1VIFA

Structure of dihydrofolate reductase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
PSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DIHYDROFOLATE REDUCTASE
publication title A plasmid-encoded dihydrofolate reductase from trimethoprim-resistant bacteria has a novel D2-symmetric active site.
pubmed doi rcsb
source organism Escherichia coli
total genus 12
structure length 60
sequence length 60
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 1996-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1vifA00
3UDCA 2P4TA 2RK1A 1VIFA 2VV5A 3T9NA 2RK2A 2GQVA 2OAUA 3SFMA 1VIEA 2RH2A
chains in the Genus database with same CATH superfamily
2F2WA 4X34A 3G4ST 4IUTA 3CPFA 5KYYB 2D8JA 1U06A 2I0NA 4GLKA 4IKFA 1IHVA 2MOXA 2KI7A 2RJCA 4QKUA 1UB4A 1QKWA 2PNIA 3JB9D 1U3OA 2K5LA 2KR3A 3A8MB 1FYNA 4BB7A 4DBRA 4HKEA 2R5AA 7AT1B 2CYZB 4FYVB 1ZUKA 3CMEQ 4LD9K 3CCRQ 4J9HA 4M78D 2D6FA 3NMZC 3QO3A 3TVTA 5LJ3j 5FU6B 3QZ5B 2RI2A 3FC3A 2P4TA 5GAN4 1T3LA 1WPYA 2B86A 2KROA 4C5GA 3KUFA 2P84A 1Y71A 1I81A 3EHQA 1XJWB 1WDXA 2CUBA 1W1FA 3CMAQ 4A4GA 4F7UF 5GAOp 1FMVA 1ABQA 1I5OB 1VQ9T 2DJQA 4AT1B 1BI2A 1QWFA 2KYMA 1YI2T 1VQ9A 2YHTA 1YJNQ 1WGSA 1QQJA 2K7AA 2LJ3A 3HSBA 4QVCA 3X20B 1JJ2A 1LOJA 3E9GA 1KQ2A 2XDPA 3HRUA 4ZN1A 2DX1A 1GXIE 2FZGB 4X9DA 1Y0MA 2D0QB 1SKUB 2DTHA 2RF0A 2X4YA 3ZFJA 3I56Q 2IG0A 3CC4Q 1QVFS 1AWJA 3A8LB 3M59A 4C0DC 2NUZA 2XG8D 3M56A 3M0SA 3OYLA 4ESRA 2CP5A 4II1A 1JRIA 3R6OA 1Q86U 4C8QF 5CR2A 2L3SA 4J8OA 4KT0E 5LJ3d 3OYEA 4LDVA 1G5VA 4FW1A 3EFSA 1M1KC 5GAMf 5IHIA 4WCIA 4J6WA 4AFSC 3OY9A 3CCJQ 2SRCA 4OMFB 1VQPA 2F1LA 4CRIA 4BACA 2FRYA 5FRMA 1OX9A 4E7JA 3E9FA 2HBPA 2LVMA 5GAOm 3OYHA 4PJOC 4J9GA 2QTVA 2XD0A 1PRLC 2VYTA 4C92E 1ZA2B 5GAOr 3VS4A 4FSXA 3CCUQ 1OPLA 2PTKA 1PKSA 1UJYA 3P8DA 5KYXA 3CCMQ 1VOMA 2E3HA 3EAEA 2VXFA 2NYSA 4ZTJA 1YJWA 4MDXA 4M78B 3G6EQ 1AHJB 2DETA 1PHTA 1UJ0A 4KUIA 4E2FB 4ELZC 2MYSA 2P4RA 4NS5A 4OF1A 8ATCB 2DVEA 2CZ7B 2KRNA 2LJ0A 2EJFA 2QK0A 3HTRA 1H92A 2YUPA 1ZQ1A 3CCLQ 1YITQ 2YSQA 2DJZA 3CC7A 4PLIA 4PJOF 4IURA 1VQKQ 1AZEA 3A8OB 4Y91A 2YLCA 3OW2P 1YCSB 2F2XA 4EMKA 5L23A 4PJMA 2VB6A 2H8HA 5KYUA 2VV5A 1VQLA 4RCCA 1X6GA 2AK5A 2DMOA 4BY6C 1IZ6A 2A0FB 1MNEA 1UG1A 3JCMX 1QW1A 1W2BS 1GRIA 4QT7A 1NM7A 1AD5A 4FL6A 2Y4YA 5HY6A 2CT3A 2HEQA 1G3WA 2DVJA 2LCLA 1ZUUA 2C06A 2CREA 3SB2A 2DBMA 1P92A 5DLQE 4A54A 5GANj 3PIOA 5HKCA 3SFMA 4Q5WA 4MMKA 1M30A 1OU9A 3V8JA 1M90C 1HYOA 3UATA 1DJ7B 2DM1A 5GMKl 2XHCA 2KRMA 1TSFA 1G83A 3RUXA 2EKOA 4RG8A 3LH0A 1RI9A 4NOYA 2AZVA 2RHZA 1OU8A 2GFAA 2JJ9A 4BI8B 4PL6A 4JDSA 3P8BB 2ZZDA 1QWEA 1VYTA 3CEYA 5J3BA 2AKKA 3CQTA 2LC4A 1Y57A 4O5VA 2ED1A 2QXFA 3MEVA 1A0NB 3EFRA 3CBOA 3CXCS 3CD6T 4IIOA 2JS2A 1WHJA 3O8VA 2LT4A 5GMKe 4E7SA 2W0ZA 2QQSA 2HQHA 2ZPIB 3CD6A 2COYA 4XTUA 2RD1A 4Z02A 2RI5A 2BUDA 4ZGJB 2W10A 3N5BB 1M1KU 1KFZA 4EMHA 3SWNC 4F04B 2KMTA 5FRNA 2EQIA 2XU8A 2J6OA 5GAMg 3QBYA 2RHXA 1UGQB 5GANd 5CAIA 1RAFB 4OMOA 4QVZA 4CC3A 2RHYA 3R6NA 4ZTFA 1OV3A 4F14A 3KXTA 3OSVA 2DK3A 2MMPA 2JS0A 5CKDA 3RR6A 2X4JA 1VQ4A 3EFOB 3MP1A 2HBWA 1RACB 4M7DB 5IXBA 2GF7A 3NTHA 3EG0A 2E10A 2AIRB 4F7UE 4OB2B 2QGGA 2V8IA 3GBQA 2JTMA 3JCMe 4RTUA 2KBTA 1G8XA 1WXUA 2RNAA 4KGXB 2JZ2A 3CCET 2HNIA 1E6HA 1SSFA 2DXCA 2XMFA 3QXEB 3CCEA 3VS0A 5IT9E 4Z8AA 2GTOA 1RADB 2ZPEB 3BE3A 3GNFB 1AEYA 2DIGA 4B6MA 1LPLA 2YUQA 4M77D 2M0YA 3QYGB 3VYHB 4BDZA 1OX8A 4Z88A 3OSSC 2J6KA 4M75B 3QYHB 4C8QE 2E12A 2HL5C 3QJYA 1JEGA 3I5SA 1R0BG 3G71T 2LRQA 3SHWA 3PFSA 1FWZA 3G71A 3VS1A 1QVFA 1V76A 3I35A 2OX7A 4N4IA 1X69A 2CSQA 2LNHB 1KJWA 3PVLA 5A0DA 3JCMc 1AOJA 2K4YA 4BUGA 5FW9A 1Q82C 3A98A 4RTYA 1S72T 2DZCA 4JJCA 5CCAA 1M9SA 3CCVQ 1W4SA 1E7OA 2EQUA 2XIDA 2QQ9A 3META 4KULA 5C6SA 2RI3A 1MHNA 3GLXA 3G4SQ 2EGAA 2X4WA 1OPKA 5KCHA 5J26A 5LJ3f 5I2MA 2C0OA 1RABB 4M4ZA 5GMKm 4HCKA 4QVDA 1Q82R 4MDWA 1M90U 5LJ5f 4PK4A 2PUKB 4J9CA 2O9VA 1WJQA 3KFVA 5IAYA 3OS1A 1D3BA 3PTAA 2YDLA 3VRZA 2FZCB 3A5ZB 1ABOA 3U23A 5GMKj 2Z0WA 2C0IA 4A4FA 1VQNT 2ABLA 2FHDA 2JM9A 3LGLA 3A8GB 3JV3A 1AWWA 5FU7C 1VQNA 1VYUA 1UUEA 1KK7A 4M77A 3JB9J 2C0TA 4PJJA 4PJOE 2YT6A 3QHSA 3M0QA 4A4KA 5A2QE 3JB9F 2A7YA 3EGXB 5DM7R 1K76A 2XDDA 4M77G 1WHGA 2VGMA 4XTXA 1N27A 1YP5A 4PJLA 1VQ9Q 1D3BB 3OB9A 3C4SA 5HCKA 1YI2Q 1T0HA 1WQ7A 3SD4A 4M78F 2O88A 2HL3A 1NJIC 3ULRB 1WLPB 2X4XA 2QAZA 2P0QA 4XU3A 5FWCA 5IXFA 2COWA 8AT1B 1UGRB 2EQKA 2YUOA 2YWWA 4AG2C 4XTYA 1BCOA 4M77B 4BI3A 4P5NA 5KYWB 4XTZA 2DL3A 2PZ1A 3JAME 1IRXA 4RTZA 2MCNA 1U1TA 1AWOA 1N9SA 3RDVA 3QUIA 4EMKC 2FVUA 1NJIR 1FMKA 3S3NA 1HK9A 1D1AA 5I2SA 1RLPC 4J9FA 2G6FX 1R0CB 1W2BA 2DKGA 1UFFA 4C5IA 2L5QA 1KQSS 3CCST 1T0JA 2KDSA 2V1QA 2ZGWA 3REAB 4HCCA 1ZBXA 3CCSA 1MMGA 4HCZA 2JTFA 4DBFA 5CQYA 4N0AA 2DXUA 4TVRA 2K3BA 4LN2A 2DL4A 4OMPA 1O75A 2KVQG 1WNLA 1WYXA 1ZSZB 2JUFA 3JCMW 1VQ6T 1N6AA 1OULA 1YWOA 2QA4A 4KH1B 2D9TA 3PGGA 3JCMd 1VQ6A 3HRTA 1UHCA 2EYXA 2EGCA 3M0PA 4CC2A 3CCQA 4XAXB 4F16A 1UGSB 2KXCA 3MP8A 4A4EA 3OYDA 1YCYA 5HK0A 1X27A 1QVGP 3JSCA 2H3EB 3WXMB 2QQAA 1IXDA 4C8QC 1BK2A 2DRMA 4CI0C 3CXCA 2VGNA 4OGEA 1Q82U 1VQMT 2CH4W 2Y90A 2HQXA 5FWBA 1VQMA 5KE2A 4M7AD 1I8FA 3MPUB 3QJ6A 3REBB 1TUGB 2DL5A 4RMOA 3J7AF 1KQ1A 3RBBB 4OB1B 4B9WA 2VWFA 3QDFA 4PJNA 4PFOA 1SF9A 1TUCA 1UECA 5LJ3g 2BZXA 1K9MC 3JCMJ 5CQXA 5GANf 3V8KA 2XDBA 5LJ5g 1PSFA 3THKA 4JJNK 1OEBA 1M3BA 2E4HA 3UDCA 3URGA 2K5IA 4X1VA 5GMKh 1BI3A 4FT2A 1KD1C 2OTJT 4IIMA 1JQQA 1CKAA 1BIAA 2MI6A 3O5ZA 5GJVB 4Z89A 1K9MR 2OTJA 3CPWP 1VQPT 2QDLA 4PFZA 3QDRB 1SHGA 1VQ7T 3JB9G 4M78A 3M4GA 5GAMe 3RMSA 1VQ7A 5HK3A 2DILA 1OOTA 6AT1B 1AVZC 1KD1R 3CC2A 3ASKA 2NUTB 3X24B 2FPDA 5CIUA 4M78G 2X51A 4J9BA 3VS6A 1M1KR 1NJIU 2RK1A 2QYZA 3HL8A 2V8KA 3INZA 3RNJA 4LUEA 4JS5A 2RQRA 3JCMh 4AFUC 4QW2A 2H3JA 1MGQA 1YJWT 1RUWA 4M7AA 2LT1A 2AKLA 4IUVA 4HT9A 2EPDA 4E7HA 5D7UA 1K73C 4RCBA 1WHHA 3CMEA 1YNZA 2JXBA 4M7AG 3CD6Q 3QWYA 2FPEA 2NLUA 4J5YA 2DNUA 3GIBA 5CKBA 1C6VX 1W70A 3CC7T 3VU3C 1YJ9T 3MP6A 2CS7A 3LWIA 4Y92A 1QKXA 4B9XA 2E6NA 3OMCA 4KGZB 1YJ9A 1LCKA 4ATOA 1UTIA 3I55T 3X28B 5CKHA 1YHQT 4J83A 2F5TX 2YRDA 1KG1A 3CMAA 4M7AB 4J9DA 3I55A 4M7DD 1EIFA 3HFOA 1YHQA 1V29B 1VQLT 1VQ4Q 2L8DA 2GNCA 2KXDA 5I11A 1H641 3M5AA 2DYBA 1K1ZA 2V26A 3AT1B 2EAYA 2FL7A 3RESA 3LH5A 1LJOA 2F69A 1JXMA 3PNWC 2RMOA 3I56A 1JB0E 4JZ3A 3TSZA 2MK5A 3NGPA 1GL5A 4M78E 4BE1A 2KNBB 3CCEQ 2FZKB 4RKUE 3MEWA 3OYCA 3JB9H 4IUQA 1R77A 2OAWA 2DTOA 4M75D 1TTHB 1WX6A 4K11A 2DTIA 1PWTA 5IN1A 2D1XA 5GAOn 1BB9A 2LQNA 2ECZA 2IVWA 2J06A 5GAN2 1VYVA 4OMMA 3OW2S 4J9EA 4WTOB 1JJ2P 1U1SA 2MWOA 1M3CA 2DXBA 2F5KA 1K9MU 3ZEHA 3G71Q 3EG2A 2K3YA 2E1HA 4FIBA 4HA8A 1O9SA 2HQEA 2KK4A 1M90R 1WJRA 2LCSA 1V1CA 2K3XA 5GAMj 2F2VA 3WVEB 3EFOA 3VUZA 4KGVB 2KE9A 2EJGA 2K57A 1NEGA 3PMIA 1M1FA 4M7DA 3FJ5A 1RAHB 1GCPA 1S72Q 4LE9A 4M77F 3CCMA 2NUPA 1KD1U 4J6YA 1KQSA 2GFUA 3EG9B 1M2VB 1YIJT 4JLIA 4FW2A 2M16A 4M7DG 2CH4A 1YIJA 1WA7A 2RQTA 1Q81C 1G2BA 3V7SA 5FU6C 3OYYA 2MAMA 2ZAEA 3L2ZA 2HCKA 4JRQA 2KSSA 3VS2A 2XKOC 1VQ4T 4N4GA 3NPFA 4D8DA 4HVWA 2LQWA 3PMTA 2JNGA 4N0AC 2QG9B 2KAFA 1UE9A 1MMAA 1NYFA 4IUUA 1K0SA 2NUPB 1Y96A 1EX4A 3OBYA 3Q1JA 1JU5C 1SSHA 3H6ZA 3QWXX 2RJEA 4FYWB 1Q81R 1VQNQ 4M75A 4DEYA 3V7RA 1WJSA 3JCMf 3QG1A 4E6RA 2CZ6B 3M57A 4NL3A 4EMGA 1FXXA 1XOVA 5GAMd 2G3RA 4M75G 3HPWA 4E7KA 9ATCB 1NLPC 1KHCA 2Y4XA 4WF2A 1GBRA 3TREA 3SEMA 1B34B 3BY7A 1AT1B 1GFDA 3CCVA 1Y96B 3V8LA 2FEIA 2DEUA 4MZTA 4OP0A 2RO0A 3C94A 4C0DB 2DO3A 2CP7A 3RMQA 5FLXE 1WQWA 2HSPA 1VUBA 2XICA 4LNPA 2K9GA 2EYZA 1VQ5T 2JOYA 4HCBA 1D1BA 3UA6A 1VQ8T 2BZYA 1M3AA 1GCQA 1VQ5A 1VQOT 3J81E 1VQ8A 1AZGB 1ZLMA 2CT4A 4KRTA 2R58A 1ACMB 3VV0A 2L2PA 2O2OA 1I1JA 2MPXC 5CKEA 1VQOA 1AWXA 3JRZA 3PIPA 1X2KA 1G3SA 2EFIA 4HVUA 5CVIA 5A0LA 3D7SB 2VASA 4R55A 1TXQA 1VIFA 3CCSQ 4JRKA 4OB0B 3HFNA 3FB9A 2KQWA 3HRSA 3L2RA 1BKBA 1H3HA 2JW4A 2JVVA 3PVQA 3ZL7C 4Y28E 1OZ3A 2RPNA 1TH7A 2LZ6B 1C1AA 3EGXA 2GTJA 2ZPBB 5LJ3e 3E19A 4M78C 1JXOA 4DQ2A 2QA4Q 4LXCA 2R57A 3UPUA 5GAN3 4JJBA 3E1SA 2CGHA 1VQ6Q 2OTLT 1IO6A 4A63B 2DEQA 5LJ5e 1R8OB 2FYKA 1MV3A 2OTLA 4ZNXA 1F1BB 5I22A 1H8KA 2JTEA 4LDXA 2DLPA 2DL8A 2RHIA 2L3PA 3HKSA 2RJDA 1HXDA 2LQKA 2M51A 4OGCA 1U5SA 3C95A 3NTKA 5KYWA 4L59A 3M9QA 1SRLA 4M7AC 1KC8C 3EH2A 3LLRA 3M0TA 3PE0A 3QKJA 5GAMh 2PVOB 1Q95G 2J6FA 4OMQA 1VQMQ 4OB3B 3UF4A 2P0PA 3RERA 2HMAA 3OMGA 3MJXA 3X25B 1UGVA 1D09B 1K8AC 4LUDA 4J9IA 3C0CA 1RI0A 4X9CA 3OS5A 1MV0B 2BIVA 4C92D 1Q81U 1S1NA 1XTDA 1B3QA 2AHJB 3DKMA 1KC8R 4J6XA 2OI3A 1NG2A 1WHMA 2QTXA 4XQ3A 3FLGA 3UA7A 2GQVA 4JJDA 1M8VA 2YUNA 3VS7A 4KH0B 2KY9A 5LL6S 1QCOA 3P8HA 1QP2A 1ZSZA 2E64A 2DAQA 2CP0A 3L2WA 5GAOl 1K8AR 1IREB 4M7AF 3H8ZA 2A37A 1FMWA 2IIMA 2OTJQ 2A36A 1OI1A 1M2OA 1PSEA 2L3RA 2KRSA 1B07A 1RAIB 2CP6A 2KYBA 1TWBA 2CKKA 2O9SA 3C12A 1UGPB 3JCMV 3J80E 3GF5A 1VQPQ 2JM8A 3WVDB 1VQ7Q 1H3ZA 3DLLA 2JMAA 3OYGA 4DOVA 4BDYA 3GOXA 4F17A 4PNOA 2K79A 3HP9A 2DA9A 2QA4T 5CK9A 4JUVA 5I21A 4PLLA 3VUBA 1X01A 4XTWA 1D0XA 1Z9ZA 4ANJA 1X2QA 1SHFA 5KCOA 2DYIA 3G4SA 3OW2A 2DZ9A 4OVAA 1WZOA 1Y7XA 3EG1A 3CCQT 4M77E 3ER0A 3OYKA 1FX7A 4EPCA 2B8AA 2QEXT 1YJWQ 1IGUA 3BW1A 2LNVA 5EC7A 2QEXA 2KEAA 1ZSGA 3SWNB 2ED0A 1QVFP 1ZBJA 1Y07A 4C92A 2BKDN 1PD0A 4XK8E 4FU6A 3QPHA 1WI7A 4OMNA 2LCCA 3TCJA 1PM3A 3G7ZA 3ME9A 4JRPA 4MZPA 3CC7Q 1KIKA 4KBMB 1YJ9Q 4M7DC 2DPPB 5LJ5j 2QDYB 4C92G 2EQJA 2E6ZA 3JCMb 1TG0A 3S3OA 1C0MA 1ZHIA 1SRMA 1WXBA 3OS0A 3I55Q 2E70A 2RJFA 1YHQQ 2HDAA 1M1GA 3FEOA 2BE9B 1QP3A 2CP2A 1OZ2A 2CP3A 3MCAB 1VQLQ 3OS2A 3OYBA 4C92B 2DFUA 2PU9B 1YI2A 1BBZA 2CSIA 1YBYA 4V2SA 5KE3A 3L2QA 3S3MA 2NUTA 3OYNA 2CZ1B 2OJ2A 1J3TA 5J39A 2J7IA 3FDRA 5GANe 2PVGB 1WFWA 1WHKA 3TEEA 3MHXA 1MUZA 5IH2A 4R56A 1VA7A 5GAN8 2YRCA 4LD6A 2FB7A 4FYXB 1QVGS 1G3YA 1HD3A 2KT8A 4AG1C 1RAEB 2KT1A 2FO0A 4M75C 4YTLA 4M7DF 1KC8U 2M1HA 1TOVA 4HVVA 4FSSA 4BE0A 2EBPA 3OYIA 2JMCA 1NLOC 4RTTA 4MZMA 3CC2T 1PRMC 2GBQA 3LW5E 4DA4A 4RG2A 3VRYA 1IB8A 1RL2A 3M0UA 2LTOA 4O6JA 2L0AA 5LJ5d 1K8AU 2BZ8A 1LVKA 1ZA1B 1BCMA 3M4YA 1K9AA 3JCMQ 1X6OA 4FM4B 2RQUA 3TQ7P 2EYQA 4BI4A 1PD1A 3CMET 1SG5A 3CCRT 1TUDA 1I5LA 4L5GA 1EZZB 2FPFA 1I07A 4RTVA 2M9UA 3KBGA 3HHTB 4M75F 2BTTA 4NL2A 2JN0A 3CCRA 2LX9A 2QGFB 4UC4A 1E6GA 1GCQC 1W2BP 1K0XA 3CPWS 4FCYA 3JB9I 2VXEA 3FRNA 1YIJQ 1BU1A 3CMAT 1K73R 1HSQA 1WXTA 1UEBA 1X75C 4GY5A 4MMLA 4JRIA 3NHNA 1YFNA 3FJPA 4FYYB 1QCFA 4C8QD 1G3TA 1YJNT 4EIKA 5FU7B 1X6BA 3VKIA 1XNIA 1YJNA 1M4ZA 1QVPA 3LYIA 2L89A 5KYXB 4BD3A 4PKCC 3LX7A 4LDYA 4CC4B 3I56T 5A0GA 1ZUYA 3CC4T 2X3XD 1QLYA 3M54A 3F70A 3CC4A 2YRVA 2ZPGB 4LDWA 2DBKA 2MWPA 1PC0A 3L2VA 3I5RA 3H9NA 2A28A 3RKWA 1N8RC 4ZGEB 4M77C 3VS5A 2ZPFB 3GNGA 2SEMA 3RKYA 2M02A 3CXCP 2E5QA 1CKBA 4F7UA 1D1CA 3EHRA 4ORZA 3OQ5A 1Q7YC 4L6V5 5LJ3h 3RIRA 1VIEA 4XU1A 2V1RA 2HKNA 2ROLA 4QQ6A 3CCJT 4JS4A 3UT1A 1HJDA 2R5MA 1ARKA 3EG9A 2MF2A 1M2VA 3NFCA 4EMKB 2AT1B 4E47A 5LJ5h 3CCJA 4F7UG 3CBMA 3PT9A 3LWHA 4M7AE 5L8RE 5GMKi 5KYUB 1N8RR 1NE8A 4RTWA 4AFQC 2K5FA 4C0GA 3DB4A 3VYGA 2QQRA 4OMLA 1I0CA 4QQGA 5CKFA 1Q7YR 1CSKA 2GQIA 4E7LA 2E65A 1VQ5Q 3EG3A 3CCUT 3DLMA 2QI2A 1VQ8Q 2COZA 5CO7A 2LQ8A 2E41A 5GANg 3CCUA 1JO8A 4F7UB 4PJOD 3T9NA 1MNDA 4FT4A 1M8MA 2WACA 3CCMT 5C0MA 3BDLA 1VQOQ 2M0OA 3IQLA 1UHFA 4E7ZA 5D6XA 1JBMA 2ESWA 1IGQA 3TSWA 2RQVA 5FROA 5EG2A 2O01E 4C8QA 4KUDK 1ZSZC 2JT4A 2VUBA 3BDUA 3G6ET 3QZ9B 5GJWB 1I4K1 1BI0A 2PUOB 1TS9A 3G6EA 1TU0B 2RK2A 2PVDB 2D0NA 3MKDA 4ELYC 5GAN5 3H0HA 4C8QG 1OQKA 3FIFA 2DIQA 4DOWA 5IHNA 1KHIA 4E7IA 1BYMA 3CCLT 1YITT 5D6WA 3M55A 2EQMA 3CCLA 3RKXA 1YITA 4LDUA 2EJ9A 2EW3A 1VQKT 1B34A 4JZ4A 3OYFA 1JJ2S 1GBQA 2OTLQ 4C0ZA 1VQKA 4A53A 3A1PA 3GPLA 4C8QB 3SDZA 1RAGB 4DBQA 1QCNA 2RB6A 3M58A 4EDUA 4HXJA 2RQWA 3S6WA 4ZN3A 3E2UA 1NPPA 1K73U 2CUDA 2ZPHB 2EYWA 4JPBW 2CZ0B 2V8JA 3VS3A 5DY9A 1PNJA 2BE7D 2L3QA 1XQHA 4IUPA 1RAAB 3VJPA 3TU4K 4N4HA 2O4XA 2LJ1A 2EKHA 1D0YA 1M5Q1 3OA6A 4D8KA 1RLQC 4C92C 1U8RA 3M0RA 1NEBA 5M9OA 1N9RA 5ECAA 4GLMA 4PJOA 2DRKA 2XI9A 1BIBA 2HD0A 2DXTA 5GAOq 2GCXA 2MIOA 2WSEE 4A4HA 3G1JA 1SPKA 4RTXA 2DF6A 2DE0X 2RH2A 4PJOG 3V7CA 4J7IA 4M7DE 3A8HB 1OYXA 2E3IA 4RUGA 2O4XB 1NYGA 2A3LA 1X43A 2CDTA 2DL7A 3M53A 4AFZC 3DB3A 3MO8A 2VKNA 3L1AA 1WHLA 3H0FA 1QVGA 1SEMA 2EGEA 4PJOB 4C92F 1BI1A 4CC7A 4XTVA 1NZ9A 2OAUA 2DD4A 3AHUA 1MMNA 1N8RU 4ZGDB 2RM4A 5AYFA 2AZSA 3BFMA 1S72A 4VUBA 5IHKA 2KGTA 2PQWA 1Q7YU 2HSEB 2E5KA 4C5HA 2HZYA 2A08A 2LMJA 1NPRA 3ZBDA 4BE2A 1QMCA 1EFNA 3OYAA 4M75E 2QASA 1D0ZA 1PG5B 5GANh 4AMCA 3CCQQ 2O31A 1GFCA 1MMDA 2DD5A 3JCMP 5GAN7 2QEXQ 2LX7A 2ROTA 2WSFE 1PCXA 1KSWA 1PKTA 1IHWA 2ENMA 1B7TA 3H0IA 2QQBA 3UWNA 4ME7A 1Q86C 1YN8A 1T3SA 2XK0A 2DERA 2FRWA 4C5EA 3CPWA 1WIEA 3MEUA 1KQSP 4C0FA 4J7FA 5KYNA 2X3WD 2HAXA 3OBWA 2VVKA 1UDLA 3QIIA 4XU2A 4DBHA 2EIFA 3MEAA 2IPOB 4BY6B 2RN8A 2YXYA 1Q86R 3I9QA 1M27C 3EGDA 2FG0A 3L2UA 1YWPA 1N5ZA 2GGRA 2HKQB 3H41A 2ATCB 2I2LA 2LDMA 2J05A 2RA2A 3OYMA 2P0KA 2YLBA 3X26B 2X9HA 5AT1B 1NBEB 3EH1A 3L42A 1W6XA 1K4US 2X35A 2K6DA 2EWNA 5KYYA 2WSCE 3OYJA 5GAN6 2EYYA 1ZX6A 4HT8A 5DLOA 1LNXA 2RHUA 4JLGA 2K2MA 3NTIA 4XU0A 3EGUA 3QSUA 2VC8A 3CBPA 2ZCFB 3JCMg 3LGFA 1Z9QA 2K2VA 4QQDA 2D8HA 4R0KA 3GP8A 2LP5A 4PFPA 3EGDB 3SWNA 3CCVT 4D6WA 4GBQA 5KH6A 2EVRA 4DEXA 3CC2Q 5D6YA 2NWMA
chains in the Genus database with same CATH topology
3M4YA 2E1HA 4FIBA 2K4YA 4HA8A 4X34A 4BUGA 1Q82C 3JCMQ 3G4ST 1O9SA 2HQEA 2KK4A 1S72T 2DZCA 1WJRA 4IUTA 3CPFA 5CCAA 1M9SA 1X6OA 1W4SA 2K3XA 5GAMj 2EQUA 2XIDA 3WVEB 2QQ9A 4GLKA 4FM4B 3VUZA 4IKFA 2RJCA 2EJGA 2K57A 3META 4KULA 5C6SA 3PMIA 1M1FA 2RI3A 4M7DA 1UB4A 1MHNA 3GLXA 2EYQA 4BI4A 3JB9D 2K5LA 3CMET 4M77F 3CCRT 3CCMA 1I5LA 4L5GA 2X4WA 5KCHA 3A8MB 5J26A 4J6YA 5I2MA 5LJ3f 1KD1U 1KQSA 4BB7A 2M9UA 3KBGA 3HHTB 2GFUA 4M75F 4NL2A 2JN0A 3CCRA 2LX9A 4HKEA 5GMKm 1YIJT 4UC4A 2R5AA 4JLIA 2CYZB 2M16A 4QVDA 4M7DG 4LD9K 4MDWA 1YIJA 1M90U 5LJ5f 2PUKB 1Q81C 4M78D 3CPWS 2D6FA 1WJQA 3V7SA 5IAYA 5FU6C 3OYYA 2MAMA 3OS1A 3QO3A 1D3BA 2VXEA 3JB9I 3PTAA 3FRNA 5LJ3j 3L2ZA 5FU6B 4JRQA 2KSSA 3QZ5B 2RI2A 2XKOC 3CMAT 3A5ZB 1VQ4T 3FC3A 4N4GA 2P4TA 5GMKj 5GAN4 1WPYA 4C5GA 4A4FA 1UEBA 1X75C 4GY5A 4MMLA 3KUFA 4JRIA 1VQNT 2FHDA 1Y71A 3LGLA 3A8GB 1I81A 3PMTA 2JNGA 4N0AC 2KAFA 5FU7C 3FJPA 1VQNA 4C8QD 1G3TA 1YJNT 5FU7B 4M77A 4IUUA 3JB9J 4A4GA 4F7UF 1Y96A 3VKIA 5GAOp 3OBYA 3Q1JA 3H6ZA 4PJOE 1XNIA 2RJEA 1VQ9T 1YJNA 1M4ZA 1QVPA 3LYIA 3QHSA 4M75A 4A4KA 2L89A 3V7RA 1WJSA 5A2QE 1BI2A 4BD3A 4PKCC 3JB9F 2A7YA 1YI2T 1VQ9A 5DM7R 3JCMf 2YHTA 3QG1A 3LX7A 1WGSA 4LDYA 3I56T 2CZ6B 5A0GA 2XDDA 4M77G 3HSBA 4QVCA 2VGMA 3M57A 4XTXA 4EMGA 1N27A 4NL3A 1FXXA 1D3BB 3X20B 3OB9A 1LOJA 1XOVA 3E9GA 3CC4T 2XDPA 1JJ2A 5GAMd 1KQ2A 2G3RA 3HRUA 4M75G 3C4SA 3HPWA 4ZN1A 4E7KA 1KHCA 1GXIE 3M54A 3F70A 3CC4A 1WQ7A 2YRVA 2ZPGB 4M78F 3SD4A 1NJIC 4X9DA 2DTHA 2D0QB 2X4YA 4LDWA 2X4XA 3ZFJA 2IG0A 1KQSS 2MWPA 2P0QA 4XU3A 3L2VA 2Y4XA 4WF2A 3TREA 1B34B 3RKWA 1N8RC 4ZGEB 4M77C 1UGRB 2EQKA 2ZPFB 3BY7A 3GNGA 3RKYA 1QVFS 3A8LB 4XTYA 2E5QA 4M77B 3CCVA 3M59A 1Y96B 3V8LA 4C0DC 4F7UA 4BI3A 1VQ7A 4P5NA 2XG8D 3M56A 3OQ5A 4MZTA 4OP0A 2RO0A 1Q7YC 3C94A 4L6V5 4C0DB 3OYLA 5LJ3h 3RIRA 4XTZA 2DO3A 4II1A 3RMQA 5FLXE 1VIEA 1JRIA 3R6OA 4XU1A 1Q86U 3JAME 1WQWA 4C8QF 1U1TA 4QQ6A 5CR2A 1N9SA 3QUIA 4J8OA 4KT0E 5LJ3d 4EMKC 3CCJT 3OYEA 1VUBA 4JS4A 3UT1A 2FVUA 2R5MA 2XICA 4LDVA 1G5VA 2MF2A 3NFCA 4EMKB 3EFSA 1M1KC 4E47A 5LJ5h 3CCJA 4F7UG 3CBMA 5GAMf 3PT9A 1HK9A 2JOYA 3LWHA 3S3NA 1VQ5T 5L8RE 5GMKi 4J6WA 4HCBA 4M7AE 5I2SA 1W2BA 1VQ8T 2DKGA 1NE8A 3OY9A 1VQ5A 2K5FA 4C5IA 2L5QA 3DB4A 4C0GA 4OMFB 3CCST 1VQOT 3VYGA 2QQRA 2KDSA 4CRIA 3J81E 4QQGA 1VQPA 1VQ8A 2ZGWA 4BACA 5CKFA 2R58A 3VV0A 4E7LA 4HCCA 2E65A 1ZBXA 5CKEA 3CCSA 1VQOA 3CCUT 4HCZA 3JRZA 5FRMA 3PIPA 2JTFA 3DLMA 2QI2A 1G3SA 4E7JA 2EFIA 3E9FA 5CO7A 2HBPA 2LQ8A 2E41A 5CQYA 5CVIA 2LVMA 5A0LA 5GANg 5GAOm 3OYHA 3CCUA 4F7UB 4PJOC 4PJOD 3T9NA 4FT4A 1VIFA 4R55A 2WACA 3CCMT 4JRKA 3BDLA 4OB0B 2M0OA 5C0MA 2VYTA 1JBMA 5D6XA 4C92E 4N0AA 2DXUA 3HFNA 3FB9A 5GAOr 2KQWA 4TVRA 4FSXA 2XD0A 3HRSA 5EG2A 5FROA 2O01E 4C8QA 3L2RA 4KUDK 1BKBA 2JVVA 1O75A 2KVQG 2VUBA 1WNLA 2JUFA 3BDUA 4Y28E 1OZ3A 3G6ET 3JCMW 1TH7A 3P8DA 1VQ6T 1N6AA 3QZ9B 2QA4A 2D9TA 1I4K1 1BI0A 2PUOB 3PGGA 3G6EA 3EAEA 3JCMd 2ZPBB 5LJ3e 2VXFA 1VQ6A 2RK2A 3E19A 3HRTA 4M78C 2PVDB 4ZTJA 4ELYC 5GAN5 4DQ2A 1YJWA 4C8QG 2R57A 4M78B 4MDXA 3UPUA 3FIFA 2DIQA 5GAN3 4DOWA 3E1SA 2CGHA 1KHIA 1AHJB 4E7IA 2OTLT 1BYMA 3CCLT 1YITT 2DEQA 3CCQA 4KUIA 5D6WA 4XAXB 1UGSB 3M55A 1R8OB 2EQMA 4ELZC 5LJ5e 3MP8A 2FYKA 4NS5A 4OF1A 4A4EA 2DVEA 3OYDA 2OTLA 3CCLA 3RKXA 1YITA 4LDUA 2CZ7B 2EJ9A 1YCYA 1VQKT 5HK0A 4LDXA 3JSCA 3WXMB 2EJFA 1B34A 2QQAA 2RHIA 3OYFA 1JJ2S 4C8QC 1ZQ1A 4C0ZA 4CI0C 4A53A 1VQKA 3CXCA 3GPLA 3HKSA 2RJDA 2VGNA 1HXDA 2LQKA 4C8QB 3SDZA 2DJZA 4OGEA 4OGCA 1VQMT 1Q82U 3C95A 4PLIA 3CC7A 3NTKA 4PJOF 4IURA 2RB6A 2Y90A 3M58A 4EDUA 2HQXA 4L59A 3M9QA 1VQMA 3A8OB 5KE2A 1KC8C 1I8FA 3S6WA 4M7AC 4M7AD 3LLRA 2YLCA 4Y91A 4ZN3A 3QJ6A 1NPPA 3QKJA 5GAMh 2PVOB 4RMOA 1K73U 3J7AF 1KQ1A 4EMKA 2ZPHB 4OB3B 2P0PA 4OB1B 4B9WA 3RERA 2CZ0B 2V8JA 5DY9A 3OMGA 2VV5A 3VJPA 1XQHA 4IUPA 3X25B 1VQLA 3TU4K 5LJ3g 1K8AC 4N4HA 2O4XA 1RI0A 4RCCA 4X9CA 1K9MC 1M5Q1 3OS5A 3OA6A 2BIVA 4BY6C 4C92C 1IZ6A 4C92D 3JCMJ 1U8RA 1XTDA 5CQXA 1Q81U 5GANf 3JCMX 2AHJB 3DKMA 1QW1A 3V8KA 4J6XA 1W2BS 2XDBA 5M9OA 5LJ5g 1N9RA 2QTXA 4XQ3A 1PSFA 3FLGA 4FL6A 4JJNK 2Y4YA 5HY6A 2GQVA 2XI9A 4PJOA 1BIBA 1M8VA 2HD0A 1G3WA 2LCLA 3UDCA 3URGA 2K5IA 2KY9A 2C06A 2DXTA 5GMKh 1BI3A 4FT2A 5LL6S 3SB2A 5GAOq 1P92A 3P8HA 1KD1C 2OTJT 2GCXA 1QP2A 5DLQE 2WSEE 2E64A 1BIAA 2DAQA 4A54A 4A4HA 3PIOA 5HKCA 5GAOl 2MI6A 3L2WA 3SFMA 4Q5WA 4MMKA 2OTJA 1IREB 2RH2A 4M7AF 3H8ZA 4PJOG 1VQPT 3V7CA 3V8JA 4J7IA 4M7DE 3A8HB 1M90C 1OYXA 3QDRB 1VQ7T 2O4XB 4M78A 3JB9G 2A3LA 1DJ7B 1OI1A 1PSEA 3M4GA 2L3RA 5GAMe 3JCMV 3M53A 3C12A 3DB3A 2CKKA 3RMSA 5GMKl 1UGPB 3MO8A 5HK3A 2XHCA 3J80E 3GF5A 3RUXA 2EKOA 3L1AA 4RG8A 3LH0A 4NOYA 3WVDB 2RHZA 1QVGA 2GFAA 3CC2A 3ASKA 1H3ZA 3DLLA 3X24B 3OYGA 4BI8B 5CIUA 4M78G 4DOVA 4BDYA 4PJOB 4PL6A 3GOXA 4JDSA 4C92F 1NJIU 2RK1A 1BI1A 4PNOA 4XTVA 3P8BB 3HL8A 2ZZDA 1NZ9A 2OAUA 3HP9A 2V8KA 2DD4A 3INZA 3AHUA 2QA4T 3CEYA 4JS5A 5CK9A 4JUVA 5I21A 1N8RU 4PLLA 5J3BA 3VUBA 4ZGDB 3JCMh 1X01A 2RM4A 4XTWA 5AYFA 4QW2A 2LC4A 5KCOA 4O5VA 2H3JA 3BFMA 1MGQA 3G4SA 1YJWT 1S72A 4M7AA 2QXFA 4VUBA 3MEVA 2DZ9A 2LT1A 2PQWA 3OW2A 4IUVA 1Q7YU 4HT9A 3EFRA 3CBOA 3CXCS 3CD6T 4OVAA 4E7HA 1Y7XA 1K73C 4C5HA 3CCQT 3O8VA 2LT4A 4M77E 5GMKe 4RCBA 2QQSA 2ZPIB 3ER0A 3CD6A 1NPRA 3ZBDA 4XTUA 2RD1A 4BE2A 4Z02A 3OYKA 1FX7A 2RI5A 3OYAA 2BUDA 2B8AA 4M75E 4EPCA 4ZGJB 3BW1A 3N5BB 2QEXT 3CMEA 1M1KU 2LNVA 4EMHA 3SWNC 4M7AG 5GANh 2KMTA 2NLUA 2QEXA 5FRNA 3SWNB 4J5YA 2XU8A 3GIBA 5CKBA 5GAMg 2DD5A 3QBYA 2RHXA 1Y07A 3JCMP 1UGQB 3CC7T 3VU3C 4C92A 2BKDN 5GANd 1YJ9T 5CAIA 5GAN7 3MP6A 4QVZA 2RHYA 2CS7A 2WSFE 4ZTFA 3LWIA 4XK8E 4B9XA 2E6NA 3OMCA 4FU6A 3QPHA 1YJ9A 4ATOA 3KXTA 3OSVA 2DK3A 2LCCA 3X28B 3I55T 3TCJA 5CKHA 2MMPA 4JRPA 3G7ZA 3ME9A 4J83A 1YHQT 2QQBA 2F5TX 4MZPA 3UWNA 4ME7A 5CKDA 2X4JA 1Q86C 1KG1A 3CMAA 4M7AB 3I55A 4KBMB 1VQ4A 3MP1A 4M7DC 4M7DD 1EIFA 3HFOA 2DPPB 5LJ5j 1YHQA 2QDYB 2XK0A 4C92G 2EQJA 2E6ZA 3JCMb 1V29B 3S3OA 1ZHIA 2GF7A 4M7DB 3NTHA 1VQLT 2E10A 3OS0A 4C5EA 3CPWA 2E70A 4F7UE 2RJFA 2L8DA 3MEUA 4OB2B 2V8IA 3JCMe 2JTMA 4C0FA 4J7FA 1M1GA 3FEOA 2HAXA 1H641 3OBWA 3M5AA 3QIIA 1QP3A 4XU2A 1OZ2A 2EIFA 3MCAB 3MEAA 3OS2A 3OYBA 2EAYA 2FL7A 3RESA 4BY6B 2JZ2A 4C92B 2PU9B 5GANj 1LJOA 2F69A 1YI2A 2HNIA 3CCET 3PNWC 1SSFA 2DXCA 1YBYA 4V2SA 5KE3A 3QXEB 3I56A 3L2QA 3S3MA 3OYNA 2CZ1B 3L2UA 3CCEA 1JB0E 5IT9E 2I2LA 2LDMA 2ZPEB 5J39A 2RA2A 3GNFB 2P0KA 4M78E 3FDRA 5GANe 3OYMA 2YLBA 3X26B 2PVGB 2DIGA 4BE1A 3TEEA 3MHXA 4RKUE 4R56A 3MEWA 3OYCA 5GAN8 3JB9H 4IUQA 3L42A 2FB7A 4LD6A 4M77D 1QVGS 2X35A 1G3YA 3QYGB 2DTOA 2EWNA 2WSCE 3VYHB 3OYJA 5GAN6 4BDZA 4M75D 4M75C 4HT8A 4YTLA 5DLOA 3OSSC 4M7DF 1LNXA 2DTIA 2RHUA 4M75B 5IN1A 4JLGA 1KC8U 3QYHB 2M1HA 4C8QE 5GAOn 4BE0A 2E12A 3NTIA 3OYIA 2IVWA 4XU0A 3QJYA 5GAN2 3QSUA 2VC8A 3CBPA 3G71T 2LRQA 4MZMA 3CC2T 2ZCFB 3JCMg 3OW2S 3LGFA 3LW5E 4DA4A 2K2VA 4QQDA 3GP8A 3PFSA 4RG2A 1FWZA 3SWNA 3G71A 1QVFA 1U1SA 2MWOA 1RL2A 3CCVT 2DXBA 2LTOA 4N4IA 2F5KA 4O6JA 1K8AU 5LJ5d 4D6WA 5KH6A 1K9MU 3ZEHA 5A0DA 5D6YA 2K3YA 3JCMc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UDC A;  2P4T A;  2RK1 A;  1VIF A;  2VV5 A;  3T9N A;  2RK2 A;  2GQV A;  2OAU A;  3SFM A;  1VIE A;  2RH2 A; 
#chains in the Genus database with same CATH topology
 2F2W A;  4X34 A;  3G4S T;  4IUT A;  3CPF A;  5KYY B;  2D8J A;  1U06 A;  2I0N A;  4GLK A;  4IKF A;  1IHV A;  2MOX A;  2KI7 A;  2RJC A;  4QKU A;  1UB4 A;  1QKW A;  2PNI A;  3JB9 D;  1U3O A;  2K5L A;  2KR3 A;  3A8M B;  1FYN A;  4BB7 A;  4DBR A;  4HKE A;  2R5A A;  7AT1 B;  2CYZ B;  4FYV B;  1ZUK A;  3CME Q;  4LD9 K;  3CCR Q;  4J9H A;  4M78 D;  2D6F A;  3NMZ C;  3QO3 A;  3TVT A;  5LJ3 j;  5FU6 B;  3QZ5 B;  2RI2 A;  3FC3 A;  2P4T A;  5GAN 4;  1T3L A;  1WPY A;  2B86 A;  2KRO A;  4C5G A;  3KUF A;  2P84 A;  1Y71 A;  1I81 A;  3EHQ A;  1XJW B;  1WDX A;  2CUB A;  1W1F A;  3CMA Q;  4A4G A;  4F7U F;  5GAO p;  1FMV A;  1ABQ A;  1I5O B;  1VQ9 T;  2DJQ A;  4AT1 B;  1BI2 A;  1QWF A;  2KYM A;  1YI2 T;  1VQ9 A;  2YHT A;  1YJN Q;  1WGS A;  1QQJ A;  2K7A A;  2LJ3 A;  3HSB A;  4QVC A;  3X20 B;  1JJ2 A;  1LOJ A;  3E9G A;  1KQ2 A;  2XDP A;  3HRU A;  4ZN1 A;  2DX1 A;  1GXI E;  2FZG B;  4X9D A;  1Y0M A;  2D0Q B;  1SKU B;  2DTH A;  2RF0 A;  2X4Y A;  3ZFJ A;  3I56 Q;  2IG0 A;  3CC4 Q;  1QVF S;  1AWJ A;  3A8L B;  3M59 A;  4C0D C;  2NUZ A;  2XG8 D;  3M56 A;  3M0S A;  3OYL A;  4ESR A;  2CP5 A;  4II1 A;  1JRI A;  3R6O A;  1Q86 U;  4C8Q F;  5CR2 A;  2L3S A;  4J8O A;  4KT0 E;  5LJ3 d;  3OYE A;  4LDV A;  1G5V A;  4FW1 A;  3EFS A;  1M1K C;  5GAM f;  5IHI A;  4WCI A;  4J6W A;  4AFS C;  3OY9 A;  3CCJ Q;  2SRC A;  4OMF B;  1VQP A;  2F1L A;  4CRI A;  4BAC A;  2FRY A;  5FRM A;  1OX9 A;  4E7J A;  3E9F A;  2HBP A;  2LVM A;  5GAO m;  3OYH A;  4PJO C;  4J9G A;  2QTV A;  2XD0 A;  1PRL C;  2VYT A;  4C92 E;  1ZA2 B;  5GAO r;  3VS4 A;  4FSX A;  3CCU Q;  1OPL A;  2PTK A;  1PKS A;  1UJY A;  3P8D A;  5KYX A;  3CCM Q;  1VOM A;  2E3H A;  3EAE A;  2VXF A;  2NYS A;  4ZTJ A;  1YJW A;  4MDX A;  4M78 B;  3G6E Q;  1AHJ B;  2DET A;  1PHT A;  1UJ0 A;  4KUI A;  4E2F B;  4ELZ C;  2MYS A;  2P4R A;  4NS5 A;  4OF1 A;  8ATC B;  2DVE A;  2CZ7 B;  2KRN A;  2LJ0 A;  2EJF A;  2QK0 A;  3HTR A;  1H92 A;  2YUP A;  1ZQ1 A;  3CCL Q;  1YIT Q;  2YSQ A;  2DJZ A;  3CC7 A;  4PLI A;  4PJO F;  4IUR A;  1VQK Q;  1AZE A;  3A8O B;  4Y91 A;  2YLC A;  3OW2 P;  1YCS B;  2F2X A;  4EMK A;  5L23 A;  4PJM A;  2VB6 A;  2H8H A;  5KYU A;  2VV5 A;  1VQL A;  4RCC A;  1X6G A;  2AK5 A;  2DMO A;  4BY6 C;  1IZ6 A;  2A0F B;  1MNE A;  1UG1 A;  3JCM X;  1QW1 A;  1W2B S;  1GRI A;  4QT7 A;  1NM7 A;  1AD5 A;  4FL6 A;  2Y4Y A;  5HY6 A;  2CT3 A;  2HEQ A;  1G3W A;  2DVJ A;  2LCL A;  1ZUU A;  2C06 A;  2CRE A;  3SB2 A;  2DBM A;  1P92 A;  5DLQ E;  4A54 A;  5GAN j;  3PIO A;  5HKC A;  3SFM A;  4Q5W A;  4MMK A;  1M30 A;  1OU9 A;  3V8J A;  1M90 C;  1HYO A;  3UAT A;  1DJ7 B;  2DM1 A;  5GMK l;  2XHC A;  2KRM A;  1TSF A;  1G83 A;  3RUX A;  2EKO A;  4RG8 A;  3LH0 A;  1RI9 A;  4NOY A;  2AZV A;  2RHZ A;  1OU8 A;  2GFA A;  2JJ9 A;  4BI8 B;  4PL6 A;  4JDS A;  3P8B B;  2ZZD A;  1QWE A;  1VYT A;  3CEY A;  5J3B A;  2AKK A;  3CQT A;  2LC4 A;  1Y57 A;  4O5V A;  2ED1 A;  2QXF A;  3MEV A;  1A0N B;  3EFR A;  3CBO A;  3CXC S;  3CD6 T;  4IIO A;  2JS2 A;  1WHJ A;  3O8V A;  2LT4 A;  5GMK e;  4E7S A;  2W0Z A;  2QQS A;  2HQH A;  2ZPI B;  3CD6 A;  2COY A;  4XTU A;  2RD1 A;  4Z02 A;  2RI5 A;  2BUD A;  4ZGJ B;  2W10 A;  3N5B B;  1M1K U;  1KFZ A;  4EMH A;  3SWN C;  4F04 B;  2KMT A;  5FRN A;  2EQI A;  2XU8 A;  2J6O A;  5GAM g;  3QBY A;  2RHX A;  1UGQ B;  5GAN d;  5CAI A;  1RAF B;  4OMO A;  4QVZ A;  4CC3 A;  2RHY A;  3R6N A;  4ZTF A;  1OV3 A;  4F14 A;  3KXT A;  3OSV A;  2DK3 A;  2MMP A;  2JS0 A;  5CKD A;  3RR6 A;  2X4J A;  1VQ4 A;  3EFO B;  3MP1 A;  2HBW A;  1RAC B;  4M7D B;  5IXB A;  2GF7 A;  3NTH A;  3EG0 A;  2E10 A;  2AIR B;  4F7U E;  4OB2 B;  2QGG A;  2V8I A;  3GBQ A;  2JTM A;  3JCM e;  4RTU A;  2KBT A;  1G8X A;  1WXU A;  2RNA A;  4KGX B;  2JZ2 A;  3CCE T;  2HNI A;  1E6H A;  1SSF A;  2DXC A;  2XMF A;  3QXE B;  3CCE A;  3VS0 A;  5IT9 E;  4Z8A A;  2GTO A;  1RAD B;  2ZPE B;  3BE3 A;  3GNF B;  1AEY A;  2DIG A;  4B6M A;  1LPL A;  2YUQ A;  4M77 D;  2M0Y A;  3QYG B;  3VYH B;  4BDZ A;  1OX8 A;  4Z88 A;  3OSS C;  2J6K A;  4M75 B;  3QYH B;  4C8Q E;  2E12 A;  2HL5 C;  3QJY A;  1JEG A;  3I5S A;  1R0B G;  3G71 T;  2LRQ A;  3SHW A;  3PFS A;  1FWZ A;  3G71 A;  3VS1 A;  1QVF A;  1V76 A;  3I35 A;  2OX7 A;  4N4I A;  1X69 A;  2CSQ A;  2LNH B;  1KJW A;  3PVL A;  5A0D A;  3JCM c;  1AOJ A;  2K4Y A;  4BUG A;  5FW9 A;  1Q82 C;  3A98 A;  4RTY A;  1S72 T;  2DZC A;  4JJC A;  5CCA A;  1M9S A;  3CCV Q;  1W4S A;  1E7O A;  2EQU A;  2XID A;  2QQ9 A;  3MET A;  4KUL A;  5C6S A;  2RI3 A;  1MHN A;  3GLX A;  3G4S Q;  2EGA A;  2X4W A;  1OPK A;  5KCH A;  5J26 A;  5LJ3 f;  5I2M A;  2C0O A;  1RAB B;  4M4Z A;  5GMK m;  4HCK A;  4QVD A;  1Q82 R;  4MDW A;  1M90 U;  5LJ5 f;  4PK4 A;  2PUK B;  4J9C A;  2O9V A;  1WJQ A;  3KFV A;  5IAY A;  3OS1 A;  1D3B A;  3PTA A;  2YDL A;  3VRZ A;  2FZC B;  3A5Z B;  1ABO A;  3U23 A;  5GMK j;  2Z0W A;  2C0I A;  4A4F A;  1VQN T;  2ABL A;  2FHD A;  2JM9 A;  3LGL A;  3A8G B;  3JV3 A;  1AWW A;  5FU7 C;  1VQN A;  1VYU A;  1UUE A;  1KK7 A;  4M77 A;  3JB9 J;  2C0T A;  4PJJ A;  4PJO E;  2YT6 A;  3QHS A;  3M0Q A;  4A4K A;  5A2Q E;  3JB9 F;  2A7Y A;  3EGX B;  5DM7 R;  1K76 A;  2XDD A;  4M77 G;  1WHG A;  2VGM A;  4XTX A;  1N27 A;  1YP5 A;  4PJL A;  1VQ9 Q;  1D3B B;  3OB9 A;  3C4S A;  5HCK A;  1YI2 Q;  1T0H A;  1WQ7 A;  3SD4 A;  4M78 F;  2O88 A;  2HL3 A;  1NJI C;  3ULR B;  1WLP B;  2X4X A;  2QAZ A;  2P0Q A;  4XU3 A;  5FWC A;  5IXF A;  2COW A;  8AT1 B;  1UGR B;  2EQK A;  2YUO A;  2YWW A;  4AG2 C;  4XTY A;  1BCO A;  4M77 B;  4BI3 A;  4P5N A;  5KYW B;  4XTZ A;  2DL3 A;  2PZ1 A;  3JAM E;  1IRX A;  4RTZ A;  2MCN A;  1U1T A;  1AWO A;  1N9S A;  3RDV A;  3QUI A;  4EMK C;  2FVU A;  1NJI R;  1FMK A;  3S3N A;  1HK9 A;  1D1A A;  5I2S A;  1RLP C;  4J9F A;  2G6F X;  1R0C B;  1W2B A;  2DKG A;  1UFF A;  4C5I A;  2L5Q A;  1KQS S;  3CCS T;  1T0J A;  2KDS A;  2V1Q A;  2ZGW A;  3REA B;  4HCC A;  1ZBX A;  3CCS A;  1MMG A;  4HCZ A;  2JTF A;  4DBF A;  5CQY A;  4N0A A;  2DXU A;  4TVR A;  2K3B A;  4LN2 A;  2DL4 A;  4OMP A;  1O75 A;  2KVQ G;  1WNL A;  1WYX A;  1ZSZ B;  2JUF A;  3JCM W;  1VQ6 T;  1N6A A;  1OUL A;  1YWO A;  2QA4 A;  4KH1 B;  2D9T A;  3PGG A;  3JCM d;  1VQ6 A;  3HRT A;  1UHC A;  2EYX A;  2EGC A;  3M0P A;  4CC2 A;  3CCQ A;  4XAX B;  4F16 A;  1UGS B;  2KXC A;  3MP8 A;  4A4E A;  3OYD A;  1YCY A;  5HK0 A;  1X27 A;  1QVG P;  3JSC A;  2H3E B;  3WXM B;  2QQA A;  1IXD A;  4C8Q C;  1BK2 A;  2DRM A;  4CI0 C;  3CXC A;  2VGN A;  4OGE A;  1Q82 U;  1VQM T;  2CH4 W;  2Y90 A;  2HQX A;  5FWB A;  1VQM A;  5KE2 A;  4M7A D;  1I8F A;  3MPU B;  3QJ6 A;  3REB B;  1TUG B;  2DL5 A;  4RMO A;  3J7A F;  1KQ1 A;  3RBB B;  4OB1 B;  4B9W A;  2VWF A;  3QDF A;  4PJN A;  4PFO A;  1SF9 A;  1TUC A;  1UEC A;  5LJ3 g;  2BZX A;  1K9M C;  3JCM J;  5CQX A;  5GAN f;  3V8K A;  2XDB A;  5LJ5 g;  1PSF A;  3THK A;  4JJN K;  1OEB A;  1M3B A;  2E4H A;  3UDC A;  3URG A;  2K5I A;  4X1V A;  5GMK h;  1BI3 A;  4FT2 A;  1KD1 C;  2OTJ T;  4IIM A;  1JQQ A;  1CKA A;  1BIA A;  2MI6 A;  3O5Z A;  5GJV B;  4Z89 A;  1K9M R;  2OTJ A;  3CPW P;  1VQP T;  2QDL A;  4PFZ A;  3QDR B;  1SHG A;  1VQ7 T;  3JB9 G;  4M78 A;  3M4G A;  5GAM e;  3RMS A;  1VQ7 A;  5HK3 A;  2DIL A;  1OOT A;  6AT1 B;  1AVZ C;  1KD1 R;  3CC2 A;  3ASK A;  2NUT B;  3X24 B;  2FPD A;  5CIU A;  4M78 G;  2X51 A;  4J9B A;  3VS6 A;  1M1K R;  1NJI U;  2RK1 A;  2QYZ A;  3HL8 A;  2V8K A;  3INZ A;  3RNJ A;  4LUE A;  4JS5 A;  2RQR A;  3JCM h;  4AFU C;  4QW2 A;  2H3J A;  1MGQ A;  1YJW T;  1RUW A;  4M7A A;  2LT1 A;  2AKL A;  4IUV A;  4HT9 A;  2EPD A;  4E7H A;  5D7U A;  1K73 C;  4RCB A;  1WHH A;  3CME A;  1YNZ A;  2JXB A;  4M7A G;  3CD6 Q;  3QWY A;  2FPE A;  2NLU A;  4J5Y A;  2DNU A;  3GIB A;  5CKB A;  1C6V X;  1W70 A;  3CC7 T;  3VU3 C;  1YJ9 T;  3MP6 A;  2CS7 A;  3LWI A;  4Y92 A;  1QKX A;  4B9X A;  2E6N A;  3OMC A;  4KGZ B;  1YJ9 A;  1LCK A;  4ATO A;  1UTI A;  3I55 T;  3X28 B;  5CKH A;  1YHQ T;  4J83 A;  2F5T X;  2YRD A;  1KG1 A;  3CMA A;  4M7A B;  4J9D A;  3I55 A;  4M7D D;  1EIF A;  3HFO A;  1YHQ A;  1V29 B;  1VQL T;  1VQ4 Q;  2L8D A;  2GNC A;  2KXD A;  5I11 A;  1H64 1;  3M5A A;  2DYB A;  1K1Z A;  2V26 A;  3AT1 B;  2EAY A;  2FL7 A;  3RES A;  3LH5 A;  1LJO A;  2F69 A;  1JXM A;  3PNW C;  2RMO A;  3I56 A;  1JB0 E;  4JZ3 A;  3TSZ A;  2MK5 A;  3NGP A;  1GL5 A;  4M78 E;  4BE1 A;  2KNB B;  3CCE Q;  2FZK B;  4RKU E;  3MEW A;  3OYC A;  3JB9 H;  4IUQ A;  1R77 A;  2OAW A;  2DTO A;  4M75 D;  1TTH B;  1WX6 A;  4K11 A;  2DTI A;  1PWT A;  5IN1 A;  2D1X A;  5GAO n;  1BB9 A;  2LQN A;  2ECZ A;  2IVW A;  2J06 A;  5GAN 2;  1VYV A;  4OMM A;  3OW2 S;  4J9E A;  4WTO B;  1JJ2 P;  1U1S A;  2MWO A;  1M3C A;  2DXB A;  2F5K A;  1K9M U;  3ZEH A;  3G71 Q;  3EG2 A;  2K3Y A;  2E1H A;  4FIB A;  4HA8 A;  1O9S A;  2HQE A;  2KK4 A;  1M90 R;  1WJR A;  2LCS A;  1V1C A;  2K3X A;  5GAM j;  2F2V A;  3WVE B;  3EFO A;  3VUZ A;  4KGV B;  2KE9 A;  2EJG A;  2K57 A;  1NEG A;  3PMI A;  1M1F A;  4M7D A;  3FJ5 A;  1RAH B;  1GCP A;  1S72 Q;  4LE9 A;  4M77 F;  3CCM A;  2NUP A;  1KD1 U;  4J6Y A;  1KQS A;  2GFU A;  3EG9 B;  1M2V B;  1YIJ T;  4JLI A;  4FW2 A;  2M16 A;  4M7D G;  2CH4 A;  1YIJ A;  1WA7 A;  2RQT A;  1Q81 C;  1G2B A;  3V7S A;  5FU6 C;  3OYY A;  2MAM A;  2ZAE A;  3L2Z A;  2HCK A;  4JRQ A;  2KSS A;  3VS2 A;  2XKO C;  1VQ4 T;  4N4G A;  3NPF A;  4D8D A;  4HVW A;  2LQW A;  3PMT A;  2JNG A;  4N0A C;  2QG9 B;  2KAF A;  1UE9 A;  1MMA A;  1NYF A;  4IUU A;  1K0S A;  2NUP B;  1Y96 A;  1EX4 A;  3OBY A;  3Q1J A;  1JU5 C;  1SSH A;  3H6Z A;  3QWX X;  2RJE A;  4FYW B;  1Q81 R;  1VQN Q;  4M75 A;  4DEY A;  3V7R A;  1WJS A;  3JCM f;  3QG1 A;  4E6R A;  2CZ6 B;  3M57 A;  4NL3 A;  4EMG A;  1FXX A;  1XOV A;  5GAM d;  2G3R A;  4M75 G;  3HPW A;  4E7K A;  9ATC B;  1NLP C;  1KHC A;  2Y4X A;  4WF2 A;  1GBR A;  3TRE A;  3SEM A;  1B34 B;  3BY7 A;  1AT1 B;  1GFD A;  3CCV A;  1Y96 B;  3V8L A;  2FEI A;  2DEU A;  4MZT A;  4OP0 A;  2RO0 A;  3C94 A;  4C0D B;  2DO3 A;  2CP7 A;  3RMQ A;  5FLX E;  1WQW A;  2HSP A;  1VUB A;  2XIC A;  4LNP A;  2K9G A;  2EYZ A;  1VQ5 T;  2JOY A;  4HCB A;  1D1B A;  3UA6 A;  1VQ8 T;  2BZY A;  1M3A A;  1GCQ A;  1VQ5 A;  1VQO T;  3J81 E;  1VQ8 A;  1AZG B;  1ZLM A;  2CT4 A;  4KRT A;  2R58 A;  1ACM B;  3VV0 A;  2L2P A;  2O2O A;  1I1J A;  2MPX C;  5CKE A;  1VQO A;  1AWX A;  3JRZ A;  3PIP A;  1X2K A;  1G3S A;  2EFI A;  4HVU A;  5CVI A;  5A0L A;  3D7S B;  2VAS A;  4R55 A;  1TXQ A;  1VIF A;  3CCS Q;  4JRK A;  4OB0 B;  3HFN A;  3FB9 A;  2KQW A;  3HRS A;  3L2R A;  1BKB A;  1H3H A;  2JW4 A;  2JVV A;  3PVQ A;  3ZL7 C;  4Y28 E;  1OZ3 A;  2RPN A;  1TH7 A;  2LZ6 B;  1C1A A;  3EGX A;  2GTJ A;  2ZPB B;  5LJ3 e;  3E19 A;  4M78 C;  1JXO A;  4DQ2 A;  2QA4 Q;  4LXC A;  2R57 A;  3UPU A;  5GAN 3;  4JJB A;  3E1S A;  2CGH A;  1VQ6 Q;  2OTL T;  1IO6 A;  4A63 B;  2DEQ A;  5LJ5 e;  1R8O B;  2FYK A;  1MV3 A;  2OTL A;  4ZNX A;  1F1B B;  5I22 A;  1H8K A;  2JTE A;  4LDX A;  2DLP A;  2DL8 A;  2RHI A;  2L3P A;  3HKS A;  2RJD A;  1HXD A;  2LQK A;  2M51 A;  4OGC A;  1U5S A;  3C95 A;  3NTK A;  5KYW A;  4L59 A;  3M9Q A;  1SRL A;  4M7A C;  1KC8 C;  3EH2 A;  3LLR A;  3M0T A;  3PE0 A;  3QKJ A;  5GAM h;  2PVO B;  1Q95 G;  2J6F A;  4OMQ A;  1VQM Q;  4OB3 B;  3UF4 A;  2P0P A;  3RER A;  2HMA A;  3OMG A;  3MJX A;  3X25 B;  1UGV A;  1D09 B;  1K8A C;  4LUD A;  4J9I A;  3C0C A;  1RI0 A;  4X9C A;  3OS5 A;  1MV0 B;  2BIV A;  4C92 D;  1Q81 U;  1S1N A;  1XTD A;  1B3Q A;  2AHJ B;  3DKM A;  1KC8 R;  4J6X A;  2OI3 A;  1NG2 A;  1WHM A;  2QTX A;  4XQ3 A;  3FLG A;  3UA7 A;  2GQV A;  4JJD A;  1M8V A;  2YUN A;  3VS7 A;  4KH0 B;  2KY9 A;  5LL6 S;  1QCO A;  3P8H A;  1QP2 A;  1ZSZ A;  2E64 A;  2DAQ A;  2CP0 A;  3L2W A;  5GAO l;  1K8A R;  1IRE B;  4M7A F;  3H8Z A;  2A37 A;  1FMW A;  2IIM A;  2OTJ Q;  2A36 A;  1OI1 A;  1M2O A;  1PSE A;  2L3R A;  2KRS A;  1B07 A;  1RAI B;  2CP6 A;  2KYB A;  1TWB A;  2CKK A;  2O9S A;  3C12 A;  1UGP B;  3JCM V;  3J80 E;  3GF5 A;  1VQP Q;  2JM8 A;  3WVD B;  1VQ7 Q;  1H3Z A;  3DLL A;  2JMA A;  3OYG A;  4DOV A;  4BDY A;  3GOX A;  4F17 A;  4PNO A;  2K79 A;  3HP9 A;  2DA9 A;  2QA4 T;  5CK9 A;  4JUV A;  5I21 A;  4PLL A;  3VUB A;  1X01 A;  4XTW A;  1D0X A;  1Z9Z A;  4ANJ A;  1X2Q A;  1SHF A;  5KCO A;  2DYI A;  3G4S A;  3OW2 A;  2DZ9 A;  4OVA A;  1WZO A;  1Y7X A;  3EG1 A;  3CCQ T;  4M77 E;  3ER0 A;  3OYK A;  1FX7 A;  4EPC A;  2B8A A;  2QEX T;  1YJW Q;  1IGU A;  3BW1 A;  2LNV A;  5EC7 A;  2QEX A;  2KEA A;  1ZSG A;  3SWN B;  2ED0 A;  1QVF P;  1ZBJ A;  1Y07 A;  4C92 A;  2BKD N;  1PD0 A;  4XK8 E;  4FU6 A;  3QPH A;  1WI7 A;  4OMN A;  2LCC A;  3TCJ A;  1PM3 A;  3G7Z A;  3ME9 A;  4JRP A;  4MZP A;  3CC7 Q;  1KIK A;  4KBM B;  1YJ9 Q;  4M7D C;  2DPP B;  5LJ5 j;  2QDY B;  4C92 G;  2EQJ A;  2E6Z A;  3JCM b;  1TG0 A;  3S3O A;  1C0M A;  1ZHI A;  1SRM A;  1WXB A;  3OS0 A;  3I55 Q;  2E70 A;  2RJF A;  1YHQ Q;  2HDA A;  1M1G A;  3FEO A;  2BE9 B;  1QP3 A;  2CP2 A;  1OZ2 A;  2CP3 A;  3MCA B;  1VQL Q;  3OS2 A;  3OYB A;  4C92 B;  2DFU A;  2PU9 B;  1YI2 A;  1BBZ A;  2CSI A;  1YBY A;  4V2S A;  5KE3 A;  3L2Q A;  3S3M A;  2NUT A;  3OYN A;  2CZ1 B;  2OJ2 A;  1J3T A;  5J39 A;  2J7I A;  3FDR A;  5GAN e;  2PVG B;  1WFW A;  1WHK A;  3TEE A;  3MHX A;  1MUZ A;  5IH2 A;  4R56 A;  1VA7 A;  5GAN 8;  2YRC A;  4LD6 A;  2FB7 A;  4FYX B;  1QVG S;  1G3Y A;  1HD3 A;  2KT8 A;  4AG1 C;  1RAE B;  2KT1 A;  2FO0 A;  4M75 C;  4YTL A;  4M7D F;  1KC8 U;  2M1H A;  1TOV A;  4HVV A;  4FSS A;  4BE0 A;  2EBP A;  3OYI A;  2JMC A;  1NLO C;  4RTT A;  4MZM A;  3CC2 T;  1PRM C;  2GBQ A;  3LW5 E;  4DA4 A;  4RG2 A;  3VRY A;  1IB8 A;  1RL2 A;  3M0U A;  2LTO A;  4O6J A;  2L0A A;  5LJ5 d;  1K8A U;  2BZ8 A;  1LVK A;  1ZA1 B;  1BCM A;  3M4Y A;  1K9A A;  3JCM Q;  1X6O A;  4FM4 B;  2RQU A;  3TQ7 P;  2EYQ A;  4BI4 A;  1PD1 A;  3CME T;  1SG5 A;  3CCR T;  1TUD A;  1I5L A;  4L5G A;  1EZZ B;  2FPF A;  1I07 A;  4RTV A;  2M9U A;  3KBG A;  3HHT B;  4M75 F;  2BTT A;  4NL2 A;  2JN0 A;  3CCR A;  2LX9 A;  2QGF B;  4UC4 A;  1E6G A;  1GCQ C;  1W2B P;  1K0X A;  3CPW S;  4FCY A;  3JB9 I;  2VXE A;  3FRN A;  1YIJ Q;  1BU1 A;  3CMA T;  1K73 R;  1HSQ A;  1WXT A;  1UEB A;  1X75 C;  4GY5 A;  4MML A;  4JRI A;  3NHN A;  1YFN A;  3FJP A;  4FYY B;  1QCF A;  4C8Q D;  1G3T A;  1YJN T;  4EIK A;  5FU7 B;  1X6B A;  3VKI A;  1XNI A;  1YJN A;  1M4Z A;  1QVP A;  3LYI A;  2L89 A;  5KYX B;  4BD3 A;  4PKC C;  3LX7 A;  4LDY A;  4CC4 B;  3I56 T;  5A0G A;  1ZUY A;  3CC4 T;  2X3X D;  1QLY A;  3M54 A;  3F70 A;  3CC4 A;  2YRV A;  2ZPG B;  4LDW A;  2DBK A;  2MWP A;  1PC0 A;  3L2V A;  3I5R A;  3H9N A;  2A28 A;  3RKW A;  1N8R C;  4ZGE B;  4M77 C;  3VS5 A;  2ZPF B;  3GNG A;  2SEM A;  3RKY A;  2M02 A;  3CXC P;  2E5Q A;  1CKB A;  4F7U A;  1D1C A;  3EHR A;  4ORZ A;  3OQ5 A;  1Q7Y C;  4L6V 5;  5LJ3 h;  3RIR A;  1VIE A;  4XU1 A;  2V1R A;  2HKN A;  2ROL A;  4QQ6 A;  3CCJ T;  4JS4 A;  3UT1 A;  1HJD A;  2R5M A;  1ARK A;  3EG9 A;  2MF2 A;  1M2V A;  3NFC A;  4EMK B;  2AT1 B;  4E47 A;  5LJ5 h;  3CCJ A;  4F7U G;  3CBM A;  3PT9 A;  3LWH A;  4M7A E;  5L8R E;  5GMK i;  5KYU B;  1N8R R;  1NE8 A;  4RTW A;  4AFQ C;  2K5F A;  4C0G A;  3DB4 A;  3VYG A;  2QQR A;  4OML A;  1I0C A;  4QQG A;  5CKF A;  1Q7Y R;  1CSK A;  2GQI A;  4E7L A;  2E65 A;  1VQ5 Q;  3EG3 A;  3CCU T;  3DLM A;  2QI2 A;  1VQ8 Q;  2COZ A;  5CO7 A;  2LQ8 A;  2E41 A;  5GAN g;  3CCU A;  1JO8 A;  4F7U B;  4PJO D;  3T9N A;  1MND A;  4FT4 A;  1M8M A;  2WAC A;  3CCM T;  5C0M A;  3BDL A;  1VQO Q;  2M0O A;  3IQL A;  1UHF A;  4E7Z A;  5D6X A;  1JBM A;  2ESW A;  1IGQ A;  3TSW A;  2RQV A;  5FRO A;  5EG2 A;  2O01 E;  4C8Q A;  4KUD K;  1ZSZ C;  2JT4 A;  2VUB A;  3BDU A;  3G6E T;  3QZ9 B;  5GJW B;  1I4K 1;  1BI0 A;  2PUO B;  1TS9 A;  3G6E A;  1TU0 B;  2RK2 A;  2PVD B;  2D0N A;  3MKD A;  4ELY C;  5GAN 5;  3H0H A;  4C8Q G;  1OQK A;  3FIF A;  2DIQ A;  4DOW A;  5IHN A;  1KHI A;  4E7I A;  1BYM A;  3CCL T;  1YIT T;  5D6W A;  3M55 A;  2EQM A;  3CCL A;  3RKX A;  1YIT A;  4LDU A;  2EJ9 A;  2EW3 A;  1VQK T;  1B34 A;  4JZ4 A;  3OYF A;  1JJ2 S;  1GBQ A;  2OTL Q;  4C0Z A;  1VQK A;  4A53 A;  3A1P A;  3GPL A;  4C8Q B;  3SDZ A;  1RAG B;  4DBQ A;  1QCN A;  2RB6 A;  3M58 A;  4EDU A;  4HXJ A;  2RQW A;  3S6W A;  4ZN3 A;  3E2U A;  1NPP A;  1K73 U;  2CUD A;  2ZPH B;  2EYW A;  4JPB W;  2CZ0 B;  2V8J A;  3VS3 A;  5DY9 A;  1PNJ A;  2BE7 D;  2L3Q A;  1XQH A;  4IUP A;  1RAA B;  3VJP A;  3TU4 K;  4N4H A;  2O4X A;  2LJ1 A;  2EKH A;  1D0Y A;  1M5Q 1;  3OA6 A;  4D8K A;  1RLQ C;  4C92 C;  1U8R A;  3M0R A;  1NEB A;  5M9O A;  1N9R A;  5ECA A;  4GLM A;  4PJO A;  2DRK A;  2XI9 A;  1BIB A;  2HD0 A;  2DXT A;  5GAO q;  2GCX A;  2MIO A;  2WSE E;  4A4H A;  3G1J A;  1SPK A;  4RTX A;  2DF6 A;  2DE0 X;  2RH2 A;  4PJO G;  3V7C A;  4J7I A;  4M7D E;  3A8H B;  1OYX A;  2E3I A;  4RUG A;  2O4X B;  1NYG A;  2A3L A;  1X43 A;  2CDT A;  2DL7 A;  3M53 A;  4AFZ C;  3DB3 A;  3MO8 A;  2VKN A;  3L1A A;  1WHL A;  3H0F A;  1QVG A;  1SEM A;  2EGE A;  4PJO B;  4C92 F;  1BI1 A;  4CC7 A;  4XTV A;  1NZ9 A;  2OAU A;  2DD4 A;  3AHU A;  1MMN A;  1N8R U;  4ZGD B;  2RM4 A;  5AYF A;  2AZS A;  3BFM A;  1S72 A;  4VUB A;  5IHK A;  2KGT A;  2PQW A;  1Q7Y U;  2HSE B;  2E5K A;  4C5H A;  2HZY A;  2A08 A;  2LMJ A;  1NPR A;  3ZBD A;  4BE2 A;  1QMC A;  1EFN A;  3OYA A;  4M75 E;  2QAS A;  1D0Z A;  1PG5 B;  5GAN h;  4AMC A;  3CCQ Q;  2O31 A;  1GFC A;  1MMD A;  2DD5 A;  3JCM P;  5GAN 7;  2QEX Q;  2LX7 A;  2ROT A;  2WSF E;  1PCX A;  1KSW A;  1PKT A;  1IHW A;  2ENM A;  1B7T A;  3H0I A;  2QQB A;  3UWN A;  4ME7 A;  1Q86 C;  1YN8 A;  1T3S A;  2XK0 A;  2DER A;  2FRW A;  4C5E A;  3CPW A;  1WIE A;  3MEU A;  1KQS P;  4C0F A;  4J7F A;  5KYN A;  2X3W D;  2HAX A;  3OBW A;  2VVK A;  1UDL A;  3QII A;  4XU2 A;  4DBH A;  2EIF A;  3MEA A;  2IPO B;  4BY6 B;  2RN8 A;  2YXY A;  1Q86 R;  3I9Q A;  1M27 C;  3EGD A;  2FG0 A;  3L2U A;  1YWP A;  1N5Z A;  2GGR A;  2HKQ B;  3H41 A;  2ATC B;  2I2L A;  2LDM A;  2J05 A;  2RA2 A;  3OYM A;  2P0K A;  2YLB A;  3X26 B;  2X9H A;  5AT1 B;  1NBE B;  3EH1 A;  3L42 A;  1W6X A;  1K4U S;  2X35 A;  2K6D A;  2EWN A;  5KYY A;  2WSC E;  3OYJ A;  5GAN 6;  2EYY A;  1ZX6 A;  4HT8 A;  5DLO A;  1LNX A;  2RHU A;  4JLG A;  2K2M A;  3NTI A;  4XU0 A;  3EGU A;  3QSU A;  2VC8 A;  3CBP A;  2ZCF B;  3JCM g;  3LGF A;  1Z9Q A;  2K2V A;  4QQD A;  2D8H A;  4R0K A;  3GP8 A;  2LP5 A;  4PFP A;  3EGD B;  3SWN A;  3CCV T;  4D6W A;  4GBQ A;  5KH6 A;  2EVR A;  4DEX A;  3CC2 Q;  5D6Y A;  2NWM A; 
#chains in the Genus database with same CATH homology
 3M4Y A;  2E1H A;  4FIB A;  2K4Y A;  4HA8 A;  4X34 A;  4BUG A;  1Q82 C;  3JCM Q;  3G4S T;  1O9S A;  2HQE A;  2KK4 A;  1S72 T;  2DZC A;  1WJR A;  4IUT A;  3CPF A;  5CCA A;  1M9S A;  1X6O A;  1W4S A;  2K3X A;  5GAM j;  2EQU A;  2XID A;  3WVE B;  2QQ9 A;  4GLK A;  4FM4 B;  3VUZ A;  4IKF A;  2RJC A;  2EJG A;  2K57 A;  3MET A;  4KUL A;  5C6S A;  3PMI A;  1M1F A;  2RI3 A;  4M7D A;  1UB4 A;  1MHN A;  3GLX A;  2EYQ A;  4BI4 A;  3JB9 D;  2K5L A;  3CME T;  4M77 F;  3CCR T;  3CCM A;  1I5L A;  4L5G A;  2X4W A;  5KCH A;  3A8M B;  5J26 A;  4J6Y A;  5I2M A;  5LJ3 f;  1KD1 U;  1KQS A;  4BB7 A;  2M9U A;  3KBG A;  3HHT B;  2GFU A;  4M75 F;  4NL2 A;  2JN0 A;  3CCR A;  2LX9 A;  4HKE A;  5GMK m;  1YIJ T;  4UC4 A;  2R5A A;  4JLI A;  2CYZ B;  2M16 A;  4QVD A;  4M7D G;  4LD9 K;  4MDW A;  1YIJ A;  1M90 U;  5LJ5 f;  2PUK B;  1Q81 C;  4M78 D;  3CPW S;  2D6F A;  1WJQ A;  3V7S A;  5IAY A;  5FU6 C;  3OYY A;  2MAM A;  3OS1 A;  3QO3 A;  1D3B A;  2VXE A;  3JB9 I;  3PTA A;  3FRN A;  5LJ3 j;  3L2Z A;  5FU6 B;  4JRQ A;  2KSS A;  3QZ5 B;  2RI2 A;  2XKO C;  3CMA T;  3A5Z B;  1VQ4 T;  3FC3 A;  4N4G A;  2P4T A;  5GMK j;  5GAN 4;  1WPY A;  4C5G A;  4A4F A;  1UEB A;  1X75 C;  4GY5 A;  4MML A;  3KUF A;  4JRI A;  1VQN T;  2FHD A;  1Y71 A;  3LGL A;  3A8G B;  1I81 A;  3PMT A;  2JNG A;  4N0A C;  2KAF A;  5FU7 C;  3FJP A;  1VQN A;  4C8Q D;  1G3T A;  1YJN T;  5FU7 B;  4M77 A;  4IUU A;  3JB9 J;  4A4G A;  4F7U F;  1Y96 A;  3VKI A;  5GAO p;  3OBY A;  3Q1J A;  3H6Z A;  4PJO E;  1XNI A;  2RJE A;  1VQ9 T;  1YJN A;  1M4Z A;  1QVP A;  3LYI A;  3QHS A;  4M75 A;  4A4K A;  2L89 A;  3V7R A;  1WJS A;  5A2Q E;  1BI2 A;  4BD3 A;  4PKC C;  3JB9 F;  2A7Y A;  1YI2 T;  1VQ9 A;  5DM7 R;  3JCM f;  2YHT A;  3QG1 A;  3LX7 A;  1WGS A;  4LDY A;  3I56 T;  2CZ6 B;  5A0G A;  2XDD A;  4M77 G;  3HSB A;  4QVC A;  2VGM A;  3M57 A;  4XTX A;  4EMG A;  1N27 A;  4NL3 A;  1FXX A;  1D3B B;  3X20 B;  3OB9 A;  1LOJ A;  1XOV A;  3E9G A;  3CC4 T;  2XDP A;  1JJ2 A;  5GAM d;  1KQ2 A;  2G3R A;  3HRU A;  4M75 G;  3C4S A;  3HPW A;  4ZN1 A;  4E7K A;  1KHC A;  1GXI E;  3M54 A;  3F70 A;  3CC4 A;  1WQ7 A;  2YRV A;  2ZPG B;  4M78 F;  3SD4 A;  1NJI C;  4X9D A;  2DTH A;  2D0Q B;  2X4Y A;  4LDW A;  2X4X A;  3ZFJ A;  2IG0 A;  1KQS S;  2MWP A;  2P0Q A;  4XU3 A;  3L2V A;  2Y4X A;  4WF2 A;  3TRE A;  1B34 B;  3RKW A;  1N8R C;  4ZGE B;  4M77 C;  1UGR B;  2EQK A;  2ZPF B;  3BY7 A;  3GNG A;  3RKY A;  1QVF S;  3A8L B;  4XTY A;  2E5Q A;  4M77 B;  3CCV A;  3M59 A;  1Y96 B;  3V8L A;  4C0D C;  4F7U A;  4BI3 A;  1VQ7 A;  4P5N A;  2XG8 D;  3M56 A;  3OQ5 A;  4MZT A;  4OP0 A;  2RO0 A;  1Q7Y C;  3C94 A;  4L6V 5;  4C0D B;  3OYL A;  5LJ3 h;  3RIR A;  4XTZ A;  2DO3 A;  4II1 A;  3RMQ A;  5FLX E;  1VIE A;  1JRI A;  3R6O A;  4XU1 A;  1Q86 U;  3JAM E;  1WQW A;  4C8Q F;  1U1T A;  4QQ6 A;  5CR2 A;  1N9S A;  3QUI A;  4J8O A;  4KT0 E;  5LJ3 d;  4EMK C;  3CCJ T;  3OYE A;  1VUB A;  4JS4 A;  3UT1 A;  2FVU A;  2R5M A;  2XIC A;  4LDV A;  1G5V A;  2MF2 A;  3NFC A;  4EMK B;  3EFS A;  1M1K C;  4E47 A;  5LJ5 h;  3CCJ A;  4F7U G;  3CBM A;  5GAM f;  3PT9 A;  1HK9 A;  2JOY A;  3LWH A;  3S3N A;  1VQ5 T;  5L8R E;  5GMK i;  4J6W A;  4HCB A;  4M7A E;  5I2S A;  1W2B A;  1VQ8 T;  2DKG A;  1NE8 A;  3OY9 A;  1VQ5 A;  2K5F A;  4C5I A;  2L5Q A;  3DB4 A;  4C0G A;  4OMF B;  3CCS T;  1VQO T;  3VYG A;  2QQR A;  2KDS A;  4CRI A;  3J81 E;  4QQG A;  1VQP A;  1VQ8 A;  2ZGW A;  4BAC A;  5CKF A;  2R58 A;  3VV0 A;  4E7L A;  4HCC A;  2E65 A;  1ZBX A;  5CKE A;  3CCS A;  1VQO A;  3CCU T;  4HCZ A;  3JRZ A;  5FRM A;  3PIP A;  2JTF A;  3DLM A;  2QI2 A;  1G3S A;  4E7J A;  2EFI A;  3E9F A;  5CO7 A;  2HBP A;  2LQ8 A;  2E41 A;  5CQY A;  5CVI A;  2LVM A;  5A0L A;  5GAN g;  5GAO m;  3OYH A;  3CCU A;  4F7U B;  4PJO C;  4PJO D;  3T9N A;  4FT4 A;  1VIF A;  4R55 A;  2WAC A;  3CCM T;  4JRK A;  3BDL A;  4OB0 B;  2M0O A;  5C0M A;  2VYT A;  1JBM A;  5D6X A;  4C92 E;  4N0A A;  2DXU A;  3HFN A;  3FB9 A;  5GAO r;  2KQW A;  4TVR A;  4FSX A;  2XD0 A;  3HRS A;  5EG2 A;  5FRO A;  2O01 E;  4C8Q A;  3L2R A;  4KUD K;  1BKB A;  2JVV A;  1O75 A;  2KVQ G;  2VUB A;  1WNL A;  2JUF A;  3BDU A;  4Y28 E;  1OZ3 A;  3G6E T;  3JCM W;  1TH7 A;  3P8D A;  1VQ6 T;  1N6A A;  3QZ9 B;  2QA4 A;  2D9T A;  1I4K 1;  1BI0 A;  2PUO B;  3PGG A;  3G6E A;  3EAE A;  3JCM d;  2ZPB B;  5LJ3 e;  2VXF A;  1VQ6 A;  2RK2 A;  3E19 A;  3HRT A;  4M78 C;  2PVD B;  4ZTJ A;  4ELY C;  5GAN 5;  4DQ2 A;  1YJW A;  4C8Q G;  2R57 A;  4M78 B;  4MDX A;  3UPU A;  3FIF A;  2DIQ A;  5GAN 3;  4DOW A;  3E1S A;  2CGH A;  1KHI A;  1AHJ B;  4E7I A;  2OTL T;  1BYM A;  3CCL T;  1YIT T;  2DEQ A;  3CCQ A;  4KUI A;  5D6W A;  4XAX B;  1UGS B;  3M55 A;  1R8O B;  2EQM A;  4ELZ C;  5LJ5 e;  3MP8 A;  2FYK A;  4NS5 A;  4OF1 A;  4A4E A;  2DVE A;  3OYD A;  2OTL A;  3CCL A;  3RKX A;  1YIT A;  4LDU A;  2CZ7 B;  2EJ9 A;  1YCY A;  1VQK T;  5HK0 A;  4LDX A;  3JSC A;  3WXM B;  2EJF A;  1B34 A;  2QQA A;  2RHI A;  3OYF A;  1JJ2 S;  4C8Q C;  1ZQ1 A;  4C0Z A;  4CI0 C;  4A53 A;  1VQK A;  3CXC A;  3GPL A;  3HKS A;  2RJD A;  2VGN A;  1HXD A;  2LQK A;  4C8Q B;  3SDZ A;  2DJZ A;  4OGE A;  4OGC A;  1VQM T;  1Q82 U;  3C95 A;  4PLI A;  3CC7 A;  3NTK A;  4PJO F;  4IUR A;  2RB6 A;  2Y90 A;  3M58 A;  4EDU A;  2HQX A;  4L59 A;  3M9Q A;  1VQM A;  3A8O B;  5KE2 A;  1KC8 C;  1I8F A;  3S6W A;  4M7A C;  4M7A D;  3LLR A;  2YLC A;  4Y91 A;  4ZN3 A;  3QJ6 A;  1NPP A;  3QKJ A;  5GAM h;  2PVO B;  4RMO A;  1K73 U;  3J7A F;  1KQ1 A;  4EMK A;  2ZPH B;  4OB3 B;  2P0P A;  4OB1 B;  4B9W A;  3RER A;  2CZ0 B;  2V8J A;  5DY9 A;  3OMG A;  2VV5 A;  3VJP A;  1XQH A;  4IUP A;  3X25 B;  1VQL A;  3TU4 K;  5LJ3 g;  1K8A C;  4N4H A;  2O4X A;  1RI0 A;  4RCC A;  4X9C A;  1K9M C;  1M5Q 1;  3OS5 A;  3OA6 A;  2BIV A;  4BY6 C;  4C92 C;  1IZ6 A;  4C92 D;  3JCM J;  1U8R A;  1XTD A;  5CQX A;  1Q81 U;  5GAN f;  3JCM X;  2AHJ B;  3DKM A;  1QW1 A;  3V8K A;  4J6X A;  1W2B S;  2XDB A;  5M9O A;  5LJ5 g;  1N9R A;  2QTX A;  4XQ3 A;  1PSF A;  3FLG A;  4FL6 A;  4JJN K;  2Y4Y A;  5HY6 A;  2GQV A;  2XI9 A;  4PJO A;  1BIB A;  1M8V A;  2HD0 A;  1G3W A;  2LCL A;  3UDC A;  3URG A;  2K5I A;  2KY9 A;  2C06 A;  2DXT A;  5GMK h;  1BI3 A;  4FT2 A;  5LL6 S;  3SB2 A;  5GAO q;  1P92 A;  3P8H A;  1KD1 C;  2OTJ T;  2GCX A;  1QP2 A;  5DLQ E;  2WSE E;  2E64 A;  1BIA A;  2DAQ A;  4A54 A;  4A4H A;  3PIO A;  5HKC A;  5GAO l;  2MI6 A;  3L2W A;  3SFM A;  4Q5W A;  4MMK A;  2OTJ A;  1IRE B;  2RH2 A;  4M7A F;  3H8Z A;  4PJO G;  1VQP T;  3V7C A;  3V8J A;  4J7I A;  4M7D E;  3A8H B;  1M90 C;  1OYX A;  3QDR B;  1VQ7 T;  2O4X B;  4M78 A;  3JB9 G;  2A3L A;  1DJ7 B;  1OI1 A;  1PSE A;  3M4G A;  2L3R A;  5GAM e;  3JCM V;  3M53 A;  3C12 A;  3DB3 A;  2CKK A;  3RMS A;  5GMK l;  1UGP B;  3MO8 A;  5HK3 A;  2XHC A;  3J80 E;  3GF5 A;  3RUX A;  2EKO A;  3L1A A;  4RG8 A;  3LH0 A;  4NOY A;  3WVD B;  2RHZ A;  1QVG A;  2GFA A;  3CC2 A;  3ASK A;  1H3Z A;  3DLL A;  3X24 B;  3OYG A;  4BI8 B;  5CIU A;  4M78 G;  4DOV A;  4BDY A;  4PJO B;  4PL6 A;  3GOX A;  4JDS A;  4C92 F;  1NJI U;  2RK1 A;  1BI1 A;  4PNO A;  4XTV A;  3P8B B;  3HL8 A;  2ZZD A;  1NZ9 A;  2OAU A;  3HP9 A;  2V8K A;  2DD4 A;  3INZ A;  3AHU A;  2QA4 T;  3CEY A;  4JS5 A;  5CK9 A;  4JUV A;  5I21 A;  1N8R U;  4PLL A;  5J3B A;  3VUB A;  4ZGD B;  3JCM h;  1X01 A;  2RM4 A;  4XTW A;  5AYF A;  4QW2 A;  2LC4 A;  5KCO A;  4O5V A;  2H3J A;  3BFM A;  1MGQ A;  3G4S A;  1YJW T;  1S72 A;  4M7A A;  2QXF A;  4VUB A;  3MEV A;  2DZ9 A;  2LT1 A;  2PQW A;  3OW2 A;  4IUV A;  1Q7Y U;  4HT9 A;  3EFR A;  3CBO A;  3CXC S;  3CD6 T;  4OVA A;  4E7H A;  1Y7X A;  1K73 C;  4C5H A;  3CCQ T;  3O8V A;  2LT4 A;  4M77 E;  5GMK e;  4RCB A;  2QQS A;  2ZPI B;  3ER0 A;  3CD6 A;  1NPR A;  3ZBD A;  4XTU A;  2RD1 A;  4BE2 A;  4Z02 A;  3OYK A;  1FX7 A;  2RI5 A;  3OYA A;  2BUD A;  2B8A A;  4M75 E;  4EPC A;  4ZGJ B;  3BW1 A;  3N5B B;  2QEX T;  3CME A;  1M1K U;  2LNV A;  4EMH A;  3SWN C;  4M7A G;  5GAN h;  2KMT A;  2NLU A;  2QEX A;  5FRN A;  3SWN B;  4J5Y A;  2XU8 A;  3GIB A;  5CKB A;  5GAM g;  2DD5 A;  3QBY A;  2RHX A;  1Y07 A;  3JCM P;  1UGQ B;  3CC7 T;  3VU3 C;  4C92 A;  2BKD N;  5GAN d;  1YJ9 T;  5CAI A;  5GAN 7;  3MP6 A;  4QVZ A;  2RHY A;  2CS7 A;  2WSF E;  4ZTF A;  3LWI A;  4XK8 E;  4B9X A;  2E6N A;  3OMC A;  4FU6 A;  3QPH A;  1YJ9 A;  4ATO A;  3KXT A;  3OSV A;  2DK3 A;  2LCC A;  3X28 B;  3I55 T;  3TCJ A;  5CKH A;  2MMP A;  4JRP A;  3G7Z A;  3ME9 A;  4J83 A;  1YHQ T;  2QQB A;  2F5T X;  4MZP A;  3UWN A;  4ME7 A;  5CKD A;  2X4J A;  1Q86 C;  1KG1 A;  3CMA A;  4M7A B;  3I55 A;  4KBM B;  1VQ4 A;  3MP1 A;  4M7D C;  4M7D D;  1EIF A;  3HFO A;  2DPP B;  5LJ5 j;  1YHQ A;  2QDY B;  2XK0 A;  4C92 G;  2EQJ A;  2E6Z A;  3JCM b;  1V29 B;  3S3O A;  1ZHI A;  2GF7 A;  4M7D B;  3NTH A;  1VQL T;  2E10 A;  3OS0 A;  4C5E A;  3CPW A;  2E70 A;  4F7U E;  2RJF A;  2L8D A;  3MEU A;  4OB2 B;  2V8I A;  3JCM e;  2JTM A;  4C0F A;  4J7F A;  1M1G A;  3FEO A;  2HAX A;  1H64 1;  3OBW A;  3M5A A;  3QII A;  1QP3 A;  4XU2 A;  1OZ2 A;  2EIF A;  3MCA B;  3MEA A;  3OS2 A;  3OYB A;  2EAY A;  2FL7 A;  3RES A;  4BY6 B;  2JZ2 A;  4C92 B;  2PU9 B;  5GAN j;  1LJO A;  2F69 A;  1YI2 A;  2HNI A;  3CCE T;  3PNW C;  1SSF A;  2DXC A;  1YBY A;  4V2S A;  5KE3 A;  3QXE B;  3I56 A;  3L2Q A;  3S3M A;  3OYN A;  2CZ1 B;  3L2U A;  3CCE A;  1JB0 E;  5IT9 E;  2I2L A;  2LDM A;  2ZPE B;  5J39 A;  2RA2 A;  3GNF B;  2P0K A;  4M78 E;  3FDR A;  5GAN e;  3OYM A;  2YLB A;  3X26 B;  2PVG B;  2DIG A;  4BE1 A;  3TEE A;  3MHX A;  4RKU E;  4R56 A;  3MEW A;  3OYC A;  5GAN 8;  3JB9 H;  4IUQ A;  3L42 A;  2FB7 A;  4LD6 A;  4M77 D;  1QVG S;  2X35 A;  1G3Y A;  3QYG B;  2DTO A;  2EWN A;  2WSC E;  3VYH B;  3OYJ A;  5GAN 6;  4BDZ A;  4M75 D;  4M75 C;  4HT8 A;  4YTL A;  5DLO A;  3OSS C;  4M7D F;  1LNX A;  2DTI A;  2RHU A;  4M75 B;  5IN1 A;  4JLG A;  1KC8 U;  3QYH B;  2M1H A;  4C8Q E;  5GAO n;  4BE0 A;  2E12 A;  3NTI A;  3OYI A;  2IVW A;  4XU0 A;  3QJY A;  5GAN 2;  3QSU A;  2VC8 A;  3CBP A;  3G71 T;  2LRQ A;  4MZM A;  3CC2 T;  2ZCF B;  3JCM g;  3OW2 S;  3LGF A;  3LW5 E;  4DA4 A;  2K2V A;  4QQD A;  3GP8 A;  3PFS A;  4RG2 A;  1FWZ A;  3SWN A;  3G71 A;  1QVF A;  1U1S A;  2MWO A;  1RL2 A;  3CCV T;  2DXB A;  2LTO A;  4N4I A;  2F5K A;  4O6J A;  1K8A U;  5LJ5 d;  4D6W A;  5KH6 A;  1K9M U;  3ZEH A;  5A0D A;  5D6Y A;  2K3Y A;  3JCM c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...