1BK2A

A-spectrin sh3 domain d48g mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sh3-domain
molecule keywords A-SPECTRIN
publication title Obligatory steps in protein folding and the conformational diversity of the transition state.
pubmed doi rcsb
source organism Gallus gallus
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1bk2A00
2RPNA 1KSWA 1YCSB 4D8DA 2NUZA 1UJ0A 2JM9A 1YWPA 2RQWA 2KYBA 2PZ1A 4JPBW 1AZEA 4LUEA 2JW4A 1YWOA 1PKTA 1QKWA 3TSZA 3H0HA 2FRWA 3IQLA 4QT7A 1ZBJA 4J9FA 4J9DA 3PVQA 2DBKA 2C0IA 1ZSGA 1UECA 2BZXA 1J3TA 1VYUA 2LNHB 1ZUYA 2DL4A 1ABQA 2CUBA 2IIMA 3SEMA 2D8HA 1RLPC 2KBTA 2D8JA 1W6XA 4RTTA 1UTIA 2AK5A 3SHWA 2CUDA 3VS7A 3QWXX 5FW9A 2MCNA 2J06A 3A98A 1UUEA 2EKHA 2GTOA 4D8KA 1QLYA 1K76A 1PHTA 2JMAA 4ORZA 2J6OA 1WLPB 1W70A 2DF6A 2CREA 2GBQA 1TUDA 1UJYA 2JT4A 1QWFA 2NWMA 3EG0A 1ABOA 1MV3A 1NLPC 1OV3A 3VS6A 3REAB 1AD5A 1OPKA 4KRTA 4J9EA 2EYXA 2LJ1A 2EQIA 2DM1A 2O9SA 1AWJA 3VS4A 1CKAA 5IHIA 1ZX6A 1SEMA 1K0XA 3NHNA 3THKA 2CH4A 2KT8A 1TG0A 1FMKA 2CH4W 2J6FA 2OJ2A 3EHRA 2EYZA 1AOJA 4OMPA 2DL3A 1ZLMA 2YDLA 1JO8A 2RMOA 3I9QA 2KROA 4HCKA 2RQUA 4JJCA 2F2VA 2DJQA 2L3SA 2G6FX 2L3PA 1B07A 1GCQA 4OMOA 1M8MA 1T3SA 2ROLA 2AZSA 2C0OA 2GNCA 2PNIA 5GJVB 1BBZA 2F2XA 3TVTA 4CC3A 2KXDA 2BZ8A 2GTJA 1GBQA 1KJWA 1WA7A 2PTKA 2CSIA 1GCQC 2FG0A 5IXFA 2LX7A 4J9GA 2JS0A 4JZ4A 2KYMA 3H0IA 1OOTA 1FYNA 3LH5A 2JS2A 3NPFA 5L23A 1X2KA 1HJDA 1VA7A 2JXBA 1GFDA 2EYYA 2RF0A 3QWYA 2MIOA 4J9BA 1WFWA 2D0NA 4OMNA 1QCFA 2KXCA 2O2OA 1WIEA 2ECZA 4JJDA 2DMOA 2FRYA 4AG1C 2DNUA 2LZ6B 1UG1A 1G83A 2H8HA 1SPKA 2X3XD 3EG1A 1NEBA 2RQRA 1N5ZA 3M0PA 4AFQC 1H92A 4F17A 1NYGA 2EVRA 2LJ3A 3M0QA 2V1RA 4IIMA 2K7AA 4CC7A 2E5KA 2DRKA 2ABLA 1SRLA 2CSQA 2A28A 5IHKA 3O5ZA 5IH2A 4Z8AA 4HVWA 1Z9ZA 2EPDA 1BK2A 2KRMA 3EGUA 5HCKA 2QDLA 2L3QA 4R0KA 2LJ0A 1X6BA 1HSQA 2W10A 1A0NB 2LCSA 4ESRA 1G2BA 1I0CA 2O9VA 4CC2A 5IXBA 1T0JA 1UDLA 2ED0A 1X43A 4JJBA 2FEIA 2RQVA 1LCKA 1M3CA 1SSHA 2ROTA 1AVZC 1M30A 4OMLA 1W1FA 1E7OA 1UHCA 4JZ3A 4LNPA 1WX6A 2I0NA 2GGRA 1GRIA 2FO0A 2EGAA 1U06A 4EIKA 1K4US 2KNBB 2LP5A 1UGVA 5GJWB 3UF4A 1QKXA 1MV0B 1ZUUA 1XOVA 2YT6A 2A37A 1WXTA 1WYXA 2EYWA 3M0RA 1RUWA 2EGCA 2HCKA 2RNAA 1EFNA 2RQTA 3NMZC 4RTWA 4Y92A 3VS2A 1JQQA 3PVLA 2KGTA 2EBPA 2EGEA 2HBWA 1BB9A 1K0SA 4RTUA 1GFCA 5ECAA 3RNJA 3RBBB 2L0AA 1WI7A 2K3BA 5FWCA 2O31A 4LN2A 3UA6A 3H41A 2VVKA 2F2WA 1JXMA 2JMCA 1NG2A 2HSPA 2CDTA 2VWFA 4E6RA 1K1ZA 1UE9A 3VS5A 3FJ5A 2FPDA 2XMFA 1H8KA 2K9GA 4AFSC 4F16A 1NLOC 1I1JA 1I07A 1WXUA 2DYBA 2GQIA 2ED1A 4OMMA 3GBQA 3PE0A 2RN8A 1U5SA 1X6GA 3M0SA 1IO6A 1WDXA 3VRZA 2VKNA 4J9IA 4HVVA 3H0FA 1CSKA 2DLPA 2M0YA 1S1NA 3EHQA 2KRNA 1M3BA 1ZUKA 1NEGA 2FPFA 3C0CA 2JM8A 1K9AA 2KRSA 4WCIA 2LMJA 1YN8A 2AKKA 3UA7A 2JTEA 4DEXA 3ULRB 1E6HA 1PWTA 1X69A 1RLQC 3TSWA 4CC4B 4A63B 2ESWA 2DA9A 1OEBA 1M3AA 1E6GA 1SHFA 4RTYA 3U23A 1PRMC 2L2PA 4AFUC 2HEQA 2FPEA 1UHFA 1SHGA 1Y57A 2KE9A 3CQTA 3I35A 2AKLA 2M51A 2LQNA 1M27C 1ARKA 4AG2C 1OPLA 2J05A 1U3OA 2C0TA 2ENMA 5IHNA 4F14A 3UATA 2BZYA 2K79A 1QWEA 1VYVA 2DVJA 2YUQA 3REBB 2EW3A 1AWXA 3EG2A 1Y0MA 5I11A 3VS1A 1GCPA 1CKBA 4AFZC 2W0ZA 1GBRA 5EC7A 2SEMA 2D1XA 1TUCA 2P4RA 1AEYA 2CT4A 2X3WD 1B3QA 1BU1A 1V1CA 1PKSA 1PNJA 4GLMA 2OI3A 4X1VA 3R6NA 2AZVA 3KFVA 2DBMA 1MUZA 1SRMA 4LE9A 2LQWA 4RTZA 3ZL7C 4DEYA 2DL5A 3VRYA 3EG3A 2DILA 1PRLC 2J6KA 2HDAA 2MOXA 2DRMA 1T0HA 1JEGA 1KIKA 4RUGA 1RI9A 3JV3A 1AWOA 2CT3A 2A36A 2KR3A 4J9HA 4M4ZA 3VS0A 1YP5A 1NYFA 4FSSA 3NGPA 4HXJA 1HD3A 1GL5A 3M0UA 2DL7A 3VS3A 4Z88A 1JU5C 1Z9QA 5FWBA 2J7IA 1AWWA 2DE0X 2A08A 4Z89A 1AZGB 3M0TA 4GBQA 2K6DA 4K11A 1JXOA 4OMQA 1VYTA 2YUOA 4ZNXA 2DL8A 1UFFA 2OAWA 1KFZA 4IIOA 1H3HA 2BTTA 1NM7A 2KEAA 3I5SA 2O88A 2K2MA 2SRCA 1X2QA 1YNZA 4J9CA 3I5RA 2YSQA 4RTXA 2KT1A 5I22A 2B86A 2V1QA 4LUDA 4HVUA 4RTVA 2YUPA 2YUNA 2DX1A 1T3LA 1X27A 1WXBA
chains in the Genus database with same CATH superfamily
1KSWA 1X6OA 1WHMA 2NUTA 5CCAA 4PL6A 3RKYA 1S72Q 5KYNA 1O9SA 3OYIA 1AZEA 3GOXA 2CYZB 2FRWA 3RIRA 3RR6A 2K57A 4QT7A 1ZBJA 2MWPA 1W2BS 3V8LA 2WSEE 2C0IA 3J80E 2ZPEB 4Y28E 1ZSGA 2P4TA 4C0ZA 4J83A 2E1HA 3CPWS 2KI7A 1U1SA 3QZ9B 3CCST 3PIPA 4AMCA 5GANf 3X20B 4FM4B 1VQNT 3I55T 4QVZA 3BDUA 2MCNA 3CCQT 4OGCA 2EKHA 3HRTA 2HBPA 1W2BP 8AT1B 2DETA 1B34A 2KK4A 1K73U 5FRNA 2J6OA 1KK7A 1WLPB 4IUVA 3A8GB 2GBQA 2JT4A 1QWFA 4TVRA 1VUBA 1OV3A 1KD1U 5GAN8 3G71A 3REAB 3CCJT 2EKOA 2EYXA 3G6EA 2EQIA 2DM1A 2O9SA 1AWJA 1UGSB 3VS4A 4QVDA 5IHIA 1ZX6A 4R55A 2WSFE 1TG0A 3QG1A 2V26A 2EYZA 3LYIA 3CD6A 1RABB 2DL3A 3LLRA 1LJOA 2QTVA 1G5VA 3URGA 2KROA 2RJEA 2RQUA 4M78C 2L3PA 2OTLT 1B07A 2QK0A 1ZA2B 1YJWT 2AZSA 5KYYB 4NL3A 2PNIA 3QYGB 2BZ8A 2R58A 1WA7A 9ATCB 5DM7R 1BIAA 5GANh 3OQ5A 2EJFA 1RAFB 1VQ6A 4JZ4A 4M75A 3CMAT 1HK9A 3NPFA 1G8XA 4ZTJA 5KE2A 1HJDA 2PQWA 3HFNA 4C92A 3V8KA 1GFDA 4J9BA 3M58A 3PMIA 4OMNA 2KXCA 3JCMc 2O2OA 2RHIA 3S3MA 1VQ9A 4JJDA 4RCBA 4AG1C 1NPPA 4M78D 1G83A 2AIRB 1U1TA 4KH1B 1Q81R 2RQRA 3I56A 1N5ZA 2MYSA 4F17A 3CCMT 4IIMA 2ZCFB 1JJ2S 2FZGB 3QZ5B 3VUBA 2DRKA 2QQ9A 2ABLA 4HCCA 1Q95G 3SFMA 4E47A 5GMKj 3CCSQ 5IH2A 4Z8AA 4F04B 5FRMA 2NUTB 4PJNA 1X01A 3FDRA 2QDLA 4FYVB 5KCOA 1VQNQ 3I55Q 1VQOT 1AHJB 4ESRA 3KUFA 5IXBA 3CCQQ 8ATCB 3FEOA 1T0JA 1UDLA 3HRUA 4J6YA 2HQXA 4QVCA 4C8QC 3LWHA 1UGRB 2VXFA 1M30A 4IUPA 4OB1B 2I0NA 4DBHA 3SWNB 2HZYA 3CCJQ 3A8MB 4AT1B 3UF4A 1QKXA 1ZUUA 1RUWA 2EGCA 2EWNA 1KC8C 3X25B 5C0MA 3VS2A 2DPPB 2CZ1B 3PVLA 2KGTA 2YWWA 2F5TX 2EBPA 1VQ8A 3EFSA 1K0SA 3RNJA 3G71T 4C8QD 4D6WA 1H641 1HYOA 4LN2A 1Y96B 3FLGA 3PGGA 3OY9A 3H41A 2OTLQ 3HPWA 2E6NA 5HY6A 3G4SA 2RI2A 2F2WA 1JXMA 1YJWQ 2JMCA 2LVMA 1MMDA 2X35A 3OS5A 2EQJA 4PJOA 2QEXT 2YLCA 6AT1B 1Q82C 1I1JA 2GQIA 2ED1A 2LDMA 1RAIB 1MMGA 2RA2A 3M53A 4M75E 1IHWA 3JCMe 1NJIU 3CMAQ 1IO6A 3C95A 2XIDA 2X51A 4C92E 2MF2A 4X9CA 2E41A 5KYUB 1I8FA 1YIJT 3EG9A 1VQPA 2DLPA 4MZPA 3ZBDA 2M0YA 3KBGA 1VQKT 5LJ5h 1W4SA 3EHQA 1ZUKA 2FPFA 2YLBA 1YI2A 3M4YA 1VQMA 1E6HA 2QASA 4QQ6A 1WJSA 2JVVA 5CKFA 4P5NA 4BB7A 3C94A 2DA9A 4ELZC 2FB7A 2RK1A 4RTYA 3U23A 2RHYA 3CC7A 1UHFA 5LJ3g 3CCMQ 1Y57A 2K2VA 2KE9A 3H6ZA 3CQTA 2M51A 2K3YA 1KG1A 1ARKA 1TWBA 4DA4A 1VQ9T 4F14A 3UATA 3BDLA 2BZYA 4R56A 4PLLA 1AWXA 3VS1A 1GCPA 1RAHB 2W0ZA 4J7IA 1VQOQ 5I2SA 2D1XA 1TUCA 3OYHA 4M77C 1B3QA 1BU1A 2LT4A 5GAN4 3OYJA 2ZPFB 3H9NA 1B7TA 3R6NA 2AZVA 2VUBA 4N0AA 5D6XA 1YHQT 3JCMP 4LE9A 4RTZA 3ZL7C 1WPYA 3G7ZA 4DEYA 2XHCA 3VRYA 2X9HA 2CP2A 4HT8A 1VQ4A 2DILA 2MOXA 1BI2A 3OW2S 2DEQA 1T0HA 1KIKA 2DK3A 4BDZA 4RUGA 1OZ3A 1RAAB 3N5BB 2Y4YA 2NUPB 4FT4A 2NYSA 5AYFA 1YP5A 1NYFA 2I2LA 4FSSA 3OS2A 4EPCA 3NGPA 2HAXA 2ZPBB 3GF5A 3C12A 3OMGA 2DL7A 1K8AC 3G71Q 2DXCA 1AWWA 1KC8R 2LQ8A 3S6WA 3TREA 2DL8A 4PJOE 1BIBA 4PLIA 1Q7YC 1KFZA 2QEXQ 2BTTA 2EYQA 2KEAA 3I5SA 3GP8A 3OYMA 5LL6S 2CP7A 1VQ8T 1EX4A 1FMVA 1O75A 4LUDA 4HVUA 4RTVA 1ZA1B 3CC4Q 4LDVA 2HL5C 2YUNA 2YRVA 1YIJQ 3Q1JA 3G4ST 1VQKQ 3H8ZA 4FYYB 5GAMh 3CC2T 3CXCA 2NUZA 1Q82R 1UJ0A 3L2RA 4JRKA 2DVEA 3MEAA 3X26B 4PJJA 2KYBA 2PZ1A 2QTXA 4M7AG 4V2SA 4JPBW 1YJ9A 5A0DA 1QKWA 1WHGA 3TSZA 3GPLA 4MMLA 4ANJA 3RERA 3DB4A 4OMFB 1UECA 4M7AB 2DXBA 5A0LA 3C4SA 2ZGWA 2V8KA 1VYUA 3LH0A 1ZUYA 2OTJA 2RH2A 2DIQA 2LQKA 4XTZA 2PUKB 3AHUA 5GAN6 4Z02A 3SHWA 2D6FA 2ZAEA 2CUDA 2LC4A 5CVIA 3QWXX 2J06A 4DOWA 3CCRA 1UUEA 5CKDA 2GTOA 4E7SA 3HTRA 1M4ZA 4XU3A 2KAFA 4N4HA 2LNVA 1YHQQ 2KVQG 4ORZA 5CKHA 1Y07A 3WVEB 4M7AD 2IG0A 2O01E 4XU1A 3QSUA 5GANd 1TU0B 1H3ZA 1ABOA 1MV3A 1NLPC 4A4EA 4DOVA 3RKXA 4KRTA 3LGFA 3X28B 3QJYA 4M7AF 1ZBXA 2LJ1A 5GANj 2D9TA 2B8AA 1FMWA 3CCLA 2D0QB 2DXTA 1SEMA 1SF9A 3NHNA 2CH4A 4FW2A 2J6FA 2H3JA 3EHRA 1G3WA 4OMPA 2VGNA 1BYMA 3QUIA 3M56A 5I21A 1KQSA 3I9QA 4LDXA 2HKNA 5IT9E 1M2VA 3BFMA 4C0DB 1ZSZC 4OMOA 1M8MA 5CKBA 2QQRA 3OYLA 3ER0A 1BBZA 2ZPGB 1GBQA 4ZTFA 1K8AR 4BE1A 1VQ8Q 2GQVA 5LJ5g 2CSIA 1WQWA 1GCQC 3VUZA 2FG0A 5IXFA 1K9MC 2HQEA 3LH5A 4XTWA 4J5YA 1VA7A 1Q7YR 3G4SQ 4WTOB 2EYYA 3CC2Q 3V7CA 2GFUA 3JCMW 2DZCA 1WIEA 1WZOA 2OX7A 1JBMA 4BACA 2DMOA 1D3BA 2LZ6B 4M7DG 1SPKA 3MP6A 4RKUE 1KQ1A 2DD5A 1N6AA 4J7FA 1NEBA 3M0QA 5KYXB 4M7DB 3CXCS 2JN0A 2JTMA 5J26A 2OAUA 4CC7A 7AT1B 4KUDK 5LJ3h 3CMEA 4EMHA 1R0CB 3RKWA 2A28A 2X4YA 2VV5A 3O5ZA 2LRQA 1MNEA 1IHVA 4HVWA 3V8JA 2F5KA 1YJ9T 3RUXA 2KRMA 2O4XB 5HCKA 4ZN3A 2XI9A 1HSQA 2W10A 1A0NB 2LCSA 1G2BA 1BI0A 1I0CA 4BY6B 1YITA 5GAOr 4JJBA 2HQHA 2FEIA 3EFOB 5M9OA 4XAXB 2DEUA 2RJCA 5DLQE 5GAN5 1W1FA 2V8JA 1E7OA 1UHCA 1RADB 3CXCP 1WX6A 4M7DD 3VV0A 2KMTA 2GGRA 5AT1B 1GRIA 1GXIE 1IREB 3FIFA 3QYHB 3A8OB 5FLXE 3BY7A 1SG5A 3CCUT 1U06A 2DJZA 1K4US 2EJ9A 1VQ5A 2DTOA 3HL8A 2VGMA 1JRIA 1KHIA 3FB9A 4M7DF 1XOVA 2YT6A 3FC3A 2JJ9A 4HKEA 2RI5A 3MO8A 1VIFA 2RNAA 1EFNA 2RQTA 2EIFA 4RTWA 4Y92A 3MEWA 2XU8A 2QQAA 2QDYB 2RK2A 2LCCA 5FU7C 5LJ5j 1D09B 4RTUA 4FIBA 4E7ZA 1RI0A 1LPLA 2K3BA 5FWCA 1YJNA 5J39A 4MZTA 5FU7B 1KC8U 4PK4A 3UA6A 2VVKA 5CK9A 4BE0A 3CCVT 2CDTA 2VWFA 3BW1A 1BI1A 3CCLT 3FJ5A 1KHCA 2K9GA 3EGDB 3SD4A 1I07A 2DYBA 4JRQA 5GAMg 4OMMA 3GBQA 3PE0A 2QA4A 1X6GA 2QQSA 4J8OA 3VRZA 2QYZA 2CP0A 3ASKA 3OYYA 4C5IA 4EMGA 2RHXA 2KRNA 1NEGA 4BD3A 1Q82U 2JM8A 2C06A 2KQWA 4WCIA 1PWTA 3NFCA 3TSWA 4JLIA 1OQKA 1VQ7A 2E12A 4J6XA 1KQSP 2MK5A 1Y7XA 2FPEA 1HXDA 3V7RA 1SHGA 1M1FA 1WNLA 2AKLA 2K4YA 2LTOA 4AG2C 4M77A 2C0TA 2ENMA 4EMKA 2WACA 3M54A 1M1KC 1I81A 1VYVA 2EW3A 1NPRA 1YJ9Q 3EG2A 1Y0MA 1VQLA 4RG2A 3MCAB 4CI0C 4AFZC 3OYAA 1GBRA 5EC7A 2SEMA 3OYFA 5LJ5f 1EIFA 4JRIA 1BI3A 2X3WD 1PKSA 3SWNC 4KGXB 1OYXA 4XK8E 2OI3A 5DLOA 2LQWA 5CQYA 4ZN1A 3CCUQ 1PRLC 3CCEA 3P8BB 1R8OB 1M1GA 1OI1A 1YITT 4FT2A 5GAMd 2COZA 5FU6B 2F1LA 2A36A 2KR3A 4M4ZA 3VS0A 3VJPA 2L5QA 2JZ2A 4HXJA 1B34B 1HD3A 2CP5A 4QKUA 1PG5B 3M0UA 5GAMj 2J7IA 2DE0X 4L59A 3G6ET 1MMNA 2DIGA 4K11A 4OMQA 3CBOA 4ZNXA 4B6MA 3CCVQ 1UFFA 1MHNA 2FZCB 3CCLQ 2OAWA 3CD6T 2CKKA 1RL2A 1K8AU 1X2QA 2PVOB 1XJWB 3I5RA 4GLKA 2YSQA 4RTXA 3QIIA 3EGXA 2V1QA 1S72A 3CEYA 3UWNA 1Q7YU 2RPNA 3CBMA 4MZMA 3JSCA 4OVAA 1M9SA 1YCSB 4D8DA 1OU8A 2JM9A 4QQDA 2BE7D 2M16A 1YWPA 1BKBA 4M75G 3E1SA 1TH7A 2K5IA 1VQ6T 4C92G 4LUEA 4XTUA 5FROA 5CKEA 3H0HA 3EFRA 5GMKe 4JUVA 4J9FA 4LXCA 2A0FB 4M75B 2DBKA 4F7UA 4A4FA 3A5ZB 3OB9A 3JB9H 2BZXA 4C92B 4M77E 4C5EA 4XTYA 1J3TA 4HCBA 1VIEA 2BUDA 5D6WA 1QVGP 1TS9A 1WQ7A 2DL4A 3M59A 2IIMA 3SEMA 3P8DA 2D8HA 3LGLA 3I56T 1FWZA 1RLPC 2KBTA 3JB9I 2D8JA 4X34A 2QI2A 2VASA 3JRZA 2AK5A 5CO7A 3OYEA 5GAMf 5GAN2 5FW9A 4E7HA 3A98A 3JCMh 4D8KA 2EQMA 3TU4K 1K76A 1OZ2A 5CR2A 1PHTA 1M1KR 4MMKA 4M75D 2R5MA 1N8RC 3MP8A 3PIOA 1TUDA 2V8IA 4ZGDB 3DB3A 2YRCA 3UT1A 1AD5A 3L2ZA 3GIBA 3OYKA 4LDUA 2EAYA 1G3SA 4M75F 4EMKB 2WSCE 4J9EA 3TCJA 4E7LA 2E3HA 3MEVA 4C92F 3EH1A 1D0XA 2BE9B 2E70A 2VB6A 3HSBA 5A0GA 5KYWA 3DLMA 1CKAA 1QMCA 1XTDA 3E2UA 3OS1A 3THKA 2KT8A 2CH4W 3MJXA 1ZSZA 2OJ2A 2XG8D 1AOJA 1IXDA 1JO8A 2IVWA 2RMOA 4KUIA 3EH2A 3G6EQ 3PNWC 5D7UA 2GF7A 2L3SA 2G6FX 4FCYA 1PD0A 2HD0A 4J6WA 1GCQA 1QP3A 1T3SA 5LJ3d 3GNGA 2GNCA 3CD6Q 3TQ7P 3G1JA 2F2XA 5J3BA 3PMTA 3JCMJ 2FYKA 4BI8B 5GAOm 1RAEB 2PVGB 3KXTA 5LJ3j 2LX7A 4J9GA 1WJRA 2KYMA 2X4WA 1FYNA 3H0IA 4RCCA 4PJOG 4XU0A 4A54A 2FHDA 1X2KA 1PM3A 2RM4A 3QWYA 2MIOA 3A8HB 1WFWA 2D0NA 5GMKi 2P0QA 1SSFA 2ECZA 2RI3A 2FRYA 4PJOB 2DNUA 4M7AC 3OYNA 1VQ6Q 4II1A 1UG1A 1K9MU 2X3XD 3EG1A 3CPWA 1IB8A 4B9XA 3CCSA 1VQPT 4F7UE 3JCMQ 1NYGA 2LJ3A 1VQ9Q 1VQNA 1YI2T 3MHXA 3I55A 1VQMT 5KE3A 3EG9B 3CCQA 1KQ2A 2E5KA 2P84A 3JB9G 1WJQA 4NS5A 2CSQA 5IHKA 3I56Q 3OSSC 4C5HA 2VXEA 1PD1A 2EPDA 1BK2A 3L2UA 3CC7T 1WGSA 2LT1A 2L3QA 4R0KA 2LJ0A 4PJOD 1X6BA 3CPFA 1R77A 4IUQA 2O9VA 2XD0A 1X43A 1N27A 2JUFA 1QW1A 1M90C 1SSHA 4LD9K 2ROTA 1AVZC 1RACB 4PJOF 1QVPA 4Q5WA 2HNIA 4JZ3A 4JS5A 4LNPA 3MEUA 1D1BA 3TEEA 5GAOl 3QBYA 4PJMA 2EGAA 2L89A 4OP0A 4JDSA 4EIKA 3HKSA 2KNBB 4FW1A 2LP5A 3ZFJA 3X24B 3L2WA 4XTVA 5GAN3 1MV0B 2YHTA 2XDPA 2ZPHB 5KYYA 4M78A 2A37A 3OYDA 1WYXA 5LJ3f 2E6ZA 4JJNK 2OTLA 1QCOA 1N8RR 5DY9A 2MAMA 1OX9A 1VQ4T 1YJWA 1JQQA 4C0DC 3WXMB 3DLLA 1I5OB 3JCMb 3J81E 4XQ3A 2CGHA 2EGEA 1ACMB 3MP1A 2GFAA 3S3OA 1GFCA 2GCXA 2L0AA 5GAN7 4BE2A 2O31A 3OMCA 4KGVB 2EQKA 4CRIA 3CMAA 3QHSA 1QQJA 1BCMA 4E6RA 2F69A 4OB3B 3VYGA 3QXEB 2FPDA 2XMFA 1H8KA 4AFSC 2RO0A 3A8LB 1NLOC 4IURA 4XTXA 3M4GA 2RN8A 1TSFA 2MWOA 2QXFA 3M0SA 3QO3A 4PNOA 4J9IA 4HVVA 3EAEA 4UC4A 1N9RA 1G3TA 1Q81C 3C0CA 4E7IA 2HSEB 2KRSA 3CCMA 2LMJA 1YN8A 2AKKA 2JTEA 3VKIA 1X69A 4JLGA 1RLQC 5GAOq 1JJ2A 4M7DC 1AT1B 4CC4B 4A63B 2R5AA 1OEBA 3QPHA 1OU9A 1VQPQ 1PRMC 3HFOA 2HEQA 1PSFA 1BCOA 1TXQA 3R6OA 1YI2Q 1VQMQ 1VQOA 2XKOC 4FYWB 1G3YA 2X4JA 1ZQ1A 4C5GA 4C8QA 4BY6C 2BKDN 2J05A 1U3OA 5IHNA 5D6YA 3SWNA 3JCMg 2DVJA 3REBB 3UPUA 4E7KA 4JS4A 3CC7Q 1Q86C 1CKBA 2DERA 4QW2A 2P4RA 3OYCA 4KGZB 1D0YA 2CT4A 4O6JA 5CAIA 2COYA 4GLMA 2OTJT 3KFVA 1M1KU 2JOYA 5GANe 3VYHB 4IKFA 1UGQB 1Y96A 2FVUA 5LJ5d 3CCRT 3CPWP 3OYBA 4QQGA 4M78E 4VUBA 1JEGA 1M90R 3JV3A 1SKUB 1NBEB 4LDWA 4J9HA 1VQ4Q 1MGQA 3FRNA 2K5LA 4PJLA 2VYTA 2ZPIB 2QEXA 1GL5A 3JCMV 3VS3A 2DFUA 1Z9QA 1I5LA 5KYUA 4LD6A 3RMQA 2Y90A 4Z89A 2EFIA 2K5FA 4M78G 5GAOn 3M0TA 2DYIA 2K6DA 2BIVA 1JXOA 1QVGA 3OA6A 4N4IA 5EG2A 3RDVA 3CC4A 5L8RE 4OGEA 2HL3A 4IIOA 1YIJA 1H3HA 1KQSS 1VQKA 2O88A 2K2MA 1UB4A 2SRCA 1WHKA 4M78B 4A4KA 4DBRA 1YNZA 3S3NA 3META 2KY9A 2KT1A 5I22A 2B86A 3SB2A 5CQXA 3JCMd 2DX1A 1X27A 2K3XA 1WXBA 4ELYC 1M2VB 3QDFA 1C0MA 2PU9B 1K9MR 2JNGA 1QP2A 2RQWA 4O5VA 2ZZDA 1U8RA 2JW4A 1YWOA 1PKTA 2DXUA 3PT9A 3IQLA 1D0ZA 4J9DA 1D1CA 3PVQA 4FL6A 4C0FA 3LWIA 1V76A 4HT9A 2XDDA 3J7AF 4C8QE 2MPXC 2MMPA 4BDYA 4FSXA 4M78F 4OB2B 2LNHB 3SDZA 1ABQA 2CUBA 1TTHB 3UDCA 1YHQA 1K73C 1D3BB 3A1PA 3NTKA 1WHJA 1W6XA 4RTTA 1UTIA 2P0PA 4E7JA 5HK3A 3CBPA 2NUPA 3VS7A 1UEBA 1KD1C 2DZ9A 1P92A 2OTJQ 3CMET 1QLYA 4C8QG 4BI3A 2DO3A 1F1BB 3OW2A 4HA8A 2M0OA 2H3EB 2E10A 2JMAA 3L1AA 1W70A 1Q86R 2DF6A 2CREA 5KCHA 2QGFB 5FU6C 1UJYA 2NWMA 3EG0A 1JJ2P 2XDBA 2MI6A 3VS6A 3CCRQ 4C8QB 3RESA 1OPKA 4PFPA 5LJ5e 3JAME 4MDWA 3M5AA 3GLXA 1XQHA 4GY5A 5GAOp 1N8RU 3MPUB 1K0XA 1FMKA 4OF1A 3HP9A 1VQ5T 1ZLMA 2YDLA 3NTIA 2DKGA 4HCKA 4FYXB 4JJCA 3JCMf 2F2VA 5GMKm 2DJQA 1PC0A 2ROLA 2RJDA 2KDSA 2C0OA 5GJVB 1RAGB 4CC3A 3TVTA 1YCYA 2KXDA 2M1HA 2GTJA 4ZGEB 1KJWA 3CC2A 4NOYA 1DJ7B 3OYGA 2PTKA 4C8QF 1YJNT 4N4GA 1C6VX 2CS7A 2JS0A 2FZKB 4KBMB 1OOTA 2PVDB 2JS2A 5L23A 4M7AA 1QVGS 2JXBA 2RF0A 3M55A 3LX7A 1QCFA 3CC4T 3AT1B 2A3LA 4M75C 4A4HA 2E5QA 5A2QE 1I4K1 5HK0A 2QA4T 4JRPA 2H8HA 4C92C 1FX7A 3M9QA 1M2OA 3HHTB 3M0PA 4AFQC 1H92A 2EVRA 2RHZA 2CP3A 2V1RA 2XICA 2CZ7B 2ATCB 5CIUA 2K7AA 2CP6A 3OBWA 3QDRB 1OX8A 1QVFA 1SRLA 1PSEA 1VQ7T 1IZ6A 1Z9ZA 3VU3C 5IAYA 3EGUA 5GMKl 1D1AA 2DTIA 1MMAA 1M5Q1 2EQUA 4DBQA 4CC2A 4M77G 4L6V5 1OULA 2ED0A 2E3IA 3CMEQ 2P0KA 1VOMA 2RQVA 1TUGB 1LCKA 2QG9B 1M3CA 4NL2A 3GNFB 4C92D 4OMLA 2M02A 4EMKC 4PFOA 3INZA 4MDXA 1K73R 2DD4A 1X75C 1VQLT 2JTFA 2QQBA 4M77B 2FO0A 1IGQA 2AT1B 1YITQ 1KD1R 1UGVA 5GJWB 3DKMA 3RMSA 5GAMe 1WHHA 4KULA 1M90U 2YRDA 1WXTA 2EYWA 3JCMX 3M0RA 3ME9A 2HCKA 5GMKh 2E4HA 4Y91A 3E9GA 3OSVA 3L2QA 3NMZC 2PUOB 5I2MA 1VQ5Q 4BUGA 2HBWA 1BB9A 3CCET 5ECAA 2RD1A 3RBBB 1WI7A 1QCNA 4IUUA 2HMAA 4M77D 4DBFA 1NJIC 3LW5E 2FL7A 1NG2A 1R0BG 2Z0WA 2HSPA 3M57A 2CZ6B 4LDYA 1K1ZA 1UE9A 3VS5A 1C1AA 5GANg 4XU2A 3OW2P 4M77F 2LX9A 1JB0E 4F16A 2Y4XA 1WXUA 3P8HA 4L5GA 4BI4A 3V7SA 1YJNQ 4RMOA 3L42A 4KT0E 1U5SA 3FJPA 1YFNA 4ZGJB 4M7AE 3E19A 2L3RA 4C0GA 4PJOC 1WDXA 5KYXA 2VKNA 3MKDA 4M7DA 2YXYA 2QGGA 3H0FA 1CSKA 3HRSA 1W2BA 4HCZA 3OBYA 4RG8A 1S1NA 1M3BA 4KH0B 1K9AA 3UA7A 4DEXA 2G3RA 1MNDA 2KSSA 3ULRB 5IN1A 2QA4Q 1S72T 2O4XA 4EDUA 2A7YA 2ESWA 2M9UA 1NZ9A 1WHLA 2XK0A 1M3AA 4X9DA 1E6GA 1SHFA 3OS0A 2IPOB 4PFZA 3EGXB 4PKCC 4E2FB 5KH6A 2L2PA 4AFUC 3EFOA 1Q81U 2E64A 3PTAA 3I35A 4A53A 2LQNA 1M27C 2RJFA 4DQ2A 1OPLA 1TOVA 2K79A 1VQ7Q 1QWEA 2YUQA 1ZHIA 4F7UG 2AHJB 5I11A 3QKJA 1PCXA 3CCJA 4FU6A 3CCUA 1AEYA 1V1CA 2LCLA 2COWA 2VC8A 3O8VA 1PNJA 4F7UB 3D7SB 1M8VA 1QVFS 4X1VA 1V29B 2DBMA 1MUZA 1UGPB 1VQLQ 1SRMA 2R57A 1Q86U 4A4GA 2NLUA 2DL5A 3EG3A 2CZ0B 1LOJA 1FXXA 1XNIA 2X4XA 2J6KA 2HDAA 2L8DA 2DRMA 4ATOA 4N0AC 1IGUA 2DAQA 3JB9D 2QAZA 1RI9A 4WF2A 2RB6A 1YBYA 4IUTA 1AWOA 1N9SA 2CT3A 3PFSA 3EGDA 1LVKA 1LNXA 2EJGA 3CCVA 1QVFP 2HKQB 3JB9F 5HKCA 4B9WA 3WVDB 4Z88A 3CCEQ 1JU5C 3F70A 5FWBA 2A08A 1AZGB 3L2VA 4GBQA 3QJ6A 4OB0B 1VYTA 5LJ3e 2YUOA 4F7UF 3T9NA 1NM7A 3ZEHA 1NE8A 5KYWB 2RHUA 4J9CA 1EZZB 1ZSZB 1Y71A 3E9FA 5C6SA 1NJIR 3JB9J 4M7DE 1IRXA 3NTHA 4ME7A 2YUPA 3BE3A 2DTHA 4YTLA 1T3LA 2E65A
chains in the Genus database with same CATH topology
2RPNA 1KSWA 1YCSB 4D8DA 2NUZA 1UJ0A 2JM9A 1YWPA 2RQWA 2KYBA 2PZ1A 4JPBW 1AZEA 4LUEA 2JW4A 1YWOA 1PKTA 1QKWA 3TSZA 3H0HA 2FRWA 3IQLA 4QT7A 1ZBJA 4J9FA 4J9DA 3PVQA 2DBKA 2C0IA 1ZSGA 1UECA 2BZXA 1J3TA 1VYUA 2LNHB 1ZUYA 2DL4A 1ABQA 2CUBA 2IIMA 3SEMA 2D8HA 1RLPC 2KBTA 2D8JA 1W6XA 4RTTA 1UTIA 2AK5A 3SHWA 2CUDA 3VS7A 3QWXX 5FW9A 2MCNA 2J06A 3A98A 1UUEA 2EKHA 2GTOA 4D8KA 1QLYA 1K76A 1PHTA 2JMAA 4ORZA 2J6OA 1WLPB 1W70A 2DF6A 2CREA 2GBQA 1TUDA 1UJYA 2JT4A 1QWFA 2NWMA 3EG0A 1ABOA 1MV3A 1NLPC 1OV3A 3VS6A 3REAB 1AD5A 1OPKA 4KRTA 4J9EA 2EYXA 2LJ1A 2EQIA 2DM1A 2O9SA 1AWJA 3VS4A 1CKAA 5IHIA 1ZX6A 1SEMA 1K0XA 3NHNA 3THKA 2CH4A 2KT8A 1TG0A 1FMKA 2CH4W 2J6FA 2OJ2A 3EHRA 2EYZA 1AOJA 4OMPA 2DL3A 1ZLMA 2YDLA 1JO8A 2RMOA 3I9QA 2KROA 4HCKA 2RQUA 4JJCA 2F2VA 2DJQA 2L3SA 2G6FX 2L3PA 1B07A 1GCQA 4OMOA 1M8MA 1T3SA 2ROLA 2AZSA 2C0OA 2GNCA 2PNIA 5GJVB 1BBZA 2F2XA 3TVTA 4CC3A 2KXDA 2BZ8A 2GTJA 1GBQA 1KJWA 1WA7A 2PTKA 2CSIA 1GCQC 2FG0A 5IXFA 2LX7A 4J9GA 2JS0A 4JZ4A 2KYMA 3H0IA 1OOTA 1FYNA 3LH5A 2JS2A 3NPFA 5L23A 1X2KA 1HJDA 1VA7A 2JXBA 1GFDA 2EYYA 2RF0A 3QWYA 2MIOA 4J9BA 1WFWA 2D0NA 4OMNA 1QCFA 2KXCA 2O2OA 1WIEA 2ECZA 4JJDA 2DMOA 2FRYA 4AG1C 2DNUA 2LZ6B 1UG1A 1G83A 2H8HA 1SPKA 2X3XD 3EG1A 1NEBA 2RQRA 1N5ZA 3M0PA 4AFQC 1H92A 4F17A 1NYGA 2EVRA 2LJ3A 3M0QA 2V1RA 4IIMA 2K7AA 4CC7A 2E5KA 2DRKA 2ABLA 1SRLA 2CSQA 2A28A 5IHKA 3O5ZA 5IH2A 4Z8AA 4HVWA 1Z9ZA 2EPDA 1BK2A 2KRMA 3EGUA 5HCKA 2QDLA 2L3QA 4R0KA 2LJ0A 1X6BA 1HSQA 2W10A 1A0NB 2LCSA 4ESRA 1G2BA 1I0CA 2O9VA 4CC2A 5IXBA 1T0JA 1UDLA 2ED0A 1X43A 4JJBA 2FEIA 2RQVA 1LCKA 1M3CA 1SSHA 2ROTA 1AVZC 1M30A 4OMLA 1W1FA 1E7OA 1UHCA 4JZ3A 4LNPA 1WX6A 2I0NA 2GGRA 1GRIA 2FO0A 2EGAA 1U06A 4EIKA 1K4US 2KNBB 2LP5A 1UGVA 5GJWB 3UF4A 1QKXA 1MV0B 1ZUUA 1XOVA 2YT6A 2A37A 1WXTA 1WYXA 2EYWA 3M0RA 1RUWA 2EGCA 2HCKA 2RNAA 1EFNA 2RQTA 3NMZC 4RTWA 4Y92A 3VS2A 1JQQA 3PVLA 2KGTA 2EBPA 2EGEA 2HBWA 1BB9A 1K0SA 4RTUA 1GFCA 5ECAA 3RNJA 3RBBB 2L0AA 1WI7A 2K3BA 5FWCA 2O31A 4LN2A 3UA6A 3H41A 2VVKA 2F2WA 1JXMA 2JMCA 1NG2A 2HSPA 2CDTA 2VWFA 4E6RA 1K1ZA 1UE9A 3VS5A 3FJ5A 2FPDA 2XMFA 1H8KA 2K9GA 4AFSC 4F16A 1NLOC 1I1JA 1I07A 1WXUA 2DYBA 2GQIA 2ED1A 4OMMA 3GBQA 3PE0A 2RN8A 1U5SA 1X6GA 3M0SA 1IO6A 1WDXA 3VRZA 2VKNA 4J9IA 4HVVA 3H0FA 1CSKA 2DLPA 2M0YA 1S1NA 3EHQA 2KRNA 1M3BA 1ZUKA 1NEGA 2FPFA 3C0CA 2JM8A 1K9AA 2KRSA 4WCIA 2LMJA 1YN8A 2AKKA 3UA7A 2JTEA 4DEXA 3ULRB 1E6HA 1PWTA 1X69A 1RLQC 3TSWA 4CC4B 4A63B 2ESWA 2DA9A 1OEBA 1M3AA 1E6GA 1SHFA 4RTYA 3U23A 1PRMC 2L2PA 4AFUC 2HEQA 2FPEA 1UHFA 1SHGA 1Y57A 2KE9A 3CQTA 3I35A 2AKLA 2M51A 2LQNA 1M27C 1ARKA 4AG2C 1OPLA 2J05A 1U3OA 2C0TA 2ENMA 5IHNA 4F14A 3UATA 2BZYA 2K79A 1QWEA 1VYVA 2DVJA 2YUQA 3REBB 2EW3A 1AWXA 3EG2A 1Y0MA 5I11A 3VS1A 1GCPA 1CKBA 4AFZC 2W0ZA 1GBRA 5EC7A 2SEMA 2D1XA 1TUCA 2P4RA 1AEYA 2CT4A 2X3WD 1B3QA 1BU1A 1V1CA 1PKSA 1PNJA 4GLMA 2OI3A 4X1VA 3R6NA 2AZVA 3KFVA 2DBMA 1MUZA 1SRMA 4LE9A 2LQWA 4RTZA 3ZL7C 4DEYA 2DL5A 3VRYA 3EG3A 2DILA 1PRLC 2J6KA 2HDAA 2MOXA 2DRMA 1T0HA 1JEGA 1KIKA 4RUGA 1RI9A 3JV3A 1AWOA 2CT3A 2A36A 2KR3A 4J9HA 4M4ZA 3VS0A 1YP5A 1NYFA 4FSSA 3NGPA 4HXJA 1HD3A 1GL5A 3M0UA 2DL7A 3VS3A 4Z88A 1JU5C 1Z9QA 5FWBA 2J7IA 1AWWA 2DE0X 2A08A 4Z89A 1AZGB 3M0TA 4GBQA 2K6DA 4K11A 1JXOA 4OMQA 1VYTA 2YUOA 4ZNXA 2DL8A 1UFFA 2OAWA 1KFZA 4IIOA 1H3HA 2BTTA 1NM7A 2KEAA 3I5SA 2O88A 2K2MA 2SRCA 1X2QA 1YNZA 4J9CA 3I5RA 2YSQA 4RTXA 2KT1A 5I22A 2B86A 2V1QA 4LUDA 4HVUA 4RTVA 2YUPA 2YUNA 2DX1A 1T3LA 1X27A 1WXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPN A;  1KSW A;  1YCS B;  4D8D A;  2NUZ A;  1UJ0 A;  2JM9 A;  1YWP A;  2RQW A;  2KYB A;  2PZ1 A;  4JPB W;  1AZE A;  4LUE A;  2JW4 A;  1YWO A;  1PKT A;  1QKW A;  3TSZ A;  3H0H A;  2FRW A;  3IQL A;  4QT7 A;  1ZBJ A;  4J9F A;  4J9D A;  3PVQ A;  2DBK A;  2C0I A;  1ZSG A;  1UEC A;  2BZX A;  1J3T A;  1VYU A;  2LNH B;  1ZUY A;  2DL4 A;  1ABQ A;  2CUB A;  2IIM A;  3SEM A;  2D8H A;  1RLP C;  2KBT A;  2D8J A;  1W6X A;  4RTT A;  1UTI A;  2AK5 A;  3SHW A;  2CUD A;  3VS7 A;  3QWX X;  5FW9 A;  2MCN A;  2J06 A;  3A98 A;  1UUE A;  2EKH A;  2GTO A;  4D8K A;  1QLY A;  1K76 A;  1PHT A;  2JMA A;  4ORZ A;  2J6O A;  1WLP B;  1W70 A;  2DF6 A;  2CRE A;  2GBQ A;  1TUD A;  1UJY A;  2JT4 A;  1QWF A;  2NWM A;  3EG0 A;  1ABO A;  1MV3 A;  1NLP C;  1OV3 A;  3VS6 A;  3REA B;  1AD5 A;  1OPK A;  4KRT A;  4J9E A;  2EYX A;  2LJ1 A;  2EQI A;  2DM1 A;  2O9S A;  1AWJ A;  3VS4 A;  1CKA A;  5IHI A;  1ZX6 A;  1SEM A;  1K0X A;  3NHN A;  3THK A;  2CH4 A;  2KT8 A;  1TG0 A;  1FMK A;  2CH4 W;  2J6F A;  2OJ2 A;  3EHR A;  2EYZ A;  1AOJ A;  4OMP A;  2DL3 A;  1ZLM A;  2YDL A;  1JO8 A;  2RMO A;  3I9Q A;  2KRO A;  4HCK A;  2RQU A;  4JJC A;  2F2V A;  2DJQ A;  2L3S A;  2G6F X;  2L3P A;  1B07 A;  1GCQ A;  4OMO A;  1M8M A;  1T3S A;  2ROL A;  2AZS A;  2C0O A;  2GNC A;  2PNI A;  5GJV B;  1BBZ A;  2F2X A;  3TVT A;  4CC3 A;  2KXD A;  2BZ8 A;  2GTJ A;  1GBQ A;  1KJW A;  1WA7 A;  2PTK A;  2CSI A;  1GCQ C;  2FG0 A;  5IXF A;  2LX7 A;  4J9G A;  2JS0 A;  4JZ4 A;  2KYM A;  3H0I A;  1OOT A;  1FYN A;  3LH5 A;  2JS2 A;  3NPF A;  5L23 A;  1X2K A;  1HJD A;  1VA7 A;  2JXB A;  1GFD A;  2EYY A;  2RF0 A;  3QWY A;  2MIO A;  4J9B A;  1WFW A;  2D0N A;  4OMN A;  1QCF A;  2KXC A;  2O2O A;  1WIE A;  2ECZ A;  4JJD A;  2DMO A;  2FRY A;  4AG1 C;  2DNU A;  2LZ6 B;  1UG1 A;  1G83 A;  2H8H A;  1SPK A;  2X3X D;  3EG1 A;  1NEB A;  2RQR A;  1N5Z A;  3M0P A;  4AFQ C;  1H92 A;  4F17 A;  1NYG A;  2EVR A;  2LJ3 A;  3M0Q A;  2V1R A;  4IIM A;  2K7A A;  4CC7 A;  2E5K A;  2DRK A;  2ABL A;  1SRL A;  2CSQ A;  2A28 A;  5IHK A;  3O5Z A;  5IH2 A;  4Z8A A;  4HVW A;  1Z9Z A;  2EPD A;  1BK2 A;  2KRM A;  3EGU A;  5HCK A;  2QDL A;  2L3Q A;  4R0K A;  2LJ0 A;  1X6B A;  1HSQ A;  2W10 A;  1A0N B;  2LCS A;  4ESR A;  1G2B A;  1I0C A;  2O9V A;  4CC2 A;  5IXB A;  1T0J A;  1UDL A;  2ED0 A;  1X43 A;  4JJB A;  2FEI A;  2RQV A;  1LCK A;  1M3C A;  1SSH A;  2ROT A;  1AVZ C;  1M30 A;  4OML A;  1W1F A;  1E7O A;  1UHC A;  4JZ3 A;  4LNP A;  1WX6 A;  2I0N A;  2GGR A;  1GRI A;  2FO0 A;  2EGA A;  1U06 A;  4EIK A;  1K4U S;  2KNB B;  2LP5 A;  1UGV A;  5GJW B;  3UF4 A;  1QKX A;  1MV0 B;  1ZUU A;  1XOV A;  2YT6 A;  2A37 A;  1WXT A;  1WYX A;  2EYW A;  3M0R A;  1RUW A;  2EGC A;  2HCK A;  2RNA A;  1EFN A;  2RQT A;  3NMZ C;  4RTW A;  4Y92 A;  3VS2 A;  1JQQ A;  3PVL A;  2KGT A;  2EBP A;  2EGE A;  2HBW A;  1BB9 A;  1K0S A;  4RTU A;  1GFC A;  5ECA A;  3RNJ A;  3RBB B;  2L0A A;  1WI7 A;  2K3B A;  5FWC A;  2O31 A;  4LN2 A;  3UA6 A;  3H41 A;  2VVK A;  2F2W A;  1JXM A;  2JMC A;  1NG2 A;  2HSP A;  2CDT A;  2VWF A;  4E6R A;  1K1Z A;  1UE9 A;  3VS5 A;  3FJ5 A;  2FPD A;  2XMF A;  1H8K A;  2K9G A;  4AFS C;  4F16 A;  1NLO C;  1I1J A;  1I07 A;  1WXU A;  2DYB A;  2GQI A;  2ED1 A;  4OMM A;  3GBQ A;  3PE0 A;  2RN8 A;  1U5S A;  1X6G A;  3M0S A;  1IO6 A;  1WDX A;  3VRZ A;  2VKN A;  4J9I A;  4HVV A;  3H0F A;  1CSK A;  2DLP A;  2M0Y A;  1S1N A;  3EHQ A;  2KRN A;  1M3B A;  1ZUK A;  1NEG A;  2FPF A;  3C0C A;  2JM8 A;  1K9A A;  2KRS A;  4WCI A;  2LMJ A;  1YN8 A;  2AKK A;  3UA7 A;  2JTE A;  4DEX A;  3ULR B;  1E6H A;  1PWT A;  1X69 A;  1RLQ C;  3TSW A;  4CC4 B;  4A63 B;  2ESW A;  2DA9 A;  1OEB A;  1M3A A;  1E6G A;  1SHF A;  4RTY A;  3U23 A;  1PRM C;  2L2P A;  4AFU C;  2HEQ A;  2FPE A;  1UHF A;  1SHG A;  1Y57 A;  2KE9 A;  3CQT A;  3I35 A;  2AKL A;  2M51 A;  2LQN A;  1M27 C;  1ARK A;  4AG2 C;  1OPL A;  2J05 A;  1U3O A;  2C0T A;  2ENM A;  5IHN A;  4F14 A;  3UAT A;  2BZY A;  2K79 A;  1QWE A;  1VYV A;  2DVJ A;  2YUQ A;  3REB B;  2EW3 A;  1AWX A;  3EG2 A;  1Y0M A;  5I11 A;  3VS1 A;  1GCP A;  1CKB A;  4AFZ C;  2W0Z A;  1GBR A;  5EC7 A;  2SEM A;  2D1X A;  1TUC A;  2P4R A;  1AEY A;  2CT4 A;  2X3W D;  1B3Q A;  1BU1 A;  1V1C A;  1PKS A;  1PNJ A;  4GLM A;  2OI3 A;  4X1V A;  3R6N A;  2AZV A;  3KFV A;  2DBM A;  1MUZ A;  1SRM A;  4LE9 A;  2LQW A;  4RTZ A;  3ZL7 C;  4DEY A;  2DL5 A;  3VRY A;  3EG3 A;  2DIL A;  1PRL C;  2J6K A;  2HDA A;  2MOX A;  2DRM A;  1T0H A;  1JEG A;  1KIK A;  4RUG A;  1RI9 A;  3JV3 A;  1AWO A;  2CT3 A;  2A36 A;  2KR3 A;  4J9H A;  4M4Z A;  3VS0 A;  1YP5 A;  1NYF A;  4FSS A;  3NGP A;  4HXJ A;  1HD3 A;  1GL5 A;  3M0U A;  2DL7 A;  3VS3 A;  4Z88 A;  1JU5 C;  1Z9Q A;  5FWB A;  2J7I A;  1AWW A;  2DE0 X;  2A08 A;  4Z89 A;  1AZG B;  3M0T A;  4GBQ A;  2K6D A;  4K11 A;  1JXO A;  4OMQ A;  1VYT A;  2YUO A;  4ZNX A;  2DL8 A;  1UFF A;  2OAW A;  1KFZ A;  4IIO A;  1H3H A;  2BTT A;  1NM7 A;  2KEA A;  3I5S A;  2O88 A;  2K2M A;  2SRC A;  1X2Q A;  1YNZ A;  4J9C A;  3I5R A;  2YSQ A;  4RTX A;  2KT1 A;  5I22 A;  2B86 A;  2V1Q A;  4LUD A;  4HVU A;  4RTV A;  2YUP A;  2YUN A;  2DX1 A;  1T3L A;  1X27 A;  1WXB A; 
#chains in the Genus database with same CATH topology
 1KSW A;  1X6O A;  1WHM A;  2NUT A;  5CCA A;  4PL6 A;  3RKY A;  1S72 Q;  5KYN A;  1O9S A;  3OYI A;  1AZE A;  3GOX A;  2CYZ B;  2FRW A;  3RIR A;  3RR6 A;  2K57 A;  4QT7 A;  1ZBJ A;  2MWP A;  1W2B S;  3V8L A;  2WSE E;  2C0I A;  3J80 E;  2ZPE B;  4Y28 E;  1ZSG A;  2P4T A;  4C0Z A;  4J83 A;  2E1H A;  3CPW S;  2KI7 A;  1U1S A;  3QZ9 B;  3CCS T;  3PIP A;  4AMC A;  5GAN f;  3X20 B;  4FM4 B;  1VQN T;  3I55 T;  4QVZ A;  3BDU A;  2MCN A;  3CCQ T;  4OGC A;  2EKH A;  3HRT A;  2HBP A;  1W2B P;  8AT1 B;  2DET A;  1B34 A;  2KK4 A;  1K73 U;  5FRN A;  2J6O A;  1KK7 A;  1WLP B;  4IUV A;  3A8G B;  2GBQ A;  2JT4 A;  1QWF A;  4TVR A;  1VUB A;  1OV3 A;  1KD1 U;  5GAN 8;  3G71 A;  3REA B;  3CCJ T;  2EKO A;  2EYX A;  3G6E A;  2EQI A;  2DM1 A;  2O9S A;  1AWJ A;  1UGS B;  3VS4 A;  4QVD A;  5IHI A;  1ZX6 A;  4R55 A;  2WSF E;  1TG0 A;  3QG1 A;  2V26 A;  2EYZ A;  3LYI A;  3CD6 A;  1RAB B;  2DL3 A;  3LLR A;  1LJO A;  2QTV A;  1G5V A;  3URG A;  2KRO A;  2RJE A;  2RQU A;  4M78 C;  2L3P A;  2OTL T;  1B07 A;  2QK0 A;  1ZA2 B;  1YJW T;  2AZS A;  5KYY B;  4NL3 A;  2PNI A;  3QYG B;  2BZ8 A;  2R58 A;  1WA7 A;  9ATC B;  5DM7 R;  1BIA A;  5GAN h;  3OQ5 A;  2EJF A;  1RAF B;  1VQ6 A;  4JZ4 A;  4M75 A;  3CMA T;  1HK9 A;  3NPF A;  1G8X A;  4ZTJ A;  5KE2 A;  1HJD A;  2PQW A;  3HFN A;  4C92 A;  3V8K A;  1GFD A;  4J9B A;  3M58 A;  3PMI A;  4OMN A;  2KXC A;  3JCM c;  2O2O A;  2RHI A;  3S3M A;  1VQ9 A;  4JJD A;  4RCB A;  4AG1 C;  1NPP A;  4M78 D;  1G83 A;  2AIR B;  1U1T A;  4KH1 B;  1Q81 R;  2RQR A;  3I56 A;  1N5Z A;  2MYS A;  4F17 A;  3CCM T;  4IIM A;  2ZCF B;  1JJ2 S;  2FZG B;  3QZ5 B;  3VUB A;  2DRK A;  2QQ9 A;  2ABL A;  4HCC A;  1Q95 G;  3SFM A;  4E47 A;  5GMK j;  3CCS Q;  5IH2 A;  4Z8A A;  4F04 B;  5FRM A;  2NUT B;  4PJN A;  1X01 A;  3FDR A;  2QDL A;  4FYV B;  5KCO A;  1VQN Q;  3I55 Q;  1VQO T;  1AHJ B;  4ESR A;  3KUF A;  5IXB A;  3CCQ Q;  8ATC B;  3FEO A;  1T0J A;  1UDL A;  3HRU A;  4J6Y A;  2HQX A;  4QVC A;  4C8Q C;  3LWH A;  1UGR B;  2VXF A;  1M30 A;  4IUP A;  4OB1 B;  2I0N A;  4DBH A;  3SWN B;  2HZY A;  3CCJ Q;  3A8M B;  4AT1 B;  3UF4 A;  1QKX A;  1ZUU A;  1RUW A;  2EGC A;  2EWN A;  1KC8 C;  3X25 B;  5C0M A;  3VS2 A;  2DPP B;  2CZ1 B;  3PVL A;  2KGT A;  2YWW A;  2F5T X;  2EBP A;  1VQ8 A;  3EFS A;  1K0S A;  3RNJ A;  3G71 T;  4C8Q D;  4D6W A;  1H64 1;  1HYO A;  4LN2 A;  1Y96 B;  3FLG A;  3PGG A;  3OY9 A;  3H41 A;  2OTL Q;  3HPW A;  2E6N A;  5HY6 A;  3G4S A;  2RI2 A;  2F2W A;  1JXM A;  1YJW Q;  2JMC A;  2LVM A;  1MMD A;  2X35 A;  3OS5 A;  2EQJ A;  4PJO A;  2QEX T;  2YLC A;  6AT1 B;  1Q82 C;  1I1J A;  2GQI A;  2ED1 A;  2LDM A;  1RAI B;  1MMG A;  2RA2 A;  3M53 A;  4M75 E;  1IHW A;  3JCM e;  1NJI U;  3CMA Q;  1IO6 A;  3C95 A;  2XID A;  2X51 A;  4C92 E;  2MF2 A;  4X9C A;  2E41 A;  5KYU B;  1I8F A;  1YIJ T;  3EG9 A;  1VQP A;  2DLP A;  4MZP A;  3ZBD A;  2M0Y A;  3KBG A;  1VQK T;  5LJ5 h;  1W4S A;  3EHQ A;  1ZUK A;  2FPF A;  2YLB A;  1YI2 A;  3M4Y A;  1VQM A;  1E6H A;  2QAS A;  4QQ6 A;  1WJS A;  2JVV A;  5CKF A;  4P5N A;  4BB7 A;  3C94 A;  2DA9 A;  4ELZ C;  2FB7 A;  2RK1 A;  4RTY A;  3U23 A;  2RHY A;  3CC7 A;  1UHF A;  5LJ3 g;  3CCM Q;  1Y57 A;  2K2V A;  2KE9 A;  3H6Z A;  3CQT A;  2M51 A;  2K3Y A;  1KG1 A;  1ARK A;  1TWB A;  4DA4 A;  1VQ9 T;  4F14 A;  3UAT A;  3BDL A;  2BZY A;  4R56 A;  4PLL A;  1AWX A;  3VS1 A;  1GCP A;  1RAH B;  2W0Z A;  4J7I A;  1VQO Q;  5I2S A;  2D1X A;  1TUC A;  3OYH A;  4M77 C;  1B3Q A;  1BU1 A;  2LT4 A;  5GAN 4;  3OYJ A;  2ZPF B;  3H9N A;  1B7T A;  3R6N A;  2AZV A;  2VUB A;  4N0A A;  5D6X A;  1YHQ T;  3JCM P;  4LE9 A;  4RTZ A;  3ZL7 C;  1WPY A;  3G7Z A;  4DEY A;  2XHC A;  3VRY A;  2X9H A;  2CP2 A;  4HT8 A;  1VQ4 A;  2DIL A;  2MOX A;  1BI2 A;  3OW2 S;  2DEQ A;  1T0H A;  1KIK A;  2DK3 A;  4BDZ A;  4RUG A;  1OZ3 A;  1RAA B;  3N5B B;  2Y4Y A;  2NUP B;  4FT4 A;  2NYS A;  5AYF A;  1YP5 A;  1NYF A;  2I2L A;  4FSS A;  3OS2 A;  4EPC A;  3NGP A;  2HAX A;  2ZPB B;  3GF5 A;  3C12 A;  3OMG A;  2DL7 A;  1K8A C;  3G71 Q;  2DXC A;  1AWW A;  1KC8 R;  2LQ8 A;  3S6W A;  3TRE A;  2DL8 A;  4PJO E;  1BIB A;  4PLI A;  1Q7Y C;  1KFZ A;  2QEX Q;  2BTT A;  2EYQ A;  2KEA A;  3I5S A;  3GP8 A;  3OYM A;  5LL6 S;  2CP7 A;  1VQ8 T;  1EX4 A;  1FMV A;  1O75 A;  4LUD A;  4HVU A;  4RTV A;  1ZA1 B;  3CC4 Q;  4LDV A;  2HL5 C;  2YUN A;  2YRV A;  1YIJ Q;  3Q1J A;  3G4S T;  1VQK Q;  3H8Z A;  4FYY B;  5GAM h;  3CC2 T;  3CXC A;  2NUZ A;  1Q82 R;  1UJ0 A;  3L2R A;  4JRK A;  2DVE A;  3MEA A;  3X26 B;  4PJJ A;  2KYB A;  2PZ1 A;  2QTX A;  4M7A G;  4V2S A;  4JPB W;  1YJ9 A;  5A0D A;  1QKW A;  1WHG A;  3TSZ A;  3GPL A;  4MML A;  4ANJ A;  3RER A;  3DB4 A;  4OMF B;  1UEC A;  4M7A B;  2DXB A;  5A0L A;  3C4S A;  2ZGW A;  2V8K A;  1VYU A;  3LH0 A;  1ZUY A;  2OTJ A;  2RH2 A;  2DIQ A;  2LQK A;  4XTZ A;  2PUK B;  3AHU A;  5GAN 6;  4Z02 A;  3SHW A;  2D6F A;  2ZAE A;  2CUD A;  2LC4 A;  5CVI A;  3QWX X;  2J06 A;  4DOW A;  3CCR A;  1UUE A;  5CKD A;  2GTO A;  4E7S A;  3HTR A;  1M4Z A;  4XU3 A;  2KAF A;  4N4H A;  2LNV A;  1YHQ Q;  2KVQ G;  4ORZ A;  5CKH A;  1Y07 A;  3WVE B;  4M7A D;  2IG0 A;  2O01 E;  4XU1 A;  3QSU A;  5GAN d;  1TU0 B;  1H3Z A;  1ABO A;  1MV3 A;  1NLP C;  4A4E A;  4DOV A;  3RKX A;  4KRT A;  3LGF A;  3X28 B;  3QJY A;  4M7A F;  1ZBX A;  2LJ1 A;  5GAN j;  2D9T A;  2B8A A;  1FMW A;  3CCL A;  2D0Q B;  2DXT A;  1SEM A;  1SF9 A;  3NHN A;  2CH4 A;  4FW2 A;  2J6F A;  2H3J A;  3EHR A;  1G3W A;  4OMP A;  2VGN A;  1BYM A;  3QUI A;  3M56 A;  5I21 A;  1KQS A;  3I9Q A;  4LDX A;  2HKN A;  5IT9 E;  1M2V A;  3BFM A;  4C0D B;  1ZSZ C;  4OMO A;  1M8M A;  5CKB A;  2QQR A;  3OYL A;  3ER0 A;  1BBZ A;  2ZPG B;  1GBQ A;  4ZTF A;  1K8A R;  4BE1 A;  1VQ8 Q;  2GQV A;  5LJ5 g;  2CSI A;  1WQW A;  1GCQ C;  3VUZ A;  2FG0 A;  5IXF A;  1K9M C;  2HQE A;  3LH5 A;  4XTW A;  4J5Y A;  1VA7 A;  1Q7Y R;  3G4S Q;  4WTO B;  2EYY A;  3CC2 Q;  3V7C A;  2GFU A;  3JCM W;  2DZC A;  1WIE A;  1WZO A;  2OX7 A;  1JBM A;  4BAC A;  2DMO A;  1D3B A;  2LZ6 B;  4M7D G;  1SPK A;  3MP6 A;  4RKU E;  1KQ1 A;  2DD5 A;  1N6A A;  4J7F A;  1NEB A;  3M0Q A;  5KYX B;  4M7D B;  3CXC S;  2JN0 A;  2JTM A;  5J26 A;  2OAU A;  4CC7 A;  7AT1 B;  4KUD K;  5LJ3 h;  3CME A;  4EMH A;  1R0C B;  3RKW A;  2A28 A;  2X4Y A;  2VV5 A;  3O5Z A;  2LRQ A;  1MNE A;  1IHV A;  4HVW A;  3V8J A;  2F5K A;  1YJ9 T;  3RUX A;  2KRM A;  2O4X B;  5HCK A;  4ZN3 A;  2XI9 A;  1HSQ A;  2W10 A;  1A0N B;  2LCS A;  1G2B A;  1BI0 A;  1I0C A;  4BY6 B;  1YIT A;  5GAO r;  4JJB A;  2HQH A;  2FEI A;  3EFO B;  5M9O A;  4XAX B;  2DEU A;  2RJC A;  5DLQ E;  5GAN 5;  1W1F A;  2V8J A;  1E7O A;  1UHC A;  1RAD B;  3CXC P;  1WX6 A;  4M7D D;  3VV0 A;  2KMT A;  2GGR A;  5AT1 B;  1GRI A;  1GXI E;  1IRE B;  3FIF A;  3QYH B;  3A8O B;  5FLX E;  3BY7 A;  1SG5 A;  3CCU T;  1U06 A;  2DJZ A;  1K4U S;  2EJ9 A;  1VQ5 A;  2DTO A;  3HL8 A;  2VGM A;  1JRI A;  1KHI A;  3FB9 A;  4M7D F;  1XOV A;  2YT6 A;  3FC3 A;  2JJ9 A;  4HKE A;  2RI5 A;  3MO8 A;  1VIF A;  2RNA A;  1EFN A;  2RQT A;  2EIF A;  4RTW A;  4Y92 A;  3MEW A;  2XU8 A;  2QQA A;  2QDY B;  2RK2 A;  2LCC A;  5FU7 C;  5LJ5 j;  1D09 B;  4RTU A;  4FIB A;  4E7Z A;  1RI0 A;  1LPL A;  2K3B A;  5FWC A;  1YJN A;  5J39 A;  4MZT A;  5FU7 B;  1KC8 U;  4PK4 A;  3UA6 A;  2VVK A;  5CK9 A;  4BE0 A;  3CCV T;  2CDT A;  2VWF A;  3BW1 A;  1BI1 A;  3CCL T;  3FJ5 A;  1KHC A;  2K9G A;  3EGD B;  3SD4 A;  1I07 A;  2DYB A;  4JRQ A;  5GAM g;  4OMM A;  3GBQ A;  3PE0 A;  2QA4 A;  1X6G A;  2QQS A;  4J8O A;  3VRZ A;  2QYZ A;  2CP0 A;  3ASK A;  3OYY A;  4C5I A;  4EMG A;  2RHX A;  2KRN A;  1NEG A;  4BD3 A;  1Q82 U;  2JM8 A;  2C06 A;  2KQW A;  4WCI A;  1PWT A;  3NFC A;  3TSW A;  4JLI A;  1OQK A;  1VQ7 A;  2E12 A;  4J6X A;  1KQS P;  2MK5 A;  1Y7X A;  2FPE A;  1HXD A;  3V7R A;  1SHG A;  1M1F A;  1WNL A;  2AKL A;  2K4Y A;  2LTO A;  4AG2 C;  4M77 A;  2C0T A;  2ENM A;  4EMK A;  2WAC A;  3M54 A;  1M1K C;  1I81 A;  1VYV A;  2EW3 A;  1NPR A;  1YJ9 Q;  3EG2 A;  1Y0M A;  1VQL A;  4RG2 A;  3MCA B;  4CI0 C;  4AFZ C;  3OYA A;  1GBR A;  5EC7 A;  2SEM A;  3OYF A;  5LJ5 f;  1EIF A;  4JRI A;  1BI3 A;  2X3W D;  1PKS A;  3SWN C;  4KGX B;  1OYX A;  4XK8 E;  2OI3 A;  5DLO A;  2LQW A;  5CQY A;  4ZN1 A;  3CCU Q;  1PRL C;  3CCE A;  3P8B B;  1R8O B;  1M1G A;  1OI1 A;  1YIT T;  4FT2 A;  5GAM d;  2COZ A;  5FU6 B;  2F1L A;  2A36 A;  2KR3 A;  4M4Z A;  3VS0 A;  3VJP A;  2L5Q A;  2JZ2 A;  4HXJ A;  1B34 B;  1HD3 A;  2CP5 A;  4QKU A;  1PG5 B;  3M0U A;  5GAM j;  2J7I A;  2DE0 X;  4L59 A;  3G6E T;  1MMN A;  2DIG A;  4K11 A;  4OMQ A;  3CBO A;  4ZNX A;  4B6M A;  3CCV Q;  1UFF A;  1MHN A;  2FZC B;  3CCL Q;  2OAW A;  3CD6 T;  2CKK A;  1RL2 A;  1K8A U;  1X2Q A;  2PVO B;  1XJW B;  3I5R A;  4GLK A;  2YSQ A;  4RTX A;  3QII A;  3EGX A;  2V1Q A;  1S72 A;  3CEY A;  3UWN A;  1Q7Y U;  2RPN A;  3CBM A;  4MZM A;  3JSC A;  4OVA A;  1M9S A;  1YCS B;  4D8D A;  1OU8 A;  2JM9 A;  4QQD A;  2BE7 D;  2M16 A;  1YWP A;  1BKB A;  4M75 G;  3E1S A;  1TH7 A;  2K5I A;  1VQ6 T;  4C92 G;  4LUE A;  4XTU A;  5FRO A;  5CKE A;  3H0H A;  3EFR A;  5GMK e;  4JUV A;  4J9F A;  4LXC A;  2A0F B;  4M75 B;  2DBK A;  4F7U A;  4A4F A;  3A5Z B;  3OB9 A;  3JB9 H;  2BZX A;  4C92 B;  4M77 E;  4C5E A;  4XTY A;  1J3T A;  4HCB A;  1VIE A;  2BUD A;  5D6W A;  1QVG P;  1TS9 A;  1WQ7 A;  2DL4 A;  3M59 A;  2IIM A;  3SEM A;  3P8D A;  2D8H A;  3LGL A;  3I56 T;  1FWZ A;  1RLP C;  2KBT A;  3JB9 I;  2D8J A;  4X34 A;  2QI2 A;  2VAS A;  3JRZ A;  2AK5 A;  5CO7 A;  3OYE A;  5GAM f;  5GAN 2;  5FW9 A;  4E7H A;  3A98 A;  3JCM h;  4D8K A;  2EQM A;  3TU4 K;  1K76 A;  1OZ2 A;  5CR2 A;  1PHT A;  1M1K R;  4MMK A;  4M75 D;  2R5M A;  1N8R C;  3MP8 A;  3PIO A;  1TUD A;  2V8I A;  4ZGD B;  3DB3 A;  2YRC A;  3UT1 A;  1AD5 A;  3L2Z A;  3GIB A;  3OYK A;  4LDU A;  2EAY A;  1G3S A;  4M75 F;  4EMK B;  2WSC E;  4J9E A;  3TCJ A;  4E7L A;  2E3H A;  3MEV A;  4C92 F;  3EH1 A;  1D0X A;  2BE9 B;  2E70 A;  2VB6 A;  3HSB A;  5A0G A;  5KYW A;  3DLM A;  1CKA A;  1QMC A;  1XTD A;  3E2U A;  3OS1 A;  3THK A;  2KT8 A;  2CH4 W;  3MJX A;  1ZSZ A;  2OJ2 A;  2XG8 D;  1AOJ A;  1IXD A;  1JO8 A;  2IVW A;  2RMO A;  4KUI A;  3EH2 A;  3G6E Q;  3PNW C;  5D7U A;  2GF7 A;  2L3S A;  2G6F X;  4FCY A;  1PD0 A;  2HD0 A;  4J6W A;  1GCQ A;  1QP3 A;  1T3S A;  5LJ3 d;  3GNG A;  2GNC A;  3CD6 Q;  3TQ7 P;  3G1J A;  2F2X A;  5J3B A;  3PMT A;  3JCM J;  2FYK A;  4BI8 B;  5GAO m;  1RAE B;  2PVG B;  3KXT A;  5LJ3 j;  2LX7 A;  4J9G A;  1WJR A;  2KYM A;  2X4W A;  1FYN A;  3H0I A;  4RCC A;  4PJO G;  4XU0 A;  4A54 A;  2FHD A;  1X2K A;  1PM3 A;  2RM4 A;  3QWY A;  2MIO A;  3A8H B;  1WFW A;  2D0N A;  5GMK i;  2P0Q A;  1SSF A;  2ECZ A;  2RI3 A;  2FRY A;  4PJO B;  2DNU A;  4M7A C;  3OYN A;  1VQ6 Q;  4II1 A;  1UG1 A;  1K9M U;  2X3X D;  3EG1 A;  3CPW A;  1IB8 A;  4B9X A;  3CCS A;  1VQP T;  4F7U E;  3JCM Q;  1NYG A;  2LJ3 A;  1VQ9 Q;  1VQN A;  1YI2 T;  3MHX A;  3I55 A;  1VQM T;  5KE3 A;  3EG9 B;  3CCQ A;  1KQ2 A;  2E5K A;  2P84 A;  3JB9 G;  1WJQ A;  4NS5 A;  2CSQ A;  5IHK A;  3I56 Q;  3OSS C;  4C5H A;  2VXE A;  1PD1 A;  2EPD A;  1BK2 A;  3L2U A;  3CC7 T;  1WGS A;  2LT1 A;  2L3Q A;  4R0K A;  2LJ0 A;  4PJO D;  1X6B A;  3CPF A;  1R77 A;  4IUQ A;  2O9V A;  2XD0 A;  1X43 A;  1N27 A;  2JUF A;  1QW1 A;  1M90 C;  1SSH A;  4LD9 K;  2ROT A;  1AVZ C;  1RAC B;  4PJO F;  1QVP A;  4Q5W A;  2HNI A;  4JZ3 A;  4JS5 A;  4LNP A;  3MEU A;  1D1B A;  3TEE A;  5GAO l;  3QBY A;  4PJM A;  2EGA A;  2L89 A;  4OP0 A;  4JDS A;  4EIK A;  3HKS A;  2KNB B;  4FW1 A;  2LP5 A;  3ZFJ A;  3X24 B;  3L2W A;  4XTV A;  5GAN 3;  1MV0 B;  2YHT A;  2XDP A;  2ZPH B;  5KYY A;  4M78 A;  2A37 A;  3OYD A;  1WYX A;  5LJ3 f;  2E6Z A;  4JJN K;  2OTL A;  1QCO A;  1N8R R;  5DY9 A;  2MAM A;  1OX9 A;  1VQ4 T;  1YJW A;  1JQQ A;  4C0D C;  3WXM B;  3DLL A;  1I5O B;  3JCM b;  3J81 E;  4XQ3 A;  2CGH A;  2EGE A;  1ACM B;  3MP1 A;  2GFA A;  3S3O A;  1GFC A;  2GCX A;  2L0A A;  5GAN 7;  4BE2 A;  2O31 A;  3OMC A;  4KGV B;  2EQK A;  4CRI A;  3CMA A;  3QHS A;  1QQJ A;  1BCM A;  4E6R A;  2F69 A;  4OB3 B;  3VYG A;  3QXE B;  2FPD A;  2XMF A;  1H8K A;  4AFS C;  2RO0 A;  3A8L B;  1NLO C;  4IUR A;  4XTX A;  3M4G A;  2RN8 A;  1TSF A;  2MWO A;  2QXF A;  3M0S A;  3QO3 A;  4PNO A;  4J9I A;  4HVV A;  3EAE A;  4UC4 A;  1N9R A;  1G3T A;  1Q81 C;  3C0C A;  4E7I A;  2HSE B;  2KRS A;  3CCM A;  2LMJ A;  1YN8 A;  2AKK A;  2JTE A;  3VKI A;  1X69 A;  4JLG A;  1RLQ C;  5GAO q;  1JJ2 A;  4M7D C;  1AT1 B;  4CC4 B;  4A63 B;  2R5A A;  1OEB A;  3QPH A;  1OU9 A;  1VQP Q;  1PRM C;  3HFO A;  2HEQ A;  1PSF A;  1BCO A;  1TXQ A;  3R6O A;  1YI2 Q;  1VQM Q;  1VQO A;  2XKO C;  4FYW B;  1G3Y A;  2X4J A;  1ZQ1 A;  4C5G A;  4C8Q A;  4BY6 C;  2BKD N;  2J05 A;  1U3O A;  5IHN A;  5D6Y A;  3SWN A;  3JCM g;  2DVJ A;  3REB B;  3UPU A;  4E7K A;  4JS4 A;  3CC7 Q;  1Q86 C;  1CKB A;  2DER A;  4QW2 A;  2P4R A;  3OYC A;  4KGZ B;  1D0Y A;  2CT4 A;  4O6J A;  5CAI A;  2COY A;  4GLM A;  2OTJ T;  3KFV A;  1M1K U;  2JOY A;  5GAN e;  3VYH B;  4IKF A;  1UGQ B;  1Y96 A;  2FVU A;  5LJ5 d;  3CCR T;  3CPW P;  3OYB A;  4QQG A;  4M78 E;  4VUB A;  1JEG A;  1M90 R;  3JV3 A;  1SKU B;  1NBE B;  4LDW A;  4J9H A;  1VQ4 Q;  1MGQ A;  3FRN A;  2K5L A;  4PJL A;  2VYT A;  2ZPI B;  2QEX A;  1GL5 A;  3JCM V;  3VS3 A;  2DFU A;  1Z9Q A;  1I5L A;  5KYU A;  4LD6 A;  3RMQ A;  2Y90 A;  4Z89 A;  2EFI A;  2K5F A;  4M78 G;  5GAO n;  3M0T A;  2DYI A;  2K6D A;  2BIV A;  1JXO A;  1QVG A;  3OA6 A;  4N4I A;  5EG2 A;  3RDV A;  3CC4 A;  5L8R E;  4OGE A;  2HL3 A;  4IIO A;  1YIJ A;  1H3H A;  1KQS S;  1VQK A;  2O88 A;  2K2M A;  1UB4 A;  2SRC A;  1WHK A;  4M78 B;  4A4K A;  4DBR A;  1YNZ A;  3S3N A;  3MET A;  2KY9 A;  2KT1 A;  5I22 A;  2B86 A;  3SB2 A;  5CQX A;  3JCM d;  2DX1 A;  1X27 A;  2K3X A;  1WXB A;  4ELY C;  1M2V B;  3QDF A;  1C0M A;  2PU9 B;  1K9M R;  2JNG A;  1QP2 A;  2RQW A;  4O5V A;  2ZZD A;  1U8R A;  2JW4 A;  1YWO A;  1PKT A;  2DXU A;  3PT9 A;  3IQL A;  1D0Z A;  4J9D A;  1D1C A;  3PVQ A;  4FL6 A;  4C0F A;  3LWI A;  1V76 A;  4HT9 A;  2XDD A;  3J7A F;  4C8Q E;  2MPX C;  2MMP A;  4BDY A;  4FSX A;  4M78 F;  4OB2 B;  2LNH B;  3SDZ A;  1ABQ A;  2CUB A;  1TTH B;  3UDC A;  1YHQ A;  1K73 C;  1D3B B;  3A1P A;  3NTK A;  1WHJ A;  1W6X A;  4RTT A;  1UTI A;  2P0P A;  4E7J A;  5HK3 A;  3CBP A;  2NUP A;  3VS7 A;  1UEB A;  1KD1 C;  2DZ9 A;  1P92 A;  2OTJ Q;  3CME T;  1QLY A;  4C8Q G;  4BI3 A;  2DO3 A;  1F1B B;  3OW2 A;  4HA8 A;  2M0O A;  2H3E B;  2E10 A;  2JMA A;  3L1A A;  1W70 A;  1Q86 R;  2DF6 A;  2CRE A;  5KCH A;  2QGF B;  5FU6 C;  1UJY A;  2NWM A;  3EG0 A;  1JJ2 P;  2XDB A;  2MI6 A;  3VS6 A;  3CCR Q;  4C8Q B;  3RES A;  1OPK A;  4PFP A;  5LJ5 e;  3JAM E;  4MDW A;  3M5A A;  3GLX A;  1XQH A;  4GY5 A;  5GAO p;  1N8R U;  3MPU B;  1K0X A;  1FMK A;  4OF1 A;  3HP9 A;  1VQ5 T;  1ZLM A;  2YDL A;  3NTI A;  2DKG A;  4HCK A;  4FYX B;  4JJC A;  3JCM f;  2F2V A;  5GMK m;  2DJQ A;  1PC0 A;  2ROL A;  2RJD A;  2KDS A;  2C0O A;  5GJV B;  1RAG B;  4CC3 A;  3TVT A;  1YCY A;  2KXD A;  2M1H A;  2GTJ A;  4ZGE B;  1KJW A;  3CC2 A;  4NOY A;  1DJ7 B;  3OYG A;  2PTK A;  4C8Q F;  1YJN T;  4N4G A;  1C6V X;  2CS7 A;  2JS0 A;  2FZK B;  4KBM B;  1OOT A;  2PVD B;  2JS2 A;  5L23 A;  4M7A A;  1QVG S;  2JXB A;  2RF0 A;  3M55 A;  3LX7 A;  1QCF A;  3CC4 T;  3AT1 B;  2A3L A;  4M75 C;  4A4H A;  2E5Q A;  5A2Q E;  1I4K 1;  5HK0 A;  2QA4 T;  4JRP A;  2H8H A;  4C92 C;  1FX7 A;  3M9Q A;  1M2O A;  3HHT B;  3M0P A;  4AFQ C;  1H92 A;  2EVR A;  2RHZ A;  2CP3 A;  2V1R A;  2XIC A;  2CZ7 B;  2ATC B;  5CIU A;  2K7A A;  2CP6 A;  3OBW A;  3QDR B;  1OX8 A;  1QVF A;  1SRL A;  1PSE A;  1VQ7 T;  1IZ6 A;  1Z9Z A;  3VU3 C;  5IAY A;  3EGU A;  5GMK l;  1D1A A;  2DTI A;  1MMA A;  1M5Q 1;  2EQU A;  4DBQ A;  4CC2 A;  4M77 G;  4L6V 5;  1OUL A;  2ED0 A;  2E3I A;  3CME Q;  2P0K A;  1VOM A;  2RQV A;  1TUG B;  1LCK A;  2QG9 B;  1M3C A;  4NL2 A;  3GNF B;  4C92 D;  4OML A;  2M02 A;  4EMK C;  4PFO A;  3INZ A;  4MDX A;  1K73 R;  2DD4 A;  1X75 C;  1VQL T;  2JTF A;  2QQB A;  4M77 B;  2FO0 A;  1IGQ A;  2AT1 B;  1YIT Q;  1KD1 R;  1UGV A;  5GJW B;  3DKM A;  3RMS A;  5GAM e;  1WHH A;  4KUL A;  1M90 U;  2YRD A;  1WXT A;  2EYW A;  3JCM X;  3M0R A;  3ME9 A;  2HCK A;  5GMK h;  2E4H A;  4Y91 A;  3E9G A;  3OSV A;  3L2Q A;  3NMZ C;  2PUO B;  5I2M A;  1VQ5 Q;  4BUG A;  2HBW A;  1BB9 A;  3CCE T;  5ECA A;  2RD1 A;  3RBB B;  1WI7 A;  1QCN A;  4IUU A;  2HMA A;  4M77 D;  4DBF A;  1NJI C;  3LW5 E;  2FL7 A;  1NG2 A;  1R0B G;  2Z0W A;  2HSP A;  3M57 A;  2CZ6 B;  4LDY A;  1K1Z A;  1UE9 A;  3VS5 A;  1C1A A;  5GAN g;  4XU2 A;  3OW2 P;  4M77 F;  2LX9 A;  1JB0 E;  4F16 A;  2Y4X A;  1WXU A;  3P8H A;  4L5G A;  4BI4 A;  3V7S A;  1YJN Q;  4RMO A;  3L42 A;  4KT0 E;  1U5S A;  3FJP A;  1YFN A;  4ZGJ B;  4M7A E;  3E19 A;  2L3R A;  4C0G A;  4PJO C;  1WDX A;  5KYX A;  2VKN A;  3MKD A;  4M7D A;  2YXY A;  2QGG A;  3H0F A;  1CSK A;  3HRS A;  1W2B A;  4HCZ A;  3OBY A;  4RG8 A;  1S1N A;  1M3B A;  4KH0 B;  1K9A A;  3UA7 A;  4DEX A;  2G3R A;  1MND A;  2KSS A;  3ULR B;  5IN1 A;  2QA4 Q;  1S72 T;  2O4X A;  4EDU A;  2A7Y A;  2ESW A;  2M9U A;  1NZ9 A;  1WHL A;  2XK0 A;  1M3A A;  4X9D A;  1E6G A;  1SHF A;  3OS0 A;  2IPO B;  4PFZ A;  3EGX B;  4PKC C;  4E2F B;  5KH6 A;  2L2P A;  4AFU C;  3EFO A;  1Q81 U;  2E64 A;  3PTA A;  3I35 A;  4A53 A;  2LQN A;  1M27 C;  2RJF A;  4DQ2 A;  1OPL A;  1TOV A;  2K79 A;  1VQ7 Q;  1QWE A;  2YUQ A;  1ZHI A;  4F7U G;  2AHJ B;  5I11 A;  3QKJ A;  1PCX A;  3CCJ A;  4FU6 A;  3CCU A;  1AEY A;  1V1C A;  2LCL A;  2COW A;  2VC8 A;  3O8V A;  1PNJ A;  4F7U B;  3D7S B;  1M8V A;  1QVF S;  4X1V A;  1V29 B;  2DBM A;  1MUZ A;  1UGP B;  1VQL Q;  1SRM A;  2R57 A;  1Q86 U;  4A4G A;  2NLU A;  2DL5 A;  3EG3 A;  2CZ0 B;  1LOJ A;  1FXX A;  1XNI A;  2X4X A;  2J6K A;  2HDA A;  2L8D A;  2DRM A;  4ATO A;  4N0A C;  1IGU A;  2DAQ A;  3JB9 D;  2QAZ A;  1RI9 A;  4WF2 A;  2RB6 A;  1YBY A;  4IUT A;  1AWO A;  1N9S A;  2CT3 A;  3PFS A;  3EGD A;  1LVK A;  1LNX A;  2EJG A;  3CCV A;  1QVF P;  2HKQ B;  3JB9 F;  5HKC A;  4B9W A;  3WVD B;  4Z88 A;  3CCE Q;  1JU5 C;  3F70 A;  5FWB A;  2A08 A;  1AZG B;  3L2V A;  4GBQ A;  3QJ6 A;  4OB0 B;  1VYT A;  5LJ3 e;  2YUO A;  4F7U F;  3T9N A;  1NM7 A;  3ZEH A;  1NE8 A;  5KYW B;  2RHU A;  4J9C A;  1EZZ B;  1ZSZ B;  1Y71 A;  3E9F A;  5C6S A;  1NJI R;  3JB9 J;  4M7D E;  1IRX A;  3NTH A;  4ME7 A;  2YUP A;  3BE3 A;  2DTH A;  4YTL A;  1T3L A;  2E65 A; 
#chains in the Genus database with same CATH homology
 2RPN A;  1KSW A;  1YCS B;  4D8D A;  2NUZ A;  1UJ0 A;  2JM9 A;  1YWP A;  2RQW A;  2KYB A;  2PZ1 A;  4JPB W;  1AZE A;  4LUE A;  2JW4 A;  1YWO A;  1PKT A;  1QKW A;  3TSZ A;  3H0H A;  2FRW A;  3IQL A;  4QT7 A;  1ZBJ A;  4J9F A;  4J9D A;  3PVQ A;  2DBK A;  2C0I A;  1ZSG A;  1UEC A;  2BZX A;  1J3T A;  1VYU A;  2LNH B;  1ZUY A;  2DL4 A;  1ABQ A;  2CUB A;  2IIM A;  3SEM A;  2D8H A;  1RLP C;  2KBT A;  2D8J A;  1W6X A;  4RTT A;  1UTI A;  2AK5 A;  3SHW A;  2CUD A;  3VS7 A;  3QWX X;  5FW9 A;  2MCN A;  2J06 A;  3A98 A;  1UUE A;  2EKH A;  2GTO A;  4D8K A;  1QLY A;  1K76 A;  1PHT A;  2JMA A;  4ORZ A;  2J6O A;  1WLP B;  1W70 A;  2DF6 A;  2CRE A;  2GBQ A;  1TUD A;  1UJY A;  2JT4 A;  1QWF A;  2NWM A;  3EG0 A;  1ABO A;  1MV3 A;  1NLP C;  1OV3 A;  3VS6 A;  3REA B;  1AD5 A;  1OPK A;  4KRT A;  4J9E A;  2EYX A;  2LJ1 A;  2EQI A;  2DM1 A;  2O9S A;  1AWJ A;  3VS4 A;  1CKA A;  5IHI A;  1ZX6 A;  1SEM A;  1K0X A;  3NHN A;  3THK A;  2CH4 A;  2KT8 A;  1TG0 A;  1FMK A;  2CH4 W;  2J6F A;  2OJ2 A;  3EHR A;  2EYZ A;  1AOJ A;  4OMP A;  2DL3 A;  1ZLM A;  2YDL A;  1JO8 A;  2RMO A;  3I9Q A;  2KRO A;  4HCK A;  2RQU A;  4JJC A;  2F2V A;  2DJQ A;  2L3S A;  2G6F X;  2L3P A;  1B07 A;  1GCQ A;  4OMO A;  1M8M A;  1T3S A;  2ROL A;  2AZS A;  2C0O A;  2GNC A;  2PNI A;  5GJV B;  1BBZ A;  2F2X A;  3TVT A;  4CC3 A;  2KXD A;  2BZ8 A;  2GTJ A;  1GBQ A;  1KJW A;  1WA7 A;  2PTK A;  2CSI A;  1GCQ C;  2FG0 A;  5IXF A;  2LX7 A;  4J9G A;  2JS0 A;  4JZ4 A;  2KYM A;  3H0I A;  1OOT A;  1FYN A;  3LH5 A;  2JS2 A;  3NPF A;  5L23 A;  1X2K A;  1HJD A;  1VA7 A;  2JXB A;  1GFD A;  2EYY A;  2RF0 A;  3QWY A;  2MIO A;  4J9B A;  1WFW A;  2D0N A;  4OMN A;  1QCF A;  2KXC A;  2O2O A;  1WIE A;  2ECZ A;  4JJD A;  2DMO A;  2FRY A;  4AG1 C;  2DNU A;  2LZ6 B;  1UG1 A;  1G83 A;  2H8H A;  1SPK A;  2X3X D;  3EG1 A;  1NEB A;  2RQR A;  1N5Z A;  3M0P A;  4AFQ C;  1H92 A;  4F17 A;  1NYG A;  2EVR A;  2LJ3 A;  3M0Q A;  2V1R A;  4IIM A;  2K7A A;  4CC7 A;  2E5K A;  2DRK A;  2ABL A;  1SRL A;  2CSQ A;  2A28 A;  5IHK A;  3O5Z A;  5IH2 A;  4Z8A A;  4HVW A;  1Z9Z A;  2EPD A;  1BK2 A;  2KRM A;  3EGU A;  5HCK A;  2QDL A;  2L3Q A;  4R0K A;  2LJ0 A;  1X6B A;  1HSQ A;  2W10 A;  1A0N B;  2LCS A;  4ESR A;  1G2B A;  1I0C A;  2O9V A;  4CC2 A;  5IXB A;  1T0J A;  1UDL A;  2ED0 A;  1X43 A;  4JJB A;  2FEI A;  2RQV A;  1LCK A;  1M3C A;  1SSH A;  2ROT A;  1AVZ C;  1M30 A;  4OML A;  1W1F A;  1E7O A;  1UHC A;  4JZ3 A;  4LNP A;  1WX6 A;  2I0N A;  2GGR A;  1GRI A;  2FO0 A;  2EGA A;  1U06 A;  4EIK A;  1K4U S;  2KNB B;  2LP5 A;  1UGV A;  5GJW B;  3UF4 A;  1QKX A;  1MV0 B;  1ZUU A;  1XOV A;  2YT6 A;  2A37 A;  1WXT A;  1WYX A;  2EYW A;  3M0R A;  1RUW A;  2EGC A;  2HCK A;  2RNA A;  1EFN A;  2RQT A;  3NMZ C;  4RTW A;  4Y92 A;  3VS2 A;  1JQQ A;  3PVL A;  2KGT A;  2EBP A;  2EGE A;  2HBW A;  1BB9 A;  1K0S A;  4RTU A;  1GFC A;  5ECA A;  3RNJ A;  3RBB B;  2L0A A;  1WI7 A;  2K3B A;  5FWC A;  2O31 A;  4LN2 A;  3UA6 A;  3H41 A;  2VVK A;  2F2W A;  1JXM A;  2JMC A;  1NG2 A;  2HSP A;  2CDT A;  2VWF A;  4E6R A;  1K1Z A;  1UE9 A;  3VS5 A;  3FJ5 A;  2FPD A;  2XMF A;  1H8K A;  2K9G A;  4AFS C;  4F16 A;  1NLO C;  1I1J A;  1I07 A;  1WXU A;  2DYB A;  2GQI A;  2ED1 A;  4OMM A;  3GBQ A;  3PE0 A;  2RN8 A;  1U5S A;  1X6G A;  3M0S A;  1IO6 A;  1WDX A;  3VRZ A;  2VKN A;  4J9I A;  4HVV A;  3H0F A;  1CSK A;  2DLP A;  2M0Y A;  1S1N A;  3EHQ A;  2KRN A;  1M3B A;  1ZUK A;  1NEG A;  2FPF A;  3C0C A;  2JM8 A;  1K9A A;  2KRS A;  4WCI A;  2LMJ A;  1YN8 A;  2AKK A;  3UA7 A;  2JTE A;  4DEX A;  3ULR B;  1E6H A;  1PWT A;  1X69 A;  1RLQ C;  3TSW A;  4CC4 B;  4A63 B;  2ESW A;  2DA9 A;  1OEB A;  1M3A A;  1E6G A;  1SHF A;  4RTY A;  3U23 A;  1PRM C;  2L2P A;  4AFU C;  2HEQ A;  2FPE A;  1UHF A;  1SHG A;  1Y57 A;  2KE9 A;  3CQT A;  3I35 A;  2AKL A;  2M51 A;  2LQN A;  1M27 C;  1ARK A;  4AG2 C;  1OPL A;  2J05 A;  1U3O A;  2C0T A;  2ENM A;  5IHN A;  4F14 A;  3UAT A;  2BZY A;  2K79 A;  1QWE A;  1VYV A;  2DVJ A;  2YUQ A;  3REB B;  2EW3 A;  1AWX A;  3EG2 A;  1Y0M A;  5I11 A;  3VS1 A;  1GCP A;  1CKB A;  4AFZ C;  2W0Z A;  1GBR A;  5EC7 A;  2SEM A;  2D1X A;  1TUC A;  2P4R A;  1AEY A;  2CT4 A;  2X3W D;  1B3Q A;  1BU1 A;  1V1C A;  1PKS A;  1PNJ A;  4GLM A;  2OI3 A;  4X1V A;  3R6N A;  2AZV A;  3KFV A;  2DBM A;  1MUZ A;  1SRM A;  4LE9 A;  2LQW A;  4RTZ A;  3ZL7 C;  4DEY A;  2DL5 A;  3VRY A;  3EG3 A;  2DIL A;  1PRL C;  2J6K A;  2HDA A;  2MOX A;  2DRM A;  1T0H A;  1JEG A;  1KIK A;  4RUG A;  1RI9 A;  3JV3 A;  1AWO A;  2CT3 A;  2A36 A;  2KR3 A;  4J9H A;  4M4Z A;  3VS0 A;  1YP5 A;  1NYF A;  4FSS A;  3NGP A;  4HXJ A;  1HD3 A;  1GL5 A;  3M0U A;  2DL7 A;  3VS3 A;  4Z88 A;  1JU5 C;  1Z9Q A;  5FWB A;  2J7I A;  1AWW A;  2DE0 X;  2A08 A;  4Z89 A;  1AZG B;  3M0T A;  4GBQ A;  2K6D A;  4K11 A;  1JXO A;  4OMQ A;  1VYT A;  2YUO A;  4ZNX A;  2DL8 A;  1UFF A;  2OAW A;  1KFZ A;  4IIO A;  1H3H A;  2BTT A;  1NM7 A;  2KEA A;  3I5S A;  2O88 A;  2K2M A;  2SRC A;  1X2Q A;  1YNZ A;  4J9C A;  3I5R A;  2YSQ A;  4RTX A;  2KT1 A;  5I22 A;  2B86 A;  2V1Q A;  4LUD A;  4HVU A;  4RTV A;  2YUP A;  2YUN A;  2DX1 A;  1T3L A;  1X27 A;  1WXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...