2RH2A

High resolution dhfr r-67
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydrofolate reductase type 2
publication title Crystal Structure of a Type II Dihydrofolate Reductase Catalytic Ternary Complex
pubmed doi rcsb
source organism Escherichia coli
total genus 11
structure length 57
sequence length 57
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2007-10-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rh2A00
2GQVA 2RH2A 2RK1A 2P4TA 1VIEA 3SFMA 3UDCA 2RK2A 2VV5A 3T9NA 1VIFA 2OAUA
chains in the Genus database with same CATH superfamily
4OGEA 2EYZA 4BE1A 1ZHIA 4XU1A 5CVIA 2MK5A 1RAFB 1I07A 1G3WA 5GAOm 2DRMA 4B6MA 3V7CA 5KYUB 1T0JA 2AKLA 3VS1A 2DILA 3REBB 3DLMA 2VASA 3EGDA 4RTZA 5FRMA 1D3BB 5GAOl 2VC8A 3OW2S 1E7OA 3NGPA 1PKTA 2HSEB 1OULA 1N9RA 3UWNA 2F2XA 1VYUA 2B86A 1RAEB 3RR6A 4AG1C 2DXBA 2VUBA 4J6WA 4HT8A 4C8QF 2V1QA 4C92F 2MF2A 3PTAA 1X43A 1SEMA 2QGFB 2HL3A 3CD6Q 3QG1A 3RERA 4ZGEB 2RI5A 4NL2A 1UGSB 2L3SA 4M78A 3TVTA 2HD0A 3EAEA 1M5Q1 1HD3A 3TQ7P 4M7AA 2EYQA 1YJNQ 1PM3A 1YJNA 2X9HA 3L2WA 4C92C 5KYWA 3OW2P 5CCAA 2RO0A 2RA2A 3GP8A 2VKNA 3WXMB 4QQDA 4CI0C 3GNGA 2F2VA 1VQ8Q 2J06A 3PIOA 4J5YA 3AT1B 2J7IA 3VUBA 4A53A 4PJOC 3H9NA 1WHKA 2XD0A 2VVKA 4OB3B 5GAOp 2DJZA 4KGVB 5GAN2 3QHSA 2K6DA 3CBMA 4C92G 3JB9F 1ZSZC 1VQMQ 2RH2A 2X35A 2DERA 5LJ3f 2CP6A 4PJOG 4BB7A 3PMIA 3CC7T 2RQUA 1UGRB 4M75F 5FWCA 4RCCA 3RBBB 1M2VB 3PGGA 2M0OA 5LJ3j 4F7UA 5J39A 2KROA 1XTDA 3GLXA 1QVPA 4M75C 5D6XA 2HZYA 1GRIA 3PT9A 2P4RA 4JZ4A 2E5QA 1YIJA 2O9VA 2KT8A 2DBMA 5GAOn 3JB9G 4C92D 1MGQA 1FX7A 4ZGDB 1ZUKA 2LQNA 1BK2A 2DE0X 4A4KA 1M1KR 2M9UA 1X6BA 4GLMA 4PJOD 5DY9A 1YWPA 3BFMA 4JDSA 4LDYA 2BZ8A 3QXEB 3WVDB 1RAHB 3NTKA 1TOVA 4HKEA 4M75G 4JLIA 1KC8R 1JXMA 4AFSC 1RI9A 3VUZA 4WF2A 5GAMf 4J83A 2BUDA 1YCSB 2CP3A 3MCAB 3VS2A 4BUGA 4C5EA 3M0RA 1H92A 2CT3A 3P8BB 3G71A 1QW1A 4M77F 2RJEA 4C8QA 1X27A 2EKHA 2KBTA 4PFZA 4JRPA 4JJDA 5D6WA 1Q81R 1IHVA 2MWPA 5GAMj 2WSEE 1VQ4A 2GQVA 4A54A 3JB9D 2G6FX 4M77C 2A7YA 1QKWA 3OYFA 2PUKB 1OI1A 4RTYA 1UFFA 2ECZA 2KDSA 2MI6A 1B34B 3EGXA 1PKSA 2ROTA 1VYVA 3CEYA 4M75D 3KXTA 3CBOA 2FZKB 1VQ7Q 2D9TA 3CD6T 2RHUA 1C1AA 1XJWB 3CXCS 1QMCA 4DBHA 1ACMB 2PU9B 3VS7A 4M77G 3EG9A 3I5RA 3S6WA 2M0YA 3ZEHA 1FWZA 5FROA 2Z0WA 1OQKA 3OBWA 1KJWA 1VQ8T 1I5OB 1Y96A 1YWOA 2E65A 2QAZA 2RJDA 2FRWA 3EFOB 8AT1B 3E19A 3H0HA 4A4HA 3HP9A 3CCUQ 1QVFA 3M57A 2COWA 2L8DA 3L2UA 3HRUA 2C0TA 3MEAA 3MJXA 1OZ3A 5IN1A 3RKWA 2A0FB 1GCQA 1PWTA 1VQMT 4PNOA 1WNLA 5KYXA 2A08A 2CZ7B 1KC8U 1R0CB 4M77D 3DKMA 2CUDA 4XK8E 3CCQQ 4KT0E 5C0MA 5FU7B 4BY6C 1TUDA 4BACA 1UG1A 3OYLA 1UHFA 2GF7A 3CMEQ 2V8JA 4LXCA 1Q81U 2YHTA 4JJBA 2CP5A 3I56Q 1Q95G 2RM4A 3LWHA 1VUBA 3N5BB 4MDXA 1VQNA 3JSCA 4L6V5 5D6YA 1WJQA 1M1KC 3LW5E 1YITA 1K73R 2QA4Q 1QKXA 1NZ9A 5IHNA 2QTVA 2X4XA 1X6GA 3REAB 1KC8C 2PUOB 3KBGA 1OPLA 2MIOA 2DF6A 1RL2A 1VQKA 1SRLA 1AZGB 5A0LA 1VQ9A 2M51A 3QPHA 4IUVA 1T0HA 2K57A 4J9CA 4EPCA 4ME7A 3QWXX 4LDUA 1PD1A 1CSKA 1Q81C 1V76A 5LL6S 5GANg 2DPPB 1G83A 1N9SA 1LCKA 2VV5A 4BI4A 1W2BA 2KK4A 4A63B 4C0GA 3JCMb 2DL4A 1WXTA 2EBPA 5ECAA 4NOYA 5KYUA 2RB6A 1B3QA 3CCMA 3IQLA 2PZ1A 1OYXA 1QVGA 4JPBW 1G3TA 2DTOA 1D3BA 4Y28E 5GANd 1CKAA 4QVDA 3OYMA 2C0IA 2LZ6B 4Z02A 2DTHA 1E6HA 3I5SA 3RNJA 1BKBA 1WGSA 1S72Q 3CC4Q 1WHHA 4O5VA 2GFAA 1PD0A 2E12A 3PMTA 4J6YA 2JTEA 3BDUA 3QBYA 5GANh 1G5VA 4MMKA 2LQKA 4RTUA 1UDLA 1LOJA 2BZXA 2AK5A 1ZX6A 1ZQ1A 2E3HA 3VS6A 1EX4A 3CCUT 2PVOB 2E3IA 2W10A 1SSHA 1RUWA 1K73U 3CMAA 4LDVA 4A4FA 2RI3A 4E7IA 2D0NA 1Q86R 2XICA 3X25B 3JCMJ 2FB7A 4OGCA 4N4GA 1JJ2A 3DB4A 1D0YA 1GBQA 1H3ZA 4GBQA 4IUPA 1YI2T 1BCOA 3OMGA 5FWBA 4MZPA 1LJOA 2LDMA 2LNHB 2E6ZA 2W0ZA 1XNIA 1WA7A 2OI3A 3VJPA 2R5MA 1DJ7B 4J7FA 3CMET 1KFZA 2IG0A 2O88A 3NTHA 1K73C 3CPWP 2XI9A 1M2VA 3CCEA 1FMWA 2ZZDA 2EJGA 2A28A 2JXBA 2QA4T 1VA7A 1HK9A 2XHCA 5A0GA 1QCNA 1M9SA 3A8HB 4OMNA 2DYIA 2DFUA 3FJPA 2LC4A 2JN0A 5LJ5j 4J9GA 1BI1A 3JCMX 1UGPB 2MAMA 4AG2C 4HCZA 3QYHB 2X4YA 5I22A 1GBRA 1IHWA 2CGHA 4EMKC 2FL7A 3LWIA 2DIGA 4HT9A 5IXBA 2CP0A 4AMCA 1K9MR 1QP3A 4A4GA 2DXUA 2RK2A 3X20B 4XTYA 3HFNA 3GPLA 2X3XD 1G8XA 5AYFA 5GANe 2AZVA 2EQUA 1YFNA 1YJ9A 2DBKA 4PJOB 2CZ6B 3EGUA 3I55Q 1GXIE 1WHLA 4RTWA 4JS5A 1Q86U 2PTKA 3NHNA 1M3CA 1W70A 4HVVA 2RHZA 3PNWC 1NEBA 1UGVA 5HCKA 1TUGB 1NYFA 1UECA 4OF1A 2HQEA 1QCFA 4N0AA 3J7AF 1BU1A 2ESWA 2KRMA 2NUZA 5HK0A 2B8AA 1B34A 2RHIA 4NL3A 2J6FA 3CCRQ 2EJ9A 2JVVA 4RG8A 2P0PA 3EH2A 3VV0A 5KE3A 3OYJA 1BBZA 3RUXA 3M56A 5KCHA 1PRMC 2QK0A 3OYNA 3OYDA 4E6RA 1Q86C 2KI7A 3UA6A 4M78F 3M59A 2MCNA 2RHXA 2QQAA 1D09B 3CCJQ 2RMOA 4XU2A 3SFMA 5AT1B 2FZCB 2EW3A 3A1PA 2YRCA 1C0MA 1WYXA 2ZAEA 3CC7Q 4CC7A 1NLPC 4M7AC 3R6NA 4JRQA 2HBPA 3SEMA 1V1CA 2DK3A 2M1HA 1K9MU 1QLYA 3TEEA 4KGZB 4RMOA 1KQSA 3LH0A 4BI8B 2EJFA 4LD6A 3DLLA 2R57A 3CPFA 4XQ3A 3CCVA 4AT1B 1NE8A 3QZ9B 2RF0A 4J6XA 3QZ5B 2XDPA 3CCLQ 4FSXA 4M7AG 1Y07A 4PFOA 4RTXA 1XQHA 4IUQA 1T3LA 4PJOE 2ZPIB 4MDWA 4QT7A 2JNGA 4QVZA 1MNDA 4F7UF 1D1AA 3FB9A 4OMMA 2JMAA 1R0BG 2QDYB 1K9MC 1PNJA 2JM9A 2PQWA 2YUPA 3EHRA 3RDVA 2LP5A 4M4ZA 2EYWA 2LCSA 1Q7YR 2M02A 1O9SA 2MPXC 4J7IA 4M78D 4DQ2A 3UDCA 4M7AD 1MUZA 3VS0A 1UGQB 3HTRA 2KE9A 3I55T 4WTOB 2HSPA 4OB2B 1RLPC 4ESRA 3L1AA 4F7UG 2KMTA 2CREA 3A98A 1KHCA 3BDLA 4LNPA 4LUEA 2MYSA 4RG2A 3CD6A 2DD4A 2RN8A 2ZPGB 3PVLA 3M0SA 5DM7R 4ELYC 3A8OB 2DRKA 1YN8A 1RADB 3V8JA 1VQ5Q 5GAN7 1T3SA 3RKYA 4C8QC 4ZN1A 3CCRT 1K0XA 1KD1R 1VQLT 5I2MA 1PRLC 2HBWA 4BDZA 1VQ8A 3LYIA 1NLOC 2KR3A 1K9AA 1H3HA 2GGRA 2DXCA 1YCYA 4KGXB 1TXQA 5GAN5 2HQXA 1ZUYA 1UE9A 4C8QG 2MMPA 3THKA 1AWXA 4FT4A 1VQMA 3CCJT 2XMFA 1PCXA 4D8KA 5IXFA 1U3OA 2YRVA 3CCST 2KT1A 1WHGA 1Q7YU 1YJWQ 1PSEA 3J80E 5A0DA 2CYZB 2DX1A 1NPRA 3GNFB 3OA6A 1SPKA 2QASA 2EIFA 1AWOA 1BIBA 3SHWA 4EMGA 2GBQA 3CCLT 3HSBA 4C8QD 2CSIA 4MZTA 2DNUA 1GCQC 2J6KA 2K2MA 2XKOC 3RKXA 4GLKA 4L59A 2DAQA 2KRNA 5FLXE 3MP1A 4BDYA 3INZA 2ZPEB 4IIMA 2QQRA 1SG5A 1Q7YC 4II1A 1W2BP 4FYYB 4C0DC 5CKEA 3L2QA 2ZCFB 2LQ8A 1PG5B 2KYBA 1KD1U 4LDWA 2DEUA 4Y92A 4CC4B 4Q5WA 4PLLA 4JJNK 3QDRB 1EFNA 4B9WA 3P8DA 2E5KA 7AT1B 2IPOB 1BIAA 4ORZA 3LX7A 3EG1A 2F5KA 9ATCB 2XDBA 2CZ1B 4FW1A 3TREA 3QKJA 4PJOA 1VQ7A 4J8OA 1WDXA 1UB4A 2YLBA 2JW4A 1KD1C 1VQOQ 3JB9H 1VQ5T 2E64A 4OMOA 4M7DB 2HKNA 4X34A 3EFRA 1MMNA 1QCOA 2GQIA 2V26A 3VRYA 1AOJA 2VYTA 5CO7A 3SWNA 3CCUA 3JCMW 2YWWA 4JS4A 2X4WA 1GFDA 4A4EA 4FYXB 1M2OA 2KNBB 2XDDA 4XTVA 4DOWA 1M1KU 2K3XA 4CC2A 1V29B 4CC3A 5M9OA 2EYYA 4JUVA 1YI2Q 1YI2A 2Y4YA 3OYCA 2P4TA 4R55A 1SHFA 1OX8A 3OW2A 3BE3A 2K5IA 3MPUB 1WZOA 3G1JA 1RAIB 3CCQA 1Q82R 1RAGB 2CP2A 1ARKA 2KSSA 1YJWT 2QDLA 2YUOA 3CMEA 1N27A 3I56A 3L42A 2QI2A 3JCMc 4ZGJB 4PK4A 2SRCA 2QA4A 1JRIA 1KQ2A 3M55A 3JCMV 4ANJA 1I81A 3META 3RMQA 5FU6B 1X2KA 2RD1A 1NM7A 4ZTJA 2YLCA 4D6WA 3OBYA 2LCLA 1ZLMA 4DBFA 2ZPHB 1D0ZA 4IUUA 3VS4A 1WXUA 1OPKA 1PSFA 4Z88A 4DA4A 4KRTA 4FU6A 3CC2Q 2LCCA 5GMKh 2JOYA 4IKFA 1JB0E 3JRZA 4O6JA 2JS0A 4Z89A 2QXFA 2YUNA 3WVEB 2OTLT 4IIOA 1X75C 1AWJA 2BE7D 1VQ6Q 4M7DE 2DETA 2EGCA 5CIUA 2AKKA 3S3OA 1FMKA 3OMCA 5GMKj 1Y71A 4HCBA 2K3YA 5CKBA 3G71T 2ZPFB 3HL8A 4X1VA 2JUFA 4RKUE 2PVDB 1M8VA 1OU8A 4PKCC 2LNVA 2R58A 1FXXA 1NJIR 1S72A 3CC4A 4KUDK 4MZMA 2YXYA 1YNZA 4J9BA 1VQOT 1Q82U 2CKKA 3LGLA 4M7AB 3ZBDA 2GTOA 2L0AA 3VRZA 5GANf 2D6FA 5IHKA 3SDZA 1LNXA 2C06A 4PJJA 2DL5A 3X24B 1EIFA 2F69A 4HCKA 3CPWS 4UC4A 1TSFA 5GANj 1J3TA 3HKSA 2O2OA 4LUDA 2R5AA 4OMQA 3MEUA 4N0AC 1KQSP 3QJYA 1GFCA 2Y4XA 1Q82C 5KE2A 3H6ZA 5CR2A 1LPLA 2D1XA 1JEGA 1BI3A 3L2VA 1JXOA 5L23A 2HKQB 2I2LA 3VU3C 3NMZC 3GIBA 4C5IA 1U1SA 2XU8A 3KFVA 3M53A 1M4ZA 2CH4A 2AHJB 1N8RC 1FYNA 3UA7A 5GMKe 1OOTA 1RI0A 4DEYA 2MOXA 5EC7A 1YHQT 2HL5C 4KBMB 4KUIA 2L89A 5A2QE 3R6OA 1TU0B 3CXCA 1WQ7A 2XK0A 3EHQA 1TWBA 2BE9B 4DEXA 3G6EQ 3TU4K 1NJIU 2H8HA 1YITT 1WIEA 3GOXA 3FEOA 3CC2T 2PNIA 1BB9A 2GNCA 3O5ZA 4F16A 2QGGA 2BIVA 1VQPQ 4E7JA 4C8QB 3ME9A 4C92B 4M7AE 1MV3A 5GAN4 1VQ6T 1UTIA 3OQ5A 5FU7C 2HEQA 1AWWA 3EFSA 2BKDN 1U06A 3F70A 3I55A 1WFWA 1NJIC 1ZBJA 1QP2A 2DM1A 1XOVA 2OAUA 2LMJA 5GAN3 4V2SA 1ZSZB 1IGQA 4LDXA 1BCMA 2KYMA 3GF5A 1NYGA 3O8VA 3CCMT 2D0QB 3G4SQ 2FG0A 2GFUA 4OB0B 3CCRA 2JT4A 1IRXA 1VQLQ 4HA8A 1Y96B 1BI2A 5CKHA 2V8KA 3JCMg 4M7DA 2DVJA 4M75B 4E7KA 4J9IA 3J81E 4FYVB 1D1BA 2NYSA 4KH1B 3EFOA 3CCJA 3QDFA 1VOMA 3DB3A 4M78C 2NUPB 4XU3A 1M90R 3CC7A 2RQTA 1IB8A 3PIPA 4RTTA 4FW2A 1CKBA 3JCMd 3CCSQ 1X01A 3CCSA 3V7RA 2A36A 5I21A 2F1LA 2KAFA 2LVMA 2KY9A 5GAN8 4J9EA 2SEMA 2EWNA 3FDRA 2K9GA 4M78G 2DO3A 4C8QE 3CCLA 3JCMh 4C92E 4FIBA 4HXJA 2L3RA 4B9XA 3JCMf 2HQHA 3M58A 1I8FA 3AHUA 4M77B 3A8GB 3MO8A 1BYMA 2RPNA 3A8LB 2YT6A 1WHJA 3G6ET 4JJCA 3MP8A 4F17A 3ZFJA 2HNIA 3OS1A 2QTXA 2RI2A 1NG2A 1S1NA 1JO8A 2OTJQ 2EFIA 2J05A 2NLUA 2QEXQ 2E6NA 3HHTB 2P0KA 1UJ0A 2RQRA 1AZEA 3FJ5A 1D0XA 1QVFS 1VQPT 3I35A 1Z9ZA 2HDAA 2ZPBB 4PJLA 2CT4A 1W6XA 4FM4B 5CQYA 3RIRA 2QQSA 2YDLA 1TH7A 2HMAA 2KQWA 1JU5C 5CKFA 2WACA 3A8MB 3C0CA 3V7SA 1HXDA 2JTFA 3S3MA 3VYHB 2NUTB 2E10A 2BZYA 3NTIA 3QIIA 3MEVA 4M75E 1OU9A 1ZBXA 4HCCA 1RLQC 1M90U 2XIDA 1K76A 2QG9B 1HYOA 3T9NA 1WXBA 2FO0A 1YJ9T 1KSWA 1QVFP 1VQ5A 4JRIA 3G4ST 4QQGA 1VIEA 2QQ9A 2X51A 4HVUA 5LJ3g 1QWEA 1EZZB 4XTXA 4KH0B 4OB1B 4Z8AA 1M8MA 2DYBA 4BY6B 4PJOF 1OZ2A 2HAXA 1I0CA 2AIRB 2VGMA 3X26B 1PHTA 3H8ZA 3OYGA 3M4GA 2DL8A 2F5TX 4OP0A 1LVKA 2EQMA 1GCPA 2JM8A 1M90C 3PE0A 3M0UA 5LJ3d 2FRYA 2FVUA 3JCMe 1JQQA 4BE0A 4XAXB 3JB9J 4E7SA 4M77E 1M3AA 3M9QA 3PVQA 3M0PA 2V1RA 1B07A 3OY9A 1KIKA 1G3SA 2LTOA 2DVEA 1IXDA 2L3QA 5LJ3h 3L2ZA 4CRIA 4L5GA 1W2BS 3SWNC 1M27C 1YJWA 3X28B 3QJ6A 3FIFA 4E7LA 2CH4W 2K79A 3TSZA 3LLRA 6AT1B 1WX6A 2LT1A 2LX7A 5GAMg 2E1HA 3QO3A 4DBRA 2DD5A 3MHXA 1PC0A 1QVGS 2GTJA 1TS9A 2EGEA 1K1ZA 4MMLA 2EQKA 1ABOA 2EYXA 2P0QA 5GAN6 5FRNA 3CCVT 3OS5A 1G3YA 1F1BB 4LN2A 3OYEA 5DLQE 5GAMd 1YIJQ 4RTVA 2LJ0A 3E1SA 2E4HA 2LRQA 2JJ9A 2YUQA 2OTJT 2DL3A 3JV3A 2QEXT 5L8RE 1MHNA 1SHGA 2OTLQ 2OTLA 1Y7XA 1QVGP 4EDUA 4J9FA 1O75A 1VYTA 5FW9A 3SB2A 5GAMh 3BW1A 3QSUA 2FPDA 2X4JA 1R8OB 5KYYB 3FRNA 5GJVB 4N4IA 3G71Q 2X3WD 4X9DA 1JJ2S 4C92A 3VS3A 2E41A 2DLPA 2FPFA 2EGAA 3MP6A 5I2SA 3LGFA 5HY6A 4BE2A 1VQ4Q 2O4XB 1TTHB 2DZ9A 1QWFA 3ULRB 3VS5A 2LJ3A 1VQOA 5CQXA 3OYKA 2RK1A 2EVRA 2CSQA 1B7TA 2KXCA 1UHCA 1ZSZA 2L5QA 3Q1JA 1MV0B 3VYGA 2RQVA 1JJ2P 1WI7A 5LJ3e 5IT9E 1VIFA 3ZL7C 2Y90A 1R77A 3M5AA 1YJNT 3G7ZA 4F14A 1NEGA 4LD9K 5J3BA 5KYNA 5GMKi 4QQ6A 1OX9A 2C0OA 1MMDA 4YTLA 1I1JA 2K2VA 2RQWA 1TG0A 3C95A 1KHIA 3M0QA 3V8KA 3OS2A 1WLPB 2O01E 3P8HA 4M75A 2K5LA 4R56A 4XU0A 2ATCB 1HSQA 1SRMA 3M0TA 1UJYA 2P84A 1HJDA 2VWFA 4OMLA 3OYHA 2F2WA 4ELZC 3CXCP 4EMKB 2FYKA 2NUPA 4C5GA 3H41A 3JAME 3H0FA 2PVGB 1K4US 1KG1A 1MMGA 1YHQQ 1ABQA 1WPYA 1YHQA 3RESA 3UF4A 3JB9I 1N8RR 2AT1B 3OYIA 2L2PA 2CP7A 3E9FA 5GAMe 1IZ6A 2WSFE 2VXEA 1WJSA 1C6VX 1Z9QA 4R0KA 1SF9A 1M1GA 1VQNQ 1RAAB 1YITQ 2LT4A 1YIJT 2KXDA 4ZNXA 1K8AR 4E7HA 2JZ2A 1K0SA 4M77A 3CC2A 2H3EB 2CZ0B 2EAYA 4ATOA 1TUCA 4JRKA 1M3BA 4TVRA 2DTIA 1VQKQ 1Y0MA 1U8RA 3CBPA 1VQ9Q 4VUBA 5IH2A 2QYZA 3EGDB 1VQ6A 3D7SB 1AT1B 2YSQA 2AZSA 2O31A 2OX7A 4E7ZA 4OMFB 2DJQA 4E47A 2QQBA 4IUTA 3FC3A 1AD5A 1U1TA 2VXFA 3LH5A 3U23A 1VQ4T 1OEBA 2DA9A 3CCMQ 1KQSS 3JCMP 1WHMA 4FYWB 3EG2A 4M78B 2NUTA 3EG0A 5D7UA 2FZGB 4QVCA 2ABLA 5KH6A 5KYWB 2OAWA 4JLGA 1VQ7T 1IO6A 2VGNA 4PJNA 2DKGA 2CUBA 1A0NB 4WCIA 3VKIA 1N8RU 2DMOA 2RHYA 4J9DA 4XTZA 2DXTA 5KCOA 1ZA2B 1G2BA 2WSCE 4PL6A 2L3PA 3HFOA 1NPPA 1KQ1A 1GL5A 3GBQA 3ER0A 5LJ5g 1K8AU 1X6OA 3KUFA 3CMAQ 4BD3A 2H3JA 3URGA 4X9CA 4M7DF 2COZA 1AHJB 4AFZC 2ED0A 2A37A 2D8JA 1N6AA 1M1FA 2DIQA 4EMHA 2BTTA 3OSSC 3C12A 5CK9A 4FL6A 4F7UB 4EIKA 3E9GA 1QQJA 5HK3A 4AFUC 2LJ1A 3M54A 3FLGA 2XG8D 2OJ2A 5LJ5d 1RABB 4M7DC 3QUIA 2GCXA 3CCQT 1JBMA 2IVWA 1SSFA 3HRTA 5GMKm 4PFPA 3PFSA 2RJFA 3MEWA 4Y91A 3EH1A 5IAYA 1K8AC 5I11A 3G6EA 2CDTA 3I56T 5J26A 5GMKl 5LJ5h 1VQNT 4RCBA 3CCEQ 3NFCA 5GAOr 4PJMA 5LJ5f 4M7DG 4AFQC 2D8HA 4KULA 3M4YA 1NBEB 3UATA 2CS7A 2HCKA 2J6OA 2EKOA 4FCYA 4M78E 8ATCB 1VQKT 1VQPA 4LE9A 2KEAA 3CQTA 3E2UA 1I4K1 1VQ9T 2I0NA 4DBQA 1RACB 1H641 3C4SA 3I9QA 2DZCA 3OYBA 2FPEA 2EPDA 1ZUUA 3V8LA 2JMCA 4OMPA 2NWMA 2KVQG 1KK7A 4C0FA 3S3NA 3TCJA 5CKDA 2JTMA 1IGUA 4FSSA 5EG2A 1H8KA 1X69A 2KRSA 4PLIA 1YP5A 5HKCA 2A3LA 3HRSA 3EGXB 5KYYA 4QKUA 4D8DA 4QW2A 4RUGA 4M7DD 3ASKA 1YJ9Q 1FMVA 4K11A 1MMAA 3UT1A 2EQJA 3G4SA 1UEBA 5FU6C 2DEQA 5IHIA 1MNEA 2EQIA 3OSVA 3EG9B 4J9HA 4E2FB 4C0ZA 4F04B 4C5HA 1VQLA 5GAOq 4N4HA 4IURA 2O4XA 2ZGWA 1S72T 3CC4T 2COYA 3SWNB 1X2QA 2LX9A 2MWOA 4GY5A 4BI3A 4F7UE 4JZ3A 1UUEA 1I5LA 4FT2A 2YRDA 1SKUB 2K7AA 1ZSGA 1OV3A 2ROLA 3BY7A 3TSWA 2ENMA 3A5ZB 3NPFA 3JCMQ 2DL7A 5C6SA 4OVAA 3QYGB 5KYXB 1N5ZA 2RJCA 2K4YA 1D1CA 1Y57A 3CMAT 1W1FA 2IIMA 1YBYA 3H0IA 2FEIA 4M7AF 2K3BA 5LJ5e 5GJWB 1U5SA 1M30A 4C0DB 3OS0A 2O9SA 3OYYA 2VB6A 1AVZC 5DLOA 3C94A 4ZTFA 1WJRA 3RMSA 1W4SA 1BI0A 2M16A 3UPUA 4EMKA 3MKDA 1IREB 2K5FA 1ZA1B 1AEYA 3SD4A 2FHDA 3CCVQ 3L2RA 4XTUA 4HVWA 3HPWA 1E6GA 2JS2A 3CCET 3OB9A 3EG3A 2G3RA 2E70A 4P5NA 4XTWA 2LQWA 3QWYA 1P92A 4ZN3A 2KGTA 2OTJA 4DOVA 1WQWA 2RNAA 2QEXA 4NS5A 3CPWA 2ED1A 5CAIA 2V8IA 3OYAA
chains in the Genus database with same CATH topology
2CGHA 4OGEA 4EMKC 4IKFA 1JB0E 2FL7A 1Y7XA 3LWIA 3JRZA 2DIGA 1ZHIA 4O6JA 4XU1A 4BE1A 2OTLA 4HT9A 4EDUA 5CVIA 2QXFA 1QP3A 1O75A 3WVEB 3SB2A 2OTLT 1G3WA 3BW1A 1X75C 4A4GA 5GAMh 5GAOm 3QSUA 2DXUA 2RK2A 2X4JA 1R8OB 3X20B 4M7DE 3V7CA 4XTYA 3HFNA 3FRNA 5CIUA 3GPLA 4N4IA 3S3OA 3DLMA 4X9DA 3OMCA 1JJ2S 5GMKj 5AYFA 5GANe 5FRMA 2EQUA 1D3BB 4C92A 1Y71A 1YJ9A 4HCBA 5GAOl 2K3YA 2VC8A 2CZ6B 2E41A 5CKBA 3G71T 3OW2S 2ZPFB 4PJOB 3HL8A 1GXIE 2JUFA 4RKUE 3MP6A 4JS5A 1Q86U 1N9RA 5I2SA 2PVDB 1M8VA 3LGFA 4PKCC 5HY6A 3UWNA 4BE2A 2LNVA 2O4XB 2RHZA 2R58A 3PNWC 2DZ9A 1FXXA 1S72A 2DXBA 3CC4A 1VQOA 4KUDK 2VUBA 4OF1A 5CQXA 3OYKA 2RK1A 4MZMA 2HQEA 4J6WA 4HT8A 4C8QF 4N0AA 4C92F 2MF2A 3PTAA 3J7AF 1VQOT 1Q82U 3QG1A 2CKKA 3RERA 4ZGEB 3LGLA 5HK0A 4M7AB 2RI5A 2L5QA 2B8AA 3Q1JA 4NL2A 1UGSB 1B34A 2RHIA 4M78A 3ZBDA 4NL3A 2EJ9A 2HD0A 2JVVA 1M5Q1 3EAEA 4RG8A 2P0PA 2EYQA 3VYGA 5GANf 2D6FA 5LJ3e 3SDZA 1YJNA 3VV0A 5IT9E 3L2WA 4C92C 5KE3A 3OYJA 1VIFA 1LNXA 2Y90A 3RUXA 2RO0A 5CCAA 3M56A 3M5AA 2RA2A 3GP8A 2C06A 5KCHA 3WXMB 4QQDA 3G7ZA 4CI0C 1YJNT 3X24B 3GNGA 1EIFA 2F69A 3OYNA 3OYDA 4PJOC 3PIOA 4J5YA 4A53A 3VUBA 4LD9K 5J3BA 1Q86C 5GMKi 4QQ6A 4YTLA 3CPWS 2K2VA 4UC4A 5GANj 2XD0A 3C95A 1KHIA 4M78F 3V8KA 3M59A 3OS2A 4OB3B 3HKSA 5GAOp 2DJZA 2O01E 3P8HA 2R5AA 2RHXA 3MEUA 4M75A 4N0AC 2K5LA 2QQAA 3QJYA 5GAN2 4R56A 2Y4XA 4XU0A 3QHSA 4XU2A 3SFMA 1Q82C 3CBMA 4C92G 3JB9F 5KE2A 2RH2A 3H6ZA 5CR2A 2X35A 5LJ3f 4M7AC 1BI3A 3OYHA 3L2VA 4ELZC 4PJOG 2I2LA 3VU3C 4BB7A 2HBPA 4JRQA 4C5IA 4EMKB 3GIBA 1U1SA 2FYKA 2XU8A 2DK3A 2M1HA 3PMIA 4C5GA 3CC7T 3JAME 1K9MU 1UGRB 1M4ZA 3M53A 2PVGB 3TEEA 4M75F 4RMOA 1KQSA 1KG1A 3LH0A 4BI8B 2AHJB 4RCCA 1WPYA 1N8RC 1YHQA 3RESA 5GMKe 2EJFA 3JB9I 4LD6A 3DLLA 1RI0A 3PGGA 2M0OA 5LJ3j 2R57A 3CPFA 4XQ3A 1YHQT 4KBMB 4F7UA 3OYIA 5J39A 3CCVA 4KUIA 2L89A 3AHUA 1XTDA 1NE8A 3E9FA 3GLXA 1IZ6A 2WSFE 3QZ9B 1QVPA 3R6OA 4J6XA 5GAMe 5A2QE 3QZ5B 4M75C 5D6XA 3CXCA 2XDPA 1WQ7A 4FSXA 4M7AG 2VXEA 2XK0A 1WJSA 1Y07A 3PT9A 1XQHA 2E5QA 4IUQA 1YIJA 1M1GA 5GAOn 4PJOE 3TU4K 3JB9G 4C92D 1MGQA 1FX7A 2ZPIB 2LT4A 4MDWA 4ZGDB 1YIJT 2JNGA 4QVZA 1NJIU 4E7HA 2JZ2A 4A4KA 4F7UF 2M9UA 4M77A 4PJOD 3FB9A 5DY9A 1YITT 3CC2A 3BFMA 4JDSA 4LDYA 2QDYB 1K9MC 3QXEB 3GOXA 3WVDB 2CZ0B 2EAYA 3FEOA 4ATOA 2PQWA 3CC2T 3NTKA 4HKEA 4JRKA 4JLIA 4M75G 2DTIA 4TVRA 1U8RA 3CBPA 3VUZA 4WF2A 4VUBA 5GAMf 4J83A 2BIVA 1VQ6A 2BUDA 4E7JA 3MCAB 4C8QB 4BUGA 3ME9A 4C92B 1O9SA 4M7AE 4C5EA 5GAN4 3P8BB 1VQ6T 3G71A 4J7IA 1QW1A 3OQ5A 2RJEA 4M77F 5FU7C 4C8QA 4M78D 4DQ2A 3EFSA 3UDCA 4M7AD 2BKDN 4OMFB 1UGQB 3F70A 3I55A 4JRPA 5D6WA 2MWPA 4E47A 5GAMj 2QQBA 4IUTA 3FC3A 3I55T 2WSEE 1VQ4A 2GQVA 4OB2B 4A54A 3JB9D 1NJIC 4M77C 2A7YA 1QP2A 3OYFA 2PUKB 1OI1A 1U1TA 3L1AA 2VXFA 1XOVA 2OAUA 1VQ4T 4F7UG 2KMTA 1KHCA 3BDLA 5GAN3 4V2SA 1KQSS 3JCMP 2KDSA 2MI6A 1B34B 4M78B 4RG2A 4LDXA 3CD6A 3GF5A 2DD4A 2ZPGB 3O8VA 4M75D 3CEYA 3CCMT 3KXTA 2D0QB 3CBOA 5DM7R 2D9TA 2GFUA 4ELYC 3CD6T 4OB0B 2RHUA 3A8OB 4QVCA 5KH6A 3CCRA 3V8JA 5GAN7 3CXCS 3RKYA 4C8QC 4JLGA 1VQ7T 2VGNA 4ZN1A 3CCRT 2PU9B 2DKGA 4M77G 3S6WA 3VKIA 1N8RU 1VQLT 5I2MA 2RHYA 4HA8A 3ZEHA 4XTZA 4BDZA 1FWZA 1BI2A 1Y96B 3LYIA 5FROA 1VQ8A 5CKHA 2V8KA 2DXTA 3OBWA 5KCOA 3JCMg 1VQ8T 4M7DA 1Y96A 4M75B 2E65A 2RJDA 4E7KA 4PL6A 2DXCA 2WSCE 3J81E 3E19A 4A4HA 1QVFA 3HP9A 1YCYA 3M57A 2L8DA 3L2UA 3HFOA 3HRUA 4M7AA 1NPPA 5GAN5 1KQ1A 2HQXA 3CCJA 3ER0A 3MEAA 4C8QG 2MMPA 5LJ5g 4FT4A 1VQMA 1K8AU 1OZ3A 1X6OA 3DB3A 3KUFA 4M78C 5IN1A 3RKWA 3CCJT 4XU3A 4BD3A 2H3JA 3CC7A 3URGA 1VQMT 4X9CA 4PNOA 4M7DF 1WNLA 3PIPA 3JCMd 1AHJB 1X01A 1N6AA 3CCSA 2CZ7B 1KC8U 1M1FA 3V7RA 2DIQA 4EMHA 2YRVA 3OSSC 3C12A 4M77D 5CK9A 5I21A 4FL6A 4F7UB 3E9GA 3CCST 5HK3A 2KAFA 2LVMA 3M54A 3FLGA 2KY9A 5GAN8 1Q7YU 3DKMA 2XG8D 4XK8E 5LJ5d 4M7DC 2EWNA 4KT0E 3QUIA 5C0MA 3FDRA 2GCXA 5FU7B 4BY6C 1PSEA 4M78G 5A0DA 2CYZB 3J80E 3CCQT 1JBMA 1NPRA 2DO3A 2IVWA 1SSFA 3GNFB 3HRTA 2GF7A 5GMKm 3OYLA 3OA6A 3PFSA 2V8JA 3JCMh 4C8QE 3CCLA 4C92E 2EIFA 2RJFA 4FIBA 3MEWA 4Y91A 1Q81U 2L3RA 1BIBA 4B9XA 2YHTA 4EMGA 3JCMf 2RM4A 3LWHA 3CCLT 1VUBA 5IAYA 3N5BB 4MDXA 3HSBA 3M58A 4C8QD 1I8FA 3G6EA 1K8AC 3JSCA 4L6V5 3A8GB 3MO8A 4M77B 1WJQA 4MZTA 3LW5E 5D6YA 1M1KC 1BYMA 3I56T 5J26A 1YITA 3A8LB 5GMKl 5LJ5h 1VQNT 3G6ET 4RCBA 3MP8A 2XKOC 3NFCA 5GAOr 1NZ9A 3RKXA 5LJ5f 2X4XA 4M7DG 4GLKA 3ZFJA 4L59A 1KC8C 2HNIA 2PUOB 2DAQA 4KULA 3M4YA 3OS1A 2QTXA 2RI2A 5FLXE 3KBGA 3MP1A 4BDYA 3INZA 2CS7A 2ZPEB 1RL2A 2EKOA 1VQKA 2QQRA 1Q7YC 2EFIA 2NLUA 4II1A 4C0DC 5A0LA 1VQ9A 5CKEA 4M78E 1VQKT 3L2QA 1VQPA 2ZCFB 3QPHA 2E6NA 3HHTB 4IUVA 2LQ8A 2P0KA 2K57A 1I4K1 4EPCA 1VQ9T 4ME7A 1QVFS 1VQPT 1H641 4LDUA 4LDWA 1KD1U 3C4SA 3OYBA 2DZCA 2ZPBB 4BACA 1Q81C 3V8LA 4FM4B 5CQYA 5LL6S 2QQSA 3RIRA 1TH7A 2DPPB 5GANg 2KQWA 2KVQG 4PLLA 1N9SA 3QDRB 4Q5WA 4C0FA 2VV5A 4B9WA 4JJNK 3S3NA 5CKFA 2WACA 3TCJA 4BI4A 5CKDA 3P8DA 3A8MB 1W2BA 3V7SA 2JTMA 2KK4A 5EG2A 4C0GA 1BIAA 3JCMb 4PLIA 1HXDA 2JTFA 2A3LA 5HKCA 3HRSA 3S3MA 3VYHB 2E10A 3LX7A 3NTIA 3QIIA 3MEVA 4M75E 4QW2A 2F5KA 4M7DD 4NOYA 3ASKA 2RB6A 1ZBXA 3CCMA 4HCCA 1OYXA 1QVGA 1M90U 2XIDA 2XDBA 2CZ1B 1G3TA 2DTOA 3T9NA 1D3BA 2EQJA 3TREA 4Y28E 3QKJA 3UT1A 5GANd 1YJ9T 4PJOA 4QVDA 3G4SA 1UEBA 3OYMA 5FU6C 1VQ7A 2DEQA 4J8OA 3OSVA 4Z02A 1VQ5A 4JRIA 3G4ST 2DTHA 4C0ZA 1UB4A 2YLBA 1BKBA 1WGSA 4QQGA 4C5HA 1KD1C 5GAOq 1VIEA 2QQ9A 1VQLA 4N4HA 4IURA 3JB9H 2O4XA 4O5VA 5LJ3g 1VQ5T 2ZGWA 2E64A 4XTXA 2GFAA 1S72T 2E12A 3CC4T 4M7DB 4X34A 3PMTA 3EFRA 4J6YA 4OB1B 3SWNB 2LX9A 2MWOA 3BDUA 3QBYA 4BY6B 4GY5A 4BI3A 4F7UE 4PJOF 5GANh 1I5LA 1OZ2A 2HAXA 2VYTA 1G5VA 4FT2A 5CO7A 3SWNA 2VGMA 4MMKA 2LQKA 3X26B 1LOJA 3CCUA 1VQNA 3JCMW 3BY7A 1ZQ1A 3A5ZB 3H8ZA 3M4GA 3OYGA 2F5TX 2X4WA 3CCUT 4JS4A 4OP0A 2PVOB 2EQMA 4A4EA 3JCMQ 5C6SA 1M90C 4OVAA 5LJ3d 3QYGB 2FVUA 2XDDA 4XTVA 3JCMe 4BE0A 1K73U 4DOWA 4XAXB 2K3XA 2RJCA 3CMAA 2K4YA 4LDVA 4A4FA 1M1KU 2RI3A 1V29B 4E7IA 5M9OA 2XICA 3X25B 3JB9J 4M77E 3CMAT 3M9QA 3JCMJ 1YBYA 2FB7A 4JUVA 4OGCA 3OY9A 4M7AF 1YI2A 4N4GA 1JJ2A 2Y4YA 3OYCA 1G3SA 2P4TA 5LJ5e 4R55A 3DB4A 1H3ZA 2LTOA 4IUPA 2DVEA 3OW2A 1YI2T 4C0DB 2K5IA 3OMGA 4MZPA 5LJ3h 3OS0A 3OYYA 3L2ZA 4CRIA 4L5GA 3C94A 5DLOA 3CCQA 1W2BS 3SWNC 1YJWA 3X28B 3QJ6A 3FIFA 4E7LA 2KSSA 3LLRA 1LJOA 4ZTFA 2LDMA 2LT1A 1WJRA 1YJWT 5GAMg 2E1HA 3CMEA 3QO3A 3RMSA 1W4SA 1N27A 1BI0A 2M16A 2E6ZA 3UPUA 1XNIA 4EMKA 2DD5A 3MHXA 3I56A 1IREB 2QI2A 2R5MA 1DJ7B 2K5FA 3L42A 4J7FA 3VJPA 3JCMc 3CMET 1QVGS 2IG0A 3SD4A 3NTHA 1K73C 4ZGJB 2FHDA 4MMLA 3L2RA 4XTUA 2XI9A 2QA4A 3CCEA 1JRIA 2EQKA 3HPWA 1KQ2A 3M55A 2P0QA 2ZZDA 2EJGA 5GAN6 3JCMV 5FRNA 3CCVT 3OS5A 2QA4T 1G3YA 3OB9A 3CCET 1I81A 2G3RA 2E70A 3META 3OYEA 1HK9A 2XHCA 4P5NA 5A0GA 5DLQE 4XTWA 5GAMd 1P92A 3RMQA 1M9SA 4ZN3A 5FU6B 3A8HB 2RD1A 2OTJA 4DOVA 4ZTJA 1WQWA 2YLCA 3FJPA 4D6WA 3OBYA 3E1SA 2LC4A 2JN0A 2QEXA 2LCLA 4NS5A 3CPWA 3OYAA 2LRQA 2ZPHB 5LJ5j 1BI1A 4IUUA 1UGPB 2MAMA 3JCMX 2OTJT 4DA4A 1PSFA 4HCZA 5CAIA 3QYHB 2X4YA 4FU6A 5L8RE 2V8IA 2LCCA 5GMKh 2QEXT 2JOYA 1MHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQV A;  2RH2 A;  2RK1 A;  2P4T A;  1VIE A;  3SFM A;  3UDC A;  2RK2 A;  2VV5 A;  3T9N A;  1VIF A;  2OAU A; 
#chains in the Genus database with same CATH topology
 4OGE A;  2EYZ A;  4BE1 A;  1ZHI A;  4XU1 A;  5CVI A;  2MK5 A;  1RAF B;  1I07 A;  1G3W A;  5GAO m;  2DRM A;  4B6M A;  3V7C A;  5KYU B;  1T0J A;  2AKL A;  3VS1 A;  2DIL A;  3REB B;  3DLM A;  2VAS A;  3EGD A;  4RTZ A;  5FRM A;  1D3B B;  5GAO l;  2VC8 A;  3OW2 S;  1E7O A;  3NGP A;  1PKT A;  2HSE B;  1OUL A;  1N9R A;  3UWN A;  2F2X A;  1VYU A;  2B86 A;  1RAE B;  3RR6 A;  4AG1 C;  2DXB A;  2VUB A;  4J6W A;  4HT8 A;  4C8Q F;  2V1Q A;  4C92 F;  2MF2 A;  3PTA A;  1X43 A;  1SEM A;  2QGF B;  2HL3 A;  3CD6 Q;  3QG1 A;  3RER A;  4ZGE B;  2RI5 A;  4NL2 A;  1UGS B;  2L3S A;  4M78 A;  3TVT A;  2HD0 A;  3EAE A;  1M5Q 1;  1HD3 A;  3TQ7 P;  4M7A A;  2EYQ A;  1YJN Q;  1PM3 A;  1YJN A;  2X9H A;  3L2W A;  4C92 C;  5KYW A;  3OW2 P;  5CCA A;  2RO0 A;  2RA2 A;  3GP8 A;  2VKN A;  3WXM B;  4QQD A;  4CI0 C;  3GNG A;  2F2V A;  1VQ8 Q;  2J06 A;  3PIO A;  4J5Y A;  3AT1 B;  2J7I A;  3VUB A;  4A53 A;  4PJO C;  3H9N A;  1WHK A;  2XD0 A;  2VVK A;  4OB3 B;  5GAO p;  2DJZ A;  4KGV B;  5GAN 2;  3QHS A;  2K6D A;  3CBM A;  4C92 G;  3JB9 F;  1ZSZ C;  1VQM Q;  2RH2 A;  2X35 A;  2DER A;  5LJ3 f;  2CP6 A;  4PJO G;  4BB7 A;  3PMI A;  3CC7 T;  2RQU A;  1UGR B;  4M75 F;  5FWC A;  4RCC A;  3RBB B;  1M2V B;  3PGG A;  2M0O A;  5LJ3 j;  4F7U A;  5J39 A;  2KRO A;  1XTD A;  3GLX A;  1QVP A;  4M75 C;  5D6X A;  2HZY A;  1GRI A;  3PT9 A;  2P4R A;  4JZ4 A;  2E5Q A;  1YIJ A;  2O9V A;  2KT8 A;  2DBM A;  5GAO n;  3JB9 G;  4C92 D;  1MGQ A;  1FX7 A;  4ZGD B;  1ZUK A;  2LQN A;  1BK2 A;  2DE0 X;  4A4K A;  1M1K R;  2M9U A;  1X6B A;  4GLM A;  4PJO D;  5DY9 A;  1YWP A;  3BFM A;  4JDS A;  4LDY A;  2BZ8 A;  3QXE B;  3WVD B;  1RAH B;  3NTK A;  1TOV A;  4HKE A;  4M75 G;  4JLI A;  1KC8 R;  1JXM A;  4AFS C;  1RI9 A;  3VUZ A;  4WF2 A;  5GAM f;  4J83 A;  2BUD A;  1YCS B;  2CP3 A;  3MCA B;  3VS2 A;  4BUG A;  4C5E A;  3M0R A;  1H92 A;  2CT3 A;  3P8B B;  3G71 A;  1QW1 A;  4M77 F;  2RJE A;  4C8Q A;  1X27 A;  2EKH A;  2KBT A;  4PFZ A;  4JRP A;  4JJD A;  5D6W A;  1Q81 R;  1IHV A;  2MWP A;  5GAM j;  2WSE E;  1VQ4 A;  2GQV A;  4A54 A;  3JB9 D;  2G6F X;  4M77 C;  2A7Y A;  1QKW A;  3OYF A;  2PUK B;  1OI1 A;  4RTY A;  1UFF A;  2ECZ A;  2KDS A;  2MI6 A;  1B34 B;  3EGX A;  1PKS A;  2ROT A;  1VYV A;  3CEY A;  4M75 D;  3KXT A;  3CBO A;  2FZK B;  1VQ7 Q;  2D9T A;  3CD6 T;  2RHU A;  1C1A A;  1XJW B;  3CXC S;  1QMC A;  4DBH A;  1ACM B;  2PU9 B;  3VS7 A;  4M77 G;  3EG9 A;  3I5R A;  3S6W A;  2M0Y A;  3ZEH A;  1FWZ A;  5FRO A;  2Z0W A;  1OQK A;  3OBW A;  1KJW A;  1VQ8 T;  1I5O B;  1Y96 A;  1YWO A;  2E65 A;  2QAZ A;  2RJD A;  2FRW A;  3EFO B;  8AT1 B;  3E19 A;  3H0H A;  4A4H A;  3HP9 A;  3CCU Q;  1QVF A;  3M57 A;  2COW A;  2L8D A;  3L2U A;  3HRU A;  2C0T A;  3MEA A;  3MJX A;  1OZ3 A;  5IN1 A;  3RKW A;  2A0F B;  1GCQ A;  1PWT A;  1VQM T;  4PNO A;  1WNL A;  5KYX A;  2A08 A;  2CZ7 B;  1KC8 U;  1R0C B;  4M77 D;  3DKM A;  2CUD A;  4XK8 E;  3CCQ Q;  4KT0 E;  5C0M A;  5FU7 B;  4BY6 C;  1TUD A;  4BAC A;  1UG1 A;  3OYL A;  1UHF A;  2GF7 A;  3CME Q;  2V8J A;  4LXC A;  1Q81 U;  2YHT A;  4JJB A;  2CP5 A;  3I56 Q;  1Q95 G;  2RM4 A;  3LWH A;  1VUB A;  3N5B B;  4MDX A;  1VQN A;  3JSC A;  4L6V 5;  5D6Y A;  1WJQ A;  1M1K C;  3LW5 E;  1YIT A;  1K73 R;  2QA4 Q;  1QKX A;  1NZ9 A;  5IHN A;  2QTV A;  2X4X A;  1X6G A;  3REA B;  1KC8 C;  2PUO B;  3KBG A;  1OPL A;  2MIO A;  2DF6 A;  1RL2 A;  1VQK A;  1SRL A;  1AZG B;  5A0L A;  1VQ9 A;  2M51 A;  3QPH A;  4IUV A;  1T0H A;  2K57 A;  4J9C A;  4EPC A;  4ME7 A;  3QWX X;  4LDU A;  1PD1 A;  1CSK A;  1Q81 C;  1V76 A;  5LL6 S;  5GAN g;  2DPP B;  1G83 A;  1N9S A;  1LCK A;  2VV5 A;  4BI4 A;  1W2B A;  2KK4 A;  4A63 B;  4C0G A;  3JCM b;  2DL4 A;  1WXT A;  2EBP A;  5ECA A;  4NOY A;  5KYU A;  2RB6 A;  1B3Q A;  3CCM A;  3IQL A;  2PZ1 A;  1OYX A;  1QVG A;  4JPB W;  1G3T A;  2DTO A;  1D3B A;  4Y28 E;  5GAN d;  1CKA A;  4QVD A;  3OYM A;  2C0I A;  2LZ6 B;  4Z02 A;  2DTH A;  1E6H A;  3I5S A;  3RNJ A;  1BKB A;  1WGS A;  1S72 Q;  3CC4 Q;  1WHH A;  4O5V A;  2GFA A;  1PD0 A;  2E12 A;  3PMT A;  4J6Y A;  2JTE A;  3BDU A;  3QBY A;  5GAN h;  1G5V A;  4MMK A;  2LQK A;  4RTU A;  1UDL A;  1LOJ A;  2BZX A;  2AK5 A;  1ZX6 A;  1ZQ1 A;  2E3H A;  3VS6 A;  1EX4 A;  3CCU T;  2PVO B;  2E3I A;  2W10 A;  1SSH A;  1RUW A;  1K73 U;  3CMA A;  4LDV A;  4A4F A;  2RI3 A;  4E7I A;  2D0N A;  1Q86 R;  2XIC A;  3X25 B;  3JCM J;  2FB7 A;  4OGC A;  4N4G A;  1JJ2 A;  3DB4 A;  1D0Y A;  1GBQ A;  1H3Z A;  4GBQ A;  4IUP A;  1YI2 T;  1BCO A;  3OMG A;  5FWB A;  4MZP A;  1LJO A;  2LDM A;  2LNH B;  2E6Z A;  2W0Z A;  1XNI A;  1WA7 A;  2OI3 A;  3VJP A;  2R5M A;  1DJ7 B;  4J7F A;  3CME T;  1KFZ A;  2IG0 A;  2O88 A;  3NTH A;  1K73 C;  3CPW P;  2XI9 A;  1M2V A;  3CCE A;  1FMW A;  2ZZD A;  2EJG A;  2A28 A;  2JXB A;  2QA4 T;  1VA7 A;  1HK9 A;  2XHC A;  5A0G A;  1QCN A;  1M9S A;  3A8H B;  4OMN A;  2DYI A;  2DFU A;  3FJP A;  2LC4 A;  2JN0 A;  5LJ5 j;  4J9G A;  1BI1 A;  3JCM X;  1UGP B;  2MAM A;  4AG2 C;  4HCZ A;  3QYH B;  2X4Y A;  5I22 A;  1GBR A;  1IHW A;  2CGH A;  4EMK C;  2FL7 A;  3LWI A;  2DIG A;  4HT9 A;  5IXB A;  2CP0 A;  4AMC A;  1K9M R;  1QP3 A;  4A4G A;  2DXU A;  2RK2 A;  3X20 B;  4XTY A;  3HFN A;  3GPL A;  2X3X D;  1G8X A;  5AYF A;  5GAN e;  2AZV A;  2EQU A;  1YFN A;  1YJ9 A;  2DBK A;  4PJO B;  2CZ6 B;  3EGU A;  3I55 Q;  1GXI E;  1WHL A;  4RTW A;  4JS5 A;  1Q86 U;  2PTK A;  3NHN A;  1M3C A;  1W70 A;  4HVV A;  2RHZ A;  3PNW C;  1NEB A;  1UGV A;  5HCK A;  1TUG B;  1NYF A;  1UEC A;  4OF1 A;  2HQE A;  1QCF A;  4N0A A;  3J7A F;  1BU1 A;  2ESW A;  2KRM A;  2NUZ A;  5HK0 A;  2B8A A;  1B34 A;  2RHI A;  4NL3 A;  2J6F A;  3CCR Q;  2EJ9 A;  2JVV A;  4RG8 A;  2P0P A;  3EH2 A;  3VV0 A;  5KE3 A;  3OYJ A;  1BBZ A;  3RUX A;  3M56 A;  5KCH A;  1PRM C;  2QK0 A;  3OYN A;  3OYD A;  4E6R A;  1Q86 C;  2KI7 A;  3UA6 A;  4M78 F;  3M59 A;  2MCN A;  2RHX A;  2QQA A;  1D09 B;  3CCJ Q;  2RMO A;  4XU2 A;  3SFM A;  5AT1 B;  2FZC B;  2EW3 A;  3A1P A;  2YRC A;  1C0M A;  1WYX A;  2ZAE A;  3CC7 Q;  4CC7 A;  1NLP C;  4M7A C;  3R6N A;  4JRQ A;  2HBP A;  3SEM A;  1V1C A;  2DK3 A;  2M1H A;  1K9M U;  1QLY A;  3TEE A;  4KGZ B;  4RMO A;  1KQS A;  3LH0 A;  4BI8 B;  2EJF A;  4LD6 A;  3DLL A;  2R57 A;  3CPF A;  4XQ3 A;  3CCV A;  4AT1 B;  1NE8 A;  3QZ9 B;  2RF0 A;  4J6X A;  3QZ5 B;  2XDP A;  3CCL Q;  4FSX A;  4M7A G;  1Y07 A;  4PFO A;  4RTX A;  1XQH A;  4IUQ A;  1T3L A;  4PJO E;  2ZPI B;  4MDW A;  4QT7 A;  2JNG A;  4QVZ A;  1MND A;  4F7U F;  1D1A A;  3FB9 A;  4OMM A;  2JMA A;  1R0B G;  2QDY B;  1K9M C;  1PNJ A;  2JM9 A;  2PQW A;  2YUP A;  3EHR A;  3RDV A;  2LP5 A;  4M4Z A;  2EYW A;  2LCS A;  1Q7Y R;  2M02 A;  1O9S A;  2MPX C;  4J7I A;  4M78 D;  4DQ2 A;  3UDC A;  4M7A D;  1MUZ A;  3VS0 A;  1UGQ B;  3HTR A;  2KE9 A;  3I55 T;  4WTO B;  2HSP A;  4OB2 B;  1RLP C;  4ESR A;  3L1A A;  4F7U G;  2KMT A;  2CRE A;  3A98 A;  1KHC A;  3BDL A;  4LNP A;  4LUE A;  2MYS A;  4RG2 A;  3CD6 A;  2DD4 A;  2RN8 A;  2ZPG B;  3PVL A;  3M0S A;  5DM7 R;  4ELY C;  3A8O B;  2DRK A;  1YN8 A;  1RAD B;  3V8J A;  1VQ5 Q;  5GAN 7;  1T3S A;  3RKY A;  4C8Q C;  4ZN1 A;  3CCR T;  1K0X A;  1KD1 R;  1VQL T;  5I2M A;  1PRL C;  2HBW A;  4BDZ A;  1VQ8 A;  3LYI A;  1NLO C;  2KR3 A;  1K9A A;  1H3H A;  2GGR A;  2DXC A;  1YCY A;  4KGX B;  1TXQ A;  5GAN 5;  2HQX A;  1ZUY A;  1UE9 A;  4C8Q G;  2MMP A;  3THK A;  1AWX A;  4FT4 A;  1VQM A;  3CCJ T;  2XMF A;  1PCX A;  4D8K A;  5IXF A;  1U3O A;  2YRV A;  3CCS T;  2KT1 A;  1WHG A;  1Q7Y U;  1YJW Q;  1PSE A;  3J80 E;  5A0D A;  2CYZ B;  2DX1 A;  1NPR A;  3GNF B;  3OA6 A;  1SPK A;  2QAS A;  2EIF A;  1AWO A;  1BIB A;  3SHW A;  4EMG A;  2GBQ A;  3CCL T;  3HSB A;  4C8Q D;  2CSI A;  4MZT A;  2DNU A;  1GCQ C;  2J6K A;  2K2M A;  2XKO C;  3RKX A;  4GLK A;  4L59 A;  2DAQ A;  2KRN A;  5FLX E;  3MP1 A;  4BDY A;  3INZ A;  2ZPE B;  4IIM A;  2QQR A;  1SG5 A;  1Q7Y C;  4II1 A;  1W2B P;  4FYY B;  4C0D C;  5CKE A;  3L2Q A;  2ZCF B;  2LQ8 A;  1PG5 B;  2KYB A;  1KD1 U;  4LDW A;  2DEU A;  4Y92 A;  4CC4 B;  4Q5W A;  4PLL A;  4JJN K;  3QDR B;  1EFN A;  4B9W A;  3P8D A;  2E5K A;  7AT1 B;  2IPO B;  1BIA A;  4ORZ A;  3LX7 A;  3EG1 A;  2F5K A;  9ATC B;  2XDB A;  2CZ1 B;  4FW1 A;  3TRE A;  3QKJ A;  4PJO A;  1VQ7 A;  4J8O A;  1WDX A;  1UB4 A;  2YLB A;  2JW4 A;  1KD1 C;  1VQO Q;  3JB9 H;  1VQ5 T;  2E64 A;  4OMO A;  4M7D B;  2HKN A;  4X34 A;  3EFR A;  1MMN A;  1QCO A;  2GQI A;  2V26 A;  3VRY A;  1AOJ A;  2VYT A;  5CO7 A;  3SWN A;  3CCU A;  3JCM W;  2YWW A;  4JS4 A;  2X4W A;  1GFD A;  4A4E A;  4FYX B;  1M2O A;  2KNB B;  2XDD A;  4XTV A;  4DOW A;  1M1K U;  2K3X A;  4CC2 A;  1V29 B;  4CC3 A;  5M9O A;  2EYY A;  4JUV A;  1YI2 Q;  1YI2 A;  2Y4Y A;  3OYC A;  2P4T A;  4R55 A;  1SHF A;  1OX8 A;  3OW2 A;  3BE3 A;  2K5I A;  3MPU B;  1WZO A;  3G1J A;  1RAI B;  3CCQ A;  1Q82 R;  1RAG B;  2CP2 A;  1ARK A;  2KSS A;  1YJW T;  2QDL A;  2YUO A;  3CME A;  1N27 A;  3I56 A;  3L42 A;  2QI2 A;  3JCM c;  4ZGJ B;  4PK4 A;  2SRC A;  2QA4 A;  1JRI A;  1KQ2 A;  3M55 A;  3JCM V;  4ANJ A;  1I81 A;  3MET A;  3RMQ A;  5FU6 B;  1X2K A;  2RD1 A;  1NM7 A;  4ZTJ A;  2YLC A;  4D6W A;  3OBY A;  2LCL A;  1ZLM A;  4DBF A;  2ZPH B;  1D0Z A;  4IUU A;  3VS4 A;  1WXU A;  1OPK A;  1PSF A;  4Z88 A;  4DA4 A;  4KRT A;  4FU6 A;  3CC2 Q;  2LCC A;  5GMK h;  2JOY A;  4IKF A;  1JB0 E;  3JRZ A;  4O6J A;  2JS0 A;  4Z89 A;  2QXF A;  2YUN A;  3WVE B;  2OTL T;  4IIO A;  1X75 C;  1AWJ A;  2BE7 D;  1VQ6 Q;  4M7D E;  2DET A;  2EGC A;  5CIU A;  2AKK A;  3S3O A;  1FMK A;  3OMC A;  5GMK j;  1Y71 A;  4HCB A;  2K3Y A;  5CKB A;  3G71 T;  2ZPF B;  3HL8 A;  4X1V A;  2JUF A;  4RKU E;  2PVD B;  1M8V A;  1OU8 A;  4PKC C;  2LNV A;  2R58 A;  1FXX A;  1NJI R;  1S72 A;  3CC4 A;  4KUD K;  4MZM A;  2YXY A;  1YNZ A;  4J9B A;  1VQO T;  1Q82 U;  2CKK A;  3LGL A;  4M7A B;  3ZBD A;  2GTO A;  2L0A A;  3VRZ A;  5GAN f;  2D6F A;  5IHK A;  3SDZ A;  1LNX A;  2C06 A;  4PJJ A;  2DL5 A;  3X24 B;  1EIF A;  2F69 A;  4HCK A;  3CPW S;  4UC4 A;  1TSF A;  5GAN j;  1J3T A;  3HKS A;  2O2O A;  4LUD A;  2R5A A;  4OMQ A;  3MEU A;  4N0A C;  1KQS P;  3QJY A;  1GFC A;  2Y4X A;  1Q82 C;  5KE2 A;  3H6Z A;  5CR2 A;  1LPL A;  2D1X A;  1JEG A;  1BI3 A;  3L2V A;  1JXO A;  5L23 A;  2HKQ B;  2I2L A;  3VU3 C;  3NMZ C;  3GIB A;  4C5I A;  1U1S A;  2XU8 A;  3KFV A;  3M53 A;  1M4Z A;  2CH4 A;  2AHJ B;  1N8R C;  1FYN A;  3UA7 A;  5GMK e;  1OOT A;  1RI0 A;  4DEY A;  2MOX A;  5EC7 A;  1YHQ T;  2HL5 C;  4KBM B;  4KUI A;  2L89 A;  5A2Q E;  3R6O A;  1TU0 B;  3CXC A;  1WQ7 A;  2XK0 A;  3EHQ A;  1TWB A;  2BE9 B;  4DEX A;  3G6E Q;  3TU4 K;  1NJI U;  2H8H A;  1YIT T;  1WIE A;  3GOX A;  3FEO A;  3CC2 T;  2PNI A;  1BB9 A;  2GNC A;  3O5Z A;  4F16 A;  2QGG A;  2BIV A;  1VQP Q;  4E7J A;  4C8Q B;  3ME9 A;  4C92 B;  4M7A E;  1MV3 A;  5GAN 4;  1VQ6 T;  1UTI A;  3OQ5 A;  5FU7 C;  2HEQ A;  1AWW A;  3EFS A;  2BKD N;  1U06 A;  3F70 A;  3I55 A;  1WFW A;  1NJI C;  1ZBJ A;  1QP2 A;  2DM1 A;  1XOV A;  2OAU A;  2LMJ A;  5GAN 3;  4V2S A;  1ZSZ B;  1IGQ A;  4LDX A;  1BCM A;  2KYM A;  3GF5 A;  1NYG A;  3O8V A;  3CCM T;  2D0Q B;  3G4S Q;  2FG0 A;  2GFU A;  4OB0 B;  3CCR A;  2JT4 A;  1IRX A;  1VQL Q;  4HA8 A;  1Y96 B;  1BI2 A;  5CKH A;  2V8K A;  3JCM g;  4M7D A;  2DVJ A;  4M75 B;  4E7K A;  4J9I A;  3J81 E;  4FYV B;  1D1B A;  2NYS A;  4KH1 B;  3EFO A;  3CCJ A;  3QDF A;  1VOM A;  3DB3 A;  4M78 C;  2NUP B;  4XU3 A;  1M90 R;  3CC7 A;  2RQT A;  1IB8 A;  3PIP A;  4RTT A;  4FW2 A;  1CKB A;  3JCM d;  3CCS Q;  1X01 A;  3CCS A;  3V7R A;  2A36 A;  5I21 A;  2F1L A;  2KAF A;  2LVM A;  2KY9 A;  5GAN 8;  4J9E A;  2SEM A;  2EWN A;  3FDR A;  2K9G A;  4M78 G;  2DO3 A;  4C8Q E;  3CCL A;  3JCM h;  4C92 E;  4FIB A;  4HXJ A;  2L3R A;  4B9X A;  3JCM f;  2HQH A;  3M58 A;  1I8F A;  3AHU A;  4M77 B;  3A8G B;  3MO8 A;  1BYM A;  2RPN A;  3A8L B;  2YT6 A;  1WHJ A;  3G6E T;  4JJC A;  3MP8 A;  4F17 A;  3ZFJ A;  2HNI A;  3OS1 A;  2QTX A;  2RI2 A;  1NG2 A;  1S1N A;  1JO8 A;  2OTJ Q;  2EFI A;  2J05 A;  2NLU A;  2QEX Q;  2E6N A;  3HHT B;  2P0K A;  1UJ0 A;  2RQR A;  1AZE A;  3FJ5 A;  1D0X A;  1QVF S;  1VQP T;  3I35 A;  1Z9Z A;  2HDA A;  2ZPB B;  4PJL A;  2CT4 A;  1W6X A;  4FM4 B;  5CQY A;  3RIR A;  2QQS A;  2YDL A;  1TH7 A;  2HMA A;  2KQW A;  1JU5 C;  5CKF A;  2WAC A;  3A8M B;  3C0C A;  3V7S A;  1HXD A;  2JTF A;  3S3M A;  3VYH B;  2NUT B;  2E10 A;  2BZY A;  3NTI A;  3QII A;  3MEV A;  4M75 E;  1OU9 A;  1ZBX A;  4HCC A;  1RLQ C;  1M90 U;  2XID A;  1K76 A;  2QG9 B;  1HYO A;  3T9N A;  1WXB A;  2FO0 A;  1YJ9 T;  1KSW A;  1QVF P;  1VQ5 A;  4JRI A;  3G4S T;  4QQG A;  1VIE A;  2QQ9 A;  2X51 A;  4HVU A;  5LJ3 g;  1QWE A;  1EZZ B;  4XTX A;  4KH0 B;  4OB1 B;  4Z8A A;  1M8M A;  2DYB A;  4BY6 B;  4PJO F;  1OZ2 A;  2HAX A;  1I0C A;  2AIR B;  2VGM A;  3X26 B;  1PHT A;  3H8Z A;  3OYG A;  3M4G A;  2DL8 A;  2F5T X;  4OP0 A;  1LVK A;  2EQM A;  1GCP A;  2JM8 A;  1M90 C;  3PE0 A;  3M0U A;  5LJ3 d;  2FRY A;  2FVU A;  3JCM e;  1JQQ A;  4BE0 A;  4XAX B;  3JB9 J;  4E7S A;  4M77 E;  1M3A A;  3M9Q A;  3PVQ A;  3M0P A;  2V1R A;  1B07 A;  3OY9 A;  1KIK A;  1G3S A;  2LTO A;  2DVE A;  1IXD A;  2L3Q A;  5LJ3 h;  3L2Z A;  4CRI A;  4L5G A;  1W2B S;  3SWN C;  1M27 C;  1YJW A;  3X28 B;  3QJ6 A;  3FIF A;  4E7L A;  2CH4 W;  2K79 A;  3TSZ A;  3LLR A;  6AT1 B;  1WX6 A;  2LT1 A;  2LX7 A;  5GAM g;  2E1H A;  3QO3 A;  4DBR A;  2DD5 A;  3MHX A;  1PC0 A;  1QVG S;  2GTJ A;  1TS9 A;  2EGE A;  1K1Z A;  4MML A;  2EQK A;  1ABO A;  2EYX A;  2P0Q A;  5GAN 6;  5FRN A;  3CCV T;  3OS5 A;  1G3Y A;  1F1B B;  4LN2 A;  3OYE A;  5DLQ E;  5GAM d;  1YIJ Q;  4RTV A;  2LJ0 A;  3E1S A;  2E4H A;  2LRQ A;  2JJ9 A;  2YUQ A;  2OTJ T;  2DL3 A;  3JV3 A;  2QEX T;  5L8R E;  1MHN A;  1SHG A;  2OTL Q;  2OTL A;  1Y7X A;  1QVG P;  4EDU A;  4J9F A;  1O75 A;  1VYT A;  5FW9 A;  3SB2 A;  5GAM h;  3BW1 A;  3QSU A;  2FPD A;  2X4J A;  1R8O B;  5KYY B;  3FRN A;  5GJV B;  4N4I A;  3G71 Q;  2X3W D;  4X9D A;  1JJ2 S;  4C92 A;  3VS3 A;  2E41 A;  2DLP A;  2FPF A;  2EGA A;  3MP6 A;  5I2S A;  3LGF A;  5HY6 A;  4BE2 A;  1VQ4 Q;  2O4X B;  1TTH B;  2DZ9 A;  1QWF A;  3ULR B;  3VS5 A;  2LJ3 A;  1VQO A;  5CQX A;  3OYK A;  2RK1 A;  2EVR A;  2CSQ A;  1B7T A;  2KXC A;  1UHC A;  1ZSZ A;  2L5Q A;  3Q1J A;  1MV0 B;  3VYG A;  2RQV A;  1JJ2 P;  1WI7 A;  5LJ3 e;  5IT9 E;  1VIF A;  3ZL7 C;  2Y90 A;  1R77 A;  3M5A A;  1YJN T;  3G7Z A;  4F14 A;  1NEG A;  4LD9 K;  5J3B A;  5KYN A;  5GMK i;  4QQ6 A;  1OX9 A;  2C0O A;  1MMD A;  4YTL A;  1I1J A;  2K2V A;  2RQW A;  1TG0 A;  3C95 A;  1KHI A;  3M0Q A;  3V8K A;  3OS2 A;  1WLP B;  2O01 E;  3P8H A;  4M75 A;  2K5L A;  4R56 A;  4XU0 A;  2ATC B;  1HSQ A;  1SRM A;  3M0T A;  1UJY A;  2P84 A;  1HJD A;  2VWF A;  4OML A;  3OYH A;  2F2W A;  4ELZ C;  3CXC P;  4EMK B;  2FYK A;  2NUP A;  4C5G A;  3H41 A;  3JAM E;  3H0F A;  2PVG B;  1K4U S;  1KG1 A;  1MMG A;  1YHQ Q;  1ABQ A;  1WPY A;  1YHQ A;  3RES A;  3UF4 A;  3JB9 I;  1N8R R;  2AT1 B;  3OYI A;  2L2P A;  2CP7 A;  3E9F A;  5GAM e;  1IZ6 A;  2WSF E;  2VXE A;  1WJS A;  1C6V X;  1Z9Q A;  4R0K A;  1SF9 A;  1M1G A;  1VQN Q;  1RAA B;  1YIT Q;  2LT4 A;  1YIJ T;  2KXD A;  4ZNX A;  1K8A R;  4E7H A;  2JZ2 A;  1K0S A;  4M77 A;  3CC2 A;  2H3E B;  2CZ0 B;  2EAY A;  4ATO A;  1TUC A;  4JRK A;  1M3B A;  4TVR A;  2DTI A;  1VQK Q;  1Y0M A;  1U8R A;  3CBP A;  1VQ9 Q;  4VUB A;  5IH2 A;  2QYZ A;  3EGD B;  1VQ6 A;  3D7S B;  1AT1 B;  2YSQ A;  2AZS A;  2O31 A;  2OX7 A;  4E7Z A;  4OMF B;  2DJQ A;  4E47 A;  2QQB A;  4IUT A;  3FC3 A;  1AD5 A;  1U1T A;  2VXF A;  3LH5 A;  3U23 A;  1VQ4 T;  1OEB A;  2DA9 A;  3CCM Q;  1KQS S;  3JCM P;  1WHM A;  4FYW B;  3EG2 A;  4M78 B;  2NUT A;  3EG0 A;  5D7U A;  2FZG B;  4QVC A;  2ABL A;  5KH6 A;  5KYW B;  2OAW A;  4JLG A;  1VQ7 T;  1IO6 A;  2VGN A;  4PJN A;  2DKG A;  2CUB A;  1A0N B;  4WCI A;  3VKI A;  1N8R U;  2DMO A;  2RHY A;  4J9D A;  4XTZ A;  2DXT A;  5KCO A;  1ZA2 B;  1G2B A;  2WSC E;  4PL6 A;  2L3P A;  3HFO A;  1NPP A;  1KQ1 A;  1GL5 A;  3GBQ A;  3ER0 A;  5LJ5 g;  1K8A U;  1X6O A;  3KUF A;  3CMA Q;  4BD3 A;  2H3J A;  3URG A;  4X9C A;  4M7D F;  2COZ A;  1AHJ B;  4AFZ C;  2ED0 A;  2A37 A;  2D8J A;  1N6A A;  1M1F A;  2DIQ A;  4EMH A;  2BTT A;  3OSS C;  3C12 A;  5CK9 A;  4FL6 A;  4F7U B;  4EIK A;  3E9G A;  1QQJ A;  5HK3 A;  4AFU C;  2LJ1 A;  3M54 A;  3FLG A;  2XG8 D;  2OJ2 A;  5LJ5 d;  1RAB B;  4M7D C;  3QUI A;  2GCX A;  3CCQ T;  1JBM A;  2IVW A;  1SSF A;  3HRT A;  5GMK m;  4PFP A;  3PFS A;  2RJF A;  3MEW A;  4Y91 A;  3EH1 A;  5IAY A;  1K8A C;  5I11 A;  3G6E A;  2CDT A;  3I56 T;  5J26 A;  5GMK l;  5LJ5 h;  1VQN T;  4RCB A;  3CCE Q;  3NFC A;  5GAO r;  4PJM A;  5LJ5 f;  4M7D G;  4AFQ C;  2D8H A;  4KUL A;  3M4Y A;  1NBE B;  3UAT A;  2CS7 A;  2HCK A;  2J6O A;  2EKO A;  4FCY A;  4M78 E;  8ATC B;  1VQK T;  1VQP A;  4LE9 A;  2KEA A;  3CQT A;  3E2U A;  1I4K 1;  1VQ9 T;  2I0N A;  4DBQ A;  1RAC B;  1H64 1;  3C4S A;  3I9Q A;  2DZC A;  3OYB A;  2FPE A;  2EPD A;  1ZUU A;  3V8L A;  2JMC A;  4OMP A;  2NWM A;  2KVQ G;  1KK7 A;  4C0F A;  3S3N A;  3TCJ A;  5CKD A;  2JTM A;  1IGU A;  4FSS A;  5EG2 A;  1H8K A;  1X69 A;  2KRS A;  4PLI A;  1YP5 A;  5HKC A;  2A3L A;  3HRS A;  3EGX B;  5KYY A;  4QKU A;  4D8D A;  4QW2 A;  4RUG A;  4M7D D;  3ASK A;  1YJ9 Q;  1FMV A;  4K11 A;  1MMA A;  3UT1 A;  2EQJ A;  3G4S A;  1UEB A;  5FU6 C;  2DEQ A;  5IHI A;  1MNE A;  2EQI A;  3OSV A;  3EG9 B;  4J9H A;  4E2F B;  4C0Z A;  4F04 B;  4C5H A;  1VQL A;  5GAO q;  4N4H A;  4IUR A;  2O4X A;  2ZGW A;  1S72 T;  3CC4 T;  2COY A;  3SWN B;  1X2Q A;  2LX9 A;  2MWO A;  4GY5 A;  4BI3 A;  4F7U E;  4JZ3 A;  1UUE A;  1I5L A;  4FT2 A;  2YRD A;  1SKU B;  2K7A A;  1ZSG A;  1OV3 A;  2ROL A;  3BY7 A;  3TSW A;  2ENM A;  3A5Z B;  3NPF A;  3JCM Q;  2DL7 A;  5C6S A;  4OVA A;  3QYG B;  5KYX B;  1N5Z A;  2RJC A;  2K4Y A;  1D1C A;  1Y57 A;  3CMA T;  1W1F A;  2IIM A;  1YBY A;  3H0I A;  2FEI A;  4M7A F;  2K3B A;  5LJ5 e;  5GJW B;  1U5S A;  1M30 A;  4C0D B;  3OS0 A;  2O9S A;  3OYY A;  2VB6 A;  1AVZ C;  5DLO A;  3C94 A;  4ZTF A;  1WJR A;  3RMS A;  1W4S A;  1BI0 A;  2M16 A;  3UPU A;  4EMK A;  3MKD A;  1IRE B;  2K5F A;  1ZA1 B;  1AEY A;  3SD4 A;  2FHD A;  3CCV Q;  3L2R A;  4XTU A;  4HVW A;  3HPW A;  1E6G A;  2JS2 A;  3CCE T;  3OB9 A;  3EG3 A;  2G3R A;  2E70 A;  4P5N A;  4XTW A;  2LQW A;  3QWY A;  1P92 A;  4ZN3 A;  2KGT A;  2OTJ A;  4DOV A;  1WQW A;  2RNA A;  2QEX A;  4NS5 A;  3CPW A;  2ED1 A;  5CAI A;  2V8I A;  3OYA A; 
#chains in the Genus database with same CATH homology
 2CGH A;  4OGE A;  4EMK C;  4IKF A;  1JB0 E;  2FL7 A;  1Y7X A;  3LWI A;  3JRZ A;  2DIG A;  1ZHI A;  4O6J A;  4XU1 A;  4BE1 A;  2OTL A;  4HT9 A;  4EDU A;  5CVI A;  2QXF A;  1QP3 A;  1O75 A;  3WVE B;  3SB2 A;  2OTL T;  1G3W A;  3BW1 A;  1X75 C;  4A4G A;  5GAM h;  5GAO m;  3QSU A;  2DXU A;  2RK2 A;  2X4J A;  1R8O B;  3X20 B;  4M7D E;  3V7C A;  4XTY A;  3HFN A;  3FRN A;  5CIU A;  3GPL A;  4N4I A;  3S3O A;  3DLM A;  4X9D A;  3OMC A;  1JJ2 S;  5GMK j;  5AYF A;  5GAN e;  5FRM A;  2EQU A;  1D3B B;  4C92 A;  1Y71 A;  1YJ9 A;  4HCB A;  5GAO l;  2K3Y A;  2VC8 A;  2CZ6 B;  2E41 A;  5CKB A;  3G71 T;  3OW2 S;  2ZPF B;  4PJO B;  3HL8 A;  1GXI E;  2JUF A;  4RKU E;  3MP6 A;  4JS5 A;  1Q86 U;  1N9R A;  5I2S A;  2PVD B;  1M8V A;  3LGF A;  4PKC C;  5HY6 A;  3UWN A;  4BE2 A;  2LNV A;  2O4X B;  2RHZ A;  2R58 A;  3PNW C;  2DZ9 A;  1FXX A;  1S72 A;  2DXB A;  3CC4 A;  1VQO A;  4KUD K;  2VUB A;  4OF1 A;  5CQX A;  3OYK A;  2RK1 A;  4MZM A;  2HQE A;  4J6W A;  4HT8 A;  4C8Q F;  4N0A A;  4C92 F;  2MF2 A;  3PTA A;  3J7A F;  1VQO T;  1Q82 U;  3QG1 A;  2CKK A;  3RER A;  4ZGE B;  3LGL A;  5HK0 A;  4M7A B;  2RI5 A;  2L5Q A;  2B8A A;  3Q1J A;  4NL2 A;  1UGS B;  1B34 A;  2RHI A;  4M78 A;  3ZBD A;  4NL3 A;  2EJ9 A;  2HD0 A;  2JVV A;  1M5Q 1;  3EAE A;  4RG8 A;  2P0P A;  2EYQ A;  3VYG A;  5GAN f;  2D6F A;  5LJ3 e;  3SDZ A;  1YJN A;  3VV0 A;  5IT9 E;  3L2W A;  4C92 C;  5KE3 A;  3OYJ A;  1VIF A;  1LNX A;  2Y90 A;  3RUX A;  2RO0 A;  5CCA A;  3M56 A;  3M5A A;  2RA2 A;  3GP8 A;  2C06 A;  5KCH A;  3WXM B;  4QQD A;  3G7Z A;  4CI0 C;  1YJN T;  3X24 B;  3GNG A;  1EIF A;  2F69 A;  3OYN A;  3OYD A;  4PJO C;  3PIO A;  4J5Y A;  4A53 A;  3VUB A;  4LD9 K;  5J3B A;  1Q86 C;  5GMK i;  4QQ6 A;  4YTL A;  3CPW S;  2K2V A;  4UC4 A;  5GAN j;  2XD0 A;  3C95 A;  1KHI A;  4M78 F;  3V8K A;  3M59 A;  3OS2 A;  4OB3 B;  3HKS A;  5GAO p;  2DJZ A;  2O01 E;  3P8H A;  2R5A A;  2RHX A;  3MEU A;  4M75 A;  4N0A C;  2K5L A;  2QQA A;  3QJY A;  5GAN 2;  4R56 A;  2Y4X A;  4XU0 A;  3QHS A;  4XU2 A;  3SFM A;  1Q82 C;  3CBM A;  4C92 G;  3JB9 F;  5KE2 A;  2RH2 A;  3H6Z A;  5CR2 A;  2X35 A;  5LJ3 f;  4M7A C;  1BI3 A;  3OYH A;  3L2V A;  4ELZ C;  4PJO G;  2I2L A;  3VU3 C;  4BB7 A;  2HBP A;  4JRQ A;  4C5I A;  4EMK B;  3GIB A;  1U1S A;  2FYK A;  2XU8 A;  2DK3 A;  2M1H A;  3PMI A;  4C5G A;  3CC7 T;  3JAM E;  1K9M U;  1UGR B;  1M4Z A;  3M53 A;  2PVG B;  3TEE A;  4M75 F;  4RMO A;  1KQS A;  1KG1 A;  3LH0 A;  4BI8 B;  2AHJ B;  4RCC A;  1WPY A;  1N8R C;  1YHQ A;  3RES A;  5GMK e;  2EJF A;  3JB9 I;  4LD6 A;  3DLL A;  1RI0 A;  3PGG A;  2M0O A;  5LJ3 j;  2R57 A;  3CPF A;  4XQ3 A;  1YHQ T;  4KBM B;  4F7U A;  3OYI A;  5J39 A;  3CCV A;  4KUI A;  2L89 A;  3AHU A;  1XTD A;  1NE8 A;  3E9F A;  3GLX A;  1IZ6 A;  2WSF E;  3QZ9 B;  1QVP A;  3R6O A;  4J6X A;  5GAM e;  5A2Q E;  3QZ5 B;  4M75 C;  5D6X A;  3CXC A;  2XDP A;  1WQ7 A;  4FSX A;  4M7A G;  2VXE A;  2XK0 A;  1WJS A;  1Y07 A;  3PT9 A;  1XQH A;  2E5Q A;  4IUQ A;  1YIJ A;  1M1G A;  5GAO n;  4PJO E;  3TU4 K;  3JB9 G;  4C92 D;  1MGQ A;  1FX7 A;  2ZPI B;  2LT4 A;  4MDW A;  4ZGD B;  1YIJ T;  2JNG A;  4QVZ A;  1NJI U;  4E7H A;  2JZ2 A;  4A4K A;  4F7U F;  2M9U A;  4M77 A;  4PJO D;  3FB9 A;  5DY9 A;  1YIT T;  3CC2 A;  3BFM A;  4JDS A;  4LDY A;  2QDY B;  1K9M C;  3QXE B;  3GOX A;  3WVD B;  2CZ0 B;  2EAY A;  3FEO A;  4ATO A;  2PQW A;  3CC2 T;  3NTK A;  4HKE A;  4JRK A;  4JLI A;  4M75 G;  2DTI A;  4TVR A;  1U8R A;  3CBP A;  3VUZ A;  4WF2 A;  4VUB A;  5GAM f;  4J83 A;  2BIV A;  1VQ6 A;  2BUD A;  4E7J A;  3MCA B;  4C8Q B;  4BUG A;  3ME9 A;  4C92 B;  1O9S A;  4M7A E;  4C5E A;  5GAN 4;  3P8B B;  1VQ6 T;  3G71 A;  4J7I A;  1QW1 A;  3OQ5 A;  2RJE A;  4M77 F;  5FU7 C;  4C8Q A;  4M78 D;  4DQ2 A;  3EFS A;  3UDC A;  4M7A D;  2BKD N;  4OMF B;  1UGQ B;  3F70 A;  3I55 A;  4JRP A;  5D6W A;  2MWP A;  4E47 A;  5GAM j;  2QQB A;  4IUT A;  3FC3 A;  3I55 T;  2WSE E;  1VQ4 A;  2GQV A;  4OB2 B;  4A54 A;  3JB9 D;  1NJI C;  4M77 C;  2A7Y A;  1QP2 A;  3OYF A;  2PUK B;  1OI1 A;  1U1T A;  3L1A A;  2VXF A;  1XOV A;  2OAU A;  1VQ4 T;  4F7U G;  2KMT A;  1KHC A;  3BDL A;  5GAN 3;  4V2S A;  1KQS S;  3JCM P;  2KDS A;  2MI6 A;  1B34 B;  4M78 B;  4RG2 A;  4LDX A;  3CD6 A;  3GF5 A;  2DD4 A;  2ZPG B;  3O8V A;  4M75 D;  3CEY A;  3CCM T;  3KXT A;  2D0Q B;  3CBO A;  5DM7 R;  2D9T A;  2GFU A;  4ELY C;  3CD6 T;  4OB0 B;  2RHU A;  3A8O B;  4QVC A;  5KH6 A;  3CCR A;  3V8J A;  5GAN 7;  3CXC S;  3RKY A;  4C8Q C;  4JLG A;  1VQ7 T;  2VGN A;  4ZN1 A;  3CCR T;  2PU9 B;  2DKG A;  4M77 G;  3S6W A;  3VKI A;  1N8R U;  1VQL T;  5I2M A;  2RHY A;  4HA8 A;  3ZEH A;  4XTZ A;  4BDZ A;  1FWZ A;  1BI2 A;  1Y96 B;  3LYI A;  5FRO A;  1VQ8 A;  5CKH A;  2V8K A;  2DXT A;  3OBW A;  5KCO A;  3JCM g;  1VQ8 T;  4M7D A;  1Y96 A;  4M75 B;  2E65 A;  2RJD A;  4E7K A;  4PL6 A;  2DXC A;  2WSC E;  3J81 E;  3E19 A;  4A4H A;  1QVF A;  3HP9 A;  1YCY A;  3M57 A;  2L8D A;  3L2U A;  3HFO A;  3HRU A;  4M7A A;  1NPP A;  5GAN 5;  1KQ1 A;  2HQX A;  3CCJ A;  3ER0 A;  3MEA A;  4C8Q G;  2MMP A;  5LJ5 g;  4FT4 A;  1VQM A;  1K8A U;  1OZ3 A;  1X6O A;  3DB3 A;  3KUF A;  4M78 C;  5IN1 A;  3RKW A;  3CCJ T;  4XU3 A;  4BD3 A;  2H3J A;  3CC7 A;  3URG A;  1VQM T;  4X9C A;  4PNO A;  4M7D F;  1WNL A;  3PIP A;  3JCM d;  1AHJ B;  1X01 A;  1N6A A;  3CCS A;  2CZ7 B;  1KC8 U;  1M1F A;  3V7R A;  2DIQ A;  4EMH A;  2YRV A;  3OSS C;  3C12 A;  4M77 D;  5CK9 A;  5I21 A;  4FL6 A;  4F7U B;  3E9G A;  3CCS T;  5HK3 A;  2KAF A;  2LVM A;  3M54 A;  3FLG A;  2KY9 A;  5GAN 8;  1Q7Y U;  3DKM A;  2XG8 D;  4XK8 E;  5LJ5 d;  4M7D C;  2EWN A;  4KT0 E;  3QUI A;  5C0M A;  3FDR A;  2GCX A;  5FU7 B;  4BY6 C;  1PSE A;  4M78 G;  5A0D A;  2CYZ B;  3J80 E;  3CCQ T;  1JBM A;  1NPR A;  2DO3 A;  2IVW A;  1SSF A;  3GNF B;  3HRT A;  2GF7 A;  5GMK m;  3OYL A;  3OA6 A;  3PFS A;  2V8J A;  3JCM h;  4C8Q E;  3CCL A;  4C92 E;  2EIF A;  2RJF A;  4FIB A;  3MEW A;  4Y91 A;  1Q81 U;  2L3R A;  1BIB A;  4B9X A;  2YHT A;  4EMG A;  3JCM f;  2RM4 A;  3LWH A;  3CCL T;  1VUB A;  5IAY A;  3N5B B;  4MDX A;  3HSB A;  3M58 A;  4C8Q D;  1I8F A;  3G6E A;  1K8A C;  3JSC A;  4L6V 5;  3A8G B;  3MO8 A;  4M77 B;  1WJQ A;  4MZT A;  3LW5 E;  5D6Y A;  1M1K C;  1BYM A;  3I56 T;  5J26 A;  1YIT A;  3A8L B;  5GMK l;  5LJ5 h;  1VQN T;  3G6E T;  4RCB A;  3MP8 A;  2XKO C;  3NFC A;  5GAO r;  1NZ9 A;  3RKX A;  5LJ5 f;  2X4X A;  4M7D G;  4GLK A;  3ZFJ A;  4L59 A;  1KC8 C;  2HNI A;  2PUO B;  2DAQ A;  4KUL A;  3M4Y A;  3OS1 A;  2QTX A;  2RI2 A;  5FLX E;  3KBG A;  3MP1 A;  4BDY A;  3INZ A;  2CS7 A;  2ZPE B;  1RL2 A;  2EKO A;  1VQK A;  2QQR A;  1Q7Y C;  2EFI A;  2NLU A;  4II1 A;  4C0D C;  5A0L A;  1VQ9 A;  5CKE A;  4M78 E;  1VQK T;  3L2Q A;  1VQP A;  2ZCF B;  3QPH A;  2E6N A;  3HHT B;  4IUV A;  2LQ8 A;  2P0K A;  2K57 A;  1I4K 1;  4EPC A;  1VQ9 T;  4ME7 A;  1QVF S;  1VQP T;  1H64 1;  4LDU A;  4LDW A;  1KD1 U;  3C4S A;  3OYB A;  2DZC A;  2ZPB B;  4BAC A;  1Q81 C;  3V8L A;  4FM4 B;  5CQY A;  5LL6 S;  2QQS A;  3RIR A;  1TH7 A;  2DPP B;  5GAN g;  2KQW A;  2KVQ G;  4PLL A;  1N9S A;  3QDR B;  4Q5W A;  4C0F A;  2VV5 A;  4B9W A;  4JJN K;  3S3N A;  5CKF A;  2WAC A;  3TCJ A;  4BI4 A;  5CKD A;  3P8D A;  3A8M B;  1W2B A;  3V7S A;  2JTM A;  2KK4 A;  5EG2 A;  4C0G A;  1BIA A;  3JCM b;  4PLI A;  1HXD A;  2JTF A;  2A3L A;  5HKC A;  3HRS A;  3S3M A;  3VYH B;  2E10 A;  3LX7 A;  3NTI A;  3QII A;  3MEV A;  4M75 E;  4QW2 A;  2F5K A;  4M7D D;  4NOY A;  3ASK A;  2RB6 A;  1ZBX A;  3CCM A;  4HCC A;  1OYX A;  1QVG A;  1M90 U;  2XID A;  2XDB A;  2CZ1 B;  1G3T A;  2DTO A;  3T9N A;  1D3B A;  2EQJ A;  3TRE A;  4Y28 E;  3QKJ A;  3UT1 A;  5GAN d;  1YJ9 T;  4PJO A;  4QVD A;  3G4S A;  1UEB A;  3OYM A;  5FU6 C;  1VQ7 A;  2DEQ A;  4J8O A;  3OSV A;  4Z02 A;  1VQ5 A;  4JRI A;  3G4S T;  2DTH A;  4C0Z A;  1UB4 A;  2YLB A;  1BKB A;  1WGS A;  4QQG A;  4C5H A;  1KD1 C;  5GAO q;  1VIE A;  2QQ9 A;  1VQL A;  4N4H A;  4IUR A;  3JB9 H;  2O4X A;  4O5V A;  5LJ3 g;  1VQ5 T;  2ZGW A;  2E64 A;  4XTX A;  2GFA A;  1S72 T;  2E12 A;  3CC4 T;  4M7D B;  4X34 A;  3PMT A;  3EFR A;  4J6Y A;  4OB1 B;  3SWN B;  2LX9 A;  2MWO A;  3BDU A;  3QBY A;  4BY6 B;  4GY5 A;  4BI3 A;  4F7U E;  4PJO F;  5GAN h;  1I5L A;  1OZ2 A;  2HAX A;  2VYT A;  1G5V A;  4FT2 A;  5CO7 A;  3SWN A;  2VGM A;  4MMK A;  2LQK A;  3X26 B;  1LOJ A;  3CCU A;  1VQN A;  3JCM W;  3BY7 A;  1ZQ1 A;  3A5Z B;  3H8Z A;  3M4G A;  3OYG A;  2F5T X;  2X4W A;  3CCU T;  4JS4 A;  4OP0 A;  2PVO B;  2EQM A;  4A4E A;  3JCM Q;  5C6S A;  1M90 C;  4OVA A;  5LJ3 d;  3QYG B;  2FVU A;  2XDD A;  4XTV A;  3JCM e;  4BE0 A;  1K73 U;  4DOW A;  4XAX B;  2K3X A;  2RJC A;  3CMA A;  2K4Y A;  4LDV A;  4A4F A;  1M1K U;  2RI3 A;  1V29 B;  4E7I A;  5M9O A;  2XIC A;  3X25 B;  3JB9 J;  4M77 E;  3CMA T;  3M9Q A;  3JCM J;  1YBY A;  2FB7 A;  4JUV A;  4OGC A;  3OY9 A;  4M7A F;  1YI2 A;  4N4G A;  1JJ2 A;  2Y4Y A;  3OYC A;  1G3S A;  2P4T A;  5LJ5 e;  4R55 A;  3DB4 A;  1H3Z A;  2LTO A;  4IUP A;  2DVE A;  3OW2 A;  1YI2 T;  4C0D B;  2K5I A;  3OMG A;  4MZP A;  5LJ3 h;  3OS0 A;  3OYY A;  3L2Z A;  4CRI A;  4L5G A;  3C94 A;  5DLO A;  3CCQ A;  1W2B S;  3SWN C;  1YJW A;  3X28 B;  3QJ6 A;  3FIF A;  4E7L A;  2KSS A;  3LLR A;  1LJO A;  4ZTF A;  2LDM A;  2LT1 A;  1WJR A;  1YJW T;  5GAM g;  2E1H A;  3CME A;  3QO3 A;  3RMS A;  1W4S A;  1N27 A;  1BI0 A;  2M16 A;  2E6Z A;  3UPU A;  1XNI A;  4EMK A;  2DD5 A;  3MHX A;  3I56 A;  1IRE B;  2QI2 A;  2R5M A;  1DJ7 B;  2K5F A;  3L42 A;  4J7F A;  3VJP A;  3JCM c;  3CME T;  1QVG S;  2IG0 A;  3SD4 A;  3NTH A;  1K73 C;  4ZGJ B;  2FHD A;  4MML A;  3L2R A;  4XTU A;  2XI9 A;  2QA4 A;  3CCE A;  1JRI A;  2EQK A;  3HPW A;  1KQ2 A;  3M55 A;  2P0Q A;  2ZZD A;  2EJG A;  5GAN 6;  3JCM V;  5FRN A;  3CCV T;  3OS5 A;  2QA4 T;  1G3Y A;  3OB9 A;  3CCE T;  1I81 A;  2G3R A;  2E70 A;  3MET A;  3OYE A;  1HK9 A;  2XHC A;  4P5N A;  5A0G A;  5DLQ E;  4XTW A;  5GAM d;  1P92 A;  3RMQ A;  1M9S A;  4ZN3 A;  5FU6 B;  3A8H B;  2RD1 A;  2OTJ A;  4DOV A;  4ZTJ A;  1WQW A;  2YLC A;  3FJP A;  4D6W A;  3OBY A;  3E1S A;  2LC4 A;  2JN0 A;  2QEX A;  2LCL A;  4NS5 A;  3CPW A;  3OYA A;  2LRQ A;  2ZPH B;  5LJ5 j;  1BI1 A;  4IUU A;  1UGP B;  2MAM A;  3JCM X;  2OTJ T;  4DA4 A;  1PSF A;  4HCZ A;  5CAI A;  3QYH B;  2X4Y A;  4FU6 A;  5L8R E;  2V8I A;  2LCC A;  5GMK h;  2QEX T;  2JOY A;  1MHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...