3JCMW

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
70
Chain Sequence
QPVNPKPFLKGLVNHRVGVKLKTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 7
structure length 70
sequence length 73
chains with identical sequence Z
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmW00
4J5YA 4M75G 5GAN6 3JB9D 4NL2A 4NOYA 4XTWA 4M77E 2Y90A 5GANd 4M7AA 4M7DG 4C8QE 3SWNB 1YCYA 4F7UF 5GAN5 5GAOr 1KQ2A 4C92B 3JCMQ 4PNOA 5LJ3f 5LJ3g 2VXEA 5GAMd 4A53A 4PJOC 4X9DA 4QVDA 2RD1A 4A54A 4HA8A 3QUIA 5GAOm 3M4GA 3INZA 4M77C 4N0AA 4XTYA 1WQWA 4M78G 4M75A 3V7RA 1KQ1A 4XTXA 5GAOp 1M8VA 3RIRA 4X9CA 5DY9A 2QTXA 4JRIA 4PJOF 4C92E 1M5Q1 3JCMJ 3BFMA 3EFRA 1BIAA 4C8QB 5LJ3j 4PJOD 5GMKl 3JCMf 3JCMg 4M77F 3AHUA 5LJ3e 4EMGA 4HT8A 5GAOl 4M77D 4XQ3A 2VXFA 4C8QD 4M78A 3SWNC 5LJ3h 4C92C 3RKXA 5GANg 5GANf 1B34A 1HXDA 2VC8A 4F7UA 3JCMW 2DKGA 2DTOA 2E10A 4DQ2A 4WF2A 5GAMf 5GAMg 2YHTA 3JB9G 3JCMP 4M75B 4XTUA 3RKWA 2RA2A 4C92F 3JCMe 4M7AE 1JRIA 4M7DB 1LOJA 1MGQA 4V2SA 1HK9A 4XU1A 4C92D 4C8QC 4EMKB 5GANj 3HSBA 4PJOA 3JCMh 3GIBA 2FYKA 4F7UG 1H641 5GANe 3QSUA 3JB9H 5LJ5d 5GAMj 3V8JA 1I81A 3BW1A 5GAMe 5GAN3 5GANh 4M75E 3V7CA 2DVEA 4M78B 1U1SA 5GAMh 3QO3A 4C8QF 3V8KA 4QVCA 5I21A 4M7DC 2YLBA 4M7DE 1N9RA 3L1AA 4RCCA 4M7AB 2E64A 3HFNA 2DZ9A 2ZGWA 4N0AC 4PJOG 3QHSA 4M75C 1LJOA 2DJZA 5GAN7 4XTVA 2E41A 3JB9I 3SWNA 4M77G 2I2LA 2RM4A 1WPYA 4JRKA 4M78E 2DXTA 4C8QG 4EMKC 5GAN2 4J6WA 5GAOq 4XU3A 2FB7A 5GMKh 2RB6A 4M75F 4J6YA 4JLIA 5LJ5g 5LJ5f 5GMKi 2DTIA 1I5LA 1Y96A 2E1HA 4M78C 4JUVA 4M75D 4M7DF 5CAIA 3EFSA 4M7DD 4M77A 1LNXA 2EWNA 4C8QA 3JCMc 3JCMX 4M7AC 4C92G 1WQ7A 3HFOA 1TH7A 1D3BA 4NL3A 2JN0A 1B34B 4F7UB 1I8FA 2E65A 1BIBA 3V7SA 4M78F 3PGGA 3V8LA 2HNIA 4MMLA 5LJ5j 3RKYA 4Y91A 4HT9A 4M78D 3JCMV 2EJGA 1JBMA 3FIFA 4OP0A 5LJ5e 5GMKm 3BDUA 4M7AF 3VU3C 2EJ9A 2CGHA 4M7AD 5GMKj 3RESA 3BY7A 4XTZA 5LJ3d 4C92A 5LJ5h 5GMKe 3SB2A 2DTHA 3JCMb 4F7UE 5GAOn 3RERA 3FB9A 1Y96B 5GAN8 4PJOB 4M7DA 1I4K1 1N9SA 3FJPA 1X01A 4EMKA 4M7AG 4J6XA 3RUXA 4M77B 4EMHA 5GAN4 4RCBA 2YLCA 4XU2A 2DEQA 3L2ZA 2EAYA 4MMKA 1D3BB 2DZCA 1WNLA 2DXUA 2K57A 2EJFA 4XU0A 3JB9F 1U1TA 3JB9J 3JCMd 4PJOE
chains in the Genus database with same CATH superfamily
3I55T 1KQ2A 3UT1A 4C92B 2NYSA 2DEUA 1U5SA 3INZA 2LT4A 3V7RA 2F1LA 2RI3A 2K3XA 4PJOF 3UDCA 3BFMA 1I07A 5EG2A 2QASA 2LDMA 2LMJA 4HVWA 1TU0B 4PLLA 3M57A 4KUIA 4PL6A 2OTLA 3PVQA 1YCSB 2CP2A 1Q86R 5KYUB 1U3OA 1PHTA 1GBQA 2JM8A 2DL7A 4HVVA 4GLMA 4LN2A 4C92D 4EMKB 3HSBA 4ME7A 5GANe 3FEOA 5IHNA 3MEVA 1ZLMA 3V8JA 1YIJT 2MYSA 5GANh 1AWXA 4LD6A 1QW1A 3CCJT 3CCRQ 2DRKA 2G6FX 2OX7A 4RG8A 5D7UA 1B07A 4HCCA 5GAN7 1M30A 4K11A 2ECZA 2KXDA 3OYFA 1UECA 4ZGDB 5FWBA 4QT7A 2FZKB 1G3WA 2CSQA 5DM7R 1UGPB 2DL4A 1YHQT 5LJ5g 2CP0A 1XTDA 2MAMA 3DB3A 3JCMc 4FM4B 2HBWA 1WQ7A 3HFOA 4C0FA 1B34B 5IHIA 3V7SA 4IUTA 2HNIA 2V1QA 5DLQE 3CPWA 1UHFA 1NZ9A 1YP5A 5GMKm 2CP6A 4FYXB 2B86A 4C92A 2M0YA 1M3AA 1WIEA 2D0QB 2YDLA 2A3LA 4HVUA 1OU9A 4M7AG 5FU7C 1SSFA 1YJWA 2OTLQ 1K9MC 1TWBA 3GPLA 2DZCA 2LJ1A 3PIPA 1KD1C 5CCAA 1WHLA 1H8KA 3VUBA 4EDUA 3GNFB 3VV0A 1D1BA 4FT2A 4PJOC 2GBQA 1N27A 4XTXA 2O88A 1O9SA 1PC0A 3JCMJ 5KCHA 3MCAB 3BE3A 3AHUA 1AEYA 3MP8A 2LQWA 2L5QA 4RTWA 2DTOA 5CO7A 2MIOA 2WACA 3M54A 3A8GB 1YWPA 1VQNA 3R6NA 2QQSA 4KULA 2X35A 3VS7A 1HJDA 4LDVA 1VQ5T 4XU1A 3HP9A 4IIMA 3I55Q 3NMZC 1T3LA 2HKQB 4MDWA 2B8AA 2L0AA 2MK5A 4OGEA 1CKBA 2GQVA 1RLQC 5GAOq 1V76A 2HL3A 4C5HA 4UC4A 1JXMA 1G5VA 2D9TA 2PQWA 4AFUC 2G3RA 3EHQA 4BE1A 1QVFA 1FYNA 4O5VA 3M0QA 3H0HA 2V26A 4OMNA 1PKSA 4BE0A 4KRTA 2QQBA 3QBYA 3UA7A 1RADB 3ULRB 5EC7A 1BU1A 1H92A 3FIFA 2DVJA 4WCIA 3UWNA 1GCQA 1YIJQ 5CKFA 4N4IA 3ZEHA 1QVFP 1WHJA 2DFUA 2FPDA 1JQQA 1X27A 1E7OA 4RCBA 1QVGA 2FHDA 2DYIA 5J26A 3CQTA 4HCKA 3JB9D 1VQNQ 1IHWA 1M1KR 4M7DG 1JB0E 4E7IA 3CCET 1YHQQ 3CCUA 1NJIC 3AT1B 4X9DA 1PKTA 1H3HA 3HPWA 1PD0A 1QVGP 1RAIB 1BI3A 1C1AA 1SRMA 2DBKA 3HRUA 1VOMA 1ZBJA 4JRIA 1RAAB 2KSSA 5HY6A 1AZGB 3E9GA 4KH1B 3G7ZA 2X4JA 3JCMg 4CC7A 2A37A 3M0SA 5CKDA 3SWNC 4R0KA 4C5GA 2XHCA 1QVPA 1S72A 4Y28E 2VC8A 1LPLA 1NPPA 2QGGA 7AT1B 5L8RE 1GBRA 3G6EA 3CMAA 4IUQA 3EAEA 2CP7A 2IG0A 4N4HA 3M0UA 1LOJA 5IHKA 1X6OA 1UEBA 2DJQA 5IN1A 4ANJA 5LJ5d 1QQJA 2K3BA 2MPXC 2KQWA 2M0OA 4C8QF 3CCVT 4N0AC 4QKUA 1G3YA 2LQ8A 4OB2B 3H0IA 3OA6A 2JW4A 2WSEE 2RB6A 2HAXA 4JUVA 3GP8A 4HCZA 4M7DF 5FU6B 1YITT 4C92G 2KEAA 2CH4W 1N8RC 1BIBA 1PG5B 2KYBA 1EZZB 3RKYA 5LJ5j 3MEWA 1VQ5Q 1VQ6T 3VU3C 3OYGA 4DOWA 5GMKj 1VQ9T 3KBGA 2LX7A 2LJ3A 3ME9A 4FYVB 1SPKA 3GLXA 1I4K1 4ZN1A 1X01A 3X28B 2BZ8A 2CT3A 2PZ1A 1SF9A 3G6EQ 2VASA 1WNLA 3CPFA 4ZTFA 2EYXA 3X26B 2D0NA 3OYCA 1VQ7A 1S1NA 1WA7A 5CIUA 5GAN5 3KXTA 2AZVA 2J6FA 1T0HA 1X2QA 4FT4A 2KRMA 4C0DC 4L5GA 2RQUA 3META 4HA8A 3OS2A 4AT1B 4XTYA 2JS2A 2K5IA 4MZPA 1K8AC 1LVKA 1ZA2B 1RAFB 3EFRA 1B3QA 2HD0A 3CCQT 1M27C 2E5KA 4HT8A 1YJNA 2ZPBB 4Q5WA 2ENMA 2EQJA 3CCVA 5KYYB 3RR6A 2BIVA 2DKGA 2KE9A 3A5ZB 1UG1A 3F70A 4WF2A 1TUDA 2KROA 1SG5A 3QKJA 1AWOA 2M9UA 3JCMP 1WHKA 1ZSGA 4CC4B 2FRWA 1NBEB 2RA2A 4C92F 2VUBA 5FRNA 4C8QC 2R57A 3ZL7C 2W0ZA 4OB0B 1GXIE 1H641 3H6ZA 2JTMA 2R5AA 4OB3B 3OYAA 4BDYA 2K79A 2JOYA 4TVRA 2K5FA 3UPUA 4M7AB 2QQAA 2ZGWA 4OMPA 4HKEA 4M7DC 3OW2S 4M78E 3EGDB 2E6NA 1VQ9A 4E7HA 2KT1A 5FRMA 4BI3A 4J7FA 1JJ2S 1K73C 4ZGJB 1VQLT 1G83A 1Y71A 4J83A 5GJVB 1TH7A 1KHCA 2LVMA 3L42A 4Y91A 2D1XA 2ZZDA 1IGQA 1RAGB 2DO3A 4NS5A 4OMQA 1IZ6A 2A36A 1QWEA 3OS1A 2RN8A 2GCXA 4C0GA 4FU6A 3CCVQ 3M56A 1D3BB 4AFSC 4XU0A 3LWHA 3JCMd 3EG9B 2COZA 2DIGA 1YJ9T 2CZ6B 5KYYA 3X25B 1M90C 3M4GA 1K1ZA 2L3QA 1YITQ 4ORZA 4Z02A 1Q81U 2QTXA 1IXDA 2EFIA 3M9QA 3OY9A 3TVTA 2O9SA 5D6WA 1Z9ZA 5CQYA 1VQ9Q 4C92C 2ATCB 1RABB 5KH6A 5LL6S 3BDLA 1OOTA 5GAMg 3RMSA 4ZN3A 2J06A 4JJBA 1Q82U 4JLGA 3JB9G 4RMOA 1X75C 3WXMB 1QCFA 3EGDA 3A8HB 2DM1A 1VUBA 2YUQA 2QQ9A 1ZHIA 2RH2A 3Q1JA 5GAN3 4M75E 2C0IA 4FW1A 1X6GA 1WJSA 4E7ZA 5IXFA 2YLBA 1G2BA 1RAHB 2GTOA 1D1AA 1LJOA 2VVKA 1R77A 1JO8A 2DXTA 4EMKC 1R0BG 5KE2A 5CR2A 5GMKh 2ED1A 2LNHB 3MEAA 4PK4A 5CAIA 3M53A 4MZMA 5C0MA 2EWNA 1D0YA 2X4WA 4J9CA 2DMOA 2HCKA 2E70A 3VYHB 1D3BA 2RQRA 2VYTA 1IREB 1EFNA 1GL5A 4J9GA 2DNUA 2LQKA 4DBQA 3EH1A 1KC8U 2DXCA 2CH4A 2O4XA 1Y96B 2X3WD 1I1JA 3CD6A 3RUXA 3VUZA 5GAN4 2GNCA 2FRYA 5HK3A 1MV0B 5CKHA 2EJFA 3JB9F 1OPKA 3OYEA 4GBQA 1UJ0A 3G71A 2RNAA 2JUFA 2DD4A 3OW2P 3PIOA 2CDTA 2VKNA 1LCKA 2F69A 1NEGA 2E3IA 1JJ2P 2GGRA 3VS2A 2F2VA 1K73R 1G3TA 5DY9A 2CUDA 5IH2A 3WVEB 1VQKT 1OX8A 3OSSC 2M02A 2ROLA 1WYXA 1QMCA 1C6VX 2CUBA 4BI4A 4GY5A 1GCQC 2JJ9A 4F7UA 1WHHA 2DPPB 2LTOA 2EQMA 2E6ZA 3OBYA 1U8RA 3EGXA 2HQHA 2HQXA 3MKDA 1E6GA 2V1RA 4C5IA 1WJQA 2KR3A 2DVEA 4M78B 3OYBA 4QVCA 1KK7A 1XQHA 2AKLA 2VGNA 3QHSA 3CD6Q 2RHYA 1VQOA 1Y0MA 1OEBA 2K6DA 1M90R 2JTEA 4JRKA 1SHFA 4MZTA 3VS5A 2EYWA 4O6JA 1FMKA 5FWCA 3G71Q 1Y96A 1K76A 5DLOA 1RACB 3T9NA 3QWYA 2KXCA 2VGMA 1M1FA 2YRDA 3LH0A 1VQPT 2MMPA 4M78D 1M1KC 2QEXT 4E7SA 4JJCA 3C94A 3MP6A 4AG1C 1ZBXA 2VB6A 3RERA 1DJ7B 2DL5A 2DLPA 4J6XA 2VWFA 1M3BA 4XU2A 1WLPB 3LYIA 3JB9J 2IPOB 3I55A 2K5LA 3OSVA 5GAMd 4PNOA 5LJ3g 2ZAEA 3OYKA 4OB1B 3QXEB 2JNGA 1QKXA 4D6WA 3HL8A 5FROA 3QWXX 3VS4A 2QA4T 3OB9A 1QP2A 2EQKA 4LUEA 2PUOB 1KJWA 2HDAA 4A63B 5GMKl 4LD9K 1VQOQ 4XQ3A 3VKIA 2RHZA 4M78A 2XDDA 3DKMA 3RKXA 4KT0E 3U23A 3JCMW 4EPCA 3E1SA 1GRIA 1UTIA 3CBPA 1ZX6A 4M75B 5J39A 4IKFA 3TSWA 1TUGB 1MGQA 4V2SA 3H9NA 1K4US 2X4XA 1XNIA 4ZTJA 1IGUA 1BKBA 1YNZA 5GAMj 3D7SB 1YIJA 1NYFA 1U1SA 3V8KA 1IB8A 3X20B 3CCJA 2M1HA 4A4EA 4KBMB 2FVUA 1ZQ1A 3NGPA 1NLPC 3JB9I 3C0CA 3M0RA 1M4ZA 2QXFA 1VQ4T 3ASKA 2RK2A 4FYYB 3M55A 1VQKQ 3OYDA 4JLIA 5LJ5f 3EG3A 4M75D 1YHQA 2KMTA 1G8XA 5KYXA 2JN0A 1AT1B 1D0ZA 1K8AU 4M7AF 3BDUA 2DX1A 2HEQA 2YWWA 2XU8A 1WHMA 1Z9QA 3VS6A 4OMLA 2EQIA 4RKUE 2X9HA 2DF6A 5FU6C 2QA4A 3C4SA 3ZBDA 1GFCA 3FJ5A 2FL7A 5CK9A 2PNIA 3QZ5B 4RTXA 3RMQA 4F14A 2DE0X 1RI0A 4M77E 3TQ7P 2QDYB 1MMNA 4LDXA 4Y92A 2CP3A 3OS5A 8ATCB 2K2MA 4M75A 3OYNA 4J9FA 3C95A 3L2QA 1CSKA 3CCJQ 1JU5C 3MO8A 1M5Q1 2RQTA 1UGSB 1Q7YU 1AWJA 5GANg 4BY6B 2JVVA 3DLLA 1I5OB 2KK4A 3M4YA 1I0CA 2YHTA 4FL6A 5IXBA 1OU8A 1IHVA 8AT1B 4WTOB 1AWWA 4XTUA 2AIRB 4PLIA 4C0ZA 1WXBA 5L23A 4AFZC 1VQ5A 2DD5A 3OQ5A 3MHXA 3V7CA 2OTJT 3CCMT 4KH0B 1T0JA 2LQNA 5KE3A 2F5KA 1Q81R 4DBHA 4JRQA 3ER0A 3R6OA 4R56A 4R55A 2QA4Q 3HHTB 2KY9A 3E19A 5HCKA 1AHJB 3EFOA 2K7AA 4J6WA 4ELYC 2YT6A 1AVZC 1WX6A 1I5LA 2W10A 3PE0A 1Q82R 1Q86U 4M7AC 1VIEA 3JV3A 3GNGA 1X43A 2EJGA 4OP0A 3DB4A 3NPFA 5LJ3d 3S3NA 4F7UE 1VQMT 3CBOA 1XOVA 2XKOC 1N6AA 4MMKA 1ZUYA 4RG2A 3C12A 3CC2T 1O75A 4NL2A 1C0MA 1HYOA 4C8QE 2DIQA 5GAOr 2BZYA 1F1BB 2RHXA 1X6BA 3CCEA 4KGVB 3VYGA 1YI2T 4M78G 4II1A 5GAOp 4AFQC 1PCXA 4QVZA 5M9OA 1BIAA 1KC8R 5LJ3j 3JCMf 2NUPB 3EG1A 3VRZA 1IO6A 2EYQA 3P8DA 3M59A 2DETA 1PD1A 4J9DA 2J05A 3QPHA 2FEIA 1RLPC 4PJOA 2O2OA 4AG2C 2ZPEB 1PSEA 3QO3A 4Z88A 1N9RA 4RCCA 2E64A 4DEXA 1WFWA 3L2WA 1SSHA 2WSCE 1AOJA 4VUBA 3LW5E 1Q95G 1QWFA 1VYVA 2AK5A 3KFVA 3OMGA 1W4SA 5I11A 5GMKi 2DAQA 2CZ0B 1YITA 1PM3A 3S3MA 1FX7A 2X51A 3UATA 3CCEQ 4NL3A 5I2SA 3CC2A 4M78F 4JS4A 2HL5C 1M9SA 1SRLA 4IIOA 1VQ8T 3SFMA 1VQ6A 3RESA 2L8DA 3P8BB 2HBPA 4F04B 1TTHB 1X69A 3JCMb 1MMDA 2OTJQ 3IQLA 4M77B 2LCLA 1HD3A 2NUZA 2F2XA 1OV3A 3SD4A 3PVLA 4LXCA 2RI2A 3CC4T 2NUPA 5GAN6 4M75G 3MP1A 4NOYA 2NUTB 1OQKA 5GANd 2RO0A 3JCMQ 2XG8D 4A54A 3OS0A 3RDVA 4E47A 1KQSS 2X3XD 2BTTA 1NE8A 1UDLA 3VRYA 3QYGB 4OMMA 2H3EB 3CCQA 4M77D 1KIKA 2VXFA 1M2OA 2F5TX 2A7YA 5A0LA 3I56T 3CC7T 4BACA 2O4XB 1NEBA 2A08A 2FZCB 1T3SA 2P4RA 2QG9B 3H8ZA 3SHWA 5GANj 5AYFA 2FYKA 3CC2Q 1H3ZA 3RNJA 1ACMB 1K9AA 2RHUA 1ZSZB 1VQ6Q 2FPFA 1KG1A 2DZ9A 2JS0A 4XTVA 2E41A 2PVOB 1G3SA 3SWNA 2V8KA 2IVWA 3QZ9B 3CMET 3JAME 4XU3A 2FB7A 4M75F 4N4GA 1OZ2A 1NG2A 4M78C 3H41A 4M77A 1VQLA 3TSZA 3OMCA 2HMAA 2QYZA 4F7UB 2X4YA 4HXJA 2V8JA 3SDZA 1BCOA 4HT9A 2NUTA 4RTVA 5LJ5e 1PRLC 3CCRT 2YUOA 4XTZA 1K9MU 5LJ5h 2KI7A 5GMKe 2ZPIB 3EGXB 1KD1U 2K4YA 1MUZA 3CCQQ 3ZFJA 1A0NB 3E9FA 4KUDK 2AZSA 1SKUB 1W2BS 4XTWA 2RPNA 2Y90A 4OMOA 4RTUA 3QYHB 1W70A 1YJ9A 2XDPA 3A8MB 3L2RA 4FSXA 3OW2A 3EH2A 3EHRA 4XK8E 3CCST 2LZ6B 3LGFA 4IUPA 1JJ2A 1PNJA 2FZGB 2O01E 1VQ8Q 4C8QD 2OTLT 3N5BB 1ZSZA 1GFDA 3CPWS 4X1VA 5GAMf 4D8KA 3CXCS 2LCSA 4IUUA 2C0OA 2DERA 1VQLQ 4BB7A 2KRNA 2MF2A 3I5RA 1KQSA 2Y4XA 3A1PA 2EGEA 3GIBA 1UGVA 2P0QA 3CC4Q 4PJLA 3QSUA 1I81A 2XIDA 2SEMA 2EGAA 2HSEB 4CRIA 2KYMA 1BI2A 2H8HA 3GOXA 4M75C 2LX9A 1TOVA 4F16A 1Q7YR 2OAUA 1KQSP 5GAN2 2KRSA 2YUNA 3EG0A 4CC2A 1NYGA 4KGXB 2CZ1B 4HCBA 4QQ6A 9ATCB 1OZ3A 3P8HA 4A4HA 2R58A 4M4ZA 4C8QA 1YJ9Q 1BBZA 4LNPA 4BD3A 3I56Q 3CC7Q 3NFCA 2QI2A 4ZNXA 4CC3A 1YFNA 2E65A 2SRCA 1KHIA 4MMLA 3JCMV 1D09B 1SEMA 2CGHA 3BY7A 3G1JA 1AZEA 4LUDA 3KUFA 2DTHA 2PVGB 4D8DA 4X34A 3CCSA 4M7DA 3FJPA 1YJWT 4PFOA 1MMAA 2YUPA 2O9VA 1NJIU 2K57A 4PJOE 1ARKA 3CMEQ 1MNEA 3VS3A 2CREA 2K9GA 2P4TA 4FYWB 3PMTA 4A53A 4JZ3A 2GQIA 2LCCA 3SEMA 1N5ZA 6AT1B 2YRVA 3OYHA 1IRXA 4JS5A 1M8VA 3RIRA 2EW3A 1QVFS 1EIFA 1EX4A 1BI0A 5KYXB 4J9HA 1R0CB 4FSSA 3M5AA 1VQKA 1U06A 2BZXA 5D6YA 3TEEA 1W2BA 3QIIA 1Q81C 4FIBA 4DEYA 1VQNT 2KBTA 2KT8A 1V1CA 1W6XA 1X2KA 3JCMe 4QQDA 1JRIA 2HKNA 2KVQG 1BB9A 5CKBA 3JCMh 1QVGS 4OVAA 1Q82C 3TCJA 1W2BP 4XAXB 4BY6C 5FLXE 3J7AF 3O5ZA 2RMOA 4JRPA 3CCSQ 1XJWB 2L2PA 1MNDA 3FC3A 2BE7D 3QG1A 3QDRB 3CXCA 2QAZA 4M77G 4E6RA 2ZPHB 1RL2A 1UGQB 4JDSA 1N8RU 3WVDB 2LRQA 4J6YA 4JJNK 2F2WA 3OYLA 2RHIA 4ZGEB 1WGSA 1QLYA 3PTAA 3CPWP 2RF0A 2DYBA 1ZA1B 4OGCA 1I8FA 2ROTA 3CXCP 1E6HA 4IUVA 2KDSA 1VQPA 3O8VA 2EJ9A 2QEXA 2P84A 5KYUA 1FMWA 3SB2A 3I5SA 1J3TA 5GAN8 1WDXA 1PSFA 4PFPA 3UA6A 4EMKA 2EGCA 1WJRA 2XI9A 4B6MA 2EBPA 2EAYA 3FDRA 5J3BA 1KC8C 3M0TA 1AD5A 1JXOA 4J5YA 4PKCC 1OYXA 2D8JA 2GTJA 3CCUT 1VA7A 5LJ3f 3EFOB 2RJEA 1WQWA 4DBRA 2E12A 2QTVA 2AHJB 2C06A 2PVDB 3MPUB 3LLRA 4GLKA 4M77F 1ABOA 3HTRA 4DOVA 1S72T 3NTKA 1FWZA 3G6ET 1FMVA 1B34A 1HXDA 3CMAT 1TXQA 1UHCA 4DQ2A 4A4KA 1M8MA 1B7TA 1YJWQ 4J7IA 5KCOA 4M7AE 4F7UG 2ZCFB 5CQXA 2CKKA 3BW1A 3EG2A 2KGTA 3PNWC 1VQPQ 1BCMA 2HSPA 4A4FA 2QEXQ 3QJYA 2ED0A 4LE9A 4ATOA 3TU4K 1K73U 2LP5A 2I2LA 2RM4A 4C8QG 2QGFB 4JPBW 2AT1B 2RK1A 1VQ4A 1OX9A 2LT1A 4RTYA 5GJWB 2O31A 3G4ST 1VYUA 1LNXA 5FU7B 4Z8AA 5IAYA 4PJJA 2M51A 1JBMA 3S3OA 3CEYA 2XK0A 2RJDA 2JT4A 4OF1A 2XDBA 4PJOB 3M58A 2DILA 2EYZA 2MOXA 2MI6A 2JM9A 1MHNA 3LWIA 2FO0A 3I35A 2FPEA 3VS1A 3M0PA 4C5EA 3S6WA 1M90U 3RBBB 3TREA 2YRCA 3FRNA 1VQ7T 1R8OB 2COWA 3LGLA 4ELZC 2LNVA 4BDZA 4F7UF 1SHGA 1PWTA 2V8IA 5HKCA 4Z89A 3A8LB 2RD1A 4E2FB 4M77C 3EGUA 2CP5A 2EKHA 4X9CA 2MCNA 1UJYA 3CCLT 1K9MR 1K0XA 2E3HA 3VS0A 1YJNT 4PJOD 1KD1R 2RQVA 2OAWA 1WI7A 5GANf 1VYTA 1VQ4Q 3LX7A 2E10A 2QK0A 4DA4A 4LDWA 2JMCA 3VJPA 1OPLA 3NTIA 3QDFA 3REAB 1OI1A 1WXTA 1BK2A 2ZPGB 5CKEA 1Y7XA 3G4SA 5GAMe 5I2MA 1UB4A 2KNBB 4E7KA 3URGA 1M1GA 5A0GA 3CCUQ 3OYYA 5GAMh 4M7DE 3E2UA 5CVIA 2D6FA 3CCMA 2OTJA 3HFNA 1NM7A 4F17A 4CI0C 5A0DA 5FW9A 2L3RA 1UUEA 3HRTA 1S72Q 2DA9A 2E1HA 1PRMC 1UE9A 4BE2A 1ZSZC 3CMAQ 2M16A 3JCMX 3H0FA 2DL3A 4J9EA 1ZUKA 2DL8A 1M2VB 3PGGA 5IT9E 3THKA 2HZYA 2EIFA 4L59A 3J80E 4ESRA 1VQMA 4FW2A 4EMHA 2A0FB 3CCLA 2DEQA 3L2ZA 2DXUA 3UF4A 3PFSA 4JJDA 3PMIA 2CS7A 4PFZA 3A98A 4RUGA 3CBMA 2J6OA 3SWNB 4L6V5 3OBWA 2VXEA 1JEGA 3G4SQ 3QUIA 2DBMA 2RI5A 2CZ7B 2Y4YA 2K2VA 1YI2A 3CCMQ 2RJFA 2J6KA 1WZOA 5KYWB 4C92E 1RUWA 2DRMA 2E4HA 4YTLA 4EMGA 5I22A 1RI9A 4B9XA 1BYMA 2ABLA 1VIFA 1Y57A 3GBQA 2OJ2A 1NJIR 2PTKA 2PU9B 2CSIA 1TS9A 4DBFA 1Q7YC 3RKWA 1UFFA 3A8OB 1HK9A 3NTHA 1MV3A 1V29B 4RTTA 3JB9H 1VQ7Q 1QCOA 2KAFA 2EYYA 2MWOA 2LJ0A 3L1AA 2YSQA 1UGRB 1BI1A 2ESWA 1M2VA 2P0KA 2RQWA 2EPDA 2DJZA 1NPRA 2ZPFB 4LDUA 5C6SA 1VQMQ 3X24B 2FG0A 4M7AD 3REBB 1WPYA 5A2QE 2GFUA 3CCLQ 2GF7A 2R5MA 1YJNQ 1HSQA 1P92A 4IURA 2BKDN 2XMFA 4E7JA 3EFSA 1M1KU 2QQRA 3PT9A 3JSCA 4BUGA 3HRSA 1Y07A 2DXBA 2K3YA 2NLUA 1GCPA 1YI2Q 1Q86C 2XD0A 1VQ8A 2IIMA 3CD6T 3FB9A 4C0DB 2CT4A 2H3JA 2NWMA 2P0PA 2E5QA 2YLCA 5ECAA 3NHNA 2BUDA 5KYWA 3DLMA 1FXXA 3G71T 1N8RR 1U1TA 2EQUA 1YN8A 2GFAA 3OYJA 1CKAA 1ZUUA 3LH5A 3CC4A 4QQGA 4M7AA 1YCYA 2EKOA 1OULA 2CYZB 2HQEA 3I9QA 3MEUA 3J81E 4QVDA 2AKKA 5GAOm 1W1FA 4N0AA 2JMAA 1KQ1A 2JXBA 2LC4A 1TSFA 4J9IA 2A28A 4C8QB 5LJ3e 3L2UA 5GAOl 2QDLA 1KSWA 3FLGA 5LJ3h 4J9BA 1QKWA 2YXYA 3I56A 3CC7A 3JRZA 4QW2A 1MMGA 3L2VA 4M7DB 1K8AR 2XICA 3MJXA 3OYIA 2L3SA 4PJMA 2EVRA 1YBYA 2OI3A 4P5NA 5I21A 2COYA 2L89A 3EG9A 4JZ4A 4FCYA 4PJOG 1VQOT 4LDYA 1ABQA 1D1CA 4RTZA 5KYNA 4OMFB 1M3CA 3QJ6A 3CMEA 4MDXA 2C0TA 4J8OA 1WHGA 2JTFA 2DTIA 3OYMA 1WXUA 4BI8B 5AT1B 4M7DD 2RJCA 2WSFE 2Z0WA 4A4GA 1K0SA 4EIKA 3GF5A 1QCNA 2I0NA 1TUCA 3V8LA 5HK0A 4PJNA 1YWOA 2MWPA 3CCRA 2VV5A 2L3PA 1KFZA 2D8HA 5GAOn 1D0XA 2J7IA 1N9SA 1TG0A 1QP3A 4AMCA 4KGZB 2JZ2A 2BE9B 4E7LA 3HKSA 1NLOC 1RAEB 2PUKB 2DK3A 5D6XA 4B9WA
chains in the Genus database with same CATH topology
1O75A 4J5YA 4PKCC 3I55T 4NL2A 2DIGA 1OYXA 1YJ9T 2CZ6B 4C8QE 2DIQA 3CCUT 1KQ2A 3UT1A 5GAOr 4C92B 5LJ3f 3X25B 2RHXA 1M90C 2RJEA 3CCEA 3VYGA 3M4GA 3INZA 2LT4A 1WQWA 4M78G 3V7RA 1YI2T 4II1A 2RI3A 4Z02A 5GAOp 2E12A 2K3XA 4QVZA 1Q81U 2AHJB 5M9OA 2QTXA 4PJOF 2PVDB 3UDCA 2C06A 3BFMA 1BIAA 5LJ3j 3LLRA 4GLKA 2EFIA 3M9QA 4M77F 5EG2A 3JCMf 3CC2T 2LDMA 3OY9A 4DOVA 1S72T 3NTKA 5D6WA 2EYQA 1FWZA 3P8DA 5CQYA 4PLLA 4C92C 3G6ET 1B34A 1HXDA 3M57A 5LL6S 3BDLA 4KUIA 4PL6A 5KH6A 2OTLA 3CMAT 4DQ2A 5GAMg 3RMSA 3M59A 4A4KA 4ZN3A 1Q82U 4JLGA 3JB9G 4RMOA 1X75C 4J7IA 3WXMB 5KCOA 4M7AE 3QPHA 3A8HB 4C92D 4EMKB 1VUBA 3HSBA 4ME7A 2QQ9A 4PJOA 4F7UG 5GANe 3FEOA 2ZCFB 3MEVA 5CQXA 3V8JA 1ZHIA 1YIJT 2CKKA 3BW1A 3PNWC 2RH2A 2ZPEB 3Q1JA 5GAN3 5GANh 4M75E 4LD6A 1PSEA 1QW1A 3CCJT 3QO3A 4A4FA 1WJSA 2YLBA 3QJYA 1N9RA 4RCCA 2E64A 4RG8A 3L2WA 4ATOA 2WSCE 4HCCA 5GAN7 4VUBA 1LJOA 3LW5E 3TU4K 1K73U 3OYFA 4ZGDB 2I2LA 2RM4A 4C8QG 2DXTA 4EMKC 2RK1A 5KE2A 5CR2A 1VQ4A 1G3WA 2LT1A 5GMKh 3OMGA 5DM7R 1W4SA 1UGPB 1YHQT 3MEAA 5LJ5g 5GMKi 2DAQA 3G4ST 5CAIA 1XTDA 3M53A 4MZMA 2MAMA 2CZ0B 3DB3A 5C0MA 1LNXA 2EWNA 2X4WA 5FU7B 4FM4B 3JCMc 1WQ7A 3HFOA 1YITA 5IAYA 3S3MA 1FX7A 2E70A 3VYHB 1D3BA 4C0FA 5I2SA 1B34B 2VYTA 4NL3A 1IREB 3CC2A 3V7SA 4M78F 4JS4A 4IUTA 2HNIA 5DLQE 3CPWA 1NZ9A 1M9SA 1JBMA 3S3OA 1VQ8T 3CEYA 2XK0A 5GMKm 3SFMA 1VQ6A 2LQKA 3RESA 2L8DA 2RJDA 3P8BB 4C92A 2HBPA 1KC8U 2D0QB 2DXCA 3CCET 3JCMb 2O4XA 4OF1A 2XDBA 4PJOB 1Y96B 3M58A 2A3LA 2MI6A 3CD6A 4M7AG 3RUXA 5FU7C 4M77B 1MHNA 2LCLA 3VUZA 5GAN4 3LWIA 1SSFA 1YJWA 5HK3A 1K9MC 3GPLA 5CKHA 2DZCA 3S6WA 3SD4A 4C5EA 2EJFA 3TREA 3PIPA 1M90U 3JB9F 3OYEA 3FRNA 2RI2A 3G71A 3CC4T 1KD1C 5CCAA 5GAN6 4M75G 1VQ7T 3MP1A 4NOYA 1R8OB 3LGLA 2JUFA 4ELZC 2DD4A 2LNVA 3PIOA 3VUBA 5GANd 4BDZA 4EDUA 4F7UF 2RO0A 3GNFB 3JCMQ 3VV0A 2F69A 2V8IA 2XG8D 4FT2A 5HKCA 3A8LB 4PJOC 2RD1A 4A54A 3OS0A 4M77C 4E47A 1N27A 1KQSS 4XTXA 1NE8A 1O9SA 1G3TA 4X9CA 5DY9A 3CCLT 3JCMJ 5KCHA 3MCAB 3WVEB 1YJNT 4PJOD 1VQKT 3OSSC 3QYGB 3AHUA 3CCQA 4M77D 2VXFA 2F5TX 5GANf 3MP8A 4BI4A 4GY5A 2L5QA 4F7UA 2DPPB 2A7YA 2DTOA 2E10A 3LX7A 5CO7A 5A0LA 4DA4A 3I56T 3CC7T 2WACA 3M54A 4LDWA 3A8GB 3VJPA 2LTOA 1VQNA 4BACA 2O4XB 3NTIA 2QQSA 2EQMA 2E6ZA 2X35A 3OBYA 4KULA 4LDVA 1U8RA 1OI1A 1VQ5T 3H8ZA 4XU1A 5GANj 5AYFA 3HP9A 2FYKA 2ZPGB 2HQXA 1H3ZA 5CKEA 1Y7XA 3G4SA 4C5IA 5GAMe 5I2MA 1UB4A 1WJQA 4E7KA 3URGA 1M1GA 5A0GA 2DVEA 4M78B 2RHUA 3OYBA 3OYYA 5GAMh 4M7DE 5CVIA 4QVCA 2D6FA 3CCMA 2OTJA 1KG1A 3HFNA 1XQHA 2B8AA 4MDWA 2DZ9A 4OGEA 2VGNA 3QHSA 4XTVA 2E41A 2RHYA 2PVOB 1G3SA 2GQVA 3SWNA 4CI0C 2V8KA 2IVWA 4JRKA 5A0DA 5GAOq 3QZ9B 3CMET 4MZTA 4C5HA 3JAME 2L3RA 4UC4A 4XU3A 2FB7A 2D9TA 2PQWA 1G5VA 4O6JA 4M75F 4N4GA 3HRTA 2G3RA 1OZ2A 1Y96A 2E1HA 4M78C 4BE1A 1QVFA 4BE2A 5DLOA 4M77A 4O5VA 2M16A 1VQLA 3T9NA 3JCMX 3OMCA 2VGMA 4F7UB 4BE0A 1M1FA 2X4YA 2QQBA 3LH0A 3PGGA 3QBYA 2MMPA 2V8JA 5IT9E 1VQPT 3SDZA 2EIFA 4L59A 4M78D 3J80E 1M1KC 4HT9A 5LJ5e 2QEXT 3FIFA 3CCRT 3UWNA 3C94A 4XTZA 1K9MU 5LJ5h 3MP6A 5GMKe 2ZPIB 1ZBXA 5CKFA 4N4IA 3ZEHA 1KD1U 3RERA 2K4YA 1DJ7B 1VQMA 4J6XA 4EMHA 3ZFJA 1QVGA 4RCBA 3CCLA 4XU2A 2DEQA 3L2ZA 2FHDA 3E9FA 2DXUA 4KUDK 3LYIA 3JB9J 3PFSA 5J26A 3PMIA 3JB9D 2CS7A 1W2BS 4XTWA 3I55A 4M7DG 2Y90A 3CBMA 2K5LA 1JB0E 3SWNB 3QYHB 4L6V5 3OSVA 4E7IA 2XDPA 5GAMd 1YJ9A 3A8MB 4PNOA 3OBWA 2VXEA 4FSXA 5LJ3g 3L2RA 3CCUA 1NJIC 4X9DA 3OYKA 4OB1B 3OW2A 3HPWA 2JNGA 2RI5A 3QUIA 2CZ7B 3QXEB 4XK8E 4D6WA 2Y4YA 3HL8A 5FROA 3CCST 3LGFA 1BI3A 2K2VA 2QA4T 3OB9A 4IUPA 1QP2A 1YI2A 1JJ2A 2RJFA 3HRUA 5HY6A 4JRIA 2EQKA 2KSSA 4C92E 2PUOB 5GMKl 3E9GA 4YTLA 3G7ZA 2X4JA 3JCMg 4EMGA 2O01E 5CKDA 4LD9K 4XQ3A 3VKIA 2RHZA 4M78A 3SWNC 4C8QD 4C5GA 2XHCA 2XDDA 1QVPA 3DKMA 3N5BB 4Y28E 4KT0E 2VC8A 3RKXA 1NPPA 4B9XA 3CPWS 5L8RE 3JCMW 1BYMA 1VIFA 5GAMf 3G6EA 4EPCA 3CMAA 4IUQA 3E1SA 3EAEA 3CXCS 4IUUA 3CBPA 2PU9B 4M75B 5J39A 1Q7YC 3RKWA 4IKFA 2IG0A 4N4HA 4BB7A 3A8OB 1LOJA 1MGQA 4V2SA 2MF2A 1HK9A 2X4XA 3NTHA 1X6OA 1KQSA 2Y4XA 3GIBA 1UEBA 1XNIA 1V29B 2P0QA 1BKBA 5IN1A 4ZTJA 5LJ5d 5GAMj 3JB9H 2KAFA 1I81A 3QSUA 2XIDA 1YIJA 2KQWA 2MWOA 2M0OA 1U1SA 4C8QF 3V8KA 3CCVT 3X20B 3CCJA 2M1HA 3L1AA 4CRIA 4A4EA 1UGRB 1BI1A 1BI2A 4KBMB 2P0KA 4N0AC 2FVUA 2ZPFB 1ZQ1A 2DJZA 1NPRA 2LX9A 4LDUA 4M75C 5C6SA 3GOXA 3JB9I 3X24B 1G3YA 2LQ8A 4M7AD 1M4ZA 1WPYA 2OAUA 5A2QE 2GFUA 5GAN2 2QXFA 4OB2B 1VQ4T 2GF7A 3ASKA 2RK2A 2R5MA 3M55A 3OA6A 2OTLT 2WSEE 2CZ1B 1P92A 2RB6A 4IURA 3OYDA 4HCBA 4JLIA 2BKDN 5LJ5f 4QQ6A 2HAXA 4M75D 4JUVA 3GP8A 4HCZA 4E7JA 1YHQA 1OZ3A 3EFSA 3P8HA 1M1KU 5FU6B 4A4HA 1YITT 2R58A 4C8QA 2QQRA 4C92G 2KMTA 4BD3A 1N8RC 3PT9A 3NFCA 2JN0A 2QI2A 2E65A 1BIBA 3HRSA 3JSCA 4BUGA 1KHIA 4MMLA 1Y07A 5LJ5j 3RKYA 1K8AU 2DXBA 2K3YA 2NLUA 3MEWA 3JCMV 1VQ6T 4M7AF 1Q86C 3BDUA 3VU3C 2XD0A 3OYGA 2CGHA 4DOWA 5GMKj 3BY7A 2XU8A 3KBGA 1VQ9T 1VQ8A 3KUFA 2DTHA 3ME9A 2PVGB 3CD6T 3FB9A 4RKUE 4X34A 4C0DB 3GLXA 5FU6C 3CCSA 1I4K1 3FJPA 4ZN1A 2QA4A 4M7DA 1X01A 2H3JA 1YJWT 3X28B 3C4SA 2P0PA 2E5QA 2YLCA 3ZBDA 2BUDA 3DLMA 1FXXA 2K57A 1WNLA 3G71T 1NJIU 3CPFA 1U1TA 2FL7A 2EQUA 4ZTFA 4PJOE 2GFAA 5CK9A 3X26B 3QZ5B 3OYJA 3RMQA 3CC4A 1RI0A 3OYCA 1VQ7A 2P4TA 4M77E 4QQGA 4M7AA 5CIUA 1YCYA 2EKOA 2QDYB 3PMTA 5GAN5 3KXTA 2CYZB 2HQEA 4LDXA 3MEUA 3J81E 4A53A 4FT4A 4C0DC 4QVDA 4L5GA 2LCCA 3META 4HA8A 5GAOm 3OS2A 3OS5A 4N0AA 4XTYA 4M75A 1KQ1A 2YRVA 3OYNA 3C95A 3OYHA 4JS5A 3L2QA 2K5IA 2LC4A 4MZPA 1M8VA 3RIRA 1K8AC 1QVFS 1EIFA 3MO8A 1M5Q1 4C8QB 3EFRA 2HD0A 3CCQT 1BI0A 1UGSB 5LJ3e 3L2UA 4HT8A 1YJNA 2ZPBB 4Q5WA 3M5AA 1VQKA 5GAOl 1Q7YU 2EQJA 5D6YA 3FLGA 3CCVA 5LJ3h 3TEEA 5GANg 4BY6B 2JVVA 3QIIA 1W2BA 1Q81C 2BIVA 2DKGA 3A5ZB 4FIBA 3DLLA 2KK4A 3F70A 4WF2A 3M4YA 3QKJA 2YHTA 1VQNT 4FL6A 2M9UA 3I56A 3JCMP 3CC7A 4XTUA 3JRZA 2RA2A 4PLIA 2VUBA 4QQDA 1JRIA 4QW2A 4C92F 3JCMe 4C0ZA 3L2VA 5FRNA 4M7DB 4C8QC 2KVQG 2R57A 2XICA 4OB0B 5CKBA 3JCMh 1S72A 1VQ5A 1QVGS 1H641 2DD5A 4OVAA 3H6ZA 3OYIA 2JTMA 1GXIE 1Q82C 3OQ5A 3MHXA 2R5AA 4OB3B 3TCJA 3OYAA 4BDYA 3V7CA 1YBYA 4XAXB 4BY6C 3CCMT 2OTJT 2JOYA 5FLXE 4TVRA 4P5NA 5I21A 2L89A 3J7AF 1VQOA 2K5FA 2F5KA 5KE3A 3UPUA 4M7AB 2QQAA 4JRPA 4JRQA 2ZGWA 4PJOG 1VQOT 3ER0A 4LDYA 3R6OA 4R56A 4R55A 3FC3A 3HHTB 3QG1A 3QDRB 2KY9A 4HKEA 4M77G 3CXCA 3OW2S 4M7DC 4M78E 3E19A 1AHJB 2E6NA 2ZPHB 4J6WA 1VQ9A 4OMFB 4E7HA 1RL2A 1UGQB 3QJ6A 3CMEA 4JDSA 4ELYC 5FRMA 4BI3A 1N8RU 4MDXA 4J7FA 4J8OA 3WVDB 2LRQA 1JJ2S 4J6YA 1I5LA 2JTFA 4JJNK 2DTIA 1K73C 3OYMA 4ZGJB 3OYLA 2RHIA 4BI8B 1VQLT 1Y71A 4ZGEB 1WGSA 4M7DD 1Q86U 2RJCA 4J83A 3PTAA 4M7AC 2WSFE 4A4GA 1VIEA 1TH7A 3GF5A 1KHCA 4OGCA 1I8FA 2LVMA 3GNGA 3V8LA 3L42A 5HK0A 4Y91A 4IUVA 2ZZDA 2KDSA 1VQPA 2EJGA 2MWPA 4OP0A 3O8VA 3DB4A 2EJ9A 3CCRA 2QEXA 5LJ3d 2VV5A 2DO3A 4NS5A 3SB2A 1IZ6A 3S3NA 4F7UE 3OS1A 5GAOn 1VQMT 5GAN8 2GCXA 4C0GA 1N9SA 1PSFA 1XOVA 3CBOA 2XKOC 4EMKA 1QP3A 4FU6A 1N6AA 1WJRA 2XI9A 2JZ2A 4M7DF 3M56A 2EAYA 4MMKA 4RG2A 1D3BB 3FDRA 4XU0A 3C12A 5J3BA 3HKSA 4E7LA 1KC8C 3LWHA 3JCMd 2PUKB 2DK3A 5D6XA 4B9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J5Y A;  4M75 G;  5GAN 6;  3JB9 D;  4NL2 A;  4NOY A;  4XTW A;  4M77 E;  2Y90 A;  5GAN d;  4M7A A;  4M7D G;  4C8Q E;  3SWN B;  1YCY A;  4F7U F;  5GAN 5;  5GAO r;  1KQ2 A;  4C92 B;  3JCM Q;  4PNO A;  5LJ3 f;  5LJ3 g;  2VXE A;  5GAM d;  4A53 A;  4PJO C;  4X9D A;  4QVD A;  2RD1 A;  4A54 A;  4HA8 A;  3QUI A;  5GAO m;  3M4G A;  3INZ A;  4M77 C;  4N0A A;  4XTY A;  1WQW A;  4M78 G;  4M75 A;  3V7R A;  1KQ1 A;  4XTX A;  5GAO p;  1M8V A;  3RIR A;  4X9C A;  5DY9 A;  2QTX A;  4JRI A;  4PJO F;  4C92 E;  1M5Q 1;  3JCM J;  3BFM A;  3EFR A;  1BIA A;  4C8Q B;  5LJ3 j;  4PJO D;  5GMK l;  3JCM f;  3JCM g;  4M77 F;  3AHU A;  5LJ3 e;  4EMG A;  4HT8 A;  5GAO l;  4M77 D;  4XQ3 A;  2VXF A;  4C8Q D;  4M78 A;  3SWN C;  5LJ3 h;  4C92 C;  3RKX A;  5GAN g;  5GAN f;  1B34 A;  1HXD A;  2VC8 A;  4F7U A;  3JCM W;  2DKG A;  2DTO A;  2E10 A;  4DQ2 A;  4WF2 A;  5GAM f;  5GAM g;  2YHT A;  3JB9 G;  3JCM P;  4M75 B;  4XTU A;  3RKW A;  2RA2 A;  4C92 F;  3JCM e;  4M7A E;  1JRI A;  4M7D B;  1LOJ A;  1MGQ A;  4V2S A;  1HK9 A;  4XU1 A;  4C92 D;  4C8Q C;  4EMK B;  5GAN j;  3HSB A;  4PJO A;  3JCM h;  3GIB A;  2FYK A;  4F7U G;  1H64 1;  5GAN e;  3QSU A;  3JB9 H;  5LJ5 d;  5GAM j;  3V8J A;  1I81 A;  3BW1 A;  5GAM e;  5GAN 3;  5GAN h;  4M75 E;  3V7C A;  2DVE A;  4M78 B;  1U1S A;  5GAM h;  3QO3 A;  4C8Q F;  3V8K A;  4QVC A;  5I21 A;  4M7D C;  2YLB A;  4M7D E;  1N9R A;  3L1A A;  4RCC A;  4M7A B;  2E64 A;  3HFN A;  2DZ9 A;  2ZGW A;  4N0A C;  4PJO G;  3QHS A;  4M75 C;  1LJO A;  2DJZ A;  5GAN 7;  4XTV A;  2E41 A;  3JB9 I;  3SWN A;  4M77 G;  2I2L A;  2RM4 A;  1WPY A;  4JRK A;  4M78 E;  2DXT A;  4C8Q G;  4EMK C;  5GAN 2;  4J6W A;  5GAO q;  4XU3 A;  2FB7 A;  5GMK h;  2RB6 A;  4M75 F;  4J6Y A;  4JLI A;  5LJ5 g;  5LJ5 f;  5GMK i;  2DTI A;  1I5L A;  1Y96 A;  2E1H A;  4M78 C;  4JUV A;  4M75 D;  4M7D F;  5CAI A;  3EFS A;  4M7D D;  4M77 A;  1LNX A;  2EWN A;  4C8Q A;  3JCM c;  3JCM X;  4M7A C;  4C92 G;  1WQ7 A;  3HFO A;  1TH7 A;  1D3B A;  4NL3 A;  2JN0 A;  1B34 B;  4F7U B;  1I8F A;  2E65 A;  1BIB A;  3V7S A;  4M78 F;  3PGG A;  3V8L A;  2HNI A;  4MML A;  5LJ5 j;  3RKY A;  4Y91 A;  4HT9 A;  4M78 D;  3JCM V;  2EJG A;  1JBM A;  3FIF A;  4OP0 A;  5LJ5 e;  5GMK m;  3BDU A;  4M7A F;  3VU3 C;  2EJ9 A;  2CGH A;  4M7A D;  5GMK j;  3RES A;  3BY7 A;  4XTZ A;  5LJ3 d;  4C92 A;  5LJ5 h;  5GMK e;  3SB2 A;  2DTH A;  3JCM b;  4F7U E;  5GAO n;  3RER A;  3FB9 A;  1Y96 B;  5GAN 8;  4PJO B;  4M7D A;  1I4K 1;  1N9S A;  3FJP A;  1X01 A;  4EMK A;  4M7A G;  4J6X A;  3RUX A;  4M77 B;  4EMH A;  5GAN 4;  4RCB A;  2YLC A;  4XU2 A;  2DEQ A;  3L2Z A;  2EAY A;  4MMK A;  1D3B B;  2DZC A;  1WNL A;  2DXU A;  2K57 A;  2EJF A;  4XU0 A;  3JB9 F;  1U1T A;  3JB9 J;  3JCM d;  4PJO E; 
#chains in the Genus database with same CATH topology
 3I55 T;  1KQ2 A;  3UT1 A;  4C92 B;  2NYS A;  2DEU A;  1U5S A;  3INZ A;  2LT4 A;  3V7R A;  2F1L A;  2RI3 A;  2K3X A;  4PJO F;  3UDC A;  3BFM A;  1I07 A;  5EG2 A;  2QAS A;  2LDM A;  2LMJ A;  4HVW A;  1TU0 B;  4PLL A;  3M57 A;  4KUI A;  4PL6 A;  2OTL A;  3PVQ A;  1YCS B;  2CP2 A;  1Q86 R;  5KYU B;  1U3O A;  1PHT A;  1GBQ A;  2JM8 A;  2DL7 A;  4HVV A;  4GLM A;  4LN2 A;  4C92 D;  4EMK B;  3HSB A;  4ME7 A;  5GAN e;  3FEO A;  5IHN A;  3MEV A;  1ZLM A;  3V8J A;  1YIJ T;  2MYS A;  5GAN h;  1AWX A;  4LD6 A;  1QW1 A;  3CCJ T;  3CCR Q;  2DRK A;  2G6F X;  2OX7 A;  4RG8 A;  5D7U A;  1B07 A;  4HCC A;  5GAN 7;  1M30 A;  4K11 A;  2ECZ A;  2KXD A;  3OYF A;  1UEC A;  4ZGD B;  5FWB A;  4QT7 A;  2FZK B;  1G3W A;  2CSQ A;  5DM7 R;  1UGP B;  2DL4 A;  1YHQ T;  5LJ5 g;  2CP0 A;  1XTD A;  2MAM A;  3DB3 A;  3JCM c;  4FM4 B;  2HBW A;  1WQ7 A;  3HFO A;  4C0F A;  1B34 B;  5IHI A;  3V7S A;  4IUT A;  2HNI A;  2V1Q A;  5DLQ E;  3CPW A;  1UHF A;  1NZ9 A;  1YP5 A;  5GMK m;  2CP6 A;  4FYX B;  2B86 A;  4C92 A;  2M0Y A;  1M3A A;  1WIE A;  2D0Q B;  2YDL A;  2A3L A;  4HVU A;  1OU9 A;  4M7A G;  5FU7 C;  1SSF A;  1YJW A;  2OTL Q;  1K9M C;  1TWB A;  3GPL A;  2DZC A;  2LJ1 A;  3PIP A;  1KD1 C;  5CCA A;  1WHL A;  1H8K A;  3VUB A;  4EDU A;  3GNF B;  3VV0 A;  1D1B A;  4FT2 A;  4PJO C;  2GBQ A;  1N27 A;  4XTX A;  2O88 A;  1O9S A;  1PC0 A;  3JCM J;  5KCH A;  3MCA B;  3BE3 A;  3AHU A;  1AEY A;  3MP8 A;  2LQW A;  2L5Q A;  4RTW A;  2DTO A;  5CO7 A;  2MIO A;  2WAC A;  3M54 A;  3A8G B;  1YWP A;  1VQN A;  3R6N A;  2QQS A;  4KUL A;  2X35 A;  3VS7 A;  1HJD A;  4LDV A;  1VQ5 T;  4XU1 A;  3HP9 A;  4IIM A;  3I55 Q;  3NMZ C;  1T3L A;  2HKQ B;  4MDW A;  2B8A A;  2L0A A;  2MK5 A;  4OGE A;  1CKB A;  2GQV A;  1RLQ C;  5GAO q;  1V76 A;  2HL3 A;  4C5H A;  4UC4 A;  1JXM A;  1G5V A;  2D9T A;  2PQW A;  4AFU C;  2G3R A;  3EHQ A;  4BE1 A;  1QVF A;  1FYN A;  4O5V A;  3M0Q A;  3H0H A;  2V26 A;  4OMN A;  1PKS A;  4BE0 A;  4KRT A;  2QQB A;  3QBY A;  3UA7 A;  1RAD B;  3ULR B;  5EC7 A;  1BU1 A;  1H92 A;  3FIF A;  2DVJ A;  4WCI A;  3UWN A;  1GCQ A;  1YIJ Q;  5CKF A;  4N4I A;  3ZEH A;  1QVF P;  1WHJ A;  2DFU A;  2FPD A;  1JQQ A;  1X27 A;  1E7O A;  4RCB A;  1QVG A;  2FHD A;  2DYI A;  5J26 A;  3CQT A;  4HCK A;  3JB9 D;  1VQN Q;  1IHW A;  1M1K R;  4M7D G;  1JB0 E;  4E7I A;  3CCE T;  1YHQ Q;  3CCU A;  1NJI C;  3AT1 B;  4X9D A;  1PKT A;  1H3H A;  3HPW A;  1PD0 A;  1QVG P;  1RAI B;  1BI3 A;  1C1A A;  1SRM A;  2DBK A;  3HRU A;  1VOM A;  1ZBJ A;  4JRI A;  1RAA B;  2KSS A;  5HY6 A;  1AZG B;  3E9G A;  4KH1 B;  3G7Z A;  2X4J A;  3JCM g;  4CC7 A;  2A37 A;  3M0S A;  5CKD A;  3SWN C;  4R0K A;  4C5G A;  2XHC A;  1QVP A;  1S72 A;  4Y28 E;  2VC8 A;  1LPL A;  1NPP A;  2QGG A;  7AT1 B;  5L8R E;  1GBR A;  3G6E A;  3CMA A;  4IUQ A;  3EAE A;  2CP7 A;  2IG0 A;  4N4H A;  3M0U A;  1LOJ A;  5IHK A;  1X6O A;  1UEB A;  2DJQ A;  5IN1 A;  4ANJ A;  5LJ5 d;  1QQJ A;  2K3B A;  2MPX C;  2KQW A;  2M0O A;  4C8Q F;  3CCV T;  4N0A C;  4QKU A;  1G3Y A;  2LQ8 A;  4OB2 B;  3H0I A;  3OA6 A;  2JW4 A;  2WSE E;  2RB6 A;  2HAX A;  4JUV A;  3GP8 A;  4HCZ A;  4M7D F;  5FU6 B;  1YIT T;  4C92 G;  2KEA A;  2CH4 W;  1N8R C;  1BIB A;  1PG5 B;  2KYB A;  1EZZ B;  3RKY A;  5LJ5 j;  3MEW A;  1VQ5 Q;  1VQ6 T;  3VU3 C;  3OYG A;  4DOW A;  5GMK j;  1VQ9 T;  3KBG A;  2LX7 A;  2LJ3 A;  3ME9 A;  4FYV B;  1SPK A;  3GLX A;  1I4K 1;  4ZN1 A;  1X01 A;  3X28 B;  2BZ8 A;  2CT3 A;  2PZ1 A;  1SF9 A;  3G6E Q;  2VAS A;  1WNL A;  3CPF A;  4ZTF A;  2EYX A;  3X26 B;  2D0N A;  3OYC A;  1VQ7 A;  1S1N A;  1WA7 A;  5CIU A;  5GAN 5;  3KXT A;  2AZV A;  2J6F A;  1T0H A;  1X2Q A;  4FT4 A;  2KRM A;  4C0D C;  4L5G A;  2RQU A;  3MET A;  4HA8 A;  3OS2 A;  4AT1 B;  4XTY A;  2JS2 A;  2K5I A;  4MZP A;  1K8A C;  1LVK A;  1ZA2 B;  1RAF B;  3EFR A;  1B3Q A;  2HD0 A;  3CCQ T;  1M27 C;  2E5K A;  4HT8 A;  1YJN A;  2ZPB B;  4Q5W A;  2ENM A;  2EQJ A;  3CCV A;  5KYY B;  3RR6 A;  2BIV A;  2DKG A;  2KE9 A;  3A5Z B;  1UG1 A;  3F70 A;  4WF2 A;  1TUD A;  2KRO A;  1SG5 A;  3QKJ A;  1AWO A;  2M9U A;  3JCM P;  1WHK A;  1ZSG A;  4CC4 B;  2FRW A;  1NBE B;  2RA2 A;  4C92 F;  2VUB A;  5FRN A;  4C8Q C;  2R57 A;  3ZL7 C;  2W0Z A;  4OB0 B;  1GXI E;  1H64 1;  3H6Z A;  2JTM A;  2R5A A;  4OB3 B;  3OYA A;  4BDY A;  2K79 A;  2JOY A;  4TVR A;  2K5F A;  3UPU A;  4M7A B;  2QQA A;  2ZGW A;  4OMP A;  4HKE A;  4M7D C;  3OW2 S;  4M78 E;  3EGD B;  2E6N A;  1VQ9 A;  4E7H A;  2KT1 A;  5FRM A;  4BI3 A;  4J7F A;  1JJ2 S;  1K73 C;  4ZGJ B;  1VQL T;  1G83 A;  1Y71 A;  4J83 A;  5GJV B;  1TH7 A;  1KHC A;  2LVM A;  3L42 A;  4Y91 A;  2D1X A;  2ZZD A;  1IGQ A;  1RAG B;  2DO3 A;  4NS5 A;  4OMQ A;  1IZ6 A;  2A36 A;  1QWE A;  3OS1 A;  2RN8 A;  2GCX A;  4C0G A;  4FU6 A;  3CCV Q;  3M56 A;  1D3B B;  4AFS C;  4XU0 A;  3LWH A;  3JCM d;  3EG9 B;  2COZ A;  2DIG A;  1YJ9 T;  2CZ6 B;  5KYY A;  3X25 B;  1M90 C;  3M4G A;  1K1Z A;  2L3Q A;  1YIT Q;  4ORZ A;  4Z02 A;  1Q81 U;  2QTX A;  1IXD A;  2EFI A;  3M9Q A;  3OY9 A;  3TVT A;  2O9S A;  5D6W A;  1Z9Z A;  5CQY A;  1VQ9 Q;  4C92 C;  2ATC B;  1RAB B;  5KH6 A;  5LL6 S;  3BDL A;  1OOT A;  5GAM g;  3RMS A;  4ZN3 A;  2J06 A;  4JJB A;  1Q82 U;  4JLG A;  3JB9 G;  4RMO A;  1X75 C;  3WXM B;  1QCF A;  3EGD A;  3A8H B;  2DM1 A;  1VUB A;  2YUQ A;  2QQ9 A;  1ZHI A;  2RH2 A;  3Q1J A;  5GAN 3;  4M75 E;  2C0I A;  4FW1 A;  1X6G A;  1WJS A;  4E7Z A;  5IXF A;  2YLB A;  1G2B A;  1RAH B;  2GTO A;  1D1A A;  1LJO A;  2VVK A;  1R77 A;  1JO8 A;  2DXT A;  4EMK C;  1R0B G;  5KE2 A;  5CR2 A;  5GMK h;  2ED1 A;  2LNH B;  3MEA A;  4PK4 A;  5CAI A;  3M53 A;  4MZM A;  5C0M A;  2EWN A;  1D0Y A;  2X4W A;  4J9C A;  2DMO A;  2HCK A;  2E70 A;  3VYH B;  1D3B A;  2RQR A;  2VYT A;  1IRE B;  1EFN A;  1GL5 A;  4J9G A;  2DNU A;  2LQK A;  4DBQ A;  3EH1 A;  1KC8 U;  2DXC A;  2CH4 A;  2O4X A;  1Y96 B;  2X3W D;  1I1J A;  3CD6 A;  3RUX A;  3VUZ A;  5GAN 4;  2GNC A;  2FRY A;  5HK3 A;  1MV0 B;  5CKH A;  2EJF A;  3JB9 F;  1OPK A;  3OYE A;  4GBQ A;  1UJ0 A;  3G71 A;  2RNA A;  2JUF A;  2DD4 A;  3OW2 P;  3PIO A;  2CDT A;  2VKN A;  1LCK A;  2F69 A;  1NEG A;  2E3I A;  1JJ2 P;  2GGR A;  3VS2 A;  2F2V A;  1K73 R;  1G3T A;  5DY9 A;  2CUD A;  5IH2 A;  3WVE B;  1VQK T;  1OX8 A;  3OSS C;  2M02 A;  2ROL A;  1WYX A;  1QMC A;  1C6V X;  2CUB A;  4BI4 A;  4GY5 A;  1GCQ C;  2JJ9 A;  4F7U A;  1WHH A;  2DPP B;  2LTO A;  2EQM A;  2E6Z A;  3OBY A;  1U8R A;  3EGX A;  2HQH A;  2HQX A;  3MKD A;  1E6G A;  2V1R A;  4C5I A;  1WJQ A;  2KR3 A;  2DVE A;  4M78 B;  3OYB A;  4QVC A;  1KK7 A;  1XQH A;  2AKL A;  2VGN A;  3QHS A;  3CD6 Q;  2RHY A;  1VQO A;  1Y0M A;  1OEB A;  2K6D A;  1M90 R;  2JTE A;  4JRK A;  1SHF A;  4MZT A;  3VS5 A;  2EYW A;  4O6J A;  1FMK A;  5FWC A;  3G71 Q;  1Y96 A;  1K76 A;  5DLO A;  1RAC B;  3T9N A;  3QWY A;  2KXC A;  2VGM A;  1M1F A;  2YRD A;  3LH0 A;  1VQP T;  2MMP A;  4M78 D;  1M1K C;  2QEX T;  4E7S A;  4JJC A;  3C94 A;  3MP6 A;  4AG1 C;  1ZBX A;  2VB6 A;  3RER A;  1DJ7 B;  2DL5 A;  2DLP A;  4J6X A;  2VWF A;  1M3B A;  4XU2 A;  1WLP B;  3LYI A;  3JB9 J;  2IPO B;  3I55 A;  2K5L A;  3OSV A;  5GAM d;  4PNO A;  5LJ3 g;  2ZAE A;  3OYK A;  4OB1 B;  3QXE B;  2JNG A;  1QKX A;  4D6W A;  3HL8 A;  5FRO A;  3QWX X;  3VS4 A;  2QA4 T;  3OB9 A;  1QP2 A;  2EQK A;  4LUE A;  2PUO B;  1KJW A;  2HDA A;  4A63 B;  5GMK l;  4LD9 K;  1VQO Q;  4XQ3 A;  3VKI A;  2RHZ A;  4M78 A;  2XDD A;  3DKM A;  3RKX A;  4KT0 E;  3U23 A;  3JCM W;  4EPC A;  3E1S A;  1GRI A;  1UTI A;  3CBP A;  1ZX6 A;  4M75 B;  5J39 A;  4IKF A;  3TSW A;  1TUG B;  1MGQ A;  4V2S A;  3H9N A;  1K4U S;  2X4X A;  1XNI A;  4ZTJ A;  1IGU A;  1BKB A;  1YNZ A;  5GAM j;  3D7S B;  1YIJ A;  1NYF A;  1U1S A;  3V8K A;  1IB8 A;  3X20 B;  3CCJ A;  2M1H A;  4A4E A;  4KBM B;  2FVU A;  1ZQ1 A;  3NGP A;  1NLP C;  3JB9 I;  3C0C A;  3M0R A;  1M4Z A;  2QXF A;  1VQ4 T;  3ASK A;  2RK2 A;  4FYY B;  3M55 A;  1VQK Q;  3OYD A;  4JLI A;  5LJ5 f;  3EG3 A;  4M75 D;  1YHQ A;  2KMT A;  1G8X A;  5KYX A;  2JN0 A;  1AT1 B;  1D0Z A;  1K8A U;  4M7A F;  3BDU A;  2DX1 A;  2HEQ A;  2YWW A;  2XU8 A;  1WHM A;  1Z9Q A;  3VS6 A;  4OML A;  2EQI A;  4RKU E;  2X9H A;  2DF6 A;  5FU6 C;  2QA4 A;  3C4S A;  3ZBD A;  1GFC A;  3FJ5 A;  2FL7 A;  5CK9 A;  2PNI A;  3QZ5 B;  4RTX A;  3RMQ A;  4F14 A;  2DE0 X;  1RI0 A;  4M77 E;  3TQ7 P;  2QDY B;  1MMN A;  4LDX A;  4Y92 A;  2CP3 A;  3OS5 A;  8ATC B;  2K2M A;  4M75 A;  3OYN A;  4J9F A;  3C95 A;  3L2Q A;  1CSK A;  3CCJ Q;  1JU5 C;  3MO8 A;  1M5Q 1;  2RQT A;  1UGS B;  1Q7Y U;  1AWJ A;  5GAN g;  4BY6 B;  2JVV A;  3DLL A;  1I5O B;  2KK4 A;  3M4Y A;  1I0C A;  2YHT A;  4FL6 A;  5IXB A;  1OU8 A;  1IHV A;  8AT1 B;  4WTO B;  1AWW A;  4XTU A;  2AIR B;  4PLI A;  4C0Z A;  1WXB A;  5L23 A;  4AFZ C;  1VQ5 A;  2DD5 A;  3OQ5 A;  3MHX A;  3V7C A;  2OTJ T;  3CCM T;  4KH0 B;  1T0J A;  2LQN A;  5KE3 A;  2F5K A;  1Q81 R;  4DBH A;  4JRQ A;  3ER0 A;  3R6O A;  4R56 A;  4R55 A;  2QA4 Q;  3HHT B;  2KY9 A;  3E19 A;  5HCK A;  1AHJ B;  3EFO A;  2K7A A;  4J6W A;  4ELY C;  2YT6 A;  1AVZ C;  1WX6 A;  1I5L A;  2W10 A;  3PE0 A;  1Q82 R;  1Q86 U;  4M7A C;  1VIE A;  3JV3 A;  3GNG A;  1X43 A;  2EJG A;  4OP0 A;  3DB4 A;  3NPF A;  5LJ3 d;  3S3N A;  4F7U E;  1VQM T;  3CBO A;  1XOV A;  2XKO C;  1N6A A;  4MMK A;  1ZUY A;  4RG2 A;  3C12 A;  3CC2 T;  1O75 A;  4NL2 A;  1C0M A;  1HYO A;  4C8Q E;  2DIQ A;  5GAO r;  2BZY A;  1F1B B;  2RHX A;  1X6B A;  3CCE A;  4KGV B;  3VYG A;  1YI2 T;  4M78 G;  4II1 A;  5GAO p;  4AFQ C;  1PCX A;  4QVZ A;  5M9O A;  1BIA A;  1KC8 R;  5LJ3 j;  3JCM f;  2NUP B;  3EG1 A;  3VRZ A;  1IO6 A;  2EYQ A;  3P8D A;  3M59 A;  2DET A;  1PD1 A;  4J9D A;  2J05 A;  3QPH A;  2FEI A;  1RLP C;  4PJO A;  2O2O A;  4AG2 C;  2ZPE B;  1PSE A;  3QO3 A;  4Z88 A;  1N9R A;  4RCC A;  2E64 A;  4DEX A;  1WFW A;  3L2W A;  1SSH A;  2WSC E;  1AOJ A;  4VUB A;  3LW5 E;  1Q95 G;  1QWF A;  1VYV A;  2AK5 A;  3KFV A;  3OMG A;  1W4S A;  5I11 A;  5GMK i;  2DAQ A;  2CZ0 B;  1YIT A;  1PM3 A;  3S3M A;  1FX7 A;  2X51 A;  3UAT A;  3CCE Q;  4NL3 A;  5I2S A;  3CC2 A;  4M78 F;  4JS4 A;  2HL5 C;  1M9S A;  1SRL A;  4IIO A;  1VQ8 T;  3SFM A;  1VQ6 A;  3RES A;  2L8D A;  3P8B B;  2HBP A;  4F04 B;  1TTH B;  1X69 A;  3JCM b;  1MMD A;  2OTJ Q;  3IQL A;  4M77 B;  2LCL A;  1HD3 A;  2NUZ A;  2F2X A;  1OV3 A;  3SD4 A;  3PVL A;  4LXC A;  2RI2 A;  3CC4 T;  2NUP A;  5GAN 6;  4M75 G;  3MP1 A;  4NOY A;  2NUT B;  1OQK A;  5GAN d;  2RO0 A;  3JCM Q;  2XG8 D;  4A54 A;  3OS0 A;  3RDV A;  4E47 A;  1KQS S;  2X3X D;  2BTT A;  1NE8 A;  1UDL A;  3VRY A;  3QYG B;  4OMM A;  2H3E B;  3CCQ A;  4M77 D;  1KIK A;  2VXF A;  1M2O A;  2F5T X;  2A7Y A;  5A0L A;  3I56 T;  3CC7 T;  4BAC A;  2O4X B;  1NEB A;  2A08 A;  2FZC B;  1T3S A;  2P4R A;  2QG9 B;  3H8Z A;  3SHW A;  5GAN j;  5AYF A;  2FYK A;  3CC2 Q;  1H3Z A;  3RNJ A;  1ACM B;  1K9A A;  2RHU A;  1ZSZ B;  1VQ6 Q;  2FPF A;  1KG1 A;  2DZ9 A;  2JS0 A;  4XTV A;  2E41 A;  2PVO B;  1G3S A;  3SWN A;  2V8K A;  2IVW A;  3QZ9 B;  3CME T;  3JAM E;  4XU3 A;  2FB7 A;  4M75 F;  4N4G A;  1OZ2 A;  1NG2 A;  4M78 C;  3H41 A;  4M77 A;  1VQL A;  3TSZ A;  3OMC A;  2HMA A;  2QYZ A;  4F7U B;  2X4Y A;  4HXJ A;  2V8J A;  3SDZ A;  1BCO A;  4HT9 A;  2NUT A;  4RTV A;  5LJ5 e;  1PRL C;  3CCR T;  2YUO A;  4XTZ A;  1K9M U;  5LJ5 h;  2KI7 A;  5GMK e;  2ZPI B;  3EGX B;  1KD1 U;  2K4Y A;  1MUZ A;  3CCQ Q;  3ZFJ A;  1A0N B;  3E9F A;  4KUD K;  2AZS A;  1SKU B;  1W2B S;  4XTW A;  2RPN A;  2Y90 A;  4OMO A;  4RTU A;  3QYH B;  1W70 A;  1YJ9 A;  2XDP A;  3A8M B;  3L2R A;  4FSX A;  3OW2 A;  3EH2 A;  3EHR A;  4XK8 E;  3CCS T;  2LZ6 B;  3LGF A;  4IUP A;  1JJ2 A;  1PNJ A;  2FZG B;  2O01 E;  1VQ8 Q;  4C8Q D;  2OTL T;  3N5B B;  1ZSZ A;  1GFD A;  3CPW S;  4X1V A;  5GAM f;  4D8K A;  3CXC S;  2LCS A;  4IUU A;  2C0O A;  2DER A;  1VQL Q;  4BB7 A;  2KRN A;  2MF2 A;  3I5R A;  1KQS A;  2Y4X A;  3A1P A;  2EGE A;  3GIB A;  1UGV A;  2P0Q A;  3CC4 Q;  4PJL A;  3QSU A;  1I81 A;  2XID A;  2SEM A;  2EGA A;  2HSE B;  4CRI A;  2KYM A;  1BI2 A;  2H8H A;  3GOX A;  4M75 C;  2LX9 A;  1TOV A;  4F16 A;  1Q7Y R;  2OAU A;  1KQS P;  5GAN 2;  2KRS A;  2YUN A;  3EG0 A;  4CC2 A;  1NYG A;  4KGX B;  2CZ1 B;  4HCB A;  4QQ6 A;  9ATC B;  1OZ3 A;  3P8H A;  4A4H A;  2R58 A;  4M4Z A;  4C8Q A;  1YJ9 Q;  1BBZ A;  4LNP A;  4BD3 A;  3I56 Q;  3CC7 Q;  3NFC A;  2QI2 A;  4ZNX A;  4CC3 A;  1YFN A;  2E65 A;  2SRC A;  1KHI A;  4MML A;  3JCM V;  1D09 B;  1SEM A;  2CGH A;  3BY7 A;  3G1J A;  1AZE A;  4LUD A;  3KUF A;  2DTH A;  2PVG B;  4D8D A;  4X34 A;  3CCS A;  4M7D A;  3FJP A;  1YJW T;  4PFO A;  1MMA A;  2YUP A;  2O9V A;  1NJI U;  2K57 A;  4PJO E;  1ARK A;  3CME Q;  1MNE A;  3VS3 A;  2CRE A;  2K9G A;  2P4T A;  4FYW B;  3PMT A;  4A53 A;  4JZ3 A;  2GQI A;  2LCC A;  3SEM A;  1N5Z A;  6AT1 B;  2YRV A;  3OYH A;  1IRX A;  4JS5 A;  1M8V A;  3RIR A;  2EW3 A;  1QVF S;  1EIF A;  1EX4 A;  1BI0 A;  5KYX B;  4J9H A;  1R0C B;  4FSS A;  3M5A A;  1VQK A;  1U06 A;  2BZX A;  5D6Y A;  3TEE A;  1W2B A;  3QII A;  1Q81 C;  4FIB A;  4DEY A;  1VQN T;  2KBT A;  2KT8 A;  1V1C A;  1W6X A;  1X2K A;  3JCM e;  4QQD A;  1JRI A;  2HKN A;  2KVQ G;  1BB9 A;  5CKB A;  3JCM h;  1QVG S;  4OVA A;  1Q82 C;  3TCJ A;  1W2B P;  4XAX B;  4BY6 C;  5FLX E;  3J7A F;  3O5Z A;  2RMO A;  4JRP A;  3CCS Q;  1XJW B;  2L2P A;  1MND A;  3FC3 A;  2BE7 D;  3QG1 A;  3QDR B;  3CXC A;  2QAZ A;  4M77 G;  4E6R A;  2ZPH B;  1RL2 A;  1UGQ B;  4JDS A;  1N8R U;  3WVD B;  2LRQ A;  4J6Y A;  4JJN K;  2F2W A;  3OYL A;  2RHI A;  4ZGE B;  1WGS A;  1QLY A;  3PTA A;  3CPW P;  2RF0 A;  2DYB A;  1ZA1 B;  4OGC A;  1I8F A;  2ROT A;  3CXC P;  1E6H A;  4IUV A;  2KDS A;  1VQP A;  3O8V A;  2EJ9 A;  2QEX A;  2P84 A;  5KYU A;  1FMW A;  3SB2 A;  3I5S A;  1J3T A;  5GAN 8;  1WDX A;  1PSF A;  4PFP A;  3UA6 A;  4EMK A;  2EGC A;  1WJR A;  2XI9 A;  4B6M A;  2EBP A;  2EAY A;  3FDR A;  5J3B A;  1KC8 C;  3M0T A;  1AD5 A;  1JXO A;  4J5Y A;  4PKC C;  1OYX A;  2D8J A;  2GTJ A;  3CCU T;  1VA7 A;  5LJ3 f;  3EFO B;  2RJE A;  1WQW A;  4DBR A;  2E12 A;  2QTV A;  2AHJ B;  2C06 A;  2PVD B;  3MPU B;  3LLR A;  4GLK A;  4M77 F;  1ABO A;  3HTR A;  4DOV A;  1S72 T;  3NTK A;  1FWZ A;  3G6E T;  1FMV A;  1B34 A;  1HXD A;  3CMA T;  1TXQ A;  1UHC A;  4DQ2 A;  4A4K A;  1M8M A;  1B7T A;  1YJW Q;  4J7I A;  5KCO A;  4M7A E;  4F7U G;  2ZCF B;  5CQX A;  2CKK A;  3BW1 A;  3EG2 A;  2KGT A;  3PNW C;  1VQP Q;  1BCM A;  2HSP A;  4A4F A;  2QEX Q;  3QJY A;  2ED0 A;  4LE9 A;  4ATO A;  3TU4 K;  1K73 U;  2LP5 A;  2I2L A;  2RM4 A;  4C8Q G;  2QGF B;  4JPB W;  2AT1 B;  2RK1 A;  1VQ4 A;  1OX9 A;  2LT1 A;  4RTY A;  5GJW B;  2O31 A;  3G4S T;  1VYU A;  1LNX A;  5FU7 B;  4Z8A A;  5IAY A;  4PJJ A;  2M51 A;  1JBM A;  3S3O A;  3CEY A;  2XK0 A;  2RJD A;  2JT4 A;  4OF1 A;  2XDB A;  4PJO B;  3M58 A;  2DIL A;  2EYZ A;  2MOX A;  2MI6 A;  2JM9 A;  1MHN A;  3LWI A;  2FO0 A;  3I35 A;  2FPE A;  3VS1 A;  3M0P A;  4C5E A;  3S6W A;  1M90 U;  3RBB B;  3TRE A;  2YRC A;  3FRN A;  1VQ7 T;  1R8O B;  2COW A;  3LGL A;  4ELZ C;  2LNV A;  4BDZ A;  4F7U F;  1SHG A;  1PWT A;  2V8I A;  5HKC A;  4Z89 A;  3A8L B;  2RD1 A;  4E2F B;  4M77 C;  3EGU A;  2CP5 A;  2EKH A;  4X9C A;  2MCN A;  1UJY A;  3CCL T;  1K9M R;  1K0X A;  2E3H A;  3VS0 A;  1YJN T;  4PJO D;  1KD1 R;  2RQV A;  2OAW A;  1WI7 A;  5GAN f;  1VYT A;  1VQ4 Q;  3LX7 A;  2E10 A;  2QK0 A;  4DA4 A;  4LDW A;  2JMC A;  3VJP A;  1OPL A;  3NTI A;  3QDF A;  3REA B;  1OI1 A;  1WXT A;  1BK2 A;  2ZPG B;  5CKE A;  1Y7X A;  3G4S A;  5GAM e;  5I2M A;  1UB4 A;  2KNB B;  4E7K A;  3URG A;  1M1G A;  5A0G A;  3CCU Q;  3OYY A;  5GAM h;  4M7D E;  3E2U A;  5CVI A;  2D6F A;  3CCM A;  2OTJ A;  3HFN A;  1NM7 A;  4F17 A;  4CI0 C;  5A0D A;  5FW9 A;  2L3R A;  1UUE A;  3HRT A;  1S72 Q;  2DA9 A;  2E1H A;  1PRM C;  1UE9 A;  4BE2 A;  1ZSZ C;  3CMA Q;  2M16 A;  3JCM X;  3H0F A;  2DL3 A;  4J9E A;  1ZUK A;  2DL8 A;  1M2V B;  3PGG A;  5IT9 E;  3THK A;  2HZY A;  2EIF A;  4L59 A;  3J80 E;  4ESR A;  1VQM A;  4FW2 A;  4EMH A;  2A0F B;  3CCL A;  2DEQ A;  3L2Z A;  2DXU A;  3UF4 A;  3PFS A;  4JJD A;  3PMI A;  2CS7 A;  4PFZ A;  3A98 A;  4RUG A;  3CBM A;  2J6O A;  3SWN B;  4L6V 5;  3OBW A;  2VXE A;  1JEG A;  3G4S Q;  3QUI A;  2DBM A;  2RI5 A;  2CZ7 B;  2Y4Y A;  2K2V A;  1YI2 A;  3CCM Q;  2RJF A;  2J6K A;  1WZO A;  5KYW B;  4C92 E;  1RUW A;  2DRM A;  2E4H A;  4YTL A;  4EMG A;  5I22 A;  1RI9 A;  4B9X A;  1BYM A;  2ABL A;  1VIF A;  1Y57 A;  3GBQ A;  2OJ2 A;  1NJI R;  2PTK A;  2PU9 B;  2CSI A;  1TS9 A;  4DBF A;  1Q7Y C;  3RKW A;  1UFF A;  3A8O B;  1HK9 A;  3NTH A;  1MV3 A;  1V29 B;  4RTT A;  3JB9 H;  1VQ7 Q;  1QCO A;  2KAF A;  2EYY A;  2MWO A;  2LJ0 A;  3L1A A;  2YSQ A;  1UGR B;  1BI1 A;  2ESW A;  1M2V A;  2P0K A;  2RQW A;  2EPD A;  2DJZ A;  1NPR A;  2ZPF B;  4LDU A;  5C6S A;  1VQM Q;  3X24 B;  2FG0 A;  4M7A D;  3REB B;  1WPY A;  5A2Q E;  2GFU A;  3CCL Q;  2GF7 A;  2R5M A;  1YJN Q;  1HSQ A;  1P92 A;  4IUR A;  2BKD N;  2XMF A;  4E7J A;  3EFS A;  1M1K U;  2QQR A;  3PT9 A;  3JSC A;  4BUG A;  3HRS A;  1Y07 A;  2DXB A;  2K3Y A;  2NLU A;  1GCP A;  1YI2 Q;  1Q86 C;  2XD0 A;  1VQ8 A;  2IIM A;  3CD6 T;  3FB9 A;  4C0D B;  2CT4 A;  2H3J A;  2NWM A;  2P0P A;  2E5Q A;  2YLC A;  5ECA A;  3NHN A;  2BUD A;  5KYW A;  3DLM A;  1FXX A;  3G71 T;  1N8R R;  1U1T A;  2EQU A;  1YN8 A;  2GFA A;  3OYJ A;  1CKA A;  1ZUU A;  3LH5 A;  3CC4 A;  4QQG A;  4M7A A;  1YCY A;  2EKO A;  1OUL A;  2CYZ B;  2HQE A;  3I9Q A;  3MEU A;  3J81 E;  4QVD A;  2AKK A;  5GAO m;  1W1F A;  4N0A A;  2JMA A;  1KQ1 A;  2JXB A;  2LC4 A;  1TSF A;  4J9I A;  2A28 A;  4C8Q B;  5LJ3 e;  3L2U A;  5GAO l;  2QDL A;  1KSW A;  3FLG A;  5LJ3 h;  4J9B A;  1QKW A;  2YXY A;  3I56 A;  3CC7 A;  3JRZ A;  4QW2 A;  1MMG A;  3L2V A;  4M7D B;  1K8A R;  2XIC A;  3MJX A;  3OYI A;  2L3S A;  4PJM A;  2EVR A;  1YBY A;  2OI3 A;  4P5N A;  5I21 A;  2COY A;  2L89 A;  3EG9 A;  4JZ4 A;  4FCY A;  4PJO G;  1VQO T;  4LDY A;  1ABQ A;  1D1C A;  4RTZ A;  5KYN A;  4OMF B;  1M3C A;  3QJ6 A;  3CME A;  4MDX A;  2C0T A;  4J8O A;  1WHG A;  2JTF A;  2DTI A;  3OYM A;  1WXU A;  4BI8 B;  5AT1 B;  4M7D D;  2RJC A;  2WSF E;  2Z0W A;  4A4G A;  1K0S A;  4EIK A;  3GF5 A;  1QCN A;  2I0N A;  1TUC A;  3V8L A;  5HK0 A;  4PJN A;  1YWO A;  2MWP A;  3CCR A;  2VV5 A;  2L3P A;  1KFZ A;  2D8H A;  5GAO n;  1D0X A;  2J7I A;  1N9S A;  1TG0 A;  1QP3 A;  4AMC A;  4KGZ B;  2JZ2 A;  2BE9 B;  4E7L A;  3HKS A;  1NLO C;  1RAE B;  2PUK B;  2DK3 A;  5D6X A;  4B9W A; 
#chains in the Genus database with same CATH homology
 1O75 A;  4J5Y A;  4PKC C;  3I55 T;  4NL2 A;  2DIG A;  1OYX A;  1YJ9 T;  2CZ6 B;  4C8Q E;  2DIQ A;  3CCU T;  1KQ2 A;  3UT1 A;  5GAO r;  4C92 B;  5LJ3 f;  3X25 B;  2RHX A;  1M90 C;  2RJE A;  3CCE A;  3VYG A;  3M4G A;  3INZ A;  2LT4 A;  1WQW A;  4M78 G;  3V7R A;  1YI2 T;  4II1 A;  2RI3 A;  4Z02 A;  5GAO p;  2E12 A;  2K3X A;  4QVZ A;  1Q81 U;  2AHJ B;  5M9O A;  2QTX A;  4PJO F;  2PVD B;  3UDC A;  2C06 A;  3BFM A;  1BIA A;  5LJ3 j;  3LLR A;  4GLK A;  2EFI A;  3M9Q A;  4M77 F;  5EG2 A;  3JCM f;  3CC2 T;  2LDM A;  3OY9 A;  4DOV A;  1S72 T;  3NTK A;  5D6W A;  2EYQ A;  1FWZ A;  3P8D A;  5CQY A;  4PLL A;  4C92 C;  3G6E T;  1B34 A;  1HXD A;  3M57 A;  5LL6 S;  3BDL A;  4KUI A;  4PL6 A;  5KH6 A;  2OTL A;  3CMA T;  4DQ2 A;  5GAM g;  3RMS A;  3M59 A;  4A4K A;  4ZN3 A;  1Q82 U;  4JLG A;  3JB9 G;  4RMO A;  1X75 C;  4J7I A;  3WXM B;  5KCO A;  4M7A E;  3QPH A;  3A8H B;  4C92 D;  4EMK B;  1VUB A;  3HSB A;  4ME7 A;  2QQ9 A;  4PJO A;  4F7U G;  5GAN e;  3FEO A;  2ZCF B;  3MEV A;  5CQX A;  3V8J A;  1ZHI A;  1YIJ T;  2CKK A;  3BW1 A;  3PNW C;  2RH2 A;  2ZPE B;  3Q1J A;  5GAN 3;  5GAN h;  4M75 E;  4LD6 A;  1PSE A;  1QW1 A;  3CCJ T;  3QO3 A;  4A4F A;  1WJS A;  2YLB A;  3QJY A;  1N9R A;  4RCC A;  2E64 A;  4RG8 A;  3L2W A;  4ATO A;  2WSC E;  4HCC A;  5GAN 7;  4VUB A;  1LJO A;  3LW5 E;  3TU4 K;  1K73 U;  3OYF A;  4ZGD B;  2I2L A;  2RM4 A;  4C8Q G;  2DXT A;  4EMK C;  2RK1 A;  5KE2 A;  5CR2 A;  1VQ4 A;  1G3W A;  2LT1 A;  5GMK h;  3OMG A;  5DM7 R;  1W4S A;  1UGP B;  1YHQ T;  3MEA A;  5LJ5 g;  5GMK i;  2DAQ A;  3G4S T;  5CAI A;  1XTD A;  3M53 A;  4MZM A;  2MAM A;  2CZ0 B;  3DB3 A;  5C0M A;  1LNX A;  2EWN A;  2X4W A;  5FU7 B;  4FM4 B;  3JCM c;  1WQ7 A;  3HFO A;  1YIT A;  5IAY A;  3S3M A;  1FX7 A;  2E70 A;  3VYH B;  1D3B A;  4C0F A;  5I2S A;  1B34 B;  2VYT A;  4NL3 A;  1IRE B;  3CC2 A;  3V7S A;  4M78 F;  4JS4 A;  4IUT A;  2HNI A;  5DLQ E;  3CPW A;  1NZ9 A;  1M9S A;  1JBM A;  3S3O A;  1VQ8 T;  3CEY A;  2XK0 A;  5GMK m;  3SFM A;  1VQ6 A;  2LQK A;  3RES A;  2L8D A;  2RJD A;  3P8B B;  4C92 A;  2HBP A;  1KC8 U;  2D0Q B;  2DXC A;  3CCE T;  3JCM b;  2O4X A;  4OF1 A;  2XDB A;  4PJO B;  1Y96 B;  3M58 A;  2A3L A;  2MI6 A;  3CD6 A;  4M7A G;  3RUX A;  5FU7 C;  4M77 B;  1MHN A;  2LCL A;  3VUZ A;  5GAN 4;  3LWI A;  1SSF A;  1YJW A;  5HK3 A;  1K9M C;  3GPL A;  5CKH A;  2DZC A;  3S6W A;  3SD4 A;  4C5E A;  2EJF A;  3TRE A;  3PIP A;  1M90 U;  3JB9 F;  3OYE A;  3FRN A;  2RI2 A;  3G71 A;  3CC4 T;  1KD1 C;  5CCA A;  5GAN 6;  4M75 G;  1VQ7 T;  3MP1 A;  4NOY A;  1R8O B;  3LGL A;  2JUF A;  4ELZ C;  2DD4 A;  2LNV A;  3PIO A;  3VUB A;  5GAN d;  4BDZ A;  4EDU A;  4F7U F;  2RO0 A;  3GNF B;  3JCM Q;  3VV0 A;  2F69 A;  2V8I A;  2XG8 D;  4FT2 A;  5HKC A;  3A8L B;  4PJO C;  2RD1 A;  4A54 A;  3OS0 A;  4M77 C;  4E47 A;  1N27 A;  1KQS S;  4XTX A;  1NE8 A;  1O9S A;  1G3T A;  4X9C A;  5DY9 A;  3CCL T;  3JCM J;  5KCH A;  3MCA B;  3WVE B;  1YJN T;  4PJO D;  1VQK T;  3OSS C;  3QYG B;  3AHU A;  3CCQ A;  4M77 D;  2VXF A;  2F5T X;  5GAN f;  3MP8 A;  4BI4 A;  4GY5 A;  2L5Q A;  4F7U A;  2DPP B;  2A7Y A;  2DTO A;  2E10 A;  3LX7 A;  5CO7 A;  5A0L A;  4DA4 A;  3I56 T;  3CC7 T;  2WAC A;  3M54 A;  4LDW A;  3A8G B;  3VJP A;  2LTO A;  1VQN A;  4BAC A;  2O4X B;  3NTI A;  2QQS A;  2EQM A;  2E6Z A;  2X35 A;  3OBY A;  4KUL A;  4LDV A;  1U8R A;  1OI1 A;  1VQ5 T;  3H8Z A;  4XU1 A;  5GAN j;  5AYF A;  3HP9 A;  2FYK A;  2ZPG B;  2HQX A;  1H3Z A;  5CKE A;  1Y7X A;  3G4S A;  4C5I A;  5GAM e;  5I2M A;  1UB4 A;  1WJQ A;  4E7K A;  3URG A;  1M1G A;  5A0G A;  2DVE A;  4M78 B;  2RHU A;  3OYB A;  3OYY A;  5GAM h;  4M7D E;  5CVI A;  4QVC A;  2D6F A;  3CCM A;  2OTJ A;  1KG1 A;  3HFN A;  1XQH A;  2B8A A;  4MDW A;  2DZ9 A;  4OGE A;  2VGN A;  3QHS A;  4XTV A;  2E41 A;  2RHY A;  2PVO B;  1G3S A;  2GQV A;  3SWN A;  4CI0 C;  2V8K A;  2IVW A;  4JRK A;  5A0D A;  5GAO q;  3QZ9 B;  3CME T;  4MZT A;  4C5H A;  3JAM E;  2L3R A;  4UC4 A;  4XU3 A;  2FB7 A;  2D9T A;  2PQW A;  1G5V A;  4O6J A;  4M75 F;  4N4G A;  3HRT A;  2G3R A;  1OZ2 A;  1Y96 A;  2E1H A;  4M78 C;  4BE1 A;  1QVF A;  4BE2 A;  5DLO A;  4M77 A;  4O5V A;  2M16 A;  1VQL A;  3T9N A;  3JCM X;  3OMC A;  2VGM A;  4F7U B;  4BE0 A;  1M1F A;  2X4Y A;  2QQB A;  3LH0 A;  3PGG A;  3QBY A;  2MMP A;  2V8J A;  5IT9 E;  1VQP T;  3SDZ A;  2EIF A;  4L59 A;  4M78 D;  3J80 E;  1M1K C;  4HT9 A;  5LJ5 e;  2QEX T;  3FIF A;  3CCR T;  3UWN A;  3C94 A;  4XTZ A;  1K9M U;  5LJ5 h;  3MP6 A;  5GMK e;  2ZPI B;  1ZBX A;  5CKF A;  4N4I A;  3ZEH A;  1KD1 U;  3RER A;  2K4Y A;  1DJ7 B;  1VQM A;  4J6X A;  4EMH A;  3ZFJ A;  1QVG A;  4RCB A;  3CCL A;  4XU2 A;  2DEQ A;  3L2Z A;  2FHD A;  3E9F A;  2DXU A;  4KUD K;  3LYI A;  3JB9 J;  3PFS A;  5J26 A;  3PMI A;  3JB9 D;  2CS7 A;  1W2B S;  4XTW A;  3I55 A;  4M7D G;  2Y90 A;  3CBM A;  2K5L A;  1JB0 E;  3SWN B;  3QYH B;  4L6V 5;  3OSV A;  4E7I A;  2XDP A;  5GAM d;  1YJ9 A;  3A8M B;  4PNO A;  3OBW A;  2VXE A;  4FSX A;  5LJ3 g;  3L2R A;  3CCU A;  1NJI C;  4X9D A;  3OYK A;  4OB1 B;  3OW2 A;  3HPW A;  2JNG A;  2RI5 A;  3QUI A;  2CZ7 B;  3QXE B;  4XK8 E;  4D6W A;  2Y4Y A;  3HL8 A;  5FRO A;  3CCS T;  3LGF A;  1BI3 A;  2K2V A;  2QA4 T;  3OB9 A;  4IUP A;  1QP2 A;  1YI2 A;  1JJ2 A;  2RJF A;  3HRU A;  5HY6 A;  4JRI A;  2EQK A;  2KSS A;  4C92 E;  2PUO B;  5GMK l;  3E9G A;  4YTL A;  3G7Z A;  2X4J A;  3JCM g;  4EMG A;  2O01 E;  5CKD A;  4LD9 K;  4XQ3 A;  3VKI A;  2RHZ A;  4M78 A;  3SWN C;  4C8Q D;  4C5G A;  2XHC A;  2XDD A;  1QVP A;  3DKM A;  3N5B B;  4Y28 E;  4KT0 E;  2VC8 A;  3RKX A;  1NPP A;  4B9X A;  3CPW S;  5L8R E;  3JCM W;  1BYM A;  1VIF A;  5GAM f;  3G6E A;  4EPC A;  3CMA A;  4IUQ A;  3E1S A;  3EAE A;  3CXC S;  4IUU A;  3CBP A;  2PU9 B;  4M75 B;  5J39 A;  1Q7Y C;  3RKW A;  4IKF A;  2IG0 A;  4N4H A;  4BB7 A;  3A8O B;  1LOJ A;  1MGQ A;  4V2S A;  2MF2 A;  1HK9 A;  2X4X A;  3NTH A;  1X6O A;  1KQS A;  2Y4X A;  3GIB A;  1UEB A;  1XNI A;  1V29 B;  2P0Q A;  1BKB A;  5IN1 A;  4ZTJ A;  5LJ5 d;  5GAM j;  3JB9 H;  2KAF A;  1I81 A;  3QSU A;  2XID A;  1YIJ A;  2KQW A;  2MWO A;  2M0O A;  1U1S A;  4C8Q F;  3V8K A;  3CCV T;  3X20 B;  3CCJ A;  2M1H A;  3L1A A;  4CRI A;  4A4E A;  1UGR B;  1BI1 A;  1BI2 A;  4KBM B;  2P0K A;  4N0A C;  2FVU A;  2ZPF B;  1ZQ1 A;  2DJZ A;  1NPR A;  2LX9 A;  4LDU A;  4M75 C;  5C6S A;  3GOX A;  3JB9 I;  3X24 B;  1G3Y A;  2LQ8 A;  4M7A D;  1M4Z A;  1WPY A;  2OAU A;  5A2Q E;  2GFU A;  5GAN 2;  2QXF A;  4OB2 B;  1VQ4 T;  2GF7 A;  3ASK A;  2RK2 A;  2R5M A;  3M55 A;  3OA6 A;  2OTL T;  2WSE E;  2CZ1 B;  1P92 A;  2RB6 A;  4IUR A;  3OYD A;  4HCB A;  4JLI A;  2BKD N;  5LJ5 f;  4QQ6 A;  2HAX A;  4M75 D;  4JUV A;  3GP8 A;  4HCZ A;  4E7J A;  1YHQ A;  1OZ3 A;  3EFS A;  3P8H A;  1M1K U;  5FU6 B;  4A4H A;  1YIT T;  2R58 A;  4C8Q A;  2QQR A;  4C92 G;  2KMT A;  4BD3 A;  1N8R C;  3PT9 A;  3NFC A;  2JN0 A;  2QI2 A;  2E65 A;  1BIB A;  3HRS A;  3JSC A;  4BUG A;  1KHI A;  4MML A;  1Y07 A;  5LJ5 j;  3RKY A;  1K8A U;  2DXB A;  2K3Y A;  2NLU A;  3MEW A;  3JCM V;  1VQ6 T;  4M7A F;  1Q86 C;  3BDU A;  3VU3 C;  2XD0 A;  3OYG A;  2CGH A;  4DOW A;  5GMK j;  3BY7 A;  2XU8 A;  3KBG A;  1VQ9 T;  1VQ8 A;  3KUF A;  2DTH A;  3ME9 A;  2PVG B;  3CD6 T;  3FB9 A;  4RKU E;  4X34 A;  4C0D B;  3GLX A;  5FU6 C;  3CCS A;  1I4K 1;  3FJP A;  4ZN1 A;  2QA4 A;  4M7D A;  1X01 A;  2H3J A;  1YJW T;  3X28 B;  3C4S A;  2P0P A;  2E5Q A;  2YLC A;  3ZBD A;  2BUD A;  3DLM A;  1FXX A;  2K57 A;  1WNL A;  3G71 T;  1NJI U;  3CPF A;  1U1T A;  2FL7 A;  2EQU A;  4ZTF A;  4PJO E;  2GFA A;  5CK9 A;  3X26 B;  3QZ5 B;  3OYJ A;  3RMQ A;  3CC4 A;  1RI0 A;  3OYC A;  1VQ7 A;  2P4T A;  4M77 E;  4QQG A;  4M7A A;  5CIU A;  1YCY A;  2EKO A;  2QDY B;  3PMT A;  5GAN 5;  3KXT A;  2CYZ B;  2HQE A;  4LDX A;  3MEU A;  3J81 E;  4A53 A;  4FT4 A;  4C0D C;  4QVD A;  4L5G A;  2LCC A;  3MET A;  4HA8 A;  5GAO m;  3OS2 A;  3OS5 A;  4N0A A;  4XTY A;  4M75 A;  1KQ1 A;  2YRV A;  3OYN A;  3C95 A;  3OYH A;  4JS5 A;  3L2Q A;  2K5I A;  2LC4 A;  4MZP A;  1M8V A;  3RIR A;  1K8A C;  1QVF S;  1EIF A;  3MO8 A;  1M5Q 1;  4C8Q B;  3EFR A;  2HD0 A;  3CCQ T;  1BI0 A;  1UGS B;  5LJ3 e;  3L2U A;  4HT8 A;  1YJN A;  2ZPB B;  4Q5W A;  3M5A A;  1VQK A;  5GAO l;  1Q7Y U;  2EQJ A;  5D6Y A;  3FLG A;  3CCV A;  5LJ3 h;  3TEE A;  5GAN g;  4BY6 B;  2JVV A;  3QII A;  1W2B A;  1Q81 C;  2BIV A;  2DKG A;  3A5Z B;  4FIB A;  3DLL A;  2KK4 A;  3F70 A;  4WF2 A;  3M4Y A;  3QKJ A;  2YHT A;  1VQN T;  4FL6 A;  2M9U A;  3I56 A;  3JCM P;  3CC7 A;  4XTU A;  3JRZ A;  2RA2 A;  4PLI A;  2VUB A;  4QQD A;  1JRI A;  4QW2 A;  4C92 F;  3JCM e;  4C0Z A;  3L2V A;  5FRN A;  4M7D B;  4C8Q C;  2KVQ G;  2R57 A;  2XIC A;  4OB0 B;  5CKB A;  3JCM h;  1S72 A;  1VQ5 A;  1QVG S;  1H64 1;  2DD5 A;  4OVA A;  3H6Z A;  3OYI A;  2JTM A;  1GXI E;  1Q82 C;  3OQ5 A;  3MHX A;  2R5A A;  4OB3 B;  3TCJ A;  3OYA A;  4BDY A;  3V7C A;  1YBY A;  4XAX B;  4BY6 C;  3CCM T;  2OTJ T;  2JOY A;  5FLX E;  4TVR A;  4P5N A;  5I21 A;  2L89 A;  3J7A F;  1VQO A;  2K5F A;  2F5K A;  5KE3 A;  3UPU A;  4M7A B;  2QQA A;  4JRP A;  4JRQ A;  2ZGW A;  4PJO G;  1VQO T;  3ER0 A;  4LDY A;  3R6O A;  4R56 A;  4R55 A;  3FC3 A;  3HHT B;  3QG1 A;  3QDR B;  2KY9 A;  4HKE A;  4M77 G;  3CXC A;  3OW2 S;  4M7D C;  4M78 E;  3E19 A;  1AHJ B;  2E6N A;  2ZPH B;  4J6W A;  1VQ9 A;  4OMF B;  4E7H A;  1RL2 A;  1UGQ B;  3QJ6 A;  3CME A;  4JDS A;  4ELY C;  5FRM A;  4BI3 A;  1N8R U;  4MDX A;  4J7F A;  4J8O A;  3WVD B;  2LRQ A;  1JJ2 S;  4J6Y A;  1I5L A;  2JTF A;  4JJN K;  2DTI A;  1K73 C;  3OYM A;  4ZGJ B;  3OYL A;  2RHI A;  4BI8 B;  1VQL T;  1Y71 A;  4ZGE B;  1WGS A;  4M7D D;  1Q86 U;  2RJC A;  4J83 A;  3PTA A;  4M7A C;  2WSF E;  4A4G A;  1VIE A;  1TH7 A;  3GF5 A;  1KHC A;  4OGC A;  1I8F A;  2LVM A;  3GNG A;  3V8L A;  3L42 A;  5HK0 A;  4Y91 A;  4IUV A;  2ZZD A;  2KDS A;  1VQP A;  2EJG A;  2MWP A;  4OP0 A;  3O8V A;  3DB4 A;  2EJ9 A;  3CCR A;  2QEX A;  5LJ3 d;  2VV5 A;  2DO3 A;  4NS5 A;  3SB2 A;  1IZ6 A;  3S3N A;  4F7U E;  3OS1 A;  5GAO n;  1VQM T;  5GAN 8;  2GCX A;  4C0G A;  1N9S A;  1PSF A;  1XOV A;  3CBO A;  2XKO C;  4EMK A;  1QP3 A;  4FU6 A;  1N6A A;  1WJR A;  2XI9 A;  2JZ2 A;  4M7D F;  3M56 A;  2EAY A;  4MMK A;  4RG2 A;  1D3B B;  3FDR A;  4XU0 A;  3C12 A;  5J3B A;  3HKS A;  4E7L A;  1KC8 C;  3LWH A;  3JCM d;  2PUK B;  2DK3 A;  5D6X A;  4B9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...