2LX7A

Solution nmr structure of sh3 domain of growth arrest-specific protein 7 (gas7) (fragment 1-60) from homo sapiens, northeast structural genomics consortium (nesg) target hr8574a
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
MSGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGWFPASYVQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth arrest-specific protein 7
publication title Solution NMR structure of SH3 domain of growth arrest-specific protein 7 (GAS7) (fragment 1-60) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8574A
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lx7A00
1M3CA 1MV3A 2L3PA 3SEMA 4QT7A 1GRIA 1QLYA 1W6XA 2LMJA 4WCIA 4LUEA 1NYFA 1M3AA 4CC3A 1ABQA 3A98A 1X69A 1M27C 3M0UA 3I5RA 2M0YA 1X6GA 2H8HA 1ZBJA 2CUDA 2P4RA 3VS3A 1SRMA 2C0OA 2LJ3A 2FPEA 2CSIA 2EGCA 4X1VA 1OEBA 1TUCA 2AK5A 4HVWA 4LN2A 2BZ8A 1CSKA 2KXCA 3VS0A 2A28A 2OAWA 1EFNA 3C0CA 2MIOA 1PNJA 4HCKA 4CC7A 1N5ZA 1NM7A 3NMZC 4K11A 1UDLA 1RLPC 1PRLC 2V1QA 3ULRB 2CH4A 1HD3A 2FPDA 3VS7A 2KYBA 2L3QA 2PNIA 2YSQA 1UTIA 4CC2A 2LJ1A 1ZX6A 2EGAA 2FEIA 3O5ZA 4KRTA 4OMOA 1VYUA 4OMNA 3KFVA 3M0QA 2JTEA 4OMLA 2ED0A 4Y92A 2JMCA 2RN8A 3PVQA 4J9CA 2EW3A 1ZSGA 3UA7A 3M0TA 1YWOA 2MOXA 1UHCA 2O9VA 2LP5A 2ENMA 2HEQA 1AVZC 2A37A 2DRKA 1UJ0A 2NWMA 2DX1A 4LNPA 1U3OA 2KE9A 2YDLA 1UG1A 1AWOA 3EGUA 2RNAA 1JXOA 2PZ1A 4AG2C 3IQLA 3REBB 4Z89A 2A08A 1SPKA 4RUGA 2FPFA 2GTOA 1AWJA 1UE9A 2ROTA 2DF6A 1Y57A 1AZEA 3TSWA 2DNUA 5FWBA 1WFWA 4ZNXA 1GCPA 2EYXA 2CUBA 2DA9A 1U06A 2M51A 2K3BA 4FSSA 3REAB 3SHWA 3EHRA 2J7IA 5IHIA 5IHNA 4J9FA 2KYMA 3VS2A 2LQNA 1NYGA 2DL5A 1PKTA 2O31A 2A36A 3RBBB 1TG0A 1OOTA 3VS5A 1UUEA 1NEGA 1YCSB 3UF4A 1UFFA 1WLPB 2DL8A 4D8DA 2VVKA 1BK2A 3M0SA 4JJDA 3VRYA 2KNBB 1M30A 2KRNA 1FYNA 4JZ3A 2DVJA 2DYBA 2F2WA 2L2PA 1LCKA 4E6RA 2K79A 2D8HA 2JMAA 2NUZA 4GLMA 1E7OA 2DLPA 2CSQA 2JM9A 1GFCA 3TVTA 2FRWA 5IXFA 2KR3A 2FG0A 2ABLA 2HDAA 1AEYA 1K76A 1NLOC 1X43A 1WDXA 3U23A 3R6NA 2OI3A 1X6BA 2KRMA 1RLQC 1PWTA 1WXTA 2CREA 2CT3A 3UA6A 2D1XA 1K0XA 4AFQC 2CH4W 3VS1A 2B86A 2EKHA 1OPLA 1G83A 4OMPA 3H0IA 1GBQA 1SRLA 1T3SA 1V1CA 1SSHA 3I9QA 4A63B 2DE0X 4J9HA 2HBWA 2KBTA 4RTVA 1Z9ZA 2LCSA 3EG1A 2YUOA 2DL3A 1KFZA 2J6KA 1SHGA 4HXJA 1HJDA 2O2OA 5I22A 2J05A 4F14A 1PHTA 3CQTA 2DJQA 1J3TA 2KT8A 4JJBA 2C0IA 2BTTA 4AG1C 2EVRA 4CC4B 3NPFA 4AFZC 2RQRA 1NLPC 1GCQC 2OJ2A 1RUWA 1WXBA 2K6DA 2LZ6B 2AKKA 1T3LA 2FRYA 1AD5A 2J6OA 5GJWB 4D8KA 2KEAA 2DBMA 3EG0A 3RNJA 2YUNA 2JS0A 1NEBA 2G6FX 1BU1A 3NGPA 2I0NA 1H92A 2PTKA 4J9EA 4DEYA 2W0ZA 1YN8A 2EBPA 1VA7A 1RI9A 2ROLA 2RQTA 3GBQA 1PRMC 2BZXA 2FO0A 3JV3A 1JO8A 3QWXX 1UECA 1JU5C 1B07A 5IHKA 1MUZA 2EYWA 1QCFA 3LH5A 1BBZA 1K4US 2LJ0A 2V1RA 1YWPA 3THKA 1T0JA 1GL5A 2RQVA 1BB9A 4RTUA 1UJYA 1I0CA 2MCNA 5L23A 1S1NA 2KGTA 4Z88A 4OMMA 1KSWA 1NG2A 2JM8A 1QWEA 2EQIA 2LNHB 3M0PA 1B3QA 2HCKA 2C0TA 1T0HA 1IO6A 4R0KA 3PVLA 3I5SA 2XMFA 1KIKA 1AOJA 4AFSC 3ZL7C 1VYTA 4IIOA 5HCKA 1WA7A 5FW9A 4J9IA 3NHNA 1X27A 3H0FA 1OPKA 2W10A 3H41A 1I1JA 2DBKA 1ZUYA 2JXBA 2O9SA 4M4ZA 1U5SA 2QDLA 2E5KA 1E6GA 2DL7A 2GBQA 3UATA 1WX6A 2DILA 1AWXA 1X2KA 5FWCA 1GBRA 2L0AA 1K1ZA 1YNZA 2X3WD 2X3XD 1H8KA 2YUPA 2EYZA 2DM1A 2RQWA 2RMOA 2JT4A 4LUDA 2JS2A 1VYVA 1OV3A 4AFUC 2KT1A 1Z9QA 1KJWA 4DEXA 3FJ5A 4ESRA 4JZ4A 1WI7A 3VS4A 1MV0B 3EG2A 4RTXA 1XOVA 3M0RA 2ESWA 1ARKA 1E6HA 2BZYA 2EYYA 4Z8AA 1JXMA 2J06A 2SEMA 2RQUA 2F2VA 4HVUA 2AKLA 2LQWA 1X2QA 5I11A 2GNCA 3H0HA 2DRMA 3VS6A 2J6FA 2JW4A 2K9GA 1PKSA 2YT6A 4RTWA 4RTYA 1JQQA 2HSPA 4JJCA 1M3BA 1QKWA 1K0SA 4OMQA 1ABOA 5IXBA 4RTTA 1A0NB 3I35A 2CT4A 2F2XA 4IIMA 5IH2A 2RPNA 2DL4A 4JPBW 1WIEA 1UHFA 1ZUUA 2ED1A 3PE0A 4J9DA 2RF0A 4GBQA 1SHFA 5ECAA 1M8MA 1TUDA 2GQIA 2EGEA 2AZSA 1SEMA 4F17A 4J9GA 2YUQA 1G2BA 1HSQA 3EHQA 2GGRA 2L3SA 2CDTA 2D0NA 3QWYA 4F16A 1UGVA 2SRCA 4RTZA 4LE9A 2DMOA 1JEGA 4J9BA 2VWFA 1YP5A 1W1FA 2O88A 2GTJA 1ZLMA 1GCQA 1CKAA 2KROA 2K2MA 2AZVA 1QWFA 2K7AA 1WXUA 3VRZA 5EC7A 2KXDA 1GFDA 5GJVB 1QKXA 4EIKA 1W70A 1WYXA 1CKBA 1K9AA 2KRSA 1AWWA 1Y0MA 1ZUKA 4HVVA 1FMKA 3EG3A 1I07A 2EPDA 2IIMA 1H3HA 3TSZA 2D8JA 1AZGB 2VKNA 4ORZA 2ECZA 2LX7A
chains in the Genus database with same CATH superfamily
2HKQB 5KH6A 1MV3A 2XDBA 3SEMA 3HTRA 1W6XA 4DA4A 3JB9G 2A3LA 1NYFA 5A0DA 3L2WA 3I56A 1YJWT 3M0UA 1WHGA 1ZBJA 1QQJA 3TCJA 3G6EA 3RKXA 2CSIA 1WJSA 4JDSA 1TUCA 3G4SA 3BDUA 1CSKA 1I5LA 1SG5A 4JJNK 5GMKe 2MIOA 1VQKQ 4CC7A 1IRXA 1NM7A 3CCUQ 3ULRB 1PRLC 3UWNA 1QVPA 4DBFA 2PNIA 2YSQA 1OX9A 5KCHA 3CC4Q 2LVMA 3CMAT 5GAOp 3BY7A 4XTWA 3DB4A 1W2BP 2JTEA 4CI0C 3JCMV 2E65A 1KC8C 2DXBA 2DXTA 3SWNA 2JMCA 1K8AU 1KQ2A 3C95A 3KUFA 4M7AE 5CK9A 2ATCB 1K8AR 2MF2A 5DLOA 2QA4Q 1YI2Q 1UHCA 2O9VA 4M78B 2ENMA 2HEQA 2DRKA 1UJ0A 4C92C 2DX1A 4MZMA 1U3OA 2KE9A 4ZTFA 4M75A 2E64A 2QASA 2QQBA 1NJIC 2RNAA 2LTOA 3ER0A 4AG2C 3EFRA 4BDYA 3REBB 5D6XA 4RUGA 1K73U 3EG9B 4NOYA 4B9XA 3OYNA 2AIRB 4C5EA 1K73R 4Y28E 4UC4A 3ASKA 1GCPA 2EYXA 4JLGA 3VKIA 2QYZA 1TSFA 4FSSA 1BKBA 2YRDA 8AT1B 2QQ9A 1JB0E 5CQYA 2KYMA 2LQNA 1KG1A 3OSSC 2FL7A 2ZPFB 3CCMA 3E9FA 4PK4A 1M2OA 1TG0A 2L5QA 3FRNA 5D6WA 2RI2A 3UF4A 2YWWA 1RAEB 3QDRB 2VVKA 4PJOE 1Q86R 2LCCA 1MMAA 4PJNA 1QVGS 4HKEA 1P92A 3OYJA 4V2SA 4RCCA 2K3YA 2EJFA 2DYBA 4IUQA 3QBYA 2L2PA 3HFNA 2M1HA 2NYSA 2CZ0B 3PIPA 2CSQA 3TQ7P 2FRWA 3QIIA 4F7UA 1QW1A 3MHXA 2ZZDA 3EH2A 2ABLA 1JJ2P 1AEYA 5GAOn 1NLOC 1ZSZB 2E5QA 2OI3A 1M1GA 2KRMA 3PNWC 3QZ9B 3FEOA 2QG9B 2V8JA 3PMIA 5J3BA 3RMSA 3V7CA 3OYBA 1HK9A 1UGPB 2MWOA 2NUPA 1IHWA 2CH4W 1K0XA 3VV0A 3VJPA 4ZGEB 4J7IA 3H0IA 1T3SA 1V1CA 3INZA 4M7DE 4JS4A 2DE0X 2WSCE 2RJDA 1KQ1A 2HBWA 4LDUA 3PIOA 2DAQA 3DKMA 3V8LA 2DL3A 3CCVA 3M58A 2HAXA 1SHGA 2V26A 4OP0A 5IT9E 1KHIA 4FYYB 1J3TA 2RB6A 2VGMA 3VUZA 4JJBA 2C0IA 4C8QB 4M7AD 2XIDA 1D1AA 1NLPC 3RUXA 1GCQC 1G8XA 4L6V5 1D0YA 4M77E 2ZPBB 4E2FB 2KEAA 2HQEA 1VQMQ 4E47A 3JRZA 2YUNA 2M0OA 5GAN2 2L89A 1NEBA 2G6FX 2QXFA 1R77A 2ZPEB 3NFCA 3TU4K 4M78G 3QXEB 4J9EA 2OTJQ 1YN8A 2EBPA 1VA7A 9ATCB 3GBQA 1D0XA 2BZXA 4BACA 1Q81C 2R5MA 1VQOA 1B07A 2E4HA 1BBZA 4XK8E 2LJ0A 1VQLA 1VQ9T 1XTDA 5CKFA 1K4US 2VYTA 4EMKA 5GAMg 2RQVA 1VQNT 4DQ2A 1YJ9A 5EG2A 2MCNA 1EIFA 8ATCB 3QO3A 2KGTA 3X26B 3JCMe 1QWEA 2EQIA 3CCJT 4PJOD 3OYFA 2HCKA 2C0TA 1VQ5A 4R55A 4E7KA 3EGDA 4QQDA 1IO6A 3CC2Q 3C12A 5GANg 2DTOA 1KIKA 5FROA 2XI9A 3ZL7C 4C0FA 1X27A 3GLXA 2YLBA 2W10A 2HQHA 2YRVA 5LJ3f 3BFMA 3CXCA 2DBKA 4PJLA 1BCMA 4XTXA 4M4ZA 3KXTA 5DM7R 5KYXA 4C5GA 2JUFA 4PFPA 2QEXA 1E6GA 3P8DA 1Y96A 1ZBXA 4X34A 1M5Q1 2G3RA 1U1SA 4ZTJA 3SFMA 3L2QA 4XTZA 1VQKT 3FC3A 2FVUA 4RG8A 5I21A 1BI2A 2RHYA 2X3XD 2RMOA 4LUDA 2JT4A 2Y4YA 3META 3X28B 4M7DD 2RK2A 3JCMJ 1VYVA 1YIJA 2EQUA 4AFUC 4DEXA 3FJ5A 1WI7A 5CR2A 3OMGA 1QP3A 3CMAQ 3EG2A 3CCSA 1V76A 5CAIA 2BZYA 3KBGA 2EYYA 4HA8A 4Z8AA 3RKWA 2SEMA 3MEAA 4C0DC 2PVOB 2LQWA 2X9HA 3HRTA 3LW5E 4M7AA 2QA4T 1YJNQ 5I11A 2FB7A 2DRMA 2J6FA 2JW4A 4C8QF 1JQQA 4FW1A 3OYAA 1M3BA 1JRIA 1QKWA 1M2VB 4OMQA 1H3ZA 4RTTA 2EJ9A 4M77D 2CT4A 3OYIA 2HNIA 4ZGJB 1KQSS 4Q5WA 4VUBA 2LCLA 4C8QG 3PE0A 4E7LA 5FRNA 1PSEA 3CBPA 3GNGA 1VQPQ 5KYNA 1SHFA 1QVFS 2O4XA 3CCEQ 1TTHB 2CZ7B 3OSVA 4L59A 2VC8A 4PJMA 1FMVA 2YUQA 2JTFA 1HSQA 2PUOB 3CPFA 2QI2A 2IPOB 2DTIA 1LJOA 1G3TA 2CDTA 2GGRA 2CYZB 4F16A 4MMLA 1BI0A 4ELYC 4J9BA 3I56Q 2VWFA 1XNIA 3CD6A 3EGXA 4PJOA 1CKAA 1MMNA 2AZVA 5CCAA 2K7AA 3G6EQ 3JAME 2KXDA 3QUIA 2X35A 3G4SQ 4N0AA 1CKBA 1K9AA 1KK7A 4M75F 4J6XA 4C92D 4HVVA 3EG3A 1VQ7A 1RACB 3M4GA 2CP5A 4F7UE 4PL6A 2D8JA 2E1HA 5GMKi 1I81A 5FU7C 2HL3A 4IUVA 4QT7A 1GRIA 1QLYA 2K4YA 3CPWA 3A1PA 5AYFA 5KYUB 1ABQA 5KYWA 2H3EB 3OS5A 2M0YA 2P4RA 1SRMA 4CRIA 2LJ3A 3GOXA 3OB9A 2EGCA 1OEBA 2PUKB 2DK3A 4HVWA 2BZ8A 2KXCA 1IXDA 1EFNA 4M7DA 2EFIA 3C0CA 1WGSA 1PNJA 4HCKA 1N5ZA 3JCMb 3OS1A 1UDLA 1RLPC 4BB7A 4JRQA 2YRCA 1HD3A 2FPDA 2L3RA 3VS7A 5J39A 2L3QA 2WACA 1UTIA 2M02A 2LJ1A 1EZZB 1MMGA 1WHMA 2M16A 2CP0A 2ZCFB 3P8BB 3WVDB 5A0LA 2KMTA 4KRTA 4OMOA 3ME9A 1VYUA 2JTMA 4LDWA 3S6WA 4Y92A 4PKCC 4DOWA 4A4GA 1RAGB 2HMAA 2LRQA 2EW3A 3OYLA 3M0TA 2MOXA 3OYMA 3I55A 1VQ8A 1OU9A 3CMEA 1BIBA 4M77A 1VQMT 3CCMQ 2YDLA 1YITA 5LJ5d 3EGUA 4AMCA 3WVEB 1JXOA 1BYMA 3IQLA 2QDYB 1M1KC 2A08A 1SPKA 2OTJT 1AWJA 3MJXA 2DF6A 2XK0A 2DNUA 4IUPA 3CCQA 5GAN4 1W4SA 2DXUA 2GQVA 3GIBA 1QCNA 2JVVA 3MP8A 2OAUA 2J7IA 2XD0A 2OTLT 1WHKA 1G3WA 3NTHA 5IHNA 4JUVA 3VS2A 1VQNQ 2X4XA 3OBWA 2O31A 1Q7YR 2A36A 1YHQA 1MNEA 1OOTA 1NEGA 2KAFA 3S3OA 1WLPB 4KUDK 4LDYA 3RKYA 3CC2T 1RADB 1Q95G 1S72A 3VRYA 1RI0A 3HRUA 4C92A 1HYOA 4A4HA 4JZ3A 3CCLA 5FRMA 2DVJA 3FDRA 4KGXB 3JCMX 4J5YA 4E6RA 4DBRA 2JMAA 2E10A 1KQSP 3J80E 2L8DA 4MDWA 5CKDA 1RAFB 2KI7A 2FG0A 4E7IA 3CCVQ 3VYHB 2ZPHB 4Z02A 2HDAA 3LGFA 3LLRA 1IGQA 3CEYA 2XICA 5GAMh 1Q82R 3FB9A 1G5VA 1NE8A 2CT3A 2P0KA 2V8IA 4BE1A 2B86A 2EKHA 1N6AA 1OPLA 2K5IA 1MHNA 5GANh 3I9QA 4YTLA 3M57A 2KBTA 4QQGA 4RTVA 1Z9ZA 2DKGA 2YXYA 1PCXA 1ZSZC 2J6KA 4BE0A 3RR6A 5I22A 4BUGA 1YJNT 2DEQA 2WSEE 3CCQT 1X75C 2J05A 3EFOB 3MEWA 4F14A 1PHTA 1I5OB 3CQTA 2KT8A 5CKHA 2BTTA 1IZ6A 1VQOQ 5CKBA 1FX7A 4HT9A 1JJ2A 2VV5A 1VQLQ 3NPFA 4AFZC 2RQRA 4EPCA 1OX8A 2O01E 1RUWA 2K6DA 2LZ6B 2AKKA 1YJ9Q 1T3LA 2FRYA 1AD5A 4F04B 4FT4A 4O5VA 3FJPA 2AHJB 2DBMA 4N4GA 1VQPT 3RNJA 1F1BB 3QJ6A 3GF5A 3GP8A 3JB9D 3HP9A 3CCET 3NGPA 1VQ5Q 1H92A 4EDUA 4OB2B 2PTKA 4LD9K 3HKSA 2JZ2A 5FU6B 4MZPA 2ROLA 5LJ3g 3A8LB 1PRMC 2FO0A 4A4KA 3M53A 4TVRA 4C8QC 3QWXX 1UECA 1JU5C 4WF2A 1X6OA 3PTAA 4RKUE 1Q86U 1BB9A 4RTUA 3I56T 1VQ6A 4HCBA 3SD4A 1YCYA 5L23A 3HL8A 3G6ET 1WJRA 4M7AF 4WTOB 5GAN3 2QEXQ 2RI3A 4OMMA 4RCBA 3L2RA 3JSCA 4HT8A 4C5IA 3G4ST 2X4WA 2LQ8A 1TOVA 1KD1U 1Y71A 4R0KA 1WHJA 2LDMA 2K5FA 2XMFA 1KD1R 1AOJA 4QQ6A 1UGRB 2EQKA 3HFOA 4J6YA 1VYTA 3GNFB 4IIOA 1K8AC 1WA7A 3G71A 4J9IA 1Y7XA 1WJQA 1I4K1 3QSUA 1YIJQ 2RD1A 4ZN3A 3H0FA 3UPUA 1M90U 1BI1A 1I1JA 2CS7A 4KH1B 2E3HA 1M90R 3CCSQ 5KYYA 1YBYA 4Y91A 5CQXA 3RMQA 3LH0A 3OW2P 2E5KA 2DL7A 2MYSA 4JRKA 3UATA 4M78E 4M75C 3L2UA 1K73C 1WNLA 2DILA 1AWXA 1GBRA 2L0AA 4XTYA 3JB9H 1JBMA 4NL2A 3JB9J 2YUPA 2EYZA 4PJOF 1B34A 1KHCA 3MO8A 2VUBA 1D1CA 1TU0B 3H6ZA 1OV3A 2K5LA 4XU1A 3JCMQ 4JZ4A 2NUTB 1N8RR 1MMDA 4RTXA 3E1SA 5KE2A 1Q86C 3OQ5A 4BY6B 3H0HA 3J7AF 1M8VA 3VS6A 2K9GA 1PKSA 3CCMT 2HSPA 5DLQE 2JOYA 4A53A 1KD1C 1K0SA 1ABOA 4PLIA 5A0GA 2QGFB 2F2XA 2RPNA 1RAHB 3L1AA 3OYEA 2HZYA 4JPBW 1AHJB 1UHFA 2EQMA 2ED1A 3CCUA 2RF0A 4GBQA 4ATOA 4M7DF 1M90C 1M8MA 3LWIA 1TUDA 3CC4A 2ZPIB 2AZSA 3S3NA 5LJ5g 1VQ7Q 5KCOA 2EJGA 4J9GA 3ZFJA 5CKEA 2K3XA 3H8ZA 2OTLQ 3QWYA 2D0NA 2L3SA 2RI5A 3SWNB 2KVQG 2DJZA 2DIGA 4LE9A 4O6JA 5LJ3j 1YI2A 3RERA 2COWA 2XG8D 1SKUB 1W1FA 3M54A 2GTJA 1ZLMA 3A8GB 3FIFA 1PD0A 4M75B 1LNXA 5KE3A 4C92E 2MWPA 3VRZA 5EC7A 3NTKA 1GFDA 3O8VA 4M77F 5GJVB 1QKXA 4EIKA 3OS2A 1WYXA 2KRSA 4A4FA 1AWWA 2BE7D 4NS5A 3JCMf 1WZOA 2IIMA 1UB4A 3TSZA 3CCVT 1EX4A 2ECZA 1M3CA 2Z0WA 2E3IA 4WCIA 2LMJA 4LUEA 4XAXB 3ZEHA 1PM3A 3E19A 4CC3A 1D3BA 4A54A 2XKOC 3C4SA 4C8QE 3BDLA 3I5RA 1X6GA 2CUDA 3FLGA 3VS3A 2C0OA 2FPEA 3A8OB 4M78D 3I55Q 4X1VA 1VQ8Q 3CMEQ 5GMKm 3VS0A 2A28A 2OAWA 3M59A 2AT1B 3EH1A 1YITQ 4K11A 3NMZC 1QVGP 2V1QA 4ZN1A 2JJ9A 3CC7A 4CC2A 4GLKA 2K57A 1ZX6A 2EGAA 1XQHA 1TH7A 4J83A 2FEIA 3O5ZA 4F7UB 2KY9A 3CCQQ 3KFVA 1VQOT 3PT9A 2ED0A 2KK4A 2OX7A 1O9SA 4OVAA 4J9CA 1VQLT 1YWOA 3JCMd 2RO0A 3LGLA 1YJ9T 4FYWB 4JLIA 1V29B 3HPWA 1AVZC 2NWMA 4LDVA 2D0QB 3JCMW 4LNPA 3S3MA 1UG1A 3TREA 5HKCA 2NUPB 3GPLA 2FYKA 1VQ5T 4QVZA 1VOMA 1UE9A 1S72Q 4RMOA 2ROTA 1OQKA 3CCLQ 1Y57A 3VU3C 2RK1A 4ZNXA 4L5GA 2DA9A 1U06A 2FHDA 2RJFA 2KQWA 3REAB 1RAIB 3WXMB 4N4IA 5GMKl 2EKOA 4J9FA 1BCOA 2QEXT 3RBBB 3MP6A 3CCRA 3VS5A 5GAOq 2HQXA 1YCSB 5GAMj 1UFFA 2DL8A 1IREB 3M0SA 1RABB 2KNBB 2KRNA 1OZ3A 1BIAA 1FYNA 1LCKA 3M56A 1YIJT 3V7RA 2D8HA 5LJ3h 2NUZA 2DLPA 5GANj 1VQ4A 5LJ5f 2DIQA 2DFUA 4M75G 5GAMe 3CCST 3NTIA 2F5TX 2F1LA 4M7AC 4P5NA 1WDXA 3U23A 3R6NA 4XTUA 4EMKB 1RLQC 4QVDA 4BD3A 4JRPA 1NPRA 4C8QD 4M78A 4QW2A 1PWTA 1WXTA 2CREA 5J26A 2CZ6B 1UGQB 5GANe 3VS1A 2HBPA 2HD0A 1UEBA 1G83A 4OMPA 1SSHA 1DJ7B 3EGDB 4OGCA 4QVCA 1RL2A 1C1AA 4J9HA 1O75A 2DZCA 3EG9A 2R57A 5I2MA 4XU0A 1HJDA 4HXJA 3AHUA 2O2OA 4F7UF 1OU8A 2JN0A 2DJQA 1KQSA 2QQRA 2XDDA 4ZGDB 5M9OA 1VIFA 3F70A 4AG1C 1YJWA 3BW1A 2GF7A 5KYXB 2DXCA 2GFUA 2ZAEA 3MPUB 4FIBA 1Y96B 4PJOC 4LXCA 1VQ6Q 1IGUA 4XTVA 3CD6T 4F7UG 4OMFB 2P4TA 3QYGB 5GJWB 4D8KA 1BI3A 3C94A 3EG0A 2EWNA 2JS0A 2DETA 1BU1A 2I0NA 2LQKA 2X4JA 1VQ7T 4DEYA 2W0ZA 2CP7A 2RQTA 1RI9A 1TWBA 3CMAA 3JV3A 2HSEB 2RHUA 4FYXB 1Q7YU 4FW2A 3P8HA 2CZ1B 1MUZA 5IN1A 1W2BA 3R6OA 1ZSZA 2EYWA 4RG2A 1YWPA 3THKA 4M7AB 3QJYA 5GAOr 1UJYA 3PGGA 1I0CA 1G3SA 2QAZA 3VUBA 4QKUA 2KDSA 1KSWA 2JM8A 2RHXA 2DZ9A 4M7DC 4IUTA 1KC8R 1B3QA 2KSSA 2XHCA 5FU6C 1M1FA 3I5SA 5LL6S 2FZGB 2X4YA 1NJIU 4C0GA 3JB9F 1WQWA 2RHZA 5FW9A 3SB2A 2O4XB 5LJ5h 1Q82U 1NJIR 1OPKA 1QVFP 4D6WA 2X51A 3LX7A 2JNGA 3EFSA 1N9RA 2RA2A 4E7SA 5GAOm 4OGEA 4KH0B 4C8QA 2JXBA 2O9SA 2QDLA 5GMKj 2MPXC 3I55T 1VQ8T 4M77C 2D6FA 3CMET 5GAN7 3MCAB 3LYIA 1YITT 3EGXB 3OYCA 4PJOB 1WHLA 5FWCA 4OB3B 1H8KA 2RQWA 2DYIA 2XDPA 2LT4A 2JS2A 2QGGA 4XU3A 4E7ZA 2DVEA 1KJWA 4PNOA 1Q7YC 3VS4A 1MV0B 3ZBDA 5CIUA 2CKKA 1XOVA 2FZKB 3M0RA 3QDFA 2ESWA 2IG0A 2DEUA 1E6HA 1NBEB 2J06A 2RQUA 5L8RE 2F2VA 4PJJA 1LVKA 2AKLA 3RIRA 5GAN6 3RESA 1X2QA 5A2QE 4II1A 4RTWA 4RTYA 2YT6A 5KYWB 1SF9A 2MK5A 1PSFA 1YHQT 4JJCA 1VUBA 4GY5A 4DBQA 2LC4A 4J7FA 1FXXA 1LOJA 3OW2A 3M4YA 1A0NB 3I35A 2NLUA 5IH2A 3URGA 2XU8A 1S72T 1WIEA 4M7DB 3QPHA 3CCLT 2MAMA 3A8MB 3JCMg 3T9NA 4J9DA 4EMGA 1OYXA 1Q82C 3CBMA 1D1BA 5CVIA 5ECAA 5GAOl 3Q1JA 2GQIA 2EGEA 4JRIA 2EYQA 4BY6C 4KGVB 4F17A 2LNVA 3L2ZA 3EHQA 3UDCA 1H641 2E6ZA 2DMOA 1JEGA 2LX9A 3OYHA 4AT1B 4PFZA 2FZCB 2O88A 4M77B 1GCQA 2VB6A 2K2MA 1K9MU 1QWFA 1WXUA 2ZGWA 3X25B 1K9MR 4M7AG 1W70A 2K2VA 1ZQ1A 1Y0MA 1ZUKA 1FMKA 1I07A 4BI4A 3L2VA 4ME7A 1QCOA 2EPDA 1G3YA 3SWNC 1C6VX 5AT1B 4BDZA 2I2LA 2PVGB 2LX7A 3CC7Q 3E2UA 2L3PA 3SDZA 4C5HA 3EAEA 2B8AA 3QG1A 2DTHA 3QZ5B 3QKJA 1VQ9A 1M3AA 3V8JA 1MGQA 3A98A 1VQNA 1X69A 2QQSA 1Q81U 3OA6A 1M27C 2E41A 1R0BG 2YLCA 2H8HA 1Q81R 1M2VA 2VXEA 3CCJA 2AK5A 4LN2A 3BE3A 4BI3A 2R58A 1N8RU 3CXCS 2EIFA 2HKNA 3OYDA 4C92B 2BKDN 2CH4A 2VXFA 5GMKh 1QP2A 2KYBA 1U1TA 2DERA 4FT2A 4PJOG 2P0QA 2A7YA 4OMNA 3M0QA 4OMLA 4ELZC 2RN8A 3PVQA 1ZA2B 1ZSGA 1R8OB 2LT1A 3UA7A 3M9QA 2WSFE 1VQ6T 3A8HB 1RAAB 3G1JA 3QYHB 5FLXE 2LP5A 1K9MC 2A37A 3CD6Q 3QHSA 2Y90A 4KULA 4KUIA 1VQKA 1AWOA 3J81E 3CCRQ 4M78F 4HCCA 4OB0B 2PZ1A 3DLMA 5GAN5 4XQ3A 4Z89A 2PU9B 2FPFA 2GTOA 4FSXA 1UGSB 1MNDA 1AZEA 3TSWA 5FWBA 3G71T 1WFWA 1TS9A 2RHIA 2CUBA 1QVGA 2M51A 4BI8B 3LWHA 1QMCA 1ZHIA 2K3BA 3SHWA 3EHRA 4M7DG 1VQ4Q 5KYUA 2QA4A 5IHIA 1ZA1B 2ZPGB 1NYGA 2DL5A 1PKTA 5HY6A 4ANJA 4J8OA 2QTVA 3DLLA 1UUEA 2H3JA 3MKDA 3DB3A 3X20B 1N8RC 4D8DA 4FYVB 1BK2A 4JJDA 1M30A 5LJ3e 3OYYA 2F2WA 3TEEA 2K79A 1OULA 4GLMA 5HK0A 1E7OA 4M77G 2JM9A 1GFCA 1TUGB 3TVTA 5IAYA 4MMKA 5IXFA 2KR3A 1U8RA 2DD5A 3A5ZB 1K76A 1X43A 7AT1B 2RH2A 1X6BA 4LD6A 2BIVA 2RJCA 5CO7A 1YJWQ 3UA6A 2E6NA 6AT1B 2D1XA 3MEVA 4AFQC 3CPWS 1AT1B 1GBQA 1SRLA 4A63B 2DO3A 2CP6A 1WHHA 4PFOA 2CP3A 3M55A 4C92F 2QQAA 3CCUT 1TXQA 4XU2A 1M9SA 2LCSA 3OY9A 4NL3A 4J6WA 3EG1A 2YUOA 2E70A 3UT1A 4FU6A 1KFZA 3N5BB 2GFAA 3CC4T 4EMKC 3V8KA 5GAN8 2CGHA 4C92G 1FMWA 2V8KA 4PLLA 3VYGA 3H9NA 2BUDA 4B6MA 1D0ZA 2EVRA 5KYYB 4KGZB 1HXDA 4CC4B 1YHQQ 1YI2T 4IURA 2OJ2A 1WXBA 3L42A 2EQJA 2J6OA 4M75E 5LJ3d 5C0MA 1B7TA 2E12A 1B34B 4N4HA 1ACMB 2QK0A 3OYKA 3CXCP 4MZTA 1JO8A 3HRSA 5IHKA 1OZ2A 3G7ZA 1D09B 3LH5A 1QCFA 2V1RA 1T0JA 5LJ5j 1GL5A 2EAYA 5I2SA 3OBYA 4A4EA 1S1NA 5C6SA 1WQ7A 4Z88A 1VQMA 1NG2A 1M4ZA 2LNHB 3M0PA 1T0HA 1XJWB 4KT0E 1IB8A 3PVLA 3JCMh 2DPPB 4FM4B 5DY9A 5LJ5e 2OTJA 1YFNA 2D9TA 4IUUA 3RDVA 2A0FB 1W2BS 3PMTA 4AFSC 1OI1A 2DD4A 5HCKA 2YHTA 3CC7T 1PC0A 3NHNA 4C0ZA 1M1KU 1I8FA 4JS5A 1NPPA 1N27A 3H41A 3EFOA 1M1KR 2OTLA 4FL6A 1WPYA 2MMPA 1ZUYA 5D7UA 1U5SA 2MI6A 2P0PA 1FWZA 5GAMf 2GBQA 4C0DB 2GCXA 1WX6A 3JCMP 3CC2A 1X2KA 1K1ZA 4KBMB 1R0CB 1YNZA 2X3WD 3V7SA 2DM1A 2PQWA 3X24B 2KT1A 1Z9QA 4ESRA 5GANf 2VASA 1SSFA 4OB1B 3HHTB 4FCYA 4BE2A 2P84A 1ARKA 1JXMA 1VIEA 4HVUA 2M9UA 1QVFA 2GNCA 3HSBA 1D3BB 3OS0A 4E7JA 2BE9B 3OMCA 4R56A 3JCMc 2RJEA 2IVWA 3CCRT 2COZA 4DBHA 4N0AC 4MDXA 5IXBA 3AT1B 4IIMA 4OF1A 4EMHA 5HK3A 2DL4A 4M75D 2HL5C 3MEUA 4LDXA 1Y07A 1PG5B 1GXIE 1ZUUA 1X01A 4E7HA 3JB9I 2RM4A 2VGNA 3CBOA 1JJ2S 5GAMd 1IHVA 4DOVA 1N9SA 2Y4XA 3G71Q 3CPWP 4X9DA 2F5KA 1VQ4T 3D7SB 3M5AA 1SEMA 4HCZA 1G2BA 1YJNA 3OW2S 4X9CA 1LPLA 3MP1A 1UGVA 2SRCA 1C0MA 5FU7B 4RTZA 2C06A 4M78C 5GANd 1KC8U 1VQ9Q 3OYGA 4IKFA 1YP5A 2R5AA 2KROA 4B9WA 3E9GA 1VQPA 1PD1A 3CCJQ 2COYA 3CCEA 1NZ9A 2CP2A 2NUTA 3PFSA 1H3HA 2F69A 2PVDB 5D6YA 2VKNA 4ORZA 2QTXA 1AZGB
chains in the Genus database with same CATH topology
1M3CA 1MV3A 2L3PA 3SEMA 4QT7A 1GRIA 1QLYA 1W6XA 2LMJA 4WCIA 4LUEA 1NYFA 1M3AA 4CC3A 1ABQA 3A98A 1X69A 1M27C 3M0UA 3I5RA 2M0YA 1X6GA 2H8HA 1ZBJA 2CUDA 2P4RA 3VS3A 1SRMA 2C0OA 2LJ3A 2FPEA 2CSIA 2EGCA 4X1VA 1OEBA 1TUCA 2AK5A 4HVWA 4LN2A 2BZ8A 1CSKA 2KXCA 3VS0A 2A28A 2OAWA 1EFNA 3C0CA 2MIOA 1PNJA 4HCKA 4CC7A 1N5ZA 1NM7A 3NMZC 4K11A 1UDLA 1RLPC 1PRLC 2V1QA 3ULRB 2CH4A 1HD3A 2FPDA 3VS7A 2KYBA 2L3QA 2PNIA 2YSQA 1UTIA 4CC2A 2LJ1A 1ZX6A 2EGAA 2FEIA 3O5ZA 4KRTA 4OMOA 1VYUA 4OMNA 3KFVA 3M0QA 2JTEA 4OMLA 2ED0A 4Y92A 2JMCA 2RN8A 3PVQA 4J9CA 2EW3A 1ZSGA 3UA7A 3M0TA 1YWOA 2MOXA 1UHCA 2O9VA 2LP5A 2ENMA 2HEQA 1AVZC 2A37A 2DRKA 1UJ0A 2NWMA 2DX1A 4LNPA 1U3OA 2KE9A 2YDLA 1UG1A 1AWOA 3EGUA 2RNAA 1JXOA 2PZ1A 4AG2C 3IQLA 3REBB 4Z89A 2A08A 1SPKA 4RUGA 2FPFA 2GTOA 1AWJA 1UE9A 2ROTA 2DF6A 1Y57A 1AZEA 3TSWA 2DNUA 5FWBA 1WFWA 4ZNXA 1GCPA 2EYXA 2CUBA 2DA9A 1U06A 2M51A 2K3BA 4FSSA 3REAB 3SHWA 3EHRA 2J7IA 5IHIA 5IHNA 4J9FA 2KYMA 3VS2A 2LQNA 1NYGA 2DL5A 1PKTA 2O31A 2A36A 3RBBB 1TG0A 1OOTA 3VS5A 1UUEA 1NEGA 1YCSB 3UF4A 1UFFA 1WLPB 2DL8A 4D8DA 2VVKA 1BK2A 3M0SA 4JJDA 3VRYA 2KNBB 1M30A 2KRNA 1FYNA 4JZ3A 2DVJA 2DYBA 2F2WA 2L2PA 1LCKA 4E6RA 2K79A 2D8HA 2JMAA 2NUZA 4GLMA 1E7OA 2DLPA 2CSQA 2JM9A 1GFCA 3TVTA 2FRWA 5IXFA 2KR3A 2FG0A 2ABLA 2HDAA 1AEYA 1K76A 1NLOC 1X43A 1WDXA 3U23A 3R6NA 2OI3A 1X6BA 2KRMA 1RLQC 1PWTA 1WXTA 2CREA 2CT3A 3UA6A 2D1XA 1K0XA 4AFQC 2CH4W 3VS1A 2B86A 2EKHA 1OPLA 1G83A 4OMPA 3H0IA 1GBQA 1SRLA 1T3SA 1V1CA 1SSHA 3I9QA 4A63B 2DE0X 4J9HA 2HBWA 2KBTA 4RTVA 1Z9ZA 2LCSA 3EG1A 2YUOA 2DL3A 1KFZA 2J6KA 1SHGA 4HXJA 1HJDA 2O2OA 5I22A 2J05A 4F14A 1PHTA 3CQTA 2DJQA 1J3TA 2KT8A 4JJBA 2C0IA 2BTTA 4AG1C 2EVRA 4CC4B 3NPFA 4AFZC 2RQRA 1NLPC 1GCQC 2OJ2A 1RUWA 1WXBA 2K6DA 2LZ6B 2AKKA 1T3LA 2FRYA 1AD5A 2J6OA 5GJWB 4D8KA 2KEAA 2DBMA 3EG0A 3RNJA 2YUNA 2JS0A 1NEBA 2G6FX 1BU1A 3NGPA 2I0NA 1H92A 2PTKA 4J9EA 4DEYA 2W0ZA 1YN8A 2EBPA 1VA7A 1RI9A 2ROLA 2RQTA 3GBQA 1PRMC 2BZXA 2FO0A 3JV3A 1JO8A 3QWXX 1UECA 1JU5C 1B07A 5IHKA 1MUZA 2EYWA 1QCFA 3LH5A 1BBZA 1K4US 2LJ0A 2V1RA 1YWPA 3THKA 1T0JA 1GL5A 2RQVA 1BB9A 4RTUA 1UJYA 1I0CA 2MCNA 5L23A 1S1NA 2KGTA 4Z88A 4OMMA 1KSWA 1NG2A 2JM8A 1QWEA 2EQIA 2LNHB 3M0PA 1B3QA 2HCKA 2C0TA 1T0HA 1IO6A 4R0KA 3PVLA 3I5SA 2XMFA 1KIKA 1AOJA 4AFSC 3ZL7C 1VYTA 4IIOA 5HCKA 1WA7A 5FW9A 4J9IA 3NHNA 1X27A 3H0FA 1OPKA 2W10A 3H41A 1I1JA 2DBKA 1ZUYA 2JXBA 2O9SA 4M4ZA 1U5SA 2QDLA 2E5KA 1E6GA 2DL7A 2GBQA 3UATA 1WX6A 2DILA 1AWXA 1X2KA 5FWCA 1GBRA 2L0AA 1K1ZA 1YNZA 2X3WD 2X3XD 1H8KA 2YUPA 2EYZA 2DM1A 2RQWA 2RMOA 2JT4A 4LUDA 2JS2A 1VYVA 1OV3A 4AFUC 2KT1A 1Z9QA 1KJWA 4DEXA 3FJ5A 4ESRA 4JZ4A 1WI7A 3VS4A 1MV0B 3EG2A 4RTXA 1XOVA 3M0RA 2ESWA 1ARKA 1E6HA 2BZYA 2EYYA 4Z8AA 1JXMA 2J06A 2SEMA 2RQUA 2F2VA 4HVUA 2AKLA 2LQWA 1X2QA 5I11A 2GNCA 3H0HA 2DRMA 3VS6A 2J6FA 2JW4A 2K9GA 1PKSA 2YT6A 4RTWA 4RTYA 1JQQA 2HSPA 4JJCA 1M3BA 1QKWA 1K0SA 4OMQA 1ABOA 5IXBA 4RTTA 1A0NB 3I35A 2CT4A 2F2XA 4IIMA 5IH2A 2RPNA 2DL4A 4JPBW 1WIEA 1UHFA 1ZUUA 2ED1A 3PE0A 4J9DA 2RF0A 4GBQA 1SHFA 5ECAA 1M8MA 1TUDA 2GQIA 2EGEA 2AZSA 1SEMA 4F17A 4J9GA 2YUQA 1G2BA 1HSQA 3EHQA 2GGRA 2L3SA 2CDTA 2D0NA 3QWYA 4F16A 1UGVA 2SRCA 4RTZA 4LE9A 2DMOA 1JEGA 4J9BA 2VWFA 1YP5A 1W1FA 2O88A 2GTJA 1ZLMA 1GCQA 1CKAA 2KROA 2K2MA 2AZVA 1QWFA 2K7AA 1WXUA 3VRZA 5EC7A 2KXDA 1GFDA 5GJVB 1QKXA 4EIKA 1W70A 1WYXA 1CKBA 1K9AA 2KRSA 1AWWA 1Y0MA 1ZUKA 4HVVA 1FMKA 3EG3A 1I07A 2EPDA 2IIMA 1H3HA 3TSZA 2D8JA 1AZGB 2VKNA 4ORZA 2ECZA 2LX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M3C A;  1MV3 A;  2L3P A;  3SEM A;  4QT7 A;  1GRI A;  1QLY A;  1W6X A;  2LMJ A;  4WCI A;  4LUE A;  1NYF A;  1M3A A;  4CC3 A;  1ABQ A;  3A98 A;  1X69 A;  1M27 C;  3M0U A;  3I5R A;  2M0Y A;  1X6G A;  2H8H A;  1ZBJ A;  2CUD A;  2P4R A;  3VS3 A;  1SRM A;  2C0O A;  2LJ3 A;  2FPE A;  2CSI A;  2EGC A;  4X1V A;  1OEB A;  1TUC A;  2AK5 A;  4HVW A;  4LN2 A;  2BZ8 A;  1CSK A;  2KXC A;  3VS0 A;  2A28 A;  2OAW A;  1EFN A;  3C0C A;  2MIO A;  1PNJ A;  4HCK A;  4CC7 A;  1N5Z A;  1NM7 A;  3NMZ C;  4K11 A;  1UDL A;  1RLP C;  1PRL C;  2V1Q A;  3ULR B;  2CH4 A;  1HD3 A;  2FPD A;  3VS7 A;  2KYB A;  2L3Q A;  2PNI A;  2YSQ A;  1UTI A;  4CC2 A;  2LJ1 A;  1ZX6 A;  2EGA A;  2FEI A;  3O5Z A;  4KRT A;  4OMO A;  1VYU A;  4OMN A;  3KFV A;  3M0Q A;  2JTE A;  4OML A;  2ED0 A;  4Y92 A;  2JMC A;  2RN8 A;  3PVQ A;  4J9C A;  2EW3 A;  1ZSG A;  3UA7 A;  3M0T A;  1YWO A;  2MOX A;  1UHC A;  2O9V A;  2LP5 A;  2ENM A;  2HEQ A;  1AVZ C;  2A37 A;  2DRK A;  1UJ0 A;  2NWM A;  2DX1 A;  4LNP A;  1U3O A;  2KE9 A;  2YDL A;  1UG1 A;  1AWO A;  3EGU A;  2RNA A;  1JXO A;  2PZ1 A;  4AG2 C;  3IQL A;  3REB B;  4Z89 A;  2A08 A;  1SPK A;  4RUG A;  2FPF A;  2GTO A;  1AWJ A;  1UE9 A;  2ROT A;  2DF6 A;  1Y57 A;  1AZE A;  3TSW A;  2DNU A;  5FWB A;  1WFW A;  4ZNX A;  1GCP A;  2EYX A;  2CUB A;  2DA9 A;  1U06 A;  2M51 A;  2K3B A;  4FSS A;  3REA B;  3SHW A;  3EHR A;  2J7I A;  5IHI A;  5IHN A;  4J9F A;  2KYM A;  3VS2 A;  2LQN A;  1NYG A;  2DL5 A;  1PKT A;  2O31 A;  2A36 A;  3RBB B;  1TG0 A;  1OOT A;  3VS5 A;  1UUE A;  1NEG A;  1YCS B;  3UF4 A;  1UFF A;  1WLP B;  2DL8 A;  4D8D A;  2VVK A;  1BK2 A;  3M0S A;  4JJD A;  3VRY A;  2KNB B;  1M30 A;  2KRN A;  1FYN A;  4JZ3 A;  2DVJ A;  2DYB A;  2F2W A;  2L2P A;  1LCK A;  4E6R A;  2K79 A;  2D8H A;  2JMA A;  2NUZ A;  4GLM A;  1E7O A;  2DLP A;  2CSQ A;  2JM9 A;  1GFC A;  3TVT A;  2FRW A;  5IXF A;  2KR3 A;  2FG0 A;  2ABL A;  2HDA A;  1AEY A;  1K76 A;  1NLO C;  1X43 A;  1WDX A;  3U23 A;  3R6N A;  2OI3 A;  1X6B A;  2KRM A;  1RLQ C;  1PWT A;  1WXT A;  2CRE A;  2CT3 A;  3UA6 A;  2D1X A;  1K0X A;  4AFQ C;  2CH4 W;  3VS1 A;  2B86 A;  2EKH A;  1OPL A;  1G83 A;  4OMP A;  3H0I A;  1GBQ A;  1SRL A;  1T3S A;  1V1C A;  1SSH A;  3I9Q A;  4A63 B;  2DE0 X;  4J9H A;  2HBW A;  2KBT A;  4RTV A;  1Z9Z A;  2LCS A;  3EG1 A;  2YUO A;  2DL3 A;  1KFZ A;  2J6K A;  1SHG A;  4HXJ A;  1HJD A;  2O2O A;  5I22 A;  2J05 A;  4F14 A;  1PHT A;  3CQT A;  2DJQ A;  1J3T A;  2KT8 A;  4JJB A;  2C0I A;  2BTT A;  4AG1 C;  2EVR A;  4CC4 B;  3NPF A;  4AFZ C;  2RQR A;  1NLP C;  1GCQ C;  2OJ2 A;  1RUW A;  1WXB A;  2K6D A;  2LZ6 B;  2AKK A;  1T3L A;  2FRY A;  1AD5 A;  2J6O A;  5GJW B;  4D8K A;  2KEA A;  2DBM A;  3EG0 A;  3RNJ A;  2YUN A;  2JS0 A;  1NEB A;  2G6F X;  1BU1 A;  3NGP A;  2I0N A;  1H92 A;  2PTK A;  4J9E A;  4DEY A;  2W0Z A;  1YN8 A;  2EBP A;  1VA7 A;  1RI9 A;  2ROL A;  2RQT A;  3GBQ A;  1PRM C;  2BZX A;  2FO0 A;  3JV3 A;  1JO8 A;  3QWX X;  1UEC A;  1JU5 C;  1B07 A;  5IHK A;  1MUZ A;  2EYW A;  1QCF A;  3LH5 A;  1BBZ A;  1K4U S;  2LJ0 A;  2V1R A;  1YWP A;  3THK A;  1T0J A;  1GL5 A;  2RQV A;  1BB9 A;  4RTU A;  1UJY A;  1I0C A;  2MCN A;  5L23 A;  1S1N A;  2KGT A;  4Z88 A;  4OMM A;  1KSW A;  1NG2 A;  2JM8 A;  1QWE A;  2EQI A;  2LNH B;  3M0P A;  1B3Q A;  2HCK A;  2C0T A;  1T0H A;  1IO6 A;  4R0K A;  3PVL A;  3I5S A;  2XMF A;  1KIK A;  1AOJ A;  4AFS C;  3ZL7 C;  1VYT A;  4IIO A;  5HCK A;  1WA7 A;  5FW9 A;  4J9I A;  3NHN A;  1X27 A;  3H0F A;  1OPK A;  2W10 A;  3H41 A;  1I1J A;  2DBK A;  1ZUY A;  2JXB A;  2O9S A;  4M4Z A;  1U5S A;  2QDL A;  2E5K A;  1E6G A;  2DL7 A;  2GBQ A;  3UAT A;  1WX6 A;  2DIL A;  1AWX A;  1X2K A;  5FWC A;  1GBR A;  2L0A A;  1K1Z A;  1YNZ A;  2X3W D;  2X3X D;  1H8K A;  2YUP A;  2EYZ A;  2DM1 A;  2RQW A;  2RMO A;  2JT4 A;  4LUD A;  2JS2 A;  1VYV A;  1OV3 A;  4AFU C;  2KT1 A;  1Z9Q A;  1KJW A;  4DEX A;  3FJ5 A;  4ESR A;  4JZ4 A;  1WI7 A;  3VS4 A;  1MV0 B;  3EG2 A;  4RTX A;  1XOV A;  3M0R A;  2ESW A;  1ARK A;  1E6H A;  2BZY A;  2EYY A;  4Z8A A;  1JXM A;  2J06 A;  2SEM A;  2RQU A;  2F2V A;  4HVU A;  2AKL A;  2LQW A;  1X2Q A;  5I11 A;  2GNC A;  3H0H A;  2DRM A;  3VS6 A;  2J6F A;  2JW4 A;  2K9G A;  1PKS A;  2YT6 A;  4RTW A;  4RTY A;  1JQQ A;  2HSP A;  4JJC A;  1M3B A;  1QKW A;  1K0S A;  4OMQ A;  1ABO A;  5IXB A;  4RTT A;  1A0N B;  3I35 A;  2CT4 A;  2F2X A;  4IIM A;  5IH2 A;  2RPN A;  2DL4 A;  4JPB W;  1WIE A;  1UHF A;  1ZUU A;  2ED1 A;  3PE0 A;  4J9D A;  2RF0 A;  4GBQ A;  1SHF A;  5ECA A;  1M8M A;  1TUD A;  2GQI A;  2EGE A;  2AZS A;  1SEM A;  4F17 A;  4J9G A;  2YUQ A;  1G2B A;  1HSQ A;  3EHQ A;  2GGR A;  2L3S A;  2CDT A;  2D0N A;  3QWY A;  4F16 A;  1UGV A;  2SRC A;  4RTZ A;  4LE9 A;  2DMO A;  1JEG A;  4J9B A;  2VWF A;  1YP5 A;  1W1F A;  2O88 A;  2GTJ A;  1ZLM A;  1GCQ A;  1CKA A;  2KRO A;  2K2M A;  2AZV A;  1QWF A;  2K7A A;  1WXU A;  3VRZ A;  5EC7 A;  2KXD A;  1GFD A;  5GJV B;  1QKX A;  4EIK A;  1W70 A;  1WYX A;  1CKB A;  1K9A A;  2KRS A;  1AWW A;  1Y0M A;  1ZUK A;  4HVV A;  1FMK A;  3EG3 A;  1I07 A;  2EPD A;  2IIM A;  1H3H A;  3TSZ A;  2D8J A;  1AZG B;  2VKN A;  4ORZ A;  2ECZ A;  2LX7 A; 
#chains in the Genus database with same CATH topology
 2HKQ B;  5KH6 A;  1MV3 A;  2XDB A;  3SEM A;  3HTR A;  1W6X A;  4DA4 A;  3JB9 G;  2A3L A;  1NYF A;  5A0D A;  3L2W A;  3I56 A;  1YJW T;  3M0U A;  1WHG A;  1ZBJ A;  1QQJ A;  3TCJ A;  3G6E A;  3RKX A;  2CSI A;  1WJS A;  4JDS A;  1TUC A;  3G4S A;  3BDU A;  1CSK A;  1I5L A;  1SG5 A;  4JJN K;  5GMK e;  2MIO A;  1VQK Q;  4CC7 A;  1IRX A;  1NM7 A;  3CCU Q;  3ULR B;  1PRL C;  3UWN A;  1QVP A;  4DBF A;  2PNI A;  2YSQ A;  1OX9 A;  5KCH A;  3CC4 Q;  2LVM A;  3CMA T;  5GAO p;  3BY7 A;  4XTW A;  3DB4 A;  1W2B P;  2JTE A;  4CI0 C;  3JCM V;  2E65 A;  1KC8 C;  2DXB A;  2DXT A;  3SWN A;  2JMC A;  1K8A U;  1KQ2 A;  3C95 A;  3KUF A;  4M7A E;  5CK9 A;  2ATC B;  1K8A R;  2MF2 A;  5DLO A;  2QA4 Q;  1YI2 Q;  1UHC A;  2O9V A;  4M78 B;  2ENM A;  2HEQ A;  2DRK A;  1UJ0 A;  4C92 C;  2DX1 A;  4MZM A;  1U3O A;  2KE9 A;  4ZTF A;  4M75 A;  2E64 A;  2QAS A;  2QQB A;  1NJI C;  2RNA A;  2LTO A;  3ER0 A;  4AG2 C;  3EFR A;  4BDY A;  3REB B;  5D6X A;  4RUG A;  1K73 U;  3EG9 B;  4NOY A;  4B9X A;  3OYN A;  2AIR B;  4C5E A;  1K73 R;  4Y28 E;  4UC4 A;  3ASK A;  1GCP A;  2EYX A;  4JLG A;  3VKI A;  2QYZ A;  1TSF A;  4FSS A;  1BKB A;  2YRD A;  8AT1 B;  2QQ9 A;  1JB0 E;  5CQY A;  2KYM A;  2LQN A;  1KG1 A;  3OSS C;  2FL7 A;  2ZPF B;  3CCM A;  3E9F A;  4PK4 A;  1M2O A;  1TG0 A;  2L5Q A;  3FRN A;  5D6W A;  2RI2 A;  3UF4 A;  2YWW A;  1RAE B;  3QDR B;  2VVK A;  4PJO E;  1Q86 R;  2LCC A;  1MMA A;  4PJN A;  1QVG S;  4HKE A;  1P92 A;  3OYJ A;  4V2S A;  4RCC A;  2K3Y A;  2EJF A;  2DYB A;  4IUQ A;  3QBY A;  2L2P A;  3HFN A;  2M1H A;  2NYS A;  2CZ0 B;  3PIP A;  2CSQ A;  3TQ7 P;  2FRW A;  3QII A;  4F7U A;  1QW1 A;  3MHX A;  2ZZD A;  3EH2 A;  2ABL A;  1JJ2 P;  1AEY A;  5GAO n;  1NLO C;  1ZSZ B;  2E5Q A;  2OI3 A;  1M1G A;  2KRM A;  3PNW C;  3QZ9 B;  3FEO A;  2QG9 B;  2V8J A;  3PMI A;  5J3B A;  3RMS A;  3V7C A;  3OYB A;  1HK9 A;  1UGP B;  2MWO A;  2NUP A;  1IHW A;  2CH4 W;  1K0X A;  3VV0 A;  3VJP A;  4ZGE B;  4J7I A;  3H0I A;  1T3S A;  1V1C A;  3INZ A;  4M7D E;  4JS4 A;  2DE0 X;  2WSC E;  2RJD A;  1KQ1 A;  2HBW A;  4LDU A;  3PIO A;  2DAQ A;  3DKM A;  3V8L A;  2DL3 A;  3CCV A;  3M58 A;  2HAX A;  1SHG A;  2V26 A;  4OP0 A;  5IT9 E;  1KHI A;  4FYY B;  1J3T A;  2RB6 A;  2VGM A;  3VUZ A;  4JJB A;  2C0I A;  4C8Q B;  4M7A D;  2XID A;  1D1A A;  1NLP C;  3RUX A;  1GCQ C;  1G8X A;  4L6V 5;  1D0Y A;  4M77 E;  2ZPB B;  4E2F B;  2KEA A;  2HQE A;  1VQM Q;  4E47 A;  3JRZ A;  2YUN A;  2M0O A;  5GAN 2;  2L89 A;  1NEB A;  2G6F X;  2QXF A;  1R77 A;  2ZPE B;  3NFC A;  3TU4 K;  4M78 G;  3QXE B;  4J9E A;  2OTJ Q;  1YN8 A;  2EBP A;  1VA7 A;  9ATC B;  3GBQ A;  1D0X A;  2BZX A;  4BAC A;  1Q81 C;  2R5M A;  1VQO A;  1B07 A;  2E4H A;  1BBZ A;  4XK8 E;  2LJ0 A;  1VQL A;  1VQ9 T;  1XTD A;  5CKF A;  1K4U S;  2VYT A;  4EMK A;  5GAM g;  2RQV A;  1VQN T;  4DQ2 A;  1YJ9 A;  5EG2 A;  2MCN A;  1EIF A;  8ATC B;  3QO3 A;  2KGT A;  3X26 B;  3JCM e;  1QWE A;  2EQI A;  3CCJ T;  4PJO D;  3OYF A;  2HCK A;  2C0T A;  1VQ5 A;  4R55 A;  4E7K A;  3EGD A;  4QQD A;  1IO6 A;  3CC2 Q;  3C12 A;  5GAN g;  2DTO A;  1KIK A;  5FRO A;  2XI9 A;  3ZL7 C;  4C0F A;  1X27 A;  3GLX A;  2YLB A;  2W10 A;  2HQH A;  2YRV A;  5LJ3 f;  3BFM A;  3CXC A;  2DBK A;  4PJL A;  1BCM A;  4XTX A;  4M4Z A;  3KXT A;  5DM7 R;  5KYX A;  4C5G A;  2JUF A;  4PFP A;  2QEX A;  1E6G A;  3P8D A;  1Y96 A;  1ZBX A;  4X34 A;  1M5Q 1;  2G3R A;  1U1S A;  4ZTJ A;  3SFM A;  3L2Q A;  4XTZ A;  1VQK T;  3FC3 A;  2FVU A;  4RG8 A;  5I21 A;  1BI2 A;  2RHY A;  2X3X D;  2RMO A;  4LUD A;  2JT4 A;  2Y4Y A;  3MET A;  3X28 B;  4M7D D;  2RK2 A;  3JCM J;  1VYV A;  1YIJ A;  2EQU A;  4AFU C;  4DEX A;  3FJ5 A;  1WI7 A;  5CR2 A;  3OMG A;  1QP3 A;  3CMA Q;  3EG2 A;  3CCS A;  1V76 A;  5CAI A;  2BZY A;  3KBG A;  2EYY A;  4HA8 A;  4Z8A A;  3RKW A;  2SEM A;  3MEA A;  4C0D C;  2PVO B;  2LQW A;  2X9H A;  3HRT A;  3LW5 E;  4M7A A;  2QA4 T;  1YJN Q;  5I11 A;  2FB7 A;  2DRM A;  2J6F A;  2JW4 A;  4C8Q F;  1JQQ A;  4FW1 A;  3OYA A;  1M3B A;  1JRI A;  1QKW A;  1M2V B;  4OMQ A;  1H3Z A;  4RTT A;  2EJ9 A;  4M77 D;  2CT4 A;  3OYI A;  2HNI A;  4ZGJ B;  1KQS S;  4Q5W A;  4VUB A;  2LCL A;  4C8Q G;  3PE0 A;  4E7L A;  5FRN A;  1PSE A;  3CBP A;  3GNG A;  1VQP Q;  5KYN A;  1SHF A;  1QVF S;  2O4X A;  3CCE Q;  1TTH B;  2CZ7 B;  3OSV A;  4L59 A;  2VC8 A;  4PJM A;  1FMV A;  2YUQ A;  2JTF A;  1HSQ A;  2PUO B;  3CPF A;  2QI2 A;  2IPO B;  2DTI A;  1LJO A;  1G3T A;  2CDT A;  2GGR A;  2CYZ B;  4F16 A;  4MML A;  1BI0 A;  4ELY C;  4J9B A;  3I56 Q;  2VWF A;  1XNI A;  3CD6 A;  3EGX A;  4PJO A;  1CKA A;  1MMN A;  2AZV A;  5CCA A;  2K7A A;  3G6E Q;  3JAM E;  2KXD A;  3QUI A;  2X35 A;  3G4S Q;  4N0A A;  1CKB A;  1K9A A;  1KK7 A;  4M75 F;  4J6X A;  4C92 D;  4HVV A;  3EG3 A;  1VQ7 A;  1RAC B;  3M4G A;  2CP5 A;  4F7U E;  4PL6 A;  2D8J A;  2E1H A;  5GMK i;  1I81 A;  5FU7 C;  2HL3 A;  4IUV A;  4QT7 A;  1GRI A;  1QLY A;  2K4Y A;  3CPW A;  3A1P A;  5AYF A;  5KYU B;  1ABQ A;  5KYW A;  2H3E B;  3OS5 A;  2M0Y A;  2P4R A;  1SRM A;  4CRI A;  2LJ3 A;  3GOX A;  3OB9 A;  2EGC A;  1OEB A;  2PUK B;  2DK3 A;  4HVW A;  2BZ8 A;  2KXC A;  1IXD A;  1EFN A;  4M7D A;  2EFI A;  3C0C A;  1WGS A;  1PNJ A;  4HCK A;  1N5Z A;  3JCM b;  3OS1 A;  1UDL A;  1RLP C;  4BB7 A;  4JRQ A;  2YRC A;  1HD3 A;  2FPD A;  2L3R A;  3VS7 A;  5J39 A;  2L3Q A;  2WAC A;  1UTI A;  2M02 A;  2LJ1 A;  1EZZ B;  1MMG A;  1WHM A;  2M16 A;  2CP0 A;  2ZCF B;  3P8B B;  3WVD B;  5A0L A;  2KMT A;  4KRT A;  4OMO A;  3ME9 A;  1VYU A;  2JTM A;  4LDW A;  3S6W A;  4Y92 A;  4PKC C;  4DOW A;  4A4G A;  1RAG B;  2HMA A;  2LRQ A;  2EW3 A;  3OYL A;  3M0T A;  2MOX A;  3OYM A;  3I55 A;  1VQ8 A;  1OU9 A;  3CME A;  1BIB A;  4M77 A;  1VQM T;  3CCM Q;  2YDL A;  1YIT A;  5LJ5 d;  3EGU A;  4AMC A;  3WVE B;  1JXO A;  1BYM A;  3IQL A;  2QDY B;  1M1K C;  2A08 A;  1SPK A;  2OTJ T;  1AWJ A;  3MJX A;  2DF6 A;  2XK0 A;  2DNU A;  4IUP A;  3CCQ A;  5GAN 4;  1W4S A;  2DXU A;  2GQV A;  3GIB A;  1QCN A;  2JVV A;  3MP8 A;  2OAU A;  2J7I A;  2XD0 A;  2OTL T;  1WHK A;  1G3W A;  3NTH A;  5IHN A;  4JUV A;  3VS2 A;  1VQN Q;  2X4X A;  3OBW A;  2O31 A;  1Q7Y R;  2A36 A;  1YHQ A;  1MNE A;  1OOT A;  1NEG A;  2KAF A;  3S3O A;  1WLP B;  4KUD K;  4LDY A;  3RKY A;  3CC2 T;  1RAD B;  1Q95 G;  1S72 A;  3VRY A;  1RI0 A;  3HRU A;  4C92 A;  1HYO A;  4A4H A;  4JZ3 A;  3CCL A;  5FRM A;  2DVJ A;  3FDR A;  4KGX B;  3JCM X;  4J5Y A;  4E6R A;  4DBR A;  2JMA A;  2E10 A;  1KQS P;  3J80 E;  2L8D A;  4MDW A;  5CKD A;  1RAF B;  2KI7 A;  2FG0 A;  4E7I A;  3CCV Q;  3VYH B;  2ZPH B;  4Z02 A;  2HDA A;  3LGF A;  3LLR A;  1IGQ A;  3CEY A;  2XIC A;  5GAM h;  1Q82 R;  3FB9 A;  1G5V A;  1NE8 A;  2CT3 A;  2P0K A;  2V8I A;  4BE1 A;  2B86 A;  2EKH A;  1N6A A;  1OPL A;  2K5I A;  1MHN A;  5GAN h;  3I9Q A;  4YTL A;  3M57 A;  2KBT A;  4QQG A;  4RTV A;  1Z9Z A;  2DKG A;  2YXY A;  1PCX A;  1ZSZ C;  2J6K A;  4BE0 A;  3RR6 A;  5I22 A;  4BUG A;  1YJN T;  2DEQ A;  2WSE E;  3CCQ T;  1X75 C;  2J05 A;  3EFO B;  3MEW A;  4F14 A;  1PHT A;  1I5O B;  3CQT A;  2KT8 A;  5CKH A;  2BTT A;  1IZ6 A;  1VQO Q;  5CKB A;  1FX7 A;  4HT9 A;  1JJ2 A;  2VV5 A;  1VQL Q;  3NPF A;  4AFZ C;  2RQR A;  4EPC A;  1OX8 A;  2O01 E;  1RUW A;  2K6D A;  2LZ6 B;  2AKK A;  1YJ9 Q;  1T3L A;  2FRY A;  1AD5 A;  4F04 B;  4FT4 A;  4O5V A;  3FJP A;  2AHJ B;  2DBM A;  4N4G A;  1VQP T;  3RNJ A;  1F1B B;  3QJ6 A;  3GF5 A;  3GP8 A;  3JB9 D;  3HP9 A;  3CCE T;  3NGP A;  1VQ5 Q;  1H92 A;  4EDU A;  4OB2 B;  2PTK A;  4LD9 K;  3HKS A;  2JZ2 A;  5FU6 B;  4MZP A;  2ROL A;  5LJ3 g;  3A8L B;  1PRM C;  2FO0 A;  4A4K A;  3M53 A;  4TVR A;  4C8Q C;  3QWX X;  1UEC A;  1JU5 C;  4WF2 A;  1X6O A;  3PTA A;  4RKU E;  1Q86 U;  1BB9 A;  4RTU A;  3I56 T;  1VQ6 A;  4HCB A;  3SD4 A;  1YCY A;  5L23 A;  3HL8 A;  3G6E T;  1WJR A;  4M7A F;  4WTO B;  5GAN 3;  2QEX Q;  2RI3 A;  4OMM A;  4RCB A;  3L2R A;  3JSC A;  4HT8 A;  4C5I A;  3G4S T;  2X4W A;  2LQ8 A;  1TOV A;  1KD1 U;  1Y71 A;  4R0K A;  1WHJ A;  2LDM A;  2K5F A;  2XMF A;  1KD1 R;  1AOJ A;  4QQ6 A;  1UGR B;  2EQK A;  3HFO A;  4J6Y A;  1VYT A;  3GNF B;  4IIO A;  1K8A C;  1WA7 A;  3G71 A;  4J9I A;  1Y7X A;  1WJQ A;  1I4K 1;  3QSU A;  1YIJ Q;  2RD1 A;  4ZN3 A;  3H0F A;  3UPU A;  1M90 U;  1BI1 A;  1I1J A;  2CS7 A;  4KH1 B;  2E3H A;  1M90 R;  3CCS Q;  5KYY A;  1YBY A;  4Y91 A;  5CQX A;  3RMQ A;  3LH0 A;  3OW2 P;  2E5K A;  2DL7 A;  2MYS A;  4JRK A;  3UAT A;  4M78 E;  4M75 C;  3L2U A;  1K73 C;  1WNL A;  2DIL A;  1AWX A;  1GBR A;  2L0A A;  4XTY A;  3JB9 H;  1JBM A;  4NL2 A;  3JB9 J;  2YUP A;  2EYZ A;  4PJO F;  1B34 A;  1KHC A;  3MO8 A;  2VUB A;  1D1C A;  1TU0 B;  3H6Z A;  1OV3 A;  2K5L A;  4XU1 A;  3JCM Q;  4JZ4 A;  2NUT B;  1N8R R;  1MMD A;  4RTX A;  3E1S A;  5KE2 A;  1Q86 C;  3OQ5 A;  4BY6 B;  3H0H A;  3J7A F;  1M8V A;  3VS6 A;  2K9G A;  1PKS A;  3CCM T;  2HSP A;  5DLQ E;  2JOY A;  4A53 A;  1KD1 C;  1K0S A;  1ABO A;  4PLI A;  5A0G A;  2QGF B;  2F2X A;  2RPN A;  1RAH B;  3L1A A;  3OYE A;  2HZY A;  4JPB W;  1AHJ B;  1UHF A;  2EQM A;  2ED1 A;  3CCU A;  2RF0 A;  4GBQ A;  4ATO A;  4M7D F;  1M90 C;  1M8M A;  3LWI A;  1TUD A;  3CC4 A;  2ZPI B;  2AZS A;  3S3N A;  5LJ5 g;  1VQ7 Q;  5KCO A;  2EJG A;  4J9G A;  3ZFJ A;  5CKE A;  2K3X A;  3H8Z A;  2OTL Q;  3QWY A;  2D0N A;  2L3S A;  2RI5 A;  3SWN B;  2KVQ G;  2DJZ A;  2DIG A;  4LE9 A;  4O6J A;  5LJ3 j;  1YI2 A;  3RER A;  2COW A;  2XG8 D;  1SKU B;  1W1F A;  3M54 A;  2GTJ A;  1ZLM A;  3A8G B;  3FIF A;  1PD0 A;  4M75 B;  1LNX A;  5KE3 A;  4C92 E;  2MWP A;  3VRZ A;  5EC7 A;  3NTK A;  1GFD A;  3O8V A;  4M77 F;  5GJV B;  1QKX A;  4EIK A;  3OS2 A;  1WYX A;  2KRS A;  4A4F A;  1AWW A;  2BE7 D;  4NS5 A;  3JCM f;  1WZO A;  2IIM A;  1UB4 A;  3TSZ A;  3CCV T;  1EX4 A;  2ECZ A;  1M3C A;  2Z0W A;  2E3I A;  4WCI A;  2LMJ A;  4LUE A;  4XAX B;  3ZEH A;  1PM3 A;  3E19 A;  4CC3 A;  1D3B A;  4A54 A;  2XKO C;  3C4S A;  4C8Q E;  3BDL A;  3I5R A;  1X6G A;  2CUD A;  3FLG A;  3VS3 A;  2C0O A;  2FPE A;  3A8O B;  4M78 D;  3I55 Q;  4X1V A;  1VQ8 Q;  3CME Q;  5GMK m;  3VS0 A;  2A28 A;  2OAW A;  3M59 A;  2AT1 B;  3EH1 A;  1YIT Q;  4K11 A;  3NMZ C;  1QVG P;  2V1Q A;  4ZN1 A;  2JJ9 A;  3CC7 A;  4CC2 A;  4GLK A;  2K57 A;  1ZX6 A;  2EGA A;  1XQH A;  1TH7 A;  4J83 A;  2FEI A;  3O5Z A;  4F7U B;  2KY9 A;  3CCQ Q;  3KFV A;  1VQO T;  3PT9 A;  2ED0 A;  2KK4 A;  2OX7 A;  1O9S A;  4OVA A;  4J9C A;  1VQL T;  1YWO A;  3JCM d;  2RO0 A;  3LGL A;  1YJ9 T;  4FYW B;  4JLI A;  1V29 B;  3HPW A;  1AVZ C;  2NWM A;  4LDV A;  2D0Q B;  3JCM W;  4LNP A;  3S3M A;  1UG1 A;  3TRE A;  5HKC A;  2NUP B;  3GPL A;  2FYK A;  1VQ5 T;  4QVZ A;  1VOM A;  1UE9 A;  1S72 Q;  4RMO A;  2ROT A;  1OQK A;  3CCL Q;  1Y57 A;  3VU3 C;  2RK1 A;  4ZNX A;  4L5G A;  2DA9 A;  1U06 A;  2FHD A;  2RJF A;  2KQW A;  3REA B;  1RAI B;  3WXM B;  4N4I A;  5GMK l;  2EKO A;  4J9F A;  1BCO A;  2QEX T;  3RBB B;  3MP6 A;  3CCR A;  3VS5 A;  5GAO q;  2HQX A;  1YCS B;  5GAM j;  1UFF A;  2DL8 A;  1IRE B;  3M0S A;  1RAB B;  2KNB B;  2KRN A;  1OZ3 A;  1BIA A;  1FYN A;  1LCK A;  3M56 A;  1YIJ T;  3V7R A;  2D8H A;  5LJ3 h;  2NUZ A;  2DLP A;  5GAN j;  1VQ4 A;  5LJ5 f;  2DIQ A;  2DFU A;  4M75 G;  5GAM e;  3CCS T;  3NTI A;  2F5T X;  2F1L A;  4M7A C;  4P5N A;  1WDX A;  3U23 A;  3R6N A;  4XTU A;  4EMK B;  1RLQ C;  4QVD A;  4BD3 A;  4JRP A;  1NPR A;  4C8Q D;  4M78 A;  4QW2 A;  1PWT A;  1WXT A;  2CRE A;  5J26 A;  2CZ6 B;  1UGQ B;  5GAN e;  3VS1 A;  2HBP A;  2HD0 A;  1UEB A;  1G83 A;  4OMP A;  1SSH A;  1DJ7 B;  3EGD B;  4OGC A;  4QVC A;  1RL2 A;  1C1A A;  4J9H A;  1O75 A;  2DZC A;  3EG9 A;  2R57 A;  5I2M A;  4XU0 A;  1HJD A;  4HXJ A;  3AHU A;  2O2O A;  4F7U F;  1OU8 A;  2JN0 A;  2DJQ A;  1KQS A;  2QQR A;  2XDD A;  4ZGD B;  5M9O A;  1VIF A;  3F70 A;  4AG1 C;  1YJW A;  3BW1 A;  2GF7 A;  5KYX B;  2DXC A;  2GFU A;  2ZAE A;  3MPU B;  4FIB A;  1Y96 B;  4PJO C;  4LXC A;  1VQ6 Q;  1IGU A;  4XTV A;  3CD6 T;  4F7U G;  4OMF B;  2P4T A;  3QYG B;  5GJW B;  4D8K A;  1BI3 A;  3C94 A;  3EG0 A;  2EWN A;  2JS0 A;  2DET A;  1BU1 A;  2I0N A;  2LQK A;  2X4J A;  1VQ7 T;  4DEY A;  2W0Z A;  2CP7 A;  2RQT A;  1RI9 A;  1TWB A;  3CMA A;  3JV3 A;  2HSE B;  2RHU A;  4FYX B;  1Q7Y U;  4FW2 A;  3P8H A;  2CZ1 B;  1MUZ A;  5IN1 A;  1W2B A;  3R6O A;  1ZSZ A;  2EYW A;  4RG2 A;  1YWP A;  3THK A;  4M7A B;  3QJY A;  5GAO r;  1UJY A;  3PGG A;  1I0C A;  1G3S A;  2QAZ A;  3VUB A;  4QKU A;  2KDS A;  1KSW A;  2JM8 A;  2RHX A;  2DZ9 A;  4M7D C;  4IUT A;  1KC8 R;  1B3Q A;  2KSS A;  2XHC A;  5FU6 C;  1M1F A;  3I5S A;  5LL6 S;  2FZG B;  2X4Y A;  1NJI U;  4C0G A;  3JB9 F;  1WQW A;  2RHZ A;  5FW9 A;  3SB2 A;  2O4X B;  5LJ5 h;  1Q82 U;  1NJI R;  1OPK A;  1QVF P;  4D6W A;  2X51 A;  3LX7 A;  2JNG A;  3EFS A;  1N9R A;  2RA2 A;  4E7S A;  5GAO m;  4OGE A;  4KH0 B;  4C8Q A;  2JXB A;  2O9S A;  2QDL A;  5GMK j;  2MPX C;  3I55 T;  1VQ8 T;  4M77 C;  2D6F A;  3CME T;  5GAN 7;  3MCA B;  3LYI A;  1YIT T;  3EGX B;  3OYC A;  4PJO B;  1WHL A;  5FWC A;  4OB3 B;  1H8K A;  2RQW A;  2DYI A;  2XDP A;  2LT4 A;  2JS2 A;  2QGG A;  4XU3 A;  4E7Z A;  2DVE A;  1KJW A;  4PNO A;  1Q7Y C;  3VS4 A;  1MV0 B;  3ZBD A;  5CIU A;  2CKK A;  1XOV A;  2FZK B;  3M0R A;  3QDF A;  2ESW A;  2IG0 A;  2DEU A;  1E6H A;  1NBE B;  2J06 A;  2RQU A;  5L8R E;  2F2V A;  4PJJ A;  1LVK A;  2AKL A;  3RIR A;  5GAN 6;  3RES A;  1X2Q A;  5A2Q E;  4II1 A;  4RTW A;  4RTY A;  2YT6 A;  5KYW B;  1SF9 A;  2MK5 A;  1PSF A;  1YHQ T;  4JJC A;  1VUB A;  4GY5 A;  4DBQ A;  2LC4 A;  4J7F A;  1FXX A;  1LOJ A;  3OW2 A;  3M4Y A;  1A0N B;  3I35 A;  2NLU A;  5IH2 A;  3URG A;  2XU8 A;  1S72 T;  1WIE A;  4M7D B;  3QPH A;  3CCL T;  2MAM A;  3A8M B;  3JCM g;  3T9N A;  4J9D A;  4EMG A;  1OYX A;  1Q82 C;  3CBM A;  1D1B A;  5CVI A;  5ECA A;  5GAO l;  3Q1J A;  2GQI A;  2EGE A;  4JRI A;  2EYQ A;  4BY6 C;  4KGV B;  4F17 A;  2LNV A;  3L2Z A;  3EHQ A;  3UDC A;  1H64 1;  2E6Z A;  2DMO A;  1JEG A;  2LX9 A;  3OYH A;  4AT1 B;  4PFZ A;  2FZC B;  2O88 A;  4M77 B;  1GCQ A;  2VB6 A;  2K2M A;  1K9M U;  1QWF A;  1WXU A;  2ZGW A;  3X25 B;  1K9M R;  4M7A G;  1W70 A;  2K2V A;  1ZQ1 A;  1Y0M A;  1ZUK A;  1FMK A;  1I07 A;  4BI4 A;  3L2V A;  4ME7 A;  1QCO A;  2EPD A;  1G3Y A;  3SWN C;  1C6V X;  5AT1 B;  4BDZ A;  2I2L A;  2PVG B;  2LX7 A;  3CC7 Q;  3E2U A;  2L3P A;  3SDZ A;  4C5H A;  3EAE A;  2B8A A;  3QG1 A;  2DTH A;  3QZ5 B;  3QKJ A;  1VQ9 A;  1M3A A;  3V8J A;  1MGQ A;  3A98 A;  1VQN A;  1X69 A;  2QQS A;  1Q81 U;  3OA6 A;  1M27 C;  2E41 A;  1R0B G;  2YLC A;  2H8H A;  1Q81 R;  1M2V A;  2VXE A;  3CCJ A;  2AK5 A;  4LN2 A;  3BE3 A;  4BI3 A;  2R58 A;  1N8R U;  3CXC S;  2EIF A;  2HKN A;  3OYD A;  4C92 B;  2BKD N;  2CH4 A;  2VXF A;  5GMK h;  1QP2 A;  2KYB A;  1U1T A;  2DER A;  4FT2 A;  4PJO G;  2P0Q A;  2A7Y A;  4OMN A;  3M0Q A;  4OML A;  4ELZ C;  2RN8 A;  3PVQ A;  1ZA2 B;  1ZSG A;  1R8O B;  2LT1 A;  3UA7 A;  3M9Q A;  2WSF E;  1VQ6 T;  3A8H B;  1RAA B;  3G1J A;  3QYH B;  5FLX E;  2LP5 A;  1K9M C;  2A37 A;  3CD6 Q;  3QHS A;  2Y90 A;  4KUL A;  4KUI A;  1VQK A;  1AWO A;  3J81 E;  3CCR Q;  4M78 F;  4HCC A;  4OB0 B;  2PZ1 A;  3DLM A;  5GAN 5;  4XQ3 A;  4Z89 A;  2PU9 B;  2FPF A;  2GTO A;  4FSX A;  1UGS B;  1MND A;  1AZE A;  3TSW A;  5FWB A;  3G71 T;  1WFW A;  1TS9 A;  2RHI A;  2CUB A;  1QVG A;  2M51 A;  4BI8 B;  3LWH A;  1QMC A;  1ZHI A;  2K3B A;  3SHW A;  3EHR A;  4M7D G;  1VQ4 Q;  5KYU A;  2QA4 A;  5IHI A;  1ZA1 B;  2ZPG B;  1NYG A;  2DL5 A;  1PKT A;  5HY6 A;  4ANJ A;  4J8O A;  2QTV A;  3DLL A;  1UUE A;  2H3J A;  3MKD A;  3DB3 A;  3X20 B;  1N8R C;  4D8D A;  4FYV B;  1BK2 A;  4JJD A;  1M30 A;  5LJ3 e;  3OYY A;  2F2W A;  3TEE A;  2K79 A;  1OUL A;  4GLM A;  5HK0 A;  1E7O A;  4M77 G;  2JM9 A;  1GFC A;  1TUG B;  3TVT A;  5IAY A;  4MMK A;  5IXF A;  2KR3 A;  1U8R A;  2DD5 A;  3A5Z B;  1K76 A;  1X43 A;  7AT1 B;  2RH2 A;  1X6B A;  4LD6 A;  2BIV A;  2RJC A;  5CO7 A;  1YJW Q;  3UA6 A;  2E6N A;  6AT1 B;  2D1X A;  3MEV A;  4AFQ C;  3CPW S;  1AT1 B;  1GBQ A;  1SRL A;  4A63 B;  2DO3 A;  2CP6 A;  1WHH A;  4PFO A;  2CP3 A;  3M55 A;  4C92 F;  2QQA A;  3CCU T;  1TXQ A;  4XU2 A;  1M9S A;  2LCS A;  3OY9 A;  4NL3 A;  4J6W A;  3EG1 A;  2YUO A;  2E70 A;  3UT1 A;  4FU6 A;  1KFZ A;  3N5B B;  2GFA A;  3CC4 T;  4EMK C;  3V8K A;  5GAN 8;  2CGH A;  4C92 G;  1FMW A;  2V8K A;  4PLL A;  3VYG A;  3H9N A;  2BUD A;  4B6M A;  1D0Z A;  2EVR A;  5KYY B;  4KGZ B;  1HXD A;  4CC4 B;  1YHQ Q;  1YI2 T;  4IUR A;  2OJ2 A;  1WXB A;  3L42 A;  2EQJ A;  2J6O A;  4M75 E;  5LJ3 d;  5C0M A;  1B7T A;  2E12 A;  1B34 B;  4N4H A;  1ACM B;  2QK0 A;  3OYK A;  3CXC P;  4MZT A;  1JO8 A;  3HRS A;  5IHK A;  1OZ2 A;  3G7Z A;  1D09 B;  3LH5 A;  1QCF A;  2V1R A;  1T0J A;  5LJ5 j;  1GL5 A;  2EAY A;  5I2S A;  3OBY A;  4A4E A;  1S1N A;  5C6S A;  1WQ7 A;  4Z88 A;  1VQM A;  1NG2 A;  1M4Z A;  2LNH B;  3M0P A;  1T0H A;  1XJW B;  4KT0 E;  1IB8 A;  3PVL A;  3JCM h;  2DPP B;  4FM4 B;  5DY9 A;  5LJ5 e;  2OTJ A;  1YFN A;  2D9T A;  4IUU A;  3RDV A;  2A0F B;  1W2B S;  3PMT A;  4AFS C;  1OI1 A;  2DD4 A;  5HCK A;  2YHT A;  3CC7 T;  1PC0 A;  3NHN A;  4C0Z A;  1M1K U;  1I8F A;  4JS5 A;  1NPP A;  1N27 A;  3H41 A;  3EFO A;  1M1K R;  2OTL A;  4FL6 A;  1WPY A;  2MMP A;  1ZUY A;  5D7U A;  1U5S A;  2MI6 A;  2P0P A;  1FWZ A;  5GAM f;  2GBQ A;  4C0D B;  2GCX A;  1WX6 A;  3JCM P;  3CC2 A;  1X2K A;  1K1Z A;  4KBM B;  1R0C B;  1YNZ A;  2X3W D;  3V7S A;  2DM1 A;  2PQW A;  3X24 B;  2KT1 A;  1Z9Q A;  4ESR A;  5GAN f;  2VAS A;  1SSF A;  4OB1 B;  3HHT B;  4FCY A;  4BE2 A;  2P84 A;  1ARK A;  1JXM A;  1VIE A;  4HVU A;  2M9U A;  1QVF A;  2GNC A;  3HSB A;  1D3B B;  3OS0 A;  4E7J A;  2BE9 B;  3OMC A;  4R56 A;  3JCM c;  2RJE A;  2IVW A;  3CCR T;  2COZ A;  4DBH A;  4N0A C;  4MDX A;  5IXB A;  3AT1 B;  4IIM A;  4OF1 A;  4EMH A;  5HK3 A;  2DL4 A;  4M75 D;  2HL5 C;  3MEU A;  4LDX A;  1Y07 A;  1PG5 B;  1GXI E;  1ZUU A;  1X01 A;  4E7H A;  3JB9 I;  2RM4 A;  2VGN A;  3CBO A;  1JJ2 S;  5GAM d;  1IHV A;  4DOV A;  1N9S A;  2Y4X A;  3G71 Q;  3CPW P;  4X9D A;  2F5K A;  1VQ4 T;  3D7S B;  3M5A A;  1SEM A;  4HCZ A;  1G2B A;  1YJN A;  3OW2 S;  4X9C A;  1LPL A;  3MP1 A;  1UGV A;  2SRC A;  1C0M A;  5FU7 B;  4RTZ A;  2C06 A;  4M78 C;  5GAN d;  1KC8 U;  1VQ9 Q;  3OYG A;  4IKF A;  1YP5 A;  2R5A A;  2KRO A;  4B9W A;  3E9G A;  1VQP A;  1PD1 A;  3CCJ Q;  2COY A;  3CCE A;  1NZ9 A;  2CP2 A;  2NUT A;  3PFS A;  1H3H A;  2F69 A;  2PVD B;  5D6Y A;  2VKN A;  4ORZ A;  2QTX A;  1AZG B; 
#chains in the Genus database with same CATH homology
 1M3C A;  1MV3 A;  2L3P A;  3SEM A;  4QT7 A;  1GRI A;  1QLY A;  1W6X A;  2LMJ A;  4WCI A;  4LUE A;  1NYF A;  1M3A A;  4CC3 A;  1ABQ A;  3A98 A;  1X69 A;  1M27 C;  3M0U A;  3I5R A;  2M0Y A;  1X6G A;  2H8H A;  1ZBJ A;  2CUD A;  2P4R A;  3VS3 A;  1SRM A;  2C0O A;  2LJ3 A;  2FPE A;  2CSI A;  2EGC A;  4X1V A;  1OEB A;  1TUC A;  2AK5 A;  4HVW A;  4LN2 A;  2BZ8 A;  1CSK A;  2KXC A;  3VS0 A;  2A28 A;  2OAW A;  1EFN A;  3C0C A;  2MIO A;  1PNJ A;  4HCK A;  4CC7 A;  1N5Z A;  1NM7 A;  3NMZ C;  4K11 A;  1UDL A;  1RLP C;  1PRL C;  2V1Q A;  3ULR B;  2CH4 A;  1HD3 A;  2FPD A;  3VS7 A;  2KYB A;  2L3Q A;  2PNI A;  2YSQ A;  1UTI A;  4CC2 A;  2LJ1 A;  1ZX6 A;  2EGA A;  2FEI A;  3O5Z A;  4KRT A;  4OMO A;  1VYU A;  4OMN A;  3KFV A;  3M0Q A;  2JTE A;  4OML A;  2ED0 A;  4Y92 A;  2JMC A;  2RN8 A;  3PVQ A;  4J9C A;  2EW3 A;  1ZSG A;  3UA7 A;  3M0T A;  1YWO A;  2MOX A;  1UHC A;  2O9V A;  2LP5 A;  2ENM A;  2HEQ A;  1AVZ C;  2A37 A;  2DRK A;  1UJ0 A;  2NWM A;  2DX1 A;  4LNP A;  1U3O A;  2KE9 A;  2YDL A;  1UG1 A;  1AWO A;  3EGU A;  2RNA A;  1JXO A;  2PZ1 A;  4AG2 C;  3IQL A;  3REB B;  4Z89 A;  2A08 A;  1SPK A;  4RUG A;  2FPF A;  2GTO A;  1AWJ A;  1UE9 A;  2ROT A;  2DF6 A;  1Y57 A;  1AZE A;  3TSW A;  2DNU A;  5FWB A;  1WFW A;  4ZNX A;  1GCP A;  2EYX A;  2CUB A;  2DA9 A;  1U06 A;  2M51 A;  2K3B A;  4FSS A;  3REA B;  3SHW A;  3EHR A;  2J7I A;  5IHI A;  5IHN A;  4J9F A;  2KYM A;  3VS2 A;  2LQN A;  1NYG A;  2DL5 A;  1PKT A;  2O31 A;  2A36 A;  3RBB B;  1TG0 A;  1OOT A;  3VS5 A;  1UUE A;  1NEG A;  1YCS B;  3UF4 A;  1UFF A;  1WLP B;  2DL8 A;  4D8D A;  2VVK A;  1BK2 A;  3M0S A;  4JJD A;  3VRY A;  2KNB B;  1M30 A;  2KRN A;  1FYN A;  4JZ3 A;  2DVJ A;  2DYB A;  2F2W A;  2L2P A;  1LCK A;  4E6R A;  2K79 A;  2D8H A;  2JMA A;  2NUZ A;  4GLM A;  1E7O A;  2DLP A;  2CSQ A;  2JM9 A;  1GFC A;  3TVT A;  2FRW A;  5IXF A;  2KR3 A;  2FG0 A;  2ABL A;  2HDA A;  1AEY A;  1K76 A;  1NLO C;  1X43 A;  1WDX A;  3U23 A;  3R6N A;  2OI3 A;  1X6B A;  2KRM A;  1RLQ C;  1PWT A;  1WXT A;  2CRE A;  2CT3 A;  3UA6 A;  2D1X A;  1K0X A;  4AFQ C;  2CH4 W;  3VS1 A;  2B86 A;  2EKH A;  1OPL A;  1G83 A;  4OMP A;  3H0I A;  1GBQ A;  1SRL A;  1T3S A;  1V1C A;  1SSH A;  3I9Q A;  4A63 B;  2DE0 X;  4J9H A;  2HBW A;  2KBT A;  4RTV A;  1Z9Z A;  2LCS A;  3EG1 A;  2YUO A;  2DL3 A;  1KFZ A;  2J6K A;  1SHG A;  4HXJ A;  1HJD A;  2O2O A;  5I22 A;  2J05 A;  4F14 A;  1PHT A;  3CQT A;  2DJQ A;  1J3T A;  2KT8 A;  4JJB A;  2C0I A;  2BTT A;  4AG1 C;  2EVR A;  4CC4 B;  3NPF A;  4AFZ C;  2RQR A;  1NLP C;  1GCQ C;  2OJ2 A;  1RUW A;  1WXB A;  2K6D A;  2LZ6 B;  2AKK A;  1T3L A;  2FRY A;  1AD5 A;  2J6O A;  5GJW B;  4D8K A;  2KEA A;  2DBM A;  3EG0 A;  3RNJ A;  2YUN A;  2JS0 A;  1NEB A;  2G6F X;  1BU1 A;  3NGP A;  2I0N A;  1H92 A;  2PTK A;  4J9E A;  4DEY A;  2W0Z A;  1YN8 A;  2EBP A;  1VA7 A;  1RI9 A;  2ROL A;  2RQT A;  3GBQ A;  1PRM C;  2BZX A;  2FO0 A;  3JV3 A;  1JO8 A;  3QWX X;  1UEC A;  1JU5 C;  1B07 A;  5IHK A;  1MUZ A;  2EYW A;  1QCF A;  3LH5 A;  1BBZ A;  1K4U S;  2LJ0 A;  2V1R A;  1YWP A;  3THK A;  1T0J A;  1GL5 A;  2RQV A;  1BB9 A;  4RTU A;  1UJY A;  1I0C A;  2MCN A;  5L23 A;  1S1N A;  2KGT A;  4Z88 A;  4OMM A;  1KSW A;  1NG2 A;  2JM8 A;  1QWE A;  2EQI A;  2LNH B;  3M0P A;  1B3Q A;  2HCK A;  2C0T A;  1T0H A;  1IO6 A;  4R0K A;  3PVL A;  3I5S A;  2XMF A;  1KIK A;  1AOJ A;  4AFS C;  3ZL7 C;  1VYT A;  4IIO A;  5HCK A;  1WA7 A;  5FW9 A;  4J9I A;  3NHN A;  1X27 A;  3H0F A;  1OPK A;  2W10 A;  3H41 A;  1I1J A;  2DBK A;  1ZUY A;  2JXB A;  2O9S A;  4M4Z A;  1U5S A;  2QDL A;  2E5K A;  1E6G A;  2DL7 A;  2GBQ A;  3UAT A;  1WX6 A;  2DIL A;  1AWX A;  1X2K A;  5FWC A;  1GBR A;  2L0A A;  1K1Z A;  1YNZ A;  2X3W D;  2X3X D;  1H8K A;  2YUP A;  2EYZ A;  2DM1 A;  2RQW A;  2RMO A;  2JT4 A;  4LUD A;  2JS2 A;  1VYV A;  1OV3 A;  4AFU C;  2KT1 A;  1Z9Q A;  1KJW A;  4DEX A;  3FJ5 A;  4ESR A;  4JZ4 A;  1WI7 A;  3VS4 A;  1MV0 B;  3EG2 A;  4RTX A;  1XOV A;  3M0R A;  2ESW A;  1ARK A;  1E6H A;  2BZY A;  2EYY A;  4Z8A A;  1JXM A;  2J06 A;  2SEM A;  2RQU A;  2F2V A;  4HVU A;  2AKL A;  2LQW A;  1X2Q A;  5I11 A;  2GNC A;  3H0H A;  2DRM A;  3VS6 A;  2J6F A;  2JW4 A;  2K9G A;  1PKS A;  2YT6 A;  4RTW A;  4RTY A;  1JQQ A;  2HSP A;  4JJC A;  1M3B A;  1QKW A;  1K0S A;  4OMQ A;  1ABO A;  5IXB A;  4RTT A;  1A0N B;  3I35 A;  2CT4 A;  2F2X A;  4IIM A;  5IH2 A;  2RPN A;  2DL4 A;  4JPB W;  1WIE A;  1UHF A;  1ZUU A;  2ED1 A;  3PE0 A;  4J9D A;  2RF0 A;  4GBQ A;  1SHF A;  5ECA A;  1M8M A;  1TUD A;  2GQI A;  2EGE A;  2AZS A;  1SEM A;  4F17 A;  4J9G A;  2YUQ A;  1G2B A;  1HSQ A;  3EHQ A;  2GGR A;  2L3S A;  2CDT A;  2D0N A;  3QWY A;  4F16 A;  1UGV A;  2SRC A;  4RTZ A;  4LE9 A;  2DMO A;  1JEG A;  4J9B A;  2VWF A;  1YP5 A;  1W1F A;  2O88 A;  2GTJ A;  1ZLM A;  1GCQ A;  1CKA A;  2KRO A;  2K2M A;  2AZV A;  1QWF A;  2K7A A;  1WXU A;  3VRZ A;  5EC7 A;  2KXD A;  1GFD A;  5GJV B;  1QKX A;  4EIK A;  1W70 A;  1WYX A;  1CKB A;  1K9A A;  2KRS A;  1AWW A;  1Y0M A;  1ZUK A;  4HVV A;  1FMK A;  3EG3 A;  1I07 A;  2EPD A;  2IIM A;  1H3H A;  3TSZ A;  2D8J A;  1AZG B;  2VKN A;  4ORZ A;  2ECZ A;  2LX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...