3JCMW

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
70
Chain Sequence
QPVNPKPFLKGLVNHRVGVKLKTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
total genus 7
structure length 70
sequence length 73
chains with identical sequence Z
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmW00
4C92C 4M7AC 1I8FA 1WNLA 4RCCA 5GAOn 4M7DD 5LJ5f 4M77D 4M75C 5GANe 1I5LA 4PJOB 4PJOE 3HFNA 4J6WA 3RUXA 2DKGA 5LJ3f 1M8VA 2VXFA 4EMKC 4M7DG 2DEQA 4MMLA 4XU3A 4C8QC 2RD1A 3JCMf 5GAN4 5CAIA 3V8KA 2DJZA 3QSUA 5LJ5d 4M7DE 5GMKj 3V7RA 2VXEA 4MMKA 5GAN6 2RA2A 4M77B 5GMKh 3RERA 4EMHA 4M7AB 4HT8A 4M7AF 2DTOA 1U1TA 3PGGA 4C8QE 3JCMJ 4XU0A 3SB2A 4N0AA 2RM4A 4JLIA 3JB9J 1Y96A 4M7DF 5LJ5j 4PJOA 2FYKA 3QHSA 5GMKe 4C8QF 5GAOr 3EFSA 1KQ2A 2RB6A 3JB9G 2EJGA 4M77F 2VC8A 2ZGWA 1Y96B 4NOYA 4C92G 4NL3A 1N9SA 4M78E 3V7SA 3JCMc 4C92A 4M78B 4XTXA 2E65A 3RKXA 3SWNC 4XU1A 4M7DB 3AHUA 2E64A 3L2ZA 4JRIA 4C92F 2YLCA 1U1SA 5LJ5g 2YHTA 2JN0A 5GAN2 2EJ9A 1JRIA 1I4K1 4JUVA 4WF2A 4F7UE 1D3BA 3EFRA 4PJOF 1LJOA 4EMGA 4M7AD 1M5Q1 2DTHA 4M75G 4EMKB 5GAMj 1HK9A 3JCMd 4A54A 5GAN3 4XTZA 3FIFA 1TH7A 3FJPA 4F7UG 1HXDA 4XTUA 4PJOG 4M75B 4F7UA 4HT9A 4M75F 1YCYA 4M75E 1X01A 5GAMh 4J5YA 4QVDA 3JB9I 1LNXA 4C8QA 4V2SA 4M77C 5GAMd 1BIBA 3BW1A 5GAOl 5LJ5h 4HA8A 5GAMg 4A53A 3HFOA 3JCMP 2DZCA 4XTYA 3RKYA 3JB9D 1B34A 2HNIA 5LJ3g 1WQWA 1WQ7A 3BDUA 4J6YA 3INZA 4EMKA 3JCMh 1LOJA 3FB9A 2DXTA 3M4GA 3QUIA 5GAOm 5GAMf 1BIAA 1N9RA 2DXUA 5GANj 5GMKl 4PNOA 2FB7A 3L1AA 5GMKi 3BY7A 4M75A 4N0AC 1B34B 4RCBA 4F7UB 5LJ3h 1I81A 1MGQA 1H641 4NL2A 4JRKA 5DY9A 3JCMg 4C8QD 5GANf 3JCMW 4XTVA 2EWNA 5LJ3j 3HSBA 5LJ3e 1JBMA 5GMKm 2EJFA 2CGHA 3SWNA 4C92B 4C92E 5GANd 5GAN7 2EAYA 4C8QB 3VU3C 4C8QG 3RKWA 1D3BB 1WPYA 4M78C 2DVEA 4PJOC 3SWNB 4F7UF 3JCMe 3JB9F 5GAOp 4Y91A 2E41A 2K57A 4M78D 4XQ3A 4X9DA 4M78F 5LJ3d 3QO3A 3JCMV 4QVCA 3JCMX 5GAN5 3BFMA 4XU2A 5GAOq 2E1HA 4M7DA 4XTWA 4M78A 3RIRA 5LJ5e 3V7CA 4X9CA 4M78G 4C92D 2I2LA 4M7AA 4M7AG 5GANh 2Y90A 3JCMQ 4M77E 4PJOD 3JB9H 5GAN8 3GIBA 4M7AE 2DZ9A 3RESA 2YLBA 4DQ2A 4OP0A 3V8LA 5GAMe 5I21A 3V8JA 5GANg 4J6XA 2QTXA 2E10A 4M77G 3JCMb 4M77A 4M7DC 2DTIA 1KQ1A 4M75D
chains in the Genus database with same CATH superfamily
2V1RA 4C92C 4LXCA 4J9CA 3RUXA 3MP6A 1OV3A 1YNZA 4IURA 2RD1A 3V8KA 5LJ5d 2EQMA 1SPKA 1XTDA 4OB3B 1SG5A 2AKLA 1D1BA 1YI2T 1WHHA 1AT1B 3QHSA 1QVGA 2KRSA 4HCCA 1E7OA 5I2SA 2HZYA 1M2VA 2EJGA 2EW3A 3RKXA 1W4SA 4PFZA 2BTTA 2LZ6B 4C5GA 5LJ5g 4BE1A 4BI3A 1UHCA 1NEBA 1D3BA 3QPHA 1M5Q1 3FDRA 4HXJA 1S1NA 1K9MU 1RADB 4PJOG 4M75F 5GAMh 3QIIA 1Z9QA 3ZBDA 1LNXA 1QMCA 3REAB 3VS7A 4C5IA 3S3OA 4JS5A 2JT4A 4PLLA 2QXFA 3I55T 2C0OA 2CH4A 2P0PA 3BDUA 4D8DA 1JJ2P 2EYYA 4AG2C 2K3XA 2KT1A 3BY7A 3TVTA 1UGQB 1MGQA 1M90U 3CPWP 1RAEB 4ELYC 3OY9A 2K6DA 3KBGA 1JBMA 3M0RA 2GTOA 3TREA 2DAQA 4IKFA 4M78C 4IIMA 2LJ0A 2GBQA 4CC3A 2DVJA 1PD0A 4XU2A 2E1HA 4M7AG 3H9NA 1K8AR 4Z89A 3KUFA 2XMFA 2EQKA 5EC7A 3E1SA 4KGXB 1PD1A 5IHKA 3GIBA 4DQ2A 1VQ4Q 2XDDA 3I5RA 1KJWA 3C95A 2L0AA 3JCMb 3C4SA 4BI4A 3CCUA 2X4WA 3CCLA 1PNJA 1YJ9Q 1WHLA 4J6WA 2RMOA 2VXFA 2JJ9A 2O2OA 4XU3A 1VUBA 2VXEA 1XNIA 3TEEA 3X25B 4XU0A 3X24B 3E9FA 2PUOB 2B8AA 1M1FA 2CT4A 2H8HA 5KYXB 4WTOB 2G6FX 4GBQA 1QWFA 1VQKA 1Y57A 3NHNA 1D09B 2J6KA 2NUTA 3ZFJA 1WDXA 2YLCA 2HL3A 1WHMA 2FO0A 3EGDB 3M53A 2NUPB 3DLLA 2CP5A 3JCMd 3CC7T 3VYGA 3L2QA 5D7UA 1M8MA 2DBKA 1RLPC 2KRNA 5GAMd 2QGGA 1MNDA 1AWWA 3HFOA 2C0TA 2COYA 1BU1A 3VUZA 5GAMf 3UA7A 1HJDA 4J9FA 3DKMA 1I81A 1QWEA 3M56A 2A3LA 4XTVA 4PFPA 2WACA 5LJ3e 1KSWA 1UDLA 2MMPA 4C92E 2EAYA 1ZUUA 1VQ7Q 3MHXA 3SDZA 1NEGA 3LYIA 1KIKA 7AT1B 5CVIA 4QVCA 1WGSA 2J6FA 4XTWA 2PVDB 3RIRA 4BACA 1M3CA 2JM9A 1KG1A 1TXQA 3QDFA 5KYWA 3RESA 4F16A 1X2KA 2YUQA 4M77A 3PVQA 3LGFA 1T0HA 1WX6A 4M7DD 1FX7A 4RTZA 5GANe 1I5LA 2W10A 2KAFA 3JSCA 3A8OB 2PVOB 3A1PA 1VQNT 6AT1B 1WXTA 3P8DA 2DRKA 1W2BA 1G8XA 3CBMA 4E7HA 5KYYB 2GCXA 4MMKA 1AWXA 3M0SA 3PNWC 1WLPB 2OX7A 3CCMQ 1F1BB 1ZA2B 3EG9A 4ZN1A 1YJNA 5GMKe 3M58A 2VUBA 2HCKA 3L42A 4J9GA 5IXFA 3L2UA 2J06A 3ASKA 1VQLA 2FZCB 1U1SA 4LDUA 2R57A 2V8IA 1IGQA 5D6XA 1OOTA 3I56T 1X43A 4N4HA 1HXDA 1JXMA 1WI7A 4LUEA 2EGCA 2NUPA 2EFIA 2FEIA 4DEXA 4XAXB 4BDZA 2PVGB 2P4TA 4RTVA 3I35A 4A4HA 3JB9D 4OB1B 3QZ5B 2QQBA 3JCMh 1X6OA 2HSPA 1PCXA 2Z0WA 4F7UB 2FPEA 3ER0A 3JCMg 1MV3A 2E5QA 5ECAA 1TOVA 1AZGB 4PJOC 2AZVA 3CMAQ 2K2MA 1VOMA 2GGRA 4KUIA 1ACMB 1X27A 4MZMA 5GAN5 1YHQA 4OMNA 3PIOA 3LWIA 2RI3A 1YI2A 5GANh 4PLIA 2YRDA 3CMAA 4A4GA 4Q5WA 2XKOC 5GANg 1IREB 2QTXA 8ATCB 3D7SB 3H0HA 1VQ8T 1NM7A 1RUWA 2MPXC 5LJ5f 1Z9ZA 3MEUA 1BB9A 2E4HA 4HKEA 4LNPA 5HK3A 3X28B 1VIEA 4BUGA 4JZ3A 3G71Q 5I2MA 2O9SA 5CCAA 2PQWA 1WHJA 4BE0A 1RABB 4PJOA 2DXCA 5AT1B 2L3PA 2CSQA 3CCUT 2RHIA 1AVZC 4LDVA 3L2VA 5FRNA 3AHUA 4JRIA 1VQOA 1Y07A 3QWYA 2QASA 1QVFP 4TVRA 1K73R 2KROA 4EMGA 5GAMj 1OEBA 1VQNQ 1N27A 1YBYA 2X3XD 4F7UG 1JJ2A 1EFNA 1YCYA 3TU4K 2V26A 2RK2A 2RHYA 4M77C 4V2SA 3NFCA 5GAOl 4QVZA 3M0QA 1TS9A 2LTOA 1G3YA 3DB3A 3CC2A 3VS5A 1GXIE 4B9WA 3OS5A 5A0DA 1KK7A 2NYSA 3CCLT 1RAIB 1Q81U 1O9SA 2ED0A 2XDPA 3CC7A 2CGHA 5GANd 4C8QB 1WPYA 1Y7XA 2HL5C 1TU0B 4KGVB 4C0ZA 3S3MA 2KDSA 1HD3A 3OBWA 4N4GA 3H0IA 1K4US 5KYXA 1M90C 1BYMA 3MEWA 5I21A 2QQRA 1SRMA 2D9TA 4M7DC 1ZQ1A 1WIEA 2KXCA 3EGXA 1G5VA 4M7AC 1VQPA 3GNGA 3CCQA 2SEMA 2YDLA 1RLQC 2OTJQ 2RN8A 3FC3A 2JXBA 2VWFA 2FRYA 2PUKB 4EMHA 1K9AA 3NTKA 3EG9B 3JCMJ 3FLGA 5D6WA 4JLIA 1FYNA 1O75A 2JTMA 1TUGB 1Q7YU 3CMAT 1H3HA 4JS4A 1BKBA 3URGA 2X4JA 2E65A 4CC7A 1W2BP 2QQ9A 2L3RA 3MEAA 2GNCA 1SF9A 1GFCA 1JRIA 2GFAA 2L5QA 3HHTB 4DOVA 4RTTA 2RQTA 3META 4E47A 4M75E 4J5YA 4KGZB 2VYTA 2D0NA 1WJQA 3TQ7P 1QVFS 1BIBA 1N6AA 5M9OA 4JJNK 5IHNA 1RAAB 1M1KR 4RTUA 2XIDA 2DJQA 3J81E 3S6WA 3MJXA 3I56Q 3QYHB 5GMKl 3CCEQ 3EFOB 1RAFB 4NL2A 2FPDA 2AT1B 4VUBA 3G1JA 2D1XA 3PT9A 3EH1A 1ZA1B 1M2VB 3QXEB 4FT4A 1KD1R 4OB2B 5CIUA 2JMCA 2I2LA 4AFUC 2Y90A 2ECZA 1NJIC 1Q81C 1FMWA 3V8JA 1K8AC 1OZ2A 1ZUYA 3RBBB 4J9DA 3WVDB 1SHGA 3ME9A 4E7SA 1SKUB 2RNAA 2YSQA 3NPFA 2DL7A 2DKGA 2JZ2A 5CKFA 3OMGA 1WJSA 4DBRA 1ARKA 4ZTFA 2JTFA 4R55A 1YHQT 1YFNA 5GAN4 2QA4T 4LUDA 1BI1A 3LGLA 1UGRB 2JS2A 3LH0A 1VQ9Q 4FSSA 5HY6A 3EHRA 3RERA 2K7AA 4YTLA 4M7AF 2V8JA 2ZCFB 4N0AA 1RAHB 2BKDN 1UUEA 2RF0A 4C8QF 3GP8A 4JPBW 5I11A 1I1JA 3JB9G 4QT7A 2YHTA 2JN0A 2ROLA 1I4K1 3CCQT 4A4KA 3CCJT 1LJOA 2DTHA 4EMKB 2MK5A 4OMQA 1NZ9A 1KD1C 1QVPA 2W0ZA 3EAEA 2C0IA 1ZSZC 1KQSP 2OTJT 2DL4A 4F04B 4E7ZA 2DZCA 3RKYA 2EIFA 2QTVA 2F1LA 5KH6A 1NBEB 3LLRA 3CC7Q 2LNVA 2CP6A 1G3WA 1VQ8A 1IGUA 3L1AA 1NLOC 3TSZA 1H641 1TSFA 1M1KC 1AOJA 2ESWA 4PK4A 1YIJQ 1WA7A 2EYZA 2KY9A 1X75C 4K11A 4X1VA 1JQQA 3QO3A 2HQXA 2DE0X 5GAOq 2LQKA 4L5GA 1VQKQ 8AT1B 2CUBA 3CCRT 1D0YA 1S72A 2GQVA 4M77E 4BY6B 4PJOD 1BCMA 2DZ9A 2K3BA 2ZAEA 2J05A 1FXXA 4J6XA 5IXBA 1YIJT 5GMKj 1R8OB 2YUNA 3SEMA 1VQ4A 4HCBA 4ZGDB 2RH2A 1RL2A 2DEUA 2NUTB 2ZZDA 5GAN6 3OW2P 2JOYA 2OTLT 5HK0A 2O88A 4O6JA 5GJVB 2O31A 3QYGB 2MOXA 2L8DA 2KMTA 2Y4YA 2ZGWA 2DMOA 4FM4B 3JCMc 4FSXA 2DFUA 4M78B 4OVAA 4XTXA 2CZ1B 3EG0A 2EVRA 3OSVA 3ZL7C 3S3NA 1IO6A 3G6EQ 3EG3A 3FJ5A 2F5TX 1YWOA 2CDTA 4F14A 4IIOA 2QG9B 2KRMA 2GFUA 1VQ9T 2LJ1A 1WHGA 1MMGA 4A53A 3LH5A 3QKJA 1KHCA 4KH0B 2PNIA 1LOJA 3FB9A 3OYCA 2DXUA 2CSIA 5FROA 3PTAA 1OX8A 2P84A 1K1ZA 1VQPT 2LX7A 1IXDA 3VS4A 1UB4A 1B3QA 2RQRA 4R0KA 1A0NB 1G83A 3UPUA 3UDCA 1PRMC 5FU6C 2CT3A 3RMSA 4PKCC 4OMMA 3R6OA 4JDSA 3I55A 3CCMA 2LMJA 1KC8R 3A8LB 4IUUA 1FMKA 2EQIA 3JB9H 5J39A 1UG1A 3V8LA 2H3JA 4MZPA 1WZOA 3OYKA 1WYXA 4HVUA 2DTIA 3CC2Q 2RJEA 3CCET 2X35A 4RCCA 2GTJA 2LCCA 2R58A 1T3SA 1KFZA 2GF7A 2E3HA 2IPOB 3OB9A 3VUBA 1BCOA 2LRQA 4AT1B 3T9NA 1YJNQ 5IH2A 5CKDA 4M7DE 1U3OA 2HMAA 2YRVA 3EGUA 3HPWA 3EH2A 4BB7A 2KE9A 1Q82R 1E6GA 2FHDA 3CMEQ 2XD0A 5DM7R 4FYVB 4HCKA 4L59A 4DA4A 3VS0A 1CSKA 2HSEB 2KXDA 3X20B 5J3BA 1M2OA 2RB6A 4LN2A 2DD5A 2ZPIB 5EG2A 4NOYA 2QYZA 3L2RA 3CCST 4M78E 1YIJA 2MWOA 2E64A 4C92F 3ULRB 1U8RA 4BD3A 2QA4A 2QQAA 2JNGA 3LWHA 5GAN3 3CPFA 5FU6B 1W70A 2M51A 4XTZA 1VQ5T 2JMAA 1X01A 1SEMA 2EKHA 3EG2A 4EDUA 3M0TA 4HA8A 1D1CA 4ME7A 5LJ5h 4RMOA 4JJDA 2ZPFB 3JCMP 3X26B 1SSFA 5GAOm 4J9EA 1K73C 1R77A 4PNOA 3G4SQ 1PSFA 4RCBA 3M4YA 3OYGA 4PFOA 4JRKA 5DY9A 5GANf 1V29B 1N8RU 1JU5C 3OSSC 3SWNA 1KC8U 1PG5B 4MDXA 4P5NA 4F7UF 2HQEA 1NE8A 1C0MA 4O5VA 1UHFA 4OGCA 1IB8A 1VQ7T 4M78G 2JM8A 1V1CA 1WXUA 2J7IA 3OQ5A 3VS6A 4M7AE 2QK0A 1BI2A 1SHFA 2PU9B 1PKSA 5FU7C 1H8KA 1NPRA 4DEYA 2G3RA 1T0JA 1UGPB 1WNLA 5GAOn 2X4XA 3EGDA 2DPPB 3WVEB 1SRLA 3DLMA 4J7IA 3CCJA 2VV5A 1M8VA 4RTWA 3MP8A 2DEQA 2MCNA 1XQHA 2K5IA 2X3WD 3CCVQ 4PL6A 3QSUA 1NJIR 2L2PA 2XI9A 2RA2A 1MNEA 2E5KA 3SD4A 5KE2A 3SHWA 1OYXA 4JJCA 2ROTA 3CBPA 3CD6T 1IRXA 5GAOr 3UWNA 2VC8A 1M30A 3NTIA 2AHJB 4FT2A 2M9UA 4XU1A 2AK5A 3RDVA 1M90R 2O4XB 1N8RC 1HSQA 2EJ9A 2VGMA 2NUZA 4LD6A 3U23A 4PJOF 4M75G 4AG1C 2JVVA 4PJJA 4M75B 2CZ7B 4HCZA 4QVDA 5A0LA 3QZ9B 2K5FA 5KE3A 3A8GB 2EBPA 3P8HA 2M0YA 3INZA 1C1AA 1ZBJA 2DXTA 1N9RA 2EQUA 2FB7A 3NTHA 3CCSA 4RKUE 2KNBB 3HRSA 1ZX6A 1VQ4T 1Q86C 2RHXA 3I56A 2A7YA 1GCQA 2RQVA 4C92B 1OPKA 2FZGB 2RI5A 2DVEA 2DK3A 3NGPA 1VQ9A 4Y91A 3GNFB 3RMQA 3KFVA 4A63B 2FVUA 2QEXQ 2FG0A 4C0DB 1UGSB 2YUPA 2E6ZA 1Q81R 1AD5A 2XG8D 5CK9A 2XDBA 1R0BG 4FL6A 1U5SA 1IHVA 1KC8C 1BK2A 1YN8A 1QW1A 3M9QA 2DO3A 2DA9A 4M77D 4PJOE 1X2QA 2DERA 4AFQC 3CC4A 3OS2A 2OAUA 4FU6A 2K4YA 5FW9A 5HCKA 1GCQC 1OU9A 4MDWA 1EX4A 1VQPQ 4M77B 1YITQ 4HT8A 2DYIA 1U1TA 4FW1A 2QAZA 4M7DF 4EPCA 5AYFA 2LDMA 4FIBA 2YRCA 3EFSA 5A2QE 3CCEA 4M4ZA 1MHNA 2RJFA 2LQWA 4NS5A 2KVQG 1OQKA 1GCPA 1LVKA 1G2BA 2F2XA 4RG8A 5L23A 4CC2A 1BBZA 2XHCA 2A37A 3CCMT 3C0CA 3OYEA 2LQNA 1B07A 3QG1A 1PC0A 1BI3A 2RK1A 1Y0MA 3CCSQ 1K73U 4XTYA 2KT8A 1B34A 2MYSA 3CD6A 3OYFA 5CQYA 3JAME 2CP7A 4DBQA 4FYXB 1I0CA 1ZSZB 2E12A 2K9GA 3PMIA 4C8QD 3CMET 4ZTJA 3OS0A 1PSEA 1WJRA 4J83A 2VVKA 2QQSA 3CEYA 2BZYA 5CKBA 3RKWA 1D3BB 3SWNB 3JCMe 1VQ6T 3JCMX 3KXTA 4OGEA 2ZPEB 4PJNA 3BFMA 3OYDA 4M78A 2MAMA 3V7CA 2RHUA 3PIPA 3CC2T 3FEOA 3JCMQ 3PMTA 4N4IA 1VQLQ 2AZSA 4M77G 2HBPA 2ZPBB 4GLKA 1VQOQ 3CC4Q 3VRZA 1RAGB 5CO7A 2LT4A 5J26A 1P92A 1MMNA 3GF5A 2LP5A 3CPWS 2HKNA 1MV0B 3MEVA 3QJ6A 1VQ5A 1TWBA 3PE0A 2V8KA 5CAIA 2J6OA 1D0XA 1YCSB 4RTXA 2COWA 2HDAA 4C8QE 2GQIA 2A28A 2BE9B 2KI7A 2HD0A 4KULA 1ZLMA 2X51A 3QBYA 1K9MR 1ABQA 3GPLA 2EPDA 2WSFE 2EYXA 4L6V5 1YWPA 5FU7B 4GLMA 4B6MA 2CH4W 2M02A 1JXOA 3CCQQ 1NYGA 2KGTA 1QCOA 1Q7YC 3CC4T 3FIFA 4DBFA 3HL8A 1MMDA 2D8HA 4A4EA 1C6VX 2QGFB 1Q86U 1MUZA 4D8KA 1EZZB 1QVFA 4LDYA 2OJ2A 1ZBXA 1UEBA 3CXCP 1WQ7A 3M4GA 2BUDA 1G3TA 1BIAA 4Y92A 4E2FB 4JRPA 1PHTA 2F2WA 2MF2A 1YHQQ 4FYWB 1AWOA 2HEQA 5CQXA 1KHIA 2CS7A 1VQMT 4EIKA 2E41A 2K57A 4IUVA 4X9DA 5LJ3d 1UGVA 1UFFA 1XJWB 1AEYA 1HYOA 3REBB 2RQWA 3CXCA 3E9GA 2M0OA 4OP0A 2XU8A 3TCJA 3OYBA 3M59A 1YJ9A 2X4YA 1PM3A 1CKAA 4Z02A 4B9XA 1VQKT 3H8ZA 4M75C 4WCIA 4DBHA 1TUDA 2R5MA 4M7DG 2Y4XA 3G71T 1Q86R 2NWMA 4C5EA 3V7RA 1VQ6A 1EIFA 3A5ZB 2MWPA 4M7AB 3EGXB 5IAYA 4OMLA 2KSSA 2RJCA 1QKXA 1GRIA 3PGGA 1QCNA 5IN1A 4JRQA 2CZ6B 3H6ZA 3P8BB 1VQ8Q 2DRMA 2FYKA 3O5ZA 3M0UA 3HRTA 2ZPHB 2RHZA 3OYHA 3I5SA 3M5AA 4JJBA 4CRIA 5IT9E 5L8RE 1WFWA 3OMCA 1ZSZA 5C6SA 5GAN2 2MI6A 1H92A 3UA6A 2DM1A 2VASA 4WF2A 3EFRA 4IUTA 2FZKB 4GY5A 3OYJA 3CCJQ 2LQ8A 4F7UA 4UC4A 2COZA 3VJPA 1M9SA 2VGNA 2KQWA 3MPUB 3PVLA 3G4SA 4F17A 3OYAA 4JLGA 1WQWA 3QWXX 1W6XA 1LPLA 2IIMA 5GANj 2P4RA 1K8AU 2AIRB 4N0AC 2CKKA 1Y71A 1W1FA 3JCMW 3EG1A 3G7ZA 3THKA 1NPPA 5I22A 2EYQA 3BDLA 2LCSA 5GAN7 3C94A 1AHJB 2QA4Q 1KQSS 3MKDA 1NYFA 1N5ZA 5GAOp 2EGEA 3JCMV 3O8VA 4E7KA 1RACB 4M7DA 2A36A 1IHWA 1PRLC 3CBOA 4QQ6A 3Q1JA 3E19A 4J9IA 1VA7A 2QEXA 2RO0A 3I9QA 3OYNA 2QDYB 1I8FA 3CCVA 1GL5A 4HVWA 2JW4A 5D6YA 2FRWA 4IUPA 4MMLA 3HRUA 2HAXA 2CZ0B 2EKOA 3JCMf 3C12A 3CCRA 1VQMA 4RG2A 1S72T 3CCLQ 4Z8AA 4J9BA 2VB6A 3VYHB 2DTOA 3CD6Q 2DD4A 3DB4A 3JB9J 1Y96A 5KYWB 1YP5A 4R56A 2IG0A 2A08A 2PZ1A 3IQLA 5KCHA 1VQMQ 1NLPC 4QQDA 2O01E 3CMEA 4M7DB 1OX9A 1E6HA 4D6WA 4LD9K 2LNHB 2D0QB 4II1A 1K76A 2XK0A 4QQGA 4F7UE 4MZTA 5LL6S 3GBQA 3ZEHA 1KQSA 1OZ3A 3G6EA 2JS0A 3N5BB 3JB9I 2YUOA 4C8QA 1M3BA 1YITA 2DF6A 4A4FA 3RNJA 5GAMg 3OYIA 2OAWA 1Q7YR 4EMKA 2KR3A 1X6GA 1M27C 1Q95G 2BE7D 4LDXA 4JZ4A 3QJYA 5LJ3j 2EJFA 3VU3C 2DYBA 2HBWA 1K9MC 2D6FA 2I0NA 4BDYA 4XQ3A 1LCKA 3OS1A 3EFOA 4FCYA 4C92D 2O9VA 4M7AA 3L2WA 1VYVA 1BI0A 1YJWT 4KH1B 1H3ZA 1QVGP 1NG2A 3LW5E 4CC4B 4E6RA 2L3SA 4M75D 2C06A 2DL8A 1DJ7B 1QQJA 2BZXA 1M1GA 4IUQA 2M1HA 4KRTA 3JRZA 4BY6C 1FWZA 3MCAB 1VQOT 4J8OA 1PWTA 2IVWA 4C0DC 4FW2A 2DL3A 2DJZA 4C0GA 1WXBA 5DLQE 3H0FA 5KYUA 1YJ9T 2K3YA 2BZ8A 4ATOA 4KUDK 1M4ZA 3HKSA 3NMZC 1VQ6Q 2HQHA 1Y96B 1U06A 1QKWA 3V7SA 3VS2A 5KYUB 2R5AA 1Q82U 2FPFA 2ABLA 1G3SA 1OI1A 5DLOA 2DBMA 3CCVT 1HK9A 2O4XA 1TH7A 4XTUA 1S72Q 2K5LA 2HKQB 3TSWA 5IHIA 1OPLA 2RPNA 1MMAA 2E6NA 1RI0A 4C5HA 4AFSC 1OULA 2OI3A 3CCUQ 2K2VA 2E3IA 3QUIA 5KYNA 1I5OB 2KYMA 2CYZB 2KBTA 3UATA 2FL7A 4J7FA 1UJYA 2DIQA 3G71A 3VKIA 4XK8E 2CP3A 2B86A 3M55A 5CKHA 3AT1B 3OYLA 1VIFA 4QKUA 3G4ST 4ORZA 3A8HB 2DNUA 1GFDA 3J80E 4CI0C 4E7LA 3VRYA 2K79A 1N8RR 1YITT 5GAN8 3MP1A 2RI2A 4DOWA 1J3TA 2RQUA 1UTIA 2E10A 3E2UA 2EGAA 1JJ2S 5KYYA 5CR2A 1YI2Q 1TUCA 1VQ5Q 4AMCA 4QW2A 1JB0E 1QVGS 2LX9A 5FLXE 4OMPA 4EMKC 1K0XA 1UE9A 4KT0E 4C8QC 2DXBA 2MIOA 4OMFB 1VQ7A 3RR6A 2CREA 2F5KA 3F70A 5GMKh 2DL5A 2A0FB 1PKTA 2X9HA 1ABOA 4Y28E 5LJ5j 2QEXT 2KYBA 1R0CB 4RUGA 1TTHB 2VKNA 4BI8B 2OTLQ 1KQ2A 1TG0A 4M77F 1GBRA 4NL3A 1N9SA 3L2ZA 3HP9A 2NLUA 2WSEE 3LX7A 2QDLA 2EQJA 2JUFA 3OW2A 4PJLA 1M1KU 1FMVA 4M7AD 1B7TA 2H3EB 3JV3A 2KK4A 1UECA 3PFSA 2L89A 1UJ0A 1QLYA 4PJMA 5CKEA 4RTYA 1I07A 1CKBA 4AFZC 2AKKA 2DX1A 2EYWA 3EHQA 3BW1A 3OA6A 3R6NA 3CCRQ 1V76A 1W2BS 5LJ3g 4J6YA 2YWWA 3M0PA 2DILA 1KD1U 2SRCA 3CPWA 2ZPGB 1B34B 3QDRB 5LJ3h 1OU8A 4HVVA 2EWNA 4OB0B 3CQTA 5GMKm 3OYYA 2CP2A 4ZGEB 9ATCB 4LE9A 4ZN3A 1YJWQ 2RJDA 4M78D 4OF1A 3FRNA 3GLXA 4X34A 1T3LA 2DETA 1QP3A 3BE3A 3UT1A 4LDWA 5LJ5e 2P0KA 3A98A 2ATCB 2D8JA 2YLBA 3VS1A 2E70A 1AWJA 2YT6A 4E7IA 4Z88A 4PJOB 2F2VA 3HFNA 3WXMB 5LJ3f 1QP2A 2LC4A 3G6ET 2DLPA 2LT1A 5FWCA 2JTEA 4ZNXA 1YJWA 1D0ZA 3SB2A 2RM4A 2P0QA 2V1QA 3GOXA 3I55Q 2OTJA 1AZEA 5C0MA 4ZGJB 5A0GA 4OMOA 1JO8A 4C0FA 1ZUKA 1ZHIA 2DIGA 4C92G 5HKCA 4C92A 2KEAA 3SFMA 3M54A 3SWNC 4FYYB 1WHKA 4ANJA 2CUDA 1M3AA 4JUVA 4A54A 3FJPA 4KBMB 4HT9A 3UF4A 2M16A 4J9HA 1RI9A 3H41A 3MO8A 2ED1A 3VS3A 2LCLA 5GJWB 1X69A 1D1AA 2F69A 2HNIA 2QI2A 3HTRA 5GMKi 1K0SA 3J7AF 4M75A 1QCFA 1VQLT 2PTKA 3CXCS 3HSBA 2LJ3A 2L3QA 4C8QG 2YXYA 1IZ6A 4E7JA 1GBQA 1JEGA 1VYTA 3JB9F 3A8MB 2CP0A 5FRMA 1VQNA 3OBYA 5KCOA 4M78F 1NJIU 5FWBA 2LVMA 3VV0A 2XICA 4BE2A 1XOVA 4X9CA 1Q82C 1X6BA 2BIVA 2OTLA 3OW2S 3M57A 1ZSGA 3OYMA 5GAMe 2ENMA 1VYUA 4ELZC 4ESRA 1YJNT 1SSHA 1KQ1A 2WSCE
chains in the Genus database with same CATH topology
1NPRA 4C92C 3OYNA 1G5VA 2G3RA 4M7AC 1UGPB 1I8FA 1WNLA 2QDYB 2X4XA 5GAOn 3CCVA 1VQPA 3GNGA 2DPPB 3WVEB 3CCQA 3DLMA 4J7IA 3RUXA 3CCJA 2VV5A 5D6YA 1M8VA 3MP6A 4IUPA 3MP8A 2DEQA 3HRUA 4MMLA 2CZ0B 2HAXA 1XQHA 2EKOA 2K5IA 4IURA 2RD1A 4PL6A 3JCMf 3FC3A 3V8KA 3QSUA 5LJ5d 3C12A 3CCRA 1VQMA 2EQMA 4RG2A 1S72T 1XTDA 2XI9A 2RA2A 4OB3B 2PUKB 4EMHA 3VYHB 3SD4A 3NTKA 2DTOA 3JCMJ 2DD4A 5KE2A 3FLGA 5D6WA 3DB4A 4JLIA 3JB9J 1Y96A 1O75A 1OYXA 4R56A 2IG0A 2JTMA 1YI2T 3QHSA 3CBPA 3CD6T 5KCHA 5GAOr 1QVGA 4HCCA 3UWNA 5I2SA 2EJGA 1Q7YU 3CMAT 2VC8A 3NTIA 2AHJB 4JS4A 4QQDA 1BKBA 4FT2A 3URGA 2X4JA 2E65A 1W4SA 2M9UA 2O01E 4XU1A 3RKXA 3CMEA 4M7DB 2QQ9A 2O4XB 4D6WA 2L3RA 4LD9K 3MEAA 4C5GA 5LJ5g 1N8RC 2EJ9A 2D0QB 4BE1A 1JRIA 2GFAA 2L5QA 4BI3A 4II1A 2XK0A 4QQGA 2VGMA 4LD6A 1D3BA 4MZTA 4PJOF 4F7UE 3QPHA 3HHTB 5LL6S 1M5Q1 3FDRA 4M75G 4DOVA 1K9MU 2JVVA 3META 3ZEHA 4E47A 1KQSA 1OZ3A 4PJOG 3G6EA 4M75B 4M75F 2CZ7B 4M75E 3N5BB 5GAMh 4HCZA 4J5YA 4QVDA 3JB9I 3QIIA 5A0LA 3ZBDA 1LNXA 2VYTA 1WJQA 4C8QA 1QVFS 3QZ9B 1BIBA 1N6AA 1YITA 4C5IA 4A4FA 5M9OA 2K5FA 5KE3A 4JS5A 3S3OA 4JJNK 5GAMg 4PLLA 2QXFA 3I55T 3A8GB 3OYIA 2XIDA 2P0PA 3J81E 3BDUA 3P8HA 3INZA 3S6WA 4EMKA 2DXTA 3QYHB 1N9RA 2EQUA 5GMKl 2FB7A 2K3XA 3NTHA 3BY7A 3CCSA 4RKUE 1MGQA 1UGQB 1M90U 4NL2A 4LDXA 3HRSA 4ELYC 1VQ4T 1Q86C 2RHXA 3QJYA 3OY9A 3I56A 4VUBA 5LJ3j 3KBGA 2A7YA 1JBMA 2EJFA 4C92B 3TREA 3PT9A 3VU3C 2RI5A 2DAQA 4IKFA 4M78C 2DVEA 3QXEB 4FT4A 1K9MC 2DK3A 2D6FA 4BDYA 1VQ9A 4Y91A 4XQ3A 3OS1A 4OB2B 3GNFB 5CIUA 3RMQA 2FVUA 4XU2A 2E1HA 4C0DB 4M7AG 4C92D 2I2LA 3KUFA 4M7AA 1UGSB 2EQKA 2Y90A 3E1SA 1BI0A 3L2WA 1NJIC 1Q81C 2E6ZA 1YJWT 3GIBA 4DQ2A 1H3ZA 2XG8D 5CK9A 3LW5E 2XDDA 4FL6A 3V8JA 2XDBA 1K8AC 3C95A 1KC8C 1OZ2A 3JCMb 3C4SA 3WVDB 4M75D 4BI4A 2C06A 3ME9A 1QW1A 1DJ7B 2DO3A 3M9QA 3CCUA 2X4WA 3CCLA 4M77D 4PJOE 1M1GA 4IUQA 4J6WA 2DKGA 2M1HA 2JZ2A 5CKFA 3OMGA 2VXFA 1WJSA 1FWZA 3JRZA 4BY6C 3MCAB 1VQOT 3CC4A 4J8OA 3OS2A 4ZTFA 2JTFA 2OAUA 2K4YA 4FU6A 4XU3A 2IVWA 4C0DC 4R55A 1YHQT 5GAN4 2QA4T 2DJZA 1BI1A 3LGLA 1UGRB 4MDWA 4C0GA 1VUBA 3LH0A 2VXEA 1XNIA 3TEEA 3X25B 5HY6A 4M77B 5DLQE 3RERA 4YTLA 1M1KC 4HT8A 4M7AF 1U1TA 2V8JA 2ZCFB 4XU0A 1YJ9T 4N0AA 4M7DF 2K3YA 3X24B 3E9FA 4EPCA 2BKDN 2PUOB 4KUDK 5AYFA 2B8AA 1M1FA 1M4ZA 2LDMA 3HKSA 4FIBA 4C8QF 3GP8A 3EFSA 5A2QE 3CCEA 3JB9G 1VQKA 1Y96B 2RO0A 3V7SA 1MHNA 2RJFA 2R5AA 1Q82U 3ZFJA 2YLCA 4NS5A 1G3SA 1OI1A 2KVQG 2YHTA 2JN0A 5DLOA 3CCVT 1I4K1 3M53A 3CCQT 4A4KA 4RG8A 3DLLA 3CCJT 1LJOA 2DTHA 4EMKB 1HK9A 2O4XA 3JCMd 3CC7T 1NZ9A 1TH7A 2XHCA 3VYGA 4XTUA 3L2QA 1KD1C 1QVPA 3CCMT 3EAEA 2K5LA 3OYEA 2E6NA 2OTJT 5GAMd 1RI0A 3QG1A 4C5HA 1BI3A 2RK1A 3HFOA 1K73U 2DZCA 4XTYA 3RKYA 2EIFA 1B34A 3CD6A 3OYFA 2K2VA 3VUZA 5KH6A 3LLRA 5CQYA 2LNVA 3QUIA 3JAME 5GAMf 1G3WA 1VQ8A 3L1AA 2CYZB 2E12A 3DKMA 1I81A 3PMIA 1H641 4C8QD 3CMET 2FL7A 4J7FA 3OS0A 3M56A 4ZTJA 2A3LA 1PSEA 1WJRA 2DIQA 4XTVA 4J83A 2WACA 5LJ3e 2QQSA 3G71A 2MMPA 3CEYA 3VKIA 2EAYA 4XK8E 5CKBA 4C92E 3RKWA 1D3BB 2KY9A 1X75C 3MHXA 3SDZA 3SWNB 3M55A 3JCMe 1VQ6T 5CKHA 3LYIA 3OYLA 1VIFA 3QO3A 5CVIA 4QVCA 3JCMX 3KXTA 2HQXA 1WGSA 2ZPEB 4OGEA 3OYDA 3A8HB 3BFMA 5GAOq 3G4ST 4XTWA 4M78A 2PVDB 3RIRA 2LQKA 2MAMA 2RHUA 4L5GA 3V7CA 4CI0C 3J80E 4BACA 4E7LA 3CCRT 3PIPA 1KG1A 1S72A 3CC2T 3FEOA 3JCMQ 1YITT 3PMTA 2GQVA 4M77E 4BY6B 4PJOD 5GAN8 3MP1A 2DZ9A 3RESA 4N4IA 2RI2A 4DOWA 1FXXA 4J6XA 2E10A 4M77G 2HBPA 2ZPBB 4GLKA 4M77A 1YIJT 5GMKj 1JJ2S 1R8OB 5CO7A 3LGFA 5CR2A 2LT4A 4M7DD 5J26A 1FX7A 1P92A 5GANe 1I5LA 2KAFA 3GF5A 3JSCA 4QW2A 1JB0E 1QVGS 1ZQ1A 2PVOB 2LX9A 3A8OB 3CPWS 5FLXE 1VQ4A 1VQNT 4HCBA 4EMKC 3P8DA 4ZGDB 4KT0E 4C8QC 2DXBA 3MEVA 3CBMA 2RH2A 3QJ6A 1W2BA 1VQ5A 2V8KA 4OMFB 1RL2A 5CAIA 1VQ7A 4E7HA 2GCXA 4MMKA 5GAN6 2ZZDA 2F5KA 3F70A 2JOYA 3PNWC 5GMKh 2OTLT 5HK0A 4O6JA 4C8QE 4Y28E 4ZN1A 5LJ5j 2QEXT 1YJNA 5GMKe 3QYGB 3M58A 2HD0A 2L8DA 3QBYA 4KULA 4BI8B 2KMTA 2Y4YA 2VUBA 1KQ2A 3L42A 3GPLA 4M77F 2ZGWA 4FM4B 3L2UA 2WSFE 1N9SA 4NL3A 3JCMc 4FSXA 4M78B 4OVAA 4XTXA 3ASKA 2CZ1B 4L6V5 1VQLA 5FU7B 3L2ZA 3HP9A 3OSVA 3S3NA 2NLUA 1U1SA 2WSEE 3LX7A 4LDUA 2R57A 2EQJA 2JUFA 3OW2A 2F5TX 1M1KU 2V8IA 4M7AD 5D6XA 1Q7YC 3CC4T 3I56T 2KK4A 3FIFA 3HL8A 3PFSA 4N4HA 1HXDA 2GFUA 2L89A 4A4EA 5CKEA 2EFIA 1Q86U 1VQ9T 4XAXB 4BDZA 2PVGB 2P4TA 3BW1A 1QVFA 4LDYA 3OA6A 1ZBXA 4A53A 4A4HA 1UEBA 3QKJA 3JB9D 1KHCA 1W2BS 4OB1B 1WQ7A 5LJ3g 3QZ5B 2QQBA 4J6YA 3JCMh 1LOJA 3FB9A 1X6OA 3M4GA 2BUDA 1G3TA 3OYCA 1KD1U 1BIAA 4JRPA 2DXUA 3CPWA 5FROA 3PTAA 4F7UB 1VQPT 2ZPGB 1B34B 3QDRB 5LJ3h 3ER0A 3JCMg 2MF2A 2E5QA 2EWNA 1UB4A 4OB0B 5GMKm 3OYYA 5CQXA 4ZGEB 4ZN3A 4PJOC 1KHIA 2CS7A 2RJDA 3UDCA 3UPUA 1VQMT 5FU6C 3RMSA 2E41A 2K57A 4IUVA 4M78D 4X9DA 4KUIA 4OF1A 4PKCC 5LJ3d 3R6OA 3FRNA 3GLXA 4JDSA 4X34A 3I55A 4MZMA 5GAN5 1QP3A 3CCMA 1YHQA 3UT1A 4LDWA 5LJ5e 3PIOA 3LWIA 3A8LB 4IUUA 2RI3A 1YI2A 5GANh 2P0KA 4PLIA 3JB9H 3CXCA 3E9GA 5J39A 2M0OA 2YLBA 4A4GA 4OP0A 2XU8A 2H3JA 3TCJA 3V8LA 3M59A 4Q5WA 3OYBA 1YJ9A 4MZPA 2XKOC 5GANg 1IREB 2QTXA 3OYKA 2X4YA 2E70A 2DTIA 2RJEA 4Z02A 4B9XA 3CCET 1VQ8T 4E7IA 2X35A 4RCCA 1VQKT 3H8ZA 5LJ5f 4M75C 4PJOB 2LCCA 3HFNA 2R58A 3MEUA 3WXMB 2GF7A 5LJ3f 1QP2A 2R5MA 3OB9A 3VUBA 2LC4A 2Y4XA 2LRQA 4M7DG 3T9NA 3G71T 4HKEA 3G6ET 5HK3A 2LT1A 5CKDA 4M7DE 3X28B 1VIEA 4C5EA 2YRVA 3HPWA 3V7RA 1EIFA 4BB7A 3A5ZB 4BUGA 1VQ6A 2MWPA 5I2MA 4M7AB 1YJWA 5IAYA 5CCAA 2KSSA 2FHDA 2PQWA 2RJCA 3PGGA 5DM7R 4BE0A 2XD0A 5IN1A 3SB2A 4JRQA 2RM4A 4L59A 2CZ6B 3H6ZA 3P8BB 4DA4A 2P0QA 2DXCA 3GOXA 4PJOA 2FYKA 3CMAA 3X20B 5J3BA 5C0MA 4ZGJB 5A0GA 2OTJA 2RB6A 3HRTA 2ZPHB 2RHZA 4C0FA 3OYHA 2DD5A 1ZHIA 3CCUT 2RHIA 2ZPIB 3M5AA 5EG2A 4CRIA 2DIGA 4NOYA 4C92G 3L2RA 4LDVA 5HKCA 3CCST 4M78E 4C92A 3L2VA 3SFMA 5IT9E 3M54A 5FRNA 3SWNC 5L8RE 1YIJA 2MWOA 3AHUA 2E64A 4JRIA 1Y07A 4C92F 1VQOA 3OMCA 5C6SA 1U8RA 4BD3A 5GAN2 2MI6A 2QQAA 2JNGA 4TVRA 4JUVA 4WF2A 2QA4A 3EFRA 4IUTA 3LWHA 4EMGA 4GY5A 5GAN3 5GAMj 3OYJA 3CPFA 1N27A 5FU6B 4A54A 4XTZA 1YBYA 3FJPA 4F7UG 4KBMB 2LQ8A 1VQ5T 1JJ2A 2M16A 4F7UA 4HT9A 3TU4K 1YCYA 1X01A 4UC4A 2RK2A 3VJPA 1M9SA 2RHYA 4M77C 2VGNA 2KQWA 4V2SA 3MO8A 4EDUA 3NFCA 5GAOl 5LJ5h 4HA8A 4RMOA 4ME7A 2LCLA 4QVZA 2ZPFB 3G4SA 3JCMP 2F69A 1SSFA 3X26B 3OYAA 2HNIA 2LTOA 1WQWA 4JLGA 2QI2A 4ATOA 1G3YA 5GAOm 3DB3A 3CC2A 1K73C 1GXIE 4B9WA 5GANj 1K8AU 3OS5A 4PNOA 5A0DA 5GMKi 1PSFA 3CCLT 4M75A 4RCBA 4N0AC 3M4YA 3J7AF 2CKKA 1Y71A 3OYGA 5GANf 4JRKA 5DY9A 3JCMW 1V29B 3G7ZA 1O9SA 1Q81U 1VQLT 2XDPA 3CC7A 3CXCS 1N8RU 3HSBA 1NPPA 3OSSC 2CGHA 2EYQA 3BDLA 3SWNA 5GANd 5GAN7 4C8QB 3C94A 1AHJB 4C8QG 4E7JA 1IZ6A 1WPYA 1Y7XA 4C0ZA 1KC8U 4P5NA 1KQSS 4MDXA 4F7UF 3JB9F 2HQEA 3A8MB 5GAOp 3S3MA 5FRMA 1NE8A 1VQNA 3OBYA 5KCOA 4M78F 4O5VA 2KDSA 1NJIU 3JCMV 3O8VA 4E7KA 2LVMA 3OBWA 4OGCA 3VV0A 2XICA 4M7DA 4N4GA 4BE2A 1XOVA 4X9CA 4M78G 1VQ7T 1Q82C 2BIVA 3CBOA 2OTLA 3OQ5A 3OW2S 1M90C 3M57A 4QQ6A 4M7AE 3OYMA 3MEWA 1BYMA 5GAMe 5I21A 2QQRA 3Q1JA 3E19A 1BI2A 4ELZC 2QEXA 1YJNT 2D9TA 4M7DC 2PU9B 1KQ1A 2WSCE 5FU7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 C;  4M7A C;  1I8F A;  1WNL A;  4RCC A;  5GAO n;  4M7D D;  5LJ5 f;  4M77 D;  4M75 C;  5GAN e;  1I5L A;  4PJO B;  4PJO E;  3HFN A;  4J6W A;  3RUX A;  2DKG A;  5LJ3 f;  1M8V A;  2VXF A;  4EMK C;  4M7D G;  2DEQ A;  4MML A;  4XU3 A;  4C8Q C;  2RD1 A;  3JCM f;  5GAN 4;  5CAI A;  3V8K A;  2DJZ A;  3QSU A;  5LJ5 d;  4M7D E;  5GMK j;  3V7R A;  2VXE A;  4MMK A;  5GAN 6;  2RA2 A;  4M77 B;  5GMK h;  3RER A;  4EMH A;  4M7A B;  4HT8 A;  4M7A F;  2DTO A;  1U1T A;  3PGG A;  4C8Q E;  3JCM J;  4XU0 A;  3SB2 A;  4N0A A;  2RM4 A;  4JLI A;  3JB9 J;  1Y96 A;  4M7D F;  5LJ5 j;  4PJO A;  2FYK A;  3QHS A;  5GMK e;  4C8Q F;  5GAO r;  3EFS A;  1KQ2 A;  2RB6 A;  3JB9 G;  2EJG A;  4M77 F;  2VC8 A;  2ZGW A;  1Y96 B;  4NOY A;  4C92 G;  4NL3 A;  1N9S A;  4M78 E;  3V7S A;  3JCM c;  4C92 A;  4M78 B;  4XTX A;  2E65 A;  3RKX A;  3SWN C;  4XU1 A;  4M7D B;  3AHU A;  2E64 A;  3L2Z A;  4JRI A;  4C92 F;  2YLC A;  1U1S A;  5LJ5 g;  2YHT A;  2JN0 A;  5GAN 2;  2EJ9 A;  1JRI A;  1I4K 1;  4JUV A;  4WF2 A;  4F7U E;  1D3B A;  3EFR A;  4PJO F;  1LJO A;  4EMG A;  4M7A D;  1M5Q 1;  2DTH A;  4M75 G;  4EMK B;  5GAM j;  1HK9 A;  3JCM d;  4A54 A;  5GAN 3;  4XTZ A;  3FIF A;  1TH7 A;  3FJP A;  4F7U G;  1HXD A;  4XTU A;  4PJO G;  4M75 B;  4F7U A;  4HT9 A;  4M75 F;  1YCY A;  4M75 E;  1X01 A;  5GAM h;  4J5Y A;  4QVD A;  3JB9 I;  1LNX A;  4C8Q A;  4V2S A;  4M77 C;  5GAM d;  1BIB A;  3BW1 A;  5GAO l;  5LJ5 h;  4HA8 A;  5GAM g;  4A53 A;  3HFO A;  3JCM P;  2DZC A;  4XTY A;  3RKY A;  3JB9 D;  1B34 A;  2HNI A;  5LJ3 g;  1WQW A;  1WQ7 A;  3BDU A;  4J6Y A;  3INZ A;  4EMK A;  3JCM h;  1LOJ A;  3FB9 A;  2DXT A;  3M4G A;  3QUI A;  5GAO m;  5GAM f;  1BIA A;  1N9R A;  2DXU A;  5GAN j;  5GMK l;  4PNO A;  2FB7 A;  3L1A A;  5GMK i;  3BY7 A;  4M75 A;  4N0A C;  1B34 B;  4RCB A;  4F7U B;  5LJ3 h;  1I81 A;  1MGQ A;  1H64 1;  4NL2 A;  4JRK A;  5DY9 A;  3JCM g;  4C8Q D;  5GAN f;  3JCM W;  4XTV A;  2EWN A;  5LJ3 j;  3HSB A;  5LJ3 e;  1JBM A;  5GMK m;  2EJF A;  2CGH A;  3SWN A;  4C92 B;  4C92 E;  5GAN d;  5GAN 7;  2EAY A;  4C8Q B;  3VU3 C;  4C8Q G;  3RKW A;  1D3B B;  1WPY A;  4M78 C;  2DVE A;  4PJO C;  3SWN B;  4F7U F;  3JCM e;  3JB9 F;  5GAO p;  4Y91 A;  2E41 A;  2K57 A;  4M78 D;  4XQ3 A;  4X9D A;  4M78 F;  5LJ3 d;  3QO3 A;  3JCM V;  4QVC A;  3JCM X;  5GAN 5;  3BFM A;  4XU2 A;  5GAO q;  2E1H A;  4M7D A;  4XTW A;  4M78 A;  3RIR A;  5LJ5 e;  3V7C A;  4X9C A;  4M78 G;  4C92 D;  2I2L A;  4M7A A;  4M7A G;  5GAN h;  2Y90 A;  3JCM Q;  4M77 E;  4PJO D;  3JB9 H;  5GAN 8;  3GIB A;  4M7A E;  2DZ9 A;  3RES A;  2YLB A;  4DQ2 A;  4OP0 A;  3V8L A;  5GAM e;  5I21 A;  3V8J A;  5GAN g;  4J6X A;  2QTX A;  2E10 A;  4M77 G;  3JCM b;  4M77 A;  4M7D C;  2DTI A;  1KQ1 A;  4M75 D; 
#chains in the Genus database with same CATH topology
 2V1R A;  4C92 C;  4LXC A;  4J9C A;  3RUX A;  3MP6 A;  1OV3 A;  1YNZ A;  4IUR A;  2RD1 A;  3V8K A;  5LJ5 d;  2EQM A;  1SPK A;  1XTD A;  4OB3 B;  1SG5 A;  2AKL A;  1D1B A;  1YI2 T;  1WHH A;  1AT1 B;  3QHS A;  1QVG A;  2KRS A;  4HCC A;  1E7O A;  5I2S A;  2HZY A;  1M2V A;  2EJG A;  2EW3 A;  3RKX A;  1W4S A;  4PFZ A;  2BTT A;  2LZ6 B;  4C5G A;  5LJ5 g;  4BE1 A;  4BI3 A;  1UHC A;  1NEB A;  1D3B A;  3QPH A;  1M5Q 1;  3FDR A;  4HXJ A;  1S1N A;  1K9M U;  1RAD B;  4PJO G;  4M75 F;  5GAM h;  3QII A;  1Z9Q A;  3ZBD A;  1LNX A;  1QMC A;  3REA B;  3VS7 A;  4C5I A;  3S3O A;  4JS5 A;  2JT4 A;  4PLL A;  2QXF A;  3I55 T;  2C0O A;  2CH4 A;  2P0P A;  3BDU A;  4D8D A;  1JJ2 P;  2EYY A;  4AG2 C;  2K3X A;  2KT1 A;  3BY7 A;  3TVT A;  1UGQ B;  1MGQ A;  1M90 U;  3CPW P;  1RAE B;  4ELY C;  3OY9 A;  2K6D A;  3KBG A;  1JBM A;  3M0R A;  2GTO A;  3TRE A;  2DAQ A;  4IKF A;  4M78 C;  4IIM A;  2LJ0 A;  2GBQ A;  4CC3 A;  2DVJ A;  1PD0 A;  4XU2 A;  2E1H A;  4M7A G;  3H9N A;  1K8A R;  4Z89 A;  3KUF A;  2XMF A;  2EQK A;  5EC7 A;  3E1S A;  4KGX B;  1PD1 A;  5IHK A;  3GIB A;  4DQ2 A;  1VQ4 Q;  2XDD A;  3I5R A;  1KJW A;  3C95 A;  2L0A A;  3JCM b;  3C4S A;  4BI4 A;  3CCU A;  2X4W A;  3CCL A;  1PNJ A;  1YJ9 Q;  1WHL A;  4J6W A;  2RMO A;  2VXF A;  2JJ9 A;  2O2O A;  4XU3 A;  1VUB A;  2VXE A;  1XNI A;  3TEE A;  3X25 B;  4XU0 A;  3X24 B;  3E9F A;  2PUO B;  2B8A A;  1M1F A;  2CT4 A;  2H8H A;  5KYX B;  4WTO B;  2G6F X;  4GBQ A;  1QWF A;  1VQK A;  1Y57 A;  3NHN A;  1D09 B;  2J6K A;  2NUT A;  3ZFJ A;  1WDX A;  2YLC A;  2HL3 A;  1WHM A;  2FO0 A;  3EGD B;  3M53 A;  2NUP B;  3DLL A;  2CP5 A;  3JCM d;  3CC7 T;  3VYG A;  3L2Q A;  5D7U A;  1M8M A;  2DBK A;  1RLP C;  2KRN A;  5GAM d;  2QGG A;  1MND A;  1AWW A;  3HFO A;  2C0T A;  2COY A;  1BU1 A;  3VUZ A;  5GAM f;  3UA7 A;  1HJD A;  4J9F A;  3DKM A;  1I81 A;  1QWE A;  3M56 A;  2A3L A;  4XTV A;  4PFP A;  2WAC A;  5LJ3 e;  1KSW A;  1UDL A;  2MMP A;  4C92 E;  2EAY A;  1ZUU A;  1VQ7 Q;  3MHX A;  3SDZ A;  1NEG A;  3LYI A;  1KIK A;  7AT1 B;  5CVI A;  4QVC A;  1WGS A;  2J6F A;  4XTW A;  2PVD B;  3RIR A;  4BAC A;  1M3C A;  2JM9 A;  1KG1 A;  1TXQ A;  3QDF A;  5KYW A;  3RES A;  4F16 A;  1X2K A;  2YUQ A;  4M77 A;  3PVQ A;  3LGF A;  1T0H A;  1WX6 A;  4M7D D;  1FX7 A;  4RTZ A;  5GAN e;  1I5L A;  2W10 A;  2KAF A;  3JSC A;  3A8O B;  2PVO B;  3A1P A;  1VQN T;  6AT1 B;  1WXT A;  3P8D A;  2DRK A;  1W2B A;  1G8X A;  3CBM A;  4E7H A;  5KYY B;  2GCX A;  4MMK A;  1AWX A;  3M0S A;  3PNW C;  1WLP B;  2OX7 A;  3CCM Q;  1F1B B;  1ZA2 B;  3EG9 A;  4ZN1 A;  1YJN A;  5GMK e;  3M58 A;  2VUB A;  2HCK A;  3L42 A;  4J9G A;  5IXF A;  3L2U A;  2J06 A;  3ASK A;  1VQL A;  2FZC B;  1U1S A;  4LDU A;  2R57 A;  2V8I A;  1IGQ A;  5D6X A;  1OOT A;  3I56 T;  1X43 A;  4N4H A;  1HXD A;  1JXM A;  1WI7 A;  4LUE A;  2EGC A;  2NUP A;  2EFI A;  2FEI A;  4DEX A;  4XAX B;  4BDZ A;  2PVG B;  2P4T A;  4RTV A;  3I35 A;  4A4H A;  3JB9 D;  4OB1 B;  3QZ5 B;  2QQB A;  3JCM h;  1X6O A;  2HSP A;  1PCX A;  2Z0W A;  4F7U B;  2FPE A;  3ER0 A;  3JCM g;  1MV3 A;  2E5Q A;  5ECA A;  1TOV A;  1AZG B;  4PJO C;  2AZV A;  3CMA Q;  2K2M A;  1VOM A;  2GGR A;  4KUI A;  1ACM B;  1X27 A;  4MZM A;  5GAN 5;  1YHQ A;  4OMN A;  3PIO A;  3LWI A;  2RI3 A;  1YI2 A;  5GAN h;  4PLI A;  2YRD A;  3CMA A;  4A4G A;  4Q5W A;  2XKO C;  5GAN g;  1IRE B;  2QTX A;  8ATC B;  3D7S B;  3H0H A;  1VQ8 T;  1NM7 A;  1RUW A;  2MPX C;  5LJ5 f;  1Z9Z A;  3MEU A;  1BB9 A;  2E4H A;  4HKE A;  4LNP A;  5HK3 A;  3X28 B;  1VIE A;  4BUG A;  4JZ3 A;  3G71 Q;  5I2M A;  2O9S A;  5CCA A;  2PQW A;  1WHJ A;  4BE0 A;  1RAB B;  4PJO A;  2DXC A;  5AT1 B;  2L3P A;  2CSQ A;  3CCU T;  2RHI A;  1AVZ C;  4LDV A;  3L2V A;  5FRN A;  3AHU A;  4JRI A;  1VQO A;  1Y07 A;  3QWY A;  2QAS A;  1QVF P;  4TVR A;  1K73 R;  2KRO A;  4EMG A;  5GAM j;  1OEB A;  1VQN Q;  1N27 A;  1YBY A;  2X3X D;  4F7U G;  1JJ2 A;  1EFN A;  1YCY A;  3TU4 K;  2V26 A;  2RK2 A;  2RHY A;  4M77 C;  4V2S A;  3NFC A;  5GAO l;  4QVZ A;  3M0Q A;  1TS9 A;  2LTO A;  1G3Y A;  3DB3 A;  3CC2 A;  3VS5 A;  1GXI E;  4B9W A;  3OS5 A;  5A0D A;  1KK7 A;  2NYS A;  3CCL T;  1RAI B;  1Q81 U;  1O9S A;  2ED0 A;  2XDP A;  3CC7 A;  2CGH A;  5GAN d;  4C8Q B;  1WPY A;  1Y7X A;  2HL5 C;  1TU0 B;  4KGV B;  4C0Z A;  3S3M A;  2KDS A;  1HD3 A;  3OBW A;  4N4G A;  3H0I A;  1K4U S;  5KYX A;  1M90 C;  1BYM A;  3MEW A;  5I21 A;  2QQR A;  1SRM A;  2D9T A;  4M7D C;  1ZQ1 A;  1WIE A;  2KXC A;  3EGX A;  1G5V A;  4M7A C;  1VQP A;  3GNG A;  3CCQ A;  2SEM A;  2YDL A;  1RLQ C;  2OTJ Q;  2RN8 A;  3FC3 A;  2JXB A;  2VWF A;  2FRY A;  2PUK B;  4EMH A;  1K9A A;  3NTK A;  3EG9 B;  3JCM J;  3FLG A;  5D6W A;  4JLI A;  1FYN A;  1O75 A;  2JTM A;  1TUG B;  1Q7Y U;  3CMA T;  1H3H A;  4JS4 A;  1BKB A;  3URG A;  2X4J A;  2E65 A;  4CC7 A;  1W2B P;  2QQ9 A;  2L3R A;  3MEA A;  2GNC A;  1SF9 A;  1GFC A;  1JRI A;  2GFA A;  2L5Q A;  3HHT B;  4DOV A;  4RTT A;  2RQT A;  3MET A;  4E47 A;  4M75 E;  4J5Y A;  4KGZ B;  2VYT A;  2D0N A;  1WJQ A;  3TQ7 P;  1QVF S;  1BIB A;  1N6A A;  5M9O A;  4JJN K;  5IHN A;  1RAA B;  1M1K R;  4RTU A;  2XID A;  2DJQ A;  3J81 E;  3S6W A;  3MJX A;  3I56 Q;  3QYH B;  5GMK l;  3CCE Q;  3EFO B;  1RAF B;  4NL2 A;  2FPD A;  2AT1 B;  4VUB A;  3G1J A;  2D1X A;  3PT9 A;  3EH1 A;  1ZA1 B;  1M2V B;  3QXE B;  4FT4 A;  1KD1 R;  4OB2 B;  5CIU A;  2JMC A;  2I2L A;  4AFU C;  2Y90 A;  2ECZ A;  1NJI C;  1Q81 C;  1FMW A;  3V8J A;  1K8A C;  1OZ2 A;  1ZUY A;  3RBB B;  4J9D A;  3WVD B;  1SHG A;  3ME9 A;  4E7S A;  1SKU B;  2RNA A;  2YSQ A;  3NPF A;  2DL7 A;  2DKG A;  2JZ2 A;  5CKF A;  3OMG A;  1WJS A;  4DBR A;  1ARK A;  4ZTF A;  2JTF A;  4R55 A;  1YHQ T;  1YFN A;  5GAN 4;  2QA4 T;  4LUD A;  1BI1 A;  3LGL A;  1UGR B;  2JS2 A;  3LH0 A;  1VQ9 Q;  4FSS A;  5HY6 A;  3EHR A;  3RER A;  2K7A A;  4YTL A;  4M7A F;  2V8J A;  2ZCF B;  4N0A A;  1RAH B;  2BKD N;  1UUE A;  2RF0 A;  4C8Q F;  3GP8 A;  4JPB W;  5I11 A;  1I1J A;  3JB9 G;  4QT7 A;  2YHT A;  2JN0 A;  2ROL A;  1I4K 1;  3CCQ T;  4A4K A;  3CCJ T;  1LJO A;  2DTH A;  4EMK B;  2MK5 A;  4OMQ A;  1NZ9 A;  1KD1 C;  1QVP A;  2W0Z A;  3EAE A;  2C0I A;  1ZSZ C;  1KQS P;  2OTJ T;  2DL4 A;  4F04 B;  4E7Z A;  2DZC A;  3RKY A;  2EIF A;  2QTV A;  2F1L A;  5KH6 A;  1NBE B;  3LLR A;  3CC7 Q;  2LNV A;  2CP6 A;  1G3W A;  1VQ8 A;  1IGU A;  3L1A A;  1NLO C;  3TSZ A;  1H64 1;  1TSF A;  1M1K C;  1AOJ A;  2ESW A;  4PK4 A;  1YIJ Q;  1WA7 A;  2EYZ A;  2KY9 A;  1X75 C;  4K11 A;  4X1V A;  1JQQ A;  3QO3 A;  2HQX A;  2DE0 X;  5GAO q;  2LQK A;  4L5G A;  1VQK Q;  8AT1 B;  2CUB A;  3CCR T;  1D0Y A;  1S72 A;  2GQV A;  4M77 E;  4BY6 B;  4PJO D;  1BCM A;  2DZ9 A;  2K3B A;  2ZAE A;  2J05 A;  1FXX A;  4J6X A;  5IXB A;  1YIJ T;  5GMK j;  1R8O B;  2YUN A;  3SEM A;  1VQ4 A;  4HCB A;  4ZGD B;  2RH2 A;  1RL2 A;  2DEU A;  2NUT B;  2ZZD A;  5GAN 6;  3OW2 P;  2JOY A;  2OTL T;  5HK0 A;  2O88 A;  4O6J A;  5GJV B;  2O31 A;  3QYG B;  2MOX A;  2L8D A;  2KMT A;  2Y4Y A;  2ZGW A;  2DMO A;  4FM4 B;  3JCM c;  4FSX A;  2DFU A;  4M78 B;  4OVA A;  4XTX A;  2CZ1 B;  3EG0 A;  2EVR A;  3OSV A;  3ZL7 C;  3S3N A;  1IO6 A;  3G6E Q;  3EG3 A;  3FJ5 A;  2F5T X;  1YWO A;  2CDT A;  4F14 A;  4IIO A;  2QG9 B;  2KRM A;  2GFU A;  1VQ9 T;  2LJ1 A;  1WHG A;  1MMG A;  4A53 A;  3LH5 A;  3QKJ A;  1KHC A;  4KH0 B;  2PNI A;  1LOJ A;  3FB9 A;  3OYC A;  2DXU A;  2CSI A;  5FRO A;  3PTA A;  1OX8 A;  2P84 A;  1K1Z A;  1VQP T;  2LX7 A;  1IXD A;  3VS4 A;  1UB4 A;  1B3Q A;  2RQR A;  4R0K A;  1A0N B;  1G83 A;  3UPU A;  3UDC A;  1PRM C;  5FU6 C;  2CT3 A;  3RMS A;  4PKC C;  4OMM A;  3R6O A;  4JDS A;  3I55 A;  3CCM A;  2LMJ A;  1KC8 R;  3A8L B;  4IUU A;  1FMK A;  2EQI A;  3JB9 H;  5J39 A;  1UG1 A;  3V8L A;  2H3J A;  4MZP A;  1WZO A;  3OYK A;  1WYX A;  4HVU A;  2DTI A;  3CC2 Q;  2RJE A;  3CCE T;  2X35 A;  4RCC A;  2GTJ A;  2LCC A;  2R58 A;  1T3S A;  1KFZ A;  2GF7 A;  2E3H A;  2IPO B;  3OB9 A;  3VUB A;  1BCO A;  2LRQ A;  4AT1 B;  3T9N A;  1YJN Q;  5IH2 A;  5CKD A;  4M7D E;  1U3O A;  2HMA A;  2YRV A;  3EGU A;  3HPW A;  3EH2 A;  4BB7 A;  2KE9 A;  1Q82 R;  1E6G A;  2FHD A;  3CME Q;  2XD0 A;  5DM7 R;  4FYV B;  4HCK A;  4L59 A;  4DA4 A;  3VS0 A;  1CSK A;  2HSE B;  2KXD A;  3X20 B;  5J3B A;  1M2O A;  2RB6 A;  4LN2 A;  2DD5 A;  2ZPI B;  5EG2 A;  4NOY A;  2QYZ A;  3L2R A;  3CCS T;  4M78 E;  1YIJ A;  2MWO A;  2E64 A;  4C92 F;  3ULR B;  1U8R A;  4BD3 A;  2QA4 A;  2QQA A;  2JNG A;  3LWH A;  5GAN 3;  3CPF A;  5FU6 B;  1W70 A;  2M51 A;  4XTZ A;  1VQ5 T;  2JMA A;  1X01 A;  1SEM A;  2EKH A;  3EG2 A;  4EDU A;  3M0T A;  4HA8 A;  1D1C A;  4ME7 A;  5LJ5 h;  4RMO A;  4JJD A;  2ZPF B;  3JCM P;  3X26 B;  1SSF A;  5GAO m;  4J9E A;  1K73 C;  1R77 A;  4PNO A;  3G4S Q;  1PSF A;  4RCB A;  3M4Y A;  3OYG A;  4PFO A;  4JRK A;  5DY9 A;  5GAN f;  1V29 B;  1N8R U;  1JU5 C;  3OSS C;  3SWN A;  1KC8 U;  1PG5 B;  4MDX A;  4P5N A;  4F7U F;  2HQE A;  1NE8 A;  1C0M A;  4O5V A;  1UHF A;  4OGC A;  1IB8 A;  1VQ7 T;  4M78 G;  2JM8 A;  1V1C A;  1WXU A;  2J7I A;  3OQ5 A;  3VS6 A;  4M7A E;  2QK0 A;  1BI2 A;  1SHF A;  2PU9 B;  1PKS A;  5FU7 C;  1H8K A;  1NPR A;  4DEY A;  2G3R A;  1T0J A;  1UGP B;  1WNL A;  5GAO n;  2X4X A;  3EGD A;  2DPP B;  3WVE B;  1SRL A;  3DLM A;  4J7I A;  3CCJ A;  2VV5 A;  1M8V A;  4RTW A;  3MP8 A;  2DEQ A;  2MCN A;  1XQH A;  2K5I A;  2X3W D;  3CCV Q;  4PL6 A;  3QSU A;  1NJI R;  2L2P A;  2XI9 A;  2RA2 A;  1MNE A;  2E5K A;  3SD4 A;  5KE2 A;  3SHW A;  1OYX A;  4JJC A;  2ROT A;  3CBP A;  3CD6 T;  1IRX A;  5GAO r;  3UWN A;  2VC8 A;  1M30 A;  3NTI A;  2AHJ B;  4FT2 A;  2M9U A;  4XU1 A;  2AK5 A;  3RDV A;  1M90 R;  2O4X B;  1N8R C;  1HSQ A;  2EJ9 A;  2VGM A;  2NUZ A;  4LD6 A;  3U23 A;  4PJO F;  4M75 G;  4AG1 C;  2JVV A;  4PJJ A;  4M75 B;  2CZ7 B;  4HCZ A;  4QVD A;  5A0L A;  3QZ9 B;  2K5F A;  5KE3 A;  3A8G B;  2EBP A;  3P8H A;  2M0Y A;  3INZ A;  1C1A A;  1ZBJ A;  2DXT A;  1N9R A;  2EQU A;  2FB7 A;  3NTH A;  3CCS A;  4RKU E;  2KNB B;  3HRS A;  1ZX6 A;  1VQ4 T;  1Q86 C;  2RHX A;  3I56 A;  2A7Y A;  1GCQ A;  2RQV A;  4C92 B;  1OPK A;  2FZG B;  2RI5 A;  2DVE A;  2DK3 A;  3NGP A;  1VQ9 A;  4Y91 A;  3GNF B;  3RMQ A;  3KFV A;  4A63 B;  2FVU A;  2QEX Q;  2FG0 A;  4C0D B;  1UGS B;  2YUP A;  2E6Z A;  1Q81 R;  1AD5 A;  2XG8 D;  5CK9 A;  2XDB A;  1R0B G;  4FL6 A;  1U5S A;  1IHV A;  1KC8 C;  1BK2 A;  1YN8 A;  1QW1 A;  3M9Q A;  2DO3 A;  2DA9 A;  4M77 D;  4PJO E;  1X2Q A;  2DER A;  4AFQ C;  3CC4 A;  3OS2 A;  2OAU A;  4FU6 A;  2K4Y A;  5FW9 A;  5HCK A;  1GCQ C;  1OU9 A;  4MDW A;  1EX4 A;  1VQP Q;  4M77 B;  1YIT Q;  4HT8 A;  2DYI A;  1U1T A;  4FW1 A;  2QAZ A;  4M7D F;  4EPC A;  5AYF A;  2LDM A;  4FIB A;  2YRC A;  3EFS A;  5A2Q E;  3CCE A;  4M4Z A;  1MHN A;  2RJF A;  2LQW A;  4NS5 A;  2KVQ G;  1OQK A;  1GCP A;  1LVK A;  1G2B A;  2F2X A;  4RG8 A;  5L23 A;  4CC2 A;  1BBZ A;  2XHC A;  2A37 A;  3CCM T;  3C0C A;  3OYE A;  2LQN A;  1B07 A;  3QG1 A;  1PC0 A;  1BI3 A;  2RK1 A;  1Y0M A;  3CCS Q;  1K73 U;  4XTY A;  2KT8 A;  1B34 A;  2MYS A;  3CD6 A;  3OYF A;  5CQY A;  3JAM E;  2CP7 A;  4DBQ A;  4FYX B;  1I0C A;  1ZSZ B;  2E12 A;  2K9G A;  3PMI A;  4C8Q D;  3CME T;  4ZTJ A;  3OS0 A;  1PSE A;  1WJR A;  4J83 A;  2VVK A;  2QQS A;  3CEY A;  2BZY A;  5CKB A;  3RKW A;  1D3B B;  3SWN B;  3JCM e;  1VQ6 T;  3JCM X;  3KXT A;  4OGE A;  2ZPE B;  4PJN A;  3BFM A;  3OYD A;  4M78 A;  2MAM A;  3V7C A;  2RHU A;  3PIP A;  3CC2 T;  3FEO A;  3JCM Q;  3PMT A;  4N4I A;  1VQL Q;  2AZS A;  4M77 G;  2HBP A;  2ZPB B;  4GLK A;  1VQO Q;  3CC4 Q;  3VRZ A;  1RAG B;  5CO7 A;  2LT4 A;  5J26 A;  1P92 A;  1MMN A;  3GF5 A;  2LP5 A;  3CPW S;  2HKN A;  1MV0 B;  3MEV A;  3QJ6 A;  1VQ5 A;  1TWB A;  3PE0 A;  2V8K A;  5CAI A;  2J6O A;  1D0X A;  1YCS B;  4RTX A;  2COW A;  2HDA A;  4C8Q E;  2GQI A;  2A28 A;  2BE9 B;  2KI7 A;  2HD0 A;  4KUL A;  1ZLM A;  2X51 A;  3QBY A;  1K9M R;  1ABQ A;  3GPL A;  2EPD A;  2WSF E;  2EYX A;  4L6V 5;  1YWP A;  5FU7 B;  4GLM A;  4B6M A;  2CH4 W;  2M02 A;  1JXO A;  3CCQ Q;  1NYG A;  2KGT A;  1QCO A;  1Q7Y C;  3CC4 T;  3FIF A;  4DBF A;  3HL8 A;  1MMD A;  2D8H A;  4A4E A;  1C6V X;  2QGF B;  1Q86 U;  1MUZ A;  4D8K A;  1EZZ B;  1QVF A;  4LDY A;  2OJ2 A;  1ZBX A;  1UEB A;  3CXC P;  1WQ7 A;  3M4G A;  2BUD A;  1G3T A;  1BIA A;  4Y92 A;  4E2F B;  4JRP A;  1PHT A;  2F2W A;  2MF2 A;  1YHQ Q;  4FYW B;  1AWO A;  2HEQ A;  5CQX A;  1KHI A;  2CS7 A;  1VQM T;  4EIK A;  2E41 A;  2K57 A;  4IUV A;  4X9D A;  5LJ3 d;  1UGV A;  1UFF A;  1XJW B;  1AEY A;  1HYO A;  3REB B;  2RQW A;  3CXC A;  3E9G A;  2M0O A;  4OP0 A;  2XU8 A;  3TCJ A;  3OYB A;  3M59 A;  1YJ9 A;  2X4Y A;  1PM3 A;  1CKA A;  4Z02 A;  4B9X A;  1VQK T;  3H8Z A;  4M75 C;  4WCI A;  4DBH A;  1TUD A;  2R5M A;  4M7D G;  2Y4X A;  3G71 T;  1Q86 R;  2NWM A;  4C5E A;  3V7R A;  1VQ6 A;  1EIF A;  3A5Z B;  2MWP A;  4M7A B;  3EGX B;  5IAY A;  4OML A;  2KSS A;  2RJC A;  1QKX A;  1GRI A;  3PGG A;  1QCN A;  5IN1 A;  4JRQ A;  2CZ6 B;  3H6Z A;  3P8B B;  1VQ8 Q;  2DRM A;  2FYK A;  3O5Z A;  3M0U A;  3HRT A;  2ZPH B;  2RHZ A;  3OYH A;  3I5S A;  3M5A A;  4JJB A;  4CRI A;  5IT9 E;  5L8R E;  1WFW A;  3OMC A;  1ZSZ A;  5C6S A;  5GAN 2;  2MI6 A;  1H92 A;  3UA6 A;  2DM1 A;  2VAS A;  4WF2 A;  3EFR A;  4IUT A;  2FZK B;  4GY5 A;  3OYJ A;  3CCJ Q;  2LQ8 A;  4F7U A;  4UC4 A;  2COZ A;  3VJP A;  1M9S A;  2VGN A;  2KQW A;  3MPU B;  3PVL A;  3G4S A;  4F17 A;  3OYA A;  4JLG A;  1WQW A;  3QWX X;  1W6X A;  1LPL A;  2IIM A;  5GAN j;  2P4R A;  1K8A U;  2AIR B;  4N0A C;  2CKK A;  1Y71 A;  1W1F A;  3JCM W;  3EG1 A;  3G7Z A;  3THK A;  1NPP A;  5I22 A;  2EYQ A;  3BDL A;  2LCS A;  5GAN 7;  3C94 A;  1AHJ B;  2QA4 Q;  1KQS S;  3MKD A;  1NYF A;  1N5Z A;  5GAO p;  2EGE A;  3JCM V;  3O8V A;  4E7K A;  1RAC B;  4M7D A;  2A36 A;  1IHW A;  1PRL C;  3CBO A;  4QQ6 A;  3Q1J A;  3E19 A;  4J9I A;  1VA7 A;  2QEX A;  2RO0 A;  3I9Q A;  3OYN A;  2QDY B;  1I8F A;  3CCV A;  1GL5 A;  4HVW A;  2JW4 A;  5D6Y A;  2FRW A;  4IUP A;  4MML A;  3HRU A;  2HAX A;  2CZ0 B;  2EKO A;  3JCM f;  3C12 A;  3CCR A;  1VQM A;  4RG2 A;  1S72 T;  3CCL Q;  4Z8A A;  4J9B A;  2VB6 A;  3VYH B;  2DTO A;  3CD6 Q;  2DD4 A;  3DB4 A;  3JB9 J;  1Y96 A;  5KYW B;  1YP5 A;  4R56 A;  2IG0 A;  2A08 A;  2PZ1 A;  3IQL A;  5KCH A;  1VQM Q;  1NLP C;  4QQD A;  2O01 E;  3CME A;  4M7D B;  1OX9 A;  1E6H A;  4D6W A;  4LD9 K;  2LNH B;  2D0Q B;  4II1 A;  1K76 A;  2XK0 A;  4QQG A;  4F7U E;  4MZT A;  5LL6 S;  3GBQ A;  3ZEH A;  1KQS A;  1OZ3 A;  3G6E A;  2JS0 A;  3N5B B;  3JB9 I;  2YUO A;  4C8Q A;  1M3B A;  1YIT A;  2DF6 A;  4A4F A;  3RNJ A;  5GAM g;  3OYI A;  2OAW A;  1Q7Y R;  4EMK A;  2KR3 A;  1X6G A;  1M27 C;  1Q95 G;  2BE7 D;  4LDX A;  4JZ4 A;  3QJY A;  5LJ3 j;  2EJF A;  3VU3 C;  2DYB A;  2HBW A;  1K9M C;  2D6F A;  2I0N A;  4BDY A;  4XQ3 A;  1LCK A;  3OS1 A;  3EFO A;  4FCY A;  4C92 D;  2O9V A;  4M7A A;  3L2W A;  1VYV A;  1BI0 A;  1YJW T;  4KH1 B;  1H3Z A;  1QVG P;  1NG2 A;  3LW5 E;  4CC4 B;  4E6R A;  2L3S A;  4M75 D;  2C06 A;  2DL8 A;  1DJ7 B;  1QQJ A;  2BZX A;  1M1G A;  4IUQ A;  2M1H A;  4KRT A;  3JRZ A;  4BY6 C;  1FWZ A;  3MCA B;  1VQO T;  4J8O A;  1PWT A;  2IVW A;  4C0D C;  4FW2 A;  2DL3 A;  2DJZ A;  4C0G A;  1WXB A;  5DLQ E;  3H0F A;  5KYU A;  1YJ9 T;  2K3Y A;  2BZ8 A;  4ATO A;  4KUD K;  1M4Z A;  3HKS A;  3NMZ C;  1VQ6 Q;  2HQH A;  1Y96 B;  1U06 A;  1QKW A;  3V7S A;  3VS2 A;  5KYU B;  2R5A A;  1Q82 U;  2FPF A;  2ABL A;  1G3S A;  1OI1 A;  5DLO A;  2DBM A;  3CCV T;  1HK9 A;  2O4X A;  1TH7 A;  4XTU A;  1S72 Q;  2K5L A;  2HKQ B;  3TSW A;  5IHI A;  1OPL A;  2RPN A;  1MMA A;  2E6N A;  1RI0 A;  4C5H A;  4AFS C;  1OUL A;  2OI3 A;  3CCU Q;  2K2V A;  2E3I A;  3QUI A;  5KYN A;  1I5O B;  2KYM A;  2CYZ B;  2KBT A;  3UAT A;  2FL7 A;  4J7F A;  1UJY A;  2DIQ A;  3G71 A;  3VKI A;  4XK8 E;  2CP3 A;  2B86 A;  3M55 A;  5CKH A;  3AT1 B;  3OYL A;  1VIF A;  4QKU A;  3G4S T;  4ORZ A;  3A8H B;  2DNU A;  1GFD A;  3J80 E;  4CI0 C;  4E7L A;  3VRY A;  2K79 A;  1N8R R;  1YIT T;  5GAN 8;  3MP1 A;  2RI2 A;  4DOW A;  1J3T A;  2RQU A;  1UTI A;  2E10 A;  3E2U A;  2EGA A;  1JJ2 S;  5KYY A;  5CR2 A;  1YI2 Q;  1TUC A;  1VQ5 Q;  4AMC A;  4QW2 A;  1JB0 E;  1QVG S;  2LX9 A;  5FLX E;  4OMP A;  4EMK C;  1K0X A;  1UE9 A;  4KT0 E;  4C8Q C;  2DXB A;  2MIO A;  4OMF B;  1VQ7 A;  3RR6 A;  2CRE A;  2F5K A;  3F70 A;  5GMK h;  2DL5 A;  2A0F B;  1PKT A;  2X9H A;  1ABO A;  4Y28 E;  5LJ5 j;  2QEX T;  2KYB A;  1R0C B;  4RUG A;  1TTH B;  2VKN A;  4BI8 B;  2OTL Q;  1KQ2 A;  1TG0 A;  4M77 F;  1GBR A;  4NL3 A;  1N9S A;  3L2Z A;  3HP9 A;  2NLU A;  2WSE E;  3LX7 A;  2QDL A;  2EQJ A;  2JUF A;  3OW2 A;  4PJL A;  1M1K U;  1FMV A;  4M7A D;  1B7T A;  2H3E B;  3JV3 A;  2KK4 A;  1UEC A;  3PFS A;  2L89 A;  1UJ0 A;  1QLY A;  4PJM A;  5CKE A;  4RTY A;  1I07 A;  1CKB A;  4AFZ C;  2AKK A;  2DX1 A;  2EYW A;  3EHQ A;  3BW1 A;  3OA6 A;  3R6N A;  3CCR Q;  1V76 A;  1W2B S;  5LJ3 g;  4J6Y A;  2YWW A;  3M0P A;  2DIL A;  1KD1 U;  2SRC A;  3CPW A;  2ZPG B;  1B34 B;  3QDR B;  5LJ3 h;  1OU8 A;  4HVV A;  2EWN A;  4OB0 B;  3CQT A;  5GMK m;  3OYY A;  2CP2 A;  4ZGE B;  9ATC B;  4LE9 A;  4ZN3 A;  1YJW Q;  2RJD A;  4M78 D;  4OF1 A;  3FRN A;  3GLX A;  4X34 A;  1T3L A;  2DET A;  1QP3 A;  3BE3 A;  3UT1 A;  4LDW A;  5LJ5 e;  2P0K A;  3A98 A;  2ATC B;  2D8J A;  2YLB A;  3VS1 A;  2E70 A;  1AWJ A;  2YT6 A;  4E7I A;  4Z88 A;  4PJO B;  2F2V A;  3HFN A;  3WXM B;  5LJ3 f;  1QP2 A;  2LC4 A;  3G6E T;  2DLP A;  2LT1 A;  5FWC A;  2JTE A;  4ZNX A;  1YJW A;  1D0Z A;  3SB2 A;  2RM4 A;  2P0Q A;  2V1Q A;  3GOX A;  3I55 Q;  2OTJ A;  1AZE A;  5C0M A;  4ZGJ B;  5A0G A;  4OMO A;  1JO8 A;  4C0F A;  1ZUK A;  1ZHI A;  2DIG A;  4C92 G;  5HKC A;  4C92 A;  2KEA A;  3SFM A;  3M54 A;  3SWN C;  4FYY B;  1WHK A;  4ANJ A;  2CUD A;  1M3A A;  4JUV A;  4A54 A;  3FJP A;  4KBM B;  4HT9 A;  3UF4 A;  2M16 A;  4J9H A;  1RI9 A;  3H41 A;  3MO8 A;  2ED1 A;  3VS3 A;  2LCL A;  5GJW B;  1X69 A;  1D1A A;  2F69 A;  2HNI A;  2QI2 A;  3HTR A;  5GMK i;  1K0S A;  3J7A F;  4M75 A;  1QCF A;  1VQL T;  2PTK A;  3CXC S;  3HSB A;  2LJ3 A;  2L3Q A;  4C8Q G;  2YXY A;  1IZ6 A;  4E7J A;  1GBQ A;  1JEG A;  1VYT A;  3JB9 F;  3A8M B;  2CP0 A;  5FRM A;  1VQN A;  3OBY A;  5KCO A;  4M78 F;  1NJI U;  5FWB A;  2LVM A;  3VV0 A;  2XIC A;  4BE2 A;  1XOV A;  4X9C A;  1Q82 C;  1X6B A;  2BIV A;  2OTL A;  3OW2 S;  3M57 A;  1ZSG A;  3OYM A;  5GAM e;  2ENM A;  1VYU A;  4ELZ C;  4ESR A;  1YJN T;  1SSH A;  1KQ1 A;  2WSC E; 
#chains in the Genus database with same CATH homology
 1NPR A;  4C92 C;  3OYN A;  1G5V A;  2G3R A;  4M7A C;  1UGP B;  1I8F A;  1WNL A;  2QDY B;  2X4X A;  5GAO n;  3CCV A;  1VQP A;  3GNG A;  2DPP B;  3WVE B;  3CCQ A;  3DLM A;  4J7I A;  3RUX A;  3CCJ A;  2VV5 A;  5D6Y A;  1M8V A;  3MP6 A;  4IUP A;  3MP8 A;  2DEQ A;  3HRU A;  4MML A;  2CZ0 B;  2HAX A;  1XQH A;  2EKO A;  2K5I A;  4IUR A;  2RD1 A;  4PL6 A;  3JCM f;  3FC3 A;  3V8K A;  3QSU A;  5LJ5 d;  3C12 A;  3CCR A;  1VQM A;  2EQM A;  4RG2 A;  1S72 T;  1XTD A;  2XI9 A;  2RA2 A;  4OB3 B;  2PUK B;  4EMH A;  3VYH B;  3SD4 A;  3NTK A;  2DTO A;  3JCM J;  2DD4 A;  5KE2 A;  3FLG A;  5D6W A;  3DB4 A;  4JLI A;  3JB9 J;  1Y96 A;  1O75 A;  1OYX A;  4R56 A;  2IG0 A;  2JTM A;  1YI2 T;  3QHS A;  3CBP A;  3CD6 T;  5KCH A;  5GAO r;  1QVG A;  4HCC A;  3UWN A;  5I2S A;  2EJG A;  1Q7Y U;  3CMA T;  2VC8 A;  3NTI A;  2AHJ B;  4JS4 A;  4QQD A;  1BKB A;  4FT2 A;  3URG A;  2X4J A;  2E65 A;  1W4S A;  2M9U A;  2O01 E;  4XU1 A;  3RKX A;  3CME A;  4M7D B;  2QQ9 A;  2O4X B;  4D6W A;  2L3R A;  4LD9 K;  3MEA A;  4C5G A;  5LJ5 g;  1N8R C;  2EJ9 A;  2D0Q B;  4BE1 A;  1JRI A;  2GFA A;  2L5Q A;  4BI3 A;  4II1 A;  2XK0 A;  4QQG A;  2VGM A;  4LD6 A;  1D3B A;  4MZT A;  4PJO F;  4F7U E;  3QPH A;  3HHT B;  5LL6 S;  1M5Q 1;  3FDR A;  4M75 G;  4DOV A;  1K9M U;  2JVV A;  3MET A;  3ZEH A;  4E47 A;  1KQS A;  1OZ3 A;  4PJO G;  3G6E A;  4M75 B;  4M75 F;  2CZ7 B;  4M75 E;  3N5B B;  5GAM h;  4HCZ A;  4J5Y A;  4QVD A;  3JB9 I;  3QII A;  5A0L A;  3ZBD A;  1LNX A;  2VYT A;  1WJQ A;  4C8Q A;  1QVF S;  3QZ9 B;  1BIB A;  1N6A A;  1YIT A;  4C5I A;  4A4F A;  5M9O A;  2K5F A;  5KE3 A;  4JS5 A;  3S3O A;  4JJN K;  5GAM g;  4PLL A;  2QXF A;  3I55 T;  3A8G B;  3OYI A;  2XID A;  2P0P A;  3J81 E;  3BDU A;  3P8H A;  3INZ A;  3S6W A;  4EMK A;  2DXT A;  3QYH B;  1N9R A;  2EQU A;  5GMK l;  2FB7 A;  2K3X A;  3NTH A;  3BY7 A;  3CCS A;  4RKU E;  1MGQ A;  1UGQ B;  1M90 U;  4NL2 A;  4LDX A;  3HRS A;  4ELY C;  1VQ4 T;  1Q86 C;  2RHX A;  3QJY A;  3OY9 A;  3I56 A;  4VUB A;  5LJ3 j;  3KBG A;  2A7Y A;  1JBM A;  2EJF A;  4C92 B;  3TRE A;  3PT9 A;  3VU3 C;  2RI5 A;  2DAQ A;  4IKF A;  4M78 C;  2DVE A;  3QXE B;  4FT4 A;  1K9M C;  2DK3 A;  2D6F A;  4BDY A;  1VQ9 A;  4Y91 A;  4XQ3 A;  3OS1 A;  4OB2 B;  3GNF B;  5CIU A;  3RMQ A;  2FVU A;  4XU2 A;  2E1H A;  4C0D B;  4M7A G;  4C92 D;  2I2L A;  3KUF A;  4M7A A;  1UGS B;  2EQK A;  2Y90 A;  3E1S A;  1BI0 A;  3L2W A;  1NJI C;  1Q81 C;  2E6Z A;  1YJW T;  3GIB A;  4DQ2 A;  1H3Z A;  2XG8 D;  5CK9 A;  3LW5 E;  2XDD A;  4FL6 A;  3V8J A;  2XDB A;  1K8A C;  3C95 A;  1KC8 C;  1OZ2 A;  3JCM b;  3C4S A;  3WVD B;  4M75 D;  4BI4 A;  2C06 A;  3ME9 A;  1QW1 A;  1DJ7 B;  2DO3 A;  3M9Q A;  3CCU A;  2X4W A;  3CCL A;  4M77 D;  4PJO E;  1M1G A;  4IUQ A;  4J6W A;  2DKG A;  2M1H A;  2JZ2 A;  5CKF A;  3OMG A;  2VXF A;  1WJS A;  1FWZ A;  3JRZ A;  4BY6 C;  3MCA B;  1VQO T;  3CC4 A;  4J8O A;  3OS2 A;  4ZTF A;  2JTF A;  2OAU A;  2K4Y A;  4FU6 A;  4XU3 A;  2IVW A;  4C0D C;  4R55 A;  1YHQ T;  5GAN 4;  2QA4 T;  2DJZ A;  1BI1 A;  3LGL A;  1UGR B;  4MDW A;  4C0G A;  1VUB A;  3LH0 A;  2VXE A;  1XNI A;  3TEE A;  3X25 B;  5HY6 A;  4M77 B;  5DLQ E;  3RER A;  4YTL A;  1M1K C;  4HT8 A;  4M7A F;  1U1T A;  2V8J A;  2ZCF B;  4XU0 A;  1YJ9 T;  4N0A A;  4M7D F;  2K3Y A;  3X24 B;  3E9F A;  4EPC A;  2BKD N;  2PUO B;  4KUD K;  5AYF A;  2B8A A;  1M1F A;  1M4Z A;  2LDM A;  3HKS A;  4FIB A;  4C8Q F;  3GP8 A;  3EFS A;  5A2Q E;  3CCE A;  3JB9 G;  1VQK A;  1Y96 B;  2RO0 A;  3V7S A;  1MHN A;  2RJF A;  2R5A A;  1Q82 U;  3ZFJ A;  2YLC A;  4NS5 A;  1G3S A;  1OI1 A;  2KVQ G;  2YHT A;  2JN0 A;  5DLO A;  3CCV T;  1I4K 1;  3M53 A;  3CCQ T;  4A4K A;  4RG8 A;  3DLL A;  3CCJ T;  1LJO A;  2DTH A;  4EMK B;  1HK9 A;  2O4X A;  3JCM d;  3CC7 T;  1NZ9 A;  1TH7 A;  2XHC A;  3VYG A;  4XTU A;  3L2Q A;  1KD1 C;  1QVP A;  3CCM T;  3EAE A;  2K5L A;  3OYE A;  2E6N A;  2OTJ T;  5GAM d;  1RI0 A;  3QG1 A;  4C5H A;  1BI3 A;  2RK1 A;  3HFO A;  1K73 U;  2DZC A;  4XTY A;  3RKY A;  2EIF A;  1B34 A;  3CD6 A;  3OYF A;  2K2V A;  3VUZ A;  5KH6 A;  3LLR A;  5CQY A;  2LNV A;  3QUI A;  3JAM E;  5GAM f;  1G3W A;  1VQ8 A;  3L1A A;  2CYZ B;  2E12 A;  3DKM A;  1I81 A;  3PMI A;  1H64 1;  4C8Q D;  3CME T;  2FL7 A;  4J7F A;  3OS0 A;  3M56 A;  4ZTJ A;  2A3L A;  1PSE A;  1WJR A;  2DIQ A;  4XTV A;  4J83 A;  2WAC A;  5LJ3 e;  2QQS A;  3G71 A;  2MMP A;  3CEY A;  3VKI A;  2EAY A;  4XK8 E;  5CKB A;  4C92 E;  3RKW A;  1D3B B;  2KY9 A;  1X75 C;  3MHX A;  3SDZ A;  3SWN B;  3M55 A;  3JCM e;  1VQ6 T;  5CKH A;  3LYI A;  3OYL A;  1VIF A;  3QO3 A;  5CVI A;  4QVC A;  3JCM X;  3KXT A;  2HQX A;  1WGS A;  2ZPE B;  4OGE A;  3OYD A;  3A8H B;  3BFM A;  5GAO q;  3G4S T;  4XTW A;  4M78 A;  2PVD B;  3RIR A;  2LQK A;  2MAM A;  2RHU A;  4L5G A;  3V7C A;  4CI0 C;  3J80 E;  4BAC A;  4E7L A;  3CCR T;  3PIP A;  1KG1 A;  1S72 A;  3CC2 T;  3FEO A;  3JCM Q;  1YIT T;  3PMT A;  2GQV A;  4M77 E;  4BY6 B;  4PJO D;  5GAN 8;  3MP1 A;  2DZ9 A;  3RES A;  4N4I A;  2RI2 A;  4DOW A;  1FXX A;  4J6X A;  2E10 A;  4M77 G;  2HBP A;  2ZPB B;  4GLK A;  4M77 A;  1YIJ T;  5GMK j;  1JJ2 S;  1R8O B;  5CO7 A;  3LGF A;  5CR2 A;  2LT4 A;  4M7D D;  5J26 A;  1FX7 A;  1P92 A;  5GAN e;  1I5L A;  2KAF A;  3GF5 A;  3JSC A;  4QW2 A;  1JB0 E;  1QVG S;  1ZQ1 A;  2PVO B;  2LX9 A;  3A8O B;  3CPW S;  5FLX E;  1VQ4 A;  1VQN T;  4HCB A;  4EMK C;  3P8D A;  4ZGD B;  4KT0 E;  4C8Q C;  2DXB A;  3MEV A;  3CBM A;  2RH2 A;  3QJ6 A;  1W2B A;  1VQ5 A;  2V8K A;  4OMF B;  1RL2 A;  5CAI A;  1VQ7 A;  4E7H A;  2GCX A;  4MMK A;  5GAN 6;  2ZZD A;  2F5K A;  3F70 A;  2JOY A;  3PNW C;  5GMK h;  2OTL T;  5HK0 A;  4O6J A;  4C8Q E;  4Y28 E;  4ZN1 A;  5LJ5 j;  2QEX T;  1YJN A;  5GMK e;  3QYG B;  3M58 A;  2HD0 A;  2L8D A;  3QBY A;  4KUL A;  4BI8 B;  2KMT A;  2Y4Y A;  2VUB A;  1KQ2 A;  3L42 A;  3GPL A;  4M77 F;  2ZGW A;  4FM4 B;  3L2U A;  2WSF E;  1N9S A;  4NL3 A;  3JCM c;  4FSX A;  4M78 B;  4OVA A;  4XTX A;  3ASK A;  2CZ1 B;  4L6V 5;  1VQL A;  5FU7 B;  3L2Z A;  3HP9 A;  3OSV A;  3S3N A;  2NLU A;  1U1S A;  2WSE E;  3LX7 A;  4LDU A;  2R57 A;  2EQJ A;  2JUF A;  3OW2 A;  2F5T X;  1M1K U;  2V8I A;  4M7A D;  5D6X A;  1Q7Y C;  3CC4 T;  3I56 T;  2KK4 A;  3FIF A;  3HL8 A;  3PFS A;  4N4H A;  1HXD A;  2GFU A;  2L89 A;  4A4E A;  5CKE A;  2EFI A;  1Q86 U;  1VQ9 T;  4XAX B;  4BDZ A;  2PVG B;  2P4T A;  3BW1 A;  1QVF A;  4LDY A;  3OA6 A;  1ZBX A;  4A53 A;  4A4H A;  1UEB A;  3QKJ A;  3JB9 D;  1KHC A;  1W2B S;  4OB1 B;  1WQ7 A;  5LJ3 g;  3QZ5 B;  2QQB A;  4J6Y A;  3JCM h;  1LOJ A;  3FB9 A;  1X6O A;  3M4G A;  2BUD A;  1G3T A;  3OYC A;  1KD1 U;  1BIA A;  4JRP A;  2DXU A;  3CPW A;  5FRO A;  3PTA A;  4F7U B;  1VQP T;  2ZPG B;  1B34 B;  3QDR B;  5LJ3 h;  3ER0 A;  3JCM g;  2MF2 A;  2E5Q A;  2EWN A;  1UB4 A;  4OB0 B;  5GMK m;  3OYY A;  5CQX A;  4ZGE B;  4ZN3 A;  4PJO C;  1KHI A;  2CS7 A;  2RJD A;  3UDC A;  3UPU A;  1VQM T;  5FU6 C;  3RMS A;  2E41 A;  2K57 A;  4IUV A;  4M78 D;  4X9D A;  4KUI A;  4OF1 A;  4PKC C;  5LJ3 d;  3R6O A;  3FRN A;  3GLX A;  4JDS A;  4X34 A;  3I55 A;  4MZM A;  5GAN 5;  1QP3 A;  3CCM A;  1YHQ A;  3UT1 A;  4LDW A;  5LJ5 e;  3PIO A;  3LWI A;  3A8L B;  4IUU A;  2RI3 A;  1YI2 A;  5GAN h;  2P0K A;  4PLI A;  3JB9 H;  3CXC A;  3E9G A;  5J39 A;  2M0O A;  2YLB A;  4A4G A;  4OP0 A;  2XU8 A;  2H3J A;  3TCJ A;  3V8L A;  3M59 A;  4Q5W A;  3OYB A;  1YJ9 A;  4MZP A;  2XKO C;  5GAN g;  1IRE B;  2QTX A;  3OYK A;  2X4Y A;  2E70 A;  2DTI A;  2RJE A;  4Z02 A;  4B9X A;  3CCE T;  1VQ8 T;  4E7I A;  2X35 A;  4RCC A;  1VQK T;  3H8Z A;  5LJ5 f;  4M75 C;  4PJO B;  2LCC A;  3HFN A;  2R58 A;  3MEU A;  3WXM B;  2GF7 A;  5LJ3 f;  1QP2 A;  2R5M A;  3OB9 A;  3VUB A;  2LC4 A;  2Y4X A;  2LRQ A;  4M7D G;  3T9N A;  3G71 T;  4HKE A;  3G6E T;  5HK3 A;  2LT1 A;  5CKD A;  4M7D E;  3X28 B;  1VIE A;  4C5E A;  2YRV A;  3HPW A;  3V7R A;  1EIF A;  4BB7 A;  3A5Z B;  4BUG A;  1VQ6 A;  2MWP A;  5I2M A;  4M7A B;  1YJW A;  5IAY A;  5CCA A;  2KSS A;  2FHD A;  2PQW A;  2RJC A;  3PGG A;  5DM7 R;  4BE0 A;  2XD0 A;  5IN1 A;  3SB2 A;  4JRQ A;  2RM4 A;  4L59 A;  2CZ6 B;  3H6Z A;  3P8B B;  4DA4 A;  2P0Q A;  2DXC A;  3GOX A;  4PJO A;  2FYK A;  3CMA A;  3X20 B;  5J3B A;  5C0M A;  4ZGJ B;  5A0G A;  2OTJ A;  2RB6 A;  3HRT A;  2ZPH B;  2RHZ A;  4C0F A;  3OYH A;  2DD5 A;  1ZHI A;  3CCU T;  2RHI A;  2ZPI B;  3M5A A;  5EG2 A;  4CRI A;  2DIG A;  4NOY A;  4C92 G;  3L2R A;  4LDV A;  5HKC A;  3CCS T;  4M78 E;  4C92 A;  3L2V A;  3SFM A;  5IT9 E;  3M54 A;  5FRN A;  3SWN C;  5L8R E;  1YIJ A;  2MWO A;  3AHU A;  2E64 A;  4JRI A;  1Y07 A;  4C92 F;  1VQO A;  3OMC A;  5C6S A;  1U8R A;  4BD3 A;  5GAN 2;  2MI6 A;  2QQA A;  2JNG A;  4TVR A;  4JUV A;  4WF2 A;  2QA4 A;  3EFR A;  4IUT A;  3LWH A;  4EMG A;  4GY5 A;  5GAN 3;  5GAM j;  3OYJ A;  3CPF A;  1N27 A;  5FU6 B;  4A54 A;  4XTZ A;  1YBY A;  3FJP A;  4F7U G;  4KBM B;  2LQ8 A;  1VQ5 T;  1JJ2 A;  2M16 A;  4F7U A;  4HT9 A;  3TU4 K;  1YCY A;  1X01 A;  4UC4 A;  2RK2 A;  3VJP A;  1M9S A;  2RHY A;  4M77 C;  2VGN A;  2KQW A;  4V2S A;  3MO8 A;  4EDU A;  3NFC A;  5GAO l;  5LJ5 h;  4HA8 A;  4RMO A;  4ME7 A;  2LCL A;  4QVZ A;  2ZPF B;  3G4S A;  3JCM P;  2F69 A;  1SSF A;  3X26 B;  3OYA A;  2HNI A;  2LTO A;  1WQW A;  4JLG A;  2QI2 A;  4ATO A;  1G3Y A;  5GAO m;  3DB3 A;  3CC2 A;  1K73 C;  1GXI E;  4B9W A;  5GAN j;  1K8A U;  3OS5 A;  4PNO A;  5A0D A;  5GMK i;  1PSF A;  3CCL T;  4M75 A;  4RCB A;  4N0A C;  3M4Y A;  3J7A F;  2CKK A;  1Y71 A;  3OYG A;  5GAN f;  4JRK A;  5DY9 A;  3JCM W;  1V29 B;  3G7Z A;  1O9S A;  1Q81 U;  1VQL T;  2XDP A;  3CC7 A;  3CXC S;  1N8R U;  3HSB A;  1NPP A;  3OSS C;  2CGH A;  2EYQ A;  3BDL A;  3SWN A;  5GAN d;  5GAN 7;  4C8Q B;  3C94 A;  1AHJ B;  4C8Q G;  4E7J A;  1IZ6 A;  1WPY A;  1Y7X A;  4C0Z A;  1KC8 U;  4P5N A;  1KQS S;  4MDX A;  4F7U F;  3JB9 F;  2HQE A;  3A8M B;  5GAO p;  3S3M A;  5FRM A;  1NE8 A;  1VQN A;  3OBY A;  5KCO A;  4M78 F;  4O5V A;  2KDS A;  1NJI U;  3JCM V;  3O8V A;  4E7K A;  2LVM A;  3OBW A;  4OGC A;  3VV0 A;  2XIC A;  4M7D A;  4N4G A;  4BE2 A;  1XOV A;  4X9C A;  4M78 G;  1VQ7 T;  1Q82 C;  2BIV A;  3CBO A;  2OTL A;  3OQ5 A;  3OW2 S;  1M90 C;  3M57 A;  4QQ6 A;  4M7A E;  3OYM A;  3MEW A;  1BYM A;  5GAM e;  5I21 A;  2QQR A;  3Q1J A;  3E19 A;  1BI2 A;  4ELZ C;  2QEX A;  1YJN T;  2D9T A;  4M7D C;  2PU9 B;  1KQ1 A;  2WSC E;  5FU7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...