1BK2A

A-spectrin sh3 domain d48g mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
b'KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A-SPECTRIN
publication title Obligatory steps in protein folding and the conformational diversity of the transition state.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Sh3-domain
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1bk2A00
2FRYA 1UHCA 2E5KA 1QWFA 1X43A 2H8HA 2JMCA 4D8KA 1BK2A 1RLQC 1I0CA 4HVVA 2RMOA 1GBQA 1U5SA 2ABLA 1U3OA 2EQIA 1QKXA 2ED0A 4RTZA 1NYGA 1J3TA 2RPNA 3M0QA 1GFCA 1CKBA 2KEAA 3REBB 3KFVA 4KRTA 1NEBA 3JV3A 2EW3A 1JO8A 1PHTA 1AZGB 1GBRA 1QKWA 4ESRA 3IQLA 4K11A 2DJQA 5I11A 1AD5A 4OMMA 1H3HA 1QLYA 3EG0A 2RN8A 2EYXA 2DLPA 5FWCA 4JJDA 2A36A 1K76A 2J6KA 2YUQA 3NGPA 1X2QA 1WXUA 1NLPC 4JPBW 2F2VA 5HCKA 2KYMA 1H8KA 2B86A 2EKHA 2VKNA 2YUNA 4E6RA 1OOTA 2L3PA 4LN2A 2DL8A 4CC4B 4DEXA 4F16A 4CC7A 4Z8AA 2DMOA 2PZ1A 4J9CA 1YWOA 2RQWA 3I9QA 2KYBA 2GTOA 1GFDA 1UUEA 3TSZA 1W6XA 2CT3A 1HJDA 2KR3A 2W10A 3QWXX 4GLMA 1U06A 2JS2A 4HXJA 2AK5A 2AZSA 4AFZC 4AFSC 2KGTA 4QT7A 1I07A 2HDAA 2VWFA 1S1NA 4OMNA 4OMQA 1YN8A 1PKTA 1UJYA 2LQWA 2DF6A 1OPLA 2CDTA 5IHNA 1A0NB 2ESWA 3M0SA 2FEIA 1X6GA 2HEQA 2JT4A 2A37A 2YUOA 2LJ3A 1YWPA 2JTEA 1VA7A 2DL7A 2EYWA 2ROLA 2C0TA 3M0TA 3A98A 4J9FA 2ECZA 2JW4A 1WDXA 3EHRA 1NYFA 3H0HA 2D1XA 4OMOA 1AWXA 1ZUUA 1QWEA 2D0NA 1T3SA 1E6HA 4HVUA 2EVRA 2KXDA 1M27C 1BB9A 3VS2A 4IIMA 1GCPA 4F14A 2K79A 1PRMC 3H41A 2L2PA 1M8MA 2LNHB 2OJ2A 5I22A 3QWYA 1M3CA 2BTTA 1H92A 1QCFA 2FG0A 4RTWA 1M3BA 5GJVB 4CC2A 1V1CA 1AWJA 4OMLA 5IH2A 1E6GA 1YNZA 3UF4A 3THKA 3UA6A 2CH4W 2DVJA 1KIKA 3VS0A 2M0YA 4OMPA 1UHFA 1VYTA 1WXBA 1JQQA 2FPEA 2KRSA 3M0PA 1UDLA 1SEMA 4RTVA 1KFZA 1ZX6A 4RTUA 2EGCA 1AWWA 2J7IA 2DBMA 2NUZA 2RQRA 2J6FA 2MOXA 1AVZC 3VS4A 2RNAA 1SPKA 1IO6A 3EGUA 4DEYA 2LQNA 2SEMA 2RF0A 3VS7A 2FPDA 3NMZC 2KRMA 3UA7A 1PRLC 2CSIA 2CSQA 2GNCA 1Y0MA 1GRIA 2CH4A 2QDLA 4Y92A 2KT8A 1BBZA 4ZNXA 3RBBB 2CUDA 4HCKA 3VS5A 1CSKA 3SEMA 2DE0X 1TUDA 5ECAA 1RLPC 1K9AA 3CQTA 4J9DA 1Z9ZA 1X27A 1NEGA 1ZLMA 2JS0A 3R6NA 1X69A 4RTXA 2ROTA 1G2BA 2DNUA 2CREA 4LUDA 2RQTA 1K0SA 2BZ8A 3REAB 1WA7A 3PE0A 2JMAA 3VS1A 1FYNA 2VVKA 1UG1A 2EYZA 4LNPA 4J9IA 2HCKA 1ZUKA 4LUEA 1WFWA 2DRKA 1K0XA 3RNJA 3I5RA 3NPFA 2GBQA 1E7OA 1YP5A 1W70A 2DRMA 3O5ZA 2O9VA 2RQUA 3ZL7C 4ORZA 1UJ0A 4AFUC 1MUZA 2O31A 5GJWB 2KNBB 3NHNA 1HD3A 2AZVA 1JXOA 2BZXA 3PVLA 2JM8A 1AEYA 4FSSA 1RI9A 5L23A 1GCQC 2DBKA 3M0RA 2FPFA 3EHQA 1VYVA 2K3BA 4AG1C 1LCKA 4J9GA 1HSQA 2K2MA 4R0KA 4F17A 1I1JA 4RUGA 3C0CA 2LJ0A 3TSWA 4AFQC 4IIOA 4Z88A 4M4ZA 1SRLA 4RTYA 1ABQA 2LZ6B 4A63B 2KXCA 2G6FX 2K9GA 2YSQA 5IHIA 4GBQA 1UE9A 1ZSGA 2EGAA 3I5SA 2F2XA 2OAWA 1ARKA 1WXTA 4D8DA 1Y57A 1X2KA 2A28A 2LMJA 1CKAA 2CT4A 2M51A 4JZ4A 3TVTA 1WX6A 1X6BA 1PKSA 1GL5A 2AKLA 2FO0A 3UATA 2YUPA 2DM1A 2NWMA 2MCNA 3M0UA 4JJBA 4AG2C 1T0JA 5IHKA 3H0FA 2MIOA 1WIEA 3U23A 1JU5C 1N5ZA 2JM9A 2CUBA 2DL3A 2C0OA 1OPKA 3EG3A 1WI7A 2RQVA 1NG2A 1JEGA 1AZEA 2PNIA 2V1RA 3I35A 2X3XD 2YT6A 2O9SA 2XMFA 4CC3A 2J05A 1B07A 1PWTA 2L0AA 1AOJA 2DYBA 2O88A 1T3LA 4JZ3A 2FRWA 5FW9A 2IIMA 1M3AA 1ZBJA 2GTJA 2YDLA 1ZUYA 1G83A 4J9BA 1AWOA 1KJWA 1TG0A 1B3QA 2OI3A 2J06A 2L3QA 2LCSA 2F2WA 2P4RA 2V1QA 1RUWA 2BZYA 4RTTA 2JXBA 1BU1A 4J9EA 1SSHA 1PNJA 1T0HA 2DL4A 5IXFA 4JJCA 1OEBA 2HSPA 2X3WD 2ENMA 4WCIA 3VRYA 1YCSB 2DA9A 1NM7A 5EC7A 1UTIA 2LP5A 2ED1A 1GCQA 1MV3A 2A08A 1FMKA 1ABOA 2LJ1A 2D8JA 2SRCA 2J6OA 1M30A 3FJ5A 2AKKA 3ULRB 2L3SA 1UFFA 4LE9A 1K1ZA 4EIKA 2D8HA 1OV3A 2EYYA 2EPDA 3GBQA 3LH5A 2EBPA 2LX7A 4HVWA 2W0ZA 1Z9QA 5IXBA 1WLPB 2DL5A 1W1FA 1SHFA 2KRNA 2PTKA 3VS3A 1MV0B 1SRMA 4J9HA 1UGVA 2KBTA 2GGRA 2I0NA 2C0IA 1KSWA 2HBWA 2K7AA 3PVQA 4Z89A 2EGEA 2KROA 2GQIA 2DILA 2K6DA 3EG2A 2DX1A 2KT1A 1NLOC 5FWBA 1JXMA 1XOVA 2O2OA 1EFNA 3EG1A 1SHGA 4X1VA 1WYXA 3SHWA 3H0IA 1K4US 3VRZA 1TUCA 1UECA 3VS6A 1VYUA 2KE9A
chains in the Genus database with same CATH superfamily
1QP2A 2DTHA 2MYSA 2I2LA 3J80E 2XDBA 3OMGA 5HKCA 1U5SA 2ABLA 1YBYA 1K73C 5KE3A 1J3TA 1YI2A 3OYKA 1MMGA 4C0DB 3P8BB 2EW3A 1W2BA 3I55T 2DXUA 1PHTA 2YLBA 3RDVA 1Q81R 3ER0A 4ESRA 4K11A 2DJQA 5I11A 1D1AA 3EG0A 2ATCB 1WHJA 4JJDA 7AT1B 5GAN6 2LT1A 1S72T 3JB9I 1NLPC 2XG8D 3CBPA 4PJOD 2B86A 2EKHA 2RI5A 1M1KU 4LN2A 4RMOA 1C1AA 3FDRA 4CC7A 1YWOA 4M75A 2KI7A 5D6XA 5D6WA 1GFDA 1W6XA 2GFUA 1GXIE 1HJDA 2W10A 2R5MA 4DA4A 1VQ6T 1VQ6A 1XJWB 4M7DC 2K3YA 1SKUB 1UGSB 2AZSA 4AFZC 3FLGA 5LJ5g 4QT7A 3CCSA 2HDAA 1OQKA 2VWFA 4FYYB 4OMNA 2RA2A 2IVWA 4OMQA 1RAIB 1YN8A 1UJYA 2V26A 1YFNA 2EQKA 2Y4YA 2CDTA 3EGDA 3V7SA 2E4HA 1X6GA 2HEQA 1RAEB 4M7AB 4XTZA 1VQPT 5GMKe 4LDXA 5GANh 1G3WA 2YUOA 1YWPA 4C5EA 1VQLT 1VA7A 4MMLA 1VQLA 3JCMe 2ROLA 2BUDA 3M0TA 2CYZB 2F5KA 2JW4A 1WDXA 4E7ZA 1AWXA 2QEXA 2D0NA 2QQSA 3PT9A 2MI6A 2EVRA 4M77E 2EJ9A 3H9NA 1GCPA 2JOYA 4F14A 1VQMT 2K79A 1V29B 4FT4A 2O4XB 4L59A 3OS0A 2LNHB 1M8MA 3OYBA 3QWYA 1M3CA 2BTTA 2EQUA 4A4EA 4RTWA 4A4GA 3GF5A 3MEWA 4M75D 5LJ5d 4OB3B 3THKA 2CH4W 2DVJA 2LT4A 1KIKA 2H3EB 1IXDA 3OW2A 1UHFA 2QQAA 2RJCA 2ZPHB 3M57A 4C0DC 5CQYA 1SEMA 4XTWA 2ZPBB 2J7IA 2YRVA 4II1A 2J6FA 4AMCA 3QG1A 1SSFA 4M77D 3SWNB 3EGUA 4DEYA 2SEMA 4FT2A 3NMZC 1JRIA 1D3BB 3WVEB 5CCAA 2GNCA 1N8RC 3CMET 4FSXA 2E6NA 2CH4A 3A1PA 1K8AR 2QDLA 2LCCA 4C8QA 2LTOA 2KT8A 4ZNXA 3RBBB 3TEEA 2CUDA 3QJYA 4FM4B 5FLXE 4MZPA 4J6WA 5ECAA 4J9DA 3OS5A 1X27A 4HA8A 4M7DF 2ROTA 2CP0A 2CP6A 1LJOA 5CKDA 2RQTA 3FEOA 4EMGA 4XU3A 4JRPA 1WA7A 2YLCA 3MCAB 4JLIA 1PC0A 2EYZA 3CCMQ 2VV5A 4J9IA 2HCKA 1WFWA 4M7AC 1D0ZA 1K0XA 3RNJA 2DFUA 3NPFA 4JRKA 2OTLT 1RAGB 2O9VA 2RQUA 1WJRA 2OTLA 1UJ0A 4ATOA 1WQ7A 4C92C 2KNBB 3VUZA 2DXTA 3S6WA 1OULA 2V8JA 2AZVA 1JXOA 1IHVA 5GAN8 1W2BS 4ZGEB 2QI2A 3A8MB 2K5IA 2DTOA 4J9GA 4JS4A 4R0KA 4AT1B 4F17A 1LOJA 3C0CA 2FZCB 2LJ0A 4AFQC 4IUQA 2F69A 4J5YA 4E2FB 1YJWA 5GAMg 3UWNA 3EH2A 1D0XA 3SB2A 1QVGS 5A0GA 2YSQA 4HKEA 1R0BG 5FROA 5KYNA 3CCET 3CC2A 1ARKA 1I4K1 2WSEE 4EMKA 4D8DA 3PNWC 1Y57A 1VQKT 4NL2A 3PIOA 1VQKA 2C06A 2QTVA 3S3OA 1CKAA 5GAN4 3A8LB 2M51A 3KXTA 5GAN3 3TVTA 1VQNQ 1WX6A 3SWNC 1GL5A 1RAHB 3QYHB 2JVVA 1G8XA 1YIJQ 2YUPA 1BI2A 5GANe 1PM3A 1U1SA 4AG2C 5IHKA 2LQKA 3CCQT 1M90R 3M59A 2E5QA 1V76A 5LJ5e 4M7DG 2JM9A 1IB8A 5GAMd 3X20B 2FZKB 1NG2A 1AZEA 3I56Q 2V1RA 3JB9J 2X3XD 2YT6A 2O9SA 4QVDA 1Q82R 2XMFA 3OY9A 2DZ9A 3DB4A 1KC8C 1K8AU 1OZ3A 4M78E 1M9SA 3RR6A 1OU8A 3RKXA 3JB9H 1T3LA 3CXCA 5HK3A 4BD3A 2IIMA 5CKFA 1ZBJA 3OB9A 3LWIA 3PIPA 4OB2B 2DPPB 1RI0A 4M7AF 2OI3A 2K4YA 5LJ3g 3CCLA 4PFPA 1QVFP 5DY9A 2V1QA 1KK7A 3RESA 4DQ2A 4DBHA 3OYEA 1SSHA 3OW2S 2H3JA 4ZGJB 1Q95G 1T0HA 1VQ9Q 5GAOn 4C92F 4JJCA 4PK4A 4F7UB 1K9MR 4WCIA 1U8RA 1YCSB 4JLGA 1NM7A 3OYHA 1UTIA 3PMTA 5GANj 4EDUA 5GMKi 4QW2A 4BDZA 4M78D 2SRCA 3LLRA 1B34B 4OP0A 3G71A 1UFFA 1NZ9A 3QO3A 1D1CA 3HFNA 1B7TA 1VIEA 3BDLA 2EPDA 3G6ET 3G6EA 2EBPA 1WGSA 4NOYA 5DLOA 1Z9QA 3JCMf 3CCUT 3G4ST 3VS3A 3M55A 1UGVA 1KSWA 4Z89A 5LJ3d 1QW1A 3EG2A 3CCRQ 3HHTB 2DX1A 2KT1A 2PQWA 3TREA 1EFNA 1M2VB 1FXXA 5LL6S 1PD0A 3H0IA 5FU7B 1TUCA 1UECA 1WHGA 1WHLA 1WNLA 2RQWA 2KE9A 1XQHA 2OX7A 2FHDA 3CC7T 2E5KA 1X43A 2QG9B 4D8KA 1RLQC 1I0CA 1VQ4T 1VQ4A 3RIRA 3HRUA 1VQOT 4BACA 3CMAT 5GAOq 1JJ2S 2JNGA 2EQIA 3HTRA 1K73R 3E9FA 1TTHB 3LYIA 1NYGA 4PJOB 1M90U 3M0QA 4Y28E 3S3NA 2KEAA 3L2ZA 3KFVA 4CRIA 3I55Q 2M0OA 1VQNA 5GMKh 1FMWA 1QKWA 4L5GA 1YJNA 4M7AG 3JCMh 4VUBA 1H3HA 2QA4T 2PVGB 1QLYA 2QA4A 2RN8A 2DLPA 4WTOB 1VQ5A 4C92G 2YUQA 1TOVA 1S72Q 4X9CA 3PTAA 4JPBW 2KYMA 1H8KA 2FVUA 4LDWA 3VU3C 2DIGA 2XDDA 2JTMA 5A0LA 4F7UE 2PVDB 3HL8A 4DEXA 4Z8AA 2PZ1A 4J9CA 1PCXA 1M2OA 5GAMe 3BE3A 2GTOA 2ZPEB 3RMQA 4E7JA 3TSZA 3OA6A 4D6WA 3V8JA 4FW2A 2DXBA 3OYNA 4AFSC 2KGTA 1I07A 2HD0A 1S1NA 4KH0B 1PKTA 3JCMP 1A0NB 2ESWA 1IGUA 4B6MA 1F1BB 1YJ9Q 1VQPQ 3OQ5A 2VUBA 5FRNA 2JT4A 2PUOB 3L1AA 2CKKA 3X26B 4BI8B 2EYWA 2M16A 1NJIC 4M75B 3A98A 4JRQA 4J9FA 5D7UA 2HL3A 1EIFA 1Q86U 1QWEA 2RM4A 1T3SA 2IPOB 1VUBA 1Q7YC 5KYXA 2GFAA 4IIMA 1TXQA 5GAOr 2Y90A 5FU7C 3MEUA 2XIDA 3OYCA 1H92A 1G3YA 2FG0A 4Y91A 2COYA 1KD1U 1AWJA 3EGDB 5IH2A 1YNZA 4P5NA 3HP9A 4ZTFA 4F04B 1M5Q1 2M0YA 4PJOC 1OU9A 2FPEA 1PSEA 3M0PA 2RHXA 3OSSC 1UDLA 4N4HA 4BUGA 1YI2T 2KVQG 1RL2A 2VGMA 5LJ3e 1ZX6A 4RTUA 1OZ2A 2EGCA 4E47A 5CIUA 2CS7A 1AVZC 1NPRA 1YHQQ 5GANf 4JJNK 3M5AA 3JCMX 3CBOA 2X35A 1JB0E 3VS7A 3UA7A 2A7YA 4J7IA 3G1JA 3CMEQ 2CSQA 1O9SA 1N8RR 4OB0B 3JCMc 3OBYA 1QVGA 3QIIA 4FYWB 2XDPA 3M58A 2MPXC 2X4YA 1CSKA 2EAYA 1RLPC 1K9AA 3HSBA 4PL6A 3LX7A 4M7DA 1ZLMA 4HCBA 2LDMA 1X69A 1PD1A 4NS5A 4BDYA 2RHIA 1G2BA 4XU1A 1M1KC 2CREA 4LUDA 3LWHA 2BZ8A 3REAB 1VQ7T 4BI4A 1VQ7A 2JMAA 1QP3A 3CCST 1TS9A 1ZUKA 4M75E 4E7IA 3HKSA 3I5RA 2GBQA 4C0FA 1E7OA 1YP5A 2DRMA 4C0ZA 3ZL7C 1IRXA 1MUZA 2O31A 2V8IA 3CPWS 2QK0A 3OSVA 5CQXA 2EJGA 1HD3A 4KBMB 2PU9B 2BZXA 3PVLA 4ANJA 5LJ5h 4E7SA 3GP8A 5HY6A 2YHTA 1RI9A 4FSSA 4OF1A 1ZSZC 1W2BP 2QEXT 1LVKA 2DBKA 3M0RA 2FPFA 4AG1C 1LCKA 2DD5A 2K2MA 1YITQ 3DLMA 4IIOA 4Z88A 4M4ZA 2CGHA 3CCVA 4M77C 1D1BA 2KXCA 3C95A 1I81A 4CI0C 4OMFB 1ZSGA 4MZMA 2EGAA 3CCEQ 2F2XA 2R5AA 2OAWA 4N0AA 1WXTA 1FX7A 4J6XA 2P0PA 2D0QB 2FB7A 3MP6A 4J8OA 4JZ4A 5DM7R 2RJDA 4KGVB 3CC4Q 3UATA 1OI1A 5GMKj 1Q81U 2MCNA 3X25B 3MEVA 2D6FA 2QQ9A 3EH1A 2MWPA 4QQ6A 1T0JA 3CCQQ 2MIOA 1N27A 1Y71A 1RABB 5CAIA 2CUBA 2DL3A 5KYYA 2E41A 3VKIA 1W4SA 4PNOA 1BI0A 2B8AA 3EG3A 2X51A 2PNIA 3CCJQ 3I35A 3EGXA 4BB7A 4CC3A 1KC8R 1U1TA 3QSUA 1UB4A 5KYUA 1B07A 4EMKB 2QQRA 3MP8A 1PWTA 4O6JA 3M53A 2OTJQ 2FRWA 2LVMA 3DKMA 1ACMB 2RHUA 4QQGA 2KY9A 2BIVA 2GTJA 2Z0WA 3V7RA 4M78B 2HNIA 4C8QE 3DLLA 1TG0A 1B3QA 2CP5A 2MMPA 2J06A 2L3QA 2F2WA 3ASKA 5AT1B 3SDZA 3GIBA 2P4RA 1M1GA 1IZ6A 4IURA 2JXBA 4J9EA 4C92A 1JJ2A 3OS2A 2AIRB 2DL4A 4BE0A 2HSPA 3OW2P 4A4FA 4R56A 2X3WD 1H3ZA 2DA9A 3L2RA 5EC7A 1QMCA 3M4GA 4ELYC 3L2VA 2EJFA 3A5ZB 1D0YA 3FRNA 2D8JA 2HMAA 3FJ5A 4XTXA 2DTIA 4PJOG 5A0DA 4N4IA 4LE9A 2R57A 4PJLA 3JSCA 3HPWA 5GAOl 1BI1A 2NYSA 1OV3A 2NUPA 4M77F 2P4TA 2LX7A 1YJWT 4C8QD 3G4SQ 4B9WA 5IXBA 1WLPB 2DL5A 2PTKA 1SHFA 1MV0B 4J9HA 2VXEA 1G5VA 2K7AA 4EMHA 3L2QA 2L5QA 4HCZA 4YTLA 1KQSA 1KG1A 2YRDA 4XU2A 3CC2T 5CO7A 1NLOC 1JXMA 1XOVA 2K57A 4PJMA 3SWNA 5GAMh 5KE2A 4J83A 4X1VA 1QCNA 2HQXA 3S3MA 2RHYA 4R55A 4UC4A 3VRZA 3JCMQ 3VS6A 4A53A 1VYUA 4QKUA 3CC7Q 4E7LA 4C92D 2FRYA 1QWFA 1BK2A 3OYGA 2DO3A 3JB9D 2RMOA 3SFMA 1VQOQ 4HT9A 3VJPA 3QPHA 1VOMA 1RADB 4C5HA 4BE1A 2BE9B 1QKXA 2ED0A 3RKWA 1CKBA 1WPYA 1WJSA 3REBB 2BKDN 4KRTA 1KQ2A 3C94A 1IGQA 3JV3A 1JO8A 4EMKC 1GBRA 2XKOC 3IQLA 2DVEA 2KMTA 2NUTA 1X01A 4KUDK 5C0MA 4OMMA 4HT8A 4KH1B 1KC8U 2EYXA 1UGQB 2A36A 1K76A 3TU4K 1M1FA 4M78C 3CD6Q 2YUNA 4IUVA 4E6RA 1OOTA 3KUFA 1KHIA 4CC4B 4F16A 2EKOA 2MAMA 2DK3A 1HK9A 3CCLT 2RJFA 3I9QA 2KYBA 5M9OA 1UUEA 4LDUA 4XTUA 2CT3A 2EFIA 4DBQA 4M77G 2KR3A 3QWXX 1Y96B 1U06A 4HXJA 2K3XA 1IREB 2AK5A 2YWWA 5LJ3h 3CCMA 3G71T 3RERA 5LJ5j 2DF6A 3URGA 1OPLA 4A4KA 3M0SA 4LDYA 1X6OA 2FYKA 3M56A 5I2MA 3ZEHA 3QBYA 2LJ3A 2JTEA 3ZFJA 1LPLA 2C0TA 1NJIR 2CZ6B 4FYXB 3EHRA 3WVDB 1NYFA 3H0HA 5CR2A 4OMOA 3MPUB 2JUFA 3FIFA 1NBEB 1E6HA 2XD0A 4HVUA 1Q7YR 3P8HA 3E2UA 5I21A 1M27C 1BB9A 4QVZA 1VQ8Q 3VS2A 3LGLA 1Y07A 2L2PA 2OJ2A 1KHCA 2LC4A 4JUVA 3CXCP 4KUIA 2EQMA 3E9GA 2DXCA 3VUBA 3JAME 4RG2A 3OYAA 5GAOm 3UF4A 3UA6A 5FU6B 2HL5C 4OMPA 4FYVB 1WHHA 1WXBA 1MMNA 1YI2Q 1QVPA 4O5VA 3BDUA 3CPWA 4XU0A 3QKJA 1AWWA 5C6SA 1VQNT 5KYXB 2DBMA 1I5OB 2NUZA 1YJNT 5KH6A 3JCMg 4QVCA 1YIJA 2RO0A 5CK9A 3VV0A 1Q82U 3O8VA 2RD1A 3UPUA 2DD4A 2KAFA 4M78F 2DKGA 2CZ0B 1VQ5T 3A8OB 2KRMA 2M9UA 1PRLC 1P92A 1Y0MA 3L42A 3I56A 4Y92A 2HQEA 6AT1B 1BBZA 1VIFA 4ELZC 4ZN1A 5D6YA 4HCKA 2M1HA 3KBGA 2HBPA 2LNVA 2JS0A 1KQSS 1BIAA 4KT0E 3M4YA 4OVAA 3LH0A 1M1KR 5FRMA 1VQ6Q 2ZAEA 1K0SA 1K9MU 2VVKA 1UG1A 4LNPA 3JCMd 4LUEA 2COWA 3OYMA 1N9RA 1VQ9A 4LXCA 1W70A 5DLQE 1MNDA 2EIFA 4EPCA 4ZGDB 1VQLQ 4KGXB 4RCBA 3NHNA 3OYJA 2HAXA 2E70A 3D7SB 1FMVA 5L23A 2QEXQ 1GCQC 2QXFA 3EHQA 1VYVA 4ZTJA 3C12A 3HRSA 1VQMQ 4MDXA 1G3TA 1I1JA 4RUGA 3EG9A 1SRLA 1ABQA 2LZ6B 4A63B 5FU6C 1Q86C 5GAMj 4C5IA 3RMSA 1UE9A 2L8DA 3NFCA 2P0KA 3CCRT 3CCRA 2GF7A 4M78G 2AT1B 4BY6B 2IG0A 3EFOA 3TCJA 1KD1C 2XI9A 1X2KA 3SD4A 2A0FB 1EX4A 1K73U 2CT4A 1MHNA 3MEAA 1PKSA 2AKLA 2F5TX 2FO0A 2KQWA 2VYTA 3AT1B 2NWMA 4OGEA 1ZHIA 3GLXA 1HXDA 1JU5C 1N5ZA 1OYXA 4XTVA 5GAN5 1SG5A 3OYYA 5LJ5f 5KYWA 1ZBXA 3J81E 1OPKA 3I55A 4Z02A 2RQVA 1JEGA 4RCCA 4F7UF 4PLLA 2L0AA 1AOJA 5AYFA 2DYBA 2QAZA 2O88A 2ZPIB 2M02A 2DIQA 2DZCA 2NLUA 3GOXA 1S72A 3JCMV 3QDFA 2F1LA 2VGNA 4PLIA 5A2QE 3QZ9B 4J9BA 1BCMA 1AWOA 1KJWA 2LCSA 2JTFA 1PSFA 1RUWA 2BZYA 4RTTA 4J7FA 4E7HA 4M7DE 1R0CB 5KYYB 1BIBA 5LJ3j 4RG8A 1D09B 1HYOA 5IXFA 2OTLQ 5GANg 3NTIA 2E64A 3TQ7P 3EGXB 2MK5A 4C8QB 4M75C 5KYUB 2CP7A 1ZSZA 2ED1A 2HKQB 1FMKA 4IUPA 2EQJA 2VASA 4FL6A 4GY5A 2MF2A 4FW1A 3GNGA 1M30A 2AKKA 2L3SA 1BI3A 1K1ZA 4M77A 2GCXA 1YJ9T 3OS1A 1VQPA 1YJ9A 2DEUA 1DJ7B 4FCYA 2EYYA 2G3RA 3LH5A 1YJWQ 5GAN7 2FZGB 3CCVT 3A8GB 2WACA 2KRNA 4C92B 2DAQA 2DYIA 2KBTA 3X28B 2I0NA 3OMCA 1UGPB 4PJOF 2HBWA 3MP1A 3PVQA 4BY6C 4M7DD 1QVGP 2EGEA 4FIBA 2KROA 2ZPFB 2R58A 1NE8A 2XK0A 4XTYA 1VQMA 3CC2Q 2PUKB 4IUUA 5FWBA 1UEBA 2COZA 2X9HA 2O2OA 5GANd 1VQKQ 3EG1A 5IN1A 3LGFA 1WYXA 3H6ZA 3E19A 1K4US 3FB9A 4XK8E 4DOVA 1UHCA 2NUPB 2H8HA 2JMCA 4A4HA 4HVVA 5CKHA 1RACB 4F7UG 2K5FA 1GBQA 3UDCA 4HCCA 2RI2A 3A8HB 1U3OA 3QHSA 2CP2A 4RTZA 1MGQA 1RAFB 2RPNA 1FWZA 1GFCA 4XQ3A 4N0AC 1NEBA 3EAEA 1AZGB 1Q81C 4N4GA 3ME9A 1N8RU 3MHXA 1R77A 2ZZDA 3Q1JA 1YHQT 1YHQA 1AD5A 2EWNA 4PFOA 1EZZB 3E1SA 5FWCA 5GMKl 2J6KA 2ZPGB 3NGPA 1X2QA 1WXUA 2F2VA 2QTXA 3CMEA 3M54A 5HCKA 2VKNA 2GQVA 4M7AA 2L3PA 2DL8A 4BI3A 2LRQA 3CCLQ 4ME7A 1WJQA 2DMOA 2CP3A 2X4XA 3H8ZA 2KDSA 4LD6A 2FL7A 2HSEB 2K5LA 2P84A 4E7KA 5CKEA 4C8QC 3V8KA 4M75F 5GAMf 5GAOp 1TUGB 2NUTB 4GLMA 4M7AE 1XNIA 3C4SA 3J7AF 2JS2A 3LW5E 3BY7A 2O4XA 3QJ6A 2HKNA 3G71Q 4C92E 2LQWA 2RI3A 5IHNA 3FJPA 2AHJB 2FEIA 1QQJA 2RHZA 4TVRA 1MNEA 1Y7XA 2A37A 3RKYA 3G6EQ 2DL7A 4IKFA 4MMKA 3CCUQ 2X4JA 3MJXA 2QYZA 2RB6A 2E6ZA 2ECZA 1OX9A 2L3RA 2D1XA 1ZUUA 2VC8A 2KXDA 1LNXA 1YITT 3GNFB 3V7CA 1YITA 2CZ1B 1PRMC 3QDRB 2DETA 5I2SA 3H41A 4M7AD 5I22A 1QCFA 5GJVB 1M3BA 1QVFA 4CC2A 1V1CA 2EYQA 4OMLA 5J3BA 1ZA1B 3L2WA 1E6GA 1D3BA 4KGZB 2QGFB 1VQ4Q 3VS0A 3PMIA 1QCOA 2RK2A 3CCEA 5CVIA 3CMAQ 2QASA 3CPFA 4DBRA 1VYTA 3MO8A 1JQQA 2KRSA 3META 1JJ2P 1N6AA 2QQBA 3PFSA 4RTVA 4C5GA 2E65A 1KFZA 1BKBA 3G7ZA 5LJ3f 4GLKA 2QDYB 1YJNQ 2JZ2A 2RQRA 3CC4T 3CC4A 2WSCE 4WF2A 5J39A 2MOXA 3P8DA 3VS4A 2RNAA 5KCHA 4M78A 2QA4Q 2RJEA 1SPKA 3OYLA 2VB6A 4PFZA 3CCQA 1IO6A 1VQ5Q 2YRCA 3BFMA 2LQNA 4M75G 2RF0A 2FPDA 4J6YA 2CSIA 1OX8A 1MMDA 4QQDA 1I8FA 2OAUA 4BE2A 1GRIA 5CKBA 1K8AC 3CCJT 3CCJA 2D9TA 4C8QF 3X24B 1WQWA 3VS5A 4RKUE 1TSFA 1AT1B 2XICA 2DE0X 1TUDA 3NTKA 3SEMA 3OYIA 4JDSA 5IAYA 2OTJT 2OTJA 3CQTA 1Z9ZA 3NTHA 2JN0A 4PKCC 1NEGA 3R6NA 4RTXA 4LD9K 1KQSP 1M4ZA 5IT9E 2WSFE 2DNUA 2E3IA 1G3SA 2CZ7B 4Q5WA 4XAXB 3OYDA 2HQHA 2XHCA 1BCOA 3PE0A 3VS1A 1FYNA 5GMKm 3CCMT 1H641 2DRKA 2QGGA 2E3HA 1M8VA 3QZ5B 3L2UA 4MDWA 3JB9F 4V2SA 3O5ZA 4X34A 4ORZA 4PJNA 2L89A 3AHUA 4AFUC 5GJWB 3V8LA 1WZOA 3UT1A 2JM8A 2YXYA 1AEYA 3FC3A 1YCYA 2JJ9A 3JCMW 3QXEB 2K3BA 1BYMA 1HSQA 3VYHB 3TSWA 5L8RE 3R6OA 4DBFA 4RTYA 2E1HA 1C6VX 3CCUA 3G4SA 3JRZA 2RK1A 1MMAA 4B9XA 1Q86R 1ZQ1A 2G6FX 2K9GA 5IHIA 4GBQA 2DEQA 2ZGWA 3QUIA 3I5SA 3M9QA 2LQ8A 5KCOA 4OB1B 2VXFA 1KD1R 3WXMB 2A28A 2LMJA 3EFRA 5J26A 4OGCA 3JCMb 3INZA 1X6BA 3CC7A 1NPPA 3CBMA 4FU6A 2DM1A 1YIJT 3EG9B 4C8QG 1VQOA 3CMAA 3M0UA 4JJBA 4C0GA 3H0FA 3QYGB 1M90C 2X4WA 3OYFA 1WIEA 3RUXA 3U23A 3EFSA 1TWBA 1RAAB 5EG2A 2C0OA 2V8KA 1JBMA 3BW1A 1UGRB 2LX9A 3VYGA 1WI7A 2XU8A 3I56T 3N5BB 4F7UA 4MZTA 2P0QA 4IUTA 1Q82C 1Y96A 3MKDA 3EFOB 2J05A 1SF9A 5HK0A 2BE7D 3CEYA 4JZ3A 5FW9A 2Y4XA 1M3AA 1B34A 8AT1B 3JB9G 1IHWA 2YDLA 4L6V5 1ZUYA 1C0MA 3CD6T 4JS5A 3CD6A 1G83A 2O01E 2MWOA 2E12A 1VQ7Q 1QVFS 3CCSQ 8ATCB 1I5LA 2A3LA 3DB3A 1ZA2B 1WHMA 4X9DA 1BU1A 5KYWB 1PNJA 1VQ9T 1OEBA 2ENMA 1KQ1A 1K9MC 2DERA 3VRYA 1XTDA 1X75C 1R8OB 3OBWA 2LP5A 1GCQA 1MV3A 2A08A 3CPWP 3ZBDA 1O75A 1ABOA 2LJ1A 4M7DB 1NJIU 4DOWA 2J6OA 1M2VA 3HFOA 3ULRB 1WHKA 2RH2A 2PVOB 2E10A 1TH7A 1TU0B 4EIKA 2D8HA 3JCMJ 1Q7YU 3GBQA 1N9SA 3GPLA 3CCVQ 4HVWA 2W0ZA 3HRTA 4KULA 1W1FA 1AHJB 1SRMA 3PGGA 4PJOA 2K2VA 2KSSA 2GGRA 2C0IA 2DJZA 4PJJA 2HZYA 3F70A 2GQIA 2DILA 1ZSZB 1VQ8T 2K6DA 1VQ8A 5GAN2 9ATCB 2KK4A 3CXCS 4A54A 4ZN3A 4LDVA 1SHGA 1PG5B 4JRIA 3SHWA 4PJOE 2LCLA 4NL3A 3T9NA 2ZCFB 4M77B
chains in the Genus database with same CATH topology
2FRYA 1UHCA 2E5KA 1QWFA 1X43A 2H8HA 2JMCA 4D8KA 1BK2A 1RLQC 1I0CA 4HVVA 2RMOA 1GBQA 1U5SA 2ABLA 1U3OA 2EQIA 1QKXA 2ED0A 4RTZA 1NYGA 1J3TA 2RPNA 3M0QA 1GFCA 1CKBA 2KEAA 3REBB 3KFVA 4KRTA 1NEBA 3JV3A 2EW3A 1JO8A 1PHTA 1AZGB 1GBRA 1QKWA 4ESRA 3IQLA 4K11A 2DJQA 5I11A 1AD5A 4OMMA 1H3HA 1QLYA 3EG0A 2RN8A 2EYXA 2DLPA 5FWCA 4JJDA 2A36A 1K76A 2J6KA 2YUQA 3NGPA 1X2QA 1WXUA 1NLPC 4JPBW 2F2VA 5HCKA 2KYMA 1H8KA 2B86A 2EKHA 2VKNA 2YUNA 4E6RA 1OOTA 2L3PA 4LN2A 2DL8A 4CC4B 4DEXA 4F16A 4CC7A 4Z8AA 2DMOA 2PZ1A 4J9CA 1YWOA 2RQWA 3I9QA 2KYBA 2GTOA 1GFDA 1UUEA 3TSZA 1W6XA 2CT3A 1HJDA 2KR3A 2W10A 3QWXX 4GLMA 1U06A 2JS2A 4HXJA 2AK5A 2AZSA 4AFZC 4AFSC 2KGTA 4QT7A 1I07A 2HDAA 2VWFA 1S1NA 4OMNA 4OMQA 1YN8A 1PKTA 1UJYA 2LQWA 2DF6A 1OPLA 2CDTA 5IHNA 1A0NB 2ESWA 3M0SA 2FEIA 1X6GA 2HEQA 2JT4A 2A37A 2YUOA 2LJ3A 1YWPA 2JTEA 1VA7A 2DL7A 2EYWA 2ROLA 2C0TA 3M0TA 3A98A 4J9FA 2ECZA 2JW4A 1WDXA 3EHRA 1NYFA 3H0HA 2D1XA 4OMOA 1AWXA 1ZUUA 1QWEA 2D0NA 1T3SA 1E6HA 4HVUA 2EVRA 2KXDA 1M27C 1BB9A 3VS2A 4IIMA 1GCPA 4F14A 2K79A 1PRMC 3H41A 2L2PA 1M8MA 2LNHB 2OJ2A 5I22A 3QWYA 1M3CA 2BTTA 1H92A 1QCFA 2FG0A 4RTWA 1M3BA 5GJVB 4CC2A 1V1CA 1AWJA 4OMLA 5IH2A 1E6GA 1YNZA 3UF4A 3THKA 3UA6A 2CH4W 2DVJA 1KIKA 3VS0A 2M0YA 4OMPA 1UHFA 1VYTA 1WXBA 1JQQA 2FPEA 2KRSA 3M0PA 1UDLA 1SEMA 4RTVA 1KFZA 1ZX6A 4RTUA 2EGCA 1AWWA 2J7IA 2DBMA 2NUZA 2RQRA 2J6FA 2MOXA 1AVZC 3VS4A 2RNAA 1SPKA 1IO6A 3EGUA 4DEYA 2LQNA 2SEMA 2RF0A 3VS7A 2FPDA 3NMZC 2KRMA 3UA7A 1PRLC 2CSIA 2CSQA 2GNCA 1Y0MA 1GRIA 2CH4A 2QDLA 4Y92A 2KT8A 1BBZA 4ZNXA 3RBBB 2CUDA 4HCKA 3VS5A 1CSKA 3SEMA 2DE0X 1TUDA 5ECAA 1RLPC 1K9AA 3CQTA 4J9DA 1Z9ZA 1X27A 1NEGA 1ZLMA 2JS0A 3R6NA 1X69A 4RTXA 2ROTA 1G2BA 2DNUA 2CREA 4LUDA 2RQTA 1K0SA 2BZ8A 3REAB 1WA7A 3PE0A 2JMAA 3VS1A 1FYNA 2VVKA 1UG1A 2EYZA 4LNPA 4J9IA 2HCKA 1ZUKA 4LUEA 1WFWA 2DRKA 1K0XA 3RNJA 3I5RA 3NPFA 2GBQA 1E7OA 1YP5A 1W70A 2DRMA 3O5ZA 2O9VA 2RQUA 3ZL7C 4ORZA 1UJ0A 4AFUC 1MUZA 2O31A 5GJWB 2KNBB 3NHNA 1HD3A 2AZVA 1JXOA 2BZXA 3PVLA 2JM8A 1AEYA 4FSSA 1RI9A 5L23A 1GCQC 2DBKA 3M0RA 2FPFA 3EHQA 1VYVA 2K3BA 4AG1C 1LCKA 4J9GA 1HSQA 2K2MA 4R0KA 4F17A 1I1JA 4RUGA 3C0CA 2LJ0A 3TSWA 4AFQC 4IIOA 4Z88A 4M4ZA 1SRLA 4RTYA 1ABQA 2LZ6B 4A63B 2KXCA 2G6FX 2K9GA 2YSQA 5IHIA 4GBQA 1UE9A 1ZSGA 2EGAA 3I5SA 2F2XA 2OAWA 1ARKA 1WXTA 4D8DA 1Y57A 1X2KA 2A28A 2LMJA 1CKAA 2CT4A 2M51A 4JZ4A 3TVTA 1WX6A 1X6BA 1PKSA 1GL5A 2AKLA 2FO0A 3UATA 2YUPA 2DM1A 2NWMA 2MCNA 3M0UA 4JJBA 4AG2C 1T0JA 5IHKA 3H0FA 2MIOA 1WIEA 3U23A 1JU5C 1N5ZA 2JM9A 2CUBA 2DL3A 2C0OA 1OPKA 3EG3A 1WI7A 2RQVA 1NG2A 1JEGA 1AZEA 2PNIA 2V1RA 3I35A 2X3XD 2YT6A 2O9SA 2XMFA 4CC3A 2J05A 1B07A 1PWTA 2L0AA 1AOJA 2DYBA 2O88A 1T3LA 4JZ3A 2FRWA 5FW9A 2IIMA 1M3AA 1ZBJA 2GTJA 2YDLA 1ZUYA 1G83A 4J9BA 1AWOA 1KJWA 1TG0A 1B3QA 2OI3A 2J06A 2L3QA 2LCSA 2F2WA 2P4RA 2V1QA 1RUWA 2BZYA 4RTTA 2JXBA 1BU1A 4J9EA 1SSHA 1PNJA 1T0HA 2DL4A 5IXFA 4JJCA 1OEBA 2HSPA 2X3WD 2ENMA 4WCIA 3VRYA 1YCSB 2DA9A 1NM7A 5EC7A 1UTIA 2LP5A 2ED1A 1GCQA 1MV3A 2A08A 1FMKA 1ABOA 2LJ1A 2D8JA 2SRCA 2J6OA 1M30A 3FJ5A 2AKKA 3ULRB 2L3SA 1UFFA 4LE9A 1K1ZA 4EIKA 2D8HA 1OV3A 2EYYA 2EPDA 3GBQA 3LH5A 2EBPA 2LX7A 4HVWA 2W0ZA 1Z9QA 5IXBA 1WLPB 2DL5A 1W1FA 1SHFA 2KRNA 2PTKA 3VS3A 1MV0B 1SRMA 4J9HA 1UGVA 2KBTA 2GGRA 2I0NA 2C0IA 1KSWA 2HBWA 2K7AA 3PVQA 4Z89A 2EGEA 2KROA 2GQIA 2DILA 2K6DA 3EG2A 2DX1A 2KT1A 1NLOC 5FWBA 1JXMA 1XOVA 2O2OA 1EFNA 3EG1A 1SHGA 4X1VA 1WYXA 3SHWA 3H0IA 1K4US 3VRZA 1TUCA 1UECA 3VS6A 1VYUA 2KE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FRY A;  1UHC A;  2E5K A;  1QWF A;  1X43 A;  2H8H A;  2JMC A;  4D8K A;  1BK2 A;  1RLQ C;  1I0C A;  4HVV A;  2RMO A;  1GBQ A;  1U5S A;  2ABL A;  1U3O A;  2EQI A;  1QKX A;  2ED0 A;  4RTZ A;  1NYG A;  1J3T A;  2RPN A;  3M0Q A;  1GFC A;  1CKB A;  2KEA A;  3REB B;  3KFV A;  4KRT A;  1NEB A;  3JV3 A;  2EW3 A;  1JO8 A;  1PHT A;  1AZG B;  1GBR A;  1QKW A;  4ESR A;  3IQL A;  4K11 A;  2DJQ A;  5I11 A;  1AD5 A;  4OMM A;  1H3H A;  1QLY A;  3EG0 A;  2RN8 A;  2EYX A;  2DLP A;  5FWC A;  4JJD A;  2A36 A;  1K76 A;  2J6K A;  2YUQ A;  3NGP A;  1X2Q A;  1WXU A;  1NLP C;  4JPB W;  2F2V A;  5HCK A;  2KYM A;  1H8K A;  2B86 A;  2EKH A;  2VKN A;  2YUN A;  4E6R A;  1OOT A;  2L3P A;  4LN2 A;  2DL8 A;  4CC4 B;  4DEX A;  4F16 A;  4CC7 A;  4Z8A A;  2DMO A;  2PZ1 A;  4J9C A;  1YWO A;  2RQW A;  3I9Q A;  2KYB A;  2GTO A;  1GFD A;  1UUE A;  3TSZ A;  1W6X A;  2CT3 A;  1HJD A;  2KR3 A;  2W10 A;  3QWX X;  4GLM A;  1U06 A;  2JS2 A;  4HXJ A;  2AK5 A;  2AZS A;  4AFZ C;  4AFS C;  2KGT A;  4QT7 A;  1I07 A;  2HDA A;  2VWF A;  1S1N A;  4OMN A;  4OMQ A;  1YN8 A;  1PKT A;  1UJY A;  2LQW A;  2DF6 A;  1OPL A;  2CDT A;  5IHN A;  1A0N B;  2ESW A;  3M0S A;  2FEI A;  1X6G A;  2HEQ A;  2JT4 A;  2A37 A;  2YUO A;  2LJ3 A;  1YWP A;  2JTE A;  1VA7 A;  2DL7 A;  2EYW A;  2ROL A;  2C0T A;  3M0T A;  3A98 A;  4J9F A;  2ECZ A;  2JW4 A;  1WDX A;  3EHR A;  1NYF A;  3H0H A;  2D1X A;  4OMO A;  1AWX A;  1ZUU A;  1QWE A;  2D0N A;  1T3S A;  1E6H A;  4HVU A;  2EVR A;  2KXD A;  1M27 C;  1BB9 A;  3VS2 A;  4IIM A;  1GCP A;  4F14 A;  2K79 A;  1PRM C;  3H41 A;  2L2P A;  1M8M A;  2LNH B;  2OJ2 A;  5I22 A;  3QWY A;  1M3C A;  2BTT A;  1H92 A;  1QCF A;  2FG0 A;  4RTW A;  1M3B A;  5GJV B;  4CC2 A;  1V1C A;  1AWJ A;  4OML A;  5IH2 A;  1E6G A;  1YNZ A;  3UF4 A;  3THK A;  3UA6 A;  2CH4 W;  2DVJ A;  1KIK A;  3VS0 A;  2M0Y A;  4OMP A;  1UHF A;  1VYT A;  1WXB A;  1JQQ A;  2FPE A;  2KRS A;  3M0P A;  1UDL A;  1SEM A;  4RTV A;  1KFZ A;  1ZX6 A;  4RTU A;  2EGC A;  1AWW A;  2J7I A;  2DBM A;  2NUZ A;  2RQR A;  2J6F A;  2MOX A;  1AVZ C;  3VS4 A;  2RNA A;  1SPK A;  1IO6 A;  3EGU A;  4DEY A;  2LQN A;  2SEM A;  2RF0 A;  3VS7 A;  2FPD A;  3NMZ C;  2KRM A;  3UA7 A;  1PRL C;  2CSI A;  2CSQ A;  2GNC A;  1Y0M A;  1GRI A;  2CH4 A;  2QDL A;  4Y92 A;  2KT8 A;  1BBZ A;  4ZNX A;  3RBB B;  2CUD A;  4HCK A;  3VS5 A;  1CSK A;  3SEM A;  2DE0 X;  1TUD A;  5ECA A;  1RLP C;  1K9A A;  3CQT A;  4J9D A;  1Z9Z A;  1X27 A;  1NEG A;  1ZLM A;  2JS0 A;  3R6N A;  1X69 A;  4RTX A;  2ROT A;  1G2B A;  2DNU A;  2CRE A;  4LUD A;  2RQT A;  1K0S A;  2BZ8 A;  3REA B;  1WA7 A;  3PE0 A;  2JMA A;  3VS1 A;  1FYN A;  2VVK A;  1UG1 A;  2EYZ A;  4LNP A;  4J9I A;  2HCK A;  1ZUK A;  4LUE A;  1WFW A;  2DRK A;  1K0X A;  3RNJ A;  3I5R A;  3NPF A;  2GBQ A;  1E7O A;  1YP5 A;  1W70 A;  2DRM A;  3O5Z A;  2O9V A;  2RQU A;  3ZL7 C;  4ORZ A;  1UJ0 A;  4AFU C;  1MUZ A;  2O31 A;  5GJW B;  2KNB B;  3NHN A;  1HD3 A;  2AZV A;  1JXO A;  2BZX A;  3PVL A;  2JM8 A;  1AEY A;  4FSS A;  1RI9 A;  5L23 A;  1GCQ C;  2DBK A;  3M0R A;  2FPF A;  3EHQ A;  1VYV A;  2K3B A;  4AG1 C;  1LCK A;  4J9G A;  1HSQ A;  2K2M A;  4R0K A;  4F17 A;  1I1J A;  4RUG A;  3C0C A;  2LJ0 A;  3TSW A;  4AFQ C;  4IIO A;  4Z88 A;  4M4Z A;  1SRL A;  4RTY A;  1ABQ A;  2LZ6 B;  4A63 B;  2KXC A;  2G6F X;  2K9G A;  2YSQ A;  5IHI A;  4GBQ A;  1UE9 A;  1ZSG A;  2EGA A;  3I5S A;  2F2X A;  2OAW A;  1ARK A;  1WXT A;  4D8D A;  1Y57 A;  1X2K A;  2A28 A;  2LMJ A;  1CKA A;  2CT4 A;  2M51 A;  4JZ4 A;  3TVT A;  1WX6 A;  1X6B A;  1PKS A;  1GL5 A;  2AKL A;  2FO0 A;  3UAT A;  2YUP A;  2DM1 A;  2NWM A;  2MCN A;  3M0U A;  4JJB A;  4AG2 C;  1T0J A;  5IHK A;  3H0F A;  2MIO A;  1WIE A;  3U23 A;  1JU5 C;  1N5Z A;  2JM9 A;  2CUB A;  2DL3 A;  2C0O A;  1OPK A;  3EG3 A;  1WI7 A;  2RQV A;  1NG2 A;  1JEG A;  1AZE A;  2PNI A;  2V1R A;  3I35 A;  2X3X D;  2YT6 A;  2O9S A;  2XMF A;  4CC3 A;  2J05 A;  1B07 A;  1PWT A;  2L0A A;  1AOJ A;  2DYB A;  2O88 A;  1T3L A;  4JZ3 A;  2FRW A;  5FW9 A;  2IIM A;  1M3A A;  1ZBJ A;  2GTJ A;  2YDL A;  1ZUY A;  1G83 A;  4J9B A;  1AWO A;  1KJW A;  1TG0 A;  1B3Q A;  2OI3 A;  2J06 A;  2L3Q A;  2LCS A;  2F2W A;  2P4R A;  2V1Q A;  1RUW A;  2BZY A;  4RTT A;  2JXB A;  1BU1 A;  4J9E A;  1SSH A;  1PNJ A;  1T0H A;  2DL4 A;  5IXF A;  4JJC A;  1OEB A;  2HSP A;  2X3W D;  2ENM A;  4WCI A;  3VRY A;  1YCS B;  2DA9 A;  1NM7 A;  5EC7 A;  1UTI A;  2LP5 A;  2ED1 A;  1GCQ A;  1MV3 A;  2A08 A;  1FMK A;  1ABO A;  2LJ1 A;  2D8J A;  2SRC A;  2J6O A;  1M30 A;  3FJ5 A;  2AKK A;  3ULR B;  2L3S A;  1UFF A;  4LE9 A;  1K1Z A;  4EIK A;  2D8H A;  1OV3 A;  2EYY A;  2EPD A;  3GBQ A;  3LH5 A;  2EBP A;  2LX7 A;  4HVW A;  2W0Z A;  1Z9Q A;  5IXB A;  1WLP B;  2DL5 A;  1W1F A;  1SHF A;  2KRN A;  2PTK A;  3VS3 A;  1MV0 B;  1SRM A;  4J9H A;  1UGV A;  2KBT A;  2GGR A;  2I0N A;  2C0I A;  1KSW A;  2HBW A;  2K7A A;  3PVQ A;  4Z89 A;  2EGE A;  2KRO A;  2GQI A;  2DIL A;  2K6D A;  3EG2 A;  2DX1 A;  2KT1 A;  1NLO C;  5FWB A;  1JXM A;  1XOV A;  2O2O A;  1EFN A;  3EG1 A;  1SHG A;  4X1V A;  1WYX A;  3SHW A;  3H0I A;  1K4U S;  3VRZ A;  1TUC A;  1UEC A;  3VS6 A;  1VYU A;  2KE9 A; 
#chains in the Genus database with same CATH topology
 1QP2 A;  2DTH A;  2MYS A;  2I2L A;  3J80 E;  2XDB A;  3OMG A;  5HKC A;  1U5S A;  2ABL A;  1YBY A;  1K73 C;  5KE3 A;  1J3T A;  1YI2 A;  3OYK A;  1MMG A;  4C0D B;  3P8B B;  2EW3 A;  1W2B A;  3I55 T;  2DXU A;  1PHT A;  2YLB A;  3RDV A;  1Q81 R;  3ER0 A;  4ESR A;  4K11 A;  2DJQ A;  5I11 A;  1D1A A;  3EG0 A;  2ATC B;  1WHJ A;  4JJD A;  7AT1 B;  5GAN 6;  2LT1 A;  1S72 T;  3JB9 I;  1NLP C;  2XG8 D;  3CBP A;  4PJO D;  2B86 A;  2EKH A;  2RI5 A;  1M1K U;  4LN2 A;  4RMO A;  1C1A A;  3FDR A;  4CC7 A;  1YWO A;  4M75 A;  2KI7 A;  5D6X A;  5D6W A;  1GFD A;  1W6X A;  2GFU A;  1GXI E;  1HJD A;  2W10 A;  2R5M A;  4DA4 A;  1VQ6 T;  1VQ6 A;  1XJW B;  4M7D C;  2K3Y A;  1SKU B;  1UGS B;  2AZS A;  4AFZ C;  3FLG A;  5LJ5 g;  4QT7 A;  3CCS A;  2HDA A;  1OQK A;  2VWF A;  4FYY B;  4OMN A;  2RA2 A;  2IVW A;  4OMQ A;  1RAI B;  1YN8 A;  1UJY A;  2V26 A;  1YFN A;  2EQK A;  2Y4Y A;  2CDT A;  3EGD A;  3V7S A;  2E4H A;  1X6G A;  2HEQ A;  1RAE B;  4M7A B;  4XTZ A;  1VQP T;  5GMK e;  4LDX A;  5GAN h;  1G3W A;  2YUO A;  1YWP A;  4C5E A;  1VQL T;  1VA7 A;  4MML A;  1VQL A;  3JCM e;  2ROL A;  2BUD A;  3M0T A;  2CYZ B;  2F5K A;  2JW4 A;  1WDX A;  4E7Z A;  1AWX A;  2QEX A;  2D0N A;  2QQS A;  3PT9 A;  2MI6 A;  2EVR A;  4M77 E;  2EJ9 A;  3H9N A;  1GCP A;  2JOY A;  4F14 A;  1VQM T;  2K79 A;  1V29 B;  4FT4 A;  2O4X B;  4L59 A;  3OS0 A;  2LNH B;  1M8M A;  3OYB A;  3QWY A;  1M3C A;  2BTT A;  2EQU A;  4A4E A;  4RTW A;  4A4G A;  3GF5 A;  3MEW A;  4M75 D;  5LJ5 d;  4OB3 B;  3THK A;  2CH4 W;  2DVJ A;  2LT4 A;  1KIK A;  2H3E B;  1IXD A;  3OW2 A;  1UHF A;  2QQA A;  2RJC A;  2ZPH B;  3M57 A;  4C0D C;  5CQY A;  1SEM A;  4XTW A;  2ZPB B;  2J7I A;  2YRV A;  4II1 A;  2J6F A;  4AMC A;  3QG1 A;  1SSF A;  4M77 D;  3SWN B;  3EGU A;  4DEY A;  2SEM A;  4FT2 A;  3NMZ C;  1JRI A;  1D3B B;  3WVE B;  5CCA A;  2GNC A;  1N8R C;  3CME T;  4FSX A;  2E6N A;  2CH4 A;  3A1P A;  1K8A R;  2QDL A;  2LCC A;  4C8Q A;  2LTO A;  2KT8 A;  4ZNX A;  3RBB B;  3TEE A;  2CUD A;  3QJY A;  4FM4 B;  5FLX E;  4MZP A;  4J6W A;  5ECA A;  4J9D A;  3OS5 A;  1X27 A;  4HA8 A;  4M7D F;  2ROT A;  2CP0 A;  2CP6 A;  1LJO A;  5CKD A;  2RQT A;  3FEO A;  4EMG A;  4XU3 A;  4JRP A;  1WA7 A;  2YLC A;  3MCA B;  4JLI A;  1PC0 A;  2EYZ A;  3CCM Q;  2VV5 A;  4J9I A;  2HCK A;  1WFW A;  4M7A C;  1D0Z A;  1K0X A;  3RNJ A;  2DFU A;  3NPF A;  4JRK A;  2OTL T;  1RAG B;  2O9V A;  2RQU A;  1WJR A;  2OTL A;  1UJ0 A;  4ATO A;  1WQ7 A;  4C92 C;  2KNB B;  3VUZ A;  2DXT A;  3S6W A;  1OUL A;  2V8J A;  2AZV A;  1JXO A;  1IHV A;  5GAN 8;  1W2B S;  4ZGE B;  2QI2 A;  3A8M B;  2K5I A;  2DTO A;  4J9G A;  4JS4 A;  4R0K A;  4AT1 B;  4F17 A;  1LOJ A;  3C0C A;  2FZC B;  2LJ0 A;  4AFQ C;  4IUQ A;  2F69 A;  4J5Y A;  4E2F B;  1YJW A;  5GAM g;  3UWN A;  3EH2 A;  1D0X A;  3SB2 A;  1QVG S;  5A0G A;  2YSQ A;  4HKE A;  1R0B G;  5FRO A;  5KYN A;  3CCE T;  3CC2 A;  1ARK A;  1I4K 1;  2WSE E;  4EMK A;  4D8D A;  3PNW C;  1Y57 A;  1VQK T;  4NL2 A;  3PIO A;  1VQK A;  2C06 A;  2QTV A;  3S3O A;  1CKA A;  5GAN 4;  3A8L B;  2M51 A;  3KXT A;  5GAN 3;  3TVT A;  1VQN Q;  1WX6 A;  3SWN C;  1GL5 A;  1RAH B;  3QYH B;  2JVV A;  1G8X A;  1YIJ Q;  2YUP A;  1BI2 A;  5GAN e;  1PM3 A;  1U1S A;  4AG2 C;  5IHK A;  2LQK A;  3CCQ T;  1M90 R;  3M59 A;  2E5Q A;  1V76 A;  5LJ5 e;  4M7D G;  2JM9 A;  1IB8 A;  5GAM d;  3X20 B;  2FZK B;  1NG2 A;  1AZE A;  3I56 Q;  2V1R A;  3JB9 J;  2X3X D;  2YT6 A;  2O9S A;  4QVD A;  1Q82 R;  2XMF A;  3OY9 A;  2DZ9 A;  3DB4 A;  1KC8 C;  1K8A U;  1OZ3 A;  4M78 E;  1M9S A;  3RR6 A;  1OU8 A;  3RKX A;  3JB9 H;  1T3L A;  3CXC A;  5HK3 A;  4BD3 A;  2IIM A;  5CKF A;  1ZBJ A;  3OB9 A;  3LWI A;  3PIP A;  4OB2 B;  2DPP B;  1RI0 A;  4M7A F;  2OI3 A;  2K4Y A;  5LJ3 g;  3CCL A;  4PFP A;  1QVF P;  5DY9 A;  2V1Q A;  1KK7 A;  3RES A;  4DQ2 A;  4DBH A;  3OYE A;  1SSH A;  3OW2 S;  2H3J A;  4ZGJ B;  1Q95 G;  1T0H A;  1VQ9 Q;  5GAO n;  4C92 F;  4JJC A;  4PK4 A;  4F7U B;  1K9M R;  4WCI A;  1U8R A;  1YCS B;  4JLG A;  1NM7 A;  3OYH A;  1UTI A;  3PMT A;  5GAN j;  4EDU A;  5GMK i;  4QW2 A;  4BDZ A;  4M78 D;  2SRC A;  3LLR A;  1B34 B;  4OP0 A;  3G71 A;  1UFF A;  1NZ9 A;  3QO3 A;  1D1C A;  3HFN A;  1B7T A;  1VIE A;  3BDL A;  2EPD A;  3G6E T;  3G6E A;  2EBP A;  1WGS A;  4NOY A;  5DLO A;  1Z9Q A;  3JCM f;  3CCU T;  3G4S T;  3VS3 A;  3M55 A;  1UGV A;  1KSW A;  4Z89 A;  5LJ3 d;  1QW1 A;  3EG2 A;  3CCR Q;  3HHT B;  2DX1 A;  2KT1 A;  2PQW A;  3TRE A;  1EFN A;  1M2V B;  1FXX A;  5LL6 S;  1PD0 A;  3H0I A;  5FU7 B;  1TUC A;  1UEC A;  1WHG A;  1WHL A;  1WNL A;  2RQW A;  2KE9 A;  1XQH A;  2OX7 A;  2FHD A;  3CC7 T;  2E5K A;  1X43 A;  2QG9 B;  4D8K A;  1RLQ C;  1I0C A;  1VQ4 T;  1VQ4 A;  3RIR A;  3HRU A;  1VQO T;  4BAC A;  3CMA T;  5GAO q;  1JJ2 S;  2JNG A;  2EQI A;  3HTR A;  1K73 R;  3E9F A;  1TTH B;  3LYI A;  1NYG A;  4PJO B;  1M90 U;  3M0Q A;  4Y28 E;  3S3N A;  2KEA A;  3L2Z A;  3KFV A;  4CRI A;  3I55 Q;  2M0O A;  1VQN A;  5GMK h;  1FMW A;  1QKW A;  4L5G A;  1YJN A;  4M7A G;  3JCM h;  4VUB A;  1H3H A;  2QA4 T;  2PVG B;  1QLY A;  2QA4 A;  2RN8 A;  2DLP A;  4WTO B;  1VQ5 A;  4C92 G;  2YUQ A;  1TOV A;  1S72 Q;  4X9C A;  3PTA A;  4JPB W;  2KYM A;  1H8K A;  2FVU A;  4LDW A;  3VU3 C;  2DIG A;  2XDD A;  2JTM A;  5A0L A;  4F7U E;  2PVD B;  3HL8 A;  4DEX A;  4Z8A A;  2PZ1 A;  4J9C A;  1PCX A;  1M2O A;  5GAM e;  3BE3 A;  2GTO A;  2ZPE B;  3RMQ A;  4E7J A;  3TSZ A;  3OA6 A;  4D6W A;  3V8J A;  4FW2 A;  2DXB A;  3OYN A;  4AFS C;  2KGT A;  1I07 A;  2HD0 A;  1S1N A;  4KH0 B;  1PKT A;  3JCM P;  1A0N B;  2ESW A;  1IGU A;  4B6M A;  1F1B B;  1YJ9 Q;  1VQP Q;  3OQ5 A;  2VUB A;  5FRN A;  2JT4 A;  2PUO B;  3L1A A;  2CKK A;  3X26 B;  4BI8 B;  2EYW A;  2M16 A;  1NJI C;  4M75 B;  3A98 A;  4JRQ A;  4J9F A;  5D7U A;  2HL3 A;  1EIF A;  1Q86 U;  1QWE A;  2RM4 A;  1T3S A;  2IPO B;  1VUB A;  1Q7Y C;  5KYX A;  2GFA A;  4IIM A;  1TXQ A;  5GAO r;  2Y90 A;  5FU7 C;  3MEU A;  2XID A;  3OYC A;  1H92 A;  1G3Y A;  2FG0 A;  4Y91 A;  2COY A;  1KD1 U;  1AWJ A;  3EGD B;  5IH2 A;  1YNZ A;  4P5N A;  3HP9 A;  4ZTF A;  4F04 B;  1M5Q 1;  2M0Y A;  4PJO C;  1OU9 A;  2FPE A;  1PSE A;  3M0P A;  2RHX A;  3OSS C;  1UDL A;  4N4H A;  4BUG A;  1YI2 T;  2KVQ G;  1RL2 A;  2VGM A;  5LJ3 e;  1ZX6 A;  4RTU A;  1OZ2 A;  2EGC A;  4E47 A;  5CIU A;  2CS7 A;  1AVZ C;  1NPR A;  1YHQ Q;  5GAN f;  4JJN K;  3M5A A;  3JCM X;  3CBO A;  2X35 A;  1JB0 E;  3VS7 A;  3UA7 A;  2A7Y A;  4J7I A;  3G1J A;  3CME Q;  2CSQ A;  1O9S A;  1N8R R;  4OB0 B;  3JCM c;  3OBY A;  1QVG A;  3QII A;  4FYW B;  2XDP A;  3M58 A;  2MPX C;  2X4Y A;  1CSK A;  2EAY A;  1RLP C;  1K9A A;  3HSB A;  4PL6 A;  3LX7 A;  4M7D A;  1ZLM A;  4HCB A;  2LDM A;  1X69 A;  1PD1 A;  4NS5 A;  4BDY A;  2RHI A;  1G2B A;  4XU1 A;  1M1K C;  2CRE A;  4LUD A;  3LWH A;  2BZ8 A;  3REA B;  1VQ7 T;  4BI4 A;  1VQ7 A;  2JMA A;  1QP3 A;  3CCS T;  1TS9 A;  1ZUK A;  4M75 E;  4E7I A;  3HKS A;  3I5R A;  2GBQ A;  4C0F A;  1E7O A;  1YP5 A;  2DRM A;  4C0Z A;  3ZL7 C;  1IRX A;  1MUZ A;  2O31 A;  2V8I A;  3CPW S;  2QK0 A;  3OSV A;  5CQX A;  2EJG A;  1HD3 A;  4KBM B;  2PU9 B;  2BZX A;  3PVL A;  4ANJ A;  5LJ5 h;  4E7S A;  3GP8 A;  5HY6 A;  2YHT A;  1RI9 A;  4FSS A;  4OF1 A;  1ZSZ C;  1W2B P;  2QEX T;  1LVK A;  2DBK A;  3M0R A;  2FPF A;  4AG1 C;  1LCK A;  2DD5 A;  2K2M A;  1YIT Q;  3DLM A;  4IIO A;  4Z88 A;  4M4Z A;  2CGH A;  3CCV A;  4M77 C;  1D1B A;  2KXC A;  3C95 A;  1I81 A;  4CI0 C;  4OMF B;  1ZSG A;  4MZM A;  2EGA A;  3CCE Q;  2F2X A;  2R5A A;  2OAW A;  4N0A A;  1WXT A;  1FX7 A;  4J6X A;  2P0P A;  2D0Q B;  2FB7 A;  3MP6 A;  4J8O A;  4JZ4 A;  5DM7 R;  2RJD A;  4KGV B;  3CC4 Q;  3UAT A;  1OI1 A;  5GMK j;  1Q81 U;  2MCN A;  3X25 B;  3MEV A;  2D6F A;  2QQ9 A;  3EH1 A;  2MWP A;  4QQ6 A;  1T0J A;  3CCQ Q;  2MIO A;  1N27 A;  1Y71 A;  1RAB B;  5CAI A;  2CUB A;  2DL3 A;  5KYY A;  2E41 A;  3VKI A;  1W4S A;  4PNO A;  1BI0 A;  2B8A A;  3EG3 A;  2X51 A;  2PNI A;  3CCJ Q;  3I35 A;  3EGX A;  4BB7 A;  4CC3 A;  1KC8 R;  1U1T A;  3QSU A;  1UB4 A;  5KYU A;  1B07 A;  4EMK B;  2QQR A;  3MP8 A;  1PWT A;  4O6J A;  3M53 A;  2OTJ Q;  2FRW A;  2LVM A;  3DKM A;  1ACM B;  2RHU A;  4QQG A;  2KY9 A;  2BIV A;  2GTJ A;  2Z0W A;  3V7R A;  4M78 B;  2HNI A;  4C8Q E;  3DLL A;  1TG0 A;  1B3Q A;  2CP5 A;  2MMP A;  2J06 A;  2L3Q A;  2F2W A;  3ASK A;  5AT1 B;  3SDZ A;  3GIB A;  2P4R A;  1M1G A;  1IZ6 A;  4IUR A;  2JXB A;  4J9E A;  4C92 A;  1JJ2 A;  3OS2 A;  2AIR B;  2DL4 A;  4BE0 A;  2HSP A;  3OW2 P;  4A4F A;  4R56 A;  2X3W D;  1H3Z A;  2DA9 A;  3L2R A;  5EC7 A;  1QMC A;  3M4G A;  4ELY C;  3L2V A;  2EJF A;  3A5Z B;  1D0Y A;  3FRN A;  2D8J A;  2HMA A;  3FJ5 A;  4XTX A;  2DTI A;  4PJO G;  5A0D A;  4N4I A;  4LE9 A;  2R57 A;  4PJL A;  3JSC A;  3HPW A;  5GAO l;  1BI1 A;  2NYS A;  1OV3 A;  2NUP A;  4M77 F;  2P4T A;  2LX7 A;  1YJW T;  4C8Q D;  3G4S Q;  4B9W A;  5IXB A;  1WLP B;  2DL5 A;  2PTK A;  1SHF A;  1MV0 B;  4J9H A;  2VXE A;  1G5V A;  2K7A A;  4EMH A;  3L2Q A;  2L5Q A;  4HCZ A;  4YTL A;  1KQS A;  1KG1 A;  2YRD A;  4XU2 A;  3CC2 T;  5CO7 A;  1NLO C;  1JXM A;  1XOV A;  2K57 A;  4PJM A;  3SWN A;  5GAM h;  5KE2 A;  4J83 A;  4X1V A;  1QCN A;  2HQX A;  3S3M A;  2RHY A;  4R55 A;  4UC4 A;  3VRZ A;  3JCM Q;  3VS6 A;  4A53 A;  1VYU A;  4QKU A;  3CC7 Q;  4E7L A;  4C92 D;  2FRY A;  1QWF A;  1BK2 A;  3OYG A;  2DO3 A;  3JB9 D;  2RMO A;  3SFM A;  1VQO Q;  4HT9 A;  3VJP A;  3QPH A;  1VOM A;  1RAD B;  4C5H A;  4BE1 A;  2BE9 B;  1QKX A;  2ED0 A;  3RKW A;  1CKB A;  1WPY A;  1WJS A;  3REB B;  2BKD N;  4KRT A;  1KQ2 A;  3C94 A;  1IGQ A;  3JV3 A;  1JO8 A;  4EMK C;  1GBR A;  2XKO C;  3IQL A;  2DVE A;  2KMT A;  2NUT A;  1X01 A;  4KUD K;  5C0M A;  4OMM A;  4HT8 A;  4KH1 B;  1KC8 U;  2EYX A;  1UGQ B;  2A36 A;  1K76 A;  3TU4 K;  1M1F A;  4M78 C;  3CD6 Q;  2YUN A;  4IUV A;  4E6R A;  1OOT A;  3KUF A;  1KHI A;  4CC4 B;  4F16 A;  2EKO A;  2MAM A;  2DK3 A;  1HK9 A;  3CCL T;  2RJF A;  3I9Q A;  2KYB A;  5M9O A;  1UUE A;  4LDU A;  4XTU A;  2CT3 A;  2EFI A;  4DBQ A;  4M77 G;  2KR3 A;  3QWX X;  1Y96 B;  1U06 A;  4HXJ A;  2K3X A;  1IRE B;  2AK5 A;  2YWW A;  5LJ3 h;  3CCM A;  3G71 T;  3RER A;  5LJ5 j;  2DF6 A;  3URG A;  1OPL A;  4A4K A;  3M0S A;  4LDY A;  1X6O A;  2FYK A;  3M56 A;  5I2M A;  3ZEH A;  3QBY A;  2LJ3 A;  2JTE A;  3ZFJ A;  1LPL A;  2C0T A;  1NJI R;  2CZ6 B;  4FYX B;  3EHR A;  3WVD B;  1NYF A;  3H0H A;  5CR2 A;  4OMO A;  3MPU B;  2JUF A;  3FIF A;  1NBE B;  1E6H A;  2XD0 A;  4HVU A;  1Q7Y R;  3P8H A;  3E2U A;  5I21 A;  1M27 C;  1BB9 A;  4QVZ A;  1VQ8 Q;  3VS2 A;  3LGL A;  1Y07 A;  2L2P A;  2OJ2 A;  1KHC A;  2LC4 A;  4JUV A;  3CXC P;  4KUI A;  2EQM A;  3E9G A;  2DXC A;  3VUB A;  3JAM E;  4RG2 A;  3OYA A;  5GAO m;  3UF4 A;  3UA6 A;  5FU6 B;  2HL5 C;  4OMP A;  4FYV B;  1WHH A;  1WXB A;  1MMN A;  1YI2 Q;  1QVP A;  4O5V A;  3BDU A;  3CPW A;  4XU0 A;  3QKJ A;  1AWW A;  5C6S A;  1VQN T;  5KYX B;  2DBM A;  1I5O B;  2NUZ A;  1YJN T;  5KH6 A;  3JCM g;  4QVC A;  1YIJ A;  2RO0 A;  5CK9 A;  3VV0 A;  1Q82 U;  3O8V A;  2RD1 A;  3UPU A;  2DD4 A;  2KAF A;  4M78 F;  2DKG A;  2CZ0 B;  1VQ5 T;  3A8O B;  2KRM A;  2M9U A;  1PRL C;  1P92 A;  1Y0M A;  3L42 A;  3I56 A;  4Y92 A;  2HQE A;  6AT1 B;  1BBZ A;  1VIF A;  4ELZ C;  4ZN1 A;  5D6Y A;  4HCK A;  2M1H A;  3KBG A;  2HBP A;  2LNV A;  2JS0 A;  1KQS S;  1BIA A;  4KT0 E;  3M4Y A;  4OVA A;  3LH0 A;  1M1K R;  5FRM A;  1VQ6 Q;  2ZAE A;  1K0S A;  1K9M U;  2VVK A;  1UG1 A;  4LNP A;  3JCM d;  4LUE A;  2COW A;  3OYM A;  1N9R A;  1VQ9 A;  4LXC A;  1W70 A;  5DLQ E;  1MND A;  2EIF A;  4EPC A;  4ZGD B;  1VQL Q;  4KGX B;  4RCB A;  3NHN A;  3OYJ A;  2HAX A;  2E70 A;  3D7S B;  1FMV A;  5L23 A;  2QEX Q;  1GCQ C;  2QXF A;  3EHQ A;  1VYV A;  4ZTJ A;  3C12 A;  3HRS A;  1VQM Q;  4MDX A;  1G3T A;  1I1J A;  4RUG A;  3EG9 A;  1SRL A;  1ABQ A;  2LZ6 B;  4A63 B;  5FU6 C;  1Q86 C;  5GAM j;  4C5I A;  3RMS A;  1UE9 A;  2L8D A;  3NFC A;  2P0K A;  3CCR T;  3CCR A;  2GF7 A;  4M78 G;  2AT1 B;  4BY6 B;  2IG0 A;  3EFO A;  3TCJ A;  1KD1 C;  2XI9 A;  1X2K A;  3SD4 A;  2A0F B;  1EX4 A;  1K73 U;  2CT4 A;  1MHN A;  3MEA A;  1PKS A;  2AKL A;  2F5T X;  2FO0 A;  2KQW A;  2VYT A;  3AT1 B;  2NWM A;  4OGE A;  1ZHI A;  3GLX A;  1HXD A;  1JU5 C;  1N5Z A;  1OYX A;  4XTV A;  5GAN 5;  1SG5 A;  3OYY A;  5LJ5 f;  5KYW A;  1ZBX A;  3J81 E;  1OPK A;  3I55 A;  4Z02 A;  2RQV A;  1JEG A;  4RCC A;  4F7U F;  4PLL A;  2L0A A;  1AOJ A;  5AYF A;  2DYB A;  2QAZ A;  2O88 A;  2ZPI B;  2M02 A;  2DIQ A;  2DZC A;  2NLU A;  3GOX A;  1S72 A;  3JCM V;  3QDF A;  2F1L A;  2VGN A;  4PLI A;  5A2Q E;  3QZ9 B;  4J9B A;  1BCM A;  1AWO A;  1KJW A;  2LCS A;  2JTF A;  1PSF A;  1RUW A;  2BZY A;  4RTT A;  4J7F A;  4E7H A;  4M7D E;  1R0C B;  5KYY B;  1BIB A;  5LJ3 j;  4RG8 A;  1D09 B;  1HYO A;  5IXF A;  2OTL Q;  5GAN g;  3NTI A;  2E64 A;  3TQ7 P;  3EGX B;  2MK5 A;  4C8Q B;  4M75 C;  5KYU B;  2CP7 A;  1ZSZ A;  2ED1 A;  2HKQ B;  1FMK A;  4IUP A;  2EQJ A;  2VAS A;  4FL6 A;  4GY5 A;  2MF2 A;  4FW1 A;  3GNG A;  1M30 A;  2AKK A;  2L3S A;  1BI3 A;  1K1Z A;  4M77 A;  2GCX A;  1YJ9 T;  3OS1 A;  1VQP A;  1YJ9 A;  2DEU A;  1DJ7 B;  4FCY A;  2EYY A;  2G3R A;  3LH5 A;  1YJW Q;  5GAN 7;  2FZG B;  3CCV T;  3A8G B;  2WAC A;  2KRN A;  4C92 B;  2DAQ A;  2DYI A;  2KBT A;  3X28 B;  2I0N A;  3OMC A;  1UGP B;  4PJO F;  2HBW A;  3MP1 A;  3PVQ A;  4BY6 C;  4M7D D;  1QVG P;  2EGE A;  4FIB A;  2KRO A;  2ZPF B;  2R58 A;  1NE8 A;  2XK0 A;  4XTY A;  1VQM A;  3CC2 Q;  2PUK B;  4IUU A;  5FWB A;  1UEB A;  2COZ A;  2X9H A;  2O2O A;  5GAN d;  1VQK Q;  3EG1 A;  5IN1 A;  3LGF A;  1WYX A;  3H6Z A;  3E19 A;  1K4U S;  3FB9 A;  4XK8 E;  4DOV A;  1UHC A;  2NUP B;  2H8H A;  2JMC A;  4A4H A;  4HVV A;  5CKH A;  1RAC B;  4F7U G;  2K5F A;  1GBQ A;  3UDC A;  4HCC A;  2RI2 A;  3A8H B;  1U3O A;  3QHS A;  2CP2 A;  4RTZ A;  1MGQ A;  1RAF B;  2RPN A;  1FWZ A;  1GFC A;  4XQ3 A;  4N0A C;  1NEB A;  3EAE A;  1AZG B;  1Q81 C;  4N4G A;  3ME9 A;  1N8R U;  3MHX A;  1R77 A;  2ZZD A;  3Q1J A;  1YHQ T;  1YHQ A;  1AD5 A;  2EWN A;  4PFO A;  1EZZ B;  3E1S A;  5FWC A;  5GMK l;  2J6K A;  2ZPG B;  3NGP A;  1X2Q A;  1WXU A;  2F2V A;  2QTX A;  3CME A;  3M54 A;  5HCK A;  2VKN A;  2GQV A;  4M7A A;  2L3P A;  2DL8 A;  4BI3 A;  2LRQ A;  3CCL Q;  4ME7 A;  1WJQ A;  2DMO A;  2CP3 A;  2X4X A;  3H8Z A;  2KDS A;  4LD6 A;  2FL7 A;  2HSE B;  2K5L A;  2P84 A;  4E7K A;  5CKE A;  4C8Q C;  3V8K A;  4M75 F;  5GAM f;  5GAO p;  1TUG B;  2NUT B;  4GLM A;  4M7A E;  1XNI A;  3C4S A;  3J7A F;  2JS2 A;  3LW5 E;  3BY7 A;  2O4X A;  3QJ6 A;  2HKN A;  3G71 Q;  4C92 E;  2LQW A;  2RI3 A;  5IHN A;  3FJP A;  2AHJ B;  2FEI A;  1QQJ A;  2RHZ A;  4TVR A;  1MNE A;  1Y7X A;  2A37 A;  3RKY A;  3G6E Q;  2DL7 A;  4IKF A;  4MMK A;  3CCU Q;  2X4J A;  3MJX A;  2QYZ A;  2RB6 A;  2E6Z A;  2ECZ A;  1OX9 A;  2L3R A;  2D1X A;  1ZUU A;  2VC8 A;  2KXD A;  1LNX A;  1YIT T;  3GNF B;  3V7C A;  1YIT A;  2CZ1 B;  1PRM C;  3QDR B;  2DET A;  5I2S A;  3H41 A;  4M7A D;  5I22 A;  1QCF A;  5GJV B;  1M3B A;  1QVF A;  4CC2 A;  1V1C A;  2EYQ A;  4OML A;  5J3B A;  1ZA1 B;  3L2W A;  1E6G A;  1D3B A;  4KGZ B;  2QGF B;  1VQ4 Q;  3VS0 A;  3PMI A;  1QCO A;  2RK2 A;  3CCE A;  5CVI A;  3CMA Q;  2QAS A;  3CPF A;  4DBR A;  1VYT A;  3MO8 A;  1JQQ A;  2KRS A;  3MET A;  1JJ2 P;  1N6A A;  2QQB A;  3PFS A;  4RTV A;  4C5G A;  2E65 A;  1KFZ A;  1BKB A;  3G7Z A;  5LJ3 f;  4GLK A;  2QDY B;  1YJN Q;  2JZ2 A;  2RQR A;  3CC4 T;  3CC4 A;  2WSC E;  4WF2 A;  5J39 A;  2MOX A;  3P8D A;  3VS4 A;  2RNA A;  5KCH A;  4M78 A;  2QA4 Q;  2RJE A;  1SPK A;  3OYL A;  2VB6 A;  4PFZ A;  3CCQ A;  1IO6 A;  1VQ5 Q;  2YRC A;  3BFM A;  2LQN A;  4M75 G;  2RF0 A;  2FPD A;  4J6Y A;  2CSI A;  1OX8 A;  1MMD A;  4QQD A;  1I8F A;  2OAU A;  4BE2 A;  1GRI A;  5CKB A;  1K8A C;  3CCJ T;  3CCJ A;  2D9T A;  4C8Q F;  3X24 B;  1WQW A;  3VS5 A;  4RKU E;  1TSF A;  1AT1 B;  2XIC A;  2DE0 X;  1TUD A;  3NTK A;  3SEM A;  3OYI A;  4JDS A;  5IAY A;  2OTJ T;  2OTJ A;  3CQT A;  1Z9Z A;  3NTH A;  2JN0 A;  4PKC C;  1NEG A;  3R6N A;  4RTX A;  4LD9 K;  1KQS P;  1M4Z A;  5IT9 E;  2WSF E;  2DNU A;  2E3I A;  1G3S A;  2CZ7 B;  4Q5W A;  4XAX B;  3OYD A;  2HQH A;  2XHC A;  1BCO A;  3PE0 A;  3VS1 A;  1FYN A;  5GMK m;  3CCM T;  1H64 1;  2DRK A;  2QGG A;  2E3H A;  1M8V A;  3QZ5 B;  3L2U A;  4MDW A;  3JB9 F;  4V2S A;  3O5Z A;  4X34 A;  4ORZ A;  4PJN A;  2L89 A;  3AHU A;  4AFU C;  5GJW B;  3V8L A;  1WZO A;  3UT1 A;  2JM8 A;  2YXY A;  1AEY A;  3FC3 A;  1YCY A;  2JJ9 A;  3JCM W;  3QXE B;  2K3B A;  1BYM A;  1HSQ A;  3VYH B;  3TSW A;  5L8R E;  3R6O A;  4DBF A;  4RTY A;  2E1H A;  1C6V X;  3CCU A;  3G4S A;  3JRZ A;  2RK1 A;  1MMA A;  4B9X A;  1Q86 R;  1ZQ1 A;  2G6F X;  2K9G A;  5IHI A;  4GBQ A;  2DEQ A;  2ZGW A;  3QUI A;  3I5S A;  3M9Q A;  2LQ8 A;  5KCO A;  4OB1 B;  2VXF A;  1KD1 R;  3WXM B;  2A28 A;  2LMJ A;  3EFR A;  5J26 A;  4OGC A;  3JCM b;  3INZ A;  1X6B A;  3CC7 A;  1NPP A;  3CBM A;  4FU6 A;  2DM1 A;  1YIJ T;  3EG9 B;  4C8Q G;  1VQO A;  3CMA A;  3M0U A;  4JJB A;  4C0G A;  3H0F A;  3QYG B;  1M90 C;  2X4W A;  3OYF A;  1WIE A;  3RUX A;  3U23 A;  3EFS A;  1TWB A;  1RAA B;  5EG2 A;  2C0O A;  2V8K A;  1JBM A;  3BW1 A;  1UGR B;  2LX9 A;  3VYG A;  1WI7 A;  2XU8 A;  3I56 T;  3N5B B;  4F7U A;  4MZT A;  2P0Q A;  4IUT A;  1Q82 C;  1Y96 A;  3MKD A;  3EFO B;  2J05 A;  1SF9 A;  5HK0 A;  2BE7 D;  3CEY A;  4JZ3 A;  5FW9 A;  2Y4X A;  1M3A A;  1B34 A;  8AT1 B;  3JB9 G;  1IHW A;  2YDL A;  4L6V 5;  1ZUY A;  1C0M A;  3CD6 T;  4JS5 A;  3CD6 A;  1G83 A;  2O01 E;  2MWO A;  2E12 A;  1VQ7 Q;  1QVF S;  3CCS Q;  8ATC B;  1I5L A;  2A3L A;  3DB3 A;  1ZA2 B;  1WHM A;  4X9D A;  1BU1 A;  5KYW B;  1PNJ A;  1VQ9 T;  1OEB A;  2ENM A;  1KQ1 A;  1K9M C;  2DER A;  3VRY A;  1XTD A;  1X75 C;  1R8O B;  3OBW A;  2LP5 A;  1GCQ A;  1MV3 A;  2A08 A;  3CPW P;  3ZBD A;  1O75 A;  1ABO A;  2LJ1 A;  4M7D B;  1NJI U;  4DOW A;  2J6O A;  1M2V A;  3HFO A;  3ULR B;  1WHK A;  2RH2 A;  2PVO B;  2E10 A;  1TH7 A;  1TU0 B;  4EIK A;  2D8H A;  3JCM J;  1Q7Y U;  3GBQ A;  1N9S A;  3GPL A;  3CCV Q;  4HVW A;  2W0Z A;  3HRT A;  4KUL A;  1W1F A;  1AHJ B;  1SRM A;  3PGG A;  4PJO A;  2K2V A;  2KSS A;  2GGR A;  2C0I A;  2DJZ A;  4PJJ A;  2HZY A;  3F70 A;  2GQI A;  2DIL A;  1ZSZ B;  1VQ8 T;  2K6D A;  1VQ8 A;  5GAN 2;  9ATC B;  2KK4 A;  3CXC S;  4A54 A;  4ZN3 A;  4LDV A;  1SHG A;  1PG5 B;  4JRI A;  3SHW A;  4PJO E;  2LCL A;  4NL3 A;  3T9N A;  2ZCF B;  4M77 B; 
#chains in the Genus database with same CATH homology
 2FRY A;  1UHC A;  2E5K A;  1QWF A;  1X43 A;  2H8H A;  2JMC A;  4D8K A;  1BK2 A;  1RLQ C;  1I0C A;  4HVV A;  2RMO A;  1GBQ A;  1U5S A;  2ABL A;  1U3O A;  2EQI A;  1QKX A;  2ED0 A;  4RTZ A;  1NYG A;  1J3T A;  2RPN A;  3M0Q A;  1GFC A;  1CKB A;  2KEA A;  3REB B;  3KFV A;  4KRT A;  1NEB A;  3JV3 A;  2EW3 A;  1JO8 A;  1PHT A;  1AZG B;  1GBR A;  1QKW A;  4ESR A;  3IQL A;  4K11 A;  2DJQ A;  5I11 A;  1AD5 A;  4OMM A;  1H3H A;  1QLY A;  3EG0 A;  2RN8 A;  2EYX A;  2DLP A;  5FWC A;  4JJD A;  2A36 A;  1K76 A;  2J6K A;  2YUQ A;  3NGP A;  1X2Q A;  1WXU A;  1NLP C;  4JPB W;  2F2V A;  5HCK A;  2KYM A;  1H8K A;  2B86 A;  2EKH A;  2VKN A;  2YUN A;  4E6R A;  1OOT A;  2L3P A;  4LN2 A;  2DL8 A;  4CC4 B;  4DEX A;  4F16 A;  4CC7 A;  4Z8A A;  2DMO A;  2PZ1 A;  4J9C A;  1YWO A;  2RQW A;  3I9Q A;  2KYB A;  2GTO A;  1GFD A;  1UUE A;  3TSZ A;  1W6X A;  2CT3 A;  1HJD A;  2KR3 A;  2W10 A;  3QWX X;  4GLM A;  1U06 A;  2JS2 A;  4HXJ A;  2AK5 A;  2AZS A;  4AFZ C;  4AFS C;  2KGT A;  4QT7 A;  1I07 A;  2HDA A;  2VWF A;  1S1N A;  4OMN A;  4OMQ A;  1YN8 A;  1PKT A;  1UJY A;  2LQW A;  2DF6 A;  1OPL A;  2CDT A;  5IHN A;  1A0N B;  2ESW A;  3M0S A;  2FEI A;  1X6G A;  2HEQ A;  2JT4 A;  2A37 A;  2YUO A;  2LJ3 A;  1YWP A;  2JTE A;  1VA7 A;  2DL7 A;  2EYW A;  2ROL A;  2C0T A;  3M0T A;  3A98 A;  4J9F A;  2ECZ A;  2JW4 A;  1WDX A;  3EHR A;  1NYF A;  3H0H A;  2D1X A;  4OMO A;  1AWX A;  1ZUU A;  1QWE A;  2D0N A;  1T3S A;  1E6H A;  4HVU A;  2EVR A;  2KXD A;  1M27 C;  1BB9 A;  3VS2 A;  4IIM A;  1GCP A;  4F14 A;  2K79 A;  1PRM C;  3H41 A;  2L2P A;  1M8M A;  2LNH B;  2OJ2 A;  5I22 A;  3QWY A;  1M3C A;  2BTT A;  1H92 A;  1QCF A;  2FG0 A;  4RTW A;  1M3B A;  5GJV B;  4CC2 A;  1V1C A;  1AWJ A;  4OML A;  5IH2 A;  1E6G A;  1YNZ A;  3UF4 A;  3THK A;  3UA6 A;  2CH4 W;  2DVJ A;  1KIK A;  3VS0 A;  2M0Y A;  4OMP A;  1UHF A;  1VYT A;  1WXB A;  1JQQ A;  2FPE A;  2KRS A;  3M0P A;  1UDL A;  1SEM A;  4RTV A;  1KFZ A;  1ZX6 A;  4RTU A;  2EGC A;  1AWW A;  2J7I A;  2DBM A;  2NUZ A;  2RQR A;  2J6F A;  2MOX A;  1AVZ C;  3VS4 A;  2RNA A;  1SPK A;  1IO6 A;  3EGU A;  4DEY A;  2LQN A;  2SEM A;  2RF0 A;  3VS7 A;  2FPD A;  3NMZ C;  2KRM A;  3UA7 A;  1PRL C;  2CSI A;  2CSQ A;  2GNC A;  1Y0M A;  1GRI A;  2CH4 A;  2QDL A;  4Y92 A;  2KT8 A;  1BBZ A;  4ZNX A;  3RBB B;  2CUD A;  4HCK A;  3VS5 A;  1CSK A;  3SEM A;  2DE0 X;  1TUD A;  5ECA A;  1RLP C;  1K9A A;  3CQT A;  4J9D A;  1Z9Z A;  1X27 A;  1NEG A;  1ZLM A;  2JS0 A;  3R6N A;  1X69 A;  4RTX A;  2ROT A;  1G2B A;  2DNU A;  2CRE A;  4LUD A;  2RQT A;  1K0S A;  2BZ8 A;  3REA B;  1WA7 A;  3PE0 A;  2JMA A;  3VS1 A;  1FYN A;  2VVK A;  1UG1 A;  2EYZ A;  4LNP A;  4J9I A;  2HCK A;  1ZUK A;  4LUE A;  1WFW A;  2DRK A;  1K0X A;  3RNJ A;  3I5R A;  3NPF A;  2GBQ A;  1E7O A;  1YP5 A;  1W70 A;  2DRM A;  3O5Z A;  2O9V A;  2RQU A;  3ZL7 C;  4ORZ A;  1UJ0 A;  4AFU C;  1MUZ A;  2O31 A;  5GJW B;  2KNB B;  3NHN A;  1HD3 A;  2AZV A;  1JXO A;  2BZX A;  3PVL A;  2JM8 A;  1AEY A;  4FSS A;  1RI9 A;  5L23 A;  1GCQ C;  2DBK A;  3M0R A;  2FPF A;  3EHQ A;  1VYV A;  2K3B A;  4AG1 C;  1LCK A;  4J9G A;  1HSQ A;  2K2M A;  4R0K A;  4F17 A;  1I1J A;  4RUG A;  3C0C A;  2LJ0 A;  3TSW A;  4AFQ C;  4IIO A;  4Z88 A;  4M4Z A;  1SRL A;  4RTY A;  1ABQ A;  2LZ6 B;  4A63 B;  2KXC A;  2G6F X;  2K9G A;  2YSQ A;  5IHI A;  4GBQ A;  1UE9 A;  1ZSG A;  2EGA A;  3I5S A;  2F2X A;  2OAW A;  1ARK A;  1WXT A;  4D8D A;  1Y57 A;  1X2K A;  2A28 A;  2LMJ A;  1CKA A;  2CT4 A;  2M51 A;  4JZ4 A;  3TVT A;  1WX6 A;  1X6B A;  1PKS A;  1GL5 A;  2AKL A;  2FO0 A;  3UAT A;  2YUP A;  2DM1 A;  2NWM A;  2MCN A;  3M0U A;  4JJB A;  4AG2 C;  1T0J A;  5IHK A;  3H0F A;  2MIO A;  1WIE A;  3U23 A;  1JU5 C;  1N5Z A;  2JM9 A;  2CUB A;  2DL3 A;  2C0O A;  1OPK A;  3EG3 A;  1WI7 A;  2RQV A;  1NG2 A;  1JEG A;  1AZE A;  2PNI A;  2V1R A;  3I35 A;  2X3X D;  2YT6 A;  2O9S A;  2XMF A;  4CC3 A;  2J05 A;  1B07 A;  1PWT A;  2L0A A;  1AOJ A;  2DYB A;  2O88 A;  1T3L A;  4JZ3 A;  2FRW A;  5FW9 A;  2IIM A;  1M3A A;  1ZBJ A;  2GTJ A;  2YDL A;  1ZUY A;  1G83 A;  4J9B A;  1AWO A;  1KJW A;  1TG0 A;  1B3Q A;  2OI3 A;  2J06 A;  2L3Q A;  2LCS A;  2F2W A;  2P4R A;  2V1Q A;  1RUW A;  2BZY A;  4RTT A;  2JXB A;  1BU1 A;  4J9E A;  1SSH A;  1PNJ A;  1T0H A;  2DL4 A;  5IXF A;  4JJC A;  1OEB A;  2HSP A;  2X3W D;  2ENM A;  4WCI A;  3VRY A;  1YCS B;  2DA9 A;  1NM7 A;  5EC7 A;  1UTI A;  2LP5 A;  2ED1 A;  1GCQ A;  1MV3 A;  2A08 A;  1FMK A;  1ABO A;  2LJ1 A;  2D8J A;  2SRC A;  2J6O A;  1M30 A;  3FJ5 A;  2AKK A;  3ULR B;  2L3S A;  1UFF A;  4LE9 A;  1K1Z A;  4EIK A;  2D8H A;  1OV3 A;  2EYY A;  2EPD A;  3GBQ A;  3LH5 A;  2EBP A;  2LX7 A;  4HVW A;  2W0Z A;  1Z9Q A;  5IXB A;  1WLP B;  2DL5 A;  1W1F A;  1SHF A;  2KRN A;  2PTK A;  3VS3 A;  1MV0 B;  1SRM A;  4J9H A;  1UGV A;  2KBT A;  2GGR A;  2I0N A;  2C0I A;  1KSW A;  2HBW A;  2K7A A;  3PVQ A;  4Z89 A;  2EGE A;  2KRO A;  2GQI A;  2DIL A;  2K6D A;  3EG2 A;  2DX1 A;  2KT1 A;  1NLO C;  5FWB A;  1JXM A;  1XOV A;  2O2O A;  1EFN A;  3EG1 A;  1SHG A;  4X1V A;  1WYX A;  3SHW A;  3H0I A;  1K4U S;  3VRZ A;  1TUC A;  1UEC A;  3VS6 A;  1VYU A;  2KE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...