2L3RA

Nmr structure of uhrf1 tandem tudor domains in a complex with histone h3 peptide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
161
structure length
161
Chain Sequence
GMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Recognition of Multivalent Histone States Associated with Heterochromatin by UHRF1 Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/gene regulation
total genus 21
structure length 161
sequence length 161
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12148 TTD Tandem tudor domain within UHRF1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2l3rA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2l3rA01
3SD4A 1QVGS 1N8RC 2FHDA 3J80E 3META 1M90C 4NS5A 4QVZA 3HKSA 2DIQA 2RI3A 2VYTA 3P8DA 1S72T 3S3OA 4BD3A 1S72A 3DLLA 4C5EA 3JAME 2DO3A 4B9WA 4C5IA 2MI6A 3CPWA 3MEWA 3PNWC 1JJ2S 1NPPA 3I55T 3P8BB 3CC4T 3OS0A 1G5VA 3I55A 5D6XA 2EKOA 1VQ9T 1VQ5T 3OYJA 2XK0A 1XNIA 1QVFA 3PMTA 2QQRA 3CCUT 1IZ6A 2HQEA 3CMAA 1VQ5A 1VQ9A 3QIIA 4CRIA 2LQ8A 2LVMA 3CCUA 3G6EA 5LL6S 1WJQA 2RHYA 3OW2S 4Z02A 2YRVA 3CCLA 3OYAA 4E7IA 1Q7YC 3CCJT 2X4XA 1KHCA 4A4GA 1VQ4T 2RJDA 3ZEHA 3LH0A 3CD6T 1KQSS 3OYMA 1WGSA 1RL2A 3CCST 3CCVT 3CD6A 1N8RU 4QQGA 4BDYA 1M90U 3QKJA 3OYKA 3F70A 3LX7A 5J3BA 2EQUA 3KUFA 4N4HA 4IUTA 1KD1C 2OTLT 1RI0A 1K73C 1OZ3A 3LYIA 3NTIA 4HCZA 3L2VA 3Q1JA 3MEAA 3UT1A 3UWNA 4PLIA 3S6WA 1VQ8A 3ME9A 1MHNA 2RHZA 2LTOA 1VQMA 1OI1A 2K3XA 5D6WA 4QQDA 3S3MA 2RO0A 3CCRT 1YI2T 1YBYA 2DAQA 1N27A 3OYHA 2OTJT 1YI2A 2R58A 2LRQA 2X4WA 3QBYA 3CXCA 4A4EA 4N4IA 4BE1A 3OYNA 2MWOA 3NTHA 5IN1A 3L2WA 2JVVA 1W2BS 3H8ZA 4PL6A 5FROA 5IT9E 3MEVA 2GFAA 2LCLA 1Q82C 4ZN1A 3MP1A 4BE0A 1UEBA 2L89A 3PIOA 2BIVA 1K8AC 3CC2T 1QVGA 3KBGA 4IKFA 1M1KC 4ZTJA 3CC2A 3MP8A 4N4GA 1KD1U 2K3YA 3EAEA 2D9TA 1K73U 3O8VA 3CMAT 1OZ2A 4E7KA 1YITT 3G6ET 3H6ZA 2BKDN 4FU6A 3OYLA 1YITA 2X4YA 2EQMA 3CCLT 3L2RA 3DB4A 1KC8C 4C5HA 1WJRA 3OYFA 3DB3A 5HY6A 5FLXE 4A4FA 5C6SA 3MO8A 1VQPT 3OA6A 2BUDA 3E9GA 2M16A 1VQPA 5DLQE 1YJWT 3E9FA 3CCQT 2IG0A 5DM7R 1YJWA 3LLRA 5KE3A 3J81E 3CCQA 3OW2A 3P8HA 3OYGA 3J7AF 1VQOT 3G71T 3LGLA 1VQOA 1Q82U 3G71A 3L42A 3PMIA 1VQ7T 4ZN3A 1KQSA 1WJSA 3PFSA 2HQXA 4QW2A 2RJFA 1YJNT 1VQ7A 5C0MA 2EFIA 2R57A 1VQ8T 2XHCA 4E7JA 1VQMT 4BDZA 1Q86C 1YJNA 1M1KU 1M1GA 4E7LA 3A5ZB 4IUPA 2RJCA 1BKBA 4PLLA 1YJ9A 4IUQA 1KHIA 2M0OA 3CXCS 3OMGA 3MP6A 4TVRA 1K9MC 2DIGA 3CMET 3LGFA 2RHUA 4IUVA 5D6YA 3CMEA 2O4XA 3OMCA 1Q7YU 4RG2A 3OYIA 5FRMA 3ER0A 1EIFA 5IAYA 3CC7A 4B9XA 3OYBA 3FDRA 2G3RA 3NTKA 3CPWS 1VQ6T 3OB9A 1VQ6A 1SSFA 3M9QA 4IURA 3BDLA 3MEUA 2LCCA 3OS2A 1W2BA 2M1HA 3DLMA 2JOYA 3G4ST 1QVFS 2R5MA 4E7HA 3QJ6A 2JZ2A 2RHXA 2NLUA 3FLGA 3G4SA 4YTLA 4EDUA 2EQKA 5KE2A 2JUFA 3CPFA 4FL6A 2QA4T 3OYDA 2RI5A 3FC3A 1Q86U 3OS1A 4X34A 1VQLT 2QA4A 5A2QE 2RI2A 1JJ2A 4C5GA 1VQLA 1Q81C 4QQ6A 3CC4A 1VQNT 2EIFA 5J39A 3L2UA 1K9MU 1H3ZA 5KCHA 1VQNA 2L3RA 2E6NA 5KH6A 3CEYA 2RJEA 2QQSA 2PQWA 3OY9A 1NJIC 1OYXA 2JTFA 2O4XB 2JNGA 4ZTFA 2CKKA 3FEOA 4UC4A 2B8AA 4II1A 3TREA 2LDMA 4BE2A 1YHQT 3S3NA 3OYYA 3CCJA 2E6ZA 1NPRA 3OYEA 2E5QA 1YHQA 1VQ4A 1YIJT 2R5AA 1X6OA 1YIJA 3CCSA 2F5KA 1K8AU 1VQKT 3CCVA 3ASKA 2EQJA 4Q5WA 1NZ9A 1VQKA 3CCET 2QEXT 5CIUA 4LD6A 1YJ9T 3C4SA 3CCEA 2QEXA 5FRNA 5KCOA 3L2QA 2OTLA 2KDSA 4A4HA 5M9OA 2WACA 2E70A 3GOXA 2L8DA 1KC8U 3OYCA 4OVAA 2RHIA 1Q81U 2KVQG 4BACA 2GF7A 3CC7T 4L59A 2GFUA 4GY5A 3CCRA 5J26A 2XDPA 4IUUA 2P0KA 2MWPA 3CCMT 3PIPA 2OTJA 1XTDA 3I56T 2X35A 3OQ5A 1NJIU 3CCMA 3I56A
chains in the Genus database with same CATH superfamily
4R55A 2KE9A 3X20B 3J80E 1M30A 4M7AE 5CKHA 3QWXX 1ZA1B 5LJ5d 2PUOB 3P8DA 4ELYC 2JXBA 2F2WA 2SEMA 4E2FB 2WSFE 2AK5A 2COZA 2RPNA 3TCJA 1S72Q 1S72A 2DYBA 2DVEA 3FRNA 2KGTA 1AWWA 1RAIB 2O01E 1MMAA 3I5RA 4K11A 3PNWC 3JB9I 4J8OA 2EYQA 2AZVA 1JJ2S 2G6FX 5I22A 5GAMe 3OS0A 3I55A 3I55Q 2MMPA 3OYJA 1VQ9T 2DL4A 5CCAA 2YLCA 1IZ6A 2DTOA 5CO7A 4F7UA 1VQ5A 1VQ5Q 3VS5A 5GAN5 2LVMA 3CCUQ 3CCUA 3G6EA 1E6HA 4Z02A 2YRVA 3CCLA 1G3WA 1M8MA 1UFFA 2J05A 3A8GB 2EAYA 2FEIA 1Q7YC 2X4XA 3M0UA 2XIDA 3C12A 3V7RA 2CGHA 4KGVB 4M77A 3CCJQ 2GBQA 2HCKA 2PU9B 2ZPIB 3CCST 1Q7YR 1GL5A 2M9UA 4QQGA 2OI3A 2VGNA 4BDYA 3QKJA 2DM1A 3NGPA 2C0TA 3UPUA 1TUGB 4M78F 4WTOB 4N4HA 2IVWA 5GAN7 5GAOr 1T0JA 2YRCA 1KD1C 1X2QA 2CH4W 2V8JA 1K73C 1EFNA 4J5YA 5GAMf 3Q1JA 1VYVA 3MEAA 3TEEA 2V8KA 2FPEA 4R56A 3S6WA 2LJ1A 2VUBA 1KD1R 1WHLA 1K73R 1W70A 4JS4A 2K3XA 2K5FA 2JJ9A 4EMKA 2XU8A 3VKIA 2DAQA 4EIKA 1UTIA 1F1BB 4M78C 2AIRB 1ACMB 3VUBA 4M78G 4KUIA 2X4WA 4BY6B 4XTVA 1T3LA 2COYA 1H8KA 2QI2A 2ZPHB 1E6GA 4XTYA 1D3BA 2E41A 2QK0A 3WVDB 1IGUA 4PJOG 1R77A 2YWWA 3H8ZA 2BTTA 1I1JA 4OMLA 5FROA 1D1CA 4JRIA 2CZ0B 2RNAA 2HL3A 1Y57A 1VIFA 2XI9A 3QWYA 2KROA 3CC2A 3CC2Q 4RTUA 1NEGA 2LZ6B 1UJ0A 3VJPA 3O8VA 1YITT 4F7UF 4C92D 3C0CA 3G6ET 5LJ3d 2BKDN 3OYLA 2NUPB 4XTUA 3CCLT 1KQSP 2MYSA 1AZEA 1G8XA 1WHHA 4M7DF 1OULA 4FYWB 4RUGA 5HY6A 2NUTB 1UGSB 4A4FA 5C6SA 4M4ZA 2J7IA 3OA6A 4WF2A 3FB9A 2BUDA 3TSWA 3M59A 4M77F 1VQPA 1VQPQ 5DLQE 1B07A 3EGDA 4PJNA 1FYNA 3VYHB 2ESWA 1KFZA 5KE3A 5DM7R 2FO0A 3KXTA 2DD4A 2ED0A 2RB6A 3BE3A 1VYTA 4Y28E 1W6XA 3J7AF 3EHQA 1JO8A 3LWHA 4M7DG 3G71T 3MHXA 2DEUA 2HBPA 2CYZB 3RKXA 1GXIE 4M77C 2L5QA 6AT1B 1KQSA 1WHMA 1Y7XA 2CP6A 2HQXA 4M77G 3OS5A 2RJFA 4QT7A 4OF1A 2K7AA 3UA6A 1TTHB 2DZCA 1Q86C 3VYGA 1YJNA 1E7OA 1YJNQ 4VUBA 3X28B 1UGRB 4E7LA 4IUPA 1WI7A 2Y4XA 1NLOC 5A0GA 1W2BP 2FZCB 3NPFA 3EGXA 4M7AA 5CVIA 4EPCA 4C8QB 1Q86R 4XTZA 1K9MC 3NHNA 4FW2A 1I8FA 4XQ3A 3CMET 1V29B 4JZ3A 1QKWA 3VS7A 2RHUA 4M78E 4RG8A 1IO6A 2QAZA 4JJCA 3OMCA 2KAFA 1Q7YU 5IH2A 1K9MR 1FXXA 3R6OA 4FM4B 3CC7A 3CC7Q 4PJOE 1NLPC 4EMKC 3OYBA 1IHVA 1M2VA 2G3RA 2E10A 3OB9A 1WQ7A 1SHFA 4XK8E 1ZSGA 3M9QA 3QYHB 4DEYA 2LCCA 2A28A 1W2BA 4HVWA 9ATCB 4E7ZA 5GAOl 5CKBA 2JOYA 2R5MA 2MF2A 4DQ2A 3QJ6A 1N8RR 2RHXA 2H8HA 1NE8A 3G4SA 3G4SQ 2K3BA 5HCKA 2RK2A 2QA4T 3QHSA 2QG9B 5CR2A 4C5GA 4EMGA 3JCMV 3VRYA 2CDTA 4QQ6A 3CC4A 5KYXA 3CC4Q 4KT0E 2X3WD 1VQNT 1BYMA 3RDVA 3L2UA 4GLMA 2JS0A 1H3ZA 5KCHA 1R8OB 4DBQA 5KH6A 5EC7A 2FG0A 5LJ5f 2E12A 5KYWA 1OYXA 2JTFA 2O4XB 1BU1A 4NL2A 5AT1B 1X01A 5GMKj 4OB1B 1QMCA 1G83A 1NPRA 3FJ5A 3U23A 1YHQA 1U1TA 1YHQQ 1VA7A 1ZX6A 2CT4A 1VQ4A 4JPBW 4JUVA 3H0HA 4M7DE 4BI4A 3H0IA 4OP0A 3QSUA 4HKEA 3JCMh 1GBRA 2HBWA 1WXBA 4A63B 1RAGB 3EG0A 2F5KA 2KR3A 2LQNA 2KQWA 2EQJA 2ZAEA 2LX7A 1VQKA 1VQKQ 4M77E 4J9BA 5LJ5h 4C92B 4M7AF 2K5IA 5KCOA 2DK3A 2KDSA 5M9OA 1XOVA 2D8JA 3GOXA 5GANj 1I0CA 2HSEB 1PCXA 2RHIA 4DOVA 2PVDB 1J3TA 1GFDA 4RTXA 2LMJA 2D0QB 3CC7T 2GFUA 2EJGA 1FX7A 1UECA 3CCRA 2XDPA 4F7UB 2JN0A 5GAOm 2P0KA 1PG5B 2DL8A 3CCMT 1QCOA 3PIPA 1MNDA 4M7AC 3OQ5A 3PVLA 4RTTA 1NJIU 4LE9A 3I56A 3I56Q 5I2MA 2HNIA 1QVGS 1K9AA 5L23A 1FWZA 1YN8A 3META 3LH5A 3HFNA 2EGAA 2XICA 3O5ZA 2EQIA 4F14A 2EBPA 1X75C 2RD1A 2J6KA 2VYTA 4HCKA 3GP8A 3JV3A 4C0FA 4Y92A 3S3OA 1BIBA 4PJLA 3VS2A 1JB0E 1WPYA 2VVKA 4E47A 3SEMA 2EYWA 4D8KA 4ME7A 3MEWA 5GAN6 1NPPA 1IHWA 3CC4T 3CBMA 1LJOA 1G5VA 5IHNA 1FMKA 2FVUA 5D6XA 1U5SA 1AEYA 2XK0A 1XNIA 2DTIA 3JSCA 2ZCFB 1VQ9Q 2MCNA 1VQ9A 2V26A 2LQ8A 5LL6S 3HP9A 3LW5E 4ESRA 2XMFA 1JXOA 3L2ZA 5GAOq 4E7IA 4HA8A 1T3SA 2BE7D 3HFOA 5AYFA 3TVTA 1UDLA 1Y96A 2CT3A 4A4GA 1KSWA 2LT1A 1SRLA 8AT1B 4LUDA 2RJDA 1VQ4T 2DYIA 2M02A 2YDLA 1Y0MA 4JZ4A 1AWXA 3ZEHA 2EYYA 3CD6T 4Z88A 2YUOA 3CXCP 3X26B 1N8RU 4KH0B 1ABOA 3QO3A 3OYKA 3M0PA 5LJ3f 3LX7A 4M78A 2KNBB 2F1LA 1YCYA 3PTAA 1W4SA 3NTIA 3L2VA 4PJOA 2DKGA 2J06A 4RTVA 1ARKA 4JLIA 3OSSC 2DL3A 2RHZA 2P4TA 1VQMA 3WVEB 1QKXA 1JBMA 5D6WA 1IREB 3S3MA 3CCRT 3QJYA 3JB9D 2VASA 4C0DC 1M3AA 1N27A 3OYHA 2DETA 3QBYA 3VU3C 5LJ3h 3CXCA 2KXDA 1ZUUA 2JTEA 3JCMd 3SFMA 2JTMA 2OJ2A 1IRXA 2MWOA 4WCIA 3INZA 2SRCA 4HXJA 3M57A 2RQRA 2PVOB 1GFCA 1BI3A 1SRMA 2CSIA 2MOXA 3EGDB 1KQ2A 5GANg 2LCLA 5GAN3 3REBB 5I21A 2E3HA 1WHJA 2F2XA 2RQUA 5CKDA 1N9RA 2VV5A 3KBGA 3QDRB 2J6FA 4ZTJA 1VOMA 5GMKh 5CKEA 2K3YA 1JU5C 3TQ7P 3EAEA 1WQWA 1PHTA 2X4YA 4C8QD 2EQMA 1YITQ 1YITA 3G6EQ 1YNZA 4RKUE 2LNHB 3CCLQ 4C5HA 4M7DA 3OYFA 3JCMP 2XDDA 3DB3A 3PT9A 1RLQC 3VUZA 2RK1A 1PSEA 2IIMA 3VS0A 1OPLA 3EGXB 1OQKA 3EG2A 1RUWA 4CI0C 3RESA 3E9GA 1YJWT 2QYZA 4HVVA 3A8OB 3CCQT 5KYUB 3OBWA 1RAAB 3X24B 2DTHA 2DBKA 2C0IA 2HD0A 4KUDK 3T9NA 3P8HA 3AT1B 1TXQA 3CQTA 2QQAA 1ZUKA 1VQOT 1Y07A 4J9GA 1AZGB 1NBEB 1PKTA 4N0AC 3JRZA 1BCMA 1Q82U 3G71A 3G71Q 5D7UA 1OU8A 1M2VB 3HRSA 4B6MA 1P92A 4X9CA 3PVQA 2AHJB 2OAWA 4PJOF 1WJSA 4MZMA 4QW2A 5C0MA 2EFIA 2R57A 4M75F 2XHCA 4E7JA 3JCMQ 1VQMT 1K0SA 1M3BA 4CC4B 2ZPBB 1K4US 3OSVA 2RJCA 2RN8A 4M78D 1WHGA 1UUEA 3BY7A 1YJ9A 2A08A 2HMAA 4IUQA 4J9CA 3V7SA 3HHTB 2M0OA 1DJ7B 2E65A 4XAXB 4DA4A 3HTRA 2CREA 1UJYA 1D09B 4IUVA 5D6YA 3CMEA 3CMEQ 2CSQA 2K9GA 3QUIA 4PJOC 1R0BG 1D0XA 4RG2A 4M75C 1NG2A 2EKHA 1YWOA 1TUCA 2YLBA 2PTKA 3GLXA 5KYXB 4M75G 5GAN8 5FRMA 2KRMA 2ATCB 3TSZA 5IAYA 4NOYA 4AT1B 1QP3A 3EFOA 4MZPA 1G3YA 4J7FA 2E4HA 3CPWS 5KYWB 1VQ6T 2RF0A 2QXFA 3RBBB 3BDUA 2GTOA 1I81A 1LNXA 2KI7A 4JRQA 4OMMA 3BDLA 3SHWA 4JRPA 1UE9A 2GNCA 2DVJA 1UGPB 5DLOA 3QYGB 2HDAA 1QVFS 4AFQC 3EH2A 1TOVA 4XU2A 2WSEE 2LT4A 3NMZC 1MV0B 4EDUA 2EQKA 2DFUA 3M56A 2AT1B 4FL6A 2A36A 2KK4A 2RI5A 3FC3A 3OS1A 4F17A 5FU7C 2L3SA 1VQLT 2QA4A 2QA4Q 3EG9A 4C0DB 1OX8A 1M8VA 1RADB 4CC3A 3R6NA 5J39A 1SF9A 2CZ6B 1VQNA 4J6WA 2L3RA 1VQNQ 2O9SA 3QDFA 2JMCA 4CC2A 1NJIC 1WYXA 3CBPA 1D1BA 3A8HB 3ULRB 1WHKA 2CKKA 3E19A 4UC4A 2B8AA 3EFSA 4ORZA 4M7DC 2X3XD 4A4KA 3OYEA 1NJIR 4M77D 1YIJT 1YWPA 2R5AA 2OX7A 3HRUA 2DNUA 1AD5A 1WA7A 1LVKA 3H0FA 3CCVA 3ZBDA 4Z89A 1HD3A 1NZ9A 2QEXT 4LD6A 1YJ9T 4E7SA 3C4SA 4LXCA 4PFOA 1K0XA 2LQKA 2QTXA 2W0ZA 4O6JA 1T0HA 1VUBA 1CKBA 2OTLA 4A4HA 1PKSA 2ZZDA 3JCMe 2L8DA 5GANd 1PWTA 2K2MA 3JB9H 4OVAA 2EYXA 3UATA 2E3IA 4F04B 4LUEA 2WSCE 1M5Q1 5LJ5e 3RNJA 4J9IA 4L5GA 4BI3A 1EX4A 1X69A 4M75E 3CCMA 3CCMQ 4XTWA 3SD4A 1N8RC 2FHDA 2EGCA 2EJFA 5GJVB 1HYOA 1OV3A 4NS5A 3HKSA 2CH4A 2DIQA 4EMHA 1Y96B 4NL3A 2RI3A 2CUBA 4LDYA 3VS3A 2K2VA 4BD3A 4LD9K 2VC8A 3DLLA 1BK2A 3JAME 2DO3A 1N5ZA 2O88A 1H92A 2MPXC 4B9WA 4J9FA 4PK4A 3M0SA 1D0ZA 1MNEA 4ELZC 2CUDA 1XJWB 4M78B 3P8BB 3M55A 3JCMf 2CZ7B 2EKOA 2HEQA 3M53A 2X51A 3PMTA 2QQRA 3CMAA 3CMAQ 2LC4A 1FMVA 2I0NA 2DXCA 4CRIA 1M1KR 4FYXB 1QWFA 1Q95G 1M27C 4J7IA 3OW2S 3NFCA 5GMKl 2EJ9A 3M4GA 4X9DA 2JMAA 3OYAA 2LCSA 4C92E 2YRDA 1I5OB 3HL8A 1VQ4Q 1RL2A 2LP5A 2ECZA 4RCCA 3CCVT 3CD6A 3CD6Q 3QG1A 2ED1A 1M90U 1NM7A 2LQWA 1G3TA 3F70A 4D6WA 2EQUA 2K4YA 3KUFA 1MMDA 2ZPFB 2GCXA 1JXMA 2OTLT 2E5KA 4X1VA 4KGZB 1X6BA 3LYIA 2JS2A 4HCCA 2GTJA 3UT1A 1KJWA 3QZ9B 1M9SA 4PLIA 5IHKA 1BIAA 3H9NA 1VQ8A 1VQ8Q 1MHNA 4A54A 2XKOC 1QVGP 1IGQA 1OI1A 3QXEB 4Y91A 1YI2T 3HSBA 4ATOA 2O31A 2HKNA 3CCRQ 3A8LB 4M7AD 3VRZA 1B34A 4N4IA 1TS9A 4M7DB 4DBHA 3OBYA 3NTHA 5IN1A 3L2WA 1N9SA 4PL6A 3M0TA 4FYVB 4M77B 3MPUB 3JCMX 1LCKA 5IT9E 2GFAA 5LJ3e 1Q82C 1WXUA 2Y4YA 3MP1A 4DBRA 2YUNA 2L89A 1AT1B 1TSFA 3A98A 3M0RA 1K8AC 5CK9A 2HQHA 3GPLA 3I5SA 1QVGA 4IKFA 1Q82R 3C94A 2FPFA 1UHCA 4JLGA 2D9TA 3CMAT 1OZ2A 1I5LA 5KYYA 1WXTA 5FW9A 2W10A 1K8AR 1HXDA 5CQXA 4PFPA 3L2RA 1QLYA 5A0DA 4XU0A 2J6OA 3DB4A 1KC8C 1OU9A 2RM4A 1HSQA 2L3QA 2DL5A 5GMKe 5GAMj 4N0AA 4EMKB 1QQJA 4MDWA 2CP0A 2EYZA 2H3JA 3FIFA 1KC8R 1M1FA 3DKMA 1QCFA 4OB0B 4RTYA 2HZYA 2L2PA 2MK5A 2IG0A 4J83A 1YJWA 4JDSA 1YJWQ 3J81E 3SWNA 1Q81R 2LJ0A 2EW3A 5FU6C 3CCQA 3WXMB 3CCQQ 1D3BB 4D8DA 4E6RA 1GCQA 3OYGA 1SEMA 3LGLA 4J9EA 1VQOA 1VQOQ 3EFOB 3L42A 3PMIA 1VQ7T 2CP7A 5CQYA 1FMWA 2K57A 3PFSA 1X43A 4DOWA 1UHFA 1M4ZA 2VKNA 4C0ZA 1VQ8T 3ZL7C 4M75A 1UB4A 1RLPC 4XTXA 1M1KU 1SHGA 1M1GA 2DEQA 3A5ZB 1VQMQ 2NWMA 1O9SA 2DJQA 1BKBA 4PLLA 2X4JA 1XQHA 2DERA 3RMQA 1U06A 4LDVA 3URGA 1S1NA 1KHIA 3CXCS 2AKKA 2D1XA 2P84A 2DIGA 2VB6A 3LGFA 4FIBA 2OAUA 2O4XA 3EG9B 7AT1B 5IHIA 2KRSA 1JJ2P 2V8IA 3OYIA 4RTWA 3ZFJA 5HK3A 2QGFB 3G1JA 3ER0A 3EH1A 3V8JA 4PJMA 1EIFA 3A8MB 4AFUC 4B9XA 1H641 1HJDA 3FDRA 1SPKA 3NTKA 1GCPA 5CKFA 1AOJA 4C0GA 1WZOA 1YFNA 3G7ZA 1VQ6Q 1VQ6A 2JM8A 1RAEB 1QCNA 3OS2A 5GANf 3DLMA 4LDWA 4C92A 2JZ2A 4C8QF 1PRMC 2H3EB 4J6XA 2NLUA 3RIRA 4YTLA 3M4YA 5KE2A 3UDCA 2DXUA 3GNGA 1YP5A 1U1SA 2F5TX 4X34A 2K79A 2DMOA 3V8KA 5A2QE 2RI2A 1JJ2A 2KT1A 1VQLA 1VQLQ 1I4K1 2KYMA 2KT8A 3X25B 1KQ1A 4M7AB 3GF5A 2EIFA 1MMNA 2YT6A 3RMSA 3A1PA 4C8QC 2V1QA 2GQIA 2QQSA 2RMOA 4FSSA 5GANh 3OY9A 4C8QG 4MDXA 4BUGA 2K5LA 2QASA 2JNGA 2ZPGB 4ZTFA 2EPDA 4LDXA 2LDMA 3S3NA 3CCJA 2E6ZA 2DA9A 3E1SA 1GBQA 1QWEA 2HKQB 2F69A 1WNLA 1X6OA 1YIJA 1YIJQ 4OB3B 4PJJA 1MGQA 1K8AU 4OMOA 4XU3A 1X2KA 5GAMg 3ASKA 4IIMA 4LNPA 3SWNC 2NYSA 3EG1A 4Q5WA 1PNJA 1LOJA 2KY9A 3CCET 1ZHIA 3TU4K 1GCQC 2QEXA 2QEXQ 1YJ9Q 3L2QA 5I11A 1QP2A 5GJWB 1C0MA 4KH1B 2WACA 5A0LA 4CC7A 1KC8U 2VXEA 4PJOD 4AG2C 3CPWP 2A37A 2L3PA 4M75D 1Q81U 2KVQG 2FRWA 4MMKA 4BACA 2GF7A 4GY5A 1OX9A 2CP3A 5FU6B 2A7YA 2CS7A 2RH2A 1QVFP 2VWFA 3JCMb 2MWPA 2QDYB 2OTJA 2OTJQ 1XTDA 1X27A 1IXDA 2DE0X 2X35A 1NYGA 4P5NA 2KYBA 5FWBA 3N5BB 2LJ3A 3EFRA 2BZ8A 3PE0A 1M90C 4QVZA 3VV0A 1ZUYA 2RA2A 4FT2A 1TH7A 1ZSZA 5GAMh 2DPPB 1UGQB 5LJ5j 1S72T 4C92F 1Z9ZA 1JQQA 4C5EA 4Z8AA 2FRYA 1M90R 1JRIA 4C5IA 2MI6A 3CPWA 3GNFB 2XD0A 1MUZA 2KBTA 4OMPA 3RKWA 3I55T 1WIEA 4F16A 4FCYA 5CAIA 1RI9A 1B3QA 1GRIA 2DZ9A 2KMTA 1VQ5T 1U3OA 1QVFA 4MZTA 1R0CB 3CCUT 3REAB 4AMCA 2HQEA 2FZKB 4J6YA 3QIIA 3EGUA 4C92C 2NUZA 2KXCA 3HPWA 1BI2A 1WJQA 2RHYA 2F2VA 4C92G 3I9QA 2ROTA 1PD0A 3VS6A 3RKYA 1ZLMA 4HVUA 4M7DD 3VS4A 3CCJT 1KHCA 4C8QE 4DEXA 4KRTA 4GBQA 5HKCA 1PSFA 3LH0A 1BI0A 3OYMA 1KQSS 2ZGWA 1B34B 1WGSA 3L1AA 4FSXA 4F7UG 2GGRA 1LPLA 3RR6A 2QDLA 3CCVQ 4ZNXA 5J3BA 2BZYA 2DILA 3M5AA 4OMFB 4BI8B 4DBFA 4LN2A 4IUTA 4ZGDB 3V7CA 2I2LA 4HT9A 5ECAA 1RAHB 1RI0A 1UG1A 1OZ3A 5GAN2 1ABQA 1PM3A 2OTLQ 2ENMA 4HCZA 3UF4A 4OB2B 4AFSC 3UWNA 4L6V5 2RQWA 3JB9J 3ME9A 2C06A 2LTOA 4QQDA 2RO0A 3VS1A 4FT4A 1YBYA 4HT8A 4LDUA 3GBQA 5KYYB 2OTJT 1YI2A 1YI2Q 2R58A 2LX9A 2C0OA 2LRQA 2E1HA 3AHUA 2FZGB 1OPKA 4RCBA 1VIEA 4A4EA 2E64A 4IIOA 5KYUA 3QZ5B 5EG2A 5I2SA 1UGVA 4PNOA 1BBZA 4BE1A 3OYNA 4KBMB 1K76A 2JVVA 1K1ZA 3RUXA 1W2BS 1C1AA 2IPOB 4KGXB 1WLPB 1QW1A 1X6GA 2XG8D 1ZA2B 1SKUB 4OMNA 3MJXA 1YCSB 3MEVA 4ZN1A 4XU1A 1I07A 3SWNB 4BE0A 1UEBA 2FYKA 2CP2A 3SDZA 2LNVA 3PIOA 2BIVA 2A0FB 3OW2P 3CC2T 2EGEA 3IQLA 1NEBA 1M1KC 2BZXA 3MP8A 4N4GA 1KD1U 2EWNA 2ABLA 1K73U 1G2BA 2DD5A 2QGGA 5L8RE 1ZSZC 3JCMg 4E7KA 2RQTA 4RMOA 1A0NB 3H6ZA 4FU6A 5LJ3j 2YXYA 3C95A 4PJOB 2EVRA 1SSHA 2DXTA 4M75B 1Y71A 2A3LA 1WJRA 5LJ5g 5FLXE 3MO8A 3V8LA 5GAMd 1VQPT 1JEGA 2PVGB 2M51A 4PFZA 5GMKi 1KK7A 2M16A 2DL7A 3M54A 3E9FA 3LLRA 2JT4A 3KFVA 1AWOA 3BW1A 3OW2A 4R0KA 4HCBA 1MMGA 2D8HA 4A53A 5GAN4 1SG5A 2AKLA 4J9DA 4FW1A 1ZBJA 4F7UE 1IB8A 2X9HA 1PD1A 5FU7B 1M3CA 4ZN3A 2K6DA 4JJBA 2B86A 2NUPA 1YJNT 1VQ7A 1VQ7Q 2DJZA 4QKUA 4BDZA 5IXFA 2FPDA 2NUTA 4OGCA 3UA7A 1O75A 2FB7A 1D0YA 4KULA 3OMGA 3MP6A 8ATCB 4TVRA 1H3HA 1RABB 4AG1C 3M0QA 1AHJB 5FWCA 1W1FA 1ZQ1A 2PZ1A 2YSQA 2Z0WA 2ZPEB 2DBMA 5KYNA 3HRTA 1AVZC 4ZGJB 1EZZB 1BI1A 3D7SB 4JJNK 1WDXA 2FL7A 4M7AG 1M2OA 4V2SA 2JM9A 4FYYB 1PRLC 1SSFA 4BB7A 4ZGEB 4IURA 1TU0B 5GMKm 3MEUA 2RQVA 2VXFA 4JRKA 1TG0A 2M1HA 3G4ST 4E7HA 1AWJA 1VYUA 3QPHA 3FLGA 4C8QA 1G3SA 3THKA 1TWBA 2JUFA 3CPFA 2KSSA 2YUPA 3OYDA 1Q86U 5IXBA 1Z9QA 1ZBXA 1MV3A 4GLKA 1U8RA 1Q81C 1BCOA 2AZSA 3JCMW 2PUKB 4J9HA 4JJDA 2DRMA 1BB9A 2D0NA 1K9MU 1CSKA 3BFMA 3LWIA 2KRNA 3H41A 2MIOA 2O9VA 2E6NA 3MCAB 3CEYA 2RJEA 2YUQA 4ANJA 4QVDA 2YHTA 1N6AA 2PQWA 1KG1A 2P0PA 2DRKA 3I35A 4PKCC 2P4RA 2P0QA 2D6FA 4BY6C 1CKAA 4AFZC 3FEOA 3MKDA 4II1A 1HK9A 3TREA 4BE2A 2V1RA 1YHQT 3OYYA 2VGMA 5LJ3g 3GIBA 2JW4A 2MAMA 5GAOn 2E5QA 3JCMc 2CZ1B 1OEBA 3SB2A 3E2UA 4RTZA 2O2OA 2QQ9A 4JS5A 2HL5C 5GANe 2DX1A 3CCSA 3CCSQ 2CP5A 1VQKT 2L0AA 1RACB 1OOTA 1RAFB 4QVCA 3FJPA 2PNIA 5CIUA 3JB9F 1ZSZB 2DXBA 1WX6A 1NYFA 3PGGA 3CCEA 3CCEQ 2QQBA 5FRNA 2QTVA 1KIKA 2M0YA 3M58A 4MMLA 3JCMJ 2E70A 1TUDA 5GAOp 4OGEA 3EHRA 1D1AA 3OYCA 1QVPA 2DLPA 1V76A 4O5VA 1V1CA 2DF6A 2COWA 1B7TA 1C6VX 2ROLA 4OMQA 4L59A 2HSPA 2KEAA 5HK0A 5DY9A 4IUUA 2Y90A 5J26A 2HAXA 3RERA 3JB9G 2BE9B 3EG3A 3I56T 2XDBA 2GQVA 1WFWA 1PC0A 3CBOA
chains in the Genus database with same CATH topology
5I2MA 4R55A 2HNIA 3SD4A 3EFRA 1QVGS 1N8RC 1FWZA 2FHDA 3X20B 3META 2EJFA 3J80E 1M90C 4NS5A 4QVZA 3HKSA 3HFNA 3VV0A 4M7AE 2DIQA 2XICA 1Y96B 5CKHA 2RA2A 4EMHA 4FT2A 1TH7A 4NL3A 2RI3A 5GAMh 2DPPB 4LDYA 1X75C 2RD1A 1UGQB 2VYTA 2PUOB 3P8DA 4ELYC 5LJ5j 5LJ5d 3GP8A 4C0FA 3S3OA 2K2VA 4BD3A 1S72T 4C92F 4LD9K 2VC8A 1BIBA 2WSFE 1S72A 3TCJA 4C5EA 3DLLA 1JB0E 2DVEA 3FRNA 1WPYA 3JAME 1JRIA 2DO3A 4E47A 4B9WA 4C5IA 2O01E 2MI6A 3CPWA 4ME7A 3MEWA 3PNWC 3GNFB 3JB9I 5GAN6 4J8OA 2EYQA 2XD0A 1JJ2S 1NPPA 4ELZC 3RKWA 3I55T 4M78B 3P8BB 3CBMA 5GAMe 5CAIA 3CC4T 3M55A 1LJOA 3JCMf 3OS0A 1G5VA 3I55A 2FVUA 2MMPA 2CZ7B 5D6XA 2DZ9A 2KMTA 2EKOA 3OYJA 1VQ9T 1VQ5T 2XK0A 1XNIA 5CCAA 3M53A 1QVFA 3PMTA 2YLCA 4MZTA 2QQRA 3CCUT 1IZ6A 2HQEA 2DTIA 2DTOA 3JSCA 2ZCFB 4J6YA 3QIIA 5CO7A 4F7UA 3CMAA 2LC4A 1VQ5A 1VQ9A 2DXCA 4CRIA 5GAN5 2LQ8A 4C92C 2LVMA 3CCUA 3HPWA 1BI2A 5J26A 3G6EA 5LL6S 1WJQA 2RHYA 3HP9A 4J7IA 4C92G 3OW2S 3LW5E 3NFCA 4Z02A 2EJ9A 5GMKl 2YRVA 3CCLA 1G3WA 3L2ZA 3M4GA 4X9DA 5GAOq 3RKYA 3OYAA 4E7IA 4HA8A 3A8GB 3HFOA 2EAYA 5AYFA 4M7DD 4C92E 1Q7YC 3CCJT 2X4XA 1KHCA 1Y96A 2XIDA 3C12A 4A4GA 4C8QE 3V7RA 2LT1A 5HKCA 2CGHA 4M77A 2RJDA 1VQ4T 3ZEHA 1PSFA 3LH0A 1BI0A 3HL8A 3CD6T 3OYMA 1KQSS 2ZGWA 1B34B 2PU9B 1WGSA 1RL2A 2ZPIB 3L1AA 4FSXA 3CCST 3X26B 2M9UA 4RCCA 3CCVT 3CD6A 1N8RU 4QQGA 4F7UG 2VGNA 4BDYA 3QG1A 1M90U 3QO3A 3QKJA 3OYKA 3UPUA 1G3TA 5LJ3f 3F70A 3LX7A 4D6WA 2EQUA 2K4YA 4M78F 5J3BA 3M5AA 3KUFA 4N4HA 4OMFB 4M78A 2IVWA 4BI8B 4IUTA 2ZPFB 5GAN7 5GAOr 4ZGDB 1KD1C 2GCXA 2OTLT 1YCYA 3V7CA 2I2LA 4HT9A 2V8JA 1RI0A 1W4SA 3PTAA 1OZ3A 1K73C 5GAN2 3LYIA 3NTIA 4HCZA 4J5YA 4OB2B 5GAMf 4HCCA 3L2VA 3Q1JA 3MEAA 3UT1A 2DKGA 4PJOA 3QZ9B 3TEEA 2V8KA 1M9SA 3UWNA 4R56A 4PLIA 3S6WA 4JLIA 2VUBA 3OSSC 4L6V5 1BIAA 3JB9J 1VQ8A 3ME9A 2C06A 1MHNA 2RHZA 2P4TA 4A54A 2XKOC 2LTOA 1VQMA 3WVEB 4JS4A 1JBMA 1OI1A 1IREB 2K3XA 4QQDA 5D6WA 2RO0A 3S3MA 3QXEB 2K5FA 4Y91A 4F7UB 3CCRT 3QJYA 4EMKA 4FT4A 2XU8A 1YBYA 3VKIA 2DAQA 3JB9D 1YI2T 4LDUA 4C0DC 4HT8A 3HSBA 4ATOA 4M78C 1N27A 3OYHA 2OTJT 1YI2A 3A8LB 2R58A 3VUBA 2LX9A 4M78G 4M7AD 4KUIA 2LRQA 2E1HA 2X4WA 3AHUA 3QBYA 3VU3C 4RCBA 5LJ3h 3CXCA 1VIEA 4XTVA 4A4EA 2E64A 4BY6B 1B34A 2QI2A 2ZPHB 3QZ5B 3JCMd 4N4IA 5EG2A 3SFMA 2JTMA 4XTYA 1D3BA 2E41A 4M7DB 3WVDB 4PNOA 5I2SA 4BE1A 3OYNA 4KBMB 4PJOG 3OBYA 2MWOA 3NTHA 5IN1A 3L2WA 2JVVA 1W2BS 3RUXA 1N9SA 3H8ZA 4PL6A 3INZA 3M57A 1QW1A 2XG8D 4M77B 2PVOB 5FROA 3JCMX 1BI3A 5IT9E 1KQ2A 3MEVA 5GANg 2GFAA 2LCLA 5LJ3e 1Q82C 4JRIA 4ZN1A 2CZ0B 2Y4YA 3MP1A 4XU1A 3SWNB 5GAN3 4BE0A 1UEBA 2FYKA 2L89A 5I21A 3SDZA 1GXIE 2LNVA 3PIOA 2BIVA 5CKDA 1N9RA 1VIFA 1K8AC 2VV5A 5CK9A 3CC2T 1QVGA 3GPLA 3KBGA 4IKFA 2XI9A 3QDRB 1M1KC 4ZTJA 3CC2A 3MP8A 4N4GA 5GMKh 3C94A 5CKEA 1KD1U 2EWNA 2K3YA 3VJPA 4JLGA 3EAEA 2D9TA 1K73U 3O8VA 3CMAT 1OZ2A 2DD5A 5L8RE 1I5LA 4E7KA 3JCMg 1YITT 4RMOA 4F7UF 4C92D 1WQWA 3G6ET 1HXDA 3H6ZA 2BKDN 4FU6A 5LJ3d 5LJ3j 3OYLA 5CQXA 2X4YA 3C95A 2EQMA 4XTUA 4C8QD 1YITA 4PJOB 3CCLT 3L2RA 5A0DA 4RKUE 4XU0A 2DXTA 3DB4A 4M75B 1KC8C 1Y71A 4M7DF 2A3LA 4C5HA 1WJRA 4M7DA 2RM4A 3OYFA 3JCMP 2XDDA 3DB3A 5HY6A 5LJ5g 3PT9A 1UGSB 5FLXE 4A4FA 5C6SA 3VUZA 3MO8A 2RK1A 5GMKe 3V8LA 5GAMd 5GAMj 1PSEA 4N0AA 1VQPT 2PVGB 4EMKB 4MDWA 4WF2A 3OA6A 3FB9A 5GMKi 2BUDA 4CI0C 2H3JA 3M59A 4M77F 3RESA 3E9GA 2M16A 3FIFA 1VQPA 5DLQE 3M54A 1M1FA 3DKMA 1YJWT 3A8OB 3E9FA 4OB0B 3VYHB 3CCQT 2IG0A 4J83A 5KE3A 3LLRA 4JDSA 5DM7R 3OBWA 3SWNA 3J81E 1YJWA 3X24B 2DTHA 3BW1A 5FU6C 3CCQA 3WXMB 4KUDK 2HD0A 3OW2A 1D3BB 3T9NA 4HCBA 3P8HA 3KXTA 2DD4A 2RB6A 2QQAA 4A53A 4Y28E 3OYGA 5GAN4 3J7AF 3LWHA 4F7UE 1VQOT 4M7DG 1Y07A 3G71T 3MHXA 4N0AC 2HBPA 3LGLA 2CYZB 3JRZA 1VQOA 1Q82U 3L42A 3G71A 3RKXA 3PMIA 1VQ7T 3HRSA 4M77C 1P92A 4X9CA 2L5QA 5CQYA 5FU7B 4ZN3A 1KQSA 2AHJB 4PJOF 1WJSA 2K57A 1Y7XA 3PFSA 2HQXA 4M77G 3OS5A 4MZMA 2RJFA 4QW2A 4DOWA 1M4ZA 4OF1A 5C0MA 2DJZA 2EFIA 2R57A 4C0ZA 4M75F 1YJNT 1VQ8T 1VQ7A 2XHCA 4E7JA 2DZCA 1UB4A 4M75A 4XTXA 3JCMQ 4BDZA 1VQMT 1Q86C 3VYGA 1YJNA 2ZPBB 1M1KU 4VUBA 1M1GA 1UGRB 2DEQA 3A5ZB 3OSVA 4IUPA 2Y4XA 3X28B 4E7LA 1O9SA 2RJCA 1BKBA 2X4JA 4PLLA 1XQHA 4M78D 4OGCA 3RMQA 5A0GA 1O75A 3BY7A 1YJ9A 4IUQA 4M7AA 2FB7A 4LDVA 5CVIA 3URGA 3HHTB 3V7SA 4EPCA 4KULA 4C8QB 1KHIA 2M0OA 1DJ7B 3CXCS 2E65A 3OMGA 3MP6A 4XTZA 2DIGA 4TVRA 4XAXB 1K9MC 1I8FA 4DA4A 4XQ3A 3CMET 3LGFA 1V29B 4FIBA 1AHJB 2RHUA 4IUVA 5D6YA 2OAUA 3CMEA 4M78E 3QUIA 2O4XA 4RG8A 4PJOC 3OMCA 1ZQ1A 2KAFA 1Q7YU 4RG2A 4M75C 2V8IA 2YLBA 3OYIA 3ZFJA 5HK3A 3GLXA 5GAN8 2ZPEB 4M75G 5FRMA 3ER0A 3HRTA 1FXXA 3V8JA 1EIFA 3A8MB 3R6OA 4FM4B 5IAYA 3CC7A 4NOYA 4PJOE 4ZGJB 4B9XA 4EMKC 1BI1A 3OYBA 1H641 4JJNK 1QP3A 4MZPA 1G3YA 4J7FA 3FDRA 2G3RA 2FL7A 3NTKA 3CPWS 4M7AG 2E10A 5CKFA 1VQ6T 2QXFA 3BDUA 3OB9A 4V2SA 1WQ7A 4C0GA 1I81A 1LNXA 3G7ZA 4XK8E 4JRQA 1VQ6A 1SSFA 4BB7A 4ZGEB 3M9QA 3QYHB 4IURA 3BDLA 5GMKm 4JRPA 3MEUA 2LCCA 3OS2A 1W2BA 2VXFA 4JRKA 5GANf 5GAOl 1UGPB 5DLOA 3QYGB 2M1HA 3DLMA 5CKBA 4LDWA 2JOYA 2R5MA 2MF2A 3G4ST 4C92A 1QVFS 4DQ2A 3QJ6A 4E7HA 2JZ2A 2RHXA 4C8QF 3QPHA 1NE8A 4J6XA 2NLUA 2WSEE 3FLGA 2LT4A 4XU2A 3RIRA 4C8QA 4YTLA 4EDUA 3G4SA 2EQKA 3M4YA 5KE2A 3M56A 1G3SA 2RK2A 2DXUA 2JUFA 3CPFA 3GNGA 4FL6A 3UDCA 2KSSA 2KK4A 2QA4T 3OYDA 2RI5A 3FC3A 3QHSA 1Q86U 3OS1A 1U1SA 1ZBXA 5FU7C 2F5TX 4X34A 1VQLT 2QA4A 3V8KA 5A2QE 4C0DB 2RI2A 4GLKA 1JJ2A 5CR2A 4C5GA 1M8VA 4EMGA 3JCMV 1VQLA 1U8RA 1Q81C 4QQ6A 1I4K1 3X25B 2PUKB 3JCMW 3CC4A 1KQ1A 4KT0E 1VQNT 4M7AB 3GF5A 2EIFA 5J39A 3L2UA 1BYMA 1K9MU 3BFMA 3LWIA 2CZ6B 1R8OB 5KCHA 4J6WA 2L3RA 3RMSA 1VQNA 2E6NA 1H3ZA 5KH6A 3MCAB 3CEYA 2RJEA 4C8QC 4QVDA 5LJ5f 2E12A 2QQSA 2YHTA 1N6AA 2PQWA 5GANh 3OY9A 1KG1A 2P0PA 4C8QG 1NJIC 1OYXA 4PKCC 4MDXA 2JTFA 2P0QA 2O4XB 4BUGA 2D6FA 2K5LA 3CBPA 4BY6C 3A8HB 4NL2A 2JNGA 2ZPGB 4ZTFA 2CKKA 3E19A 3FEOA 4UC4A 2B8AA 1X01A 3EFSA 4II1A 1HK9A 4OB1B 2LDMA 3TREA 4A4KA 5GMKj 4BE2A 1YHQT 3S3NA 4LDXA 3OYYA 3CCJA 2E6ZA 2VGMA 5LJ3g 1NPRA 3GIBA 2MAMA 5GAOn 3OYEA 2E5QA 3E1SA 4M7DC 1YHQA 1U1TA 2CZ1B 3JCMc 4M77D 1VQ4A 1YIJT 3SB2A 2R5AA 2F69A 1WNLA 4JUVA 1X6OA 3HRUA 4M7DE 2QQ9A 4JS5A 1YIJA 4BI4A 4OP0A 3QSUA 4OB3B 4HKEA 3JCMh 5GANe 2HAXA 3RERA 2F5KA 1MGQA 3CCSA 1K8AU 4XU3A 1VQKT 3CCVA 5GAMg 3ASKA 3SWNC 2KQWA 3ZBDA 2EQJA 4QVCA 4Q5WA 1NZ9A 3FJPA 1LOJA 1VQKA 2KY9A 5CIUA 2QEXT 3CCET 4M77E 1ZHIA 2DXBA 4LD6A 3TU4K 3JB9F 1YJ9T 3C4SA 3I56A 2LQKA 2QTXA 3PGGA 3CCEA 2QEXA 5GAOm 5LJ5h 4O6JA 4C92B 2QQBA 4M7AF 2K5IA 5FRNA 5KCOA 3L2QA 1VUBA 2OTLA 2DK3A 1QP2A 3M58A 2KDSA 4MMLA 4A4HA 2ZZDA 5M9OA 1XOVA 2WACA 2E70A 3JCMJ 5GAOp 5A0LA 3JCMe 4OGEA 3GOXA 2L8DA 5GANd 5GANj 1KC8U 2VXEA 4PJOD 3OYCA 1QVPA 4O5VA 4M75D 3JB9H 4OVAA 2RHIA 1Q81U 2KVQG 4DOVA 2PVDB 4MMKA 4BACA 2WSCE 2GF7A 1M5Q1 2D0QB 3CC7T 4L59A 2GFUA 2EJGA 5LJ5e 1FX7A 4GY5A 3CCRA 5HK0A 2XDPA 4IUUA 2Y90A 2JN0A 4L5GA 2P0KA 2A7YA 2CS7A 2RH2A 5DY9A 5FU6B 4BI3A 3JCMb 2MWPA 3CCMT 3JB9G 2QDYB 3PIPA 2OTJA 1XTDA 4M75E 4M7AC 3I56T 2XDBA 2X35A 2GQVA 4P5NA 3OQ5A 1NJIU 3CCMA 4XTWA 3N5BB 3CBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SD4 A;  1QVG S;  1N8R C;  2FHD A;  3J80 E;  3MET A;  1M90 C;  4NS5 A;  4QVZ A;  3HKS A;  2DIQ A;  2RI3 A;  2VYT A;  3P8D A;  1S72 T;  3S3O A;  4BD3 A;  1S72 A;  3DLL A;  4C5E A;  3JAM E;  2DO3 A;  4B9W A;  4C5I A;  2MI6 A;  3CPW A;  3MEW A;  3PNW C;  1JJ2 S;  1NPP A;  3I55 T;  3P8B B;  3CC4 T;  3OS0 A;  1G5V A;  3I55 A;  5D6X A;  2EKO A;  1VQ9 T;  1VQ5 T;  3OYJ A;  2XK0 A;  1XNI A;  1QVF A;  3PMT A;  2QQR A;  3CCU T;  1IZ6 A;  2HQE A;  3CMA A;  1VQ5 A;  1VQ9 A;  3QII A;  4CRI A;  2LQ8 A;  2LVM A;  3CCU A;  3G6E A;  5LL6 S;  1WJQ A;  2RHY A;  3OW2 S;  4Z02 A;  2YRV A;  3CCL A;  3OYA A;  4E7I A;  1Q7Y C;  3CCJ T;  2X4X A;  1KHC A;  4A4G A;  1VQ4 T;  2RJD A;  3ZEH A;  3LH0 A;  3CD6 T;  1KQS S;  3OYM A;  1WGS A;  1RL2 A;  3CCS T;  3CCV T;  3CD6 A;  1N8R U;  4QQG A;  4BDY A;  1M90 U;  3QKJ A;  3OYK A;  3F70 A;  3LX7 A;  5J3B A;  2EQU A;  3KUF A;  4N4H A;  4IUT A;  1KD1 C;  2OTL T;  1RI0 A;  1K73 C;  1OZ3 A;  3LYI A;  3NTI A;  4HCZ A;  3L2V A;  3Q1J A;  3MEA A;  3UT1 A;  3UWN A;  4PLI A;  3S6W A;  1VQ8 A;  3ME9 A;  1MHN A;  2RHZ A;  2LTO A;  1VQM A;  1OI1 A;  2K3X A;  5D6W A;  4QQD A;  3S3M A;  2RO0 A;  3CCR T;  1YI2 T;  1YBY A;  2DAQ A;  1N27 A;  3OYH A;  2OTJ T;  1YI2 A;  2R58 A;  2LRQ A;  2X4W A;  3QBY A;  3CXC A;  4A4E A;  4N4I A;  4BE1 A;  3OYN A;  2MWO A;  3NTH A;  5IN1 A;  3L2W A;  2JVV A;  1W2B S;  3H8Z A;  4PL6 A;  5FRO A;  5IT9 E;  3MEV A;  2GFA A;  2LCL A;  1Q82 C;  4ZN1 A;  3MP1 A;  4BE0 A;  1UEB A;  2L89 A;  3PIO A;  2BIV A;  1K8A C;  3CC2 T;  1QVG A;  3KBG A;  4IKF A;  1M1K C;  4ZTJ A;  3CC2 A;  3MP8 A;  4N4G A;  1KD1 U;  2K3Y A;  3EAE A;  2D9T A;  1K73 U;  3O8V A;  3CMA T;  1OZ2 A;  4E7K A;  1YIT T;  3G6E T;  3H6Z A;  2BKD N;  4FU6 A;  3OYL A;  1YIT A;  2X4Y A;  2EQM A;  3CCL T;  3L2R A;  3DB4 A;  1KC8 C;  4C5H A;  1WJR A;  3OYF A;  3DB3 A;  5HY6 A;  5FLX E;  4A4F A;  5C6S A;  3MO8 A;  1VQP T;  3OA6 A;  2BUD A;  3E9G A;  2M16 A;  1VQP A;  5DLQ E;  1YJW T;  3E9F A;  3CCQ T;  2IG0 A;  5DM7 R;  1YJW A;  3LLR A;  5KE3 A;  3J81 E;  3CCQ A;  3OW2 A;  3P8H A;  3OYG A;  3J7A F;  1VQO T;  3G71 T;  3LGL A;  1VQO A;  1Q82 U;  3G71 A;  3L42 A;  3PMI A;  1VQ7 T;  4ZN3 A;  1KQS A;  1WJS A;  3PFS A;  2HQX A;  4QW2 A;  2RJF A;  1YJN T;  1VQ7 A;  5C0M A;  2EFI A;  2R57 A;  1VQ8 T;  2XHC A;  4E7J A;  1VQM T;  4BDZ A;  1Q86 C;  1YJN A;  1M1K U;  1M1G A;  4E7L A;  3A5Z B;  4IUP A;  2RJC A;  1BKB A;  4PLL A;  1YJ9 A;  4IUQ A;  1KHI A;  2M0O A;  3CXC S;  3OMG A;  3MP6 A;  4TVR A;  1K9M C;  2DIG A;  3CME T;  3LGF A;  2RHU A;  4IUV A;  5D6Y A;  3CME A;  2O4X A;  3OMC A;  1Q7Y U;  4RG2 A;  3OYI A;  5FRM A;  3ER0 A;  1EIF A;  5IAY A;  3CC7 A;  4B9X A;  3OYB A;  3FDR A;  2G3R A;  3NTK A;  3CPW S;  1VQ6 T;  3OB9 A;  1VQ6 A;  1SSF A;  3M9Q A;  4IUR A;  3BDL A;  3MEU A;  2LCC A;  3OS2 A;  1W2B A;  2M1H A;  3DLM A;  2JOY A;  3G4S T;  1QVF S;  2R5M A;  4E7H A;  3QJ6 A;  2JZ2 A;  2RHX A;  2NLU A;  3FLG A;  3G4S A;  4YTL A;  4EDU A;  2EQK A;  5KE2 A;  2JUF A;  3CPF A;  4FL6 A;  2QA4 T;  3OYD A;  2RI5 A;  3FC3 A;  1Q86 U;  3OS1 A;  4X34 A;  1VQL T;  2QA4 A;  5A2Q E;  2RI2 A;  1JJ2 A;  4C5G A;  1VQL A;  1Q81 C;  4QQ6 A;  3CC4 A;  1VQN T;  2EIF A;  5J39 A;  3L2U A;  1K9M U;  1H3Z A;  5KCH A;  1VQN A;  2L3R A;  2E6N A;  5KH6 A;  3CEY A;  2RJE A;  2QQS A;  2PQW A;  3OY9 A;  1NJI C;  1OYX A;  2JTF A;  2O4X B;  2JNG A;  4ZTF A;  2CKK A;  3FEO A;  4UC4 A;  2B8A A;  4II1 A;  3TRE A;  2LDM A;  4BE2 A;  1YHQ T;  3S3N A;  3OYY A;  3CCJ A;  2E6Z A;  1NPR A;  3OYE A;  2E5Q A;  1YHQ A;  1VQ4 A;  1YIJ T;  2R5A A;  1X6O A;  1YIJ A;  3CCS A;  2F5K A;  1K8A U;  1VQK T;  3CCV A;  3ASK A;  2EQJ A;  4Q5W A;  1NZ9 A;  1VQK A;  3CCE T;  2QEX T;  5CIU A;  4LD6 A;  1YJ9 T;  3C4S A;  3CCE A;  2QEX A;  5FRN A;  5KCO A;  3L2Q A;  2OTL A;  2KDS A;  4A4H A;  5M9O A;  2WAC A;  2E70 A;  3GOX A;  2L8D A;  1KC8 U;  3OYC A;  4OVA A;  2RHI A;  1Q81 U;  2KVQ G;  4BAC A;  2GF7 A;  3CC7 T;  4L59 A;  2GFU A;  4GY5 A;  3CCR A;  5J26 A;  2XDP A;  4IUU A;  2P0K A;  2MWP A;  3CCM T;  3PIP A;  2OTJ A;  1XTD A;  3I56 T;  2X35 A;  3OQ5 A;  1NJI U;  3CCM A;  3I56 A; 
#chains in the Genus database with same CATH topology
 4R55 A;  2KE9 A;  3X20 B;  3J80 E;  1M30 A;  4M7A E;  5CKH A;  3QWX X;  1ZA1 B;  5LJ5 d;  2PUO B;  3P8D A;  4ELY C;  2JXB A;  2F2W A;  2SEM A;  4E2F B;  2WSF E;  2AK5 A;  2COZ A;  2RPN A;  3TCJ A;  1S72 Q;  1S72 A;  2DYB A;  2DVE A;  3FRN A;  2KGT A;  1AWW A;  1RAI B;  2O01 E;  1MMA A;  3I5R A;  4K11 A;  3PNW C;  3JB9 I;  4J8O A;  2EYQ A;  2AZV A;  1JJ2 S;  2G6F X;  5I22 A;  5GAM e;  3OS0 A;  3I55 A;  3I55 Q;  2MMP A;  3OYJ A;  1VQ9 T;  2DL4 A;  5CCA A;  2YLC A;  1IZ6 A;  2DTO A;  5CO7 A;  4F7U A;  1VQ5 A;  1VQ5 Q;  3VS5 A;  5GAN 5;  2LVM A;  3CCU Q;  3CCU A;  3G6E A;  1E6H A;  4Z02 A;  2YRV A;  3CCL A;  1G3W A;  1M8M A;  1UFF A;  2J05 A;  3A8G B;  2EAY A;  2FEI A;  1Q7Y C;  2X4X A;  3M0U A;  2XID A;  3C12 A;  3V7R A;  2CGH A;  4KGV B;  4M77 A;  3CCJ Q;  2GBQ A;  2HCK A;  2PU9 B;  2ZPI B;  3CCS T;  1Q7Y R;  1GL5 A;  2M9U A;  4QQG A;  2OI3 A;  2VGN A;  4BDY A;  3QKJ A;  2DM1 A;  3NGP A;  2C0T A;  3UPU A;  1TUG B;  4M78 F;  4WTO B;  4N4H A;  2IVW A;  5GAN 7;  5GAO r;  1T0J A;  2YRC A;  1KD1 C;  1X2Q A;  2CH4 W;  2V8J A;  1K73 C;  1EFN A;  4J5Y A;  5GAM f;  3Q1J A;  1VYV A;  3MEA A;  3TEE A;  2V8K A;  2FPE A;  4R56 A;  3S6W A;  2LJ1 A;  2VUB A;  1KD1 R;  1WHL A;  1K73 R;  1W70 A;  4JS4 A;  2K3X A;  2K5F A;  2JJ9 A;  4EMK A;  2XU8 A;  3VKI A;  2DAQ A;  4EIK A;  1UTI A;  1F1B B;  4M78 C;  2AIR B;  1ACM B;  3VUB A;  4M78 G;  4KUI A;  2X4W A;  4BY6 B;  4XTV A;  1T3L A;  2COY A;  1H8K A;  2QI2 A;  2ZPH B;  1E6G A;  4XTY A;  1D3B A;  2E41 A;  2QK0 A;  3WVD B;  1IGU A;  4PJO G;  1R77 A;  2YWW A;  3H8Z A;  2BTT A;  1I1J A;  4OML A;  5FRO A;  1D1C A;  4JRI A;  2CZ0 B;  2RNA A;  2HL3 A;  1Y57 A;  1VIF A;  2XI9 A;  3QWY A;  2KRO A;  3CC2 A;  3CC2 Q;  4RTU A;  1NEG A;  2LZ6 B;  1UJ0 A;  3VJP A;  3O8V A;  1YIT T;  4F7U F;  4C92 D;  3C0C A;  3G6E T;  5LJ3 d;  2BKD N;  3OYL A;  2NUP B;  4XTU A;  3CCL T;  1KQS P;  2MYS A;  1AZE A;  1G8X A;  1WHH A;  4M7D F;  1OUL A;  4FYW B;  4RUG A;  5HY6 A;  2NUT B;  1UGS B;  4A4F A;  5C6S A;  4M4Z A;  2J7I A;  3OA6 A;  4WF2 A;  3FB9 A;  2BUD A;  3TSW A;  3M59 A;  4M77 F;  1VQP A;  1VQP Q;  5DLQ E;  1B07 A;  3EGD A;  4PJN A;  1FYN A;  3VYH B;  2ESW A;  1KFZ A;  5KE3 A;  5DM7 R;  2FO0 A;  3KXT A;  2DD4 A;  2ED0 A;  2RB6 A;  3BE3 A;  1VYT A;  4Y28 E;  1W6X A;  3J7A F;  3EHQ A;  1JO8 A;  3LWH A;  4M7D G;  3G71 T;  3MHX A;  2DEU A;  2HBP A;  2CYZ B;  3RKX A;  1GXI E;  4M77 C;  2L5Q A;  6AT1 B;  1KQS A;  1WHM A;  1Y7X A;  2CP6 A;  2HQX A;  4M77 G;  3OS5 A;  2RJF A;  4QT7 A;  4OF1 A;  2K7A A;  3UA6 A;  1TTH B;  2DZC A;  1Q86 C;  3VYG A;  1YJN A;  1E7O A;  1YJN Q;  4VUB A;  3X28 B;  1UGR B;  4E7L A;  4IUP A;  1WI7 A;  2Y4X A;  1NLO C;  5A0G A;  1W2B P;  2FZC B;  3NPF A;  3EGX A;  4M7A A;  5CVI A;  4EPC A;  4C8Q B;  1Q86 R;  4XTZ A;  1K9M C;  3NHN A;  4FW2 A;  1I8F A;  4XQ3 A;  3CME T;  1V29 B;  4JZ3 A;  1QKW A;  3VS7 A;  2RHU A;  4M78 E;  4RG8 A;  1IO6 A;  2QAZ A;  4JJC A;  3OMC A;  2KAF A;  1Q7Y U;  5IH2 A;  1K9M R;  1FXX A;  3R6O A;  4FM4 B;  3CC7 A;  3CC7 Q;  4PJO E;  1NLP C;  4EMK C;  3OYB A;  1IHV A;  1M2V A;  2G3R A;  2E10 A;  3OB9 A;  1WQ7 A;  1SHF A;  4XK8 E;  1ZSG A;  3M9Q A;  3QYH B;  4DEY A;  2LCC A;  2A28 A;  1W2B A;  4HVW A;  9ATC B;  4E7Z A;  5GAO l;  5CKB A;  2JOY A;  2R5M A;  2MF2 A;  4DQ2 A;  3QJ6 A;  1N8R R;  2RHX A;  2H8H A;  1NE8 A;  3G4S A;  3G4S Q;  2K3B A;  5HCK A;  2RK2 A;  2QA4 T;  3QHS A;  2QG9 B;  5CR2 A;  4C5G A;  4EMG A;  3JCM V;  3VRY A;  2CDT A;  4QQ6 A;  3CC4 A;  5KYX A;  3CC4 Q;  4KT0 E;  2X3W D;  1VQN T;  1BYM A;  3RDV A;  3L2U A;  4GLM A;  2JS0 A;  1H3Z A;  5KCH A;  1R8O B;  4DBQ A;  5KH6 A;  5EC7 A;  2FG0 A;  5LJ5 f;  2E12 A;  5KYW A;  1OYX A;  2JTF A;  2O4X B;  1BU1 A;  4NL2 A;  5AT1 B;  1X01 A;  5GMK j;  4OB1 B;  1QMC A;  1G83 A;  1NPR A;  3FJ5 A;  3U23 A;  1YHQ A;  1U1T A;  1YHQ Q;  1VA7 A;  1ZX6 A;  2CT4 A;  1VQ4 A;  4JPB W;  4JUV A;  3H0H A;  4M7D E;  4BI4 A;  3H0I A;  4OP0 A;  3QSU A;  4HKE A;  3JCM h;  1GBR A;  2HBW A;  1WXB A;  4A63 B;  1RAG B;  3EG0 A;  2F5K A;  2KR3 A;  2LQN A;  2KQW A;  2EQJ A;  2ZAE A;  2LX7 A;  1VQK A;  1VQK Q;  4M77 E;  4J9B A;  5LJ5 h;  4C92 B;  4M7A F;  2K5I A;  5KCO A;  2DK3 A;  2KDS A;  5M9O A;  1XOV A;  2D8J A;  3GOX A;  5GAN j;  1I0C A;  2HSE B;  1PCX A;  2RHI A;  4DOV A;  2PVD B;  1J3T A;  1GFD A;  4RTX A;  2LMJ A;  2D0Q B;  3CC7 T;  2GFU A;  2EJG A;  1FX7 A;  1UEC A;  3CCR A;  2XDP A;  4F7U B;  2JN0 A;  5GAO m;  2P0K A;  1PG5 B;  2DL8 A;  3CCM T;  1QCO A;  3PIP A;  1MND A;  4M7A C;  3OQ5 A;  3PVL A;  4RTT A;  1NJI U;  4LE9 A;  3I56 A;  3I56 Q;  5I2M A;  2HNI A;  1QVG S;  1K9A A;  5L23 A;  1FWZ A;  1YN8 A;  3MET A;  3LH5 A;  3HFN A;  2EGA A;  2XIC A;  3O5Z A;  2EQI A;  4F14 A;  2EBP A;  1X75 C;  2RD1 A;  2J6K A;  2VYT A;  4HCK A;  3GP8 A;  3JV3 A;  4C0F A;  4Y92 A;  3S3O A;  1BIB A;  4PJL A;  3VS2 A;  1JB0 E;  1WPY A;  2VVK A;  4E47 A;  3SEM A;  2EYW A;  4D8K A;  4ME7 A;  3MEW A;  5GAN 6;  1NPP A;  1IHW A;  3CC4 T;  3CBM A;  1LJO A;  1G5V A;  5IHN A;  1FMK A;  2FVU A;  5D6X A;  1U5S A;  1AEY A;  2XK0 A;  1XNI A;  2DTI A;  3JSC A;  2ZCF B;  1VQ9 Q;  2MCN A;  1VQ9 A;  2V26 A;  2LQ8 A;  5LL6 S;  3HP9 A;  3LW5 E;  4ESR A;  2XMF A;  1JXO A;  3L2Z A;  5GAO q;  4E7I A;  4HA8 A;  1T3S A;  2BE7 D;  3HFO A;  5AYF A;  3TVT A;  1UDL A;  1Y96 A;  2CT3 A;  4A4G A;  1KSW A;  2LT1 A;  1SRL A;  8AT1 B;  4LUD A;  2RJD A;  1VQ4 T;  2DYI A;  2M02 A;  2YDL A;  1Y0M A;  4JZ4 A;  1AWX A;  3ZEH A;  2EYY A;  3CD6 T;  4Z88 A;  2YUO A;  3CXC P;  3X26 B;  1N8R U;  4KH0 B;  1ABO A;  3QO3 A;  3OYK A;  3M0P A;  5LJ3 f;  3LX7 A;  4M78 A;  2KNB B;  2F1L A;  1YCY A;  3PTA A;  1W4S A;  3NTI A;  3L2V A;  4PJO A;  2DKG A;  2J06 A;  4RTV A;  1ARK A;  4JLI A;  3OSS C;  2DL3 A;  2RHZ A;  2P4T A;  1VQM A;  3WVE B;  1QKX A;  1JBM A;  5D6W A;  1IRE B;  3S3M A;  3CCR T;  3QJY A;  3JB9 D;  2VAS A;  4C0D C;  1M3A A;  1N27 A;  3OYH A;  2DET A;  3QBY A;  3VU3 C;  5LJ3 h;  3CXC A;  2KXD A;  1ZUU A;  2JTE A;  3JCM d;  3SFM A;  2JTM A;  2OJ2 A;  1IRX A;  2MWO A;  4WCI A;  3INZ A;  2SRC A;  4HXJ A;  3M57 A;  2RQR A;  2PVO B;  1GFC A;  1BI3 A;  1SRM A;  2CSI A;  2MOX A;  3EGD B;  1KQ2 A;  5GAN g;  2LCL A;  5GAN 3;  3REB B;  5I21 A;  2E3H A;  1WHJ A;  2F2X A;  2RQU A;  5CKD A;  1N9R A;  2VV5 A;  3KBG A;  3QDR B;  2J6F A;  4ZTJ A;  1VOM A;  5GMK h;  5CKE A;  2K3Y A;  1JU5 C;  3TQ7 P;  3EAE A;  1WQW A;  1PHT A;  2X4Y A;  4C8Q D;  2EQM A;  1YIT Q;  1YIT A;  3G6E Q;  1YNZ A;  4RKU E;  2LNH B;  3CCL Q;  4C5H A;  4M7D A;  3OYF A;  3JCM P;  2XDD A;  3DB3 A;  3PT9 A;  1RLQ C;  3VUZ A;  2RK1 A;  1PSE A;  2IIM A;  3VS0 A;  1OPL A;  3EGX B;  1OQK A;  3EG2 A;  1RUW A;  4CI0 C;  3RES A;  3E9G A;  1YJW T;  2QYZ A;  4HVV A;  3A8O B;  3CCQ T;  5KYU B;  3OBW A;  1RAA B;  3X24 B;  2DTH A;  2DBK A;  2C0I A;  2HD0 A;  4KUD K;  3T9N A;  3P8H A;  3AT1 B;  1TXQ A;  3CQT A;  2QQA A;  1ZUK A;  1VQO T;  1Y07 A;  4J9G A;  1AZG B;  1NBE B;  1PKT A;  4N0A C;  3JRZ A;  1BCM A;  1Q82 U;  3G71 A;  3G71 Q;  5D7U A;  1OU8 A;  1M2V B;  3HRS A;  4B6M A;  1P92 A;  4X9C A;  3PVQ A;  2AHJ B;  2OAW A;  4PJO F;  1WJS A;  4MZM A;  4QW2 A;  5C0M A;  2EFI A;  2R57 A;  4M75 F;  2XHC A;  4E7J A;  3JCM Q;  1VQM T;  1K0S A;  1M3B A;  4CC4 B;  2ZPB B;  1K4U S;  3OSV A;  2RJC A;  2RN8 A;  4M78 D;  1WHG A;  1UUE A;  3BY7 A;  1YJ9 A;  2A08 A;  2HMA A;  4IUQ A;  4J9C A;  3V7S A;  3HHT B;  2M0O A;  1DJ7 B;  2E65 A;  4XAX B;  4DA4 A;  3HTR A;  2CRE A;  1UJY A;  1D09 B;  4IUV A;  5D6Y A;  3CME A;  3CME Q;  2CSQ A;  2K9G A;  3QUI A;  4PJO C;  1R0B G;  1D0X A;  4RG2 A;  4M75 C;  1NG2 A;  2EKH A;  1YWO A;  1TUC A;  2YLB A;  2PTK A;  3GLX A;  5KYX B;  4M75 G;  5GAN 8;  5FRM A;  2KRM A;  2ATC B;  3TSZ A;  5IAY A;  4NOY A;  4AT1 B;  1QP3 A;  3EFO A;  4MZP A;  1G3Y A;  4J7F A;  2E4H A;  3CPW S;  5KYW B;  1VQ6 T;  2RF0 A;  2QXF A;  3RBB B;  3BDU A;  2GTO A;  1I81 A;  1LNX A;  2KI7 A;  4JRQ A;  4OMM A;  3BDL A;  3SHW A;  4JRP A;  1UE9 A;  2GNC A;  2DVJ A;  1UGP B;  5DLO A;  3QYG B;  2HDA A;  1QVF S;  4AFQ C;  3EH2 A;  1TOV A;  4XU2 A;  2WSE E;  2LT4 A;  3NMZ C;  1MV0 B;  4EDU A;  2EQK A;  2DFU A;  3M56 A;  2AT1 B;  4FL6 A;  2A36 A;  2KK4 A;  2RI5 A;  3FC3 A;  3OS1 A;  4F17 A;  5FU7 C;  2L3S A;  1VQL T;  2QA4 A;  2QA4 Q;  3EG9 A;  4C0D B;  1OX8 A;  1M8V A;  1RAD B;  4CC3 A;  3R6N A;  5J39 A;  1SF9 A;  2CZ6 B;  1VQN A;  4J6W A;  2L3R A;  1VQN Q;  2O9S A;  3QDF A;  2JMC A;  4CC2 A;  1NJI C;  1WYX A;  3CBP A;  1D1B A;  3A8H B;  3ULR B;  1WHK A;  2CKK A;  3E19 A;  4UC4 A;  2B8A A;  3EFS A;  4ORZ A;  4M7D C;  2X3X D;  4A4K A;  3OYE A;  1NJI R;  4M77 D;  1YIJ T;  1YWP A;  2R5A A;  2OX7 A;  3HRU A;  2DNU A;  1AD5 A;  1WA7 A;  1LVK A;  3H0F A;  3CCV A;  3ZBD A;  4Z89 A;  1HD3 A;  1NZ9 A;  2QEX T;  4LD6 A;  1YJ9 T;  4E7S A;  3C4S A;  4LXC A;  4PFO A;  1K0X A;  2LQK A;  2QTX A;  2W0Z A;  4O6J A;  1T0H A;  1VUB A;  1CKB A;  2OTL A;  4A4H A;  1PKS A;  2ZZD A;  3JCM e;  2L8D A;  5GAN d;  1PWT A;  2K2M A;  3JB9 H;  4OVA A;  2EYX A;  3UAT A;  2E3I A;  4F04 B;  4LUE A;  2WSC E;  1M5Q 1;  5LJ5 e;  3RNJ A;  4J9I A;  4L5G A;  4BI3 A;  1EX4 A;  1X69 A;  4M75 E;  3CCM A;  3CCM Q;  4XTW A;  3SD4 A;  1N8R C;  2FHD A;  2EGC A;  2EJF A;  5GJV B;  1HYO A;  1OV3 A;  4NS5 A;  3HKS A;  2CH4 A;  2DIQ A;  4EMH A;  1Y96 B;  4NL3 A;  2RI3 A;  2CUB A;  4LDY A;  3VS3 A;  2K2V A;  4BD3 A;  4LD9 K;  2VC8 A;  3DLL A;  1BK2 A;  3JAM E;  2DO3 A;  1N5Z A;  2O88 A;  1H92 A;  2MPX C;  4B9W A;  4J9F A;  4PK4 A;  3M0S A;  1D0Z A;  1MNE A;  4ELZ C;  2CUD A;  1XJW B;  4M78 B;  3P8B B;  3M55 A;  3JCM f;  2CZ7 B;  2EKO A;  2HEQ A;  3M53 A;  2X51 A;  3PMT A;  2QQR A;  3CMA A;  3CMA Q;  2LC4 A;  1FMV A;  2I0N A;  2DXC A;  4CRI A;  1M1K R;  4FYX B;  1QWF A;  1Q95 G;  1M27 C;  4J7I A;  3OW2 S;  3NFC A;  5GMK l;  2EJ9 A;  3M4G A;  4X9D A;  2JMA A;  3OYA A;  2LCS A;  4C92 E;  2YRD A;  1I5O B;  3HL8 A;  1VQ4 Q;  1RL2 A;  2LP5 A;  2ECZ A;  4RCC A;  3CCV T;  3CD6 A;  3CD6 Q;  3QG1 A;  2ED1 A;  1M90 U;  1NM7 A;  2LQW A;  1G3T A;  3F70 A;  4D6W A;  2EQU A;  2K4Y A;  3KUF A;  1MMD A;  2ZPF B;  2GCX A;  1JXM A;  2OTL T;  2E5K A;  4X1V A;  4KGZ B;  1X6B A;  3LYI A;  2JS2 A;  4HCC A;  2GTJ A;  3UT1 A;  1KJW A;  3QZ9 B;  1M9S A;  4PLI A;  5IHK A;  1BIA A;  3H9N A;  1VQ8 A;  1VQ8 Q;  1MHN A;  4A54 A;  2XKO C;  1QVG P;  1IGQ A;  1OI1 A;  3QXE B;  4Y91 A;  1YI2 T;  3HSB A;  4ATO A;  2O31 A;  2HKN A;  3CCR Q;  3A8L B;  4M7A D;  3VRZ A;  1B34 A;  4N4I A;  1TS9 A;  4M7D B;  4DBH A;  3OBY A;  3NTH A;  5IN1 A;  3L2W A;  1N9S A;  4PL6 A;  3M0T A;  4FYV B;  4M77 B;  3MPU B;  3JCM X;  1LCK A;  5IT9 E;  2GFA A;  5LJ3 e;  1Q82 C;  1WXU A;  2Y4Y A;  3MP1 A;  4DBR A;  2YUN A;  2L89 A;  1AT1 B;  1TSF A;  3A98 A;  3M0R A;  1K8A C;  5CK9 A;  2HQH A;  3GPL A;  3I5S A;  1QVG A;  4IKF A;  1Q82 R;  3C94 A;  2FPF A;  1UHC A;  4JLG A;  2D9T A;  3CMA T;  1OZ2 A;  1I5L A;  5KYY A;  1WXT A;  5FW9 A;  2W10 A;  1K8A R;  1HXD A;  5CQX A;  4PFP A;  3L2R A;  1QLY A;  5A0D A;  4XU0 A;  2J6O A;  3DB4 A;  1KC8 C;  1OU9 A;  2RM4 A;  1HSQ A;  2L3Q A;  2DL5 A;  5GMK e;  5GAM j;  4N0A A;  4EMK B;  1QQJ A;  4MDW A;  2CP0 A;  2EYZ A;  2H3J A;  3FIF A;  1KC8 R;  1M1F A;  3DKM A;  1QCF A;  4OB0 B;  4RTY A;  2HZY A;  2L2P A;  2MK5 A;  2IG0 A;  4J83 A;  1YJW A;  4JDS A;  1YJW Q;  3J81 E;  3SWN A;  1Q81 R;  2LJ0 A;  2EW3 A;  5FU6 C;  3CCQ A;  3WXM B;  3CCQ Q;  1D3B B;  4D8D A;  4E6R A;  1GCQ A;  3OYG A;  1SEM A;  3LGL A;  4J9E A;  1VQO A;  1VQO Q;  3EFO B;  3L42 A;  3PMI A;  1VQ7 T;  2CP7 A;  5CQY A;  1FMW A;  2K57 A;  3PFS A;  1X43 A;  4DOW A;  1UHF A;  1M4Z A;  2VKN A;  4C0Z A;  1VQ8 T;  3ZL7 C;  4M75 A;  1UB4 A;  1RLP C;  4XTX A;  1M1K U;  1SHG A;  1M1G A;  2DEQ A;  3A5Z B;  1VQM Q;  2NWM A;  1O9S A;  2DJQ A;  1BKB A;  4PLL A;  2X4J A;  1XQH A;  2DER A;  3RMQ A;  1U06 A;  4LDV A;  3URG A;  1S1N A;  1KHI A;  3CXC S;  2AKK A;  2D1X A;  2P84 A;  2DIG A;  2VB6 A;  3LGF A;  4FIB A;  2OAU A;  2O4X A;  3EG9 B;  7AT1 B;  5IHI A;  2KRS A;  1JJ2 P;  2V8I A;  3OYI A;  4RTW A;  3ZFJ A;  5HK3 A;  2QGF B;  3G1J A;  3ER0 A;  3EH1 A;  3V8J A;  4PJM A;  1EIF A;  3A8M B;  4AFU C;  4B9X A;  1H64 1;  1HJD A;  3FDR A;  1SPK A;  3NTK A;  1GCP A;  5CKF A;  1AOJ A;  4C0G A;  1WZO A;  1YFN A;  3G7Z A;  1VQ6 Q;  1VQ6 A;  2JM8 A;  1RAE B;  1QCN A;  3OS2 A;  5GAN f;  3DLM A;  4LDW A;  4C92 A;  2JZ2 A;  4C8Q F;  1PRM C;  2H3E B;  4J6X A;  2NLU A;  3RIR A;  4YTL A;  3M4Y A;  5KE2 A;  3UDC A;  2DXU A;  3GNG A;  1YP5 A;  1U1S A;  2F5T X;  4X34 A;  2K79 A;  2DMO A;  3V8K A;  5A2Q E;  2RI2 A;  1JJ2 A;  2KT1 A;  1VQL A;  1VQL Q;  1I4K 1;  2KYM A;  2KT8 A;  3X25 B;  1KQ1 A;  4M7A B;  3GF5 A;  2EIF A;  1MMN A;  2YT6 A;  3RMS A;  3A1P A;  4C8Q C;  2V1Q A;  2GQI A;  2QQS A;  2RMO A;  4FSS A;  5GAN h;  3OY9 A;  4C8Q G;  4MDX A;  4BUG A;  2K5L A;  2QAS A;  2JNG A;  2ZPG B;  4ZTF A;  2EPD A;  4LDX A;  2LDM A;  3S3N A;  3CCJ A;  2E6Z A;  2DA9 A;  3E1S A;  1GBQ A;  1QWE A;  2HKQ B;  2F69 A;  1WNL A;  1X6O A;  1YIJ A;  1YIJ Q;  4OB3 B;  4PJJ A;  1MGQ A;  1K8A U;  4OMO A;  4XU3 A;  1X2K A;  5GAM g;  3ASK A;  4IIM A;  4LNP A;  3SWN C;  2NYS A;  3EG1 A;  4Q5W A;  1PNJ A;  1LOJ A;  2KY9 A;  3CCE T;  1ZHI A;  3TU4 K;  1GCQ C;  2QEX A;  2QEX Q;  1YJ9 Q;  3L2Q A;  5I11 A;  1QP2 A;  5GJW B;  1C0M A;  4KH1 B;  2WAC A;  5A0L A;  4CC7 A;  1KC8 U;  2VXE A;  4PJO D;  4AG2 C;  3CPW P;  2A37 A;  2L3P A;  4M75 D;  1Q81 U;  2KVQ G;  2FRW A;  4MMK A;  4BAC A;  2GF7 A;  4GY5 A;  1OX9 A;  2CP3 A;  5FU6 B;  2A7Y A;  2CS7 A;  2RH2 A;  1QVF P;  2VWF A;  3JCM b;  2MWP A;  2QDY B;  2OTJ A;  2OTJ Q;  1XTD A;  1X27 A;  1IXD A;  2DE0 X;  2X35 A;  1NYG A;  4P5N A;  2KYB A;  5FWB A;  3N5B B;  2LJ3 A;  3EFR A;  2BZ8 A;  3PE0 A;  1M90 C;  4QVZ A;  3VV0 A;  1ZUY A;  2RA2 A;  4FT2 A;  1TH7 A;  1ZSZ A;  5GAM h;  2DPP B;  1UGQ B;  5LJ5 j;  1S72 T;  4C92 F;  1Z9Z A;  1JQQ A;  4C5E A;  4Z8A A;  2FRY A;  1M90 R;  1JRI A;  4C5I A;  2MI6 A;  3CPW A;  3GNF B;  2XD0 A;  1MUZ A;  2KBT A;  4OMP A;  3RKW A;  3I55 T;  1WIE A;  4F16 A;  4FCY A;  5CAI A;  1RI9 A;  1B3Q A;  1GRI A;  2DZ9 A;  2KMT A;  1VQ5 T;  1U3O A;  1QVF A;  4MZT A;  1R0C B;  3CCU T;  3REA B;  4AMC A;  2HQE A;  2FZK B;  4J6Y A;  3QII A;  3EGU A;  4C92 C;  2NUZ A;  2KXC A;  3HPW A;  1BI2 A;  1WJQ A;  2RHY A;  2F2V A;  4C92 G;  3I9Q A;  2ROT A;  1PD0 A;  3VS6 A;  3RKY A;  1ZLM A;  4HVU A;  4M7D D;  3VS4 A;  3CCJ T;  1KHC A;  4C8Q E;  4DEX A;  4KRT A;  4GBQ A;  5HKC A;  1PSF A;  3LH0 A;  1BI0 A;  3OYM A;  1KQS S;  2ZGW A;  1B34 B;  1WGS A;  3L1A A;  4FSX A;  4F7U G;  2GGR A;  1LPL A;  3RR6 A;  2QDL A;  3CCV Q;  4ZNX A;  5J3B A;  2BZY A;  2DIL A;  3M5A A;  4OMF B;  4BI8 B;  4DBF A;  4LN2 A;  4IUT A;  4ZGD B;  3V7C A;  2I2L A;  4HT9 A;  5ECA A;  1RAH B;  1RI0 A;  1UG1 A;  1OZ3 A;  5GAN 2;  1ABQ A;  1PM3 A;  2OTL Q;  2ENM A;  4HCZ A;  3UF4 A;  4OB2 B;  4AFS C;  3UWN A;  4L6V 5;  2RQW A;  3JB9 J;  3ME9 A;  2C06 A;  2LTO A;  4QQD A;  2RO0 A;  3VS1 A;  4FT4 A;  1YBY A;  4HT8 A;  4LDU A;  3GBQ A;  5KYY B;  2OTJ T;  1YI2 A;  1YI2 Q;  2R58 A;  2LX9 A;  2C0O A;  2LRQ A;  2E1H A;  3AHU A;  2FZG B;  1OPK A;  4RCB A;  1VIE A;  4A4E A;  2E64 A;  4IIO A;  5KYU A;  3QZ5 B;  5EG2 A;  5I2S A;  1UGV A;  4PNO A;  1BBZ A;  4BE1 A;  3OYN A;  4KBM B;  1K76 A;  2JVV A;  1K1Z A;  3RUX A;  1W2B S;  1C1A A;  2IPO B;  4KGX B;  1WLP B;  1QW1 A;  1X6G A;  2XG8 D;  1ZA2 B;  1SKU B;  4OMN A;  3MJX A;  1YCS B;  3MEV A;  4ZN1 A;  4XU1 A;  1I07 A;  3SWN B;  4BE0 A;  1UEB A;  2FYK A;  2CP2 A;  3SDZ A;  2LNV A;  3PIO A;  2BIV A;  2A0F B;  3OW2 P;  3CC2 T;  2EGE A;  3IQL A;  1NEB A;  1M1K C;  2BZX A;  3MP8 A;  4N4G A;  1KD1 U;  2EWN A;  2ABL A;  1K73 U;  1G2B A;  2DD5 A;  2QGG A;  5L8R E;  1ZSZ C;  3JCM g;  4E7K A;  2RQT A;  4RMO A;  1A0N B;  3H6Z A;  4FU6 A;  5LJ3 j;  2YXY A;  3C95 A;  4PJO B;  2EVR A;  1SSH A;  2DXT A;  4M75 B;  1Y71 A;  2A3L A;  1WJR A;  5LJ5 g;  5FLX E;  3MO8 A;  3V8L A;  5GAM d;  1VQP T;  1JEG A;  2PVG B;  2M51 A;  4PFZ A;  5GMK i;  1KK7 A;  2M16 A;  2DL7 A;  3M54 A;  3E9F A;  3LLR A;  2JT4 A;  3KFV A;  1AWO A;  3BW1 A;  3OW2 A;  4R0K A;  4HCB A;  1MMG A;  2D8H A;  4A53 A;  5GAN 4;  1SG5 A;  2AKL A;  4J9D A;  4FW1 A;  1ZBJ A;  4F7U E;  1IB8 A;  2X9H A;  1PD1 A;  5FU7 B;  1M3C A;  4ZN3 A;  2K6D A;  4JJB A;  2B86 A;  2NUP A;  1YJN T;  1VQ7 A;  1VQ7 Q;  2DJZ A;  4QKU A;  4BDZ A;  5IXF A;  2FPD A;  2NUT A;  4OGC A;  3UA7 A;  1O75 A;  2FB7 A;  1D0Y A;  4KUL A;  3OMG A;  3MP6 A;  8ATC B;  4TVR A;  1H3H A;  1RAB B;  4AG1 C;  3M0Q A;  1AHJ B;  5FWC A;  1W1F A;  1ZQ1 A;  2PZ1 A;  2YSQ A;  2Z0W A;  2ZPE B;  2DBM A;  5KYN A;  3HRT A;  1AVZ C;  4ZGJ B;  1EZZ B;  1BI1 A;  3D7S B;  4JJN K;  1WDX A;  2FL7 A;  4M7A G;  1M2O A;  4V2S A;  2JM9 A;  4FYY B;  1PRL C;  1SSF A;  4BB7 A;  4ZGE B;  4IUR A;  1TU0 B;  5GMK m;  3MEU A;  2RQV A;  2VXF A;  4JRK A;  1TG0 A;  2M1H A;  3G4S T;  4E7H A;  1AWJ A;  1VYU A;  3QPH A;  3FLG A;  4C8Q A;  1G3S A;  3THK A;  1TWB A;  2JUF A;  3CPF A;  2KSS A;  2YUP A;  3OYD A;  1Q86 U;  5IXB A;  1Z9Q A;  1ZBX A;  1MV3 A;  4GLK A;  1U8R A;  1Q81 C;  1BCO A;  2AZS A;  3JCM W;  2PUK B;  4J9H A;  4JJD A;  2DRM A;  1BB9 A;  2D0N A;  1K9M U;  1CSK A;  3BFM A;  3LWI A;  2KRN A;  3H41 A;  2MIO A;  2O9V A;  2E6N A;  3MCA B;  3CEY A;  2RJE A;  2YUQ A;  4ANJ A;  4QVD A;  2YHT A;  1N6A A;  2PQW A;  1KG1 A;  2P0P A;  2DRK A;  3I35 A;  4PKC C;  2P4R A;  2P0Q A;  2D6F A;  4BY6 C;  1CKA A;  4AFZ C;  3FEO A;  3MKD A;  4II1 A;  1HK9 A;  3TRE A;  4BE2 A;  2V1R A;  1YHQ T;  3OYY A;  2VGM A;  5LJ3 g;  3GIB A;  2JW4 A;  2MAM A;  5GAO n;  2E5Q A;  3JCM c;  2CZ1 B;  1OEB A;  3SB2 A;  3E2U A;  4RTZ A;  2O2O A;  2QQ9 A;  4JS5 A;  2HL5 C;  5GAN e;  2DX1 A;  3CCS A;  3CCS Q;  2CP5 A;  1VQK T;  2L0A A;  1RAC B;  1OOT A;  1RAF B;  4QVC A;  3FJP A;  2PNI A;  5CIU A;  3JB9 F;  1ZSZ B;  2DXB A;  1WX6 A;  1NYF A;  3PGG A;  3CCE A;  3CCE Q;  2QQB A;  5FRN A;  2QTV A;  1KIK A;  2M0Y A;  3M58 A;  4MML A;  3JCM J;  2E70 A;  1TUD A;  5GAO p;  4OGE A;  3EHR A;  1D1A A;  3OYC A;  1QVP A;  2DLP A;  1V76 A;  4O5V A;  1V1C A;  2DF6 A;  2COW A;  1B7T A;  1C6V X;  2ROL A;  4OMQ A;  4L59 A;  2HSP A;  2KEA A;  5HK0 A;  5DY9 A;  4IUU A;  2Y90 A;  5J26 A;  2HAX A;  3RER A;  3JB9 G;  2BE9 B;  3EG3 A;  3I56 T;  2XDB A;  2GQV A;  1WFW A;  1PC0 A;  3CBO A; 
#chains in the Genus database with same CATH homology
 5I2M A;  4R55 A;  2HNI A;  3SD4 A;  3EFR A;  1QVG S;  1N8R C;  1FWZ A;  2FHD A;  3X20 B;  3MET A;  2EJF A;  3J80 E;  1M90 C;  4NS5 A;  4QVZ A;  3HKS A;  3HFN A;  3VV0 A;  4M7A E;  2DIQ A;  2XIC A;  1Y96 B;  5CKH A;  2RA2 A;  4EMH A;  4FT2 A;  1TH7 A;  4NL3 A;  2RI3 A;  5GAM h;  2DPP B;  4LDY A;  1X75 C;  2RD1 A;  1UGQ B;  2VYT A;  2PUO B;  3P8D A;  4ELY C;  5LJ5 j;  5LJ5 d;  3GP8 A;  4C0F A;  3S3O A;  2K2V A;  4BD3 A;  1S72 T;  4C92 F;  4LD9 K;  2VC8 A;  1BIB A;  2WSF E;  1S72 A;  3TCJ A;  4C5E A;  3DLL A;  1JB0 E;  2DVE A;  3FRN A;  1WPY A;  3JAM E;  1JRI A;  2DO3 A;  4E47 A;  4B9W A;  4C5I A;  2O01 E;  2MI6 A;  3CPW A;  4ME7 A;  3MEW A;  3PNW C;  3GNF B;  3JB9 I;  5GAN 6;  4J8O A;  2EYQ A;  2XD0 A;  1JJ2 S;  1NPP A;  4ELZ C;  3RKW A;  3I55 T;  4M78 B;  3P8B B;  3CBM A;  5GAM e;  5CAI A;  3CC4 T;  3M55 A;  1LJO A;  3JCM f;  3OS0 A;  1G5V A;  3I55 A;  2FVU A;  2MMP A;  2CZ7 B;  5D6X A;  2DZ9 A;  2KMT A;  2EKO A;  3OYJ A;  1VQ9 T;  1VQ5 T;  2XK0 A;  1XNI A;  5CCA A;  3M53 A;  1QVF A;  3PMT A;  2YLC A;  4MZT A;  2QQR A;  3CCU T;  1IZ6 A;  2HQE A;  2DTI A;  2DTO A;  3JSC A;  2ZCF B;  4J6Y A;  3QII A;  5CO7 A;  4F7U A;  3CMA A;  2LC4 A;  1VQ5 A;  1VQ9 A;  2DXC A;  4CRI A;  5GAN 5;  2LQ8 A;  4C92 C;  2LVM A;  3CCU A;  3HPW A;  1BI2 A;  5J26 A;  3G6E A;  5LL6 S;  1WJQ A;  2RHY A;  3HP9 A;  4J7I A;  4C92 G;  3OW2 S;  3LW5 E;  3NFC A;  4Z02 A;  2EJ9 A;  5GMK l;  2YRV A;  3CCL A;  1G3W A;  3L2Z A;  3M4G A;  4X9D A;  5GAO q;  3RKY A;  3OYA A;  4E7I A;  4HA8 A;  3A8G B;  3HFO A;  2EAY A;  5AYF A;  4M7D D;  4C92 E;  1Q7Y C;  3CCJ T;  2X4X A;  1KHC A;  1Y96 A;  2XID A;  3C12 A;  4A4G A;  4C8Q E;  3V7R A;  2LT1 A;  5HKC A;  2CGH A;  4M77 A;  2RJD A;  1VQ4 T;  3ZEH A;  1PSF A;  3LH0 A;  1BI0 A;  3HL8 A;  3CD6 T;  3OYM A;  1KQS S;  2ZGW A;  1B34 B;  2PU9 B;  1WGS A;  1RL2 A;  2ZPI B;  3L1A A;  4FSX A;  3CCS T;  3X26 B;  2M9U A;  4RCC A;  3CCV T;  3CD6 A;  1N8R U;  4QQG A;  4F7U G;  2VGN A;  4BDY A;  3QG1 A;  1M90 U;  3QO3 A;  3QKJ A;  3OYK A;  3UPU A;  1G3T A;  5LJ3 f;  3F70 A;  3LX7 A;  4D6W A;  2EQU A;  2K4Y A;  4M78 F;  5J3B A;  3M5A A;  3KUF A;  4N4H A;  4OMF B;  4M78 A;  2IVW A;  4BI8 B;  4IUT A;  2ZPF B;  5GAN 7;  5GAO r;  4ZGD B;  1KD1 C;  2GCX A;  2OTL T;  1YCY A;  3V7C A;  2I2L A;  4HT9 A;  2V8J A;  1RI0 A;  1W4S A;  3PTA A;  1OZ3 A;  1K73 C;  5GAN 2;  3LYI A;  3NTI A;  4HCZ A;  4J5Y A;  4OB2 B;  5GAM f;  4HCC A;  3L2V A;  3Q1J A;  3MEA A;  3UT1 A;  2DKG A;  4PJO A;  3QZ9 B;  3TEE A;  2V8K A;  1M9S A;  3UWN A;  4R56 A;  4PLI A;  3S6W A;  4JLI A;  2VUB A;  3OSS C;  4L6V 5;  1BIA A;  3JB9 J;  1VQ8 A;  3ME9 A;  2C06 A;  1MHN A;  2RHZ A;  2P4T A;  4A54 A;  2XKO C;  2LTO A;  1VQM A;  3WVE B;  4JS4 A;  1JBM A;  1OI1 A;  1IRE B;  2K3X A;  4QQD A;  5D6W A;  2RO0 A;  3S3M A;  3QXE B;  2K5F A;  4Y91 A;  4F7U B;  3CCR T;  3QJY A;  4EMK A;  4FT4 A;  2XU8 A;  1YBY A;  3VKI A;  2DAQ A;  3JB9 D;  1YI2 T;  4LDU A;  4C0D C;  4HT8 A;  3HSB A;  4ATO A;  4M78 C;  1N27 A;  3OYH A;  2OTJ T;  1YI2 A;  3A8L B;  2R58 A;  3VUB A;  2LX9 A;  4M78 G;  4M7A D;  4KUI A;  2LRQ A;  2E1H A;  2X4W A;  3AHU A;  3QBY A;  3VU3 C;  4RCB A;  5LJ3 h;  3CXC A;  1VIE A;  4XTV A;  4A4E A;  2E64 A;  4BY6 B;  1B34 A;  2QI2 A;  2ZPH B;  3QZ5 B;  3JCM d;  4N4I A;  5EG2 A;  3SFM A;  2JTM A;  4XTY A;  1D3B A;  2E41 A;  4M7D B;  3WVD B;  4PNO A;  5I2S A;  4BE1 A;  3OYN A;  4KBM B;  4PJO G;  3OBY A;  2MWO A;  3NTH A;  5IN1 A;  3L2W A;  2JVV A;  1W2B S;  3RUX A;  1N9S A;  3H8Z A;  4PL6 A;  3INZ A;  3M57 A;  1QW1 A;  2XG8 D;  4M77 B;  2PVO B;  5FRO A;  3JCM X;  1BI3 A;  5IT9 E;  1KQ2 A;  3MEV A;  5GAN g;  2GFA A;  2LCL A;  5LJ3 e;  1Q82 C;  4JRI A;  4ZN1 A;  2CZ0 B;  2Y4Y A;  3MP1 A;  4XU1 A;  3SWN B;  5GAN 3;  4BE0 A;  1UEB A;  2FYK A;  2L89 A;  5I21 A;  3SDZ A;  1GXI E;  2LNV A;  3PIO A;  2BIV A;  5CKD A;  1N9R A;  1VIF A;  1K8A C;  2VV5 A;  5CK9 A;  3CC2 T;  1QVG A;  3GPL A;  3KBG A;  4IKF A;  2XI9 A;  3QDR B;  1M1K C;  4ZTJ A;  3CC2 A;  3MP8 A;  4N4G A;  5GMK h;  3C94 A;  5CKE A;  1KD1 U;  2EWN A;  2K3Y A;  3VJP A;  4JLG A;  3EAE A;  2D9T A;  1K73 U;  3O8V A;  3CMA T;  1OZ2 A;  2DD5 A;  5L8R E;  1I5L A;  4E7K A;  3JCM g;  1YIT T;  4RMO A;  4F7U F;  4C92 D;  1WQW A;  3G6E T;  1HXD A;  3H6Z A;  2BKD N;  4FU6 A;  5LJ3 d;  5LJ3 j;  3OYL A;  5CQX A;  2X4Y A;  3C95 A;  2EQM A;  4XTU A;  4C8Q D;  1YIT A;  4PJO B;  3CCL T;  3L2R A;  5A0D A;  4RKU E;  4XU0 A;  2DXT A;  3DB4 A;  4M75 B;  1KC8 C;  1Y71 A;  4M7D F;  2A3L A;  4C5H A;  1WJR A;  4M7D A;  2RM4 A;  3OYF A;  3JCM P;  2XDD A;  3DB3 A;  5HY6 A;  5LJ5 g;  3PT9 A;  1UGS B;  5FLX E;  4A4F A;  5C6S A;  3VUZ A;  3MO8 A;  2RK1 A;  5GMK e;  3V8L A;  5GAM d;  5GAM j;  1PSE A;  4N0A A;  1VQP T;  2PVG B;  4EMK B;  4MDW A;  4WF2 A;  3OA6 A;  3FB9 A;  5GMK i;  2BUD A;  4CI0 C;  2H3J A;  3M59 A;  4M77 F;  3RES A;  3E9G A;  2M16 A;  3FIF A;  1VQP A;  5DLQ E;  3M54 A;  1M1F A;  3DKM A;  1YJW T;  3A8O B;  3E9F A;  4OB0 B;  3VYH B;  3CCQ T;  2IG0 A;  4J83 A;  5KE3 A;  3LLR A;  4JDS A;  5DM7 R;  3OBW A;  3SWN A;  3J81 E;  1YJW A;  3X24 B;  2DTH A;  3BW1 A;  5FU6 C;  3CCQ A;  3WXM B;  4KUD K;  2HD0 A;  3OW2 A;  1D3B B;  3T9N A;  4HCB A;  3P8H A;  3KXT A;  2DD4 A;  2RB6 A;  2QQA A;  4A53 A;  4Y28 E;  3OYG A;  5GAN 4;  3J7A F;  3LWH A;  4F7U E;  1VQO T;  4M7D G;  1Y07 A;  3G71 T;  3MHX A;  4N0A C;  2HBP A;  3LGL A;  2CYZ B;  3JRZ A;  1VQO A;  1Q82 U;  3L42 A;  3G71 A;  3RKX A;  3PMI A;  1VQ7 T;  3HRS A;  4M77 C;  1P92 A;  4X9C A;  2L5Q A;  5CQY A;  5FU7 B;  4ZN3 A;  1KQS A;  2AHJ B;  4PJO F;  1WJS A;  2K57 A;  1Y7X A;  3PFS A;  2HQX A;  4M77 G;  3OS5 A;  4MZM A;  2RJF A;  4QW2 A;  4DOW A;  1M4Z A;  4OF1 A;  5C0M A;  2DJZ A;  2EFI A;  2R57 A;  4C0Z A;  4M75 F;  1YJN T;  1VQ8 T;  1VQ7 A;  2XHC A;  4E7J A;  2DZC A;  1UB4 A;  4M75 A;  4XTX A;  3JCM Q;  4BDZ A;  1VQM T;  1Q86 C;  3VYG A;  1YJN A;  2ZPB B;  1M1K U;  4VUB A;  1M1G A;  1UGR B;  2DEQ A;  3A5Z B;  3OSV A;  4IUP A;  2Y4X A;  3X28 B;  4E7L A;  1O9S A;  2RJC A;  1BKB A;  2X4J A;  4PLL A;  1XQH A;  4M78 D;  4OGC A;  3RMQ A;  5A0G A;  1O75 A;  3BY7 A;  1YJ9 A;  4IUQ A;  4M7A A;  2FB7 A;  4LDV A;  5CVI A;  3URG A;  3HHT B;  3V7S A;  4EPC A;  4KUL A;  4C8Q B;  1KHI A;  2M0O A;  1DJ7 B;  3CXC S;  2E65 A;  3OMG A;  3MP6 A;  4XTZ A;  2DIG A;  4TVR A;  4XAX B;  1K9M C;  1I8F A;  4DA4 A;  4XQ3 A;  3CME T;  3LGF A;  1V29 B;  4FIB A;  1AHJ B;  2RHU A;  4IUV A;  5D6Y A;  2OAU A;  3CME A;  4M78 E;  3QUI A;  2O4X A;  4RG8 A;  4PJO C;  3OMC A;  1ZQ1 A;  2KAF A;  1Q7Y U;  4RG2 A;  4M75 C;  2V8I A;  2YLB A;  3OYI A;  3ZFJ A;  5HK3 A;  3GLX A;  5GAN 8;  2ZPE B;  4M75 G;  5FRM A;  3ER0 A;  3HRT A;  1FXX A;  3V8J A;  1EIF A;  3A8M B;  3R6O A;  4FM4 B;  5IAY A;  3CC7 A;  4NOY A;  4PJO E;  4ZGJ B;  4B9X A;  4EMK C;  1BI1 A;  3OYB A;  1H64 1;  4JJN K;  1QP3 A;  4MZP A;  1G3Y A;  4J7F A;  3FDR A;  2G3R A;  2FL7 A;  3NTK A;  3CPW S;  4M7A G;  2E10 A;  5CKF A;  1VQ6 T;  2QXF A;  3BDU A;  3OB9 A;  4V2S A;  1WQ7 A;  4C0G A;  1I81 A;  1LNX A;  3G7Z A;  4XK8 E;  4JRQ A;  1VQ6 A;  1SSF A;  4BB7 A;  4ZGE B;  3M9Q A;  3QYH B;  4IUR A;  3BDL A;  5GMK m;  4JRP A;  3MEU A;  2LCC A;  3OS2 A;  1W2B A;  2VXF A;  4JRK A;  5GAN f;  5GAO l;  1UGP B;  5DLO A;  3QYG B;  2M1H A;  3DLM A;  5CKB A;  4LDW A;  2JOY A;  2R5M A;  2MF2 A;  3G4S T;  4C92 A;  1QVF S;  4DQ2 A;  3QJ6 A;  4E7H A;  2JZ2 A;  2RHX A;  4C8Q F;  3QPH A;  1NE8 A;  4J6X A;  2NLU A;  2WSE E;  3FLG A;  2LT4 A;  4XU2 A;  3RIR A;  4C8Q A;  4YTL A;  4EDU A;  3G4S A;  2EQK A;  3M4Y A;  5KE2 A;  3M56 A;  1G3S A;  2RK2 A;  2DXU A;  2JUF A;  3CPF A;  3GNG A;  4FL6 A;  3UDC A;  2KSS A;  2KK4 A;  2QA4 T;  3OYD A;  2RI5 A;  3FC3 A;  3QHS A;  1Q86 U;  3OS1 A;  1U1S A;  1ZBX A;  5FU7 C;  2F5T X;  4X34 A;  1VQL T;  2QA4 A;  3V8K A;  5A2Q E;  4C0D B;  2RI2 A;  4GLK A;  1JJ2 A;  5CR2 A;  4C5G A;  1M8V A;  4EMG A;  3JCM V;  1VQL A;  1U8R A;  1Q81 C;  4QQ6 A;  1I4K 1;  3X25 B;  2PUK B;  3JCM W;  3CC4 A;  1KQ1 A;  4KT0 E;  1VQN T;  4M7A B;  3GF5 A;  2EIF A;  5J39 A;  3L2U A;  1BYM A;  1K9M U;  3BFM A;  3LWI A;  2CZ6 B;  1R8O B;  5KCH A;  4J6W A;  2L3R A;  3RMS A;  1VQN A;  2E6N A;  1H3Z A;  5KH6 A;  3MCA B;  3CEY A;  2RJE A;  4C8Q C;  4QVD A;  5LJ5 f;  2E12 A;  2QQS A;  2YHT A;  1N6A A;  2PQW A;  5GAN h;  3OY9 A;  1KG1 A;  2P0P A;  4C8Q G;  1NJI C;  1OYX A;  4PKC C;  4MDX A;  2JTF A;  2P0Q A;  2O4X B;  4BUG A;  2D6F A;  2K5L A;  3CBP A;  4BY6 C;  3A8H B;  4NL2 A;  2JNG A;  2ZPG B;  4ZTF A;  2CKK A;  3E19 A;  3FEO A;  4UC4 A;  2B8A A;  1X01 A;  3EFS A;  4II1 A;  1HK9 A;  4OB1 B;  2LDM A;  3TRE A;  4A4K A;  5GMK j;  4BE2 A;  1YHQ T;  3S3N A;  4LDX A;  3OYY A;  3CCJ A;  2E6Z A;  2VGM A;  5LJ3 g;  1NPR A;  3GIB A;  2MAM A;  5GAO n;  3OYE A;  2E5Q A;  3E1S A;  4M7D C;  1YHQ A;  1U1T A;  2CZ1 B;  3JCM c;  4M77 D;  1VQ4 A;  1YIJ T;  3SB2 A;  2R5A A;  2F69 A;  1WNL A;  4JUV A;  1X6O A;  3HRU A;  4M7D E;  2QQ9 A;  4JS5 A;  1YIJ A;  4BI4 A;  4OP0 A;  3QSU A;  4OB3 B;  4HKE A;  3JCM h;  5GAN e;  2HAX A;  3RER A;  2F5K A;  1MGQ A;  3CCS A;  1K8A U;  4XU3 A;  1VQK T;  3CCV A;  5GAM g;  3ASK A;  3SWN C;  2KQW A;  3ZBD A;  2EQJ A;  4QVC A;  4Q5W A;  1NZ9 A;  3FJP A;  1LOJ A;  1VQK A;  2KY9 A;  5CIU A;  2QEX T;  3CCE T;  4M77 E;  1ZHI A;  2DXB A;  4LD6 A;  3TU4 K;  3JB9 F;  1YJ9 T;  3C4S A;  3I56 A;  2LQK A;  2QTX A;  3PGG A;  3CCE A;  2QEX A;  5GAO m;  5LJ5 h;  4O6J A;  4C92 B;  2QQB A;  4M7A F;  2K5I A;  5FRN A;  5KCO A;  3L2Q A;  1VUB A;  2OTL A;  2DK3 A;  1QP2 A;  3M58 A;  2KDS A;  4MML A;  4A4H A;  2ZZD A;  5M9O A;  1XOV A;  2WAC A;  2E70 A;  3JCM J;  5GAO p;  5A0L A;  3JCM e;  4OGE A;  3GOX A;  2L8D A;  5GAN d;  5GAN j;  1KC8 U;  2VXE A;  4PJO D;  3OYC A;  1QVP A;  4O5V A;  4M75 D;  3JB9 H;  4OVA A;  2RHI A;  1Q81 U;  2KVQ G;  4DOV A;  2PVD B;  4MMK A;  4BAC A;  2WSC E;  2GF7 A;  1M5Q 1;  2D0Q B;  3CC7 T;  4L59 A;  2GFU A;  2EJG A;  5LJ5 e;  1FX7 A;  4GY5 A;  3CCR A;  5HK0 A;  2XDP A;  4IUU A;  2Y90 A;  2JN0 A;  4L5G A;  2P0K A;  2A7Y A;  2CS7 A;  2RH2 A;  5DY9 A;  5FU6 B;  4BI3 A;  3JCM b;  2MWP A;  3CCM T;  3JB9 G;  2QDY B;  3PIP A;  2OTJ A;  1XTD A;  4M75 E;  4M7A C;  3I56 T;  2XDB A;  2X35 A;  2GQV A;  4P5N A;  3OQ5 A;  1NJI U;  3CCM A;  4XTW A;  3N5B B;  3CBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...