2LX7A

Solution nmr structure of sh3 domain of growth arrest-specific protein 7 (gas7) (fragment 1-60) from homo sapiens, northeast structural genomics consortium (nesg) target hr8574a
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
MSGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGWFPASYVQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of SH3 domain of growth arrest-specific protein 7 (GAS7) (fragment 1-60) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8574A
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Growth arrest-specific protein 7
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lx7A00
1NLPC 1PNJA 2EYYA 4RTWA 3REBB 2DVJA 2A37A 3REAB 2EW3A 3H0FA 1UTIA 5IXBA 1BU1A 2EYWA 3QWXX 2J6KA 1E7OA 1X6BA 3PVLA 3SEMA 1NM7A 2FO0A 1GL5A 2DNUA 1I07A 2K79A 2YSQA 2CDTA 1PKSA 2D8HA 2LX7A 1YWPA 1YN8A 4J9BA 5L23A 2X3WD 4HVUA 4HXJA 4HVVA 2DMOA 2YUPA 1UJYA 1VYVA 4ORZA 1HJDA 2LCSA 1SHGA 4RTUA 2KROA 2P4RA 2F2WA 4LUEA 1B3QA 3TSWA 1JXOA 2DL5A 2D0NA 2IIMA 1PRLC 1X2QA 2J6OA 1OEBA 2EQIA 2YT6A 4DEYA 1GBQA 1YWOA 1IO6A 1XOVA 2ENMA 2KRNA 1X6GA 2EKHA 4ZNXA 2HEQA 1SEMA 2B86A 3VS6A 4JZ4A 1ARKA 1T0HA 2AKLA 3IQLA 4RTVA 1KIKA 4LUDA 1ZSGA 1JQQA 2L2PA 3VS7A 2RQTA 2SRCA 2K6DA 1UECA 1S1NA 1QKXA 1RI9A 1AWOA 1YNZA 3I35A 2G6FX 1E6HA 1A0NB 2BZXA 2LJ0A 3LH5A 3KFVA 4RTYA 4D8DA 2JS0A 1FYNA 1X69A 2SEMA 3UATA 1OOTA 4ESRA 2LQWA 1HSQA 1PKTA 1ZUKA 2L0AA 2A08A 4JJDA 5FWBA 3FJ5A 2J05A 5FWCA 4IIOA 1OV3A 2O88A 2YUNA 2NWMA 1UFFA 4FSSA 5IHIA 4X1VA 2L3SA 2O9SA 2DA9A 1GRIA 3I9QA 2D1XA 4A63B 1I1JA 1M8MA 4RTXA 4WCIA 2LJ1A 1Z9ZA 2CH4W 1AEYA 2LNHB 1QWEA 4IIMA 2DRMA 4CC7A 4AFSC 1U3OA 4D8KA 3VS3A 4F14A 2OI3A 2EVRA 2JS2A 4RUGA 3I5RA 2KNBB 1BK2A 3VS1A 2W0ZA 4Y92A 2CT4A 2KGTA 1I0CA 2MIOA 4F16A 1V1CA 2DBMA 1GFCA 1T0JA 1AZGB 1RLQC 1Z9QA 2RQUA 1QLYA 2VVKA 2KRMA 1Y0MA 2JTEA 3EGUA 3M0TA 5EC7A 1NEGA 2RNAA 1JO8A 3JV3A 2AKKA 1PWTA 2DL8A 1MUZA 2EGAA 2DL7A 1U06A 3PE0A 3UA6A 1AWXA 2AK5A 5IHKA 1CKBA 1MV3A 2F2VA 1QWFA 2E5KA 1NEBA 1UJ0A 2AZSA 2K2MA 1UDLA 2DF6A 1UG1A 4LE9A 2GNCA 5I22A 4E6RA 2BZ8A 2CUBA 1M3AA 2OAWA 2M51A 2DE0X 1AD5A 2YUOA 1UHFA 3RBBB 1CSKA 2RPNA 1SHFA 2KXDA 2HBWA 1B07A 2RQWA 4JZ3A 1BB9A 1WX6A 1UHCA 2MCNA 2CREA 3M0SA 4Z8AA 2ROTA 1CKAA 2I0NA 2K3BA 2V1RA 2A36A 1MV0B 1TG0A 1SSHA 1U5SA 1EFNA 4AFZC 2V1QA 2DRKA 4QT7A 4J9EA 3EG0A 3U23A 1N5ZA 1VYUA 4J9IA 2AZVA 2FRWA 2O2OA 1GCQA 2L3QA 2C0TA 1ZX6A 1WYXA 4CC4B 2BZYA 2FG0A 1T3SA 4J9HA 1WFWA 2CH4A 3EG3A 4JPBW 4M4ZA 1KJWA 1WDXA 2H8HA 4RTTA 3I5SA 2KXCA 4LNPA 1G2BA 1WLPB 5ECAA 4JJBA 1G83A 4K11A 2LP5A 3H41A 2DL3A 1ZUYA 2KE9A 4EIKA 2KT8A 2JW4A 2KYBA 3TVTA 2YDLA 3THKA 2RN8A 4OMLA 1YCSB 1AWJA 5IHNA 3EG2A 2EYZA 5IH2A 4J9CA 1UUEA 3UF4A 1WI7A 1JXMA 4HCKA 2J06A 3SHWA 2K9GA 2PZ1A 4R0KA 1PHTA 2CSQA 1ABQA 1QCFA 1JEGA 1K76A 1HD3A 2GGRA 4OMMA 2VWFA 3ZL7C 2C0IA 2NUZA 2LZ6B 3EHRA 2LQNA 2EYXA 4J9FA 2HDAA 2ED0A 3NHNA 4Z88A 3O5ZA 4CC2A 2CSIA 2EBPA 1E6GA 4J9DA 1WXTA 1LCKA 3VRZA 2EPDA 4CC3A 1ZBJA 1K9AA 3ULRB 3M0RA 3GBQA 1FMKA 3M0QA 4RTZA 1X43A 2JM8A 3VS5A 4GLMA 3VS4A 3NGPA 1GCPA 1Y57A 2LMJA 2JMAA 2KEAA 4JJCA 2FEIA 1ZUUA 4OMNA 4F17A 3NMZC 3VS2A 1JU5C 4AFQC 3M0UA 1QKWA 2FPEA 3A98A 1K1ZA 3RNJA 1K0SA 2ECZA 3R6NA 1H92A 1NLOC 1OPLA 3C0CA 2K7AA 2X3XD 1WXBA 1H3HA 2QDLA 2DX1A 2M0YA 1NYFA 2RQRA 2JT4A 2EGCA 1AVZC 2FRYA 3UA7A 2GBQA 1J3TA 3CQTA 2JMCA 1WXUA 2HSPA 1OPKA 2JM9A 3PVQA 4AFUC 2XMFA 5I11A 2ABLA 1VA7A 1AOJA 3EHQA 2KRSA 2ED1A 2W10A 1M30A 2VKNA 2A28A 4GBQA 1RUWA 1GBRA 4AG2C 2YUQA 1GFDA 1AWWA 3H0IA 2C0OA 1M3BA 2L3PA 5HCKA 5IXFA 2DLPA 2KYMA 4OMQA 1K0XA 1NG2A 1NYGA 2MOXA 2ESWA 2EGEA 1K4US 1SPKA 2GQIA 2KBTA 1KSWA 4HVWA 2BTTA 2GTJA 1W70A 1T3LA 2DL4A 5GJVB 3VRYA 1H8KA 3NPFA 1SRMA 2DJQA 4LN2A 2F2XA 1RLPC 2HCKA 2O9VA 1BBZA 2KT1A 2OJ2A 1AZEA 2J7IA 4KRTA 1X2KA 1W6XA 4Z89A 1ZLMA 1X27A 2FPFA 1WA7A 2O31A 2D8JA 3QWYA 3VS0A 3TSZA 2RF0A 5GJWB 5FW9A 2JXBA 4OMPA 1W1FA 1TUCA 4J9GA 2FPDA 1UGVA 4DEXA 1WIEA 3H0HA 2CT3A 1KFZA 1GCQC 1TUDA 2DBKA 2DM1A 2RQVA 1PRMC 2DYBA 2ROLA 1VYTA 2KR3A 1M3CA 2RMOA 4AG1C 2PNIA 3EG1A 2PTKA 4OMOA 1SRLA 1YP5A 2CUDA 3M0PA 1UE9A 2J6FA 2LJ3A 1ABOA 1M27C 2DILA 2GTOA
chains in the Genus database with same CATH superfamily
3QBYA 2EYYA 1VQ7A 2RI3A 2MAMA 3OYYA 2DVEA 1IZ6A 5GAN5 4E2FB 2JOYA 4F7UB 1BYMA 4FYWB 4IUPA 2J6KA 4M7AC 1KHCA 4BE2A 3SEMA 5C0MA 1YHQA 2DNUA 2YSQA 2K79A 1QW1A 2EWNA 2CDTA 2D8HA 1YWPA 3TCJA 4RG8A 2X3WD 1Y96A 2ZPFB 1YJWT 3CCEQ 3C94A 1C1AA 5GANd 2CZ0B 3CD6A 4MZMA 4QQ6A 4C8QG 6AT1B 1UJYA 5FU7B 2MI6A 4EPCA 4A4HA 1VQPQ 3CCLA 2MWOA 3V7CA 3G71A 4J5YA 3TSWA 3MKDA 3BFMA 2IIMA 3TEEA 4MZTA 2MPXC 2EQIA 4DEYA 2HD0A 1YWOA 1IO6A 2Y4XA 3OYEA 2ENMA 2KRNA 1X6GA 1D09B 2EKHA 2Y90A 4PNOA 1SEMA 2B86A 3VS6A 2EIFA 3MJXA 2QA4Q 1ARKA 2HAXA 4RTVA 1KIKA 4LUDA 1UGSB 4HA8A 2R57A 2M16A 2SRCA 1V29B 1TUGB 1BCOA 5KYYA 1G3WA 4HKEA 5GANg 4C92B 4L59A 2RJCA 1WNLA 2BZXA 3JSCA 2WACA 2HZYA 4KULA 1FYNA 4LD9K 2CZ1B 3BDLA 2XICA 1VQ6A 1OOTA 2QQSA 3HSBA 3E9FA 2L0AA 4DBRA 5FWBA 1OV3A 2O88A 2XK0A 2YUNA 2CGHA 1UFFA 4LD6A 3MP6A 2DA9A 2VC8A 3S3MA 2IVWA 4MDXA 4M75E 1WHJA 4KBMB 3NTHA 2LJ1A 3BE3A 2CH4W 2D9TA 2LNHB 4IIMA 4CC7A 1XQHA 1ZBXA 4PFPA 4F14A 2OI3A 2EVRA 3O8VA 1K9MR 2VB6A 3HFOA 4M78C 4RUGA 3VS1A 3MEVA 3BY7A 4BI8B 4WTOB 5KYXA 3JAME 1GFCA 1T0JA 1AZGB 4PJOF 1VQNT 1Z9QA 2RQUA 2VVKA 2IPOB 2KRMA 1F1BB 1Y0MA 3CCUA 3M0TA 2RNAA 1JO8A 3JV3A 1MUZA 4XU0A 1U06A 3CXCS 4FU6A 1TOVA 5GMKm 4B9WA 1OULA 4XTVA 3EGXA 1AWXA 2AT1B 4PFOA 1MV3A 2K5IA 1X6OA 2LT4A 1G5VA 4M75F 5J39A 4BE0A 1DJ7B 3CC4T 3ME9A 3WXMB 4KGXB 1ZSZC 1UG1A 2D0QB 1M1FA 3QO3A 4YTLA 2CUBA 2OAWA 4OVAA 3GNGA 1GXIE 2NLUA 2YUOA 2OAUA 2QEXQ 4RG2A 1CSKA 2RPNA 2ZPEB 2KVQG 4C0DC 4N4HA 2COWA 4LDUA 5GAOl 3I56A 4M7DE 1BB9A 1WX6A 4KGZB 2K3BA 4DOVA 3G71Q 1M1KU 3CCSA 1EFNA 4M7AA 2EYQA 1ACMB 2V1QA 3R6OA 4QT7A 2QYZA 3EG0A 3U23A 1K9MU 2FRWA 2X4WA 4E7ZA 1IXDA 1WYXA 2EJFA 3M53A 1AHJB 2BZYA 1NJIR 3LWHA 1N27A 5GANe 3BDUA 3MO8A 3D7SB 4XTYA 3HRSA 1ZSZB 1WHGA 4QVDA 3FJPA 5CKFA 5LJ3h 1KQ2A 2H8HA 3INZA 5D6WA 2FB7A 2E12A 2MWPA 4FL6A 4K11A 3NTKA 3MEAA 3QHSA 1VQ7Q 1RI0A 1ZUYA 4EIKA 5IT9E 3TVTA 3THKA 5LJ5e 1ZA2B 4OMLA 3QXEB 5IHNA 4N0AC 2RB6A 2F5KA 3EG2A 4J8OA 1QVPA 3QKJA 5IH2A 3CCMT 1UUEA 3CCRT 1S72Q 3UF4A 2ZPGB 1JXMA 4M7DF 2K9GA 2DKGA 1Y71A 4R0KA 3A8GB 2LVMA 3J81E 4BI4A 1JEGA 1K76A 2GGRA 2CS7A 3OB9A 9ATCB 2NUZA 4FIBA 2KQWA 2QQRA 1Q81R 1VQ7T 3NHNA 3O5ZA 1YI2A 2CSIA 2LQ8A 2EBPA 2CP7A 1Q86C 2BE7D 3PGGA 1N9SA 3GBQA 3M0QA 3RESA 1BI1A 4C8QC 5GAOr 1X43A 3MPUB 3VS5A 2FZGB 4GLMA 3VS4A 4E7IA 2V8KA 3NGPA 3SWNB 1Y57A 1TS9A 3JCMf 3OW2A 1YJWA 3URGA 2FEIA 1N9RA 3NMZC 3VS2A 2DZ9A 1K8AU 2YLBA 5FLXE 1JU5C 2EJ9A 3FEOA 3CPWP 5AT1B 1QKWA 3A98A 3ZFJA 3QZ5B 1X75C 1N6AA 3QG1A 1JBMA 1H3HA 2L8DA 4M7DA 1KQSS 2HQHA 2EGCA 1VQLQ 1AVZC 4F04B 2OTJA 2RJEA 1J3TA 4FW1A 1LVKA 4JLIA 3NTIA 3CQTA 5FRNA 2JM9A 4AFUC 2XMFA 4FYXB 2ABLA 1VA7A 4NOYA 3BW1A 4M78E 4F7UA 3HL8A 2QG9B 1RUWA 3PFSA 5CK9A 4AG2C 4PJOG 2FL7A 1GFDA 2DXUA 1VIEA 5GAOq 3OYDA 3AHUA 3JB9J 5HCKA 5IXFA 4PJOD 2DLPA 4OMQA 1NG2A 1NYGA 2X4YA 1YITA 5FRMA 2BTTA 4LXCA 2BKDN 1T3LA 8AT1B 1TH7A 3VRYA 2VASA 1WHKA 1ZHIA 1VQOT 2VYTA 3M55A 5LL6S 5KE2A 2P4TA 2HCKA 2OJ2A 2G3RA 2X51A 2R5AA 1M90U 4M7AB 4KRTA 1RAEB 1X2KA 1OQKA 4OB0B 1ZLMA 3FIFA 1VQNQ 1YJWQ 1WA7A 3CCET 3TSZA 5GJWB 3OMGA 4OMPA 1K73C 3CD6T 2BIVA 2WSEE 2LTOA 2FPDA 2YXYA 2HKNA 4RMOA 1KFZA 4Z02A 1XNIA 1ZSZA 5LJ3e 1PRMC 2COZA 3CEYA 3EH2A 5KYYB 4AG1C 5CKBA 3OYIA 4OMOA 2QGFB 1SRLA 1YP5A 3M0PA 2CUDA 3OMCA 5A0GA 1VQOQ 4M78F 2GTOA 3OYNA 4J83A 3TU4K 2EW3A 3VYHB 1UTIA 2L89A 3CCQT 3QWXX 2JZ2A 4OB2B 1E7OA 1X6BA 3PVLA 5CCAA 4J7FA 5FU7C 4E7HA 3LWIA 3KXTA 4JJNK 1PKSA 5GAMg 1YCYA 1YN8A 4J9BA 2XHCA 4HVUA 2C06A 3CCVA 4PFZA 1VQ9A 2YUPA 4ORZA 4PJNA 3GLXA 2LCSA 5AYFA 2KROA 2P4RA 2F2WA 4LUEA 2YRCA 2E5QA 1B3QA 1JXOA 1M1KC 1VQLT 2DL5A 4PJOE 1X2QA 4C0FA 3SDZA 4MMLA 2QA4A 2RJDA 4ZNXA 3OS5A 2HEQA 1VQ5A 1QQJA 1LNXA 4JZ4A 3IQLA 4M78A 3OW2S 3JB9H 1JRIA 5HY6A 4C8QB 2QAZA 1OZ2A 1UECA 1S1NA 1QKXA 3FLGA 1I5OB 3AT1B 3KUFA 4PK4A 5GAMf 3WVEB 3JCMh 4ZTFA 1YNZA 1YJNQ 2QDYB 3I35A 1E6HA 2LJ0A 3KFVA 3H8ZA 4RTYA 4J6XA 4X9DA 4D8DA 4M7DB 4M75B 1X69A 1O9SA 2A0FB 1QVFA 2DD5A 1VOMA 1HSQA 1PKTA 2A08A 2KDSA 1YIJT 2HBPA 1D1AA 4C0DB 5LJ5g 3V8KA 4A54A 3UT1A 4C5IA 3E1SA 2DTOA 3OYGA 1GRIA 4A63B 1I1JA 4JRQA 1H3ZA 1ZA1B 4WCIA 3GPLA 4JS5A 4CRIA 1KD1U 1AEYA 1QWEA 1W2BS 3CCMA 2QXFA 4JUVA 1Q7YR 2Y4YA 1U3OA 3A8OB 3OYMA 2A7YA 5IAYA 1QMCA 3X20B 2RI2A 1D0XA 1OU9A 3L2ZA 1WZOA 3X26B 2CT4A 2MIOA 2DBMA 1C0MA 5CR2A 3M58A 1D1BA 3CCUQ 1FWZA 5GMKi 2XG8D 4HT9A 4C8QF 4ZN1A 1NEGA 1OU8A 5CAIA 2X4XA 3JB9D 2EGAA 1YITT 5FU6B 1QCOA 2PUOB 3UA6A 2AK5A 4XK8E 1CKBA 5LJ5h 1OI1A 3OY9A 1UJ0A 2K2MA 1Q86U 3QIIA 3CXCP 2K3YA 1V76A 2GFUA 2GNCA 4DOWA 4FT2A 4E6RA 2BZ8A 2M51A 3HTRA 3EFOA 1AD5A 4A4KA 1UHFA 1U1TA 1VQMA 3GF5A 4PJOA 3CPFA 5LJ5f 1B07A 1BIAA 2RQWA 3MP1A 4JZ3A 2JN0A 4J7IA 2K2VA 2MCNA 3X25B 2DEUA 4JDSA 3TQ7P 2I0NA 2V1RA 4J6YA 4PJMA 2V8IA 3E19A 1TG0A 1U5SA 4CI0C 1IB8A 4QQDA 3CC4Q 2DRKA 4J9EA 1PM3A 1VQPA 1K9MC 1WJQA 2GFAA 3CMEA 1U8RA 2O2OA 4M78G 1ZX6A 1M1GA 3A1PA 4M77D 3RKYA 3QJYA 3PIOA 2JTFA 5CKDA 1WQWA 2RI5A 2DETA 2DERA 2LX9A 3LW5E 1Q82R 2E6ZA 1YIJA 4R55A 3CBPA 3A8MB 4M4ZA 8ATCB 2QGGA 3LLRA 3G4SQ 3GOXA 3H9NA 1WLPB 1YHQT 4JJBA 2LP5A 4ZN3A 5CQYA 1M2VA 3MCAB 4M78B 4EMGA 2KE9A 2YDLA 2RN8A 3I56T 1TTHB 3JCMX 1KD1R 1WJSA 4J9CA 1G3SA 1WI7A 5GAN3 1VQ5T 4O6JA 4EMKC 2QI2A 4ATOA 1NPPA 3MEUA 3OYKA 4M75A 2CSQA 4N4IA 4C92F 3JB9I 1QCFA 1AT1B 4M75G 2MYSA 4GY5A 4TVRA 1OZ3A 3JCMb 4OMMA 2VWFA 2X9HA 1VQ4T 1TXQA 5DM7R 3ZL7C 2IG0A 2P84A 2EYXA 3CC2A 5GMKj 4IUQA 2ED0A 2CZ7B 4KH1B 4XTZA 4Z88A 1MMAA 4UC4A 2QK0A 2QQ9A 4J9DA 1WXTA 4A4GA 2H3JA 4CC3A 2DD4A 4Q5WA 3OYFA 1FMKA 2OTJQ 2JM8A 3QDFA 2ZAEA 2QASA 4IUTA 1HYOA 3CC4A 2HQXA 2LMJA 5LJ5d 3E9GA 3Q1JA 1W2BP 1KD1C 4M7DD 4OMNA 1ZUUA 4QQGA 3CCVT 2RHUA 2E4HA 4DA4A 2P0KA 1K0SA 1NLOC 1OPLA 3CCQQ 1H641 2QDLA 2M0YA 2F5TX 3UA7A 3CPWS 1VQPT 1K73R 5A2QE 2RK1A 4PL6A 1NZ9A 2JMCA 1KC8C 3LH0A 1WXUA 1OPKA 2DJZA 3QZ9B 3WVDB 1AOJA 3CPWA 2KRSA 2LQKA 4M75D 3I55Q 1YI2T 3UDCA 2VKNA 2A28A 4KGVB 3CC7A 2LC4A 1FXXA 2KI7A 2CP3A 3META 2C0OA 1IRXA 1BCMA 2L3PA 3HKSA 3EFOB 3VU3C 2M1HA 4XU1A 1K4US 1SPKA 2GQIA 2K4YA 4HCZA 1WHMA 1KSWA 4HVWA 4M7DG 2CP2A 3G4ST 1H8KA 4C0GA 3NPFA 2EQMA 2WSFE 1VQ8T 1RLPC 1BBZA 2O9VA 2VV5A 4IKFA 1VQKA 3JCMQ 1AZEA 3M59A 4Z89A 4M7AF 4PJJA 2FPFA 2H3EB 2D8JA 5GANh 2JXBA 3C12A 1W1FA 4J9GA 4A53A 4DEXA 3SFMA 1R77A 3OS2A 1TUDA 2DM1A 1D0ZA 4DBQA 1IHVA 2RQVA 2EQJA 4C8QA 5GAOp 3EFRA 5FROA 4QKUA 1VYTA 1M3CA 3UWNA 1OX8A 2XDDA 2V26A 3E2UA 2LT1A 1PNJA 3EGDA 4RTWA 3REBB 2DVJA 1WHLA 1N8RR 5GAN6 3KBGA 4ZGJB 3RMQA 1FMVA 2PVGB 1VQNA 4M7AE 1FMWA 3DLLA 3JCMP 3CCEA 2LX7A 5L23A 4EMKB 4HXJA 4LDXA 2ZGWA 1YITQ 2COYA 2DMOA 5KCHA 1VYVA 4XTUA 1BI0A 1HJDA 1SHGA 4BI3A 4RTUA 2QEXT 4L5GA 3OBYA 3L42A 4C8QE 3V8JA 1PSEA 2D0NA 4FCYA 4M78D 3OYAA 2J6OA 4ELYC 2YT6A 1GBQA 2P0PA 3JB9G 2OTLQ 4ZGDB 5DLOA 3CC7T 2KMTA 1S72A 3X28B 1WHHA 3HRUA 5D6YA 4PJOC 1KQSP 3CBMA 2CP6A 1T0HA 2AKLA 4C5HA 3JCMW 2M02A 3VS7A 3PT9A 4PKCC 2ZZDA 5I2SA 3M4YA 3OYHA 1RI9A 1AWOA 1M8VA 3LH5A 1U1SA 5J3BA 4BE1A 2EFIA 3QUIA 2SEMA 3CC7Q 2ATCB 1VQKQ 1M5Q1 1PG5B 1PSFA 3MP8A 4OP0A 4JJDA 3L2QA 3FJ5A 4M75C 3S3NA 4KUIA 4PJOB 3JCMc 4MMKA 5GAOn 4FSSA 4FYVB 4JRPA 4X1VA 1HK9A 1KHIA 3OYCA 3I9QA 2X35A 2D1XA 4AMCA 4FSXA 4RTXA 2DFUA 4GLKA 2HL5C 2DRMA 4C92G 4AFSC 1RABB 3VS3A 4BD3A 2I2LA 1R0BG 3M4GA 4N0AA 4HCCA 2JS2A 3I5RA 3M54A 4II1A 1BK2A 1W2BA 3RR6A 4BACA 1I0CA 1LOJA 3A8LB 1V1CA 2DAQA 5LJ3f 1QVGS 2DXTA 2FYKA 1FX7A 5EC7A 1PWTA 1R0CB 1RACB 2DL7A 3C4SA 1M2VB 3TREA 4JS4A 5IHKA 2F2VA 1YFNA 3OYLA 2E41A 1NBEB 1QWFA 4R56A 1NEBA 1UDLA 2ZCFB 4LE9A 1Q82U 3F70A 3N5BB 1VQ4Q 2XDBA 2RHIA 4E7KA 2DE0X 1MNEA 4ZTJA 3CC2Q 4ZGEB 2KXDA 3NFCA 1MGQA 3OA6A 1KQ1A 1UHCA 1VQ5Q 2MF2A 3J7AF 2CREA 2GCXA 1UGQB 1QP3A 2ROTA 1CKAA 2A36A 3CCSQ 2DTHA 3EFSA 5A0DA 1VIFA 4AFZC 1MMDA 4XTXA 1N5ZA 1I5LA 1GCQA 3CD6Q 4XAXB 4M77B 3CCJA 2ZPHB 1VQ9Q 1I81A 2RHZA 4LDVA 1MHNA 1WFWA 2CH4A 2E65A 4XU3A 2NUTA 3G6ET 1VQ6Q 3EG3A 4JPBW 4IURA 5L8RE 1KJWA 3DB3A 4OGEA 4RTTA 2KXCA 4LNPA 1G2BA 5ECAA 4M7AG 1G83A 5IN1A 2CYZB 2YRDA 3OQ5A 1QVFP 1JB0E 4OB3B 2QTXA 2KT8A 2KYBA 2HSEB 1YCSB 1AWJA 1QCNA 3C95A 3CCVQ 4J6WA 2AIRB 3LGFA 1PC0A 2HNIA 4QW2A 1BIBA 5D6XA 5CIUA 1K73U 4XU2A 4HCKA 2RJFA 4M77C 5HK0A 2PZ1A 5CQXA 1PHTA 2DXCA 3HRTA 4VUBA 3P8DA 1WJRA 3V8LA 3CCLQ 5KCOA 2QA4T 5EG2A 1MMGA 2X4JA 4V2SA 1RAAB 2C0IA 2EAYA 1M90R 3HP9A 1SG5A 5GAMj 3I55A 3QPHA 2RM4A 5GMKh 2O4XA 5GAMd 1C6VX 3HHTB 1K9AA 5GAN8 1W4SA 3SWNC 5GAMe 3VV0A 4F7UF 2K5FA 1GCPA 3QSUA 2JVVA 2YWWA 4JJCA 1SKUB 3QJ6A 2ZPIB 3QYGB 1YBYA 4OB1B 2E3HA 3M0UA 1H92A 3R6NA 4C92C 1VQKT 2K7AA 1WXBA 2DTIA 2VXEA 1KG1A 4QVZA 3CCST 1NYFA 4IUUA 2NYSA 1YHQQ 4Y91A 2FRYA 2EJGA 1RADB 5CKHA 3CBOA 5M9OA 2F1LA 1VQ4A 4B6MA 1KC8U 3EGDB 4DBFA 2HL3A 3RERA 2JTMA 3CC2T 2FZCB 3DKMA 2HMAA 3OS0A 2W10A 3CCMQ 1M30A 4F7UG 3DB4A 4GBQA 1Q95G 7AT1B 1GBRA 2YUQA 4Y28E 3RKWA 1AWWA 3H0IA 1M3BA 1O75A 1VUBA 1Q7YC 1K0XA 2DPPB 1EIFA 2ESWA 2EGEA 4EMKA 2KBTA 4FYYB 2WSCE 2QQBA 1W70A 3PTAA 2EQKA 1YJNT 4MDWA 1N8RU 1SRMA 2DJQA 4RCBA 4X34A 4LN2A 2F2XA 2BUDA 1Y07A 3RKXA 2RHXA 1ZQ1A 4PLIA 2J7IA 5GMKl 1QVGA 1W6XA 2E6NA 2Z0WA 4JRKA 2LRQA 3QWYA 4ANJA 4M77A 4XTWA 4BB7A 3M9QA 2QTVA 1D3BA 2CT3A 1GCQC 2DBKA 2NUTB 3CMAA 3G71T 2AHJB 1I4K1 4BY6C 2DYBA 2HKQB 2KR3A 2PQWA 2V8JA 1YJ9Q 3JCMJ 2F69A 3M56A 5CO7A 2PNIA 3EG1A 2FVUA 1UE9A 2LJ3A 2DILA 3VYGA 1JJ2P 1EX4A 3OSSC 1NLPC 4C8QD 3MEWA 3FC3A 2CKKA 3L2UA 2A37A 2VGNA 3CCUT 3REAB 2DXBA 3PMTA 3H0FA 3FB9A 5IXBA 1BU1A 1PD0A 2EYWA 4KT0E 5FU6C 2CP0A 1IGUA 1SF9A 5GANj 5D7UA 5LJ3d 1NM7A 1VQ8A 1TWBA 2FO0A 4LDYA 1GL5A 3H6ZA 2OX7A 1I07A 3JCMg 3GIBA 4FM4B 1RAGB 4M77E 4HVVA 4P5NA 1VQ8Q 5HK3A 4E47A 5GANf 2CZ6B 3RMSA 2HQEA 2MK5A 1PRLC 4OMFB 4EDUA 2XIDA 1OEBA 4RCCA 2JUFA 3SB2A 1M90C 2OTLT 1XOVA 3CCJQ 1VQMT 1P92A 1BKBA 1M4ZA 1YJ9A 1ZSGA 5KE3A 1JQQA 2L2PA 3I55T 2RQTA 3CMAQ 3JCMe 4FW2A 2K6DA 2KSSA 4C92D 1Y7XA 3T9NA 1YJNA 3S3OA 1QVFS 3VKIA 4KUDK 2L5QA 5GAMh 2G6FX 1A0NB 4PJLA 3ZEHA 1B34A 2RH2A 2XKOC 2NUPA 3G6EA 2JS0A 2LCLA 1LJOA 3UATA 1N8RC 4ESRA 2D6FA 2LQWA 3FRNA 4DBHA 1ZUKA 4BY6B 1KC8R 1R8OB 2B8AA 2J05A 1RAIB 2QEXA 2RO0A 4IIOA 3CCLT 4M77F 1Q7YU 2NWMA 3QDRB 5IHIA 2L3SA 3MHXA 1WPYA 2O9SA 2ZPBB 3A5ZB 5KYWB 1X01A 1Y96B 1M8MA 2OTJT 3P8BB 4LDWA 4BDYA 1Z9ZA 4D8KA 1LPLA 5LJ3g 2KNBB 4EMHA 5HKCA 2W0ZA 4B9XA 4C92E 4NS5A 4Y92A 2KGTA 3OS1A 4F16A 1D0YA 5CKEA 1XTDA 3ER0A 2KY9A 4L6V5 1RLQC 2PVOB 1QLYA 2JTEA 3EGUA 4HCBA 4M77G 4JLGA 2XU8A 5CVIA 2AKKA 4AT1B 1VQ6T 2DL8A 5I21A 3G1JA 1WGSA 1QVGP 3PE0A 5GAN4 2RD1A 3G7ZA 1VQ9T 4HT8A 2K57A 3JB9F 4D6WA 1VQMQ 2E5KA 1UGRB 2AZSA 2VGMA 1RL2A 3G4SA 2E1HA 3OYBA 1JJ2S 2DF6A 3L2VA 5I22A 3PNWC 1RAFB 1YI2Q 3V7RA 1M3AA 2JNGA 2DIQA 4WF2A 3EH1A 1UGPB 3RBBB 3OBWA 3L1AA 1Q86R 1SHFA 2HBWA 4M7AD 3CMEQ 4E7LA 5KYUB 3M0SA 4F7UE 3CCRQ 1S72T 4Z8AA 2XDPA 1Q81C 3PIPA 2VUBA 1MV0B 1NJIU 1SSHA 1B7TA 1XJWB 1VYUA 2O4XB 4J9IA 3RIRA 2AZVA 2CP5A 2L3QA 2C0TA 3CCQA 2YHTA 3LGLA 3UPUA 5KYXB 4CC4B 2XD0A 2FG0A 1T3SA 3A8HB 4J9HA 5GAOm 1WDXA 4E7SA 1NPRA 2O01E 3I5SA 3VUZA 4BDZA 2QQAA 3EG9A 5A0LA 1G3YA 3H41A 2L3RA 1MNDA 2DL3A 5LJ5j 2YRVA 5KYNA 1TSFA 4DQ2A 2JW4A 2DO3A 1BI2A 4PLLA 3M57A 4C0ZA 1M2OA 2EYZA 2OTLA 2KAFA 3SD4A 3VUBA 5J26A 3JRZA 1M9SA 2EKOA 1B34B 3FDRA 2DIGA 2PUKB 4N4GA 1NJIC 2J06A 3SHWA 2DK3A 2NUPB 3CMAT 1ABQA 1Q82C 4XQ3A 3EAEA 1HD3A 1SSFA 3CCJT 4QVCA 3I56Q 2LZ6B 3EHRA 1G8XA 2LQNA 5DY9A 2M9UA 2HDAA 4J9FA 2DZCA 1G3TA 4O5VA 2GF7A 2E70A 4CC2A 3P8HA 5KYWA 1PD1A 4C5GA 1E6GA 4NL3A 5I2MA 1LCKA 3VRZA 2GQVA 3VJPA 2EPDA 1ZBJA 1K8AR 1KK7A 3JCMV 2E64A 3ULRB 3M0RA 1IGQA 1I8FA 2MMPA 4IUVA 4RTZA 1WQ7A 2DEQA 5GMKe 3HPWA 2LCCA 3QYHB 1BI3A 2JMAA 2KEAA 1YIJQ 2KK4A 3ASKA 4F17A 1D3BB 4FT4A 5GAN2 3RUXA 4A4EA 2RK2A 4AFQC 1VQOA 2LDMA 2FPEA 3RNJA 1K1ZA 4C92A 3CCRA 2ECZA 4MZPA 3C0CA 1IHWA 4JRIA 2X3XD 2DX1A 2RQRA 5DLQE 2JT4A 1HXDA 2GBQA 3OW2P 4A4FA 4BUGA 1RAHB 4ME7A 1MMNA 2HSPA 1OX9A 1KQSA 3PVQA 1NE8A 5I11A 5LJ3j 3EHQA 1YJ9T 2ED1A 1JJ2A 2R58A 5C6SA 4ELZC 4E7JA 1EZZB 4OGCA 3L2RA 1Q81U 3V7SA 4C5EA 2KYMA 2PU9B 1OYXA 3GNFB 2XI9A 2MOXA 4X9CA 2E10A 2JJ9A 2GTJA 3X24B 2DL4A 5KYUA 5GJVB 2R5MA 5KH6A 2YLCA 1PCXA 2KT1A 5GAN7 3M5AA 2PVDB 3LYIA 1X27A 4NL2A 3LX7A 3PMIA 2O31A 3HFNA 3ZBDA 3VS0A 2M0OA 2RF0A 1UEBA 3DLMA 4RKUE 5FW9A 2LNVA 1M1KR 4M7DC 1UB4A 3SWNA 2E3IA 1TUCA 2FZKB 3OSVA 1UGVA 1IREB 2FHDA 4KH0B 3CXCA 3JCMd 1WIEA 3EGXB 3H0HA 2K3XA 3S6WA 3L2WA 4OF1A 3OYJA 1VQLA 2ROLA 3GP8A 2K5LA 2RA2A 1TU0B 2P0QA 1K8AC 2RMOA 2DYIA 3RDVA 3J80E 1QP2A 2PTKA 3CMET 2A3LA 2VXFA 2RHYA 3EG9B 2J6FA 1ABOA 1M27C 2EQUA 2BE9B 5FWCA 3G6EQ 1D1CA
chains in the Genus database with same CATH topology
1NLPC 1PNJA 2EYYA 4RTWA 3REBB 2DVJA 2A37A 3REAB 2EW3A 3H0FA 1UTIA 5IXBA 1BU1A 2EYWA 3QWXX 2J6KA 1E7OA 1X6BA 3PVLA 3SEMA 1NM7A 2FO0A 1GL5A 2DNUA 1I07A 2K79A 2YSQA 2CDTA 1PKSA 2D8HA 2LX7A 1YWPA 1YN8A 4J9BA 5L23A 2X3WD 4HVUA 4HXJA 4HVVA 2DMOA 2YUPA 1UJYA 1VYVA 4ORZA 1HJDA 2LCSA 1SHGA 4RTUA 2KROA 2P4RA 2F2WA 4LUEA 1B3QA 3TSWA 1JXOA 2DL5A 2D0NA 2IIMA 1PRLC 1X2QA 2J6OA 1OEBA 2EQIA 2YT6A 4DEYA 1GBQA 1YWOA 1IO6A 1XOVA 2ENMA 2KRNA 1X6GA 2EKHA 4ZNXA 2HEQA 1SEMA 2B86A 3VS6A 4JZ4A 1ARKA 1T0HA 2AKLA 3IQLA 4RTVA 1KIKA 4LUDA 1ZSGA 1JQQA 2L2PA 3VS7A 2RQTA 2SRCA 2K6DA 1UECA 1S1NA 1QKXA 1RI9A 1AWOA 1YNZA 3I35A 2G6FX 1E6HA 1A0NB 2BZXA 2LJ0A 3LH5A 3KFVA 4RTYA 4D8DA 2JS0A 1FYNA 1X69A 2SEMA 3UATA 1OOTA 4ESRA 2LQWA 1HSQA 1PKTA 1ZUKA 2L0AA 2A08A 4JJDA 5FWBA 3FJ5A 2J05A 5FWCA 4IIOA 1OV3A 2O88A 2YUNA 2NWMA 1UFFA 4FSSA 5IHIA 4X1VA 2L3SA 2O9SA 2DA9A 1GRIA 3I9QA 2D1XA 4A63B 1I1JA 1M8MA 4RTXA 4WCIA 2LJ1A 1Z9ZA 2CH4W 1AEYA 2LNHB 1QWEA 4IIMA 2DRMA 4CC7A 4AFSC 1U3OA 4D8KA 3VS3A 4F14A 2OI3A 2EVRA 2JS2A 4RUGA 3I5RA 2KNBB 1BK2A 3VS1A 2W0ZA 4Y92A 2CT4A 2KGTA 1I0CA 2MIOA 4F16A 1V1CA 2DBMA 1GFCA 1T0JA 1AZGB 1RLQC 1Z9QA 2RQUA 1QLYA 2VVKA 2KRMA 1Y0MA 2JTEA 3EGUA 3M0TA 5EC7A 1NEGA 2RNAA 1JO8A 3JV3A 2AKKA 1PWTA 2DL8A 1MUZA 2EGAA 2DL7A 1U06A 3PE0A 3UA6A 1AWXA 2AK5A 5IHKA 1CKBA 1MV3A 2F2VA 1QWFA 2E5KA 1NEBA 1UJ0A 2AZSA 2K2MA 1UDLA 2DF6A 1UG1A 4LE9A 2GNCA 5I22A 4E6RA 2BZ8A 2CUBA 1M3AA 2OAWA 2M51A 2DE0X 1AD5A 2YUOA 1UHFA 3RBBB 1CSKA 2RPNA 1SHFA 2KXDA 2HBWA 1B07A 2RQWA 4JZ3A 1BB9A 1WX6A 1UHCA 2MCNA 2CREA 3M0SA 4Z8AA 2ROTA 1CKAA 2I0NA 2K3BA 2V1RA 2A36A 1MV0B 1TG0A 1SSHA 1U5SA 1EFNA 4AFZC 2V1QA 2DRKA 4QT7A 4J9EA 3EG0A 3U23A 1N5ZA 1VYUA 4J9IA 2AZVA 2FRWA 2O2OA 1GCQA 2L3QA 2C0TA 1ZX6A 1WYXA 4CC4B 2BZYA 2FG0A 1T3SA 4J9HA 1WFWA 2CH4A 3EG3A 4JPBW 4M4ZA 1KJWA 1WDXA 2H8HA 4RTTA 3I5SA 2KXCA 4LNPA 1G2BA 1WLPB 5ECAA 4JJBA 1G83A 4K11A 2LP5A 3H41A 2DL3A 1ZUYA 2KE9A 4EIKA 2KT8A 2JW4A 2KYBA 3TVTA 2YDLA 3THKA 2RN8A 4OMLA 1YCSB 1AWJA 5IHNA 3EG2A 2EYZA 5IH2A 4J9CA 1UUEA 3UF4A 1WI7A 1JXMA 4HCKA 2J06A 3SHWA 2K9GA 2PZ1A 4R0KA 1PHTA 2CSQA 1ABQA 1QCFA 1JEGA 1K76A 1HD3A 2GGRA 4OMMA 2VWFA 3ZL7C 2C0IA 2NUZA 2LZ6B 3EHRA 2LQNA 2EYXA 4J9FA 2HDAA 2ED0A 3NHNA 4Z88A 3O5ZA 4CC2A 2CSIA 2EBPA 1E6GA 4J9DA 1WXTA 1LCKA 3VRZA 2EPDA 4CC3A 1ZBJA 1K9AA 3ULRB 3M0RA 3GBQA 1FMKA 3M0QA 4RTZA 1X43A 2JM8A 3VS5A 4GLMA 3VS4A 3NGPA 1GCPA 1Y57A 2LMJA 2JMAA 2KEAA 4JJCA 2FEIA 1ZUUA 4OMNA 4F17A 3NMZC 3VS2A 1JU5C 4AFQC 3M0UA 1QKWA 2FPEA 3A98A 1K1ZA 3RNJA 1K0SA 2ECZA 3R6NA 1H92A 1NLOC 1OPLA 3C0CA 2K7AA 2X3XD 1WXBA 1H3HA 2QDLA 2DX1A 2M0YA 1NYFA 2RQRA 2JT4A 2EGCA 1AVZC 2FRYA 3UA7A 2GBQA 1J3TA 3CQTA 2JMCA 1WXUA 2HSPA 1OPKA 2JM9A 3PVQA 4AFUC 2XMFA 5I11A 2ABLA 1VA7A 1AOJA 3EHQA 2KRSA 2ED1A 2W10A 1M30A 2VKNA 2A28A 4GBQA 1RUWA 1GBRA 4AG2C 2YUQA 1GFDA 1AWWA 3H0IA 2C0OA 1M3BA 2L3PA 5HCKA 5IXFA 2DLPA 2KYMA 4OMQA 1K0XA 1NG2A 1NYGA 2MOXA 2ESWA 2EGEA 1K4US 1SPKA 2GQIA 2KBTA 1KSWA 4HVWA 2BTTA 2GTJA 1W70A 1T3LA 2DL4A 5GJVB 3VRYA 1H8KA 3NPFA 1SRMA 2DJQA 4LN2A 2F2XA 1RLPC 2HCKA 2O9VA 1BBZA 2KT1A 2OJ2A 1AZEA 2J7IA 4KRTA 1X2KA 1W6XA 4Z89A 1ZLMA 1X27A 2FPFA 1WA7A 2O31A 2D8JA 3QWYA 3VS0A 3TSZA 2RF0A 5GJWB 5FW9A 2JXBA 4OMPA 1W1FA 1TUCA 4J9GA 2FPDA 1UGVA 4DEXA 1WIEA 3H0HA 2CT3A 1KFZA 1GCQC 1TUDA 2DBKA 2DM1A 2RQVA 1PRMC 2DYBA 2ROLA 1VYTA 2KR3A 1M3CA 2RMOA 4AG1C 2PNIA 3EG1A 2PTKA 4OMOA 1SRLA 1YP5A 2CUDA 3M0PA 1UE9A 2J6FA 2LJ3A 1ABOA 1M27C 2DILA 2GTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLP C;  1PNJ A;  2EYY A;  4RTW A;  3REB B;  2DVJ A;  2A37 A;  3REA B;  2EW3 A;  3H0F A;  1UTI A;  5IXB A;  1BU1 A;  2EYW A;  3QWX X;  2J6K A;  1E7O A;  1X6B A;  3PVL A;  3SEM A;  1NM7 A;  2FO0 A;  1GL5 A;  2DNU A;  1I07 A;  2K79 A;  2YSQ A;  2CDT A;  1PKS A;  2D8H A;  2LX7 A;  1YWP A;  1YN8 A;  4J9B A;  5L23 A;  2X3W D;  4HVU A;  4HXJ A;  4HVV A;  2DMO A;  2YUP A;  1UJY A;  1VYV A;  4ORZ A;  1HJD A;  2LCS A;  1SHG A;  4RTU A;  2KRO A;  2P4R A;  2F2W A;  4LUE A;  1B3Q A;  3TSW A;  1JXO A;  2DL5 A;  2D0N A;  2IIM A;  1PRL C;  1X2Q A;  2J6O A;  1OEB A;  2EQI A;  2YT6 A;  4DEY A;  1GBQ A;  1YWO A;  1IO6 A;  1XOV A;  2ENM A;  2KRN A;  1X6G A;  2EKH A;  4ZNX A;  2HEQ A;  1SEM A;  2B86 A;  3VS6 A;  4JZ4 A;  1ARK A;  1T0H A;  2AKL A;  3IQL A;  4RTV A;  1KIK A;  4LUD A;  1ZSG A;  1JQQ A;  2L2P A;  3VS7 A;  2RQT A;  2SRC A;  2K6D A;  1UEC A;  1S1N A;  1QKX A;  1RI9 A;  1AWO A;  1YNZ A;  3I35 A;  2G6F X;  1E6H A;  1A0N B;  2BZX A;  2LJ0 A;  3LH5 A;  3KFV A;  4RTY A;  4D8D A;  2JS0 A;  1FYN A;  1X69 A;  2SEM A;  3UAT A;  1OOT A;  4ESR A;  2LQW A;  1HSQ A;  1PKT A;  1ZUK A;  2L0A A;  2A08 A;  4JJD A;  5FWB A;  3FJ5 A;  2J05 A;  5FWC A;  4IIO A;  1OV3 A;  2O88 A;  2YUN A;  2NWM A;  1UFF A;  4FSS A;  5IHI A;  4X1V A;  2L3S A;  2O9S A;  2DA9 A;  1GRI A;  3I9Q A;  2D1X A;  4A63 B;  1I1J A;  1M8M A;  4RTX A;  4WCI A;  2LJ1 A;  1Z9Z A;  2CH4 W;  1AEY A;  2LNH B;  1QWE A;  4IIM A;  2DRM A;  4CC7 A;  4AFS C;  1U3O A;  4D8K A;  3VS3 A;  4F14 A;  2OI3 A;  2EVR A;  2JS2 A;  4RUG A;  3I5R A;  2KNB B;  1BK2 A;  3VS1 A;  2W0Z A;  4Y92 A;  2CT4 A;  2KGT A;  1I0C A;  2MIO A;  4F16 A;  1V1C A;  2DBM A;  1GFC A;  1T0J A;  1AZG B;  1RLQ C;  1Z9Q A;  2RQU A;  1QLY A;  2VVK A;  2KRM A;  1Y0M A;  2JTE A;  3EGU A;  3M0T A;  5EC7 A;  1NEG A;  2RNA A;  1JO8 A;  3JV3 A;  2AKK A;  1PWT A;  2DL8 A;  1MUZ A;  2EGA A;  2DL7 A;  1U06 A;  3PE0 A;  3UA6 A;  1AWX A;  2AK5 A;  5IHK A;  1CKB A;  1MV3 A;  2F2V A;  1QWF A;  2E5K A;  1NEB A;  1UJ0 A;  2AZS A;  2K2M A;  1UDL A;  2DF6 A;  1UG1 A;  4LE9 A;  2GNC A;  5I22 A;  4E6R A;  2BZ8 A;  2CUB A;  1M3A A;  2OAW A;  2M51 A;  2DE0 X;  1AD5 A;  2YUO A;  1UHF A;  3RBB B;  1CSK A;  2RPN A;  1SHF A;  2KXD A;  2HBW A;  1B07 A;  2RQW A;  4JZ3 A;  1BB9 A;  1WX6 A;  1UHC A;  2MCN A;  2CRE A;  3M0S A;  4Z8A A;  2ROT A;  1CKA A;  2I0N A;  2K3B A;  2V1R A;  2A36 A;  1MV0 B;  1TG0 A;  1SSH A;  1U5S A;  1EFN A;  4AFZ C;  2V1Q A;  2DRK A;  4QT7 A;  4J9E A;  3EG0 A;  3U23 A;  1N5Z A;  1VYU A;  4J9I A;  2AZV A;  2FRW A;  2O2O A;  1GCQ A;  2L3Q A;  2C0T A;  1ZX6 A;  1WYX A;  4CC4 B;  2BZY A;  2FG0 A;  1T3S A;  4J9H A;  1WFW A;  2CH4 A;  3EG3 A;  4JPB W;  4M4Z A;  1KJW A;  1WDX A;  2H8H A;  4RTT A;  3I5S A;  2KXC A;  4LNP A;  1G2B A;  1WLP B;  5ECA A;  4JJB A;  1G83 A;  4K11 A;  2LP5 A;  3H41 A;  2DL3 A;  1ZUY A;  2KE9 A;  4EIK A;  2KT8 A;  2JW4 A;  2KYB A;  3TVT A;  2YDL A;  3THK A;  2RN8 A;  4OML A;  1YCS B;  1AWJ A;  5IHN A;  3EG2 A;  2EYZ A;  5IH2 A;  4J9C A;  1UUE A;  3UF4 A;  1WI7 A;  1JXM A;  4HCK A;  2J06 A;  3SHW A;  2K9G A;  2PZ1 A;  4R0K A;  1PHT A;  2CSQ A;  1ABQ A;  1QCF A;  1JEG A;  1K76 A;  1HD3 A;  2GGR A;  4OMM A;  2VWF A;  3ZL7 C;  2C0I A;  2NUZ A;  2LZ6 B;  3EHR A;  2LQN A;  2EYX A;  4J9F A;  2HDA A;  2ED0 A;  3NHN A;  4Z88 A;  3O5Z A;  4CC2 A;  2CSI A;  2EBP A;  1E6G A;  4J9D A;  1WXT A;  1LCK A;  3VRZ A;  2EPD A;  4CC3 A;  1ZBJ A;  1K9A A;  3ULR B;  3M0R A;  3GBQ A;  1FMK A;  3M0Q A;  4RTZ A;  1X43 A;  2JM8 A;  3VS5 A;  4GLM A;  3VS4 A;  3NGP A;  1GCP A;  1Y57 A;  2LMJ A;  2JMA A;  2KEA A;  4JJC A;  2FEI A;  1ZUU A;  4OMN A;  4F17 A;  3NMZ C;  3VS2 A;  1JU5 C;  4AFQ C;  3M0U A;  1QKW A;  2FPE A;  3A98 A;  1K1Z A;  3RNJ A;  1K0S A;  2ECZ A;  3R6N A;  1H92 A;  1NLO C;  1OPL A;  3C0C A;  2K7A A;  2X3X D;  1WXB A;  1H3H A;  2QDL A;  2DX1 A;  2M0Y A;  1NYF A;  2RQR A;  2JT4 A;  2EGC A;  1AVZ C;  2FRY A;  3UA7 A;  2GBQ A;  1J3T A;  3CQT A;  2JMC A;  1WXU A;  2HSP A;  1OPK A;  2JM9 A;  3PVQ A;  4AFU C;  2XMF A;  5I11 A;  2ABL A;  1VA7 A;  1AOJ A;  3EHQ A;  2KRS A;  2ED1 A;  2W10 A;  1M30 A;  2VKN A;  2A28 A;  4GBQ A;  1RUW A;  1GBR A;  4AG2 C;  2YUQ A;  1GFD A;  1AWW A;  3H0I A;  2C0O A;  1M3B A;  2L3P A;  5HCK A;  5IXF A;  2DLP A;  2KYM A;  4OMQ A;  1K0X A;  1NG2 A;  1NYG A;  2MOX A;  2ESW A;  2EGE A;  1K4U S;  1SPK A;  2GQI A;  2KBT A;  1KSW A;  4HVW A;  2BTT A;  2GTJ A;  1W70 A;  1T3L A;  2DL4 A;  5GJV B;  3VRY A;  1H8K A;  3NPF A;  1SRM A;  2DJQ A;  4LN2 A;  2F2X A;  1RLP C;  2HCK A;  2O9V A;  1BBZ A;  2KT1 A;  2OJ2 A;  1AZE A;  2J7I A;  4KRT A;  1X2K A;  1W6X A;  4Z89 A;  1ZLM A;  1X27 A;  2FPF A;  1WA7 A;  2O31 A;  2D8J A;  3QWY A;  3VS0 A;  3TSZ A;  2RF0 A;  5GJW B;  5FW9 A;  2JXB A;  4OMP A;  1W1F A;  1TUC A;  4J9G A;  2FPD A;  1UGV A;  4DEX A;  1WIE A;  3H0H A;  2CT3 A;  1KFZ A;  1GCQ C;  1TUD A;  2DBK A;  2DM1 A;  2RQV A;  1PRM C;  2DYB A;  2ROL A;  1VYT A;  2KR3 A;  1M3C A;  2RMO A;  4AG1 C;  2PNI A;  3EG1 A;  2PTK A;  4OMO A;  1SRL A;  1YP5 A;  2CUD A;  3M0P A;  1UE9 A;  2J6F A;  2LJ3 A;  1ABO A;  1M27 C;  2DIL A;  2GTO A; 
#chains in the Genus database with same CATH topology
 3QBY A;  2EYY A;  1VQ7 A;  2RI3 A;  2MAM A;  3OYY A;  2DVE A;  1IZ6 A;  5GAN 5;  4E2F B;  2JOY A;  4F7U B;  1BYM A;  4FYW B;  4IUP A;  2J6K A;  4M7A C;  1KHC A;  4BE2 A;  3SEM A;  5C0M A;  1YHQ A;  2DNU A;  2YSQ A;  2K79 A;  1QW1 A;  2EWN A;  2CDT A;  2D8H A;  1YWP A;  3TCJ A;  4RG8 A;  2X3W D;  1Y96 A;  2ZPF B;  1YJW T;  3CCE Q;  3C94 A;  1C1A A;  5GAN d;  2CZ0 B;  3CD6 A;  4MZM A;  4QQ6 A;  4C8Q G;  6AT1 B;  1UJY A;  5FU7 B;  2MI6 A;  4EPC A;  4A4H A;  1VQP Q;  3CCL A;  2MWO A;  3V7C A;  3G71 A;  4J5Y A;  3TSW A;  3MKD A;  3BFM A;  2IIM A;  3TEE A;  4MZT A;  2MPX C;  2EQI A;  4DEY A;  2HD0 A;  1YWO A;  1IO6 A;  2Y4X A;  3OYE A;  2ENM A;  2KRN A;  1X6G A;  1D09 B;  2EKH A;  2Y90 A;  4PNO A;  1SEM A;  2B86 A;  3VS6 A;  2EIF A;  3MJX A;  2QA4 Q;  1ARK A;  2HAX A;  4RTV A;  1KIK A;  4LUD A;  1UGS B;  4HA8 A;  2R57 A;  2M16 A;  2SRC A;  1V29 B;  1TUG B;  1BCO A;  5KYY A;  1G3W A;  4HKE A;  5GAN g;  4C92 B;  4L59 A;  2RJC A;  1WNL A;  2BZX A;  3JSC A;  2WAC A;  2HZY A;  4KUL A;  1FYN A;  4LD9 K;  2CZ1 B;  3BDL A;  2XIC A;  1VQ6 A;  1OOT A;  2QQS A;  3HSB A;  3E9F A;  2L0A A;  4DBR A;  5FWB A;  1OV3 A;  2O88 A;  2XK0 A;  2YUN A;  2CGH A;  1UFF A;  4LD6 A;  3MP6 A;  2DA9 A;  2VC8 A;  3S3M A;  2IVW A;  4MDX A;  4M75 E;  1WHJ A;  4KBM B;  3NTH A;  2LJ1 A;  3BE3 A;  2CH4 W;  2D9T A;  2LNH B;  4IIM A;  4CC7 A;  1XQH A;  1ZBX A;  4PFP A;  4F14 A;  2OI3 A;  2EVR A;  3O8V A;  1K9M R;  2VB6 A;  3HFO A;  4M78 C;  4RUG A;  3VS1 A;  3MEV A;  3BY7 A;  4BI8 B;  4WTO B;  5KYX A;  3JAM E;  1GFC A;  1T0J A;  1AZG B;  4PJO F;  1VQN T;  1Z9Q A;  2RQU A;  2VVK A;  2IPO B;  2KRM A;  1F1B B;  1Y0M A;  3CCU A;  3M0T A;  2RNA A;  1JO8 A;  3JV3 A;  1MUZ A;  4XU0 A;  1U06 A;  3CXC S;  4FU6 A;  1TOV A;  5GMK m;  4B9W A;  1OUL A;  4XTV A;  3EGX A;  1AWX A;  2AT1 B;  4PFO A;  1MV3 A;  2K5I A;  1X6O A;  2LT4 A;  1G5V A;  4M75 F;  5J39 A;  4BE0 A;  1DJ7 B;  3CC4 T;  3ME9 A;  3WXM B;  4KGX B;  1ZSZ C;  1UG1 A;  2D0Q B;  1M1F A;  3QO3 A;  4YTL A;  2CUB A;  2OAW A;  4OVA A;  3GNG A;  1GXI E;  2NLU A;  2YUO A;  2OAU A;  2QEX Q;  4RG2 A;  1CSK A;  2RPN A;  2ZPE B;  2KVQ G;  4C0D C;  4N4H A;  2COW A;  4LDU A;  5GAO l;  3I56 A;  4M7D E;  1BB9 A;  1WX6 A;  4KGZ B;  2K3B A;  4DOV A;  3G71 Q;  1M1K U;  3CCS A;  1EFN A;  4M7A A;  2EYQ A;  1ACM B;  2V1Q A;  3R6O A;  4QT7 A;  2QYZ A;  3EG0 A;  3U23 A;  1K9M U;  2FRW A;  2X4W A;  4E7Z A;  1IXD A;  1WYX A;  2EJF A;  3M53 A;  1AHJ B;  2BZY A;  1NJI R;  3LWH A;  1N27 A;  5GAN e;  3BDU A;  3MO8 A;  3D7S B;  4XTY A;  3HRS A;  1ZSZ B;  1WHG A;  4QVD A;  3FJP A;  5CKF A;  5LJ3 h;  1KQ2 A;  2H8H A;  3INZ A;  5D6W A;  2FB7 A;  2E12 A;  2MWP A;  4FL6 A;  4K11 A;  3NTK A;  3MEA A;  3QHS A;  1VQ7 Q;  1RI0 A;  1ZUY A;  4EIK A;  5IT9 E;  3TVT A;  3THK A;  5LJ5 e;  1ZA2 B;  4OML A;  3QXE B;  5IHN A;  4N0A C;  2RB6 A;  2F5K A;  3EG2 A;  4J8O A;  1QVP A;  3QKJ A;  5IH2 A;  3CCM T;  1UUE A;  3CCR T;  1S72 Q;  3UF4 A;  2ZPG B;  1JXM A;  4M7D F;  2K9G A;  2DKG A;  1Y71 A;  4R0K A;  3A8G B;  2LVM A;  3J81 E;  4BI4 A;  1JEG A;  1K76 A;  2GGR A;  2CS7 A;  3OB9 A;  9ATC B;  2NUZ A;  4FIB A;  2KQW A;  2QQR A;  1Q81 R;  1VQ7 T;  3NHN A;  3O5Z A;  1YI2 A;  2CSI A;  2LQ8 A;  2EBP A;  2CP7 A;  1Q86 C;  2BE7 D;  3PGG A;  1N9S A;  3GBQ A;  3M0Q A;  3RES A;  1BI1 A;  4C8Q C;  5GAO r;  1X43 A;  3MPU B;  3VS5 A;  2FZG B;  4GLM A;  3VS4 A;  4E7I A;  2V8K A;  3NGP A;  3SWN B;  1Y57 A;  1TS9 A;  3JCM f;  3OW2 A;  1YJW A;  3URG A;  2FEI A;  1N9R A;  3NMZ C;  3VS2 A;  2DZ9 A;  1K8A U;  2YLB A;  5FLX E;  1JU5 C;  2EJ9 A;  3FEO A;  3CPW P;  5AT1 B;  1QKW A;  3A98 A;  3ZFJ A;  3QZ5 B;  1X75 C;  1N6A A;  3QG1 A;  1JBM A;  1H3H A;  2L8D A;  4M7D A;  1KQS S;  2HQH A;  2EGC A;  1VQL Q;  1AVZ C;  4F04 B;  2OTJ A;  2RJE A;  1J3T A;  4FW1 A;  1LVK A;  4JLI A;  3NTI A;  3CQT A;  5FRN A;  2JM9 A;  4AFU C;  2XMF A;  4FYX B;  2ABL A;  1VA7 A;  4NOY A;  3BW1 A;  4M78 E;  4F7U A;  3HL8 A;  2QG9 B;  1RUW A;  3PFS A;  5CK9 A;  4AG2 C;  4PJO G;  2FL7 A;  1GFD A;  2DXU A;  1VIE A;  5GAO q;  3OYD A;  3AHU A;  3JB9 J;  5HCK A;  5IXF A;  4PJO D;  2DLP A;  4OMQ A;  1NG2 A;  1NYG A;  2X4Y A;  1YIT A;  5FRM A;  2BTT A;  4LXC A;  2BKD N;  1T3L A;  8AT1 B;  1TH7 A;  3VRY A;  2VAS A;  1WHK A;  1ZHI A;  1VQO T;  2VYT A;  3M55 A;  5LL6 S;  5KE2 A;  2P4T A;  2HCK A;  2OJ2 A;  2G3R A;  2X51 A;  2R5A A;  1M90 U;  4M7A B;  4KRT A;  1RAE B;  1X2K A;  1OQK A;  4OB0 B;  1ZLM A;  3FIF A;  1VQN Q;  1YJW Q;  1WA7 A;  3CCE T;  3TSZ A;  5GJW B;  3OMG A;  4OMP A;  1K73 C;  3CD6 T;  2BIV A;  2WSE E;  2LTO A;  2FPD A;  2YXY A;  2HKN A;  4RMO A;  1KFZ A;  4Z02 A;  1XNI A;  1ZSZ A;  5LJ3 e;  1PRM C;  2COZ A;  3CEY A;  3EH2 A;  5KYY B;  4AG1 C;  5CKB A;  3OYI A;  4OMO A;  2QGF B;  1SRL A;  1YP5 A;  3M0P A;  2CUD A;  3OMC A;  5A0G A;  1VQO Q;  4M78 F;  2GTO A;  3OYN A;  4J83 A;  3TU4 K;  2EW3 A;  3VYH B;  1UTI A;  2L89 A;  3CCQ T;  3QWX X;  2JZ2 A;  4OB2 B;  1E7O A;  1X6B A;  3PVL A;  5CCA A;  4J7F A;  5FU7 C;  4E7H A;  3LWI A;  3KXT A;  4JJN K;  1PKS A;  5GAM g;  1YCY A;  1YN8 A;  4J9B A;  2XHC A;  4HVU A;  2C06 A;  3CCV A;  4PFZ A;  1VQ9 A;  2YUP A;  4ORZ A;  4PJN A;  3GLX A;  2LCS A;  5AYF A;  2KRO A;  2P4R A;  2F2W A;  4LUE A;  2YRC A;  2E5Q A;  1B3Q A;  1JXO A;  1M1K C;  1VQL T;  2DL5 A;  4PJO E;  1X2Q A;  4C0F A;  3SDZ A;  4MML A;  2QA4 A;  2RJD A;  4ZNX A;  3OS5 A;  2HEQ A;  1VQ5 A;  1QQJ A;  1LNX A;  4JZ4 A;  3IQL A;  4M78 A;  3OW2 S;  3JB9 H;  1JRI A;  5HY6 A;  4C8Q B;  2QAZ A;  1OZ2 A;  1UEC A;  1S1N A;  1QKX A;  3FLG A;  1I5O B;  3AT1 B;  3KUF A;  4PK4 A;  5GAM f;  3WVE B;  3JCM h;  4ZTF A;  1YNZ A;  1YJN Q;  2QDY B;  3I35 A;  1E6H A;  2LJ0 A;  3KFV A;  3H8Z A;  4RTY A;  4J6X A;  4X9D A;  4D8D A;  4M7D B;  4M75 B;  1X69 A;  1O9S A;  2A0F B;  1QVF A;  2DD5 A;  1VOM A;  1HSQ A;  1PKT A;  2A08 A;  2KDS A;  1YIJ T;  2HBP A;  1D1A A;  4C0D B;  5LJ5 g;  3V8K A;  4A54 A;  3UT1 A;  4C5I A;  3E1S A;  2DTO A;  3OYG A;  1GRI A;  4A63 B;  1I1J A;  4JRQ A;  1H3Z A;  1ZA1 B;  4WCI A;  3GPL A;  4JS5 A;  4CRI A;  1KD1 U;  1AEY A;  1QWE A;  1W2B S;  3CCM A;  2QXF A;  4JUV A;  1Q7Y R;  2Y4Y A;  1U3O A;  3A8O B;  3OYM A;  2A7Y A;  5IAY A;  1QMC A;  3X20 B;  2RI2 A;  1D0X A;  1OU9 A;  3L2Z A;  1WZO A;  3X26 B;  2CT4 A;  2MIO A;  2DBM A;  1C0M A;  5CR2 A;  3M58 A;  1D1B A;  3CCU Q;  1FWZ A;  5GMK i;  2XG8 D;  4HT9 A;  4C8Q F;  4ZN1 A;  1NEG A;  1OU8 A;  5CAI A;  2X4X A;  3JB9 D;  2EGA A;  1YIT T;  5FU6 B;  1QCO A;  2PUO B;  3UA6 A;  2AK5 A;  4XK8 E;  1CKB A;  5LJ5 h;  1OI1 A;  3OY9 A;  1UJ0 A;  2K2M A;  1Q86 U;  3QII A;  3CXC P;  2K3Y A;  1V76 A;  2GFU A;  2GNC A;  4DOW A;  4FT2 A;  4E6R A;  2BZ8 A;  2M51 A;  3HTR A;  3EFO A;  1AD5 A;  4A4K A;  1UHF A;  1U1T A;  1VQM A;  3GF5 A;  4PJO A;  3CPF A;  5LJ5 f;  1B07 A;  1BIA A;  2RQW A;  3MP1 A;  4JZ3 A;  2JN0 A;  4J7I A;  2K2V A;  2MCN A;  3X25 B;  2DEU A;  4JDS A;  3TQ7 P;  2I0N A;  2V1R A;  4J6Y A;  4PJM A;  2V8I A;  3E19 A;  1TG0 A;  1U5S A;  4CI0 C;  1IB8 A;  4QQD A;  3CC4 Q;  2DRK A;  4J9E A;  1PM3 A;  1VQP A;  1K9M C;  1WJQ A;  2GFA A;  3CME A;  1U8R A;  2O2O A;  4M78 G;  1ZX6 A;  1M1G A;  3A1P A;  4M77 D;  3RKY A;  3QJY A;  3PIO A;  2JTF A;  5CKD A;  1WQW A;  2RI5 A;  2DET A;  2DER A;  2LX9 A;  3LW5 E;  1Q82 R;  2E6Z A;  1YIJ A;  4R55 A;  3CBP A;  3A8M B;  4M4Z A;  8ATC B;  2QGG A;  3LLR A;  3G4S Q;  3GOX A;  3H9N A;  1WLP B;  1YHQ T;  4JJB A;  2LP5 A;  4ZN3 A;  5CQY A;  1M2V A;  3MCA B;  4M78 B;  4EMG A;  2KE9 A;  2YDL A;  2RN8 A;  3I56 T;  1TTH B;  3JCM X;  1KD1 R;  1WJS A;  4J9C A;  1G3S A;  1WI7 A;  5GAN 3;  1VQ5 T;  4O6J A;  4EMK C;  2QI2 A;  4ATO A;  1NPP A;  3MEU A;  3OYK A;  4M75 A;  2CSQ A;  4N4I A;  4C92 F;  3JB9 I;  1QCF A;  1AT1 B;  4M75 G;  2MYS A;  4GY5 A;  4TVR A;  1OZ3 A;  3JCM b;  4OMM A;  2VWF A;  2X9H A;  1VQ4 T;  1TXQ A;  5DM7 R;  3ZL7 C;  2IG0 A;  2P84 A;  2EYX A;  3CC2 A;  5GMK j;  4IUQ A;  2ED0 A;  2CZ7 B;  4KH1 B;  4XTZ A;  4Z88 A;  1MMA A;  4UC4 A;  2QK0 A;  2QQ9 A;  4J9D A;  1WXT A;  4A4G A;  2H3J A;  4CC3 A;  2DD4 A;  4Q5W A;  3OYF A;  1FMK A;  2OTJ Q;  2JM8 A;  3QDF A;  2ZAE A;  2QAS A;  4IUT A;  1HYO A;  3CC4 A;  2HQX A;  2LMJ A;  5LJ5 d;  3E9G A;  3Q1J A;  1W2B P;  1KD1 C;  4M7D D;  4OMN A;  1ZUU A;  4QQG A;  3CCV T;  2RHU A;  2E4H A;  4DA4 A;  2P0K A;  1K0S A;  1NLO C;  1OPL A;  3CCQ Q;  1H64 1;  2QDL A;  2M0Y A;  2F5T X;  3UA7 A;  3CPW S;  1VQP T;  1K73 R;  5A2Q E;  2RK1 A;  4PL6 A;  1NZ9 A;  2JMC A;  1KC8 C;  3LH0 A;  1WXU A;  1OPK A;  2DJZ A;  3QZ9 B;  3WVD B;  1AOJ A;  3CPW A;  2KRS A;  2LQK A;  4M75 D;  3I55 Q;  1YI2 T;  3UDC A;  2VKN A;  2A28 A;  4KGV B;  3CC7 A;  2LC4 A;  1FXX A;  2KI7 A;  2CP3 A;  3MET A;  2C0O A;  1IRX A;  1BCM A;  2L3P A;  3HKS A;  3EFO B;  3VU3 C;  2M1H A;  4XU1 A;  1K4U S;  1SPK A;  2GQI A;  2K4Y A;  4HCZ A;  1WHM A;  1KSW A;  4HVW A;  4M7D G;  2CP2 A;  3G4S T;  1H8K A;  4C0G A;  3NPF A;  2EQM A;  2WSF E;  1VQ8 T;  1RLP C;  1BBZ A;  2O9V A;  2VV5 A;  4IKF A;  1VQK A;  3JCM Q;  1AZE A;  3M59 A;  4Z89 A;  4M7A F;  4PJJ A;  2FPF A;  2H3E B;  2D8J A;  5GAN h;  2JXB A;  3C12 A;  1W1F A;  4J9G A;  4A53 A;  4DEX A;  3SFM A;  1R77 A;  3OS2 A;  1TUD A;  2DM1 A;  1D0Z A;  4DBQ A;  1IHV A;  2RQV A;  2EQJ A;  4C8Q A;  5GAO p;  3EFR A;  5FRO A;  4QKU A;  1VYT A;  1M3C A;  3UWN A;  1OX8 A;  2XDD A;  2V26 A;  3E2U A;  2LT1 A;  1PNJ A;  3EGD A;  4RTW A;  3REB B;  2DVJ A;  1WHL A;  1N8R R;  5GAN 6;  3KBG A;  4ZGJ B;  3RMQ A;  1FMV A;  2PVG B;  1VQN A;  4M7A E;  1FMW A;  3DLL A;  3JCM P;  3CCE A;  2LX7 A;  5L23 A;  4EMK B;  4HXJ A;  4LDX A;  2ZGW A;  1YIT Q;  2COY A;  2DMO A;  5KCH A;  1VYV A;  4XTU A;  1BI0 A;  1HJD A;  1SHG A;  4BI3 A;  4RTU A;  2QEX T;  4L5G A;  3OBY A;  3L42 A;  4C8Q E;  3V8J A;  1PSE A;  2D0N A;  4FCY A;  4M78 D;  3OYA A;  2J6O A;  4ELY C;  2YT6 A;  1GBQ A;  2P0P A;  3JB9 G;  2OTL Q;  4ZGD B;  5DLO A;  3CC7 T;  2KMT A;  1S72 A;  3X28 B;  1WHH A;  3HRU A;  5D6Y A;  4PJO C;  1KQS P;  3CBM A;  2CP6 A;  1T0H A;  2AKL A;  4C5H A;  3JCM W;  2M02 A;  3VS7 A;  3PT9 A;  4PKC C;  2ZZD A;  5I2S A;  3M4Y A;  3OYH A;  1RI9 A;  1AWO A;  1M8V A;  3LH5 A;  1U1S A;  5J3B A;  4BE1 A;  2EFI A;  3QUI A;  2SEM A;  3CC7 Q;  2ATC B;  1VQK Q;  1M5Q 1;  1PG5 B;  1PSF A;  3MP8 A;  4OP0 A;  4JJD A;  3L2Q A;  3FJ5 A;  4M75 C;  3S3N A;  4KUI A;  4PJO B;  3JCM c;  4MMK A;  5GAO n;  4FSS A;  4FYV B;  4JRP A;  4X1V A;  1HK9 A;  1KHI A;  3OYC A;  3I9Q A;  2X35 A;  2D1X A;  4AMC A;  4FSX A;  4RTX A;  2DFU A;  4GLK A;  2HL5 C;  2DRM A;  4C92 G;  4AFS C;  1RAB B;  3VS3 A;  4BD3 A;  2I2L A;  1R0B G;  3M4G A;  4N0A A;  4HCC A;  2JS2 A;  3I5R A;  3M54 A;  4II1 A;  1BK2 A;  1W2B A;  3RR6 A;  4BAC A;  1I0C A;  1LOJ A;  3A8L B;  1V1C A;  2DAQ A;  5LJ3 f;  1QVG S;  2DXT A;  2FYK A;  1FX7 A;  5EC7 A;  1PWT A;  1R0C B;  1RAC B;  2DL7 A;  3C4S A;  1M2V B;  3TRE A;  4JS4 A;  5IHK A;  2F2V A;  1YFN A;  3OYL A;  2E41 A;  1NBE B;  1QWF A;  4R56 A;  1NEB A;  1UDL A;  2ZCF B;  4LE9 A;  1Q82 U;  3F70 A;  3N5B B;  1VQ4 Q;  2XDB A;  2RHI A;  4E7K A;  2DE0 X;  1MNE A;  4ZTJ A;  3CC2 Q;  4ZGE B;  2KXD A;  3NFC A;  1MGQ A;  3OA6 A;  1KQ1 A;  1UHC A;  1VQ5 Q;  2MF2 A;  3J7A F;  2CRE A;  2GCX A;  1UGQ B;  1QP3 A;  2ROT A;  1CKA A;  2A36 A;  3CCS Q;  2DTH A;  3EFS A;  5A0D A;  1VIF A;  4AFZ C;  1MMD A;  4XTX A;  1N5Z A;  1I5L A;  1GCQ A;  3CD6 Q;  4XAX B;  4M77 B;  3CCJ A;  2ZPH B;  1VQ9 Q;  1I81 A;  2RHZ A;  4LDV A;  1MHN A;  1WFW A;  2CH4 A;  2E65 A;  4XU3 A;  2NUT A;  3G6E T;  1VQ6 Q;  3EG3 A;  4JPB W;  4IUR A;  5L8R E;  1KJW A;  3DB3 A;  4OGE A;  4RTT A;  2KXC A;  4LNP A;  1G2B A;  5ECA A;  4M7A G;  1G83 A;  5IN1 A;  2CYZ B;  2YRD A;  3OQ5 A;  1QVF P;  1JB0 E;  4OB3 B;  2QTX A;  2KT8 A;  2KYB A;  2HSE B;  1YCS B;  1AWJ A;  1QCN A;  3C95 A;  3CCV Q;  4J6W A;  2AIR B;  3LGF A;  1PC0 A;  2HNI A;  4QW2 A;  1BIB A;  5D6X A;  5CIU A;  1K73 U;  4XU2 A;  4HCK A;  2RJF A;  4M77 C;  5HK0 A;  2PZ1 A;  5CQX A;  1PHT A;  2DXC A;  3HRT A;  4VUB A;  3P8D A;  1WJR A;  3V8L A;  3CCL Q;  5KCO A;  2QA4 T;  5EG2 A;  1MMG A;  2X4J A;  4V2S A;  1RAA B;  2C0I A;  2EAY A;  1M90 R;  3HP9 A;  1SG5 A;  5GAM j;  3I55 A;  3QPH A;  2RM4 A;  5GMK h;  2O4X A;  5GAM d;  1C6V X;  3HHT B;  1K9A A;  5GAN 8;  1W4S A;  3SWN C;  5GAM e;  3VV0 A;  4F7U F;  2K5F A;  1GCP A;  3QSU A;  2JVV A;  2YWW A;  4JJC A;  1SKU B;  3QJ6 A;  2ZPI B;  3QYG B;  1YBY A;  4OB1 B;  2E3H A;  3M0U A;  1H92 A;  3R6N A;  4C92 C;  1VQK T;  2K7A A;  1WXB A;  2DTI A;  2VXE A;  1KG1 A;  4QVZ A;  3CCS T;  1NYF A;  4IUU A;  2NYS A;  1YHQ Q;  4Y91 A;  2FRY A;  2EJG A;  1RAD B;  5CKH A;  3CBO A;  5M9O A;  2F1L A;  1VQ4 A;  4B6M A;  1KC8 U;  3EGD B;  4DBF A;  2HL3 A;  3RER A;  2JTM A;  3CC2 T;  2FZC B;  3DKM A;  2HMA A;  3OS0 A;  2W10 A;  3CCM Q;  1M30 A;  4F7U G;  3DB4 A;  4GBQ A;  1Q95 G;  7AT1 B;  1GBR A;  2YUQ A;  4Y28 E;  3RKW A;  1AWW A;  3H0I A;  1M3B A;  1O75 A;  1VUB A;  1Q7Y C;  1K0X A;  2DPP B;  1EIF A;  2ESW A;  2EGE A;  4EMK A;  2KBT A;  4FYY B;  2WSC E;  2QQB A;  1W70 A;  3PTA A;  2EQK A;  1YJN T;  4MDW A;  1N8R U;  1SRM A;  2DJQ A;  4RCB A;  4X34 A;  4LN2 A;  2F2X A;  2BUD A;  1Y07 A;  3RKX A;  2RHX A;  1ZQ1 A;  4PLI A;  2J7I A;  5GMK l;  1QVG A;  1W6X A;  2E6N A;  2Z0W A;  4JRK A;  2LRQ A;  3QWY A;  4ANJ A;  4M77 A;  4XTW A;  4BB7 A;  3M9Q A;  2QTV A;  1D3B A;  2CT3 A;  1GCQ C;  2DBK A;  2NUT B;  3CMA A;  3G71 T;  2AHJ B;  1I4K 1;  4BY6 C;  2DYB A;  2HKQ B;  2KR3 A;  2PQW A;  2V8J A;  1YJ9 Q;  3JCM J;  2F69 A;  3M56 A;  5CO7 A;  2PNI A;  3EG1 A;  2FVU A;  1UE9 A;  2LJ3 A;  2DIL A;  3VYG A;  1JJ2 P;  1EX4 A;  3OSS C;  1NLP C;  4C8Q D;  3MEW A;  3FC3 A;  2CKK A;  3L2U A;  2A37 A;  2VGN A;  3CCU T;  3REA B;  2DXB A;  3PMT A;  3H0F A;  3FB9 A;  5IXB A;  1BU1 A;  1PD0 A;  2EYW A;  4KT0 E;  5FU6 C;  2CP0 A;  1IGU A;  1SF9 A;  5GAN j;  5D7U A;  5LJ3 d;  1NM7 A;  1VQ8 A;  1TWB A;  2FO0 A;  4LDY A;  1GL5 A;  3H6Z A;  2OX7 A;  1I07 A;  3JCM g;  3GIB A;  4FM4 B;  1RAG B;  4M77 E;  4HVV A;  4P5N A;  1VQ8 Q;  5HK3 A;  4E47 A;  5GAN f;  2CZ6 B;  3RMS A;  2HQE A;  2MK5 A;  1PRL C;  4OMF B;  4EDU A;  2XID A;  1OEB A;  4RCC A;  2JUF A;  3SB2 A;  1M90 C;  2OTL T;  1XOV A;  3CCJ Q;  1VQM T;  1P92 A;  1BKB A;  1M4Z A;  1YJ9 A;  1ZSG A;  5KE3 A;  1JQQ A;  2L2P A;  3I55 T;  2RQT A;  3CMA Q;  3JCM e;  4FW2 A;  2K6D A;  2KSS A;  4C92 D;  1Y7X A;  3T9N A;  1YJN A;  3S3O A;  1QVF S;  3VKI A;  4KUD K;  2L5Q A;  5GAM h;  2G6F X;  1A0N B;  4PJL A;  3ZEH A;  1B34 A;  2RH2 A;  2XKO C;  2NUP A;  3G6E A;  2JS0 A;  2LCL A;  1LJO A;  3UAT A;  1N8R C;  4ESR A;  2D6F A;  2LQW A;  3FRN A;  4DBH A;  1ZUK A;  4BY6 B;  1KC8 R;  1R8O B;  2B8A A;  2J05 A;  1RAI B;  2QEX A;  2RO0 A;  4IIO A;  3CCL T;  4M77 F;  1Q7Y U;  2NWM A;  3QDR B;  5IHI A;  2L3S A;  3MHX A;  1WPY A;  2O9S A;  2ZPB B;  3A5Z B;  5KYW B;  1X01 A;  1Y96 B;  1M8M A;  2OTJ T;  3P8B B;  4LDW A;  4BDY A;  1Z9Z A;  4D8K A;  1LPL A;  5LJ3 g;  2KNB B;  4EMH A;  5HKC A;  2W0Z A;  4B9X A;  4C92 E;  4NS5 A;  4Y92 A;  2KGT A;  3OS1 A;  4F16 A;  1D0Y A;  5CKE A;  1XTD A;  3ER0 A;  2KY9 A;  4L6V 5;  1RLQ C;  2PVO B;  1QLY A;  2JTE A;  3EGU A;  4HCB A;  4M77 G;  4JLG A;  2XU8 A;  5CVI A;  2AKK A;  4AT1 B;  1VQ6 T;  2DL8 A;  5I21 A;  3G1J A;  1WGS A;  1QVG P;  3PE0 A;  5GAN 4;  2RD1 A;  3G7Z A;  1VQ9 T;  4HT8 A;  2K57 A;  3JB9 F;  4D6W A;  1VQM Q;  2E5K A;  1UGR B;  2AZS A;  2VGM A;  1RL2 A;  3G4S A;  2E1H A;  3OYB A;  1JJ2 S;  2DF6 A;  3L2V A;  5I22 A;  3PNW C;  1RAF B;  1YI2 Q;  3V7R A;  1M3A A;  2JNG A;  2DIQ A;  4WF2 A;  3EH1 A;  1UGP B;  3RBB B;  3OBW A;  3L1A A;  1Q86 R;  1SHF A;  2HBW A;  4M7A D;  3CME Q;  4E7L A;  5KYU B;  3M0S A;  4F7U E;  3CCR Q;  1S72 T;  4Z8A A;  2XDP A;  1Q81 C;  3PIP A;  2VUB A;  1MV0 B;  1NJI U;  1SSH A;  1B7T A;  1XJW B;  1VYU A;  2O4X B;  4J9I A;  3RIR A;  2AZV A;  2CP5 A;  2L3Q A;  2C0T A;  3CCQ A;  2YHT A;  3LGL A;  3UPU A;  5KYX B;  4CC4 B;  2XD0 A;  2FG0 A;  1T3S A;  3A8H B;  4J9H A;  5GAO m;  1WDX A;  4E7S A;  1NPR A;  2O01 E;  3I5S A;  3VUZ A;  4BDZ A;  2QQA A;  3EG9 A;  5A0L A;  1G3Y A;  3H41 A;  2L3R A;  1MND A;  2DL3 A;  5LJ5 j;  2YRV A;  5KYN A;  1TSF A;  4DQ2 A;  2JW4 A;  2DO3 A;  1BI2 A;  4PLL A;  3M57 A;  4C0Z A;  1M2O A;  2EYZ A;  2OTL A;  2KAF A;  3SD4 A;  3VUB A;  5J26 A;  3JRZ A;  1M9S A;  2EKO A;  1B34 B;  3FDR A;  2DIG A;  2PUK B;  4N4G A;  1NJI C;  2J06 A;  3SHW A;  2DK3 A;  2NUP B;  3CMA T;  1ABQ A;  1Q82 C;  4XQ3 A;  3EAE A;  1HD3 A;  1SSF A;  3CCJ T;  4QVC A;  3I56 Q;  2LZ6 B;  3EHR A;  1G8X A;  2LQN A;  5DY9 A;  2M9U A;  2HDA A;  4J9F A;  2DZC A;  1G3T A;  4O5V A;  2GF7 A;  2E70 A;  4CC2 A;  3P8H A;  5KYW A;  1PD1 A;  4C5G A;  1E6G A;  4NL3 A;  5I2M A;  1LCK A;  3VRZ A;  2GQV A;  3VJP A;  2EPD A;  1ZBJ A;  1K8A R;  1KK7 A;  3JCM V;  2E64 A;  3ULR B;  3M0R A;  1IGQ A;  1I8F A;  2MMP A;  4IUV A;  4RTZ A;  1WQ7 A;  2DEQ A;  5GMK e;  3HPW A;  2LCC A;  3QYH B;  1BI3 A;  2JMA A;  2KEA A;  1YIJ Q;  2KK4 A;  3ASK A;  4F17 A;  1D3B B;  4FT4 A;  5GAN 2;  3RUX A;  4A4E A;  2RK2 A;  4AFQ C;  1VQO A;  2LDM A;  2FPE A;  3RNJ A;  1K1Z A;  4C92 A;  3CCR A;  2ECZ A;  4MZP A;  3C0C A;  1IHW A;  4JRI A;  2X3X D;  2DX1 A;  2RQR A;  5DLQ E;  2JT4 A;  1HXD A;  2GBQ A;  3OW2 P;  4A4F A;  4BUG A;  1RAH B;  4ME7 A;  1MMN A;  2HSP A;  1OX9 A;  1KQS A;  3PVQ A;  1NE8 A;  5I11 A;  5LJ3 j;  3EHQ A;  1YJ9 T;  2ED1 A;  1JJ2 A;  2R58 A;  5C6S A;  4ELZ C;  4E7J A;  1EZZ B;  4OGC A;  3L2R A;  1Q81 U;  3V7S A;  4C5E A;  2KYM A;  2PU9 B;  1OYX A;  3GNF B;  2XI9 A;  2MOX A;  4X9C A;  2E10 A;  2JJ9 A;  2GTJ A;  3X24 B;  2DL4 A;  5KYU A;  5GJV B;  2R5M A;  5KH6 A;  2YLC A;  1PCX A;  2KT1 A;  5GAN 7;  3M5A A;  2PVD B;  3LYI A;  1X27 A;  4NL2 A;  3LX7 A;  3PMI A;  2O31 A;  3HFN A;  3ZBD A;  3VS0 A;  2M0O A;  2RF0 A;  1UEB A;  3DLM A;  4RKU E;  5FW9 A;  2LNV A;  1M1K R;  4M7D C;  1UB4 A;  3SWN A;  2E3I A;  1TUC A;  2FZK B;  3OSV A;  1UGV A;  1IRE B;  2FHD A;  4KH0 B;  3CXC A;  3JCM d;  1WIE A;  3EGX B;  3H0H A;  2K3X A;  3S6W A;  3L2W A;  4OF1 A;  3OYJ A;  1VQL A;  2ROL A;  3GP8 A;  2K5L A;  2RA2 A;  1TU0 B;  2P0Q A;  1K8A C;  2RMO A;  2DYI A;  3RDV A;  3J80 E;  1QP2 A;  2PTK A;  3CME T;  2A3L A;  2VXF A;  2RHY A;  3EG9 B;  2J6F A;  1ABO A;  1M27 C;  2EQU A;  2BE9 B;  5FWC A;  3G6E Q;  1D1C A; 
#chains in the Genus database with same CATH homology
 1NLP C;  1PNJ A;  2EYY A;  4RTW A;  3REB B;  2DVJ A;  2A37 A;  3REA B;  2EW3 A;  3H0F A;  1UTI A;  5IXB A;  1BU1 A;  2EYW A;  3QWX X;  2J6K A;  1E7O A;  1X6B A;  3PVL A;  3SEM A;  1NM7 A;  2FO0 A;  1GL5 A;  2DNU A;  1I07 A;  2K79 A;  2YSQ A;  2CDT A;  1PKS A;  2D8H A;  2LX7 A;  1YWP A;  1YN8 A;  4J9B A;  5L23 A;  2X3W D;  4HVU A;  4HXJ A;  4HVV A;  2DMO A;  2YUP A;  1UJY A;  1VYV A;  4ORZ A;  1HJD A;  2LCS A;  1SHG A;  4RTU A;  2KRO A;  2P4R A;  2F2W A;  4LUE A;  1B3Q A;  3TSW A;  1JXO A;  2DL5 A;  2D0N A;  2IIM A;  1PRL C;  1X2Q A;  2J6O A;  1OEB A;  2EQI A;  2YT6 A;  4DEY A;  1GBQ A;  1YWO A;  1IO6 A;  1XOV A;  2ENM A;  2KRN A;  1X6G A;  2EKH A;  4ZNX A;  2HEQ A;  1SEM A;  2B86 A;  3VS6 A;  4JZ4 A;  1ARK A;  1T0H A;  2AKL A;  3IQL A;  4RTV A;  1KIK A;  4LUD A;  1ZSG A;  1JQQ A;  2L2P A;  3VS7 A;  2RQT A;  2SRC A;  2K6D A;  1UEC A;  1S1N A;  1QKX A;  1RI9 A;  1AWO A;  1YNZ A;  3I35 A;  2G6F X;  1E6H A;  1A0N B;  2BZX A;  2LJ0 A;  3LH5 A;  3KFV A;  4RTY A;  4D8D A;  2JS0 A;  1FYN A;  1X69 A;  2SEM A;  3UAT A;  1OOT A;  4ESR A;  2LQW A;  1HSQ A;  1PKT A;  1ZUK A;  2L0A A;  2A08 A;  4JJD A;  5FWB A;  3FJ5 A;  2J05 A;  5FWC A;  4IIO A;  1OV3 A;  2O88 A;  2YUN A;  2NWM A;  1UFF A;  4FSS A;  5IHI A;  4X1V A;  2L3S A;  2O9S A;  2DA9 A;  1GRI A;  3I9Q A;  2D1X A;  4A63 B;  1I1J A;  1M8M A;  4RTX A;  4WCI A;  2LJ1 A;  1Z9Z A;  2CH4 W;  1AEY A;  2LNH B;  1QWE A;  4IIM A;  2DRM A;  4CC7 A;  4AFS C;  1U3O A;  4D8K A;  3VS3 A;  4F14 A;  2OI3 A;  2EVR A;  2JS2 A;  4RUG A;  3I5R A;  2KNB B;  1BK2 A;  3VS1 A;  2W0Z A;  4Y92 A;  2CT4 A;  2KGT A;  1I0C A;  2MIO A;  4F16 A;  1V1C A;  2DBM A;  1GFC A;  1T0J A;  1AZG B;  1RLQ C;  1Z9Q A;  2RQU A;  1QLY A;  2VVK A;  2KRM A;  1Y0M A;  2JTE A;  3EGU A;  3M0T A;  5EC7 A;  1NEG A;  2RNA A;  1JO8 A;  3JV3 A;  2AKK A;  1PWT A;  2DL8 A;  1MUZ A;  2EGA A;  2DL7 A;  1U06 A;  3PE0 A;  3UA6 A;  1AWX A;  2AK5 A;  5IHK A;  1CKB A;  1MV3 A;  2F2V A;  1QWF A;  2E5K A;  1NEB A;  1UJ0 A;  2AZS A;  2K2M A;  1UDL A;  2DF6 A;  1UG1 A;  4LE9 A;  2GNC A;  5I22 A;  4E6R A;  2BZ8 A;  2CUB A;  1M3A A;  2OAW A;  2M51 A;  2DE0 X;  1AD5 A;  2YUO A;  1UHF A;  3RBB B;  1CSK A;  2RPN A;  1SHF A;  2KXD A;  2HBW A;  1B07 A;  2RQW A;  4JZ3 A;  1BB9 A;  1WX6 A;  1UHC A;  2MCN A;  2CRE A;  3M0S A;  4Z8A A;  2ROT A;  1CKA A;  2I0N A;  2K3B A;  2V1R A;  2A36 A;  1MV0 B;  1TG0 A;  1SSH A;  1U5S A;  1EFN A;  4AFZ C;  2V1Q A;  2DRK A;  4QT7 A;  4J9E A;  3EG0 A;  3U23 A;  1N5Z A;  1VYU A;  4J9I A;  2AZV A;  2FRW A;  2O2O A;  1GCQ A;  2L3Q A;  2C0T A;  1ZX6 A;  1WYX A;  4CC4 B;  2BZY A;  2FG0 A;  1T3S A;  4J9H A;  1WFW A;  2CH4 A;  3EG3 A;  4JPB W;  4M4Z A;  1KJW A;  1WDX A;  2H8H A;  4RTT A;  3I5S A;  2KXC A;  4LNP A;  1G2B A;  1WLP B;  5ECA A;  4JJB A;  1G83 A;  4K11 A;  2LP5 A;  3H41 A;  2DL3 A;  1ZUY A;  2KE9 A;  4EIK A;  2KT8 A;  2JW4 A;  2KYB A;  3TVT A;  2YDL A;  3THK A;  2RN8 A;  4OML A;  1YCS B;  1AWJ A;  5IHN A;  3EG2 A;  2EYZ A;  5IH2 A;  4J9C A;  1UUE A;  3UF4 A;  1WI7 A;  1JXM A;  4HCK A;  2J06 A;  3SHW A;  2K9G A;  2PZ1 A;  4R0K A;  1PHT A;  2CSQ A;  1ABQ A;  1QCF A;  1JEG A;  1K76 A;  1HD3 A;  2GGR A;  4OMM A;  2VWF A;  3ZL7 C;  2C0I A;  2NUZ A;  2LZ6 B;  3EHR A;  2LQN A;  2EYX A;  4J9F A;  2HDA A;  2ED0 A;  3NHN A;  4Z88 A;  3O5Z A;  4CC2 A;  2CSI A;  2EBP A;  1E6G A;  4J9D A;  1WXT A;  1LCK A;  3VRZ A;  2EPD A;  4CC3 A;  1ZBJ A;  1K9A A;  3ULR B;  3M0R A;  3GBQ A;  1FMK A;  3M0Q A;  4RTZ A;  1X43 A;  2JM8 A;  3VS5 A;  4GLM A;  3VS4 A;  3NGP A;  1GCP A;  1Y57 A;  2LMJ A;  2JMA A;  2KEA A;  4JJC A;  2FEI A;  1ZUU A;  4OMN A;  4F17 A;  3NMZ C;  3VS2 A;  1JU5 C;  4AFQ C;  3M0U A;  1QKW A;  2FPE A;  3A98 A;  1K1Z A;  3RNJ A;  1K0S A;  2ECZ A;  3R6N A;  1H92 A;  1NLO C;  1OPL A;  3C0C A;  2K7A A;  2X3X D;  1WXB A;  1H3H A;  2QDL A;  2DX1 A;  2M0Y A;  1NYF A;  2RQR A;  2JT4 A;  2EGC A;  1AVZ C;  2FRY A;  3UA7 A;  2GBQ A;  1J3T A;  3CQT A;  2JMC A;  1WXU A;  2HSP A;  1OPK A;  2JM9 A;  3PVQ A;  4AFU C;  2XMF A;  5I11 A;  2ABL A;  1VA7 A;  1AOJ A;  3EHQ A;  2KRS A;  2ED1 A;  2W10 A;  1M30 A;  2VKN A;  2A28 A;  4GBQ A;  1RUW A;  1GBR A;  4AG2 C;  2YUQ A;  1GFD A;  1AWW A;  3H0I A;  2C0O A;  1M3B A;  2L3P A;  5HCK A;  5IXF A;  2DLP A;  2KYM A;  4OMQ A;  1K0X A;  1NG2 A;  1NYG A;  2MOX A;  2ESW A;  2EGE A;  1K4U S;  1SPK A;  2GQI A;  2KBT A;  1KSW A;  4HVW A;  2BTT A;  2GTJ A;  1W70 A;  1T3L A;  2DL4 A;  5GJV B;  3VRY A;  1H8K A;  3NPF A;  1SRM A;  2DJQ A;  4LN2 A;  2F2X A;  1RLP C;  2HCK A;  2O9V A;  1BBZ A;  2KT1 A;  2OJ2 A;  1AZE A;  2J7I A;  4KRT A;  1X2K A;  1W6X A;  4Z89 A;  1ZLM A;  1X27 A;  2FPF A;  1WA7 A;  2O31 A;  2D8J A;  3QWY A;  3VS0 A;  3TSZ A;  2RF0 A;  5GJW B;  5FW9 A;  2JXB A;  4OMP A;  1W1F A;  1TUC A;  4J9G A;  2FPD A;  1UGV A;  4DEX A;  1WIE A;  3H0H A;  2CT3 A;  1KFZ A;  1GCQ C;  1TUD A;  2DBK A;  2DM1 A;  2RQV A;  1PRM C;  2DYB A;  2ROL A;  1VYT A;  2KR3 A;  1M3C A;  2RMO A;  4AG1 C;  2PNI A;  3EG1 A;  2PTK A;  4OMO A;  1SRL A;  1YP5 A;  2CUD A;  3M0P A;  1UE9 A;  2J6F A;  2LJ3 A;  1ABO A;  1M27 C;  2DIL A;  2GTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...