3JCMW

Cryo-em structure of the spliceosomal u4/u6.u5 tri-snrnp
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
70
Chain Sequence
QPVNPKPFLKGLVNHRVGVKLKTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Pre-mRNA-splicing factor 8
publication title The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
pubmed doi rcsb
total genus 7
structure length 70
sequence length 73
chains with identical sequence Z
ec nomenclature
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jcmW00
5CAIA 5GAN4 4C92F 5GMKl 2DTIA 2DZCA 3M4GA 4M75A 1D3BA 4WF2A 4X9DA 5GANd 1N9RA 3V8JA 4EMKB 3BY7A 5I21A 4M7DA 2E65A 2ZGWA 4XU0A 3JCMJ 3BW1A 4M75D 5GAMe 2VXEA 3SWNB 4C8QB 1B34B 5GAMf 4F7UG 4M77B 2DXUA 4NOYA 3EFRA 4XTUA 4M7DD 2VXFA 3HFOA 3JB9D 1X01A 5LJ3e 2DTOA 2DZ9A 2I2LA 2RM4A 5LJ3f 4XU3A 4JRIA 5GAMg 4N0AA 5GAMd 1WQWA 5GANj 4F7UA 1I81A 4V2SA 3FJPA 4M78E 5LJ3g 5LJ3d 3RUXA 3INZA 5GAOm 2E1HA 4XTVA 1MGQA 4PJOB 2RD1A 4M78G 1LOJA 2JN0A 4OP0A 3JCMe 3JCMf 5GANe 4M75C 4M7AF 2EJGA 1I8FA 3FB9A 3L1AA 3JB9G 4M7DC 2E41A 4M75F 4MMKA 3V7RA 5GAMj 3JCMg 3JCMd 4M78A 4PNOA 2RB6A 5GANg 3JCMW 5GAN6 3PGGA 3GIBA 5LJ3j 4EMHA 4M78D 3RKYA 5GAN3 3BFMA 4M7AB 4N0AC 1BIAA 1WQ7A 4C8QE 4M7AE 2YHTA 4M77E 4C92B 4J5YA 4C92E 3V8LA 5GMKh 4XTXA 4XTYA 4C8QG 1YCYA 2E64A 2FB7A 4M77G 4C92G 4RCBA 4JLIA 4F7UF 4HT8A 4EMKA 2EAYA 4X9CA 4XQ3A 3QSUA 1Y96B 2QTXA 3JCMc 5LJ5h 4MMLA 3SWNA 4C8QA 5LJ5f 1B34A 2DEQA 4QVDA 4M77A 4PJOE 3VU3C 4C92A 2HNIA 4RCCA 3JCMb 1H641 4HA8A 4M78C 5GAN2 4XU1A 4C8QD 4M7AD 1WPYA 4M77D 4PJOG 4C92D 3JCMQ 4M78F 2YLBA 5GAOp 3BDUA 4M7DF 5GMKm 5GAN5 4XTWA 5GAOn 3JB9F 2YLCA 3QHSA 3JCMV 5GAOr 1U1SA 4PJOA 3V8KA 2E10A 3V7SA 2VC8A 1JBMA 3RKWA 1U1TA 2K57A 4JRKA 4PJOD 1LJOA 4M75B 1JRIA 1D3BB 4EMKC 5GAOl 3QUIA 3JB9J 4DQ2A 4NL2A 5GMKe 4M7AG 5GAN7 4M7DB 5GAOq 3SWNC 4C8QC 5GMKi 4M7AC 3RIRA 2EWNA 4M77C 2EJFA 4A53A 4C92C 5GANh 3RESA 3RERA 1I4K1 4C8QF 4A54A 4M77F 3FIFA 5LJ5e 5GAN8 4HT9A 1KQ1A 2DVEA 3AHUA 2Y90A 4M7AA 3EFSA 1M5Q1 3HFNA 3JB9H 3L2ZA 4XTZA 4Y91A 4F7UB 1TH7A 4EMGA 4F7UE 5LJ5g 5LJ5d 5DY9A 4NL3A 3JCMP 4PJOC 5GAMh 1WNLA 2DTHA 2CGHA 1M8VA 1Y96A 2DKGA 4J6YA 3JCMX 4PJOF 1N9SA 1KQ2A 5LJ3h 4QVCA 5GMKj 2DXTA 1HXDA 1LNXA 1I5LA 3SB2A 2DJZA 4J6WA 4JUVA 4M78B 2RA2A 4M75E 4XU2A 5LJ5j 3V7CA 1BIBA 2EJ9A 2FYKA 3QO3A 3HSBA 4M7DE 4J6XA 4M75G 3JCMh 3RKXA 3JB9I 1HK9A 4M7DG 5GANf
chains in the Genus database with same CATH superfamily
5GAN4 2QQ9A 4IUQA 2X4YA 1N9RA 3V8JA 4C8QB 2XI9A 2DTOA 5LJ3f 5FWCA 3I9QA 2QTVA 4GLKA 4N4IA 4F7UA 1NM7A 1R77A 4M78E 3QZ5B 1UDLA 4E7KA 2JN0A 4BE1A 3CMET 2D1XA 1I8FA 3FB9A 5IHKA 4IIOA 3J7AF 1D0YA 2LQNA 1VQ6T 1GFDA 1U06A 1A0NB 3LGFA 1VQPT 4J5YA 1PCXA 4C92E 3QWYA 2B86A 3H8ZA 2M16A 4HCKA 2OTJA 2VVKA 3TVTA 1W6XA 1YNZA 5LJ5h 3RDVA 4C8QA 3FJ5A 1VQ7T 1Q86U 2DF6A 2HNIA 3RR6A 3M57A 5GAN2 2BIVA 4LDVA 5I2SA 1BI1A 5GAOp 1K9MC 1M1KU 3BDLA 3CD6Q 4M7DF 1CKBA 3ZBDA 3M9QA 1WHHA 3V8KA 3CCMT 1JEGA 2XMFA 5AYFA 1RADB 5FLXE 1G2BA 4DQ2A 5GMKe 5GAOq 3CMEA 2ED0A 3CCVT 1EIFA 2YSQA 4F17A 1VQ6A 2ATCB 2CYZB 3KFVA 4F7UE 2F69A 1BCOA 2DTHA 2WSCE 2DLPA 3HL8A 4ELZC 3PVLA 1WLPB 2G6FX 1VQ7A 4J9FA 4OMPA 3ASKA 4FT2A 3RKXA 1TWBA 3G71T 1D1AA 3VYGA 1YJWT 2E3HA 2F1LA 4J9BA 4WF2A 2KRMA 1UGVA 4PFPA 2YRCA 1GBQA 1B07A 2LZ6B 2VXEA 1XQHA 4Z89A 3HFOA 2XDPA 2K5IA 4L59A 2J05A 3CCVA 3CC7A 1ZUUA 2SRCA 1XNIA 2D8JA 4C0FA 3OBWA 2M02A 5GANe 2CT4A 2HSEB 2X9HA 4JJCA 3L1AA 1AWJA 2E6ZA 3PGGA 1M9SA 2BZ8A 3NHNA 5KE3A 2CH4A 1AZEA 3FRNA 4M78D 4AMCA 5FRNA 4JLGA 2V8IA 2KSSA 4JJNK 1OU8A 4P5NA 2MPXC 2L2PA 4XTYA 1V76A 3UDCA 3QYGB 3G71A 2EAYA 1YJWA 2DL4A 4FT4A 4RCCA 4BI3A 2K6DA 4C92D 1VQ8T 2HL5C 3E1SA 1QKXA 2A08A 2MMPA 1T0HA 1VYUA 2HBPA 3QHSA 4II1A 4J9CA 4AG2C 3RKWA 1UGQB 5AT1B 4EMKC 3MO8A 2COWA 3CEYA 4ZTJA 3RMQA 5GAN8 3FIFA 4E7LA 2VB6A 1Y57A 1BU1A 1Q82C 1E7OA 4Y91A 1GXIE 1VQ6Q 5IHIA 2HEQA 2ZPBB 5CKHA 2LCCA 3MHXA 1VQPQ 1WIEA 2NWMA 1LNXA 5M9OA 1SRLA 2HD0A 3VYHB 2HKNA 1NJIU 2RHZA 2ROTA 4Y92A 1VQ8A 3C0CA 4C0ZA 1WA7A 5A0GA 1M3AA 5GMKl 2QA4T 3Q1JA 2CP7A 4EMKB 4X34A 1ZQ1A 4XU0A 1SEMA 3QWXX 3NGPA 1WFWA 3CCMQ 4OVAA 3NMZC 4NOYA 1PNJA 5KYXB 2QXFA 5LJ3e 4EIKA 2L3RA 2X4JA 4OMQA 1KD1R 2RQUA 3REAB 5KYNA 1I81A 2E6NA 3OW2A 2EYYA 1TG0A 4ANJA 1WYXA 4D8KA 1MNDA 4LDXA 4M78G 3WVEB 2V26A 3SHWA 2DERA 1HYOA 1W70A 1PD1A 2E41A 3RBBB 3UPUA 2LJ0A 3OS5A 4EMHA 2SEMA 2IIMA 3MP6A 2J6FA 1Q7YC 3JSCA 4C92G 2LX9A 2QQBA 3PNWC 4EMKA 2H8HA 3QSUA 2Y4XA 2V8KA 4DOWA 3G71Q 3VUBA 2QA4A 1VQKQ 1AEYA 3KXTA 3UA6A 3L2RA 4QVDA 2CZ1B 5KYXA 1YJWQ 4XU1A 4D6WA 2MF2A 1N5ZA 3A8OB 1LCKA 3BDUA 4E7ZA 4NS5A 1Q81U 5GJVB 4JZ3A 2KMTA 5GJWB 2HQXA 2EGAA 2FRWA 1YITA 4LD6A 6AT1B 2DL8A 1KK7A 4M77F 4F04B 4HT9A 5KH6A 1R0BG 3AHUA 3LWIA 2KYMA 4RMOA 4D8DA 5DLOA 3S3OA 1UGRB 5CKEA 4IUVA 3SFMA 2GFUA 1XTDA 2YDLA 1QLYA 1SG5A 1OX8A 4M75E 1QVGP 3OSSC 1SHFA 1QVGS 2XD0A 1F1BB 3OQ5A 1TU0B 3HKSA 3O8VA 2CP5A 4OMMA 4FYWB 1UB4A 1VQ8Q 5GANd 3L2VA 1K9MR 1BYMA 4FYYB 3OYHA 2DXUA 1AVZC 2DPPB 2VXFA 4BI8B 1N8RR 3VS7A 1NLPC 4QVZA 3VS5A 2LC4A 3VS4A 1MHNA 1FYNA 3INZA 2F5KA 2RD1A 1OPKA 2EGCA 2KGTA 4R55A 3GOXA 1X43A 2D0QB 2HL3A 4N4GA 3OYGA 1M1GA 4Z02A 2DIGA 3JCMW 2K7AA 3LX7A 1PC0A 1VQ9T 2M9UA 2DMOA 3PMIA 2HQEA 2YHTA 1ABQA 1S72A 3PIPA 2GCXA 3X24B 2DYIA 2QA4Q 1JJ2P 2GGRA 1JJ2S 5FU6C 4F16A 4JS4A 2FHDA 2JTEA 2C06A 3L2UA 3E2UA 4LN2A 3TSZA 1ZSGA 1JBMA 1M90U 3EG3A 2MWOA 2YRDA 4M7AG 5HK3A 3LH0A 3RESA 5LJ5e 1IZ6A 2RI5A 4OB0B 4A4HA 2E4HA 3C12A 3JCMP 4KUIA 2HKQB 5I11A 1YN8A 2P4TA 1YFNA 1Y7XA 1WHMA 4KRTA 5KCOA 2PUKB 3V7CA 4M7DE 1ZLMA 2RQWA 4CI0C 5FU6B 3AT1B 2F2WA 2A36A 4PJJA 5KYWA 1NLOC 3X28B 2DE0X 2EQIA 2HSPA 2PNIA 4OMLA 3META 4BB7A 2DBMA 3BE3A 4M75D 2QI2A 4BI4A 3H0IA 1K8AC 4J9IA 3EFRA 3CCQT 1X01A 2EFIA 2CP6A 2COZA 4VUBA 3L42A 1KQSP 4EDUA 3JV3A 1KQSS 3OYIA 4V2SA 2K3XA 1G3SA 1H8KA 1E6HA 2J6KA 1MGQA 2XKOC 2VV5A 1PD0A 3V7RA 3OYKA 3OA6A 2KK4A 5KYYB 1PWTA 3QDFA 2P0KA 1OPLA 3RKYA 5GAN3 3UT1A 4EPCA 4KH1B 4FL6A 1GRIA 3CCSQ 3P8HA 2EPDA 1YBYA 1J3TA 3TREA 2OTLT 4IKFA 4K11A 5FW9A 1V1CA 4PLIA 2QDYB 1M1FA 3CCQA 2A0FB 1PSFA 4MZPA 5GAN5 3JB9F 3JCMV 4LD9K 1U1SA 3CC2Q 1TXQA 4DBQA 2KEAA 4FSSA 2PVOB 2DRMA 2ZPHB 1X2KA 2F2VA 4M77C 3OYJA 2KVQG 5KYYA 4BDYA 2ROLA 4JJBA 3HFNA 3H0HA 1OU9A 3OSVA 1N6AA 2I0NA 1LVKA 1VQ9Q 3EG1A 4PJOF 3URGA 5CCAA 3A8HB 1Q7YR 1AT1B 2OTLA 4J9GA 4XU2A 1N27A 2XG8D 4FW2A 4C0DC 2DK3A 1VQ5T 2X51A 2O2OA 4M75G 1YJ9T 1KG1A 4KULA 2MYSA 2WSEE 3ZL7C 2BE9B 2GTJA 3OYEA 2MI6A 3REBB 3E9GA 2AIRB 4M77B 4M7DD 4RTWA 2M1HA 2RI3A 4DEYA 3OYFA 2PU9B 8ATCB 2ED1A 3NFCA 2RHUA 5GAMd 2EQKA 5GANj 3CBMA 3QXEB 1JO8A 1IREB 3FJPA 4ESRA 1R8OB 4DBHA 2COYA 2VYTA 3TEEA 2RJEA 2JZ2A 2QQSA 3KBGA 1W1FA 1VYVA 1V29B 3C4SA 5GAN6 1MMAA 2LT4A 3BFMA 4C0DB 2JOYA 2RJFA 3M0TA 4X1VA 2DAQA 2DNUA 2VGNA 2HQHA 2XU8A 1VQ5A 1YCYA 1WGSA 4OB2B 1CSKA 2QEXT 3EGXB 1JXOA 4AFUC 4HCZA 2DEQA 1P92A 4M77A 2RI2A 4AFZC 1KC8R 4DOVA 2O9VA 4J9DA 2FPEA 4C5IA 2RQVA 5J26A 2V1QA 3CCQQ 2CDTA 2AHJB 3MCAB 1MMGA 1U1TA 2K57A 1IHVA 8AT1B 2CSQA 1M3CA 1ZBXA 1EFNA 5GAN7 2KDSA 4M7AC 1RAEB 4KH0B 4DA4A 1RAHB 4BUGA 4E6RA 3G1JA 3ULRB 4J9HA 2L3SA 2DL7A 1WJSA 1Y0MA 3EGXA 4HVVA 3CPWA 1G3YA 2GFAA 3A1PA 1Y07A 2JTMA 1AZGB 4E7JA 2CH4W 1OV3A 1UGSB 1N8RC 3QJ6A 1YJNT 2KRSA 2LQKA 4JDSA 2OTLQ 2FYKA 3T9NA 2QK0A 4M7DG 1UUEA 4IUUA 4PJLA 3O5ZA 2YUOA 2QQRA 5D6WA 1U5SA 4O5VA 2OAWA 4J83A 1VQPA 4HCCA 5FRMA 1I5OB 1Z9ZA 2L3QA 3LLRA 3A8GB 1M8MA 3L2QA 4PJNA 3OS1A 3X25B 9ATCB 1W2BA 4MDXA 2R5AA 3X20B 1NEBA 2HDAA 5GAOm 3QYHB 2JM8A 1VQKT 2X3XD 2CUDA 1QVFA 3JCMd 2RB6A 3VS2A 3CCMA 2DX1A 4LUEA 4C8QE 1BI0A 3QKJA 1NEGA 4XTXA 4A4GA 1IGUA 2FB7A 2X4WA 4PJMA 4B6MA 2W0ZA 1VQ5Q 1YJ9Q 1GCQC 1OX9A 1MMNA 2DJQA 3VU3C 2EYXA 3NTHA 2FPFA 1WJRA 2RQRA 3F70A 1UHCA 4GBQA 4RTTA 1K8AR 3OYAA 2K5LA 3MP8A 5HCKA 1H92A 1D3BB 3I5RA 1WHKA 3C95A 1VQKA 5C6SA 5GMKi 1LPLA 2QASA 4QW2A 5IXFA 1I07A 1SKUB 1QP2A 4FIBA 4XTZA 4JRQA 3MEAA 1AD5A 1M30A 1RACB 5J3BA 4EMGA 2KNBB 3EG0A 1K0SA 3E9FA 4PJOC 4TVRA 1HJDA 2P0PA 1KQ2A 2DM1A 5CKDA 4M4ZA 3D7SB 2RA2A 2QEXQ 2L5QA 3HSBA 2K3YA 5HK0A 1HK9A 2R58A 3DB3A 3J81E 2LNVA 1WXTA 1RI9A 5EC7A 2O31A 1C0MA 1ABOA 1D3BA 1JXMA 2ZGWA 2ZPEB 3P8BB 2JS0A 2QYZA 1MUZA 1VQNT 3CMAT 1VIFA 3G4ST 4C5HA 1NYFA 3QIIA 1JB0E 2DO3A 3H41A 4PJOB 2GQVA 2LTOA 2D6FA 1S1NA 1GCQA 3QDRB 3S3MA 2HCKA 1ZBJA 2JUFA 2RK1A 5GAMj 1H3ZA 1KJWA 2LMJA 2DD4A 3S6WA 3CCLT 4BACA 3L2WA 1YJNQ 2EBPA 3V8LA 1WXUA 2YUNA 4DEXA 2L3PA 2G3RA 4BY6C 3QJYA 1D0ZA 4C8QD 1QKWA 3H6ZA 4M78F 4C5EA 2AT1B 1VQNA 2YLCA 5CVIA 4PJOA 1UEBA 3G4SA 3V7SA 2KT1A 3VS0A 3UA7A 3JB9J 3SWNC 3GP8A 3OB9A 1QWEA 2K5FA 4MZTA 2Y90A 4HXJA 4IUTA 1NZ9A 5HY6A 2PQWA 5CIUA 2XK0A 3CCLA 2MK5A 3M55A 1IXDA 1FXXA 3GPLA 3EGDB 3LGLA 3THKA 1M90C 4BY6B 1IRXA 5ECAA 4Z8AA 1RLPC 2RN8A 3H0FA 1BB9A 1G83A 2GBQA 1X75C 1M2VB 2QDLA 3OBYA 4RTUA 3SWNB 4F7UG 3UATA 2AKKA 3M54A 2EQJA 4E7IA 1AWOA 2CZ6B 2DZ9A 2E70A 4E47A 2NYSA 3CCST 4C0GA 1UTIA 2V1RA 3E19A 1UFFA 1Q82U 2LP5A 2CZ0B 3CC4T 3NTIA 3EGDA 2ENMA 3EG9B 1KC8C 2KT8A 3CCUT 2EYWA 2K2VA 3PIOA 3CC2T 4LE9A 2JW4A 2R5MA 2DFUA 4C8QG 5C0MA 2D9TA 1M2VA 2EQMA 2EYQA 1K73C 3ZEHA 2YWWA 2DYBA 3SWNA 2KBTA 3EG2A 5D7UA 2QG9B 5CR2A 3HRUA 4RTXA 1RLQC 2EKOA 3A8LB 2EQUA 1QCOA 3CCJT 4WTOB 1QVGA 3CCSA 2RH2A 3CMAQ 1VQNQ 3G4SQ 1RAFB 1JRIA 2GNCA 5GAOl 2FZKB 3RNJA 1WX6A 3EG9A 4OB1B 2E5KA 3CC4A 1UGPB 1NJIR 5GANh 5D6YA 2LJ1A 1VUBA 2OX7A 3CCUA 4KUDK 3OYYA 1PRMC 1TH7A 2DEUA 3CC2A 2CGHA 1NG2A 2DBKA 3JCMX 2VASA 2KROA 3CCLQ 4ZTFA 1ACMB 2NUTB 2HMAA 2P0QA 5KYWB 1QMCA 3PFSA 1PSEA 3QZ9B 4KT0E 2KI7A 1TUGB 1NPRA 4M7AF 3PVQA 2CSIA 3PMTA 1MNEA 3CCJA 1VQ9A 3BY7A 3NPFA 4Y28E 3TCJA 2ZZDA 1OZ2A 3JB9D 1PM3A 2FO0A 5GAMg 1C6VX 3VS1A 3LW5E 3FLGA 5CQXA 5LJ3d 1OQKA 1BCMA 2E1HA 4PK4A 1PKSA 2V8JA 4AG1C 2L8DA 4ZN3A 4PFZA 5L23A 2NUTA 4KGVB 4Z88A 1WHGA 4MMKA 4PNOA 2X35A 4L5GA 3GIBA 2K9GA 1YI2T 4RKUE 1BK2A 1YCSB 2AZSA 2DL5A 1YWPA 2QTXA 3OYNA 5CKBA 4KBMB 1K0XA 2H3JA 4HA8A 4M78C 4GLMA 4OGCA 5DLQE 4XTWA 1K1ZA 3CXCA 4AT1B 4JRKA 1O75A 2PTKA 1D1BA 2E3IA 4KGXB 1CKAA 2DL3A 2XDBA 2EJFA 4C92C 3EHQA 2E5QA 1Q95G 3CC4Q 4RUGA 3EFSA 4HVUA 1YIJT 4RTYA 2HBWA 2A37A 3CCUQ 2AK5A 1WNLA 4QT7A 2DKGA 1QVPA 1KQSA 5GMKj 1O9SA 3EFOB 1HXDA 1U8RA 4J6WA 3SDZA 3I55T 3QBYA 1EZZB 4M78B 2BTTA 1SF9A 2YRVA 2RNAA 3MJXA 3QO3A 1DJ7B 3RERA 2ESWA 2MWPA 5GANf 4KGZB 1Q86C 4J7IA 3EHRA 1G3WA 2LDMA 1SSFA 2RF0A 5KYUA 1NPPA 3CCJQ 1M1KC 2ECZA 1T3SA 4IUPA 5HKCA 4BD3A 2OJ2A 2HZYA 3UWNA 3DLLA 3MKDA 3ER0A 1PG5B 1X6BA 2BZXA 1ZA1B 2BUDA 1I0CA 1YIJA 4XTVA 1IGQA 4OP0A 2IVWA 3EFOA 1VQMT 2NUPB 1VQOT 4RG8A 4M75F 3HRSA 3JCMg 4M78A 2AKLA 3FC3A 2CT3A 2R57A 2CP3A 3CCET 3M59A 2DXCA 4B9XA 1M90R 2FL7A 4JLIA 4MDWA 3EH1A 1WXBA 1Y96B 3HHTB 1X6OA 1BI3A 4C92A 3JCMb 2J06A 4DBRA 3LWHA 2FZGB 2X3WD 3JCMQ 2D0NA 4MZMA 5GAOn 4JJDA 1HSQA 2DILA 2J6OA 5CQYA 5A0DA 1ARKA 1YWOA 3M5AA 1KSWA 2NUPA 1OEBA 4NL2A 2FRYA 1TOVA 1RL2A 1YJ9A 1K9AA 3RIRA 2WACA 4ZNXA 2OTJT 2BKDN 2ABLA 2AZVA 1WZOA 4FYVB 4A4FA 3A5ZB 2H3EB 3CCEA 5LJ5d 5GAMh 4ME7A 1TTHB 2O01E 5I2MA 4A4KA 1Y96A 2MIOA 1YI2Q 3M0SA 3CPWP 3CPWS 1IHWA 1KHCA 1RAGB 2KRNA 1KIKA 2CKKA 1K73R 4OMNA 1BBZA 2OI3A 1D09B 1W4SA 1ZX6A 4XK8E 2NUZA 3DLMA 1ZHIA 2E12A 2LCLA 3DKMA 5I21A 2JTFA 2E65A 3I56T 3I5SA 4XTUA 2QEXA 4JRIA 3VJPA 4F14A 2WSFE 1M27C 3VS6A 3CCRQ 2PUOB 3TSWA 3EH2A 2HAXA 4OGEA 1W2BP 2ZPFB 1W2BS 1YIJQ 1D1CA 2M51A 3M58A 5LJ3j 4QQDA 4L6V5 1QVFP 4M7AB 1UJ0A 1WQ7A 1QVFS 4M77E 2RHYA 1KD1U 3I55Q 3DB4A 5J39A 1VQ4Q 2ZCFB 4WCIA 4MMLA 3CC7T 2JJ9A 1NJIC 2LJ3A 2ZPIB 5LL6S 3GLXA 2F2XA 2O88A 1JU5C 1NYGA 2B8AA 2RQTA 3I56A 2RJCA 1PHTA 2JMAA 1VYTA 4BE2A 4BDZA 1YJNA 2KR3A 1LJOA 7AT1B 5DM7R 3QUIA 3M53A 2P4RA 2RHXA 2L89A 4J8OA 4A54A 1VQMQ 4M7AA 3M0QA 1M2OA 1VQOQ 2KY9A 4CC2A 4FSXA 3GF5A 5FWBA 5IXBA 4LNPA 1I1JA 3CCEQ 4E7SA 4OB3B 1N9SA 3QPHA 4QVCA 5FU7C 2PVGB 2FPDA 2DJZA 1PRLC 3VS3A 1XOVA 1BIBA 3S3NA 1HD3A 3JCMh 2QAZA 1UG1A 3C94A 3VKIA 2X4XA 1UJYA 2KAFA 3M4GA 1AWWA 2CZ7B 4X9DA 1AWXA 4OMFB 1VQLT 3A8MB 2M0OA 1Y71A 3HPWA 4FCYA 5GAMf 3U23A 2RHIA 1RABB 1Q81C 2M0YA 2IPOB 2LVMA 3FDRA 1MMDA 1SPKA 4RTVA 2MAMA 3RUXA 2PVDB 4J7FA 2OTJQ 3MEVA 5IT9E 5A2QE 4M75C 4XAXB 2EJGA 5FU7B 4LXCA 4ATOA 1K9MU 2GQIA 5GANg 4ELYC 2FG0A 2PZ1A 1N8RU 1BIAA 4M7AE 3M0RA 1YHQT 1WDXA 2E64A 1X27A 5LJ5f 3CMEQ 2FEIA 3OW2P 1H641 1Q86R 1VQLA 3OW2S 2KE9A 1WPYA 4M77D 5I22A 1WHJA 5FROA 3I56Q 2CP2A 4AFQC 1M1KR 3M56A 2QQAA 3EGUA 1MV0B 4M75B 3UF4A 4IIMA 4OMOA 4R56A 4FU6A 5IH2A 4FYXB 4A53A 1VQ7Q 1AHJB 2EKHA 2NLUA 1RUWA 1RI0A 4PLLA 5CK9A 2BE7D 2JXBA 3OYDA 2CS7A 3X26B 3A98A 2YUQA 1YHQA 3CMAA 1IB8A 4ZGJB 1XJWB 3PT9A 3N5BB 4J9EA 2K79A 3SB2A 1OULA 2JMCA 5KCHA 3JAME 1VOMA 1QCFA 2FVUA 5LJ5j 2EGEA 3CCVQ 4BE0A 3CC7Q 1NE8A 1OI1A 3ME9A 3JB9I 4DBFA 1YITT 2JM9A 4C92F 1G3TA 1X69A 2LX7A 4QQGA 4M75A 2EIFA 2C0TA 1K76A 1UECA 4ZGEB 4E7HA 1QQJA 1UE9A 2LCSA 3R6NA 4A63B 3VV0A 5LJ3g 2QGFB 4B9WA 2DXBA 1QWFA 1EX4A 3OMGA 2C0IA 3JCMf 4HCBA 4E2FB 4M7DC 1KFZA 4QKUA 1TS9A 4Q5WA 2RPNA 4UC4A 2W10A 4R0KA 4JRPA 2MOXA 1FX7A 3M0UA 1TSFA 5GMKh 1MV3A 1X6GA 4M77G 2K4YA 4F7UF 4RCBA 1FMVA 3QG1A 4X9CA 4CC7A 2VKNA 4PJOE 3CBPA 4RTZA 4M7AD 4FM4B 3H9NA 3OYBA 1VQLQ 1RAAB 3M4YA 1BKBA 5L8RE 1SSHA 2E10A 2VC8A 2RJDA 1ZSZC 4HVWA 3MEWA 3HP9A 4M7DB 1S72T 2RO0A 2JVVA 2FZCB 1I4K1 4C8QF 2EW3A 2EYZA 3RMSA 1M5Q1 1GBRA 2JS2A 1QCNA 4QQ6A 2QGGA 3OYLA 3LH5A 3NTKA 4CC3A 2DXTA 1GCPA 1YHQQ 1D0XA 4JUVA 1OZ3A 2P84A 3TQ7P 5IN1A 4J6XA 4HKEA 2LQWA 2DTIA 2LRQA 3WXMB 1R0CB 1ZSZB 3TU4K 2ZPGB 4M7DA 1QW1A 3BW1A 5GAMe 4GY5A 1B34B 3CQTA 3M0PA 2MCNA 2J7IA 2LNHB 1Q7YU 1K4US 2RM4A 3OYMA 4XU3A 3OS0A 2O4XB 2DD5A 1VA7A 1B3QA 3SD4A 3CPFA 2OAUA 2KXCA 3G6ET 1FMKA 3EAEA 4PKCC 1LOJA 2GTOA 4JS5A 1VIEA 3I35A 2DIQA 4A4EA 2JNGA 2DVJA 4N0AC 3GNGA 2CREA 4YTLA 1ZA2B 3ZFJA 1ZSZA 3KUFA 2VGMA 4JPBW 3CBOA 1QP3A 1YITQ 1B34A 3GBQA 2LQ8A 1JJ2A 2YUPA 4RG2A 2O4XA 3G7ZA 5GAOr 3OY9A 1KHIA 1Q81R 3OMCA 4PJOD 1ZUKA 1U3OA 3CXCP 3G6EA 1SHGA 3CXCS 1SRMA 3OS2A 1C1AA 2Z0WA 3P8DA 3VUZA 4N4HA 1G8XA 3R6OA 4IURA 4CC4B 2A7YA 1G5VA 2DETA 5EG2A 1YP5A 1KC8U 3JB9H 2GF7A 3HTRA 5LJ5g 5DY9A 1TUCA 2LT1A 1M8VA 4AFSC 3J80E 5LJ3h 1M4ZA 2XIDA 2RK2A 1K73U 5KE2A 2EVRA 5KYUB 2BZYA 3JRZA 2C0OA 2VUBA 5D6XA 3CCRT 5CAIA 4C5GA 1Q82R 2KXDA 2DZCA 4LDWA 1YI2A 3CD6T 3JCMJ 1BI2A 2JT4A 5IHNA 2KYBA 1FWZA 1WHLA 4CRIA 2I2LA 2F5TX 4N0AA 1WQWA 3GNFB 4LDUA 1OOTA 1S72Q 1VQ4T 1ZUYA 4LDYA 3JCMe 2KQWA 3VRZA 3JB9G 2YXYA 4ORZA 1TUDA 1X2QA 4LUDA 5A0LA 3MEUA 4ZGDB 1FMWA 1WJQA 2K3BA 3HRTA 2D8HA 1M3BA 4C92B 3FEOA 4OF1A 2A28A 1PKTA 2VWFA 3CCRA 5CO7A 5CKFA 4HT8A 4XQ3A 2RMOA 3PTAA 3JCMc 3SEMA 3OYCA 1GFCA 3VRYA 3MPUB 3CD6A 4PJOG 2YLBA 1T3LA 4FW1A 5GMKm 1JQQA 1Z9QA 2CP0A 1WI7A 3I55A 5IAYA 2YT6A 1GL5A 4PL6A 2IG0A 1T0JA 1VQ4A 1KD1C 2CUBA 1NBEB 4C8QC 2EWNA 3G6EQ 2ZAEA 2XDDA 1KQ1A 2DVEA 2A3LA 4JZ4A 3L2ZA 1H3HA 2K2MA 4PFOA 4F7UB 4O6JA 4NL3A 2XICA 3IQLA 2O9SA 4J6YA 1K8AU 3LYIA 3PE0A 1OYXA 1I5LA 2DRKA 2Y4YA 4ZN1A 1AOJA 1IO6A 1B7TA 1RAIB 2DA9A 2EJ9A 3MP1A 2L0AA 1VQMA 2XHCA 1VQOA 1E6GA 3WVDB 1UHFA
chains in the Genus database with same CATH topology
5GAN4 2X4XA 2QQ9A 4IUQA 2X4YA 3X28B 2KAFA 1X75C 3M4GA 2CZ7B 4X9DA 3META 1N9RA 3V8JA 4BB7A 4OMFB 1VQLT 3A8MB 2M0OA 3OBYA 4M75D 1Y71A 3HPWA 2QI2A 3SWNB 4C8QB 2XI9A 4BI4A 4F7UG 5GAMf 1K8AC 3CCQT 2RHIA 2EQJA 3EFRA 3M54A 4E7IA 1X01A 2EFIA 1Q81C 2CZ6B 2DTOA 2DZ9A 2E70A 5LJ3f 4E47A 2LVMA 3FDRA 4VUBA 3L42A 4GLKA 4EDUA 4N4IA 4F7UA 3CCST 4C0GA 3OYIA 1KQSS 4V2SA 2MAMA 4M78E 2K3XA 1G3SA 2PVDB 4J7FA 3QZ5B 3E19A 3RUXA 4E7KA 1MGQA 3MEVA 5IT9E 1Q82U 2CZ0B 2JN0A 3CC4T 4BE1A 5A2QE 4M75C 2XKOC 2VV5A 4XAXB 3CMET 2EJGA 1I8FA 3FB9A 3NTIA 5FU7B 3V7RA 4ATOA 1K9MU 1KC8C 3J7AF 5GANg 3OYKA 3OA6A 3CCUT 4ELYC 2K2VA 2KK4A 1VQ6T 2P0KA 3PIOA 3RKYA 5GAN3 3LGFA 3UT1A 1N8RU 1BIAA 1VQPT 4M7AE 3CC2T 4EPCA 4J5YA 4C92E 4FL6A 1YHQT 2R5MA 4C8QG 3P8HA 2E64A 5C0MA 3H8ZA 2D9TA 2M16A 1YBYA 2OTJA 2EQMA 2EYQA 1K73C 3TREA 3ZEHA 2OTLT 4IKFA 5LJ5h 3SWNA 4C8QA 5LJ5f 1VQ7T 1Q86U 2HNIA 1H641 5CR2A 3M57A 5GAN2 1VQLA 4PLIA 3OW2S 2BIVA 1WPYA 4M77D 4LDVA 5I2SA 3HRUA 1BI1A 2QDYB 1M1FA 2EKOA 5GAOp 3A8LB 1K9MC 3CCQA 2EQUA 5FROA 1M1KU 3BDLA 4M7DF 5GAN5 1PSFA 4MZPA 3JB9F 3CCJT 3JCMV 3ZBDA 4LD9K 1U1SA 3M9QA 3M56A 3V8KA 3CCMT 1QVGA 3CCSA 2RH2A 5AYFA 2QQAA 4M75B 1JRIA 5FLXE 5GAOl 2PVOB 4DQ2A 5GMKe 2ZPHB 5GAOq 4OB1B 4R56A 3CC4A 1UGPB 4FU6A 4M77C 3OYJA 4A53A 3CMEA 5GANh 3CCVT 2KVQG 5D6YA 4BDYA 1AHJB 2NLUA 1EIFA 1RI0A 1VUBA 3HFNA 4PLLA 5CK9A 3CCUA 4KUDK 1VQ6A 3OYYA 2CYZB 3OYDA 2CS7A 3OSVA 1TH7A 4F7UE 2F69A 1N6AA 3X26B 2DTHA 2WSCE 3CC2A 2CGHA 3HL8A 3JCMX 4PJOF 5CCAA 3URGA 3CMAA 1YHQA 3A8HB 2P0QA 4ZGJB 4ELZC 3PT9A 3N5BB 4ZTFA 3SB2A 5KCHA 3JAME 2OTLA 3PFSA 1PSEA 3QZ9B 1N27A 4XU2A 2FVUA 4KT0E 5LJ5j 1VQ7A 2XG8D 4C0DC 2DK3A 4BE0A 1VQ5T 3ASKA 4FT2A 4M75G 1NE8A 1NPRA 1OI1A 3ME9A 4KULA 3RKXA 3JB9I 3G71T 1YJ9T 1YITT 4M7AF 2WSEE 4C92F 3VYGA 1G3TA 1YJWT 3PMTA 4QQGA 4M75A 3CCJA 2EIFA 4WF2A 1VQ9A 3OYEA 3BY7A 2MI6A 2VXEA 3E9GA 4Y28E 3TCJA 4M77B 1XQHA 2ZZDA 4M7DD 1OZ2A 2M1HA 2RI3A 3HFOA 4ZGEB 3OYFA 2PU9B 2XDPA 2K5IA 4L59A 4E7HA 3JB9D 3NFCA 2RHUA 5GAMg 5GAMd 3CCVA 2EQKA 5GANj 3CBMA 3QXEB 3LW5E 3VV0A 3FLGA 1IREB 3FJPA 5CQXA 5LJ3g 3CC7A 1R8OB 5LJ3d 4B9WA 2DXBA 2E1HA 2V8JA 1XNIA 3OMGA 2L8DA 4ZN3A 4C0FA 3OBWA 2VYTA 3JCMf 3TEEA 5GANe 2RJEA 4HCBA 2JZ2A 3L1AA 4M7DC 2QQSA 4MMKA 3KBGA 2E6ZA 4PNOA 4Q5WA 1V29B 3C4SA 2X35A 3PGGA 4L5GA 1M9SA 5GAN6 3GIBA 5KE3A 2LT4A 3FRNA 4UC4A 4M78D 3BFMA 4C0DB 1YI2T 4RKUE 5FRNA 4JLGA 2JOYA 2V8IA 2KSSA 4JJNK 2RJFA 4JRPA 1FX7A 4P5NA 2DAQA 2XU8A 2VGNA 5GMKh 4XTYA 1VQ5A 1YCYA 3UDCA 3QYGB 4M77G 1WGSA 2K4YA 4OB2B 4RCBA 4F7UF 3G71A 2QEXT 2EAYA 3QG1A 4X9CA 2QTXA 4HCZA 3OYNA 1YJWA 4KBMB 4FT4A 2DEQA 1P92A 4M77A 2H3JA 4PJOE 2RI2A 4RCCA 3CBPA 4HA8A 4M78C 4BI3A 4M7AD 4DOVA 4FM4B 4C92D 1VQ8T 3OYBA 4OGCA 3E1SA 5DLQE 1BKBA 2MMPA 3M4YA 4XTWA 5J26A 5L8RE 4C5IA 2HBPA 3QHSA 4II1A 3CXCA 2E10A 2VC8A 2RJDA 2AHJB 3MCAB 3RKWA 1U1TA 2K57A 1UGQB 4JRKA 1O75A 4EMKC 3MO8A 3MEWA 3HP9A 1ZBXA 3CEYA 5GAN7 4M7DB 2KDSA 4M7AC 4ZTJA 1S72T 3RMQA 4DA4A 2EJFA 2RO0A 4C92C 2XDBA 2JVVA 1I4K1 2E5QA 4C8QF 4BUGA 3FIFA 5GAN8 4E7LA 3EFSA 1M5Q1 3RMSA 1YIJT 1Q82C 4Y91A 1WJSA 4QQ6A 1GXIE 1WNLA 3OYLA 2ZPBB 2DKGA 1QVPA 1G3YA 3NTKA 5CKHA 3CPWA 1KQSA 2LCCA 2GFAA 3MHXA 5GMKj 1O9SA 1Y07A 2DXTA 1HXDA 2JTMA 4E7JA 1LNXA 5M9OA 1UGSB 1N8RC 3QJ6A 1U8RA 4J6WA 3SDZA 1YJNT 3I55T 2HD0A 3QBYA 2LQKA 4JUVA 1OZ3A 4M78B 2YRVA 3VYHB 4JDSA 1NJIU 2RHZA 2FYKA 3QO3A 3T9NA 5IN1A 4J6XA 4HKEA 1DJ7B 3RERA 2MWPA 4M7DG 5GANf 1VQ8A 4IUUA 4C0ZA 1KG1A 2QA4T 5A0GA 5GMKl 1Q86C 4J7IA 2DTIA 2LRQA 1G3WA 3WXMB 2LDMA 3TU4K 1SSFA 3Q1JA 2QQRA 5D6WA 2ZPGB 4EMKB 4M7DA 1NPPA 1ZQ1A 1QW1A 4J83A 4O5VA 3BW1A 4X34A 4XU0A 1VQPA 1M1KC 4HCCA 3LLRA 4GY5A 5GAMe 5FRMA 1B34B 3A8GB 4OVAA 4NOYA 4IUPA 5HKCA 2QXFA 4BD3A 3L2QA 5LJ3e 1Q7YU 2RM4A 3OS1A 3OYMA 2L3RA 2X4JA 4XU3A 3X25B 3OS0A 3UWNA 3DLLA 1W2BA 4MDXA 3ER0A 2O4XB 2DD5A 1I81A 2E6NA 3OW2A 2R5AA 3SD4A 3X20B 2OAUA 2BUDA 3CPFA 5GAOm 1YIJA 3QYHB 4XTVA 3G6ET 4LDXA 3EAEA 4M78G 4PKCC 3WVEB 1LOJA 1VQKT 4OP0A 1VIEA 4JS5A 2IVWA 1VQMT 1VQOT 4RG8A 2DIQA 2E41A 4M75F 4A4EA 3HRSA 2JNGA 3UPUA 3JCMg 1QVFA 3JCMd 4M78A 2RB6A 3OS5A 3FC3A 3CCMA 4EMHA 2R57A 3CCET 3M59A 3MP6A 2DXCA 4N0AC 4B9XA 4C8QE 1BI0A 3GNGA 3QKJA 1Q7YC 4XTXA 4YTLA 4A4GA 2FL7A 3JSCA 2FB7A 3ZFJA 2X4WA 2LX9A 2QQBA 2VGMA 3KUFA 3PNWC 4JLIA 4MDWA 4C92G 4EMKA 3CBOA 1Y96B 2Y4XA 2V8KA 3HHTB 4DOWA 3VUBA 2QA4A 1QP3A 3QSUA 3KXTA 1X6OA 3L2RA 1B34A 1BI3A 2CZ1B 4QVDA 2LQ8A 3VU3C 4C92A 1JJ2A 3JCMb 3NTHA 4XU1A 4D6WA 3LWHA 2MF2A 3JCMQ 3A8OB 4RG2A 1WJRA 2O4XA 3BDUA 3F70A 4MZMA 4NS5A 5GAOn 3G7ZA 5GAOr 1Q81U 5CQYA 5A0DA 3OY9A 3OYAA 2K5LA 1KHIA 3MP8A 3M5AA 3OMCA 2KMTA 4PJOD 1D3BB 2HQXA 3G6EA 4NL2A 1RL2A 3C95A 3CXCS 1YJ9A 1VQKA 5C6SA 5GMKi 3RIRA 3OS2A 2WACA 1YITA 3P8DA 4LD6A 4N4HA 3VUZA 4QW2A 2OTJT 3R6OA 2BKDN 4IURA 4M77F 1QVFS 2A7YA 1G5VA 4HT9A 5KH6A 3AHUA 1QP2A 4FIBA 5EG2A 3LWIA 1KC8U 3JB9H 2GF7A 4XTZA 4JRQA 3MEAA 4RMOA 4A4FA 3A5ZB 5J3BA 4EMGA 5DLOA 5LJ5g 5LJ5d 5DY9A 3CCEA 3E9FA 4PJOC 2LT1A 5GAMh 4TVRA 3S3OA 4ME7A 5I2MA 1UGRB 2O01E 5CKEA 1Y96A 2P0PA 4IUVA 3SFMA 4A4KA 1M8VA 1KQ2A 3J80E 2GFUA 5LJ3h 1XTDA 1M4ZA 5CKDA 2XIDA 2RK2A 3CPWS 1K73U 2RA2A 1KHCA 4M75E 5KE2A 2CKKA 3OSSC 2L5QA 3HSBA 1QVGS 2XD0A 3JRZA 3OQ5A 2K3YA 2VUBA 5D6XA 5HK0A 1HK9A 2R58A 1W4SA 3DB3A 3CCRT 3J81E 5CAIA 2LNVA 3HKSA 4C5GA 3O8VA 4XK8E 1UB4A 2DZCA 3DLMA 1ZHIA 1D3BA 4LDWA 2E12A 5GANd 2LCLA 3L2VA 3DKMA 5I21A 2JTFA 2E65A 2ZGWA 2ZPEB 3I56T 3JCMJ 1YI2A 3P8BB 3CD6T 1BYMA 1BI2A 3OYHA 4XTUA 2DXUA 2DPPB 2VXFA 4BI8B 1FWZA 1VQNT 4CRIA 2I2LA 2QEXA 2F5TX 1VIFA 3CMAT 4JRIA 4N0AA 4QVZA 3VJPA 3G4ST 1WQWA 2LC4A 3GNFB 2WSFE 4C5HA 4LDUA 3QIIA 1JB0E 1MHNA 2DO3A 2PUOB 1VQ4T 3INZA 2F5KA 2HAXA 4OGEA 4PJOB 2GQVA 2LTOA 2RD1A 2ZPFB 4LDYA 3JCMe 2KQWA 4R55A 3GOXA 1W2BS 2D0QB 2D6FA 3QDRB 4N4GA 3S3MA 3OYGA 2JUFA 2RK1A 3JB9G 3M58A 1M1GA 4Z02A 5GAMj 1H3ZA 5A0LA 3MEUA 2DIGA 3JCMW 4ZGDB 3LX7A 5LJ3j 4QQDA 1VQ9T 2M9UA 1WJQA 4L6V5 3PMIA 2DD4A 4M7AB 2HQEA 3HRTA 1WQ7A 3S6WA 3CCLT 2YHTA 4M77E 4C92B 2RHYA 3FEOA 4BACA 3L2WA 4OF1A 1KD1U 3V8LA 3DB4A 5J39A 1S72A 3CCRA 5CO7A 3PIPA 2GCXA 5CKFA 4HT8A 4XQ3A 3PTAA 2ZCFB 3JCMc 4MMLA 3CC7T 1NJIC 3X24B 2G3RA 3OYCA 2ZPIB 5LL6S 3GLXA 4BY6C 2B8AA 3QJYA 4C8QD 3H6ZA 3I56A 3CD6A 4PJOG 4M78F 2YLBA 4C5EA 1JJ2S 2RJCA 5FU6C 4JS4A 5GMKm 2FHDA 1VQNA 2YLCA 5CVIA 3L2UA 2C06A 4PJOA 4BE2A 1UEBA 3G4SA 4BDZA 1YJNA 3V7SA 3I55A 5IAYA 4PL6A 1JBMA 1M90U 2IG0A 1LJOA 2MWOA 5DM7R 1VQ4A 3JB9J 1KD1C 3QUIA 4M7AG 3SWNC 4C8QC 3M53A 2EWNA 3GP8A 5HK3A 3OB9A 3LH0A 3RESA 2K5FA 2RHXA 2L89A 4J8OA 4MZTA 4A54A 2XDDA 5LJ5e 1IZ6A 1KQ1A 2DVEA 2RI5A 2A3LA 2Y90A 4OB0B 4M7AA 2KY9A 3L2ZA 4A4HA 4FSXA 3GF5A 4IUTA 1NZ9A 5HY6A 2PQWA 4O6JA 4F7UB 4NL3A 5CIUA 2XICA 3C12A 3JCMP 2XK0A 3CCLA 4KUIA 3M55A 4J6YA 1K8AU 4OB3B 1N9SA 3QPHA 4QVCA 1FXXA 5FU7C 3LYIA 3GPLA 2PVGB 1OYXA 1I5LA 3LGLA 2P4TA 2DJZA 4BY6B 1Y7XA 1M90C 2Y4YA 1XOVA 4ZN1A 5KCOA 2PUKB 3V7CA 1BIBA 3S3NA 2EJ9A 3MP1A 4M7DE 4CI0C 3JCMh 1VQMA 2XHCA 3C94A 5FU6B 3VKIA 1VQOA 5CKBA 3WVDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CAI A;  5GAN 4;  4C92 F;  5GMK l;  2DTI A;  2DZC A;  3M4G A;  4M75 A;  1D3B A;  4WF2 A;  4X9D A;  5GAN d;  1N9R A;  3V8J A;  4EMK B;  3BY7 A;  5I21 A;  4M7D A;  2E65 A;  2ZGW A;  4XU0 A;  3JCM J;  3BW1 A;  4M75 D;  5GAM e;  2VXE A;  3SWN B;  4C8Q B;  1B34 B;  5GAM f;  4F7U G;  4M77 B;  2DXU A;  4NOY A;  3EFR A;  4XTU A;  4M7D D;  2VXF A;  3HFO A;  3JB9 D;  1X01 A;  5LJ3 e;  2DTO A;  2DZ9 A;  2I2L A;  2RM4 A;  5LJ3 f;  4XU3 A;  4JRI A;  5GAM g;  4N0A A;  5GAM d;  1WQW A;  5GAN j;  4F7U A;  1I81 A;  4V2S A;  3FJP A;  4M78 E;  5LJ3 g;  5LJ3 d;  3RUX A;  3INZ A;  5GAO m;  2E1H A;  4XTV A;  1MGQ A;  4PJO B;  2RD1 A;  4M78 G;  1LOJ A;  2JN0 A;  4OP0 A;  3JCM e;  3JCM f;  5GAN e;  4M75 C;  4M7A F;  2EJG A;  1I8F A;  3FB9 A;  3L1A A;  3JB9 G;  4M7D C;  2E41 A;  4M75 F;  4MMK A;  3V7R A;  5GAM j;  3JCM g;  3JCM d;  4M78 A;  4PNO A;  2RB6 A;  5GAN g;  3JCM W;  5GAN 6;  3PGG A;  3GIB A;  5LJ3 j;  4EMH A;  4M78 D;  3RKY A;  5GAN 3;  3BFM A;  4M7A B;  4N0A C;  1BIA A;  1WQ7 A;  4C8Q E;  4M7A E;  2YHT A;  4M77 E;  4C92 B;  4J5Y A;  4C92 E;  3V8L A;  5GMK h;  4XTX A;  4XTY A;  4C8Q G;  1YCY A;  2E64 A;  2FB7 A;  4M77 G;  4C92 G;  4RCB A;  4JLI A;  4F7U F;  4HT8 A;  4EMK A;  2EAY A;  4X9C A;  4XQ3 A;  3QSU A;  1Y96 B;  2QTX A;  3JCM c;  5LJ5 h;  4MML A;  3SWN A;  4C8Q A;  5LJ5 f;  1B34 A;  2DEQ A;  4QVD A;  4M77 A;  4PJO E;  3VU3 C;  4C92 A;  2HNI A;  4RCC A;  3JCM b;  1H64 1;  4HA8 A;  4M78 C;  5GAN 2;  4XU1 A;  4C8Q D;  4M7A D;  1WPY A;  4M77 D;  4PJO G;  4C92 D;  3JCM Q;  4M78 F;  2YLB A;  5GAO p;  3BDU A;  4M7D F;  5GMK m;  5GAN 5;  4XTW A;  5GAO n;  3JB9 F;  2YLC A;  3QHS A;  3JCM V;  5GAO r;  1U1S A;  4PJO A;  3V8K A;  2E10 A;  3V7S A;  2VC8 A;  1JBM A;  3RKW A;  1U1T A;  2K57 A;  4JRK A;  4PJO D;  1LJO A;  4M75 B;  1JRI A;  1D3B B;  4EMK C;  5GAO l;  3QUI A;  3JB9 J;  4DQ2 A;  4NL2 A;  5GMK e;  4M7A G;  5GAN 7;  4M7D B;  5GAO q;  3SWN C;  4C8Q C;  5GMK i;  4M7A C;  3RIR A;  2EWN A;  4M77 C;  2EJF A;  4A53 A;  4C92 C;  5GAN h;  3RES A;  3RER A;  1I4K 1;  4C8Q F;  4A54 A;  4M77 F;  3FIF A;  5LJ5 e;  5GAN 8;  4HT9 A;  1KQ1 A;  2DVE A;  3AHU A;  2Y90 A;  4M7A A;  3EFS A;  1M5Q 1;  3HFN A;  3JB9 H;  3L2Z A;  4XTZ A;  4Y91 A;  4F7U B;  1TH7 A;  4EMG A;  4F7U E;  5LJ5 g;  5LJ5 d;  5DY9 A;  4NL3 A;  3JCM P;  4PJO C;  5GAM h;  1WNL A;  2DTH A;  2CGH A;  1M8V A;  1Y96 A;  2DKG A;  4J6Y A;  3JCM X;  4PJO F;  1N9S A;  1KQ2 A;  5LJ3 h;  4QVC A;  5GMK j;  2DXT A;  1HXD A;  1LNX A;  1I5L A;  3SB2 A;  2DJZ A;  4J6W A;  4JUV A;  4M78 B;  2RA2 A;  4M75 E;  4XU2 A;  5LJ5 j;  3V7C A;  1BIB A;  2EJ9 A;  2FYK A;  3QO3 A;  3HSB A;  4M7D E;  4J6X A;  4M75 G;  3JCM h;  3RKX A;  3JB9 I;  1HK9 A;  4M7D G;  5GAN f; 
#chains in the Genus database with same CATH topology
 5GAN 4;  2QQ9 A;  4IUQ A;  2X4Y A;  1N9R A;  3V8J A;  4C8Q B;  2XI9 A;  2DTO A;  5LJ3 f;  5FWC A;  3I9Q A;  2QTV A;  4GLK A;  4N4I A;  4F7U A;  1NM7 A;  1R77 A;  4M78 E;  3QZ5 B;  1UDL A;  4E7K A;  2JN0 A;  4BE1 A;  3CME T;  2D1X A;  1I8F A;  3FB9 A;  5IHK A;  4IIO A;  3J7A F;  1D0Y A;  2LQN A;  1VQ6 T;  1GFD A;  1U06 A;  1A0N B;  3LGF A;  1VQP T;  4J5Y A;  1PCX A;  4C92 E;  3QWY A;  2B86 A;  3H8Z A;  2M16 A;  4HCK A;  2OTJ A;  2VVK A;  3TVT A;  1W6X A;  1YNZ A;  5LJ5 h;  3RDV A;  4C8Q A;  3FJ5 A;  1VQ7 T;  1Q86 U;  2DF6 A;  2HNI A;  3RR6 A;  3M57 A;  5GAN 2;  2BIV A;  4LDV A;  5I2S A;  1BI1 A;  5GAO p;  1K9M C;  1M1K U;  3BDL A;  3CD6 Q;  4M7D F;  1CKB A;  3ZBD A;  3M9Q A;  1WHH A;  3V8K A;  3CCM T;  1JEG A;  2XMF A;  5AYF A;  1RAD B;  5FLX E;  1G2B A;  4DQ2 A;  5GMK e;  5GAO q;  3CME A;  2ED0 A;  3CCV T;  1EIF A;  2YSQ A;  4F17 A;  1VQ6 A;  2ATC B;  2CYZ B;  3KFV A;  4F7U E;  2F69 A;  1BCO A;  2DTH A;  2WSC E;  2DLP A;  3HL8 A;  4ELZ C;  3PVL A;  1WLP B;  2G6F X;  1VQ7 A;  4J9F A;  4OMP A;  3ASK A;  4FT2 A;  3RKX A;  1TWB A;  3G71 T;  1D1A A;  3VYG A;  1YJW T;  2E3H A;  2F1L A;  4J9B A;  4WF2 A;  2KRM A;  1UGV A;  4PFP A;  2YRC A;  1GBQ A;  1B07 A;  2LZ6 B;  2VXE A;  1XQH A;  4Z89 A;  3HFO A;  2XDP A;  2K5I A;  4L59 A;  2J05 A;  3CCV A;  3CC7 A;  1ZUU A;  2SRC A;  1XNI A;  2D8J A;  4C0F A;  3OBW A;  2M02 A;  5GAN e;  2CT4 A;  2HSE B;  2X9H A;  4JJC A;  3L1A A;  1AWJ A;  2E6Z A;  3PGG A;  1M9S A;  2BZ8 A;  3NHN A;  5KE3 A;  2CH4 A;  1AZE A;  3FRN A;  4M78 D;  4AMC A;  5FRN A;  4JLG A;  2V8I A;  2KSS A;  4JJN K;  1OU8 A;  4P5N A;  2MPX C;  2L2P A;  4XTY A;  1V76 A;  3UDC A;  3QYG B;  3G71 A;  2EAY A;  1YJW A;  2DL4 A;  4FT4 A;  4RCC A;  4BI3 A;  2K6D A;  4C92 D;  1VQ8 T;  2HL5 C;  3E1S A;  1QKX A;  2A08 A;  2MMP A;  1T0H A;  1VYU A;  2HBP A;  3QHS A;  4II1 A;  4J9C A;  4AG2 C;  3RKW A;  1UGQ B;  5AT1 B;  4EMK C;  3MO8 A;  2COW A;  3CEY A;  4ZTJ A;  3RMQ A;  5GAN 8;  3FIF A;  4E7L A;  2VB6 A;  1Y57 A;  1BU1 A;  1Q82 C;  1E7O A;  4Y91 A;  1GXI E;  1VQ6 Q;  5IHI A;  2HEQ A;  2ZPB B;  5CKH A;  2LCC A;  3MHX A;  1VQP Q;  1WIE A;  2NWM A;  1LNX A;  5M9O A;  1SRL A;  2HD0 A;  3VYH B;  2HKN A;  1NJI U;  2RHZ A;  2ROT A;  4Y92 A;  1VQ8 A;  3C0C A;  4C0Z A;  1WA7 A;  5A0G A;  1M3A A;  5GMK l;  2QA4 T;  3Q1J A;  2CP7 A;  4EMK B;  4X34 A;  1ZQ1 A;  4XU0 A;  1SEM A;  3QWX X;  3NGP A;  1WFW A;  3CCM Q;  4OVA A;  3NMZ C;  4NOY A;  1PNJ A;  5KYX B;  2QXF A;  5LJ3 e;  4EIK A;  2L3R A;  2X4J A;  4OMQ A;  1KD1 R;  2RQU A;  3REA B;  5KYN A;  1I81 A;  2E6N A;  3OW2 A;  2EYY A;  1TG0 A;  4ANJ A;  1WYX A;  4D8K A;  1MND A;  4LDX A;  4M78 G;  3WVE B;  2V26 A;  3SHW A;  2DER A;  1HYO A;  1W70 A;  1PD1 A;  2E41 A;  3RBB B;  3UPU A;  2LJ0 A;  3OS5 A;  4EMH A;  2SEM A;  2IIM A;  3MP6 A;  2J6F A;  1Q7Y C;  3JSC A;  4C92 G;  2LX9 A;  2QQB A;  3PNW C;  4EMK A;  2H8H A;  3QSU A;  2Y4X A;  2V8K A;  4DOW A;  3G71 Q;  3VUB A;  2QA4 A;  1VQK Q;  1AEY A;  3KXT A;  3UA6 A;  3L2R A;  4QVD A;  2CZ1 B;  5KYX A;  1YJW Q;  4XU1 A;  4D6W A;  2MF2 A;  1N5Z A;  3A8O B;  1LCK A;  3BDU A;  4E7Z A;  4NS5 A;  1Q81 U;  5GJV B;  4JZ3 A;  2KMT A;  5GJW B;  2HQX A;  2EGA A;  2FRW A;  1YIT A;  4LD6 A;  6AT1 B;  2DL8 A;  1KK7 A;  4M77 F;  4F04 B;  4HT9 A;  5KH6 A;  1R0B G;  3AHU A;  3LWI A;  2KYM A;  4RMO A;  4D8D A;  5DLO A;  3S3O A;  1UGR B;  5CKE A;  4IUV A;  3SFM A;  2GFU A;  1XTD A;  2YDL A;  1QLY A;  1SG5 A;  1OX8 A;  4M75 E;  1QVG P;  3OSS C;  1SHF A;  1QVG S;  2XD0 A;  1F1B B;  3OQ5 A;  1TU0 B;  3HKS A;  3O8V A;  2CP5 A;  4OMM A;  4FYW B;  1UB4 A;  1VQ8 Q;  5GAN d;  3L2V A;  1K9M R;  1BYM A;  4FYY B;  3OYH A;  2DXU A;  1AVZ C;  2DPP B;  2VXF A;  4BI8 B;  1N8R R;  3VS7 A;  1NLP C;  4QVZ A;  3VS5 A;  2LC4 A;  3VS4 A;  1MHN A;  1FYN A;  3INZ A;  2F5K A;  2RD1 A;  1OPK A;  2EGC A;  2KGT A;  4R55 A;  3GOX A;  1X43 A;  2D0Q B;  2HL3 A;  4N4G A;  3OYG A;  1M1G A;  4Z02 A;  2DIG A;  3JCM W;  2K7A A;  3LX7 A;  1PC0 A;  1VQ9 T;  2M9U A;  2DMO A;  3PMI A;  2HQE A;  2YHT A;  1ABQ A;  1S72 A;  3PIP A;  2GCX A;  3X24 B;  2DYI A;  2QA4 Q;  1JJ2 P;  2GGR A;  1JJ2 S;  5FU6 C;  4F16 A;  4JS4 A;  2FHD A;  2JTE A;  2C06 A;  3L2U A;  3E2U A;  4LN2 A;  3TSZ A;  1ZSG A;  1JBM A;  1M90 U;  3EG3 A;  2MWO A;  2YRD A;  4M7A G;  5HK3 A;  3LH0 A;  3RES A;  5LJ5 e;  1IZ6 A;  2RI5 A;  4OB0 B;  4A4H A;  2E4H A;  3C12 A;  3JCM P;  4KUI A;  2HKQ B;  5I11 A;  1YN8 A;  2P4T A;  1YFN A;  1Y7X A;  1WHM A;  4KRT A;  5KCO A;  2PUK B;  3V7C A;  4M7D E;  1ZLM A;  2RQW A;  4CI0 C;  5FU6 B;  3AT1 B;  2F2W A;  2A36 A;  4PJJ A;  5KYW A;  1NLO C;  3X28 B;  2DE0 X;  2EQI A;  2HSP A;  2PNI A;  4OML A;  3MET A;  4BB7 A;  2DBM A;  3BE3 A;  4M75 D;  2QI2 A;  4BI4 A;  3H0I A;  1K8A C;  4J9I A;  3EFR A;  3CCQ T;  1X01 A;  2EFI A;  2CP6 A;  2COZ A;  4VUB A;  3L42 A;  1KQS P;  4EDU A;  3JV3 A;  1KQS S;  3OYI A;  4V2S A;  2K3X A;  1G3S A;  1H8K A;  1E6H A;  2J6K A;  1MGQ A;  2XKO C;  2VV5 A;  1PD0 A;  3V7R A;  3OYK A;  3OA6 A;  2KK4 A;  5KYY B;  1PWT A;  3QDF A;  2P0K A;  1OPL A;  3RKY A;  5GAN 3;  3UT1 A;  4EPC A;  4KH1 B;  4FL6 A;  1GRI A;  3CCS Q;  3P8H A;  2EPD A;  1YBY A;  1J3T A;  3TRE A;  2OTL T;  4IKF A;  4K11 A;  5FW9 A;  1V1C A;  4PLI A;  2QDY B;  1M1F A;  3CCQ A;  2A0F B;  1PSF A;  4MZP A;  5GAN 5;  3JB9 F;  3JCM V;  4LD9 K;  1U1S A;  3CC2 Q;  1TXQ A;  4DBQ A;  2KEA A;  4FSS A;  2PVO B;  2DRM A;  2ZPH B;  1X2K A;  2F2V A;  4M77 C;  3OYJ A;  2KVQ G;  5KYY A;  4BDY A;  2ROL A;  4JJB A;  3HFN A;  3H0H A;  1OU9 A;  3OSV A;  1N6A A;  2I0N A;  1LVK A;  1VQ9 Q;  3EG1 A;  4PJO F;  3URG A;  5CCA A;  3A8H B;  1Q7Y R;  1AT1 B;  2OTL A;  4J9G A;  4XU2 A;  1N27 A;  2XG8 D;  4FW2 A;  4C0D C;  2DK3 A;  1VQ5 T;  2X51 A;  2O2O A;  4M75 G;  1YJ9 T;  1KG1 A;  4KUL A;  2MYS A;  2WSE E;  3ZL7 C;  2BE9 B;  2GTJ A;  3OYE A;  2MI6 A;  3REB B;  3E9G A;  2AIR B;  4M77 B;  4M7D D;  4RTW A;  2M1H A;  2RI3 A;  4DEY A;  3OYF A;  2PU9 B;  8ATC B;  2ED1 A;  3NFC A;  2RHU A;  5GAM d;  2EQK A;  5GAN j;  3CBM A;  3QXE B;  1JO8 A;  1IRE B;  3FJP A;  4ESR A;  1R8O B;  4DBH A;  2COY A;  2VYT A;  3TEE A;  2RJE A;  2JZ2 A;  2QQS A;  3KBG A;  1W1F A;  1VYV A;  1V29 B;  3C4S A;  5GAN 6;  1MMA A;  2LT4 A;  3BFM A;  4C0D B;  2JOY A;  2RJF A;  3M0T A;  4X1V A;  2DAQ A;  2DNU A;  2VGN A;  2HQH A;  2XU8 A;  1VQ5 A;  1YCY A;  1WGS A;  4OB2 B;  1CSK A;  2QEX T;  3EGX B;  1JXO A;  4AFU C;  4HCZ A;  2DEQ A;  1P92 A;  4M77 A;  2RI2 A;  4AFZ C;  1KC8 R;  4DOV A;  2O9V A;  4J9D A;  2FPE A;  4C5I A;  2RQV A;  5J26 A;  2V1Q A;  3CCQ Q;  2CDT A;  2AHJ B;  3MCA B;  1MMG A;  1U1T A;  2K57 A;  1IHV A;  8AT1 B;  2CSQ A;  1M3C A;  1ZBX A;  1EFN A;  5GAN 7;  2KDS A;  4M7A C;  1RAE B;  4KH0 B;  4DA4 A;  1RAH B;  4BUG A;  4E6R A;  3G1J A;  3ULR B;  4J9H A;  2L3S A;  2DL7 A;  1WJS A;  1Y0M A;  3EGX A;  4HVV A;  3CPW A;  1G3Y A;  2GFA A;  3A1P A;  1Y07 A;  2JTM A;  1AZG B;  4E7J A;  2CH4 W;  1OV3 A;  1UGS B;  1N8R C;  3QJ6 A;  1YJN T;  2KRS A;  2LQK A;  4JDS A;  2OTL Q;  2FYK A;  3T9N A;  2QK0 A;  4M7D G;  1UUE A;  4IUU A;  4PJL A;  3O5Z A;  2YUO A;  2QQR A;  5D6W A;  1U5S A;  4O5V A;  2OAW A;  4J83 A;  1VQP A;  4HCC A;  5FRM A;  1I5O B;  1Z9Z A;  2L3Q A;  3LLR A;  3A8G B;  1M8M A;  3L2Q A;  4PJN A;  3OS1 A;  3X25 B;  9ATC B;  1W2B A;  4MDX A;  2R5A A;  3X20 B;  1NEB A;  2HDA A;  5GAO m;  3QYH B;  2JM8 A;  1VQK T;  2X3X D;  2CUD A;  1QVF A;  3JCM d;  2RB6 A;  3VS2 A;  3CCM A;  2DX1 A;  4LUE A;  4C8Q E;  1BI0 A;  3QKJ A;  1NEG A;  4XTX A;  4A4G A;  1IGU A;  2FB7 A;  2X4W A;  4PJM A;  4B6M A;  2W0Z A;  1VQ5 Q;  1YJ9 Q;  1GCQ C;  1OX9 A;  1MMN A;  2DJQ A;  3VU3 C;  2EYX A;  3NTH A;  2FPF A;  1WJR A;  2RQR A;  3F70 A;  1UHC A;  4GBQ A;  4RTT A;  1K8A R;  3OYA A;  2K5L A;  3MP8 A;  5HCK A;  1H92 A;  1D3B B;  3I5R A;  1WHK A;  3C95 A;  1VQK A;  5C6S A;  5GMK i;  1LPL A;  2QAS A;  4QW2 A;  5IXF A;  1I07 A;  1SKU B;  1QP2 A;  4FIB A;  4XTZ A;  4JRQ A;  3MEA A;  1AD5 A;  1M30 A;  1RAC B;  5J3B A;  4EMG A;  2KNB B;  3EG0 A;  1K0S A;  3E9F A;  4PJO C;  4TVR A;  1HJD A;  2P0P A;  1KQ2 A;  2DM1 A;  5CKD A;  4M4Z A;  3D7S B;  2RA2 A;  2QEX Q;  2L5Q A;  3HSB A;  2K3Y A;  5HK0 A;  1HK9 A;  2R58 A;  3DB3 A;  3J81 E;  2LNV A;  1WXT A;  1RI9 A;  5EC7 A;  2O31 A;  1C0M A;  1ABO A;  1D3B A;  1JXM A;  2ZGW A;  2ZPE B;  3P8B B;  2JS0 A;  2QYZ A;  1MUZ A;  1VQN T;  3CMA T;  1VIF A;  3G4S T;  4C5H A;  1NYF A;  3QII A;  1JB0 E;  2DO3 A;  3H41 A;  4PJO B;  2GQV A;  2LTO A;  2D6F A;  1S1N A;  1GCQ A;  3QDR B;  3S3M A;  2HCK A;  1ZBJ A;  2JUF A;  2RK1 A;  5GAM j;  1H3Z A;  1KJW A;  2LMJ A;  2DD4 A;  3S6W A;  3CCL T;  4BAC A;  3L2W A;  1YJN Q;  2EBP A;  3V8L A;  1WXU A;  2YUN A;  4DEX A;  2L3P A;  2G3R A;  4BY6 C;  3QJY A;  1D0Z A;  4C8Q D;  1QKW A;  3H6Z A;  4M78 F;  4C5E A;  2AT1 B;  1VQN A;  2YLC A;  5CVI A;  4PJO A;  1UEB A;  3G4S A;  3V7S A;  2KT1 A;  3VS0 A;  3UA7 A;  3JB9 J;  3SWN C;  3GP8 A;  3OB9 A;  1QWE A;  2K5F A;  4MZT A;  2Y90 A;  4HXJ A;  4IUT A;  1NZ9 A;  5HY6 A;  2PQW A;  5CIU A;  2XK0 A;  3CCL A;  2MK5 A;  3M55 A;  1IXD A;  1FXX A;  3GPL A;  3EGD B;  3LGL A;  3THK A;  1M90 C;  4BY6 B;  1IRX A;  5ECA A;  4Z8A A;  1RLP C;  2RN8 A;  3H0F A;  1BB9 A;  1G83 A;  2GBQ A;  1X75 C;  1M2V B;  2QDL A;  3OBY A;  4RTU A;  3SWN B;  4F7U G;  3UAT A;  2AKK A;  3M54 A;  2EQJ A;  4E7I A;  1AWO A;  2CZ6 B;  2DZ9 A;  2E70 A;  4E47 A;  2NYS A;  3CCS T;  4C0G A;  1UTI A;  2V1R A;  3E19 A;  1UFF A;  1Q82 U;  2LP5 A;  2CZ0 B;  3CC4 T;  3NTI A;  3EGD A;  2ENM A;  3EG9 B;  1KC8 C;  2KT8 A;  3CCU T;  2EYW A;  2K2V A;  3PIO A;  3CC2 T;  4LE9 A;  2JW4 A;  2R5M A;  2DFU A;  4C8Q G;  5C0M A;  2D9T A;  1M2V A;  2EQM A;  2EYQ A;  1K73 C;  3ZEH A;  2YWW A;  2DYB A;  3SWN A;  2KBT A;  3EG2 A;  5D7U A;  2QG9 B;  5CR2 A;  3HRU A;  4RTX A;  1RLQ C;  2EKO A;  3A8L B;  2EQU A;  1QCO A;  3CCJ T;  4WTO B;  1QVG A;  3CCS A;  2RH2 A;  3CMA Q;  1VQN Q;  3G4S Q;  1RAF B;  1JRI A;  2GNC A;  5GAO l;  2FZK B;  3RNJ A;  1WX6 A;  3EG9 A;  4OB1 B;  2E5K A;  3CC4 A;  1UGP B;  1NJI R;  5GAN h;  5D6Y A;  2LJ1 A;  1VUB A;  2OX7 A;  3CCU A;  4KUD K;  3OYY A;  1PRM C;  1TH7 A;  2DEU A;  3CC2 A;  2CGH A;  1NG2 A;  2DBK A;  3JCM X;  2VAS A;  2KRO A;  3CCL Q;  4ZTF A;  1ACM B;  2NUT B;  2HMA A;  2P0Q A;  5KYW B;  1QMC A;  3PFS A;  1PSE A;  3QZ9 B;  4KT0 E;  2KI7 A;  1TUG B;  1NPR A;  4M7A F;  3PVQ A;  2CSI A;  3PMT A;  1MNE A;  3CCJ A;  1VQ9 A;  3BY7 A;  3NPF A;  4Y28 E;  3TCJ A;  2ZZD A;  1OZ2 A;  3JB9 D;  1PM3 A;  2FO0 A;  5GAM g;  1C6V X;  3VS1 A;  3LW5 E;  3FLG A;  5CQX A;  5LJ3 d;  1OQK A;  1BCM A;  2E1H A;  4PK4 A;  1PKS A;  2V8J A;  4AG1 C;  2L8D A;  4ZN3 A;  4PFZ A;  5L23 A;  2NUT A;  4KGV B;  4Z88 A;  1WHG A;  4MMK A;  4PNO A;  2X35 A;  4L5G A;  3GIB A;  2K9G A;  1YI2 T;  4RKU E;  1BK2 A;  1YCS B;  2AZS A;  2DL5 A;  1YWP A;  2QTX A;  3OYN A;  5CKB A;  4KBM B;  1K0X A;  2H3J A;  4HA8 A;  4M78 C;  4GLM A;  4OGC A;  5DLQ E;  4XTW A;  1K1Z A;  3CXC A;  4AT1 B;  4JRK A;  1O75 A;  2PTK A;  1D1B A;  2E3I A;  4KGX B;  1CKA A;  2DL3 A;  2XDB A;  2EJF A;  4C92 C;  3EHQ A;  2E5Q A;  1Q95 G;  3CC4 Q;  4RUG A;  3EFS A;  4HVU A;  1YIJ T;  4RTY A;  2HBW A;  2A37 A;  3CCU Q;  2AK5 A;  1WNL A;  4QT7 A;  2DKG A;  1QVP A;  1KQS A;  5GMK j;  1O9S A;  3EFO B;  1HXD A;  1U8R A;  4J6W A;  3SDZ A;  3I55 T;  3QBY A;  1EZZ B;  4M78 B;  2BTT A;  1SF9 A;  2YRV A;  2RNA A;  3MJX A;  3QO3 A;  1DJ7 B;  3RER A;  2ESW A;  2MWP A;  5GAN f;  4KGZ B;  1Q86 C;  4J7I A;  3EHR A;  1G3W A;  2LDM A;  1SSF A;  2RF0 A;  5KYU A;  1NPP A;  3CCJ Q;  1M1K C;  2ECZ A;  1T3S A;  4IUP A;  5HKC A;  4BD3 A;  2OJ2 A;  2HZY A;  3UWN A;  3DLL A;  3MKD A;  3ER0 A;  1PG5 B;  1X6B A;  2BZX A;  1ZA1 B;  2BUD A;  1I0C A;  1YIJ A;  4XTV A;  1IGQ A;  4OP0 A;  2IVW A;  3EFO A;  1VQM T;  2NUP B;  1VQO T;  4RG8 A;  4M75 F;  3HRS A;  3JCM g;  4M78 A;  2AKL A;  3FC3 A;  2CT3 A;  2R57 A;  2CP3 A;  3CCE T;  3M59 A;  2DXC A;  4B9X A;  1M90 R;  2FL7 A;  4JLI A;  4MDW A;  3EH1 A;  1WXB A;  1Y96 B;  3HHT B;  1X6O A;  1BI3 A;  4C92 A;  3JCM b;  2J06 A;  4DBR A;  3LWH A;  2FZG B;  2X3W D;  3JCM Q;  2D0N A;  4MZM A;  5GAO n;  4JJD A;  1HSQ A;  2DIL A;  2J6O A;  5CQY A;  5A0D A;  1ARK A;  1YWO A;  3M5A A;  1KSW A;  2NUP A;  1OEB A;  4NL2 A;  2FRY A;  1TOV A;  1RL2 A;  1YJ9 A;  1K9A A;  3RIR A;  2WAC A;  4ZNX A;  2OTJ T;  2BKD N;  2ABL A;  2AZV A;  1WZO A;  4FYV B;  4A4F A;  3A5Z B;  2H3E B;  3CCE A;  5LJ5 d;  5GAM h;  4ME7 A;  1TTH B;  2O01 E;  5I2M A;  4A4K A;  1Y96 A;  2MIO A;  1YI2 Q;  3M0S A;  3CPW P;  3CPW S;  1IHW A;  1KHC A;  1RAG B;  2KRN A;  1KIK A;  2CKK A;  1K73 R;  4OMN A;  1BBZ A;  2OI3 A;  1D09 B;  1W4S A;  1ZX6 A;  4XK8 E;  2NUZ A;  3DLM A;  1ZHI A;  2E12 A;  2LCL A;  3DKM A;  5I21 A;  2JTF A;  2E65 A;  3I56 T;  3I5S A;  4XTU A;  2QEX A;  4JRI A;  3VJP A;  4F14 A;  2WSF E;  1M27 C;  3VS6 A;  3CCR Q;  2PUO B;  3TSW A;  3EH2 A;  2HAX A;  4OGE A;  1W2B P;  2ZPF B;  1W2B S;  1YIJ Q;  1D1C A;  2M51 A;  3M58 A;  5LJ3 j;  4QQD A;  4L6V 5;  1QVF P;  4M7A B;  1UJ0 A;  1WQ7 A;  1QVF S;  4M77 E;  2RHY A;  1KD1 U;  3I55 Q;  3DB4 A;  5J39 A;  1VQ4 Q;  2ZCF B;  4WCI A;  4MML A;  3CC7 T;  2JJ9 A;  1NJI C;  2LJ3 A;  2ZPI B;  5LL6 S;  3GLX A;  2F2X A;  2O88 A;  1JU5 C;  1NYG A;  2B8A A;  2RQT A;  3I56 A;  2RJC A;  1PHT A;  2JMA A;  1VYT A;  4BE2 A;  4BDZ A;  1YJN A;  2KR3 A;  1LJO A;  7AT1 B;  5DM7 R;  3QUI A;  3M53 A;  2P4R A;  2RHX A;  2L89 A;  4J8O A;  4A54 A;  1VQM Q;  4M7A A;  3M0Q A;  1M2O A;  1VQO Q;  2KY9 A;  4CC2 A;  4FSX A;  3GF5 A;  5FWB A;  5IXB A;  4LNP A;  1I1J A;  3CCE Q;  4E7S A;  4OB3 B;  1N9S A;  3QPH A;  4QVC A;  5FU7 C;  2PVG B;  2FPD A;  2DJZ A;  1PRL C;  3VS3 A;  1XOV A;  1BIB A;  3S3N A;  1HD3 A;  3JCM h;  2QAZ A;  1UG1 A;  3C94 A;  3VKI A;  2X4X A;  1UJY A;  2KAF A;  3M4G A;  1AWW A;  2CZ7 B;  4X9D A;  1AWX A;  4OMF B;  1VQL T;  3A8M B;  2M0O A;  1Y71 A;  3HPW A;  4FCY A;  5GAM f;  3U23 A;  2RHI A;  1RAB B;  1Q81 C;  2M0Y A;  2IPO B;  2LVM A;  3FDR A;  1MMD A;  1SPK A;  4RTV A;  2MAM A;  3RUX A;  2PVD B;  4J7F A;  2OTJ Q;  3MEV A;  5IT9 E;  5A2Q E;  4M75 C;  4XAX B;  2EJG A;  5FU7 B;  4LXC A;  4ATO A;  1K9M U;  2GQI A;  5GAN g;  4ELY C;  2FG0 A;  2PZ1 A;  1N8R U;  1BIA A;  4M7A E;  3M0R A;  1YHQ T;  1WDX A;  2E64 A;  1X27 A;  5LJ5 f;  3CME Q;  2FEI A;  3OW2 P;  1H64 1;  1Q86 R;  1VQL A;  3OW2 S;  2KE9 A;  1WPY A;  4M77 D;  5I22 A;  1WHJ A;  5FRO A;  3I56 Q;  2CP2 A;  4AFQ C;  1M1K R;  3M56 A;  2QQA A;  3EGU A;  1MV0 B;  4M75 B;  3UF4 A;  4IIM A;  4OMO A;  4R56 A;  4FU6 A;  5IH2 A;  4FYX B;  4A53 A;  1VQ7 Q;  1AHJ B;  2EKH A;  2NLU A;  1RUW A;  1RI0 A;  4PLL A;  5CK9 A;  2BE7 D;  2JXB A;  3OYD A;  2CS7 A;  3X26 B;  3A98 A;  2YUQ A;  1YHQ A;  3CMA A;  1IB8 A;  4ZGJ B;  1XJW B;  3PT9 A;  3N5B B;  4J9E A;  2K79 A;  3SB2 A;  1OUL A;  2JMC A;  5KCH A;  3JAM E;  1VOM A;  1QCF A;  2FVU A;  5LJ5 j;  2EGE A;  3CCV Q;  4BE0 A;  3CC7 Q;  1NE8 A;  1OI1 A;  3ME9 A;  3JB9 I;  4DBF A;  1YIT T;  2JM9 A;  4C92 F;  1G3T A;  1X69 A;  2LX7 A;  4QQG A;  4M75 A;  2EIF A;  2C0T A;  1K76 A;  1UEC A;  4ZGE B;  4E7H A;  1QQJ A;  1UE9 A;  2LCS A;  3R6N A;  4A63 B;  3VV0 A;  5LJ3 g;  2QGF B;  4B9W A;  2DXB A;  1QWF A;  1EX4 A;  3OMG A;  2C0I A;  3JCM f;  4HCB A;  4E2F B;  4M7D C;  1KFZ A;  4QKU A;  1TS9 A;  4Q5W A;  2RPN A;  4UC4 A;  2W10 A;  4R0K A;  4JRP A;  2MOX A;  1FX7 A;  3M0U A;  1TSF A;  5GMK h;  1MV3 A;  1X6G A;  4M77 G;  2K4Y A;  4F7U F;  4RCB A;  1FMV A;  3QG1 A;  4X9C A;  4CC7 A;  2VKN A;  4PJO E;  3CBP A;  4RTZ A;  4M7A D;  4FM4 B;  3H9N A;  3OYB A;  1VQL Q;  1RAA B;  3M4Y A;  1BKB A;  5L8R E;  1SSH A;  2E10 A;  2VC8 A;  2RJD A;  1ZSZ C;  4HVW A;  3MEW A;  3HP9 A;  4M7D B;  1S72 T;  2RO0 A;  2JVV A;  2FZC B;  1I4K 1;  4C8Q F;  2EW3 A;  2EYZ A;  3RMS A;  1M5Q 1;  1GBR A;  2JS2 A;  1QCN A;  4QQ6 A;  2QGG A;  3OYL A;  3LH5 A;  3NTK A;  4CC3 A;  2DXT A;  1GCP A;  1YHQ Q;  1D0X A;  4JUV A;  1OZ3 A;  2P84 A;  3TQ7 P;  5IN1 A;  4J6X A;  4HKE A;  2LQW A;  2DTI A;  2LRQ A;  3WXM B;  1R0C B;  1ZSZ B;  3TU4 K;  2ZPG B;  4M7D A;  1QW1 A;  3BW1 A;  5GAM e;  4GY5 A;  1B34 B;  3CQT A;  3M0P A;  2MCN A;  2J7I A;  2LNH B;  1Q7Y U;  1K4U S;  2RM4 A;  3OYM A;  4XU3 A;  3OS0 A;  2O4X B;  2DD5 A;  1VA7 A;  1B3Q A;  3SD4 A;  3CPF A;  2OAU A;  2KXC A;  3G6E T;  1FMK A;  3EAE A;  4PKC C;  1LOJ A;  2GTO A;  4JS5 A;  1VIE A;  3I35 A;  2DIQ A;  4A4E A;  2JNG A;  2DVJ A;  4N0A C;  3GNG A;  2CRE A;  4YTL A;  1ZA2 B;  3ZFJ A;  1ZSZ A;  3KUF A;  2VGM A;  4JPB W;  3CBO A;  1QP3 A;  1YIT Q;  1B34 A;  3GBQ A;  2LQ8 A;  1JJ2 A;  2YUP A;  4RG2 A;  2O4X A;  3G7Z A;  5GAO r;  3OY9 A;  1KHI A;  1Q81 R;  3OMC A;  4PJO D;  1ZUK A;  1U3O A;  3CXC P;  3G6E A;  1SHG A;  3CXC S;  1SRM A;  3OS2 A;  1C1A A;  2Z0W A;  3P8D A;  3VUZ A;  4N4H A;  1G8X A;  3R6O A;  4IUR A;  4CC4 B;  2A7Y A;  1G5V A;  2DET A;  5EG2 A;  1YP5 A;  1KC8 U;  3JB9 H;  2GF7 A;  3HTR A;  5LJ5 g;  5DY9 A;  1TUC A;  2LT1 A;  1M8V A;  4AFS C;  3J80 E;  5LJ3 h;  1M4Z A;  2XID A;  2RK2 A;  1K73 U;  5KE2 A;  2EVR A;  5KYU B;  2BZY A;  3JRZ A;  2C0O A;  2VUB A;  5D6X A;  3CCR T;  5CAI A;  4C5G A;  1Q82 R;  2KXD A;  2DZC A;  4LDW A;  1YI2 A;  3CD6 T;  3JCM J;  1BI2 A;  2JT4 A;  5IHN A;  2KYB A;  1FWZ A;  1WHL A;  4CRI A;  2I2L A;  2F5T X;  4N0A A;  1WQW A;  3GNF B;  4LDU A;  1OOT A;  1S72 Q;  1VQ4 T;  1ZUY A;  4LDY A;  3JCM e;  2KQW A;  3VRZ A;  3JB9 G;  2YXY A;  4ORZ A;  1TUD A;  1X2Q A;  4LUD A;  5A0L A;  3MEU A;  4ZGD B;  1FMW A;  1WJQ A;  2K3B A;  3HRT A;  2D8H A;  1M3B A;  4C92 B;  3FEO A;  4OF1 A;  2A28 A;  1PKT A;  2VWF A;  3CCR A;  5CO7 A;  5CKF A;  4HT8 A;  4XQ3 A;  2RMO A;  3PTA A;  3JCM c;  3SEM A;  3OYC A;  1GFC A;  3VRY A;  3MPU B;  3CD6 A;  4PJO G;  2YLB A;  1T3L A;  4FW1 A;  5GMK m;  1JQQ A;  1Z9Q A;  2CP0 A;  1WI7 A;  3I55 A;  5IAY A;  2YT6 A;  1GL5 A;  4PL6 A;  2IG0 A;  1T0J A;  1VQ4 A;  1KD1 C;  2CUB A;  1NBE B;  4C8Q C;  2EWN A;  3G6E Q;  2ZAE A;  2XDD A;  1KQ1 A;  2DVE A;  2A3L A;  4JZ4 A;  3L2Z A;  1H3H A;  2K2M A;  4PFO A;  4F7U B;  4O6J A;  4NL3 A;  2XIC A;  3IQL A;  2O9S A;  4J6Y A;  1K8A U;  3LYI A;  3PE0 A;  1OYX A;  1I5L A;  2DRK A;  2Y4Y A;  4ZN1 A;  1AOJ A;  1IO6 A;  1B7T A;  1RAI B;  2DA9 A;  2EJ9 A;  3MP1 A;  2L0A A;  1VQM A;  2XHC A;  1VQO A;  1E6G A;  3WVD B;  1UHF A; 
#chains in the Genus database with same CATH homology
 5GAN 4;  2X4X A;  2QQ9 A;  4IUQ A;  2X4Y A;  3X28 B;  2KAF A;  1X75 C;  3M4G A;  2CZ7 B;  4X9D A;  3MET A;  1N9R A;  3V8J A;  4BB7 A;  4OMF B;  1VQL T;  3A8M B;  2M0O A;  3OBY A;  4M75 D;  1Y71 A;  3HPW A;  2QI2 A;  3SWN B;  4C8Q B;  2XI9 A;  4BI4 A;  4F7U G;  5GAM f;  1K8A C;  3CCQ T;  2RHI A;  2EQJ A;  3EFR A;  3M54 A;  4E7I A;  1X01 A;  2EFI A;  1Q81 C;  2CZ6 B;  2DTO A;  2DZ9 A;  2E70 A;  5LJ3 f;  4E47 A;  2LVM A;  3FDR A;  4VUB A;  3L42 A;  4GLK A;  4EDU A;  4N4I A;  4F7U A;  3CCS T;  4C0G A;  3OYI A;  1KQS S;  4V2S A;  2MAM A;  4M78 E;  2K3X A;  1G3S A;  2PVD B;  4J7F A;  3QZ5 B;  3E19 A;  3RUX A;  4E7K A;  1MGQ A;  3MEV A;  5IT9 E;  1Q82 U;  2CZ0 B;  2JN0 A;  3CC4 T;  4BE1 A;  5A2Q E;  4M75 C;  2XKO C;  2VV5 A;  4XAX B;  3CME T;  2EJG A;  1I8F A;  3FB9 A;  3NTI A;  5FU7 B;  3V7R A;  4ATO A;  1K9M U;  1KC8 C;  3J7A F;  5GAN g;  3OYK A;  3OA6 A;  3CCU T;  4ELY C;  2K2V A;  2KK4 A;  1VQ6 T;  2P0K A;  3PIO A;  3RKY A;  5GAN 3;  3LGF A;  3UT1 A;  1N8R U;  1BIA A;  1VQP T;  4M7A E;  3CC2 T;  4EPC A;  4J5Y A;  4C92 E;  4FL6 A;  1YHQ T;  2R5M A;  4C8Q G;  3P8H A;  2E64 A;  5C0M A;  3H8Z A;  2D9T A;  2M16 A;  1YBY A;  2OTJ A;  2EQM A;  2EYQ A;  1K73 C;  3TRE A;  3ZEH A;  2OTL T;  4IKF A;  5LJ5 h;  3SWN A;  4C8Q A;  5LJ5 f;  1VQ7 T;  1Q86 U;  2HNI A;  1H64 1;  5CR2 A;  3M57 A;  5GAN 2;  1VQL A;  4PLI A;  3OW2 S;  2BIV A;  1WPY A;  4M77 D;  4LDV A;  5I2S A;  3HRU A;  1BI1 A;  2QDY B;  1M1F A;  2EKO A;  5GAO p;  3A8L B;  1K9M C;  3CCQ A;  2EQU A;  5FRO A;  1M1K U;  3BDL A;  4M7D F;  5GAN 5;  1PSF A;  4MZP A;  3JB9 F;  3CCJ T;  3JCM V;  3ZBD A;  4LD9 K;  1U1S A;  3M9Q A;  3M56 A;  3V8K A;  3CCM T;  1QVG A;  3CCS A;  2RH2 A;  5AYF A;  2QQA A;  4M75 B;  1JRI A;  5FLX E;  5GAO l;  2PVO B;  4DQ2 A;  5GMK e;  2ZPH B;  5GAO q;  4OB1 B;  4R56 A;  3CC4 A;  1UGP B;  4FU6 A;  4M77 C;  3OYJ A;  4A53 A;  3CME A;  5GAN h;  3CCV T;  2KVQ G;  5D6Y A;  4BDY A;  1AHJ B;  2NLU A;  1EIF A;  1RI0 A;  1VUB A;  3HFN A;  4PLL A;  5CK9 A;  3CCU A;  4KUD K;  1VQ6 A;  3OYY A;  2CYZ B;  3OYD A;  2CS7 A;  3OSV A;  1TH7 A;  4F7U E;  2F69 A;  1N6A A;  3X26 B;  2DTH A;  2WSC E;  3CC2 A;  2CGH A;  3HL8 A;  3JCM X;  4PJO F;  5CCA A;  3URG A;  3CMA A;  1YHQ A;  3A8H B;  2P0Q A;  4ZGJ B;  4ELZ C;  3PT9 A;  3N5B B;  4ZTF A;  3SB2 A;  5KCH A;  3JAM E;  2OTL A;  3PFS A;  1PSE A;  3QZ9 B;  1N27 A;  4XU2 A;  2FVU A;  4KT0 E;  5LJ5 j;  1VQ7 A;  2XG8 D;  4C0D C;  2DK3 A;  4BE0 A;  1VQ5 T;  3ASK A;  4FT2 A;  4M75 G;  1NE8 A;  1NPR A;  1OI1 A;  3ME9 A;  4KUL A;  3RKX A;  3JB9 I;  3G71 T;  1YJ9 T;  1YIT T;  4M7A F;  2WSE E;  4C92 F;  3VYG A;  1G3T A;  1YJW T;  3PMT A;  4QQG A;  4M75 A;  3CCJ A;  2EIF A;  4WF2 A;  1VQ9 A;  3OYE A;  3BY7 A;  2MI6 A;  2VXE A;  3E9G A;  4Y28 E;  3TCJ A;  4M77 B;  1XQH A;  2ZZD A;  4M7D D;  1OZ2 A;  2M1H A;  2RI3 A;  3HFO A;  4ZGE B;  3OYF A;  2PU9 B;  2XDP A;  2K5I A;  4L59 A;  4E7H A;  3JB9 D;  3NFC A;  2RHU A;  5GAM g;  5GAM d;  3CCV A;  2EQK A;  5GAN j;  3CBM A;  3QXE B;  3LW5 E;  3VV0 A;  3FLG A;  1IRE B;  3FJP A;  5CQX A;  5LJ3 g;  3CC7 A;  1R8O B;  5LJ3 d;  4B9W A;  2DXB A;  2E1H A;  2V8J A;  1XNI A;  3OMG A;  2L8D A;  4ZN3 A;  4C0F A;  3OBW A;  2VYT A;  3JCM f;  3TEE A;  5GAN e;  2RJE A;  4HCB A;  2JZ2 A;  3L1A A;  4M7D C;  2QQS A;  4MMK A;  3KBG A;  2E6Z A;  4PNO A;  4Q5W A;  1V29 B;  3C4S A;  2X35 A;  3PGG A;  4L5G A;  1M9S A;  5GAN 6;  3GIB A;  5KE3 A;  2LT4 A;  3FRN A;  4UC4 A;  4M78 D;  3BFM A;  4C0D B;  1YI2 T;  4RKU E;  5FRN A;  4JLG A;  2JOY A;  2V8I A;  2KSS A;  4JJN K;  2RJF A;  4JRP A;  1FX7 A;  4P5N A;  2DAQ A;  2XU8 A;  2VGN A;  5GMK h;  4XTY A;  1VQ5 A;  1YCY A;  3UDC A;  3QYG B;  4M77 G;  1WGS A;  2K4Y A;  4OB2 B;  4RCB A;  4F7U F;  3G71 A;  2QEX T;  2EAY A;  3QG1 A;  4X9C A;  2QTX A;  4HCZ A;  3OYN A;  1YJW A;  4KBM B;  4FT4 A;  2DEQ A;  1P92 A;  4M77 A;  2H3J A;  4PJO E;  2RI2 A;  4RCC A;  3CBP A;  4HA8 A;  4M78 C;  4BI3 A;  4M7A D;  4DOV A;  4FM4 B;  4C92 D;  1VQ8 T;  3OYB A;  4OGC A;  3E1S A;  5DLQ E;  1BKB A;  2MMP A;  3M4Y A;  4XTW A;  5J26 A;  5L8R E;  4C5I A;  2HBP A;  3QHS A;  4II1 A;  3CXC A;  2E10 A;  2VC8 A;  2RJD A;  2AHJ B;  3MCA B;  3RKW A;  1U1T A;  2K57 A;  1UGQ B;  4JRK A;  1O75 A;  4EMK C;  3MO8 A;  3MEW A;  3HP9 A;  1ZBX A;  3CEY A;  5GAN 7;  4M7D B;  2KDS A;  4M7A C;  4ZTJ A;  1S72 T;  3RMQ A;  4DA4 A;  2EJF A;  2RO0 A;  4C92 C;  2XDB A;  2JVV A;  1I4K 1;  2E5Q A;  4C8Q F;  4BUG A;  3FIF A;  5GAN 8;  4E7L A;  3EFS A;  1M5Q 1;  3RMS A;  1YIJ T;  1Q82 C;  4Y91 A;  1WJS A;  4QQ6 A;  1GXI E;  1WNL A;  3OYL A;  2ZPB B;  2DKG A;  1QVP A;  1G3Y A;  3NTK A;  5CKH A;  3CPW A;  1KQS A;  2LCC A;  2GFA A;  3MHX A;  5GMK j;  1O9S A;  1Y07 A;  2DXT A;  1HXD A;  2JTM A;  4E7J A;  1LNX A;  5M9O A;  1UGS B;  1N8R C;  3QJ6 A;  1U8R A;  4J6W A;  3SDZ A;  1YJN T;  3I55 T;  2HD0 A;  3QBY A;  2LQK A;  4JUV A;  1OZ3 A;  4M78 B;  2YRV A;  3VYH B;  4JDS A;  1NJI U;  2RHZ A;  2FYK A;  3QO3 A;  3T9N A;  5IN1 A;  4J6X A;  4HKE A;  1DJ7 B;  3RER A;  2MWP A;  4M7D G;  5GAN f;  1VQ8 A;  4IUU A;  4C0Z A;  1KG1 A;  2QA4 T;  5A0G A;  5GMK l;  1Q86 C;  4J7I A;  2DTI A;  2LRQ A;  1G3W A;  3WXM B;  2LDM A;  3TU4 K;  1SSF A;  3Q1J A;  2QQR A;  5D6W A;  2ZPG B;  4EMK B;  4M7D A;  1NPP A;  1ZQ1 A;  1QW1 A;  4J83 A;  4O5V A;  3BW1 A;  4X34 A;  4XU0 A;  1VQP A;  1M1K C;  4HCC A;  3LLR A;  4GY5 A;  5GAM e;  5FRM A;  1B34 B;  3A8G B;  4OVA A;  4NOY A;  4IUP A;  5HKC A;  2QXF A;  4BD3 A;  3L2Q A;  5LJ3 e;  1Q7Y U;  2RM4 A;  3OS1 A;  3OYM A;  2L3R A;  2X4J A;  4XU3 A;  3X25 B;  3OS0 A;  3UWN A;  3DLL A;  1W2B A;  4MDX A;  3ER0 A;  2O4X B;  2DD5 A;  1I81 A;  2E6N A;  3OW2 A;  2R5A A;  3SD4 A;  3X20 B;  2OAU A;  2BUD A;  3CPF A;  5GAO m;  1YIJ A;  3QYH B;  4XTV A;  3G6E T;  4LDX A;  3EAE A;  4M78 G;  4PKC C;  3WVE B;  1LOJ A;  1VQK T;  4OP0 A;  1VIE A;  4JS5 A;  2IVW A;  1VQM T;  1VQO T;  4RG8 A;  2DIQ A;  2E41 A;  4M75 F;  4A4E A;  3HRS A;  2JNG A;  3UPU A;  3JCM g;  1QVF A;  3JCM d;  4M78 A;  2RB6 A;  3OS5 A;  3FC3 A;  3CCM A;  4EMH A;  2R57 A;  3CCE T;  3M59 A;  3MP6 A;  2DXC A;  4N0A C;  4B9X A;  4C8Q E;  1BI0 A;  3GNG A;  3QKJ A;  1Q7Y C;  4XTX A;  4YTL A;  4A4G A;  2FL7 A;  3JSC A;  2FB7 A;  3ZFJ A;  2X4W A;  2LX9 A;  2QQB A;  2VGM A;  3KUF A;  3PNW C;  4JLI A;  4MDW A;  4C92 G;  4EMK A;  3CBO A;  1Y96 B;  2Y4X A;  2V8K A;  3HHT B;  4DOW A;  3VUB A;  2QA4 A;  1QP3 A;  3QSU A;  3KXT A;  1X6O A;  3L2R A;  1B34 A;  1BI3 A;  2CZ1 B;  4QVD A;  2LQ8 A;  3VU3 C;  4C92 A;  1JJ2 A;  3JCM b;  3NTH A;  4XU1 A;  4D6W A;  3LWH A;  2MF2 A;  3JCM Q;  3A8O B;  4RG2 A;  1WJR A;  2O4X A;  3BDU A;  3F70 A;  4MZM A;  4NS5 A;  5GAO n;  3G7Z A;  5GAO r;  1Q81 U;  5CQY A;  5A0D A;  3OY9 A;  3OYA A;  2K5L A;  1KHI A;  3MP8 A;  3M5A A;  3OMC A;  2KMT A;  4PJO D;  1D3B B;  2HQX A;  3G6E A;  4NL2 A;  1RL2 A;  3C95 A;  3CXC S;  1YJ9 A;  1VQK A;  5C6S A;  5GMK i;  3RIR A;  3OS2 A;  2WAC A;  1YIT A;  3P8D A;  4LD6 A;  4N4H A;  3VUZ A;  4QW2 A;  2OTJ T;  3R6O A;  2BKD N;  4IUR A;  4M77 F;  1QVF S;  2A7Y A;  1G5V A;  4HT9 A;  5KH6 A;  3AHU A;  1QP2 A;  4FIB A;  5EG2 A;  3LWI A;  1KC8 U;  3JB9 H;  2GF7 A;  4XTZ A;  4JRQ A;  3MEA A;  4RMO A;  4A4F A;  3A5Z B;  5J3B A;  4EMG A;  5DLO A;  5LJ5 g;  5LJ5 d;  5DY9 A;  3CCE A;  3E9F A;  4PJO C;  2LT1 A;  5GAM h;  4TVR A;  3S3O A;  4ME7 A;  5I2M A;  1UGR B;  2O01 E;  5CKE A;  1Y96 A;  2P0P A;  4IUV A;  3SFM A;  4A4K A;  1M8V A;  1KQ2 A;  3J80 E;  2GFU A;  5LJ3 h;  1XTD A;  1M4Z A;  5CKD A;  2XID A;  2RK2 A;  3CPW S;  1K73 U;  2RA2 A;  1KHC A;  4M75 E;  5KE2 A;  2CKK A;  3OSS C;  2L5Q A;  3HSB A;  1QVG S;  2XD0 A;  3JRZ A;  3OQ5 A;  2K3Y A;  2VUB A;  5D6X A;  5HK0 A;  1HK9 A;  2R58 A;  1W4S A;  3DB3 A;  3CCR T;  3J81 E;  5CAI A;  2LNV A;  3HKS A;  4C5G A;  3O8V A;  4XK8 E;  1UB4 A;  2DZC A;  3DLM A;  1ZHI A;  1D3B A;  4LDW A;  2E12 A;  5GAN d;  2LCL A;  3L2V A;  3DKM A;  5I21 A;  2JTF A;  2E65 A;  2ZGW A;  2ZPE B;  3I56 T;  3JCM J;  1YI2 A;  3P8B B;  3CD6 T;  1BYM A;  1BI2 A;  3OYH A;  4XTU A;  2DXU A;  2DPP B;  2VXF A;  4BI8 B;  1FWZ A;  1VQN T;  4CRI A;  2I2L A;  2QEX A;  2F5T X;  1VIF A;  3CMA T;  4JRI A;  4N0A A;  4QVZ A;  3VJP A;  3G4S T;  1WQW A;  2LC4 A;  3GNF B;  2WSF E;  4C5H A;  4LDU A;  3QII A;  1JB0 E;  1MHN A;  2DO3 A;  2PUO B;  1VQ4 T;  3INZ A;  2F5K A;  2HAX A;  4OGE A;  4PJO B;  2GQV A;  2LTO A;  2RD1 A;  2ZPF B;  4LDY A;  3JCM e;  2KQW A;  4R55 A;  3GOX A;  1W2B S;  2D0Q B;  2D6F A;  3QDR B;  4N4G A;  3S3M A;  3OYG A;  2JUF A;  2RK1 A;  3JB9 G;  3M58 A;  1M1G A;  4Z02 A;  5GAM j;  1H3Z A;  5A0L A;  3MEU A;  2DIG A;  3JCM W;  4ZGD B;  3LX7 A;  5LJ3 j;  4QQD A;  1VQ9 T;  2M9U A;  1WJQ A;  4L6V 5;  3PMI A;  2DD4 A;  4M7A B;  2HQE A;  3HRT A;  1WQ7 A;  3S6W A;  3CCL T;  2YHT A;  4M77 E;  4C92 B;  2RHY A;  3FEO A;  4BAC A;  3L2W A;  4OF1 A;  1KD1 U;  3V8L A;  3DB4 A;  5J39 A;  1S72 A;  3CCR A;  5CO7 A;  3PIP A;  2GCX A;  5CKF A;  4HT8 A;  4XQ3 A;  3PTA A;  2ZCF B;  3JCM c;  4MML A;  3CC7 T;  1NJI C;  3X24 B;  2G3R A;  3OYC A;  2ZPI B;  5LL6 S;  3GLX A;  4BY6 C;  2B8A A;  3QJY A;  4C8Q D;  3H6Z A;  3I56 A;  3CD6 A;  4PJO G;  4M78 F;  2YLB A;  4C5E A;  1JJ2 S;  2RJC A;  5FU6 C;  4JS4 A;  5GMK m;  2FHD A;  1VQN A;  2YLC A;  5CVI A;  3L2U A;  2C06 A;  4PJO A;  4BE2 A;  1UEB A;  3G4S A;  4BDZ A;  1YJN A;  3V7S A;  3I55 A;  5IAY A;  4PL6 A;  1JBM A;  1M90 U;  2IG0 A;  1LJO A;  2MWO A;  5DM7 R;  1VQ4 A;  3JB9 J;  1KD1 C;  3QUI A;  4M7A G;  3SWN C;  4C8Q C;  3M53 A;  2EWN A;  3GP8 A;  5HK3 A;  3OB9 A;  3LH0 A;  3RES A;  2K5F A;  2RHX A;  2L89 A;  4J8O A;  4MZT A;  4A54 A;  2XDD A;  5LJ5 e;  1IZ6 A;  1KQ1 A;  2DVE A;  2RI5 A;  2A3L A;  2Y90 A;  4OB0 B;  4M7A A;  2KY9 A;  3L2Z A;  4A4H A;  4FSX A;  3GF5 A;  4IUT A;  1NZ9 A;  5HY6 A;  2PQW A;  4O6J A;  4F7U B;  4NL3 A;  5CIU A;  2XIC A;  3C12 A;  3JCM P;  2XK0 A;  3CCL A;  4KUI A;  3M55 A;  4J6Y A;  1K8A U;  4OB3 B;  1N9S A;  3QPH A;  4QVC A;  1FXX A;  5FU7 C;  3LYI A;  3GPL A;  2PVG B;  1OYX A;  1I5L A;  3LGL A;  2P4T A;  2DJZ A;  4BY6 B;  1Y7X A;  1M90 C;  2Y4Y A;  1XOV A;  4ZN1 A;  5KCO A;  2PUK B;  3V7C A;  1BIB A;  3S3N A;  2EJ9 A;  3MP1 A;  4M7D E;  4CI0 C;  3JCM h;  1VQM A;  2XHC A;  3C94 A;  5FU6 B;  3VKI A;  1VQO A;  5CKB A;  3WVD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...