4M7AA

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
TLKDYLNKRVVIILVDGESLIASLNGFDKNTNLFLTNVFNRISKEFISKAQLLRGSEIALVGLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 13
structure length 64
sequence length 64
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aA00
5GAMd 4MMLA 1KQ2A 4M78C 2DZ9A 4C8QF 5LJ5h 3JB9H 3BDUA 4C92B 4M75B 1X01A 2EWNA 5LJ5g 3BY7A 5LJ5j 5LJ5d 5GAOp 4N0AC 3V7CA 2DTHA 2YLBA 1Y96A 4NL3A 3BW1A 2QTXA 1YCYA 1BIAA 5GAOq 3JCMh 3V8JA 3INZA 4M77E 5GAN3 2K57A 2FYKA 1WNLA 5GAN5 4N0AA 4QVDA 4M7AF 3GIBA 3HFOA 2DTIA 3SB2A 3RIRA 3V7RA 2E65A 4M7AB 4M7DF 5GMKi 3L1AA 4M78A 3PGGA 4C8QA 3JCMW 4J6XA 4RCBA 4C8QG 3RKXA 4Y91A 5GAMf 5LJ3h 4A53A 2RB6A 3JCMJ 3FJPA 1N9SA 1H641 5GAMg 5GAN7 4V2SA 5LJ3g 3RKWA 5LJ3d 2HNIA 1JRIA 2FB7A 4C8QE 1D3BB 5GAN2 5GAN4 5I21A 4EMHA 5GAN8 3QUIA 4XTYA 4EMKB 3JB9F 1MGQA 4C92G 3SWNB 3JCMc 2EAYA 4J5YA 5GAMe 1WQ7A 4F7UF 4JUVA 5GANf 4C8QC 5GMKj 1M5Q1 5GAOn 4C92F 4F7UB 4JLIA 3JB9J 1I5LA 2DKGA 4C92D 1BIBA 3FIFA 4WF2A 4NOYA 4PJOG 2I2LA 3JCMe 2DJZA 3QSUA 3AHUA 4XU3A 4EMGA 2Y90A 2E41A 2E1HA 3JCMX 3VU3C 3JB9D 1I8FA 4F7UA 4PJOE 4M75C 2DXTA 2EJGA 4M78G 2ZGWA 4M75D 1N9RA 2CGHA 4OP0A 1B34B 4XTUA 3EFSA 4XTZA 4M75F 4PJOF 4C92E 4EMKC 2DEQA 3RESA 1U1SA 4M77A 5GAOr 2DXUA 4NL2A 4C8QB 2VXEA 4F7UG 5GAOm 4M75A 3RUXA 1TH7A 4M7DB 5GANd 4M7AG 5GANg 4MMKA 4PNOA 4J6WA 4M77C 3V8LA 4M7AC 5GANh 4F7UE 4PJOD 4C8QD 5GMKe 4M7AD 4PJOC 1LNXA 4M78E 4M78D 5GAMj 3JCMQ 3JCMb 4M7AE 4M78B 4QVCA 4M7DD 1M8VA 2YHTA 5LJ3f 4M7DA 5GAMh 1HXDA 3FB9A 4XU1A 2YLCA 2EJFA 2DTOA 4EMKA 5GANj 4M7AA 3V7SA 5LJ5e 1LJOA 2RA2A 4PJOA 4XQ3A 3RKYA 4HT9A 4X9DA 1U1TA 3QO3A 4M7DG 2E64A 4M78F 2RD1A 1D3BA 2DVEA 3JCMg 4RCCA 4C92C 4DQ2A 3JCMd 4M77F 3JCMf 3V8KA 4M75E 1KQ1A 3JB9I 4M77D 3JB9G 2JN0A 5GMKl 4HT8A 3M4GA 1WPYA 4XU2A 4XU0A 5GAOl 4M7DE 3SWNA 4JRKA 4XTWA 5LJ3j 4M7DC 2VC8A 2EJ9A 3JCMP 5CAIA 1LOJA 4HA8A 5GAN6 1JBMA 4M77B 5LJ5f 3RERA 3JCMV 4J6YA 3QHSA 4X9CA 3BFMA 3SWNC 5DY9A 5LJ3e 1WQWA 4JRIA 2DZCA 3EFRA 3HFNA 4C92A 5GANe 4A54A 5GMKh 3HSBA 4M75G 4XTVA 3L2ZA 4M77G 5GMKm 2VXFA 4XTXA 1B34A 1HK9A 2RM4A 1I81A 1Y96B 4PJOB 1I4K1 2E10A
chains in the Genus database with same CATH superfamily
4MMLA 3CC7A 1QKWA 4C8QF 3JB9H 2KK4A 2EWNA 3TREA 1OOTA 5CCAA 1OPKA 1VQ5A 2D1XA 3EG1A 2YRDA 1KQSS 4HCBA 3I56T 3VRZA 1WNLA 3LW5E 2RJDA 2DE0X 3GIBA 3NTHA 3P8DA 2E65A 3ZFJA 1RAIB 4C8QA 2F2VA 4J6XA 1LPLA 1JJ2A 5GAMf 3OBYA 4E7SA 5D6XA 1ACMB 2AIRB 1VQMT 5I2MA 5LJ3d 3URGA 4II1A 3E1SA 1KC8C 5IXBA 1VUBA 4C92G 3JCMc 4J5YA 5GANf 1VQ9A 2LQKA 2MK5A 4RG2A 1AOJA 3L42A 4RTXA 2LNVA 4BD3A 1Q86C 4J9DA 4ZGEB 2QEXT 2XU8A 4BY6B 3JB9D 2QXFA 1YJ9A 1ZSZB 1GBQA 1TSFA 3PNWC 3VV0A 4C5EA 3OS5A 4MDWA 4BUGA 1IO6A 2LP5A 5HCKA 2KROA 2RHZA 4OB2B 4Z89A 1UHFA 1Y57A 3NTKA 1T0HA 3EG9A 1VQOA 4PJOC 2CT3A 3QJYA 3QWXX 4R55A 1SPKA 2YHTA 1G5VA 3EHQA 3SDZA 1VA7A 4PJNA 2SRCA 2EKHA 3G4ST 3EFOA 4ZN3A 5LL6S 1DJ7B 2L89A 3JCMf 4IKFA 1WPYA 1UGQB 2HBWA 4PJMA 3EGXB 2DL7A 2DYBA 1Q95G 2X3WD 2LCLA 4R56A 2A3LA 3EGXA 1U06A 2DL5A 2M1HA 3LGLA 2RM4A 5GJWB 1QCNA 4M78C 4C92B 5A0DA 1VQ4Q 2RO0A 2LDMA 1RLQC 3F70A 2XHCA 2HKQB 3M4YA 1Y96A 2JNGA 1PC0A 1NYGA 3VYGA 1YJNA 1WLPB 3X26B 2PNIA 2DTIA 3V7RA 1ZUKA 2J6KA 2JM9A 2ZPGB 3C12A 2LX7A 1M3AA 1ABOA 5DLQE 1H641 1R8OB 1WGSA 1NYFA 2HNIA 4LE9A 2NLUA 2RN8A 2LJ0A 2X51A 3M57A 5I21A 2WSEE 4J8OA 4C0FA 2CREA 4R0KA 1YJWT 5KYWB 1UJYA 4C92F 1W70A 2CP2A 1YHQA 2VGNA 2HD0A 3EG2A 2OTLT 3DLLA 2CDTA 1G3TA 3LWHA 1ARKA 4XTUA 2EBPA 1OYXA 1KHCA 1PD0A 4JZ4A 1U1SA 1R0CB 2YSQA 4B9XA 4C8QB 1PHTA 4F7UG 1KFZA 2QGFB 3RUXA 2EGCA 2FRWA 5GANd 3HL8A 4JDSA 5CKFA 4MZPA 2K79A 3QDRB 2LT1A 1M1KR 2YWWA 1Y7XA 2HAXA 1Y0MA 4JS5A 1SF9A 2LQ8A 4FT4A 2VUBA 4XU1A 4JJBA 2F1LA 3A8MB 1K73C 4M7AA 2KNBB 1VQNT 2KYBA 3HHTB 3CCET 3TSZA 2E64A 4ATOA 2LJ3A 4DQ2A 2CUBA 2QASA 4M77F 2BUDA 2DL3A 2GGRA 1TXQA 5IHNA 3M53A 4J83A 5IHIA 4MZTA 3G6EQ 2GTOA 1SHFA 5CK9A 2HKNA 4Z8AA 2L0AA 2EPDA 1HK9A 3L2UA 2C0TA 2VGMA 3G71Q 3SFMA 2JS2A 3VS1A 4WTOB 3M0SA 4ZTJA 4VUBA 3BY7A 4Z88A 4JS4A 1QWFA 1F1BB 1T0JA 4M7AF 3M5AA 3A98A 5IN1A 1KC8U 3H6ZA 4FIBA 3G71A 3S3NA 2CKKA 2KR3A 4ZTFA 2RB6A 5GAN7 4AG1C 1Q86U 3QYHB 4CC4B 1VYTA 5FWCA 1W6XA 1M1GA 4HCZA 4F7UB 5D7UA 4PJOG 2GCXA 3RBBB 2DD5A 3CC2T 2G6FX 3RNJA 1VQ7T 4E6RA 3H0FA 1VYUA 4F7UA 2DVJA 4A4GA 4EMKC 3WVEB 2QA4T 2LJ1A 4M7DB 1JQQA 5GJVB 3I5RA 4PJOD 4M7AD 4D6WA 2RHYA 4HKEA 1VQPT 1NEGA 1W1FA 1VQ7A 2DJQA 3CC4Q 1M8MA 1R0BG 3I55Q 4B9WA 2BKDN 2RPNA 4IUUA 4E7IA 3HTRA 2KRNA 3AT1B 3LLRA 3PIPA 1ZSZA 2K3YA 1K9MR 2XD0A 5GMKl 2GQIA 1E6GA 1WDXA 3SWNA 4M7DC 1OEBA 5CAIA 5KCOA 1WIEA 4PK4A 2DF6A 3I9QA 1OX8A 5LJ3e 1IGUA 1T3SA 4Y28E 4DBFA 2DM1A 2F2WA 5GAMd 1KD1R 3LWIA 1RAAB 4KT0E 2QAZA 1VQ8Q 4OB1B 4OB3B 5CKDA 1RACB 4P5NA 1SRMA 3JRZA 1YCYA 2JJ9A 3JCMh 2FYKA 3NFCA 4IIOA 2PUKB 5DLOA 1G83A 3RKWA 1VQLQ 4E47A 1TUCA 8ATCB 2KXDA 3CCUQ 1P92A 1QVFA 4JLIA 2JM8A 1VIEA 2R57A 4DBHA 4WF2A 4NOYA 2YRCA 2IPOB 4LDXA 2F2XA 2KVQG 4QQ6A 1I8FA 1UDLA 3I5SA 2R58A 3VS7A 5J26A 4M75F 3CCRA 3G4SQ 1M90R 2CT4A 1X69A 3OYAA 1K73U 1AWJA 2FZCB 4FCYA 1D09B 1QVFS 3EHRA 4M78D 1UJ0A 1UGVA 3OQ5A 1EX4A 2EJFA 1ZLMA 5FWBA 2DETA 1OZ3A 8AT1B 1N5ZA 3FJ5A 3CCJQ 3VS2A 4ELZC 2JN0A 3TVTA 3OS1A 2C0IA 4BDZA 1YITT 2CZ7B 9ATCB 2LQNA 1QMCA 2K2MA 4FT2A 3OB9A 4K11A 1X6BA 4M77B 2CYZB 4KGVB 3NPFA 4JRIA 3TSWA 3RMSA 2X35A 2RMOA 3L2ZA 4X1VA 1Q7YU 1I81A 3CMEQ 4AG2C 2JZ2A 2QDYB 2DBKA 2GFUA 1K4US 1V76A 2QTXA 4AFQC 2E4HA 5CKEA 4ZN1A 1WZOA 3OBWA 4B6MA 4QVDA 3CMAQ 2RQTA 4PLLA 4HVWA 5GMKi 2KQWA 3PMTA 2HSPA 2HL5C 1UGPB 1MMDA 1PKSA 4J9IA 4OB0B 3WVDB 3NTIA 1EZZB 1EIFA 2FB7A 2L3RA 1WHGA 1D3BB 1YITQ 1OU8A 1B07A 4XTYA 3JB9F 5CQXA 3S3MA 1HYOA 2P0KA 3OYIA 1AEYA 4D8KA 2ZPFB 1Q82R 2E5QA 3M0UA 1NBEB 4C5HA 3AHUA 3M0PA 4XU3A 3OYDA 4KUDK 1T3LA 3D7SB 2CZ6B 1VQKT 1YIJT 4M75C 2KEAA 4BI4A 1YITA 3GPLA 2CP6A 5A0LA 2DXUA 1IHVA 2BZYA 3MJXA 4C0GA 3JSCA 2MPXC 5CR2A 2KYMA 3V8LA 1NPPA 1YWOA 4M7AC 5KYXA 5GMKe 1W2BS 4M78E 2A28A 1NJIC 3CMAA 1IZ6A 2KBTA 2HQHA 5GAMh 4EMKA 3VS4A 5IH2A 4PKCC 2EFIA 3CPWP 1VQ4A 3JCMd 3ASKA 1UECA 4KH1B 4F04B 4FL6A 5HY6A 1G3YA 4LD6A 2COWA 1OQKA 2HEQA 3EFRA 1OI1A 3CC2Q 1N27A 2M02A 3CCSA 1QWEA 2OTJA 1Y96B 3T9NA 3EAEA 1KQ2A 2LCCA 2OJ2A 1D0ZA 1ZBJA 2JTFA 1BBZA 4NL3A 3CEYA 2QA4A 2RQRA 2JMAA 3HRSA 2R5AA 4F17A 1YIJQ 1VQNA 1B7TA 5KYNA 3JCMW 3RKXA 3C94A 2OAUA 2EVRA 1ABQA 2LX9A 1S1NA 4OMLA 3PIOA 1RADB 4CC7A 2XDPA 2PUOB 4EMHA 3QUIA 2IIMA 2FZGB 3EH2A 1GL5A 2MWPA 2L3SA 3E19A 2F5KA 1X75C 3MP8A 3CCVA 2Y90A 2V8IA 4OMOA 2EJGA 1OV3A 1ZUUA 4RG8A 4ZNXA 1AWOA 1WFWA 4FYXB 2ENMA 1ZQ1A 2J6FA 5KYYB 5HK0A 2G3RA 2VB6A 1IREB 2K6DA 2QTVA 4QQDA 1M8VA 2DFUA 4M78B 1M27C 3CD6Q 1YI2Q 3OS0A 2A37A 1OPLA 2NWMA 4N4GA 2EGEA 2K5LA 2VVKA 4M7DG 1NM7A 3QYGB 2JTMA 1YWPA 4HVVA 1X6GA 3VS0A 5GAOl 2EJ9A 3JCMP 4FSXA 3QHSA 1W2BA 2OTLQ 2PTKA 3OYJA 3HSBA 5GMKm 4E7ZA 3CBMA 3G7ZA 1JB0E 2JTEA 1PRLC 2C06A 1I1JA 5AT1B 4M75B 1QLYA 1MNEA 1S72A 3P8HA 1FMKA 5GAOp 4J7IA 2YLBA 3A8HB 2FVUA 4OGEA 5CIUA 2YUOA 1A0NB 2P0QA 3CCVT 1G2BA 4RTWA 3SB2A 1AWXA 2M0YA 4NS5A 2KSSA 3OY9A 2K5IA 1AHJB 5I2SA 2P0PA 3CCLQ 1JXOA 2YXYA 3VUBA 1RAHB 2RI5A 2ZPIB 2RQWA 2QQBA 1VIFA 5AYFA 2RJEA 1XTDA 3SWNB 1U8RA 1WQ7A 2KT1A 3MP1A 2A08A 4JZ3A 3QSUA 4J9BA 3UWNA 3OS2A 4Z02A 2E1HA 2IG0A 4M78G 2RJCA 1N9RA 3A8GB 3CCLT 4PJOF 2WSFE 5FU7B 2E70A 4M77A 5GAOr 4OF1A 4IUPA 2DEUA 2E12A 1GFCA 1QP3A 1C0MA 1IGQA 1UE9A 1NZ9A 1KD1U 1M3CA 3CC2A 3MEAA 4KRTA 3UPUA 1JU5C 4BI3A 2EYQA 1ZSGA 2LMJA 3CC4T 3CPFA 2KT8A 4A4FA 1CKBA 4C0DC 4A4HA 3GOXA 3OSVA 2K3BA 2D6FA 1PSEA 4C0ZA 1NLOC 3M4GA 4LDVA 2ZZDA 1YCSB 2QQSA 2D8HA 2PZ1A 2ZPEB 4UC4A 2CZ1B 1C1AA 2PVOB 3FRNA 1SSHA 2AK5A 3TU4K 4ZGDB 4C92A 1K8AU 4ELYC 4OMQA 1RAEB 1EFNA 2W10A 1B34A 3H0HA 2CUDA 3CCSQ 2EQMA 1X01A 4ESRA 2EYYA 1TOVA 3OYLA 2EIFA 3I55A 1WHHA 4LNPA 2FZKB 3MEUA 3CCVQ 1QP2A 3Q1JA 4E7LA 2KRMA 3OA6A 3E9FA 3CCLA 1N6AA 4FYWB 1SRLA 3OMCA 4J7FA 3I35A 5KYXB 1M1FA 3S6WA 3PVLA 3DKMA 1VQOQ 2DLPA 1QVGA 3ER0A 2DXCA 4DOWA 3META 1UGRB 1K1ZA 1NJIR 1M3BA 3SHWA 4ORZA 1RUWA 1Y07A 3CBOA 1D1CA 3KFVA 4EMGA 4LDWA 3EGUA 2COYA 2O9SA 2E3HA 3EFSA 5IHKA 1MV0B 1X2KA 2V8KA 1RABB 2VV5A 3KBGA 3FC3A 3I56A 2ROLA 4MMKA 2MYSA 3OYMA 3MP6A 5GAMj 2DERA 3CPWA 3OYFA 5LJ3f 2RK2A 3VJPA 4DEYA 3A8OB 4XQ3A 2LT4A 3UF4A 1FMVA 2RD1A 4AFUC 2KMTA 1QQJA 1KQ1A 1C6VX 5J39A 4HT8A 2YRVA 3MCAB 2ABLA 5FRNA 2E6NA 3M59A 1TG0A 2IVWA 1NEBA 5DM7R 1BI2A 2ESWA 2DZCA 2EQKA 1Z9ZA 3PFSA 1Q81R 2BTTA 5CKBA 1TTHB 4XTXA 2ZPHB 1I4K1 2E6ZA 1MMNA 2CH4W 1N8RR 4OMNA 5KCHA 3TCJA 3MPUB 2WACA 1RI9A 3HFOA 2D9TA 2VYTA 2MCNA 1K73R 3HKSA 1AVZC 3HRTA 5GAMg 3CXCS 4V2SA 2K7AA 1YIJA 3QXEB 2CP7A 1RAFB 2OAWA 1VQ6T 2MMPA 2ROTA 5CQYA 1Q82U 5GAN8 3QKJA 1KQSP 1ZA1B 1U3OA 5D6WA 4JUVA 2FL7A 1M5Q1 1I5LA 2AKLA 4ANJA 1K0SA 1NE8A 1RLPC 1BYMA 2I2LA 2QEXQ 1SHGA 1TUGB 5EG2A 1VYVA 1KD1C 1PWTA 4XTZA 1YFNA 3RESA 2FO0A 4QKUA 1Y71A 1TH7A 2XDBA 4M7AG 2KAFA 2LNHB 4DA4A 2X4WA 1K0XA 3OW2S 2AT1B 1WX6A 4M7DA 1YJNQ 2L3QA 2BZXA 1LJOA 4JJCA 2LQWA 5CKHA 1PNJA 1U1TA 3QO3A 4C92C 3JCMg 4L59A 1BI0A 1PD1A 2H8HA 1K8AC 4XU2A 4M7DE 3DLMA 2O2OA 3ULRB 4FU6A 2DO3A 3OYKA 1LCKA 5I11A 1AZEA 4O5VA 3OYNA 1UFFA 1KHIA 3HFNA 4RTVA 1SSFA 5GANe 1NJIU 3QBYA 2VKNA 3PVQA 1PRMC 3CMET 3BDUA 3EG0A 5A0GA 4PFZA 2LZ6B 1AWWA 2M9UA 4ZGJB 2NUTB 5CVIA 2FPDA 5J3BA 2RNAA 3R6NA 1BIAA 1VQ6Q 3V8JA 2LC4A 2XIDA 1GCQA 3OW2P 1M90U 1VOMA 3CCMQ 4PFOA 3CCUA 3JCMJ 1KG1A 3X20B 3EGDB 3M58A 1JRIA 3CC4A 4C8QE 4PL6A 1QVFP 4Y92A 1YJ9Q 1NPRA 1X27A 5FU7C 4JJNK 5CO7A 2NUZA 3OYHA 2XMFA 4PLIA 3SD4A 2DKGA 2CSQA 1VQ9Q 1BI3A 1E6HA 1Q86R 2H3EB 1QVPA 3MO8A 1SKUB 1GBRA 3CQTA 2DMOA 3VKIA 3CXCA 1MMGA 1K76A 4FW2A 2QG9B 4M75A 2HCKA 3VS6A 1X43A 1WXBA 2X4YA 3GNFB 1H92A 1D0YA 1JXMA 3X25B 1M30A 2FG0A 3JCMQ 2XICA 3CCQQ 2OTLA 3EH1A 2DRKA 1VQMA 2F5TX 4PJOA 3ZL7C 3A8LB 3OYGA 5KYUB 4Q5WA 3H8ZA 1VQLT 4GY5A 1RI0A 1V29B 3J80E 1OZ2A 1N8RC 2A36A 2CP0A 1WHJA 1WHMA 3UT1A 1FX7A 1BKBA 3M55A 2BIVA 2RK1A 4OMFB 1JBMA 3OW2A 3BFMA 2JS0A 3CCUT 1BCOA 2O4XB 1K9MU 3OSSC 4LDYA 4M75G 4XTVA 2WSCE 2HQEA 2DXBA 3S3OA 2DYIA 3G71T 5KE2A 4BY6C 1KQSA 5LJ5d 4HXJA 1VQOT 3E2UA 2DIGA 1NG2A 2EQUA 3G6ET 4X34A 3BW1A 2DBMA 4GBQA 5EC7A 1KSWA 3TQ7P 4N0AA 1K9AA 4RTUA 2EYWA 3ZBDA 5HK3A 4A63B 3LYIA 4BE0A 2B86A 4LD9K 4EIKA 1JO8A 3UA7A 3QIIA 2CH4A 2DA9A 2DPPB 3QJ6A 4KULA 1KIKA 5GAMe 5GAOn 1G8XA 2HBPA 5L8RE 4C92D 1NLPC 4AFZC 1IHWA 2K2VA 2V1RA 5FW9A 5KE3A 1UHCA 2ATCB 2DXTA 3REBB 2ZGWA 4M75D 4OP0A 3J7AF 1B34B 5IXFA 2XKOC 3A1PA 2QDLA 1ZX6A 1S72Q 4D8DA 2D0NA 2K3XA 4LUDA 1Z9QA 1AD5A 3RMQA 4GLMA 3RDVA 4RMOA 4LUEA 4C8QD 1UTIA 2NUPB 2MAMA 4QVCA 1HXDA 1YI2T 3P8BB 2DTOA 2SEMA 2RI2A 5LJ5e 4E7JA 3EG9B 3RKYA 1WXUA 2LVMA 3DB3A 1D3BA 1YNZA 3LH5A 4M77D 2XDDA 1KC8R 2Y4YA 3M54A 2KY9A 2EYZA 4CC3A 4HA8A 2YUNA 2DNUA 3REAB 1YI2A 4OGCA 1XOVA 1YJWQ 1I5OB 4JRQA 1D1BA 4JJDA 3M9QA 2OX7A 3CCRT 2JVVA 2E10A 2E3IA 2DZ9A 1VQNQ 3M0QA 2O31A 3C95A 4IIMA 3L2RA 3PTAA 3C0CA 3INZA 1FXXA 3RIRA 2BE9B 3U23A 4M7DF 3L2QA 2D8JA 4J9HA 1Q81C 3QZ9B 3CD6T 4A53A 2BZ8A 4E7KA 3EG3A 3CCEQ 5FLXE 4LDUA 1ZHIA 2K9GA 3M0RA 1MGQA 1XQHA 4C0DB 1G3WA 4E2FB 4KUIA 4KGZB 3L2VA 1AT1B 2GTJA 2C0OA 3VU3C 2M16A 1XJWB 2QA4Q 1VQMQ 3LX7A 2CGHA 1R77A 3QPHA 2NUTA 2EYXA 4RTTA 4CI0C 3CMEA 1UG1A 1FWZA 1I07A 1RL2A 2J05A 2DRMA 2OTJQ 2JXBA 4M77C 4BI8B 2HL3A 4C5IA 4AMCA 1WJRA 2D0QB 4M7AE 4M7DD 4MDXA 1N8RU 2P4TA 4QVZA 4HT9A 2Z0WA 1IXDA 2DK3A 2QEXA 2DVEA 4BDYA 3H41A 4M75E 3CCJA 1K9MC 1QKXA 1W4SA 2A7YA 2I0NA 2L5QA 2HSEB 3LGFA 4JRKA 1IRXA 2VC8A 2KXCA 5M9OA 5GAN6 2CSIA 4X9CA 2J6OA 4J6YA 1D1AA 1QVGS 3ME9A 2FEIA 3C4SA 3CMAT 1BU1A 1YHQQ 4PJOB 5LJ5h 1HJDA 4J9GA 4GLKA 3G4SA 2DTHA 2QQRA 5A2QE 3OYEA 3O8VA 2VASA 5GAN5 3FDRA 2ED1A 4RUGA 4FM4B 1Q7YR 1FMWA 4JRPA 2MF2A 4ME7A 5LJ3h 2KRSA 3FJPA 2QQAA 3NHNA 1QCOA 2GNCA 4KH0B 1WHKA 2A0FB 3SEMA 2KI7A 5GAN2 2L3PA 4PFPA 5GAN4 1H3ZA 1MMAA 1UEBA 1VQLA 2QQ9A 3CCJT 4TVRA 4XAXB 4C8QC 2ZCFB 1MNDA 4FSSA 3VRYA 4A4KA 2ZPBB 4J9CA 2RHIA 2F69A 2O01E 1LVKA 2XI9A 2HQXA 1D0XA 3GF5A 2DEQA 1VQ8A 4HCCA 3R6OA 3I56Q 2M0OA 3GNGA 4F7UE 2JT4A 1Q82C 3JCMb 2GBQA 3O5ZA 5GANj 3NMZC 4F16A 1ZUYA 5I22A 1VQ5T 2OTJT 2V1QA 4XU0A 1GXIE 3VS3A 2LTOA 5LJ3j 2RF0A 3H9NA 2R5MA 3MKDA 1M1KC 1TUDA 1BI1A 4MZMA 2GF7A 1WHLA 1VQ7Q 2FRYA 2NUPA 4FYVB 2RQVA 4C5GA 4OVAA 2B8AA 2EKOA 1PG5B 3A5ZB 1VQ4T 1GRIA 1BIBA 1PSFA 3N5BB 2VWFA 3EFOB 1QVGP 2MWOA 5LJ5j 4N0AC 3V7CA 1WYXA 3QWYA 3H0IA 3QDFA 4RTYA 5FROA 1Q81U 5HKCA 1VQ8T 2HDAA 3JAME 5KYYA 2HMAA 3OYCA 3OYBA 1TS9A 5FU6C 4A4EA 2QYZA 1W2BP 2L8DA 2PQWA 4Y91A 1H8KA 4J9EA 3DB4A 2MOXA 5KYUA 5ECAA 2JOYA 4N4IA 2OI3A 3PMIA 2BE7D 4EMKB 2AHJB 5GMKj 1BB9A 1HSQA 2RHUA 2K5FA 3E9GA 3KXTA 4IUTA 2CS7A 2ECZA 4DBRA 7AT1B 2MIOA 3JCMe 3MEVA 2FPFA 1BK2A 2V8JA 2EGAA 1VQPQ 4JLGA 4PJOE 4F14A 3CCST 3JB9J 1M90C 3CCEA 3NGPA 1ZBXA 2RI3A 3OYYA 4FW1A 2O9VA 1X6OA 4CRIA 2RH2A 5GANg 4PNOA 4QQGA 4FYYB 2JW4A 4J6WA 2YUPA 1QCFA 2O4XA 3I55T 5KYWA 1UB4A 3CCRQ 2YLCA 4LN2A 1SG5A 5C6SA 3VS5A 2GQVA 3CBPA 2LCSA 1KK7A 4CC2A 3UDCA 4WCIA 3HPWA 3V8KA 1K8AR 3JB9G 3UA6A 2MI6A 4OMMA 5FRMA 3QZ5B 3HRUA 3M0TA 4QT7A 1YJWA 2FHDA 2YT6A 2P84A 1VQKA 1RAGB 1WA7A 1ZA2B 1TWBA 4RTZA 3JCMV 4M4ZA 4DBQA 1OX9A 1IB8A 4HCKA 5LJ5g 4QW2A 2ZAEA 2LRQA 2DILA 2FPEA 5GAN3 4M77E 1VQPA 2K57A 2QI2A 3X28B 2AKKA 1J3TA 2M51A 3IQLA 4M7AB 3CCMT 1QW1A 2YDLA 3L1AA 4IUQA 2HZYA 3PGGA 3CXCP 1GCQC 4RCBA 2EQJA 4C8QG 2EW3A 3KUFA 1N9SA 2X9HA 5LJ3g 1PKTA 2JMCA 4J9FA 5IT9E 2DD4A 1GCPA 3G6EA 3HP9A 3L2WA 2EAYA 4F7UF 1U5SA 4E7HA 4AFSC 3QG1A 2QK0A 1CKAA 4JPBW 4RKUE 4N4HA 4IURA 4XK8E 4C92E 1JEGA 1JJ2P 3CD6A 4NL2A 1G3SA 1S72T 2RJFA 5C0MA 3ZEHA 3J81E 2W0ZA 1LNXA 1YP5A 1WI7A 1GFDA 1BCMA 2O88A 3G1JA 4EPCA 2RQUA 2GFAA 3V7SA 2RA2A 2DAQA 5FU6B 3GLXA 1M1KU 1PM3A 2XG8D 2RHXA 1WJSA 3JB9I 3UATA 3PE0A 4OMPA 2Y4XA 5D6YA 1VQ6A 1YN8A 2V26A 2CP3A 3TEEA 4KBMB 1WQWA 2AZSA 2H3JA 3BE3A 1VQ9T 2NYSA 1ZSZC 4A54A 5GMKh 2DIQA 3LH0A 1UGSB 2K4YA 4HVUA 2XK0A 1JJ2S 1FYNA 2DX1A 2X4JA 2CZ0B 1OU9A 4DOVA 2AZVA 1YBYA 3FLGA 5KH6A 3WXMB 5GAOq 3CPWS 2DL4A 4L6V5 2J7IA 4L5GA 4KGXB 4LXCA 4BE2A 4BB7A 3THKA 3MEWA 1OULA 4M78A 4BACA 1PCXA 1O9SA 2KE9A 2QGGA 3VUZA 2DL8A 3RR6A 1B3QA 1M4ZA 4AT1B 5L23A 2J06A 3VYHB 3FEOA 2EQIA 1XNIA 2L2PA 2CP5A 5IAYA 1CSKA 3GP8A 2YUQA 1M9SA 4BE1A 4PJLA 2PU9B 1UUEA 4PJJA 3FIFA 4O6JA 2DJZA 3PT9A 1O75A 2E41A 3JCMX 6AT1B 2PVDB 2COZA 2KDSA 1VQKQ 1H3HA 1VQ5Q 3EGDA 1MHNA 1X2QA 2VXEA 5GAOm 4IUVA 3CC7Q 3X24B 2P4RA 3GBQA 3JV3A 3CCMA 3OMGA 1V1CA 5GANh 2X3XD 2X4XA 2E5KA 1Q7YC 2JUFA 3FB9A 1YJNT 1WXTA 1TU0B 1KJWA 4X9DA 2KGTA 4M78F 4RCCA 3CCQA 1YJ9T 4YTLA 1M2VB 1SEMA 3CC7T 1I0CA 3BDLA 4DEXA 4XTWA 1HD3A 1MV3A 1E7OA 1LOJA 4EDUA 5LJ5f 3RERA 1AZGB 1M2VA 1WJQA 3SWNC 5DY9A 1MUZA 2ED0A 1M2OA 3M56A 4M77G 2VXFA 3MHXA 2PVGB 3CCQT 1YHQT
chains in the Genus database with same CATH topology
4MMLA 5LJ5h 4C8QF 3CC7A 3JB9H 2KK4A 2EWNA 3TREA 2JZ2A 5CCAA 2QDYB 2GFUA 4GLKA 5KCHA 3G4SA 1VQ5A 2DTHA 2QQRA 5A2QE 3TCJA 2QTXA 3OYEA 3O8VA 1KQSS 4HCBA 3I56T 5CKEA 4ZN1A 1WNLA 2WACA 5GAN5 3LW5E 3FDRA 2RJDA 3OBWA 4QVDA 4FM4B 3GIBA 3HFOA 3NTHA 2D9TA 2VYTA 3P8DA 2E65A 4PLLA 5GMKi 3ZFJA 3I55A 2KQWA 4JRPA 3HKSA 4C8QA 3PMTA 4J6XA 2MF2A 1JJ2A 5GAMf 3OBYA 1UGPB 4ME7A 5LJ3h 3FJPA 3HRTA 5GAMg 5D6XA 2QQAA 3CXCS 4OB0B 1VQMT 4V2SA 3WVDB 5I2MA 1YIJA 3QXEB 5LJ3d 3URGA 3NTIA 1EIFA 2FB7A 2L3RA 1D3BB 5GAN2 5GAN4 1VQ6T 2MMPA 4II1A 5CQYA 1H3ZA 1UEBA 3E1SA 1VQLA 2QQ9A 1Q82U 1KC8C 5GAN8 3CCJT 3QKJA 4XTYA 4TVRA 3JB9F 1VUBA 5CQXA 4C92G 4XAXB 3JCMc 4J5YA 5D6WA 3S3MA 2P0KA 5GANf 4JUVA 1VQ9A 2FL7A 4C8QC 1M5Q1 3OYIA 1I5LA 2ZCFB 2LQKA 1NE8A 2ZPFB 4RG2A 4A4KA 2E5QA 3L42A 2ZPBB 2LNVA 1BYMA 2I2LA 4C5HA 4BD3A 3AHUA 1Q86C 4XU3A 3OYDA 4ZGEB 2QEXT 4KUDK 2XU8A 2RHIA 4BY6B 2F69A 3JB9D 2O01E 2CZ6B 1VQKT 2QXFA 1YJ9A 1YIJT 5EG2A 4M75C 2XI9A 2HQXA 1KD1C 4BI4A 4XTZA 3GF5A 3GPLA 1YITA 2DEQA 3PNWC 3RESA 3VV0A 4C5EA 5A0LA 2DXUA 1VQ8A 3OS5A 4C0GA 4MDWA 4BUGA 4HCCA 1Y71A 1TH7A 3JSCA 2XDBA 2RHZA 4M7AG 4OB2B 2KAFA 5CR2A 3V8LA 3R6OA 3NTKA 1NPPA 4M7AC 2M0OA 3GNGA 4F7UE 4DA4A 2X4WA 5GMKe 3QJYA 1VQOA 4PJOC 3OW2S 1W2BS 4M78E 1Q82C 1NJIC 3JCMb 4R55A 3CMAA 1IZ6A 2YHTA 4M7DA 5GAMh 3CCLT 4EMKA 1G5VA 3SDZA 5GANj 1LJOA 5CKHA 4PKCC 2EFIA 1U1TA 3QO3A 3G4ST 1VQ5T 4C92C 3JCMg 4ZN3A 5LL6S 1VQ4A 1DJ7B 1BI0A 2L89A 4L59A 3JCMd 3ASKA 2OTJT 3JCMf 4IKFA 1K8AC 4FL6A 5HY6A 1G3YA 1UGQB 1WPYA 4XU2A 4XU0A 3DLMA 2LTOA 4M7DE 1GXIE 4LD6A 5LJ3j 2R5MA 4FU6A 2DO3A 1M1KC 3OYKA 1BI1A 4MZMA 2GF7A 4O5VA 2LCLA 3OYNA 4R56A 2A3LA 3EFRA 1KHIA 1OI1A 3HFNA 1SSFA 5GANe 1N27A 4C5GA 4OVAA 2B8AA 3CCSA 2EKOA 2M1HA 3LGLA 1NJIU 3A5ZB 2RM4A 1VQ4T 1Y96B 3QBYA 2OTJA 3T9NA 1BIBA 3EAEA 3CMET 1KQ2A 4M78C 1PSFA 3BDUA 3N5BB 4C92B 5A0DA 2RO0A 2LCCA 2LDMA 5A0GA 2MWOA 2M9UA 4ZGJB 5LJ5j 4N0AC 3V7CA 5CVIA 2JTFA 3F70A 2XHCA 3M4YA 5FROA 1Y96A 2JNGA 5HKCA 3CEYA 4NL3A 5J3BA 3JAME 2QA4A 1VQ8T 1BIAA 3V8JA 3VYGA 2LC4A 2XIDA 3HRSA 1YJNA 3X26B 3OYCA 2DTIA 2R5AA 3V7RA 3OYBA 1VQNA 5FU6C 4A4EA 1M90U 3JCMW 2L8DA 2PQWA 3CCUA 2ZPGB 3RKXA 4Y91A 3C12A 5DLQE 3C94A 3JCMJ 1H641 1R8OB 1WGSA 2OAUA 3DB4A 3X20B 1KG1A 3J7AF 2LX9A 2HNIA 3M58A 1JRIA 3CC4A 4C8QE 3PIOA 4PL6A 2JOYA 2XDPA 2PUOB 4N4IA 2NLUA 3M57A 5I21A 4EMHA 1NPRA 2WSEE 3PMIA 3QUIA 4J8OA 5FU7C 4C0FA 4EMKB 4JJNK 5CO7A 3OYHA 2AHJB 4PLIA 1YJWT 3SD4A 5GMKj 2RHUA 2K5FA 3E9GA 4C92F 3KXTA 2DKGA 4IUTA 2MWPA 2CS7A 3E19A 2F5KA 3JCMe 3MEVA 1X75C 1YHQT 3MP8A 1BI3A 2VGNA 3CCVA 2HD0A 1YHQA 2Y90A 2V8JA 2OTLT 3DLLA 1QVPA 2V8IA 1G3TA 3MO8A 4JLGA 3LWHA 4PJOE 2EJGA 4XTUA 3VKIA 3CCST 3JB9J 3CXCA 4RG8A 1OYXA 1M90C 1KHCA 3CCEA 1U1SA 1ZBXA 2RI3A 3OYYA 4B9XA 4C8QB 4F7UG 4M75A 3RUXA 1X6OA 2X4YA 1ZQ1A 3GNFB 3HL8A 4CRIA 2RH2A 2G3RA 4JDSA 5CKFA 5HK0A 5GANg 5GANd 4PNOA 4QQGA 4J6WA 4MZPA 1IREB 3QDRB 2LT1A 3X25B 1Y7XA 2HAXA 4QQDA 1M8VA 3JCMQ 4JS5A 2O4XA 2XICA 4M78B 3I55T 1UB4A 2LQ8A 2OTLA 4FT4A 2VUBA 4XU1A 2YLCA 3OS0A 3A8MB 1K73C 4M7AA 1VQMA 2F5TX 5C6SA 1VQNT 4PJOA 3HHTB 4N4GA 2GQVA 2K5LA 3CBPA 3A8LB 3CCET 3OYGA 2E64A 4ATOA 3QYGB 3UDCA 4Q5WA 3H8ZA 1VQLT 4M7DG 4GY5A 2JTMA 4DQ2A 4M77F 3HPWA 1RI0A 3V8KA 1V29B 3JB9G 2BUDA 3J80E 1OZ2A 5GAOl 1N8RC 2MI6A 3UT1A 3M53A 1FX7A 1BKBA 2EJ9A 3M55A 3QZ5B 3JCMP 5FRMA 2BIVA 2RK1A 4FSXA 4J83A 4OMFB 1JBMA 3HRUA 3QHSA 4MZTA 3OW2A 3BFMA 1YJWA 3CCUT 2FHDA 1W2BA 1VQKA 5CK9A 2O4XB 3OYJA 1K9MU 3OSSC 4LDYA 3HSBA 4M75G 4XTVA 5GMKm 3CBMA 2WSCE 2HQEA 3G7ZA 1JB0E 2DXBA 1HK9A 3L2UA 2VGMA 3S3OA 3G71T 5KE2A 3JCMV 3SFMA 2C06A 4BY6C 4M75B 4ZTJA 4VUBA 3P8HA 5LJ5g 3BY7A 1S72A 4JS4A 1KQSA 4QW2A 5LJ5d 5GAOp 4J7IA 1VQOT 2DIGA 2YLBA 3A8HB 2EQUA 2FVUA 2LRQA 4X34A 3BW1A 3G6ET 4OGEA 5CIUA 5GAN3 4M77E 1VQPA 2K57A 2P0QA 2QI2A 3CCVT 4N0AA 3X28B 4M7AF 3SB2A 3CCMT 3M5AA 4M7AB 1QW1A 4NS5A 2KSSA 3ZBDA 3OY9A 3L1AA 5IN1A 1KC8U 4IUQA 3H6ZA 3PGGA 2K5IA 1AHJB 4FIBA 5I2SA 2P0PA 5HK3A 3G71A 3S3NA 2CKKA 3LYIA 2EQJA 4RCBA 4C8QG 4BE0A 4ZTFA 3KUFA 2RB6A 4LD9K 1N9SA 5GAN7 5LJ3g 3VUBA 5IT9E 2RI5A 2ZPIB 2DD4A 2QQBA 1VIFA 5AYFA 3QIIA 3L2RA 3G6EA 1Q86U 3HP9A 3QYHB 2RJEA 3L2WA 2DPPB 3QJ6A 4KULA 1XTDA 3SWNB 2EAYA 5GAMe 5GAOn 1WQ7A 4F7UF 1U8RA 1M1GA 4HCZA 4F7UB 2HBPA 5L8RE 4C92D 4E7HA 3MP1A 3QG1A 4PJOG 2GCXA 2DD5A 3QSUA 3CC2T 2K2VA 3UWNA 3OS2A 4Z02A 1VQ7T 2E1HA 5KE3A 2IG0A 4RKUE 4F7UA 4N4HA 2DXTA 4M78G 2ZGWA 2RJCA 1N9RA 3A8GB 4IURA 1B34B 4M75D 4OP0A 4XK8E 2WSFE 5FU7B 4PJOF 2XKOC 3WVEB 4A4GA 4C92E 4EMKC 3CD6A 2E70A 2QA4T 4M77A 5GAOr 4NL2A 4OF1A 4IUPA 2E12A 2K3XA 1G3SA 1S72T 4M7DB 1QP3A 2RJFA 5C0MA 3ZEHA 3RMQA 1NZ9A 4PJOD 4RMOA 4C8QD 3J81E 1KD1U 4M7AD 1LNXA 4D6WA 2RHYA 4HKEA 3CC2A 1VQPT 2MAMA 3MEAA 4QVCA 1VQ7A 1HXDA 1YI2T 4EPCA 3P8BB 2DTOA 3UPUA 2RI2A 4BI3A 2GFAA 3V7SA 5LJ5e 2EYQA 2RA2A 4B9WA 4E7JA 2BKDN 2DAQA 4IUUA 5FU6B 3RKYA 3CPFA 3GLXA 4A4FA 3CC4T 4E7IA 1M1KU 4C0DC 2LVMA 2XG8D 4A4HA 3DB3A 3GOXA 1D3BA 3LLRA 3OSVA 3PIPA 2D6FA 1PSEA 2K3YA 4C0ZA 2RHXA 1WJSA 3JB9I 4M77D 2XD0A 5GMKl 3M4GA 3SWNA 2XDDA 4LDVA 2Y4XA 2Y4YA 2ZZDA 3M54A 4M7DC 2KY9A 5D6YA 5CAIA 1VQ6A 2QQSA 5KCOA 2ZPEB 4UC4A 4HA8A 2CZ1B 3TEEA 3FRNA 2PVOB 1YI2A 4OGCA 1XOVA 4KBMB 3TU4K 5LJ3e 1WQWA 2H3JA 4Y28E 4ZGDB 4C92A 4JRQA 1VQ9T 4A54A 1K8AU 5GMKh 4ELYC 3M9QA 3CPWS 2DIQA 3LH0A 1B34A 1UGSB 3CCRT 2K4YA 2JVVA 2E10A 2XK0A 5GAMd 3LWIA 2DZ9A 2EQMA 4KT0E 1JJ2S 1X01A 4OB1B 4OB3B 5CKDA 3OYLA 2X4JA 2EIFA 2CZ0B 4P5NA 4DOVA 3C95A 1YBYA 1YCYA 3FLGA 3JRZA 3WXMB 5KH6A 3JCMh 5GAOq 3INZA 4L6V5 4L5GA 1FXXA 3PTAA 2FYKA 3MEUA 3NFCA 1QP2A 4BE2A 3RIRA 4BB7A 3Q1JA 2PUKB 4E7LA 4M7DF 3MEWA 3OA6A 4M78A 3E9FA 3L2QA 1N6AA 3CCLA 4BACA 1O9SA 5DLOA 3VUZA 1Q81C 3QZ9B 3CD6T 4A53A 4E7KA 1M4ZA 3RKWA 3OMCA 4J7FA 3VYHB 4E47A 3FEOA 1M1FA 5FLXE 4LDUA 3S6WA 1XNIA 3DKMA 1ZHIA 5IAYA 1QVGA 3GP8A 1MGQA 3ER0A 2DXCA 4DOWA 1XQHA 3META 1P92A 1UGRB 1M9SA 4C0DB 4BE1A 4JLIA 1QVFA 1VIEA 1G3WA 2PU9B 2R57A 3FIFA 4WF2A 4KUIA 4NOYA 4O6JA 1Y07A 3CBOA 2DJZA 3L2VA 3PT9A 4EMGA 1O75A 4LDXA 4LDWA 2E41A 3JCMX 2KVQG 3VU3C 4QQ6A 2M16A 1I8FA 2R58A 2PVDB 3LX7A 2CGHA 3EFSA 2KDSA 4M75F 5J26A 3QPHA 3CCRA 2V8KA 1MHNA 2VXEA 5GAOm 3OYAA 1K73U 4IUVA 4CI0C 2VV5A 3KBGA 3X24B 3I56A 3FC3A 1FWZA 1RL2A 3CMEA 4MMKA 3CCMA 3OMGA 4M77C 4BI8B 4C5IA 5GANh 1QVFS 3OYMA 1WJRA 4M78D 3MP6A 5GAMj 2D0QB 4M7AE 2X4XA 1Q7YC 3CPWA 4M7DD 3OYFA 3OQ5A 2JUFA 5LJ3f 4MDXA 2RK2A 3FB9A 1YJNT 2EJFA 3VJPA 2P4TA 1N8RU 3A8OB 1OZ3A 4QVZA 4XQ3A 4HT9A 4X9DA 2LT4A 2DK3A 4M78F 2RD1A 2QEXA 2DVEA 1Q81U 4RCCA 3CCQA 4BDYA 1YJ9T 2KMTA 4M75E 1KQ1A 4YTLA 3CCJA 5J39A 3CC7T 4ELZC 2JN0A 3OS1A 1K9MC 4BDZA 1YITT 1W4SA 2A7YA 2L5QA 2YRVA 4HT8A 2CZ7B 3LGFA 3BDLA 3MCAB 4JRKA 4XTWA 2VC8A 5FRNA 4FT2A 2E6NA 3OB9A 5M9OA 1LOJA 5GAN6 3M59A 4M77B 4EDUA 5LJ5f 3RERA 2CYZB 2IVWA 1WJQA 4J6YA 4X9CA 5DM7R 1QVGS 3ME9A 3SWNC 1BI2A 5DY9A 4JRIA 2DZCA 2EQKA 3C4SA 3RMSA 3PFSA 2X35A 3M56A 3L2ZA 4M77G 5CKBA 2VXFA 4XTXA 3CMAT 3MHXA 2PVGB 1Q7YU 3CCQT 1I81A 4PJOB 2ZPHB 1I4K1 2E6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM d;  4MML A;  1KQ2 A;  4M78 C;  2DZ9 A;  4C8Q F;  5LJ5 h;  3JB9 H;  3BDU A;  4C92 B;  4M75 B;  1X01 A;  2EWN A;  5LJ5 g;  3BY7 A;  5LJ5 j;  5LJ5 d;  5GAO p;  4N0A C;  3V7C A;  2DTH A;  2YLB A;  1Y96 A;  4NL3 A;  3BW1 A;  2QTX A;  1YCY A;  1BIA A;  5GAO q;  3JCM h;  3V8J A;  3INZ A;  4M77 E;  5GAN 3;  2K57 A;  2FYK A;  1WNL A;  5GAN 5;  4N0A A;  4QVD A;  4M7A F;  3GIB A;  3HFO A;  2DTI A;  3SB2 A;  3RIR A;  3V7R A;  2E65 A;  4M7A B;  4M7D F;  5GMK i;  3L1A A;  4M78 A;  3PGG A;  4C8Q A;  3JCM W;  4J6X A;  4RCB A;  4C8Q G;  3RKX A;  4Y91 A;  5GAM f;  5LJ3 h;  4A53 A;  2RB6 A;  3JCM J;  3FJP A;  1N9S A;  1H64 1;  5GAM g;  5GAN 7;  4V2S A;  5LJ3 g;  3RKW A;  5LJ3 d;  2HNI A;  1JRI A;  2FB7 A;  4C8Q E;  1D3B B;  5GAN 2;  5GAN 4;  5I21 A;  4EMH A;  5GAN 8;  3QUI A;  4XTY A;  4EMK B;  3JB9 F;  1MGQ A;  4C92 G;  3SWN B;  3JCM c;  2EAY A;  4J5Y A;  5GAM e;  1WQ7 A;  4F7U F;  4JUV A;  5GAN f;  4C8Q C;  5GMK j;  1M5Q 1;  5GAO n;  4C92 F;  4F7U B;  4JLI A;  3JB9 J;  1I5L A;  2DKG A;  4C92 D;  1BIB A;  3FIF A;  4WF2 A;  4NOY A;  4PJO G;  2I2L A;  3JCM e;  2DJZ A;  3QSU A;  3AHU A;  4XU3 A;  4EMG A;  2Y90 A;  2E41 A;  2E1H A;  3JCM X;  3VU3 C;  3JB9 D;  1I8F A;  4F7U A;  4PJO E;  4M75 C;  2DXT A;  2EJG A;  4M78 G;  2ZGW A;  4M75 D;  1N9R A;  2CGH A;  4OP0 A;  1B34 B;  4XTU A;  3EFS A;  4XTZ A;  4M75 F;  4PJO F;  4C92 E;  4EMK C;  2DEQ A;  3RES A;  1U1S A;  4M77 A;  5GAO r;  2DXU A;  4NL2 A;  4C8Q B;  2VXE A;  4F7U G;  5GAO m;  4M75 A;  3RUX A;  1TH7 A;  4M7D B;  5GAN d;  4M7A G;  5GAN g;  4MMK A;  4PNO A;  4J6W A;  4M77 C;  3V8L A;  4M7A C;  5GAN h;  4F7U E;  4PJO D;  4C8Q D;  5GMK e;  4M7A D;  4PJO C;  1LNX A;  4M78 E;  4M78 D;  5GAM j;  3JCM Q;  3JCM b;  4M7A E;  4M78 B;  4QVC A;  4M7D D;  1M8V A;  2YHT A;  5LJ3 f;  4M7D A;  5GAM h;  1HXD A;  3FB9 A;  4XU1 A;  2YLC A;  2EJF A;  2DTO A;  4EMK A;  5GAN j;  4M7A A;  3V7S A;  5LJ5 e;  1LJO A;  2RA2 A;  4PJO A;  4XQ3 A;  3RKY A;  4HT9 A;  4X9D A;  1U1T A;  3QO3 A;  4M7D G;  2E64 A;  4M78 F;  2RD1 A;  1D3B A;  2DVE A;  3JCM g;  4RCC A;  4C92 C;  4DQ2 A;  3JCM d;  4M77 F;  3JCM f;  3V8K A;  4M75 E;  1KQ1 A;  3JB9 I;  4M77 D;  3JB9 G;  2JN0 A;  5GMK l;  4HT8 A;  3M4G A;  1WPY A;  4XU2 A;  4XU0 A;  5GAO l;  4M7D E;  3SWN A;  4JRK A;  4XTW A;  5LJ3 j;  4M7D C;  2VC8 A;  2EJ9 A;  3JCM P;  5CAI A;  1LOJ A;  4HA8 A;  5GAN 6;  1JBM A;  4M77 B;  5LJ5 f;  3RER A;  3JCM V;  4J6Y A;  3QHS A;  4X9C A;  3BFM A;  3SWN C;  5DY9 A;  5LJ3 e;  1WQW A;  4JRI A;  2DZC A;  3EFR A;  3HFN A;  4C92 A;  5GAN e;  4A54 A;  5GMK h;  3HSB A;  4M75 G;  4XTV A;  3L2Z A;  4M77 G;  5GMK m;  2VXF A;  4XTX A;  1B34 A;  1HK9 A;  2RM4 A;  1I81 A;  1Y96 B;  4PJO B;  1I4K 1;  2E10 A; 
#chains in the Genus database with same CATH topology
 4MML A;  3CC7 A;  1QKW A;  4C8Q F;  3JB9 H;  2KK4 A;  2EWN A;  3TRE A;  1OOT A;  5CCA A;  1OPK A;  1VQ5 A;  2D1X A;  3EG1 A;  2YRD A;  1KQS S;  4HCB A;  3I56 T;  3VRZ A;  1WNL A;  3LW5 E;  2RJD A;  2DE0 X;  3GIB A;  3NTH A;  3P8D A;  2E65 A;  3ZFJ A;  1RAI B;  4C8Q A;  2F2V A;  4J6X A;  1LPL A;  1JJ2 A;  5GAM f;  3OBY A;  4E7S A;  5D6X A;  1ACM B;  2AIR B;  1VQM T;  5I2M A;  5LJ3 d;  3URG A;  4II1 A;  3E1S A;  1KC8 C;  5IXB A;  1VUB A;  4C92 G;  3JCM c;  4J5Y A;  5GAN f;  1VQ9 A;  2LQK A;  2MK5 A;  4RG2 A;  1AOJ A;  3L42 A;  4RTX A;  2LNV A;  4BD3 A;  1Q86 C;  4J9D A;  4ZGE B;  2QEX T;  2XU8 A;  4BY6 B;  3JB9 D;  2QXF A;  1YJ9 A;  1ZSZ B;  1GBQ A;  1TSF A;  3PNW C;  3VV0 A;  4C5E A;  3OS5 A;  4MDW A;  4BUG A;  1IO6 A;  2LP5 A;  5HCK A;  2KRO A;  2RHZ A;  4OB2 B;  4Z89 A;  1UHF A;  1Y57 A;  3NTK A;  1T0H A;  3EG9 A;  1VQO A;  4PJO C;  2CT3 A;  3QJY A;  3QWX X;  4R55 A;  1SPK A;  2YHT A;  1G5V A;  3EHQ A;  3SDZ A;  1VA7 A;  4PJN A;  2SRC A;  2EKH A;  3G4S T;  3EFO A;  4ZN3 A;  5LL6 S;  1DJ7 B;  2L89 A;  3JCM f;  4IKF A;  1WPY A;  1UGQ B;  2HBW A;  4PJM A;  3EGX B;  2DL7 A;  2DYB A;  1Q95 G;  2X3W D;  2LCL A;  4R56 A;  2A3L A;  3EGX A;  1U06 A;  2DL5 A;  2M1H A;  3LGL A;  2RM4 A;  5GJW B;  1QCN A;  4M78 C;  4C92 B;  5A0D A;  1VQ4 Q;  2RO0 A;  2LDM A;  1RLQ C;  3F70 A;  2XHC A;  2HKQ B;  3M4Y A;  1Y96 A;  2JNG A;  1PC0 A;  1NYG A;  3VYG A;  1YJN A;  1WLP B;  3X26 B;  2PNI A;  2DTI A;  3V7R A;  1ZUK A;  2J6K A;  2JM9 A;  2ZPG B;  3C12 A;  2LX7 A;  1M3A A;  1ABO A;  5DLQ E;  1H64 1;  1R8O B;  1WGS A;  1NYF A;  2HNI A;  4LE9 A;  2NLU A;  2RN8 A;  2LJ0 A;  2X51 A;  3M57 A;  5I21 A;  2WSE E;  4J8O A;  4C0F A;  2CRE A;  4R0K A;  1YJW T;  5KYW B;  1UJY A;  4C92 F;  1W70 A;  2CP2 A;  1YHQ A;  2VGN A;  2HD0 A;  3EG2 A;  2OTL T;  3DLL A;  2CDT A;  1G3T A;  3LWH A;  1ARK A;  4XTU A;  2EBP A;  1OYX A;  1KHC A;  1PD0 A;  4JZ4 A;  1U1S A;  1R0C B;  2YSQ A;  4B9X A;  4C8Q B;  1PHT A;  4F7U G;  1KFZ A;  2QGF B;  3RUX A;  2EGC A;  2FRW A;  5GAN d;  3HL8 A;  4JDS A;  5CKF A;  4MZP A;  2K79 A;  3QDR B;  2LT1 A;  1M1K R;  2YWW A;  1Y7X A;  2HAX A;  1Y0M A;  4JS5 A;  1SF9 A;  2LQ8 A;  4FT4 A;  2VUB A;  4XU1 A;  4JJB A;  2F1L A;  3A8M B;  1K73 C;  4M7A A;  2KNB B;  1VQN T;  2KYB A;  3HHT B;  3CCE T;  3TSZ A;  2E64 A;  4ATO A;  2LJ3 A;  4DQ2 A;  2CUB A;  2QAS A;  4M77 F;  2BUD A;  2DL3 A;  2GGR A;  1TXQ A;  5IHN A;  3M53 A;  4J83 A;  5IHI A;  4MZT A;  3G6E Q;  2GTO A;  1SHF A;  5CK9 A;  2HKN A;  4Z8A A;  2L0A A;  2EPD A;  1HK9 A;  3L2U A;  2C0T A;  2VGM A;  3G71 Q;  3SFM A;  2JS2 A;  3VS1 A;  4WTO B;  3M0S A;  4ZTJ A;  4VUB A;  3BY7 A;  4Z88 A;  4JS4 A;  1QWF A;  1F1B B;  1T0J A;  4M7A F;  3M5A A;  3A98 A;  5IN1 A;  1KC8 U;  3H6Z A;  4FIB A;  3G71 A;  3S3N A;  2CKK A;  2KR3 A;  4ZTF A;  2RB6 A;  5GAN 7;  4AG1 C;  1Q86 U;  3QYH B;  4CC4 B;  1VYT A;  5FWC A;  1W6X A;  1M1G A;  4HCZ A;  4F7U B;  5D7U A;  4PJO G;  2GCX A;  3RBB B;  2DD5 A;  3CC2 T;  2G6F X;  3RNJ A;  1VQ7 T;  4E6R A;  3H0F A;  1VYU A;  4F7U A;  2DVJ A;  4A4G A;  4EMK C;  3WVE B;  2QA4 T;  2LJ1 A;  4M7D B;  1JQQ A;  5GJV B;  3I5R A;  4PJO D;  4M7A D;  4D6W A;  2RHY A;  4HKE A;  1VQP T;  1NEG A;  1W1F A;  1VQ7 A;  2DJQ A;  3CC4 Q;  1M8M A;  1R0B G;  3I55 Q;  4B9W A;  2BKD N;  2RPN A;  4IUU A;  4E7I A;  3HTR A;  2KRN A;  3AT1 B;  3LLR A;  3PIP A;  1ZSZ A;  2K3Y A;  1K9M R;  2XD0 A;  5GMK l;  2GQI A;  1E6G A;  1WDX A;  3SWN A;  4M7D C;  1OEB A;  5CAI A;  5KCO A;  1WIE A;  4PK4 A;  2DF6 A;  3I9Q A;  1OX8 A;  5LJ3 e;  1IGU A;  1T3S A;  4Y28 E;  4DBF A;  2DM1 A;  2F2W A;  5GAM d;  1KD1 R;  3LWI A;  1RAA B;  4KT0 E;  2QAZ A;  1VQ8 Q;  4OB1 B;  4OB3 B;  5CKD A;  1RAC B;  4P5N A;  1SRM A;  3JRZ A;  1YCY A;  2JJ9 A;  3JCM h;  2FYK A;  3NFC A;  4IIO A;  2PUK B;  5DLO A;  1G83 A;  3RKW A;  1VQL Q;  4E47 A;  1TUC A;  8ATC B;  2KXD A;  3CCU Q;  1P92 A;  1QVF A;  4JLI A;  2JM8 A;  1VIE A;  2R57 A;  4DBH A;  4WF2 A;  4NOY A;  2YRC A;  2IPO B;  4LDX A;  2F2X A;  2KVQ G;  4QQ6 A;  1I8F A;  1UDL A;  3I5S A;  2R58 A;  3VS7 A;  5J26 A;  4M75 F;  3CCR A;  3G4S Q;  1M90 R;  2CT4 A;  1X69 A;  3OYA A;  1K73 U;  1AWJ A;  2FZC B;  4FCY A;  1D09 B;  1QVF S;  3EHR A;  4M78 D;  1UJ0 A;  1UGV A;  3OQ5 A;  1EX4 A;  2EJF A;  1ZLM A;  5FWB A;  2DET A;  1OZ3 A;  8AT1 B;  1N5Z A;  3FJ5 A;  3CCJ Q;  3VS2 A;  4ELZ C;  2JN0 A;  3TVT A;  3OS1 A;  2C0I A;  4BDZ A;  1YIT T;  2CZ7 B;  9ATC B;  2LQN A;  1QMC A;  2K2M A;  4FT2 A;  3OB9 A;  4K11 A;  1X6B A;  4M77 B;  2CYZ B;  4KGV B;  3NPF A;  4JRI A;  3TSW A;  3RMS A;  2X35 A;  2RMO A;  3L2Z A;  4X1V A;  1Q7Y U;  1I81 A;  3CME Q;  4AG2 C;  2JZ2 A;  2QDY B;  2DBK A;  2GFU A;  1K4U S;  1V76 A;  2QTX A;  4AFQ C;  2E4H A;  5CKE A;  4ZN1 A;  1WZO A;  3OBW A;  4B6M A;  4QVD A;  3CMA Q;  2RQT A;  4PLL A;  4HVW A;  5GMK i;  2KQW A;  3PMT A;  2HSP A;  2HL5 C;  1UGP B;  1MMD A;  1PKS A;  4J9I A;  4OB0 B;  3WVD B;  3NTI A;  1EZZ B;  1EIF A;  2FB7 A;  2L3R A;  1WHG A;  1D3B B;  1YIT Q;  1OU8 A;  1B07 A;  4XTY A;  3JB9 F;  5CQX A;  3S3M A;  1HYO A;  2P0K A;  3OYI A;  1AEY A;  4D8K A;  2ZPF B;  1Q82 R;  2E5Q A;  3M0U A;  1NBE B;  4C5H A;  3AHU A;  3M0P A;  4XU3 A;  3OYD A;  4KUD K;  1T3L A;  3D7S B;  2CZ6 B;  1VQK T;  1YIJ T;  4M75 C;  2KEA A;  4BI4 A;  1YIT A;  3GPL A;  2CP6 A;  5A0L A;  2DXU A;  1IHV A;  2BZY A;  3MJX A;  4C0G A;  3JSC A;  2MPX C;  5CR2 A;  2KYM A;  3V8L A;  1NPP A;  1YWO A;  4M7A C;  5KYX A;  5GMK e;  1W2B S;  4M78 E;  2A28 A;  1NJI C;  3CMA A;  1IZ6 A;  2KBT A;  2HQH A;  5GAM h;  4EMK A;  3VS4 A;  5IH2 A;  4PKC C;  2EFI A;  3CPW P;  1VQ4 A;  3JCM d;  3ASK A;  1UEC A;  4KH1 B;  4F04 B;  4FL6 A;  5HY6 A;  1G3Y A;  4LD6 A;  2COW A;  1OQK A;  2HEQ A;  3EFR A;  1OI1 A;  3CC2 Q;  1N27 A;  2M02 A;  3CCS A;  1QWE A;  2OTJ A;  1Y96 B;  3T9N A;  3EAE A;  1KQ2 A;  2LCC A;  2OJ2 A;  1D0Z A;  1ZBJ A;  2JTF A;  1BBZ A;  4NL3 A;  3CEY A;  2QA4 A;  2RQR A;  2JMA A;  3HRS A;  2R5A A;  4F17 A;  1YIJ Q;  1VQN A;  1B7T A;  5KYN A;  3JCM W;  3RKX A;  3C94 A;  2OAU A;  2EVR A;  1ABQ A;  2LX9 A;  1S1N A;  4OML A;  3PIO A;  1RAD B;  4CC7 A;  2XDP A;  2PUO B;  4EMH A;  3QUI A;  2IIM A;  2FZG B;  3EH2 A;  1GL5 A;  2MWP A;  2L3S A;  3E19 A;  2F5K A;  1X75 C;  3MP8 A;  3CCV A;  2Y90 A;  2V8I A;  4OMO A;  2EJG A;  1OV3 A;  1ZUU A;  4RG8 A;  4ZNX A;  1AWO A;  1WFW A;  4FYX B;  2ENM A;  1ZQ1 A;  2J6F A;  5KYY B;  5HK0 A;  2G3R A;  2VB6 A;  1IRE B;  2K6D A;  2QTV A;  4QQD A;  1M8V A;  2DFU A;  4M78 B;  1M27 C;  3CD6 Q;  1YI2 Q;  3OS0 A;  2A37 A;  1OPL A;  2NWM A;  4N4G A;  2EGE A;  2K5L A;  2VVK A;  4M7D G;  1NM7 A;  3QYG B;  2JTM A;  1YWP A;  4HVV A;  1X6G A;  3VS0 A;  5GAO l;  2EJ9 A;  3JCM P;  4FSX A;  3QHS A;  1W2B A;  2OTL Q;  2PTK A;  3OYJ A;  3HSB A;  5GMK m;  4E7Z A;  3CBM A;  3G7Z A;  1JB0 E;  2JTE A;  1PRL C;  2C06 A;  1I1J A;  5AT1 B;  4M75 B;  1QLY A;  1MNE A;  1S72 A;  3P8H A;  1FMK A;  5GAO p;  4J7I A;  2YLB A;  3A8H B;  2FVU A;  4OGE A;  5CIU A;  2YUO A;  1A0N B;  2P0Q A;  3CCV T;  1G2B A;  4RTW A;  3SB2 A;  1AWX A;  2M0Y A;  4NS5 A;  2KSS A;  3OY9 A;  2K5I A;  1AHJ B;  5I2S A;  2P0P A;  3CCL Q;  1JXO A;  2YXY A;  3VUB A;  1RAH B;  2RI5 A;  2ZPI B;  2RQW A;  2QQB A;  1VIF A;  5AYF A;  2RJE A;  1XTD A;  3SWN B;  1U8R A;  1WQ7 A;  2KT1 A;  3MP1 A;  2A08 A;  4JZ3 A;  3QSU A;  4J9B A;  3UWN A;  3OS2 A;  4Z02 A;  2E1H A;  2IG0 A;  4M78 G;  2RJC A;  1N9R A;  3A8G B;  3CCL T;  4PJO F;  2WSF E;  5FU7 B;  2E70 A;  4M77 A;  5GAO r;  4OF1 A;  4IUP A;  2DEU A;  2E12 A;  1GFC A;  1QP3 A;  1C0M A;  1IGQ A;  1UE9 A;  1NZ9 A;  1KD1 U;  1M3C A;  3CC2 A;  3MEA A;  4KRT A;  3UPU A;  1JU5 C;  4BI3 A;  2EYQ A;  1ZSG A;  2LMJ A;  3CC4 T;  3CPF A;  2KT8 A;  4A4F A;  1CKB A;  4C0D C;  4A4H A;  3GOX A;  3OSV A;  2K3B A;  2D6F A;  1PSE A;  4C0Z A;  1NLO C;  3M4G A;  4LDV A;  2ZZD A;  1YCS B;  2QQS A;  2D8H A;  2PZ1 A;  2ZPE B;  4UC4 A;  2CZ1 B;  1C1A A;  2PVO B;  3FRN A;  1SSH A;  2AK5 A;  3TU4 K;  4ZGD B;  4C92 A;  1K8A U;  4ELY C;  4OMQ A;  1RAE B;  1EFN A;  2W10 A;  1B34 A;  3H0H A;  2CUD A;  3CCS Q;  2EQM A;  1X01 A;  4ESR A;  2EYY A;  1TOV A;  3OYL A;  2EIF A;  3I55 A;  1WHH A;  4LNP A;  2FZK B;  3MEU A;  3CCV Q;  1QP2 A;  3Q1J A;  4E7L A;  2KRM A;  3OA6 A;  3E9F A;  3CCL A;  1N6A A;  4FYW B;  1SRL A;  3OMC A;  4J7F A;  3I35 A;  5KYX B;  1M1F A;  3S6W A;  3PVL A;  3DKM A;  1VQO Q;  2DLP A;  1QVG A;  3ER0 A;  2DXC A;  4DOW A;  3MET A;  1UGR B;  1K1Z A;  1NJI R;  1M3B A;  3SHW A;  4ORZ A;  1RUW A;  1Y07 A;  3CBO A;  1D1C A;  3KFV A;  4EMG A;  4LDW A;  3EGU A;  2COY A;  2O9S A;  2E3H A;  3EFS A;  5IHK A;  1MV0 B;  1X2K A;  2V8K A;  1RAB B;  2VV5 A;  3KBG A;  3FC3 A;  3I56 A;  2ROL A;  4MMK A;  2MYS A;  3OYM A;  3MP6 A;  5GAM j;  2DER A;  3CPW A;  3OYF A;  5LJ3 f;  2RK2 A;  3VJP A;  4DEY A;  3A8O B;  4XQ3 A;  2LT4 A;  3UF4 A;  1FMV A;  2RD1 A;  4AFU C;  2KMT A;  1QQJ A;  1KQ1 A;  1C6V X;  5J39 A;  4HT8 A;  2YRV A;  3MCA B;  2ABL A;  5FRN A;  2E6N A;  3M59 A;  1TG0 A;  2IVW A;  1NEB A;  5DM7 R;  1BI2 A;  2ESW A;  2DZC A;  2EQK A;  1Z9Z A;  3PFS A;  1Q81 R;  2BTT A;  5CKB A;  1TTH B;  4XTX A;  2ZPH B;  1I4K 1;  2E6Z A;  1MMN A;  2CH4 W;  1N8R R;  4OMN A;  5KCH A;  3TCJ A;  3MPU B;  2WAC A;  1RI9 A;  3HFO A;  2D9T A;  2VYT A;  2MCN A;  1K73 R;  3HKS A;  1AVZ C;  3HRT A;  5GAM g;  3CXC S;  4V2S A;  2K7A A;  1YIJ A;  3QXE B;  2CP7 A;  1RAF B;  2OAW A;  1VQ6 T;  2MMP A;  2ROT A;  5CQY A;  1Q82 U;  5GAN 8;  3QKJ A;  1KQS P;  1ZA1 B;  1U3O A;  5D6W A;  4JUV A;  2FL7 A;  1M5Q 1;  1I5L A;  2AKL A;  4ANJ A;  1K0S A;  1NE8 A;  1RLP C;  1BYM A;  2I2L A;  2QEX Q;  1SHG A;  1TUG B;  5EG2 A;  1VYV A;  1KD1 C;  1PWT A;  4XTZ A;  1YFN A;  3RES A;  2FO0 A;  4QKU A;  1Y71 A;  1TH7 A;  2XDB A;  4M7A G;  2KAF A;  2LNH B;  4DA4 A;  2X4W A;  1K0X A;  3OW2 S;  2AT1 B;  1WX6 A;  4M7D A;  1YJN Q;  2L3Q A;  2BZX A;  1LJO A;  4JJC A;  2LQW A;  5CKH A;  1PNJ A;  1U1T A;  3QO3 A;  4C92 C;  3JCM g;  4L59 A;  1BI0 A;  1PD1 A;  2H8H A;  1K8A C;  4XU2 A;  4M7D E;  3DLM A;  2O2O A;  3ULR B;  4FU6 A;  2DO3 A;  3OYK A;  1LCK A;  5I11 A;  1AZE A;  4O5V A;  3OYN A;  1UFF A;  1KHI A;  3HFN A;  4RTV A;  1SSF A;  5GAN e;  1NJI U;  3QBY A;  2VKN A;  3PVQ A;  1PRM C;  3CME T;  3BDU A;  3EG0 A;  5A0G A;  4PFZ A;  2LZ6 B;  1AWW A;  2M9U A;  4ZGJ B;  2NUT B;  5CVI A;  2FPD A;  5J3B A;  2RNA A;  3R6N A;  1BIA A;  1VQ6 Q;  3V8J A;  2LC4 A;  2XID A;  1GCQ A;  3OW2 P;  1M90 U;  1VOM A;  3CCM Q;  4PFO A;  3CCU A;  3JCM J;  1KG1 A;  3X20 B;  3EGD B;  3M58 A;  1JRI A;  3CC4 A;  4C8Q E;  4PL6 A;  1QVF P;  4Y92 A;  1YJ9 Q;  1NPR A;  1X27 A;  5FU7 C;  4JJN K;  5CO7 A;  2NUZ A;  3OYH A;  2XMF A;  4PLI A;  3SD4 A;  2DKG A;  2CSQ A;  1VQ9 Q;  1BI3 A;  1E6H A;  1Q86 R;  2H3E B;  1QVP A;  3MO8 A;  1SKU B;  1GBR A;  3CQT A;  2DMO A;  3VKI A;  3CXC A;  1MMG A;  1K76 A;  4FW2 A;  2QG9 B;  4M75 A;  2HCK A;  3VS6 A;  1X43 A;  1WXB A;  2X4Y A;  3GNF B;  1H92 A;  1D0Y A;  1JXM A;  3X25 B;  1M30 A;  2FG0 A;  3JCM Q;  2XIC A;  3CCQ Q;  2OTL A;  3EH1 A;  2DRK A;  1VQM A;  2F5T X;  4PJO A;  3ZL7 C;  3A8L B;  3OYG A;  5KYU B;  4Q5W A;  3H8Z A;  1VQL T;  4GY5 A;  1RI0 A;  1V29 B;  3J80 E;  1OZ2 A;  1N8R C;  2A36 A;  2CP0 A;  1WHJ A;  1WHM A;  3UT1 A;  1FX7 A;  1BKB A;  3M55 A;  2BIV A;  2RK1 A;  4OMF B;  1JBM A;  3OW2 A;  3BFM A;  2JS0 A;  3CCU T;  1BCO A;  2O4X B;  1K9M U;  3OSS C;  4LDY A;  4M75 G;  4XTV A;  2WSC E;  2HQE A;  2DXB A;  3S3O A;  2DYI A;  3G71 T;  5KE2 A;  4BY6 C;  1KQS A;  5LJ5 d;  4HXJ A;  1VQO T;  3E2U A;  2DIG A;  1NG2 A;  2EQU A;  3G6E T;  4X34 A;  3BW1 A;  2DBM A;  4GBQ A;  5EC7 A;  1KSW A;  3TQ7 P;  4N0A A;  1K9A A;  4RTU A;  2EYW A;  3ZBD A;  5HK3 A;  4A63 B;  3LYI A;  4BE0 A;  2B86 A;  4LD9 K;  4EIK A;  1JO8 A;  3UA7 A;  3QII A;  2CH4 A;  2DA9 A;  2DPP B;  3QJ6 A;  4KUL A;  1KIK A;  5GAM e;  5GAO n;  1G8X A;  2HBP A;  5L8R E;  4C92 D;  1NLP C;  4AFZ C;  1IHW A;  2K2V A;  2V1R A;  5FW9 A;  5KE3 A;  1UHC A;  2ATC B;  2DXT A;  3REB B;  2ZGW A;  4M75 D;  4OP0 A;  3J7A F;  1B34 B;  5IXF A;  2XKO C;  3A1P A;  2QDL A;  1ZX6 A;  1S72 Q;  4D8D A;  2D0N A;  2K3X A;  4LUD A;  1Z9Q A;  1AD5 A;  3RMQ A;  4GLM A;  3RDV A;  4RMO A;  4LUE A;  4C8Q D;  1UTI A;  2NUP B;  2MAM A;  4QVC A;  1HXD A;  1YI2 T;  3P8B B;  2DTO A;  2SEM A;  2RI2 A;  5LJ5 e;  4E7J A;  3EG9 B;  3RKY A;  1WXU A;  2LVM A;  3DB3 A;  1D3B A;  1YNZ A;  3LH5 A;  4M77 D;  2XDD A;  1KC8 R;  2Y4Y A;  3M54 A;  2KY9 A;  2EYZ A;  4CC3 A;  4HA8 A;  2YUN A;  2DNU A;  3REA B;  1YI2 A;  4OGC A;  1XOV A;  1YJW Q;  1I5O B;  4JRQ A;  1D1B A;  4JJD A;  3M9Q A;  2OX7 A;  3CCR T;  2JVV A;  2E10 A;  2E3I A;  2DZ9 A;  1VQN Q;  3M0Q A;  2O31 A;  3C95 A;  4IIM A;  3L2R A;  3PTA A;  3C0C A;  3INZ A;  1FXX A;  3RIR A;  2BE9 B;  3U23 A;  4M7D F;  3L2Q A;  2D8J A;  4J9H A;  1Q81 C;  3QZ9 B;  3CD6 T;  4A53 A;  2BZ8 A;  4E7K A;  3EG3 A;  3CCE Q;  5FLX E;  4LDU A;  1ZHI A;  2K9G A;  3M0R A;  1MGQ A;  1XQH A;  4C0D B;  1G3W A;  4E2F B;  4KUI A;  4KGZ B;  3L2V A;  1AT1 B;  2GTJ A;  2C0O A;  3VU3 C;  2M16 A;  1XJW B;  2QA4 Q;  1VQM Q;  3LX7 A;  2CGH A;  1R77 A;  3QPH A;  2NUT A;  2EYX A;  4RTT A;  4CI0 C;  3CME A;  1UG1 A;  1FWZ A;  1I07 A;  1RL2 A;  2J05 A;  2DRM A;  2OTJ Q;  2JXB A;  4M77 C;  4BI8 B;  2HL3 A;  4C5I A;  4AMC A;  1WJR A;  2D0Q B;  4M7A E;  4M7D D;  4MDX A;  1N8R U;  2P4T A;  4QVZ A;  4HT9 A;  2Z0W A;  1IXD A;  2DK3 A;  2QEX A;  2DVE A;  4BDY A;  3H41 A;  4M75 E;  3CCJ A;  1K9M C;  1QKX A;  1W4S A;  2A7Y A;  2I0N A;  2L5Q A;  2HSE B;  3LGF A;  4JRK A;  1IRX A;  2VC8 A;  2KXC A;  5M9O A;  5GAN 6;  2CSI A;  4X9C A;  2J6O A;  4J6Y A;  1D1A A;  1QVG S;  3ME9 A;  2FEI A;  3C4S A;  3CMA T;  1BU1 A;  1YHQ Q;  4PJO B;  5LJ5 h;  1HJD A;  4J9G A;  4GLK A;  3G4S A;  2DTH A;  2QQR A;  5A2Q E;  3OYE A;  3O8V A;  2VAS A;  5GAN 5;  3FDR A;  2ED1 A;  4RUG A;  4FM4 B;  1Q7Y R;  1FMW A;  4JRP A;  2MF2 A;  4ME7 A;  5LJ3 h;  2KRS A;  3FJP A;  2QQA A;  3NHN A;  1QCO A;  2GNC A;  4KH0 B;  1WHK A;  2A0F B;  3SEM A;  2KI7 A;  5GAN 2;  2L3P A;  4PFP A;  5GAN 4;  1H3Z A;  1MMA A;  1UEB A;  1VQL A;  2QQ9 A;  3CCJ T;  4TVR A;  4XAX B;  4C8Q C;  2ZCF B;  1MND A;  4FSS A;  3VRY A;  4A4K A;  2ZPB B;  4J9C A;  2RHI A;  2F69 A;  2O01 E;  1LVK A;  2XI9 A;  2HQX A;  1D0X A;  3GF5 A;  2DEQ A;  1VQ8 A;  4HCC A;  3R6O A;  3I56 Q;  2M0O A;  3GNG A;  4F7U E;  2JT4 A;  1Q82 C;  3JCM b;  2GBQ A;  3O5Z A;  5GAN j;  3NMZ C;  4F16 A;  1ZUY A;  5I22 A;  1VQ5 T;  2OTJ T;  2V1Q A;  4XU0 A;  1GXI E;  3VS3 A;  2LTO A;  5LJ3 j;  2RF0 A;  3H9N A;  2R5M A;  3MKD A;  1M1K C;  1TUD A;  1BI1 A;  4MZM A;  2GF7 A;  1WHL A;  1VQ7 Q;  2FRY A;  2NUP A;  4FYV B;  2RQV A;  4C5G A;  4OVA A;  2B8A A;  2EKO A;  1PG5 B;  3A5Z B;  1VQ4 T;  1GRI A;  1BIB A;  1PSF A;  3N5B B;  2VWF A;  3EFO B;  1QVG P;  2MWO A;  5LJ5 j;  4N0A C;  3V7C A;  1WYX A;  3QWY A;  3H0I A;  3QDF A;  4RTY A;  5FRO A;  1Q81 U;  5HKC A;  1VQ8 T;  2HDA A;  3JAM E;  5KYY A;  2HMA A;  3OYC A;  3OYB A;  1TS9 A;  5FU6 C;  4A4E A;  2QYZ A;  1W2B P;  2L8D A;  2PQW A;  4Y91 A;  1H8K A;  4J9E A;  3DB4 A;  2MOX A;  5KYU A;  5ECA A;  2JOY A;  4N4I A;  2OI3 A;  3PMI A;  2BE7 D;  4EMK B;  2AHJ B;  5GMK j;  1BB9 A;  1HSQ A;  2RHU A;  2K5F A;  3E9G A;  3KXT A;  4IUT A;  2CS7 A;  2ECZ A;  4DBR A;  7AT1 B;  2MIO A;  3JCM e;  3MEV A;  2FPF A;  1BK2 A;  2V8J A;  2EGA A;  1VQP Q;  4JLG A;  4PJO E;  4F14 A;  3CCS T;  3JB9 J;  1M90 C;  3CCE A;  3NGP A;  1ZBX A;  2RI3 A;  3OYY A;  4FW1 A;  2O9V A;  1X6O A;  4CRI A;  2RH2 A;  5GAN g;  4PNO A;  4QQG A;  4FYY B;  2JW4 A;  4J6W A;  2YUP A;  1QCF A;  2O4X A;  3I55 T;  5KYW A;  1UB4 A;  3CCR Q;  2YLC A;  4LN2 A;  1SG5 A;  5C6S A;  3VS5 A;  2GQV A;  3CBP A;  2LCS A;  1KK7 A;  4CC2 A;  3UDC A;  4WCI A;  3HPW A;  3V8K A;  1K8A R;  3JB9 G;  3UA6 A;  2MI6 A;  4OMM A;  5FRM A;  3QZ5 B;  3HRU A;  3M0T A;  4QT7 A;  1YJW A;  2FHD A;  2YT6 A;  2P84 A;  1VQK A;  1RAG B;  1WA7 A;  1ZA2 B;  1TWB A;  4RTZ A;  3JCM V;  4M4Z A;  4DBQ A;  1OX9 A;  1IB8 A;  4HCK A;  5LJ5 g;  4QW2 A;  2ZAE A;  2LRQ A;  2DIL A;  2FPE A;  5GAN 3;  4M77 E;  1VQP A;  2K57 A;  2QI2 A;  3X28 B;  2AKK A;  1J3T A;  2M51 A;  3IQL A;  4M7A B;  3CCM T;  1QW1 A;  2YDL A;  3L1A A;  4IUQ A;  2HZY A;  3PGG A;  3CXC P;  1GCQ C;  4RCB A;  2EQJ A;  4C8Q G;  2EW3 A;  3KUF A;  1N9S A;  2X9H A;  5LJ3 g;  1PKT A;  2JMC A;  4J9F A;  5IT9 E;  2DD4 A;  1GCP A;  3G6E A;  3HP9 A;  3L2W A;  2EAY A;  4F7U F;  1U5S A;  4E7H A;  4AFS C;  3QG1 A;  2QK0 A;  1CKA A;  4JPB W;  4RKU E;  4N4H A;  4IUR A;  4XK8 E;  4C92 E;  1JEG A;  1JJ2 P;  3CD6 A;  4NL2 A;  1G3S A;  1S72 T;  2RJF A;  5C0M A;  3ZEH A;  3J81 E;  2W0Z A;  1LNX A;  1YP5 A;  1WI7 A;  1GFD A;  1BCM A;  2O88 A;  3G1J A;  4EPC A;  2RQU A;  2GFA A;  3V7S A;  2RA2 A;  2DAQ A;  5FU6 B;  3GLX A;  1M1K U;  1PM3 A;  2XG8 D;  2RHX A;  1WJS A;  3JB9 I;  3UAT A;  3PE0 A;  4OMP A;  2Y4X A;  5D6Y A;  1VQ6 A;  1YN8 A;  2V26 A;  2CP3 A;  3TEE A;  4KBM B;  1WQW A;  2AZS A;  2H3J A;  3BE3 A;  1VQ9 T;  2NYS A;  1ZSZ C;  4A54 A;  5GMK h;  2DIQ A;  3LH0 A;  1UGS B;  2K4Y A;  4HVU A;  2XK0 A;  1JJ2 S;  1FYN A;  2DX1 A;  2X4J A;  2CZ0 B;  1OU9 A;  4DOV A;  2AZV A;  1YBY A;  3FLG A;  5KH6 A;  3WXM B;  5GAO q;  3CPW S;  2DL4 A;  4L6V 5;  2J7I A;  4L5G A;  4KGX B;  4LXC A;  4BE2 A;  4BB7 A;  3THK A;  3MEW A;  1OUL A;  4M78 A;  4BAC A;  1PCX A;  1O9S A;  2KE9 A;  2QGG A;  3VUZ A;  2DL8 A;  3RR6 A;  1B3Q A;  1M4Z A;  4AT1 B;  5L23 A;  2J06 A;  3VYH B;  3FEO A;  2EQI A;  1XNI A;  2L2P A;  2CP5 A;  5IAY A;  1CSK A;  3GP8 A;  2YUQ A;  1M9S A;  4BE1 A;  4PJL A;  2PU9 B;  1UUE A;  4PJJ A;  3FIF A;  4O6J A;  2DJZ A;  3PT9 A;  1O75 A;  2E41 A;  3JCM X;  6AT1 B;  2PVD B;  2COZ A;  2KDS A;  1VQK Q;  1H3H A;  1VQ5 Q;  3EGD A;  1MHN A;  1X2Q A;  2VXE A;  5GAO m;  4IUV A;  3CC7 Q;  3X24 B;  2P4R A;  3GBQ A;  3JV3 A;  3CCM A;  3OMG A;  1V1C A;  5GAN h;  2X3X D;  2X4X A;  2E5K A;  1Q7Y C;  2JUF A;  3FB9 A;  1YJN T;  1WXT A;  1TU0 B;  1KJW A;  4X9D A;  2KGT A;  4M78 F;  4RCC A;  3CCQ A;  1YJ9 T;  4YTL A;  1M2V B;  1SEM A;  3CC7 T;  1I0C A;  3BDL A;  4DEX A;  4XTW A;  1HD3 A;  1MV3 A;  1E7O A;  1LOJ A;  4EDU A;  5LJ5 f;  3RER A;  1AZG B;  1M2V A;  1WJQ A;  3SWN C;  5DY9 A;  1MUZ A;  2ED0 A;  1M2O A;  3M56 A;  4M77 G;  2VXF A;  3MHX A;  2PVG B;  3CCQ T;  1YHQ T; 
#chains in the Genus database with same CATH homology
 4MML A;  5LJ5 h;  4C8Q F;  3CC7 A;  3JB9 H;  2KK4 A;  2EWN A;  3TRE A;  2JZ2 A;  5CCA A;  2QDY B;  2GFU A;  4GLK A;  5KCH A;  3G4S A;  1VQ5 A;  2DTH A;  2QQR A;  5A2Q E;  3TCJ A;  2QTX A;  3OYE A;  3O8V A;  1KQS S;  4HCB A;  3I56 T;  5CKE A;  4ZN1 A;  1WNL A;  2WAC A;  5GAN 5;  3LW5 E;  3FDR A;  2RJD A;  3OBW A;  4QVD A;  4FM4 B;  3GIB A;  3HFO A;  3NTH A;  2D9T A;  2VYT A;  3P8D A;  2E65 A;  4PLL A;  5GMK i;  3ZFJ A;  3I55 A;  2KQW A;  4JRP A;  3HKS A;  4C8Q A;  3PMT A;  4J6X A;  2MF2 A;  1JJ2 A;  5GAM f;  3OBY A;  1UGP B;  4ME7 A;  5LJ3 h;  3FJP A;  3HRT A;  5GAM g;  5D6X A;  2QQA A;  3CXC S;  4OB0 B;  1VQM T;  4V2S A;  3WVD B;  5I2M A;  1YIJ A;  3QXE B;  5LJ3 d;  3URG A;  3NTI A;  1EIF A;  2FB7 A;  2L3R A;  1D3B B;  5GAN 2;  5GAN 4;  1VQ6 T;  2MMP A;  4II1 A;  5CQY A;  1H3Z A;  1UEB A;  3E1S A;  1VQL A;  2QQ9 A;  1Q82 U;  1KC8 C;  5GAN 8;  3CCJ T;  3QKJ A;  4XTY A;  4TVR A;  3JB9 F;  1VUB A;  5CQX A;  4C92 G;  4XAX B;  3JCM c;  4J5Y A;  5D6W A;  3S3M A;  2P0K A;  5GAN f;  4JUV A;  1VQ9 A;  2FL7 A;  4C8Q C;  1M5Q 1;  3OYI A;  1I5L A;  2ZCF B;  2LQK A;  1NE8 A;  2ZPF B;  4RG2 A;  4A4K A;  2E5Q A;  3L42 A;  2ZPB B;  2LNV A;  1BYM A;  2I2L A;  4C5H A;  4BD3 A;  3AHU A;  1Q86 C;  4XU3 A;  3OYD A;  4ZGE B;  2QEX T;  4KUD K;  2XU8 A;  2RHI A;  4BY6 B;  2F69 A;  3JB9 D;  2O01 E;  2CZ6 B;  1VQK T;  2QXF A;  1YJ9 A;  1YIJ T;  5EG2 A;  4M75 C;  2XI9 A;  2HQX A;  1KD1 C;  4BI4 A;  4XTZ A;  3GF5 A;  3GPL A;  1YIT A;  2DEQ A;  3PNW C;  3RES A;  3VV0 A;  4C5E A;  5A0L A;  2DXU A;  1VQ8 A;  3OS5 A;  4C0G A;  4MDW A;  4BUG A;  4HCC A;  1Y71 A;  1TH7 A;  3JSC A;  2XDB A;  2RHZ A;  4M7A G;  4OB2 B;  2KAF A;  5CR2 A;  3V8L A;  3R6O A;  3NTK A;  1NPP A;  4M7A C;  2M0O A;  3GNG A;  4F7U E;  4DA4 A;  2X4W A;  5GMK e;  3QJY A;  1VQO A;  4PJO C;  3OW2 S;  1W2B S;  4M78 E;  1Q82 C;  1NJI C;  3JCM b;  4R55 A;  3CMA A;  1IZ6 A;  2YHT A;  4M7D A;  5GAM h;  3CCL T;  4EMK A;  1G5V A;  3SDZ A;  5GAN j;  1LJO A;  5CKH A;  4PKC C;  2EFI A;  1U1T A;  3QO3 A;  3G4S T;  1VQ5 T;  4C92 C;  3JCM g;  4ZN3 A;  5LL6 S;  1VQ4 A;  1DJ7 B;  1BI0 A;  2L89 A;  4L59 A;  3JCM d;  3ASK A;  2OTJ T;  3JCM f;  4IKF A;  1K8A C;  4FL6 A;  5HY6 A;  1G3Y A;  1UGQ B;  1WPY A;  4XU2 A;  4XU0 A;  3DLM A;  2LTO A;  4M7D E;  1GXI E;  4LD6 A;  5LJ3 j;  2R5M A;  4FU6 A;  2DO3 A;  1M1K C;  3OYK A;  1BI1 A;  4MZM A;  2GF7 A;  4O5V A;  2LCL A;  3OYN A;  4R56 A;  2A3L A;  3EFR A;  1KHI A;  1OI1 A;  3HFN A;  1SSF A;  5GAN e;  1N27 A;  4C5G A;  4OVA A;  2B8A A;  3CCS A;  2EKO A;  2M1H A;  3LGL A;  1NJI U;  3A5Z B;  2RM4 A;  1VQ4 T;  1Y96 B;  3QBY A;  2OTJ A;  3T9N A;  1BIB A;  3EAE A;  3CME T;  1KQ2 A;  4M78 C;  1PSF A;  3BDU A;  3N5B B;  4C92 B;  5A0D A;  2RO0 A;  2LCC A;  2LDM A;  5A0G A;  2MWO A;  2M9U A;  4ZGJ B;  5LJ5 j;  4N0A C;  3V7C A;  5CVI A;  2JTF A;  3F70 A;  2XHC A;  3M4Y A;  5FRO A;  1Y96 A;  2JNG A;  5HKC A;  3CEY A;  4NL3 A;  5J3B A;  3JAM E;  2QA4 A;  1VQ8 T;  1BIA A;  3V8J A;  3VYG A;  2LC4 A;  2XID A;  3HRS A;  1YJN A;  3X26 B;  3OYC A;  2DTI A;  2R5A A;  3V7R A;  3OYB A;  1VQN A;  5FU6 C;  4A4E A;  1M90 U;  3JCM W;  2L8D A;  2PQW A;  3CCU A;  2ZPG B;  3RKX A;  4Y91 A;  3C12 A;  5DLQ E;  3C94 A;  3JCM J;  1H64 1;  1R8O B;  1WGS A;  2OAU A;  3DB4 A;  3X20 B;  1KG1 A;  3J7A F;  2LX9 A;  2HNI A;  3M58 A;  1JRI A;  3CC4 A;  4C8Q E;  3PIO A;  4PL6 A;  2JOY A;  2XDP A;  2PUO B;  4N4I A;  2NLU A;  3M57 A;  5I21 A;  4EMH A;  1NPR A;  2WSE E;  3PMI A;  3QUI A;  4J8O A;  5FU7 C;  4C0F A;  4EMK B;  4JJN K;  5CO7 A;  3OYH A;  2AHJ B;  4PLI A;  1YJW T;  3SD4 A;  5GMK j;  2RHU A;  2K5F A;  3E9G A;  4C92 F;  3KXT A;  2DKG A;  4IUT A;  2MWP A;  2CS7 A;  3E19 A;  2F5K A;  3JCM e;  3MEV A;  1X75 C;  1YHQ T;  3MP8 A;  1BI3 A;  2VGN A;  3CCV A;  2HD0 A;  1YHQ A;  2Y90 A;  2V8J A;  2OTL T;  3DLL A;  1QVP A;  2V8I A;  1G3T A;  3MO8 A;  4JLG A;  3LWH A;  4PJO E;  2EJG A;  4XTU A;  3VKI A;  3CCS T;  3JB9 J;  3CXC A;  4RG8 A;  1OYX A;  1M90 C;  1KHC A;  3CCE A;  1U1S A;  1ZBX A;  2RI3 A;  3OYY A;  4B9X A;  4C8Q B;  4F7U G;  4M75 A;  3RUX A;  1X6O A;  2X4Y A;  1ZQ1 A;  3GNF B;  3HL8 A;  4CRI A;  2RH2 A;  2G3R A;  4JDS A;  5CKF A;  5HK0 A;  5GAN g;  5GAN d;  4PNO A;  4QQG A;  4J6W A;  4MZP A;  1IRE B;  3QDR B;  2LT1 A;  3X25 B;  1Y7X A;  2HAX A;  4QQD A;  1M8V A;  3JCM Q;  4JS5 A;  2O4X A;  2XIC A;  4M78 B;  3I55 T;  1UB4 A;  2LQ8 A;  2OTL A;  4FT4 A;  2VUB A;  4XU1 A;  2YLC A;  3OS0 A;  3A8M B;  1K73 C;  4M7A A;  1VQM A;  2F5T X;  5C6S A;  1VQN T;  4PJO A;  3HHT B;  4N4G A;  2GQV A;  2K5L A;  3CBP A;  3A8L B;  3CCE T;  3OYG A;  2E64 A;  4ATO A;  3QYG B;  3UDC A;  4Q5W A;  3H8Z A;  1VQL T;  4M7D G;  4GY5 A;  2JTM A;  4DQ2 A;  4M77 F;  3HPW A;  1RI0 A;  3V8K A;  1V29 B;  3JB9 G;  2BUD A;  3J80 E;  1OZ2 A;  5GAO l;  1N8R C;  2MI6 A;  3UT1 A;  3M53 A;  1FX7 A;  1BKB A;  2EJ9 A;  3M55 A;  3QZ5 B;  3JCM P;  5FRM A;  2BIV A;  2RK1 A;  4FSX A;  4J83 A;  4OMF B;  1JBM A;  3HRU A;  3QHS A;  4MZT A;  3OW2 A;  3BFM A;  1YJW A;  3CCU T;  2FHD A;  1W2B A;  1VQK A;  5CK9 A;  2O4X B;  3OYJ A;  1K9M U;  3OSS C;  4LDY A;  3HSB A;  4M75 G;  4XTV A;  5GMK m;  3CBM A;  2WSC E;  2HQE A;  3G7Z A;  1JB0 E;  2DXB A;  1HK9 A;  3L2U A;  2VGM A;  3S3O A;  3G71 T;  5KE2 A;  3JCM V;  3SFM A;  2C06 A;  4BY6 C;  4M75 B;  4ZTJ A;  4VUB A;  3P8H A;  5LJ5 g;  3BY7 A;  1S72 A;  4JS4 A;  1KQS A;  4QW2 A;  5LJ5 d;  5GAO p;  4J7I A;  1VQO T;  2DIG A;  2YLB A;  3A8H B;  2EQU A;  2FVU A;  2LRQ A;  4X34 A;  3BW1 A;  3G6E T;  4OGE A;  5CIU A;  5GAN 3;  4M77 E;  1VQP A;  2K57 A;  2P0Q A;  2QI2 A;  3CCV T;  4N0A A;  3X28 B;  4M7A F;  3SB2 A;  3CCM T;  3M5A A;  4M7A B;  1QW1 A;  4NS5 A;  2KSS A;  3ZBD A;  3OY9 A;  3L1A A;  5IN1 A;  1KC8 U;  4IUQ A;  3H6Z A;  3PGG A;  2K5I A;  1AHJ B;  4FIB A;  5I2S A;  2P0P A;  5HK3 A;  3G71 A;  3S3N A;  2CKK A;  3LYI A;  2EQJ A;  4RCB A;  4C8Q G;  4BE0 A;  4ZTF A;  3KUF A;  2RB6 A;  4LD9 K;  1N9S A;  5GAN 7;  5LJ3 g;  3VUB A;  5IT9 E;  2RI5 A;  2ZPI B;  2DD4 A;  2QQB A;  1VIF A;  5AYF A;  3QII A;  3L2R A;  3G6E A;  1Q86 U;  3HP9 A;  3QYH B;  2RJE A;  3L2W A;  2DPP B;  3QJ6 A;  4KUL A;  1XTD A;  3SWN B;  2EAY A;  5GAM e;  5GAO n;  1WQ7 A;  4F7U F;  1U8R A;  1M1G A;  4HCZ A;  4F7U B;  2HBP A;  5L8R E;  4C92 D;  4E7H A;  3MP1 A;  3QG1 A;  4PJO G;  2GCX A;  2DD5 A;  3QSU A;  3CC2 T;  2K2V A;  3UWN A;  3OS2 A;  4Z02 A;  1VQ7 T;  2E1H A;  5KE3 A;  2IG0 A;  4RKU E;  4F7U A;  4N4H A;  2DXT A;  4M78 G;  2ZGW A;  2RJC A;  1N9R A;  3A8G B;  4IUR A;  1B34 B;  4M75 D;  4OP0 A;  4XK8 E;  2WSF E;  5FU7 B;  4PJO F;  2XKO C;  3WVE B;  4A4G A;  4C92 E;  4EMK C;  3CD6 A;  2E70 A;  2QA4 T;  4M77 A;  5GAO r;  4NL2 A;  4OF1 A;  4IUP A;  2E12 A;  2K3X A;  1G3S A;  1S72 T;  4M7D B;  1QP3 A;  2RJF A;  5C0M A;  3ZEH A;  3RMQ A;  1NZ9 A;  4PJO D;  4RMO A;  4C8Q D;  3J81 E;  1KD1 U;  4M7A D;  1LNX A;  4D6W A;  2RHY A;  4HKE A;  3CC2 A;  1VQP T;  2MAM A;  3MEA A;  4QVC A;  1VQ7 A;  1HXD A;  1YI2 T;  4EPC A;  3P8B B;  2DTO A;  3UPU A;  2RI2 A;  4BI3 A;  2GFA A;  3V7S A;  5LJ5 e;  2EYQ A;  2RA2 A;  4B9W A;  4E7J A;  2BKD N;  2DAQ A;  4IUU A;  5FU6 B;  3RKY A;  3CPF A;  3GLX A;  4A4F A;  3CC4 T;  4E7I A;  1M1K U;  4C0D C;  2LVM A;  2XG8 D;  4A4H A;  3DB3 A;  3GOX A;  1D3B A;  3LLR A;  3OSV A;  3PIP A;  2D6F A;  1PSE A;  2K3Y A;  4C0Z A;  2RHX A;  1WJS A;  3JB9 I;  4M77 D;  2XD0 A;  5GMK l;  3M4G A;  3SWN A;  2XDD A;  4LDV A;  2Y4X A;  2Y4Y A;  2ZZD A;  3M54 A;  4M7D C;  2KY9 A;  5D6Y A;  5CAI A;  1VQ6 A;  2QQS A;  5KCO A;  2ZPE B;  4UC4 A;  4HA8 A;  2CZ1 B;  3TEE A;  3FRN A;  2PVO B;  1YI2 A;  4OGC A;  1XOV A;  4KBM B;  3TU4 K;  5LJ3 e;  1WQW A;  2H3J A;  4Y28 E;  4ZGD B;  4C92 A;  4JRQ A;  1VQ9 T;  4A54 A;  1K8A U;  5GMK h;  4ELY C;  3M9Q A;  3CPW S;  2DIQ A;  3LH0 A;  1B34 A;  1UGS B;  3CCR T;  2K4Y A;  2JVV A;  2E10 A;  2XK0 A;  5GAM d;  3LWI A;  2DZ9 A;  2EQM A;  4KT0 E;  1JJ2 S;  1X01 A;  4OB1 B;  4OB3 B;  5CKD A;  3OYL A;  2X4J A;  2EIF A;  2CZ0 B;  4P5N A;  4DOV A;  3C95 A;  1YBY A;  1YCY A;  3FLG A;  3JRZ A;  3WXM B;  5KH6 A;  3JCM h;  5GAO q;  3INZ A;  4L6V 5;  4L5G A;  1FXX A;  3PTA A;  2FYK A;  3MEU A;  3NFC A;  1QP2 A;  4BE2 A;  3RIR A;  4BB7 A;  3Q1J A;  2PUK B;  4E7L A;  4M7D F;  3MEW A;  3OA6 A;  4M78 A;  3E9F A;  3L2Q A;  1N6A A;  3CCL A;  4BAC A;  1O9S A;  5DLO A;  3VUZ A;  1Q81 C;  3QZ9 B;  3CD6 T;  4A53 A;  4E7K A;  1M4Z A;  3RKW A;  3OMC A;  4J7F A;  3VYH B;  4E47 A;  3FEO A;  1M1F A;  5FLX E;  4LDU A;  3S6W A;  1XNI A;  3DKM A;  1ZHI A;  5IAY A;  1QVG A;  3GP8 A;  1MGQ A;  3ER0 A;  2DXC A;  4DOW A;  1XQH A;  3MET A;  1P92 A;  1UGR B;  1M9S A;  4C0D B;  4BE1 A;  4JLI A;  1QVF A;  1VIE A;  1G3W A;  2PU9 B;  2R57 A;  3FIF A;  4WF2 A;  4KUI A;  4NOY A;  4O6J A;  1Y07 A;  3CBO A;  2DJZ A;  3L2V A;  3PT9 A;  4EMG A;  1O75 A;  4LDX A;  4LDW A;  2E41 A;  3JCM X;  2KVQ G;  3VU3 C;  4QQ6 A;  2M16 A;  1I8F A;  2R58 A;  2PVD B;  3LX7 A;  2CGH A;  3EFS A;  2KDS A;  4M75 F;  5J26 A;  3QPH A;  3CCR A;  2V8K A;  1MHN A;  2VXE A;  5GAO m;  3OYA A;  1K73 U;  4IUV A;  4CI0 C;  2VV5 A;  3KBG A;  3X24 B;  3I56 A;  3FC3 A;  1FWZ A;  1RL2 A;  3CME A;  4MMK A;  3CCM A;  3OMG A;  4M77 C;  4BI8 B;  4C5I A;  5GAN h;  1QVF S;  3OYM A;  1WJR A;  4M78 D;  3MP6 A;  5GAM j;  2D0Q B;  4M7A E;  2X4X A;  1Q7Y C;  3CPW A;  4M7D D;  3OYF A;  3OQ5 A;  2JUF A;  5LJ3 f;  4MDX A;  2RK2 A;  3FB9 A;  1YJN T;  2EJF A;  3VJP A;  2P4T A;  1N8R U;  3A8O B;  1OZ3 A;  4QVZ A;  4XQ3 A;  4HT9 A;  4X9D A;  2LT4 A;  2DK3 A;  4M78 F;  2RD1 A;  2QEX A;  2DVE A;  1Q81 U;  4RCC A;  3CCQ A;  4BDY A;  1YJ9 T;  2KMT A;  4M75 E;  1KQ1 A;  4YTL A;  3CCJ A;  5J39 A;  3CC7 T;  4ELZ C;  2JN0 A;  3OS1 A;  1K9M C;  4BDZ A;  1YIT T;  1W4S A;  2A7Y A;  2L5Q A;  2YRV A;  4HT8 A;  2CZ7 B;  3LGF A;  3BDL A;  3MCA B;  4JRK A;  4XTW A;  2VC8 A;  5FRN A;  4FT2 A;  2E6N A;  3OB9 A;  5M9O A;  1LOJ A;  5GAN 6;  3M59 A;  4M77 B;  4EDU A;  5LJ5 f;  3RER A;  2CYZ B;  2IVW A;  1WJQ A;  4J6Y A;  4X9C A;  5DM7 R;  1QVG S;  3ME9 A;  3SWN C;  1BI2 A;  5DY9 A;  4JRI A;  2DZC A;  2EQK A;  3C4S A;  3RMS A;  3PFS A;  2X35 A;  3M56 A;  3L2Z A;  4M77 G;  5CKB A;  2VXF A;  4XTX A;  3CMA T;  3MHX A;  2PVG B;  1Q7Y U;  3CCQ T;  1I81 A;  4PJO B;  2ZPH B;  1I4K 1;  2E6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...