1VIFA

Structure of dihydrofolate reductase
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
b'PSNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROFOLATE REDUCTASE
publication title A plasmid-encoded dihydrofolate reductase from trimethoprim-resistant bacteria has a novel D2-symmetric active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 12
structure length 60
sequence length 60
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 1996-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.60 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1vifA00
2RH2A 2GQVA 2OAUA 1VIEA 3T9NA 2P4TA 2RK2A 1VIFA 3SFMA 2VV5A 2RK1A 3UDCA
chains in the Genus database with same CATH superfamily
3ASKA 5LJ3f 1W6XA 3LW5E 3EH1A 3CEYA 1G5VA 1EFNA 4V2SA 4M78F 3CCST 1I07A 2E4HA 4IIMA 1Z9ZA 4JZ4A 2KBTA 1WHHA 2GTOA 3H0FA 4HVUA 4MDWA 1OX8A 3E2UA 3M4YA 2D0QB 1RAIB 4DOVA 4DA4A 3VKIA 3CCVT 2RN8A 4OMMA 2ZGWA 2CH4A 3TSZA 2XHCA 1VQ8A 1Q7YR 1UEBA 5GANg 4JRQA 4QVCA 4OB0B 2GNCA 1Y0MA 4FU6A 4AT1B 3VJPA 5GAN5 4FSSA 3OYJA 2QGFB 3CQTA 2XI9A 1M8MA 2DKGA 3EGDB 2RI3A 1RLPC 3CMAQ 1VQ7T 2DEUA 5GANd 3RKXA 1NPRA 2COZA 2CZ7B 2EJ9A 2M1HA 2JXBA 4BY6C 1B07A 2MPXC 5GAMj 1GRIA 3A5ZB 1OU8A 4AFZC 1NBEB 4RTWA 5KYXB 4F04B 2K3YA 3LGFA 2RJDA 3QIIA 1X6GA 3CCJA 2YLBA 1VQ6T 3L2RA 3MEVA 4C92A 5GAMg 4KUIA 3CCVA 2FHDA 1VQ5Q 4J7IA 3UATA 2OTJQ 5A2QE 1CKBA 3HRUA 2LCSA 2LQNA 4LDUA 3TVTA 1D1CA 1KC8U 3VS2A 2QAZA 3NPFA 2NUTA 1PC0A 4QVDA 3JCMW 2DRKA 2F5KA 3CXCS 1IHVA 1R77A 1X69A 4OVAA 2PQWA 2EBPA 3VUBA 4D6WA 1SG5A 2X3XD 1TS9A 2K5IA 3G4SQ 3CCUT 3M0QA 4N4HA 4NS5A 5M9OA 2E64A 4ZTJA 2X4YA 1K8AU 3RR6A 4EMHA 3HFNA 3CMEA 3GPLA 3FIFA 4RTTA 1LNXA 2YLCA 3MCAB 1KFZA 4BB7A 2EQUA 2O88A 4M7DC 4YTLA 2NUPA 5KCHA 1WZOA 3MEUA 3JCMh 1VQ4A 1YJWQ 4M77D 1ZA1B 3BE3A 4ESRA 3JB9H 2LNHB 4A4EA 2QK0A 3CD6A 1WDXA 1KC8C 3C95A 4M77F 3GNGA 5CKFA 1GCQA 3CC7T 3CC2Q 4J9FA 3SWNC 3EGDA 2YRDA 3CPFA 1VQPQ 2DAQA 2JMAA 5FU7C 1VQKT 1M4ZA 2VC8A 4R0KA 3MEWA 5GANf 2EAYA 4M7AB 3DKMA 2DFUA 1K8AC 2E3HA 2GGRA 4PJMA 3M0TA 3I9QA 3BDLA 2DL4A 2A28A 2RHYA 4E7IA 3HSBA 3NTKA 4MMLA 3E19A 3X28B 2LZ6B 4IUPA 1OEBA 1K1ZA 3QBYA 1ZHIA 3ULRB 2L8DA 1SRMA 4IUQA 4HCKA 3RKYA 4F7UG 3OYCA 4FSXA 1FXXA 4J9CA 2D8JA 3QO3A 1XOVA 1JB0E 3QKJA 3SEMA 3L2UA 1LCKA 4NL3A 3LWHA 2MI6A 1WQ7A 1RACB 2HQEA 2HBPA 2R5AA 4AMCA 2O01E 1Q82C 2ED1A 5GAMf 1VYTA 4XTYA 4C8QD 3QJYA 1DJ7B 2QG9B 3A98A 1YHQT 1MV3A 5CAIA 1QCNA 2ED0A 1AT1B 3S3OA 2WACA 2HBWA 3THKA 1WNLA 1ZSZB 4C8QF 1K9MC 3CXCA 1VQLA 2ZPEB 3LX7A 1ABQA 1VQMT 3PVLA 4J5YA 3OYAA 1KC8R 4BE1A 4XU3A 4QQ6A 5I21A 1PSEA 3CCET 3VYGA 1KIKA 3QWXX 1BI1A 2QI2A 1GCQC 1MNEA 3I55T 2F1LA 3V7RA 4HXJA 4CC2A 1M1GA 4C92F 3GF5A 4RCBA 1SF9A 1JJ2A 2LJ0A 4XU0A 2RQWA 1ZX6A 2RA2A 2DLPA 2F69A 3KBGA 1K8AR 1O75A 1JBMA 4JZ3A 1YHQA 5GAOp 2EJGA 3PIOA 1I5OB 4GLKA 4PJOG 5GAOm 2P0PA 3KUFA 3V7CA 4A54A 2LCLA 4XTXA 4HA8A 2X51A 3CCJQ 2FVUA 5GAOr 2VXEA 1W2BS 3S6WA 4M7AA 2CH4W 2B86A 4F16A 1UFFA 1OZ2A 4QQDA 3CCVQ 5J26A 1I1JA 3LH5A 3WVDB 2RK2A 4LE9A 1GFDA 2L3SA 5GAMe 3CCQA 1WXTA 2HL5C 1H3HA 1E6GA 1MMGA 3EG9B 1K0SA 3CBOA 4M75E 2AZSA 2A7YA 4EDUA 3CMAT 5I22A 1G3YA 5KYYB 1IO6A 3PE0A 3QWYA 2V8JA 2E6NA 2K5LA 4XQ3A 4OMQA 3P8HA 4ME7A 1NPPA 2HQXA 1QVFS 1WYXA 5GMKh 4O6JA 3M5AA 3CMEQ 1QKWA 4J9HA 2OJ2A 1M5Q1 3OB9A 4OGEA 1QVGS 1R0BG 4HCBA 1MV0B 1ZSZA 3I5SA 3LWIA 1C0MA 4MZTA 2X9HA 1QP3A 1Y71A 1VQ5T 3NGPA 3OW2S 4PL6A 1VQ4Q 3EAEA 2OTJT 2RHIA 4ZGEB 2RNAA 4Z88A 2MWOA 4QVZA 2PVGB 3FLGA 1UJ0A 3CD6Q 4HCCA 4A4KA 1WA7A 4QW2A 2YWWA 4KH0B 5GAOl 2D6FA 1KSWA 2BE7D 1R8OB 3OYLA 3E1SA 4OB3B 1U1TA 5D6XA 4LUEA 5LJ3j 4M7AC 3JAME 3G4ST 4BI3A 1S72A 4XU2A 1JJ2P 3JB9D 3NMZC 4ANJA 2CP2A 1PKTA 4FL6A 1PSFA 1VIEA 2YXYA 3JSCA 3OY9A 3HPWA 2KXCA 2EGEA 1V76A 2V8IA 1BI2A 2LJ3A 2KYBA 2LCCA 3JB9F 5DM7R 2PVDB 2KYMA 2V1RA 1Q86C 1YJWT 2DIGA 3R6NA 3PVQA 3L2QA 4RG2A 2YHTA 1FMVA 3LH0A 2CP0A 5J39A 4FYYB 4Z89A 3EG9A 1D0YA 2RHZA 4KBMB 2YUOA 4JJBA 1TUGB 4HVWA 2EW3A 1EZZB 3VS6A 2F2VA 1VQPT 5KYYA 3X26B 1PD0A 2CKKA 4E7ZA 1T0JA 1PHTA 2ZPFB 1FMWA 1ZSZC 3MP1A 1RI9A 3KFVA 1IZ6A 1RAAB 3GLXA 1YCYA 4FW2A 5DY9A 2K7AA 2OTLQ 3FC3A 1N8RR 4LDVA 1ZQ1A 2BZXA 4A4FA 1VQLQ 1IHWA 2SRCA 2MCNA 4E7JA 3SDZA 4F14A 1KG1A 2O9VA 4ELYC 4XU1A 2NLUA 2J6OA 4IURA 1IGQA 3NTHA 4IUTA 5LJ5g 2X4JA 2JJ9A 2DETA 2NYSA 1QVFA 3EHQA 2M9UA 3H0IA 4ORZA 5L8RE 1ZLMA 1VA7A 2VVKA 4D8DA 1QWEA 4ZN1A 3X20B 1GBQA 1QVGA 2ROLA 3IQLA 1YCSB 4ZTFA 2L0AA 1FMKA 1Y96B 4M78G 2A0FB 5LJ5d 2EYZA 4M7DE 3EHRA 3OW2A 1PKSA 2NWMA 1G2BA 1JXOA 1M2VB 2FPFA 2A08A 1QWFA 1KQSS 3OYKA 2EPDA 1SPKA 1U1SA 2DF6A 1OU9A 3JCMJ 1OYXA 1TXQA 3SB2A 2MOXA 2XD0A 1WJSA 2Y4XA 3CCQQ 2D9TA 2QQBA 5ECAA 2DO3A 3SFMA 4F7UB 2DXUA 5KYWB 3WXMB 4EIKA 1YBYA 4RTVA 1IB8A 4LN2A 4EMGA 4M78D 5CKHA 3ME9A 4N0AC 5CKBA 2IPOB 1W4SA 2VYTA 5KYNA 3PTAA 1UHCA 2PUOB 5A0GA 2E5KA 4J7FA 2DXCA 3G6EA 1X27A 1QVPA 1QKXA 4WCIA 2DIQA 5FW9A 1TOVA 3FJPA 2DVEA 1KHCA 1ARKA 1U5SA 4JJDA 3CCJT 3S3NA 5GANj 3I56A 3P8BB 1S1NA 1UHFA 2JTEA 4PLLA 1G3SA 2R58A 2BE9B 4JS4A 2DA9A 1M30A 2FB7A 5CKDA 1IRXA 1NZ9A 3QHSA 2YDLA 2EGAA 4M75D 5GMKl 3I35A 3AT1B 4M7DA 2VASA 2JS2A 2C0TA 2KRSA 3M59A 2VXFA 2O4XB 3RKWA 3L1AA 1RABB 3LGLA 4KH1B 4M75F 2DYBA 1M9SA 4KUDK 2RPNA 3QSUA 4X1VA 1X6BA 4DBFA 4VUBA 4PJOB 3H0HA 3GBQA 1WLPB 1ZUKA 1S72Q 4B9WA 1AZGB 1BIBA 1QLYA 3V8LA 1FYNA 3SWNA 3HL8A 1GFCA 4LD6A 3GP8A 4ZNXA 3SHWA 5LJ5f 1MUZA 2K6DA 4QKUA 1WHJA 2LQ8A 3CMET 3EFSA 2QYZA 5LJ3e 2K79A 2GTJA 3OYEA 1BYMA 2A37A 1PCXA 4PJJA 3QYHB 1BI0A 1VQ4T 3BY7A 4M77G 1KQSA 2RQTA 4J9EA 3CCMT 2JNGA 4X34A 4DQ2A 2XMFA 3H8ZA 4F7UA 3CD6T 2K5FA 1J3TA 2DXTA 1AWJA 3T9NA 3JB9I 4GBQA 2HL3A 4NL2A 2KK4A 1PG5B 2IVWA 2NUZA 1VQOA 2CZ6B 3G1JA 2W0ZA 3CPWS 4P5NA 3JCMg 3F70A 3QDFA 3OS2A 2P84A 3UF4A 3A1PA 2ECZA 1WX6A 2LJ1A 4J6YA 2YSQA 2EIFA 3NFCA 2QQAA 5GAN2 2E65A 2PU9B 4BE0A 1Y7XA 1YP5A 4OP0A 4FT4A 4EMKB 3FRNA 3MEAA 4JLGA 2K57A 4Y91A 1AHJB 4JRIA 3JCMd 1OQKA 2JZ2A 2O2OA 3X24B 3QYGB 2P4RA 4DEXA 2V8KA 3VV0A 4FCYA 3CCMA 4JDSA 2ZPHB 2MK5A 5KH6A 2X4WA 1XNIA 5HK3A 1M1KU 1ZA2B 4OGCA 3GNFB 3HHTB 1XTDA 1BIAA 3GIBA 3QG1A 3SD4A 3ZFJA 5GJVB 1G83A 2RD1A 1VYUA 5IXFA 3LLRA 4C8QG 2E12A 1UDLA 5KYXA 5GAOn 2OTLT 4PFZA 3L42A 2CP6A 2JM9A 2HMAA 2FRWA 4MZMA 1VQLT 4XTZA 1NYFA 4TVRA 2JMCA 4M7AE 3LYIA 4IUVA 2MAMA 4C92G 3M55A 4J9BA 1YIJA 2MIOA 2O9SA 2QQSA 4K11A 3QZ5B 3J7AF 4ELZC 2RB6A 2E6ZA 2KQWA 2W10A 2HEQA 4AFUC 1RAGB 1OX9A 1M1KC 1TUDA 3OSSC 2KGTA 4J9DA 4M7DD 2E10A 1VOMA 3QPHA 2QXFA 3MO8A 2I2LA 4BD3A 3G6EQ 4DEYA 4JUVA 4M7DF 3PGGA 2OTLA 3UA6A 2JOYA 3VS1A 2PNIA 1BCOA 3I56Q 4AG1C 4J8OA 4QT7A 2K4YA 4C92D 4RTZA 4QQGA 4EMKA 4LUDA 3CCQT 3CPWA 3QJ6A 2XKOC 4A4HA 1FX7A 2YUNA 5GANe 2ESWA 4HCZA 1B7TA 2QEXA 3Q1JA 3JCMf 5I2MA 4BE2A 2J05A 5FLXE 1VQ9Q 2LX9A 2H3EB 4GLMA 4PJOC 4M78B 3HRSA 1M3AA 2E41A 2LQKA 2VGMA 4DBQA 2VKNA 1OI1A 3OYGA 2P0KA 2LDMA 2DD5A 3QXEB 3EFOB 2PZ1A 3FDRA 1TH7A 1AD5A 1K73U 5J3BA 2JN0A 3C4SA 2YT6A 1LPLA 4JJNK 9ATCB 2AT1B 2QA4A 1N8RU 5GMKj 2BZ8A 4KGZB 1JRIA 3E9GA 1M1KR 1AWOA 4Y28E 7AT1B 2QGGA 2F5TX 5IT9E 4PLIA 5EG2A 5GJWB 2EYWA 4CC7A 5FWBA 4JRPA 2DD4A 3UPUA 2LT1A 3J80E 1NJIU 4JRKA 2LRQA 1VQOQ 1G3TA 1OULA 2GFAA 2A36A 5IHIA 2DVJA 1S72T 1C6VX 1UGSB 3OQ5A 4EMKC 1U3OA 2LC4A 3JB9G 1T0HA 1BI3A 2FG0A 2JS0A 2ZPIB 1PRLC 2HNIA 1K0XA 3VU3C 2KVQG 2ATCB 1RLQC 3JB9J 1YJNQ 2YRCA 1WJRA 1X43A 2KY9A 2FZKB 2JUFA 2FZGB 5DLQE 4BI8B 5CR2A 5C0MA 2OI3A 1N8RC 3CXCP 1YJ9A 2X35A 2DBMA 1AVZC 3CCMQ 3V8KA 1N9RA 1UTIA 3BW1A 5FWCA 2KSSA 1AWWA 1QP2A 2GQIA 3RESA 5GAOq 1JO8A 3MP8A 1H8KA 1T3SA 4JJCA 4NOYA 1M1FA 4XTUA 1YWOA 1QCOA 1RAEB 1OZ3A 1RUWA 1BKBA 1SSHA 2KI7A 1BCMA 3ZL7C 2GBQA 5KYUB 3UDCA 4PFPA 3A8GB 4E6RA 2RJFA 3DLLA 1PWTA 1VYVA 3RMQA 1NG2A 4A63B 3D7SB 3VS7A 1B34B 1A0NB 2QQ9A 4L5GA 4C5IA 2PVOB 2XDPA 2CT4A 2KRNA 3CCLA 3UA7A 1WFWA 1H3ZA 4M77B 2M16A 1YIJQ 2JM8A 2KNBB 3JCMX 3ER0A 1GCPA 1W2BA 3M9QA 3HTRA 2HKQB 3BDUA 4XAXB 4KGVB 2EVRA 3C12A 4JS5A 2RF0A 1K73R 3S3MA 5CCAA 5IAYA 1WXBA 2JTMA 5LJ3h 5IXBA 1I81A 3OYHA 2ENMA 4MZPA 4N0AA 1K4US 2HDAA 2E70A 5LL6S 1HXDA 1ABOA 2ZPGB 3JCMV 1NLOC 3A8LB 1WIEA 4J6XA 3URGA 3ZEHA 5LJ5j 1GBRA 4D8KA 5CQYA 1HD3A 3HP9A 2EQJA 4WF2A 3EFRA 2DRMA 5IHKA 2H3JA 3CCRQ 4M7AD 2XDBA 2P0QA 5A0DA 2HSPA 2OAUA 2XDDA 2E5QA 4X9DA 3HFOA 2E3IA 1IXDA 2Y90A 2X4XA 2EQKA 4M7AF 4M78C 2QEXQ 1WI7A 1NJIR 2XIDA 2KR3A 5GAN4 3G71A 1X6OA 1WHKA 2LP5A 2EQIA 2DL7A 2J6KA 2M0OA 3OYMA 3TSWA 5IHNA 3OYFA 1WGSA 3G6ET 4X9CA 2DXBA 4N4IA 1YI2A 5DLOA 4C8QB 3A8OB 5KYUA 2LNVA 3H41A 2DJZA 4LNPA 3ZBDA 2DYIA 2L89A 3I56T 2CT3A 3HKSA 1V29B 3RIRA 1OPKA 2EKHA 2J7IA 1UGPB 4CC3A 2QA4Q 1NYGA 3OS1A 1LJOA 3M56A 4C92B 1MMDA 2M02A 5GMKi 1H641 1KJWA 1WXUA 2C0IA 2K9GA 4PNOA 5GAN6 3VRZA 2EGCA 2OX7A 4M77A 5IN1A 1RL2A 1N9SA 2CSQA 4M75G 1VQ9T 2R57A 4F7UE 2HAXA 5GMKe 4OB1B 2JVVA 2EYXA 3JCMc 2L3QA 1VQNA 2NUTB 1M3CA 2XG8D 2DERA 4Q5WA 1W2BP 3VYHB 1BBZA 3OYDA 1R0CB 2MF2A 2RH2A 5GAN8 1YITA 1ZBXA 2D1XA 2V26A 1O9SA 2COYA 4FYWB 2RHXA 2AIRB 4RUGA 2RJEA 3J81E 4PFOA 4BUGA 4MMKA 5KE3A 2FPEA 3TEEA 2CS7A 1ZUYA 4C0DB 1PM3A 2GCXA 1YFNA 3EG1A 2DILA 3KXTA 4J9IA 4BDYA 2COWA 1YJ9Q 2XK0A 3EGUA 2LTOA 4RG8A 5KCOA 4E7HA 2FZCB 4MDXA 1EIFA 3MJXA 1VQ9A 2NUPB 2IG0A 2CZ0B 4M4ZA 2RMOA 4A53A 1QVFP 1Y96A 3OYNA 2E1HA 1ZSGA 1VQOT 3OMGA 1QVGP 3V8JA 4C0ZA 2DK3A 1UB4A 1WHGA 3M0PA 5FRMA 1D09B 1M2VA 1ACMB 1WJQA 4UC4A 4C5GA 4C8QA 2FO0A 5GANh 3OW2P 3JCMQ 1UJYA 4PJOE 4R56A 2K3BA 2ZZDA 2JW4A 1YJNT 3CCSA 5I11A 1M90U 4M77C 2CGHA 1KQ1A 3OA6A 3VS5A 3VRYA 1MMAA 4DBRA 3OYBA 2CSIA 4RTXA 4RTYA 2RK1A 4Y92A 2ZCFB 1TG0A 1RADB 3CCLQ 2KAFA 1U06A 1UECA 2A3LA 4O5VA 2DX1A 2MYSA 5KYWA 3NTIA 4II1A 4E7SA 1NLPC 2FRYA 2L3PA 2R5MA 1UG1A 1OPLA 4BACA 4OF1A 2VWFA 1I0CA 4XTWA 2WSEE 5GAMd 3EGXB 1KD1U 2HQHA 2AK5A 5GAMh 2PTKA 3CC4Q 4GY5A 1D0XA 2EFIA 1VQ7A 2DM1A 2FL7A 1Q81U 4KRTA 1QQJA 2DL3A 3VS4A 2D0NA 1YJNA 5FROA 2YUPA 1D1BA 1Z9QA 1ZUUA 2V1QA 1ZBJA 2G6FX 3O5ZA 1X01A 4Z02A 3FEOA 1H92A 1E7OA 1M90C 1VQ6A 2XICA 1E6HA 2RO0A 1I5LA 3REBB 3UWNA 4OB2B 2BZYA 2KROA 3E9FA 2HSEB 5CIUA 1JJ2S 4ZGJB 5LJ5e 3EH2A 1MNDA 1YIJT 1JXMA 1M2OA 2CYZB 5D6YA 3G71Q 3OMCA 4C8QC 2EWNA 2O4XA 1SHFA 2DZCA 3RNJA 2QQRA 1G8XA 1KHIA 2F2XA 4M7DG 2DL5A 4CI0C 1RAHB 4DBHA 1UGRB 1YI2Q 3DLMA 1KD1C 4PJOA 5KE2A 1JEGA 2J06A 1Q82U 2F2WA 1IGUA 3M53A 4PK4A 1Q81C 3A8HB 3L2ZA 4C92C 5GAN3 3CCUA 3HRTA 3M4GA 4HT8A 1SKUB 1TWBA 2DL8A 1XQHA 2RM4A 3CCRT 4OMLA 2Y4YA 2WSCE 2RJCA 4PKCC 1K9MU 3MHXA 4IKFA 2J6FA 2O31A 8AT1B 3VS3A 3M0RA 4LXCA 2MMPA 4LD9K 2QEXT 2DEQA 3M57A 2HCKA 1P92A 2CUBA 1FWZA 1D1AA 4FIBA 1TSFA 2HD0A 3QDRB 1KQSP 3TU4K 1VQNQ 1W1FA 2G3RA 3EG3A 3PNWC 2CREA 4BDZA 3FB9A 4C0FA 3RMSA 1K9AA 3DB4A 2RQUA 3CC7A 2RI5A 3EGXA 2LMJA 4RKUE 1M90R 2FEIA 2FPDA 2JTFA 1YITQ 4R55A 1V1CA 3RDVA 4E47A 4C0DC 1VQKA 3PFSA 1BB9A 2CP5A 2VB6A 2QASA 3CCRA 2DJQA 3TREA 3M58A 2GQVA 1K76A 4B9XA 3QZ9B 2QA4T 2L5QA 1AZEA 2QDYB 3V7SA 3OBYA 3P8DA 6AT1B 2RHUA 3OSVA 2CDTA 3R6OA 2JT4A 3MP6A 4RCCA 3RBBB 2K3XA 3INZA 4C5EA 2K2VA 4CC4B 2CZ1B 2QDLA 3G7ZA 1KD1R 4L59A 1VQ8Q 2DMOA 1N6AA 4FYVB 2L3RA 4OMOA 1KQ2A 2GFUA 2DTOA 3META 2MWPA 1Q81R 2X3WD 1VIFA 5FU6B 1TTHB 4N4GA 1EX4A 4JPBW 1HSQA 4L6V5 4F7UF 1U8RA 4JLIA 2VV5A 1I8FA 4M78E 3AHUA 1M8VA 2AKKA 2CP7A 4F17A 3A8MB 4E7LA 5HKCA 5C6SA 3PMIA 1F1BB 2H8HA 2EYYA 4LDWA 3QUIA 2DNUA 1SRLA 5I2SA 2KRMA 3CCSQ 2EJFA 4XK8E 1D0ZA 4ATOA 4C0GA 2KDSA 1NM7A 1WHMA 1YJ9T 3OBWA 1X2KA 1CKAA 1VQMA 1SSFA 2OAWA 1X75C 3C0CA 3CCEA 4M75B 1UUEA 1TUCA 2KT8A 4KULA 5AYFA 5CVIA 1I4K1 4C5HA 2XU8A 3I55A 3L2VA 2SEMA 1Q82R 4ZN3A 3M0UA 2HKNA 5A0LA 3JV3A 4OMFB 1M27C 1HYOA 3M54A 2LQWA 1AWXA 2DE0X 2AKLA 1VQ7Q 1LOJA 2PUKB 3JCMe 1K73C 1OOTA 2D8HA 1UGQB 4PJLA 3C94A 1QW1A 5D7UA 4PJOD 1K9MR 2EQMA 4OMNA 4RTUA 2L2PA 2IIMA 3CBPA 3CBMA 2BTTA 4HVVA 2YRVA 1VQ6Q 1C1AA 4PJOF 1QCFA 3CCLT 3OS5A 3TQ7P 2DPPB 2DTIA 4FW1A 1WQWA 1LVKA 2KXDA 1UE9A 1MGQA 1X2QA 2BIVA 1AEYA 1Q86U 3TCJA 1UGVA 5GAN7 2B8AA 3CPWP 2KMTA 1OV3A 2EYQA 5HK0A 4PJNA 4FM4B 4M78A 3H9NA 2BKDN 1NJIC 2LVMA 3VUZA 4LDYA 3OYIA 2BUDA 3PIPA 3U23A 3CC4T 4AFQC 1BK2A 2VUBA 1Y07A 4AFSC 1D3BB 3CMAA 4WTOB 3RERA 1GXIE 3EFOA 2RI2A 4DOWA 4HT9A 2WSFE 3FJ5A 4E7KA 4J83A 1PNJA 2KEAA 5CK9A 1NE8A 1XJWB 1RI0A 3I5RA 1QMCA 3CCUQ 3O8VA 4J9GA 4E2FB 1HK9A 1JQQA 2HZYA 1JU5C 4HKEA 4M7AG 2K2MA 4BY6B 5LJ3g 5EC7A 2DZ9A 3H6ZA 2ROTA 2ZAEA 4ZGDB 1VQ5A 2LX7A 3EG0A 2Z0WA 1WPYA 2KE9A 1HJDA 2OTJA 4IIOA 2LT4A 3OYYA 4M75A 5FRNA 3G71T 4M77E 2RQVA 2CUDA 1Y57A 3JCMb 2P4TA 1TU0B 5LJ3d 2M51A 3PMTA 5D6WA 1GL5A 1RAFB 4IUUA 1Q7YU 4EPCA 3CC4A 3WVEB 4FYXB 4RMOA 2C06A 3MPUB 4B6MA 1YI2T 4BI4A 4KT0E 3CC7Q 5L23A 1SEMA 1AOJA 1NEBA 3CC2T 3VS0A 8ATCB 2DBKA 1MMNA 3G4SA 2VGNA 2FYKA 1VQKQ 1B3QA 1YWPA 2AHJB 2KT1A 2GF7A 1T3LA 5HY6A 4J6WA 5IH2A 3UT1A 2ABLA 2EKOA 2ZPBB 3RUXA 5HCKA 1YN8A 4KGXB 5FU6C 1YJWA 5CO7A 1IREB 3JRZA 3REAB 1CSKA 2AZVA 1VQNT 2CP3A 4M7DB 1N5ZA 5CQXA 3L2WA 2QTXA 1Q7YC 4LDXA 3MKDA 3CC2A 1PD1A 1YITT 1D3BA 5GMKm 1VQPA 5LJ5h 1N27A 3PT9A 3N5BB 4OMPA 4C8QE 1B34A 3EG2A 1YHQQ 2DTHA 5CKEA 3SWNB 1MHNA 3X25B 1Q86R 2QTVA 2RQRA 3JCMP 4FT2A 5FU7B 3DB3A 1YNZA 4M75C 1PRMC 3NHNA 3GOXA 4AG2C 1VQMQ 3OS0A 3M0SA 1VUBA 4XTVA 4C92E 4Z8AA 2M0YA 4CRIA 4A4GA 3CCEQ 1NEGA 1M3BA 1VQ8T 2C0OA 1Q95G 1KK7A 3I55Q 3BFMA 1SHGA 1W70A 1G3WA 2I0NA 5AT1B 1WHLA 1BU1A 2YUQA
chains in the Genus database with same CATH topology
2P0KA 4ZGJB 5LJ5e 2LDMA 3ASKA 5LJ3f 2DIGA 2DD5A 1YIJT 3QXEB 3LW5E 1YJWT 3CEYA 3FDRA 1TH7A 3L2QA 1G5VA 4RG2A 1K73U 2YHTA 2CYZB 4V2SA 5J3BA 3LH0A 4M78F 5J39A 5D6YA 3CCST 2JN0A 3C4SA 2RHZA 4KBMB 3OMCA 4C8QC 2EWNA 2O4XA 2DZCA 4MDWA 4JJNK 2QQRA 1KHIA 2D0QB 3M4YA 4M7DG 2QA4A 4DOVA 1N8RU 5GMKj 4DA4A 1JRIA 3VKIA 3E9GA 4CI0C 3CCVT 1KD1C 1UGRB 4PJOA 3DLMA 1VQPT 4Y28E 5KE2A 2ZGWA 3X26B 2CKKA 2XHCA 1VQ8A 2F5TX 5IT9E 1Q82U 1UEBA 4PLIA 5EG2A 2ZPFB 5GANg 3MP1A 4JRQA 4QVCA 4OB0B 3M53A 1Q81C 1IZ6A 3GLXA 3A8HB 3L2ZA 4JRPA 2DD4A 4FU6A 4C92C 1YCYA 3VJPA 5GAN3 3CCUA 3UPUA 5DY9A 3HRTA 3M4GA 5GAN5 4HT8A 3FC3A 2LT1A 1XQHA 2RM4A 3J80E 3CCRT 4LDVA 1ZQ1A 3OYJA 4A4FA 2Y4YA 4E7JA 2WSCE 2XI9A 2RJCA 4PKCC 3SDZA 1NJIU 4JRKA 2DKGA 2LRQA 3MHXA 1K9MU 4IKFA 4ELYC 4XU1A 1KG1A 2RI3A 2NLUA 1VQ7T 1G3TA 5GANd 2GFAA 3RKXA 1NPRA 2CZ7B 4IURA 2EJ9A 3NTHA 4IUTA 5LJ5g 2X4JA 1S72T 2M1HA 2MMPA 1UGSB 3OQ5A 4LD9K 4EMKC 2QEXT 2DEQA 2LC4A 3M57A 3JB9G 1QVFA 1BI3A 1P92A 4BY6C 1FWZA 2M9UA 5GAMj 4FIBA 3A5ZB 2ZPIB 5L8RE 2HNIA 2HD0A 3VU3C 2KVQG 3JB9J 3QDRB 2K3YA 3LGFA 3TU4K 2RJDA 3QIIA 3CCJA 4ZN1A 1WJRA 3X20B 2YLBA 1VQ6T 2KY9A 1QVGA 3L2RA 2JUFA 2G3RA 3MEVA 3PNWC 4C92A 5GAMg 4BDZA 3FB9A 4ZTFA 4C0FA 5DLQE 4KUIA 3CCVA 1Y96B 2FHDA 4M78G 3RMSA 5LJ5d 3DB4A 4M7DE 4BI8B 5CR2A 5C0MA 3OW2A 3CC7A 2RI5A 1N8RC 1YJ9A 4RKUE 2X35A 2JTFA 4J7IA 3V8KA 1N9RA 4R55A 3BW1A 2KSSA 5A2QE 4E47A 1QP2A 4C0DC 3RESA 1KQSS 3HRUA 3PFSA 5GAOq 1VQKA 3OYKA 3CCRA 4LDUA 1KC8U 3MP8A 4NOYA 1U1SA 3TREA 3M58A 1M1FA 4XTUA 2GQVA 3JCMJ 4B9XA 1OZ3A 3QZ9B 2QA4T 1OYXA 4QVDA 3JCMW 2L5QA 2F5KA 3CXCS 1BKBA 3SB2A 4OVAA 2PQWA 2XD0A 2QDYB 3V7SA 1WJSA 3OBYA 2Y4XA 3VUBA 3P8DA 3UDCA 4D6WA 2RHUA 3A8GB 3OSVA 2RJFA 3R6OA 3DLLA 2D9TA 2QQBA 3MP6A 4RCCA 2K3XA 3INZA 2DO3A 3SFMA 4C5EA 4F7UB 2K2VA 2K5IA 2DXUA 2CZ1B 3RMQA 3G7ZA 4N4HA 4NS5A 4L59A 5M9OA 3CCUT 3WXMB 1N6AA 2L3RA 1YBYA 2E64A 4ZTJA 1B34B 1KQ2A 2GFUA 2QQ9A 2X4YA 4EMGA 2DTOA 1K8AU 4M78D 3META 5CKHA 2MWPA 3ME9A 4L5GA 4EMHA 3HFNA 3CMEA 1VIFA 2PVOB 4N0AC 5CKBA 5FU6B 4C5IA 1W4SA 3GPLA 3FIFA 4N4GA 4L6V5 2XDPA 2VYTA 4F7UF 1U8RA 1LNXA 3PTAA 2YLCA 4JLIA 2PUOB 2VV5A 3MCAB 1I8FA 5A0GA 4M78E 4J7FA 3CCLA 2DXCA 3G6EA 3AHUA 4BB7A 1M8VA 2EQUA 1H3ZA 4M77B 4M7DC 3A8MB 4E7LA 1QVPA 4YTLA 2M16A 5KCHA 5HKCA 2DIQA 3JCMh 3FJPA 3MEUA 3PMIA 5C6SA 4M77D 2DVEA 1KHCA 3ER0A 3JCMX 4LDWA 3QUIA 1W2BA 3M9QA 3JB9H 1VQ4A 4A4EA 5I2SA 2EJFA 3CCJT 3S3NA 5GANj 4XK8E 3BDUA 3I56A 3CD6A 4XAXB 3P8BB 1KC8C 3C12A 3C95A 4C0GA 4JS5A 4ATOA 4M77F 2KDSA 3S3MA 3GNGA 4PLLA 5CKFA 5CCAA 5IAYA 1G3SA 2JTMA 3CC7T 5LJ3h 2R58A 1YJ9T 4JS4A 1I81A 3OYHA 3OBWA 4MZPA 3SWNC 4N0AA 1SSFA 1VQMA 3CPFA 2E70A 1X75C 2FB7A 5LL6S 1HXDA 3CCET 3CCEA 2DAQA 5CKDA 4M75B 2ZPGB 1NZ9A 5FU7C 3JCMV 4KULA 1VQKT 3QHSA 5AYFA 5CVIA 3A8LB 1M4ZA 4J6XA 3URGA 1I4K1 2VC8A 4M75D 5GMKl 3ZEHA 4C5HA 5LJ5j 2XU8A 3I55A 4M7DA 3MEWA 3L2VA 5CQYA 5GANf 2EAYA 3HP9A 4M7AB 2EQJA 4WF2A 3DKMA 3EFRA 4ZN3A 2H3JA 3M59A 1K8AC 2VXFA 2O4XB 3RKWA 4M7AD 5A0LA 3L1AA 2XDBA 2P0QA 3BDLA 2RHYA 4OMFB 5A0DA 4E7IA 3HSBA 3LGLA 4M75F 3NTKA 1M9SA 2OAUA 4MMLA 4KUDK 3E19A 3M54A 2XDDA 2E5QA 4X9DA 3X28B 3QSUA 4IUPA 3HFOA 1JJ2S 1LOJA 2PUKB 3JCMe 2Y90A 4VUBA 3QBYA 1K73C 1UGQB 4PJOB 2X4XA 1ZHIA 2EQKA 1QW1A 3C94A 4M7AF 4M78C 1BIBA 4B9WA 2L8DA 4PJOD 2XIDA 5GAN4 3V8LA 4IUQA 3SWNA 2EQMA 3HL8A 4LD6A 3RKYA 3GP8A 4F7UG 5LJ5f 3G71A 1X6OA 2LQ8A 3CBPA 3CMET 3OYCA 3CBMA 4FSXA 4HT9A 1FXXA 3QO3A 1XOVA 1JB0E 2M0OA 3QKJA 2YRVA 3EFSA 3L2UA 4NL3A 3OYMA 5LJ3e 4PJOF 3LWHA 2MI6A 3OYFA 1WQ7A 3CCLT 3OS5A 1WGSA 2DPPB 2DTIA 2HBPA 2HQEA 2R5AA 4X9CA 3OYEA 3G6ET 1BYMA 2DXBA 1WQWA 4N4IA 2O01E 1MGQA 1Q82C 3QYHB 5DLOA 1YI2A 4C8QB 1BI0A 2OTJA 1VQ4T 3A8OB 2BIVA 2LNVA 3BY7A 5GAMf 4XTYA 1Q86U 2DJZA 3TCJA 4C8QD 3QJYA 3ZBDA 1DJ7B 5GAN7 2B8AA 4M77G 1YHQT 2KMTA 1KQSA 5CAIA 3CCMT 2JNGA 2EYQA 4X34A 2L89A 3H8ZA 4DQ2A 4F7UA 3I56T 3S3OA 3CD6T 2WACA 3HKSA 5HK0A 1V29B 2K5FA 4FM4B 2DXTA 4M78A 3RIRA 2BKDN 3T9NA 3JB9I 1WNLA 1UGPB 4C8QF 2LVMA 1NJIC 3CXCA 1K9MC 1VQLA 4NL2A 3VUZA 2KK4A 4LDYA 3OYIA 2BUDA 2ZPEB 3PIPA 3LX7A 1LJOA 3M56A 3OS1A 4C92B 2IVWA 2VUBA 3CC4T 1VQMT 1VQOA 2CZ6B 1Y07A 4J5YA 3OYAA 1D3BB 3CMAA 5GMKi 4BE1A 3RERA 1H641 4XU3A 1GXIE 1VQ5A 2RI2A 4QQ6A 5I21A 4P5NA 1PSEA 3CPWS 3JCMg 3F70A 4PNOA 2WSFE 3VYGA 1BI1A 2QI2A 4DOWA 5GAN6 3OS2A 4E7KA 4J83A 4M77A 5CK9A 5IN1A 4J6YA 1RL2A 1NE8A 1N9SA 2EIFA 3I55T 1RI0A 4M75G 3NFCA 2QQAA 5GAN2 1VQ9T 3O8VA 2E65A 3V7RA 1M1GA 2PU9B 2R57A 1Y7XA 3GF5A 4C92F 1HK9A 4F7UE 5GMKe 4BE0A 2HAXA 4OB1B 2JVVA 4FT4A 4OP0A 4RCBA 3JCMc 4EMKB 3FRNA 1VQNA 1JJ2A 4HKEA 4XU0A 4M7AG 2XG8D 4BY6B 5LJ3g 3MEAA 2DZ9A 3H6ZA 2K57A 4JLGA 2RA2A 4Y91A 1AHJB 4JRIA 3JCMd 4Q5WA 2F69A 2JZ2A 3VYHB 3KBGA 3OYDA 1O75A 1JBMA 3QYGB 3X24B 4ZGDB 2MF2A 1YHQA 2V8KA 3VV0A 5GAOp 2EJGA 2RH2A 5GAN8 3CCMA 4JDSA 1YITA 2ZPHB 1WPYA 1ZBXA 3PIOA 1O9SA 4GLKA 4PJOG 2LT4A 5GAOm 2P0PA 3KUFA 3OYYA 2RHXA 4M75A 2X4WA 1XNIA 2LCLA 4M77E 3V7CA 5HK3A 3G71T 5FRNA 2RJEA 3JCMb 2P4TA 3J81E 4XTXA 4HA8A 1M1KU 5LJ3d 4BUGA 3PMTA 5D6WA 2FVUA 4MMKA 5KE3A 4OGCA 3TEEA 5GAOr 3GNFB 4IUUA 1Q7YU 2VXEA 3HHTB 3S6WA 2CS7A 4EPCA 1XTDA 1W2BS 3CC4A 4M7AA 3WVEB 4C0DB 1OZ2A 4RMOA 4QQDA 2C06A 2GCXA 5J26A 1BIAA 3GIBA 3KXTA 3QG1A 4BDYA 1YI2T 4BI4A 4KT0E 3SD4A 2RK2A 3WVDB 3ZFJA 2XK0A 2RD1A 5GAMe 3CCQA 2LTOA 4RG8A 3CC2T 5KCOA 4E7HA 4MDXA 3LLRA 4C8QG 1EIFA 2E12A 1VQ9A 3G4SA 2VGNA 2FYKA 5GAOn 2OTLT 2AHJB 2IG0A 3CBOA 2CZ0B 4M75E 3L42A 2A7YA 4A53A 2GF7A 4MZMA 1VQLT 4XTZA 5HY6A 4EDUA 1Y96A 4TVRA 4J6WA 2E1HA 3OYNA 1VQOT 3CMAT 4M7AE 1G3YA 3LYIA 3UT1A 3OMGA 2EKOA 3V8JA 2DK3A 4C0ZA 1UB4A 2MAMA 2ZPBB 4IUVA 2V8JA 4C92G 3M55A 2E6NA 5FRMA 3RUXA 1WJQA 4UC4A 4C5GA 2K5LA 4XQ3A 4C8QA 5FU6C 1YIJA 5CO7A 3P8HA 1YJWA 1IREB 2QQSA 4ME7A 1NPPA 5GANh 3QZ5B 2HQXA 3JCMQ 1QVFS 3J7AF 5GMKh 4A54A 4PJOE 4ELZC 4R56A 2ZZDA 2RB6A 3JRZA 1YJNT 2E6ZA 2KQWA 3CCSA 1VQNT 4O6JA 4M7DB 3M5AA 1M90U 5CQXA 4M77C 2CGHA 3L2WA 1KQ1A 1M1KC 3OSSC 3OA6A 4M7DD 1M5Q1 2E10A 3OB9A 2QTXA 3QPHA 4OGEA 1QVGS 2QXFA 3OYBA 1Q7YC 4HCBA 4LDXA 3MO8A 2I2LA 3LWIA 2RK1A 4BD3A 4MZTA 2ZCFB 3CC2A 1QP3A 1Y71A 2KAFA 1VQ5T 1YITT 1D3BA 3OW2S 2A3LA 4O5VA 4PL6A 5GMKm 4JUVA 1VQPA 5LJ5h 3EAEA 4M7DF 1N27A 3PT9A 2OTJT 3PGGA 2RHIA 3N5BB 2OTLA 3NTIA 2JOYA 4II1A 4ZGEB 2MWOA 4C8QE 1B34A 4QVZA 2PVGB 2DTHA 3FLGA 5CKEA 3SWNB 2R5MA 1MHNA 3X25B 4HCCA 4J8OA 1Q86C 4A4KA 2K4YA 4BACA 4OF1A 3JCMP 4FT2A 5FU7B 4QW2A 3DB3A 4M75C 4XTWA 4C92D 4QQGA 2WSEE 4EMKA 5GAOl 2D6FA 5GAMd 1KD1U 5GAMh 1R8OB 3GOXA 3OYLA 3CCQT 4GY5A 3CPWA 3QJ6A 2XKOC 4A4HA 3OS0A 3E1SA 2EFIA 4OB3B 1U1TA 5D6XA 1FX7A 1VQ7A 1VUBA 5LJ3j 2FL7A 4XTVA 4M7AC 4C92E 5GANe 4CRIA 1Q81U 4A4GA 3JAME 4BI3A 3G4ST 1S72A 4XU2A 4HCZA 3JB9D 1VQ8T 2QEXA 1YJNA 5FROA 4FL6A 3Q1JA 1PSFA 1VIEA 3JCMf 5I2MA 4BE2A 3JSCA 5FLXE 3OY9A 3BFMA 2LX9A 3HPWA 2V8IA 1X01A 1BI2A 4Z02A 3FEOA 2LCCA 4PJOC 4M78B 3HRSA 1G3WA 1M90C 3JB9F 5KH6A 1VQ6A 2XICA 5DM7R 2PVDB 2E41A 2LQKA 2RO0A 1I5LA 2VGMA 3UWNA 1OI1A 4OB2B 3E9FA 3OYGA 5CIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RH2 A;  2GQV A;  2OAU A;  1VIE A;  3T9N A;  2P4T A;  2RK2 A;  1VIF A;  3SFM A;  2VV5 A;  2RK1 A;  3UDC A; 
#chains in the Genus database with same CATH topology
 3ASK A;  5LJ3 f;  1W6X A;  3LW5 E;  3EH1 A;  3CEY A;  1G5V A;  1EFN A;  4V2S A;  4M78 F;  3CCS T;  1I07 A;  2E4H A;  4IIM A;  1Z9Z A;  4JZ4 A;  2KBT A;  1WHH A;  2GTO A;  3H0F A;  4HVU A;  4MDW A;  1OX8 A;  3E2U A;  3M4Y A;  2D0Q B;  1RAI B;  4DOV A;  4DA4 A;  3VKI A;  3CCV T;  2RN8 A;  4OMM A;  2ZGW A;  2CH4 A;  3TSZ A;  2XHC A;  1VQ8 A;  1Q7Y R;  1UEB A;  5GAN g;  4JRQ A;  4QVC A;  4OB0 B;  2GNC A;  1Y0M A;  4FU6 A;  4AT1 B;  3VJP A;  5GAN 5;  4FSS A;  3OYJ A;  2QGF B;  3CQT A;  2XI9 A;  1M8M A;  2DKG A;  3EGD B;  2RI3 A;  1RLP C;  3CMA Q;  1VQ7 T;  2DEU A;  5GAN d;  3RKX A;  1NPR A;  2COZ A;  2CZ7 B;  2EJ9 A;  2M1H A;  2JXB A;  4BY6 C;  1B07 A;  2MPX C;  5GAM j;  1GRI A;  3A5Z B;  1OU8 A;  4AFZ C;  1NBE B;  4RTW A;  5KYX B;  4F04 B;  2K3Y A;  3LGF A;  2RJD A;  3QII A;  1X6G A;  3CCJ A;  2YLB A;  1VQ6 T;  3L2R A;  3MEV A;  4C92 A;  5GAM g;  4KUI A;  3CCV A;  2FHD A;  1VQ5 Q;  4J7I A;  3UAT A;  2OTJ Q;  5A2Q E;  1CKB A;  3HRU A;  2LCS A;  2LQN A;  4LDU A;  3TVT A;  1D1C A;  1KC8 U;  3VS2 A;  2QAZ A;  3NPF A;  2NUT A;  1PC0 A;  4QVD A;  3JCM W;  2DRK A;  2F5K A;  3CXC S;  1IHV A;  1R77 A;  1X69 A;  4OVA A;  2PQW A;  2EBP A;  3VUB A;  4D6W A;  1SG5 A;  2X3X D;  1TS9 A;  2K5I A;  3G4S Q;  3CCU T;  3M0Q A;  4N4H A;  4NS5 A;  5M9O A;  2E64 A;  4ZTJ A;  2X4Y A;  1K8A U;  3RR6 A;  4EMH A;  3HFN A;  3CME A;  3GPL A;  3FIF A;  4RTT A;  1LNX A;  2YLC A;  3MCA B;  1KFZ A;  4BB7 A;  2EQU A;  2O88 A;  4M7D C;  4YTL A;  2NUP A;  5KCH A;  1WZO A;  3MEU A;  3JCM h;  1VQ4 A;  1YJW Q;  4M77 D;  1ZA1 B;  3BE3 A;  4ESR A;  3JB9 H;  2LNH B;  4A4E A;  2QK0 A;  3CD6 A;  1WDX A;  1KC8 C;  3C95 A;  4M77 F;  3GNG A;  5CKF A;  1GCQ A;  3CC7 T;  3CC2 Q;  4J9F A;  3SWN C;  3EGD A;  2YRD A;  3CPF A;  1VQP Q;  2DAQ A;  2JMA A;  5FU7 C;  1VQK T;  1M4Z A;  2VC8 A;  4R0K A;  3MEW A;  5GAN f;  2EAY A;  4M7A B;  3DKM A;  2DFU A;  1K8A C;  2E3H A;  2GGR A;  4PJM A;  3M0T A;  3I9Q A;  3BDL A;  2DL4 A;  2A28 A;  2RHY A;  4E7I A;  3HSB A;  3NTK A;  4MML A;  3E19 A;  3X28 B;  2LZ6 B;  4IUP A;  1OEB A;  1K1Z A;  3QBY A;  1ZHI A;  3ULR B;  2L8D A;  1SRM A;  4IUQ A;  4HCK A;  3RKY A;  4F7U G;  3OYC A;  4FSX A;  1FXX A;  4J9C A;  2D8J A;  3QO3 A;  1XOV A;  1JB0 E;  3QKJ A;  3SEM A;  3L2U A;  1LCK A;  4NL3 A;  3LWH A;  2MI6 A;  1WQ7 A;  1RAC B;  2HQE A;  2HBP A;  2R5A A;  4AMC A;  2O01 E;  1Q82 C;  2ED1 A;  5GAM f;  1VYT A;  4XTY A;  4C8Q D;  3QJY A;  1DJ7 B;  2QG9 B;  3A98 A;  1YHQ T;  1MV3 A;  5CAI A;  1QCN A;  2ED0 A;  1AT1 B;  3S3O A;  2WAC A;  2HBW A;  3THK A;  1WNL A;  1ZSZ B;  4C8Q F;  1K9M C;  3CXC A;  1VQL A;  2ZPE B;  3LX7 A;  1ABQ A;  1VQM T;  3PVL A;  4J5Y A;  3OYA A;  1KC8 R;  4BE1 A;  4XU3 A;  4QQ6 A;  5I21 A;  1PSE A;  3CCE T;  3VYG A;  1KIK A;  3QWX X;  1BI1 A;  2QI2 A;  1GCQ C;  1MNE A;  3I55 T;  2F1L A;  3V7R A;  4HXJ A;  4CC2 A;  1M1G A;  4C92 F;  3GF5 A;  4RCB A;  1SF9 A;  1JJ2 A;  2LJ0 A;  4XU0 A;  2RQW A;  1ZX6 A;  2RA2 A;  2DLP A;  2F69 A;  3KBG A;  1K8A R;  1O75 A;  1JBM A;  4JZ3 A;  1YHQ A;  5GAO p;  2EJG A;  3PIO A;  1I5O B;  4GLK A;  4PJO G;  5GAO m;  2P0P A;  3KUF A;  3V7C A;  4A54 A;  2LCL A;  4XTX A;  4HA8 A;  2X51 A;  3CCJ Q;  2FVU A;  5GAO r;  2VXE A;  1W2B S;  3S6W A;  4M7A A;  2CH4 W;  2B86 A;  4F16 A;  1UFF A;  1OZ2 A;  4QQD A;  3CCV Q;  5J26 A;  1I1J A;  3LH5 A;  3WVD B;  2RK2 A;  4LE9 A;  1GFD A;  2L3S A;  5GAM e;  3CCQ A;  1WXT A;  2HL5 C;  1H3H A;  1E6G A;  1MMG A;  3EG9 B;  1K0S A;  3CBO A;  4M75 E;  2AZS A;  2A7Y A;  4EDU A;  3CMA T;  5I22 A;  1G3Y A;  5KYY B;  1IO6 A;  3PE0 A;  3QWY A;  2V8J A;  2E6N A;  2K5L A;  4XQ3 A;  4OMQ A;  3P8H A;  4ME7 A;  1NPP A;  2HQX A;  1QVF S;  1WYX A;  5GMK h;  4O6J A;  3M5A A;  3CME Q;  1QKW A;  4J9H A;  2OJ2 A;  1M5Q 1;  3OB9 A;  4OGE A;  1QVG S;  1R0B G;  4HCB A;  1MV0 B;  1ZSZ A;  3I5S A;  3LWI A;  1C0M A;  4MZT A;  2X9H A;  1QP3 A;  1Y71 A;  1VQ5 T;  3NGP A;  3OW2 S;  4PL6 A;  1VQ4 Q;  3EAE A;  2OTJ T;  2RHI A;  4ZGE B;  2RNA A;  4Z88 A;  2MWO A;  4QVZ A;  2PVG B;  3FLG A;  1UJ0 A;  3CD6 Q;  4HCC A;  4A4K A;  1WA7 A;  4QW2 A;  2YWW A;  4KH0 B;  5GAO l;  2D6F A;  1KSW A;  2BE7 D;  1R8O B;  3OYL A;  3E1S A;  4OB3 B;  1U1T A;  5D6X A;  4LUE A;  5LJ3 j;  4M7A C;  3JAM E;  3G4S T;  4BI3 A;  1S72 A;  4XU2 A;  1JJ2 P;  3JB9 D;  3NMZ C;  4ANJ A;  2CP2 A;  1PKT A;  4FL6 A;  1PSF A;  1VIE A;  2YXY A;  3JSC A;  3OY9 A;  3HPW A;  2KXC A;  2EGE A;  1V76 A;  2V8I A;  1BI2 A;  2LJ3 A;  2KYB A;  2LCC A;  3JB9 F;  5DM7 R;  2PVD B;  2KYM A;  2V1R A;  1Q86 C;  1YJW T;  2DIG A;  3R6N A;  3PVQ A;  3L2Q A;  4RG2 A;  2YHT A;  1FMV A;  3LH0 A;  2CP0 A;  5J39 A;  4FYY B;  4Z89 A;  3EG9 A;  1D0Y A;  2RHZ A;  4KBM B;  2YUO A;  4JJB A;  1TUG B;  4HVW A;  2EW3 A;  1EZZ B;  3VS6 A;  2F2V A;  1VQP T;  5KYY A;  3X26 B;  1PD0 A;  2CKK A;  4E7Z A;  1T0J A;  1PHT A;  2ZPF B;  1FMW A;  1ZSZ C;  3MP1 A;  1RI9 A;  3KFV A;  1IZ6 A;  1RAA B;  3GLX A;  1YCY A;  4FW2 A;  5DY9 A;  2K7A A;  2OTL Q;  3FC3 A;  1N8R R;  4LDV A;  1ZQ1 A;  2BZX A;  4A4F A;  1VQL Q;  1IHW A;  2SRC A;  2MCN A;  4E7J A;  3SDZ A;  4F14 A;  1KG1 A;  2O9V A;  4ELY C;  4XU1 A;  2NLU A;  2J6O A;  4IUR A;  1IGQ A;  3NTH A;  4IUT A;  5LJ5 g;  2X4J A;  2JJ9 A;  2DET A;  2NYS A;  1QVF A;  3EHQ A;  2M9U A;  3H0I A;  4ORZ A;  5L8R E;  1ZLM A;  1VA7 A;  2VVK A;  4D8D A;  1QWE A;  4ZN1 A;  3X20 B;  1GBQ A;  1QVG A;  2ROL A;  3IQL A;  1YCS B;  4ZTF A;  2L0A A;  1FMK A;  1Y96 B;  4M78 G;  2A0F B;  5LJ5 d;  2EYZ A;  4M7D E;  3EHR A;  3OW2 A;  1PKS A;  2NWM A;  1G2B A;  1JXO A;  1M2V B;  2FPF A;  2A08 A;  1QWF A;  1KQS S;  3OYK A;  2EPD A;  1SPK A;  1U1S A;  2DF6 A;  1OU9 A;  3JCM J;  1OYX A;  1TXQ A;  3SB2 A;  2MOX A;  2XD0 A;  1WJS A;  2Y4X A;  3CCQ Q;  2D9T A;  2QQB A;  5ECA A;  2DO3 A;  3SFM A;  4F7U B;  2DXU A;  5KYW B;  3WXM B;  4EIK A;  1YBY A;  4RTV A;  1IB8 A;  4LN2 A;  4EMG A;  4M78 D;  5CKH A;  3ME9 A;  4N0A C;  5CKB A;  2IPO B;  1W4S A;  2VYT A;  5KYN A;  3PTA A;  1UHC A;  2PUO B;  5A0G A;  2E5K A;  4J7F A;  2DXC A;  3G6E A;  1X27 A;  1QVP A;  1QKX A;  4WCI A;  2DIQ A;  5FW9 A;  1TOV A;  3FJP A;  2DVE A;  1KHC A;  1ARK A;  1U5S A;  4JJD A;  3CCJ T;  3S3N A;  5GAN j;  3I56 A;  3P8B B;  1S1N A;  1UHF A;  2JTE A;  4PLL A;  1G3S A;  2R58 A;  2BE9 B;  4JS4 A;  2DA9 A;  1M30 A;  2FB7 A;  5CKD A;  1IRX A;  1NZ9 A;  3QHS A;  2YDL A;  2EGA A;  4M75 D;  5GMK l;  3I35 A;  3AT1 B;  4M7D A;  2VAS A;  2JS2 A;  2C0T A;  2KRS A;  3M59 A;  2VXF A;  2O4X B;  3RKW A;  3L1A A;  1RAB B;  3LGL A;  4KH1 B;  4M75 F;  2DYB A;  1M9S A;  4KUD K;  2RPN A;  3QSU A;  4X1V A;  1X6B A;  4DBF A;  4VUB A;  4PJO B;  3H0H A;  3GBQ A;  1WLP B;  1ZUK A;  1S72 Q;  4B9W A;  1AZG B;  1BIB A;  1QLY A;  3V8L A;  1FYN A;  3SWN A;  3HL8 A;  1GFC A;  4LD6 A;  3GP8 A;  4ZNX A;  3SHW A;  5LJ5 f;  1MUZ A;  2K6D A;  4QKU A;  1WHJ A;  2LQ8 A;  3CME T;  3EFS A;  2QYZ A;  5LJ3 e;  2K79 A;  2GTJ A;  3OYE A;  1BYM A;  2A37 A;  1PCX A;  4PJJ A;  3QYH B;  1BI0 A;  1VQ4 T;  3BY7 A;  4M77 G;  1KQS A;  2RQT A;  4J9E A;  3CCM T;  2JNG A;  4X34 A;  4DQ2 A;  2XMF A;  3H8Z A;  4F7U A;  3CD6 T;  2K5F A;  1J3T A;  2DXT A;  1AWJ A;  3T9N A;  3JB9 I;  4GBQ A;  2HL3 A;  4NL2 A;  2KK4 A;  1PG5 B;  2IVW A;  2NUZ A;  1VQO A;  2CZ6 B;  3G1J A;  2W0Z A;  3CPW S;  4P5N A;  3JCM g;  3F70 A;  3QDF A;  3OS2 A;  2P84 A;  3UF4 A;  3A1P A;  2ECZ A;  1WX6 A;  2LJ1 A;  4J6Y A;  2YSQ A;  2EIF A;  3NFC A;  2QQA A;  5GAN 2;  2E65 A;  2PU9 B;  4BE0 A;  1Y7X A;  1YP5 A;  4OP0 A;  4FT4 A;  4EMK B;  3FRN A;  3MEA A;  4JLG A;  2K57 A;  4Y91 A;  1AHJ B;  4JRI A;  3JCM d;  1OQK A;  2JZ2 A;  2O2O A;  3X24 B;  3QYG B;  2P4R A;  4DEX A;  2V8K A;  3VV0 A;  4FCY A;  3CCM A;  4JDS A;  2ZPH B;  2MK5 A;  5KH6 A;  2X4W A;  1XNI A;  5HK3 A;  1M1K U;  1ZA2 B;  4OGC A;  3GNF B;  3HHT B;  1XTD A;  1BIA A;  3GIB A;  3QG1 A;  3SD4 A;  3ZFJ A;  5GJV B;  1G83 A;  2RD1 A;  1VYU A;  5IXF A;  3LLR A;  4C8Q G;  2E12 A;  1UDL A;  5KYX A;  5GAO n;  2OTL T;  4PFZ A;  3L42 A;  2CP6 A;  2JM9 A;  2HMA A;  2FRW A;  4MZM A;  1VQL T;  4XTZ A;  1NYF A;  4TVR A;  2JMC A;  4M7A E;  3LYI A;  4IUV A;  2MAM A;  4C92 G;  3M55 A;  4J9B A;  1YIJ A;  2MIO A;  2O9S A;  2QQS A;  4K11 A;  3QZ5 B;  3J7A F;  4ELZ C;  2RB6 A;  2E6Z A;  2KQW A;  2W10 A;  2HEQ A;  4AFU C;  1RAG B;  1OX9 A;  1M1K C;  1TUD A;  3OSS C;  2KGT A;  4J9D A;  4M7D D;  2E10 A;  1VOM A;  3QPH A;  2QXF A;  3MO8 A;  2I2L A;  4BD3 A;  3G6E Q;  4DEY A;  4JUV A;  4M7D F;  3PGG A;  2OTL A;  3UA6 A;  2JOY A;  3VS1 A;  2PNI A;  1BCO A;  3I56 Q;  4AG1 C;  4J8O A;  4QT7 A;  2K4Y A;  4C92 D;  4RTZ A;  4QQG A;  4EMK A;  4LUD A;  3CCQ T;  3CPW A;  3QJ6 A;  2XKO C;  4A4H A;  1FX7 A;  2YUN A;  5GAN e;  2ESW A;  4HCZ A;  1B7T A;  2QEX A;  3Q1J A;  3JCM f;  5I2M A;  4BE2 A;  2J05 A;  5FLX E;  1VQ9 Q;  2LX9 A;  2H3E B;  4GLM A;  4PJO C;  4M78 B;  3HRS A;  1M3A A;  2E41 A;  2LQK A;  2VGM A;  4DBQ A;  2VKN A;  1OI1 A;  3OYG A;  2P0K A;  2LDM A;  2DD5 A;  3QXE B;  3EFO B;  2PZ1 A;  3FDR A;  1TH7 A;  1AD5 A;  1K73 U;  5J3B A;  2JN0 A;  3C4S A;  2YT6 A;  1LPL A;  4JJN K;  9ATC B;  2AT1 B;  2QA4 A;  1N8R U;  5GMK j;  2BZ8 A;  4KGZ B;  1JRI A;  3E9G A;  1M1K R;  1AWO A;  4Y28 E;  7AT1 B;  2QGG A;  2F5T X;  5IT9 E;  4PLI A;  5EG2 A;  5GJW B;  2EYW A;  4CC7 A;  5FWB A;  4JRP A;  2DD4 A;  3UPU A;  2LT1 A;  3J80 E;  1NJI U;  4JRK A;  2LRQ A;  1VQO Q;  1G3T A;  1OUL A;  2GFA A;  2A36 A;  5IHI A;  2DVJ A;  1S72 T;  1C6V X;  1UGS B;  3OQ5 A;  4EMK C;  1U3O A;  2LC4 A;  3JB9 G;  1T0H A;  1BI3 A;  2FG0 A;  2JS0 A;  2ZPI B;  1PRL C;  2HNI A;  1K0X A;  3VU3 C;  2KVQ G;  2ATC B;  1RLQ C;  3JB9 J;  1YJN Q;  2YRC A;  1WJR A;  1X43 A;  2KY9 A;  2FZK B;  2JUF A;  2FZG B;  5DLQ E;  4BI8 B;  5CR2 A;  5C0M A;  2OI3 A;  1N8R C;  3CXC P;  1YJ9 A;  2X35 A;  2DBM A;  1AVZ C;  3CCM Q;  3V8K A;  1N9R A;  1UTI A;  3BW1 A;  5FWC A;  2KSS A;  1AWW A;  1QP2 A;  2GQI A;  3RES A;  5GAO q;  1JO8 A;  3MP8 A;  1H8K A;  1T3S A;  4JJC A;  4NOY A;  1M1F A;  4XTU A;  1YWO A;  1QCO A;  1RAE B;  1OZ3 A;  1RUW A;  1BKB A;  1SSH A;  2KI7 A;  1BCM A;  3ZL7 C;  2GBQ A;  5KYU B;  3UDC A;  4PFP A;  3A8G B;  4E6R A;  2RJF A;  3DLL A;  1PWT A;  1VYV A;  3RMQ A;  1NG2 A;  4A63 B;  3D7S B;  3VS7 A;  1B34 B;  1A0N B;  2QQ9 A;  4L5G A;  4C5I A;  2PVO B;  2XDP A;  2CT4 A;  2KRN A;  3CCL A;  3UA7 A;  1WFW A;  1H3Z A;  4M77 B;  2M16 A;  1YIJ Q;  2JM8 A;  2KNB B;  3JCM X;  3ER0 A;  1GCP A;  1W2B A;  3M9Q A;  3HTR A;  2HKQ B;  3BDU A;  4XAX B;  4KGV B;  2EVR A;  3C12 A;  4JS5 A;  2RF0 A;  1K73 R;  3S3M A;  5CCA A;  5IAY A;  1WXB A;  2JTM A;  5LJ3 h;  5IXB A;  1I81 A;  3OYH A;  2ENM A;  4MZP A;  4N0A A;  1K4U S;  2HDA A;  2E70 A;  5LL6 S;  1HXD A;  1ABO A;  2ZPG B;  3JCM V;  1NLO C;  3A8L B;  1WIE A;  4J6X A;  3URG A;  3ZEH A;  5LJ5 j;  1GBR A;  4D8K A;  5CQY A;  1HD3 A;  3HP9 A;  2EQJ A;  4WF2 A;  3EFR A;  2DRM A;  5IHK A;  2H3J A;  3CCR Q;  4M7A D;  2XDB A;  2P0Q A;  5A0D A;  2HSP A;  2OAU A;  2XDD A;  2E5Q A;  4X9D A;  3HFO A;  2E3I A;  1IXD A;  2Y90 A;  2X4X A;  2EQK A;  4M7A F;  4M78 C;  2QEX Q;  1WI7 A;  1NJI R;  2XID A;  2KR3 A;  5GAN 4;  3G71 A;  1X6O A;  1WHK A;  2LP5 A;  2EQI A;  2DL7 A;  2J6K A;  2M0O A;  3OYM A;  3TSW A;  5IHN A;  3OYF A;  1WGS A;  3G6E T;  4X9C A;  2DXB A;  4N4I A;  1YI2 A;  5DLO A;  4C8Q B;  3A8O B;  5KYU A;  2LNV A;  3H41 A;  2DJZ A;  4LNP A;  3ZBD A;  2DYI A;  2L89 A;  3I56 T;  2CT3 A;  3HKS A;  1V29 B;  3RIR A;  1OPK A;  2EKH A;  2J7I A;  1UGP B;  4CC3 A;  2QA4 Q;  1NYG A;  3OS1 A;  1LJO A;  3M56 A;  4C92 B;  1MMD A;  2M02 A;  5GMK i;  1H64 1;  1KJW A;  1WXU A;  2C0I A;  2K9G A;  4PNO A;  5GAN 6;  3VRZ A;  2EGC A;  2OX7 A;  4M77 A;  5IN1 A;  1RL2 A;  1N9S A;  2CSQ A;  4M75 G;  1VQ9 T;  2R57 A;  4F7U E;  2HAX A;  5GMK e;  4OB1 B;  2JVV A;  2EYX A;  3JCM c;  2L3Q A;  1VQN A;  2NUT B;  1M3C A;  2XG8 D;  2DER A;  4Q5W A;  1W2B P;  3VYH B;  1BBZ A;  3OYD A;  1R0C B;  2MF2 A;  2RH2 A;  5GAN 8;  1YIT A;  1ZBX A;  2D1X A;  2V26 A;  1O9S A;  2COY A;  4FYW B;  2RHX A;  2AIR B;  4RUG A;  2RJE A;  3J81 E;  4PFO A;  4BUG A;  4MMK A;  5KE3 A;  2FPE A;  3TEE A;  2CS7 A;  1ZUY A;  4C0D B;  1PM3 A;  2GCX A;  1YFN A;  3EG1 A;  2DIL A;  3KXT A;  4J9I A;  4BDY A;  2COW A;  1YJ9 Q;  2XK0 A;  3EGU A;  2LTO A;  4RG8 A;  5KCO A;  4E7H A;  2FZC B;  4MDX A;  1EIF A;  3MJX A;  1VQ9 A;  2NUP B;  2IG0 A;  2CZ0 B;  4M4Z A;  2RMO A;  4A53 A;  1QVF P;  1Y96 A;  3OYN A;  2E1H A;  1ZSG A;  1VQO T;  3OMG A;  1QVG P;  3V8J A;  4C0Z A;  2DK3 A;  1UB4 A;  1WHG A;  3M0P A;  5FRM A;  1D09 B;  1M2V A;  1ACM B;  1WJQ A;  4UC4 A;  4C5G A;  4C8Q A;  2FO0 A;  5GAN h;  3OW2 P;  3JCM Q;  1UJY A;  4PJO E;  4R56 A;  2K3B A;  2ZZD A;  2JW4 A;  1YJN T;  3CCS A;  5I11 A;  1M90 U;  4M77 C;  2CGH A;  1KQ1 A;  3OA6 A;  3VS5 A;  3VRY A;  1MMA A;  4DBR A;  3OYB A;  2CSI A;  4RTX A;  4RTY A;  2RK1 A;  4Y92 A;  2ZCF B;  1TG0 A;  1RAD B;  3CCL Q;  2KAF A;  1U06 A;  1UEC A;  2A3L A;  4O5V A;  2DX1 A;  2MYS A;  5KYW A;  3NTI A;  4II1 A;  4E7S A;  1NLP C;  2FRY A;  2L3P A;  2R5M A;  1UG1 A;  1OPL A;  4BAC A;  4OF1 A;  2VWF A;  1I0C A;  4XTW A;  2WSE E;  5GAM d;  3EGX B;  1KD1 U;  2HQH A;  2AK5 A;  5GAM h;  2PTK A;  3CC4 Q;  4GY5 A;  1D0X A;  2EFI A;  1VQ7 A;  2DM1 A;  2FL7 A;  1Q81 U;  4KRT A;  1QQJ A;  2DL3 A;  3VS4 A;  2D0N A;  1YJN A;  5FRO A;  2YUP A;  1D1B A;  1Z9Q A;  1ZUU A;  2V1Q A;  1ZBJ A;  2G6F X;  3O5Z A;  1X01 A;  4Z02 A;  3FEO A;  1H92 A;  1E7O A;  1M90 C;  1VQ6 A;  2XIC A;  1E6H A;  2RO0 A;  1I5L A;  3REB B;  3UWN A;  4OB2 B;  2BZY A;  2KRO A;  3E9F A;  2HSE B;  5CIU A;  1JJ2 S;  4ZGJ B;  5LJ5 e;  3EH2 A;  1MND A;  1YIJ T;  1JXM A;  1M2O A;  2CYZ B;  5D6Y A;  3G71 Q;  3OMC A;  4C8Q C;  2EWN A;  2O4X A;  1SHF A;  2DZC A;  3RNJ A;  2QQR A;  1G8X A;  1KHI A;  2F2X A;  4M7D G;  2DL5 A;  4CI0 C;  1RAH B;  4DBH A;  1UGR B;  1YI2 Q;  3DLM A;  1KD1 C;  4PJO A;  5KE2 A;  1JEG A;  2J06 A;  1Q82 U;  2F2W A;  1IGU A;  3M53 A;  4PK4 A;  1Q81 C;  3A8H B;  3L2Z A;  4C92 C;  5GAN 3;  3CCU A;  3HRT A;  3M4G A;  4HT8 A;  1SKU B;  1TWB A;  2DL8 A;  1XQH A;  2RM4 A;  3CCR T;  4OML A;  2Y4Y A;  2WSC E;  2RJC A;  4PKC C;  1K9M U;  3MHX A;  4IKF A;  2J6F A;  2O31 A;  8AT1 B;  3VS3 A;  3M0R A;  4LXC A;  2MMP A;  4LD9 K;  2QEX T;  2DEQ A;  3M57 A;  2HCK A;  1P92 A;  2CUB A;  1FWZ A;  1D1A A;  4FIB A;  1TSF A;  2HD0 A;  3QDR B;  1KQS P;  3TU4 K;  1VQN Q;  1W1F A;  2G3R A;  3EG3 A;  3PNW C;  2CRE A;  4BDZ A;  3FB9 A;  4C0F A;  3RMS A;  1K9A A;  3DB4 A;  2RQU A;  3CC7 A;  2RI5 A;  3EGX A;  2LMJ A;  4RKU E;  1M90 R;  2FEI A;  2FPD A;  2JTF A;  1YIT Q;  4R55 A;  1V1C A;  3RDV A;  4E47 A;  4C0D C;  1VQK A;  3PFS A;  1BB9 A;  2CP5 A;  2VB6 A;  2QAS A;  3CCR A;  2DJQ A;  3TRE A;  3M58 A;  2GQV A;  1K76 A;  4B9X A;  3QZ9 B;  2QA4 T;  2L5Q A;  1AZE A;  2QDY B;  3V7S A;  3OBY A;  3P8D A;  6AT1 B;  2RHU A;  3OSV A;  2CDT A;  3R6O A;  2JT4 A;  3MP6 A;  4RCC A;  3RBB B;  2K3X A;  3INZ A;  4C5E A;  2K2V A;  4CC4 B;  2CZ1 B;  2QDL A;  3G7Z A;  1KD1 R;  4L59 A;  1VQ8 Q;  2DMO A;  1N6A A;  4FYV B;  2L3R A;  4OMO A;  1KQ2 A;  2GFU A;  2DTO A;  3MET A;  2MWP A;  1Q81 R;  2X3W D;  1VIF A;  5FU6 B;  1TTH B;  4N4G A;  1EX4 A;  4JPB W;  1HSQ A;  4L6V 5;  4F7U F;  1U8R A;  4JLI A;  2VV5 A;  1I8F A;  4M78 E;  3AHU A;  1M8V A;  2AKK A;  2CP7 A;  4F17 A;  3A8M B;  4E7L A;  5HKC A;  5C6S A;  3PMI A;  1F1B B;  2H8H A;  2EYY A;  4LDW A;  3QUI A;  2DNU A;  1SRL A;  5I2S A;  2KRM A;  3CCS Q;  2EJF A;  4XK8 E;  1D0Z A;  4ATO A;  4C0G A;  2KDS A;  1NM7 A;  1WHM A;  1YJ9 T;  3OBW A;  1X2K A;  1CKA A;  1VQM A;  1SSF A;  2OAW A;  1X75 C;  3C0C A;  3CCE A;  4M75 B;  1UUE A;  1TUC A;  2KT8 A;  4KUL A;  5AYF A;  5CVI A;  1I4K 1;  4C5H A;  2XU8 A;  3I55 A;  3L2V A;  2SEM A;  1Q82 R;  4ZN3 A;  3M0U A;  2HKN A;  5A0L A;  3JV3 A;  4OMF B;  1M27 C;  1HYO A;  3M54 A;  2LQW A;  1AWX A;  2DE0 X;  2AKL A;  1VQ7 Q;  1LOJ A;  2PUK B;  3JCM e;  1K73 C;  1OOT A;  2D8H A;  1UGQ B;  4PJL A;  3C94 A;  1QW1 A;  5D7U A;  4PJO D;  1K9M R;  2EQM A;  4OMN A;  4RTU A;  2L2P A;  2IIM A;  3CBP A;  3CBM A;  2BTT A;  4HVV A;  2YRV A;  1VQ6 Q;  1C1A A;  4PJO F;  1QCF A;  3CCL T;  3OS5 A;  3TQ7 P;  2DPP B;  2DTI A;  4FW1 A;  1WQW A;  1LVK A;  2KXD A;  1UE9 A;  1MGQ A;  1X2Q A;  2BIV A;  1AEY A;  1Q86 U;  3TCJ A;  1UGV A;  5GAN 7;  2B8A A;  3CPW P;  2KMT A;  1OV3 A;  2EYQ A;  5HK0 A;  4PJN A;  4FM4 B;  4M78 A;  3H9N A;  2BKD N;  1NJI C;  2LVM A;  3VUZ A;  4LDY A;  3OYI A;  2BUD A;  3PIP A;  3U23 A;  3CC4 T;  4AFQ C;  1BK2 A;  2VUB A;  1Y07 A;  4AFS C;  1D3B B;  3CMA A;  4WTO B;  3RER A;  1GXI E;  3EFO A;  2RI2 A;  4DOW A;  4HT9 A;  2WSF E;  3FJ5 A;  4E7K A;  4J83 A;  1PNJ A;  2KEA A;  5CK9 A;  1NE8 A;  1XJW B;  1RI0 A;  3I5R A;  1QMC A;  3CCU Q;  3O8V A;  4J9G A;  4E2F B;  1HK9 A;  1JQQ A;  2HZY A;  1JU5 C;  4HKE A;  4M7A G;  2K2M A;  4BY6 B;  5LJ3 g;  5EC7 A;  2DZ9 A;  3H6Z A;  2ROT A;  2ZAE A;  4ZGD B;  1VQ5 A;  2LX7 A;  3EG0 A;  2Z0W A;  1WPY A;  2KE9 A;  1HJD A;  2OTJ A;  4IIO A;  2LT4 A;  3OYY A;  4M75 A;  5FRN A;  3G71 T;  4M77 E;  2RQV A;  2CUD A;  1Y57 A;  3JCM b;  2P4T A;  1TU0 B;  5LJ3 d;  2M51 A;  3PMT A;  5D6W A;  1GL5 A;  1RAF B;  4IUU A;  1Q7Y U;  4EPC A;  3CC4 A;  3WVE B;  4FYX B;  4RMO A;  2C06 A;  3MPU B;  4B6M A;  1YI2 T;  4BI4 A;  4KT0 E;  3CC7 Q;  5L23 A;  1SEM A;  1AOJ A;  1NEB A;  3CC2 T;  3VS0 A;  8ATC B;  2DBK A;  1MMN A;  3G4S A;  2VGN A;  2FYK A;  1VQK Q;  1B3Q A;  1YWP A;  2AHJ B;  2KT1 A;  2GF7 A;  1T3L A;  5HY6 A;  4J6W A;  5IH2 A;  3UT1 A;  2ABL A;  2EKO A;  2ZPB B;  3RUX A;  5HCK A;  1YN8 A;  4KGX B;  5FU6 C;  1YJW A;  5CO7 A;  1IRE B;  3JRZ A;  3REA B;  1CSK A;  2AZV A;  1VQN T;  2CP3 A;  4M7D B;  1N5Z A;  5CQX A;  3L2W A;  2QTX A;  1Q7Y C;  4LDX A;  3MKD A;  3CC2 A;  1PD1 A;  1YIT T;  1D3B A;  5GMK m;  1VQP A;  5LJ5 h;  1N27 A;  3PT9 A;  3N5B B;  4OMP A;  4C8Q E;  1B34 A;  3EG2 A;  1YHQ Q;  2DTH A;  5CKE A;  3SWN B;  1MHN A;  3X25 B;  1Q86 R;  2QTV A;  2RQR A;  3JCM P;  4FT2 A;  5FU7 B;  3DB3 A;  1YNZ A;  4M75 C;  1PRM C;  3NHN A;  3GOX A;  4AG2 C;  1VQM Q;  3OS0 A;  3M0S A;  1VUB A;  4XTV A;  4C92 E;  4Z8A A;  2M0Y A;  4CRI A;  4A4G A;  3CCE Q;  1NEG A;  1M3B A;  1VQ8 T;  2C0O A;  1Q95 G;  1KK7 A;  3I55 Q;  3BFM A;  1SHG A;  1W70 A;  1G3W A;  2I0N A;  5AT1 B;  1WHL A;  1BU1 A;  2YUQ A; 
#chains in the Genus database with same CATH homology
 2P0K A;  4ZGJ B;  5LJ5 e;  2LDM A;  3ASK A;  5LJ3 f;  2DIG A;  2DD5 A;  1YIJ T;  3QXE B;  3LW5 E;  1YJW T;  3CEY A;  3FDR A;  1TH7 A;  3L2Q A;  1G5V A;  4RG2 A;  1K73 U;  2YHT A;  2CYZ B;  4V2S A;  5J3B A;  3LH0 A;  4M78 F;  5J39 A;  5D6Y A;  3CCS T;  2JN0 A;  3C4S A;  2RHZ A;  4KBM B;  3OMC A;  4C8Q C;  2EWN A;  2O4X A;  2DZC A;  4MDW A;  4JJN K;  2QQR A;  1KHI A;  2D0Q B;  3M4Y A;  4M7D G;  2QA4 A;  4DOV A;  1N8R U;  5GMK j;  4DA4 A;  1JRI A;  3VKI A;  3E9G A;  4CI0 C;  3CCV T;  1KD1 C;  1UGR B;  4PJO A;  3DLM A;  1VQP T;  4Y28 E;  5KE2 A;  2ZGW A;  3X26 B;  2CKK A;  2XHC A;  1VQ8 A;  2F5T X;  5IT9 E;  1Q82 U;  1UEB A;  4PLI A;  5EG2 A;  2ZPF B;  5GAN g;  3MP1 A;  4JRQ A;  4QVC A;  4OB0 B;  3M53 A;  1Q81 C;  1IZ6 A;  3GLX A;  3A8H B;  3L2Z A;  4JRP A;  2DD4 A;  4FU6 A;  4C92 C;  1YCY A;  3VJP A;  5GAN 3;  3CCU A;  3UPU A;  5DY9 A;  3HRT A;  3M4G A;  5GAN 5;  4HT8 A;  3FC3 A;  2LT1 A;  1XQH A;  2RM4 A;  3J80 E;  3CCR T;  4LDV A;  1ZQ1 A;  3OYJ A;  4A4F A;  2Y4Y A;  4E7J A;  2WSC E;  2XI9 A;  2RJC A;  4PKC C;  3SDZ A;  1NJI U;  4JRK A;  2DKG A;  2LRQ A;  3MHX A;  1K9M U;  4IKF A;  4ELY C;  4XU1 A;  1KG1 A;  2RI3 A;  2NLU A;  1VQ7 T;  1G3T A;  5GAN d;  2GFA A;  3RKX A;  1NPR A;  2CZ7 B;  4IUR A;  2EJ9 A;  3NTH A;  4IUT A;  5LJ5 g;  2X4J A;  1S72 T;  2M1H A;  2MMP A;  1UGS B;  3OQ5 A;  4LD9 K;  4EMK C;  2QEX T;  2DEQ A;  2LC4 A;  3M57 A;  3JB9 G;  1QVF A;  1BI3 A;  1P92 A;  4BY6 C;  1FWZ A;  2M9U A;  5GAM j;  4FIB A;  3A5Z B;  2ZPI B;  5L8R E;  2HNI A;  2HD0 A;  3VU3 C;  2KVQ G;  3JB9 J;  3QDR B;  2K3Y A;  3LGF A;  3TU4 K;  2RJD A;  3QII A;  3CCJ A;  4ZN1 A;  1WJR A;  3X20 B;  2YLB A;  1VQ6 T;  2KY9 A;  1QVG A;  3L2R A;  2JUF A;  2G3R A;  3MEV A;  3PNW C;  4C92 A;  5GAM g;  4BDZ A;  3FB9 A;  4ZTF A;  4C0F A;  5DLQ E;  4KUI A;  3CCV A;  1Y96 B;  2FHD A;  4M78 G;  3RMS A;  5LJ5 d;  3DB4 A;  4M7D E;  4BI8 B;  5CR2 A;  5C0M A;  3OW2 A;  3CC7 A;  2RI5 A;  1N8R C;  1YJ9 A;  4RKU E;  2X35 A;  2JTF A;  4J7I A;  3V8K A;  1N9R A;  4R55 A;  3BW1 A;  2KSS A;  5A2Q E;  4E47 A;  1QP2 A;  4C0D C;  3RES A;  1KQS S;  3HRU A;  3PFS A;  5GAO q;  1VQK A;  3OYK A;  3CCR A;  4LDU A;  1KC8 U;  3MP8 A;  4NOY A;  1U1S A;  3TRE A;  3M58 A;  1M1F A;  4XTU A;  2GQV A;  3JCM J;  4B9X A;  1OZ3 A;  3QZ9 B;  2QA4 T;  1OYX A;  4QVD A;  3JCM W;  2L5Q A;  2F5K A;  3CXC S;  1BKB A;  3SB2 A;  4OVA A;  2PQW A;  2XD0 A;  2QDY B;  3V7S A;  1WJS A;  3OBY A;  2Y4X A;  3VUB A;  3P8D A;  3UDC A;  4D6W A;  2RHU A;  3A8G B;  3OSV A;  2RJF A;  3R6O A;  3DLL A;  2D9T A;  2QQB A;  3MP6 A;  4RCC A;  2K3X A;  3INZ A;  2DO3 A;  3SFM A;  4C5E A;  4F7U B;  2K2V A;  2K5I A;  2DXU A;  2CZ1 B;  3RMQ A;  3G7Z A;  4N4H A;  4NS5 A;  4L59 A;  5M9O A;  3CCU T;  3WXM B;  1N6A A;  2L3R A;  1YBY A;  2E64 A;  4ZTJ A;  1B34 B;  1KQ2 A;  2GFU A;  2QQ9 A;  2X4Y A;  4EMG A;  2DTO A;  1K8A U;  4M78 D;  3MET A;  5CKH A;  2MWP A;  3ME9 A;  4L5G A;  4EMH A;  3HFN A;  3CME A;  1VIF A;  2PVO B;  4N0A C;  5CKB A;  5FU6 B;  4C5I A;  1W4S A;  3GPL A;  3FIF A;  4N4G A;  4L6V 5;  2XDP A;  2VYT A;  4F7U F;  1U8R A;  1LNX A;  3PTA A;  2YLC A;  4JLI A;  2PUO B;  2VV5 A;  3MCA B;  1I8F A;  5A0G A;  4M78 E;  4J7F A;  3CCL A;  2DXC A;  3G6E A;  3AHU A;  4BB7 A;  1M8V A;  2EQU A;  1H3Z A;  4M77 B;  4M7D C;  3A8M B;  4E7L A;  1QVP A;  4YTL A;  2M16 A;  5KCH A;  5HKC A;  2DIQ A;  3JCM h;  3FJP A;  3MEU A;  3PMI A;  5C6S A;  4M77 D;  2DVE A;  1KHC A;  3ER0 A;  3JCM X;  4LDW A;  3QUI A;  1W2B A;  3M9Q A;  3JB9 H;  1VQ4 A;  4A4E A;  5I2S A;  2EJF A;  3CCJ T;  3S3N A;  5GAN j;  4XK8 E;  3BDU A;  3I56 A;  3CD6 A;  4XAX B;  3P8B B;  1KC8 C;  3C12 A;  3C95 A;  4C0G A;  4JS5 A;  4ATO A;  4M77 F;  2KDS A;  3S3M A;  3GNG A;  4PLL A;  5CKF A;  5CCA A;  5IAY A;  1G3S A;  2JTM A;  3CC7 T;  5LJ3 h;  2R58 A;  1YJ9 T;  4JS4 A;  1I81 A;  3OYH A;  3OBW A;  4MZP A;  3SWN C;  4N0A A;  1SSF A;  1VQM A;  3CPF A;  2E70 A;  1X75 C;  2FB7 A;  5LL6 S;  1HXD A;  3CCE T;  3CCE A;  2DAQ A;  5CKD A;  4M75 B;  2ZPG B;  1NZ9 A;  5FU7 C;  3JCM V;  4KUL A;  1VQK T;  3QHS A;  5AYF A;  5CVI A;  3A8L B;  1M4Z A;  4J6X A;  3URG A;  1I4K 1;  2VC8 A;  4M75 D;  5GMK l;  3ZEH A;  4C5H A;  5LJ5 j;  2XU8 A;  3I55 A;  4M7D A;  3MEW A;  3L2V A;  5CQY A;  5GAN f;  2EAY A;  3HP9 A;  4M7A B;  2EQJ A;  4WF2 A;  3DKM A;  3EFR A;  4ZN3 A;  2H3J A;  3M59 A;  1K8A C;  2VXF A;  2O4X B;  3RKW A;  4M7A D;  5A0L A;  3L1A A;  2XDB A;  2P0Q A;  3BDL A;  2RHY A;  4OMF B;  5A0D A;  4E7I A;  3HSB A;  3LGL A;  4M75 F;  3NTK A;  1M9S A;  2OAU A;  4MML A;  4KUD K;  3E19 A;  3M54 A;  2XDD A;  2E5Q A;  4X9D A;  3X28 B;  3QSU A;  4IUP A;  3HFO A;  1JJ2 S;  1LOJ A;  2PUK B;  3JCM e;  2Y90 A;  4VUB A;  3QBY A;  1K73 C;  1UGQ B;  4PJO B;  2X4X A;  1ZHI A;  2EQK A;  1QW1 A;  3C94 A;  4M7A F;  4M78 C;  1BIB A;  4B9W A;  2L8D A;  4PJO D;  2XID A;  5GAN 4;  3V8L A;  4IUQ A;  3SWN A;  2EQM A;  3HL8 A;  4LD6 A;  3RKY A;  3GP8 A;  4F7U G;  5LJ5 f;  3G71 A;  1X6O A;  2LQ8 A;  3CBP A;  3CME T;  3OYC A;  3CBM A;  4FSX A;  4HT9 A;  1FXX A;  3QO3 A;  1XOV A;  1JB0 E;  2M0O A;  3QKJ A;  2YRV A;  3EFS A;  3L2U A;  4NL3 A;  3OYM A;  5LJ3 e;  4PJO F;  3LWH A;  2MI6 A;  3OYF A;  1WQ7 A;  3CCL T;  3OS5 A;  1WGS A;  2DPP B;  2DTI A;  2HBP A;  2HQE A;  2R5A A;  4X9C A;  3OYE A;  3G6E T;  1BYM A;  2DXB A;  1WQW A;  4N4I A;  2O01 E;  1MGQ A;  1Q82 C;  3QYH B;  5DLO A;  1YI2 A;  4C8Q B;  1BI0 A;  2OTJ A;  1VQ4 T;  3A8O B;  2BIV A;  2LNV A;  3BY7 A;  5GAM f;  4XTY A;  1Q86 U;  2DJZ A;  3TCJ A;  4C8Q D;  3QJY A;  3ZBD A;  1DJ7 B;  5GAN 7;  2B8A A;  4M77 G;  1YHQ T;  2KMT A;  1KQS A;  5CAI A;  3CCM T;  2JNG A;  2EYQ A;  4X34 A;  2L89 A;  3H8Z A;  4DQ2 A;  4F7U A;  3I56 T;  3S3O A;  3CD6 T;  2WAC A;  3HKS A;  5HK0 A;  1V29 B;  2K5F A;  4FM4 B;  2DXT A;  4M78 A;  3RIR A;  2BKD N;  3T9N A;  3JB9 I;  1WNL A;  1UGP B;  4C8Q F;  2LVM A;  1NJI C;  3CXC A;  1K9M C;  1VQL A;  4NL2 A;  3VUZ A;  2KK4 A;  4LDY A;  3OYI A;  2BUD A;  2ZPE B;  3PIP A;  3LX7 A;  1LJO A;  3M56 A;  3OS1 A;  4C92 B;  2IVW A;  2VUB A;  3CC4 T;  1VQM T;  1VQO A;  2CZ6 B;  1Y07 A;  4J5Y A;  3OYA A;  1D3B B;  3CMA A;  5GMK i;  4BE1 A;  3RER A;  1H64 1;  4XU3 A;  1GXI E;  1VQ5 A;  2RI2 A;  4QQ6 A;  5I21 A;  4P5N A;  1PSE A;  3CPW S;  3JCM g;  3F70 A;  4PNO A;  2WSF E;  3VYG A;  1BI1 A;  2QI2 A;  4DOW A;  5GAN 6;  3OS2 A;  4E7K A;  4J83 A;  4M77 A;  5CK9 A;  5IN1 A;  4J6Y A;  1RL2 A;  1NE8 A;  1N9S A;  2EIF A;  3I55 T;  1RI0 A;  4M75 G;  3NFC A;  2QQA A;  5GAN 2;  1VQ9 T;  3O8V A;  2E65 A;  3V7R A;  1M1G A;  2PU9 B;  2R57 A;  1Y7X A;  3GF5 A;  4C92 F;  1HK9 A;  4F7U E;  5GMK e;  4BE0 A;  2HAX A;  4OB1 B;  2JVV A;  4FT4 A;  4OP0 A;  4RCB A;  3JCM c;  4EMK B;  3FRN A;  1VQN A;  1JJ2 A;  4HKE A;  4XU0 A;  4M7A G;  2XG8 D;  4BY6 B;  5LJ3 g;  3MEA A;  2DZ9 A;  3H6Z A;  2K57 A;  4JLG A;  2RA2 A;  4Y91 A;  1AHJ B;  4JRI A;  3JCM d;  4Q5W A;  2F69 A;  2JZ2 A;  3VYH B;  3KBG A;  3OYD A;  1O75 A;  1JBM A;  3QYG B;  3X24 B;  4ZGD B;  2MF2 A;  1YHQ A;  2V8K A;  3VV0 A;  5GAO p;  2EJG A;  2RH2 A;  5GAN 8;  3CCM A;  4JDS A;  1YIT A;  2ZPH B;  1WPY A;  1ZBX A;  3PIO A;  1O9S A;  4GLK A;  4PJO G;  2LT4 A;  5GAO m;  2P0P A;  3KUF A;  3OYY A;  2RHX A;  4M75 A;  2X4W A;  1XNI A;  2LCL A;  4M77 E;  3V7C A;  5HK3 A;  3G71 T;  5FRN A;  2RJE A;  3JCM b;  2P4T A;  3J81 E;  4XTX A;  4HA8 A;  1M1K U;  5LJ3 d;  4BUG A;  3PMT A;  5D6W A;  2FVU A;  4MMK A;  5KE3 A;  4OGC A;  3TEE A;  5GAO r;  3GNF B;  4IUU A;  1Q7Y U;  2VXE A;  3HHT B;  3S6W A;  2CS7 A;  4EPC A;  1XTD A;  1W2B S;  3CC4 A;  4M7A A;  3WVE B;  4C0D B;  1OZ2 A;  4RMO A;  4QQD A;  2C06 A;  2GCX A;  5J26 A;  1BIA A;  3GIB A;  3KXT A;  3QG1 A;  4BDY A;  1YI2 T;  4BI4 A;  4KT0 E;  3SD4 A;  2RK2 A;  3WVD B;  3ZFJ A;  2XK0 A;  2RD1 A;  5GAM e;  3CCQ A;  2LTO A;  4RG8 A;  3CC2 T;  5KCO A;  4E7H A;  4MDX A;  3LLR A;  4C8Q G;  1EIF A;  2E12 A;  1VQ9 A;  3G4S A;  2VGN A;  2FYK A;  5GAO n;  2OTL T;  2AHJ B;  2IG0 A;  3CBO A;  2CZ0 B;  4M75 E;  3L42 A;  2A7Y A;  4A53 A;  2GF7 A;  4MZM A;  1VQL T;  4XTZ A;  5HY6 A;  4EDU A;  1Y96 A;  4TVR A;  4J6W A;  2E1H A;  3OYN A;  1VQO T;  3CMA T;  4M7A E;  1G3Y A;  3LYI A;  3UT1 A;  3OMG A;  2EKO A;  3V8J A;  2DK3 A;  4C0Z A;  1UB4 A;  2MAM A;  2ZPB B;  4IUV A;  2V8J A;  4C92 G;  3M55 A;  2E6N A;  5FRM A;  3RUX A;  1WJQ A;  4UC4 A;  4C5G A;  2K5L A;  4XQ3 A;  4C8Q A;  5FU6 C;  1YIJ A;  5CO7 A;  3P8H A;  1YJW A;  1IRE B;  2QQS A;  4ME7 A;  1NPP A;  5GAN h;  3QZ5 B;  2HQX A;  3JCM Q;  1QVF S;  3J7A F;  5GMK h;  4A54 A;  4PJO E;  4ELZ C;  4R56 A;  2ZZD A;  2RB6 A;  3JRZ A;  1YJN T;  2E6Z A;  2KQW A;  3CCS A;  1VQN T;  4O6J A;  4M7D B;  3M5A A;  1M90 U;  5CQX A;  4M77 C;  2CGH A;  3L2W A;  1KQ1 A;  1M1K C;  3OSS C;  3OA6 A;  4M7D D;  1M5Q 1;  2E10 A;  3OB9 A;  2QTX A;  3QPH A;  4OGE A;  1QVG S;  2QXF A;  3OYB A;  1Q7Y C;  4HCB A;  4LDX A;  3MO8 A;  2I2L A;  3LWI A;  2RK1 A;  4BD3 A;  4MZT A;  2ZCF B;  3CC2 A;  1QP3 A;  1Y71 A;  2KAF A;  1VQ5 T;  1YIT T;  1D3B A;  3OW2 S;  2A3L A;  4O5V A;  4PL6 A;  5GMK m;  4JUV A;  1VQP A;  5LJ5 h;  3EAE A;  4M7D F;  1N27 A;  3PT9 A;  2OTJ T;  3PGG A;  2RHI A;  3N5B B;  2OTL A;  3NTI A;  2JOY A;  4II1 A;  4ZGE B;  2MWO A;  4C8Q E;  1B34 A;  4QVZ A;  2PVG B;  2DTH A;  3FLG A;  5CKE A;  3SWN B;  2R5M A;  1MHN A;  3X25 B;  4HCC A;  4J8O A;  1Q86 C;  4A4K A;  2K4Y A;  4BAC A;  4OF1 A;  3JCM P;  4FT2 A;  5FU7 B;  4QW2 A;  3DB3 A;  4M75 C;  4XTW A;  4C92 D;  4QQG A;  2WSE E;  4EMK A;  5GAO l;  2D6F A;  5GAM d;  1KD1 U;  5GAM h;  1R8O B;  3GOX A;  3OYL A;  3CCQ T;  4GY5 A;  3CPW A;  3QJ6 A;  2XKO C;  4A4H A;  3OS0 A;  3E1S A;  2EFI A;  4OB3 B;  1U1T A;  5D6X A;  1FX7 A;  1VQ7 A;  1VUB A;  5LJ3 j;  2FL7 A;  4XTV A;  4M7A C;  4C92 E;  5GAN e;  4CRI A;  1Q81 U;  4A4G A;  3JAM E;  4BI3 A;  3G4S T;  1S72 A;  4XU2 A;  4HCZ A;  3JB9 D;  1VQ8 T;  2QEX A;  1YJN A;  5FRO A;  4FL6 A;  3Q1J A;  1PSF A;  1VIE A;  3JCM f;  5I2M A;  4BE2 A;  3JSC A;  5FLX E;  3OY9 A;  3BFM A;  2LX9 A;  3HPW A;  2V8I A;  1X01 A;  1BI2 A;  4Z02 A;  3FEO A;  2LCC A;  4PJO C;  4M78 B;  3HRS A;  1G3W A;  1M90 C;  3JB9 F;  5KH6 A;  1VQ6 A;  2XIC A;  5DM7 R;  2PVD B;  2E41 A;  2LQK A;  2RO0 A;  1I5L A;  2VGM A;  3UWN A;  1OI1 A;  4OB2 B;  3E9F A;  3OYG A;  5CIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...