2LX7A

Solution nmr structure of sh3 domain of growth arrest-specific protein 7 (gas7) (fragment 1-60) from homo sapiens, northeast structural genomics consortium (nesg) target hr8574a
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
MSGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGWFPASYVQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth arrest-specific protein 7
publication title Solution NMR structure of SH3 domain of growth arrest-specific protein 7 (GAS7) (fragment 1-60) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8574A
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lx7A00
3CQTA 4HCKA 5GJVB 1KSWA 2KEAA 2FPEA 3EG2A 2L3QA 1ZBJA 2EYWA 3TVTA 1U06A 3M0RA 2O9VA 3O5ZA 5IH2A 1HJDA 1W1FA 4JZ4A 2GGRA 4ORZA 1M3BA 4OMMA 2FPFA 2C0TA 3M0SA 2EQIA 3SHWA 2FRWA 4CC7A 2JMCA 2M0YA 5GJWB 1I0CA 3NPFA 2A37A 4D8KA 1K76A 1UFFA 1WXTA 4OMLA 2EYXA 3LH5A 4J9HA 4K11A 2J6FA 2MOXA 2V1RA 4X1VA 2HEQA 4A63B 1ZUYA 2DLPA 4GBQA 2EGEA 2C0IA 2YUNA 1YN8A 2GQIA 3VRYA 3FJ5A 2KE9A 4HVUA 1ABOA 1ARKA 4R0KA 2RPNA 2LQNA 3VS4A 2EPDA 1ABQA 1FMKA 3UA6A 1QKXA 1EFNA 1SHFA 1OPLA 1QWEA 1AZEA 1AWJA 2GTOA 1HSQA 1M30A 1PRLC 2GTJA 1WDXA 2LJ0A 2MCNA 3TSZA 2PTKA 2O88A 1CKAA 2VWFA 3ULRB 1CKBA 4QT7A 1G2BA 2RQTA 1QKWA 3A98A 2AKKA 3NMZC 4IIMA 2PNIA 2OAWA 1A0NB 4AFSC 2JT4A 1V1CA 2VVKA 1GCQC 2DL3A 2EYZA 5ECAA 2EYYA 2KT8A 1K1ZA 1UUEA 2JM9A 2LP5A 3U23A 3IQLA 2CH4W 3VS3A 1BU1A 2JXBA 4JJCA 2KBTA 4F14A 5I22A 1RUWA 1GRIA 4RTUA 1NLOC 3VS2A 1T3SA 2DM1A 1WI7A 1GCPA 4Z88A 2J6KA 1T0JA 2CSQA 2D0NA 2KROA 1W6XA 2H8HA 3I35A 1AWXA 1K0SA 2OI3A 2O2OA 2C0OA 1Y0MA 2L3SA 4RTTA 1X6GA 2KR3A 2L2PA 3VS0A 4D8DA 3PE0A 2D8JA 4OMOA 1LCKA 2A36A 2EGCA 2LJ1A 4J9EA 1AZGB 1PNJA 2JTEA 1RLPC 2ABLA 2D1XA 1NYFA 3EG0A 1X69A 4AFUC 4RTZA 1J3TA 4JPBW 4AFZC 2KYMA 4OMQA 1K0XA 1GBQA 1BBZA 1WA7A 2A28A 2KNBB 3ZL7C 2E5KA 1XOVA 2K6DA 1ZUKA 3RNJA 2KRNA 1M3AA 3C0CA 3H41A 2DE0X 1NLPC 4RUGA 4GLMA 5IXBA 2DA9A 1AOJA 2ENMA 4CC3A 1X6BA 2M51A 2YUQA 2CH4A 5IHIA 1OPKA 2DL8A 2DL5A 3M0TA 1M27C 1AVZC 1Z9ZA 2MIOA 1CSKA 1K4US 1X2QA 3M0QA 2DRMA 1UE9A 5HCKA 1QWFA 1SRLA 3TSWA 3VS1A 3REAB 3EGUA 2F2XA 2YUOA 4RTYA 2VKNA 4F16A 2FEIA 1X43A 2F2VA 2YSQA 4DEYA 2CT4A 1UJ0A 1VYVA 4J9DA 1QCFA 1UG1A 2HDAA 1ZUUA 3NGPA 1UGVA 2X3WD 2K79A 2AKLA 1KIKA 4AG1C 1VYUA 2DJQA 3NHNA 4ZNXA 2F2WA 4KRTA 2K9GA 1H3HA 2RQUA 1NG2A 2HBWA 2CT3A 1E6GA 1WFWA 2B86A 1T0HA 2NWMA 2LJ3A 1WIEA 1ZLMA 2AZVA 1JO8A 2J06A 2EKHA 2ESWA 1JQQA 1JXMA 1N5ZA 2JW4A 2A08A 2LQWA 2LMJA 2YDLA 1HD3A 2LX7A 2LNHB 2IIMA 2KXDA 1UTIA 2BZ8A 1RI9A 1PHTA 1I07A 2RQVA 3UA7A 2CSIA 4EIKA 2K3BA 1X27A 2DILA 1GFCA 2XMFA 2RQWA 1U3OA 1W70A 1SSHA 2KRSA 4J9CA 1WX6A 3I5RA 3VS5A 1NM7A 4FSSA 1E6HA 4CC4B 2YUPA 3I5SA 2G6FX 1NEBA 2JS0A 4J9IA 1PRMC 4RTXA 1SPKA 1UECA 4LUDA 2BZYA 4IIOA 3EHQA 1WLPB 2ROLA 1AEYA 3PVQA 1H8KA 3UF4A 3VS6A 2BZXA 2RNAA 5IHKA 2J6OA 4F17A 4WCIA 1YP5A 2CREA 1K9AA 3H0FA 4RTVA 2LZ6B 2LCSA 2W0ZA 4AFQC 4E6RA 2I0NA 3SEMA 2HSPA 1AD5A 2BTTA 2RMOA 1VA7A 2FO0A 3PVLA 4RTWA 3EG3A 1TUDA 2KRMA 1IO6A 1OV3A 2V1QA 3VRZA 1GBRA 4HVVA 1B07A 2RQRA 2KXCA 2AZSA 2EVRA 1OOTA 2NUZA 2OJ2A 1YWPA 1AWWA 1GL5A 3I9QA 2P4RA 3EHRA 5I11A 4LN2A 3GBQA 2ED0A 1E7OA 1KFZA 1WXUA 1UHCA 1BK2A 1X2KA 1SHGA 2RN8A 2CUBA 1AWOA 4J9BA 1OEBA 5FWCA 3QWYA 1Y57A 2SEMA 1FYNA 2DBKA 4J9FA 2K7AA 1KJWA 4OMNA 1JEGA 5IHNA 4M4ZA 1YNZA 2QDLA 1VYTA 2SRCA 1SEMA 2DBMA 2KT1A 1PKTA 3H0IA 2CUDA 2X3XD 4HVWA 1ZSGA 1B3QA 4JZ3A 1I1JA 2W10A 1M3CA 1H92A 1WYXA 3H0HA 2JMAA 4Y92A 2JM8A 2GBQA 2L3PA 2EBPA 2YT6A 1SRMA 1TUCA 1NYGA 2FPDA 3R6NA 2ED1A 1RLQC 1TG0A 4AG2C 1MUZA 2J7IA 1T3LA 2ECZA 2DL7A 2EW3A 2FRYA 2ROTA 1UHFA 2DVJA 2RF0A 1G83A 2J05A 1GFDA 1PWTA 4Z89A 1Z9QA 1WXBA 1JU5C 2AK5A 2DMOA 2HCKA 1U5SA 1UDLA 3THKA 2DX1A 2JS2A 4LNPA 2K2MA 3M0UA 5IXFA 1QLYA 1UJYA 2D8HA 3JV3A 2L0AA 2KGTA 2PZ1A 4HXJA 2DNUA 2O9SA 1MV0B 5FWBA 2DL4A 5L23A 2DF6A 4JJBA 3VS7A 4Z8AA 4LUEA 3RBBB 3KFVA 1MV3A 2DYBA 2GNCA 3QWXX 3UATA 1YCSB 4ESRA 1PKSA 4OMPA 1S1NA 1YWOA 4LE9A 4DEXA 1M8MA 4J9GA 3REBB 5FW9A 2KYBA 2CDTA 4JJDA 2O31A 2FG0A 2DRKA 1JXOA 1ZX6A 3EG1A 3M0PA 2EGAA 1BB9A 4CC2A 1GCQA 5EC7A 1NEGA
chains in the Genus database with same CATH superfamily
5GJVB 2X4YA 2K2VA 4M7DC 2O4XA 1KC8C 2EYWA 2PU9B 4DOVA 2O9VA 3OA6A 1W1FA 2GGRA 1QVGS 4EPCA 4ORZA 1M3BA 1IHVA 4P5NA 5IAYA 3OYJA 1OU8A 4XK8E 2RHXA 3QIIA 3X24B 3NPFA 2A37A 3MPUB 4M75F 5HK3A 1WXTA 4ELZC 3FJPA 2EYXA 3LH5A 3FLGA 4PK4A 5GAN4 5I21A 3CC7A 2YRDA 4A63B 4Z02A 4BE2A 4GBQA 1K9MU 3CMAQ 2C0IA 3LYIA 3OYBA 1YN8A 2GQIA 8ATCB 3PTAA 4M7DE 2QEXT 2HKNA 1K8AC 4A4KA 2RPNA 3OSVA 2EAYA 1FMKA 3UA6A 5GAOm 4FT2A 4QQ6A 1AZEA 2RJDA 2X4WA 1AWJA 3KUFA 1B7TA 3EFOA 4E7IA 1QQJA 1VQ6A 1JJ2A 2DTOA 2MCNA 1BKBA 4EMKC 2O88A 2K5IA 4QT7A 1G2BA 1D09B 5J26A 3G71A 5FROA 5CQXA 2PNIA 2OAWA 1A0NB 5LL6S 3OB9A 1GCQC 1TUGB 4KT0E 4M78D 4C8QG 3LW5E 2LP5A 2ZGWA 3U23A 4PLIA 3JRZA 3OS2A 2K5LA 4ANJA 1OZ2A 5GMKj 4B9XA 3OBWA 1N8RR 2XI9A 1NJIC 4XAXB 2DM1A 1WI7A 3RKXA 4FT4A 1T0JA 2D0NA 2KROA 2OX7A 3QZ9B 3I35A 2O2OA 4BE0A 2JJ9A 4ZGJB 4N0AC 4D8DA 4LXCA 1UGPB 3HFNA 1PC0A 2E12A 3JAME 2AIRB 4HA8A 1PNJA 2ABLA 1VQLA 2F5TX 1NYFA 4MMLA 1VQPT 1KQSS 2MMPA 4HT9A 4PJOC 1C1AA 4AFZC 2KYMA 1AHJB 4JRPA 1K0XA 1PSFA 2CP6A 1BBZA 2CP7A 4C92C 1WPYA 3VYGA 2K6DA 3HRTA 4AMCA 3C0CA 3H41A 2DE0X 4XTVA 4GLMA 1NE8A 3JCMX 2B8AA 2KK4A 3LWHA 1AOJA 5FRNA 4X34A 5IHIA 1K9MC 3M0TA 1Z9ZA 2MYSA 3RERA 2FVUA 1X2QA 1YITA 2K4YA 2DRMA 1G3YA 1UE9A 3CXCP 1SRLA 3TSWA 4PJOE 4QVZA 4E7SA 2XICA 2LT4A 1IGQA 2LQ8A 5AYFA 1UGQB 2FEIA 4X9DA 4M77B 1VYVA 1UG1A 4C92E 3NGPA 2QTVA 3OS0A 3CC7Q 2K79A 2QAZA 2AKLA 2PQWA 4AG1C 1VYUA 2DJQA 2GQVA 1H3HA 1D3BA 1M1GA 4RCCA 3CCMT 1YJ9T 1QVFS 5FU7B 3P8HA 2O4XB 1WIEA 2VXEA 3C95A 1JO8A 2EWNA 2J06A 1VQ6Q 2ESWA 2LRQA 3EFSA 4BDZA 4F7UB 1JQQA 5CK9A 5C0MA 2JW4A 3GNFB 3OSSC 2RA2A 2YDLA 3G71Q 2LX7A 3OYMA 2E41A 5GAN5 4Y91A 3P8DA 2Y4XA 4NL2A 1Q86U 1UTIA 3QYHB 5GAOl 3CCEQ 2VASA 4KGZB 2CSIA 3CCQT 1X27A 1GFCA 3MP6A 3CCRT 2QTXA 3I5RA 4M78C 1NM7A 2V8JA 2JS0A 2XD0A 2EQMA 1PRMC 4RTXA 3DLMA 5LJ5d 5HKCA 2XDDA 4BDYA 1YJNA 2NYSA 1WHLA 3E9GA 1KQ1A 4XTUA 2ROLA 2KSSA 2M1HA 3PVQA 2HBPA 1H8KA 4ZTJA 4HT8A 1VQNT 1Q81C 4F17A 2HL3A 2L89A 1K9AA 4M75D 2Y4YA 1VQLQ 4WF2A 3ER0A 4M78E 1AD5A 3HHTB 2RMOA 3PVLA 3WVDB 5GANf 5M9OA 1VQ5T 4KUIA 1JJ2S 3CCUQ 3G6EA 3JCMd 2CZ6B 4BY6C 1B07A 1OOTA 3PIPA 1M8VA 1PG5B 2OJ2A 3X26B 2KMTA 4PFOA 4XU3A 3S3OA 4VUBA 4LN2A 3GBQA 2ED0A 1UHCA 3SWNC 1AWOA 4J9BA 1OEBA 1YITQ 4YTLA 5FWCA 5KE2A 1FYNA 2HL5C 2ZPFB 4DBRA 2K5FA 4ZGDB 2CZ1B 3ZFJA 2OTJA 1KJWA 3M53A 4JLIA 4OMNA 4CRIA 4M7AF 5IHNA 2AHJB 5KYXA 4J5YA 4LD6A 2XDPA 1ZHIA 2FHDA 1QP3A 2L5QA 2DXCA 3C12A 3QUIA 1C0MA 1TXQA 5KCOA 2RHUA 2D9TA 1ZSGA 3ME9A 4JZ3A 5LJ5g 1I1JA 3PFSA 1ZSZC 2JM8A 2CP0A 2L3PA 3QBYA 3GP8A 3MEWA 3V8JA 3FEOA 1SRMA 1TUCA 2K3XA 2QG9B 2D6FA 4HCBA 1NYGA 2MWOA 2RB6A 4KBMB 3G4SA 2ED1A 4GLKA 4JDSA 2VC8A 2CGHA 1MUZA 1T3LA 2DL7A 4M7DG 3CMAT 5GAN2 2ROTA 1UHFA 2J05A 3CC2A 5FU6C 4LDXA 4E7LA 2HQHA 1D0YA 3JCMg 2DVEA 2JS2A 5GAN6 3M0UA 2LX9A 4X9CA 3JV3A 2L0AA 3HSBA 4HXJA 2P0KA 2DNUA 4NS5A 1NPRA 4XTZA 1FMVA 1MV0B 3CCJQ 2XKOC 4JRQA 2EYQA 1G8XA 2YLCA 3VS7A 3TEEA 1YJNQ 3LLRA 3RBBB 3KFVA 1FXXA 2NUTB 2VXFA 1PKSA 3EG9A 3V7SA 4DEXA 4C5GA 1MNEA 4RCBA 2CP5A 4GY5A 2LCLA 1ZX6A 4BE1A 3AHUA 2EGAA 5EC7A 1NEGA 1BCOA 3CQTA 3A5ZB 4M75C 1N6AA 1PD0A 1WJQA 3TVTA 3G6EQ 9ATCB 4O5VA 2D0QB 4QW2A 3OMGA 2OTLA 2KVQG 4OMMA 3M4YA 1KC8U 2E4HA 1I8FA 5LJ3d 2JMCA 2QI2A 1NPPA 3HFOA 3SB2A 1VQ9Q 1W2BP 1UB4A 1ZUYA 4IUTA 5GANe 1RAEB 1PM3A 2EGEA 4M75E 1KQSA 2OTJQ 3V7RA 2P0QA 2KE9A 2QQRA 3OYDA 1R8OB 1QKXA 3FIFA 1EFNA 3META 1QWEA 1VUBA 3HRSA 2YLBA 4QVDA 4OB3B 1M30A 1OZ3A 2VUBA 2GCXA 4PNOA 3EAEA 3ULRB 8AT1B 2PVOB 1BI2A 2RQTA 3E19A 1OX8A 3A98A 1Y96B 2R5MA 3UWNA 3OYKA 1BIBA 1WJRA 3CMEA 3E1SA 1Y71A 2JT4A 2DL3A 2KDSA 4C8QA 2YRVA 4C92G 1K1ZA 1S72A 1IGUA 3CC7T 3M55A 4M77F 3LGLA 3CBOA 2CH4W 3H9NA 3OMCA 2M9UA 4JJCA 3PMTA 3CC2Q 2KBTA 3CEYA 4C0DB 1EIFA 5GAOr 4RTUA 3G7ZA 5KYXB 3VS2A 3CXCS 7AT1B 3I56A 2CSQA 2EQUA 2PUKB 4R55A 1VQ6T 1AWXA 1QVFA 5CVIA 1KG1A 1NJIU 3G71T 3R6OA 2HD0A 3OYNA 2C0OA 4R56A 1Y0MA 3MEVA 4RTTA 4F7UF 1X6GA 2L2PA 2QXFA 3D7SB 4M77A 1YJWA 2E6NA 3RKYA 2R58A 1OX9A 2NUPA 3N5BB 3TREA 3URGA 3CCET 2F69A 1RLPC 2D1XA 4OVAA 2WSFE 1J3TA 4JPBW 4M7AD 2QK0A 5DY9A 3OBYA 1M2VB 1WA7A 2QDYB 2A28A 3JB9H 2KNBB 1ZUKA 3RNJA 4A4HA 1M3AA 4F7UA 1NLPC 4RUGA 1Y7XA 1WHMA 1VQMA 5IXBA 3AT1B 1X6BA 1RL2A 2M51A 2CH4A 1OPKA 2DL5A 3JB9F 1RADB 2KI7A 3OYCA 1AVZC 2MIOA 1TOVA 3H6ZA 1X6OA 5A0GA 5HCKA 2RI3A 4M78G 4DOWA 3HP9A 1VQLT 1Y07A 2F2XA 2QQ9A 4LDVA 4F16A 1LJOA 1WJSA 3EG9B 4ZTFA 1QCFA 1NBEB 3CCUT 2BIVA 2JN0A 1M1FA 2BE7D 1RACB 1TS9A 1BI1A 4KRTA 5L8RE 3KBGA 2DIGA 2E6ZA 3VKIA 3UT1A 3SD4A 4MMKA 2CZ0B 1WFWA 2DZCA 1U8RA 1NZ9A 1T0HA 1YCYA 5KE3A 2LJ3A 1PD1A 1ZLMA 1R0CB 2RI2A 3FB9A 1VQ4A 1UGSB 1YITT 1N5ZA 5GANh 2XG8D 2IG0A 2EQKA 2GFUA 3OS5A 4DBFA 3CMEQ 1IRXA 1Q82U 1K8AR 3V8LA 1RI9A 4TVRA 1VIEA 2RQVA 4LD9K 1S72Q 3NTIA 4JLGA 4XTYA 2K3BA 3CD6Q 1U3OA 1W70A 1SSHA 3VS5A 1ZA1B 2LCCA 2M0OA 5A0DA 5I2SA 2XU8A 2V8KA 4J9IA 5D7UA 1SPKA 1LNXA 2E64A 3QPHA 1UECA 3MKDA 5AT1B 5HK0A 1TWBA 2BZYA 3JCMP 1WLPB 3NTKA 1AEYA 3EGXB 2A0FB 3M54A 1V29B 2CREA 3A8GB 2COWA 4RTVA 1YJWQ 3QDRB 2V8IA 2W0ZA 1QVPA 2WSCE 4C8QB 3DB3A 1RAIB 1QMCA 1I5OB 4D6WA 4PL6A 1JRIA 3HTRA 2HAXA 1Q81U 1X75C 4PFPA 2YXYA 4IUVA 3PGGA 4UC4A 2KRMA 1IO6A 3VU3C 1OV3A 4BACA 3DB4A 2C06A 4N4IA 3OW2P 2V26A 2IVWA 2QEXA 3CCJT 1H641 2AZSA 2EVRA 1D1BA 1YWPA 1GL5A 3OYIA 3I9QA 2ZPGB 1G3TA 4A4EA 1YJNT 4M7AC 3EHRA 4FYYB 5I11A 1VQMQ 2COYA 3SDZA 1KFZA 1WHKA 4QQDA 1BK2A 2RN8A 2M02A 1G3WA 4C0ZA 2VYTA 3JCMW 4XTWA 2SEMA 1RAFB 1VQ7A 2X4JA 2NUPB 4J9FA 2K7AA 1JEGA 4M77D 1YNZA 1FMWA 3E2UA 1VQOA 3GNGA 3G6ET 2H3EB 2XIDA 4LDWA 5CKFA 1K9MR 2RJFA 2VB6A 4M7AE 1F1BB 1Q82C 1B3QA 2RO0A 4PKCC 1H92A 2ZPHB 2NUTA 3PT9A 2GBQA 2CP2A 4N4GA 4BB7A 3QG1A 1VQ9T 2HQXA 1VQ4Q 3OYEA 4OMFB 5FU6B 5IT9E 4BUGA 4XU1A 1BI3A 3CCSA 4AG2C 4M75G 4KGVB 3RESA 2OTJT 4IKFA 1N27A 1G83A 5D6YA 3JB9I 3EGDA 1IB8A 1QVGP 2HCKA 1U5SA 1UDLA 3CCVA 5CO7A 2DYIA 4LNPA 4E7HA 5IXFA 3CCLA 1G5VA 2D8HA 3V7CA 2PZ1A 1W2BS 1QP2A 4E2FB 1VOMA 5L23A 4NOYA 1ZBXA 3JB9D 3GF5A 1EX4A 1MMDA 4LUEA 2PVDB 2GNCA 3M58A 1YCSB 1RAAB 3DKMA 2RJCA 2NLUA 1YWOA 1K73R 1M8MA 3L2UA 4EMKA 3REBB 1N9RA 3CC2T 4HKEA 4JJDA 2DD4A 2KQWA 1VQKA 2O31A 3S6WA 2DRKA 3OYAA 1D0ZA 2RD1A 1BB9A 4CC2A 1MNDA 1GCQA 4WTOB 3LX7A 1BIAA 1KSWA 2DAQA 2L3QA 1ZBJA 3J80E 1Y96A 2X51A 3CXCA 1D1AA 2DJZA 4JS4A 1U06A 3O5ZA 5IH2A 4PJMA 1KD1U 2DK3A 4PJJA 2FPFA 2C0TA 3JCMc 2EQIA 4CC7A 2ZCFB 1XTDA 5GJWB 5D6WA 1JBMA 2AT1B 3M5AA 4JUVA 1K76A 2E1HA 4RKUE 4DBQA 4OMLA 1TH7A 4ZN1A 3QZ5B 3JCMf 4IUUA 4X1VA 2HEQA 2DFUA 2DLPA 1VQ7Q 4C0GA 3BW1A 4FW1A 4N0AA 3VRYA 3V8KA 3F70A 3FJ5A 3VYHB 4HVUA 4MZMA 1ABOA 1VQOQ 2LQNA 1WHGA 2WACA 4PJNA 2WSEE 1OPLA 2X9HA 1YBYA 2GTOA 1HSQA 2L8DA 4PJOA 1O75A 1PRLC 2DXUA 5GANj 5CKHA 3TSZA 4QKUA 1CKBA 2MK5A 1QKWA 5GAMf 2AKKA 2EJGA 4IIMA 3MJXA 2H3JA 1IXDA 2VVKA 1MMAA 3PMIA 2KT8A 5I2MA 5FU7C 2JM9A 3CCSQ 1MGQA 1M2VA 3RIRA 3MEAA 2GFAA 4KGXB 3IQLA 3VS3A 4II1A 3VV0A 2GF7A 2JXBA 4E7KA 3L2RA 3OYFA 1Q86R 3CPWP 1I81A 2R5AA 4O6JA 5I22A 1SG5A 1GRIA 1NLOC 4M77E 1T3SA 3CCVQ 1TU0B 2LDMA 2RJEA 2ZPBB 1SSFA 4XTXA 2FZGB 2XK0A 1XNIA 4DBHA 2DZ9A 3CCLQ 2H8HA 1K0SA 2ZZDA 5CKEA 3BFMA 3CMET 1M90R 3PE0A 2D8JA 2JNGA 3MCAB 5A2QE 3LGFA 4FM4B 2EGCA 2Y90A 5J39A 5GAN3 2LJ1A 2RHYA 1S72T 4M7DB 2CP3A 4F7UE 3CD6T 1JB0E 2QQBA 3EG0A 3RDVA 1X69A 1M4ZA 2G3RA 1KD1C 1PSEA 4OMQA 5KH6A 1VQKQ 1D0XA 3EGDB 2DEQA 2E5KA 4FU6A 4RMOA 1Q7YR 2EFIA 2KRNA 1LPLA 2EKOA 3VUZA 2ENMA 1YIJA 2RK2A 2YUQA 5GAOq 2DL8A 3HKSA 1K4US 1CSKA 4M78A 1YJWT 3M0QA 3T9NA 3VS1A 3REAB 2BE9B 3QDFA 3QJ6A 3WXMB 4C8QF 2XDBA 2QASA 1X43A 2RHIA 2YSQA 3A8OB 4J9DA 2HDAA 1ZUUA 2A7YA 4EMKB 5LJ5e 2DIQA 2X3WD 5FLXE 4JS5A 1KIKA 3NHNA 4ZNXA 2F2WA 2K9GA 5KYUB 3S3MA 1NG2A 2HBWA 1E6GA 2BUDA 5LJ3f 3EGXA 1VQMT 2KAFA 1VIFA 2CS7A 4LDYA 1AT1B 2P4TA 2QYZA 2EKHA 2FL7A 1YI2A 1Q95G 2L3RA 3G4SQ 2A08A 2LQWA 2MWPA 2KY9A 2LMJA 2JVVA 3UDCA 3JCMe 1JJ2P 3OW2S 3QXEB 3ZBDA 1V76A 1OQKA 3INZA 1N8RU 3M59A 3MEUA 3MP8A 3UA7A 2XMFA 2LQKA 4M7AG 2RQWA 2JZ2A 4Q5WA 4J9CA 4EDUA 3J7AF 1WX6A 3JCMb 2YUPA 4XU0A 1SKUB 1BYMA 4A4FA 5EG2A 3E9FA 2CKKA 1VQ8A 3MHXA 4FSXA 2QA4A 3I55A 1D1CA 5GAMe 1VQ4T 4PFZA 4PJOB 3SFMA 1QCOA 2X35A 2EIFA 3UF4A 3VS6A 2BZXA 5IHKA 5GAOn 2RHZA 3A8MB 4C92B 4ATOA 3H0FA 2LCSA 2LZ6B 2ZPEB 4AFQC 2FYKA 2HZYA 1M1KR 1SF9A 1ZSZA 2I0NA 3ZEHA 3QHSA 4XU2A 1EZZB 5DLQE 2BTTA 1VA7A 1FWZA 3JB9J 4RTWA 1TUDA 3A8LB 2V1QA 1XJWB 2JTMA 2O01E 1B34A 2EJ9A 2RQRA 4B6MA 2KXCA 2QGGA 2LVMA 2NUZA 2OTLQ 2MF2A 1W2BA 2E5QA 1TSFA 1MHNA 2LC4A 1YIJQ 1SHGA 4PJLA 3PNWC 1YHQA 2DKGA 4OB2B 1Y57A 5GAN8 1KC8R 2DBKA 3MO8A 3G1JA 3TU4K 2FZCB 1WGSA 4C0FA 3FC3A 2Z0WA 4PLLA 1VYTA 3CC4A 2HMAA 2SRCA 1I4K1 1SEMA 2DBMA 2MPXC 1PKTA 2X3XD 1KHIA 4CI0C 4FCYA 2W10A 1G3SA 3HPWA 1WYXA 3O8VA 4J7IA 1N8RC 4Y92A 3Q1JA 1H3ZA 3VJPA 2YT6A 4E7ZA 4M75A 5LJ5h 4M78B 1YI2Q 3L2WA 3BDLA 1TG0A 1VQ7T 2J7IA 2ECZA 5CAIA 3KXTA 5GAN7 2DVJA 2F5KA 1X01A 2FB7A 3RR6A 1VQOT 1WZOA 1GFDA 3CCEA 4Z89A 1Z9QA 1JU5C 2DMOA 4FYVB 5D6XA 3A8HB 3X25B 3THKA 2DX1A 5LJ3e 1P92A 3BE3A 2HNIA 2K2MA 3I56Q 5HY6A 1UJYA 2HKQB 2KGTA 4AT1B 4FYWB 3OQ5A 3JCMh 2EJFA 1VQ8Q 5FWBA 2DL4A 2QA4Q 3I55Q 4C0DC 5DM7R 3CCST 4BD3A 2ATCB 1MV3A 1K73U 1NJIR 3UATA 4ESRA 5C6SA 3M9QA 4KH0B 3BDUA 4BY6B 2DETA 4Y28E 5FW9A 4C8QD 1WNLA 2KYBA 3RMQA 4M77G 4KUDK 4MZTA 1JXOA 3JSCA 3EG1A 3DLLA 3CCVT 4ZGEB 5GAMh 4HCKA 2QGFB 3VUBA 3CCLT 2KEAA 3C94A 3SWNB 3CCUA 2FPEA 3EG2A 4N4HA 3M0RA 3L42A 3L2QA 1HJDA 2RK1A 4JZ4A 1XQHA 1R0BG 4J6WA 3M0SA 4ZN3A 2DEUA 2DXTA 3SHWA 2FRWA 2ZPIB 1M9SA 3CPWS 5KYWB 4F7UG 2M0YA 2A3LA 1ACMB 1I0CA 4RG2A 4D8KA 2ZAEA 4MZPA 4M7DF 1UFFA 1YHQQ 4J9HA 2IPOB 2VGNA 4K11A 1VQKT 2LNVA 2J6FA 2MOXA 2V1RA 1C6VX 4A53A 1DJ7B 1KK7A 1ZSZB 2VV5A 2YUNA 3A1PA 3EH2A 4FYXB 3M4GA 3JCMJ 1ARKA 4R0KA 3VS4A 5CKDA 2EPDA 2YRCA 4L59A 2E65A 1ABQA 1OU9A 3LWIA 3L2ZA 3CC4Q 1SHFA 2DTHA 1B34B 1OYXA 1LOJA 2GTJA 2LJ0A 1WDXA 3X28B 2PTKA 4B9WA 1CKAA 2VWFA 1O9SA 2F1LA 4M7DA 1M2OA 2CYZB 3JB9G 3NMZC 1M5Q1 4FIBA 4AFSC 5GMKe 4C5EA 1I5LA 2M16A 1V1CA 3QKJA 5ECAA 3UPUA 2EYZA 5A0LA 2EYYA 4L5GA 3OYYA 4MDXA 4LDUA 4C5IA 4QQGA 1UUEA 3OYGA 1KHCA 4QVCA 1VQPA 4IUPA 1BU1A 4EMGA 1Q82R 1FX7A 4F14A 4J8OA 1RUWA 5CR2A 2X4XA 2VGMA 1K73C 4RG8A 5GAOp 1GCPA 4Z88A 2J6KA 1W6XA 4BI4A 4FL6A 5GANd 3GPLA 3G4ST 2OI3A 3L2VA 1M90U 3CCJA 1PCXA 2K3YA 2L3SA 2KR3A 3VS0A 1BI0A 3EFOB 4OMOA 4JRIA 1LCKA 2A36A 3QYGB 4M75B 4J9EA 1AZGB 2JTEA 3LH0A 5LJ3h 5KYUA 4AFUC 3OYLA 3OW2A 2MI6A 4RTZA 2COZA 5LJ5f 1YFNA 1GBQA 5CQYA 1Q7YU 1R77A 3ZL7C 3CPFA 1Q81R 1HXDA 1XOVA 2QEXQ 2HSEB 4C8QC 5KYYA 3CCMA 1YJ9A 3P8BB 1U1TA 2JOYA 4L6V5 2DA9A 4CC3A 4PJOF 4DQ2A 1M27C 5IN1A 1RAHB 4XQ3A 3CBMA 1QWFA 4C92F 4KULA 3EGUA 1VQ9A 2YUOA 4RTYA 4J83A 2VKNA 2F2VA 4DEYA 3FRNA 4BI8B 2CT4A 1UJ0A 3C4SA 3PIOA 1UGVA 5GAMd 3CCQA 2YHTA 4OGCA 4C8QE 5FRMA 1MMGA 2RQUA 3CCRA 4JJNK 3RMSA 2OTLT 2FZKB 4M77C 1WQWA 2CT3A 1QCNA 5GANg 1OULA 2B86A 2NWMA 5GMKm 1KQSP 3J81E 1YIJT 3S3NA 4C92A 2AZVA 5LJ5j 3GIBA 1HYOA 1Q86C 5DLOA 2P0PA 4HCCA 1JXMA 3TCJA 4IUQA 1W4SA 1HD3A 1QVGA 2LNHB 1VQNA 3OY9A 2IIMA 2LT1A 4OP0A 2KXDA 2BZ8A 1RABB 3HL8A 4M7AA 1PHTA 2YWWA 5CCAA 1I07A 1TTHB 2EQJA 3GLXA 2RM4A 4EIKA 2DILA 3EFRA 1VQPQ 1M90C 4HCZA 2KRSA 3CBPA 3BY7A 4FSSA 4CC4B 1E6HA 4E47A 1VQ5A 3I5SA 2G6FX 5J3BA 1NEBA 1HK9A 2HQEA 3JCMQ 5GMKh 4IURA 1GXIE 1D3BB 4LUDA 1U1SA 3L1AA 3M57A 1BCMA 2E70A 4IIOA 3EHQA 1YI2T 2RNAA 4M78F 2J6OA 1Q7YC 4WCIA 4ELYC 1YP5A 3NTHA 1M1KU 2BKDN 2DPPB 2DD5A 1QVFP 4M7DD 4E7JA 4E6RA 6AT1B 5GAMj 3SEMA 2QQAA 2I2LA 5GAMg 2DO3A 2HSPA 4F04B 2FO0A 2CZ7B 3QJYA 3I56T 3EG3A 3VRZA 1GBRA 4HVVA 1UEBA 1VQ8T 2QA4T 3I55T 4J6XA 1IZ6A 4A54A 1AWWA 3CCMQ 1RAGB 2P4RA 2JUFA 5CKBA 1YJ9Q 5KCHA 2E3IA 2JTFA 1E7OA 1WXUA 1X2KA 4OF1A 1KD1R 3NFCA 2CUBA 4J7FA 1RI0A 2PVGB 2XHCA 3ASKA 2OAUA 2K57A 3QWYA 1WHJA 2RI5A 1IREB 3CMAA 2E3HA 1LVKA 1QW1A 4M4ZA 3MP1A 3OYHA 2QDLA 5CIUA 3RKWA 3QO3A 3CCQQ 2QQSA 4J6YA 2KT1A 3H0IA 3CCRQ 2CUDA 3TQ7P 3QSUA 4HVWA 4NL3A 1M3CA 3H0HA 5KYYB 2JMAA 3WVEB 2EBPA 1IHWA 2R57A 1K8AU 4C5HA 2LTOA 4JRKA 1YHQT 2FPDA 4ME7A 3M56A 3R6NA 1N9SA 1RLQC 4PJOG 5KYNA 3CPWA 3OS1A 1MMNA 1ZQ1A 2EW3A 2FRYA 1VQNQ 5GMKi 2RF0A 3SWNA 4OB0B 1ZA2B 1PWTA 4OGEA 1WXBA 2AK5A 5GMKl 3CD6A 4OB1B 3CC4T 3X20B 2DXBA 3FDRA 4MDWA 2DERA 1QLYA 5KYWA 1M1KC 2P84A 1VQ5Q 4A4GA 2O9SA 4DA4A 4V2SA 2E10A 3JCMV 3HRUA 2DF6A 4PJOD 4JJBA 4KH1B 4EMHA 5LJ3j 1WHHA 2PUOB 5LJ3g 4Z8AA 3RUXA 2DYBA 3QWXX 1WQ7A 2RH2A 4C92D 4OMPA 1S1NA 4LE9A 3H8ZA 4FW2A 4J9GA 3GOXA 2CDTA 1KQ2A 2FG0A 1OI1A 4M7AB 1UGRB 3M0PA 2MAMA 2DTIA 4BI3A 3EH1A
chains in the Genus database with same CATH topology
3CQTA 4HCKA 5GJVB 1KSWA 2KEAA 2FPEA 3EG2A 2L3QA 1ZBJA 2EYWA 3TVTA 1U06A 3M0RA 2O9VA 3O5ZA 5IH2A 1HJDA 1W1FA 4JZ4A 2GGRA 4ORZA 1M3BA 4OMMA 2FPFA 2C0TA 3M0SA 2EQIA 3SHWA 2FRWA 4CC7A 2JMCA 2M0YA 5GJWB 1I0CA 3NPFA 2A37A 4D8KA 1K76A 1UFFA 1WXTA 4OMLA 2EYXA 3LH5A 4J9HA 4K11A 2J6FA 2MOXA 2V1RA 4X1VA 2HEQA 4A63B 1ZUYA 2DLPA 4GBQA 2EGEA 2C0IA 2YUNA 1YN8A 2GQIA 3VRYA 3FJ5A 2KE9A 4HVUA 1ABOA 1ARKA 4R0KA 2RPNA 2LQNA 3VS4A 2EPDA 1ABQA 1FMKA 3UA6A 1QKXA 1EFNA 1SHFA 1OPLA 1QWEA 1AZEA 1AWJA 2GTOA 1HSQA 1M30A 1PRLC 2GTJA 1WDXA 2LJ0A 2MCNA 3TSZA 2PTKA 2O88A 1CKAA 2VWFA 3ULRB 1CKBA 4QT7A 1G2BA 2RQTA 1QKWA 3A98A 2AKKA 3NMZC 4IIMA 2PNIA 2OAWA 1A0NB 4AFSC 2JT4A 1V1CA 2VVKA 1GCQC 2DL3A 2EYZA 5ECAA 2EYYA 2KT8A 1K1ZA 1UUEA 2JM9A 2LP5A 3U23A 3IQLA 2CH4W 3VS3A 1BU1A 2JXBA 4JJCA 2KBTA 4F14A 5I22A 1RUWA 1GRIA 4RTUA 1NLOC 3VS2A 1T3SA 2DM1A 1WI7A 1GCPA 4Z88A 2J6KA 1T0JA 2CSQA 2D0NA 2KROA 1W6XA 2H8HA 3I35A 1AWXA 1K0SA 2OI3A 2O2OA 2C0OA 1Y0MA 2L3SA 4RTTA 1X6GA 2KR3A 2L2PA 3VS0A 4D8DA 3PE0A 2D8JA 4OMOA 1LCKA 2A36A 2EGCA 2LJ1A 4J9EA 1AZGB 1PNJA 2JTEA 1RLPC 2ABLA 2D1XA 1NYFA 3EG0A 1X69A 4AFUC 4RTZA 1J3TA 4JPBW 4AFZC 2KYMA 4OMQA 1K0XA 1GBQA 1BBZA 1WA7A 2A28A 2KNBB 3ZL7C 2E5KA 1XOVA 2K6DA 1ZUKA 3RNJA 2KRNA 1M3AA 3C0CA 3H41A 2DE0X 1NLPC 4RUGA 4GLMA 5IXBA 2DA9A 1AOJA 2ENMA 4CC3A 1X6BA 2M51A 2YUQA 2CH4A 5IHIA 1OPKA 2DL8A 2DL5A 3M0TA 1M27C 1AVZC 1Z9ZA 2MIOA 1CSKA 1K4US 1X2QA 3M0QA 2DRMA 1UE9A 5HCKA 1QWFA 1SRLA 3TSWA 3VS1A 3REAB 3EGUA 2F2XA 2YUOA 4RTYA 2VKNA 4F16A 2FEIA 1X43A 2F2VA 2YSQA 4DEYA 2CT4A 1UJ0A 1VYVA 4J9DA 1QCFA 1UG1A 2HDAA 1ZUUA 3NGPA 1UGVA 2X3WD 2K79A 2AKLA 1KIKA 4AG1C 1VYUA 2DJQA 3NHNA 4ZNXA 2F2WA 4KRTA 2K9GA 1H3HA 2RQUA 1NG2A 2HBWA 2CT3A 1E6GA 1WFWA 2B86A 1T0HA 2NWMA 2LJ3A 1WIEA 1ZLMA 2AZVA 1JO8A 2J06A 2EKHA 2ESWA 1JQQA 1JXMA 1N5ZA 2JW4A 2A08A 2LQWA 2LMJA 2YDLA 1HD3A 2LX7A 2LNHB 2IIMA 2KXDA 1UTIA 2BZ8A 1RI9A 1PHTA 1I07A 2RQVA 3UA7A 2CSIA 4EIKA 2K3BA 1X27A 2DILA 1GFCA 2XMFA 2RQWA 1U3OA 1W70A 1SSHA 2KRSA 4J9CA 1WX6A 3I5RA 3VS5A 1NM7A 4FSSA 1E6HA 4CC4B 2YUPA 3I5SA 2G6FX 1NEBA 2JS0A 4J9IA 1PRMC 4RTXA 1SPKA 1UECA 4LUDA 2BZYA 4IIOA 3EHQA 1WLPB 2ROLA 1AEYA 3PVQA 1H8KA 3UF4A 3VS6A 2BZXA 2RNAA 5IHKA 2J6OA 4F17A 4WCIA 1YP5A 2CREA 1K9AA 3H0FA 4RTVA 2LZ6B 2LCSA 2W0ZA 4AFQC 4E6RA 2I0NA 3SEMA 2HSPA 1AD5A 2BTTA 2RMOA 1VA7A 2FO0A 3PVLA 4RTWA 3EG3A 1TUDA 2KRMA 1IO6A 1OV3A 2V1QA 3VRZA 1GBRA 4HVVA 1B07A 2RQRA 2KXCA 2AZSA 2EVRA 1OOTA 2NUZA 2OJ2A 1YWPA 1AWWA 1GL5A 3I9QA 2P4RA 3EHRA 5I11A 4LN2A 3GBQA 2ED0A 1E7OA 1KFZA 1WXUA 1UHCA 1BK2A 1X2KA 1SHGA 2RN8A 2CUBA 1AWOA 4J9BA 1OEBA 5FWCA 3QWYA 1Y57A 2SEMA 1FYNA 2DBKA 4J9FA 2K7AA 1KJWA 4OMNA 1JEGA 5IHNA 4M4ZA 1YNZA 2QDLA 1VYTA 2SRCA 1SEMA 2DBMA 2KT1A 1PKTA 3H0IA 2CUDA 2X3XD 4HVWA 1ZSGA 1B3QA 4JZ3A 1I1JA 2W10A 1M3CA 1H92A 1WYXA 3H0HA 2JMAA 4Y92A 2JM8A 2GBQA 2L3PA 2EBPA 2YT6A 1SRMA 1TUCA 1NYGA 2FPDA 3R6NA 2ED1A 1RLQC 1TG0A 4AG2C 1MUZA 2J7IA 1T3LA 2ECZA 2DL7A 2EW3A 2FRYA 2ROTA 1UHFA 2DVJA 2RF0A 1G83A 2J05A 1GFDA 1PWTA 4Z89A 1Z9QA 1WXBA 1JU5C 2AK5A 2DMOA 2HCKA 1U5SA 1UDLA 3THKA 2DX1A 2JS2A 4LNPA 2K2MA 3M0UA 5IXFA 1QLYA 1UJYA 2D8HA 3JV3A 2L0AA 2KGTA 2PZ1A 4HXJA 2DNUA 2O9SA 1MV0B 5FWBA 2DL4A 5L23A 2DF6A 4JJBA 3VS7A 4Z8AA 4LUEA 3RBBB 3KFVA 1MV3A 2DYBA 2GNCA 3QWXX 3UATA 1YCSB 4ESRA 1PKSA 4OMPA 1S1NA 1YWOA 4LE9A 4DEXA 1M8MA 4J9GA 3REBB 5FW9A 2KYBA 2CDTA 4JJDA 2O31A 2FG0A 2DRKA 1JXOA 1ZX6A 3EG1A 3M0PA 2EGAA 1BB9A 4CC2A 1GCQA 5EC7A 1NEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQT A;  4HCK A;  5GJV B;  1KSW A;  2KEA A;  2FPE A;  3EG2 A;  2L3Q A;  1ZBJ A;  2EYW A;  3TVT A;  1U06 A;  3M0R A;  2O9V A;  3O5Z A;  5IH2 A;  1HJD A;  1W1F A;  4JZ4 A;  2GGR A;  4ORZ A;  1M3B A;  4OMM A;  2FPF A;  2C0T A;  3M0S A;  2EQI A;  3SHW A;  2FRW A;  4CC7 A;  2JMC A;  2M0Y A;  5GJW B;  1I0C A;  3NPF A;  2A37 A;  4D8K A;  1K76 A;  1UFF A;  1WXT A;  4OML A;  2EYX A;  3LH5 A;  4J9H A;  4K11 A;  2J6F A;  2MOX A;  2V1R A;  4X1V A;  2HEQ A;  4A63 B;  1ZUY A;  2DLP A;  4GBQ A;  2EGE A;  2C0I A;  2YUN A;  1YN8 A;  2GQI A;  3VRY A;  3FJ5 A;  2KE9 A;  4HVU A;  1ABO A;  1ARK A;  4R0K A;  2RPN A;  2LQN A;  3VS4 A;  2EPD A;  1ABQ A;  1FMK A;  3UA6 A;  1QKX A;  1EFN A;  1SHF A;  1OPL A;  1QWE A;  1AZE A;  1AWJ A;  2GTO A;  1HSQ A;  1M30 A;  1PRL C;  2GTJ A;  1WDX A;  2LJ0 A;  2MCN A;  3TSZ A;  2PTK A;  2O88 A;  1CKA A;  2VWF A;  3ULR B;  1CKB A;  4QT7 A;  1G2B A;  2RQT A;  1QKW A;  3A98 A;  2AKK A;  3NMZ C;  4IIM A;  2PNI A;  2OAW A;  1A0N B;  4AFS C;  2JT4 A;  1V1C A;  2VVK A;  1GCQ C;  2DL3 A;  2EYZ A;  5ECA A;  2EYY A;  2KT8 A;  1K1Z A;  1UUE A;  2JM9 A;  2LP5 A;  3U23 A;  3IQL A;  2CH4 W;  3VS3 A;  1BU1 A;  2JXB A;  4JJC A;  2KBT A;  4F14 A;  5I22 A;  1RUW A;  1GRI A;  4RTU A;  1NLO C;  3VS2 A;  1T3S A;  2DM1 A;  1WI7 A;  1GCP A;  4Z88 A;  2J6K A;  1T0J A;  2CSQ A;  2D0N A;  2KRO A;  1W6X A;  2H8H A;  3I35 A;  1AWX A;  1K0S A;  2OI3 A;  2O2O A;  2C0O A;  1Y0M A;  2L3S A;  4RTT A;  1X6G A;  2KR3 A;  2L2P A;  3VS0 A;  4D8D A;  3PE0 A;  2D8J A;  4OMO A;  1LCK A;  2A36 A;  2EGC A;  2LJ1 A;  4J9E A;  1AZG B;  1PNJ A;  2JTE A;  1RLP C;  2ABL A;  2D1X A;  1NYF A;  3EG0 A;  1X69 A;  4AFU C;  4RTZ A;  1J3T A;  4JPB W;  4AFZ C;  2KYM A;  4OMQ A;  1K0X A;  1GBQ A;  1BBZ A;  1WA7 A;  2A28 A;  2KNB B;  3ZL7 C;  2E5K A;  1XOV A;  2K6D A;  1ZUK A;  3RNJ A;  2KRN A;  1M3A A;  3C0C A;  3H41 A;  2DE0 X;  1NLP C;  4RUG A;  4GLM A;  5IXB A;  2DA9 A;  1AOJ A;  2ENM A;  4CC3 A;  1X6B A;  2M51 A;  2YUQ A;  2CH4 A;  5IHI A;  1OPK A;  2DL8 A;  2DL5 A;  3M0T A;  1M27 C;  1AVZ C;  1Z9Z A;  2MIO A;  1CSK A;  1K4U S;  1X2Q A;  3M0Q A;  2DRM A;  1UE9 A;  5HCK A;  1QWF A;  1SRL A;  3TSW A;  3VS1 A;  3REA B;  3EGU A;  2F2X A;  2YUO A;  4RTY A;  2VKN A;  4F16 A;  2FEI A;  1X43 A;  2F2V A;  2YSQ A;  4DEY A;  2CT4 A;  1UJ0 A;  1VYV A;  4J9D A;  1QCF A;  1UG1 A;  2HDA A;  1ZUU A;  3NGP A;  1UGV A;  2X3W D;  2K79 A;  2AKL A;  1KIK A;  4AG1 C;  1VYU A;  2DJQ A;  3NHN A;  4ZNX A;  2F2W A;  4KRT A;  2K9G A;  1H3H A;  2RQU A;  1NG2 A;  2HBW A;  2CT3 A;  1E6G A;  1WFW A;  2B86 A;  1T0H A;  2NWM A;  2LJ3 A;  1WIE A;  1ZLM A;  2AZV A;  1JO8 A;  2J06 A;  2EKH A;  2ESW A;  1JQQ A;  1JXM A;  1N5Z A;  2JW4 A;  2A08 A;  2LQW A;  2LMJ A;  2YDL A;  1HD3 A;  2LX7 A;  2LNH B;  2IIM A;  2KXD A;  1UTI A;  2BZ8 A;  1RI9 A;  1PHT A;  1I07 A;  2RQV A;  3UA7 A;  2CSI A;  4EIK A;  2K3B A;  1X27 A;  2DIL A;  1GFC A;  2XMF A;  2RQW A;  1U3O A;  1W70 A;  1SSH A;  2KRS A;  4J9C A;  1WX6 A;  3I5R A;  3VS5 A;  1NM7 A;  4FSS A;  1E6H A;  4CC4 B;  2YUP A;  3I5S A;  2G6F X;  1NEB A;  2JS0 A;  4J9I A;  1PRM C;  4RTX A;  1SPK A;  1UEC A;  4LUD A;  2BZY A;  4IIO A;  3EHQ A;  1WLP B;  2ROL A;  1AEY A;  3PVQ A;  1H8K A;  3UF4 A;  3VS6 A;  2BZX A;  2RNA A;  5IHK A;  2J6O A;  4F17 A;  4WCI A;  1YP5 A;  2CRE A;  1K9A A;  3H0F A;  4RTV A;  2LZ6 B;  2LCS A;  2W0Z A;  4AFQ C;  4E6R A;  2I0N A;  3SEM A;  2HSP A;  1AD5 A;  2BTT A;  2RMO A;  1VA7 A;  2FO0 A;  3PVL A;  4RTW A;  3EG3 A;  1TUD A;  2KRM A;  1IO6 A;  1OV3 A;  2V1Q A;  3VRZ A;  1GBR A;  4HVV A;  1B07 A;  2RQR A;  2KXC A;  2AZS A;  2EVR A;  1OOT A;  2NUZ A;  2OJ2 A;  1YWP A;  1AWW A;  1GL5 A;  3I9Q A;  2P4R A;  3EHR A;  5I11 A;  4LN2 A;  3GBQ A;  2ED0 A;  1E7O A;  1KFZ A;  1WXU A;  1UHC A;  1BK2 A;  1X2K A;  1SHG A;  2RN8 A;  2CUB A;  1AWO A;  4J9B A;  1OEB A;  5FWC A;  3QWY A;  1Y57 A;  2SEM A;  1FYN A;  2DBK A;  4J9F A;  2K7A A;  1KJW A;  4OMN A;  1JEG A;  5IHN A;  4M4Z A;  1YNZ A;  2QDL A;  1VYT A;  2SRC A;  1SEM A;  2DBM A;  2KT1 A;  1PKT A;  3H0I A;  2CUD A;  2X3X D;  4HVW A;  1ZSG A;  1B3Q A;  4JZ3 A;  1I1J A;  2W10 A;  1M3C A;  1H92 A;  1WYX A;  3H0H A;  2JMA A;  4Y92 A;  2JM8 A;  2GBQ A;  2L3P A;  2EBP A;  2YT6 A;  1SRM A;  1TUC A;  1NYG A;  2FPD A;  3R6N A;  2ED1 A;  1RLQ C;  1TG0 A;  4AG2 C;  1MUZ A;  2J7I A;  1T3L A;  2ECZ A;  2DL7 A;  2EW3 A;  2FRY A;  2ROT A;  1UHF A;  2DVJ A;  2RF0 A;  1G83 A;  2J05 A;  1GFD A;  1PWT A;  4Z89 A;  1Z9Q A;  1WXB A;  1JU5 C;  2AK5 A;  2DMO A;  2HCK A;  1U5S A;  1UDL A;  3THK A;  2DX1 A;  2JS2 A;  4LNP A;  2K2M A;  3M0U A;  5IXF A;  1QLY A;  1UJY A;  2D8H A;  3JV3 A;  2L0A A;  2KGT A;  2PZ1 A;  4HXJ A;  2DNU A;  2O9S A;  1MV0 B;  5FWB A;  2DL4 A;  5L23 A;  2DF6 A;  4JJB A;  3VS7 A;  4Z8A A;  4LUE A;  3RBB B;  3KFV A;  1MV3 A;  2DYB A;  2GNC A;  3QWX X;  3UAT A;  1YCS B;  4ESR A;  1PKS A;  4OMP A;  1S1N A;  1YWO A;  4LE9 A;  4DEX A;  1M8M A;  4J9G A;  3REB B;  5FW9 A;  2KYB A;  2CDT A;  4JJD A;  2O31 A;  2FG0 A;  2DRK A;  1JXO A;  1ZX6 A;  3EG1 A;  3M0P A;  2EGA A;  1BB9 A;  4CC2 A;  1GCQ A;  5EC7 A;  1NEG A; 
#chains in the Genus database with same CATH topology
 5GJV B;  2X4Y A;  2K2V A;  4M7D C;  2O4X A;  1KC8 C;  2EYW A;  2PU9 B;  4DOV A;  2O9V A;  3OA6 A;  1W1F A;  2GGR A;  1QVG S;  4EPC A;  4ORZ A;  1M3B A;  1IHV A;  4P5N A;  5IAY A;  3OYJ A;  1OU8 A;  4XK8 E;  2RHX A;  3QII A;  3X24 B;  3NPF A;  2A37 A;  3MPU B;  4M75 F;  5HK3 A;  1WXT A;  4ELZ C;  3FJP A;  2EYX A;  3LH5 A;  3FLG A;  4PK4 A;  5GAN 4;  5I21 A;  3CC7 A;  2YRD A;  4A63 B;  4Z02 A;  4BE2 A;  4GBQ A;  1K9M U;  3CMA Q;  2C0I A;  3LYI A;  3OYB A;  1YN8 A;  2GQI A;  8ATC B;  3PTA A;  4M7D E;  2QEX T;  2HKN A;  1K8A C;  4A4K A;  2RPN A;  3OSV A;  2EAY A;  1FMK A;  3UA6 A;  5GAO m;  4FT2 A;  4QQ6 A;  1AZE A;  2RJD A;  2X4W A;  1AWJ A;  3KUF A;  1B7T A;  3EFO A;  4E7I A;  1QQJ A;  1VQ6 A;  1JJ2 A;  2DTO A;  2MCN A;  1BKB A;  4EMK C;  2O88 A;  2K5I A;  4QT7 A;  1G2B A;  1D09 B;  5J26 A;  3G71 A;  5FRO A;  5CQX A;  2PNI A;  2OAW A;  1A0N B;  5LL6 S;  3OB9 A;  1GCQ C;  1TUG B;  4KT0 E;  4M78 D;  4C8Q G;  3LW5 E;  2LP5 A;  2ZGW A;  3U23 A;  4PLI A;  3JRZ A;  3OS2 A;  2K5L A;  4ANJ A;  1OZ2 A;  5GMK j;  4B9X A;  3OBW A;  1N8R R;  2XI9 A;  1NJI C;  4XAX B;  2DM1 A;  1WI7 A;  3RKX A;  4FT4 A;  1T0J A;  2D0N A;  2KRO A;  2OX7 A;  3QZ9 B;  3I35 A;  2O2O A;  4BE0 A;  2JJ9 A;  4ZGJ B;  4N0A C;  4D8D A;  4LXC A;  1UGP B;  3HFN A;  1PC0 A;  2E12 A;  3JAM E;  2AIR B;  4HA8 A;  1PNJ A;  2ABL A;  1VQL A;  2F5T X;  1NYF A;  4MML A;  1VQP T;  1KQS S;  2MMP A;  4HT9 A;  4PJO C;  1C1A A;  4AFZ C;  2KYM A;  1AHJ B;  4JRP A;  1K0X A;  1PSF A;  2CP6 A;  1BBZ A;  2CP7 A;  4C92 C;  1WPY A;  3VYG A;  2K6D A;  3HRT A;  4AMC A;  3C0C A;  3H41 A;  2DE0 X;  4XTV A;  4GLM A;  1NE8 A;  3JCM X;  2B8A A;  2KK4 A;  3LWH A;  1AOJ A;  5FRN A;  4X34 A;  5IHI A;  1K9M C;  3M0T A;  1Z9Z A;  2MYS A;  3RER A;  2FVU A;  1X2Q A;  1YIT A;  2K4Y A;  2DRM A;  1G3Y A;  1UE9 A;  3CXC P;  1SRL A;  3TSW A;  4PJO E;  4QVZ A;  4E7S A;  2XIC A;  2LT4 A;  1IGQ A;  2LQ8 A;  5AYF A;  1UGQ B;  2FEI A;  4X9D A;  4M77 B;  1VYV A;  1UG1 A;  4C92 E;  3NGP A;  2QTV A;  3OS0 A;  3CC7 Q;  2K79 A;  2QAZ A;  2AKL A;  2PQW A;  4AG1 C;  1VYU A;  2DJQ A;  2GQV A;  1H3H A;  1D3B A;  1M1G A;  4RCC A;  3CCM T;  1YJ9 T;  1QVF S;  5FU7 B;  3P8H A;  2O4X B;  1WIE A;  2VXE A;  3C95 A;  1JO8 A;  2EWN A;  2J06 A;  1VQ6 Q;  2ESW A;  2LRQ A;  3EFS A;  4BDZ A;  4F7U B;  1JQQ A;  5CK9 A;  5C0M A;  2JW4 A;  3GNF B;  3OSS C;  2RA2 A;  2YDL A;  3G71 Q;  2LX7 A;  3OYM A;  2E41 A;  5GAN 5;  4Y91 A;  3P8D A;  2Y4X A;  4NL2 A;  1Q86 U;  1UTI A;  3QYH B;  5GAO l;  3CCE Q;  2VAS A;  4KGZ B;  2CSI A;  3CCQ T;  1X27 A;  1GFC A;  3MP6 A;  3CCR T;  2QTX A;  3I5R A;  4M78 C;  1NM7 A;  2V8J A;  2JS0 A;  2XD0 A;  2EQM A;  1PRM C;  4RTX A;  3DLM A;  5LJ5 d;  5HKC A;  2XDD A;  4BDY A;  1YJN A;  2NYS A;  1WHL A;  3E9G A;  1KQ1 A;  4XTU A;  2ROL A;  2KSS A;  2M1H A;  3PVQ A;  2HBP A;  1H8K A;  4ZTJ A;  4HT8 A;  1VQN T;  1Q81 C;  4F17 A;  2HL3 A;  2L89 A;  1K9A A;  4M75 D;  2Y4Y A;  1VQL Q;  4WF2 A;  3ER0 A;  4M78 E;  1AD5 A;  3HHT B;  2RMO A;  3PVL A;  3WVD B;  5GAN f;  5M9O A;  1VQ5 T;  4KUI A;  1JJ2 S;  3CCU Q;  3G6E A;  3JCM d;  2CZ6 B;  4BY6 C;  1B07 A;  1OOT A;  3PIP A;  1M8V A;  1PG5 B;  2OJ2 A;  3X26 B;  2KMT A;  4PFO A;  4XU3 A;  3S3O A;  4VUB A;  4LN2 A;  3GBQ A;  2ED0 A;  1UHC A;  3SWN C;  1AWO A;  4J9B A;  1OEB A;  1YIT Q;  4YTL A;  5FWC A;  5KE2 A;  1FYN A;  2HL5 C;  2ZPF B;  4DBR A;  2K5F A;  4ZGD B;  2CZ1 B;  3ZFJ A;  2OTJ A;  1KJW A;  3M53 A;  4JLI A;  4OMN A;  4CRI A;  4M7A F;  5IHN A;  2AHJ B;  5KYX A;  4J5Y A;  4LD6 A;  2XDP A;  1ZHI A;  2FHD A;  1QP3 A;  2L5Q A;  2DXC A;  3C12 A;  3QUI A;  1C0M A;  1TXQ A;  5KCO A;  2RHU A;  2D9T A;  1ZSG A;  3ME9 A;  4JZ3 A;  5LJ5 g;  1I1J A;  3PFS A;  1ZSZ C;  2JM8 A;  2CP0 A;  2L3P A;  3QBY A;  3GP8 A;  3MEW A;  3V8J A;  3FEO A;  1SRM A;  1TUC A;  2K3X A;  2QG9 B;  2D6F A;  4HCB A;  1NYG A;  2MWO A;  2RB6 A;  4KBM B;  3G4S A;  2ED1 A;  4GLK A;  4JDS A;  2VC8 A;  2CGH A;  1MUZ A;  1T3L A;  2DL7 A;  4M7D G;  3CMA T;  5GAN 2;  2ROT A;  1UHF A;  2J05 A;  3CC2 A;  5FU6 C;  4LDX A;  4E7L A;  2HQH A;  1D0Y A;  3JCM g;  2DVE A;  2JS2 A;  5GAN 6;  3M0U A;  2LX9 A;  4X9C A;  3JV3 A;  2L0A A;  3HSB A;  4HXJ A;  2P0K A;  2DNU A;  4NS5 A;  1NPR A;  4XTZ A;  1FMV A;  1MV0 B;  3CCJ Q;  2XKO C;  4JRQ A;  2EYQ A;  1G8X A;  2YLC A;  3VS7 A;  3TEE A;  1YJN Q;  3LLR A;  3RBB B;  3KFV A;  1FXX A;  2NUT B;  2VXF A;  1PKS A;  3EG9 A;  3V7S A;  4DEX A;  4C5G A;  1MNE A;  4RCB A;  2CP5 A;  4GY5 A;  2LCL A;  1ZX6 A;  4BE1 A;  3AHU A;  2EGA A;  5EC7 A;  1NEG A;  1BCO A;  3CQT A;  3A5Z B;  4M75 C;  1N6A A;  1PD0 A;  1WJQ A;  3TVT A;  3G6E Q;  9ATC B;  4O5V A;  2D0Q B;  4QW2 A;  3OMG A;  2OTL A;  2KVQ G;  4OMM A;  3M4Y A;  1KC8 U;  2E4H A;  1I8F A;  5LJ3 d;  2JMC A;  2QI2 A;  1NPP A;  3HFO A;  3SB2 A;  1VQ9 Q;  1W2B P;  1UB4 A;  1ZUY A;  4IUT A;  5GAN e;  1RAE B;  1PM3 A;  2EGE A;  4M75 E;  1KQS A;  2OTJ Q;  3V7R A;  2P0Q A;  2KE9 A;  2QQR A;  3OYD A;  1R8O B;  1QKX A;  3FIF A;  1EFN A;  3MET A;  1QWE A;  1VUB A;  3HRS A;  2YLB A;  4QVD A;  4OB3 B;  1M30 A;  1OZ3 A;  2VUB A;  2GCX A;  4PNO A;  3EAE A;  3ULR B;  8AT1 B;  2PVO B;  1BI2 A;  2RQT A;  3E19 A;  1OX8 A;  3A98 A;  1Y96 B;  2R5M A;  3UWN A;  3OYK A;  1BIB A;  1WJR A;  3CME A;  3E1S A;  1Y71 A;  2JT4 A;  2DL3 A;  2KDS A;  4C8Q A;  2YRV A;  4C92 G;  1K1Z A;  1S72 A;  1IGU A;  3CC7 T;  3M55 A;  4M77 F;  3LGL A;  3CBO A;  2CH4 W;  3H9N A;  3OMC A;  2M9U A;  4JJC A;  3PMT A;  3CC2 Q;  2KBT A;  3CEY A;  4C0D B;  1EIF A;  5GAO r;  4RTU A;  3G7Z A;  5KYX B;  3VS2 A;  3CXC S;  7AT1 B;  3I56 A;  2CSQ A;  2EQU A;  2PUK B;  4R55 A;  1VQ6 T;  1AWX A;  1QVF A;  5CVI A;  1KG1 A;  1NJI U;  3G71 T;  3R6O A;  2HD0 A;  3OYN A;  2C0O A;  4R56 A;  1Y0M A;  3MEV A;  4RTT A;  4F7U F;  1X6G A;  2L2P A;  2QXF A;  3D7S B;  4M77 A;  1YJW A;  2E6N A;  3RKY A;  2R58 A;  1OX9 A;  2NUP A;  3N5B B;  3TRE A;  3URG A;  3CCE T;  2F69 A;  1RLP C;  2D1X A;  4OVA A;  2WSF E;  1J3T A;  4JPB W;  4M7A D;  2QK0 A;  5DY9 A;  3OBY A;  1M2V B;  1WA7 A;  2QDY B;  2A28 A;  3JB9 H;  2KNB B;  1ZUK A;  3RNJ A;  4A4H A;  1M3A A;  4F7U A;  1NLP C;  4RUG A;  1Y7X A;  1WHM A;  1VQM A;  5IXB A;  3AT1 B;  1X6B A;  1RL2 A;  2M51 A;  2CH4 A;  1OPK A;  2DL5 A;  3JB9 F;  1RAD B;  2KI7 A;  3OYC A;  1AVZ C;  2MIO A;  1TOV A;  3H6Z A;  1X6O A;  5A0G A;  5HCK A;  2RI3 A;  4M78 G;  4DOW A;  3HP9 A;  1VQL T;  1Y07 A;  2F2X A;  2QQ9 A;  4LDV A;  4F16 A;  1LJO A;  1WJS A;  3EG9 B;  4ZTF A;  1QCF A;  1NBE B;  3CCU T;  2BIV A;  2JN0 A;  1M1F A;  2BE7 D;  1RAC B;  1TS9 A;  1BI1 A;  4KRT A;  5L8R E;  3KBG A;  2DIG A;  2E6Z A;  3VKI A;  3UT1 A;  3SD4 A;  4MMK A;  2CZ0 B;  1WFW A;  2DZC A;  1U8R A;  1NZ9 A;  1T0H A;  1YCY A;  5KE3 A;  2LJ3 A;  1PD1 A;  1ZLM A;  1R0C B;  2RI2 A;  3FB9 A;  1VQ4 A;  1UGS B;  1YIT T;  1N5Z A;  5GAN h;  2XG8 D;  2IG0 A;  2EQK A;  2GFU A;  3OS5 A;  4DBF A;  3CME Q;  1IRX A;  1Q82 U;  1K8A R;  3V8L A;  1RI9 A;  4TVR A;  1VIE A;  2RQV A;  4LD9 K;  1S72 Q;  3NTI A;  4JLG A;  4XTY A;  2K3B A;  3CD6 Q;  1U3O A;  1W70 A;  1SSH A;  3VS5 A;  1ZA1 B;  2LCC A;  2M0O A;  5A0D A;  5I2S A;  2XU8 A;  2V8K A;  4J9I A;  5D7U A;  1SPK A;  1LNX A;  2E64 A;  3QPH A;  1UEC A;  3MKD A;  5AT1 B;  5HK0 A;  1TWB A;  2BZY A;  3JCM P;  1WLP B;  3NTK A;  1AEY A;  3EGX B;  2A0F B;  3M54 A;  1V29 B;  2CRE A;  3A8G B;  2COW A;  4RTV A;  1YJW Q;  3QDR B;  2V8I A;  2W0Z A;  1QVP A;  2WSC E;  4C8Q B;  3DB3 A;  1RAI B;  1QMC A;  1I5O B;  4D6W A;  4PL6 A;  1JRI A;  3HTR A;  2HAX A;  1Q81 U;  1X75 C;  4PFP A;  2YXY A;  4IUV A;  3PGG A;  4UC4 A;  2KRM A;  1IO6 A;  3VU3 C;  1OV3 A;  4BAC A;  3DB4 A;  2C06 A;  4N4I A;  3OW2 P;  2V26 A;  2IVW A;  2QEX A;  3CCJ T;  1H64 1;  2AZS A;  2EVR A;  1D1B A;  1YWP A;  1GL5 A;  3OYI A;  3I9Q A;  2ZPG B;  1G3T A;  4A4E A;  1YJN T;  4M7A C;  3EHR A;  4FYY B;  5I11 A;  1VQM Q;  2COY A;  3SDZ A;  1KFZ A;  1WHK A;  4QQD A;  1BK2 A;  2RN8 A;  2M02 A;  1G3W A;  4C0Z A;  2VYT A;  3JCM W;  4XTW A;  2SEM A;  1RAF B;  1VQ7 A;  2X4J A;  2NUP B;  4J9F A;  2K7A A;  1JEG A;  4M77 D;  1YNZ A;  1FMW A;  3E2U A;  1VQO A;  3GNG A;  3G6E T;  2H3E B;  2XID A;  4LDW A;  5CKF A;  1K9M R;  2RJF A;  2VB6 A;  4M7A E;  1F1B B;  1Q82 C;  1B3Q A;  2RO0 A;  4PKC C;  1H92 A;  2ZPH B;  2NUT A;  3PT9 A;  2GBQ A;  2CP2 A;  4N4G A;  4BB7 A;  3QG1 A;  1VQ9 T;  2HQX A;  1VQ4 Q;  3OYE A;  4OMF B;  5FU6 B;  5IT9 E;  4BUG A;  4XU1 A;  1BI3 A;  3CCS A;  4AG2 C;  4M75 G;  4KGV B;  3RES A;  2OTJ T;  4IKF A;  1N27 A;  1G83 A;  5D6Y A;  3JB9 I;  3EGD A;  1IB8 A;  1QVG P;  2HCK A;  1U5S A;  1UDL A;  3CCV A;  5CO7 A;  2DYI A;  4LNP A;  4E7H A;  5IXF A;  3CCL A;  1G5V A;  2D8H A;  3V7C A;  2PZ1 A;  1W2B S;  1QP2 A;  4E2F B;  1VOM A;  5L23 A;  4NOY A;  1ZBX A;  3JB9 D;  3GF5 A;  1EX4 A;  1MMD A;  4LUE A;  2PVD B;  2GNC A;  3M58 A;  1YCS B;  1RAA B;  3DKM A;  2RJC A;  2NLU A;  1YWO A;  1K73 R;  1M8M A;  3L2U A;  4EMK A;  3REB B;  1N9R A;  3CC2 T;  4HKE A;  4JJD A;  2DD4 A;  2KQW A;  1VQK A;  2O31 A;  3S6W A;  2DRK A;  3OYA A;  1D0Z A;  2RD1 A;  1BB9 A;  4CC2 A;  1MND A;  1GCQ A;  4WTO B;  3LX7 A;  1BIA A;  1KSW A;  2DAQ A;  2L3Q A;  1ZBJ A;  3J80 E;  1Y96 A;  2X51 A;  3CXC A;  1D1A A;  2DJZ A;  4JS4 A;  1U06 A;  3O5Z A;  5IH2 A;  4PJM A;  1KD1 U;  2DK3 A;  4PJJ A;  2FPF A;  2C0T A;  3JCM c;  2EQI A;  4CC7 A;  2ZCF B;  1XTD A;  5GJW B;  5D6W A;  1JBM A;  2AT1 B;  3M5A A;  4JUV A;  1K76 A;  2E1H A;  4RKU E;  4DBQ A;  4OML A;  1TH7 A;  4ZN1 A;  3QZ5 B;  3JCM f;  4IUU A;  4X1V A;  2HEQ A;  2DFU A;  2DLP A;  1VQ7 Q;  4C0G A;  3BW1 A;  4FW1 A;  4N0A A;  3VRY A;  3V8K A;  3F70 A;  3FJ5 A;  3VYH B;  4HVU A;  4MZM A;  1ABO A;  1VQO Q;  2LQN A;  1WHG A;  2WAC A;  4PJN A;  2WSE E;  1OPL A;  2X9H A;  1YBY A;  2GTO A;  1HSQ A;  2L8D A;  4PJO A;  1O75 A;  1PRL C;  2DXU A;  5GAN j;  5CKH A;  3TSZ A;  4QKU A;  1CKB A;  2MK5 A;  1QKW A;  5GAM f;  2AKK A;  2EJG A;  4IIM A;  3MJX A;  2H3J A;  1IXD A;  2VVK A;  1MMA A;  3PMI A;  2KT8 A;  5I2M A;  5FU7 C;  2JM9 A;  3CCS Q;  1MGQ A;  1M2V A;  3RIR A;  3MEA A;  2GFA A;  4KGX B;  3IQL A;  3VS3 A;  4II1 A;  3VV0 A;  2GF7 A;  2JXB A;  4E7K A;  3L2R A;  3OYF A;  1Q86 R;  3CPW P;  1I81 A;  2R5A A;  4O6J A;  5I22 A;  1SG5 A;  1GRI A;  1NLO C;  4M77 E;  1T3S A;  3CCV Q;  1TU0 B;  2LDM A;  2RJE A;  2ZPB B;  1SSF A;  4XTX A;  2FZG B;  2XK0 A;  1XNI A;  4DBH A;  2DZ9 A;  3CCL Q;  2H8H A;  1K0S A;  2ZZD A;  5CKE A;  3BFM A;  3CME T;  1M90 R;  3PE0 A;  2D8J A;  2JNG A;  3MCA B;  5A2Q E;  3LGF A;  4FM4 B;  2EGC A;  2Y90 A;  5J39 A;  5GAN 3;  2LJ1 A;  2RHY A;  1S72 T;  4M7D B;  2CP3 A;  4F7U E;  3CD6 T;  1JB0 E;  2QQB A;  3EG0 A;  3RDV A;  1X69 A;  1M4Z A;  2G3R A;  1KD1 C;  1PSE A;  4OMQ A;  5KH6 A;  1VQK Q;  1D0X A;  3EGD B;  2DEQ A;  2E5K A;  4FU6 A;  4RMO A;  1Q7Y R;  2EFI A;  2KRN A;  1LPL A;  2EKO A;  3VUZ A;  2ENM A;  1YIJ A;  2RK2 A;  2YUQ A;  5GAO q;  2DL8 A;  3HKS A;  1K4U S;  1CSK A;  4M78 A;  1YJW T;  3M0Q A;  3T9N A;  3VS1 A;  3REA B;  2BE9 B;  3QDF A;  3QJ6 A;  3WXM B;  4C8Q F;  2XDB A;  2QAS A;  1X43 A;  2RHI A;  2YSQ A;  3A8O B;  4J9D A;  2HDA A;  1ZUU A;  2A7Y A;  4EMK B;  5LJ5 e;  2DIQ A;  2X3W D;  5FLX E;  4JS5 A;  1KIK A;  3NHN A;  4ZNX A;  2F2W A;  2K9G A;  5KYU B;  3S3M A;  1NG2 A;  2HBW A;  1E6G A;  2BUD A;  5LJ3 f;  3EGX A;  1VQM T;  2KAF A;  1VIF A;  2CS7 A;  4LDY A;  1AT1 B;  2P4T A;  2QYZ A;  2EKH A;  2FL7 A;  1YI2 A;  1Q95 G;  2L3R A;  3G4S Q;  2A08 A;  2LQW A;  2MWP A;  2KY9 A;  2LMJ A;  2JVV A;  3UDC A;  3JCM e;  1JJ2 P;  3OW2 S;  3QXE B;  3ZBD A;  1V76 A;  1OQK A;  3INZ A;  1N8R U;  3M59 A;  3MEU A;  3MP8 A;  3UA7 A;  2XMF A;  2LQK A;  4M7A G;  2RQW A;  2JZ2 A;  4Q5W A;  4J9C A;  4EDU A;  3J7A F;  1WX6 A;  3JCM b;  2YUP A;  4XU0 A;  1SKU B;  1BYM A;  4A4F A;  5EG2 A;  3E9F A;  2CKK A;  1VQ8 A;  3MHX A;  4FSX A;  2QA4 A;  3I55 A;  1D1C A;  5GAM e;  1VQ4 T;  4PFZ A;  4PJO B;  3SFM A;  1QCO A;  2X35 A;  2EIF A;  3UF4 A;  3VS6 A;  2BZX A;  5IHK A;  5GAO n;  2RHZ A;  3A8M B;  4C92 B;  4ATO A;  3H0F A;  2LCS A;  2LZ6 B;  2ZPE B;  4AFQ C;  2FYK A;  2HZY A;  1M1K R;  1SF9 A;  1ZSZ A;  2I0N A;  3ZEH A;  3QHS A;  4XU2 A;  1EZZ B;  5DLQ E;  2BTT A;  1VA7 A;  1FWZ A;  3JB9 J;  4RTW A;  1TUD A;  3A8L B;  2V1Q A;  1XJW B;  2JTM A;  2O01 E;  1B34 A;  2EJ9 A;  2RQR A;  4B6M A;  2KXC A;  2QGG A;  2LVM A;  2NUZ A;  2OTL Q;  2MF2 A;  1W2B A;  2E5Q A;  1TSF A;  1MHN A;  2LC4 A;  1YIJ Q;  1SHG A;  4PJL A;  3PNW C;  1YHQ A;  2DKG A;  4OB2 B;  1Y57 A;  5GAN 8;  1KC8 R;  2DBK A;  3MO8 A;  3G1J A;  3TU4 K;  2FZC B;  1WGS A;  4C0F A;  3FC3 A;  2Z0W A;  4PLL A;  1VYT A;  3CC4 A;  2HMA A;  2SRC A;  1I4K 1;  1SEM A;  2DBM A;  2MPX C;  1PKT A;  2X3X D;  1KHI A;  4CI0 C;  4FCY A;  2W10 A;  1G3S A;  3HPW A;  1WYX A;  3O8V A;  4J7I A;  1N8R C;  4Y92 A;  3Q1J A;  1H3Z A;  3VJP A;  2YT6 A;  4E7Z A;  4M75 A;  5LJ5 h;  4M78 B;  1YI2 Q;  3L2W A;  3BDL A;  1TG0 A;  1VQ7 T;  2J7I A;  2ECZ A;  5CAI A;  3KXT A;  5GAN 7;  2DVJ A;  2F5K A;  1X01 A;  2FB7 A;  3RR6 A;  1VQO T;  1WZO A;  1GFD A;  3CCE A;  4Z89 A;  1Z9Q A;  1JU5 C;  2DMO A;  4FYV B;  5D6X A;  3A8H B;  3X25 B;  3THK A;  2DX1 A;  5LJ3 e;  1P92 A;  3BE3 A;  2HNI A;  2K2M A;  3I56 Q;  5HY6 A;  1UJY A;  2HKQ B;  2KGT A;  4AT1 B;  4FYW B;  3OQ5 A;  3JCM h;  2EJF A;  1VQ8 Q;  5FWB A;  2DL4 A;  2QA4 Q;  3I55 Q;  4C0D C;  5DM7 R;  3CCS T;  4BD3 A;  2ATC B;  1MV3 A;  1K73 U;  1NJI R;  3UAT A;  4ESR A;  5C6S A;  3M9Q A;  4KH0 B;  3BDU A;  4BY6 B;  2DET A;  4Y28 E;  5FW9 A;  4C8Q D;  1WNL A;  2KYB A;  3RMQ A;  4M77 G;  4KUD K;  4MZT A;  1JXO A;  3JSC A;  3EG1 A;  3DLL A;  3CCV T;  4ZGE B;  5GAM h;  4HCK A;  2QGF B;  3VUB A;  3CCL T;  2KEA A;  3C94 A;  3SWN B;  3CCU A;  2FPE A;  3EG2 A;  4N4H A;  3M0R A;  3L42 A;  3L2Q A;  1HJD A;  2RK1 A;  4JZ4 A;  1XQH A;  1R0B G;  4J6W A;  3M0S A;  4ZN3 A;  2DEU A;  2DXT A;  3SHW A;  2FRW A;  2ZPI B;  1M9S A;  3CPW S;  5KYW B;  4F7U G;  2M0Y A;  2A3L A;  1ACM B;  1I0C A;  4RG2 A;  4D8K A;  2ZAE A;  4MZP A;  4M7D F;  1UFF A;  1YHQ Q;  4J9H A;  2IPO B;  2VGN A;  4K11 A;  1VQK T;  2LNV A;  2J6F A;  2MOX A;  2V1R A;  1C6V X;  4A53 A;  1DJ7 B;  1KK7 A;  1ZSZ B;  2VV5 A;  2YUN A;  3A1P A;  3EH2 A;  4FYX B;  3M4G A;  3JCM J;  1ARK A;  4R0K A;  3VS4 A;  5CKD A;  2EPD A;  2YRC A;  4L59 A;  2E65 A;  1ABQ A;  1OU9 A;  3LWI A;  3L2Z A;  3CC4 Q;  1SHF A;  2DTH A;  1B34 B;  1OYX A;  1LOJ A;  2GTJ A;  2LJ0 A;  1WDX A;  3X28 B;  2PTK A;  4B9W A;  1CKA A;  2VWF A;  1O9S A;  2F1L A;  4M7D A;  1M2O A;  2CYZ B;  3JB9 G;  3NMZ C;  1M5Q 1;  4FIB A;  4AFS C;  5GMK e;  4C5E A;  1I5L A;  2M16 A;  1V1C A;  3QKJ A;  5ECA A;  3UPU A;  2EYZ A;  5A0L A;  2EYY A;  4L5G A;  3OYY A;  4MDX A;  4LDU A;  4C5I A;  4QQG A;  1UUE A;  3OYG A;  1KHC A;  4QVC A;  1VQP A;  4IUP A;  1BU1 A;  4EMG A;  1Q82 R;  1FX7 A;  4F14 A;  4J8O A;  1RUW A;  5CR2 A;  2X4X A;  2VGM A;  1K73 C;  4RG8 A;  5GAO p;  1GCP A;  4Z88 A;  2J6K A;  1W6X A;  4BI4 A;  4FL6 A;  5GAN d;  3GPL A;  3G4S T;  2OI3 A;  3L2V A;  1M90 U;  3CCJ A;  1PCX A;  2K3Y A;  2L3S A;  2KR3 A;  3VS0 A;  1BI0 A;  3EFO B;  4OMO A;  4JRI A;  1LCK A;  2A36 A;  3QYG B;  4M75 B;  4J9E A;  1AZG B;  2JTE A;  3LH0 A;  5LJ3 h;  5KYU A;  4AFU C;  3OYL A;  3OW2 A;  2MI6 A;  4RTZ A;  2COZ A;  5LJ5 f;  1YFN A;  1GBQ A;  5CQY A;  1Q7Y U;  1R77 A;  3ZL7 C;  3CPF A;  1Q81 R;  1HXD A;  1XOV A;  2QEX Q;  2HSE B;  4C8Q C;  5KYY A;  3CCM A;  1YJ9 A;  3P8B B;  1U1T A;  2JOY A;  4L6V 5;  2DA9 A;  4CC3 A;  4PJO F;  4DQ2 A;  1M27 C;  5IN1 A;  1RAH B;  4XQ3 A;  3CBM A;  1QWF A;  4C92 F;  4KUL A;  3EGU A;  1VQ9 A;  2YUO A;  4RTY A;  4J83 A;  2VKN A;  2F2V A;  4DEY A;  3FRN A;  4BI8 B;  2CT4 A;  1UJ0 A;  3C4S A;  3PIO A;  1UGV A;  5GAM d;  3CCQ A;  2YHT A;  4OGC A;  4C8Q E;  5FRM A;  1MMG A;  2RQU A;  3CCR A;  4JJN K;  3RMS A;  2OTL T;  2FZK B;  4M77 C;  1WQW A;  2CT3 A;  1QCN A;  5GAN g;  1OUL A;  2B86 A;  2NWM A;  5GMK m;  1KQS P;  3J81 E;  1YIJ T;  3S3N A;  4C92 A;  2AZV A;  5LJ5 j;  3GIB A;  1HYO A;  1Q86 C;  5DLO A;  2P0P A;  4HCC A;  1JXM A;  3TCJ A;  4IUQ A;  1W4S A;  1HD3 A;  1QVG A;  2LNH B;  1VQN A;  3OY9 A;  2IIM A;  2LT1 A;  4OP0 A;  2KXD A;  2BZ8 A;  1RAB B;  3HL8 A;  4M7A A;  1PHT A;  2YWW A;  5CCA A;  1I07 A;  1TTH B;  2EQJ A;  3GLX A;  2RM4 A;  4EIK A;  2DIL A;  3EFR A;  1VQP Q;  1M90 C;  4HCZ A;  2KRS A;  3CBP A;  3BY7 A;  4FSS A;  4CC4 B;  1E6H A;  4E47 A;  1VQ5 A;  3I5S A;  2G6F X;  5J3B A;  1NEB A;  1HK9 A;  2HQE A;  3JCM Q;  5GMK h;  4IUR A;  1GXI E;  1D3B B;  4LUD A;  1U1S A;  3L1A A;  3M57 A;  1BCM A;  2E70 A;  4IIO A;  3EHQ A;  1YI2 T;  2RNA A;  4M78 F;  2J6O A;  1Q7Y C;  4WCI A;  4ELY C;  1YP5 A;  3NTH A;  1M1K U;  2BKD N;  2DPP B;  2DD5 A;  1QVF P;  4M7D D;  4E7J A;  4E6R A;  6AT1 B;  5GAM j;  3SEM A;  2QQA A;  2I2L A;  5GAM g;  2DO3 A;  2HSP A;  4F04 B;  2FO0 A;  2CZ7 B;  3QJY A;  3I56 T;  3EG3 A;  3VRZ A;  1GBR A;  4HVV A;  1UEB A;  1VQ8 T;  2QA4 T;  3I55 T;  4J6X A;  1IZ6 A;  4A54 A;  1AWW A;  3CCM Q;  1RAG B;  2P4R A;  2JUF A;  5CKB A;  1YJ9 Q;  5KCH A;  2E3I A;  2JTF A;  1E7O A;  1WXU A;  1X2K A;  4OF1 A;  1KD1 R;  3NFC A;  2CUB A;  4J7F A;  1RI0 A;  2PVG B;  2XHC A;  3ASK A;  2OAU A;  2K57 A;  3QWY A;  1WHJ A;  2RI5 A;  1IRE B;  3CMA A;  2E3H A;  1LVK A;  1QW1 A;  4M4Z A;  3MP1 A;  3OYH A;  2QDL A;  5CIU A;  3RKW A;  3QO3 A;  3CCQ Q;  2QQS A;  4J6Y A;  2KT1 A;  3H0I A;  3CCR Q;  2CUD A;  3TQ7 P;  3QSU A;  4HVW A;  4NL3 A;  1M3C A;  3H0H A;  5KYY B;  2JMA A;  3WVE B;  2EBP A;  1IHW A;  2R57 A;  1K8A U;  4C5H A;  2LTO A;  4JRK A;  1YHQ T;  2FPD A;  4ME7 A;  3M56 A;  3R6N A;  1N9S A;  1RLQ C;  4PJO G;  5KYN A;  3CPW A;  3OS1 A;  1MMN A;  1ZQ1 A;  2EW3 A;  2FRY A;  1VQN Q;  5GMK i;  2RF0 A;  3SWN A;  4OB0 B;  1ZA2 B;  1PWT A;  4OGE A;  1WXB A;  2AK5 A;  5GMK l;  3CD6 A;  4OB1 B;  3CC4 T;  3X20 B;  2DXB A;  3FDR A;  4MDW A;  2DER A;  1QLY A;  5KYW A;  1M1K C;  2P84 A;  1VQ5 Q;  4A4G A;  2O9S A;  4DA4 A;  4V2S A;  2E10 A;  3JCM V;  3HRU A;  2DF6 A;  4PJO D;  4JJB A;  4KH1 B;  4EMH A;  5LJ3 j;  1WHH A;  2PUO B;  5LJ3 g;  4Z8A A;  3RUX A;  2DYB A;  3QWX X;  1WQ7 A;  2RH2 A;  4C92 D;  4OMP A;  1S1N A;  4LE9 A;  3H8Z A;  4FW2 A;  4J9G A;  3GOX A;  2CDT A;  1KQ2 A;  2FG0 A;  1OI1 A;  4M7A B;  1UGR B;  3M0P A;  2MAM A;  2DTI A;  4BI3 A;  3EH1 A; 
#chains in the Genus database with same CATH homology
 3CQT A;  4HCK A;  5GJV B;  1KSW A;  2KEA A;  2FPE A;  3EG2 A;  2L3Q A;  1ZBJ A;  2EYW A;  3TVT A;  1U06 A;  3M0R A;  2O9V A;  3O5Z A;  5IH2 A;  1HJD A;  1W1F A;  4JZ4 A;  2GGR A;  4ORZ A;  1M3B A;  4OMM A;  2FPF A;  2C0T A;  3M0S A;  2EQI A;  3SHW A;  2FRW A;  4CC7 A;  2JMC A;  2M0Y A;  5GJW B;  1I0C A;  3NPF A;  2A37 A;  4D8K A;  1K76 A;  1UFF A;  1WXT A;  4OML A;  2EYX A;  3LH5 A;  4J9H A;  4K11 A;  2J6F A;  2MOX A;  2V1R A;  4X1V A;  2HEQ A;  4A63 B;  1ZUY A;  2DLP A;  4GBQ A;  2EGE A;  2C0I A;  2YUN A;  1YN8 A;  2GQI A;  3VRY A;  3FJ5 A;  2KE9 A;  4HVU A;  1ABO A;  1ARK A;  4R0K A;  2RPN A;  2LQN A;  3VS4 A;  2EPD A;  1ABQ A;  1FMK A;  3UA6 A;  1QKX A;  1EFN A;  1SHF A;  1OPL A;  1QWE A;  1AZE A;  1AWJ A;  2GTO A;  1HSQ A;  1M30 A;  1PRL C;  2GTJ A;  1WDX A;  2LJ0 A;  2MCN A;  3TSZ A;  2PTK A;  2O88 A;  1CKA A;  2VWF A;  3ULR B;  1CKB A;  4QT7 A;  1G2B A;  2RQT A;  1QKW A;  3A98 A;  2AKK A;  3NMZ C;  4IIM A;  2PNI A;  2OAW A;  1A0N B;  4AFS C;  2JT4 A;  1V1C A;  2VVK A;  1GCQ C;  2DL3 A;  2EYZ A;  5ECA A;  2EYY A;  2KT8 A;  1K1Z A;  1UUE A;  2JM9 A;  2LP5 A;  3U23 A;  3IQL A;  2CH4 W;  3VS3 A;  1BU1 A;  2JXB A;  4JJC A;  2KBT A;  4F14 A;  5I22 A;  1RUW A;  1GRI A;  4RTU A;  1NLO C;  3VS2 A;  1T3S A;  2DM1 A;  1WI7 A;  1GCP A;  4Z88 A;  2J6K A;  1T0J A;  2CSQ A;  2D0N A;  2KRO A;  1W6X A;  2H8H A;  3I35 A;  1AWX A;  1K0S A;  2OI3 A;  2O2O A;  2C0O A;  1Y0M A;  2L3S A;  4RTT A;  1X6G A;  2KR3 A;  2L2P A;  3VS0 A;  4D8D A;  3PE0 A;  2D8J A;  4OMO A;  1LCK A;  2A36 A;  2EGC A;  2LJ1 A;  4J9E A;  1AZG B;  1PNJ A;  2JTE A;  1RLP C;  2ABL A;  2D1X A;  1NYF A;  3EG0 A;  1X69 A;  4AFU C;  4RTZ A;  1J3T A;  4JPB W;  4AFZ C;  2KYM A;  4OMQ A;  1K0X A;  1GBQ A;  1BBZ A;  1WA7 A;  2A28 A;  2KNB B;  3ZL7 C;  2E5K A;  1XOV A;  2K6D A;  1ZUK A;  3RNJ A;  2KRN A;  1M3A A;  3C0C A;  3H41 A;  2DE0 X;  1NLP C;  4RUG A;  4GLM A;  5IXB A;  2DA9 A;  1AOJ A;  2ENM A;  4CC3 A;  1X6B A;  2M51 A;  2YUQ A;  2CH4 A;  5IHI A;  1OPK A;  2DL8 A;  2DL5 A;  3M0T A;  1M27 C;  1AVZ C;  1Z9Z A;  2MIO A;  1CSK A;  1K4U S;  1X2Q A;  3M0Q A;  2DRM A;  1UE9 A;  5HCK A;  1QWF A;  1SRL A;  3TSW A;  3VS1 A;  3REA B;  3EGU A;  2F2X A;  2YUO A;  4RTY A;  2VKN A;  4F16 A;  2FEI A;  1X43 A;  2F2V A;  2YSQ A;  4DEY A;  2CT4 A;  1UJ0 A;  1VYV A;  4J9D A;  1QCF A;  1UG1 A;  2HDA A;  1ZUU A;  3NGP A;  1UGV A;  2X3W D;  2K79 A;  2AKL A;  1KIK A;  4AG1 C;  1VYU A;  2DJQ A;  3NHN A;  4ZNX A;  2F2W A;  4KRT A;  2K9G A;  1H3H A;  2RQU A;  1NG2 A;  2HBW A;  2CT3 A;  1E6G A;  1WFW A;  2B86 A;  1T0H A;  2NWM A;  2LJ3 A;  1WIE A;  1ZLM A;  2AZV A;  1JO8 A;  2J06 A;  2EKH A;  2ESW A;  1JQQ A;  1JXM A;  1N5Z A;  2JW4 A;  2A08 A;  2LQW A;  2LMJ A;  2YDL A;  1HD3 A;  2LX7 A;  2LNH B;  2IIM A;  2KXD A;  1UTI A;  2BZ8 A;  1RI9 A;  1PHT A;  1I07 A;  2RQV A;  3UA7 A;  2CSI A;  4EIK A;  2K3B A;  1X27 A;  2DIL A;  1GFC A;  2XMF A;  2RQW A;  1U3O A;  1W70 A;  1SSH A;  2KRS A;  4J9C A;  1WX6 A;  3I5R A;  3VS5 A;  1NM7 A;  4FSS A;  1E6H A;  4CC4 B;  2YUP A;  3I5S A;  2G6F X;  1NEB A;  2JS0 A;  4J9I A;  1PRM C;  4RTX A;  1SPK A;  1UEC A;  4LUD A;  2BZY A;  4IIO A;  3EHQ A;  1WLP B;  2ROL A;  1AEY A;  3PVQ A;  1H8K A;  3UF4 A;  3VS6 A;  2BZX A;  2RNA A;  5IHK A;  2J6O A;  4F17 A;  4WCI A;  1YP5 A;  2CRE A;  1K9A A;  3H0F A;  4RTV A;  2LZ6 B;  2LCS A;  2W0Z A;  4AFQ C;  4E6R A;  2I0N A;  3SEM A;  2HSP A;  1AD5 A;  2BTT A;  2RMO A;  1VA7 A;  2FO0 A;  3PVL A;  4RTW A;  3EG3 A;  1TUD A;  2KRM A;  1IO6 A;  1OV3 A;  2V1Q A;  3VRZ A;  1GBR A;  4HVV A;  1B07 A;  2RQR A;  2KXC A;  2AZS A;  2EVR A;  1OOT A;  2NUZ A;  2OJ2 A;  1YWP A;  1AWW A;  1GL5 A;  3I9Q A;  2P4R A;  3EHR A;  5I11 A;  4LN2 A;  3GBQ A;  2ED0 A;  1E7O A;  1KFZ A;  1WXU A;  1UHC A;  1BK2 A;  1X2K A;  1SHG A;  2RN8 A;  2CUB A;  1AWO A;  4J9B A;  1OEB A;  5FWC A;  3QWY A;  1Y57 A;  2SEM A;  1FYN A;  2DBK A;  4J9F A;  2K7A A;  1KJW A;  4OMN A;  1JEG A;  5IHN A;  4M4Z A;  1YNZ A;  2QDL A;  1VYT A;  2SRC A;  1SEM A;  2DBM A;  2KT1 A;  1PKT A;  3H0I A;  2CUD A;  2X3X D;  4HVW A;  1ZSG A;  1B3Q A;  4JZ3 A;  1I1J A;  2W10 A;  1M3C A;  1H92 A;  1WYX A;  3H0H A;  2JMA A;  4Y92 A;  2JM8 A;  2GBQ A;  2L3P A;  2EBP A;  2YT6 A;  1SRM A;  1TUC A;  1NYG A;  2FPD A;  3R6N A;  2ED1 A;  1RLQ C;  1TG0 A;  4AG2 C;  1MUZ A;  2J7I A;  1T3L A;  2ECZ A;  2DL7 A;  2EW3 A;  2FRY A;  2ROT A;  1UHF A;  2DVJ A;  2RF0 A;  1G83 A;  2J05 A;  1GFD A;  1PWT A;  4Z89 A;  1Z9Q A;  1WXB A;  1JU5 C;  2AK5 A;  2DMO A;  2HCK A;  1U5S A;  1UDL A;  3THK A;  2DX1 A;  2JS2 A;  4LNP A;  2K2M A;  3M0U A;  5IXF A;  1QLY A;  1UJY A;  2D8H A;  3JV3 A;  2L0A A;  2KGT A;  2PZ1 A;  4HXJ A;  2DNU A;  2O9S A;  1MV0 B;  5FWB A;  2DL4 A;  5L23 A;  2DF6 A;  4JJB A;  3VS7 A;  4Z8A A;  4LUE A;  3RBB B;  3KFV A;  1MV3 A;  2DYB A;  2GNC A;  3QWX X;  3UAT A;  1YCS B;  4ESR A;  1PKS A;  4OMP A;  1S1N A;  1YWO A;  4LE9 A;  4DEX A;  1M8M A;  4J9G A;  3REB B;  5FW9 A;  2KYB A;  2CDT A;  4JJD A;  2O31 A;  2FG0 A;  2DRK A;  1JXO A;  1ZX6 A;  3EG1 A;  3M0P A;  2EGA A;  1BB9 A;  4CC2 A;  1GCQ A;  5EC7 A;  1NEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...