2KE9A

Nmr solution structure of the caskin sh3 domain
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
67
structure length
67
Chain Sequence
GSLKVRALKDFWNLHDPTALNVRAGDVITVLEQHPDGRWKGHIHESQRGTDRIGYFPPGIVEVVSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caskin-2
publication title NMR solution structure of the CASKIN SH3 domain
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2009-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ke9A00
1U06A 1WI7A 4HVWA 1VYUA 3CQTA 2GTJA 1QLYA 2NUZA 3QWXX 3FJ5A 1B07A 1ZUUA 1VA7A 3M0TA 4OMMA 2G6FX 4RTYA 4LE9A 5IXFA 4LUEA 2L3SA 1UUEA 1V1CA 1WA7A 1I07A 1GFDA 2A37A 2M0YA 2CT4A 2DF6A 2OAWA 1NYGA 1JQQA 2KYBA 2J6KA 5IH2A 1X2KA 2BZXA 1KFZA 2K79A 2ESWA 2D8HA 4WCIA 3UA6A 3PE0A 4J9BA 1K76A 3I5SA 2EYYA 2YT6A 1QWFA 2BZYA 1WX6A 2PZ1A 4LNPA 3QWYA 4DEYA 1A0NB 2RPNA 3ZL7C 4Y92A 3EGUA 2ROLA 3VS6A 4J9DA 3M0PA 1KSWA 1OV3A 1PWTA 1NM7A 1ZBJA 4HCKA 1MUZA 4A63B 1NLPC 1SHGA 2RNAA 2FO0A 2LQWA 1CSKA 4IIMA 4D8KA 4Z8AA 2KGTA 1VYVA 4F16A 3A98A 4OMPA 2DRKA 2GQIA 3PVQA 2ED0A 4F14A 1AWXA 2K6DA 2LCSA 2ABLA 4JPBW 4KRTA 4GBQA 2D1XA 4D8DA 2XMFA 4DEXA 1VYTA 1S1NA 2EPDA 1H8KA 2LJ1A 2LX7A 1UDLA 4RTWA 2ROTA 3TSZA 2MCNA 1FYNA 2CUDA 2ED1A 1HD3A 1Y0MA 1K1ZA 2I0NA 1T0JA 1AD5A 1H92A 2J06A 5ECAA 1U3OA 2EQIA 2IIMA 2LZ6B 1GBRA 2PNIA 2DJQA 1W6XA 1W70A 1NLOC 2HSPA 4R0KA 1UTIA 2JMAA 1WIEA 2CH4A 2D8JA 3VS5A 2EYXA 2HDAA 2MOXA 1AWOA 1KJWA 3PVLA 1YN8A 1PHTA 1QKXA 1K0SA 2F2XA 4Z89A 1GL5A 2JM8A 3VS4A 1UHCA 4E6RA 4AG1C 2DL8A 4J9FA 1E6GA 3EG0A 4CC2A 1SPKA 1ABQA 1W1FA 2A28A 3NPFA 1JU5C 4F17A 1YNZA 3UA7A 2CREA 1SHFA 1TUCA 2V1QA 1M3AA 1M3CA 2DL5A 2O31A 2M51A 2J7IA 2J6OA 4AFZC 1UG1A 1G83A 1OEBA 1M3BA 3EG2A 2DILA 4OMLA 1JEGA 1WFWA 1AWWA 1M27C 3TSWA 2YSQA 4HXJA 4OMNA 2EGCA 2EVRA 2JT4A 2H8HA 3NGPA 3EG1A 1MV0B 3M0RA 2JS2A 3EHRA 2RQVA 4GLMA 2HCKA 1WYXA 2RMOA 2DBMA 1ARKA 2K3BA 2RQUA 1M8MA 2DYBA 2AKLA 2LJ0A 1ZX6A 5IHIA 2CH4W 1SEMA 1X6BA 1BB9A 1TG0A 2J6FA 3SHWA 1Z9QA 2YUOA 2W0ZA 1T3SA 2JMCA 2A08A 1ZLMA 1FMKA 2EW3A 2K7AA 2DLPA 4RTUA 2VKNA 2AK5A 2YDLA 1ZUYA 2KT8A 2EGAA 2VWFA 1X2QA 1QKWA 2DNUA 5IHKA 2EBPA 5FWCA 2L3PA 4J9GA 1AZEA 3H0IA 2CSQA 2CDTA 4CC7A 2EYWA 1YWPA 1ZUKA 1SSHA 3REAB 2EGEA 2KEAA 1SRLA 3JV3A 2E5KA 2X3XD 2BZ8A 1GBQA 1EFNA 5L23A 4J9HA 2KE9A 1LCKA 1ABOA 2RN8A 3M0SA 4K11A 4J9EA 1PKTA 2C0TA 2DRMA 1NYFA 4JJDA 2P4RA 2JS0A 5GJVB 1JXOA 1K4US 3M0UA 3H0FA 4AFSC 4ZNXA 2PTKA 1UE9A 2DL4A 2GBQA 2C0OA 1E6HA 2A36A 1AVZC 1RLPC 2EKHA 3H41A 2RQRA 2FG0A 1YCSB 2J05A 2CUBA 4RTZA 2YUNA 1E7OA 2FPEA 1GFCA 3VRZA 2AZVA 5GJWB 1PKSA 2NWMA 2C0IA 2RF0A 1NEGA 2LP5A 3VS0A 3M0QA 2YUQA 3REBB 2ENMA 2FRYA 2SEMA 1HSQA 2KXCA 2OJ2A 3U23A 1PNJA 3EHQA 1YWOA 4X1VA 3VRYA 4HVUA 3VS3A 3THKA 1UJYA 2D0NA 2KXDA 1M30A 2OI3A 4RUGA 1KIKA 4J9IA 1T3LA 2KRSA 2RQWA 1I1JA 1GCQA 5IXBA 2W10A 1GCQC 2LNHB 3NHNA 2QDLA 3EG3A 4CC4B 1AWJA 5FW9A 2KR3A 1X27A 3UF4A 4LN2A 1GRIA 1J3TA 3C0CA 1PRLC 2JTEA 1RLQC 2KROA 1TUDA 1AEYA 5HCKA 2K9GA 2BTTA 1CKBA 1WLPB 2DMOA 3VS7A 1RI9A 1B3QA 1OPLA 3VS2A 2KRMA 3I35A 2X3WD 1X69A 2KT1A 1UGVA 3H0HA 4OMQA 2JM9A 2DL7A 4OMOA 2LQNA 1G2BA 4RTXA 2DBKA 1XOVA 2AZSA 1N5ZA 3ULRB 4AG2C 1MV3A 1YP5A 2GNCA 2CT3A 1NEBA 1JO8A 4ESRA 4AFQC 2RQTA 4AFUC 1CKAA 2CSIA 2GTOA 2SRCA 5FWBA 3GBQA 3LH5A 1I0CA 5I11A 2ECZA 1UJ0A 4J9CA 1BU1A 1HJDA 2O2OA 5IHNA 2F2WA 1X43A 2DX1A 3IQLA 4JJBA 1AZGB 4M4ZA 2F2VA 1H3HA 2AKKA 3I5RA 2DE0X 3O5ZA 2DA9A 2L2PA 1WXTA 2HBWA 1WXBA 4EIKA 4IIOA 1U5SA 2KYMA 4JZ4A 2L3QA 2V1RA 1ZSGA 4QT7A 1UHFA 2MIOA 3SEMA 3VS1A 1BK2A 2EYZA 2KBTA 4JJCA 1QCFA 3KFVA 1K9AA 2O9VA 2JXBA 4RTVA 2FRWA 4RTTA 4CC3A 2JW4A 2DVJA 1UECA 1RUWA 4Z88A 4JZ3A 2B86A 3RNJA 1Y57A 2KNBB 2O88A 1AOJA 1QWEA 3UATA 2DM1A 1T0HA 3TVTA 1UFFA 3NMZC 1WXUA 1PRMC 1JXMA 3R6NA 4FSSA 2KRNA 1X6GA 2FPFA 2LMJA 2O9SA 4HVVA 2GGRA 5EC7A 1NG2A 1K0XA 1SRMA 2VVKA 2DL3A 1Z9ZA 1BBZA 2LJ3A 3I9QA 1GCPA 1OPKA 4ORZA 2YUPA 1OOTA 3RBBB 5I22A 1IO6A 2FPDA 2K2MA 2L0AA 4LUDA 1WDXA 2HEQA 2FEIA
chains in the Genus database with same CATH superfamily
1U06A 3PGGA 4PJOA 3CQTA 1QLYA 4Z02A 1BYMA 5IT9E 4MDWA 3EGXB 3HTRA 2L3SA 1JJ2A 1I07A 4L6V5 2K3XA 1B7TA 4QVDA 4HCZA 4DOVA 2DF6A 1NYGA 2KYBA 2KSSA 4M78A 2K79A 3WVEB 3UA6A 3PE0A 4J9BA 1K76A 3I5SA 2EYYA 3G4SA 1QWFA 4C0FA 2BZYA 2WSFE 1WX6A 2P84A 3VUZA 3QWYA 1I5OB 3M57A 4EMHA 4EMKB 3EGUA 3QG1A 2ROLA 3FB9A 1ZSZC 2DTHA 1PWTA 1ZBJA 5A0GA 1MUZA 2D0QB 2DD4A 1BIAA 1D1BA 1AT1B 4XU2A 3QSUA 1BCOA 4IIMA 4C92C 2AHJB 3CCEQ 3A98A 1MHNA 4DBRA 1PSEA 2DRKA 1YBYA 3PVQA 2QEXQ 4OB1B 3I56A 4PJNA 2E3IA 2RHZA 5GAOn 2ZPGB 2D1XA 4J8OA 1VYTA 2DETA 3AHUA 2EPDA 2LJ1A 5IAYA 2QEXT 1RAGB 4NS5A 4X9DA 4C8QA 2MCNA 2CUDA 3C4SA 1YJWA 1NZ9A 1Y0MA 3CC7A 1K1ZA 5KYWA 1W2BS 5ECAA 1UB4A 5LJ3d 2IIMA 2CP6A 2PNIA 2DJQA 1N8RR 2HSPA 3LH0A 3CD6A 1VQNA 1UTIA 2AIRB 1K8AU 3L2ZA 3VS5A 3ASKA 2QAZA 2COZA 1AWOA 3PVLA 2F2XA 2RK2A 1NJIR 4XU1A 3JCMh 3QIIA 5KYXA 4NL3A 4E7LA 1ZA2B 4WTOB 4AG1C 2YRVA 2DL8A 5GAOp 3OYKA 1VIEA 4C92D 3L2VA 4RG8A 4F17A 3RDVA 1JBMA 2C06A 3GOXA 4C92G 4ZN3A 5CKBA 3JSCA 2M51A 3S3OA 1BCMA 2ZZDA 3OYJA 1G83A 3TREA 5GMKi 5LJ5h 3BFMA 2DFUA 3JCMc 3CMAA 3EG2A 1YITQ 4QQGA 1H3ZA 2DILA 4LD6A 4M75A 4PK4A 3NFCA 3SWNB 4XAXB 1K9MU 1Q81C 2FZKB 1WFWA 3I55T 3FJPA 3TSWA 2YSQA 4HXJA 2FVUA 2QA4A 2JT4A 4VUBA 1YITT 5KCHA 2X9HA 2X4WA 4IUQA 2DBMA 1K73U 3OMCA 1ARKA 2K3BA 4J83A 2RK1A 3BW1A 2AKLA 5GAOl 4XU3A 2EKOA 2CH4W 1SEMA 2E5QA 1X6BA 1M1GA 2J6FA 2YUOA 2W0ZA 1Q82U 1T3SA 2JOYA 2YLCA 3HRSA 5GMKl 1FMKA 2EW3A 2LT1A 2HKQB 2K7AA 4J6XA 4FSXA 3PT9A 1HYOA 4PJOF 1M1KU 3EFSA 2YDLA 3S6WA 5CR2A 2YLBA 1D3BB 2KVQG 3CXCP 4A4KA 2HZYA 1RAEB 5KYYB 2QDYB 2DNUA 2K2VA 5FRMA 4A4GA 4IUTA 4XQ3A 3ZBDA 5FWCA 1WQ7A 3OBWA 2XDDA 1SSFA 4IUUA 4CC7A 1WHMA 3VYGA 3CCUQ 3JCMd 4L5GA 2LQ8A 4M7DB 1SRLA 1FX7A 3JV3A 2E5KA 1PCXA 2BZ8A 3CBOA 3P8DA 1RAHB 5L23A 3CCUT 1LCKA 4K11A 5D7UA 4J9EA 4PJOE 2C0TA 4JJDA 3HSBA 1WHJA 3CCRQ 1Q86R 1JXOA 2PTKA 2GBQA 2C0OA 1MMGA 3CCQQ 1SG5A 2QQ9A 1VQPT 5LJ5d 3JB9F 3KXTA 2QQAA 2YUNA 2PQWA 1E7OA 3PMTA 3CCQT 2FPEA 1KG1A 1MMAA 2CYZB 2AZVA 2NWMA 1JB0E 1S72T 4JRKA 2LP5A 4OMFB 1KQSP 2OJ2A 1PNJA 3EHQA 1QQJA 2F5TX 4N4IA 1UJYA 1VQLQ 3PNWC 3OMGA 2OI3A 2EIFA 2K4YA 1N9SA 3EFOA 2OTJQ 2QEXA 1Q7YC 2DXUA 2YXYA 5I21A 2PU9B 1MNEA 2RQWA 1I1JA 5IXBA 3QJYA 1VQLT 1GCQC 2LNHB 3NHNA 4CC4B 3CMEQ 1QVFP 2E65A 2OTJT 3DLLA 2VGNA 1OX9A 2LCCA 1G3SA 2JTEA 5KYYA 1TUDA 1AEYA 3V8JA 2BIVA 2QTVA 5GAN3 3MO8A 3CMET 1B3QA 2QXFA 3VS2A 3QDRB 2DPPB 4BACA 4BE0A 4OGCA 2FYKA 2X3WD 4M7DA 3VU3C 2HQXA 1KQ2A 1ZHIA 3OY9A 4A4FA 4AG2C 2GNCA 2CS7A 4KGXB 5FWBA 1W4SA 1TSFA 1I0CA 2XHCA 1DJ7B 1UJ0A 1YCYA 1X43A 2DX1A 4M75F 3IQLA 1VQ5T 4M7AB 4JJBA 1AZGB 4M4ZA 2AKKA 2BE9B 2GCXA 3I5RA 4XTUA 5LJ3e 2MWOA 3QXEB 3GP8A 2DA9A 1D0XA 1WXBA 2LX9A 3WXMB 3I55A 4J5YA 2L3QA 3VKIA 2HAXA 1YITA 2V1RA 3FIFA 5FRNA 1ZSGA 4OB3B 4ZGJB 3VS1A 4MZPA 4J6WA 5IN1A 1K9AA 2O9VA 2JXBA 3CCMT 2GFAA 1RACB 4CC3A 2DVJA 1UECA 4Z88A 5D6WA 3QO3A 3G4SQ 5KE2A 2B86A 4M75E 2EYQA 3SB2A 1AHJB 1YJNT 2AT1B 1Y57A 3MPUB 1KHIA 5GAOm 1QWEA 4OB2B 3OSVA 4R55A 2K3YA 3NMZC 3NTIA 4EDUA 1PRMC 4LDYA 1B34B 3R6NA 5GMKm 4FSSA 2YHTA 4JS5A 2KY9A 3DB4A 1IZ6A 5DLOA 3MEUA 1WZOA 2GGRA 4C5GA 1Q81R 3CBPA 1K0XA 1Z9ZA 1GCPA 2YUPA 2MI6A 1YI2T 1BKBA 2RA2A 5I22A 2FPDA 1OI1A 3OYHA 3HRTA 2JTMA 2HEQA 4LXCA 2CP3A 3CCUA 3QWXX 4PJOC 3CCSQ 1B07A 3BDUA 2H3JA 2NUPB 5HKCA 2G6FX 4ELZC 5IXFA 4KUIA 1M90U 3CC7Q 2DD5A 7AT1B 1D1AA 4M7AA 3CCST 3CXCA 2F5KA 5KYUB 2L8DA 2CT4A 2JZ2A 1VQOT 1WJRA 1VQPA 5AT1B 4M78C 2ESWA 2D8HA 3CCQA 3EH1A 4RMOA 1X01A 2EQKA 1BI3A 2PZ1A 1S72A 4LNPA 4DEYA 5GAN2 1V76A 1M2OA 3JCMe 1M5Q1 5AYFA 4LDUA 4IKFA 3MHXA 5D6YA 4KUDK 1SHGA 5GANh 1YJ9Q 3BY7A 3L2RA 5GMKj 4J7FA 4V2SA 2LTOA 5FU7B 3KBGA 2K57A 4OMPA 1I4K1 1VQ7Q 1VQLA 1M1FA 2RJFA 2ED0A 2PVGB 2MMPA 3HP9A 4MZTA 1YJ9T 2OTJA 2K6DA 3HPWA 1RABB 2R58A 5LJ5e 1VQ7T 3RUXA 1M9SA 1S1NA 1R0CB 3M53A 4M7DF 3CMEA 3LLRA 4BUGA 4RTWA 1KC8C 1ACMB 3L2UA 4C8QC 1YFNA 1KQSA 4NOYA 1T0JA 4M78D 1AD5A 4FW1A 5GAN6 2EQIA 2VXFA 1U1TA 2BE7D 4M78G 3CCLT 1KD1C 2B8AA 3MCAB 4CI0C 2CP0A 2VB6A 3ME9A 2LRQA 2NUPA 2VC8A 1M2VA 5KH6A 1Q7YR 1TH7A 2EYXA 1RI0A 1KJWA 1YN8A 1C1AA 1GL5A 2HQEA 1QVFA 2RH2A 1VQ5A 1UHCA 4M77B 2X4YA 3OS5A 2R5AA 3OSSC 4M7DE 3M54A 1SPKA 1MMDA 1W1FA 1ZBXA 2A28A 2EFIA 4QQDA 3NPFA 2QQBA 4M77D 1YNZA 2CKKA 9ATCB 5GAN4 4M77G 1M3CA 2DL5A 1VQ9T 1XTDA 1LPLA 1UG1A 5J39A 1BIBA 2V26A 1OEBA 2JVVA 3CCMA 3H9NA 3OYCA 5GANd 4M75C 4C8QD 4OMLA 1JEGA 1AWWA 2COWA 1YJNA 1OX8A 2DTIA 4C8QG 1M27C 4OMNA 2F69A 3EG1A 1MV0B 3DB3A 3EHRA 3JB9I 2RQVA 2EQUA 4BB7A 3JAME 2RQUA 3RKWA 1M8MA 4FM4B 1WQWA 3A8OB 1TG0A 1VQ4Q 5GAOr 2LT4A 2VASA 4A4HA 4D6WA 2DLPA 1I81A 3HKSA 2VKNA 1I8FA 5CCAA 4JDSA 4JS4A 2AK5A 1VQ4T 1RAIB 3SDZA 2EGAA 2KI7A 5CK9A 4ZN1A 4M7AF 3G6ET 2EBPA 4J9GA 2ZPFB 1QVPA 1YWPA 3X26B 4FU6A 1SSHA 3H6ZA 2CZ6B 1OU9A 3CCSA 2HKNA 1TU0B 1VQOA 3OYBA 4A54A 1GBQA 4PLLA 1OULA 2ZGWA 3M0SA 4HCCA 3OYYA 1NYFA 2P4RA 5GJVB 4ZGDB 1K4US 3M0UA 3H0FA 4AFSC 3GIBA 4FW2A 2X4JA 3EGXA 2QQSA 2A36A 1AVZC 3RMSA 2JN0A 4M7AE 1G3WA 4C92B 4RTZA 3VUBA 2M0OA 3OW2P 1UGRB 1D09B 2VV5A 1GFCA 1EX4A 1PKSA 2C0IA 2RF0A 1NEGA 3GNGA 4F7UB 3M0QA 2E12A 3UPUA 2SEMA 1VQ8Q 1WPYA 2KMTA 1YJ9A 1YWOA 2NYSA 5GAOq 4EMKA 1BI2A 2D0NA 1KHCA 4UC4A 4CRIA 1VQ7A 3I55Q 4F7UG 3OB9A 4RKUE 1WGSA 4J9IA 2QGGA 2RJEA 3RKXA 4A4EA 1VQ8T 2NUTB 4E7HA 3UWNA 1YIJQ 2QYZA 3JCMW 3F70A 3J7AF 2KR3A 4ME7A 1X27A 4LN2A 5LL6S 1J3TA 3CCLA 3FDRA 1PRLC 2KROA 2M9UA 1YIJT 1CKBA 3ZEHA 1VQMT 2DMOA 1HXDA 1RI9A 2E1HA 1WHLA 4TVRA 1K8AC 4FL6A 3H0HA 1G3YA 3V8KA 2JM9A 4ATOA 1XOVA 2CZ7B 3BDLA 1N5ZA 1W2BP 1YP5A 3X25B 4JLIA 2RQTA 5GAN8 1CKAA 3SD4A 2CSIA 1KQSS 2SRCA 4ZTFA 1KC8R 3M5AA 3LH5A 3URGA 2ECZA 3A5ZB 2XDBA 3QDFA 2K5LA 2WACA 4JRPA 2L89A 2O2OA 5IHNA 2F2WA 3CC4Q 3ER0A 1KD1R 4HA8A 2DO3A 2DEQA 3A1PA 5L8RE 1PD0A 3D7SB 4C92A 3DKMA 3O5ZA 4WF2A 1OYXA 4BE2A 2L2PA 2QG9B 3MEAA 3CC4T 2KYMA 4MMLA 1TWBA 3JRZA 1K9MC 5D6XA 5GAMe 4QT7A 2EYZA 1VQPQ 1TS9A 4JJCA 4RTTA 1IHVA 1K73C 3NTKA 3DLMA 3RNJA 2NUTA 1S72Q 2I2LA 1JJ2S 3ZFJA 3SWNA 1Q82C 1C0MA 2XDPA 3UATA 1VQ4A 4FYVB 4B6MA 1WXUA 1JXMA 2A0FB 3H8ZA 1M1KC 2ZPEB 1X6GA 1Y96B 2RJDA 2ZPBB 4KT0E 2D6FA 1PSFA 1NG2A 3G6EA 4N4GA 4BI8B 5GANe 4BI4A 1OPKA 1MNDA 1VQKT 1OOTA 3HL8A 3UT1A 3RBBB 4QKUA 3OS2A 3CPWP 4J6YA 4LUDA 3TVTA 2A08A 2VUBA 4GLKA 4BY6C 1VYUA 2NUZA 3M58A 1D3BA 1QP3A 3V7SA 3M0TA 1SF9A 2RHUA 4OMMA 2V8IA 3OYNA 4RTYA 1V1CA 1WA7A 1GFDA 2A37A 3TQ7P 1R77A 5DLQE 2EJFA 2M0YA 3E1SA 4N0AC 2CP2A 2OAWA 1JQQA 5IH2A 2BZXA 2L5QA 2QTXA 2PUOB 3GF5A 2YT6A 3QYHB 2D9TA 1VQ5Q 1VQ6T 2X51A 3ZL7C 1ZQ1A 4Y92A 3RKYA 5CVIA 1KSWA 2P0KA 4E47A 1NM7A 2DKGA 4A63B 3INZA 1Y7XA 1NLPC 3CCJQ 3T9NA 2RNAA 2FO0A 3BE3A 2LQWA 1CSKA 1VQ8A 2LVMA 4D8KA 4F16A 4B9XA 2RHYA 5CO7A 1Q95G 1XQHA 3CCJT 3EH2A 4E7JA 3CCMQ 4PJJA 1N8RU 2ABLA 4JPBW 3OW2A 2WSEE 4O5VA 4DQ2A 4GBQA 1YIJA 3OYFA 1NE8A 4DEXA 1VQMA 1YJNQ 1ZA1B 1H8KA 2LX7A 3QJ6A 1UDLA 1NJIU 4O6JA 4C0DC 3LX7A 3V7CA 3TSZA 1FYNA 1HD3A 1TOVA 3M55A 1U3OA 2NLUA 3MEVA 5CQXA 2LZ6B 1GBRA 4QW2A 2E4HA 1W6XA 2RI3A 3LGFA 5GAN5 5GAN7 2JMAA 2CH4A 2D8JA 5M9OA 3QZ9B 2HDAA 1YI2Q 2KQWA 2XU8A 4E7KA 4DBFA 1NPRA 4C92F 2O01E 2FZCB 2DXCA 2DIGA 3CPFA 1WJQA 5CIUA 2COYA 2A7YA 4J9FA 1E6GA 3EG0A 2DZCA 2JJ9A 1QCOA 2LC4A 3FEOA 3UA7A 2KAFA 2CREA 1D0YA 2DERA 3CC4A 4PFPA 2XI9A 1MGQA 1M3AA 1K8AR 3OA6A 2FHDA 2J7IA 4FT4A 4AFZC 1VQOQ 5GAMh 1W2BA 3FC3A 2E3HA 1RAFB 1IXDA 4FIBA 8ATCB 1V29B 4E7SA 4C92E 3JCMb 3VV0A 4PL6A 3MEWA 2EGCA 1KQ1A 2EVRA 3M0RA 2LNVA 2XG8D 1QP2A 5A2QE 2A3LA 5A0DA 1WYXA 2DZ9A 3NTHA 4F04B 3PIPA 1R8OB 1GXIE 5IHIA 5I2SA 1BB9A 1VOMA 1RADB 5FU6C 4KBMB 4Y28E 2JMCA 4JLGA 4OP0A 1IHWA 1K9MR 3JCMJ 1VQKA 4RTUA 2R5MA 2CZ0B 3QUIA 1I5LA 1UGQB 5LJ3j 4PKCC 4PJOB 1U8RA 3L1AA 1ZUYA 3E9FA 5LJ3f 1X2QA 3MP6A 1K73R 1QKWA 3OYGA 1B34A 4PJOD 1XNIA 1Q86U 3A8HB 2OX7A 2L3PA 4PJOG 3H0IA 4RCCA 2FL7A 2CDTA 1NBEB 2EYWA 4IURA 1Q82R 2MPXC 4BI3A 1ZUKA 4RCBA 2QGFB 4M78B 2IG0A 3VYHB 1M90C 4HCBA 3CCLQ 2KEAA 1M1KR 4OGEA 2X3XD 3HHTB 1EFNA 2KE9A 1ABOA 4EPCA 1UE9A 4II1A 4PNOA 3CPWA 1E6HA 1RLPC 3H41A 2DTOA 5GAMd 3X24B 1YCSB 2MWPA 2J05A 2CUBA 2K5IA 5KYUA 1KK7A 6AT1B 1VUBA 2OAUA 1LJOA 3PMIA 1VQ9Q 2EQMA 3META 4JRIA 3JB9D 2HD0A 3SFMA 2RHXA 3VS0A 3CCJA 3REBB 2ENMA 3KUFA 3JB9G 1JRIA 1HSQA 2KXCA 3X28B 3U23A 4DBQA 3VRYA 4HT9A 3TU4K 3THKA 3PIOA 2KXDA 2YRDA 4EMKC 1M30A 4C8QB 5LJ3g 2OTLT 2XIDA 4RUGA 2E70A 1KIKA 1WHGA 3QYGB 5GMKh 3GNFB 2W10A 2DJZA 2QASA 3EG3A 3QZ5B 1QVGP 1LVKA 3UF4A 3RERA 1IREB 4HT8A 1RAAB 1FXXA 2RHIA 2K9GA 2BTTA 1UEBA 2DK3A 1D0ZA 1P92A 3VS7A 5KYXB 3LGLA 1OPLA 2KRMA 3I35A 3QPHA 3CEYA 3OW2S 3M4GA 4LDXA 5KCOA 1X69A 3L42A 3OS1A 2Y4YA 3N5BB 2LQNA 3JCMV 3JCMf 2AZSA 2M02A 4XK8E 1QMCA 1YI2A 3O8VA 2CT3A 1O75A 1JO8A 3OYAA 2RO0A 3G6EQ 2HL5C 3QBYA 8AT1B 2GTOA 4XTXA 3GBQA 3EFRA 5I11A 3G71Q 1BU1A 4KGVB 1C6VX 1X6OA 2XICA 5HK3A 3OYIA 3OYEA 2M1HA 4M75B 1H3HA 3G1JA 5FLXE 5LJ5j 3M9QA 1PC0A 3G71T 5HY6A 1Y07A 4M77A 4X34A 5LJ5f 4QVCA 1R0BG 3OYLA 4M75D 4FT2A 4EIKA 2R57A 1U5SA 4J7IA 2EJGA 4BDYA 4M75G 2G3RA 4L59A 2LCLA 3C94A 1UHFA 1LOJA 3SEMA 3CCET 1ZSZB 1QCFA 2QI2A 2FRWA 2DXTA 1Q81U 2JW4A 1EZZB 4JZ3A 4XU0A 2VXEA 4JUVA 1PM3A 2FZGB 4HKEA 5KYNA 2V8KA 1G5VA 2KNBB 2HBPA 3SWNC 4E7IA 2M16A 2DM1A 1EIFA 1T0HA 3CXCS 1UFFA 2CZ1B 4E2FB 1OU8A 4KH0B 3JCMP 3JCMg 2FPFA 4C5HA 3TCJA 2MAMA 2DIQA 2P0QA 3V8LA 3OYMA 3EAEA 4MMKA 2LJ3A 1OQKA 3VJPA 2YWWA 4ORZA 3CCVQ 5EG2A 2CP5A 2F1LA 2L0AA 1WDXA 2FEIA 1G8XA 1WI7A 4HVWA 1VQMQ 1QW1A 3CCVT 2GFUA 2GTJA 3MP8A 3FJ5A 4GY5A 1ZUUA 1VA7A 3JCMQ 5LJ5g 4LE9A 4LUEA 1UUEA 4X9CA 5DM7R 5CKDA 4BDZA 3QHSA 2J6KA 3HFOA 1X2KA 4KULA 1KFZA 1D1CA 3A8GB 3E19A 4WCIA 3JB9J 4M7DC 1M4ZA 3M59A 3CC2Q 3OS0A 3L2QA 1A0NB 1M90R 2RPNA 1ZSZA 3VS6A 4J9DA 3M0PA 4BE1A 1PG5B 1U1SA 1OV3A 1VQ9A 3EFOB 4HCKA 3EG9B 5KE3A 3CC2T 2OTLA 3RESA 3PTAA 3CPWS 2V8JA 4OB0B 4Z8AA 2KGTA 1VYVA 2E41A 1QVFS 3JCMX 2GQIA 4LD9K 3MJXA 4BD3A 3HFNA 4F14A 1AWXA 2DEUA 5CAIA 4EMGA 4F7UA 2LCSA 4KRTA 1Q7YU 2E6ZA 2XMFA 4D8DA 4M78F 4PLIA 4QVZA 1TTHB 4ELYC 4QQ6A 3GPLA 2ROTA 2GQVA 4PJLA 2ED1A 4C5EA 3RIRA 3S3NA 2I0NA 1HK9A 3PFSA 2HL3A 1H92A 2J06A 1IRXA 4M7DD 1SKUB 3LWIA 5CKEA 1N9RA 4M7DG 1W70A 5CKHA 1NLOC 1IB8A 4DA4A 2K5FA 4R0KA 5FROA 1WIEA 2IVWA 2YRCA 1FMVA 2MOXA 1F1BB 1VQKQ 4B9WA 3S3MA 1PHTA 1QKXA 3CCRT 1K0SA 4Z89A 1QVGA 2JM8A 4M77F 1UGPB 3VS4A 2EAYA 4M78E 3E2UA 3MP1A 1N6AA 4E6RA 1YHQQ 2ATCB 1M8VA 1IGUA 4CC2A 3G71A 1ABQA 2E10A 1JU5C 2P0PA 3MKDA 3FLGA 1SHFA 1IGQA 1TUCA 1YHQT 4N4HA 2ZCFB 2V1QA 2JNGA 2O31A 2J6OA 4C8QF 3CCEA 1Y71A 4MZMA 4JJNK 1TXQA 2EWNA 3EG9A 1M3BA 1FMWA 1BI1A 4M7AC 5CKFA 1TUGB 2MK5A 4M77E 2GF7A 3RMQA 2BUDA 3X20B 1VQ6Q 2RJCA 2PVDB 2H8HA 3NGPA 2JS2A 3C12A 4R56A 4NL2A 1WJSA 4GLMA 2HCKA 2RMOA 2PVOB 2HNIA 4PFZA 2O4XB 2DYBA 3R6OA 2LJ0A 1ZX6A 3SHWA 1Z9QA 4C8QE 5J26A 2HSEB 1ZLMA 2L3RA 4XTVA 4MDXA 4BY6B 1JJ2P 2EQJA 2E64A 4LDVA 2KT8A 2VWFA 5A0LA 3OQ5A 3CCVA 4JRQA 2H3EB 4C0GA 5IHKA 3E9GA 1AZEA 1Y96A 3HRUA 5GAMj 2CSQA 1WNLA 2EJ9A 2Y4XA 5C6SA 5GAMf 4DBHA 1O9SA 3REAB 5GMKe 1LNXA 2QK0A 2RI5A 2EGEA 4M7AD 2Y90A 4M7AG 4KGZB 4J9HA 2HMAA 2RN8A 4P5NA 1PKTA 2DRMA 2JS0A 2CP7A 4ZNXA 2RD1A 2DL4A 3EGDB 4PFOA 4C5IA 1PD1A 2EKHA 2RQRA 2FG0A 3P8HA 2BKDN 3CC2A 5GANj 4IUVA 3G4ST 5GANf 2RM4A 3VRZA 5GJWB 4F7UF 3A8MB 2WSCE 2YUQA 2XK0A 4KH1B 4Y91A 2FRYA 2O4XA 4ZTJA 4X1VA 4C0DB 4HVUA 3VS3A 2XKOC 2DYIA 1N8RC 3I56Q 2RI2A 1T3LA 2VYTA 1UGSB 4YTLA 2KRSA 3WVDB 3OBYA 1GCQA 2RB6A 2VGMA 4Q5WA 1NJIC 2QDLA 1AWJA 5FW9A 5GAMg 3I56T 5FU7C 1GRIA 3FRNA 1M2VB 3C0CA 2KDSA 1RLQC 2E6NA 1RL2A 4XTWA 5C0MA 5HCKA 4F7UE 1YJWQ 2ZAEA 3AT1B 1KC8U 3G7ZA 1FWZA 1G3TA 1MMNA 1WLPB 2X35A 2QQRA 4N0AA 5CQYA 2DAQA 2HQHA 5HK0A 2DVEA 3CCRA 2DXBA 4FYWB 2X4XA 1YJWT 2KT1A 1KD1U 3CC7T 1UGVA 3Q1JA 1VQNQ 3CD6Q 4OMQA 2DL7A 4OMOA 1G2BA 4RTXA 2DBKA 4OVAA 3ULRB 1MV3A 1NEBA 4ESRA 4AFQC 1N27A 3CD6T 4AFUC 1VQNT 4E7ZA 4A53A 3LW5E 1YHQA 4J9CA 1HJDA 2ZPIB 4FYXB 3EGDA 5GANg 3L2WA 3P8BB 3M4YA 3CBMA 2F2VA 3J81E 4RG2A 1NPPA 2LDMA 2MF2A 1WHHA 5J3BA 2DE0X 4XTYA 4M77C 4XTZA 1QVGS 1WXTA 2HBWA 3OYDA 3LWHA 4IIOA 3QKJA 4LDWA 4FCYA 4JZ4A 3CMAQ 3J80E 4IUPA 3TEEA 4AT1B 2MIOA 2KK4A 1BK2A 3C95A 2KBTA 1X75C 3KFVA 5FU6B 4RTVA 1VQ6A 2QA4Q 3CMAT 3A8LB 1RUWA 2MYSA 1OZ2A 1H641 3V7RA 1WHKA 1QCNA 2JUFA 2PUKB 1XJWB 3GLXA 4FYYB 2JTFA 2Z0WA 1BI0A 2LQKA 2QA4T 2O88A 1AOJA 5DY9A 1VIFA 4C0ZA 3M56A 2KRNA 2OTLQ 3JB9H 2LMJA 2O9SA 2CGHA 4HVVA 2FB7A 3RR6A 5EC7A 2P4TA 1SRMA 2VVKA 2DL3A 3UDCA 1BBZA 5I2MA 3I9QA 4DOWA 4PJMA 4OF1A 1Q86C 4ZGEB 1OZ3A 3LYIA 5KYWB 2XD0A 2ZPHB 4ANJA 1IO6A 5LJ3h 2IPOB 2K2MA 4AMCA
chains in the Genus database with same CATH topology
1U06A 1WI7A 4HVWA 1VYUA 3CQTA 2GTJA 1QLYA 2NUZA 3QWXX 3FJ5A 1B07A 1ZUUA 1VA7A 3M0TA 4OMMA 2G6FX 4RTYA 4LE9A 5IXFA 4LUEA 2L3SA 1UUEA 1V1CA 1WA7A 1I07A 1GFDA 2A37A 2M0YA 2CT4A 2DF6A 2OAWA 1NYGA 1JQQA 2KYBA 2J6KA 5IH2A 1X2KA 2BZXA 1KFZA 2K79A 2ESWA 2D8HA 4WCIA 3UA6A 3PE0A 4J9BA 1K76A 3I5SA 2EYYA 2YT6A 1QWFA 2BZYA 1WX6A 2PZ1A 4LNPA 3QWYA 4DEYA 1A0NB 2RPNA 3ZL7C 4Y92A 3EGUA 2ROLA 3VS6A 4J9DA 3M0PA 1KSWA 1OV3A 1PWTA 1NM7A 1ZBJA 4HCKA 1MUZA 4A63B 1NLPC 1SHGA 2RNAA 2FO0A 2LQWA 1CSKA 4IIMA 4D8KA 4Z8AA 2KGTA 1VYVA 4F16A 3A98A 4OMPA 2DRKA 2GQIA 3PVQA 2ED0A 4F14A 1AWXA 2K6DA 2LCSA 2ABLA 4JPBW 4KRTA 4GBQA 2D1XA 4D8DA 2XMFA 4DEXA 1VYTA 1S1NA 2EPDA 1H8KA 2LJ1A 2LX7A 1UDLA 4RTWA 2ROTA 3TSZA 2MCNA 1FYNA 2CUDA 2ED1A 1HD3A 1Y0MA 1K1ZA 2I0NA 1T0JA 1AD5A 1H92A 2J06A 5ECAA 1U3OA 2EQIA 2IIMA 2LZ6B 1GBRA 2PNIA 2DJQA 1W6XA 1W70A 1NLOC 2HSPA 4R0KA 1UTIA 2JMAA 1WIEA 2CH4A 2D8JA 3VS5A 2EYXA 2HDAA 2MOXA 1AWOA 1KJWA 3PVLA 1YN8A 1PHTA 1QKXA 1K0SA 2F2XA 4Z89A 1GL5A 2JM8A 3VS4A 1UHCA 4E6RA 4AG1C 2DL8A 4J9FA 1E6GA 3EG0A 4CC2A 1SPKA 1ABQA 1W1FA 2A28A 3NPFA 1JU5C 4F17A 1YNZA 3UA7A 2CREA 1SHFA 1TUCA 2V1QA 1M3AA 1M3CA 2DL5A 2O31A 2M51A 2J7IA 2J6OA 4AFZC 1UG1A 1G83A 1OEBA 1M3BA 3EG2A 2DILA 4OMLA 1JEGA 1WFWA 1AWWA 1M27C 3TSWA 2YSQA 4HXJA 4OMNA 2EGCA 2EVRA 2JT4A 2H8HA 3NGPA 3EG1A 1MV0B 3M0RA 2JS2A 3EHRA 2RQVA 4GLMA 2HCKA 1WYXA 2RMOA 2DBMA 1ARKA 2K3BA 2RQUA 1M8MA 2DYBA 2AKLA 2LJ0A 1ZX6A 5IHIA 2CH4W 1SEMA 1X6BA 1BB9A 1TG0A 2J6FA 3SHWA 1Z9QA 2YUOA 2W0ZA 1T3SA 2JMCA 2A08A 1ZLMA 1FMKA 2EW3A 2K7AA 2DLPA 4RTUA 2VKNA 2AK5A 2YDLA 1ZUYA 2KT8A 2EGAA 2VWFA 1X2QA 1QKWA 2DNUA 5IHKA 2EBPA 5FWCA 2L3PA 4J9GA 1AZEA 3H0IA 2CSQA 2CDTA 4CC7A 2EYWA 1YWPA 1ZUKA 1SSHA 3REAB 2EGEA 2KEAA 1SRLA 3JV3A 2E5KA 2X3XD 2BZ8A 1GBQA 1EFNA 5L23A 4J9HA 2KE9A 1LCKA 1ABOA 2RN8A 3M0SA 4K11A 4J9EA 1PKTA 2C0TA 2DRMA 1NYFA 4JJDA 2P4RA 2JS0A 5GJVB 1JXOA 1K4US 3M0UA 3H0FA 4AFSC 4ZNXA 2PTKA 1UE9A 2DL4A 2GBQA 2C0OA 1E6HA 2A36A 1AVZC 1RLPC 2EKHA 3H41A 2RQRA 2FG0A 1YCSB 2J05A 2CUBA 4RTZA 2YUNA 1E7OA 2FPEA 1GFCA 3VRZA 2AZVA 5GJWB 1PKSA 2NWMA 2C0IA 2RF0A 1NEGA 2LP5A 3VS0A 3M0QA 2YUQA 3REBB 2ENMA 2FRYA 2SEMA 1HSQA 2KXCA 2OJ2A 3U23A 1PNJA 3EHQA 1YWOA 4X1VA 3VRYA 4HVUA 3VS3A 3THKA 1UJYA 2D0NA 2KXDA 1M30A 2OI3A 4RUGA 1KIKA 4J9IA 1T3LA 2KRSA 2RQWA 1I1JA 1GCQA 5IXBA 2W10A 1GCQC 2LNHB 3NHNA 2QDLA 3EG3A 4CC4B 1AWJA 5FW9A 2KR3A 1X27A 3UF4A 4LN2A 1GRIA 1J3TA 3C0CA 1PRLC 2JTEA 1RLQC 2KROA 1TUDA 1AEYA 5HCKA 2K9GA 2BTTA 1CKBA 1WLPB 2DMOA 3VS7A 1RI9A 1B3QA 1OPLA 3VS2A 2KRMA 3I35A 2X3WD 1X69A 2KT1A 1UGVA 3H0HA 4OMQA 2JM9A 2DL7A 4OMOA 2LQNA 1G2BA 4RTXA 2DBKA 1XOVA 2AZSA 1N5ZA 3ULRB 4AG2C 1MV3A 1YP5A 2GNCA 2CT3A 1NEBA 1JO8A 4ESRA 4AFQC 2RQTA 4AFUC 1CKAA 2CSIA 2GTOA 2SRCA 5FWBA 3GBQA 3LH5A 1I0CA 5I11A 2ECZA 1UJ0A 4J9CA 1BU1A 1HJDA 2O2OA 5IHNA 2F2WA 1X43A 2DX1A 3IQLA 4JJBA 1AZGB 4M4ZA 2F2VA 1H3HA 2AKKA 3I5RA 2DE0X 3O5ZA 2DA9A 2L2PA 1WXTA 2HBWA 1WXBA 4EIKA 4IIOA 1U5SA 2KYMA 4JZ4A 2L3QA 2V1RA 1ZSGA 4QT7A 1UHFA 2MIOA 3SEMA 3VS1A 1BK2A 2EYZA 2KBTA 4JJCA 1QCFA 3KFVA 1K9AA 2O9VA 2JXBA 4RTVA 2FRWA 4RTTA 4CC3A 2JW4A 2DVJA 1UECA 1RUWA 4Z88A 4JZ3A 2B86A 3RNJA 1Y57A 2KNBB 2O88A 1AOJA 1QWEA 3UATA 2DM1A 1T0HA 3TVTA 1UFFA 3NMZC 1WXUA 1PRMC 1JXMA 3R6NA 4FSSA 2KRNA 1X6GA 2FPFA 2LMJA 2O9SA 4HVVA 2GGRA 5EC7A 1NG2A 1K0XA 1SRMA 2VVKA 2DL3A 1Z9ZA 1BBZA 2LJ3A 3I9QA 1GCPA 1OPKA 4ORZA 2YUPA 1OOTA 3RBBB 5I22A 1IO6A 2FPDA 2K2MA 2L0AA 4LUDA 1WDXA 2HEQA 2FEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U06 A;  1WI7 A;  4HVW A;  1VYU A;  3CQT A;  2GTJ A;  1QLY A;  2NUZ A;  3QWX X;  3FJ5 A;  1B07 A;  1ZUU A;  1VA7 A;  3M0T A;  4OMM A;  2G6F X;  4RTY A;  4LE9 A;  5IXF A;  4LUE A;  2L3S A;  1UUE A;  1V1C A;  1WA7 A;  1I07 A;  1GFD A;  2A37 A;  2M0Y A;  2CT4 A;  2DF6 A;  2OAW A;  1NYG A;  1JQQ A;  2KYB A;  2J6K A;  5IH2 A;  1X2K A;  2BZX A;  1KFZ A;  2K79 A;  2ESW A;  2D8H A;  4WCI A;  3UA6 A;  3PE0 A;  4J9B A;  1K76 A;  3I5S A;  2EYY A;  2YT6 A;  1QWF A;  2BZY A;  1WX6 A;  2PZ1 A;  4LNP A;  3QWY A;  4DEY A;  1A0N B;  2RPN A;  3ZL7 C;  4Y92 A;  3EGU A;  2ROL A;  3VS6 A;  4J9D A;  3M0P A;  1KSW A;  1OV3 A;  1PWT A;  1NM7 A;  1ZBJ A;  4HCK A;  1MUZ A;  4A63 B;  1NLP C;  1SHG A;  2RNA A;  2FO0 A;  2LQW A;  1CSK A;  4IIM A;  4D8K A;  4Z8A A;  2KGT A;  1VYV A;  4F16 A;  3A98 A;  4OMP A;  2DRK A;  2GQI A;  3PVQ A;  2ED0 A;  4F14 A;  1AWX A;  2K6D A;  2LCS A;  2ABL A;  4JPB W;  4KRT A;  4GBQ A;  2D1X A;  4D8D A;  2XMF A;  4DEX A;  1VYT A;  1S1N A;  2EPD A;  1H8K A;  2LJ1 A;  2LX7 A;  1UDL A;  4RTW A;  2ROT A;  3TSZ A;  2MCN A;  1FYN A;  2CUD A;  2ED1 A;  1HD3 A;  1Y0M A;  1K1Z A;  2I0N A;  1T0J A;  1AD5 A;  1H92 A;  2J06 A;  5ECA A;  1U3O A;  2EQI A;  2IIM A;  2LZ6 B;  1GBR A;  2PNI A;  2DJQ A;  1W6X A;  1W70 A;  1NLO C;  2HSP A;  4R0K A;  1UTI A;  2JMA A;  1WIE A;  2CH4 A;  2D8J A;  3VS5 A;  2EYX A;  2HDA A;  2MOX A;  1AWO A;  1KJW A;  3PVL A;  1YN8 A;  1PHT A;  1QKX A;  1K0S A;  2F2X A;  4Z89 A;  1GL5 A;  2JM8 A;  3VS4 A;  1UHC A;  4E6R A;  4AG1 C;  2DL8 A;  4J9F A;  1E6G A;  3EG0 A;  4CC2 A;  1SPK A;  1ABQ A;  1W1F A;  2A28 A;  3NPF A;  1JU5 C;  4F17 A;  1YNZ A;  3UA7 A;  2CRE A;  1SHF A;  1TUC A;  2V1Q A;  1M3A A;  1M3C A;  2DL5 A;  2O31 A;  2M51 A;  2J7I A;  2J6O A;  4AFZ C;  1UG1 A;  1G83 A;  1OEB A;  1M3B A;  3EG2 A;  2DIL A;  4OML A;  1JEG A;  1WFW A;  1AWW A;  1M27 C;  3TSW A;  2YSQ A;  4HXJ A;  4OMN A;  2EGC A;  2EVR A;  2JT4 A;  2H8H A;  3NGP A;  3EG1 A;  1MV0 B;  3M0R A;  2JS2 A;  3EHR A;  2RQV A;  4GLM A;  2HCK A;  1WYX A;  2RMO A;  2DBM A;  1ARK A;  2K3B A;  2RQU A;  1M8M A;  2DYB A;  2AKL A;  2LJ0 A;  1ZX6 A;  5IHI A;  2CH4 W;  1SEM A;  1X6B A;  1BB9 A;  1TG0 A;  2J6F A;  3SHW A;  1Z9Q A;  2YUO A;  2W0Z A;  1T3S A;  2JMC A;  2A08 A;  1ZLM A;  1FMK A;  2EW3 A;  2K7A A;  2DLP A;  4RTU A;  2VKN A;  2AK5 A;  2YDL A;  1ZUY A;  2KT8 A;  2EGA A;  2VWF A;  1X2Q A;  1QKW A;  2DNU A;  5IHK A;  2EBP A;  5FWC A;  2L3P A;  4J9G A;  1AZE A;  3H0I A;  2CSQ A;  2CDT A;  4CC7 A;  2EYW A;  1YWP A;  1ZUK A;  1SSH A;  3REA B;  2EGE A;  2KEA A;  1SRL A;  3JV3 A;  2E5K A;  2X3X D;  2BZ8 A;  1GBQ A;  1EFN A;  5L23 A;  4J9H A;  2KE9 A;  1LCK A;  1ABO A;  2RN8 A;  3M0S A;  4K11 A;  4J9E A;  1PKT A;  2C0T A;  2DRM A;  1NYF A;  4JJD A;  2P4R A;  2JS0 A;  5GJV B;  1JXO A;  1K4U S;  3M0U A;  3H0F A;  4AFS C;  4ZNX A;  2PTK A;  1UE9 A;  2DL4 A;  2GBQ A;  2C0O A;  1E6H A;  2A36 A;  1AVZ C;  1RLP C;  2EKH A;  3H41 A;  2RQR A;  2FG0 A;  1YCS B;  2J05 A;  2CUB A;  4RTZ A;  2YUN A;  1E7O A;  2FPE A;  1GFC A;  3VRZ A;  2AZV A;  5GJW B;  1PKS A;  2NWM A;  2C0I A;  2RF0 A;  1NEG A;  2LP5 A;  3VS0 A;  3M0Q A;  2YUQ A;  3REB B;  2ENM A;  2FRY A;  2SEM A;  1HSQ A;  2KXC A;  2OJ2 A;  3U23 A;  1PNJ A;  3EHQ A;  1YWO A;  4X1V A;  3VRY A;  4HVU A;  3VS3 A;  3THK A;  1UJY A;  2D0N A;  2KXD A;  1M30 A;  2OI3 A;  4RUG A;  1KIK A;  4J9I A;  1T3L A;  2KRS A;  2RQW A;  1I1J A;  1GCQ A;  5IXB A;  2W10 A;  1GCQ C;  2LNH B;  3NHN A;  2QDL A;  3EG3 A;  4CC4 B;  1AWJ A;  5FW9 A;  2KR3 A;  1X27 A;  3UF4 A;  4LN2 A;  1GRI A;  1J3T A;  3C0C A;  1PRL C;  2JTE A;  1RLQ C;  2KRO A;  1TUD A;  1AEY A;  5HCK A;  2K9G A;  2BTT A;  1CKB A;  1WLP B;  2DMO A;  3VS7 A;  1RI9 A;  1B3Q A;  1OPL A;  3VS2 A;  2KRM A;  3I35 A;  2X3W D;  1X69 A;  2KT1 A;  1UGV A;  3H0H A;  4OMQ A;  2JM9 A;  2DL7 A;  4OMO A;  2LQN A;  1G2B A;  4RTX A;  2DBK A;  1XOV A;  2AZS A;  1N5Z A;  3ULR B;  4AG2 C;  1MV3 A;  1YP5 A;  2GNC A;  2CT3 A;  1NEB A;  1JO8 A;  4ESR A;  4AFQ C;  2RQT A;  4AFU C;  1CKA A;  2CSI A;  2GTO A;  2SRC A;  5FWB A;  3GBQ A;  3LH5 A;  1I0C A;  5I11 A;  2ECZ A;  1UJ0 A;  4J9C A;  1BU1 A;  1HJD A;  2O2O A;  5IHN A;  2F2W A;  1X43 A;  2DX1 A;  3IQL A;  4JJB A;  1AZG B;  4M4Z A;  2F2V A;  1H3H A;  2AKK A;  3I5R A;  2DE0 X;  3O5Z A;  2DA9 A;  2L2P A;  1WXT A;  2HBW A;  1WXB A;  4EIK A;  4IIO A;  1U5S A;  2KYM A;  4JZ4 A;  2L3Q A;  2V1R A;  1ZSG A;  4QT7 A;  1UHF A;  2MIO A;  3SEM A;  3VS1 A;  1BK2 A;  2EYZ A;  2KBT A;  4JJC A;  1QCF A;  3KFV A;  1K9A A;  2O9V A;  2JXB A;  4RTV A;  2FRW A;  4RTT A;  4CC3 A;  2JW4 A;  2DVJ A;  1UEC A;  1RUW A;  4Z88 A;  4JZ3 A;  2B86 A;  3RNJ A;  1Y57 A;  2KNB B;  2O88 A;  1AOJ A;  1QWE A;  3UAT A;  2DM1 A;  1T0H A;  3TVT A;  1UFF A;  3NMZ C;  1WXU A;  1PRM C;  1JXM A;  3R6N A;  4FSS A;  2KRN A;  1X6G A;  2FPF A;  2LMJ A;  2O9S A;  4HVV A;  2GGR A;  5EC7 A;  1NG2 A;  1K0X A;  1SRM A;  2VVK A;  2DL3 A;  1Z9Z A;  1BBZ A;  2LJ3 A;  3I9Q A;  1GCP A;  1OPK A;  4ORZ A;  2YUP A;  1OOT A;  3RBB B;  5I22 A;  1IO6 A;  2FPD A;  2K2M A;  2L0A A;  4LUD A;  1WDX A;  2HEQ A;  2FEI A; 
#chains in the Genus database with same CATH topology
 1U06 A;  3PGG A;  4PJO A;  3CQT A;  1QLY A;  4Z02 A;  1BYM A;  5IT9 E;  4MDW A;  3EGX B;  3HTR A;  2L3S A;  1JJ2 A;  1I07 A;  4L6V 5;  2K3X A;  1B7T A;  4QVD A;  4HCZ A;  4DOV A;  2DF6 A;  1NYG A;  2KYB A;  2KSS A;  4M78 A;  2K79 A;  3WVE B;  3UA6 A;  3PE0 A;  4J9B A;  1K76 A;  3I5S A;  2EYY A;  3G4S A;  1QWF A;  4C0F A;  2BZY A;  2WSF E;  1WX6 A;  2P84 A;  3VUZ A;  3QWY A;  1I5O B;  3M57 A;  4EMH A;  4EMK B;  3EGU A;  3QG1 A;  2ROL A;  3FB9 A;  1ZSZ C;  2DTH A;  1PWT A;  1ZBJ A;  5A0G A;  1MUZ A;  2D0Q B;  2DD4 A;  1BIA A;  1D1B A;  1AT1 B;  4XU2 A;  3QSU A;  1BCO A;  4IIM A;  4C92 C;  2AHJ B;  3CCE Q;  3A98 A;  1MHN A;  4DBR A;  1PSE A;  2DRK A;  1YBY A;  3PVQ A;  2QEX Q;  4OB1 B;  3I56 A;  4PJN A;  2E3I A;  2RHZ A;  5GAO n;  2ZPG B;  2D1X A;  4J8O A;  1VYT A;  2DET A;  3AHU A;  2EPD A;  2LJ1 A;  5IAY A;  2QEX T;  1RAG B;  4NS5 A;  4X9D A;  4C8Q A;  2MCN A;  2CUD A;  3C4S A;  1YJW A;  1NZ9 A;  1Y0M A;  3CC7 A;  1K1Z A;  5KYW A;  1W2B S;  5ECA A;  1UB4 A;  5LJ3 d;  2IIM A;  2CP6 A;  2PNI A;  2DJQ A;  1N8R R;  2HSP A;  3LH0 A;  3CD6 A;  1VQN A;  1UTI A;  2AIR B;  1K8A U;  3L2Z A;  3VS5 A;  3ASK A;  2QAZ A;  2COZ A;  1AWO A;  3PVL A;  2F2X A;  2RK2 A;  1NJI R;  4XU1 A;  3JCM h;  3QII A;  5KYX A;  4NL3 A;  4E7L A;  1ZA2 B;  4WTO B;  4AG1 C;  2YRV A;  2DL8 A;  5GAO p;  3OYK A;  1VIE A;  4C92 D;  3L2V A;  4RG8 A;  4F17 A;  3RDV A;  1JBM A;  2C06 A;  3GOX A;  4C92 G;  4ZN3 A;  5CKB A;  3JSC A;  2M51 A;  3S3O A;  1BCM A;  2ZZD A;  3OYJ A;  1G83 A;  3TRE A;  5GMK i;  5LJ5 h;  3BFM A;  2DFU A;  3JCM c;  3CMA A;  3EG2 A;  1YIT Q;  4QQG A;  1H3Z A;  2DIL A;  4LD6 A;  4M75 A;  4PK4 A;  3NFC A;  3SWN B;  4XAX B;  1K9M U;  1Q81 C;  2FZK B;  1WFW A;  3I55 T;  3FJP A;  3TSW A;  2YSQ A;  4HXJ A;  2FVU A;  2QA4 A;  2JT4 A;  4VUB A;  1YIT T;  5KCH A;  2X9H A;  2X4W A;  4IUQ A;  2DBM A;  1K73 U;  3OMC A;  1ARK A;  2K3B A;  4J83 A;  2RK1 A;  3BW1 A;  2AKL A;  5GAO l;  4XU3 A;  2EKO A;  2CH4 W;  1SEM A;  2E5Q A;  1X6B A;  1M1G A;  2J6F A;  2YUO A;  2W0Z A;  1Q82 U;  1T3S A;  2JOY A;  2YLC A;  3HRS A;  5GMK l;  1FMK A;  2EW3 A;  2LT1 A;  2HKQ B;  2K7A A;  4J6X A;  4FSX A;  3PT9 A;  1HYO A;  4PJO F;  1M1K U;  3EFS A;  2YDL A;  3S6W A;  5CR2 A;  2YLB A;  1D3B B;  2KVQ G;  3CXC P;  4A4K A;  2HZY A;  1RAE B;  5KYY B;  2QDY B;  2DNU A;  2K2V A;  5FRM A;  4A4G A;  4IUT A;  4XQ3 A;  3ZBD A;  5FWC A;  1WQ7 A;  3OBW A;  2XDD A;  1SSF A;  4IUU A;  4CC7 A;  1WHM A;  3VYG A;  3CCU Q;  3JCM d;  4L5G A;  2LQ8 A;  4M7D B;  1SRL A;  1FX7 A;  3JV3 A;  2E5K A;  1PCX A;  2BZ8 A;  3CBO A;  3P8D A;  1RAH B;  5L23 A;  3CCU T;  1LCK A;  4K11 A;  5D7U A;  4J9E A;  4PJO E;  2C0T A;  4JJD A;  3HSB A;  1WHJ A;  3CCR Q;  1Q86 R;  1JXO A;  2PTK A;  2GBQ A;  2C0O A;  1MMG A;  3CCQ Q;  1SG5 A;  2QQ9 A;  1VQP T;  5LJ5 d;  3JB9 F;  3KXT A;  2QQA A;  2YUN A;  2PQW A;  1E7O A;  3PMT A;  3CCQ T;  2FPE A;  1KG1 A;  1MMA A;  2CYZ B;  2AZV A;  2NWM A;  1JB0 E;  1S72 T;  4JRK A;  2LP5 A;  4OMF B;  1KQS P;  2OJ2 A;  1PNJ A;  3EHQ A;  1QQJ A;  2F5T X;  4N4I A;  1UJY A;  1VQL Q;  3PNW C;  3OMG A;  2OI3 A;  2EIF A;  2K4Y A;  1N9S A;  3EFO A;  2OTJ Q;  2QEX A;  1Q7Y C;  2DXU A;  2YXY A;  5I21 A;  2PU9 B;  1MNE A;  2RQW A;  1I1J A;  5IXB A;  3QJY A;  1VQL T;  1GCQ C;  2LNH B;  3NHN A;  4CC4 B;  3CME Q;  1QVF P;  2E65 A;  2OTJ T;  3DLL A;  2VGN A;  1OX9 A;  2LCC A;  1G3S A;  2JTE A;  5KYY A;  1TUD A;  1AEY A;  3V8J A;  2BIV A;  2QTV A;  5GAN 3;  3MO8 A;  3CME T;  1B3Q A;  2QXF A;  3VS2 A;  3QDR B;  2DPP B;  4BAC A;  4BE0 A;  4OGC A;  2FYK A;  2X3W D;  4M7D A;  3VU3 C;  2HQX A;  1KQ2 A;  1ZHI A;  3OY9 A;  4A4F A;  4AG2 C;  2GNC A;  2CS7 A;  4KGX B;  5FWB A;  1W4S A;  1TSF A;  1I0C A;  2XHC A;  1DJ7 B;  1UJ0 A;  1YCY A;  1X43 A;  2DX1 A;  4M75 F;  3IQL A;  1VQ5 T;  4M7A B;  4JJB A;  1AZG B;  4M4Z A;  2AKK A;  2BE9 B;  2GCX A;  3I5R A;  4XTU A;  5LJ3 e;  2MWO A;  3QXE B;  3GP8 A;  2DA9 A;  1D0X A;  1WXB A;  2LX9 A;  3WXM B;  3I55 A;  4J5Y A;  2L3Q A;  3VKI A;  2HAX A;  1YIT A;  2V1R A;  3FIF A;  5FRN A;  1ZSG A;  4OB3 B;  4ZGJ B;  3VS1 A;  4MZP A;  4J6W A;  5IN1 A;  1K9A A;  2O9V A;  2JXB A;  3CCM T;  2GFA A;  1RAC B;  4CC3 A;  2DVJ A;  1UEC A;  4Z88 A;  5D6W A;  3QO3 A;  3G4S Q;  5KE2 A;  2B86 A;  4M75 E;  2EYQ A;  3SB2 A;  1AHJ B;  1YJN T;  2AT1 B;  1Y57 A;  3MPU B;  1KHI A;  5GAO m;  1QWE A;  4OB2 B;  3OSV A;  4R55 A;  2K3Y A;  3NMZ C;  3NTI A;  4EDU A;  1PRM C;  4LDY A;  1B34 B;  3R6N A;  5GMK m;  4FSS A;  2YHT A;  4JS5 A;  2KY9 A;  3DB4 A;  1IZ6 A;  5DLO A;  3MEU A;  1WZO A;  2GGR A;  4C5G A;  1Q81 R;  3CBP A;  1K0X A;  1Z9Z A;  1GCP A;  2YUP A;  2MI6 A;  1YI2 T;  1BKB A;  2RA2 A;  5I22 A;  2FPD A;  1OI1 A;  3OYH A;  3HRT A;  2JTM A;  2HEQ A;  4LXC A;  2CP3 A;  3CCU A;  3QWX X;  4PJO C;  3CCS Q;  1B07 A;  3BDU A;  2H3J A;  2NUP B;  5HKC A;  2G6F X;  4ELZ C;  5IXF A;  4KUI A;  1M90 U;  3CC7 Q;  2DD5 A;  7AT1 B;  1D1A A;  4M7A A;  3CCS T;  3CXC A;  2F5K A;  5KYU B;  2L8D A;  2CT4 A;  2JZ2 A;  1VQO T;  1WJR A;  1VQP A;  5AT1 B;  4M78 C;  2ESW A;  2D8H A;  3CCQ A;  3EH1 A;  4RMO A;  1X01 A;  2EQK A;  1BI3 A;  2PZ1 A;  1S72 A;  4LNP A;  4DEY A;  5GAN 2;  1V76 A;  1M2O A;  3JCM e;  1M5Q 1;  5AYF A;  4LDU A;  4IKF A;  3MHX A;  5D6Y A;  4KUD K;  1SHG A;  5GAN h;  1YJ9 Q;  3BY7 A;  3L2R A;  5GMK j;  4J7F A;  4V2S A;  2LTO A;  5FU7 B;  3KBG A;  2K57 A;  4OMP A;  1I4K 1;  1VQ7 Q;  1VQL A;  1M1F A;  2RJF A;  2ED0 A;  2PVG B;  2MMP A;  3HP9 A;  4MZT A;  1YJ9 T;  2OTJ A;  2K6D A;  3HPW A;  1RAB B;  2R58 A;  5LJ5 e;  1VQ7 T;  3RUX A;  1M9S A;  1S1N A;  1R0C B;  3M53 A;  4M7D F;  3CME A;  3LLR A;  4BUG A;  4RTW A;  1KC8 C;  1ACM B;  3L2U A;  4C8Q C;  1YFN A;  1KQS A;  4NOY A;  1T0J A;  4M78 D;  1AD5 A;  4FW1 A;  5GAN 6;  2EQI A;  2VXF A;  1U1T A;  2BE7 D;  4M78 G;  3CCL T;  1KD1 C;  2B8A A;  3MCA B;  4CI0 C;  2CP0 A;  2VB6 A;  3ME9 A;  2LRQ A;  2NUP A;  2VC8 A;  1M2V A;  5KH6 A;  1Q7Y R;  1TH7 A;  2EYX A;  1RI0 A;  1KJW A;  1YN8 A;  1C1A A;  1GL5 A;  2HQE A;  1QVF A;  2RH2 A;  1VQ5 A;  1UHC A;  4M77 B;  2X4Y A;  3OS5 A;  2R5A A;  3OSS C;  4M7D E;  3M54 A;  1SPK A;  1MMD A;  1W1F A;  1ZBX A;  2A28 A;  2EFI A;  4QQD A;  3NPF A;  2QQB A;  4M77 D;  1YNZ A;  2CKK A;  9ATC B;  5GAN 4;  4M77 G;  1M3C A;  2DL5 A;  1VQ9 T;  1XTD A;  1LPL A;  1UG1 A;  5J39 A;  1BIB A;  2V26 A;  1OEB A;  2JVV A;  3CCM A;  3H9N A;  3OYC A;  5GAN d;  4M75 C;  4C8Q D;  4OML A;  1JEG A;  1AWW A;  2COW A;  1YJN A;  1OX8 A;  2DTI A;  4C8Q G;  1M27 C;  4OMN A;  2F69 A;  3EG1 A;  1MV0 B;  3DB3 A;  3EHR A;  3JB9 I;  2RQV A;  2EQU A;  4BB7 A;  3JAM E;  2RQU A;  3RKW A;  1M8M A;  4FM4 B;  1WQW A;  3A8O B;  1TG0 A;  1VQ4 Q;  5GAO r;  2LT4 A;  2VAS A;  4A4H A;  4D6W A;  2DLP A;  1I81 A;  3HKS A;  2VKN A;  1I8F A;  5CCA A;  4JDS A;  4JS4 A;  2AK5 A;  1VQ4 T;  1RAI B;  3SDZ A;  2EGA A;  2KI7 A;  5CK9 A;  4ZN1 A;  4M7A F;  3G6E T;  2EBP A;  4J9G A;  2ZPF B;  1QVP A;  1YWP A;  3X26 B;  4FU6 A;  1SSH A;  3H6Z A;  2CZ6 B;  1OU9 A;  3CCS A;  2HKN A;  1TU0 B;  1VQO A;  3OYB A;  4A54 A;  1GBQ A;  4PLL A;  1OUL A;  2ZGW A;  3M0S A;  4HCC A;  3OYY A;  1NYF A;  2P4R A;  5GJV B;  4ZGD B;  1K4U S;  3M0U A;  3H0F A;  4AFS C;  3GIB A;  4FW2 A;  2X4J A;  3EGX A;  2QQS A;  2A36 A;  1AVZ C;  3RMS A;  2JN0 A;  4M7A E;  1G3W A;  4C92 B;  4RTZ A;  3VUB A;  2M0O A;  3OW2 P;  1UGR B;  1D09 B;  2VV5 A;  1GFC A;  1EX4 A;  1PKS A;  2C0I A;  2RF0 A;  1NEG A;  3GNG A;  4F7U B;  3M0Q A;  2E12 A;  3UPU A;  2SEM A;  1VQ8 Q;  1WPY A;  2KMT A;  1YJ9 A;  1YWO A;  2NYS A;  5GAO q;  4EMK A;  1BI2 A;  2D0N A;  1KHC A;  4UC4 A;  4CRI A;  1VQ7 A;  3I55 Q;  4F7U G;  3OB9 A;  4RKU E;  1WGS A;  4J9I A;  2QGG A;  2RJE A;  3RKX A;  4A4E A;  1VQ8 T;  2NUT B;  4E7H A;  3UWN A;  1YIJ Q;  2QYZ A;  3JCM W;  3F70 A;  3J7A F;  2KR3 A;  4ME7 A;  1X27 A;  4LN2 A;  5LL6 S;  1J3T A;  3CCL A;  3FDR A;  1PRL C;  2KRO A;  2M9U A;  1YIJ T;  1CKB A;  3ZEH A;  1VQM T;  2DMO A;  1HXD A;  1RI9 A;  2E1H A;  1WHL A;  4TVR A;  1K8A C;  4FL6 A;  3H0H A;  1G3Y A;  3V8K A;  2JM9 A;  4ATO A;  1XOV A;  2CZ7 B;  3BDL A;  1N5Z A;  1W2B P;  1YP5 A;  3X25 B;  4JLI A;  2RQT A;  5GAN 8;  1CKA A;  3SD4 A;  2CSI A;  1KQS S;  2SRC A;  4ZTF A;  1KC8 R;  3M5A A;  3LH5 A;  3URG A;  2ECZ A;  3A5Z B;  2XDB A;  3QDF A;  2K5L A;  2WAC A;  4JRP A;  2L89 A;  2O2O A;  5IHN A;  2F2W A;  3CC4 Q;  3ER0 A;  1KD1 R;  4HA8 A;  2DO3 A;  2DEQ A;  3A1P A;  5L8R E;  1PD0 A;  3D7S B;  4C92 A;  3DKM A;  3O5Z A;  4WF2 A;  1OYX A;  4BE2 A;  2L2P A;  2QG9 B;  3MEA A;  3CC4 T;  2KYM A;  4MML A;  1TWB A;  3JRZ A;  1K9M C;  5D6X A;  5GAM e;  4QT7 A;  2EYZ A;  1VQP Q;  1TS9 A;  4JJC A;  4RTT A;  1IHV A;  1K73 C;  3NTK A;  3DLM A;  3RNJ A;  2NUT A;  1S72 Q;  2I2L A;  1JJ2 S;  3ZFJ A;  3SWN A;  1Q82 C;  1C0M A;  2XDP A;  3UAT A;  1VQ4 A;  4FYV B;  4B6M A;  1WXU A;  1JXM A;  2A0F B;  3H8Z A;  1M1K C;  2ZPE B;  1X6G A;  1Y96 B;  2RJD A;  2ZPB B;  4KT0 E;  2D6F A;  1PSF A;  1NG2 A;  3G6E A;  4N4G A;  4BI8 B;  5GAN e;  4BI4 A;  1OPK A;  1MND A;  1VQK T;  1OOT A;  3HL8 A;  3UT1 A;  3RBB B;  4QKU A;  3OS2 A;  3CPW P;  4J6Y A;  4LUD A;  3TVT A;  2A08 A;  2VUB A;  4GLK A;  4BY6 C;  1VYU A;  2NUZ A;  3M58 A;  1D3B A;  1QP3 A;  3V7S A;  3M0T A;  1SF9 A;  2RHU A;  4OMM A;  2V8I A;  3OYN A;  4RTY A;  1V1C A;  1WA7 A;  1GFD A;  2A37 A;  3TQ7 P;  1R77 A;  5DLQ E;  2EJF A;  2M0Y A;  3E1S A;  4N0A C;  2CP2 A;  2OAW A;  1JQQ A;  5IH2 A;  2BZX A;  2L5Q A;  2QTX A;  2PUO B;  3GF5 A;  2YT6 A;  3QYH B;  2D9T A;  1VQ5 Q;  1VQ6 T;  2X51 A;  3ZL7 C;  1ZQ1 A;  4Y92 A;  3RKY A;  5CVI A;  1KSW A;  2P0K A;  4E47 A;  1NM7 A;  2DKG A;  4A63 B;  3INZ A;  1Y7X A;  1NLP C;  3CCJ Q;  3T9N A;  2RNA A;  2FO0 A;  3BE3 A;  2LQW A;  1CSK A;  1VQ8 A;  2LVM A;  4D8K A;  4F16 A;  4B9X A;  2RHY A;  5CO7 A;  1Q95 G;  1XQH A;  3CCJ T;  3EH2 A;  4E7J A;  3CCM Q;  4PJJ A;  1N8R U;  2ABL A;  4JPB W;  3OW2 A;  2WSE E;  4O5V A;  4DQ2 A;  4GBQ A;  1YIJ A;  3OYF A;  1NE8 A;  4DEX A;  1VQM A;  1YJN Q;  1ZA1 B;  1H8K A;  2LX7 A;  3QJ6 A;  1UDL A;  1NJI U;  4O6J A;  4C0D C;  3LX7 A;  3V7C A;  3TSZ A;  1FYN A;  1HD3 A;  1TOV A;  3M55 A;  1U3O A;  2NLU A;  3MEV A;  5CQX A;  2LZ6 B;  1GBR A;  4QW2 A;  2E4H A;  1W6X A;  2RI3 A;  3LGF A;  5GAN 5;  5GAN 7;  2JMA A;  2CH4 A;  2D8J A;  5M9O A;  3QZ9 B;  2HDA A;  1YI2 Q;  2KQW A;  2XU8 A;  4E7K A;  4DBF A;  1NPR A;  4C92 F;  2O01 E;  2FZC B;  2DXC A;  2DIG A;  3CPF A;  1WJQ A;  5CIU A;  2COY A;  2A7Y A;  4J9F A;  1E6G A;  3EG0 A;  2DZC A;  2JJ9 A;  1QCO A;  2LC4 A;  3FEO A;  3UA7 A;  2KAF A;  2CRE A;  1D0Y A;  2DER A;  3CC4 A;  4PFP A;  2XI9 A;  1MGQ A;  1M3A A;  1K8A R;  3OA6 A;  2FHD A;  2J7I A;  4FT4 A;  4AFZ C;  1VQO Q;  5GAM h;  1W2B A;  3FC3 A;  2E3H A;  1RAF B;  1IXD A;  4FIB A;  8ATC B;  1V29 B;  4E7S A;  4C92 E;  3JCM b;  3VV0 A;  4PL6 A;  3MEW A;  2EGC A;  1KQ1 A;  2EVR A;  3M0R A;  2LNV A;  2XG8 D;  1QP2 A;  5A2Q E;  2A3L A;  5A0D A;  1WYX A;  2DZ9 A;  3NTH A;  4F04 B;  3PIP A;  1R8O B;  1GXI E;  5IHI A;  5I2S A;  1BB9 A;  1VOM A;  1RAD B;  5FU6 C;  4KBM B;  4Y28 E;  2JMC A;  4JLG A;  4OP0 A;  1IHW A;  1K9M R;  3JCM J;  1VQK A;  4RTU A;  2R5M A;  2CZ0 B;  3QUI A;  1I5L A;  1UGQ B;  5LJ3 j;  4PKC C;  4PJO B;  1U8R A;  3L1A A;  1ZUY A;  3E9F A;  5LJ3 f;  1X2Q A;  3MP6 A;  1K73 R;  1QKW A;  3OYG A;  1B34 A;  4PJO D;  1XNI A;  1Q86 U;  3A8H B;  2OX7 A;  2L3P A;  4PJO G;  3H0I A;  4RCC A;  2FL7 A;  2CDT A;  1NBE B;  2EYW A;  4IUR A;  1Q82 R;  2MPX C;  4BI3 A;  1ZUK A;  4RCB A;  2QGF B;  4M78 B;  2IG0 A;  3VYH B;  1M90 C;  4HCB A;  3CCL Q;  2KEA A;  1M1K R;  4OGE A;  2X3X D;  3HHT B;  1EFN A;  2KE9 A;  1ABO A;  4EPC A;  1UE9 A;  4II1 A;  4PNO A;  3CPW A;  1E6H A;  1RLP C;  3H41 A;  2DTO A;  5GAM d;  3X24 B;  1YCS B;  2MWP A;  2J05 A;  2CUB A;  2K5I A;  5KYU A;  1KK7 A;  6AT1 B;  1VUB A;  2OAU A;  1LJO A;  3PMI A;  1VQ9 Q;  2EQM A;  3MET A;  4JRI A;  3JB9 D;  2HD0 A;  3SFM A;  2RHX A;  3VS0 A;  3CCJ A;  3REB B;  2ENM A;  3KUF A;  3JB9 G;  1JRI A;  1HSQ A;  2KXC A;  3X28 B;  3U23 A;  4DBQ A;  3VRY A;  4HT9 A;  3TU4 K;  3THK A;  3PIO A;  2KXD A;  2YRD A;  4EMK C;  1M30 A;  4C8Q B;  5LJ3 g;  2OTL T;  2XID A;  4RUG A;  2E70 A;  1KIK A;  1WHG A;  3QYG B;  5GMK h;  3GNF B;  2W10 A;  2DJZ A;  2QAS A;  3EG3 A;  3QZ5 B;  1QVG P;  1LVK A;  3UF4 A;  3RER A;  1IRE B;  4HT8 A;  1RAA B;  1FXX A;  2RHI A;  2K9G A;  2BTT A;  1UEB A;  2DK3 A;  1D0Z A;  1P92 A;  3VS7 A;  5KYX B;  3LGL A;  1OPL A;  2KRM A;  3I35 A;  3QPH A;  3CEY A;  3OW2 S;  3M4G A;  4LDX A;  5KCO A;  1X69 A;  3L42 A;  3OS1 A;  2Y4Y A;  3N5B B;  2LQN A;  3JCM V;  3JCM f;  2AZS A;  2M02 A;  4XK8 E;  1QMC A;  1YI2 A;  3O8V A;  2CT3 A;  1O75 A;  1JO8 A;  3OYA A;  2RO0 A;  3G6E Q;  2HL5 C;  3QBY A;  8AT1 B;  2GTO A;  4XTX A;  3GBQ A;  3EFR A;  5I11 A;  3G71 Q;  1BU1 A;  4KGV B;  1C6V X;  1X6O A;  2XIC A;  5HK3 A;  3OYI A;  3OYE A;  2M1H A;  4M75 B;  1H3H A;  3G1J A;  5FLX E;  5LJ5 j;  3M9Q A;  1PC0 A;  3G71 T;  5HY6 A;  1Y07 A;  4M77 A;  4X34 A;  5LJ5 f;  4QVC A;  1R0B G;  3OYL A;  4M75 D;  4FT2 A;  4EIK A;  2R57 A;  1U5S A;  4J7I A;  2EJG A;  4BDY A;  4M75 G;  2G3R A;  4L59 A;  2LCL A;  3C94 A;  1UHF A;  1LOJ A;  3SEM A;  3CCE T;  1ZSZ B;  1QCF A;  2QI2 A;  2FRW A;  2DXT A;  1Q81 U;  2JW4 A;  1EZZ B;  4JZ3 A;  4XU0 A;  2VXE A;  4JUV A;  1PM3 A;  2FZG B;  4HKE A;  5KYN A;  2V8K A;  1G5V A;  2KNB B;  2HBP A;  3SWN C;  4E7I A;  2M16 A;  2DM1 A;  1EIF A;  1T0H A;  3CXC S;  1UFF A;  2CZ1 B;  4E2F B;  1OU8 A;  4KH0 B;  3JCM P;  3JCM g;  2FPF A;  4C5H A;  3TCJ A;  2MAM A;  2DIQ A;  2P0Q A;  3V8L A;  3OYM A;  3EAE A;  4MMK A;  2LJ3 A;  1OQK A;  3VJP A;  2YWW A;  4ORZ A;  3CCV Q;  5EG2 A;  2CP5 A;  2F1L A;  2L0A A;  1WDX A;  2FEI A;  1G8X A;  1WI7 A;  4HVW A;  1VQM Q;  1QW1 A;  3CCV T;  2GFU A;  2GTJ A;  3MP8 A;  3FJ5 A;  4GY5 A;  1ZUU A;  1VA7 A;  3JCM Q;  5LJ5 g;  4LE9 A;  4LUE A;  1UUE A;  4X9C A;  5DM7 R;  5CKD A;  4BDZ A;  3QHS A;  2J6K A;  3HFO A;  1X2K A;  4KUL A;  1KFZ A;  1D1C A;  3A8G B;  3E19 A;  4WCI A;  3JB9 J;  4M7D C;  1M4Z A;  3M59 A;  3CC2 Q;  3OS0 A;  3L2Q A;  1A0N B;  1M90 R;  2RPN A;  1ZSZ A;  3VS6 A;  4J9D A;  3M0P A;  4BE1 A;  1PG5 B;  1U1S A;  1OV3 A;  1VQ9 A;  3EFO B;  4HCK A;  3EG9 B;  5KE3 A;  3CC2 T;  2OTL A;  3RES A;  3PTA A;  3CPW S;  2V8J A;  4OB0 B;  4Z8A A;  2KGT A;  1VYV A;  2E41 A;  1QVF S;  3JCM X;  2GQI A;  4LD9 K;  3MJX A;  4BD3 A;  3HFN A;  4F14 A;  1AWX A;  2DEU A;  5CAI A;  4EMG A;  4F7U A;  2LCS A;  4KRT A;  1Q7Y U;  2E6Z A;  2XMF A;  4D8D A;  4M78 F;  4PLI A;  4QVZ A;  1TTH B;  4ELY C;  4QQ6 A;  3GPL A;  2ROT A;  2GQV A;  4PJL A;  2ED1 A;  4C5E A;  3RIR A;  3S3N A;  2I0N A;  1HK9 A;  3PFS A;  2HL3 A;  1H92 A;  2J06 A;  1IRX A;  4M7D D;  1SKU B;  3LWI A;  5CKE A;  1N9R A;  4M7D G;  1W70 A;  5CKH A;  1NLO C;  1IB8 A;  4DA4 A;  2K5F A;  4R0K A;  5FRO A;  1WIE A;  2IVW A;  2YRC A;  1FMV A;  2MOX A;  1F1B B;  1VQK Q;  4B9W A;  3S3M A;  1PHT A;  1QKX A;  3CCR T;  1K0S A;  4Z89 A;  1QVG A;  2JM8 A;  4M77 F;  1UGP B;  3VS4 A;  2EAY A;  4M78 E;  3E2U A;  3MP1 A;  1N6A A;  4E6R A;  1YHQ Q;  2ATC B;  1M8V A;  1IGU A;  4CC2 A;  3G71 A;  1ABQ A;  2E10 A;  1JU5 C;  2P0P A;  3MKD A;  3FLG A;  1SHF A;  1IGQ A;  1TUC A;  1YHQ T;  4N4H A;  2ZCF B;  2V1Q A;  2JNG A;  2O31 A;  2J6O A;  4C8Q F;  3CCE A;  1Y71 A;  4MZM A;  4JJN K;  1TXQ A;  2EWN A;  3EG9 A;  1M3B A;  1FMW A;  1BI1 A;  4M7A C;  5CKF A;  1TUG B;  2MK5 A;  4M77 E;  2GF7 A;  3RMQ A;  2BUD A;  3X20 B;  1VQ6 Q;  2RJC A;  2PVD B;  2H8H A;  3NGP A;  2JS2 A;  3C12 A;  4R56 A;  4NL2 A;  1WJS A;  4GLM A;  2HCK A;  2RMO A;  2PVO B;  2HNI A;  4PFZ A;  2O4X B;  2DYB A;  3R6O A;  2LJ0 A;  1ZX6 A;  3SHW A;  1Z9Q A;  4C8Q E;  5J26 A;  2HSE B;  1ZLM A;  2L3R A;  4XTV A;  4MDX A;  4BY6 B;  1JJ2 P;  2EQJ A;  2E64 A;  4LDV A;  2KT8 A;  2VWF A;  5A0L A;  3OQ5 A;  3CCV A;  4JRQ A;  2H3E B;  4C0G A;  5IHK A;  3E9G A;  1AZE A;  1Y96 A;  3HRU A;  5GAM j;  2CSQ A;  1WNL A;  2EJ9 A;  2Y4X A;  5C6S A;  5GAM f;  4DBH A;  1O9S A;  3REA B;  5GMK e;  1LNX A;  2QK0 A;  2RI5 A;  2EGE A;  4M7A D;  2Y90 A;  4M7A G;  4KGZ B;  4J9H A;  2HMA A;  2RN8 A;  4P5N A;  1PKT A;  2DRM A;  2JS0 A;  2CP7 A;  4ZNX A;  2RD1 A;  2DL4 A;  3EGD B;  4PFO A;  4C5I A;  1PD1 A;  2EKH A;  2RQR A;  2FG0 A;  3P8H A;  2BKD N;  3CC2 A;  5GAN j;  4IUV A;  3G4S T;  5GAN f;  2RM4 A;  3VRZ A;  5GJW B;  4F7U F;  3A8M B;  2WSC E;  2YUQ A;  2XK0 A;  4KH1 B;  4Y91 A;  2FRY A;  2O4X A;  4ZTJ A;  4X1V A;  4C0D B;  4HVU A;  3VS3 A;  2XKO C;  2DYI A;  1N8R C;  3I56 Q;  2RI2 A;  1T3L A;  2VYT A;  1UGS B;  4YTL A;  2KRS A;  3WVD B;  3OBY A;  1GCQ A;  2RB6 A;  2VGM A;  4Q5W A;  1NJI C;  2QDL A;  1AWJ A;  5FW9 A;  5GAM g;  3I56 T;  5FU7 C;  1GRI A;  3FRN A;  1M2V B;  3C0C A;  2KDS A;  1RLQ C;  2E6N A;  1RL2 A;  4XTW A;  5C0M A;  5HCK A;  4F7U E;  1YJW Q;  2ZAE A;  3AT1 B;  1KC8 U;  3G7Z A;  1FWZ A;  1G3T A;  1MMN A;  1WLP B;  2X35 A;  2QQR A;  4N0A A;  5CQY A;  2DAQ A;  2HQH A;  5HK0 A;  2DVE A;  3CCR A;  2DXB A;  4FYW B;  2X4X A;  1YJW T;  2KT1 A;  1KD1 U;  3CC7 T;  1UGV A;  3Q1J A;  1VQN Q;  3CD6 Q;  4OMQ A;  2DL7 A;  4OMO A;  1G2B A;  4RTX A;  2DBK A;  4OVA A;  3ULR B;  1MV3 A;  1NEB A;  4ESR A;  4AFQ C;  1N27 A;  3CD6 T;  4AFU C;  1VQN T;  4E7Z A;  4A53 A;  3LW5 E;  1YHQ A;  4J9C A;  1HJD A;  2ZPI B;  4FYX B;  3EGD A;  5GAN g;  3L2W A;  3P8B B;  3M4Y A;  3CBM A;  2F2V A;  3J81 E;  4RG2 A;  1NPP A;  2LDM A;  2MF2 A;  1WHH A;  5J3B A;  2DE0 X;  4XTY A;  4M77 C;  4XTZ A;  1QVG S;  1WXT A;  2HBW A;  3OYD A;  3LWH A;  4IIO A;  3QKJ A;  4LDW A;  4FCY A;  4JZ4 A;  3CMA Q;  3J80 E;  4IUP A;  3TEE A;  4AT1 B;  2MIO A;  2KK4 A;  1BK2 A;  3C95 A;  2KBT A;  1X75 C;  3KFV A;  5FU6 B;  4RTV A;  1VQ6 A;  2QA4 Q;  3CMA T;  3A8L B;  1RUW A;  2MYS A;  1OZ2 A;  1H64 1;  3V7R A;  1WHK A;  1QCN A;  2JUF A;  2PUK B;  1XJW B;  3GLX A;  4FYY B;  2JTF A;  2Z0W A;  1BI0 A;  2LQK A;  2QA4 T;  2O88 A;  1AOJ A;  5DY9 A;  1VIF A;  4C0Z A;  3M56 A;  2KRN A;  2OTL Q;  3JB9 H;  2LMJ A;  2O9S A;  2CGH A;  4HVV A;  2FB7 A;  3RR6 A;  5EC7 A;  2P4T A;  1SRM A;  2VVK A;  2DL3 A;  3UDC A;  1BBZ A;  5I2M A;  3I9Q A;  4DOW A;  4PJM A;  4OF1 A;  1Q86 C;  4ZGE B;  1OZ3 A;  3LYI A;  5KYW B;  2XD0 A;  2ZPH B;  4ANJ A;  1IO6 A;  5LJ3 h;  2IPO B;  2K2M A;  4AMC A; 
#chains in the Genus database with same CATH homology
 1U06 A;  1WI7 A;  4HVW A;  1VYU A;  3CQT A;  2GTJ A;  1QLY A;  2NUZ A;  3QWX X;  3FJ5 A;  1B07 A;  1ZUU A;  1VA7 A;  3M0T A;  4OMM A;  2G6F X;  4RTY A;  4LE9 A;  5IXF A;  4LUE A;  2L3S A;  1UUE A;  1V1C A;  1WA7 A;  1I07 A;  1GFD A;  2A37 A;  2M0Y A;  2CT4 A;  2DF6 A;  2OAW A;  1NYG A;  1JQQ A;  2KYB A;  2J6K A;  5IH2 A;  1X2K A;  2BZX A;  1KFZ A;  2K79 A;  2ESW A;  2D8H A;  4WCI A;  3UA6 A;  3PE0 A;  4J9B A;  1K76 A;  3I5S A;  2EYY A;  2YT6 A;  1QWF A;  2BZY A;  1WX6 A;  2PZ1 A;  4LNP A;  3QWY A;  4DEY A;  1A0N B;  2RPN A;  3ZL7 C;  4Y92 A;  3EGU A;  2ROL A;  3VS6 A;  4J9D A;  3M0P A;  1KSW A;  1OV3 A;  1PWT A;  1NM7 A;  1ZBJ A;  4HCK A;  1MUZ A;  4A63 B;  1NLP C;  1SHG A;  2RNA A;  2FO0 A;  2LQW A;  1CSK A;  4IIM A;  4D8K A;  4Z8A A;  2KGT A;  1VYV A;  4F16 A;  3A98 A;  4OMP A;  2DRK A;  2GQI A;  3PVQ A;  2ED0 A;  4F14 A;  1AWX A;  2K6D A;  2LCS A;  2ABL A;  4JPB W;  4KRT A;  4GBQ A;  2D1X A;  4D8D A;  2XMF A;  4DEX A;  1VYT A;  1S1N A;  2EPD A;  1H8K A;  2LJ1 A;  2LX7 A;  1UDL A;  4RTW A;  2ROT A;  3TSZ A;  2MCN A;  1FYN A;  2CUD A;  2ED1 A;  1HD3 A;  1Y0M A;  1K1Z A;  2I0N A;  1T0J A;  1AD5 A;  1H92 A;  2J06 A;  5ECA A;  1U3O A;  2EQI A;  2IIM A;  2LZ6 B;  1GBR A;  2PNI A;  2DJQ A;  1W6X A;  1W70 A;  1NLO C;  2HSP A;  4R0K A;  1UTI A;  2JMA A;  1WIE A;  2CH4 A;  2D8J A;  3VS5 A;  2EYX A;  2HDA A;  2MOX A;  1AWO A;  1KJW A;  3PVL A;  1YN8 A;  1PHT A;  1QKX A;  1K0S A;  2F2X A;  4Z89 A;  1GL5 A;  2JM8 A;  3VS4 A;  1UHC A;  4E6R A;  4AG1 C;  2DL8 A;  4J9F A;  1E6G A;  3EG0 A;  4CC2 A;  1SPK A;  1ABQ A;  1W1F A;  2A28 A;  3NPF A;  1JU5 C;  4F17 A;  1YNZ A;  3UA7 A;  2CRE A;  1SHF A;  1TUC A;  2V1Q A;  1M3A A;  1M3C A;  2DL5 A;  2O31 A;  2M51 A;  2J7I A;  2J6O A;  4AFZ C;  1UG1 A;  1G83 A;  1OEB A;  1M3B A;  3EG2 A;  2DIL A;  4OML A;  1JEG A;  1WFW A;  1AWW A;  1M27 C;  3TSW A;  2YSQ A;  4HXJ A;  4OMN A;  2EGC A;  2EVR A;  2JT4 A;  2H8H A;  3NGP A;  3EG1 A;  1MV0 B;  3M0R A;  2JS2 A;  3EHR A;  2RQV A;  4GLM A;  2HCK A;  1WYX A;  2RMO A;  2DBM A;  1ARK A;  2K3B A;  2RQU A;  1M8M A;  2DYB A;  2AKL A;  2LJ0 A;  1ZX6 A;  5IHI A;  2CH4 W;  1SEM A;  1X6B A;  1BB9 A;  1TG0 A;  2J6F A;  3SHW A;  1Z9Q A;  2YUO A;  2W0Z A;  1T3S A;  2JMC A;  2A08 A;  1ZLM A;  1FMK A;  2EW3 A;  2K7A A;  2DLP A;  4RTU A;  2VKN A;  2AK5 A;  2YDL A;  1ZUY A;  2KT8 A;  2EGA A;  2VWF A;  1X2Q A;  1QKW A;  2DNU A;  5IHK A;  2EBP A;  5FWC A;  2L3P A;  4J9G A;  1AZE A;  3H0I A;  2CSQ A;  2CDT A;  4CC7 A;  2EYW A;  1YWP A;  1ZUK A;  1SSH A;  3REA B;  2EGE A;  2KEA A;  1SRL A;  3JV3 A;  2E5K A;  2X3X D;  2BZ8 A;  1GBQ A;  1EFN A;  5L23 A;  4J9H A;  2KE9 A;  1LCK A;  1ABO A;  2RN8 A;  3M0S A;  4K11 A;  4J9E A;  1PKT A;  2C0T A;  2DRM A;  1NYF A;  4JJD A;  2P4R A;  2JS0 A;  5GJV B;  1JXO A;  1K4U S;  3M0U A;  3H0F A;  4AFS C;  4ZNX A;  2PTK A;  1UE9 A;  2DL4 A;  2GBQ A;  2C0O A;  1E6H A;  2A36 A;  1AVZ C;  1RLP C;  2EKH A;  3H41 A;  2RQR A;  2FG0 A;  1YCS B;  2J05 A;  2CUB A;  4RTZ A;  2YUN A;  1E7O A;  2FPE A;  1GFC A;  3VRZ A;  2AZV A;  5GJW B;  1PKS A;  2NWM A;  2C0I A;  2RF0 A;  1NEG A;  2LP5 A;  3VS0 A;  3M0Q A;  2YUQ A;  3REB B;  2ENM A;  2FRY A;  2SEM A;  1HSQ A;  2KXC A;  2OJ2 A;  3U23 A;  1PNJ A;  3EHQ A;  1YWO A;  4X1V A;  3VRY A;  4HVU A;  3VS3 A;  3THK A;  1UJY A;  2D0N A;  2KXD A;  1M30 A;  2OI3 A;  4RUG A;  1KIK A;  4J9I A;  1T3L A;  2KRS A;  2RQW A;  1I1J A;  1GCQ A;  5IXB A;  2W10 A;  1GCQ C;  2LNH B;  3NHN A;  2QDL A;  3EG3 A;  4CC4 B;  1AWJ A;  5FW9 A;  2KR3 A;  1X27 A;  3UF4 A;  4LN2 A;  1GRI A;  1J3T A;  3C0C A;  1PRL C;  2JTE A;  1RLQ C;  2KRO A;  1TUD A;  1AEY A;  5HCK A;  2K9G A;  2BTT A;  1CKB A;  1WLP B;  2DMO A;  3VS7 A;  1RI9 A;  1B3Q A;  1OPL A;  3VS2 A;  2KRM A;  3I35 A;  2X3W D;  1X69 A;  2KT1 A;  1UGV A;  3H0H A;  4OMQ A;  2JM9 A;  2DL7 A;  4OMO A;  2LQN A;  1G2B A;  4RTX A;  2DBK A;  1XOV A;  2AZS A;  1N5Z A;  3ULR B;  4AG2 C;  1MV3 A;  1YP5 A;  2GNC A;  2CT3 A;  1NEB A;  1JO8 A;  4ESR A;  4AFQ C;  2RQT A;  4AFU C;  1CKA A;  2CSI A;  2GTO A;  2SRC A;  5FWB A;  3GBQ A;  3LH5 A;  1I0C A;  5I11 A;  2ECZ A;  1UJ0 A;  4J9C A;  1BU1 A;  1HJD A;  2O2O A;  5IHN A;  2F2W A;  1X43 A;  2DX1 A;  3IQL A;  4JJB A;  1AZG B;  4M4Z A;  2F2V A;  1H3H A;  2AKK A;  3I5R A;  2DE0 X;  3O5Z A;  2DA9 A;  2L2P A;  1WXT A;  2HBW A;  1WXB A;  4EIK A;  4IIO A;  1U5S A;  2KYM A;  4JZ4 A;  2L3Q A;  2V1R A;  1ZSG A;  4QT7 A;  1UHF A;  2MIO A;  3SEM A;  3VS1 A;  1BK2 A;  2EYZ A;  2KBT A;  4JJC A;  1QCF A;  3KFV A;  1K9A A;  2O9V A;  2JXB A;  4RTV A;  2FRW A;  4RTT A;  4CC3 A;  2JW4 A;  2DVJ A;  1UEC A;  1RUW A;  4Z88 A;  4JZ3 A;  2B86 A;  3RNJ A;  1Y57 A;  2KNB B;  2O88 A;  1AOJ A;  1QWE A;  3UAT A;  2DM1 A;  1T0H A;  3TVT A;  1UFF A;  3NMZ C;  1WXU A;  1PRM C;  1JXM A;  3R6N A;  4FSS A;  2KRN A;  1X6G A;  2FPF A;  2LMJ A;  2O9S A;  4HVV A;  2GGR A;  5EC7 A;  1NG2 A;  1K0X A;  1SRM A;  2VVK A;  2DL3 A;  1Z9Z A;  1BBZ A;  2LJ3 A;  3I9Q A;  1GCP A;  1OPK A;  4ORZ A;  2YUP A;  1OOT A;  3RBB B;  5I22 A;  1IO6 A;  2FPD A;  2K2M A;  2L0A A;  4LUD A;  1WDX A;  2HEQ A;  2FEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...