3G71Q

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3g71Q00
3G6EQ 3I55Q 1K9MR 2QEXQ 1VQMQ 1W2BP 3CCEQ 1VQ7Q 3CXCP 3CPWP 3CC2Q 1VQ9Q 1Q81R 3CC7Q 3CCUQ 1YJWQ 1YHQQ 3G71Q 1QVFP 3CD6Q 3G4SQ 1YIJQ 1YITQ 1KC8R 1JJ2P 1YI2Q 1VQPQ 1VQ4Q 1VQKQ 1KQSP 1NJIR 1KD1R 1Q86R 1VQOQ 1VQ5Q 3CMEQ 3CCMQ 3CC4Q 1VQ8Q 2OTLQ 1S72Q 3CCRQ 1VQ6Q 3CCJQ 1QVGP 1VQLQ 1K8AR 3CCLQ 3CMAQ 3OW2P 1YJNQ 1N8RR 3CCQQ 3I56Q 2QA4Q 2OTJQ 1VQNQ 1K73R 1Q7YR 1M1KR 3CCSQ 1YJ9Q 1M90R 1Q82R 3CCVQ
chains in the Genus database with same CATH superfamily
1U1TA 2F2WA 3OYJA 2E1HA 2HQEA 2VV5A 3CC2Q 5GANe 3FIFA 2DRKA 4RTZA 3CBMA 1KD1R 3CCMT 2K79A 1OEBA 3G7ZA 4MDXA 5CKEA 3DB4A 3META 1OPLA 2JVVA 2CREA 2WACA 4RTVA 3E19A 2CSIA 4PKCC 1K4US 2XKOC 4M7DF 3LGLA 1PG5B 3RIRA 1AEYA 2O9SA 2RQVA 4J9HA 3CCUQ 3RERA 3FJ5A 2LDMA 3A8LB 1GCQC 1S72Q 4RCCA 3CCLT 5KE3A 4ZGDB 3EGXB 5GAMh 4A4KA 3NGPA 5LL6S 1GFCA 4EMKC 4N4IA 2RJEA 1VQ7T 4ZGJB 1NJIU 1WGSA 4JRIA 3G4ST 4XTZA 2KYMA 4E7HA 2RI3A 4E7IA 2DYIA 1H92A 2D1XA 1WHKA 3LGFA 2ABLA 2RQTA 4HXJA 3UA7A 2MIOA 2HBPA 4DEXA 5LJ3h 2EYYA 3OS2A 3OW2P 2QTVA 3EFRA 1BKBA 4OGEA 3QUIA 4A4HA 1F1BB 1NE8A 2MK5A 1NLOC 5KYUB 1G3TA 2YUOA 3E2UA 4FU6A 2D8HA 1WX6A 2DIGA 1WPYA 3N5BB 2HNIA 4AMCA 4PJOD 2HBWA 1FXXA 1WQWA 4FCYA 4HVUA 1S1NA 1HXDA 1FMWA 2B86A 2BZYA 3JCMJ 2DTHA 1KC8U 1IZ6A 4XQ3A 5ECAA 4E47A 4JS5A 2CUDA 5IHIA 4J8OA 5I21A 1QQJA 2KDSA 2O31A 1WDXA 2QA4A 5GMKj 4XTVA 4IUUA 1BI2A 1OU9A 4F04B 1ZHIA 1K0XA 3OYKA 4ELYC 2P84A 1R0BG 4DBQA 4KRTA 3INZA 1T0JA 3HRUA 4R55A 4M7DE 3OBWA 3CCET 1AWXA 2CDTA 4OMFB 4L6V5 3OSVA 3VS7A 1YITT 3FJPA 3V7CA 4J6XA 3RBBB 2EQJA 2I2LA 4O5VA 1I07A 1YFNA 2YRVA 2DEUA 2IIMA 1OULA 2KY9A 1MHNA 1W2BS 2R58A 5KYXB 2V8IA 4M77A 2EVRA 3OYEA 3EH2A 2MAMA 3VU3C 1G3YA 1YWOA 2EYXA 5IXFA 2DYBA 1TXQA 2DFUA 2YT6A 5LJ3d 4LDWA 2OTJA 2DKGA 1M2VA 1VQ8Q 3DKMA 3ULRB 2QASA 2LCSA 2DXUA 5GAN3 1IRXA 2P0QA 3CCVT 2LJ3A 1X6OA 3NTIA 1X43A 2RD1A 1IO6A 1RAEB 3LH0A 2XK0A 1ZSZA 2KK4A 2L3QA 2QDYB 1WZOA 4GLKA 5GAOr 1BI0A 1VQ5T 1VQKT 1BCOA 4C8QB 4FSSA 1AOJA 3CCRT 1PNJA 3CCJQ 4PJLA 1BBZA 4JS4A 3OMGA 4XAXB 1WI7A 3A98A 3JCMg 2DJQA 1B3QA 5LJ3e 2DD5A 3OYDA 1M5Q1 2K3YA 1NJIC 2LMJA 1W1FA 3LH5A 2AT1B 1T3LA 3QZ9B 3BE3A 2ZPEB 2ECZA 5KE2A 3GIBA 2Y4YA 4DBFA 4DBHA 1M90C 5FWCA 1Q81U 3PMTA 4J6WA 3GOXA 5GAN5 1QCNA 4Q5WA 1UJYA 3QDRB 1I4K1 3H0HA 2KXDA 5FU7B 2HEQA 2V1QA 2G3RA 3UA6A 5IHNA 2LRQA 4C0ZA 3EG3A 3J81E 1N5ZA 1Y07A 3QO3A 4J9IA 5I2SA 1JB0E 1MV0B 1M1KC 2O88A 2QA4Q 1KJWA 2CZ0B 3M53A 4M4ZA 1IHVA 1W2BP 4HCZA 2BTTA 4B9WA 5CO7A 1UGRB 2YUQA 4OMPA 4KUIA 2JM9A 2OTLT 2DJZA 4X9CA 1AWOA 2K2VA 5FW9A 4IUPA 3JCMX 4Y28E 4FYYB 1BK2A 3JB9H 4NS5A 1UG1A 3CCMA 1KQSS 2XG8D 5IN1A 1U5SA 4J83A 5C6SA 1XTDA 4KGXB 3TSWA 3O5ZA 3CCQA 3I56A 4ZGEB 4OF1A 3M5AA 1YJ9A 4C8QC 1PCXA 2E10A 4HT9A 1KG1A 1YHQA 3VYGA 3EG2A 3HPWA 1YJWA 1VQNT 1WJRA 4FT4A 2YRCA 4FYVB 2K5FA 1M90R 2RJFA 3KXTA 1YCYA 4LUDA 3HSBA 1QVFA 4OGCA 1ZSZB 4N0AC 1SKUB 4LUEA 4E7KA 1EFNA 4WCIA 3A8GB 3L2UA 2H8HA 3VUBA 3I35A 2K2MA 2DE0X 4M77D 3PFSA 1X2KA 2W0ZA 5FWBA 3SFMA 3CBOA 3G4SA 5D6WA 1M1KR 1GRIA 4C8QG 5FU7C 2YLBA 1BB9A 1SG5A 4C8QF 1GBQA 2HKNA 5J3BA 2ATCB 5CKHA 5GAMj 3L1AA 1KHIA 2ZPBB 1X27A 1X2QA 2EW3A 2DL4A 2JUFA 2RMOA 3RNJA 1VIEA 2RHZA 2L5QA 2DTOA 1VIFA 2E65A 2XU8A 4RTUA 1WYXA 2BZ8A 2J6FA 1UHFA 1OZ3A 2PVOB 3X24B 1OOTA 1SSFA 2QEXA 3C94A 1U3OA 5D7UA 4RTWA 3G71A 4J9EA 4LDUA 4M78C 2J6KA 2KQWA 2MYSA 3QYGB 2VYTA 1MMAA 5LJ5h 2I0NA 1XNIA 4ZTJA 2L8DA 4BDZA 2VC8A 1KQSP 3IQLA 2BE9B 1U8RA 2BIVA 4OMLA 4DA4A 3S3OA 5DY9A 3ER0A 3MEAA 3CC2A 3J7AF 3OYMA 3OYNA 4IUVA 2DTIA 1AVZC 1M8MA 1YIJA 1YITA 3OYCA 2QQ9A 2O9VA 4LDVA 1J3TA 2KXCA 4PLLA 1QVFP 4M7AB 3DB3A 2VB6A 3CQTA 3JSCA 4M78G 3QJYA 3CCMQ 1XQHA 2EJGA 4BE2A 2J7IA 3I9QA 2NUZA 4M78F 2RHXA 1QMCA 3D7SB 3MPUB 1SHFA 3QG1A 2JTMA 2LJ1A 2EQKA 3PNWC 1YHQQ 2FYKA 4C8QE 1LPLA 2DMOA 3CMET 3CCSA 3QXEB 3LYIA 2YDLA 2QQRA 3WVDB 3CCLQ 1N8RC 4PJOA 1RAGB 1JBMA 1NBEB 2DA9A 3ASKA 4N4HA 1PKSA 3NHNA 2E12A 2LCLA 4NL2A 3X25B 4IUQA 1VQ7Q 2KR3A 1OX9A 4XTYA 3CD6T 2CP0A 3HKSA 3G4SQ 5KCHA 1AT1B 5IAYA 2PTKA 2LP5A 4JUVA 2KI7A 5LJ5f 2KRMA 2LZ6B 5HCKA 1N9SA 2E6ZA 1QP2A 3OYFA 1SPKA 4OB1B 3MHXA 5CK9A 5HK3A 5CR2A 1VQ9T 2D0QB 4F17A 5KCOA 1WNLA 2HSPA 2EGCA 4FL6A 5GANf 1KIKA 3NTHA 2YUPA 1W6XA 1X6GA 2Z0WA 2RN8A 1NZ9A 1QVPA 1VQ6T 2XMFA 2CZ1B 4B9XA 2YUNA 3J80E 1TUDA 2ZGWA 1N6AA 4JJNK 4JRKA 4O6JA 4HVVA 1KQ1A 4PFOA 3RKXA 1QWEA 2WSFE 4RKUE 2QEXQ 1DJ7B 2V1RA 2CP5A 2RH2A 4A63B 2HL5C 4LNPA 3JCMd 4P5NA 4ME7A 1VQ4T 4M7AC 1WHMA 5CIUA 4CC3A 3EHQA 2IVWA 4M78E 2RNAA 4RCBA 2FZGB 1YJNT 2DNUA 8AT1B 1N8RR 1PD0A 3RDVA 3M0UA 1UGVA 3CCEQ 2MF2A 1UGPB 4J7FA 3PVLA 2CP2A 3O8VA 3OYGA 1YIJQ 2K5IA 2R5MA 1YITQ 4NL3A 2AKLA 1D0XA 5GAN7 3FRNA 2KMTA 4J9DA 5D6YA 2DEQA 3CC7A 4M7DG 2JTEA 3A5ZB 4QVDA 4M7AG 2C0OA 2J6OA 3ME9A 2YHTA 1VQ8A 2DLPA 2RM4A 2MWPA 2PNIA 4PJNA 4MZPA 4M7AF 1O9SA 4JJBA 1P92A 1VQNA 4DOVA 3QDFA 3E9FA 2F1LA 4C92A 3NTKA 3SWNA 2X35A 1Q82U 3UWNA 5CKDA 4PJOB 2Y4XA 3OYAA 4F7UB 1M30A 3RR6A 4QQ6A 1JRIA 3CCSQ 2KNBB 3SEMA 1YN8A 5KYNA 2GFAA 1AD5A 4GBQA 2A0FB 2EAYA 3CCJA 1B34A 4MMKA 2BUDA 1VQKQ 2L89A 4MMLA 4BY6B 5GMKm 2C0TA 3CCRQ 2M0YA 2GNCA 5CQYA 3M0QA 1VYUA 4XU1A 4BDYA 3VS2A 2EIFA 2DBMA 3T9NA 3H8ZA 4PFPA 3JRZA 1D3BA 1AZEA 2DVJA 3A8OB 2P0KA 2ZPHB 3SHWA 2WSEE 2MPXC 3FC3A 2P4TA 2PUOB 4J9FA 1VQLT 5GJWB 1SRLA 2CT4A 3V8KA 3JV3A 1I1JA 4RMOA 5DM7R 4HA8A 1TOVA 3CC4A 1IGUA 3EGDB 1V1CA 2EKOA 1U06A 2DXCA 1VQPT 1R0CB 2CP6A 3AT1B 3OBYA 4Z02A 2VUBA 1K73U 1Q7YU 1SF9A 2CYZB 2GF7A 2F5KA 4LN2A 2D8JA 2KRSA 2O4XB 4Z8AA 3RMSA 1I5OB 2OAUA 1CKBA 2MCNA 4AFSC 3A8HB 4M7AE 2YXYA 2JW4A 5GAMf 3L2WA 2J06A 1TS9A 2E5QA 1RACB 3GBQA 3OQ5A 2YRDA 3OS0A 3CBPA 2RK2A 3CEYA 2RJCA 1G8XA 1N27A 4UC4A 4PJOC 4EDUA 5CKBA 4C0DB 3I55T 1W2BA 5LJ5j 4Z88A 4KH0B 3VS4A 5LJ3f 1OX8A 2RPNA 4JPBW 3CC7Q 3VJPA 2GQIA 1ZA1B 2COYA 4IURA 5GAN6 1RLQC 4C92B 4BY6C 1RAHB 3SWNB 4E7JA 1PSEA 5GANj 2CH4W 3P8BB 1VQNQ 3AHUA 1OV3A 2DF6A 2V8JA 1ZA2B 3CCUT 2IPOB 4OMOA 4KULA 1NPRA 1X69A 1K8AU 2QAZA 4F7UG 3P8DA 4XTWA 2QI2A 1VQOT 1CSKA 1XJWB 1M1GA 4BACA 1K9MU 4PJOF 4F7UF 1KK7A 1V29B 1Q82C 4PFZA 5GANg 3HRTA 2RI5A 2B8AA 3TREA 1D3BB 3REBB 1NLPC 3M0RA 3GNGA 4C92D 3G1JA 2LX7A 2FPFA 1M8VA 5IHKA 3CMAT 1RAFB 2K4YA 2O2OA 1FMKA 1VQ9A 4AG1C 1UGSB 4HCKA 3VS1A 5FRMA 3X28B 4WTOB 1R77A 1GL5A 1WHLA 4PJJA 1WHHA 4C0GA 4DOWA 3M56A 4BE0A 1YI2T 1WQ7A 1G3SA 4KBMB 3VS6A 1UB4A 4IKFA 5FROA 2K6DA 4OMMA 3CC4Q 4DBRA 4X34A 2NUPA 4GY5A 2M9UA 3PT9A 4JDSA 2DILA 1MV3A 1NM7A 3QJ6A 4FW1A 1RL2A 3BFMA 2BE7D 4C0DC 4C5GA 2LNVA 5CAIA 5L23A 2V8KA 4PL6A 3PIOA 2L3PA 3MP6A 1KC8C 4M75D 1UE9A 3HFOA 1YJNA 2YSQA 2EYZA 4Z89A 1IHWA 4JZ4A 2CZ6B 2HMAA 1K73C 2FZKB 2LCCA 3VS3A 1Q7YC 1TUGB 4A53A 4C5EA 3QBYA 1Q82R 4M77B 1QKWA 4EIKA 4QT7A 1EIFA 1JU5C 4MZTA 2M16A 3MKDA 2P0PA 2XHCA 2EJFA 1UUEA 1QVGS 3BDUA 1KQSA 1NJIR 4VUBA 1QVGA 4PJOE 1M2VB 4A4EA 1M3BA 4F7UE 2GBQA 2H3JA 2D0NA 4AFQC 2DETA 1FYNA 1MMDA 1PKTA 4DEYA 2AKKA 1M9SA 1QCOA 2AK5A 1RAAB 2RI2A 3CCLA 1HK9A 1LVKA 2XDDA 2HCKA 4AFZC 2BKDN 1NEGA 1UDLA 1WLPB 1VQ7A 3S3NA 2RF0A 2X4JA 4JLIA 5AYFA 2K9GA 4CI0C 1TWBA 4E7LA 1ZLMA 3QHSA 1KD1U 1E7OA 4D8KA 2RQRA 3CD6Q 1KC8R 2NWMA 2X4YA 4OB2B 1VA7A 3JCMb 3EG9A 1K8AC 1D0YA 2DL8A 2EQIA 1K9AA 3VRZA 2OI3A 2XIDA 5GAN2 1GXIE 1B07A 2K7AA 5J26A 3VKIA 1H8KA 1K73R 1Q7YR 1K76A 3OYHA 3TVTA 1VQMT 2VVKA 1KFZA 4D6WA 1X01A 3OYLA 1VQ9Q 1OI1A 3RKYA 3WVEB 1JO8A 3JCMP 2RJDA 2L2PA 1WIEA 1GCQA 3FB9A 1G5VA 1A0NB 1VQ6Q 2HL3A 2JMAA 2KBTA 2FG0A 2DK3A 2RA2A 5LJ3j 2NUPB 8ATCB 4EMKA 3EFSA 4OMQA 3VS5A 5C0MA 3QPHA 3S6WA 1VQPA 2GTOA 5GAMg 5GAOp 5DLQE 3VV0A 4RTTA 1OQKA 3MP8A 5KYWA 1Q81C 4M77C 2X9HA 1IREB 3LLRA 1PRMC 2ZPIB 1VQ4Q 4HT8A 2EJ9A 4EPCA 2E41A 1QVGP 3CCEA 5FU6B 3JCMQ 2QA4T 1WA7A 4KGZB 1YJNQ 2DD4A 5LJ3g 2HAXA 2GGRA 2CUBA 1YBYA 2FB7A 4B6MA 3HHTB 1LJOA 2G6FX 3VRYA 2DXBA 5IXBA 4OMNA 4EMHA 1ZSZC 1OZ2A 3C12A 4GLMA 2RQWA 1R8OB 2F69A 2X3WD 4OP0A 4XTXA 4HVWA 1C6VX 4M77G 3L2RA 4ZN3A 2E4HA 2F2VA 2RK1A 3JB9G 3JCMh 1ZBXA 2K3BA 1T3SA 2DZCA 4M77F 4II1A 3G6ET 2KSSA 3RKWA 3JB9F 4ELZC 1PRLC 1TUCA 3QSUA 1H641 3JCMc 2DPPB 1TTHB 4J9GA 7AT1B 3CCVA 2AZVA 4A4GA 2DL3A 3NFCA 2MWOA 1FWZA 2DRMA 2R57A 5GAOq 4JRPA 2QYZA 1I5LA 2OTJT 4LXCA 3OS1A 5FLXE 1VQ5A 1VQKA 1VQOA 1KHCA 2EWNA 4FYWB 5A0DA 1AWWA 3CCRA 2X4XA 2K3XA 1Q81R 2DO3A 5A0GA 1T0HA 3C0CA 3ZBDA 4KT0E 1QCFA 2VXFA 3EG9B 4DQ2A 4V2SA 1UECA 3EGXA 1LOJA 4PNOA 4IIMA 2XICA 1QKXA 1NG2A 4ZTFA 2JTFA 4LDYA 2DIQA 4RG2A 4M7DD 1SRMA 4R0KA 2OJ2A 2L0AA 2LJ0A 2LX9A 2DERA 3P8HA 1ZUYA 5M9OA 2VXEA 3CMAA 2JJ9A 2EKHA 2ENMA 4AFUC 4QQGA 1RUWA 2FPDA 1TSFA 1YWPA 2QK0A 5L8RE 4KGVB 1VQLQ 5A2QE 1NPPA 5GMKe 1WJSA 2FO0A 1E6HA 2VKNA 1K1ZA 1NYGA 2EGAA 5KYWB 3S3MA 2CH4A 2M02A 1JXMA 3H41A 2ED0A 1YCSB 1HD3A 2HD0A 3EFOA 1VQPQ 3OW2S 1W70A 1BU1A 3URGA 1RAIB 4M77E 1WHGA 2VASA 5I22A 4FSXA 2VGMA 3DLLA 5DLOA 2OTLA 4LE9A 1WXTA 3ZEHA 2RHUA 9ATCB 2EQMA 3KFVA 4OB3B 1XOVA 1FX7A 4YTLA 3OB9A 1G3WA 2JOYA 3OYBA 1MNEA 2PQWA 1D0ZA 3THKA 3JB9J 3RMQA 1TU0B 2M0OA 3H0IA 2QXFA 3M59A 1ZSGA 3I55Q 2KE9A 2J05A 3SB2A 3CPFA 3JCMe 2OX7A 2WSCE 1ARKA 3E1SA 3OYYA 4E2FB 3HRSA 4ATOA 2LQKA 1H3ZA 2JT4A 2QQBA 2M1HA 5KYXA 3BDLA 3CCQT 2QTXA 1WXBA 5IH2A 3U23A 1VOMA 3I56T 1ZX6A 5KYYA 1YJ9T 5I2MA 4NOYA 3CCVQ 4JJDA 4C5IA 3MEUA 1YHQT 4E6RA 1YJWT 2V26A 1I8FA 1VYVA 1Y57A 1K0SA 2LNHB 2A08A 2PVGB 2AZSA 2RQUA 1VQ5Q 1C0MA 1VQOQ 1Y0MA 4HCCA 2HSEB 3QZ5B 4FIBA 3OMCA 3SDZA 1RABB 3X26B 1N9RA 3CPWS 4QKUA 2D6FA 3CPWA 1JJ2S 2CSQA 2E70A 3LX7A 2R5AA 3EAEA 1Y7XA 1JJ2A 2A36A 3NPFA 4C8QA 2DVEA 3LW5E 4M75A 1BYMA 1VQMA 4LD9K 1M90U 3UPUA 2DZ9A 5GAOm 3CMAQ 2E64A 3TCJA 2E3HA 4XTUA 2DBKA 4HKEA 1OPKA 2QGGA 2GQVA 4N0AA 6AT1B 4ZN1A 2DXTA 2KVQG 1EX4A 2JM8A 2DL7A 1BI3A 2JMCA 3MEVA 1YI2Q 3EFOB 2RHYA 3M0TA 4K11A 5D6XA 3F70A 1D1AA 4LDXA 3UATA 5CCAA 1M1KU 2A37A 4FM4B 4IIOA 2DX1A 3UDCA 2JS0A 5EG2A 3H0FA 4AG2C 1RLPC 1SEMA 2QEXT 2A7YA 2A3LA 2CP3A 4Y92A 3A8MB 2EYWA 3M55A 3G71T 4F14A 4R56A 3M4GA 3PE0A 4EMGA 3GF5A 2OTLQ 1D1BA 1H3HA 3QYHB 4WF2A 2AHJB 3CXCS 3SD4A 3CXCA 3KBGA 3CC2T 3OY9A 1TH7A 1YIJT 2GCXA 2ZPGB 5GAMd 1C1AA 3V8LA 2DL5A 1HSQA 5GJVB 1WXUA 3G6EA 3X20B 4MZMA 1AWJA 1BIBA 3JCMV 4BUGA 4M78A 3M4YA 3MO8A 4Y91A 4D8DA 2COZA 3V8JA 4J7IA 3M0PA 5KYYB 1TG0A 3PVQA 3JAME 1OYXA 1I0CA 3CMEA 2BZXA 2ZZDA 3CPWP 1B34B 1D1CA 5CVIA 5LJ5g 4MDWA 1JJ2P 4PJOG 5HY6A 2P4RA 4E7SA 1M2OA 1S72T 3VS0A 3M58A 3L2ZA 3EH1A 1V76A 1MMNA 4A4FA 2RO0A 3CD6A 3CCST 5GAMe 1EZZB 4J6YA 2VWFA 1PWTA 1PHTA 4N4GA 1MUZA 4M75B 2QDLA 2PUKB 2FVUA 1M4ZA 3E9GA 4C0FA 3PIPA 2FL7A 2KYBA 2LQ8A 2X4WA 2RHIA 1VQMQ 4CC7A 2YLCA 1VQ6A 4QVZA 2EQUA 1SHGA 1UTIA 2E3IA 3TQ7P 1ZUKA 2EYQA 1ZUUA 2FPEA 3C95A 5GAN4 5IT9E 3LWIA 2C06A 1Y71A 1VQ4A 4RG8A 1KSWA 3CXCP 2QGFB 1HJDA 3JB9I 3L2QA 1Q86U 4C8QD 2L3SA 4CC4B 2MOXA 3V7SA 3HP9A 1LNXA 1PC0A 2KRNA 1ZQ1A 4X1VA 1FMVA 4C92C 3HL8A 3SWNC 3M9QA 4ZNXA 3GPLA 3KUFA 4JLGA 2NUTA 3L2VA 1UFFA 2W10A 1JEGA 4AT1B 2F2XA 4KUDK 2M51A 3M57A 4FW2A 5FRNA 1E6GA 4J9CA 2EBPA 2LVMA 4M78B 2ROLA 4RTXA 3QWXX 3VYHB 3MJXA 2COWA 2K5LA 1GBRA 3PTAA 1MGQA 4QVCA 1X6BA 1PD1A 4J5YA 4BI8B 3G6EQ 4M7DA 3EG0A 3CC7T 1O75A 4M7AA 1ACMB 2CZ7B 4C92G 3ZL7C 3R6NA 1BCMA 1M3CA 1N8RU 5GAOn 1VQ8T 2QG9B 3CMEQ 3EGUA 1OU8A 4M75C 4C92F 4E7ZA 2DM1A 4JZ3A 2OTJQ 4QQDA 2VGNA 1QVFS 1UJ0A 4XU0A 4ANJA 2RB6A 3BY7A 4BD3A 3C4SA 3H9NA 2CT3A 5HK0A 1RADB 3HTRA 1U1SA 1BIAA 2A28A 1SSHA 1Z9ZA 2KT8A 2CKKA 4M78D 2JNGA 3CCJT 4L5GA 1YNZA 2IG0A 4LD6A 1Z9QA 4L59A 3JB9D 3FEOA 5J39A 1K9MC 4XK8E 3OSSC 2LTOA 1BI1A 1IB8A 1JQQA 1M3AA 1X75C 4M75G 1M27C 1VQLA 2FRYA 4M75F 5GMKh 1JXOA 2FEIA 2CGHA 1YP5A 2JZ2A 2AIRB 3MEWA 4F16A 1RI0A 2K57A 1AZGB 2OAWA 2XI9A 2EPDA 4FT2A 3REAB 4BI3A 2KAFA 2LT4A 1NEBA 3MP1A 3A1PA 2NLUA 2L3RA 3L42A 3VUZA 5GMKi 3CC4T 2FHDA 2LC4A 4JRQA 1Y96A 4ORZA 2O01E 1Q95G 3QKJA 1M1FA 2ROTA 3GLXA 2PZ1A 4JJCA 1IGQA 4PJMA 2SRCA 3RESA 2NUTB 3LWHA 4XU3A 2CP7A 3ZFJA 2YWWA 5A0LA 1Q86C 1RI9A 1AHJB 5AT1B 4C92E 2X51A 1ZBJA 3FLGA 3I55A 1K8AR 2EFIA 1ABQA 2EGEA 5I11A 1CKAA 3I5RA 2KEAA 4HCBA 5GANh 3BW1A 2QQAA 1K9MR 1HYOA 1UGQB 3PGGA 4RTYA 4M7DB 2KROA 3R6OA 2F5TX 4KH1B 3M0SA 4XU2A 2DAQA 1MMGA 3GP8A 2LQWA 1WFWA 3MCAB 2Y90A 3CCUA 2XDBA 3CCQQ 3I56Q 1GFDA 2C0IA 1QP3A 1YJ9Q 5GAN8 1G83A 1S72A 1D09B 2E5KA 2JXBA 2MMPA 3EHRA 3WXMB 1YJWQ 2JS2A 3FDRA 1ABOA 3QWYA 2MI6A 4M75E 3UT1A 1I81A 2X3XD 5GMKl 1UHCA 2FRWA 2FZCB 4BI4A 2ZCFB 3QIIA 4F7UA 4A54A 4QW2A 3JCMW 1NYFA 4FYXB 1QW1A 4M7AD 2HQXA 2JN0A 4OB0B 1VYTA 3TEEA 1KD1C 2SEMA 3HFNA 1Q86R 3TU4K 5GAOl 1QWFA 3TSZA 2E6NA 3EG1A 4IUTA 2CS7A 5CQXA 2GFUA 5KH6A 4PK4A 5LJ5d 2ESWA 3OS5A 5FU6C 2D9TA 4EMKB 1GCPA 2HDAA 1YI2A 1VUBA 5KYUA 1PSFA 2PVDB 1PM3A 3I5SA 2PU9B 2XDPA 1MNDA 2GTJA 2HKQB 1UEBA 3JCMf 3OYIA 4CRIA 2H3EB 2ZAEA 4TVRA 2KT1A 1WHJA 5GANd 4RUGA 3M54A 4ESRA 2XD0A 3OW2A 1Y96B 4BB7A 1WJQA 3RUXA 1LCKA 3PMIA 3NMZC 2LT1A 5EC7A 1G2BA 2ZPFB 3V7RA 3EGDA 2ED1A 2HQHA 2LQNA 3Q1JA 5CKFA 4M7DC 2KGTA 3G71Q 3DLMA 4BE1A 4C5HA 2HZYA 1B7TA 2NYSA 4OVAA 1W4SA 5LJ5e 1KQ2A 4PLIA 4J9BA 2O4XA 4CC2A 3H6ZA 3UF4A 3GNFB 4X9DA 1QLYA 2QQSA 1IXDA 5HKCA 3OA6A
chains in the Genus database with same CATH topology
3G6EQ 3I55Q 1K9MR 2QEXQ 1VQMQ 1W2BP 3CCEQ 1VQ7Q 3CXCP 3CPWP 3CC2Q 1VQ9Q 1Q81R 3CC7Q 3CCUQ 1YJWQ 1YHQQ 3G71Q 1QVFP 3CD6Q 3G4SQ 1YIJQ 1YITQ 1KC8R 1JJ2P 1YI2Q 1VQPQ 1VQ4Q 1VQKQ 1KQSP 1NJIR 1KD1R 1Q86R 1VQOQ 1VQ5Q 3CMEQ 3CCMQ 3CC4Q 1VQ8Q 2OTLQ 1S72Q 3CCRQ 1VQ6Q 3CCJQ 1QVGP 1VQLQ 1K8AR 3CCLQ 3CMAQ 3OW2P 1YJNQ 1N8RR 3CCQQ 3I56Q 2QA4Q 2OTJQ 1VQNQ 1K73R 1Q7YR 1M1KR 3CCSQ 1YJ9Q 1M90R 1Q82R 3CCVQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E Q;  3I55 Q;  1K9M R;  2QEX Q;  1VQM Q;  1W2B P;  3CCE Q;  1VQ7 Q;  3CXC P;  3CPW P;  3CC2 Q;  1VQ9 Q;  1Q81 R;  3CC7 Q;  3CCU Q;  1YJW Q;  1YHQ Q;  3G71 Q;  1QVF P;  3CD6 Q;  3G4S Q;  1YIJ Q;  1YIT Q;  1KC8 R;  1JJ2 P;  1YI2 Q;  1VQP Q;  1VQ4 Q;  1VQK Q;  1KQS P;  1NJI R;  1KD1 R;  1Q86 R;  1VQO Q;  1VQ5 Q;  3CME Q;  3CCM Q;  3CC4 Q;  1VQ8 Q;  2OTL Q;  1S72 Q;  3CCR Q;  1VQ6 Q;  3CCJ Q;  1QVG P;  1VQL Q;  1K8A R;  3CCL Q;  3CMA Q;  3OW2 P;  1YJN Q;  1N8R R;  3CCQ Q;  3I56 Q;  2QA4 Q;  2OTJ Q;  1VQN Q;  1K73 R;  1Q7Y R;  1M1K R;  3CCS Q;  1YJ9 Q;  1M90 R;  1Q82 R;  3CCV Q; 
#chains in the Genus database with same CATH topology
 1U1T A;  2F2W A;  3OYJ A;  2E1H A;  2HQE A;  2VV5 A;  3CC2 Q;  5GAN e;  3FIF A;  2DRK A;  4RTZ A;  3CBM A;  1KD1 R;  3CCM T;  2K79 A;  1OEB A;  3G7Z A;  4MDX A;  5CKE A;  3DB4 A;  3MET A;  1OPL A;  2JVV A;  2CRE A;  2WAC A;  4RTV A;  3E19 A;  2CSI A;  4PKC C;  1K4U S;  2XKO C;  4M7D F;  3LGL A;  1PG5 B;  3RIR A;  1AEY A;  2O9S A;  2RQV A;  4J9H A;  3CCU Q;  3RER A;  3FJ5 A;  2LDM A;  3A8L B;  1GCQ C;  1S72 Q;  4RCC A;  3CCL T;  5KE3 A;  4ZGD B;  3EGX B;  5GAM h;  4A4K A;  3NGP A;  5LL6 S;  1GFC A;  4EMK C;  4N4I A;  2RJE A;  1VQ7 T;  4ZGJ B;  1NJI U;  1WGS A;  4JRI A;  3G4S T;  4XTZ A;  2KYM A;  4E7H A;  2RI3 A;  4E7I A;  2DYI A;  1H92 A;  2D1X A;  1WHK A;  3LGF A;  2ABL A;  2RQT A;  4HXJ A;  3UA7 A;  2MIO A;  2HBP A;  4DEX A;  5LJ3 h;  2EYY A;  3OS2 A;  3OW2 P;  2QTV A;  3EFR A;  1BKB A;  4OGE A;  3QUI A;  4A4H A;  1F1B B;  1NE8 A;  2MK5 A;  1NLO C;  5KYU B;  1G3T A;  2YUO A;  3E2U A;  4FU6 A;  2D8H A;  1WX6 A;  2DIG A;  1WPY A;  3N5B B;  2HNI A;  4AMC A;  4PJO D;  2HBW A;  1FXX A;  1WQW A;  4FCY A;  4HVU A;  1S1N A;  1HXD A;  1FMW A;  2B86 A;  2BZY A;  3JCM J;  2DTH A;  1KC8 U;  1IZ6 A;  4XQ3 A;  5ECA A;  4E47 A;  4JS5 A;  2CUD A;  5IHI A;  4J8O A;  5I21 A;  1QQJ A;  2KDS A;  2O31 A;  1WDX A;  2QA4 A;  5GMK j;  4XTV A;  4IUU A;  1BI2 A;  1OU9 A;  4F04 B;  1ZHI A;  1K0X A;  3OYK A;  4ELY C;  2P84 A;  1R0B G;  4DBQ A;  4KRT A;  3INZ A;  1T0J A;  3HRU A;  4R55 A;  4M7D E;  3OBW A;  3CCE T;  1AWX A;  2CDT A;  4OMF B;  4L6V 5;  3OSV A;  3VS7 A;  1YIT T;  3FJP A;  3V7C A;  4J6X A;  3RBB B;  2EQJ A;  2I2L A;  4O5V A;  1I07 A;  1YFN A;  2YRV A;  2DEU A;  2IIM A;  1OUL A;  2KY9 A;  1MHN A;  1W2B S;  2R58 A;  5KYX B;  2V8I A;  4M77 A;  2EVR A;  3OYE A;  3EH2 A;  2MAM A;  3VU3 C;  1G3Y A;  1YWO A;  2EYX A;  5IXF A;  2DYB A;  1TXQ A;  2DFU A;  2YT6 A;  5LJ3 d;  4LDW A;  2OTJ A;  2DKG A;  1M2V A;  1VQ8 Q;  3DKM A;  3ULR B;  2QAS A;  2LCS A;  2DXU A;  5GAN 3;  1IRX A;  2P0Q A;  3CCV T;  2LJ3 A;  1X6O A;  3NTI A;  1X43 A;  2RD1 A;  1IO6 A;  1RAE B;  3LH0 A;  2XK0 A;  1ZSZ A;  2KK4 A;  2L3Q A;  2QDY B;  1WZO A;  4GLK A;  5GAO r;  1BI0 A;  1VQ5 T;  1VQK T;  1BCO A;  4C8Q B;  4FSS A;  1AOJ A;  3CCR T;  1PNJ A;  3CCJ Q;  4PJL A;  1BBZ A;  4JS4 A;  3OMG A;  4XAX B;  1WI7 A;  3A98 A;  3JCM g;  2DJQ A;  1B3Q A;  5LJ3 e;  2DD5 A;  3OYD A;  1M5Q 1;  2K3Y A;  1NJI C;  2LMJ A;  1W1F A;  3LH5 A;  2AT1 B;  1T3L A;  3QZ9 B;  3BE3 A;  2ZPE B;  2ECZ A;  5KE2 A;  3GIB A;  2Y4Y A;  4DBF A;  4DBH A;  1M90 C;  5FWC A;  1Q81 U;  3PMT A;  4J6W A;  3GOX A;  5GAN 5;  1QCN A;  4Q5W A;  1UJY A;  3QDR B;  1I4K 1;  3H0H A;  2KXD A;  5FU7 B;  2HEQ A;  2V1Q A;  2G3R A;  3UA6 A;  5IHN A;  2LRQ A;  4C0Z A;  3EG3 A;  3J81 E;  1N5Z A;  1Y07 A;  3QO3 A;  4J9I A;  5I2S A;  1JB0 E;  1MV0 B;  1M1K C;  2O88 A;  2QA4 Q;  1KJW A;  2CZ0 B;  3M53 A;  4M4Z A;  1IHV A;  1W2B P;  4HCZ A;  2BTT A;  4B9W A;  5CO7 A;  1UGR B;  2YUQ A;  4OMP A;  4KUI A;  2JM9 A;  2OTL T;  2DJZ A;  4X9C A;  1AWO A;  2K2V A;  5FW9 A;  4IUP A;  3JCM X;  4Y28 E;  4FYY B;  1BK2 A;  3JB9 H;  4NS5 A;  1UG1 A;  3CCM A;  1KQS S;  2XG8 D;  5IN1 A;  1U5S A;  4J83 A;  5C6S A;  1XTD A;  4KGX B;  3TSW A;  3O5Z A;  3CCQ A;  3I56 A;  4ZGE B;  4OF1 A;  3M5A A;  1YJ9 A;  4C8Q C;  1PCX A;  2E10 A;  4HT9 A;  1KG1 A;  1YHQ A;  3VYG A;  3EG2 A;  3HPW A;  1YJW A;  1VQN T;  1WJR A;  4FT4 A;  2YRC A;  4FYV B;  2K5F A;  1M90 R;  2RJF A;  3KXT A;  1YCY A;  4LUD A;  3HSB A;  1QVF A;  4OGC A;  1ZSZ B;  4N0A C;  1SKU B;  4LUE A;  4E7K A;  1EFN A;  4WCI A;  3A8G B;  3L2U A;  2H8H A;  3VUB A;  3I35 A;  2K2M A;  2DE0 X;  4M77 D;  3PFS A;  1X2K A;  2W0Z A;  5FWB A;  3SFM A;  3CBO A;  3G4S A;  5D6W A;  1M1K R;  1GRI A;  4C8Q G;  5FU7 C;  2YLB A;  1BB9 A;  1SG5 A;  4C8Q F;  1GBQ A;  2HKN A;  5J3B A;  2ATC B;  5CKH A;  5GAM j;  3L1A A;  1KHI A;  2ZPB B;  1X27 A;  1X2Q A;  2EW3 A;  2DL4 A;  2JUF A;  2RMO A;  3RNJ A;  1VIE A;  2RHZ A;  2L5Q A;  2DTO A;  1VIF A;  2E65 A;  2XU8 A;  4RTU A;  1WYX A;  2BZ8 A;  2J6F A;  1UHF A;  1OZ3 A;  2PVO B;  3X24 B;  1OOT A;  1SSF A;  2QEX A;  3C94 A;  1U3O A;  5D7U A;  4RTW A;  3G71 A;  4J9E A;  4LDU A;  4M78 C;  2J6K A;  2KQW A;  2MYS A;  3QYG B;  2VYT A;  1MMA A;  5LJ5 h;  2I0N A;  1XNI A;  4ZTJ A;  2L8D A;  4BDZ A;  2VC8 A;  1KQS P;  3IQL A;  2BE9 B;  1U8R A;  2BIV A;  4OML A;  4DA4 A;  3S3O A;  5DY9 A;  3ER0 A;  3MEA A;  3CC2 A;  3J7A F;  3OYM A;  3OYN A;  4IUV A;  2DTI A;  1AVZ C;  1M8M A;  1YIJ A;  1YIT A;  3OYC A;  2QQ9 A;  2O9V A;  4LDV A;  1J3T A;  2KXC A;  4PLL A;  1QVF P;  4M7A B;  3DB3 A;  2VB6 A;  3CQT A;  3JSC A;  4M78 G;  3QJY A;  3CCM Q;  1XQH A;  2EJG A;  4BE2 A;  2J7I A;  3I9Q A;  2NUZ A;  4M78 F;  2RHX A;  1QMC A;  3D7S B;  3MPU B;  1SHF A;  3QG1 A;  2JTM A;  2LJ1 A;  2EQK A;  3PNW C;  1YHQ Q;  2FYK A;  4C8Q E;  1LPL A;  2DMO A;  3CME T;  3CCS A;  3QXE B;  3LYI A;  2YDL A;  2QQR A;  3WVD B;  3CCL Q;  1N8R C;  4PJO A;  1RAG B;  1JBM A;  1NBE B;  2DA9 A;  3ASK A;  4N4H A;  1PKS A;  3NHN A;  2E12 A;  2LCL A;  4NL2 A;  3X25 B;  4IUQ A;  1VQ7 Q;  2KR3 A;  1OX9 A;  4XTY A;  3CD6 T;  2CP0 A;  3HKS A;  3G4S Q;  5KCH A;  1AT1 B;  5IAY A;  2PTK A;  2LP5 A;  4JUV A;  2KI7 A;  5LJ5 f;  2KRM A;  2LZ6 B;  5HCK A;  1N9S A;  2E6Z A;  1QP2 A;  3OYF A;  1SPK A;  4OB1 B;  3MHX A;  5CK9 A;  5HK3 A;  5CR2 A;  1VQ9 T;  2D0Q B;  4F17 A;  5KCO A;  1WNL A;  2HSP A;  2EGC A;  4FL6 A;  5GAN f;  1KIK A;  3NTH A;  2YUP A;  1W6X A;  1X6G A;  2Z0W A;  2RN8 A;  1NZ9 A;  1QVP A;  1VQ6 T;  2XMF A;  2CZ1 B;  4B9X A;  2YUN A;  3J80 E;  1TUD A;  2ZGW A;  1N6A A;  4JJN K;  4JRK A;  4O6J A;  4HVV A;  1KQ1 A;  4PFO A;  3RKX A;  1QWE A;  2WSF E;  4RKU E;  2QEX Q;  1DJ7 B;  2V1R A;  2CP5 A;  2RH2 A;  4A63 B;  2HL5 C;  4LNP A;  3JCM d;  4P5N A;  4ME7 A;  1VQ4 T;  4M7A C;  1WHM A;  5CIU A;  4CC3 A;  3EHQ A;  2IVW A;  4M78 E;  2RNA A;  4RCB A;  2FZG B;  1YJN T;  2DNU A;  8AT1 B;  1N8R R;  1PD0 A;  3RDV A;  3M0U A;  1UGV A;  3CCE Q;  2MF2 A;  1UGP B;  4J7F A;  3PVL A;  2CP2 A;  3O8V A;  3OYG A;  1YIJ Q;  2K5I A;  2R5M A;  1YIT Q;  4NL3 A;  2AKL A;  1D0X A;  5GAN 7;  3FRN A;  2KMT A;  4J9D A;  5D6Y A;  2DEQ A;  3CC7 A;  4M7D G;  2JTE A;  3A5Z B;  4QVD A;  4M7A G;  2C0O A;  2J6O A;  3ME9 A;  2YHT A;  1VQ8 A;  2DLP A;  2RM4 A;  2MWP A;  2PNI A;  4PJN A;  4MZP A;  4M7A F;  1O9S A;  4JJB A;  1P92 A;  1VQN A;  4DOV A;  3QDF A;  3E9F A;  2F1L A;  4C92 A;  3NTK A;  3SWN A;  2X35 A;  1Q82 U;  3UWN A;  5CKD A;  4PJO B;  2Y4X A;  3OYA A;  4F7U B;  1M30 A;  3RR6 A;  4QQ6 A;  1JRI A;  3CCS Q;  2KNB B;  3SEM A;  1YN8 A;  5KYN A;  2GFA A;  1AD5 A;  4GBQ A;  2A0F B;  2EAY A;  3CCJ A;  1B34 A;  4MMK A;  2BUD A;  1VQK Q;  2L89 A;  4MML A;  4BY6 B;  5GMK m;  2C0T A;  3CCR Q;  2M0Y A;  2GNC A;  5CQY A;  3M0Q A;  1VYU A;  4XU1 A;  4BDY A;  3VS2 A;  2EIF A;  2DBM A;  3T9N A;  3H8Z A;  4PFP A;  3JRZ A;  1D3B A;  1AZE A;  2DVJ A;  3A8O B;  2P0K A;  2ZPH B;  3SHW A;  2WSE E;  2MPX C;  3FC3 A;  2P4T A;  2PUO B;  4J9F A;  1VQL T;  5GJW B;  1SRL A;  2CT4 A;  3V8K A;  3JV3 A;  1I1J A;  4RMO A;  5DM7 R;  4HA8 A;  1TOV A;  3CC4 A;  1IGU A;  3EGD B;  1V1C A;  2EKO A;  1U06 A;  2DXC A;  1VQP T;  1R0C B;  2CP6 A;  3AT1 B;  3OBY A;  4Z02 A;  2VUB A;  1K73 U;  1Q7Y U;  1SF9 A;  2CYZ B;  2GF7 A;  2F5K A;  4LN2 A;  2D8J A;  2KRS A;  2O4X B;  4Z8A A;  3RMS A;  1I5O B;  2OAU A;  1CKB A;  2MCN A;  4AFS C;  3A8H B;  4M7A E;  2YXY A;  2JW4 A;  5GAM f;  3L2W A;  2J06 A;  1TS9 A;  2E5Q A;  1RAC B;  3GBQ A;  3OQ5 A;  2YRD A;  3OS0 A;  3CBP A;  2RK2 A;  3CEY A;  2RJC A;  1G8X A;  1N27 A;  4UC4 A;  4PJO C;  4EDU A;  5CKB A;  4C0D B;  3I55 T;  1W2B A;  5LJ5 j;  4Z88 A;  4KH0 B;  3VS4 A;  5LJ3 f;  1OX8 A;  2RPN A;  4JPB W;  3CC7 Q;  3VJP A;  2GQI A;  1ZA1 B;  2COY A;  4IUR A;  5GAN 6;  1RLQ C;  4C92 B;  4BY6 C;  1RAH B;  3SWN B;  4E7J A;  1PSE A;  5GAN j;  2CH4 W;  3P8B B;  1VQN Q;  3AHU A;  1OV3 A;  2DF6 A;  2V8J A;  1ZA2 B;  3CCU T;  2IPO B;  4OMO A;  4KUL A;  1NPR A;  1X69 A;  1K8A U;  2QAZ A;  4F7U G;  3P8D A;  4XTW A;  2QI2 A;  1VQO T;  1CSK A;  1XJW B;  1M1G A;  4BAC A;  1K9M U;  4PJO F;  4F7U F;  1KK7 A;  1V29 B;  1Q82 C;  4PFZ A;  5GAN g;  3HRT A;  2RI5 A;  2B8A A;  3TRE A;  1D3B B;  3REB B;  1NLP C;  3M0R A;  3GNG A;  4C92 D;  3G1J A;  2LX7 A;  2FPF A;  1M8V A;  5IHK A;  3CMA T;  1RAF B;  2K4Y A;  2O2O A;  1FMK A;  1VQ9 A;  4AG1 C;  1UGS B;  4HCK A;  3VS1 A;  5FRM A;  3X28 B;  4WTO B;  1R77 A;  1GL5 A;  1WHL A;  4PJJ A;  1WHH A;  4C0G A;  4DOW A;  3M56 A;  4BE0 A;  1YI2 T;  1WQ7 A;  1G3S A;  4KBM B;  3VS6 A;  1UB4 A;  4IKF A;  5FRO A;  2K6D A;  4OMM A;  3CC4 Q;  4DBR A;  4X34 A;  2NUP A;  4GY5 A;  2M9U A;  3PT9 A;  4JDS A;  2DIL A;  1MV3 A;  1NM7 A;  3QJ6 A;  4FW1 A;  1RL2 A;  3BFM A;  2BE7 D;  4C0D C;  4C5G A;  2LNV A;  5CAI A;  5L23 A;  2V8K A;  4PL6 A;  3PIO A;  2L3P A;  3MP6 A;  1KC8 C;  4M75 D;  1UE9 A;  3HFO A;  1YJN A;  2YSQ A;  2EYZ A;  4Z89 A;  1IHW A;  4JZ4 A;  2CZ6 B;  2HMA A;  1K73 C;  2FZK B;  2LCC A;  3VS3 A;  1Q7Y C;  1TUG B;  4A53 A;  4C5E A;  3QBY A;  1Q82 R;  4M77 B;  1QKW A;  4EIK A;  4QT7 A;  1EIF A;  1JU5 C;  4MZT A;  2M16 A;  3MKD A;  2P0P A;  2XHC A;  2EJF A;  1UUE A;  1QVG S;  3BDU A;  1KQS A;  1NJI R;  4VUB A;  1QVG A;  4PJO E;  1M2V B;  4A4E A;  1M3B A;  4F7U E;  2GBQ A;  2H3J A;  2D0N A;  4AFQ C;  2DET A;  1FYN A;  1MMD A;  1PKT A;  4DEY A;  2AKK A;  1M9S A;  1QCO A;  2AK5 A;  1RAA B;  2RI2 A;  3CCL A;  1HK9 A;  1LVK A;  2XDD A;  2HCK A;  4AFZ C;  2BKD N;  1NEG A;  1UDL A;  1WLP B;  1VQ7 A;  3S3N A;  2RF0 A;  2X4J A;  4JLI A;  5AYF A;  2K9G A;  4CI0 C;  1TWB A;  4E7L A;  1ZLM A;  3QHS A;  1KD1 U;  1E7O A;  4D8K A;  2RQR A;  3CD6 Q;  1KC8 R;  2NWM A;  2X4Y A;  4OB2 B;  1VA7 A;  3JCM b;  3EG9 A;  1K8A C;  1D0Y A;  2DL8 A;  2EQI A;  1K9A A;  3VRZ A;  2OI3 A;  2XID A;  5GAN 2;  1GXI E;  1B07 A;  2K7A A;  5J26 A;  3VKI A;  1H8K A;  1K73 R;  1Q7Y R;  1K76 A;  3OYH A;  3TVT A;  1VQM T;  2VVK A;  1KFZ A;  4D6W A;  1X01 A;  3OYL A;  1VQ9 Q;  1OI1 A;  3RKY A;  3WVE B;  1JO8 A;  3JCM P;  2RJD A;  2L2P A;  1WIE A;  1GCQ A;  3FB9 A;  1G5V A;  1A0N B;  1VQ6 Q;  2HL3 A;  2JMA A;  2KBT A;  2FG0 A;  2DK3 A;  2RA2 A;  5LJ3 j;  2NUP B;  8ATC B;  4EMK A;  3EFS A;  4OMQ A;  3VS5 A;  5C0M A;  3QPH A;  3S6W A;  1VQP A;  2GTO A;  5GAM g;  5GAO p;  5DLQ E;  3VV0 A;  4RTT A;  1OQK A;  3MP8 A;  5KYW A;  1Q81 C;  4M77 C;  2X9H A;  1IRE B;  3LLR A;  1PRM C;  2ZPI B;  1VQ4 Q;  4HT8 A;  2EJ9 A;  4EPC A;  2E41 A;  1QVG P;  3CCE A;  5FU6 B;  3JCM Q;  2QA4 T;  1WA7 A;  4KGZ B;  1YJN Q;  2DD4 A;  5LJ3 g;  2HAX A;  2GGR A;  2CUB A;  1YBY A;  2FB7 A;  4B6M A;  3HHT B;  1LJO A;  2G6F X;  3VRY A;  2DXB A;  5IXB A;  4OMN A;  4EMH A;  1ZSZ C;  1OZ2 A;  3C12 A;  4GLM A;  2RQW A;  1R8O B;  2F69 A;  2X3W D;  4OP0 A;  4XTX A;  4HVW A;  1C6V X;  4M77 G;  3L2R A;  4ZN3 A;  2E4H A;  2F2V A;  2RK1 A;  3JB9 G;  3JCM h;  1ZBX A;  2K3B A;  1T3S A;  2DZC A;  4M77 F;  4II1 A;  3G6E T;  2KSS A;  3RKW A;  3JB9 F;  4ELZ C;  1PRL C;  1TUC A;  3QSU A;  1H64 1;  3JCM c;  2DPP B;  1TTH B;  4J9G A;  7AT1 B;  3CCV A;  2AZV A;  4A4G A;  2DL3 A;  3NFC A;  2MWO A;  1FWZ A;  2DRM A;  2R57 A;  5GAO q;  4JRP A;  2QYZ A;  1I5L A;  2OTJ T;  4LXC A;  3OS1 A;  5FLX E;  1VQ5 A;  1VQK A;  1VQO A;  1KHC A;  2EWN A;  4FYW B;  5A0D A;  1AWW A;  3CCR A;  2X4X A;  2K3X A;  1Q81 R;  2DO3 A;  5A0G A;  1T0H A;  3C0C A;  3ZBD A;  4KT0 E;  1QCF A;  2VXF A;  3EG9 B;  4DQ2 A;  4V2S A;  1UEC A;  3EGX A;  1LOJ A;  4PNO A;  4IIM A;  2XIC A;  1QKX A;  1NG2 A;  4ZTF A;  2JTF A;  4LDY A;  2DIQ A;  4RG2 A;  4M7D D;  1SRM A;  4R0K A;  2OJ2 A;  2L0A A;  2LJ0 A;  2LX9 A;  2DER A;  3P8H A;  1ZUY A;  5M9O A;  2VXE A;  3CMA A;  2JJ9 A;  2EKH A;  2ENM A;  4AFU C;  4QQG A;  1RUW A;  2FPD A;  1TSF A;  1YWP A;  2QK0 A;  5L8R E;  4KGV B;  1VQL Q;  5A2Q E;  1NPP A;  5GMK e;  1WJS A;  2FO0 A;  1E6H A;  2VKN A;  1K1Z A;  1NYG A;  2EGA A;  5KYW B;  3S3M A;  2CH4 A;  2M02 A;  1JXM A;  3H41 A;  2ED0 A;  1YCS B;  1HD3 A;  2HD0 A;  3EFO A;  1VQP Q;  3OW2 S;  1W70 A;  1BU1 A;  3URG A;  1RAI B;  4M77 E;  1WHG A;  2VAS A;  5I22 A;  4FSX A;  2VGM A;  3DLL A;  5DLO A;  2OTL A;  4LE9 A;  1WXT A;  3ZEH A;  2RHU A;  9ATC B;  2EQM A;  3KFV A;  4OB3 B;  1XOV A;  1FX7 A;  4YTL A;  3OB9 A;  1G3W A;  2JOY A;  3OYB A;  1MNE A;  2PQW A;  1D0Z A;  3THK A;  3JB9 J;  3RMQ A;  1TU0 B;  2M0O A;  3H0I A;  2QXF A;  3M59 A;  1ZSG A;  3I55 Q;  2KE9 A;  2J05 A;  3SB2 A;  3CPF A;  3JCM e;  2OX7 A;  2WSC E;  1ARK A;  3E1S A;  3OYY A;  4E2F B;  3HRS A;  4ATO A;  2LQK A;  1H3Z A;  2JT4 A;  2QQB A;  2M1H A;  5KYX A;  3BDL A;  3CCQ T;  2QTX A;  1WXB A;  5IH2 A;  3U23 A;  1VOM A;  3I56 T;  1ZX6 A;  5KYY A;  1YJ9 T;  5I2M A;  4NOY A;  3CCV Q;  4JJD A;  4C5I A;  3MEU A;  1YHQ T;  4E6R A;  1YJW T;  2V26 A;  1I8F A;  1VYV A;  1Y57 A;  1K0S A;  2LNH B;  2A08 A;  2PVG B;  2AZS A;  2RQU A;  1VQ5 Q;  1C0M A;  1VQO Q;  1Y0M A;  4HCC A;  2HSE B;  3QZ5 B;  4FIB A;  3OMC A;  3SDZ A;  1RAB B;  3X26 B;  1N9R A;  3CPW S;  4QKU A;  2D6F A;  3CPW A;  1JJ2 S;  2CSQ A;  2E70 A;  3LX7 A;  2R5A A;  3EAE A;  1Y7X A;  1JJ2 A;  2A36 A;  3NPF A;  4C8Q A;  2DVE A;  3LW5 E;  4M75 A;  1BYM A;  1VQM A;  4LD9 K;  1M90 U;  3UPU A;  2DZ9 A;  5GAO m;  3CMA Q;  2E64 A;  3TCJ A;  2E3H A;  4XTU A;  2DBK A;  4HKE A;  1OPK A;  2QGG A;  2GQV A;  4N0A A;  6AT1 B;  4ZN1 A;  2DXT A;  2KVQ G;  1EX4 A;  2JM8 A;  2DL7 A;  1BI3 A;  2JMC A;  3MEV A;  1YI2 Q;  3EFO B;  2RHY A;  3M0T A;  4K11 A;  5D6X A;  3F70 A;  1D1A A;  4LDX A;  3UAT A;  5CCA A;  1M1K U;  2A37 A;  4FM4 B;  4IIO A;  2DX1 A;  3UDC A;  2JS0 A;  5EG2 A;  3H0F A;  4AG2 C;  1RLP C;  1SEM A;  2QEX T;  2A7Y A;  2A3L A;  2CP3 A;  4Y92 A;  3A8M B;  2EYW A;  3M55 A;  3G71 T;  4F14 A;  4R56 A;  3M4G A;  3PE0 A;  4EMG A;  3GF5 A;  2OTL Q;  1D1B A;  1H3H A;  3QYH B;  4WF2 A;  2AHJ B;  3CXC S;  3SD4 A;  3CXC A;  3KBG A;  3CC2 T;  3OY9 A;  1TH7 A;  1YIJ T;  2GCX A;  2ZPG B;  5GAM d;  1C1A A;  3V8L A;  2DL5 A;  1HSQ A;  5GJV B;  1WXU A;  3G6E A;  3X20 B;  4MZM A;  1AWJ A;  1BIB A;  3JCM V;  4BUG A;  4M78 A;  3M4Y A;  3MO8 A;  4Y91 A;  4D8D A;  2COZ A;  3V8J A;  4J7I A;  3M0P A;  5KYY B;  1TG0 A;  3PVQ A;  3JAM E;  1OYX A;  1I0C A;  3CME A;  2BZX A;  2ZZD A;  3CPW P;  1B34 B;  1D1C A;  5CVI A;  5LJ5 g;  4MDW A;  1JJ2 P;  4PJO G;  5HY6 A;  2P4R A;  4E7S A;  1M2O A;  1S72 T;  3VS0 A;  3M58 A;  3L2Z A;  3EH1 A;  1V76 A;  1MMN A;  4A4F A;  2RO0 A;  3CD6 A;  3CCS T;  5GAM e;  1EZZ B;  4J6Y A;  2VWF A;  1PWT A;  1PHT A;  4N4G A;  1MUZ A;  4M75 B;  2QDL A;  2PUK B;  2FVU A;  1M4Z A;  3E9G A;  4C0F A;  3PIP A;  2FL7 A;  2KYB A;  2LQ8 A;  2X4W A;  2RHI A;  1VQM Q;  4CC7 A;  2YLC A;  1VQ6 A;  4QVZ A;  2EQU A;  1SHG A;  1UTI A;  2E3I A;  3TQ7 P;  1ZUK A;  2EYQ A;  1ZUU A;  2FPE A;  3C95 A;  5GAN 4;  5IT9 E;  3LWI A;  2C06 A;  1Y71 A;  1VQ4 A;  4RG8 A;  1KSW A;  3CXC P;  2QGF B;  1HJD A;  3JB9 I;  3L2Q A;  1Q86 U;  4C8Q D;  2L3S A;  4CC4 B;  2MOX A;  3V7S A;  3HP9 A;  1LNX A;  1PC0 A;  2KRN A;  1ZQ1 A;  4X1V A;  1FMV A;  4C92 C;  3HL8 A;  3SWN C;  3M9Q A;  4ZNX A;  3GPL A;  3KUF A;  4JLG A;  2NUT A;  3L2V A;  1UFF A;  2W10 A;  1JEG A;  4AT1 B;  2F2X A;  4KUD K;  2M51 A;  3M57 A;  4FW2 A;  5FRN A;  1E6G A;  4J9C A;  2EBP A;  2LVM A;  4M78 B;  2ROL A;  4RTX A;  3QWX X;  3VYH B;  3MJX A;  2COW A;  2K5L A;  1GBR A;  3PTA A;  1MGQ A;  4QVC A;  1X6B A;  1PD1 A;  4J5Y A;  4BI8 B;  3G6E Q;  4M7D A;  3EG0 A;  3CC7 T;  1O75 A;  4M7A A;  1ACM B;  2CZ7 B;  4C92 G;  3ZL7 C;  3R6N A;  1BCM A;  1M3C A;  1N8R U;  5GAO n;  1VQ8 T;  2QG9 B;  3CME Q;  3EGU A;  1OU8 A;  4M75 C;  4C92 F;  4E7Z A;  2DM1 A;  4JZ3 A;  2OTJ Q;  4QQD A;  2VGN A;  1QVF S;  1UJ0 A;  4XU0 A;  4ANJ A;  2RB6 A;  3BY7 A;  4BD3 A;  3C4S A;  3H9N A;  2CT3 A;  5HK0 A;  1RAD B;  3HTR A;  1U1S A;  1BIA A;  2A28 A;  1SSH A;  1Z9Z A;  2KT8 A;  2CKK A;  4M78 D;  2JNG A;  3CCJ T;  4L5G A;  1YNZ A;  2IG0 A;  4LD6 A;  1Z9Q A;  4L59 A;  3JB9 D;  3FEO A;  5J39 A;  1K9M C;  4XK8 E;  3OSS C;  2LTO A;  1BI1 A;  1IB8 A;  1JQQ A;  1M3A A;  1X75 C;  4M75 G;  1M27 C;  1VQL A;  2FRY A;  4M75 F;  5GMK h;  1JXO A;  2FEI A;  2CGH A;  1YP5 A;  2JZ2 A;  2AIR B;  3MEW A;  4F16 A;  1RI0 A;  2K57 A;  1AZG B;  2OAW A;  2XI9 A;  2EPD A;  4FT2 A;  3REA B;  4BI3 A;  2KAF A;  2LT4 A;  1NEB A;  3MP1 A;  3A1P A;  2NLU A;  2L3R A;  3L42 A;  3VUZ A;  5GMK i;  3CC4 T;  2FHD A;  2LC4 A;  4JRQ A;  1Y96 A;  4ORZ A;  2O01 E;  1Q95 G;  3QKJ A;  1M1F A;  2ROT A;  3GLX A;  2PZ1 A;  4JJC A;  1IGQ A;  4PJM A;  2SRC A;  3RES A;  2NUT B;  3LWH A;  4XU3 A;  2CP7 A;  3ZFJ A;  2YWW A;  5A0L A;  1Q86 C;  1RI9 A;  1AHJ B;  5AT1 B;  4C92 E;  2X51 A;  1ZBJ A;  3FLG A;  3I55 A;  1K8A R;  2EFI A;  1ABQ A;  2EGE A;  5I11 A;  1CKA A;  3I5R A;  2KEA A;  4HCB A;  5GAN h;  3BW1 A;  2QQA A;  1K9M R;  1HYO A;  1UGQ B;  3PGG A;  4RTY A;  4M7D B;  2KRO A;  3R6O A;  2F5T X;  4KH1 B;  3M0S A;  4XU2 A;  2DAQ A;  1MMG A;  3GP8 A;  2LQW A;  1WFW A;  3MCA B;  2Y90 A;  3CCU A;  2XDB A;  3CCQ Q;  3I56 Q;  1GFD A;  2C0I A;  1QP3 A;  1YJ9 Q;  5GAN 8;  1G83 A;  1S72 A;  1D09 B;  2E5K A;  2JXB A;  2MMP A;  3EHR A;  3WXM B;  1YJW Q;  2JS2 A;  3FDR A;  1ABO A;  3QWY A;  2MI6 A;  4M75 E;  3UT1 A;  1I81 A;  2X3X D;  5GMK l;  1UHC A;  2FRW A;  2FZC B;  4BI4 A;  2ZCF B;  3QII A;  4F7U A;  4A54 A;  4QW2 A;  3JCM W;  1NYF A;  4FYX B;  1QW1 A;  4M7A D;  2HQX A;  2JN0 A;  4OB0 B;  1VYT A;  3TEE A;  1KD1 C;  2SEM A;  3HFN A;  1Q86 R;  3TU4 K;  5GAO l;  1QWF A;  3TSZ A;  2E6N A;  3EG1 A;  4IUT A;  2CS7 A;  5CQX A;  2GFU A;  5KH6 A;  4PK4 A;  5LJ5 d;  2ESW A;  3OS5 A;  5FU6 C;  2D9T A;  4EMK B;  1GCP A;  2HDA A;  1YI2 A;  1VUB A;  5KYU A;  1PSF A;  2PVD B;  1PM3 A;  3I5S A;  2PU9 B;  2XDP A;  1MND A;  2GTJ A;  2HKQ B;  1UEB A;  3JCM f;  3OYI A;  4CRI A;  2H3E B;  2ZAE A;  4TVR A;  2KT1 A;  1WHJ A;  5GAN d;  4RUG A;  3M54 A;  4ESR A;  2XD0 A;  3OW2 A;  1Y96 B;  4BB7 A;  1WJQ A;  3RUX A;  1LCK A;  3PMI A;  3NMZ C;  2LT1 A;  5EC7 A;  1G2B A;  2ZPF B;  3V7R A;  3EGD A;  2ED1 A;  2HQH A;  2LQN A;  3Q1J A;  5CKF A;  4M7D C;  2KGT A;  3G71 Q;  3DLM A;  4BE1 A;  4C5H A;  2HZY A;  1B7T A;  2NYS A;  4OVA A;  1W4S A;  5LJ5 e;  1KQ2 A;  4PLI A;  4J9B A;  2O4X A;  4CC2 A;  3H6Z A;  3UF4 A;  3GNF B;  4X9D A;  1QLY A;  2QQS A;  1IXD A;  5HKC A;  3OA6 A; 
#chains in the Genus database with same CATH homology
 3G6E Q;  3I55 Q;  1K9M R;  2QEX Q;  1VQM Q;  1W2B P;  3CCE Q;  1VQ7 Q;  3CXC P;  3CPW P;  3CC2 Q;  1VQ9 Q;  1Q81 R;  3CC7 Q;  3CCU Q;  1YJW Q;  1YHQ Q;  3G71 Q;  1QVF P;  3CD6 Q;  3G4S Q;  1YIJ Q;  1YIT Q;  1KC8 R;  1JJ2 P;  1YI2 Q;  1VQP Q;  1VQ4 Q;  1VQK Q;  1KQS P;  1NJI R;  1KD1 R;  1Q86 R;  1VQO Q;  1VQ5 Q;  3CME Q;  3CCM Q;  3CC4 Q;  1VQ8 Q;  2OTL Q;  1S72 Q;  3CCR Q;  1VQ6 Q;  3CCJ Q;  1QVG P;  1VQL Q;  1K8A R;  3CCL Q;  3CMA Q;  3OW2 P;  1YJN Q;  1N8R R;  3CCQ Q;  3I56 Q;  2QA4 Q;  2OTJ Q;  1VQN Q;  1K73 R;  1Q7Y R;  1M1K R;  3CCS Q;  1YJ9 Q;  1M90 R;  1Q82 R;  3CCV Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...