3G71Q

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3g71Q00
3G71Q 1K73R 1KC8R 3CCRQ 1YHQQ 1K8AR 3CMEQ 2QA4Q 1VQ5Q 1VQKQ 1VQPQ 3CC7Q 1YJNQ 1VQ4Q 1K9MR 3CCQQ 1VQ7Q 1JJ2P 3CCLQ 1N8RR 3I56Q 3CCEQ 3CC2Q 1KD1R 1Q86R 3CPWP 1VQ8Q 3CC4Q 1S72Q 1Q82R 1QVFP 3CCMQ 3CXCP 2OTJQ 3OW2P 3I55Q 1YIJQ 3CMAQ 1M90R 1Q7YR 1YITQ 3CD6Q 1VQNQ 1VQMQ 1M1KR 1KQSP 1VQLQ 1NJIR 2QEXQ 1VQ9Q 1W2BP 3G4SQ 1YJ9Q 1VQ6Q 3CCJQ 3G6EQ 1YJWQ 1QVGP 1YI2Q 2OTLQ 3CCSQ 3CCVQ 1Q81R 3CCUQ 1VQOQ
chains in the Genus database with same CATH superfamily
1S72T 4OMMA 3HP9A 3L2WA 2D6FA 2RNAA 1Z9ZA 2AK5A 2P0QA 4PKCC 2V8IA 1P92A 1UGPB 4ELYC 3G71A 2CYZB 3FRNA 2HQHA 2ROLA 1VQ7T 2XMFA 1Y96B 3M0SA 3FC3A 1RAFB 2XKOC 3Q1JA 4O5VA 2DZ9A 3THKA 2WSCE 3BY7A 7AT1B 3EFOA 3CBPA 2L8DA 2QQBA 3ULRB 2BZXA 2L2PA 3ER0A 3INZA 3T9NA 3FLGA 2QASA 3HL8A 1NM7A 5EG2A 1GFCA 2K5IA 1M3BA 4A63B 4YTLA 2AZVA 3EAEA 1IB8A 3SWNC 2LJ3A 1YI2A 2CGHA 1WLPB 1ARKA 4JZ4A 2XICA 3HKSA 1NZ9A 1MMNA 2KY9A 4JUVA 3FIFA 4A53A 6AT1B 4RCCA 5CAIA 1LOJA 2HCKA 3JCMd 2FPFA 2RD1A 2KXDA 3CC7Q 3HRUA 1WI7A 2LQ8A 5LL6S 3META 5GAMe 2CUDA 1HD3A 2QQ9A 4F7UF 1RAAB 1V29B 4CC2A 2QDLA 4M7AD 3C4SA 2KYBA 2E5QA 2JXBA 1TG0A 2QYZA 2X4XA 3G4SQ 3G4ST 1SSHA 2OTLQ 2OTLT 3H8ZA 3OB9A 3SDZA 1KC8R 4JRQA 3OYYA 1YJNT 3E19A 1QQJA 3TREA 3EFSA 3KBGA 2JS0A 1VQOT 3AHUA 5GAMf 2K5LA 2NYSA 4XU3A 5GAN6 1N5ZA 3QYGB 4EMHA 3G6EQ 4C8QG 4F7UG 3CC4T 4IKFA 5IHIA 1YITT 1UG1A 2KT8A 1IXDA 4HXJA 1ZBJA 2I0NA 3QHSA 4C5GA 4KH1B 1UB4A 4M75E 1RAIB 1RADB 2YUQA 4AFQC 2DLPA 1U1TA 1VQNA 3JCMX 3SFMA 4F7UE 3DLMA 2P0KA 1YJ9A 4C8QA 5CKEA 2ZPIB 1QP2A 5FRNA 2A0FB 4IIOA 1WHLA 4ORZA 2RHXA 3OYCA 2QAZA 5IXFA 2CT4A 4RTTA 5KYWA 4ANJA 3H0IA 2E5KA 2E70A 4CC3A 2F69A 2MIOA 4JS5A 5AYFA 1PD0A 3MP6A 2K5FA 1D3BB 3CCQA 3I9QA 4E7LA 1VQMT 3EGDA 3M59A 5CQYA 3CPWS 2FVUA 2LQKA 4P5NA 4C0DC 2X3XD 3CPFA 1UTIA 3DKMA 4QQ6A 2OTLA 3CCSQ 3JCMb 3J80E 3CCRQ 1W1FA 3JB9H 1IZ6A 4LDWA 4AFUC 2FO0A 2HEQA 3OYBA 4FYWB 3PMIA 1RL2A 5KE3A 4M7DB 2F5TX 4HT9A 3EHRA 2RHYA 2CH4A 2DEQA 2OAWA 1PM3A 4KUIA 3QJYA 3LLRA 3TSWA 1JJ2S 2R5AA 1Q86U 4C92G 1BCOA 4OB1B 1YN8A 1WHGA 4PK4A 3A1PA 1ACMB 1YI2T 2MI6A 5LJ3e 2GFUA 4N0AC 3VKIA 3RMQA 5LJ5d 1QWFA 2RJEA 5KCOA 2DTOA 4J9HA 3CCVT 4XAXB 3G6EA 1AT1B 3CCUA 1K8AU 4C5EA 1O9SA 4XTZA 1W70A 1KSWA 3UA7A 3X25B 4OMPA 3BDUA 4DBHA 1VQNT 1HJDA 4PLIA 2SRCA 1JQQA 2JMCA 1VQKQ 5LJ5h 3QZ5B 2EW3A 2FB7A 3CCQT 3EHQA 8ATCB 3CD6A 1N8RC 2FL7A 2E10A 1OX8A 1C0MA 1W2BP 4QVCA 2RI5A 4E7JA 4BI3A 1I81A 4HVVA 4J9GA 3NFCA 1MUZA 2LTOA 4PJOB 3OY9A 2BUDA 5CKFA 4XTVA 1MGQA 3LH0A 2HKQB 2DE0X 1FWZA 1VQ6Q 3VS0A 3I56T 1YFNA 1OI1A 4LNPA 3M55A 3EG1A 4DOVA 1WIEA 1C6VX 1A0NB 2CP3A 3NTKA 4E7IA 3CPWP 2YUPA 2XIDA 3H9NA 1TH7A 1ZSGA 2ED0A 3SWNA 2M02A 2DJQA 2K3YA 2DIQA 2FZKB 4PLLA 5DM7R 2HD0A 4DBQA 3VS4A 1YI2Q 4Q5WA 1AWOA 3C95A 2NUTA 3OYFA 2E12A 1K8AR 1VQMA 1R77A 1KHCA 5KYXB 4OF1A 4C8QC 5CKDA 4J9CA 4GBQA 1M27C 3EG2A 2VVKA 4E7ZA 1FMWA 5FWBA 1G3SA 2VC8A 3JCMQ 2X4JA 4E7HA 2LNHB 4DEYA 1TUDA 2KBTA 1WHJA 2NUPB 2FHDA 3UDCA 1QVGP 3CCST 1VQOQ 1FX7A 4AG1C 3LWIA 4PNOA 1SEMA 2DL5A 4MZPA 4C92A 4M78A 1EZZB 2PNIA 5LJ3f 4OP0A 3V8JA 4OGEA 4OMFB 2JW4A 2W0ZA 3LX7A 5GANd 2B86A 3OYEA 3HRSA 2QEXQ 4C8QD 1GFDA 1H3HA 4FSXA 1WPYA 5LJ5g 4IUQA 1QW1A 2QTXA 2KMTA 1TS9A 5GJWB 1GL5A 2VUBA 3CC2Q 2A7YA 2JJ9A 4JDSA 3OYGA 1TUCA 1N9RA 2LT1A 5GAN7 1FYNA 2DD5A 1KQSS 3PNWC 2D0QB 2H3JA 5LJ5j 2O88A 2XDBA 2H3EB 3CMEQ 4L6V5 2O4XB 1M2OA 2EJGA 5GAOn 1RAEB 1Q81C 2KYMA 3CBMA 3PGGA 2VWFA 2DXBA 2V26A 4OB0B 1IGUA 2MMPA 1JU5C 2K79A 5CQXA 2X4WA 4L59A 2EQIA 4M7AA 1XJWB 5IH2A 3JCMP 2LJ1A 3REBB 1CKBA 3CEYA 4X1VA 2XDDA 2AHJB 2JMAA 2K9GA 2ED1A 2DJZA 1NE8A 1RUWA 3BFMA 4OGCA 2MPXC 2QGGA 2C0OA 3CPWA 4B9XA 3CXCA 2YRCA 1WX6A 1ZA2B 2KRNA 4Z02A 1YHQA 3OW2S 3ZEHA 4M7DE 1U3OA 1D1CA 2I2LA 2CSQA 2HNIA 4PJJA 5L8RE 2PVDB 4X34A 3QJ6A 1N8RU 2RQTA 2GGRA 2MAMA 1JXOA 3EGDB 2AKKA 9ATCB 3CCEA 2DYIA 4M77A 2M0OA 2DFUA 1ZUUA 4M75F 4R56A 2G6FX 3O8VA 1Q82C 5KYUA 4RTXA 2EYXA 1Q81U 2A3LA 3QPHA 4K11A 2YWWA 2QQSA 2AT1B 2FG0A 1K8AC 3OMCA 4E2FB 5I2MA 4XTWA 2GQIA 1KD1U 4M77G 1VQ6A 4LD9K 3S6WA 3VS6A 4C92C 5CKBA 3NPFA 3CCJA 2EGEA 1C1AA 5KH6A 3UPUA 4QVDA 1Y57A 1Q86C 4Y28E 4F14A 2LMJA 2AZSA 2NLUA 2E64A 1RACB 5CR2A 2EQJA 2M16A 1S1NA 3GOXA 2HSPA 2MK5A 3I55A 1V1CA 4BD3A 2ECZA 5GMKh 4FYXB 4A4GA 3NMZC 2JS2A 4PL6A 2VV5A 4ZTJA 2R5MA 2V8JA 1K9MR 3PT9A 1EIFA 2E65A 2Z0WA 2RJCA 1D1BA 3H0HA 5GMKl 1KQSA 2JM8A 1Z9QA 3MEUA 1VQ4T 3HRTA 1N6AA 3RMSA 3OSSC 2RA2A 4DBRA 5HK0A 2PU9B 4Z88A 1YHQT 3L1AA 3M4YA 3ZBDA 3S3NA 4QQGA 2J6KA 1UGSB 4DA4A 2JTFA 1SHGA 1T0HA 2YRVA 2OTJQ 1K9MC 2X9HA 2EIFA 2RPNA 1KQ2A 2RQVA 3L2UA 2L0AA 5DY9A 1B3QA 4F7UA 2XU8A 3A98A 3I55T 2PVGB 3PIOA 2COYA 3JB9I 3TU4K 1RAGB 1JJ2P 2QQRA 5HCKA 1WFWA 4PJOC 1ZX6A 3KXTA 2K2VA 1QMCA 3PIPA 4J9DA 4NOYA 3CCJQ 1QVPA 2J05A 2CS7A 3A8GB 2M51A 4XQ3A 3JB9D 1YBYA 3QWXX 1QCOA 3GNFB 4M77C 1KFZA 4O6JA 2CP7A 2RHZA 2E41A 2GCXA 1OYXA 4FW2A 4A4HA 5GAN5 3OMGA 2DXUA 4LXCA 1VQNQ 2VGNA 2YUOA 2VXEA 2D1XA 3QIIA 2P84A 4OMNA 1R8OB 1KIKA 4VUBA 4PFZA 1AEYA 2JNGA 4BB7A 2HL3A 1W6XA 1JBMA 2MCNA 2MWOA 1NYGA 4BI4A 3CCLA 1UGRB 3LH5A 4LUDA 4FT4A 3VYHB 3GNGA 3VRYA 4TVRA 3V7SA 1EFNA 5A0LA 2EQUA 2GFAA 4AMCA 2QK0A 3NGPA 4RTZA 2XI9A 5IN1A 1WZOA 2DX1A 1AVZC 1PG5B 2EPDA 4LDUA 5CKHA 3CCEQ 4KBMB 2O31A 2CP2A 4JRKA 5GMKe 1SF9A 1VYVA 2ATCB 2CP5A 2DBMA 1WGSA 2M1HA 3PVQA 1Q7YC 4BE1A 3EH1A 4M7AG 1YHQQ 2V1QA 3DB4A 1GCQC 1BI0A 4FYVB 1QVFA 2QQAA 1MMDA 2A36A 3MEAA 4JJNK 1I0CA 2HL5C 1CKAA 3OW2P 1M2VA 4HT8A 1OX9A 2O2OA 2X35A 4PJOD 4XU1A 2EFIA 4JLGA 4M7AE 1TTHB 4IUUA 2HZYA 1NEGA 2CT3A 4E47A 5GANg 2CZ6B 1QP3A 2DRKA 5GAMj 4MZMA 4BDZA 3CCLT 2QTVA 1NLOC 2Y4XA 1TUGB 1JJ2A 2YXYA 3C12A 1OZ3A 1ZSZB 1M8MA 3R6NA 3CBOA 2A28A 4A4FA 2MWPA 3M4GA 2DVJA 3X20B 3EFRA 3OYIA 3I5RA 2SEMA 2B8AA 1PNJA 3LGFA 3G71Q 3O5ZA 4FM4B 1VQ5Q 3M54A 1QKWA 1QCFA 1M90U 3L42A 1N8RR 1W4SA 1N27A 1BK2A 4IUVA 2NWMA 1PRLC 3VJPA 3C94A 4NL3A 1XNIA 1Q81R 2BIVA 3KFVA 1F1BB 2Y90A 2WSFE 3OYDA 2QGFB 4M78E 4J6YA 3G71T 4EMKB 1I8FA 2DD4A 4JJBA 3EGXA 1D09B 5CVIA 3J81E 1LJOA 4D8KA 3CMET 1WNLA 1ZQ1A 1VQPT 4C5IA 1ZSZC 3VV0A 5KCHA 1NPPA 3M0TA 5LJ3j 1PSFA 4N4IA 1X43A 2RK1A 4R55A 2PQWA 3QBYA 1VQ4A 3UT1A 4C8QB 4JLIA 3M56A 1Q7YU 1M3CA 2L3QA 2DERA 3CC2T 4KUDK 2DXTA 2KEAA 2YSQA 1VQ7A 2DK3A 5A0GA 3GP8A 3DLLA 3MEWA 1R0CB 3H41A 2KROA 4A4EA 2KRSA 1PKSA 3QKJA 1D3BA 1S72A 2R58A 3QDRB 4ME7A 3REAB 5J3BA 5IHNA 3RBBB 3HHTB 3OYHA 4M7DF 2BKDN 3CCVA 4FIBA 4J7IA 1M30A 4PJOA 1UGQB 1SRMA 1X75C 1NEBA 1KQ1A 4M78F 2DO3A 1Y71A 5DLQE 2V8KA 2ZPHB 3VS1A 4LD6A 1TXQA 5GANj 4HVUA 2A37A 1H3ZA 2KSSA 2XG8D 1K4US 4KULA 3RNJA 1K0XA 5FLXE 1K73R 1UFFA 3JCMW 1NJIU 2RI2A 2GTJA 3CCET 3OS0A 1WYXA 3QSUA 4GLKA 1GCQA 4RG2A 1VQLQ 1GCPA 2JZ2A 3QXEB 4HCZA 2YLCA 2EKHA 1LCKA 1MMGA 1V76A 2ZPBB 2GTOA 4AFSC 1PHTA 1I1JA 1BCMA 2ZZDA 2VXFA 3ME9A 2QEXT 1XOVA 4E7SA 2ROTA 3OBWA 1KG1A 4NL2A 2G3RA 3CMAQ 2JOYA 2YT6A 1YJWT 2HDAA 1OU8A 5I11A 2BZ8A 3RDVA 1MV0B 2OAUA 5GMKm 1AZGB 3GF5A 3JCMV 1AWWA 4KGXB 2HMAA 4BDYA 1M90C 3U23A 1BYMA 1H641 4BACA 4C92B 1E6GA 2JVVA 2LNVA 5FW9A 2VKNA 1WQ7A 4LN2A 1OQKA 1I5LA 3JSCA 1UJYA 4XTYA 3JB9G 3D7SB 3OYAA 3CCSA 1T0JA 5M9OA 3CC4A 5GAOl 2MF2A 3V8KA 3JCMJ 2KR3A 1IO6A 3FEOA 3RKXA 2LP5A 1T3SA 1FMKA 5LJ5e 3CCQQ 3CCRT 1YIJA 4M75G 4IIMA 1ZA1B 5KYUB 3I55Q 4F04B 2LT4A 4FW1A 2X4YA 1VQMQ 1VQKT 1JXMA 1YNZA 1YJ9T 1YJ9Q 3SWNB 3MCAB 5I21A 2RI3A 1LVKA 2FRYA 1O75A 3PFSA 4M75A 4OMOA 3J7AF 4ZTFA 2DKGA 5LJ5f 2FEIA 4PJNA 2O9SA 4KH0B 2GNCA 4BE2A 3OYKA 4JZ3A 2VASA 2COZA 2WACA 4QVZA 4M7AC 2JTEA 3L2VA 1VQ9Q 4N0AA 2D8JA 1RI9A 2JN0A 1D0ZA 3ZFJA 4E6RA 3JCMe 1B7TA 4ZGJB 4J7FA 1MHNA 5GAN3 3V8LA 2CDTA 1JB0E 3SEMA 3NTIA 3OW2A 2ZPGB 4D6WA 3LWHA 1IHWA 3RKWA 4F7UB 3EG9B 1ZHIA 2PVOB 3JCMc 1KD1C 5GAOq 2LC4A 2YDLA 1AD5A 3G4SA 4IUTA 1RLPC 1B07A 5GAN4 1T3LA 1Q82U 2BE9B 1RLQC 4LDVA 1YCSB 3UATA 1YJNQ 3JV3A 2KDSA 5A0DA 3OA6A 4DOWA 4JRPA 1VOMA 3V7CA 3PVLA 2JT4A 1QKXA 2FYKA 5J39A 3WVDB 2HKNA 5FU6B 2RHUA 5CCAA 3OYMA 3A8OB 1QLYA 2LRQA 2DPPB 2KGTA 3JCMf 2EJ9A 4QW2A 4M75B 3TSZA 3UF4A 1AOJA 4C8QE 5GAN2 1G3YA 2P4RA 4EDUA 5HK3A 5GMKi 2OJ2A 2CP0A 4OB2B 3NTHA 3JCMg 3EG0A 4OMLA 3CCRA 4D8DA 1YIJT 3OYLA 1YITQ 1RAHB 4JPBW 2HQEA 1Q7YR 2D8HA 4XTXA 1QVFS 1G5VA 1DJ7B 3PMTA 1X6OA 1QWEA 2RB6A 1OV3A 4M78G 4J8OA 2LDMA 2PZ1A 3OYJA 4J9BA 2DRMA 4UC4A 5C0MA 3OQ5A 1YWOA 4M77D 4C0FA 2XDPA 1X2QA 1X6BA 1YJNA 3S3OA 4Z89A 2DL4A 3H6ZA 3FB9A 3WVEB 3H0FA 1K9MU 3HSBA 3WXMB 2EGAA 1UUEA 2DETA 2QG9B 2F1LA 1VA7A 2EWNA 4M7AB 3M9QA 4JS4A 2LZ6B 1BKBA 5LJ3d 1JEGA 2QEXA 4PJLA 1TSFA 5C6SA 1UECA 1SPKA 3UA6A 3L2QA 5FU7C 3UWNA 1ZBXA 2CREA 2ZCFB 2LX9A 3RKYA 2Y4YA 4RMOA 2YUNA 1E6HA 1VQ8T 5J26A 2EYZA 2E6ZA 1QCNA 4J5YA 1SG5A 3JB9F 2BTTA 1VQPQ 1OPKA 4Y91A 2RQRA 1JO8A 3RERA 5GAMd 3ASKA 1AHJB 1X27A 2X51A 3SHWA 4M75C 2RF0A 3HFOA 1EX4A 4ZNXA 5D6YA 1KC8U 3CCUQ 2QI2A 1MNEA 1UEBA 1PSEA 2NUTB 3C0CA 1VQ9A 1BI2A 3IQLA 3URGA 3OS2A 2E1HA 1VQ7Q 2IG0A 4IUPA 2L89A 1PKTA 4C92F 3MP1A 1WQWA 2CUBA 4ZGEB 1W2BS 4C92E 1M2VB 3M0RA 4E7KA 4II1A 4QT7A 4FYYB 4XTUA 1WA7A 1I5OB 3TVTA 5IAYA 4JRIA 3VS3A 3AT1B 3M5AA 1QVFP 2ZPEB 1YIJQ 3R6OA 2K2MA 2COWA 2DTIA 3BW1A 3QO3A 1YCYA 5KYWB 1VQ9T 3QUIA 4RKUE 2RQUA 2F2XA 2J6OA 3I56A 2DYBA 3CMEA 3CMAA 1VQPA 2K57A 3P8BB 5KYNA 3QDFA 1NPRA 4FSSA 5GMKj 1X2KA 2JUFA 2L3PA 4CC4B 4B9WA 1N9SA 3I35A 1TWBA 3CD6Q 5GAMg 1WJSA 2YHTA 1VQ8A 1GRIA 4L5GA 2DF6A 2F5KA 2O01E 3OBYA 1ZUYA 3GBQA 3P8HA 2FZGB 2J06A 2ZPFB 2RN8A 4BE0A 1IGQA 1UHFA 1PCXA 2CH4W 2EAYA 4M78B 4HCCA 5GAOr 4DBFA 4ZN3A 1WJQA 1K73U 5LJ3g 3MKDA 1SHFA 3I5SA 3HPWA 1OU9A 2NUZA 1WJRA 3VU3C 2IVWA 3LGLA 2C0TA 5EC7A 5KYXA 1TOVA 2FPDA 4EPCA 1X69A 2EQKA 3JAME 1WDXA 4M75D 3ZL7C 2BZYA 5GAN8 4PJOE 4J6XA 2EYQA 4AFZC 4LE9A 1M90R 2QA4T 1FMVA 3OSVA 4C0DB 1ZLMA 2PUKB 3VS7A 2KXCA 1KK7A 1YJWQ 1ZUKA 4M77F 3F70A 1MMAA 4X9CA 1VUBA 2RMOA 4M77E 2O4XA 3X28B 1BBZA 3I56Q 1VQ6T 4MZTA 4PFOA 4FL6A 4EMKC 4RTUA 1LNXA 4BY6B 4M77B 1XTDA 4HVWA 1K76A 5IHKA 4DEXA 3EG3A 4CC7A 5CO7A 5GJVB 5D6XA 4M4ZA 4LDYA 1WHKA 2DXCA 2F2WA 3VUZA 1PD1A 1ABOA 2EKOA 3V7RA 4CRIA 1UGVA 1RI0A 1U8RA 1PC0A 2V1RA 3VRZA 3X24B 3CXCS 2PUOB 3SB2A 3OS1A 1KHIA 2CP6A 3E2UA 1JRIA 1M3AA 5DLOA 1SKUB 1Y96A 2KRMA 4LUEA 2E6NA 2K7AA 3EGUA 3G1JA 3S3MA 3HFNA 1MNDA 2OTJT 4V2SA 4ZGDB 4IURA 2W10A 4RTVA 1K73C 4C92D 2E3IA 1NLPC 1IREB 4HKEA 2JTMA 2LVMA 3JCMh 1X6GA 2EJFA 3CD6T 2XD0A 3A8LB 3QWYA 1VQLT 3FDRA 1I4K1 4J9EA 2ABLA 2K3BA 5AT1B 4C8QF 2LCLA 5GANf 1OOTA 2DAQA 1VQ5A 1GBRA 3QZ9B 3L2RA 1OPLA 1D0XA 2CSIA 4N4HA 4XU0A 5GANe 2KAFA 1UE9A 3TCJA 1WXUA 2DL3A 3FJ5A 1NBEB 1WHHA 1CSKA 1H8KA 2OX7A 4BUGA 1VQ8Q 3CC4Q 2NUPA 1U5SA 3PTAA 2DA9A 5FROA 1YITA 1NYFA 2JM9A 1NJIR 1AZEA 2KVQG 1U1SA 2DIGA 2MYSA 2H8HA 1M5Q1 1VQOA 1BIBA 2OTJA 4MMKA 3A8HB 1VYTA 4WF2A 2DVEA 2CZ1B 3L2ZA 3CC7T 1AWXA 2KT1A 4XU2A 4PFPA 2HBPA 3VYGA 3N5BB 1K1ZA 1X01A 1B34B 1YP5A 3LW5E 4RUGA 3M0PA 3X26B 1NG2A 1IRXA 3DB3A 1PWTA 1HYOA 2J7IA 3CCLQ 5HY6A 2VYTA 4WCIA 1GBQA 4XK8E 2WSEE 2L3RA 2L5QA 2M0YA 1VQLA 1IHVA 2CKKA 2CZ0B 3GPLA 2PTKA 1KC8C 1KQSP 4KGVB 2EGCA 1M1KU 4C0ZA 4HCKA 4J9IA 1BI3A 4GY5A 3LYIA 2D9TA 2DTHA 1XQHA 4J6WA 3P8DA 4OMQA 3E1SA 4PJMA 1G8XA 2KI7A 2RK2A 1OZ2A 2A08A 3QYHB 1W2BA 1MV3A 2M9UA 2DBKA 4WTOB 1TU0B 4M7DC 3CQTA 1VQ5T 4F17A 1RABB 4RTYA 4BI8B 3RUXA 3JB9J 1Y7XA 4M78C 1M9SA 5ECAA 5GANh 1S72Q 5HKCA 2KE9A 2GQVA 5D6WA 3RESA 4OB3B 4QQDA 2KK4A 1K9AA 3SD4A 2FRWA 1D1AA 2CZ7B 2BE7D 2VB6A 1UJ0A 2F2VA 1WXBA 1M4ZA 3TEEA 1VQKA 2C06A 2RHIA 4JJCA 1Q86R 1OULA 1WHMA 4AG2C 1QVGS 1BB9A 1D0YA 2FPEA 1UDLA 3BE3A 1ABQA 5IT9E 5IXBA 5FU6C 4MMLA 2DEUA 4RG8A 1G2BA 2L3SA 4FU6A 2LCSA 3MO8A 3CCMT 4KRTA 3RR6A 2IIMA 2QA4A 3G6ET 3CCUT 3A5ZB 5FWCA 1BI1A 2HAXA 4MDWA 1BIAA 5CK9A 1ZSZA 2KNBB 2RH2A 3FJPA 5FU7B 1H92A 3EH2A 3VUBA 4AT1B 2LQWA 3VS2A 2EQMA 4ATOA 2DL8A 1NJIC 2RJDA 4FCYA 4EMGA 2R57A 2KQWA 2DZCA 1G3WA 5KE2A 5A2QE 2ZAEA 3E9GA 3EFOB 2DNUA 3PE0A 4ZN1A 3GIBA 1UHCA 3CXCP 4C5HA 2K3XA 1FXXA 1KJWA 3QG1A 2C0IA 1M1KR 4M7DG 3M58A 3G7ZA 3GLXA 3KUFA 1HXDA 2RM4A 3M0UA 2HBWA 3M57A 4R0KA 5LJ3h 2EYWA 4A4KA 5I2SA 1Y07A 1SRLA 1VIEA 4KGZB 1LPLA 4DQ2A 2DILA 1E7OA 2E3HA 3EGXB 4OVAA 3OYNA 3CC2A 4FT2A 1HSQA 4RTWA 1QVGA 2AIRB 1AWJA 2E4HA 4CI0C 2LJ0A 2LCCA 5CIUA 2YLBA 2RQWA 3CCVQ 4B6MA 2EYYA 1M1KC 3CCJT 3MP8A 2QA4Q 3A8MB 2QDYB 3RIRA 2EVRA 4HCBA 4F16A 1OEBA 4M7AF 1Q95G 4HA8A 2AKLA 1B34A 2EBPA 4PJOF 2GF7A 1BU1A 3MHXA 3BDLA 3M53A 4NS5A 3EG9A 3CCMA 1PRMC 5KYYB 4C0GA 4J9FA 5L23A 2X3WD 1K0SA 5D7UA 3NHNA 2K4YA 4QKUA 1M8VA 2HQXA 2ESWA 3HTRA 1U06A 2K6DA 4Y92A 4N4GA 3VS5A 2LQNA 4EMKA 2ENMA 3CMAT 4BY6C 3OS5A 3TQ7P 1Y0MA 4JJDA 2O9VA 2YRDA 2P4TA 4M78D 4ESRA 4GLMA 5I22A 5FRMA 3E9FA 2GBQA 1G3TA 2ZGWA 5GAMh 5KYYA 3CC7A 4M7DD 4X9DA 1VQ4Q 1WXTA 1VIFA 1GXIE 4Z8AA 1KD1R 2DL7A 3JRZA 1Q82R 3CCMQ 1HK9A 4EIKA 2P0PA 2RJFA 2QXFA 4A54A 5GAOp 1VYUA 4ELZC 2XK0A 3MPUB 1G83A 3M0QA 1YJWA 1J3TA 1I07A 4KT0E 1R0BG 1SSFA 3MEVA 5GAOm 2HSEB 1M1FA 1M1GA 2FZCB 2MOXA 4PJOG 1YWPA 2DMOA 2XHCA 2DM1A 2J6FA 4MDXA 2RO0A 2LX7A 4RCBA 2VGMA 4M7DA 2IPOB 4LDXA 2OI3A 3MJXA 4J83A 2D0NA 8AT1B
chains in the Genus database with same CATH topology
3G71Q 1K73R 1KC8R 3CCRQ 1YHQQ 1K8AR 3CMEQ 2QA4Q 1VQ5Q 1VQKQ 1VQPQ 3CC7Q 1YJNQ 1VQ4Q 1K9MR 3CCQQ 1VQ7Q 1JJ2P 3CCLQ 1N8RR 3I56Q 3CCEQ 3CC2Q 1KD1R 1Q86R 3CPWP 1VQ8Q 3CC4Q 1S72Q 1Q82R 1QVFP 3CCMQ 3CXCP 2OTJQ 3OW2P 3I55Q 1YIJQ 3CMAQ 1M90R 1Q7YR 1YITQ 3CD6Q 1VQNQ 1VQMQ 1M1KR 1KQSP 1VQLQ 1NJIR 2QEXQ 1VQ9Q 1W2BP 3G4SQ 1YJ9Q 1VQ6Q 3CCJQ 3G6EQ 1YJWQ 1QVGP 1YI2Q 2OTLQ 3CCSQ 3CCVQ 1Q81R 3CCUQ 1VQOQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 Q;  1K73 R;  1KC8 R;  3CCR Q;  1YHQ Q;  1K8A R;  3CME Q;  2QA4 Q;  1VQ5 Q;  1VQK Q;  1VQP Q;  3CC7 Q;  1YJN Q;  1VQ4 Q;  1K9M R;  3CCQ Q;  1VQ7 Q;  1JJ2 P;  3CCL Q;  1N8R R;  3I56 Q;  3CCE Q;  3CC2 Q;  1KD1 R;  1Q86 R;  3CPW P;  1VQ8 Q;  3CC4 Q;  1S72 Q;  1Q82 R;  1QVF P;  3CCM Q;  3CXC P;  2OTJ Q;  3OW2 P;  3I55 Q;  1YIJ Q;  3CMA Q;  1M90 R;  1Q7Y R;  1YIT Q;  3CD6 Q;  1VQN Q;  1VQM Q;  1M1K R;  1KQS P;  1VQL Q;  1NJI R;  2QEX Q;  1VQ9 Q;  1W2B P;  3G4S Q;  1YJ9 Q;  1VQ6 Q;  3CCJ Q;  3G6E Q;  1YJW Q;  1QVG P;  1YI2 Q;  2OTL Q;  3CCS Q;  3CCV Q;  1Q81 R;  3CCU Q;  1VQO Q; 
#chains in the Genus database with same CATH topology
 1S72 T;  4OMM A;  3HP9 A;  3L2W A;  2D6F A;  2RNA A;  1Z9Z A;  2AK5 A;  2P0Q A;  4PKC C;  2V8I A;  1P92 A;  1UGP B;  4ELY C;  3G71 A;  2CYZ B;  3FRN A;  2HQH A;  2ROL A;  1VQ7 T;  2XMF A;  1Y96 B;  3M0S A;  3FC3 A;  1RAF B;  2XKO C;  3Q1J A;  4O5V A;  2DZ9 A;  3THK A;  2WSC E;  3BY7 A;  7AT1 B;  3EFO A;  3CBP A;  2L8D A;  2QQB A;  3ULR B;  2BZX A;  2L2P A;  3ER0 A;  3INZ A;  3T9N A;  3FLG A;  2QAS A;  3HL8 A;  1NM7 A;  5EG2 A;  1GFC A;  2K5I A;  1M3B A;  4A63 B;  4YTL A;  2AZV A;  3EAE A;  1IB8 A;  3SWN C;  2LJ3 A;  1YI2 A;  2CGH A;  1WLP B;  1ARK A;  4JZ4 A;  2XIC A;  3HKS A;  1NZ9 A;  1MMN A;  2KY9 A;  4JUV A;  3FIF A;  4A53 A;  6AT1 B;  4RCC A;  5CAI A;  1LOJ A;  2HCK A;  3JCM d;  2FPF A;  2RD1 A;  2KXD A;  3CC7 Q;  3HRU A;  1WI7 A;  2LQ8 A;  5LL6 S;  3MET A;  5GAM e;  2CUD A;  1HD3 A;  2QQ9 A;  4F7U F;  1RAA B;  1V29 B;  4CC2 A;  2QDL A;  4M7A D;  3C4S A;  2KYB A;  2E5Q A;  2JXB A;  1TG0 A;  2QYZ A;  2X4X A;  3G4S Q;  3G4S T;  1SSH A;  2OTL Q;  2OTL T;  3H8Z A;  3OB9 A;  3SDZ A;  1KC8 R;  4JRQ A;  3OYY A;  1YJN T;  3E19 A;  1QQJ A;  3TRE A;  3EFS A;  3KBG A;  2JS0 A;  1VQO T;  3AHU A;  5GAM f;  2K5L A;  2NYS A;  4XU3 A;  5GAN 6;  1N5Z A;  3QYG B;  4EMH A;  3G6E Q;  4C8Q G;  4F7U G;  3CC4 T;  4IKF A;  5IHI A;  1YIT T;  1UG1 A;  2KT8 A;  1IXD A;  4HXJ A;  1ZBJ A;  2I0N A;  3QHS A;  4C5G A;  4KH1 B;  1UB4 A;  4M75 E;  1RAI B;  1RAD B;  2YUQ A;  4AFQ C;  2DLP A;  1U1T A;  1VQN A;  3JCM X;  3SFM A;  4F7U E;  3DLM A;  2P0K A;  1YJ9 A;  4C8Q A;  5CKE A;  2ZPI B;  1QP2 A;  5FRN A;  2A0F B;  4IIO A;  1WHL A;  4ORZ A;  2RHX A;  3OYC A;  2QAZ A;  5IXF A;  2CT4 A;  4RTT A;  5KYW A;  4ANJ A;  3H0I A;  2E5K A;  2E70 A;  4CC3 A;  2F69 A;  2MIO A;  4JS5 A;  5AYF A;  1PD0 A;  3MP6 A;  2K5F A;  1D3B B;  3CCQ A;  3I9Q A;  4E7L A;  1VQM T;  3EGD A;  3M59 A;  5CQY A;  3CPW S;  2FVU A;  2LQK A;  4P5N A;  4C0D C;  2X3X D;  3CPF A;  1UTI A;  3DKM A;  4QQ6 A;  2OTL A;  3CCS Q;  3JCM b;  3J80 E;  3CCR Q;  1W1F A;  3JB9 H;  1IZ6 A;  4LDW A;  4AFU C;  2FO0 A;  2HEQ A;  3OYB A;  4FYW B;  3PMI A;  1RL2 A;  5KE3 A;  4M7D B;  2F5T X;  4HT9 A;  3EHR A;  2RHY A;  2CH4 A;  2DEQ A;  2OAW A;  1PM3 A;  4KUI A;  3QJY A;  3LLR A;  3TSW A;  1JJ2 S;  2R5A A;  1Q86 U;  4C92 G;  1BCO A;  4OB1 B;  1YN8 A;  1WHG A;  4PK4 A;  3A1P A;  1ACM B;  1YI2 T;  2MI6 A;  5LJ3 e;  2GFU A;  4N0A C;  3VKI A;  3RMQ A;  5LJ5 d;  1QWF A;  2RJE A;  5KCO A;  2DTO A;  4J9H A;  3CCV T;  4XAX B;  3G6E A;  1AT1 B;  3CCU A;  1K8A U;  4C5E A;  1O9S A;  4XTZ A;  1W70 A;  1KSW A;  3UA7 A;  3X25 B;  4OMP A;  3BDU A;  4DBH A;  1VQN T;  1HJD A;  4PLI A;  2SRC A;  1JQQ A;  2JMC A;  1VQK Q;  5LJ5 h;  3QZ5 B;  2EW3 A;  2FB7 A;  3CCQ T;  3EHQ A;  8ATC B;  3CD6 A;  1N8R C;  2FL7 A;  2E10 A;  1OX8 A;  1C0M A;  1W2B P;  4QVC A;  2RI5 A;  4E7J A;  4BI3 A;  1I81 A;  4HVV A;  4J9G A;  3NFC A;  1MUZ A;  2LTO A;  4PJO B;  3OY9 A;  2BUD A;  5CKF A;  4XTV A;  1MGQ A;  3LH0 A;  2HKQ B;  2DE0 X;  1FWZ A;  1VQ6 Q;  3VS0 A;  3I56 T;  1YFN A;  1OI1 A;  4LNP A;  3M55 A;  3EG1 A;  4DOV A;  1WIE A;  1C6V X;  1A0N B;  2CP3 A;  3NTK A;  4E7I A;  3CPW P;  2YUP A;  2XID A;  3H9N A;  1TH7 A;  1ZSG A;  2ED0 A;  3SWN A;  2M02 A;  2DJQ A;  2K3Y A;  2DIQ A;  2FZK B;  4PLL A;  5DM7 R;  2HD0 A;  4DBQ A;  3VS4 A;  1YI2 Q;  4Q5W A;  1AWO A;  3C95 A;  2NUT A;  3OYF A;  2E12 A;  1K8A R;  1VQM A;  1R77 A;  1KHC A;  5KYX B;  4OF1 A;  4C8Q C;  5CKD A;  4J9C A;  4GBQ A;  1M27 C;  3EG2 A;  2VVK A;  4E7Z A;  1FMW A;  5FWB A;  1G3S A;  2VC8 A;  3JCM Q;  2X4J A;  4E7H A;  2LNH B;  4DEY A;  1TUD A;  2KBT A;  1WHJ A;  2NUP B;  2FHD A;  3UDC A;  1QVG P;  3CCS T;  1VQO Q;  1FX7 A;  4AG1 C;  3LWI A;  4PNO A;  1SEM A;  2DL5 A;  4MZP A;  4C92 A;  4M78 A;  1EZZ B;  2PNI A;  5LJ3 f;  4OP0 A;  3V8J A;  4OGE A;  4OMF B;  2JW4 A;  2W0Z A;  3LX7 A;  5GAN d;  2B86 A;  3OYE A;  3HRS A;  2QEX Q;  4C8Q D;  1GFD A;  1H3H A;  4FSX A;  1WPY A;  5LJ5 g;  4IUQ A;  1QW1 A;  2QTX A;  2KMT A;  1TS9 A;  5GJW B;  1GL5 A;  2VUB A;  3CC2 Q;  2A7Y A;  2JJ9 A;  4JDS A;  3OYG A;  1TUC A;  1N9R A;  2LT1 A;  5GAN 7;  1FYN A;  2DD5 A;  1KQS S;  3PNW C;  2D0Q B;  2H3J A;  5LJ5 j;  2O88 A;  2XDB A;  2H3E B;  3CME Q;  4L6V 5;  2O4X B;  1M2O A;  2EJG A;  5GAO n;  1RAE B;  1Q81 C;  2KYM A;  3CBM A;  3PGG A;  2VWF A;  2DXB A;  2V26 A;  4OB0 B;  1IGU A;  2MMP A;  1JU5 C;  2K79 A;  5CQX A;  2X4W A;  4L59 A;  2EQI A;  4M7A A;  1XJW B;  5IH2 A;  3JCM P;  2LJ1 A;  3REB B;  1CKB A;  3CEY A;  4X1V A;  2XDD A;  2AHJ B;  2JMA A;  2K9G A;  2ED1 A;  2DJZ A;  1NE8 A;  1RUW A;  3BFM A;  4OGC A;  2MPX C;  2QGG A;  2C0O A;  3CPW A;  4B9X A;  3CXC A;  2YRC A;  1WX6 A;  1ZA2 B;  2KRN A;  4Z02 A;  1YHQ A;  3OW2 S;  3ZEH A;  4M7D E;  1U3O A;  1D1C A;  2I2L A;  2CSQ A;  2HNI A;  4PJJ A;  5L8R E;  2PVD B;  4X34 A;  3QJ6 A;  1N8R U;  2RQT A;  2GGR A;  2MAM A;  1JXO A;  3EGD B;  2AKK A;  9ATC B;  3CCE A;  2DYI A;  4M77 A;  2M0O A;  2DFU A;  1ZUU A;  4M75 F;  4R56 A;  2G6F X;  3O8V A;  1Q82 C;  5KYU A;  4RTX A;  2EYX A;  1Q81 U;  2A3L A;  3QPH A;  4K11 A;  2YWW A;  2QQS A;  2AT1 B;  2FG0 A;  1K8A C;  3OMC A;  4E2F B;  5I2M A;  4XTW A;  2GQI A;  1KD1 U;  4M77 G;  1VQ6 A;  4LD9 K;  3S6W A;  3VS6 A;  4C92 C;  5CKB A;  3NPF A;  3CCJ A;  2EGE A;  1C1A A;  5KH6 A;  3UPU A;  4QVD A;  1Y57 A;  1Q86 C;  4Y28 E;  4F14 A;  2LMJ A;  2AZS A;  2NLU A;  2E64 A;  1RAC B;  5CR2 A;  2EQJ A;  2M16 A;  1S1N A;  3GOX A;  2HSP A;  2MK5 A;  3I55 A;  1V1C A;  4BD3 A;  2ECZ A;  5GMK h;  4FYX B;  4A4G A;  3NMZ C;  2JS2 A;  4PL6 A;  2VV5 A;  4ZTJ A;  2R5M A;  2V8J A;  1K9M R;  3PT9 A;  1EIF A;  2E65 A;  2Z0W A;  2RJC A;  1D1B A;  3H0H A;  5GMK l;  1KQS A;  2JM8 A;  1Z9Q A;  3MEU A;  1VQ4 T;  3HRT A;  1N6A A;  3RMS A;  3OSS C;  2RA2 A;  4DBR A;  5HK0 A;  2PU9 B;  4Z88 A;  1YHQ T;  3L1A A;  3M4Y A;  3ZBD A;  3S3N A;  4QQG A;  2J6K A;  1UGS B;  4DA4 A;  2JTF A;  1SHG A;  1T0H A;  2YRV A;  2OTJ Q;  1K9M C;  2X9H A;  2EIF A;  2RPN A;  1KQ2 A;  2RQV A;  3L2U A;  2L0A A;  5DY9 A;  1B3Q A;  4F7U A;  2XU8 A;  3A98 A;  3I55 T;  2PVG B;  3PIO A;  2COY A;  3JB9 I;  3TU4 K;  1RAG B;  1JJ2 P;  2QQR A;  5HCK A;  1WFW A;  4PJO C;  1ZX6 A;  3KXT A;  2K2V A;  1QMC A;  3PIP A;  4J9D A;  4NOY A;  3CCJ Q;  1QVP A;  2J05 A;  2CS7 A;  3A8G B;  2M51 A;  4XQ3 A;  3JB9 D;  1YBY A;  3QWX X;  1QCO A;  3GNF B;  4M77 C;  1KFZ A;  4O6J A;  2CP7 A;  2RHZ A;  2E41 A;  2GCX A;  1OYX A;  4FW2 A;  4A4H A;  5GAN 5;  3OMG A;  2DXU A;  4LXC A;  1VQN Q;  2VGN A;  2YUO A;  2VXE A;  2D1X A;  3QII A;  2P84 A;  4OMN A;  1R8O B;  1KIK A;  4VUB A;  4PFZ A;  1AEY A;  2JNG A;  4BB7 A;  2HL3 A;  1W6X A;  1JBM A;  2MCN A;  2MWO A;  1NYG A;  4BI4 A;  3CCL A;  1UGR B;  3LH5 A;  4LUD A;  4FT4 A;  3VYH B;  3GNG A;  3VRY A;  4TVR A;  3V7S A;  1EFN A;  5A0L A;  2EQU A;  2GFA A;  4AMC A;  2QK0 A;  3NGP A;  4RTZ A;  2XI9 A;  5IN1 A;  1WZO A;  2DX1 A;  1AVZ C;  1PG5 B;  2EPD A;  4LDU A;  5CKH A;  3CCE Q;  4KBM B;  2O31 A;  2CP2 A;  4JRK A;  5GMK e;  1SF9 A;  1VYV A;  2ATC B;  2CP5 A;  2DBM A;  1WGS A;  2M1H A;  3PVQ A;  1Q7Y C;  4BE1 A;  3EH1 A;  4M7A G;  1YHQ Q;  2V1Q A;  3DB4 A;  1GCQ C;  1BI0 A;  4FYV B;  1QVF A;  2QQA A;  1MMD A;  2A36 A;  3MEA A;  4JJN K;  1I0C A;  2HL5 C;  1CKA A;  3OW2 P;  1M2V A;  4HT8 A;  1OX9 A;  2O2O A;  2X35 A;  4PJO D;  4XU1 A;  2EFI A;  4JLG A;  4M7A E;  1TTH B;  4IUU A;  2HZY A;  1NEG A;  2CT3 A;  4E47 A;  5GAN g;  2CZ6 B;  1QP3 A;  2DRK A;  5GAM j;  4MZM A;  4BDZ A;  3CCL T;  2QTV A;  1NLO C;  2Y4X A;  1TUG B;  1JJ2 A;  2YXY A;  3C12 A;  1OZ3 A;  1ZSZ B;  1M8M A;  3R6N A;  3CBO A;  2A28 A;  4A4F A;  2MWP A;  3M4G A;  2DVJ A;  3X20 B;  3EFR A;  3OYI A;  3I5R A;  2SEM A;  2B8A A;  1PNJ A;  3LGF A;  3G71 Q;  3O5Z A;  4FM4 B;  1VQ5 Q;  3M54 A;  1QKW A;  1QCF A;  1M90 U;  3L42 A;  1N8R R;  1W4S A;  1N27 A;  1BK2 A;  4IUV A;  2NWM A;  1PRL C;  3VJP A;  3C94 A;  4NL3 A;  1XNI A;  1Q81 R;  2BIV A;  3KFV A;  1F1B B;  2Y90 A;  2WSF E;  3OYD A;  2QGF B;  4M78 E;  4J6Y A;  3G71 T;  4EMK B;  1I8F A;  2DD4 A;  4JJB A;  3EGX A;  1D09 B;  5CVI A;  3J81 E;  1LJO A;  4D8K A;  3CME T;  1WNL A;  1ZQ1 A;  1VQP T;  4C5I A;  1ZSZ C;  3VV0 A;  5KCH A;  1NPP A;  3M0T A;  5LJ3 j;  1PSF A;  4N4I A;  1X43 A;  2RK1 A;  4R55 A;  2PQW A;  3QBY A;  1VQ4 A;  3UT1 A;  4C8Q B;  4JLI A;  3M56 A;  1Q7Y U;  1M3C A;  2L3Q A;  2DER A;  3CC2 T;  4KUD K;  2DXT A;  2KEA A;  2YSQ A;  1VQ7 A;  2DK3 A;  5A0G A;  3GP8 A;  3DLL A;  3MEW A;  1R0C B;  3H41 A;  2KRO A;  4A4E A;  2KRS A;  1PKS A;  3QKJ A;  1D3B A;  1S72 A;  2R58 A;  3QDR B;  4ME7 A;  3REA B;  5J3B A;  5IHN A;  3RBB B;  3HHT B;  3OYH A;  4M7D F;  2BKD N;  3CCV A;  4FIB A;  4J7I A;  1M30 A;  4PJO A;  1UGQ B;  1SRM A;  1X75 C;  1NEB A;  1KQ1 A;  4M78 F;  2DO3 A;  1Y71 A;  5DLQ E;  2V8K A;  2ZPH B;  3VS1 A;  4LD6 A;  1TXQ A;  5GAN j;  4HVU A;  2A37 A;  1H3Z A;  2KSS A;  2XG8 D;  1K4U S;  4KUL A;  3RNJ A;  1K0X A;  5FLX E;  1K73 R;  1UFF A;  3JCM W;  1NJI U;  2RI2 A;  2GTJ A;  3CCE T;  3OS0 A;  1WYX A;  3QSU A;  4GLK A;  1GCQ A;  4RG2 A;  1VQL Q;  1GCP A;  2JZ2 A;  3QXE B;  4HCZ A;  2YLC A;  2EKH A;  1LCK A;  1MMG A;  1V76 A;  2ZPB B;  2GTO A;  4AFS C;  1PHT A;  1I1J A;  1BCM A;  2ZZD A;  2VXF A;  3ME9 A;  2QEX T;  1XOV A;  4E7S A;  2ROT A;  3OBW A;  1KG1 A;  4NL2 A;  2G3R A;  3CMA Q;  2JOY A;  2YT6 A;  1YJW T;  2HDA A;  1OU8 A;  5I11 A;  2BZ8 A;  3RDV A;  1MV0 B;  2OAU A;  5GMK m;  1AZG B;  3GF5 A;  3JCM V;  1AWW A;  4KGX B;  2HMA A;  4BDY A;  1M90 C;  3U23 A;  1BYM A;  1H64 1;  4BAC A;  4C92 B;  1E6G A;  2JVV A;  2LNV A;  5FW9 A;  2VKN A;  1WQ7 A;  4LN2 A;  1OQK A;  1I5L A;  3JSC A;  1UJY A;  4XTY A;  3JB9 G;  3D7S B;  3OYA A;  3CCS A;  1T0J A;  5M9O A;  3CC4 A;  5GAO l;  2MF2 A;  3V8K A;  3JCM J;  2KR3 A;  1IO6 A;  3FEO A;  3RKX A;  2LP5 A;  1T3S A;  1FMK A;  5LJ5 e;  3CCQ Q;  3CCR T;  1YIJ A;  4M75 G;  4IIM A;  1ZA1 B;  5KYU B;  3I55 Q;  4F04 B;  2LT4 A;  4FW1 A;  2X4Y A;  1VQM Q;  1VQK T;  1JXM A;  1YNZ A;  1YJ9 T;  1YJ9 Q;  3SWN B;  3MCA B;  5I21 A;  2RI3 A;  1LVK A;  2FRY A;  1O75 A;  3PFS A;  4M75 A;  4OMO A;  3J7A F;  4ZTF A;  2DKG A;  5LJ5 f;  2FEI A;  4PJN A;  2O9S A;  4KH0 B;  2GNC A;  4BE2 A;  3OYK A;  4JZ3 A;  2VAS A;  2COZ A;  2WAC A;  4QVZ A;  4M7A C;  2JTE A;  3L2V A;  1VQ9 Q;  4N0A A;  2D8J A;  1RI9 A;  2JN0 A;  1D0Z A;  3ZFJ A;  4E6R A;  3JCM e;  1B7T A;  4ZGJ B;  4J7F A;  1MHN A;  5GAN 3;  3V8L A;  2CDT A;  1JB0 E;  3SEM A;  3NTI A;  3OW2 A;  2ZPG B;  4D6W A;  3LWH A;  1IHW A;  3RKW A;  4F7U B;  3EG9 B;  1ZHI A;  2PVO B;  3JCM c;  1KD1 C;  5GAO q;  2LC4 A;  2YDL A;  1AD5 A;  3G4S A;  4IUT A;  1RLP C;  1B07 A;  5GAN 4;  1T3L A;  1Q82 U;  2BE9 B;  1RLQ C;  4LDV A;  1YCS B;  3UAT A;  1YJN Q;  3JV3 A;  2KDS A;  5A0D A;  3OA6 A;  4DOW A;  4JRP A;  1VOM A;  3V7C A;  3PVL A;  2JT4 A;  1QKX A;  2FYK A;  5J39 A;  3WVD B;  2HKN A;  5FU6 B;  2RHU A;  5CCA A;  3OYM A;  3A8O B;  1QLY A;  2LRQ A;  2DPP B;  2KGT A;  3JCM f;  2EJ9 A;  4QW2 A;  4M75 B;  3TSZ A;  3UF4 A;  1AOJ A;  4C8Q E;  5GAN 2;  1G3Y A;  2P4R A;  4EDU A;  5HK3 A;  5GMK i;  2OJ2 A;  2CP0 A;  4OB2 B;  3NTH A;  3JCM g;  3EG0 A;  4OML A;  3CCR A;  4D8D A;  1YIJ T;  3OYL A;  1YIT Q;  1RAH B;  4JPB W;  2HQE A;  1Q7Y R;  2D8H A;  4XTX A;  1QVF S;  1G5V A;  1DJ7 B;  3PMT A;  1X6O A;  1QWE A;  2RB6 A;  1OV3 A;  4M78 G;  4J8O A;  2LDM A;  2PZ1 A;  3OYJ A;  4J9B A;  2DRM A;  4UC4 A;  5C0M A;  3OQ5 A;  1YWO A;  4M77 D;  4C0F A;  2XDP A;  1X2Q A;  1X6B A;  1YJN A;  3S3O A;  4Z89 A;  2DL4 A;  3H6Z A;  3FB9 A;  3WVE B;  3H0F A;  1K9M U;  3HSB A;  3WXM B;  2EGA A;  1UUE A;  2DET A;  2QG9 B;  2F1L A;  1VA7 A;  2EWN A;  4M7A B;  3M9Q A;  4JS4 A;  2LZ6 B;  1BKB A;  5LJ3 d;  1JEG A;  2QEX A;  4PJL A;  1TSF A;  5C6S A;  1UEC A;  1SPK A;  3UA6 A;  3L2Q A;  5FU7 C;  3UWN A;  1ZBX A;  2CRE A;  2ZCF B;  2LX9 A;  3RKY A;  2Y4Y A;  4RMO A;  2YUN A;  1E6H A;  1VQ8 T;  5J26 A;  2EYZ A;  2E6Z A;  1QCN A;  4J5Y A;  1SG5 A;  3JB9 F;  2BTT A;  1VQP Q;  1OPK A;  4Y91 A;  2RQR A;  1JO8 A;  3RER A;  5GAM d;  3ASK A;  1AHJ B;  1X27 A;  2X51 A;  3SHW A;  4M75 C;  2RF0 A;  3HFO A;  1EX4 A;  4ZNX A;  5D6Y A;  1KC8 U;  3CCU Q;  2QI2 A;  1MNE A;  1UEB A;  1PSE A;  2NUT B;  3C0C A;  1VQ9 A;  1BI2 A;  3IQL A;  3URG A;  3OS2 A;  2E1H A;  1VQ7 Q;  2IG0 A;  4IUP A;  2L89 A;  1PKT A;  4C92 F;  3MP1 A;  1WQW A;  2CUB A;  4ZGE B;  1W2B S;  4C92 E;  1M2V B;  3M0R A;  4E7K A;  4II1 A;  4QT7 A;  4FYY B;  4XTU A;  1WA7 A;  1I5O B;  3TVT A;  5IAY A;  4JRI A;  3VS3 A;  3AT1 B;  3M5A A;  1QVF P;  2ZPE B;  1YIJ Q;  3R6O A;  2K2M A;  2COW A;  2DTI A;  3BW1 A;  3QO3 A;  1YCY A;  5KYW B;  1VQ9 T;  3QUI A;  4RKU E;  2RQU A;  2F2X A;  2J6O A;  3I56 A;  2DYB A;  3CME A;  3CMA A;  1VQP A;  2K57 A;  3P8B B;  5KYN A;  3QDF A;  1NPR A;  4FSS A;  5GMK j;  1X2K A;  2JUF A;  2L3P A;  4CC4 B;  4B9W A;  1N9S A;  3I35 A;  1TWB A;  3CD6 Q;  5GAM g;  1WJS A;  2YHT A;  1VQ8 A;  1GRI A;  4L5G A;  2DF6 A;  2F5K A;  2O01 E;  3OBY A;  1ZUY A;  3GBQ A;  3P8H A;  2FZG B;  2J06 A;  2ZPF B;  2RN8 A;  4BE0 A;  1IGQ A;  1UHF A;  1PCX A;  2CH4 W;  2EAY A;  4M78 B;  4HCC A;  5GAO r;  4DBF A;  4ZN3 A;  1WJQ A;  1K73 U;  5LJ3 g;  3MKD A;  1SHF A;  3I5S A;  3HPW A;  1OU9 A;  2NUZ A;  1WJR A;  3VU3 C;  2IVW A;  3LGL A;  2C0T A;  5EC7 A;  5KYX A;  1TOV A;  2FPD A;  4EPC A;  1X69 A;  2EQK A;  3JAM E;  1WDX A;  4M75 D;  3ZL7 C;  2BZY A;  5GAN 8;  4PJO E;  4J6X A;  2EYQ A;  4AFZ C;  4LE9 A;  1M90 R;  2QA4 T;  1FMV A;  3OSV A;  4C0D B;  1ZLM A;  2PUK B;  3VS7 A;  2KXC A;  1KK7 A;  1YJW Q;  1ZUK A;  4M77 F;  3F70 A;  1MMA A;  4X9C A;  1VUB A;  2RMO A;  4M77 E;  2O4X A;  3X28 B;  1BBZ A;  3I56 Q;  1VQ6 T;  4MZT A;  4PFO A;  4FL6 A;  4EMK C;  4RTU A;  1LNX A;  4BY6 B;  4M77 B;  1XTD A;  4HVW A;  1K76 A;  5IHK A;  4DEX A;  3EG3 A;  4CC7 A;  5CO7 A;  5GJV B;  5D6X A;  4M4Z A;  4LDY A;  1WHK A;  2DXC A;  2F2W A;  3VUZ A;  1PD1 A;  1ABO A;  2EKO A;  3V7R A;  4CRI A;  1UGV A;  1RI0 A;  1U8R A;  1PC0 A;  2V1R A;  3VRZ A;  3X24 B;  3CXC S;  2PUO B;  3SB2 A;  3OS1 A;  1KHI A;  2CP6 A;  3E2U A;  1JRI A;  1M3A A;  5DLO A;  1SKU B;  1Y96 A;  2KRM A;  4LUE A;  2E6N A;  2K7A A;  3EGU A;  3G1J A;  3S3M A;  3HFN A;  1MND A;  2OTJ T;  4V2S A;  4ZGD B;  4IUR A;  2W10 A;  4RTV A;  1K73 C;  4C92 D;  2E3I A;  1NLP C;  1IRE B;  4HKE A;  2JTM A;  2LVM A;  3JCM h;  1X6G A;  2EJF A;  3CD6 T;  2XD0 A;  3A8L B;  3QWY A;  1VQL T;  3FDR A;  1I4K 1;  4J9E A;  2ABL A;  2K3B A;  5AT1 B;  4C8Q F;  2LCL A;  5GAN f;  1OOT A;  2DAQ A;  1VQ5 A;  1GBR A;  3QZ9 B;  3L2R A;  1OPL A;  1D0X A;  2CSI A;  4N4H A;  4XU0 A;  5GAN e;  2KAF A;  1UE9 A;  3TCJ A;  1WXU A;  2DL3 A;  3FJ5 A;  1NBE B;  1WHH A;  1CSK A;  1H8K A;  2OX7 A;  4BUG A;  1VQ8 Q;  3CC4 Q;  2NUP A;  1U5S A;  3PTA A;  2DA9 A;  5FRO A;  1YIT A;  1NYF A;  2JM9 A;  1NJI R;  1AZE A;  2KVQ G;  1U1S A;  2DIG A;  2MYS A;  2H8H A;  1M5Q 1;  1VQO A;  1BIB A;  2OTJ A;  4MMK A;  3A8H B;  1VYT A;  4WF2 A;  2DVE A;  2CZ1 B;  3L2Z A;  3CC7 T;  1AWX A;  2KT1 A;  4XU2 A;  4PFP A;  2HBP A;  3VYG A;  3N5B B;  1K1Z A;  1X01 A;  1B34 B;  1YP5 A;  3LW5 E;  4RUG A;  3M0P A;  3X26 B;  1NG2 A;  1IRX A;  3DB3 A;  1PWT A;  1HYO A;  2J7I A;  3CCL Q;  5HY6 A;  2VYT A;  4WCI A;  1GBQ A;  4XK8 E;  2WSE E;  2L3R A;  2L5Q A;  2M0Y A;  1VQL A;  1IHV A;  2CKK A;  2CZ0 B;  3GPL A;  2PTK A;  1KC8 C;  1KQS P;  4KGV B;  2EGC A;  1M1K U;  4C0Z A;  4HCK A;  4J9I A;  1BI3 A;  4GY5 A;  3LYI A;  2D9T A;  2DTH A;  1XQH A;  4J6W A;  3P8D A;  4OMQ A;  3E1S A;  4PJM A;  1G8X A;  2KI7 A;  2RK2 A;  1OZ2 A;  2A08 A;  3QYH B;  1W2B A;  1MV3 A;  2M9U A;  2DBK A;  4WTO B;  1TU0 B;  4M7D C;  3CQT A;  1VQ5 T;  4F17 A;  1RAB B;  4RTY A;  4BI8 B;  3RUX A;  3JB9 J;  1Y7X A;  4M78 C;  1M9S A;  5ECA A;  5GAN h;  1S72 Q;  5HKC A;  2KE9 A;  2GQV A;  5D6W A;  3RES A;  4OB3 B;  4QQD A;  2KK4 A;  1K9A A;  3SD4 A;  2FRW A;  1D1A A;  2CZ7 B;  2BE7 D;  2VB6 A;  1UJ0 A;  2F2V A;  1WXB A;  1M4Z A;  3TEE A;  1VQK A;  2C06 A;  2RHI A;  4JJC A;  1Q86 R;  1OUL A;  1WHM A;  4AG2 C;  1QVG S;  1BB9 A;  1D0Y A;  2FPE A;  1UDL A;  3BE3 A;  1ABQ A;  5IT9 E;  5IXB A;  5FU6 C;  4MML A;  2DEU A;  4RG8 A;  1G2B A;  2L3S A;  4FU6 A;  2LCS A;  3MO8 A;  3CCM T;  4KRT A;  3RR6 A;  2IIM A;  2QA4 A;  3G6E T;  3CCU T;  3A5Z B;  5FWC A;  1BI1 A;  2HAX A;  4MDW A;  1BIA A;  5CK9 A;  1ZSZ A;  2KNB B;  2RH2 A;  3FJP A;  5FU7 B;  1H92 A;  3EH2 A;  3VUB A;  4AT1 B;  2LQW A;  3VS2 A;  2EQM A;  4ATO A;  2DL8 A;  1NJI C;  2RJD A;  4FCY A;  4EMG A;  2R57 A;  2KQW A;  2DZC A;  1G3W A;  5KE2 A;  5A2Q E;  2ZAE A;  3E9G A;  3EFO B;  2DNU A;  3PE0 A;  4ZN1 A;  3GIB A;  1UHC A;  3CXC P;  4C5H A;  2K3X A;  1FXX A;  1KJW A;  3QG1 A;  2C0I A;  1M1K R;  4M7D G;  3M58 A;  3G7Z A;  3GLX A;  3KUF A;  1HXD A;  2RM4 A;  3M0U A;  2HBW A;  3M57 A;  4R0K A;  5LJ3 h;  2EYW A;  4A4K A;  5I2S A;  1Y07 A;  1SRL A;  1VIE A;  4KGZ B;  1LPL A;  4DQ2 A;  2DIL A;  1E7O A;  2E3H A;  3EGX B;  4OVA A;  3OYN A;  3CC2 A;  4FT2 A;  1HSQ A;  4RTW A;  1QVG A;  2AIR B;  1AWJ A;  2E4H A;  4CI0 C;  2LJ0 A;  2LCC A;  5CIU A;  2YLB A;  2RQW A;  3CCV Q;  4B6M A;  2EYY A;  1M1K C;  3CCJ T;  3MP8 A;  2QA4 Q;  3A8M B;  2QDY B;  3RIR A;  2EVR A;  4HCB A;  4F16 A;  1OEB A;  4M7A F;  1Q95 G;  4HA8 A;  2AKL A;  1B34 A;  2EBP A;  4PJO F;  2GF7 A;  1BU1 A;  3MHX A;  3BDL A;  3M53 A;  4NS5 A;  3EG9 A;  3CCM A;  1PRM C;  5KYY B;  4C0G A;  4J9F A;  5L23 A;  2X3W D;  1K0S A;  5D7U A;  3NHN A;  2K4Y A;  4QKU A;  1M8V A;  2HQX A;  2ESW A;  3HTR A;  1U06 A;  2K6D A;  4Y92 A;  4N4G A;  3VS5 A;  2LQN A;  4EMK A;  2ENM A;  3CMA T;  4BY6 C;  3OS5 A;  3TQ7 P;  1Y0M A;  4JJD A;  2O9V A;  2YRD A;  2P4T A;  4M78 D;  4ESR A;  4GLM A;  5I22 A;  5FRM A;  3E9F A;  2GBQ A;  1G3T A;  2ZGW A;  5GAM h;  5KYY A;  3CC7 A;  4M7D D;  4X9D A;  1VQ4 Q;  1WXT A;  1VIF A;  1GXI E;  4Z8A A;  1KD1 R;  2DL7 A;  3JRZ A;  1Q82 R;  3CCM Q;  1HK9 A;  4EIK A;  2P0P A;  2RJF A;  2QXF A;  4A54 A;  5GAO p;  1VYU A;  4ELZ C;  2XK0 A;  3MPU B;  1G83 A;  3M0Q A;  1YJW A;  1J3T A;  1I07 A;  4KT0 E;  1R0B G;  1SSF A;  3MEV A;  5GAO m;  2HSE B;  1M1F A;  1M1G A;  2FZC B;  2MOX A;  4PJO G;  1YWP A;  2DMO A;  2XHC A;  2DM1 A;  2J6F A;  4MDX A;  2RO0 A;  2LX7 A;  4RCB A;  2VGM A;  4M7D A;  2IPO B;  4LDX A;  2OI3 A;  3MJX A;  4J83 A;  2D0N A;  8AT1 B; 
#chains in the Genus database with same CATH homology
 3G71 Q;  1K73 R;  1KC8 R;  3CCR Q;  1YHQ Q;  1K8A R;  3CME Q;  2QA4 Q;  1VQ5 Q;  1VQK Q;  1VQP Q;  3CC7 Q;  1YJN Q;  1VQ4 Q;  1K9M R;  3CCQ Q;  1VQ7 Q;  1JJ2 P;  3CCL Q;  1N8R R;  3I56 Q;  3CCE Q;  3CC2 Q;  1KD1 R;  1Q86 R;  3CPW P;  1VQ8 Q;  3CC4 Q;  1S72 Q;  1Q82 R;  1QVF P;  3CCM Q;  3CXC P;  2OTJ Q;  3OW2 P;  3I55 Q;  1YIJ Q;  3CMA Q;  1M90 R;  1Q7Y R;  1YIT Q;  3CD6 Q;  1VQN Q;  1VQM Q;  1M1K R;  1KQS P;  1VQL Q;  1NJI R;  2QEX Q;  1VQ9 Q;  1W2B P;  3G4S Q;  1YJ9 Q;  1VQ6 Q;  3CCJ Q;  3G6E Q;  1YJW Q;  1QVG P;  1YI2 Q;  2OTL Q;  3CCS Q;  3CCV Q;  1Q81 R;  3CCU Q;  1VQO Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...