3G71Q

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3g71Q00
3CCSQ 1VQ9Q 1KQSP 3I56Q 1JJ2P 1VQ5Q 1VQKQ 1VQ6Q 3CPWP 3OW2P 1W2BP 3CMAQ 1NJIR 1YHQQ 3CC2Q 1YIJQ 1VQPQ 1VQMQ 1VQNQ 1K73R 1VQOQ 3CCQQ 1Q81R 3CXCP 1M90R 1VQ4Q 1VQ7Q 1K8AR 2OTJQ 1QVGP 3G6EQ 1Q82R 3CCUQ 3G71Q 1VQLQ 1YITQ 1Q86R 1YI2Q 3CC7Q 3CCVQ 3CCJQ 3CCRQ 1YJ9Q 2QEXQ 1KD1R 2QA4Q 3CC4Q 1QVFP 1YJWQ 1S72Q 3G4SQ 3CCMQ 1KC8R 3I55Q 3CCEQ 3CD6Q 1N8RR 1YJNQ 1K9MR 1Q7YR 2OTLQ 1M1KR 3CMEQ 1VQ8Q 3CCLQ
chains in the Genus database with same CATH superfamily
1CKAA 1JJ2P 2K5LA 1UE9A 1YJWA 1Z9QA 1BKBA 3HP9A 3NFCA 4FYXB 4JJBA 2J06A 4PJLA 5GAOl 4P5NA 1UG1A 2W0ZA 3I35A 3UDCA 2ZPFB 1WHGA 2QG9B 1IGQA 3VYHB 2DILA 3PMTA 3RMSA 2CZ1B 1W2BS 4GBQA 2XD0A 2FZGB 2RQTA 1TTHB 3QO3A 4XU1A 2CT3A 3CCEQ 4FT4A 2FRYA 3NTHA 2KNBB 1B34B 3M0SA 3JB9F 1M3BA 2A3LA 2YXYA 4RTWA 4Y91A 4M75C 1OPKA 1W4SA 2KVQG 1RADB 2HQHA 3DLMA 2VUBA 2EGCA 2PQWA 2OTJQ 1M2VA 4RG8A 2X35A 1WXUA 1BCMA 5DY9A 1YCSB 3E2UA 3CCRT 2V8KA 4FSXA 3HTRA 1PWTA 2DMOA 1I5OB 2LX9A 3QDRB 4PFPA 4XU2A 5CKFA 5GAN4 3OYCA 3E9GA 2ZCFB 3OYYA 3CCLT 3G4SA 4PL6A 1IHVA 3JCMV 2AHJB 2KSSA 2PUOB 3S3NA 1PM3A 1X01A 1IXDA 1MMNA 1FXXA 2QEXT 3JCMf 2D6FA 3OQ5A 5GAN3 1UJYA 1NYFA 2QTVA 1M3AA 3M0PA 4V2SA 4X1VA 3V8LA 1PCXA 2EYXA 3JB9J 1VQNQ 1YIJT 4C92F 5AYFA 3CCQQ 2L89A 3QJYA 1OQKA 2L8DA 3CCSA 4M77B 2RM4A 4BB7A 4JRPA 1K73U 2VKNA 2RJFA 1WPYA 1G3YA 1BIAA 3QG1A 3L2VA 2CP0A 2FO0A 2KQWA 4F7UF 3CMAT 1PRMC 1AEYA 3EHQA 2JXBA 1JJ2S 1Q86R 2KBTA 2V26A 2CUDA 4XAXB 2DVJA 1QWFA 4OF1A 4M7DF 2KR3A 2DM1A 2HNIA 3CD6T 2JT4A 1SRLA 1UGSB 5CQYA 1PNJA 1Y07A 4LE9A 2MMPA 3INZA 4HA8A 4M78E 3RBBB 1RAIB 1VQ7Q 2DFUA 2DL8A 3PVLA 3CQTA 3I56A 1WNLA 4A4FA 5LJ5j 1MMDA 2VB6A 3OW2A 1X2KA 2D0QB 3EFOA 5GAN6 3FJ5A 1ZSGA 4M77A 2LDMA 1M9SA 3PTAA 2BE9B 2JNGA 2CREA 3CC7A 2ECZA 3GOXA 3C4SA 2XKOC 2A37A 2DXBA 3M59A 2K5FA 4RCCA 1MNEA 1M1KC 3G6EQ 1VQ9A 2RPNA 2JMAA 1X6GA 2HKNA 1EX4A 4EMGA 4OP0A 2GQIA 1BIBA 2QQRA 2HSEB 2YSQA 3G71A 3I55T 2DNUA 2X4WA 2X4JA 3SFMA 5I2SA 2QQ9A 4GY5A 5GANe 1KQSS 2CH4A 3AT1B 3PMIA 4M77C 1WI7A 1MMGA 2GFAA 2VASA 2CSIA 1VQ4A 3EG3A 2RI2A 1UGRB 4B9WA 4PK4A 1M5Q1 5KE2A 2PVGB 4HVWA 3OYBA 4OMQA 1VQMQ 4BI8B 4RTXA 4FU6A 1MV0B 1VQ6A 4BE1A 3MP6A 2GCXA 2FRWA 3CCJT 3EG1A 3OBWA 1HJDA 1AZGB 3CXCA 2CUBA 4BI4A 4C8QG 2ZPHB 1UJ0A 2E64A 1TH7A 2LNHB 2NLUA 3NMZC 2YRCA 3VJPA 4R56A 3EFRA 1VA7A 2CZ7B 2DTIA 2DJZA 1HK9A 3HRSA 4KGZB 1LCKA 2EBPA 3QWYA 3OSVA 3UATA 3V7SA 2DXTA 3CMEQ 5LJ3h 2DYBA 4J6XA 3S3MA 3CBPA 5D6WA 3VRZA 5A0LA 4M78D 4KGVB 2DX1A 1OX9A 2IIMA 2MPXC 3EH2A 1SG5A 3PE0A 1IO6A 1IRXA 2AZSA 1Y0MA 4FYWB 1YITT 2K2VA 2CP7A 3A8HB 3BW1A 4EPCA 1RABB 2LQ8A 4RTYA 1Q82U 3JB9G 3E19A 3T9NA 3REBB 1E6GA 4HVUA 4J6YA 1D3BA 4RTVA 3CPWP 1I8FA 4C8QD 3CCEA 3C0CA 4GLKA 1OZ2A 1T0HA 3H0FA 1LPLA 1K8AR 4FCYA 4AFQC 2HCKA 3MPUB 4JDSA 3M54A 2CZ6B 4HCZA 1X69A 2FEIA 4XTXA 2KYBA 2QA4T 2LQKA 4PLIA 4M7AF 4KRTA 4M75E 4AG2C 3JCMb 2F5KA 2EGAA 2OTJA 4NS5A 2E3IA 1HYOA 3QUIA 1JXMA 5L8RE 1YBYA 1BCOA 3RDVA 2E3HA 5FW9A 1TUGB 4DBRA 1GCQA 3JAME 2J6KA 3C94A 2DAQA 2OI3A 5FWCA 3L2RA 5KE3A 3KBGA 2EPDA 4OB3B 3U23A 6AT1B 7AT1B 4C92G 5I22A 4OGEA 2R5MA 4N4HA 3LX7A 2KYMA 1NPRA 3LGLA 5KYYB 2D0NA 1C6VX 2PTKA 5CO7A 1K8AU 1VQNA 1K73C 3X24B 3CCQA 3M4YA 4RMOA 3J80E 2RJEA 1BI3A 4HCBA 1KQ2A 4XTZA 4Z8AA 4BACA 4LDWA 1GCQC 3A8MB 1SSHA 3RKYA 3DB4A 4E7LA 2F2WA 5KYUA 5GAMf 4C8QA 5ECAA 2E5KA 3I5RA 1SHFA 5CK9A 1WYXA 2EFIA 1HD3A 1M1KR 1OULA 3M56A 4LDXA 5GMKl 2K6DA 1I5LA 1QKWA 2X4XA 4IURA 3M0QA 4RG2A 1Q81R 1I07A 2F2VA 1P92A 2EVRA 3CPWS 1YJ9Q 3R6NA 3CCVT 5D6YA 3CC4T 2YUQA 2CGHA 5AT1B 1TU0B 2EKHA 2ABLA 1VQ7A 2V1QA 2KRMA 3CCLQ 3I56Q 2EQJA 1KHCA 1YHQT 3OYMA 2HQEA 5GAMe 1W2BA 4C8QC 4JZ4A 3V8JA 4LN2A 4C92B 3OYJA 3OYKA 4II1A 2A08A 2D8JA 2ESWA 2EYQA 4M75D 3G6EA 2WSFE 4E7HA 1UHFA 2ZZDA 2ATCB 5GAOq 3CPFA 1K76A 3QKJA 1OI1A 2DL4A 2KI7A 2QQSA 1X6OA 4LD9K 1HXDA 5GANh 5FU6B 3X20B 4D6WA 3G71Q 2OAUA 2JTMA 1M3CA 4FW1A 1PG5B 2KMTA 3SWNB 4DBHA 4MMLA 4F7UB 5LL6S 2KY9A 4ZGDB 4E7KA 2OTLQ 2H3JA 4E2FB 2COYA 2GNCA 1KG1A 1CSKA 4M7DB 3SHWA 3OB9A 1M1GA 3CMAQ 1WHHA 3FC3A 1H8KA 2H8HA 4M77E 4OMMA 1VQOT 2LCSA 2LX7A 3GPLA 1ZUKA 1YJWT 1VQMA 4MZPA 2KDSA 1K9AA 3MCAB 4C92A 3ZBDA 1X2QA 1DJ7B 1VQ6Q 1OU8A 5LJ3f 2E70A 3VU3C 3TREA 2LCCA 4OB2B 1E7OA 1U3OA 2VYTA 2YHTA 3NTIA 3MKDA 3SWNA 3EGDB 3KXTA 2JMCA 3LH0A 3PIPA 1TOVA 4OVAA 1E6HA 2O9SA 3OS2A 3LYIA 1MHNA 3VKIA 1B07A 2O01E 1WHLA 2J05A 4A53A 1FMVA 2RQUA 1QVGP 1JJ2A 3SDZA 1VQ5A 4DOWA 3G7ZA 2YLBA 1UHCA 1M90U 1R0CB 3QDFA 2AK5A 2DL5A 4FW2A 1WLPB 4C92C 3I55Q 3GNFB 1I0CA 2G3RA 1Q82C 2KK4A 2VXEA 1UDLA 2DRKA 4J8OA 4OMFB 1N8RU 1WQWA 3A8LB 1M8VA 2D9TA 1U1TA 1G3WA 2LQWA 1RAAB 2DZCA 1NYGA 1VUBA 2BZ8A 2O9VA 5I2MA 2K3XA 4PJOF 4M7AG 3F70A 3G1JA 3SWNC 2RD1A 1D0XA 2HDAA 2BZYA 2H3EB 1K4US 2QASA 3OBYA 4M7DC 3CC2T 3M0UA 1K73R 4C0DC 4KBMB 1D09B 2E41A 4LD6A 4CI0C 4FIBA 2IVWA 3CCJQ 1I1JA 3MEVA 3LLRA 2EYZA 3X26B 5A2QE 1VYTA 4LDUA 1G83A 4J83A 2LJ1A 1G3TA 2L3PA 2P0QA 4FYYB 5IN1A 1RI0A 3JCMW 1OU9A 2Y4XA 3JCMJ 1UB4A 4DA4A 3OYFA 3HRTA 1RLQC 4JLGA 1NLOC 4M77D 2M0OA 3RR6A 4A4GA 3C95A 3HL8A 3UF4A 4JZ3A 2LT4A 3DLLA 4QVZA 4JRQA 1M4ZA 3H8ZA 3QZ9B 2O31A 2M16A 4JRKA 3MP1A 2NWMA 1KD1U 1K8AC 1KQSP 2LC4A 2ZGWA 2GTOA 4OMNA 1VIEA 3OYGA 4L6V5 1B34A 2LVMA 1TWBA 2XHCA 3RESA 2RI3A 1UGQB 3I9QA 3ZFJA 1SF9A 2M02A 4ZGJB 1G2BA 5FWBA 4RUGA 1Z9ZA 1QVGS 2DVEA 2DYIA 1IB8A 5GAMg 2L3QA 5HK3A 1EZZB 3OYLA 1VQ8T 1RAHB 2RHYA 2D1XA 1R8OB 4M7AB 3QBYA 2HSPA 1WHJA 4KH1B 1ZX6A 2OAWA 3UWNA 2BE7D 2K7AA 1Y71A 2RK1A 4IKFA 4L59A 3VUBA 1AOJA 1YJ9A 3HRUA 4LNPA 2L2PA 2LJ0A 2K4YA 3GNGA 4O5VA 3PT9A 2QGGA 1VQ4T 5GAMh 3CCLA 3EHRA 3OSSC 1NM7A 3JCMd 3L2WA 3URGA 2A28A 5GAOn 4M75F 5GANf 3RERA 2DERA 2X3WD 2XU8A 1BB9A 3BDUA 4Z89A 3A1PA 3OS0A 3LW5E 3WVDB 3BFMA 2JTFA 5D7UA 2KRNA 1LNXA 4BE2A 2JJ9A 1ZHIA 4KUDK 2RJDA 4C5HA 5IHIA 3L42A 4C8QE 2K79A 2KAFA 2R5AA 5LJ5d 3BE3A 4M7AA 1KQ1A 2K57A 3M4GA 1X6BA 1YIJA 3VS4A 2NUTB 4LXCA 3WXMB 3RMQA 3A8GB 2C06A 2J7IA 1Y7XA 4NL3A 2FG0A 1Q81C 4DBFA 3NGPA 4WTOB 4AFZC 4DEXA 1GBRA 2EYYA 2ED1A 2CS7A 2OTLA 2AKLA 2DEUA 4NL2A 4J9DA 2WACA 2HBWA 3IQLA 3CMAA 1OV3A 4A4KA 1A0NB 3CCMQ 4C0FA 4A4HA 3SD4A 1X75C 4PJNA 3QWXX 2GF7A 1VQKQ 2K5IA 1LOJA 1N9SA 1AZEA 1X43A 1MGQA 1Y96B 2MYSA 5GAN5 1WFWA 4XK8E 4M7AC 4E7ZA 1OX8A 1T3SA 1Q82R 5GAN7 2W10A 1PKSA 4A4EA 5J3BA 3CCUT 5LJ3g 3CC4Q 1QVFP 1NPPA 2X9HA 3M57A 3QZ5B 2YWWA 3CCET 2DK3A 2LP5A 2NUTA 2I2LA 3GP8A 1D1BA 1UGPB 3QHSA 3LWIA 2XDBA 2NUZA 4O6JA 2YLCA 1WQ7A 2L5QA 3NPFA 4IUUA 2DPPB 2HMAA 3NHNA 1AWOA 1NBEB 1N9RA 2ED0A 1GBQA 3OYIA 3A5ZB 4BI3A 5GMKj 2O2OA 3QYGB 2V1RA 1UTIA 3H41A 1M90C 1K9MR 2RHUA 4Y28E 2L3RA 5A0GA 4YTLA 1WJRA 4DBQA 1VQ5Q 2HBPA 2EQMA 3QJ6A 4RKUE 3I55A 1T3LA 2XIDA 5CAIA 2KEAA 3GIBA 4C92E 3CPWA 3BY7A 5IXBA 3JRZA 3M9QA 4E47A 2AKKA 1QCFA 1ABQA 2O4XB 2DRMA 2BTTA 4B6MA 3TCJA 1WA7A 2RN8A 5CCAA 4XTUA 2DF6A 1VQOQ 1VQNT 3CCQT 2P84A 4PJJA 5KYXB 1WHKA 2NYSA 1ZBXA 1YI2Q 1TXQA 4D8KA 4E7SA 1U06A 3TU4K 1MUZA 2JVVA 2DJQA 1ZA1B 1AD5A 4M7DE 1W70A 4F14A 3META 5KH6A 4ELYC 3RUXA 3CCJA 3EFSA 4A54A 1BI2A 2XDPA 1K9MU 2P4RA 1I81A 4C5EA 4E6RA 1YFNA 2EQKA 2HAXA 1O9SA 2B86A 3X28B 1ZSZB 4HCCA 2KT1A 5CVIA 2Y90A 3EGUA 1QVFS 3FLGA 3VS7A 3PGGA 5DM7R 4PKCC 3TEEA 2JW4A 4QQDA 3JB9D 3OYDA 1VQPT 1QKXA 5GJVB 1VQ7T 4ZGEB 4AMCA 1VQLQ 1M27C 2LNVA 4BDZA 1IHWA 3JB9I 2E4HA 1AWJA 1WXTA 1M8MA 1YJNQ 1YITA 2CP5A 4PJOB 1JU5C 1KC8U 4F7UG 1SSFA 1RUWA 2EJGA 2EYWA 4PFOA 1SRMA 2ROTA 2BKDN 2JN0A 2YRVA 3M0RA 4M7DG 4AFSC 1WGSA 3EG2A 4J9BA 3CXCS 2MOXA 2J6FA 2ENMA 3PFSA 1UGVA 4X9CA 2EGEA 1K0SA 4NOYA 5IH2A 2CP6A 2ZPGB 2DLPA 2E6ZA 2EW3A 1BI0A 3MEUA 4BY6B 1QP3A 3EG9B 3RNJA 3WVEB 4IUQA 1WDXA 4JJCA 3VS3A 5GMKm 1EIFA 4C92D 3HPWA 3CCRQ 1G3SA 2FZKB 3MJXA 3P8DA 5KYYA 2XDDA 4K11A 2XG8D 2IG0A 5GANg 1I4K1 2CH4W 3OMCA 1D1CA 2RQRA 3RKXA 3JCMP 3S3OA 1ZA2B 1SPKA 3EGXB 1VQMT 2CYZB 2C0OA 2YUPA 2QI2A 1IREB 4OB1B 1GRIA 2QEXQ 2F2XA 5GAMj 4HT9A 4JRIA 1S72T 2MK5A 2P0PA 2LTOA 4M7DD 2A36A 2EWNA 1YIJQ 1FX7A 2CP3A 3SEMA 3GLXA 2XMFA 3M55A 4IUVA 1JRIA 3JV3A 3X25B 5KCOA 2L3SA 2YRDA 3EG9A 1O75A 3JCMX 5IT9E 5KYWB 1AVZC 4XTYA 4AFUC 4OB0B 3HFOA 4PFZA 4IIOA 1BK2A 4WF2A 2EAYA 2EJFA 3CEYA 1VQ8Q 3CMET 2SEMA 3C12A 4PJOC 5HKCA 4OGCA 3CCMA 4X34A 2JUFA 1M90R 1NLPC 5GAN8 4JLIA 1HSQA 1YCYA 1VQKA 1N5ZA 2VVKA 4AT1B 2HZYA 4RTZA 4KULA 1WJSA 2RHIA 1IGUA 4CC4B 5J39A 3CD6Q 2DL7A 5FROA 1J3TA 5CKHA 1N8RR 2K9GA 2Z0WA 9ATCB 4M75B 4M7AE 2OX7A 3EH1A 4MDWA 3CC4A 2VC8A 4XU0A 2NUPB 2RH2A 2QQAA 4BY6C 1UEBA 1QCNA 4JUVA 2CSQA 1QVGA 1VIFA 5KYWA 2AIRB 4F7UA 2RHXA 3THKA 2DD4A 2JOYA 4CC2A 3OYAA 1TUDA 2QK0A 4M78F 3OS1A 2JM8A 4M7DA 4UC4A 2O88A 3CBOA 2KROA 1QVPA 3LWHA 2K3BA 2XI9A 2YUNA 1ZBJA 2JM9A 5GMKi 4MZTA 3G4ST 4R55A 1VYVA 4C8QF 2K3YA 3PVQA 1ZLMA 2QGFB 3UT1A 1KIKA 1JXOA 4JJDA 2DBKA 2YDLA 5LJ3j 3O8VA 4FM4B 4FL6A 4AG1C 1NJIU 2RMOA 1QQJA 4QVCA 5KYNA 1KD1R 2CT4A 3M5AA 5FU6C 2BUDA 1BYMA 5GAOm 1VQOA 4KT0E 1PHTA 2DL3A 4N0AA 5DLQE 1YI2A 3P8HA 5LJ3d 3CCST 3EGDA 2LJ3A 1LJOA 1K9MC 4Y92A 5GJWB 4J7IA 3CCUQ 3LH5A 2DA9A 1AHJB 2HQXA 4JS4A 2DIGA 3KUFA 4DQ2A 3R6OA 3OY9A 1R77A 1BI1A 1YP5A 1V29B 4Z88A 3H6ZA 3MEAA 4MDXA 4EIKA 4J7FA 3M0TA 2RI5A 4FT2A 1YWOA 3A8OB 1KQSA 1QLYA 5A0DA 4OMLA 1YN8A 4LUDA 4EMHA 3REAB 1YJ9T 1IZ6A 2HL5C 2XK0A 1N6AA 4N0AC 3UA7A 1PSEA 3O5ZA 5GAOr 1QMCA 3TSZA 1VQLA 1ABOA 3VS2A 4JJNK 4M7AD 3I56T 1QCOA 3H0IA 1T0JA 4TVRA 1KC8C 2MF2A 1NEGA 1YJNA 4HKEA 4Q5WA 2RB6A 1V76A 3FIFA 2JS0A 4BDYA 2DEQA 1YITQ 5HK0A 3CC7T 2E5QA 4F04B 2C0TA 2DZ9A 1SHGA 4XTVA 3OYEA 1AT1B 1KFZA 1X27A 1VQ9T 3D7SB 1KJWA 5KCHA 3BDLA 2EQUA 3V8KA 3EFOB 2D8HA 4EMKB 1RACB 1D1AA 1QWEA 1KSWA 5LJ5f 1H92A 3ER0A 3G71T 1R0BG 2QA4Q 5J26A 4BE0A 3CC2A 2KXCA 5DLOA 4D8DA 2LZ6B 4OMPA 2M0YA 3L1AA 1XJWB 2OTLT 3JCMQ 3CCRA 2ZPIB 3KFVA 1ARKA 2MIOA 1JEGA 5IHNA 4CC7A 3JCMe 4J9FA 4MZMA 3MO8A 3A98A 4XU3A 3UA6A 4B9XA 2HKQB 1OYXA 4N4IA 5M9OA 1RLPC 3ASKA 2PVDB 4PLLA 3EAEA 1OEBA 5CKEA 2QEXA 1VQ6T 5LJ5e 4QVDA 4F17A 1VQPQ 5GAOp 1GFDA 2M51A 1FMWA 4QKUA 4X9DA 4ANJA 1U1SA 3LGFA 2JZ2A 5CIUA 2ZPBB 4EMKA 2LRQA 1WXBA 4ZNXA 3DKMA 2GBQA 3EG0A 2VXFA 1ZQ1A 4HCKA 4IUPA 3QSUA 1NG2A 3OW2P 1OZ3A 2GTJA 2PU9B 4XQ3A 2QAZA 1PC0A 1YNZA 2COWA 4CRIA 1VQ8A 2CKKA 4LDVA 4J9CA 2G6FX 4R0KA 1H3ZA 1D0YA 1RI9A 1U5SA 5GANj 1YWPA 3L2ZA 4FYVB 5FRNA 4PJOE 1Q86U 4ORZA 2MI6A 3E9FA 1Q7YR 4C5GA 1AWWA 3VS6A 1TG0A 1QVFA 1M1FA 3JCMc 5EG2A 5EC7A 3M53A 4IIMA 2COZA 3DB3A 3JSCA 3CD6A 4FSSA 2ZPEB 4KUIA 1H3HA 3OYHA 4EMKC 1UECA 5GANd 1RAGB 3GBQA 3CCVQ 2DXCA 2HL3A 2V8JA 1PD0A 4J6WA 5I21A 2VGMA 2FVUA 3E1SA 4M78G 4KGXB 2DBMA 2PZ1A 2KGTA 2FYKA 4E7IA 5HY6A 3AHUA 1YHQQ 5L23A 3MP8A 1OPLA 4GLMA 3ZEHA 2K2MA 1XNIA 2RK2A 1ZUYA 3VRYA 2DETA 1C0MA 2OTJT 1S72Q 2QDYB 1D3BB 2VGNA 2DIQA 4RCBA 2J6OA 2HD0A 4L5GA 2EJ9A 2BZXA 3V7RA 2DE0X 2B8AA 2CP2A 4ELZC 4CC3A 1Q7YU 1EFNA 4ATOA 5GMKe 8AT1B 3OA6A 3CXCP 3FRNA 4QQ6A 1N8RC 4PJOG 1MV3A 1Y96A 3H0HA 4J9EA 1SKUB 1NJIC 4J9GA 4RTTA 1TSFA 3J7AF 2QTXA 4LUEA 2X3XD 2WSEE 1QP2A 4J5YA 2MAMA 1TS9A 2VWFA 1KK7A 1MNDA 2EIFA 3SB2A 1F1BB 2E12A 2KE9A 1RAEB 1RAFB 1B7TA 1RL2A 4DOVA 3ME9A 4F7UE 3FB9A 2CZ0B 3OW2S 5CR2A 1YJWQ 3Q1JA 4ME7A 4C0ZA 2RO0A 1W1FA 1KC8R 4C0GA 3CCUA 2R58A 4ZN3A 5HCKA 1NE8A 4M77F 2RJCA 1M30A 2A7YA 3CBMA 3L2QA 1UUEA 1FYNA 3VUZA 4M78B 2ROLA 2RQWA 3OS5A 2FPEA 2QDLA 4PJOD 2FZCB 2ZAEA 1B3QA 2E65A 2RNAA 1KD1C 5CKBA 1K1ZA 2P0KA 2O4XA 2MWOA 1JQQA 5KYUB 4C8QB 4BD3A 1XTDA 1S1NA 1N27A 2FHDA 1KHIA 2RHZA 1XOVA 2EKOA 2QQBA 2JTEA 1FWZA 4IUTA 3G4SQ 5KYXA 3QIIA 1ACMB 3TQ7P 5CQXA 3TVTA 2SRCA 3JCMg 1PKTA 2OJ2A 5D6XA 1NZ9A 2L0AA 5C0MA 2QXFA 2E6NA 2VV5A 2YUOA 2YT6A 4OMOA 3MEWA 2GFUA 3HFNA 3G6ET 2F5TX 5GAN2 5IXFA 3HSBA 5FLXE 2GQVA 1V1CA 4M78A 3MHXA 2MWPA 5LJ5g 4JS5A 2EQIA 1ZSZA 4HVVA 3CCSQ 2QA4A 3HHTB 4MMKA 1G5VA 2DXUA 3CC2Q 1WX6A 2QYZA 4HXJA 4F16A 3JCMh 4M75G 3VS5A 1WIEA 2DD5A 2LCLA 2KRSA 3V7CA 5C6SA 2KT8A 3CCMT 1BU1A 5FU7B 3I5SA 2KXDA 2MCNA 2FL7A 4J9IA 4ESRA 3VS0A 1VQKT 2A0FB 4Z02A 4EDUA 2M1HA 5IAYA 4PJOA 2E10A 5LJ5h 3OYNA 2BIVA 2DO3A 4ZN1A 2R57A 1PD1A 2DTOA 1Y57A 4M78C 1U8RA 1PSFA 1VOMA 1VQPA 1JB0E 2FB7A 1WHMA 1ZSZC 4RTUA 2F1LA 3PIOA 1FMKA 4QQGA 1LVKA 2C0IA 2HEQA 2PNIA 5IHKA 2DTHA 1GXIE 3FJPA 1GCPA 3J81E 1WZOA 2GGRA 3PNWC 1GL5A 4PJMA 2AT1B 3ZL7C 5GAMd 1VYUA 3CC7Q 1G8XA 4KH0B 2LT1A 2P4TA 2PUKB 4PNOA 2V8IA 2LQNA 3HKSA 4ZTJA 1Q86C 1VQ9Q 2X4YA 5I11A 1VQ5T 1W2BP 1OOTA 4WCIA 2RF0A 1M1KU 4A63B 4ZTFA 3EGXA 4HT8A 2IPOB 5FRMA 1JO8A 1TUCA 1Q81U 2I0NA 3M58A 4JPBW 3JB9H 2FPDA 4BUGA 3S6WA 3CCVA 2M9UA 5CKDA 4C0DB 3FDRA 2AZVA 4C5IA 1NJIR 2FPFA 2E1HA 4DEYA 2JS2A 1BBZA 4QT7A 1VQ4Q 2DKGA 1H641 3QXEB 4VUBA 3L2UA 1YI2T 4LDYA 1YHQA 3QPHA 4QW2A 1JBMA 3QYHB 1NEBA 1SEMA 5FU7C 1ZUUA 2XICA 1W6XA 1S72A 3ULRB 1QW1A 3H9NA 1UFFA 1D0ZA 3GF5A 4M4ZA 3VYGA 5GMKh 1WJQA 3FEOA 1Q7YC 2PVOB 1CKBA 4J9HA 2RA2A 2Y4YA 3UPUA 3VS1A 1XQHA 1AWXA 3OMGA 1MMAA 1M2OA 1K0XA 2LMJA 1M2VB 1Q95G 3RIRA 4M75A 3NTKA 3CMEA 2WSCE 3RKWA 2NUPA 2X51A 1VQLT 8ATCB 4XTWA 2F69A 3TSWA 4E7JA 3N5BB 1C1AA 2RQVA 1GFCA 4M77G 3VV0A 3P8BB 1YJNT 4N4GA 1PRLC 5LJ3e 2CDTA
chains in the Genus database with same CATH topology
3CCSQ 1VQ9Q 1KQSP 3I56Q 1JJ2P 1VQ5Q 1VQKQ 1VQ6Q 3CPWP 3OW2P 1W2BP 3CMAQ 1NJIR 1YHQQ 3CC2Q 1YIJQ 1VQPQ 1VQMQ 1VQNQ 1K73R 1VQOQ 3CCQQ 1Q81R 3CXCP 1M90R 1VQ4Q 1VQ7Q 1K8AR 2OTJQ 1QVGP 3G6EQ 1Q82R 3CCUQ 3G71Q 1VQLQ 1YITQ 1Q86R 1YI2Q 3CC7Q 3CCVQ 3CCJQ 3CCRQ 1YJ9Q 2QEXQ 1KD1R 2QA4Q 3CC4Q 1QVFP 1YJWQ 1S72Q 3G4SQ 3CCMQ 1KC8R 3I55Q 3CCEQ 3CD6Q 1N8RR 1YJNQ 1K9MR 1Q7YR 2OTLQ 1M1KR 3CMEQ 1VQ8Q 3CCLQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS Q;  1VQ9 Q;  1KQS P;  3I56 Q;  1JJ2 P;  1VQ5 Q;  1VQK Q;  1VQ6 Q;  3CPW P;  3OW2 P;  1W2B P;  3CMA Q;  1NJI R;  1YHQ Q;  3CC2 Q;  1YIJ Q;  1VQP Q;  1VQM Q;  1VQN Q;  1K73 R;  1VQO Q;  3CCQ Q;  1Q81 R;  3CXC P;  1M90 R;  1VQ4 Q;  1VQ7 Q;  1K8A R;  2OTJ Q;  1QVG P;  3G6E Q;  1Q82 R;  3CCU Q;  3G71 Q;  1VQL Q;  1YIT Q;  1Q86 R;  1YI2 Q;  3CC7 Q;  3CCV Q;  3CCJ Q;  3CCR Q;  1YJ9 Q;  2QEX Q;  1KD1 R;  2QA4 Q;  3CC4 Q;  1QVF P;  1YJW Q;  1S72 Q;  3G4S Q;  3CCM Q;  1KC8 R;  3I55 Q;  3CCE Q;  3CD6 Q;  1N8R R;  1YJN Q;  1K9M R;  1Q7Y R;  2OTL Q;  1M1K R;  3CME Q;  1VQ8 Q;  3CCL Q; 
#chains in the Genus database with same CATH topology
 1CKA A;  1JJ2 P;  2K5L A;  1UE9 A;  1YJW A;  1Z9Q A;  1BKB A;  3HP9 A;  3NFC A;  4FYX B;  4JJB A;  2J06 A;  4PJL A;  5GAO l;  4P5N A;  1UG1 A;  2W0Z A;  3I35 A;  3UDC A;  2ZPF B;  1WHG A;  2QG9 B;  1IGQ A;  3VYH B;  2DIL A;  3PMT A;  3RMS A;  2CZ1 B;  1W2B S;  4GBQ A;  2XD0 A;  2FZG B;  2RQT A;  1TTH B;  3QO3 A;  4XU1 A;  2CT3 A;  3CCE Q;  4FT4 A;  2FRY A;  3NTH A;  2KNB B;  1B34 B;  3M0S A;  3JB9 F;  1M3B A;  2A3L A;  2YXY A;  4RTW A;  4Y91 A;  4M75 C;  1OPK A;  1W4S A;  2KVQ G;  1RAD B;  2HQH A;  3DLM A;  2VUB A;  2EGC A;  2PQW A;  2OTJ Q;  1M2V A;  4RG8 A;  2X35 A;  1WXU A;  1BCM A;  5DY9 A;  1YCS B;  3E2U A;  3CCR T;  2V8K A;  4FSX A;  3HTR A;  1PWT A;  2DMO A;  1I5O B;  2LX9 A;  3QDR B;  4PFP A;  4XU2 A;  5CKF A;  5GAN 4;  3OYC A;  3E9G A;  2ZCF B;  3OYY A;  3CCL T;  3G4S A;  4PL6 A;  1IHV A;  3JCM V;  2AHJ B;  2KSS A;  2PUO B;  3S3N A;  1PM3 A;  1X01 A;  1IXD A;  1MMN A;  1FXX A;  2QEX T;  3JCM f;  2D6F A;  3OQ5 A;  5GAN 3;  1UJY A;  1NYF A;  2QTV A;  1M3A A;  3M0P A;  4V2S A;  4X1V A;  3V8L A;  1PCX A;  2EYX A;  3JB9 J;  1VQN Q;  1YIJ T;  4C92 F;  5AYF A;  3CCQ Q;  2L89 A;  3QJY A;  1OQK A;  2L8D A;  3CCS A;  4M77 B;  2RM4 A;  4BB7 A;  4JRP A;  1K73 U;  2VKN A;  2RJF A;  1WPY A;  1G3Y A;  1BIA A;  3QG1 A;  3L2V A;  2CP0 A;  2FO0 A;  2KQW A;  4F7U F;  3CMA T;  1PRM C;  1AEY A;  3EHQ A;  2JXB A;  1JJ2 S;  1Q86 R;  2KBT A;  2V26 A;  2CUD A;  4XAX B;  2DVJ A;  1QWF A;  4OF1 A;  4M7D F;  2KR3 A;  2DM1 A;  2HNI A;  3CD6 T;  2JT4 A;  1SRL A;  1UGS B;  5CQY A;  1PNJ A;  1Y07 A;  4LE9 A;  2MMP A;  3INZ A;  4HA8 A;  4M78 E;  3RBB B;  1RAI B;  1VQ7 Q;  2DFU A;  2DL8 A;  3PVL A;  3CQT A;  3I56 A;  1WNL A;  4A4F A;  5LJ5 j;  1MMD A;  2VB6 A;  3OW2 A;  1X2K A;  2D0Q B;  3EFO A;  5GAN 6;  3FJ5 A;  1ZSG A;  4M77 A;  2LDM A;  1M9S A;  3PTA A;  2BE9 B;  2JNG A;  2CRE A;  3CC7 A;  2ECZ A;  3GOX A;  3C4S A;  2XKO C;  2A37 A;  2DXB A;  3M59 A;  2K5F A;  4RCC A;  1MNE A;  1M1K C;  3G6E Q;  1VQ9 A;  2RPN A;  2JMA A;  1X6G A;  2HKN A;  1EX4 A;  4EMG A;  4OP0 A;  2GQI A;  1BIB A;  2QQR A;  2HSE B;  2YSQ A;  3G71 A;  3I55 T;  2DNU A;  2X4W A;  2X4J A;  3SFM A;  5I2S A;  2QQ9 A;  4GY5 A;  5GAN e;  1KQS S;  2CH4 A;  3AT1 B;  3PMI A;  4M77 C;  1WI7 A;  1MMG A;  2GFA A;  2VAS A;  2CSI A;  1VQ4 A;  3EG3 A;  2RI2 A;  1UGR B;  4B9W A;  4PK4 A;  1M5Q 1;  5KE2 A;  2PVG B;  4HVW A;  3OYB A;  4OMQ A;  1VQM Q;  4BI8 B;  4RTX A;  4FU6 A;  1MV0 B;  1VQ6 A;  4BE1 A;  3MP6 A;  2GCX A;  2FRW A;  3CCJ T;  3EG1 A;  3OBW A;  1HJD A;  1AZG B;  3CXC A;  2CUB A;  4BI4 A;  4C8Q G;  2ZPH B;  1UJ0 A;  2E64 A;  1TH7 A;  2LNH B;  2NLU A;  3NMZ C;  2YRC A;  3VJP A;  4R56 A;  3EFR A;  1VA7 A;  2CZ7 B;  2DTI A;  2DJZ A;  1HK9 A;  3HRS A;  4KGZ B;  1LCK A;  2EBP A;  3QWY A;  3OSV A;  3UAT A;  3V7S A;  2DXT A;  3CME Q;  5LJ3 h;  2DYB A;  4J6X A;  3S3M A;  3CBP A;  5D6W A;  3VRZ A;  5A0L A;  4M78 D;  4KGV B;  2DX1 A;  1OX9 A;  2IIM A;  2MPX C;  3EH2 A;  1SG5 A;  3PE0 A;  1IO6 A;  1IRX A;  2AZS A;  1Y0M A;  4FYW B;  1YIT T;  2K2V A;  2CP7 A;  3A8H B;  3BW1 A;  4EPC A;  1RAB B;  2LQ8 A;  4RTY A;  1Q82 U;  3JB9 G;  3E19 A;  3T9N A;  3REB B;  1E6G A;  4HVU A;  4J6Y A;  1D3B A;  4RTV A;  3CPW P;  1I8F A;  4C8Q D;  3CCE A;  3C0C A;  4GLK A;  1OZ2 A;  1T0H A;  3H0F A;  1LPL A;  1K8A R;  4FCY A;  4AFQ C;  2HCK A;  3MPU B;  4JDS A;  3M54 A;  2CZ6 B;  4HCZ A;  1X69 A;  2FEI A;  4XTX A;  2KYB A;  2QA4 T;  2LQK A;  4PLI A;  4M7A F;  4KRT A;  4M75 E;  4AG2 C;  3JCM b;  2F5K A;  2EGA A;  2OTJ A;  4NS5 A;  2E3I A;  1HYO A;  3QUI A;  1JXM A;  5L8R E;  1YBY A;  1BCO A;  3RDV A;  2E3H A;  5FW9 A;  1TUG B;  4DBR A;  1GCQ A;  3JAM E;  2J6K A;  3C94 A;  2DAQ A;  2OI3 A;  5FWC A;  3L2R A;  5KE3 A;  3KBG A;  2EPD A;  4OB3 B;  3U23 A;  6AT1 B;  7AT1 B;  4C92 G;  5I22 A;  4OGE A;  2R5M A;  4N4H A;  3LX7 A;  2KYM A;  1NPR A;  3LGL A;  5KYY B;  2D0N A;  1C6V X;  2PTK A;  5CO7 A;  1K8A U;  1VQN A;  1K73 C;  3X24 B;  3CCQ A;  3M4Y A;  4RMO A;  3J80 E;  2RJE A;  1BI3 A;  4HCB A;  1KQ2 A;  4XTZ A;  4Z8A A;  4BAC A;  4LDW A;  1GCQ C;  3A8M B;  1SSH A;  3RKY A;  3DB4 A;  4E7L A;  2F2W A;  5KYU A;  5GAM f;  4C8Q A;  5ECA A;  2E5K A;  3I5R A;  1SHF A;  5CK9 A;  1WYX A;  2EFI A;  1HD3 A;  1M1K R;  1OUL A;  3M56 A;  4LDX A;  5GMK l;  2K6D A;  1I5L A;  1QKW A;  2X4X A;  4IUR A;  3M0Q A;  4RG2 A;  1Q81 R;  1I07 A;  2F2V A;  1P92 A;  2EVR A;  3CPW S;  1YJ9 Q;  3R6N A;  3CCV T;  5D6Y A;  3CC4 T;  2YUQ A;  2CGH A;  5AT1 B;  1TU0 B;  2EKH A;  2ABL A;  1VQ7 A;  2V1Q A;  2KRM A;  3CCL Q;  3I56 Q;  2EQJ A;  1KHC A;  1YHQ T;  3OYM A;  2HQE A;  5GAM e;  1W2B A;  4C8Q C;  4JZ4 A;  3V8J A;  4LN2 A;  4C92 B;  3OYJ A;  3OYK A;  4II1 A;  2A08 A;  2D8J A;  2ESW A;  2EYQ A;  4M75 D;  3G6E A;  2WSF E;  4E7H A;  1UHF A;  2ZZD A;  2ATC B;  5GAO q;  3CPF A;  1K76 A;  3QKJ A;  1OI1 A;  2DL4 A;  2KI7 A;  2QQS A;  1X6O A;  4LD9 K;  1HXD A;  5GAN h;  5FU6 B;  3X20 B;  4D6W A;  3G71 Q;  2OAU A;  2JTM A;  1M3C A;  4FW1 A;  1PG5 B;  2KMT A;  3SWN B;  4DBH A;  4MML A;  4F7U B;  5LL6 S;  2KY9 A;  4ZGD B;  4E7K A;  2OTL Q;  2H3J A;  4E2F B;  2COY A;  2GNC A;  1KG1 A;  1CSK A;  4M7D B;  3SHW A;  3OB9 A;  1M1G A;  3CMA Q;  1WHH A;  3FC3 A;  1H8K A;  2H8H A;  4M77 E;  4OMM A;  1VQO T;  2LCS A;  2LX7 A;  3GPL A;  1ZUK A;  1YJW T;  1VQM A;  4MZP A;  2KDS A;  1K9A A;  3MCA B;  4C92 A;  3ZBD A;  1X2Q A;  1DJ7 B;  1VQ6 Q;  1OU8 A;  5LJ3 f;  2E70 A;  3VU3 C;  3TRE A;  2LCC A;  4OB2 B;  1E7O A;  1U3O A;  2VYT A;  2YHT A;  3NTI A;  3MKD A;  3SWN A;  3EGD B;  3KXT A;  2JMC A;  3LH0 A;  3PIP A;  1TOV A;  4OVA A;  1E6H A;  2O9S A;  3OS2 A;  3LYI A;  1MHN A;  3VKI A;  1B07 A;  2O01 E;  1WHL A;  2J05 A;  4A53 A;  1FMV A;  2RQU A;  1QVG P;  1JJ2 A;  3SDZ A;  1VQ5 A;  4DOW A;  3G7Z A;  2YLB A;  1UHC A;  1M90 U;  1R0C B;  3QDF A;  2AK5 A;  2DL5 A;  4FW2 A;  1WLP B;  4C92 C;  3I55 Q;  3GNF B;  1I0C A;  2G3R A;  1Q82 C;  2KK4 A;  2VXE A;  1UDL A;  2DRK A;  4J8O A;  4OMF B;  1N8R U;  1WQW A;  3A8L B;  1M8V A;  2D9T A;  1U1T A;  1G3W A;  2LQW A;  1RAA B;  2DZC A;  1NYG A;  1VUB A;  2BZ8 A;  2O9V A;  5I2M A;  2K3X A;  4PJO F;  4M7A G;  3F70 A;  3G1J A;  3SWN C;  2RD1 A;  1D0X A;  2HDA A;  2BZY A;  2H3E B;  1K4U S;  2QAS A;  3OBY A;  4M7D C;  3CC2 T;  3M0U A;  1K73 R;  4C0D C;  4KBM B;  1D09 B;  2E41 A;  4LD6 A;  4CI0 C;  4FIB A;  2IVW A;  3CCJ Q;  1I1J A;  3MEV A;  3LLR A;  2EYZ A;  3X26 B;  5A2Q E;  1VYT A;  4LDU A;  1G83 A;  4J83 A;  2LJ1 A;  1G3T A;  2L3P A;  2P0Q A;  4FYY B;  5IN1 A;  1RI0 A;  3JCM W;  1OU9 A;  2Y4X A;  3JCM J;  1UB4 A;  4DA4 A;  3OYF A;  3HRT A;  1RLQ C;  4JLG A;  1NLO C;  4M77 D;  2M0O A;  3RR6 A;  4A4G A;  3C95 A;  3HL8 A;  3UF4 A;  4JZ3 A;  2LT4 A;  3DLL A;  4QVZ A;  4JRQ A;  1M4Z A;  3H8Z A;  3QZ9 B;  2O31 A;  2M16 A;  4JRK A;  3MP1 A;  2NWM A;  1KD1 U;  1K8A C;  1KQS P;  2LC4 A;  2ZGW A;  2GTO A;  4OMN A;  1VIE A;  3OYG A;  4L6V 5;  1B34 A;  2LVM A;  1TWB A;  2XHC A;  3RES A;  2RI3 A;  1UGQ B;  3I9Q A;  3ZFJ A;  1SF9 A;  2M02 A;  4ZGJ B;  1G2B A;  5FWB A;  4RUG A;  1Z9Z A;  1QVG S;  2DVE A;  2DYI A;  1IB8 A;  5GAM g;  2L3Q A;  5HK3 A;  1EZZ B;  3OYL A;  1VQ8 T;  1RAH B;  2RHY A;  2D1X A;  1R8O B;  4M7A B;  3QBY A;  2HSP A;  1WHJ A;  4KH1 B;  1ZX6 A;  2OAW A;  3UWN A;  2BE7 D;  2K7A A;  1Y71 A;  2RK1 A;  4IKF A;  4L59 A;  3VUB A;  1AOJ A;  1YJ9 A;  3HRU A;  4LNP A;  2L2P A;  2LJ0 A;  2K4Y A;  3GNG A;  4O5V A;  3PT9 A;  2QGG A;  1VQ4 T;  5GAM h;  3CCL A;  3EHR A;  3OSS C;  1NM7 A;  3JCM d;  3L2W A;  3URG A;  2A28 A;  5GAO n;  4M75 F;  5GAN f;  3RER A;  2DER A;  2X3W D;  2XU8 A;  1BB9 A;  3BDU A;  4Z89 A;  3A1P A;  3OS0 A;  3LW5 E;  3WVD B;  3BFM A;  2JTF A;  5D7U A;  2KRN A;  1LNX A;  4BE2 A;  2JJ9 A;  1ZHI A;  4KUD K;  2RJD A;  4C5H A;  5IHI A;  3L42 A;  4C8Q E;  2K79 A;  2KAF A;  2R5A A;  5LJ5 d;  3BE3 A;  4M7A A;  1KQ1 A;  2K57 A;  3M4G A;  1X6B A;  1YIJ A;  3VS4 A;  2NUT B;  4LXC A;  3WXM B;  3RMQ A;  3A8G B;  2C06 A;  2J7I A;  1Y7X A;  4NL3 A;  2FG0 A;  1Q81 C;  4DBF A;  3NGP A;  4WTO B;  4AFZ C;  4DEX A;  1GBR A;  2EYY A;  2ED1 A;  2CS7 A;  2OTL A;  2AKL A;  2DEU A;  4NL2 A;  4J9D A;  2WAC A;  2HBW A;  3IQL A;  3CMA A;  1OV3 A;  4A4K A;  1A0N B;  3CCM Q;  4C0F A;  4A4H A;  3SD4 A;  1X75 C;  4PJN A;  3QWX X;  2GF7 A;  1VQK Q;  2K5I A;  1LOJ A;  1N9S A;  1AZE A;  1X43 A;  1MGQ A;  1Y96 B;  2MYS A;  5GAN 5;  1WFW A;  4XK8 E;  4M7A C;  4E7Z A;  1OX8 A;  1T3S A;  1Q82 R;  5GAN 7;  2W10 A;  1PKS A;  4A4E A;  5J3B A;  3CCU T;  5LJ3 g;  3CC4 Q;  1QVF P;  1NPP A;  2X9H A;  3M57 A;  3QZ5 B;  2YWW A;  3CCE T;  2DK3 A;  2LP5 A;  2NUT A;  2I2L A;  3GP8 A;  1D1B A;  1UGP B;  3QHS A;  3LWI A;  2XDB A;  2NUZ A;  4O6J A;  2YLC A;  1WQ7 A;  2L5Q A;  3NPF A;  4IUU A;  2DPP B;  2HMA A;  3NHN A;  1AWO A;  1NBE B;  1N9R A;  2ED0 A;  1GBQ A;  3OYI A;  3A5Z B;  4BI3 A;  5GMK j;  2O2O A;  3QYG B;  2V1R A;  1UTI A;  3H41 A;  1M90 C;  1K9M R;  2RHU A;  4Y28 E;  2L3R A;  5A0G A;  4YTL A;  1WJR A;  4DBQ A;  1VQ5 Q;  2HBP A;  2EQM A;  3QJ6 A;  4RKU E;  3I55 A;  1T3L A;  2XID A;  5CAI A;  2KEA A;  3GIB A;  4C92 E;  3CPW A;  3BY7 A;  5IXB A;  3JRZ A;  3M9Q A;  4E47 A;  2AKK A;  1QCF A;  1ABQ A;  2O4X B;  2DRM A;  2BTT A;  4B6M A;  3TCJ A;  1WA7 A;  2RN8 A;  5CCA A;  4XTU A;  2DF6 A;  1VQO Q;  1VQN T;  3CCQ T;  2P84 A;  4PJJ A;  5KYX B;  1WHK A;  2NYS A;  1ZBX A;  1YI2 Q;  1TXQ A;  4D8K A;  4E7S A;  1U06 A;  3TU4 K;  1MUZ A;  2JVV A;  2DJQ A;  1ZA1 B;  1AD5 A;  4M7D E;  1W70 A;  4F14 A;  3MET A;  5KH6 A;  4ELY C;  3RUX A;  3CCJ A;  3EFS A;  4A54 A;  1BI2 A;  2XDP A;  1K9M U;  2P4R A;  1I81 A;  4C5E A;  4E6R A;  1YFN A;  2EQK A;  2HAX A;  1O9S A;  2B86 A;  3X28 B;  1ZSZ B;  4HCC A;  2KT1 A;  5CVI A;  2Y90 A;  3EGU A;  1QVF S;  3FLG A;  3VS7 A;  3PGG A;  5DM7 R;  4PKC C;  3TEE A;  2JW4 A;  4QQD A;  3JB9 D;  3OYD A;  1VQP T;  1QKX A;  5GJV B;  1VQ7 T;  4ZGE B;  4AMC A;  1VQL Q;  1M27 C;  2LNV A;  4BDZ A;  1IHW A;  3JB9 I;  2E4H A;  1AWJ A;  1WXT A;  1M8M A;  1YJN Q;  1YIT A;  2CP5 A;  4PJO B;  1JU5 C;  1KC8 U;  4F7U G;  1SSF A;  1RUW A;  2EJG A;  2EYW A;  4PFO A;  1SRM A;  2ROT A;  2BKD N;  2JN0 A;  2YRV A;  3M0R A;  4M7D G;  4AFS C;  1WGS A;  3EG2 A;  4J9B A;  3CXC S;  2MOX A;  2J6F A;  2ENM A;  3PFS A;  1UGV A;  4X9C A;  2EGE A;  1K0S A;  4NOY A;  5IH2 A;  2CP6 A;  2ZPG B;  2DLP A;  2E6Z A;  2EW3 A;  1BI0 A;  3MEU A;  4BY6 B;  1QP3 A;  3EG9 B;  3RNJ A;  3WVE B;  4IUQ A;  1WDX A;  4JJC A;  3VS3 A;  5GMK m;  1EIF A;  4C92 D;  3HPW A;  3CCR Q;  1G3S A;  2FZK B;  3MJX A;  3P8D A;  5KYY A;  2XDD A;  4K11 A;  2XG8 D;  2IG0 A;  5GAN g;  1I4K 1;  2CH4 W;  3OMC A;  1D1C A;  2RQR A;  3RKX A;  3JCM P;  3S3O A;  1ZA2 B;  1SPK A;  3EGX B;  1VQM T;  2CYZ B;  2C0O A;  2YUP A;  2QI2 A;  1IRE B;  4OB1 B;  1GRI A;  2QEX Q;  2F2X A;  5GAM j;  4HT9 A;  4JRI A;  1S72 T;  2MK5 A;  2P0P A;  2LTO A;  4M7D D;  2A36 A;  2EWN A;  1YIJ Q;  1FX7 A;  2CP3 A;  3SEM A;  3GLX A;  2XMF A;  3M55 A;  4IUV A;  1JRI A;  3JV3 A;  3X25 B;  5KCO A;  2L3S A;  2YRD A;  3EG9 A;  1O75 A;  3JCM X;  5IT9 E;  5KYW B;  1AVZ C;  4XTY A;  4AFU C;  4OB0 B;  3HFO A;  4PFZ A;  4IIO A;  1BK2 A;  4WF2 A;  2EAY A;  2EJF A;  3CEY A;  1VQ8 Q;  3CME T;  2SEM A;  3C12 A;  4PJO C;  5HKC A;  4OGC A;  3CCM A;  4X34 A;  2JUF A;  1M90 R;  1NLP C;  5GAN 8;  4JLI A;  1HSQ A;  1YCY A;  1VQK A;  1N5Z A;  2VVK A;  4AT1 B;  2HZY A;  4RTZ A;  4KUL A;  1WJS A;  2RHI A;  1IGU A;  4CC4 B;  5J39 A;  3CD6 Q;  2DL7 A;  5FRO A;  1J3T A;  5CKH A;  1N8R R;  2K9G A;  2Z0W A;  9ATC B;  4M75 B;  4M7A E;  2OX7 A;  3EH1 A;  4MDW A;  3CC4 A;  2VC8 A;  4XU0 A;  2NUP B;  2RH2 A;  2QQA A;  4BY6 C;  1UEB A;  1QCN A;  4JUV A;  2CSQ A;  1QVG A;  1VIF A;  5KYW A;  2AIR B;  4F7U A;  2RHX A;  3THK A;  2DD4 A;  2JOY A;  4CC2 A;  3OYA A;  1TUD A;  2QK0 A;  4M78 F;  3OS1 A;  2JM8 A;  4M7D A;  4UC4 A;  2O88 A;  3CBO A;  2KRO A;  1QVP A;  3LWH A;  2K3B A;  2XI9 A;  2YUN A;  1ZBJ A;  2JM9 A;  5GMK i;  4MZT A;  3G4S T;  4R55 A;  1VYV A;  4C8Q F;  2K3Y A;  3PVQ A;  1ZLM A;  2QGF B;  3UT1 A;  1KIK A;  1JXO A;  4JJD A;  2DBK A;  2YDL A;  5LJ3 j;  3O8V A;  4FM4 B;  4FL6 A;  4AG1 C;  1NJI U;  2RMO A;  1QQJ A;  4QVC A;  5KYN A;  1KD1 R;  2CT4 A;  3M5A A;  5FU6 C;  2BUD A;  1BYM A;  5GAO m;  1VQO A;  4KT0 E;  1PHT A;  2DL3 A;  4N0A A;  5DLQ E;  1YI2 A;  3P8H A;  5LJ3 d;  3CCS T;  3EGD A;  2LJ3 A;  1LJO A;  1K9M C;  4Y92 A;  5GJW B;  4J7I A;  3CCU Q;  3LH5 A;  2DA9 A;  1AHJ B;  2HQX A;  4JS4 A;  2DIG A;  3KUF A;  4DQ2 A;  3R6O A;  3OY9 A;  1R77 A;  1BI1 A;  1YP5 A;  1V29 B;  4Z88 A;  3H6Z A;  3MEA A;  4MDX A;  4EIK A;  4J7F A;  3M0T A;  2RI5 A;  4FT2 A;  1YWO A;  3A8O B;  1KQS A;  1QLY A;  5A0D A;  4OML A;  1YN8 A;  4LUD A;  4EMH A;  3REA B;  1YJ9 T;  1IZ6 A;  2HL5 C;  2XK0 A;  1N6A A;  4N0A C;  3UA7 A;  1PSE A;  3O5Z A;  5GAO r;  1QMC A;  3TSZ A;  1VQL A;  1ABO A;  3VS2 A;  4JJN K;  4M7A D;  3I56 T;  1QCO A;  3H0I A;  1T0J A;  4TVR A;  1KC8 C;  2MF2 A;  1NEG A;  1YJN A;  4HKE A;  4Q5W A;  2RB6 A;  1V76 A;  3FIF A;  2JS0 A;  4BDY A;  2DEQ A;  1YIT Q;  5HK0 A;  3CC7 T;  2E5Q A;  4F04 B;  2C0T A;  2DZ9 A;  1SHG A;  4XTV A;  3OYE A;  1AT1 B;  1KFZ A;  1X27 A;  1VQ9 T;  3D7S B;  1KJW A;  5KCH A;  3BDL A;  2EQU A;  3V8K A;  3EFO B;  2D8H A;  4EMK B;  1RAC B;  1D1A A;  1QWE A;  1KSW A;  5LJ5 f;  1H92 A;  3ER0 A;  3G71 T;  1R0B G;  2QA4 Q;  5J26 A;  4BE0 A;  3CC2 A;  2KXC A;  5DLO A;  4D8D A;  2LZ6 B;  4OMP A;  2M0Y A;  3L1A A;  1XJW B;  2OTL T;  3JCM Q;  3CCR A;  2ZPI B;  3KFV A;  1ARK A;  2MIO A;  1JEG A;  5IHN A;  4CC7 A;  3JCM e;  4J9F A;  4MZM A;  3MO8 A;  3A98 A;  4XU3 A;  3UA6 A;  4B9X A;  2HKQ B;  1OYX A;  4N4I A;  5M9O A;  1RLP C;  3ASK A;  2PVD B;  4PLL A;  3EAE A;  1OEB A;  5CKE A;  2QEX A;  1VQ6 T;  5LJ5 e;  4QVD A;  4F17 A;  1VQP Q;  5GAO p;  1GFD A;  2M51 A;  1FMW A;  4QKU A;  4X9D A;  4ANJ A;  1U1S A;  3LGF A;  2JZ2 A;  5CIU A;  2ZPB B;  4EMK A;  2LRQ A;  1WXB A;  4ZNX A;  3DKM A;  2GBQ A;  3EG0 A;  2VXF A;  1ZQ1 A;  4HCK A;  4IUP A;  3QSU A;  1NG2 A;  3OW2 P;  1OZ3 A;  2GTJ A;  2PU9 B;  4XQ3 A;  2QAZ A;  1PC0 A;  1YNZ A;  2COW A;  4CRI A;  1VQ8 A;  2CKK A;  4LDV A;  4J9C A;  2G6F X;  4R0K A;  1H3Z A;  1D0Y A;  1RI9 A;  1U5S A;  5GAN j;  1YWP A;  3L2Z A;  4FYV B;  5FRN A;  4PJO E;  1Q86 U;  4ORZ A;  2MI6 A;  3E9F A;  1Q7Y R;  4C5G A;  1AWW A;  3VS6 A;  1TG0 A;  1QVF A;  1M1F A;  3JCM c;  5EG2 A;  5EC7 A;  3M53 A;  4IIM A;  2COZ A;  3DB3 A;  3JSC A;  3CD6 A;  4FSS A;  2ZPE B;  4KUI A;  1H3H A;  3OYH A;  4EMK C;  1UEC A;  5GAN d;  1RAG B;  3GBQ A;  3CCV Q;  2DXC A;  2HL3 A;  2V8J A;  1PD0 A;  4J6W A;  5I21 A;  2VGM A;  2FVU A;  3E1S A;  4M78 G;  4KGX B;  2DBM A;  2PZ1 A;  2KGT A;  2FYK A;  4E7I A;  5HY6 A;  3AHU A;  1YHQ Q;  5L23 A;  3MP8 A;  1OPL A;  4GLM A;  3ZEH A;  2K2M A;  1XNI A;  2RK2 A;  1ZUY A;  3VRY A;  2DET A;  1C0M A;  2OTJ T;  1S72 Q;  2QDY B;  1D3B B;  2VGN A;  2DIQ A;  4RCB A;  2J6O A;  2HD0 A;  4L5G A;  2EJ9 A;  2BZX A;  3V7R A;  2DE0 X;  2B8A A;  2CP2 A;  4ELZ C;  4CC3 A;  1Q7Y U;  1EFN A;  4ATO A;  5GMK e;  8AT1 B;  3OA6 A;  3CXC P;  3FRN A;  4QQ6 A;  1N8R C;  4PJO G;  1MV3 A;  1Y96 A;  3H0H A;  4J9E A;  1SKU B;  1NJI C;  4J9G A;  4RTT A;  1TSF A;  3J7A F;  2QTX A;  4LUE A;  2X3X D;  2WSE E;  1QP2 A;  4J5Y A;  2MAM A;  1TS9 A;  2VWF A;  1KK7 A;  1MND A;  2EIF A;  3SB2 A;  1F1B B;  2E12 A;  2KE9 A;  1RAE B;  1RAF B;  1B7T A;  1RL2 A;  4DOV A;  3ME9 A;  4F7U E;  3FB9 A;  2CZ0 B;  3OW2 S;  5CR2 A;  1YJW Q;  3Q1J A;  4ME7 A;  4C0Z A;  2RO0 A;  1W1F A;  1KC8 R;  4C0G A;  3CCU A;  2R58 A;  4ZN3 A;  5HCK A;  1NE8 A;  4M77 F;  2RJC A;  1M30 A;  2A7Y A;  3CBM A;  3L2Q A;  1UUE A;  1FYN A;  3VUZ A;  4M78 B;  2ROL A;  2RQW A;  3OS5 A;  2FPE A;  2QDL A;  4PJO D;  2FZC B;  2ZAE A;  1B3Q A;  2E65 A;  2RNA A;  1KD1 C;  5CKB A;  1K1Z A;  2P0K A;  2O4X A;  2MWO A;  1JQQ A;  5KYU B;  4C8Q B;  4BD3 A;  1XTD A;  1S1N A;  1N27 A;  2FHD A;  1KHI A;  2RHZ A;  1XOV A;  2EKO A;  2QQB A;  2JTE A;  1FWZ A;  4IUT A;  3G4S Q;  5KYX A;  3QII A;  1ACM B;  3TQ7 P;  5CQX A;  3TVT A;  2SRC A;  3JCM g;  1PKT A;  2OJ2 A;  5D6X A;  1NZ9 A;  2L0A A;  5C0M A;  2QXF A;  2E6N A;  2VV5 A;  2YUO A;  2YT6 A;  4OMO A;  3MEW A;  2GFU A;  3HFN A;  3G6E T;  2F5T X;  5GAN 2;  5IXF A;  3HSB A;  5FLX E;  2GQV A;  1V1C A;  4M78 A;  3MHX A;  2MWP A;  5LJ5 g;  4JS5 A;  2EQI A;  1ZSZ A;  4HVV A;  3CCS Q;  2QA4 A;  3HHT B;  4MMK A;  1G5V A;  2DXU A;  3CC2 Q;  1WX6 A;  2QYZ A;  4HXJ A;  4F16 A;  3JCM h;  4M75 G;  3VS5 A;  1WIE A;  2DD5 A;  2LCL A;  2KRS A;  3V7C A;  5C6S A;  2KT8 A;  3CCM T;  1BU1 A;  5FU7 B;  3I5S A;  2KXD A;  2MCN A;  2FL7 A;  4J9I A;  4ESR A;  3VS0 A;  1VQK T;  2A0F B;  4Z02 A;  4EDU A;  2M1H A;  5IAY A;  4PJO A;  2E10 A;  5LJ5 h;  3OYN A;  2BIV A;  2DO3 A;  4ZN1 A;  2R57 A;  1PD1 A;  2DTO A;  1Y57 A;  4M78 C;  1U8R A;  1PSF A;  1VOM A;  1VQP A;  1JB0 E;  2FB7 A;  1WHM A;  1ZSZ C;  4RTU A;  2F1L A;  3PIO A;  1FMK A;  4QQG A;  1LVK A;  2C0I A;  2HEQ A;  2PNI A;  5IHK A;  2DTH A;  1GXI E;  3FJP A;  1GCP A;  3J81 E;  1WZO A;  2GGR A;  3PNW C;  1GL5 A;  4PJM A;  2AT1 B;  3ZL7 C;  5GAM d;  1VYU A;  3CC7 Q;  1G8X A;  4KH0 B;  2LT1 A;  2P4T A;  2PUK B;  4PNO A;  2V8I A;  2LQN A;  3HKS A;  4ZTJ A;  1Q86 C;  1VQ9 Q;  2X4Y A;  5I11 A;  1VQ5 T;  1W2B P;  1OOT A;  4WCI A;  2RF0 A;  1M1K U;  4A63 B;  4ZTF A;  3EGX A;  4HT8 A;  2IPO B;  5FRM A;  1JO8 A;  1TUC A;  1Q81 U;  2I0N A;  3M58 A;  4JPB W;  3JB9 H;  2FPD A;  4BUG A;  3S6W A;  3CCV A;  2M9U A;  5CKD A;  4C0D B;  3FDR A;  2AZV A;  4C5I A;  1NJI R;  2FPF A;  2E1H A;  4DEY A;  2JS2 A;  1BBZ A;  4QT7 A;  1VQ4 Q;  2DKG A;  1H64 1;  3QXE B;  4VUB A;  3L2U A;  1YI2 T;  4LDY A;  1YHQ A;  3QPH A;  4QW2 A;  1JBM A;  3QYH B;  1NEB A;  1SEM A;  5FU7 C;  1ZUU A;  2XIC A;  1W6X A;  1S72 A;  3ULR B;  1QW1 A;  3H9N A;  1UFF A;  1D0Z A;  3GF5 A;  4M4Z A;  3VYG A;  5GMK h;  1WJQ A;  3FEO A;  1Q7Y C;  2PVO B;  1CKB A;  4J9H A;  2RA2 A;  2Y4Y A;  3UPU A;  3VS1 A;  1XQH A;  1AWX A;  3OMG A;  1MMA A;  1M2O A;  1K0X A;  2LMJ A;  1M2V B;  1Q95 G;  3RIR A;  4M75 A;  3NTK A;  3CME A;  2WSC E;  3RKW A;  2NUP A;  2X51 A;  1VQL T;  8ATC B;  4XTW A;  2F69 A;  3TSW A;  4E7J A;  3N5B B;  1C1A A;  2RQV A;  1GFC A;  4M77 G;  3VV0 A;  3P8B B;  1YJN T;  4N4G A;  1PRL C;  5LJ3 e;  2CDT A; 
#chains in the Genus database with same CATH homology
 3CCS Q;  1VQ9 Q;  1KQS P;  3I56 Q;  1JJ2 P;  1VQ5 Q;  1VQK Q;  1VQ6 Q;  3CPW P;  3OW2 P;  1W2B P;  3CMA Q;  1NJI R;  1YHQ Q;  3CC2 Q;  1YIJ Q;  1VQP Q;  1VQM Q;  1VQN Q;  1K73 R;  1VQO Q;  3CCQ Q;  1Q81 R;  3CXC P;  1M90 R;  1VQ4 Q;  1VQ7 Q;  1K8A R;  2OTJ Q;  1QVG P;  3G6E Q;  1Q82 R;  3CCU Q;  3G71 Q;  1VQL Q;  1YIT Q;  1Q86 R;  1YI2 Q;  3CC7 Q;  3CCV Q;  3CCJ Q;  3CCR Q;  1YJ9 Q;  2QEX Q;  1KD1 R;  2QA4 Q;  3CC4 Q;  1QVF P;  1YJW Q;  1S72 Q;  3G4S Q;  3CCM Q;  1KC8 R;  3I55 Q;  3CCE Q;  3CD6 Q;  1N8R R;  1YJN Q;  1K9M R;  1Q7Y R;  2OTL Q;  1M1K R;  3CME Q;  1VQ8 Q;  3CCL Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...