1BK2A

A-spectrin sh3 domain d48g mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNGRQGFVPAAYVKKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A-SPECTRIN
publication title Obligatory steps in protein folding and the conformational diversity of the transition state.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Sh3-domain
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1bk2A00
4HVUA 3M0SA 2G6FX 4OMQA 1H92A 1W70A 1M3AA 2L3QA 1NM7A 2JM9A 4Z88A 1BBZA 3U23A 2P4RA 2K3BA 3KFVA 3VS5A 2BZXA 4CC3A 4EIKA 4RUGA 4Z89A 2DRMA 3I9QA 4CC2A 1HJDA 4AFQC 2NWMA 2RQTA 2EYXA 2KR3A 3EGUA 1M8MA 1HD3A 1UG1A 2FPDA 2J7IA 4RTVA 1GBQA 1TG0A 2JXBA 3FJ5A 4JPBW 2EYWA 1YP5A 4WCIA 5L23A 1UFFA 1OV3A 2F2XA 2K7AA 1CSKA 1ZUYA 2CUDA 1WA7A 2ABLA 1HSQA 2DL4A 1WX6A 1NLPC 3CQTA 2X3WD 4X1VA 3EG1A 4LN2A 2HDAA 2OI3A 2LQNA 1CKAA 2FG0A 1JXMA 2RQRA 1U5SA 2F2VA 2YT6A 2MCNA 2CREA 2ECZA 4JJCA 3NMZC 1M3CA 5IXBA 1OPKA 2YUQA 1Z9QA 1ZUKA 3H41A 3I5RA 1JU5C 4J9BA 2DJQA 4RTTA 3SEMA 1Y0MA 3VS7A 2FPFA 2J6FA 2AZVA 2GNCA 5FW9A 2DM1A 5HCKA 1JXOA 2ESWA 4A63B 3M0PA 1A0NB 4FSSA 1T0JA 4J9DA 4JZ3A 2PTKA 4OMPA 3I35A 1QKXA 1GCQC 2DX1A 2XMFA 2YUNA 3PVQA 2NUZA 2ENMA 4J9IA 1UJ0A 2VWFA 1K0SA 2BZYA 1SHFA 2CSQA 5ECAA 1E7OA 1V1CA 2JMAA 2CUBA 2KYMA 1ZLMA 5IHNA 2ED0A 3EG0A 1AVZC 3THKA 1J3TA 3QWYA 2ROLA 2JS2A 4JJDA 2DBKA 5EC7A 4LNPA 1AWXA 1VA7A 5FWCA 1W1FA 1UHCA 2KE9A 4OMMA 2DMOA 2DL5A 2EVRA 2QDLA 2J6OA 3EHRA 1NYFA 5I22A 4JJBA 1NLOC 3PVLA 2PNIA 2GTJA 1GFCA 1MUZA 2CDTA 2LNHB 3TSZA 2RQWA 1QWEA 2CSIA 1YNZA 2DF6A 2CH4W 2EBPA 2HCKA 2AZSA 2EPDA 2FRYA 4F17A 2I0NA 3C0CA 1AEYA 2H8HA 2ED1A 2O88A 4M4ZA 1SPKA 1ZSGA 1MV3A 2DILA 2FO0A 2A37A 1ARKA 3H0HA 2YDLA 2L3PA 1VYUA 4R0KA 1GRIA 2KXDA 1WXBA 1X2KA 2LZ6B 1UECA 2EYZA 4OMLA 2KROA 2RMOA 2DBMA 1AOJA 1RUWA 2EQIA 1NEBA 4DEXA 1YWOA 1T3LA 1U06A 1N5ZA 4E6RA 1ZX6A 1BB9A 3REBB 2GQIA 3VS6A 1X6GA 1WFWA 2JTEA 2JW4A 2J05A 2DNUA 2KNBB 3IQLA 5GJVB 1GFDA 1IO6A 2J6KA 3VRZA 1VYTA 3VS3A 1E6GA 4IIOA 1NYGA 2LCSA 3VS4A 2MIOA 3VS0A 1CKBA 2SEMA 4OMNA 1K4US 1H3HA 2V1RA 1BU1A 2KBTA 1Y57A 1B3QA 2RF0A 4F16A 2KRNA 2V1QA 2YSQA 1FMKA 2IIMA 1OEBA 1QKWA 4HVVA 2KRSA 2DVJA 2DL7A 1PWTA 4KRTA 2DL3A 1UDLA 1T0HA 2EYYA 1G83A 2GGRA 3EG3A 2LQWA 1ABQA 1WXTA 1RLPC 1I1JA 1YN8A 2RN8A 1MV0B 2HSPA 2KT8A 4GBQA 2CT3A 2AK5A 3H0FA 4F14A 3GBQA 1X2QA 2DLPA 2JM8A 4D8DA 2A28A 3M0TA 1PHTA 2DYBA 3LH5A 2EGEA 2YUPA 1E6HA 2VKNA 1PKSA 5FWBA 1GCPA 2EGAA 4J9HA 1EFNA 4D8KA 1GCQA 4GLMA 1KJWA 2A36A 2LJ3A 3H0IA 3UA7A 4DEYA 2KYBA 2BTTA 2K6DA 1S1NA 4ESRA 4RTZA 1TUDA 1I07A 2LMJA 2HEQA 4HCKA 1X69A 2LJ0A 3TSWA 5IHKA 4LUDA 4J9GA 3A98A 2M0YA 1SSHA 2FRWA 2GBQA 2O2OA 3UF4A 1UUEA 2L0AA 2M51A 1YCSB 1PRLC 2JT4A 1AZGB 1WIEA 2DA9A 2O9SA 4JZ4A 1OPLA 3REAB 1KSWA 1TUCA 2EKHA 3SHWA 2E5KA 4OMOA 1JEGA 2J06A 2C0OA 2ROTA 1AWOA 4CC4B 2KXCA 1ZBJA 1ZUUA 3ZL7C 2KGTA 1PRMC 3NHNA 3UATA 5GJWB 1GBRA 1GL5A 4ZNXA 1K9AA 2K2MA 1NG2A 1T3SA 2O31A 2YUOA 1JQQA 1K76A 2GTOA 4J9CA 2JMCA 1XOVA 3EHQA 4RTUA 2PZ1A 4Z8AA 1YWPA 3TVTA 5IH2A 1QLYA 1ABOA 2X3XD 2EW3A 4HXJA 2DE0X 3ULRB 1H8KA 4AFUC 2RPNA 2VVKA 3JV3A 3NGPA 1UJYA 4AFZC 2CH4A 2A08A 5IXFA 3EG2A 1AD5A 1I0CA 1UHFA 1BK2A 2O9VA 3VRYA 1SRLA 1UTIA 1KIKA 2W0ZA 1QCFA 3NPFA 4IIMA 2AKLA 2D1XA 1VYVA 4RTYA 4RTXA 2JS0A 2L2PA 2KEAA 2OJ2A 1WYXA 1W6XA 1WXUA 4AG1C 2L3SA 1UE9A 4LUEA 2EGCA 1SHGA 3O5ZA 4Y92A 2DL8A 1RLQC 4ORZA 1G2BA 2KT1A 2LP5A 1AZEA 1M3BA 1K1ZA 1SRMA 1U3OA 2RNAA 2CT4A 2LX7A 1KFZA 4K11A 1PNJA 1B07A 2FEIA 4AFSC 3M0QA 2KRMA 3PE0A 4RTWA 1WLPB 2D8JA 2DRKA 2F2WA 1FYNA 2D8HA 1X6BA 2C0TA 1NEGA 2FPEA 1AWJA 3RBBB 1M27C 1LCKA 3RNJA 4QT7A 5I11A 3VS2A 1OOTA 1K0XA 3VS1A 2HBWA 3QWXX 2K79A 1UGVA 4J9EA 2OAWA 4AG2C 2W10A 1WDXA 1M30A 2RQVA 3M0RA 2BZ8A 4LE9A 4J9FA 2MOXA 1SEMA 1X43A 2B86A 1Z9ZA 2LJ1A 5IHIA 3M0UA 2K9GA 3UA6A 1JO8A 1RI9A 4HVWA 2D0NA 2AKKA 3R6NA 1AWWA 4CC7A 2C0IA 1PKTA 2RQUA 3I5SA 1QWFA 2SRCA 1WI7A 1X27A
chains in the Genus database with same CATH superfamily
5KYUA 2G6FX 2COYA 3LGLA 4JRKA 2VGMA 5LJ5g 1H92A 2HBPA 4Z88A 3VS5A 4C92B 4M7AF 4CC3A 4RCBA 2HMAA 1UB4A 1HJDA 3R6OA 1S72A 4AMCA 4N4IA 3MJXA 1VQLT 1MHNA 3HP9A 3A8MB 3E1SA 2EYXA 2KR3A 2LX9A 3HFOA 4BI4A 2FB7A 2X51A 3QXEB 4DA4A 1Q81R 2E5QA 4RTVA 4JUVA 2JXBA 3BW1A 2EQKA 1KG1A 1WJRA 4C8QB 2JJ9A 1MMNA 3MP6A 2O01E 2F2XA 4LDVA 4R55A 4C92E 3UPUA 1ZUYA 3EG9B 4J6WA 1MGQA 1UGQB 2X3WD 2V8JA 4RMOA 4N4GA 2HDAA 3X20B 4QKUA 3RDVA 1CKAA 1IB8A 4Y91A 1W4SA 2YT6A 3CC4Q 2ECZA 3UWNA 4FU6A 5A0DA 4M7AC 1WPYA 1OPKA 4C8QE 1ZUKA 4F7UF 5HK3A 4BE1A 3SEMA 2QDYB 1IZ6A 2DO3A 4PK4A 2L8DA 2FPFA 2J6FA 3GP8A 3QO3A 5FW9A 5HCKA 1KQSP 4A63B 3OYGA 1T0JA 5FU6C 1Q82C 4OMPA 3I35A 3CCUA 2DX1A 5DLOA 4UC4A 2XMFA 3JCMQ 2DFUA 3KBGA 2YUNA 3M4GA 4OGCA 1K8AC 4J9IA 1UGPB 2BZYA 4KH0B 2DXBA 1UGRB 1Y96B 2CZ6B 2L3RA 3JCMd 1KQSS 4M78F 4BI3A 4M7DB 3G1JA 2DZCA 2ED0A 1YHQA 3THKA 1GXIE 2Y4YA 3CCET 4E7ZA 3QWYA 4BY6B 2ZPIB 3DLMA 1RAFB 2ZPEB 2GQVA 2COWA 1VQKT 3QSUA 1VA7A 4C92G 5GMKj 1M90R 2E65A 2RI2A 3C12A 4JLIA 1RAGB 3S6WA 2C06A 1WHJA 2J6OA 3EHRA 2IVWA 5KYWB 1NYFA 4JJBA 3Q1JA 3CMAA 2OTJA 2I2LA 1NLOC 3PVLA 5LJ5j 4M7DE 4BDZA 2GTJA 4HA8A 4L5GA 1B34A 3QZ9B 2IPOB 1GFCA 4XTWA 3TSZA 2CSIA 1YNZA 3G6EA 5AT1B 4C8QG 2P0QA 3FLGA 4EPCA 3C4SA 4XTUA 3GF5A 2H8HA 1QCNA 2LCCA 2M02A 4KBMB 2O88A 4M78C 4OVAA 2YRDA 3OS5A 2RK2A 1YBYA 1MV3A 2FO0A 5KYYB 1U1SA 3JAME 5GAOr 2FZGB 1EZZB 3H0HA 2LNVA 1KQ2A 1VQMQ 3EFSA 1WXBA 4YTLA 3META 2HL3A 1BIBA 1VQ7T 4PJNA 5IN1A 2HZYA 1YWOA 1N5ZA 1MMAA 1ZX6A 4E6RA 3V7CA 3VS6A 1YJWA 4Q5WA 3TCJA 1WFWA 4FW1A 3CXCP 3CD6A 5LL6S 4N0AA 1TS9A 2J6KA 2DEQA 1OX8A 3OYKA 2K2VA 2QGFB 2LCSA 4PJOF 2SEMA 4X34A 4A53A 2HAXA 3NTHA 1BU1A 2PVOB 1Q82R 3RKXA 8ATCB 4M7AE 2WSCE 4A4GA 3OYEA 4BDYA 3KUFA 1C6VX 1N6AA 2ZCFB 2KQWA 4A4FA 2V26A 4M7DG 1B3QA 3CXCS 1QVGP 1FMKA 2F5KA 5KCHA 2KRSA 3EG9A 4B9XA 1JJ2A 4MDWA 4KRTA 2DL3A 4ZTJA 1UDLA 1T0HA 4XAXB 4J6XA 1ABQA 1WXTA 1XJWB 4F7UB 2M1HA 1I1JA 1YN8A 3CC4T 3GBQA 1QVGS 3CMAQ 3LH5A 2YUPA 1E6HA 2VKNA 1KD1U 4PJOC 3CC7A 3OYCA 1N9SA 2EIFA 4J5YA 4GLMA 2LJ3A 3G6EQ 3CPWA 2QQAA 3UA7A 5GAOl 4ANJA 2RHXA 4F7UE 3TQ7P 4ESRA 3OYHA 4RTZA 2LMJA 3M59A 1Y07A 4DBRA 2HL5C 3JSCA 4M78B 3PMTA 4M75B 3A98A 1LVKA 2O2OA 3UF4A 2DJZA 5D6WA 3L42A 2DA9A 4VUBA 2DXCA 1SG5A 3VYGA 5HY6A 2EFIA 4PJJA 1Q7YR 2O4XB 5CQYA 4M7AG 1TUCA 3VYHB 2EKHA 3DB3A 2E5KA 4OMOA 3SHWA 1JEGA 1AWOA 2KXCA 1JBMA 1VQLA 2DXUA 1I8FA 3QPHA 4QVZA 3NHNA 4M78E 3OYIA 1GL5A 1K9AA 1BCOA 4OB0B 1NG2A 2O31A 2VB6A 1VQOT 2GFUA 3CD6Q 4O6JA 3EHQA 4MZTA 2PZ1A 3OYMA 1YWPA 4X9DA 3RUXA 3H8ZA 3TVTA 3X25B 5IH2A 1ABOA 3TREA 2EW3A 4JRPA 1FXXA 2DE0X 2DERA 4MMLA 1YFNA 5GMKm 3JV3A 1VQNQ 1UJYA 2CH4A 1LPLA 4DBQA 4PL6A 3MEVA 3TU4K 2RHYA 3OYFA 2R5MA 2IG0A 3NPFA 4NL3A 4IIMA 2AKLA 1H3ZA 2DIQA 2D1XA 1R0BG 2RJFA 1KHIA 3ZFJA 2DXTA 2L2PA 4F7UG 2KEAA 3FRNA 2OJ2A 3QZ5B 1WYXA 3BFMA 1PG5B 5KE2A 1VQMT 2L3SA 1UE9A 4ZTFA 2DL8A 4ORZA 2KT1A 1VIFA 5CO7A 1X75C 5CAIA 1QP3A 3FJPA 5AYFA 3ZEHA 3CBMA 1K1ZA 3LH0A 3OB9A 2G3RA 2M9UA 2F69A 4PJOB 5GAMe 3G71Q 4JDSA 3JCMX 3PE0A 5D7UA 1KD1C 5GANe 2D8HA 1WQ7A 4M78G 4FYXB 2RHUA 1NEGA 3CCEA 5GANh 1M27C 1LCKA 5KYNA 5I11A 3VS2A 2E6NA 4ELZC 1F1BB 1G3YA 1U1TA 1VQKA 1SF9A 5KYUB 4F04B 5CIUA 2HBWA 4PJOE 4AG2C 4B9WA 5GAMd 2W10A 2QAZA 4Y28E 2RQVA 3M0RA 4DOWA 1RL2A 3WVDB 2B86A 2NUPB 2CGHA 2X35A 5IHIA 3M0UA 2PVDB 3VKIA 3AT1B 1W2BP 2CS7A 5KE3A 3CCVQ 4HCZA 1M8VA 3I5SA 2V8KA 4E2FB 1HXDA 4QQDA 3OQ5A 3M56A 4PJLA 1X27A 3FC3A 3M0SA 3OW2P 4OMQA 2E4HA 1MNEA 2L89A 1M3AA 2L3QA 1BBZA 2P4RA 2K3BA 3KFVA 2BZXA 3KXTA 1YI2Q 4MDXA 3EGDA 3PTAA 1EX4A 4OP0A 4AFQC 1W2BS 3JB9F 6AT1B 3I55A 4M75A 2WACA 1M5Q1 2YLCA 2FPDA 2J7IA 3N5BB 4ZGJB 4XTZA 1TG0A 3FJ5A 3OW2S 1YP5A 5L23A 2XDBA 2VYTA 1PCXA 1CSKA 3CCST 1Q81C 4ME7A 3LWIA 3PFSA 3FIFA 3PNWC 2DL4A 2VV5A 3VUBA 4M7AD 3X24B 4PJOG 1ZQ1A 4X1VA 2BUDA 4LN2A 2FG0A 1JXMA 2RQRA 4LDWA 2NUTB 1M3CA 2JTMA 5IXBA 2YUQA 4EMGA 5LJ3e 1JU5C 4OF1A 3GOXA 3CCEQ 1VQNT 3JCMW 1NZ9A 3E19A 5LJ3h 3I56Q 2R5AA 4C5GA 1KD1R 5FU7B 2LTOA 2AZVA 3HSBA 2GNCA 2RHIA 3JCMJ 4PJMA 3QIIA 4FSSA 3CC4A 1M2OA 2KMTA 4JZ3A 2PTKA 1QKXA 3E2UA 4LD6A 5GAMf 1N9RA 1K0SA 3OYNA 2R57A 5GANf 2CSQA 1O9SA 1QVFS 4HCCA 1C1AA 2XDPA 5KCOA 2KYMA 1ZLMA 3EG0A 4BE2A 5GMKi 2JS2A 3A5ZB 2KDSA 1YJNT 5CQXA 3G71T 1W1FA 2LVMA 1N8RU 2DL5A 1R8OB 1WJQA 2EKOA 2JTFA 1BYMA 4BY6C 3ER0A 2A3LA 1IHWA 2MMPA 1VQ7Q 2EAYA 5GAN2 2RI5A 1MUZA 2D6FA 2HCKA 3A8LB 2AZSA 2FRYA 3C0CA 4O5VA 2K5IA 4LD9K 5A0LA 3V7RA 4FYVB 1JB0E 4L6V5 2A37A 1ARKA 4M77B 2NUPA 1VYUA 2VXEA 3MO8A 4R0KA 2FVUA 2LZ6B 1Q7YU 3H6ZA 2FYKA 2EYZA 1NPRA 5A0GA 3CCVT 3A8OB 1OX9A 2EQIA 2E3IA 2AT1B 4DEXA 3REBB 4E7HA 2GQIA 1NE8A 2ZPFB 3EH1A 4C0ZA 1VQMA 2FHDA 1X01A 2JTEA 1YI2T 2PU9B 5GJVB 4WTOB 3VS3A 1U8RA 1NYGA 1PC0A 3JCMe 1K4US 4HT9A 4QQGA 3S3NA 3J80E 3JCMh 3OMGA 2LQKA 1WHMA 5LJ3f 4N4HA 3OYAA 3VV0A 1OEBA 4HVVA 2DVJA 2H3JA 1BI3A 1PWTA 1ZA2B 3OMCA 2EYYA 3EFRA 1IXDA 4BE0A 3SDZA 4EDUA 4FM4B 1HYOA 4C5IA 5CCAA 2CT3A 2NUTA 2QGGA 1X2QA 2DLPA 3ME9A 4M75F 4BUGA 4D8DA 3M0TA 2DYBA 3CCLT 3I56T 4GY5A 1WHGA 2EGAA 4J9HA 2A36A 4PNOA 3H0IA 4DEYA 2DTHA 2BTTA 1VQOQ 2K6DA 2NYSA 2QXFA 2X9HA 3RKYA 1TUDA 1EIFA 2HEQA 2HKQB 2RI3A 3QDRB 3TSWA 1Q95G 4LUDA 2D0QB 3OA6A 2X4XA 3EGXB 2LQ8A 2M0YA 4FYYB 1UUEA 2L0AA 2JT4A 1AZGB 4JS5A 5M9OA 1KSWA 3LGFA 4OGEA 2MK5A 4M75C 2J06A 2ROTA 4CC4B 1ZUUA 3L2ZA 3CBOA 4XU2A 2YRVA 3JB9G 2KGTA 1Q7YC 1GBRA 3FDRA 4ZNXA 1Y7XA 2K2MA 4C5EA 3CPFA 2YUOA 1D09B 3JB9H 2GTOA 3SFMA 4E7IA 1WGSA 1XOVA 2MWPA 4Z8AA 3NFCA 1QLYA 2X3XD 3MEUA 3CCSA 4ZGDB 1H8KA 4PLLA 2RPNA 2Y4XA 4JJNK 3PT9A 4AFZC 1NPPA 1AD5A 1I0CA 3HFNA 1M4ZA 3VRYA 1VQ6Q 1KIKA 1UTIA 5C0MA 2KY9A 3E9GA 2DYIA 1QCFA 1RAEB 3C95A 4QW2A 2RK1A 3CXCA 1VYVA 4RTYA 1YJ9Q 3MHXA 2JS0A 1VQNA 1O75A 2ZPHB 4KGXB 4XQ3A 4M77A 4P5NA 4A4EA 1WXUA 3LWHA 1FMWA 5LJ5d 1R77A 3OS2A 4XK8E 3JCMf 1RLQC 4C0GA 2OX7A 1M3BA 4MZMA 1QVGA 1SRMA 1OULA 2LCLA 2RJDA 1YIJQ 4BB7A 1XQHA 1PNJA 4C0FA 1AT1B 1B07A 4AFSC 2K5FA 1N8RR 1WLPB 2DD4A 1WZOA 2DRKA 2F2WA 4QQ6A 1TOVA 2XDDA 2C0TA 1AWJA 3RBBB 3LX7A 3RNJA 4DOVA 2EJ9A 2E6ZA 3G71A 3J81E 3VJPA 1N27A 3EGDB 3JB9I 1UGVA 2CP7A 4EMKA 1M30A 5I2SA 4J9FA 3OYLA 4ELYC 2P0KA 1RI0A 1WNLA 3M55A 2KI7A 2MOXA 1C0MA 1X43A 3V8LA 5GAN5 2LJ1A 3CCJT 1RAAB 2CZ7B 3BE3A 1RABB 3M4YA 2CP6A 4HVWA 4KGZB 3CCSQ 2SRCA 3FB9A 3JRZA 4E7JA 1OQKA 4HVUA 4M75E 2QA4Q 1NM7A 3E9FA 3X28B 2FL7A 1TUGB 4RUGA 5I2MA 4C92D 4Z89A 2DRMA 1IRXA 3I9QA 4CC2A 3OSSC 3CCVA 2DPPB 3O8VA 3OS1A 2WSEE 3EGXA 5FRMA 1BI2A 1UG1A 1UFFA 3PMIA 5GAOp 1OV3A 1YI2A 4C8QD 1TXQA 1FX7A 2PUKB 2A7YA 1TSFA 2RM4A 1P92A 2CUDA 2L5QA 4XTYA 1HSQA 2HKNA 3QJ6A 3CMEQ 2GFAA 4EMHA 3EG1A 2DTOA 4LDUA 2LQNA 3JB9D 2K3YA 2LDMA 4QVDA 2CREA 3OY9A 2PUOB 2XK0A 3HHTB 3SD4A 4PFPA 3G4ST 2DJQA 4RTTA 4FT4A 3ZBDA 4KGVB 2DK3A 2BE9B 3WXMB 1YJNQ 3VS7A 1XTDA 1I5OB 2DM1A 2X4JA 4OB1B 2ESWA 1VQ6T 2K57A 3M0PA 4CRIA 1K73R 5GAMh 4J9DA 2RHZA 3HRUA 4L59A 5FU7C 1YJ9T 4M75G 5GAN7 4J83A 3CCLA 3PVQA 5A2QE 2ENMA 3I56A 5GAOn 4FW2A 1QP2A 1BCMA 5CKEA 5GAN3 1V1CA 4ZN1A 5IHNA 4M7DD 1AVZC 2QI2A 1J3TA 1G3TA 3GNGA 4JJDA 3UDCA 1YIJT 1RACB 5FWCA 1WHLA 4OMMA 2DMOA 2CKKA 2QDLA 2CZ1B 5I22A 4M77F 5CK9A 2CDTA 2LNHB 2QK0A 1W2BA 2RQWA 5EG2A 1QWEA 1I5LA 2EBPA 1VQ4Q 1VQ8Q 2HQHA 4F17A 1WHKA 2ED1A 3LYIA 3OW2A 2OTLQ 4M4ZA 3QHSA 1SPKA 1VQ7A 4XTXA 1ZSGA 4XU3A 1IREB 1OU9A 3HRSA 4AT1B 2YDLA 2CP0A 2L3PA 3LW5E 3QJYA 1M1GA 2KXDA 1X2KA 3PGGA 5DLQE 1UECA 5FLXE 2EQUA 4Z02A 2RMOA 2HD0A 2DBMA 4OB3B 3GLXA 1UGSB 4D6WA 1AOJA 4M77C 2RA2A 1NEBA 5D6YA 1T3LA 4IKFA 4R56A 1V76A 3JCMg 2QA4T 1X6GA 2MYSA 4JS4A 2GF7A 1PSFA 3EFOA 4IUPA 2DNUA 2KNBB 1IO6A 4IUUA 2CP3A 3QYGB 2KAFA 2QEXT 1E6GA 4IIOA 3VS4A 3VS0A 3CCLQ 2RO0A 4OMNA 1H3HA 3T9NA 1HK9A 2V1RA 2KBTA 4OB2B 3PIPA 4XU0A 1ACMB 3A8HB 5C6SA 3FEOA 1YITT 1QVFP 1Y57A 2CYZB 2QQ9A 1ZSZA 4J7FA 3RMSA 1BKBA 3EH2A 5IT9E 2GCXA 1QKWA 1M1FA 3URGA 3CCQQ 2OAUA 3TEEA 1K9MU 3CMET 3MP1A 1Y71A 1DJ7B 2LQWA 4ZGEB 3LLRA 3MEAA 1RLPC 2YLBA 2F5TX 1BIAA 5GAN4 5FROA 2KT8A 4GBQA 4EMKC 3DKMA 1RAIB 4ATOA 3QYHB 2JM8A 2DIGA 2A28A 1PHTA 2EGEA 3RIRA 3OBYA 3RKWA 1X6OA 1WHHA 4XU1A 4D8KA 1GCQA 1D3BB 3M5AA 2HSEB 3L2QA 2CP2A 3MCAB 4ZN3A 3RR6A 2DETA 2HQEA 2FZCB 1S1NA 1NJIU 3OYYA 1OI1A 4HCKA 5IHKA 3CC7T 4J9GA 2DKGA 1LOJA 4M78D 4M75D 2FRWA 2GBQA 4RG2A 3V7SA 2JZ2A 5HKCA 4JRQA 1VQOA 3REAB 2Z0WA 8AT1B 3V8JA 1KC8U 4A54A 2C0OA 1IGQA 4PKCC 1OZ2A 3JCMb 3P8BB 2MF2A 3VU3C 9ATCB 3INZA 4RKUE 1PRMC 3UATA 2RH2A 5GJWB 3M58A 1G5VA 1T3SA 4LDXA 2JMCA 3V8KA 4HKEA 4HXJA 4NL2A 3ULRB 4AFUC 2VVKA 3NGPA 2LRQA 3MPUB 4HT8A 1VQ4T 5IXFA 3HTRA 1VQ8T 3EG2A 3CCMT 2MWOA 1UHFA 4M77E 2O9VA 1SRLA 2W0ZA 2OTLT 2ZAEA 2B8AA 1VQPT 3CEYA 1M1KU 3OYDA 3G4SA 2RB6A 2ZGWA 4AG1C 3CCRT 4LUEA 2QTVA 1VQ6A 1R0CB 2EGCA 3A1PA 1SHGA 3O5ZA 1K9MC 1M9SA 1G2BA 2LP5A 2XICA 1AZEA 4EMKB 1KQSA 1YJ9A 1IGUA 1VQ9Q 3G7ZA 2R58A 2VGNA 2RNAA 2CT4A 1PSEA 2LX7A 4JLGA 2DD5A 2Y90A 4K11A 1QQJA 4PJOD 3M0QA 3CCJQ 2KRMA 3PIOA 3C94A 4DBHA 3S3MA 3DB4A 1FYNA 4RCCA 3QBYA 2YWWA 1VQ5Q 1QW1A 2FPEA 4NOYA 5D6XA 1M2VA 4HCBA 1N8RC 1YIJA 3SWNC 3MEWA 1NJIC 4JRIA 2ZZDA 4FL6A 1K73U 1K0XA 4II1A 3VS1A 3QWXX 2LC4A 4J9EA 2QG9B 3CCQT 3OYBA 3CC2T 2XKOC 1WDXA 4M77G 4MZPA 2E10A 3HPWA 4NS5A 1KC8C 1OYXA 1Z9ZA 4BI8B 1JO8A 1RI9A 2AKKA 3R6NA 2C0IA 1S72Q 2RQUA 4QVCA 4WF2A 5CVIA 3EAEA 1WI7A 4PLIA 1D3BA 1D1CA 4IURA 4XTVA 1W70A 2JM9A 3U23A 2EQJA 2KVQG 4EIKA 5GMKe 2HQXA 3QDFA 5GMKh 2NWMA 2BE7D 2RQTA 1G3SA 3EGUA 2HNIA 3G4SQ 1M8MA 1HD3A 5LJ5e 1GBQA 2PVGB 2QA4A 4JPBW 1D0YA 2EYWA 4WCIA 5LJ5h 1M1KC 2ZPGB 4FT2A 2K7AA 1QVPA 2QEXA 4KT0E 3J7AF 4M7AB 4FSXA 5CKHA 1WA7A 3I55T 2ABLA 3S3OA 1I81A 1WX6A 1NLPC 3CQTA 5KYXB 1K9MR 2V8IA 1ZSZC 1KHCA 2OI3A 2PQWA 1YITA 3VUZA 1U5SA 2F2VA 2MCNA 4C92A 2MPXC 5GAMg 4JJCA 3NMZC 1TWBA 1AHJB 1Z9QA 3H41A 3I5RA 4TVRA 3CCUQ 3JB9J 2E12A 4E7SA 5GANg 4J9BA 2RD1A 1JRIA 5FU6B 3CMEA 1Y0MA 5L8RE 1JXOA 1JJ2P 1A0NB 3SWNB 4C8QA 1K8AR 1VUBA 1YHQQ 1NJIR 1GCQC 4E47A 5CKFA 2NUZA 4J8OA 4DBFA 1UJ0A 1K73C 2YHTA 2VWFA 1QCOA 3CBPA 1YJNA 1H641 1SHFA 3DLLA 3OBWA 5ECAA 1D1AA 1JJ2S 1E7OA 5FRNA 2JMAA 2CUBA 1KC8R 4J6YA 1UEBA 5GMKl 3CPWP 1PD1A 1SKUB 2OTJQ 4CI0C 2QQRA 1VQ9T 2ROLA 4OMFB 2DBKA 5EC7A 4LNPA 1AWXA 2YRCA 4PFOA 2CZ0B 2D9TA 3L2UA 2K5LA 2A0FB 1UHCA 2QTXA 4X9CA 2KE9A 2EVRA 5CR2A 2COZA 4KH1B 1VQ5T 3L2VA 3RERA 3L2RA 3CPWS 2PNIA 1FWZA 2K3XA 1OZ3A 2DF6A 2CH4W 1Y96A 2XIDA 4KULA 2EPDA 3QKJA 2I0NA 4FCYA 3EFOB 3NTKA 1AEYA 3H9NA 3X26B 4M7DA 3P8HA 4J7IA 2M16A 3QG1A 2QEXQ 5J26A 1OU8A 2DILA 1M1KR 2JVVA 1TTHB 4MMKA 1YJWQ 1RADB 4M77D 1VQ4A 3AHUA 1YITQ 1VQ8A 1GRIA 3CCMA 2E1HA 4RG8A 1Q86U 5GAOm 1ZSZB 4OMLA 2KROA 2XI9A 5KYWA 1S72T 1I4K1 2RJEA 1SSFA 2OTLA 2KK4A 5LJ5f 2XHCA 1RUWA 2KSSA 3D7SB 1VQPA 5LJ3g 1U06A 4E7KA 5GAMj 1BB9A 3CCRA 5GANj 2JW4A 2J05A 1QMCA 3OS0A 3IQLA 1GFDA 3BDLA 4LDYA 3VRZA 1VYTA 3L2WA 2MIOA 1CKBA 1BI0A 2XG8D 5KYYA 1Q81U 2DVEA 3JCMV 2JOYA 3GIBA 4F16A 2FZKB 2RF0A 2KRNA 2V1QA 2YSQA 2IIMA 4IUQA 4BACA 3WVEB 2DL7A 2AIRB 4M7AA 2MI6A 2AHJB 3CC7Q 1G83A 2GGRA 5KYXA 2M0OA 3EG3A 5IAYA 2DZ9A 2QQBA 2DTIA 3ASKA 1D0XA 2RN8A 5GAOq 1MV0B 2HSPA 3F70A 4C0DC 3SB2A 2AK5A 3H0FA 4F14A 3CCUT 5KH6A 3CCQA 3CC2A 1G8XA 1WJSA 1D0ZA 1PKSA 5FWBA 1GCPA 1EFNA 4E7LA 1KJWA 3UT1A 1V29B 2KYBA 4FYWB 3SWNA 1KQ1A 1YHQT 4C5HA 1I07A 2QYZA 1VOMA 1X69A 2LJ0A 1WQWA 1VQLQ 4C92F 5GANd 2NLUA 1SSHA 1VIEA 4F7UA 1G3WA 2M51A 1YCSB 1PRLC 3CCMQ 1WIEA 2O9SA 4JZ4A 1OPLA 2LT1A 3CMAT 2OTJT 3BY7A 3MKDA 1PM3A 2JUFA 1VQPQ 1ZBJA 5DY9A 2E70A 3ZL7C 3L1AA 3G6ET 4C8QF 1PD0A 1Q86C 3M9QA 2BKDN 1MMDA 1M90U 3M53A 2EQMA 3CCRQ 1JQQA 1K76A 4J9CA 5LJ3j 4RTUA 5J3BA 2P84A 3OSVA 4GLKA 3GNFB 3QUIA 2JN0A 1TH7A 2ATCB 4M78A 3HL8A 2E3HA 1ZA1B 1TU0B 2A08A 2VUBA 4C92C 1BI1A 4N0AC 4V2SA 2F1LA 2VC8A 1BK2A 5I21A 1RAHB 3RESA 3HKSA 2O4XA 5HK0A 2E64A 3BDUA 2XD0A 4RTXA 2H3EB 1M2VB 3MP8A 1YJWT 2XU8A 2VASA 4C8QC 1W6XA 3HRTA 5CKBA 1LJOA 3CD6T 3M57A 1KK7A 1ZBXA 3JCMc 7AT1B 4Y92A 5GAN8 1LNXA 1QVFA 4C0DB 4FIBA 2JNGA 3CC2Q 2WSFE 1U3OA 2DAQA 4B6MA 4KUIA 1KFZA 1VQKQ 4M7DF 5DM7R 1MNDA 2EWNA 1IHVA 3P8DA 4IUVA 2FEIA 2ZPBB 5CKDA 4RTWA 2QASA 3RMQA 1MMGA 2D8JA 2K4YA 1X6BA 1FMVA 4LXCA 1B34B 1Q82U 1VQ9A 2EJFA 4QT7A 3NTIA 4PFZA 4BD3A 2RJCA 5LJ3d 4A4KA 1OOTA 2X4WA 2EJGA 1K8AU 3JCMP 1B7TA 2BIVA 2E41A 3CCJA 2MAMA 2K79A 2P0PA 3OYJA 2OAWA 3M54A 5J39A 1VQ5A 2LT4A 2EYQA 1D1BA 2BZ8A 4LE9A 3A8GB 2X4YA 4IUTA 1NBEB 2QQSA 1SEMA 4PJOA 3GPLA 1YCYA 4M7DC 2P4TA 4DQ2A 4KUDK 2K9GA 2YXYA 3UA6A 1Q86R 2D0NA 5GAN6 1AWWA 2VXFA 4CC7A 1ZHIA 1PKTA 1QWFA 1M90C 1XNIA 2CP5A 2DEUA 4A4HA 3I55Q
chains in the Genus database with same CATH topology
4HVUA 3M0SA 2G6FX 4OMQA 1H92A 1W70A 1M3AA 2L3QA 1NM7A 2JM9A 4Z88A 1BBZA 3U23A 2P4RA 2K3BA 3KFVA 3VS5A 2BZXA 4CC3A 4EIKA 4RUGA 4Z89A 2DRMA 3I9QA 4CC2A 1HJDA 4AFQC 2NWMA 2RQTA 2EYXA 2KR3A 3EGUA 1M8MA 1HD3A 1UG1A 2FPDA 2J7IA 4RTVA 1GBQA 1TG0A 2JXBA 3FJ5A 4JPBW 2EYWA 1YP5A 4WCIA 5L23A 1UFFA 1OV3A 2F2XA 2K7AA 1CSKA 1ZUYA 2CUDA 1WA7A 2ABLA 1HSQA 2DL4A 1WX6A 1NLPC 3CQTA 2X3WD 4X1VA 3EG1A 4LN2A 2HDAA 2OI3A 2LQNA 1CKAA 2FG0A 1JXMA 2RQRA 1U5SA 2F2VA 2YT6A 2MCNA 2CREA 2ECZA 4JJCA 3NMZC 1M3CA 5IXBA 1OPKA 2YUQA 1Z9QA 1ZUKA 3H41A 3I5RA 1JU5C 4J9BA 2DJQA 4RTTA 3SEMA 1Y0MA 3VS7A 2FPFA 2J6FA 2AZVA 2GNCA 5FW9A 2DM1A 5HCKA 1JXOA 2ESWA 4A63B 3M0PA 1A0NB 4FSSA 1T0JA 4J9DA 4JZ3A 2PTKA 4OMPA 3I35A 1QKXA 1GCQC 2DX1A 2XMFA 2YUNA 3PVQA 2NUZA 2ENMA 4J9IA 1UJ0A 2VWFA 1K0SA 2BZYA 1SHFA 2CSQA 5ECAA 1E7OA 1V1CA 2JMAA 2CUBA 2KYMA 1ZLMA 5IHNA 2ED0A 3EG0A 1AVZC 3THKA 1J3TA 3QWYA 2ROLA 2JS2A 4JJDA 2DBKA 5EC7A 4LNPA 1AWXA 1VA7A 5FWCA 1W1FA 1UHCA 2KE9A 4OMMA 2DMOA 2DL5A 2EVRA 2QDLA 2J6OA 3EHRA 1NYFA 5I22A 4JJBA 1NLOC 3PVLA 2PNIA 2GTJA 1GFCA 1MUZA 2CDTA 2LNHB 3TSZA 2RQWA 1QWEA 2CSIA 1YNZA 2DF6A 2CH4W 2EBPA 2HCKA 2AZSA 2EPDA 2FRYA 4F17A 2I0NA 3C0CA 1AEYA 2H8HA 2ED1A 2O88A 4M4ZA 1SPKA 1ZSGA 1MV3A 2DILA 2FO0A 2A37A 1ARKA 3H0HA 2YDLA 2L3PA 1VYUA 4R0KA 1GRIA 2KXDA 1WXBA 1X2KA 2LZ6B 1UECA 2EYZA 4OMLA 2KROA 2RMOA 2DBMA 1AOJA 1RUWA 2EQIA 1NEBA 4DEXA 1YWOA 1T3LA 1U06A 1N5ZA 4E6RA 1ZX6A 1BB9A 3REBB 2GQIA 3VS6A 1X6GA 1WFWA 2JTEA 2JW4A 2J05A 2DNUA 2KNBB 3IQLA 5GJVB 1GFDA 1IO6A 2J6KA 3VRZA 1VYTA 3VS3A 1E6GA 4IIOA 1NYGA 2LCSA 3VS4A 2MIOA 3VS0A 1CKBA 2SEMA 4OMNA 1K4US 1H3HA 2V1RA 1BU1A 2KBTA 1Y57A 1B3QA 2RF0A 4F16A 2KRNA 2V1QA 2YSQA 1FMKA 2IIMA 1OEBA 1QKWA 4HVVA 2KRSA 2DVJA 2DL7A 1PWTA 4KRTA 2DL3A 1UDLA 1T0HA 2EYYA 1G83A 2GGRA 3EG3A 2LQWA 1ABQA 1WXTA 1RLPC 1I1JA 1YN8A 2RN8A 1MV0B 2HSPA 2KT8A 4GBQA 2CT3A 2AK5A 3H0FA 4F14A 3GBQA 1X2QA 2DLPA 2JM8A 4D8DA 2A28A 3M0TA 1PHTA 2DYBA 3LH5A 2EGEA 2YUPA 1E6HA 2VKNA 1PKSA 5FWBA 1GCPA 2EGAA 4J9HA 1EFNA 4D8KA 1GCQA 4GLMA 1KJWA 2A36A 2LJ3A 3H0IA 3UA7A 4DEYA 2KYBA 2BTTA 2K6DA 1S1NA 4ESRA 4RTZA 1TUDA 1I07A 2LMJA 2HEQA 4HCKA 1X69A 2LJ0A 3TSWA 5IHKA 4LUDA 4J9GA 3A98A 2M0YA 1SSHA 2FRWA 2GBQA 2O2OA 3UF4A 1UUEA 2L0AA 2M51A 1YCSB 1PRLC 2JT4A 1AZGB 1WIEA 2DA9A 2O9SA 4JZ4A 1OPLA 3REAB 1KSWA 1TUCA 2EKHA 3SHWA 2E5KA 4OMOA 1JEGA 2J06A 2C0OA 2ROTA 1AWOA 4CC4B 2KXCA 1ZBJA 1ZUUA 3ZL7C 2KGTA 1PRMC 3NHNA 3UATA 5GJWB 1GBRA 1GL5A 4ZNXA 1K9AA 2K2MA 1NG2A 1T3SA 2O31A 2YUOA 1JQQA 1K76A 2GTOA 4J9CA 2JMCA 1XOVA 3EHQA 4RTUA 2PZ1A 4Z8AA 1YWPA 3TVTA 5IH2A 1QLYA 1ABOA 2X3XD 2EW3A 4HXJA 2DE0X 3ULRB 1H8KA 4AFUC 2RPNA 2VVKA 3JV3A 3NGPA 1UJYA 4AFZC 2CH4A 2A08A 5IXFA 3EG2A 1AD5A 1I0CA 1UHFA 1BK2A 2O9VA 3VRYA 1SRLA 1UTIA 1KIKA 2W0ZA 1QCFA 3NPFA 4IIMA 2AKLA 2D1XA 1VYVA 4RTYA 4RTXA 2JS0A 2L2PA 2KEAA 2OJ2A 1WYXA 1W6XA 1WXUA 4AG1C 2L3SA 1UE9A 4LUEA 2EGCA 1SHGA 3O5ZA 4Y92A 2DL8A 1RLQC 4ORZA 1G2BA 2KT1A 2LP5A 1AZEA 1M3BA 1K1ZA 1SRMA 1U3OA 2RNAA 2CT4A 2LX7A 1KFZA 4K11A 1PNJA 1B07A 2FEIA 4AFSC 3M0QA 2KRMA 3PE0A 4RTWA 1WLPB 2D8JA 2DRKA 2F2WA 1FYNA 2D8HA 1X6BA 2C0TA 1NEGA 2FPEA 1AWJA 3RBBB 1M27C 1LCKA 3RNJA 4QT7A 5I11A 3VS2A 1OOTA 1K0XA 3VS1A 2HBWA 3QWXX 2K79A 1UGVA 4J9EA 2OAWA 4AG2C 2W10A 1WDXA 1M30A 2RQVA 3M0RA 2BZ8A 4LE9A 4J9FA 2MOXA 1SEMA 1X43A 2B86A 1Z9ZA 2LJ1A 5IHIA 3M0UA 2K9GA 3UA6A 1JO8A 1RI9A 4HVWA 2D0NA 2AKKA 3R6NA 1AWWA 4CC7A 2C0IA 1PKTA 2RQUA 3I5SA 1QWFA 2SRCA 1WI7A 1X27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVU A;  3M0S A;  2G6F X;  4OMQ A;  1H92 A;  1W70 A;  1M3A A;  2L3Q A;  1NM7 A;  2JM9 A;  4Z88 A;  1BBZ A;  3U23 A;  2P4R A;  2K3B A;  3KFV A;  3VS5 A;  2BZX A;  4CC3 A;  4EIK A;  4RUG A;  4Z89 A;  2DRM A;  3I9Q A;  4CC2 A;  1HJD A;  4AFQ C;  2NWM A;  2RQT A;  2EYX A;  2KR3 A;  3EGU A;  1M8M A;  1HD3 A;  1UG1 A;  2FPD A;  2J7I A;  4RTV A;  1GBQ A;  1TG0 A;  2JXB A;  3FJ5 A;  4JPB W;  2EYW A;  1YP5 A;  4WCI A;  5L23 A;  1UFF A;  1OV3 A;  2F2X A;  2K7A A;  1CSK A;  1ZUY A;  2CUD A;  1WA7 A;  2ABL A;  1HSQ A;  2DL4 A;  1WX6 A;  1NLP C;  3CQT A;  2X3W D;  4X1V A;  3EG1 A;  4LN2 A;  2HDA A;  2OI3 A;  2LQN A;  1CKA A;  2FG0 A;  1JXM A;  2RQR A;  1U5S A;  2F2V A;  2YT6 A;  2MCN A;  2CRE A;  2ECZ A;  4JJC A;  3NMZ C;  1M3C A;  5IXB A;  1OPK A;  2YUQ A;  1Z9Q A;  1ZUK A;  3H41 A;  3I5R A;  1JU5 C;  4J9B A;  2DJQ A;  4RTT A;  3SEM A;  1Y0M A;  3VS7 A;  2FPF A;  2J6F A;  2AZV A;  2GNC A;  5FW9 A;  2DM1 A;  5HCK A;  1JXO A;  2ESW A;  4A63 B;  3M0P A;  1A0N B;  4FSS A;  1T0J A;  4J9D A;  4JZ3 A;  2PTK A;  4OMP A;  3I35 A;  1QKX A;  1GCQ C;  2DX1 A;  2XMF A;  2YUN A;  3PVQ A;  2NUZ A;  2ENM A;  4J9I A;  1UJ0 A;  2VWF A;  1K0S A;  2BZY A;  1SHF A;  2CSQ A;  5ECA A;  1E7O A;  1V1C A;  2JMA A;  2CUB A;  2KYM A;  1ZLM A;  5IHN A;  2ED0 A;  3EG0 A;  1AVZ C;  3THK A;  1J3T A;  3QWY A;  2ROL A;  2JS2 A;  4JJD A;  2DBK A;  5EC7 A;  4LNP A;  1AWX A;  1VA7 A;  5FWC A;  1W1F A;  1UHC A;  2KE9 A;  4OMM A;  2DMO A;  2DL5 A;  2EVR A;  2QDL A;  2J6O A;  3EHR A;  1NYF A;  5I22 A;  4JJB A;  1NLO C;  3PVL A;  2PNI A;  2GTJ A;  1GFC A;  1MUZ A;  2CDT A;  2LNH B;  3TSZ A;  2RQW A;  1QWE A;  2CSI A;  1YNZ A;  2DF6 A;  2CH4 W;  2EBP A;  2HCK A;  2AZS A;  2EPD A;  2FRY A;  4F17 A;  2I0N A;  3C0C A;  1AEY A;  2H8H A;  2ED1 A;  2O88 A;  4M4Z A;  1SPK A;  1ZSG A;  1MV3 A;  2DIL A;  2FO0 A;  2A37 A;  1ARK A;  3H0H A;  2YDL A;  2L3P A;  1VYU A;  4R0K A;  1GRI A;  2KXD A;  1WXB A;  1X2K A;  2LZ6 B;  1UEC A;  2EYZ A;  4OML A;  2KRO A;  2RMO A;  2DBM A;  1AOJ A;  1RUW A;  2EQI A;  1NEB A;  4DEX A;  1YWO A;  1T3L A;  1U06 A;  1N5Z A;  4E6R A;  1ZX6 A;  1BB9 A;  3REB B;  2GQI A;  3VS6 A;  1X6G A;  1WFW A;  2JTE A;  2JW4 A;  2J05 A;  2DNU A;  2KNB B;  3IQL A;  5GJV B;  1GFD A;  1IO6 A;  2J6K A;  3VRZ A;  1VYT A;  3VS3 A;  1E6G A;  4IIO A;  1NYG A;  2LCS A;  3VS4 A;  2MIO A;  3VS0 A;  1CKB A;  2SEM A;  4OMN A;  1K4U S;  1H3H A;  2V1R A;  1BU1 A;  2KBT A;  1Y57 A;  1B3Q A;  2RF0 A;  4F16 A;  2KRN A;  2V1Q A;  2YSQ A;  1FMK A;  2IIM A;  1OEB A;  1QKW A;  4HVV A;  2KRS A;  2DVJ A;  2DL7 A;  1PWT A;  4KRT A;  2DL3 A;  1UDL A;  1T0H A;  2EYY A;  1G83 A;  2GGR A;  3EG3 A;  2LQW A;  1ABQ A;  1WXT A;  1RLP C;  1I1J A;  1YN8 A;  2RN8 A;  1MV0 B;  2HSP A;  2KT8 A;  4GBQ A;  2CT3 A;  2AK5 A;  3H0F A;  4F14 A;  3GBQ A;  1X2Q A;  2DLP A;  2JM8 A;  4D8D A;  2A28 A;  3M0T A;  1PHT A;  2DYB A;  3LH5 A;  2EGE A;  2YUP A;  1E6H A;  2VKN A;  1PKS A;  5FWB A;  1GCP A;  2EGA A;  4J9H A;  1EFN A;  4D8K A;  1GCQ A;  4GLM A;  1KJW A;  2A36 A;  2LJ3 A;  3H0I A;  3UA7 A;  4DEY A;  2KYB A;  2BTT A;  2K6D A;  1S1N A;  4ESR A;  4RTZ A;  1TUD A;  1I07 A;  2LMJ A;  2HEQ A;  4HCK A;  1X69 A;  2LJ0 A;  3TSW A;  5IHK A;  4LUD A;  4J9G A;  3A98 A;  2M0Y A;  1SSH A;  2FRW A;  2GBQ A;  2O2O A;  3UF4 A;  1UUE A;  2L0A A;  2M51 A;  1YCS B;  1PRL C;  2JT4 A;  1AZG B;  1WIE A;  2DA9 A;  2O9S A;  4JZ4 A;  1OPL A;  3REA B;  1KSW A;  1TUC A;  2EKH A;  3SHW A;  2E5K A;  4OMO A;  1JEG A;  2J06 A;  2C0O A;  2ROT A;  1AWO A;  4CC4 B;  2KXC A;  1ZBJ A;  1ZUU A;  3ZL7 C;  2KGT A;  1PRM C;  3NHN A;  3UAT A;  5GJW B;  1GBR A;  1GL5 A;  4ZNX A;  1K9A A;  2K2M A;  1NG2 A;  1T3S A;  2O31 A;  2YUO A;  1JQQ A;  1K76 A;  2GTO A;  4J9C A;  2JMC A;  1XOV A;  3EHQ A;  4RTU A;  2PZ1 A;  4Z8A A;  1YWP A;  3TVT A;  5IH2 A;  1QLY A;  1ABO A;  2X3X D;  2EW3 A;  4HXJ A;  2DE0 X;  3ULR B;  1H8K A;  4AFU C;  2RPN A;  2VVK A;  3JV3 A;  3NGP A;  1UJY A;  4AFZ C;  2CH4 A;  2A08 A;  5IXF A;  3EG2 A;  1AD5 A;  1I0C A;  1UHF A;  1BK2 A;  2O9V A;  3VRY A;  1SRL A;  1UTI A;  1KIK A;  2W0Z A;  1QCF A;  3NPF A;  4IIM A;  2AKL A;  2D1X A;  1VYV A;  4RTY A;  4RTX A;  2JS0 A;  2L2P A;  2KEA A;  2OJ2 A;  1WYX A;  1W6X A;  1WXU A;  4AG1 C;  2L3S A;  1UE9 A;  4LUE A;  2EGC A;  1SHG A;  3O5Z A;  4Y92 A;  2DL8 A;  1RLQ C;  4ORZ A;  1G2B A;  2KT1 A;  2LP5 A;  1AZE A;  1M3B A;  1K1Z A;  1SRM A;  1U3O A;  2RNA A;  2CT4 A;  2LX7 A;  1KFZ A;  4K11 A;  1PNJ A;  1B07 A;  2FEI A;  4AFS C;  3M0Q A;  2KRM A;  3PE0 A;  4RTW A;  1WLP B;  2D8J A;  2DRK A;  2F2W A;  1FYN A;  2D8H A;  1X6B A;  2C0T A;  1NEG A;  2FPE A;  1AWJ A;  3RBB B;  1M27 C;  1LCK A;  3RNJ A;  4QT7 A;  5I11 A;  3VS2 A;  1OOT A;  1K0X A;  3VS1 A;  2HBW A;  3QWX X;  2K79 A;  1UGV A;  4J9E A;  2OAW A;  4AG2 C;  2W10 A;  1WDX A;  1M30 A;  2RQV A;  3M0R A;  2BZ8 A;  4LE9 A;  4J9F A;  2MOX A;  1SEM A;  1X43 A;  2B86 A;  1Z9Z A;  2LJ1 A;  5IHI A;  3M0U A;  2K9G A;  3UA6 A;  1JO8 A;  1RI9 A;  4HVW A;  2D0N A;  2AKK A;  3R6N A;  1AWW A;  4CC7 A;  2C0I A;  1PKT A;  2RQU A;  3I5S A;  1QWF A;  2SRC A;  1WI7 A;  1X27 A; 
#chains in the Genus database with same CATH topology
 5KYU A;  2G6F X;  2COY A;  3LGL A;  4JRK A;  2VGM A;  5LJ5 g;  1H92 A;  2HBP A;  4Z88 A;  3VS5 A;  4C92 B;  4M7A F;  4CC3 A;  4RCB A;  2HMA A;  1UB4 A;  1HJD A;  3R6O A;  1S72 A;  4AMC A;  4N4I A;  3MJX A;  1VQL T;  1MHN A;  3HP9 A;  3A8M B;  3E1S A;  2EYX A;  2KR3 A;  2LX9 A;  3HFO A;  4BI4 A;  2FB7 A;  2X51 A;  3QXE B;  4DA4 A;  1Q81 R;  2E5Q A;  4RTV A;  4JUV A;  2JXB A;  3BW1 A;  2EQK A;  1KG1 A;  1WJR A;  4C8Q B;  2JJ9 A;  1MMN A;  3MP6 A;  2O01 E;  2F2X A;  4LDV A;  4R55 A;  4C92 E;  3UPU A;  1ZUY A;  3EG9 B;  4J6W A;  1MGQ A;  1UGQ B;  2X3W D;  2V8J A;  4RMO A;  4N4G A;  2HDA A;  3X20 B;  4QKU A;  3RDV A;  1CKA A;  1IB8 A;  4Y91 A;  1W4S A;  2YT6 A;  3CC4 Q;  2ECZ A;  3UWN A;  4FU6 A;  5A0D A;  4M7A C;  1WPY A;  1OPK A;  4C8Q E;  1ZUK A;  4F7U F;  5HK3 A;  4BE1 A;  3SEM A;  2QDY B;  1IZ6 A;  2DO3 A;  4PK4 A;  2L8D A;  2FPF A;  2J6F A;  3GP8 A;  3QO3 A;  5FW9 A;  5HCK A;  1KQS P;  4A63 B;  3OYG A;  1T0J A;  5FU6 C;  1Q82 C;  4OMP A;  3I35 A;  3CCU A;  2DX1 A;  5DLO A;  4UC4 A;  2XMF A;  3JCM Q;  2DFU A;  3KBG A;  2YUN A;  3M4G A;  4OGC A;  1K8A C;  4J9I A;  1UGP B;  2BZY A;  4KH0 B;  2DXB A;  1UGR B;  1Y96 B;  2CZ6 B;  2L3R A;  3JCM d;  1KQS S;  4M78 F;  4BI3 A;  4M7D B;  3G1J A;  2DZC A;  2ED0 A;  1YHQ A;  3THK A;  1GXI E;  2Y4Y A;  3CCE T;  4E7Z A;  3QWY A;  4BY6 B;  2ZPI B;  3DLM A;  1RAF B;  2ZPE B;  2GQV A;  2COW A;  1VQK T;  3QSU A;  1VA7 A;  4C92 G;  5GMK j;  1M90 R;  2E65 A;  2RI2 A;  3C12 A;  4JLI A;  1RAG B;  3S6W A;  2C06 A;  1WHJ A;  2J6O A;  3EHR A;  2IVW A;  5KYW B;  1NYF A;  4JJB A;  3Q1J A;  3CMA A;  2OTJ A;  2I2L A;  1NLO C;  3PVL A;  5LJ5 j;  4M7D E;  4BDZ A;  2GTJ A;  4HA8 A;  4L5G A;  1B34 A;  3QZ9 B;  2IPO B;  1GFC A;  4XTW A;  3TSZ A;  2CSI A;  1YNZ A;  3G6E A;  5AT1 B;  4C8Q G;  2P0Q A;  3FLG A;  4EPC A;  3C4S A;  4XTU A;  3GF5 A;  2H8H A;  1QCN A;  2LCC A;  2M02 A;  4KBM B;  2O88 A;  4M78 C;  4OVA A;  2YRD A;  3OS5 A;  2RK2 A;  1YBY A;  1MV3 A;  2FO0 A;  5KYY B;  1U1S A;  3JAM E;  5GAO r;  2FZG B;  1EZZ B;  3H0H A;  2LNV A;  1KQ2 A;  1VQM Q;  3EFS A;  1WXB A;  4YTL A;  3MET A;  2HL3 A;  1BIB A;  1VQ7 T;  4PJN A;  5IN1 A;  2HZY A;  1YWO A;  1N5Z A;  1MMA A;  1ZX6 A;  4E6R A;  3V7C A;  3VS6 A;  1YJW A;  4Q5W A;  3TCJ A;  1WFW A;  4FW1 A;  3CXC P;  3CD6 A;  5LL6 S;  4N0A A;  1TS9 A;  2J6K A;  2DEQ A;  1OX8 A;  3OYK A;  2K2V A;  2QGF B;  2LCS A;  4PJO F;  2SEM A;  4X34 A;  4A53 A;  2HAX A;  3NTH A;  1BU1 A;  2PVO B;  1Q82 R;  3RKX A;  8ATC B;  4M7A E;  2WSC E;  4A4G A;  3OYE A;  4BDY A;  3KUF A;  1C6V X;  1N6A A;  2ZCF B;  2KQW A;  4A4F A;  2V26 A;  4M7D G;  1B3Q A;  3CXC S;  1QVG P;  1FMK A;  2F5K A;  5KCH A;  2KRS A;  3EG9 A;  4B9X A;  1JJ2 A;  4MDW A;  4KRT A;  2DL3 A;  4ZTJ A;  1UDL A;  1T0H A;  4XAX B;  4J6X A;  1ABQ A;  1WXT A;  1XJW B;  4F7U B;  2M1H A;  1I1J A;  1YN8 A;  3CC4 T;  3GBQ A;  1QVG S;  3CMA Q;  3LH5 A;  2YUP A;  1E6H A;  2VKN A;  1KD1 U;  4PJO C;  3CC7 A;  3OYC A;  1N9S A;  2EIF A;  4J5Y A;  4GLM A;  2LJ3 A;  3G6E Q;  3CPW A;  2QQA A;  3UA7 A;  5GAO l;  4ANJ A;  2RHX A;  4F7U E;  3TQ7 P;  4ESR A;  3OYH A;  4RTZ A;  2LMJ A;  3M59 A;  1Y07 A;  4DBR A;  2HL5 C;  3JSC A;  4M78 B;  3PMT A;  4M75 B;  3A98 A;  1LVK A;  2O2O A;  3UF4 A;  2DJZ A;  5D6W A;  3L42 A;  2DA9 A;  4VUB A;  2DXC A;  1SG5 A;  3VYG A;  5HY6 A;  2EFI A;  4PJJ A;  1Q7Y R;  2O4X B;  5CQY A;  4M7A G;  1TUC A;  3VYH B;  2EKH A;  3DB3 A;  2E5K A;  4OMO A;  3SHW A;  1JEG A;  1AWO A;  2KXC A;  1JBM A;  1VQL A;  2DXU A;  1I8F A;  3QPH A;  4QVZ A;  3NHN A;  4M78 E;  3OYI A;  1GL5 A;  1K9A A;  1BCO A;  4OB0 B;  1NG2 A;  2O31 A;  2VB6 A;  1VQO T;  2GFU A;  3CD6 Q;  4O6J A;  3EHQ A;  4MZT A;  2PZ1 A;  3OYM A;  1YWP A;  4X9D A;  3RUX A;  3H8Z A;  3TVT A;  3X25 B;  5IH2 A;  1ABO A;  3TRE A;  2EW3 A;  4JRP A;  1FXX A;  2DE0 X;  2DER A;  4MML A;  1YFN A;  5GMK m;  3JV3 A;  1VQN Q;  1UJY A;  2CH4 A;  1LPL A;  4DBQ A;  4PL6 A;  3MEV A;  3TU4 K;  2RHY A;  3OYF A;  2R5M A;  2IG0 A;  3NPF A;  4NL3 A;  4IIM A;  2AKL A;  1H3Z A;  2DIQ A;  2D1X A;  1R0B G;  2RJF A;  1KHI A;  3ZFJ A;  2DXT A;  2L2P A;  4F7U G;  2KEA A;  3FRN A;  2OJ2 A;  3QZ5 B;  1WYX A;  3BFM A;  1PG5 B;  5KE2 A;  1VQM T;  2L3S A;  1UE9 A;  4ZTF A;  2DL8 A;  4ORZ A;  2KT1 A;  1VIF A;  5CO7 A;  1X75 C;  5CAI A;  1QP3 A;  3FJP A;  5AYF A;  3ZEH A;  3CBM A;  1K1Z A;  3LH0 A;  3OB9 A;  2G3R A;  2M9U A;  2F69 A;  4PJO B;  5GAM e;  3G71 Q;  4JDS A;  3JCM X;  3PE0 A;  5D7U A;  1KD1 C;  5GAN e;  2D8H A;  1WQ7 A;  4M78 G;  4FYX B;  2RHU A;  1NEG A;  3CCE A;  5GAN h;  1M27 C;  1LCK A;  5KYN A;  5I11 A;  3VS2 A;  2E6N A;  4ELZ C;  1F1B B;  1G3Y A;  1U1T A;  1VQK A;  1SF9 A;  5KYU B;  4F04 B;  5CIU A;  2HBW A;  4PJO E;  4AG2 C;  4B9W A;  5GAM d;  2W10 A;  2QAZ A;  4Y28 E;  2RQV A;  3M0R A;  4DOW A;  1RL2 A;  3WVD B;  2B86 A;  2NUP B;  2CGH A;  2X35 A;  5IHI A;  3M0U A;  2PVD B;  3VKI A;  3AT1 B;  1W2B P;  2CS7 A;  5KE3 A;  3CCV Q;  4HCZ A;  1M8V A;  3I5S A;  2V8K A;  4E2F B;  1HXD A;  4QQD A;  3OQ5 A;  3M56 A;  4PJL A;  1X27 A;  3FC3 A;  3M0S A;  3OW2 P;  4OMQ A;  2E4H A;  1MNE A;  2L89 A;  1M3A A;  2L3Q A;  1BBZ A;  2P4R A;  2K3B A;  3KFV A;  2BZX A;  3KXT A;  1YI2 Q;  4MDX A;  3EGD A;  3PTA A;  1EX4 A;  4OP0 A;  4AFQ C;  1W2B S;  3JB9 F;  6AT1 B;  3I55 A;  4M75 A;  2WAC A;  1M5Q 1;  2YLC A;  2FPD A;  2J7I A;  3N5B B;  4ZGJ B;  4XTZ A;  1TG0 A;  3FJ5 A;  3OW2 S;  1YP5 A;  5L23 A;  2XDB A;  2VYT A;  1PCX A;  1CSK A;  3CCS T;  1Q81 C;  4ME7 A;  3LWI A;  3PFS A;  3FIF A;  3PNW C;  2DL4 A;  2VV5 A;  3VUB A;  4M7A D;  3X24 B;  4PJO G;  1ZQ1 A;  4X1V A;  2BUD A;  4LN2 A;  2FG0 A;  1JXM A;  2RQR A;  4LDW A;  2NUT B;  1M3C A;  2JTM A;  5IXB A;  2YUQ A;  4EMG A;  5LJ3 e;  1JU5 C;  4OF1 A;  3GOX A;  3CCE Q;  1VQN T;  3JCM W;  1NZ9 A;  3E19 A;  5LJ3 h;  3I56 Q;  2R5A A;  4C5G A;  1KD1 R;  5FU7 B;  2LTO A;  2AZV A;  3HSB A;  2GNC A;  2RHI A;  3JCM J;  4PJM A;  3QII A;  4FSS A;  3CC4 A;  1M2O A;  2KMT A;  4JZ3 A;  2PTK A;  1QKX A;  3E2U A;  4LD6 A;  5GAM f;  1N9R A;  1K0S A;  3OYN A;  2R57 A;  5GAN f;  2CSQ A;  1O9S A;  1QVF S;  4HCC A;  1C1A A;  2XDP A;  5KCO A;  2KYM A;  1ZLM A;  3EG0 A;  4BE2 A;  5GMK i;  2JS2 A;  3A5Z B;  2KDS A;  1YJN T;  5CQX A;  3G71 T;  1W1F A;  2LVM A;  1N8R U;  2DL5 A;  1R8O B;  1WJQ A;  2EKO A;  2JTF A;  1BYM A;  4BY6 C;  3ER0 A;  2A3L A;  1IHW A;  2MMP A;  1VQ7 Q;  2EAY A;  5GAN 2;  2RI5 A;  1MUZ A;  2D6F A;  2HCK A;  3A8L B;  2AZS A;  2FRY A;  3C0C A;  4O5V A;  2K5I A;  4LD9 K;  5A0L A;  3V7R A;  4FYV B;  1JB0 E;  4L6V 5;  2A37 A;  1ARK A;  4M77 B;  2NUP A;  1VYU A;  2VXE A;  3MO8 A;  4R0K A;  2FVU A;  2LZ6 B;  1Q7Y U;  3H6Z A;  2FYK A;  2EYZ A;  1NPR A;  5A0G A;  3CCV T;  3A8O B;  1OX9 A;  2EQI A;  2E3I A;  2AT1 B;  4DEX A;  3REB B;  4E7H A;  2GQI A;  1NE8 A;  2ZPF B;  3EH1 A;  4C0Z A;  1VQM A;  2FHD A;  1X01 A;  2JTE A;  1YI2 T;  2PU9 B;  5GJV B;  4WTO B;  3VS3 A;  1U8R A;  1NYG A;  1PC0 A;  3JCM e;  1K4U S;  4HT9 A;  4QQG A;  3S3N A;  3J80 E;  3JCM h;  3OMG A;  2LQK A;  1WHM A;  5LJ3 f;  4N4H A;  3OYA A;  3VV0 A;  1OEB A;  4HVV A;  2DVJ A;  2H3J A;  1BI3 A;  1PWT A;  1ZA2 B;  3OMC A;  2EYY A;  3EFR A;  1IXD A;  4BE0 A;  3SDZ A;  4EDU A;  4FM4 B;  1HYO A;  4C5I A;  5CCA A;  2CT3 A;  2NUT A;  2QGG A;  1X2Q A;  2DLP A;  3ME9 A;  4M75 F;  4BUG A;  4D8D A;  3M0T A;  2DYB A;  3CCL T;  3I56 T;  4GY5 A;  1WHG A;  2EGA A;  4J9H A;  2A36 A;  4PNO A;  3H0I A;  4DEY A;  2DTH A;  2BTT A;  1VQO Q;  2K6D A;  2NYS A;  2QXF A;  2X9H A;  3RKY A;  1TUD A;  1EIF A;  2HEQ A;  2HKQ B;  2RI3 A;  3QDR B;  3TSW A;  1Q95 G;  4LUD A;  2D0Q B;  3OA6 A;  2X4X A;  3EGX B;  2LQ8 A;  2M0Y A;  4FYY B;  1UUE A;  2L0A A;  2JT4 A;  1AZG B;  4JS5 A;  5M9O A;  1KSW A;  3LGF A;  4OGE A;  2MK5 A;  4M75 C;  2J06 A;  2ROT A;  4CC4 B;  1ZUU A;  3L2Z A;  3CBO A;  4XU2 A;  2YRV A;  3JB9 G;  2KGT A;  1Q7Y C;  1GBR A;  3FDR A;  4ZNX A;  1Y7X A;  2K2M A;  4C5E A;  3CPF A;  2YUO A;  1D09 B;  3JB9 H;  2GTO A;  3SFM A;  4E7I A;  1WGS A;  1XOV A;  2MWP A;  4Z8A A;  3NFC A;  1QLY A;  2X3X D;  3MEU A;  3CCS A;  4ZGD B;  1H8K A;  4PLL A;  2RPN A;  2Y4X A;  4JJN K;  3PT9 A;  4AFZ C;  1NPP A;  1AD5 A;  1I0C A;  3HFN A;  1M4Z A;  3VRY A;  1VQ6 Q;  1KIK A;  1UTI A;  5C0M A;  2KY9 A;  3E9G A;  2DYI A;  1QCF A;  1RAE B;  3C95 A;  4QW2 A;  2RK1 A;  3CXC A;  1VYV A;  4RTY A;  1YJ9 Q;  3MHX A;  2JS0 A;  1VQN A;  1O75 A;  2ZPH B;  4KGX B;  4XQ3 A;  4M77 A;  4P5N A;  4A4E A;  1WXU A;  3LWH A;  1FMW A;  5LJ5 d;  1R77 A;  3OS2 A;  4XK8 E;  3JCM f;  1RLQ C;  4C0G A;  2OX7 A;  1M3B A;  4MZM A;  1QVG A;  1SRM A;  1OUL A;  2LCL A;  2RJD A;  1YIJ Q;  4BB7 A;  1XQH A;  1PNJ A;  4C0F A;  1AT1 B;  1B07 A;  4AFS C;  2K5F A;  1N8R R;  1WLP B;  2DD4 A;  1WZO A;  2DRK A;  2F2W A;  4QQ6 A;  1TOV A;  2XDD A;  2C0T A;  1AWJ A;  3RBB B;  3LX7 A;  3RNJ A;  4DOV A;  2EJ9 A;  2E6Z A;  3G71 A;  3J81 E;  3VJP A;  1N27 A;  3EGD B;  3JB9 I;  1UGV A;  2CP7 A;  4EMK A;  1M30 A;  5I2S A;  4J9F A;  3OYL A;  4ELY C;  2P0K A;  1RI0 A;  1WNL A;  3M55 A;  2KI7 A;  2MOX A;  1C0M A;  1X43 A;  3V8L A;  5GAN 5;  2LJ1 A;  3CCJ T;  1RAA B;  2CZ7 B;  3BE3 A;  1RAB B;  3M4Y A;  2CP6 A;  4HVW A;  4KGZ B;  3CCS Q;  2SRC A;  3FB9 A;  3JRZ A;  4E7J A;  1OQK A;  4HVU A;  4M75 E;  2QA4 Q;  1NM7 A;  3E9F A;  3X28 B;  2FL7 A;  1TUG B;  4RUG A;  5I2M A;  4C92 D;  4Z89 A;  2DRM A;  1IRX A;  3I9Q A;  4CC2 A;  3OSS C;  3CCV A;  2DPP B;  3O8V A;  3OS1 A;  2WSE E;  3EGX A;  5FRM A;  1BI2 A;  1UG1 A;  1UFF A;  3PMI A;  5GAO p;  1OV3 A;  1YI2 A;  4C8Q D;  1TXQ A;  1FX7 A;  2PUK B;  2A7Y A;  1TSF A;  2RM4 A;  1P92 A;  2CUD A;  2L5Q A;  4XTY A;  1HSQ A;  2HKN A;  3QJ6 A;  3CME Q;  2GFA A;  4EMH A;  3EG1 A;  2DTO A;  4LDU A;  2LQN A;  3JB9 D;  2K3Y A;  2LDM A;  4QVD A;  2CRE A;  3OY9 A;  2PUO B;  2XK0 A;  3HHT B;  3SD4 A;  4PFP A;  3G4S T;  2DJQ A;  4RTT A;  4FT4 A;  3ZBD A;  4KGV B;  2DK3 A;  2BE9 B;  3WXM B;  1YJN Q;  3VS7 A;  1XTD A;  1I5O B;  2DM1 A;  2X4J A;  4OB1 B;  2ESW A;  1VQ6 T;  2K57 A;  3M0P A;  4CRI A;  1K73 R;  5GAM h;  4J9D A;  2RHZ A;  3HRU A;  4L59 A;  5FU7 C;  1YJ9 T;  4M75 G;  5GAN 7;  4J83 A;  3CCL A;  3PVQ A;  5A2Q E;  2ENM A;  3I56 A;  5GAO n;  4FW2 A;  1QP2 A;  1BCM A;  5CKE A;  5GAN 3;  1V1C A;  4ZN1 A;  5IHN A;  4M7D D;  1AVZ C;  2QI2 A;  1J3T A;  1G3T A;  3GNG A;  4JJD A;  3UDC A;  1YIJ T;  1RAC B;  5FWC A;  1WHL A;  4OMM A;  2DMO A;  2CKK A;  2QDL A;  2CZ1 B;  5I22 A;  4M77 F;  5CK9 A;  2CDT A;  2LNH B;  2QK0 A;  1W2B A;  2RQW A;  5EG2 A;  1QWE A;  1I5L A;  2EBP A;  1VQ4 Q;  1VQ8 Q;  2HQH A;  4F17 A;  1WHK A;  2ED1 A;  3LYI A;  3OW2 A;  2OTL Q;  4M4Z A;  3QHS A;  1SPK A;  1VQ7 A;  4XTX A;  1ZSG A;  4XU3 A;  1IRE B;  1OU9 A;  3HRS A;  4AT1 B;  2YDL A;  2CP0 A;  2L3P A;  3LW5 E;  3QJY A;  1M1G A;  2KXD A;  1X2K A;  3PGG A;  5DLQ E;  1UEC A;  5FLX E;  2EQU A;  4Z02 A;  2RMO A;  2HD0 A;  2DBM A;  4OB3 B;  3GLX A;  1UGS B;  4D6W A;  1AOJ A;  4M77 C;  2RA2 A;  1NEB A;  5D6Y A;  1T3L A;  4IKF A;  4R56 A;  1V76 A;  3JCM g;  2QA4 T;  1X6G A;  2MYS A;  4JS4 A;  2GF7 A;  1PSF A;  3EFO A;  4IUP A;  2DNU A;  2KNB B;  1IO6 A;  4IUU A;  2CP3 A;  3QYG B;  2KAF A;  2QEX T;  1E6G A;  4IIO A;  3VS4 A;  3VS0 A;  3CCL Q;  2RO0 A;  4OMN A;  1H3H A;  3T9N A;  1HK9 A;  2V1R A;  2KBT A;  4OB2 B;  3PIP A;  4XU0 A;  1ACM B;  3A8H B;  5C6S A;  3FEO A;  1YIT T;  1QVF P;  1Y57 A;  2CYZ B;  2QQ9 A;  1ZSZ A;  4J7F A;  3RMS A;  1BKB A;  3EH2 A;  5IT9 E;  2GCX A;  1QKW A;  1M1F A;  3URG A;  3CCQ Q;  2OAU A;  3TEE A;  1K9M U;  3CME T;  3MP1 A;  1Y71 A;  1DJ7 B;  2LQW A;  4ZGE B;  3LLR A;  3MEA A;  1RLP C;  2YLB A;  2F5T X;  1BIA A;  5GAN 4;  5FRO A;  2KT8 A;  4GBQ A;  4EMK C;  3DKM A;  1RAI B;  4ATO A;  3QYH B;  2JM8 A;  2DIG A;  2A28 A;  1PHT A;  2EGE A;  3RIR A;  3OBY A;  3RKW A;  1X6O A;  1WHH A;  4XU1 A;  4D8K A;  1GCQ A;  1D3B B;  3M5A A;  2HSE B;  3L2Q A;  2CP2 A;  3MCA B;  4ZN3 A;  3RR6 A;  2DET A;  2HQE A;  2FZC B;  1S1N A;  1NJI U;  3OYY A;  1OI1 A;  4HCK A;  5IHK A;  3CC7 T;  4J9G A;  2DKG A;  1LOJ A;  4M78 D;  4M75 D;  2FRW A;  2GBQ A;  4RG2 A;  3V7S A;  2JZ2 A;  5HKC A;  4JRQ A;  1VQO A;  3REA B;  2Z0W A;  8AT1 B;  3V8J A;  1KC8 U;  4A54 A;  2C0O A;  1IGQ A;  4PKC C;  1OZ2 A;  3JCM b;  3P8B B;  2MF2 A;  3VU3 C;  9ATC B;  3INZ A;  4RKU E;  1PRM C;  3UAT A;  2RH2 A;  5GJW B;  3M58 A;  1G5V A;  1T3S A;  4LDX A;  2JMC A;  3V8K A;  4HKE A;  4HXJ A;  4NL2 A;  3ULR B;  4AFU C;  2VVK A;  3NGP A;  2LRQ A;  3MPU B;  4HT8 A;  1VQ4 T;  5IXF A;  3HTR A;  1VQ8 T;  3EG2 A;  3CCM T;  2MWO A;  1UHF A;  4M77 E;  2O9V A;  1SRL A;  2W0Z A;  2OTL T;  2ZAE A;  2B8A A;  1VQP T;  3CEY A;  1M1K U;  3OYD A;  3G4S A;  2RB6 A;  2ZGW A;  4AG1 C;  3CCR T;  4LUE A;  2QTV A;  1VQ6 A;  1R0C B;  2EGC A;  3A1P A;  1SHG A;  3O5Z A;  1K9M C;  1M9S A;  1G2B A;  2LP5 A;  2XIC A;  1AZE A;  4EMK B;  1KQS A;  1YJ9 A;  1IGU A;  1VQ9 Q;  3G7Z A;  2R58 A;  2VGN A;  2RNA A;  2CT4 A;  1PSE A;  2LX7 A;  4JLG A;  2DD5 A;  2Y90 A;  4K11 A;  1QQJ A;  4PJO D;  3M0Q A;  3CCJ Q;  2KRM A;  3PIO A;  3C94 A;  4DBH A;  3S3M A;  3DB4 A;  1FYN A;  4RCC A;  3QBY A;  2YWW A;  1VQ5 Q;  1QW1 A;  2FPE A;  4NOY A;  5D6X A;  1M2V A;  4HCB A;  1N8R C;  1YIJ A;  3SWN C;  3MEW A;  1NJI C;  4JRI A;  2ZZD A;  4FL6 A;  1K73 U;  1K0X A;  4II1 A;  3VS1 A;  3QWX X;  2LC4 A;  4J9E A;  2QG9 B;  3CCQ T;  3OYB A;  3CC2 T;  2XKO C;  1WDX A;  4M77 G;  4MZP A;  2E10 A;  3HPW A;  4NS5 A;  1KC8 C;  1OYX A;  1Z9Z A;  4BI8 B;  1JO8 A;  1RI9 A;  2AKK A;  3R6N A;  2C0I A;  1S72 Q;  2RQU A;  4QVC A;  4WF2 A;  5CVI A;  3EAE A;  1WI7 A;  4PLI A;  1D3B A;  1D1C A;  4IUR A;  4XTV A;  1W70 A;  2JM9 A;  3U23 A;  2EQJ A;  2KVQ G;  4EIK A;  5GMK e;  2HQX A;  3QDF A;  5GMK h;  2NWM A;  2BE7 D;  2RQT A;  1G3S A;  3EGU A;  2HNI A;  3G4S Q;  1M8M A;  1HD3 A;  5LJ5 e;  1GBQ A;  2PVG B;  2QA4 A;  4JPB W;  1D0Y A;  2EYW A;  4WCI A;  5LJ5 h;  1M1K C;  2ZPG B;  4FT2 A;  2K7A A;  1QVP A;  2QEX A;  4KT0 E;  3J7A F;  4M7A B;  4FSX A;  5CKH A;  1WA7 A;  3I55 T;  2ABL A;  3S3O A;  1I81 A;  1WX6 A;  1NLP C;  3CQT A;  5KYX B;  1K9M R;  2V8I A;  1ZSZ C;  1KHC A;  2OI3 A;  2PQW A;  1YIT A;  3VUZ A;  1U5S A;  2F2V A;  2MCN A;  4C92 A;  2MPX C;  5GAM g;  4JJC A;  3NMZ C;  1TWB A;  1AHJ B;  1Z9Q A;  3H41 A;  3I5R A;  4TVR A;  3CCU Q;  3JB9 J;  2E12 A;  4E7S A;  5GAN g;  4J9B A;  2RD1 A;  1JRI A;  5FU6 B;  3CME A;  1Y0M A;  5L8R E;  1JXO A;  1JJ2 P;  1A0N B;  3SWN B;  4C8Q A;  1K8A R;  1VUB A;  1YHQ Q;  1NJI R;  1GCQ C;  4E47 A;  5CKF A;  2NUZ A;  4J8O A;  4DBF A;  1UJ0 A;  1K73 C;  2YHT A;  2VWF A;  1QCO A;  3CBP A;  1YJN A;  1H64 1;  1SHF A;  3DLL A;  3OBW A;  5ECA A;  1D1A A;  1JJ2 S;  1E7O A;  5FRN A;  2JMA A;  2CUB A;  1KC8 R;  4J6Y A;  1UEB A;  5GMK l;  3CPW P;  1PD1 A;  1SKU B;  2OTJ Q;  4CI0 C;  2QQR A;  1VQ9 T;  2ROL A;  4OMF B;  2DBK A;  5EC7 A;  4LNP A;  1AWX A;  2YRC A;  4PFO A;  2CZ0 B;  2D9T A;  3L2U A;  2K5L A;  2A0F B;  1UHC A;  2QTX A;  4X9C A;  2KE9 A;  2EVR A;  5CR2 A;  2COZ A;  4KH1 B;  1VQ5 T;  3L2V A;  3RER A;  3L2R A;  3CPW S;  2PNI A;  1FWZ A;  2K3X A;  1OZ3 A;  2DF6 A;  2CH4 W;  1Y96 A;  2XID A;  4KUL A;  2EPD A;  3QKJ A;  2I0N A;  4FCY A;  3EFO B;  3NTK A;  1AEY A;  3H9N A;  3X26 B;  4M7D A;  3P8H A;  4J7I A;  2M16 A;  3QG1 A;  2QEX Q;  5J26 A;  1OU8 A;  2DIL A;  1M1K R;  2JVV A;  1TTH B;  4MMK A;  1YJW Q;  1RAD B;  4M77 D;  1VQ4 A;  3AHU A;  1YIT Q;  1VQ8 A;  1GRI A;  3CCM A;  2E1H A;  4RG8 A;  1Q86 U;  5GAO m;  1ZSZ B;  4OML A;  2KRO A;  2XI9 A;  5KYW A;  1S72 T;  1I4K 1;  2RJE A;  1SSF A;  2OTL A;  2KK4 A;  5LJ5 f;  2XHC A;  1RUW A;  2KSS A;  3D7S B;  1VQP A;  5LJ3 g;  1U06 A;  4E7K A;  5GAM j;  1BB9 A;  3CCR A;  5GAN j;  2JW4 A;  2J05 A;  1QMC A;  3OS0 A;  3IQL A;  1GFD A;  3BDL A;  4LDY A;  3VRZ A;  1VYT A;  3L2W A;  2MIO A;  1CKB A;  1BI0 A;  2XG8 D;  5KYY A;  1Q81 U;  2DVE A;  3JCM V;  2JOY A;  3GIB A;  4F16 A;  2FZK B;  2RF0 A;  2KRN A;  2V1Q A;  2YSQ A;  2IIM A;  4IUQ A;  4BAC A;  3WVE B;  2DL7 A;  2AIR B;  4M7A A;  2MI6 A;  2AHJ B;  3CC7 Q;  1G83 A;  2GGR A;  5KYX A;  2M0O A;  3EG3 A;  5IAY A;  2DZ9 A;  2QQB A;  2DTI A;  3ASK A;  1D0X A;  2RN8 A;  5GAO q;  1MV0 B;  2HSP A;  3F70 A;  4C0D C;  3SB2 A;  2AK5 A;  3H0F A;  4F14 A;  3CCU T;  5KH6 A;  3CCQ A;  3CC2 A;  1G8X A;  1WJS A;  1D0Z A;  1PKS A;  5FWB A;  1GCP A;  1EFN A;  4E7L A;  1KJW A;  3UT1 A;  1V29 B;  2KYB A;  4FYW B;  3SWN A;  1KQ1 A;  1YHQ T;  4C5H A;  1I07 A;  2QYZ A;  1VOM A;  1X69 A;  2LJ0 A;  1WQW A;  1VQL Q;  4C92 F;  5GAN d;  2NLU A;  1SSH A;  1VIE A;  4F7U A;  1G3W A;  2M51 A;  1YCS B;  1PRL C;  3CCM Q;  1WIE A;  2O9S A;  4JZ4 A;  1OPL A;  2LT1 A;  3CMA T;  2OTJ T;  3BY7 A;  3MKD A;  1PM3 A;  2JUF A;  1VQP Q;  1ZBJ A;  5DY9 A;  2E70 A;  3ZL7 C;  3L1A A;  3G6E T;  4C8Q F;  1PD0 A;  1Q86 C;  3M9Q A;  2BKD N;  1MMD A;  1M90 U;  3M53 A;  2EQM A;  3CCR Q;  1JQQ A;  1K76 A;  4J9C A;  5LJ3 j;  4RTU A;  5J3B A;  2P84 A;  3OSV A;  4GLK A;  3GNF B;  3QUI A;  2JN0 A;  1TH7 A;  2ATC B;  4M78 A;  3HL8 A;  2E3H A;  1ZA1 B;  1TU0 B;  2A08 A;  2VUB A;  4C92 C;  1BI1 A;  4N0A C;  4V2S A;  2F1L A;  2VC8 A;  1BK2 A;  5I21 A;  1RAH B;  3RES A;  3HKS A;  2O4X A;  5HK0 A;  2E64 A;  3BDU A;  2XD0 A;  4RTX A;  2H3E B;  1M2V B;  3MP8 A;  1YJW T;  2XU8 A;  2VAS A;  4C8Q C;  1W6X A;  3HRT A;  5CKB A;  1LJO A;  3CD6 T;  3M57 A;  1KK7 A;  1ZBX A;  3JCM c;  7AT1 B;  4Y92 A;  5GAN 8;  1LNX A;  1QVF A;  4C0D B;  4FIB A;  2JNG A;  3CC2 Q;  2WSF E;  1U3O A;  2DAQ A;  4B6M A;  4KUI A;  1KFZ A;  1VQK Q;  4M7D F;  5DM7 R;  1MND A;  2EWN A;  1IHV A;  3P8D A;  4IUV A;  2FEI A;  2ZPB B;  5CKD A;  4RTW A;  2QAS A;  3RMQ A;  1MMG A;  2D8J A;  2K4Y A;  1X6B A;  1FMV A;  4LXC A;  1B34 B;  1Q82 U;  1VQ9 A;  2EJF A;  4QT7 A;  3NTI A;  4PFZ A;  4BD3 A;  2RJC A;  5LJ3 d;  4A4K A;  1OOT A;  2X4W A;  2EJG A;  1K8A U;  3JCM P;  1B7T A;  2BIV A;  2E41 A;  3CCJ A;  2MAM A;  2K79 A;  2P0P A;  3OYJ A;  2OAW A;  3M54 A;  5J39 A;  1VQ5 A;  2LT4 A;  2EYQ A;  1D1B A;  2BZ8 A;  4LE9 A;  3A8G B;  2X4Y A;  4IUT A;  1NBE B;  2QQS A;  1SEM A;  4PJO A;  3GPL A;  1YCY A;  4M7D C;  2P4T A;  4DQ2 A;  4KUD K;  2K9G A;  2YXY A;  3UA6 A;  1Q86 R;  2D0N A;  5GAN 6;  1AWW A;  2VXF A;  4CC7 A;  1ZHI A;  1PKT A;  1QWF A;  1M90 C;  1XNI A;  2CP5 A;  2DEU A;  4A4H A;  3I55 Q; 
#chains in the Genus database with same CATH homology
 4HVU A;  3M0S A;  2G6F X;  4OMQ A;  1H92 A;  1W70 A;  1M3A A;  2L3Q A;  1NM7 A;  2JM9 A;  4Z88 A;  1BBZ A;  3U23 A;  2P4R A;  2K3B A;  3KFV A;  3VS5 A;  2BZX A;  4CC3 A;  4EIK A;  4RUG A;  4Z89 A;  2DRM A;  3I9Q A;  4CC2 A;  1HJD A;  4AFQ C;  2NWM A;  2RQT A;  2EYX A;  2KR3 A;  3EGU A;  1M8M A;  1HD3 A;  1UG1 A;  2FPD A;  2J7I A;  4RTV A;  1GBQ A;  1TG0 A;  2JXB A;  3FJ5 A;  4JPB W;  2EYW A;  1YP5 A;  4WCI A;  5L23 A;  1UFF A;  1OV3 A;  2F2X A;  2K7A A;  1CSK A;  1ZUY A;  2CUD A;  1WA7 A;  2ABL A;  1HSQ A;  2DL4 A;  1WX6 A;  1NLP C;  3CQT A;  2X3W D;  4X1V A;  3EG1 A;  4LN2 A;  2HDA A;  2OI3 A;  2LQN A;  1CKA A;  2FG0 A;  1JXM A;  2RQR A;  1U5S A;  2F2V A;  2YT6 A;  2MCN A;  2CRE A;  2ECZ A;  4JJC A;  3NMZ C;  1M3C A;  5IXB A;  1OPK A;  2YUQ A;  1Z9Q A;  1ZUK A;  3H41 A;  3I5R A;  1JU5 C;  4J9B A;  2DJQ A;  4RTT A;  3SEM A;  1Y0M A;  3VS7 A;  2FPF A;  2J6F A;  2AZV A;  2GNC A;  5FW9 A;  2DM1 A;  5HCK A;  1JXO A;  2ESW A;  4A63 B;  3M0P A;  1A0N B;  4FSS A;  1T0J A;  4J9D A;  4JZ3 A;  2PTK A;  4OMP A;  3I35 A;  1QKX A;  1GCQ C;  2DX1 A;  2XMF A;  2YUN A;  3PVQ A;  2NUZ A;  2ENM A;  4J9I A;  1UJ0 A;  2VWF A;  1K0S A;  2BZY A;  1SHF A;  2CSQ A;  5ECA A;  1E7O A;  1V1C A;  2JMA A;  2CUB A;  2KYM A;  1ZLM A;  5IHN A;  2ED0 A;  3EG0 A;  1AVZ C;  3THK A;  1J3T A;  3QWY A;  2ROL A;  2JS2 A;  4JJD A;  2DBK A;  5EC7 A;  4LNP A;  1AWX A;  1VA7 A;  5FWC A;  1W1F A;  1UHC A;  2KE9 A;  4OMM A;  2DMO A;  2DL5 A;  2EVR A;  2QDL A;  2J6O A;  3EHR A;  1NYF A;  5I22 A;  4JJB A;  1NLO C;  3PVL A;  2PNI A;  2GTJ A;  1GFC A;  1MUZ A;  2CDT A;  2LNH B;  3TSZ A;  2RQW A;  1QWE A;  2CSI A;  1YNZ A;  2DF6 A;  2CH4 W;  2EBP A;  2HCK A;  2AZS A;  2EPD A;  2FRY A;  4F17 A;  2I0N A;  3C0C A;  1AEY A;  2H8H A;  2ED1 A;  2O88 A;  4M4Z A;  1SPK A;  1ZSG A;  1MV3 A;  2DIL A;  2FO0 A;  2A37 A;  1ARK A;  3H0H A;  2YDL A;  2L3P A;  1VYU A;  4R0K A;  1GRI A;  2KXD A;  1WXB A;  1X2K A;  2LZ6 B;  1UEC A;  2EYZ A;  4OML A;  2KRO A;  2RMO A;  2DBM A;  1AOJ A;  1RUW A;  2EQI A;  1NEB A;  4DEX A;  1YWO A;  1T3L A;  1U06 A;  1N5Z A;  4E6R A;  1ZX6 A;  1BB9 A;  3REB B;  2GQI A;  3VS6 A;  1X6G A;  1WFW A;  2JTE A;  2JW4 A;  2J05 A;  2DNU A;  2KNB B;  3IQL A;  5GJV B;  1GFD A;  1IO6 A;  2J6K A;  3VRZ A;  1VYT A;  3VS3 A;  1E6G A;  4IIO A;  1NYG A;  2LCS A;  3VS4 A;  2MIO A;  3VS0 A;  1CKB A;  2SEM A;  4OMN A;  1K4U S;  1H3H A;  2V1R A;  1BU1 A;  2KBT A;  1Y57 A;  1B3Q A;  2RF0 A;  4F16 A;  2KRN A;  2V1Q A;  2YSQ A;  1FMK A;  2IIM A;  1OEB A;  1QKW A;  4HVV A;  2KRS A;  2DVJ A;  2DL7 A;  1PWT A;  4KRT A;  2DL3 A;  1UDL A;  1T0H A;  2EYY A;  1G83 A;  2GGR A;  3EG3 A;  2LQW A;  1ABQ A;  1WXT A;  1RLP C;  1I1J A;  1YN8 A;  2RN8 A;  1MV0 B;  2HSP A;  2KT8 A;  4GBQ A;  2CT3 A;  2AK5 A;  3H0F A;  4F14 A;  3GBQ A;  1X2Q A;  2DLP A;  2JM8 A;  4D8D A;  2A28 A;  3M0T A;  1PHT A;  2DYB A;  3LH5 A;  2EGE A;  2YUP A;  1E6H A;  2VKN A;  1PKS A;  5FWB A;  1GCP A;  2EGA A;  4J9H A;  1EFN A;  4D8K A;  1GCQ A;  4GLM A;  1KJW A;  2A36 A;  2LJ3 A;  3H0I A;  3UA7 A;  4DEY A;  2KYB A;  2BTT A;  2K6D A;  1S1N A;  4ESR A;  4RTZ A;  1TUD A;  1I07 A;  2LMJ A;  2HEQ A;  4HCK A;  1X69 A;  2LJ0 A;  3TSW A;  5IHK A;  4LUD A;  4J9G A;  3A98 A;  2M0Y A;  1SSH A;  2FRW A;  2GBQ A;  2O2O A;  3UF4 A;  1UUE A;  2L0A A;  2M51 A;  1YCS B;  1PRL C;  2JT4 A;  1AZG B;  1WIE A;  2DA9 A;  2O9S A;  4JZ4 A;  1OPL A;  3REA B;  1KSW A;  1TUC A;  2EKH A;  3SHW A;  2E5K A;  4OMO A;  1JEG A;  2J06 A;  2C0O A;  2ROT A;  1AWO A;  4CC4 B;  2KXC A;  1ZBJ A;  1ZUU A;  3ZL7 C;  2KGT A;  1PRM C;  3NHN A;  3UAT A;  5GJW B;  1GBR A;  1GL5 A;  4ZNX A;  1K9A A;  2K2M A;  1NG2 A;  1T3S A;  2O31 A;  2YUO A;  1JQQ A;  1K76 A;  2GTO A;  4J9C A;  2JMC A;  1XOV A;  3EHQ A;  4RTU A;  2PZ1 A;  4Z8A A;  1YWP A;  3TVT A;  5IH2 A;  1QLY A;  1ABO A;  2X3X D;  2EW3 A;  4HXJ A;  2DE0 X;  3ULR B;  1H8K A;  4AFU C;  2RPN A;  2VVK A;  3JV3 A;  3NGP A;  1UJY A;  4AFZ C;  2CH4 A;  2A08 A;  5IXF A;  3EG2 A;  1AD5 A;  1I0C A;  1UHF A;  1BK2 A;  2O9V A;  3VRY A;  1SRL A;  1UTI A;  1KIK A;  2W0Z A;  1QCF A;  3NPF A;  4IIM A;  2AKL A;  2D1X A;  1VYV A;  4RTY A;  4RTX A;  2JS0 A;  2L2P A;  2KEA A;  2OJ2 A;  1WYX A;  1W6X A;  1WXU A;  4AG1 C;  2L3S A;  1UE9 A;  4LUE A;  2EGC A;  1SHG A;  3O5Z A;  4Y92 A;  2DL8 A;  1RLQ C;  4ORZ A;  1G2B A;  2KT1 A;  2LP5 A;  1AZE A;  1M3B A;  1K1Z A;  1SRM A;  1U3O A;  2RNA A;  2CT4 A;  2LX7 A;  1KFZ A;  4K11 A;  1PNJ A;  1B07 A;  2FEI A;  4AFS C;  3M0Q A;  2KRM A;  3PE0 A;  4RTW A;  1WLP B;  2D8J A;  2DRK A;  2F2W A;  1FYN A;  2D8H A;  1X6B A;  2C0T A;  1NEG A;  2FPE A;  1AWJ A;  3RBB B;  1M27 C;  1LCK A;  3RNJ A;  4QT7 A;  5I11 A;  3VS2 A;  1OOT A;  1K0X A;  3VS1 A;  2HBW A;  3QWX X;  2K79 A;  1UGV A;  4J9E A;  2OAW A;  4AG2 C;  2W10 A;  1WDX A;  1M30 A;  2RQV A;  3M0R A;  2BZ8 A;  4LE9 A;  4J9F A;  2MOX A;  1SEM A;  1X43 A;  2B86 A;  1Z9Z A;  2LJ1 A;  5IHI A;  3M0U A;  2K9G A;  3UA6 A;  1JO8 A;  1RI9 A;  4HVW A;  2D0N A;  2AKK A;  3R6N A;  1AWW A;  4CC7 A;  2C0I A;  1PKT A;  2RQU A;  3I5S A;  1QWF A;  2SRC A;  1WI7 A;  1X27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...