1OZ3A

Crystal structure of 3-mbt repeats of lethal (3) malignant brain tumor (native-i) at 1.85 angstrom
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
313
structure length
313
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Malignant brain tumor repeats: a three-leaved propeller architecture with ligand/peptide binding pockets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 76
structure length 313
sequence length 313
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz3A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz3A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oz3A03
2RHIA 5D6WA 3FDRA 2R5AA 3OQ5A 4IUQA 4QQDA 4FL6A 4ZTJA 4C5HA 4Q5WA 5J26A 3OYJA 4E7JA 3OYKA 1OZ2A 4IUPA 3OB9A 3MEVA 2LTOA 1OI1A 4II1A 1N27A 1SSFA 3PFSA 3L2UA 3OYLA 2R5MA 3OYHA 3CEYA 4QQGA 3OYAA 3LX7A 4N4HA 3C4SA 3M9QA 2L3RA 3OYGA 4E7KA 2GFUA 4IUUA 4NS5A 4E7HA 3S3NA 3O8VA 2B8AA 3LGFA 5IN1A 2BKDN 1OZ3A 3L2VA 4PLIA 3LH0A 2RHXA 2RJDA 2DAQA 2EFIA 2RHYA 3PNWC 3PMIA 4L59A 3UT1A 2XK0A 3L2WA 1WGSA 5KE2A 3H8ZA 4EDUA 3OYCA 2M1HA 2LCCA 4BE2A 5C0MA 2M0OA 2EQKA 2VYTA 4BE0A 2NLUA 4PL6A 2L8DA 4Z02A 4IURA 2DIGA 2YRVA 2RO0A 2EKOA 1WJSA 2X4YA 2EQMA 3E9FA 3KUFA 3FLGA 2RI2A 5KCHA 3S6WA 2L89A 4C5EA 3MO8A 3GOXA 3PMTA 3MEWA 2HQXA 3ASKA 3OYDA 2O4XB 2EQJA 3L2RA 3OS0A 4BDYA 2EQUA 2X4WA 3MEAA 2BUDA 4QVZA 4A4FA 4A4GA 3MP6A 3Q1JA 1XNIA 4IUTA 5FRMA 4C5GA 3LYIA 2R57A 1OYXA 4BD3A 5FRNA 3MP1A 2WACA 3OY9A 4UC4A 2D9TA 2JTFA 3NTHA 3OYMA 3P8HA 4FU6A 4A4HA 4A4EA 5FROA 5J39A 5D6XA 4B9WA 5M9OA 3OYBA 2GFAA 2RHUA 4X34A 4E7LA 2XDPA 5KH6A 1WJRA 2RJEA 4RG2A 2QQSA 3P8DA 5CIUA 2F5KA 2X35A 4QQ6A 3S3MA 5C6SA 4QW2A 4B9XA 2RJFA 1RI0A 2FHDA 3NTIA 4N4IA 3OYFA 3F70A 2DIQA 2RJCA 4LD6A 3EAEA 2HQEA 4BDZA 4OVAA 3L42A 2PQWA 5KCOA 2O4XA 3S3OA 4PLLA 3NTKA 3OS1A 4BE1A 3LLRA 3UWNA 2E5QA 5IAYA 1G5VA 2MWOA 2LVMA 4C5IA 3META 4IUVA 5KE3A 2LDMA 2K3YA 3DB3A 4ZTFA 2X4XA 2G3RA 2P0KA 1KHCA 2M16A 3OYNA 2GF7A 3MEUA 1WJQA 3ME9A 2RHZA 1MHNA 4GY5A 3QBYA 2IG0A 3QIIA 3ZEHA 2LRQA 3MP8A 3OYIA 3L2QA 4E7IA 2BIVA 2QQRA 2R58A 2RI3A 2JZ2A 5D6YA 3OYEA 4IKFA 4N4GA 3DB4A 3SD4A 4BACA 2K3XA 3QJ6A 2RI5A 2MWPA 3BDLA 3QKJA 3OS2A 3FEOA 2E6NA 4CRIA 4HCZA 3FC3A 2CKKA 3H6ZA 3OA6A 1H3ZA 3DLMA 3OMGA 3E9GA 3LGLA 3OMCA
chains in the Genus database with same CATH superfamily
3EG0A 4J8OA 4MZTA 3FDRA 3GNGA 2BE7D 4C8QG 2A28A 2HD0A 4C8QF 3E2UA 1OZ2A 4ELYC 3RNJA 1OPLA 4PJOB 3HRTA 1SSFA 2RN8A 2OTLT 2E4HA 2ENMA 2L3RA 4IUUA 1YWOA 4L59A 3PNWC 2ZPHB 1U06A 2Z0WA 5CAIA 2A0FB 2ZGWA 1T0JA 2FRYA 2LJ0A 4JRPA 2HCKA 2EQKA 1V29B 2L2PA 2MCNA 1ARKA 3GF5A 3CBMA 1VQMT 2RO0A 2LQ8A 1M3CA 2FPDA 2F1LA 5GAOl 3LWHA 4M75D 3VS6A 3BDUA 3CCET 4A4FA 3CCVA 2W0ZA 2PVGB 2BZXA 3I9QA 1NLPC 1UB4A 4FU6A 3DKMA 4RG8A 4LUEA 2QGFB 3G1JA 4M7DA 1UGQB 5GAMf 4KGVB 2DIQA 3EAEA 2D6FA 1RABB 4DBHA 4XTXA 2JMCA 2K7AA 3UWNA 4M77G 2F69A 4IUVA 2LDMA 1YITA 4DQ2A 2QTVA 4KT0E 5A0GA 2MYSA 4MMKA 4DBQA 2KDSA 4FW2A 2AK5A 1ZX6A 3MP8A 3PE0A 3QPHA 4J7FA 1S1NA 2OTJT 2JVVA 3DB4A 4PJOF 3CCUQ 2LNVA 3QDRB 2VV5A 4BB7A 2CKKA 2RQUA 3JSCA 3OQ5A 1WHMA 4QQDA 3NFCA 4NOYA 1YIJQ 1HK9A 2EQIA 3G71T 1TWBA 4II1A 2H3JA 2V1QA 3PFSA 4JJNK 2MIOA 2FYKA 2YWWA 3SDZA 1K8AR 4M7AD 2O9SA 2KRNA 2C0OA 1WQWA 4N4HA 2K5LA 1WHLA 4F14A 3HFNA 4B6MA 3NGPA 4A63B 4KULA 2B8AA 2KT8A 5GMKm 4Y92A 4FT4A 1OU9A 1ABOA 1NJIU 2HNIA 3UT1A 3REBB 2O01E 3CCVT 3H8ZA 5C0MA 3PTAA 1N9SA 3CCRQ 1E6GA 2V8KA 2L8DA 3FJ5A 3CBPA 1YCSB 1RUWA 3CCLQ 1PCXA 5LJ5d 2RI2A 5KCHA 5CK9A 2JTMA 3E1SA 1IGQA 2G6FX 4M75B 1Y0MA 4FYXB 1S72T 3JCMf 4RTXA 1WPYA 3MP6A 5GAOm 2A37A 2DXTA 1K8AU 1D0YA 1MMAA 5GAN3 2R57A 3MKDA 3JCMJ 2ATCB 2OX7A 3JB9J 2XKOC 2HKNA 3H0FA 3CC7T 4C92E 4J7IA 2JS0A 2CZ0B 1PD1A 3P8DA 3M0PA 3H0IA 1LCKA 5C6SA 1T0HA 4DOWA 2RJCA 2JNGA 1IB8A 6AT1B 3JCMX 3X20B 3TQ7P 4M7DC 1QCOA 4M77C 4Y91A 1X27A 4ZNXA 1KQ2A 2VVKA 1UE9A 1D0ZA 2A08A 4C8QB 2IIMA 3CCQA 2ED0A 2O31A 1UUEA 4F7UA 2LRQA 5HCKA 1Q7YU 2ZPFB 4CC3A 1XJWB 2RI5A 1MMDA 3UDCA 4XTWA 4HVWA 5FW9A 3OMCA 4X1VA 2CGHA 1SHFA 1Y96A 4ELZC 4Q5WA 3OB9A 4M7DG 2ZCFB 1PKTA 5I11A 1I07A 3HTRA 2YXYA 1K76A 2HBWA 2CYZB 4E7HA 2CUDA 2JM9A 1Q81C 3LGFA 4LD9K 3CCLT 3LH0A 2KVQG 4C0FA 1Q7YC 5KE2A 4EDUA 4RTZA 1AZEA 2RD1A 2LX9A 2LMJA 2NYSA 2YRDA 1FYNA 2NLUA 1QVGA 1UHCA 1ZBXA 5FU7B 3UA7A 2EKOA 9ATCB 1AEYA 2K9GA 1YCYA 2L89A 3JCMQ 2JOYA 2C0TA 2RMOA 2AKKA 1VQPQ 2L3SA 4PJJA 5IXBA 4PJOE 2COZA 4KH0B 2ROLA 4UC4A 2D9TA 4M7AE 4PKCC 4PFOA 3CC4T 2EJFA 1WFWA 3D7SB 1WJRA 2X35A 2E6ZA 1AWXA 2DVJA 4C0GA 4JDSA 4LD6A 3JCMP 1WYXA 1MMGA 1W6XA 2MWOA 4CC4B 1GL5A 3G4SA 2FG0A 1ZUKA 1YITT 1MHNA 5KYYA 1NZ9A 4J5YA 3JCMh 1XTDA 2R58A 2XIDA 4CC7A 2CP7A 1Y7XA 2E5KA 1ZQ1A 2EJGA 4CRIA 3OA6A 2FZGB 1RI9A 4DEXA 3E9GA 4BY6B 1VIEA 3MPUB 1WXTA 2YLCA 1M1FA 3SWNB 1VQ4Q 1HD3A 3UPUA 4E6RA 2KRSA 2ED1A 2P4RA 3JB9G 1KQSA 3VJPA 4M7AB 2F2XA 5FWCA 1LJOA 2EKHA 3PVLA 2DEUA 3EGUA 4LE9A 1QWFA 3M55A 1M27C 4A54A 1ZBJA 2EJ9A 2YSQA 1GFDA 3VS1A 3CCUT 1YJNQ 1WGSA 2P0PA 1EX4A 1WXBA 2DIGA 1Q81U 2YRCA 2MOXA 1OV3A 5EG2A 2EYQA 3HHTB 3LH5A 2J05A 2RNAA 3OS0A 5DY9A 2EQUA 2DD4A 5LJ5g 4E7ZA 4OMPA 2DBKA 3RMQA 1Q81R 1FMVA 3VU3C 1WZOA 5GANf 4VUBA 1G3TA 2KT1A 5D6XA 2KYBA 3CCLA 4X34A 3EGDA 1N8RC 3ULRB 4OMFB 1KC8R 2QDLA 2LQKA 2DL5A 3JCMe 1RI0A 1RAGB 4DBFA 1VQ6Q 3H41A 2JM8A 3NTKA 1QQJA 5KYXB 1G5VA 2DX1A 2LVMA 3CCEQ 2Y4YA 1FX7A 2RB6A 2EGAA 2O9VA 2VUBA 1KHCA 2A3LA 3I55T 3EGXA 3HFOA 5GANj 2JMAA 3CCMT 4FCYA 1PSFA 1U3OA 3JCMW 2HL5C 2DM1A 2J7IA 3SD4A 4J83A 3QJ6A 1VQ7A 1B34A 1LOJA 5CKFA 3QSUA 4AT1B 2CH4W 2RHIA 1M1KR 4J9HA 3KBGA 4J9CA 3X24B 4OMQA 1AZGB 3OYKA 3CC2Q 5CKDA 1VA7A 2VXEA 1FXXA 3LW5E 4EMKA 2DF6A 3VUBA 2RF0A 3OYHA 1K73R 2KXDA 3A8OB 3CCJQ 4NS5A 1TUGB 2JUFA 2XD0A 5IN1A 3R6OA 1AT1B 4OP0A 1VQKA 2RHYA 2KI7A 1G3YA 3RESA 5CO7A 1NJIC 1VQ6T 1VUBA 1N8RR 4BE0A 5GANd 1RLQC 1JJ2S 4KUIA 4PJOA 5LJ5j 2NWMA 1WHGA 3JB9H 5I2SA 1PC0A 1UG1A 2O4XB 3EGDB 4WF2A 1PM3A 2VWFA 2M0YA 4FYWB 2LJ3A 2DD5A 3LYIA 3NTHA 4IIOA 4PFPA 4RMOA 4MDWA 3A8HB 4EIKA 2LNHB 1NM7A 2CP0A 1Q86C 1ZHIA 2RJEA 2F5KA 3S3MA 3CBOA 4ZN3A 3TSZA 1B7TA 3OYFA 2CZ1B 4PJLA 2ECZA 3VYHB 4LNPA 3HRSA 3S3OA 1J3TA 1AWJA 1DJ7B 5DLOA 1MGQA 1BI2A 2P0QA 1MV3A 5IHNA 1WA7A 2D0NA 3CC7Q 1VQLQ 4ZTFA 3M53A 1K4US 2IVWA 1AWWA 2M16A 2GF7A 4OB3B 3DLLA 5AYFA 2DRMA 3TREA 3L2QA 2OTJQ 5D7UA 1UGPB 2NUTA 4CC2A 3PT9A 3EFOA 1TUDA 2EBPA 2K3XA 2OI3A 3M0RA 2EPDA 4F7UF 4ZGJB 5ECAA 2SRCA 5LJ5f 3VS3A 1UTIA 4J9DA 3M4YA 4C5HA 2EVRA 2KGTA 3CCRT 1Q86R 1O75A 3H0HA 2ZAEA 1JEGA 4R56A 1JBMA 2DMOA 4WCIA 1D1CA 2ZPIB 2K2MA 3CMEQ 2L3QA 2HSEB 3CMET 1Q7YR 3CCEA 3N5BB 2RJDA 1VQ9A 1WNLA 1WDXA 3OYCA 1YIJT 2JS2A 4M78D 4LDUA 1KD1U 1D1BA 2E12A 3MEWA 3M0QA 4M78F 1M1KC 4AG2C 3A8GB 2GQIA 2K6DA 1K73U 1XNIA 5LJ3f 3CC4A 3MP1A 3CXCA 2X51A 1VQ9T 1LPLA 2DL7A 4Z88A 5J39A 3OYBA 4L6V5 4E7LA 1IXDA 1TG0A 2MPXC 1X6GA 1VQLA 1VIFA 2KR3A 3SWNC 1BI0A 4OGEA 5GJWB 1PSEA 3OS1A 4BE1A 5IXFA 1RACB 4F04B 3CCSQ 1SF9A 3FIFA 2NUTB 3META 1CKBA 1OOTA 1X2KA 1BI3A 2QI2A 1LNXA 4K11A 3AHUA 3L2ZA 2AHJB 5GMKi 2HBPA 1BYMA 1QLYA 4DA4A 1X75C 3C94A 1W4SA 1ZSZC 2WSEE 3CXCS 4LUDA 3VS7A 1NYGA 2D8HA 3CCUA 3PGGA 4QT7A 2V26A 2J6KA 3VV0A 2QA4A 1N27A 4EPCA 5GAMh 4C0DB 3CEYA 4E7KA 2E3HA 1EFNA 3JB9D 3V8KA 3L2VA 1C0MA 2IPOB 2DAQA 4XQ3A 2EIFA 3NPFA 3I56A 4BE2A 2QGGA 2F2WA 2FPFA 2KK4A 4JLGA 1WJSA 1GRIA 1HYOA 1T3SA 3NHNA 4M7DD 2CSQA 1R8OB 1P92A 2SEMA 4ZGEB 1YI2A 4RTWA 5GAMj 1KQSP 2MMPA 1VQOT 2YUPA 3C12A 4J9EA 2RK2A 5M9OA 3OW2P 1UGRB 1OX8A 3C95A 2PUOB 5CKHA 1Y57A 3M0TA 4B9XA 3NTIA 4N4IA 1JU5C 3L42A 5KCOA 1ZSZB 4M78E 2E5QA 4PFZA 1M1KU 3WXMB 2A7YA 3KFVA 4M4ZA 3CCJA 1X43A 2DTHA 5A2QE 3DB3A 3RIRA 1V76A 4GY5A 2KNBB 2B86A 2V8JA 1KD1C 4XU3A 2COYA 2GTOA 5D6YA 1X69A 2KQWA 4FSXA 1OPKA 1D3BB 3CC2T 3QKJA 5LL6S 1BB9A 3JCMg 4X9CA 1MNEA 4HVVA 4IUQA 1UHFA 3MJXA 1GCQC 1JXOA 1M30A 1M5Q1 5J26A 4LDYA 5EC7A 4LN2A 3MEVA 1E6HA 2QQAA 3CD6T 5HK3A 2DK3A 1YHQT 3OYAA 3THKA 5L23A 3EHQA 5LJ5e 1WHJA 3BE3A 3HPWA 1SRLA 5CQYA 2FPEA 2QAZA 3JCMb 2DFUA 2EFIA 1TXQA 3I35A 2FRWA 3PIPA 2L5QA 3URGA 4PJNA 3VRYA 2RH2A 1N6AA 4AFZC 1D09B 4QKUA 4Z02A 3G7ZA 2NUPB 2QQ9A 2KE9A 4OGCA 4OMLA 1YHQA 4C5EA 4ANJA 3RR6A 4BI3A 3L2RA 1B34B 4A4GA 3UF4A 1NE8A 3OS5A 1PD0A 4M77A 4ZGDB 2HEQA 2E64A 5GAN6 3P8HA 2OTJA 5FROA 3AT1B 1KK7A 2RHUA 3V7RA 4KUDK 5KH6A 1H92A 3OBYA 4EMGA 1NG2A 3EG9B 4HXJA 3EG2A 4KGZB 1I81A 1K9AA 2PQWA 3QO3A 4XK8E 3VS2A 2DVEA 1CKAA 1UGSB 5IAYA 2HAXA 1QWEA 4HCKA 3EG9A 2QDYB 2K3YA 1VQ5Q 3V7SA 1G2BA 3REAB 3CCJT 3QWYA 2OTLQ 1AD5A 4N0AC 1E7OA 3QBYA 3CD6Q 3ZEHA 4EMKB 1YJWQ 1TS9A 1QP2A 2FEIA 4J9BA 1PKSA 2DBMA 4NL2A 1U8RA 3CPWA 1QKWA 1JRIA 4MMLA 2DA9A 1A0NB 1UFFA 2DJQA 1M8MA 4QVDA 1M90C 4C0DC 5GANh 1RAHB 2DTIA 1IRXA 1RLPC 4F16A 1X01A 2DNUA 4AG1C 2LTOA 4HCBA 3M56A 3ZL7C 3SB2A 3I56Q 5FWBA 4OF1A 2EWNA 3M9QA 2FO0A 2EW3A 5FU7C 1YN8A 1PRMC 2ROTA 2BKDN 4NL3A 5KYXA 4PLIA 4DBRA 2BTTA 2LJ1A 1UGVA 4OB2B 2QEXT 3EGXB 2GCXA 1VQ8Q 3JAME 2EQMA 3KUFA 3WVEB 4QVCA 2PU9B 2RQTA 4J9GA 3C0CA 3J80E 5GAOr 4PK4A 1WQ7A 3HKSA 3M54A 4BD3A 2JW4A 1MV0B 3WVDB 1W2BP 3G71A 4C92B 2DKGA 1WHKA 2QEXA 1VQ8A 2AT1B 3CCQQ 2VXFA 4M77E 4N0AA 2PVDB 3PVQA 4M7DF 1GCQA 2RJFA 4Y28E 1YJ9T 2KRMA 1VQKQ 2O4XA 1SHGA 3FB9A 2M02A 5KYWA 3MHXA 5KE3A 2GBQA 4ME7A 1UECA 2BZYA 2X4XA 5I2MA 2D1XA 2K3BA 4JUVA 1UEBA 4D8KA 4OMOA 1AOJA 2HZYA 1IO6A 1GFCA 4M7AF 2BIVA 1ZLMA 2YLBA 5A0DA 1HSQA 4BACA 2KY9A 2QASA 1RAEB 1M90U 2QTXA 1JXMA 2KYMA 4GLMA 1BIAA 1BBZA 5DM7R 1R77A 3IQLA 2KAFA 5GAN2 4RKUE 4JZ4A 5LJ3h 2EYWA 1ZUUA 2OTLA 1QKXA 3CCRA 5FU6B 2AKLA 1RL2A 1I0CA 2GFUA 4XTUA 5I22A 1M2OA 2RHXA 3CMEA 2XK0A 3L1AA 4M77F 3J81E 4X9DA 2RQVA 4XU0A 3U23A 2BZ8A 4C8QD 2I2LA 2P84A 2E65A 4PL6A 1WLPB 1I8FA 2X4YA 3CPWS 1QVGP 2EYYA 1PWTA 4C8QE 3PMTA 2LCSA 5IHIA 1VQ8T 1MNDA 1M1GA 4FM4B 4AFUC 3FRNA 2HQHA 4LDWA 1GCPA 3M59A 3JCMd 3QZ9B 3OY9A 3G6ET 1B3QA 3X28B 2DYBA 1VQPT 2CH4A 3SHWA 3QUIA 4GLKA 2J06A 5CIUA 3GBQA 5I21A 2ESWA 1W2BS 3HP9A 4JRKA 2HMAA 4PLLA 2DLPA 3LLRA 2K79A 1K9MC 4BY6C 3CMAQ 2DXBA 5GAOq 4P5NA 1QVGS 2K5FA 1K0SA 2G3RA 2P0KA 3QDFA 3MEUA 1TSFA 4ESRA 2IG0A 2XG8D 4LXCA 4JRQA 1KIKA 2JJ9A 2KXCA 2PVOB 2X9HA 3HSBA 1YJWT 1NJIR 1KFZA 2FVUA 2E6NA 3EFRA 3FC3A 3TVTA 4C92C 1M4ZA 2DL8A 1AHJB 1VQPA 1IHVA 1HXDA 2M51A 3M58A 4PJOC 3VKIA 1W2BA 3L2UA 3EHRA 2VASA 1Q82U 3CC7A 3QWXX 2DRKA 2LT1A 3X25B 1U5SA 1C6VX 1BI1A 2JTEA 4D6WA 4JLIA 2M0OA 1KD1R 4E2FB 2MF2A 4IURA 7AT1B 1QCFA 1G3SA 1X6BA 4XAXB 1WHHA 2CP5A 2CP2A 1YI2T 4JJDA 3BFMA 4BDYA 4M78C 3M57A 3GP8A 2VGNA 3Q1JA 4XU1A 5GMKe 1ABQA 2D8JA 2CSIA 2WACA 2JN0A 2DL3A 1YJWA 2L3PA 4J9IA 3JB9F 3QJYA 1YWPA 1T3LA 2JXBA 1QVFP 4QW2A 5KYUB 4M7AG 1VQ5A 2XI9A 1FWZA 2W10A 1VYVA 1VYUA 4OVAA 3G6EQ 3E19A 4PJOG 2PTKA 5LJ3j 2D0QB 2XMFA 3CXCP 1IHWA 4KBMB 3RMSA 2X4JA 4LDVA 1YBYA 2E41A 5GAMe 4OMNA 3CC2A 1N5ZA 1NBEB 1UJ0A 3QIIA 4E7IA 3OYEA 5LJ3d 4IKFA 1WXUA 2OAWA 4N4GA 1I5LA 1SG5A 2MWPA 1ZSZA 1VQ4T 4RUGA 2K57A 3RUXA 1YP5A 3DLMA 1VQ7Q 2LT4A 5LJ5h 1QVFS 4J6YA 4BI4A 1TH7A 2M9UA 4R0KA 3CD6A 1K8AC 1ACMB 2CP3A 2MK5A 2L0AA 5J3BA 2PZ1A 1V1CA 5IHKA 1YJNA 1JJ2A 1TUCA 3C4SA 4E47A 4HKEA 3I55Q 2FB7A 4FW1A 4KGXB 2HDAA 1VQ6A 1IREB 2ZZDA 4RTTA 2V8IA 2LCCA 4M75C 2A36A 5LJ3e 5L8RE 3FJPA 1Z9ZA 4RCCA 3H9NA 2CZ7B 5CCAA 2YRVA 1NYFA 2VKNA 2HL3A 1H3HA 4XU2A 1W70A 1VQ7T 3GOXA 2VC8A 5GMKh 3CC4Q 3INZA 2HQXA 3ASKA 3I5SA 3HRUA 1K9MU 3SFMA 2RPNA 1VQKT 4RTYA 5FRMA 2HKQB 5IH2A 2XHCA 3VS0A 4O5VA 4J6XA 3RKYA 2DYIA 4ZN1A 4OB0B 5FLXE 2GFAA 3X26B 1Q86U 3M0SA 3ZFJA 2QQSA 2YHTA 4QQ6A 4PJMA 2CDTA 1BU1A 3F70A 3GIBA 4FYYB 3A8MB 2HQEA 2K4YA 1IZ6A 4BUGA 5GAN8 3G4SQ 3JRZA 3G4ST 4BDZA 3O5ZA 4DEYA 4FT2A 2WSCE 1S72Q 1O9SA 1QCNA 4C5IA 2KSSA 1AVZC 1SEMA 3ME9A 2QEXQ 1KJWA 3CPFA 1GBQA 5FU6C 1VQ4A 3OYIA 5GAN5 2RI3A 1XQHA 4IIMA 1M2VB 1BCMA 1C1AA 1BK2A 2F2VA 1U1TA 2ZPGB 5CKBA 4OMMA 2PNIA 1BCOA 1BIBA 1OU8A 3FEOA 2FL7A 2FZKB 3H6ZA 4HA8A 1RAIB 1QMCA 1X6OA 1TTHB 4AFSC 1OULA 5CR2A 1K73C 1G3WA 3M4GA 1CSKA 1WI7A 3QYGB 2H8HA 4A4KA 2R5MA 4ATOA 1PG5B 4QQGA 4Z8AA 1YITQ 2X3WD 3QG1A 1XOVA 3M0UA 4PJOD 5GANg 2E1HA 4HT9A 1OZ3A 3RERA 1F1BB 4FSSA 2C06A 1KG1A 2EGCA 1NPPA 2ABLA 3L2WA 3GNFB 2OAUA 3CPWP 3CCMQ 1QP3A 2QK0A 2DJZA 1KQSS 3ER0A 4XTZA 2P4TA 4TVRA 3TSWA 2AZVA 5LJ3g 2O88A 3A8LB 1NLOC 1VQNT 3OYDA 2J6OA 4A53A 2BUDA 4M7DE 2CT4A 2YUNA 4CI0C 1MMNA 2XICA 1I1JA 2JTFA 2YDLA 1NEBA 2CP6A 4A4EA 2DPPB 1VYTA 2JT4A 1WX6A 1SSHA 2FHDA 1RAAB 4D8DA 3CCSA 4RTVA 2J6FA 2EAYA 2AIRB 1OX9A 3RDVA 1S72A 5A0LA 1M2VA 4EMKC 4FIBA 1QVPA 2QG9B 4OB1B 3EFOB 1RADB 1Q95G 3RBBB 1M3AA 3OYNA 2F5TX 3J7AF 2NUZA 2LQNA 3JCMc 2QA4Q 3GPLA 3A98A 2JZ2A 3UA6A 2KEAA 3QXEB 1UDLA 5GANe 3TEEA 4DOVA 1U1SA 2R5AA 4XTVA 1YHQQ 1VQMQ 3I56T 3OYJA 4E7JA 3RKWA 4M7DB 3VYGA 4PNOA 2COWA 4AFQC 3OYLA 1YJ9Q 2XDBA 4C0ZA 3LX7A 1FMWA 4KRTA 3VUZA 1AWOA 5KYWB 2CUBA 4V2SA 3PMIA 5HY6A 4J9FA 4RCBA 2GQVA 1JJ2P 4JRIA 1YJNT 2QXFA 3EG3A 3VS5A 3FLGA 4C8QC 1UJYA 3EH2A 2RM4A 2DILA 1G8XA 2AZSA 4QVZA 2ZPEB 3QZ5B 2RQRA 4IUTA 2QA4T 1OYXA 4ORZA 2CREA 2DEQA 3TU4K 4EMHA 2E3IA 8ATCB 2XDPA 5CQXA 2DO3A 1OQKA 4M77D 3EG1A 2DXUA 2HSPA 4L5GA 1Q82C 1QW1A 5CVIA 4F7UE 4XTYA 3CCQT 1VOMA 4GBQA 3UATA 4O6JA 2E70A 2LC4A 1H8KA 1KHIA 5HK0A 1B07A 2RHZA 1GBRA 3G71Q 2RK1A 1YIJA 3EH1A 3R6NA 1M90R 4M75A 4M75G 4C92F 4BI8B 3HL8A 1VQNQ 2OJ2A 5DLQE 1N8RU 1I4K1 4C92G 4E7SA 2QYZA 3NMZC 3OSSC 2LCLA 1Y71A 4YTLA 3A1PA 5D6WA 1MUZA 4ZTJA 2DZ9A 1SRMA 5GMKj 4C92D 4MDXA 4IUPA 2RQWA 1R0CB 1K1ZA 1TU0B 2I0NA 3CCMA 2VB6A 8AT1B 3BW1A 3QYHB 1WIEA 1K9MR 3OYGA 2C0IA 2PUKB 3CMAT 3V7CA 2Y90A 1NPRA 1JB0E 3OW2A 1EIFA 4HT8A 1Y96B 1KC8C 2M1HA 4C8QA 4JS4A 4JJCA 2VYTA 5CKEA 4F7UB 4HCCA 3SEMA 3S6WA 1W1FA 4F7UG 4FYVB 2X4WA 1PNJA 4Z89A 3I5RA 2NUPA 4AMCA 2FZCB 2DE0X 2DTOA 3CQTA 1SPKA 1PHTA 4C5GA 2RA2A 1VQNA 5FRNA 1H641 3RKXA 3OYMA 4A4HA 1JQQA 4B9WA 1ZA2B 2GTJA 4JS5A 5GAN4 1VQ5T 3EFSA 4M77B 2YT6A 1KC8U 4F17A 1ZUYA 3CMAA 3OW2S 1ZA1B 1FMKA 1LVKA 1R0BG 2E10A 1KQ1A 3SWNA 4KH1B 5KYNA 1N9RA 1WJQA 5GAMg 1D1AA 1HJDA 1OEBA 3LWIA 3GLXA 2XU8A 5GJVB 1M9SA 4MZPA 5KYUA 3QHSA 1RAFB 1X2QA 3A5ZB 1YFNA 4HCZA 2V1RA 1H3ZA 3OMGA 4R55A 1SKUB 3LGLA 1PRLC 4J6WA 4FL6A 4MZMA 4M7AC 3CCST 3V8LA 4RTUA 4M75E 5GAOn 1OI1A 2CT3A 1VQOA 2WSFE 1M8VA 3JV3A 3TCJA 2CS7A 4JJBA 1K0XA 1I5OB 1BKBA 2LP5A 3O8VA 3S3NA 4LDXA 2YUQA 2MAMA 4M78G 3BY7A 2DZCA 3V8JA 5GAMd 2DETA 2VGMA 1G83A 4HVUA 2QQBA 3OBWA 1GXIE 2LQWA 1TOVA 2BE9B 2GNCA 2MI6A 3MCAB 5KYYB 5GAOp 3E9FA 1VQMA 2O2OA 4M7AA 3MO8A 3OSVA 2CZ6B 1JO8A 2LX7A 2EQJA 1IGUA 3MEAA 2H3EB 2EYXA 5GMKl 2DERA 4JPBW 2KROA 2LZ6B 4WTOB 1QVFA 2Y4XA 1D0XA 4RG2A 1Y07A 1ZSGA 5AT1B 1KSWA 5HKCA 1M3BA 3VRZA 1VQ9Q 1YNZA 3JCMV 4M75F 4C92A 5GAN7 4M78B 2DXCA 3M5AA 2GGRA 3I55A 3OYYA 3G6EA 3T9NA 1EZZB 1Z9QA 3ZBDA 2YUOA 1D3BA 2X3XD 2ZPBB 3VS4A 1YJ9A 1VQOQ 3PIOA 4M78A 1NEGA 2K5IA 4JZ3A 2XDDA 3KXTA 2QQRA 2KBTA 2K2VA 3P8BB 3CCVQ 2EYZA 2EGEA 5IT9E 2DL4A 3BDLA 3OS2A 1YI2Q 1Q82R 3JB9I 2KMTA 1VQLT
chains in the Genus database with same CATH topology
4J8OA 2RHIA 4MZTA 3FDRA 3GNGA 1X6OA 3KBGA 4C8QG 3X24B 4C0DC 5GANh 2HD0A 5CR2A 2DTIA 4C8QF 3OYKA 1K73C 1X01A 1G3WA 1OZ2A 4ELYC 3M4GA 5CKDA 2LTOA 4HCBA 4PJOB 3M56A 2VXEA 3QYGB 3HRTA 1SSFA 4A4KA 1FXXA 3LW5E 4EMKA 3VUBA 3SB2A 2R5MA 3OYHA 4ATOA 2OTLT 4QQGA 4OF1A 2EWNA 3A8OB 3M9QA 2L3RA 3QG1A 1XOVA 4PJOD 5GANg 4IUUA 4NS5A 2JUFA 5FU7C 2XD0A 2E1HA 5IN1A 4HT9A 2BKDN 1OZ3A 3R6OA 4NL3A 3RERA 2C06A 4PLIA 4OP0A 1VQKA 4L59A 1KG1A 3PNWC 2ZPHB 1NPPA 2RHYA 3L2WA 5CAIA 3GNFB 1G3YA 2OAUA 2ZGWA 5CO7A 3RESA 1QP3A 1NJIC 4JRPA 1VUBA 2DJZA 4OB2B 2EQKA 1V29B 1VQ6T 2QEXT 1KQSS 3ER0A 2GCXA 4XTZA 4BE0A 5GANd 3GF5A 3CBMA 4KUIA 2P4TA 3JAME 1VQMT 1JJ2S 4PJOA 2RO0A 4TVRA 5LJ5j 2EQMA 2LQ8A 3KUFA 3WVEB 4QVCA 3JB9H 2PU9B 5LJ3g 5GAOl 3A8LB 3J80E 5I2SA 3LWHA 1VQNT 5GAOr 3OYDA 2O4XB 4M75D 4A53A 3BDUA 3CCET 4WF2A 1WQ7A 3HKSA 2BUDA 4A4FA 4M7DE 3M54A 4CI0C 2DD5A 2XICA 3LYIA 4BD3A 3CCVA 3NTHA 2JTFA 2PVGB 3WVDB 1UB4A 4FU6A 3DKMA 4RMOA 3G71A 4A4EA 4MDWA 3A8HB 4RG8A 4C92B 2DKGA 2DPPB 2QEXA 1VQ8A 1Q86C 4M7DA 1ZHIA 2RJEA 1UGQB 2VXFA 2F5KA 4M77E 4N0AA 3S3MA 2PVDB 3CBOA 5GAMf 4M7DF 4ZN3A 2RJFA 2FHDA 4Y28E 3OYFA 1YJ9T 2CZ1B 2DIQA 3EAEA 2D6FA 3VYHB 3CCSA 2EAYA 2O4XA 3HRSA 3S3OA 3FB9A 4XTXA 1DJ7B 3UWNA 5DLOA 1S72A 4BDZA 1MGQA 4M77G 5A0LA 1BI2A 3MHXA 2P0QA 2F69A 4IUVA 4EMKC 5KE3A 2LDMA 1YITA 4FIBA 4ME7A 1QVPA 4OB1B 4DQ2A 4ZTFA 2X4XA 3M53A 5I2MA 4KT0E 5A0GA 2IVWA 4MMKA 3J7AF 2KDSA 2F5TX 2GF7A 2M16A 4OB3B 3OYNA 4JUVA 1UEBA 3DLLA 3JCMc 5AYFA 3TREA 3L2QA 3GPLA 3MP8A 4J7FA 3QPHA 2BIVA 4M7AF 1UGPB 2YLBA 2JZ2A 3PT9A 5A0DA 2OTJT 2JVVA 3DB4A 4PJOF 2K3XA 2KY9A 3QXEB 4BACA 2LNVA 1M90U 2QTXA 4F7UF 3QDRB 2VV5A 3TEEA 4BB7A 2CKKA 5GANe 4ZGJB 4DOVA 5LJ5f 1BIAA 1U1SA 5DM7R 3JSCA 2R5AA 3OQ5A 4QQDA 4XTVA 3NFCA 3M4YA 4C5HA 2KAFA 4NOYA 3CCRT 3I56T 1O75A 5GAN2 3OYJA 4RKUE 4E7JA 1HK9A 3RKWA 3G71T 3VYGA 4R56A 4M7DB 4II1A 5LJ3h 1JBMA 2H3JA 4PNOA 2OTLA 3PFSA 4JJNK 3OYLA 3CCRA 2XDBA 2ZPIB 2FYKA 5FU6B 3SDZA 4C0ZA 4M7AD 1WQWA 1RL2A 2K5LA 3LX7A 4N4HA 2GFUA 3HFNA 3CMET 3CCEA 4KULA 3VUZA 2B8AA 3N5BB 4XTUA 5GMKm 4FT4A 2RHXA 2RJDA 1NJIU 2HNIA 3PMIA 5HY6A 3UT1A 2XK0A 3CMEA 2O01E 3L1AA 4V2SA 4M77F 1VQ9A 3J81E 1WNLA 3CCVT 3H8ZA 4X9DA 4RCBA 3OYCA 5C0MA 3PTAA 1N9SA 2GQVA 4JRIA 4XU0A 4C8QD 4M78D 1YIJT 1YJNT 2QXFA 2I2LA 2V8KA 2E65A 2L8DA 4PL6A 4LDUA 1KD1U 3CBPA 1I8FA 2X4YA 5LJ5d 3CPWS 3FLGA 2RI2A 5KCHA 4C8QC 5CK9A 2JTMA 3E1SA 4C8QE 3PMTA 2E12A 3MEWA 2RM4A 4M75B 1VQ8T 1M1GA 4M78F 1S72T 4FM4B 3JCMf 1M1KC 3FRNA 4QVZA 1WPYA 2ZPEB 3MP6A 3A8GB 5GAOm 1K73U 2DXTA 1K8AU 1XNIA 3QZ5B 4IUTA 2QA4T 5GAN3 4LDWA 5LJ3f 2R57A 1OYXA 3JCMJ 3M59A 3MP1A 3CXCA 3JCMd 3QZ9B 3OY9A 3G6ET 3CC4A 3X28B 2DEQA 3TU4K 3JB9J 1VQ9T 2XKOC 1VQPT 4EMHA 5J39A 3OYBA 3CC7T 4L6V5 4C92E 3QUIA 4GLKA 4J7IA 4E7LA 2XDPA 2CZ0B 3P8DA 5CIUA 5CQXA 5I21A 2DO3A 5C6SA 4M77D 1VQLA 1VIFA 4DOWA 2RJCA 2JNGA 1W2BS 2DXUA 4L5GA 1BI0A 3HP9A 4JRKA 4OGEA 3SWNC 1QW1A 5CVIA 3X20B 3JCMX 1Q82C 4F7UE 1PSEA 4PLLA 3OS1A 4BE1A 4XTYA 3LLRA 4M7DC 4M77C 1K9MC 4Y91A 4BY6C 3CCQT 3FIFA 3META 2DXBA 1KQ2A 5GAOq 4P5NA 1QVGS 2K5FA 4O6JA 2E70A 1BI3A 2QI2A 2LC4A 4C8QB 2G3RA 1KHIA 2P0KA 1LNXA 3AHUA 3CCQA 4F7UA 3MEUA 5HK0A 2RHZA 3L2ZA 2AHJB 5GMKi 2HBPA 1BYMA 2IG0A 2LRQA 4DA4A 2RK1A 2XG8D 1YIJA 4JRQA 1X75C 2PVOB 3C94A 3HSBA 1YJWT 1Q7YU 1W4SA 2ZPFB 4M75A 4M75G 4C92F 4BI8B 3HL8A 2RI5A 2WSEE 2FVUA 3CXCS 5DLQE 1N8RU 3UDCA 4XTWA 2E6NA 1I4K1 3EFRA 3FC3A 4C92G 4C92C 3OSSC 2LCLA 1Y71A 1M4ZA 3OMCA 4YTLA 3CCUA 3PGGA 5D6WA 1AHJB 1VQPA 2CGHA 1Y96A 4ZTJA 2DZ9A 1HXDA 4ELZC 5GMKj 4Q5WA 4C92D 3VV0A 3M58A 2QA4A 4MDXA 4PJOC 4IUPA 3OB9A 3VKIA 4M7DG 2ZCFB 1W2BA 1N27A 3L2UA 4EPCA 5GAMh 1Q82U 3CCMA 4C0DB 3CC7A 3CEYA 3BW1A 3QYHB 3OYGA 4E7KA 2CYZB 4E7HA 2LT1A 3X25B 1Q81C 2PUKB 3LGFA 3JB9D 3CMAT 4LD9K 3V7CA 2Y90A 3CCLT 3V8KA 3L2VA 1NPRA 1JB0E 3LH0A 2DAQA 1BI1A 3OW2A 4XQ3A 1EIFA 2EIFA 4HT8A 2KVQG 4C0FA 1Q7YC 5KE2A 1Y96B 4EDUA 4D6WA 2M1HA 2RD1A 4JLIA 4C8QA 3I56A 4JS4A 2M0OA 4BE2A 2VYTA 2LX9A 5CKEA 4F7UB 2MF2A 2KK4A 2NLUA 1QVGA 1ZBXA 4IURA 4HCCA 5FU7B 4JLGA 2EKOA 1WJSA 1G3SA 1YCYA 3S6WA 4M7DD 2L89A 4XAXB 3JCMQ 2JOYA 4F7UG 1YI2T 1R8OB 1P92A 3BFMA 4BDYA 2X4WA 4ZGEB 4M78C 3M57A 1YI2A 3GP8A 2VGNA 4PJOE 2DTOA 3Q1JA 4XU1A 5GMKe 5GAMj 4C5GA 2RA2A 1VQNA 5FRNA 1H641 2MMPA 2WACA 2JN0A 4UC4A 2D9TA 4M7AE 4PKCC 1VQOT 3RKXA 3OYMA 3C12A 4A4HA 2RK2A 1YJWA 4B9WA 5M9OA 3JB9F 4JS5A 3QJYA 3CC4T 2EJFA 5GAN4 1UGRB 1WJRA 3C95A 1VQ5T 2PUOB 3EFSA 2X35A 2E6ZA 4M77B 5CKHA 4QW2A 4B9XA 4C0GA 1KC8U 3NTIA 1VQ5A 4JDSA 2XI9A 4N4IA 4M7AG 1FWZA 4LD6A 3CMAA 4OVAA 3L42A 5KCOA 3OW2S 3JCMP 3E19A 4PJOG 4M78E 2E5QA 1M1KU 5LJ3j 2MWOA 3WXMB 2A7YA 2D0QB 3CCJA 3G4SA 4KBMB 2E10A 3RMSA 2DTHA 1KQ1A 5A2QE 2X4JA 3DB3A 4LDVA 3RIRA 1YITT 3SWNA 1YBYA 2E41A 5GAMe 1N9RA 1WJQA 5GAMg 4GY5A 1MHNA 2V8JA 1KD1C 1NZ9A 4J5YA 3JCMh 4XU3A 3LWIA 1XTDA 3CC2A 3QIIA 4E7IA 3GLXA 2XU8A 2R58A 3OYEA 5D6YA 5LJ3d 2XIDA 1M9SA 4MZPA 4IKFA 2KQWA 3QHSA 4N4GA 1Y7XA 1I5LA 4FSXA 1D3BB 3CC2T 2MWPA 3QKJA 1VQ4T 3A5ZB 1ZQ1A 2EJGA 4CRIA 4HCZA 2K57A 5LL6S 3OA6A 3RUXA 1H3ZA 3DLMA 3OMGA 4R55A 3E9GA 4BY6B 2LT4A 3LGLA 1VIEA 5LJ5h 4J6WA 3JCMg 1VQ4A 4X9CA 1QVFS 4IUQA 4FL6A 4MZMA 4M7AC 3CCST 2YLCA 3V8LA 1M1FA 4J6YA 4M75E 4BI4A 1M5Q1 1TH7A 5J26A 3SWNB 5GAOn 2M9UA 3CD6A 4LDYA 3UPUA 1K8AC 3MEVA 2QQAA 1OI1A 3CD6T 5HK3A 2DK3A 1VQOA 2WSFE 3JB9G 5J3BA 1M8VA 3TCJA 1KQSA 2CS7A 3VJPA 4M7AB 1YHQT 3OYAA 1LJOA 4E47A 3C4SA 1YJNA 1JJ2A 5LJ5e 4HKEA 1BKBA 3S3NA 3O8VA 2FB7A 4LDXA 5CQYA 2MAMA 3HPWA 4M78G 3M55A 4A54A 3BY7A 2DZCA 3V8JA 3JCMb 5GAMd 2VGMA 2EJ9A 2EFIA 1VQ6A 3CCUT 1IREB 2ZZDA 3PIPA 1WGSA 2L5QA 2P0PA 2V8IA 3URGA 2LCCA 2QQBA 3OBWA 4M75C 1GXIE 5LJ3e 2RH2A 1N6AA 5L8RE 3FJPA 4RCCA 5CCAA 2CZ7B 3MCAB 2MI6A 3G7ZA 2DIGA 2QQ9A 4Z02A 2YRVA 5GAOp 1Q81U 4OGCA 3E9FA 1VQMA 4XU2A 5EG2A 4M7AA 2EYQA 3HHTB 1YHQA 4C5EA 3MO8A 3GOXA 1VQ7T 2VC8A 5GMKh 3OSVA 2CZ6B 2HQXA 3ASKA 3INZA 4BI3A 2EQJA 3HRUA 3OS0A 3L2RA 1K9MU 5DY9A 2EQUA 3SFMA 1B34B 3MEAA 2DD4A 4A4GA 5LJ5g 1NE8A 1VQKT 3OS5A 5FRMA 2XHCA 4M77A 3RMQA 4ZGDB 4O5VA 5GMKl 3VU3C 2E64A 4J6XA 5GANf 4VUBA 3RKYA 5GAN6 3P8HA 1G3TA 4ZN1A 4OB0B 2OTJA 5FROA 5D6XA 5FLXE 3CCLA 2GFAA 2RHUA 3X26B 4X34A 3V7RA 4KUDK 1QVFA 2Y4XA 5KH6A 1Q86U 1N8RC 3OBYA 3ZFJA 4RG2A 2QQSA 1Y07A 4OMFB 4EMGA 2YHTA 4QQ6A 2LQKA 3JCMe 5HKCA 1RI0A 3F70A 3GIBA 3A8MB 2HQEA 2K4YA 1IZ6A 4BUGA 1I81A 2PQWA 3JCMV 3JRZA 3QO3A 4XK8E 5GAN8 3G4ST 4M75F 3NTKA 2DVEA 4C92A 4FT2A 5GAN7 2WSCE 4M78B 1O9SA 1UGSB 2DXCA 5IAYA 1G5VA 3M5AA 2LVMA 4C5IA 3I55A 3OYYA 3G6EA 2HAXA 3T9NA 2KSSA 2QDYB 2K3YA 3V7SA 2Y4YA 1FX7A 2RB6A 3ZBDA 3CCJT 1D3BA 2ZPBB 2VUBA 1YJ9A 1KHCA 2A3LA 3I55T 3HFOA 3PIOA 4M78A 3ME9A 4N0AC 2K5IA 2XDDA 5GANj 3QBYA 3CPFA 5FU6C 3ZEHA 4EMKB 3OYIA 5GAN5 3KXTA 3CCMT 2RI3A 1QP2A 1XQHA 2QQRA 2K2VA 1PSFA 3P8BB 3JCMW 1U1TA 4NL2A 2ZPGB 5CKBA 3SD4A 4J83A 1U8RA 5IT9E 3QJ6A 1VQ7A 3BDLA 3CPWA 3OS2A 1B34A 1BIBA 3FEOA 1LOJA 1JRIA 4MMLA 5CKFA 2FL7A 1KC8C 3H6ZA 4HA8A 2KMTA 3JB9I 4QVDA 3QSUA 1M90C 1VQLT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHI A;  5D6W A;  3FDR A;  2R5A A;  3OQ5 A;  4IUQ A;  4QQD A;  4FL6 A;  4ZTJ A;  4C5H A;  4Q5W A;  5J26 A;  3OYJ A;  4E7J A;  3OYK A;  1OZ2 A;  4IUP A;  3OB9 A;  3MEV A;  2LTO A;  1OI1 A;  4II1 A;  1N27 A;  1SSF A;  3PFS A;  3L2U A;  3OYL A;  2R5M A;  3OYH A;  3CEY A;  4QQG A;  3OYA A;  3LX7 A;  4N4H A;  3C4S A;  3M9Q A;  2L3R A;  3OYG A;  4E7K A;  2GFU A;  4IUU A;  4NS5 A;  4E7H A;  3S3N A;  3O8V A;  2B8A A;  3LGF A;  5IN1 A;  2BKD N;  1OZ3 A;  3L2V A;  4PLI A;  3LH0 A;  2RHX A;  2RJD A;  2DAQ A;  2EFI A;  2RHY A;  3PNW C;  3PMI A;  4L59 A;  3UT1 A;  2XK0 A;  3L2W A;  1WGS A;  5KE2 A;  3H8Z A;  4EDU A;  3OYC A;  2M1H A;  2LCC A;  4BE2 A;  5C0M A;  2M0O A;  2EQK A;  2VYT A;  4BE0 A;  2NLU A;  4PL6 A;  2L8D A;  4Z02 A;  4IUR A;  2DIG A;  2YRV A;  2RO0 A;  2EKO A;  1WJS A;  2X4Y A;  2EQM A;  3E9F A;  3KUF A;  3FLG A;  2RI2 A;  5KCH A;  3S6W A;  2L89 A;  4C5E A;  3MO8 A;  3GOX A;  3PMT A;  3MEW A;  2HQX A;  3ASK A;  3OYD A;  2O4X B;  2EQJ A;  3L2R A;  3OS0 A;  4BDY A;  2EQU A;  2X4W A;  3MEA A;  2BUD A;  4QVZ A;  4A4F A;  4A4G A;  3MP6 A;  3Q1J A;  1XNI A;  4IUT A;  5FRM A;  4C5G A;  3LYI A;  2R57 A;  1OYX A;  4BD3 A;  5FRN A;  3MP1 A;  2WAC A;  3OY9 A;  4UC4 A;  2D9T A;  2JTF A;  3NTH A;  3OYM A;  3P8H A;  4FU6 A;  4A4H A;  4A4E A;  5FRO A;  5J39 A;  5D6X A;  4B9W A;  5M9O A;  3OYB A;  2GFA A;  2RHU A;  4X34 A;  4E7L A;  2XDP A;  5KH6 A;  1WJR A;  2RJE A;  4RG2 A;  2QQS A;  3P8D A;  5CIU A;  2F5K A;  2X35 A;  4QQ6 A;  3S3M A;  5C6S A;  4QW2 A;  4B9X A;  2RJF A;  1RI0 A;  2FHD A;  3NTI A;  4N4I A;  3OYF A;  3F70 A;  2DIQ A;  2RJC A;  4LD6 A;  3EAE A;  2HQE A;  4BDZ A;  4OVA A;  3L42 A;  2PQW A;  5KCO A;  2O4X A;  3S3O A;  4PLL A;  3NTK A;  3OS1 A;  4BE1 A;  3LLR A;  3UWN A;  2E5Q A;  5IAY A;  1G5V A;  2MWO A;  2LVM A;  4C5I A;  3MET A;  4IUV A;  5KE3 A;  2LDM A;  2K3Y A;  3DB3 A;  4ZTF A;  2X4X A;  2G3R A;  2P0K A;  1KHC A;  2M16 A;  3OYN A;  2GF7 A;  3MEU A;  1WJQ A;  3ME9 A;  2RHZ A;  1MHN A;  4GY5 A;  3QBY A;  2IG0 A;  3QII A;  3ZEH A;  2LRQ A;  3MP8 A;  3OYI A;  3L2Q A;  4E7I A;  2BIV A;  2QQR A;  2R58 A;  2RI3 A;  2JZ2 A;  5D6Y A;  3OYE A;  4IKF A;  4N4G A;  3DB4 A;  3SD4 A;  4BAC A;  2K3X A;  3QJ6 A;  2RI5 A;  2MWP A;  3BDL A;  3QKJ A;  3OS2 A;  3FEO A;  2E6N A;  4CRI A;  4HCZ A;  3FC3 A;  2CKK A;  3H6Z A;  3OA6 A;  1H3Z A;  3DLM A;  3OMG A;  3E9G A;  3LGL A;  3OMC A; 
#chains in the Genus database with same CATH topology
 3EG0 A;  4J8O A;  4MZT A;  3FDR A;  3GNG A;  2BE7 D;  4C8Q G;  2A28 A;  2HD0 A;  4C8Q F;  3E2U A;  1OZ2 A;  4ELY C;  3RNJ A;  1OPL A;  4PJO B;  3HRT A;  1SSF A;  2RN8 A;  2OTL T;  2E4H A;  2ENM A;  2L3R A;  4IUU A;  1YWO A;  4L59 A;  3PNW C;  2ZPH B;  1U06 A;  2Z0W A;  5CAI A;  2A0F B;  2ZGW A;  1T0J A;  2FRY A;  2LJ0 A;  4JRP A;  2HCK A;  2EQK A;  1V29 B;  2L2P A;  2MCN A;  1ARK A;  3GF5 A;  3CBM A;  1VQM T;  2RO0 A;  2LQ8 A;  1M3C A;  2FPD A;  2F1L A;  5GAO l;  3LWH A;  4M75 D;  3VS6 A;  3BDU A;  3CCE T;  4A4F A;  3CCV A;  2W0Z A;  2PVG B;  2BZX A;  3I9Q A;  1NLP C;  1UB4 A;  4FU6 A;  3DKM A;  4RG8 A;  4LUE A;  2QGF B;  3G1J A;  4M7D A;  1UGQ B;  5GAM f;  4KGV B;  2DIQ A;  3EAE A;  2D6F A;  1RAB B;  4DBH A;  4XTX A;  2JMC A;  2K7A A;  3UWN A;  4M77 G;  2F69 A;  4IUV A;  2LDM A;  1YIT A;  4DQ2 A;  2QTV A;  4KT0 E;  5A0G A;  2MYS A;  4MMK A;  4DBQ A;  2KDS A;  4FW2 A;  2AK5 A;  1ZX6 A;  3MP8 A;  3PE0 A;  3QPH A;  4J7F A;  1S1N A;  2OTJ T;  2JVV A;  3DB4 A;  4PJO F;  3CCU Q;  2LNV A;  3QDR B;  2VV5 A;  4BB7 A;  2CKK A;  2RQU A;  3JSC A;  3OQ5 A;  1WHM A;  4QQD A;  3NFC A;  4NOY A;  1YIJ Q;  1HK9 A;  2EQI A;  3G71 T;  1TWB A;  4II1 A;  2H3J A;  2V1Q A;  3PFS A;  4JJN K;  2MIO A;  2FYK A;  2YWW A;  3SDZ A;  1K8A R;  4M7A D;  2O9S A;  2KRN A;  2C0O A;  1WQW A;  4N4H A;  2K5L A;  1WHL A;  4F14 A;  3HFN A;  4B6M A;  3NGP A;  4A63 B;  4KUL A;  2B8A A;  2KT8 A;  5GMK m;  4Y92 A;  4FT4 A;  1OU9 A;  1ABO A;  1NJI U;  2HNI A;  3UT1 A;  3REB B;  2O01 E;  3CCV T;  3H8Z A;  5C0M A;  3PTA A;  1N9S A;  3CCR Q;  1E6G A;  2V8K A;  2L8D A;  3FJ5 A;  3CBP A;  1YCS B;  1RUW A;  3CCL Q;  1PCX A;  5LJ5 d;  2RI2 A;  5KCH A;  5CK9 A;  2JTM A;  3E1S A;  1IGQ A;  2G6F X;  4M75 B;  1Y0M A;  4FYX B;  1S72 T;  3JCM f;  4RTX A;  1WPY A;  3MP6 A;  5GAO m;  2A37 A;  2DXT A;  1K8A U;  1D0Y A;  1MMA A;  5GAN 3;  2R57 A;  3MKD A;  3JCM J;  2ATC B;  2OX7 A;  3JB9 J;  2XKO C;  2HKN A;  3H0F A;  3CC7 T;  4C92 E;  4J7I A;  2JS0 A;  2CZ0 B;  1PD1 A;  3P8D A;  3M0P A;  3H0I A;  1LCK A;  5C6S A;  1T0H A;  4DOW A;  2RJC A;  2JNG A;  1IB8 A;  6AT1 B;  3JCM X;  3X20 B;  3TQ7 P;  4M7D C;  1QCO A;  4M77 C;  4Y91 A;  1X27 A;  4ZNX A;  1KQ2 A;  2VVK A;  1UE9 A;  1D0Z A;  2A08 A;  4C8Q B;  2IIM A;  3CCQ A;  2ED0 A;  2O31 A;  1UUE A;  4F7U A;  2LRQ A;  5HCK A;  1Q7Y U;  2ZPF B;  4CC3 A;  1XJW B;  2RI5 A;  1MMD A;  3UDC A;  4XTW A;  4HVW A;  5FW9 A;  3OMC A;  4X1V A;  2CGH A;  1SHF A;  1Y96 A;  4ELZ C;  4Q5W A;  3OB9 A;  4M7D G;  2ZCF B;  1PKT A;  5I11 A;  1I07 A;  3HTR A;  2YXY A;  1K76 A;  2HBW A;  2CYZ B;  4E7H A;  2CUD A;  2JM9 A;  1Q81 C;  3LGF A;  4LD9 K;  3CCL T;  3LH0 A;  2KVQ G;  4C0F A;  1Q7Y C;  5KE2 A;  4EDU A;  4RTZ A;  1AZE A;  2RD1 A;  2LX9 A;  2LMJ A;  2NYS A;  2YRD A;  1FYN A;  2NLU A;  1QVG A;  1UHC A;  1ZBX A;  5FU7 B;  3UA7 A;  2EKO A;  9ATC B;  1AEY A;  2K9G A;  1YCY A;  2L89 A;  3JCM Q;  2JOY A;  2C0T A;  2RMO A;  2AKK A;  1VQP Q;  2L3S A;  4PJJ A;  5IXB A;  4PJO E;  2COZ A;  4KH0 B;  2ROL A;  4UC4 A;  2D9T A;  4M7A E;  4PKC C;  4PFO A;  3CC4 T;  2EJF A;  1WFW A;  3D7S B;  1WJR A;  2X35 A;  2E6Z A;  1AWX A;  2DVJ A;  4C0G A;  4JDS A;  4LD6 A;  3JCM P;  1WYX A;  1MMG A;  1W6X A;  2MWO A;  4CC4 B;  1GL5 A;  3G4S A;  2FG0 A;  1ZUK A;  1YIT T;  1MHN A;  5KYY A;  1NZ9 A;  4J5Y A;  3JCM h;  1XTD A;  2R58 A;  2XID A;  4CC7 A;  2CP7 A;  1Y7X A;  2E5K A;  1ZQ1 A;  2EJG A;  4CRI A;  3OA6 A;  2FZG B;  1RI9 A;  4DEX A;  3E9G A;  4BY6 B;  1VIE A;  3MPU B;  1WXT A;  2YLC A;  1M1F A;  3SWN B;  1VQ4 Q;  1HD3 A;  3UPU A;  4E6R A;  2KRS A;  2ED1 A;  2P4R A;  3JB9 G;  1KQS A;  3VJP A;  4M7A B;  2F2X A;  5FWC A;  1LJO A;  2EKH A;  3PVL A;  2DEU A;  3EGU A;  4LE9 A;  1QWF A;  3M55 A;  1M27 C;  4A54 A;  1ZBJ A;  2EJ9 A;  2YSQ A;  1GFD A;  3VS1 A;  3CCU T;  1YJN Q;  1WGS A;  2P0P A;  1EX4 A;  1WXB A;  2DIG A;  1Q81 U;  2YRC A;  2MOX A;  1OV3 A;  5EG2 A;  2EYQ A;  3HHT B;  3LH5 A;  2J05 A;  2RNA A;  3OS0 A;  5DY9 A;  2EQU A;  2DD4 A;  5LJ5 g;  4E7Z A;  4OMP A;  2DBK A;  3RMQ A;  1Q81 R;  1FMV A;  3VU3 C;  1WZO A;  5GAN f;  4VUB A;  1G3T A;  2KT1 A;  5D6X A;  2KYB A;  3CCL A;  4X34 A;  3EGD A;  1N8R C;  3ULR B;  4OMF B;  1KC8 R;  2QDL A;  2LQK A;  2DL5 A;  3JCM e;  1RI0 A;  1RAG B;  4DBF A;  1VQ6 Q;  3H41 A;  2JM8 A;  3NTK A;  1QQJ A;  5KYX B;  1G5V A;  2DX1 A;  2LVM A;  3CCE Q;  2Y4Y A;  1FX7 A;  2RB6 A;  2EGA A;  2O9V A;  2VUB A;  1KHC A;  2A3L A;  3I55 T;  3EGX A;  3HFO A;  5GAN j;  2JMA A;  3CCM T;  4FCY A;  1PSF A;  1U3O A;  3JCM W;  2HL5 C;  2DM1 A;  2J7I A;  3SD4 A;  4J83 A;  3QJ6 A;  1VQ7 A;  1B34 A;  1LOJ A;  5CKF A;  3QSU A;  4AT1 B;  2CH4 W;  2RHI A;  1M1K R;  4J9H A;  3KBG A;  4J9C A;  3X24 B;  4OMQ A;  1AZG B;  3OYK A;  3CC2 Q;  5CKD A;  1VA7 A;  2VXE A;  1FXX A;  3LW5 E;  4EMK A;  2DF6 A;  3VUB A;  2RF0 A;  3OYH A;  1K73 R;  2KXD A;  3A8O B;  3CCJ Q;  4NS5 A;  1TUG B;  2JUF A;  2XD0 A;  5IN1 A;  3R6O A;  1AT1 B;  4OP0 A;  1VQK A;  2RHY A;  2KI7 A;  1G3Y A;  3RES A;  5CO7 A;  1NJI C;  1VQ6 T;  1VUB A;  1N8R R;  4BE0 A;  5GAN d;  1RLQ C;  1JJ2 S;  4KUI A;  4PJO A;  5LJ5 j;  2NWM A;  1WHG A;  3JB9 H;  5I2S A;  1PC0 A;  1UG1 A;  2O4X B;  3EGD B;  4WF2 A;  1PM3 A;  2VWF A;  2M0Y A;  4FYW B;  2LJ3 A;  2DD5 A;  3LYI A;  3NTH A;  4IIO A;  4PFP A;  4RMO A;  4MDW A;  3A8H B;  4EIK A;  2LNH B;  1NM7 A;  2CP0 A;  1Q86 C;  1ZHI A;  2RJE A;  2F5K A;  3S3M A;  3CBO A;  4ZN3 A;  3TSZ A;  1B7T A;  3OYF A;  2CZ1 B;  4PJL A;  2ECZ A;  3VYH B;  4LNP A;  3HRS A;  3S3O A;  1J3T A;  1AWJ A;  1DJ7 B;  5DLO A;  1MGQ A;  1BI2 A;  2P0Q A;  1MV3 A;  5IHN A;  1WA7 A;  2D0N A;  3CC7 Q;  1VQL Q;  4ZTF A;  3M53 A;  1K4U S;  2IVW A;  1AWW A;  2M16 A;  2GF7 A;  4OB3 B;  3DLL A;  5AYF A;  2DRM A;  3TRE A;  3L2Q A;  2OTJ Q;  5D7U A;  1UGP B;  2NUT A;  4CC2 A;  3PT9 A;  3EFO A;  1TUD A;  2EBP A;  2K3X A;  2OI3 A;  3M0R A;  2EPD A;  4F7U F;  4ZGJ B;  5ECA A;  2SRC A;  5LJ5 f;  3VS3 A;  1UTI A;  4J9D A;  3M4Y A;  4C5H A;  2EVR A;  2KGT A;  3CCR T;  1Q86 R;  1O75 A;  3H0H A;  2ZAE A;  1JEG A;  4R56 A;  1JBM A;  2DMO A;  4WCI A;  1D1C A;  2ZPI B;  2K2M A;  3CME Q;  2L3Q A;  2HSE B;  3CME T;  1Q7Y R;  3CCE A;  3N5B B;  2RJD A;  1VQ9 A;  1WNL A;  1WDX A;  3OYC A;  1YIJ T;  2JS2 A;  4M78 D;  4LDU A;  1KD1 U;  1D1B A;  2E12 A;  3MEW A;  3M0Q A;  4M78 F;  1M1K C;  4AG2 C;  3A8G B;  2GQI A;  2K6D A;  1K73 U;  1XNI A;  5LJ3 f;  3CC4 A;  3MP1 A;  3CXC A;  2X51 A;  1VQ9 T;  1LPL A;  2DL7 A;  4Z88 A;  5J39 A;  3OYB A;  4L6V 5;  4E7L A;  1IXD A;  1TG0 A;  2MPX C;  1X6G A;  1VQL A;  1VIF A;  2KR3 A;  3SWN C;  1BI0 A;  4OGE A;  5GJW B;  1PSE A;  3OS1 A;  4BE1 A;  5IXF A;  1RAC B;  4F04 B;  3CCS Q;  1SF9 A;  3FIF A;  2NUT B;  3MET A;  1CKB A;  1OOT A;  1X2K A;  1BI3 A;  2QI2 A;  1LNX A;  4K11 A;  3AHU A;  3L2Z A;  2AHJ B;  5GMK i;  2HBP A;  1BYM A;  1QLY A;  4DA4 A;  1X75 C;  3C94 A;  1W4S A;  1ZSZ C;  2WSE E;  3CXC S;  4LUD A;  3VS7 A;  1NYG A;  2D8H A;  3CCU A;  3PGG A;  4QT7 A;  2V26 A;  2J6K A;  3VV0 A;  2QA4 A;  1N27 A;  4EPC A;  5GAM h;  4C0D B;  3CEY A;  4E7K A;  2E3H A;  1EFN A;  3JB9 D;  3V8K A;  3L2V A;  1C0M A;  2IPO B;  2DAQ A;  4XQ3 A;  2EIF A;  3NPF A;  3I56 A;  4BE2 A;  2QGG A;  2F2W A;  2FPF A;  2KK4 A;  4JLG A;  1WJS A;  1GRI A;  1HYO A;  1T3S A;  3NHN A;  4M7D D;  2CSQ A;  1R8O B;  1P92 A;  2SEM A;  4ZGE B;  1YI2 A;  4RTW A;  5GAM j;  1KQS P;  2MMP A;  1VQO T;  2YUP A;  3C12 A;  4J9E A;  2RK2 A;  5M9O A;  3OW2 P;  1UGR B;  1OX8 A;  3C95 A;  2PUO B;  5CKH A;  1Y57 A;  3M0T A;  4B9X A;  3NTI A;  4N4I A;  1JU5 C;  3L42 A;  5KCO A;  1ZSZ B;  4M78 E;  2E5Q A;  4PFZ A;  1M1K U;  3WXM B;  2A7Y A;  3KFV A;  4M4Z A;  3CCJ A;  1X43 A;  2DTH A;  5A2Q E;  3DB3 A;  3RIR A;  1V76 A;  4GY5 A;  2KNB B;  2B86 A;  2V8J A;  1KD1 C;  4XU3 A;  2COY A;  2GTO A;  5D6Y A;  1X69 A;  2KQW A;  4FSX A;  1OPK A;  1D3B B;  3CC2 T;  3QKJ A;  5LL6 S;  1BB9 A;  3JCM g;  4X9C A;  1MNE A;  4HVV A;  4IUQ A;  1UHF A;  3MJX A;  1GCQ C;  1JXO A;  1M30 A;  1M5Q 1;  5J26 A;  4LDY A;  5EC7 A;  4LN2 A;  3MEV A;  1E6H A;  2QQA A;  3CD6 T;  5HK3 A;  2DK3 A;  1YHQ T;  3OYA A;  3THK A;  5L23 A;  3EHQ A;  5LJ5 e;  1WHJ A;  3BE3 A;  3HPW A;  1SRL A;  5CQY A;  2FPE A;  2QAZ A;  3JCM b;  2DFU A;  2EFI A;  1TXQ A;  3I35 A;  2FRW A;  3PIP A;  2L5Q A;  3URG A;  4PJN A;  3VRY A;  2RH2 A;  1N6A A;  4AFZ C;  1D09 B;  4QKU A;  4Z02 A;  3G7Z A;  2NUP B;  2QQ9 A;  2KE9 A;  4OGC A;  4OML A;  1YHQ A;  4C5E A;  4ANJ A;  3RR6 A;  4BI3 A;  3L2R A;  1B34 B;  4A4G A;  3UF4 A;  1NE8 A;  3OS5 A;  1PD0 A;  4M77 A;  4ZGD B;  2HEQ A;  2E64 A;  5GAN 6;  3P8H A;  2OTJ A;  5FRO A;  3AT1 B;  1KK7 A;  2RHU A;  3V7R A;  4KUD K;  5KH6 A;  1H92 A;  3OBY A;  4EMG A;  1NG2 A;  3EG9 B;  4HXJ A;  3EG2 A;  4KGZ B;  1I81 A;  1K9A A;  2PQW A;  3QO3 A;  4XK8 E;  3VS2 A;  2DVE A;  1CKA A;  1UGS B;  5IAY A;  2HAX A;  1QWE A;  4HCK A;  3EG9 A;  2QDY B;  2K3Y A;  1VQ5 Q;  3V7S A;  1G2B A;  3REA B;  3CCJ T;  3QWY A;  2OTL Q;  1AD5 A;  4N0A C;  1E7O A;  3QBY A;  3CD6 Q;  3ZEH A;  4EMK B;  1YJW Q;  1TS9 A;  1QP2 A;  2FEI A;  4J9B A;  1PKS A;  2DBM A;  4NL2 A;  1U8R A;  3CPW A;  1QKW A;  1JRI A;  4MML A;  2DA9 A;  1A0N B;  1UFF A;  2DJQ A;  1M8M A;  4QVD A;  1M90 C;  4C0D C;  5GAN h;  1RAH B;  2DTI A;  1IRX A;  1RLP C;  4F16 A;  1X01 A;  2DNU A;  4AG1 C;  2LTO A;  4HCB A;  3M56 A;  3ZL7 C;  3SB2 A;  3I56 Q;  5FWB A;  4OF1 A;  2EWN A;  3M9Q A;  2FO0 A;  2EW3 A;  5FU7 C;  1YN8 A;  1PRM C;  2ROT A;  2BKD N;  4NL3 A;  5KYX A;  4PLI A;  4DBR A;  2BTT A;  2LJ1 A;  1UGV A;  4OB2 B;  2QEX T;  3EGX B;  2GCX A;  1VQ8 Q;  3JAM E;  2EQM A;  3KUF A;  3WVE B;  4QVC A;  2PU9 B;  2RQT A;  4J9G A;  3C0C A;  3J80 E;  5GAO r;  4PK4 A;  1WQ7 A;  3HKS A;  3M54 A;  4BD3 A;  2JW4 A;  1MV0 B;  3WVD B;  1W2B P;  3G71 A;  4C92 B;  2DKG A;  1WHK A;  2QEX A;  1VQ8 A;  2AT1 B;  3CCQ Q;  2VXF A;  4M77 E;  4N0A A;  2PVD B;  3PVQ A;  4M7D F;  1GCQ A;  2RJF A;  4Y28 E;  1YJ9 T;  2KRM A;  1VQK Q;  2O4X A;  1SHG A;  3FB9 A;  2M02 A;  5KYW A;  3MHX A;  5KE3 A;  2GBQ A;  4ME7 A;  1UEC A;  2BZY A;  2X4X A;  5I2M A;  2D1X A;  2K3B A;  4JUV A;  1UEB A;  4D8K A;  4OMO A;  1AOJ A;  2HZY A;  1IO6 A;  1GFC A;  4M7A F;  2BIV A;  1ZLM A;  2YLB A;  5A0D A;  1HSQ A;  4BAC A;  2KY9 A;  2QAS A;  1RAE B;  1M90 U;  2QTX A;  1JXM A;  2KYM A;  4GLM A;  1BIA A;  1BBZ A;  5DM7 R;  1R77 A;  3IQL A;  2KAF A;  5GAN 2;  4RKU E;  4JZ4 A;  5LJ3 h;  2EYW A;  1ZUU A;  2OTL A;  1QKX A;  3CCR A;  5FU6 B;  2AKL A;  1RL2 A;  1I0C A;  2GFU A;  4XTU A;  5I22 A;  1M2O A;  2RHX A;  3CME A;  2XK0 A;  3L1A A;  4M77 F;  3J81 E;  4X9D A;  2RQV A;  4XU0 A;  3U23 A;  2BZ8 A;  4C8Q D;  2I2L A;  2P84 A;  2E65 A;  4PL6 A;  1WLP B;  1I8F A;  2X4Y A;  3CPW S;  1QVG P;  2EYY A;  1PWT A;  4C8Q E;  3PMT A;  2LCS A;  5IHI A;  1VQ8 T;  1MND A;  1M1G A;  4FM4 B;  4AFU C;  3FRN A;  2HQH A;  4LDW A;  1GCP A;  3M59 A;  3JCM d;  3QZ9 B;  3OY9 A;  3G6E T;  1B3Q A;  3X28 B;  2DYB A;  1VQP T;  2CH4 A;  3SHW A;  3QUI A;  4GLK A;  2J06 A;  5CIU A;  3GBQ A;  5I21 A;  2ESW A;  1W2B S;  3HP9 A;  4JRK A;  2HMA A;  4PLL A;  2DLP A;  3LLR A;  2K79 A;  1K9M C;  4BY6 C;  3CMA Q;  2DXB A;  5GAO q;  4P5N A;  1QVG S;  2K5F A;  1K0S A;  2G3R A;  2P0K A;  3QDF A;  3MEU A;  1TSF A;  4ESR A;  2IG0 A;  2XG8 D;  4LXC A;  4JRQ A;  1KIK A;  2JJ9 A;  2KXC A;  2PVO B;  2X9H A;  3HSB A;  1YJW T;  1NJI R;  1KFZ A;  2FVU A;  2E6N A;  3EFR A;  3FC3 A;  3TVT A;  4C92 C;  1M4Z A;  2DL8 A;  1AHJ B;  1VQP A;  1IHV A;  1HXD A;  2M51 A;  3M58 A;  4PJO C;  3VKI A;  1W2B A;  3L2U A;  3EHR A;  2VAS A;  1Q82 U;  3CC7 A;  3QWX X;  2DRK A;  2LT1 A;  3X25 B;  1U5S A;  1C6V X;  1BI1 A;  2JTE A;  4D6W A;  4JLI A;  2M0O A;  1KD1 R;  4E2F B;  2MF2 A;  4IUR A;  7AT1 B;  1QCF A;  1G3S A;  1X6B A;  4XAX B;  1WHH A;  2CP5 A;  2CP2 A;  1YI2 T;  4JJD A;  3BFM A;  4BDY A;  4M78 C;  3M57 A;  3GP8 A;  2VGN A;  3Q1J A;  4XU1 A;  5GMK e;  1ABQ A;  2D8J A;  2CSI A;  2WAC A;  2JN0 A;  2DL3 A;  1YJW A;  2L3P A;  4J9I A;  3JB9 F;  3QJY A;  1YWP A;  1T3L A;  2JXB A;  1QVF P;  4QW2 A;  5KYU B;  4M7A G;  1VQ5 A;  2XI9 A;  1FWZ A;  2W10 A;  1VYV A;  1VYU A;  4OVA A;  3G6E Q;  3E19 A;  4PJO G;  2PTK A;  5LJ3 j;  2D0Q B;  2XMF A;  3CXC P;  1IHW A;  4KBM B;  3RMS A;  2X4J A;  4LDV A;  1YBY A;  2E41 A;  5GAM e;  4OMN A;  3CC2 A;  1N5Z A;  1NBE B;  1UJ0 A;  3QII A;  4E7I A;  3OYE A;  5LJ3 d;  4IKF A;  1WXU A;  2OAW A;  4N4G A;  1I5L A;  1SG5 A;  2MWP A;  1ZSZ A;  1VQ4 T;  4RUG A;  2K57 A;  3RUX A;  1YP5 A;  3DLM A;  1VQ7 Q;  2LT4 A;  5LJ5 h;  1QVF S;  4J6Y A;  4BI4 A;  1TH7 A;  2M9U A;  4R0K A;  3CD6 A;  1K8A C;  1ACM B;  2CP3 A;  2MK5 A;  2L0A A;  5J3B A;  2PZ1 A;  1V1C A;  5IHK A;  1YJN A;  1JJ2 A;  1TUC A;  3C4S A;  4E47 A;  4HKE A;  3I55 Q;  2FB7 A;  4FW1 A;  4KGX B;  2HDA A;  1VQ6 A;  1IRE B;  2ZZD A;  4RTT A;  2V8I A;  2LCC A;  4M75 C;  2A36 A;  5LJ3 e;  5L8R E;  3FJP A;  1Z9Z A;  4RCC A;  3H9N A;  2CZ7 B;  5CCA A;  2YRV A;  1NYF A;  2VKN A;  2HL3 A;  1H3H A;  4XU2 A;  1W70 A;  1VQ7 T;  3GOX A;  2VC8 A;  5GMK h;  3CC4 Q;  3INZ A;  2HQX A;  3ASK A;  3I5S A;  3HRU A;  1K9M U;  3SFM A;  2RPN A;  1VQK T;  4RTY A;  5FRM A;  2HKQ B;  5IH2 A;  2XHC A;  3VS0 A;  4O5V A;  4J6X A;  3RKY A;  2DYI A;  4ZN1 A;  4OB0 B;  5FLX E;  2GFA A;  3X26 B;  1Q86 U;  3M0S A;  3ZFJ A;  2QQS A;  2YHT A;  4QQ6 A;  4PJM A;  2CDT A;  1BU1 A;  3F70 A;  3GIB A;  4FYY B;  3A8M B;  2HQE A;  2K4Y A;  1IZ6 A;  4BUG A;  5GAN 8;  3G4S Q;  3JRZ A;  3G4S T;  4BDZ A;  3O5Z A;  4DEY A;  4FT2 A;  2WSC E;  1S72 Q;  1O9S A;  1QCN A;  4C5I A;  2KSS A;  1AVZ C;  1SEM A;  3ME9 A;  2QEX Q;  1KJW A;  3CPF A;  1GBQ A;  5FU6 C;  1VQ4 A;  3OYI A;  5GAN 5;  2RI3 A;  1XQH A;  4IIM A;  1M2V B;  1BCM A;  1C1A A;  1BK2 A;  2F2V A;  1U1T A;  2ZPG B;  5CKB A;  4OMM A;  2PNI A;  1BCO A;  1BIB A;  1OU8 A;  3FEO A;  2FL7 A;  2FZK B;  3H6Z A;  4HA8 A;  1RAI B;  1QMC A;  1X6O A;  1TTH B;  4AFS C;  1OUL A;  5CR2 A;  1K73 C;  1G3W A;  3M4G A;  1CSK A;  1WI7 A;  3QYG B;  2H8H A;  4A4K A;  2R5M A;  4ATO A;  1PG5 B;  4QQG A;  4Z8A A;  1YIT Q;  2X3W D;  3QG1 A;  1XOV A;  3M0U A;  4PJO D;  5GAN g;  2E1H A;  4HT9 A;  1OZ3 A;  3RER A;  1F1B B;  4FSS A;  2C06 A;  1KG1 A;  2EGC A;  1NPP A;  2ABL A;  3L2W A;  3GNF B;  2OAU A;  3CPW P;  3CCM Q;  1QP3 A;  2QK0 A;  2DJZ A;  1KQS S;  3ER0 A;  4XTZ A;  2P4T A;  4TVR A;  3TSW A;  2AZV A;  5LJ3 g;  2O88 A;  3A8L B;  1NLO C;  1VQN T;  3OYD A;  2J6O A;  4A53 A;  2BUD A;  4M7D E;  2CT4 A;  2YUN A;  4CI0 C;  1MMN A;  2XIC A;  1I1J A;  2JTF A;  2YDL A;  1NEB A;  2CP6 A;  4A4E A;  2DPP B;  1VYT A;  2JT4 A;  1WX6 A;  1SSH A;  2FHD A;  1RAA B;  4D8D A;  3CCS A;  4RTV A;  2J6F A;  2EAY A;  2AIR B;  1OX9 A;  3RDV A;  1S72 A;  5A0L A;  1M2V A;  4EMK C;  4FIB A;  1QVP A;  2QG9 B;  4OB1 B;  3EFO B;  1RAD B;  1Q95 G;  3RBB B;  1M3A A;  3OYN A;  2F5T X;  3J7A F;  2NUZ A;  2LQN A;  3JCM c;  2QA4 Q;  3GPL A;  3A98 A;  2JZ2 A;  3UA6 A;  2KEA A;  3QXE B;  1UDL A;  5GAN e;  3TEE A;  4DOV A;  1U1S A;  2R5A A;  4XTV A;  1YHQ Q;  1VQM Q;  3I56 T;  3OYJ A;  4E7J A;  3RKW A;  4M7D B;  3VYG A;  4PNO A;  2COW A;  4AFQ C;  3OYL A;  1YJ9 Q;  2XDB A;  4C0Z A;  3LX7 A;  1FMW A;  4KRT A;  3VUZ A;  1AWO A;  5KYW B;  2CUB A;  4V2S A;  3PMI A;  5HY6 A;  4J9F A;  4RCB A;  2GQV A;  1JJ2 P;  4JRI A;  1YJN T;  2QXF A;  3EG3 A;  3VS5 A;  3FLG A;  4C8Q C;  1UJY A;  3EH2 A;  2RM4 A;  2DIL A;  1G8X A;  2AZS A;  4QVZ A;  2ZPE B;  3QZ5 B;  2RQR A;  4IUT A;  2QA4 T;  1OYX A;  4ORZ A;  2CRE A;  2DEQ A;  3TU4 K;  4EMH A;  2E3I A;  8ATC B;  2XDP A;  5CQX A;  2DO3 A;  1OQK A;  4M77 D;  3EG1 A;  2DXU A;  2HSP A;  4L5G A;  1Q82 C;  1QW1 A;  5CVI A;  4F7U E;  4XTY A;  3CCQ T;  1VOM A;  4GBQ A;  3UAT A;  4O6J A;  2E70 A;  2LC4 A;  1H8K A;  1KHI A;  5HK0 A;  1B07 A;  2RHZ A;  1GBR A;  3G71 Q;  2RK1 A;  1YIJ A;  3EH1 A;  3R6N A;  1M90 R;  4M75 A;  4M75 G;  4C92 F;  4BI8 B;  3HL8 A;  1VQN Q;  2OJ2 A;  5DLQ E;  1N8R U;  1I4K 1;  4C92 G;  4E7S A;  2QYZ A;  3NMZ C;  3OSS C;  2LCL A;  1Y71 A;  4YTL A;  3A1P A;  5D6W A;  1MUZ A;  4ZTJ A;  2DZ9 A;  1SRM A;  5GMK j;  4C92 D;  4MDX A;  4IUP A;  2RQW A;  1R0C B;  1K1Z A;  1TU0 B;  2I0N A;  3CCM A;  2VB6 A;  8AT1 B;  3BW1 A;  3QYH B;  1WIE A;  1K9M R;  3OYG A;  2C0I A;  2PUK B;  3CMA T;  3V7C A;  2Y90 A;  1NPR A;  1JB0 E;  3OW2 A;  1EIF A;  4HT8 A;  1Y96 B;  1KC8 C;  2M1H A;  4C8Q A;  4JS4 A;  4JJC A;  2VYT A;  5CKE A;  4F7U B;  4HCC A;  3SEM A;  3S6W A;  1W1F A;  4F7U G;  4FYV B;  2X4W A;  1PNJ A;  4Z89 A;  3I5R A;  2NUP A;  4AMC A;  2FZC B;  2DE0 X;  2DTO A;  3CQT A;  1SPK A;  1PHT A;  4C5G A;  2RA2 A;  1VQN A;  5FRN A;  1H64 1;  3RKX A;  3OYM A;  4A4H A;  1JQQ A;  4B9W A;  1ZA2 B;  2GTJ A;  4JS5 A;  5GAN 4;  1VQ5 T;  3EFS A;  4M77 B;  2YT6 A;  1KC8 U;  4F17 A;  1ZUY A;  3CMA A;  3OW2 S;  1ZA1 B;  1FMK A;  1LVK A;  1R0B G;  2E10 A;  1KQ1 A;  3SWN A;  4KH1 B;  5KYN A;  1N9R A;  1WJQ A;  5GAM g;  1D1A A;  1HJD A;  1OEB A;  3LWI A;  3GLX A;  2XU8 A;  5GJV B;  1M9S A;  4MZP A;  5KYU A;  3QHS A;  1RAF B;  1X2Q A;  3A5Z B;  1YFN A;  4HCZ A;  2V1R A;  1H3Z A;  3OMG A;  4R55 A;  1SKU B;  3LGL A;  1PRL C;  4J6W A;  4FL6 A;  4MZM A;  4M7A C;  3CCS T;  3V8L A;  4RTU A;  4M75 E;  5GAO n;  1OI1 A;  2CT3 A;  1VQO A;  2WSF E;  1M8V A;  3JV3 A;  3TCJ A;  2CS7 A;  4JJB A;  1K0X A;  1I5O B;  1BKB A;  2LP5 A;  3O8V A;  3S3N A;  4LDX A;  2YUQ A;  2MAM A;  4M78 G;  3BY7 A;  2DZC A;  3V8J A;  5GAM d;  2DET A;  2VGM A;  1G83 A;  4HVU A;  2QQB A;  3OBW A;  1GXI E;  2LQW A;  1TOV A;  2BE9 B;  2GNC A;  2MI6 A;  3MCA B;  5KYY B;  5GAO p;  3E9F A;  1VQM A;  2O2O A;  4M7A A;  3MO8 A;  3OSV A;  2CZ6 B;  1JO8 A;  2LX7 A;  2EQJ A;  1IGU A;  3MEA A;  2H3E B;  2EYX A;  5GMK l;  2DER A;  4JPB W;  2KRO A;  2LZ6 B;  4WTO B;  1QVF A;  2Y4X A;  1D0X A;  4RG2 A;  1Y07 A;  1ZSG A;  5AT1 B;  1KSW A;  5HKC A;  1M3B A;  3VRZ A;  1VQ9 Q;  1YNZ A;  3JCM V;  4M75 F;  4C92 A;  5GAN 7;  4M78 B;  2DXC A;  3M5A A;  2GGR A;  3I55 A;  3OYY A;  3G6E A;  3T9N A;  1EZZ B;  1Z9Q A;  3ZBD A;  2YUO A;  1D3B A;  2X3X D;  2ZPB B;  3VS4 A;  1YJ9 A;  1VQO Q;  3PIO A;  4M78 A;  1NEG A;  2K5I A;  4JZ3 A;  2XDD A;  3KXT A;  2QQR A;  2KBT A;  2K2V A;  3P8B B;  3CCV Q;  2EYZ A;  2EGE A;  5IT9 E;  2DL4 A;  3BDL A;  3OS2 A;  1YI2 Q;  1Q82 R;  3JB9 I;  2KMT A;  1VQL T; 
#chains in the Genus database with same CATH homology
 4J8O A;  2RHI A;  4MZT A;  3FDR A;  3GNG A;  1X6O A;  3KBG A;  4C8Q G;  3X24 B;  4C0D C;  5GAN h;  2HD0 A;  5CR2 A;  2DTI A;  4C8Q F;  3OYK A;  1K73 C;  1X01 A;  1G3W A;  1OZ2 A;  4ELY C;  3M4G A;  5CKD A;  2LTO A;  4HCB A;  4PJO B;  3M56 A;  2VXE A;  3QYG B;  3HRT A;  1SSF A;  4A4K A;  1FXX A;  3LW5 E;  4EMK A;  3VUB A;  3SB2 A;  2R5M A;  3OYH A;  4ATO A;  2OTL T;  4QQG A;  4OF1 A;  2EWN A;  3A8O B;  3M9Q A;  2L3R A;  3QG1 A;  1XOV A;  4PJO D;  5GAN g;  4IUU A;  4NS5 A;  2JUF A;  5FU7 C;  2XD0 A;  2E1H A;  5IN1 A;  4HT9 A;  2BKD N;  1OZ3 A;  3R6O A;  4NL3 A;  3RER A;  2C06 A;  4PLI A;  4OP0 A;  1VQK A;  4L59 A;  1KG1 A;  3PNW C;  2ZPH B;  1NPP A;  2RHY A;  3L2W A;  5CAI A;  3GNF B;  1G3Y A;  2OAU A;  2ZGW A;  5CO7 A;  3RES A;  1QP3 A;  1NJI C;  4JRP A;  1VUB A;  2DJZ A;  4OB2 B;  2EQK A;  1V29 B;  1VQ6 T;  2QEX T;  1KQS S;  3ER0 A;  2GCX A;  4XTZ A;  4BE0 A;  5GAN d;  3GF5 A;  3CBM A;  4KUI A;  2P4T A;  3JAM E;  1VQM T;  1JJ2 S;  4PJO A;  2RO0 A;  4TVR A;  5LJ5 j;  2EQM A;  2LQ8 A;  3KUF A;  3WVE B;  4QVC A;  3JB9 H;  2PU9 B;  5LJ3 g;  5GAO l;  3A8L B;  3J80 E;  5I2S A;  3LWH A;  1VQN T;  5GAO r;  3OYD A;  2O4X B;  4M75 D;  4A53 A;  3BDU A;  3CCE T;  4WF2 A;  1WQ7 A;  3HKS A;  2BUD A;  4A4F A;  4M7D E;  3M54 A;  4CI0 C;  2DD5 A;  2XIC A;  3LYI A;  4BD3 A;  3CCV A;  3NTH A;  2JTF A;  2PVG B;  3WVD B;  1UB4 A;  4FU6 A;  3DKM A;  4RMO A;  3G71 A;  4A4E A;  4MDW A;  3A8H B;  4RG8 A;  4C92 B;  2DKG A;  2DPP B;  2QEX A;  1VQ8 A;  1Q86 C;  4M7D A;  1ZHI A;  2RJE A;  1UGQ B;  2VXF A;  2F5K A;  4M77 E;  4N0A A;  3S3M A;  2PVD B;  3CBO A;  5GAM f;  4M7D F;  4ZN3 A;  2RJF A;  2FHD A;  4Y28 E;  3OYF A;  1YJ9 T;  2CZ1 B;  2DIQ A;  3EAE A;  2D6F A;  3VYH B;  3CCS A;  2EAY A;  2O4X A;  3HRS A;  3S3O A;  3FB9 A;  4XTX A;  1DJ7 B;  3UWN A;  5DLO A;  1S72 A;  4BDZ A;  1MGQ A;  4M77 G;  5A0L A;  1BI2 A;  3MHX A;  2P0Q A;  2F69 A;  4IUV A;  4EMK C;  5KE3 A;  2LDM A;  1YIT A;  4FIB A;  4ME7 A;  1QVP A;  4OB1 B;  4DQ2 A;  4ZTF A;  2X4X A;  3M53 A;  5I2M A;  4KT0 E;  5A0G A;  2IVW A;  4MMK A;  3J7A F;  2KDS A;  2F5T X;  2GF7 A;  2M16 A;  4OB3 B;  3OYN A;  4JUV A;  1UEB A;  3DLL A;  3JCM c;  5AYF A;  3TRE A;  3L2Q A;  3GPL A;  3MP8 A;  4J7F A;  3QPH A;  2BIV A;  4M7A F;  1UGP B;  2YLB A;  2JZ2 A;  3PT9 A;  5A0D A;  2OTJ T;  2JVV A;  3DB4 A;  4PJO F;  2K3X A;  2KY9 A;  3QXE B;  4BAC A;  2LNV A;  1M90 U;  2QTX A;  4F7U F;  3QDR B;  2VV5 A;  3TEE A;  4BB7 A;  2CKK A;  5GAN e;  4ZGJ B;  4DOV A;  5LJ5 f;  1BIA A;  1U1S A;  5DM7 R;  3JSC A;  2R5A A;  3OQ5 A;  4QQD A;  4XTV A;  3NFC A;  3M4Y A;  4C5H A;  2KAF A;  4NOY A;  3CCR T;  3I56 T;  1O75 A;  5GAN 2;  3OYJ A;  4RKU E;  4E7J A;  1HK9 A;  3RKW A;  3G71 T;  3VYG A;  4R56 A;  4M7D B;  4II1 A;  5LJ3 h;  1JBM A;  2H3J A;  4PNO A;  2OTL A;  3PFS A;  4JJN K;  3OYL A;  3CCR A;  2XDB A;  2ZPI B;  2FYK A;  5FU6 B;  3SDZ A;  4C0Z A;  4M7A D;  1WQW A;  1RL2 A;  2K5L A;  3LX7 A;  4N4H A;  2GFU A;  3HFN A;  3CME T;  3CCE A;  4KUL A;  3VUZ A;  2B8A A;  3N5B B;  4XTU A;  5GMK m;  4FT4 A;  2RHX A;  2RJD A;  1NJI U;  2HNI A;  3PMI A;  5HY6 A;  3UT1 A;  2XK0 A;  3CME A;  2O01 E;  3L1A A;  4V2S A;  4M77 F;  1VQ9 A;  3J81 E;  1WNL A;  3CCV T;  3H8Z A;  4X9D A;  4RCB A;  3OYC A;  5C0M A;  3PTA A;  1N9S A;  2GQV A;  4JRI A;  4XU0 A;  4C8Q D;  4M78 D;  1YIJ T;  1YJN T;  2QXF A;  2I2L A;  2V8K A;  2E65 A;  2L8D A;  4PL6 A;  4LDU A;  1KD1 U;  3CBP A;  1I8F A;  2X4Y A;  5LJ5 d;  3CPW S;  3FLG A;  2RI2 A;  5KCH A;  4C8Q C;  5CK9 A;  2JTM A;  3E1S A;  4C8Q E;  3PMT A;  2E12 A;  3MEW A;  2RM4 A;  4M75 B;  1VQ8 T;  1M1G A;  4M78 F;  1S72 T;  4FM4 B;  3JCM f;  1M1K C;  3FRN A;  4QVZ A;  1WPY A;  2ZPE B;  3MP6 A;  3A8G B;  5GAO m;  1K73 U;  2DXT A;  1K8A U;  1XNI A;  3QZ5 B;  4IUT A;  2QA4 T;  5GAN 3;  4LDW A;  5LJ3 f;  2R57 A;  1OYX A;  3JCM J;  3M59 A;  3MP1 A;  3CXC A;  3JCM d;  3QZ9 B;  3OY9 A;  3G6E T;  3CC4 A;  3X28 B;  2DEQ A;  3TU4 K;  3JB9 J;  1VQ9 T;  2XKO C;  1VQP T;  4EMH A;  5J39 A;  3OYB A;  3CC7 T;  4L6V 5;  4C92 E;  3QUI A;  4GLK A;  4J7I A;  4E7L A;  2XDP A;  2CZ0 B;  3P8D A;  5CIU A;  5CQX A;  5I21 A;  2DO3 A;  5C6S A;  4M77 D;  1VQL A;  1VIF A;  4DOW A;  2RJC A;  2JNG A;  1W2B S;  2DXU A;  4L5G A;  1BI0 A;  3HP9 A;  4JRK A;  4OGE A;  3SWN C;  1QW1 A;  5CVI A;  3X20 B;  3JCM X;  1Q82 C;  4F7U E;  1PSE A;  4PLL A;  3OS1 A;  4BE1 A;  4XTY A;  3LLR A;  4M7D C;  4M77 C;  1K9M C;  4Y91 A;  4BY6 C;  3CCQ T;  3FIF A;  3MET A;  2DXB A;  1KQ2 A;  5GAO q;  4P5N A;  1QVG S;  2K5F A;  4O6J A;  2E70 A;  1BI3 A;  2QI2 A;  2LC4 A;  4C8Q B;  2G3R A;  1KHI A;  2P0K A;  1LNX A;  3AHU A;  3CCQ A;  4F7U A;  3MEU A;  5HK0 A;  2RHZ A;  3L2Z A;  2AHJ B;  5GMK i;  2HBP A;  1BYM A;  2IG0 A;  2LRQ A;  4DA4 A;  2RK1 A;  2XG8 D;  1YIJ A;  4JRQ A;  1X75 C;  2PVO B;  3C94 A;  3HSB A;  1YJW T;  1Q7Y U;  1W4S A;  2ZPF B;  4M75 A;  4M75 G;  4C92 F;  4BI8 B;  3HL8 A;  2RI5 A;  2WSE E;  2FVU A;  3CXC S;  5DLQ E;  1N8R U;  3UDC A;  4XTW A;  2E6N A;  1I4K 1;  3EFR A;  3FC3 A;  4C92 G;  4C92 C;  3OSS C;  2LCL A;  1Y71 A;  1M4Z A;  3OMC A;  4YTL A;  3CCU A;  3PGG A;  5D6W A;  1AHJ B;  1VQP A;  2CGH A;  1Y96 A;  4ZTJ A;  2DZ9 A;  1HXD A;  4ELZ C;  5GMK j;  4Q5W A;  4C92 D;  3VV0 A;  3M58 A;  2QA4 A;  4MDX A;  4PJO C;  4IUP A;  3OB9 A;  3VKI A;  4M7D G;  2ZCF B;  1W2B A;  1N27 A;  3L2U A;  4EPC A;  5GAM h;  1Q82 U;  3CCM A;  4C0D B;  3CC7 A;  3CEY A;  3BW1 A;  3QYH B;  3OYG A;  4E7K A;  2CYZ B;  4E7H A;  2LT1 A;  3X25 B;  1Q81 C;  2PUK B;  3LGF A;  3JB9 D;  3CMA T;  4LD9 K;  3V7C A;  2Y90 A;  3CCL T;  3V8K A;  3L2V A;  1NPR A;  1JB0 E;  3LH0 A;  2DAQ A;  1BI1 A;  3OW2 A;  4XQ3 A;  1EIF A;  2EIF A;  4HT8 A;  2KVQ G;  4C0F A;  1Q7Y C;  5KE2 A;  1Y96 B;  4EDU A;  4D6W A;  2M1H A;  2RD1 A;  4JLI A;  4C8Q A;  3I56 A;  4JS4 A;  2M0O A;  4BE2 A;  2VYT A;  2LX9 A;  5CKE A;  4F7U B;  2MF2 A;  2KK4 A;  2NLU A;  1QVG A;  1ZBX A;  4IUR A;  4HCC A;  5FU7 B;  4JLG A;  2EKO A;  1WJS A;  1G3S A;  1YCY A;  3S6W A;  4M7D D;  2L89 A;  4XAX B;  3JCM Q;  2JOY A;  4F7U G;  1YI2 T;  1R8O B;  1P92 A;  3BFM A;  4BDY A;  2X4W A;  4ZGE B;  4M78 C;  3M57 A;  1YI2 A;  3GP8 A;  2VGN A;  4PJO E;  2DTO A;  3Q1J A;  4XU1 A;  5GMK e;  5GAM j;  4C5G A;  2RA2 A;  1VQN A;  5FRN A;  1H64 1;  2MMP A;  2WAC A;  2JN0 A;  4UC4 A;  2D9T A;  4M7A E;  4PKC C;  1VQO T;  3RKX A;  3OYM A;  3C12 A;  4A4H A;  2RK2 A;  1YJW A;  4B9W A;  5M9O A;  3JB9 F;  4JS5 A;  3QJY A;  3CC4 T;  2EJF A;  5GAN 4;  1UGR B;  1WJR A;  3C95 A;  1VQ5 T;  2PUO B;  3EFS A;  2X35 A;  2E6Z A;  4M77 B;  5CKH A;  4QW2 A;  4B9X A;  4C0G A;  1KC8 U;  3NTI A;  1VQ5 A;  4JDS A;  2XI9 A;  4N4I A;  4M7A G;  1FWZ A;  4LD6 A;  3CMA A;  4OVA A;  3L42 A;  5KCO A;  3OW2 S;  3JCM P;  3E19 A;  4PJO G;  4M78 E;  2E5Q A;  1M1K U;  5LJ3 j;  2MWO A;  3WXM B;  2A7Y A;  2D0Q B;  3CCJ A;  3G4S A;  4KBM B;  2E10 A;  3RMS A;  2DTH A;  1KQ1 A;  5A2Q E;  2X4J A;  3DB3 A;  4LDV A;  3RIR A;  1YIT T;  3SWN A;  1YBY A;  2E41 A;  5GAM e;  1N9R A;  1WJQ A;  5GAM g;  4GY5 A;  1MHN A;  2V8J A;  1KD1 C;  1NZ9 A;  4J5Y A;  3JCM h;  4XU3 A;  3LWI A;  1XTD A;  3CC2 A;  3QII A;  4E7I A;  3GLX A;  2XU8 A;  2R58 A;  3OYE A;  5D6Y A;  5LJ3 d;  2XID A;  1M9S A;  4MZP A;  4IKF A;  2KQW A;  3QHS A;  4N4G A;  1Y7X A;  1I5L A;  4FSX A;  1D3B B;  3CC2 T;  2MWP A;  3QKJ A;  1VQ4 T;  3A5Z B;  1ZQ1 A;  2EJG A;  4CRI A;  4HCZ A;  2K57 A;  5LL6 S;  3OA6 A;  3RUX A;  1H3Z A;  3DLM A;  3OMG A;  4R55 A;  3E9G A;  4BY6 B;  2LT4 A;  3LGL A;  1VIE A;  5LJ5 h;  4J6W A;  3JCM g;  1VQ4 A;  4X9C A;  1QVF S;  4IUQ A;  4FL6 A;  4MZM A;  4M7A C;  3CCS T;  2YLC A;  3V8L A;  1M1F A;  4J6Y A;  4M75 E;  4BI4 A;  1M5Q 1;  1TH7 A;  5J26 A;  3SWN B;  5GAO n;  2M9U A;  3CD6 A;  4LDY A;  3UPU A;  1K8A C;  3MEV A;  2QQA A;  1OI1 A;  3CD6 T;  5HK3 A;  2DK3 A;  1VQO A;  2WSF E;  3JB9 G;  5J3B A;  1M8V A;  3TCJ A;  1KQS A;  2CS7 A;  3VJP A;  4M7A B;  1YHQ T;  3OYA A;  1LJO A;  4E47 A;  3C4S A;  1YJN A;  1JJ2 A;  5LJ5 e;  4HKE A;  1BKB A;  3S3N A;  3O8V A;  2FB7 A;  4LDX A;  5CQY A;  2MAM A;  3HPW A;  4M78 G;  3M55 A;  4A54 A;  3BY7 A;  2DZC A;  3V8J A;  3JCM b;  5GAM d;  2VGM A;  2EJ9 A;  2EFI A;  1VQ6 A;  3CCU T;  1IRE B;  2ZZD A;  3PIP A;  1WGS A;  2L5Q A;  2P0P A;  2V8I A;  3URG A;  2LCC A;  2QQB A;  3OBW A;  4M75 C;  1GXI E;  5LJ3 e;  2RH2 A;  1N6A A;  5L8R E;  3FJP A;  4RCC A;  5CCA A;  2CZ7 B;  3MCA B;  2MI6 A;  3G7Z A;  2DIG A;  2QQ9 A;  4Z02 A;  2YRV A;  5GAO p;  1Q81 U;  4OGC A;  3E9F A;  1VQM A;  4XU2 A;  5EG2 A;  4M7A A;  2EYQ A;  3HHT B;  1YHQ A;  4C5E A;  3MO8 A;  3GOX A;  1VQ7 T;  2VC8 A;  5GMK h;  3OSV A;  2CZ6 B;  2HQX A;  3ASK A;  3INZ A;  4BI3 A;  2EQJ A;  3HRU A;  3OS0 A;  3L2R A;  1K9M U;  5DY9 A;  2EQU A;  3SFM A;  1B34 B;  3MEA A;  2DD4 A;  4A4G A;  5LJ5 g;  1NE8 A;  1VQK T;  3OS5 A;  5FRM A;  2XHC A;  4M77 A;  3RMQ A;  4ZGD B;  4O5V A;  5GMK l;  3VU3 C;  2E64 A;  4J6X A;  5GAN f;  4VUB A;  3RKY A;  5GAN 6;  3P8H A;  1G3T A;  4ZN1 A;  4OB0 B;  2OTJ A;  5FRO A;  5D6X A;  5FLX E;  3CCL A;  2GFA A;  2RHU A;  3X26 B;  4X34 A;  3V7R A;  4KUD K;  1QVF A;  2Y4X A;  5KH6 A;  1Q86 U;  1N8R C;  3OBY A;  3ZFJ A;  4RG2 A;  2QQS A;  1Y07 A;  4OMF B;  4EMG A;  2YHT A;  4QQ6 A;  2LQK A;  3JCM e;  5HKC A;  1RI0 A;  3F70 A;  3GIB A;  3A8M B;  2HQE A;  2K4Y A;  1IZ6 A;  4BUG A;  1I81 A;  2PQW A;  3JCM V;  3JRZ A;  3QO3 A;  4XK8 E;  5GAN 8;  3G4S T;  4M75 F;  3NTK A;  2DVE A;  4C92 A;  4FT2 A;  5GAN 7;  2WSC E;  4M78 B;  1O9S A;  1UGS B;  2DXC A;  5IAY A;  1G5V A;  3M5A A;  2LVM A;  4C5I A;  3I55 A;  3OYY A;  3G6E A;  2HAX A;  3T9N A;  2KSS A;  2QDY B;  2K3Y A;  3V7S A;  2Y4Y A;  1FX7 A;  2RB6 A;  3ZBD A;  3CCJ T;  1D3B A;  2ZPB B;  2VUB A;  1YJ9 A;  1KHC A;  2A3L A;  3I55 T;  3HFO A;  3PIO A;  4M78 A;  3ME9 A;  4N0A C;  2K5I A;  2XDD A;  5GAN j;  3QBY A;  3CPF A;  5FU6 C;  3ZEH A;  4EMK B;  3OYI A;  5GAN 5;  3KXT A;  3CCM T;  2RI3 A;  1QP2 A;  1XQH A;  2QQR A;  2K2V A;  1PSF A;  3P8B B;  3JCM W;  1U1T A;  4NL2 A;  2ZPG B;  5CKB A;  3SD4 A;  4J83 A;  1U8R A;  5IT9 E;  3QJ6 A;  1VQ7 A;  3BDL A;  3CPW A;  3OS2 A;  1B34 A;  1BIB A;  3FEO A;  1LOJ A;  1JRI A;  4MML A;  5CKF A;  2FL7 A;  1KC8 C;  3H6Z A;  4HA8 A;  2KMT A;  3JB9 I;  4QVD A;  3QSU A;  1M90 C;  1VQL T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...