4JZ4A

Crystal structure of chicken c-src-sh3 domain: monomeric form
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
total genus 11
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jz4A00
1PNJA 2LX7A 1H8KA 1I0CA 1M8MA 2LJ1A 1W70A 3VS2A 1ARKA 1QKWA 2P4RA 5HCKA 1KFZA 2DL5A 2LJ0A 3EG2A 2VKNA 1UGVA 2YT6A 3PE0A 3M0RA 4F17A 2PNIA 2DM1A 3QWXX 2KNBB 2KYMA 2A08A 4DEXA 4QT7A 1SPKA 1GBRA 2DILA 1QWEA 3H41A 2D1XA 3GBQA 2J06A 2LZ6B 4JJDA 4AFZC 1SRLA 2KR3A 4J9EA 2W10A 1UDLA 2LP5A 1ABOA 2CREA 1BBZA 1SRMA 2EBPA 4OMOA 3UA7A 2GNCA 2V1QA 2IIMA 2C0IA 2RQUA 2EPDA 4F14A 2O88A 2K3BA 2DBKA 4R0KA 1X2QA 4J9DA 4RTZA 5FWCA 2I0NA 1U3OA 2ESWA 2DF6A 1OV3A 2G6FX 1NG2A 1H3HA 2EYWA 1M27C 2KROA 1Y0MA 1XOVA 2KRMA 1M3AA 5IXBA 1K9AA 1UJYA 2RPNA 2KEAA 3EGUA 2MOXA 4HCKA 5IHIA 2A37A 4LUDA 1X27A 4OMMA 3ZL7C 2AKLA 2D8HA 2RQRA 3M0UA 3REAB 1GFDA 1I07A 1TG0A 2ED0A 1LCKA 4CC4B 1KJWA 1MV0B 1ZBJA 2NUZA 2LCSA 2J6FA 1VA7A 1ABQA 1FYNA 4RTWA 2KGTA 4AFUC 1YNZA 1JU5C 4AG2C 1GRIA 2M51A 1MUZA 4J9BA 5EC7A 3R6NA 1BK2A 2DE0X 2RQVA 2KBTA 4DEYA 4OMLA 2RMOA 2RN8A 2CT3A 1WXTA 2EGCA 2DMOA 1M30A 2JTEA 4CC7A 1UJ0A 4RTYA 1JXMA 2JW4A 4ZNXA 3NPFA 2LJ3A 2YUNA 4AFSC 2MCNA 3VS4A 2JT4A 1GCQA 2DX1A 2F2VA 2CT4A 4OMQA 2EYXA 2EYYA 1H92A 2E5KA 1VYUA 2LNHB 4Z89A 4LE9A 4CC2A 1WXBA 1QKXA 1ZLMA 2AKKA 1OOTA 2J6OA 4FSSA 5ECAA 5I11A 4J9FA 2ABLA 3KFVA 3THKA 2EQIA 3NMZC 3M0PA 3U23A 4WCIA 1EFNA 2JS2A 2SEMA 3PVLA 2JM8A 1X6GA 4JZ4A 2CH4W 2K2MA 1CSKA 4CC3A 4K11A 4RUGA 1X69A 1AVZC 2HDAA 3LH5A 3VS6A 1B07A 3IQLA 1AWOA 2F2WA 4HVUA 1BB9A 2O9SA 3VS5A 1W1FA 2DL7A 4LN2A 2O2OA 1UE9A 2RQWA 2EVRA 1K0XA 5IHKA 3FJ5A 1UFFA 5FWBA 2J05A 3NGPA 1YP5A 2L0AA 2F2XA 3TVTA 2OI3A 2JS0A 2YUQA 4D8KA 3VS1A 4A63B 4IIMA 1NYGA 1RLQC 3REBB 1AZEA 4GBQA 1NM7A 2HSPA 4J9HA 1GBQA 2AZVA 3UATA 2DL8A 1GL5A 1HSQA 1SHGA 2B86A 1AWXA 2EGAA 4E6RA 1E6GA 1ZUYA 2EW3A 2YSQA 4Z88A 1AD5A 1X43A 4ESRA 1U06A 2OJ2A 2ENMA 2X3XD 1WFWA 3SEMA 1JQQA 2X3WD 1G83A 4RTTA 2FEIA 4HXJA 3TSZA 2J7IA 2D8JA 1PKTA 1PKSA 1B3QA 2CUBA 3QWYA 2JM9A 3TSWA 2VVKA 2CSQA 2YDLA 1RLPC 1RUWA 5IHNA 2D0NA 4JJCA 2L2PA 3H0FA 1Y57A 2DVJA 2L3QA 2RF0A 4Y92A 2DL3A 3UF4A 3M0SA 1HJDA 4M4ZA 1YWPA 1OPKA 4LNPA 1YWOA 1J3TA 1T0HA 1YCSB 3M0QA 1S1NA 2QDLA 4OMPA 3RNJA 1ZX6A 1HD3A 4D8DA 1Z9ZA 3I35A 1UHCA 1SSHA 2CDTA 4RTUA 1I1JA 1T3SA 2DBMA 3EG3A 5IXFA 2EKHA 1VYTA 2L3SA 1T3LA 2XMFA 3EHRA 5GJVB 4LUEA 1TUDA 1AEYA 1UG1A 2GTOA 1AWJA 2LMJA 2GGRA 4J9IA 2KYBA 3C0CA 1M3CA 2DNUA 2PTKA 2HBWA 1CKBA 1ZSGA 4EIKA 4Z8AA 2JXBA 2RQTA 2ROLA 2ED1A 2CSIA 3ULRB 1NEBA 2A36A 2DRMA 2AZSA 2FO0A 2FRWA 1JO8A 2KRNA 5IH2A 4HVWA 3VS3A 1PRLC 2PZ1A 5GJWB 1KIKA 1ZUUA 4RTVA 2CH4A 2K9GA 1OEBA 1JXOA 1N5ZA 1X2KA 2LQWA 4X1VA 1K76A 1M3BA 2M0YA 1SHFA 3UA6A 1KSWA 1UUEA 1QWFA 1K0SA 2FG0A 1AWWA 4GLMA 3I5SA 2DRKA 4AFQC 1YN8A 3EG1A 3RBBB 1E7OA 3JV3A 2BTTA 2HCKA 4HVVA 5L23A 1WI7A 1WLPB 5I22A 1VYVA 3M0TA 2KXCA 1U5SA 2BZXA 4ORZA 1TUCA 2GQIA 2BZYA 1PWTA 2W0ZA 5FW9A 2HEQA 2FPEA 4OMNA 2FPDA 1GFCA 3H0HA 3EHQA 2JMCA 2O9VA 1WA7A 2EGEA 1K4US 3VS7A 1NYFA 2VWFA 1PHTA 4J9GA 3VS0A 3O5ZA 3I9QA 1GCPA 3VRYA 2K7AA 1NLPC 1ZUKA 4J9CA 3EG0A 2NWMA 1Z9QA 1SEMA 1WDXA 2J6KA 2BZ8A 2DYBA 2H8HA 1NLOC 1X6BA 2KXDA 2GBQA 2KE9A 3I5RA 3NHNA 2DLPA 1G2BA 1JEGA 1PRMC 1WIEA 1QCFA 1A0NB 1W6XA 4IIOA 2K79A 1E6HA 2L3PA 2YUOA 1NEGA 2SRCA 1FMKA 2CUDA 2EYZA 3H0IA 1BU1A 1V1CA 1WYXA 2K6DA 1T0JA 2A28A 2O31A 2OAWA 1GCQC 2ROTA 2AK5A 1MV3A 2RNAA 1RI9A 1IO6A 2DA9A 4JPBW 2KT8A 2FRYA 1AOJA 3PVQA 2V1RA 3CQTA 3VRZA 4KRTA 1WXUA 2KT1A 2YUPA 2LQNA 2DL4A 2FPFA 4AG1C 2KRSA 2GTJA 1UTIA 2C0OA 1K1ZA 1UECA 2DJQA 3SHWA 2MIOA 4JZ3A 1QLYA 2ECZA 1AZGB 2C0TA 3A98A 4RTXA 2JMAA 1WX6A 1UHFA 1OPLA 4JJBA 4F16A 1CKAA
chains in the Genus database with same CATH superfamily
4WF2A 3RUXA 2MK5A 1YIJA 1WJQA 2DVEA 3V7RA 4A4HA 2YT6A 4QVDA 3PE0A 4FIBA 2KVQG 1Q82C 4QT7A 1GBRA 3PGGA 1M2OA 1QWEA 3OMCA 1UGPB 4XU2A 3I56Q 1YI2A 1TUGB 4FCYA 3VV0A 3S3NA 2J06A 3QYGB 2QQRA 3NTIA 1SRLA 3CCRT 1FXXA 4PNOA 4J9EA 4IUTA 3OYCA 4M78E 2W10A 3L2UA 2LP5A 1VQKA 3G1JA 1WQ7A 1Q95G 3CCMA 2EYQA 1VQPA 4BE1A 4OMOA 3I55A 2V1QA 2CZ0B 1MMGA 3CCQA 2C0IA 1NJIR 2EPDA 2HMAA 2K3BA 3E9FA 2DBKA 3CCSA 2ZPFB 1R8OB 4DBFA 2DF6A 3OYMA 1NG2A 1LVKA 4PLIA 2LC4A 4DBQA 4LDXA 1QP2A 1MMNA 3GNGA 5GAN7 3RERA 2MOXA 5KYUB 5IHIA 1QVGA 4LUDA 4OMMA 2ZGWA 1KC8C 3L2QA 1D3BA 4PJOE 2ZCFB 4BE2A 2QI2A 1I07A 1K73C 5IAYA 3CCVQ 4OB3B 4XAXB 3CXCA 1Y96A 2CZ1B 3LYIA 1MV0B 2LCSA 4XTVA 1M90U 2FYKA 2Y90A 4Q5WA 1RAFB 3GOXA 4JRIA 2WACA 4Y91A 1VQ8A 4E7ZA 1FX7A 4DBHA 3QG1A 1Q7YC 1JU5C 4AG2C 4KH0B 5GANd 5CK9A 4PL6A 1H641 1VQMT 1VQ5T 4EDUA 1N9SA 1N8RC 2CZ7B 3EGDB 2DE0X 2GFAA 2XICA 4KBMB 2RN8A 1VUBA 2QYZA 3EFSA 1SF9A 1UB4A 1MMDA 2JTEA 3M59A 2WSFE 3AT1B 4B9WA 1UJ0A 4CC7A 4RTYA 3SWNA 1M1KU 1PC0A 1PD1A 2OTJT 5KYWA 4AFSC 2JT4A 3S3OA 1GCQA 1I4K1 4MZTA 1BKBA 4M7DD 4JS4A 2CT4A 2XHCA 3CC4Q 4OMQA 5IT9E 3X24B 1VQ7Q 1QQJA 1WHGA 1DJ7B 3THKA 2RHZA 3QJ6A 2I2LA 4M77C 1WQWA 1D1CA 3PVLA 4JZ4A 2EIFA 2K2MA 4C0ZA 1AHJB 4RUGA 1X69A 2HDAA 4HCBA 2F1LA 3TQ7P 2F2WA 3VS5A 1W1FA 1Q86C 4C92B 4XTXA 2RQWA 1TSFA 4N0AA 5IHKA 5FWBA 5LJ3f 2L0AA 2OI3A 3OS0A 3C94A 4A63B 2RH2A 4MDWA 2QA4Q 4J5YA 3VJPA 1UGRB 3C95A 1Q81C 4J9HA 4BI8B 3JCMb 1VIEA 3UATA 1NZ9A 4ANJA 1AWXA 3S6WA 2XIDA 3G6ET 2V8KA 5EG2A 4E6RA 1E6GA 1YFNA 2K5FA 2RI2A 2OJ2A 2ENMA 4LDUA 1WFWA 4O5VA 3CCUA 2FEIA 3UT1A 4LD9K 2K5IA 4E7JA 4V2SA 2O01E 1PKTA 4E2FB 1UGSB 1VQNA 1RADB 2CSQA 1QVGS 4J6WA 5IHNA 3LX7A 3ZEHA 2RHXA 2L2PA 2DVJA 4M77G 4Y92A 1BIAA 5KH6A 2YRVA 3M0SA 1HJDA 4M4ZA 2CGHA 3CCET 1J3TA 3QO3A 3M0QA 1S1NA 1VQLT 3PFSA 1W2BS 4ZGDB 2JNGA 2LCCA 2CDTA 2VXFA 2DKGA 1T3SA 4KULA 3OBYA 4PKCC 2PVGB 2XMFA 5GJVB 3KBGA 5IN1A 1AEYA 5KYUA 2LMJA 3JCMV 2EAYA 3CC7Q 2QQAA 1M9SA 1ZSGA 2RHUA 2RQTA 3OYJA 2LT4A 3ULRB 1NEBA 2XKOC 3GIBA 2AZSA 1WPYA 2HQXA 3M57A 5IH2A 1JO8A 2KRNA 2RD1A 4HVWA 1PRLC 1YI2T 1W2BP 1NPRA 3SDZA 2A7YA 2RK1A 1X2KA 2LQWA 3OS2A 3EGDA 4HT8A 1KSWA 1UUEA 3C12A 1VQKT 1K0SA 2DRKA 4AFQC 3CCMT 1VQPT 3I55T 1W4SA 4PJLA 2HCKA 4CI0C 3CCST 1TXQA 2X4WA 5L23A 1WI7A 1WLPB 1VYVA 3CBOA 4BY6B 1TUCA 1C1AA 1BI3A 1YJNQ 2HEQA 1KC8R 2QQ9A 1G3YA 1EIFA 1FWZA 1K73R 2O9VA 2QEXQ 1K4US 4A53A 1NYFA 4J9GA 2EKOA 4VUBA 4ELYC 1BYMA 3MEAA 4QQGA 2GQVA 1ZUKA 2EJGA 1Q7YR 3EG0A 1KD1U 1SEMA 1I5OB 2J6KA 5GANf 4C92A 2H8HA 1N8RR 3JCMd 2ZZDA 3CBPA 1NLOC 3GF5A 1IXDA 4PJOG 3M55A 4KGZB 1ZA1B 2GBQA 4M7AE 2CZ6B 3NHNA 1NJIC 1YITQ 2DLPA 1JEGA 1PRMC 4A4EA 2KK4A 4GY5A 5CR2A 1W6XA 4IIOA 4JS5A 3G4SQ 2CUDA 1NE8A 3CD6Q 3H0IA 1WHKA 2WSCE 1LJOA 5DLOA 5GAOp 2CP7A 2K6DA 1YBYA 1ZQ1A 2MWPA 3E19A 1T0JA 4F04B 3VUZA 3BE3A 2AK5A 2NYSA 4J83A 4JPBW 1KQSA 4XTUA 2XD0A 1AOJA 1BI1A 2KSSA 3Q1JA 1KQ2A 2FPFA 4AG1C 5D6YA 2OTLA 1UTIA 2C0OA 2P0PA 4M77D 3G6EQ 4BDZA 1UECA 1WHLA 2DJQA 2DFUA 3G71A 2ECZA 1Q86R 1BCOA 5LJ5j 3A98A 4M75C 3QIIA 3LWIA 1HXDA 4M7DB 3OY9A 2VUBA 4F16A 1I0CA 1M8MA 2OTJA 2C06A 1I5LA 1IZ6A 1QKWA 2P4RA 4IUUA 1VQOQ 1MMAA 2DL5A 5CCAA 3CC2A 2HZYA 3L2WA 4E7SA 1LPLA 4F17A 3A8LB 4BDYA 1QVFS 3QWXX 3WXMB 3J81E 4DEXA 4C5EA 3D7SB 2DXUA 3CCLQ 3WVDB 2JTFA 1VQLQ 2P4TA 2E6ZA 3ASKA 2LX9A 4PLLA 4QVCA 1U1SA 2K4YA 2LCLA 4RCBA 2DERA 1ABOA 1JJ2S 2EBPA 1YIJQ 2IIMA 2EQJA 4F14A 2RQUA 3CCUT 1YHQA 2Z0WA 3SB2A 1X2QA 2NUTB 2ESWA 3RESA 4DOWA 5LJ3d 1RABB 4L5GA 1VQNT 1KD1R 2KROA 1Y0MA 1XOVA 2DTOA 2KRMA 4M78D 5IXBA 5KCHA 1YI2Q 5M9OA 1UJYA 4XU1A 2RPNA 1D1AA 1KHIA 4M75G 4OB2B 5GAOl 5GAMg 5LJ5g 2A37A 4EMHA 3M0UA 3A8HB 4LDVA 3REAB 4D6WA 1TG0A 1JJ2P 2E6NA 3H8ZA 2EJ9A 3RR6A 5GMKl 3CCJA 5KYYB 4HCZA 1ZBJA 2MMPA 3CCQQ 1ABQA 4IUVA 2KGTA 1K9MU 3NFCA 2MPXC 4FT4A 5FLXE 5KYXB 2R57A 1MUZA 4J9BA 2FZCB 5EC7A 4PJOD 4PFOA 2FZKB 2QASA 1KQSS 4OMLA 2RMOA 1SSFA 4F7UG 4BUGA 2DMOA 1M90C 2XI9A 5J3BA 3X26B 3EH2A 2LJ3A 5GANj 2YUNA 4M7AC 3VS4A 4QQ6A 3OB9A 2EYXA 2EYYA 1H92A 2E5KA 1VYUA 4LE9A 4CC2A 1ZLMA 1QKXA 2J6OA 4C0DB 1VQ8Q 2ABLA 3NMZC 4HA8A 1O75A 4OF1A 4OVAA 2QXFA 1K8AU 3M0PA 2JS2A 2QGGA 2MYSA 1M4ZA 3DLLA 2JM8A 1JB0E 2M0OA 1X6GA 1N9RA 3PIPA 1KQSP 4JRKA 1TU0B 4C0DC 3G7ZA 1M1KC 3VS6A 1KK7A 4HVUA 2K3XA 2DL7A 2H3EB 1PCXA 1K0XA 4QW2A 2J05A 3JB9I 1D0ZA 3JCMf 2HSEB 2YUQA 4D8KA 4M7DA 4IIMA 1RLQC 3REBB 2HKQB 2E5QA 3H6ZA 1BI2A 1GBQA 2AZVA 2DL8A 4E7KA 1VQ6A 4C8QC 3DKMA 4PJNA 1SHGA 3MP8A 2B86A 4M75F 4QKUA 1ZHIA 2EGAA 3VUBA 2DK3A 3BDLA 4FW1A 2YSQA 2LQKA 1BI0A 2E1HA 9ATCB 4JJNK 5CKFA 3HRTA 3PT9A 4RTTA 4M7AG 2EQUA 3MEUA 3TSZA 2EWNA 4RG2A 1B34B 1WJRA 4M7DF 2A0FB 2JM9A 2GF7A 4PFPA 2JOYA 3TSWA 3UPUA 1LOJA 1RLPC 2OX7A 2Y4YA 2DPPB 1R0CB 1OZ3A 2L3QA 3QDFA 4OMFB 1IHVA 2DD4A 2DL3A 3UF4A 4A4GA 1W2BA 1HK9A 1YWPA 2NUTA 3RKWA 1K9MR 1YWOA 1YJ9Q 2OTLT 1T0HA 4F7UF 2F69A 2BIVA 3V7CA 4M75D 5FU7B 3G71T 1Z9ZA 2AT1B 1EX4A 2CP5A 3EG3A 2EKHA 3CCUQ 4J8OA 5GAOm 1M2VB 3EHRA 1MGQA 1AWJA 5FU7C 3TEEA 3JB9H 4M77B 1VQNQ 3CC2T 3QPHA 1M3CA 3I56A 2HBPA 5GAN6 5GMKm 5KYYA 4EIKA 2EQKA 3L2RA 2BUDA 5AYFA 2ED1A 3EG9B 1Q82U 4C8QG 4JRQA 2FZGB 3X28B 2RI3A 2JUFA 2FRWA 2DXBA 2X9HA 5CKBA 2JZ2A 1VQ4T 5GAMe 2PZ1A 5LJ5e 1ZUUA 1OU8A 4RTVA 5KYXA 3JSCA 1OEBA 1JXOA 2V8IA 3HL8A 3OYKA 1K76A 1S72T 3QZ5B 3UA6A 2FG0A 3A1PA 3UWNA 3OS1A 3I5SA 3OYNA 4Y28E 3VU3C 2H3JA 3OQ5A 3JCMW 1YHQT 1E7OA 3MO8A 4HVVA 5GAMh 5LJ5h 2BZXA 2W0ZA 2FPEA 2VYTA 3FRNA 4OMNA 2FPDA 5LL6S 3V8KA 1D09B 3HSBA 1OYXA 1WA7A 2HQEA 3CCVA 1OU9A 2F5KA 2GCXA 3LGLA 4P5NA 3O5ZA 2XDBA 4OGCA 3M4YA 2K7AA 4J9CA 5GMKj 4FSXA 1C6VX 1OX9A 5GAOr 3CCJT 2MI6A 1SKUB 2L8DA 2PVDB 1X6BA 2NLUA 2DEUA 3BFMA 2YLBA 2KE9A 2AHJB 3I5RA 4A4FA 1M90R 4JUVA 4M78C 1PSFA 4YTLA 1SG5A 1WIEA 4LDYA 3PTAA 2XG8D 1A0NB 1E6HA 2LNVA 2YUOA 3CCRQ 1KD1C 3INZA 1WYXA 3MP6A 4A54A 3CC4A 1TWBA 4FYXB 1VQ7A 3L1AA 1RI0A 3JRZA 2ROTA 4RMOA 2ZAEA 1MV3A 4M7AD 2RNAA 2PUOB 1RI9A 1B7TA 1Y07A 3P8HA 3RDVA 2FRYA 4PJOB 3LH0A 3PVQA 2V1RA 4OP0A 3VRZA 2X4XA 3O8VA 1WXUA 2LQNA 2DL4A 1M1KR 2KRSA 3QUIA 1B34A 4DQ2A 2IVWA 4C8QF 4PJOC 6AT1B 1AZGB 2E41A 1R0BG 4EMKB 1YJWA 2V26A 2QAZA 3F70A 3MEVA 1OPLA 2LVMA 4B9XA 2D6FA 1H8KA 7AT1B 2LJ1A 4MMKA 3OSVA 5J26A 3VS2A 4HT9A 5HCKA 3EFOB 1KFZA 3PIOA 4EMKC 2LDMA 5GANe 3FC3A 3FIFA 4HCCA 3M5AA 2LJ0A 3EG2A 2VKNA 3JB9G 1UGVA 1N27A 3WVEB 8AT1B 2PNIA 2DM1A 5GAOn 4ATOA 4TVRA 2XU8A 4LXCA 5CIUA 2A08A 1SPKA 4L59A 3URGA 1M2VA 5KE2A 2DILA 4BI3A 4RG8A 3H41A 2OTLQ 1VQMQ 4M78G 1Q81U 2D1XA 1VQ5Q 3TCJA 2LQ8A 3GBQA 3OMGA 4M77A 1BCMA 5GAN3 3FEOA 2LZ6B 4C8QD 4JJDA 2L3RA 1VQ6T 2KY9A 1JJ2A 1QVPA 2M02A 5GANh 2VV5A 2DIQA 1UDLA 5GAN2 2OTJQ 2O88A 3CC2Q 4RTZA 1U3OA 1M1FA 2VB6A 1H3HA 4PK4A 5GAN5 2FHDA 1M3AA 3RKYA 1K9AA 4M77F 2V8JA 2XK0A 2CP0A 3HRUA 1OQKA 3HFNA 3EH1A 2FL7A 1X27A 2E10A 2AKLA 2DJZA 2RQRA 2AIRB 4FYVB 5LJ3j 3DLMA 4CC4B 3NTHA 2J6FA 1VA7A 3ZFJA 1BIBA 4PJJA 5CAIA 1WJSA 2P0QA 3RMSA 2DO3A 4RTWA 4AFUC 5HKCA 1YNZA 3GP8A 2M1HA 3SD4A 2M51A 1ZSZB 1ACMB 3I56T 4M75B 5FRMA 3CBMA 3RIRA 1BK2A 2RQVA 2KBTA 3JB9J 2BKDN 3J7AF 4CRIA 2KMTA 2CT3A 1WXTA 1IHWA 2EGCA 1QP3A 1RAIB 3ME9A 1ZSZC 2JVVA 4B6MA 5C0MA 1JXMA 2JW4A 4ZNXA 3CMEA 1HYOA 1K9MC 3CPFA 4IUPA 4BD3A 1VQ9A 2LNHB 4Z89A 1WXBA 1OOTA 5ECAA 4J9FA 4X9DA 2ZPGB 1YJNA 5GMKi 4NL2A 1FMWA 3BY7A 3U23A 4WCIA 3X25B 3HTRA 2SEMA 4M78F 3PMTA 2QEXA 2DEQA 4F7UB 2CH4W 4X34A 1CSKA 2NUPB 4K11A 5DM7R 3CCEQ 1Y71A 1VQ4A 5J39A 2L5QA 1H3ZA 5KE3A 2B8AA 2Y4XA 1S72A 4FYWB 3CCVT 2EVRA 4NS5A 5LJ3g 2EFIA 2RM4A 3FJ5A 3HFOA 1YP5A 1K8AC 3N5BB 3GNFB 3JB9D 4JDSA 4RKUE 4XU0A 3OYAA 1NYGA 1YITA 1D3BB 1AZEA 4GBQA 2E65A 1NM7A 3EFOA 4N4IA 2COYA 4C5HA 2YLCA 3G4SA 2QK0A 4PJOF 1RL2A 1HSQA 1QMCA 1G3SA 2KI7A 3CD6A 2RB6A 1NJIU 2IG0A 2EW3A 1AD5A 2HKNA 3TU4K 4DBRA 2DTHA 2X3XD 3SEMA 2K5LA 1G83A 2QQSA 3LW5E 3VYGA 2XDPA 4XTYA 3EAEA 3A5ZB 4HXJA 2J7IA 4ME7A 5GMKe 2D8JA 1WHJA 3CPWP 1B3QA 1XJWB 3CC4T 1VQKQ 1ZA2B 3OYYA 5C6SA 1VQ7T 3A8OB 3CCMQ 1VOMA 1VQPQ 2RJDA 2YDLA 1EZZB 4C5GA 3I55Q 3DB3A 3META 3CCSQ 1TTHB 5KYWB 3MEWA 4ZN1A 3BDUA 2MWOA 4KGXB 1OZ2A 4OMPA 3J80E 1HD3A 5GMKh 4D8DA 4M7AB 3I35A 1VQOA 4FT2A 5GAMd 1YJWT 1I1JA 5LJ5d 1RAGB 2DBMA 3P8DA 2L3SA 2DTIA 4LUEA 1UG1A 3OW2S 2GGRA 3E1SA 4J9IA 2KYBA 2IPOB 1GXIE 3C0CA 1M5Q1 2QA4T 2K3YA 4ZTJA 5HK0A 2DNUA 1CKBA 3CMAA 4C92E 5CQXA 3X20B 2DRMA 1XNIA 2PQWA 2FO0A 3MHXA 3V8JA 3VS3A 2F5TX 5GJWB 4XTWA 5KCOA 4KGVB 2CH4A 4N0AC 1ZSZA 2K9GA 4E7IA 1PD0A 4M75A 4X1VA 3TREA 3KXTA 2DD5A 4DOVA 3OS5A 1SHFA 5DY9A 1O9SA 2RJCA 1QWFA 3OW2P 1AWWA 4GLMA 2DIGA 1YN8A 3EG1A 3FJPA 2RI5A 2M9UA 3RBBB 3JV3A 2BTTA 2X51A 1QW1A 4C8QB 5I22A 3M0TA 2KXCA 1U5SA 2ZPBB 4FW2A 2GQIA 2BZYA 2VXEA 1QVFA 3JCMc 1AT1B 1TS9A 1GFCA 3EHQA 2JMCA 2EGEA 3VS7A 3FDRA 2VWFA 1I81A 1PHTA 4ZN3A 4GLKA 3HHTB 5KYNA 4F7UA 1NLPC 2NUPA 5CKDA 2G3RA 3CC7T 5GANg 3HPWA 2DYBA 2ZPHB 1IGQA 1R77A 4QQDA 2QG9B 1G2BA 4A4KA 3OSSC 1QCNA 5A2QE 4BE0A 3SFMA 2L3PA 1G5VA 4EPCA 3HP9A 1IREB 1NEGA 2SRCA 1C0MA 3M53A 1YCYA 5LJ3e 4BB7A 1G3WA 3CMET 3QDRB 4N4HA 2FB7A 3A8MB 2KT8A 3RKXA 3CQTA 4KRTA 1VQ9T 2LRQA 2YRDA 2KT1A 2YUPA 4OGEA 2GTJA 1I8FA 1YJNT 2VASA 3SHWA 2MIOA 4JZ3A 4JLIA 2PU9B 5DLQE 4C5IA 4RTXA 2QTXA 2JMAA 5LJ3h 1WX6A 2QEXT 1Y7XA 4L6V5 5FRNA 1K8AR 1PNJA 2LX7A 1W70A 1ARKA 3ER0A 3HKSA 4X9CA 1U1TA 2KAFA 3P8BB 2OAUA 4M7AA 3OYIA 3M0RA 2R5AA 3QXEB 5HK3A 1KQ1A 4MDXA 1IGUA 1OI1A 2KNBB 2KYMA 3EFRA 1PSEA 4XK8E 3LWHA 1WHMA 3C4SA 2ATCB 1YITT 1D0XA 3OYHA 1IRXA 4IUQA 3OYFA 4AFZC 4AMCA 3G4ST 2KR3A 1YJWQ 2LTOA 4R56A 3CD6T 2P0KA 5HY6A 4QVZA 5FU6B 5GAOq 4C0GA 2CREA 3DB4A 2BE9B 1BBZA 1MHNA 1SRMA 2QTVA 2GNCA 2RK2A 4FU6A 3UA7A 4C92C 4BI4A 4M7AF 4NL3A 2CP3A 1KC8U 3EGXB 5I21A 4R0KA 4J9DA 5FWCA 1K73U 4LD6A 2I0NA 4NOYA 3V7SA 1XTDA 1OV3A 3E2UA 5FU6C 2G6FX 2DYIA 2E4HA 4M78B 2EYWA 1M27C 1YJ9A 4J6YA 5CKEA 3JCMQ 4Z02A 1Q7YU 2RA2A 2KEAA 3EGUA 1X6OA 2XDDA 4HCKA 5GAMf 4C8QA 5LJ5f 3M54A 1N8RU 4LDWA 3ZL7C 3M9QA 2CP2A 2K2VA 2D8HA 5D6WA 1GFDA 4E7LA 2ED0A 2YXYA 4M75E 1LCKA 1NPPA 1QVFP 1VQOT 1KJWA 2NUZA 4J7FA 1XQHA 4ZTFA 1RAHB 1FYNA 2HL5C 3JAME 4KH1B 3CXCS 3H9NA 4BACA 4N4GA 4FYYB 1GRIA 2HD0A 4M7DE 3GLXA 2M16A 3CCLT 3CMAT 1KG1A 4PFZA 3R6NA 2VGNA 4DEYA 2D9TA 1X01A 2E64A 1X75C 1M30A 3A8GB 3QBYA 2COWA 3NPFA 5A0DA 4R55A 1MNEA 1Q82R 3FLGA 1QVGP 4XU3A 1YIJT 2MCNA 4F7UE 4C92G 2KQWA 2R5MA 2DX1A 3LLRA 3OBWA 2F2VA 1JBMA 3QYHB 2DXTA 3QSUA 4OB1B 1Q86U 2L89A 2JTMA 3QHSA 3CXCP 2AKKA 4FSSA 2QA4A 2BE7D 5I11A 3R6OA 3KFVA 2EQIA 2VC8A 2YWWA 3QZ9B 4AT1B 3UDCA 3QKJA 1EFNA 1V29B 3AHUA 3OYEA 4WTOB 2O4XB 4J7IA 3VYHB 2RHIA 4CC3A 2RJEA 1P92A 1AVZC 4EMGA 3LH5A 3MP1A 2K57A 1B07A 3IQLA 1AWOA 3G71Q 1BB9A 2O9SA 1U8RA 4LN2A 3CPWA 1N6AA 2O2OA 1UE9A 2D0QB 3OYLA 2GFUA 3CMEQ 1UFFA 3MJXA 3MKDA 1M8VA 3EG9A 3NGPA 2F2XA 3TVTA 3JCMg 5FROA 4FL6A 4ELZC 3CCQT 1G8XA 4MZMA 2JS0A 1VQ9Q 3VS1A 8ATCB 1VIFA 2HSPA 4II1A 1GL5A 4C0FA 3CCRA 3JCMJ 2MF2A 4KT0E 3VKIA 5AT1B 4BY6C 5A0GA 5I2SA 1ZUYA 1VQ4Q 4Z88A 5L8RE 1X43A 4ESRA 3KUFA 1U06A 2EJFA 1JQQA 2X3WD 5I2MA 1S72Q 1WGSA 3JCMX 3OYBA 2KDSA 4KUIA 1PKSA 1IB8A 2CUBA 2LT1A 3QWYA 2PUKB 4DA4A 3CC7A 3M4GA 2VVKA 2JJ9A 1VQ8T 1RUWA 2D0NA 4JJCA 1PM3A 1YHQQ 3H0FA 2EQMA 1Y57A 4JLGA 2QGFB 3L42A 1MNDA 2DZCA 2RF0A 3PNWC 2QDYB 3EGXA 2P84A 1OPKA 2E70A 1WNLA 4LNPA 3L2ZA 1YCSB 2MAMA 2QDLA 3RNJA 1ZX6A 2PVOB 4M78A 4E47A 2CKKA 1OULA 1NBEB 1UHCA 1SSHA 4RTUA 3OW2A 2RHYA 5IXFA 1VYTA 4XQ3A 2HAXA 4C92F 1T3LA 1TUDA 2GTOA 3CCJQ 3S3MA 3JB9F 2PTKA 2HBWA 3QJYA 1VQMA 1VQ5A 5CKHA 4MMLA 2VGMA 2E12A 2HNIA 4MZPA 4Z8AA 2JXBA 2ROLA 1D1BA 5GAMj 1M1GA 2HL3A 2CSIA 2A36A 2DAQA 2DZ9A 1UGQB 5D6XA 1F1BB 4RCCA 1KIKA 3GPLA 1UEBA 1D0YA 4PJOA 2CS7A 2YHTA 4J6XA 2ZPIB 4C8QE 1N5ZA 1M3BA 2M0YA 2DETA 1Q81R 4M7DC 2JN0A 3FB9A 5GAN4 4OB0B 4C92D 3OYDA 1TH7A 3RMQA 4EMKA 3CPWS 4JRPA 3CMAQ 4ORZA 3PMIA 1PWTA 1RAAB 5FW9A 1YJ9T 3ZBDA 1Y96B 2RO0A 3OA6A 3H0HA 2HQHA 4E7HA 1WHHA 2X4YA 4KUDK 5D7UA 3VS0A 2CYZB 3NTKA 2O4XA 3I9QA 1QCOA 1GCPA 3VRYA 3OYGA 2E3IA 2E3HA 1RACB 2COZA 2NWMA 3MPUB 1Z9QA 4ZGJB 1WDXA 1G3TA 2BZ8A 3LGFA 1RAEB 2KXDA 1JRIA 3G6EA 4IKFA 2X35A 3L2VA 4ZGEB 3SWNB 3JCMP 1FMVA 1OX8A 1ZBXA 1QCFA 2K79A 1VQ6Q 3MCAB 1FMKA 2EYZA 2DXCA 5CQYA 5CVIA 1BU1A 4M77E 2R58A 2RJFA 3E9GA 3SWNC 1V1CA 2QQBA 5GAN8 4M7DG 1V76A 2A28A 2O31A 1PG5B 2OAWA 1GCQC 1LNXA 3BW1A 3JCMe 2X4JA 2ZPEB 1IO6A 1KHCA 2A3LA 2DA9A 3V8LA 3HRSA 3CEYA 4FM4B 2CP6A 4O6JA 4IURA 3CCEA 1WZOA 3CCLA 3M56A 1K1ZA 5A0LA 2YRCA 1VQLA 2FVUA 1QLYA 4XTZA 2C0TA 1TOVA 5CO7A 1UHFA 2WSEE 4HKEA 4PJMA 3M58A 3JCMh 4JJBA 3T9NA 1CKAA 4UC4A
chains in the Genus database with same CATH topology
1PNJA 2LX7A 1H8KA 1I0CA 1M8MA 2LJ1A 1W70A 3VS2A 1ARKA 1QKWA 2P4RA 5HCKA 1KFZA 2DL5A 2LJ0A 3EG2A 2VKNA 1UGVA 2YT6A 3PE0A 3M0RA 4F17A 2PNIA 2DM1A 3QWXX 2KNBB 2KYMA 2A08A 4DEXA 4QT7A 1SPKA 1GBRA 2DILA 1QWEA 3H41A 2D1XA 3GBQA 2J06A 2LZ6B 4JJDA 4AFZC 1SRLA 2KR3A 4J9EA 2W10A 1UDLA 2LP5A 1ABOA 2CREA 1BBZA 1SRMA 2EBPA 4OMOA 3UA7A 2GNCA 2V1QA 2IIMA 2C0IA 2RQUA 2EPDA 4F14A 2O88A 2K3BA 2DBKA 4R0KA 1X2QA 4J9DA 4RTZA 5FWCA 2I0NA 1U3OA 2ESWA 2DF6A 1OV3A 2G6FX 1NG2A 1H3HA 2EYWA 1M27C 2KROA 1Y0MA 1XOVA 2KRMA 1M3AA 5IXBA 1K9AA 1UJYA 2RPNA 2KEAA 3EGUA 2MOXA 4HCKA 5IHIA 2A37A 4LUDA 1X27A 4OMMA 3ZL7C 2AKLA 2D8HA 2RQRA 3M0UA 3REAB 1GFDA 1I07A 1TG0A 2ED0A 1LCKA 4CC4B 1KJWA 1MV0B 1ZBJA 2NUZA 2LCSA 2J6FA 1VA7A 1ABQA 1FYNA 4RTWA 2KGTA 4AFUC 1YNZA 1JU5C 4AG2C 1GRIA 2M51A 1MUZA 4J9BA 5EC7A 3R6NA 1BK2A 2DE0X 2RQVA 2KBTA 4DEYA 4OMLA 2RMOA 2RN8A 2CT3A 1WXTA 2EGCA 2DMOA 1M30A 2JTEA 4CC7A 1UJ0A 4RTYA 1JXMA 2JW4A 4ZNXA 3NPFA 2LJ3A 2YUNA 4AFSC 2MCNA 3VS4A 2JT4A 1GCQA 2DX1A 2F2VA 2CT4A 4OMQA 2EYXA 2EYYA 1H92A 2E5KA 1VYUA 2LNHB 4Z89A 4LE9A 4CC2A 1WXBA 1QKXA 1ZLMA 2AKKA 1OOTA 2J6OA 4FSSA 5ECAA 5I11A 4J9FA 2ABLA 3KFVA 3THKA 2EQIA 3NMZC 3M0PA 3U23A 4WCIA 1EFNA 2JS2A 2SEMA 3PVLA 2JM8A 1X6GA 4JZ4A 2CH4W 2K2MA 1CSKA 4CC3A 4K11A 4RUGA 1X69A 1AVZC 2HDAA 3LH5A 3VS6A 1B07A 3IQLA 1AWOA 2F2WA 4HVUA 1BB9A 2O9SA 3VS5A 1W1FA 2DL7A 4LN2A 2O2OA 1UE9A 2RQWA 2EVRA 1K0XA 5IHKA 3FJ5A 1UFFA 5FWBA 2J05A 3NGPA 1YP5A 2L0AA 2F2XA 3TVTA 2OI3A 2JS0A 2YUQA 4D8KA 3VS1A 4A63B 4IIMA 1NYGA 1RLQC 3REBB 1AZEA 4GBQA 1NM7A 2HSPA 4J9HA 1GBQA 2AZVA 3UATA 2DL8A 1GL5A 1HSQA 1SHGA 2B86A 1AWXA 2EGAA 4E6RA 1E6GA 1ZUYA 2EW3A 2YSQA 4Z88A 1AD5A 1X43A 4ESRA 1U06A 2OJ2A 2ENMA 2X3XD 1WFWA 3SEMA 1JQQA 2X3WD 1G83A 4RTTA 2FEIA 4HXJA 3TSZA 2J7IA 2D8JA 1PKTA 1PKSA 1B3QA 2CUBA 3QWYA 2JM9A 3TSWA 2VVKA 2CSQA 2YDLA 1RLPC 1RUWA 5IHNA 2D0NA 4JJCA 2L2PA 3H0FA 1Y57A 2DVJA 2L3QA 2RF0A 4Y92A 2DL3A 3UF4A 3M0SA 1HJDA 4M4ZA 1YWPA 1OPKA 4LNPA 1YWOA 1J3TA 1T0HA 1YCSB 3M0QA 1S1NA 2QDLA 4OMPA 3RNJA 1ZX6A 1HD3A 4D8DA 1Z9ZA 3I35A 1UHCA 1SSHA 2CDTA 4RTUA 1I1JA 1T3SA 2DBMA 3EG3A 5IXFA 2EKHA 1VYTA 2L3SA 1T3LA 2XMFA 3EHRA 5GJVB 4LUEA 1TUDA 1AEYA 1UG1A 2GTOA 1AWJA 2LMJA 2GGRA 4J9IA 2KYBA 3C0CA 1M3CA 2DNUA 2PTKA 2HBWA 1CKBA 1ZSGA 4EIKA 4Z8AA 2JXBA 2RQTA 2ROLA 2ED1A 2CSIA 3ULRB 1NEBA 2A36A 2DRMA 2AZSA 2FO0A 2FRWA 1JO8A 2KRNA 5IH2A 4HVWA 3VS3A 1PRLC 2PZ1A 5GJWB 1KIKA 1ZUUA 4RTVA 2CH4A 2K9GA 1OEBA 1JXOA 1N5ZA 1X2KA 2LQWA 4X1VA 1K76A 1M3BA 2M0YA 1SHFA 3UA6A 1KSWA 1UUEA 1QWFA 1K0SA 2FG0A 1AWWA 4GLMA 3I5SA 2DRKA 4AFQC 1YN8A 3EG1A 3RBBB 1E7OA 3JV3A 2BTTA 2HCKA 4HVVA 5L23A 1WI7A 1WLPB 5I22A 1VYVA 3M0TA 2KXCA 1U5SA 2BZXA 4ORZA 1TUCA 2GQIA 2BZYA 1PWTA 2W0ZA 5FW9A 2HEQA 2FPEA 4OMNA 2FPDA 1GFCA 3H0HA 3EHQA 2JMCA 2O9VA 1WA7A 2EGEA 1K4US 3VS7A 1NYFA 2VWFA 1PHTA 4J9GA 3VS0A 3O5ZA 3I9QA 1GCPA 3VRYA 2K7AA 1NLPC 1ZUKA 4J9CA 3EG0A 2NWMA 1Z9QA 1SEMA 1WDXA 2J6KA 2BZ8A 2DYBA 2H8HA 1NLOC 1X6BA 2KXDA 2GBQA 2KE9A 3I5RA 3NHNA 2DLPA 1G2BA 1JEGA 1PRMC 1WIEA 1QCFA 1A0NB 1W6XA 4IIOA 2K79A 1E6HA 2L3PA 2YUOA 1NEGA 2SRCA 1FMKA 2CUDA 2EYZA 3H0IA 1BU1A 1V1CA 1WYXA 2K6DA 1T0JA 2A28A 2O31A 2OAWA 1GCQC 2ROTA 2AK5A 1MV3A 2RNAA 1RI9A 1IO6A 2DA9A 4JPBW 2KT8A 2FRYA 1AOJA 3PVQA 2V1RA 3CQTA 3VRZA 4KRTA 1WXUA 2KT1A 2YUPA 2LQNA 2DL4A 2FPFA 4AG1C 2KRSA 2GTJA 1UTIA 2C0OA 1K1ZA 1UECA 2DJQA 3SHWA 2MIOA 4JZ3A 1QLYA 2ECZA 1AZGB 2C0TA 3A98A 4RTXA 2JMAA 1WX6A 1UHFA 1OPLA 4JJBA 4F16A 1CKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PNJ A;  2LX7 A;  1H8K A;  1I0C A;  1M8M A;  2LJ1 A;  1W70 A;  3VS2 A;  1ARK A;  1QKW A;  2P4R A;  5HCK A;  1KFZ A;  2DL5 A;  2LJ0 A;  3EG2 A;  2VKN A;  1UGV A;  2YT6 A;  3PE0 A;  3M0R A;  4F17 A;  2PNI A;  2DM1 A;  3QWX X;  2KNB B;  2KYM A;  2A08 A;  4DEX A;  4QT7 A;  1SPK A;  1GBR A;  2DIL A;  1QWE A;  3H41 A;  2D1X A;  3GBQ A;  2J06 A;  2LZ6 B;  4JJD A;  4AFZ C;  1SRL A;  2KR3 A;  4J9E A;  2W10 A;  1UDL A;  2LP5 A;  1ABO A;  2CRE A;  1BBZ A;  1SRM A;  2EBP A;  4OMO A;  3UA7 A;  2GNC A;  2V1Q A;  2IIM A;  2C0I A;  2RQU A;  2EPD A;  4F14 A;  2O88 A;  2K3B A;  2DBK A;  4R0K A;  1X2Q A;  4J9D A;  4RTZ A;  5FWC A;  2I0N A;  1U3O A;  2ESW A;  2DF6 A;  1OV3 A;  2G6F X;  1NG2 A;  1H3H A;  2EYW A;  1M27 C;  2KRO A;  1Y0M A;  1XOV A;  2KRM A;  1M3A A;  5IXB A;  1K9A A;  1UJY A;  2RPN A;  2KEA A;  3EGU A;  2MOX A;  4HCK A;  5IHI A;  2A37 A;  4LUD A;  1X27 A;  4OMM A;  3ZL7 C;  2AKL A;  2D8H A;  2RQR A;  3M0U A;  3REA B;  1GFD A;  1I07 A;  1TG0 A;  2ED0 A;  1LCK A;  4CC4 B;  1KJW A;  1MV0 B;  1ZBJ A;  2NUZ A;  2LCS A;  2J6F A;  1VA7 A;  1ABQ A;  1FYN A;  4RTW A;  2KGT A;  4AFU C;  1YNZ A;  1JU5 C;  4AG2 C;  1GRI A;  2M51 A;  1MUZ A;  4J9B A;  5EC7 A;  3R6N A;  1BK2 A;  2DE0 X;  2RQV A;  2KBT A;  4DEY A;  4OML A;  2RMO A;  2RN8 A;  2CT3 A;  1WXT A;  2EGC A;  2DMO A;  1M30 A;  2JTE A;  4CC7 A;  1UJ0 A;  4RTY A;  1JXM A;  2JW4 A;  4ZNX A;  3NPF A;  2LJ3 A;  2YUN A;  4AFS C;  2MCN A;  3VS4 A;  2JT4 A;  1GCQ A;  2DX1 A;  2F2V A;  2CT4 A;  4OMQ A;  2EYX A;  2EYY A;  1H92 A;  2E5K A;  1VYU A;  2LNH B;  4Z89 A;  4LE9 A;  4CC2 A;  1WXB A;  1QKX A;  1ZLM A;  2AKK A;  1OOT A;  2J6O A;  4FSS A;  5ECA A;  5I11 A;  4J9F A;  2ABL A;  3KFV A;  3THK A;  2EQI A;  3NMZ C;  3M0P A;  3U23 A;  4WCI A;  1EFN A;  2JS2 A;  2SEM A;  3PVL A;  2JM8 A;  1X6G A;  4JZ4 A;  2CH4 W;  2K2M A;  1CSK A;  4CC3 A;  4K11 A;  4RUG A;  1X69 A;  1AVZ C;  2HDA A;  3LH5 A;  3VS6 A;  1B07 A;  3IQL A;  1AWO A;  2F2W A;  4HVU A;  1BB9 A;  2O9S A;  3VS5 A;  1W1F A;  2DL7 A;  4LN2 A;  2O2O A;  1UE9 A;  2RQW A;  2EVR A;  1K0X A;  5IHK A;  3FJ5 A;  1UFF A;  5FWB A;  2J05 A;  3NGP A;  1YP5 A;  2L0A A;  2F2X A;  3TVT A;  2OI3 A;  2JS0 A;  2YUQ A;  4D8K A;  3VS1 A;  4A63 B;  4IIM A;  1NYG A;  1RLQ C;  3REB B;  1AZE A;  4GBQ A;  1NM7 A;  2HSP A;  4J9H A;  1GBQ A;  2AZV A;  3UAT A;  2DL8 A;  1GL5 A;  1HSQ A;  1SHG A;  2B86 A;  1AWX A;  2EGA A;  4E6R A;  1E6G A;  1ZUY A;  2EW3 A;  2YSQ A;  4Z88 A;  1AD5 A;  1X43 A;  4ESR A;  1U06 A;  2OJ2 A;  2ENM A;  2X3X D;  1WFW A;  3SEM A;  1JQQ A;  2X3W D;  1G83 A;  4RTT A;  2FEI A;  4HXJ A;  3TSZ A;  2J7I A;  2D8J A;  1PKT A;  1PKS A;  1B3Q A;  2CUB A;  3QWY A;  2JM9 A;  3TSW A;  2VVK A;  2CSQ A;  2YDL A;  1RLP C;  1RUW A;  5IHN A;  2D0N A;  4JJC A;  2L2P A;  3H0F A;  1Y57 A;  2DVJ A;  2L3Q A;  2RF0 A;  4Y92 A;  2DL3 A;  3UF4 A;  3M0S A;  1HJD A;  4M4Z A;  1YWP A;  1OPK A;  4LNP A;  1YWO A;  1J3T A;  1T0H A;  1YCS B;  3M0Q A;  1S1N A;  2QDL A;  4OMP A;  3RNJ A;  1ZX6 A;  1HD3 A;  4D8D A;  1Z9Z A;  3I35 A;  1UHC A;  1SSH A;  2CDT A;  4RTU A;  1I1J A;  1T3S A;  2DBM A;  3EG3 A;  5IXF A;  2EKH A;  1VYT A;  2L3S A;  1T3L A;  2XMF A;  3EHR A;  5GJV B;  4LUE A;  1TUD A;  1AEY A;  1UG1 A;  2GTO A;  1AWJ A;  2LMJ A;  2GGR A;  4J9I A;  2KYB A;  3C0C A;  1M3C A;  2DNU A;  2PTK A;  2HBW A;  1CKB A;  1ZSG A;  4EIK A;  4Z8A A;  2JXB A;  2RQT A;  2ROL A;  2ED1 A;  2CSI A;  3ULR B;  1NEB A;  2A36 A;  2DRM A;  2AZS A;  2FO0 A;  2FRW A;  1JO8 A;  2KRN A;  5IH2 A;  4HVW A;  3VS3 A;  1PRL C;  2PZ1 A;  5GJW B;  1KIK A;  1ZUU A;  4RTV A;  2CH4 A;  2K9G A;  1OEB A;  1JXO A;  1N5Z A;  1X2K A;  2LQW A;  4X1V A;  1K76 A;  1M3B A;  2M0Y A;  1SHF A;  3UA6 A;  1KSW A;  1UUE A;  1QWF A;  1K0S A;  2FG0 A;  1AWW A;  4GLM A;  3I5S A;  2DRK A;  4AFQ C;  1YN8 A;  3EG1 A;  3RBB B;  1E7O A;  3JV3 A;  2BTT A;  2HCK A;  4HVV A;  5L23 A;  1WI7 A;  1WLP B;  5I22 A;  1VYV A;  3M0T A;  2KXC A;  1U5S A;  2BZX A;  4ORZ A;  1TUC A;  2GQI A;  2BZY A;  1PWT A;  2W0Z A;  5FW9 A;  2HEQ A;  2FPE A;  4OMN A;  2FPD A;  1GFC A;  3H0H A;  3EHQ A;  2JMC A;  2O9V A;  1WA7 A;  2EGE A;  1K4U S;  3VS7 A;  1NYF A;  2VWF A;  1PHT A;  4J9G A;  3VS0 A;  3O5Z A;  3I9Q A;  1GCP A;  3VRY A;  2K7A A;  1NLP C;  1ZUK A;  4J9C A;  3EG0 A;  2NWM A;  1Z9Q A;  1SEM A;  1WDX A;  2J6K A;  2BZ8 A;  2DYB A;  2H8H A;  1NLO C;  1X6B A;  2KXD A;  2GBQ A;  2KE9 A;  3I5R A;  3NHN A;  2DLP A;  1G2B A;  1JEG A;  1PRM C;  1WIE A;  1QCF A;  1A0N B;  1W6X A;  4IIO A;  2K79 A;  1E6H A;  2L3P A;  2YUO A;  1NEG A;  2SRC A;  1FMK A;  2CUD A;  2EYZ A;  3H0I A;  1BU1 A;  1V1C A;  1WYX A;  2K6D A;  1T0J A;  2A28 A;  2O31 A;  2OAW A;  1GCQ C;  2ROT A;  2AK5 A;  1MV3 A;  2RNA A;  1RI9 A;  1IO6 A;  2DA9 A;  4JPB W;  2KT8 A;  2FRY A;  1AOJ A;  3PVQ A;  2V1R A;  3CQT A;  3VRZ A;  4KRT A;  1WXU A;  2KT1 A;  2YUP A;  2LQN A;  2DL4 A;  2FPF A;  4AG1 C;  2KRS A;  2GTJ A;  1UTI A;  2C0O A;  1K1Z A;  1UEC A;  2DJQ A;  3SHW A;  2MIO A;  4JZ3 A;  1QLY A;  2ECZ A;  1AZG B;  2C0T A;  3A98 A;  4RTX A;  2JMA A;  1WX6 A;  1UHF A;  1OPL A;  4JJB A;  4F16 A;  1CKA A; 
#chains in the Genus database with same CATH topology
 4WF2 A;  3RUX A;  2MK5 A;  1YIJ A;  1WJQ A;  2DVE A;  3V7R A;  4A4H A;  2YT6 A;  4QVD A;  3PE0 A;  4FIB A;  2KVQ G;  1Q82 C;  4QT7 A;  1GBR A;  3PGG A;  1M2O A;  1QWE A;  3OMC A;  1UGP B;  4XU2 A;  3I56 Q;  1YI2 A;  1TUG B;  4FCY A;  3VV0 A;  3S3N A;  2J06 A;  3QYG B;  2QQR A;  3NTI A;  1SRL A;  3CCR T;  1FXX A;  4PNO A;  4J9E A;  4IUT A;  3OYC A;  4M78 E;  2W10 A;  3L2U A;  2LP5 A;  1VQK A;  3G1J A;  1WQ7 A;  1Q95 G;  3CCM A;  2EYQ A;  1VQP A;  4BE1 A;  4OMO A;  3I55 A;  2V1Q A;  2CZ0 B;  1MMG A;  3CCQ A;  2C0I A;  1NJI R;  2EPD A;  2HMA A;  2K3B A;  3E9F A;  2DBK A;  3CCS A;  2ZPF B;  1R8O B;  4DBF A;  2DF6 A;  3OYM A;  1NG2 A;  1LVK A;  4PLI A;  2LC4 A;  4DBQ A;  4LDX A;  1QP2 A;  1MMN A;  3GNG A;  5GAN 7;  3RER A;  2MOX A;  5KYU B;  5IHI A;  1QVG A;  4LUD A;  4OMM A;  2ZGW A;  1KC8 C;  3L2Q A;  1D3B A;  4PJO E;  2ZCF B;  4BE2 A;  2QI2 A;  1I07 A;  1K73 C;  5IAY A;  3CCV Q;  4OB3 B;  4XAX B;  3CXC A;  1Y96 A;  2CZ1 B;  3LYI A;  1MV0 B;  2LCS A;  4XTV A;  1M90 U;  2FYK A;  2Y90 A;  4Q5W A;  1RAF B;  3GOX A;  4JRI A;  2WAC A;  4Y91 A;  1VQ8 A;  4E7Z A;  1FX7 A;  4DBH A;  3QG1 A;  1Q7Y C;  1JU5 C;  4AG2 C;  4KH0 B;  5GAN d;  5CK9 A;  4PL6 A;  1H64 1;  1VQM T;  1VQ5 T;  4EDU A;  1N9S A;  1N8R C;  2CZ7 B;  3EGD B;  2DE0 X;  2GFA A;  2XIC A;  4KBM B;  2RN8 A;  1VUB A;  2QYZ A;  3EFS A;  1SF9 A;  1UB4 A;  1MMD A;  2JTE A;  3M59 A;  2WSF E;  3AT1 B;  4B9W A;  1UJ0 A;  4CC7 A;  4RTY A;  3SWN A;  1M1K U;  1PC0 A;  1PD1 A;  2OTJ T;  5KYW A;  4AFS C;  2JT4 A;  3S3O A;  1GCQ A;  1I4K 1;  4MZT A;  1BKB A;  4M7D D;  4JS4 A;  2CT4 A;  2XHC A;  3CC4 Q;  4OMQ A;  5IT9 E;  3X24 B;  1VQ7 Q;  1QQJ A;  1WHG A;  1DJ7 B;  3THK A;  2RHZ A;  3QJ6 A;  2I2L A;  4M77 C;  1WQW A;  1D1C A;  3PVL A;  4JZ4 A;  2EIF A;  2K2M A;  4C0Z A;  1AHJ B;  4RUG A;  1X69 A;  2HDA A;  4HCB A;  2F1L A;  3TQ7 P;  2F2W A;  3VS5 A;  1W1F A;  1Q86 C;  4C92 B;  4XTX A;  2RQW A;  1TSF A;  4N0A A;  5IHK A;  5FWB A;  5LJ3 f;  2L0A A;  2OI3 A;  3OS0 A;  3C94 A;  4A63 B;  2RH2 A;  4MDW A;  2QA4 Q;  4J5Y A;  3VJP A;  1UGR B;  3C95 A;  1Q81 C;  4J9H A;  4BI8 B;  3JCM b;  1VIE A;  3UAT A;  1NZ9 A;  4ANJ A;  1AWX A;  3S6W A;  2XID A;  3G6E T;  2V8K A;  5EG2 A;  4E6R A;  1E6G A;  1YFN A;  2K5F A;  2RI2 A;  2OJ2 A;  2ENM A;  4LDU A;  1WFW A;  4O5V A;  3CCU A;  2FEI A;  3UT1 A;  4LD9 K;  2K5I A;  4E7J A;  4V2S A;  2O01 E;  1PKT A;  4E2F B;  1UGS B;  1VQN A;  1RAD B;  2CSQ A;  1QVG S;  4J6W A;  5IHN A;  3LX7 A;  3ZEH A;  2RHX A;  2L2P A;  2DVJ A;  4M77 G;  4Y92 A;  1BIA A;  5KH6 A;  2YRV A;  3M0S A;  1HJD A;  4M4Z A;  2CGH A;  3CCE T;  1J3T A;  3QO3 A;  3M0Q A;  1S1N A;  1VQL T;  3PFS A;  1W2B S;  4ZGD B;  2JNG A;  2LCC A;  2CDT A;  2VXF A;  2DKG A;  1T3S A;  4KUL A;  3OBY A;  4PKC C;  2PVG B;  2XMF A;  5GJV B;  3KBG A;  5IN1 A;  1AEY A;  5KYU A;  2LMJ A;  3JCM V;  2EAY A;  3CC7 Q;  2QQA A;  1M9S A;  1ZSG A;  2RHU A;  2RQT A;  3OYJ A;  2LT4 A;  3ULR B;  1NEB A;  2XKO C;  3GIB A;  2AZS A;  1WPY A;  2HQX A;  3M57 A;  5IH2 A;  1JO8 A;  2KRN A;  2RD1 A;  4HVW A;  1PRL C;  1YI2 T;  1W2B P;  1NPR A;  3SDZ A;  2A7Y A;  2RK1 A;  1X2K A;  2LQW A;  3OS2 A;  3EGD A;  4HT8 A;  1KSW A;  1UUE A;  3C12 A;  1VQK T;  1K0S A;  2DRK A;  4AFQ C;  3CCM T;  1VQP T;  3I55 T;  1W4S A;  4PJL A;  2HCK A;  4CI0 C;  3CCS T;  1TXQ A;  2X4W A;  5L23 A;  1WI7 A;  1WLP B;  1VYV A;  3CBO A;  4BY6 B;  1TUC A;  1C1A A;  1BI3 A;  1YJN Q;  2HEQ A;  1KC8 R;  2QQ9 A;  1G3Y A;  1EIF A;  1FWZ A;  1K73 R;  2O9V A;  2QEX Q;  1K4U S;  4A53 A;  1NYF A;  4J9G A;  2EKO A;  4VUB A;  4ELY C;  1BYM A;  3MEA A;  4QQG A;  2GQV A;  1ZUK A;  2EJG A;  1Q7Y R;  3EG0 A;  1KD1 U;  1SEM A;  1I5O B;  2J6K A;  5GAN f;  4C92 A;  2H8H A;  1N8R R;  3JCM d;  2ZZD A;  3CBP A;  1NLO C;  3GF5 A;  1IXD A;  4PJO G;  3M55 A;  4KGZ B;  1ZA1 B;  2GBQ A;  4M7A E;  2CZ6 B;  3NHN A;  1NJI C;  1YIT Q;  2DLP A;  1JEG A;  1PRM C;  4A4E A;  2KK4 A;  4GY5 A;  5CR2 A;  1W6X A;  4IIO A;  4JS5 A;  3G4S Q;  2CUD A;  1NE8 A;  3CD6 Q;  3H0I A;  1WHK A;  2WSC E;  1LJO A;  5DLO A;  5GAO p;  2CP7 A;  2K6D A;  1YBY A;  1ZQ1 A;  2MWP A;  3E19 A;  1T0J A;  4F04 B;  3VUZ A;  3BE3 A;  2AK5 A;  2NYS A;  4J83 A;  4JPB W;  1KQS A;  4XTU A;  2XD0 A;  1AOJ A;  1BI1 A;  2KSS A;  3Q1J A;  1KQ2 A;  2FPF A;  4AG1 C;  5D6Y A;  2OTL A;  1UTI A;  2C0O A;  2P0P A;  4M77 D;  3G6E Q;  4BDZ A;  1UEC A;  1WHL A;  2DJQ A;  2DFU A;  3G71 A;  2ECZ A;  1Q86 R;  1BCO A;  5LJ5 j;  3A98 A;  4M75 C;  3QII A;  3LWI A;  1HXD A;  4M7D B;  3OY9 A;  2VUB A;  4F16 A;  1I0C A;  1M8M A;  2OTJ A;  2C06 A;  1I5L A;  1IZ6 A;  1QKW A;  2P4R A;  4IUU A;  1VQO Q;  1MMA A;  2DL5 A;  5CCA A;  3CC2 A;  2HZY A;  3L2W A;  4E7S A;  1LPL A;  4F17 A;  3A8L B;  4BDY A;  1QVF S;  3QWX X;  3WXM B;  3J81 E;  4DEX A;  4C5E A;  3D7S B;  2DXU A;  3CCL Q;  3WVD B;  2JTF A;  1VQL Q;  2P4T A;  2E6Z A;  3ASK A;  2LX9 A;  4PLL A;  4QVC A;  1U1S A;  2K4Y A;  2LCL A;  4RCB A;  2DER A;  1ABO A;  1JJ2 S;  2EBP A;  1YIJ Q;  2IIM A;  2EQJ A;  4F14 A;  2RQU A;  3CCU T;  1YHQ A;  2Z0W A;  3SB2 A;  1X2Q A;  2NUT B;  2ESW A;  3RES A;  4DOW A;  5LJ3 d;  1RAB B;  4L5G A;  1VQN T;  1KD1 R;  2KRO A;  1Y0M A;  1XOV A;  2DTO A;  2KRM A;  4M78 D;  5IXB A;  5KCH A;  1YI2 Q;  5M9O A;  1UJY A;  4XU1 A;  2RPN A;  1D1A A;  1KHI A;  4M75 G;  4OB2 B;  5GAO l;  5GAM g;  5LJ5 g;  2A37 A;  4EMH A;  3M0U A;  3A8H B;  4LDV A;  3REA B;  4D6W A;  1TG0 A;  1JJ2 P;  2E6N A;  3H8Z A;  2EJ9 A;  3RR6 A;  5GMK l;  3CCJ A;  5KYY B;  4HCZ A;  1ZBJ A;  2MMP A;  3CCQ Q;  1ABQ A;  4IUV A;  2KGT A;  1K9M U;  3NFC A;  2MPX C;  4FT4 A;  5FLX E;  5KYX B;  2R57 A;  1MUZ A;  4J9B A;  2FZC B;  5EC7 A;  4PJO D;  4PFO A;  2FZK B;  2QAS A;  1KQS S;  4OML A;  2RMO A;  1SSF A;  4F7U G;  4BUG A;  2DMO A;  1M90 C;  2XI9 A;  5J3B A;  3X26 B;  3EH2 A;  2LJ3 A;  5GAN j;  2YUN A;  4M7A C;  3VS4 A;  4QQ6 A;  3OB9 A;  2EYX A;  2EYY A;  1H92 A;  2E5K A;  1VYU A;  4LE9 A;  4CC2 A;  1ZLM A;  1QKX A;  2J6O A;  4C0D B;  1VQ8 Q;  2ABL A;  3NMZ C;  4HA8 A;  1O75 A;  4OF1 A;  4OVA A;  2QXF A;  1K8A U;  3M0P A;  2JS2 A;  2QGG A;  2MYS A;  1M4Z A;  3DLL A;  2JM8 A;  1JB0 E;  2M0O A;  1X6G A;  1N9R A;  3PIP A;  1KQS P;  4JRK A;  1TU0 B;  4C0D C;  3G7Z A;  1M1K C;  3VS6 A;  1KK7 A;  4HVU A;  2K3X A;  2DL7 A;  2H3E B;  1PCX A;  1K0X A;  4QW2 A;  2J05 A;  3JB9 I;  1D0Z A;  3JCM f;  2HSE B;  2YUQ A;  4D8K A;  4M7D A;  4IIM A;  1RLQ C;  3REB B;  2HKQ B;  2E5Q A;  3H6Z A;  1BI2 A;  1GBQ A;  2AZV A;  2DL8 A;  4E7K A;  1VQ6 A;  4C8Q C;  3DKM A;  4PJN A;  1SHG A;  3MP8 A;  2B86 A;  4M75 F;  4QKU A;  1ZHI A;  2EGA A;  3VUB A;  2DK3 A;  3BDL A;  4FW1 A;  2YSQ A;  2LQK A;  1BI0 A;  2E1H A;  9ATC B;  4JJN K;  5CKF A;  3HRT A;  3PT9 A;  4RTT A;  4M7A G;  2EQU A;  3MEU A;  3TSZ A;  2EWN A;  4RG2 A;  1B34 B;  1WJR A;  4M7D F;  2A0F B;  2JM9 A;  2GF7 A;  4PFP A;  2JOY A;  3TSW A;  3UPU A;  1LOJ A;  1RLP C;  2OX7 A;  2Y4Y A;  2DPP B;  1R0C B;  1OZ3 A;  2L3Q A;  3QDF A;  4OMF B;  1IHV A;  2DD4 A;  2DL3 A;  3UF4 A;  4A4G A;  1W2B A;  1HK9 A;  1YWP A;  2NUT A;  3RKW A;  1K9M R;  1YWO A;  1YJ9 Q;  2OTL T;  1T0H A;  4F7U F;  2F69 A;  2BIV A;  3V7C A;  4M75 D;  5FU7 B;  3G71 T;  1Z9Z A;  2AT1 B;  1EX4 A;  2CP5 A;  3EG3 A;  2EKH A;  3CCU Q;  4J8O A;  5GAO m;  1M2V B;  3EHR A;  1MGQ A;  1AWJ A;  5FU7 C;  3TEE A;  3JB9 H;  4M77 B;  1VQN Q;  3CC2 T;  3QPH A;  1M3C A;  3I56 A;  2HBP A;  5GAN 6;  5GMK m;  5KYY A;  4EIK A;  2EQK A;  3L2R A;  2BUD A;  5AYF A;  2ED1 A;  3EG9 B;  1Q82 U;  4C8Q G;  4JRQ A;  2FZG B;  3X28 B;  2RI3 A;  2JUF A;  2FRW A;  2DXB A;  2X9H A;  5CKB A;  2JZ2 A;  1VQ4 T;  5GAM e;  2PZ1 A;  5LJ5 e;  1ZUU A;  1OU8 A;  4RTV A;  5KYX A;  3JSC A;  1OEB A;  1JXO A;  2V8I A;  3HL8 A;  3OYK A;  1K76 A;  1S72 T;  3QZ5 B;  3UA6 A;  2FG0 A;  3A1P A;  3UWN A;  3OS1 A;  3I5S A;  3OYN A;  4Y28 E;  3VU3 C;  2H3J A;  3OQ5 A;  3JCM W;  1YHQ T;  1E7O A;  3MO8 A;  4HVV A;  5GAM h;  5LJ5 h;  2BZX A;  2W0Z A;  2FPE A;  2VYT A;  3FRN A;  4OMN A;  2FPD A;  5LL6 S;  3V8K A;  1D09 B;  3HSB A;  1OYX A;  1WA7 A;  2HQE A;  3CCV A;  1OU9 A;  2F5K A;  2GCX A;  3LGL A;  4P5N A;  3O5Z A;  2XDB A;  4OGC A;  3M4Y A;  2K7A A;  4J9C A;  5GMK j;  4FSX A;  1C6V X;  1OX9 A;  5GAO r;  3CCJ T;  2MI6 A;  1SKU B;  2L8D A;  2PVD B;  1X6B A;  2NLU A;  2DEU A;  3BFM A;  2YLB A;  2KE9 A;  2AHJ B;  3I5R A;  4A4F A;  1M90 R;  4JUV A;  4M78 C;  1PSF A;  4YTL A;  1SG5 A;  1WIE A;  4LDY A;  3PTA A;  2XG8 D;  1A0N B;  1E6H A;  2LNV A;  2YUO A;  3CCR Q;  1KD1 C;  3INZ A;  1WYX A;  3MP6 A;  4A54 A;  3CC4 A;  1TWB A;  4FYX B;  1VQ7 A;  3L1A A;  1RI0 A;  3JRZ A;  2ROT A;  4RMO A;  2ZAE A;  1MV3 A;  4M7A D;  2RNA A;  2PUO B;  1RI9 A;  1B7T A;  1Y07 A;  3P8H A;  3RDV A;  2FRY A;  4PJO B;  3LH0 A;  3PVQ A;  2V1R A;  4OP0 A;  3VRZ A;  2X4X A;  3O8V A;  1WXU A;  2LQN A;  2DL4 A;  1M1K R;  2KRS A;  3QUI A;  1B34 A;  4DQ2 A;  2IVW A;  4C8Q F;  4PJO C;  6AT1 B;  1AZG B;  2E41 A;  1R0B G;  4EMK B;  1YJW A;  2V26 A;  2QAZ A;  3F70 A;  3MEV A;  1OPL A;  2LVM A;  4B9X A;  2D6F A;  1H8K A;  7AT1 B;  2LJ1 A;  4MMK A;  3OSV A;  5J26 A;  3VS2 A;  4HT9 A;  5HCK A;  3EFO B;  1KFZ A;  3PIO A;  4EMK C;  2LDM A;  5GAN e;  3FC3 A;  3FIF A;  4HCC A;  3M5A A;  2LJ0 A;  3EG2 A;  2VKN A;  3JB9 G;  1UGV A;  1N27 A;  3WVE B;  8AT1 B;  2PNI A;  2DM1 A;  5GAO n;  4ATO A;  4TVR A;  2XU8 A;  4LXC A;  5CIU A;  2A08 A;  1SPK A;  4L59 A;  3URG A;  1M2V A;  5KE2 A;  2DIL A;  4BI3 A;  4RG8 A;  3H41 A;  2OTL Q;  1VQM Q;  4M78 G;  1Q81 U;  2D1X A;  1VQ5 Q;  3TCJ A;  2LQ8 A;  3GBQ A;  3OMG A;  4M77 A;  1BCM A;  5GAN 3;  3FEO A;  2LZ6 B;  4C8Q D;  4JJD A;  2L3R A;  1VQ6 T;  2KY9 A;  1JJ2 A;  1QVP A;  2M02 A;  5GAN h;  2VV5 A;  2DIQ A;  1UDL A;  5GAN 2;  2OTJ Q;  2O88 A;  3CC2 Q;  4RTZ A;  1U3O A;  1M1F A;  2VB6 A;  1H3H A;  4PK4 A;  5GAN 5;  2FHD A;  1M3A A;  3RKY A;  1K9A A;  4M77 F;  2V8J A;  2XK0 A;  2CP0 A;  3HRU A;  1OQK A;  3HFN A;  3EH1 A;  2FL7 A;  1X27 A;  2E10 A;  2AKL A;  2DJZ A;  2RQR A;  2AIR B;  4FYV B;  5LJ3 j;  3DLM A;  4CC4 B;  3NTH A;  2J6F A;  1VA7 A;  3ZFJ A;  1BIB A;  4PJJ A;  5CAI A;  1WJS A;  2P0Q A;  3RMS A;  2DO3 A;  4RTW A;  4AFU C;  5HKC A;  1YNZ A;  3GP8 A;  2M1H A;  3SD4 A;  2M51 A;  1ZSZ B;  1ACM B;  3I56 T;  4M75 B;  5FRM A;  3CBM A;  3RIR A;  1BK2 A;  2RQV A;  2KBT A;  3JB9 J;  2BKD N;  3J7A F;  4CRI A;  2KMT A;  2CT3 A;  1WXT A;  1IHW A;  2EGC A;  1QP3 A;  1RAI B;  3ME9 A;  1ZSZ C;  2JVV A;  4B6M A;  5C0M A;  1JXM A;  2JW4 A;  4ZNX A;  3CME A;  1HYO A;  1K9M C;  3CPF A;  4IUP A;  4BD3 A;  1VQ9 A;  2LNH B;  4Z89 A;  1WXB A;  1OOT A;  5ECA A;  4J9F A;  4X9D A;  2ZPG B;  1YJN A;  5GMK i;  4NL2 A;  1FMW A;  3BY7 A;  3U23 A;  4WCI A;  3X25 B;  3HTR A;  2SEM A;  4M78 F;  3PMT A;  2QEX A;  2DEQ A;  4F7U B;  2CH4 W;  4X34 A;  1CSK A;  2NUP B;  4K11 A;  5DM7 R;  3CCE Q;  1Y71 A;  1VQ4 A;  5J39 A;  2L5Q A;  1H3Z A;  5KE3 A;  2B8A A;  2Y4X A;  1S72 A;  4FYW B;  3CCV T;  2EVR A;  4NS5 A;  5LJ3 g;  2EFI A;  2RM4 A;  3FJ5 A;  3HFO A;  1YP5 A;  1K8A C;  3N5B B;  3GNF B;  3JB9 D;  4JDS A;  4RKU E;  4XU0 A;  3OYA A;  1NYG A;  1YIT A;  1D3B B;  1AZE A;  4GBQ A;  2E65 A;  1NM7 A;  3EFO A;  4N4I A;  2COY A;  4C5H A;  2YLC A;  3G4S A;  2QK0 A;  4PJO F;  1RL2 A;  1HSQ A;  1QMC A;  1G3S A;  2KI7 A;  3CD6 A;  2RB6 A;  1NJI U;  2IG0 A;  2EW3 A;  1AD5 A;  2HKN A;  3TU4 K;  4DBR A;  2DTH A;  2X3X D;  3SEM A;  2K5L A;  1G83 A;  2QQS A;  3LW5 E;  3VYG A;  2XDP A;  4XTY A;  3EAE A;  3A5Z B;  4HXJ A;  2J7I A;  4ME7 A;  5GMK e;  2D8J A;  1WHJ A;  3CPW P;  1B3Q A;  1XJW B;  3CC4 T;  1VQK Q;  1ZA2 B;  3OYY A;  5C6S A;  1VQ7 T;  3A8O B;  3CCM Q;  1VOM A;  1VQP Q;  2RJD A;  2YDL A;  1EZZ B;  4C5G A;  3I55 Q;  3DB3 A;  3MET A;  3CCS Q;  1TTH B;  5KYW B;  3MEW A;  4ZN1 A;  3BDU A;  2MWO A;  4KGX B;  1OZ2 A;  4OMP A;  3J80 E;  1HD3 A;  5GMK h;  4D8D A;  4M7A B;  3I35 A;  1VQO A;  4FT2 A;  5GAM d;  1YJW T;  1I1J A;  5LJ5 d;  1RAG B;  2DBM A;  3P8D A;  2L3S A;  2DTI A;  4LUE A;  1UG1 A;  3OW2 S;  2GGR A;  3E1S A;  4J9I A;  2KYB A;  2IPO B;  1GXI E;  3C0C A;  1M5Q 1;  2QA4 T;  2K3Y A;  4ZTJ A;  5HK0 A;  2DNU A;  1CKB A;  3CMA A;  4C92 E;  5CQX A;  3X20 B;  2DRM A;  1XNI A;  2PQW A;  2FO0 A;  3MHX A;  3V8J A;  3VS3 A;  2F5T X;  5GJW B;  4XTW A;  5KCO A;  4KGV B;  2CH4 A;  4N0A C;  1ZSZ A;  2K9G A;  4E7I A;  1PD0 A;  4M75 A;  4X1V A;  3TRE A;  3KXT A;  2DD5 A;  4DOV A;  3OS5 A;  1SHF A;  5DY9 A;  1O9S A;  2RJC A;  1QWF A;  3OW2 P;  1AWW A;  4GLM A;  2DIG A;  1YN8 A;  3EG1 A;  3FJP A;  2RI5 A;  2M9U A;  3RBB B;  3JV3 A;  2BTT A;  2X51 A;  1QW1 A;  4C8Q B;  5I22 A;  3M0T A;  2KXC A;  1U5S A;  2ZPB B;  4FW2 A;  2GQI A;  2BZY A;  2VXE A;  1QVF A;  3JCM c;  1AT1 B;  1TS9 A;  1GFC A;  3EHQ A;  2JMC A;  2EGE A;  3VS7 A;  3FDR A;  2VWF A;  1I81 A;  1PHT A;  4ZN3 A;  4GLK A;  3HHT B;  5KYN A;  4F7U A;  1NLP C;  2NUP A;  5CKD A;  2G3R A;  3CC7 T;  5GAN g;  3HPW A;  2DYB A;  2ZPH B;  1IGQ A;  1R77 A;  4QQD A;  2QG9 B;  1G2B A;  4A4K A;  3OSS C;  1QCN A;  5A2Q E;  4BE0 A;  3SFM A;  2L3P A;  1G5V A;  4EPC A;  3HP9 A;  1IRE B;  1NEG A;  2SRC A;  1C0M A;  3M53 A;  1YCY A;  5LJ3 e;  4BB7 A;  1G3W A;  3CME T;  3QDR B;  4N4H A;  2FB7 A;  3A8M B;  2KT8 A;  3RKX A;  3CQT A;  4KRT A;  1VQ9 T;  2LRQ A;  2YRD A;  2KT1 A;  2YUP A;  4OGE A;  2GTJ A;  1I8F A;  1YJN T;  2VAS A;  3SHW A;  2MIO A;  4JZ3 A;  4JLI A;  2PU9 B;  5DLQ E;  4C5I A;  4RTX A;  2QTX A;  2JMA A;  5LJ3 h;  1WX6 A;  2QEX T;  1Y7X A;  4L6V 5;  5FRN A;  1K8A R;  1PNJ A;  2LX7 A;  1W70 A;  1ARK A;  3ER0 A;  3HKS A;  4X9C A;  1U1T A;  2KAF A;  3P8B B;  2OAU A;  4M7A A;  3OYI A;  3M0R A;  2R5A A;  3QXE B;  5HK3 A;  1KQ1 A;  4MDX A;  1IGU A;  1OI1 A;  2KNB B;  2KYM A;  3EFR A;  1PSE A;  4XK8 E;  3LWH A;  1WHM A;  3C4S A;  2ATC B;  1YIT T;  1D0X A;  3OYH A;  1IRX A;  4IUQ A;  3OYF A;  4AFZ C;  4AMC A;  3G4S T;  2KR3 A;  1YJW Q;  2LTO A;  4R56 A;  3CD6 T;  2P0K A;  5HY6 A;  4QVZ A;  5FU6 B;  5GAO q;  4C0G A;  2CRE A;  3DB4 A;  2BE9 B;  1BBZ A;  1MHN A;  1SRM A;  2QTV A;  2GNC A;  2RK2 A;  4FU6 A;  3UA7 A;  4C92 C;  4BI4 A;  4M7A F;  4NL3 A;  2CP3 A;  1KC8 U;  3EGX B;  5I21 A;  4R0K A;  4J9D A;  5FWC A;  1K73 U;  4LD6 A;  2I0N A;  4NOY A;  3V7S A;  1XTD A;  1OV3 A;  3E2U A;  5FU6 C;  2G6F X;  2DYI A;  2E4H A;  4M78 B;  2EYW A;  1M27 C;  1YJ9 A;  4J6Y A;  5CKE A;  3JCM Q;  4Z02 A;  1Q7Y U;  2RA2 A;  2KEA A;  3EGU A;  1X6O A;  2XDD A;  4HCK A;  5GAM f;  4C8Q A;  5LJ5 f;  3M54 A;  1N8R U;  4LDW A;  3ZL7 C;  3M9Q A;  2CP2 A;  2K2V A;  2D8H A;  5D6W A;  1GFD A;  4E7L A;  2ED0 A;  2YXY A;  4M75 E;  1LCK A;  1NPP A;  1QVF P;  1VQO T;  1KJW A;  2NUZ A;  4J7F A;  1XQH A;  4ZTF A;  1RAH B;  1FYN A;  2HL5 C;  3JAM E;  4KH1 B;  3CXC S;  3H9N A;  4BAC A;  4N4G A;  4FYY B;  1GRI A;  2HD0 A;  4M7D E;  3GLX A;  2M16 A;  3CCL T;  3CMA T;  1KG1 A;  4PFZ A;  3R6N A;  2VGN A;  4DEY A;  2D9T A;  1X01 A;  2E64 A;  1X75 C;  1M30 A;  3A8G B;  3QBY A;  2COW A;  3NPF A;  5A0D A;  4R55 A;  1MNE A;  1Q82 R;  3FLG A;  1QVG P;  4XU3 A;  1YIJ T;  2MCN A;  4F7U E;  4C92 G;  2KQW A;  2R5M A;  2DX1 A;  3LLR A;  3OBW A;  2F2V A;  1JBM A;  3QYH B;  2DXT A;  3QSU A;  4OB1 B;  1Q86 U;  2L89 A;  2JTM A;  3QHS A;  3CXC P;  2AKK A;  4FSS A;  2QA4 A;  2BE7 D;  5I11 A;  3R6O A;  3KFV A;  2EQI A;  2VC8 A;  2YWW A;  3QZ9 B;  4AT1 B;  3UDC A;  3QKJ A;  1EFN A;  1V29 B;  3AHU A;  3OYE A;  4WTO B;  2O4X B;  4J7I A;  3VYH B;  2RHI A;  4CC3 A;  2RJE A;  1P92 A;  1AVZ C;  4EMG A;  3LH5 A;  3MP1 A;  2K57 A;  1B07 A;  3IQL A;  1AWO A;  3G71 Q;  1BB9 A;  2O9S A;  1U8R A;  4LN2 A;  3CPW A;  1N6A A;  2O2O A;  1UE9 A;  2D0Q B;  3OYL A;  2GFU A;  3CME Q;  1UFF A;  3MJX A;  3MKD A;  1M8V A;  3EG9 A;  3NGP A;  2F2X A;  3TVT A;  3JCM g;  5FRO A;  4FL6 A;  4ELZ C;  3CCQ T;  1G8X A;  4MZM A;  2JS0 A;  1VQ9 Q;  3VS1 A;  8ATC B;  1VIF A;  2HSP A;  4II1 A;  1GL5 A;  4C0F A;  3CCR A;  3JCM J;  2MF2 A;  4KT0 E;  3VKI A;  5AT1 B;  4BY6 C;  5A0G A;  5I2S A;  1ZUY A;  1VQ4 Q;  4Z88 A;  5L8R E;  1X43 A;  4ESR A;  3KUF A;  1U06 A;  2EJF A;  1JQQ A;  2X3W D;  5I2M A;  1S72 Q;  1WGS A;  3JCM X;  3OYB A;  2KDS A;  4KUI A;  1PKS A;  1IB8 A;  2CUB A;  2LT1 A;  3QWY A;  2PUK B;  4DA4 A;  3CC7 A;  3M4G A;  2VVK A;  2JJ9 A;  1VQ8 T;  1RUW A;  2D0N A;  4JJC A;  1PM3 A;  1YHQ Q;  3H0F A;  2EQM A;  1Y57 A;  4JLG A;  2QGF B;  3L42 A;  1MND A;  2DZC A;  2RF0 A;  3PNW C;  2QDY B;  3EGX A;  2P84 A;  1OPK A;  2E70 A;  1WNL A;  4LNP A;  3L2Z A;  1YCS B;  2MAM A;  2QDL A;  3RNJ A;  1ZX6 A;  2PVO B;  4M78 A;  4E47 A;  2CKK A;  1OUL A;  1NBE B;  1UHC A;  1SSH A;  4RTU A;  3OW2 A;  2RHY A;  5IXF A;  1VYT A;  4XQ3 A;  2HAX A;  4C92 F;  1T3L A;  1TUD A;  2GTO A;  3CCJ Q;  3S3M A;  3JB9 F;  2PTK A;  2HBW A;  3QJY A;  1VQM A;  1VQ5 A;  5CKH A;  4MML A;  2VGM A;  2E12 A;  2HNI A;  4MZP A;  4Z8A A;  2JXB A;  2ROL A;  1D1B A;  5GAM j;  1M1G A;  2HL3 A;  2CSI A;  2A36 A;  2DAQ A;  2DZ9 A;  1UGQ B;  5D6X A;  1F1B B;  4RCC A;  1KIK A;  3GPL A;  1UEB A;  1D0Y A;  4PJO A;  2CS7 A;  2YHT A;  4J6X A;  2ZPI B;  4C8Q E;  1N5Z A;  1M3B A;  2M0Y A;  2DET A;  1Q81 R;  4M7D C;  2JN0 A;  3FB9 A;  5GAN 4;  4OB0 B;  4C92 D;  3OYD A;  1TH7 A;  3RMQ A;  4EMK A;  3CPW S;  4JRP A;  3CMA Q;  4ORZ A;  3PMI A;  1PWT A;  1RAA B;  5FW9 A;  1YJ9 T;  3ZBD A;  1Y96 B;  2RO0 A;  3OA6 A;  3H0H A;  2HQH A;  4E7H A;  1WHH A;  2X4Y A;  4KUD K;  5D7U A;  3VS0 A;  2CYZ B;  3NTK A;  2O4X A;  3I9Q A;  1QCO A;  1GCP A;  3VRY A;  3OYG A;  2E3I A;  2E3H A;  1RAC B;  2COZ A;  2NWM A;  3MPU B;  1Z9Q A;  4ZGJ B;  1WDX A;  1G3T A;  2BZ8 A;  3LGF A;  1RAE B;  2KXD A;  1JRI A;  3G6E A;  4IKF A;  2X35 A;  3L2V A;  4ZGE B;  3SWN B;  3JCM P;  1FMV A;  1OX8 A;  1ZBX A;  1QCF A;  2K79 A;  1VQ6 Q;  3MCA B;  1FMK A;  2EYZ A;  2DXC A;  5CQY A;  5CVI A;  1BU1 A;  4M77 E;  2R58 A;  2RJF A;  3E9G A;  3SWN C;  1V1C A;  2QQB A;  5GAN 8;  4M7D G;  1V76 A;  2A28 A;  2O31 A;  1PG5 B;  2OAW A;  1GCQ C;  1LNX A;  3BW1 A;  3JCM e;  2X4J A;  2ZPE B;  1IO6 A;  1KHC A;  2A3L A;  2DA9 A;  3V8L A;  3HRS A;  3CEY A;  4FM4 B;  2CP6 A;  4O6J A;  4IUR A;  3CCE A;  1WZO A;  3CCL A;  3M56 A;  1K1Z A;  5A0L A;  2YRC A;  1VQL A;  2FVU A;  1QLY A;  4XTZ A;  2C0T A;  1TOV A;  5CO7 A;  1UHF A;  2WSE E;  4HKE A;  4PJM A;  3M58 A;  3JCM h;  4JJB A;  3T9N A;  1CKA A;  4UC4 A; 
#chains in the Genus database with same CATH homology
 1PNJ A;  2LX7 A;  1H8K A;  1I0C A;  1M8M A;  2LJ1 A;  1W70 A;  3VS2 A;  1ARK A;  1QKW A;  2P4R A;  5HCK A;  1KFZ A;  2DL5 A;  2LJ0 A;  3EG2 A;  2VKN A;  1UGV A;  2YT6 A;  3PE0 A;  3M0R A;  4F17 A;  2PNI A;  2DM1 A;  3QWX X;  2KNB B;  2KYM A;  2A08 A;  4DEX A;  4QT7 A;  1SPK A;  1GBR A;  2DIL A;  1QWE A;  3H41 A;  2D1X A;  3GBQ A;  2J06 A;  2LZ6 B;  4JJD A;  4AFZ C;  1SRL A;  2KR3 A;  4J9E A;  2W10 A;  1UDL A;  2LP5 A;  1ABO A;  2CRE A;  1BBZ A;  1SRM A;  2EBP A;  4OMO A;  3UA7 A;  2GNC A;  2V1Q A;  2IIM A;  2C0I A;  2RQU A;  2EPD A;  4F14 A;  2O88 A;  2K3B A;  2DBK A;  4R0K A;  1X2Q A;  4J9D A;  4RTZ A;  5FWC A;  2I0N A;  1U3O A;  2ESW A;  2DF6 A;  1OV3 A;  2G6F X;  1NG2 A;  1H3H A;  2EYW A;  1M27 C;  2KRO A;  1Y0M A;  1XOV A;  2KRM A;  1M3A A;  5IXB A;  1K9A A;  1UJY A;  2RPN A;  2KEA A;  3EGU A;  2MOX A;  4HCK A;  5IHI A;  2A37 A;  4LUD A;  1X27 A;  4OMM A;  3ZL7 C;  2AKL A;  2D8H A;  2RQR A;  3M0U A;  3REA B;  1GFD A;  1I07 A;  1TG0 A;  2ED0 A;  1LCK A;  4CC4 B;  1KJW A;  1MV0 B;  1ZBJ A;  2NUZ A;  2LCS A;  2J6F A;  1VA7 A;  1ABQ A;  1FYN A;  4RTW A;  2KGT A;  4AFU C;  1YNZ A;  1JU5 C;  4AG2 C;  1GRI A;  2M51 A;  1MUZ A;  4J9B A;  5EC7 A;  3R6N A;  1BK2 A;  2DE0 X;  2RQV A;  2KBT A;  4DEY A;  4OML A;  2RMO A;  2RN8 A;  2CT3 A;  1WXT A;  2EGC A;  2DMO A;  1M30 A;  2JTE A;  4CC7 A;  1UJ0 A;  4RTY A;  1JXM A;  2JW4 A;  4ZNX A;  3NPF A;  2LJ3 A;  2YUN A;  4AFS C;  2MCN A;  3VS4 A;  2JT4 A;  1GCQ A;  2DX1 A;  2F2V A;  2CT4 A;  4OMQ A;  2EYX A;  2EYY A;  1H92 A;  2E5K A;  1VYU A;  2LNH B;  4Z89 A;  4LE9 A;  4CC2 A;  1WXB A;  1QKX A;  1ZLM A;  2AKK A;  1OOT A;  2J6O A;  4FSS A;  5ECA A;  5I11 A;  4J9F A;  2ABL A;  3KFV A;  3THK A;  2EQI A;  3NMZ C;  3M0P A;  3U23 A;  4WCI A;  1EFN A;  2JS2 A;  2SEM A;  3PVL A;  2JM8 A;  1X6G A;  4JZ4 A;  2CH4 W;  2K2M A;  1CSK A;  4CC3 A;  4K11 A;  4RUG A;  1X69 A;  1AVZ C;  2HDA A;  3LH5 A;  3VS6 A;  1B07 A;  3IQL A;  1AWO A;  2F2W A;  4HVU A;  1BB9 A;  2O9S A;  3VS5 A;  1W1F A;  2DL7 A;  4LN2 A;  2O2O A;  1UE9 A;  2RQW A;  2EVR A;  1K0X A;  5IHK A;  3FJ5 A;  1UFF A;  5FWB A;  2J05 A;  3NGP A;  1YP5 A;  2L0A A;  2F2X A;  3TVT A;  2OI3 A;  2JS0 A;  2YUQ A;  4D8K A;  3VS1 A;  4A63 B;  4IIM A;  1NYG A;  1RLQ C;  3REB B;  1AZE A;  4GBQ A;  1NM7 A;  2HSP A;  4J9H A;  1GBQ A;  2AZV A;  3UAT A;  2DL8 A;  1GL5 A;  1HSQ A;  1SHG A;  2B86 A;  1AWX A;  2EGA A;  4E6R A;  1E6G A;  1ZUY A;  2EW3 A;  2YSQ A;  4Z88 A;  1AD5 A;  1X43 A;  4ESR A;  1U06 A;  2OJ2 A;  2ENM A;  2X3X D;  1WFW A;  3SEM A;  1JQQ A;  2X3W D;  1G83 A;  4RTT A;  2FEI A;  4HXJ A;  3TSZ A;  2J7I A;  2D8J A;  1PKT A;  1PKS A;  1B3Q A;  2CUB A;  3QWY A;  2JM9 A;  3TSW A;  2VVK A;  2CSQ A;  2YDL A;  1RLP C;  1RUW A;  5IHN A;  2D0N A;  4JJC A;  2L2P A;  3H0F A;  1Y57 A;  2DVJ A;  2L3Q A;  2RF0 A;  4Y92 A;  2DL3 A;  3UF4 A;  3M0S A;  1HJD A;  4M4Z A;  1YWP A;  1OPK A;  4LNP A;  1YWO A;  1J3T A;  1T0H A;  1YCS B;  3M0Q A;  1S1N A;  2QDL A;  4OMP A;  3RNJ A;  1ZX6 A;  1HD3 A;  4D8D A;  1Z9Z A;  3I35 A;  1UHC A;  1SSH A;  2CDT A;  4RTU A;  1I1J A;  1T3S A;  2DBM A;  3EG3 A;  5IXF A;  2EKH A;  1VYT A;  2L3S A;  1T3L A;  2XMF A;  3EHR A;  5GJV B;  4LUE A;  1TUD A;  1AEY A;  1UG1 A;  2GTO A;  1AWJ A;  2LMJ A;  2GGR A;  4J9I A;  2KYB A;  3C0C A;  1M3C A;  2DNU A;  2PTK A;  2HBW A;  1CKB A;  1ZSG A;  4EIK A;  4Z8A A;  2JXB A;  2RQT A;  2ROL A;  2ED1 A;  2CSI A;  3ULR B;  1NEB A;  2A36 A;  2DRM A;  2AZS A;  2FO0 A;  2FRW A;  1JO8 A;  2KRN A;  5IH2 A;  4HVW A;  3VS3 A;  1PRL C;  2PZ1 A;  5GJW B;  1KIK A;  1ZUU A;  4RTV A;  2CH4 A;  2K9G A;  1OEB A;  1JXO A;  1N5Z A;  1X2K A;  2LQW A;  4X1V A;  1K76 A;  1M3B A;  2M0Y A;  1SHF A;  3UA6 A;  1KSW A;  1UUE A;  1QWF A;  1K0S A;  2FG0 A;  1AWW A;  4GLM A;  3I5S A;  2DRK A;  4AFQ C;  1YN8 A;  3EG1 A;  3RBB B;  1E7O A;  3JV3 A;  2BTT A;  2HCK A;  4HVV A;  5L23 A;  1WI7 A;  1WLP B;  5I22 A;  1VYV A;  3M0T A;  2KXC A;  1U5S A;  2BZX A;  4ORZ A;  1TUC A;  2GQI A;  2BZY A;  1PWT A;  2W0Z A;  5FW9 A;  2HEQ A;  2FPE A;  4OMN A;  2FPD A;  1GFC A;  3H0H A;  3EHQ A;  2JMC A;  2O9V A;  1WA7 A;  2EGE A;  1K4U S;  3VS7 A;  1NYF A;  2VWF A;  1PHT A;  4J9G A;  3VS0 A;  3O5Z A;  3I9Q A;  1GCP A;  3VRY A;  2K7A A;  1NLP C;  1ZUK A;  4J9C A;  3EG0 A;  2NWM A;  1Z9Q A;  1SEM A;  1WDX A;  2J6K A;  2BZ8 A;  2DYB A;  2H8H A;  1NLO C;  1X6B A;  2KXD A;  2GBQ A;  2KE9 A;  3I5R A;  3NHN A;  2DLP A;  1G2B A;  1JEG A;  1PRM C;  1WIE A;  1QCF A;  1A0N B;  1W6X A;  4IIO A;  2K79 A;  1E6H A;  2L3P A;  2YUO A;  1NEG A;  2SRC A;  1FMK A;  2CUD A;  2EYZ A;  3H0I A;  1BU1 A;  1V1C A;  1WYX A;  2K6D A;  1T0J A;  2A28 A;  2O31 A;  2OAW A;  1GCQ C;  2ROT A;  2AK5 A;  1MV3 A;  2RNA A;  1RI9 A;  1IO6 A;  2DA9 A;  4JPB W;  2KT8 A;  2FRY A;  1AOJ A;  3PVQ A;  2V1R A;  3CQT A;  3VRZ A;  4KRT A;  1WXU A;  2KT1 A;  2YUP A;  2LQN A;  2DL4 A;  2FPF A;  4AG1 C;  2KRS A;  2GTJ A;  1UTI A;  2C0O A;  1K1Z A;  1UEC A;  2DJQ A;  3SHW A;  2MIO A;  4JZ3 A;  1QLY A;  2ECZ A;  1AZG B;  2C0T A;  3A98 A;  4RTX A;  2JMA A;  1WX6 A;  1UHF A;  1OPL A;  4JJB A;  4F16 A;  1CKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...