1OZ3A

Crystal structure of 3-mbt repeats of lethal (3) malignant brain tumor (native-i) at 1.85 angstrom
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
313
structure length
313
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Malignant brain tumor repeats: a three-leaved propeller architecture with ligand/peptide binding pockets.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 313
sequence length 313
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz3A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz3A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz3A03
3MP8A 2JZ2A 2RHZA 1RI0A 2FHDA 2GFUA 2O4XB 3L2UA 3OYBA 2X35A 4CRIA 3QBYA 3UT1A 3UWNA 1OYXA 4II1A 3DB4A 5FRNA 1SSFA 3M9QA 3MP6A 5KCOA 1N27A 4E7JA 2RHUA 3ASKA 3MEWA 2G3RA 3LH0A 4RG2A 2EQJA 4PLIA 5D6XA 5KE2A 3SD4A 3S3MA 3NTIA 3META 3OA6A 4PLLA 4IURA 1OI1A 4E7LA 4C5IA 4FL6A 2RHXA 4ZTJA 4PL6A 3MEVA 5J26A 4E7HA 3PFSA 4B9WA 4BACA 2QQSA 1WJQA 2XK0A 2RO0A 4L59A 5KE3A 3PMTA 2LTOA 3NTHA 2GF7A 3LX7A 4N4IA 4IUVA 2NLUA 2DAQA 4A4FA 5KCHA 4QQGA 2RJDA 4A4EA 4BD3A 4N4GA 4C5EA 2QQRA 2WACA 3L2WA 5D6YA 3OB9A 3ME9A 4X34A 4QQDA 2K3XA 3LGLA 3O8VA 3OYKA 4N4HA 5M9OA 3MO8A 3OYGA 4ZTFA 2F5KA 4IUPA 2XDPA 3QKJA 3MEUA 1OZ2A 4C5GA 2CKKA 3FC3A 3CEYA 5J39A 3FEOA 2X4WA 2EQUA 5FRMA 2E5QA 2O4XA 4FU6A 2M0OA 2RI2A 3MP1A 3BDLA 4BDZA 3E9GA 3DLMA 4BDYA 2HQEA 2K3YA 3L2VA 3OYEA 3GOXA 3OYAA 2R5MA 3QIIA 5C6SA 3OYIA 3OYJA 3OMCA 2LCCA 3S3NA 2PQWA 1OZ3A 3QJ6A 1H3ZA 2HQXA 2RHIA 2RJCA 4HCZA 3H8ZA 4Q5WA 4NS5A 2LRQA 2B8AA 1KHCA 2RJEA 3EAEA 3OYLA 2YRVA 4E7KA 2RHYA 3OYHA 4A4HA 2R58A 3PMIA 2E6NA 4QW2A 4BE1A 1MHNA 3PNWC 3Q1JA 4QQ6A 2JTFA 2LDMA 2X4XA 2R5AA 3P8HA 2L8DA 3L2RA 4BE0A 4EDUA 4IUUA 2DIQA 4C5HA 5IAYA 1G5VA 3P8DA 3LGFA 4IUTA 5CIUA 2D9TA 5KH6A 3ZEHA 3NTKA 3OYDA 2VYTA 3L42A 3LLRA 3MEAA 3FLGA 2M16A 2RJFA 3OYCA 5IN1A 1WJSA 2P0KA 3LYIA 4LD6A 2DIGA 2EQMA 2EFIA 4Z02A 2M1HA 2BUDA 2BIVA 3S3OA 4B9XA 4OVAA 2X4YA 3E9FA 3OMGA 1WGSA 2EQKA 1XNIA 4BE2A 3S6WA 2MWPA 4UC4A 5D6WA 2L89A 2R57A 4E7IA 2GFAA 4A4GA 3OYFA 4IKFA 4GY5A 1WJRA 2MWOA 2EKOA 2RI3A 3H6ZA 3OYMA 3OS2A 3F70A 5C0MA 2RI5A 2LVMA 3OS0A 3OY9A 2BKDN 3FDRA 3OQ5A 3L2QA 2L3RA 3C4SA 4QVZA 3OS1A 3OYNA 4IUQA 5FROA 3KUFA 2IG0A 3DB3A
chains in the Genus database with same CATH superfamily
2JM8A 2HL5C 2X9HA 4M78C 2CSIA 1KD1C 3DB4A 1Q81C 4A53A 3HKSA 2E64A 2EQJA 3VYHB 1TUDA 4FYVB 7AT1B 1NPRA 3META 1SG5A 4IURA 3OS5A 4Y92A 3QXEB 1CSKA 1LNXA 1WFWA 3G4SQ 3CCMQ 1Y0MA 2OJ2A 2RK2A 4EPCA 4M77D 1K9MU 1W6XA 2V1QA 1VQMT 3M53A 2WACA 1AWOA 2QDYB 3EGUA 5CQYA 3M0RA 1RAEB 1M30A 5GMKm 2MYSA 2CP5A 4WF2A 1U1SA 5FRMA 3BY7A 2RI2A 3E9GA 4M7DG 2HD0A 4J7FA 4JRKA 1M3CA 2E65A 4F16A 4P5NA 5GMKe 1QMCA 2LC4A 1HJDA 5LJ3f 2AKKA 2RMOA 3JCMe 3OYHA 1N5ZA 1MHNA 1AEYA 1VQPA 2LQ8A 4M77C 2DL5A 3VUZA 2VUBA 3A8OB 1TS9A 2FEIA 3E19A 4IUTA 4ZGDB 1QP3A 3GF5A 3LLRA 4J9HA 5FU6C 3HRUA 2ZPHB 3CCVQ 2DL8A 2RK1A 2BTTA 5GANd 4C92B 1WHMA 4LE9A 4MZTA 2KXCA 2OAWA 2JXBA 1VQLA 5LJ3g 1ZA1B 2HZYA 3RR6A 2ZZDA 4ANJA 5FU7B 2L3RA 5IHIA 1MMDA 4XK8E 2XU8A 1V29B 2FHDA 1LPLA 4PJOG 1UGPB 2AKLA 3CD6A 1PG5B 2COYA 3UWNA 1SRLA 4E2FB 2RHUA 4LDVA 5CK9A 1D09B 2G3RA 4M75F 2JOYA 1VQNT 5D6XA 5GANe 3SD4A 2DL7A 2H3JA 1VOMA 4BUGA 4ZTJA 5KYWA 2QQBA 5ECAA 3VJPA 2QQSA 2D6FA 2LCLA 3KFVA 1AWWA 2RJDA 1W70A 4C8QE 5DY9A 2KRMA 2M02A 2JJ9A 3GIBA 4M78B 3LGLA 2JS0A 3CCET 5LL6S 3QKJA 3MEUA 2DNUA 4DBRA 5J39A 2K2MA 4ZN3A 4PJLA 1Q82R 3DLMA 1YFNA 3QG1A 4PJOA 4XU3A 1VQPT 1Q95G 1M2OA 1VQ7A 4HCZA 4M78G 3BFMA 2CP6A 2D0QB 2LX9A 2SEMA 4KBMB 4QVDA 3QHSA 3VS7A 2HSEB 1AWXA 1B7TA 2LDMA 2FZKB 3G6EQ 3M55A 3L2RA 2YUOA 1M1KU 5GAN2 4JRPA 4YTLA 4L5GA 2ED1A 4J5YA 5FWCA 1NJIR 1M90C 3EGXA 4RKUE 2GCXA 4HVUA 2H8HA 3X28B 4XTWA 1YIJA 1D1AA 2LT4A 4PJNA 1BI2A 2Z0WA 1UHCA 2CZ1B 2RQTA 4ORZA 3CCLQ 1GXIE 1XTDA 4A63B 4M75D 4FW2A 1PSEA 3CD6T 4M7AF 3OS2A 4BY6C 1QVFP 3O5ZA 3EFOB 2CZ7B 3M59A 5KYUA 4GBQA 4LDWA 2FRYA 4DBHA 2JMCA 2LZ6B 1ZUYA 4RTVA 1X6GA 2NUPA 2XICA 5L23A 4M77G 5FRNA 1G3WA 1MNDA 4AFSC 2DTIA 3ASKA 2H3EB 5KE2A 1U8RA 1OV3A 2KE9A 4PLLA 1VQ6Q 4C5IA 4FL6A 1KG1A 3C94A 2YXYA 4F7UE 4J8OA 4M75C 2RO0A 1ACMB 4KULA 3M54A 2GF7A 3H41A 3EG2A 5IXBA 4M4ZA 2EJ9A 4CI0C 4A4FA 5KCHA 3JCMW 2CP7A 1QCOA 1D1CA 2CP0A 4BD3A 1FXXA 3GP8A 1VQ8A 3ME9A 1MV0B 3OYGA 3MO8A 2ROLA 2I0NA 2A0FB 2O4XA 3BW1A 2P4RA 3BDLA 4MMLA 1BK2A 2DTOA 1BKBA 4ZGEB 2DJZA 5LJ5j 1YI2Q 3OYIA 1K9MR 2EJGA 5FW9A 2K3BA 3QYHB 2HQXA 3J80E 2B8AA 1R77A 2Y4YA 3LWHA 5DLQE 4E7KA 2XMFA 3CCQA 2K2VA 4BE1A 3Q1JA 5I22A 2E70A 2R5AA 3HRTA 4J7IA 3LWIA 3I55A 3EFSA 3I56Q 1J3TA 5DM7R 3P8DA 1V76A 2D1XA 2ENMA 1S72Q 4M7AD 2VV5A 4OMNA 5KYXA 3TCJA 3HTRA 1PD0A 2YWWA 3RKXA 3UDCA 5EG2A 1T3LA 1UGRB 2C0TA 3EFRA 1WJSA 1SHGA 1I4K1 1IHWA 3INZA 3RMQA 1EIFA 3OW2P 4KUDK 1Y96B 4EMGA 3ZBDA 1C0MA 5I2SA 2ROTA 2DXTA 3OYFA 5DLOA 2ZPGB 4GLKA 3OYMA 3I5SA 3VS2A 1GCQA 1IRXA 2FO0A 1JO8A 3C4SA 4C8QA 3G4SA 2F69A 3CCMA 4PKCC 4KH1B 1YITT 2CDTA 4LUEA 1JEGA 4RUGA 4M7AC 1NE8A 4GLMA 5HK0A 4EMKA 2KSSA 2CP3A 1K8AU 1YNZA 2DL4A 3UT1A 4XTUA 1SSFA 2GTOA 4R55A 1N27A 4E7JA 4M7DF 4MDXA 3M0SA 3CC7Q 1OPLA 1FWZA 2KEAA 2EYWA 3RBBB 3QSUA 2ABLA 4XAXB 4E7LA 1M5Q1 3H9NA 4BY6B 4BACA 2EWNA 2DL3A 2V8JA 4MDWA 1U1TA 1GBRA 4N4GA 3M0UA 3MKDA 4JZ3A 3X20B 1X43A 5GMKl 3PIOA 2F5KA 2XDPA 2AZSA 3GBQA 1VUBA 3FEOA 1FX7A 4F14A 1Q7YC 1RL2A 1W2BA 5LJ3j 1G2BA 2FG0A 3OMCA 3QZ5B 4M75B 2RQWA 3CCVA 2OTLQ 2RHYA 2RQRA 4A4KA 1SSHA 1VA7A 2C0IA 6AT1B 4N0AC 3N5BB 2O88A 2DD5A 1X69A 5GAOr 1RLQC 3JSCA 3SWNA 2EW3A 2E41A 4PJOF 2JM9A 4M75G 1HD3A 3UA7A 3SEMA 2EQIA 3ULRB 4OMPA 4E7ZA 3CCJQ 3RIRA 4FIBA 2KT1A 1WX6A 3HFNA 2CT4A 4PFPA 5D6WA 1M1KR 1NM7A 1SRMA 2XI9A 2NYSA 1U5SA 4F7UA 1CKBA 2CREA 5LJ5e 2WSCE 1UJYA 2OAUA 3L2UA 4AG2C 3CQTA 2E12A 5HY6A 3M0PA 1RAHB 2E6ZA 1QVFS 2ZPEB 4D8KA 2X4JA 5GMKi 1E7OA 4LN2A 2HDAA 2XK0A 3L2ZA 3EH2A 3JAME 4QVCA 1B07A 4NL2A 1ZX6A 2ZPIB 4M7AB 4FM4B 2K3XA 1RAGB 2XDDA 1YJNQ 4DBQA 3A8MB 1WHKA 3G6EA 1MNEA 2CH4W 1TOVA 3CXCP 3I35A 4PJOD 1BU1A 3EH1A 4Z8AA 3S3NA 1IGUA 1FMVA 2RHIA 4KGVB 1VQ9Q 3G1JA 1M1FA 2AZVA 1PKSA 3VRYA 3REAB 5GAN7 5LJ3d 3CCLA 2L8DA 5L8RE 2CH4A 4DA4A 4DOWA 1JJ2A 1AD5A 2E10A 1QWFA 1PHTA 4J9IA 2OTJQ 1IREB 4RTXA 4M77F 4A54A 2P0KA 2DEQA 2QA4Q 3HHTB 2EAYA 2HSPA 4AFUC 4PJOC 2GGRA 2EQKA 8AT1B 1SEMA 5HCKA 2YSQA 2KRNA 3HPWA 4PFOA 3AT1B 3RERA 4JJBA 5LJ3e 1BCMA 1Q82C 2Y4XA 3OW2S 4KH0B 2KGTA 5D7UA 2KI7A 2FPEA 2O31A 2X35A 3OYBA 1KD1U 2DFUA 3JCMh 3A8HB 2LJ1A 1Q81U 3V7SA 1K9AA 2MK5A 4XQ3A 1UECA 1UGQB 4PLIA 1ABOA 2K79A 2KY9A 4FCYA 1WHJA 1NLOC 1BBZA 2QXFA 1KQ2A 1WJQA 1YI2A 2DVJA 2KDSA 2HQHA 2LNVA 4C92E 5GAMh 3A8LB 2QQ9A 3QWXX 2LQKA 4FYYB 1VYVA 2O2OA 3CEYA 4FU6A 1QVPA 1ZUUA 2L3SA 3I56A 2CP2A 3CMAT 1S72A 2AT1B 1E6GA 1YN8A 1ZLMA 1RI9A 1PNJA 1KC8R 4M7DB 1KHCA 3JCMV 3AHUA 1LCKA 1UB4A 4A4HA 4JDSA 2R58A 2VGNA 3PMIA 3JB9J 3I9QA 1ZA2B 2W10A 4D8DA 1EX4A 4IIMA 2RNAA 1ZSZC 2BZ8A 3VU3C 1B3QA 5KYYA 3FLGA 2V8IA 5AT1B 1KK7A 2J7IA 2FB7A 2DYIA 2YRCA 5KYWB 1YJWT 3CCST 2ZCFB 3CC7A 1O75A 1UJ0A 1PCXA 1YHQT 4J9CA 3CCRT 2LVMA 3OS1A 4C8QD 3NPFA 4OMOA 2FPDA 5A0DA 2FYKA 2FZCB 2GFUA 1VQKQ 4ZNXA 1M1GA 1PSFA 3JCMP 4PJOB 5KCOA 1WLPB 3GPLA 2VB6A 4RG2A 3VS0A 1H92A 2PNIA 2PUKB 5A0GA 4C0DC 1G3SA 2DILA 2YLBA 5CKFA 5J26A 4E7HA 3V7CA 2BE7D 3RKWA 2DZ9A 2KK4A 3LX7A 3JRZA 4QQGA 4A4EA 2AK5A 1GCQC 3G7ZA 3I56T 2OTLA 4C8QC 1QQJA 3EGXB 1UGVA 3O8VA 4Z89A 3OYKA 3THKA 4C0ZA 4EMKC 2DKGA 3MP1A 3EG9B 3SFMA 2XDBA 1AZEA 1TWBA 2K3YA 1JU5C 1XJWB 2FVUA 1QVGP 4RCBA 3CMEQ 4PNOA 2RN8A 1ZBJA 1X2QA 2K5FA 1O9SA 2GBQA 3CBMA 3OYLA 4V2SA 2EGCA 3CCJA 1Y57A 4QW2A 3EGDA 1A0NB 3CXCS 2M51A 5I21A 2KQWA 3VRZA 4C0GA 5GAN8 1M3BA 4AFZC 1M90U 2DA9A 3OYDA 2DBMA 1IZ6A 1QCFA 3I5RA 2EVRA 2EYYA 2M16A 2RJFA 3T9NA 2X3WD 3VS4A 5KYNA 1WQWA 3E9FA 4EIKA 3V8JA 2AHJB 3J81E 2MWPA 1GCPA 4RMOA 2D8HA 2QYZA 3QYGB 4OMFB 2EGEA 2E1HA 3GNFB 2EJFA 1I07A 3ZFJA 1ZSZB 4ZGJB 3OS0A 3JV3A 4C92A 3C95A 1WIEA 4E47A 1I5OB 2KAFA 5CIUA 3SWNC 3BE3A 3X26B 2L3QA 2O4XB 3VS6A 1NLPC 1VQOQ 1VQLT 3V8LA 2ATCB 1H641 1GFDA 2GQIA 2CYZB 2KRSA 3H0IA 1D3BA 3QPHA 1H3HA 2LJ3A 5GAMf 1OEBA 3R6NA 2HNIA 2QASA 2ZPBB 1YJNA 1JQQA 4M77B 4OMQA 3OA6A 1IO6A 2OTLT 1JRIA 1LJOA 2YUNA 4PL6A 2DZCA 1Z9QA 4L59A 3JCMg 1KD1R 1K76A 1JB0E 2PVOB 1Q81R 4C5EA 5FU6B 3LH5A 1VQ9A 4LD9K 2JT4A 5M9OA 4JRQA 1K73C 1VQMQ 2V26A 1K1ZA 1TUCA 4DOVA 3OYEA 2R5MA 5GAMg 3GNGA 3HP9A 4OF1A 3VYGA 4OMMA 2F2XA 1Q86C 2K7AA 2OTJA 1X6BA 3REBB 2QA4A 2I2LA 2E6NA 2VVKA 2NUTB 4FSSA 3P8HA 1M2VA 1W1FA 4HVWA 1VQ7T 1C6VX 2DIQA 5IAYA 3QWYA 3CCUQ 1I8FA 3CBPA 5KH6A 5HKCA 3NTKA 3CBOA 1B34A 2HMAA 2GTJA 4WTOB 4F17A 1VQ4Q 4C8QG 2JMAA 3OMGA 2DE0X 1OPKA 2BZYA 3S6WA 2NUZA 1IGQA 4J9DA 4FYWB 4EMHA 1WJRA 2CS7A 1ZQ1A 1N8RC 1YIJT 3OQ5A 2DYBA 3G71Q 4TVRA 2DX1A 1AZGB 3DLLA 2JZ2A 2RHZA 4CC3A 2JTMA 1BI1A 2OI3A 1KHIA 1QP2A 3MEWA 2EKHA 3S3MA 3NTIA 2QGGA 2DJQA 3PFSA 1WA7A 4AFQC 3CPWP 1VQNQ 3HSBA 4IUVA 3HRSA 3EG0A 3EG1A 3SWNB 3PTAA 4E7SA 3A1PA 4XTYA 4NOYA 5D6YA 1SF9A 1LVKA 1OZ2A 1G83A 2PUOB 1Q7YU 4CC2A 2FL7A 2F1LA 4JUVA 1OX8A 2QA4T 3CCEQ 2P84A 1RABB 2X51A 1VQ5Q 5LJ5h 1VQ8T 3BDUA 5CCAA 5GAOm 3CC2Q 1TUGB 2CUBA 2RPNA 1RAAB 1AOJA 3JCMJ 2LRQA 1AT1B 3VS3A 3FJPA 1UG1A 4QQ6A 3PNWC 5J3BA 1ABQA 1OX9A 2A08A 2X4XA 1QVGS 2D8JA 3TSWA 4QT7A 1YCYA 3CCQT 4F7UG 4L6V5 3MEAA 2XIDA 1K0SA 2DPPB 1KQSP 2XKOC 1YP5A 3I55T 5AYFA 1VQKA 3NHNA 3S3OA 4OVAA 9ATCB 3PIPA 1WGSA 3PE0A 5FLXE 1NEGA 1PM3A 1IHVA 2L89A 2GQVA 2R57A 1M90R 1KSWA 3EG3A 1GRIA 1IB8A 1Y96A 2K9GA 2F2VA 2KT8A 3DB3A 3OSSC 3UATA 4IIOA 1TU0B 1KC8C 3CPFA 3MP6A 3M9QA 3G4ST 3CCMT 1QVFA 1NYFA 3RMSA 3QUIA 4FT4A 4XTXA 3MPUB 2SRCA 3PMTA 1M8VA 3NTHA 3WVDB 2QG9B 3M4GA 4HVVA 3ZL7C 3CMEA 2KBTA 1D0XA 3L2WA 4QQDA 4ESRA 2LQWA 1AWJA 1MMNA 3HFOA 4C5GA 3FC3A 4RTUA 3L2VA 2LQNA 3GOXA 1PD1A 4MZMA 4AMCA 2J05A 4OB2B 4K11A 2QAZA 3IQLA 2P0PA 1G3YA 4PK4A 3WXMB 1PRMC 4R56A 1KJWA 2J6OA 4EDUA 1SHFA 5GJVB 4Y28E 4C5HA 3CCVT 1OULA 1SPKA 1EZZB 2VXEA 3ZEHA 2QGFB 1OU8A 2V1RA 1YJ9Q 2DXUA 4JRIA 2COZA 2A7YA 2DK3A 2ZAEA 3OYCA 4JS4A 1U06A 2ESWA 4LD6A 1ARKA 3UA6A 1M27C 2QI2A 1VQOA 2BUDA 4BE2A 3NGPA 3JB9G 4Y91A 3JB9H 3OBWA 3EHRA 4A4GA 1D1BA 1WXUA 2QEXQ 2EBPA 2DETA 4IKFA 2KMTA 4M7DE 3TVTA 3F70A 5GAOp 1Q82U 2VKNA 2X3XD 5IXFA 4QVZA 3OYNA 4RTZA 1MMAA 5GAMj 3OW2A 3X25B 1M3AA 5GAOn 3FB9A 4CRIA 1Y71A 3QBYA 1YITQ 1OYXA 4J83A 2OX7A 1N6AA 2JVVA 1VQMA 2FRWA 1VYTA 3CMET 1NZ9A 5CAIA 4X1VA 1Z9ZA 1VQ6A 4DEYA 4ATOA 5GMKh 2LMJA 2CZ6B 1X75C 2QQRA 3DKMA 5KYYB 4N4HA 2L5QA 4IUPA 2EYZA 3CPWS 4AT1B 4HCCA 4JJCA 5CQXA 1K0XA 3CCUA 3JCMc 2KVQG 3QIIA 4C8QF 3JCMQ 5I2MA 2DVEA 2PQWA 3QJ6A 1I5LA 2K5IA 1K8AR 1NJIC 4PJOE 3C12A 3G6ET 1VQ4A 4C0FA 1OOTA 3HL8A 3H0FA 4RTTA 4JJDA 5LJ5g 1X01A 2ZPFB 2RQVA 1G5VA 2CZ0B 2HKQB 1MMGA 2COWA 3L42A 3G71A 1QKXA 2ZGWA 1PC0A 1UE9A 5IN1A 3TSZA 1RLPC 4ELYC 3CCLT 1S1NA 3JCMX 1RACB 4B9XA 2YLCA 2Y90A 2DERA 1XNIA 2JW4A 2G6FX 2GFAA 4RTWA 4BI4A 1KQSS 5GANh 2RQUA 4JLGA 4XU2A 2QK0A 2DXCA 3M58A 3OY9A 1WHHA 3L2QA 3JCMd 4IUQA 2CT3A 2LX7A 4N0AA 3URGA 4ZN1A 2ECZA 1VQNA 2W0ZA 3OSVA 4M78E 2HL3A 1RAFB 4JLIA 1WZOA 4OGEA 1VQ6T 2DMOA 1KQ1A 3L1AA 1DJ7B 1R0BG 2PVGB 2EPDA 4ME7A 2JNGA 4Z88A 1TH7A 5A2QE 3KXTA 3CCEA 5GAMd 3MEVA 2D0NA 3EGDB 1VQ5A 2KROA 3ER0A 3CC2A 2LTOA 4N4IA 3U23A 3VS5A 3V8KA 1QKWA 1XQHA 2KXDA 1K9MC 2P4TA 2LNHB 5I11A 2FPFA 2K57A 3CCUT 5EC7A 1WNLA 1YI2T 4LDUA 1ZHIA 1WQ7A 4DQ2A 4F7UF 1VQ4T 4BDYA 3V7RA 5GAOl 2DD4A 3OYAA 3UF4A 1T0JA 2IPOB 5GAMe 2O9SA 4BB7A 3VUBA 4X9DA 1X2KA 2MPXC 1CKAA 4M77E 2DO3A 3KBGA 2LCSA 1S72T 2K5LA 3G71T 4M7DA 3FRNA 3CXCA 2YHTA 4JZ4A 3LGFA 3CC4Q 2VYTA 1D3BB 2FZGB 2KYMA 2QTVA 4F04B 4C92G 2B86A 2EFIA 2MOXA 2O9VA 5IH2A 3X24B 5KYUB 2HAXA 1WHLA 2PZ1A 2ED0A 3PVQA 3VV0A 2J6KA 5C0MA 2NUPB 2BKDN 2DBKA 4KGZB 2LT1A 1RADB 2VASA 4WCIA 4MMKA 3H0HA 3CC7T 3R6OA 1W4SA 4QKUA 3RDVA 1VQ5T 3CC2T 4KUIA 1N9SA 2C06A 3JCMf 4FYXB 3SB2A 2F5TX 5GAOq 4B9WA 4HA8A 1YBYA 1BIBA 5KE3A 1W2BP 4XTVA 1M2VB 1UDLA 2HCKA 4DBFA 2RH2A 1EFNA 1RAIB 2L0AA 1K73U 3TEEA 4RTYA 1M9SA 1B34B 1AHJB 1UTIA 2X4WA 2EQUA 1FMWA 2A36A 4BDZA 1MUZA 1WPYA 2IVWA 3LW5E 2V8KA 1HXDA 3QJYA 4PJJA 5C6SA 3OYJA 1Q86U 3JB9I 1YJ9A 1H3ZA 2QQAA 4JJNK 3C0CA 3EG9A 3H8ZA 2WSFE 3CMAQ 3JB9F 1X27A 2YRVA 2KR3A 3A98A 5KYXB 2YUQA 1GFCA 2JN0A 3WVEB 2VC8A 4HCKA 2CSQA 5CVIA 2QEXA 2XD0A 1G8XA 1M1KC 2RM4A 1I1JA 3CCJT 5GAN5 4M78A 5A0LA 1MGQA 4C0DB 5GANf 5CKDA 4LUDA 2DRKA 1UGSB 3LYIA 4Z02A 4J9FA 1GL5A 1NBEB 2MI6A 1YITA 1G3TA 4C8QB 4X9CA 4LNPA 1HYOA 2L3PA 1N8RU 3H6ZA 2DM1A 1KIKA 4EMKB 1H8KA 1YJWQ 3FDRA 4OB0B 1BYMA 3CCSQ 1TSFA 4ZTFA 3MP8A 1FYNA 1YHQQ 1ZBXA 2F2WA 3M0TA 4J9EA 1ZSZA 2M0YA 3CCRQ 1TTHB 2PTKA 2YUPA 5GANg 4FSXA 2K6DA 3A8GB 1I81A 2AIRB 4LXCA 4OB3B 3QDFA 2MF2A 2RHXA 4M75E 3VS1A 3UPUA 2XG8D 4O5VA 3NMZC 1LOJA 4JPBW 2DAQA 5IHNA 2EYQA 4M77A 1YJNT 3JB9D 2A3LA 1WI7A 3EFOA 1YJ9T 2P0QA 2M0OA 1I0CA 4E6RA 4D6WA 4CC4B 1VQ9T 3PGGA 1V1CA 1OZ3A 1Y7XA 4OB1B 2MCNA 1JJ2P 2QEXT 2CUDA 3EAEA 2RB6A 4LDYA 1U3OA 3RKYA 3QO3A 2CGHA 3GLXA 1Y07A 3RESA 5CKEA 2OTJT 1QVGA 4LDXA 2D9TA 3D7SB 2DLPA 4KT0E 2NUTA 4B6MA 4J6YA 1F1BB 3FJ5A 4HXJA 2EQMA 1BI3A 2DXBA 2E4HA 4F7UB 1GBQA 2DRMA 1QW1A 1WDXA 1UFFA 1BB9A 1VQPQ 2QTXA 1E6HA 4UC4A 1JXOA 1M4ZA 2PVDB 5GAN6 4E7IA 1R8OB 1T0HA 2VGMA 4HT8A 2EKOA 3M4YA 3JCMb 2A37A 5GJWB 4AG1C 2MMPA 4M7AE 2HBPA 1RI0A 1SKUB 3A5ZB 1KC8U 4R0KA 3TREA 1K8AC 3M56A 3FIFA 3OBYA 2EYXA 1UUEA 3LH0A 1VQLQ 1VYUA 3SHWA 4J9BA 1OI1A 4HCBA 1BCOA 2K4YA 2HKNA 4JS5A 3MCAB 3PT9A 1IXDA 2BZXA 1N9RA 1NYGA 2NLUA 1K4US 1WHGA 2E3HA 3CD6Q 3M5AA 2DF6A 2YT6A 2JTEA 2L2PA 1M8MA 1D0YA 5LJ5d 2GNCA 1W2BS 1YCSB 3RNJA 1P92A 2VWFA 1T3SA 2HQEA 3EHQA 4O6JA 3MHXA 4C92F 1VIFA 1FMKA 4J6XA 1KFZA 3CC4A 2LCCA 2YDLA 1PKTA 2JUFA 5GAN4 5FWBA 4HKEA 4NL3A 2RJCA 4NS5A 4MZPA 4J6WA 1K73R 2RF0A 3P8BB 1UEBA 2VXFA 2QDLA 2LJ0A 2MIOA 1MV3A 5CR2A 4M7DD 2JTFA 1R0CB 3TU4K 2WSEE 2RA2A 4RCCA 2E3IA 1YWOA 1Q86R 2NWMA 3E1SA 2JS2A 5LJ3h 4KGXB 1VQ7Q 2A28A 2DIGA 2PU9B 1JXMA 4XU1A 2M1HA 4OMLA 2BIVA 4RG8A 3PVLA 5HK3A 4M75A 2MWOA 1HSQA 2RI3A 1QWEA 4VUBA 1VQKT 1UHFA 4M78F 4M7DC 3KUFA 5GMKj 2IG0A 4KRTA 1JBMA 2IIMA 5GAN3 3QDRB 1YIJQ 5CKHA 5CO7A 2XHCA 1OU9A 1C1AA 4II1A 2EGAA 1N8RR 4OP0A 1WYXA 4DEXA 2LP5A 2DTHA 1QLYA 1NEBA 5IT9E 1XOVA 1ZSGA 1X6OA 4C92D 1NPPA 1WXBA 1OQKA 4M7AG 1YWPA 4CC7A 1TXQA 4XU0A 2EIFA 2HBWA 3CMAA 3SDZA 3OB9A 4X34A 2KYBA 3CC4T 2CKKA 2J6FA 1D0ZA 1NG2A 2E5QA 3CPWA 3J7AF 8ATCB 1PRLC 3RUXA 5IHKA 3M0QA 1HK9A 1WXTA 2MAMA 1NJIU 1QCNA 4OGCA 4BI8B 1BIAA 4Q5WA 3TQ7P 1AVZC 2RJEA 5LJ5f 1VQ8Q 4C92C 1VIEA 4PFZA 2DEUA 4FW1A 2E5KA 3M57A 5GANj 4BE0A 4IUUA 5FU7C 1JJ2S 4M7AA 1YJWA 4M78D 4ELZC 1BI0A 1ZUKA 3CCSA 3MJXA 4BI3A 2J06A 2M9UA 2BE9B 3NFCA 3QZ9B 1YHQA 2YRDA 3CCRA 4PJMA 3CCQQ 2X4YA 3E2UA 5CKBA 4HT9A 4J9GA 1Q7YR 1RUWA 3I55Q 1TG0A 4FT2A 2HEQA 4XTZA 4GY5A 2RD1A 1PWTA 1VQOT 1KQSA 2RI5A 2O01E 2C0OA 3OYYA 3VKIA 5FROA 2KNBB
chains in the Genus database with same CATH topology
3DLLA 2JZ2A 2RHZA 2OAUA 3L2UA 4MMKA 2JTMA 3CC7T 2E12A 5HY6A 1BI1A 3R6OA 4M78C 1KD1C 1W4SA 2E6ZA 1KHIA 1QP2A 2ZPEB 3DB4A 1VQ5T 1QVFS 1Q81C 4A53A 3HKSA 3MEWA 3CC2T 4KUIA 2E64A 2EQJA 1N9SA 3VYHB 3JCMf 2C06A 2X4JA 5GMKi 3NTIA 3S3MA 1NPRA 3META 4IURA 3OS5A 3QXEB 3SB2A 1LNXA 2F5TX 5GAOq 3PFSA 4B9WA 4HA8A 2XK0A 1YBYA 1BIBA 5KE3A 3L2ZA 3HSBA 4IUVA 3HRSA 4XTVA 3JAME 2RK2A 4EPCA 4M77D 1K9MU 4QVCA 1VQMT 3M53A 3SWNB 4NL2A 2RH2A 3PTAA 2WACA 2ZPIB 4M7AB 4XTYA 2QDYB 4NOYA 5CQYA 5D6YA 4FM4B 2K3XA 1K73U 3TEEA 5GMKm 1M9SA 1OZ2A 1B34B 1AHJB 2PUOB 2XDDA 1Q7YU 2X4WA 1U1SA 2EQUA 4WF2A 5FRMA 2FL7A 3A8MB 3BY7A 2RI2A 3G6EA 4BDZA 3E9GA 4JUVA 1WPYA 2IVWA 2QA4T 4M7DG 3LW5E 2V8KA 3G4SA 1HXDA 2HD0A 3QJYA 5LJ5h 1VQ8T 3BDUA 5CCAA 4PJOD 4J7FA 4JRKA 5C6SA 5GAOm 3OYJA 1Q86U 2E65A 3JB9I 1YJ9A 3S3NA 1H3ZA 4P5NA 5GMKe 2QQAA 4JJNK 3JCMJ 2RHIA 3H8ZA 2WSFE 2LC4A 2LRQA 3JB9F 5LJ3f 3JCMe 2YRVA 3OYHA 1M1FA 3FJPA 1MHNA 3PNWC 4QQ6A 2JN0A 1VQPA 5J3BA 2LQ8A 4M77C 3VUZA 3WVEB 2VUBA 2VC8A 2X4XA 1QVGS 3A8OB 5LJ3d 5GAN7 2L8DA 3CCLA 3E19A 5L8RE 5CVIA 2QEXA 2XD0A 4DA4A 1M1KC 4IUTA 2RM4A 1YCYA 4DOWA 5GAN5 3CCJT 1JJ2A 4M78A 5A0LA 4ZGDB 1QP3A 3GF5A 4F7UG 3CCQT 1MGQA 3LLRA 2E10A 4L6V5 3MEAA 2XIDA 4C0DB 5GANf 5FU6C 2DPPB 3HRUA 5CKDA 1IREB 2ZPHB 2XKOC 4M77F 4A54A 2P0KA 1UGSB 2DEQA 3HHTB 3LYIA 3I55T 3LWHA 4Z02A 5AYFA 2EAYA 1VQKA 3S3OA 4PJOC 2RK1A 4OVAA 3PIPA 1WGSA 2EQKA 5GANd 2MI6A 5FLXE 4C92B 1YITA 1G3TA 4C8QB 4X9CA 2L89A 2GQVA 2R57A 4MZTA 3HPWA 1VQLA 5LJ3g 1N8RU 3H6ZA 2ZZDA 4EMKB 3RERA 5FU7B 3FDRA 4OB0B 1Y96A 5LJ3e 1BYMA 2L3RA 1Q82C 2Y4XA 4XK8E 3OW2S 4ZTFA 3DB3A 3MP8A 2XU8A 3OSSC 1V29B 1ZBXA 2FHDA 4PJOG 1UGPB 3OYBA 2X35A 1KD1U 3JCMh 1KC8C 3CD6A 3A8HB 3CPFA 1Q81U 3UWNA 3V7SA 3MP6A 3M9QA 5GANg 2RHUA 3G4ST 4LDVA 5CK9A 4FSXA 4XQ3A 3CCMT 1QVFA 2G3RA 4M75F 1UGQB 2JOYA 3A8GB 4PLIA 5D6XA 1I81A 1VQNT 5GANe 4OB3B 3SD4A 2H3JA 3RMSA 3QUIA 2MF2A 4FT4A 4BUGA 2KY9A 4XTXA 2RHXA 4ZTJA 4M75E 3UPUA 2QQBA 3VJPA 2XG8D 4O5VA 2QXFA 2QQSA 1WJQA 1YI2A 1KQ2A 2D6FA 3PMTA 1M8VA 3NTHA 2KDSA 3WVDB 2LCLA 1LOJA 2DAQA 3M4GA 2LNVA 4C92E 2EYQA 4M77A 3CMEA 2RJDA 5GAMh 4C8QE 1YJNT 5DY9A 3A8LB 2QQ9A 3JB9D 2A3LA 3L2WA 1KQSS 2LQKA 3GIBA 4M78B 3LGLA 4QQDA 3CCET 5LL6S 3QKJA 3MEUA 3HFOA 4C5GA 1YJ9T 3FC3A 3CEYA 5J39A 1VQLT 2P0QA 4FU6A 2M0OA 1QVPA 4ZN3A 3DLMA 3I56A 4D6WA 3L2VA 3CMAT 1S72A 3QG1A 1VQ9T 3GOXA 3PGGA 4PJOA 4XU3A 1VQPT 4MZMA 4M7DB 1OZ3A 1Y7XA 1VQ7A 4OB1B 4HCZA 4M78G 3BFMA 1KHCA 4OB2B 3JCMV 2D0QB 2LX9A 3EAEA 4KBMB 4QVDA 2QEXT 3AHUA 1UB4A 2RB6A 4A4HA 4JDSA 2R58A 2VGNA 3PMIA 3QHSA 4LDYA 3JB9J 2P0PA 3RKYA 1G3YA 2LDMA 3QO3A 2CGHA 3GLXA 1Y07A 3WXMB 4R56A 3M55A 3L2RA 3RESA 4EDUA 5CKEA 4C5HA 4Y28E 3VU3C 5GAN2 1QVGA 1M1KU 4JRPA 2OTJT 4YTLA 3CCVT 4L5GA 4LDXA 4J5YA 2D9TA 2VXEA 3ZEHA 1M90C 4KT0E 2DXUA 4J6YA 4JRIA 3FLGA 2A7YA 2DK3A 4RKUE 3OYCA 2GCXA 4JS4A 4LD6A 2V8IA 2EQMA 1BI3A 2DXBA 4XTWA 3X28B 2QI2A 4F7UB 2BUDA 1VQOA 1QW1A 1YIJA 2LT4A 1BI2A 2FB7A 2CZ1B 2QTXA 1YJWT 4BE2A 4UC4A 3JB9G 4Y91A 3CCST 1M4ZA 2PVDB 2ZCFB 5GAN6 3JB9H 1XTDA 3OBWA 1GXIE 4E7IA 4A4GA 1R8OB 4M75D 3CC7A 1O75A 4IKFA 2VGMA 4HT8A 2KMTA 2EKOA 1PSEA 1YHQT 3CD6T 4M7AF 3OS2A 4M7DE 3F70A 3M4YA 5GAOp 3CCRT 4BY6C 3JCMb 2LVMA 1Q82U 3OS1A 2CZ7B 4QVZA 4C8QD 3OYNA 3M59A 2MMPA 4M7AE 5GAMj 1YITT 5A0DA 2FYKA 2HBPA 1RI0A 2GFUA 3A5ZB 4LDWA 3X25B 3OW2A 1KC8U 1M1GA 5GAOn 3FB9A 3TREA 4CRIA 1PSFA 1VQ4A 1Y71A 1K8AC 3JCMP 3M56A 3QBYA 2XICA 1OYXA 3FIFA 3OBYA 4M77G 5FRNA 1G3WA 5KCOA 4PJOB 2DTIA 3GPLA 3ASKA 4J83A 3LH0A 1N6AA 2JVVA 4RG2A 1VQMA 5KE2A 1U8RA 3CMET 2PUKB 1NZ9A 5A0GA 4PLLA 4C0DC 1OI1A 4HCBA 4C5IA 4FL6A 5CAIA 1G3SA 1KG1A 2YLBA 2K4YA 5CKFA 5J26A 4E7HA 3V7CA 3C94A 4F7UE 4JS5A 1VQ6A 3MCAB 4J8OA 4M75C 2RO0A 3PT9A 4KULA 2DZ9A 3M54A 3RKWA 2GF7A 2KK4A 1N9RA 3LX7A 4ATOA 2EJ9A 2NLUA 4A4FA 4CI0C 5KCHA 5GMKh 3JCMW 3JRZA 2CZ6B 4QQGA 4A4EA 4BD3A 1FXXA 3G7ZA 1X75C 2QQRA 3M5AA 3GP8A 3I56T 2OTLA 3DKMA 4C8QC 1VQ8A 3ME9A 3OYGA 3O8VA 3OYKA 4N4HA 2L5QA 3MO8A 4IUPA 3CPWS 4C0ZA 4HCCA 4EMKC 5LJ5d 5CQXA 1W2BS 2O4XA 2DKGA 3BW1A 3MP1A 3BDLA 1P92A 3SFMA 4MMLA 2XDBA 2DTOA 1BKBA 2HQEA 4ZGEB 2DJZA 2K3YA 5LJ5j 4O6JA 3CCUA 3MHXA 4C92F 2FVUA 3JCMc 1VIFA 2KVQG 3QIIA 4C8QF 4J6XA 3OYIA 3JCMQ 5I2MA 3CC4A 2EJGA 2DVEA 2LCCA 2JUFA 2PQWA 5GAN4 3QJ6A 4RCBA 1I5LA 4PNOA 4HKEA 2K5IA 3QYHB 2HQXA 4NL3A 2RJCA 3J80E 1NJIC 4PJOE 2K5FA 4NS5A 1O9SA 2B8AA 2Y4YA 3C12A 3CBMA 4J6WA 4MZPA 5DLQE 3OYLA 3P8BB 1UEBA 2VXFA 4C0FA 3G6ET 3CCJA 4E7KA 4V2SA 3CCQA 4QW2A 2K2VA 3HL8A 4BE1A 3Q1JA 5CR2A 3TU4K 3CXCS 4M7DD 2JTFA 5I21A 2E70A 2KQWA 2R5AA 2WSEE 2RA2A 3HRTA 4J7IA 4C0GA 5LJ5g 4RCCA 1X01A 2ZPFB 3EFSA 5GAN8 3I55A 5DM7R 1G5VA 2CZ0B 3P8DA 1M90U 4M7AD 2VV5A 3E1SA 3TCJA 3OYDA 5LJ3h 3L42A 1IZ6A 3G71A 3RKXA 2ZGWA 3UDCA 3LWIA 5EG2A 2M16A 1UGRB 2RJFA 3EFRA 3T9NA 5IN1A 1WJSA 4ELYC 3CCLT 2DIGA 2PU9B 3JCMX 4XU1A 2M1HA 2BIVA 1WQWA 4B9XA 1I4K1 2YLCA 3E9FA 3INZA 4RG8A 3RMQA 1EIFA 2Y90A 3V8JA 4KUDK 2AHJB 1Y96B 5HK3A 1XNIA 4EMGA 3J81E 2MWPA 3ZBDA 5I2SA 4RMOA 2GFAA 2DXTA 3QYGB 4M75A 4OMFB 4BI4A 5DLOA 2ZPGB 2MWOA 3OYFA 2E1HA 3GNFB 2EJFA 5GANh 4JLGA 2RI3A 4GLKA 4XU2A 3ZFJA 3OYMA 4VUBA 2DXCA 3M58A 4ZGJB 3OS0A 4M78F 3OY9A 1VQKT 3L2QA 4M7DC 4C92A 3C4SA 3C95A 4C8QA 4E47A 2F69A 4IUQA 3JCMd 4PKCC 3URGA 4N0AA 4ZN1A 3KUFA 2KAFA 5GMKj 2IG0A 5CIUA 1JBMA 3SWNC 3X26B 5GAN3 1VQNA 3OSVA 2O4XB 4M78E 4M7AC 1NE8A 3QDRB 5HK0A 5CKHA 2KSSA 4JLIA 5CO7A 3V8LA 4EMKA 2XHCA 1H641 1K8AU 4OGEA 3UT1A 4II1A 4XTUA 1SSFA 2CYZB 1VQ6T 4R55A 1D3BA 1N27A 3QPHA 4E7JA 4M7DF 5GAMf 4MDXA 1KQ1A 3L1AA 1DJ7B 2HNIA 1FWZA 2PVGB 4OP0A 2ZPBB 1YJNA 4M77B 4ME7A 3QSUA 2DTHA 3OA6A 2JNGA 4XAXB 4E7LA 2OTLT 1TH7A 5A2QE 3KXTA 1JRIA 3CCEA 5IT9E 5GAMd 1LJOA 1XOVA 1M5Q1 1X6OA 3MEVA 4PL6A 4C92D 1VQ5A 2DZCA 3ER0A 1NPPA 2EWNA 4BY6B 4L59A 3JCMg 4BACA 2LTOA 4N4IA 3CC2A 4M7AG 3V8KA 2V8JA 4MDWA 1U1TA 1XQHA 1JB0E 2PVOB 4N4GA 4XU0A 5FU6B 4C5EA 2P4TA 1K9MC 2EIFA 3CMAA 3X20B 3SDZA 1VQ9A 3OB9A 4LD9K 2K57A 4X34A 5GMKl 3PIOA 3CCUT 1WNLA 5M9OA 4JRQA 2F5KA 3CC4T 2XDPA 1K73C 1YI2T 4LDUA 2CKKA 1VUBA 3FEOA 1ZHIA 1FX7A 2E5QA 1WQ7A 4DQ2A 3CPWA 4F7UF 1Q7YC 3J7AF 1RL2A 1VQ4T 1W2BA 3RUXA 5LJ3j 3V7RA 4BDYA 5GAOl 2DD4A 4DOVA 3OYEA 3OYAA 2R5MA 1HK9A 5GAMg 3GNGA 3HP9A 3OMCA 2MAMA 3QZ5B 4OF1A 4OGCA 3VYGA 4BI8B 1Q86C 1NJIU 4M75B 5GAMe 2OTJA 1BIAA 4Q5WA 4BB7A 3VUBA 3CCVA 2QA4A 2RJEA 5LJ5f 2I2LA 2RHYA 4X9DA 4C92C 1VIEA 4A4KA 2E6NA 4M77E 2DO3A 3KBGA 3N5BB 4N0AC 1S72T 2K5LA 3G71T 4M7DA 3FRNA 2DD5A 3M57A 3P8HA 5GANj 3CXCA 4BE0A 5GAOr 1VQ7T 2YHTA 4IUUA 2DIQA 5FU7C 3JSCA 3SWNA 5IAYA 1JJ2S 3LGFA 4M7AA 1I8FA 2E41A 3CBPA 5KH6A 4PJOF 5HKCA 3NTKA 4M75G 4M78D 1BI0A 2VYTA 4ELZC 1YJWA 1D3BB 3CCSA 4BI3A 3CBOA 1B34A 2M9UA 3NFCA 3QZ9B 4C92G 1YHQA 4C8QG 2EFIA 3CCRA 3RIRA 2X4YA 4FIBA 3OMGA 5CKBA 3HFNA 4HT9A 3X24B 3S6WA 5D6WA 2HAXA 2XI9A 4FT2A 4XTZA 4EMHA 4GY5A 1WJRA 4F7UA 2RD1A 3VV0A 2CS7A 1ZQ1A 1N8RC 1VQOT 5C0MA 2RI5A 1YIJT 1KQSA 2BKDN 2O01E 3OQ5A 5LJ5e 2LT1A 3CCMA 4TVRA 3OYYA 3VKIA 5FROA 2WSCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP8 A;  2JZ2 A;  2RHZ A;  1RI0 A;  2FHD A;  2GFU A;  2O4X B;  3L2U A;  3OYB A;  2X35 A;  4CRI A;  3QBY A;  3UT1 A;  3UWN A;  1OYX A;  4II1 A;  3DB4 A;  5FRN A;  1SSF A;  3M9Q A;  3MP6 A;  5KCO A;  1N27 A;  4E7J A;  2RHU A;  3ASK A;  3MEW A;  2G3R A;  3LH0 A;  4RG2 A;  2EQJ A;  4PLI A;  5D6X A;  5KE2 A;  3SD4 A;  3S3M A;  3NTI A;  3MET A;  3OA6 A;  4PLL A;  4IUR A;  1OI1 A;  4E7L A;  4C5I A;  4FL6 A;  2RHX A;  4ZTJ A;  4PL6 A;  3MEV A;  5J26 A;  4E7H A;  3PFS A;  4B9W A;  4BAC A;  2QQS A;  1WJQ A;  2XK0 A;  2RO0 A;  4L59 A;  5KE3 A;  3PMT A;  2LTO A;  3NTH A;  2GF7 A;  3LX7 A;  4N4I A;  4IUV A;  2NLU A;  2DAQ A;  4A4F A;  5KCH A;  4QQG A;  2RJD A;  4A4E A;  4BD3 A;  4N4G A;  4C5E A;  2QQR A;  2WAC A;  3L2W A;  5D6Y A;  3OB9 A;  3ME9 A;  4X34 A;  4QQD A;  2K3X A;  3LGL A;  3O8V A;  3OYK A;  4N4H A;  5M9O A;  3MO8 A;  3OYG A;  4ZTF A;  2F5K A;  4IUP A;  2XDP A;  3QKJ A;  3MEU A;  1OZ2 A;  4C5G A;  2CKK A;  3FC3 A;  3CEY A;  5J39 A;  3FEO A;  2X4W A;  2EQU A;  5FRM A;  2E5Q A;  2O4X A;  4FU6 A;  2M0O A;  2RI2 A;  3MP1 A;  3BDL A;  4BDZ A;  3E9G A;  3DLM A;  4BDY A;  2HQE A;  2K3Y A;  3L2V A;  3OYE A;  3GOX A;  3OYA A;  2R5M A;  3QII A;  5C6S A;  3OYI A;  3OYJ A;  3OMC A;  2LCC A;  3S3N A;  2PQW A;  1OZ3 A;  3QJ6 A;  1H3Z A;  2HQX A;  2RHI A;  2RJC A;  4HCZ A;  3H8Z A;  4Q5W A;  4NS5 A;  2LRQ A;  2B8A A;  1KHC A;  2RJE A;  3EAE A;  3OYL A;  2YRV A;  4E7K A;  2RHY A;  3OYH A;  4A4H A;  2R58 A;  3PMI A;  2E6N A;  4QW2 A;  4BE1 A;  1MHN A;  3PNW C;  3Q1J A;  4QQ6 A;  2JTF A;  2LDM A;  2X4X A;  2R5A A;  3P8H A;  2L8D A;  3L2R A;  4BE0 A;  4EDU A;  4IUU A;  2DIQ A;  4C5H A;  5IAY A;  1G5V A;  3P8D A;  3LGF A;  4IUT A;  5CIU A;  2D9T A;  5KH6 A;  3ZEH A;  3NTK A;  3OYD A;  2VYT A;  3L42 A;  3LLR A;  3MEA A;  3FLG A;  2M16 A;  2RJF A;  3OYC A;  5IN1 A;  1WJS A;  2P0K A;  3LYI A;  4LD6 A;  2DIG A;  2EQM A;  2EFI A;  4Z02 A;  2M1H A;  2BUD A;  2BIV A;  3S3O A;  4B9X A;  4OVA A;  2X4Y A;  3E9F A;  3OMG A;  1WGS A;  2EQK A;  1XNI A;  4BE2 A;  3S6W A;  2MWP A;  4UC4 A;  5D6W A;  2L89 A;  2R57 A;  4E7I A;  2GFA A;  4A4G A;  3OYF A;  4IKF A;  4GY5 A;  1WJR A;  2MWO A;  2EKO A;  2RI3 A;  3H6Z A;  3OYM A;  3OS2 A;  3F70 A;  5C0M A;  2RI5 A;  2LVM A;  3OS0 A;  3OY9 A;  2BKD N;  3FDR A;  3OQ5 A;  3L2Q A;  2L3R A;  3C4S A;  4QVZ A;  3OS1 A;  3OYN A;  4IUQ A;  5FRO A;  3KUF A;  2IG0 A;  3DB3 A; 
#chains in the Genus database with same CATH topology
 2JM8 A;  2HL5 C;  2X9H A;  4M78 C;  2CSI A;  1KD1 C;  3DB4 A;  1Q81 C;  4A53 A;  3HKS A;  2E64 A;  2EQJ A;  3VYH B;  1TUD A;  4FYV B;  7AT1 B;  1NPR A;  3MET A;  1SG5 A;  4IUR A;  3OS5 A;  4Y92 A;  3QXE B;  1CSK A;  1LNX A;  1WFW A;  3G4S Q;  3CCM Q;  1Y0M A;  2OJ2 A;  2RK2 A;  4EPC A;  4M77 D;  1K9M U;  1W6X A;  2V1Q A;  1VQM T;  3M53 A;  2WAC A;  1AWO A;  2QDY B;  3EGU A;  5CQY A;  3M0R A;  1RAE B;  1M30 A;  5GMK m;  2MYS A;  2CP5 A;  4WF2 A;  1U1S A;  5FRM A;  3BY7 A;  2RI2 A;  3E9G A;  4M7D G;  2HD0 A;  4J7F A;  4JRK A;  1M3C A;  2E65 A;  4F16 A;  4P5N A;  5GMK e;  1QMC A;  2LC4 A;  1HJD A;  5LJ3 f;  2AKK A;  2RMO A;  3JCM e;  3OYH A;  1N5Z A;  1MHN A;  1AEY A;  1VQP A;  2LQ8 A;  4M77 C;  2DL5 A;  3VUZ A;  2VUB A;  3A8O B;  1TS9 A;  2FEI A;  3E19 A;  4IUT A;  4ZGD B;  1QP3 A;  3GF5 A;  3LLR A;  4J9H A;  5FU6 C;  3HRU A;  2ZPH B;  3CCV Q;  2DL8 A;  2RK1 A;  2BTT A;  5GAN d;  4C92 B;  1WHM A;  4LE9 A;  4MZT A;  2KXC A;  2OAW A;  2JXB A;  1VQL A;  5LJ3 g;  1ZA1 B;  2HZY A;  3RR6 A;  2ZZD A;  4ANJ A;  5FU7 B;  2L3R A;  5IHI A;  1MMD A;  4XK8 E;  2XU8 A;  1V29 B;  2FHD A;  1LPL A;  4PJO G;  1UGP B;  2AKL A;  3CD6 A;  1PG5 B;  2COY A;  3UWN A;  1SRL A;  4E2F B;  2RHU A;  4LDV A;  5CK9 A;  1D09 B;  2G3R A;  4M75 F;  2JOY A;  1VQN T;  5D6X A;  5GAN e;  3SD4 A;  2DL7 A;  2H3J A;  1VOM A;  4BUG A;  4ZTJ A;  5KYW A;  2QQB A;  5ECA A;  3VJP A;  2QQS A;  2D6F A;  2LCL A;  3KFV A;  1AWW A;  2RJD A;  1W70 A;  4C8Q E;  5DY9 A;  2KRM A;  2M02 A;  2JJ9 A;  3GIB A;  4M78 B;  3LGL A;  2JS0 A;  3CCE T;  5LL6 S;  3QKJ A;  3MEU A;  2DNU A;  4DBR A;  5J39 A;  2K2M A;  4ZN3 A;  4PJL A;  1Q82 R;  3DLM A;  1YFN A;  3QG1 A;  4PJO A;  4XU3 A;  1VQP T;  1Q95 G;  1M2O A;  1VQ7 A;  4HCZ A;  4M78 G;  3BFM A;  2CP6 A;  2D0Q B;  2LX9 A;  2SEM A;  4KBM B;  4QVD A;  3QHS A;  3VS7 A;  2HSE B;  1AWX A;  1B7T A;  2LDM A;  2FZK B;  3G6E Q;  3M55 A;  3L2R A;  2YUO A;  1M1K U;  5GAN 2;  4JRP A;  4YTL A;  4L5G A;  2ED1 A;  4J5Y A;  5FWC A;  1NJI R;  1M90 C;  3EGX A;  4RKU E;  2GCX A;  4HVU A;  2H8H A;  3X28 B;  4XTW A;  1YIJ A;  1D1A A;  2LT4 A;  4PJN A;  1BI2 A;  2Z0W A;  1UHC A;  2CZ1 B;  2RQT A;  4ORZ A;  3CCL Q;  1GXI E;  1XTD A;  4A63 B;  4M75 D;  4FW2 A;  1PSE A;  3CD6 T;  4M7A F;  3OS2 A;  4BY6 C;  1QVF P;  3O5Z A;  3EFO B;  2CZ7 B;  3M59 A;  5KYU A;  4GBQ A;  4LDW A;  2FRY A;  4DBH A;  2JMC A;  2LZ6 B;  1ZUY A;  4RTV A;  1X6G A;  2NUP A;  2XIC A;  5L23 A;  4M77 G;  5FRN A;  1G3W A;  1MND A;  4AFS C;  2DTI A;  3ASK A;  2H3E B;  5KE2 A;  1U8R A;  1OV3 A;  2KE9 A;  4PLL A;  1VQ6 Q;  4C5I A;  4FL6 A;  1KG1 A;  3C94 A;  2YXY A;  4F7U E;  4J8O A;  4M75 C;  2RO0 A;  1ACM B;  4KUL A;  3M54 A;  2GF7 A;  3H41 A;  3EG2 A;  5IXB A;  4M4Z A;  2EJ9 A;  4CI0 C;  4A4F A;  5KCH A;  3JCM W;  2CP7 A;  1QCO A;  1D1C A;  2CP0 A;  4BD3 A;  1FXX A;  3GP8 A;  1VQ8 A;  3ME9 A;  1MV0 B;  3OYG A;  3MO8 A;  2ROL A;  2I0N A;  2A0F B;  2O4X A;  3BW1 A;  2P4R A;  3BDL A;  4MML A;  1BK2 A;  2DTO A;  1BKB A;  4ZGE B;  2DJZ A;  5LJ5 j;  1YI2 Q;  3OYI A;  1K9M R;  2EJG A;  5FW9 A;  2K3B A;  3QYH B;  2HQX A;  3J80 E;  2B8A A;  1R77 A;  2Y4Y A;  3LWH A;  5DLQ E;  4E7K A;  2XMF A;  3CCQ A;  2K2V A;  4BE1 A;  3Q1J A;  5I22 A;  2E70 A;  2R5A A;  3HRT A;  4J7I A;  3LWI A;  3I55 A;  3EFS A;  3I56 Q;  1J3T A;  5DM7 R;  3P8D A;  1V76 A;  2D1X A;  2ENM A;  1S72 Q;  4M7A D;  2VV5 A;  4OMN A;  5KYX A;  3TCJ A;  3HTR A;  1PD0 A;  2YWW A;  3RKX A;  3UDC A;  5EG2 A;  1T3L A;  1UGR B;  2C0T A;  3EFR A;  1WJS A;  1SHG A;  1I4K 1;  1IHW A;  3INZ A;  3RMQ A;  1EIF A;  3OW2 P;  4KUD K;  1Y96 B;  4EMG A;  3ZBD A;  1C0M A;  5I2S A;  2ROT A;  2DXT A;  3OYF A;  5DLO A;  2ZPG B;  4GLK A;  3OYM A;  3I5S A;  3VS2 A;  1GCQ A;  1IRX A;  2FO0 A;  1JO8 A;  3C4S A;  4C8Q A;  3G4S A;  2F69 A;  3CCM A;  4PKC C;  4KH1 B;  1YIT T;  2CDT A;  4LUE A;  1JEG A;  4RUG A;  4M7A C;  1NE8 A;  4GLM A;  5HK0 A;  4EMK A;  2KSS A;  2CP3 A;  1K8A U;  1YNZ A;  2DL4 A;  3UT1 A;  4XTU A;  1SSF A;  2GTO A;  4R55 A;  1N27 A;  4E7J A;  4M7D F;  4MDX A;  3M0S A;  3CC7 Q;  1OPL A;  1FWZ A;  2KEA A;  2EYW A;  3RBB B;  3QSU A;  2ABL A;  4XAX B;  4E7L A;  1M5Q 1;  3H9N A;  4BY6 B;  4BAC A;  2EWN A;  2DL3 A;  2V8J A;  4MDW A;  1U1T A;  1GBR A;  4N4G A;  3M0U A;  3MKD A;  4JZ3 A;  3X20 B;  1X43 A;  5GMK l;  3PIO A;  2F5K A;  2XDP A;  2AZS A;  3GBQ A;  1VUB A;  3FEO A;  1FX7 A;  4F14 A;  1Q7Y C;  1RL2 A;  1W2B A;  5LJ3 j;  1G2B A;  2FG0 A;  3OMC A;  3QZ5 B;  4M75 B;  2RQW A;  3CCV A;  2OTL Q;  2RHY A;  2RQR A;  4A4K A;  1SSH A;  1VA7 A;  2C0I A;  6AT1 B;  4N0A C;  3N5B B;  2O88 A;  2DD5 A;  1X69 A;  5GAO r;  1RLQ C;  3JSC A;  3SWN A;  2EW3 A;  2E41 A;  4PJO F;  2JM9 A;  4M75 G;  1HD3 A;  3UA7 A;  3SEM A;  2EQI A;  3ULR B;  4OMP A;  4E7Z A;  3CCJ Q;  3RIR A;  4FIB A;  2KT1 A;  1WX6 A;  3HFN A;  2CT4 A;  4PFP A;  5D6W A;  1M1K R;  1NM7 A;  1SRM A;  2XI9 A;  2NYS A;  1U5S A;  4F7U A;  1CKB A;  2CRE A;  5LJ5 e;  2WSC E;  1UJY A;  2OAU A;  3L2U A;  4AG2 C;  3CQT A;  2E12 A;  5HY6 A;  3M0P A;  1RAH B;  2E6Z A;  1QVF S;  2ZPE B;  4D8K A;  2X4J A;  5GMK i;  1E7O A;  4LN2 A;  2HDA A;  2XK0 A;  3L2Z A;  3EH2 A;  3JAM E;  4QVC A;  1B07 A;  4NL2 A;  1ZX6 A;  2ZPI B;  4M7A B;  4FM4 B;  2K3X A;  1RAG B;  2XDD A;  1YJN Q;  4DBQ A;  3A8M B;  1WHK A;  3G6E A;  1MNE A;  2CH4 W;  1TOV A;  3CXC P;  3I35 A;  4PJO D;  1BU1 A;  3EH1 A;  4Z8A A;  3S3N A;  1IGU A;  1FMV A;  2RHI A;  4KGV B;  1VQ9 Q;  3G1J A;  1M1F A;  2AZV A;  1PKS A;  3VRY A;  3REA B;  5GAN 7;  5LJ3 d;  3CCL A;  2L8D A;  5L8R E;  2CH4 A;  4DA4 A;  4DOW A;  1JJ2 A;  1AD5 A;  2E10 A;  1QWF A;  1PHT A;  4J9I A;  2OTJ Q;  1IRE B;  4RTX A;  4M77 F;  4A54 A;  2P0K A;  2DEQ A;  2QA4 Q;  3HHT B;  2EAY A;  2HSP A;  4AFU C;  4PJO C;  2GGR A;  2EQK A;  8AT1 B;  1SEM A;  5HCK A;  2YSQ A;  2KRN A;  3HPW A;  4PFO A;  3AT1 B;  3RER A;  4JJB A;  5LJ3 e;  1BCM A;  1Q82 C;  2Y4X A;  3OW2 S;  4KH0 B;  2KGT A;  5D7U A;  2KI7 A;  2FPE A;  2O31 A;  2X35 A;  3OYB A;  1KD1 U;  2DFU A;  3JCM h;  3A8H B;  2LJ1 A;  1Q81 U;  3V7S A;  1K9A A;  2MK5 A;  4XQ3 A;  1UEC A;  1UGQ B;  4PLI A;  1ABO A;  2K79 A;  2KY9 A;  4FCY A;  1WHJ A;  1NLO C;  1BBZ A;  2QXF A;  1KQ2 A;  1WJQ A;  1YI2 A;  2DVJ A;  2KDS A;  2HQH A;  2LNV A;  4C92 E;  5GAM h;  3A8L B;  2QQ9 A;  3QWX X;  2LQK A;  4FYY B;  1VYV A;  2O2O A;  3CEY A;  4FU6 A;  1QVP A;  1ZUU A;  2L3S A;  3I56 A;  2CP2 A;  3CMA T;  1S72 A;  2AT1 B;  1E6G A;  1YN8 A;  1ZLM A;  1RI9 A;  1PNJ A;  1KC8 R;  4M7D B;  1KHC A;  3JCM V;  3AHU A;  1LCK A;  1UB4 A;  4A4H A;  4JDS A;  2R58 A;  2VGN A;  3PMI A;  3JB9 J;  3I9Q A;  1ZA2 B;  2W10 A;  4D8D A;  1EX4 A;  4IIM A;  2RNA A;  1ZSZ C;  2BZ8 A;  3VU3 C;  1B3Q A;  5KYY A;  3FLG A;  2V8I A;  5AT1 B;  1KK7 A;  2J7I A;  2FB7 A;  2DYI A;  2YRC A;  5KYW B;  1YJW T;  3CCS T;  2ZCF B;  3CC7 A;  1O75 A;  1UJ0 A;  1PCX A;  1YHQ T;  4J9C A;  3CCR T;  2LVM A;  3OS1 A;  4C8Q D;  3NPF A;  4OMO A;  2FPD A;  5A0D A;  2FYK A;  2FZC B;  2GFU A;  1VQK Q;  4ZNX A;  1M1G A;  1PSF A;  3JCM P;  4PJO B;  5KCO A;  1WLP B;  3GPL A;  2VB6 A;  4RG2 A;  3VS0 A;  1H92 A;  2PNI A;  2PUK B;  5A0G A;  4C0D C;  1G3S A;  2DIL A;  2YLB A;  5CKF A;  5J26 A;  4E7H A;  3V7C A;  2BE7 D;  3RKW A;  2DZ9 A;  2KK4 A;  3LX7 A;  3JRZ A;  4QQG A;  4A4E A;  2AK5 A;  1GCQ C;  3G7Z A;  3I56 T;  2OTL A;  4C8Q C;  1QQJ A;  3EGX B;  1UGV A;  3O8V A;  4Z89 A;  3OYK A;  3THK A;  4C0Z A;  4EMK C;  2DKG A;  3MP1 A;  3EG9 B;  3SFM A;  2XDB A;  1AZE A;  1TWB A;  2K3Y A;  1JU5 C;  1XJW B;  2FVU A;  1QVG P;  4RCB A;  3CME Q;  4PNO A;  2RN8 A;  1ZBJ A;  1X2Q A;  2K5F A;  1O9S A;  2GBQ A;  3CBM A;  3OYL A;  4V2S A;  2EGC A;  3CCJ A;  1Y57 A;  4QW2 A;  3EGD A;  1A0N B;  3CXC S;  2M51 A;  5I21 A;  2KQW A;  3VRZ A;  4C0G A;  5GAN 8;  1M3B A;  4AFZ C;  1M90 U;  2DA9 A;  3OYD A;  2DBM A;  1IZ6 A;  1QCF A;  3I5R A;  2EVR A;  2EYY A;  2M16 A;  2RJF A;  3T9N A;  2X3W D;  3VS4 A;  5KYN A;  1WQW A;  3E9F A;  4EIK A;  3V8J A;  2AHJ B;  3J81 E;  2MWP A;  1GCP A;  4RMO A;  2D8H A;  2QYZ A;  3QYG B;  4OMF B;  2EGE A;  2E1H A;  3GNF B;  2EJF A;  1I07 A;  3ZFJ A;  1ZSZ B;  4ZGJ B;  3OS0 A;  3JV3 A;  4C92 A;  3C95 A;  1WIE A;  4E47 A;  1I5O B;  2KAF A;  5CIU A;  3SWN C;  3BE3 A;  3X26 B;  2L3Q A;  2O4X B;  3VS6 A;  1NLP C;  1VQO Q;  1VQL T;  3V8L A;  2ATC B;  1H64 1;  1GFD A;  2GQI A;  2CYZ B;  2KRS A;  3H0I A;  1D3B A;  3QPH A;  1H3H A;  2LJ3 A;  5GAM f;  1OEB A;  3R6N A;  2HNI A;  2QAS A;  2ZPB B;  1YJN A;  1JQQ A;  4M77 B;  4OMQ A;  3OA6 A;  1IO6 A;  2OTL T;  1JRI A;  1LJO A;  2YUN A;  4PL6 A;  2DZC A;  1Z9Q A;  4L59 A;  3JCM g;  1KD1 R;  1K76 A;  1JB0 E;  2PVO B;  1Q81 R;  4C5E A;  5FU6 B;  3LH5 A;  1VQ9 A;  4LD9 K;  2JT4 A;  5M9O A;  4JRQ A;  1K73 C;  1VQM Q;  2V26 A;  1K1Z A;  1TUC A;  4DOV A;  3OYE A;  2R5M A;  5GAM g;  3GNG A;  3HP9 A;  4OF1 A;  3VYG A;  4OMM A;  2F2X A;  1Q86 C;  2K7A A;  2OTJ A;  1X6B A;  3REB B;  2QA4 A;  2I2L A;  2E6N A;  2VVK A;  2NUT B;  4FSS A;  3P8H A;  1M2V A;  1W1F A;  4HVW A;  1VQ7 T;  1C6V X;  2DIQ A;  5IAY A;  3QWY A;  3CCU Q;  1I8F A;  3CBP A;  5KH6 A;  5HKC A;  3NTK A;  3CBO A;  1B34 A;  2HMA A;  2GTJ A;  4WTO B;  4F17 A;  1VQ4 Q;  4C8Q G;  2JMA A;  3OMG A;  2DE0 X;  1OPK A;  2BZY A;  3S6W A;  2NUZ A;  1IGQ A;  4J9D A;  4FYW B;  4EMH A;  1WJR A;  2CS7 A;  1ZQ1 A;  1N8R C;  1YIJ T;  3OQ5 A;  2DYB A;  3G71 Q;  4TVR A;  2DX1 A;  1AZG B;  3DLL A;  2JZ2 A;  2RHZ A;  4CC3 A;  2JTM A;  1BI1 A;  2OI3 A;  1KHI A;  1QP2 A;  3MEW A;  2EKH A;  3S3M A;  3NTI A;  2QGG A;  2DJQ A;  3PFS A;  1WA7 A;  4AFQ C;  3CPW P;  1VQN Q;  3HSB A;  4IUV A;  3HRS A;  3EG0 A;  3EG1 A;  3SWN B;  3PTA A;  4E7S A;  3A1P A;  4XTY A;  4NOY A;  5D6Y A;  1SF9 A;  1LVK A;  1OZ2 A;  1G83 A;  2PUO B;  1Q7Y U;  4CC2 A;  2FL7 A;  2F1L A;  4JUV A;  1OX8 A;  2QA4 T;  3CCE Q;  2P84 A;  1RAB B;  2X51 A;  1VQ5 Q;  5LJ5 h;  1VQ8 T;  3BDU A;  5CCA A;  5GAO m;  3CC2 Q;  1TUG B;  2CUB A;  2RPN A;  1RAA B;  1AOJ A;  3JCM J;  2LRQ A;  1AT1 B;  3VS3 A;  3FJP A;  1UG1 A;  4QQ6 A;  3PNW C;  5J3B A;  1ABQ A;  1OX9 A;  2A08 A;  2X4X A;  1QVG S;  2D8J A;  3TSW A;  4QT7 A;  1YCY A;  3CCQ T;  4F7U G;  4L6V 5;  3MEA A;  2XID A;  1K0S A;  2DPP B;  1KQS P;  2XKO C;  1YP5 A;  3I55 T;  5AYF A;  1VQK A;  3NHN A;  3S3O A;  4OVA A;  9ATC B;  3PIP A;  1WGS A;  3PE0 A;  5FLX E;  1NEG A;  1PM3 A;  1IHV A;  2L89 A;  2GQV A;  2R57 A;  1M90 R;  1KSW A;  3EG3 A;  1GRI A;  1IB8 A;  1Y96 A;  2K9G A;  2F2V A;  2KT8 A;  3DB3 A;  3OSS C;  3UAT A;  4IIO A;  1TU0 B;  1KC8 C;  3CPF A;  3MP6 A;  3M9Q A;  3G4S T;  3CCM T;  1QVF A;  1NYF A;  3RMS A;  3QUI A;  4FT4 A;  4XTX A;  3MPU B;  2SRC A;  3PMT A;  1M8V A;  3NTH A;  3WVD B;  2QG9 B;  3M4G A;  4HVV A;  3ZL7 C;  3CME A;  2KBT A;  1D0X A;  3L2W A;  4QQD A;  4ESR A;  2LQW A;  1AWJ A;  1MMN A;  3HFO A;  4C5G A;  3FC3 A;  4RTU A;  3L2V A;  2LQN A;  3GOX A;  1PD1 A;  4MZM A;  4AMC A;  2J05 A;  4OB2 B;  4K11 A;  2QAZ A;  3IQL A;  2P0P A;  1G3Y A;  4PK4 A;  3WXM B;  1PRM C;  4R56 A;  1KJW A;  2J6O A;  4EDU A;  1SHF A;  5GJV B;  4Y28 E;  4C5H A;  3CCV T;  1OUL A;  1SPK A;  1EZZ B;  2VXE A;  3ZEH A;  2QGF B;  1OU8 A;  2V1R A;  1YJ9 Q;  2DXU A;  4JRI A;  2COZ A;  2A7Y A;  2DK3 A;  2ZAE A;  3OYC A;  4JS4 A;  1U06 A;  2ESW A;  4LD6 A;  1ARK A;  3UA6 A;  1M27 C;  2QI2 A;  1VQO A;  2BUD A;  4BE2 A;  3NGP A;  3JB9 G;  4Y91 A;  3JB9 H;  3OBW A;  3EHR A;  4A4G A;  1D1B A;  1WXU A;  2QEX Q;  2EBP A;  2DET A;  4IKF A;  2KMT A;  4M7D E;  3TVT A;  3F70 A;  5GAO p;  1Q82 U;  2VKN A;  2X3X D;  5IXF A;  4QVZ A;  3OYN A;  4RTZ A;  1MMA A;  5GAM j;  3OW2 A;  3X25 B;  1M3A A;  5GAO n;  3FB9 A;  4CRI A;  1Y71 A;  3QBY A;  1YIT Q;  1OYX A;  4J83 A;  2OX7 A;  1N6A A;  2JVV A;  1VQM A;  2FRW A;  1VYT A;  3CME T;  1NZ9 A;  5CAI A;  4X1V A;  1Z9Z A;  1VQ6 A;  4DEY A;  4ATO A;  5GMK h;  2LMJ A;  2CZ6 B;  1X75 C;  2QQR A;  3DKM A;  5KYY B;  4N4H A;  2L5Q A;  4IUP A;  2EYZ A;  3CPW S;  4AT1 B;  4HCC A;  4JJC A;  5CQX A;  1K0X A;  3CCU A;  3JCM c;  2KVQ G;  3QII A;  4C8Q F;  3JCM Q;  5I2M A;  2DVE A;  2PQW A;  3QJ6 A;  1I5L A;  2K5I A;  1K8A R;  1NJI C;  4PJO E;  3C12 A;  3G6E T;  1VQ4 A;  4C0F A;  1OOT A;  3HL8 A;  3H0F A;  4RTT A;  4JJD A;  5LJ5 g;  1X01 A;  2ZPF B;  2RQV A;  1G5V A;  2CZ0 B;  2HKQ B;  1MMG A;  2COW A;  3L42 A;  3G71 A;  1QKX A;  2ZGW A;  1PC0 A;  1UE9 A;  5IN1 A;  3TSZ A;  1RLP C;  4ELY C;  3CCL T;  1S1N A;  3JCM X;  1RAC B;  4B9X A;  2YLC A;  2Y90 A;  2DER A;  1XNI A;  2JW4 A;  2G6F X;  2GFA A;  4RTW A;  4BI4 A;  1KQS S;  5GAN h;  2RQU A;  4JLG A;  4XU2 A;  2QK0 A;  2DXC A;  3M58 A;  3OY9 A;  1WHH A;  3L2Q A;  3JCM d;  4IUQ A;  2CT3 A;  2LX7 A;  4N0A A;  3URG A;  4ZN1 A;  2ECZ A;  1VQN A;  2W0Z A;  3OSV A;  4M78 E;  2HL3 A;  1RAF B;  4JLI A;  1WZO A;  4OGE A;  1VQ6 T;  2DMO A;  1KQ1 A;  3L1A A;  1DJ7 B;  1R0B G;  2PVG B;  2EPD A;  4ME7 A;  2JNG A;  4Z88 A;  1TH7 A;  5A2Q E;  3KXT A;  3CCE A;  5GAM d;  3MEV A;  2D0N A;  3EGD B;  1VQ5 A;  2KRO A;  3ER0 A;  3CC2 A;  2LTO A;  4N4I A;  3U23 A;  3VS5 A;  3V8K A;  1QKW A;  1XQH A;  2KXD A;  1K9M C;  2P4T A;  2LNH B;  5I11 A;  2FPF A;  2K57 A;  3CCU T;  5EC7 A;  1WNL A;  1YI2 T;  4LDU A;  1ZHI A;  1WQ7 A;  4DQ2 A;  4F7U F;  1VQ4 T;  4BDY A;  3V7R A;  5GAO l;  2DD4 A;  3OYA A;  3UF4 A;  1T0J A;  2IPO B;  5GAM e;  2O9S A;  4BB7 A;  3VUB A;  4X9D A;  1X2K A;  2MPX C;  1CKA A;  4M77 E;  2DO3 A;  3KBG A;  2LCS A;  1S72 T;  2K5L A;  3G71 T;  4M7D A;  3FRN A;  3CXC A;  2YHT A;  4JZ4 A;  3LGF A;  3CC4 Q;  2VYT A;  1D3B B;  2FZG B;  2KYM A;  2QTV A;  4F04 B;  4C92 G;  2B86 A;  2EFI A;  2MOX A;  2O9V A;  5IH2 A;  3X24 B;  5KYU B;  2HAX A;  1WHL A;  2PZ1 A;  2ED0 A;  3PVQ A;  3VV0 A;  2J6K A;  5C0M A;  2NUP B;  2BKD N;  2DBK A;  4KGZ B;  2LT1 A;  1RAD B;  2VAS A;  4WCI A;  4MMK A;  3H0H A;  3CC7 T;  3R6O A;  1W4S A;  4QKU A;  3RDV A;  1VQ5 T;  3CC2 T;  4KUI A;  1N9S A;  2C06 A;  3JCM f;  4FYX B;  3SB2 A;  2F5T X;  5GAO q;  4B9W A;  4HA8 A;  1YBY A;  1BIB A;  5KE3 A;  1W2B P;  4XTV A;  1M2V B;  1UDL A;  2HCK A;  4DBF A;  2RH2 A;  1EFN A;  1RAI B;  2L0A A;  1K73 U;  3TEE A;  4RTY A;  1M9S A;  1B34 B;  1AHJ B;  1UTI A;  2X4W A;  2EQU A;  1FMW A;  2A36 A;  4BDZ A;  1MUZ A;  1WPY A;  2IVW A;  3LW5 E;  2V8K A;  1HXD A;  3QJY A;  4PJJ A;  5C6S A;  3OYJ A;  1Q86 U;  3JB9 I;  1YJ9 A;  1H3Z A;  2QQA A;  4JJN K;  3C0C A;  3EG9 A;  3H8Z A;  2WSF E;  3CMA Q;  3JB9 F;  1X27 A;  2YRV A;  2KR3 A;  3A98 A;  5KYX B;  2YUQ A;  1GFC A;  2JN0 A;  3WVE B;  2VC8 A;  4HCK A;  2CSQ A;  5CVI A;  2QEX A;  2XD0 A;  1G8X A;  1M1K C;  2RM4 A;  1I1J A;  3CCJ T;  5GAN 5;  4M78 A;  5A0L A;  1MGQ A;  4C0D B;  5GAN f;  5CKD A;  4LUD A;  2DRK A;  1UGS B;  3LYI A;  4Z02 A;  4J9F A;  1GL5 A;  1NBE B;  2MI6 A;  1YIT A;  1G3T A;  4C8Q B;  4X9C A;  4LNP A;  1HYO A;  2L3P A;  1N8R U;  3H6Z A;  2DM1 A;  1KIK A;  4EMK B;  1H8K A;  1YJW Q;  3FDR A;  4OB0 B;  1BYM A;  3CCS Q;  1TSF A;  4ZTF A;  3MP8 A;  1FYN A;  1YHQ Q;  1ZBX A;  2F2W A;  3M0T A;  4J9E A;  1ZSZ A;  2M0Y A;  3CCR Q;  1TTH B;  2PTK A;  2YUP A;  5GAN g;  4FSX A;  2K6D A;  3A8G B;  1I81 A;  2AIR B;  4LXC A;  4OB3 B;  3QDF A;  2MF2 A;  2RHX A;  4M75 E;  3VS1 A;  3UPU A;  2XG8 D;  4O5V A;  3NMZ C;  1LOJ A;  4JPB W;  2DAQ A;  5IHN A;  2EYQ A;  4M77 A;  1YJN T;  3JB9 D;  2A3L A;  1WI7 A;  3EFO A;  1YJ9 T;  2P0Q A;  2M0O A;  1I0C A;  4E6R A;  4D6W A;  4CC4 B;  1VQ9 T;  3PGG A;  1V1C A;  1OZ3 A;  1Y7X A;  4OB1 B;  2MCN A;  1JJ2 P;  2QEX T;  2CUD A;  3EAE A;  2RB6 A;  4LDY A;  1U3O A;  3RKY A;  3QO3 A;  2CGH A;  3GLX A;  1Y07 A;  3RES A;  5CKE A;  2OTJ T;  1QVG A;  4LDX A;  2D9T A;  3D7S B;  2DLP A;  4KT0 E;  2NUT A;  4B6M A;  4J6Y A;  1F1B B;  3FJ5 A;  4HXJ A;  2EQM A;  1BI3 A;  2DXB A;  2E4H A;  4F7U B;  1GBQ A;  2DRM A;  1QW1 A;  1WDX A;  1UFF A;  1BB9 A;  1VQP Q;  2QTX A;  1E6H A;  4UC4 A;  1JXO A;  1M4Z A;  2PVD B;  5GAN 6;  4E7I A;  1R8O B;  1T0H A;  2VGM A;  4HT8 A;  2EKO A;  3M4Y A;  3JCM b;  2A37 A;  5GJW B;  4AG1 C;  2MMP A;  4M7A E;  2HBP A;  1RI0 A;  1SKU B;  3A5Z B;  1KC8 U;  4R0K A;  3TRE A;  1K8A C;  3M56 A;  3FIF A;  3OBY A;  2EYX A;  1UUE A;  3LH0 A;  1VQL Q;  1VYU A;  3SHW A;  4J9B A;  1OI1 A;  4HCB A;  1BCO A;  2K4Y A;  2HKN A;  4JS5 A;  3MCA B;  3PT9 A;  1IXD A;  2BZX A;  1N9R A;  1NYG A;  2NLU A;  1K4U S;  1WHG A;  2E3H A;  3CD6 Q;  3M5A A;  2DF6 A;  2YT6 A;  2JTE A;  2L2P A;  1M8M A;  1D0Y A;  5LJ5 d;  2GNC A;  1W2B S;  1YCS B;  3RNJ A;  1P92 A;  2VWF A;  1T3S A;  2HQE A;  3EHQ A;  4O6J A;  3MHX A;  4C92 F;  1VIF A;  1FMK A;  4J6X A;  1KFZ A;  3CC4 A;  2LCC A;  2YDL A;  1PKT A;  2JUF A;  5GAN 4;  5FWB A;  4HKE A;  4NL3 A;  2RJC A;  4NS5 A;  4MZP A;  4J6W A;  1K73 R;  2RF0 A;  3P8B B;  1UEB A;  2VXF A;  2QDL A;  2LJ0 A;  2MIO A;  1MV3 A;  5CR2 A;  4M7D D;  2JTF A;  1R0C B;  3TU4 K;  2WSE E;  2RA2 A;  4RCC A;  2E3I A;  1YWO A;  1Q86 R;  2NWM A;  3E1S A;  2JS2 A;  5LJ3 h;  4KGX B;  1VQ7 Q;  2A28 A;  2DIG A;  2PU9 B;  1JXM A;  4XU1 A;  2M1H A;  4OML A;  2BIV A;  4RG8 A;  3PVL A;  5HK3 A;  4M75 A;  2MWO A;  1HSQ A;  2RI3 A;  1QWE A;  4VUB A;  1VQK T;  1UHF A;  4M78 F;  4M7D C;  3KUF A;  5GMK j;  2IG0 A;  4KRT A;  1JBM A;  2IIM A;  5GAN 3;  3QDR B;  1YIJ Q;  5CKH A;  5CO7 A;  2XHC A;  1OU9 A;  1C1A A;  4II1 A;  2EGA A;  1N8R R;  4OP0 A;  1WYX A;  4DEX A;  2LP5 A;  2DTH A;  1QLY A;  1NEB A;  5IT9 E;  1XOV A;  1ZSG A;  1X6O A;  4C92 D;  1NPP A;  1WXB A;  1OQK A;  4M7A G;  1YWP A;  4CC7 A;  1TXQ A;  4XU0 A;  2EIF A;  2HBW A;  3CMA A;  3SDZ A;  3OB9 A;  4X34 A;  2KYB A;  3CC4 T;  2CKK A;  2J6F A;  1D0Z A;  1NG2 A;  2E5Q A;  3CPW A;  3J7A F;  8ATC B;  1PRL C;  3RUX A;  5IHK A;  3M0Q A;  1HK9 A;  1WXT A;  2MAM A;  1NJI U;  1QCN A;  4OGC A;  4BI8 B;  1BIA A;  4Q5W A;  3TQ7 P;  1AVZ C;  2RJE A;  5LJ5 f;  1VQ8 Q;  4C92 C;  1VIE A;  4PFZ A;  2DEU A;  4FW1 A;  2E5K A;  3M57 A;  5GAN j;  4BE0 A;  4IUU A;  5FU7 C;  1JJ2 S;  4M7A A;  1YJW A;  4M78 D;  4ELZ C;  1BI0 A;  1ZUK A;  3CCS A;  3MJX A;  4BI3 A;  2J06 A;  2M9U A;  2BE9 B;  3NFC A;  3QZ9 B;  1YHQ A;  2YRD A;  3CCR A;  4PJM A;  3CCQ Q;  2X4Y A;  3E2U A;  5CKB A;  4HT9 A;  4J9G A;  1Q7Y R;  1RUW A;  3I55 Q;  1TG0 A;  4FT2 A;  2HEQ A;  4XTZ A;  4GY5 A;  2RD1 A;  1PWT A;  1VQO T;  1KQS A;  2RI5 A;  2O01 E;  2C0O A;  3OYY A;  3VKI A;  5FRO A;  2KNB B; 
#chains in the Genus database with same CATH homology
 3DLL A;  2JZ2 A;  2RHZ A;  2OAU A;  3L2U A;  4MMK A;  2JTM A;  3CC7 T;  2E12 A;  5HY6 A;  1BI1 A;  3R6O A;  4M78 C;  1KD1 C;  1W4S A;  2E6Z A;  1KHI A;  1QP2 A;  2ZPE B;  3DB4 A;  1VQ5 T;  1QVF S;  1Q81 C;  4A53 A;  3HKS A;  3MEW A;  3CC2 T;  4KUI A;  2E64 A;  2EQJ A;  1N9S A;  3VYH B;  3JCM f;  2C06 A;  2X4J A;  5GMK i;  3NTI A;  3S3M A;  1NPR A;  3MET A;  4IUR A;  3OS5 A;  3QXE B;  3SB2 A;  1LNX A;  2F5T X;  5GAO q;  3PFS A;  4B9W A;  4HA8 A;  2XK0 A;  1YBY A;  1BIB A;  5KE3 A;  3L2Z A;  3HSB A;  4IUV A;  3HRS A;  4XTV A;  3JAM E;  2RK2 A;  4EPC A;  4M77 D;  1K9M U;  4QVC A;  1VQM T;  3M53 A;  3SWN B;  4NL2 A;  2RH2 A;  3PTA A;  2WAC A;  2ZPI B;  4M7A B;  4XTY A;  2QDY B;  4NOY A;  5CQY A;  5D6Y A;  4FM4 B;  2K3X A;  1K73 U;  3TEE A;  5GMK m;  1M9S A;  1OZ2 A;  1B34 B;  1AHJ B;  2PUO B;  2XDD A;  1Q7Y U;  2X4W A;  1U1S A;  2EQU A;  4WF2 A;  5FRM A;  2FL7 A;  3A8M B;  3BY7 A;  2RI2 A;  3G6E A;  4BDZ A;  3E9G A;  4JUV A;  1WPY A;  2IVW A;  2QA4 T;  4M7D G;  3LW5 E;  2V8K A;  3G4S A;  1HXD A;  2HD0 A;  3QJY A;  5LJ5 h;  1VQ8 T;  3BDU A;  5CCA A;  4PJO D;  4J7F A;  4JRK A;  5C6S A;  5GAO m;  3OYJ A;  1Q86 U;  2E65 A;  3JB9 I;  1YJ9 A;  3S3N A;  1H3Z A;  4P5N A;  5GMK e;  2QQA A;  4JJN K;  3JCM J;  2RHI A;  3H8Z A;  2WSF E;  2LC4 A;  2LRQ A;  3JB9 F;  5LJ3 f;  3JCM e;  2YRV A;  3OYH A;  1M1F A;  3FJP A;  1MHN A;  3PNW C;  4QQ6 A;  2JN0 A;  1VQP A;  5J3B A;  2LQ8 A;  4M77 C;  3VUZ A;  3WVE B;  2VUB A;  2VC8 A;  2X4X A;  1QVG S;  3A8O B;  5LJ3 d;  5GAN 7;  2L8D A;  3CCL A;  3E19 A;  5L8R E;  5CVI A;  2QEX A;  2XD0 A;  4DA4 A;  1M1K C;  4IUT A;  2RM4 A;  1YCY A;  4DOW A;  5GAN 5;  3CCJ T;  1JJ2 A;  4M78 A;  5A0L A;  4ZGD B;  1QP3 A;  3GF5 A;  4F7U G;  3CCQ T;  1MGQ A;  3LLR A;  2E10 A;  4L6V 5;  3MEA A;  2XID A;  4C0D B;  5GAN f;  5FU6 C;  2DPP B;  3HRU A;  5CKD A;  1IRE B;  2ZPH B;  2XKO C;  4M77 F;  4A54 A;  2P0K A;  1UGS B;  2DEQ A;  3HHT B;  3LYI A;  3I55 T;  3LWH A;  4Z02 A;  5AYF A;  2EAY A;  1VQK A;  3S3O A;  4PJO C;  2RK1 A;  4OVA A;  3PIP A;  1WGS A;  2EQK A;  5GAN d;  2MI6 A;  5FLX E;  4C92 B;  1YIT A;  1G3T A;  4C8Q B;  4X9C A;  2L89 A;  2GQV A;  2R57 A;  4MZT A;  3HPW A;  1VQL A;  5LJ3 g;  1N8R U;  3H6Z A;  2ZZD A;  4EMK B;  3RER A;  5FU7 B;  3FDR A;  4OB0 B;  1Y96 A;  5LJ3 e;  1BYM A;  2L3R A;  1Q82 C;  2Y4X A;  4XK8 E;  3OW2 S;  4ZTF A;  3DB3 A;  3MP8 A;  2XU8 A;  3OSS C;  1V29 B;  1ZBX A;  2FHD A;  4PJO G;  1UGP B;  3OYB A;  2X35 A;  1KD1 U;  3JCM h;  1KC8 C;  3CD6 A;  3A8H B;  3CPF A;  1Q81 U;  3UWN A;  3V7S A;  3MP6 A;  3M9Q A;  5GAN g;  2RHU A;  3G4S T;  4LDV A;  5CK9 A;  4FSX A;  4XQ3 A;  3CCM T;  1QVF A;  2G3R A;  4M75 F;  1UGQ B;  2JOY A;  3A8G B;  4PLI A;  5D6X A;  1I81 A;  1VQN T;  5GAN e;  4OB3 B;  3SD4 A;  2H3J A;  3RMS A;  3QUI A;  2MF2 A;  4FT4 A;  4BUG A;  2KY9 A;  4XTX A;  2RHX A;  4ZTJ A;  4M75 E;  3UPU A;  2QQB A;  3VJP A;  2XG8 D;  4O5V A;  2QXF A;  2QQS A;  1WJQ A;  1YI2 A;  1KQ2 A;  2D6F A;  3PMT A;  1M8V A;  3NTH A;  2KDS A;  3WVD B;  2LCL A;  1LOJ A;  2DAQ A;  3M4G A;  2LNV A;  4C92 E;  2EYQ A;  4M77 A;  3CME A;  2RJD A;  5GAM h;  4C8Q E;  1YJN T;  5DY9 A;  3A8L B;  2QQ9 A;  3JB9 D;  2A3L A;  3L2W A;  1KQS S;  2LQK A;  3GIB A;  4M78 B;  3LGL A;  4QQD A;  3CCE T;  5LL6 S;  3QKJ A;  3MEU A;  3HFO A;  4C5G A;  1YJ9 T;  3FC3 A;  3CEY A;  5J39 A;  1VQL T;  2P0Q A;  4FU6 A;  2M0O A;  1QVP A;  4ZN3 A;  3DLM A;  3I56 A;  4D6W A;  3L2V A;  3CMA T;  1S72 A;  3QG1 A;  1VQ9 T;  3GOX A;  3PGG A;  4PJO A;  4XU3 A;  1VQP T;  4MZM A;  4M7D B;  1OZ3 A;  1Y7X A;  1VQ7 A;  4OB1 B;  4HCZ A;  4M78 G;  3BFM A;  1KHC A;  4OB2 B;  3JCM V;  2D0Q B;  2LX9 A;  3EAE A;  4KBM B;  4QVD A;  2QEX T;  3AHU A;  1UB4 A;  2RB6 A;  4A4H A;  4JDS A;  2R58 A;  2VGN A;  3PMI A;  3QHS A;  4LDY A;  3JB9 J;  2P0P A;  3RKY A;  1G3Y A;  2LDM A;  3QO3 A;  2CGH A;  3GLX A;  1Y07 A;  3WXM B;  4R56 A;  3M55 A;  3L2R A;  3RES A;  4EDU A;  5CKE A;  4C5H A;  4Y28 E;  3VU3 C;  5GAN 2;  1QVG A;  1M1K U;  4JRP A;  2OTJ T;  4YTL A;  3CCV T;  4L5G A;  4LDX A;  4J5Y A;  2D9T A;  2VXE A;  3ZEH A;  1M90 C;  4KT0 E;  2DXU A;  4J6Y A;  4JRI A;  3FLG A;  2A7Y A;  2DK3 A;  4RKU E;  3OYC A;  2GCX A;  4JS4 A;  4LD6 A;  2V8I A;  2EQM A;  1BI3 A;  2DXB A;  4XTW A;  3X28 B;  2QI2 A;  4F7U B;  2BUD A;  1VQO A;  1QW1 A;  1YIJ A;  2LT4 A;  1BI2 A;  2FB7 A;  2CZ1 B;  2QTX A;  1YJW T;  4BE2 A;  4UC4 A;  3JB9 G;  4Y91 A;  3CCS T;  1M4Z A;  2PVD B;  2ZCF B;  5GAN 6;  3JB9 H;  1XTD A;  3OBW A;  1GXI E;  4E7I A;  4A4G A;  1R8O B;  4M75 D;  3CC7 A;  1O75 A;  4IKF A;  2VGM A;  4HT8 A;  2KMT A;  2EKO A;  1PSE A;  1YHQ T;  3CD6 T;  4M7A F;  3OS2 A;  4M7D E;  3F70 A;  3M4Y A;  5GAO p;  3CCR T;  4BY6 C;  3JCM b;  2LVM A;  1Q82 U;  3OS1 A;  2CZ7 B;  4QVZ A;  4C8Q D;  3OYN A;  3M59 A;  2MMP A;  4M7A E;  5GAM j;  1YIT T;  5A0D A;  2FYK A;  2HBP A;  1RI0 A;  2GFU A;  3A5Z B;  4LDW A;  3X25 B;  3OW2 A;  1KC8 U;  1M1G A;  5GAO n;  3FB9 A;  3TRE A;  4CRI A;  1PSF A;  1VQ4 A;  1Y71 A;  1K8A C;  3JCM P;  3M56 A;  3QBY A;  2XIC A;  1OYX A;  3FIF A;  3OBY A;  4M77 G;  5FRN A;  1G3W A;  5KCO A;  4PJO B;  2DTI A;  3GPL A;  3ASK A;  4J83 A;  3LH0 A;  1N6A A;  2JVV A;  4RG2 A;  1VQM A;  5KE2 A;  1U8R A;  3CME T;  2PUK B;  1NZ9 A;  5A0G A;  4PLL A;  4C0D C;  1OI1 A;  4HCB A;  4C5I A;  4FL6 A;  5CAI A;  1G3S A;  1KG1 A;  2YLB A;  2K4Y A;  5CKF A;  5J26 A;  4E7H A;  3V7C A;  3C94 A;  4F7U E;  4JS5 A;  1VQ6 A;  3MCA B;  4J8O A;  4M75 C;  2RO0 A;  3PT9 A;  4KUL A;  2DZ9 A;  3M54 A;  3RKW A;  2GF7 A;  2KK4 A;  1N9R A;  3LX7 A;  4ATO A;  2EJ9 A;  2NLU A;  4A4F A;  4CI0 C;  5KCH A;  5GMK h;  3JCM W;  3JRZ A;  2CZ6 B;  4QQG A;  4A4E A;  4BD3 A;  1FXX A;  3G7Z A;  1X75 C;  2QQR A;  3M5A A;  3GP8 A;  3I56 T;  2OTL A;  3DKM A;  4C8Q C;  1VQ8 A;  3ME9 A;  3OYG A;  3O8V A;  3OYK A;  4N4H A;  2L5Q A;  3MO8 A;  4IUP A;  3CPW S;  4C0Z A;  4HCC A;  4EMK C;  5LJ5 d;  5CQX A;  1W2B S;  2O4X A;  2DKG A;  3BW1 A;  3MP1 A;  3BDL A;  1P92 A;  3SFM A;  4MML A;  2XDB A;  2DTO A;  1BKB A;  2HQE A;  4ZGE B;  2DJZ A;  2K3Y A;  5LJ5 j;  4O6J A;  3CCU A;  3MHX A;  4C92 F;  2FVU A;  3JCM c;  1VIF A;  2KVQ G;  3QII A;  4C8Q F;  4J6X A;  3OYI A;  3JCM Q;  5I2M A;  3CC4 A;  2EJG A;  2DVE A;  2LCC A;  2JUF A;  2PQW A;  5GAN 4;  3QJ6 A;  4RCB A;  1I5L A;  4PNO A;  4HKE A;  2K5I A;  3QYH B;  2HQX A;  4NL3 A;  2RJC A;  3J80 E;  1NJI C;  4PJO E;  2K5F A;  4NS5 A;  1O9S A;  2B8A A;  2Y4Y A;  3C12 A;  3CBM A;  4J6W A;  4MZP A;  5DLQ E;  3OYL A;  3P8B B;  1UEB A;  2VXF A;  4C0F A;  3G6E T;  3CCJ A;  4E7K A;  4V2S A;  3CCQ A;  4QW2 A;  2K2V A;  3HL8 A;  4BE1 A;  3Q1J A;  5CR2 A;  3TU4 K;  3CXC S;  4M7D D;  2JTF A;  5I21 A;  2E70 A;  2KQW A;  2R5A A;  2WSE E;  2RA2 A;  3HRT A;  4J7I A;  4C0G A;  5LJ5 g;  4RCC A;  1X01 A;  2ZPF B;  3EFS A;  5GAN 8;  3I55 A;  5DM7 R;  1G5V A;  2CZ0 B;  3P8D A;  1M90 U;  4M7A D;  2VV5 A;  3E1S A;  3TCJ A;  3OYD A;  5LJ3 h;  3L42 A;  1IZ6 A;  3G71 A;  3RKX A;  2ZGW A;  3UDC A;  3LWI A;  5EG2 A;  2M16 A;  1UGR B;  2RJF A;  3EFR A;  3T9N A;  5IN1 A;  1WJS A;  4ELY C;  3CCL T;  2DIG A;  2PU9 B;  3JCM X;  4XU1 A;  2M1H A;  2BIV A;  1WQW A;  4B9X A;  1I4K 1;  2YLC A;  3E9F A;  3INZ A;  4RG8 A;  3RMQ A;  1EIF A;  2Y90 A;  3V8J A;  4KUD K;  2AHJ B;  1Y96 B;  5HK3 A;  1XNI A;  4EMG A;  3J81 E;  2MWP A;  3ZBD A;  5I2S A;  4RMO A;  2GFA A;  2DXT A;  3QYG B;  4M75 A;  4OMF B;  4BI4 A;  5DLO A;  2ZPG B;  2MWO A;  3OYF A;  2E1H A;  3GNF B;  2EJF A;  5GAN h;  4JLG A;  2RI3 A;  4GLK A;  4XU2 A;  3ZFJ A;  3OYM A;  4VUB A;  2DXC A;  3M58 A;  4ZGJ B;  3OS0 A;  4M78 F;  3OY9 A;  1VQK T;  3L2Q A;  4M7D C;  4C92 A;  3C4S A;  3C95 A;  4C8Q A;  4E47 A;  2F69 A;  4IUQ A;  3JCM d;  4PKC C;  3URG A;  4N0A A;  4ZN1 A;  3KUF A;  2KAF A;  5GMK j;  2IG0 A;  5CIU A;  1JBM A;  3SWN C;  3X26 B;  5GAN 3;  1VQN A;  3OSV A;  2O4X B;  4M78 E;  4M7A C;  1NE8 A;  3QDR B;  5HK0 A;  5CKH A;  2KSS A;  4JLI A;  5CO7 A;  3V8L A;  4EMK A;  2XHC A;  1H64 1;  1K8A U;  4OGE A;  3UT1 A;  4II1 A;  4XTU A;  1SSF A;  2CYZ B;  1VQ6 T;  4R55 A;  1D3B A;  1N27 A;  3QPH A;  4E7J A;  4M7D F;  5GAM f;  4MDX A;  1KQ1 A;  3L1A A;  1DJ7 B;  2HNI A;  1FWZ A;  2PVG B;  4OP0 A;  2ZPB B;  1YJN A;  4M77 B;  4ME7 A;  3QSU A;  2DTH A;  3OA6 A;  2JNG A;  4XAX B;  4E7L A;  2OTL T;  1TH7 A;  5A2Q E;  3KXT A;  1JRI A;  3CCE A;  5IT9 E;  5GAM d;  1LJO A;  1XOV A;  1M5Q 1;  1X6O A;  3MEV A;  4PL6 A;  4C92 D;  1VQ5 A;  2DZC A;  3ER0 A;  1NPP A;  2EWN A;  4BY6 B;  4L59 A;  3JCM g;  4BAC A;  2LTO A;  4N4I A;  3CC2 A;  4M7A G;  3V8K A;  2V8J A;  4MDW A;  1U1T A;  1XQH A;  1JB0 E;  2PVO B;  4N4G A;  4XU0 A;  5FU6 B;  4C5E A;  2P4T A;  1K9M C;  2EIF A;  3CMA A;  3X20 B;  3SDZ A;  1VQ9 A;  3OB9 A;  4LD9 K;  2K57 A;  4X34 A;  5GMK l;  3PIO A;  3CCU T;  1WNL A;  5M9O A;  4JRQ A;  2F5K A;  3CC4 T;  2XDP A;  1K73 C;  1YI2 T;  4LDU A;  2CKK A;  1VUB A;  3FEO A;  1ZHI A;  1FX7 A;  2E5Q A;  1WQ7 A;  4DQ2 A;  3CPW A;  4F7U F;  1Q7Y C;  3J7A F;  1RL2 A;  1VQ4 T;  1W2B A;  3RUX A;  5LJ3 j;  3V7R A;  4BDY A;  5GAO l;  2DD4 A;  4DOV A;  3OYE A;  3OYA A;  2R5M A;  1HK9 A;  5GAM g;  3GNG A;  3HP9 A;  3OMC A;  2MAM A;  3QZ5 B;  4OF1 A;  4OGC A;  3VYG A;  4BI8 B;  1Q86 C;  1NJI U;  4M75 B;  5GAM e;  2OTJ A;  1BIA A;  4Q5W A;  4BB7 A;  3VUB A;  3CCV A;  2QA4 A;  2RJE A;  5LJ5 f;  2I2L A;  2RHY A;  4X9D A;  4C92 C;  1VIE A;  4A4K A;  2E6N A;  4M77 E;  2DO3 A;  3KBG A;  3N5B B;  4N0A C;  1S72 T;  2K5L A;  3G71 T;  4M7D A;  3FRN A;  2DD5 A;  3M57 A;  3P8H A;  5GAN j;  3CXC A;  4BE0 A;  5GAO r;  1VQ7 T;  2YHT A;  4IUU A;  2DIQ A;  5FU7 C;  3JSC A;  3SWN A;  5IAY A;  1JJ2 S;  3LGF A;  4M7A A;  1I8F A;  2E41 A;  3CBP A;  5KH6 A;  4PJO F;  5HKC A;  3NTK A;  4M75 G;  4M78 D;  1BI0 A;  2VYT A;  4ELZ C;  1YJW A;  1D3B B;  3CCS A;  4BI3 A;  3CBO A;  1B34 A;  2M9U A;  3NFC A;  3QZ9 B;  4C92 G;  1YHQ A;  4C8Q G;  2EFI A;  3CCR A;  3RIR A;  2X4Y A;  4FIB A;  3OMG A;  5CKB A;  3HFN A;  4HT9 A;  3X24 B;  3S6W A;  5D6W A;  2HAX A;  2XI9 A;  4FT2 A;  4XTZ A;  4EMH A;  4GY5 A;  1WJR A;  4F7U A;  2RD1 A;  3VV0 A;  2CS7 A;  1ZQ1 A;  1N8R C;  1VQO T;  5C0M A;  2RI5 A;  1YIJ T;  1KQS A;  2BKD N;  2O01 E;  3OQ5 A;  5LJ5 e;  2LT1 A;  3CCM A;  4TVR A;  3OYY A;  3VKI A;  5FRO A;  2WSC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...