1VIFA

Structure of dihydrofolate reductase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
PSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROFOLATE REDUCTASE
publication title A plasmid-encoded dihydrofolate reductase from trimethoprim-resistant bacteria has a novel D2-symmetric active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 12
structure length 60
sequence length 60
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 1996-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1vifA00
1VIFA 1VIEA 2GQVA 2OAUA 2P4TA 2RK2A 2RH2A 3T9NA 2VV5A 2RK1A 3UDCA 3SFMA
chains in the Genus database with same CATH superfamily
1YWOA 3CXCP 3JB9H 2HDAA 2K2VA 4XU0A 1KSWA 1OU9A 2DTIA 2YRVA 1VQ5T 2EVRA 3ASKA 2EIFA 1G3YA 1K8AU 2COYA 3GNFB 1NM7A 1BB9A 1RUWA 2IG0A 1SRLA 3NTIA 4C92G 2E6ZA 2AZSA 1KFZA 4LUEA 4C92F 4DBFA 2E64A 1ZUYA 4PKCC 1N9SA 2KGTA 1IO6A 2GF7A 2CT3A 1N9RA 3QKJA 2RPNA 4B9XA 2K7AA 2Y4XA 2BKDN 2LC4A 4IUUA 4J6XA 2C0OA 4Y92A 1JB0E 1SKUB 4C5IA 1NZ9A 4PJOD 4FU6A 3NMZC 5AYFA 3CCQT 1NEGA 4PJJA 3M55A 2M02A 2O9SA 5GMKj 1FXXA 1RL2A 4CC4B 1GBRA 4KUIA 2K3XA 4AFQC 2HQHA 9ATCB 1HSQA 2D0NA 2M1HA 3ME9A 5HK3A 2KNBB 1QP2A 3TQ7P 5LJ3e 1YIJA 3URGA 2KQWA 4XTVA 4KGZB 3LLRA 4FW1A 3MO8A 3PNWC 1W2BS 1AZGB 1YJWQ 4NS5A 3CCQA 3VU3C 3VS7A 2D6FA 4LDYA 4PJOB 2DEUA 2E4HA 2LQNA 4QT7A 2JJ9A 4PJLA 3X26B 3L2VA 2DEQA 1D0YA 3OYGA 4GBQA 3CC7T 2OTJT 4Q5WA 2LZ6B 4HVWA 4JDSA 3EH2A 3CCMQ 4FYVB 1ZHIA 4PNOA 3VS0A 4RCBA 1O75A 1ZX6A 2JXBA 1WXUA 1A0NB 1YJ9Q 1ZSZA 4KGVB 4MMKA 1WLPB 1KJWA 3R6NA 4PL6A 5GAOr 2R5MA 4A4GA 1AWOA 2ED1A 3G7ZA 4J9HA 4AFZC 4JJCA 2FRWA 5LJ5f 4RTWA 3G1JA 2GBQA 3QIIA 4J9IA 4GY5A 4CC3A 3VUBA 4M78E 5KH6A 1N27A 1G3WA 2M0YA 2DXBA 2AK5A 2QEXT 2EFIA 2L0AA 4C8QD 2K5IA 5CQYA 1UG1A 3F70A 4Z8AA 3OYBA 2JS0A 4M7DE 1ZSZC 5A0GA 1Y57A 1U5SA 1UB4A 1MMGA 5GAMh 3M4YA 5IHIA 3OS0A 1UEBA 3J81E 5FROA 1K0SA 1FMKA 2X4YA 4OB0B 3G4SA 1VQNA 3ULRB 1VQ6T 3LW5E 3S3NA 2O4XB 4M77G 2CP0A 4OMNA 1IGQA 1MHNA 2L3QA 4M77F 2YUPA 2RNAA 1YHQQ 4F7UA 1UHFA 2LT4A 3JCMc 1CSKA 3M0UA 4FM4B 4JS4A 3EH1A 2EQKA 4C0DC 4N4GA 4M7AE 1ACMB 3QYGB 1Q86R 4FT4A 4C8QB 1OZ3A 1M5Q1 2P84A 1I4K1 1M90U 1H8KA 2E6NA 3OW2A 1WXTA 1UGQB 2EAYA 5I2SA 4L59A 5C6SA 5CKEA 4ZGEB 1W2BP 2MWOA 4D8DA 3DLMA 1M9SA 2BZ8A 5IHNA 1ARKA 3OYMA 1WYXA 1X75C 4DBQA 2HKNA 3M0SA 1M3BA 3QXEB 3C4SA 3HFNA 1JU5C 1VQMT 1M1KC 1AVZC 4VUBA 2XDBA 2Z0WA 2HQXA 3OS2A 3OMCA 5LJ3g 1VQ7T 2DVEA 2HEQA 4RG8A 3CC2A 1Q86C 2DF6A 2RM4A 3NFCA 3VS1A 2D8JA 2L8DA 1QP3A 1ZSZB 2EQUA 2MOXA 3I56T 2W10A 4C92A 3CPWP 2XG8D 1V76A 3C95A 2CUDA 4CC2A 3HHTB 1B34B 2BZYA 2J06A 1RAGB 4NL3A 3OYYA 4RTTA 3O5ZA 3GNGA 1WZOA 1LJOA 4IURA 4II1A 2K79A 2A3LA 2RHUA 2RO0A 4Z88A 1ZBXA 2HZYA 4AG2C 2RJDA 2FEIA 3G6EA 2ZPHB 3UPUA 4C92C 1VYTA 1K9MR 2MF2A 1T3SA 4C0GA 2R5AA 5GAMe 2RQTA 2DIQA 1NEBA 3M54A 3JCMb 3ZFJA 1WQ7A 2O01E 4E7ZA 3OBWA 2ED0A 3UF4A 5KYUB 3CD6A 2XMFA 4PK4A 5CKFA 2LNHB 1BIAA 1RAHB 1U1TA 3JB9J 2GGRA 5CK9A 4F7UB 3FJPA 2DD4A 3KBGA 5GANd 1VIEA 3OMGA 3G4SQ 3S3MA 1B3QA 1SSHA 2PNIA 4QVDA 3OW2S 3CMAT 1J3TA 3OSVA 1WDXA 3L42A 1RLPC 2AKLA 1VQ9A 2HSPA 2OAUA 2FHDA 3ZEHA 2DE0X 2KAFA 2KY9A 2MMPA 3PMIA 1VQ8A 5FW9A 2QA4T 1M1KU 3CCST 3CC4A 2CP6A 4EMKB 3OYJA 1MNDA 2NYSA 3VS4A 2P0KA 5J26A 4V2SA 5L23A 1N5ZA 3REAB 1U3OA 2YRCA 4XK8E 4XTXA 1WX6A 1DJ7B 5A2QE 4EDUA 3QHSA 3EGUA 1BK2A 5GMKl 4KH0B 5CIUA 3L1AA 4XTZA 1BIBA 3RMSA 1YJNA 4IUTA 2QA4A 1M1GA 3EG9A 2NUTA 1YWPA 3RMQA 2RJCA 3MKDA 4J9BA 4CRIA 5KYNA 1ZBJA 2DZ9A 3EAEA 1VA7A 2L3SA 2J05A 1AWWA 1QKXA 2CS7A 1G2BA 2RHYA 2PVOB 4RCCA 1KQSA 2K4YA 2KEAA 3HP9A 3OYFA 1E7OA 1MMNA 1XOVA 2CUBA 5KCHA 3OYCA 1XNIA 2LJ3A 4J9DA 2EYZA 4WTOB 5DY9A 2F5KA 4M77A 1NPRA 3FEOA 2NWMA 4KRTA 2JNGA 3CCJQ 2IVWA 1WPYA 3RBBB 1JBMA 1RAIB 2CP3A 5IAYA 1S72A 4J9EA 2DJZA 3OYAA 1K8AR 1D3BA 2FPEA 3OS5A 2KRNA 4EMGA 4R55A 3G6EQ 2LJ0A 1H3ZA 2DRMA 3JCMQ 2DPPB 1ZUKA 2KSSA 4RKUE 3EG2A 2E41A 2C0IA 4M77C 2QK0A 1OI1A 2DXCA 8AT1B 4F7UE 3SEMA 2GFAA 2DA9A 4OMPA 3MP8A 2PQWA 3GLXA 1QW1A 4O5VA 2XI9A 3SFMA 4C5HA 3CCVA 3VS3A 1N6AA 1WA7A 2DO3A 1X6OA 1G3SA 5GAMj 1MMDA 5GAMg 1D0ZA 2LNVA 3RKYA 1OZ2A 3JB9G 1E6HA 3G71A 1Z9ZA 1AWXA 1VQ9Q 1TWBA 2KROA 2CZ6B 1KQ2A 2CSQA 3HL8A 2VB6A 3RKXA 3O8VA 2V8JA 1D0XA 2COZA 2M0OA 1VQ8Q 4HVVA 3CCUQ 4X1VA 4RTYA 1VQPA 1MV3A 3NPFA 1EZZB 2HBWA 5CCAA 2HNIA 4FT2A 2E5KA 2SEMA 2X4WA 4JPBW 1X6BA 4P5NA 2X35A 3PGGA 5A0DA 5HKCA 2AZVA 1XJWB 3EG1A 3RIRA 3GF5A 3UA6A 2RI5A 1SSFA 4E7SA 1KQSS 2DXUA 3QDFA 4B6MA 3CCMT 2QYZA 4C92E 1X69A 3I55A 2L2PA 2RHZA 4PFZA 2XK0A 2GCXA 3LGFA 2P4TA 2OTLQ 2QQSA 4M78D 2YT6A 1YJ9T 3JCMP 2YUQA 2LX7A 1I81A 1GBQA 3CCLA 1MGQA 1KHCA 2LCSA 4HCKA 2WSFE 2EYQA 1UGRB 3EG0A 2HD0A 2PVDB 2VV5A 2Y90A 4M7DD 1YFNA 1IZ6A 2KK4A 2YHTA 3NTKA 2K2MA 3TSWA 1VQ4Q 4CI0C 2EQIA 1Q7YR 1IREB 2E70A 1ZQ1A 2MIOA 2XDDA 3V7CA 4J6WA 3H0IA 2EJ9A 2ZPIB 3OB9A 3UDCA 3M9QA 2EYXA 4QKUA 2NUPA 3QSUA 1K4US 2V8IA 5KYYB 1OX9A 3CCRA 4KT0E 1S72Q 1OQKA 1M30A 2HL3A 1VQLQ 3V7RA 5GAOn 4M78B 1O9SA 1WJSA 4M75G 1BCOA 5KE3A 5DM7R 3BE3A 4M7AD 1OPKA 3M0QA 4M75F 2LCLA 2QI2A 5FU6B 3X25B 3C94A 1QWFA 2H8HA 1PSEA 3P8BB 5HK0A 4KGXB 2V1RA 1FMWA 1R0CB 4F17A 4M7DB 2ROTA 1XTDA 1TUCA 1WHGA 1Q7YC 5IT9E 1UGPB 4BI3A 1LVKA 3BW1A 3DKMA 2DAQA 2EGAA 3CCVQ 5J39A 4LXCA 1VQ5A 4OB1B 3LWIA 2YUOA 2RQWA 2HL5C 2JMCA 1X6GA 2PU9B 3EGDA 1M90R 2HAXA 2O88A 1BI1A 5LL6S 2RK1A 2EYWA 2VXFA 3AHUA 1Y7XA 2CGHA 4M7AB 5CQXA 1F1BB 5CR2A 4FSXA 1KQSP 2RJEA 1AZEA 1VQPQ 3SD4A 1OX8A 3EFSA 1Y96A 5I21A 4ATOA 2OAWA 4BI8B 1V1CA 3M57A 1YP5A 2HMAA 4A4FA 5LJ5h 3INZA 2D8HA 5HY6A 1WFWA 4E7JA 2RMOA 4XTUA 3QO3A 1BYMA 2DBMA 2K57A 2J7IA 3FIFA 2OI3A 3H0HA 4BDYA 3V8LA 2RF0A 3I55Q 2JT4A 2KDSA 2BE9B 2K9GA 4QQ6A 1M90C 2FZKB 1S1NA 3HPWA 1NYGA 1UGSB 4M77E 1V29B 1YITT 2HKQB 1WHHA 2JM9A 3CCLQ 2DETA 3CEYA 2H3EB 2PUOB 2ZAEA 1VQKQ 3GBQA 1SHGA 1UECA 2EJFA 5GANf 1Q81R 3A8LB 4D8KA 4YTLA 1IRXA 1HYOA 5CAIA 2RJFA 1Q7YU 4MZTA 2M9UA 1QVPA 3JV3A 4FSSA 1YI2Q 2E12A 2QGGA 2K3BA 1KHIA 3CC7A 3TEEA 2OTJA 1OYXA 4C5GA 3CCRQ 2LP5A 1T0JA 3L2WA 1H92A 3CCET 3FRNA 2KI7A 4LDXA 1ABOA 3EGXA 1G5VA 1UDLA 2F2WA 1PKSA 3MEAA 4AFUC 4ZGJB 2A37A 4IIMA 3MPUB 4E2FB 2DFUA 1Q81C 2YSQA 2DLPA 2E5QA 5AT1B 1NLPC 4JUVA 4WCIA 7AT1B 3JCMW 3UA7A 2VUBA 1Q95G 1M3AA 1QVGA 1TU0B 3EGDB 1AWJA 3V8JA 3QZ5B 6AT1B 2RI2A 2RI3A 5DLOA 3D7SB 5M9OA 2QEXA 2XD0A 1MV0B 2HCKA 3CCEA 1M1KR 5KYWA 3T9NA 3CMET 2A28A 2CREA 1BI0A 3QDRB 1NYFA 1TS9A 2DX1A 1X2QA 3M56A 4E7LA 3QWXX 2RQVA 1VYUA 3OYDA 4PJMA 3ZL7C 2MI6A 4MDWA 4AT1B 5LJ5e 3AT1B 2FPFA 2LQ8A 2GTJA 4FYYB 5CKBA 1N8RU 5LJ3d 1VQ6A 5IHKA 3S3OA 3PMTA 1YIJQ 4OMMA 2V1QA 1FX7A 4LDUA 3L2ZA 4C0FA 4ZTFA 2ZCFB 4A63B 2EKHA 4ZN1A 2RB6A 1K1ZA 5KE2A 4UC4A 3CMEA 2GQIA 2RA2A 1QLYA 3JCMV 4M78F 3JCMX 3CCQQ 5LJ3j 2DBKA 4M75A 1ZUUA 2R58A 3RNJA 1D1CA 2V26A 3CCJT 4M4ZA 4J7FA 3BDLA 3PVQA 5GAN4 5D6XA 1RAFB 5GAN8 4JJDA 1JO8A 1JQQA 3L2QA 2VASA 4PFPA 2VGNA 3A8HB 1TTHB 3WVDB 1Q81U 4J9CA 1PD0A 2KRSA 4M75C 1VQMA 4IKFA 2LQWA 2LJ1A 2BZXA 2ZZDA 1VQ7A 2QG9B 4C0DB 3CC7Q 4XAXB 2OTJQ 2CP5A 1QVGS 3I56A 2EGCA 4M7AF 1Y07A 2KYMA 1M8VA 1OULA 4BACA 4HCCA 3SWNA 1QVFA 2XHCA 2DL7A 2QDYB 3RR6A 3HSBA 3L2RA 2ENMA 2KRMA 1WI7A 2JN0A 4A4KA 1X27A 4IUPA 1OPLA 2IIMA 1VQNQ 4DQ2A 5HCKA 4J83A 3OYEA 4RTZA 4PJOG 5GAN6 3CCUT 4O6JA 4PJOF 1VQOT 1UE9A 3SWNC 4C92D 2QQ9A 3QJ6A 1GXIE 4WF2A 4GLMA 2QEXQ 1D1AA 1VIFA 2DZCA 3JCMf 1BI3A 3PVLA 4JRKA 2AKKA 3H6ZA 4BUGA 3THKA 2XKOC 1P92A 3TREA 5GMKh 3OS1A 3CXCA 1EIFA 5CKDA 3EFOA 4XU3A 3VRYA 2F2XA 3NGPA 1SPKA 2CP7A 1NLOC 5ECAA 4QVCA 1VQ6Q 5DLQE 3H9NA 4ANJA 3J7AF 3CMAA 2JMAA 1D09B 1I1JA 2SRCA 3E9GA 5GANg 1PSFA 3CBOA 2LQKA 5A0LA 5KYXA 1G83A 5FU7C 3SB2A 3P8HA 3QJYA 4OMQA 2FRYA 4E7KA 4C92B 4Z02A 5LJ5g 3CCSA 5KCOA 1VQ4T 1PHTA 1YNZA 2B8AA 2NUZA 1QKWA 4Y91A 2X9HA 4R0KA 2KT1A 4C5EA 3CC2Q 1AOJA 3J80E 1M2VA 3LH0A 2JTFA 1KC8C 2K5FA 4DEYA 3MEUA 1PCXA 4RTXA 1WHMA 4XQ3A 4LD9K 2KYBA 4BE1A 1VQLT 2HQEA 2DL5A 1UTIA 4IUVA 1QVFS 3DB3A 2EWNA 1IB8A 2MYSA 2EW3A 4HA8A 2LTOA 2RH2A 2DTHA 3LH5A 2WSCE 1C6VX 3CPFA 3SWNB 2YUNA 1OU8A 4F14A 2DL3A 2J6FA 4C8QG 4FYXB 4RUGA 2ECZA 4C8QF 1I8FA 3RUXA 2HBPA 5FRNA 2ZPBB 4HXJA 5GAMd 3I56Q 3LX7A 4ZGDB 1QQJA 3OW2P 2E10A 1ZSGA 3CD6Q 3FLGA 2K6DA 2QQAA 2QASA 2DL4A 1GCQA 2EKOA 1RI0A 3N5BB 1LCKA 3CXCS 1YCSB 3OQ5A 4EPCA 1FYNA 1HJDA 4HT9A 2YDLA 3QG1A 4HCBA 1B07A 3A8GB 3KFVA 4AMCA 4NL2A 2X3WD 3RKWA 5FWCA 1X2KA 1GCPA 5GMKe 1GFCA 2E3IA 3GP8A 2W0ZA 2RQRA 3VYHB 4OVAA 5I11A 2VVKA 1W6XA 3WVEB 4M77D 1GCQC 3CC4Q 2GQVA 1YJWT 1YN8A 3HRSA 4LUDA 4BD3A 4ME7A 3QZ9B 3MHXA 3MEWA 2E1HA 4D6WA 1BKBA 4M75E 2BE7D 4DBHA 1G8XA 1KIKA 2D0QB 3A8OB 2VC8A 1KC8U 2A0FB 1E6GA 2K5LA 2NUTB 3EG9B 2K3YA 2ZPGB 2CYZB 4OMLA 1C0MA 1B7TA 4RG2A 1OV3A 5GAOm 1GRIA 4EMHA 1M8MA 4ORZA 1YJNQ 2DXTA 1TSFA 1RACB 2COWA 2CSIA 2QA4Q 1TH7A 3CCSQ 2JZ2A 4ESRA 2KVQG 1UJYA 3JCMd 1WXBA 3V7SA 1QVFP 4M77B 2VWFA 1YI2T 4BE0A 1K0XA 4F7UF 3PIOA 3M58A 2RN8A 3H0FA 4BB7A 2GTOA 3JAME 5I2MA 2KXDA 4HCZA 4AG1C 3M53A 4QW2A 3CCMA 1D3BB 2DD5A 4OMOA 5IXFA 3X28B 4MZPA 4PJOA 2JVVA 1BU1A 1RAEB 1TXQA 5D6YA 1M4ZA 1YJ9A 1VUBA 1C1AA 2EYYA 4PLIA 1R0BG 2KE9A 1I5OB 3WXMB 1AEYA 4OMFB 3VS6A 2A08A 2LCCA 1NJIR 4JRIA 1QCFA 5LJ3f 1JJ2A 4LNPA 3CBPA 1YHQT 2EJGA 4OF1A 4PJOC 1SEMA 3PIPA 1U8RA 3ZBDA 5IH2A 3I9QA 3CPWA 2DM1A 3EHQA 1BI2A 1JEGA 2QTVA 2P0QA 2XDPA 4J5YA 4KBMB 3E1SA 3G71Q 4PLLA 4DBRA 4XU1A 3GPLA 1YIJT 2ABLA 3PT9A 1YHQA 1N8RR 5GANh 1NJIC 4FL6A 1UJ0A 1D1BA 5FLXE 3KUFA 1RLQC 1MNEA 2O4XA 2XICA 2FB7A 3LGLA 2F5TX 4IIOA 4MDXA 3QBYA 1XQHA 2R57A 4A54A 4X34A 1PM3A 2P4RA 3HRUA 1BCMA 3OYHA 4JS5A 4JLIA 2ZPFB 1QCOA 4C8QA 3HRTA 2X3XD 3VJPA 3M4GA 1X01A 3VUZA 5GMKi 3E2UA 1ZA1B 5GAN7 2EQMA 3L2UA 2I2LA 3RERA 1N8RC 1LNXA 1QMCA 2CZ7B 4L6V5 1NBEB 4E47A 4OB3B 2HSEB 2RD1A 1K73U 1Y71A 1KD1R 1UGVA 3U23A 5GAN3 4MMLA 2LX9A 2CH4A 2NUPB 4N0AA 1SF9A 4XTYA 2YLCA 3OA6A 4C8QC 2VGMA 2F69A 2LDMA 5J3BA 1JJ2S 1OEBA 2FL7A 4RTVA 2XIDA 3MEVA 5I22A 3OYLA 5FWBA 3EFRA 1YITA 2DK3A 2MWPA 4K11A 3SDZA 1T3LA 2KT8A 4PJNA 2D9TA 3CPWS 1K9AA 4N0AC 3G4ST 1VQNT 1ZA2B 2WACA 2JW4A 2EBPA 3M0TA 1CKAA 1B34A 3BFMA 2YLBA 1KD1C 1LPLA 1ZLMA 3VYGA 1RI9A 4ZTJA 1NJIU 2JS2A 2IPOB 4HVUA 3JRZA 2FVUA 4DOWA 3JB9I 3M5AA 2QQRA 3JSCA 4N4IA 2YWWA 1EX4A 1WHLA 2EGEA 2GFUA 1WHKA 4FYWB 4A4HA 1VQ5Q 3MJXA 3A8MB 2L3RA 2L5QA 5GANe 4E7HA 4JLGA 1NPPA 3FB9A 1Y96B 1WJQA 2KXCA 5KYUA 2AIRB 2YXYA 3BDUA 1KG1A 1M1FA 4J8OA 1G3TA 4JRPA 2FZCB 1M3CA 3I35A 4ZNXA 3JB9D 1HD3A 1IXDA 4JJBA 1FMVA 4HKEA 1QCNA 4QQDA 2B86A 3SHWA 1PG5B 4LN2A 2QXFA 2CP2A 3OYNA 4ELYC 1SRMA 5L8RE 2ESWA 3BY7A 4KH1B 4NOYA 3MP1A 4XU2A 3CC2T 2MAMA 2FYKA 1BBZA 2ATCB 2D1XA 2I0NA 1WIEA 4LDWA 4M78G 2BTTA 1ABQA 2QAZA 3A5ZB 5GJWB 1GFDA 1WNLA 3TU4K 1TUDA 2RQUA 4EMKA 2X4JA 5GAMf 2DMOA 3GIBA 2M16A 4BDZA 1NG2A 4M7DG 1RABB 1HK9A 4PJOE 1R8OB 3VKIA 3X24B 4M7DF 3CBMA 4DA4A 4FW2A 1JJ2P 1PNJA 3KXTA 2DL8A 1WHJA 1I07A 1LOJA 5IXBA 2A7YA 2A36A 4L5GA 3G6ET 4OGEA 1KD1U 2RHIA 1TG0A 2C06A 2DVJA 2DYBA 2JTEA 1H641 4EMKC 2PVGB 1MMAA 1AHJB 2PTKA 3QUIA 3EGXB 3JCMh 2DRKA 2VYTA 4IUQA 1AT1B 2FG0A 4F04B 1I0CA 4BY6C 3CD6T 2CKKA 2M51A 3IQLA 4F16A 2DERA 4M7AG 2OJ2A 1YITQ 3VRZA 3CCJA 4OP0A 3X20B 2L89A 3I5RA 5GJVB 2BUDA 1KQ1A 2ROLA 4JRQA 3CQTA 4RTUA 2CT4A 1PC0A 4J6YA 1VQ9T 1X43A 2CDTA 2FZGB 5D7UA 2MPXC 4BI4A 1PRLC 3LYIA 3TVTA 2BIVA 5CO7A 5KYWB 4M75D 1VQ8T 3H8ZA 5IN1A 1PWTA 3CC4T 1WQWA 1PRMC 2G3RA 4TVRA 3TCJA 2ZGWA 2QGFB 3DLLA 3CCEQ 3VS2A 2ZPEB 2GNCA 2O31A 3P8DA 4KUDK 1YBYA 1M2OA 1R77A 2F2VA 2CZ1B 3ER0A 3TSZA 2QDLA 2H3JA 5LJ5d 4X9CA 3FC3A 3UATA 1OOTA 1KC8R 2LMJA 3GOXA 4C8QE 3VV0A 2OX7A 5GAN5 1Q82R 1K9MC 1W70A 2OTLT 2CZ0B 1YJNT 3UT1A 3CCUA 5GANj 1I5LA 2DYIA 1RADB 2QTXA 2X4XA 2FPDA 1VQOA 4M75B 4FCYA 1UHCA 2O2OA 1Q86U 4JJNK 1TUGB 1U06A 3EHRA 3C12A 1Z9QA 3CMEQ 5LJ5j 4BY6B 3HFOA 2DKGA 2QQBA 3S6WA 2DILA 3QWYA 2Y4YA 1K76A 1T0HA 2DIGA 2J6OA 2YRDA 3PTAA 5GAOq 2E65A 2O9VA 5GMKm 2OTLA 2PUKB 3VS5A 4DOVA 3EG3A 3E9FA 2EQJA 5EG2A 3M0PA 2KMTA 1Q82C 1EFNA 1S72T 5EC7A 3OYKA 1W1FA 1VOMA 4J9FA 3REBB 2XU8A 5CVIA 4LD6A 3PE0A 4HT8A 3JCMe 1IHVA 1GL5A 2AT1B 4ELZC 3HTRA 1QVGP 5FRMA 2C0TA 1WJRA 4C0ZA 2FO0A 2EPDA 3NHNA 1VQMQ 3R6OA 4N4HA 2JOYA 1VQ4A 3OYIA 3MP6A 1VQ7Q 2F1LA 4A4EA 3A98A 3M59A 1CKBA 4FIBA 3C0CA 4Z89A 2MCNA 4R56A 2DJQA 2WSEE 2JUFA 2LVMA 3OY9A 3CCVT 4A53A 2RHXA 4ZN3A 2J6KA 3E19A 2KR3A 1VQLA 4GLKA 1IGUA 2VXEA 3G71T 1RAAB 4CC7A 3M0RA 3OSSC 3PFSA 5KYYA 1W4SA 3DB4A 4OB2B 3NTHA 2DTOA 3A1PA 1K9MU 1Y0MA 3RDVA 3HKSA 5FU7B 4M78A 1VQPT 4QQGA 3FJ5A 1M27C 4OGCA 3EFOB 3UWNA 3RESA 3JCMJ 4M7DA 1NE8A 2P0PA 4QVZA 2JTMA 2G6FX 1K8AC 3FDRA 1HXDA 3JB9F 4Y28E 3I55T 5KYXB 1PD1A 4J7IA 4JZ4A 1QWEA 2KBTA 4AFSC 2PZ1A 1JXMA 2AHJB 4M78C 4PFOA 4BE2A 1AD5A 1SG5A 1U1SA 5GAN2 5FU6C 4MZMA 3CMAQ 1Q82U 1WGSA 1SHFA 3CCLT 5CKHA 5GAOl 1VQOQ 1VQKT 2X51A 1JXOA 4M7DC 1TOVA 2L3PA 3H41A 2LT1A 3V8KA 4E7IA 4M7AA 1M2VB 5GAOp 8ATCB 5LJ3h 3OBYA 1PKTA 4EIKA 1UUEA 1K73R 2RK2A 1YJWA 2MK5A 4JZ3A 1FWZA 1VYVA 2E3HA 4F7UG 4DEXA 1YCYA 4B9WA 3MCAB 3QYHB 3QPHA 2VKNA 4LE9A 1KK7A 3CCRT 4LDVA 4KULA 2V8KA 1JRIA 4M7AC 1VQKA 1MUZA 1H3HA 5C0MA 4XTWA 4X9DA 1IHWA 4RMOA 1W2BA 2NLUA 2LRQA 2JM8A 2CH4W 1UFFA 3META 3Q1JA 4J9GA 3I5SA 2DNUA 1K73C 4E6RA 3LWHA 1YI2A 5D6WA 3JCMg
chains in the Genus database with same CATH topology
3OYAA 2DJZA 4C0DB 4N0AC 3G4ST 1VQNT 2WACA 1D3BA 4XAXB 3OS5A 1QVGS 3JB9H 3I56A 1B34A 2K2VA 1Y07A 4XU0A 3BFMA 4EMGA 2YRVA 2DTIA 4R55A 4M7AF 1VQ5T 1M8VA 4BACA 4HCCA 1H3ZA 3SWNA 2YLBA 1QVFA 1KD1C 3JCMQ 2DPPB 3ASKA 2EIFA 3VYGA 2XHCA 1G3YA 2KSSA 4ZTJA 4RKUE 2QDYB 1K8AU 3HSBA 1NJIU 2E41A 4M77C 3L2RA 1OI1A 2DXCA 3GNFB 4F7UE 3JRZA 2FVUA 2GFAA 2JN0A 4A4KA 2IG0A 4DOWA 3JB9I 3MP8A 3M5AA 3NTIA 4C92G 2PQWA 2E6ZA 3GLXA 2QQRA 1QW1A 3JSCA 4IUPA 4N4IA 4C92F 4O5VA 2XI9A 4DQ2A 2E64A 4J83A 2GFUA 4PKCC 3SFMA 1N9SA 3OYEA 4C5HA 4PJOG 4A4HA 2GF7A 5GAN6 3CCUT 3CCVA 1N6AA 4O6JA 3QKJA 1N9RA 3A8MB 4B9XA 2DO3A 2BKDN 2L3RA 1X6OA 1G3SA 2LC4A 2Y4XA 4PJOF 5GAMj 3SWNC 2L5QA 5GAMg 1VQOT 4C92D 2QQ9A 2LNVA 3QJ6A 3RKYA 4IUUA 1OZ2A 4JLGA 5GANe 4E7HA 4J6XA 3JB9G 1NPPA 3FB9A 1Y96B 4WF2A 1JB0E 3G71A 1GXIE 1WJQA 1VIFA 4C5IA 2CZ6B 2DZCA 3JCMf 1BI3A 1NZ9A 1KQ2A 4JRKA 3HL8A 3RKXA 3H6ZA 3O8VA 4BUGA 4PJOD 2XKOC 2V8JA 1P92A 3BDUA 4FU6A 1KG1A 3TREA 1M1FA 4J8OA 1G3TA 4JRPA 5GMKh 3OS1A 5AYFA 3CCQT 3CXCA 2M0OA 3M55A 1EIFA 3JB9D 5CKDA 5GMKj 1FXXA 4HKEA 4XU3A 1VQPA 1S72A 1RL2A 4QQDA 5CCAA 4KUIA 2K3XA 2HNIA 4FT2A 2QXFA 3OYNA 4ELYC 2M1HA 3ME9A 5L8RE 2X4WA 4QVCA 3BY7A 5DLQE 5HK3A 4NOYA 3MP1A 4XU2A 3CC2T 3J7AF 4P5NA 3CMAA 2MAMA 1QP2A 2X35A 3PGGA 5A0DA 5HKCA 5LJ3e 3E9GA 2FYKA 5GANg 1YIJA 1PSFA 3URGA 3CBOA 3RIRA 4LDWA 3GF5A 4M78G 2RI5A 2KQWA 2LQKA 4XTVA 5A0LA 1SSFA 3A5ZB 1KQSS 2DXUA 5FU7C 1WNLA 3SB2A 3P8HA 3QJYA 3CCMT 3TU4K 3LLRA 4C92E 4EMKA 2X4JA 4E7KA 3I55A 5GAMf 3GIBA 2RHZA 3MO8A 4C92B 2M16A 4Z02A 2XK0A 5LJ5g 4BDZA 3CCSA 3PNWC 5KCOA 1VQ4T 2GCXA 1W2BS 2B8AA 3LGFA 4NS5A 2P4TA 4M7DG 2QQSA 4M78D 4Y91A 3CCQA 1HK9A 3VU3C 4PJOE 1R8OB 3VKIA 4C5EA 3X24B 1YJ9T 3CBMA 2D6FA 4LDYA 4M7DF 4PJOB 3JCMP 4DA4A 1I81A 3CCLA 1MGQA 3X26B 1KHCA 3KXTA 3L2VA 2DEQA 2WSFE 2EYQA 1UGRB 3J80E 3OYGA 3CC7T 3LH0A 2OTJT 2HD0A 4Q5WA 2PVDB 2VV5A 1LOJA 2JTFA 2A7YA 2Y90A 1KC8C 4L5GA 3G6ET 4JDSA 2K5FA 4M7DD 3MEUA 4OGEA 1KD1U 2RHIA 1IZ6A 1ZHIA 4PNOA 2KK4A 4XQ3A 4LD9K 2YHTA 2C06A 4BE1A 1VQLT 2HQEA 3NTKA 1O75A 4RCBA 1H641 4IUVA 4EMKC 1QVFS 2PVGB 4CI0C 1AHJB 3DB3A 1IREB 2EWNA 2E70A 3QUIA 3JCMh 1ZQ1A 2XDDA 3V7CA 4HA8A 2VYTA 4J6WA 4IUQA 2EJ9A 2LTOA 2RH2A 2DTHA 2ZPIB 3OB9A 4MMKA 3UDCA 3M9QA 4BY6C 3CD6T 2CKKA 2WSCE 4PL6A 5GAOr 3CPFA 3SWNB 2R5MA 4A4GA 4M7AG 3QSUA 3G7ZA 2V8IA 3CCJA 4OP0A 4C8QG 3X20B 5LJ5f 2L89A 3QIIA 3CCRA 4GY5A 4KT0E 4C8QF 3VUBA 4M78E 1I8FA 3RUXA 2HBPA 5KH6A 2BUDA 5FRNA 3V7RA 1KQ1A 1N27A 1G3WA 1O9SA 1WJSA 2ZPBB 4M78B 4M75G 5GAMd 4JRQA 5KE3A 3LX7A 5DM7R 2DXBA 4J6YA 4ZGDB 4M7AD 2QEXT 2EFIA 4M75F 1VQ9T 2LCLA 2QI2A 5FU6B 3X25B 4C8QD 3C94A 4BI4A 2K5IA 5CQYA 3F70A 2E10A 1PSEA 3P8BB 5HK0A 3OYBA 4M7DE 3LYIA 5A0GA 3FLGA 2BIVA 5CO7A 4M7DB 2QQAA 1XTDA 4M75D 1VQ8T 1UB4A 2EKOA 3H8ZA 5GAMh 3M4YA 5IN1A 1RI0A 3OS0A 1Q7YC 3N5BB 3CXCS 3CC4T 5IT9E 1UEBA 3OQ5A 4EPCA 1UGPB 3J81E 4BI3A 1WQWA 3BW1A 2G3RA 5FROA 4TVRA 3TCJA 2X4YA 4OB0B 3G4SA 1VQNA 4HT9A 3DKMA 3QG1A 4HCBA 2ZGWA 1VQ6T 3LW5E 3S3NA 2O4XB 4M77G 3DLLA 2DAQA 3A8GB 5J39A 1VQ5A 1MHNA 4NL2A 4OB1B 4M77F 2ZPEB 3LWIA 3P8DA 3RKWA 4KUDK 5GMKe 1YBYA 3GP8A 4F7UA 2LT4A 3JCMc 3VYHB 2PU9B 2CZ1B 3ER0A 4FM4B 4OVAA 2H3JA 4JS4A 3WVEB 2HAXA 4M77D 1BI1A 5LL6S 2EQKA 2RK1A 4C0DC 5LJ5d 4X9CA 4N4GA 3FC3A 2VXFA 3AHUA 4M7AE 1Y7XA 2CGHA 3QYGB 2GQVA 4M7AB 3GOXA 1YJWT 4C8QE 3VV0A 5CQXA 5GAN5 1K9MC 5CR2A 2OTLT 2CZ0B 1YJNT 4FT4A 4C8QB 3HRSA 4FSXA 1OZ3A 1M5Q1 2RJEA 4BD3A 1I4K1 3UT1A 4ME7A 1M90U 3CCUA 3QZ9B 3MHXA 3SD4A 3EFSA 3MEWA 2E1HA 1Y96A 5I21A 4D6WA 1BKBA 5GANj 4M75E 2E6NA 3OW2A 1I5LA 4BI8B 1UGQB 2EAYA 2QTXA 2X4XA 5I2SA 4L59A 1VQOA 4M75B 3M57A 2D0QB 3A8OB 5CKEA 2VC8A 4ZGEB 5C6SA 1KC8U 4A4FA 5LJ5h 1Q86U 4JJNK 3INZA 2K5LA 2MWOA 5HY6A 4E7JA 2K3YA 2ZPGB 2CYZB 3C12A 4XTUA 3DLMA 5LJ5j 1M9SA 3QO3A 4RG2A 3OYMA 4BY6B 3HFOA 2DKGA 1BYMA 2QQBA 5GAOm 1X75C 3S6WA 2K57A 4EMHA 3FIFA 2Y4YA 4BDYA 2DIGA 3V8LA 2DXTA 2KDSA 3QXEB 3PTAA 1TH7A 3C4SA 3HFNA 2JZ2A 4QQ6A 1VQMT 1M1KC 1M90C 5GAOq 2KVQG 2E65A 3HPWA 3JCMd 4VUBA 2XDBA 1UGSB 2HQXA 4M77E 3OS2A 1V29B 5GMKm 2PUKB 3OMCA 1YITT 3V7SA 4DOVA 2OTLA 4M77B 5LJ3g 1VQ7T 2DVEA 4RG8A 3E9FA 1Q86C 2EQJA 5EG2A 3CC2A 2KMTA 1Q82C 2RM4A 1YI2T 1S72T 4BE0A 3CEYA 3OYKA 3NFCA 2PUOB 2L8DA 4F7UF 3PIOA 1QP3A 2XU8A 5CVIA 4LD6A 2EQUA 3M58A 4HT8A 3I56T 4BB7A 3JCMe 3JAME 5I2MA 4C92A 2XG8D 4HCZA 4ELZC 2EJFA 3M53A 4QW2A 5GANf 3CCMA 3A8LB 3C95A 5FRMA 1D3BB 1WJRA 3HHTB 4C0ZA 2DD5A 4YTLA 1B34B 3X28B 4MZPA 4NL3A 3R6OA 4N4HA 5CAIA 4PJOA 2JOYA 2JVVA 3OYYA 1VQ4A 3OYIA 3GNGA 1LJOA 2RJFA 1Q7YU 5D6YA 5GAOn 3MP6A 4IURA 1M4ZA 4A4EA 4MZTA 1YJ9A 2M9UA 3M59A 1QVPA 1VUBA 4II1A 4ATOA 2E12A 4FIBA 2A3LA 2RHUA 2RO0A 4PLIA 4R56A 1ZBXA 1KHIA 2WSEE 2JUFA 3CC7A 3TEEA 3WXMB 2OTJA 1OYXA 2LVMA 4C5GA 3OY9A 4OMFB 3L2WA 3CCVT 2RJDA 3G6EA 3CCET 2ZPHB 3UPUA 4A53A 3FRNA 2RHXA 4C92C 4ZN3A 4LDXA 2LCCA 3E19A 1VQLA 4GLKA 1G5VA 4JRIA 1JJ2A 5LJ3f 2MF2A 3CBPA 4C0GA 1YHQT 2R5AA 2VXEA 3G71T 3MEAA 5GAMe 2EJGA 4ZGJB 4OF1A 4PJOC 2DIQA 3PIPA 1U8RA 3M54A 3JCMb 3OSSC 3ZFJA 1WQ7A 2O01E 3PFSA 3OBWA 3ZBDA 1W4SA 1Q81C 3DB4A 4OB2B 3NTHA 2DTOA 1K9MU 3CD6A 2E5QA 5CKFA 1BIAA 4JUVA 3HKSA 3JCMW 1U1TA 3JB9J 5FU7B 4M78A 2VUBA 3CPWA 5CK9A 4F7UB 1BI2A 1VQPT 3FJPA 2DD4A 4QQGA 3KBGA 3JCMg 1QVGA 5GANd 2P0QA 2XDPA 4J5YA 1VIEA 3OMGA 4KBMB 4OGCA 3E1SA 3V8JA 3QZ5B 3UWNA 3S3MA 2RI2A 3RESA 4QVDA 3OW2S 2RI3A 4PLLA 5DLOA 3OSVA 3CMAT 3L42A 5M9OA 2XD0A 2QEXA 3JCMJ 4XU1A 1VQ9A 3CCEA 2OAUA 3GPLA 2FHDA 1NE8A 3T9NA 3ZEHA 5IAYA 1YIJT 4M7DA 3CMET 2KAFA 1BI0A 2P0PA 3QDRB 2KY9A 3PT9A 2MMPA 4QVZA 2JTMA 1YHQA 3PMIA 1K8AC 3M56A 5GANh 1NJIC 4FL6A 3FDRA 1HXDA 1VQ8A 4Y28E 5FLXE 3KUFA 3I55T 2QA4T 4E7LA 3JB9F 4J7IA 1M1KU 3OYDA 3CCST 2O4XA 2AHJB 4M78C 3CC4A 4BE2A 2XICA 2FB7A 2MI6A 4MDWA 5LJ5e 1U1SA 5GAN2 4EMKB 3OYJA 3LGLA 2F5TX 2LQ8A 5CKBA 1N8RU 5FU6C 4MZMA 5LJ3d 1Q82U 1VQ6A 4MDXA 3QBYA 1WGSA 1XQHA 3S3OA 2P0KA 3PMTA 5J26A 3CCLT 4V2SA 5CKHA 2R57A 4A54A 5GAOl 4X34A 1FX7A 4LDUA 1VQKT 4M7DC 3L2ZA 4C0FA 4ZTFA 4XK8E 2LT1A 2ZCFB 3V8KA 4E7IA 3HRUA 4ZN1A 3OYHA 2RB6A 4XTXA 4M7AA 4JS5A 1DJ7B 2ZPFB 4JLIA 5A2QE 5KE2A 4EDUA 3QHSA 4UC4A 5GAOp 5LJ3h 2RA2A 3OBYA 3HRTA 4C8QA 3CMEA 3VJPA 3M4GA 1X01A 5GMKl 3VUZA 5GMKi 3JCMV 2RK2A 4M78F 5CIUA 3JCMX 2EQMA 5GAN7 3L2UA 1YJWA 3L1AA 2I2LA 4XTZA 5LJ3j 1BIBA 3RMSA 1YJNA 1FWZA 4IUTA 4M75A 3RERA 2QA4A 1M1GA 4F7UG 1N8RC 1LNXA 1YCYA 2CZ7B 2R58A 4L6V5 4E47A 4B9WA 4OB3B 2RJCA 3RMQA 3MCAB 3QYHB 3QPHA 2RD1A 4CRIA 2DZ9A 3EAEA 3CCJT 4J7FA 1Y71A 3BDLA 5GAN4 1K73U 5GAN3 4MMLA 5D6XA 3CCRT 2LX9A 5GAN8 2CS7A 4N0AA 4LDVA 2RHYA 2PVOB 4RCCA 1KQSA 2K4YA 4KULA 2V8KA 1JRIA 3HP9A 4XTYA 3OYFA 1VQKA 4M7AC 1XOVA 2YLCA 3OA6A 4C8QC 2VGMA 5C0MA 5KCHA 3OYCA 1XNIA 2F69A 3L2QA 4XTWA 4X9DA 2LDMA 2VGNA 5J3BA 1JJ2S 3A8HB 5DY9A 2FL7A 4RMOA 1W2BA 3WVDB 2F5KA 2NLUA 2LRQA 1Q81U 4M77A 2XIDA 3MEVA 1NPRA 3FEOA 4M75C 1VQMA 3OYLA 2JNGA 4IKFA 3META 2IVWA 3EFRA 3Q1JA 1YITA 2DK3A 1WPYA 2MWPA 3SDZA 1K73C 1JBMA 2ZZDA 1VQ7A 3LWHA 1YI2A 5D6WA 2D9TA 3CPWS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIF A;  1VIE A;  2GQV A;  2OAU A;  2P4T A;  2RK2 A;  2RH2 A;  3T9N A;  2VV5 A;  2RK1 A;  3UDC A;  3SFM A; 
#chains in the Genus database with same CATH topology
 1YWO A;  3CXC P;  3JB9 H;  2HDA A;  2K2V A;  4XU0 A;  1KSW A;  1OU9 A;  2DTI A;  2YRV A;  1VQ5 T;  2EVR A;  3ASK A;  2EIF A;  1G3Y A;  1K8A U;  2COY A;  3GNF B;  1NM7 A;  1BB9 A;  1RUW A;  2IG0 A;  1SRL A;  3NTI A;  4C92 G;  2E6Z A;  2AZS A;  1KFZ A;  4LUE A;  4C92 F;  4DBF A;  2E64 A;  1ZUY A;  4PKC C;  1N9S A;  2KGT A;  1IO6 A;  2GF7 A;  2CT3 A;  1N9R A;  3QKJ A;  2RPN A;  4B9X A;  2K7A A;  2Y4X A;  2BKD N;  2LC4 A;  4IUU A;  4J6X A;  2C0O A;  4Y92 A;  1JB0 E;  1SKU B;  4C5I A;  1NZ9 A;  4PJO D;  4FU6 A;  3NMZ C;  5AYF A;  3CCQ T;  1NEG A;  4PJJ A;  3M55 A;  2M02 A;  2O9S A;  5GMK j;  1FXX A;  1RL2 A;  4CC4 B;  1GBR A;  4KUI A;  2K3X A;  4AFQ C;  2HQH A;  9ATC B;  1HSQ A;  2D0N A;  2M1H A;  3ME9 A;  5HK3 A;  2KNB B;  1QP2 A;  3TQ7 P;  5LJ3 e;  1YIJ A;  3URG A;  2KQW A;  4XTV A;  4KGZ B;  3LLR A;  4FW1 A;  3MO8 A;  3PNW C;  1W2B S;  1AZG B;  1YJW Q;  4NS5 A;  3CCQ A;  3VU3 C;  3VS7 A;  2D6F A;  4LDY A;  4PJO B;  2DEU A;  2E4H A;  2LQN A;  4QT7 A;  2JJ9 A;  4PJL A;  3X26 B;  3L2V A;  2DEQ A;  1D0Y A;  3OYG A;  4GBQ A;  3CC7 T;  2OTJ T;  4Q5W A;  2LZ6 B;  4HVW A;  4JDS A;  3EH2 A;  3CCM Q;  4FYV B;  1ZHI A;  4PNO A;  3VS0 A;  4RCB A;  1O75 A;  1ZX6 A;  2JXB A;  1WXU A;  1A0N B;  1YJ9 Q;  1ZSZ A;  4KGV B;  4MMK A;  1WLP B;  1KJW A;  3R6N A;  4PL6 A;  5GAO r;  2R5M A;  4A4G A;  1AWO A;  2ED1 A;  3G7Z A;  4J9H A;  4AFZ C;  4JJC A;  2FRW A;  5LJ5 f;  4RTW A;  3G1J A;  2GBQ A;  3QII A;  4J9I A;  4GY5 A;  4CC3 A;  3VUB A;  4M78 E;  5KH6 A;  1N27 A;  1G3W A;  2M0Y A;  2DXB A;  2AK5 A;  2QEX T;  2EFI A;  2L0A A;  4C8Q D;  2K5I A;  5CQY A;  1UG1 A;  3F70 A;  4Z8A A;  3OYB A;  2JS0 A;  4M7D E;  1ZSZ C;  5A0G A;  1Y57 A;  1U5S A;  1UB4 A;  1MMG A;  5GAM h;  3M4Y A;  5IHI A;  3OS0 A;  1UEB A;  3J81 E;  5FRO A;  1K0S A;  1FMK A;  2X4Y A;  4OB0 B;  3G4S A;  1VQN A;  3ULR B;  1VQ6 T;  3LW5 E;  3S3N A;  2O4X B;  4M77 G;  2CP0 A;  4OMN A;  1IGQ A;  1MHN A;  2L3Q A;  4M77 F;  2YUP A;  2RNA A;  1YHQ Q;  4F7U A;  1UHF A;  2LT4 A;  3JCM c;  1CSK A;  3M0U A;  4FM4 B;  4JS4 A;  3EH1 A;  2EQK A;  4C0D C;  4N4G A;  4M7A E;  1ACM B;  3QYG B;  1Q86 R;  4FT4 A;  4C8Q B;  1OZ3 A;  1M5Q 1;  2P84 A;  1I4K 1;  1M90 U;  1H8K A;  2E6N A;  3OW2 A;  1WXT A;  1UGQ B;  2EAY A;  5I2S A;  4L59 A;  5C6S A;  5CKE A;  4ZGE B;  1W2B P;  2MWO A;  4D8D A;  3DLM A;  1M9S A;  2BZ8 A;  5IHN A;  1ARK A;  3OYM A;  1WYX A;  1X75 C;  4DBQ A;  2HKN A;  3M0S A;  1M3B A;  3QXE B;  3C4S A;  3HFN A;  1JU5 C;  1VQM T;  1M1K C;  1AVZ C;  4VUB A;  2XDB A;  2Z0W A;  2HQX A;  3OS2 A;  3OMC A;  5LJ3 g;  1VQ7 T;  2DVE A;  2HEQ A;  4RG8 A;  3CC2 A;  1Q86 C;  2DF6 A;  2RM4 A;  3NFC A;  3VS1 A;  2D8J A;  2L8D A;  1QP3 A;  1ZSZ B;  2EQU A;  2MOX A;  3I56 T;  2W10 A;  4C92 A;  3CPW P;  2XG8 D;  1V76 A;  3C95 A;  2CUD A;  4CC2 A;  3HHT B;  1B34 B;  2BZY A;  2J06 A;  1RAG B;  4NL3 A;  3OYY A;  4RTT A;  3O5Z A;  3GNG A;  1WZO A;  1LJO A;  4IUR A;  4II1 A;  2K79 A;  2A3L A;  2RHU A;  2RO0 A;  4Z88 A;  1ZBX A;  2HZY A;  4AG2 C;  2RJD A;  2FEI A;  3G6E A;  2ZPH B;  3UPU A;  4C92 C;  1VYT A;  1K9M R;  2MF2 A;  1T3S A;  4C0G A;  2R5A A;  5GAM e;  2RQT A;  2DIQ A;  1NEB A;  3M54 A;  3JCM b;  3ZFJ A;  1WQ7 A;  2O01 E;  4E7Z A;  3OBW A;  2ED0 A;  3UF4 A;  5KYU B;  3CD6 A;  2XMF A;  4PK4 A;  5CKF A;  2LNH B;  1BIA A;  1RAH B;  1U1T A;  3JB9 J;  2GGR A;  5CK9 A;  4F7U B;  3FJP A;  2DD4 A;  3KBG A;  5GAN d;  1VIE A;  3OMG A;  3G4S Q;  3S3M A;  1B3Q A;  1SSH A;  2PNI A;  4QVD A;  3OW2 S;  3CMA T;  1J3T A;  3OSV A;  1WDX A;  3L42 A;  1RLP C;  2AKL A;  1VQ9 A;  2HSP A;  2OAU A;  2FHD A;  3ZEH A;  2DE0 X;  2KAF A;  2KY9 A;  2MMP A;  3PMI A;  1VQ8 A;  5FW9 A;  2QA4 T;  1M1K U;  3CCS T;  3CC4 A;  2CP6 A;  4EMK B;  3OYJ A;  1MND A;  2NYS A;  3VS4 A;  2P0K A;  5J26 A;  4V2S A;  5L23 A;  1N5Z A;  3REA B;  1U3O A;  2YRC A;  4XK8 E;  4XTX A;  1WX6 A;  1DJ7 B;  5A2Q E;  4EDU A;  3QHS A;  3EGU A;  1BK2 A;  5GMK l;  4KH0 B;  5CIU A;  3L1A A;  4XTZ A;  1BIB A;  3RMS A;  1YJN A;  4IUT A;  2QA4 A;  1M1G A;  3EG9 A;  2NUT A;  1YWP A;  3RMQ A;  2RJC A;  3MKD A;  4J9B A;  4CRI A;  5KYN A;  1ZBJ A;  2DZ9 A;  3EAE A;  1VA7 A;  2L3S A;  2J05 A;  1AWW A;  1QKX A;  2CS7 A;  1G2B A;  2RHY A;  2PVO B;  4RCC A;  1KQS A;  2K4Y A;  2KEA A;  3HP9 A;  3OYF A;  1E7O A;  1MMN A;  1XOV A;  2CUB A;  5KCH A;  3OYC A;  1XNI A;  2LJ3 A;  4J9D A;  2EYZ A;  4WTO B;  5DY9 A;  2F5K A;  4M77 A;  1NPR A;  3FEO A;  2NWM A;  4KRT A;  2JNG A;  3CCJ Q;  2IVW A;  1WPY A;  3RBB B;  1JBM A;  1RAI B;  2CP3 A;  5IAY A;  1S72 A;  4J9E A;  2DJZ A;  3OYA A;  1K8A R;  1D3B A;  2FPE A;  3OS5 A;  2KRN A;  4EMG A;  4R55 A;  3G6E Q;  2LJ0 A;  1H3Z A;  2DRM A;  3JCM Q;  2DPP B;  1ZUK A;  2KSS A;  4RKU E;  3EG2 A;  2E41 A;  2C0I A;  4M77 C;  2QK0 A;  1OI1 A;  2DXC A;  8AT1 B;  4F7U E;  3SEM A;  2GFA A;  2DA9 A;  4OMP A;  3MP8 A;  2PQW A;  3GLX A;  1QW1 A;  4O5V A;  2XI9 A;  3SFM A;  4C5H A;  3CCV A;  3VS3 A;  1N6A A;  1WA7 A;  2DO3 A;  1X6O A;  1G3S A;  5GAM j;  1MMD A;  5GAM g;  1D0Z A;  2LNV A;  3RKY A;  1OZ2 A;  3JB9 G;  1E6H A;  3G71 A;  1Z9Z A;  1AWX A;  1VQ9 Q;  1TWB A;  2KRO A;  2CZ6 B;  1KQ2 A;  2CSQ A;  3HL8 A;  2VB6 A;  3RKX A;  3O8V A;  2V8J A;  1D0X A;  2COZ A;  2M0O A;  1VQ8 Q;  4HVV A;  3CCU Q;  4X1V A;  4RTY A;  1VQP A;  1MV3 A;  3NPF A;  1EZZ B;  2HBW A;  5CCA A;  2HNI A;  4FT2 A;  2E5K A;  2SEM A;  2X4W A;  4JPB W;  1X6B A;  4P5N A;  2X35 A;  3PGG A;  5A0D A;  5HKC A;  2AZV A;  1XJW B;  3EG1 A;  3RIR A;  3GF5 A;  3UA6 A;  2RI5 A;  1SSF A;  4E7S A;  1KQS S;  2DXU A;  3QDF A;  4B6M A;  3CCM T;  2QYZ A;  4C92 E;  1X69 A;  3I55 A;  2L2P A;  2RHZ A;  4PFZ A;  2XK0 A;  2GCX A;  3LGF A;  2P4T A;  2OTL Q;  2QQS A;  4M78 D;  2YT6 A;  1YJ9 T;  3JCM P;  2YUQ A;  2LX7 A;  1I81 A;  1GBQ A;  3CCL A;  1MGQ A;  1KHC A;  2LCS A;  4HCK A;  2WSF E;  2EYQ A;  1UGR B;  3EG0 A;  2HD0 A;  2PVD B;  2VV5 A;  2Y90 A;  4M7D D;  1YFN A;  1IZ6 A;  2KK4 A;  2YHT A;  3NTK A;  2K2M A;  3TSW A;  1VQ4 Q;  4CI0 C;  2EQI A;  1Q7Y R;  1IRE B;  2E70 A;  1ZQ1 A;  2MIO A;  2XDD A;  3V7C A;  4J6W A;  3H0I A;  2EJ9 A;  2ZPI B;  3OB9 A;  3UDC A;  3M9Q A;  2EYX A;  4QKU A;  2NUP A;  3QSU A;  1K4U S;  2V8I A;  5KYY B;  1OX9 A;  3CCR A;  4KT0 E;  1S72 Q;  1OQK A;  1M30 A;  2HL3 A;  1VQL Q;  3V7R A;  5GAO n;  4M78 B;  1O9S A;  1WJS A;  4M75 G;  1BCO A;  5KE3 A;  5DM7 R;  3BE3 A;  4M7A D;  1OPK A;  3M0Q A;  4M75 F;  2LCL A;  2QI2 A;  5FU6 B;  3X25 B;  3C94 A;  1QWF A;  2H8H A;  1PSE A;  3P8B B;  5HK0 A;  4KGX B;  2V1R A;  1FMW A;  1R0C B;  4F17 A;  4M7D B;  2ROT A;  1XTD A;  1TUC A;  1WHG A;  1Q7Y C;  5IT9 E;  1UGP B;  4BI3 A;  1LVK A;  3BW1 A;  3DKM A;  2DAQ A;  2EGA A;  3CCV Q;  5J39 A;  4LXC A;  1VQ5 A;  4OB1 B;  3LWI A;  2YUO A;  2RQW A;  2HL5 C;  2JMC A;  1X6G A;  2PU9 B;  3EGD A;  1M90 R;  2HAX A;  2O88 A;  1BI1 A;  5LL6 S;  2RK1 A;  2EYW A;  2VXF A;  3AHU A;  1Y7X A;  2CGH A;  4M7A B;  5CQX A;  1F1B B;  5CR2 A;  4FSX A;  1KQS P;  2RJE A;  1AZE A;  1VQP Q;  3SD4 A;  1OX8 A;  3EFS A;  1Y96 A;  5I21 A;  4ATO A;  2OAW A;  4BI8 B;  1V1C A;  3M57 A;  1YP5 A;  2HMA A;  4A4F A;  5LJ5 h;  3INZ A;  2D8H A;  5HY6 A;  1WFW A;  4E7J A;  2RMO A;  4XTU A;  3QO3 A;  1BYM A;  2DBM A;  2K57 A;  2J7I A;  3FIF A;  2OI3 A;  3H0H A;  4BDY A;  3V8L A;  2RF0 A;  3I55 Q;  2JT4 A;  2KDS A;  2BE9 B;  2K9G A;  4QQ6 A;  1M90 C;  2FZK B;  1S1N A;  3HPW A;  1NYG A;  1UGS B;  4M77 E;  1V29 B;  1YIT T;  2HKQ B;  1WHH A;  2JM9 A;  3CCL Q;  2DET A;  3CEY A;  2H3E B;  2PUO B;  2ZAE A;  1VQK Q;  3GBQ A;  1SHG A;  1UEC A;  2EJF A;  5GAN f;  1Q81 R;  3A8L B;  4D8K A;  4YTL A;  1IRX A;  1HYO A;  5CAI A;  2RJF A;  1Q7Y U;  4MZT A;  2M9U A;  1QVP A;  3JV3 A;  4FSS A;  1YI2 Q;  2E12 A;  2QGG A;  2K3B A;  1KHI A;  3CC7 A;  3TEE A;  2OTJ A;  1OYX A;  4C5G A;  3CCR Q;  2LP5 A;  1T0J A;  3L2W A;  1H92 A;  3CCE T;  3FRN A;  2KI7 A;  4LDX A;  1ABO A;  3EGX A;  1G5V A;  1UDL A;  2F2W A;  1PKS A;  3MEA A;  4AFU C;  4ZGJ B;  2A37 A;  4IIM A;  3MPU B;  4E2F B;  2DFU A;  1Q81 C;  2YSQ A;  2DLP A;  2E5Q A;  5AT1 B;  1NLP C;  4JUV A;  4WCI A;  7AT1 B;  3JCM W;  3UA7 A;  2VUB A;  1Q95 G;  1M3A A;  1QVG A;  1TU0 B;  3EGD B;  1AWJ A;  3V8J A;  3QZ5 B;  6AT1 B;  2RI2 A;  2RI3 A;  5DLO A;  3D7S B;  5M9O A;  2QEX A;  2XD0 A;  1MV0 B;  2HCK A;  3CCE A;  1M1K R;  5KYW A;  3T9N A;  3CME T;  2A28 A;  2CRE A;  1BI0 A;  3QDR B;  1NYF A;  1TS9 A;  2DX1 A;  1X2Q A;  3M56 A;  4E7L A;  3QWX X;  2RQV A;  1VYU A;  3OYD A;  4PJM A;  3ZL7 C;  2MI6 A;  4MDW A;  4AT1 B;  5LJ5 e;  3AT1 B;  2FPF A;  2LQ8 A;  2GTJ A;  4FYY B;  5CKB A;  1N8R U;  5LJ3 d;  1VQ6 A;  5IHK A;  3S3O A;  3PMT A;  1YIJ Q;  4OMM A;  2V1Q A;  1FX7 A;  4LDU A;  3L2Z A;  4C0F A;  4ZTF A;  2ZCF B;  4A63 B;  2EKH A;  4ZN1 A;  2RB6 A;  1K1Z A;  5KE2 A;  4UC4 A;  3CME A;  2GQI A;  2RA2 A;  1QLY A;  3JCM V;  4M78 F;  3JCM X;  3CCQ Q;  5LJ3 j;  2DBK A;  4M75 A;  1ZUU A;  2R58 A;  3RNJ A;  1D1C A;  2V26 A;  3CCJ T;  4M4Z A;  4J7F A;  3BDL A;  3PVQ A;  5GAN 4;  5D6X A;  1RAF B;  5GAN 8;  4JJD A;  1JO8 A;  1JQQ A;  3L2Q A;  2VAS A;  4PFP A;  2VGN A;  3A8H B;  1TTH B;  3WVD B;  1Q81 U;  4J9C A;  1PD0 A;  2KRS A;  4M75 C;  1VQM A;  4IKF A;  2LQW A;  2LJ1 A;  2BZX A;  2ZZD A;  1VQ7 A;  2QG9 B;  4C0D B;  3CC7 Q;  4XAX B;  2OTJ Q;  2CP5 A;  1QVG S;  3I56 A;  2EGC A;  4M7A F;  1Y07 A;  2KYM A;  1M8V A;  1OUL A;  4BAC A;  4HCC A;  3SWN A;  1QVF A;  2XHC A;  2DL7 A;  2QDY B;  3RR6 A;  3HSB A;  3L2R A;  2ENM A;  2KRM A;  1WI7 A;  2JN0 A;  4A4K A;  1X27 A;  4IUP A;  1OPL A;  2IIM A;  1VQN Q;  4DQ2 A;  5HCK A;  4J83 A;  3OYE A;  4RTZ A;  4PJO G;  5GAN 6;  3CCU T;  4O6J A;  4PJO F;  1VQO T;  1UE9 A;  3SWN C;  4C92 D;  2QQ9 A;  3QJ6 A;  1GXI E;  4WF2 A;  4GLM A;  2QEX Q;  1D1A A;  1VIF A;  2DZC A;  3JCM f;  1BI3 A;  3PVL A;  4JRK A;  2AKK A;  3H6Z A;  4BUG A;  3THK A;  2XKO C;  1P92 A;  3TRE A;  5GMK h;  3OS1 A;  3CXC A;  1EIF A;  5CKD A;  3EFO A;  4XU3 A;  3VRY A;  2F2X A;  3NGP A;  1SPK A;  2CP7 A;  1NLO C;  5ECA A;  4QVC A;  1VQ6 Q;  5DLQ E;  3H9N A;  4ANJ A;  3J7A F;  3CMA A;  2JMA A;  1D09 B;  1I1J A;  2SRC A;  3E9G A;  5GAN g;  1PSF A;  3CBO A;  2LQK A;  5A0L A;  5KYX A;  1G83 A;  5FU7 C;  3SB2 A;  3P8H A;  3QJY A;  4OMQ A;  2FRY A;  4E7K A;  4C92 B;  4Z02 A;  5LJ5 g;  3CCS A;  5KCO A;  1VQ4 T;  1PHT A;  1YNZ A;  2B8A A;  2NUZ A;  1QKW A;  4Y91 A;  2X9H A;  4R0K A;  2KT1 A;  4C5E A;  3CC2 Q;  1AOJ A;  3J80 E;  1M2V A;  3LH0 A;  2JTF A;  1KC8 C;  2K5F A;  4DEY A;  3MEU A;  1PCX A;  4RTX A;  1WHM A;  4XQ3 A;  4LD9 K;  2KYB A;  4BE1 A;  1VQL T;  2HQE A;  2DL5 A;  1UTI A;  4IUV A;  1QVF S;  3DB3 A;  2EWN A;  1IB8 A;  2MYS A;  2EW3 A;  4HA8 A;  2LTO A;  2RH2 A;  2DTH A;  3LH5 A;  2WSC E;  1C6V X;  3CPF A;  3SWN B;  2YUN A;  1OU8 A;  4F14 A;  2DL3 A;  2J6F A;  4C8Q G;  4FYX B;  4RUG A;  2ECZ A;  4C8Q F;  1I8F A;  3RUX A;  2HBP A;  5FRN A;  2ZPB B;  4HXJ A;  5GAM d;  3I56 Q;  3LX7 A;  4ZGD B;  1QQJ A;  3OW2 P;  2E10 A;  1ZSG A;  3CD6 Q;  3FLG A;  2K6D A;  2QQA A;  2QAS A;  2DL4 A;  1GCQ A;  2EKO A;  1RI0 A;  3N5B B;  1LCK A;  3CXC S;  1YCS B;  3OQ5 A;  4EPC A;  1FYN A;  1HJD A;  4HT9 A;  2YDL A;  3QG1 A;  4HCB A;  1B07 A;  3A8G B;  3KFV A;  4AMC A;  4NL2 A;  2X3W D;  3RKW A;  5FWC A;  1X2K A;  1GCP A;  5GMK e;  1GFC A;  2E3I A;  3GP8 A;  2W0Z A;  2RQR A;  3VYH B;  4OVA A;  5I11 A;  2VVK A;  1W6X A;  3WVE B;  4M77 D;  1GCQ C;  3CC4 Q;  2GQV A;  1YJW T;  1YN8 A;  3HRS A;  4LUD A;  4BD3 A;  4ME7 A;  3QZ9 B;  3MHX A;  3MEW A;  2E1H A;  4D6W A;  1BKB A;  4M75 E;  2BE7 D;  4DBH A;  1G8X A;  1KIK A;  2D0Q B;  3A8O B;  2VC8 A;  1KC8 U;  2A0F B;  1E6G A;  2K5L A;  2NUT B;  3EG9 B;  2K3Y A;  2ZPG B;  2CYZ B;  4OML A;  1C0M A;  1B7T A;  4RG2 A;  1OV3 A;  5GAO m;  1GRI A;  4EMH A;  1M8M A;  4ORZ A;  1YJN Q;  2DXT A;  1TSF A;  1RAC B;  2COW A;  2CSI A;  2QA4 Q;  1TH7 A;  3CCS Q;  2JZ2 A;  4ESR A;  2KVQ G;  1UJY A;  3JCM d;  1WXB A;  3V7S A;  1QVF P;  4M77 B;  2VWF A;  1YI2 T;  4BE0 A;  1K0X A;  4F7U F;  3PIO A;  3M58 A;  2RN8 A;  3H0F A;  4BB7 A;  2GTO A;  3JAM E;  5I2M A;  2KXD A;  4HCZ A;  4AG1 C;  3M53 A;  4QW2 A;  3CCM A;  1D3B B;  2DD5 A;  4OMO A;  5IXF A;  3X28 B;  4MZP A;  4PJO A;  2JVV A;  1BU1 A;  1RAE B;  1TXQ A;  5D6Y A;  1M4Z A;  1YJ9 A;  1VUB A;  1C1A A;  2EYY A;  4PLI A;  1R0B G;  2KE9 A;  1I5O B;  3WXM B;  1AEY A;  4OMF B;  3VS6 A;  2A08 A;  2LCC A;  1NJI R;  4JRI A;  1QCF A;  5LJ3 f;  1JJ2 A;  4LNP A;  3CBP A;  1YHQ T;  2EJG A;  4OF1 A;  4PJO C;  1SEM A;  3PIP A;  1U8R A;  3ZBD A;  5IH2 A;  3I9Q A;  3CPW A;  2DM1 A;  3EHQ A;  1BI2 A;  1JEG A;  2QTV A;  2P0Q A;  2XDP A;  4J5Y A;  4KBM B;  3E1S A;  3G71 Q;  4PLL A;  4DBR A;  4XU1 A;  3GPL A;  1YIJ T;  2ABL A;  3PT9 A;  1YHQ A;  1N8R R;  5GAN h;  1NJI C;  4FL6 A;  1UJ0 A;  1D1B A;  5FLX E;  3KUF A;  1RLQ C;  1MNE A;  2O4X A;  2XIC A;  2FB7 A;  3LGL A;  2F5T X;  4IIO A;  4MDX A;  3QBY A;  1XQH A;  2R57 A;  4A54 A;  4X34 A;  1PM3 A;  2P4R A;  3HRU A;  1BCM A;  3OYH A;  4JS5 A;  4JLI A;  2ZPF B;  1QCO A;  4C8Q A;  3HRT A;  2X3X D;  3VJP A;  3M4G A;  1X01 A;  3VUZ A;  5GMK i;  3E2U A;  1ZA1 B;  5GAN 7;  2EQM A;  3L2U A;  2I2L A;  3RER A;  1N8R C;  1LNX A;  1QMC A;  2CZ7 B;  4L6V 5;  1NBE B;  4E47 A;  4OB3 B;  2HSE B;  2RD1 A;  1K73 U;  1Y71 A;  1KD1 R;  1UGV A;  3U23 A;  5GAN 3;  4MML A;  2LX9 A;  2CH4 A;  2NUP B;  4N0A A;  1SF9 A;  4XTY A;  2YLC A;  3OA6 A;  4C8Q C;  2VGM A;  2F69 A;  2LDM A;  5J3B A;  1JJ2 S;  1OEB A;  2FL7 A;  4RTV A;  2XID A;  3MEV A;  5I22 A;  3OYL A;  5FWB A;  3EFR A;  1YIT A;  2DK3 A;  2MWP A;  4K11 A;  3SDZ A;  1T3L A;  2KT8 A;  4PJN A;  2D9T A;  3CPW S;  1K9A A;  4N0A C;  3G4S T;  1VQN T;  1ZA2 B;  2WAC A;  2JW4 A;  2EBP A;  3M0T A;  1CKA A;  1B34 A;  3BFM A;  2YLB A;  1KD1 C;  1LPL A;  1ZLM A;  3VYG A;  1RI9 A;  4ZTJ A;  1NJI U;  2JS2 A;  2IPO B;  4HVU A;  3JRZ A;  2FVU A;  4DOW A;  3JB9 I;  3M5A A;  2QQR A;  3JSC A;  4N4I A;  2YWW A;  1EX4 A;  1WHL A;  2EGE A;  2GFU A;  1WHK A;  4FYW B;  4A4H A;  1VQ5 Q;  3MJX A;  3A8M B;  2L3R A;  2L5Q A;  5GAN e;  4E7H A;  4JLG A;  1NPP A;  3FB9 A;  1Y96 B;  1WJQ A;  2KXC A;  5KYU A;  2AIR B;  2YXY A;  3BDU A;  1KG1 A;  1M1F A;  4J8O A;  1G3T A;  4JRP A;  2FZC B;  1M3C A;  3I35 A;  4ZNX A;  3JB9 D;  1HD3 A;  1IXD A;  4JJB A;  1FMV A;  4HKE A;  1QCN A;  4QQD A;  2B86 A;  3SHW A;  1PG5 B;  4LN2 A;  2QXF A;  2CP2 A;  3OYN A;  4ELY C;  1SRM A;  5L8R E;  2ESW A;  3BY7 A;  4KH1 B;  4NOY A;  3MP1 A;  4XU2 A;  3CC2 T;  2MAM A;  2FYK A;  1BBZ A;  2ATC B;  2D1X A;  2I0N A;  1WIE A;  4LDW A;  4M78 G;  2BTT A;  1ABQ A;  2QAZ A;  3A5Z B;  5GJW B;  1GFD A;  1WNL A;  3TU4 K;  1TUD A;  2RQU A;  4EMK A;  2X4J A;  5GAM f;  2DMO A;  3GIB A;  2M16 A;  4BDZ A;  1NG2 A;  4M7D G;  1RAB B;  1HK9 A;  4PJO E;  1R8O B;  3VKI A;  3X24 B;  4M7D F;  3CBM A;  4DA4 A;  4FW2 A;  1JJ2 P;  1PNJ A;  3KXT A;  2DL8 A;  1WHJ A;  1I07 A;  1LOJ A;  5IXB A;  2A7Y A;  2A36 A;  4L5G A;  3G6E T;  4OGE A;  1KD1 U;  2RHI A;  1TG0 A;  2C06 A;  2DVJ A;  2DYB A;  2JTE A;  1H64 1;  4EMK C;  2PVG B;  1MMA A;  1AHJ B;  2PTK A;  3QUI A;  3EGX B;  3JCM h;  2DRK A;  2VYT A;  4IUQ A;  1AT1 B;  2FG0 A;  4F04 B;  1I0C A;  4BY6 C;  3CD6 T;  2CKK A;  2M51 A;  3IQL A;  4F16 A;  2DER A;  4M7A G;  2OJ2 A;  1YIT Q;  3VRZ A;  3CCJ A;  4OP0 A;  3X20 B;  2L89 A;  3I5R A;  5GJV B;  2BUD A;  1KQ1 A;  2ROL A;  4JRQ A;  3CQT A;  4RTU A;  2CT4 A;  1PC0 A;  4J6Y A;  1VQ9 T;  1X43 A;  2CDT A;  2FZG B;  5D7U A;  2MPX C;  4BI4 A;  1PRL C;  3LYI A;  3TVT A;  2BIV A;  5CO7 A;  5KYW B;  4M75 D;  1VQ8 T;  3H8Z A;  5IN1 A;  1PWT A;  3CC4 T;  1WQW A;  1PRM C;  2G3R A;  4TVR A;  3TCJ A;  2ZGW A;  2QGF B;  3DLL A;  3CCE Q;  3VS2 A;  2ZPE B;  2GNC A;  2O31 A;  3P8D A;  4KUD K;  1YBY A;  1M2O A;  1R77 A;  2F2V A;  2CZ1 B;  3ER0 A;  3TSZ A;  2QDL A;  2H3J A;  5LJ5 d;  4X9C A;  3FC3 A;  3UAT A;  1OOT A;  1KC8 R;  2LMJ A;  3GOX A;  4C8Q E;  3VV0 A;  2OX7 A;  5GAN 5;  1Q82 R;  1K9M C;  1W70 A;  2OTL T;  2CZ0 B;  1YJN T;  3UT1 A;  3CCU A;  5GAN j;  1I5L A;  2DYI A;  1RAD B;  2QTX A;  2X4X A;  2FPD A;  1VQO A;  4M75 B;  4FCY A;  1UHC A;  2O2O A;  1Q86 U;  4JJN K;  1TUG B;  1U06 A;  3EHR A;  3C12 A;  1Z9Q A;  3CME Q;  5LJ5 j;  4BY6 B;  3HFO A;  2DKG A;  2QQB A;  3S6W A;  2DIL A;  3QWY A;  2Y4Y A;  1K76 A;  1T0H A;  2DIG A;  2J6O A;  2YRD A;  3PTA A;  5GAO q;  2E65 A;  2O9V A;  5GMK m;  2OTL A;  2PUK B;  3VS5 A;  4DOV A;  3EG3 A;  3E9F A;  2EQJ A;  5EG2 A;  3M0P A;  2KMT A;  1Q82 C;  1EFN A;  1S72 T;  5EC7 A;  3OYK A;  1W1F A;  1VOM A;  4J9F A;  3REB B;  2XU8 A;  5CVI A;  4LD6 A;  3PE0 A;  4HT8 A;  3JCM e;  1IHV A;  1GL5 A;  2AT1 B;  4ELZ C;  3HTR A;  1QVG P;  5FRM A;  2C0T A;  1WJR A;  4C0Z A;  2FO0 A;  2EPD A;  3NHN A;  1VQM Q;  3R6O A;  4N4H A;  2JOY A;  1VQ4 A;  3OYI A;  3MP6 A;  1VQ7 Q;  2F1L A;  4A4E A;  3A98 A;  3M59 A;  1CKB A;  4FIB A;  3C0C A;  4Z89 A;  2MCN A;  4R56 A;  2DJQ A;  2WSE E;  2JUF A;  2LVM A;  3OY9 A;  3CCV T;  4A53 A;  2RHX A;  4ZN3 A;  2J6K A;  3E19 A;  2KR3 A;  1VQL A;  4GLK A;  1IGU A;  2VXE A;  3G71 T;  1RAA B;  4CC7 A;  3M0R A;  3OSS C;  3PFS A;  5KYY A;  1W4S A;  3DB4 A;  4OB2 B;  3NTH A;  2DTO A;  3A1P A;  1K9M U;  1Y0M A;  3RDV A;  3HKS A;  5FU7 B;  4M78 A;  1VQP T;  4QQG A;  3FJ5 A;  1M27 C;  4OGC A;  3EFO B;  3UWN A;  3RES A;  3JCM J;  4M7D A;  1NE8 A;  2P0P A;  4QVZ A;  2JTM A;  2G6F X;  1K8A C;  3FDR A;  1HXD A;  3JB9 F;  4Y28 E;  3I55 T;  5KYX B;  1PD1 A;  4J7I A;  4JZ4 A;  1QWE A;  2KBT A;  4AFS C;  2PZ1 A;  1JXM A;  2AHJ B;  4M78 C;  4PFO A;  4BE2 A;  1AD5 A;  1SG5 A;  1U1S A;  5GAN 2;  5FU6 C;  4MZM A;  3CMA Q;  1Q82 U;  1WGS A;  1SHF A;  3CCL T;  5CKH A;  5GAO l;  1VQO Q;  1VQK T;  2X51 A;  1JXO A;  4M7D C;  1TOV A;  2L3P A;  3H41 A;  2LT1 A;  3V8K A;  4E7I A;  4M7A A;  1M2V B;  5GAO p;  8ATC B;  5LJ3 h;  3OBY A;  1PKT A;  4EIK A;  1UUE A;  1K73 R;  2RK2 A;  1YJW A;  2MK5 A;  4JZ3 A;  1FWZ A;  1VYV A;  2E3H A;  4F7U G;  4DEX A;  1YCY A;  4B9W A;  3MCA B;  3QYH B;  3QPH A;  2VKN A;  4LE9 A;  1KK7 A;  3CCR T;  4LDV A;  4KUL A;  2V8K A;  1JRI A;  4M7A C;  1VQK A;  1MUZ A;  1H3H A;  5C0M A;  4XTW A;  4X9D A;  1IHW A;  4RMO A;  1W2B A;  2NLU A;  2LRQ A;  2JM8 A;  2CH4 W;  1UFF A;  3MET A;  3Q1J A;  4J9G A;  3I5S A;  2DNU A;  1K73 C;  4E6R A;  3LWH A;  1YI2 A;  5D6W A;  3JCM g; 
#chains in the Genus database with same CATH homology
 3OYA A;  2DJZ A;  4C0D B;  4N0A C;  3G4S T;  1VQN T;  2WAC A;  1D3B A;  4XAX B;  3OS5 A;  1QVG S;  3JB9 H;  3I56 A;  1B34 A;  2K2V A;  1Y07 A;  4XU0 A;  3BFM A;  4EMG A;  2YRV A;  2DTI A;  4R55 A;  4M7A F;  1VQ5 T;  1M8V A;  4BAC A;  4HCC A;  1H3Z A;  3SWN A;  2YLB A;  1QVF A;  1KD1 C;  3JCM Q;  2DPP B;  3ASK A;  2EIF A;  3VYG A;  2XHC A;  1G3Y A;  2KSS A;  4ZTJ A;  4RKU E;  2QDY B;  1K8A U;  3HSB A;  1NJI U;  2E41 A;  4M77 C;  3L2R A;  1OI1 A;  2DXC A;  3GNF B;  4F7U E;  3JRZ A;  2FVU A;  2GFA A;  2JN0 A;  4A4K A;  2IG0 A;  4DOW A;  3JB9 I;  3MP8 A;  3M5A A;  3NTI A;  4C92 G;  2PQW A;  2E6Z A;  3GLX A;  2QQR A;  1QW1 A;  3JSC A;  4IUP A;  4N4I A;  4C92 F;  4O5V A;  2XI9 A;  4DQ2 A;  2E64 A;  4J83 A;  2GFU A;  4PKC C;  3SFM A;  1N9S A;  3OYE A;  4C5H A;  4PJO G;  4A4H A;  2GF7 A;  5GAN 6;  3CCU T;  3CCV A;  1N6A A;  4O6J A;  3QKJ A;  1N9R A;  3A8M B;  4B9X A;  2DO3 A;  2BKD N;  2L3R A;  1X6O A;  1G3S A;  2LC4 A;  2Y4X A;  4PJO F;  5GAM j;  3SWN C;  2L5Q A;  5GAM g;  1VQO T;  4C92 D;  2QQ9 A;  2LNV A;  3QJ6 A;  3RKY A;  4IUU A;  1OZ2 A;  4JLG A;  5GAN e;  4E7H A;  4J6X A;  3JB9 G;  1NPP A;  3FB9 A;  1Y96 B;  4WF2 A;  1JB0 E;  3G71 A;  1GXI E;  1WJQ A;  1VIF A;  4C5I A;  2CZ6 B;  2DZC A;  3JCM f;  1BI3 A;  1NZ9 A;  1KQ2 A;  4JRK A;  3HL8 A;  3RKX A;  3H6Z A;  3O8V A;  4BUG A;  4PJO D;  2XKO C;  2V8J A;  1P92 A;  3BDU A;  4FU6 A;  1KG1 A;  3TRE A;  1M1F A;  4J8O A;  1G3T A;  4JRP A;  5GMK h;  3OS1 A;  5AYF A;  3CCQ T;  3CXC A;  2M0O A;  3M55 A;  1EIF A;  3JB9 D;  5CKD A;  5GMK j;  1FXX A;  4HKE A;  4XU3 A;  1VQP A;  1S72 A;  1RL2 A;  4QQD A;  5CCA A;  4KUI A;  2K3X A;  2HNI A;  4FT2 A;  2QXF A;  3OYN A;  4ELY C;  2M1H A;  3ME9 A;  5L8R E;  2X4W A;  4QVC A;  3BY7 A;  5DLQ E;  5HK3 A;  4NOY A;  3MP1 A;  4XU2 A;  3CC2 T;  3J7A F;  4P5N A;  3CMA A;  2MAM A;  1QP2 A;  2X35 A;  3PGG A;  5A0D A;  5HKC A;  5LJ3 e;  3E9G A;  2FYK A;  5GAN g;  1YIJ A;  1PSF A;  3URG A;  3CBO A;  3RIR A;  4LDW A;  3GF5 A;  4M78 G;  2RI5 A;  2KQW A;  2LQK A;  4XTV A;  5A0L A;  1SSF A;  3A5Z B;  1KQS S;  2DXU A;  5FU7 C;  1WNL A;  3SB2 A;  3P8H A;  3QJY A;  3CCM T;  3TU4 K;  3LLR A;  4C92 E;  4EMK A;  2X4J A;  4E7K A;  3I55 A;  5GAM f;  3GIB A;  2RHZ A;  3MO8 A;  4C92 B;  2M16 A;  4Z02 A;  2XK0 A;  5LJ5 g;  4BDZ A;  3CCS A;  3PNW C;  5KCO A;  1VQ4 T;  2GCX A;  1W2B S;  2B8A A;  3LGF A;  4NS5 A;  2P4T A;  4M7D G;  2QQS A;  4M78 D;  4Y91 A;  3CCQ A;  1HK9 A;  3VU3 C;  4PJO E;  1R8O B;  3VKI A;  4C5E A;  3X24 B;  1YJ9 T;  3CBM A;  2D6F A;  4LDY A;  4M7D F;  4PJO B;  3JCM P;  4DA4 A;  1I81 A;  3CCL A;  1MGQ A;  3X26 B;  1KHC A;  3KXT A;  3L2V A;  2DEQ A;  2WSF E;  2EYQ A;  1UGR B;  3J80 E;  3OYG A;  3CC7 T;  3LH0 A;  2OTJ T;  2HD0 A;  4Q5W A;  2PVD B;  2VV5 A;  1LOJ A;  2JTF A;  2A7Y A;  2Y90 A;  1KC8 C;  4L5G A;  3G6E T;  4JDS A;  2K5F A;  4M7D D;  3MEU A;  4OGE A;  1KD1 U;  2RHI A;  1IZ6 A;  1ZHI A;  4PNO A;  2KK4 A;  4XQ3 A;  4LD9 K;  2YHT A;  2C06 A;  4BE1 A;  1VQL T;  2HQE A;  3NTK A;  1O75 A;  4RCB A;  1H64 1;  4IUV A;  4EMK C;  1QVF S;  2PVG B;  4CI0 C;  1AHJ B;  3DB3 A;  1IRE B;  2EWN A;  2E70 A;  3QUI A;  3JCM h;  1ZQ1 A;  2XDD A;  3V7C A;  4HA8 A;  2VYT A;  4J6W A;  4IUQ A;  2EJ9 A;  2LTO A;  2RH2 A;  2DTH A;  2ZPI B;  3OB9 A;  4MMK A;  3UDC A;  3M9Q A;  4BY6 C;  3CD6 T;  2CKK A;  2WSC E;  4PL6 A;  5GAO r;  3CPF A;  3SWN B;  2R5M A;  4A4G A;  4M7A G;  3QSU A;  3G7Z A;  2V8I A;  3CCJ A;  4OP0 A;  4C8Q G;  3X20 B;  5LJ5 f;  2L89 A;  3QII A;  3CCR A;  4GY5 A;  4KT0 E;  4C8Q F;  3VUB A;  4M78 E;  1I8F A;  3RUX A;  2HBP A;  5KH6 A;  2BUD A;  5FRN A;  3V7R A;  1KQ1 A;  1N27 A;  1G3W A;  1O9S A;  1WJS A;  2ZPB B;  4M78 B;  4M75 G;  5GAM d;  4JRQ A;  5KE3 A;  3LX7 A;  5DM7 R;  2DXB A;  4J6Y A;  4ZGD B;  4M7A D;  2QEX T;  2EFI A;  4M75 F;  1VQ9 T;  2LCL A;  2QI2 A;  5FU6 B;  3X25 B;  4C8Q D;  3C94 A;  4BI4 A;  2K5I A;  5CQY A;  3F70 A;  2E10 A;  1PSE A;  3P8B B;  5HK0 A;  3OYB A;  4M7D E;  3LYI A;  5A0G A;  3FLG A;  2BIV A;  5CO7 A;  4M7D B;  2QQA A;  1XTD A;  4M75 D;  1VQ8 T;  1UB4 A;  2EKO A;  3H8Z A;  5GAM h;  3M4Y A;  5IN1 A;  1RI0 A;  3OS0 A;  1Q7Y C;  3N5B B;  3CXC S;  3CC4 T;  5IT9 E;  1UEB A;  3OQ5 A;  4EPC A;  1UGP B;  3J81 E;  4BI3 A;  1WQW A;  3BW1 A;  2G3R A;  5FRO A;  4TVR A;  3TCJ A;  2X4Y A;  4OB0 B;  3G4S A;  1VQN A;  4HT9 A;  3DKM A;  3QG1 A;  4HCB A;  2ZGW A;  1VQ6 T;  3LW5 E;  3S3N A;  2O4X B;  4M77 G;  3DLL A;  2DAQ A;  3A8G B;  5J39 A;  1VQ5 A;  1MHN A;  4NL2 A;  4OB1 B;  4M77 F;  2ZPE B;  3LWI A;  3P8D A;  3RKW A;  4KUD K;  5GMK e;  1YBY A;  3GP8 A;  4F7U A;  2LT4 A;  3JCM c;  3VYH B;  2PU9 B;  2CZ1 B;  3ER0 A;  4FM4 B;  4OVA A;  2H3J A;  4JS4 A;  3WVE B;  2HAX A;  4M77 D;  1BI1 A;  5LL6 S;  2EQK A;  2RK1 A;  4C0D C;  5LJ5 d;  4X9C A;  4N4G A;  3FC3 A;  2VXF A;  3AHU A;  4M7A E;  1Y7X A;  2CGH A;  3QYG B;  2GQV A;  4M7A B;  3GOX A;  1YJW T;  4C8Q E;  3VV0 A;  5CQX A;  5GAN 5;  1K9M C;  5CR2 A;  2OTL T;  2CZ0 B;  1YJN T;  4FT4 A;  4C8Q B;  3HRS A;  4FSX A;  1OZ3 A;  1M5Q 1;  2RJE A;  4BD3 A;  1I4K 1;  3UT1 A;  4ME7 A;  1M90 U;  3CCU A;  3QZ9 B;  3MHX A;  3SD4 A;  3EFS A;  3MEW A;  2E1H A;  1Y96 A;  5I21 A;  4D6W A;  1BKB A;  5GAN j;  4M75 E;  2E6N A;  3OW2 A;  1I5L A;  4BI8 B;  1UGQ B;  2EAY A;  2QTX A;  2X4X A;  5I2S A;  4L59 A;  1VQO A;  4M75 B;  3M57 A;  2D0Q B;  3A8O B;  5CKE A;  2VC8 A;  4ZGE B;  5C6S A;  1KC8 U;  4A4F A;  5LJ5 h;  1Q86 U;  4JJN K;  3INZ A;  2K5L A;  2MWO A;  5HY6 A;  4E7J A;  2K3Y A;  2ZPG B;  2CYZ B;  3C12 A;  4XTU A;  3DLM A;  5LJ5 j;  1M9S A;  3QO3 A;  4RG2 A;  3OYM A;  4BY6 B;  3HFO A;  2DKG A;  1BYM A;  2QQB A;  5GAO m;  1X75 C;  3S6W A;  2K57 A;  4EMH A;  3FIF A;  2Y4Y A;  4BDY A;  2DIG A;  3V8L A;  2DXT A;  2KDS A;  3QXE B;  3PTA A;  1TH7 A;  3C4S A;  3HFN A;  2JZ2 A;  4QQ6 A;  1VQM T;  1M1K C;  1M90 C;  5GAO q;  2KVQ G;  2E65 A;  3HPW A;  3JCM d;  4VUB A;  2XDB A;  1UGS B;  2HQX A;  4M77 E;  3OS2 A;  1V29 B;  5GMK m;  2PUK B;  3OMC A;  1YIT T;  3V7S A;  4DOV A;  2OTL A;  4M77 B;  5LJ3 g;  1VQ7 T;  2DVE A;  4RG8 A;  3E9F A;  1Q86 C;  2EQJ A;  5EG2 A;  3CC2 A;  2KMT A;  1Q82 C;  2RM4 A;  1YI2 T;  1S72 T;  4BE0 A;  3CEY A;  3OYK A;  3NFC A;  2PUO B;  2L8D A;  4F7U F;  3PIO A;  1QP3 A;  2XU8 A;  5CVI A;  4LD6 A;  2EQU A;  3M58 A;  4HT8 A;  3I56 T;  4BB7 A;  3JCM e;  3JAM E;  5I2M A;  4C92 A;  2XG8 D;  4HCZ A;  4ELZ C;  2EJF A;  3M53 A;  4QW2 A;  5GAN f;  3CCM A;  3A8L B;  3C95 A;  5FRM A;  1D3B B;  1WJR A;  3HHT B;  4C0Z A;  2DD5 A;  4YTL A;  1B34 B;  3X28 B;  4MZP A;  4NL3 A;  3R6O A;  4N4H A;  5CAI A;  4PJO A;  2JOY A;  2JVV A;  3OYY A;  1VQ4 A;  3OYI A;  3GNG A;  1LJO A;  2RJF A;  1Q7Y U;  5D6Y A;  5GAO n;  3MP6 A;  4IUR A;  1M4Z A;  4A4E A;  4MZT A;  1YJ9 A;  2M9U A;  3M59 A;  1QVP A;  1VUB A;  4II1 A;  4ATO A;  2E12 A;  4FIB A;  2A3L A;  2RHU A;  2RO0 A;  4PLI A;  4R56 A;  1ZBX A;  1KHI A;  2WSE E;  2JUF A;  3CC7 A;  3TEE A;  3WXM B;  2OTJ A;  1OYX A;  2LVM A;  4C5G A;  3OY9 A;  4OMF B;  3L2W A;  3CCV T;  2RJD A;  3G6E A;  3CCE T;  2ZPH B;  3UPU A;  4A53 A;  3FRN A;  2RHX A;  4C92 C;  4ZN3 A;  4LDX A;  2LCC A;  3E19 A;  1VQL A;  4GLK A;  1G5V A;  4JRI A;  1JJ2 A;  5LJ3 f;  2MF2 A;  3CBP A;  4C0G A;  1YHQ T;  2R5A A;  2VXE A;  3G71 T;  3MEA A;  5GAM e;  2EJG A;  4ZGJ B;  4OF1 A;  4PJO C;  2DIQ A;  3PIP A;  1U8R A;  3M54 A;  3JCM b;  3OSS C;  3ZFJ A;  1WQ7 A;  2O01 E;  3PFS A;  3OBW A;  3ZBD A;  1W4S A;  1Q81 C;  3DB4 A;  4OB2 B;  3NTH A;  2DTO A;  1K9M U;  3CD6 A;  2E5Q A;  5CKF A;  1BIA A;  4JUV A;  3HKS A;  3JCM W;  1U1T A;  3JB9 J;  5FU7 B;  4M78 A;  2VUB A;  3CPW A;  5CK9 A;  4F7U B;  1BI2 A;  1VQP T;  3FJP A;  2DD4 A;  4QQG A;  3KBG A;  3JCM g;  1QVG A;  5GAN d;  2P0Q A;  2XDP A;  4J5Y A;  1VIE A;  3OMG A;  4KBM B;  4OGC A;  3E1S A;  3V8J A;  3QZ5 B;  3UWN A;  3S3M A;  2RI2 A;  3RES A;  4QVD A;  3OW2 S;  2RI3 A;  4PLL A;  5DLO A;  3OSV A;  3CMA T;  3L42 A;  5M9O A;  2XD0 A;  2QEX A;  3JCM J;  4XU1 A;  1VQ9 A;  3CCE A;  2OAU A;  3GPL A;  2FHD A;  1NE8 A;  3T9N A;  3ZEH A;  5IAY A;  1YIJ T;  4M7D A;  3CME T;  2KAF A;  1BI0 A;  2P0P A;  3QDR B;  2KY9 A;  3PT9 A;  2MMP A;  4QVZ A;  2JTM A;  1YHQ A;  3PMI A;  1K8A C;  3M56 A;  5GAN h;  1NJI C;  4FL6 A;  3FDR A;  1HXD A;  1VQ8 A;  4Y28 E;  5FLX E;  3KUF A;  3I55 T;  2QA4 T;  4E7L A;  3JB9 F;  4J7I A;  1M1K U;  3OYD A;  3CCS T;  2O4X A;  2AHJ B;  4M78 C;  3CC4 A;  4BE2 A;  2XIC A;  2FB7 A;  2MI6 A;  4MDW A;  5LJ5 e;  1U1S A;  5GAN 2;  4EMK B;  3OYJ A;  3LGL A;  2F5T X;  2LQ8 A;  5CKB A;  1N8R U;  5FU6 C;  4MZM A;  5LJ3 d;  1Q82 U;  1VQ6 A;  4MDX A;  3QBY A;  1WGS A;  1XQH A;  3S3O A;  2P0K A;  3PMT A;  5J26 A;  3CCL T;  4V2S A;  5CKH A;  2R57 A;  4A54 A;  5GAO l;  4X34 A;  1FX7 A;  4LDU A;  1VQK T;  4M7D C;  3L2Z A;  4C0F A;  4ZTF A;  4XK8 E;  2LT1 A;  2ZCF B;  3V8K A;  4E7I A;  3HRU A;  4ZN1 A;  3OYH A;  2RB6 A;  4XTX A;  4M7A A;  4JS5 A;  1DJ7 B;  2ZPF B;  4JLI A;  5A2Q E;  5KE2 A;  4EDU A;  3QHS A;  4UC4 A;  5GAO p;  5LJ3 h;  2RA2 A;  3OBY A;  3HRT A;  4C8Q A;  3CME A;  3VJP A;  3M4G A;  1X01 A;  5GMK l;  3VUZ A;  5GMK i;  3JCM V;  2RK2 A;  4M78 F;  5CIU A;  3JCM X;  2EQM A;  5GAN 7;  3L2U A;  1YJW A;  3L1A A;  2I2L A;  4XTZ A;  5LJ3 j;  1BIB A;  3RMS A;  1YJN A;  1FWZ A;  4IUT A;  4M75 A;  3RER A;  2QA4 A;  1M1G A;  4F7U G;  1N8R C;  1LNX A;  1YCY A;  2CZ7 B;  2R58 A;  4L6V 5;  4E47 A;  4B9W A;  4OB3 B;  2RJC A;  3RMQ A;  3MCA B;  3QYH B;  3QPH A;  2RD1 A;  4CRI A;  2DZ9 A;  3EAE A;  3CCJ T;  4J7F A;  1Y71 A;  3BDL A;  5GAN 4;  1K73 U;  5GAN 3;  4MML A;  5D6X A;  3CCR T;  2LX9 A;  5GAN 8;  2CS7 A;  4N0A A;  4LDV A;  2RHY A;  2PVO B;  4RCC A;  1KQS A;  2K4Y A;  4KUL A;  2V8K A;  1JRI A;  3HP9 A;  4XTY A;  3OYF A;  1VQK A;  4M7A C;  1XOV A;  2YLC A;  3OA6 A;  4C8Q C;  2VGM A;  5C0M A;  5KCH A;  3OYC A;  1XNI A;  2F69 A;  3L2Q A;  4XTW A;  4X9D A;  2LDM A;  2VGN A;  5J3B A;  1JJ2 S;  3A8H B;  5DY9 A;  2FL7 A;  4RMO A;  1W2B A;  3WVD B;  2F5K A;  2NLU A;  2LRQ A;  1Q81 U;  4M77 A;  2XID A;  3MEV A;  1NPR A;  3FEO A;  4M75 C;  1VQM A;  3OYL A;  2JNG A;  4IKF A;  3MET A;  2IVW A;  3EFR A;  3Q1J A;  1YIT A;  2DK3 A;  1WPY A;  2MWP A;  3SDZ A;  1K73 C;  1JBM A;  2ZZD A;  1VQ7 A;  3LWH A;  1YI2 A;  5D6W A;  2D9T A;  3CPW S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...