2L3RA

Nmr structure of uhrf1 tandem tudor domains in a complex with histone h3 peptide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
161
structure length
161
Chain Sequence
GMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/gene regulation
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Recognition of Multivalent Histone States Associated with Heterochromatin by UHRF1 Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 161
sequence length 161
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12148 TTD Tandem tudor domain within UHRF1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2l3rA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2l3rA01
1M1KU 2QA4A 1VQNT 3CCLA 2XK0A 4BE0A 3CCJA 3L2UA 2RO0A 5KH6A 5D6YA 3BDLA 1S72T 3MP1A 3QBYA 4ZTFA 4FL6A 4A4GA 1X6OA 3CCRA 1SSFA 2OTJT 1VQ8A 4Z02A 3MEAA 2RHZA 4CRIA 4A4EA 1IZ6A 3I56A 1YJWA 4BE1A 3UWNA 3G6EA 1KQSS 4QQGA 1N8RC 3FDRA 1MHNA 4B9XA 3L2RA 2E5QA 1YJ9T 3OYMA 3G71T 2R58A 2EQMA 3P8BB 1VQNA 5C0MA 2XHCA 1K73C 4N4HA 4RG2A 4B9WA 4IUQA 1OYXA 1H3ZA 3MO8A 3CCMT 3OYYA 1VQPT 1VQOT 3H8ZA 4FU6A 3PIOA 3CMET 1YJNA 4Q5WA 4TVRA 1Q7YU 1QVFS 3M9QA 3ZEHA 3FEOA 3P8HA 2VYTA 3G71A 1WJSA 5LL6S 1YHQT 2BKDN 2EQJA 2RI3A 3OYHA 1VQMT 2F5KA 1KC8C 2JUFA 5IN1A 1M1GA 3CCQA 4E7KA 3PMTA 3DB3A 1M90U 2E6NA 2MI6A 2D9TA 5KCOA 1VQPA 3CCVT 1VQOA 1VQ9A 5FRNA 3S6WA 5FLXE 4X34A 3I55A 3J80E 1QVGS 4E7IA 3NTIA 2HQXA 1KD1C 3OYLA 2O4XA 2E6ZA 1K9MC 1Q86C 4LD6A 4E7JA 1G5VA 2BIVA 2RJDA 3KUFA 1VQKT 1JJ2A 1YHQA 3CC2T 3DLMA 5D6WA 3CCLT 1NPRA 1VQMA 3S3MA 2LQ8A 4OVAA 2GFUA 3G4SA 3OYKA 2LDMA 3OYEA 3CEYA 2P0KA 3CD6A 2JTFA 3CCVA 1XNIA 2CKKA 2X4XA 3MP6A 5KCHA 5IAYA 4A4HA 3L2QA 1YJWT 2WACA 2LCCA 3G6ET 3O8VA 1N8RU 3CC7T 3CC2A 3CC4T 3OYBA 1K73U 2L3RA 5HY6A 1W2BA 4ZTJA 1WJRA 2R57A 3CXCA 4E7HA 3E9FA 1YJNT 3E9GA 3META 2KVQG 4QQDA 4PLLA 3MEVA 3OYFA 1WJQA 3CC7A 3OYJA 4YTLA 3OYGA 2EIFA 2O4XB 2QEXT 4PL6A 3CC4A 1OZ3A 1Q81C 1KHCA 3OA6A 1KC8U 4NS5A 3CCQT 1YBYA 3OYCA 2LRQA 2EFIA 2RHXA 2M1HA 3OQ5A 2MWPA 1VQ9T 3OW2A 3MEUA 3I55T 4C5IA 5J3BA 2M0OA 2YRVA 1KD1U 1NZ9A 4A4FA 5DLQE 3FC3A 1NJIC 3OS2A 1K9MU 1Q86U 2DAQA 4PLIA 4UC4A 3CMAA 5KE3A 3PFSA 4BE2A 2NLUA 2QEXA 3CCUA 1YIJT 1K8AC 4L59A 3LYIA 1KQSA 2XDPA 2JNGA 3P8DA 1KHIA 1RI0A 3LH0A 4IUVA 2RHYA 1VQ7T 2X4YA 3OS1A 3G4ST 3QKJA 2DIGA 3EAEA 2DIQA 4N4IA 3CD6T 2IG0A 3CCST 2X35A 2RI5A 4E7LA 2QQRA 3SD4A 3MP8A 2X4WA 4C5GA 5FRMA 3CCEA 3ER0A 3LGFA 5KE2A 1YIJA 5DM7R 1YI2A 4GY5A 1VQ7A 2PQWA 3C4SA 2RHIA 3S3OA 3CPWA 3CCSA 5J39A 1RL2A 3OMGA 2LTOA 2RI2A 2RJEA 1Q81U 1WGSA 3L2WA 2RJCA 1VQ6T 4IUPA 3GOXA 3OYNA 3L42A 3CPFA 2JOYA 4IKFA 2GF7A 2M16A 4BDYA 4ZN1A 1VQ4A 2G3RA 4IUUA 2EKOA 4IURA 3OYDA 1NJIU 3JAME 5A2QE 3CMAT 3J7AF 2E70A 3LGLA 3CCUT 2FHDA 1K8AU 3OW2S 1VQ5T 4II1A 2OTLA 3DB4A 1VQ6A 2L89A 3PNWC 3NTKA 2LCLA 3KBGA 1Q82C 2LVMA 2JVVA 1OI1A 3PMIA 4N4GA 1M1KC 3OMCA 3HKSA 3ME9A 1BKBA 3OY9A 2MWOA 3OB9A 3CCET 2K3XA 3PIPA 2K3YA 5C6SA 1S72A 1VQ5A 2RHUA 2OTJA 1YI2T 4C5EA 2DO3A 2EQUA 4BDZA 2R5AA 5D6XA 1NPPA 3LX7A 2KDSA 4HCZA 1JJ2S 2JZ2A 5M9OA 4QW2A 1YJ9A 2GFAA 2QQSA 2L8DA 3S3NA 3NTHA 1N27A 4ZN3A 3TREA 4QVZA 1OZ2A 1QVFA 3J81E 1YITT 3CPWS 3CCMA 3OS0A 4BD3A 3H6ZA 3DLLA 3CMEA 1VQLT 2EQKA 5IT9E 3LLRA 1Q7YC 5CIUA 5J26A 1VQ4T 3UT1A 3L2VA 3ASKA 2QA4T 1XTDA 1W2BS 1QVGA 3FLGA 3CCJT 3QJ6A 3CXCS 4EDUA 1YITA 1M90C 3QIIA 4QQ6A 5FROA 3Q1JA 4C5HA 2OTLT 1EIFA 3CCRT 1VQ8T 3OYAA 3MEWA 4IUTA 2BUDA 1VQLA 3A5ZB 3F70A 3I56T 2B8AA 3OYIA 4BACA 1UEBA 1Q82U 2RJFA 2HQEA 2R5MA 1VQKA
chains in the Genus database with same CATH superfamily
5EG2A 2PVGB 2DA9A 4WF2A 2XK0A 2FZKB 3FIFA 3UA6A 3L2UA 2HAXA 1AWOA 2J6FA 4LDVA 5KH6A 1QP3A 5D6YA 3BDLA 4C8QC 2HMAA 1A0NB 1W1FA 4LUEA 4JRIA 4A4EA 1IZ6A 1YJWA 4Y28E 1NLPC 4F04B 1D0ZA 4LXCA 1ZBJA 1X01A 1B7TA 2KXDA 4DA4A 3CC7Q 1ZA1B 5FU6B 1X2KA 4EIKA 3VU3C 1NJIR 3P8BB 4J83A 2XHCA 2HBWA 2JS2A 4N4HA 1BK2A 4IUQA 4JJBA 1KQ1A 1X27A 3CCMT 1Y96A 2F69A 1QLYA 1ABOA 1VQOT 2KT1A 4J9FA 2GQVA 4D8DA 3QPHA 1OOTA 1YJNA 1ZHIA 4OGCA 4C92B 3I9QA 1TH7A 5GAOp 3ZEHA 4OF1A 3QO3A 1AOJA 4BY6B 3E2UA 1WJSA 1VQ5Q 3VV0A 2O9VA 3MJXA 3EGXB 2F5KA 4M7DD 4J9GA 2YUNA 4XU2A 2VWFA 2HL5C 2VXEA 2E6NA 3WVDB 1XQHA 4HT8A 4L6V5 2FYKA 5KCOA 5CKBA 4PNOA 5IHKA 1X6BA 3S6WA 1SSHA 3UATA 3J80E 2FO0A 3I55A 3NTIA 2HQXA 3VRZA 2JM8A 1K9MC 2CSIA 2DZCA 4E47A 2BIVA 3QJYA 4RKUE 5CKDA 2GGRA 3M58A 8ATCB 2X9HA 3VS7A 5GAN2 3VKIA 5LJ3f 3WVEB 4ELYC 2SRCA 2EYXA 2XMFA 1JBMA 4KRTA 1VYVA 2LQ8A 1SRMA 4M7DG 2NUPA 2QDYB 4Y92A 2B86A 1PD1A 5KYUB 1SHFA 3OYEA 3CD6A 5CQYA 3OBYA 2CKKA 2X4XA 5LJ5j 5KCHA 5CKHA 4A4HA 4EMKC 2EGAA 3L2QA 2CUBA 2L3PA 2RB6A 2QGGA 1TTHB 5LJ3h 2KR3A 4OMLA 4JRQA 2ED1A 3M57A 3CC2A 4MZPA 4IIMA 3M59A 4JUVA 1RI9A 4OMNA 4RUGA 1M3CA 2KYMA 4LN2A 5HY6A 1Q81R 2LQKA 3G1JA 2EGEA 3RBBB 5CO7A 4C8QA 1VQ4Q 1TUGB 4C92D 3HRTA 3EHRA 4J6XA 1Y07A 2LNVA 3META 2EYQA 1AEYA 3SB2A 5GANe 3MEVA 3OYFA 1BI2A 1FMVA 5CKEA 3CC7A 3OYGA 3PTAA 4LD9K 2PVOB 2ECZA 2O4XB 4PL6A 3CCRQ 4FSSA 4DOWA 4M7AE 2DLPA 3ZFJA 1RAEB 2CDTA 1PNJA 4BI4A 3I56Q 3OYCA 3LWHA 2CZ6B 4OMPA 3JCMc 2YXYA 1EZZB 4C92G 4KUIA 4O5VA 3VRYA 4C5IA 3OS2A 1NG2A 1K9MU 5GJWB 1AT1B 2ROTA 1ZLMA 5KE3A 1E7OA 3RNJA 5LJ5f 2QEXA 1KQSA 2XDPA 1MNEA 3HL8A 1RI0A 3LH0A 1BIBA 3TVTA 1G83A 3FJPA 1QQJA 5GAOq 1YJ9Q 2IG0A 3BW1A 2RI5A 4FIBA 2XICA 3SD4A 3M0UA 5GAOn 2P4RA 2COYA 4C5GA 5FRMA 4FYWB 2WSEE 4M77F 4F7UE 3OSVA 5DM7R 2ED0A 2PUKB 2DETA 3CMEQ 5D7UA 1B07A 4GY5A 3R6NA 2YLCA 3D7SB 5FU6C 3EG0A 3C4SA 2CT3A 1ZSZC 6AT1B 1M30A 4M4ZA 4EMKA 3THKA 1VQMQ 4MMLA 2L3QA 1KFZA 1MNDA 5HKCA 1RAFB 4HVVA 2RJEA 2RJCA 4IUPA 1W4SA 4A53A 3OYNA 2EYYA 1TSFA 5CVIA 4BDYA 1VQKQ 2KBTA 1VQ4A 3EG2A 1MV0B 2G3RA 1MGQA 1LNXA 4PJMA 5GANj 1V1CA 3CCLQ 3QSUA 3JCMf 1OX9A 3CCJQ 4ATOA 3CMAT 2C06A 1JB0E 3OW2S 1WHHA 1TUCA 4HCKA 2LX7A 2AZVA 2LCLA 1U5SA 3VS6A 3KBGA 2YHTA 2LT1A 2DBKA 2F2WA 4IIOA 2NUPB 3OSSC 1OI1A 3JCMh 3PMIA 1N9RA 2DTOA 2WSCE 4LE9A 2I0NA 3OMCA 3ZBDA 3HKSA 3ME9A 2QQAA 1WX6A 2DF6A 1JJ2P 2K3XA 2KNBB 4PJOF 1QP2A 4D6WA 1YI2T 3M4GA 2R5AA 5CKFA 1QWFA 3RERA 2JZ2A 3H0IA 2KK4A 2VGMA 2DNUA 3G71Q 1UUEA 5GMKj 1YJ9A 1GL5A 1I4K1 3X28B 5GJVB 1K9MR 1K0SA 3CCQQ 3M4YA 1YITT 5LJ3g 3CPWS 5GANf 3OS0A 2J06A 2KAFA 3PT9A 2ZPIB 1UFFA 5FU7C 3CMEA 1VQLT 3QG1A 1M5Q1 3A8GB 2EQKA 3SDZA 2RM4A 1D1CA 2LJ0A 5CCAA 5CIUA 5J26A 5I11A 1BCOA 2SEMA 1YHQQ 1ZSZA 3PVLA 3ASKA 4HVWA 2PTKA 3FLGA 1UG1A 5FWCA 4D8KA 1G3TA 3SEMA 4XTYA 3G4SQ 4LDUA 4QQ6A 4E6RA 1KIKA 2OTLT 3V7CA 4C92A 4KGXB 2DL7A 2BUDA 3A5ZB 4WCIA 1OU8A 3VYGA 2D0QB 1D3BB 2DERA 1WXTA 1VQKA 3HHTB 2HD0A 1PKTA 2V1QA 4JJDA 3PVQA 3CCLA 2DEQA 3GPLA 2K57A 4A4KA 3CCJA 3HPWA 1QWEA 2ZZDA 4ZNXA 4E7ZA 3JB9D 1I0CA 1S72T 4FT4A 3JB9J 1SSFA 4Z02A 4X9DA 4CRIA 1WNLA 2EJ9A 5GAOr 3UWNA 2A28A 4C8QD 1KQSS 4QQGA 4FYXB 5A0GA 5KYWB 1MHNA 1RAHB 2EAYA 2EQMA 3BY7A 2HZYA 3NPFA 3TSZA 1VQ6Q 3NFCA 5C0MA 4RTUA 2BTTA 5KYUA 1K73C 1UE9A 5LJ5g 5DLOA 3C0CA 4DBFA 1H3ZA 4JPBW 3JB9G 2CP0A 1D0XA 4FW2A 2XU8A 4M77C 3MKDA 1GBQA 4Q5WA 1QVPA 4M77E 5ECAA 1B3QA 1KK7A 3M9QA 1IGUA 4C8QG 1NYGA 1KD1R 3CCUQ 4M75E 1HJDA 3G71A 5LL6S 3JV3A 4M78F 2QI2A 1OEBA 1FXXA 2RI3A 3QZ5B 1I81A 2DYIA 4OMFB 5IN1A 3I5SA 2KSSA 1JXOA 3CCQA 2L5QA 3VS4A 4E7KA 3PMTA 1M4ZA 2GTJA 3EHQA 2GTOA 2D9TA 2MI6A 1FYNA 1VQPA 5CAIA 5FRNA 2JMAA 4E7IA 4M7AB 1W2BP 2KI7A 2O4XA 2GCXA 1C6VX 3CCEQ 2RJDA 5L8RE 1YIJQ 1UB4A 1O75A 4AMCA 3HSBA 3TSWA 4CC2A 5GAN3 1YHQA 3CC2T 3DLMA 2HDAA 1NPRA 2QQBA 2ATCB 4HCBA 2PZ1A 3S3MA 1M3BA 3RMSA 4M7DF 2GFUA 2L0AA 2X3XD 5KYYB 1HK9A 3G4SA 3NHNA 4OB3B 2YUQA 1EX4A 1JEGA 1XNIA 3LH5A 2DILA 5IHIA 1WHMA 4F7UF 3LWIA 1TG0A 1D1AA 2WACA 3BE3A 1UECA 4RTWA 5HK0A 3G6ET 2ZGWA 5KYNA 3CC7T 3N5BB 1YWOA 3H9NA 4AG2C 2K6DA 1PSEA 3JCMg 4FCYA 5GAMd 1U06A 5GAMe 1K73U 2XDBA 2MAMA 2K2VA 2EVRA 5L23A 4J9IA 3M5AA 4J9DA 2QK0A 2R57A 3VS5A 2DXCA 4X9CA 2M51A 2QA4Q 1BI0A 3AT1B 4CC3A 4RTVA 3ULRB 4PLLA 3SHWA 4PJOE 1M8VA 4YTLA 2RQWA 2QEXT 4XAXB 1OZ3A 4J9CA 3G7ZA 1KHCA 1VQ8Q 1LOJA 1RLPC 2F5TX 2DTHA 4DBRA 2QG9B 1X69A 2K5IA 2VVKA 4NS5A 1ZSZB 1QVFP 2FZGB 2LRQA 2EFIA 3QWXX 2W10A 1OULA 2DJQA 5A0LA 2KQWA 2MWPA 1VQ9T 5GAOl 4RG8A 3OW2A 4FSXA 1JXMA 2YUOA 2E4HA 1XJWB 4JZ3A 1CKBA 3QXEB 1NZ9A 5DLQE 3FC3A 1X2QA 2J05A 1G3YA 4UC4A 3EH2A 3PFSA 4CI0C 2P0QA 1R0BG 3CCUA 3LYIA 4KH1B 2DL4A 1QVGP 2ZPGB 4IUVA 2RHYA 2YRCA 2KE9A 2X4YA 4ANJA 5GANg 1VYUA 2DIGA 2DIQA 3JCMQ 1BCMA 1IRXA 1PRLC 4E7LA 2QQRA 3X25B 1JRIA 3QDFA 4FT2A 1RACB 4JRKA 4F16A 2X4WA 2FPDA 2DRKA 3CCEA 3ER0A 3ZL7C 3CCMQ 1YIJA 3EFOB 1WFWA 2K9GA 1UTIA 2OJ2A 2MIOA 1M27C 4J7FA 4Z89A 5IHNA 2RHIA 3S3OA 1WHKA 3CPWA 4J9BA 2HNIA 2LT4A 3GNGA 4EPCA 4GLMA 4HT9A 3INZA 4DEXA 2DMOA 2OX7A 1M2VA 5GAMj 4ZGEB 1K1ZA 1VIEA 2ZPHB 2YSQA 3RDVA 1JU5C 3L42A 2VKNA 4IKFA 1YNZA 2FG0A 2JT4A 3LW5E 3GP8A 4IUUA 4VUBA 2QYZA 4Z8AA 1N9SA 3OYDA 1AVZC 2X51A 5FU7B 1JO8A 4M7AC 1K73R 1UJYA 1WIEA 2XKOC 3QUIA 2AZSA 2YWWA 2G6FX 1Y7XA 3DB4A 2L89A 4JJNK 1PRMC 4M78C 3JCMb 1WQWA 3I5RA 4HVUA 4M78E 3X24B 3HFOA 2BE9B 1LJOA 1Q82C 2LVMA 2LQWA 2KRNA 1ZUUA 1M1KC 1VQNQ 2QTXA 2DE0X 1X75C 1QKXA 3OB9A 4FYYB 2K3YA 1VQ5A 1WXBA 4XU0A 2EQUA 1D3BA 4HKEA 2E1HA 4A63B 3C12A 1R0CB 4HCZA 1ZX6A 5M9OA 1DJ7B 2P84A 4MZMA 2F2VA 3H0FA 4M7DE 2L8DA 4OMMA 1PC0A 5GMKe 2DVJA 1SHGA 1SKUB 2M02A 1AWWA 1M8MA 1E6GA 3NTHA 5LJ5h 4HCCA 4ZN3A 3TREA 4JLGA 3J81E 2AIRB 2DD5A 3CCMA 4KH0B 1B34B 1N6AA 3CBOA 3GF5A 1NEBA 1N5ZA 3CBPA 1TXQA 4M75F 1TWBA 4DQ2A 5KYWA 3LLRA 1NE8A 4XTZA 1MMGA 4KGZB 3GIBA 1IHVA 1ZUYA 1GBRA 4FYVB 4OMOA 2ROLA 4NOYA 3RKXA 2O9SA 3CCJT 4M77B 3CBMA 5FROA 3PGGA 2EPDA 4OB1B 4BB7A 3Q1JA 3CCVQ 4FM4B 2D1XA 2LQNA 2H3EB 4J9EA 3MEWA 4IUTA 3REBB 1T3SA 2E65A 2B8AA 2KROA 2VXFA 2ZPFB 5KYXB 3M56A 2AKKA 3OYIA 4AFSC 2CP6A 1JQQA 3JCMX 5IH2A 1Q82U 2RJFA 2HQEA 2COZA 2P0PA 2JN0A 4Z88A 1M1KU 5HCKA 5GAN7 2HKQB 1QKWA 2LCSA 4BE0A 4C92E 2LMJA 2RO0A 2EJGA 3HRSA 4AFUC 3QBYA 2VUBA 4ZTFA 4M7AA 4FL6A 4A4GA 1KQSP 1X6OA 3CCRA 2OTJT 4MDXA 1RABB 1H92A 4DBHA 2H8HA 1K4US 2RHZA 4OGEA 3QYGB 3I56A 4PJNA 4BE1A 4OB0B 3NMZC 2NUZA 3FDRA 1N8RC 4B9XA 3L2RA 2E5QA 3OYMA 3G71T 1V76A 3CC4Q 3A8HB 1VQNA 3SFMA 2JTEA 5KYYA 2QAZA 1Z9QA 1AZGB 4FW1A 3GBQA 1X6GA 4NL3A 4F17A 3JB9F 3MO8A 1LPLA 3OYYA 4RMOA 1VQPT 1UHCA 3H8ZA 4FU6A 1M2VB 4E2FB 1CSKA 5I2SA 3HRUA 4C8QF 3A8OB 3CMAQ 2DL3A 4BI3A 1RADB 2VYTA 4M77D 1WHLA 2JXBA 1YHQT 1M2OA 1V29B 2LZ6B 2BKDN 2EQJA 4RCBA 2EGCA 1IGQA 1QCFA 4J6YA 4R56A 3VYHB 5CR2A 4F7UA 1M1GA 4PK4A 5CQXA 4PJOB 2CGHA 4R55A 2LJ3A 2KYBA 4X34A 4CC4B 2CH4A 4EMHA 1ZSGA 2D8HA 3OYLA 4LD6A 1Q86C 3R6OA 4E7JA 2RNAA 4XTVA 1ARKA 2YRDA 2Z0WA 4M77G 3VS2A 2RK2A 4A54A 1YI2Q 5D6WA 2CS7A 3SWNC 2A0FB 1VQMA 1VQ7Q 1PWTA 4OVAA 5GANh 3HP9A 2NUTA 4JDSA 1FWZA 4AT1B 2MOXA 2VB6A 3CCSQ 3CEYA 2A08A 2P0KA 2JTFA 3CCVA 1NEGA 2RMOA 1M9SA 1YN8A 3JB9H 5I21A 1YJWT 2K3BA 4C0ZA 4KBMB 1YCSB 4Y91A 3EGDA 2LC4A 1BI1A 3VUBA 4BI8B 1N8RU 1BU1A 4XTXA 4KULA 1G3SA 3OYBA 2ZPBB 2O88A 1SPKA 1I8FA 1ZUKA 1VQLQ 4OP0A 2EW3A 2XI9A 1HD3A 3RKWA 1RAIB 3M0PA 1W2BA 1ZA2B 4ZTJA 1WJRA 2K5FA 1BYMA 1ABQA 3CXCA 4PFOA 4E7HA 2QASA 2BZYA 1YJNT 1U3OA 1Q82R 3KXTA 1YP5A 2KVQG 3EFOA 1OX8A 1M1KR 1PSFA 3OYJA 4E7SA 3HTRA 2DBMA 2OTLQ 3CC4A 1Q81C 5GMKh 2E10A 2FVUA 2DPPB 2AK5A 1YBYA 1WPYA 1R8OB 5LJ3d 1RAAB 4XTWA 1LVKA 2E5KA 3V8JA 2L3SA 3MEUA 3I55T 2RN8A 5J3BA 3JB9I 2YRVA 1FMKA 1UGSB 4QT7A 1OPKA 2DAQA 4M75C 1Q86U 3M55A 3RUXA 2K2MA 3CMAA 2E41A 2HBPA 4P5NA 1F1BB 3JRZA 3M0RA 1YIJT 1S72Q 2O2OA 1UGQB 4L59A 1K8AC 2JNGA 2C0TA 5HK3A 1KHIA 3MPUB 4R0KA 2D0NA 1GRIA 1I5LA 1GFDA 3QKJA 1TOVA 4N4IA 2L2PA 4X1VA 3CD6T 1U8RA 1T3LA 1AWJA 1IB8A 2I2LA 1H8KA 2KRSA 1W6XA 1QMCA 2DRMA 2E3HA 2RQRA 3MP8A 5AYFA 4M78B 3LGFA 5KE2A 4HXJA 3RESA 2MMPA 1YI2A 4ESRA 1VQ7A 3UF4A 4WTOB 4QKUA 4QVCA 4PJLA 4LDWA 1VYTA 3V8LA 3CCSA 2JS0A 1OQKA 2RQUA 2BE7D 2VV5A 5J39A 1YCYA 1RL2A 2FRWA 1KQ2A 5I2MA 3UPUA 2J6OA 2FB7A 2ZCFB 2JMCA 2LTOA 2YLBA 1GCQC 2CZ1B 1ZQ1A 8AT1B 4RTTA 1Q81U 1AD5A 4M7DB 1NBEB 2K5LA 1SG5A 5LJ5d 5CK9A 2DEUA 2JOYA 2DVEA 3EGUA 1QCNA 4F7UB 2HQHA 3AHUA 4KUDK 3QWYA 4JS5A 2LJ1A 3C95A 1WI7A 2ZPEB 4PJOC 4V2SA 1P92A 2EKOA 1RUWA 4XK8E 1N8RR 1B34A 2AHJB 2VC8A 5A2QE 2GBQA 4LDYA 2CREA 3BDUA 4EMGA 1K8AU 1VQ5T 3A98A 2CP2A 3T9NA 2W0ZA 4NL2A 1KJWA 2OTLA 1BIAA 1MMDA 2CP5A 2DKGA 1VQ6A 3FB9A 4C8QE 1BI3A 1XOVA 3NTKA 1YFNA 4JRPA 4ZGDB 5LJ3j 5GAN6 4M7AD 3G6EQ 2V26A 4PJJA 4C92F 5GAOm 3QZ9B 4N4GA 2NUTB 2LP5A 1YWPA 4M77A 2NYSA 1Y71A 3V8KA 4M78D 2ENMA 5I22A 2HSPA 3OY9A 4PFPA 4M75A 5DY9A 2CP7A 3EGDB 5C6SA 2BZXA 2RHUA 1S72A 1MMAA 2DL8A 3A1PA 5KYXA 4O6JA 5GMKi 4BDZA 2F1LA 2EWNA 2RQVA 3FRNA 5D6XA 3VS1A 4M7AG 1WA7A 2J6KA 4MZTA 2Y90A 2HSEB 2Y4XA 2QQSA 2QEXQ 2JTMA 1Q86R 1LCKA 4M78G 3VS3A 4KGVB 1WZOA 1QCOA 1QW1A 4QVZA 2RQTA 3TQ7P 2XDDA 3JCMd 3X20B 3JCMe 1VQOQ 4BD3A 1VQ9Q 3DLLA 2CYZB 4J6WA 4DOVA 5IT9E 1Q7YC 1IREB 2ABLA 2J7IA 5EC7A 1UGVA 1VQ4T 2IPOB 3I35A 3OS5A 3L2VA 2V8IA 7AT1B 3M0TA 3CQTA 2A37A 2CT4A 1VIFA 1W2BS 3A8LB 2HEQA 3QJ6A 3CXCS 1M90C 1GCQA 4C5HA 2EYWA 4DEYA 3EG9B 3CCRT 3JSCA 2EKHA 2AKLA 4F7UG 2DXUA 3C94A 4RTXA 3I56T 2FL7A 4BACA 1K9AA 4KT0E 2R5MA 1C0MA 3OW2P 3QYHB 4RTZA 1WLPB 2QA4A 1VQNT 4PJOA 1IHWA 2RF0A 4QVDA 2V8JA 4AFQC 2CP3A 3MP1A 2K4YA 1VQ8A 2O31A 1Y0MA 3MEAA 3GLXA 3RMQA 4AG1C 4XU1A 5GANd 4JZ4A 3L2ZA 2QXFA 3SWNB 3G6EA 1W70A 2RH2A 9ATCB 1YJ9T 1NLOC 2R58A 2LNHB 1D1BA 3M0SA 3VJPA 2VASA 1K8AR 1O9SA 4RG2A 4B9WA 4J9HA 5A0DA 2A3LA 1OYXA 3UA7A 2HCKA 4GLKA 4LDXA 2FEIA 2AT1B 2GNCA 3PIOA 3CMET 1T0HA 4TVRA 1Q7YU 1QVFS 1KSWA 5GAMf 4M7DC 4K11A 1X43A 3FEOA 4F14A 3P8HA 3CPWP 1TU0B 3EG3A 3OYHA 2YDLA 3RIRA 1VQMT 1GXIE 1KC8C 2JUFA 1OPLA 1AWXA 5GAN5 3DB3A 1M90U 2D6FA 4DBQA 3MCAB 5FW9A 4MDWA 1UGRB 2X4JA 4N0AC 3CCVT 1VQOA 1VQ9A 5FLXE 1M1FA 5GAMh 1QVGS 3TEEA 1KD1C 1WHJA 4J5YA 2E6ZA 1Z9ZA 1G5VA 2MYSA 2IIMA 3KUFA 1VQKT 2EBPA 1JJ2A 3E1SA 4JS4A 2XD0A 3CCLT 3EH1A 1WDXA 2Y4YA 3TU4K 2O01E 1UHFA 2LDMA 3OYKA 2K7AA 5IXFA 1TUDA 4M75B 2YT6A 3JCMW 2DTIA 3MP6A 1GCPA 5IAYA 1CKAA 1Y96B 2LCCA 1MUZA 3PE0A 2DL5A 3O8VA 1NYFA 2EQIA 4OMQA 2A7YA 3CC4T 4C92C 2QQ9A 3U23A 1WYXA 2PVDB 2QGFB 4ME7A 2L3RA 4J8OA 3GNFB 4BY6C 2HKNA 2COWA 1I07A 3H41A 2PNIA 1Y57A 1C1AA 3E9FA 3E9GA 4M78A 5GAN4 3EFRA 4QQDA 2C0IA 5FWBA 4C0DB 1WJQA 4AFZC 2JW4A 2RPNA 3JCMP 2EIFA 2DYBA 1U1TA 3L1AA 3QHSA 2KT8A 1UGPB 2A36A 3OA6A 4RCCA 1HXDA 2RD1A 4JJCA 1KC8U 3HFNA 3CCQT 1PHTA 2RHXA 3TCJA 2M1HA 3OQ5A 2OI3A 2M0OA 2E12A 1KD1U 4A4FA 1GFCA 1H641 1NJIC 1WXUA 3RKYA 2ESWA 4PLIA 4M7DA 2OAUA 2KMTA 2X3WD 4BE2A 2NLUA 1WHGA 1ZBXA 2CZ7B 3BFMA 4LNPA 2IVWA 2OTJQ 1G2BA 3P8DA 4M75D 1VQ7T 1OU9A 3OS1A 3QDRB 3RR6A 3G4ST 3EAEA 2P4TA 2EYZA 2M9UA 3CCST 4N0AA 1Q7YR 2X35A 1PM3A 1R77A 3H0HA 4BUGA 2KY9A 4C8QB 3X26B 4J7IA 3FJ5A 4GBQA 1U1SA 5IXBA 1M3AA 1H3HA 1HYOA 2V1RA 1WQ7A 2DZ9A 2DXBA 2F2XA 1J3TA 2NWMA 1VQPQ 2C0OA 4LUDA 1M90R 1G3WA 2PQWA 4M75G 1VUBA 1E6HA 2FPEA 2DFUA 2HL3A 3A8MB 3URGA 1KG1A 4C0GA 4L5GA 4HA8A 5AT1B 4XQ3A 3OMGA 1MV3A 1ACMB 3NGPA 1VA7A 1YITQ 2RI2A 1D09B 3OBWA 1WGSA 4ZGJB 1PCXA 3L2WA 1VQ6T 2CUDA 3GOXA 3M53A 2CH4W 1IO6A 1SF9A 1FMWA 4ELZC 3CPFA 4PFZA 2GF7A 3WXMB 2M16A 4ZN1A 1TS9A 2WSFE 2K79A 2VGNA 3E19A 3EGXA 4IURA 4RTYA 1NJIU 3JAME 2D8JA 3J7AF 2E70A 2PUOB 3LGLA 3CCUT 2MPXC 2FHDA 2E3IA 2DXTA 2QDLA 4II1A 4PJOD 2ZAEA 3V7SA 3PNWC 2E64A 3EFSA 2JM9A 2RK1A 1YJWQ 2DX1A 2M0YA 4MMKA 1AZEA 5LJ3e 2JVVA 1OV3A 1I1JA 2GQIA 4C0FA 3DKMA 5GAMg 2FZCB 1AHJB 1BKBA 3JCMV 4OB2B 5GMKm 2MWOA 1UDLA 4CC7A 1VOMA 5GMKl 3EG9A 3CCET 1IXDA 4EMKB 3VS0A 3PIPA 1K0XA 2XG8D 1KC8R 4PJOG 2OTJA 2KGTA 4C5EA 2QTVA 2DO3A 1MMNA 1G8XA 1YJNQ 2V8KA 2DJZA 2KXCA 4JLIA 2FPFA 1NPPA 3LX7A 2KDSA 3IQLA 1JJ2S 4M7AF 2DD4A 1BB9A 4QW2A 4XU3A 2JJ9A 3M54A 1Q95G 2GFAA 3M0QA 1PG5B 5GAN8 3S3NA 3VUZA 2CZ0B 1N27A 4ORZA 1K76A 1OZ2A 1EFNA 1QVFA 1HSQA 3JCMJ 2MK5A 3EG1A 1NM7A 3O5ZA 4PKCC 1S1NA 2H3JA 3H6ZA 4C0DC 2BZ8A 3I55Q 4B6MA 3SWNA 1SRLA 2RA2A 2OAWA 2MF2A 2KRMA 2YUPA 1T0JA 2PU9B 1FX7A 2FRYA 3CXCP 3UT1A 1SEMA 2DK3A 1RAGB 3MHXA 2QA4T 3REAB 1XTDA 2CSQA 2MCNA 1QVGA 1BBZA 2EJFA 2LX9A 1RLQC 4EDUA 2XIDA 3UDCA 1YITA 3QIIA 1UJ0A 3KFVA 1I5OB 3CD6Q 1EIFA 1VQ8T 3OYAA 1PKSA 1VQLA 2KEAA 3F70A 5LJ5e 1D0YA 4XTUA 1UEBA 1PD0A 2DM1A 3CC2Q 3V7RA
chains in the Genus database with same CATH topology
1M1KU 5EG2A 5GAN7 2QA4A 1VQNT 2PVGB 4PJOA 4WF2A 3CCLA 2DEQA 3GPLA 2XK0A 4QVDA 3FIFA 2K57A 2V8JA 4A4KA 4C92E 3CCJA 3HPWA 3L2UA 4BE0A 2HAXA 2RO0A 4LDVA 2ZZDA 2EJGA 5KH6A 1QP3A 3JB9D 3HRSA 5D6YA 3BDLA 3MP1A 3QBYA 4C8QC 2K4YA 2VUBA 4ZTFA 1S72T 4FL6A 4FT4A 4A4GA 4M7AA 3JB9J 1X6OA 3CCRA 1SSFA 4MDXA 2OTJT 4JRIA 1VQ8A 4Z02A 3MEAA 2RHZA 4OGEA 3QYGB 3GLXA 4X9DA 3RMQA 4A4EA 1IZ6A 4CRIA 3I56A 1YJWA 4XU1A 1WNLA 4Y28E 5GANd 4BE1A 2EJ9A 5GAOr 4OB0B 3L2ZA 2QXFA 3UWNA 4C8QD 3SWNB 4DA4A 1X01A 3G6EA 1KQSS 4QQGA 5A0GA 3FDRA 2RH2A 1MHNA 1N8RC 4B9XA 3L2RA 2E5QA 1YJ9T 5FU6B 3OYMA 3G71T 2R58A 3VU3C 2EAYA 2EQMA 3A8HB 3BY7A 3P8BB 1VQNA 3SFMA 3NFCA 4J83A 3VJPA 2XHCA 5C0MA 1K73C 4N4HA 1O9SA 5LJ5g 4RG2A 4B9WA 4IUQA 5A0DA 5DLOA 2A3LA 1OYXA 4NL3A 1H3ZA 4GLKA 3JB9F 1KQ1A 3MO8A 4LDXA 3JB9G 3CCMT 3OYYA 1Y96A 4RMOA 2F69A 3V7RA 2XU8A 1VQPT 1VQOT 2GQVA 3H8ZA 4FU6A 4M77C 3QPHA 3PIOA 3CMET 5I2SA 1YJNA 4Q5WA 1QVPA 3HRUA 4M77E 4TVRA 1ZHIA 4OGCA 1Q7YU 4C92B 1QVFS 3M9QA 5GAMf 4C8QF 4M7DC 1TH7A 5GAOp 3A8OB 4OF1A 3ZEHA 4C8QG 3FEOA 3QO3A 3P8HA 4BI3A 4BY6B 4M75E 2VYTA 3G71A 1WJSA 4M77D 5LL6S 4M78F 2QI2A 3VV0A 1YHQT 1V29B 2BKDN 2EQJA 4RCBA 1FXXA 2RI3A 3QZ5B 1I81A 4J6YA 3RIRA 4R56A 2F5KA 3OYHA 1VQMT 1KC8C 2JUFA 3VYHB 4M7DD 4OMFB 5IN1A 5CR2A 4F7UA 2KSSA 1M1GA 3CCQA 2L5QA 5CQXA 4XU2A 2VXEA 5GAN5 3PMTA 2E6NA 1M4ZA 3DB3A 4E7KA 1M90U 3WVDB 2D6FA 4PJOB 1XQHA 3MCAB 2MI6A 2D9TA 4HT8A 4L6V5 2CGHA 4MDWA 2FYKA 5KCOA 4R55A 1UGRB 2X4JA 4N0AC 5CKBA 5CAIA 3CCVT 1VQOA 1VQPA 1VQ9A 5FRNA 4PNOA 3S6WA 5FLXE 1M1FA 4X34A 5GAMh 3J80E 3TEEA 3I55A 4E7IA 3NTIA 1QVGS 4M7AB 2HQXA 4EMHA 1KD1C 4J5YA 3OYLA 2O4XA 2E6ZA 2GCXA 1K9MC 4LD6A 2DZCA 1Q86C 3R6OA 4E47A 4E7JA 1G5VA 2BIVA 2RJDA 4XTVA 5L8RE 3QJYA 3KUFA 1VQKT 1JJ2A 4RKUE 3E1SA 1UB4A 5CKDA 1O75A 4JS4A 3M58A 5GAN2 3HSBA 4M77G 5GAN3 3VKIA 1YHQA 3CC2T 3DLMA 5LJ3f 3WVEB 2RK2A 4A54A 4ELYC 5D6WA 3CCLT 2XD0A 1NPRA 2QQBA 2CS7A 3SWNC 1JBMA 1VQMA 4HCBA 3S3MA 3RMSA 5GANh 2LQ8A 4OVAA 4M7DF 4M7DG 2QDYB 3HP9A 2GFUA 2Y4YA 4JDSA 1FWZA 3TU4K 1HK9A 2O01E 3G4SA 3OYKA 2LDMA 2HD0A 4OB3B 3OYEA 3CEYA 4M75B 2P0KA 3CD6A 2JTFA 3CCVA 1XNIA 3JCMW 2DTIA 3OBYA 5CQYA 1M9SA 2CKKA 2X4XA 3MP6A 5LJ5j 3JB9H 4F7UF 5KCHA 5CKHA 3LWIA 5IAYA 1Y96B 4A4HA 4EMKC 5I21A 3L2QA 2WACA 4C0ZA 1YJWT 2LCCA 2RB6A 4KBMB 4Y91A 2LC4A 1BI1A 3VUBA 3O8VA 5HK0A 2ZGWA 3G6ET 4BI8B 1N8RU 5LJ3h 3N5BB 3CC7T 4XTXA 4KULA 1PSEA 3JCMg 4JRQA 1G3SA 3M57A 2A7YA 3CC2A 4MZPA 3CC4T 3M59A 4C92C 2QQ9A 4JUVA 3OYBA 5GAMd 2PVDB 2ZPBB 1K73U 1I8FA 5GAMe 2XDBA 4ME7A 2L3RA 2MAMA 5HY6A 4J8OA 4OP0A 3GNFB 2XI9A 4BY6C 3RKWA 1W2BA 2LQKA 2K2VA 4ZTJA 1GXIE 1WJRA 2K5FA 1BYMA 3M5AA 2R57A 5CO7A 4C8QA 3CXCA 2DXCA 4C92D 4E7HA 3HRTA 4X9CA 3E9FA 4J6XA 1Y07A 1BI0A 3E9GA 2LNVA 1YJNT 3META 4M78A 2EYQA 3KXTA 5GAN4 2KVQG 3EFRA 4PLLA 4QQDA 3SB2A 5GANe 3MEVA 3OYFA 4C0DB 4PJOE 1WJQA 1BI2A 1M8VA 1PSFA 5CKEA 3CC7A 3OYJA 4YTLA 3OYGA 3PTAA 3JCMP 4LD9K 2PVOB 2EIFA 2O4XB 2QEXT 4PL6A 1U1TA 3CC4A 3L1AA 1OZ3A 3QHSA 4XAXB 3G7ZA 1KHCA 1Q81C 1LOJA 4DOWA 2F5TX 2DTHA 1UGPB 5GMKh 4M7AE 3OA6A 4RCCA 1HXDA 2RD1A 2K5IA 3ZFJA 4NS5A 2E10A 2FVUA 1KC8U 3HFNA 2DPPB 4BI4A 3CCQT 1YBYA 1WPYA 3OYCA 1R8OB 2LRQA 2EFIA 3LWHA 2CZ6B 2RHXA 3TCJA 5LJ3d 3JCMc 2M1HA 4XTWA 3OQ5A 5A0LA 2KQWA 2MWPA 4C92G 1VQ9T 4KUIA 4O5VA 3V8JA 4RG8A 5GAOl 3MEUA 3OW2A 3I55T 4C5IA 4FSXA 5J3BA 2M0OA 3JB9I 2YRVA 2E12A 3QXEB 1KD1U 1NZ9A 4A4FA 1H641 1UGSB 5DLQE 3FC3A 1NJIC 3OS2A 1K9MU 2DAQA 4M75C 1Q86U 3M55A 3RKYA 4PLIA 1G3YA 3RUXA 4M7DA 2OAUA 4UC4A 2KMTA 5KE3A 3CMAA 2E41A 3PFSA 4CI0C 2HBPA 4BE2A 3JRZA 2P0QA 2NLUA 4P5NA 5LJ5f 1ZBXA 2QEXA 3CCUA 1UGQB 2CZ7B 3BFMA 3LYIA 4L59A 1YIJT 1K8AC 2XDPA 2IVWA 1KQSA 2JNGA 3HL8A 3P8DA 1KHIA 5HK3A 1I5LA 1RI0A 2ZPGB 3LH0A 4IUVA 4M75D 2RHYA 1VQ7T 2X4YA 1BIBA 3OS1A 3FJPA 3QDRB 5GANg 3G4ST 3QKJA 2DIGA 3EAEA 2DIQA 2P4TA 3JCMQ 4N4IA 3CD6T 2M9UA 5GAOq 1U8RA 2IG0A 3CCST 2I2LA 4N0AA 2X35A 3BW1A 2RI5A 4E7LA 2QQRA 4FIBA 3X25B 1JRIA 2XICA 3SD4A 4BUGA 2KY9A 4C8QB 3X26B 4J7IA 4FT2A 5GAOn 1U1SA 3MP8A 4JRKA 5AYFA 2X4WA 4C5GA 5FRMA 3CCEA 3ER0A 1WQ7A 4M78B 3LGFA 2DZ9A 2WSEE 2DXBA 4M77F 4F7UE 5KE2A 1YIJA 3OSVA 3RESA 5DM7R 2MMPA 2PUKB 1YI2A 4GY5A 2YLCA 1G3WA 1VQ7A 2PQWA 4M75G 5FU6C 4J7FA 1VUBA 3C4SA 2RHIA 4QVCA 4LDWA 3S3OA 3V8LA 3CPWA 3CCSA 2HNIA 3A8MB 3URGA 2VV5A 1KG1A 4C0GA 2LT4A 4L5GA 5J39A 1YCYA 1RL2A 4HA8A 3GNGA 4EPCA 4EMKA 4XQ3A 4HT9A 3OMGA 1KQ2A 3INZA 4MMLA 5I2MA 3UPUA 2FB7A 2ZCFB 2LTOA 2YLBA 5HKCA 2RI2A 2CZ1B 2RJEA 5GAMj 1ZQ1A 4ZGEB 3OBWA 1WGSA 1VIEA 2ZPHB 4ZGJB 2RJCA 3L2WA 1Q81U 1VQ6T 4IUPA 4M7DB 1W4SA 4A53A 3GOXA 3OYNA 2K5LA 3M53A 3L42A 5LJ5d 4ELZC 5CK9A 3CPFA 2JOYA 4IKFA 2DVEA 2GF7A 5CVIA 3WXMB 2M16A 4BDYA 4ZN1A 2WSFE 4F7UB 1VQ4A 2VGNA 3AHUA 3E19A 3LW5E 4KUDK 2G3RA 3GP8A 4JS5A 3C95A 1MGQA 1LNXA 2ZPEB 4PJOC 5GANj 4IUUA 3QSUA 1P92A 2EKOA 4VUBA 4XK8E 3JCMf 4V2SA 1N9SA 4IURA 3OYDA 1NJIU 1B34A 2AHJB 4ATOA 2VC8A 5FU7B 3JAME 5A2QE 4LDYA 3CMAT 3J7AF 2E70A 2PUOB 3LGLA 2C06A 3CCUT 1JB0E 2FHDA 3BDUA 4EMGA 1K8AU 3OW2S 1VQ5T 2DXTA 4M7AC 2XKOC 3QUIA 4II1A 3T9NA 4NL2A 4PJOD 2OTLA 1BIAA 2DKGA 3DB4A 1VQ6A 1Y7XA 3FB9A 4C8QE 3V7SA 1BI3A 2L89A 3PNWC 1XOVA 3NTKA 4JJNK 2E64A 2LCLA 3EFSA 4M78C 4ZGDB 2RK1A 3JCMb 4JRPA 1WQWA 5LJ3j 3KBGA 5GAN6 4M78E 4M7AD 2YHTA 4MMKA 3X24B 3HFOA 2LT1A 5LJ3e 1LJOA 5GAOm 4C92F 1Q82C 3QZ9B 2LVMA 2JVVA 3OSSC 1OI1A 3JCMh 3PMIA 4N4GA 1N9RA 2DTOA 2WSCE 4C0FA 3DKMA 4M77A 1M1KC 3OMCA 1Y71A 2QTXA 3V8KA 4M78D 5GAMg 1AHJB 3ZBDA 3HKSA 3ME9A 1BKBA 3JCMV 4OB2B 1X75C 2QQAA 5GMKm 2MWOA 3OY9A 5GMKl 4M75A 5DY9A 3OB9A 3CCET 4EMKB 2K3XA 2K3YA 3PIPA 5C6SA 1S72A 2RHUA 1VQ5A 2XG8D 4PJOF 1QP2A 4XU0A 4D6WA 4PJOG 4O6JA 2OTJA 1YI2T 4C5EA 2DO3A 1D3BA 2EQUA 3M4GA 5GMKi 4BDZA 2V8KA 4HKEA 2DJZA 2EWNA 2E1HA 4JLIA 3C12A 3FRNA 2R5AA 5CKFA 1NPPA 5D6XA 3LX7A 2KDSA 4HCZA 1JJ2S 3RERA 4M7AF 2DD4A 2JZ2A 5M9OA 4QW2A 4XU3A 2KK4A 1DJ7B 2VGMA 4MZTA 4M7AG 2Y90A 3M54A 4MZMA 5GMKj 2GFAA 2Y4XA 2QQSA 1YJ9A 1I4K1 2L8DA 4M7DE 2JTMA 3X28B 5GMKe 5GAN8 4M78G 3S3NA 3VUZA 2CZ0B 3NTHA 5LJ5h 1N27A 4ZN3A 4HCCA 1QW1A 3TREA 4QVZA 1OZ2A 4JLGA 1QVFA 3M4YA 3J81E 2XDDA 1YITT 5LJ3g 2DD5A 3CPWS 3JCMJ 3JCMd 5GANf 3CCMA 4PKCC 3X20B 3OS0A 1B34B 2KAFA 1N6AA 3CBOA 3GF5A 2H3JA 4BD3A 3PT9A 2ZPIB 3JCMe 3H6ZA 4C0DC 3DLLA 5FU7C 2CYZB 3CBPA 3SWNA 4M75F 2RA2A 4DQ2A 3CMEA 4J6WA 1VQLT 2MF2A 3QG1A 1M5Q1 3A8GB 2EQKA 3SDZA 3LLRA 4DOVA 2RM4A 5IT9E 1NE8A 4XTZA 1Q7YC 1IREB 5CCAA 2PU9B 5CIUA 3GIBA 1FX7A 5J26A 1VQ4T 3UT1A 3OS5A 3L2VA 2DK3A 2V8IA 3ASKA 3MHXA 2QA4T 1XTDA 1VIFA 1W2BS 4NOYA 3RKXA 1QVGA 3FLGA 3A8LB 3CCJT 4M77B 2EJFA 3QJ6A 1G3TA 2LX9A 4EDUA 3CBMA 2XIDA 4XTYA 3UDCA 3CXCS 1YITA 3QIIA 4LDUA 4QQ6A 3PGGA 5FROA 1M90C 4OB1B 4BB7A 3Q1JA 4C5HA 4FM4B 2OTLT 3V7CA 4C92A 1EIFA 3CCRT 1VQ8T 3OYAA 3JSCA 3MEWA 4IUTA 2BUDA 1VQLA 3A5ZB 2DXUA 4F7UG 3C94A 3F70A 2E65A 2B8AA 2FL7A 2VXFA 2ZPFB 5LJ5e 3M56A 3OYIA 3I56T 4BACA 3VYGA 3JCMX 2D0QB 1D3BB 4XTUA 1UEBA 4KT0E 1Q82U 2RJFA 2HQEA 2R5MA 1VQKA 3HHTB 2P0PA 2JN0A 3QYHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K U;  2QA4 A;  1VQN T;  3CCL A;  2XK0 A;  4BE0 A;  3CCJ A;  3L2U A;  2RO0 A;  5KH6 A;  5D6Y A;  3BDL A;  1S72 T;  3MP1 A;  3QBY A;  4ZTF A;  4FL6 A;  4A4G A;  1X6O A;  3CCR A;  1SSF A;  2OTJ T;  1VQ8 A;  4Z02 A;  3MEA A;  2RHZ A;  4CRI A;  4A4E A;  1IZ6 A;  3I56 A;  1YJW A;  4BE1 A;  3UWN A;  3G6E A;  1KQS S;  4QQG A;  1N8R C;  3FDR A;  1MHN A;  4B9X A;  3L2R A;  2E5Q A;  1YJ9 T;  3OYM A;  3G71 T;  2R58 A;  2EQM A;  3P8B B;  1VQN A;  5C0M A;  2XHC A;  1K73 C;  4N4H A;  4RG2 A;  4B9W A;  4IUQ A;  1OYX A;  1H3Z A;  3MO8 A;  3CCM T;  3OYY A;  1VQP T;  1VQO T;  3H8Z A;  4FU6 A;  3PIO A;  3CME T;  1YJN A;  4Q5W A;  4TVR A;  1Q7Y U;  1QVF S;  3M9Q A;  3ZEH A;  3FEO A;  3P8H A;  2VYT A;  3G71 A;  1WJS A;  5LL6 S;  1YHQ T;  2BKD N;  2EQJ A;  2RI3 A;  3OYH A;  1VQM T;  2F5K A;  1KC8 C;  2JUF A;  5IN1 A;  1M1G A;  3CCQ A;  4E7K A;  3PMT A;  3DB3 A;  1M90 U;  2E6N A;  2MI6 A;  2D9T A;  5KCO A;  1VQP A;  3CCV T;  1VQO A;  1VQ9 A;  5FRN A;  3S6W A;  5FLX E;  4X34 A;  3I55 A;  3J80 E;  1QVG S;  4E7I A;  3NTI A;  2HQX A;  1KD1 C;  3OYL A;  2O4X A;  2E6Z A;  1K9M C;  1Q86 C;  4LD6 A;  4E7J A;  1G5V A;  2BIV A;  2RJD A;  3KUF A;  1VQK T;  1JJ2 A;  1YHQ A;  3CC2 T;  3DLM A;  5D6W A;  3CCL T;  1NPR A;  1VQM A;  3S3M A;  2LQ8 A;  4OVA A;  2GFU A;  3G4S A;  3OYK A;  2LDM A;  3OYE A;  3CEY A;  2P0K A;  3CD6 A;  2JTF A;  3CCV A;  1XNI A;  2CKK A;  2X4X A;  3MP6 A;  5KCH A;  5IAY A;  4A4H A;  3L2Q A;  1YJW T;  2WAC A;  2LCC A;  3G6E T;  3O8V A;  1N8R U;  3CC7 T;  3CC2 A;  3CC4 T;  3OYB A;  1K73 U;  2L3R A;  5HY6 A;  1W2B A;  4ZTJ A;  1WJR A;  2R57 A;  3CXC A;  4E7H A;  3E9F A;  1YJN T;  3E9G A;  3MET A;  2KVQ G;  4QQD A;  4PLL A;  3MEV A;  3OYF A;  1WJQ A;  3CC7 A;  3OYJ A;  4YTL A;  3OYG A;  2EIF A;  2O4X B;  2QEX T;  4PL6 A;  3CC4 A;  1OZ3 A;  1Q81 C;  1KHC A;  3OA6 A;  1KC8 U;  4NS5 A;  3CCQ T;  1YBY A;  3OYC A;  2LRQ A;  2EFI A;  2RHX A;  2M1H A;  3OQ5 A;  2MWP A;  1VQ9 T;  3OW2 A;  3MEU A;  3I55 T;  4C5I A;  5J3B A;  2M0O A;  2YRV A;  1KD1 U;  1NZ9 A;  4A4F A;  5DLQ E;  3FC3 A;  1NJI C;  3OS2 A;  1K9M U;  1Q86 U;  2DAQ A;  4PLI A;  4UC4 A;  3CMA A;  5KE3 A;  3PFS A;  4BE2 A;  2NLU A;  2QEX A;  3CCU A;  1YIJ T;  1K8A C;  4L59 A;  3LYI A;  1KQS A;  2XDP A;  2JNG A;  3P8D A;  1KHI A;  1RI0 A;  3LH0 A;  4IUV A;  2RHY A;  1VQ7 T;  2X4Y A;  3OS1 A;  3G4S T;  3QKJ A;  2DIG A;  3EAE A;  2DIQ A;  4N4I A;  3CD6 T;  2IG0 A;  3CCS T;  2X35 A;  2RI5 A;  4E7L A;  2QQR A;  3SD4 A;  3MP8 A;  2X4W A;  4C5G A;  5FRM A;  3CCE A;  3ER0 A;  3LGF A;  5KE2 A;  1YIJ A;  5DM7 R;  1YI2 A;  4GY5 A;  1VQ7 A;  2PQW A;  3C4S A;  2RHI A;  3S3O A;  3CPW A;  3CCS A;  5J39 A;  1RL2 A;  3OMG A;  2LTO A;  2RI2 A;  2RJE A;  1Q81 U;  1WGS A;  3L2W A;  2RJC A;  1VQ6 T;  4IUP A;  3GOX A;  3OYN A;  3L42 A;  3CPF A;  2JOY A;  4IKF A;  2GF7 A;  2M16 A;  4BDY A;  4ZN1 A;  1VQ4 A;  2G3R A;  4IUU A;  2EKO A;  4IUR A;  3OYD A;  1NJI U;  3JAM E;  5A2Q E;  3CMA T;  3J7A F;  2E70 A;  3LGL A;  3CCU T;  2FHD A;  1K8A U;  3OW2 S;  1VQ5 T;  4II1 A;  2OTL A;  3DB4 A;  1VQ6 A;  2L89 A;  3PNW C;  3NTK A;  2LCL A;  3KBG A;  1Q82 C;  2LVM A;  2JVV A;  1OI1 A;  3PMI A;  4N4G A;  1M1K C;  3OMC A;  3HKS A;  3ME9 A;  1BKB A;  3OY9 A;  2MWO A;  3OB9 A;  3CCE T;  2K3X A;  3PIP A;  2K3Y A;  5C6S A;  1S72 A;  1VQ5 A;  2RHU A;  2OTJ A;  1YI2 T;  4C5E A;  2DO3 A;  2EQU A;  4BDZ A;  2R5A A;  5D6X A;  1NPP A;  3LX7 A;  2KDS A;  4HCZ A;  1JJ2 S;  2JZ2 A;  5M9O A;  4QW2 A;  1YJ9 A;  2GFA A;  2QQS A;  2L8D A;  3S3N A;  3NTH A;  1N27 A;  4ZN3 A;  3TRE A;  4QVZ A;  1OZ2 A;  1QVF A;  3J81 E;  1YIT T;  3CPW S;  3CCM A;  3OS0 A;  4BD3 A;  3H6Z A;  3DLL A;  3CME A;  1VQL T;  2EQK A;  5IT9 E;  3LLR A;  1Q7Y C;  5CIU A;  5J26 A;  1VQ4 T;  3UT1 A;  3L2V A;  3ASK A;  2QA4 T;  1XTD A;  1W2B S;  1QVG A;  3FLG A;  3CCJ T;  3QJ6 A;  3CXC S;  4EDU A;  1YIT A;  1M90 C;  3QII A;  4QQ6 A;  5FRO A;  3Q1J A;  4C5H A;  2OTL T;  1EIF A;  3CCR T;  1VQ8 T;  3OYA A;  3MEW A;  4IUT A;  2BUD A;  1VQL A;  3A5Z B;  3F70 A;  3I56 T;  2B8A A;  3OYI A;  4BAC A;  1UEB A;  1Q82 U;  2RJF A;  2HQE A;  2R5M A;  1VQK A; 
#chains in the Genus database with same CATH topology
 5EG2 A;  2PVG B;  2DA9 A;  4WF2 A;  2XK0 A;  2FZK B;  3FIF A;  3UA6 A;  3L2U A;  2HAX A;  1AWO A;  2J6F A;  4LDV A;  5KH6 A;  1QP3 A;  5D6Y A;  3BDL A;  4C8Q C;  2HMA A;  1A0N B;  1W1F A;  4LUE A;  4JRI A;  4A4E A;  1IZ6 A;  1YJW A;  4Y28 E;  1NLP C;  4F04 B;  1D0Z A;  4LXC A;  1ZBJ A;  1X01 A;  1B7T A;  2KXD A;  4DA4 A;  3CC7 Q;  1ZA1 B;  5FU6 B;  1X2K A;  4EIK A;  3VU3 C;  1NJI R;  3P8B B;  4J83 A;  2XHC A;  2HBW A;  2JS2 A;  4N4H A;  1BK2 A;  4IUQ A;  4JJB A;  1KQ1 A;  1X27 A;  3CCM T;  1Y96 A;  2F69 A;  1QLY A;  1ABO A;  1VQO T;  2KT1 A;  4J9F A;  2GQV A;  4D8D A;  3QPH A;  1OOT A;  1YJN A;  1ZHI A;  4OGC A;  4C92 B;  3I9Q A;  1TH7 A;  5GAO p;  3ZEH A;  4OF1 A;  3QO3 A;  1AOJ A;  4BY6 B;  3E2U A;  1WJS A;  1VQ5 Q;  3VV0 A;  2O9V A;  3MJX A;  3EGX B;  2F5K A;  4M7D D;  4J9G A;  2YUN A;  4XU2 A;  2VWF A;  2HL5 C;  2VXE A;  2E6N A;  3WVD B;  1XQH A;  4HT8 A;  4L6V 5;  2FYK A;  5KCO A;  5CKB A;  4PNO A;  5IHK A;  1X6B A;  3S6W A;  1SSH A;  3UAT A;  3J80 E;  2FO0 A;  3I55 A;  3NTI A;  2HQX A;  3VRZ A;  2JM8 A;  1K9M C;  2CSI A;  2DZC A;  4E47 A;  2BIV A;  3QJY A;  4RKU E;  5CKD A;  2GGR A;  3M58 A;  8ATC B;  2X9H A;  3VS7 A;  5GAN 2;  3VKI A;  5LJ3 f;  3WVE B;  4ELY C;  2SRC A;  2EYX A;  2XMF A;  1JBM A;  4KRT A;  1VYV A;  2LQ8 A;  1SRM A;  4M7D G;  2NUP A;  2QDY B;  4Y92 A;  2B86 A;  1PD1 A;  5KYU B;  1SHF A;  3OYE A;  3CD6 A;  5CQY A;  3OBY A;  2CKK A;  2X4X A;  5LJ5 j;  5KCH A;  5CKH A;  4A4H A;  4EMK C;  2EGA A;  3L2Q A;  2CUB A;  2L3P A;  2RB6 A;  2QGG A;  1TTH B;  5LJ3 h;  2KR3 A;  4OML A;  4JRQ A;  2ED1 A;  3M57 A;  3CC2 A;  4MZP A;  4IIM A;  3M59 A;  4JUV A;  1RI9 A;  4OMN A;  4RUG A;  1M3C A;  2KYM A;  4LN2 A;  5HY6 A;  1Q81 R;  2LQK A;  3G1J A;  2EGE A;  3RBB B;  5CO7 A;  4C8Q A;  1VQ4 Q;  1TUG B;  4C92 D;  3HRT A;  3EHR A;  4J6X A;  1Y07 A;  2LNV A;  3MET A;  2EYQ A;  1AEY A;  3SB2 A;  5GAN e;  3MEV A;  3OYF A;  1BI2 A;  1FMV A;  5CKE A;  3CC7 A;  3OYG A;  3PTA A;  4LD9 K;  2PVO B;  2ECZ A;  2O4X B;  4PL6 A;  3CCR Q;  4FSS A;  4DOW A;  4M7A E;  2DLP A;  3ZFJ A;  1RAE B;  2CDT A;  1PNJ A;  4BI4 A;  3I56 Q;  3OYC A;  3LWH A;  2CZ6 B;  4OMP A;  3JCM c;  2YXY A;  1EZZ B;  4C92 G;  4KUI A;  4O5V A;  3VRY A;  4C5I A;  3OS2 A;  1NG2 A;  1K9M U;  5GJW B;  1AT1 B;  2ROT A;  1ZLM A;  5KE3 A;  1E7O A;  3RNJ A;  5LJ5 f;  2QEX A;  1KQS A;  2XDP A;  1MNE A;  3HL8 A;  1RI0 A;  3LH0 A;  1BIB A;  3TVT A;  1G83 A;  3FJP A;  1QQJ A;  5GAO q;  1YJ9 Q;  2IG0 A;  3BW1 A;  2RI5 A;  4FIB A;  2XIC A;  3SD4 A;  3M0U A;  5GAO n;  2P4R A;  2COY A;  4C5G A;  5FRM A;  4FYW B;  2WSE E;  4M77 F;  4F7U E;  3OSV A;  5DM7 R;  2ED0 A;  2PUK B;  2DET A;  3CME Q;  5D7U A;  1B07 A;  4GY5 A;  3R6N A;  2YLC A;  3D7S B;  5FU6 C;  3EG0 A;  3C4S A;  2CT3 A;  1ZSZ C;  6AT1 B;  1M30 A;  4M4Z A;  4EMK A;  3THK A;  1VQM Q;  4MML A;  2L3Q A;  1KFZ A;  1MND A;  5HKC A;  1RAF B;  4HVV A;  2RJE A;  2RJC A;  4IUP A;  1W4S A;  4A53 A;  3OYN A;  2EYY A;  1TSF A;  5CVI A;  4BDY A;  1VQK Q;  2KBT A;  1VQ4 A;  3EG2 A;  1MV0 B;  2G3R A;  1MGQ A;  1LNX A;  4PJM A;  5GAN j;  1V1C A;  3CCL Q;  3QSU A;  3JCM f;  1OX9 A;  3CCJ Q;  4ATO A;  3CMA T;  2C06 A;  1JB0 E;  3OW2 S;  1WHH A;  1TUC A;  4HCK A;  2LX7 A;  2AZV A;  2LCL A;  1U5S A;  3VS6 A;  3KBG A;  2YHT A;  2LT1 A;  2DBK A;  2F2W A;  4IIO A;  2NUP B;  3OSS C;  1OI1 A;  3JCM h;  3PMI A;  1N9R A;  2DTO A;  2WSC E;  4LE9 A;  2I0N A;  3OMC A;  3ZBD A;  3HKS A;  3ME9 A;  2QQA A;  1WX6 A;  2DF6 A;  1JJ2 P;  2K3X A;  2KNB B;  4PJO F;  1QP2 A;  4D6W A;  1YI2 T;  3M4G A;  2R5A A;  5CKF A;  1QWF A;  3RER A;  2JZ2 A;  3H0I A;  2KK4 A;  2VGM A;  2DNU A;  3G71 Q;  1UUE A;  5GMK j;  1YJ9 A;  1GL5 A;  1I4K 1;  3X28 B;  5GJV B;  1K9M R;  1K0S A;  3CCQ Q;  3M4Y A;  1YIT T;  5LJ3 g;  3CPW S;  5GAN f;  3OS0 A;  2J06 A;  2KAF A;  3PT9 A;  2ZPI B;  1UFF A;  5FU7 C;  3CME A;  1VQL T;  3QG1 A;  1M5Q 1;  3A8G B;  2EQK A;  3SDZ A;  2RM4 A;  1D1C A;  2LJ0 A;  5CCA A;  5CIU A;  5J26 A;  5I11 A;  1BCO A;  2SEM A;  1YHQ Q;  1ZSZ A;  3PVL A;  3ASK A;  4HVW A;  2PTK A;  3FLG A;  1UG1 A;  5FWC A;  4D8K A;  1G3T A;  3SEM A;  4XTY A;  3G4S Q;  4LDU A;  4QQ6 A;  4E6R A;  1KIK A;  2OTL T;  3V7C A;  4C92 A;  4KGX B;  2DL7 A;  2BUD A;  3A5Z B;  4WCI A;  1OU8 A;  3VYG A;  2D0Q B;  1D3B B;  2DER A;  1WXT A;  1VQK A;  3HHT B;  2HD0 A;  1PKT A;  2V1Q A;  4JJD A;  3PVQ A;  3CCL A;  2DEQ A;  3GPL A;  2K57 A;  4A4K A;  3CCJ A;  3HPW A;  1QWE A;  2ZZD A;  4ZNX A;  4E7Z A;  3JB9 D;  1I0C A;  1S72 T;  4FT4 A;  3JB9 J;  1SSF A;  4Z02 A;  4X9D A;  4CRI A;  1WNL A;  2EJ9 A;  5GAO r;  3UWN A;  2A28 A;  4C8Q D;  1KQS S;  4QQG A;  4FYX B;  5A0G A;  5KYW B;  1MHN A;  1RAH B;  2EAY A;  2EQM A;  3BY7 A;  2HZY A;  3NPF A;  3TSZ A;  1VQ6 Q;  3NFC A;  5C0M A;  4RTU A;  2BTT A;  5KYU A;  1K73 C;  1UE9 A;  5LJ5 g;  5DLO A;  3C0C A;  4DBF A;  1H3Z A;  4JPB W;  3JB9 G;  2CP0 A;  1D0X A;  4FW2 A;  2XU8 A;  4M77 C;  3MKD A;  1GBQ A;  4Q5W A;  1QVP A;  4M77 E;  5ECA A;  1B3Q A;  1KK7 A;  3M9Q A;  1IGU A;  4C8Q G;  1NYG A;  1KD1 R;  3CCU Q;  4M75 E;  1HJD A;  3G71 A;  5LL6 S;  3JV3 A;  4M78 F;  2QI2 A;  1OEB A;  1FXX A;  2RI3 A;  3QZ5 B;  1I81 A;  2DYI A;  4OMF B;  5IN1 A;  3I5S A;  2KSS A;  1JXO A;  3CCQ A;  2L5Q A;  3VS4 A;  4E7K A;  3PMT A;  1M4Z A;  2GTJ A;  3EHQ A;  2GTO A;  2D9T A;  2MI6 A;  1FYN A;  1VQP A;  5CAI A;  5FRN A;  2JMA A;  4E7I A;  4M7A B;  1W2B P;  2KI7 A;  2O4X A;  2GCX A;  1C6V X;  3CCE Q;  2RJD A;  5L8R E;  1YIJ Q;  1UB4 A;  1O75 A;  4AMC A;  3HSB A;  3TSW A;  4CC2 A;  5GAN 3;  1YHQ A;  3CC2 T;  3DLM A;  2HDA A;  1NPR A;  2QQB A;  2ATC B;  4HCB A;  2PZ1 A;  3S3M A;  1M3B A;  3RMS A;  4M7D F;  2GFU A;  2L0A A;  2X3X D;  5KYY B;  1HK9 A;  3G4S A;  3NHN A;  4OB3 B;  2YUQ A;  1EX4 A;  1JEG A;  1XNI A;  3LH5 A;  2DIL A;  5IHI A;  1WHM A;  4F7U F;  3LWI A;  1TG0 A;  1D1A A;  2WAC A;  3BE3 A;  1UEC A;  4RTW A;  5HK0 A;  3G6E T;  2ZGW A;  5KYN A;  3CC7 T;  3N5B B;  1YWO A;  3H9N A;  4AG2 C;  2K6D A;  1PSE A;  3JCM g;  4FCY A;  5GAM d;  1U06 A;  5GAM e;  1K73 U;  2XDB A;  2MAM A;  2K2V A;  2EVR A;  5L23 A;  4J9I A;  3M5A A;  4J9D A;  2QK0 A;  2R57 A;  3VS5 A;  2DXC A;  4X9C A;  2M51 A;  2QA4 Q;  1BI0 A;  3AT1 B;  4CC3 A;  4RTV A;  3ULR B;  4PLL A;  3SHW A;  4PJO E;  1M8V A;  4YTL A;  2RQW A;  2QEX T;  4XAX B;  1OZ3 A;  4J9C A;  3G7Z A;  1KHC A;  1VQ8 Q;  1LOJ A;  1RLP C;  2F5T X;  2DTH A;  4DBR A;  2QG9 B;  1X69 A;  2K5I A;  2VVK A;  4NS5 A;  1ZSZ B;  1QVF P;  2FZG B;  2LRQ A;  2EFI A;  3QWX X;  2W10 A;  1OUL A;  2DJQ A;  5A0L A;  2KQW A;  2MWP A;  1VQ9 T;  5GAO l;  4RG8 A;  3OW2 A;  4FSX A;  1JXM A;  2YUO A;  2E4H A;  1XJW B;  4JZ3 A;  1CKB A;  3QXE B;  1NZ9 A;  5DLQ E;  3FC3 A;  1X2Q A;  2J05 A;  1G3Y A;  4UC4 A;  3EH2 A;  3PFS A;  4CI0 C;  2P0Q A;  1R0B G;  3CCU A;  3LYI A;  4KH1 B;  2DL4 A;  1QVG P;  2ZPG B;  4IUV A;  2RHY A;  2YRC A;  2KE9 A;  2X4Y A;  4ANJ A;  5GAN g;  1VYU A;  2DIG A;  2DIQ A;  3JCM Q;  1BCM A;  1IRX A;  1PRL C;  4E7L A;  2QQR A;  3X25 B;  1JRI A;  3QDF A;  4FT2 A;  1RAC B;  4JRK A;  4F16 A;  2X4W A;  2FPD A;  2DRK A;  3CCE A;  3ER0 A;  3ZL7 C;  3CCM Q;  1YIJ A;  3EFO B;  1WFW A;  2K9G A;  1UTI A;  2OJ2 A;  2MIO A;  1M27 C;  4J7F A;  4Z89 A;  5IHN A;  2RHI A;  3S3O A;  1WHK A;  3CPW A;  4J9B A;  2HNI A;  2LT4 A;  3GNG A;  4EPC A;  4GLM A;  4HT9 A;  3INZ A;  4DEX A;  2DMO A;  2OX7 A;  1M2V A;  5GAM j;  4ZGE B;  1K1Z A;  1VIE A;  2ZPH B;  2YSQ A;  3RDV A;  1JU5 C;  3L42 A;  2VKN A;  4IKF A;  1YNZ A;  2FG0 A;  2JT4 A;  3LW5 E;  3GP8 A;  4IUU A;  4VUB A;  2QYZ A;  4Z8A A;  1N9S A;  3OYD A;  1AVZ C;  2X51 A;  5FU7 B;  1JO8 A;  4M7A C;  1K73 R;  1UJY A;  1WIE A;  2XKO C;  3QUI A;  2AZS A;  2YWW A;  2G6F X;  1Y7X A;  3DB4 A;  2L89 A;  4JJN K;  1PRM C;  4M78 C;  3JCM b;  1WQW A;  3I5R A;  4HVU A;  4M78 E;  3X24 B;  3HFO A;  2BE9 B;  1LJO A;  1Q82 C;  2LVM A;  2LQW A;  2KRN A;  1ZUU A;  1M1K C;  1VQN Q;  2QTX A;  2DE0 X;  1X75 C;  1QKX A;  3OB9 A;  4FYY B;  2K3Y A;  1VQ5 A;  1WXB A;  4XU0 A;  2EQU A;  1D3B A;  4HKE A;  2E1H A;  4A63 B;  3C12 A;  1R0C B;  4HCZ A;  1ZX6 A;  5M9O A;  1DJ7 B;  2P84 A;  4MZM A;  2F2V A;  3H0F A;  4M7D E;  2L8D A;  4OMM A;  1PC0 A;  5GMK e;  2DVJ A;  1SHG A;  1SKU B;  2M02 A;  1AWW A;  1M8M A;  1E6G A;  3NTH A;  5LJ5 h;  4HCC A;  4ZN3 A;  3TRE A;  4JLG A;  3J81 E;  2AIR B;  2DD5 A;  3CCM A;  4KH0 B;  1B34 B;  1N6A A;  3CBO A;  3GF5 A;  1NEB A;  1N5Z A;  3CBP A;  1TXQ A;  4M75 F;  1TWB A;  4DQ2 A;  5KYW A;  3LLR A;  1NE8 A;  4XTZ A;  1MMG A;  4KGZ B;  3GIB A;  1IHV A;  1ZUY A;  1GBR A;  4FYV B;  4OMO A;  2ROL A;  4NOY A;  3RKX A;  2O9S A;  3CCJ T;  4M77 B;  3CBM A;  5FRO A;  3PGG A;  2EPD A;  4OB1 B;  4BB7 A;  3Q1J A;  3CCV Q;  4FM4 B;  2D1X A;  2LQN A;  2H3E B;  4J9E A;  3MEW A;  4IUT A;  3REB B;  1T3S A;  2E65 A;  2B8A A;  2KRO A;  2VXF A;  2ZPF B;  5KYX B;  3M56 A;  2AKK A;  3OYI A;  4AFS C;  2CP6 A;  1JQQ A;  3JCM X;  5IH2 A;  1Q82 U;  2RJF A;  2HQE A;  2COZ A;  2P0P A;  2JN0 A;  4Z88 A;  1M1K U;  5HCK A;  5GAN 7;  2HKQ B;  1QKW A;  2LCS A;  4BE0 A;  4C92 E;  2LMJ A;  2RO0 A;  2EJG A;  3HRS A;  4AFU C;  3QBY A;  2VUB A;  4ZTF A;  4M7A A;  4FL6 A;  4A4G A;  1KQS P;  1X6O A;  3CCR A;  2OTJ T;  4MDX A;  1RAB B;  1H92 A;  4DBH A;  2H8H A;  1K4U S;  2RHZ A;  4OGE A;  3QYG B;  3I56 A;  4PJN A;  4BE1 A;  4OB0 B;  3NMZ C;  2NUZ A;  3FDR A;  1N8R C;  4B9X A;  3L2R A;  2E5Q A;  3OYM A;  3G71 T;  1V76 A;  3CC4 Q;  3A8H B;  1VQN A;  3SFM A;  2JTE A;  5KYY A;  2QAZ A;  1Z9Q A;  1AZG B;  4FW1 A;  3GBQ A;  1X6G A;  4NL3 A;  4F17 A;  3JB9 F;  3MO8 A;  1LPL A;  3OYY A;  4RMO A;  1VQP T;  1UHC A;  3H8Z A;  4FU6 A;  1M2V B;  4E2F B;  1CSK A;  5I2S A;  3HRU A;  4C8Q F;  3A8O B;  3CMA Q;  2DL3 A;  4BI3 A;  1RAD B;  2VYT A;  4M77 D;  1WHL A;  2JXB A;  1YHQ T;  1M2O A;  1V29 B;  2LZ6 B;  2BKD N;  2EQJ A;  4RCB A;  2EGC A;  1IGQ A;  1QCF A;  4J6Y A;  4R56 A;  3VYH B;  5CR2 A;  4F7U A;  1M1G A;  4PK4 A;  5CQX A;  4PJO B;  2CGH A;  4R55 A;  2LJ3 A;  2KYB A;  4X34 A;  4CC4 B;  2CH4 A;  4EMH A;  1ZSG A;  2D8H A;  3OYL A;  4LD6 A;  1Q86 C;  3R6O A;  4E7J A;  2RNA A;  4XTV A;  1ARK A;  2YRD A;  2Z0W A;  4M77 G;  3VS2 A;  2RK2 A;  4A54 A;  1YI2 Q;  5D6W A;  2CS7 A;  3SWN C;  2A0F B;  1VQM A;  1VQ7 Q;  1PWT A;  4OVA A;  5GAN h;  3HP9 A;  2NUT A;  4JDS A;  1FWZ A;  4AT1 B;  2MOX A;  2VB6 A;  3CCS Q;  3CEY A;  2A08 A;  2P0K A;  2JTF A;  3CCV A;  1NEG A;  2RMO A;  1M9S A;  1YN8 A;  3JB9 H;  5I21 A;  1YJW T;  2K3B A;  4C0Z A;  4KBM B;  1YCS B;  4Y91 A;  3EGD A;  2LC4 A;  1BI1 A;  3VUB A;  4BI8 B;  1N8R U;  1BU1 A;  4XTX A;  4KUL A;  1G3S A;  3OYB A;  2ZPB B;  2O88 A;  1SPK A;  1I8F A;  1ZUK A;  1VQL Q;  4OP0 A;  2EW3 A;  2XI9 A;  1HD3 A;  3RKW A;  1RAI B;  3M0P A;  1W2B A;  1ZA2 B;  4ZTJ A;  1WJR A;  2K5F A;  1BYM A;  1ABQ A;  3CXC A;  4PFO A;  4E7H A;  2QAS A;  2BZY A;  1YJN T;  1U3O A;  1Q82 R;  3KXT A;  1YP5 A;  2KVQ G;  3EFO A;  1OX8 A;  1M1K R;  1PSF A;  3OYJ A;  4E7S A;  3HTR A;  2DBM A;  2OTL Q;  3CC4 A;  1Q81 C;  5GMK h;  2E10 A;  2FVU A;  2DPP B;  2AK5 A;  1YBY A;  1WPY A;  1R8O B;  5LJ3 d;  1RAA B;  4XTW A;  1LVK A;  2E5K A;  3V8J A;  2L3S A;  3MEU A;  3I55 T;  2RN8 A;  5J3B A;  3JB9 I;  2YRV A;  1FMK A;  1UGS B;  4QT7 A;  1OPK A;  2DAQ A;  4M75 C;  1Q86 U;  3M55 A;  3RUX A;  2K2M A;  3CMA A;  2E41 A;  2HBP A;  4P5N A;  1F1B B;  3JRZ A;  3M0R A;  1YIJ T;  1S72 Q;  2O2O A;  1UGQ B;  4L59 A;  1K8A C;  2JNG A;  2C0T A;  5HK3 A;  1KHI A;  3MPU B;  4R0K A;  2D0N A;  1GRI A;  1I5L A;  1GFD A;  3QKJ A;  1TOV A;  4N4I A;  2L2P A;  4X1V A;  3CD6 T;  1U8R A;  1T3L A;  1AWJ A;  1IB8 A;  2I2L A;  1H8K A;  2KRS A;  1W6X A;  1QMC A;  2DRM A;  2E3H A;  2RQR A;  3MP8 A;  5AYF A;  4M78 B;  3LGF A;  5KE2 A;  4HXJ A;  3RES A;  2MMP A;  1YI2 A;  4ESR A;  1VQ7 A;  3UF4 A;  4WTO B;  4QKU A;  4QVC A;  4PJL A;  4LDW A;  1VYT A;  3V8L A;  3CCS A;  2JS0 A;  1OQK A;  2RQU A;  2BE7 D;  2VV5 A;  5J39 A;  1YCY A;  1RL2 A;  2FRW A;  1KQ2 A;  5I2M A;  3UPU A;  2J6O A;  2FB7 A;  2ZCF B;  2JMC A;  2LTO A;  2YLB A;  1GCQ C;  2CZ1 B;  1ZQ1 A;  8AT1 B;  4RTT A;  1Q81 U;  1AD5 A;  4M7D B;  1NBE B;  2K5L A;  1SG5 A;  5LJ5 d;  5CK9 A;  2DEU A;  2JOY A;  2DVE A;  3EGU A;  1QCN A;  4F7U B;  2HQH A;  3AHU A;  4KUD K;  3QWY A;  4JS5 A;  2LJ1 A;  3C95 A;  1WI7 A;  2ZPE B;  4PJO C;  4V2S A;  1P92 A;  2EKO A;  1RUW A;  4XK8 E;  1N8R R;  1B34 A;  2AHJ B;  2VC8 A;  5A2Q E;  2GBQ A;  4LDY A;  2CRE A;  3BDU A;  4EMG A;  1K8A U;  1VQ5 T;  3A98 A;  2CP2 A;  3T9N A;  2W0Z A;  4NL2 A;  1KJW A;  2OTL A;  1BIA A;  1MMD A;  2CP5 A;  2DKG A;  1VQ6 A;  3FB9 A;  4C8Q E;  1BI3 A;  1XOV A;  3NTK A;  1YFN A;  4JRP A;  4ZGD B;  5LJ3 j;  5GAN 6;  4M7A D;  3G6E Q;  2V26 A;  4PJJ A;  4C92 F;  5GAO m;  3QZ9 B;  4N4G A;  2NUT B;  2LP5 A;  1YWP A;  4M77 A;  2NYS A;  1Y71 A;  3V8K A;  4M78 D;  2ENM A;  5I22 A;  2HSP A;  3OY9 A;  4PFP A;  4M75 A;  5DY9 A;  2CP7 A;  3EGD B;  5C6S A;  2BZX A;  2RHU A;  1S72 A;  1MMA A;  2DL8 A;  3A1P A;  5KYX A;  4O6J A;  5GMK i;  4BDZ A;  2F1L A;  2EWN A;  2RQV A;  3FRN A;  5D6X A;  3VS1 A;  4M7A G;  1WA7 A;  2J6K A;  4MZT A;  2Y90 A;  2HSE B;  2Y4X A;  2QQS A;  2QEX Q;  2JTM A;  1Q86 R;  1LCK A;  4M78 G;  3VS3 A;  4KGV B;  1WZO A;  1QCO A;  1QW1 A;  4QVZ A;  2RQT A;  3TQ7 P;  2XDD A;  3JCM d;  3X20 B;  3JCM e;  1VQO Q;  4BD3 A;  1VQ9 Q;  3DLL A;  2CYZ B;  4J6W A;  4DOV A;  5IT9 E;  1Q7Y C;  1IRE B;  2ABL A;  2J7I A;  5EC7 A;  1UGV A;  1VQ4 T;  2IPO B;  3I35 A;  3OS5 A;  3L2V A;  2V8I A;  7AT1 B;  3M0T A;  3CQT A;  2A37 A;  2CT4 A;  1VIF A;  1W2B S;  3A8L B;  2HEQ A;  3QJ6 A;  3CXC S;  1M90 C;  1GCQ A;  4C5H A;  2EYW A;  4DEY A;  3EG9 B;  3CCR T;  3JSC A;  2EKH A;  2AKL A;  4F7U G;  2DXU A;  3C94 A;  4RTX A;  3I56 T;  2FL7 A;  4BAC A;  1K9A A;  4KT0 E;  2R5M A;  1C0M A;  3OW2 P;  3QYH B;  4RTZ A;  1WLP B;  2QA4 A;  1VQN T;  4PJO A;  1IHW A;  2RF0 A;  4QVD A;  2V8J A;  4AFQ C;  2CP3 A;  3MP1 A;  2K4Y A;  1VQ8 A;  2O31 A;  1Y0M A;  3MEA A;  3GLX A;  3RMQ A;  4AG1 C;  4XU1 A;  5GAN d;  4JZ4 A;  3L2Z A;  2QXF A;  3SWN B;  3G6E A;  1W70 A;  2RH2 A;  9ATC B;  1YJ9 T;  1NLO C;  2R58 A;  2LNH B;  1D1B A;  3M0S A;  3VJP A;  2VAS A;  1K8A R;  1O9S A;  4RG2 A;  4B9W A;  4J9H A;  5A0D A;  2A3L A;  1OYX A;  3UA7 A;  2HCK A;  4GLK A;  4LDX A;  2FEI A;  2AT1 B;  2GNC A;  3PIO A;  3CME T;  1T0H A;  4TVR A;  1Q7Y U;  1QVF S;  1KSW A;  5GAM f;  4M7D C;  4K11 A;  1X43 A;  3FEO A;  4F14 A;  3P8H A;  3CPW P;  1TU0 B;  3EG3 A;  3OYH A;  2YDL A;  3RIR A;  1VQM T;  1GXI E;  1KC8 C;  2JUF A;  1OPL A;  1AWX A;  5GAN 5;  3DB3 A;  1M90 U;  2D6F A;  4DBQ A;  3MCA B;  5FW9 A;  4MDW A;  1UGR B;  2X4J A;  4N0A C;  3CCV T;  1VQO A;  1VQ9 A;  5FLX E;  1M1F A;  5GAM h;  1QVG S;  3TEE A;  1KD1 C;  1WHJ A;  4J5Y A;  2E6Z A;  1Z9Z A;  1G5V A;  2MYS A;  2IIM A;  3KUF A;  1VQK T;  2EBP A;  1JJ2 A;  3E1S A;  4JS4 A;  2XD0 A;  3CCL T;  3EH1 A;  1WDX A;  2Y4Y A;  3TU4 K;  2O01 E;  1UHF A;  2LDM A;  3OYK A;  2K7A A;  5IXF A;  1TUD A;  4M75 B;  2YT6 A;  3JCM W;  2DTI A;  3MP6 A;  1GCP A;  5IAY A;  1CKA A;  1Y96 B;  2LCC A;  1MUZ A;  3PE0 A;  2DL5 A;  3O8V A;  1NYF A;  2EQI A;  4OMQ A;  2A7Y A;  3CC4 T;  4C92 C;  2QQ9 A;  3U23 A;  1WYX A;  2PVD B;  2QGF B;  4ME7 A;  2L3R A;  4J8O A;  3GNF B;  4BY6 C;  2HKN A;  2COW A;  1I07 A;  3H41 A;  2PNI A;  1Y57 A;  1C1A A;  3E9F A;  3E9G A;  4M78 A;  5GAN 4;  3EFR A;  4QQD A;  2C0I A;  5FWB A;  4C0D B;  1WJQ A;  4AFZ C;  2JW4 A;  2RPN A;  3JCM P;  2EIF A;  2DYB A;  1U1T A;  3L1A A;  3QHS A;  2KT8 A;  1UGP B;  2A36 A;  3OA6 A;  4RCC A;  1HXD A;  2RD1 A;  4JJC A;  1KC8 U;  3HFN A;  3CCQ T;  1PHT A;  2RHX A;  3TCJ A;  2M1H A;  3OQ5 A;  2OI3 A;  2M0O A;  2E12 A;  1KD1 U;  4A4F A;  1GFC A;  1H64 1;  1NJI C;  1WXU A;  3RKY A;  2ESW A;  4PLI A;  4M7D A;  2OAU A;  2KMT A;  2X3W D;  4BE2 A;  2NLU A;  1WHG A;  1ZBX A;  2CZ7 B;  3BFM A;  4LNP A;  2IVW A;  2OTJ Q;  1G2B A;  3P8D A;  4M75 D;  1VQ7 T;  1OU9 A;  3OS1 A;  3QDR B;  3RR6 A;  3G4S T;  3EAE A;  2P4T A;  2EYZ A;  2M9U A;  3CCS T;  4N0A A;  1Q7Y R;  2X35 A;  1PM3 A;  1R77 A;  3H0H A;  4BUG A;  2KY9 A;  4C8Q B;  3X26 B;  4J7I A;  3FJ5 A;  4GBQ A;  1U1S A;  5IXB A;  1M3A A;  1H3H A;  1HYO A;  2V1R A;  1WQ7 A;  2DZ9 A;  2DXB A;  2F2X A;  1J3T A;  2NWM A;  1VQP Q;  2C0O A;  4LUD A;  1M90 R;  1G3W A;  2PQW A;  4M75 G;  1VUB A;  1E6H A;  2FPE A;  2DFU A;  2HL3 A;  3A8M B;  3URG A;  1KG1 A;  4C0G A;  4L5G A;  4HA8 A;  5AT1 B;  4XQ3 A;  3OMG A;  1MV3 A;  1ACM B;  3NGP A;  1VA7 A;  1YIT Q;  2RI2 A;  1D09 B;  3OBW A;  1WGS A;  4ZGJ B;  1PCX A;  3L2W A;  1VQ6 T;  2CUD A;  3GOX A;  3M53 A;  2CH4 W;  1IO6 A;  1SF9 A;  1FMW A;  4ELZ C;  3CPF A;  4PFZ A;  2GF7 A;  3WXM B;  2M16 A;  4ZN1 A;  1TS9 A;  2WSF E;  2K79 A;  2VGN A;  3E19 A;  3EGX A;  4IUR A;  4RTY A;  1NJI U;  3JAM E;  2D8J A;  3J7A F;  2E70 A;  2PUO B;  3LGL A;  3CCU T;  2MPX C;  2FHD A;  2E3I A;  2DXT A;  2QDL A;  4II1 A;  4PJO D;  2ZAE A;  3V7S A;  3PNW C;  2E64 A;  3EFS A;  2JM9 A;  2RK1 A;  1YJW Q;  2DX1 A;  2M0Y A;  4MMK A;  1AZE A;  5LJ3 e;  2JVV A;  1OV3 A;  1I1J A;  2GQI A;  4C0F A;  3DKM A;  5GAM g;  2FZC B;  1AHJ B;  1BKB A;  3JCM V;  4OB2 B;  5GMK m;  2MWO A;  1UDL A;  4CC7 A;  1VOM A;  5GMK l;  3EG9 A;  3CCE T;  1IXD A;  4EMK B;  3VS0 A;  3PIP A;  1K0X A;  2XG8 D;  1KC8 R;  4PJO G;  2OTJ A;  2KGT A;  4C5E A;  2QTV A;  2DO3 A;  1MMN A;  1G8X A;  1YJN Q;  2V8K A;  2DJZ A;  2KXC A;  4JLI A;  2FPF A;  1NPP A;  3LX7 A;  2KDS A;  3IQL A;  1JJ2 S;  4M7A F;  2DD4 A;  1BB9 A;  4QW2 A;  4XU3 A;  2JJ9 A;  3M54 A;  1Q95 G;  2GFA A;  3M0Q A;  1PG5 B;  5GAN 8;  3S3N A;  3VUZ A;  2CZ0 B;  1N27 A;  4ORZ A;  1K76 A;  1OZ2 A;  1EFN A;  1QVF A;  1HSQ A;  3JCM J;  2MK5 A;  3EG1 A;  1NM7 A;  3O5Z A;  4PKC C;  1S1N A;  2H3J A;  3H6Z A;  4C0D C;  2BZ8 A;  3I55 Q;  4B6M A;  3SWN A;  1SRL A;  2RA2 A;  2OAW A;  2MF2 A;  2KRM A;  2YUP A;  1T0J A;  2PU9 B;  1FX7 A;  2FRY A;  3CXC P;  3UT1 A;  1SEM A;  2DK3 A;  1RAG B;  3MHX A;  2QA4 T;  3REA B;  1XTD A;  2CSQ A;  2MCN A;  1QVG A;  1BBZ A;  2EJF A;  2LX9 A;  1RLQ C;  4EDU A;  2XID A;  3UDC A;  1YIT A;  3QII A;  1UJ0 A;  3KFV A;  1I5O B;  3CD6 Q;  1EIF A;  1VQ8 T;  3OYA A;  1PKS A;  1VQL A;  2KEA A;  3F70 A;  5LJ5 e;  1D0Y A;  4XTU A;  1UEB A;  1PD0 A;  2DM1 A;  3CC2 Q;  3V7R A; 
#chains in the Genus database with same CATH homology
 1M1K U;  5EG2 A;  5GAN 7;  2QA4 A;  1VQN T;  2PVG B;  4PJO A;  4WF2 A;  3CCL A;  2DEQ A;  3GPL A;  2XK0 A;  4QVD A;  3FIF A;  2K57 A;  2V8J A;  4A4K A;  4C92 E;  3CCJ A;  3HPW A;  3L2U A;  4BE0 A;  2HAX A;  2RO0 A;  4LDV A;  2ZZD A;  2EJG A;  5KH6 A;  1QP3 A;  3JB9 D;  3HRS A;  5D6Y A;  3BDL A;  3MP1 A;  3QBY A;  4C8Q C;  2K4Y A;  2VUB A;  4ZTF A;  1S72 T;  4FL6 A;  4FT4 A;  4A4G A;  4M7A A;  3JB9 J;  1X6O A;  3CCR A;  1SSF A;  4MDX A;  2OTJ T;  4JRI A;  1VQ8 A;  4Z02 A;  3MEA A;  2RHZ A;  4OGE A;  3QYG B;  3GLX A;  4X9D A;  3RMQ A;  4A4E A;  1IZ6 A;  4CRI A;  3I56 A;  1YJW A;  4XU1 A;  1WNL A;  4Y28 E;  5GAN d;  4BE1 A;  2EJ9 A;  5GAO r;  4OB0 B;  3L2Z A;  2QXF A;  3UWN A;  4C8Q D;  3SWN B;  4DA4 A;  1X01 A;  3G6E A;  1KQS S;  4QQG A;  5A0G A;  3FDR A;  2RH2 A;  1MHN A;  1N8R C;  4B9X A;  3L2R A;  2E5Q A;  1YJ9 T;  5FU6 B;  3OYM A;  3G71 T;  2R58 A;  3VU3 C;  2EAY A;  2EQM A;  3A8H B;  3BY7 A;  3P8B B;  1VQN A;  3SFM A;  3NFC A;  4J83 A;  3VJP A;  2XHC A;  5C0M A;  1K73 C;  4N4H A;  1O9S A;  5LJ5 g;  4RG2 A;  4B9W A;  4IUQ A;  5A0D A;  5DLO A;  2A3L A;  1OYX A;  4NL3 A;  1H3Z A;  4GLK A;  3JB9 F;  1KQ1 A;  3MO8 A;  4LDX A;  3JB9 G;  3CCM T;  3OYY A;  1Y96 A;  4RMO A;  2F69 A;  3V7R A;  2XU8 A;  1VQP T;  1VQO T;  2GQV A;  3H8Z A;  4FU6 A;  4M77 C;  3QPH A;  3PIO A;  3CME T;  5I2S A;  1YJN A;  4Q5W A;  1QVP A;  3HRU A;  4M77 E;  4TVR A;  1ZHI A;  4OGC A;  1Q7Y U;  4C92 B;  1QVF S;  3M9Q A;  5GAM f;  4C8Q F;  4M7D C;  1TH7 A;  5GAO p;  3A8O B;  4OF1 A;  3ZEH A;  4C8Q G;  3FEO A;  3QO3 A;  3P8H A;  4BI3 A;  4BY6 B;  4M75 E;  2VYT A;  3G71 A;  1WJS A;  4M77 D;  5LL6 S;  4M78 F;  2QI2 A;  3VV0 A;  1YHQ T;  1V29 B;  2BKD N;  2EQJ A;  4RCB A;  1FXX A;  2RI3 A;  3QZ5 B;  1I81 A;  4J6Y A;  3RIR A;  4R56 A;  2F5K A;  3OYH A;  1VQM T;  1KC8 C;  2JUF A;  3VYH B;  4M7D D;  4OMF B;  5IN1 A;  5CR2 A;  4F7U A;  2KSS A;  1M1G A;  3CCQ A;  2L5Q A;  5CQX A;  4XU2 A;  2VXE A;  5GAN 5;  3PMT A;  2E6N A;  1M4Z A;  3DB3 A;  4E7K A;  1M90 U;  3WVD B;  2D6F A;  4PJO B;  1XQH A;  3MCA B;  2MI6 A;  2D9T A;  4HT8 A;  4L6V 5;  2CGH A;  4MDW A;  2FYK A;  5KCO A;  4R55 A;  1UGR B;  2X4J A;  4N0A C;  5CKB A;  5CAI A;  3CCV T;  1VQO A;  1VQP A;  1VQ9 A;  5FRN A;  4PNO A;  3S6W A;  5FLX E;  1M1F A;  4X34 A;  5GAM h;  3J80 E;  3TEE A;  3I55 A;  4E7I A;  3NTI A;  1QVG S;  4M7A B;  2HQX A;  4EMH A;  1KD1 C;  4J5Y A;  3OYL A;  2O4X A;  2E6Z A;  2GCX A;  1K9M C;  4LD6 A;  2DZC A;  1Q86 C;  3R6O A;  4E47 A;  4E7J A;  1G5V A;  2BIV A;  2RJD A;  4XTV A;  5L8R E;  3QJY A;  3KUF A;  1VQK T;  1JJ2 A;  4RKU E;  3E1S A;  1UB4 A;  5CKD A;  1O75 A;  4JS4 A;  3M58 A;  5GAN 2;  3HSB A;  4M77 G;  5GAN 3;  3VKI A;  1YHQ A;  3CC2 T;  3DLM A;  5LJ3 f;  3WVE B;  2RK2 A;  4A54 A;  4ELY C;  5D6W A;  3CCL T;  2XD0 A;  1NPR A;  2QQB A;  2CS7 A;  3SWN C;  1JBM A;  1VQM A;  4HCB A;  3S3M A;  3RMS A;  5GAN h;  2LQ8 A;  4OVA A;  4M7D F;  4M7D G;  2QDY B;  3HP9 A;  2GFU A;  2Y4Y A;  4JDS A;  1FWZ A;  3TU4 K;  1HK9 A;  2O01 E;  3G4S A;  3OYK A;  2LDM A;  2HD0 A;  4OB3 B;  3OYE A;  3CEY A;  4M75 B;  2P0K A;  3CD6 A;  2JTF A;  3CCV A;  1XNI A;  3JCM W;  2DTI A;  3OBY A;  5CQY A;  1M9S A;  2CKK A;  2X4X A;  3MP6 A;  5LJ5 j;  3JB9 H;  4F7U F;  5KCH A;  5CKH A;  3LWI A;  5IAY A;  1Y96 B;  4A4H A;  4EMK C;  5I21 A;  3L2Q A;  2WAC A;  4C0Z A;  1YJW T;  2LCC A;  2RB6 A;  4KBM B;  4Y91 A;  2LC4 A;  1BI1 A;  3VUB A;  3O8V A;  5HK0 A;  2ZGW A;  3G6E T;  4BI8 B;  1N8R U;  5LJ3 h;  3N5B B;  3CC7 T;  4XTX A;  4KUL A;  1PSE A;  3JCM g;  4JRQ A;  1G3S A;  3M57 A;  2A7Y A;  3CC2 A;  4MZP A;  3CC4 T;  3M59 A;  4C92 C;  2QQ9 A;  4JUV A;  3OYB A;  5GAM d;  2PVD B;  2ZPB B;  1K73 U;  1I8F A;  5GAM e;  2XDB A;  4ME7 A;  2L3R A;  2MAM A;  5HY6 A;  4J8O A;  4OP0 A;  3GNF B;  2XI9 A;  4BY6 C;  3RKW A;  1W2B A;  2LQK A;  2K2V A;  4ZTJ A;  1GXI E;  1WJR A;  2K5F A;  1BYM A;  3M5A A;  2R57 A;  5CO7 A;  4C8Q A;  3CXC A;  2DXC A;  4C92 D;  4E7H A;  3HRT A;  4X9C A;  3E9F A;  4J6X A;  1Y07 A;  1BI0 A;  3E9G A;  2LNV A;  1YJN T;  3MET A;  4M78 A;  2EYQ A;  3KXT A;  5GAN 4;  2KVQ G;  3EFR A;  4PLL A;  4QQD A;  3SB2 A;  5GAN e;  3MEV A;  3OYF A;  4C0D B;  4PJO E;  1WJQ A;  1BI2 A;  1M8V A;  1PSF A;  5CKE A;  3CC7 A;  3OYJ A;  4YTL A;  3OYG A;  3PTA A;  3JCM P;  4LD9 K;  2PVO B;  2EIF A;  2O4X B;  2QEX T;  4PL6 A;  1U1T A;  3CC4 A;  3L1A A;  1OZ3 A;  3QHS A;  4XAX B;  3G7Z A;  1KHC A;  1Q81 C;  1LOJ A;  4DOW A;  2F5T X;  2DTH A;  1UGP B;  5GMK h;  4M7A E;  3OA6 A;  4RCC A;  1HXD A;  2RD1 A;  2K5I A;  3ZFJ A;  4NS5 A;  2E10 A;  2FVU A;  1KC8 U;  3HFN A;  2DPP B;  4BI4 A;  3CCQ T;  1YBY A;  1WPY A;  3OYC A;  1R8O B;  2LRQ A;  2EFI A;  3LWH A;  2CZ6 B;  2RHX A;  3TCJ A;  5LJ3 d;  3JCM c;  2M1H A;  4XTW A;  3OQ5 A;  5A0L A;  2KQW A;  2MWP A;  4C92 G;  1VQ9 T;  4KUI A;  4O5V A;  3V8J A;  4RG8 A;  5GAO l;  3MEU A;  3OW2 A;  3I55 T;  4C5I A;  4FSX A;  5J3B A;  2M0O A;  3JB9 I;  2YRV A;  2E12 A;  3QXE B;  1KD1 U;  1NZ9 A;  4A4F A;  1H64 1;  1UGS B;  5DLQ E;  3FC3 A;  1NJI C;  3OS2 A;  1K9M U;  2DAQ A;  4M75 C;  1Q86 U;  3M55 A;  3RKY A;  4PLI A;  1G3Y A;  3RUX A;  4M7D A;  2OAU A;  4UC4 A;  2KMT A;  5KE3 A;  3CMA A;  2E41 A;  3PFS A;  4CI0 C;  2HBP A;  4BE2 A;  3JRZ A;  2P0Q A;  2NLU A;  4P5N A;  5LJ5 f;  1ZBX A;  2QEX A;  3CCU A;  1UGQ B;  2CZ7 B;  3BFM A;  3LYI A;  4L59 A;  1YIJ T;  1K8A C;  2XDP A;  2IVW A;  1KQS A;  2JNG A;  3HL8 A;  3P8D A;  1KHI A;  5HK3 A;  1I5L A;  1RI0 A;  2ZPG B;  3LH0 A;  4IUV A;  4M75 D;  2RHY A;  1VQ7 T;  2X4Y A;  1BIB A;  3OS1 A;  3FJP A;  3QDR B;  5GAN g;  3G4S T;  3QKJ A;  2DIG A;  3EAE A;  2DIQ A;  2P4T A;  3JCM Q;  4N4I A;  3CD6 T;  2M9U A;  5GAO q;  1U8R A;  2IG0 A;  3CCS T;  2I2L A;  4N0A A;  2X35 A;  3BW1 A;  2RI5 A;  4E7L A;  2QQR A;  4FIB A;  3X25 B;  1JRI A;  2XIC A;  3SD4 A;  4BUG A;  2KY9 A;  4C8Q B;  3X26 B;  4J7I A;  4FT2 A;  5GAO n;  1U1S A;  3MP8 A;  4JRK A;  5AYF A;  2X4W A;  4C5G A;  5FRM A;  3CCE A;  3ER0 A;  1WQ7 A;  4M78 B;  3LGF A;  2DZ9 A;  2WSE E;  2DXB A;  4M77 F;  4F7U E;  5KE2 A;  1YIJ A;  3OSV A;  3RES A;  5DM7 R;  2MMP A;  2PUK B;  1YI2 A;  4GY5 A;  2YLC A;  1G3W A;  1VQ7 A;  2PQW A;  4M75 G;  5FU6 C;  4J7F A;  1VUB A;  3C4S A;  2RHI A;  4QVC A;  4LDW A;  3S3O A;  3V8L A;  3CPW A;  3CCS A;  2HNI A;  3A8M B;  3URG A;  2VV5 A;  1KG1 A;  4C0G A;  2LT4 A;  4L5G A;  5J39 A;  1YCY A;  1RL2 A;  4HA8 A;  3GNG A;  4EPC A;  4EMK A;  4XQ3 A;  4HT9 A;  3OMG A;  1KQ2 A;  3INZ A;  4MML A;  5I2M A;  3UPU A;  2FB7 A;  2ZCF B;  2LTO A;  2YLB A;  5HKC A;  2RI2 A;  2CZ1 B;  2RJE A;  5GAM j;  1ZQ1 A;  4ZGE B;  3OBW A;  1WGS A;  1VIE A;  2ZPH B;  4ZGJ B;  2RJC A;  3L2W A;  1Q81 U;  1VQ6 T;  4IUP A;  4M7D B;  1W4S A;  4A53 A;  3GOX A;  3OYN A;  2K5L A;  3M53 A;  3L42 A;  5LJ5 d;  4ELZ C;  5CK9 A;  3CPF A;  2JOY A;  4IKF A;  2DVE A;  2GF7 A;  5CVI A;  3WXM B;  2M16 A;  4BDY A;  4ZN1 A;  2WSF E;  4F7U B;  1VQ4 A;  2VGN A;  3AHU A;  3E19 A;  3LW5 E;  4KUD K;  2G3R A;  3GP8 A;  4JS5 A;  3C95 A;  1MGQ A;  1LNX A;  2ZPE B;  4PJO C;  5GAN j;  4IUU A;  3QSU A;  1P92 A;  2EKO A;  4VUB A;  4XK8 E;  3JCM f;  4V2S A;  1N9S A;  4IUR A;  3OYD A;  1NJI U;  1B34 A;  2AHJ B;  4ATO A;  2VC8 A;  5FU7 B;  3JAM E;  5A2Q E;  4LDY A;  3CMA T;  3J7A F;  2E70 A;  2PUO B;  3LGL A;  2C06 A;  3CCU T;  1JB0 E;  2FHD A;  3BDU A;  4EMG A;  1K8A U;  3OW2 S;  1VQ5 T;  2DXT A;  4M7A C;  2XKO C;  3QUI A;  4II1 A;  3T9N A;  4NL2 A;  4PJO D;  2OTL A;  1BIA A;  2DKG A;  3DB4 A;  1VQ6 A;  1Y7X A;  3FB9 A;  4C8Q E;  3V7S A;  1BI3 A;  2L89 A;  3PNW C;  1XOV A;  3NTK A;  4JJN K;  2E64 A;  2LCL A;  3EFS A;  4M78 C;  4ZGD B;  2RK1 A;  3JCM b;  4JRP A;  1WQW A;  5LJ3 j;  3KBG A;  5GAN 6;  4M78 E;  4M7A D;  2YHT A;  4MMK A;  3X24 B;  3HFO A;  2LT1 A;  5LJ3 e;  1LJO A;  5GAO m;  4C92 F;  1Q82 C;  3QZ9 B;  2LVM A;  2JVV A;  3OSS C;  1OI1 A;  3JCM h;  3PMI A;  4N4G A;  1N9R A;  2DTO A;  2WSC E;  4C0F A;  3DKM A;  4M77 A;  1M1K C;  3OMC A;  1Y71 A;  2QTX A;  3V8K A;  4M78 D;  5GAM g;  1AHJ B;  3ZBD A;  3HKS A;  3ME9 A;  1BKB A;  3JCM V;  4OB2 B;  1X75 C;  2QQA A;  5GMK m;  2MWO A;  3OY9 A;  5GMK l;  4M75 A;  5DY9 A;  3OB9 A;  3CCE T;  4EMK B;  2K3X A;  2K3Y A;  3PIP A;  5C6S A;  1S72 A;  2RHU A;  1VQ5 A;  2XG8 D;  4PJO F;  1QP2 A;  4XU0 A;  4D6W A;  4PJO G;  4O6J A;  2OTJ A;  1YI2 T;  4C5E A;  2DO3 A;  1D3B A;  2EQU A;  3M4G A;  5GMK i;  4BDZ A;  2V8K A;  4HKE A;  2DJZ A;  2EWN A;  2E1H A;  4JLI A;  3C12 A;  3FRN A;  2R5A A;  5CKF A;  1NPP A;  5D6X A;  3LX7 A;  2KDS A;  4HCZ A;  1JJ2 S;  3RER A;  4M7A F;  2DD4 A;  2JZ2 A;  5M9O A;  4QW2 A;  4XU3 A;  2KK4 A;  1DJ7 B;  2VGM A;  4MZT A;  4M7A G;  2Y90 A;  3M54 A;  4MZM A;  5GMK j;  2GFA A;  2Y4X A;  2QQS A;  1YJ9 A;  1I4K 1;  2L8D A;  4M7D E;  2JTM A;  3X28 B;  5GMK e;  5GAN 8;  4M78 G;  3S3N A;  3VUZ A;  2CZ0 B;  3NTH A;  5LJ5 h;  1N27 A;  4ZN3 A;  4HCC A;  1QW1 A;  3TRE A;  4QVZ A;  1OZ2 A;  4JLG A;  1QVF A;  3M4Y A;  3J81 E;  2XDD A;  1YIT T;  5LJ3 g;  2DD5 A;  3CPW S;  3JCM J;  3JCM d;  5GAN f;  3CCM A;  4PKC C;  3X20 B;  3OS0 A;  1B34 B;  2KAF A;  1N6A A;  3CBO A;  3GF5 A;  2H3J A;  4BD3 A;  3PT9 A;  2ZPI B;  3JCM e;  3H6Z A;  4C0D C;  3DLL A;  5FU7 C;  2CYZ B;  3CBP A;  3SWN A;  4M75 F;  2RA2 A;  4DQ2 A;  3CME A;  4J6W A;  1VQL T;  2MF2 A;  3QG1 A;  1M5Q 1;  3A8G B;  2EQK A;  3SDZ A;  3LLR A;  4DOV A;  2RM4 A;  5IT9 E;  1NE8 A;  4XTZ A;  1Q7Y C;  1IRE B;  5CCA A;  2PU9 B;  5CIU A;  3GIB A;  1FX7 A;  5J26 A;  1VQ4 T;  3UT1 A;  3OS5 A;  3L2V A;  2DK3 A;  2V8I A;  3ASK A;  3MHX A;  2QA4 T;  1XTD A;  1VIF A;  1W2B S;  4NOY A;  3RKX A;  1QVG A;  3FLG A;  3A8L B;  3CCJ T;  4M77 B;  2EJF A;  3QJ6 A;  1G3T A;  2LX9 A;  4EDU A;  3CBM A;  2XID A;  4XTY A;  3UDC A;  3CXC S;  1YIT A;  3QII A;  4LDU A;  4QQ6 A;  3PGG A;  5FRO A;  1M90 C;  4OB1 B;  4BB7 A;  3Q1J A;  4C5H A;  4FM4 B;  2OTL T;  3V7C A;  4C92 A;  1EIF A;  3CCR T;  1VQ8 T;  3OYA A;  3JSC A;  3MEW A;  4IUT A;  2BUD A;  1VQL A;  3A5Z B;  2DXU A;  4F7U G;  3C94 A;  3F70 A;  2E65 A;  2B8A A;  2FL7 A;  2VXF A;  2ZPF B;  5LJ5 e;  3M56 A;  3OYI A;  3I56 T;  4BAC A;  3VYG A;  3JCM X;  2D0Q B;  1D3B B;  4XTU A;  1UEB A;  4KT0 E;  1Q82 U;  2RJF A;  2HQE A;  2R5M A;  1VQK A;  3HHT B;  2P0P A;  2JN0 A;  3QYH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...