4M7AA

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
TLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 13
structure length 64
sequence length 64
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aA00
2DJZA 5LJ3f 3V8JA 4J6WA 5I21A 4PJOF 5GANg 2E64A 4C8QB 4PJOE 4M78C 4PNOA 3QO3A 1KQ1A 4JUVA 5GANe 3JCMX 3HFOA 5GAOp 2EWNA 4M7AA 5GAMj 4M7DC 1TH7A 2K57A 4XTYA 4M75A 4M7AG 3JB9F 4J6YA 3FIFA 2QTXA 4MMKA 3BDUA 3PGGA 4M75C 1BIBA 4EMKA 2DEQA 4QVCA 4M75G 5LJ5g 4PJOC 1MGQA 4M77A 1I81A 1M5Q1 3EFRA 4C92B 1D3BB 3V7SA 5LJ5e 4M77C 1LOJA 5CAIA 4M77G 5LJ3h 4QVDA 2RM4A 5GANj 4F7UE 2FB7A 3L2ZA 4OP0A 4XTZA 1HK9A 4J6XA 3QHSA 2FYKA 4C8QD 5GMKm 1X01A 5GAMh 4M7AF 4M7DE 3V8LA 1I8FA 4M75F 3JB9H 2YLCA 4MMLA 5LJ3d 5LJ5j 1I5LA 4M75E 4HT8A 3L1AA 4M77F 4F7UA 5GMKe 4M78B 2CGHA 2E10A 2DKGA 4M77E 5GAMf 4NOYA 4F7UG 3AHUA 1U1SA 1WQWA 4XTWA 4C92D 4M7AC 2YHTA 1YCYA 1I4K1 2EJFA 5GMKl 3JCMb 2E1HA 1B34A 4EMKC 4PJOB 4XTUA 4XU3A 5GMKi 5GANf 4J5YA 3BW1A 1Y96B 4HA8A 5GMKj 1LNXA 3BFMA 2DTHA 4C8QA 4XTXA 3SWNB 3EFSA 5GAOn 5GAOr 4F7UF 4C8QC 2Y90A 4C8QG 2HNIA 3VU3C 3JCMf 4JRIA 4N0AA 4NL2A 3V7CA 4DQ2A 4M78D 1U1TA 2RD1A 2VXEA 5GAN8 2DZ9A 5LJ5f 4N0AC 3JCMQ 4M7AE 3RESA 3RKXA 2DZCA 2RA2A 4XQ3A 2EJ9A 4M7DD 3V8KA 4C92A 1D3BA 4XU1A 5LJ3g 1M8VA 4RCBA 5GAOm 5GANh 1Y96A 4PJOD 4C92G 1JBMA 5LJ3e 5GAMd 4Y91A 3V7RA 4M7DB 2VC8A 3SWNA 4C8QF 3JCMP 1LJOA 1BIAA 1WNLA 4M75B 4C8QE 2I2LA 3BY7A 2ZGWA 3RIRA 5GAMg 1WPYA 3RERA 3JCMW 3JCMh 4EMKB 3INZA 4XU0A 5GAMe 3JB9D 4M77B 4A53A 5LJ5h 5GAOq 2EJGA 3JCMV 2JN0A 2E41A 4JRKA 3RKWA 5GANd 5GAN5 3QSUA 3FB9A 5LJ3j 4X9CA 4M78A 5GAOl 2VXFA 3RUXA 4C92F 4EMHA 4X9DA 3GIBA 5GAN6 4C92E 4JLIA 1N9SA 4M78G 5DY9A 3JCMd 1H641 3JB9J 4M7DA 3JCMc 5LJ5d 5GAN4 2DTOA 1WQ7A 2DXTA 3HFNA 4WF2A 4XU2A 3JCMg 3HSBA 4M7DG 4M7AD 2YLBA 4PJOA 5GAN7 4M75D 4C92C 5GMKh 4EMGA 4PJOG 4F7UB 3JCMe 1KQ2A 3JCMJ 3SB2A 2DTIA 2E65A 4V2SA 1JRIA 4M7AB 4M77D 3QUIA 3JB9I 2DXUA 4M78F 3M4GA 3SWNC 1N9RA 3FJPA 5GAN3 4NL3A 4HT9A 4M78E 2DVEA 4A54A 2EAYA 3RKYA 1B34B 1HXDA 4XTVA 4RCCA 5GAN2 2RB6A 3JB9G 4M7DF
chains in the Genus database with same CATH superfamily
2M16A 2LTOA 2CP6A 4QQGA 1D1AA 4RTZA 1VQ6A 4L6V5 3L2QA 1OV3A 1WJRA 2QTXA 1TUGB 4M77A 4Z8AA 1U06A 1WYXA 4J9DA 3CCEA 3ULRB 1OOTA 4DA4A 2OTLQ 4E7SA 2KRMA 1JQQA 1NBEB 1TS9A 1R8OB 2LQNA 2CS7A 1B7TA 5LJ3d 1RL2A 3ER0A 3UWNA 3L1AA 1J3TA 2CGHA 1Q81R 2HSEB 1PNJA 2EW3A 3HRTA 3VYHB 3GNFB 4GLMA 3A5ZB 1SSFA 1B34A 1Q86R 2JM9A 1UDLA 3OB9A 3G4SQ 4KH0B 2FEIA 1WJSA 1IRXA 4PFOA 3M55A 1W4SA 4JRIA 4NL2A 3V7CA 2COWA 1X6OA 2HL3A 2CSIA 2O01E 2CDTA 3OW2P 3NHNA 2EYWA 2L3QA 2PUKB 3I5RA 3X26B 5CCAA 3VS6A 1I5OB 3M57A 1JBMA 4Y91A 3QYHB 3OA6A 4C8QF 2KDSA 2LC4A 1W70A 1ZBJA 2Y4XA 5KYUA 3EH1A 2YDLA 5GAOl 3RUXA 1QLYA 3R6NA 5J3BA 3TSWA 4JJCA 4M7DA 2KYMA 1GFDA 1DJ7B 5LJ5d 5HCKA 2NLUA 2HCKA 2YLBA 2CZ0B 4C92C 1ZBXA 1AOJA 4OMLA 2EKOA 1JRIA 1VQ5T 3LH5A 4HKEA 2RHYA 5FWCA 3LGLA 1HXDA 5LJ3f 1ZSZC 5I21A 2CP2A 2L2PA 1AZEA 3WXMB 2KRSA 4QW2A 1VYUA 1IHVA 2A0FB 3D7SB 1JXMA 1QMCA 1OYXA 1IHWA 2EQJA 4HCZA 3CCJT 1HD3A 5I2SA 3I56T 2P4TA 2J06A 3QZ5B 3OYLA 2AT1B 1YHQQ 4M7DE 1I8FA 4Z88A 2C06A 3J81E 1OPLA 5GMKe 2JT4A 2HMAA 4OB1B 4XTWA 2DL8A 3EHQA 4J9HA 1YJ9A 1QKWA 4PJOB 4A4HA 4XU3A 4J5YA 2E6NA 3TVTA 2KVQG 2F69A 2V26A 2DE0X 1H3HA 1U1TA 1EIFA 5LJ5f 1ZSZB 1Q7YU 4EDUA 4EIKA 5CKHA 1UGPB 3CCRQ 4AFSC 3S3MA 3J80E 1MV3A 2EQKA 5IHKA 2O31A 4CC2A 4C92G 1VQ5A 3ME9A 4RMOA 2OTLT 4X34A 4N4GA 4EPCA 4XU0A 2WACA 2YT6A 2GCXA 2EJGA 1FWZA 4QQ6A 2X51A 3EG9B 4RG8A 1K0XA 1UECA 3META 1UGQB 4J9FA 1GCPA 2ROTA 4ZN3A 4OMNA 2COYA 2P0QA 5GMKh 4FYWB 4F7UB 2RQRA 3OSSC 5CKEA 2DTIA 3G4ST 4M77D 1VIFA 3MEVA 2ESWA 2XU8A 4MZMA 1JXOA 2DJZA 4J6WA 5GANg 3OYHA 3EFOA 2YXYA 3G7ZA 4M78C 4CI0C 1FMVA 1KQ1A 1FYNA 4C0DC 1G3SA 1GCQC 2GF7A 2LCLA 3I35A 3BDUA 1X6BA 4PFZA 1D3BB 3U23A 1KG1A 4QVDA 2IIMA 1UUEA 1SRLA 5GANj 5CR2A 3QWXX 4OP0A 1ZUKA 2RI5A 3NTKA 1K73R 1Y07A 1ZX6A 2LP5A 2ZPFB 1K0SA 3ZEHA 1KSWA 1PRMC 2MOXA 1WFWA 5A0LA 1VQMQ 2OTLA 1YCYA 2HKQB 2OTJQ 1YJNQ 3QDFA 2GNCA 5ECAA 5LL6S 1W2BS 1KHIA 3HL8A 3BFMA 4IURA 3TSZA 2KGTA 2Z0WA 1VQ8Q 1VYTA 1X27A 2VB6A 2MF2A 1OX8A 4IUPA 3MEWA 1ZQ1A 2X4XA 5HK3A 3CCST 4XQ3A 2QI2A 4M7DD 5J39A 2L89A 4C92A 1U8RA 4C0DB 2HDAA 5KCOA 1RAEB 2RH2A 2O4XB 2YUOA 2DYIA 4LDUA 3VS7A 2JXBA 2RMOA 3JAME 2PQWA 4OMQA 1P92A 1K9AA 2J05A 1MHNA 1ZSZA 5GAOq 1KIKA 1R0CB 4FSSA 4DBRA 3VUZA 1KC8R 2GBQA 3H0HA 4IUVA 5IHIA 4M78G 2K5IA 3M0SA 4AG2C 3CBOA 2HD0A 2RJEA 1C0MA 2LX7A 4BE0A 5FROA 2KI7A 3M0PA 2AIRB 2DL4A 3HP9A 3TQ7P 2EYQA 2EYXA 1PKSA 4A54A 3M59A 4BI8B 2XICA 5CQXA 1Y71A 2G6FX 3PTAA 3CC7Q 2I0NA 4PJOE 4JS5A 1XNIA 1RAGB 2EIFA 4HVVA 1VIEA 4DBQA 1TH7A 5D6WA 5L8RE 1H92A 2DMOA 3CCMT 2NUPB 4RTYA 3RR6A 2FZGB 3M56A 4KBMB 2CKKA 2ECZA 2HKNA 1NEGA 3FC3A 3QHSA 3DLMA 4J9BA 3CMET 4RKUE 4RTXA 1ZSGA 2FZCB 5GMKl 3CC4Q 2CT4A 2DA9A 1YHQA 4HXJA 1Y96B 1K9MC 3S3OA 3E2UA 2AKKA 5C0MA 4C8QG 5KYXA 4F7UE 2M0YA 5IN1A 1KQSA 3FDRA 2RA2A 2CP5A 3EHRA 1RI9A 3VS4A 4C0GA 3R6OA 1M30A 3QWYA 2DD4A 4KT0E 5EG2A 2DEUA 1WHMA 1UJ0A 1LJOA 4HVUA 3ZFJA 4E2FB 1WPYA 1VQ9T 3JCMh 5D6YA 5GJWB 2DAQA 4A53A 1VQKT 1V29B 3CCRA 1RUWA 4M78A 3PVLA 4X9DA 5GAN6 1N9SA 4A4KA 4HCBA 1GCQA 4RTVA 1SF9A 5GAN4 4WF2A 1YJNT 4XU2A 1W2BP 4FT4A 2ENMA 4N4HA 4QKUA 2RI2A 1WHJA 3O5ZA 2WSFE 3RKYA 3EGXB 5KE2A 4RTUA 3GLXA 1T0JA 1G3WA 2MK5A 1M3AA 3OYDA 1OI1A 2AHJB 4PJOF 3LX7A 2E64A 2LQKA 2Y4YA 2JTEA 2RJCA 4RG2A 1D1CA 2JNGA 1BI0A 2YRDA 4OMFB 2FZKB 2E3IA 2NUZA 4LDYA 3JRZA 2V8IA 2F2WA 2GGRA 1VA7A 1X01A 1ZA2B 2MWOA 4B9WA 3FEOA 4C0FA 4HT8A 3QPHA 3UDCA 2NUPA 3LWHA 2YUNA 4NOYA 1OU9A 4LUDA 4C92D 3OW2A 3OBWA 1WIEA 3HRUA 2E1HA 2FPEA 2XDDA 3BW1A 1NE8A 2X4YA 2HZYA 4C8QA 4M4ZA 1VQ4Q 2DK3A 1QWFA 2LDMA 4F7UF 2BZYA 3UATA 5GAMh 1VQMA 2DXCA 3H9NA 1OULA 1XOVA 2OTJA 2DZCA 1YJNA 1Q7YR 1M1KC 1UB4A 1M3CA 4XU1A 2XI9A 1RABB 1Y96A 4DOVA 2V1QA 1BCMA 2QASA 1VQ8A 1CKAA 2F5KA 1N8RC 2G3RA 1C6VX 2J7IA 3L2WA 1X43A 1U3OA 3OS0A 1HSQA 3QSUA 1ZA1B 1PCXA 2ZAEA 3H8ZA 2BUDA 4A4EA 1CKBA 4CRIA 3CC4T 3VRYA 3QZ9B 1M8MA 5DLOA 3RMSA 2F1LA 4JLGA 1CSKA 3QBYA 2L8DA 4NS5A 3CCUQ 4XTVA 1WZOA 4VUBA 4LUEA 3J7AF 2E4HA 3CCJQ 5FU6C 1K9MU 1KJWA 2E3HA 2F5TX 2VGMA 4OB0B 3CXCA 4R56A 4XTYA 3LH0A 4E7IA 5I22A 2QGFB 2BE9B 4M75C 1RLQC 3I55T 4GY5A 3EGXA 3CPWS 1IGUA 3Q1JA 3CC7A 2HQXA 2O9SA 3L2ZA 2QQSA 4KGZB 4J6XA 2FYKA 2K5LA 1SKUB 4LN2A 4HVWA 2DVJA 1PWTA 1UHCA 1I0CA 3QJ6A 2VKNA 4IKFA 2DBMA 2E5QA 1JJ2A 3CPFA 1TSFA 5CKBA 1LPLA 3HKSA 5GMKi 5FW9A 3CCLT 4K11A 1S72T 1FXXA 1EX4A 4XTXA 4PL6A 2EQIA 4F16A 3M58A 4DQ2A 4AFZC 4N0AA 2DETA 4M78D 3GP8A 5A0GA 2QG9B 3HPWA 5FU6B 2NUTB 2VASA 4PJLA 2R5MA 5LJ3g 2A36A 1KD1C 1XJWB 3EG0A 3JSCA 1JU5C 1BIAA 2E12A 4M75B 3BY7A 2HQEA 2KT1A 2A3LA 1PSEA 2GQVA 1C1AA 1GL5A 1X2QA 3CD6T 4LDWA 2E70A 5LJ3j 3T9NA 2A08A 1QP2A 1OX9A 5DY9A 4ZNXA 1TUCA 4MDXA 2KK4A 4JZ3A 1UEBA 4F14A 3HRSA 1PG5B 2NYSA 2DNUA 2KE9A 3RDVA 4JDSA 2E65A 4GLKA 3MO8A 2WSCE 1VQ4T 2AKLA 3OYYA 1T3SA 3OBYA 1WXTA 3G71T 5DLQE 2D8HA 4J9CA 1IB8A 4UC4A 4PNOA 2KNBB 3PE0A 2ZPIB 1QKXA 3OYBA 3OS1A 1FX7A 3JB9J 1QW1A 3PGGA 4QVCA 2DEQA 5LJ5g 4PJOC 1RAIB 1WX6A 4FIBA 2SEMA 1M1KU 4L5GA 1O9SA 2ZPEB 1T0HA 3CCQQ 4C8QD 4M7AF 3CEYA 2HQHA 1N8RU 3MP1A 1OZ3A 1I5LA 4MMLA 5LJ5j 2B8AA 3P8HA 3VUBA 2DFUA 1X6GA 2CP0A 2CREA 2QGGA 3CCSQ 3CCUT 1I4K1 3JCMb 1VQLQ 4WTOB 2IG0A 4LXCA 2P0PA 4QT7A 4HA8A 1ZUUA 3BDLA 3M9QA 3OYEA 1K8AC 2VXEA 1Q86C 2KXDA 1BU1A 2F2XA 2KXCA 1VQOT 3CPWP 4E7ZA 3V8KA 5FU7B 2YSQA 3ZBDA 2X35A 5KYWB 2LX9A 1GRIA 2O9VA 2DM1A 4JJDA 3ZL7C 2NUTA 2VXFA 1QVFS 3G6ET 2LQWA 4DBHA 1H641 3E19A 1PD0A 1SHGA 4BE2A 2K3BA 1BKBA 2ED0A 4JRQA 1ABQA 4PLIA 4J7IA 4PJOG 2EGEA 3QUIA 4JS4A 1TXQA 1QCNA 2H3JA 2LJ0A 2MI6A 1KHCA 3CCMQ 2KR3A 2EAYA 5HK0A 3VS3A 2HBWA 4Z89A 3V8JA 1T3LA 2MMPA 3EGUA 5GANe 3CCVQ 2A28A 4MZTA 2V8KA 4WCIA 1VQPT 2JJ9A 3CMEQ 2MAMA 2O2OA 4J9IA 1U5SA 1NLOC 1BK2A 1M2VB 3CCJA 1QVGA 3I56A 1XQHA 1KD1U 1Q82R 2LNVA 1TWBA 2DD5A 1WHGA 1E6GA 2RK1A 4KGVB 2YLCA 1SPKA 1YJWT 4M75E 4OB2B 3FJ5A 2JTMA 2IVWA 2DKGA 2JUFA 4F7UG 5IT9E 3UF4A 2FPFA 3MCAB 4OVAA 1W6XA 1FMKA 4B6MA 4XTUA 5FWBA 4Q5WA 3QYGB 3VYGA 4C5GA 3QIIA 2MIOA 1VQ9Q 3M0TA 4JZ4A 4KUDK 5C6SA 1VQKQ 4PLLA 2DO3A 3L2VA 1WXBA 2NWMA 5CO7A 4RCBA 2DX1A 5GANh 3QG1A 3SHWA 3RIRA 3CCQT 2ABLA 2JN0A 2JW4A 5KH6A 3RKWA 3LGFA 3OS5A 2BIVA 2DL3A 1AEYA 2GTJA 3NTIA 4FYVB 1ACMB 2RPNA 4F04B 5IAYA 1PHTA 3OMGA 5KYWA 1UE9A 2DXTA 1X75C 3HFNA 1VQLT 4PJOA 1XTDA 1KQ2A 1RACB 3G4SA 2CYZB 2HSPA 2H8HA 3NGPA 2V8JA 2RJFA 2PUOB 4D6WA 4ZTJA 1WGSA 1KFZA 1PRLC 4XK8E 5M9OA 2YWWA 3CQTA 4OMMA 2CUBA 1MNDA 2LCSA 1V1CA 3DLLA 1VQ7Q 4BI4A 1K8AU 4J9EA 2K6DA 4BDZA 3JB9F 1Q86U 3C12A 1QQJA 1I81A 1M90C 3FRNA 5GJVB 4E7HA 2ZPHB 2DYBA 2QA4T 1QVFP 3EG9A 2KBTA 4XTZA 3S6WA 1HK9A 4AT1B 1MNEA 2ZCFB 4M75F 4PFPA 1NZ9A 3LWIA 4F7UA 4BI3A 2QDYB 2QK0A 4M7AC 2KQWA 2FL7A 2J6OA 1M1GA 1MMGA 5CKFA 2D1XA 1UG1A 2ZPBB 1UGRB 2HL5C 2B86A 1AZGB 4ZTFA 2PVGB 2CP3A 3GBQA 2M1HA 1NLPC 2E6ZA 3CCVT 2FRYA 3CCSA 3PMTA 2CH4W 1VQLA 4Y28E 1D3BA 5GAOm 1Z9ZA 2DBKA 2PU9B 3JCMP 3HHTB 2ZPGB 4EMKB 2P84A 2QEXT 2P0KA 4BY6C 1PC0A 4OB3B 1WXUA 1BI1A 3X28B 4BDYA 1IXDA 5FRNA 3JCMd 1E6HA 2CT3A 3OYFA 1MMDA 3GNGA 2K7AA 1GBQA 3JCMg 1D0YA 2LMJA 2XMFA 1KK7A 1YIJT 2OX7A 3RBBB 3UPUA 2D0QB 4M7AB 5KCHA 3M4YA 3PVQA 3I55Q 1YI2T 3C95A 3PMIA 3N5BB 2VGNA 2DLPA 2EGAA 2L3SA 2JS2A 3VS1A 4RTTA 4FM4B 3GF5A 1VQNT 3QDRB 5GAOp 4J83A 2FG0A 2EWNA 1IO6A 2O4XA 3RMQA 3CCMA 4M7AG 1E7OA 2QQRA 4P5NA 3SD4A 4M77C 1M1KR 2RM4A 1LVKA 2QDLA 5J26A 4D8DA 4KRTA 3CCVA 3CCLQ 4BY6B 1S72Q 2CZ7B 1WHKA 3CMEA 1UHFA 2FHDA 3IQLA 1PSFA 4KH1B 1NYGA 3NFCA 2XKOC 3EAEA 1RAAB 2K4YA 3KFVA 3OY9A 1M4ZA 2K3YA 1WDXA 2QQAA 3JCMf 3NTHA 1VQ7T 3HTRA 3CD6Q 3NMZC 2ED1A 4A4GA 2XHCA 1NJIC 2JMCA 4PJOD 3P8DA 2LJ3A 4LE9A 5GAMd 5HKCA 4R55A 1WNLA 1VQ9A 5GAMg 3RERA 2K2MA 1VOMA 4M77B 3VKIA 1VQKA 1NPRA 4BUGA 4JRKA 4HCCA 1M90U 4BACA 2MPXC 3AT1B 4EMHA 4ZGJB 3G71Q 5IXFA 4IIOA 4DBFA 3JCMc 1TU0B 2X4JA 3OQ5A 2X3XD 3L2RA 1YITQ 2P4RA 1UTIA 2XK0A 5CIUA 3OYGA 2H3EB 2LZ6B 4FYYB 3SWNC 1N9RA 1OU8A 3SDZA 3OYKA 1B34B 2RB6A 3A8LB 1PM3A 4ZGEB 3VV0A 3WVDB 3JCMX 4JUVA 2JS0A 3BE3A 4M7AA 3S3NA 2QYZA 3A98A 2LRQA 1IREB 3QXEB 1LOJA 1WI7A 3CCET 4JRPA 3P8BB 3H0FA 1GBRA 2HEQA 4N4IA 1Q95G 1KD1R 1I1JA 2DIGA 5KE3A 1VQ7A 1AT1B 1BCOA 2RNAA 4MZPA 2RJDA 2E10A 2EKHA 3JV3A 5GAMf 1M2OA 4A4FA 3AHUA 3OYNA 7AT1B 1Y57A 1VQOQ 2EJFA 1MV0B 2DRMA 3E1SA 1LNXA 2KAFA 2OJ2A 3SWNB 5GAOn 2K2VA 3O8VA 4ANJA 5IH2A 2RD1A 4CC4B 4M7AE 2R5AA 3OYCA 2LJ1A 1PKTA 2GFAA 2GTOA 3CBPA 2DXBA 3G6EQ 3DB4A 2LQ8A 3OMCA 3CXCS 5LJ3e 4J9GA 2JM8A 2K5FA 1AVZC 2I2LA 4PK4A 1OEBA 4ZGDB 2YRVA 4TVRA 2RF0A 4CC3A 1D0XA 3GIBA 3L2UA 5L23A 2JVVA 3OYJA 3CC4A 1V76A 2DTOA 2D6FA 4JJNK 4FCYA 2QAZA 3M0RA 4EMGA 2E5KA 3GOXA 4A63B 4X1VA 1JJ2S 3M4GA 4HT9A 1VQPQ 3QKJA 3JB9G 2KSSA 4RCCA 1M27C 3NPFA 4E7JA 5HY6A 3OYAA 1SRMA 1D09B 4E7LA 5IHNA 2KEAA 2DL5A 3MP8A 2F2VA 3PNWC 1YJWQ 4J6YA 3I55A 1N27A 1PD1A 1K8AR 4M75G 1MGQA 2WSEE 5LJ5e 5CAIA 4KGXB 5LJ3h 1X69A 1NJIU 2FB7A 1HYOA 3REBB 1GFCA 1H3ZA 1YP5A 5GMKm 2LT4A 2DRKA 3V8LA 2SRCA 4QQDA 2BTTA 1TTHB 5FU7C 3CC2Q 2W0ZA 1YITT 4M77E 3A1PA 4FU6A 4II1A 1Z9QA 2ZZDA 2EQUA 1YJ9T 3CCLA 4E6RA 1S72A 1OZ2A 2Y90A 2ROLA 2FRWA 2MCNA 2DZ9A 2FPDA 5I11A 1ARKA 3EFOB 1D0ZA 3E9FA 3SWNA 4MDWA 3KUFA 2ZGWA 4XAXB 2HAXA 5LJ5h 1Q81C 3JCMV 1ZHIA 2CUDA 2E41A 3EH2A 3CD6A 2BZ8A 2CZ6B 2X4WA 1K76A 4PJJA 2RK2A 2D8JA 3I5SA 4F17A 2KT8A 2XD0A 4M7AD 4IUUA 4DEYA 5FRMA 3HSBA 2C0TA 3JCMJ 3EGDB 3SB2A 3TEEA 1VQ4A 3DKMA 1QVPA 3G71A 2RQVA 2M02A 2EBPA 1QVFA 4KUIA 4B9XA 2ATCB 2QA4Q 3CXCP 2QQBA 3EG1A 4Z02A 1YITA 2JZ2A 2A37A 1N6AA 2DPPB 4M75A 3KXTA 1BIBA 1BBZA 4C92B 3V7SA 2QXFA 1NPPA 2RO0A 1RADB 1QCFA 4GBQA 3M53A 2QTVA 3X25B 3MKDA 3JB9H 1AWXA 1AWWA 4M77F 2BE7D 4L59A 4BB7A 1JJ2P 3CCUA 2RN8A 1D1BA 2L0AA 4JJBA 1SG5A 4D8KA 3L42A 5GMKj 1G3TA 2PVOB 4ELZC 5FLXE 2EGCA 1W1FA 1VUBA 1O75A 2QEXQ 1YN8A 3RKXA 5KYYB 1AWOA 3TREA 1VQOA 2VVKA 1A0NB 5D6XA 3V7RA 2C0OA 1TUDA 4LNPA 3CMAQ 1WLPB 2BKDN 2J6KA 1YIJQ 2FVUA 5GANd 1QVGS 3URGA 1M90R 3CC2T 3G6EA 1G5VA 1B07A 1YI2Q 4ESRA 2X9HA 3X20B 1WQ7A 1HJDA 1NM7A 4OMOA 4LDXA 1VQNQ 3MP6A 1BYMA 1WA7A 1W2BA 3UA7A 2D0NA 9ATCB 4AMCA 2DXUA 1G3YA 2CSQA 3X24B 4M7DF 1YBYA 2XIDA 3ASKA 4DEXA 3EGDA 4AG1C 5KYXB 2PTKA 1RI0A 3FLGA 3MEUA 2EYZA 3MHXA 1VQPA 4LD9K 2PVDB 3A8OB 4KULA 1M9SA 1M5Q1 3EFRA 4LDVA 3REAB 1FMWA 1Y7XA 3PT9A 4J7FA 2L5QA 1RLPC 1YJWA 1BI2A 3VS5A 1Q81U 2DILA 4M78B 1K9MR 4RUGA 4FT2A 1Q82C 3UT1A 2M51A 4EMKC 3EG2A 5KYNA 5GANf 2RHZA 1YHQT 2M9UA 1MMNA 2PNIA 4Y92A 4E47A 3H0IA 2D9TA 3UA6A 3EFSA 3SEMA 3CC2A 2W10A 5GAOr 1K1ZA 4C8QC 4PJMA 1AD5A 5D7UA 3PFSA 3A8MB 2AK5A 5GAN8 1X2KA 2LCCA 1MMAA 1TOVA 4R0KA 1I07A 1LCKA 1M8VA 1M2VA 1R77A 4OF1A 1EFNA 2KY9A 3VS0A 1K73C 3MJXA 2VC8A 1UGSB 1F1BB 3CCQA 1YCSB 2VWFA 1WHHA 4PJNA 3JB9D 4C5EA 5KYYA 2VV5A 1ZLMA 3F70A 3FB9A 6AT1B 3CCRT 2O88A 4LD6A 4OMPA 2RQWA 4C92E 3VRZA 1VYVA 2OAUA 1YWOA 1IZ6A 1AHJB 5GAN7 4M75D 3JCMe 1VQ6Q 2DJQA 3H41A 2JTFA 4NL3A 2LT1A 2K9GA 5CQYA 5GAN2 2CP7A 2AZSA 3CCEQ 2RI3A 3SFMA 1BB9A 4C8QB 2JOYA 2EQMA 3CMAT 3OS2A 2OAWA 3FIFA 4FSXA 1QVGP 2K79A 1KC8C 3QJYA 1G2BA 2AZVA 4IUQA 2QA4A 1K4US 1UJYA 3THKA 1SEMA 1Y0MA 3A8GB 1YFNA 2DF6A 3A8HB 5IXBA 2VUBA 1NJIR 1RAFB 1JEGA 2JMAA 3VS2A 1NEBA 2IPOB 2RHXA 2MYSA 1SHFA 4QVZA 1OQKA 2HBPA 4ME7A 1WQWA 1KQSS 1S1NA 4AFUC 4CC7A 4HCKA 3GPLA 1EZZB 2EFIA 3WVEB 5CKDA 4ATOA 2EYYA 3G1JA 2HNIA 4ELYC 1N5ZA 1VQMT 5AYFA 4N0AC 1QWEA 2GFUA 3RESA 3I9QA 1N8RR 2OTJT 2EJ9A 1WHLA 4ZN1A 2KROA 2XDPA 1AWJA 2KRNA 1G83A 2VYTA 2R58A 4J8OA 1M3BA 3LW5E 2K3XA 1VQ8T 4JPBW 5GAMe 3LLRA 2QEXA 3CBMA 2L3RA 1YNZA 2RHIA 4C92F 2DIQA 4JLIA 2YUPA 2LVMA 2DL7A 3CMAA 4FYXB 3TU4K 1MUZA 3C4SA 2FO0A 4OGEA 3VJPA 1G8XA 1YIJA 3OSVA 2C0IA 1OPKA 2COZA 4C5HA 1YI2A 1Q82U 1JB0E 1NYFA 2A7YA 4M78E 5A0DA 2DVEA 3KBGA 4RTWA 4AFQC 2RQUA 1IGQA 2RHUA 4FW1A 4BE1A 1JO8A 3OYIA 1VQNA 2BZXA 3QO3A 3EG3A 4E7KA 3HFOA 8ATCB 4BD3A 3MEAA 5EC7A 5GAMj 4M7DC 2K57A 1UGVA 2RQTA 2KMTA 2EPDA 1QP3A 2GQIA 4MMKA 1ZUYA 3H6ZA 4O6JA 4EMKA 5CVIA 4IUTA 4OGCA 3OW2S 1R0BG 3M0UA 4M77G 1TG0A 4O5VA 2QQ9A 2EVRA 3CC7T 1GXIE 3E9GA 1SSHA 3PIOA 1K73U 1YJ9Q 3LYIA 3MPUB 2M0OA 1M1FA 2MWPA 1VQ6T 4ORZA 1U1SA 2DERA 5A2QE 2YHTA 2J6FA 3C94A 1UFFA 3M0QA 2XDBA 2LNHB 3PIPA 2R57A 2X3WD 4DOWA 2OI3A 2KYBA 3OYMA 1VQ5Q 2YRCA 2DTHA 3C0CA 3DB3A 3VU3C 4FL6A 4YTLA 5AT1B 3JCMQ 4PKCC 5KYUB 2PZ1A 3M5AA 1WJQA 1BI3A 4IIMA 2L3PA 3CPWA 8AT1B 4M7DB 4C8QE 3JCMW 1YWPA 3INZA 2V1RA 3TCJA 4FW2A 3RNJA 5GAN5 1KC8U 5I2MA 4X9CA 1KQSP 1RAHB 3I56Q 1ABOA 1NG2A 2XG8D 1QCOA 4M7DG 3M54A 2CH4A 4C5IA 2CZ1B 4V2SA 2YUQA 1H8KA 4M78F 3FJPA 5GAN3 1B3QA 5CK9A 1Q7YC 3JB9I 4C0ZA 5DM7R
chains in the Genus database with same CATH topology
2M16A 1G3WA 5M9OA 3OYDA 1OI1A 2AHJB 4PJOF 3LX7A 2LTOA 4QQGA 2E64A 2QQBA 4M7AE 2LQKA 2Y4YA 4L6V5 2RJCA 4Z02A 1YITA 3L2QA 2JZ2A 1VQ6A 4RG2A 1N6AA 3DLLA 2DPPB 4M75A 4BI4A 3KXTA 2JNGA 4BDZA 1K8AU 1WJRA 2QTXA 3JB9F 1BIBA 1Q86U 1BI0A 4OMFB 3C12A 4M77A 1M90C 1I81A 3FRNA 4C92B 3V7SA 3CCEA 4E7HA 2ZPHB 2QXFA 4LDYA 4DA4A 2QA4T 1NPPA 2RO0A 3JRZA 2V8IA 4XTZA 1R8OB 3S6WA 1HK9A 3M53A 4M7DG 1X01A 2ZCFB 2CS7A 2MWOA 4B9WA 4M75F 3X25B 3JB9H 1NZ9A 1RL2A 3FEOA 5LJ3d 3ER0A 3UWNA 4C0FA 4HT8A 3QPHA 3L1AA 3UDCA 3LWIA 4M77F 4F7UA 3LWHA 4BI3A 2CGHA 4L59A 4BB7A 4NOYA 2QDYB 4C92D 3OW2A 4M7AC 2KQWA 2FL7A 3OBWA 3HRTA 3CCUA 3VYHB 1M1GA 3GNFB 3A5ZB 3HRUA 5CKFA 1SSFA 2E1HA 1B34A 2XDDA 2ZPBB 1UGRB 3BW1A 3L42A 1NE8A 3OB9A 5GMKj 1G3TA 2PVOB 2X4YA 4ELZC 5FLXE 4C8QA 2DK3A 1WJSA 2LDMA 4F7UF 2PVGB 4ZTFA 2M1HA 3M55A 2E6ZA 5GAMh 1VQMA 1W4SA 4JRIA 2DXCA 4NL2A 3V7CA 3CCVT 1X6OA 1VUBA 1O75A 1XOVA 2O01E 3RKXA 3CCSA 2DZCA 3TREA 1VQOA 2OTJA 3PMTA 1YJNA 1M1KC 1VQLA 1UB4A 4Y28E 2PUKB 1D3BA 4XU1A 5D6XA 2XI9A 3X26B 5CCAA 5GAOm 1Y96A 3M57A 4DOVA 1JBMA 4Y91A 3V7RA 3QYHB 4M7AD 3OA6A 2PU9B 2KDSA 4C8QF 3JCMP 1VQ8A 2LC4A 2F5KA 3HHTB 2BKDN 1N8RC 2ZPGB 2G3RA 4EMKB 2Y4XA 2FVUA 5GANd 2P0KA 2QEXT 1QVGS 4XK8E 4BY6C 3L2WA 3OS0A 3URGA 3QSUA 4OB3B 3CC2T 5GAOl 3RUXA 3G6EA 1G5VA 5J3BA 1BI1A 3X28B 4BDYA 5FRNA 3JCMd 4M7DA 3H8ZA 2BUDA 3X20B 3GNGA 1DJ7B 5LJ5d 4A4EA 3OYFA 1WQ7A 4CRIA 3CC4T 3JCMg 2NLUA 2YLBA 3QZ9B 2CZ0B 4C92C 1YIJT 1ZBXA 4LDXA 3MP6A 5DLOA 1BYMA 3RMSA 2EKOA 1JRIA 3UPUA 1W2BA 2D0QB 4M7AB 1VQ5T 4JLGA 4HKEA 2DXUA 2RHYA 5KCHA 1G3YA 2L8DA 3QBYA 4NS5A 3M4YA 1YI2T 3C95A 3LGLA 3PMIA 1HXDA 4XTVA 3X24B 4VUBA 4M7DF 3N5BB 2VGNA 3J7AF 5LJ3f 1YBYA 2XIDA 5I21A 3ASKA 5FU6C 1K9MU 4FM4B 2F5TX 4HT9A 3GF5A 2VGMA 4OB0B 3QDRB 3WXMB 1VQNT 4QW2A 5GAOp 4J83A 2EWNA 2O4XA 3CXCA 3FLGA 1RI0A 3MEUA 3RMQA 4R56A 3MHXA 4XTYA 3LH0A 3CCMA 4E7IA 1VQPA 2QQRA 2PVDB 3A8OB 4LD9K 4M7AG 4M75C 4KULA 3I55T 1M9SA 4GY5A 1M5Q1 3EFRA 4P5NA 3SD4A 4M77C 3CPWS 3Q1JA 4LDVA 1OYXA 2RM4A 3CC7A 2EQJA 4HCZA 1Y7XA 3PT9A 2HQXA 3CCJT 5I2SA 5J26A 4J7FA 3L2ZA 3I56T 2P4TA 2QQSA 4J6XA 2FYKA 2K5LA 3CCVA 3QZ5B 3OYLA 2L5QA 4M7DE 1YJWA 4BY6B 1BI2A 1I8FA 2CZ7B 2C06A 3J81E 3CMEA 1Q81U 2FHDA 5GMKe 4M78B 1PSFA 4FT2A 4OB1B 1Q82C 3QJ6A 4XTWA 4IKFA 3NFCA 2XKOC 3UT1A 2E5QA 3EAEA 1JJ2A 1YJ9A 3CPFA 4EMKC 4PJOB 5CKBA 3HKSA 4A4HA 4XU3A 5GMKi 5GANf 4J5YA 2RHZA 1YHQT 2K4YA 3CCLT 3OY9A 1M4ZA 2E6NA 2M9UA 2KVQG 1FXXA 1S72T 4E47A 2K3YA 2D9TA 4XTXA 2F69A 3EFSA 4PL6A 3CC2A 5GAOr 3M58A 4C8QC 2QQAA 4DQ2A 3PFSA 3JCMf 4N0AA 3A8MB 4M78D 1U1TA 5GAN8 1EIFA 3GP8A 5A0GA 2LCCA 5LJ5f 3NTHA 3HPWA 1Q7YU 1VQ7T 4EDUA 5FU6B 5CKHA 1UGPB 4A4GA 2XHCA 3S3MA 2R5MA 5LJ3g 3J80E 1NJIC 1M8VA 2EQKA 4PJOD 3P8DA 4OF1A 4C92G 3ME9A 5GAMd 2KY9A 4RMOA 1K73C 1KD1C 1VQ5A 2OTLT 4X34A 2VC8A 5HKCA 1UGSB 4R55A 3JSCA 3CCQA 1BIAA 1WNLA 2E12A 4M75B 5GAMg 3BY7A 1KC8U 1VQ9A 3RERA 4N4GA 4EPCA 2HQEA 4XU0A 2A3LA 2WACA 1PSEA 2GCXA 2GQVA 4M77B 3VKIA 1NPRA 4C5EA 3JB9D 1VQKA 2EJGA 2VV5A 4JRKA 4BUGA 4HCCA 1FWZA 1M90U 3F70A 3CD6T 4BACA 4LDWA 2E70A 3FB9A 4QQ6A 4RG8A 5LJ3j 3CCRT 3T9NA 4LD6A 4EMHA 3META 4C92E 4ZGJB 1QP2A 5DY9A 2OAUA 1UGQB 4MDXA 2KK4A 3JCMc 1UEBA 1IZ6A 3HRSA 4ZN3A 1AHJB 2X4JA 3OQ5A 5GAN7 2P0QA 4M75D 5GMKh 3JCMe 3L2RA 4F7UB 3OSSC 4JDSA 5CKEA 2DTIA 2E65A 2XK0A 4GLKA 5CIUA 3G4ST 3OYGA 4M77D 2JTFA 3MO8A 2WSCE 1VQ4T 1VIFA 3SWNC 4NL3A 1N9RA 2LT1A 3OYYA 3SDZA 3MEVA 5CQYA 3OBYA 5GAN2 1B34B 3OYKA 3G71T 2XU8A 2RB6A 3A8LB 4MZMA 5DLQE 2DJZA 2RI3A 3SFMA 4ZGEB 4J6WA 4UC4A 5GANg 3VV0A 3OYHA 4C8QB 3G7ZA 4M78C 3WVDB 2JOYA 4PNOA 4CI0C 1KQ1A 4JUVA 3JCMX 4C0DC 2EQMA 2ZPIB 1G3SA 4M7AA 3S3NA 3OYBA 3CMAT 3OS2A 3OS1A 1FX7A 2GF7A 2LRQA 2LCLA 3FIFA 3JB9J 1QW1A 3BDUA 3PGGA 4QVCA 1IREB 2DEQA 4FSXA 5LJ5g 1KC8C 4PJOC 4FIBA 3QJYA 1D3BB 1M1KU 4IUQA 1KG1A 3QXEB 1LOJA 2QA4A 3CCET 4QVDA 4JRPA 4L5GA 5GANj 1O9SA 3P8BB 5CR2A 2ZPEB 4N4IA 3A8GB 3A8HB 4OP0A 2VUBA 2RI5A 3NTKA 4C8QD 1Y07A 4M7AF 3CEYA 2DIGA 5KE3A 2ZPFB 3MP1A 1N8RU 3ZEHA 1OZ3A 1VQ7A 1I5LA 4MMLA 5LJ5j 2B8AA 4MZPA 2RHXA 2RJDA 3P8HA 3VUBA 2E10A 5GAMf 4QVZA 2HBPA 4ME7A 4A4FA 5A0LA 1WQWA 1KQSS 2OTLA 3OYNA 3AHUA 1YCYA 3CCUT 1I4K1 2EJFA 3JCMb 3GPLA 5LL6S 2IG0A 3E1SA 1W2BS 2P0PA 1KHIA 2EFIA 3HL8A 4HA8A 1LNXA 3WVEB 3BFMA 4IURA 5CKDA 4ATOA 2KAFA 3SWNB 5GAOn 3BDLA 3M9QA 3OYEA 2K2VA 2HNIA 4ELYC 3O8VA 1K8AC 2MF2A 2RD1A 2VXEA 5AYFA 1VQMT 4IUPA 1Q86C 1ZQ1A 2R5AA 2X4XA 3MEWA 2GFUA 4N0AC 3RESA 5HK3A 3OYCA 3CCST 2OTJT 4XQ3A 2QI2A 2EJ9A 2GFAA 1VQOT 5J39A 4M7DD 2L89A 3CBPA 3V8KA 4C92A 2DXBA 5FU7B 4ZN1A 1U8RA 3DB4A 4C0DB 2LQ8A 2XDPA 3OMCA 5LJ3e 5KCOA 3CXCS 3ZBDA 2RH2A 2O4XB 2VYTA 2X35A 4LDUA 2K5FA 2R58A 4J8OA 3LW5E 2K3XA 2LX9A 1VQ8T 2I2LA 3JAME 2PQWA 4ZGDB 5GAMe 3LLRA 1P92A 2QEXA 3CBMA 1MHNA 2L3RA 5GAOq 2YRVA 4TVRA 2RHIA 3VUZA 2VXFA 4IUVA 4C92F 1QVFS 3G6ET 3L2UA 3GIBA 2DIQA 4JLIA 4M78G 2K5IA 2LVMA 1H641 3E19A 3CBOA 2HD0A 3CMAA 2RJEA 2JVVA 3OYJA 4BE2A 3TU4K 2DTOA 1BKBA 4JRQA 4JJNK 4BE0A 3CC4A 3C4SA 3VJPA 4OGEA 5FROA 4PLIA 1YIJA 4J7IA 3OSVA 4EMGA 4PJOG 3HP9A 3GOXA 3QUIA 4JS4A 2H3JA 2MI6A 2EYQA 3M4GA 1JJ2S 4C5HA 1KHCA 1YI2A 1Q82U 1JB0E 2A7YA 3QKJA 4M78E 5A0DA 2DVEA 3KBGA 4A54A 2EAYA 3JB9G 2KSSA 4RCCA 3M59A 5HK0A 4BI8B 2XICA 4E7JA 5HY6A 3OYAA 2RHUA 5CQXA 2D6FA 3V8JA 2MMPA 1Y71A 3PTAA 4E7LA 4BE1A 4PJOE 3OYIA 1VQNA 4JS5A 3MP8A 1XNIA 3QO3A 5GANe 3CD6A 4E7KA 3HFOA 2EIFA 4BD3A 3MEAA 1VIEA 3PNWC 4MZTA 5GAMj 4M7DC 1TH7A 2K57A 5D6WA 5L8RE 2V8KA 2KMTA 4J6YA 1QP3A 4MMKA 3I55A 1N27A 3CCMT 1VQPT 4O6JA 3H6ZA 4EMKA 4M75G 5CVIA 2MAMA 1MGQA 4IUTA 4OGCA 2WSEE 5LJ5e 3OW2S 5CAIA 4M77G 5LJ3h 4O5VA 3CCJA 2QQ9A 3M56A 1QVGA 1NJIU 3I56A 3CC7T 2FB7A 1XQHA 2CKKA 4KBMB 1GXIE 3E9GA 3PIOA 1K73U 1KD1U 3FC3A 1H3ZA 3QHSA 5GMKm 3DLMA 2LNVA 2LT4A 2DD5A 3LYIA 2RK1A 3V8LA 2YLCA 4QQDA 1YJWT 4M75E 4OB2B 2M0OA 5FU7C 3CMET 2JTMA 1M1FA 2IVWA 2MWPA 1YITT 1VQ6T 2DKGA 4M77E 2JUFA 4RKUE 4F7UG 1U1SA 5IT9E 3MCAB 4FU6A 5A2QE 2YHTA 4II1A 4OVAA 3C94A 2ZZDA 5GMKl 2EQUA 2XDBA 3PIPA 1YJ9T 4XTUA 2R57A 1YHQA 3CCLA 4DOWA 1Y96B 1S72A 1K9MC 4Q5WA 3OYMA 1OZ2A 3S3OA 2DTHA 3QYGB 3VYGA 4C5GA 3QIIA 3DB3A 2Y90A 4C8QG 3VU3C 4F7UE 5C0MA 4FL6A 4YTLA 5IN1A 4KUDK 2DZ9A 5C6SA 3JCMQ 1KQSA 3FDRA 4PKCC 2DO3A 4PLLA 2RA2A 3L2VA 3M5AA 1WJQA 3R6OA 4C0GA 1BI3A 5CO7A 2DD4A 4RCBA 5GANh 3QG1A 4KT0E 3CPWA 5EG2A 4M7DB 3E9FA 3SWNA 1LJOA 4MDWA 3KUFA 3ZFJA 4C8QE 3RIRA 3CCQT 2ZGWA 1WPYA 4XAXB 1VQ9T 3JCMW 3JCMh 5D6YA 3INZA 2HAXA 2DAQA 4A53A 5LJ5h 1Q81C 3TCJA 3JCMV 1VQKT 1ZHIA 2E41A 1V29B 2JN0A 5I2MA 3LGFA 2CZ6B 3RKWA 5KH6A 5GAN5 2X4WA 3OS5A 3CCRA 2BIVA 4M78A 4X9CA 4X9DA 2RK2A 5GAN6 3NTIA 1N9SA 4A4KA 4HCBA 2XG8D 5IAYA 3OMGA 5GAN4 2XD0A 2DXTA 3HFNA 1X75C 3M54A 4IUUA 4WF2A 4XU2A 1YJNT 1XTDA 4FT4A 1VQLT 5FRMA 3HSBA 4PJOA 1KQ2A 4C5IA 4N4HA 3G4SA 2CZ1B 3JCMJ 3SB2A 4V2SA 2CYZB 3TEEA 2RI2A 1VQ4A 3DKMA 2V8JA 4M78F 2RJFA 3FJPA 2PUOB 1QVPA 2WSFE 4D6WA 5CK9A 5GAN3 3G71A 4ZTJA 1Q7YC 1WGSA 3RKYA 1QVFA 3JB9I 4KUIA 5KE2A 4B9XA 4C0ZA 5DM7R 3GLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJZ A;  5LJ3 f;  3V8J A;  4J6W A;  5I21 A;  4PJO F;  5GAN g;  2E64 A;  4C8Q B;  4PJO E;  4M78 C;  4PNO A;  3QO3 A;  1KQ1 A;  4JUV A;  5GAN e;  3JCM X;  3HFO A;  5GAO p;  2EWN A;  4M7A A;  5GAM j;  4M7D C;  1TH7 A;  2K57 A;  4XTY A;  4M75 A;  4M7A G;  3JB9 F;  4J6Y A;  3FIF A;  2QTX A;  4MMK A;  3BDU A;  3PGG A;  4M75 C;  1BIB A;  4EMK A;  2DEQ A;  4QVC A;  4M75 G;  5LJ5 g;  4PJO C;  1MGQ A;  4M77 A;  1I81 A;  1M5Q 1;  3EFR A;  4C92 B;  1D3B B;  3V7S A;  5LJ5 e;  4M77 C;  1LOJ A;  5CAI A;  4M77 G;  5LJ3 h;  4QVD A;  2RM4 A;  5GAN j;  4F7U E;  2FB7 A;  3L2Z A;  4OP0 A;  4XTZ A;  1HK9 A;  4J6X A;  3QHS A;  2FYK A;  4C8Q D;  5GMK m;  1X01 A;  5GAM h;  4M7A F;  4M7D E;  3V8L A;  1I8F A;  4M75 F;  3JB9 H;  2YLC A;  4MML A;  5LJ3 d;  5LJ5 j;  1I5L A;  4M75 E;  4HT8 A;  3L1A A;  4M77 F;  4F7U A;  5GMK e;  4M78 B;  2CGH A;  2E10 A;  2DKG A;  4M77 E;  5GAM f;  4NOY A;  4F7U G;  3AHU A;  1U1S A;  1WQW A;  4XTW A;  4C92 D;  4M7A C;  2YHT A;  1YCY A;  1I4K 1;  2EJF A;  5GMK l;  3JCM b;  2E1H A;  1B34 A;  4EMK C;  4PJO B;  4XTU A;  4XU3 A;  5GMK i;  5GAN f;  4J5Y A;  3BW1 A;  1Y96 B;  4HA8 A;  5GMK j;  1LNX A;  3BFM A;  2DTH A;  4C8Q A;  4XTX A;  3SWN B;  3EFS A;  5GAO n;  5GAO r;  4F7U F;  4C8Q C;  2Y90 A;  4C8Q G;  2HNI A;  3VU3 C;  3JCM f;  4JRI A;  4N0A A;  4NL2 A;  3V7C A;  4DQ2 A;  4M78 D;  1U1T A;  2RD1 A;  2VXE A;  5GAN 8;  2DZ9 A;  5LJ5 f;  4N0A C;  3JCM Q;  4M7A E;  3RES A;  3RKX A;  2DZC A;  2RA2 A;  4XQ3 A;  2EJ9 A;  4M7D D;  3V8K A;  4C92 A;  1D3B A;  4XU1 A;  5LJ3 g;  1M8V A;  4RCB A;  5GAO m;  5GAN h;  1Y96 A;  4PJO D;  4C92 G;  1JBM A;  5LJ3 e;  5GAM d;  4Y91 A;  3V7R A;  4M7D B;  2VC8 A;  3SWN A;  4C8Q F;  3JCM P;  1LJO A;  1BIA A;  1WNL A;  4M75 B;  4C8Q E;  2I2L A;  3BY7 A;  2ZGW A;  3RIR A;  5GAM g;  1WPY A;  3RER A;  3JCM W;  3JCM h;  4EMK B;  3INZ A;  4XU0 A;  5GAM e;  3JB9 D;  4M77 B;  4A53 A;  5LJ5 h;  5GAO q;  2EJG A;  3JCM V;  2JN0 A;  2E41 A;  4JRK A;  3RKW A;  5GAN d;  5GAN 5;  3QSU A;  3FB9 A;  5LJ3 j;  4X9C A;  4M78 A;  5GAO l;  2VXF A;  3RUX A;  4C92 F;  4EMH A;  4X9D A;  3GIB A;  5GAN 6;  4C92 E;  4JLI A;  1N9S A;  4M78 G;  5DY9 A;  3JCM d;  1H64 1;  3JB9 J;  4M7D A;  3JCM c;  5LJ5 d;  5GAN 4;  2DTO A;  1WQ7 A;  2DXT A;  3HFN A;  4WF2 A;  4XU2 A;  3JCM g;  3HSB A;  4M7D G;  4M7A D;  2YLB A;  4PJO A;  5GAN 7;  4M75 D;  4C92 C;  5GMK h;  4EMG A;  4PJO G;  4F7U B;  3JCM e;  1KQ2 A;  3JCM J;  3SB2 A;  2DTI A;  2E65 A;  4V2S A;  1JRI A;  4M7A B;  4M77 D;  3QUI A;  3JB9 I;  2DXU A;  4M78 F;  3M4G A;  3SWN C;  1N9R A;  3FJP A;  5GAN 3;  4NL3 A;  4HT9 A;  4M78 E;  2DVE A;  4A54 A;  2EAY A;  3RKY A;  1B34 B;  1HXD A;  4XTV A;  4RCC A;  5GAN 2;  2RB6 A;  3JB9 G;  4M7D F; 
#chains in the Genus database with same CATH topology
 2M16 A;  2LTO A;  2CP6 A;  4QQG A;  1D1A A;  4RTZ A;  1VQ6 A;  4L6V 5;  3L2Q A;  1OV3 A;  1WJR A;  2QTX A;  1TUG B;  4M77 A;  4Z8A A;  1U06 A;  1WYX A;  4J9D A;  3CCE A;  3ULR B;  1OOT A;  4DA4 A;  2OTL Q;  4E7S A;  2KRM A;  1JQQ A;  1NBE B;  1TS9 A;  1R8O B;  2LQN A;  2CS7 A;  1B7T A;  5LJ3 d;  1RL2 A;  3ER0 A;  3UWN A;  3L1A A;  1J3T A;  2CGH A;  1Q81 R;  2HSE B;  1PNJ A;  2EW3 A;  3HRT A;  3VYH B;  3GNF B;  4GLM A;  3A5Z B;  1SSF A;  1B34 A;  1Q86 R;  2JM9 A;  1UDL A;  3OB9 A;  3G4S Q;  4KH0 B;  2FEI A;  1WJS A;  1IRX A;  4PFO A;  3M55 A;  1W4S A;  4JRI A;  4NL2 A;  3V7C A;  2COW A;  1X6O A;  2HL3 A;  2CSI A;  2O01 E;  2CDT A;  3OW2 P;  3NHN A;  2EYW A;  2L3Q A;  2PUK B;  3I5R A;  3X26 B;  5CCA A;  3VS6 A;  1I5O B;  3M57 A;  1JBM A;  4Y91 A;  3QYH B;  3OA6 A;  4C8Q F;  2KDS A;  2LC4 A;  1W70 A;  1ZBJ A;  2Y4X A;  5KYU A;  3EH1 A;  2YDL A;  5GAO l;  3RUX A;  1QLY A;  3R6N A;  5J3B A;  3TSW A;  4JJC A;  4M7D A;  2KYM A;  1GFD A;  1DJ7 B;  5LJ5 d;  5HCK A;  2NLU A;  2HCK A;  2YLB A;  2CZ0 B;  4C92 C;  1ZBX A;  1AOJ A;  4OML A;  2EKO A;  1JRI A;  1VQ5 T;  3LH5 A;  4HKE A;  2RHY A;  5FWC A;  3LGL A;  1HXD A;  5LJ3 f;  1ZSZ C;  5I21 A;  2CP2 A;  2L2P A;  1AZE A;  3WXM B;  2KRS A;  4QW2 A;  1VYU A;  1IHV A;  2A0F B;  3D7S B;  1JXM A;  1QMC A;  1OYX A;  1IHW A;  2EQJ A;  4HCZ A;  3CCJ T;  1HD3 A;  5I2S A;  3I56 T;  2P4T A;  2J06 A;  3QZ5 B;  3OYL A;  2AT1 B;  1YHQ Q;  4M7D E;  1I8F A;  4Z88 A;  2C06 A;  3J81 E;  1OPL A;  5GMK e;  2JT4 A;  2HMA A;  4OB1 B;  4XTW A;  2DL8 A;  3EHQ A;  4J9H A;  1YJ9 A;  1QKW A;  4PJO B;  4A4H A;  4XU3 A;  4J5Y A;  2E6N A;  3TVT A;  2KVQ G;  2F69 A;  2V26 A;  2DE0 X;  1H3H A;  1U1T A;  1EIF A;  5LJ5 f;  1ZSZ B;  1Q7Y U;  4EDU A;  4EIK A;  5CKH A;  1UGP B;  3CCR Q;  4AFS C;  3S3M A;  3J80 E;  1MV3 A;  2EQK A;  5IHK A;  2O31 A;  4CC2 A;  4C92 G;  1VQ5 A;  3ME9 A;  4RMO A;  2OTL T;  4X34 A;  4N4G A;  4EPC A;  4XU0 A;  2WAC A;  2YT6 A;  2GCX A;  2EJG A;  1FWZ A;  4QQ6 A;  2X51 A;  3EG9 B;  4RG8 A;  1K0X A;  1UEC A;  3MET A;  1UGQ B;  4J9F A;  1GCP A;  2ROT A;  4ZN3 A;  4OMN A;  2COY A;  2P0Q A;  5GMK h;  4FYW B;  4F7U B;  2RQR A;  3OSS C;  5CKE A;  2DTI A;  3G4S T;  4M77 D;  1VIF A;  3MEV A;  2ESW A;  2XU8 A;  4MZM A;  1JXO A;  2DJZ A;  4J6W A;  5GAN g;  3OYH A;  3EFO A;  2YXY A;  3G7Z A;  4M78 C;  4CI0 C;  1FMV A;  1KQ1 A;  1FYN A;  4C0D C;  1G3S A;  1GCQ C;  2GF7 A;  2LCL A;  3I35 A;  3BDU A;  1X6B A;  4PFZ A;  1D3B B;  3U23 A;  1KG1 A;  4QVD A;  2IIM A;  1UUE A;  1SRL A;  5GAN j;  5CR2 A;  3QWX X;  4OP0 A;  1ZUK A;  2RI5 A;  3NTK A;  1K73 R;  1Y07 A;  1ZX6 A;  2LP5 A;  2ZPF B;  1K0S A;  3ZEH A;  1KSW A;  1PRM C;  2MOX A;  1WFW A;  5A0L A;  1VQM Q;  2OTL A;  1YCY A;  2HKQ B;  2OTJ Q;  1YJN Q;  3QDF A;  2GNC A;  5ECA A;  5LL6 S;  1W2B S;  1KHI A;  3HL8 A;  3BFM A;  4IUR A;  3TSZ A;  2KGT A;  2Z0W A;  1VQ8 Q;  1VYT A;  1X27 A;  2VB6 A;  2MF2 A;  1OX8 A;  4IUP A;  3MEW A;  1ZQ1 A;  2X4X A;  5HK3 A;  3CCS T;  4XQ3 A;  2QI2 A;  4M7D D;  5J39 A;  2L89 A;  4C92 A;  1U8R A;  4C0D B;  2HDA A;  5KCO A;  1RAE B;  2RH2 A;  2O4X B;  2YUO A;  2DYI A;  4LDU A;  3VS7 A;  2JXB A;  2RMO A;  3JAM E;  2PQW A;  4OMQ A;  1P92 A;  1K9A A;  2J05 A;  1MHN A;  1ZSZ A;  5GAO q;  1KIK A;  1R0C B;  4FSS A;  4DBR A;  3VUZ A;  1KC8 R;  2GBQ A;  3H0H A;  4IUV A;  5IHI A;  4M78 G;  2K5I A;  3M0S A;  4AG2 C;  3CBO A;  2HD0 A;  2RJE A;  1C0M A;  2LX7 A;  4BE0 A;  5FRO A;  2KI7 A;  3M0P A;  2AIR B;  2DL4 A;  3HP9 A;  3TQ7 P;  2EYQ A;  2EYX A;  1PKS A;  4A54 A;  3M59 A;  4BI8 B;  2XIC A;  5CQX A;  1Y71 A;  2G6F X;  3PTA A;  3CC7 Q;  2I0N A;  4PJO E;  4JS5 A;  1XNI A;  1RAG B;  2EIF A;  4HVV A;  1VIE A;  4DBQ A;  1TH7 A;  5D6W A;  5L8R E;  1H92 A;  2DMO A;  3CCM T;  2NUP B;  4RTY A;  3RR6 A;  2FZG B;  3M56 A;  4KBM B;  2CKK A;  2ECZ A;  2HKN A;  1NEG A;  3FC3 A;  3QHS A;  3DLM A;  4J9B A;  3CME T;  4RKU E;  4RTX A;  1ZSG A;  2FZC B;  5GMK l;  3CC4 Q;  2CT4 A;  2DA9 A;  1YHQ A;  4HXJ A;  1Y96 B;  1K9M C;  3S3O A;  3E2U A;  2AKK A;  5C0M A;  4C8Q G;  5KYX A;  4F7U E;  2M0Y A;  5IN1 A;  1KQS A;  3FDR A;  2RA2 A;  2CP5 A;  3EHR A;  1RI9 A;  3VS4 A;  4C0G A;  3R6O A;  1M30 A;  3QWY A;  2DD4 A;  4KT0 E;  5EG2 A;  2DEU A;  1WHM A;  1UJ0 A;  1LJO A;  4HVU A;  3ZFJ A;  4E2F B;  1WPY A;  1VQ9 T;  3JCM h;  5D6Y A;  5GJW B;  2DAQ A;  4A53 A;  1VQK T;  1V29 B;  3CCR A;  1RUW A;  4M78 A;  3PVL A;  4X9D A;  5GAN 6;  1N9S A;  4A4K A;  4HCB A;  1GCQ A;  4RTV A;  1SF9 A;  5GAN 4;  4WF2 A;  1YJN T;  4XU2 A;  1W2B P;  4FT4 A;  2ENM A;  4N4H A;  4QKU A;  2RI2 A;  1WHJ A;  3O5Z A;  2WSF E;  3RKY A;  3EGX B;  5KE2 A;  4RTU A;  3GLX A;  1T0J A;  1G3W A;  2MK5 A;  1M3A A;  3OYD A;  1OI1 A;  2AHJ B;  4PJO F;  3LX7 A;  2E64 A;  2LQK A;  2Y4Y A;  2JTE A;  2RJC A;  4RG2 A;  1D1C A;  2JNG A;  1BI0 A;  2YRD A;  4OMF B;  2FZK B;  2E3I A;  2NUZ A;  4LDY A;  3JRZ A;  2V8I A;  2F2W A;  2GGR A;  1VA7 A;  1X01 A;  1ZA2 B;  2MWO A;  4B9W A;  3FEO A;  4C0F A;  4HT8 A;  3QPH A;  3UDC A;  2NUP A;  3LWH A;  2YUN A;  4NOY A;  1OU9 A;  4LUD A;  4C92 D;  3OW2 A;  3OBW A;  1WIE A;  3HRU A;  2E1H A;  2FPE A;  2XDD A;  3BW1 A;  1NE8 A;  2X4Y A;  2HZY A;  4C8Q A;  4M4Z A;  1VQ4 Q;  2DK3 A;  1QWF A;  2LDM A;  4F7U F;  2BZY A;  3UAT A;  5GAM h;  1VQM A;  2DXC A;  3H9N A;  1OUL A;  1XOV A;  2OTJ A;  2DZC A;  1YJN A;  1Q7Y R;  1M1K C;  1UB4 A;  1M3C A;  4XU1 A;  2XI9 A;  1RAB B;  1Y96 A;  4DOV A;  2V1Q A;  1BCM A;  2QAS A;  1VQ8 A;  1CKA A;  2F5K A;  1N8R C;  2G3R A;  1C6V X;  2J7I A;  3L2W A;  1X43 A;  1U3O A;  3OS0 A;  1HSQ A;  3QSU A;  1ZA1 B;  1PCX A;  2ZAE A;  3H8Z A;  2BUD A;  4A4E A;  1CKB A;  4CRI A;  3CC4 T;  3VRY A;  3QZ9 B;  1M8M A;  5DLO A;  3RMS A;  2F1L A;  4JLG A;  1CSK A;  3QBY A;  2L8D A;  4NS5 A;  3CCU Q;  4XTV A;  1WZO A;  4VUB A;  4LUE A;  3J7A F;  2E4H A;  3CCJ Q;  5FU6 C;  1K9M U;  1KJW A;  2E3H A;  2F5T X;  2VGM A;  4OB0 B;  3CXC A;  4R56 A;  4XTY A;  3LH0 A;  4E7I A;  5I22 A;  2QGF B;  2BE9 B;  4M75 C;  1RLQ C;  3I55 T;  4GY5 A;  3EGX A;  3CPW S;  1IGU A;  3Q1J A;  3CC7 A;  2HQX A;  2O9S A;  3L2Z A;  2QQS A;  4KGZ B;  4J6X A;  2FYK A;  2K5L A;  1SKU B;  4LN2 A;  4HVW A;  2DVJ A;  1PWT A;  1UHC A;  1I0C A;  3QJ6 A;  2VKN A;  4IKF A;  2DBM A;  2E5Q A;  1JJ2 A;  3CPF A;  1TSF A;  5CKB A;  1LPL A;  3HKS A;  5GMK i;  5FW9 A;  3CCL T;  4K11 A;  1S72 T;  1FXX A;  1EX4 A;  4XTX A;  4PL6 A;  2EQI A;  4F16 A;  3M58 A;  4DQ2 A;  4AFZ C;  4N0A A;  2DET A;  4M78 D;  3GP8 A;  5A0G A;  2QG9 B;  3HPW A;  5FU6 B;  2NUT B;  2VAS A;  4PJL A;  2R5M A;  5LJ3 g;  2A36 A;  1KD1 C;  1XJW B;  3EG0 A;  3JSC A;  1JU5 C;  1BIA A;  2E12 A;  4M75 B;  3BY7 A;  2HQE A;  2KT1 A;  2A3L A;  1PSE A;  2GQV A;  1C1A A;  1GL5 A;  1X2Q A;  3CD6 T;  4LDW A;  2E70 A;  5LJ3 j;  3T9N A;  2A08 A;  1QP2 A;  1OX9 A;  5DY9 A;  4ZNX A;  1TUC A;  4MDX A;  2KK4 A;  4JZ3 A;  1UEB A;  4F14 A;  3HRS A;  1PG5 B;  2NYS A;  2DNU A;  2KE9 A;  3RDV A;  4JDS A;  2E65 A;  4GLK A;  3MO8 A;  2WSC E;  1VQ4 T;  2AKL A;  3OYY A;  1T3S A;  3OBY A;  1WXT A;  3G71 T;  5DLQ E;  2D8H A;  4J9C A;  1IB8 A;  4UC4 A;  4PNO A;  2KNB B;  3PE0 A;  2ZPI B;  1QKX A;  3OYB A;  3OS1 A;  1FX7 A;  3JB9 J;  1QW1 A;  3PGG A;  4QVC A;  2DEQ A;  5LJ5 g;  4PJO C;  1RAI B;  1WX6 A;  4FIB A;  2SEM A;  1M1K U;  4L5G A;  1O9S A;  2ZPE B;  1T0H A;  3CCQ Q;  4C8Q D;  4M7A F;  3CEY A;  2HQH A;  1N8R U;  3MP1 A;  1OZ3 A;  1I5L A;  4MML A;  5LJ5 j;  2B8A A;  3P8H A;  3VUB A;  2DFU A;  1X6G A;  2CP0 A;  2CRE A;  2QGG A;  3CCS Q;  3CCU T;  1I4K 1;  3JCM b;  1VQL Q;  4WTO B;  2IG0 A;  4LXC A;  2P0P A;  4QT7 A;  4HA8 A;  1ZUU A;  3BDL A;  3M9Q A;  3OYE A;  1K8A C;  2VXE A;  1Q86 C;  2KXD A;  1BU1 A;  2F2X A;  2KXC A;  1VQO T;  3CPW P;  4E7Z A;  3V8K A;  5FU7 B;  2YSQ A;  3ZBD A;  2X35 A;  5KYW B;  2LX9 A;  1GRI A;  2O9V A;  2DM1 A;  4JJD A;  3ZL7 C;  2NUT A;  2VXF A;  1QVF S;  3G6E T;  2LQW A;  4DBH A;  1H64 1;  3E19 A;  1PD0 A;  1SHG A;  4BE2 A;  2K3B A;  1BKB A;  2ED0 A;  4JRQ A;  1ABQ A;  4PLI A;  4J7I A;  4PJO G;  2EGE A;  3QUI A;  4JS4 A;  1TXQ A;  1QCN A;  2H3J A;  2LJ0 A;  2MI6 A;  1KHC A;  3CCM Q;  2KR3 A;  2EAY A;  5HK0 A;  3VS3 A;  2HBW A;  4Z89 A;  3V8J A;  1T3L A;  2MMP A;  3EGU A;  5GAN e;  3CCV Q;  2A28 A;  4MZT A;  2V8K A;  4WCI A;  1VQP T;  2JJ9 A;  3CME Q;  2MAM A;  2O2O A;  4J9I A;  1U5S A;  1NLO C;  1BK2 A;  1M2V B;  3CCJ A;  1QVG A;  3I56 A;  1XQH A;  1KD1 U;  1Q82 R;  2LNV A;  1TWB A;  2DD5 A;  1WHG A;  1E6G A;  2RK1 A;  4KGV B;  2YLC A;  1SPK A;  1YJW T;  4M75 E;  4OB2 B;  3FJ5 A;  2JTM A;  2IVW A;  2DKG A;  2JUF A;  4F7U G;  5IT9 E;  3UF4 A;  2FPF A;  3MCA B;  4OVA A;  1W6X A;  1FMK A;  4B6M A;  4XTU A;  5FWB A;  4Q5W A;  3QYG B;  3VYG A;  4C5G A;  3QII A;  2MIO A;  1VQ9 Q;  3M0T A;  4JZ4 A;  4KUD K;  5C6S A;  1VQK Q;  4PLL A;  2DO3 A;  3L2V A;  1WXB A;  2NWM A;  5CO7 A;  4RCB A;  2DX1 A;  5GAN h;  3QG1 A;  3SHW A;  3RIR A;  3CCQ T;  2ABL A;  2JN0 A;  2JW4 A;  5KH6 A;  3RKW A;  3LGF A;  3OS5 A;  2BIV A;  2DL3 A;  1AEY A;  2GTJ A;  3NTI A;  4FYV B;  1ACM B;  2RPN A;  4F04 B;  5IAY A;  1PHT A;  3OMG A;  5KYW A;  1UE9 A;  2DXT A;  1X75 C;  3HFN A;  1VQL T;  4PJO A;  1XTD A;  1KQ2 A;  1RAC B;  3G4S A;  2CYZ B;  2HSP A;  2H8H A;  3NGP A;  2V8J A;  2RJF A;  2PUO B;  4D6W A;  4ZTJ A;  1WGS A;  1KFZ A;  1PRL C;  4XK8 E;  5M9O A;  2YWW A;  3CQT A;  4OMM A;  2CUB A;  1MND A;  2LCS A;  1V1C A;  3DLL A;  1VQ7 Q;  4BI4 A;  1K8A U;  4J9E A;  2K6D A;  4BDZ A;  3JB9 F;  1Q86 U;  3C12 A;  1QQJ A;  1I81 A;  1M90 C;  3FRN A;  5GJV B;  4E7H A;  2ZPH B;  2DYB A;  2QA4 T;  1QVF P;  3EG9 A;  2KBT A;  4XTZ A;  3S6W A;  1HK9 A;  4AT1 B;  1MNE A;  2ZCF B;  4M75 F;  4PFP A;  1NZ9 A;  3LWI A;  4F7U A;  4BI3 A;  2QDY B;  2QK0 A;  4M7A C;  2KQW A;  2FL7 A;  2J6O A;  1M1G A;  1MMG A;  5CKF A;  2D1X A;  1UG1 A;  2ZPB B;  1UGR B;  2HL5 C;  2B86 A;  1AZG B;  4ZTF A;  2PVG B;  2CP3 A;  3GBQ A;  2M1H A;  1NLP C;  2E6Z A;  3CCV T;  2FRY A;  3CCS A;  3PMT A;  2CH4 W;  1VQL A;  4Y28 E;  1D3B A;  5GAO m;  1Z9Z A;  2DBK A;  2PU9 B;  3JCM P;  3HHT B;  2ZPG B;  4EMK B;  2P84 A;  2QEX T;  2P0K A;  4BY6 C;  1PC0 A;  4OB3 B;  1WXU A;  1BI1 A;  3X28 B;  4BDY A;  1IXD A;  5FRN A;  3JCM d;  1E6H A;  2CT3 A;  3OYF A;  1MMD A;  3GNG A;  2K7A A;  1GBQ A;  3JCM g;  1D0Y A;  2LMJ A;  2XMF A;  1KK7 A;  1YIJ T;  2OX7 A;  3RBB B;  3UPU A;  2D0Q B;  4M7A B;  5KCH A;  3M4Y A;  3PVQ A;  3I55 Q;  1YI2 T;  3C95 A;  3PMI A;  3N5B B;  2VGN A;  2DLP A;  2EGA A;  2L3S A;  2JS2 A;  3VS1 A;  4RTT A;  4FM4 B;  3GF5 A;  1VQN T;  3QDR B;  5GAO p;  4J83 A;  2FG0 A;  2EWN A;  1IO6 A;  2O4X A;  3RMQ A;  3CCM A;  4M7A G;  1E7O A;  2QQR A;  4P5N A;  3SD4 A;  4M77 C;  1M1K R;  2RM4 A;  1LVK A;  2QDL A;  5J26 A;  4D8D A;  4KRT A;  3CCV A;  3CCL Q;  4BY6 B;  1S72 Q;  2CZ7 B;  1WHK A;  3CME A;  1UHF A;  2FHD A;  3IQL A;  1PSF A;  4KH1 B;  1NYG A;  3NFC A;  2XKO C;  3EAE A;  1RAA B;  2K4Y A;  3KFV A;  3OY9 A;  1M4Z A;  2K3Y A;  1WDX A;  2QQA A;  3JCM f;  3NTH A;  1VQ7 T;  3HTR A;  3CD6 Q;  3NMZ C;  2ED1 A;  4A4G A;  2XHC A;  1NJI C;  2JMC A;  4PJO D;  3P8D A;  2LJ3 A;  4LE9 A;  5GAM d;  5HKC A;  4R55 A;  1WNL A;  1VQ9 A;  5GAM g;  3RER A;  2K2M A;  1VOM A;  4M77 B;  3VKI A;  1VQK A;  1NPR A;  4BUG A;  4JRK A;  4HCC A;  1M90 U;  4BAC A;  2MPX C;  3AT1 B;  4EMH A;  4ZGJ B;  3G71 Q;  5IXF A;  4IIO A;  4DBF A;  3JCM c;  1TU0 B;  2X4J A;  3OQ5 A;  2X3X D;  3L2R A;  1YIT Q;  2P4R A;  1UTI A;  2XK0 A;  5CIU A;  3OYG A;  2H3E B;  2LZ6 B;  4FYY B;  3SWN C;  1N9R A;  1OU8 A;  3SDZ A;  3OYK A;  1B34 B;  2RB6 A;  3A8L B;  1PM3 A;  4ZGE B;  3VV0 A;  3WVD B;  3JCM X;  4JUV A;  2JS0 A;  3BE3 A;  4M7A A;  3S3N A;  2QYZ A;  3A98 A;  2LRQ A;  1IRE B;  3QXE B;  1LOJ A;  1WI7 A;  3CCE T;  4JRP A;  3P8B B;  3H0F A;  1GBR A;  2HEQ A;  4N4I A;  1Q95 G;  1KD1 R;  1I1J A;  2DIG A;  5KE3 A;  1VQ7 A;  1AT1 B;  1BCO A;  2RNA A;  4MZP A;  2RJD A;  2E10 A;  2EKH A;  3JV3 A;  5GAM f;  1M2O A;  4A4F A;  3AHU A;  3OYN A;  7AT1 B;  1Y57 A;  1VQO Q;  2EJF A;  1MV0 B;  2DRM A;  3E1S A;  1LNX A;  2KAF A;  2OJ2 A;  3SWN B;  5GAO n;  2K2V A;  3O8V A;  4ANJ A;  5IH2 A;  2RD1 A;  4CC4 B;  4M7A E;  2R5A A;  3OYC A;  2LJ1 A;  1PKT A;  2GFA A;  2GTO A;  3CBP A;  2DXB A;  3G6E Q;  3DB4 A;  2LQ8 A;  3OMC A;  3CXC S;  5LJ3 e;  4J9G A;  2JM8 A;  2K5F A;  1AVZ C;  2I2L A;  4PK4 A;  1OEB A;  4ZGD B;  2YRV A;  4TVR A;  2RF0 A;  4CC3 A;  1D0X A;  3GIB A;  3L2U A;  5L23 A;  2JVV A;  3OYJ A;  3CC4 A;  1V76 A;  2DTO A;  2D6F A;  4JJN K;  4FCY A;  2QAZ A;  3M0R A;  4EMG A;  2E5K A;  3GOX A;  4A63 B;  4X1V A;  1JJ2 S;  3M4G A;  4HT9 A;  1VQP Q;  3QKJ A;  3JB9 G;  2KSS A;  4RCC A;  1M27 C;  3NPF A;  4E7J A;  5HY6 A;  3OYA A;  1SRM A;  1D09 B;  4E7L A;  5IHN A;  2KEA A;  2DL5 A;  3MP8 A;  2F2V A;  3PNW C;  1YJW Q;  4J6Y A;  3I55 A;  1N27 A;  1PD1 A;  1K8A R;  4M75 G;  1MGQ A;  2WSE E;  5LJ5 e;  5CAI A;  4KGX B;  5LJ3 h;  1X69 A;  1NJI U;  2FB7 A;  1HYO A;  3REB B;  1GFC A;  1H3Z A;  1YP5 A;  5GMK m;  2LT4 A;  2DRK A;  3V8L A;  2SRC A;  4QQD A;  2BTT A;  1TTH B;  5FU7 C;  3CC2 Q;  2W0Z A;  1YIT T;  4M77 E;  3A1P A;  4FU6 A;  4II1 A;  1Z9Q A;  2ZZD A;  2EQU A;  1YJ9 T;  3CCL A;  4E6R A;  1S72 A;  1OZ2 A;  2Y90 A;  2ROL A;  2FRW A;  2MCN A;  2DZ9 A;  2FPD A;  5I11 A;  1ARK A;  3EFO B;  1D0Z A;  3E9F A;  3SWN A;  4MDW A;  3KUF A;  2ZGW A;  4XAX B;  2HAX A;  5LJ5 h;  1Q81 C;  3JCM V;  1ZHI A;  2CUD A;  2E41 A;  3EH2 A;  3CD6 A;  2BZ8 A;  2CZ6 B;  2X4W A;  1K76 A;  4PJJ A;  2RK2 A;  2D8J A;  3I5S A;  4F17 A;  2KT8 A;  2XD0 A;  4M7A D;  4IUU A;  4DEY A;  5FRM A;  3HSB A;  2C0T A;  3JCM J;  3EGD B;  3SB2 A;  3TEE A;  1VQ4 A;  3DKM A;  1QVP A;  3G71 A;  2RQV A;  2M02 A;  2EBP A;  1QVF A;  4KUI A;  4B9X A;  2ATC B;  2QA4 Q;  3CXC P;  2QQB A;  3EG1 A;  4Z02 A;  1YIT A;  2JZ2 A;  2A37 A;  1N6A A;  2DPP B;  4M75 A;  3KXT A;  1BIB A;  1BBZ A;  4C92 B;  3V7S A;  2QXF A;  1NPP A;  2RO0 A;  1RAD B;  1QCF A;  4GBQ A;  3M53 A;  2QTV A;  3X25 B;  3MKD A;  3JB9 H;  1AWX A;  1AWW A;  4M77 F;  2BE7 D;  4L59 A;  4BB7 A;  1JJ2 P;  3CCU A;  2RN8 A;  1D1B A;  2L0A A;  4JJB A;  1SG5 A;  4D8K A;  3L42 A;  5GMK j;  1G3T A;  2PVO B;  4ELZ C;  5FLX E;  2EGC A;  1W1F A;  1VUB A;  1O75 A;  2QEX Q;  1YN8 A;  3RKX A;  5KYY B;  1AWO A;  3TRE A;  1VQO A;  2VVK A;  1A0N B;  5D6X A;  3V7R A;  2C0O A;  1TUD A;  4LNP A;  3CMA Q;  1WLP B;  2BKD N;  2J6K A;  1YIJ Q;  2FVU A;  5GAN d;  1QVG S;  3URG A;  1M90 R;  3CC2 T;  3G6E A;  1G5V A;  1B07 A;  1YI2 Q;  4ESR A;  2X9H A;  3X20 B;  1WQ7 A;  1HJD A;  1NM7 A;  4OMO A;  4LDX A;  1VQN Q;  3MP6 A;  1BYM A;  1WA7 A;  1W2B A;  3UA7 A;  2D0N A;  9ATC B;  4AMC A;  2DXU A;  1G3Y A;  2CSQ A;  3X24 B;  4M7D F;  1YBY A;  2XID A;  3ASK A;  4DEX A;  3EGD A;  4AG1 C;  5KYX B;  2PTK A;  1RI0 A;  3FLG A;  3MEU A;  2EYZ A;  3MHX A;  1VQP A;  4LD9 K;  2PVD B;  3A8O B;  4KUL A;  1M9S A;  1M5Q 1;  3EFR A;  4LDV A;  3REA B;  1FMW A;  1Y7X A;  3PT9 A;  4J7F A;  2L5Q A;  1RLP C;  1YJW A;  1BI2 A;  3VS5 A;  1Q81 U;  2DIL A;  4M78 B;  1K9M R;  4RUG A;  4FT2 A;  1Q82 C;  3UT1 A;  2M51 A;  4EMK C;  3EG2 A;  5KYN A;  5GAN f;  2RHZ A;  1YHQ T;  2M9U A;  1MMN A;  2PNI A;  4Y92 A;  4E47 A;  3H0I A;  2D9T A;  3UA6 A;  3EFS A;  3SEM A;  3CC2 A;  2W10 A;  5GAO r;  1K1Z A;  4C8Q C;  4PJM A;  1AD5 A;  5D7U A;  3PFS A;  3A8M B;  2AK5 A;  5GAN 8;  1X2K A;  2LCC A;  1MMA A;  1TOV A;  4R0K A;  1I07 A;  1LCK A;  1M8V A;  1M2V A;  1R77 A;  4OF1 A;  1EFN A;  2KY9 A;  3VS0 A;  1K73 C;  3MJX A;  2VC8 A;  1UGS B;  1F1B B;  3CCQ A;  1YCS B;  2VWF A;  1WHH A;  4PJN A;  3JB9 D;  4C5E A;  5KYY A;  2VV5 A;  1ZLM A;  3F70 A;  3FB9 A;  6AT1 B;  3CCR T;  2O88 A;  4LD6 A;  4OMP A;  2RQW A;  4C92 E;  3VRZ A;  1VYV A;  2OAU A;  1YWO A;  1IZ6 A;  1AHJ B;  5GAN 7;  4M75 D;  3JCM e;  1VQ6 Q;  2DJQ A;  3H41 A;  2JTF A;  4NL3 A;  2LT1 A;  2K9G A;  5CQY A;  5GAN 2;  2CP7 A;  2AZS A;  3CCE Q;  2RI3 A;  3SFM A;  1BB9 A;  4C8Q B;  2JOY A;  2EQM A;  3CMA T;  3OS2 A;  2OAW A;  3FIF A;  4FSX A;  1QVG P;  2K79 A;  1KC8 C;  3QJY A;  1G2B A;  2AZV A;  4IUQ A;  2QA4 A;  1K4U S;  1UJY A;  3THK A;  1SEM A;  1Y0M A;  3A8G B;  1YFN A;  2DF6 A;  3A8H B;  5IXB A;  2VUB A;  1NJI R;  1RAF B;  1JEG A;  2JMA A;  3VS2 A;  1NEB A;  2IPO B;  2RHX A;  2MYS A;  1SHF A;  4QVZ A;  1OQK A;  2HBP A;  4ME7 A;  1WQW A;  1KQS S;  1S1N A;  4AFU C;  4CC7 A;  4HCK A;  3GPL A;  1EZZ B;  2EFI A;  3WVE B;  5CKD A;  4ATO A;  2EYY A;  3G1J A;  2HNI A;  4ELY C;  1N5Z A;  1VQM T;  5AYF A;  4N0A C;  1QWE A;  2GFU A;  3RES A;  3I9Q A;  1N8R R;  2OTJ T;  2EJ9 A;  1WHL A;  4ZN1 A;  2KRO A;  2XDP A;  1AWJ A;  2KRN A;  1G83 A;  2VYT A;  2R58 A;  4J8O A;  1M3B A;  3LW5 E;  2K3X A;  1VQ8 T;  4JPB W;  5GAM e;  3LLR A;  2QEX A;  3CBM A;  2L3R A;  1YNZ A;  2RHI A;  4C92 F;  2DIQ A;  4JLI A;  2YUP A;  2LVM A;  2DL7 A;  3CMA A;  4FYX B;  3TU4 K;  1MUZ A;  3C4S A;  2FO0 A;  4OGE A;  3VJP A;  1G8X A;  1YIJ A;  3OSV A;  2C0I A;  1OPK A;  2COZ A;  4C5H A;  1YI2 A;  1Q82 U;  1JB0 E;  1NYF A;  2A7Y A;  4M78 E;  5A0D A;  2DVE A;  3KBG A;  4RTW A;  4AFQ C;  2RQU A;  1IGQ A;  2RHU A;  4FW1 A;  4BE1 A;  1JO8 A;  3OYI A;  1VQN A;  2BZX A;  3QO3 A;  3EG3 A;  4E7K A;  3HFO A;  8ATC B;  4BD3 A;  3MEA A;  5EC7 A;  5GAM j;  4M7D C;  2K57 A;  1UGV A;  2RQT A;  2KMT A;  2EPD A;  1QP3 A;  2GQI A;  4MMK A;  1ZUY A;  3H6Z A;  4O6J A;  4EMK A;  5CVI A;  4IUT A;  4OGC A;  3OW2 S;  1R0B G;  3M0U A;  4M77 G;  1TG0 A;  4O5V A;  2QQ9 A;  2EVR A;  3CC7 T;  1GXI E;  3E9G A;  1SSH A;  3PIO A;  1K73 U;  1YJ9 Q;  3LYI A;  3MPU B;  2M0O A;  1M1F A;  2MWP A;  1VQ6 T;  4ORZ A;  1U1S A;  2DER A;  5A2Q E;  2YHT A;  2J6F A;  3C94 A;  1UFF A;  3M0Q A;  2XDB A;  2LNH B;  3PIP A;  2R57 A;  2X3W D;  4DOW A;  2OI3 A;  2KYB A;  3OYM A;  1VQ5 Q;  2YRC A;  2DTH A;  3C0C A;  3DB3 A;  3VU3 C;  4FL6 A;  4YTL A;  5AT1 B;  3JCM Q;  4PKC C;  5KYU B;  2PZ1 A;  3M5A A;  1WJQ A;  1BI3 A;  4IIM A;  2L3P A;  3CPW A;  8AT1 B;  4M7D B;  4C8Q E;  3JCM W;  1YWP A;  3INZ A;  2V1R A;  3TCJ A;  4FW2 A;  3RNJ A;  5GAN 5;  1KC8 U;  5I2M A;  4X9C A;  1KQS P;  1RAH B;  3I56 Q;  1ABO A;  1NG2 A;  2XG8 D;  1QCO A;  4M7D G;  3M54 A;  2CH4 A;  4C5I A;  2CZ1 B;  4V2S A;  2YUQ A;  1H8K A;  4M78 F;  3FJP A;  5GAN 3;  1B3Q A;  5CK9 A;  1Q7Y C;  3JB9 I;  4C0Z A;  5DM7 R; 
#chains in the Genus database with same CATH homology
 2M16 A;  1G3W A;  5M9O A;  3OYD A;  1OI1 A;  2AHJ B;  4PJO F;  3LX7 A;  2LTO A;  4QQG A;  2E64 A;  2QQB A;  4M7A E;  2LQK A;  2Y4Y A;  4L6V 5;  2RJC A;  4Z02 A;  1YIT A;  3L2Q A;  2JZ2 A;  1VQ6 A;  4RG2 A;  1N6A A;  3DLL A;  2DPP B;  4M75 A;  4BI4 A;  3KXT A;  2JNG A;  4BDZ A;  1K8A U;  1WJR A;  2QTX A;  3JB9 F;  1BIB A;  1Q86 U;  1BI0 A;  4OMF B;  3C12 A;  4M77 A;  1M90 C;  1I81 A;  3FRN A;  4C92 B;  3V7S A;  3CCE A;  4E7H A;  2ZPH B;  2QXF A;  4LDY A;  4DA4 A;  2QA4 T;  1NPP A;  2RO0 A;  3JRZ A;  2V8I A;  4XTZ A;  1R8O B;  3S6W A;  1HK9 A;  3M53 A;  4M7D G;  1X01 A;  2ZCF B;  2CS7 A;  2MWO A;  4B9W A;  4M75 F;  3X25 B;  3JB9 H;  1NZ9 A;  1RL2 A;  3FEO A;  5LJ3 d;  3ER0 A;  3UWN A;  4C0F A;  4HT8 A;  3QPH A;  3L1A A;  3UDC A;  3LWI A;  4M77 F;  4F7U A;  3LWH A;  4BI3 A;  2CGH A;  4L59 A;  4BB7 A;  4NOY A;  2QDY B;  4C92 D;  3OW2 A;  4M7A C;  2KQW A;  2FL7 A;  3OBW A;  3HRT A;  3CCU A;  3VYH B;  1M1G A;  3GNF B;  3A5Z B;  3HRU A;  5CKF A;  1SSF A;  2E1H A;  1B34 A;  2XDD A;  2ZPB B;  1UGR B;  3BW1 A;  3L42 A;  1NE8 A;  3OB9 A;  5GMK j;  1G3T A;  2PVO B;  2X4Y A;  4ELZ C;  5FLX E;  4C8Q A;  2DK3 A;  1WJS A;  2LDM A;  4F7U F;  2PVG B;  4ZTF A;  2M1H A;  3M55 A;  2E6Z A;  5GAM h;  1VQM A;  1W4S A;  4JRI A;  2DXC A;  4NL2 A;  3V7C A;  3CCV T;  1X6O A;  1VUB A;  1O75 A;  1XOV A;  2O01 E;  3RKX A;  3CCS A;  2DZC A;  3TRE A;  1VQO A;  2OTJ A;  3PMT A;  1YJN A;  1M1K C;  1VQL A;  1UB4 A;  4Y28 E;  2PUK B;  1D3B A;  4XU1 A;  5D6X A;  2XI9 A;  3X26 B;  5CCA A;  5GAO m;  1Y96 A;  3M57 A;  4DOV A;  1JBM A;  4Y91 A;  3V7R A;  3QYH B;  4M7A D;  3OA6 A;  2PU9 B;  2KDS A;  4C8Q F;  3JCM P;  1VQ8 A;  2LC4 A;  2F5K A;  3HHT B;  2BKD N;  1N8R C;  2ZPG B;  2G3R A;  4EMK B;  2Y4X A;  2FVU A;  5GAN d;  2P0K A;  2QEX T;  1QVG S;  4XK8 E;  4BY6 C;  3L2W A;  3OS0 A;  3URG A;  3QSU A;  4OB3 B;  3CC2 T;  5GAO l;  3RUX A;  3G6E A;  1G5V A;  5J3B A;  1BI1 A;  3X28 B;  4BDY A;  5FRN A;  3JCM d;  4M7D A;  3H8Z A;  2BUD A;  3X20 B;  3GNG A;  1DJ7 B;  5LJ5 d;  4A4E A;  3OYF A;  1WQ7 A;  4CRI A;  3CC4 T;  3JCM g;  2NLU A;  2YLB A;  3QZ9 B;  2CZ0 B;  4C92 C;  1YIJ T;  1ZBX A;  4LDX A;  3MP6 A;  5DLO A;  1BYM A;  3RMS A;  2EKO A;  1JRI A;  3UPU A;  1W2B A;  2D0Q B;  4M7A B;  1VQ5 T;  4JLG A;  4HKE A;  2DXU A;  2RHY A;  5KCH A;  1G3Y A;  2L8D A;  3QBY A;  4NS5 A;  3M4Y A;  1YI2 T;  3C95 A;  3LGL A;  3PMI A;  1HXD A;  4XTV A;  3X24 B;  4VUB A;  4M7D F;  3N5B B;  2VGN A;  3J7A F;  5LJ3 f;  1YBY A;  2XID A;  5I21 A;  3ASK A;  5FU6 C;  1K9M U;  4FM4 B;  2F5T X;  4HT9 A;  3GF5 A;  2VGM A;  4OB0 B;  3QDR B;  3WXM B;  1VQN T;  4QW2 A;  5GAO p;  4J83 A;  2EWN A;  2O4X A;  3CXC A;  3FLG A;  1RI0 A;  3MEU A;  3RMQ A;  4R56 A;  3MHX A;  4XTY A;  3LH0 A;  3CCM A;  4E7I A;  1VQP A;  2QQR A;  2PVD B;  3A8O B;  4LD9 K;  4M7A G;  4M75 C;  4KUL A;  3I55 T;  1M9S A;  4GY5 A;  1M5Q 1;  3EFR A;  4P5N A;  3SD4 A;  4M77 C;  3CPW S;  3Q1J A;  4LDV A;  1OYX A;  2RM4 A;  3CC7 A;  2EQJ A;  4HCZ A;  1Y7X A;  3PT9 A;  2HQX A;  3CCJ T;  5I2S A;  5J26 A;  4J7F A;  3L2Z A;  3I56 T;  2P4T A;  2QQS A;  4J6X A;  2FYK A;  2K5L A;  3CCV A;  3QZ5 B;  3OYL A;  2L5Q A;  4M7D E;  1YJW A;  4BY6 B;  1BI2 A;  1I8F A;  2CZ7 B;  2C06 A;  3J81 E;  3CME A;  1Q81 U;  2FHD A;  5GMK e;  4M78 B;  1PSF A;  4FT2 A;  4OB1 B;  1Q82 C;  3QJ6 A;  4XTW A;  4IKF A;  3NFC A;  2XKO C;  3UT1 A;  2E5Q A;  3EAE A;  1JJ2 A;  1YJ9 A;  3CPF A;  4EMK C;  4PJO B;  5CKB A;  3HKS A;  4A4H A;  4XU3 A;  5GMK i;  5GAN f;  4J5Y A;  2RHZ A;  1YHQ T;  2K4Y A;  3CCL T;  3OY9 A;  1M4Z A;  2E6N A;  2M9U A;  2KVQ G;  1FXX A;  1S72 T;  4E47 A;  2K3Y A;  2D9T A;  4XTX A;  2F69 A;  3EFS A;  4PL6 A;  3CC2 A;  5GAO r;  3M58 A;  4C8Q C;  2QQA A;  4DQ2 A;  3PFS A;  3JCM f;  4N0A A;  3A8M B;  4M78 D;  1U1T A;  5GAN 8;  1EIF A;  3GP8 A;  5A0G A;  2LCC A;  5LJ5 f;  3NTH A;  3HPW A;  1Q7Y U;  1VQ7 T;  4EDU A;  5FU6 B;  5CKH A;  1UGP B;  4A4G A;  2XHC A;  3S3M A;  2R5M A;  5LJ3 g;  3J80 E;  1NJI C;  1M8V A;  2EQK A;  4PJO D;  3P8D A;  4OF1 A;  4C92 G;  3ME9 A;  5GAM d;  2KY9 A;  4RMO A;  1K73 C;  1KD1 C;  1VQ5 A;  2OTL T;  4X34 A;  2VC8 A;  5HKC A;  1UGS B;  4R55 A;  3JSC A;  3CCQ A;  1BIA A;  1WNL A;  2E12 A;  4M75 B;  5GAM g;  3BY7 A;  1KC8 U;  1VQ9 A;  3RER A;  4N4G A;  4EPC A;  2HQE A;  4XU0 A;  2A3L A;  2WAC A;  1PSE A;  2GCX A;  2GQV A;  4M77 B;  3VKI A;  1NPR A;  4C5E A;  3JB9 D;  1VQK A;  2EJG A;  2VV5 A;  4JRK A;  4BUG A;  4HCC A;  1FWZ A;  1M90 U;  3F70 A;  3CD6 T;  4BAC A;  4LDW A;  2E70 A;  3FB9 A;  4QQ6 A;  4RG8 A;  5LJ3 j;  3CCR T;  3T9N A;  4LD6 A;  4EMH A;  3MET A;  4C92 E;  4ZGJ B;  1QP2 A;  5DY9 A;  2OAU A;  1UGQ B;  4MDX A;  2KK4 A;  3JCM c;  1UEB A;  1IZ6 A;  3HRS A;  4ZN3 A;  1AHJ B;  2X4J A;  3OQ5 A;  5GAN 7;  2P0Q A;  4M75 D;  5GMK h;  3JCM e;  3L2R A;  4F7U B;  3OSS C;  4JDS A;  5CKE A;  2DTI A;  2E65 A;  2XK0 A;  4GLK A;  5CIU A;  3G4S T;  3OYG A;  4M77 D;  2JTF A;  3MO8 A;  2WSC E;  1VQ4 T;  1VIF A;  3SWN C;  4NL3 A;  1N9R A;  2LT1 A;  3OYY A;  3SDZ A;  3MEV A;  5CQY A;  3OBY A;  5GAN 2;  1B34 B;  3OYK A;  3G71 T;  2XU8 A;  2RB6 A;  3A8L B;  4MZM A;  5DLQ E;  2DJZ A;  2RI3 A;  3SFM A;  4ZGE B;  4J6W A;  4UC4 A;  5GAN g;  3VV0 A;  3OYH A;  4C8Q B;  3G7Z A;  4M78 C;  3WVD B;  2JOY A;  4PNO A;  4CI0 C;  1KQ1 A;  4JUV A;  3JCM X;  4C0D C;  2EQM A;  2ZPI B;  1G3S A;  4M7A A;  3S3N A;  3OYB A;  3CMA T;  3OS2 A;  3OS1 A;  1FX7 A;  2GF7 A;  2LRQ A;  2LCL A;  3FIF A;  3JB9 J;  1QW1 A;  3BDU A;  3PGG A;  4QVC A;  1IRE B;  2DEQ A;  4FSX A;  5LJ5 g;  1KC8 C;  4PJO C;  4FIB A;  3QJY A;  1D3B B;  1M1K U;  4IUQ A;  1KG1 A;  3QXE B;  1LOJ A;  2QA4 A;  3CCE T;  4QVD A;  4JRP A;  4L5G A;  5GAN j;  1O9S A;  3P8B B;  5CR2 A;  2ZPE B;  4N4I A;  3A8G B;  3A8H B;  4OP0 A;  2VUB A;  2RI5 A;  3NTK A;  4C8Q D;  1Y07 A;  4M7A F;  3CEY A;  2DIG A;  5KE3 A;  2ZPF B;  3MP1 A;  1N8R U;  3ZEH A;  1OZ3 A;  1VQ7 A;  1I5L A;  4MML A;  5LJ5 j;  2B8A A;  4MZP A;  2RHX A;  2RJD A;  3P8H A;  3VUB A;  2E10 A;  5GAM f;  4QVZ A;  2HBP A;  4ME7 A;  4A4F A;  5A0L A;  1WQW A;  1KQS S;  2OTL A;  3OYN A;  3AHU A;  1YCY A;  3CCU T;  1I4K 1;  2EJF A;  3JCM b;  3GPL A;  5LL6 S;  2IG0 A;  3E1S A;  1W2B S;  2P0P A;  1KHI A;  2EFI A;  3HL8 A;  4HA8 A;  1LNX A;  3WVE B;  3BFM A;  4IUR A;  5CKD A;  4ATO A;  2KAF A;  3SWN B;  5GAO n;  3BDL A;  3M9Q A;  3OYE A;  2K2V A;  2HNI A;  4ELY C;  3O8V A;  1K8A C;  2MF2 A;  2RD1 A;  2VXE A;  5AYF A;  1VQM T;  4IUP A;  1Q86 C;  1ZQ1 A;  2R5A A;  2X4X A;  3MEW A;  2GFU A;  4N0A C;  3RES A;  5HK3 A;  3OYC A;  3CCS T;  2OTJ T;  4XQ3 A;  2QI2 A;  2EJ9 A;  2GFA A;  1VQO T;  5J39 A;  4M7D D;  2L89 A;  3CBP A;  3V8K A;  4C92 A;  2DXB A;  5FU7 B;  4ZN1 A;  1U8R A;  3DB4 A;  4C0D B;  2LQ8 A;  2XDP A;  3OMC A;  5LJ3 e;  5KCO A;  3CXC S;  3ZBD A;  2RH2 A;  2O4X B;  2VYT A;  2X35 A;  4LDU A;  2K5F A;  2R58 A;  4J8O A;  3LW5 E;  2K3X A;  2LX9 A;  1VQ8 T;  2I2L A;  3JAM E;  2PQW A;  4ZGD B;  5GAM e;  3LLR A;  1P92 A;  2QEX A;  3CBM A;  1MHN A;  2L3R A;  5GAO q;  2YRV A;  4TVR A;  2RHI A;  3VUZ A;  2VXF A;  4IUV A;  4C92 F;  1QVF S;  3G6E T;  3L2U A;  3GIB A;  2DIQ A;  4JLI A;  4M78 G;  2K5I A;  2LVM A;  1H64 1;  3E19 A;  3CBO A;  2HD0 A;  3CMA A;  2RJE A;  2JVV A;  3OYJ A;  4BE2 A;  3TU4 K;  2DTO A;  1BKB A;  4JRQ A;  4JJN K;  4BE0 A;  3CC4 A;  3C4S A;  3VJP A;  4OGE A;  5FRO A;  4PLI A;  1YIJ A;  4J7I A;  3OSV A;  4EMG A;  4PJO G;  3HP9 A;  3GOX A;  3QUI A;  4JS4 A;  2H3J A;  2MI6 A;  2EYQ A;  3M4G A;  1JJ2 S;  4C5H A;  1KHC A;  1YI2 A;  1Q82 U;  1JB0 E;  2A7Y A;  3QKJ A;  4M78 E;  5A0D A;  2DVE A;  3KBG A;  4A54 A;  2EAY A;  3JB9 G;  2KSS A;  4RCC A;  3M59 A;  5HK0 A;  4BI8 B;  2XIC A;  4E7J A;  5HY6 A;  3OYA A;  2RHU A;  5CQX A;  2D6F A;  3V8J A;  2MMP A;  1Y71 A;  3PTA A;  4E7L A;  4BE1 A;  4PJO E;  3OYI A;  1VQN A;  4JS5 A;  3MP8 A;  1XNI A;  3QO3 A;  5GAN e;  3CD6 A;  4E7K A;  3HFO A;  2EIF A;  4BD3 A;  3MEA A;  1VIE A;  3PNW C;  4MZT A;  5GAM j;  4M7D C;  1TH7 A;  2K57 A;  5D6W A;  5L8R E;  2V8K A;  2KMT A;  4J6Y A;  1QP3 A;  4MMK A;  3I55 A;  1N27 A;  3CCM T;  1VQP T;  4O6J A;  3H6Z A;  4EMK A;  4M75 G;  5CVI A;  2MAM A;  1MGQ A;  4IUT A;  4OGC A;  2WSE E;  5LJ5 e;  3OW2 S;  5CAI A;  4M77 G;  5LJ3 h;  4O5V A;  3CCJ A;  2QQ9 A;  3M56 A;  1QVG A;  1NJI U;  3I56 A;  3CC7 T;  2FB7 A;  1XQH A;  2CKK A;  4KBM B;  1GXI E;  3E9G A;  3PIO A;  1K73 U;  1KD1 U;  3FC3 A;  1H3Z A;  3QHS A;  5GMK m;  3DLM A;  2LNV A;  2LT4 A;  2DD5 A;  3LYI A;  2RK1 A;  3V8L A;  2YLC A;  4QQD A;  1YJW T;  4M75 E;  4OB2 B;  2M0O A;  5FU7 C;  3CME T;  2JTM A;  1M1F A;  2IVW A;  2MWP A;  1YIT T;  1VQ6 T;  2DKG A;  4M77 E;  2JUF A;  4RKU E;  4F7U G;  1U1S A;  5IT9 E;  3MCA B;  4FU6 A;  5A2Q E;  2YHT A;  4II1 A;  4OVA A;  3C94 A;  2ZZD A;  5GMK l;  2EQU A;  2XDB A;  3PIP A;  1YJ9 T;  4XTU A;  2R57 A;  1YHQ A;  3CCL A;  4DOW A;  1Y96 B;  1S72 A;  1K9M C;  4Q5W A;  3OYM A;  1OZ2 A;  3S3O A;  2DTH A;  3QYG B;  3VYG A;  4C5G A;  3QII A;  3DB3 A;  2Y90 A;  4C8Q G;  3VU3 C;  4F7U E;  5C0M A;  4FL6 A;  4YTL A;  5IN1 A;  4KUD K;  2DZ9 A;  5C6S A;  3JCM Q;  1KQS A;  3FDR A;  4PKC C;  2DO3 A;  4PLL A;  2RA2 A;  3L2V A;  3M5A A;  1WJQ A;  3R6O A;  4C0G A;  1BI3 A;  5CO7 A;  2DD4 A;  4RCB A;  5GAN h;  3QG1 A;  4KT0 E;  3CPW A;  5EG2 A;  4M7D B;  3E9F A;  3SWN A;  1LJO A;  4MDW A;  3KUF A;  3ZFJ A;  4C8Q E;  3RIR A;  3CCQ T;  2ZGW A;  1WPY A;  4XAX B;  1VQ9 T;  3JCM W;  3JCM h;  5D6Y A;  3INZ A;  2HAX A;  2DAQ A;  4A53 A;  5LJ5 h;  1Q81 C;  3TCJ A;  3JCM V;  1VQK T;  1ZHI A;  2E41 A;  1V29 B;  2JN0 A;  5I2M A;  3LGF A;  2CZ6 B;  3RKW A;  5KH6 A;  5GAN 5;  2X4W A;  3OS5 A;  3CCR A;  2BIV A;  4M78 A;  4X9C A;  4X9D A;  2RK2 A;  5GAN 6;  3NTI A;  1N9S A;  4A4K A;  4HCB A;  2XG8 D;  5IAY A;  3OMG A;  5GAN 4;  2XD0 A;  2DXT A;  3HFN A;  1X75 C;  3M54 A;  4IUU A;  4WF2 A;  4XU2 A;  1YJN T;  1XTD A;  4FT4 A;  1VQL T;  5FRM A;  3HSB A;  4PJO A;  1KQ2 A;  4C5I A;  4N4H A;  3G4S A;  2CZ1 B;  3JCM J;  3SB2 A;  4V2S A;  2CYZ B;  3TEE A;  2RI2 A;  1VQ4 A;  3DKM A;  2V8J A;  4M78 F;  2RJF A;  3FJP A;  2PUO B;  1QVP A;  2WSF E;  4D6W A;  5CK9 A;  5GAN 3;  3G71 A;  4ZTJ A;  1Q7Y C;  1WGS A;  3RKY A;  1QVF A;  3JB9 I;  4KUI A;  5KE2 A;  4B9X A;  4C0Z A;  5DM7 R;  3GLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...