2RH2A

High resolution dhfr r-67
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
b'ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrofolate reductase type 2
molecule tags Oxidoreductase
source organism Escherichia coli
publication title Crystal Structure of a Type II Dihydrofolate Reductase Catalytic Ternary Complex
pubmed doi rcsb
total genus 11
structure length 57
sequence length 57
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2007-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rh2A00
2P4TA 3UDCA 2OAUA 3SFMA 2VV5A 2RK2A 2RH2A 3T9NA 1VIFA 2GQVA 1VIEA 2RK1A
chains in the Genus database with same CATH superfamily
1UG1A 3EG9A 2K3BA 4AG1C 1YJNT 1QVFP 1SHFA 3EGDB 3PNWC 4JJDA 2Z0WA 5KE3A 4JZ4A 4F17A 4FSXA 2NLUA 3RKWA 4E7IA 1VQMA 2LP5A 1MUZA 1NJIC 1SG5A 1I1JA 4P5NA 2FHDA 4JRIA 4YTLA 3JCMW 2DKGA 2HL3A 2V26A 1Z9QA 3QSUA 3CCQQ 4XTXA 1ZSZC 3UATA 5LJ3d 1RL2A 1Q86R 1KK7A 3M4GA 2B8AA 3MP1A 1AWWA 1K9AA 1ZUKA 2EGAA 2OJ2A 1JQQA 2P4TA 2OAWA 2ZZDA 3SWNC 1BKBA 2EQUA 2F2WA 3SWNB 3JB9F 2KRSA 4BACA 2CP3A 4R0KA 5IH2A 4Z8AA 3RBBB 3VJPA 5KYXB 1UHFA 3UDCA 3OYNA 1O75A 1NLPC 4RTZA 3CCVT 4M75E 1VIFA 2D9TA 2ED1A 1RUWA 1NPPA 5LJ5h 1OX8A 4GLKA 4FYVB 3M55A 1H3ZA 4M7AA 2LCLA 4E7LA 1U1SA 3CC4T 2ZPFB 4IIMA 5GAOm 3MEAA 2EYQA 4RTVA 2DFUA 2X4XA 1D3BA 2VV5A 1GFCA 1ZX6A 2E65A 5HK3A 2FPDA 1K0XA 2F2XA 2HEQA 2M0YA 1AWXA 2NYSA 2C0OA 4EDUA 4C92G 2BZ8A 4M7DB 2MMPA 3M5AA 2FVUA 3QHSA 1OOTA 2K5FA 3I56A 1AWOA 3GF5A 2ZPHB 2KYMA 2GF7A 1JJ2P 2JS2A 4HVVA 1N8RR 2CYZB 3ULRB 2CUDA 4A53A 4AMCA 5GAMj 2O4XA 1Q81U 1VQ8T 2KDSA 3V8KA 3TQ7P 3JV3A 1QVPA 3EHRA 4QQ6A 2ECZA 2L5QA 3PE0A 1OU8A 3QO3A 3A5ZB 4PL6A 2CZ6B 3VS1A 1F1BB 2LQNA 1M90C 4KUDK 4M7DE 3I55Q 4KH1B 4IUQA 4QQDA 1PG5B 4PJJA 1Q7YC 3CCVA 3UT1A 4J9FA 1KD1R 1QWEA 2DETA 3E1SA 1ZBJA 3V8JA 2DX1A 1MHNA 2AZVA 3OYBA 3CCMQ 1VQ6A 3CC4Q 1JB0E 3CMEQ 2LTOA 4A54A 2A08A 4C0DC 1VIEA 4HT9A 1TXQA 3C12A 3L2QA 3X20B 3H6ZA 4CC2A 1FXXA 4EMKA 1V1CA 4C0DB 3CC2A 4C0FA 4J8OA 1SHGA 2F1LA 4KBMB 5FWCA 1XTDA 1IB8A 2GQVA 4FCYA 3O5ZA 2DERA 1NEBA 5KYXA 1IHWA 4XTUA 3OYIA 1W2BP 1SRMA 2DA9A 1D0YA 3M0TA 4M77F 1JBMA 2GTJA 1KQSS 2EQIA 2ZPBB 1YWPA 3FRNA 2K4YA 3M57A 2CSQA 3HFNA 1K1ZA 4LDWA 2DZCA 2MCNA 1NJIR 2CDTA 1OZ3A 1BI2A 3LGFA 2XG8D 3DKMA 2VGMA 3EGUA 4WF2A 3WVDB 4E6RA 4OB0B 2KROA 3VYGA 4JZ3A 1QVFA 4DEXA 2GBQA 2MWOA 1YHQA 1U8RA 1LCKA 2COWA 2L0AA 2M1HA 3MP6A 2E12A 4QT7A 1M1GA 1YJ9A 4NOYA 3LX7A 1AD5A 4M7DD 4ZGEB 3TREA 3PMTA 1X6BA 4BB7A 1P92A 1SEMA 3EG0A 2EYXA 1M2VB 4X9DA 1RADB 2HKNA 3DB3A 2IIMA 3L42A 1PD1A 1R8OB 4A4EA 4R56A 2DZ9A 2FL7A 2DRKA 4PJOB 1QVGP 4A4FA 3CC2Q 3G6EA 2QEXT 1H3HA 2OTJT 2K57A 5GANj 3CMAA 4K11A 3H41A 3IQLA 4M75G 2KK4A 3GBQA 4LDXA 3CPWA 3CMEA 4BY6B 1U06A 2RQUA 2PNIA 2XDPA 2EYZA 4D6WA 2K2VA 3BFMA 4BE1A 3J80E 1B3QA 5FWBA 1GBQA 1WPYA 3VS7A 2AK5A 4C0ZA 1UJYA 3LYIA 5A2QE 3F70A 2KBTA 2YLCA 2QA4T 4JJBA 5CKDA 2CREA 1KIKA 1D1BA 3NGPA 1VQPA 3OS0A 3N5BB 4XU1A 3CCRA 1H641 4RTTA 2DTOA 4FSSA 4RTXA 2RA2A 1UEBA 3V7CA 4BI3A 4LE9A 5HCKA 5FRNA 2XU8A 1ZHIA 4IUUA 4RG8A 1YHQT 2QG9B 3MEWA 1K9MC 2F69A 2K9GA 2JW4A 4DBQA 5GAN8 2LT1A 2W10A 1VQLT 3A8HB 5KH6A 2R5AA 1YIJT 2H3EB 4FIBA 3PTAA 2V8IA 3I56Q 1QCFA 1D1AA 2CZ7B 2QA4Q 2RI3A 2V1QA 4O6JA 3GNGA 5GAMd 1I0CA 4MDXA 2YHTA 2PVGB 1YP5A 4Q5WA 1JRIA 2O88A 5IHNA 5LJ5e 5I2MA 2COZA 1H8KA 2LQWA 5LJ3f 8AT1B 1K73R 3CD6T 3M0SA 4RKUE 2YUQA 1OX9A 2C06A 3QG1A 1Y57A 1MNEA 4PFZA 3CCSQ 2FG0A 5LJ3h 4XTWA 1ZUYA 1QP3A 1AWJA 4M7AG 2EKHA 4N4GA 1Q86U 4C5HA 1VQNA 2JMCA 2CT4A 2LZ6B 2JOYA 3CPWP 1GXIE 2X4WA 5LJ5f 2DYIA 1J3TA 3JB9I 1TG0A 1G3SA 1XOVA 3VS6A 3CXCP 1WGSA 5GMKh 4N4IA 1UUEA 1MV0B 1QVGA 3R6OA 1YIJQ 1IZ6A 2J6KA 3CCLQ 2MOXA 2DL3A 2M9UA 3RERA 1M3CA 4OB1B 5A0LA 2EQMA 3QBYA 4C8QF 2P84A 1UE9A 3EGXA 4NL3A 1IGUA 3CPWS 3S3NA 3QIIA 4M7AB 1G3TA 3M0UA 3JRZA 5ECAA 2RO0A 3SFMA 1VQ7T 2DNUA 3QJYA 3S3MA 3GP8A 4ATOA 2DYBA 5C0MA 3G4SA 2RH2A 1YITA 1K4US 4RTWA 1ACMB 3KUFA 2QK0A 3PIOA 2RPNA 3QUIA 1U3OA 3Q1JA 1KG1A 3OBWA 1VUBA 2VXFA 2DK3A 2XIDA 1X69A 3OYDA 2DIGA 3CMAQ 3G6EQ 1OPLA 2PVOB 4PKCC 4M7DG 1M2OA 1FYNA 2HBWA 2RNAA 3VS3A 2X3XD 3HRSA 4OF1A 3CC7Q 5CIUA 3OYEA 1TU0B 2X4YA 5LJ3g 4ZN3A 2ABLA 2L3SA 1VQMT 4M78G 1UJ0A 3FLGA 2QEXQ 1ZSGA 4KGXB 3VRZA 3CC2T 4J5YA 1SRLA 2JT4A 5GANh 1X01A 2JTEA 2DL5A 3I55T 2BZXA 2JTMA 4X34A 3LH5A 1NZ9A 1UGPB 4VUBA 4BDYA 4IKFA 5DM7R 1Y07A 2ZAEA 3C4SA 1PCXA 1HYOA 2FB7A 1GCQA 2RHIA 2RJEA 1YJWT 4ORZA 4M7AC 4E7ZA 2DF6A 2YUPA 1G83A 3HKSA 2DVEA 4Y28E 2K7AA 1X2KA 4LXCA 1U1TA 5GANe 2E1HA 1OU9A 5EC7A 4XTZA 2PU9B 3I9QA 3PIPA 1OYXA 1ZA1B 3OYGA 5KCHA 2RM4A 2VB6A 5D6YA 3JCMc 1HD3A 5M9OA 3MHXA 1PKSA 4OMLA 3TEEA 4HT8A 2G3RA 2DL7A 3OMGA 3FDRA 1KQ2A 4Z89A 3PMIA 1KHCA 4MZTA 2KI7A 5AYFA 2O4XB 5IHIA 2RI2A 2SEMA 4M78B 3UA7A 3MP8A 1M3BA 3A8GB 2FRYA 2ESWA 4PJOG 2P4RA 3RNJA 1G3WA 1OPKA 3M0QA 4F7UE 1WHLA 2ROTA 4FT4A 2YWWA 1VQKA 4OMQA 3X24B 1CSKA 3M53A 2WACA 3CMET 2DXBA 5I2SA 4AFQC 4L59A 3FJ5A 3CCET 2M02A 4BI4A 4B9XA 2EJ9A 1KD1C 4M7DA 2DVJA 5GAN6 1Q7YR 1JJ2A 6AT1B 4EMGA 3UA6A 4JJNK 1PKTA 2DL4A 1M30A 1WQWA 2FZKB 4PJLA 3CXCA 3CCJQ 3P8BB 5GMKe 2RHZA 3A8OB 3ZBDA 2L89A 3OYKA 2ZGWA 2HQEA 3H8ZA 1JXOA 1XQHA 1N8RU 2HSEB 2K2MA 2VYTA 2JM9A 3L1AA 1B7TA 2L8DA 2AT1B 1YN8A 4R55A 1VQ8Q 3CCQT 2LCCA 5FROA 4RMOA 1JEGA 1N5ZA 4JRKA 1XJWB 2DO3A 2DBKA 4PLIA 1UFFA 4GY5A 2LNVA 3MJXA 4X1VA 1QCNA 2OAUA 2DIQA 1PSFA 1KJWA 3EG2A 1VQ9A 4DOVA 3META 1VQ6T 2RQWA 4RTUA 3BW1A 3HTRA 3X28B 4JLIA 3M58A 1YJNQ 5KE2A 1KC8C 1VOMA 2YT6A 3NMZC 4AFUC 3JCMJ 3OY9A 3DLMA 3ME9A 3EGDA 1S72T 3JCMf 5HK0A 4J83A 2F5KA 4MZMA 3RKXA 1C6VX 2F2VA 2QA4A 1WHGA 1YCYA 1IGQA 1KC8R 1YI2Q 1PRMC 4B9WA 2XI9A 2DMOA 3VU3C 3OYJA 4N4HA 2JNGA 2QYZA 5FU6C 4BD3A 1KQSA 2H8HA 1GFDA 2PTKA 1LJOA 3E9FA 2E4HA 1X75C 2HQXA 4M78D 4PJMA 2YUNA 5FU7B 5GAN3 3GLXA 2RK2A 4J9HA 3RKYA 3VKIA 4OMFB 2LJ3A 3VUBA 2FYKA 4HCBA 2HQHA 1KHIA 4M75F 2CH4W 3KFVA 4M77D 3E2UA 4OGCA 2KVQG 4F14A 4D8DA 1TUDA 3MPUB 2KQWA 4XAXB 4BE2A 2EPDA 4F16A 3HRTA 2LX7A 4BY6C 3CD6Q 3HFOA 4IUTA 2KY9A 2QEXA 3VRYA 2JN0A 1X43A 2EJGA 2CS7A 3LLRA 2LX9A 2CSIA 1Q7YU 4ELZC 2D1XA 3V7SA 1LPLA 2DXUA 1RAAB 4A63B 1G5VA 1VQ5A 5CKFA 1AZEA 1M90R 3FEOA 1K76A 2W0ZA 3HHTB 2G6FX 3I5RA 4E47A 1OZ2A 4IURA 4C92E 2JM8A 2GFAA 2CKKA 2QXFA 1RI9A 4RTYA 3EG3A 3QPHA 1MMNA 3CQTA 2L3PA 2O31A 3FIFA 1VQNT 1QMCA 3M59A 5A0DA 4DBRA 2RQRA 2E6NA 3NHNA 1KC8U 2RJFA 3EG9B 1NE8A 2EYYA 2KEAA 2EQKA 3L2UA 1YHQQ 2R57A 2KE9A 1TUCA 3AHUA 4E7SA 5LL6S 2KGTA 1UGVA 3L2ZA 4II1A 1VQLQ 1YJWA 1GCQC 4JPBW 2CGHA 1QW1A 2MK5A 1PSEA 4E7JA 5KYWA 1ZUUA 2R5MA 4M78F 1YIJA 5GAOl 2RK1A 3JB9G 4LD9K 3LW5E 2KYBA 4C8QA 1KQSP 1K0SA 4Z88A 4CC3A 2WSFE 4KGVB 1WI7A 4HVUA 2EFIA 2R58A 3GPLA 3A8LB 4NS5A 3HL8A 4F7UF 1VQNQ 5CKEA 3LGLA 1ZA2B 4J7IA 2OTLA 2OTLQ 1E7OA 3LWIA 4DBHA 1C1AA 5LJ3j 3WXMB 2NUTB 2FZGB 2E41A 2CT3A 2KR3A 1BI0A 3JCMV 5IXFA 2OTJQ 3CCUA 1O9SA 2QQRA 2LCSA 5GAMh 5GAOn 1AZGB 1ZBXA 1N9RA 3TU4K 1Q86C 2PZ1A 3CC4A 2MIOA 4OMPA 1BB9A 4HCZA 1W1FA 5GJWB 1Y0MA 2HSPA 2ED0A 2M51A 1T0HA 3VUZA 1KQ1A 3MEVA 1NYFA 2KXCA 1WA7A 1NEGA 2J6OA 4LUDA 4MZPA 2E5KA 3CCEA 4E7KA 1QCOA 2RF0A 3A1PA 4M7DC 2KAFA 2KT1A 1RI0A 1YNZA 2PUOB 4M77G 4PJNA 2JS0A 2NUTA 3H0FA 3G71T 4OB2B 2PQWA 2E3IA 2VKNA 3CCJT 2E3HA 2YLBA 3I35A 5CVIA 2FPEA 1I8FA 4ESRA 4N0AA 2DILA 1MGQA 2K5IA 3ZEHA 2VGNA 4HKEA 3NFCA 4XU2A 3URGA 1B34A 5HY6A 3M0RA 1RAFB 3INZA 3CCEQ 5GAMe 1JO8A 4QQGA 2D6FA 4HCKA 5CCAA 1WJRA 2DEUA 2J6FA 5J26A 2DTIA 2VC8A 1Q82U 4ZTFA 1YJ9T 1QVFS 3MCAB 3JAME 3JB9J 4J9EA 2AZSA 2LDMA 4J6XA 1S72Q 2NUZA 1W4SA 1M5Q1 1VQ9T 4M75B 1ZSZA 2DAQA 1N27A 1WHJA 2FZCB 1QQJA 2QGFB 3BDLA 4M75C 2HBPA 1WYXA 3OSSC 1Y96A 1C0MA 2J7IA 1SSHA 1QVGS 2RHUA 4JRQA 5LJ5j 1H92A 3L2WA 4PJOE 2A28A 2J06A 4QKUA 1R0CB 2J05A 2X51A 2YXYA 2E6ZA 4EIKA 2KNBB 1TWBA 1VQ4T 3ZL7C 2VVKA 1D0XA 1ABOA 4JDSA 4OGEA 2ZPGB 2DE0X 4OB3B 5L8RE 4AFZC 5A0GA 2EBPA 5DLQE 1GL5A 4J9CA 2K5LA 4KUIA 4QW2A 1NPRA 1FMVA 3QDRB 1VQ4Q 2BIVA 3CCRT 4AT1B 1YJWQ 2X4JA 1YBYA 1VA7A 3RIRA 2XHCA 3D7SB 4KH0B 2EGEA 1K8AC 4M77B 1NG2A 4EPCA 3CCQA 2K79A 4M77A 3U23A 4Z02A 2KRNA 1WJQA 5D6WA 4FYWB 1TSFA 3JSCA 2KSSA 4M77E 2MI6A 4LN2A 4BE0A 3DLLA 1HSQA 2JMAA 2QAZA 2YRVA 3EFOA 4C8QD 5GAN4 2QI2A 3CC7T 2CP7A 1IREB 4J6WA 1QWFA 1VQ9Q 4M78A 2KXDA 4RG2A 5FW9A 2KT8A 2QDLA 1JXMA 3RMSA 4IIOA 3G6ET 3CMAT 1JU5C 1B07A 1UGQB 1ARKA 2GFUA 5GAN2 4OMNA 2DXCA 1RLQC 3S6WA 2RD1A 4OP0A 1UGSB 3CCMA 4EMHA 3QXEB 1M3AA 3OMCA 5HKCA 1AVZC 3VYHB 3EFSA 3CD6A 5CR2A 4IUPA 2RN8A 3REBB 2EGCA 4PJOD 1NM7A 2QGGA 3CCVQ 3G4SQ 1SPKA 4KT0E 4F7UA 4AG2C 4PFPA 4UC4A 3JCMg 5CAIA 2GGRA 1V76A 4JRPA 3EFRA 1N8RC 2EWNA 5GANd 3OYFA 3RDVA 1HXDA 3CPFA 4JLGA 1WXTA 2EJFA 3C94A 2IPOB 3T9NA 2H3JA 2RJDA 5D7UA 1DJ7B 5KYYA 4FM4B 1I81A 1TS9A 1TTHB 1M1KU 2E10A 3QJ6A 5CQXA 3O8VA 4FU6A 3CCLA 4KGZB 2BKDN 4C92B 1RAEB 2HZYA 2QTXA 1I5OB 1UHCA 1YCSB 3CCST 1RAIB 4QVDA 4HVWA 4QVZA 3M4YA 2D8JA 2DJQA 4XQ3A 1VYTA 2ENMA 1R0BG 1I07A 2P0KA 5GMKj 1SKUB 2COYA 3H9NA 1VQKT 2FEIA 1TOVA 2MAMA 2VASA 2LQKA 1VQ7A 1D0ZA 2DTHA 2CP6A 2OTLT 2XKOC 2ZCFB 1MNDA 4QVCA 1WZOA 3LWHA 1ZQ1A 2FPFA 4DBFA 2HAXA 2L3QA 1M8VA 3S3OA 2AKKA 3PT9A 1MMAA 2CP0A 5GAN7 1V29B 5CKBA 3TSZA 1YJNA 3NPFA 2CP2A 4L5GA 2C0TA 4ZGJB 1BIBA 2A3LA 5GMKm 2JJ9A 1VQ7Q 2HNIA 3L2RA 1PHTA 1ABQA 9ATCB 2DM1A 2I0NA 4C8QB 5LJ3e 1CKAA 2PUKB 1FX7A 2HCKA 2XDBA 3JCMX 1S1NA 5CK9A 5GMKi 1YWOA 4PLLA 3VS5A 3HP9A 2X3WD 3ASKA 4AFSC 1KD1U 5J39A 3P8HA 4KULA 5GAN5 5GAOr 3CXCS 2DPPB 3DB4A 4ANJA 4MMLA 3RMQA 4XU3A 2XK0A 3OQ5A 2MYSA 2O9SA 3OBYA 2LVMA 1RACB 1PC0A 5GAOq 2D8HA 2RHXA 3QYGB 3TCJA 1Q82R 2BUDA 3CCJA 1M1KR 4ME7A 2BZYA 1NLOC 2L3RA 1W6XA 1VYVA 1UB4A 1T3LA 4J9BA 2JUFA 3ER0A 2P0QA 2C0IA 4A4HA 1VQOT 1M2VA 2HDAA 4PJOF 4F7UG 3NTHA 2E70A 1S72A 2D0QB 1M9SA 4Y91A 3OW2A 4O5VA 3H0IA 1VQKQ 1WNLA 4ZGDB 1Q82C 3AT1B 2LNHB 3QWYA 1PWTA 1D3BB 2Y90A 5DLOA 2WSCE 4L6V5 4M7AE 3FB9A 3NTKA 4JS4A 1BI3A 1BCMA 5LJ5g 4C8QC 5KYNA 1Q81C 2A36A 1UDLA 2O01E 4XTYA 3BDUA 4C5IA 2DEQA 3QYHB 3C0CA 4C92D 1WJSA 2GQIA 4MDWA 1K73C 1BIAA 3OYAA 3X25B 3OYCA 2KRMA 2GTOA 3I56T 2YRDA 2BTTA 2IVWA 1W70A 2HKQB 4CI0C 2EYWA 3J7AF 1QKWA 3LH0A 4NL2A 1ZSZB 3JCMe 2YRCA 1EIFA 1WDXA 2QQBA 4BI8B 2DD5A 2Y4YA 1K9MU 1FMWA 3OYHA 1T3SA 3BE3A 1LOJA 5GANf 3EHQA 4E7HA 4LDUA 1K73U 3ZFJA 5KYUA 2M16A 3SEMA 1IRXA 4WCIA 2P0PA 3JCMP 3SWNA 1WHMA 1BCOA 4B6MA 4LD6A 2D0NA 4J9IA 2NWMA 3SDZA 4FL6A 4X9CA 1QKXA 2CUBA 1EFNA 3UPUA 1YI2T 1BI1A 1SF9A 1EZZB 4CC4B 2EAYA 5CKHA 3CCUQ 4F7UB 3JCMQ 4WTOB 5GJVB 2HD0A 4M75D 2YUOA 1IO6A 2MF2A 1WFWA 4HXJA 4D8KA 3CC7A 3OW2S 3PGGA 1GRIA 2K3XA 1I4K1 2JVVA 4PK4A 2RHYA 2L2PA 1QP2A 3A98A 5CO7A 4E2FB 2A7YA 4M7AD 1FWZA 1NJIU 2O9VA 5C6SA 1RAGB 2RB6A 8ATCB 1K9MR 3R6NA 1LVKA 3V7RA 3JCMd 2DJZA 2LJ0A 1PD0A 1VQ6Q 1YITQ 1Z9ZA 3E9GA 4J7FA 5EG2A 3MO8A 5GANg 1VQLA 4XTVA 5CQYA 3CCRQ 1VQPQ 1G3YA 2A37A 3CBOA 1R77A 2K6DA 2OI3A 4C8QG 2LRQA 2CH4A 3NTIA 1PM3A 1BU1A 5IN1A 2BE9B 4CC7A 1GCPA 1X6OA 3P8DA 2JXBA 1U5SA 4IUVA 1SSFA 2RJCA 1W2BS 3V8LA 1X27A 7AT1B 4C0GA 2CZ0B 3G1JA 1YFNA 3G4ST 3OYYA 3CBPA 3A8MB 1KFZA 3SD4A 1E6HA 1MMDA 1OV3A 4N0AC 4EMKC 4RCBA 4M77C 3GOXA 4RUGA 4J6YA 1G2BA 4EMKB 2EW3A 3VS4A 4FYXB 3GIBA 2HMAA 1Y71A 1D09B 2JZ2A 5IHKA 1TUGB 3M0PA 3CCSA 1UGRB 1TH7A 4BDZA 4J9GA 3G7ZA 1I5LA 2HL5C 2F5TX 1YJ9Q 1AEYA 2X9HA 1Y96B 5KYWB 1QLYA 4JS5A 1K8AR 2EKOA 5FLXE 2QDYB 3OS5A 4PJOC 2RQVA 4OMMA 3UF4A 1UECA 2MPXC 4M75A 4HCCA 3CCMT 3JB9D 4DOWA 2NUPB 1KSWA 3WVEB 4M7DF 1W2BA 1NBEB 1N9SA 2V8KA 4BUGA 1VQ4A 5GAOp 3HPWA 2IG0A 4GLMA 4M78E 1X2QA 1D1CA 2K3YA 1VQPT 1MV3A 3FC3A 4PJOA 3JCMh 2M0OA 3X26B 3MKDA 4XK8E 3HRUA 5DY9A 2QTVA 4CRIA 3MEUA 3KBGA 2ATCB 1YITT 1YI2A 4A4KA 5IXBA 2VUBA 2X35A 1RLPC 2V1RA 4DEYA 4FW1A 5GMKl 3OYLA 2AKLA 4M78C 3RESA 3SB2A 3SHWA 2ROLA 1BYMA 1M1KC 2OX7A 4FW2A 1EX4A 1WHHA 3VS2A 1MMGA 2MWPA 1BK2A 1IHVA 5GAMf 5IAYA 4KRTA 4ELYC 4C92A 1JJ2S 1NYGA 2XICA 2GNCA 2RI5A 2BE7D 3VS0A 1LNXA 3L2VA 1OEBA 1VYUA 5LJ5d 1VQMQ 1AT1B 2FO0A 3I55A 1M27C 1ZLMA 2QQAA 3FJPA 2YSQA 1M1FA 2LQ8A 1M90U 2CP5A 4JUVA 4M4ZA 1AHJB 1PNJA 3I5SA 1VQ5T 3QZ5B 5GAMg 3RR6A 2EIFA 2EQJA 3M54A 3THKA 3M9QA 2AHJB 3CCUT 4MMKA 2LJ1A 2VXEA 2KMTA 4XU0A 2E5QA 2RMOA 2VWFA 1AOJA 2CZ1B 2XD0A 2GCXA 3EAEA 3VV0A 3EGXB 3OB9A 4FT2A 5J3BA 3HSBA 1A0NB 4C8QE 1BBZA 2DBMA 4A4GA 4ZN1A 5FU6B 3OS2A 2PVDB 3JCMb 1UTIA 3H0HA 3OSVA 3G71Q 4GBQA 3PVLA 5FU7C 1M8MA 2RQTA 3GNFB 4V2SA 1FMKA 1WQ7A 2A0FB 1IXDA 1WXUA 3PFSA 4C92C 2DRMA 2O2OA 4LUEA 4LNPA 4FYYB 4C92F 3CCLT 2NUPA 2ZPIB 5I21A 5FRMA 3QWXX 1Q95G 5KYUB 3PVQA 1N6AA 3UWNA 5KCOA 3CEYA 2YDLA 5I11A 2LC4A 4HA8A 1G8XA 1PRLC 2QQ9A 2OTJA 3EH1A 1VQOA 1RAHB 3RUXA 3C95A 3TSWA 2EVRA 2QQSA 2ZPEB 4OMOA 1XNIA 5L23A 4LDVA 3EFOB 2WSEE 1CKBA 3OS1A 2DL8A 1WHKA 4Y92A 4LDYA 2I2LA 1VQOQ 1GBRA 3EH2A 4J9DA 1HK9A 1X6GA 3J81E 5D6XA 4C5GA 2DLPA 4TVRA 1M4ZA 1Y7XA 2DD4A 4ZTJA 2XDDA 3KXTA 3OW2P 1WX6A 1WLPB 2E64A 2DXTA 3QKJA 2JTFA 2Y4XA 4M7AF 2B86A 4PNOA 3BY7A 2AIRB 1WXBA 4RCCA 4ZNXA 3E19A 3G71A 1OULA 4C5EA 1OI1A 1Q81R 2LMJA 3OYMA 3M56A 1E6GA 1T0JA 1VQ8A 5AT1B 3QDFA 4JJCA 3REAB 2V8JA 2FRWA 1RABB 2SRCA 3CBMA 5KYYB 5IT9E 1WIEA 2LT4A 5I22A 1VQ5Q 3EG1A 1HJDA 4PFOA 4OVAA 1K8AU 2QASA 3JB9H 3QZ9B 4F04B 3OA6A 1OQKA 3TVTA 2XMFA 1B34B 4DA4A 4DQ2A
chains in the Genus database with same CATH topology
3JCMe 1EIFA 4OB1B 1O9SA 2QQRA 2EQMA 5A0LA 5GAMh 3QBYA 4C8QF 5GAOn 1ZBXA 1N9RA 1YJNT 3TU4K 2QQBA 4BI8B 1Q86C 4NL3A 2DD5A 2Y4YA 3PNWC 1K9MU 3OYHA 5KE3A 3CC4A 1LOJA 3CPWS 5GANf 3S3NA 3QIIA 4FSXA 4HCZA 4E7HA 2NLUA 3RKWA 4LDUA 4M7AB 4E7IA 1K73U 1VQMA 3ZFJA 1G3TA 1NJIC 2M16A 4P5NA 3VUZA 3JRZA 1KQ1A 2FHDA 2P0PA 4JRIA 4YTLA 3MEVA 3JCMW 3JCMP 3SWNA 2DKGA 3SFMA 2RO0A 1VQ7T 3QSUA 4LD6A 3QJYA 3S3MA 3GP8A 4ATOA 3SDZA 5C0MA 4FL6A 3G4SA 4X9CA 2RH2A 1YITA 4XTXA 3UPUA 1BI1A 3KUFA 4MZPA 1YI2T 3PIOA 5LJ3d 3CCEA 3QUIA 3Q1JA 1RL2A 4E7KA 1KG1A 3OBWA 1VUBA 2EAYA 2VXFA 2DK3A 2KAFA 4M7DC 5CKHA 4F7UB 1RI0A 2B8AA 3M4GA 2XIDA 3MP1A 2PUOB 3JCMQ 3OYDA 2DIGA 4M77G 2HD0A 4M75D 2MF2A 2PVOB 2P4TA 4PKCC 4M7DG 3G71T 3CC7A 2ZZDA 4OB2B 3SWNC 3OW2S 2PQWA 3PGGA 2K3XA 3CCJT 3HRSA 1BKBA 2EQUA 4OF1A 1I4K1 5CIUA 3OYEA 2YLBA 5CVIA 2JVVA 1I8FA 3SWNB 3JB9F 2RHYA 1QP2A 2X4YA 4N0AA 5CO7A 2A7YA 4ZN3A 1MGQA 5LJ3g 1VQMT 2K5IA 4M78G 3ZEHA 4BACA 4M7AD 1FWZA 1NJIU 2VGNA 4HKEA 3NFCA 3FLGA 4XU2A 5C6SA 3URGA 1B34A 2RB6A 5HY6A 3VJPA 4J5YA 3CC2T 5GANh 3UDCA 1X01A 3INZA 3OYNA 1O75A 3I55T 5GAMe 3V7RA 3JCMd 2DJZA 4QQGA 2JTMA 4X34A 1NZ9A 1UGPB 4VUBA 3CCVT 4M75E 3E9GA 5CCAA 4BDYA 1VIFA 4IKFA 4J7FA 5DM7R 2D9TA 5EG2A 1WJRA 3MO8A 1Y07A 3C4SA 5J26A 5GANg 1VQLA 2FB7A 2DTIA 2RJEA 2RHIA 2VC8A 4XTVA 5CQYA 1YJWT 1Q82U 4M7AA 1NPPA 5LJ5h 4GLKA 4ZTFA 1YJ9T 1QVFS 1G3YA 3MCAB 3JAME 3JB9J 4M7AC 3CBOA 2LDMA 3M55A 4J6XA 1H3ZA 1W4SA 4C8QG 2LRQA 2DVEA 2LCLA 1M5Q1 3HKSA 3NTIA 4M75B 4E7LA 1VQ9T 1U1SA 1N27A 2DAQA 4Y28E 3CC4T 5IN1A 2ZPFB 5GAOm 3BDLA 1U1TA 5GANe 3MEAA 2E1HA 2EYQA 4M75C 1X6OA 2X4XA 1D3BA 4XTZA 2HBPA 3P8DA 2PU9B 2VV5A 3OSSC 2E65A 5HK3A 3PIPA 1OYXA 1Y96A 4IUVA 1QVGS 3OYGA 1SSFA 4EDUA 2RJCA 5KCHA 4C92G 2RHUA 2RM4A 3V8LA 1W2BS 4M7DB 2MMPA 4JRQA 5LJ5j 3M5AA 5D6YA 3JCMc 2FVUA 4C0GA 3L2WA 2CZ0B 1YHQT 4PJOE 5M9OA 3QHSA 2K5FA 3MHXA 3I56A 3OYYA 3G4ST 3CBPA 3A8MB 3SD4A 4N0AC 3TEEA 4EMKC 3GF5A 4HT8A 2ZPHB 4RCBA 2G3RA 4M77C 3GOXA 3OMGA 3FDRA 1KQ2A 2E6ZA 2GF7A 4J6YA 3PMIA 2CYZB 4EMKB 1VQ4T 4A53A 5GAMj 3GIBA 4JDSA 4OGEA 1KHCA 2O4XA 2ZPGB 4MZTA 5AYFA 2O4XB 1Q81U 1Y71A 4OB3B 2RI2A 1VQ8T 2KDSA 4M78B 5L8RE 3V8KA 2JZ2A 3MP8A 5DLQE 5A0GA 1QVPA 4QQ6A 2K5LA 3A8GB 3CCSA 1UGRB 2L5QA 1TH7A 4KUIA 4BDZA 4QW2A 1NPRA 4PJOG 3G7ZA 3QDRB 1G3WA 1I5LA 2F5TX 2BIVA 1Y96B 3QO3A 4F7UE 4FT4A 3CCRT 2X4JA 4JS5A 1YBYA 3A5ZB 4PL6A 2XHCA 3RIRA 1VQKA 2EKOA 5FLXE 3X24B 2QDYB 3OS5A 2CZ6B 4PJOC 3M53A 4M77B 1K8AC 4KUDK 2WACA 4EPCA 3CMET 2DXBA 3CCQA 1M90C 4M77A 5I2SA 4Z02A 4L59A 4M7DE 4M75A 1WJQA 5D6WA 3CCET 4IUQA 4QQDA 4B9XA 4BI4A 4HCCA 2EJ9A 3CCMT 1Q7YC 1KD1C 3CCVA 3JB9D 4DOWA 3JSCA 3UT1A 4M7DA 2KSSA 4M77E 5GAN6 3WVEB 4M7DF 1JJ2A 3E1SA 1W2BA 3V8JA 2MI6A 1MHNA 4EMGA 4BE0A 1N9SA 2V8KA 4BUGA 3OYBA 1VQ4A 3DLLA 4JJNK 5GAOp 3HPWA 2YRVA 5GAN4 4C8QD 1WQWA 1VQ6A 2QI2A 3CC7T 3CXCA 1IREB 3P8BB 4J6WA 5GMKe 4M78A 1JB0E 4RG2A 2IG0A 2RHZA 3A8OB 2LTOA 4A54A 4M78E 2L89A 3ZBDA 3OYKA 3RMSA 4C0DC 1VIEA 2K3YA 2ZGWA 2HQEA 3H8ZA 1VQPT 1XQHA 3G6ET 1N8RU 4HT9A 2VYTA 3C12A 3L2QA 3FC3A 3L1AA 3X20B 3H6ZA 3CMAT 1FXXA 4PJOA 3JCMh 4EMKA 4C0DB 2M0OA 3X26B 3CC2A 4XK8E 4C0FA 3HRUA 1UGQB 5DY9A 2L8DA 4CRIA 4J8OA 3MEUA 3KBGA 1YITT 1YI2A 2GFUA 4A4KA 2VUBA 4KBMB 5GAN2 4R55A 2X35A 3CCQT 1XTDA 2DXCA 2LCCA 5FROA 2GQVA 3S6WA 4RMOA 2RD1A 4OP0A 1UGSB 5GMKl 4JRKA 4EMHA 3OYLA 3QXEB 3CCMA 4M78C 3RESA 3OMCA 4XTUA 2DO3A 3SB2A 3OYIA 4M77F 4PLIA 5HKCA 4GY5A 2LNVA 1JBMA 3VYHB 3EFSA 3CD6A 1KQSS 2OAUA 5CR2A 4IUPA 1BYMA 2DIQA 1M1KC 1PSFA 2ZPBB 3FRNA 1VQ9A 4PJOD 4DOVA 2K4YA 3M57A 3HFNA 3META 1VQ6T 2MWPA 5GAMf 4LDWA 2DZCA 5IAYA 4KT0E 4F7UA 3BW1A 4ELYC 4C92A 3X28B 1JJ2S 1OZ3A 4JLIA 4UC4A 1BI2A 3LGFA 3M58A 2XICA 3JCMg 2XG8D 5KE2A 3DKMA 2RI5A 5CAIA 2VGMA 1LNXA 4WF2A 3WVDB 3L2VA 4JRPA 1KC8C 5LJ5d 3EFRA 4OB0B 1N8RC 2EWNA 5GANd 3OYFA 3VYGA 1HXDA 3CPFA 3I55A 2QQAA 4JLGA 1QVFA 3FJPA 1M1FA 2EJFA 2LQ8A 2MWOA 3C94A 3OY9A 3JCMJ 1U8RA 1YHQA 3T9NA 1M90U 2H3JA 2RJDA 3DLMA 1DJ7B 3ME9A 5GAOr 4JUVA 1AHJB 4FM4B 1S72T 1I81A 3JCMf 5HK0A 2M1HA 3MP6A 4J83A 2E10A 1M1KU 2E12A 1M1GA 2D6FA 1VQ5T 3QJ6A 4NOYA 5CQXA 3LX7A 2F5KA 3QZ5B 5GAMg 1YJ9A 4M7DD 3O8VA 2EIFA 2EQJA 3M54A 4FU6A 4MZMA 4ZGEB 3CCLA 3TREA 3M9QA 2AHJB 3RKXA 3PMTA 3CCUT 4BB7A 1P92A 2QA4A 4MMKA 2VXEA 4X9DA 2BKDN 3DB3A 2KMTA 4XU0A 4C92B 1YCYA 3L42A 1R8OB 2QTXA 4A4EA 2E5QA 2DZ9A 4B9WA 2FL7A 2XI9A 4R56A 4QVDA 3CCST 3VU3C 4PJOB 3OYJA 4N4HA 4A4FA 2JNGA 2CZ1B 4QVZA 2XD0A 2GCXA 3EAEA 3VV0A 3OB9A 4FT2A 3M4YA 4XQ3A 3G6EA 2QEXT 5FU6C 5J3BA 4BD3A 3HSBA 2K57A 2OTJT 4C8QE 5GANj 3CMAA 1KQSA 2P0KA 5GMKj 4M75G 1VQKT 4A4GA 1LJOA 3E9FA 4ZN1A 5FU6B 2MAMA 1X75C 2KK4A 2HQXA 4M78D 4LDXA 3CPWA 3OS2A 3CMEA 2LQKA 2PVDB 4BY6B 5FU7B 1VQ7A 2DTHA 3JCMb 5GAN3 2OTLT 2XKOC 2ZCFB 3GLXA 3OSVA 2XDPA 2RK2A 4QVCA 5FU7C 3RKYA 3VKIA 3LWHA 1ZQ1A 4OMFB 4D6WA 2HAXA 3GNFB 4V2SA 2K2VA 3VUBA 1WQ7A 2FYKA 3BFMA 4HCBA 3PFSA 3S3OA 1M8VA 1KHIA 4C92C 4M75F 3J80E 4BE1A 3PT9A 5GAN7 1V29B 1WPYA 4M77D 5CKBA 4C0ZA 4OGCA 1YJNA 3CCLT 2KVQG 4C92F 3LYIA 5A2QE 3F70A 2KQWA 2YLCA 4XAXB 2QA4T 4L5GA 2ZPIB 5CKDA 5I21A 5FRMA 4ZGJB 1BIBA 4BE2A 2A3LA 1N6AA 3UWNA 5GMKm 5KCOA 3CEYA 1VQPA 3OS0A 2HNIA 3L2RA 3HRTA 3N5BB 4XU1A 3CCRA 2LC4A 1H641 4BY6C 4HA8A 3HFOA 4IUTA 2KY9A 2DTOA 2QEXA 4C8QB 2JN0A 5LJ3e 2QQ9A 2OTJA 2PUKB 1FX7A 1VQOA 2XDBA 2EJGA 3JCMX 2RA2A 1UEBA 3V7CA 4BI3A 2CS7A 5CK9A 3LLRA 5GMKi 4PLLA 5FRNA 2XU8A 3RUXA 3HP9A 3C95A 2LX9A 3ASKA 1Q7YU 1ZHIA 2QQSA 2ZPEB 3P8HA 4IUUA 4KULA 4RG8A 4ELZC 5J39A 3MEWA 2DPPB 5GAN5 3CXCS 3V7SA 3DB4A 4MMLA 3RMQA 1K9MC 4XU3A 1XNIA 2DXUA 2F69A 4LDVA 2XK0A 2WSEE 1G5VA 3OQ5A 1VQ5A 5GAN8 2LT1A 3OS1A 3OBYA 5CKFA 2LVMA 1VQLT 3A8HB 3FEOA 5KH6A 2R5AA 1YIJT 3HHTB 4FIBA 3PTAA 2V8IA 5GAOq 2RHXA 4E47A 1OZ2A 3QYGB 4IURA 4C92E 4LDYA 1KD1U 2QXFA 2GFAA 2CKKA 2CZ7B 3TCJA 2I2LA 2BUDA 3CCJA 3QPHA 3FIFA 4ME7A 1VQNT 2L3RA 2RI3A 3M59A 5A0DA 4O6JA 3GNGA 5GAMd 1UB4A 4MDXA 1HK9A 2E6NA 2JUFA 3ER0A 2P0QA 3J81E 1KC8U 2RJFA 2YHTA 1NE8A 5D6XA 4C5GA 4TVRA 4A4HA 1M4ZA 1Y7XA 2EQKA 2PVGB 4Q5WA 3L2UA 1VQOT 1JRIA 2DD4A 4ZTJA 2R57A 2XDDA 3KXTA 4PJOF 4F7UG 3NTHA 2E70A 5LJ5e 5I2MA 1S72A 3AHUA 2D0QB 5LL6S 2E64A 1M9SA 4Y91A 3OW2A 2DXTA 4O5VA 3L2ZA 3QKJA 2JTFA 5LJ3f 1WNLA 4II1A 4ZGDB 1Q82C 3CD6T 4RKUE 1YJWA 2Y4XA 4M7AF 2CGHA 1QW1A 1D3BB 4PNOA 2Y90A 5DLOA 2C06A 3QG1A 2WSCE 3BY7A 1PSEA 4L6V5 4RCCA 4E7JA 3E19A 3G71A 4M7AE 3FB9A 3NTKA 2R5MA 4M78F 4JS4A 1YIJA 5GAOl 4C5EA 1BI3A 5LJ5g 5LJ3h 4XTWA 1OI1A 2RK1A 3JB9G 3OYMA 3M56A 4C8QC 4LD9K 1VQ8A 3LW5E 1Q81C 1QP3A 2O01E 4C8QA 4M7AG 4XTYA 4N4GA 1Q86U 2V8JA 2WSFE 4C5HA 1VQNA 2EFIA 3BDUA 4C5IA 2R58A 2JOYA 3GPLA 3CBMA 5IT9E 3A8LB 2DEQA 4NS5A 2LT4A 1GXIE 2X4WA 3QYHB 5LJ5f 3HL8A 4F7UF 4C92D 1WJSA 3LGLA 4MDWA 5CKEA 1K73C 3JB9I 1BIAA 4J7IA 3X25B 3OYAA 1G3SA 2OTLA 1XOVA 3OYCA 4OVAA 3LWIA 1K8AU 3I56T 1WGSA 5GMKh 2IVWA 4CI0C 5LJ3j 4N4IA 3JB9H 3WXMB 3QZ9B 3R6OA 1QVGA 3J7AF 1IZ6A 3OA6A 3LH0A 2E41A 2M9UA 3RERA 4NL2A 1BI0A 3JCMV 1B34B 4DA4A 3CCUA 4DQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P4T A;  3UDC A;  2OAU A;  3SFM A;  2VV5 A;  2RK2 A;  2RH2 A;  3T9N A;  1VIF A;  2GQV A;  1VIE A;  2RK1 A; 
#chains in the Genus database with same CATH topology
 1UG1 A;  3EG9 A;  2K3B A;  4AG1 C;  1YJN T;  1QVF P;  1SHF A;  3EGD B;  3PNW C;  4JJD A;  2Z0W A;  5KE3 A;  4JZ4 A;  4F17 A;  4FSX A;  2NLU A;  3RKW A;  4E7I A;  1VQM A;  2LP5 A;  1MUZ A;  1NJI C;  1SG5 A;  1I1J A;  4P5N A;  2FHD A;  4JRI A;  4YTL A;  3JCM W;  2DKG A;  2HL3 A;  2V26 A;  1Z9Q A;  3QSU A;  3CCQ Q;  4XTX A;  1ZSZ C;  3UAT A;  5LJ3 d;  1RL2 A;  1Q86 R;  1KK7 A;  3M4G A;  2B8A A;  3MP1 A;  1AWW A;  1K9A A;  1ZUK A;  2EGA A;  2OJ2 A;  1JQQ A;  2P4T A;  2OAW A;  2ZZD A;  3SWN C;  1BKB A;  2EQU A;  2F2W A;  3SWN B;  3JB9 F;  2KRS A;  4BAC A;  2CP3 A;  4R0K A;  5IH2 A;  4Z8A A;  3RBB B;  3VJP A;  5KYX B;  1UHF A;  3UDC A;  3OYN A;  1O75 A;  1NLP C;  4RTZ A;  3CCV T;  4M75 E;  1VIF A;  2D9T A;  2ED1 A;  1RUW A;  1NPP A;  5LJ5 h;  1OX8 A;  4GLK A;  4FYV B;  3M55 A;  1H3Z A;  4M7A A;  2LCL A;  4E7L A;  1U1S A;  3CC4 T;  2ZPF B;  4IIM A;  5GAO m;  3MEA A;  2EYQ A;  4RTV A;  2DFU A;  2X4X A;  1D3B A;  2VV5 A;  1GFC A;  1ZX6 A;  2E65 A;  5HK3 A;  2FPD A;  1K0X A;  2F2X A;  2HEQ A;  2M0Y A;  1AWX A;  2NYS A;  2C0O A;  4EDU A;  4C92 G;  2BZ8 A;  4M7D B;  2MMP A;  3M5A A;  2FVU A;  3QHS A;  1OOT A;  2K5F A;  3I56 A;  1AWO A;  3GF5 A;  2ZPH B;  2KYM A;  2GF7 A;  1JJ2 P;  2JS2 A;  4HVV A;  1N8R R;  2CYZ B;  3ULR B;  2CUD A;  4A53 A;  4AMC A;  5GAM j;  2O4X A;  1Q81 U;  1VQ8 T;  2KDS A;  3V8K A;  3TQ7 P;  3JV3 A;  1QVP A;  3EHR A;  4QQ6 A;  2ECZ A;  2L5Q A;  3PE0 A;  1OU8 A;  3QO3 A;  3A5Z B;  4PL6 A;  2CZ6 B;  3VS1 A;  1F1B B;  2LQN A;  1M90 C;  4KUD K;  4M7D E;  3I55 Q;  4KH1 B;  4IUQ A;  4QQD A;  1PG5 B;  4PJJ A;  1Q7Y C;  3CCV A;  3UT1 A;  4J9F A;  1KD1 R;  1QWE A;  2DET A;  3E1S A;  1ZBJ A;  3V8J A;  2DX1 A;  1MHN A;  2AZV A;  3OYB A;  3CCM Q;  1VQ6 A;  3CC4 Q;  1JB0 E;  3CME Q;  2LTO A;  4A54 A;  2A08 A;  4C0D C;  1VIE A;  4HT9 A;  1TXQ A;  3C12 A;  3L2Q A;  3X20 B;  3H6Z A;  4CC2 A;  1FXX A;  4EMK A;  1V1C A;  4C0D B;  3CC2 A;  4C0F A;  4J8O A;  1SHG A;  2F1L A;  4KBM B;  5FWC A;  1XTD A;  1IB8 A;  2GQV A;  4FCY A;  3O5Z A;  2DER A;  1NEB A;  5KYX A;  1IHW A;  4XTU A;  3OYI A;  1W2B P;  1SRM A;  2DA9 A;  1D0Y A;  3M0T A;  4M77 F;  1JBM A;  2GTJ A;  1KQS S;  2EQI A;  2ZPB B;  1YWP A;  3FRN A;  2K4Y A;  3M57 A;  2CSQ A;  3HFN A;  1K1Z A;  4LDW A;  2DZC A;  2MCN A;  1NJI R;  2CDT A;  1OZ3 A;  1BI2 A;  3LGF A;  2XG8 D;  3DKM A;  2VGM A;  3EGU A;  4WF2 A;  3WVD B;  4E6R A;  4OB0 B;  2KRO A;  3VYG A;  4JZ3 A;  1QVF A;  4DEX A;  2GBQ A;  2MWO A;  1YHQ A;  1U8R A;  1LCK A;  2COW A;  2L0A A;  2M1H A;  3MP6 A;  2E12 A;  4QT7 A;  1M1G A;  1YJ9 A;  4NOY A;  3LX7 A;  1AD5 A;  4M7D D;  4ZGE B;  3TRE A;  3PMT A;  1X6B A;  4BB7 A;  1P92 A;  1SEM A;  3EG0 A;  2EYX A;  1M2V B;  4X9D A;  1RAD B;  2HKN A;  3DB3 A;  2IIM A;  3L42 A;  1PD1 A;  1R8O B;  4A4E A;  4R56 A;  2DZ9 A;  2FL7 A;  2DRK A;  4PJO B;  1QVG P;  4A4F A;  3CC2 Q;  3G6E A;  2QEX T;  1H3H A;  2OTJ T;  2K57 A;  5GAN j;  3CMA A;  4K11 A;  3H41 A;  3IQL A;  4M75 G;  2KK4 A;  3GBQ A;  4LDX A;  3CPW A;  3CME A;  4BY6 B;  1U06 A;  2RQU A;  2PNI A;  2XDP A;  2EYZ A;  4D6W A;  2K2V A;  3BFM A;  4BE1 A;  3J80 E;  1B3Q A;  5FWB A;  1GBQ A;  1WPY A;  3VS7 A;  2AK5 A;  4C0Z A;  1UJY A;  3LYI A;  5A2Q E;  3F70 A;  2KBT A;  2YLC A;  2QA4 T;  4JJB A;  5CKD A;  2CRE A;  1KIK A;  1D1B A;  3NGP A;  1VQP A;  3OS0 A;  3N5B B;  4XU1 A;  3CCR A;  1H64 1;  4RTT A;  2DTO A;  4FSS A;  4RTX A;  2RA2 A;  1UEB A;  3V7C A;  4BI3 A;  4LE9 A;  5HCK A;  5FRN A;  2XU8 A;  1ZHI A;  4IUU A;  4RG8 A;  1YHQ T;  2QG9 B;  3MEW A;  1K9M C;  2F69 A;  2K9G A;  2JW4 A;  4DBQ A;  5GAN 8;  2LT1 A;  2W10 A;  1VQL T;  3A8H B;  5KH6 A;  2R5A A;  1YIJ T;  2H3E B;  4FIB A;  3PTA A;  2V8I A;  3I56 Q;  1QCF A;  1D1A A;  2CZ7 B;  2QA4 Q;  2RI3 A;  2V1Q A;  4O6J A;  3GNG A;  5GAM d;  1I0C A;  4MDX A;  2YHT A;  2PVG B;  1YP5 A;  4Q5W A;  1JRI A;  2O88 A;  5IHN A;  5LJ5 e;  5I2M A;  2COZ A;  1H8K A;  2LQW A;  5LJ3 f;  8AT1 B;  1K73 R;  3CD6 T;  3M0S A;  4RKU E;  2YUQ A;  1OX9 A;  2C06 A;  3QG1 A;  1Y57 A;  1MNE A;  4PFZ A;  3CCS Q;  2FG0 A;  5LJ3 h;  4XTW A;  1ZUY A;  1QP3 A;  1AWJ A;  4M7A G;  2EKH A;  4N4G A;  1Q86 U;  4C5H A;  1VQN A;  2JMC A;  2CT4 A;  2LZ6 B;  2JOY A;  3CPW P;  1GXI E;  2X4W A;  5LJ5 f;  2DYI A;  1J3T A;  3JB9 I;  1TG0 A;  1G3S A;  1XOV A;  3VS6 A;  3CXC P;  1WGS A;  5GMK h;  4N4I A;  1UUE A;  1MV0 B;  1QVG A;  3R6O A;  1YIJ Q;  1IZ6 A;  2J6K A;  3CCL Q;  2MOX A;  2DL3 A;  2M9U A;  3RER A;  1M3C A;  4OB1 B;  5A0L A;  2EQM A;  3QBY A;  4C8Q F;  2P84 A;  1UE9 A;  3EGX A;  4NL3 A;  1IGU A;  3CPW S;  3S3N A;  3QII A;  4M7A B;  1G3T A;  3M0U A;  3JRZ A;  5ECA A;  2RO0 A;  3SFM A;  1VQ7 T;  2DNU A;  3QJY A;  3S3M A;  3GP8 A;  4ATO A;  2DYB A;  5C0M A;  3G4S A;  2RH2 A;  1YIT A;  1K4U S;  4RTW A;  1ACM B;  3KUF A;  2QK0 A;  3PIO A;  2RPN A;  3QUI A;  1U3O A;  3Q1J A;  1KG1 A;  3OBW A;  1VUB A;  2VXF A;  2DK3 A;  2XID A;  1X69 A;  3OYD A;  2DIG A;  3CMA Q;  3G6E Q;  1OPL A;  2PVO B;  4PKC C;  4M7D G;  1M2O A;  1FYN A;  2HBW A;  2RNA A;  3VS3 A;  2X3X D;  3HRS A;  4OF1 A;  3CC7 Q;  5CIU A;  3OYE A;  1TU0 B;  2X4Y A;  5LJ3 g;  4ZN3 A;  2ABL A;  2L3S A;  1VQM T;  4M78 G;  1UJ0 A;  3FLG A;  2QEX Q;  1ZSG A;  4KGX B;  3VRZ A;  3CC2 T;  4J5Y A;  1SRL A;  2JT4 A;  5GAN h;  1X01 A;  2JTE A;  2DL5 A;  3I55 T;  2BZX A;  2JTM A;  4X34 A;  3LH5 A;  1NZ9 A;  1UGP B;  4VUB A;  4BDY A;  4IKF A;  5DM7 R;  1Y07 A;  2ZAE A;  3C4S A;  1PCX A;  1HYO A;  2FB7 A;  1GCQ A;  2RHI A;  2RJE A;  1YJW T;  4ORZ A;  4M7A C;  4E7Z A;  2DF6 A;  2YUP A;  1G83 A;  3HKS A;  2DVE A;  4Y28 E;  2K7A A;  1X2K A;  4LXC A;  1U1T A;  5GAN e;  2E1H A;  1OU9 A;  5EC7 A;  4XTZ A;  2PU9 B;  3I9Q A;  3PIP A;  1OYX A;  1ZA1 B;  3OYG A;  5KCH A;  2RM4 A;  2VB6 A;  5D6Y A;  3JCM c;  1HD3 A;  5M9O A;  3MHX A;  1PKS A;  4OML A;  3TEE A;  4HT8 A;  2G3R A;  2DL7 A;  3OMG A;  3FDR A;  1KQ2 A;  4Z89 A;  3PMI A;  1KHC A;  4MZT A;  2KI7 A;  5AYF A;  2O4X B;  5IHI A;  2RI2 A;  2SEM A;  4M78 B;  3UA7 A;  3MP8 A;  1M3B A;  3A8G B;  2FRY A;  2ESW A;  4PJO G;  2P4R A;  3RNJ A;  1G3W A;  1OPK A;  3M0Q A;  4F7U E;  1WHL A;  2ROT A;  4FT4 A;  2YWW A;  1VQK A;  4OMQ A;  3X24 B;  1CSK A;  3M53 A;  2WAC A;  3CME T;  2DXB A;  5I2S A;  4AFQ C;  4L59 A;  3FJ5 A;  3CCE T;  2M02 A;  4BI4 A;  4B9X A;  2EJ9 A;  1KD1 C;  4M7D A;  2DVJ A;  5GAN 6;  1Q7Y R;  1JJ2 A;  6AT1 B;  4EMG A;  3UA6 A;  4JJN K;  1PKT A;  2DL4 A;  1M30 A;  1WQW A;  2FZK B;  4PJL A;  3CXC A;  3CCJ Q;  3P8B B;  5GMK e;  2RHZ A;  3A8O B;  3ZBD A;  2L89 A;  3OYK A;  2ZGW A;  2HQE A;  3H8Z A;  1JXO A;  1XQH A;  1N8R U;  2HSE B;  2K2M A;  2VYT A;  2JM9 A;  3L1A A;  1B7T A;  2L8D A;  2AT1 B;  1YN8 A;  4R55 A;  1VQ8 Q;  3CCQ T;  2LCC A;  5FRO A;  4RMO A;  1JEG A;  1N5Z A;  4JRK A;  1XJW B;  2DO3 A;  2DBK A;  4PLI A;  1UFF A;  4GY5 A;  2LNV A;  3MJX A;  4X1V A;  1QCN A;  2OAU A;  2DIQ A;  1PSF A;  1KJW A;  3EG2 A;  1VQ9 A;  4DOV A;  3MET A;  1VQ6 T;  2RQW A;  4RTU A;  3BW1 A;  3HTR A;  3X28 B;  4JLI A;  3M58 A;  1YJN Q;  5KE2 A;  1KC8 C;  1VOM A;  2YT6 A;  3NMZ C;  4AFU C;  3JCM J;  3OY9 A;  3DLM A;  3ME9 A;  3EGD A;  1S72 T;  3JCM f;  5HK0 A;  4J83 A;  2F5K A;  4MZM A;  3RKX A;  1C6V X;  2F2V A;  2QA4 A;  1WHG A;  1YCY A;  1IGQ A;  1KC8 R;  1YI2 Q;  1PRM C;  4B9W A;  2XI9 A;  2DMO A;  3VU3 C;  3OYJ A;  4N4H A;  2JNG A;  2QYZ A;  5FU6 C;  4BD3 A;  1KQS A;  2H8H A;  1GFD A;  2PTK A;  1LJO A;  3E9F A;  2E4H A;  1X75 C;  2HQX A;  4M78 D;  4PJM A;  2YUN A;  5FU7 B;  5GAN 3;  3GLX A;  2RK2 A;  4J9H A;  3RKY A;  3VKI A;  4OMF B;  2LJ3 A;  3VUB A;  2FYK A;  4HCB A;  2HQH A;  1KHI A;  4M75 F;  2CH4 W;  3KFV A;  4M77 D;  3E2U A;  4OGC A;  2KVQ G;  4F14 A;  4D8D A;  1TUD A;  3MPU B;  2KQW A;  4XAX B;  4BE2 A;  2EPD A;  4F16 A;  3HRT A;  2LX7 A;  4BY6 C;  3CD6 Q;  3HFO A;  4IUT A;  2KY9 A;  2QEX A;  3VRY A;  2JN0 A;  1X43 A;  2EJG A;  2CS7 A;  3LLR A;  2LX9 A;  2CSI A;  1Q7Y U;  4ELZ C;  2D1X A;  3V7S A;  1LPL A;  2DXU A;  1RAA B;  4A63 B;  1G5V A;  1VQ5 A;  5CKF A;  1AZE A;  1M90 R;  3FEO A;  1K76 A;  2W0Z A;  3HHT B;  2G6F X;  3I5R A;  4E47 A;  1OZ2 A;  4IUR A;  4C92 E;  2JM8 A;  2GFA A;  2CKK A;  2QXF A;  1RI9 A;  4RTY A;  3EG3 A;  3QPH A;  1MMN A;  3CQT A;  2L3P A;  2O31 A;  3FIF A;  1VQN T;  1QMC A;  3M59 A;  5A0D A;  4DBR A;  2RQR A;  2E6N A;  3NHN A;  1KC8 U;  2RJF A;  3EG9 B;  1NE8 A;  2EYY A;  2KEA A;  2EQK A;  3L2U A;  1YHQ Q;  2R57 A;  2KE9 A;  1TUC A;  3AHU A;  4E7S A;  5LL6 S;  2KGT A;  1UGV A;  3L2Z A;  4II1 A;  1VQL Q;  1YJW A;  1GCQ C;  4JPB W;  2CGH A;  1QW1 A;  2MK5 A;  1PSE A;  4E7J A;  5KYW A;  1ZUU A;  2R5M A;  4M78 F;  1YIJ A;  5GAO l;  2RK1 A;  3JB9 G;  4LD9 K;  3LW5 E;  2KYB A;  4C8Q A;  1KQS P;  1K0S A;  4Z88 A;  4CC3 A;  2WSF E;  4KGV B;  1WI7 A;  4HVU A;  2EFI A;  2R58 A;  3GPL A;  3A8L B;  4NS5 A;  3HL8 A;  4F7U F;  1VQN Q;  5CKE A;  3LGL A;  1ZA2 B;  4J7I A;  2OTL A;  2OTL Q;  1E7O A;  3LWI A;  4DBH A;  1C1A A;  5LJ3 j;  3WXM B;  2NUT B;  2FZG B;  2E41 A;  2CT3 A;  2KR3 A;  1BI0 A;  3JCM V;  5IXF A;  2OTJ Q;  3CCU A;  1O9S A;  2QQR A;  2LCS A;  5GAM h;  5GAO n;  1AZG B;  1ZBX A;  1N9R A;  3TU4 K;  1Q86 C;  2PZ1 A;  3CC4 A;  2MIO A;  4OMP A;  1BB9 A;  4HCZ A;  1W1F A;  5GJW B;  1Y0M A;  2HSP A;  2ED0 A;  2M51 A;  1T0H A;  3VUZ A;  1KQ1 A;  3MEV A;  1NYF A;  2KXC A;  1WA7 A;  1NEG A;  2J6O A;  4LUD A;  4MZP A;  2E5K A;  3CCE A;  4E7K A;  1QCO A;  2RF0 A;  3A1P A;  4M7D C;  2KAF A;  2KT1 A;  1RI0 A;  1YNZ A;  2PUO B;  4M77 G;  4PJN A;  2JS0 A;  2NUT A;  3H0F A;  3G71 T;  4OB2 B;  2PQW A;  2E3I A;  2VKN A;  3CCJ T;  2E3H A;  2YLB A;  3I35 A;  5CVI A;  2FPE A;  1I8F A;  4ESR A;  4N0A A;  2DIL A;  1MGQ A;  2K5I A;  3ZEH A;  2VGN A;  4HKE A;  3NFC A;  4XU2 A;  3URG A;  1B34 A;  5HY6 A;  3M0R A;  1RAF B;  3INZ A;  3CCE Q;  5GAM e;  1JO8 A;  4QQG A;  2D6F A;  4HCK A;  5CCA A;  1WJR A;  2DEU A;  2J6F A;  5J26 A;  2DTI A;  2VC8 A;  1Q82 U;  4ZTF A;  1YJ9 T;  1QVF S;  3MCA B;  3JAM E;  3JB9 J;  4J9E A;  2AZS A;  2LDM A;  4J6X A;  1S72 Q;  2NUZ A;  1W4S A;  1M5Q 1;  1VQ9 T;  4M75 B;  1ZSZ A;  2DAQ A;  1N27 A;  1WHJ A;  2FZC B;  1QQJ A;  2QGF B;  3BDL A;  4M75 C;  2HBP A;  1WYX A;  3OSS C;  1Y96 A;  1C0M A;  2J7I A;  1SSH A;  1QVG S;  2RHU A;  4JRQ A;  5LJ5 j;  1H92 A;  3L2W A;  4PJO E;  2A28 A;  2J06 A;  4QKU A;  1R0C B;  2J05 A;  2X51 A;  2YXY A;  2E6Z A;  4EIK A;  2KNB B;  1TWB A;  1VQ4 T;  3ZL7 C;  2VVK A;  1D0X A;  1ABO A;  4JDS A;  4OGE A;  2ZPG B;  2DE0 X;  4OB3 B;  5L8R E;  4AFZ C;  5A0G A;  2EBP A;  5DLQ E;  1GL5 A;  4J9C A;  2K5L A;  4KUI A;  4QW2 A;  1NPR A;  1FMV A;  3QDR B;  1VQ4 Q;  2BIV A;  3CCR T;  4AT1 B;  1YJW Q;  2X4J A;  1YBY A;  1VA7 A;  3RIR A;  2XHC A;  3D7S B;  4KH0 B;  2EGE A;  1K8A C;  4M77 B;  1NG2 A;  4EPC A;  3CCQ A;  2K79 A;  4M77 A;  3U23 A;  4Z02 A;  2KRN A;  1WJQ A;  5D6W A;  4FYW B;  1TSF A;  3JSC A;  2KSS A;  4M77 E;  2MI6 A;  4LN2 A;  4BE0 A;  3DLL A;  1HSQ A;  2JMA A;  2QAZ A;  2YRV A;  3EFO A;  4C8Q D;  5GAN 4;  2QI2 A;  3CC7 T;  2CP7 A;  1IRE B;  4J6W A;  1QWF A;  1VQ9 Q;  4M78 A;  2KXD A;  4RG2 A;  5FW9 A;  2KT8 A;  2QDL A;  1JXM A;  3RMS A;  4IIO A;  3G6E T;  3CMA T;  1JU5 C;  1B07 A;  1UGQ B;  1ARK A;  2GFU A;  5GAN 2;  4OMN A;  2DXC A;  1RLQ C;  3S6W A;  2RD1 A;  4OP0 A;  1UGS B;  3CCM A;  4EMH A;  3QXE B;  1M3A A;  3OMC A;  5HKC A;  1AVZ C;  3VYH B;  3EFS A;  3CD6 A;  5CR2 A;  4IUP A;  2RN8 A;  3REB B;  2EGC A;  4PJO D;  1NM7 A;  2QGG A;  3CCV Q;  3G4S Q;  1SPK A;  4KT0 E;  4F7U A;  4AG2 C;  4PFP A;  4UC4 A;  3JCM g;  5CAI A;  2GGR A;  1V76 A;  4JRP A;  3EFR A;  1N8R C;  2EWN A;  5GAN d;  3OYF A;  3RDV A;  1HXD A;  3CPF A;  4JLG A;  1WXT A;  2EJF A;  3C94 A;  2IPO B;  3T9N A;  2H3J A;  2RJD A;  5D7U A;  1DJ7 B;  5KYY A;  4FM4 B;  1I81 A;  1TS9 A;  1TTH B;  1M1K U;  2E10 A;  3QJ6 A;  5CQX A;  3O8V A;  4FU6 A;  3CCL A;  4KGZ B;  2BKD N;  4C92 B;  1RAE B;  2HZY A;  2QTX A;  1I5O B;  1UHC A;  1YCS B;  3CCS T;  1RAI B;  4QVD A;  4HVW A;  4QVZ A;  3M4Y A;  2D8J A;  2DJQ A;  4XQ3 A;  1VYT A;  2ENM A;  1R0B G;  1I07 A;  2P0K A;  5GMK j;  1SKU B;  2COY A;  3H9N A;  1VQK T;  2FEI A;  1TOV A;  2MAM A;  2VAS A;  2LQK A;  1VQ7 A;  1D0Z A;  2DTH A;  2CP6 A;  2OTL T;  2XKO C;  2ZCF B;  1MND A;  4QVC A;  1WZO A;  3LWH A;  1ZQ1 A;  2FPF A;  4DBF A;  2HAX A;  2L3Q A;  1M8V A;  3S3O A;  2AKK A;  3PT9 A;  1MMA A;  2CP0 A;  5GAN 7;  1V29 B;  5CKB A;  3TSZ A;  1YJN A;  3NPF A;  2CP2 A;  4L5G A;  2C0T A;  4ZGJ B;  1BIB A;  2A3L A;  5GMK m;  2JJ9 A;  1VQ7 Q;  2HNI A;  3L2R A;  1PHT A;  1ABQ A;  9ATC B;  2DM1 A;  2I0N A;  4C8Q B;  5LJ3 e;  1CKA A;  2PUK B;  1FX7 A;  2HCK A;  2XDB A;  3JCM X;  1S1N A;  5CK9 A;  5GMK i;  1YWO A;  4PLL A;  3VS5 A;  3HP9 A;  2X3W D;  3ASK A;  4AFS C;  1KD1 U;  5J39 A;  3P8H A;  4KUL A;  5GAN 5;  5GAO r;  3CXC S;  2DPP B;  3DB4 A;  4ANJ A;  4MML A;  3RMQ A;  4XU3 A;  2XK0 A;  3OQ5 A;  2MYS A;  2O9S A;  3OBY A;  2LVM A;  1RAC B;  1PC0 A;  5GAO q;  2D8H A;  2RHX A;  3QYG B;  3TCJ A;  1Q82 R;  2BUD A;  3CCJ A;  1M1K R;  4ME7 A;  2BZY A;  1NLO C;  2L3R A;  1W6X A;  1VYV A;  1UB4 A;  1T3L A;  4J9B A;  2JUF A;  3ER0 A;  2P0Q A;  2C0I A;  4A4H A;  1VQO T;  1M2V A;  2HDA A;  4PJO F;  4F7U G;  3NTH A;  2E70 A;  1S72 A;  2D0Q B;  1M9S A;  4Y91 A;  3OW2 A;  4O5V A;  3H0I A;  1VQK Q;  1WNL A;  4ZGD B;  1Q82 C;  3AT1 B;  2LNH B;  3QWY A;  1PWT A;  1D3B B;  2Y90 A;  5DLO A;  2WSC E;  4L6V 5;  4M7A E;  3FB9 A;  3NTK A;  4JS4 A;  1BI3 A;  1BCM A;  5LJ5 g;  4C8Q C;  5KYN A;  1Q81 C;  2A36 A;  1UDL A;  2O01 E;  4XTY A;  3BDU A;  4C5I A;  2DEQ A;  3QYH B;  3C0C A;  4C92 D;  1WJS A;  2GQI A;  4MDW A;  1K73 C;  1BIA A;  3OYA A;  3X25 B;  3OYC A;  2KRM A;  2GTO A;  3I56 T;  2YRD A;  2BTT A;  2IVW A;  1W70 A;  2HKQ B;  4CI0 C;  2EYW A;  3J7A F;  1QKW A;  3LH0 A;  4NL2 A;  1ZSZ B;  3JCM e;  2YRC A;  1EIF A;  1WDX A;  2QQB A;  4BI8 B;  2DD5 A;  2Y4Y A;  1K9M U;  1FMW A;  3OYH A;  1T3S A;  3BE3 A;  1LOJ A;  5GAN f;  3EHQ A;  4E7H A;  4LDU A;  1K73 U;  3ZFJ A;  5KYU A;  2M16 A;  3SEM A;  1IRX A;  4WCI A;  2P0P A;  3JCM P;  3SWN A;  1WHM A;  1BCO A;  4B6M A;  4LD6 A;  2D0N A;  4J9I A;  2NWM A;  3SDZ A;  4FL6 A;  4X9C A;  1QKX A;  2CUB A;  1EFN A;  3UPU A;  1YI2 T;  1BI1 A;  1SF9 A;  1EZZ B;  4CC4 B;  2EAY A;  5CKH A;  3CCU Q;  4F7U B;  3JCM Q;  4WTO B;  5GJV B;  2HD0 A;  4M75 D;  2YUO A;  1IO6 A;  2MF2 A;  1WFW A;  4HXJ A;  4D8K A;  3CC7 A;  3OW2 S;  3PGG A;  1GRI A;  2K3X A;  1I4K 1;  2JVV A;  4PK4 A;  2RHY A;  2L2P A;  1QP2 A;  3A98 A;  5CO7 A;  4E2F B;  2A7Y A;  4M7A D;  1FWZ A;  1NJI U;  2O9V A;  5C6S A;  1RAG B;  2RB6 A;  8ATC B;  1K9M R;  3R6N A;  1LVK A;  3V7R A;  3JCM d;  2DJZ A;  2LJ0 A;  1PD0 A;  1VQ6 Q;  1YIT Q;  1Z9Z A;  3E9G A;  4J7F A;  5EG2 A;  3MO8 A;  5GAN g;  1VQL A;  4XTV A;  5CQY A;  3CCR Q;  1VQP Q;  1G3Y A;  2A37 A;  3CBO A;  1R77 A;  2K6D A;  2OI3 A;  4C8Q G;  2LRQ A;  2CH4 A;  3NTI A;  1PM3 A;  1BU1 A;  5IN1 A;  2BE9 B;  4CC7 A;  1GCP A;  1X6O A;  3P8D A;  2JXB A;  1U5S A;  4IUV A;  1SSF A;  2RJC A;  1W2B S;  3V8L A;  1X27 A;  7AT1 B;  4C0G A;  2CZ0 B;  3G1J A;  1YFN A;  3G4S T;  3OYY A;  3CBP A;  3A8M B;  1KFZ A;  3SD4 A;  1E6H A;  1MMD A;  1OV3 A;  4N0A C;  4EMK C;  4RCB A;  4M77 C;  3GOX A;  4RUG A;  4J6Y A;  1G2B A;  4EMK B;  2EW3 A;  3VS4 A;  4FYX B;  3GIB A;  2HMA A;  1Y71 A;  1D09 B;  2JZ2 A;  5IHK A;  1TUG B;  3M0P A;  3CCS A;  1UGR B;  1TH7 A;  4BDZ A;  4J9G A;  3G7Z A;  1I5L A;  2HL5 C;  2F5T X;  1YJ9 Q;  1AEY A;  2X9H A;  1Y96 B;  5KYW B;  1QLY A;  4JS5 A;  1K8A R;  2EKO A;  5FLX E;  2QDY B;  3OS5 A;  4PJO C;  2RQV A;  4OMM A;  3UF4 A;  1UEC A;  2MPX C;  4M75 A;  4HCC A;  3CCM T;  3JB9 D;  4DOW A;  2NUP B;  1KSW A;  3WVE B;  4M7D F;  1W2B A;  1NBE B;  1N9S A;  2V8K A;  4BUG A;  1VQ4 A;  5GAO p;  3HPW A;  2IG0 A;  4GLM A;  4M78 E;  1X2Q A;  1D1C A;  2K3Y A;  1VQP T;  1MV3 A;  3FC3 A;  4PJO A;  3JCM h;  2M0O A;  3X26 B;  3MKD A;  4XK8 E;  3HRU A;  5DY9 A;  2QTV A;  4CRI A;  3MEU A;  3KBG A;  2ATC B;  1YIT T;  1YI2 A;  4A4K A;  5IXB A;  2VUB A;  2X35 A;  1RLP C;  2V1R A;  4DEY A;  4FW1 A;  5GMK l;  3OYL A;  2AKL A;  4M78 C;  3RES A;  3SB2 A;  3SHW A;  2ROL A;  1BYM A;  1M1K C;  2OX7 A;  4FW2 A;  1EX4 A;  1WHH A;  3VS2 A;  1MMG A;  2MWP A;  1BK2 A;  1IHV A;  5GAM f;  5IAY A;  4KRT A;  4ELY C;  4C92 A;  1JJ2 S;  1NYG A;  2XIC A;  2GNC A;  2RI5 A;  2BE7 D;  3VS0 A;  1LNX A;  3L2V A;  1OEB A;  1VYU A;  5LJ5 d;  1VQM Q;  1AT1 B;  2FO0 A;  3I55 A;  1M27 C;  1ZLM A;  2QQA A;  3FJP A;  2YSQ A;  1M1F A;  2LQ8 A;  1M90 U;  2CP5 A;  4JUV A;  4M4Z A;  1AHJ B;  1PNJ A;  3I5S A;  1VQ5 T;  3QZ5 B;  5GAM g;  3RR6 A;  2EIF A;  2EQJ A;  3M54 A;  3THK A;  3M9Q A;  2AHJ B;  3CCU T;  4MMK A;  2LJ1 A;  2VXE A;  2KMT A;  4XU0 A;  2E5Q A;  2RMO A;  2VWF A;  1AOJ A;  2CZ1 B;  2XD0 A;  2GCX A;  3EAE A;  3VV0 A;  3EGX B;  3OB9 A;  4FT2 A;  5J3B A;  3HSB A;  1A0N B;  4C8Q E;  1BBZ A;  2DBM A;  4A4G A;  4ZN1 A;  5FU6 B;  3OS2 A;  2PVD B;  3JCM b;  1UTI A;  3H0H A;  3OSV A;  3G71 Q;  4GBQ A;  3PVL A;  5FU7 C;  1M8M A;  2RQT A;  3GNF B;  4V2S A;  1FMK A;  1WQ7 A;  2A0F B;  1IXD A;  1WXU A;  3PFS A;  4C92 C;  2DRM A;  2O2O A;  4LUE A;  4LNP A;  4FYY B;  4C92 F;  3CCL T;  2NUP A;  2ZPI B;  5I21 A;  5FRM A;  3QWX X;  1Q95 G;  5KYU B;  3PVQ A;  1N6A A;  3UWN A;  5KCO A;  3CEY A;  2YDL A;  5I11 A;  2LC4 A;  4HA8 A;  1G8X A;  1PRL C;  2QQ9 A;  2OTJ A;  3EH1 A;  1VQO A;  1RAH B;  3RUX A;  3C95 A;  3TSW A;  2EVR A;  2QQS A;  2ZPE B;  4OMO A;  1XNI A;  5L23 A;  4LDV A;  3EFO B;  2WSE E;  1CKB A;  3OS1 A;  2DL8 A;  1WHK A;  4Y92 A;  4LDY A;  2I2L A;  1VQO Q;  1GBR A;  3EH2 A;  4J9D A;  1HK9 A;  1X6G A;  3J81 E;  5D6X A;  4C5G A;  2DLP A;  4TVR A;  1M4Z A;  1Y7X A;  2DD4 A;  4ZTJ A;  2XDD A;  3KXT A;  3OW2 P;  1WX6 A;  1WLP B;  2E64 A;  2DXT A;  3QKJ A;  2JTF A;  2Y4X A;  4M7A F;  2B86 A;  4PNO A;  3BY7 A;  2AIR B;  1WXB A;  4RCC A;  4ZNX A;  3E19 A;  3G71 A;  1OUL A;  4C5E A;  1OI1 A;  1Q81 R;  2LMJ A;  3OYM A;  3M56 A;  1E6G A;  1T0J A;  1VQ8 A;  5AT1 B;  3QDF A;  4JJC A;  3REA B;  2V8J A;  2FRW A;  1RAB B;  2SRC A;  3CBM A;  5KYY B;  5IT9 E;  1WIE A;  2LT4 A;  5I22 A;  1VQ5 Q;  3EG1 A;  1HJD A;  4PFO A;  4OVA A;  1K8A U;  2QAS A;  3JB9 H;  3QZ9 B;  4F04 B;  3OA6 A;  1OQK A;  3TVT A;  2XMF A;  1B34 B;  4DA4 A;  4DQ2 A; 
#chains in the Genus database with same CATH homology
 3JCM e;  1EIF A;  4OB1 B;  1O9S A;  2QQR A;  2EQM A;  5A0L A;  5GAM h;  3QBY A;  4C8Q F;  5GAO n;  1ZBX A;  1N9R A;  1YJN T;  3TU4 K;  2QQB A;  4BI8 B;  1Q86 C;  4NL3 A;  2DD5 A;  2Y4Y A;  3PNW C;  1K9M U;  3OYH A;  5KE3 A;  3CC4 A;  1LOJ A;  3CPW S;  5GAN f;  3S3N A;  3QII A;  4FSX A;  4HCZ A;  4E7H A;  2NLU A;  3RKW A;  4LDU A;  4M7A B;  4E7I A;  1K73 U;  1VQM A;  3ZFJ A;  1G3T A;  1NJI C;  2M16 A;  4P5N A;  3VUZ A;  3JRZ A;  1KQ1 A;  2FHD A;  2P0P A;  4JRI A;  4YTL A;  3MEV A;  3JCM W;  3JCM P;  3SWN A;  2DKG A;  3SFM A;  2RO0 A;  1VQ7 T;  3QSU A;  4LD6 A;  3QJY A;  3S3M A;  3GP8 A;  4ATO A;  3SDZ A;  5C0M A;  4FL6 A;  3G4S A;  4X9C A;  2RH2 A;  1YIT A;  4XTX A;  3UPU A;  1BI1 A;  3KUF A;  4MZP A;  1YI2 T;  3PIO A;  5LJ3 d;  3CCE A;  3QUI A;  3Q1J A;  1RL2 A;  4E7K A;  1KG1 A;  3OBW A;  1VUB A;  2EAY A;  2VXF A;  2DK3 A;  2KAF A;  4M7D C;  5CKH A;  4F7U B;  1RI0 A;  2B8A A;  3M4G A;  2XID A;  3MP1 A;  2PUO B;  3JCM Q;  3OYD A;  2DIG A;  4M77 G;  2HD0 A;  4M75 D;  2MF2 A;  2PVO B;  2P4T A;  4PKC C;  4M7D G;  3G71 T;  3CC7 A;  2ZZD A;  4OB2 B;  3SWN C;  3OW2 S;  2PQW A;  3PGG A;  2K3X A;  3CCJ T;  3HRS A;  1BKB A;  2EQU A;  4OF1 A;  1I4K 1;  5CIU A;  3OYE A;  2YLB A;  5CVI A;  2JVV A;  1I8F A;  3SWN B;  3JB9 F;  2RHY A;  1QP2 A;  2X4Y A;  4N0A A;  5CO7 A;  2A7Y A;  4ZN3 A;  1MGQ A;  5LJ3 g;  1VQM T;  2K5I A;  4M78 G;  3ZEH A;  4BAC A;  4M7A D;  1FWZ A;  1NJI U;  2VGN A;  4HKE A;  3NFC A;  3FLG A;  4XU2 A;  5C6S A;  3URG A;  1B34 A;  2RB6 A;  5HY6 A;  3VJP A;  4J5Y A;  3CC2 T;  5GAN h;  3UDC A;  1X01 A;  3INZ A;  3OYN A;  1O75 A;  3I55 T;  5GAM e;  3V7R A;  3JCM d;  2DJZ A;  4QQG A;  2JTM A;  4X34 A;  1NZ9 A;  1UGP B;  4VUB A;  3CCV T;  4M75 E;  3E9G A;  5CCA A;  4BDY A;  1VIF A;  4IKF A;  4J7F A;  5DM7 R;  2D9T A;  5EG2 A;  1WJR A;  3MO8 A;  1Y07 A;  3C4S A;  5J26 A;  5GAN g;  1VQL A;  2FB7 A;  2DTI A;  2RJE A;  2RHI A;  2VC8 A;  4XTV A;  5CQY A;  1YJW T;  1Q82 U;  4M7A A;  1NPP A;  5LJ5 h;  4GLK A;  4ZTF A;  1YJ9 T;  1QVF S;  1G3Y A;  3MCA B;  3JAM E;  3JB9 J;  4M7A C;  3CBO A;  2LDM A;  3M55 A;  4J6X A;  1H3Z A;  1W4S A;  4C8Q G;  2LRQ A;  2DVE A;  2LCL A;  1M5Q 1;  3HKS A;  3NTI A;  4M75 B;  4E7L A;  1VQ9 T;  1U1S A;  1N27 A;  2DAQ A;  4Y28 E;  3CC4 T;  5IN1 A;  2ZPF B;  5GAO m;  3BDL A;  1U1T A;  5GAN e;  3MEA A;  2E1H A;  2EYQ A;  4M75 C;  1X6O A;  2X4X A;  1D3B A;  4XTZ A;  2HBP A;  3P8D A;  2PU9 B;  2VV5 A;  3OSS C;  2E65 A;  5HK3 A;  3PIP A;  1OYX A;  1Y96 A;  4IUV A;  1QVG S;  3OYG A;  1SSF A;  4EDU A;  2RJC A;  5KCH A;  4C92 G;  2RHU A;  2RM4 A;  3V8L A;  1W2B S;  4M7D B;  2MMP A;  4JRQ A;  5LJ5 j;  3M5A A;  5D6Y A;  3JCM c;  2FVU A;  4C0G A;  3L2W A;  2CZ0 B;  1YHQ T;  4PJO E;  5M9O A;  3QHS A;  2K5F A;  3MHX A;  3I56 A;  3OYY A;  3G4S T;  3CBP A;  3A8M B;  3SD4 A;  4N0A C;  3TEE A;  4EMK C;  3GF5 A;  4HT8 A;  2ZPH B;  4RCB A;  2G3R A;  4M77 C;  3GOX A;  3OMG A;  3FDR A;  1KQ2 A;  2E6Z A;  2GF7 A;  4J6Y A;  3PMI A;  2CYZ B;  4EMK B;  1VQ4 T;  4A53 A;  5GAM j;  3GIB A;  4JDS A;  4OGE A;  1KHC A;  2O4X A;  2ZPG B;  4MZT A;  5AYF A;  2O4X B;  1Q81 U;  1Y71 A;  4OB3 B;  2RI2 A;  1VQ8 T;  2KDS A;  4M78 B;  5L8R E;  3V8K A;  2JZ2 A;  3MP8 A;  5DLQ E;  5A0G A;  1QVP A;  4QQ6 A;  2K5L A;  3A8G B;  3CCS A;  1UGR B;  2L5Q A;  1TH7 A;  4KUI A;  4BDZ A;  4QW2 A;  1NPR A;  4PJO G;  3G7Z A;  3QDR B;  1G3W A;  1I5L A;  2F5T X;  2BIV A;  1Y96 B;  3QO3 A;  4F7U E;  4FT4 A;  3CCR T;  2X4J A;  4JS5 A;  1YBY A;  3A5Z B;  4PL6 A;  2XHC A;  3RIR A;  1VQK A;  2EKO A;  5FLX E;  3X24 B;  2QDY B;  3OS5 A;  2CZ6 B;  4PJO C;  3M53 A;  4M77 B;  1K8A C;  4KUD K;  2WAC A;  4EPC A;  3CME T;  2DXB A;  3CCQ A;  1M90 C;  4M77 A;  5I2S A;  4Z02 A;  4L59 A;  4M7D E;  4M75 A;  1WJQ A;  5D6W A;  3CCE T;  4IUQ A;  4QQD A;  4B9X A;  4BI4 A;  4HCC A;  2EJ9 A;  3CCM T;  1Q7Y C;  1KD1 C;  3CCV A;  3JB9 D;  4DOW A;  3JSC A;  3UT1 A;  4M7D A;  2KSS A;  4M77 E;  5GAN 6;  3WVE B;  4M7D F;  1JJ2 A;  3E1S A;  1W2B A;  3V8J A;  2MI6 A;  1MHN A;  4EMG A;  4BE0 A;  1N9S A;  2V8K A;  4BUG A;  3OYB A;  1VQ4 A;  3DLL A;  4JJN K;  5GAO p;  3HPW A;  2YRV A;  5GAN 4;  4C8Q D;  1WQW A;  1VQ6 A;  2QI2 A;  3CC7 T;  3CXC A;  1IRE B;  3P8B B;  4J6W A;  5GMK e;  4M78 A;  1JB0 E;  4RG2 A;  2IG0 A;  2RHZ A;  3A8O B;  2LTO A;  4A54 A;  4M78 E;  2L89 A;  3ZBD A;  3OYK A;  3RMS A;  4C0D C;  1VIE A;  2K3Y A;  2ZGW A;  2HQE A;  3H8Z A;  1VQP T;  1XQH A;  3G6E T;  1N8R U;  4HT9 A;  2VYT A;  3C12 A;  3L2Q A;  3FC3 A;  3L1A A;  3X20 B;  3H6Z A;  3CMA T;  1FXX A;  4PJO A;  3JCM h;  4EMK A;  4C0D B;  2M0O A;  3X26 B;  3CC2 A;  4XK8 E;  4C0F A;  3HRU A;  1UGQ B;  5DY9 A;  2L8D A;  4CRI A;  4J8O A;  3MEU A;  3KBG A;  1YIT T;  1YI2 A;  2GFU A;  4A4K A;  2VUB A;  4KBM B;  5GAN 2;  4R55 A;  2X35 A;  3CCQ T;  1XTD A;  2DXC A;  2LCC A;  5FRO A;  2GQV A;  3S6W A;  4RMO A;  2RD1 A;  4OP0 A;  1UGS B;  5GMK l;  4JRK A;  4EMH A;  3OYL A;  3QXE B;  3CCM A;  4M78 C;  3RES A;  3OMC A;  4XTU A;  2DO3 A;  3SB2 A;  3OYI A;  4M77 F;  4PLI A;  5HKC A;  4GY5 A;  2LNV A;  1JBM A;  3VYH B;  3EFS A;  3CD6 A;  1KQS S;  2OAU A;  5CR2 A;  4IUP A;  1BYM A;  2DIQ A;  1M1K C;  1PSF A;  2ZPB B;  3FRN A;  1VQ9 A;  4PJO D;  4DOV A;  2K4Y A;  3M57 A;  3HFN A;  3MET A;  1VQ6 T;  2MWP A;  5GAM f;  4LDW A;  2DZC A;  5IAY A;  4KT0 E;  4F7U A;  3BW1 A;  4ELY C;  4C92 A;  3X28 B;  1JJ2 S;  1OZ3 A;  4JLI A;  4UC4 A;  1BI2 A;  3LGF A;  3M58 A;  2XIC A;  3JCM g;  2XG8 D;  5KE2 A;  3DKM A;  2RI5 A;  5CAI A;  2VGM A;  1LNX A;  4WF2 A;  3WVD B;  3L2V A;  4JRP A;  1KC8 C;  5LJ5 d;  3EFR A;  4OB0 B;  1N8R C;  2EWN A;  5GAN d;  3OYF A;  3VYG A;  1HXD A;  3CPF A;  3I55 A;  2QQA A;  4JLG A;  1QVF A;  3FJP A;  1M1F A;  2EJF A;  2LQ8 A;  2MWO A;  3C94 A;  3OY9 A;  3JCM J;  1U8R A;  1YHQ A;  3T9N A;  1M90 U;  2H3J A;  2RJD A;  3DLM A;  1DJ7 B;  3ME9 A;  5GAO r;  4JUV A;  1AHJ B;  4FM4 B;  1S72 T;  1I81 A;  3JCM f;  5HK0 A;  2M1H A;  3MP6 A;  4J83 A;  2E10 A;  1M1K U;  2E12 A;  1M1G A;  2D6F A;  1VQ5 T;  3QJ6 A;  4NOY A;  5CQX A;  3LX7 A;  2F5K A;  3QZ5 B;  5GAM g;  1YJ9 A;  4M7D D;  3O8V A;  2EIF A;  2EQJ A;  3M54 A;  4FU6 A;  4MZM A;  4ZGE B;  3CCL A;  3TRE A;  3M9Q A;  2AHJ B;  3RKX A;  3PMT A;  3CCU T;  4BB7 A;  1P92 A;  2QA4 A;  4MMK A;  2VXE A;  4X9D A;  2BKD N;  3DB3 A;  2KMT A;  4XU0 A;  4C92 B;  1YCY A;  3L42 A;  1R8O B;  2QTX A;  4A4E A;  2E5Q A;  2DZ9 A;  4B9W A;  2FL7 A;  2XI9 A;  4R56 A;  4QVD A;  3CCS T;  3VU3 C;  4PJO B;  3OYJ A;  4N4H A;  4A4F A;  2JNG A;  2CZ1 B;  4QVZ A;  2XD0 A;  2GCX A;  3EAE A;  3VV0 A;  3OB9 A;  4FT2 A;  3M4Y A;  4XQ3 A;  3G6E A;  2QEX T;  5FU6 C;  5J3B A;  4BD3 A;  3HSB A;  2K57 A;  2OTJ T;  4C8Q E;  5GAN j;  3CMA A;  1KQS A;  2P0K A;  5GMK j;  4M75 G;  1VQK T;  4A4G A;  1LJO A;  3E9F A;  4ZN1 A;  5FU6 B;  2MAM A;  1X75 C;  2KK4 A;  2HQX A;  4M78 D;  4LDX A;  3CPW A;  3OS2 A;  3CME A;  2LQK A;  2PVD B;  4BY6 B;  5FU7 B;  1VQ7 A;  2DTH A;  3JCM b;  5GAN 3;  2OTL T;  2XKO C;  2ZCF B;  3GLX A;  3OSV A;  2XDP A;  2RK2 A;  4QVC A;  5FU7 C;  3RKY A;  3VKI A;  3LWH A;  1ZQ1 A;  4OMF B;  4D6W A;  2HAX A;  3GNF B;  4V2S A;  2K2V A;  3VUB A;  1WQ7 A;  2FYK A;  3BFM A;  4HCB A;  3PFS A;  3S3O A;  1M8V A;  1KHI A;  4C92 C;  4M75 F;  3J80 E;  4BE1 A;  3PT9 A;  5GAN 7;  1V29 B;  1WPY A;  4M77 D;  5CKB A;  4C0Z A;  4OGC A;  1YJN A;  3CCL T;  2KVQ G;  4C92 F;  3LYI A;  5A2Q E;  3F70 A;  2KQW A;  2YLC A;  4XAX B;  2QA4 T;  4L5G A;  2ZPI B;  5CKD A;  5I21 A;  5FRM A;  4ZGJ B;  1BIB A;  4BE2 A;  2A3L A;  1N6A A;  3UWN A;  5GMK m;  5KCO A;  3CEY A;  1VQP A;  3OS0 A;  2HNI A;  3L2R A;  3HRT A;  3N5B B;  4XU1 A;  3CCR A;  2LC4 A;  1H64 1;  4BY6 C;  4HA8 A;  3HFO A;  4IUT A;  2KY9 A;  2DTO A;  2QEX A;  4C8Q B;  2JN0 A;  5LJ3 e;  2QQ9 A;  2OTJ A;  2PUK B;  1FX7 A;  1VQO A;  2XDB A;  2EJG A;  3JCM X;  2RA2 A;  1UEB A;  3V7C A;  4BI3 A;  2CS7 A;  5CK9 A;  3LLR A;  5GMK i;  4PLL A;  5FRN A;  2XU8 A;  3RUX A;  3HP9 A;  3C95 A;  2LX9 A;  3ASK A;  1Q7Y U;  1ZHI A;  2QQS A;  2ZPE B;  3P8H A;  4IUU A;  4KUL A;  4RG8 A;  4ELZ C;  5J39 A;  3MEW A;  2DPP B;  5GAN 5;  3CXC S;  3V7S A;  3DB4 A;  4MML A;  3RMQ A;  1K9M C;  4XU3 A;  1XNI A;  2DXU A;  2F69 A;  4LDV A;  2XK0 A;  2WSE E;  1G5V A;  3OQ5 A;  1VQ5 A;  5GAN 8;  2LT1 A;  3OS1 A;  3OBY A;  5CKF A;  2LVM A;  1VQL T;  3A8H B;  3FEO A;  5KH6 A;  2R5A A;  1YIJ T;  3HHT B;  4FIB A;  3PTA A;  2V8I A;  5GAO q;  2RHX A;  4E47 A;  1OZ2 A;  3QYG B;  4IUR A;  4C92 E;  4LDY A;  1KD1 U;  2QXF A;  2GFA A;  2CKK A;  2CZ7 B;  3TCJ A;  2I2L A;  2BUD A;  3CCJ A;  3QPH A;  3FIF A;  4ME7 A;  1VQN T;  2L3R A;  2RI3 A;  3M59 A;  5A0D A;  4O6J A;  3GNG A;  5GAM d;  1UB4 A;  4MDX A;  1HK9 A;  2E6N A;  2JUF A;  3ER0 A;  2P0Q A;  3J81 E;  1KC8 U;  2RJF A;  2YHT A;  1NE8 A;  5D6X A;  4C5G A;  4TVR A;  4A4H A;  1M4Z A;  1Y7X A;  2EQK A;  2PVG B;  4Q5W A;  3L2U A;  1VQO T;  1JRI A;  2DD4 A;  4ZTJ A;  2R57 A;  2XDD A;  3KXT A;  4PJO F;  4F7U G;  3NTH A;  2E70 A;  5LJ5 e;  5I2M A;  1S72 A;  3AHU A;  2D0Q B;  5LL6 S;  2E64 A;  1M9S A;  4Y91 A;  3OW2 A;  2DXT A;  4O5V A;  3L2Z A;  3QKJ A;  2JTF A;  5LJ3 f;  1WNL A;  4II1 A;  4ZGD B;  1Q82 C;  3CD6 T;  4RKU E;  1YJW A;  2Y4X A;  4M7A F;  2CGH A;  1QW1 A;  1D3B B;  4PNO A;  2Y90 A;  5DLO A;  2C06 A;  3QG1 A;  2WSC E;  3BY7 A;  1PSE A;  4L6V 5;  4RCC A;  4E7J A;  3E19 A;  3G71 A;  4M7A E;  3FB9 A;  3NTK A;  2R5M A;  4M78 F;  4JS4 A;  1YIJ A;  5GAO l;  4C5E A;  1BI3 A;  5LJ5 g;  5LJ3 h;  4XTW A;  1OI1 A;  2RK1 A;  3JB9 G;  3OYM A;  3M56 A;  4C8Q C;  4LD9 K;  1VQ8 A;  3LW5 E;  1Q81 C;  1QP3 A;  2O01 E;  4C8Q A;  4M7A G;  4XTY A;  4N4G A;  1Q86 U;  2V8J A;  2WSF E;  4C5H A;  1VQN A;  2EFI A;  3BDU A;  4C5I A;  2R58 A;  2JOY A;  3GPL A;  3CBM A;  5IT9 E;  3A8L B;  2DEQ A;  4NS5 A;  2LT4 A;  1GXI E;  2X4W A;  3QYH B;  5LJ5 f;  3HL8 A;  4F7U F;  4C92 D;  1WJS A;  3LGL A;  4MDW A;  5CKE A;  1K73 C;  3JB9 I;  1BIA A;  4J7I A;  3X25 B;  3OYA A;  1G3S A;  2OTL A;  1XOV A;  3OYC A;  4OVA A;  3LWI A;  1K8A U;  3I56 T;  1WGS A;  5GMK h;  2IVW A;  4CI0 C;  5LJ3 j;  4N4I A;  3JB9 H;  3WXM B;  3QZ9 B;  3R6O A;  1QVG A;  3J7A F;  1IZ6 A;  3OA6 A;  3LH0 A;  2E41 A;  2M9U A;  3RER A;  4NL2 A;  1BI0 A;  3JCM V;  1B34 B;  4DA4 A;  3CCU A;  4DQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...