3G71Q

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3g71Q00
1S72Q 1VQLQ 1YJWQ 3G4SQ 3CCRQ 1Q86R 2OTLQ 1N8RR 1K8AR 1YI2Q 1VQ6Q 1K73R 3CCJQ 1W2BP 3CC7Q 1VQ4Q 1VQ5Q 1K9MR 1VQKQ 3CCVQ 1QVGP 1VQ9Q 3CCEQ 1M90R 3CPWP 3CMEQ 3G71Q 1KD1R 1VQNQ 3CCLQ 1YJNQ 1KC8R 1YIJQ 1Q82R 1QVFP 3CC4Q 3CCQQ 1NJIR 1KQSP 3CD6Q 3CCSQ 1Q7YR 1VQ7Q 3CMAQ 3G6EQ 3CXCP 1M1KR 1VQPQ 1YITQ 2QEXQ 1YJ9Q 1VQOQ 1YHQQ 3CC2Q 2OTJQ 1Q81R 3I55Q 3CCMQ 1JJ2P 2QA4Q 1VQMQ 3I56Q 1VQ8Q 3CCUQ 3OW2P
chains in the Genus database with same CATH superfamily
3E9FA 3M0SA 1QQJA 1KK7A 2EPDA 4FYYB 5CVIA 3UA6A 4JRKA 2HL3A 2YRVA 2BE7D 2DXBA 3JCMg 3M4YA 4J9GA 1YBYA 2YUOA 5IXBA 2NUPA 3OYKA 1JRIA 2XDBA 3OYLA 2DRMA 3VYHB 4GLMA 4RG2A 1VQ6Q 1WXBA 4C92A 2F69A 3JV3A 2KI7A 4F17A 3NMZC 5LJ3h 3CCVQ 2JNGA 2FZKB 4DQ2A 2MOXA 3H0FA 4Z8AA 5LJ5h 2E5QA 2L3RA 3OW2P 2K9GA 2QTXA 4EDUA 1P92A 1O75A 2DX1A 2EJGA 3CCRT 1VUBA 3M0UA 3SWNC 3CEYA 1QVFS 1TOVA 2FPEA 2QI2A 2FG0A 3CC7T 4LNPA 1Y96A 5IHNA 4LN2A 5GAOr 4UC4A 3L42A 1M90C 1W2BA 3CCUA 2PUOB 1PD0A 1QVGA 2BTTA 3LX7A 2HD0A 2JM9A 1Q7YC 1ABQA 1X6GA 2VB6A 2AHJB 1S1NA 4EMHA 2HSEB 2A08A 1I8FA 1ZUYA 5ECAA 4XTZA 5D6WA 1SF9A 8AT1B 2O01E 1M4ZA 4GBQA 1U06A 2P0QA 2RHYA 2Z0WA 1KD1C 2EFIA 2HKQB 1XJWB 1ZX6A 3MEWA 3JCMd 4PJJA 2K3XA 3V7CA 2FPDA 4XU2A 3IQLA 2JUFA 2RPNA 1K9MR 1YCSB 2VV5A 2X4YA 3O8VA 1WLPB 3UDCA 3GNGA 2COYA 2F2XA 4C8QD 3M57A 2LQWA 2A3LA 3UA7A 3WVDB 2ESWA 3C0CA 3VS5A 4RG8A 3QHSA 4ZN3A 2QEXT 1M8MA 2DXTA 1PRLC 3URGA 1WHHA 3QYGB 3J80E 3OYHA 1VQNA 2I2LA 2YRDA 3CCQA 2X4JA 4E47A 5GAOl 3J7AF 3BY7A 1M9SA 3CMET 1Y71A 1AD5A 1MV3A 4RTYA 1UECA 8ATCB 2QQSA 4B9WA 2MI6A 2LZ6B 4MZPA 2ZPGB 4FCYA 5FWCA 1IXDA 1GL5A 4XU3A 2NUTB 2OX7A 2PVGB 2D0QB 5GANg 2RB6A 1JU5C 1LOJA 4N4GA 3SWNA 3CPWP 4YTLA 4BB7A 4M75D 4BUGA 2EQIA 1KQSP 3H0IA 1X43A 1BIBA 2ZPBB 2GQVA 5M9OA 4P5NA 4OMNA 4QVCA 4C8QC 3NTKA 2CSQA 2QYZA 3JCMP 2DNUA 4RTWA 4QKUA 2CZ0B 5D6XA 3RUXA 4FYWB 1TSFA 1M3BA 4A4KA 2F2WA 1U3OA 1PHTA 2DO3A 5FU7C 2C0TA 4IIMA 4Z89A 2KT8A 1YITA 2YDLA 1YJNQ 3PE0A 2W10A 3GBQA 1GCPA 2CDTA 3CCET 4CI0C 2FPFA 2OTLA 4FT2A 2J05A 4D6WA 3EFSA 2DJZA 2MCNA 4EMGA 1LCKA 4JLGA 4CC2A 1VA7A 1VQMT 4M75C 1N8RR 1D1BA 3KFVA 4B6MA 1MMNA 2E5KA 2DM1A 2ZPIB 3RMQA 3VS0A 1KSWA 4B9XA 4BY6B 2RJFA 1CSKA 5GAMg 3SFMA 1M3CA 3GPLA 4KGZB 3M53A 1M2VB 3I56Q 1SPKA 2DL5A 4C0DC 1BB9A 4DBQA 2KXCA 3X26B 1JXMA 2HQEA 1JB0E 2H8HA 1ZSGA 3OYGA 1PNJA 2AK5A 1XTDA 3HTRA 3NTHA 1AHJB 1N9SA 5L23A 1X6BA 4PJOD 4M77D 4CRIA 2YLBA 3CBOA 3ULRB 1VQLQ 3G4SQ 3JB9D 1I5LA 1BI3A 4J6WA 1CKAA 1Q86C 3OY9A 1SHFA 3JCMb 3TSZA 3CCJT 1QWFA 4E7ZA 2YRCA 4C0GA 1WDXA 2JS0A 9ATCB 2JXBA 1D0ZA 3QJ6A 1RAGB 1VQOT 1UHCA 1R8OB 1KFZA 5KYUB 2EQJA 2ZPHB 3X25B 1V76A 3CQTA 2COWA 1X01A 1JO8A 1QLYA 2D0NA 2KRSA 2E4HA 2CS7A 5L8RE 2A36A 3TEEA 4PKCC 3SHWA 1X2QA 2CZ1B 2CUBA 3X20B 2O31A 2RQUA 2AZSA 1M90U 1SKUB 4PLLA 4WF2A 3CC2T 3RKXA 3MHXA 5I2SA 3CCMT 4M7DG 1OX8A 5GAOp 5KYXB 2D8HA 5KCHA 1E6GA 4XTWA 2K3BA 3EFOA 1MV0B 1PC0A 2V1QA 4FW1A 3I9QA 3OMGA 4CC7A 1WI7A 2GTJA 4IUQA 2LP5A 4JUVA 4M7DC 4RCBA 2QQRA 2XDPA 1BBZA 3OB9A 3OYFA 2DZ9A 2CZ6B 3CCST 1VQPT 2R5AA 1X2KA 1NLOC 1KD1U 4ZTJA 3PVLA 4QT7A 4OMQA 4PL6A 3LH0A 5I22A 3PGGA 1HJDA 1LVKA 4OMPA 1G3WA 4OP0A 1I5OB 4HT9A 2FVUA 2I0NA 4EMKA 1G5VA 1PWTA 1VQ7T 3CCUQ 5FU6B 2DPPB 2AIRB 1UDLA 3EGXB 2OTJT 4AG1C 2AKKA 5GANh 3GP8A 2R58A 3OYBA 4F7UB 1VYVA 2ZPFB 3VYGA 2DMOA 4RTUA 1MUZA 2HBWA 2J6KA 5CKDA 4MZTA 5DY9A 1PD1A 4C92D 4LXCA 1ZHIA 1WX6A 2LJ1A 1N8RU 1QCFA 4M7AD 3H9NA 3M58A 1UGVA 5LJ3f 4HT8A 3MCAB 2IIMA 3DKMA 4HVVA 2V1RA 2DETA 4J7IA 4XU0A 1I07A 3PFSA 4M7DF 5LJ5f 2RK1A 1OU9A 1JEGA 3CXCS 3HSBA 3OSVA 3PNWC 1IREB 4JS4A 3QIIA 4KULA 2LCCA 1AZGB 3OW2A 3MEVA 4M7DE 2L89A 2CZ7B 1T0HA 2JW4A 4ELYC 5J3BA 2CP5A 2QEXA 4M78B 2YUPA 3CD6A 3INZA 1X69A 1ZBXA 1FYNA 3CCQQ 1D3BB 4J9EA 4M7DA 2ZZDA 5IAYA 3EGDB 3VV0A 2JT4A 2RJEA 3I35A 1GBRA 1TWBA 3A98A 4C92C 3A5ZB 3V8KA 1KQ1A 4M7AC 1R77A 2OAUA 3PIOA 3QUIA 5GAMh 1VQ9Q 1RACB 4OB2B 3I5SA 4C5GA 1VQKT 1VQ8A 5DLQE 3V7SA 4LD9K 4PFZA 3CMAQ 3A8GB 1KC8C 3VS6A 3CCLT 2EQMA 1ZSZC 1B3QA 1H8KA 1YHQT 5GMKh 1PKTA 2XD0A 2EYXA 4RTZA 2YHTA 2LJ0A 3OS1A 4IUUA 1VQ6T 1LPLA 1YI2T 3A8MB 1GXIE 6AT1B 2CH4W 1M1GA 3M5AA 1VQLA 4JRIA 2GCXA 2XK0A 2EBPA 1QVFA 1FMWA 1BU1A 1IGQA 1OV3A 5CQYA 2DL4A 2BUDA 1BI2A 2E1HA 5GAN5 4J83A 3A1PA 2LX7A 5FLXE 3G6EA 2RI2A 1MNDA 3RR6A 2HAXA 2L3PA 3G1JA 4X9CA 4ELZC 2L0AA 1YITQ 1NJIC 4FYVB 2CP6A 4M7AF 3DLMA 1RAEB 1YJWQ 2YWWA 2OTLQ 4J9CA 1TUCA 4HCZA 1IO6A 2M0OA 2LT4A 1D09B 4IURA 1VYUA 5CAIA 1WHJA 5D6YA 2HQXA 4Y28E 2GBQA 3Q1JA 3CPWA 4C92E 4Z02A 5C0MA 2CP2A 2LRQA 4M7AE 1KQSA 4L6V5 4AMCA 2NWMA 4J9BA 1NEGA 3LWHA 2V8KA 4LUDA 1GRIA 3VS3A 4CC4B 1GFDA 4M7AA 1H92A 2KY9A 4A4GA 1OI1A 4JZ4A 3D7SB 5KE2A 3VS2A 2PZ1A 1E7OA 1Y57A 2YXYA 4OMOA 3VU3C 1ZSZA 2KQWA 2EIFA 1RI9A 2GF7A 1TXQA 4AFZC 1ZUUA 2RQTA 1M3AA 2DF6A 2XDDA 2HEQA 3S3MA 3ZL7C 3C4SA 1AT1B 2ZGWA 1C0MA 1RI0A 3RMSA 4ZGJB 5KYWA 5IT9E 1QCOA 3JCMJ 5AT1B 2LTOA 2M1HA 1FWZA 4E7SA 4ZGEB 3MO8A 3VKIA 2DD5A 4AFQC 3EAEA 4J6XA 5A0DA 2EYYA 3H0HA 5KYYA 3MP6A 2QASA 3BDLA 2O2OA 2DVEA 2RK2A 4KH0B 2GQIA 4HXJA 3SDZA 4E7LA 1OPLA 5FWBA 1I0CA 3G71T 2E6NA 1Q82C 3LGFA 1GFCA 3WVEB 4LDXA 5J26A 1M2OA 2RJDA 1IHWA 1D0YA 1G3YA 3OYIA 3VS4A 2DYIA 4D8DA 2QGGA 2LQ8A 1QVFP 2VXFA 4R55A 4GY5A 5GAN3 2PVDB 3VRYA 5IHKA 2W0ZA 1YJ9T 5FRMA 2HNIA 1XQHA 3OYDA 4R56A 4N0AC 4A4HA 1K9AA 2LMJA 4QQDA 3CCSA 2K57A 1VQPA 2M16A 4OMFB 3MP1A 1XOVA 1S72A 1YJNT 1WJRA 3OA6A 1C1AA 2JS2A 2RJCA 2K5FA 1VQ9A 5CQXA 1B34B 2ECZA 5GAN8 1BI1A 2IVWA 2JMAA 2JVVA 3CC4A 4Y92A 3V7RA 1Q81U 1VQ7A 4OGEA 1M90R 3CMAA 1N5ZA 3HFNA 5HY6A 1QKWA 2XI9A 1SRLA 1C6VX 1PSFA 2P4TA 4AT1B 4C8QB 1MHNA 3TVTA 4OB3B 3H8ZA 1U5SA 2GFUA 1W1FA 5C6SA 1U8RA 1PRMC 2PUKB 3I56T 2QA4T 2LCSA 1QVGS 1M30A 2VC8A 3HHTB 3A8LB 3QXEB 4JRPA 1U1TA 2RA2A 1KD1R 1H641 2B8AA 2AZVA 5FU7B 2R57A 4DEYA 4IUTA 3M0QA 2E65A 4C5EA 2XKOC 2M02A 3I55T 2LX9A 2FZGB 4QW2A 4NS5A 3HRUA 3FJ5A 2DL8A 3FLGA 3UF4A 4DEXA 4MZMA 2CP0A 3F70A 2D8JA 1SHGA 4M75B 1YJWA 1RAIB 4FSSA 2MK5A 2QEXQ 2ZPEB 2GTOA 3CD6Q 2DRKA 3QJYA 4Y91A 2AKLA 4X9DA 1RUWA 1BI0A 2IG0A 5FW9A 2PQWA 3VRZA 1MMDA 4MMKA 4N0AA 3PT9A 3CMEQ 3T9NA 2E10A 1AOJA 4C0DB 3JCMh 2P0PA 5GAN4 2E3IA 3ZFJA 4BI8B 3RIRA 2HSPA 3JSCA 5CO7A 2EGCA 4Q5WA 1JJ2S 3EG9B 3R6NA 1VQ8Q 2YLCA 1HYOA 2Y4XA 2EJ9A 2EKHA 3V8LA 5A0GA 4AFSC 3QZ5B 1QMCA 2OJ2A 2YUNA 1UJ0A 2CYZB 3GF5A 3GOXA 4E7IA 2BZ8A 1K73C 1YHQA 1BKBA 4EIKA 1JBMA 4LE9A 4WCIA 2EW3A 2LNHB 2FZCB 4EMKC 2XMFA 1TS9A 3HRTA 3UPUA 1YI2A 2ROTA 3GNFB 4J6YA 2RHZA 3FJPA 1YP5A 4OB1B 2K2MA 4M7DD 3C94A 3RKWA 2C0OA 1K8AC 2DAQA 4NL2A 1X6OA 3S3OA 2NUTA 3J81E 1WJSA 4BI3A 3G6EQ 4KT0E 4MDWA 4O6JA 1JJ2P 2EYQA 5GAMf 1LJOA 3JB9H 5FROA 1NE8A 4JJDA 1Y07A 1WZOA 2F1LA 3EG0A 2M51A 2LT1A 3JB9I 4LDUA 1OEBA 3CCEQ 4OMMA 1RAFB 2G6FX 2K4YA 2HL5C 4ZN1A 3L2RA 2CUDA 4PJOB 4M77B 2KK4A 3VJPA 1AVZC 1WA7A 4J9HA 4J5YA 2RNAA 1VQMQ 3G7ZA 5CKFA 3QBYA 2DE0X 1Q7YU 2A28A 2L2PA 2X9HA 3VUZA 2HMAA 1FMVA 2DEUA 3RESA 5I11A 1AWOA 2LVMA 3KBGA 1VQ5T 2VKNA 1IHVA 2CREA 3P8BB 1ZLMA 3QSUA 3EHRA 5LJ3j 3UT1A 1F1BB 4QQGA 1NBEB 3LYIA 3AHUA 3M54A 3NGPA 2NYSA 2O4XB 1FX7A 1UB4A 3JCMQ 2ZCFB 5LJ5j 2O9VA 2MWOA 1EX4A 3H6ZA 3L2QA 1HK9A 2X4XA 2L5QA 3PMTA 2A7YA 4ME7A 3L2WA 2RQRA 2MYSA 2DBKA 1KIKA 2MAMA 2JN0A 3L2VA 4KGXB 1VQNT 3TREA 2KROA 2FRYA 3CCRA 2O9SA 2K3YA 4XTVA 1WIEA 2XICA 3OBWA 2DK3A 3CC7A 2YSQA 3OBYA 4A53A 2QG9B 1ZUKA 4JRQA 4VUBA 2E64A 1M2VA 3E2UA 1PCXA 4BACA 2FB7A 3UATA 4F04B 2BZXA 3LH5A 3V8JA 3QWYA 4DBFA 2IPOB 2PU9B 5IHIA 3QKJA 3SEMA 4C0ZA 3BE3A 4F16A 2WSEE 5GAMe 4ZGDB 5HK0A 1YIJT 2CT3A 3FC3A 1QCNA 5I21A 4NL3A 4F7UG 3G71A 4N4HA 2GGRA 3VS1A 5A2QE 2CKKA 3TU4K 2FL7A 5KYNA 1M5Q1 2RQWA 1VQ4T 1K0XA 1NPPA 3OMCA 4AG2C 2V8IA 3QWXX 4PNOA 3OS5A 3P8HA 1B07A 2WSCE 3CC2Q 3CCMQ 2B86A 4PLIA 1G83A 2E6ZA 4FIBA 1G3SA 2WSFE 3C12A 2KRMA 3FEOA 1D0XA 2NUPB 1YJ9A 4L5GA 1ZQ1A 1UG1A 3NPFA 5LJ3d 3A8HB 2MF2A 4PJNA 3CCSQ 5KYUA 4RTTA 1ARKA 4C92B 1VQPQ 3AT1B 2RI5A 1M1KC 1EFNA 2E3HA 2K5IA 1YITT 5LJ5d 1S72Q 4PJLA 2ZAEA 2EVRA 5GAOn 1TG0A 1R0BG 3CMEA 1ZA2B 2F5TX 1YN8A 2FYKA 4M78G 2DL7A 2LDMA 1GCQA 3EGUA 1DJ7B 3DB3A 4FYXB 3EFRA 5KYXA 3CC4Q 1T3SA 4XK8E 1VQ7Q 3CXCP 3M59A 4M78C 1V1CA 1LNXA 1Y96B 3RBBB 1KJWA 4GLKA 4DOWA 1B7TA 4F7UF 2F5KA 3M0RA 4C5HA 2KNBB 2JM8A 1Q95G 1KG1A 2P4RA 3TSWA 4O5VA 1V29B 2EYZA 1K1ZA 3OYNA 4XU1A 1ZBJA 4MDXA 3CCVT 2QA4A 3EG3A 4A63B 2DLPA 3JRZA 1WHGA 2MWPA 3RKYA 5LJ3e 4DBHA 1N9RA 1VYTA 1BCOA 3L2ZA 2VXEA 3PVQA 2H3EB 5KCOA 3HFOA 2CT4A 4KUDK 2VUBA 4F7UE 5CKEA 5LJ5e 4JJCA 3E1SA 4IUPA 3EGXA 3I55A 1WJQA 3FDRA 5GMKm 1K73U 4F7UA 1WXTA 1Q81R 2RQVA 3DLLA 2RO0A 4LD6A 1ABOA 1PSEA 2D6FA 4QQ6A 2DIQA 1UUEA 2YUQA 3CCEA 5I2MA 3OYMA 1FXXA 4IIOA 2Y4YA 2DEQA 2EQKA 1WHKA 1N6AA 4M78F 2DA9A 1Q86U 1VQMA 2K79A 2E70A 2XG8D 3OW2S 1WHMA 2KEAA 5KE3A 1KHIA 1GBQA 1NLPC 1WQWA 2CP3A 4JZ3A 1RL2A 1UGQB 1NG2A 3REBB 4IUVA 1TTHB 4BD3A 1YCYA 1VQKQ 3P8DA 1T3LA 2KRNA 1K9MC 1A0NB 3O5ZA 3CCLQ 4M78E 3HL8A 1KC8R 1WXUA 1NZ9A 1QKXA 2KXDA 2ROLA 2V8JA 5HKCA 4EPCA 4BI4A 3RDVA 5GJWB 3JCMX 1YHQQ 1OX9A 1UGRB 4MMLA 1H3HA 2P84A 3SWNB 4BE0A 4M78A 3LWIA 1RAHB 3SD4A 2LNVA 4DA4A 1YI2Q 1D3BA 2LQNA 1I81A 5D7UA 3EGDA 1HSQA 3ASKA 3H41A 2EYWA 2QQAA 4XTYA 3MEAA 1AEYA 5GAOq 1VIFA 3CBPA 2EGEA 1OZ3A 1WQ7A 1IZ6A 3CCJA 2HKNA 1OOTA 2V26A 1CKBA 4K11A 3JCMf 1MMAA 1G8XA 4XQ3A 2Y90A 5GAN7 2DERA 4N4IA 1VQOA 2DKGA 1MNEA 5AYFA 1NJIR 3I5RA 1X75C 4R0KA 2ED1A 2NUZA 5CKBA 1QVPA 1I1JA 2VWFA 2VASA 3QO3A 2C0IA 2EGAA 3S6WA 1M8VA 2CGHA 4PK4A 5J39A 3HP9A 3LW5E 2LQKA 4OGCA 3LLRA 3TCJA 4JPBW 4IKFA 2JTEA 4LDVA 4BDYA 2CP7A 1O9SA 1SG5A 3CC2A 3CCMA 1UGSB 3M56A 3MPUB 3QYHB 4QVDA 2QDYB 5GAN6 2XIDA 4KH1B 1HXDA 2X3WD 5DLOA 1VQ5A 4A4EA 3HKSA 1T0JA 2D9TA 2LC4A 4E7JA 1QP2A 3META 3CPWS 1U1SA 1UFFA 2RHXA 4OMLA 4KGVB 2K7AA 5IH2A 1KQSS 3M0TA 2JJ9A 1QW1A 2JTFA 2FRWA 4PFOA 2DILA 2QAZA 2ABLA 1OU8A 3S3NA 4J8OA 1YWPA 1KQ2A 3RNJA 3CD6T 3CCRQ 4KRTA 4ZNXA 1RADB 3NTIA 2KAFA 5CKHA 1JJ2A 5HK3A 3FIFA 1N8RC 3CC7Q 2EJFA 1AWXA 2GFAA 1D1CA 1W4SA 2DZCA 4RUGA 5GANj 2RHIA 3BFMA 2OTJA 3M55A 2RD1A 1Q7YR 3MKDA 2DJQA 2WACA 3OYJA 2K5LA 4RCCA 3QPHA 1K76A 3JCMe 1VQ8T 1W2BS 1W70A 1M1KU 1WGSA 1YIJA 2X3XD 4E2FB 2QQ9A 3THKA 1AWWA 1VOMA 3G71Q 7AT1B 2VGMA 2VYTA 5GJVB 4C8QG 1Q82R 1BIAA 3ME9A 4JS5A 4Z88A 3JCMW 5GAN2 1G2BA 2HCKA 1RABB 3PMIA 2KR3A 4OF1A 1VQ4A 1WPYA 4HVUA 3QZ9B 3JCMc 1KC8U 1VQLT 2KYMA 2NLUA 2FO0A 3G4ST 5LL6S 2MPXC 4X34A 4JJNK 1IGUA 4ZTFA 2KSSA 3NFCA 2FEIA 2A37A 3FRNA 3L2UA 1UTIA 5IXFA 4ATOA 5GANf 2E12A 3EFOB 2LJ3A 1YJ9Q 3G6ET 1EZZB 3ER0A 4C5IA 3OS0A 2F2VA 4LUEA 4FSXA 1M1FA 1W2BP 1OYXA 3OYEA 1QVGP 3EG1A 2KVQG 2L3SA 4D8KA 4M75G 2OAWA 4L59A 2DL3A 5GAMj 2HDAA 3OYAA 2FHDA 1MMGA 1N27A 2K6DA 1UGPB 4XTXA 5HCKA 4OVAA 1VQKA 2PVOB 4FM4B 2DXUA 1NJIU 1IRXA 4RMOA 3CCLA 3E9GA 5GANd 1JXOA 2ENMA 4EMKB 3EHQA 2XHCA 4E6RA 5GMKj 4HA8A 1PKSA 2EAYA 2PTKA 3VUBA 3FB9A 3QDFA 2RHUA 2O88A 2QXFA 4C8QF 4A4FA 1VQ6A 2QA4Q 1K0SA 4BY6C 2DXCA 3CCVA 5CIUA 4WTOB 3CBMA 4KUIA 3BDUA 2P0KA 3M4GA 1I4K1 5KH6A 4ANJA 1OZ2A 3SB2A 4RTVA 1XNIA 4C8QE 1B34A 1WFWA 4PJMA 1K9MU 3I55Q 4BE1A 1R0CB 5GAOm 2DIGA 1MGQA 1WNLA 2J6FA 1Z9QA 3CCUT 2M9UA 3EG2A 4RTXA 4C8QA 4J9FA 4KBMB 1OPKA 3PTAA 4M4ZA 1AZEA 1AWJA 2X35A 1TUDA 1UHFA 2DTHA 5GANe 4XAXB 1QWEA 4TVRA 5EG2A 4M75F 1Z9ZA 1TU0B 2ATCB 4PFPA 5CCAA 2DD4A 3WXMB 1OULA 3CXCA 4RKUE 2E41A 1SRMA 4M7DB 2QTVA 3KXTA 1YWOA 1ACMB 2L3QA 1YNZA 5IN1A 4PJOG 5GAMd 2M0YA 2QK0A 4M77G 2ED0A 2MMPA 1X27A 4M75E 3UWNA 4JJBA 1RLQC 1EIFA 2SEMA 3JB9G 4PJOC 1FMKA 4M77C 1NPRA 1Q82U 2DFUA 2MIOA 2C06A 4M75A 1K73R 4V2SA 1UEBA 1GCQC 3ZBDA 2RN8A 4HCCA 1NM7A 2HZYA 2CH4A 5LJ3g 3OYYA 3CCQT 1BCMA 1E6HA 1UE9A 2J7IA 4HCKA 2BZYA 2BKDN 2JMCA 5LJ5g 4JDSA 2KMTA 1NYGA 5GMKl 1Q86R 1S72T 1K8AR 3EG9A 3CCJQ 1OQKA 3LGLA 2YT6A 2X4WA 2EQUA 3HPWA 1QP3A 1VQ9T 1WHLA 1Y0MA 4FU6A 2DTIA 1Y7XA 2H3JA 3CC4T 1PM3A 1G3TA 2DTOA 1VQOQ 1WYXA 2KGTA 2J06A 3CMAT 5EC7A 1D1AA 1RLPC 1HD3A 2JZ2A 3MP8A 4QVZA 3N5BB 3REAB 4J9DA 5FU6C 4M78D 2RI3A 2DYBA 5GMKi 4FT4A 5GMKe 2PNIA 4PJOF 4M77F 1TH7A 2RH2A 2RMOA 2K2VA 3PIPA 5CR2A 4F14A 3MJXA 4HVWA 4OB0B 1J3TA 3JB9F 2L8DA 4E7KA 2J6OA 1VQ5Q 3OQ5A 3BW1A 1TUGB 4DBRA 2SRCA 4J9IA 5FRNA 4HKEA 3VS7A 2DBMA 3X28B 4PJOE 3RERA 4M77E 4ORZA 4LDWA 3X24B 2XU8A 1JQQA 2HQHA 4M7AB 1Q81C 2QQBA 2JOYA 2RF0A 3M0PA 2COZA 2D1XA 3M9QA 2G3RA 2RM4A 4PJOA 1YJNA 2R5MA 4M77A 1YJWT 1BYMA 1H3ZA 3JAME 2OTLT 4HCBA 2VVKA 4AFUC 3EH2A 3EH1A 1ZSZB 1VQNQ 1VIEA 4C92G 2DVJA 4BE2A 4M7AG 3L1AA 3C95A 5A0LA 2OTJQ 3NHNA 1BK2A 3ZEHA 2QDLA 2KT1A 4X1VA 4BDZA 1K4US 2AT1B 4LDYA 2GNCA 2OI3A 4A54A 5KYWB 2O4XA 3JCMV 3HRSA 4E7HA 1IB8A 3I56A 1YIJQ 1KHCA 4CC3A 3GIBA 5KYYB 5DM7R 3JB9J 1M27C 4ESRA 3OSSC 1SSHA 3MEUA 2KE9A 1PG5B 2VGNA 2A0FB 3GLXA 4FL6A 1W6XA 1SEMA 4JLIA 2QGFB 3E19A 3CPFA 1VQ4Q 2JTMA 2LCLA 3DB4A 2EKOA 4NOYA 1NYFA 1ZA1B 3OS2A 4J7FA 3G4SA 4DOVA 2BE9B 2KBTA 3U23A 1NEBA 3KUFA 1YFNA 2CSIA 4FW2A 2KDSA 4C0FA 2EWNA 4XTUA 3TQ7P 2HBPA 1K8AU 3QG1A 3A8OB 1UJYA 2BIVA 2X51A 3OYCA 1M1KR 4C92F 1RAAB 3R6OA 3QDRB 2KYBA 5CK9A 4II1A 1SSFA
chains in the Genus database with same CATH topology
1S72Q 1VQLQ 1YJWQ 3G4SQ 3CCRQ 1Q86R 2OTLQ 1N8RR 1K8AR 1YI2Q 1VQ6Q 1K73R 3CCJQ 1W2BP 3CC7Q 1VQ4Q 1VQ5Q 1K9MR 1VQKQ 3CCVQ 1QVGP 1VQ9Q 3CCEQ 1M90R 3CPWP 3CMEQ 3G71Q 1KD1R 1VQNQ 3CCLQ 1YJNQ 1KC8R 1YIJQ 1Q82R 1QVFP 3CC4Q 3CCQQ 1NJIR 1KQSP 3CD6Q 3CCSQ 1Q7YR 1VQ7Q 3CMAQ 3G6EQ 3CXCP 1M1KR 1VQPQ 1YITQ 2QEXQ 1YJ9Q 1VQOQ 1YHQQ 3CC2Q 2OTJQ 1Q81R 3I55Q 3CCMQ 1JJ2P 2QA4Q 1VQMQ 3I56Q 1VQ8Q 3CCUQ 3OW2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 Q;  1VQL Q;  1YJW Q;  3G4S Q;  3CCR Q;  1Q86 R;  2OTL Q;  1N8R R;  1K8A R;  1YI2 Q;  1VQ6 Q;  1K73 R;  3CCJ Q;  1W2B P;  3CC7 Q;  1VQ4 Q;  1VQ5 Q;  1K9M R;  1VQK Q;  3CCV Q;  1QVG P;  1VQ9 Q;  3CCE Q;  1M90 R;  3CPW P;  3CME Q;  3G71 Q;  1KD1 R;  1VQN Q;  3CCL Q;  1YJN Q;  1KC8 R;  1YIJ Q;  1Q82 R;  1QVF P;  3CC4 Q;  3CCQ Q;  1NJI R;  1KQS P;  3CD6 Q;  3CCS Q;  1Q7Y R;  1VQ7 Q;  3CMA Q;  3G6E Q;  3CXC P;  1M1K R;  1VQP Q;  1YIT Q;  2QEX Q;  1YJ9 Q;  1VQO Q;  1YHQ Q;  3CC2 Q;  2OTJ Q;  1Q81 R;  3I55 Q;  3CCM Q;  1JJ2 P;  2QA4 Q;  1VQM Q;  3I56 Q;  1VQ8 Q;  3CCU Q;  3OW2 P; 
#chains in the Genus database with same CATH topology
 3E9F A;  3M0S A;  1QQJ A;  1KK7 A;  2EPD A;  4FYY B;  5CVI A;  3UA6 A;  4JRK A;  2HL3 A;  2YRV A;  2BE7 D;  2DXB A;  3JCM g;  3M4Y A;  4J9G A;  1YBY A;  2YUO A;  5IXB A;  2NUP A;  3OYK A;  1JRI A;  2XDB A;  3OYL A;  2DRM A;  3VYH B;  4GLM A;  4RG2 A;  1VQ6 Q;  1WXB A;  4C92 A;  2F69 A;  3JV3 A;  2KI7 A;  4F17 A;  3NMZ C;  5LJ3 h;  3CCV Q;  2JNG A;  2FZK B;  4DQ2 A;  2MOX A;  3H0F A;  4Z8A A;  5LJ5 h;  2E5Q A;  2L3R A;  3OW2 P;  2K9G A;  2QTX A;  4EDU A;  1P92 A;  1O75 A;  2DX1 A;  2EJG A;  3CCR T;  1VUB A;  3M0U A;  3SWN C;  3CEY A;  1QVF S;  1TOV A;  2FPE A;  2QI2 A;  2FG0 A;  3CC7 T;  4LNP A;  1Y96 A;  5IHN A;  4LN2 A;  5GAO r;  4UC4 A;  3L42 A;  1M90 C;  1W2B A;  3CCU A;  2PUO B;  1PD0 A;  1QVG A;  2BTT A;  3LX7 A;  2HD0 A;  2JM9 A;  1Q7Y C;  1ABQ A;  1X6G A;  2VB6 A;  2AHJ B;  1S1N A;  4EMH A;  2HSE B;  2A08 A;  1I8F A;  1ZUY A;  5ECA A;  4XTZ A;  5D6W A;  1SF9 A;  8AT1 B;  2O01 E;  1M4Z A;  4GBQ A;  1U06 A;  2P0Q A;  2RHY A;  2Z0W A;  1KD1 C;  2EFI A;  2HKQ B;  1XJW B;  1ZX6 A;  3MEW A;  3JCM d;  4PJJ A;  2K3X A;  3V7C A;  2FPD A;  4XU2 A;  3IQL A;  2JUF A;  2RPN A;  1K9M R;  1YCS B;  2VV5 A;  2X4Y A;  3O8V A;  1WLP B;  3UDC A;  3GNG A;  2COY A;  2F2X A;  4C8Q D;  3M57 A;  2LQW A;  2A3L A;  3UA7 A;  3WVD B;  2ESW A;  3C0C A;  3VS5 A;  4RG8 A;  3QHS A;  4ZN3 A;  2QEX T;  1M8M A;  2DXT A;  1PRL C;  3URG A;  1WHH A;  3QYG B;  3J80 E;  3OYH A;  1VQN A;  2I2L A;  2YRD A;  3CCQ A;  2X4J A;  4E47 A;  5GAO l;  3J7A F;  3BY7 A;  1M9S A;  3CME T;  1Y71 A;  1AD5 A;  1MV3 A;  4RTY A;  1UEC A;  8ATC B;  2QQS A;  4B9W A;  2MI6 A;  2LZ6 B;  4MZP A;  2ZPG B;  4FCY A;  5FWC A;  1IXD A;  1GL5 A;  4XU3 A;  2NUT B;  2OX7 A;  2PVG B;  2D0Q B;  5GAN g;  2RB6 A;  1JU5 C;  1LOJ A;  4N4G A;  3SWN A;  3CPW P;  4YTL A;  4BB7 A;  4M75 D;  4BUG A;  2EQI A;  1KQS P;  3H0I A;  1X43 A;  1BIB A;  2ZPB B;  2GQV A;  5M9O A;  4P5N A;  4OMN A;  4QVC A;  4C8Q C;  3NTK A;  2CSQ A;  2QYZ A;  3JCM P;  2DNU A;  4RTW A;  4QKU A;  2CZ0 B;  5D6X A;  3RUX A;  4FYW B;  1TSF A;  1M3B A;  4A4K A;  2F2W A;  1U3O A;  1PHT A;  2DO3 A;  5FU7 C;  2C0T A;  4IIM A;  4Z89 A;  2KT8 A;  1YIT A;  2YDL A;  1YJN Q;  3PE0 A;  2W10 A;  3GBQ A;  1GCP A;  2CDT A;  3CCE T;  4CI0 C;  2FPF A;  2OTL A;  4FT2 A;  2J05 A;  4D6W A;  3EFS A;  2DJZ A;  2MCN A;  4EMG A;  1LCK A;  4JLG A;  4CC2 A;  1VA7 A;  1VQM T;  4M75 C;  1N8R R;  1D1B A;  3KFV A;  4B6M A;  1MMN A;  2E5K A;  2DM1 A;  2ZPI B;  3RMQ A;  3VS0 A;  1KSW A;  4B9X A;  4BY6 B;  2RJF A;  1CSK A;  5GAM g;  3SFM A;  1M3C A;  3GPL A;  4KGZ B;  3M53 A;  1M2V B;  3I56 Q;  1SPK A;  2DL5 A;  4C0D C;  1BB9 A;  4DBQ A;  2KXC A;  3X26 B;  1JXM A;  2HQE A;  1JB0 E;  2H8H A;  1ZSG A;  3OYG A;  1PNJ A;  2AK5 A;  1XTD A;  3HTR A;  3NTH A;  1AHJ B;  1N9S A;  5L23 A;  1X6B A;  4PJO D;  4M77 D;  4CRI A;  2YLB A;  3CBO A;  3ULR B;  1VQL Q;  3G4S Q;  3JB9 D;  1I5L A;  1BI3 A;  4J6W A;  1CKA A;  1Q86 C;  3OY9 A;  1SHF A;  3JCM b;  3TSZ A;  3CCJ T;  1QWF A;  4E7Z A;  2YRC A;  4C0G A;  1WDX A;  2JS0 A;  9ATC B;  2JXB A;  1D0Z A;  3QJ6 A;  1RAG B;  1VQO T;  1UHC A;  1R8O B;  1KFZ A;  5KYU B;  2EQJ A;  2ZPH B;  3X25 B;  1V76 A;  3CQT A;  2COW A;  1X01 A;  1JO8 A;  1QLY A;  2D0N A;  2KRS A;  2E4H A;  2CS7 A;  5L8R E;  2A36 A;  3TEE A;  4PKC C;  3SHW A;  1X2Q A;  2CZ1 B;  2CUB A;  3X20 B;  2O31 A;  2RQU A;  2AZS A;  1M90 U;  1SKU B;  4PLL A;  4WF2 A;  3CC2 T;  3RKX A;  3MHX A;  5I2S A;  3CCM T;  4M7D G;  1OX8 A;  5GAO p;  5KYX B;  2D8H A;  5KCH A;  1E6G A;  4XTW A;  2K3B A;  3EFO A;  1MV0 B;  1PC0 A;  2V1Q A;  4FW1 A;  3I9Q A;  3OMG A;  4CC7 A;  1WI7 A;  2GTJ A;  4IUQ A;  2LP5 A;  4JUV A;  4M7D C;  4RCB A;  2QQR A;  2XDP A;  1BBZ A;  3OB9 A;  3OYF A;  2DZ9 A;  2CZ6 B;  3CCS T;  1VQP T;  2R5A A;  1X2K A;  1NLO C;  1KD1 U;  4ZTJ A;  3PVL A;  4QT7 A;  4OMQ A;  4PL6 A;  3LH0 A;  5I22 A;  3PGG A;  1HJD A;  1LVK A;  4OMP A;  1G3W A;  4OP0 A;  1I5O B;  4HT9 A;  2FVU A;  2I0N A;  4EMK A;  1G5V A;  1PWT A;  1VQ7 T;  3CCU Q;  5FU6 B;  2DPP B;  2AIR B;  1UDL A;  3EGX B;  2OTJ T;  4AG1 C;  2AKK A;  5GAN h;  3GP8 A;  2R58 A;  3OYB A;  4F7U B;  1VYV A;  2ZPF B;  3VYG A;  2DMO A;  4RTU A;  1MUZ A;  2HBW A;  2J6K A;  5CKD A;  4MZT A;  5DY9 A;  1PD1 A;  4C92 D;  4LXC A;  1ZHI A;  1WX6 A;  2LJ1 A;  1N8R U;  1QCF A;  4M7A D;  3H9N A;  3M58 A;  1UGV A;  5LJ3 f;  4HT8 A;  3MCA B;  2IIM A;  3DKM A;  4HVV A;  2V1R A;  2DET A;  4J7I A;  4XU0 A;  1I07 A;  3PFS A;  4M7D F;  5LJ5 f;  2RK1 A;  1OU9 A;  1JEG A;  3CXC S;  3HSB A;  3OSV A;  3PNW C;  1IRE B;  4JS4 A;  3QII A;  4KUL A;  2LCC A;  1AZG B;  3OW2 A;  3MEV A;  4M7D E;  2L89 A;  2CZ7 B;  1T0H A;  2JW4 A;  4ELY C;  5J3B A;  2CP5 A;  2QEX A;  4M78 B;  2YUP A;  3CD6 A;  3INZ A;  1X69 A;  1ZBX A;  1FYN A;  3CCQ Q;  1D3B B;  4J9E A;  4M7D A;  2ZZD A;  5IAY A;  3EGD B;  3VV0 A;  2JT4 A;  2RJE A;  3I35 A;  1GBR A;  1TWB A;  3A98 A;  4C92 C;  3A5Z B;  3V8K A;  1KQ1 A;  4M7A C;  1R77 A;  2OAU A;  3PIO A;  3QUI A;  5GAM h;  1VQ9 Q;  1RAC B;  4OB2 B;  3I5S A;  4C5G A;  1VQK T;  1VQ8 A;  5DLQ E;  3V7S A;  4LD9 K;  4PFZ A;  3CMA Q;  3A8G B;  1KC8 C;  3VS6 A;  3CCL T;  2EQM A;  1ZSZ C;  1B3Q A;  1H8K A;  1YHQ T;  5GMK h;  1PKT A;  2XD0 A;  2EYX A;  4RTZ A;  2YHT A;  2LJ0 A;  3OS1 A;  4IUU A;  1VQ6 T;  1LPL A;  1YI2 T;  3A8M B;  1GXI E;  6AT1 B;  2CH4 W;  1M1G A;  3M5A A;  1VQL A;  4JRI A;  2GCX A;  2XK0 A;  2EBP A;  1QVF A;  1FMW A;  1BU1 A;  1IGQ A;  1OV3 A;  5CQY A;  2DL4 A;  2BUD A;  1BI2 A;  2E1H A;  5GAN 5;  4J83 A;  3A1P A;  2LX7 A;  5FLX E;  3G6E A;  2RI2 A;  1MND A;  3RR6 A;  2HAX A;  2L3P A;  3G1J A;  4X9C A;  4ELZ C;  2L0A A;  1YIT Q;  1NJI C;  4FYV B;  2CP6 A;  4M7A F;  3DLM A;  1RAE B;  1YJW Q;  2YWW A;  2OTL Q;  4J9C A;  1TUC A;  4HCZ A;  1IO6 A;  2M0O A;  2LT4 A;  1D09 B;  4IUR A;  1VYU A;  5CAI A;  1WHJ A;  5D6Y A;  2HQX A;  4Y28 E;  2GBQ A;  3Q1J A;  3CPW A;  4C92 E;  4Z02 A;  5C0M A;  2CP2 A;  2LRQ A;  4M7A E;  1KQS A;  4L6V 5;  4AMC A;  2NWM A;  4J9B A;  1NEG A;  3LWH A;  2V8K A;  4LUD A;  1GRI A;  3VS3 A;  4CC4 B;  1GFD A;  4M7A A;  1H92 A;  2KY9 A;  4A4G A;  1OI1 A;  4JZ4 A;  3D7S B;  5KE2 A;  3VS2 A;  2PZ1 A;  1E7O A;  1Y57 A;  2YXY A;  4OMO A;  3VU3 C;  1ZSZ A;  2KQW A;  2EIF A;  1RI9 A;  2GF7 A;  1TXQ A;  4AFZ C;  1ZUU A;  2RQT A;  1M3A A;  2DF6 A;  2XDD A;  2HEQ A;  3S3M A;  3ZL7 C;  3C4S A;  1AT1 B;  2ZGW A;  1C0M A;  1RI0 A;  3RMS A;  4ZGJ B;  5KYW A;  5IT9 E;  1QCO A;  3JCM J;  5AT1 B;  2LTO A;  2M1H A;  1FWZ A;  4E7S A;  4ZGE B;  3MO8 A;  3VKI A;  2DD5 A;  4AFQ C;  3EAE A;  4J6X A;  5A0D A;  2EYY A;  3H0H A;  5KYY A;  3MP6 A;  2QAS A;  3BDL A;  2O2O A;  2DVE A;  2RK2 A;  4KH0 B;  2GQI A;  4HXJ A;  3SDZ A;  4E7L A;  1OPL A;  5FWB A;  1I0C A;  3G71 T;  2E6N A;  1Q82 C;  3LGF A;  1GFC A;  3WVE B;  4LDX A;  5J26 A;  1M2O A;  2RJD A;  1IHW A;  1D0Y A;  1G3Y A;  3OYI A;  3VS4 A;  2DYI A;  4D8D A;  2QGG A;  2LQ8 A;  1QVF P;  2VXF A;  4R55 A;  4GY5 A;  5GAN 3;  2PVD B;  3VRY A;  5IHK A;  2W0Z A;  1YJ9 T;  5FRM A;  2HNI A;  1XQH A;  3OYD A;  4R56 A;  4N0A C;  4A4H A;  1K9A A;  2LMJ A;  4QQD A;  3CCS A;  2K57 A;  1VQP A;  2M16 A;  4OMF B;  3MP1 A;  1XOV A;  1S72 A;  1YJN T;  1WJR A;  3OA6 A;  1C1A A;  2JS2 A;  2RJC A;  2K5F A;  1VQ9 A;  5CQX A;  1B34 B;  2ECZ A;  5GAN 8;  1BI1 A;  2IVW A;  2JMA A;  2JVV A;  3CC4 A;  4Y92 A;  3V7R A;  1Q81 U;  1VQ7 A;  4OGE A;  1M90 R;  3CMA A;  1N5Z A;  3HFN A;  5HY6 A;  1QKW A;  2XI9 A;  1SRL A;  1C6V X;  1PSF A;  2P4T A;  4AT1 B;  4C8Q B;  1MHN A;  3TVT A;  4OB3 B;  3H8Z A;  1U5S A;  2GFU A;  1W1F A;  5C6S A;  1U8R A;  1PRM C;  2PUK B;  3I56 T;  2QA4 T;  2LCS A;  1QVG S;  1M30 A;  2VC8 A;  3HHT B;  3A8L B;  3QXE B;  4JRP A;  1U1T A;  2RA2 A;  1KD1 R;  1H64 1;  2B8A A;  2AZV A;  5FU7 B;  2R57 A;  4DEY A;  4IUT A;  3M0Q A;  2E65 A;  4C5E A;  2XKO C;  2M02 A;  3I55 T;  2LX9 A;  2FZG B;  4QW2 A;  4NS5 A;  3HRU A;  3FJ5 A;  2DL8 A;  3FLG A;  3UF4 A;  4DEX A;  4MZM A;  2CP0 A;  3F70 A;  2D8J A;  1SHG A;  4M75 B;  1YJW A;  1RAI B;  4FSS A;  2MK5 A;  2QEX Q;  2ZPE B;  2GTO A;  3CD6 Q;  2DRK A;  3QJY A;  4Y91 A;  2AKL A;  4X9D A;  1RUW A;  1BI0 A;  2IG0 A;  5FW9 A;  2PQW A;  3VRZ A;  1MMD A;  4MMK A;  4N0A A;  3PT9 A;  3CME Q;  3T9N A;  2E10 A;  1AOJ A;  4C0D B;  3JCM h;  2P0P A;  5GAN 4;  2E3I A;  3ZFJ A;  4BI8 B;  3RIR A;  2HSP A;  3JSC A;  5CO7 A;  2EGC A;  4Q5W A;  1JJ2 S;  3EG9 B;  3R6N A;  1VQ8 Q;  2YLC A;  1HYO A;  2Y4X A;  2EJ9 A;  2EKH A;  3V8L A;  5A0G A;  4AFS C;  3QZ5 B;  1QMC A;  2OJ2 A;  2YUN A;  1UJ0 A;  2CYZ B;  3GF5 A;  3GOX A;  4E7I A;  2BZ8 A;  1K73 C;  1YHQ A;  1BKB A;  4EIK A;  1JBM A;  4LE9 A;  4WCI A;  2EW3 A;  2LNH B;  2FZC B;  4EMK C;  2XMF A;  1TS9 A;  3HRT A;  3UPU A;  1YI2 A;  2ROT A;  3GNF B;  4J6Y A;  2RHZ A;  3FJP A;  1YP5 A;  4OB1 B;  2K2M A;  4M7D D;  3C94 A;  3RKW A;  2C0O A;  1K8A C;  2DAQ A;  4NL2 A;  1X6O A;  3S3O A;  2NUT A;  3J81 E;  1WJS A;  4BI3 A;  3G6E Q;  4KT0 E;  4MDW A;  4O6J A;  1JJ2 P;  2EYQ A;  5GAM f;  1LJO A;  3JB9 H;  5FRO A;  1NE8 A;  4JJD A;  1Y07 A;  1WZO A;  2F1L A;  3EG0 A;  2M51 A;  2LT1 A;  3JB9 I;  4LDU A;  1OEB A;  3CCE Q;  4OMM A;  1RAF B;  2G6F X;  2K4Y A;  2HL5 C;  4ZN1 A;  3L2R A;  2CUD A;  4PJO B;  4M77 B;  2KK4 A;  3VJP A;  1AVZ C;  1WA7 A;  4J9H A;  4J5Y A;  2RNA A;  1VQM Q;  3G7Z A;  5CKF A;  3QBY A;  2DE0 X;  1Q7Y U;  2A28 A;  2L2P A;  2X9H A;  3VUZ A;  2HMA A;  1FMV A;  2DEU A;  3RES A;  5I11 A;  1AWO A;  2LVM A;  3KBG A;  1VQ5 T;  2VKN A;  1IHV A;  2CRE A;  3P8B B;  1ZLM A;  3QSU A;  3EHR A;  5LJ3 j;  3UT1 A;  1F1B B;  4QQG A;  1NBE B;  3LYI A;  3AHU A;  3M54 A;  3NGP A;  2NYS A;  2O4X B;  1FX7 A;  1UB4 A;  3JCM Q;  2ZCF B;  5LJ5 j;  2O9V A;  2MWO A;  1EX4 A;  3H6Z A;  3L2Q A;  1HK9 A;  2X4X A;  2L5Q A;  3PMT A;  2A7Y A;  4ME7 A;  3L2W A;  2RQR A;  2MYS A;  2DBK A;  1KIK A;  2MAM A;  2JN0 A;  3L2V A;  4KGX B;  1VQN T;  3TRE A;  2KRO A;  2FRY A;  3CCR A;  2O9S A;  2K3Y A;  4XTV A;  1WIE A;  2XIC A;  3OBW A;  2DK3 A;  3CC7 A;  2YSQ A;  3OBY A;  4A53 A;  2QG9 B;  1ZUK A;  4JRQ A;  4VUB A;  2E64 A;  1M2V A;  3E2U A;  1PCX A;  4BAC A;  2FB7 A;  3UAT A;  4F04 B;  2BZX A;  3LH5 A;  3V8J A;  3QWY A;  4DBF A;  2IPO B;  2PU9 B;  5IHI A;  3QKJ A;  3SEM A;  4C0Z A;  3BE3 A;  4F16 A;  2WSE E;  5GAM e;  4ZGD B;  5HK0 A;  1YIJ T;  2CT3 A;  3FC3 A;  1QCN A;  5I21 A;  4NL3 A;  4F7U G;  3G71 A;  4N4H A;  2GGR A;  3VS1 A;  5A2Q E;  2CKK A;  3TU4 K;  2FL7 A;  5KYN A;  1M5Q 1;  2RQW A;  1VQ4 T;  1K0X A;  1NPP A;  3OMC A;  4AG2 C;  2V8I A;  3QWX X;  4PNO A;  3OS5 A;  3P8H A;  1B07 A;  2WSC E;  3CC2 Q;  3CCM Q;  2B86 A;  4PLI A;  1G83 A;  2E6Z A;  4FIB A;  1G3S A;  2WSF E;  3C12 A;  2KRM A;  3FEO A;  1D0X A;  2NUP B;  1YJ9 A;  4L5G A;  1ZQ1 A;  1UG1 A;  3NPF A;  5LJ3 d;  3A8H B;  2MF2 A;  4PJN A;  3CCS Q;  5KYU A;  4RTT A;  1ARK A;  4C92 B;  1VQP Q;  3AT1 B;  2RI5 A;  1M1K C;  1EFN A;  2E3H A;  2K5I A;  1YIT T;  5LJ5 d;  1S72 Q;  4PJL A;  2ZAE A;  2EVR A;  5GAO n;  1TG0 A;  1R0B G;  3CME A;  1ZA2 B;  2F5T X;  1YN8 A;  2FYK A;  4M78 G;  2DL7 A;  2LDM A;  1GCQ A;  3EGU A;  1DJ7 B;  3DB3 A;  4FYX B;  3EFR A;  5KYX A;  3CC4 Q;  1T3S A;  4XK8 E;  1VQ7 Q;  3CXC P;  3M59 A;  4M78 C;  1V1C A;  1LNX A;  1Y96 B;  3RBB B;  1KJW A;  4GLK A;  4DOW A;  1B7T A;  4F7U F;  2F5K A;  3M0R A;  4C5H A;  2KNB B;  2JM8 A;  1Q95 G;  1KG1 A;  2P4R A;  3TSW A;  4O5V A;  1V29 B;  2EYZ A;  1K1Z A;  3OYN A;  4XU1 A;  1ZBJ A;  4MDX A;  3CCV T;  2QA4 A;  3EG3 A;  4A63 B;  2DLP A;  3JRZ A;  1WHG A;  2MWP A;  3RKY A;  5LJ3 e;  4DBH A;  1N9R A;  1VYT A;  1BCO A;  3L2Z A;  2VXE A;  3PVQ A;  2H3E B;  5KCO A;  3HFO A;  2CT4 A;  4KUD K;  2VUB A;  4F7U E;  5CKE A;  5LJ5 e;  4JJC A;  3E1S A;  4IUP A;  3EGX A;  3I55 A;  1WJQ A;  3FDR A;  5GMK m;  1K73 U;  4F7U A;  1WXT A;  1Q81 R;  2RQV A;  3DLL A;  2RO0 A;  4LD6 A;  1ABO A;  1PSE A;  2D6F A;  4QQ6 A;  2DIQ A;  1UUE A;  2YUQ A;  3CCE A;  5I2M A;  3OYM A;  1FXX A;  4IIO A;  2Y4Y A;  2DEQ A;  2EQK A;  1WHK A;  1N6A A;  4M78 F;  2DA9 A;  1Q86 U;  1VQM A;  2K79 A;  2E70 A;  2XG8 D;  3OW2 S;  1WHM A;  2KEA A;  5KE3 A;  1KHI A;  1GBQ A;  1NLP C;  1WQW A;  2CP3 A;  4JZ3 A;  1RL2 A;  1UGQ B;  1NG2 A;  3REB B;  4IUV A;  1TTH B;  4BD3 A;  1YCY A;  1VQK Q;  3P8D A;  1T3L A;  2KRN A;  1K9M C;  1A0N B;  3O5Z A;  3CCL Q;  4M78 E;  3HL8 A;  1KC8 R;  1WXU A;  1NZ9 A;  1QKX A;  2KXD A;  2ROL A;  2V8J A;  5HKC A;  4EPC A;  4BI4 A;  3RDV A;  5GJW B;  3JCM X;  1YHQ Q;  1OX9 A;  1UGR B;  4MML A;  1H3H A;  2P84 A;  3SWN B;  4BE0 A;  4M78 A;  3LWI A;  1RAH B;  3SD4 A;  2LNV A;  4DA4 A;  1YI2 Q;  1D3B A;  2LQN A;  1I81 A;  5D7U A;  3EGD A;  1HSQ A;  3ASK A;  3H41 A;  2EYW A;  2QQA A;  4XTY A;  3MEA A;  1AEY A;  5GAO q;  1VIF A;  3CBP A;  2EGE A;  1OZ3 A;  1WQ7 A;  1IZ6 A;  3CCJ A;  2HKN A;  1OOT A;  2V26 A;  1CKB A;  4K11 A;  3JCM f;  1MMA A;  1G8X A;  4XQ3 A;  2Y90 A;  5GAN 7;  2DER A;  4N4I A;  1VQO A;  2DKG A;  1MNE A;  5AYF A;  1NJI R;  3I5R A;  1X75 C;  4R0K A;  2ED1 A;  2NUZ A;  5CKB A;  1QVP A;  1I1J A;  2VWF A;  2VAS A;  3QO3 A;  2C0I A;  2EGA A;  3S6W A;  1M8V A;  2CGH A;  4PK4 A;  5J39 A;  3HP9 A;  3LW5 E;  2LQK A;  4OGC A;  3LLR A;  3TCJ A;  4JPB W;  4IKF A;  2JTE A;  4LDV A;  4BDY A;  2CP7 A;  1O9S A;  1SG5 A;  3CC2 A;  3CCM A;  1UGS B;  3M56 A;  3MPU B;  3QYH B;  4QVD A;  2QDY B;  5GAN 6;  2XID A;  4KH1 B;  1HXD A;  2X3W D;  5DLO A;  1VQ5 A;  4A4E A;  3HKS A;  1T0J A;  2D9T A;  2LC4 A;  4E7J A;  1QP2 A;  3MET A;  3CPW S;  1U1S A;  1UFF A;  2RHX A;  4OML A;  4KGV B;  2K7A A;  5IH2 A;  1KQS S;  3M0T A;  2JJ9 A;  1QW1 A;  2JTF A;  2FRW A;  4PFO A;  2DIL A;  2QAZ A;  2ABL A;  1OU8 A;  3S3N A;  4J8O A;  1YWP A;  1KQ2 A;  3RNJ A;  3CD6 T;  3CCR Q;  4KRT A;  4ZNX A;  1RAD B;  3NTI A;  2KAF A;  5CKH A;  1JJ2 A;  5HK3 A;  3FIF A;  1N8R C;  3CC7 Q;  2EJF A;  1AWX A;  2GFA A;  1D1C A;  1W4S A;  2DZC A;  4RUG A;  5GAN j;  2RHI A;  3BFM A;  2OTJ A;  3M55 A;  2RD1 A;  1Q7Y R;  3MKD A;  2DJQ A;  2WAC A;  3OYJ A;  2K5L A;  4RCC A;  3QPH A;  1K76 A;  3JCM e;  1VQ8 T;  1W2B S;  1W70 A;  1M1K U;  1WGS A;  1YIJ A;  2X3X D;  4E2F B;  2QQ9 A;  3THK A;  1AWW A;  1VOM A;  3G71 Q;  7AT1 B;  2VGM A;  2VYT A;  5GJV B;  4C8Q G;  1Q82 R;  1BIA A;  3ME9 A;  4JS5 A;  4Z88 A;  3JCM W;  5GAN 2;  1G2B A;  2HCK A;  1RAB B;  3PMI A;  2KR3 A;  4OF1 A;  1VQ4 A;  1WPY A;  4HVU A;  3QZ9 B;  3JCM c;  1KC8 U;  1VQL T;  2KYM A;  2NLU A;  2FO0 A;  3G4S T;  5LL6 S;  2MPX C;  4X34 A;  4JJN K;  1IGU A;  4ZTF A;  2KSS A;  3NFC A;  2FEI A;  2A37 A;  3FRN A;  3L2U A;  1UTI A;  5IXF A;  4ATO A;  5GAN f;  2E12 A;  3EFO B;  2LJ3 A;  1YJ9 Q;  3G6E T;  1EZZ B;  3ER0 A;  4C5I A;  3OS0 A;  2F2V A;  4LUE A;  4FSX A;  1M1F A;  1W2B P;  1OYX A;  3OYE A;  1QVG P;  3EG1 A;  2KVQ G;  2L3S A;  4D8K A;  4M75 G;  2OAW A;  4L59 A;  2DL3 A;  5GAM j;  2HDA A;  3OYA A;  2FHD A;  1MMG A;  1N27 A;  2K6D A;  1UGP B;  4XTX A;  5HCK A;  4OVA A;  1VQK A;  2PVO B;  4FM4 B;  2DXU A;  1NJI U;  1IRX A;  4RMO A;  3CCL A;  3E9G A;  5GAN d;  1JXO A;  2ENM A;  4EMK B;  3EHQ A;  2XHC A;  4E6R A;  5GMK j;  4HA8 A;  1PKS A;  2EAY A;  2PTK A;  3VUB A;  3FB9 A;  3QDF A;  2RHU A;  2O88 A;  2QXF A;  4C8Q F;  4A4F A;  1VQ6 A;  2QA4 Q;  1K0S A;  4BY6 C;  2DXC A;  3CCV A;  5CIU A;  4WTO B;  3CBM A;  4KUI A;  3BDU A;  2P0K A;  3M4G A;  1I4K 1;  5KH6 A;  4ANJ A;  1OZ2 A;  3SB2 A;  4RTV A;  1XNI A;  4C8Q E;  1B34 A;  1WFW A;  4PJM A;  1K9M U;  3I55 Q;  4BE1 A;  1R0C B;  5GAO m;  2DIG A;  1MGQ A;  1WNL A;  2J6F A;  1Z9Q A;  3CCU T;  2M9U A;  3EG2 A;  4RTX A;  4C8Q A;  4J9F A;  4KBM B;  1OPK A;  3PTA A;  4M4Z A;  1AZE A;  1AWJ A;  2X35 A;  1TUD A;  1UHF A;  2DTH A;  5GAN e;  4XAX B;  1QWE A;  4TVR A;  5EG2 A;  4M75 F;  1Z9Z A;  1TU0 B;  2ATC B;  4PFP A;  5CCA A;  2DD4 A;  3WXM B;  1OUL A;  3CXC A;  4RKU E;  2E41 A;  1SRM A;  4M7D B;  2QTV A;  3KXT A;  1YWO A;  1ACM B;  2L3Q A;  1YNZ A;  5IN1 A;  4PJO G;  5GAM d;  2M0Y A;  2QK0 A;  4M77 G;  2ED0 A;  2MMP A;  1X27 A;  4M75 E;  3UWN A;  4JJB A;  1RLQ C;  1EIF A;  2SEM A;  3JB9 G;  4PJO C;  1FMK A;  4M77 C;  1NPR A;  1Q82 U;  2DFU A;  2MIO A;  2C06 A;  4M75 A;  1K73 R;  4V2S A;  1UEB A;  1GCQ C;  3ZBD A;  2RN8 A;  4HCC A;  1NM7 A;  2HZY A;  2CH4 A;  5LJ3 g;  3OYY A;  3CCQ T;  1BCM A;  1E6H A;  1UE9 A;  2J7I A;  4HCK A;  2BZY A;  2BKD N;  2JMC A;  5LJ5 g;  4JDS A;  2KMT A;  1NYG A;  5GMK l;  1Q86 R;  1S72 T;  1K8A R;  3EG9 A;  3CCJ Q;  1OQK A;  3LGL A;  2YT6 A;  2X4W A;  2EQU A;  3HPW A;  1QP3 A;  1VQ9 T;  1WHL A;  1Y0M A;  4FU6 A;  2DTI A;  1Y7X A;  2H3J A;  3CC4 T;  1PM3 A;  1G3T A;  2DTO A;  1VQO Q;  1WYX A;  2KGT A;  2J06 A;  3CMA T;  5EC7 A;  1D1A A;  1RLP C;  1HD3 A;  2JZ2 A;  3MP8 A;  4QVZ A;  3N5B B;  3REA B;  4J9D A;  5FU6 C;  4M78 D;  2RI3 A;  2DYB A;  5GMK i;  4FT4 A;  5GMK e;  2PNI A;  4PJO F;  4M77 F;  1TH7 A;  2RH2 A;  2RMO A;  2K2V A;  3PIP A;  5CR2 A;  4F14 A;  3MJX A;  4HVW A;  4OB0 B;  1J3T A;  3JB9 F;  2L8D A;  4E7K A;  2J6O A;  1VQ5 Q;  3OQ5 A;  3BW1 A;  1TUG B;  4DBR A;  2SRC A;  4J9I A;  5FRN A;  4HKE A;  3VS7 A;  2DBM A;  3X28 B;  4PJO E;  3RER A;  4M77 E;  4ORZ A;  4LDW A;  3X24 B;  2XU8 A;  1JQQ A;  2HQH A;  4M7A B;  1Q81 C;  2QQB A;  2JOY A;  2RF0 A;  3M0P A;  2COZ A;  2D1X A;  3M9Q A;  2G3R A;  2RM4 A;  4PJO A;  1YJN A;  2R5M A;  4M77 A;  1YJW T;  1BYM A;  1H3Z A;  3JAM E;  2OTL T;  4HCB A;  2VVK A;  4AFU C;  3EH2 A;  3EH1 A;  1ZSZ B;  1VQN Q;  1VIE A;  4C92 G;  2DVJ A;  4BE2 A;  4M7A G;  3L1A A;  3C95 A;  5A0L A;  2OTJ Q;  3NHN A;  1BK2 A;  3ZEH A;  2QDL A;  2KT1 A;  4X1V A;  4BDZ A;  1K4U S;  2AT1 B;  4LDY A;  2GNC A;  2OI3 A;  4A54 A;  5KYW B;  2O4X A;  3JCM V;  3HRS A;  4E7H A;  1IB8 A;  3I56 A;  1YIJ Q;  1KHC A;  4CC3 A;  3GIB A;  5KYY B;  5DM7 R;  3JB9 J;  1M27 C;  4ESR A;  3OSS C;  1SSH A;  3MEU A;  2KE9 A;  1PG5 B;  2VGN A;  2A0F B;  3GLX A;  4FL6 A;  1W6X A;  1SEM A;  4JLI A;  2QGF B;  3E19 A;  3CPF A;  1VQ4 Q;  2JTM A;  2LCL A;  3DB4 A;  2EKO A;  4NOY A;  1NYF A;  1ZA1 B;  3OS2 A;  4J7F A;  3G4S A;  4DOV A;  2BE9 B;  2KBT A;  3U23 A;  1NEB A;  3KUF A;  1YFN A;  2CSI A;  4FW2 A;  2KDS A;  4C0F A;  2EWN A;  4XTU A;  3TQ7 P;  2HBP A;  1K8A U;  3QG1 A;  3A8O B;  1UJY A;  2BIV A;  2X51 A;  3OYC A;  1M1K R;  4C92 F;  1RAA B;  3R6O A;  3QDR B;  2KYB A;  5CK9 A;  4II1 A;  1SSF A; 
#chains in the Genus database with same CATH homology
 1S72 Q;  1VQL Q;  1YJW Q;  3G4S Q;  3CCR Q;  1Q86 R;  2OTL Q;  1N8R R;  1K8A R;  1YI2 Q;  1VQ6 Q;  1K73 R;  3CCJ Q;  1W2B P;  3CC7 Q;  1VQ4 Q;  1VQ5 Q;  1K9M R;  1VQK Q;  3CCV Q;  1QVG P;  1VQ9 Q;  3CCE Q;  1M90 R;  3CPW P;  3CME Q;  3G71 Q;  1KD1 R;  1VQN Q;  3CCL Q;  1YJN Q;  1KC8 R;  1YIJ Q;  1Q82 R;  1QVF P;  3CC4 Q;  3CCQ Q;  1NJI R;  1KQS P;  3CD6 Q;  3CCS Q;  1Q7Y R;  1VQ7 Q;  3CMA Q;  3G6E Q;  3CXC P;  1M1K R;  1VQP Q;  1YIT Q;  2QEX Q;  1YJ9 Q;  1VQO Q;  1YHQ Q;  3CC2 Q;  2OTJ Q;  1Q81 R;  3I55 Q;  3CCM Q;  1JJ2 P;  2QA4 Q;  1VQM Q;  3I56 Q;  1VQ8 Q;  3CCU Q;  3OW2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...