4M7AA

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
TLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 13
structure length 64
sequence length 64
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aA00
5LJ3e 4F7UB 1WQWA 2HNIA 4XU2A 4XTYA 3RUXA 2E1HA 1I4K1 2DVEA 4C92B 5GANe 2DKGA 4PJOB 2DTOA 2FYKA 2VC8A 4C8QF 4RCCA 4EMHA 1KQ2A 2YHTA 5GAN7 2RD1A 3JCMc 3JB9I 3JB9F 5GAOn 4XU1A 1U1SA 5GAMj 3JCMX 1X01A 4X9DA 4OP0A 5GMKl 3HSBA 1I8FA 3SB2A 5LJ5h 4QVDA 3HFNA 1TH7A 4J5YA 4M78F 4M78C 1KQ1A 3RKWA 4M77E 3FJPA 4C92G 4F7UE 3SWNC 4C92E 4M78A 5GAOl 4PJOE 3JB9J 3V7SA 4XU0A 4C8QG 4NOYA 3SWNA 3BFMA 4XTUA 4XQ3A 3V7CA 4EMKC 3JCMV 4A53A 5GAMf 1HXDA 2DZ9A 3M4GA 3RESA 1N9SA 5GMKj 5LJ3j 2QTXA 5GAOm 3JB9D 3RKXA 5GAMd 4EMKA 2DXUA 4N0AC 5LJ5e 2JN0A 4M75F 5GANj 2CGHA 2RM4A 4M75C 4A54A 2RB6A 3FB9A 4NL2A 4C8QB 1JBMA 4HT8A 1WNLA 4N0AA 3JCMW 4JLIA 2YLBA 1B34B 3INZA 4M78D 4M75A 5GMKi 3EFRA 3RIRA 5GAMg 4EMGA 4JRKA 3V8JA 1N9RA 1WQ7A 3QUIA 2E65A 5GMKe 4M78B 4M7DC 2DTHA 3JCMf 3VU3C 3BY7A 2EJGA 4J6XA 5CAIA 5GMKm 5LJ3f 5GAOp 3JCMd 1LJOA 4JUVA 1HK9A 4XTVA 4XTZA 5LJ3d 5GANf 4M7DA 4M7AC 5GAOq 3JCMP 4PJOC 4C8QE 5GANd 1M5Q1 3BW1A 4M75D 3L1AA 4EMKB 4F7UA 4NL3A 3JB9G 4J6YA 3JCMg 4M7AA 4MMKA 4J6WA 2DZCA 5GAN3 2DXTA 5LJ3g 4PJOA 3JCMh 2E41A 2EJFA 5GMKh 5GANg 2EAYA 4M75B 4HT9A 5LJ5j 4M78G 3QSUA 4M78E 3FIFA 5GAN2 3BDUA 4M7DD 1BIBA 4X9CA 3JCMJ 2EWNA 3EFSA 3JCMQ 2EJ9A 1D3BA 5GAMh 4M77D 4DQ2A 2K57A 4M7DF 4M7AD 2E64A 2RA2A 4M7DB 4PJOD 5DY9A 1LNXA 2ZGWA 3QO3A 4JRIA 4M77F 1LOJA 5GAN5 2E10A 1Y96A 2DJZA 4M77C 4WF2A 3RKYA 3SWNB 4Y91A 4F7UF 4C92F 4M75G 3V8LA 4M7AF 2Y90A 4PJOF 4M7AB 4M75E 4C92C 5LJ5f 1H641 1YCYA 4M77A 3JCMb 1I5LA 3JB9H 2YLCA 4RCBA 5GAN6 1JRIA 5LJ5d 3GIBA 5GAOr 4C8QC 4C92A 5GAMe 4PNOA 5GAN8 4XU3A 3V8KA 1MGQA 4QVCA 1M8VA 2VXFA 5LJ3h 4C8QA 5LJ5g 3V7RA 5I21A 1U1TA 4MMLA 2VXEA 5GANh 3RERA 4M7DG 1D3BB 4M7DE 1B34A 2I2LA 4M77G 1BIAA 3PGGA 4XTXA 1I81A 2DTIA 3QHSA 4F7UG 4M7AG 4PJOG 4V2SA 4M7AE 4XTWA 1Y96B 4C92D 3HFOA 3AHUA 4HA8A 5GAN4 2DEQA 3L2ZA 3JCMe 4M77B 1WPYA 4C8QD 2FB7A
chains in the Genus database with same CATH superfamily
1VQKT 3GP8A 1TSFA 2ZPGB 4CC7A 2XI9A 2X4XA 3OW2S 3L2UA 3UDCA 1VQLA 1YFNA 1WHKA 3MEWA 4OMFB 4KUDK 2E5QA 2GF7A 4KULA 1SHFA 4C92G 2XG8D 4R0KA 2NUPA 1EFNA 3LX7A 1WJQA 1SG5A 3TU4K 1V1CA 2IIMA 3OS5A 3DKMA 3L42A 2EGCA 2YRVA 2KRMA 2F2XA 2P0PA 2FRWA 5I2MA 3V8JA 2DILA 1H92A 2DX1A 1DJ7B 1N5ZA 3QG1A 4M78B 1WHMA 2GFAA 2DTHA 1UGRB 4J6XA 5D6WA 2CZ0B 4JUVA 1K8AC 3X20B 3MP8A 4PJOC 5GANd 4RTWA 1TUDA 3LGFA 1OU8A 1OZ2A 3QWXX 1G3WA 4C0GA 3PNWC 5A0GA 4DBRA 4JJBA 1V76A 1E6GA 3QJYA 4OB2B 5D7UA 3CCUT 1QLYA 2MCNA 2K57A 4M7AD 4JRIA 2LDMA 1MMGA 3UPUA 3CCLQ 1KD1C 4RTUA 4RTVA 2LZ6B 4C0DB 1YP5A 4C5EA 2VXFA 4RTXA 4OMQA 3QIIA 1UFFA 1RAFB 2I2LA 4JJNK 4XTXA 5FU6B 3QHSA 2EPDA 3CXCA 1VQMA 4BD3A 4A4HA 1TS9A 1GL5A 2FVUA 3ME9A 4XU2A 4XTYA 3EAEA 2ENMA 3CMAA 4RCCA 2JXBA 3S6WA 6AT1B 3NPFA 1WYXA 2QQ9A 3EG1A 4X9DA 1OPKA 2KSSA 1YJWT 4Z88A 1H3ZA 2RQVA 3CC2A 2RJDA 1NPPA 3G71A 1VQ9Q 2JM8A 3QPHA 2DFUA 1O9SA 4F04B 2AIRB 4PJOE 1WA7A 1G3SA 2JJ9A 1KIKA 1YJNA 1WFWA 3M4GA 5LJ3j 2KYMA 1OX9A 1Y71A 3GNFB 3THKA 1H3HA 3CMET 1JO8A 3QUIA 4QQ6A 2QI2A 2E70A 2LQKA 2RQUA 4ZN1A 2O4XA 2BE9B 5LJ3f 1HK9A 1X69A 4E47A 1NJIU 4HCBA 3TQ7P 1QCNA 5FWCA 4BDZA 2DXTA 2CT3A 2J6FA 3KFVA 3NTKA 2EWNA 3EFSA 1W4SA 4BB7A 1MNEA 2KT1A 4PJOD 2X4YA 4O6JA 2WSEE 2ZGWA 2E12A 1ZX6A 1N6AA 4F7UF 1ZA2B 3E9GA 4M7AB 4M75E 4E7HA 5IHNA 2BE7D 2YLCA 3EH1A 3CCQA 1W2BS 4C92A 4X34A 2K3BA 3TREA 5LJ5g 1SPKA 2VXEA 3OSVA 4M7DG 1SEMA 5CKEA 1Q86C 3CD6T 3FDRA 1FXXA 5IXFA 2CS7A 1UDLA 4JJDA 1JB0E 4J9FA 3MP1A 1VQ7Q 1VQKA 2GCXA 2JZ2A 2RJFA 2DEQA 4J9GA 3L2ZA 5GAOq 1NPRA 1ZBXA 1RAIB 3NTIA 2CP3A 1Z9QA 2E1HA 5CIUA 4HXJA 3PTAA 2BIVA 2EGEA 2JW4A 4CC3A 1NJIR 1M90C 1PSEA 3PMTA 3JB9I 2ECZA 3JCMX 4QVZA 4AFSC 3C0CA 1NJIC 1W6XA 1TH7A 4AMCA 2AKKA 2HQEA 3RKWA 1HYOA 3FJPA 2FHDA 3CCEQ 3OW2P 2LNVA 3V7SA 4D8DA 2DF6A 2HDAA 2EQJA 4A53A 5HK3A 2FZGB 2LTOA 2DBKA 3I56Q 4K11A 5GAMd 1UGQB 1BI0A 1NEBA 2QA4Q 2GBQA 1YJ9Q 1IREB 5FLXE 3JCMW 2F2WA 5KYUA 3I35A 2RQTA 3GBQA 2HSEB 3URGA 5DLQE 4BY6C 3JCMd 4LNPA 2RQWA 5CCAA 4DOWA 2IG0A 2O9VA 1QWEA 3QXEB 3NHNA 1JEGA 1PD1A 3CCUA 1VQNQ 4FU6A 2YT6A 4M78G 1VOMA 1FX7A 5GAN2 1X43A 2QEXQ 1M1KC 2H3JA 3MPUB 2RHXA 2F5KA 5FRMA 1PNJA 1JQQA 1PRLC 2I0NA 2IVWA 2MWOA 5DY9A 2JTFA 2LCLA 2ED1A 1YN8A 4MDXA 3J81E 4KUIA 3CCLT 2KT8A 1MMDA 3ULRB 1NG2A 1NEGA 1VIFA 3VYGA 4ZTJA 1MV0B 2QQBA 1TTHB 2CYZB 1PCXA 2X35A 4M77G 1BIAA 1WHLA 1GFDA 5KE3A 5CR2A 2X3XD 2DL5A 1RAAB 1YJWA 3WXMB 3C4SA 4E7ZA 4FSXA 4GY5A 3EFOA 1AWXA 1G3YA 2PZ1A 2XMFA 3EHRA 3UA6A 4BI3A 4CC4B 1Q82C 1OULA 2CZ1B 2H3EB 4C8QG 3SWNA 3BFMA 4XQ3A 2LT1A 4E7IA 5GMKj 5HKCA 2JN0A 3CMEA 5GANj 2QXFA 4BE1A 2DE0X 3R6OA 5J39A 1Y57A 5GMKi 1RABB 2E4HA 1ZLMA 2LC4A 2E65A 1M2VB 2H8HA 2JTEA 2GQVA 1IXDA 3BY7A 4JPBW 5GAOp 1VQOQ 2KGTA 3UT1A 4M7DA 5GANf 1C1AA 2DIQA 2AKLA 1U3OA 2EGAA 1HSQA 1KQSP 4EPCA 4Z8AA 3TCJA 1K9MU 2LQWA 2SEMA 2HBPA 5AT1B 3VRYA 3S3NA 1I5OB 3OYHA 2M0OA 3JCMQ 1UJYA 1D3BA 3OYAA 2BUDA 2Y4YA 2QG9B 3C94A 3EGXA 4M77C 4QQDA 1KHCA 1ABQA 4F17A 3JSCA 1H641 1AD5A 2IPOB 3JCMb 2JOYA 3CD6A 1MMNA 2NUTB 1M8VA 4QKUA 5KYUB 2JT4A 5CQXA 3RERA 1QVFA 1UJ0A 1QVGA 2A3LA 4M7AG 4V2SA 3SHWA 4ATOA 1VYUA 5KYXB 4HA8A 2CSQA 1TUCA 4XAXB 2XICA 5KCOA 4F16A 1I4K1 4ZNXA 2DKGA 2OTLQ 5CQYA 5GAN7 1M3BA 3J7AF 1W1FA 2JMCA 4PFZA 1TXQA 1N8RU 1K9MR 5LL6S 2X51A 2QK0A 3CQTA 1KQ1A 4F7UE 5C0MA 4HCZA 4M78A 3CCET 3NFCA 3IQLA 2P0KA 3OW2A 2F2VA 2YSQA 2QTXA 3I56T 4IUVA 3OMGA 3LWHA 4E7SA 2QA4T 4EIKA 3RDVA 1YJ9T 1Q81C 4JLIA 3EFRA 4E2FB 2MAMA 2L3RA 2VVKA 2AK5A 5C6SA 4QW2A 2A36A 1WXUA 3L2QA 5CKHA 1IHVA 3E19A 1AZGB 1RAGB 3SDZA 3L1AA 2YUOA 4L59A 2EYQA 1ZSZA 1BYMA 1VQNT 1QCOA 1UE9A 3EFOB 4FYXB 3CCVQ 3QKJA 2QEXT 2ED0A 3BDUA 4KGXB 2X4JA 1N8RR 3CCLA 1ACMB 2RA2A 4LDWA 3DB4A 1LOJA 2CDTA 4BY6B 4OMLA 3MEVA 1IRXA 3SWNB 2XKOC 4C92F 3OYLA 4BE0A 1RI9A 3G4SQ 1D1AA 4GBQA 2K5FA 3M0QA 1XOVA 3WVDB 4JS4A 3P8BB 1D0XA 1W70A 4C8QA 1AVZC 1BCOA 2K3XA 5DM7R 4MDWA 2PQWA 3VS2A 2C06A 4PJOG 3M58A 2YDLA 1B3QA 2D1XA 4DA4A 1SF9A 2OJ2A 3LYIA 1C0MA 4J9CA 1D1CA 1ABOA 5EC7A 1VQ6Q 2PNIA 2F1LA 5CVIA 2CUDA 2LX9A 1WJSA 2Y4XA 1X75C 2JVVA 1YIJQ 2HMAA 5IHKA 5GAMj 4RG8A 2QGGA 3UWNA 3L2VA 1I8FA 2V1QA 1SRMA 2MK5A 3EGXB 2RHYA 2YWWA 3UATA 1R0CB 3S3MA 4EMKC 4BI4A 5GAMf 1NYFA 3CCRQ 3JB9D 1WGSA 3GLXA 2O88A 4AFQC 3H0IA 4J83A 1QQJA 3AHUA 4ZN3A 1UG1A 1X6OA 3L2WA 4E7LA 3JCMf 1VQOT 4J9IA 2GTJA 2R5AA 3UA7A 3JCMP 4PFPA 4LDVA 1R8OB 4M7AA 1QP3A 4J6WA 5LJ3g 3I55Q 2HBWA 3OYKA 4RUGA 4O5VA 2HCKA 2OTJT 2QDYB 5GAN5 1GBQA 2ZAEA 4J9BA 2COWA 4FT4A 2Y90A 1FMVA 1K73U 3TSZA 3LGLA 2P4RA 4J7IA 5GJWB 4JRQA 4AG1C 2EYWA 3M4YA 1B34A 2VKNA 5GJVB 4A4GA 2QQAA 2QGFB 1KJWA 1YNZA 1VQPT 1WXTA 4LD6A 8AT1B 1RUWA 1W2BA 4M77B 2CUBA 1ZSZB 2DRMA 2KAFA 1M1GA 2RHZA 2WSCE 1JJ2P 2OTLT 2DVJA 4IIMA 4XU1A 9ATCB 2C0TA 3REAB 3CCEA 2OAUA 1GRIA 5LJ5h 4QVDA 1VQ5Q 2DETA 1X2QA 3NMZC 3KXTA 3I56A 4PKCC 1M9SA 2EYXA 2LCCA 4DEYA 1YJ9A 4KGZB 1HXDA 1WX6A 4ZGJB 4M75C 2KY9A 3OYNA 3FB9A 4C8QB 1K73R 3ER0A 3GOXA 4JRPA 1N9RA 1K73C 1IO6A 1K4US 3EG3A 3RMQA 5GMKm 4BE2A 2LP5A 4XTZA 1VQNA 2C0IA 3TSWA 2M0YA 3PVLA 3JAME 2QEXA 3QDFA 4PJOA 1TG0A 4D8KA 5IAYA 5GMKh 2EAYA 1RLPC 2L89A 4OB3B 1XQHA 4R55A 1PRMC 2DLPA 2KROA 1KQSS 1QMCA 1Y0MA 3U23A 3ZFJA 1YHQT 4E7KA 2QDLA 1K0SA 1GFCA 1QKXA 3RKYA 2KMTA 3X26B 3G4ST 4A4EA 5GAOr 3CCMT 3A8LB 2ESWA 3M0PA 3F70A 1NM7A 4HVUA 1CKAA 3CBPA 1I81A 2NUZA 5A0DA 2ZCFB 1VQLQ 4ANJA 2DD5A 2LJ1A 4Z89A 4HVWA 4FW1A 2MF2A 4PJJA 1VQ6T 1VYVA 3RUXA 3CC7Q 4EMHA 4OB1B 4DBHA 4C0ZA 1WDXA 1YIJT 2D9TA 3CCSQ 4JLGA 4FYVB 1KFZA 4M78F 4J5YA 1Y07A 1GCQC 4PJNA 1ZA1B 1M2VA 4C92E 4R56A 2B86A 1NLPC 3CPWP 1RAEB 3JCMV 2JS0A 3H9NA 1N9SA 3CCRT 1YI2Q 1IB8A 2CGHA 2D8JA 1VQ4Q 2L5QA 2DXBA 4FSSA 1B7TA 3C95A 1B34B 1VQOA 3A5ZB 1S72Q 1VUBA 4ZTFA 2A28A 2HZYA 1MUZA 2DL7A 2R57A 1G8XA 4MZTA 1M3AA 2QTVA 1K1ZA 2OI3A 2RJEA 2R5MA 1M5Q1 4M75D 4EMKB 4A4KA 1K76A 3I5RA 2ZPFB 1XNIA 3EGUA 2VV5A 2EJFA 4GLKA 5GANg 2OTJA 2G3RA 3I55T 2COZA 5CKDA 5CKBA 1BI3A 1ZSGA 2NUTA 3VS1A 4JZ4A 5KCHA 4NS5A 3LH5A 2L0AA 2E10A 2O01E 5KYXA 5GAN6 3OBWA 1H8KA 4LDYA 2VB6A 4MZMA 1OV3A 1MNDA 1VQPA 2X4WA 3PIOA 4M4ZA 4J9DA 2VYTA 4VUBA 4F7UG 2MPXC 4OVAA 1IGUA 2OTLA 4L6V5 3CC2Q 2FB7A 4J9HA 3G71Q 3G7ZA 4IIOA 4PJOB 4FCYA 2XDPA 2EKHA 1PKSA 2XHCA 3QYHB 1QWFA 1VQ5T 3A1PA 1RI0A 1K0XA 1MMAA 4IUQA 4N4IA 3JV3A 1X27A 4XU0A 1WJRA 3OSSC 2J6OA 3L2RA 3M53A 3HRTA 4N0AC 5LJ5e 2BKDN 4NL2A 1KG1A 4HT8A 1N27A 1OPLA 5HK0A 2DA9A 1VQ9T 1BK2A 2L3SA 3OBYA 2PU9B 2XD0A 2E3HA 2HKQB 3JB9G 2DRKA 5J26A 4JJCA 2K2VA 3JCMh 2RPNA 4M75B 1YHQA 1EZZB 1ARKA 3TVTA 2K6DA 2K4YA 3QSUA 4BUGA 3CCQQ 1U8RA 1NE8A 1WIEA 2EQIA 7AT1B 2K9GA 2DJQA 3PE0A 3EH2A 3OYIA 2FEIA 3G4SA 3VS7A 3I5SA 4HCCA 4IKFA 3TEEA 2JNGA 2GNCA 3CCMA 4Y91A 3HL8A 3C12A 1JRIA 1F1BB 4LUEA 3LH0A 3OB9A 2V8JA 4XU3A 5HCKA 1PC0A 4Q5WA 1HD3A 2ZZDA 1Y7XA 2KRNA 4M7DE 1IHWA 2XDDA 1VQ6A 1VQ8Q 3A98A 2OAWA 1D0YA 1UECA 1E6HA 3OYEA 3VS6A 1YIJA 1WHGA 3CC7T 1AWOA 2VC8A 2EYZA 3NTHA 3H0HA 1UGSB 4PK4A 1OYXA 2KI7A 4J9EA 1XJWB 2HKNA 2WACA 4A4FA 2AT1B 2NYSA 4IUTA 1BKBA 1UHFA 3CCST 4IUUA 4AT1B 1UB4A 2M16A 4B9XA 1JJ2S 1UGVA 3CCRA 3VS5A 1VQ7T 5GAOl 2DYIA 4EDUA 3CC4Q 3LW5E 2VGNA 4NOYA 3OMCA 5FW9A 1YI2T 3P8DA 2DBMA 1VQ4T 5FROA 1JBMA 5GAMg 1S72T 3M59A 2FG0A 4OMNA 5L8RE 2O31A 2QYZA 3MO8A 4FYWB 1K9MC 5IT9E 2RJCA 2CP6A 1WZOA 2O2OA 3I55A 1YWPA 4F7UA 5IXBA 3JCMg 2WSFE 1LPLA 2RQRA 4M78E 3CXCP 5FU7C 1KC8U 3JCMJ 2W0ZA 4KRTA 4LDUA 3ZEHA 4CC2A 3MJXA 1CSKA 4WF2A 2NLUA 3A8GB 2CH4A 3MCAB 4M77A 5L23A 3HPWA 2RF0A 2CH4W 2KEAA 5GAN8 3CCJQ 2F5TX 2HD0A 5LJ3h 3HKSA 5FRNA 2EVRA 3CEYA 1OU9A 1BBZA 1PG5B 2CP2A 3G6EQ 2D0QB 1WPYA 2A0FB 2EBPA 1N8RC 5J3BA 1SRLA 2DVEA 2M02A 3OY9A 2YHTA 1QVPA 1VQ5A 2RD1A 1U1SA 1LCKA 3SB2A 3HFNA 1RAHB 2K7AA 3E2UA 3M54A 2LX7A 3QJ6A 3QZ9B 1KC8R 2J05A 1UEBA 2PVGB 3SD4A 2PUKB 2JTMA 2EKOA 3V7CA 2KRSA 1KC8C 2ZPEB 1B07A 1YITQ 4JZ3A 4FW2A 3MKDA 1WNLA 2XDBA 3QZ5B 3META 2YLBA 1IGQA 1VQ9A 3CPWS 2DK3A 4JDSA 1C6VX 5EG2A 3OQ5A 4PFOA 4E6RA 3OYYA 5I11A 2EJGA 1BI2A 2Z0WA 4XTVA 2HSPA 5KYYB 3SFMA 2RI5A 2KNBB 4WCIA 3D7SB 4MMKA 1M1FA 2YRCA 3M55A 2QQRA 2RNAA 2EIFA 1K8AU 1AEYA 1G5VA 1JU5C 3PMIA 3OYJA 1NZ9A 4X9CA 2EJ9A 2L2PA 2K79A 3H8ZA 2XU8A 3QBYA 1M30A 4DOVA 4M75G 3V8LA 4LUDA 3VS4A 4BDYA 4ZGEB 5LJ5d 3VUZA 1I1JA 1P92A 1KQSA 4DEXA 3LLRA 3MHXA 1KD1U 5DLOA 5HY6A 3HP9A 3JRZA 3I9QA 2GFUA 2B8AA 4C5HA 3OA6A 2DTIA 3RNJA 2K5LA 3OYCA 1VQ8T 4M7AE 3CC7A 4AFUC 1Y96B 1WHJA 5GAN4 2RH2A 1KK7A 2YUNA 1U5SA 3H0FA 4F7UB 1WQWA 1KHIA 4LN2A 3CCSA 2DL3A 2DERA 1KQ2A 3GPLA 3ZBDA 3CPFA 2M51A 1VQ7A 2FO0A 3FJ5A 4FYYB 1K8AR 3MP6A 3DB3A 4Y28E 2L3QA 3ASKA 4ELYC 5KH6A 1YI2A 3WVEB 3CC4T 1VQ4A 1EIFA 2EFIA 3QYGB 1M8MA 5GAOm 1S72A 4EMKA 2DXUA 4HCKA 5A2QE 3INZA 5IN1A 1AZEA 1KD1R 2K2MA 3HRUA 2NWMA 4ZGDB 2MWPA 5D6YA 1ZBJA 1LJOA 3EGDB 2QA4A 2VGMA 4J6YA 3OYGA 5GAN3 1G3TA 1IZ6A 4IUPA 1R77A 2E5KA 2L3PA 1BIBA 2RHUA 1BU1A 4AG2C 2RI2A 1G2BA 2ROTA 4M7DF 2A37A 1UHCA 2E64A 4L5GA 3QO3A 3PVQA 3EHQA 1BCMA 4C92C 4KH0B 1YCYA 1WHHA 1K9AA 3G1JA 4PNOA 3CCJT 4MZPA 1XTDA 5D6XA 3VS0A 3EG9B 5GANh 3CCVT 2HL5C 5FU7B 2VUBA 4D6WA 2J7IA 3M0RA 3M0SA 2SRCA 1ZUYA 2X9HA 4HVVA 3HFOA 3VV0A 3G6ET 1Q86U 3MEUA 3HHTB 3GF5A 3Q1JA 2ABLA 4Z02A 4DBQA 5I21A 5LJ3e 2AHJB 2VWFA 1I0CA 5CO7A 2RMOA 4LDXA 3JCMc 3N5BB 5GAOn 3PT9A 1SKUB 1GBRA 2BZ8A 2DAQA 2KVQG 4XK8E 3AT1B 5ECAA 1M90U 2FZKB 2MIOA 4PJLA 2XK0A 2X3WD 2ROLA 3JB9J 4OGCA 1CKBA 3MEAA 1BB9A 1PHTA 1D0ZA 1X6BA 4PJMA 1OI1A 5KYNA 2XIDA 1YITT 2C0OA 2RB6A 3NGPA 2KBTA 3KUFA 4M75A 1LVKA 3BE3A 1FYNA 5FWBA 4JS5A 2V8IA 1Q95G 2DD4A 2NUPB 2AZVA 1KSWA 1WXBA 2HEQA 2ZPBB 4KT0E 3ZL7C 2EQMA 3M0UA 2DYBA 2G6FX 2JUFA 2J06A 1D09B 1Q86R 1QVFP 1QVGP 2E41A 1E7OA 5IHIA 3FIFA 3FRNA 4TVRA 1SHGA 2K5IA 3M9QA 3VUBA 4DQ2A 2YXYA 3DLLA 2YUPA 1M1KU 1RACB 4M77F 1M90R 3R6NA 1QCFA 3CXCS 2DL4A 1OEBA 1I5LA 2DMOA 2RK1A 2CP0A 3M56A 1AT1B 1QKWA 4LD9K 4BI8B 1FWZA 2JM9A 1MGQA 1VQ8A 4RG2A 1U1TA 4MMLA 1PSFA 3REBB 3FLGA 3M5AA 2QQSA 1MV3A 4OMMA 4C92D 8ATCB 4RTZA 2W10A 1M3CA 2PTKA 4N4HA 4Y92A 3PGGA 5I22A 5IH2A 1VQMQ 2BTTA 2MMPA 3EG2A 4C8QF 1T3SA 2CREA 1G83A 4PL6A 3X28B 3JB9F 4J8OA 2GGRA 3CMAQ 1O75A 1T0JA 3CC4A 3O5ZA 4UC4A 1PWTA 2LJ3A 2PUOB 1WI7A 3SWNC 2OX7A 1GCQA 5KYWA 2D0NA 1M1KR 3RESA 1Q82U 3RKXA 4A54A 4KGVB 1YJNQ 1Q7YU 4HKEA 1JJ2A 2BZYA 2RK2A 2KQWA 1WQ7A 4LE9A 4J7FA 3E1SA 3E9FA 4M7DC 2KE9A 2D6FA 3OS2A 3BW1A 2FPDA 4C5IA 1PD0A 1X6GA 1TU0B 4NL3A 2KR3A 1VIEA 1S1NA 5KE2A 2KXCA 2DEUA 1FMWA 5LJ5j 2COYA 3OS1A 2DPPB 3M57A 2M9UA 5GAMh 2O4XB 2CKKA 2LNHB 2P84A 4FL6A 3RR6A 1LNXA 5I2SA 3CCJA 4M7AF 3VS3A 3PFSA 2F69A 5LJ5f 2L8DA 2MYSA 3CCVA 2QASA 1Q82R 2CSIA 3HTRA 2KK4A 3G6EA 4P5NA 2DXCA 1Q7YR 1MHNA 5GMKe 2EYYA 1UUEA 2HNIA 1Q7YC 2CZ6B 4C92B 5GANe 2E6NA 3OS0A 2DTOA 2K3YA 1VQKQ 2M1HA 4PLLA 4N4GA 1YWOA 2HQXA 2LRQA 2PVDB 1V29B 1X01A 3A8MB 4OB0B 3HSBA 3O8VA 1Z9ZA 4A63B 2EQUA 1GCPA 4M78C 3S3OA 1NLOC 4FIBA 1VQLT 4C0FA 1QW1A 1T0HA 4RMOA 3RMSA 1YITA 2CP5A 1SSFA 3CBOA 5A0LA 1QP2A 2VASA 3P8HA 4XTUA 2GTOA 5KYYA 1EX4A 2DZ9A 4OMOA 2ZPHB 2DO3A 4C5GA 2DIGA 2RM4A 1ZHIA 2FPEA 4N0AA 3VRZA 1U06A 4EMGA 2LVMA 3QDRB 2OTJQ 2RHIA 2J6KA 5M9OA 1Q81U 3CBMA 3VU3C 4WTOB 1R0BG 2ATCB 4OGEA 1NYGA 1YCSB 1ZSZC 5LJ3d 2LJ0A 4C0DC 2DZCA 3CPWA 4YTLA 3X24B 2HL3A 3X25B 1PM3A 2KYBA 3KBGA 3OYFA 4M7DD 1GXIE 3CCUQ 5FU6C 1W2BP 3VKIA 4ELZC 1VQPQ 4AFZC 2KXDA 4ESRA 4RKUE 2CP7A 1Y96A 2DJZA 5KYWB 3UF4A 5CKFA 4KH1B 3LWIA 2PVOB 4PJOF 4E7JA 5CK9A 3FEOA 4II1A 4RCBA 1D1BA 3GIBA 1TWBA 2O9SA 1M4ZA 3BDLA 4C8QC 4F14A 4FT2A 1TOVA 4QVCA 2FL7A 1OQKA 3RBBB 2R58A 2HAXA 2RN8A 1T3LA 1ZQ1A 4OMPA 4CI0C 2V8KA 1J3TA 2FRYA 4RTYA 1Q81R 2EW3A 3SEMA 4KBMB 1VQMT 2FYKA 4FM4B 3VJPA 1TUGB 2A08A 3H6ZA 2YRDA 1OZ3A 3VYHB 3J80E 4OP0A 5GMKl 3CMAT 1JXMA 1YJWQ 1M27C 1OX8A 2V1RA 3DLMA 4M77E 2LQ8A 1UGPB 1SSHA 2KDSA 2JS2A 1FMKA 3H41A 3QWYA 1UTIA 2CZ7B 4DBFA 3CC2T 5AYFA 3EGDA 3G71T 2HQHA 2JMAA 2V26A 2QAZA 4BACA 1VA7A 4M75F 1JXOA 3HRSA 4IURA 1WLPB 2LT4A 1YJNT 4M78D 3RIRA 4B9WA 2ZPIB 1AWWA 2E6ZA 4JRKA 4PLIA 3OYMA 3CMEQ 1VYTA 1YHQQ 3M0TA 2BZXA 2YUQA 2RI3A 4M7AC 2FZCB 2LQNA 4C8QE 2MI6A 4RTTA 3CCMQ 1X2KA 3PIPA 4QQGA 2RO0A 4HT9A 2FPFA 4QT7A 4X1VA 1ZUUA 3EG9A 1PKTA 2CT4A 4ME7A 3A8HB 4M77D 1RL2A 4GLMA 1RADB 1QVFS 2P0QA 1AOJA 1AWJA 1QVGS 4M7DB 1RLQC 1ZUKA 1YBYA 1OOTA 2EQKA 1AHJB 4OF1A 3JB9H 4B6MA 4CRIA 1NBEB 2A7YA 2D8HA 1HJDA 3OYBA 4ORZA 2P4TA 5GAMe 2GQIA 3GNGA 3V8KA 3V7RA 2LCSA 2E3IA 2DM1A 1D3BB 3CCQT 3T9NA 2LMJA 3CD6Q 2MOXA 4LXCA 3A8OB 2AZSA 4XTWA 3FC3A 1M2OA 1I07A 2DL8A 3OYDA 1A0NB 3JCMe 3EG0A 5CAIA 1BI1A 2DNUA 4C8QD
chains in the Genus database with same CATH topology
5LJ3e 2AHJB 3G7ZA 1I4K1 4PJOB 2DKGA 1VQKT 5CO7A 3GP8A 5CQYA 2ZPGB 5GAN7 4LDXA 3J7AF 3JCMc 3N5BB 2XDPA 5GAOn 2XI9A 2X4XA 3OW2S 3PT9A 1N8RU 3L2UA 3UDCA 1VQLA 5LL6S 2XHCA 3MEWA 4OMFB 3QYHB 4KUDK 2DAQA 2KVQG 1VQ5T 2E5QA 4XK8E 1KQ1A 1M90U 2GF7A 1RI0A 4KULA 2XK0A 4C92G 4IUQA 4N4IA 4F7UE 5C0MA 2XG8D 4HCZA 4M78A 3CCET 3LX7A 1WJQA 3JB9J 4OGCA 3NFCA 4XU0A 1WJRA 3MEAA 3OSSC 3TU4K 3L2RA 2P0KA 3OS5A 3DKMA 1OI1A 3OW2A 2XIDA 3L42A 2QTXA 3M53A 3I56T 3HRTA 1YITT 4N0AC 4IUVA 5LJ5e 2BKDN 3OMGA 2YRVA 3LWHA 2QA4T 2RB6A 4NL2A 4HT8A 1KG1A 1N27A 1YJ9T 1Q81C 3KUFA 4JLIA 2P0PA 4M75A 3EFRA 2MAMA 2L3RA 5I2MA 4JS5A 3V8JA 2V8IA 5C6SA 1DJ7B 5HK0A 4QW2A 3QG1A 2DD4A 4M78B 2GFAA 2DTHA 1UGRB 4J6XA 5D6WA 3L2QA 1VQ9T 2CZ0B 2ZPBB 4KT0E 5CKHA 4JUVA 2EQMA 1K8AC 3E19A 3OBYA 3SDZA 3X20B 2PU9B 3MP8A 2XD0A 4PJOC 5GANd 1Q7YC 3L1AA 4L59A 2JUFA 2EYQA 3JB9G 1BYMA 3LGFA 5J26A 1OZ2A 3JCMh 2K2VA 2E41A 1VQNT 1G3WA 4M75B 1YHQA 4C0GA 3PNWC 2K4YA 5A0GA 3QSUA 4BUGA 3FIFA 3QKJA 3FRNA 1NE8A 2QEXT 4TVRA 1U8RA 3BDUA 2K5IA 2X4JA 3QJYA 4OB2B 3CCUT 3M9QA 3VUBA 4DQ2A 3OYIA 3CCLA 2K57A 3G4SA 3DLLA 4M7AD 2RA2A 4HCCA 4IKFA 4LDWA 3DB4A 4JRIA 2JNGA 3TEEA 4M77F 1M1KU 1LOJA 2LDMA 4BY6B 3CCMA 3MEVA 3SWNB 2XKOC 4Y91A 4C92F 3OYLA 3CXCS 3HL8A 3UPUA 4BE0A 1KD1C 1I5LA 3C12A 2RK1A 2K5FA 1XOVA 1JRIA 3M56A 3LH0A 3WVDB 3OB9A 4C0DB 3P8BB 4JS4A 4LD9K 4BI8B 2V8JA 1FWZA 4XU3A 4C5EA 1MGQA 4Q5WA 2VXFA 4C8QA 4RG2A 1VQ8A 3QIIA 1U1TA 2K3XA 2ZZDA 1Y7XA 4MMLA 1PSFA 4M7DE 5DM7R 2I2LA 4JJNK 3FLGA 3M5AA 4MDWA 2PQWA 4XTXA 5FU6B 3QHSA 2XDDA 2C06A 1VQ6A 4PJOG 3M58A 3CXCA 2QQSA 1VQMA 4C92D 4DA4A 3LYIA 4BD3A 4A4HA 3OYEA 4N4HA 3PGGA 2FVUA 1YIJA 3ME9A 4XU2A 4XTYA 3CC7T 5CVIA 3EAEA 2MMPA 2VC8A 3NTHA 4C8QF 4RCCA 3CMAA 1UGSB 3S6WA 1OYXA 1WJSA 2LX9A 2Y4XA 1X75C 2JVVA 4PL6A 3X28B 3JB9F 5GAMj 2QQ9A 2WACA 4A4FA 4RG8A 4X9DA 3UWNA 4J8OA 4IUTA 3L2VA 3CCST 1BKBA 1I8FA 2KSSA 1O75A 4IUUA 1YJWT 3CC4A 1H3ZA 4UC4A 1UB4A 2M16A 2PUOB 3CC2A 2RJDA 1NPPA 3G71A 4B9XA 1JJ2S 3SWNC 3CCRA 1VQ7T 3QPHA 4PJOE 1O9SA 2RHYA 5GAOl 4EDUA 4E7JA 1G3SA 3LW5E 2VGNA 4NOYA 3S3MA 3OMCA 4EMKC 4BI4A 5GAMf 3M4GA 3RESA 1YI2T 1YJNA 5LJ3j 3P8DA 1WGSA 3RKXA 3JB9D 1Q82U 3GLXA 3MEUA 1VQ4T 1Y71A 5FROA 4A54A 1JBMA 3GNFB 4J83A 3AHUA 5GAMg 1Q7YU 4HKEA 4ZN3A 1JJ2A 1S72T 3CMET 2RK2A 3M59A 2KQWA 1WQ7A 1X6OA 3QUIA 4J7FA 4QQ6A 2QI2A 5L8RE 3L2WA 3E1SA 3E9FA 2E70A 4M7DC 2LQKA 3MO8A 4ZN1A 2O4XA 4E7LA 3JCMf 1K9MC 5CAIA 1VQOT 5IT9E 2RJCA 5LJ3f 2D6FA 1HK9A 4E47A 1NJIU 2R5AA 3JCMP 3I55A 4HCBA 3OS2A 3BW1A 4LDVA 1R8OB 4C5IA 4F7UA 4NL3A 4BDZA 1VIEA 3JCMg 1QP3A 4M7AA 4J6WA 5KE2A 2DXTA 5LJ3g 2WSFE 5LJ5j 3OS1A 2DPPB 4M78E 3M57A 3OYKA 5FU7C 1KC8U 3JCMJ 3NTKA 2EWNA 2M9UA 3EFSA 4O5VA 5GAMh 2OTJT 2O4XB 2CKKA 4LDUA 1W4SA 4BB7A 4FL6A 2QDYB 3ZEHA 4PJOD 2X4YA 4O6JA 1LNXA 2WSEE 2ZGWA 5GAN5 2E12A 1N6AA 4WF2A 2NLUA 3A8GB 4F7UF 5I2SA 3CCJA 4M7AF 4FT4A 2Y90A 3E9GA 4M7AB 3PFSA 4M75E 2F69A 5LJ5f 3MCAB 2L8DA 4M77A 4E7HA 1K73U 2YLCA 3HPWA 3CCVA 3CCQA 3LGLA 4C92A 1W2BS 5GAN8 4X34A 2F5TX 4J7IA 2HD0A 5LJ3h 3TREA 3HKSA 4JRQA 5LJ5g 5I21A 3OSVA 2VXEA 5FRNA 4M7DG 5CKEA 2KK4A 3G6EA 3M4YA 1B34A 4P5NA 1Q86C 3CD6T 3CEYA 2DXCA 4A4GA 3FDRA 1FXXA 2QQAA 2CS7A 1JB0E 1VQPT 3MP1A 1VQKA 2GCXA 2JZ2A 2RJFA 4LD6A 2D0QB 2DEQA 1MHNA 3L2ZA 1W2BA 5GAOq 4M77B 1WPYA 1NPRA 1ZBXA 5GMKe 1N8RC 3NTIA 2HNIA 5J3BA 2CZ6B 4C92B 2E1HA 2DVEA 2KAFA 5CIUA 1M1GA 2BIVA 2E6NA 5GANe 2DTOA 2K3YA 3OS0A 3PTAA 3OY9A 2M1HA 2RHZA 2WSCE 4PLLA 4N4GA 2HQXA 2OTLT 2YHTA 1QVPA 1VQ5A 2LRQA 2PVDB 2RD1A 1M90C 1PSEA 3PMTA 3JB9I 4XU1A 1U1SA 1V29B 3JCMX 1X01A 4QVZA 3A8MB 4OB0B 3CCEA 3HSBA 3O8VA 2OAUA 3SB2A 5LJ5h 4QVDA 3HFNA 1NJIC 1TH7A 2EQUA 3M54A 2HQEA 4M78C 3RKWA 3S3OA 3FJPA 2FHDA 4FIBA 3QJ6A 3QZ9B 1VQLT 4C0FA 1QW1A 3KXTA 4RMOA 3RMSA 3I56A 1UEBA 2PVGB 4PKCC 2LNVA 2PUKB 2JTMA 3SD4A 3V7SA 1YITA 1SSFA 1M9SA 2EKOA 2LCCA 3CBOA 1QP2A 4XTUA 3P8HA 3V7CA 5A0LA 1YJ9A 2EQJA 4A53A 5HK3A 1KC8C 1HXDA 2DZ9A 2LTOA 2ZPHB 2DO3A 4C5GA 2ZPEB 5GAMd 1UGQB 2DIGA 1BI0A 2RM4A 4ZGJB 4M75C 2KY9A 1ZHIA 3OYNA 3FB9A 4C8QB 1WNLA 2XDBA 3ER0A 3QZ5B 1IREB 3META 4N0AA 5FLXE 3JCMW 2YLBA 3GOXA 1VQ9A 4EMGA 3CPWS 2LVMA 2DK3A 3QDRB 4JDSA 5EG2A 3OQ5A 4JRPA 1N9RA 2RHIA 3URGA 1K73C 3OYYA 5DLQE 5M9OA 3RMQA 1Q81U 3CBMA 3VU3C 5GMKm 2EJGA 4BY6C 4BE2A 1BI2A 4OGEA 3JCMd 4XTVA 4XTZA 1VQNA 5LJ3d 5CCAA 3SFMA 4DOWA 2RI5A 3JAME 2IG0A 3QXEB 2QEXA 4C0DC 4MMKA 1M1FA 2DZCA 3M55A 2QQRA 4PJOA 3CCUA 3CPWA 2EIFA 5IAYA 5GMKh 1K8AU 4FU6A 2EAYA 4YTLA 3X24B 1G5VA 4M78G 2L89A 4OB3B 3X25B 1XQHA 3PMIA 1FX7A 5GAN2 3OYJA 3KBGA 4R55A 1NZ9A 1M1KC 3OYFA 2H3JA 4M7DD 4X9CA 1GXIE 2RHXA 2F5KA 5FRMA 5FU6C 2EJ9A 1KQSS 3VKIA 3ZFJA 4ELZC 1YHQT 3H8ZA 4E7KA 2XU8A 3QBYA 2IVWA 4RKUE 2MWOA 5DY9A 2JTFA 2LCLA 3RKYA 1Y96A 2DJZA 4DOVA 5CKFA 4MDXA 2KMTA 3J81E 4M75G 4KUIA 2PVOB 4PJOF 3V8LA 5CK9A 3X26B 3LWIA 3FEOA 3G4ST 3CCLT 4II1A 4BDYA 4A4EA 4RCBA 4ZGEB 5LJ5d 3GIBA 1VIFA 3VUZA 3VYGA 4C8QC 3BDLA 1M4ZA 3CCMT 5GAOr 4ZTJA 4FT2A 3A8LB 4QVCA 1P92A 3Q1JA 1KQSA 3F70A 3LLRA 2QQBA 3MHXA 1KD1U 5DLOA 5HY6A 2CYZB 3HP9A 3JRZA 2FL7A 3CBPA 2X35A 4M77G 1BIAA 2GFUA 2B8AA 4C5HA 1I81A 2DTIA 3OA6A 5A0DA 2ZCFB 2K5LA 3OYCA 1VQ8T 4M7AE 3CC7A 1Y96B 2DD5A 2R58A 2HAXA 1ZQ1A 5KE3A 4CI0C 5GAN4 2RH2A 2V8KA 4C8QD 2MF2A 5CR2A 1VQ6T 4F7UB 1WQWA 3RUXA 4KBMB 1KHIA 1VQMT 3CCSA 2FYKA 4FM4B 3VJPA 4EMHA 3WXMB 1YJWA 1KQ2A 3C4SA 3H6ZA 4OB1B 3GPLA 1OZ3A 4FSXA 4C0ZA 3VYHB 1YIJT 3ZBDA 3CPFA 4GY5A 1G3YA 3J80E 2D9TA 1VQ7A 4OP0A 5GMKl 4JLGA 3CMAT 3MP6A 4M78F 4J5YA 3DB3A 1Y07A 4BI3A 4Y28E 3DLMA 3ASKA 4M77E 4ELYC 2LQ8A 1UGPB 5KH6A 2KDSA 1YI2A 4C92E 1Q82C 4R56A 2CZ1B 4C8QG 3WVEB 3CC4T 1VQ4A 3SWNA 2CZ7B 1EIFA 3BFMA 4XQ3A 2EFIA 5AYFA 3QYGB 3JCMV 3CC2T 2LT1A 3G71T 4E7IA 5GAOm 5GMKj 1N9SA 5HKCA 3CCRT 4BACA 1S72A 4EMKA 2DXUA 2JN0A 4M75F 3CMEA 2CGHA 2QXFA 3HRSA 4BE1A 4IURA 2L5QA 5GANj 5A2QE 2LT4A 3R6OA 2DXBA 5J39A 3C95A 4M78D 1B34B 3INZA 5IN1A 5GMKi 1YJNT 3RIRA 4B9WA 3A5ZB 2ZPIB 1VQOA 2E6ZA 1VUBA 4JRKA 4PLIA 3OYMA 4ZTFA 2LC4A 2E65A 3HRUA 2GQVA 4ZGDB 3JCMe 2R57A 2MWPA 2RI3A 3BY7A 4MZTA 5GAOp 5D6YA 3UT1A 1LJOA 4M7DA 5GANf 4M7AC 2RJEA 2DIQA 2R5MA 2QA4A 4C8QE 1M5Q1 2MI6A 4M75D 4EMKB 4EPCA 2VGMA 3TCJA 4J6YA 4A4KA 3OYGA 1K9MU 5GAN3 2ZPFB 1XNIA 3PIPA 2VV5A 1G3TA 2EJFA 4GLKA 5GANg 2OTJA 1IZ6A 4QQGA 2G3RA 2HBPA 2RO0A 4IUPA 5CKDA 3I55T 5CKBA 3OYHA 3S3NA 4HT9A 1BI3A 2M0OA 1BIBA 4ME7A 3A8HB 2RHUA 1D3BA 5KCHA 3JCMQ 4M77D 3OYAA 1RL2A 4NS5A 2RI2A 2BUDA 2Y4YA 2P0QA 1QVFS 4M7DF 2E64A 1QVGS 4M7DB 4L5GA 3C94A 3QO3A 2E10A 2O01E 4M77C 4QQDA 1KHCA 1YBYA 2EQKA 3JSCA 4C92C 1AHJB 4OF1A 3JB9H 1H641 1YCYA 2A7YA 4CRIA 3JCMb 5GAN6 3OBWA 2JOYA 3OYBA 3CD6A 4LDYA 2P4TA 5GAMe 4MZMA 4PNOA 3CCJT 3GNGA 4MZPA 1XTDA 5D6XA 3V8KA 1M8VA 3V7RA 1VQPA 2X4WA 5CQXA 5GANh 1QVFA 3PIOA 3CCVT 1D3BB 3CCQT 3RERA 1QVGA 3T9NA 2VYTA 5FU7B 2VUBA 4VUBA 4D6WA 3A8OB 2A3LA 4F7UG 4M7AG 4OVAA 4V2SA 4XTWA 3FC3A 4ATOA 3HFOA 3VV0A 3OYDA 3G6ET 2OTLA 4HA8A 4XAXB 4L6V5 2XICA 1Q86U 5KCOA 3HHTB 3GF5A 1BI1A 4Z02A 2FB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ3 e;  4F7U B;  1WQW A;  2HNI A;  4XU2 A;  4XTY A;  3RUX A;  2E1H A;  1I4K 1;  2DVE A;  4C92 B;  5GAN e;  2DKG A;  4PJO B;  2DTO A;  2FYK A;  2VC8 A;  4C8Q F;  4RCC A;  4EMH A;  1KQ2 A;  2YHT A;  5GAN 7;  2RD1 A;  3JCM c;  3JB9 I;  3JB9 F;  5GAO n;  4XU1 A;  1U1S A;  5GAM j;  3JCM X;  1X01 A;  4X9D A;  4OP0 A;  5GMK l;  3HSB A;  1I8F A;  3SB2 A;  5LJ5 h;  4QVD A;  3HFN A;  1TH7 A;  4J5Y A;  4M78 F;  4M78 C;  1KQ1 A;  3RKW A;  4M77 E;  3FJP A;  4C92 G;  4F7U E;  3SWN C;  4C92 E;  4M78 A;  5GAO l;  4PJO E;  3JB9 J;  3V7S A;  4XU0 A;  4C8Q G;  4NOY A;  3SWN A;  3BFM A;  4XTU A;  4XQ3 A;  3V7C A;  4EMK C;  3JCM V;  4A53 A;  5GAM f;  1HXD A;  2DZ9 A;  3M4G A;  3RES A;  1N9S A;  5GMK j;  5LJ3 j;  2QTX A;  5GAO m;  3JB9 D;  3RKX A;  5GAM d;  4EMK A;  2DXU A;  4N0A C;  5LJ5 e;  2JN0 A;  4M75 F;  5GAN j;  2CGH A;  2RM4 A;  4M75 C;  4A54 A;  2RB6 A;  3FB9 A;  4NL2 A;  4C8Q B;  1JBM A;  4HT8 A;  1WNL A;  4N0A A;  3JCM W;  4JLI A;  2YLB A;  1B34 B;  3INZ A;  4M78 D;  4M75 A;  5GMK i;  3EFR A;  3RIR A;  5GAM g;  4EMG A;  4JRK A;  3V8J A;  1N9R A;  1WQ7 A;  3QUI A;  2E65 A;  5GMK e;  4M78 B;  4M7D C;  2DTH A;  3JCM f;  3VU3 C;  3BY7 A;  2EJG A;  4J6X A;  5CAI A;  5GMK m;  5LJ3 f;  5GAO p;  3JCM d;  1LJO A;  4JUV A;  1HK9 A;  4XTV A;  4XTZ A;  5LJ3 d;  5GAN f;  4M7D A;  4M7A C;  5GAO q;  3JCM P;  4PJO C;  4C8Q E;  5GAN d;  1M5Q 1;  3BW1 A;  4M75 D;  3L1A A;  4EMK B;  4F7U A;  4NL3 A;  3JB9 G;  4J6Y A;  3JCM g;  4M7A A;  4MMK A;  4J6W A;  2DZC A;  5GAN 3;  2DXT A;  5LJ3 g;  4PJO A;  3JCM h;  2E41 A;  2EJF A;  5GMK h;  5GAN g;  2EAY A;  4M75 B;  4HT9 A;  5LJ5 j;  4M78 G;  3QSU A;  4M78 E;  3FIF A;  5GAN 2;  3BDU A;  4M7D D;  1BIB A;  4X9C A;  3JCM J;  2EWN A;  3EFS A;  3JCM Q;  2EJ9 A;  1D3B A;  5GAM h;  4M77 D;  4DQ2 A;  2K57 A;  4M7D F;  4M7A D;  2E64 A;  2RA2 A;  4M7D B;  4PJO D;  5DY9 A;  1LNX A;  2ZGW A;  3QO3 A;  4JRI A;  4M77 F;  1LOJ A;  5GAN 5;  2E10 A;  1Y96 A;  2DJZ A;  4M77 C;  4WF2 A;  3RKY A;  3SWN B;  4Y91 A;  4F7U F;  4C92 F;  4M75 G;  3V8L A;  4M7A F;  2Y90 A;  4PJO F;  4M7A B;  4M75 E;  4C92 C;  5LJ5 f;  1H64 1;  1YCY A;  4M77 A;  3JCM b;  1I5L A;  3JB9 H;  2YLC A;  4RCB A;  5GAN 6;  1JRI A;  5LJ5 d;  3GIB A;  5GAO r;  4C8Q C;  4C92 A;  5GAM e;  4PNO A;  5GAN 8;  4XU3 A;  3V8K A;  1MGQ A;  4QVC A;  1M8V A;  2VXF A;  5LJ3 h;  4C8Q A;  5LJ5 g;  3V7R A;  5I21 A;  1U1T A;  4MML A;  2VXE A;  5GAN h;  3RER A;  4M7D G;  1D3B B;  4M7D E;  1B34 A;  2I2L A;  4M77 G;  1BIA A;  3PGG A;  4XTX A;  1I81 A;  2DTI A;  3QHS A;  4F7U G;  4M7A G;  4PJO G;  4V2S A;  4M7A E;  4XTW A;  1Y96 B;  4C92 D;  3HFO A;  3AHU A;  4HA8 A;  5GAN 4;  2DEQ A;  3L2Z A;  3JCM e;  4M77 B;  1WPY A;  4C8Q D;  2FB7 A; 
#chains in the Genus database with same CATH topology
 1VQK T;  3GP8 A;  1TSF A;  2ZPG B;  4CC7 A;  2XI9 A;  2X4X A;  3OW2 S;  3L2U A;  3UDC A;  1VQL A;  1YFN A;  1WHK A;  3MEW A;  4OMF B;  4KUD K;  2E5Q A;  2GF7 A;  4KUL A;  1SHF A;  4C92 G;  2XG8 D;  4R0K A;  2NUP A;  1EFN A;  3LX7 A;  1WJQ A;  1SG5 A;  3TU4 K;  1V1C A;  2IIM A;  3OS5 A;  3DKM A;  3L42 A;  2EGC A;  2YRV A;  2KRM A;  2F2X A;  2P0P A;  2FRW A;  5I2M A;  3V8J A;  2DIL A;  1H92 A;  2DX1 A;  1DJ7 B;  1N5Z A;  3QG1 A;  4M78 B;  1WHM A;  2GFA A;  2DTH A;  1UGR B;  4J6X A;  5D6W A;  2CZ0 B;  4JUV A;  1K8A C;  3X20 B;  3MP8 A;  4PJO C;  5GAN d;  4RTW A;  1TUD A;  3LGF A;  1OU8 A;  1OZ2 A;  3QWX X;  1G3W A;  4C0G A;  3PNW C;  5A0G A;  4DBR A;  4JJB A;  1V76 A;  1E6G A;  3QJY A;  4OB2 B;  5D7U A;  3CCU T;  1QLY A;  2MCN A;  2K57 A;  4M7A D;  4JRI A;  2LDM A;  1MMG A;  3UPU A;  3CCL Q;  1KD1 C;  4RTU A;  4RTV A;  2LZ6 B;  4C0D B;  1YP5 A;  4C5E A;  2VXF A;  4RTX A;  4OMQ A;  3QII A;  1UFF A;  1RAF B;  2I2L A;  4JJN K;  4XTX A;  5FU6 B;  3QHS A;  2EPD A;  3CXC A;  1VQM A;  4BD3 A;  4A4H A;  1TS9 A;  1GL5 A;  2FVU A;  3ME9 A;  4XU2 A;  4XTY A;  3EAE A;  2ENM A;  3CMA A;  4RCC A;  2JXB A;  3S6W A;  6AT1 B;  3NPF A;  1WYX A;  2QQ9 A;  3EG1 A;  4X9D A;  1OPK A;  2KSS A;  1YJW T;  4Z88 A;  1H3Z A;  2RQV A;  3CC2 A;  2RJD A;  1NPP A;  3G71 A;  1VQ9 Q;  2JM8 A;  3QPH A;  2DFU A;  1O9S A;  4F04 B;  2AIR B;  4PJO E;  1WA7 A;  1G3S A;  2JJ9 A;  1KIK A;  1YJN A;  1WFW A;  3M4G A;  5LJ3 j;  2KYM A;  1OX9 A;  1Y71 A;  3GNF B;  3THK A;  1H3H A;  3CME T;  1JO8 A;  3QUI A;  4QQ6 A;  2QI2 A;  2E70 A;  2LQK A;  2RQU A;  4ZN1 A;  2O4X A;  2BE9 B;  5LJ3 f;  1HK9 A;  1X69 A;  4E47 A;  1NJI U;  4HCB A;  3TQ7 P;  1QCN A;  5FWC A;  4BDZ A;  2DXT A;  2CT3 A;  2J6F A;  3KFV A;  3NTK A;  2EWN A;  3EFS A;  1W4S A;  4BB7 A;  1MNE A;  2KT1 A;  4PJO D;  2X4Y A;  4O6J A;  2WSE E;  2ZGW A;  2E12 A;  1ZX6 A;  1N6A A;  4F7U F;  1ZA2 B;  3E9G A;  4M7A B;  4M75 E;  4E7H A;  5IHN A;  2BE7 D;  2YLC A;  3EH1 A;  3CCQ A;  1W2B S;  4C92 A;  4X34 A;  2K3B A;  3TRE A;  5LJ5 g;  1SPK A;  2VXE A;  3OSV A;  4M7D G;  1SEM A;  5CKE A;  1Q86 C;  3CD6 T;  3FDR A;  1FXX A;  5IXF A;  2CS7 A;  1UDL A;  4JJD A;  1JB0 E;  4J9F A;  3MP1 A;  1VQ7 Q;  1VQK A;  2GCX A;  2JZ2 A;  2RJF A;  2DEQ A;  4J9G A;  3L2Z A;  5GAO q;  1NPR A;  1ZBX A;  1RAI B;  3NTI A;  2CP3 A;  1Z9Q A;  2E1H A;  5CIU A;  4HXJ A;  3PTA A;  2BIV A;  2EGE A;  2JW4 A;  4CC3 A;  1NJI R;  1M90 C;  1PSE A;  3PMT A;  3JB9 I;  2ECZ A;  3JCM X;  4QVZ A;  4AFS C;  3C0C A;  1NJI C;  1W6X A;  1TH7 A;  4AMC A;  2AKK A;  2HQE A;  3RKW A;  1HYO A;  3FJP A;  2FHD A;  3CCE Q;  3OW2 P;  2LNV A;  3V7S A;  4D8D A;  2DF6 A;  2HDA A;  2EQJ A;  4A53 A;  5HK3 A;  2FZG B;  2LTO A;  2DBK A;  3I56 Q;  4K11 A;  5GAM d;  1UGQ B;  1BI0 A;  1NEB A;  2QA4 Q;  2GBQ A;  1YJ9 Q;  1IRE B;  5FLX E;  3JCM W;  2F2W A;  5KYU A;  3I35 A;  2RQT A;  3GBQ A;  2HSE B;  3URG A;  5DLQ E;  4BY6 C;  3JCM d;  4LNP A;  2RQW A;  5CCA A;  4DOW A;  2IG0 A;  2O9V A;  1QWE A;  3QXE B;  3NHN A;  1JEG A;  1PD1 A;  3CCU A;  1VQN Q;  4FU6 A;  2YT6 A;  4M78 G;  1VOM A;  1FX7 A;  5GAN 2;  1X43 A;  2QEX Q;  1M1K C;  2H3J A;  3MPU B;  2RHX A;  2F5K A;  5FRM A;  1PNJ A;  1JQQ A;  1PRL C;  2I0N A;  2IVW A;  2MWO A;  5DY9 A;  2JTF A;  2LCL A;  2ED1 A;  1YN8 A;  4MDX A;  3J81 E;  4KUI A;  3CCL T;  2KT8 A;  1MMD A;  3ULR B;  1NG2 A;  1NEG A;  1VIF A;  3VYG A;  4ZTJ A;  1MV0 B;  2QQB A;  1TTH B;  2CYZ B;  1PCX A;  2X35 A;  4M77 G;  1BIA A;  1WHL A;  1GFD A;  5KE3 A;  5CR2 A;  2X3X D;  2DL5 A;  1RAA B;  1YJW A;  3WXM B;  3C4S A;  4E7Z A;  4FSX A;  4GY5 A;  3EFO A;  1AWX A;  1G3Y A;  2PZ1 A;  2XMF A;  3EHR A;  3UA6 A;  4BI3 A;  4CC4 B;  1Q82 C;  1OUL A;  2CZ1 B;  2H3E B;  4C8Q G;  3SWN A;  3BFM A;  4XQ3 A;  2LT1 A;  4E7I A;  5GMK j;  5HKC A;  2JN0 A;  3CME A;  5GAN j;  2QXF A;  4BE1 A;  2DE0 X;  3R6O A;  5J39 A;  1Y57 A;  5GMK i;  1RAB B;  2E4H A;  1ZLM A;  2LC4 A;  2E65 A;  1M2V B;  2H8H A;  2JTE A;  2GQV A;  1IXD A;  3BY7 A;  4JPB W;  5GAO p;  1VQO Q;  2KGT A;  3UT1 A;  4M7D A;  5GAN f;  1C1A A;  2DIQ A;  2AKL A;  1U3O A;  2EGA A;  1HSQ A;  1KQS P;  4EPC A;  4Z8A A;  3TCJ A;  1K9M U;  2LQW A;  2SEM A;  2HBP A;  5AT1 B;  3VRY A;  3S3N A;  1I5O B;  3OYH A;  2M0O A;  3JCM Q;  1UJY A;  1D3B A;  3OYA A;  2BUD A;  2Y4Y A;  2QG9 B;  3C94 A;  3EGX A;  4M77 C;  4QQD A;  1KHC A;  1ABQ A;  4F17 A;  3JSC A;  1H64 1;  1AD5 A;  2IPO B;  3JCM b;  2JOY A;  3CD6 A;  1MMN A;  2NUT B;  1M8V A;  4QKU A;  5KYU B;  2JT4 A;  5CQX A;  3RER A;  1QVF A;  1UJ0 A;  1QVG A;  2A3L A;  4M7A G;  4V2S A;  3SHW A;  4ATO A;  1VYU A;  5KYX B;  4HA8 A;  2CSQ A;  1TUC A;  4XAX B;  2XIC A;  5KCO A;  4F16 A;  1I4K 1;  4ZNX A;  2DKG A;  2OTL Q;  5CQY A;  5GAN 7;  1M3B A;  3J7A F;  1W1F A;  2JMC A;  4PFZ A;  1TXQ A;  1N8R U;  1K9M R;  5LL6 S;  2X51 A;  2QK0 A;  3CQT A;  1KQ1 A;  4F7U E;  5C0M A;  4HCZ A;  4M78 A;  3CCE T;  3NFC A;  3IQL A;  2P0K A;  3OW2 A;  2F2V A;  2YSQ A;  2QTX A;  3I56 T;  4IUV A;  3OMG A;  3LWH A;  4E7S A;  2QA4 T;  4EIK A;  3RDV A;  1YJ9 T;  1Q81 C;  4JLI A;  3EFR A;  4E2F B;  2MAM A;  2L3R A;  2VVK A;  2AK5 A;  5C6S A;  4QW2 A;  2A36 A;  1WXU A;  3L2Q A;  5CKH A;  1IHV A;  3E19 A;  1AZG B;  1RAG B;  3SDZ A;  3L1A A;  2YUO A;  4L59 A;  2EYQ A;  1ZSZ A;  1BYM A;  1VQN T;  1QCO A;  1UE9 A;  3EFO B;  4FYX B;  3CCV Q;  3QKJ A;  2QEX T;  2ED0 A;  3BDU A;  4KGX B;  2X4J A;  1N8R R;  3CCL A;  1ACM B;  2RA2 A;  4LDW A;  3DB4 A;  1LOJ A;  2CDT A;  4BY6 B;  4OML A;  3MEV A;  1IRX A;  3SWN B;  2XKO C;  4C92 F;  3OYL A;  4BE0 A;  1RI9 A;  3G4S Q;  1D1A A;  4GBQ A;  2K5F A;  3M0Q A;  1XOV A;  3WVD B;  4JS4 A;  3P8B B;  1D0X A;  1W70 A;  4C8Q A;  1AVZ C;  1BCO A;  2K3X A;  5DM7 R;  4MDW A;  2PQW A;  3VS2 A;  2C06 A;  4PJO G;  3M58 A;  2YDL A;  1B3Q A;  2D1X A;  4DA4 A;  1SF9 A;  2OJ2 A;  3LYI A;  1C0M A;  4J9C A;  1D1C A;  1ABO A;  5EC7 A;  1VQ6 Q;  2PNI A;  2F1L A;  5CVI A;  2CUD A;  2LX9 A;  1WJS A;  2Y4X A;  1X75 C;  2JVV A;  1YIJ Q;  2HMA A;  5IHK A;  5GAM j;  4RG8 A;  2QGG A;  3UWN A;  3L2V A;  1I8F A;  2V1Q A;  1SRM A;  2MK5 A;  3EGX B;  2RHY A;  2YWW A;  3UAT A;  1R0C B;  3S3M A;  4EMK C;  4BI4 A;  5GAM f;  1NYF A;  3CCR Q;  3JB9 D;  1WGS A;  3GLX A;  2O88 A;  4AFQ C;  3H0I A;  4J83 A;  1QQJ A;  3AHU A;  4ZN3 A;  1UG1 A;  1X6O A;  3L2W A;  4E7L A;  3JCM f;  1VQO T;  4J9I A;  2GTJ A;  2R5A A;  3UA7 A;  3JCM P;  4PFP A;  4LDV A;  1R8O B;  4M7A A;  1QP3 A;  4J6W A;  5LJ3 g;  3I55 Q;  2HBW A;  3OYK A;  4RUG A;  4O5V A;  2HCK A;  2OTJ T;  2QDY B;  5GAN 5;  1GBQ A;  2ZAE A;  4J9B A;  2COW A;  4FT4 A;  2Y90 A;  1FMV A;  1K73 U;  3TSZ A;  3LGL A;  2P4R A;  4J7I A;  5GJW B;  4JRQ A;  4AG1 C;  2EYW A;  3M4Y A;  1B34 A;  2VKN A;  5GJV B;  4A4G A;  2QQA A;  2QGF B;  1KJW A;  1YNZ A;  1VQP T;  1WXT A;  4LD6 A;  8AT1 B;  1RUW A;  1W2B A;  4M77 B;  2CUB A;  1ZSZ B;  2DRM A;  2KAF A;  1M1G A;  2RHZ A;  2WSC E;  1JJ2 P;  2OTL T;  2DVJ A;  4IIM A;  4XU1 A;  9ATC B;  2C0T A;  3REA B;  3CCE A;  2OAU A;  1GRI A;  5LJ5 h;  4QVD A;  1VQ5 Q;  2DET A;  1X2Q A;  3NMZ C;  3KXT A;  3I56 A;  4PKC C;  1M9S A;  2EYX A;  2LCC A;  4DEY A;  1YJ9 A;  4KGZ B;  1HXD A;  1WX6 A;  4ZGJ B;  4M75 C;  2KY9 A;  3OYN A;  3FB9 A;  4C8Q B;  1K73 R;  3ER0 A;  3GOX A;  4JRP A;  1N9R A;  1K73 C;  1IO6 A;  1K4U S;  3EG3 A;  3RMQ A;  5GMK m;  4BE2 A;  2LP5 A;  4XTZ A;  1VQN A;  2C0I A;  3TSW A;  2M0Y A;  3PVL A;  3JAM E;  2QEX A;  3QDF A;  4PJO A;  1TG0 A;  4D8K A;  5IAY A;  5GMK h;  2EAY A;  1RLP C;  2L89 A;  4OB3 B;  1XQH A;  4R55 A;  1PRM C;  2DLP A;  2KRO A;  1KQS S;  1QMC A;  1Y0M A;  3U23 A;  3ZFJ A;  1YHQ T;  4E7K A;  2QDL A;  1K0S A;  1GFC A;  1QKX A;  3RKY A;  2KMT A;  3X26 B;  3G4S T;  4A4E A;  5GAO r;  3CCM T;  3A8L B;  2ESW A;  3M0P A;  3F70 A;  1NM7 A;  4HVU A;  1CKA A;  3CBP A;  1I81 A;  2NUZ A;  5A0D A;  2ZCF B;  1VQL Q;  4ANJ A;  2DD5 A;  2LJ1 A;  4Z89 A;  4HVW A;  4FW1 A;  2MF2 A;  4PJJ A;  1VQ6 T;  1VYV A;  3RUX A;  3CC7 Q;  4EMH A;  4OB1 B;  4DBH A;  4C0Z A;  1WDX A;  1YIJ T;  2D9T A;  3CCS Q;  4JLG A;  4FYV B;  1KFZ A;  4M78 F;  4J5Y A;  1Y07 A;  1GCQ C;  4PJN A;  1ZA1 B;  1M2V A;  4C92 E;  4R56 A;  2B86 A;  1NLP C;  3CPW P;  1RAE B;  3JCM V;  2JS0 A;  3H9N A;  1N9S A;  3CCR T;  1YI2 Q;  1IB8 A;  2CGH A;  2D8J A;  1VQ4 Q;  2L5Q A;  2DXB A;  4FSS A;  1B7T A;  3C95 A;  1B34 B;  1VQO A;  3A5Z B;  1S72 Q;  1VUB A;  4ZTF A;  2A28 A;  2HZY A;  1MUZ A;  2DL7 A;  2R57 A;  1G8X A;  4MZT A;  1M3A A;  2QTV A;  1K1Z A;  2OI3 A;  2RJE A;  2R5M A;  1M5Q 1;  4M75 D;  4EMK B;  4A4K A;  1K76 A;  3I5R A;  2ZPF B;  1XNI A;  3EGU A;  2VV5 A;  2EJF A;  4GLK A;  5GAN g;  2OTJ A;  2G3R A;  3I55 T;  2COZ A;  5CKD A;  5CKB A;  1BI3 A;  1ZSG A;  2NUT A;  3VS1 A;  4JZ4 A;  5KCH A;  4NS5 A;  3LH5 A;  2L0A A;  2E10 A;  2O01 E;  5KYX A;  5GAN 6;  3OBW A;  1H8K A;  4LDY A;  2VB6 A;  4MZM A;  1OV3 A;  1MND A;  1VQP A;  2X4W A;  3PIO A;  4M4Z A;  4J9D A;  2VYT A;  4VUB A;  4F7U G;  2MPX C;  4OVA A;  1IGU A;  2OTL A;  4L6V 5;  3CC2 Q;  2FB7 A;  4J9H A;  3G71 Q;  3G7Z A;  4IIO A;  4PJO B;  4FCY A;  2XDP A;  2EKH A;  1PKS A;  2XHC A;  3QYH B;  1QWF A;  1VQ5 T;  3A1P A;  1RI0 A;  1K0X A;  1MMA A;  4IUQ A;  4N4I A;  3JV3 A;  1X27 A;  4XU0 A;  1WJR A;  3OSS C;  2J6O A;  3L2R A;  3M53 A;  3HRT A;  4N0A C;  5LJ5 e;  2BKD N;  4NL2 A;  1KG1 A;  4HT8 A;  1N27 A;  1OPL A;  5HK0 A;  2DA9 A;  1VQ9 T;  1BK2 A;  2L3S A;  3OBY A;  2PU9 B;  2XD0 A;  2E3H A;  2HKQ B;  3JB9 G;  2DRK A;  5J26 A;  4JJC A;  2K2V A;  3JCM h;  2RPN A;  4M75 B;  1YHQ A;  1EZZ B;  1ARK A;  3TVT A;  2K6D A;  2K4Y A;  3QSU A;  4BUG A;  3CCQ Q;  1U8R A;  1NE8 A;  1WIE A;  2EQI A;  7AT1 B;  2K9G A;  2DJQ A;  3PE0 A;  3EH2 A;  3OYI A;  2FEI A;  3G4S A;  3VS7 A;  3I5S A;  4HCC A;  4IKF A;  3TEE A;  2JNG A;  2GNC A;  3CCM A;  4Y91 A;  3HL8 A;  3C12 A;  1JRI A;  1F1B B;  4LUE A;  3LH0 A;  3OB9 A;  2V8J A;  4XU3 A;  5HCK A;  1PC0 A;  4Q5W A;  1HD3 A;  2ZZD A;  1Y7X A;  2KRN A;  4M7D E;  1IHW A;  2XDD A;  1VQ6 A;  1VQ8 Q;  3A98 A;  2OAW A;  1D0Y A;  1UEC A;  1E6H A;  3OYE A;  3VS6 A;  1YIJ A;  1WHG A;  3CC7 T;  1AWO A;  2VC8 A;  2EYZ A;  3NTH A;  3H0H A;  1UGS B;  4PK4 A;  1OYX A;  2KI7 A;  4J9E A;  1XJW B;  2HKN A;  2WAC A;  4A4F A;  2AT1 B;  2NYS A;  4IUT A;  1BKB A;  1UHF A;  3CCS T;  4IUU A;  4AT1 B;  1UB4 A;  2M16 A;  4B9X A;  1JJ2 S;  1UGV A;  3CCR A;  3VS5 A;  1VQ7 T;  5GAO l;  2DYI A;  4EDU A;  3CC4 Q;  3LW5 E;  2VGN A;  4NOY A;  3OMC A;  5FW9 A;  1YI2 T;  3P8D A;  2DBM A;  1VQ4 T;  5FRO A;  1JBM A;  5GAM g;  1S72 T;  3M59 A;  2FG0 A;  4OMN A;  5L8R E;  2O31 A;  2QYZ A;  3MO8 A;  4FYW B;  1K9M C;  5IT9 E;  2RJC A;  2CP6 A;  1WZO A;  2O2O A;  3I55 A;  1YWP A;  4F7U A;  5IXB A;  3JCM g;  2WSF E;  1LPL A;  2RQR A;  4M78 E;  3CXC P;  5FU7 C;  1KC8 U;  3JCM J;  2W0Z A;  4KRT A;  4LDU A;  3ZEH A;  4CC2 A;  3MJX A;  1CSK A;  4WF2 A;  2NLU A;  3A8G B;  2CH4 A;  3MCA B;  4M77 A;  5L23 A;  3HPW A;  2RF0 A;  2CH4 W;  2KEA A;  5GAN 8;  3CCJ Q;  2F5T X;  2HD0 A;  5LJ3 h;  3HKS A;  5FRN A;  2EVR A;  3CEY A;  1OU9 A;  1BBZ A;  1PG5 B;  2CP2 A;  3G6E Q;  2D0Q B;  1WPY A;  2A0F B;  2EBP A;  1N8R C;  5J3B A;  1SRL A;  2DVE A;  2M02 A;  3OY9 A;  2YHT A;  1QVP A;  1VQ5 A;  2RD1 A;  1U1S A;  1LCK A;  3SB2 A;  3HFN A;  1RAH B;  2K7A A;  3E2U A;  3M54 A;  2LX7 A;  3QJ6 A;  3QZ9 B;  1KC8 R;  2J05 A;  1UEB A;  2PVG B;  3SD4 A;  2PUK B;  2JTM A;  2EKO A;  3V7C A;  2KRS A;  1KC8 C;  2ZPE B;  1B07 A;  1YIT Q;  4JZ3 A;  4FW2 A;  3MKD A;  1WNL A;  2XDB A;  3QZ5 B;  3MET A;  2YLB A;  1IGQ A;  1VQ9 A;  3CPW S;  2DK3 A;  4JDS A;  1C6V X;  5EG2 A;  3OQ5 A;  4PFO A;  4E6R A;  3OYY A;  5I11 A;  2EJG A;  1BI2 A;  2Z0W A;  4XTV A;  2HSP A;  5KYY B;  3SFM A;  2RI5 A;  2KNB B;  4WCI A;  3D7S B;  4MMK A;  1M1F A;  2YRC A;  3M55 A;  2QQR A;  2RNA A;  2EIF A;  1K8A U;  1AEY A;  1G5V A;  1JU5 C;  3PMI A;  3OYJ A;  1NZ9 A;  4X9C A;  2EJ9 A;  2L2P A;  2K79 A;  3H8Z A;  2XU8 A;  3QBY A;  1M30 A;  4DOV A;  4M75 G;  3V8L A;  4LUD A;  3VS4 A;  4BDY A;  4ZGE B;  5LJ5 d;  3VUZ A;  1I1J A;  1P92 A;  1KQS A;  4DEX A;  3LLR A;  3MHX A;  1KD1 U;  5DLO A;  5HY6 A;  3HP9 A;  3JRZ A;  3I9Q A;  2GFU A;  2B8A A;  4C5H A;  3OA6 A;  2DTI A;  3RNJ A;  2K5L A;  3OYC A;  1VQ8 T;  4M7A E;  3CC7 A;  4AFU C;  1Y96 B;  1WHJ A;  5GAN 4;  2RH2 A;  1KK7 A;  2YUN A;  1U5S A;  3H0F A;  4F7U B;  1WQW A;  1KHI A;  4LN2 A;  3CCS A;  2DL3 A;  2DER A;  1KQ2 A;  3GPL A;  3ZBD A;  3CPF A;  2M51 A;  1VQ7 A;  2FO0 A;  3FJ5 A;  4FYY B;  1K8A R;  3MP6 A;  3DB3 A;  4Y28 E;  2L3Q A;  3ASK A;  4ELY C;  5KH6 A;  1YI2 A;  3WVE B;  3CC4 T;  1VQ4 A;  1EIF A;  2EFI A;  3QYG B;  1M8M A;  5GAO m;  1S72 A;  4EMK A;  2DXU A;  4HCK A;  5A2Q E;  3INZ A;  5IN1 A;  1AZE A;  1KD1 R;  2K2M A;  3HRU A;  2NWM A;  4ZGD B;  2MWP A;  5D6Y A;  1ZBJ A;  1LJO A;  3EGD B;  2QA4 A;  2VGM A;  4J6Y A;  3OYG A;  5GAN 3;  1G3T A;  1IZ6 A;  4IUP A;  1R77 A;  2E5K A;  2L3P A;  1BIB A;  2RHU A;  1BU1 A;  4AG2 C;  2RI2 A;  1G2B A;  2ROT A;  4M7D F;  2A37 A;  1UHC A;  2E64 A;  4L5G A;  3QO3 A;  3PVQ A;  3EHQ A;  1BCM A;  4C92 C;  4KH0 B;  1YCY A;  1WHH A;  1K9A A;  3G1J A;  4PNO A;  3CCJ T;  4MZP A;  1XTD A;  5D6X A;  3VS0 A;  3EG9 B;  5GAN h;  3CCV T;  2HL5 C;  5FU7 B;  2VUB A;  4D6W A;  2J7I A;  3M0R A;  3M0S A;  2SRC A;  1ZUY A;  2X9H A;  4HVV A;  3HFO A;  3VV0 A;  3G6E T;  1Q86 U;  3MEU A;  3HHT B;  3GF5 A;  3Q1J A;  2ABL A;  4Z02 A;  4DBQ A;  5I21 A;  5LJ3 e;  2AHJ B;  2VWF A;  1I0C A;  5CO7 A;  2RMO A;  4LDX A;  3JCM c;  3N5B B;  5GAO n;  3PT9 A;  1SKU B;  1GBR A;  2BZ8 A;  2DAQ A;  2KVQ G;  4XK8 E;  3AT1 B;  5ECA A;  1M90 U;  2FZK B;  2MIO A;  4PJL A;  2XK0 A;  2X3W D;  2ROL A;  3JB9 J;  4OGC A;  1CKB A;  3MEA A;  1BB9 A;  1PHT A;  1D0Z A;  1X6B A;  4PJM A;  1OI1 A;  5KYN A;  2XID A;  1YIT T;  2C0O A;  2RB6 A;  3NGP A;  2KBT A;  3KUF A;  4M75 A;  1LVK A;  3BE3 A;  1FYN A;  5FWB A;  4JS5 A;  2V8I A;  1Q95 G;  2DD4 A;  2NUP B;  2AZV A;  1KSW A;  1WXB A;  2HEQ A;  2ZPB B;  4KT0 E;  3ZL7 C;  2EQM A;  3M0U A;  2DYB A;  2G6F X;  2JUF A;  2J06 A;  1D09 B;  1Q86 R;  1QVF P;  1QVG P;  2E41 A;  1E7O A;  5IHI A;  3FIF A;  3FRN A;  4TVR A;  1SHG A;  2K5I A;  3M9Q A;  3VUB A;  4DQ2 A;  2YXY A;  3DLL A;  2YUP A;  1M1K U;  1RAC B;  4M77 F;  1M90 R;  3R6N A;  1QCF A;  3CXC S;  2DL4 A;  1OEB A;  1I5L A;  2DMO A;  2RK1 A;  2CP0 A;  3M56 A;  1AT1 B;  1QKW A;  4LD9 K;  4BI8 B;  1FWZ A;  2JM9 A;  1MGQ A;  1VQ8 A;  4RG2 A;  1U1T A;  4MML A;  1PSF A;  3REB B;  3FLG A;  3M5A A;  2QQS A;  1MV3 A;  4OMM A;  4C92 D;  8ATC B;  4RTZ A;  2W10 A;  1M3C A;  2PTK A;  4N4H A;  4Y92 A;  3PGG A;  5I22 A;  5IH2 A;  1VQM Q;  2BTT A;  2MMP A;  3EG2 A;  4C8Q F;  1T3S A;  2CRE A;  1G83 A;  4PL6 A;  3X28 B;  3JB9 F;  4J8O A;  2GGR A;  3CMA Q;  1O75 A;  1T0J A;  3CC4 A;  3O5Z A;  4UC4 A;  1PWT A;  2LJ3 A;  2PUO B;  1WI7 A;  3SWN C;  2OX7 A;  1GCQ A;  5KYW A;  2D0N A;  1M1K R;  3RES A;  1Q82 U;  3RKX A;  4A54 A;  4KGV B;  1YJN Q;  1Q7Y U;  4HKE A;  1JJ2 A;  2BZY A;  2RK2 A;  2KQW A;  1WQ7 A;  4LE9 A;  4J7F A;  3E1S A;  3E9F A;  4M7D C;  2KE9 A;  2D6F A;  3OS2 A;  3BW1 A;  2FPD A;  4C5I A;  1PD0 A;  1X6G A;  1TU0 B;  4NL3 A;  2KR3 A;  1VIE A;  1S1N A;  5KE2 A;  2KXC A;  2DEU A;  1FMW A;  5LJ5 j;  2COY A;  3OS1 A;  2DPP B;  3M57 A;  2M9U A;  5GAM h;  2O4X B;  2CKK A;  2LNH B;  2P84 A;  4FL6 A;  3RR6 A;  1LNX A;  5I2S A;  3CCJ A;  4M7A F;  3VS3 A;  3PFS A;  2F69 A;  5LJ5 f;  2L8D A;  2MYS A;  3CCV A;  2QAS A;  1Q82 R;  2CSI A;  3HTR A;  2KK4 A;  3G6E A;  4P5N A;  2DXC A;  1Q7Y R;  1MHN A;  5GMK e;  2EYY A;  1UUE A;  2HNI A;  1Q7Y C;  2CZ6 B;  4C92 B;  5GAN e;  2E6N A;  3OS0 A;  2DTO A;  2K3Y A;  1VQK Q;  2M1H A;  4PLL A;  4N4G A;  1YWO A;  2HQX A;  2LRQ A;  2PVD B;  1V29 B;  1X01 A;  3A8M B;  4OB0 B;  3HSB A;  3O8V A;  1Z9Z A;  4A63 B;  2EQU A;  1GCP A;  4M78 C;  3S3O A;  1NLO C;  4FIB A;  1VQL T;  4C0F A;  1QW1 A;  1T0H A;  4RMO A;  3RMS A;  1YIT A;  2CP5 A;  1SSF A;  3CBO A;  5A0L A;  1QP2 A;  2VAS A;  3P8H A;  4XTU A;  2GTO A;  5KYY A;  1EX4 A;  2DZ9 A;  4OMO A;  2ZPH B;  2DO3 A;  4C5G A;  2DIG A;  2RM4 A;  1ZHI A;  2FPE A;  4N0A A;  3VRZ A;  1U06 A;  4EMG A;  2LVM A;  3QDR B;  2OTJ Q;  2RHI A;  2J6K A;  5M9O A;  1Q81 U;  3CBM A;  3VU3 C;  4WTO B;  1R0B G;  2ATC B;  4OGE A;  1NYG A;  1YCS B;  1ZSZ C;  5LJ3 d;  2LJ0 A;  4C0D C;  2DZC A;  3CPW A;  4YTL A;  3X24 B;  2HL3 A;  3X25 B;  1PM3 A;  2KYB A;  3KBG A;  3OYF A;  4M7D D;  1GXI E;  3CCU Q;  5FU6 C;  1W2B P;  3VKI A;  4ELZ C;  1VQP Q;  4AFZ C;  2KXD A;  4ESR A;  4RKU E;  2CP7 A;  1Y96 A;  2DJZ A;  5KYW B;  3UF4 A;  5CKF A;  4KH1 B;  3LWI A;  2PVO B;  4PJO F;  4E7J A;  5CK9 A;  3FEO A;  4II1 A;  4RCB A;  1D1B A;  3GIB A;  1TWB A;  2O9S A;  1M4Z A;  3BDL A;  4C8Q C;  4F14 A;  4FT2 A;  1TOV A;  4QVC A;  2FL7 A;  1OQK A;  3RBB B;  2R58 A;  2HAX A;  2RN8 A;  1T3L A;  1ZQ1 A;  4OMP A;  4CI0 C;  2V8K A;  1J3T A;  2FRY A;  4RTY A;  1Q81 R;  2EW3 A;  3SEM A;  4KBM B;  1VQM T;  2FYK A;  4FM4 B;  3VJP A;  1TUG B;  2A08 A;  3H6Z A;  2YRD A;  1OZ3 A;  3VYH B;  3J80 E;  4OP0 A;  5GMK l;  3CMA T;  1JXM A;  1YJW Q;  1M27 C;  1OX8 A;  2V1R A;  3DLM A;  4M77 E;  2LQ8 A;  1UGP B;  1SSH A;  2KDS A;  2JS2 A;  1FMK A;  3H41 A;  3QWY A;  1UTI A;  2CZ7 B;  4DBF A;  3CC2 T;  5AYF A;  3EGD A;  3G71 T;  2HQH A;  2JMA A;  2V26 A;  2QAZ A;  4BAC A;  1VA7 A;  4M75 F;  1JXO A;  3HRS A;  4IUR A;  1WLP B;  2LT4 A;  1YJN T;  4M78 D;  3RIR A;  4B9W A;  2ZPI B;  1AWW A;  2E6Z A;  4JRK A;  4PLI A;  3OYM A;  3CME Q;  1VYT A;  1YHQ Q;  3M0T A;  2BZX A;  2YUQ A;  2RI3 A;  4M7A C;  2FZC B;  2LQN A;  4C8Q E;  2MI6 A;  4RTT A;  3CCM Q;  1X2K A;  3PIP A;  4QQG A;  2RO0 A;  4HT9 A;  2FPF A;  4QT7 A;  4X1V A;  1ZUU A;  3EG9 A;  1PKT A;  2CT4 A;  4ME7 A;  3A8H B;  4M77 D;  1RL2 A;  4GLM A;  1RAD B;  1QVF S;  2P0Q A;  1AOJ A;  1AWJ A;  1QVG S;  4M7D B;  1RLQ C;  1ZUK A;  1YBY A;  1OOT A;  2EQK A;  1AHJ B;  4OF1 A;  3JB9 H;  4B6M A;  4CRI A;  1NBE B;  2A7Y A;  2D8H A;  1HJD A;  3OYB A;  4ORZ A;  2P4T A;  5GAM e;  2GQI A;  3GNG A;  3V8K A;  3V7R A;  2LCS A;  2E3I A;  2DM1 A;  1D3B B;  3CCQ T;  3T9N A;  2LMJ A;  3CD6 Q;  2MOX A;  4LXC A;  3A8O B;  2AZS A;  4XTW A;  3FC3 A;  1M2O A;  1I07 A;  2DL8 A;  3OYD A;  1A0N B;  3JCM e;  3EG0 A;  5CAI A;  1BI1 A;  2DNU A;  4C8Q D; 
#chains in the Genus database with same CATH homology
 5LJ3 e;  2AHJ B;  3G7Z A;  1I4K 1;  4PJO B;  2DKG A;  1VQK T;  5CO7 A;  3GP8 A;  5CQY A;  2ZPG B;  5GAN 7;  4LDX A;  3J7A F;  3JCM c;  3N5B B;  2XDP A;  5GAO n;  2XI9 A;  2X4X A;  3OW2 S;  3PT9 A;  1N8R U;  3L2U A;  3UDC A;  1VQL A;  5LL6 S;  2XHC A;  3MEW A;  4OMF B;  3QYH B;  4KUD K;  2DAQ A;  2KVQ G;  1VQ5 T;  2E5Q A;  4XK8 E;  1KQ1 A;  1M90 U;  2GF7 A;  1RI0 A;  4KUL A;  2XK0 A;  4C92 G;  4IUQ A;  4N4I A;  4F7U E;  5C0M A;  2XG8 D;  4HCZ A;  4M78 A;  3CCE T;  3LX7 A;  1WJQ A;  3JB9 J;  4OGC A;  3NFC A;  4XU0 A;  1WJR A;  3MEA A;  3OSS C;  3TU4 K;  3L2R A;  2P0K A;  3OS5 A;  3DKM A;  1OI1 A;  3OW2 A;  2XID A;  3L42 A;  2QTX A;  3M53 A;  3I56 T;  3HRT A;  1YIT T;  4N0A C;  4IUV A;  5LJ5 e;  2BKD N;  3OMG A;  2YRV A;  3LWH A;  2QA4 T;  2RB6 A;  4NL2 A;  4HT8 A;  1KG1 A;  1N27 A;  1YJ9 T;  1Q81 C;  3KUF A;  4JLI A;  2P0P A;  4M75 A;  3EFR A;  2MAM A;  2L3R A;  5I2M A;  4JS5 A;  3V8J A;  2V8I A;  5C6S A;  1DJ7 B;  5HK0 A;  4QW2 A;  3QG1 A;  2DD4 A;  4M78 B;  2GFA A;  2DTH A;  1UGR B;  4J6X A;  5D6W A;  3L2Q A;  1VQ9 T;  2CZ0 B;  2ZPB B;  4KT0 E;  5CKH A;  4JUV A;  2EQM A;  1K8A C;  3E19 A;  3OBY A;  3SDZ A;  3X20 B;  2PU9 B;  3MP8 A;  2XD0 A;  4PJO C;  5GAN d;  1Q7Y C;  3L1A A;  4L59 A;  2JUF A;  2EYQ A;  3JB9 G;  1BYM A;  3LGF A;  5J26 A;  1OZ2 A;  3JCM h;  2K2V A;  2E41 A;  1VQN T;  1G3W A;  4M75 B;  1YHQ A;  4C0G A;  3PNW C;  2K4Y A;  5A0G A;  3QSU A;  4BUG A;  3FIF A;  3QKJ A;  3FRN A;  1NE8 A;  2QEX T;  4TVR A;  1U8R A;  3BDU A;  2K5I A;  2X4J A;  3QJY A;  4OB2 B;  3CCU T;  3M9Q A;  3VUB A;  4DQ2 A;  3OYI A;  3CCL A;  2K57 A;  3G4S A;  3DLL A;  4M7A D;  2RA2 A;  4HCC A;  4IKF A;  4LDW A;  3DB4 A;  4JRI A;  2JNG A;  3TEE A;  4M77 F;  1M1K U;  1LOJ A;  2LDM A;  4BY6 B;  3CCM A;  3MEV A;  3SWN B;  2XKO C;  4Y91 A;  4C92 F;  3OYL A;  3CXC S;  3HL8 A;  3UPU A;  4BE0 A;  1KD1 C;  1I5L A;  3C12 A;  2RK1 A;  2K5F A;  1XOV A;  1JRI A;  3M56 A;  3LH0 A;  3WVD B;  3OB9 A;  4C0D B;  3P8B B;  4JS4 A;  4LD9 K;  4BI8 B;  2V8J A;  1FWZ A;  4XU3 A;  4C5E A;  1MGQ A;  4Q5W A;  2VXF A;  4C8Q A;  4RG2 A;  1VQ8 A;  3QII A;  1U1T A;  2K3X A;  2ZZD A;  1Y7X A;  4MML A;  1PSF A;  4M7D E;  5DM7 R;  2I2L A;  4JJN K;  3FLG A;  3M5A A;  4MDW A;  2PQW A;  4XTX A;  5FU6 B;  3QHS A;  2XDD A;  2C06 A;  1VQ6 A;  4PJO G;  3M58 A;  3CXC A;  2QQS A;  1VQM A;  4C92 D;  4DA4 A;  3LYI A;  4BD3 A;  4A4H A;  3OYE A;  4N4H A;  3PGG A;  2FVU A;  1YIJ A;  3ME9 A;  4XU2 A;  4XTY A;  3CC7 T;  5CVI A;  3EAE A;  2MMP A;  2VC8 A;  3NTH A;  4C8Q F;  4RCC A;  3CMA A;  1UGS B;  3S6W A;  1OYX A;  1WJS A;  2LX9 A;  2Y4X A;  1X75 C;  2JVV A;  4PL6 A;  3X28 B;  3JB9 F;  5GAM j;  2QQ9 A;  2WAC A;  4A4F A;  4RG8 A;  4X9D A;  3UWN A;  4J8O A;  4IUT A;  3L2V A;  3CCS T;  1BKB A;  1I8F A;  2KSS A;  1O75 A;  4IUU A;  1YJW T;  3CC4 A;  1H3Z A;  4UC4 A;  1UB4 A;  2M16 A;  2PUO B;  3CC2 A;  2RJD A;  1NPP A;  3G71 A;  4B9X A;  1JJ2 S;  3SWN C;  3CCR A;  1VQ7 T;  3QPH A;  4PJO E;  1O9S A;  2RHY A;  5GAO l;  4EDU A;  4E7J A;  1G3S A;  3LW5 E;  2VGN A;  4NOY A;  3S3M A;  3OMC A;  4EMK C;  4BI4 A;  5GAM f;  3M4G A;  3RES A;  1YI2 T;  1YJN A;  5LJ3 j;  3P8D A;  1WGS A;  3RKX A;  3JB9 D;  1Q82 U;  3GLX A;  3MEU A;  1VQ4 T;  1Y71 A;  5FRO A;  4A54 A;  1JBM A;  3GNF B;  4J83 A;  3AHU A;  5GAM g;  1Q7Y U;  4HKE A;  4ZN3 A;  1JJ2 A;  1S72 T;  3CME T;  2RK2 A;  3M59 A;  2KQW A;  1WQ7 A;  1X6O A;  3QUI A;  4J7F A;  4QQ6 A;  2QI2 A;  5L8R E;  3L2W A;  3E1S A;  3E9F A;  2E70 A;  4M7D C;  2LQK A;  3MO8 A;  4ZN1 A;  2O4X A;  4E7L A;  3JCM f;  1K9M C;  5CAI A;  1VQO T;  5IT9 E;  2RJC A;  5LJ3 f;  2D6F A;  1HK9 A;  4E47 A;  1NJI U;  2R5A A;  3JCM P;  3I55 A;  4HCB A;  3OS2 A;  3BW1 A;  4LDV A;  1R8O B;  4C5I A;  4F7U A;  4NL3 A;  4BDZ A;  1VIE A;  3JCM g;  1QP3 A;  4M7A A;  4J6W A;  5KE2 A;  2DXT A;  5LJ3 g;  2WSF E;  5LJ5 j;  3OS1 A;  2DPP B;  4M78 E;  3M57 A;  3OYK A;  5FU7 C;  1KC8 U;  3JCM J;  3NTK A;  2EWN A;  2M9U A;  3EFS A;  4O5V A;  5GAM h;  2OTJ T;  2O4X B;  2CKK A;  4LDU A;  1W4S A;  4BB7 A;  4FL6 A;  2QDY B;  3ZEH A;  4PJO D;  2X4Y A;  4O6J A;  1LNX A;  2WSE E;  2ZGW A;  5GAN 5;  2E12 A;  1N6A A;  4WF2 A;  2NLU A;  3A8G B;  4F7U F;  5I2S A;  3CCJ A;  4M7A F;  4FT4 A;  2Y90 A;  3E9G A;  4M7A B;  3PFS A;  4M75 E;  2F69 A;  5LJ5 f;  3MCA B;  2L8D A;  4M77 A;  4E7H A;  1K73 U;  2YLC A;  3HPW A;  3CCV A;  3CCQ A;  3LGL A;  4C92 A;  1W2B S;  5GAN 8;  4X34 A;  2F5T X;  4J7I A;  2HD0 A;  5LJ3 h;  3TRE A;  3HKS A;  4JRQ A;  5LJ5 g;  5I21 A;  3OSV A;  2VXE A;  5FRN A;  4M7D G;  5CKE A;  2KK4 A;  3G6E A;  3M4Y A;  1B34 A;  4P5N A;  1Q86 C;  3CD6 T;  3CEY A;  2DXC A;  4A4G A;  3FDR A;  1FXX A;  2QQA A;  2CS7 A;  1JB0 E;  1VQP T;  3MP1 A;  1VQK A;  2GCX A;  2JZ2 A;  2RJF A;  4LD6 A;  2D0Q B;  2DEQ A;  1MHN A;  3L2Z A;  1W2B A;  5GAO q;  4M77 B;  1WPY A;  1NPR A;  1ZBX A;  5GMK e;  1N8R C;  3NTI A;  2HNI A;  5J3B A;  2CZ6 B;  4C92 B;  2E1H A;  2DVE A;  2KAF A;  5CIU A;  1M1G A;  2BIV A;  2E6N A;  5GAN e;  2DTO A;  2K3Y A;  3OS0 A;  3PTA A;  3OY9 A;  2M1H A;  2RHZ A;  2WSC E;  4PLL A;  4N4G A;  2HQX A;  2OTL T;  2YHT A;  1QVP A;  1VQ5 A;  2LRQ A;  2PVD B;  2RD1 A;  1M90 C;  1PSE A;  3PMT A;  3JB9 I;  4XU1 A;  1U1S A;  1V29 B;  3JCM X;  1X01 A;  4QVZ A;  3A8M B;  4OB0 B;  3CCE A;  3HSB A;  3O8V A;  2OAU A;  3SB2 A;  5LJ5 h;  4QVD A;  3HFN A;  1NJI C;  1TH7 A;  2EQU A;  3M54 A;  2HQE A;  4M78 C;  3RKW A;  3S3O A;  3FJP A;  2FHD A;  4FIB A;  3QJ6 A;  3QZ9 B;  1VQL T;  4C0F A;  1QW1 A;  3KXT A;  4RMO A;  3RMS A;  3I56 A;  1UEB A;  2PVG B;  4PKC C;  2LNV A;  2PUK B;  2JTM A;  3SD4 A;  3V7S A;  1YIT A;  1SSF A;  1M9S A;  2EKO A;  2LCC A;  3CBO A;  1QP2 A;  4XTU A;  3P8H A;  3V7C A;  5A0L A;  1YJ9 A;  2EQJ A;  4A53 A;  5HK3 A;  1KC8 C;  1HXD A;  2DZ9 A;  2LTO A;  2ZPH B;  2DO3 A;  4C5G A;  2ZPE B;  5GAM d;  1UGQ B;  2DIG A;  1BI0 A;  2RM4 A;  4ZGJ B;  4M75 C;  2KY9 A;  1ZHI A;  3OYN A;  3FB9 A;  4C8Q B;  1WNL A;  2XDB A;  3ER0 A;  3QZ5 B;  1IRE B;  3MET A;  4N0A A;  5FLX E;  3JCM W;  2YLB A;  3GOX A;  1VQ9 A;  4EMG A;  3CPW S;  2LVM A;  2DK3 A;  3QDR B;  4JDS A;  5EG2 A;  3OQ5 A;  4JRP A;  1N9R A;  2RHI A;  3URG A;  1K73 C;  3OYY A;  5DLQ E;  5M9O A;  3RMQ A;  1Q81 U;  3CBM A;  3VU3 C;  5GMK m;  2EJG A;  4BY6 C;  4BE2 A;  1BI2 A;  4OGE A;  3JCM d;  4XTV A;  4XTZ A;  1VQN A;  5LJ3 d;  5CCA A;  3SFM A;  4DOW A;  2RI5 A;  3JAM E;  2IG0 A;  3QXE B;  2QEX A;  4C0D C;  4MMK A;  1M1F A;  2DZC A;  3M55 A;  2QQR A;  4PJO A;  3CCU A;  3CPW A;  2EIF A;  5IAY A;  5GMK h;  1K8A U;  4FU6 A;  2EAY A;  4YTL A;  3X24 B;  1G5V A;  4M78 G;  2L89 A;  4OB3 B;  3X25 B;  1XQH A;  3PMI A;  1FX7 A;  5GAN 2;  3OYJ A;  3KBG A;  4R55 A;  1NZ9 A;  1M1K C;  3OYF A;  2H3J A;  4M7D D;  4X9C A;  1GXI E;  2RHX A;  2F5K A;  5FRM A;  5FU6 C;  2EJ9 A;  1KQS S;  3VKI A;  3ZFJ A;  4ELZ C;  1YHQ T;  3H8Z A;  4E7K A;  2XU8 A;  3QBY A;  2IVW A;  4RKU E;  2MWO A;  5DY9 A;  2JTF A;  2LCL A;  3RKY A;  1Y96 A;  2DJZ A;  4DOV A;  5CKF A;  4MDX A;  2KMT A;  3J81 E;  4M75 G;  4KUI A;  2PVO B;  4PJO F;  3V8L A;  5CK9 A;  3X26 B;  3LWI A;  3FEO A;  3G4S T;  3CCL T;  4II1 A;  4BDY A;  4A4E A;  4RCB A;  4ZGE B;  5LJ5 d;  3GIB A;  1VIF A;  3VUZ A;  3VYG A;  4C8Q C;  3BDL A;  1M4Z A;  3CCM T;  5GAO r;  4ZTJ A;  4FT2 A;  3A8L B;  4QVC A;  1P92 A;  3Q1J A;  1KQS A;  3F70 A;  3LLR A;  2QQB A;  3MHX A;  1KD1 U;  5DLO A;  5HY6 A;  2CYZ B;  3HP9 A;  3JRZ A;  2FL7 A;  3CBP A;  2X35 A;  4M77 G;  1BIA A;  2GFU A;  2B8A A;  4C5H A;  1I81 A;  2DTI A;  3OA6 A;  5A0D A;  2ZCF B;  2K5L A;  3OYC A;  1VQ8 T;  4M7A E;  3CC7 A;  1Y96 B;  2DD5 A;  2R58 A;  2HAX A;  1ZQ1 A;  5KE3 A;  4CI0 C;  5GAN 4;  2RH2 A;  2V8K A;  4C8Q D;  2MF2 A;  5CR2 A;  1VQ6 T;  4F7U B;  1WQW A;  3RUX A;  4KBM B;  1KHI A;  1VQM T;  3CCS A;  2FYK A;  4FM4 B;  3VJP A;  4EMH A;  3WXM B;  1YJW A;  1KQ2 A;  3C4S A;  3H6Z A;  4OB1 B;  3GPL A;  1OZ3 A;  4FSX A;  4C0Z A;  3VYH B;  1YIJ T;  3ZBD A;  3CPF A;  4GY5 A;  1G3Y A;  3J80 E;  2D9T A;  1VQ7 A;  4OP0 A;  5GMK l;  4JLG A;  3CMA T;  3MP6 A;  4M78 F;  4J5Y A;  3DB3 A;  1Y07 A;  4BI3 A;  4Y28 E;  3DLM A;  3ASK A;  4M77 E;  4ELY C;  2LQ8 A;  1UGP B;  5KH6 A;  2KDS A;  1YI2 A;  4C92 E;  1Q82 C;  4R56 A;  2CZ1 B;  4C8Q G;  3WVE B;  3CC4 T;  1VQ4 A;  3SWN A;  2CZ7 B;  1EIF A;  3BFM A;  4XQ3 A;  2EFI A;  5AYF A;  3QYG B;  3JCM V;  3CC2 T;  2LT1 A;  3G71 T;  4E7I A;  5GAO m;  5GMK j;  1N9S A;  5HKC A;  3CCR T;  4BAC A;  1S72 A;  4EMK A;  2DXU A;  2JN0 A;  4M75 F;  3CME A;  2CGH A;  2QXF A;  3HRS A;  4BE1 A;  4IUR A;  2L5Q A;  5GAN j;  5A2Q E;  2LT4 A;  3R6O A;  2DXB A;  5J39 A;  3C95 A;  4M78 D;  1B34 B;  3INZ A;  5IN1 A;  5GMK i;  1YJN T;  3RIR A;  4B9W A;  3A5Z B;  2ZPI B;  1VQO A;  2E6Z A;  1VUB A;  4JRK A;  4PLI A;  3OYM A;  4ZTF A;  2LC4 A;  2E65 A;  3HRU A;  2GQV A;  4ZGD B;  3JCM e;  2R57 A;  2MWP A;  2RI3 A;  3BY7 A;  4MZT A;  5GAO p;  5D6Y A;  3UT1 A;  1LJO A;  4M7D A;  5GAN f;  4M7A C;  2RJE A;  2DIQ A;  2R5M A;  2QA4 A;  4C8Q E;  1M5Q 1;  2MI6 A;  4M75 D;  4EMK B;  4EPC A;  2VGM A;  3TCJ A;  4J6Y A;  4A4K A;  3OYG A;  1K9M U;  5GAN 3;  2ZPF B;  1XNI A;  3PIP A;  2VV5 A;  1G3T A;  2EJF A;  4GLK A;  5GAN g;  2OTJ A;  1IZ6 A;  4QQG A;  2G3R A;  2HBP A;  2RO0 A;  4IUP A;  5CKD A;  3I55 T;  5CKB A;  3OYH A;  3S3N A;  4HT9 A;  1BI3 A;  2M0O A;  1BIB A;  4ME7 A;  3A8H B;  2RHU A;  1D3B A;  5KCH A;  3JCM Q;  4M77 D;  3OYA A;  1RL2 A;  4NS5 A;  2RI2 A;  2BUD A;  2Y4Y A;  2P0Q A;  1QVF S;  4M7D F;  2E64 A;  1QVG S;  4M7D B;  4L5G A;  3C94 A;  3QO3 A;  2E10 A;  2O01 E;  4M77 C;  4QQD A;  1KHC A;  1YBY A;  2EQK A;  3JSC A;  4C92 C;  1AHJ B;  4OF1 A;  3JB9 H;  1H64 1;  1YCY A;  2A7Y A;  4CRI A;  3JCM b;  5GAN 6;  3OBW A;  2JOY A;  3OYB A;  3CD6 A;  4LDY A;  2P4T A;  5GAM e;  4MZM A;  4PNO A;  3CCJ T;  3GNG A;  4MZP A;  1XTD A;  5D6X A;  3V8K A;  1M8V A;  3V7R A;  1VQP A;  2X4W A;  5CQX A;  5GAN h;  1QVF A;  3PIO A;  3CCV T;  1D3B B;  3CCQ T;  3RER A;  1QVG A;  3T9N A;  2VYT A;  5FU7 B;  2VUB A;  4VUB A;  4D6W A;  3A8O B;  2A3L A;  4F7U G;  4M7A G;  4OVA A;  4V2S A;  4XTW A;  3FC3 A;  4ATO A;  3HFO A;  3VV0 A;  3OYD A;  3G6E T;  2OTL A;  4HA8 A;  4XAX B;  4L6V 5;  2XIC A;  1Q86 U;  5KCO A;  3HHT B;  3GF5 A;  1BI1 A;  4Z02 A;  2FB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...