1BK2A

A-spectrin sh3 domain d48g mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Obligatory steps in protein folding and the conformational diversity of the transition state.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Sh3-domain
molecule keywords A-SPECTRIN
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1bk2A00
1U3OA 2ENMA 2ROTA 4HVVA 3VS1A 1WX6A 2LCSA 5FWBA 2EGAA 1WIEA 3NGPA 2J05A 2O31A 3M0TA 4DEXA 1I1JA 2LQNA 4OMNA 1MV3A 2O9SA 1QKXA 1Y57A 2LNHB 2OJ2A 1GCQA 3NMZC 4RTZA 4OMMA 5FWCA 1AVZC 1KSWA 5IHNA 1OEBA 4AFZC 3VS3A 2JW4A 2RQUA 1QWEA 2L3PA 2DE0X 4RTXA 2OAWA 2A37A 2KGTA 3C0CA 2D0NA 3QWXX 1GRIA 1LCKA 2K6DA 3VS2A 2DVJA 1AWJA 2E5KA 4RTUA 2YUNA 5ECAA 2JM8A 1QKWA 2HDAA 2DM1A 2GQIA 2JT4A 4IIOA 1X69A 2D8HA 2IIMA 2KRNA 1M3BA 4RTWA 2G6FX 4HVUA 1KIKA 1Y0MA 2VKNA 1U06A 3EG0A 4ORZA 1AWXA 2KYBA 1NLPC 3UA7A 2GTJA 4D8KA 3U23A 3PVLA 1QCFA 1M3AA 2FEIA 3VS0A 4J9IA 1QLYA 4HXJA 1BK2A 1H3HA 2KBTA 1WFWA 1VYUA 3KFVA 4CC4B 1HJDA 3ULRB 3M0UA 1HSQA 2ESWA 1W70A 2BZXA 2EVRA 2V1RA 1AWOA 3M0QA 2CSQA 4A63B 2XMFA 4K11A 2CT4A 1J3TA 1WDXA 2RN8A 2EBPA 1SRMA 1YP5A 2EPDA 2MCNA 1IO6A 2GTOA 2AKLA 1SHFA 5GJVB 3REAB 2GGRA 2DL3A 3O5ZA 2CUBA 2KROA 2JM9A 3REBB 2JXBA 1JEGA 3QWYA 2YDLA 2DNUA 3EHRA 1UECA 1RLPC 2DL7A 2EW3A 3VS5A 2X3XD 2W10A 1UDLA 2YSQA 1WA7A 2O9VA 2O88A 4QT7A 2YUPA 4RTYA 1H92A 2HCKA 1TG0A 3TSWA 1RLQC 1OV3A 2J6OA 2DL5A 1V1CA 2M0YA 2L2PA 1TUCA 2LJ3A 1CSKA 2X3WD 1YNZA 3H41A 1GBQA 1SEMA 4AG2C 3M0SA 2C0TA 2DRKA 2QDLA 1AEYA 3TSZA 2DBKA 4WCIA 1WLPB 4J9BA 4OMPA 1S1NA 3UF4A 5GJWB 1PWTA 4LE9A 5HCKA 1UJ0A 1PNJA 1M3CA 4AFQC 1NYGA 3EGUA 2J6KA 2YUOA 2FG0A 1NG2A 2DX1A 3VRYA 1AD5A 2LP5A 2DA9A 1UHFA 1HD3A 4J9FA 4OMLA 5L23A 2DYBA 1KFZA 2NUZA 2FPEA 4GLMA 2KEAA 1Z9ZA 2KRSA 2KR3A 2AZSA 2JMAA 1GBRA 1NYFA 4F14A 2K79A 1ZUYA 2LZ6B 2B86A 2L3QA 2DF6A 4LN2A 2ED0A 2ED1A 1WI7A 4RTVA 2RQTA 4ZNXA 2J6FA 1GFCA 1YWPA 3CQTA 2LX7A 1YWOA 4IIMA 3UA6A 1GFDA 4OMOA 1OOTA 2JS2A 2CT3A 3FJ5A 1UUEA 4J9GA 2KXDA 2HEQA 3EHQA 1ARKA 2C0OA 1W6XA 2L3SA 3EG1A 1EFNA 2AZVA 3SHWA 1E6GA 2RNAA 2PTKA 1E6HA 1X43A 1YCSB 1BB9A 2NWMA 1ABQA 1X6GA 1JU5C 2EYXA 1B07A 4FSSA 4Z8AA 2KE9A 5EC7A 2EQIA 2JS0A 3PE0A 1K1ZA 3JV3A 1JQQA 3I5SA 2ECZA 2SEMA 1WXTA 2CH4A 1MUZA 2D1XA 5IXBA 4HVWA 2BZ8A 1RUWA 2CREA 2L0AA 1QWFA 2DILA 4J9CA 3LH5A 4JPBW 3THKA 4HCKA 4OMQA 1PKSA 4JZ4A 1X27A 2A08A 2ABLA 1PRMC 1B3QA 2EGCA 2K3BA 5IHIA 2M51A 1VYTA 3GBQA 1CKAA 2YUQA 2DBMA 2MIOA 4Z88A 2JTEA 4EIKA 2DJQA 4GBQA 4X1VA 1BU1A 1SRLA 4JJBA 1NM7A 2EYWA 2RPNA 4J9HA 1GL5A 2EGEA 1VYVA 4RUGA 3R6NA 3UATA 3H0FA 1JXOA 3EG2A 4CC7A 2LJ1A 1K9AA 4R0KA 4JJCA 1UJYA 1W1FA 5I22A 1G2BA 2CDTA 1ABOA 2BTTA 2V1QA 2RF0A 1PKTA 2RMOA 1ZSGA 2AK5A 2LMJA 3I5RA 1H8KA 4KRTA 2KT8A 1SSHA 1T0JA 1BBZA 5IH2A 4Z89A 1UG1A 1UHCA 1ZBJA 1T0HA 1GCQC 2HSPA 4JZ3A 2EKHA 1FYNA 2F2XA 1KJWA 1SPKA 1GCPA 2KT1A 4F17A 2K9GA 1M30A 2GNCA 2O2OA 2I0NA 1ZX6A 4LNPA 1ZUKA 4E6RA 1K0XA 4CC3A 4J9EA 1UE9A 1Z9QA 1OPKA 2EYYA 3H0IA 1OPLA 2DLPA 4D8DA 3TVTA 2RQWA 2CUDA 1M27C 2FPDA 1VA7A 3VS6A 2VVKA 3VS7A 2C0IA 2RQVA 1T3LA 1XOVA 2F2WA 2KRMA 3RBBB 1WXUA 2JMCA 2K7AA 1I07A 2PZ1A 4LUEA 1AZEA 3M0PA 5IXFA 1YN8A 1UFFA 2DL8A 2YT6A 4F16A 2J7IA 2OI3A 2DL4A 4J9DA 2SRCA 1E7OA 1ZUUA 2FPFA 2FRWA 3M0RA 1NEGA 2ROLA 1AOJA 1JO8A 1AWWA 2LJ0A 4AFUC 2MOXA 2DRMA 5I11A 1UGVA 2AKKA 4ESRA 3NPFA 1X2QA 2P4RA 2FRYA 1A0NB 5IHKA 1K0SA 1U5SA 2VWFA 1UTIA 3VS4A 3RNJA 1AZGB 2CSIA 4DEYA 2BZYA 2H8HA 2KNBB 2W0ZA 1FMKA 1T3SA 2CH4W 2A36A 2EYZA 2RQRA 1X2KA 3H0HA 3IQLA 1G83A 1NEBA 1X6BA 2DMOA 2PNIA 2FO0A 4RTTA 2HBWA 1CKBA 4CC2A 3SEMA 2LQWA 4LUDA 1TUDA 3I9QA 4JJDA 2GBQA 1WXBA 2J06A 3PVQA 3A98A 2D8JA 2F2VA 1ZLMA 1K76A 4AFSC 2A28A 1I0CA 1M8MA 1PHTA 1K4US 2KYMA 1MV0B 3VRZA 4AG1C 2K2MA 4M4ZA 3EG3A 5FW9A 1RI9A 1WYXA 2KXCA 1NLOC 1N5ZA 3ZL7C 1JXMA 1PRLC 1SHGA 4Y92A 3I35A 3NHNA
chains in the Genus database with same CATH superfamily
5I21A 4OP0A 2ROTA 4HVVA 1C1AA 3MO8A 1WIEA 3MEAA 3CC7T 1YJWT 3OSSC 1N9SA 5CO7A 1G5VA 4PK4A 1VQ4A 2GFAA 2QEXT 2LNHB 3CCQQ 2X4WA 4MMKA 1GCQA 1Y96A 3NMZC 1IRXA 1KSWA 1VQ4Q 4AFZC 3VS3A 1Q86U 2DE0X 4RTXA 2DD5A 2OAWA 4MDXA 3C0CA 2D0NA 2XK0A 1VQ8Q 1NJIU 1VQKA 5FRMA 3QPHA 2RHXA 1VQ6T 2HDAA 1BI1A 1VQKQ 1W2BS 1IREB 2KRNA 1VQNQ 1H3ZA 3CC4A 2DXTA 2E12A 3A8OB 3EGDB 3JCMd 2HAXA 2VKNA 3OW2S 3RIRA 2CGHA 3WVDB 2CP0A 3UA7A 2GTJA 1NJIC 3FDRA 4LDYA 5A2QE 1Y07A 3CCST 1QVGA 5CKDA 1BK2A 4OB0B 1WFWA 4QQ6A 2ZPEB 3M54A 2JN0A 1OQKA 3LLRA 3J81E 1BCMA 5GAN7 1PSFA 4OMFB 4TVRA 1Q82R 2RJFA 4OGCA 2ESWA 4HKEA 1D0XA 2PUKB 2EVRA 3OYCA 4E7ZA 2QQSA 4J8OA 4E7JA 2GFUA 3M0QA 2CSQA 1VQ5Q 4FM4B 4K11A 3X28B 1J3TA 4M77D 2R5AA 1FWZA 2GTOA 4P5NA 1JJ2S 1SHFA 3JCMc 3EFOA 2DL3A 3O5ZA 4LDWA 3SWNA 2CP2A 3TEEA 2M02A 3GF5A 4M75A 1YI2A 4M78B 3QWYA 1F1BB 2K57A 1UECA 2PQWA 1RLPC 4M78E 1YI2Q 1D1BA 4OF1A 3CBOA 2O9VA 3L2UA 1D0ZA 2O88A 4MZMA 4C5EA 2WSFE 4C8QG 2HL5C 3VV0A 4KULA 2LJ3A 3H41A 1GBQA 2O4XB 3PMTA 2LQ8A 3M0SA 4PJOG 1QVGP 3ER0A 4GY5A 3JCMg 4BI3A 1S1NA 2X4YA 4AT1B 1PWTA 2Y90A 2EFIA 2VXFA 1VQ9A 5GAN8 3SD4A 1KQSA 4C0FA 2J6KA 4M78C 2JTFA 1RADB 2LP5A 3CPWS 2QXFA 2RHZA 5GMKe 3GP8A 3ME9A 2CZ0B 4GLMA 3I55Q 2DKGA 1V76A 1ZUYA 2AHJB 4M7DD 3FC3A 2B86A 2L3QA 5HK3A 3QZ5B 4LN2A 3OW2A 3PMIA 1D09B 4ZNXA 1YWPA 1VOMA 3CQTA 4IIMA 2LC4A 1UGRB 3QJYA 4FCYA 3OYMA 2CP3A 2COZA 2LNVA 5I2SA 2KDSA 2QG9B 4XTZA 2DK3A 4PLIA 2HEQA 3EHQA 1X75C 3HL8A 1W6XA 3EGDA 4C92F 3E9GA 2PTKA 4PJOC 2XHCA 1HYOA 4VUBA 4BB7A 1BB9A 2DZ9A 1MNDA 1B07A 3MHXA 2CZ6B 4FSSA 3SWNB 1K1ZA 2JNGA 3I5SA 3JB9I 2ECZA 3OSVA 3M58A 3CCQT 5A0DA 1UEBA 4CI0C 2GQVA 4HVWA 2BZ8A 2HD0A 3GNGA 2L0AA 4BACA 3CPWP 1KD1C 3LH5A 1PKSA 3CC2A 4M77C 3QZ9B 2WSEE 3OYKA 1M1GA 1B3QA 1VYTA 3GBQA 3PIOA 3CCET 2LRQA 2H3JA 3VJPA 4C0DB 1YJNQ 2NYSA 4GBQA 1IXDA 4PJOB 2X4JA 4X1VA 4JJBA 1YIJA 3JB9J 1BYMA 1K9MC 1GL5A 3R6NA 2OAUA 3UATA 3CBMA 3H0FA 4LD6A 1OU8A 3M57A 5J26A 4CC7A 4R0KA 1OU9A 1BIAA 5I22A 2NUPB 1EIFA 3TU4K 1PKTA 4JRKA 2QQAA 4KRTA 5LJ3h 4FT4A 3G71A 4N4IA 2XG8D 2HSPA 4JZ3A 1NPRA 1FYNA 4BI4A 2IG0A 3MEUA 1K9MU 3G71Q 3S3MA 1SPKA 1GCPA 2KT1A 1Q86R 2B8AA 4C92D 1KD1R 3LWHA 4C0DC 2O01E 1Y71A 1ZUKA 4FU6A 2GCXA 3RESA 3M56A 2KI7A 3LW5E 4HA8A 2Y4YA 2HL3A 2DLPA 5L8RE 4PFZA 3VS6A 2VVKA 1O75A 5GAN4 4ZN3A 2RQVA 1MGQA 1XOVA 2F2WA 3RBBB 1M90R 1WXUA 3QKJA 3G4SA 2QQBA 4LUEA 2YLCA 2LVMA 5IXFA 4JUVA 4QKUA 2EQMA 2QASA 2J7IA 1ZUUA 5GAN5 5DM7R 3M0RA 1Q95G 2ROLA 1AOJA 2XDPA 3PFSA 2LJ0A 4M7AF 1UGVA 3I56A 1Q81U 3VYHB 4C8QA 2VWFA 4IUUA 1UTIA 3HTRA 3CCRA 2CSIA 5LJ5h 3NFCA 5KE3A 2KNBB 3CCMT 2CH4W 1Q86C 1VIFA 2JOYA 2ZGWA 4EMHA 3FB9A 5CIUA 2BE9B 4QVDA 4MMLA 1YHQT 4FYVB 5FU7C 4M7DB 2GBQA 1WXBA 2CZ7B 2D8JA 3OY9A 2E6NA 4FYXB 2VGNA 1ZLMA 2D0QB 1K76A 3CD6T 1OI1A 1M8MA 2KY9A 5GAOm 1M9SA 1QCNA 5FROA 1QVFP 3VRZA 2NUTA 5KCHA 3NTIA 1RI9A 2QDYB 5A0GA 2KXCA 1VQ7T 3CMET 3JB9D 3KXTA 1R8OB 3ZL7C 4M75E 4XK8E 3Q1JA 4XU0A 5KYXA 3I35A 4ZGEB 3OA6A 1OX9A 4MZTA 3NHNA 2YRDA 1U3OA 3EGXB 2XIDA 2LCSA 2EGAA 3HFNA 1RAAB 1SSFA 3NGPA 2J05A 4M75D 3M0TA 4DEXA 1WHMA 1I1JA 5C0MA 2M1HA 2LQNA 1MV3A 2DZCA 2O9SA 3P8HA 2ZPHB 3QG1A 1W2BP 5LJ5j 1N8RC 2M9UA 4C0ZA 4RTZA 4OMMA 2BE7D 5IHNA 1OEBA 2E3IA 3H8ZA 2DJZA 2JW4A 2RQUA 4O5VA 2L3PA 3G6ET 1I4K1 2A37A 1P92A 1GRIA 2LT1A 3PNWC 4BDZA 3TQ7P 1S72T 3LX7A 2K2VA 4R55A 2RI3A 2QA4T 2E4HA 3A8MB 3H9NA 3A1PA 2M16A 3X20B 1X69A 1K9MR 4PLLA 4RTWA 5KYXB 4HVUA 5GAMh 5KH6A 3CMEQ 1IHWA 2RM4A 4N0AC 1U06A 4ORZA 2XDBA 2KYBA 2RJCA 1IZ6A 2FB7A 1WNLA 2FEIA 3C95A 4J9IA 3CC4T 3JCMW 1VQ5T 3V8JA 1H3HA 1RAIB 3QSUA 2MYSA 1X6OA 2E1HA 5GANj 3KFVA 2YHTA 4YTLA 1G3SA 1HJDA 3ULRB 4M7AB 3EFSA 4E7SA 3E2UA 3G7ZA 2RN8A 3QYGB 5DLOA 2EPDA 5KYYB 3M59A 2DYIA 1WGSA 3AT1B 2GGRA 5CAIA 3CCVT 2CUBA 2KROA 3FIFA 3REBB 2BKDN 3CD6Q 1IGUA 2OTLA 2FZKB 4XQ3A 3CXCS 5LJ3j 4FT2A 4QVCA 4RG2A 4C8QB 2R5MA 2OTLQ 4M7DC 3BDLA 3UWNA 2X3XD 3MPUB 4E7LA 2W10A 1UDLA 1YCYA 1WQ7A 2YUPA 1H92A 3QXEB 2HCKA 4M78G 5GAMj 2HNIA 4BUGA 2DL5A 1V1CA 1JRIA 2X3WD 2VB6A 4J6YA 2C06A 2QDLA 3P8DA 1AEYA 1M1KU 2QTVA 3FEOA 4J9BA 4X9DA 4M7DA 4LE9A 4PJOE 2MWOA 3CC2Q 4AFQC 1NYGA 2FG0A 3VRYA 1BI0A 2PU9B 4NL3A 3FJPA 2V26A 1WQWA 1UHFA 1HD3A 4J9FA 1QMCA 1YIJQ 2NUZA 2X9HA 3CEYA 2QGGA 1VQ4T 4PJMA 2KRSA 2JMAA 1DJ7B 3M55A 3S3NA 3SDZA 1I5LA 2ED0A 4C8QE 2ED1A 4ZGDB 2XKOC 1UGQB 1GFCA 1OULA 1ZQ1A 5D6YA 4HT9A 1RL2A 4Y28E 2DEUA 2EJFA 4OMOA 4X9CA 2FL7A 3URGA 2CT3A 3RR6A 1UUEA 2KXDA 3QDFA 3L2RA 3QIIA 2L3SA 4HCCA 5IN1A 8AT1B 2YRCA 2P0KA 3CC7A 3RERA 1QVFA 3A8HB 3HSBA 1YCSB 2EQUA 1ABQA 2CZ1B 2EYXA 1VQOT 2YWWA 4Z8AA 2KE9A 5EC7A 4DBFA 3JV3A 3OYHA 1QVFS 5KYWA 1ZA2B 5LJ3f 1WXTA 5DLQE 1MUZA 1VQPT 3CBPA 1FMVA 5GAOq 4XU3A 3G1JA 1KHIA 4N4GA 3RMSA 3JCMP 1YBYA 2E41A 2CP5A 4J5YA 3EH2A 1NE8A 4J7FA 4JZ4A 1PRMC 5IHIA 4C92B 4DBHA 2M51A 4JS5A 2KVQG 1CKAA 4M77F 2YUQA 3EAEA 2JTEA 2DJQA 3JCMe 4E2FB 3A8GB 4M75F 4EMGA 1NM7A 4J9HA 4ZTFA 1HK9A 1RABB 1M1FA 5AT1B 4XAXB 3OYGA 2HQEA 1JXOA 2LCCA 3EG2A 2LJ1A 3VKIA 1UJYA 3CCRQ 1TU0B 4C92G 1G2BA 4CRIA 1W2BA 1XTDA 2CDTA 1PSEA 5C6SA 1ZSGA 2COYA 3WVEB 3CMAT 4A54A 1H8KA 2KT8A 1SSHA 6AT1B 1BBZA 2ZPBB 3HRUA 1TSFA 1UHCA 1GCQC 2R58A 1TS9A 2EKHA 2QEXQ 5DY9A 1R0CB 4PJOA 1KG1A 4A53A 2K9GA 2EQKA 1M30A 2QEXA 1VQOQ 2CKKA 2K4YA 2I0NA 2RJEA 3KUFA 1AHJB 1MNEA 2F5TX 1IGQA 4LNPA 4QQDA 4E6RA 4IURA 1KD1U 4MZPA 4J9EA 1G3WA 1Z9QA 1LJOA 1OPKA 3LYIA 2IPOB 2DD4A 4PFPA 4PJJA 2FPDA 1VA7A 4IUTA 2L5QA 1T3LA 3KBGA 2K3YA 3CCUQ 3MEVA 1I07A 5GMKj 4FSXA 4OB3B 3HP9A 1Q82U 1YN8A 1UFFA 2DL8A 2DVEA 4F16A 3OYDA 3MP8A 1I81A 3OW2P 1E7OA 2FPFA 4JRPA 2L8DA 5LJ3e 1ZSZB 1NEGA 2IVWA 1AWWA 1TWBA 2JTMA 3PTAA 4AFUC 1PG5B 2DRMA 2AKKA 3RKWA 1X2QA 4IUVA 3OBYA 4PKCC 2FYKA 4BI8B 1K0SA 2Y4XA 1WHLA 5KYUB 1M4ZA 4MDWA 3S3OA 4M77E 3EFOB 3BDUA 2BZYA 1FMKA 1C6VX 3F70A 2FZCB 2A36A 1WJSA 2EYZA 1X2KA 1W4SA 3H0HA 1NJIR 2P0QA 4M7AG 1UB4A 4PL6A 2P84A 2FO0A 2X4XA 1CKBA 2D9TA 2MK5A 1ZHIA 3ZBDA 3I9QA 4M78D 4F7UE 3M4GA 1GXIE 2XU8A 2CS7A 4XTXA 4C5HA 1MV0B 2OTLT 4AG1C 2K2MA 4KGVB 3EG3A 5FW9A 1WYXA 3CCJQ 1SKUB 2FZGB 4KUDK 1YJ9Q 1NZ9A 4ANJA 4EMKB 4O6JA 2A7YA 3ZEHA 2E6ZA 1PM3A 1QP2A 4C0GA 2HSEB 3BE3A 4J6WA 4KH0B 4M78A 3MJXA 2RA2A 2RO0A 5HK0A 4LDXA 3JB9G 1K8AU 1KQ1A 4LD9K 3WXMB 2DO3A 5FWCA 4M77G 1AVZC 4PJLA 5GAN2 1VQPQ 2PVDB 1QWEA 4WTOB 4N0AA 1Y96B 3BFMA 4M7AD 3I55A 3T9NA 4XU2A 4XTVA 1LCKA 2K6DA 1WJQA 2F5KA 2DVJA 2E5KA 4NOYA 2YUNA 5ECAA 3L1AA 2K5LA 3C12A 4M7AE 4IIOA 2D8HA 2IIMA 1TTHB 2LTOA 1S72A 4BE1A 2EYQA 2G6FX 1JBMA 3EH1A 2L89A 2K3XA 2DAQA 2XI9A 3EG0A 4DBRA 3GNFB 3HFOA 1WHJA 2A0FB 3U23A 2VYTA 2MF2A 1M3AA 3VS0A 1B7TA 1ZSZA 4DBQA 4OB1B 3O8VA 2KQWA 1QLYA 4RKUE 1TXQA 4HXJA 1VQ9T 2KBTA 3RMQA 3JCMb 1M1KC 3CD6A 4QVZA 4JRIA 3QBYA 3OS5A 1NBEB 1PCXA 1HSQA 2EKOA 3R6OA 3QDRB 2V1RA 1JB0E 1AWOA 2WACA 4ZN1A 3I55T 2COWA 2HKNA 4DOVA 4A4FA 2MCNA 3TREA 3DB4A 3OYNA 3S6WA 2AKLA 3CCEA 4D6WA 1VQNT 2KK4A 3EG9A 1OX8A 2MI6A 2JM9A 1N8RR 3LGLA 1BCOA 1JEGA 1K73U 2HKQB 5GAN6 4KBMB 2YDLA 4PJOF 4EDUA 3EHRA 2D6FA 2DL7A 2EW3A 2RD1A 4UC4A 3MEWA 5LJ5e 2YSQA 1WA7A 4QT7A 3OQ5A 1TG0A 1RLQC 2J6OA 2L2PA 2M0YA 1TUCA 4Y91A 3CCLA 1CSKA 3CMAQ 4AG2C 1K73C 2MAMA 2C0TA 2DRKA 3TSZA 4EMKC 2QK0A 4ELYC 3UF4A 3CCRT 4OB2B 5GJWB 4BDYA 2R57A 4FW2A 4F7UA 1WHGA 5CCAA 2YRVA 3I56T 2YUOA 1H641 2QYZA 3M5AA 2NLUA 1AD5A 1ACMB 3EG9B 5CQYA 2DA9A 4C92A 5L23A 2E3HA 2DYBA 1KFZA 1VQ8A 1K8AR 3PGGA 1M2VB 2KR3A 2AZSA 4II1A 1NYFA 2RI5A 3UPUA 2E70A 3CPWA 5GMKi 2K79A 2LZ6B 3HKSA 1VIEA 3FRNA 1O9SA 2LX7A 2P0PA 1YWOA 5D6XA 1ZA1B 2JUFA 5FU6B 1OOTA 5GAMd 2ZPFB 4L59A 3META 5KYNA 3QO3A 1ZSZC 2DFUA 1VQ6A 1EFNA 1MMDA 1VQMA 2QTXA 4BE2A 1X43A 2KSSA 1Q7YR 4HCBA 2DXUA 2NWMA 3OYLA 3I56Q 3L42A 1JU5C 3X25B 2EQIA 2JS0A 3PE0A 3SB2A 3OMCA 3JB9H 1JQQA 2CYZB 3G71T 3J7AF 2CH4A 4XTUA 3CCUA 5IXBA 3UDCA 1RAGB 3QJ6A 1RUWA 2CREA 5FU6C 2E65A 1YI2T 2EJ9A 2ZPIB 4J9CA 5HY6A 4JPBW 2YXYA 1D3BB 5FU7B 4OMQA 5CKEA 2A08A 4KGZB 2ABLA 4HT8A 4RG8A 2HBPA 5GAOn 1FXXA 4C8QC 2DBMA 3ASKA 4QW2A 2LDMA 2JVVA 2MIOA 4Z88A 4EIKA 2RHYA 1B34A 3OYFA 3PT9A 3L2VA 1BU1A 2EYWA 2E64A 2RPNA 5GANh 3CCJT 4JDSA 1QVGS 4RUGA 4M75C 4M7AA 3V7SA 4KGXB 4JJCA 1W1FA 2DIGA 4WF2A 3OYAA 4RMOA 2BTTA 2V1QA 3X24B 2AK5A 2LMJA 1VQ9Q 4C92E 5IH2A 1UG1A 2F2XA 5GMKm 4ZTJA 1PD1A 1MHNA 1BKBA 3VUBA 1IB8A 3GIBA 7AT1B 3HPWA 2GNCA 2O2OA 2XICA 1JJ2A 1ZX6A 3EFRA 2E5QA 1LNXA 1X01A 4L6V5 4CC3A 1M5Q1 1UE9A 3CCLT 4B9XA 1UGPB 4Z02A 2EYYA 5KYUA 2RJDA 4D8DA 1RI0A 1WHKA 2RQWA 5CQXA 4M7DE 1M27C 2BUDA 5LJ3g 2C0IA 3BY7A 3L2QA 1SG5A 4J83A 2ZAEA 2KRMA 4EMKA 4KUIA 1Q81C 2DTIA 2K7AA 5CVIA 2AT1B 4XTWA 3LGFA 2RH2A 3OBWA 2YT6A 4J9DA 2SRCA 3JB9F 2EQJA 4A4HA 1JO8A 1PD0A 2MWPA 2Z0WA 2MOXA 2WSCE 5I11A 1YJ9T 2F69A 3NPFA 2P4RA 3QUIA 2FRYA 2VUBA 1VQ7A 5EG2A 3JSCA 5FLXE 2OTJQ 1AT1B 1B34B 1U5SA 4E47A 2VASA 3VS4A 3RNJA 1AZGB 3VU3C 1VUBA 2OTJA 1TOVA 2H8HA 2LX9A 2W0ZA 1S72Q 2ZCFB 2QA4Q 3D7SB 4JLGA 1M90U 1NPPA 3CCJA 2RQRA 3CCVQ 2NUTB 2PVGB 1RAEB 1KC8C 1NEBA 3OS0A 4R56A 2PNIA 4RTTA 2HBWA 4B9WA 1XNIA 3OYIA 4JJNK 1IHVA 5I2MA 1MMGA 4C5IA 2CP6A 5CK9A 3V7CA 3A98A 1G3TA 1HXDA 3LH0A 2GF7A 2ZZDA 1PHTA 1K4US 2KYMA 4HCZA 1M2VA 1M90C 2DXCA 1WHHA 5J39A 4M75B 3CXCA 2EIFA 1QVPA 1N8RU 1LOJA 1N5ZA 2G3RA 4KH1B 2K5IA 4OGEA 3A8LB 3G6EA 2DXBA 4DA4A 2ENMA 4XTYA 3CCMQ 3RDVA 3VS1A 1WX6A 4B6MA 1N27A 5FWBA 1QP3A 2OTJT 4Q5WA 2O31A 3CCMA 3QYHB 4FIBA 2FHDA 4LDVA 2MMPA 4OMNA 2XD0A 2LCLA 1VQ8T 4M7DF 1WZOA 3OMGA 3MP1A 1QKXA 1Y57A 2OJ2A 3CCSA 2V8IA 4PFOA 1UGSB 3CXCP 2XDDA 2HQHA 1I5OB 1KK7A 1WJRA 2KGTA 4BY6C 3QWXX 4M7AC 5FRNA 1TUGB 4A4EA 3CCLQ 5GAMf 4PJNA 3VS2A 1LPLA 1AWJA 4C8QD 4RTUA 1KQSS 2DPPB 5AYFA 2JM8A 3V8KA 1QKWA 3NTKA 3M9QA 2DM1A 2GQIA 2JT4A 3G4SQ 4F7UF 2DTOA 3INZA 1M3BA 3GOXA 3UT1A 3E9FA 3RUXA 1BIBA 2CP7A 1KIKA 1Y0MA 2P4TA 3JCMX 1AWXA 1NLPC 2V8JA 1KC8R 1G3YA 5CKHA 4D8KA 3PVLA 1QCFA 5GMKl 4E7KA 2NUPA 3QHSA 1VYUA 3CPFA 2H3EB 5M9OA 4AMCA 2QQRA 4XU1A 4CC4B 3M0UA 1D0YA 2KAFA 1W70A 2BZXA 4DQ2A 1K8AC 1VQNA 1M8VA 4A63B 2XMFA 2CT4A 1WDXA 2EBPA 1SRMA 4BE0A 1YP5A 5IT9E 3H6ZA 2EWNA 5J3BA 1IO6A 3L2ZA 1RAHB 2K5FA 1QQJA 3OYJA 1Q7YC 5GJVB 2DERA 3REAB 5CKFA 3CMAA 2EJGA 2VV5A 2JXBA 1QW1A 3C4SA 4IUQA 1M2OA 2DNUA 1VQMQ 3OB9A 1BI2A 3E1SA 3CCQA 1Q81R 3VUZA 1G8XA 3VS5A 5GAMe 4OVAA 4N4HA 1VQ5A 2LT4A 4ZGJB 2HZYA 5D7UA 4EPCA 1YHQA 4RTYA 3DLLA 1RACB 2RK2A 3TSWA 1Q7YU 1OV3A 1YHQQ 1RAFB 1YNZA 1SEMA 4ME7A 3JCMh 2DBKA 4WCIA 4F7UG 1WLPB 3N5BB 4OMPA 2JJ9A 3JRZA 5HCKA 1UJ0A 1PNJA 2L3RA 5KYYA 4LDUA 1PC0A 2AIRB 3C94A 3OYEA 3CC4Q 1M3CA 4M78F 3EGUA 3JAME 1YITT 1KQSP 1NG2A 2DX1A 4M77A 3MCAB 1YITQ 5GAOr 3MP6A 5LJ5g 1U8RA 1LVKA 1YITA 4OMLA 3MKDA 1VQOA 2FPEA 5KCOA 4JS4A 2KEAA 1KHCA 1Z9ZA 5GAMg 2OX7A 3JCMQ 2HQXA 4BY6B 1GBRA 1VQ6Q 3A5ZB 1OZ3A 2YLBA 4F14A 4A4GA 4FW1A 2KMTA 2DF6A 2QAZA 5GANf 1WI7A 4RTVA 2RQTA 2J6FA 5LL6S 3UA6A 1SF9A 1GFDA 2JS2A 2V8KA 3CMEA 4NS5A 4E7IA 3CC2T 3FJ5A 3ZFJA 4ATOA 2QI2A 2DIQA 4J9GA 1ARKA 3M4YA 2C0OA 1N6AA 4C92C 3EG1A 2AZVA 3SHWA 5GAOl 3OYBA 1E6GA 2RNAA 2PVOB 3E19A 3OYYA 3G4ST 2E10A 1E6HA 4J6XA 4JLIA 1X6GA 3JCMV 2HMAA 2QQ9A 1D3BA 5CKBA 1U1TA 2SEMA 2D1XA 2LQKA 5GANe 2EAYA 5GAN3 2DETA 3EGXA 5A0LA 1QWFA 5D6WA 3V7RA 3TCJA 1M1KR 2DILA 5LJ5d 2DEQA 2DTHA 4HCKA 3THKA 1YIJT 3CCUT 1X27A 2EGCA 2K3BA 1I8FA 1OZ2A 2A3LA 3JCMJ 4C8QF 1SRLA 1VQ7Q 2EGEA 1YFNA 1VYVA 1XJWB 4E7HA 3SWNC 1K9AA 1QCOA 4GLKA 1JJ2P 3BW1A 1ABOA 2O4XA 8ATCB 2FVUA 1VQLA 2RF0A 3DB3A 2X35A 2RMOA 2ZPGB 4IUPA 1YJ9A 3CCVA 1FX7A 1MMAA 3I5RA 1T0JA 4X34A 1VQLQ 1R77A 4Z89A 3SFMA 2VGMA 1ZBJA 3OS2A 1T0HA 2RI2A 4JRQA 4PJOD 5KE2A 1KJWA 5LJ5f 4M77B 4F17A 4NL2A 5CR2A 2ATCB 1XQHA 5LJ3d 1FMWA 1VQMT 1TH7A 1D1CA 1K73R 2MPXC 1VQPA 1K0XA 1EX4A 2VC8A 3HHTB 3JCMf 3H0IA 3FLGA 1KC8U 2VXEA 5GMKh 1OPLA 4KT0E 3TVTA 5GANg 1YJNT 2CUDA 3M53A 4F7UB 3HRTA 3DLMA 3VS7A 4A4KA 3AHUA 3RKXA 2QGFB 2JMCA 3DKMA 4PNOA 3PIPA 1VQLT 2PZ1A 1OYXA 1AZEA 3GLXA 3M0PA 4L5GA 4C5GA 1KQ2A 2RB6A 2OI3A 2DL4A 1C0MA 1WPYA 1YJWA 4M7DG 2QA4A 3CC7Q 4V2SA 2FRWA 4FL6A 4ELZC 3RKYA 1YJWQ 5KYWB 2RHUA 2PUOB 9ATCB 1MMNA 2I2LA 3VYGA 2X51A 1YJNA 1V29B 5GAOp 4ESRA 1U1SA 3LWIA 5HKCA 1A0NB 1ZBXA 5IHKA 1Q82C 3P8BB 4IKFA 4DEYA 4J7IA 2RK1A 1T3SA 2M0OA 4FYYB 4F04B 3IQLA 3CCEQ 1G83A 1X6BA 2DMOA 1D1AA 2F1LA 3GPLA 4CC2A 3G6EQ 3SEMA 2LQWA 1BI3A 4LUDA 4LXCA 1TUDA 1Y7XA 4JJDA 4RCBA 3J80E 4M75G 2J06A 3PVQA 2RHIA 1R0BG 2F2VA 4RCCA 4AFSC 2A28A 1I0CA 4BD3A 3L2WA 5GANd 3NTHA 4FYWB 4DOWA 3V8LA 1VQKT 4M4ZA 3CCSQ 3X26B 5IAYA 1NLOC 1N9RA 1JXMA 1PRLC 1SHGA 4QQGA 3HRSA 1EZZB 2BIVA 3OS1A 4Y92A 2JZ2A
chains in the Genus database with same CATH topology
1U3OA 2ENMA 2ROTA 4HVVA 3VS1A 1WX6A 2LCSA 5FWBA 2EGAA 1WIEA 3NGPA 2J05A 2O31A 3M0TA 4DEXA 1I1JA 2LQNA 4OMNA 1MV3A 2O9SA 1QKXA 1Y57A 2LNHB 2OJ2A 1GCQA 3NMZC 4RTZA 4OMMA 5FWCA 1AVZC 1KSWA 5IHNA 1OEBA 4AFZC 3VS3A 2JW4A 2RQUA 1QWEA 2L3PA 2DE0X 4RTXA 2OAWA 2A37A 2KGTA 3C0CA 2D0NA 3QWXX 1GRIA 1LCKA 2K6DA 3VS2A 2DVJA 1AWJA 2E5KA 4RTUA 2YUNA 5ECAA 2JM8A 1QKWA 2HDAA 2DM1A 2GQIA 2JT4A 4IIOA 1X69A 2D8HA 2IIMA 2KRNA 1M3BA 4RTWA 2G6FX 4HVUA 1KIKA 1Y0MA 2VKNA 1U06A 3EG0A 4ORZA 1AWXA 2KYBA 1NLPC 3UA7A 2GTJA 4D8KA 3U23A 3PVLA 1QCFA 1M3AA 2FEIA 3VS0A 4J9IA 1QLYA 4HXJA 1BK2A 1H3HA 2KBTA 1WFWA 1VYUA 3KFVA 4CC4B 1HJDA 3ULRB 3M0UA 1HSQA 2ESWA 1W70A 2BZXA 2EVRA 2V1RA 1AWOA 3M0QA 2CSQA 4A63B 2XMFA 4K11A 2CT4A 1J3TA 1WDXA 2RN8A 2EBPA 1SRMA 1YP5A 2EPDA 2MCNA 1IO6A 2GTOA 2AKLA 1SHFA 5GJVB 3REAB 2GGRA 2DL3A 3O5ZA 2CUBA 2KROA 2JM9A 3REBB 2JXBA 1JEGA 3QWYA 2YDLA 2DNUA 3EHRA 1UECA 1RLPC 2DL7A 2EW3A 3VS5A 2X3XD 2W10A 1UDLA 2YSQA 1WA7A 2O9VA 2O88A 4QT7A 2YUPA 4RTYA 1H92A 2HCKA 1TG0A 3TSWA 1RLQC 1OV3A 2J6OA 2DL5A 1V1CA 2M0YA 2L2PA 1TUCA 2LJ3A 1CSKA 2X3WD 1YNZA 3H41A 1GBQA 1SEMA 4AG2C 3M0SA 2C0TA 2DRKA 2QDLA 1AEYA 3TSZA 2DBKA 4WCIA 1WLPB 4J9BA 4OMPA 1S1NA 3UF4A 5GJWB 1PWTA 4LE9A 5HCKA 1UJ0A 1PNJA 1M3CA 4AFQC 1NYGA 3EGUA 2J6KA 2YUOA 2FG0A 1NG2A 2DX1A 3VRYA 1AD5A 2LP5A 2DA9A 1UHFA 1HD3A 4J9FA 4OMLA 5L23A 2DYBA 1KFZA 2NUZA 2FPEA 4GLMA 2KEAA 1Z9ZA 2KRSA 2KR3A 2AZSA 2JMAA 1GBRA 1NYFA 4F14A 2K79A 1ZUYA 2LZ6B 2B86A 2L3QA 2DF6A 4LN2A 2ED0A 2ED1A 1WI7A 4RTVA 2RQTA 4ZNXA 2J6FA 1GFCA 1YWPA 3CQTA 2LX7A 1YWOA 4IIMA 3UA6A 1GFDA 4OMOA 1OOTA 2JS2A 2CT3A 3FJ5A 1UUEA 4J9GA 2KXDA 2HEQA 3EHQA 1ARKA 2C0OA 1W6XA 2L3SA 3EG1A 1EFNA 2AZVA 3SHWA 1E6GA 2RNAA 2PTKA 1E6HA 1X43A 1YCSB 1BB9A 2NWMA 1ABQA 1X6GA 1JU5C 2EYXA 1B07A 4FSSA 4Z8AA 2KE9A 5EC7A 2EQIA 2JS0A 3PE0A 1K1ZA 3JV3A 1JQQA 3I5SA 2ECZA 2SEMA 1WXTA 2CH4A 1MUZA 2D1XA 5IXBA 4HVWA 2BZ8A 1RUWA 2CREA 2L0AA 1QWFA 2DILA 4J9CA 3LH5A 4JPBW 3THKA 4HCKA 4OMQA 1PKSA 4JZ4A 1X27A 2A08A 2ABLA 1PRMC 1B3QA 2EGCA 2K3BA 5IHIA 2M51A 1VYTA 3GBQA 1CKAA 2YUQA 2DBMA 2MIOA 4Z88A 2JTEA 4EIKA 2DJQA 4GBQA 4X1VA 1BU1A 1SRLA 4JJBA 1NM7A 2EYWA 2RPNA 4J9HA 1GL5A 2EGEA 1VYVA 4RUGA 3R6NA 3UATA 3H0FA 1JXOA 3EG2A 4CC7A 2LJ1A 1K9AA 4R0KA 4JJCA 1UJYA 1W1FA 5I22A 1G2BA 2CDTA 1ABOA 2BTTA 2V1QA 2RF0A 1PKTA 2RMOA 1ZSGA 2AK5A 2LMJA 3I5RA 1H8KA 4KRTA 2KT8A 1SSHA 1T0JA 1BBZA 5IH2A 4Z89A 1UG1A 1UHCA 1ZBJA 1T0HA 1GCQC 2HSPA 4JZ3A 2EKHA 1FYNA 2F2XA 1KJWA 1SPKA 1GCPA 2KT1A 4F17A 2K9GA 1M30A 2GNCA 2O2OA 2I0NA 1ZX6A 4LNPA 1ZUKA 4E6RA 1K0XA 4CC3A 4J9EA 1UE9A 1Z9QA 1OPKA 2EYYA 3H0IA 1OPLA 2DLPA 4D8DA 3TVTA 2RQWA 2CUDA 1M27C 2FPDA 1VA7A 3VS6A 2VVKA 3VS7A 2C0IA 2RQVA 1T3LA 1XOVA 2F2WA 2KRMA 3RBBB 1WXUA 2JMCA 2K7AA 1I07A 2PZ1A 4LUEA 1AZEA 3M0PA 5IXFA 1YN8A 1UFFA 2DL8A 2YT6A 4F16A 2J7IA 2OI3A 2DL4A 4J9DA 2SRCA 1E7OA 1ZUUA 2FPFA 2FRWA 3M0RA 1NEGA 2ROLA 1AOJA 1JO8A 1AWWA 2LJ0A 4AFUC 2MOXA 2DRMA 5I11A 1UGVA 2AKKA 4ESRA 3NPFA 1X2QA 2P4RA 2FRYA 1A0NB 5IHKA 1K0SA 1U5SA 2VWFA 1UTIA 3VS4A 3RNJA 1AZGB 2CSIA 4DEYA 2BZYA 2H8HA 2KNBB 2W0ZA 1FMKA 1T3SA 2CH4W 2A36A 2EYZA 2RQRA 1X2KA 3H0HA 3IQLA 1G83A 1NEBA 1X6BA 2DMOA 2PNIA 2FO0A 4RTTA 2HBWA 1CKBA 4CC2A 3SEMA 2LQWA 4LUDA 1TUDA 3I9QA 4JJDA 2GBQA 1WXBA 2J06A 3PVQA 3A98A 2D8JA 2F2VA 1ZLMA 1K76A 4AFSC 2A28A 1I0CA 1M8MA 1PHTA 1K4US 2KYMA 1MV0B 3VRZA 4AG1C 2K2MA 4M4ZA 3EG3A 5FW9A 1RI9A 1WYXA 2KXCA 1NLOC 1N5ZA 3ZL7C 1JXMA 1PRLC 1SHGA 4Y92A 3I35A 3NHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3O A;  2ENM A;  2ROT A;  4HVV A;  3VS1 A;  1WX6 A;  2LCS A;  5FWB A;  2EGA A;  1WIE A;  3NGP A;  2J05 A;  2O31 A;  3M0T A;  4DEX A;  1I1J A;  2LQN A;  4OMN A;  1MV3 A;  2O9S A;  1QKX A;  1Y57 A;  2LNH B;  2OJ2 A;  1GCQ A;  3NMZ C;  4RTZ A;  4OMM A;  5FWC A;  1AVZ C;  1KSW A;  5IHN A;  1OEB A;  4AFZ C;  3VS3 A;  2JW4 A;  2RQU A;  1QWE A;  2L3P A;  2DE0 X;  4RTX A;  2OAW A;  2A37 A;  2KGT A;  3C0C A;  2D0N A;  3QWX X;  1GRI A;  1LCK A;  2K6D A;  3VS2 A;  2DVJ A;  1AWJ A;  2E5K A;  4RTU A;  2YUN A;  5ECA A;  2JM8 A;  1QKW A;  2HDA A;  2DM1 A;  2GQI A;  2JT4 A;  4IIO A;  1X69 A;  2D8H A;  2IIM A;  2KRN A;  1M3B A;  4RTW A;  2G6F X;  4HVU A;  1KIK A;  1Y0M A;  2VKN A;  1U06 A;  3EG0 A;  4ORZ A;  1AWX A;  2KYB A;  1NLP C;  3UA7 A;  2GTJ A;  4D8K A;  3U23 A;  3PVL A;  1QCF A;  1M3A A;  2FEI A;  3VS0 A;  4J9I A;  1QLY A;  4HXJ A;  1BK2 A;  1H3H A;  2KBT A;  1WFW A;  1VYU A;  3KFV A;  4CC4 B;  1HJD A;  3ULR B;  3M0U A;  1HSQ A;  2ESW A;  1W70 A;  2BZX A;  2EVR A;  2V1R A;  1AWO A;  3M0Q A;  2CSQ A;  4A63 B;  2XMF A;  4K11 A;  2CT4 A;  1J3T A;  1WDX A;  2RN8 A;  2EBP A;  1SRM A;  1YP5 A;  2EPD A;  2MCN A;  1IO6 A;  2GTO A;  2AKL A;  1SHF A;  5GJV B;  3REA B;  2GGR A;  2DL3 A;  3O5Z A;  2CUB A;  2KRO A;  2JM9 A;  3REB B;  2JXB A;  1JEG A;  3QWY A;  2YDL A;  2DNU A;  3EHR A;  1UEC A;  1RLP C;  2DL7 A;  2EW3 A;  3VS5 A;  2X3X D;  2W10 A;  1UDL A;  2YSQ A;  1WA7 A;  2O9V A;  2O88 A;  4QT7 A;  2YUP A;  4RTY A;  1H92 A;  2HCK A;  1TG0 A;  3TSW A;  1RLQ C;  1OV3 A;  2J6O A;  2DL5 A;  1V1C A;  2M0Y A;  2L2P A;  1TUC A;  2LJ3 A;  1CSK A;  2X3W D;  1YNZ A;  3H41 A;  1GBQ A;  1SEM A;  4AG2 C;  3M0S A;  2C0T A;  2DRK A;  2QDL A;  1AEY A;  3TSZ A;  2DBK A;  4WCI A;  1WLP B;  4J9B A;  4OMP A;  1S1N A;  3UF4 A;  5GJW B;  1PWT A;  4LE9 A;  5HCK A;  1UJ0 A;  1PNJ A;  1M3C A;  4AFQ C;  1NYG A;  3EGU A;  2J6K A;  2YUO A;  2FG0 A;  1NG2 A;  2DX1 A;  3VRY A;  1AD5 A;  2LP5 A;  2DA9 A;  1UHF A;  1HD3 A;  4J9F A;  4OML A;  5L23 A;  2DYB A;  1KFZ A;  2NUZ A;  2FPE A;  4GLM A;  2KEA A;  1Z9Z A;  2KRS A;  2KR3 A;  2AZS A;  2JMA A;  1GBR A;  1NYF A;  4F14 A;  2K79 A;  1ZUY A;  2LZ6 B;  2B86 A;  2L3Q A;  2DF6 A;  4LN2 A;  2ED0 A;  2ED1 A;  1WI7 A;  4RTV A;  2RQT A;  4ZNX A;  2J6F A;  1GFC A;  1YWP A;  3CQT A;  2LX7 A;  1YWO A;  4IIM A;  3UA6 A;  1GFD A;  4OMO A;  1OOT A;  2JS2 A;  2CT3 A;  3FJ5 A;  1UUE A;  4J9G A;  2KXD A;  2HEQ A;  3EHQ A;  1ARK A;  2C0O A;  1W6X A;  2L3S A;  3EG1 A;  1EFN A;  2AZV A;  3SHW A;  1E6G A;  2RNA A;  2PTK A;  1E6H A;  1X43 A;  1YCS B;  1BB9 A;  2NWM A;  1ABQ A;  1X6G A;  1JU5 C;  2EYX A;  1B07 A;  4FSS A;  4Z8A A;  2KE9 A;  5EC7 A;  2EQI A;  2JS0 A;  3PE0 A;  1K1Z A;  3JV3 A;  1JQQ A;  3I5S A;  2ECZ A;  2SEM A;  1WXT A;  2CH4 A;  1MUZ A;  2D1X A;  5IXB A;  4HVW A;  2BZ8 A;  1RUW A;  2CRE A;  2L0A A;  1QWF A;  2DIL A;  4J9C A;  3LH5 A;  4JPB W;  3THK A;  4HCK A;  4OMQ A;  1PKS A;  4JZ4 A;  1X27 A;  2A08 A;  2ABL A;  1PRM C;  1B3Q A;  2EGC A;  2K3B A;  5IHI A;  2M51 A;  1VYT A;  3GBQ A;  1CKA A;  2YUQ A;  2DBM A;  2MIO A;  4Z88 A;  2JTE A;  4EIK A;  2DJQ A;  4GBQ A;  4X1V A;  1BU1 A;  1SRL A;  4JJB A;  1NM7 A;  2EYW A;  2RPN A;  4J9H A;  1GL5 A;  2EGE A;  1VYV A;  4RUG A;  3R6N A;  3UAT A;  3H0F A;  1JXO A;  3EG2 A;  4CC7 A;  2LJ1 A;  1K9A A;  4R0K A;  4JJC A;  1UJY A;  1W1F A;  5I22 A;  1G2B A;  2CDT A;  1ABO A;  2BTT A;  2V1Q A;  2RF0 A;  1PKT A;  2RMO A;  1ZSG A;  2AK5 A;  2LMJ A;  3I5R A;  1H8K A;  4KRT A;  2KT8 A;  1SSH A;  1T0J A;  1BBZ A;  5IH2 A;  4Z89 A;  1UG1 A;  1UHC A;  1ZBJ A;  1T0H A;  1GCQ C;  2HSP A;  4JZ3 A;  2EKH A;  1FYN A;  2F2X A;  1KJW A;  1SPK A;  1GCP A;  2KT1 A;  4F17 A;  2K9G A;  1M30 A;  2GNC A;  2O2O A;  2I0N A;  1ZX6 A;  4LNP A;  1ZUK A;  4E6R A;  1K0X A;  4CC3 A;  4J9E A;  1UE9 A;  1Z9Q A;  1OPK A;  2EYY A;  3H0I A;  1OPL A;  2DLP A;  4D8D A;  3TVT A;  2RQW A;  2CUD A;  1M27 C;  2FPD A;  1VA7 A;  3VS6 A;  2VVK A;  3VS7 A;  2C0I A;  2RQV A;  1T3L A;  1XOV A;  2F2W A;  2KRM A;  3RBB B;  1WXU A;  2JMC A;  2K7A A;  1I07 A;  2PZ1 A;  4LUE A;  1AZE A;  3M0P A;  5IXF A;  1YN8 A;  1UFF A;  2DL8 A;  2YT6 A;  4F16 A;  2J7I A;  2OI3 A;  2DL4 A;  4J9D A;  2SRC A;  1E7O A;  1ZUU A;  2FPF A;  2FRW A;  3M0R A;  1NEG A;  2ROL A;  1AOJ A;  1JO8 A;  1AWW A;  2LJ0 A;  4AFU C;  2MOX A;  2DRM A;  5I11 A;  1UGV A;  2AKK A;  4ESR A;  3NPF A;  1X2Q A;  2P4R A;  2FRY A;  1A0N B;  5IHK A;  1K0S A;  1U5S A;  2VWF A;  1UTI A;  3VS4 A;  3RNJ A;  1AZG B;  2CSI A;  4DEY A;  2BZY A;  2H8H A;  2KNB B;  2W0Z A;  1FMK A;  1T3S A;  2CH4 W;  2A36 A;  2EYZ A;  2RQR A;  1X2K A;  3H0H A;  3IQL A;  1G83 A;  1NEB A;  1X6B A;  2DMO A;  2PNI A;  2FO0 A;  4RTT A;  2HBW A;  1CKB A;  4CC2 A;  3SEM A;  2LQW A;  4LUD A;  1TUD A;  3I9Q A;  4JJD A;  2GBQ A;  1WXB A;  2J06 A;  3PVQ A;  3A98 A;  2D8J A;  2F2V A;  1ZLM A;  1K76 A;  4AFS C;  2A28 A;  1I0C A;  1M8M A;  1PHT A;  1K4U S;  2KYM A;  1MV0 B;  3VRZ A;  4AG1 C;  2K2M A;  4M4Z A;  3EG3 A;  5FW9 A;  1RI9 A;  1WYX A;  2KXC A;  1NLO C;  1N5Z A;  3ZL7 C;  1JXM A;  1PRL C;  1SHG A;  4Y92 A;  3I35 A;  3NHN A; 
#chains in the Genus database with same CATH topology
 5I21 A;  4OP0 A;  2ROT A;  4HVV A;  1C1A A;  3MO8 A;  1WIE A;  3MEA A;  3CC7 T;  1YJW T;  3OSS C;  1N9S A;  5CO7 A;  1G5V A;  4PK4 A;  1VQ4 A;  2GFA A;  2QEX T;  2LNH B;  3CCQ Q;  2X4W A;  4MMK A;  1GCQ A;  1Y96 A;  3NMZ C;  1IRX A;  1KSW A;  1VQ4 Q;  4AFZ C;  3VS3 A;  1Q86 U;  2DE0 X;  4RTX A;  2DD5 A;  2OAW A;  4MDX A;  3C0C A;  2D0N A;  2XK0 A;  1VQ8 Q;  1NJI U;  1VQK A;  5FRM A;  3QPH A;  2RHX A;  1VQ6 T;  2HDA A;  1BI1 A;  1VQK Q;  1W2B S;  1IRE B;  2KRN A;  1VQN Q;  1H3Z A;  3CC4 A;  2DXT A;  2E12 A;  3A8O B;  3EGD B;  3JCM d;  2HAX A;  2VKN A;  3OW2 S;  3RIR A;  2CGH A;  3WVD B;  2CP0 A;  3UA7 A;  2GTJ A;  1NJI C;  3FDR A;  4LDY A;  5A2Q E;  1Y07 A;  3CCS T;  1QVG A;  5CKD A;  1BK2 A;  4OB0 B;  1WFW A;  4QQ6 A;  2ZPE B;  3M54 A;  2JN0 A;  1OQK A;  3LLR A;  3J81 E;  1BCM A;  5GAN 7;  1PSF A;  4OMF B;  4TVR A;  1Q82 R;  2RJF A;  4OGC A;  2ESW A;  4HKE A;  1D0X A;  2PUK B;  2EVR A;  3OYC A;  4E7Z A;  2QQS A;  4J8O A;  4E7J A;  2GFU A;  3M0Q A;  2CSQ A;  1VQ5 Q;  4FM4 B;  4K11 A;  3X28 B;  1J3T A;  4M77 D;  2R5A A;  1FWZ A;  2GTO A;  4P5N A;  1JJ2 S;  1SHF A;  3JCM c;  3EFO A;  2DL3 A;  3O5Z A;  4LDW A;  3SWN A;  2CP2 A;  3TEE A;  2M02 A;  3GF5 A;  4M75 A;  1YI2 A;  4M78 B;  3QWY A;  1F1B B;  2K57 A;  1UEC A;  2PQW A;  1RLP C;  4M78 E;  1YI2 Q;  1D1B A;  4OF1 A;  3CBO A;  2O9V A;  3L2U A;  1D0Z A;  2O88 A;  4MZM A;  4C5E A;  2WSF E;  4C8Q G;  2HL5 C;  3VV0 A;  4KUL A;  2LJ3 A;  3H41 A;  1GBQ A;  2O4X B;  3PMT A;  2LQ8 A;  3M0S A;  4PJO G;  1QVG P;  3ER0 A;  4GY5 A;  3JCM g;  4BI3 A;  1S1N A;  2X4Y A;  4AT1 B;  1PWT A;  2Y90 A;  2EFI A;  2VXF A;  1VQ9 A;  5GAN 8;  3SD4 A;  1KQS A;  4C0F A;  2J6K A;  4M78 C;  2JTF A;  1RAD B;  2LP5 A;  3CPW S;  2QXF A;  2RHZ A;  5GMK e;  3GP8 A;  3ME9 A;  2CZ0 B;  4GLM A;  3I55 Q;  2DKG A;  1V76 A;  1ZUY A;  2AHJ B;  4M7D D;  3FC3 A;  2B86 A;  2L3Q A;  5HK3 A;  3QZ5 B;  4LN2 A;  3OW2 A;  3PMI A;  1D09 B;  4ZNX A;  1YWP A;  1VOM A;  3CQT A;  4IIM A;  2LC4 A;  1UGR B;  3QJY A;  4FCY A;  3OYM A;  2CP3 A;  2COZ A;  2LNV A;  5I2S A;  2KDS A;  2QG9 B;  4XTZ A;  2DK3 A;  4PLI A;  2HEQ A;  3EHQ A;  1X75 C;  3HL8 A;  1W6X A;  3EGD A;  4C92 F;  3E9G A;  2PTK A;  4PJO C;  2XHC A;  1HYO A;  4VUB A;  4BB7 A;  1BB9 A;  2DZ9 A;  1MND A;  1B07 A;  3MHX A;  2CZ6 B;  4FSS A;  3SWN B;  1K1Z A;  2JNG A;  3I5S A;  3JB9 I;  2ECZ A;  3OSV A;  3M58 A;  3CCQ T;  5A0D A;  1UEB A;  4CI0 C;  2GQV A;  4HVW A;  2BZ8 A;  2HD0 A;  3GNG A;  2L0A A;  4BAC A;  3CPW P;  1KD1 C;  3LH5 A;  1PKS A;  3CC2 A;  4M77 C;  3QZ9 B;  2WSE E;  3OYK A;  1M1G A;  1B3Q A;  1VYT A;  3GBQ A;  3PIO A;  3CCE T;  2LRQ A;  2H3J A;  3VJP A;  4C0D B;  1YJN Q;  2NYS A;  4GBQ A;  1IXD A;  4PJO B;  2X4J A;  4X1V A;  4JJB A;  1YIJ A;  3JB9 J;  1BYM A;  1K9M C;  1GL5 A;  3R6N A;  2OAU A;  3UAT A;  3CBM A;  3H0F A;  4LD6 A;  1OU8 A;  3M57 A;  5J26 A;  4CC7 A;  4R0K A;  1OU9 A;  1BIA A;  5I22 A;  2NUP B;  1EIF A;  3TU4 K;  1PKT A;  4JRK A;  2QQA A;  4KRT A;  5LJ3 h;  4FT4 A;  3G71 A;  4N4I A;  2XG8 D;  2HSP A;  4JZ3 A;  1NPR A;  1FYN A;  4BI4 A;  2IG0 A;  3MEU A;  1K9M U;  3G71 Q;  3S3M A;  1SPK A;  1GCP A;  2KT1 A;  1Q86 R;  2B8A A;  4C92 D;  1KD1 R;  3LWH A;  4C0D C;  2O01 E;  1Y71 A;  1ZUK A;  4FU6 A;  2GCX A;  3RES A;  3M56 A;  2KI7 A;  3LW5 E;  4HA8 A;  2Y4Y A;  2HL3 A;  2DLP A;  5L8R E;  4PFZ A;  3VS6 A;  2VVK A;  1O75 A;  5GAN 4;  4ZN3 A;  2RQV A;  1MGQ A;  1XOV A;  2F2W A;  3RBB B;  1M90 R;  1WXU A;  3QKJ A;  3G4S A;  2QQB A;  4LUE A;  2YLC A;  2LVM A;  5IXF A;  4JUV A;  4QKU A;  2EQM A;  2QAS A;  2J7I A;  1ZUU A;  5GAN 5;  5DM7 R;  3M0R A;  1Q95 G;  2ROL A;  1AOJ A;  2XDP A;  3PFS A;  2LJ0 A;  4M7A F;  1UGV A;  3I56 A;  1Q81 U;  3VYH B;  4C8Q A;  2VWF A;  4IUU A;  1UTI A;  3HTR A;  3CCR A;  2CSI A;  5LJ5 h;  3NFC A;  5KE3 A;  2KNB B;  3CCM T;  2CH4 W;  1Q86 C;  1VIF A;  2JOY A;  2ZGW A;  4EMH A;  3FB9 A;  5CIU A;  2BE9 B;  4QVD A;  4MML A;  1YHQ T;  4FYV B;  5FU7 C;  4M7D B;  2GBQ A;  1WXB A;  2CZ7 B;  2D8J A;  3OY9 A;  2E6N A;  4FYX B;  2VGN A;  1ZLM A;  2D0Q B;  1K76 A;  3CD6 T;  1OI1 A;  1M8M A;  2KY9 A;  5GAO m;  1M9S A;  1QCN A;  5FRO A;  1QVF P;  3VRZ A;  2NUT A;  5KCH A;  3NTI A;  1RI9 A;  2QDY B;  5A0G A;  2KXC A;  1VQ7 T;  3CME T;  3JB9 D;  3KXT A;  1R8O B;  3ZL7 C;  4M75 E;  4XK8 E;  3Q1J A;  4XU0 A;  5KYX A;  3I35 A;  4ZGE B;  3OA6 A;  1OX9 A;  4MZT A;  3NHN A;  2YRD A;  1U3O A;  3EGX B;  2XID A;  2LCS A;  2EGA A;  3HFN A;  1RAA B;  1SSF A;  3NGP A;  2J05 A;  4M75 D;  3M0T A;  4DEX A;  1WHM A;  1I1J A;  5C0M A;  2M1H A;  2LQN A;  1MV3 A;  2DZC A;  2O9S A;  3P8H A;  2ZPH B;  3QG1 A;  1W2B P;  5LJ5 j;  1N8R C;  2M9U A;  4C0Z A;  4RTZ A;  4OMM A;  2BE7 D;  5IHN A;  1OEB A;  2E3I A;  3H8Z A;  2DJZ A;  2JW4 A;  2RQU A;  4O5V A;  2L3P A;  3G6E T;  1I4K 1;  2A37 A;  1P92 A;  1GRI A;  2LT1 A;  3PNW C;  4BDZ A;  3TQ7 P;  1S72 T;  3LX7 A;  2K2V A;  4R55 A;  2RI3 A;  2QA4 T;  2E4H A;  3A8M B;  3H9N A;  3A1P A;  2M16 A;  3X20 B;  1X69 A;  1K9M R;  4PLL A;  4RTW A;  5KYX B;  4HVU A;  5GAM h;  5KH6 A;  3CME Q;  1IHW A;  2RM4 A;  4N0A C;  1U06 A;  4ORZ A;  2XDB A;  2KYB A;  2RJC A;  1IZ6 A;  2FB7 A;  1WNL A;  2FEI A;  3C95 A;  4J9I A;  3CC4 T;  3JCM W;  1VQ5 T;  3V8J A;  1H3H A;  1RAI B;  3QSU A;  2MYS A;  1X6O A;  2E1H A;  5GAN j;  3KFV A;  2YHT A;  4YTL A;  1G3S A;  1HJD A;  3ULR B;  4M7A B;  3EFS A;  4E7S A;  3E2U A;  3G7Z A;  2RN8 A;  3QYG B;  5DLO A;  2EPD A;  5KYY B;  3M59 A;  2DYI A;  1WGS A;  3AT1 B;  2GGR A;  5CAI A;  3CCV T;  2CUB A;  2KRO A;  3FIF A;  3REB B;  2BKD N;  3CD6 Q;  1IGU A;  2OTL A;  2FZK B;  4XQ3 A;  3CXC S;  5LJ3 j;  4FT2 A;  4QVC A;  4RG2 A;  4C8Q B;  2R5M A;  2OTL Q;  4M7D C;  3BDL A;  3UWN A;  2X3X D;  3MPU B;  4E7L A;  2W10 A;  1UDL A;  1YCY A;  1WQ7 A;  2YUP A;  1H92 A;  3QXE B;  2HCK A;  4M78 G;  5GAM j;  2HNI A;  4BUG A;  2DL5 A;  1V1C A;  1JRI A;  2X3W D;  2VB6 A;  4J6Y A;  2C06 A;  2QDL A;  3P8D A;  1AEY A;  1M1K U;  2QTV A;  3FEO A;  4J9B A;  4X9D A;  4M7D A;  4LE9 A;  4PJO E;  2MWO A;  3CC2 Q;  4AFQ C;  1NYG A;  2FG0 A;  3VRY A;  1BI0 A;  2PU9 B;  4NL3 A;  3FJP A;  2V26 A;  1WQW A;  1UHF A;  1HD3 A;  4J9F A;  1QMC A;  1YIJ Q;  2NUZ A;  2X9H A;  3CEY A;  2QGG A;  1VQ4 T;  4PJM A;  2KRS A;  2JMA A;  1DJ7 B;  3M55 A;  3S3N A;  3SDZ A;  1I5L A;  2ED0 A;  4C8Q E;  2ED1 A;  4ZGD B;  2XKO C;  1UGQ B;  1GFC A;  1OUL A;  1ZQ1 A;  5D6Y A;  4HT9 A;  1RL2 A;  4Y28 E;  2DEU A;  2EJF A;  4OMO A;  4X9C A;  2FL7 A;  3URG A;  2CT3 A;  3RR6 A;  1UUE A;  2KXD A;  3QDF A;  3L2R A;  3QII A;  2L3S A;  4HCC A;  5IN1 A;  8AT1 B;  2YRC A;  2P0K A;  3CC7 A;  3RER A;  1QVF A;  3A8H B;  3HSB A;  1YCS B;  2EQU A;  1ABQ A;  2CZ1 B;  2EYX A;  1VQO T;  2YWW A;  4Z8A A;  2KE9 A;  5EC7 A;  4DBF A;  3JV3 A;  3OYH A;  1QVF S;  5KYW A;  1ZA2 B;  5LJ3 f;  1WXT A;  5DLQ E;  1MUZ A;  1VQP T;  3CBP A;  1FMV A;  5GAO q;  4XU3 A;  3G1J A;  1KHI A;  4N4G A;  3RMS A;  3JCM P;  1YBY A;  2E41 A;  2CP5 A;  4J5Y A;  3EH2 A;  1NE8 A;  4J7F A;  4JZ4 A;  1PRM C;  5IHI A;  4C92 B;  4DBH A;  2M51 A;  4JS5 A;  2KVQ G;  1CKA A;  4M77 F;  2YUQ A;  3EAE A;  2JTE A;  2DJQ A;  3JCM e;  4E2F B;  3A8G B;  4M75 F;  4EMG A;  1NM7 A;  4J9H A;  4ZTF A;  1HK9 A;  1RAB B;  1M1F A;  5AT1 B;  4XAX B;  3OYG A;  2HQE A;  1JXO A;  2LCC A;  3EG2 A;  2LJ1 A;  3VKI A;  1UJY A;  3CCR Q;  1TU0 B;  4C92 G;  1G2B A;  4CRI A;  1W2B A;  1XTD A;  2CDT A;  1PSE A;  5C6S A;  1ZSG A;  2COY A;  3WVE B;  3CMA T;  4A54 A;  1H8K A;  2KT8 A;  1SSH A;  6AT1 B;  1BBZ A;  2ZPB B;  3HRU A;  1TSF A;  1UHC A;  1GCQ C;  2R58 A;  1TS9 A;  2EKH A;  2QEX Q;  5DY9 A;  1R0C B;  4PJO A;  1KG1 A;  4A53 A;  2K9G A;  2EQK A;  1M30 A;  2QEX A;  1VQO Q;  2CKK A;  2K4Y A;  2I0N A;  2RJE A;  3KUF A;  1AHJ B;  1MNE A;  2F5T X;  1IGQ A;  4LNP A;  4QQD A;  4E6R A;  4IUR A;  1KD1 U;  4MZP A;  4J9E A;  1G3W A;  1Z9Q A;  1LJO A;  1OPK A;  3LYI A;  2IPO B;  2DD4 A;  4PFP A;  4PJJ A;  2FPD A;  1VA7 A;  4IUT A;  2L5Q A;  1T3L A;  3KBG A;  2K3Y A;  3CCU Q;  3MEV A;  1I07 A;  5GMK j;  4FSX A;  4OB3 B;  3HP9 A;  1Q82 U;  1YN8 A;  1UFF A;  2DL8 A;  2DVE A;  4F16 A;  3OYD A;  3MP8 A;  1I81 A;  3OW2 P;  1E7O A;  2FPF A;  4JRP A;  2L8D A;  5LJ3 e;  1ZSZ B;  1NEG A;  2IVW A;  1AWW A;  1TWB A;  2JTM A;  3PTA A;  4AFU C;  1PG5 B;  2DRM A;  2AKK A;  3RKW A;  1X2Q A;  4IUV A;  3OBY A;  4PKC C;  2FYK A;  4BI8 B;  1K0S A;  2Y4X A;  1WHL A;  5KYU B;  1M4Z A;  4MDW A;  3S3O A;  4M77 E;  3EFO B;  3BDU A;  2BZY A;  1FMK A;  1C6V X;  3F70 A;  2FZC B;  2A36 A;  1WJS A;  2EYZ A;  1X2K A;  1W4S A;  3H0H A;  1NJI R;  2P0Q A;  4M7A G;  1UB4 A;  4PL6 A;  2P84 A;  2FO0 A;  2X4X A;  1CKB A;  2D9T A;  2MK5 A;  1ZHI A;  3ZBD A;  3I9Q A;  4M78 D;  4F7U E;  3M4G A;  1GXI E;  2XU8 A;  2CS7 A;  4XTX A;  4C5H A;  1MV0 B;  2OTL T;  4AG1 C;  2K2M A;  4KGV B;  3EG3 A;  5FW9 A;  1WYX A;  3CCJ Q;  1SKU B;  2FZG B;  4KUD K;  1YJ9 Q;  1NZ9 A;  4ANJ A;  4EMK B;  4O6J A;  2A7Y A;  3ZEH A;  2E6Z A;  1PM3 A;  1QP2 A;  4C0G A;  2HSE B;  3BE3 A;  4J6W A;  4KH0 B;  4M78 A;  3MJX A;  2RA2 A;  2RO0 A;  5HK0 A;  4LDX A;  3JB9 G;  1K8A U;  1KQ1 A;  4LD9 K;  3WXM B;  2DO3 A;  5FWC A;  4M77 G;  1AVZ C;  4PJL A;  5GAN 2;  1VQP Q;  2PVD B;  1QWE A;  4WTO B;  4N0A A;  1Y96 B;  3BFM A;  4M7A D;  3I55 A;  3T9N A;  4XU2 A;  4XTV A;  1LCK A;  2K6D A;  1WJQ A;  2F5K A;  2DVJ A;  2E5K A;  4NOY A;  2YUN A;  5ECA A;  3L1A A;  2K5L A;  3C12 A;  4M7A E;  4IIO A;  2D8H A;  2IIM A;  1TTH B;  2LTO A;  1S72 A;  4BE1 A;  2EYQ A;  2G6F X;  1JBM A;  3EH1 A;  2L89 A;  2K3X A;  2DAQ A;  2XI9 A;  3EG0 A;  4DBR A;  3GNF B;  3HFO A;  1WHJ A;  2A0F B;  3U23 A;  2VYT A;  2MF2 A;  1M3A A;  3VS0 A;  1B7T A;  1ZSZ A;  4DBQ A;  4OB1 B;  3O8V A;  2KQW A;  1QLY A;  4RKU E;  1TXQ A;  4HXJ A;  1VQ9 T;  2KBT A;  3RMQ A;  3JCM b;  1M1K C;  3CD6 A;  4QVZ A;  4JRI A;  3QBY A;  3OS5 A;  1NBE B;  1PCX A;  1HSQ A;  2EKO A;  3R6O A;  3QDR B;  2V1R A;  1JB0 E;  1AWO A;  2WAC A;  4ZN1 A;  3I55 T;  2COW A;  2HKN A;  4DOV A;  4A4F A;  2MCN A;  3TRE A;  3DB4 A;  3OYN A;  3S6W A;  2AKL A;  3CCE A;  4D6W A;  1VQN T;  2KK4 A;  3EG9 A;  1OX8 A;  2MI6 A;  2JM9 A;  1N8R R;  3LGL A;  1BCO A;  1JEG A;  1K73 U;  2HKQ B;  5GAN 6;  4KBM B;  2YDL A;  4PJO F;  4EDU A;  3EHR A;  2D6F A;  2DL7 A;  2EW3 A;  2RD1 A;  4UC4 A;  3MEW A;  5LJ5 e;  2YSQ A;  1WA7 A;  4QT7 A;  3OQ5 A;  1TG0 A;  1RLQ C;  2J6O A;  2L2P A;  2M0Y A;  1TUC A;  4Y91 A;  3CCL A;  1CSK A;  3CMA Q;  4AG2 C;  1K73 C;  2MAM A;  2C0T A;  2DRK A;  3TSZ A;  4EMK C;  2QK0 A;  4ELY C;  3UF4 A;  3CCR T;  4OB2 B;  5GJW B;  4BDY A;  2R57 A;  4FW2 A;  4F7U A;  1WHG A;  5CCA A;  2YRV A;  3I56 T;  2YUO A;  1H64 1;  2QYZ A;  3M5A A;  2NLU A;  1AD5 A;  1ACM B;  3EG9 B;  5CQY A;  2DA9 A;  4C92 A;  5L23 A;  2E3H A;  2DYB A;  1KFZ A;  1VQ8 A;  1K8A R;  3PGG A;  1M2V B;  2KR3 A;  2AZS A;  4II1 A;  1NYF A;  2RI5 A;  3UPU A;  2E70 A;  3CPW A;  5GMK i;  2K79 A;  2LZ6 B;  3HKS A;  1VIE A;  3FRN A;  1O9S A;  2LX7 A;  2P0P A;  1YWO A;  5D6X A;  1ZA1 B;  2JUF A;  5FU6 B;  1OOT A;  5GAM d;  2ZPF B;  4L59 A;  3MET A;  5KYN A;  3QO3 A;  1ZSZ C;  2DFU A;  1VQ6 A;  1EFN A;  1MMD A;  1VQM A;  2QTX A;  4BE2 A;  1X43 A;  2KSS A;  1Q7Y R;  4HCB A;  2DXU A;  2NWM A;  3OYL A;  3I56 Q;  3L42 A;  1JU5 C;  3X25 B;  2EQI A;  2JS0 A;  3PE0 A;  3SB2 A;  3OMC A;  3JB9 H;  1JQQ A;  2CYZ B;  3G71 T;  3J7A F;  2CH4 A;  4XTU A;  3CCU A;  5IXB A;  3UDC A;  1RAG B;  3QJ6 A;  1RUW A;  2CRE A;  5FU6 C;  2E65 A;  1YI2 T;  2EJ9 A;  2ZPI B;  4J9C A;  5HY6 A;  4JPB W;  2YXY A;  1D3B B;  5FU7 B;  4OMQ A;  5CKE A;  2A08 A;  4KGZ B;  2ABL A;  4HT8 A;  4RG8 A;  2HBP A;  5GAO n;  1FXX A;  4C8Q C;  2DBM A;  3ASK A;  4QW2 A;  2LDM A;  2JVV A;  2MIO A;  4Z88 A;  4EIK A;  2RHY A;  1B34 A;  3OYF A;  3PT9 A;  3L2V A;  1BU1 A;  2EYW A;  2E64 A;  2RPN A;  5GAN h;  3CCJ T;  4JDS A;  1QVG S;  4RUG A;  4M75 C;  4M7A A;  3V7S A;  4KGX B;  4JJC A;  1W1F A;  2DIG A;  4WF2 A;  3OYA A;  4RMO A;  2BTT A;  2V1Q A;  3X24 B;  2AK5 A;  2LMJ A;  1VQ9 Q;  4C92 E;  5IH2 A;  1UG1 A;  2F2X A;  5GMK m;  4ZTJ A;  1PD1 A;  1MHN A;  1BKB A;  3VUB A;  1IB8 A;  3GIB A;  7AT1 B;  3HPW A;  2GNC A;  2O2O A;  2XIC A;  1JJ2 A;  1ZX6 A;  3EFR A;  2E5Q A;  1LNX A;  1X01 A;  4L6V 5;  4CC3 A;  1M5Q 1;  1UE9 A;  3CCL T;  4B9X A;  1UGP B;  4Z02 A;  2EYY A;  5KYU A;  2RJD A;  4D8D A;  1RI0 A;  1WHK A;  2RQW A;  5CQX A;  4M7D E;  1M27 C;  2BUD A;  5LJ3 g;  2C0I A;  3BY7 A;  3L2Q A;  1SG5 A;  4J83 A;  2ZAE A;  2KRM A;  4EMK A;  4KUI A;  1Q81 C;  2DTI A;  2K7A A;  5CVI A;  2AT1 B;  4XTW A;  3LGF A;  2RH2 A;  3OBW A;  2YT6 A;  4J9D A;  2SRC A;  3JB9 F;  2EQJ A;  4A4H A;  1JO8 A;  1PD0 A;  2MWP A;  2Z0W A;  2MOX A;  2WSC E;  5I11 A;  1YJ9 T;  2F69 A;  3NPF A;  2P4R A;  3QUI A;  2FRY A;  2VUB A;  1VQ7 A;  5EG2 A;  3JSC A;  5FLX E;  2OTJ Q;  1AT1 B;  1B34 B;  1U5S A;  4E47 A;  2VAS A;  3VS4 A;  3RNJ A;  1AZG B;  3VU3 C;  1VUB A;  2OTJ A;  1TOV A;  2H8H A;  2LX9 A;  2W0Z A;  1S72 Q;  2ZCF B;  2QA4 Q;  3D7S B;  4JLG A;  1M90 U;  1NPP A;  3CCJ A;  2RQR A;  3CCV Q;  2NUT B;  2PVG B;  1RAE B;  1KC8 C;  1NEB A;  3OS0 A;  4R56 A;  2PNI A;  4RTT A;  2HBW A;  4B9W A;  1XNI A;  3OYI A;  4JJN K;  1IHV A;  5I2M A;  1MMG A;  4C5I A;  2CP6 A;  5CK9 A;  3V7C A;  3A98 A;  1G3T A;  1HXD A;  3LH0 A;  2GF7 A;  2ZZD A;  1PHT A;  1K4U S;  2KYM A;  4HCZ A;  1M2V A;  1M90 C;  2DXC A;  1WHH A;  5J39 A;  4M75 B;  3CXC A;  2EIF A;  1QVP A;  1N8R U;  1LOJ A;  1N5Z A;  2G3R A;  4KH1 B;  2K5I A;  4OGE A;  3A8L B;  3G6E A;  2DXB A;  4DA4 A;  2ENM A;  4XTY A;  3CCM Q;  3RDV A;  3VS1 A;  1WX6 A;  4B6M A;  1N27 A;  5FWB A;  1QP3 A;  2OTJ T;  4Q5W A;  2O31 A;  3CCM A;  3QYH B;  4FIB A;  2FHD A;  4LDV A;  2MMP A;  4OMN A;  2XD0 A;  2LCL A;  1VQ8 T;  4M7D F;  1WZO A;  3OMG A;  3MP1 A;  1QKX A;  1Y57 A;  2OJ2 A;  3CCS A;  2V8I A;  4PFO A;  1UGS B;  3CXC P;  2XDD A;  2HQH A;  1I5O B;  1KK7 A;  1WJR A;  2KGT A;  4BY6 C;  3QWX X;  4M7A C;  5FRN A;  1TUG B;  4A4E A;  3CCL Q;  5GAM f;  4PJN A;  3VS2 A;  1LPL A;  1AWJ A;  4C8Q D;  4RTU A;  1KQS S;  2DPP B;  5AYF A;  2JM8 A;  3V8K A;  1QKW A;  3NTK A;  3M9Q A;  2DM1 A;  2GQI A;  2JT4 A;  3G4S Q;  4F7U F;  2DTO A;  3INZ A;  1M3B A;  3GOX A;  3UT1 A;  3E9F A;  3RUX A;  1BIB A;  2CP7 A;  1KIK A;  1Y0M A;  2P4T A;  3JCM X;  1AWX A;  1NLP C;  2V8J A;  1KC8 R;  1G3Y A;  5CKH A;  4D8K A;  3PVL A;  1QCF A;  5GMK l;  4E7K A;  2NUP A;  3QHS A;  1VYU A;  3CPF A;  2H3E B;  5M9O A;  4AMC A;  2QQR A;  4XU1 A;  4CC4 B;  3M0U A;  1D0Y A;  2KAF A;  1W70 A;  2BZX A;  4DQ2 A;  1K8A C;  1VQN A;  1M8V A;  4A63 B;  2XMF A;  2CT4 A;  1WDX A;  2EBP A;  1SRM A;  4BE0 A;  1YP5 A;  5IT9 E;  3H6Z A;  2EWN A;  5J3B A;  1IO6 A;  3L2Z A;  1RAH B;  2K5F A;  1QQJ A;  3OYJ A;  1Q7Y C;  5GJV B;  2DER A;  3REA B;  5CKF A;  3CMA A;  2EJG A;  2VV5 A;  2JXB A;  1QW1 A;  3C4S A;  4IUQ A;  1M2O A;  2DNU A;  1VQM Q;  3OB9 A;  1BI2 A;  3E1S A;  3CCQ A;  1Q81 R;  3VUZ A;  1G8X A;  3VS5 A;  5GAM e;  4OVA A;  4N4H A;  1VQ5 A;  2LT4 A;  4ZGJ B;  2HZY A;  5D7U A;  4EPC A;  1YHQ A;  4RTY A;  3DLL A;  1RAC B;  2RK2 A;  3TSW A;  1Q7Y U;  1OV3 A;  1YHQ Q;  1RAF B;  1YNZ A;  1SEM A;  4ME7 A;  3JCM h;  2DBK A;  4WCI A;  4F7U G;  1WLP B;  3N5B B;  4OMP A;  2JJ9 A;  3JRZ A;  5HCK A;  1UJ0 A;  1PNJ A;  2L3R A;  5KYY A;  4LDU A;  1PC0 A;  2AIR B;  3C94 A;  3OYE A;  3CC4 Q;  1M3C A;  4M78 F;  3EGU A;  3JAM E;  1YIT T;  1KQS P;  1NG2 A;  2DX1 A;  4M77 A;  3MCA B;  1YIT Q;  5GAO r;  3MP6 A;  5LJ5 g;  1U8R A;  1LVK A;  1YIT A;  4OML A;  3MKD A;  1VQO A;  2FPE A;  5KCO A;  4JS4 A;  2KEA A;  1KHC A;  1Z9Z A;  5GAM g;  2OX7 A;  3JCM Q;  2HQX A;  4BY6 B;  1GBR A;  1VQ6 Q;  3A5Z B;  1OZ3 A;  2YLB A;  4F14 A;  4A4G A;  4FW1 A;  2KMT A;  2DF6 A;  2QAZ A;  5GAN f;  1WI7 A;  4RTV A;  2RQT A;  2J6F A;  5LL6 S;  3UA6 A;  1SF9 A;  1GFD A;  2JS2 A;  2V8K A;  3CME A;  4NS5 A;  4E7I A;  3CC2 T;  3FJ5 A;  3ZFJ A;  4ATO A;  2QI2 A;  2DIQ A;  4J9G A;  1ARK A;  3M4Y A;  2C0O A;  1N6A A;  4C92 C;  3EG1 A;  2AZV A;  3SHW A;  5GAO l;  3OYB A;  1E6G A;  2RNA A;  2PVO B;  3E19 A;  3OYY A;  3G4S T;  2E10 A;  1E6H A;  4J6X A;  4JLI A;  1X6G A;  3JCM V;  2HMA A;  2QQ9 A;  1D3B A;  5CKB A;  1U1T A;  2SEM A;  2D1X A;  2LQK A;  5GAN e;  2EAY A;  5GAN 3;  2DET A;  3EGX A;  5A0L A;  1QWF A;  5D6W A;  3V7R A;  3TCJ A;  1M1K R;  2DIL A;  5LJ5 d;  2DEQ A;  2DTH A;  4HCK A;  3THK A;  1YIJ T;  3CCU T;  1X27 A;  2EGC A;  2K3B A;  1I8F A;  1OZ2 A;  2A3L A;  3JCM J;  4C8Q F;  1SRL A;  1VQ7 Q;  2EGE A;  1YFN A;  1VYV A;  1XJW B;  4E7H A;  3SWN C;  1K9A A;  1QCO A;  4GLK A;  1JJ2 P;  3BW1 A;  1ABO A;  2O4X A;  8ATC B;  2FVU A;  1VQL A;  2RF0 A;  3DB3 A;  2X35 A;  2RMO A;  2ZPG B;  4IUP A;  1YJ9 A;  3CCV A;  1FX7 A;  1MMA A;  3I5R A;  1T0J A;  4X34 A;  1VQL Q;  1R77 A;  4Z89 A;  3SFM A;  2VGM A;  1ZBJ A;  3OS2 A;  1T0H A;  2RI2 A;  4JRQ A;  4PJO D;  5KE2 A;  1KJW A;  5LJ5 f;  4M77 B;  4F17 A;  4NL2 A;  5CR2 A;  2ATC B;  1XQH A;  5LJ3 d;  1FMW A;  1VQM T;  1TH7 A;  1D1C A;  1K73 R;  2MPX C;  1VQP A;  1K0X A;  1EX4 A;  2VC8 A;  3HHT B;  3JCM f;  3H0I A;  3FLG A;  1KC8 U;  2VXE A;  5GMK h;  1OPL A;  4KT0 E;  3TVT A;  5GAN g;  1YJN T;  2CUD A;  3M53 A;  4F7U B;  3HRT A;  3DLM A;  3VS7 A;  4A4K A;  3AHU A;  3RKX A;  2QGF B;  2JMC A;  3DKM A;  4PNO A;  3PIP A;  1VQL T;  2PZ1 A;  1OYX A;  1AZE A;  3GLX A;  3M0P A;  4L5G A;  4C5G A;  1KQ2 A;  2RB6 A;  2OI3 A;  2DL4 A;  1C0M A;  1WPY A;  1YJW A;  4M7D G;  2QA4 A;  3CC7 Q;  4V2S A;  2FRW A;  4FL6 A;  4ELZ C;  3RKY A;  1YJW Q;  5KYW B;  2RHU A;  2PUO B;  9ATC B;  1MMN A;  2I2L A;  3VYG A;  2X51 A;  1YJN A;  1V29 B;  5GAO p;  4ESR A;  1U1S A;  3LWI A;  5HKC A;  1A0N B;  1ZBX A;  5IHK A;  1Q82 C;  3P8B B;  4IKF A;  4DEY A;  4J7I A;  2RK1 A;  1T3S A;  2M0O A;  4FYY B;  4F04 B;  3IQL A;  3CCE Q;  1G83 A;  1X6B A;  2DMO A;  1D1A A;  2F1L A;  3GPL A;  4CC2 A;  3G6E Q;  3SEM A;  2LQW A;  1BI3 A;  4LUD A;  4LXC A;  1TUD A;  1Y7X A;  4JJD A;  4RCB A;  3J80 E;  4M75 G;  2J06 A;  3PVQ A;  2RHI A;  1R0B G;  2F2V A;  4RCC A;  4AFS C;  2A28 A;  1I0C A;  4BD3 A;  3L2W A;  5GAN d;  3NTH A;  4FYW B;  4DOW A;  3V8L A;  1VQK T;  4M4Z A;  3CCS Q;  3X26 B;  5IAY A;  1NLO C;  1N9R A;  1JXM A;  1PRL C;  1SHG A;  4QQG A;  3HRS A;  1EZZ B;  2BIV A;  3OS1 A;  4Y92 A;  2JZ2 A; 
#chains in the Genus database with same CATH homology
 1U3O A;  2ENM A;  2ROT A;  4HVV A;  3VS1 A;  1WX6 A;  2LCS A;  5FWB A;  2EGA A;  1WIE A;  3NGP A;  2J05 A;  2O31 A;  3M0T A;  4DEX A;  1I1J A;  2LQN A;  4OMN A;  1MV3 A;  2O9S A;  1QKX A;  1Y57 A;  2LNH B;  2OJ2 A;  1GCQ A;  3NMZ C;  4RTZ A;  4OMM A;  5FWC A;  1AVZ C;  1KSW A;  5IHN A;  1OEB A;  4AFZ C;  3VS3 A;  2JW4 A;  2RQU A;  1QWE A;  2L3P A;  2DE0 X;  4RTX A;  2OAW A;  2A37 A;  2KGT A;  3C0C A;  2D0N A;  3QWX X;  1GRI A;  1LCK A;  2K6D A;  3VS2 A;  2DVJ A;  1AWJ A;  2E5K A;  4RTU A;  2YUN A;  5ECA A;  2JM8 A;  1QKW A;  2HDA A;  2DM1 A;  2GQI A;  2JT4 A;  4IIO A;  1X69 A;  2D8H A;  2IIM A;  2KRN A;  1M3B A;  4RTW A;  2G6F X;  4HVU A;  1KIK A;  1Y0M A;  2VKN A;  1U06 A;  3EG0 A;  4ORZ A;  1AWX A;  2KYB A;  1NLP C;  3UA7 A;  2GTJ A;  4D8K A;  3U23 A;  3PVL A;  1QCF A;  1M3A A;  2FEI A;  3VS0 A;  4J9I A;  1QLY A;  4HXJ A;  1BK2 A;  1H3H A;  2KBT A;  1WFW A;  1VYU A;  3KFV A;  4CC4 B;  1HJD A;  3ULR B;  3M0U A;  1HSQ A;  2ESW A;  1W70 A;  2BZX A;  2EVR A;  2V1R A;  1AWO A;  3M0Q A;  2CSQ A;  4A63 B;  2XMF A;  4K11 A;  2CT4 A;  1J3T A;  1WDX A;  2RN8 A;  2EBP A;  1SRM A;  1YP5 A;  2EPD A;  2MCN A;  1IO6 A;  2GTO A;  2AKL A;  1SHF A;  5GJV B;  3REA B;  2GGR A;  2DL3 A;  3O5Z A;  2CUB A;  2KRO A;  2JM9 A;  3REB B;  2JXB A;  1JEG A;  3QWY A;  2YDL A;  2DNU A;  3EHR A;  1UEC A;  1RLP C;  2DL7 A;  2EW3 A;  3VS5 A;  2X3X D;  2W10 A;  1UDL A;  2YSQ A;  1WA7 A;  2O9V A;  2O88 A;  4QT7 A;  2YUP A;  4RTY A;  1H92 A;  2HCK A;  1TG0 A;  3TSW A;  1RLQ C;  1OV3 A;  2J6O A;  2DL5 A;  1V1C A;  2M0Y A;  2L2P A;  1TUC A;  2LJ3 A;  1CSK A;  2X3W D;  1YNZ A;  3H41 A;  1GBQ A;  1SEM A;  4AG2 C;  3M0S A;  2C0T A;  2DRK A;  2QDL A;  1AEY A;  3TSZ A;  2DBK A;  4WCI A;  1WLP B;  4J9B A;  4OMP A;  1S1N A;  3UF4 A;  5GJW B;  1PWT A;  4LE9 A;  5HCK A;  1UJ0 A;  1PNJ A;  1M3C A;  4AFQ C;  1NYG A;  3EGU A;  2J6K A;  2YUO A;  2FG0 A;  1NG2 A;  2DX1 A;  3VRY A;  1AD5 A;  2LP5 A;  2DA9 A;  1UHF A;  1HD3 A;  4J9F A;  4OML A;  5L23 A;  2DYB A;  1KFZ A;  2NUZ A;  2FPE A;  4GLM A;  2KEA A;  1Z9Z A;  2KRS A;  2KR3 A;  2AZS A;  2JMA A;  1GBR A;  1NYF A;  4F14 A;  2K79 A;  1ZUY A;  2LZ6 B;  2B86 A;  2L3Q A;  2DF6 A;  4LN2 A;  2ED0 A;  2ED1 A;  1WI7 A;  4RTV A;  2RQT A;  4ZNX A;  2J6F A;  1GFC A;  1YWP A;  3CQT A;  2LX7 A;  1YWO A;  4IIM A;  3UA6 A;  1GFD A;  4OMO A;  1OOT A;  2JS2 A;  2CT3 A;  3FJ5 A;  1UUE A;  4J9G A;  2KXD A;  2HEQ A;  3EHQ A;  1ARK A;  2C0O A;  1W6X A;  2L3S A;  3EG1 A;  1EFN A;  2AZV A;  3SHW A;  1E6G A;  2RNA A;  2PTK A;  1E6H A;  1X43 A;  1YCS B;  1BB9 A;  2NWM A;  1ABQ A;  1X6G A;  1JU5 C;  2EYX A;  1B07 A;  4FSS A;  4Z8A A;  2KE9 A;  5EC7 A;  2EQI A;  2JS0 A;  3PE0 A;  1K1Z A;  3JV3 A;  1JQQ A;  3I5S A;  2ECZ A;  2SEM A;  1WXT A;  2CH4 A;  1MUZ A;  2D1X A;  5IXB A;  4HVW A;  2BZ8 A;  1RUW A;  2CRE A;  2L0A A;  1QWF A;  2DIL A;  4J9C A;  3LH5 A;  4JPB W;  3THK A;  4HCK A;  4OMQ A;  1PKS A;  4JZ4 A;  1X27 A;  2A08 A;  2ABL A;  1PRM C;  1B3Q A;  2EGC A;  2K3B A;  5IHI A;  2M51 A;  1VYT A;  3GBQ A;  1CKA A;  2YUQ A;  2DBM A;  2MIO A;  4Z88 A;  2JTE A;  4EIK A;  2DJQ A;  4GBQ A;  4X1V A;  1BU1 A;  1SRL A;  4JJB A;  1NM7 A;  2EYW A;  2RPN A;  4J9H A;  1GL5 A;  2EGE A;  1VYV A;  4RUG A;  3R6N A;  3UAT A;  3H0F A;  1JXO A;  3EG2 A;  4CC7 A;  2LJ1 A;  1K9A A;  4R0K A;  4JJC A;  1UJY A;  1W1F A;  5I22 A;  1G2B A;  2CDT A;  1ABO A;  2BTT A;  2V1Q A;  2RF0 A;  1PKT A;  2RMO A;  1ZSG A;  2AK5 A;  2LMJ A;  3I5R A;  1H8K A;  4KRT A;  2KT8 A;  1SSH A;  1T0J A;  1BBZ A;  5IH2 A;  4Z89 A;  1UG1 A;  1UHC A;  1ZBJ A;  1T0H A;  1GCQ C;  2HSP A;  4JZ3 A;  2EKH A;  1FYN A;  2F2X A;  1KJW A;  1SPK A;  1GCP A;  2KT1 A;  4F17 A;  2K9G A;  1M30 A;  2GNC A;  2O2O A;  2I0N A;  1ZX6 A;  4LNP A;  1ZUK A;  4E6R A;  1K0X A;  4CC3 A;  4J9E A;  1UE9 A;  1Z9Q A;  1OPK A;  2EYY A;  3H0I A;  1OPL A;  2DLP A;  4D8D A;  3TVT A;  2RQW A;  2CUD A;  1M27 C;  2FPD A;  1VA7 A;  3VS6 A;  2VVK A;  3VS7 A;  2C0I A;  2RQV A;  1T3L A;  1XOV A;  2F2W A;  2KRM A;  3RBB B;  1WXU A;  2JMC A;  2K7A A;  1I07 A;  2PZ1 A;  4LUE A;  1AZE A;  3M0P A;  5IXF A;  1YN8 A;  1UFF A;  2DL8 A;  2YT6 A;  4F16 A;  2J7I A;  2OI3 A;  2DL4 A;  4J9D A;  2SRC A;  1E7O A;  1ZUU A;  2FPF A;  2FRW A;  3M0R A;  1NEG A;  2ROL A;  1AOJ A;  1JO8 A;  1AWW A;  2LJ0 A;  4AFU C;  2MOX A;  2DRM A;  5I11 A;  1UGV A;  2AKK A;  4ESR A;  3NPF A;  1X2Q A;  2P4R A;  2FRY A;  1A0N B;  5IHK A;  1K0S A;  1U5S A;  2VWF A;  1UTI A;  3VS4 A;  3RNJ A;  1AZG B;  2CSI A;  4DEY A;  2BZY A;  2H8H A;  2KNB B;  2W0Z A;  1FMK A;  1T3S A;  2CH4 W;  2A36 A;  2EYZ A;  2RQR A;  1X2K A;  3H0H A;  3IQL A;  1G83 A;  1NEB A;  1X6B A;  2DMO A;  2PNI A;  2FO0 A;  4RTT A;  2HBW A;  1CKB A;  4CC2 A;  3SEM A;  2LQW A;  4LUD A;  1TUD A;  3I9Q A;  4JJD A;  2GBQ A;  1WXB A;  2J06 A;  3PVQ A;  3A98 A;  2D8J A;  2F2V A;  1ZLM A;  1K76 A;  4AFS C;  2A28 A;  1I0C A;  1M8M A;  1PHT A;  1K4U S;  2KYM A;  1MV0 B;  3VRZ A;  4AG1 C;  2K2M A;  4M4Z A;  3EG3 A;  5FW9 A;  1RI9 A;  1WYX A;  2KXC A;  1NLO C;  1N5Z A;  3ZL7 C;  1JXM A;  1PRL C;  1SHG A;  4Y92 A;  3I35 A;  3NHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...