2LX7A

Solution nmr structure of sh3 domain of growth arrest-specific protein 7 (gas7) (fragment 1-60) from homo sapiens, northeast structural genomics consortium (nesg) target hr8574a
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
MSGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGWFPASYVQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Growth arrest-specific protein 7
publication title Solution NMR structure of SH3 domain of growth arrest-specific protein 7 (GAS7) (fragment 1-60) from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR8574A
rcsb
source organism Homo sapiens
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2012-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lx7A00
1FYNA 1YP5A 2CUDA 2M51A 2O88A 2P4RA 1UHFA 1X27A 2JM8A 1UHCA 5IHKA 5I22A 1YNZA 4OMNA 2MOXA 4D8DA 2AKLA 2EKHA 1MV0B 2DRMA 3CQTA 3UATA 2ENMA 2JMAA 1OPLA 2RF0A 1CKAA 1RUWA 2CUBA 5FWCA 1M3CA 2OAWA 2DMOA 2A08A 2K2MA 1KJWA 2NUZA 1BBZA 1Y57A 4RTYA 1WIEA 2CT4A 2EQIA 2AK5A 1NLPC 4J9HA 1W1FA 2KT1A 1PWTA 2HDAA 2GNCA 4LE9A 1UG1A 1X6BA 4OMPA 4AG2C 1RI9A 1YWOA 2EGCA 1PHTA 2DL7A 1VYVA 3VS1A 1X6GA 3I35A 1HJDA 2CT3A 4JJBA 2DM1A 2YUNA 3VS7A 2KROA 2FPEA 1UJYA 1M3BA 1UECA 2YDLA 2YUOA 4JJDA 2A28A 1T0HA 2HSPA 1OV3A 2DE0X 2GGRA 2D8JA 1YN8A 3TSWA 1W70A 1KIKA 1SSHA 2DL8A 2YSQA 1GRIA 1G83A 2DYBA 5I11A 3JV3A 1AVZC 4AG1C 1I1JA 1CKBA 2JW4A 3PVQA 3VS0A 1GCQA 1RLPC 3I5RA 2W0ZA 4RTTA 4KRTA 3VRZA 1B3QA 3THKA 1X2QA 3NGPA 4J9GA 1T0JA 4M4ZA 1IO6A 2JTEA 3VS4A 3C0CA 1S1NA 3M0PA 2OJ2A 2EYZA 4J9BA 1WXUA 4AFSC 1NEGA 4E6RA 4ESRA 3M0RA 1K1ZA 5GJVB 2BTTA 2HBWA 2DL3A 2X3XD 3H0IA 2V1QA 3TSZA 1JEGA 1G2BA 1AOJA 5FW9A 4OMOA 1VA7A 1WFWA 4Y92A 4CC7A 4K11A 2EPDA 1WYXA 1GFCA 2BZXA 1SHFA 1HD3A 2YUQA 1K4US 3I5SA 4JZ3A 2D0NA 2GTOA 2KRSA 1OEBA 1HSQA 2KT8A 1GL5A 4QT7A 1H92A 1U06A 2GTJA 1K0XA 3EG1A 4J9DA 2KYBA 2QDLA 3RNJA 2CH4A 3PE0A 3EG0A 1MUZA 2X3WD 4CC4B 2JS2A 3UA6A 3UF4A 5HCKA 1SRMA 4Z8AA 2EW3A 3EG2A 1UTIA 3KFVA 1M30A 2YT6A 2L0AA 1FMKA 3NMZC 1WXTA 1BU1A 1OPKA 3I9QA 3H0HA 1CSKA 2KYMA 4LN2A 3EHQA 1LCKA 4A63B 1GCQC 1NEBA 4JZ4A 4DEXA 2RN8A 3REAB 1PNJA 4F16A 1E7OA 2DL5A 3NPFA 1QKXA 1AEYA 4IIOA 1PKSA 3QWYA 2RNAA 2KE9A 1SPKA 1YCSB 1BK2A 1E6GA 2FO0A 3VS2A 5IH2A 1H3HA 3M0SA 1BB9A 1PRLC 2K6DA 2VKNA 2K79A 4RTVA 3VS6A 4DEYA 4RTZA 2F2WA 1JXOA 5FWBA 4F14A 2RPNA 3M0TA 2GBQA 2GQIA 1MV3A 2F2XA 1K9AA 2J6KA 2K9GA 3LH5A 1RLQC 5GJWB 5IHNA 3M0QA 2LJ1A 1ZUKA 1TUDA 1GBQA 3NHNA 2A37A 3SHWA 2B86A 3PVLA 1ZBJA 2LQWA 2L3PA 2KNBB 1ABOA 2LQNA 2A36A 1ZX6A 4D8KA 1J3TA 1X2KA 1I07A 2FG0A 2J7IA 2DBMA 2C0IA 4RTUA 1TUCA 1SEMA 1QWFA 2O2OA 2G6FX 2ECZA 2CSQA 2KRNA 2ROLA 2CH4W 1JXMA 2DBKA 2I0NA 1Z9QA 2M0YA 4Z89A 1PRMC 3ZL7C 1UJ0A 2VVKA 4OMMA 2RMOA 1AWXA 2RQUA 1ZSGA 1M8MA 3SEMA 2LJ3A 1JU5C 1T3LA 1U3OA 2KXDA 1B07A 2MCNA 2IIMA 4FSSA 3U23A 1X69A 2J06A 3GBQA 3ULRB 3VS3A 2C0OA 4X1VA 2LP5A 1WA7A 1X43A 1H8KA 2AZVA 2LX7A 1WLPB 2KEAA 3A98A 3H0FA 5IXBA 1ARKA 2KXCA 2CREA 2V1RA 2ABLA 4HVUA 3VRYA 1UGVA 3EGUA 4JJCA 3UA7A 1A0NB 1I0CA 2LNHB 1TG0A 4GLMA 4HCKA 1VYUA 2CSIA 2SEMA 4J9IA 5ECAA 1KSWA 4ORZA 1NG2A 2XMFA 1NYFA 1K76A 2DLPA 3FJ5A 2LCSA 4EIKA 4J9EA 4GBQA 3TVTA 1GBRA 2LMJA 2L3QA 4LUEA 4AFQC 2W10A 2J05A 1N5ZA 2SRCA 1QKWA 1T3SA 2FEIA 1Y0MA 4JPBW 4OMQA 3R6NA 2ROTA 2FPDA 2FRYA 1NYGA 1UE9A 3IQLA 2PTKA 2DF6A 2ED1A 1SRLA 2E5KA 2PZ1A 1AWWA 1EFNA 1UFFA 2NWMA 1OOTA 1JO8A 1NLOC 2OI3A 2DX1A 2RQRA 1M3AA 1WI7A 2LJ0A 4J9CA 2EGEA 2DVJA 2O9SA 1W6XA 1ZUUA 1PKTA 2EVRA 2JMCA 5EC7A 1ZLMA 2F2VA 4CC2A 1U5SA 2DL4A 4R0KA 3REBB 5IXFA 2AZSA 1WDXA 4Z88A 2JS0A 2JXBA 2L2PA 2KGTA 2DA9A 1JQQA 3QWXX 1GCPA 1VYTA 2BZYA 2MIOA 1UDLA 1WX6A 2RQTA 2K7AA 1AWJA 4HVWA 2BZ8A 1V1CA 4ZNXA 1GFDA 1SHGA 1UUEA 1K0SA 2RQVA 1M27C 2EBPA 1WXBA 1ABQA 3O5ZA 3EG3A 3H41A 4CC3A 2EYYA 1KFZA 2EYXA 3M0UA 4F17A 1E6HA 2AKKA 2DRKA 1QWEA 1ZUYA 2JT4A 1AZEA 3RBBB 2D8HA 4RTXA 1Z9ZA 2HCKA 2KR3A 2ED0A 5L23A 2O9VA 2DNUA 2FRWA 1AZGB 2O31A 1NM7A 2D1XA 4OMLA 4AFUC 2VWFA 4HXJA 2L3SA 1YWPA 4LUDA 2CDTA 1XOVA 2H8HA 4IIMA 5IHIA 4WCIA 2FPFA 2J6OA 2RQWA 2DJQA 2K3BA 2HEQA 2KBTA 4RUGA 2YUPA 2DILA 2KRMA 2LZ6B 3VS5A 1AWOA 2EGAA 2ESWA 1QLYA 2PNIA 2JM9A 2J6FA 4RTWA 2C0TA 4AFZC 2EYWA 4J9FA 1AD5A 3EHRA 4LNPA 1QCFA 4HVVA
chains in the Genus database with same CATH superfamily
1YIJA 1YP5A 4Z02A 1OX8A 2P4RA 2QK0A 2E1HA 1OQKA 1UHFA 2VGNA 4M7DA 4FYXB 3OYEA 3EH2A 3QYHB 4QQGA 4HCCA 3PIOA 2MOXA 2AKLA 1KHCA 2BKDN 2EKHA 3OB9A 3D7SB 1RABB 1G3SA 3OYCA 1BI2A 1IHWA 1CKAA 2JTFA 2CUBA 5GAOp 1M3CA 1S72T 1YJ9A 2A08A 2K2MA 2HL5C 1KJWA 2Z0WA 1BBZA 1Y57A 3EH1A 3CCJT 3QUIA 2QDYB 4BI3A 1BI1A 1LNXA 1VQ9Q 3M9QA 1K73U 2KT1A 1PCXA 1UG1A 3I56A 3JCMg 4AG2C 1RI9A 1SSFA 3QSUA 4KBMB 2DFUA 1BIAA 2M02A 3RMSA 2YWWA 3OW2P 2DM1A 2YUNA 4MDWA 3VS7A 2RHYA 2XD0A 1M3BA 1UECA 2YUOA 2GGRA 1I81A 3KBGA 1W70A 3J80E 2X4JA 1GRIA 2MMPA 3OW2S 4EDUA 5I11A 4XU3A 1I1JA 2ZPGB 3OYMA 2EJFA 3I5RA 4KRTA 2QA4A 1B3QA 3THKA 1MMDA 3NGPA 2VASA 4M4ZA 1IO6A 4R56A 1S1NA 2MF2A 4J5YA 1EX4A 3LX7A 1OU9A 1KQ1A 3I55T 1Y96B 3M5AA 4J9BA 1WXUA 4AFSC 1NEGA 4E6RA 3M0RA 4NL2A 4C0DB 1RADB 2HBWA 1VQKA 3OW2A 1OYXA 3RIRA 1JEGA 5GAMe 4KGVB 3S3NA 3C4SA 1VA7A 3JB9D 4Y92A 3UDCA 1PC0A 4DBRA 4LDWA 1BCMA 3G4SQ 2MAMA 2D0NA 2OTJA 1YJNA 3RERA 2KRSA 1OEBA 2XU8A 4F7UF 3CCMA 8ATCB 1U06A 2LVMA 2Y4XA 3M55A 1K0XA 5KYXA 3EG1A 4M7AD 2A7YA 2HD0A 3DLLA 3RNJA 2X3WD 4CC4B 2JS2A 3DB3A 3UF4A 4C0ZA 4E7IA 3GPLA 2EW3A 3VJPA 2LX9A 3ZFJA 2A3LA 3JCMV 5GMKj 4BB7A 1M1KR 3KFVA 4BACA 1M30A 3BY7A 2L0AA 3NMZC 2ZPIB 3H0HA 1JJ2P 1CSKA 4LN2A 5LJ3h 3H6ZA 3CCRT 1NEBA 4J83A 5GMKm 2QYZA 3C12A 3FDRA 3TREA 4C0GA 1Q81C 2RD1A 2Y90A 3G1JA 3L2ZA 1VOMA 2ZGWA 1E7OA 3GP8A 2RNAA 1SPKA 1YCSB 3RDVA 4IUUA 5GANe 1E6GA 4OB1B 1KC8R 2VKNA 3HKSA 3VS6A 3CCEA 4DEYA 2MWOA 4BUGA 1JXOA 3BDUA 5FWBA 2RPNA 1QP2A 2GBQA 2F2XA 3T9NA 2CP2A 2ZPFB 4BDYA 2FZGB 3F70A 2RA2A 3X20B 5C0MA 2VUBA 4AMCA 1WPYA 5CCAA 2LQWA 4M75D 3EFRA 3M56A 2KDSA 3HFNA 2A36A 1ZX6A 1IRXA 4PJJA 2KQWA 1VQ5Q 1I07A 2PVDB 4Q5WA 1VQMA 4M7DC 3CCST 1M5Q1 3RUXA 3CC7A 1SEMA 2DK3A 2G6FX 3KUFA 2ECZA 2JTMA 2KRNA 2ROLA 1N6AA 2DBKA 1K8AC 5I21A 3VU3C 2OTLA 3JB9G 4PKCC 1RL2A 2RMOA 2RQUA 4OF1A 2LJ3A 1JU5C 1M1FA 1UGQB 1GXIE 4Y91A 4F7UA 3L1AA 2IIMA 4J6YA 1QVFA 2ZPEB 2J06A 2EQMA 3CD6A 2QTXA 2P4TA 4M78E 1R8OB 1WA7A 1YJWT 4M7AG 1VQ6T 5FU6C 2AZVA 1U1SA 4ZTFA 5IXBA 5I2MA 1VQ8A 3MEUA 1W4SA 1FXXA 2V1RA 3RR6A 2ABLA 2QG9B 3OS5A 1WHKA 2WSCE 2OAUA 3X28B 4JLGA 2VYTA 2COWA 1N8RC 1VYUA 5ECAA 4OMFB 3QDFA 2DXUA 1K76A 2DLPA 2O01E 5KE3A 3OS2A 2DXTA 4ME7A 4QVDA 1UGRB 4LUEA 2EFIA 5GAMd 2W10A 4ZN1A 2JUFA 4A4EA 1D0ZA 2SRCA 1QKWA 1T3SA 2CZ1B 5LJ3f 3QKJA 4OMQA 1I5OB 2LCCA 1QCOA 3GNGA 3IQLA 2PTKA 2ED1A 4BD3A 2LQKA 1I4K1 2PU9B 2NWMA 4B6MA 3OBYA 2XDBA 4C8QB 1XNIA 2PQWA 2RI3A 3E19A 1MNEA 5GAOl 2QQRA 2FB7A 3HRSA 2DZ9A 1VQNA 1IREB 3G71T 4A4FA 1ZUUA 2MK5A 4PFOA 2F2VA 4M77D 1U5SA 2VC8A 5CQYA 3MP1A 4M75G 3TQ7P 2JXBA 2HNIA 4FW1A 2KGTA 2DA9A 1Y96A 3OYBA 2BZYA 3OQ5A 4B9XA 3WXMB 2F1LA 5KCOA 4HVWA 1G3TA 2KK4A 1YCYA 4GLKA 3HTRA 2YRDA 1IGUA 4LDUA 1WXBA 2K3YA 1ABQA 3EG3A 2EYYA 2EYXA 3UPUA 2E70A 4RKUE 5GANd 2DRKA 1XTDA 2R5MA 4FYYB 1ZUYA 1U8RA 5GAOr 3CCUQ 1AZEA 3RBBB 3RKXA 4E47A 1S72A 2HZYA 3X24B 3BDLA 4QW2A 1X75C 2DNUA 2FRWA 3CCJA 2RHUA 3UWNA 2E4HA 4XTXA 1VQ9T 2L3SA 1W2BP 1YWPA 1XOVA 4B9WA 2VXFA 5IHIA 2BE7D 3PTAA 2RQWA 1VQ7Q 4FIBA 2KBTA 3OYNA 4RUGA 2YUPA 2DILA 2LZ6B 1NPRA 2EGAA 1EIFA 2KY9A 2JM9A 3CBMA 1LOJA 2AHJB 3QXEB 1NPPA 3M58A 4A53A 4XTUA 2L89A 3MP6A 2HKQB 3EHRA 2DKGA 4C0FA 2M51A 3CCVQ 1X27A 4IURA 2JM8A 2KI7A 5KCHA 4NL3A 1YIJQ 1UHCA 4DA4A 5I22A 1YNZA 4OMNA 5HK0A 2EQUA 1MV0B 1N9SA 2ENMA 4C92C 2JMAA 1UB4A 2QI2A 5GMKi 1G3YA 3LGLA 3G7ZA 2DMOA 1FX7A 3I55A 1Q95G 4C5GA 2EQKA 4C8QF 1G8XA 3CC4T 1WIEA 4FL6A 2CT4A 5I2SA 2AK5A 2RHIA 4FYVB 4BY6C 4J9HA 4PLIA 3V7CA 3E2UA 2MPXC 4M77G 1X6BA 1YWOA 2EGCA 5GMKl 3VS1A 2QEXT 2NLUA 2NUTB 2YRVA 2E5QA 2KROA 2FPEA 4JRIA 5EG2A 1T0HA 1KIKA 2DYIA 2YSQA 2V8IA 5LJ5j 3GIBA 2GF7A 4IUQA 2JW4A 3VS0A 2W0ZA 2PUOB 5LJ5h 1QVGA 2LDMA 1T0JA 2V26A 1ZQ1A 1UGPB 2CP3A 4OGCA 3CCRA 4J6WA 3A8GB 2DEQA 2KSSA 2E64A 4ESRA 4C92B 2RK1A 1RAFB 1Q82C 1K1ZA 4M77E 4TVRA 1X6OA 2ZZDA 4UC4A 4ZGJB 2V1QA 3TSZA 3NTHA 5FW9A 4OMOA 1WFWA 1N9RA 4CC7A 1VQKQ 1GFCA 1Q86C 2BZXA 2DTIA 3VYHB 1HD3A 2YUQA 3ZEHA 1K4US 2X51A 3I5SA 1EZZB 3EG9B 4FT2A 2K5LA 1HSQA 1GL5A 4RG2A 1H92A 3OBWA 1YJNQ 3LW5E 1KC8U 1QMCA 4IUTA 3CCMQ 1YI2Q 2HBPA 1K8AU 2KMTA 1MUZA 2R58A 4J7FA 3UA6A 1XQHA 1NBEB 1Q7YC 1TWBA 2QASA 4OB0B 1SRMA 1G3WA 4QQ6A 1VQ5T 3EG2A 4KUIA 4C8QA 4ELYC 4C0DC 2YT6A 5L8RE 3S3MA 1WXTA 3CCSA 3I9QA 4M7DE 1UGSB 2NUPB 2H3EB 4KGXB 5IN1A 1LCKA 3P8HA 2YHTA 1JBMA 2MYSA 2DL5A 3NPFA 3CC2A 3G6EA 1AEYA 3CCQA 3QWYA 1V76A 5A0LA 4JLIA 3JCMh 2FHDA 2K79A 4RTVA 4BI8B 4HA8A 1M90U 4J6XA 5FLXE 3CCEQ 1R77A 3HRTA 2BIVA 4CI0C 3R6OA 1YJWA 1VQ6A 3CPWP 1RLQC 3MEVA 1PD0A 3M0QA 3MEWA 1TUDA 1H641 1PSEA 1GBQA 2DXBA 1C1AA 4M78D 2A37A 3OYJA 4M7AB 3CPWS 3PVLA 3CCLQ 3OMCA 1TSFA 2L3PA 1RACB 2CZ6B 2HL3A 1J3TA 4LDVA 1K9MC 4HT9A 1X2KA 2FG0A 3GF5A 1VQLT 2J7IA 5LJ5f 4P5NA 4C92F 1VQMQ 3CMAT 1C6VX 3JCMJ 2YLBA 4BE0A 2CH4W 3CC7Q 5LL6S 2K3XA 4Z89A 1TH7A 3E1SA 2VVKA 4OMMA 3A5ZB 1AWXA 4XK8E 1T3LA 3CPWA 2KXDA 2JZ2A 3U23A 1X69A 4MMLA 3ULRB 2EQJA 3G71A 4O6JA 4X1VA 3V8KA 4PJOC 3CD6Q 2LX7A 1WLPB 1G5VA 3H0FA 1ARKA 2KXCA 2CREA 4A4GA 3VRYA 3JB9H 3UT1A 1R0CB 3UA7A 2M16A 1UEBA 3OSVA 1TG0A 2RJDA 4M75B 2I2LA 2EJGA 2JNGA 4RCCA 3MP8A 1VQ4A 4EPCA 9ATCB 3H9NA 4EIKA 5GMKh 4J9EA 4GBQA 4PLLA 3TVTA 1Y7XA 2L3QA 4AFQC 2P0KA 2LTOA 1BI3A 2NUTA 3L42A 3CCUT 5GAN4 1VQPQ 1UE9A 3LWHA 1SRLA 2E5KA 2PZ1A 3JB9F 2E6ZA 2LNVA 4L6V5 1JO8A 1NLOC 1K8AR 3MPUB 1YHQT 4QVCA 4J9CA 3JCMf 5GAMj 3MEAA 5KYNA 1YITQ 1PKTA 2EVRA 1QVFP 2JMCA 4M78G 5GAN2 2RHZA 2LT1A 5GAMg 4M7AF 4LD6A 4PJLA 3REBB 1RAAB 5IXFA 3PIPA 2AZSA 4Z88A 4PJOB 3FIFA 4L59A 1QVFS 4ZGEB 3QWXX 1ZSZB 1QQJA 1VYTA 1SF9A 1UDLA 2RQTA 2K7AA 4C92A 1FWZA 3JSCA 1KG1A 1V1CA 1YIJT 3JCMW 1SHGA 3LGFA 2ZCFB 2R5AA 1M4ZA 1K0SA 1WGSA 2LQ8A 4CC3A 1M90R 1KFZA 1WHLA 1E6HA 2AKKA 1AHJB 4V2SA 4A4HA 3EG9A 4C8QC 1KQSS 2CGHA 2JT4A 4KH1B 5CO7A 4RTXA 3WVEB 1ZBXA 3H8ZA 2KR3A 4E7LA 1HXDA 1WQ7A 1D1BA 5L23A 3CC4A 4FT4A 2FVUA 3OYHA 1ACMB 3CCJQ 4LUDA 2CDTA 2H8HA 5CAIA 5GANj 5A0DA 3QJYA 3BE3A 4WCIA 2DJQA 1FMVA 4HT8A 4BDZA 3JCMQ 2QEXA 4F7UE 1WQWA 1AWOA 2ESWA 5GANg 2LRQA 2QGFB 2YXYA 3C95A 2E65A 1KQSA 2NUPA 5LJ3d 2C0TA 5KH6A 3SWNB 4M75F 2YLCA 5FROA 1K73C 5KYUB 2QQSA 5IHKA 2CYZB 3QO3A 4D8DA 3URGA 4MZPA 4E2FB 2DRMA 3A8OB 2XDPA 3CQTA 1OPLA 4LXCA 1RUWA 3OSSC 5FWCA 3A8LB 4N0AA 2NUZA 1WJQA 3TEEA 4RTYA 2C06A 3I55Q 3HRUA 3N5BB 5CR2A 4M7AA 2E41A 1W1FA 1PWTA 2HDAA 2GNCA 3RESA 4LE9A 4OMPA 2M9UA 1PHTA 2DL7A 1AT1B 1YFNA 3CMEQ 1QVPA 4PJOF 3JCMP 2CZ7B 2RH2A 3M53A 5J3BA 3FC3A 1YJNT 4BE2A 2CP7A 1UJYA 2YDLA 5FU7C 4JJDA 3CCMT 1B34B 1OV3A 2HSPA 2JJ9A 4C5HA 4JRPA 1YI2T 3TSWA 1RI0A 2DL8A 2DYBA 5IT9E 2GFUA 3JAME 3DLMA 3JV3A 1AVZC 4AG1C 1CKBA 1P92A 4KULA 4PL6A 4RTTA 3OY9A 1MMGA 1VQ5A 1X2QA 4J9GA 1MMNA 2JTEA 3C0CA 5J26A 2EYZA 4QVZA 4MDXA 3QG1A 1WHHA 4NOYA 4M7DD 2CP6A 2BTTA 5D7UA 2K5FA 5D6XA 2DL3A 2L5QA 2X3XD 3H0IA 3PFSA 3LWIA 2XICA 4GY5A 4K11A 4J7IA 4M75A 2FL7A 1SHFA 4XU1A 2CKKA 2YRCA 4OB2B 4JZ3A 4L5GA 3QZ5B 2KT8A 3MCAB 4QT7A 2QAZA 2P0QA 2GTJA 1RAEB 1VQOQ 4EMHA 1KQ2A 4PJNA 2DEUA 2ZPBB 4J9DA 4O5VA 1OU8A 2KYBA 4WF2A 3WVDB 3DKMA 3CCLT 3PE0A 1HK9A 5D6WA 3EFOB 2L3RA 5FU7B 5HCKA 1C0MA 4Z8AA 3L2QA 3SFMA 5D6YA 3OYFA 1UTIA 3ZBDA 2HAXA 2E6NA 1VQLA 4E7ZA 1BU1A 1OPKA 2QTVA 2KYMA 3NTIA 3CMAA 3CCSQ 3CC7T 4A63B 1QVGP 1GCQC 4JZ4A 1YJ9Q 2L8DA 4LD9K 2EWNA 3REAB 3P8BB 1JRIA 4PJOA 5CKEA 1PKSA 2KE9A 1BK2A 2VXEA 1QVGS 1ZSZA 2FO0A 4LDYA 5IH2A 2D6FA 3MO8A 3CC2Q 1BB9A 2K6DA 3G6EQ 3G4ST 3CCQQ 3I56Q 4RTZA 2F2WA 4N4GA 4F14A 1M8VA 3CD6T 2RB6A 2EIFA 4JJNK 2J6KA 2K9GA 3LH5A 4N4IA 1Q86R 3M4YA 1ZHIA 3NTKA 1YJWQ 5GAN8 1Q81U 3SHWA 1RAIB 1VIFA 3JRZA 1QCNA 3HP9A 3PMIA 2LQNA 3V7SA 2K5IA 2M1HA 2GCXA 3BW1A 2QA4Q 3PT9A 3NFCA 1NJIC 2VV5A 3HFOA 4RTUA 1KD1C 3EGDB 2DJZA 3INZA 1MMAA 4IUVA 1TUCA 2V8JA 1QWFA 4M7DG 2O2OA 2CSQA 1Z9QA 2M0YA 1VQPT 1PRMC 1UJ0A 1MGQA 5KYWB 3VUBA 1ZSGA 1M8MA 3QZ9B 3SEMA 3SWNA 3FLGA 3CPFA 2D9TA 4N0AC 4FSXA 2LC4A 1YHQA 4FSSA 3JCMc 4DBFA 3GBQA 3VS3A 5KYUA 4M7AC 1WHJA 1YITT 2PUKB 3CBOA 2OTJQ 2LP5A 1H8KA 1D0YA 2KEAA 3A98A 1KHIA 3C94A 2QQAA 3L2WA 1TXQA 2X4XA 3JB9J 4AT1B 3HPWA 3E9FA 4M78B 1A0NB 4F04B 1I0CA 3OYAA 3GNFB 2DAQA 2LNHB 4HCKA 2X4YA 4J9IA 1TU0B 1NG2A 4E7KA 1NYFA 4RCBA 5A2QE 2O4XB 2E3IA 1DJ7B 3FRNA 4PNOA 2LCSA 1VQ4Q 2RI5A 4XU0A 4ATOA 4XAXB 1GBRA 2LMJA 5CK9A 3AHUA 3JB9I 2JN0A 1TTHB 2IPOB 5GAN7 1K9MR 2J05A 1N5ZA 2QGGA 2F5TX 4C8QE 4N4HA 3AT1B 2ROTA 5GAOm 3OYDA 2DF6A 5KE2A 1B34A 1EFNA 1UFFA 4C92D 2QXFA 2FYKA 1OOTA 1N8RU 2CP5A 2DIGA 4EMKB 3OYIA 2KVQG 2DD4A 2DTHA 4FCYA 1D09B 4OGEA 2EGEA 2H3JA 4MMKA 1XJWB 2DETA 3LYIA 2WACA 5LJ5d 3CBPA 3FJPA 5EC7A 4RG8A 4M75C 2P84A 1NE8A 1U1TA 1M2OA 4ZGDB 1R0BG 3PNWC 2XI9A 1WDXA 2RK2A 2VB6A 2JS0A 2L2PA 4CRIA 3VV0A 3P8DA 4OP0A 3GLXA 1QP3A 5LJ3e 5GMKe 4FU6A 2AT1B 1X01A 1KK7A 2IG0A 1VUBA 2XDDA 4FYWB 2OX7A 2E12A 2RQVA 1M27C 2EBPA 3O5ZA 3H41A 4II1A 4X9DA 4F17A 4RMOA 3LH0A 4E7SA 2X35A 5GAN3 2JOYA 1PD1A 2ZPHB 2OTLQ 4KH0B 2ED0A 4HKEA 2HKNA 1RAGB 1Q81R 1AZGB 2AIRB 1NM7A 2D1XA 4OMLA 2V8KA 4AFUC 2WSEE 4HXJA 1B7TA 3CC4Q 3V8JA 3EFOA 4HCZA 4IIMA 2PVGB 2RJEA 2J6OA 3HHTB 2HEQA 1ZSZC 2CP0A 3CMET 4HCBA 2KRMA 3VS5A 1WJRA 3L2RA 2LT4A 1D3BB 4M78F 4KGZB 1VQ8Q 2QEXQ 6AT1B 4RTWA 3ER0A 4FW2A 1O75A 4AFZC 2G3RA 2EYWA 2WSFE 1YI2A 1AD5A 1BI0A 1QCFA 4HVVA 5DLOA 1FYNA 1I8FA 4DBHA 2CUDA 1IXDA 4ELZC 2O88A 3VYGA 2JVVA 1BCOA 3JCMd 3O8VA 2Y4YA 3JCMX 2HQHA 5LJ3j 3UATA 5DLQE 1FMWA 1QW1A 2CZ0B 2DD5A 2RF0A 5HKCA 4XU2A 4C92G 2OAWA 5FRNA 5LJ3g 3M59A 4XTVA 2X9HA 4VUBA 1VQ9A 2EYQA 3QDRB 4MZMA 2EQIA 4M77C 1VQ7T 1NLPC 1JJ2S 5DY9A 2BUDA 3SWNC 1VQNQ 2M0OA 1VYVA 1X6GA 3OS1A 5GAMh 3I35A 3VUZA 4ZTJA 1HJDA 5CKDA 2CT3A 4F7UG 1IB8A 4JJBA 2EJ9A 3EGDA 5CQXA 4X34A 1WHMA 3E9GA 2X4WA 1VQOT 2A28A 2DE0X 2D8JA 1YN8A 2HQXA 3CEYA 1SSHA 3CCVT 1G83A 1M1KC 4NS5A 3CCLA 4PJMA 5KYWA 1KQSP 3SB2A 1V29B 2RO0A 3PVQA 1GCQA 1RLPC 1N8RR 1JJ2A 3VRZA 2COZA 3OYYA 2K2VA 3LLRA 2QQBA 1O9SA 1BKBA 4C92E 3VS4A 1K73R 3M0PA 2OJ2A 8AT1B 1M2VB 3DB4A 3RMQA 4DOWA 1KC8C 1YJ9T 1ZA2B 1S72Q 4DQ2A 3V8LA 2DTOA 4MZTA 1PM3A 5GJVB 3A8HB 4OB3B 4M78A 4PK4A 3CC2T 3G6ET 1G2BA 3CCQT 1AOJA 2EKOA 3PGGA 1NZ9A 2P0PA 3G4SA 3I56T 2EPDA 1WYXA 3GOXA 5KYYB 5GANh 4M77B 2O4XA 2QQ9A 4JUVA 2GTOA 2XKOC 1NJIU 3OYKA 3MKDA 1M9SA 1KD1U 3L2VA 4WTOB 3J81E 3S6WA 5J39A 1Q82U 2QDLA 4PJOD 4QQDA 2CH4A 3EG0A 1Y07A 3M54A 3CXCP 4PFZA 1JB0E 4QKUA 2QA4T 4KUDK 3OS0A 1IHVA 4EMKA 1Q86U 1M90C 1N27A 1PSFA 1FMKA 3EGXB 3CXCS 1VQLQ 3EHQA 3SDZA 4XTZA 3V7RA 3TU4K 1BIBA 4DEXA 2RN8A 1VQPA 4F16A 1PNJA 3EFSA 3TCJA 3KXTA 3CMAQ 1QKXA 4IIOA 2XHCA 4M7DB 1VQKT 1F1BB 2KAFA 3VS2A 1H3HA 3OMGA 1SKUB 4JRKA 3M0SA 1PRLC 1Q7YU 2HMAA 3VKIA 4A4KA 4JDSA 2XK0A 3Q1JA 4E7JA 2F5KA 2OTJT 3BFMA 3M0TA 1YITA 4M7AE 2GQIA 1MV3A 5GAMf 3CXCA 1K9AA 5GJWB 5IHNA 4DOVA 1WJSA 4LDXA 2LJ1A 1IGQA 1ZUKA 4Y28E 2ZAEA 5GAOn 5CKHA 3NHNA 2XG8D 3JCMb 2RHXA 2B86A 1LJOA 5CKBA 1ZBJA 2CS7A 2KNBB 1ABOA 3MHXA 5FU6B 4ANJA 2DPPB 4D8KA 2VGMA 3MJXA 2LCLA 1VQ4T 5AYFA 2DBMA 2C0IA 2FZKB 2K57A 2RJCA 2DIQA 3CCRQ 1JXMA 5HY6A 1D3BA 2I0NA 2XIDA 7AT1B 3ZL7C 1D1CA 1MHNA 3ME9A 1U3OA 4C8QD 4M77F 1M1GA 1B07A 4XQ3A 2E3HA 2MCNA 4IKFA 3CCET 5IAYA 1OZ2A 1K9MU 4ZN3A 1YHQQ 2B8AA 2C0OA 5GANf 1I5LA 1X43A 4JS4A 3A1PA 3META 3RKYA 1Y71A 4OVAA 4PJOG 4M75E 2IVWA 4D6WA 3OYGA 3OA6A 3J7AF 5GAN5 1W2BS 5LJ5e 4HVUA 1UGVA 3EGUA 4JJCA 4JS5A 1YBYA 2NYSA 2DXCA 4R55A 3QPHA 4GLMA 2CSIA 2E10A 2SEMA 1KSWA 4ORZA 2XMFA 5GAN6 3QHSA 3PMTA 1VQMT 3FJ5A 2FZCB 4XTWA 4XTYA 1IZ6A 4PFPA 2ATCB 1OULA 2F69A 5C6SA 2EAYA 5KYXB 4M7DF 2FEIA 1WHGA 1Y0MA 4JPBW 3R6NA 1NJIR 2FPDA 5HK3A 2FRYA 4JRQA 2OTLT 1KD1R 1NYGA 3M57A 1W2BA 1AWWA 1OX9A 1PG5B 3RKWA 2BE9B 4E7HA 3FB9A 1Q82R 2OI3A 2DX1A 3QIIA 2RQRA 1TOVA 1M3AA 1WI7A 3L2UA 2LJ0A 2K4YA 4IUPA 4A54A 3HL8A 5M9OA 1TUGB 2DVJA 2RJFA 2O9SA 1ZA1B 1W6XA 4PJOE 4M78C 2COYA 3S3OA 5A0GA 3CMEA 3QYGB 4EMGA 1ZLMA 4CC2A 1VQ6Q 1OZ3A 2GFAA 1WNLA 2DL4A 1VQ8T 4R0KA 5CIUA 1H3ZA 2R57A 1M2VA 4DBQA 3FEOA 1JQQA 2HQEA 1GCPA 2MIOA 1WZOA 3M4GA 1WX6A 1AWJA 2BZ8A 2DO3A 2RI2A 4ZNXA 1VIEA 3EAEA 2DZCA 4YTLA 1GFDA 5DM7R 1UUEA 1Q7YR 1HYOA 2HSEB 5KYYA 5AT1B 5LJ5g 2PVOB 3M0UA 1D0XA 1OI1A 2MI6A 3CCUA 4EMKC 4M77A 1QWEA 3ASKA 3JCMe 1LPLA 2D8HA 2RM4A 3X25B 4C8QG 5GAOq 1Z9ZA 2HCKA 2DERA 3SD4A 1BYMA 2O9VA 4KT0E 2O31A 5CVIA 2VWFA 3A8MB 1VQ7A 1MNDA 5CKFA 1M1KU 3X26B 1LVKA 3QBYA 1VQNT 2FPFA 3OYLA 4J8OA 3QJ6A 1RAHB 2D0QB 2K3BA 3G71Q 4BE1A 2DVEA 1SG5A 4C5EA 5FRMA 1TS9A 3HSBA 1QLYA 2A0FB 2PNIA 3EGXA 4FM4B 4BY6B 2J6FA 2MWPA 4BI4A 4X9CA 1D1AA 1VQOA 2GQVA 4J9FA 4C5IA 4LNPA 3CCVA 4F7UB
chains in the Genus database with same CATH topology
1FYNA 1YP5A 2CUDA 2M51A 2O88A 2P4RA 1UHFA 1X27A 2JM8A 1UHCA 5IHKA 5I22A 1YNZA 4OMNA 2MOXA 4D8DA 2AKLA 2EKHA 1MV0B 2DRMA 3CQTA 3UATA 2ENMA 2JMAA 1OPLA 2RF0A 1CKAA 1RUWA 2CUBA 5FWCA 1M3CA 2OAWA 2DMOA 2A08A 2K2MA 1KJWA 2NUZA 1BBZA 1Y57A 4RTYA 1WIEA 2CT4A 2EQIA 2AK5A 1NLPC 4J9HA 1W1FA 2KT1A 1PWTA 2HDAA 2GNCA 4LE9A 1UG1A 1X6BA 4OMPA 4AG2C 1RI9A 1YWOA 2EGCA 1PHTA 2DL7A 1VYVA 3VS1A 1X6GA 3I35A 1HJDA 2CT3A 4JJBA 2DM1A 2YUNA 3VS7A 2KROA 2FPEA 1UJYA 1M3BA 1UECA 2YDLA 2YUOA 4JJDA 2A28A 1T0HA 2HSPA 1OV3A 2DE0X 2GGRA 2D8JA 1YN8A 3TSWA 1W70A 1KIKA 1SSHA 2DL8A 2YSQA 1GRIA 1G83A 2DYBA 5I11A 3JV3A 1AVZC 4AG1C 1I1JA 1CKBA 2JW4A 3PVQA 3VS0A 1GCQA 1RLPC 3I5RA 2W0ZA 4RTTA 4KRTA 3VRZA 1B3QA 3THKA 1X2QA 3NGPA 4J9GA 1T0JA 4M4ZA 1IO6A 2JTEA 3VS4A 3C0CA 1S1NA 3M0PA 2OJ2A 2EYZA 4J9BA 1WXUA 4AFSC 1NEGA 4E6RA 4ESRA 3M0RA 1K1ZA 5GJVB 2BTTA 2HBWA 2DL3A 2X3XD 3H0IA 2V1QA 3TSZA 1JEGA 1G2BA 1AOJA 5FW9A 4OMOA 1VA7A 1WFWA 4Y92A 4CC7A 4K11A 2EPDA 1WYXA 1GFCA 2BZXA 1SHFA 1HD3A 2YUQA 1K4US 3I5SA 4JZ3A 2D0NA 2GTOA 2KRSA 1OEBA 1HSQA 2KT8A 1GL5A 4QT7A 1H92A 1U06A 2GTJA 1K0XA 3EG1A 4J9DA 2KYBA 2QDLA 3RNJA 2CH4A 3PE0A 3EG0A 1MUZA 2X3WD 4CC4B 2JS2A 3UA6A 3UF4A 5HCKA 1SRMA 4Z8AA 2EW3A 3EG2A 1UTIA 3KFVA 1M30A 2YT6A 2L0AA 1FMKA 3NMZC 1WXTA 1BU1A 1OPKA 3I9QA 3H0HA 1CSKA 2KYMA 4LN2A 3EHQA 1LCKA 4A63B 1GCQC 1NEBA 4JZ4A 4DEXA 2RN8A 3REAB 1PNJA 4F16A 1E7OA 2DL5A 3NPFA 1QKXA 1AEYA 4IIOA 1PKSA 3QWYA 2RNAA 2KE9A 1SPKA 1YCSB 1BK2A 1E6GA 2FO0A 3VS2A 5IH2A 1H3HA 3M0SA 1BB9A 1PRLC 2K6DA 2VKNA 2K79A 4RTVA 3VS6A 4DEYA 4RTZA 2F2WA 1JXOA 5FWBA 4F14A 2RPNA 3M0TA 2GBQA 2GQIA 1MV3A 2F2XA 1K9AA 2J6KA 2K9GA 3LH5A 1RLQC 5GJWB 5IHNA 3M0QA 2LJ1A 1ZUKA 1TUDA 1GBQA 3NHNA 2A37A 3SHWA 2B86A 3PVLA 1ZBJA 2LQWA 2L3PA 2KNBB 1ABOA 2LQNA 2A36A 1ZX6A 4D8KA 1J3TA 1X2KA 1I07A 2FG0A 2J7IA 2DBMA 2C0IA 4RTUA 1TUCA 1SEMA 1QWFA 2O2OA 2G6FX 2ECZA 2CSQA 2KRNA 2ROLA 2CH4W 1JXMA 2DBKA 2I0NA 1Z9QA 2M0YA 4Z89A 1PRMC 3ZL7C 1UJ0A 2VVKA 4OMMA 2RMOA 1AWXA 2RQUA 1ZSGA 1M8MA 3SEMA 2LJ3A 1JU5C 1T3LA 1U3OA 2KXDA 1B07A 2MCNA 2IIMA 4FSSA 3U23A 1X69A 2J06A 3GBQA 3ULRB 3VS3A 2C0OA 4X1VA 2LP5A 1WA7A 1X43A 1H8KA 2AZVA 2LX7A 1WLPB 2KEAA 3A98A 3H0FA 5IXBA 1ARKA 2KXCA 2CREA 2V1RA 2ABLA 4HVUA 3VRYA 1UGVA 3EGUA 4JJCA 3UA7A 1A0NB 1I0CA 2LNHB 1TG0A 4GLMA 4HCKA 1VYUA 2CSIA 2SEMA 4J9IA 5ECAA 1KSWA 4ORZA 1NG2A 2XMFA 1NYFA 1K76A 2DLPA 3FJ5A 2LCSA 4EIKA 4J9EA 4GBQA 3TVTA 1GBRA 2LMJA 2L3QA 4LUEA 4AFQC 2W10A 2J05A 1N5ZA 2SRCA 1QKWA 1T3SA 2FEIA 1Y0MA 4JPBW 4OMQA 3R6NA 2ROTA 2FPDA 2FRYA 1NYGA 1UE9A 3IQLA 2PTKA 2DF6A 2ED1A 1SRLA 2E5KA 2PZ1A 1AWWA 1EFNA 1UFFA 2NWMA 1OOTA 1JO8A 1NLOC 2OI3A 2DX1A 2RQRA 1M3AA 1WI7A 2LJ0A 4J9CA 2EGEA 2DVJA 2O9SA 1W6XA 1ZUUA 1PKTA 2EVRA 2JMCA 5EC7A 1ZLMA 2F2VA 4CC2A 1U5SA 2DL4A 4R0KA 3REBB 5IXFA 2AZSA 1WDXA 4Z88A 2JS0A 2JXBA 2L2PA 2KGTA 2DA9A 1JQQA 3QWXX 1GCPA 1VYTA 2BZYA 2MIOA 1UDLA 1WX6A 2RQTA 2K7AA 1AWJA 4HVWA 2BZ8A 1V1CA 4ZNXA 1GFDA 1SHGA 1UUEA 1K0SA 2RQVA 1M27C 2EBPA 1WXBA 1ABQA 3O5ZA 3EG3A 3H41A 4CC3A 2EYYA 1KFZA 2EYXA 3M0UA 4F17A 1E6HA 2AKKA 2DRKA 1QWEA 1ZUYA 2JT4A 1AZEA 3RBBB 2D8HA 4RTXA 1Z9ZA 2HCKA 2KR3A 2ED0A 5L23A 2O9VA 2DNUA 2FRWA 1AZGB 2O31A 1NM7A 2D1XA 4OMLA 4AFUC 2VWFA 4HXJA 2L3SA 1YWPA 4LUDA 2CDTA 1XOVA 2H8HA 4IIMA 5IHIA 4WCIA 2FPFA 2J6OA 2RQWA 2DJQA 2K3BA 2HEQA 2KBTA 4RUGA 2YUPA 2DILA 2KRMA 2LZ6B 3VS5A 1AWOA 2EGAA 2ESWA 1QLYA 2PNIA 2JM9A 2J6FA 4RTWA 2C0TA 4AFZC 2EYWA 4J9FA 1AD5A 3EHRA 4LNPA 1QCFA 4HVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYN A;  1YP5 A;  2CUD A;  2M51 A;  2O88 A;  2P4R A;  1UHF A;  1X27 A;  2JM8 A;  1UHC A;  5IHK A;  5I22 A;  1YNZ A;  4OMN A;  2MOX A;  4D8D A;  2AKL A;  2EKH A;  1MV0 B;  2DRM A;  3CQT A;  3UAT A;  2ENM A;  2JMA A;  1OPL A;  2RF0 A;  1CKA A;  1RUW A;  2CUB A;  5FWC A;  1M3C A;  2OAW A;  2DMO A;  2A08 A;  2K2M A;  1KJW A;  2NUZ A;  1BBZ A;  1Y57 A;  4RTY A;  1WIE A;  2CT4 A;  2EQI A;  2AK5 A;  1NLP C;  4J9H A;  1W1F A;  2KT1 A;  1PWT A;  2HDA A;  2GNC A;  4LE9 A;  1UG1 A;  1X6B A;  4OMP A;  4AG2 C;  1RI9 A;  1YWO A;  2EGC A;  1PHT A;  2DL7 A;  1VYV A;  3VS1 A;  1X6G A;  3I35 A;  1HJD A;  2CT3 A;  4JJB A;  2DM1 A;  2YUN A;  3VS7 A;  2KRO A;  2FPE A;  1UJY A;  1M3B A;  1UEC A;  2YDL A;  2YUO A;  4JJD A;  2A28 A;  1T0H A;  2HSP A;  1OV3 A;  2DE0 X;  2GGR A;  2D8J A;  1YN8 A;  3TSW A;  1W70 A;  1KIK A;  1SSH A;  2DL8 A;  2YSQ A;  1GRI A;  1G83 A;  2DYB A;  5I11 A;  3JV3 A;  1AVZ C;  4AG1 C;  1I1J A;  1CKB A;  2JW4 A;  3PVQ A;  3VS0 A;  1GCQ A;  1RLP C;  3I5R A;  2W0Z A;  4RTT A;  4KRT A;  3VRZ A;  1B3Q A;  3THK A;  1X2Q A;  3NGP A;  4J9G A;  1T0J A;  4M4Z A;  1IO6 A;  2JTE A;  3VS4 A;  3C0C A;  1S1N A;  3M0P A;  2OJ2 A;  2EYZ A;  4J9B A;  1WXU A;  4AFS C;  1NEG A;  4E6R A;  4ESR A;  3M0R A;  1K1Z A;  5GJV B;  2BTT A;  2HBW A;  2DL3 A;  2X3X D;  3H0I A;  2V1Q A;  3TSZ A;  1JEG A;  1G2B A;  1AOJ A;  5FW9 A;  4OMO A;  1VA7 A;  1WFW A;  4Y92 A;  4CC7 A;  4K11 A;  2EPD A;  1WYX A;  1GFC A;  2BZX A;  1SHF A;  1HD3 A;  2YUQ A;  1K4U S;  3I5S A;  4JZ3 A;  2D0N A;  2GTO A;  2KRS A;  1OEB A;  1HSQ A;  2KT8 A;  1GL5 A;  4QT7 A;  1H92 A;  1U06 A;  2GTJ A;  1K0X A;  3EG1 A;  4J9D A;  2KYB A;  2QDL A;  3RNJ A;  2CH4 A;  3PE0 A;  3EG0 A;  1MUZ A;  2X3W D;  4CC4 B;  2JS2 A;  3UA6 A;  3UF4 A;  5HCK A;  1SRM A;  4Z8A A;  2EW3 A;  3EG2 A;  1UTI A;  3KFV A;  1M30 A;  2YT6 A;  2L0A A;  1FMK A;  3NMZ C;  1WXT A;  1BU1 A;  1OPK A;  3I9Q A;  3H0H A;  1CSK A;  2KYM A;  4LN2 A;  3EHQ A;  1LCK A;  4A63 B;  1GCQ C;  1NEB A;  4JZ4 A;  4DEX A;  2RN8 A;  3REA B;  1PNJ A;  4F16 A;  1E7O A;  2DL5 A;  3NPF A;  1QKX A;  1AEY A;  4IIO A;  1PKS A;  3QWY A;  2RNA A;  2KE9 A;  1SPK A;  1YCS B;  1BK2 A;  1E6G A;  2FO0 A;  3VS2 A;  5IH2 A;  1H3H A;  3M0S A;  1BB9 A;  1PRL C;  2K6D A;  2VKN A;  2K79 A;  4RTV A;  3VS6 A;  4DEY A;  4RTZ A;  2F2W A;  1JXO A;  5FWB A;  4F14 A;  2RPN A;  3M0T A;  2GBQ A;  2GQI A;  1MV3 A;  2F2X A;  1K9A A;  2J6K A;  2K9G A;  3LH5 A;  1RLQ C;  5GJW B;  5IHN A;  3M0Q A;  2LJ1 A;  1ZUK A;  1TUD A;  1GBQ A;  3NHN A;  2A37 A;  3SHW A;  2B86 A;  3PVL A;  1ZBJ A;  2LQW A;  2L3P A;  2KNB B;  1ABO A;  2LQN A;  2A36 A;  1ZX6 A;  4D8K A;  1J3T A;  1X2K A;  1I07 A;  2FG0 A;  2J7I A;  2DBM A;  2C0I A;  4RTU A;  1TUC A;  1SEM A;  1QWF A;  2O2O A;  2G6F X;  2ECZ A;  2CSQ A;  2KRN A;  2ROL A;  2CH4 W;  1JXM A;  2DBK A;  2I0N A;  1Z9Q A;  2M0Y A;  4Z89 A;  1PRM C;  3ZL7 C;  1UJ0 A;  2VVK A;  4OMM A;  2RMO A;  1AWX A;  2RQU A;  1ZSG A;  1M8M A;  3SEM A;  2LJ3 A;  1JU5 C;  1T3L A;  1U3O A;  2KXD A;  1B07 A;  2MCN A;  2IIM A;  4FSS A;  3U23 A;  1X69 A;  2J06 A;  3GBQ A;  3ULR B;  3VS3 A;  2C0O A;  4X1V A;  2LP5 A;  1WA7 A;  1X43 A;  1H8K A;  2AZV A;  2LX7 A;  1WLP B;  2KEA A;  3A98 A;  3H0F A;  5IXB A;  1ARK A;  2KXC A;  2CRE A;  2V1R A;  2ABL A;  4HVU A;  3VRY A;  1UGV A;  3EGU A;  4JJC A;  3UA7 A;  1A0N B;  1I0C A;  2LNH B;  1TG0 A;  4GLM A;  4HCK A;  1VYU A;  2CSI A;  2SEM A;  4J9I A;  5ECA A;  1KSW A;  4ORZ A;  1NG2 A;  2XMF A;  1NYF A;  1K76 A;  2DLP A;  3FJ5 A;  2LCS A;  4EIK A;  4J9E A;  4GBQ A;  3TVT A;  1GBR A;  2LMJ A;  2L3Q A;  4LUE A;  4AFQ C;  2W10 A;  2J05 A;  1N5Z A;  2SRC A;  1QKW A;  1T3S A;  2FEI A;  1Y0M A;  4JPB W;  4OMQ A;  3R6N A;  2ROT A;  2FPD A;  2FRY A;  1NYG A;  1UE9 A;  3IQL A;  2PTK A;  2DF6 A;  2ED1 A;  1SRL A;  2E5K A;  2PZ1 A;  1AWW A;  1EFN A;  1UFF A;  2NWM A;  1OOT A;  1JO8 A;  1NLO C;  2OI3 A;  2DX1 A;  2RQR A;  1M3A A;  1WI7 A;  2LJ0 A;  4J9C A;  2EGE A;  2DVJ A;  2O9S A;  1W6X A;  1ZUU A;  1PKT A;  2EVR A;  2JMC A;  5EC7 A;  1ZLM A;  2F2V A;  4CC2 A;  1U5S A;  2DL4 A;  4R0K A;  3REB B;  5IXF A;  2AZS A;  1WDX A;  4Z88 A;  2JS0 A;  2JXB A;  2L2P A;  2KGT A;  2DA9 A;  1JQQ A;  3QWX X;  1GCP A;  1VYT A;  2BZY A;  2MIO A;  1UDL A;  1WX6 A;  2RQT A;  2K7A A;  1AWJ A;  4HVW A;  2BZ8 A;  1V1C A;  4ZNX A;  1GFD A;  1SHG A;  1UUE A;  1K0S A;  2RQV A;  1M27 C;  2EBP A;  1WXB A;  1ABQ A;  3O5Z A;  3EG3 A;  3H41 A;  4CC3 A;  2EYY A;  1KFZ A;  2EYX A;  3M0U A;  4F17 A;  1E6H A;  2AKK A;  2DRK A;  1QWE A;  1ZUY A;  2JT4 A;  1AZE A;  3RBB B;  2D8H A;  4RTX A;  1Z9Z A;  2HCK A;  2KR3 A;  2ED0 A;  5L23 A;  2O9V A;  2DNU A;  2FRW A;  1AZG B;  2O31 A;  1NM7 A;  2D1X A;  4OML A;  4AFU C;  2VWF A;  4HXJ A;  2L3S A;  1YWP A;  4LUD A;  2CDT A;  1XOV A;  2H8H A;  4IIM A;  5IHI A;  4WCI A;  2FPF A;  2J6O A;  2RQW A;  2DJQ A;  2K3B A;  2HEQ A;  2KBT A;  4RUG A;  2YUP A;  2DIL A;  2KRM A;  2LZ6 B;  3VS5 A;  1AWO A;  2EGA A;  2ESW A;  1QLY A;  2PNI A;  2JM9 A;  2J6F A;  4RTW A;  2C0T A;  4AFZ C;  2EYW A;  4J9F A;  1AD5 A;  3EHR A;  4LNP A;  1QCF A;  4HVV A; 
#chains in the Genus database with same CATH topology
 1YIJ A;  1YP5 A;  4Z02 A;  1OX8 A;  2P4R A;  2QK0 A;  2E1H A;  1OQK A;  1UHF A;  2VGN A;  4M7D A;  4FYX B;  3OYE A;  3EH2 A;  3QYH B;  4QQG A;  4HCC A;  3PIO A;  2MOX A;  2AKL A;  1KHC A;  2BKD N;  2EKH A;  3OB9 A;  3D7S B;  1RAB B;  1G3S A;  3OYC A;  1BI2 A;  1IHW A;  1CKA A;  2JTF A;  2CUB A;  5GAO p;  1M3C A;  1S72 T;  1YJ9 A;  2A08 A;  2K2M A;  2HL5 C;  1KJW A;  2Z0W A;  1BBZ A;  1Y57 A;  3EH1 A;  3CCJ T;  3QUI A;  2QDY B;  4BI3 A;  1BI1 A;  1LNX A;  1VQ9 Q;  3M9Q A;  1K73 U;  2KT1 A;  1PCX A;  1UG1 A;  3I56 A;  3JCM g;  4AG2 C;  1RI9 A;  1SSF A;  3QSU A;  4KBM B;  2DFU A;  1BIA A;  2M02 A;  3RMS A;  2YWW A;  3OW2 P;  2DM1 A;  2YUN A;  4MDW A;  3VS7 A;  2RHY A;  2XD0 A;  1M3B A;  1UEC A;  2YUO A;  2GGR A;  1I81 A;  3KBG A;  1W70 A;  3J80 E;  2X4J A;  1GRI A;  2MMP A;  3OW2 S;  4EDU A;  5I11 A;  4XU3 A;  1I1J A;  2ZPG B;  3OYM A;  2EJF A;  3I5R A;  4KRT A;  2QA4 A;  1B3Q A;  3THK A;  1MMD A;  3NGP A;  2VAS A;  4M4Z A;  1IO6 A;  4R56 A;  1S1N A;  2MF2 A;  4J5Y A;  1EX4 A;  3LX7 A;  1OU9 A;  1KQ1 A;  3I55 T;  1Y96 B;  3M5A A;  4J9B A;  1WXU A;  4AFS C;  1NEG A;  4E6R A;  3M0R A;  4NL2 A;  4C0D B;  1RAD B;  2HBW A;  1VQK A;  3OW2 A;  1OYX A;  3RIR A;  1JEG A;  5GAM e;  4KGV B;  3S3N A;  3C4S A;  1VA7 A;  3JB9 D;  4Y92 A;  3UDC A;  1PC0 A;  4DBR A;  4LDW A;  1BCM A;  3G4S Q;  2MAM A;  2D0N A;  2OTJ A;  1YJN A;  3RER A;  2KRS A;  1OEB A;  2XU8 A;  4F7U F;  3CCM A;  8ATC B;  1U06 A;  2LVM A;  2Y4X A;  3M55 A;  1K0X A;  5KYX A;  3EG1 A;  4M7A D;  2A7Y A;  2HD0 A;  3DLL A;  3RNJ A;  2X3W D;  4CC4 B;  2JS2 A;  3DB3 A;  3UF4 A;  4C0Z A;  4E7I A;  3GPL A;  2EW3 A;  3VJP A;  2LX9 A;  3ZFJ A;  2A3L A;  3JCM V;  5GMK j;  4BB7 A;  1M1K R;  3KFV A;  4BAC A;  1M30 A;  3BY7 A;  2L0A A;  3NMZ C;  2ZPI B;  3H0H A;  1JJ2 P;  1CSK A;  4LN2 A;  5LJ3 h;  3H6Z A;  3CCR T;  1NEB A;  4J83 A;  5GMK m;  2QYZ A;  3C12 A;  3FDR A;  3TRE A;  4C0G A;  1Q81 C;  2RD1 A;  2Y90 A;  3G1J A;  3L2Z A;  1VOM A;  2ZGW A;  1E7O A;  3GP8 A;  2RNA A;  1SPK A;  1YCS B;  3RDV A;  4IUU A;  5GAN e;  1E6G A;  4OB1 B;  1KC8 R;  2VKN A;  3HKS A;  3VS6 A;  3CCE A;  4DEY A;  2MWO A;  4BUG A;  1JXO A;  3BDU A;  5FWB A;  2RPN A;  1QP2 A;  2GBQ A;  2F2X A;  3T9N A;  2CP2 A;  2ZPF B;  4BDY A;  2FZG B;  3F70 A;  2RA2 A;  3X20 B;  5C0M A;  2VUB A;  4AMC A;  1WPY A;  5CCA A;  2LQW A;  4M75 D;  3EFR A;  3M56 A;  2KDS A;  3HFN A;  2A36 A;  1ZX6 A;  1IRX A;  4PJJ A;  2KQW A;  1VQ5 Q;  1I07 A;  2PVD B;  4Q5W A;  1VQM A;  4M7D C;  3CCS T;  1M5Q 1;  3RUX A;  3CC7 A;  1SEM A;  2DK3 A;  2G6F X;  3KUF A;  2ECZ A;  2JTM A;  2KRN A;  2ROL A;  1N6A A;  2DBK A;  1K8A C;  5I21 A;  3VU3 C;  2OTL A;  3JB9 G;  4PKC C;  1RL2 A;  2RMO A;  2RQU A;  4OF1 A;  2LJ3 A;  1JU5 C;  1M1F A;  1UGQ B;  1GXI E;  4Y91 A;  4F7U A;  3L1A A;  2IIM A;  4J6Y A;  1QVF A;  2ZPE B;  2J06 A;  2EQM A;  3CD6 A;  2QTX A;  2P4T A;  4M78 E;  1R8O B;  1WA7 A;  1YJW T;  4M7A G;  1VQ6 T;  5FU6 C;  2AZV A;  1U1S A;  4ZTF A;  5IXB A;  5I2M A;  1VQ8 A;  3MEU A;  1W4S A;  1FXX A;  2V1R A;  3RR6 A;  2ABL A;  2QG9 B;  3OS5 A;  1WHK A;  2WSC E;  2OAU A;  3X28 B;  4JLG A;  2VYT A;  2COW A;  1N8R C;  1VYU A;  5ECA A;  4OMF B;  3QDF A;  2DXU A;  1K76 A;  2DLP A;  2O01 E;  5KE3 A;  3OS2 A;  2DXT A;  4ME7 A;  4QVD A;  1UGR B;  4LUE A;  2EFI A;  5GAM d;  2W10 A;  4ZN1 A;  2JUF A;  4A4E A;  1D0Z A;  2SRC A;  1QKW A;  1T3S A;  2CZ1 B;  5LJ3 f;  3QKJ A;  4OMQ A;  1I5O B;  2LCC A;  1QCO A;  3GNG A;  3IQL A;  2PTK A;  2ED1 A;  4BD3 A;  2LQK A;  1I4K 1;  2PU9 B;  2NWM A;  4B6M A;  3OBY A;  2XDB A;  4C8Q B;  1XNI A;  2PQW A;  2RI3 A;  3E19 A;  1MNE A;  5GAO l;  2QQR A;  2FB7 A;  3HRS A;  2DZ9 A;  1VQN A;  1IRE B;  3G71 T;  4A4F A;  1ZUU A;  2MK5 A;  4PFO A;  2F2V A;  4M77 D;  1U5S A;  2VC8 A;  5CQY A;  3MP1 A;  4M75 G;  3TQ7 P;  2JXB A;  2HNI A;  4FW1 A;  2KGT A;  2DA9 A;  1Y96 A;  3OYB A;  2BZY A;  3OQ5 A;  4B9X A;  3WXM B;  2F1L A;  5KCO A;  4HVW A;  1G3T A;  2KK4 A;  1YCY A;  4GLK A;  3HTR A;  2YRD A;  1IGU A;  4LDU A;  1WXB A;  2K3Y A;  1ABQ A;  3EG3 A;  2EYY A;  2EYX A;  3UPU A;  2E70 A;  4RKU E;  5GAN d;  2DRK A;  1XTD A;  2R5M A;  4FYY B;  1ZUY A;  1U8R A;  5GAO r;  3CCU Q;  1AZE A;  3RBB B;  3RKX A;  4E47 A;  1S72 A;  2HZY A;  3X24 B;  3BDL A;  4QW2 A;  1X75 C;  2DNU A;  2FRW A;  3CCJ A;  2RHU A;  3UWN A;  2E4H A;  4XTX A;  1VQ9 T;  2L3S A;  1W2B P;  1YWP A;  1XOV A;  4B9W A;  2VXF A;  5IHI A;  2BE7 D;  3PTA A;  2RQW A;  1VQ7 Q;  4FIB A;  2KBT A;  3OYN A;  4RUG A;  2YUP A;  2DIL A;  2LZ6 B;  1NPR A;  2EGA A;  1EIF A;  2KY9 A;  2JM9 A;  3CBM A;  1LOJ A;  2AHJ B;  3QXE B;  1NPP A;  3M58 A;  4A53 A;  4XTU A;  2L89 A;  3MP6 A;  2HKQ B;  3EHR A;  2DKG A;  4C0F A;  2M51 A;  3CCV Q;  1X27 A;  4IUR A;  2JM8 A;  2KI7 A;  5KCH A;  4NL3 A;  1YIJ Q;  1UHC A;  4DA4 A;  5I22 A;  1YNZ A;  4OMN A;  5HK0 A;  2EQU A;  1MV0 B;  1N9S A;  2ENM A;  4C92 C;  2JMA A;  1UB4 A;  2QI2 A;  5GMK i;  1G3Y A;  3LGL A;  3G7Z A;  2DMO A;  1FX7 A;  3I55 A;  1Q95 G;  4C5G A;  2EQK A;  4C8Q F;  1G8X A;  3CC4 T;  1WIE A;  4FL6 A;  2CT4 A;  5I2S A;  2AK5 A;  2RHI A;  4FYV B;  4BY6 C;  4J9H A;  4PLI A;  3V7C A;  3E2U A;  2MPX C;  4M77 G;  1X6B A;  1YWO A;  2EGC A;  5GMK l;  3VS1 A;  2QEX T;  2NLU A;  2NUT B;  2YRV A;  2E5Q A;  2KRO A;  2FPE A;  4JRI A;  5EG2 A;  1T0H A;  1KIK A;  2DYI A;  2YSQ A;  2V8I A;  5LJ5 j;  3GIB A;  2GF7 A;  4IUQ A;  2JW4 A;  3VS0 A;  2W0Z A;  2PUO B;  5LJ5 h;  1QVG A;  2LDM A;  1T0J A;  2V26 A;  1ZQ1 A;  1UGP B;  2CP3 A;  4OGC A;  3CCR A;  4J6W A;  3A8G B;  2DEQ A;  2KSS A;  2E64 A;  4ESR A;  4C92 B;  2RK1 A;  1RAF B;  1Q82 C;  1K1Z A;  4M77 E;  4TVR A;  1X6O A;  2ZZD A;  4UC4 A;  4ZGJ B;  2V1Q A;  3TSZ A;  3NTH A;  5FW9 A;  4OMO A;  1WFW A;  1N9R A;  4CC7 A;  1VQK Q;  1GFC A;  1Q86 C;  2BZX A;  2DTI A;  3VYH B;  1HD3 A;  2YUQ A;  3ZEH A;  1K4U S;  2X51 A;  3I5S A;  1EZZ B;  3EG9 B;  4FT2 A;  2K5L A;  1HSQ A;  1GL5 A;  4RG2 A;  1H92 A;  3OBW A;  1YJN Q;  3LW5 E;  1KC8 U;  1QMC A;  4IUT A;  3CCM Q;  1YI2 Q;  2HBP A;  1K8A U;  2KMT A;  1MUZ A;  2R58 A;  4J7F A;  3UA6 A;  1XQH A;  1NBE B;  1Q7Y C;  1TWB A;  2QAS A;  4OB0 B;  1SRM A;  1G3W A;  4QQ6 A;  1VQ5 T;  3EG2 A;  4KUI A;  4C8Q A;  4ELY C;  4C0D C;  2YT6 A;  5L8R E;  3S3M A;  1WXT A;  3CCS A;  3I9Q A;  4M7D E;  1UGS B;  2NUP B;  2H3E B;  4KGX B;  5IN1 A;  1LCK A;  3P8H A;  2YHT A;  1JBM A;  2MYS A;  2DL5 A;  3NPF A;  3CC2 A;  3G6E A;  1AEY A;  3CCQ A;  3QWY A;  1V76 A;  5A0L A;  4JLI A;  3JCM h;  2FHD A;  2K79 A;  4RTV A;  4BI8 B;  4HA8 A;  1M90 U;  4J6X A;  5FLX E;  3CCE Q;  1R77 A;  3HRT A;  2BIV A;  4CI0 C;  3R6O A;  1YJW A;  1VQ6 A;  3CPW P;  1RLQ C;  3MEV A;  1PD0 A;  3M0Q A;  3MEW A;  1TUD A;  1H64 1;  1PSE A;  1GBQ A;  2DXB A;  1C1A A;  4M78 D;  2A37 A;  3OYJ A;  4M7A B;  3CPW S;  3PVL A;  3CCL Q;  3OMC A;  1TSF A;  2L3P A;  1RAC B;  2CZ6 B;  2HL3 A;  1J3T A;  4LDV A;  1K9M C;  4HT9 A;  1X2K A;  2FG0 A;  3GF5 A;  1VQL T;  2J7I A;  5LJ5 f;  4P5N A;  4C92 F;  1VQM Q;  3CMA T;  1C6V X;  3JCM J;  2YLB A;  4BE0 A;  2CH4 W;  3CC7 Q;  5LL6 S;  2K3X A;  4Z89 A;  1TH7 A;  3E1S A;  2VVK A;  4OMM A;  3A5Z B;  1AWX A;  4XK8 E;  1T3L A;  3CPW A;  2KXD A;  2JZ2 A;  3U23 A;  1X69 A;  4MML A;  3ULR B;  2EQJ A;  3G71 A;  4O6J A;  4X1V A;  3V8K A;  4PJO C;  3CD6 Q;  2LX7 A;  1WLP B;  1G5V A;  3H0F A;  1ARK A;  2KXC A;  2CRE A;  4A4G A;  3VRY A;  3JB9 H;  3UT1 A;  1R0C B;  3UA7 A;  2M16 A;  1UEB A;  3OSV A;  1TG0 A;  2RJD A;  4M75 B;  2I2L A;  2EJG A;  2JNG A;  4RCC A;  3MP8 A;  1VQ4 A;  4EPC A;  9ATC B;  3H9N A;  4EIK A;  5GMK h;  4J9E A;  4GBQ A;  4PLL A;  3TVT A;  1Y7X A;  2L3Q A;  4AFQ C;  2P0K A;  2LTO A;  1BI3 A;  2NUT A;  3L42 A;  3CCU T;  5GAN 4;  1VQP Q;  1UE9 A;  3LWH A;  1SRL A;  2E5K A;  2PZ1 A;  3JB9 F;  2E6Z A;  2LNV A;  4L6V 5;  1JO8 A;  1NLO C;  1K8A R;  3MPU B;  1YHQ T;  4QVC A;  4J9C A;  3JCM f;  5GAM j;  3MEA A;  5KYN A;  1YIT Q;  1PKT A;  2EVR A;  1QVF P;  2JMC A;  4M78 G;  5GAN 2;  2RHZ A;  2LT1 A;  5GAM g;  4M7A F;  4LD6 A;  4PJL A;  3REB B;  1RAA B;  5IXF A;  3PIP A;  2AZS A;  4Z88 A;  4PJO B;  3FIF A;  4L59 A;  1QVF S;  4ZGE B;  3QWX X;  1ZSZ B;  1QQJ A;  1VYT A;  1SF9 A;  1UDL A;  2RQT A;  2K7A A;  4C92 A;  1FWZ A;  3JSC A;  1KG1 A;  1V1C A;  1YIJ T;  3JCM W;  1SHG A;  3LGF A;  2ZCF B;  2R5A A;  1M4Z A;  1K0S A;  1WGS A;  2LQ8 A;  4CC3 A;  1M90 R;  1KFZ A;  1WHL A;  1E6H A;  2AKK A;  1AHJ B;  4V2S A;  4A4H A;  3EG9 A;  4C8Q C;  1KQS S;  2CGH A;  2JT4 A;  4KH1 B;  5CO7 A;  4RTX A;  3WVE B;  1ZBX A;  3H8Z A;  2KR3 A;  4E7L A;  1HXD A;  1WQ7 A;  1D1B A;  5L23 A;  3CC4 A;  4FT4 A;  2FVU A;  3OYH A;  1ACM B;  3CCJ Q;  4LUD A;  2CDT A;  2H8H A;  5CAI A;  5GAN j;  5A0D A;  3QJY A;  3BE3 A;  4WCI A;  2DJQ A;  1FMV A;  4HT8 A;  4BDZ A;  3JCM Q;  2QEX A;  4F7U E;  1WQW A;  1AWO A;  2ESW A;  5GAN g;  2LRQ A;  2QGF B;  2YXY A;  3C95 A;  2E65 A;  1KQS A;  2NUP A;  5LJ3 d;  2C0T A;  5KH6 A;  3SWN B;  4M75 F;  2YLC A;  5FRO A;  1K73 C;  5KYU B;  2QQS A;  5IHK A;  2CYZ B;  3QO3 A;  4D8D A;  3URG A;  4MZP A;  4E2F B;  2DRM A;  3A8O B;  2XDP A;  3CQT A;  1OPL A;  4LXC A;  1RUW A;  3OSS C;  5FWC A;  3A8L B;  4N0A A;  2NUZ A;  1WJQ A;  3TEE A;  4RTY A;  2C06 A;  3I55 Q;  3HRU A;  3N5B B;  5CR2 A;  4M7A A;  2E41 A;  1W1F A;  1PWT A;  2HDA A;  2GNC A;  3RES A;  4LE9 A;  4OMP A;  2M9U A;  1PHT A;  2DL7 A;  1AT1 B;  1YFN A;  3CME Q;  1QVP A;  4PJO F;  3JCM P;  2CZ7 B;  2RH2 A;  3M53 A;  5J3B A;  3FC3 A;  1YJN T;  4BE2 A;  2CP7 A;  1UJY A;  2YDL A;  5FU7 C;  4JJD A;  3CCM T;  1B34 B;  1OV3 A;  2HSP A;  2JJ9 A;  4C5H A;  4JRP A;  1YI2 T;  3TSW A;  1RI0 A;  2DL8 A;  2DYB A;  5IT9 E;  2GFU A;  3JAM E;  3DLM A;  3JV3 A;  1AVZ C;  4AG1 C;  1CKB A;  1P92 A;  4KUL A;  4PL6 A;  4RTT A;  3OY9 A;  1MMG A;  1VQ5 A;  1X2Q A;  4J9G A;  1MMN A;  2JTE A;  3C0C A;  5J26 A;  2EYZ A;  4QVZ A;  4MDX A;  3QG1 A;  1WHH A;  4NOY A;  4M7D D;  2CP6 A;  2BTT A;  5D7U A;  2K5F A;  5D6X A;  2DL3 A;  2L5Q A;  2X3X D;  3H0I A;  3PFS A;  3LWI A;  2XIC A;  4GY5 A;  4K11 A;  4J7I A;  4M75 A;  2FL7 A;  1SHF A;  4XU1 A;  2CKK A;  2YRC A;  4OB2 B;  4JZ3 A;  4L5G A;  3QZ5 B;  2KT8 A;  3MCA B;  4QT7 A;  2QAZ A;  2P0Q A;  2GTJ A;  1RAE B;  1VQO Q;  4EMH A;  1KQ2 A;  4PJN A;  2DEU A;  2ZPB B;  4J9D A;  4O5V A;  1OU8 A;  2KYB A;  4WF2 A;  3WVD B;  3DKM A;  3CCL T;  3PE0 A;  1HK9 A;  5D6W A;  3EFO B;  2L3R A;  5FU7 B;  5HCK A;  1C0M A;  4Z8A A;  3L2Q A;  3SFM A;  5D6Y A;  3OYF A;  1UTI A;  3ZBD A;  2HAX A;  2E6N A;  1VQL A;  4E7Z A;  1BU1 A;  1OPK A;  2QTV A;  2KYM A;  3NTI A;  3CMA A;  3CCS Q;  3CC7 T;  4A63 B;  1QVG P;  1GCQ C;  4JZ4 A;  1YJ9 Q;  2L8D A;  4LD9 K;  2EWN A;  3REA B;  3P8B B;  1JRI A;  4PJO A;  5CKE A;  1PKS A;  2KE9 A;  1BK2 A;  2VXE A;  1QVG S;  1ZSZ A;  2FO0 A;  4LDY A;  5IH2 A;  2D6F A;  3MO8 A;  3CC2 Q;  1BB9 A;  2K6D A;  3G6E Q;  3G4S T;  3CCQ Q;  3I56 Q;  4RTZ A;  2F2W A;  4N4G A;  4F14 A;  1M8V A;  3CD6 T;  2RB6 A;  2EIF A;  4JJN K;  2J6K A;  2K9G A;  3LH5 A;  4N4I A;  1Q86 R;  3M4Y A;  1ZHI A;  3NTK A;  1YJW Q;  5GAN 8;  1Q81 U;  3SHW A;  1RAI B;  1VIF A;  3JRZ A;  1QCN A;  3HP9 A;  3PMI A;  2LQN A;  3V7S A;  2K5I A;  2M1H A;  2GCX A;  3BW1 A;  2QA4 Q;  3PT9 A;  3NFC A;  1NJI C;  2VV5 A;  3HFO A;  4RTU A;  1KD1 C;  3EGD B;  2DJZ A;  3INZ A;  1MMA A;  4IUV A;  1TUC A;  2V8J A;  1QWF A;  4M7D G;  2O2O A;  2CSQ A;  1Z9Q A;  2M0Y A;  1VQP T;  1PRM C;  1UJ0 A;  1MGQ A;  5KYW B;  3VUB A;  1ZSG A;  1M8M A;  3QZ9 B;  3SEM A;  3SWN A;  3FLG A;  3CPF A;  2D9T A;  4N0A C;  4FSX A;  2LC4 A;  1YHQ A;  4FSS A;  3JCM c;  4DBF A;  3GBQ A;  3VS3 A;  5KYU A;  4M7A C;  1WHJ A;  1YIT T;  2PUK B;  3CBO A;  2OTJ Q;  2LP5 A;  1H8K A;  1D0Y A;  2KEA A;  3A98 A;  1KHI A;  3C94 A;  2QQA A;  3L2W A;  1TXQ A;  2X4X A;  3JB9 J;  4AT1 B;  3HPW A;  3E9F A;  4M78 B;  1A0N B;  4F04 B;  1I0C A;  3OYA A;  3GNF B;  2DAQ A;  2LNH B;  4HCK A;  2X4Y A;  4J9I A;  1TU0 B;  1NG2 A;  4E7K A;  1NYF A;  4RCB A;  5A2Q E;  2O4X B;  2E3I A;  1DJ7 B;  3FRN A;  4PNO A;  2LCS A;  1VQ4 Q;  2RI5 A;  4XU0 A;  4ATO A;  4XAX B;  1GBR A;  2LMJ A;  5CK9 A;  3AHU A;  3JB9 I;  2JN0 A;  1TTH B;  2IPO B;  5GAN 7;  1K9M R;  2J05 A;  1N5Z A;  2QGG A;  2F5T X;  4C8Q E;  4N4H A;  3AT1 B;  2ROT A;  5GAO m;  3OYD A;  2DF6 A;  5KE2 A;  1B34 A;  1EFN A;  1UFF A;  4C92 D;  2QXF A;  2FYK A;  1OOT A;  1N8R U;  2CP5 A;  2DIG A;  4EMK B;  3OYI A;  2KVQ G;  2DD4 A;  2DTH A;  4FCY A;  1D09 B;  4OGE A;  2EGE A;  2H3J A;  4MMK A;  1XJW B;  2DET A;  3LYI A;  2WAC A;  5LJ5 d;  3CBP A;  3FJP A;  5EC7 A;  4RG8 A;  4M75 C;  2P84 A;  1NE8 A;  1U1T A;  1M2O A;  4ZGD B;  1R0B G;  3PNW C;  2XI9 A;  1WDX A;  2RK2 A;  2VB6 A;  2JS0 A;  2L2P A;  4CRI A;  3VV0 A;  3P8D A;  4OP0 A;  3GLX A;  1QP3 A;  5LJ3 e;  5GMK e;  4FU6 A;  2AT1 B;  1X01 A;  1KK7 A;  2IG0 A;  1VUB A;  2XDD A;  4FYW B;  2OX7 A;  2E12 A;  2RQV A;  1M27 C;  2EBP A;  3O5Z A;  3H41 A;  4II1 A;  4X9D A;  4F17 A;  4RMO A;  3LH0 A;  4E7S A;  2X35 A;  5GAN 3;  2JOY A;  1PD1 A;  2ZPH B;  2OTL Q;  4KH0 B;  2ED0 A;  4HKE A;  2HKN A;  1RAG B;  1Q81 R;  1AZG B;  2AIR B;  1NM7 A;  2D1X A;  4OML A;  2V8K A;  4AFU C;  2WSE E;  4HXJ A;  1B7T A;  3CC4 Q;  3V8J A;  3EFO A;  4HCZ A;  4IIM A;  2PVG B;  2RJE A;  2J6O A;  3HHT B;  2HEQ A;  1ZSZ C;  2CP0 A;  3CME T;  4HCB A;  2KRM A;  3VS5 A;  1WJR A;  3L2R A;  2LT4 A;  1D3B B;  4M78 F;  4KGZ B;  1VQ8 Q;  2QEX Q;  6AT1 B;  4RTW A;  3ER0 A;  4FW2 A;  1O75 A;  4AFZ C;  2G3R A;  2EYW A;  2WSF E;  1YI2 A;  1AD5 A;  1BI0 A;  1QCF A;  4HVV A;  5DLO A;  1FYN A;  1I8F A;  4DBH A;  2CUD A;  1IXD A;  4ELZ C;  2O88 A;  3VYG A;  2JVV A;  1BCO A;  3JCM d;  3O8V A;  2Y4Y A;  3JCM X;  2HQH A;  5LJ3 j;  3UAT A;  5DLQ E;  1FMW A;  1QW1 A;  2CZ0 B;  2DD5 A;  2RF0 A;  5HKC A;  4XU2 A;  4C92 G;  2OAW A;  5FRN A;  5LJ3 g;  3M59 A;  4XTV A;  2X9H A;  4VUB A;  1VQ9 A;  2EYQ A;  3QDR B;  4MZM A;  2EQI A;  4M77 C;  1VQ7 T;  1NLP C;  1JJ2 S;  5DY9 A;  2BUD A;  3SWN C;  1VQN Q;  2M0O A;  1VYV A;  1X6G A;  3OS1 A;  5GAM h;  3I35 A;  3VUZ A;  4ZTJ A;  1HJD A;  5CKD A;  2CT3 A;  4F7U G;  1IB8 A;  4JJB A;  2EJ9 A;  3EGD A;  5CQX A;  4X34 A;  1WHM A;  3E9G A;  2X4W A;  1VQO T;  2A28 A;  2DE0 X;  2D8J A;  1YN8 A;  2HQX A;  3CEY A;  1SSH A;  3CCV T;  1G83 A;  1M1K C;  4NS5 A;  3CCL A;  4PJM A;  5KYW A;  1KQS P;  3SB2 A;  1V29 B;  2RO0 A;  3PVQ A;  1GCQ A;  1RLP C;  1N8R R;  1JJ2 A;  3VRZ A;  2COZ A;  3OYY A;  2K2V A;  3LLR A;  2QQB A;  1O9S A;  1BKB A;  4C92 E;  3VS4 A;  1K73 R;  3M0P A;  2OJ2 A;  8AT1 B;  1M2V B;  3DB4 A;  3RMQ A;  4DOW A;  1KC8 C;  1YJ9 T;  1ZA2 B;  1S72 Q;  4DQ2 A;  3V8L A;  2DTO A;  4MZT A;  1PM3 A;  5GJV B;  3A8H B;  4OB3 B;  4M78 A;  4PK4 A;  3CC2 T;  3G6E T;  1G2B A;  3CCQ T;  1AOJ A;  2EKO A;  3PGG A;  1NZ9 A;  2P0P A;  3G4S A;  3I56 T;  2EPD A;  1WYX A;  3GOX A;  5KYY B;  5GAN h;  4M77 B;  2O4X A;  2QQ9 A;  4JUV A;  2GTO A;  2XKO C;  1NJI U;  3OYK A;  3MKD A;  1M9S A;  1KD1 U;  3L2V A;  4WTO B;  3J81 E;  3S6W A;  5J39 A;  1Q82 U;  2QDL A;  4PJO D;  4QQD A;  2CH4 A;  3EG0 A;  1Y07 A;  3M54 A;  3CXC P;  4PFZ A;  1JB0 E;  4QKU A;  2QA4 T;  4KUD K;  3OS0 A;  1IHV A;  4EMK A;  1Q86 U;  1M90 C;  1N27 A;  1PSF A;  1FMK A;  3EGX B;  3CXC S;  1VQL Q;  3EHQ A;  3SDZ A;  4XTZ A;  3V7R A;  3TU4 K;  1BIB A;  4DEX A;  2RN8 A;  1VQP A;  4F16 A;  1PNJ A;  3EFS A;  3TCJ A;  3KXT A;  3CMA Q;  1QKX A;  4IIO A;  2XHC A;  4M7D B;  1VQK T;  1F1B B;  2KAF A;  3VS2 A;  1H3H A;  3OMG A;  1SKU B;  4JRK A;  3M0S A;  1PRL C;  1Q7Y U;  2HMA A;  3VKI A;  4A4K A;  4JDS A;  2XK0 A;  3Q1J A;  4E7J A;  2F5K A;  2OTJ T;  3BFM A;  3M0T A;  1YIT A;  4M7A E;  2GQI A;  1MV3 A;  5GAM f;  3CXC A;  1K9A A;  5GJW B;  5IHN A;  4DOV A;  1WJS A;  4LDX A;  2LJ1 A;  1IGQ A;  1ZUK A;  4Y28 E;  2ZAE A;  5GAO n;  5CKH A;  3NHN A;  2XG8 D;  3JCM b;  2RHX A;  2B86 A;  1LJO A;  5CKB A;  1ZBJ A;  2CS7 A;  2KNB B;  1ABO A;  3MHX A;  5FU6 B;  4ANJ A;  2DPP B;  4D8K A;  2VGM A;  3MJX A;  2LCL A;  1VQ4 T;  5AYF A;  2DBM A;  2C0I A;  2FZK B;  2K57 A;  2RJC A;  2DIQ A;  3CCR Q;  1JXM A;  5HY6 A;  1D3B A;  2I0N A;  2XID A;  7AT1 B;  3ZL7 C;  1D1C A;  1MHN A;  3ME9 A;  1U3O A;  4C8Q D;  4M77 F;  1M1G A;  1B07 A;  4XQ3 A;  2E3H A;  2MCN A;  4IKF A;  3CCE T;  5IAY A;  1OZ2 A;  1K9M U;  4ZN3 A;  1YHQ Q;  2B8A A;  2C0O A;  5GAN f;  1I5L A;  1X43 A;  4JS4 A;  3A1P A;  3MET A;  3RKY A;  1Y71 A;  4OVA A;  4PJO G;  4M75 E;  2IVW A;  4D6W A;  3OYG A;  3OA6 A;  3J7A F;  5GAN 5;  1W2B S;  5LJ5 e;  4HVU A;  1UGV A;  3EGU A;  4JJC A;  4JS5 A;  1YBY A;  2NYS A;  2DXC A;  4R55 A;  3QPH A;  4GLM A;  2CSI A;  2E10 A;  2SEM A;  1KSW A;  4ORZ A;  2XMF A;  5GAN 6;  3QHS A;  3PMT A;  1VQM T;  3FJ5 A;  2FZC B;  4XTW A;  4XTY A;  1IZ6 A;  4PFP A;  2ATC B;  1OUL A;  2F69 A;  5C6S A;  2EAY A;  5KYX B;  4M7D F;  2FEI A;  1WHG A;  1Y0M A;  4JPB W;  3R6N A;  1NJI R;  2FPD A;  5HK3 A;  2FRY A;  4JRQ A;  2OTL T;  1KD1 R;  1NYG A;  3M57 A;  1W2B A;  1AWW A;  1OX9 A;  1PG5 B;  3RKW A;  2BE9 B;  4E7H A;  3FB9 A;  1Q82 R;  2OI3 A;  2DX1 A;  3QII A;  2RQR A;  1TOV A;  1M3A A;  1WI7 A;  3L2U A;  2LJ0 A;  2K4Y A;  4IUP A;  4A54 A;  3HL8 A;  5M9O A;  1TUG B;  2DVJ A;  2RJF A;  2O9S A;  1ZA1 B;  1W6X A;  4PJO E;  4M78 C;  2COY A;  3S3O A;  5A0G A;  3CME A;  3QYG B;  4EMG A;  1ZLM A;  4CC2 A;  1VQ6 Q;  1OZ3 A;  2GFA A;  1WNL A;  2DL4 A;  1VQ8 T;  4R0K A;  5CIU A;  1H3Z A;  2R57 A;  1M2V A;  4DBQ A;  3FEO A;  1JQQ A;  2HQE A;  1GCP A;  2MIO A;  1WZO A;  3M4G A;  1WX6 A;  1AWJ A;  2BZ8 A;  2DO3 A;  2RI2 A;  4ZNX A;  1VIE A;  3EAE A;  2DZC A;  4YTL A;  1GFD A;  5DM7 R;  1UUE A;  1Q7Y R;  1HYO A;  2HSE B;  5KYY A;  5AT1 B;  5LJ5 g;  2PVO B;  3M0U A;  1D0X A;  1OI1 A;  2MI6 A;  3CCU A;  4EMK C;  4M77 A;  1QWE A;  3ASK A;  3JCM e;  1LPL A;  2D8H A;  2RM4 A;  3X25 B;  4C8Q G;  5GAO q;  1Z9Z A;  2HCK A;  2DER A;  3SD4 A;  1BYM A;  2O9V A;  4KT0 E;  2O31 A;  5CVI A;  2VWF A;  3A8M B;  1VQ7 A;  1MND A;  5CKF A;  1M1K U;  3X26 B;  1LVK A;  3QBY A;  1VQN T;  2FPF A;  3OYL A;  4J8O A;  3QJ6 A;  1RAH B;  2D0Q B;  2K3B A;  3G71 Q;  4BE1 A;  2DVE A;  1SG5 A;  4C5E A;  5FRM A;  1TS9 A;  3HSB A;  1QLY A;  2A0F B;  2PNI A;  3EGX A;  4FM4 B;  4BY6 B;  2J6F A;  2MWP A;  4BI4 A;  4X9C A;  1D1A A;  1VQO A;  2GQV A;  4J9F A;  4C5I A;  4LNP A;  3CCV A;  4F7U B; 
#chains in the Genus database with same CATH homology
 1FYN A;  1YP5 A;  2CUD A;  2M51 A;  2O88 A;  2P4R A;  1UHF A;  1X27 A;  2JM8 A;  1UHC A;  5IHK A;  5I22 A;  1YNZ A;  4OMN A;  2MOX A;  4D8D A;  2AKL A;  2EKH A;  1MV0 B;  2DRM A;  3CQT A;  3UAT A;  2ENM A;  2JMA A;  1OPL A;  2RF0 A;  1CKA A;  1RUW A;  2CUB A;  5FWC A;  1M3C A;  2OAW A;  2DMO A;  2A08 A;  2K2M A;  1KJW A;  2NUZ A;  1BBZ A;  1Y57 A;  4RTY A;  1WIE A;  2CT4 A;  2EQI A;  2AK5 A;  1NLP C;  4J9H A;  1W1F A;  2KT1 A;  1PWT A;  2HDA A;  2GNC A;  4LE9 A;  1UG1 A;  1X6B A;  4OMP A;  4AG2 C;  1RI9 A;  1YWO A;  2EGC A;  1PHT A;  2DL7 A;  1VYV A;  3VS1 A;  1X6G A;  3I35 A;  1HJD A;  2CT3 A;  4JJB A;  2DM1 A;  2YUN A;  3VS7 A;  2KRO A;  2FPE A;  1UJY A;  1M3B A;  1UEC A;  2YDL A;  2YUO A;  4JJD A;  2A28 A;  1T0H A;  2HSP A;  1OV3 A;  2DE0 X;  2GGR A;  2D8J A;  1YN8 A;  3TSW A;  1W70 A;  1KIK A;  1SSH A;  2DL8 A;  2YSQ A;  1GRI A;  1G83 A;  2DYB A;  5I11 A;  3JV3 A;  1AVZ C;  4AG1 C;  1I1J A;  1CKB A;  2JW4 A;  3PVQ A;  3VS0 A;  1GCQ A;  1RLP C;  3I5R A;  2W0Z A;  4RTT A;  4KRT A;  3VRZ A;  1B3Q A;  3THK A;  1X2Q A;  3NGP A;  4J9G A;  1T0J A;  4M4Z A;  1IO6 A;  2JTE A;  3VS4 A;  3C0C A;  1S1N A;  3M0P A;  2OJ2 A;  2EYZ A;  4J9B A;  1WXU A;  4AFS C;  1NEG A;  4E6R A;  4ESR A;  3M0R A;  1K1Z A;  5GJV B;  2BTT A;  2HBW A;  2DL3 A;  2X3X D;  3H0I A;  2V1Q A;  3TSZ A;  1JEG A;  1G2B A;  1AOJ A;  5FW9 A;  4OMO A;  1VA7 A;  1WFW A;  4Y92 A;  4CC7 A;  4K11 A;  2EPD A;  1WYX A;  1GFC A;  2BZX A;  1SHF A;  1HD3 A;  2YUQ A;  1K4U S;  3I5S A;  4JZ3 A;  2D0N A;  2GTO A;  2KRS A;  1OEB A;  1HSQ A;  2KT8 A;  1GL5 A;  4QT7 A;  1H92 A;  1U06 A;  2GTJ A;  1K0X A;  3EG1 A;  4J9D A;  2KYB A;  2QDL A;  3RNJ A;  2CH4 A;  3PE0 A;  3EG0 A;  1MUZ A;  2X3W D;  4CC4 B;  2JS2 A;  3UA6 A;  3UF4 A;  5HCK A;  1SRM A;  4Z8A A;  2EW3 A;  3EG2 A;  1UTI A;  3KFV A;  1M30 A;  2YT6 A;  2L0A A;  1FMK A;  3NMZ C;  1WXT A;  1BU1 A;  1OPK A;  3I9Q A;  3H0H A;  1CSK A;  2KYM A;  4LN2 A;  3EHQ A;  1LCK A;  4A63 B;  1GCQ C;  1NEB A;  4JZ4 A;  4DEX A;  2RN8 A;  3REA B;  1PNJ A;  4F16 A;  1E7O A;  2DL5 A;  3NPF A;  1QKX A;  1AEY A;  4IIO A;  1PKS A;  3QWY A;  2RNA A;  2KE9 A;  1SPK A;  1YCS B;  1BK2 A;  1E6G A;  2FO0 A;  3VS2 A;  5IH2 A;  1H3H A;  3M0S A;  1BB9 A;  1PRL C;  2K6D A;  2VKN A;  2K79 A;  4RTV A;  3VS6 A;  4DEY A;  4RTZ A;  2F2W A;  1JXO A;  5FWB A;  4F14 A;  2RPN A;  3M0T A;  2GBQ A;  2GQI A;  1MV3 A;  2F2X A;  1K9A A;  2J6K A;  2K9G A;  3LH5 A;  1RLQ C;  5GJW B;  5IHN A;  3M0Q A;  2LJ1 A;  1ZUK A;  1TUD A;  1GBQ A;  3NHN A;  2A37 A;  3SHW A;  2B86 A;  3PVL A;  1ZBJ A;  2LQW A;  2L3P A;  2KNB B;  1ABO A;  2LQN A;  2A36 A;  1ZX6 A;  4D8K A;  1J3T A;  1X2K A;  1I07 A;  2FG0 A;  2J7I A;  2DBM A;  2C0I A;  4RTU A;  1TUC A;  1SEM A;  1QWF A;  2O2O A;  2G6F X;  2ECZ A;  2CSQ A;  2KRN A;  2ROL A;  2CH4 W;  1JXM A;  2DBK A;  2I0N A;  1Z9Q A;  2M0Y A;  4Z89 A;  1PRM C;  3ZL7 C;  1UJ0 A;  2VVK A;  4OMM A;  2RMO A;  1AWX A;  2RQU A;  1ZSG A;  1M8M A;  3SEM A;  2LJ3 A;  1JU5 C;  1T3L A;  1U3O A;  2KXD A;  1B07 A;  2MCN A;  2IIM A;  4FSS A;  3U23 A;  1X69 A;  2J06 A;  3GBQ A;  3ULR B;  3VS3 A;  2C0O A;  4X1V A;  2LP5 A;  1WA7 A;  1X43 A;  1H8K A;  2AZV A;  2LX7 A;  1WLP B;  2KEA A;  3A98 A;  3H0F A;  5IXB A;  1ARK A;  2KXC A;  2CRE A;  2V1R A;  2ABL A;  4HVU A;  3VRY A;  1UGV A;  3EGU A;  4JJC A;  3UA7 A;  1A0N B;  1I0C A;  2LNH B;  1TG0 A;  4GLM A;  4HCK A;  1VYU A;  2CSI A;  2SEM A;  4J9I A;  5ECA A;  1KSW A;  4ORZ A;  1NG2 A;  2XMF A;  1NYF A;  1K76 A;  2DLP A;  3FJ5 A;  2LCS A;  4EIK A;  4J9E A;  4GBQ A;  3TVT A;  1GBR A;  2LMJ A;  2L3Q A;  4LUE A;  4AFQ C;  2W10 A;  2J05 A;  1N5Z A;  2SRC A;  1QKW A;  1T3S A;  2FEI A;  1Y0M A;  4JPB W;  4OMQ A;  3R6N A;  2ROT A;  2FPD A;  2FRY A;  1NYG A;  1UE9 A;  3IQL A;  2PTK A;  2DF6 A;  2ED1 A;  1SRL A;  2E5K A;  2PZ1 A;  1AWW A;  1EFN A;  1UFF A;  2NWM A;  1OOT A;  1JO8 A;  1NLO C;  2OI3 A;  2DX1 A;  2RQR A;  1M3A A;  1WI7 A;  2LJ0 A;  4J9C A;  2EGE A;  2DVJ A;  2O9S A;  1W6X A;  1ZUU A;  1PKT A;  2EVR A;  2JMC A;  5EC7 A;  1ZLM A;  2F2V A;  4CC2 A;  1U5S A;  2DL4 A;  4R0K A;  3REB B;  5IXF A;  2AZS A;  1WDX A;  4Z88 A;  2JS0 A;  2JXB A;  2L2P A;  2KGT A;  2DA9 A;  1JQQ A;  3QWX X;  1GCP A;  1VYT A;  2BZY A;  2MIO A;  1UDL A;  1WX6 A;  2RQT A;  2K7A A;  1AWJ A;  4HVW A;  2BZ8 A;  1V1C A;  4ZNX A;  1GFD A;  1SHG A;  1UUE A;  1K0S A;  2RQV A;  1M27 C;  2EBP A;  1WXB A;  1ABQ A;  3O5Z A;  3EG3 A;  3H41 A;  4CC3 A;  2EYY A;  1KFZ A;  2EYX A;  3M0U A;  4F17 A;  1E6H A;  2AKK A;  2DRK A;  1QWE A;  1ZUY A;  2JT4 A;  1AZE A;  3RBB B;  2D8H A;  4RTX A;  1Z9Z A;  2HCK A;  2KR3 A;  2ED0 A;  5L23 A;  2O9V A;  2DNU A;  2FRW A;  1AZG B;  2O31 A;  1NM7 A;  2D1X A;  4OML A;  4AFU C;  2VWF A;  4HXJ A;  2L3S A;  1YWP A;  4LUD A;  2CDT A;  1XOV A;  2H8H A;  4IIM A;  5IHI A;  4WCI A;  2FPF A;  2J6O A;  2RQW A;  2DJQ A;  2K3B A;  2HEQ A;  2KBT A;  4RUG A;  2YUP A;  2DIL A;  2KRM A;  2LZ6 B;  3VS5 A;  1AWO A;  2EGA A;  2ESW A;  1QLY A;  2PNI A;  2JM9 A;  2J6F A;  4RTW A;  2C0T A;  4AFZ C;  2EYW A;  4J9F A;  1AD5 A;  3EHR A;  4LNP A;  1QCF A;  4HVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...