3G71Q

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3g71Q00
1VQLQ 3CCSQ 1M1KR 3OW2P 1W2BP 1VQNQ 1VQPQ 1YJWQ 1KC8R 3CCJQ 1YJ9Q 3G71Q 1VQ5Q 3G4SQ 1VQ8Q 3CD6Q 1KD1R 1QVGP 1VQ6Q 3CC2Q 1YHQQ 1NJIR 3CPWP 1VQOQ 1YITQ 1VQ9Q 1VQKQ 1K8AR 3G6EQ 3CMAQ 2OTLQ 1YIJQ 1Q7YR 3CC4Q 1VQMQ 2OTJQ 3CCQQ 3CMEQ 3I55Q 3I56Q 2QA4Q 1Q86R 1N8RR 1QVFP 1Q81R 3CCVQ 1VQ7Q 1VQ4Q 3CXCP 3CCRQ 1YJNQ 1Q82R 1K73R 3CCEQ 1KQSP 3CC7Q 3CCLQ 3CCUQ 1M90R 2QEXQ 1YI2Q 1K9MR 1S72Q 1JJ2P 3CCMQ
chains in the Genus database with same CATH superfamily
2DRMA 2DX1A 2LNVA 4PJOF 8AT1B 5LJ5g 3MP6A 3C12A 3CCVT 1QW1A 4M75G 2DL8A 3RUXA 2KQWA 4M78B 3PVLA 2JS2A 4OMNA 2FHDA 3OS1A 2JUFA 2HMAA 3QKJA 3PNWC 5CQYA 5FU6B 1MNEA 2VXFA 3JCMb 3NTIA 3CCVA 2ZPIB 4RMOA 3ZFJA 4CI0C 3CD6Q 1PD1A 4C5IA 2DYIA 2YRDA 3J80E 1G5VA 2HKNA 1S1NA 2DYBA 3G71T 1NJIU 1C6VX 2D0NA 1WHGA 2MF2A 3D7SB 1VQ9A 2WSFE 2NUTB 5LJ5f 2X3XD 3G1JA 1M2VB 3HL8A 3TSWA 5ECAA 1K9MR 3TEEA 2B86A 1K8AC 1IZ6A 3KFVA 4A63B 3OW2P 2YRCA 1Y71A 4N0AC 5GANd 1FMVA 1WX6A 3QYHB 3FLGA 4RKUE 1YHQQ 5GAOn 1R0BG 4BUGA 1GCPA 3P8DA 2CSIA 4JDSA 3QYGB 2JJ9A 2EQUA 2E10A 2F5TX 1HYOA 3HTRA 1M3BA 5GAOq 5I2MA 4KT0E 3JB9J 4ESRA 3FDRA 2CGHA 1CKBA 1YCYA 2BZYA 2A08A 2E3HA 1VQNQ 4MZMA 4LXCA 1Q81U 2E65A 3VU3C 1UG1A 2W10A 2KK4A 2HDAA 3QHSA 1RI0A 5HCKA 5GANf 1WQ7A 3OYLA 5FU7B 1FWZA 1HK9A 2EQMA 5D7UA 4M77G 2YLCA 2J6OA 1JRIA 2KRMA 2A28A 1EZZB 4DEXA 1UDLA 2LX7A 2M0OA 1M9SA 4E6RA 1VIEA 5I21A 2RQRA 2AHJB 2KYMA 3G6EA 2SEMA 4M75B 1JXMA 2FVUA 1SG5A 2X4XA 2HBPA 3CCRQ 1Q82R 1VQLT 3X25B 3TU4K 2M02A 1X01A 4PKCC 5CKDA 1XTDA 1WIEA 3R6OA 2NYSA 3L42A 2NLUA 3ULRB 4ZTJA 1U1TA 2YSQA 4RTTA 3JB9D 3HRTA 2QQRA 5GAN8 3G4SA 1VQOQ 2CZ1B 1LJOA 3CEYA 5KYNA 1N8RC 3I5RA 2DEQA 2HD0A 1RUWA 3EH1A 3I9QA 3JB9I 2WACA 4E47A 4E7ZA 1K4US 1GRIA 3CC7T 1WYXA 3CCQT 1WXBA 2RPNA 1PCXA 4OMLA 1AWWA 4UC4A 3JCMg 1W6XA 5GMKi 1VIFA 4LNPA 1YI2T 5C6SA 2KXDA 2LDMA 2O2OA 1ZX6A 4M75E 4FYXB 3NPFA 3PT9A 3QZ5B 2BIVA 3OYGA 5KYXB 1OZ2A 4M78A 2Z0WA 4IIMA 4XTYA 5IHKA 2KRNA 4M7DC 3L2VA 1LPLA 1GBQA 2DIQA 1T0HA 2GQVA 5FROA 4BD3A 2AZSA 1N5ZA 2RJEA 1SRLA 4EMKB 2AZVA 1MUZA 1IXDA 2DTIA 5CKBA 4X9DA 3A1PA 1NPRA 3CC7A 3FRNA 2FZKB 3VKIA 2BZ8A 2CP5A 2EPDA 4M78E 1ZHIA 4HCKA 1BCMA 3BE3A 4DBFA 1M1KC 4XTUA 4F16A 1D3BA 1RAFB 2QDYB 2SRCA 2P0QA 3CCUT 4J6WA 3A5ZB 1JQQA 2P0PA 1VQ4A 3S3OA 2DTOA 1AWJA 2XHCA 4JRPA 4OMMA 2C0TA 4MDXA 1NPPA 1PSEA 2OTLQ 1AT1B 2L8DA 4QQ6A 4DBQA 3CMEQ 1Q86R 1BKBA 1QVGA 4N4HA 2PTKA 2E41A 2XD0A 2CP2A 2GGRA 3EHQA 3VS3A 3NTHA 1SHGA 2LC4A 2EVRA 1CKAA 1X6GA 2VYTA 1QWFA 2DVJA 1QKWA 5I11A 5KYYB 3FEOA 3PGGA 1O9SA 1UUEA 2ZCFB 1Q7YC 3QDFA 1I1JA 2M0YA 4BY6B 2Y4XA 3L2ZA 2PVOB 2VC8A 3CXCP 4AFSC 2QQAA 1PG5B 4RTUA 4QKUA 4FCYA 4FU6A 1K9MC 1NLOC 1EFNA 3A8LB 4OMPA 4LD9K 3DLLA 5D6WA 2JTEA 2HSPA 3QWXX 5GAOm 3OYKA 4C5HA 1M1GA 3SEMA 2OTLA 2ZPBB 2O9VA 2LZ6B 3V8JA 1IREB 3TQ7P 1V1CA 1K76A 2F2VA 2R57A 1WHHA 1YI2Q 4D8KA 2COWA 2CT3A 2FL7A 1YJ9A 4XTVA 2XG8D 2QA4T 2NWMA 3CMAQ 4EPCA 3TVTA 5A0DA 2CH4W 2MWPA 3SFMA 2DXCA 3S6WA 1I5OB 4ORZA 3HRUA 4XAXB 1A0NB 5HK3A 3VS5A 3JB9G 2Y90A 1WDXA 1WNLA 2XMFA 2LQ8A 1TG0A 4EMHA 1K1ZA 5DLOA 4XU3A 1VQ9Q 3OYJA 4HCBA 1JJ2S 1AZGB 1UGPB 1R77A 2P84A 2FG0A 2B8AA 2CZ0B 2L3QA 3REBB 5LJ5d 3KBGA 2DMOA 3OQ5A 5GMKe 2JOYA 2H8HA 3Q1JA 3UA7A 1SKUB 3OS2A 1QCFA 1VYUA 2AKLA 1WHMA 4F04B 2KT8A 3PMIA 5GAN3 1GL5A 4PL6A 1QVGP 5J3BA 2BZXA 3U23A 1WI7A 4M7DD 2OAWA 2K5FA 4RUGA 1Z9QA 4KH1B 1WZOA 3FJPA 2LVMA 1C1AA 3CBPA 1OQKA 2RM4A 3NHNA 2CUDA 1VUBA 1QCNA 1VQ5Q 2AT1B 3DB4A 1U5SA 5GANg 3QSUA 2XIDA 1C0MA 3MEWA 3L2RA 5GAMg 3JCMP 1Q86U 3CBOA 5GMKm 3S3NA 3LGFA 1OI1A 3E19A 4LE9A 3JB9F 3CMET 2DO3A 1AZEA 1K0XA 2LCCA 4PJOA 3KXTA 1TH7A 1JJ2A 3CMAT 3CCRA 4J9EA 4LDXA 2DL7A 3URGA 1KD1U 2OTJQ 3A8GB 4C92D 4JZ4A 1B34A 1VQPT 1WLPB 3ME9A 2DAQA 3G7ZA 2JT4A 1BI1A 3CCLT 5CKFA 1BIBA 2RJCA 1RLQC 2A0FB 2XDBA 1M30A 1PM3A 2JTMA 4E7KA 4C0DC 2CREA 2RH2A 3PE0A 5FRNA 4HT8A 1YFNA 2E6NA 3SDZA 2O88A 4QQGA 3AHUA 3M56A 1H8KA 1BI2A 4M7AA 2EBPA 4M78F 2EKOA 2ZZDA 2KSSA 2QQ9A 3OYBA 4JJNK 2FPFA 4A4HA 3M0SA 1GCQC 4L5GA 3JCMf 2O31A 1VQPQ 1YBYA 1ARKA 4Z8AA 4ZGEB 3EG9A 1K73C 1VQ9T 5GMKh 3VRZA 2VXEA 4EDUA 4M7AE 1Q95G 2FPEA 1YJ9T 2KVQG 3R6NA 3OYYA 1YJNQ 1WHJA 4DBHA 1X6BA 4ZNXA 5GAMh 4J6XA 4Y91A 1ZUYA 4NL3A 1QWEA 3EHRA 4HVUA 2YUOA 1UGRB 3M0UA 1UGQB 1FX7A 1KG1A 4MMLA 3RESA 3GF5A 3META 3OW2A 2VGMA 1K0SA 1MMNA 3OMCA 1ZQ1A 4X9CA 3MCAB 2ESWA 2MI6A 2X3WD 2J06A 1KSWA 1WHLA 1G8XA 1W2BP 2X51A 4OMOA 1M2VA 3VRYA 4JS4A 3H6ZA 1TUGB 2M16A 5D6YA 4OB3B 2BE7D 2RQVA 2PZ1A 3CD6T 2JN0A 4RTXA 4FSXA 5AYFA 5CIUA 3GP8A 2BTTA 2PVGB 2ZPHB 4BDYA 3JAME 4J6YA 1OOTA 5GJWB 1OPKA 3X28B 4ZGJB 3EGXA 4KUIA 2AK5A 4QW2A 3G71Q 1M4ZA 1YCSB 2QQSA 5I22A 3L2QA 4C8QF 1X6OA 4F7UG 1G2BA 3PTAA 2V8IA 4LDWA 2XK0A 4AMCA 1BU1A 4QT7A 2QYZA 1KQSP 1N9SA 3CCUQ 3EG1A 3JCMe 1MMAA 3EFOA 1ZSZA 2DLPA 3JB9H 3OYFA 2V8KA 1BI3A 2V1QA 2JMCA 1UJ0A 4KUDK 3LYIA 4M7DG 4C8QD 5CCAA 3V8LA 1J3TA 3CC2T 4XTXA 3I55Q 5CO7A 1D1CA 4OB2B 2FRWA 3J7AF 3MJXA 4HKEA 4M77A 1M1FA 5LJ3e 3MPUB 1QCOA 3SB2A 2RJDA 2OTJT 3OSSC 2YLBA 3LH5A 1QVFA 4FT2A 4A4FA 4BE1A 3VUZA 4ANJA 1B3QA 4E7LA 1E7OA 3RBBB 2CT4A 5CKHA 1VQLA 3OYIA 1KQ2A 3RKWA 2GQIA 4EIKA 2HQXA 2DIGA 4OGEA 4PNOA 2RHZA 2F69A 2DXBA 3M55A 1M90C 4IUPA 2DVEA 5IXBA 1LNXA 4HCZA 4A4KA 4XU0A 2KEAA 3EG3A 1TU0B 3EAEA 4RTWA 1OULA 3JCMc 2RD1A 2DL4A 3VS6A 1SRMA 1AD5A 1FYNA 4A54A 2I2LA 4M77F 3RDVA 3OBWA 1VQKA 1D0XA 3RR6A 1NLPC 2RNAA 1K8AR 4BI4A 3EFOB 5KCOA 2KROA 4RTYA 2OJ2A 1SHFA 3E2UA 1Q81C 2JM8A 2K3YA 3S3MA 2A37A 1VQ7A 2RB6A 3QIIA 3CCET 3VUBA 1WPYA 2JW4A 4V2SA 3SHWA 3UF4A 2QEXA 3VS0A 2IVWA 4N4GA 1YITA 3OB9A 2KNBB 2K2VA 3SD4A 2KY9A 3A8HB 3JRZA 4II1A 4OMQA 1N8RR 1IO6A 3WVDB 4MZPA 4IIOA 4JZ3A 2KGTA 2LRQA 1X43A 1XQHA 1QLYA 2LT1A 2ATCB 1TWBA 1PD0A 2V1RA 1YJNT 1M90U 5CAIA 4J83A 4XTZA 1BYMA 4NOYA 1SPKA 3JCMX 3GPLA 1NJIR 3A98A 3H8ZA 5HY6A 3M59A 4Z88A 1Y7XA 4DBRA 2DETA 4QVZA 4C5EA 1VQ7Q 2ECZA 5CVIA 3I35A 5GAMe 4IURA 2E1HA 2VKNA 3J81E 1T3LA 1PHTA 3H0FA 4P5NA 2HL3A 1VYTA 2VV5A 1IGQA 3QDRB 1ZA2B 1U1SA 2RHIA 3MEVA 2CUBA 1YIJQ 1VQ6T 3RKXA 4LDUA 1T0JA 4BI8B 5IXFA 1FMKA 2FB7A 2EQJA 1SEMA 2DJZA 4C92A 2JM9A 2RA2A 1PNJA 2KXCA 1S72T 1HXDA 3M0QA 1LVKA 5HKCA 2DM1A 4O5VA 3VV0A 3CCEQ 1PSFA 4M75F 1ZSGA 2KDSA 2DL3A 4HXJA 1R0CB 5GAN6 2Y4YA 2FEIA 4E7SA 1VQ6Q 1M1KU 3I5SA 1SSHA 4C8QA 2CS7A 4A4EA 1JU5C 1ABQA 1WJRA 4JJCA 5GANh 1I81A 2DRKA 2G3RA 2RK2A 3H0HA 3CXCA 3BW1A 1OX9A 2D6FA 1MV0B 1WXTA 2NUPB 2WSCE 4B9XA 1M2OA 2LJ3A 2DXUA 1VQKT 3SWNA 5A0LA 2L89A 3CCQQ 4A4GA 4JRQA 3CCST 2DD5A 4FYWB 1NG2A 1Y96B 3OY9A 2K2MA 4OVAA 4K11A 5FU6C 4QQDA 1F1BB 5FWBA 1UGVA 4AFZC 4PJMA 4RTZA 2KRSA 1PRLC 1UGSB 3DKMA 2MIOA 1RABB 3EG0A 2L0AA 2RHXA 5DY9A 2JNGA 2EWNA 2RI3A 3CPWP 4RCCA 1AVZC 1Q7YR 3I56Q 4N0AA 2CZ6B 4PJOC 2H3JA 1ACMB 5KYUA 1AWXA 1OX8A 1VYVA 3M58A 1HSQA 4ELZC 2EJ9A 2MYSA 1YJWA 4F14A 5FRMA 1D1BA 2LX9A 3M5AA 1O75A 2ZPGB 4BE2A 3OMGA 1I0CA 1YI2A 2R5MA 2EQKA 2F1LA 2GBQA 2H3EB 5IAYA 4PJOE 1B07A 3CC4Q 1VQMQ 2CDTA 2DL5A 1KHIA 2QG9B 4CRIA 3V7SA 3G71A 1D0YA 5LJ3d 4E7JA 4AG2C 4IUTA 1Y0MA 4VUBA 1VQ7T 3SWNB 1VQNA 4M4ZA 4J9BA 1Q82C 3ZEHA 4C92C 3ZBDA 3MO8A 1PRMC 2JMAA 2K4YA 5GMKj 5IH2A 3M57A 3CCUA 4XU2A 2J05A 2K7AA 2ZAEA 2ED1A 4J7FA 1I4K1 5GAMf 4PLLA 4NL2A 3JCMh 4M7DB 5KYWA 4ZGDB 5GAMj 2DERA 4ZTFA 3QZ9B 3JCMV 4M7DF 1OYXA 2GTOA 3IQLA 5I2SA 1TTHB 1U06A 4A53A 2OAUA 2OX7A 2PVDB 1W2BA 1RAHB 2L2PA 3EGDB 1XNIA 3CCVQ 1TSFA 4Z02A 1WXUA 4XK8E 3MEAA 3CPFA 3EG2A 3JCMW 4F7UF 4C8QG 1UFFA 2ROLA 2DFUA 3CCSQ 4HT9A 5C0MA 2HQEA 2QGGA 3V8KA 4ATOA 2ABLA 1JXOA 4F17A 1JBMA 1KQSS 5LJ3j 1KHCA 1GFDA 4GBQA 4PJJA 1IGUA 2JZ2A 1JEGA 1SSFA 4ELYC 2QK0A 2KMTA 3VS4A 1KJWA 4M7AC 1AEYA 3CBMA 5LL6S 1ZLMA 3F70A 2CP6A 1NJIC 2G6FX 3MP8A 4WCIA 1PKTA 2DE0X 1NEGA 2LNHB 1MMDA 4B9WA 2HCKA 1U8RA 1BI0A 1PC0A 1NE8A 1RACB 3UWNA 4FW1A 3RKYA 2KAFA 4HVWA 3UATA 3TCJA 3BFMA 3QO3A 5FLXE 3I55T 5GAOr 3M0TA 3L2UA 3X24B 3RERA 2F2XA 1YHQT 2FPDA 2M1HA 3HP9A 4ME7A 3PMTA 2FZCB 1YJWT 2ED0A 5KYWB 1G3TA 2EIFA 1AOJA 5GAOl 4D6WA 2DPPB 2J6KA 2E12A 1TOVA 3EH2A 3ER0A 2EFIA 3MP1A 2LT4A 1Q86C 2VUBA 1H3HA 1E6GA 1BBZA 5FWCA 3G6EQ 4PFZA 1VQPA 3NTKA 2YRVA 3QUIA 3LX7A 4M75D 3T9NA 3OYNA 1XOVA 2DKGA 4M78G 4LD6A 2IPOB 2XICA 4PLIA 1MV3A 1RI9A 5LJ5h 3CC4T 1VQMT 3M54A 3GNFB 3G4SQ 1VQOA 1KC8C 3OA6A 3CCJA 3C95A 2HSEB 2KBTA 2AIRB 3MKDA 1W2BS 1UTIA 3LH0A 2PUKB 1QVGS 5KYUB 1TS9A 1KD1C 2ZGWA 2RQWA 1B7TA 2DXTA 4WF2A 2MK5A 2MPXC 5KE2A 4B6MA 3CCLA 4PFPA 5GMKl 2CP0A 5KYXA 2HL5C 2CYZB 4KH0B 4PJNA 3DLMA 1Y07A 2VVKA 4M77B 3O5ZA 2GFAA 1H92A 3OYEA 4C92G 2RO0A 2X9HA 3E1SA 3AT1B 2WSEE 4R0KA 4AFUC 3M0PA 4J5YA 1I5LA 2EKHA 1DJ7B 3CCMQ 1OZ3A 3OBYA 4C0DB 4ZN1A 1HJDA 3N5BB 2HQHA 3CCJQ 1EIFA 3FJ5A 5CR2A 4E7IA 1FXXA 2RHUA 2J7IA 1I8FA 2HAXA 1UEBA 2NUPA 2V8JA 3CC2Q 1VQ5T 1D0ZA 1ZSZB 3FIFA 5GANe 4FYYB 2K3BA 1G3SA 4BE0A 2QTXA 3VS2A 4J9CA 1RL2A 2DF6A 4MMKA 1RAGB 4FW2A 4AT1B 3LW5E 1YJ9Q 2DBKA 2PUOB 3G6ET 2PQWA 3EGXB 2YT6A 2QGFB 3HKSA 3CMAA 1QVFP 3PIPA 2K5LA 2QTVA 4JPBW 2K57A 4C92B 2K6DA 2YHTA 2RI2A 1X75C 3CCMA 3I55A 4CC2A 2RI5A 1K9MU 3L1AA 4F7UA 4IKFA 1VOMA 3GNGA 4OGCA 5L8RE 3X26B 3I56A 2KT1A 1M8VA 4R55A 5KCHA 3EFRA 3PFSA 3EG9B 2A3LA 2IIMA 3DB3A 2XKOC 2M9UA 2E3IA 1BB9A 3BDUA 4C0FA 4BACA 1VQLQ 1M1KR 2K5IA 2K9GA 2RMOA 4M7DA 1VQMA 3CC4A 2KE9A 1N8RU 4JLIA 4M75C 3PIOA 3LLRA 2E64A 1OV3A 2K79A 2LJ1A 2A7YA 2GFUA 1P92A 4M77D 3H0IA 4LN2A 2M51A 5GAN7 4X34A 4OF1A 1NM7A 3CPWS 3VYHB 3RNJA 4L59A 1WFWA 3HFOA 1IHWA 4JRKA 4DOWA 2JS0A 1RAIB 5L23A 3M9QA 3QXEB 5D6XA 3RMSA 2QA4Q 2XDPA 4OB1B 2YUQA 4J9DA 3CCMT 3O8VA 4DEYA 2L3SA 4FSSA 4E7HA 1ZA1B 3OYCA 1Z9ZA 1YHQA 1RAAB 1VQ4T 1JO8A 3HRSA 2COZA 2W0ZA 1WHKA 2RQTA 4DOVA 2QASA 1X69A 2EGCA 4Y28E 1VQ8T 1NYFA 3TREA 1W1FA 5LJ3f 4IUQA 1OU8A 2DJQA 2RHYA 2LCSA 1Q81R 3P8HA 2EYWA 3JCMd 1FMWA 3OSVA 4AG1C 2E6ZA 4HA8A 2MCNA 1S72A 4PJLA 2X4WA 2RN8A 3HSBA 1Y96A 2DBMA 4GLKA 1YITT 2F2WA 2HNIA 4DQ2A 3VYGA 2CSQA 3THKA 5A2QE 5CQXA 4KGZB 3G4ST 1GXIE 4LDYA 2D8HA 3QJ6A 1UB4A 3UA6A 2ZPFB 2EYQA 1M90R 3JCMJ 2E5QA 2C0OA 2AKKA 2GCXA 5IHNA 4JUVA 4ZN3A 5HK0A 2A36A 1BK2A 1OPLA 2OTLT 1QKXA 3C4SA 1JB0E 2DZCA 3LGLA 1YIJA 4JRIA 1YJNA 3CPWA 1S72Q 1KK7A 3OS0A 3P8BB 1QP2A 3CXCS 2CP7A 1RADB 1U3OA 1VQ8A 1VQOT 1WA7A 2YUPA 2LTOA 1VQ6A 3VS7A 4JJBA 3UT1A 1ZUKA 3ASKA 5CK9A 2COYA 8ATCB 1W4SA 4XQ3A 4FT4A 4O6JA 2EGAA 2J6FA 4PFOA 4QVCA 3A8OB 1UE9A 5LJ3h 3A8MB 2PNIA 2EYXA 3OW2S 1H3ZA 1VA7A 2DTHA 3QBYA 5GANj 2HBWA 1I07A 2GTJA 3NMZC 4M77C 3QJYA 4KGXB 2LQNA 2RJFA 2LMJA 1N6AA 2QAZA 3HPWA 4J9FA 2YXYA 1R8OB 2K3XA 1GFCA 1VQ8Q 3V7RA 2LJ0A 3MHXA 3GBQA 6AT1B 4CC3A 4QVDA 3JSCA 1MHNA 1ZSZC 3CC7Q 3CCLQ 2EJGA 2RK1A 2I0NA 3QPHA 4M7AD 1SF9A 4LUDA 1QVFS 4C8QC 1YJWQ 5CKEA 2D9TA 4Z89A 2EQIA 3LWHA 2MMPA 1MGQA 5FU7C 4C92F 4HVVA 5M9OA 1OEBA 3EGUA 4OMFB 2O01E 2BUDA 2V26A 1VQ4Q 2LQWA 3M0RA 1QMCA 2D8JA 3EGDA 4C5GA 1X2QA 3CC2A 2EAYA 1HD3A 5KYYA 1YWPA 5IT9E 2HZYA 3PVQA 1D09B 2E70A 3CMEA 2FO0A 4RTVA 3TSZA 1LCKA 4N4IA 2MAMA 2RQUA 2EYZA 5IN1A 4MDWA 3OYHA 1KQ1A 1K73R 2HEQA 3GOXA 4C0ZA 1KC8U 2QXFA 1Q82U 1K73U 4HCCA 2P4TA 4M7AB 1IRXA 1EX4A 1UHFA 4J9IA 4JS5A 4GLMA 1AHJB 4IUUA 2DILA 4KULA 3X20B 1WGSA 1GBRA 3C0CA 1BCOA 1UECA 3BY7A 3REAB 3CCJT 4X1VA 1NYGA 7AT1B 2PU9B 4M77E 1M3AA 2L3PA 1B34B 1CSKA 1RAEB 1WQWA 1ZBJA 3CCRT 3MEUA 2DA9A 4L6V5 3FC3A 3QG1A 4J9GA 3GIBA 2D1XA 3UPUA 3CCSA 3GLXA 1VQKQ 1YWOA 4BY6C 3JCMQ 1W70A 1YP5A 4EMGA 1K9AA 1V29B 4XU1A 2ZPEB 2CKKA 1PKSA 3SWNC 2MWOA 5IHIA 5GAMd 3LWIA 4M78C 1M3CA 4KGVB 1X27A 2KR3A 5GAN5 5DLQE 3VJPA 1BIAA 3HFNA 4PJOG 5GAOp 1AWOA 1YITQ 1TUDA 3CQTA 4JJDA 1ZUUA 1VQNT 5EG2A 2R5AA 3JV3A 2X4JA 1M5Q1 2BKDN 2ROTA 3I56T 3BDLA 1NEBA 2QA4A 1G83A 4E2FB 3M53A 3V7CA 2DD4A 4IUVA 3H9NA 2LQKA 4FL6A 5EC7A 2XU8A 2HKQB 4EMKC 2VASA 1NZ9A 2LP5A 1G3WA 3RIRA 1UJYA 3UDCA 4LDVA 1JJ2P 4C8QB 4AFQC 4KBMB 2CP3A 2DNUA 4C92E 1Y57A 2ENMA 5DM7R 3OYMA 5J26A 2JVVA 1PWTA 1YIJT 4WTOB 9ATCB 1KQSA 2F5KA 4BI3A 5GAN4 3ZL7C 1MNDA 4J7IA 2X35A 4MZTA 2FZGB 5J39A 4M75A 4F7UB 3NFCA 2IG0A 1VQ5A 3E9GA 2QI2A 1IHVA 3NGPA 2EGEA 4J9HA 5KE3A 1TUCA 2FRYA 2MOXA 2P0KA 5AT1B 3INZA 5FW9A 1XJWB 3E9FA 1UHCA 4F7UE 2JTFA 3VS1A 2VGNA 4TVRA 1GCQA 2QDLA 4C0GA 3EFSA 4M7AF 3H41A 4LUEA 4JLGA 1IB8A 1V76A 1WJQA 2QEXQ 4BDZA 2L3RA 4Y92A 1MMGA 1QQJA 2BE9B 4FYVB 3M4YA 2YDLA 1LOJA 5LJ5j 1KFZA 2XDDA 4R56A 1KC8R 2JXBA 4C8QE 2OTJA 1Q7YU 4GY5A 1X2KA 4M7DE 4PJOD 2XI9A 2R58A 1KIKA 2VB6A 2P4RA 3C94A 4M7AG 1K8AU 2YUNA 2EJFA 2O9SA 2YWWA 5GAN2 3CCQA 4D8DA 4FIBA 2E4HA 2L5QA 2LCLA 4OB0B 4RG2A 2FYKA 4FM4B 2C06A 3OYAA 1QVPA 1YN8A 2EW3A 3HHTB 1TXQA 2CH4A 1T3SA 2KYBA 4OP0A 3WVEB 4YTLA 4CC4B 4NS5A 4DA4A 3RMQA 3QWYA 2C0IA 1WJSA 4PJOB 2NUTA 1ZBXA 1G3YA 2E5KA 1N27A 2KI7A 3KUFA 1QP3A 4PK4A 4RCBA 2EYYA 1OU9A 2GF7A 1E6HA 2NUZA 5A0GA 5LJ5e 1N9RA 4J8OA 1YNZA 2GNCA 2DK3A 2DEUA 2D0QB 4XTWA 4KRTA 3FB9A 2CZ7B 2O4XA 3OS5A 2X4YA 1RLPC 1D3BB 2OI3A 2VWFA 3CCEA 4RG8A 5KH6A 1M27C 2RF0A 4BB7A 2QQBA 1KD1R 5LJ3g 1ABOA 5GJVB 3OYDA 3CD6A 2O4XB 4Q5WA 1M8MA 3L2WA 4EMKA 1H641 1NBEB 3M4GA 2QEXT 3WXMB 2DZ9A 4CC7A 1D1AA 4M78D
chains in the Genus database with same CATH topology
1VQLQ 3CCSQ 1M1KR 3OW2P 1W2BP 1VQNQ 1VQPQ 1YJWQ 1KC8R 3CCJQ 1YJ9Q 3G71Q 1VQ5Q 3G4SQ 1VQ8Q 3CD6Q 1KD1R 1QVGP 1VQ6Q 3CC2Q 1YHQQ 1NJIR 3CPWP 1VQOQ 1YITQ 1VQ9Q 1VQKQ 1K8AR 3G6EQ 3CMAQ 2OTLQ 1YIJQ 1Q7YR 3CC4Q 1VQMQ 2OTJQ 3CCQQ 3CMEQ 3I55Q 3I56Q 2QA4Q 1Q86R 1N8RR 1QVFP 1Q81R 3CCVQ 1VQ7Q 1VQ4Q 3CXCP 3CCRQ 1YJNQ 1Q82R 1K73R 3CCEQ 1KQSP 3CC7Q 3CCLQ 3CCUQ 1M90R 2QEXQ 1YI2Q 1K9MR 1S72Q 1JJ2P 3CCMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL Q;  3CCS Q;  1M1K R;  3OW2 P;  1W2B P;  1VQN Q;  1VQP Q;  1YJW Q;  1KC8 R;  3CCJ Q;  1YJ9 Q;  3G71 Q;  1VQ5 Q;  3G4S Q;  1VQ8 Q;  3CD6 Q;  1KD1 R;  1QVG P;  1VQ6 Q;  3CC2 Q;  1YHQ Q;  1NJI R;  3CPW P;  1VQO Q;  1YIT Q;  1VQ9 Q;  1VQK Q;  1K8A R;  3G6E Q;  3CMA Q;  2OTL Q;  1YIJ Q;  1Q7Y R;  3CC4 Q;  1VQM Q;  2OTJ Q;  3CCQ Q;  3CME Q;  3I55 Q;  3I56 Q;  2QA4 Q;  1Q86 R;  1N8R R;  1QVF P;  1Q81 R;  3CCV Q;  1VQ7 Q;  1VQ4 Q;  3CXC P;  3CCR Q;  1YJN Q;  1Q82 R;  1K73 R;  3CCE Q;  1KQS P;  3CC7 Q;  3CCL Q;  3CCU Q;  1M90 R;  2QEX Q;  1YI2 Q;  1K9M R;  1S72 Q;  1JJ2 P;  3CCM Q; 
#chains in the Genus database with same CATH topology
 2DRM A;  2DX1 A;  2LNV A;  4PJO F;  8AT1 B;  5LJ5 g;  3MP6 A;  3C12 A;  3CCV T;  1QW1 A;  4M75 G;  2DL8 A;  3RUX A;  2KQW A;  4M78 B;  3PVL A;  2JS2 A;  4OMN A;  2FHD A;  3OS1 A;  2JUF A;  2HMA A;  3QKJ A;  3PNW C;  5CQY A;  5FU6 B;  1MNE A;  2VXF A;  3JCM b;  3NTI A;  3CCV A;  2ZPI B;  4RMO A;  3ZFJ A;  4CI0 C;  3CD6 Q;  1PD1 A;  4C5I A;  2DYI A;  2YRD A;  3J80 E;  1G5V A;  2HKN A;  1S1N A;  2DYB A;  3G71 T;  1NJI U;  1C6V X;  2D0N A;  1WHG A;  2MF2 A;  3D7S B;  1VQ9 A;  2WSF E;  2NUT B;  5LJ5 f;  2X3X D;  3G1J A;  1M2V B;  3HL8 A;  3TSW A;  5ECA A;  1K9M R;  3TEE A;  2B86 A;  1K8A C;  1IZ6 A;  3KFV A;  4A63 B;  3OW2 P;  2YRC A;  1Y71 A;  4N0A C;  5GAN d;  1FMV A;  1WX6 A;  3QYH B;  3FLG A;  4RKU E;  1YHQ Q;  5GAO n;  1R0B G;  4BUG A;  1GCP A;  3P8D A;  2CSI A;  4JDS A;  3QYG B;  2JJ9 A;  2EQU A;  2E10 A;  2F5T X;  1HYO A;  3HTR A;  1M3B A;  5GAO q;  5I2M A;  4KT0 E;  3JB9 J;  4ESR A;  3FDR A;  2CGH A;  1CKB A;  1YCY A;  2BZY A;  2A08 A;  2E3H A;  1VQN Q;  4MZM A;  4LXC A;  1Q81 U;  2E65 A;  3VU3 C;  1UG1 A;  2W10 A;  2KK4 A;  2HDA A;  3QHS A;  1RI0 A;  5HCK A;  5GAN f;  1WQ7 A;  3OYL A;  5FU7 B;  1FWZ A;  1HK9 A;  2EQM A;  5D7U A;  4M77 G;  2YLC A;  2J6O A;  1JRI A;  2KRM A;  2A28 A;  1EZZ B;  4DEX A;  1UDL A;  2LX7 A;  2M0O A;  1M9S A;  4E6R A;  1VIE A;  5I21 A;  2RQR A;  2AHJ B;  2KYM A;  3G6E A;  2SEM A;  4M75 B;  1JXM A;  2FVU A;  1SG5 A;  2X4X A;  2HBP A;  3CCR Q;  1Q82 R;  1VQL T;  3X25 B;  3TU4 K;  2M02 A;  1X01 A;  4PKC C;  5CKD A;  1XTD A;  1WIE A;  3R6O A;  2NYS A;  3L42 A;  2NLU A;  3ULR B;  4ZTJ A;  1U1T A;  2YSQ A;  4RTT A;  3JB9 D;  3HRT A;  2QQR A;  5GAN 8;  3G4S A;  1VQO Q;  2CZ1 B;  1LJO A;  3CEY A;  5KYN A;  1N8R C;  3I5R A;  2DEQ A;  2HD0 A;  1RUW A;  3EH1 A;  3I9Q A;  3JB9 I;  2WAC A;  4E47 A;  4E7Z A;  1K4U S;  1GRI A;  3CC7 T;  1WYX A;  3CCQ T;  1WXB A;  2RPN A;  1PCX A;  4OML A;  1AWW A;  4UC4 A;  3JCM g;  1W6X A;  5GMK i;  1VIF A;  4LNP A;  1YI2 T;  5C6S A;  2KXD A;  2LDM A;  2O2O A;  1ZX6 A;  4M75 E;  4FYX B;  3NPF A;  3PT9 A;  3QZ5 B;  2BIV A;  3OYG A;  5KYX B;  1OZ2 A;  4M78 A;  2Z0W A;  4IIM A;  4XTY A;  5IHK A;  2KRN A;  4M7D C;  3L2V A;  1LPL A;  1GBQ A;  2DIQ A;  1T0H A;  2GQV A;  5FRO A;  4BD3 A;  2AZS A;  1N5Z A;  2RJE A;  1SRL A;  4EMK B;  2AZV A;  1MUZ A;  1IXD A;  2DTI A;  5CKB A;  4X9D A;  3A1P A;  1NPR A;  3CC7 A;  3FRN A;  2FZK B;  3VKI A;  2BZ8 A;  2CP5 A;  2EPD A;  4M78 E;  1ZHI A;  4HCK A;  1BCM A;  3BE3 A;  4DBF A;  1M1K C;  4XTU A;  4F16 A;  1D3B A;  1RAF B;  2QDY B;  2SRC A;  2P0Q A;  3CCU T;  4J6W A;  3A5Z B;  1JQQ A;  2P0P A;  1VQ4 A;  3S3O A;  2DTO A;  1AWJ A;  2XHC A;  4JRP A;  4OMM A;  2C0T A;  4MDX A;  1NPP A;  1PSE A;  2OTL Q;  1AT1 B;  2L8D A;  4QQ6 A;  4DBQ A;  3CME Q;  1Q86 R;  1BKB A;  1QVG A;  4N4H A;  2PTK A;  2E41 A;  2XD0 A;  2CP2 A;  2GGR A;  3EHQ A;  3VS3 A;  3NTH A;  1SHG A;  2LC4 A;  2EVR A;  1CKA A;  1X6G A;  2VYT A;  1QWF A;  2DVJ A;  1QKW A;  5I11 A;  5KYY B;  3FEO A;  3PGG A;  1O9S A;  1UUE A;  2ZCF B;  1Q7Y C;  3QDF A;  1I1J A;  2M0Y A;  4BY6 B;  2Y4X A;  3L2Z A;  2PVO B;  2VC8 A;  3CXC P;  4AFS C;  2QQA A;  1PG5 B;  4RTU A;  4QKU A;  4FCY A;  4FU6 A;  1K9M C;  1NLO C;  1EFN A;  3A8L B;  4OMP A;  4LD9 K;  3DLL A;  5D6W A;  2JTE A;  2HSP A;  3QWX X;  5GAO m;  3OYK A;  4C5H A;  1M1G A;  3SEM A;  2OTL A;  2ZPB B;  2O9V A;  2LZ6 B;  3V8J A;  1IRE B;  3TQ7 P;  1V1C A;  1K76 A;  2F2V A;  2R57 A;  1WHH A;  1YI2 Q;  4D8K A;  2COW A;  2CT3 A;  2FL7 A;  1YJ9 A;  4XTV A;  2XG8 D;  2QA4 T;  2NWM A;  3CMA Q;  4EPC A;  3TVT A;  5A0D A;  2CH4 W;  2MWP A;  3SFM A;  2DXC A;  3S6W A;  1I5O B;  4ORZ A;  3HRU A;  4XAX B;  1A0N B;  5HK3 A;  3VS5 A;  3JB9 G;  2Y90 A;  1WDX A;  1WNL A;  2XMF A;  2LQ8 A;  1TG0 A;  4EMH A;  1K1Z A;  5DLO A;  4XU3 A;  1VQ9 Q;  3OYJ A;  4HCB A;  1JJ2 S;  1AZG B;  1UGP B;  1R77 A;  2P84 A;  2FG0 A;  2B8A A;  2CZ0 B;  2L3Q A;  3REB B;  5LJ5 d;  3KBG A;  2DMO A;  3OQ5 A;  5GMK e;  2JOY A;  2H8H A;  3Q1J A;  3UA7 A;  1SKU B;  3OS2 A;  1QCF A;  1VYU A;  2AKL A;  1WHM A;  4F04 B;  2KT8 A;  3PMI A;  5GAN 3;  1GL5 A;  4PL6 A;  1QVG P;  5J3B A;  2BZX A;  3U23 A;  1WI7 A;  4M7D D;  2OAW A;  2K5F A;  4RUG A;  1Z9Q A;  4KH1 B;  1WZO A;  3FJP A;  2LVM A;  1C1A A;  3CBP A;  1OQK A;  2RM4 A;  3NHN A;  2CUD A;  1VUB A;  1QCN A;  1VQ5 Q;  2AT1 B;  3DB4 A;  1U5S A;  5GAN g;  3QSU A;  2XID A;  1C0M A;  3MEW A;  3L2R A;  5GAM g;  3JCM P;  1Q86 U;  3CBO A;  5GMK m;  3S3N A;  3LGF A;  1OI1 A;  3E19 A;  4LE9 A;  3JB9 F;  3CME T;  2DO3 A;  1AZE A;  1K0X A;  2LCC A;  4PJO A;  3KXT A;  1TH7 A;  1JJ2 A;  3CMA T;  3CCR A;  4J9E A;  4LDX A;  2DL7 A;  3URG A;  1KD1 U;  2OTJ Q;  3A8G B;  4C92 D;  4JZ4 A;  1B34 A;  1VQP T;  1WLP B;  3ME9 A;  2DAQ A;  3G7Z A;  2JT4 A;  1BI1 A;  3CCL T;  5CKF A;  1BIB A;  2RJC A;  1RLQ C;  2A0F B;  2XDB A;  1M30 A;  1PM3 A;  2JTM A;  4E7K A;  4C0D C;  2CRE A;  2RH2 A;  3PE0 A;  5FRN A;  4HT8 A;  1YFN A;  2E6N A;  3SDZ A;  2O88 A;  4QQG A;  3AHU A;  3M56 A;  1H8K A;  1BI2 A;  4M7A A;  2EBP A;  4M78 F;  2EKO A;  2ZZD A;  2KSS A;  2QQ9 A;  3OYB A;  4JJN K;  2FPF A;  4A4H A;  3M0S A;  1GCQ C;  4L5G A;  3JCM f;  2O31 A;  1VQP Q;  1YBY A;  1ARK A;  4Z8A A;  4ZGE B;  3EG9 A;  1K73 C;  1VQ9 T;  5GMK h;  3VRZ A;  2VXE A;  4EDU A;  4M7A E;  1Q95 G;  2FPE A;  1YJ9 T;  2KVQ G;  3R6N A;  3OYY A;  1YJN Q;  1WHJ A;  4DBH A;  1X6B A;  4ZNX A;  5GAM h;  4J6X A;  4Y91 A;  1ZUY A;  4NL3 A;  1QWE A;  3EHR A;  4HVU A;  2YUO A;  1UGR B;  3M0U A;  1UGQ B;  1FX7 A;  1KG1 A;  4MML A;  3RES A;  3GF5 A;  3MET A;  3OW2 A;  2VGM A;  1K0S A;  1MMN A;  3OMC A;  1ZQ1 A;  4X9C A;  3MCA B;  2ESW A;  2MI6 A;  2X3W D;  2J06 A;  1KSW A;  1WHL A;  1G8X A;  1W2B P;  2X51 A;  4OMO A;  1M2V A;  3VRY A;  4JS4 A;  3H6Z A;  1TUG B;  2M16 A;  5D6Y A;  4OB3 B;  2BE7 D;  2RQV A;  2PZ1 A;  3CD6 T;  2JN0 A;  4RTX A;  4FSX A;  5AYF A;  5CIU A;  3GP8 A;  2BTT A;  2PVG B;  2ZPH B;  4BDY A;  3JAM E;  4J6Y A;  1OOT A;  5GJW B;  1OPK A;  3X28 B;  4ZGJ B;  3EGX A;  4KUI A;  2AK5 A;  4QW2 A;  3G71 Q;  1M4Z A;  1YCS B;  2QQS A;  5I22 A;  3L2Q A;  4C8Q F;  1X6O A;  4F7U G;  1G2B A;  3PTA A;  2V8I A;  4LDW A;  2XK0 A;  4AMC A;  1BU1 A;  4QT7 A;  2QYZ A;  1KQS P;  1N9S A;  3CCU Q;  3EG1 A;  3JCM e;  1MMA A;  3EFO A;  1ZSZ A;  2DLP A;  3JB9 H;  3OYF A;  2V8K A;  1BI3 A;  2V1Q A;  2JMC A;  1UJ0 A;  4KUD K;  3LYI A;  4M7D G;  4C8Q D;  5CCA A;  3V8L A;  1J3T A;  3CC2 T;  4XTX A;  3I55 Q;  5CO7 A;  1D1C A;  4OB2 B;  2FRW A;  3J7A F;  3MJX A;  4HKE A;  4M77 A;  1M1F A;  5LJ3 e;  3MPU B;  1QCO A;  3SB2 A;  2RJD A;  2OTJ T;  3OSS C;  2YLB A;  3LH5 A;  1QVF A;  4FT2 A;  4A4F A;  4BE1 A;  3VUZ A;  4ANJ A;  1B3Q A;  4E7L A;  1E7O A;  3RBB B;  2CT4 A;  5CKH A;  1VQL A;  3OYI A;  1KQ2 A;  3RKW A;  2GQI A;  4EIK A;  2HQX A;  2DIG A;  4OGE A;  4PNO A;  2RHZ A;  2F69 A;  2DXB A;  3M55 A;  1M90 C;  4IUP A;  2DVE A;  5IXB A;  1LNX A;  4HCZ A;  4A4K A;  4XU0 A;  2KEA A;  3EG3 A;  1TU0 B;  3EAE A;  4RTW A;  1OUL A;  3JCM c;  2RD1 A;  2DL4 A;  3VS6 A;  1SRM A;  1AD5 A;  1FYN A;  4A54 A;  2I2L A;  4M77 F;  3RDV A;  3OBW A;  1VQK A;  1D0X A;  3RR6 A;  1NLP C;  2RNA A;  1K8A R;  4BI4 A;  3EFO B;  5KCO A;  2KRO A;  4RTY A;  2OJ2 A;  1SHF A;  3E2U A;  1Q81 C;  2JM8 A;  2K3Y A;  3S3M A;  2A37 A;  1VQ7 A;  2RB6 A;  3QII A;  3CCE T;  3VUB A;  1WPY A;  2JW4 A;  4V2S A;  3SHW A;  3UF4 A;  2QEX A;  3VS0 A;  2IVW A;  4N4G A;  1YIT A;  3OB9 A;  2KNB B;  2K2V A;  3SD4 A;  2KY9 A;  3A8H B;  3JRZ A;  4II1 A;  4OMQ A;  1N8R R;  1IO6 A;  3WVD B;  4MZP A;  4IIO A;  4JZ3 A;  2KGT A;  2LRQ A;  1X43 A;  1XQH A;  1QLY A;  2LT1 A;  2ATC B;  1TWB A;  1PD0 A;  2V1R A;  1YJN T;  1M90 U;  5CAI A;  4J83 A;  4XTZ A;  1BYM A;  4NOY A;  1SPK A;  3JCM X;  3GPL A;  1NJI R;  3A98 A;  3H8Z A;  5HY6 A;  3M59 A;  4Z88 A;  1Y7X A;  4DBR A;  2DET A;  4QVZ A;  4C5E A;  1VQ7 Q;  2ECZ A;  5CVI A;  3I35 A;  5GAM e;  4IUR A;  2E1H A;  2VKN A;  3J81 E;  1T3L A;  1PHT A;  3H0F A;  4P5N A;  2HL3 A;  1VYT A;  2VV5 A;  1IGQ A;  3QDR B;  1ZA2 B;  1U1S A;  2RHI A;  3MEV A;  2CUB A;  1YIJ Q;  1VQ6 T;  3RKX A;  4LDU A;  1T0J A;  4BI8 B;  5IXF A;  1FMK A;  2FB7 A;  2EQJ A;  1SEM A;  2DJZ A;  4C92 A;  2JM9 A;  2RA2 A;  1PNJ A;  2KXC A;  1S72 T;  1HXD A;  3M0Q A;  1LVK A;  5HKC A;  2DM1 A;  4O5V A;  3VV0 A;  3CCE Q;  1PSF A;  4M75 F;  1ZSG A;  2KDS A;  2DL3 A;  4HXJ A;  1R0C B;  5GAN 6;  2Y4Y A;  2FEI A;  4E7S A;  1VQ6 Q;  1M1K U;  3I5S A;  1SSH A;  4C8Q A;  2CS7 A;  4A4E A;  1JU5 C;  1ABQ A;  1WJR A;  4JJC A;  5GAN h;  1I81 A;  2DRK A;  2G3R A;  2RK2 A;  3H0H A;  3CXC A;  3BW1 A;  1OX9 A;  2D6F A;  1MV0 B;  1WXT A;  2NUP B;  2WSC E;  4B9X A;  1M2O A;  2LJ3 A;  2DXU A;  1VQK T;  3SWN A;  5A0L A;  2L89 A;  3CCQ Q;  4A4G A;  4JRQ A;  3CCS T;  2DD5 A;  4FYW B;  1NG2 A;  1Y96 B;  3OY9 A;  2K2M A;  4OVA A;  4K11 A;  5FU6 C;  4QQD A;  1F1B B;  5FWB A;  1UGV A;  4AFZ C;  4PJM A;  4RTZ A;  2KRS A;  1PRL C;  1UGS B;  3DKM A;  2MIO A;  1RAB B;  3EG0 A;  2L0A A;  2RHX A;  5DY9 A;  2JNG A;  2EWN A;  2RI3 A;  3CPW P;  4RCC A;  1AVZ C;  1Q7Y R;  3I56 Q;  4N0A A;  2CZ6 B;  4PJO C;  2H3J A;  1ACM B;  5KYU A;  1AWX A;  1OX8 A;  1VYV A;  3M58 A;  1HSQ A;  4ELZ C;  2EJ9 A;  2MYS A;  1YJW A;  4F14 A;  5FRM A;  1D1B A;  2LX9 A;  3M5A A;  1O75 A;  2ZPG B;  4BE2 A;  3OMG A;  1I0C A;  1YI2 A;  2R5M A;  2EQK A;  2F1L A;  2GBQ A;  2H3E B;  5IAY A;  4PJO E;  1B07 A;  3CC4 Q;  1VQM Q;  2CDT A;  2DL5 A;  1KHI A;  2QG9 B;  4CRI A;  3V7S A;  3G71 A;  1D0Y A;  5LJ3 d;  4E7J A;  4AG2 C;  4IUT A;  1Y0M A;  4VUB A;  1VQ7 T;  3SWN B;  1VQN A;  4M4Z A;  4J9B A;  1Q82 C;  3ZEH A;  4C92 C;  3ZBD A;  3MO8 A;  1PRM C;  2JMA A;  2K4Y A;  5GMK j;  5IH2 A;  3M57 A;  3CCU A;  4XU2 A;  2J05 A;  2K7A A;  2ZAE A;  2ED1 A;  4J7F A;  1I4K 1;  5GAM f;  4PLL A;  4NL2 A;  3JCM h;  4M7D B;  5KYW A;  4ZGD B;  5GAM j;  2DER A;  4ZTF A;  3QZ9 B;  3JCM V;  4M7D F;  1OYX A;  2GTO A;  3IQL A;  5I2S A;  1TTH B;  1U06 A;  4A53 A;  2OAU A;  2OX7 A;  2PVD B;  1W2B A;  1RAH B;  2L2P A;  3EGD B;  1XNI A;  3CCV Q;  1TSF A;  4Z02 A;  1WXU A;  4XK8 E;  3MEA A;  3CPF A;  3EG2 A;  3JCM W;  4F7U F;  4C8Q G;  1UFF A;  2ROL A;  2DFU A;  3CCS Q;  4HT9 A;  5C0M A;  2HQE A;  2QGG A;  3V8K A;  4ATO A;  2ABL A;  1JXO A;  4F17 A;  1JBM A;  1KQS S;  5LJ3 j;  1KHC A;  1GFD A;  4GBQ A;  4PJJ A;  1IGU A;  2JZ2 A;  1JEG A;  1SSF A;  4ELY C;  2QK0 A;  2KMT A;  3VS4 A;  1KJW A;  4M7A C;  1AEY A;  3CBM A;  5LL6 S;  1ZLM A;  3F70 A;  2CP6 A;  1NJI C;  2G6F X;  3MP8 A;  4WCI A;  1PKT A;  2DE0 X;  1NEG A;  2LNH B;  1MMD A;  4B9W A;  2HCK A;  1U8R A;  1BI0 A;  1PC0 A;  1NE8 A;  1RAC B;  3UWN A;  4FW1 A;  3RKY A;  2KAF A;  4HVW A;  3UAT A;  3TCJ A;  3BFM A;  3QO3 A;  5FLX E;  3I55 T;  5GAO r;  3M0T A;  3L2U A;  3X24 B;  3RER A;  2F2X A;  1YHQ T;  2FPD A;  2M1H A;  3HP9 A;  4ME7 A;  3PMT A;  2FZC B;  1YJW T;  2ED0 A;  5KYW B;  1G3T A;  2EIF A;  1AOJ A;  5GAO l;  4D6W A;  2DPP B;  2J6K A;  2E12 A;  1TOV A;  3EH2 A;  3ER0 A;  2EFI A;  3MP1 A;  2LT4 A;  1Q86 C;  2VUB A;  1H3H A;  1E6G A;  1BBZ A;  5FWC A;  3G6E Q;  4PFZ A;  1VQP A;  3NTK A;  2YRV A;  3QUI A;  3LX7 A;  4M75 D;  3T9N A;  3OYN A;  1XOV A;  2DKG A;  4M78 G;  4LD6 A;  2IPO B;  2XIC A;  4PLI A;  1MV3 A;  1RI9 A;  5LJ5 h;  3CC4 T;  1VQM T;  3M54 A;  3GNF B;  3G4S Q;  1VQO A;  1KC8 C;  3OA6 A;  3CCJ A;  3C95 A;  2HSE B;  2KBT A;  2AIR B;  3MKD A;  1W2B S;  1UTI A;  3LH0 A;  2PUK B;  1QVG S;  5KYU B;  1TS9 A;  1KD1 C;  2ZGW A;  2RQW A;  1B7T A;  2DXT A;  4WF2 A;  2MK5 A;  2MPX C;  5KE2 A;  4B6M A;  3CCL A;  4PFP A;  5GMK l;  2CP0 A;  5KYX A;  2HL5 C;  2CYZ B;  4KH0 B;  4PJN A;  3DLM A;  1Y07 A;  2VVK A;  4M77 B;  3O5Z A;  2GFA A;  1H92 A;  3OYE A;  4C92 G;  2RO0 A;  2X9H A;  3E1S A;  3AT1 B;  2WSE E;  4R0K A;  4AFU C;  3M0P A;  4J5Y A;  1I5L A;  2EKH A;  1DJ7 B;  3CCM Q;  1OZ3 A;  3OBY A;  4C0D B;  4ZN1 A;  1HJD A;  3N5B B;  2HQH A;  3CCJ Q;  1EIF A;  3FJ5 A;  5CR2 A;  4E7I A;  1FXX A;  2RHU A;  2J7I A;  1I8F A;  2HAX A;  1UEB A;  2NUP A;  2V8J A;  3CC2 Q;  1VQ5 T;  1D0Z A;  1ZSZ B;  3FIF A;  5GAN e;  4FYY B;  2K3B A;  1G3S A;  4BE0 A;  2QTX A;  3VS2 A;  4J9C A;  1RL2 A;  2DF6 A;  4MMK A;  1RAG B;  4FW2 A;  4AT1 B;  3LW5 E;  1YJ9 Q;  2DBK A;  2PUO B;  3G6E T;  2PQW A;  3EGX B;  2YT6 A;  2QGF B;  3HKS A;  3CMA A;  1QVF P;  3PIP A;  2K5L A;  2QTV A;  4JPB W;  2K57 A;  4C92 B;  2K6D A;  2YHT A;  2RI2 A;  1X75 C;  3CCM A;  3I55 A;  4CC2 A;  2RI5 A;  1K9M U;  3L1A A;  4F7U A;  4IKF A;  1VOM A;  3GNG A;  4OGC A;  5L8R E;  3X26 B;  3I56 A;  2KT1 A;  1M8V A;  4R55 A;  5KCH A;  3EFR A;  3PFS A;  3EG9 B;  2A3L A;  2IIM A;  3DB3 A;  2XKO C;  2M9U A;  2E3I A;  1BB9 A;  3BDU A;  4C0F A;  4BAC A;  1VQL Q;  1M1K R;  2K5I A;  2K9G A;  2RMO A;  4M7D A;  1VQM A;  3CC4 A;  2KE9 A;  1N8R U;  4JLI A;  4M75 C;  3PIO A;  3LLR A;  2E64 A;  1OV3 A;  2K79 A;  2LJ1 A;  2A7Y A;  2GFU A;  1P92 A;  4M77 D;  3H0I A;  4LN2 A;  2M51 A;  5GAN 7;  4X34 A;  4OF1 A;  1NM7 A;  3CPW S;  3VYH B;  3RNJ A;  4L59 A;  1WFW A;  3HFO A;  1IHW A;  4JRK A;  4DOW A;  2JS0 A;  1RAI B;  5L23 A;  3M9Q A;  3QXE B;  5D6X A;  3RMS A;  2QA4 Q;  2XDP A;  4OB1 B;  2YUQ A;  4J9D A;  3CCM T;  3O8V A;  4DEY A;  2L3S A;  4FSS A;  4E7H A;  1ZA1 B;  3OYC A;  1Z9Z A;  1YHQ A;  1RAA B;  1VQ4 T;  1JO8 A;  3HRS A;  2COZ A;  2W0Z A;  1WHK A;  2RQT A;  4DOV A;  2QAS A;  1X69 A;  2EGC A;  4Y28 E;  1VQ8 T;  1NYF A;  3TRE A;  1W1F A;  5LJ3 f;  4IUQ A;  1OU8 A;  2DJQ A;  2RHY A;  2LCS A;  1Q81 R;  3P8H A;  2EYW A;  3JCM d;  1FMW A;  3OSV A;  4AG1 C;  2E6Z A;  4HA8 A;  2MCN A;  1S72 A;  4PJL A;  2X4W A;  2RN8 A;  3HSB A;  1Y96 A;  2DBM A;  4GLK A;  1YIT T;  2F2W A;  2HNI A;  4DQ2 A;  3VYG A;  2CSQ A;  3THK A;  5A2Q E;  5CQX A;  4KGZ B;  3G4S T;  1GXI E;  4LDY A;  2D8H A;  3QJ6 A;  1UB4 A;  3UA6 A;  2ZPF B;  2EYQ A;  1M90 R;  3JCM J;  2E5Q A;  2C0O A;  2AKK A;  2GCX A;  5IHN A;  4JUV A;  4ZN3 A;  5HK0 A;  2A36 A;  1BK2 A;  1OPL A;  2OTL T;  1QKX A;  3C4S A;  1JB0 E;  2DZC A;  3LGL A;  1YIJ A;  4JRI A;  1YJN A;  3CPW A;  1S72 Q;  1KK7 A;  3OS0 A;  3P8B B;  1QP2 A;  3CXC S;  2CP7 A;  1RAD B;  1U3O A;  1VQ8 A;  1VQO T;  1WA7 A;  2YUP A;  2LTO A;  1VQ6 A;  3VS7 A;  4JJB A;  3UT1 A;  1ZUK A;  3ASK A;  5CK9 A;  2COY A;  8ATC B;  1W4S A;  4XQ3 A;  4FT4 A;  4O6J A;  2EGA A;  2J6F A;  4PFO A;  4QVC A;  3A8O B;  1UE9 A;  5LJ3 h;  3A8M B;  2PNI A;  2EYX A;  3OW2 S;  1H3Z A;  1VA7 A;  2DTH A;  3QBY A;  5GAN j;  2HBW A;  1I07 A;  2GTJ A;  3NMZ C;  4M77 C;  3QJY A;  4KGX B;  2LQN A;  2RJF A;  2LMJ A;  1N6A A;  2QAZ A;  3HPW A;  4J9F A;  2YXY A;  1R8O B;  2K3X A;  1GFC A;  1VQ8 Q;  3V7R A;  2LJ0 A;  3MHX A;  3GBQ A;  6AT1 B;  4CC3 A;  4QVD A;  3JSC A;  1MHN A;  1ZSZ C;  3CC7 Q;  3CCL Q;  2EJG A;  2RK1 A;  2I0N A;  3QPH A;  4M7A D;  1SF9 A;  4LUD A;  1QVF S;  4C8Q C;  1YJW Q;  5CKE A;  2D9T A;  4Z89 A;  2EQI A;  3LWH A;  2MMP A;  1MGQ A;  5FU7 C;  4C92 F;  4HVV A;  5M9O A;  1OEB A;  3EGU A;  4OMF B;  2O01 E;  2BUD A;  2V26 A;  1VQ4 Q;  2LQW A;  3M0R A;  1QMC A;  2D8J A;  3EGD A;  4C5G A;  1X2Q A;  3CC2 A;  2EAY A;  1HD3 A;  5KYY A;  1YWP A;  5IT9 E;  2HZY A;  3PVQ A;  1D09 B;  2E70 A;  3CME A;  2FO0 A;  4RTV A;  3TSZ A;  1LCK A;  4N4I A;  2MAM A;  2RQU A;  2EYZ A;  5IN1 A;  4MDW A;  3OYH A;  1KQ1 A;  1K73 R;  2HEQ A;  3GOX A;  4C0Z A;  1KC8 U;  2QXF A;  1Q82 U;  1K73 U;  4HCC A;  2P4T A;  4M7A B;  1IRX A;  1EX4 A;  1UHF A;  4J9I A;  4JS5 A;  4GLM A;  1AHJ B;  4IUU A;  2DIL A;  4KUL A;  3X20 B;  1WGS A;  1GBR A;  3C0C A;  1BCO A;  1UEC A;  3BY7 A;  3REA B;  3CCJ T;  4X1V A;  1NYG A;  7AT1 B;  2PU9 B;  4M77 E;  1M3A A;  2L3P A;  1B34 B;  1CSK A;  1RAE B;  1WQW A;  1ZBJ A;  3CCR T;  3MEU A;  2DA9 A;  4L6V 5;  3FC3 A;  3QG1 A;  4J9G A;  3GIB A;  2D1X A;  3UPU A;  3CCS A;  3GLX A;  1VQK Q;  1YWO A;  4BY6 C;  3JCM Q;  1W70 A;  1YP5 A;  4EMG A;  1K9A A;  1V29 B;  4XU1 A;  2ZPE B;  2CKK A;  1PKS A;  3SWN C;  2MWO A;  5IHI A;  5GAM d;  3LWI A;  4M78 C;  1M3C A;  4KGV B;  1X27 A;  2KR3 A;  5GAN 5;  5DLQ E;  3VJP A;  1BIA A;  3HFN A;  4PJO G;  5GAO p;  1AWO A;  1YIT Q;  1TUD A;  3CQT A;  4JJD A;  1ZUU A;  1VQN T;  5EG2 A;  2R5A A;  3JV3 A;  2X4J A;  1M5Q 1;  2BKD N;  2ROT A;  3I56 T;  3BDL A;  1NEB A;  2QA4 A;  1G83 A;  4E2F B;  3M53 A;  3V7C A;  2DD4 A;  4IUV A;  3H9N A;  2LQK A;  4FL6 A;  5EC7 A;  2XU8 A;  2HKQ B;  4EMK C;  2VAS A;  1NZ9 A;  2LP5 A;  1G3W A;  3RIR A;  1UJY A;  3UDC A;  4LDV A;  1JJ2 P;  4C8Q B;  4AFQ C;  4KBM B;  2CP3 A;  2DNU A;  4C92 E;  1Y57 A;  2ENM A;  5DM7 R;  3OYM A;  5J26 A;  2JVV A;  1PWT A;  1YIJ T;  4WTO B;  9ATC B;  1KQS A;  2F5K A;  4BI3 A;  5GAN 4;  3ZL7 C;  1MND A;  4J7I A;  2X35 A;  4MZT A;  2FZG B;  5J39 A;  4M75 A;  4F7U B;  3NFC A;  2IG0 A;  1VQ5 A;  3E9G A;  2QI2 A;  1IHV A;  3NGP A;  2EGE A;  4J9H A;  5KE3 A;  1TUC A;  2FRY A;  2MOX A;  2P0K A;  5AT1 B;  3INZ A;  5FW9 A;  1XJW B;  3E9F A;  1UHC A;  4F7U E;  2JTF A;  3VS1 A;  2VGN A;  4TVR A;  1GCQ A;  2QDL A;  4C0G A;  3EFS A;  4M7A F;  3H41 A;  4LUE A;  4JLG A;  1IB8 A;  1V76 A;  1WJQ A;  2QEX Q;  4BDZ A;  2L3R A;  4Y92 A;  1MMG A;  1QQJ A;  2BE9 B;  4FYV B;  3M4Y A;  2YDL A;  1LOJ A;  5LJ5 j;  1KFZ A;  2XDD A;  4R56 A;  1KC8 R;  2JXB A;  4C8Q E;  2OTJ A;  1Q7Y U;  4GY5 A;  1X2K A;  4M7D E;  4PJO D;  2XI9 A;  2R58 A;  1KIK A;  2VB6 A;  2P4R A;  3C94 A;  4M7A G;  1K8A U;  2YUN A;  2EJF A;  2O9S A;  2YWW A;  5GAN 2;  3CCQ A;  4D8D A;  4FIB A;  2E4H A;  2L5Q A;  2LCL A;  4OB0 B;  4RG2 A;  2FYK A;  4FM4 B;  2C06 A;  3OYA A;  1QVP A;  1YN8 A;  2EW3 A;  3HHT B;  1TXQ A;  2CH4 A;  1T3S A;  2KYB A;  4OP0 A;  3WVE B;  4YTL A;  4CC4 B;  4NS5 A;  4DA4 A;  3RMQ A;  3QWY A;  2C0I A;  1WJS A;  4PJO B;  2NUT A;  1ZBX A;  1G3Y A;  2E5K A;  1N27 A;  2KI7 A;  3KUF A;  1QP3 A;  4PK4 A;  4RCB A;  2EYY A;  1OU9 A;  2GF7 A;  1E6H A;  2NUZ A;  5A0G A;  5LJ5 e;  1N9R A;  4J8O A;  1YNZ A;  2GNC A;  2DK3 A;  2DEU A;  2D0Q B;  4XTW A;  4KRT A;  3FB9 A;  2CZ7 B;  2O4X A;  3OS5 A;  2X4Y A;  1RLP C;  1D3B B;  2OI3 A;  2VWF A;  3CCE A;  4RG8 A;  5KH6 A;  1M27 C;  2RF0 A;  4BB7 A;  2QQB A;  1KD1 R;  5LJ3 g;  1ABO A;  5GJV B;  3OYD A;  3CD6 A;  2O4X B;  4Q5W A;  1M8M A;  3L2W A;  4EMK A;  1H64 1;  1NBE B;  3M4G A;  2QEX T;  3WXM B;  2DZ9 A;  4CC7 A;  1D1A A;  4M78 D; 
#chains in the Genus database with same CATH homology
 1VQL Q;  3CCS Q;  1M1K R;  3OW2 P;  1W2B P;  1VQN Q;  1VQP Q;  1YJW Q;  1KC8 R;  3CCJ Q;  1YJ9 Q;  3G71 Q;  1VQ5 Q;  3G4S Q;  1VQ8 Q;  3CD6 Q;  1KD1 R;  1QVG P;  1VQ6 Q;  3CC2 Q;  1YHQ Q;  1NJI R;  3CPW P;  1VQO Q;  1YIT Q;  1VQ9 Q;  1VQK Q;  1K8A R;  3G6E Q;  3CMA Q;  2OTL Q;  1YIJ Q;  1Q7Y R;  3CC4 Q;  1VQM Q;  2OTJ Q;  3CCQ Q;  3CME Q;  3I55 Q;  3I56 Q;  2QA4 Q;  1Q86 R;  1N8R R;  1QVF P;  1Q81 R;  3CCV Q;  1VQ7 Q;  1VQ4 Q;  3CXC P;  3CCR Q;  1YJN Q;  1Q82 R;  1K73 R;  3CCE Q;  1KQS P;  3CC7 Q;  3CCL Q;  3CCU Q;  1M90 R;  2QEX Q;  1YI2 Q;  1K9M R;  1S72 Q;  1JJ2 P;  3CCM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...