J7I A;  1BBZ A;  1I07 A;  1ZLM A;  2O31 A;  1Y0M A;  4KRT A;  1X6B A;  2O88 A;  2ED0 A;  1BB9 A;  2CSQ A;  1NYF A;  1FMK A;  4HXJ A;  2ESW A;  2LZ6 B;  4RTX A;  3EHR A;  3H0F A;  2EVR A;  3TSZ A;  5FWC A;  3I5R A;  1UUE A;  1PNJ A;  4GLM A;  4OML A;  4RTU A;  3H0I A;  2BZY A;  1RUW A;  1RI9 A;  2YUO A;  1B3Q A;  1WXT A;  2KRN A;  2DL5 A;  1OV3 A;  1UEC A;  3U23 A;  1K4U S;  2LJ3 A;  2NWM A;  1AVZ C;  1M3C A;  3CQT A;  4OMN A;  1AZE A;  2J6K A;  2K9G A;  1YWP A;  2JMA A;  2RQT A;  3M0U A;  1X43 A;  5IXB A;  2F2X A;  2KGT A;  1WX6 A;  3EHQ A;  1ZSG A;  2LJ1 A;  1QCF A;  1OEB A;  3NMZ C;  1PKS A;  2DM1 A;  4J9B A;  3EG0 A;  2EW3 A;  1Z9Z A;  2C0I A;  1JO8 A;  4Z89 A;  4RTZ A;  2ENM A;  2L2P A;  5HCK A;  1I1J A;  2DMO A;  1YN8 A;  2CDT A;  2DRK A;  2FPF A;  4AG2 C;  1A0N B;  4D8D A;  2JT4 A;  1EFN A;  2CT3 A;  2JS2 A;  4A63 B;  1VYT A;  4AFZ C;  4WCI A;  4OMO A;  4RTY A;  4Z88 A;  3REB B;  3UA7 A;  1GL5 A;  2L3S A;  3QWX X;  4JZ4 A;  1BK2 A;  2NUZ A;  1UJ0 A;  2SEM A;  2J6F A;  2W10 A;  3VS0 A;  2DRM A;  4FSS A;  1WI7 A;  2RQR A;  2J06 A;  1J3T A;  2YDL A;  1LCK A;  3SEM A;  3VS1 A;  1WDX A;  2KT1 A;  2YUQ A;  1QLY A;  1VYU A;  2RPN A;  4Z8A A;  1PRL C;  1E6G A;  4J9E A;  2F2W A;  1JXM A;  2BZX A;  2XMF A;  1M27 C;  1GCQ C;  2ROT A;  3UA6 A;  3GBQ A;  1HSQ A;  1SRM A;  1M3A A;  2BTT A;  2CH4 A;  2EYW A;  2JXB A;  5EC7 A;  1M8M A;  1IO6 A;  2LP5 A;  1BU1 A;  2M0Y A;  2EGA A;  1UFF A;  1TG0 A;  2DJQ A;  1QWF A;  1K0S A;  4ESR A;  2ED1 A;  2QDL A;  2KYB A;  1AWJ A;  2CUD A;  1U06 A;  1UGV A;  2LQN A;  2KBT A;  2OJ2 A;  3VS6 A;  2I0N A;  2K3B A;  4J9I A;  2RMO A;  2KNB B;  1CKB A;  5IHN A;  2DIL A;  3VRZ A;  1H3H A;  2FEI A;  2A08 A;  1GCQ A;  1WIE A;  4LNP A;  3I5S A;  1H92 A;  2KRO A;  1WA7 A;  2D0N A;  1NG2 A;  5IHK A;  1KFZ A;  1KIK A;  3O5Z A;  3EG2 A;  1WXU A;  1OPK A;  3TSW A;  4M4Z A;  2V1R A;  5IXF A;  4RTV A;  1WXB A;  4AG1 C;  2JS0 A;  2C0T A;  2FPE A;  1I0C A;  1VA7 A;  3EGU A;  1GBQ A;  2IIM A;  1M3B A;  2KEA A;  2LX7 A;  4AFS C;  2B86 A;  4LN2 A;  1WLP B;  1X2Q A;  4CC7 A;  1WFW A;  3H41 A;  2L3Q A;  3M0Q A;  4JPB W;  4R0K A;  4RTT A;  4JJB A;  2OAW A;  2PZ1 A;  1ZX6 A;  3VS7 A;  1NLO C;  2EQI A;  1OPL A;  1YNZ A;  2FG0 A;  1B07 A;  1N5Z A;  2ROL A;  2DE0 X;  3UF4 A;  4J9F A;  1YP5 A;  1JEG A;  1Y57 A;  3REA B;  2CUB A;  2JTE A;  1QWE A;  3KFV A;  2RQW A;  2EBP A;  5L23 A;  2DL8 A;  1FYN A;  3ULR B;  2DYB A;  3M0P A;  1AWW A;  1QKW A;  2D1X A;  1QKX A;  2MOX A;  3UAT A;  1V1C A;  5IHI A;  1K0X A;  2J05 A;  2AZV A;  5GJV B;  1G83 A;  2ECZ A;  1PRM C;  1UE9 A;  2KXC A;  2AKK A;  4F14 A;  2D8H A;  2DA9 A;  2YUN A;  3A98 A;  1ZUY A;  2H8H A;  2KRS A;  1X69 A;  2LNH B; 
#chains in the Genus database with same CATH topology
 2GQI A;  1K8A U;  1S72 Q;  3JV3 A;  4E6R A;  2BE9 B;  2LCS A;  5J26 A;  1TUC A;  2RD1 A;  4M75 B;  1NE8 A;  1M2V A;  4HKE A;  4XTX A;  4M75 A;  2V8K A;  2RHY A;  2HKQ B;  4X9D A;  1WHL A;  5GAM h;  3CC4 A;  2MAM A;  2YUP A;  1LNX A;  1G3Y A;  2PVO B;  4PLL A;  2FZC B;  3EG1 A;  1PD0 A;  2F69 A;  1VQ4 Q;  4PJO B;  2KR3 A;  2AZS A;  1K76 A;  2DL7 A;  1UGP B;  2DFU A;  3PNW C;  1ABQ A;  4HVW A;  3VU3 C;  1Y71 A;  2RK1 A;  2VC8 A;  3MET A;  2JVV A;  5DY9 A;  1UEB A;  3FLG A;  3TVT A;  5CCA A;  1ZHI A;  2D6F A;  3CPW S;  4X34 A;  2VVK A;  3OYG A;  3JCM h;  1TUD A;  1BI1 A;  2KYM A;  2X9H A;  3ASK A;  3LLR A;  3SWN A;  1KK7 A;  1E6H A;  2DF6 A;  4LUD A;  5LL6 S;  3UDC A;  3R6O A;  2YLC A;  5CQY A;  1I8F A;  2DXC A;  2V8J A;  2YRV A;  1YIT A;  3PMI A;  2DLP A;  1Q7Y U;  1PSE A;  1TH7 A;  2RI2 A;  3EH2 A;  3VRY A;  2FZG B;  2MIO A;  4XTZ A;  2EQU A;  1PC0 A;  1ZSZ B;  4FM4 B;  2HEQ A;  3LWI A;  1S1N A;  1G3S A;  1SKU B;  1T0H A;  1YHQ Q;  5LJ3 h;  3RMS A;  1BIB A;  4GY5 A;  2YXY A;  5C6S A;  2QTV A;  5GAN 7;  4C0D B;  4CC3 A;  1N8R U;  2DBM A;  3DLM A;  2CH4 W;  1UJY A;  3OYF A;  5HY6 A;  2Z0W A;  4JZ3 A;  2FYK A;  4GBQ A;  3JCM e;  4LDU A;  4ELZ C;  3G71 A;  4HVU A;  8ATC B;  2E6N A;  4PLI A;  1PM3 A;  2MK5 A;  1WJR A;  3MP1 A;  3EFR A;  2FRY A;  1G2B A;  2KVQ G;  2DL4 A;  2GFA A;  2XDB A;  1BCM A;  4C0F A;  1Z9Q A;  3I35 A;  4QVZ A;  4PK4 A;  5CAI A;  2O2O A;  2MYS A;  3KUF A;  3JCM Q;  5FW9 A;  1M90 C;  3CCS Q;  4F7U G;  1AOJ A;  3OYH A;  4XU0 A;  1AWO A;  4M78 G;  2KQW A;  3GPL A;  1Q86 C;  2QAS A;  1W2B A;  3OBY A;  2DZ9 A;  1KQS P;  2OTL A;  1XJW B;  4IUV A;  3HRT A;  5LJ3 e;  4M7D E;  2M9U A;  4ZTJ A;  4M7A D;  2EJ9 A;  3OS2 A;  2LTO A;  1X6G A;  2K79 A;  3VS2 A;  1ZA1 B;  4HCK A;  4C8Q G;  5GJW B;  2LT4 A;  1QMC A;  2HCK A;  1W6X A;  2GCX A;  3CCV T;  1HJD A;  1TXQ A;  1VQO A;  1ABO A;  4LDX A;  5ECA A;  2RJC A;  4A54 A;  2G6F X;  2LJ0 A;  1IGU A;  3URG A;  4M7D A;  2RA2 A;  4XU2 A;  3EG3 A;  1YI2 Q;  2EGC A;  4JJD A;  2HDA A;  2HNI A;  2JM9 A;  2VGN A;  3E9G A;  4FCY A;  3CCM Q;  4PJO G;  3CPW P;  5GAO m;  3TU4 K;  4LDW A;  1W1F A;  2J7I A;  2O31 A;  4BAC A;  2FZK B;  1YJN Q;  1X6B A;  2XI9 A;  4Y91 A;  2E4H A;  3I55 Q;  1WHK A;  1XNI A;  2CSQ A;  4HXJ A;  1M1F A;  2ESW A;  2LZ6 B;  5KYW B;  1IRE B;  4KUD K;  1QCN A;  4M7A F;  4RTX A;  3CC7 T;  3EHR A;  3TSZ A;  2L8D A;  2PVD B;  5CQX A;  3NTK A;  2LNV A;  3QII A;  3I56 A;  3AT1 B;  2K2V A;  2YUO A;  1B3Q A;  1WXT A;  2DL5 A;  3M4G A;  1MMD A;  1K4U S;  1AVZ C;  3HRS A;  1AZE A;  2DXB A;  2YWW A;  1YWP A;  2R5M A;  4M78 D;  4XU1 A;  3CMA A;  4C5E A;  1MGQ A;  2LJ1 A;  4BB7 A;  1PKS A;  2DZC A;  3OSV A;  5FU7 B;  3CXC P;  2MWP A;  2EW3 A;  3JCM c;  3JB9 J;  1JO8 A;  4C5G A;  4Z89 A;  4OB1 B;  3M4Y A;  1YN8 A;  2CDT A;  5CKH A;  4AG2 C;  2VXE A;  3JCM g;  3QDF A;  1M1G A;  1QCO A;  1OZ3 A;  2VUB A;  3WXM B;  4LXC A;  3LGF A;  1KQ1 A;  2JS2 A;  1N8R R;  3QUI A;  4O5V A;  4AFZ C;  2YLB A;  1Q82 U;  4M75 D;  2HL3 A;  3LWH A;  4II1 A;  4DQ2 A;  3QWX X;  2W10 A;  3VS0 A;  4QQG A;  4FSS A;  4EMH A;  2YDL A;  3VS1 A;  2YUQ A;  3A8L B;  4Z8A A;  4PJO D;  3EFO B;  2ZPG B;  4E2F B;  5GAN 2;  1E6G A;  2F1L A;  3EFO A;  4D6W A;  4J9E A;  4FYW B;  2RJE A;  2BZX A;  2OTJ T;  4ZTF A;  2X4W A;  5GAN f;  3JB9 I;  5LJ3 g;  3GBQ A;  2R57 A;  1SRM A;  5FU6 C;  2EYW A;  1B34 B;  4EMK B;  4ZN3 A;  1NJI U;  3RES A;  3EAE A;  4MZT A;  1BU1 A;  2B8A A;  3FIF A;  2M0Y A;  2EGA A;  4J6W A;  4KBM B;  1QWF A;  4M77 C;  4MZP A;  1BI3 A;  2QDL A;  2X4J A;  1FWZ A;  1VQ4 A;  1UGV A;  2LQN A;  4PJL A;  1C0M A;  3VS6 A;  2K3B A;  2KNB B;  1YIT Q;  1CKB A;  1K73 R;  5CKE A;  3VRZ A;  3CCQ Q;  4M75 F;  4LD6 A;  3OS5 A;  1GCQ A;  3G6E T;  5GAN 8;  1D3B A;  3I5S A;  3JCM V;  1H92 A;  3H9N A;  3SB2 A;  4EDU A;  4HT9 A;  3EFS A;  4C92 G;  1KIK A;  3O5Z A;  5A0D A;  1OPK A;  4RG8 A;  3OYD A;  2V1R A;  3HHT B;  3OYI A;  2MMP A;  5CKD A;  2VV5 A;  5J3B A;  2VAS A;  4L6V 5;  4R56 A;  1SG5 A;  2YRC A;  5KYN A;  3PTA A;  4J83 A;  1M5Q 1;  2M02 A;  1K8A C;  3ER0 A;  3SDZ A;  1NPP A;  2QQA A;  2EWN A;  3M58 A;  1UB4 A;  4JPB W;  2BUD A;  1ZA2 B;  1N9S A;  1NLO C;  1QVF P;  1KHI A;  1VQL T;  1OX9 A;  2VGM A;  2DE0 X;  1YHQ A;  1YP5 A;  3CCR T;  2CUB A;  4QKU A;  2EBP A;  3KXT A;  3CCL T;  1VIE A;  1QW1 A;  2HBP A;  4NL3 A;  3CCJ T;  4B9W A;  2DVE A;  1VQM A;  5LJ5 f;  4KT0 E;  1QKX A;  2A3L A;  3UAT A;  1K0X A;  2JJ9 A;  5GJV B;  1R0C B;  2ECZ A;  2OTL Q;  3CCU A;  4XK8 E;  1EIF A;  4F14 A;  2BKD N;  1TTH B;  1WJS A;  2D8H A;  3LYI A;  3J80 E;  2DA9 A;  1RAC B;  3A98 A;  2KRS A;  4N0A A;  2QA4 T;  4JRI A;  3QZ9 B;  1LJO A;  3OSS C;  4BE0 A;  2H3J A;  1VQO Q;  3CCS A;  2DYI A;  4ZGE B;  1VQ7 T;  1AWX A;  1Q82 R;  4M7D D;  5GAM f;  1N27 A;  3VJP A;  4IIM A;  2QK0 A;  4ANJ A;  3PVQ A;  4A4H A;  2EYX A;  2K5L A;  2PTK A;  3RKY A;  3RNJ A;  1OQK A;  2CP6 A;  4J6Y A;  1WHM A;  1AHJ B;  1YJ9 T;  3F70 A;  1I5O B;  3MPU B;  2HBW A;  1JXO A;  2RI3 A;  1N8R C;  1T0J A;  4KH0 B;  1QVP A;  4OMQ A;  2CSI A;  2QEX T;  2RQU A;  2X3W D;  1M9S A;  3QJ6 A;  5CIU A;  2C06 A;  2HAX A;  3RIR A;  1YI2 A;  1CSK A;  2DER A;  2E6Z A;  4F04 B;  4K11 A;  1MV0 B;  2R58 A;  2RN8 A;  5FRO A;  4P5N A;  4B6M A;  2YT6 A;  1ZUK A;  3UWN A;  1KJW A;  4ZGD B;  4IIO A;  1M90 R;  4M7D F;  1YJN A;  1UGQ B;  3M0T A;  4RMO A;  1W70 A;  5GAN e;  2RQV A;  2PVG B;  3CMA Q;  3I55 A;  1Q86 R;  4PNO A;  2EAY A;  4F7U E;  4BE1 A;  2VYT A;  1U5S A;  6AT1 B;  1SEM A;  2OI3 A;  1T3S A;  2AT1 B;  2AKL A;  4M78 E;  3S3M A;  2RM4 A;  1K9M U;  3MJX A;  3JCM W;  4BI4 A;  3C0C A;  4DEX A;  2H3E B;  4ZN1 A;  3BW1 A;  3HP9 A;  1RLQ C;  1D09 B;  1K9A A;  2K2M A;  3M5A A;  3P8H A;  2M0O A;  3VS3 A;  2ABL A;  1PWT A;  4F7U B;  1GBR A;  3PVL A;  4OVA A;  3M55 A;  4C8Q E;  3OYB A;  4F7U A;  1YBY A;  2JMC A;  2CT4 A;  2RHX A;  4E7L A;  3H6Z A;  4M78 A;  4QT7 A;  1JQQ A;  2W0Z A;  5KH6 A;  3HTR A;  5L8R E;  4CRI A;  4E7I A;  2FPD A;  3VKI A;  4C5H A;  3V7S A;  5M9O A;  1K1Z A;  2NUP B;  5IH2 A;  4C8Q B;  2YSQ A;  2NUP A;  2Y4X A;  4C8Q A;  2A0F B;  2RK2 A;  3VUZ A;  3WVD B;  2Y4Y A;  1M1K U;  4RTW A;  4PJO E;  2RO0 A;  4DA4 A;  1VQ8 A;  5D6X A;  5FRN A;  1I4K 1;  1WQW A;  4PFO A;  3OYJ A;  3C12 A;  1SPK A;  2DL3 A;  5GAO q;  2K6D A;  3RKW A;  2QQ9 A;  2M51 A;  3WVE B;  2QTX A;  2P0P A;  5GAN 5;  2CRE A;  4D8K A;  4JJN K;  1G3T A;  4F16 A;  2KMT A;  3QXE B;  3SHW A;  1AEY A;  3ME9 A;  4PJO A;  1OOT A;  4E7J A;  1PKT A;  3CC2 A;  1D0Z A;  4A53 A;  1MUZ A;  4RUG A;  1BI0 A;  5CO7 A;  3QHS A;  9ATC B;  1MMN A;  2P4R A;  4J7F A;  5LJ5 e;  1HD3 A;  2EYZ A;  4F17 A;  4ZNX A;  1VQK A;  2KT8 A;  2FO0 A;  1ZUU A;  2F2V A;  2DD4 A;  4LUE A;  3CD6 A;  1JJ2 P;  2EGE A;  4QVD A;  4DBR A;  1KC8 U;  2RNA A;  5KYU B;  2FL7 A;  5KYU A;  3SD4 A;  1Y0M A;  3CCQ A;  3MCA B;  4KRT A;  5FU6 B;  2O88 A;  1BIA A;  3PGG A;  3PMT A;  1BB9 A;  4ELY C;  1Q82 C;  1NYF A;  3X25 B;  4IUR A;  4M77 B;  5GAM e;  2DEU A;  4M77 A;  3CC7 Q;  2EVR A;  3I56 T;  3X24 B;  1ZSZ A;  1PNJ A;  4GLM A;  4RTU A;  3H0I A;  1YIJ A;  1M2O A;  2K57 A;  1RUW A;  5DLQ E;  5GAN g;  4RCB A;  3HKS A;  2KRN A;  4DBH A;  1OV3 A;  3CBO A;  1UEC A;  3P8D A;  4OMN A;  4BE2 A;  2J6K A;  4DBQ A;  2EJF A;  3M0U A;  4MZM A;  1I81 A;  5J39 A;  1XTD A;  3OW2 P;  1VQM Q;  1WQ7 A;  1VQ9 Q;  1QCF A;  1OEB A;  3NMZ C;  2K5I A;  2DM1 A;  3EG0 A;  3S3N A;  1Z9Z A;  2CZ1 B;  2C0I A;  3CCU Q;  3QPH A;  3ZFJ A;  1TOV A;  2COW A;  2FPF A;  2HQH A;  1A0N B;  1VQN T;  1QVG S;  3A1P A;  3OYC A;  1TUG B;  3QKJ A;  3CBP A;  3OMG A;  2O4X B;  5DM7 R;  3JCM J;  4WCI A;  1GL5 A;  3UA7 A;  3TRE A;  1UJ0 A;  2HQX A;  4JUV A;  1NBE B;  1WI7 A;  4JRK A;  1ACM B;  1J3T A;  1KD1 U;  1LCK A;  4M7A C;  1QLY A;  3Q1J A;  1FMV A;  2DPP B;  4C92 E;  4E7Z A;  1NPR A;  2RI5 A;  4O6J A;  1EX4 A;  3J81 E;  2OTJ Q;  2XIC A;  1WJQ A;  4Y28 E;  1S72 T;  4R55 A;  1RAG B;  1FXX A;  3UA6 A;  2ROT A;  3NTI A;  3EGX B;  1K8A R;  1R8O B;  3JB9 G;  5LJ3 j;  3MP8 A;  3VUB A;  3JSC A;  3L2R A;  1M8M A;  4BI3 A;  1IO6 A;  1LOJ A;  2EFI A;  5EG2 A;  2NLU A;  4AT1 B;  4C92 B;  1TG0 A;  1DJ7 B;  2QQR A;  4C92 A;  1I5L A;  4ESR A;  2QAZ A;  2M1H A;  1Q81 U;  1U06 A;  2P84 A;  2KBT A;  4PFP A;  2I0N A;  4BY6 B;  3JCM P;  4KUI A;  5LJ5 g;  2XHC A;  4QQ6 A;  2K4Y A;  3OYM A;  5IHN A;  2LQK A;  1H3H A;  3FDR A;  2A08 A;  1R0B G;  1SF9 A;  5IN1 A;  1WA7 A;  4JS5 A;  2ATC B;  1NG2 A;  1KQ2 A;  1OYX A;  2E1H A;  5IT9 E;  3N5B B;  1OUL A;  3CME T;  2DET A;  5KYW A;  3OYL A;  3OY9 A;  4AG1 C;  4MML A;  2JS0 A;  2C0T A;  3EGU A;  4OF1 A;  2KEA A;  1M3B A;  3HFO A;  5GMK m;  5GAM g;  3MEW A;  2E64 A;  1R77 A;  1H3Z A;  4DOV A;  2DK3 A;  1Q7Y R;  3H41 A;  2HZY A;  1VQ5 T;  2L3Q A;  4JRQ A;  2ZPE B;  2ZCF B;  4RTT A;  2MF2 A;  2ZPB B;  4M77 G;  2PZ1 A;  1QQJ A;  2QGF B;  3MHX A;  1YNZ A;  4OP0 A;  1N5Z A;  2EJG A;  1O9S A;  3CCR Q;  3LW5 E;  4C8Q D;  3G4S T;  4FL6 A;  2DL8 A;  3CCL Q;  2DYB A;  3M0P A;  4L59 A;  1QKW A;  4FW2 A;  4QQD A;  3JB9 D;  2ZAE A;  4M75 C;  1VQ8 Q;  5GAO r;  1G5V A;  5GAO l;  1G83 A;  2QG9 B;  1WHJ A;  2KXC A;  4KH1 B;  5CK9 A;  1JBM A;  3QBY A;  3QG1 A;  4L5G A;  2YUN A;  1RAH B;  1WPY A;  2YRD A;  2QA4 Q;  1X69 A;  2LNH B;  4DBF A;  4F7U F;  3C4S A;  2WAC A;  3CC2 Q;  2MI6 A;  4M78 F;  3JAM E;  1VQ7 Q;  3G1J A;  3NHN A;  1B34 A;  4CC4 B;  4EMK A;  1VQK Q;  2GTO A;  3SWN C;  2L89 A;  1GCP A;  1JU5 C;  2CP7 A;  1AT1 B;  2PUO B;  3CD6 Q;  4XTW A;  2LCL A;  4C8Q F;  3M54 A;  1YJ9 Q;  1W2B S;  2RHZ A;  3EG9 B;  2JW4 A;  3IQL A;  1K9M C;  2O9V A;  2EYQ A;  2CZ6 B;  1TS9 A;  3CCV A;  2OX7 A;  1V76 A;  4OGC A;  5FRM A;  3PIO A;  2A28 A;  2QEX Q;  4A4G A;  5A2Q E;  4N4I A;  1UGR B;  4M77 D;  4J9D A;  5GMK h;  2E10 A;  3MO8 A;  3CCM T;  4PJO F;  1MNE A;  2VXF A;  3A8H B;  2L3P A;  2DX1 A;  3PFS A;  4J9H A;  3JCM d;  1VQP T;  1YIJ Q;  5FWB A;  1PG5 B;  3RR6 A;  4C0D C;  5AYF A;  5GMK i;  3PE0 A;  1T3L A;  2V26 A;  3ZBD A;  5KCH A;  5CR2 A;  4EIK A;  1VQ6 T;  3CCE T;  3M57 A;  4OB3 B;  1M1K C;  2CP0 A;  2HKN A;  4FIB A;  1NLP C;  2DNU A;  4KGZ B;  4LDV A;  1NM7 A;  1N9R A;  4J9G A;  1RAA B;  3ZL7 C;  1RAB B;  3CBM A;  3CC7 A;  3HRU A;  4NL2 A;  2CKK A;  1OI1 A;  2RF0 A;  5GAN 4;  3TEE A;  4OMP A;  2P4T A;  2D8J A;  1AZG B;  2J6O A;  3LH5 A;  1IHW A;  5IAY A;  4DEY A;  2XDD A;  2DBK A;  1H8K A;  5LJ3 d;  1X27 A;  2XDP A;  1UHC A;  2JZ2 A;  1KG1 A;  1UGS B;  3V8J A;  2MCN A;  3VS4 A;  2FVU A;  2HSP A;  2EPD A;  2COY A;  4M77 F;  3OQ5 A;  4PL6 A;  2C0O A;  2LT1 A;  2GGR A;  4MMK A;  3L2V A;  2QQS A;  1VQ9 A;  1KQS A;  4TVR A;  4AFQ C;  3EH1 A;  3BE3 A;  1CKA A;  3TCJ A;  5A0L A;  4ME7 A;  2LQW A;  3M56 A;  1YJW Q;  2VKN A;  4ORZ A;  2E12 A;  1KSW A;  4IUT A;  5C0M A;  3R6N A;  1WHH A;  1MV3 A;  2E5Q A;  1UHF A;  2SRC A;  1KC8 C;  3I9Q A;  3E2U A;  3S6W A;  3P8B B;  4B9X A;  5I21 A;  2E5K A;  2M16 A;  4J9C A;  1Q7Y C;  4M7D C;  1GRI A;  4QVC A;  2GFU A;  3CC4 T;  3NTH A;  2DJZ A;  1RI0 A;  1NEB A;  3FJ5 A;  4C92 D;  1UG1 A;  2VWF A;  3LH0 A;  3LGL A;  4GLK A;  3HL8 A;  2K3Y A;  3CPW A;  1X2K A;  2GTJ A;  3RER A;  3H0H A;  2OTJ A;  1LPL A;  2GBQ A;  4N4H A;  1MND A;  3BFM A;  2QDY B;  1W2B P;  1Q95 G;  4CI0 C;  1NJI R;  1D0Y A;  4M7A B;  2KXD A;  1VYV A;  1ZBJ A;  3DLL A;  3DB4 A;  3L2W A;  4FYV B;  4PJN A;  5D7U A;  1YIT T;  4IUP A;  1I07 A;  5KCO A;  1D1A A;  1HK9 A;  2HQE A;  1VIF A;  2ED0 A;  3G6E A;  4C92 F;  2HD0 A;  3LX7 A;  3CXC A;  2PQW A;  4BDZ A;  3V8K A;  1UUE A;  1KD1 C;  3V7C A;  2DTO A;  1RI9 A;  2VB6 A;  1MMG A;  5GAN j;  4EMG A;  3U23 A;  4XU3 A;  2LJ3 A;  2NWM A;  1M3C A;  3CQT A;  5IXB A;  2RQT A;  2V8I A;  3OB9 A;  3M53 A;  5GAO n;  2GQV A;  2KGT A;  3G71 T;  3EHQ A;  1ZSG A;  4IUU A;  2CZ0 B;  2EQM A;  4J9B A;  3QYH B;  5CKB A;  4RTZ A;  2ENM A;  1VQL A;  2QXF A;  2AHJ B;  3H8Z A;  4OMF B;  3X28 B;  3M9Q A;  1VQN Q;  4D8D A;  3CCR A;  3MKD A;  2JT4 A;  1Q81 C;  3OS0 A;  3JCM X;  1Y96 B;  3GOX A;  2IVW A;  3GLX A;  3CCL A;  1Y96 A;  3QO3 A;  5HKC A;  3CCJ A;  4RTY A;  3REB B;  1U1T A;  4JZ4 A;  4LD9 K;  2DXU A;  2SEM A;  2OTL T;  2DIG A;  1C6V X;  1RAF B;  2RQR A;  1M8V A;  4JRP A;  4JS4 A;  4A4E A;  5CVI A;  3SEM A;  1WDX A;  2KT1 A;  2WSF E;  3OA6 A;  2RPN A;  1KQS S;  1IHV A;  3QJY A;  2E3I A;  2EIF A;  2O01 E;  1IXD A;  1JXM A;  2QA4 A;  2XKO C;  3FEO A;  1VQO T;  3CCV Q;  1M2V B;  4FU6 A;  1GCQ C;  1M3A A;  2BTT A;  2CH4 A;  1VQ7 A;  2CGH A;  2JXB A;  4JLI A;  2ZZD A;  3L42 A;  4HT8 A;  1UFF A;  1D1C A;  4RG2 A;  2LX9 A;  4EPC A;  2KYB A;  3HPW A;  2CUD A;  1YJ9 A;  2OJ2 A;  4M77 E;  4J9I A;  1PD1 A;  4PKC C;  1OU8 A;  5LJ5 j;  2FEI A;  3T9N A;  1WIE A;  4LNP A;  2QEX A;  3RDV A;  1SSF A;  2D0N A;  4FYX B;  1RAD B;  4BI8 B;  1JB0 E;  4FT2 A;  5D6Y A;  3SWN B;  1H64 1;  3EG2 A;  3CME Q;  3TSW A;  1QVF A;  4M7A G;  4M4Z A;  2NUT B;  2P0Q A;  4RTV A;  2NUT A;  4FT4 A;  4E7K A;  1WXB A;  3UPU A;  2FPE A;  1VA7 A;  2CZ7 B;  2LX7 A;  5GAO p;  2IG0 A;  2B86 A;  2RHU A;  5GAM j;  2CP3 A;  2KAF A;  1WFW A;  2JNG A;  3CMA T;  3MEV A;  1VQ5 Q;  2DO3 A;  4VUB A;  2DKG A;  4X9C A;  3VYH B;  4N4G A;  3L1A A;  4JJB A;  2OAW A;  2QYZ A;  4E7H A;  1NJI C;  1B07 A;  2FB7 A;  1FMW A;  3UF4 A;  4J9F A;  3CXC S;  3D7S B;  4N0A C;  1K9M R;  3G4S Q;  2OAU A;  5L23 A;  2KSS A;  1WGS A;  3ULR B;  3L2Q A;  2E41 A;  1AWW A;  2LC4 A;  2D1X A;  3QSU A;  3JCM b;  4WTO B;  2MOX A;  5I2S A;  3O8V A;  4OB2 B;  2O4X A;  5IHI A;  3TQ7 P;  2DTI A;  2J05 A;  2AZV A;  2JTM A;  1YCY A;  1PRM C;  4E7S A;  2AKK A;  5HK0 A;  4V2S A;  3OYE A;  2ZGW A;  1YJW A;  3DKM A;  2DD5 A;  1GFC A;  1WZO A;  2BIV A;  4LE9 A;  5KYX B;  3QWY A;  4HCZ A;  5KYX A;  3V8L A;  3DB3 A;  1E7O A;  1M1K R;  2G3R A;  2KRM A;  5HK3 A;  2K7A A;  3HFN A;  3EGX A;  1HYO A;  4OMM A;  1Y07 A;  5CKF A;  2DIQ A;  3M0R A;  2O9S A;  1VQ4 T;  2A36 A;  1ARK A;  2ZPI B;  1YFN A;  1K73 U;  1YCS B;  3OYN A;  5GAN d;  1GXI E;  1RLP C;  4KUL A;  2QQB A;  1P92 A;  4AFU C;  3RKX A;  3OMC A;  2L0A A;  2A37 A;  4M7D B;  4M75 G;  2XG8 D;  1FX7 A;  4J8O A;  3G6E Q;  1WYX A;  3S3O A;  3L2Z A;  4A4K A;  4ZGJ B;  1U3O A;  4UC4 A;  1NZ9 A;  1X75 C;  2K3X A;  2CP5 A;  2ZPH B;  1C1A A;  2JTF A;  2PNI A;  1JRI A;  1NYG A;  1SSH A;  4OGE A;  1ZBX A;  3NGP A;  8AT1 B;  1VQP Q;  1BI2 A;  1XOV A;  2KDS A;  5A0G A;  1MHN A;  4XTV A;  5KE3 A;  1BCO A;  1M30 A;  2RJF A;  1UDL A;  3M59 A;  4X1V A;  1TU0 B;  3C95 A;  1KC8 R;  4JJC A;  3RBB B;  1VQ6 Q;  3V7R A;  3CCE Q;  4FSX A;  1U1S A;  4PFZ A;  4M78 C;  1PCX A;  2RH2 A;  2KE9 A;  2XID A;  3BY7 A;  1YHQ T;  4FYY B;  1VQL Q;  2QGG A;  3JB9 H;  1IRX A;  2X35 A;  1QVF S;  2WSE E;  2PUK B;  4BDY A;  2AK5 A;  2LDM A;  3THK A;  4C8Q C;  2LMJ A;  2DVJ A;  2DEQ A;  4HVV A;  1OU9 A;  1XQH A;  1VQM T;  1O75 A;  3HSB A;  3CCJ Q;  3CPF A;  3GF5 A;  5I22 A;  1VQ9 T;  4CC2 A;  1WNL A;  4Y92 A;  1AD5 A;  3L2U A;  1SHF A;  1EZZ B;  2V1Q A;  3AHU A;  3CCU T;  1QVG P;  2E70 A;  3NPF A;  2EKO A;  1VOM A;  2MWO A;  4WF2 A;  1X01 A;  4PJO C;  1VQN A;  3VS5 A;  5LJ5 d;  1U8R A;  1SHG A;  5GAN 3;  3A8M B;  3CCS T;  4QW2 A;  2E3H A;  2FRW A;  3A8G B;  2GNC A;  3M0S A;  1NEG A;  2LRQ A;  4JDS A;  2WSC E;  4NS5 A;  5KYY B;  3CC4 Q;  1PHT A;  5GAN 6;  2EYY A;  5KYY A;  2EKH A;  1MMA A;  1M4Z A;  4XTU A;  4DOW A;  1F1B B;  1UTI A;  5GMK l;  3MP6 A;  1JJ2 A;  3VYG A;  3PIP A;  1KD1 R;  2HL5 C;  3E19 A;  2YHT A;  3EG9 A;  5GAM d;  2JUF A;  3C94 A;  1S72 A;  3X20 B;  2IPO B;  5I11 A;  3JB9 F;  1Y7X A;  1SRL A;  1ZQ1 A;  3X26 B;  1G8X A;  5AT1 B;  2BZ8 A;  4IKF A;  1KHC A;  1GFD A;  1YI2 T;  1IB8 A;  1ZSZ C;  2JM8 A;  2LQ8 A;  4ATO A;  1YWO A;  2X3X D;  3A5Z B;  2HMA A;  2CS7 A;  1M90 U;  1Q81 R;  1RL2 A;  1BBZ A;  4HCC A;  1N6A A;  1PSF A;  1LVK A;  1ZLM A;  1D3B B;  3QDR B;  2GF7 A;  1YJN T;  1Q86 U;  3OW2 A;  4M7D G;  4RCC A;  1D0X A;  2CYZ B;  3I55 T;  2JOY A;  3MEU A;  1FMK A;  4NOY A;  3KBG A;  5FLX E;  3H0F A;  3CME A;  2NYS A;  5FWC A;  2DXT A;  2D0Q B;  3UT1 A;  3I5R A;  2QI2 A;  1X6O A;  2DTH A;  4FW1 A;  4OML A;  3VV0 A;  2BZY A;  2CP2 A;  1BYM A;  1IGQ A;  4J5Y A;  4PJM A;  2K9G A;  2JMA A;  1X43 A;  2F2X A;  3G71 Q;  3E1S A;  1WX6 A;  1VQ5 A;  2XK0 A;  4LDY A;  5GMK e;  1W4S A;  3J7A F;  2EQJ A;  2L2P A;  5HCK A;  1I1J A;  2DMO A;  3QZ5 B;  2DRK A;  4AMC A;  1IZ6 A;  3SFM A;  4C0G A;  1EFN A;  2CT3 A;  2HSE B;  3EGD B;  3G4S A;  3EGD A;  4J7I A;  4A63 B;  3FB9 A;  1VYT A;  2LCC A;  3FRN A;  5GMK j;  2MPX C;  3G7Z A;  2X51 A;  1VQ8 T;  4OMO A;  4Z88 A;  2L3S A;  1BK2 A;  2NUZ A;  4YTL A;  4RKU E;  4XQ3 A;  2J6F A;  2KI7 A;  4Z02 A;  4A4F A;  4E47 A;  2DRM A;  2J06 A;  2D9T A;  4C92 C;  1G3W A;  3A8O B;  1VYU A;  1PRL C;  3GNG A;  2LVM A;  3GNF B;  2F2W A;  3BDL A;  2AIR B;  1VUB A;  4BY6 C;  4M7A E;  3CC2 T;  3OBW A;  3RMQ A;  2XMF A;  1M27 C;  1QP2 A;  2KY9 A;  1HXD A;  1HSQ A;  5GAN h;  3OS1 A;  3PT9 A;  3RUX A;  5KE2 A;  2A7Y A;  5EC7 A;  2LP5 A;  1VQK T;  2I2L A;  2DJQ A;  3CD6 T;  1K0S A;  3INZ A;  1RAI B;  2ED1 A;  1TSF A;  3GP8 A;  1AWJ A;  4M7A A;  2RB6 A;  4HCB A;  2XU8 A;  2E65 A;  2RMO A;  2Y90 A;  1JJ2 S;  4MDX A;  4OB0 B;  3OYK A;  4IUQ A;  2DIL A;  2KK4 A;  3E9F A;  3CCQ T;  3JCM f;  3JRZ A;  1RAE B;  4XAX B;  2KRO A;  2X4X A;  2R5A A;  1TWB A;  3QYG B;  5IHK A;  1KFZ A;  2K5F A;  1WXU A;  5FU7 C;  4PJJ A;  2JN0 A;  3I56 Q;  3CCM A;  5IXF A;  3OYA A;  3MEA A;  1YIJ T;  2EQK A;  1VQP A;  3NFC A;  1D1B A;  1I0C A;  2PU9 B;  1GBQ A;  2IIM A;  4C0Z A;  3OYY A;  4AFS C;  4C5I A;  5DLO A;  2L3R A;  4BUG A;  4LN2 A;  2FHD A;  2L5Q A;  1WLP B;  2RJD A;  2F5K A;  1X2Q A;  4CC7 A;  1VQ6 A;  3CCE A;  1BKB A;  2P0K A;  4J6X A;  3M0Q A;  5LJ3 f;  1QVG A;  4R0K A;  2XD0 A;  3OW2 S;  1ZX6 A;  3VS7 A;  2EQI A;  1OPL A;  2FG0 A;  3BDU A;  2ROL A;  4Q5W A;  1JEG A;  1Y57 A;  1QP3 A;  3REA B;  7AT1 B;  2JTE A;  1QWE A;  3KFV A;  1K73 C;  2RQW A;  1FYN A;  2BE7 D;  5I2M A;  1OZ2 A;  1OX8 A;  3GIB A;  4M78 B;  4MDW A;  4BD3 A;  1V1C A;  5LJ5 h;  1WHG A;  4EMK C;  2DAQ A;  4XTY A;  4JLG A;  3ZEH A;  4M75 E;  4KGX B;  1UE9 A;  1B7T A;  5D6W A;  1YJW T;  2ZPF B;  3FC3 A;  4KGV B;  4HA8 A;  3FJP A;  2X4Y A;  3CEY A;  2F5T X;  1ZUY A;  2COZ A;  2H8H A;  1V29 B;  2RHI A; 
#chains in the Genus database with same CATH homology
 2GQI A;  1GFC A;  3JV3 A;  4LE9 A;  4E6R A;  2LCS A;  3QWY A;  1TUC A;  1E7O A;  1AWX A;  2KRM A;  2K7A A;  4IIM A;  3NHN A;  3PVQ A;  2YUP A;  4OMM A;  4CC4 B;  2GTO A;  2EYX A;  2PTK A;  3EG1 A;  1GCP A;  1JU5 C;  3M0R A;  3RNJ A;  2O9S A;  2A36 A;  2KR3 A;  1ARK A;  2AZS A;  1K76 A;  1YCS B;  2DL7 A;  2JW4 A;  1RLP C;  3IQL A;  2HBW A;  1JXO A;  1ABQ A;  2O9V A;  4HVW A;  4AFU C;  2L0A A;  1T0J A;  2A37 A;  3TVT A;  2A28 A;  4OMQ A;  2CSI A;  2VVK A;  2RQU A;  1WYX A;  1TUD A;  2X3W D;  1U3O A;  2KYM A;  4J9D A;  1E6H A;  1CSK A;  2DF6 A;  2PNI A;  1NYG A;  1SSH A;  4K11 A;  1MV0 B;  2L3P A;  4LUD A;  2DX1 A;  2RN8 A;  3NGP A;  4J9H A;  1XOV A;  5FWB A;  1M30 A;  1UDL A;  2YT6 A;  1ZUK A;  2DLP A;  4X1V A;  3PE0 A;  1KJW A;  1T3L A;  4JJC A;  4IIO A;  4EIK A;  3RBB B;  3M0T A;  1W70 A;  3VRY A;  2RQV A;  1NLP C;  2DNU A;  2MIO A;  1NM7 A;  1U5S A;  2KE9 A;  1SEM A;  2HEQ A;  1T3S A;  2OI3 A;  1S1N A;  4J9G A;  3ZL7 C;  1T0H A;  2AKL A;  2RF0 A;  4OMP A;  3C0C A;  4DEX A;  2D8J A;  1AZG B;  2J6O A;  1RLQ C;  2AK5 A;  3THK A;  4CC3 A;  1K9A A;  2DBM A;  2K2M A;  2LMJ A;  3LH5 A;  3VS3 A;  2DVJ A;  4HVV A;  4DEY A;  2CH4 W;  2DBK A;  2ABL A;  1H8K A;  1X27 A;  1PWT A;  1UJY A;  1UHC A;  1GBR A;  3PVL A;  4JZ3 A;  4GBQ A;  2MCN A;  2HSP A;  3VS4 A;  5I22 A;  2EPD A;  2JMC A;  4CC2 A;  2CT4 A;  2C0O A;  4HVU A;  2GGR A;  4Y92 A;  1AD5 A;  4QT7 A;  1JQQ A;  2W0Z A;  1SHF A;  2V1Q A;  4AFQ C;  1CKA A;  2FRY A;  1G2B A;  3NPF A;  2DL4 A;  2FPD A;  2LQW A;  2VKN A;  1Z9Q A;  4ORZ A;  3I35 A;  1K1Z A;  1KSW A;  5IH2 A;  3VS5 A;  3R6N A;  2O2O A;  2YSQ A;  1SHG A;  1MV3 A;  1UHF A;  2SRC A;  5FW9 A;  3I9Q A;  4RTW A;  2E5K A;  1AOJ A;  4J9C A;  2FRW A;  1AWO A;  1GRI A;  1SPK A;  2GNC A;  3M0S A;  1NEG A;  2DL3 A;  2K6D A;  1PHT A;  2EYY A;  2M51 A;  2EKH A;  1NEB A;  3FJ5 A;  1UTI A;  1UG1 A;  2VWF A;  2CRE A;  4D8K A;  1X6G A;  2K79 A;  3VS2 A;  4F16 A;  1AEY A;  1X2K A;  3SHW A;  4HCK A;  5GJW B;  2HCK A;  1OOT A;  1W6X A;  1HJD A;  2GTJ A;  3H0H A;  1PKT A;  1ABO A;  5ECA A;  5I11 A;  1MUZ A;  1SRL A;  2GBQ A;  4RUG A;  2G6F X;  2LJ0 A;  2BZ8 A;  2P4R A;  1HD3 A;  2EYZ A;  4F17 A;  1GFD A;  4ZNX A;  3EG3 A;  2KT8 A;  2FO0 A;  1ZUU A;  2EGC A;  2F2V A;  4JJD A;  4LUE A;  2HDA A;  2JM9 A;  2KXD A;  1VYV A;  2JM8 A;  1ZBJ A;  2EGE A;  1YWO A;  2X3X D;  2RNA A;  1W1F A;  2J7I A;  1BBZ A;  1I07 A;  1ZLM A;  2O31 A;  1Y0M A;  4KRT A;  1X6B A;  2O88 A;  2ED0 A;  1BB9 A;  2CSQ A;  1NYF A;  1FMK A;  4HXJ A;  2ESW A;  2LZ6 B;  4RTX A;  3EHR A;  3H0F A;  2EVR A;  3TSZ A;  5FWC A;  3I5R A;  1UUE A;  1PNJ A;  4GLM A;  4OML A;  4RTU A;  3H0I A;  2BZY A;  1RUW A;  1RI9 A;  2YUO A;  1B3Q A;  1WXT A;  2KRN A;  2DL5 A;  1OV3 A;  1UEC A;  3U23 A;  1K4U S;  2LJ3 A;  2NWM A;  1AVZ C;  1M3C A;  3CQT A;  4OMN A;  1AZE A;  2J6K A;  2K9G A;  1YWP A;  2JMA A;  2RQT A;  3M0U A;  1X43 A;  5IXB A;  2F2X A;  2KGT A;  1WX6 A;  3EHQ A;  1ZSG A;  2LJ1 A;  1QCF A;  1OEB A;  3NMZ C;  1PKS A;  2DM1 A;  4J9B A;  3EG0 A;  2EW3 A;  1Z9Z A;  2C0I A;  1JO8 A;  4Z89 A;  4RTZ A;  2ENM A;  2L2P A;  5HCK A;  1I1J A;  2DMO A;  1YN8 A;  2CDT A;  2DRK A;  2FPF A;  4AG2 C;  1A0N B;  4D8D A;  2JT4 A;  1EFN A;  2CT3 A;  2JS2 A;  4A63 B;  1VYT A;  4AFZ C;  4WCI A;  4OMO A;  4RTY A;  4Z88 A;  3REB B;  3UA7 A;  1GL5 A;  2L3S A;  3QWX X;  4JZ4 A;  1BK2 A;  2NUZ A;  1UJ0 A;  2SEM A;  2J6F A;  2W10 A;  3VS0 A;  2DRM A;  4FSS A;  1WI7 A;  2RQR A;  2J06 A;  1J3T A;  2YDL A;  1LCK A;  3SEM A;  3VS1 A;  1WDX A;  2KT1 A;  2YUQ A;  1QLY A;  1VYU A;  2RPN A;  4Z8A A;  1PRL C;  1E6G A;  4J9E A;  2F2W A;  1JXM A;  2BZX A;  2XMF A;  1M27 C;  1GCQ C;  2ROT A;  3UA6 A;  3GBQ A;  1HSQ A;  1SRM A;  1M3A A;  2BTT A;  2CH4 A;  2EYW A;  2JXB A;  5EC7 A;  1M8M A;  1IO6 A;  2LP5 A;  1BU1 A;  2M0Y A;  2EGA A;  1UFF A;  1TG0 A;  2DJQ A;  1QWF A;  1K0S A;  4ESR A;  2ED1 A;  2QDL A;  2KYB A;  1AWJ A;  2CUD A;  1U06 A;  1UGV A;  2LQN A;  2KBT A;  2OJ2 A;  3VS6 A;  2I0N A;  2K3B A;  4J9I A;  2RMO A;  2KNB B;  1CKB A;  5IHN A;  2DIL A;  3VRZ A;  1H3H A;  2FEI A;  2A08 A;  1GCQ A;  1WIE A;  4LNP A;  3I5S A;  1H92 A;  2KRO A;  1WA7 A;  2D0N A;  1NG2 A;  5IHK A;  1KFZ A;  1KIK A;  3O5Z A;  3EG2 A;  1WXU A;  1OPK A;  3TSW A;  4M4Z A;  2V1R A;  5IXF A;  4RTV A;  1WXB A;  4AG1 C;  2JS0 A;  2C0T A;  2FPE A;  1I0C A;  1VA7 A;  3EGU A;  1GBQ A;  2IIM A;  1M3B A;  2KEA A;  2LX7 A;  4AFS C;  2B86 A;  4LN2 A;  1WLP B;  1X2Q A;  4CC7 A;  1WFW A;  3H41 A;  2L3Q A;  3M0Q A;  4JPB W;  4R0K A;  4RTT A;  4JJB A;  2OAW A;  2PZ1 A;  1ZX6 A;  3VS7 A;  1NLO C;  2EQI A;  1OPL A;  1YNZ A;  2FG0 A;  1B07 A;  1N5Z A;  2ROL A;  2DE0 X;  3UF4 A;  4J9F A;  1YP5 A;  1JEG A;  1Y57 A;  3REA B;  2CUB A;  2JTE A;  1QWE A;  3KFV A;  2RQW A;  2EBP A;  5L23 A;  2DL8 A;  1FYN A;  3ULR B;  2DYB A;  3M0P A;  1AWW A;  1QKW A;  2D1X A;  1QKX A;  2MOX A;  3UAT A;  1V1C A;  5IHI A;  1K0X A;  2J05 A;  2AZV A;  5GJV B;  1G83 A;  2ECZ A;  1PRM C;  1UE9 A;  2KXC A;  2AKK A;  4F14 A;  2D8H A;  2DA9 A;  2YUN A;  3A98 A;  1ZUY A;  2H8H A;  2KRS A;  1X69 A;  2LNH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...