4M7AA

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
b'TLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 13
structure length 64
sequence length 64
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aA00
5GANh 1B34A 4OP0A 2VXFA 5GAN8 5GAOl 4C8QE 4M7DB 4M78G 1HK9A 5GANf 2QTXA 3FIFA 4EMKB 2DTOA 4A54A 1HXDA 4X9DA 3V7SA 2E10A 3JCMJ 3JB9J 4M78F 4M7DA 2EWNA 4PJOC 1WQWA 4EMKA 3RESA 4F7UB 1Y96B 4PJOB 2DTHA 2E64A 2DEQA 2VC8A 2YLCA 1I4K1 3HFOA 3RKYA 4C8QC 2RA2A 4QVCA 4PNOA 4XU1A 5GAMh 1YCYA 3V7CA 4F7UA 5GAMf 1Y96A 5CAIA 5LJ5e 3PGGA 4XTWA 1LOJA 4J6XA 2DJZA 1BIAA 4M78E 3INZA 4M77B 3JCMg 3VU3C 3GIBA 3SB2A 3SWNB 5GANd 2FYKA 4C92D 3BY7A 3QO3A 3EFRA 4M75D 4N0AC 1H641 3JCMQ 4M7AD 5GANj 4X9CA 4DQ2A 2CGHA 4EMGA 5GAOm 5LJ3g 4M77A 1MGQA 2DVEA 4MMKA 1M5Q1 4NL2A 3SWNA 2E65A 1U1TA 2FB7A 3FJPA 3RIRA 4C92G 5GMKe 3QUIA 3QSUA 4M75G 2ZGWA 4QVDA 4M7AG 1N9SA 3JCMX 2EJFA 1KQ2A 4C92F 5GAMd 3JCMc 4WF2A 4M75F 4M7DD 1JBMA 4M7AF 4C8QB 5GAMj 2E41A 5GAOq 1I8FA 4A53A 5GMKl 3JCMe 4HT9A 2EJ9A 4PJOA 3BFMA 1I5LA 4HA8A 3V8JA 5GMKi 4M7DG 4C8QA 3JB9H 4XTXA 4XTYA 3V8KA 4C92E 3JCMP 3JB9D 5GAN4 2RM4A 4M75E 3BDUA 5LJ3e 5GAN3 4RCCA 5LJ5d 4M7AE 2E1HA 1JRIA 4M7DF 4F7UG 1I81A 5LJ5j 4V2SA 2EAYA 4XU0A 4M77D 5LJ5h 3JCMb 2I2LA 3JB9G 4M78C 2Y90A 4M78B 4N0AA 4XTUA 3M4GA 4MMLA 5LJ5f 5GAN5 3EFSA 1KQ1A 2EJGA 4F7UF 4PJOF 4Y91A 4M75C 1X01A 3BW1A 3JB9F 1LJOA 3QHSA 5GANe 4NOYA 3AHUA 4M7AC 4M7DE 2DZ9A 4M78A 4M77G 3JCMW 1BIBA 3RKXA 5GANg 3JCMV 2RB6A 5I21A 1WNLA 3L1AA 5GMKh 5GMKm 4XU3A 2DZCA 3V7RA 4M77F 2DXUA 4XTZA 4F7UE 5GAN2 4NL3A 4PJOD 3HSBA 4XTVA 4M7DC 2YLBA 4HT8A 3JCMd 4C8QD 4EMKC 2K57A 2YHTA 1D3BB 2DKGA 3V8LA 5GAMe 1LNXA 2HNIA 4J6WA 5GAOp 3JCMh 5GAMg 1WPYA 4PJOG 3RERA 4M77E 4RCBA 4XU2A 4EMHA 5LJ3d 3JCMf 1M8VA 1D3BA 4C8QG 4JRIA 5GAN7 5GAOn 2RD1A 4C92C 5GAN6 4C92B 5LJ3j 3HFNA 1WQ7A 4M75B 5LJ3h 4M7AB 5LJ3f 4C8QF 1U1SA 3FB9A 4JRKA 2DTIA 1N9RA 3RUXA 3L2ZA 2DXTA 3JB9I 4C92A 1B34B 4M77C 4M78D 5GMKj 4JLIA 4J6YA 3RKWA 4M75A 3SWNC 5GAOr 4JUVA 4XQ3A 5LJ5g 1TH7A 4J5YA 4M7AA 2JN0A 4PJOE 2VXEA 5DY9A
chains in the Genus database with same CATH superfamily
3MJXA 5GANf 3OS5A 4EMKB 2E5KA 8ATCB 2F1LA 1VQ6Q 2A08A 1ZX6A 2AKLA 1W2BS 4OVAA 1JXMA 3M54A 4C8QC 2K3YA 4MDWA 2RA2A 1IXDA 1WI7A 1NJIU 1Y96A 3CC7Q 1PWTA 2FO0A 3PMTA 3INZA 2IG0A 3SWNB 4C0ZA 5KE2A 1OV3A 5IHIA 2PUOB 1TOVA 1NPPA 5GANj 2ZPEB 3QDRB 3CMET 3DKMA 3S3OA 1WHMA 2A36A 3NTKA 1WA7A 2YT6A 2RH2A 1RLPC 4BY6C 1KQ2A 3SHWA 3VRZA 4JJCA 4E7ZA 2J6FA 3HP9A 1QWFA 2LVMA 4HA8A 2LJ1A 4OGCA 2VASA 2RJEA 2X3WD 4A4HA 1K8AC 1QVFS 2JZ2A 3C94A 2ROTA 1PG5B 1C6VX 2DMOA 2L3SA 1N27A 3ASKA 2IIMA 1ZUUA 1WXUA 4MZMA 2DYBA 2K2MA 1EFNA 2JTMA 4QQ6A 1JB0E 2DRKA 4RTTA 2JTFA 3UWNA 5HK0A 4NOYA 2P0KA 4IUQA 2MF2A 2YRVA 4LE9A 1F1BB 1PRLC 1GCPA 2LX7A 4AG2C 5FWBA 3UA7A 2CSQA 5KYXB 1RADB 2JJ9A 4KGXB 1D3BB 3V8LA 4IKFA 2LRQA 4BD3A 4Y92A 9ATCB 2HQEA 2HSEB 3PIOA 3RBBB 1WJSA 2ED0A 1LPLA 3QBYA 1TUDA 1UGQB 2XU8A 1T0JA 2P84A 2BZYA 1WYXA 1U3OA 1VQ8A 3G71T 4O5VA 4J9FA 1WLPB 1UGVA 2QK0A 3O5ZA 4OMNA 3X26B 1Y96B 4E47A 2DTHA 5KYYA 2DILA 1I4K1 4PNOA 1KHIA 5AYFA 1P92A 1LOJA 1KG1A 3M0UA 1ZSZA 2BZ8A 5EG2A 3BY7A 2E12A 2E3IA 1BI1A 1VQ8T 1D0ZA 3UF4A 1QCOA 4J9GA 3GLXA 4JS5A 1ACMB 1RI0A 4RTWA 2COWA 4PJMA 2OAWA 2EJFA 4JZ3A 4DEYA 2CP3A 4M75F 5C6SA 1OU8A 3FRNA 4A53A 3MO8A 1KD1R 3MCAB 1I5LA 4PL6A 3G6ET 1RLQC 1U5SA 3JCMP 2GTJA 2E1HA 3PMIA 1BK2A 3CXCP 2YUQA 2EAYA 3JB9G 2EBPA 2J6KA 1YI2A 3EGDA 3TSWA 4N0AA 4XTUA 1TXQA 1WJRA 4OMQA 3TCJA 5FROA 3QHSA 2COZA 3AHUA 4M7DE 2WSCE 3FDRA 3OS2A 2RB6A 1G83A 4F14A 2XMFA 1QKXA 3META 1FMWA 1W1FA 2DJQA 3JCMh 2CH4W 1YI2T 1TUCA 3N5BB 4KH1B 2CT4A 5GAN6 2JOYA 2CP2A 2XDPA 4RG2A 3O8VA 3OW2P 4FW2A 5GMKj 4OMPA 2EQKA 2FHDA 2L3PA 2H3JA 4E7HA 1T0HA 3KBGA 4BB7A 1UHFA 4HCKA 4MZTA 5KYWA 1HXDA 4X9DA 1UE9A 1ZBJA 2Y4YA 4PJOC 2RJFA 1W6XA 2LT1A 2E64A 3GNGA 4GLMA 1ZSZB 1VQOA 3QYGB 5GAMh 2FPFA 1MMAA 3FLGA 1QVGS 3GIBA 1PD1A 4BACA 2FYKA 2BKDN 3EFRA 4DQ2A 3DB3A 3VYHB 3CCRQ 3CCMA 2LZ6B 2PQWA 3JCMX 2ZPGB 2XDBA 5CQXA 1TG0A 3QJYA 1VQOT 1YP5A 4BI8B 1X2QA 3CD6T 1BI3A 3TEEA 3BE3A 1FWZA 4C92E 5HCKA 2KNBB 2LDMA 3EGDB 2BTTA 3CPWP 1Q86U 3MHXA 1W70A 1I5OB 1V29B 1M90R 3CCMT 3A8GB 2EJGA 3J80E 2LCLA 5DM7R 2CH4A 2XK0A 1WFWA 1N8RR 2R5MA 1BKBA 4E7KA 2WACA 3LGFA 5KCHA 2GFUA 2EQMA 1S1NA 4GBQA 2MPXC 1YFNA 2XI9A 1K0SA 4HT8A 3TVTA 4EMKC 2QEXQ 2K6DA 3H6ZA 1QP2A 1Y7XA 2KT8A 1S72T 4RCBA 1XJWB 5GAOn 2RF0A 3QG1A 2RD1A 4C92C 1WIEA 4RTYA 4RG8A 4L6V5 4L5GA 3CC4A 1IGUA 4HVWA 2V1QA 4ATOA 3SWNC 4DBRA 7AT1B 1M1KR 3SD4A 5KYWB 1MNEA 2JN0A 3UA6A 1YJNA 4A54A 1Y57A 2D0QB 1QLYA 1Q95G 5I22A 2MOXA 1VQ7A 3OBYA 2RI2A 1UG1A 2HQXA 4CC2A 1MHNA 1WDXA 2L89A 4JDSA 4MZPA 1G2BA 2RQRA 3CC4T 2HZYA 2DJZA 2K3BA 5J3BA 4R0KA 2YUOA 2EYQA 1YJNT 3M56A 2KDSA 4GY5A 3EG1A 3MEUA 1VQ7T 2C0IA 4C5IA 3QSUA 3P8HA 4J7FA 3CCEQ 5GAMd 2XICA 4AG1C 3C95A 4PK4A 2F69A 2D1XA 3EG9A 1X6OA 3QJ6A 1VQ4A 2MAMA 1AWWA 1RAFB 3CBPA 3OYCA 2CP0A 2EFIA 3BDUA 4M7AE 1KD1C 4M7DF 2XHCA 1B3QA 2GNCA 1WHJA 2X51A 4X1VA 1G3SA 1M3BA 3JCMb 1GBRA 3LH5A 2YUNA 1G3TA 5GAN5 3M4GA 3SDZA 2F2XA 3OS0A 4PJOF 3G7ZA 1IRXA 3QXEB 3OB9A 4EIKA 3CBOA 3QYHB 1RAGB 1M1KU 3OYIA 3P8DA 4A4KA 1VQ4T 2DXUA 4QKUA 2KVQG 4BUGA 2MK5A 5CO7A 2H3EB 2DKGA 2JNGA 1H92A 2EVRA 5FLXE 3LWIA 5GAMg 3RDVA 4M77E 3JCMf 1QCFA 1PHTA 1X69A 4E7LA 2JTEA 1RL2A 1YIJQ 3HPWA 1TS9A 3QZ5B 5CKBA 4JUVA 1TH7A 1MNDA 3OSVA 3LYIA 1M2OA 1NYGA 2FPDA 1Z9QA 3EAEA 4ZNXA 2F5KA 1JO8A 2YXYA 2C0OA 3L42A 1PC0A 2E10A 3JCMJ 3M55A 2DL8A 3DLLA 2EWNA 2LJ0A 1OZ3A 1U8RA 2K7AA 3JRZA 2PVDB 3CC2Q 1NLOC 1BCOA 4HCCA 3PVQA 4PLLA 4BI4A 1YWOA 1Q82R 5GAMf 1BIAA 2PNIA 2LQNA 2CGHA 3OMCA 1E6GA 4KUDK 4RTVA 1K8AU 2LNVA 2I0NA 4C92F 3CCLQ 1VQNQ 3PTAA 3CCJA 3CCVQ 3E1SA 1OZ2A 3ZBDA 2OTLA 5GAMj 2QQSA 1OOTA 2D8JA 4HCZA 3THKA 3BFMA 3OQ5A 1G3YA 5GAN4 4RCCA 2KT1A 4J9IA 2LC4A 1VQLA 1R77A 3VJPA 3C0CA 2CZ0B 3M57A 3I5RA 1KC8R 2RK1A 3CCJT 2CDTA 3JCMW 2OTLT 4FSSA 1M90C 2CREA 4FYXB 3OYEA 1N8RC 1I0CA 3L2QA 2DLPA 3H0IA 2YLBA 4VUBA 3TREA 4KH0B 4ZGDB 1VQLT 1X2KA 3RERA 1TTHB 3I56Q 4JRIA 1E6HA 2O88A 1ZSZC 1YITA 2PVOB 2E4HA 2M1HA 1MMGA 3A8MB 3RMQA 2VXEA 4Y91A 1B34A 5GAOl 4C8QE 2E5QA 3G4SQ 4LXCA 4OGEA 2DXBA 1FMKA 3CMAT 1KIKA 3JB9J 2KBTA 2BUDA 1ZUYA 1SKUB 3MKDA 3QPHA 1AWOA 1VQKQ 2VC8A 4HXJA 2MYSA 1YITT 4XAXB 5FRNA 2GQVA 2K5LA 4M78E 5KE3A 2LX9A 3U23A 2GTOA 2QASA 4M75D 4N0AC 3URGA 4KRTA 4MMKA 1M1FA 1HYOA 4AFSC 2FB7A 3FJ5A 2RHZA 3KXTA 1SPKA 3M58A 3EHRA 4AFQC 4M7AF 2AHJB 1B07A 2EJ9A 4J8OA 1UJ0A 1R0BG 2YRCA 3NPFA 4Y28E 1VQPQ 2QXFA 3CXCA 4B9WA 1TUGB 1I81A 4M78C 1MV3A 2HD0A 5I2MA 1QMCA 4IUUA 3E9FA 2QA4A 2OI3A 2ZZDA 1JU5C 4UC4A 3CCUQ 3L1AA 4N4HA 4M77F 3VS2A 2JUFA 2QI2A 4F7UE 4KT0E 4NL3A 3I55A 2CP6A 3J7AF 5A0LA 4J6WA 2DX1A 1NM7A 1Q7YR 4JRPA 2B8AA 2X3XD 3L2RA 1T3LA 2KEAA 1VQ9A 2RNAA 1M8VA 1G3WA 2CS7A 4OF1A 3OW2A 2DD5A 2QA4T 1VQMQ 5A2QE 1YCSB 1B34B 2DE0X 2DERA 1M30A 1UECA 4J6YA 3OYNA 2KROA 1TWBA 2R5AA 3I55T 2VVKA 1YHQQ 4AT1B 4RUGA 3E2UA 5HY6A 4FYVB 5M9OA 5J39A 2JVVA 1UFFA 1VQ9T 4P5NA 2EYXA 3M53A 2P4RA 1K73R 1UTIA 4E2FB 2L3QA 2YUPA 4ME7A 1AVZC 2DPPB 2NWMA 3OYFA 2CP7A 1H641 1SEMA 1Q82C 3HRSA 1MGQA 2ZPBB 5GJVB 2EYYA 4FYWB 1JJ2P 2K9GA 5L23A 4QVDA 4FIBA 4HVUA 2HSPA 1WXTA 1T3SA 1C1AA 2E6ZA 2B86A 4QVZA 1QQJA 1VQ5A 2CUDA 4C5EA 4RKUE 2W10A 2QQBA 5CKDA 1QVPA 2LTOA 4C0DB 1YJ9A 1Q81R 2RM4A 5LJ3e 2NLUA 3CPWA 4M4ZA 2DIGA 1AD5A 3KUFA 4LUDA 2QQ9A 3EFSA 4OB3B 3HRUA 3BW1A 1M3CA 1Y07A 2DZ9A 2V26A 4E7JA 5ECAA 1VQ5T 5FU6C 3OYGA 2AKKA 3MEVA 3R6NA 4ELYC 1B7TA 4RTZA 1KC8C 5GAN2 3CCSQ 1YJ9T 1K4US 1V76A 2QGFB 2J05A 4EMHA 2ABLA 5LJ3d 3EH1A 1K1ZA 2PZ1A 3AT1B 4C8QF 5FU7B 2D6FA 2MWPA 1EIFA 1WHGA 4M75A 5CK9A 4J7IA 1JQQA 4PJOE 4CC7A 5FRMA 1SHGA 1VIEA 3CCQQ 4IUVA 1HK9A 2RQVA 2QTXA 1MMDA 5KH6A 4M78F 2JMCA 4PFPA 1UJYA 1WQWA 3MPUB 5D6YA 2DEQA 2BE7D 3OYBA 2FRYA 2JW4A 1BI0A 5GJWB 1U06A 3JSCA 5CAIA 4XTWA 1AT1B 4N4GA 3OMGA 2F2WA 5LJ3g 3VS1A 4RTUA 3BDLA 2DK3A 2DL5A 3S3NA 1VQNA 3PT9A 4ESRA 2VWFA 3HL8A 4M75G 3VV0A 2M9UA 4ZGEB 2ZGWA 2ESWA 5IXBA 3NTIA 2DA9A 1YJWQ 4M7DD 1YWPA 3MEAA 1KD1U 1Y0MA 2DVJA 4HT9A 3NFCA 5GMKi 1M2VB 4J9BA 3CBMA 3VUZA 6AT1B 3LH0A 2J7IA 3CQTA 2M16A 1RAIB 2ED1A 4F7UF 2PUKB 1NE8A 2KYBA 2KAFA 3EFOA 2V1RA 5I21A 3S3MA 2ENMA 1IHVA 1SSFA 2DZCA 2FRWA 2DL4A 2KXDA 3GP8A 2YHTA 1LNXA 2E70A 3I56A 2OTJA 2KRSA 3CMEQ 3I5SA 1PCXA 5LJ3j 4M75B 4Z89A 3VYGA 1Q7YC 4PKCC 3ZL7C 4LDXA 3L2ZA 3JB9I 3WXMB 4X34A 2V8KA 3RKWA 1WHHA 4XQ3A 3M4YA 1GFDA 3QKJA 1X6GA 2YRDA 1YNZA 2FZGB 5IHKA 3EG3A 1D0YA 1ZA1B 3EHQA 2YDLA 2OTJT 1NEGA 2VV5A 1RUWA 3TSZA 4KBMB 5IN1A 3RESA 4IUTA 2PU9B 3KFVA 1K73C 4C92D 4BDZA 3MP1A 2AT1B 1VQ6A 2EQJA 4KUIA 4NL2A 2KMTA 2LCCA 3VS0A 1OQKA 1N9SA 2WSFE 3OSSC 2QDLA 4WCIA 3CC7A 3JAME 5DLQE 1ZA2B 5GAOq 5GMKl 3VS7A 3LWHA 3V8JA 3VS6A 3D7SB 2BE9B 1K9AA 2DRMA 4QQGA 3UDCA 1VQ6T 2DAQA 1KQSP 1ZLMA 4OB2B 4DA4A 3G71Q 4NS5A 2HBWA 5IH2A 1M90U 2QG9B 1PKSA 1Q81C 3EFOB 1KQ1A 4AFZC 1N8RU 3NHNA 1JEGA 3CCUA 3CXCS 3CC7T 5CR2A 2HAXA 1DJ7B 3X20B 1QW1A 3LLRA 3ME9A 3VUBA 3RR6A 2GCXA 1VQ8Q 1OX8A 3EG0A 3H41A 4LNPA 4A4GA 2OX7A 4XU2A 2XIDA 3X24B 1PRMC 2MMPA 2DXCA 3CEYA 3CCUT 2HEQA 4JRKA 3MP8A 4K11A 1EX4A 3OYMA 4CRIA 2PVGB 2AZVA 3OW2S 2DL3A 3G6EQ 5GAN8 2VXFA 1W2BP 2M0OA 5KYUB 1GXIE 4A4FA 4BE2A 1G8XA 3A8LB 3GNFB 3RNJA 4M7DA 4QW2A 4D8DA 3HHTB 3RKYA 4F17A 1YCYA 4DBFA 5LJ5e 1O75A 5J26A 1X6BA 2CZ1B 2RHXA 4M7AD 1CKAA 4JPBW 1M5Q1 1BCMA 2E65A 1SSHA 1IZ6A 1LCKA 2HKNA 1XTDA 1X43A 2RQUA 3LGLA 1YI2Q 2EYZA 3QIIA 5IT9E 4PLIA 1QVFP 3OYAA 1D0XA 1Y71A 1PM3A 4M7DG 3JB9H 4XTXA 3PNWC 2XKOC 5LJ5d 4B9XA 1VYTA 1JRIA 2K4YA 2XG8D 1GL5A 3EG2A 2OAUA 2ROLA 4XU0A 4M77D 2FZKB 2EIFA 2EW3A 4E7SA 1BBZA 1D1AA 3L2VA 1X01A 3CPWS 5GANe 1V1CA 4QT7A 1K9MC 2R57A 4N4IA 1MUZA 4Q5WA 1UB4A 4C0GA 1ABOA 1ARKA 2HL5C 2L2PA 5FW9A 2Y4XA 2JT4A 1NPRA 4KGVB 1RI9A 3ER0A 4FT4A 2K3XA 2ZPFB 3RMSA 2AIRB 2DXTA 2RQWA 4C92A 1QWEA 1VQOQ 1N6AA 2FEIA 5LJ5g 1UHCA 3CD6Q 2DM1A 1FMVA 4M7DB 3EGUA 3QZ9B 2VGMA 3M0RA 2IVWA 3A98A 4Z8AA 4PJOB 3DB4A 5DLOA 2YLCA 2BIVA 3HFOA 3CCMQ 1Q82U 4QVCA 4XU1A 4LUEA 4LDWA 1PNJA 2L0AA 1FX7A 2VB6A 2EYWA 2DVEA 1JJ2A 4AFUC 1O9SA 4C92G 5CKFA 3SEMA 1I1JA 4L59A 4R55A 1QCNA 3H9NA 1S72Q 1KSWA 4LDVA 2MWOA 5FWCA 2E41A 2HMAA 4HKEA 2BZXA 3WVEB 4OB1B 2LCSA 3VS4A 4JJNK 2WSEE 3VKIA 4BI3A 3EGXB 1D09B 1W4SA 2GF7A 4KGZB 1VIFA 1D1BA 3CCRA 2VYTA 2O2OA 1R8OB 5LJ5j 3PE0A 4ZN3A 2NUPA 1KC8U 4M75C 4FYYB 1NEBA 1LJOA 3LX7A 3NGPA 1HJDA 1E7OA 1BIBA 3J81E 4FW1A 3V7RA 1EZZB 1M3AA 3DLMA 3CC4Q 1OPKA 4XTVA 3CMEA 4C8QD 2K57A 2XD0A 1YJNQ 2HNIA 4IIMA 3CCRT 1J3TA 4R56A 1WPYA 3CPFA 3FC3A 1VQ7Q 1BI2A 3QWXX 1SHFA 2EGAA 4C92B 3OYDA 3HFNA 5LJ3h 2LP5A 1YBYA 2OJ2A 2COYA 4E7IA 2KGTA 4PFOA 1N9RA 3RUXA 1WGSA 2QYZA 4M78D 1WXBA 3F70A 3LW5E 2P0QA 5GAOr 1AOJA 4M7AA 2RPNA 2QEXA 2MI6A 1WX6A 4OMOA 4ZTFA 1H3HA 4RTXA 1RAHB 2MCNA 5D6XA 2A37A 3MP6A 2NUTA 2KI7A 3V7SA 5HKCA 3L2WA 4D8KA 1H3ZA 2ZPIB 4DOWA 1QVGP 1PD0A 4CC3A 8AT1B 1RAEB 2KRMA 3PGGA 3ZFJA 3M0PA 3SB2A 1VQ4Q 3HRTA 2QEXT 2LMJA 1X27A 2O31A 2RO0A 3A5ZB 5GAOm 4M77A 1KK7A 3OA6A 4J9CA 5GMKe 2G6FX 4M7AG 2YWWA 3I9QA 4FL6A 3QDFA 2C06A 1D1CA 2RMOA 2GGRA 1ZUKA 3G71A 1IO6A 1SRMA 2NUPB 4E6RA 1FXXA 3CCEA 2I2LA 2J6OA 2HL3A 3JB9F 4ORZA 1AWJA 1AWXA 3NMZC 4M77G 1G5VA 1UDLA 4II1A 1WNLA 1LVKA 1ABQA 1NBEB 1NLPC 2V8IA 2AZSA 2CYZB 1UGPB 1Q7YU 1OULA 2CP5A 2CUBA 1M2VA 2O01E 5I11A 3CCET 4AMCA 5GAN7 4M7AB 3FB9A 2QAZA 2KK4A 4LDUA 3G6EA 2G3RA 4JLIA 1TU0B 4RMOA 2M0YA 4PFZA 3C12A 1VOMA 2NUTB 1GFCA 1KJWA 2RK2A 5LL6S 4OP0A 2CKKA 1VUBA 1NYFA 1XNIA 1K73U 3T9NA 1YIJA 1CSKA 3X28B 2A0FB 1SRLA 2FPEA 4DBQA 2X4XA 1WHKA 3CCJQ 4A63B 2EQIA 4IURA 2EKHA 1Z9ZA 4D6WA 2OTLQ 4M77B 1ZHIA 1AHJB 4J9DA 5IHNA 1IB8A 2NYSA 3C4SA 1GRIA 4OMMA 2P0PA 2GFAA 2D8HA 3TU4K 3PIPA 1NJIC 1U1TA 3M5AA 4J9EA 1OYXA 1GCQA 3ULRB 1VQLQ 3CC2A 2O9VA 3SFMA 1YIJT 1QP3A 2KRNA 2D0NA 2EPDA 3I35A 3M59A 1Q81U 5D6WA 4JJBA 4C8QA 5GAN3 1KQSA 1IREB 2E6NA 2RJDA 3CCLA 3CCVA 3CMAQ 1Q86R 3CC2T 4BE1A 2CZ6B 2HCKA 3TQ7P 4M78A 2GBQA 2LQ8A 1K76A 2QQAA 4XU3A 4OMLA 1UGRB 1YITQ 5KCOA 3OBWA 4PJOD 3P8BB 3HKSA 4J83A 4M7DC 1C0MA 3OYLA 2HKQB 5KYYB 4J9HA 4ANJA 2EGCA 3CCLT 1VQNT 1AEYA 3NTHA 3CCVT 2W0ZA 3JV3A 4C8QG 1K9MR 3VRYA 5LJ3f 1U1SA 1QKWA 2DTIA 1KFZA 2DIQA 3CD6A 3REBB 2HBPA 4LDYA 4BDYA 2ZPHB 1W2BA 5DY9A 3OY9A 4DEXA 2DETA 1I07A 4M78G 4GLKA 3FIFA 3S6WA 1BYMA 2VUBA 3VS5A 2ATCB 4DOVA 2DYIA 2LT4A 4CC4B 1BB9A 1K0XA 5A0DA 2FG0A 2A7YA 3V7CA 4F7UA 2JS0A 4YTLA 1BU1A 3G4SA 2RHYA 3JCMQ 4FCYA 4X9CA 1RACB 2LNHB 1S72A 2DF6A 2JXBA 3I56T 2VKNA 1VQKA 1KHCA 2GQIA 4JZ4A 5KYUA 1QVFA 4WF2A 3GPLA 1JJ2S 2RN8A 2Z0WA 4C8QB 4JS4A 5EC7A 1N5ZA 4PJLA 2QA4Q 3JCMe 2L3RA 2O4XA 1RAAB 3Q1JA 3V8KA 1ZBXA 3G4ST 4BE0A 3I55Q 1MMNA 4C5GA 4F7UG 4V2SA 2DO3A 5LJ5h 1K9MU 3EH2A 4M78B 2FL7A 2R58A 1VQKT 1H8KA 1OEBA 4EDUA 4BY6B 2HQHA 1VQ9Q 4JRQA 1PSFA 2RI3A 4IUPA 2X4YA 2JMAA 4IIOA 1VQPA 3H0FA 3JCMd 2AK5A 5GAMe 4XK8E 2DNUA 2KY9A 4ZN1A 2X35A 1R0CB 3GOXA 2DD4A 2K5IA 2CT3A 2ECZA 2PTKA 1WQ7A 4FT2A 2HDAA 5KYNA 1WZOA 4DBHA 1OPLA 1VQPT 1CKBA 5GANh 4MDXA 1VYUA 2FZCB 2DTOA 3OS1A 4O6JA 2RHIA 4F7UB 4FU6A 1VQMA 3QWYA 2DL7A 2KXCA 5HK3A 5I2SA 2X4JA 1YHQA 4J6XA 4EPCA 3JCMg 2EQUA 1VQ5Q 3VU3C 2IPOB 3A8HB 3QO3A 2EGEA 2K5FA 2DBMA 2F2VA 1YJ9Q 1UGSB 2KYMA 2M51A 1M27C 5CVIA 3QUIA 4LD9K 3JCMc 1VQMT 1NZ9A 1K8AR 2QQRA 2O4XB 4JLGA 4ZTJA 2A3LA 2DBKA 3E19A 4PJOA 1FYNA 3PVLA 5AT1B 1YHQT 1A0NB 4XTYA 1WJQA 4C0DC 2H8HA 3UPUA 5CKEA 1UUEA 4OMFB 1VA7A 3E9GA 4F16A 2CZ7B 4JJDA 4HCBA 2Y90A 4KULA 2YSQA 3OYKA 5CQYA 4M7AC 2M02A 5IXFA 3X25B 1M1GA 2FVUA 1Q86C 3A1PA 5GMKm 5FU6B 3H8ZA 2RI5A 3GBQA 3FEOA 3HSBA 4PJNA 4PJJA 2KR3A 1OX9A 3EGXA 2RHUA 3M0TA 3G1JA 4PJOG 4F04B 2XDDA 1SF9A 3OYHA 1PSEA 2CSIA 1M8MA 1ZSGA 4QQDA 1M9SA 4HVVA 5FU7C 1AZGB 5CKHA 3WVDB 3CCSA 4M77C 1PKTA 4C0FA 3H0HA 2DEUA 1WHLA 5IAYA 2KQWA 2KSSA 2LQKA 4Z88A 1M4ZA 1RABB 1OU9A 1YN8A 3EG9B 2V8JA 1QVGA 4LD6A 2X9HA 4EMKA 2SRCA 3M9QA 1XQHA 1TSFA 2ZCFB 2O9SA 3M0QA 3CCST 2VGNA 2L5QA 3CCQA 2RJCA 5GANd 1HSQA 3A8OB 2JM8A 3VS3A 3HTRA 2C0TA 3OYJA 4EMGA 4B6MA 2A28A 3REAB 1AZEA 3SWNA 2K79A 2NUZA 3FJPA 3RIRA 4CI0C 4TVRA 3PFSA 2K2VA 5CIUA 1VYVA 3OYYA 1IHWA 2QGGA 5CCAA 1JBMA 4C5HA 1I8FA 2ZAEA 3M0SA 2RQTA 4FSXA 1NJIR 3CCQT 3JB9D 2D9TA 4FM4B 4M75E 3GF5A 1JXOA 5C0MA 3CMAA 2F5TX 3R6OA 2P4TA 2X4WA 4OB0B 4WTOB 3L2UA 1ZQ1A 2L8DA 1YJWA 3UT1A 1IGQA 5LJ5f 2OTJQ 4MMLA 3IQLA 4Z02A 5A0GA 1KQSS 2DFUA 3RKXA 5GANg 3JCMV 2MIOA 1GBQA 2QTVA 1MV0B 5GMKh 2LJ3A 1HD3A 4XTZA 3UATA 1OI1A 2EKOA 3ZEHA 5L8RE 2KE9A 2QDYB 1NG2A 1X75C 1M1KC 5GAOp 1UEBA 2J06A 4A4EA 2LQWA 5KYXA 1XOVA 1YJWT 2E3HA 1D3BA 1SG5A 2JM9A 4LN2A 2JS2A 4J5YA 2SEMA 3MEWA 1GCQC 5D7UA 4ELZC 4ZGJB
chains in the Genus database with same CATH topology
2RK2A 5LL6S 4OP0A 5GANf 3OS5A 4EMKB 2CKKA 1VUBA 3EAEA 2F5KA 4PJOC 2OTJT 2VV5A 1XNIA 3L42A 2E10A 3JCMJ 3M55A 1K73U 3T9NA 4KBMB 3DLLA 4OVAA 2EWNA 1W2BS 5IN1A 3RESA 4IUTA 1YIJA 1OZ3A 3M54A 1U8RA 3X28B 3JRZA 2PVDB 4C8QC 2K3YA 4MDWA 2RA2A 4HCCA 4PLLA 4BI4A 2X4XA 1NJIU 5GAMf 1Y96A 2PU9B 4IURA 1BIAA 3PMTA 3INZA 4M77B 4D6WA 2IG0A 1K73C 3SWNB 4C0ZA 1ZHIA 1AHJB 5KE2A 4C92D 4BDZA 2PUOB 1NPPA 3C4SA 3MP1A 5GANj 1VQ6A 2CGHA 2ZPEB 2EQJA 2P0PA 3DKMA 3OMCA 2GFAA 3QDRB 4KUIA 3CMET 3TU4K 4NL2A 3PIPA 1NJIC 3NTKA 1U1TA 2KMTA 3M5AA 4KUDK 1OYXA 2LCCA 3CC2A 1K8AU 2LNVA 3SFMA 1N9SA 2WSFE 3OSSC 2RH2A 4BY6C 1YIJT 4C92F 1KQ2A 3PTAA 3CCJA 1QP3A 3E1SA 3CC7A 1OZ2A 3JAME 3ZBDA 2OTLA 5DLQE 5GAMj 3HP9A 2QQSA 5GAOq 5GMKl 4HCZA 3M59A 2LVMA 3BFMA 4HA8A 3LWHA 1Q81U 5D6WA 4OGCA 4A4HA 2RJEA 3OQ5A 3V8JA 1K8AC 1QVFS 2JZ2A 4C8QA 1G3YA 3C94A 5GAN4 5GAN3 1KQSA 4QQGA 4RCCA 1N27A 3ASKA 2LC4A 3UDCA 1IREB 2DAQA 2E6NA 1VQ6T 1VQLA 4MZMA 4OB2B 4DA4A 4NS5A 2RJDA 1M90U 2JTMA 3VJPA 3CCLA 1Q81C 4QQ6A 3CCVA 1JB0E 3CC2T 4BE1A 1KQ1A 2CZ0B 1N8RU 3M57A 2JTFA 2CZ6B 3CCUA 3UWNA 3CXCS 5HK0A 4NOYA 2P0KA 2RK1A 4IUQA 3CCJT 3CC7T 4M78A 3JCMW 2MF2A 2LQ8A 2YRVA 5CR2A 2OTLT 1M90C 2QQAA 4XU3A 1UGRB 2HAXA 3OYEA 5KCOA 3OBWA 1DJ7B 3P8BB 3HKSA 3X20B 1N8RC 4PJOD 3L2QA 1QW1A 3LLRA 4J83A 2YLBA 4M7DC 4VUBA 3ME9A 3VUBA 1D3BB 3V8LA 3OYLA 4IKFA 3TREA 2LRQA 4BD3A 4ZGDB 1VQLT 2GCXA 4A4GA 3RERA 4XU2A 3CCLT 2XIDA 1VQNT 3NTHA 3X24B 3CCVT 4C8QG 4JRIA 2HQEA 2MMPA 2DXCA 3CEYA 3CCUT 3PIOA 1WJSA 5LJ3f 1YITA 1U1SA 4JRKA 2DTIA 3QBYA 2DIQA 3CD6A 2PVOB 3MP8A 2HBPA 1UGQB 4LDYA 2M1HA 2XU8A 3OYMA 4CRIA 4BDYA 2PVGB 3A8MB 2ZPHB 3OW2S 1W2BA 3RMQA 2VXEA 4Y91A 5DY9A 5GAN8 1B34A 5GAOl 2VXFA 3OY9A 3G71T 1VQ8A 2M0OA 4C8QE 2E5QA 4M78G 4GLKA 3FIFA 4OGEA 1GXIE 2DXBA 4A4FA 4O5VA 3CMAT 3S6WA 1BYMA 4BE2A 2VUBA 3A8LB 3JB9J 3GNFB 4DOVA 4M7DA 4QW2A 2BUDA 3X26B 1Y96B 3HHTB 4E47A 3QPHA 2DTHA 2LT4A 2VC8A 3RKYA 1I4K1 4PNOA 5A0DA 1YCYA 1YITT 1KHIA 2A7YA 4XAXB 3V7CA 2GQVA 4F7UA 2K5LA 5AYFA 5LJ5e 1P92A 1LOJA 1KG1A 4M78E 1O75A 2LX9A 5KE3A 5J26A 5EG2A 4YTLA 3BY7A 2CZ1B 3G4SA 2RHYA 2RHXA 4M75D 3URGA 4N0AC 3JCMQ 2E12A 4M7AD 4X9CA 1BI1A 1VQ8T 4MMKA 1M1FA 1M5Q1 2E65A 1S72A 2FB7A 3GLXA 3I56T 1IZ6A 4JS5A 1VQKA 2RHZA 1KHCA 1RI0A 1XTDA 3KXTA 3M58A 3LGLA 2EJFA 1QVFA 4WF2A 3GPLA 4M75F 3QIIA 5C6SA 5IT9E 4PLIA 1JJ2S 4M7AF 4C8QB 3OYAA 4JS4A 2AHJB 3FRNA 4A53A 3MO8A 3JCMe 1Y71A 2EJ9A 3MCAB 4J8OA 1I5LA 2L3RA 4PL6A 3G6ET 2O4XA 4M7DG 3JB9H 4XTXA 3JCMP 3Q1JA 3V8KA 1ZBXA 3G4ST 4Y28E 3PNWC 4BE0A 2QXFA 2XKOC 4B9XA 5LJ5d 2E1HA 1JRIA 3CXCA 2K4YA 2XG8D 3PMIA 4B9WA 2OAUA 4F7UG 1I81A 4C5GA 4V2SA 2DO3A 2EAYA 4XU0A 4M77D 5LJ5h 3JB9G 1K9MU 4M78C 1YI2A 2EIFA 4M78B 2FL7A 2HD0A 2R58A 4N0AA 4XTUA 1VQKT 1WJRA 3TCJA 5I2MA 5FROA 3L2VA 1X01A 4IUUA 3E9FA 4EDUA 3CPWS 3QHSA 5GANe 4BY6B 2QA4A 3AHUA 4JRQA 4M7DE 2WSCE 2ZZDA 1PSFA 3FDRA 4UC4A 3OS2A 2RB6A 2RI3A 3L1AA 4N4HA 4IUPA 2X4YA 1K9MC 2R57A 4M77F 2JUFA 2QI2A 3META 1VQPA 4F7UE 4KT0E 4NL3A 3I55A 4N4IA 4Q5WA 3J7AF 1UB4A 4C0GA 3JCMd 5A0LA 5GAMe 4J6WA 3JCMh 2Y4XA 4JRPA 2B8AA 4XK8E 2KY9A 3L2RA 4ZN1A 2X35A 1YI2T 1VQ9A 1M8VA 3N5BB 3GOXA 1NPRA 2DD4A 2K5IA 5GAN6 2JOYA 1G3WA 2CS7A 3ER0A 4FT4A 4OF1A 1WQ7A 3OW2A 2DD5A 2XDPA 4RG2A 2QA4T 2K3XA 2ZPFB 4FT2A 3O8VA 3RMSA 5A2QE 2DXTA 4C92A 1B34B 5GMKj 2EQKA 2FHDA 1N6AA 4J6YA 2H3JA 3OYNA 5LJ5g 4E7HA 1VQPT 2R5AA 3I55T 3KBGA 4BB7A 5GANh 4MZTA 4M7DB 4MDXA 2DTOA 3QZ9B 2VGMA 4O6JA 5HY6A 3OS1A 1HXDA 5M9OA 5J39A 2JVVA 4X9DA 2IVWA 2RHIA 2Y4YA 2RJFA 4P5NA 4F7UB 3DB4A 3M53A 5DLOA 1VQ9T 4PJOB 4FU6A 1VQMA 2LT1A 2E64A 3GNGA 2YLCA 2BIVA 3HFOA 1Q82U 4QVCA 1VQOA 4XU1A 3QYGB 5GAMh 5HK3A 4LDWA 4ME7A 2X4JA 5I2SA 1YHQA 3FLGA 4J6XA 4EPCA 1QVGS 3JCMg 2EQUA 3GIBA 2DPPB 3VU3C 3OYFA 1FX7A 4BACA 2FYKA 3A8HB 3QO3A 2BKDN 3EFRA 1H641 2K5FA 1Q82C 4DQ2A 3DB3A 3VYHB 3HRSA 1MGQA 2DVEA 2ZPBB 1JJ2A 1UGSB 1O9SA 4C92G 5CKFA 5CVIA 3QUIA 4L59A 4R55A 3CCMA 4QVDA 2PQWA 3JCMX 2ZPGB 4LD9K 4LDVA 4FIBA 3JCMc 1VQMT 1NZ9A 2XDBA 2MWOA 2O4XB 2E6ZA 2QQRA 5CQXA 4QVZA 3QJYA 1VQOT 4JLGA 2E41A 4BI8B 1VQ5A 4ZTJA 4C5EA 4HKEA 2A3LA 3E19A 4PJOA 4RKUE 3WVEB 2QQBA 4OB1B 1YHQT 3CD6T 4JJNK 5CKDA 1QVPA 2WSEE 3VKIA 1BI3A 4BI3A 4XTYA 3TEEA 1FWZA 1WJQA 4C0DC 2LTOA 4C0DB 4C92E 1YJ9A 2RM4A 1W4SA 2GF7A 5LJ3e 2LDMA 2NLUA 1VIFA 3CPWA 3UPUA 3CCRA 5CKEA 2VYTA 2DIGA 1R8OB 4OMFB 1Q86U 5LJ5j 3E9GA 2CZ7B 3KUFA 3MHXA 4HCBA 2Y90A 4KULA 4ZN3A 1KC8U 1V29B 2QQ9A 3EFSA 3A8GB 2EJGA 3J80E 3OYKA 3CCMT 2LCLA 3HRUA 4M75C 4OB3B 3BW1A 5CQYA 1LJOA 5DM7R 4M7AC 1Y07A 2XK0A 3LX7A 2DZ9A 3X25B 1BIBA 2R5MA 1M1GA 1BKBA 3J81E 2WACA 4E7JA 4E7KA 1VQ5T 2FVUA 3LGFA 5KCHA 1Q86C 5GMKm 5FU6C 3OYGA 5FU6B 3H8ZA 3V7RA 3MEVA 3DLMA 2RI5A 4ELYC 2GFUA 1KC8C 5GAN2 2EQMA 3FEOA 3HSBA 4XTVA 2XI9A 3CMEA 1YJ9T 4HT8A 4C8QD 4EMKC 2K57A 2XD0A 2HNIA 3H6ZA 1QP2A 3CCRT 4R56A 1Y7XA 2RHUA 1WPYA 3CPFA 4PJOG 2XDDA 4EMHA 4RCBA 3FC3A 1S72T 5LJ3d 1BI2A 3OYHA 1PSEA 5GAOn 3S3OA 3QG1A 2RD1A 4C92C 4C92B 3OYDA 3HFNA 5LJ3h 1YBYA 4RG8A 5FU7C 4C8QF 1M9SA 4L6V5 4QQDA 4L5GA 5CKHA 5FU7B 4E7IA 1N9RA 3RUXA 1WGSA 3CC4A 3WVDB 3CCSA 2D6FA 4M77C 2MWPA 1EIFA 4M78D 3F70A 3LW5E 3SWNC 4M75A 2P0QA 4C0FA 5GAOr 5CK9A 4M7AA 3SD4A 4J7IA 2JN0A 5IAYA 2QEXA 4PJOE 2KQWA 2KSSA 2MI6A 4A54A 1YJNA 5FRMA 2D0QB 1VIEA 2LQKA 4ZTFA 4IUVA 1HK9A 1M4ZA 2QTXA 3OBYA 1VQ7A 5D6XA 3MP6A 5KH6A 3V7SA 5HKCA 3L2WA 2V8JA 4M78F 2RI2A 1QVGA 4LD6A 1H3ZA 1WQWA 2ZPIB 4EMKA 4DOWA 2HQXA 5D6YA 1MHNA 2DEQA 2L89A 4JDSA 3OYBA 3M9QA 4MZPA 1BI0A 1XQHA 2ZCFB 3JSCA 3CC4T 5CAIA 3PGGA 4XTWA 3CCST 2VGNA 3ZFJA 2DJZA 2L5QA 3SB2A 3CCQA 2RJCA 5GANd 3HRTA 3A8OB 5J3BA 2QEXT 2RO0A 2EYQA 3OMGA 4N4GA 1YJNT 3M56A 3OYJA 2KDSA 3A5ZB 4GY5A 4EMGA 5GAOm 5LJ3g 4M77A 3MEUA 3SWNA 1VQ7T 3OA6A 3BDLA 2DK3A 3FJPA 3RIRA 5GMKe 4CI0C 4TVRA 3S3NA 3PT9A 4C5IA 1VQNA 3QSUA 3HL8A 4M75G 3VV0A 2M9UA 3P8HA 2ZGWA 4ZGEB 3PFSA 4M7AG 3NTIA 4J7FA 2K2VA 5CIUA 5GAMd 2XICA 3OYYA 4FL6A 4M7DD 3C95A 3MEAA 5CCAA 2F69A 1JBMA 4C5HA 1KD1U 2C06A 1X6OA 3QJ6A 1I8FA 1VQ4A 4HT9A 2MAMA 3NFCA 3CBPA 5GMKi 4FSXA 3OYCA 3CCQT 5FRNA 3JB9D 2EFIA 3G71A 2D9TA 4FM4B 4M75E 3BDUA 3GF5A 4M7AE 1KD1C 5C0MA 2XHCA 4M7DF 3CMAA 2F5TX 3CBMA 3R6OA 3VUZA 1G3SA 2P4TA 2X4WA 3LH0A 4OB0B 1FXXA 3L2UA 3JCMb 3CCEA 2I2LA 1ZQ1A 2L8DA 1YJWA 3UT1A 1G3TA 2M16A 3M4GA 4MMLA 3SDZA 5LJ5f 5GAN5 3OS0A 4Z02A 4PJOF 4F7UF 2PUKB 3G7ZA 5A0GA 1KQSS 3QXEB 3JB9F 3OB9A 1NE8A 3CBOA 3QYHB 4M77G 1G5VA 4II1A 2KAFA 3RKXA 3JCMV 5GANg 3P8DA 3OYIA 5I21A 4A4KA 1WNLA 1M1KU 5GMKh 1VQ4T 3S3MA 1SSFA 2DZCA 2DXUA 4XTZA 2KVQG 1OI1A 2EKOA 2V8IA 4BUGA 2CYZB 3ZEHA 1UGPB 5L8RE 5CO7A 3GP8A 2QDYB 2YHTA 1Q7YU 4ATOA 2DKGA 1X75C 2JNGA 1LNXA 2E70A 3I56A 1M1KC 2OTJA 5FLXE 3LWIA 5GAOp 5GAMg 1UEBA 2O01E 4A4EA 4M77E 3CCET 3JCMf 1XOVA 1YJWT 1D3BA 5GAN7 5LJ3j 4M75B 4E7LA 3VYGA 1RL2A 4M7AB 1Q7YC 4PKCC 3FB9A 4LDXA 2KK4A 3L2ZA 4LDUA 3JB9I 3G6EA 3WXMB 2G3RA 3HPWA 3QZ5B 2V8KA 4JLIA 4X34A 3RKWA 5CKBA 4JUVA 4XQ3A 3M4YA 1TH7A 4J5YA 3OSVA 4RMOA 3MEWA 3LYIA 3QKJA 3C12A 4ELZC 4ZGJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN h;  1B34 A;  4OP0 A;  2VXF A;  5GAN 8;  5GAO l;  4C8Q E;  4M7D B;  4M78 G;  1HK9 A;  5GAN f;  2QTX A;  3FIF A;  4EMK B;  2DTO A;  4A54 A;  1HXD A;  4X9D A;  3V7S A;  2E10 A;  3JCM J;  3JB9 J;  4M78 F;  4M7D A;  2EWN A;  4PJO C;  1WQW A;  4EMK A;  3RES A;  4F7U B;  1Y96 B;  4PJO B;  2DTH A;  2E64 A;  2DEQ A;  2VC8 A;  2YLC A;  1I4K 1;  3HFO A;  3RKY A;  4C8Q C;  2RA2 A;  4QVC A;  4PNO A;  4XU1 A;  5GAM h;  1YCY A;  3V7C A;  4F7U A;  5GAM f;  1Y96 A;  5CAI A;  5LJ5 e;  3PGG A;  4XTW A;  1LOJ A;  4J6X A;  2DJZ A;  1BIA A;  4M78 E;  3INZ A;  4M77 B;  3JCM g;  3VU3 C;  3GIB A;  3SB2 A;  3SWN B;  5GAN d;  2FYK A;  4C92 D;  3BY7 A;  3QO3 A;  3EFR A;  4M75 D;  4N0A C;  1H64 1;  3JCM Q;  4M7A D;  5GAN j;  4X9C A;  4DQ2 A;  2CGH A;  4EMG A;  5GAO m;  5LJ3 g;  4M77 A;  1MGQ A;  2DVE A;  4MMK A;  1M5Q 1;  4NL2 A;  3SWN A;  2E65 A;  1U1T A;  2FB7 A;  3FJP A;  3RIR A;  4C92 G;  5GMK e;  3QUI A;  3QSU A;  4M75 G;  2ZGW A;  4QVD A;  4M7A G;  1N9S A;  3JCM X;  2EJF A;  1KQ2 A;  4C92 F;  5GAM d;  3JCM c;  4WF2 A;  4M75 F;  4M7D D;  1JBM A;  4M7A F;  4C8Q B;  5GAM j;  2E41 A;  5GAO q;  1I8F A;  4A53 A;  5GMK l;  3JCM e;  4HT9 A;  2EJ9 A;  4PJO A;  3BFM A;  1I5L A;  4HA8 A;  3V8J A;  5GMK i;  4M7D G;  4C8Q A;  3JB9 H;  4XTX A;  4XTY A;  3V8K A;  4C92 E;  3JCM P;  3JB9 D;  5GAN 4;  2RM4 A;  4M75 E;  3BDU A;  5LJ3 e;  5GAN 3;  4RCC A;  5LJ5 d;  4M7A E;  2E1H A;  1JRI A;  4M7D F;  4F7U G;  1I81 A;  5LJ5 j;  4V2S A;  2EAY A;  4XU0 A;  4M77 D;  5LJ5 h;  3JCM b;  2I2L A;  3JB9 G;  4M78 C;  2Y90 A;  4M78 B;  4N0A A;  4XTU A;  3M4G A;  4MML A;  5LJ5 f;  5GAN 5;  3EFS A;  1KQ1 A;  2EJG A;  4F7U F;  4PJO F;  4Y91 A;  4M75 C;  1X01 A;  3BW1 A;  3JB9 F;  1LJO A;  3QHS A;  5GAN e;  4NOY A;  3AHU A;  4M7A C;  4M7D E;  2DZ9 A;  4M78 A;  4M77 G;  3JCM W;  1BIB A;  3RKX A;  5GAN g;  3JCM V;  2RB6 A;  5I21 A;  1WNL A;  3L1A A;  5GMK h;  5GMK m;  4XU3 A;  2DZC A;  3V7R A;  4M77 F;  2DXU A;  4XTZ A;  4F7U E;  5GAN 2;  4NL3 A;  4PJO D;  3HSB A;  4XTV A;  4M7D C;  2YLB A;  4HT8 A;  3JCM d;  4C8Q D;  4EMK C;  2K57 A;  2YHT A;  1D3B B;  2DKG A;  3V8L A;  5GAM e;  1LNX A;  2HNI A;  4J6W A;  5GAO p;  3JCM h;  5GAM g;  1WPY A;  4PJO G;  3RER A;  4M77 E;  4RCB A;  4XU2 A;  4EMH A;  5LJ3 d;  3JCM f;  1M8V A;  1D3B A;  4C8Q G;  4JRI A;  5GAN 7;  5GAO n;  2RD1 A;  4C92 C;  5GAN 6;  4C92 B;  5LJ3 j;  3HFN A;  1WQ7 A;  4M75 B;  5LJ3 h;  4M7A B;  5LJ3 f;  4C8Q F;  1U1S A;  3FB9 A;  4JRK A;  2DTI A;  1N9R A;  3RUX A;  3L2Z A;  2DXT A;  3JB9 I;  4C92 A;  1B34 B;  4M77 C;  4M78 D;  5GMK j;  4JLI A;  4J6Y A;  3RKW A;  4M75 A;  3SWN C;  5GAO r;  4JUV A;  4XQ3 A;  5LJ5 g;  1TH7 A;  4J5Y A;  4M7A A;  2JN0 A;  4PJO E;  2VXE A;  5DY9 A; 
#chains in the Genus database with same CATH topology
 3MJX A;  5GAN f;  3OS5 A;  4EMK B;  2E5K A;  8ATC B;  2F1L A;  1VQ6 Q;  2A08 A;  1ZX6 A;  2AKL A;  1W2B S;  4OVA A;  1JXM A;  3M54 A;  4C8Q C;  2K3Y A;  4MDW A;  2RA2 A;  1IXD A;  1WI7 A;  1NJI U;  1Y96 A;  3CC7 Q;  1PWT A;  2FO0 A;  3PMT A;  3INZ A;  2IG0 A;  3SWN B;  4C0Z A;  5KE2 A;  1OV3 A;  5IHI A;  2PUO B;  1TOV A;  1NPP A;  5GAN j;  2ZPE B;  3QDR B;  3CME T;  3DKM A;  3S3O A;  1WHM A;  2A36 A;  3NTK A;  1WA7 A;  2YT6 A;  2RH2 A;  1RLP C;  4BY6 C;  1KQ2 A;  3SHW A;  3VRZ A;  4JJC A;  4E7Z A;  2J6F A;  3HP9 A;  1QWF A;  2LVM A;  4HA8 A;  2LJ1 A;  4OGC A;  2VAS A;  2RJE A;  2X3W D;  4A4H A;  1K8A C;  1QVF S;  2JZ2 A;  3C94 A;  2ROT A;  1PG5 B;  1C6V X;  2DMO A;  2L3S A;  1N27 A;  3ASK A;  2IIM A;  1ZUU A;  1WXU A;  4MZM A;  2DYB A;  2K2M A;  1EFN A;  2JTM A;  4QQ6 A;  1JB0 E;  2DRK A;  4RTT A;  2JTF A;  3UWN A;  5HK0 A;  4NOY A;  2P0K A;  4IUQ A;  2MF2 A;  2YRV A;  4LE9 A;  1F1B B;  1PRL C;  1GCP A;  2LX7 A;  4AG2 C;  5FWB A;  3UA7 A;  2CSQ A;  5KYX B;  1RAD B;  2JJ9 A;  4KGX B;  1D3B B;  3V8L A;  4IKF A;  2LRQ A;  4BD3 A;  4Y92 A;  9ATC B;  2HQE A;  2HSE B;  3PIO A;  3RBB B;  1WJS A;  2ED0 A;  1LPL A;  3QBY A;  1TUD A;  1UGQ B;  2XU8 A;  1T0J A;  2P84 A;  2BZY A;  1WYX A;  1U3O A;  1VQ8 A;  3G71 T;  4O5V A;  4J9F A;  1WLP B;  1UGV A;  2QK0 A;  3O5Z A;  4OMN A;  3X26 B;  1Y96 B;  4E47 A;  2DTH A;  5KYY A;  2DIL A;  1I4K 1;  4PNO A;  1KHI A;  5AYF A;  1P92 A;  1LOJ A;  1KG1 A;  3M0U A;  1ZSZ A;  2BZ8 A;  5EG2 A;  3BY7 A;  2E12 A;  2E3I A;  1BI1 A;  1VQ8 T;  1D0Z A;  3UF4 A;  1QCO A;  4J9G A;  3GLX A;  4JS5 A;  1ACM B;  1RI0 A;  4RTW A;  2COW A;  4PJM A;  2OAW A;  2EJF A;  4JZ3 A;  4DEY A;  2CP3 A;  4M75 F;  5C6S A;  1OU8 A;  3FRN A;  4A53 A;  3MO8 A;  1KD1 R;  3MCA B;  1I5L A;  4PL6 A;  3G6E T;  1RLQ C;  1U5S A;  3JCM P;  2GTJ A;  2E1H A;  3PMI A;  1BK2 A;  3CXC P;  2YUQ A;  2EAY A;  3JB9 G;  2EBP A;  2J6K A;  1YI2 A;  3EGD A;  3TSW A;  4N0A A;  4XTU A;  1TXQ A;  1WJR A;  4OMQ A;  3TCJ A;  5FRO A;  3QHS A;  2COZ A;  3AHU A;  4M7D E;  2WSC E;  3FDR A;  3OS2 A;  2RB6 A;  1G83 A;  4F14 A;  2XMF A;  1QKX A;  3MET A;  1FMW A;  1W1F A;  2DJQ A;  3JCM h;  2CH4 W;  1YI2 T;  1TUC A;  3N5B B;  4KH1 B;  2CT4 A;  5GAN 6;  2JOY A;  2CP2 A;  2XDP A;  4RG2 A;  3O8V A;  3OW2 P;  4FW2 A;  5GMK j;  4OMP A;  2EQK A;  2FHD A;  2L3P A;  2H3J A;  4E7H A;  1T0H A;  3KBG A;  4BB7 A;  1UHF A;  4HCK A;  4MZT A;  5KYW A;  1HXD A;  4X9D A;  1UE9 A;  1ZBJ A;  2Y4Y A;  4PJO C;  2RJF A;  1W6X A;  2LT1 A;  2E64 A;  3GNG A;  4GLM A;  1ZSZ B;  1VQO A;  3QYG B;  5GAM h;  2FPF A;  1MMA A;  3FLG A;  1QVG S;  3GIB A;  1PD1 A;  4BAC A;  2FYK A;  2BKD N;  3EFR A;  4DQ2 A;  3DB3 A;  3VYH B;  3CCR Q;  3CCM A;  2LZ6 B;  2PQW A;  3JCM X;  2ZPG B;  2XDB A;  5CQX A;  1TG0 A;  3QJY A;  1VQO T;  1YP5 A;  4BI8 B;  1X2Q A;  3CD6 T;  1BI3 A;  3TEE A;  3BE3 A;  1FWZ A;  4C92 E;  5HCK A;  2KNB B;  2LDM A;  3EGD B;  2BTT A;  3CPW P;  1Q86 U;  3MHX A;  1W70 A;  1I5O B;  1V29 B;  1M90 R;  3CCM T;  3A8G B;  2EJG A;  3J80 E;  2LCL A;  5DM7 R;  2CH4 A;  2XK0 A;  1WFW A;  1N8R R;  2R5M A;  1BKB A;  4E7K A;  2WAC A;  3LGF A;  5KCH A;  2GFU A;  2EQM A;  1S1N A;  4GBQ A;  2MPX C;  1YFN A;  2XI9 A;  1K0S A;  4HT8 A;  3TVT A;  4EMK C;  2QEX Q;  2K6D A;  3H6Z A;  1QP2 A;  1Y7X A;  2KT8 A;  1S72 T;  4RCB A;  1XJW B;  5GAO n;  2RF0 A;  3QG1 A;  2RD1 A;  4C92 C;  1WIE A;  4RTY A;  4RG8 A;  4L6V 5;  4L5G A;  3CC4 A;  1IGU A;  4HVW A;  2V1Q A;  4ATO A;  3SWN C;  4DBR A;  7AT1 B;  1M1K R;  3SD4 A;  5KYW B;  1MNE A;  2JN0 A;  3UA6 A;  1YJN A;  4A54 A;  1Y57 A;  2D0Q B;  1QLY A;  1Q95 G;  5I22 A;  2MOX A;  1VQ7 A;  3OBY A;  2RI2 A;  1UG1 A;  2HQX A;  4CC2 A;  1MHN A;  1WDX A;  2L89 A;  4JDS A;  4MZP A;  1G2B A;  2RQR A;  3CC4 T;  2HZY A;  2DJZ A;  2K3B A;  5J3B A;  4R0K A;  2YUO A;  2EYQ A;  1YJN T;  3M56 A;  2KDS A;  4GY5 A;  3EG1 A;  3MEU A;  1VQ7 T;  2C0I A;  4C5I A;  3QSU A;  3P8H A;  4J7F A;  3CCE Q;  5GAM d;  2XIC A;  4AG1 C;  3C95 A;  4PK4 A;  2F69 A;  2D1X A;  3EG9 A;  1X6O A;  3QJ6 A;  1VQ4 A;  2MAM A;  1AWW A;  1RAF B;  3CBP A;  3OYC A;  2CP0 A;  2EFI A;  3BDU A;  4M7A E;  1KD1 C;  4M7D F;  2XHC A;  1B3Q A;  2GNC A;  1WHJ A;  2X51 A;  4X1V A;  1G3S A;  1M3B A;  3JCM b;  1GBR A;  3LH5 A;  2YUN A;  1G3T A;  5GAN 5;  3M4G A;  3SDZ A;  2F2X A;  3OS0 A;  4PJO F;  3G7Z A;  1IRX A;  3QXE B;  3OB9 A;  4EIK A;  3CBO A;  3QYH B;  1RAG B;  1M1K U;  3OYI A;  3P8D A;  4A4K A;  1VQ4 T;  2DXU A;  4QKU A;  2KVQ G;  4BUG A;  2MK5 A;  5CO7 A;  2H3E B;  2DKG A;  2JNG A;  1H92 A;  2EVR A;  5FLX E;  3LWI A;  5GAM g;  3RDV A;  4M77 E;  3JCM f;  1QCF A;  1PHT A;  1X69 A;  4E7L A;  2JTE A;  1RL2 A;  1YIJ Q;  3HPW A;  1TS9 A;  3QZ5 B;  5CKB A;  4JUV A;  1TH7 A;  1MND A;  3OSV A;  3LYI A;  1M2O A;  1NYG A;  2FPD A;  1Z9Q A;  3EAE A;  4ZNX A;  2F5K A;  1JO8 A;  2YXY A;  2C0O A;  3L42 A;  1PC0 A;  2E10 A;  3JCM J;  3M55 A;  2DL8 A;  3DLL A;  2EWN A;  2LJ0 A;  1OZ3 A;  1U8R A;  2K7A A;  3JRZ A;  2PVD B;  3CC2 Q;  1NLO C;  1BCO A;  4HCC A;  3PVQ A;  4PLL A;  4BI4 A;  1YWO A;  1Q82 R;  5GAM f;  1BIA A;  2PNI A;  2LQN A;  2CGH A;  3OMC A;  1E6G A;  4KUD K;  4RTV A;  1K8A U;  2LNV A;  2I0N A;  4C92 F;  3CCL Q;  1VQN Q;  3PTA A;  3CCJ A;  3CCV Q;  3E1S A;  1OZ2 A;  3ZBD A;  2OTL A;  5GAM j;  2QQS A;  1OOT A;  2D8J A;  4HCZ A;  3THK A;  3BFM A;  3OQ5 A;  1G3Y A;  5GAN 4;  4RCC A;  2KT1 A;  4J9I A;  2LC4 A;  1VQL A;  1R77 A;  3VJP A;  3C0C A;  2CZ0 B;  3M57 A;  3I5R A;  1KC8 R;  2RK1 A;  3CCJ T;  2CDT A;  3JCM W;  2OTL T;  4FSS A;  1M90 C;  2CRE A;  4FYX B;  3OYE A;  1N8R C;  1I0C A;  3L2Q A;  2DLP A;  3H0I A;  2YLB A;  4VUB A;  3TRE A;  4KH0 B;  4ZGD B;  1VQL T;  1X2K A;  3RER A;  1TTH B;  3I56 Q;  4JRI A;  1E6H A;  2O88 A;  1ZSZ C;  1YIT A;  2PVO B;  2E4H A;  2M1H A;  1MMG A;  3A8M B;  3RMQ A;  2VXE A;  4Y91 A;  1B34 A;  5GAO l;  4C8Q E;  2E5Q A;  3G4S Q;  4LXC A;  4OGE A;  2DXB A;  1FMK A;  3CMA T;  1KIK A;  3JB9 J;  2KBT A;  2BUD A;  1ZUY A;  1SKU B;  3MKD A;  3QPH A;  1AWO A;  1VQK Q;  2VC8 A;  4HXJ A;  2MYS A;  1YIT T;  4XAX B;  5FRN A;  2GQV A;  2K5L A;  4M78 E;  5KE3 A;  2LX9 A;  3U23 A;  2GTO A;  2QAS A;  4M75 D;  4N0A C;  3URG A;  4KRT A;  4MMK A;  1M1F A;  1HYO A;  4AFS C;  2FB7 A;  3FJ5 A;  2RHZ A;  3KXT A;  1SPK A;  3M58 A;  3EHR A;  4AFQ C;  4M7A F;  2AHJ B;  1B07 A;  2EJ9 A;  4J8O A;  1UJ0 A;  1R0B G;  2YRC A;  3NPF A;  4Y28 E;  1VQP Q;  2QXF A;  3CXC A;  4B9W A;  1TUG B;  1I81 A;  4M78 C;  1MV3 A;  2HD0 A;  5I2M A;  1QMC A;  4IUU A;  3E9F A;  2QA4 A;  2OI3 A;  2ZZD A;  1JU5 C;  4UC4 A;  3CCU Q;  3L1A A;  4N4H A;  4M77 F;  3VS2 A;  2JUF A;  2QI2 A;  4F7U E;  4KT0 E;  4NL3 A;  3I55 A;  2CP6 A;  3J7A F;  5A0L A;  4J6W A;  2DX1 A;  1NM7 A;  1Q7Y R;  4JRP A;  2B8A A;  2X3X D;  3L2R A;  1T3L A;  2KEA A;  1VQ9 A;  2RNA A;  1M8V A;  1G3W A;  2CS7 A;  4OF1 A;  3OW2 A;  2DD5 A;  2QA4 T;  1VQM Q;  5A2Q E;  1YCS B;  1B34 B;  2DE0 X;  2DER A;  1M30 A;  1UEC A;  4J6Y A;  3OYN A;  2KRO A;  1TWB A;  2R5A A;  3I55 T;  2VVK A;  1YHQ Q;  4AT1 B;  4RUG A;  3E2U A;  5HY6 A;  4FYV B;  5M9O A;  5J39 A;  2JVV A;  1UFF A;  1VQ9 T;  4P5N A;  2EYX A;  3M53 A;  2P4R A;  1K73 R;  1UTI A;  4E2F B;  2L3Q A;  2YUP A;  4ME7 A;  1AVZ C;  2DPP B;  2NWM A;  3OYF A;  2CP7 A;  1H64 1;  1SEM A;  1Q82 C;  3HRS A;  1MGQ A;  2ZPB B;  5GJV B;  2EYY A;  4FYW B;  1JJ2 P;  2K9G A;  5L23 A;  4QVD A;  4FIB A;  4HVU A;  2HSP A;  1WXT A;  1T3S A;  1C1A A;  2E6Z A;  2B86 A;  4QVZ A;  1QQJ A;  1VQ5 A;  2CUD A;  4C5E A;  4RKU E;  2W10 A;  2QQB A;  5CKD A;  1QVP A;  2LTO A;  4C0D B;  1YJ9 A;  1Q81 R;  2RM4 A;  5LJ3 e;  2NLU A;  3CPW A;  4M4Z A;  2DIG A;  1AD5 A;  3KUF A;  4LUD A;  2QQ9 A;  3EFS A;  4OB3 B;  3HRU A;  3BW1 A;  1M3C A;  1Y07 A;  2DZ9 A;  2V26 A;  4E7J A;  5ECA A;  1VQ5 T;  5FU6 C;  3OYG A;  2AKK A;  3MEV A;  3R6N A;  4ELY C;  1B7T A;  4RTZ A;  1KC8 C;  5GAN 2;  3CCS Q;  1YJ9 T;  1K4U S;  1V76 A;  2QGF B;  2J05 A;  4EMH A;  2ABL A;  5LJ3 d;  3EH1 A;  1K1Z A;  2PZ1 A;  3AT1 B;  4C8Q F;  5FU7 B;  2D6F A;  2MWP A;  1EIF A;  1WHG A;  4M75 A;  5CK9 A;  4J7I A;  1JQQ A;  4PJO E;  4CC7 A;  5FRM A;  1SHG A;  1VIE A;  3CCQ Q;  4IUV A;  1HK9 A;  2RQV A;  2QTX A;  1MMD A;  5KH6 A;  4M78 F;  2JMC A;  4PFP A;  1UJY A;  1WQW A;  3MPU B;  5D6Y A;  2DEQ A;  2BE7 D;  3OYB A;  2FRY A;  2JW4 A;  1BI0 A;  5GJW B;  1U06 A;  3JSC A;  5CAI A;  4XTW A;  1AT1 B;  4N4G A;  3OMG A;  2F2W A;  5LJ3 g;  3VS1 A;  4RTU A;  3BDL A;  2DK3 A;  2DL5 A;  3S3N A;  1VQN A;  3PT9 A;  4ESR A;  2VWF A;  3HL8 A;  4M75 G;  3VV0 A;  2M9U A;  4ZGE B;  2ZGW A;  2ESW A;  5IXB A;  3NTI A;  2DA9 A;  1YJW Q;  4M7D D;  1YWP A;  3MEA A;  1KD1 U;  1Y0M A;  2DVJ A;  4HT9 A;  3NFC A;  5GMK i;  1M2V B;  4J9B A;  3CBM A;  3VUZ A;  6AT1 B;  3LH0 A;  2J7I A;  3CQT A;  2M16 A;  1RAI B;  2ED1 A;  4F7U F;  2PUK B;  1NE8 A;  2KYB A;  2KAF A;  3EFO A;  2V1R A;  5I21 A;  3S3M A;  2ENM A;  1IHV A;  1SSF A;  2DZC A;  2FRW A;  2DL4 A;  2KXD A;  3GP8 A;  2YHT A;  1LNX A;  2E70 A;  3I56 A;  2OTJ A;  2KRS A;  3CME Q;  3I5S A;  1PCX A;  5LJ3 j;  4M75 B;  4Z89 A;  3VYG A;  1Q7Y C;  4PKC C;  3ZL7 C;  4LDX A;  3L2Z A;  3JB9 I;  3WXM B;  4X34 A;  2V8K A;  3RKW A;  1WHH A;  4XQ3 A;  3M4Y A;  1GFD A;  3QKJ A;  1X6G A;  2YRD A;  1YNZ A;  2FZG B;  5IHK A;  3EG3 A;  1D0Y A;  1ZA1 B;  3EHQ A;  2YDL A;  2OTJ T;  1NEG A;  2VV5 A;  1RUW A;  3TSZ A;  4KBM B;  5IN1 A;  3RES A;  4IUT A;  2PU9 B;  3KFV A;  1K73 C;  4C92 D;  4BDZ A;  3MP1 A;  2AT1 B;  1VQ6 A;  2EQJ A;  4KUI A;  4NL2 A;  2KMT A;  2LCC A;  3VS0 A;  1OQK A;  1N9S A;  2WSF E;  3OSS C;  2QDL A;  4WCI A;  3CC7 A;  3JAM E;  5DLQ E;  1ZA2 B;  5GAO q;  5GMK l;  3VS7 A;  3LWH A;  3V8J A;  3VS6 A;  3D7S B;  2BE9 B;  1K9A A;  2DRM A;  4QQG A;  3UDC A;  1VQ6 T;  2DAQ A;  1KQS P;  1ZLM A;  4OB2 B;  4DA4 A;  3G71 Q;  4NS5 A;  2HBW A;  5IH2 A;  1M90 U;  2QG9 B;  1PKS A;  1Q81 C;  3EFO B;  1KQ1 A;  4AFZ C;  1N8R U;  3NHN A;  1JEG A;  3CCU A;  3CXC S;  3CC7 T;  5CR2 A;  2HAX A;  1DJ7 B;  3X20 B;  1QW1 A;  3LLR A;  3ME9 A;  3VUB A;  3RR6 A;  2GCX A;  1VQ8 Q;  1OX8 A;  3EG0 A;  3H41 A;  4LNP A;  4A4G A;  2OX7 A;  4XU2 A;  2XID A;  3X24 B;  1PRM C;  2MMP A;  2DXC A;  3CEY A;  3CCU T;  2HEQ A;  4JRK A;  3MP8 A;  4K11 A;  1EX4 A;  3OYM A;  4CRI A;  2PVG B;  2AZV A;  3OW2 S;  2DL3 A;  3G6E Q;  5GAN 8;  2VXF A;  1W2B P;  2M0O A;  5KYU B;  1GXI E;  4A4F A;  4BE2 A;  1G8X A;  3A8L B;  3GNF B;  3RNJ A;  4M7D A;  4QW2 A;  4D8D A;  3HHT B;  3RKY A;  4F17 A;  1YCY A;  4DBF A;  5LJ5 e;  1O75 A;  5J26 A;  1X6B A;  2CZ1 B;  2RHX A;  4M7A D;  1CKA A;  4JPB W;  1M5Q 1;  1BCM A;  2E65 A;  1SSH A;  1IZ6 A;  1LCK A;  2HKN A;  1XTD A;  1X43 A;  2RQU A;  3LGL A;  1YI2 Q;  2EYZ A;  3QII A;  5IT9 E;  4PLI A;  1QVF P;  3OYA A;  1D0X A;  1Y71 A;  1PM3 A;  4M7D G;  3JB9 H;  4XTX A;  3PNW C;  2XKO C;  5LJ5 d;  4B9X A;  1VYT A;  1JRI A;  2K4Y A;  2XG8 D;  1GL5 A;  3EG2 A;  2OAU A;  2ROL A;  4XU0 A;  4M77 D;  2FZK B;  2EIF A;  2EW3 A;  4E7S A;  1BBZ A;  1D1A A;  3L2V A;  1X01 A;  3CPW S;  5GAN e;  1V1C A;  4QT7 A;  1K9M C;  2R57 A;  4N4I A;  1MUZ A;  4Q5W A;  1UB4 A;  4C0G A;  1ABO A;  1ARK A;  2HL5 C;  2L2P A;  5FW9 A;  2Y4X A;  2JT4 A;  1NPR A;  4KGV B;  1RI9 A;  3ER0 A;  4FT4 A;  2K3X A;  2ZPF B;  3RMS A;  2AIR B;  2DXT A;  2RQW A;  4C92 A;  1QWE A;  1VQO Q;  1N6A A;  2FEI A;  5LJ5 g;  1UHC A;  3CD6 Q;  2DM1 A;  1FMV A;  4M7D B;  3EGU A;  3QZ9 B;  2VGM A;  3M0R A;  2IVW A;  3A98 A;  4Z8A A;  4PJO B;  3DB4 A;  5DLO A;  2YLC A;  2BIV A;  3HFO A;  3CCM Q;  1Q82 U;  4QVC A;  4XU1 A;  4LUE A;  4LDW A;  1PNJ A;  2L0A A;  1FX7 A;  2VB6 A;  2EYW A;  2DVE A;  1JJ2 A;  4AFU C;  1O9S A;  4C92 G;  5CKF A;  3SEM A;  1I1J A;  4L59 A;  4R55 A;  1QCN A;  3H9N A;  1S72 Q;  1KSW A;  4LDV A;  2MWO A;  5FWC A;  2E41 A;  2HMA A;  4HKE A;  2BZX A;  3WVE B;  4OB1 B;  2LCS A;  3VS4 A;  4JJN K;  2WSE E;  3VKI A;  4BI3 A;  3EGX B;  1D09 B;  1W4S A;  2GF7 A;  4KGZ B;  1VIF A;  1D1B A;  3CCR A;  2VYT A;  2O2O A;  1R8O B;  5LJ5 j;  3PE0 A;  4ZN3 A;  2NUP A;  1KC8 U;  4M75 C;  4FYY B;  1NEB A;  1LJO A;  3LX7 A;  3NGP A;  1HJD A;  1E7O A;  1BIB A;  3J81 E;  4FW1 A;  3V7R A;  1EZZ B;  1M3A A;  3DLM A;  3CC4 Q;  1OPK A;  4XTV A;  3CME A;  4C8Q D;  2K57 A;  2XD0 A;  1YJN Q;  2HNI A;  4IIM A;  3CCR T;  1J3T A;  4R56 A;  1WPY A;  3CPF A;  3FC3 A;  1VQ7 Q;  1BI2 A;  3QWX X;  1SHF A;  2EGA A;  4C92 B;  3OYD A;  3HFN A;  5LJ3 h;  2LP5 A;  1YBY A;  2OJ2 A;  2COY A;  4E7I A;  2KGT A;  4PFO A;  1N9R A;  3RUX A;  1WGS A;  2QYZ A;  4M78 D;  1WXB A;  3F70 A;  3LW5 E;  2P0Q A;  5GAO r;  1AOJ A;  4M7A A;  2RPN A;  2QEX A;  2MI6 A;  1WX6 A;  4OMO A;  4ZTF A;  1H3H A;  4RTX A;  1RAH B;  2MCN A;  5D6X A;  2A37 A;  3MP6 A;  2NUT A;  2KI7 A;  3V7S A;  5HKC A;  3L2W A;  4D8K A;  1H3Z A;  2ZPI B;  4DOW A;  1QVG P;  1PD0 A;  4CC3 A;  8AT1 B;  1RAE B;  2KRM A;  3PGG A;  3ZFJ A;  3M0P A;  3SB2 A;  1VQ4 Q;  3HRT A;  2QEX T;  2LMJ A;  1X27 A;  2O31 A;  2RO0 A;  3A5Z B;  5GAO m;  4M77 A;  1KK7 A;  3OA6 A;  4J9C A;  5GMK e;  2G6F X;  4M7A G;  2YWW A;  3I9Q A;  4FL6 A;  3QDF A;  2C06 A;  1D1C A;  2RMO A;  2GGR A;  1ZUK A;  3G71 A;  1IO6 A;  1SRM A;  2NUP B;  4E6R A;  1FXX A;  3CCE A;  2I2L A;  2J6O A;  2HL3 A;  3JB9 F;  4ORZ A;  1AWJ A;  1AWX A;  3NMZ C;  4M77 G;  1G5V A;  1UDL A;  4II1 A;  1WNL A;  1LVK A;  1ABQ A;  1NBE B;  1NLP C;  2V8I A;  2AZS A;  2CYZ B;  1UGP B;  1Q7Y U;  1OUL A;  2CP5 A;  2CUB A;  1M2V A;  2O01 E;  5I11 A;  3CCE T;  4AMC A;  5GAN 7;  4M7A B;  3FB9 A;  2QAZ A;  2KK4 A;  4LDU A;  3G6E A;  2G3R A;  4JLI A;  1TU0 B;  4RMO A;  2M0Y A;  4PFZ A;  3C12 A;  1VOM A;  2NUT B;  1GFC A;  1KJW A;  2RK2 A;  5LL6 S;  4OP0 A;  2CKK A;  1VUB A;  1NYF A;  1XNI A;  1K73 U;  3T9N A;  1YIJ A;  1CSK A;  3X28 B;  2A0F B;  1SRL A;  2FPE A;  4DBQ A;  2X4X A;  1WHK A;  3CCJ Q;  4A63 B;  2EQI A;  4IUR A;  2EKH A;  1Z9Z A;  4D6W A;  2OTL Q;  4M77 B;  1ZHI A;  1AHJ B;  4J9D A;  5IHN A;  1IB8 A;  2NYS A;  3C4S A;  1GRI A;  4OMM A;  2P0P A;  2GFA A;  2D8H A;  3TU4 K;  3PIP A;  1NJI C;  1U1T A;  3M5A A;  4J9E A;  1OYX A;  1GCQ A;  3ULR B;  1VQL Q;  3CC2 A;  2O9V A;  3SFM A;  1YIJ T;  1QP3 A;  2KRN A;  2D0N A;  2EPD A;  3I35 A;  3M59 A;  1Q81 U;  5D6W A;  4JJB A;  4C8Q A;  5GAN 3;  1KQS A;  1IRE B;  2E6N A;  2RJD A;  3CCL A;  3CCV A;  3CMA Q;  1Q86 R;  3CC2 T;  4BE1 A;  2CZ6 B;  2HCK A;  3TQ7 P;  4M78 A;  2GBQ A;  2LQ8 A;  1K76 A;  2QQA A;  4XU3 A;  4OML A;  1UGR B;  1YIT Q;  5KCO A;  3OBW A;  4PJO D;  3P8B B;  3HKS A;  4J83 A;  4M7D C;  1C0M A;  3OYL A;  2HKQ B;  5KYY B;  4J9H A;  4ANJ A;  2EGC A;  3CCL T;  1VQN T;  1AEY A;  3NTH A;  3CCV T;  2W0Z A;  3JV3 A;  4C8Q G;  1K9M R;  3VRY A;  5LJ3 f;  1U1S A;  1QKW A;  2DTI A;  1KFZ A;  2DIQ A;  3CD6 A;  3REB B;  2HBP A;  4LDY A;  4BDY A;  2ZPH B;  1W2B A;  5DY9 A;  3OY9 A;  4DEX A;  2DET A;  1I07 A;  4M78 G;  4GLK A;  3FIF A;  3S6W A;  1BYM A;  2VUB A;  3VS5 A;  2ATC B;  4DOV A;  2DYI A;  2LT4 A;  4CC4 B;  1BB9 A;  1K0X A;  5A0D A;  2FG0 A;  2A7Y A;  3V7C A;  4F7U A;  2JS0 A;  4YTL A;  1BU1 A;  3G4S A;  2RHY A;  3JCM Q;  4FCY A;  4X9C A;  1RAC B;  2LNH B;  1S72 A;  2DF6 A;  2JXB A;  3I56 T;  2VKN A;  1VQK A;  1KHC A;  2GQI A;  4JZ4 A;  5KYU A;  1QVF A;  4WF2 A;  3GPL A;  1JJ2 S;  2RN8 A;  2Z0W A;  4C8Q B;  4JS4 A;  5EC7 A;  1N5Z A;  4PJL A;  2QA4 Q;  3JCM e;  2L3R A;  2O4X A;  1RAA B;  3Q1J A;  3V8K A;  1ZBX A;  3G4S T;  4BE0 A;  3I55 Q;  1MMN A;  4C5G A;  4F7U G;  4V2S A;  2DO3 A;  5LJ5 h;  1K9M U;  3EH2 A;  4M78 B;  2FL7 A;  2R58 A;  1VQK T;  1H8K A;  1OEB A;  4EDU A;  4BY6 B;  2HQH A;  1VQ9 Q;  4JRQ A;  1PSF A;  2RI3 A;  4IUP A;  2X4Y A;  2JMA A;  4IIO A;  1VQP A;  3H0F A;  3JCM d;  2AK5 A;  5GAM e;  4XK8 E;  2DNU A;  2KY9 A;  4ZN1 A;  2X35 A;  1R0C B;  3GOX A;  2DD4 A;  2K5I A;  2CT3 A;  2ECZ A;  2PTK A;  1WQ7 A;  4FT2 A;  2HDA A;  5KYN A;  1WZO A;  4DBH A;  1OPL A;  1VQP T;  1CKB A;  5GAN h;  4MDX A;  1VYU A;  2FZC B;  2DTO A;  3OS1 A;  4O6J A;  2RHI A;  4F7U B;  4FU6 A;  1VQM A;  3QWY A;  2DL7 A;  2KXC A;  5HK3 A;  5I2S A;  2X4J A;  1YHQ A;  4J6X A;  4EPC A;  3JCM g;  2EQU A;  1VQ5 Q;  3VU3 C;  2IPO B;  3A8H B;  3QO3 A;  2EGE A;  2K5F A;  2DBM A;  2F2V A;  1YJ9 Q;  1UGS B;  2KYM A;  2M51 A;  1M27 C;  5CVI A;  3QUI A;  4LD9 K;  3JCM c;  1VQM T;  1NZ9 A;  1K8A R;  2QQR A;  2O4X B;  4JLG A;  4ZTJ A;  2A3L A;  2DBK A;  3E19 A;  4PJO A;  1FYN A;  3PVL A;  5AT1 B;  1YHQ T;  1A0N B;  4XTY A;  1WJQ A;  4C0D C;  2H8H A;  3UPU A;  5CKE A;  1UUE A;  4OMF B;  1VA7 A;  3E9G A;  4F16 A;  2CZ7 B;  4JJD A;  4HCB A;  2Y90 A;  4KUL A;  2YSQ A;  3OYK A;  5CQY A;  4M7A C;  2M02 A;  5IXF A;  3X25 B;  1M1G A;  2FVU A;  1Q86 C;  3A1P A;  5GMK m;  5FU6 B;  3H8Z A;  2RI5 A;  3GBQ A;  3FEO A;  3HSB A;  4PJN A;  4PJJ A;  2KR3 A;  1OX9 A;  3EGX A;  2RHU A;  3M0T A;  3G1J A;  4PJO G;  4F04 B;  2XDD A;  1SF9 A;  3OYH A;  1PSE A;  2CSI A;  1M8M A;  1ZSG A;  4QQD A;  1M9S A;  4HVV A;  5FU7 C;  1AZG B;  5CKH A;  3WVD B;  3CCS A;  4M77 C;  1PKT A;  4C0F A;  3H0H A;  2DEU A;  1WHL A;  5IAY A;  2KQW A;  2KSS A;  2LQK A;  4Z88 A;  1M4Z A;  1RAB B;  1OU9 A;  1YN8 A;  3EG9 B;  2V8J A;  1QVG A;  4LD6 A;  2X9H A;  4EMK A;  2SRC A;  3M9Q A;  1XQH A;  1TSF A;  2ZCF B;  2O9S A;  3M0Q A;  3CCS T;  2VGN A;  2L5Q A;  3CCQ A;  2RJC A;  5GAN d;  1HSQ A;  3A8O B;  2JM8 A;  3VS3 A;  3HTR A;  2C0T A;  3OYJ A;  4EMG A;  4B6M A;  2A28 A;  3REA B;  1AZE A;  3SWN A;  2K79 A;  2NUZ A;  3FJP A;  3RIR A;  4CI0 C;  4TVR A;  3PFS A;  2K2V A;  5CIU A;  1VYV A;  3OYY A;  1IHW A;  2QGG A;  5CCA A;  1JBM A;  4C5H A;  1I8F A;  2ZAE A;  3M0S A;  2RQT A;  4FSX A;  1NJI R;  3CCQ T;  3JB9 D;  2D9T A;  4FM4 B;  4M75 E;  3GF5 A;  1JXO A;  5C0M A;  3CMA A;  2F5T X;  3R6O A;  2P4T A;  2X4W A;  4OB0 B;  4WTO B;  3L2U A;  1ZQ1 A;  2L8D A;  1YJW A;  3UT1 A;  1IGQ A;  5LJ5 f;  2OTJ Q;  4MML A;  3IQL A;  4Z02 A;  5A0G A;  1KQS S;  2DFU A;  3RKX A;  5GAN g;  3JCM V;  2MIO A;  1GBQ A;  2QTV A;  1MV0 B;  5GMK h;  2LJ3 A;  1HD3 A;  4XTZ A;  3UAT A;  1OI1 A;  2EKO A;  3ZEH A;  5L8R E;  2KE9 A;  2QDY B;  1NG2 A;  1X75 C;  1M1K C;  5GAO p;  1UEB A;  2J06 A;  4A4E A;  2LQW A;  5KYX A;  1XOV A;  1YJW T;  2E3H A;  1D3B A;  1SG5 A;  2JM9 A;  4LN2 A;  2JS2 A;  4J5Y A;  2SEM A;  3MEW A;  1GCQ C;  5D7U A;  4ELZ C;  4ZGJ B; 
#chains in the Genus database with same CATH homology
 2RK2 A;  5LL6 S;  4OP0 A;  5GAN f;  3OS5 A;  4EMK B;  2CKK A;  1VUB A;  3EAE A;  2F5K A;  4PJO C;  2OTJ T;  2VV5 A;  1XNI A;  3L42 A;  2E10 A;  3JCM J;  3M55 A;  1K73 U;  3T9N A;  4KBM B;  3DLL A;  4OVA A;  2EWN A;  1W2B S;  5IN1 A;  3RES A;  4IUT A;  1YIJ A;  1OZ3 A;  3M54 A;  1U8R A;  3X28 B;  3JRZ A;  2PVD B;  4C8Q C;  2K3Y A;  4MDW A;  2RA2 A;  4HCC A;  4PLL A;  4BI4 A;  2X4X A;  1NJI U;  5GAM f;  1Y96 A;  2PU9 B;  4IUR A;  1BIA A;  3PMT A;  3INZ A;  4M77 B;  4D6W A;  2IG0 A;  1K73 C;  3SWN B;  4C0Z A;  1ZHI A;  1AHJ B;  5KE2 A;  4C92 D;  4BDZ A;  2PUO B;  1NPP A;  3C4S A;  3MP1 A;  5GAN j;  1VQ6 A;  2CGH A;  2ZPE B;  2EQJ A;  2P0P A;  3DKM A;  3OMC A;  2GFA A;  3QDR B;  4KUI A;  3CME T;  3TU4 K;  4NL2 A;  3PIP A;  1NJI C;  3NTK A;  1U1T A;  2KMT A;  3M5A A;  4KUD K;  1OYX A;  2LCC A;  3CC2 A;  1K8A U;  2LNV A;  3SFM A;  1N9S A;  2WSF E;  3OSS C;  2RH2 A;  4BY6 C;  1YIJ T;  4C92 F;  1KQ2 A;  3PTA A;  3CCJ A;  1QP3 A;  3E1S A;  3CC7 A;  1OZ2 A;  3JAM E;  3ZBD A;  2OTL A;  5DLQ E;  5GAM j;  3HP9 A;  2QQS A;  5GAO q;  5GMK l;  4HCZ A;  3M59 A;  2LVM A;  3BFM A;  4HA8 A;  3LWH A;  1Q81 U;  5D6W A;  4OGC A;  4A4H A;  2RJE A;  3OQ5 A;  3V8J A;  1K8A C;  1QVF S;  2JZ2 A;  4C8Q A;  1G3Y A;  3C94 A;  5GAN 4;  5GAN 3;  1KQS A;  4QQG A;  4RCC A;  1N27 A;  3ASK A;  2LC4 A;  3UDC A;  1IRE B;  2DAQ A;  2E6N A;  1VQ6 T;  1VQL A;  4MZM A;  4OB2 B;  4DA4 A;  4NS5 A;  2RJD A;  1M90 U;  2JTM A;  3VJP A;  3CCL A;  1Q81 C;  4QQ6 A;  3CCV A;  1JB0 E;  3CC2 T;  4BE1 A;  1KQ1 A;  2CZ0 B;  1N8R U;  3M57 A;  2JTF A;  2CZ6 B;  3CCU A;  3UWN A;  3CXC S;  5HK0 A;  4NOY A;  2P0K A;  2RK1 A;  4IUQ A;  3CCJ T;  3CC7 T;  4M78 A;  3JCM W;  2MF2 A;  2LQ8 A;  2YRV A;  5CR2 A;  2OTL T;  1M90 C;  2QQA A;  4XU3 A;  1UGR B;  2HAX A;  3OYE A;  5KCO A;  3OBW A;  1DJ7 B;  3P8B B;  3HKS A;  3X20 B;  1N8R C;  4PJO D;  3L2Q A;  1QW1 A;  3LLR A;  4J83 A;  2YLB A;  4M7D C;  4VUB A;  3ME9 A;  3VUB A;  1D3B B;  3V8L A;  3OYL A;  4IKF A;  3TRE A;  2LRQ A;  4BD3 A;  4ZGD B;  1VQL T;  2GCX A;  4A4G A;  3RER A;  4XU2 A;  3CCL T;  2XID A;  1VQN T;  3NTH A;  3X24 B;  3CCV T;  4C8Q G;  4JRI A;  2HQE A;  2MMP A;  2DXC A;  3CEY A;  3CCU T;  3PIO A;  1WJS A;  5LJ3 f;  1YIT A;  1U1S A;  4JRK A;  2DTI A;  3QBY A;  2DIQ A;  3CD6 A;  2PVO B;  3MP8 A;  2HBP A;  1UGQ B;  4LDY A;  2M1H A;  2XU8 A;  3OYM A;  4CRI A;  4BDY A;  2PVG B;  3A8M B;  2ZPH B;  3OW2 S;  1W2B A;  3RMQ A;  2VXE A;  4Y91 A;  5DY9 A;  5GAN 8;  1B34 A;  5GAO l;  2VXF A;  3OY9 A;  3G71 T;  1VQ8 A;  2M0O A;  4C8Q E;  2E5Q A;  4M78 G;  4GLK A;  3FIF A;  4OGE A;  1GXI E;  2DXB A;  4A4F A;  4O5V A;  3CMA T;  3S6W A;  1BYM A;  4BE2 A;  2VUB A;  3A8L B;  3JB9 J;  3GNF B;  4DOV A;  4M7D A;  4QW2 A;  2BUD A;  3X26 B;  1Y96 B;  3HHT B;  4E47 A;  3QPH A;  2DTH A;  2LT4 A;  2VC8 A;  3RKY A;  1I4K 1;  4PNO A;  5A0D A;  1YCY A;  1YIT T;  1KHI A;  2A7Y A;  4XAX B;  3V7C A;  2GQV A;  4F7U A;  2K5L A;  5AYF A;  5LJ5 e;  1P92 A;  1LOJ A;  1KG1 A;  4M78 E;  1O75 A;  2LX9 A;  5KE3 A;  5J26 A;  5EG2 A;  4YTL A;  3BY7 A;  2CZ1 B;  3G4S A;  2RHY A;  2RHX A;  4M75 D;  3URG A;  4N0A C;  3JCM Q;  2E12 A;  4M7A D;  4X9C A;  1BI1 A;  1VQ8 T;  4MMK A;  1M1F A;  1M5Q 1;  2E65 A;  1S72 A;  2FB7 A;  3GLX A;  3I56 T;  1IZ6 A;  4JS5 A;  1VQK A;  2RHZ A;  1KHC A;  1RI0 A;  1XTD A;  3KXT A;  3M58 A;  3LGL A;  2EJF A;  1QVF A;  4WF2 A;  3GPL A;  4M75 F;  3QII A;  5C6S A;  5IT9 E;  4PLI A;  1JJ2 S;  4M7A F;  4C8Q B;  3OYA A;  4JS4 A;  2AHJ B;  3FRN A;  4A53 A;  3MO8 A;  3JCM e;  1Y71 A;  2EJ9 A;  3MCA B;  4J8O A;  1I5L A;  2L3R A;  4PL6 A;  3G6E T;  2O4X A;  4M7D G;  3JB9 H;  4XTX A;  3JCM P;  3Q1J A;  3V8K A;  1ZBX A;  3G4S T;  4Y28 E;  3PNW C;  4BE0 A;  2QXF A;  2XKO C;  4B9X A;  5LJ5 d;  2E1H A;  1JRI A;  3CXC A;  2K4Y A;  2XG8 D;  3PMI A;  4B9W A;  2OAU A;  4F7U G;  1I81 A;  4C5G A;  4V2S A;  2DO3 A;  2EAY A;  4XU0 A;  4M77 D;  5LJ5 h;  3JB9 G;  1K9M U;  4M78 C;  1YI2 A;  2EIF A;  4M78 B;  2FL7 A;  2HD0 A;  2R58 A;  4N0A A;  4XTU A;  1VQK T;  1WJR A;  3TCJ A;  5I2M A;  5FRO A;  3L2V A;  1X01 A;  4IUU A;  3E9F A;  4EDU A;  3CPW S;  3QHS A;  5GAN e;  4BY6 B;  2QA4 A;  3AHU A;  4JRQ A;  4M7D E;  2WSC E;  2ZZD A;  1PSF A;  3FDR A;  4UC4 A;  3OS2 A;  2RB6 A;  2RI3 A;  3L1A A;  4N4H A;  4IUP A;  2X4Y A;  1K9M C;  2R57 A;  4M77 F;  2JUF A;  2QI2 A;  3MET A;  1VQP A;  4F7U E;  4KT0 E;  4NL3 A;  3I55 A;  4N4I A;  4Q5W A;  3J7A F;  1UB4 A;  4C0G A;  3JCM d;  5A0L A;  5GAM e;  4J6W A;  3JCM h;  2Y4X A;  4JRP A;  2B8A A;  4XK8 E;  2KY9 A;  3L2R A;  4ZN1 A;  2X35 A;  1YI2 T;  1VQ9 A;  1M8V A;  3N5B B;  3GOX A;  1NPR A;  2DD4 A;  2K5I A;  5GAN 6;  2JOY A;  1G3W A;  2CS7 A;  3ER0 A;  4FT4 A;  4OF1 A;  1WQ7 A;  3OW2 A;  2DD5 A;  2XDP A;  4RG2 A;  2QA4 T;  2K3X A;  2ZPF B;  4FT2 A;  3O8V A;  3RMS A;  5A2Q E;  2DXT A;  4C92 A;  1B34 B;  5GMK j;  2EQK A;  2FHD A;  1N6A A;  4J6Y A;  2H3J A;  3OYN A;  5LJ5 g;  4E7H A;  1VQP T;  2R5A A;  3I55 T;  3KBG A;  4BB7 A;  5GAN h;  4MZT A;  4M7D B;  4MDX A;  2DTO A;  3QZ9 B;  2VGM A;  4O6J A;  5HY6 A;  3OS1 A;  1HXD A;  5M9O A;  5J39 A;  2JVV A;  4X9D A;  2IVW A;  2RHI A;  2Y4Y A;  2RJF A;  4P5N A;  4F7U B;  3DB4 A;  3M53 A;  5DLO A;  1VQ9 T;  4PJO B;  4FU6 A;  1VQM A;  2LT1 A;  2E64 A;  3GNG A;  2YLC A;  2BIV A;  3HFO A;  1Q82 U;  4QVC A;  1VQO A;  4XU1 A;  3QYG B;  5GAM h;  5HK3 A;  4LDW A;  4ME7 A;  2X4J A;  5I2S A;  1YHQ A;  3FLG A;  4J6X A;  4EPC A;  1QVG S;  3JCM g;  2EQU A;  3GIB A;  2DPP B;  3VU3 C;  3OYF A;  1FX7 A;  4BAC A;  2FYK A;  3A8H B;  3QO3 A;  2BKD N;  3EFR A;  1H64 1;  2K5F A;  1Q82 C;  4DQ2 A;  3DB3 A;  3VYH B;  3HRS A;  1MGQ A;  2DVE A;  2ZPB B;  1JJ2 A;  1UGS B;  1O9S A;  4C92 G;  5CKF A;  5CVI A;  3QUI A;  4L59 A;  4R55 A;  3CCM A;  4QVD A;  2PQW A;  3JCM X;  2ZPG B;  4LD9 K;  4LDV A;  4FIB A;  3JCM c;  1VQM T;  1NZ9 A;  2XDB A;  2MWO A;  2O4X B;  2E6Z A;  2QQR A;  5CQX A;  4QVZ A;  3QJY A;  1VQO T;  4JLG A;  2E41 A;  4BI8 B;  1VQ5 A;  4ZTJ A;  4C5E A;  4HKE A;  2A3L A;  3E19 A;  4PJO A;  4RKU E;  3WVE B;  2QQB A;  4OB1 B;  1YHQ T;  3CD6 T;  4JJN K;  5CKD A;  1QVP A;  2WSE E;  3VKI A;  1BI3 A;  4BI3 A;  4XTY A;  3TEE A;  1FWZ A;  1WJQ A;  4C0D C;  2LTO A;  4C0D B;  4C92 E;  1YJ9 A;  2RM4 A;  1W4S A;  2GF7 A;  5LJ3 e;  2LDM A;  2NLU A;  1VIF A;  3CPW A;  3UPU A;  3CCR A;  5CKE A;  2VYT A;  2DIG A;  1R8O B;  4OMF B;  1Q86 U;  5LJ5 j;  3E9G A;  2CZ7 B;  3KUF A;  3MHX A;  4HCB A;  2Y90 A;  4KUL A;  4ZN3 A;  1KC8 U;  1V29 B;  2QQ9 A;  3EFS A;  3A8G B;  2EJG A;  3J80 E;  3OYK A;  3CCM T;  2LCL A;  3HRU A;  4M75 C;  4OB3 B;  3BW1 A;  5CQY A;  1LJO A;  5DM7 R;  4M7A C;  1Y07 A;  2XK0 A;  3LX7 A;  2DZ9 A;  3X25 B;  1BIB A;  2R5M A;  1M1G A;  1BKB A;  3J81 E;  2WAC A;  4E7J A;  4E7K A;  1VQ5 T;  2FVU A;  3LGF A;  5KCH A;  1Q86 C;  5GMK m;  5FU6 C;  3OYG A;  5FU6 B;  3H8Z A;  3V7R A;  3MEV A;  3DLM A;  2RI5 A;  4ELY C;  2GFU A;  1KC8 C;  5GAN 2;  2EQM A;  3FEO A;  3HSB A;  4XTV A;  2XI9 A;  3CME A;  1YJ9 T;  4HT8 A;  4C8Q D;  4EMK C;  2K57 A;  2XD0 A;  2HNI A;  3H6Z A;  1QP2 A;  3CCR T;  4R56 A;  1Y7X A;  2RHU A;  1WPY A;  3CPF A;  4PJO G;  2XDD A;  4EMH A;  4RCB A;  3FC3 A;  1S72 T;  5LJ3 d;  1BI2 A;  3OYH A;  1PSE A;  5GAO n;  3S3O A;  3QG1 A;  2RD1 A;  4C92 C;  4C92 B;  3OYD A;  3HFN A;  5LJ3 h;  1YBY A;  4RG8 A;  5FU7 C;  4C8Q F;  1M9S A;  4L6V 5;  4QQD A;  4L5G A;  5CKH A;  5FU7 B;  4E7I A;  1N9R A;  3RUX A;  1WGS A;  3CC4 A;  3WVD B;  3CCS A;  2D6F A;  4M77 C;  2MWP A;  1EIF A;  4M78 D;  3F70 A;  3LW5 E;  3SWN C;  4M75 A;  2P0Q A;  4C0F A;  5GAO r;  5CK9 A;  4M7A A;  3SD4 A;  4J7I A;  2JN0 A;  5IAY A;  2QEX A;  4PJO E;  2KQW A;  2KSS A;  2MI6 A;  4A54 A;  1YJN A;  5FRM A;  2D0Q B;  1VIE A;  2LQK A;  4ZTF A;  4IUV A;  1HK9 A;  1M4Z A;  2QTX A;  3OBY A;  1VQ7 A;  5D6X A;  3MP6 A;  5KH6 A;  3V7S A;  5HKC A;  3L2W A;  2V8J A;  4M78 F;  2RI2 A;  1QVG A;  4LD6 A;  1H3Z A;  1WQW A;  2ZPI B;  4EMK A;  4DOW A;  2HQX A;  5D6Y A;  1MHN A;  2DEQ A;  2L89 A;  4JDS A;  3OYB A;  3M9Q A;  4MZP A;  1BI0 A;  1XQH A;  2ZCF B;  3JSC A;  3CC4 T;  5CAI A;  3PGG A;  4XTW A;  3CCS T;  2VGN A;  3ZFJ A;  2DJZ A;  2L5Q A;  3SB2 A;  3CCQ A;  2RJC A;  5GAN d;  3HRT A;  3A8O B;  5J3B A;  2QEX T;  2RO0 A;  2EYQ A;  3OMG A;  4N4G A;  1YJN T;  3M56 A;  3OYJ A;  2KDS A;  3A5Z B;  4GY5 A;  4EMG A;  5GAO m;  5LJ3 g;  4M77 A;  3MEU A;  3SWN A;  1VQ7 T;  3OA6 A;  3BDL A;  2DK3 A;  3FJP A;  3RIR A;  5GMK e;  4CI0 C;  4TVR A;  3S3N A;  3PT9 A;  4C5I A;  1VQN A;  3QSU A;  3HL8 A;  4M75 G;  3VV0 A;  2M9U A;  3P8H A;  2ZGW A;  4ZGE B;  3PFS A;  4M7A G;  3NTI A;  4J7F A;  2K2V A;  5CIU A;  5GAM d;  2XIC A;  3OYY A;  4FL6 A;  4M7D D;  3C95 A;  3MEA A;  5CCA A;  2F69 A;  1JBM A;  4C5H A;  1KD1 U;  2C06 A;  1X6O A;  3QJ6 A;  1I8F A;  1VQ4 A;  4HT9 A;  2MAM A;  3NFC A;  3CBP A;  5GMK i;  4FSX A;  3OYC A;  3CCQ T;  5FRN A;  3JB9 D;  2EFI A;  3G71 A;  2D9T A;  4FM4 B;  4M75 E;  3BDU A;  3GF5 A;  4M7A E;  1KD1 C;  5C0M A;  2XHC A;  4M7D F;  3CMA A;  2F5T X;  3CBM A;  3R6O A;  3VUZ A;  1G3S A;  2P4T A;  2X4W A;  3LH0 A;  4OB0 B;  1FXX A;  3L2U A;  3JCM b;  3CCE A;  2I2L A;  1ZQ1 A;  2L8D A;  1YJW A;  3UT1 A;  1G3T A;  2M16 A;  3M4G A;  4MML A;  3SDZ A;  5LJ5 f;  5GAN 5;  3OS0 A;  4Z02 A;  4PJO F;  4F7U F;  2PUK B;  3G7Z A;  5A0G A;  1KQS S;  3QXE B;  3JB9 F;  3OB9 A;  1NE8 A;  3CBO A;  3QYH B;  4M77 G;  1G5V A;  4II1 A;  2KAF A;  3RKX A;  3JCM V;  5GAN g;  3P8D A;  3OYI A;  5I21 A;  4A4K A;  1WNL A;  1M1K U;  5GMK h;  1VQ4 T;  3S3M A;  1SSF A;  2DZC A;  2DXU A;  4XTZ A;  2KVQ G;  1OI1 A;  2EKO A;  2V8I A;  4BUG A;  2CYZ B;  3ZEH A;  1UGP B;  5L8R E;  5CO7 A;  3GP8 A;  2QDY B;  2YHT A;  1Q7Y U;  4ATO A;  2DKG A;  1X75 C;  2JNG A;  1LNX A;  2E70 A;  3I56 A;  1M1K C;  2OTJ A;  5FLX E;  3LWI A;  5GAO p;  5GAM g;  1UEB A;  2O01 E;  4A4E A;  4M77 E;  3CCE T;  3JCM f;  1XOV A;  1YJW T;  1D3B A;  5GAN 7;  5LJ3 j;  4M75 B;  4E7L A;  3VYG A;  1RL2 A;  4M7A B;  1Q7Y C;  4PKC C;  3FB9 A;  4LDX A;  2KK4 A;  3L2Z A;  4LDU A;  3JB9 I;  3G6E A;  3WXM B;  2G3R A;  3HPW A;  3QZ5 B;  2V8K A;  4JLI A;  4X34 A;  3RKW A;  5CKB A;  4JUV A;  4XQ3 A;  3M4Y A;  1TH7 A;  4J5Y A;  3OSV A;  4RMO A;  3MEW A;  3LYI A;  3QKJ A;  3C12 A;  4ELZ C;  4ZGJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...