2RJFA

Crystal structure of l3mbtl1 in complex with h4k20me2 (residues 12-30), orthorhombic form i
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
315
structure length
315
Chain Sequence
b'WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 78
structure length 315
sequence length 315
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjfA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjfA03
4QVZA 4PL6A 2K3XA 1H3ZA 4N4GA 3PFSA 3OYBA 3OYAA 3OMCA 2K3YA 3OS1A 2M0OA 3S3OA 3DB4A 3L2VA 1WGSA 2RO0A 4QW2A 2PQWA 5KE2A 3C4SA 4B9XA 5J26A 2M16A 2RI2A 2DIQA 2RHIA 2RHYA 4QQ6A 4C5EA 2EQJA 2LRQA 3QKJA 1RI0A 3QJ6A 2F5KA 3BDLA 2MWPA 2RJFA 2DIGA 3MEUA 2R58A 3NTIA 1MHNA 3OYEA 3MP8A 4IUQA 2RI3A 4E7LA 4PLIA 3E9GA 3OYJA 3OS0A 3L2WA 2L8DA 3H6ZA 4A4FA 3S3MA 3UWNA 3F70A 4A4EA 2O4XB 5C0MA 3P8HA 1SSFA 3S3NA 2RJDA 4ZTFA 3LLRA 2JTFA 2LTOA 1WJRA 3PMTA 4QQGA 5D6YA 1OYXA 3OB9A 3OQ5A 2IG0A 4Q5WA 4BE0A 4ZTJA 3FLGA 2EQKA 3QBYA 4PLLA 5FROA 3GOXA 4CRIA 3L42A 3OYNA 3Q1JA 3MO8A 5KCOA 3DLMA 2GF7A 3DB3A 4A4HA 2XDPA 3CEYA 5D6XA 4LD6A 3OYIA 3LH0A 3ME9A 3FDRA 1OZ3A 5KE3A 2LDMA 4BE1A 4GY5A 4N4IA 5M9OA 5FRMA 3H8ZA 1WJQA 4C5IA 3S6WA 3OYLA 2X4WA 4IKFA 2MWOA 3MP1A 4A4GA 4HCZA 3L2UA 2YRVA 3ZEHA 2D9TA 2GFAA 3L2QA 4IUTA 3ASKA 3MEWA 2R57A 3EAEA 3UT1A 2FHDA 3LX7A 4N4HA 1N27A 2BKDN 2QQSA 2VYTA 1KHCA 4BD3A 2P0KA 3LGLA 2DAQA 5FRNA 2XK0A 2LCCA 2BUDA 2X35A 5D6WA 5IAYA 4FU6A 2QQRA 4IUVA 3OY9A 2E6NA 2O4XA 2L89A 5IN1A 3NTHA 2R5MA 4FL6A 2RHZA 2RHUA 2X4XA 2WACA 2RHXA 2EFIA 3PMIA 4IUUA 4L59A 2GFUA 2R5AA 4OVAA 3L2RA 4EDUA 2B8AA 2CKKA 4B9WA 2RJCA 3KUFA 3FEOA 3OYFA 4E7KA 2JZ2A 3OYDA 3FC3A 2G3RA 1XNIA 4C5HA 1OZ2A 4E7HA 3OYKA 4IURA 1OI1A 3MP6A 2BIVA 3META 4Z02A 3OYHA 4QQDA 4BACA 2X4YA 3OYGA 5KH6A 3PNWC 4C5GA 5J39A 3LYIA 4BDZA 1WJSA 3O8VA 4II1A 3LGFA 5CIUA 4IUPA 4X34A 2RJEA 2L3RA 4E7JA 4RG2A 2EKOA 2EQUA 2HQXA 4BE2A 4E7IA 2M1HA 2HQEA 3MEAA 2LVMA 3NTKA 5KCHA 4BDYA 3OMGA 2NLUA 3E9FA 3SD4A 3OYMA 1G5VA 4NS5A 3MEVA 3OS2A 2EQMA 3M9QA 3QIIA 4UC4A 2RI5A 5C6SA 3P8DA 3OYCA 3OA6A 2E5QA
chains in the Genus database with same CATH superfamily
1VQ4Q 3OW2A 4JS4A 3OYBA 1X6BA 3G6EQ 1WGSA 2E6ZA 4B6MA 2PQWA 4XU1A 2CSIA 2NWMA 3TU4K 4ESRA 3BDLA 4N0AC 4OMFB 2DO3A 1KC8C 1WHGA 2QXFA 2AIRB 5C0MA 3PE0A 1VUBA 1GL5A 1X43A 3EGUA 1VQLQ 1OYXA 3PVLA 2DE0X 3OQ5A 4LDUA 2KK4A 1AWXA 4L6V5 1K4US 2CT3A 2YT6A 4CRIA 4TVRA 1HSQA 5I2SA 3GNGA 1FX7A 5CKFA 1AZEA 2RNAA 5GAMe 2ESWA 2J7IA 4F7UA 2YWWA 1RABB 5GAOl 1ZUKA 5FRMA 3MP1A 2ZPIB 3CBOA 3A5ZB 2ZPEB 3X24B 4J9BA 3G71T 1G3WA 1K73R 3LGLA 2KMTA 2ZPBB 1YJWA 4Z88A 3KFVA 4F17A 1P92A 1RACB 2V8JA 2RHZA 2RHUA 4F7UE 2KQWA 2E3HA 1KQ2A 4Y91A 1YITA 2W0ZA 4EDUA 1D09B 1PSEA 3H0FA 3OYDA 4FCYA 4J9GA 4C0DC 2DZCA 2JOYA 5KYXB 4E6RA 2VKNA 2EKOA 2XMFA 2L0AA 4DEYA 2KT1A 3EGDB 3OMGA 1KQSA 4BY6C 5GJVB 2EQMA 4UC4A 5HCKA 2O2OA 4LUDA 3M55A 3PFSA 1ZSZB 1IZ6A 3CCRA 4E7SA 2J6OA 3A8OB 4M78A 2DXBA 2F1LA 2O31A 3M4YA 2RJFA 4LDWA 1VQKA 4PKCC 2OTLQ 1O75A 1X69A 1SSHA 2E10A 4XTXA 2EVRA 1VQ4A 1W4SA 1NM7A 1RAEB 2O4XB 1M3CA 3P8HA 4FM4B 3G6EA 1JJ2P 1WJRA 1M3BA 2K2MA 4C92G 4QVDA 4M78E 5IHNA 5A0GA 3OYNA 4PJOF 3DLMA 3DB3A 4A4HA 2C0IA 2CP0A 5FU7C 2V1QA 3M0PA 4GLMA 4JZ4A 5IXFA 5CAIA 3OS5A 2X3XD 1UGPB 4HT8A 1Q86C 4RTXA 3CCVT 3NFCA 4HCZA 1VQOT 3ZEHA 3VS6A 1OQKA 3LX7A 3JB9J 1UHCA 2CP2A 4BD3A 2JT4A 1ARKA 2F2WA 1VIEA 4XU2A 2DILA 4C92C 1XJWB 1QKWA 4OB3B 3NTHA 1NYFA 1N9RA 1QW1A 4M7DG 2DXCA 2CDTA 2EGAA 1MUZA 3H0HA 5CO7A 1TG0A 4ORZA 1H92A 4PJOA 3PT9A 3TCJA 5KH6A 1Y07A 3OW2P 2QEXQ 2HKNA 1LJOA 2E70A 3M4GA 2HQEA 1GXIE 1MGQA 2YUOA 2QDYB 3G4ST 1YWOA 1R77A 3CCMT 1GCPA 2BZYA 4KUDK 1W70A 2V8KA 3OYAA 1M90R 3OS1A 3C12A 3E2UA 4PJOE 4CI0C 3L2VA 3CCEQ 2L3QA 2RO0A 1SHFA 1FMKA 3R6NA 3VRZA 1B34A 1TUCA 2PUKB 4DOWA 1RI0A 1Y0MA 2RA2A 4C0GA 1Y96A 2DFUA 2DIGA 1UG1A 2RPNA 4NOYA 1NBEB 4OGEA 1BKBA 2LQWA 4HVVA 2GTJA 3E9GA 3H41A 3L2WA 2DTOA 4OB0B 4J9FA 1VQ7T 2DJZA 4E47A 4PNOA 1M2VA 4V2SA 1WI7A 2XG8D 4Q5WA 3QWXX 3JV3A 3GOXA 4FT2A 3L42A 2RM4A 4J9DA 5L23A 1Q86U 2V1RA 3A1PA 3WVDB 2OTLA 1GCQC 2XHCA 5DM7R 3OW2S 1SRMA 1NPPA 1WDXA 4FSSA 2OTJA 2DEQA 1QLYA 1I07A 4M77C 2X4WA 1IXDA 3L2UA 3VS2A 4RTTA 3ASKA 2YRCA 3CXCP 1E7OA 5CK9A 2CP6A 1ZHIA 2KBTA 3GP8A 2FPEA 2LJ0A 3C0CA 3V7RA 1B3QA 1PRMC 4M7AB 1I8FA 3LW5E 5I22A 4L59A 3A8LB 2NUPB 1D1AA 2OI3A 1QCNA 4HCBA 1U06A 4DQ2A 2GBQA 2AT1B 3X26B 1UJ0A 4FT4A 4M75G 2FO0A 4FW1A 4A4KA 1M1KR 4J7FA 2EQUA 2HQXA 3SD4A 2LNHB 1KD1U 2HCKA 4QVZA 4QKUA 1UECA 4R56A 2EW3A 2D1XA 4JRQA 2KNBB 1VQ8T 3FIFA 5GAN8 2E41A 2QQAA 2QYZA 2QEXA 3VU3C 1QVPA 2DYIA 2EQJA 4NL2A 3VS0A 1G83A 1YJNQ 3QHSA 1W2BP 5GJWB 2A08A 4M75C 1MV0B 1OOTA 2EKHA 2RQTA 1AWJA 2XU8A 5DLOA 2HNIA 1B7TA 2RJDA 3CCEA 4ATOA 4NL3A 2FEIA 1RLPC 3UPUA 1K9MR 2DEUA 3VS1A 2YUPA 1KQSS 3FJ5A 2ZPHB 1B07A 5A2QE 3THKA 5LJ3j 5LJ5f 2FPFA 3M0UA 5AYFA 3BW1A 1OZ3A 3HP9A 4RG8A 1WXTA 2RMOA 3CCJT 2D9TA 1WQWA 4MZMA 3RUXA 1Z9ZA 2K5FA 4M77D 3HFNA 2YRDA 4DBFA 1FXXA 5IAYA 2PNIA 1K9MC 1VQNQ 2LNVA 4JJCA 2YSQA 2JM8A 2WACA 2EJGA 2CUDA 4C0DB 2PVOB 3M0RA 1W2BS 5D7UA 2DF6A 2M9UA 2DTIA 1G3SA 1JO8A 5KYNA 3FC3A 3CCUT 1M2OA 3JCMe 2KRSA 5GAOr 1JBMA 2E3IA 3BY7A 2LQKA 1M3AA 4C8QA 1NJIR 2XKOC 4F7UG 2IVWA 3HRTA 5J39A 4BY6B 4JLGA 1WJSA 5CIUA 3J7AF 3MJXA 4J8OA 1E6HA 1PC0A 2KXCA 2M1HA 5KCHA 1VQMT 3NTKA 1VQPT 1WNLA 1I81A 3JCMg 1E6GA 1UGSB 1JRIA 1KHIA 4DOVA 3BE3A 4X9DA 5KYUA 1M8MA 5GAOq 4C8QE 2QAZA 2A3LA 2ROTA 4Z8AA 3DLLA 5AT1B 3CCRT 2K79A 2RHIA 4FW2A 2MCNA 3AHUA 2B86A 1AWWA 4KT0E 1M30A 1XTDA 4JJDA 4Z89A 3CC4Q 3JCMX 1QP2A 4E7LA 1U8RA 1VQKT 1PD1A 1AZGB 4OMMA 2L8DA 3H6ZA 5FWCA 4BI4A 1F1BB 4ZTFA 3OBWA 3CC2Q 2E1HA 2JTFA 1KSWA 2GNCA 3CBPA 1WA7A 5FU7B 3CCQQ 4EMKA 3G6ET 1YJ9Q 2P4RA 1YJNA 2WSFE 2XDPA 1QVFP 4BUGA 2LX7A 1NEBA 5M9OA 2PU9B 2JS2A 1RUWA 1A0NB 4C92B 1O9SA 2FPDA 2FHDA 3EFOA 2BKDN 2HDAA 5IT9E 2KVQG 3J80E 3RMSA 5GANf 3FJPA 3MHXA 4IUVA 3EGXB 3T9NA 3G7ZA 4O6JA 1JJ2A 4RCBA 1EIFA 3E19A 4M78C 1YHQQ 1OZ2A 5GAN3 2EYYA 3U23A 4C5GA 4II1A 3VYGA 2V8IA 1M1FA 4J6XA 1VQNA 1WHMA 2CP7A 2NUZA 1ACMB 1NLOC 2EYZA 1BBZA 4RUGA 2ZPGB 2IIMA 1VQ6Q 1VQ9Q 3SB2A 1TH7A 5GAOp 5KYYB 1PWTA 1RAAB 4XK8E 3JB9H 1DJ7B 4Y92A 2RQVA 1V29B 2ED0A 2DL3A 2HKQB 3EG1A 1ZSZA 1EZZB 2R58A 4FYXB 4PJOG 3JCMb 4HT9A 1T3LA 1X2KA 3CPFA 4P5NA 1H641 3QSUA 3NHNA 5D6YA 4QQGA 1K9AA 2QGGA 2WSEE 1AEYA 3V7SA 1Q82U 4XAXB 1TS9A 1PSFA 3O5ZA 2KI7A 1M1GA 2QQ9A 3EG3A 5LJ3f 3X20B 4M77B 3CC4A 2F5TX 2LC4A 1D1CA 3LWIA 2VUBA 2OTJT 5KYWB 3CCLA 2R57A 2PVDB 3UT1A 4DA4A 5GMKh 1KHCA 3CCQA 1N5ZA 5J3BA 2P0KA 2DD5A 1RAGB 4J9IA 2LCCA 2P4TA 5DY9A 2JNGA 2VC8A 2CZ0B 4WCIA 4JJBA 1MNDA 1OPKA 3H9NA 2B8AA 2FZCB 1UJYA 1UTIA 3VJPA 8AT1B 2VXFA 5CKHA 1VQ5Q 4IIOA 1WHLA 3CD6Q 3JCMJ 3I56Q 1S72Q 4MMLA 1X2QA 2EPDA 3TEEA 4M78D 4X34A 1NYGA 2KY9A 2L3RA 1HD3A 4JS5A 1BIAA 5CKDA 3JCMd 3DKMA 3CMAQ 4KUIA 3TSWA 3OS2A 2DA9A 5FU6C 4CC3A 2ZZDA 2GQIA 2J06A 3CXCA 2GCXA 4KGVB 2JM9A 1YHQA 2QDLA 3JCMc 3S3OA 1VYUA 2YDLA 2CP3A 3SFMA 1IHVA 2M16A 1YI2Q 3OYYA 5HKCA 4M75B 1ABQA 4M7AD 2OX7A 2XIDA 3JCMP 2YLCA 2QEXT 1MHNA 4JRPA 3OYJA 1IGUA 5FLXE 1VQ6A 2VVKA 3F70A 4XTYA 4J7IA 3M58A 3LLRA 1ZBJA 2PUOB 3RDVA 1X01A 3CCET 5GAMf 2FRWA 4M7AF 2ENMA 3QYGB 1GRIA 3JCMh 2RB6A 2K7AA 1Q86R 1JXOA 4GY5A 2L5QA 1WJQA 4C5IA 3MCAB 4OP0A 5CCAA 2MWOA 4AFUC 2EGEA 2HSPA 1UGRB 2CT4A 2BZXA 2DRKA 4FYYB 3GNFB 2LCLA 2DX1A 2VYTA 4LE9A 1W2BA 2LP5A 4DEXA 2RK2A 1V1CA 4XTVA 2FL7A 2RK1A 3OY9A 4LUEA 1QVGP 1X27A 2WSCE 2X4XA 1PM3A 4OMOA 3I5SA 3AT1B 2CKKA 2RJCA 1PG5B 3GBQA 1BI1A 3URGA 1VQLA 2BIVA 1PCXA 1LOJA 2H8HA 5I11A 4HXJA 2LQ8A 2EYXA 3OA6A 1K8AU 2KXDA 1KD1R 2CYZB 2EJFA 4AFQC 3WXMB 3I5RA 1VQ5A 4WTOB 3G71Q 1OEBA 3I56A 1S72A 5GAN6 4RKUE 4MZPA 3LH5A 4XTUA 4Y28E 2OAUA 4QQ6A 1SEMA 2Y4YA 1JJ2S 4C8QG 3CMAA 2BE7D 3GF5A 4IUQA 1QVGS 2DM1A 4A4FA 1WHJA 4EMHA 4KGZB 4HCKA 4HCCA 1KD1C 2LX9A 1UB4A 1C1AA 3VUZA 1BK2A 2JVVA 2ZPFB 1YI2A 4M7DC 4PFPA 4FYWB 4CC7A 3CMEQ 3RERA 3HRUA 3PGGA 5I21A 1YJNT 3TREA 2CZ1B 3PIOA 1W1FA 4AFZC 3EG9A 1BCOA 4C8QC 1Y7XA 4A4GA 2ZAEA 4OMLA 2KEAA 1FMVA 2COYA 1CKBA 2COWA 3BDUA 3CC7T 2F2VA 2K57A 4C0FA 4XU3A 2BUDA 2L2PA 1QCFA 4ZGJB 2F2XA 4BI3A 2VGMA 2KAFA 3I55T 2A7YA 1N9SA 2FZGB 4M78B 3JB9I 4FYVB 3OSVA 3UF4A 4J9CA 1RI9A 1LCKA 1EFNA 2KSSA 3REBB 2EIFA 4IIMA 1QVFA 2CS7A 3H0IA 3QG1A 3O8VA 1D3BB 2QA4T 5FWBA 2NLUA 3EHRA 1VQNT 1MMDA 1AT1B 1IREB 3QWYA 4C92D 1FMWA 1JQQA 4KGXB 3REAB 1QMCA 4EMKC 2ABLA 2GTOA 5IXBA 2AKKA 3SWNA 2HSEB 1WXBA 2D0QB 2DIQA 2VV5A 1M9SA 1YNZA 2LRQA 3QKJA 3QUIA 4CC4B 2DVJA 1CKAA 1QWEA 2DYBA 1BI3A 3NTIA 1KK7A 1OX9A 3L1AA 3A8GB 1Y71A 5GMKe 3VS5A 5LJ5e 3G71A 4C92F 4FIBA 1ZA1B 1ABOA 2LTOA 5GMKi 3JCMQ 4K11A 5GAN7 2MOXA 2FB7A 2KE9A 1MMGA 4DBHA 1BYMA 3MPUB 4OGCA 3G4SQ 4ELZC 3CXCS 3CCMQ 4M7DD 2HBWA 5LJ5g 1GFCA 4EPCA 1S1NA 2SRCA 4KH0B 3H8ZA 3FB9A 4BI8B 4J6YA 1V76A 3JSCA 2Y4XA 4HVUA 3CCLT 3CMEA 3QYHB 3CCQT 2K6DA 3JB9G 2R5MA 4M7DF 4XTWA 1B34B 1U1TA 1JXMA 2KDSA 1T0JA 3L2RA 2HL3A 3PVQA 1VQ7Q 2V26A 1K0XA 1Y96B 3VS4A 1HK9A 1OI1A 3META 4QQDA 4PJNA 2CZ6B 3ZL7C 4BDZA 2FRYA 3TSZA 2KRMA 5FU6B 4BE2A 4E7IA 1M2VB 2LVMA 4JPBW 3OBYA 4WF2A 1YJWT 2EWNA 4ZNXA 2D8JA 2P0QA 1U1SA 3QDFA 1YCYA 1YITT 3WVEB 1YHQT 4MZTA 4C5EA 3INZA 4M77F 3QPHA 4LNPA 4JRKA 5IHKA 4RTWA 4E2FB 3QJYA 1PNJA 1KIKA 4PLIA 3HHTB 3C94A 1N8RC 3A8MB 3EH2A 3D7SB 1YIJQ 1JU5C 2YXYA 4JUVA 1HYOA 3S3NA 1AOJA 2HMAA 1VQ6T 5IH2A 4YTLA 2DXTA 2IG0A 2QASA 1QCOA 2I0NA 4JLIA 5FROA 1RAIB 4D8KA 2NUTB 1Q82R 1G3TA 4J83A 1KQ1A 2DLPA 4JZ3A 2LJ1A 1C6VX 5D6XA 1K0SA 2GQVA 3NPFA 3LH0A 5GANe 1GCQA 4J9EA 2QG9B 3VS7A 5KE3A 2LJ3A 1VQ8Q 3S6WA 4M75D 4M4ZA 2GGRA 4J6WA 1Q7YC 4M77A 1VQ4T 2K9GA 1M1KU 3CBMA 2C0TA 4GBQA 5FRNA 2DNUA 2JTEA 5GANg 3G4SA 3CCMA 1NZ9A 2QQBA 3NMZC 4QT7A 1TWBA 1SHGA 1D1BA 5KYWA 1Q82C 2GFUA 1GBQA 2L3SA 3FEOA 2X9HA 1GBRA 1GFDA 1XNIA 4F04B 1CSKA 4M77E 4M75F 2EJ9A 3QZ9B 2DL4A 1VQLT 3GLXA 2VASA 2AK5A 1PD0A 2EBPA 1N6AA 2YLBA 2RI5A 2HQHA 1D0ZA 2D8HA 3CCJQ 2FG0A 1XOVA 4RTUA 1X6GA 3OMCA 2QTVA 2AHJB 4VUBA 2MMPA 2X51A 1IO6A 3EG0A 1Q81C 2M02A 1QVGA 1U3OA 2AKLA 2X4JA 1J3TA 1N8RU 4OF1A 1UEBA 3VKIA 2VWFA 3CCUQ 5KYXA 1PRLC 3OS0A 2KYBA 2ZCFB 5HK0A 2LQNA 5CQXA 4M7DB 3S3MA 2EQIA 1K76A 2RQWA 5A0LA 1QVFS 2EGCA 1ZUUA 4EIKA 2M0YA 3EFRA 1MV3A 3OB9A 3EGDA 2I2LA 1VQMQ 1VQPQ 3GIBA 4OMNA 2RN8A 4R55A 2K4YA 5LJ5d 4C8QB 2JXBA 2MIOA 5LJ3g 2DZ9A 1Q7YU 4AG1C 2HEQA 2ZGWA 4OB1B 5GAOn 1KG1A 2KROA 3QXEB 3OYLA 3RBBB 1YIJA 1I4K1 1TUDA 4OMQA 3JRZA 3MEWA 1QKXA 2E65A 3VV0A 3RKWA 2RQRA 5KYUB 2QTXA 3RKYA 5GAN4 1VQKQ 3CCSQ 3V7CA 3JAME 2O4XA 5IN1A 3UATA 2HD0A 3EHQA 2RHXA 2R5AA 1VQ8A 2F69A 2OTLT 4ELYC 2JZ2A 2J6FA 4PJOC 4F7UF 1ZLMA 3HPWA 4DBQA 3CC2A 4IURA 2MK5A 4ANJA 4Z02A 4BACA 4X1VA 3ZFJA 1YJ9A 4MDXA 2DPPB 5LJ5h 1D0XA 3M54A 1YFNA 3A98A 1AHJB 1NLPC 4RTYA 1M27C 3QIIA 1AD5A 4EMKB 1T0HA 2DL5A 1Q81U 2C06A 1H3ZA 4PJLA 1K8AR 2MF2A 3JCMW 5HY6A 2C0OA 2M0OA 4HKEA 1Q95G 1ZSGA 1LNXA 2J6KA 2O01E 2Z0WA 3EFOB 2DBMA 2JJ9A 2HL5C 3CCJA 1SRLA 4XQ3A 1SSFA 5LL6S 1OV3A 1WPYA 1K8AC 4JJNK 5GAMg 3LWHA 4GLKA 4M78F 4R0KA 2VXEA 3CCUA 3CQTA 3ME9A 4JDSA 1R0CB 5A0DA 2QGFB 4XTZA 2CSQA 1WZOA 1RLQC 3ULRB 1VQ9A 1SPKA 2E64A 1SF9A 2EYQA 4IUTA 2W10A 2QQSA 1VQMA 1VQPA 1X75C 5GANd 3MKDA 1D0YA 1OU9A 2X35A 4RMOA 2QQRA 2E6NA 1K73C 3CMET 4FL6A 4IUUA 2DL7A 5I2MA 2YHTA 3KUFA 3SWNC 1VOMA 2G3RA 3OYKA 2XICA 2CUBA 4O5VA 2X4YA 4OB2B 1BCMA 4PJOD 1KC8U 3KXTA 4E7JA 3CCSA 2SEMA 4BDYA 3MEAA 1H8KA 1U5SA 3MEVA 1VA7A 1Z9QA 3P8DA 2E5KA 2E5QA 1YBYA 2DTHA 2OTJQ 1D3BA 4ME7A 1XQHA 2M51A 4L5GA 4QW2A 4M7AA 1SG5A 2KR3A 5J26A 5GANh 5GMKj 5EC7A 2NUPA 1RADB 5LJ5j 3CPWA 1BI0A 1W6XA 2MWPA 3MEUA 3UDCA 1JEGA 3KBGA 2LT1A 3UA7A 1M8VA 2D0NA 5GAN5 5CR2A 2O9VA 2LCSA 2E12A 3QZ5B 1RL2A 1UFFA 2H3EB 4ZN3A 4A4EA 1WQ7A 2BZ8A 3CD6A 3VS3A 4M7AE 1QWFA 3NGPA 2HZYA 4F7UB 1UHFA 1K1ZA 3P8BB 1YN8A 2CREA 5LJ3d 2GF7A 4OMPA 4PJMA 1I5OB 2CH4A 4N0AA 3FDRA 2IPOB 2G6FX 2O9SA 5FW9A 4N4IA 2L3PA 4C0ZA 2XD0A 4IKFA 3ER0A 3M53A 1QP3A 1WYXA 3M59A 1PKSA 3V8KA 1K73U 1N27A 4X9CA 2PTKA 1HXDA 2JN0A 2DRMA 4KULA 1G3YA 4A53A 2QI2A 5D6WA 4F16A 4RTZA 1G8XA 4LXCA 3EFSA 2FYKA 4RTVA 2EFIA 2K5LA 4B9WA 2EAYA 2DXUA 3UA6A 5EG2A 3LGFA 4IUPA 2RJEA 2K3BA 1UUEA 5LJ3h 4M77G 1TOVA 3EG2A 2PVGB 1AWOA 3E9FA 3GPLA 1MMAA 3M9QA 5C6SA 3PMTA 5L8RE 2YUQA 2MYSA 2CP5A 4PL6A 2K3XA 4XU0A 1JB0E 1KJWA 2JW4A 6AT1B 4JRIA 2K3YA 3BFMA 1IB8A 1WHHA 5KE2A 2K2VA 1Y57A 4B9XA 5CKBA 1VIFA 1M90C 3PTAA 3RNJA 1ZUYA 2Y90A 4PFZA 4E7ZA 4LDVA 2A37A 4HA8A 2RI3A 3V8LA 3CCVQ 1VQOQ 2O88A 3UWNA 1TTHB 1TUGB 5CKEA 3VRYA 4A54A 3HSBA 5GAMd 3HFOA 3M57A 5GANj 1BIBA 1UGQB 3RR6A 1NE8A 3Q1JA 2JMAA 3MO8A 1R0BG 4RCCA 1TU0B 3CEYA 2HBPA 4LD6A 1WXUA 2JMCA 3M56A 1LVKA 2LDMA 4BE1A 1IRXA 2LZ6B 3J81E 4F14A 4PJJA 1KQSP 2NUTA 4EMGA 3C95A 2DK3A 1ZQ1A 3L2QA 1YWPA 2PZ1A 1OU8A 2D6FA 1YIJT 3EAEA 2DERA 2DJQA 2J05A 2DETA 2RH2A 4AMCA 2FVUA 2VGNA 4PJOB 3RIRA 1OULA 1VYVA 4D8DA 4LDXA 4LDYA 4LN2A 2ED1A 3OYFA 3CC4T 4PK4A 2DBKA 2DVEA 3A8HB 3MP6A 1RAHB 5GAMh 3OYHA 4AG2C 1IGQA 2FZKB 2H3JA 4C8QD 3LYIA 3CC2T 2MAMA 2LT4A 2CGHA 2CH4W 3M0SA 1WIEA 1YJ9T 1FWZA 1WX6A 1M1KC 3OYCA 4C92A 3OYGA 3CPWP 2YUNA 1UE9A 5GAN2 3E1SA 2A36A 1M90U 1R8OB 3CC7Q 1H3HA 2AZSA 3RMQA 2XI9A 2BTTA 3EGXA 2RHYA 2ATCB 1ZSZC 3EG9B 4BB7A 3I55Q 4C8QF 4KBMB 1N8RR 4PFOA 4C92E 3OYEA 3MP8A 1C0MA 1TXQA 1PHTA 4LD9K 2VB6A 1ZBXA 2QA4Q 2OAWA 3RKXA 4ZTJA 1ZX6A 3FLGA 4PLLA 4M7DA 3V8JA 5KCOA 3X25B 2KGTA 2DD4A 5KYYA 3VUBA 4ZGDB 3HL8A 5ECAA 3N5BB 1EX4A 3I9QA 5DLQE 3OYIA 3CCVA 1WHKA 1NPRA 1VQOA 1Q7YR 5CVIA 4MDWA 3TQ7P 4QVCA 3RESA 2YRVA 3CPWS 2GFAA 1VQ9T 3VYHB 3G1JA 2ROLA 4M7DE 2XK0A 5GMKm 3X28B 3FRNA 4FU6A 1TSFA 3SWNB 4KH1B 1YCSB 2A0FB 3PIPA 2DKGA 2BE9B 4OVAA 3HTRA 3QDRB 3JCMV 3SDZA 4E7KA 2RQUA 4MMKA 5CQYA 4C5HA 1KFZA 4E7HA 1IHWA 4A63B 2NYSA 1LPLA 1PKTA 3PNWC 2KRNA 2AZVA 3L2ZA 1NJIC 3M5AA 1UDLA 3ZBDA 1SKUB 1OX8A 2A28A 3JCMf 2OJ2A 3CCST 2E4HA 2HAXA 1X6OA 4N4GA 1WFWA 1VYTA 1BB9A 1Q81R 2LMJA 5IHIA 2EYWA 3DB4A 3CCLQ 3EH1A 1UGVA 5GAMj 2K5IA 3C4SA 2MPXC 2RI2A 3QJ6A 2COZA 2F5KA 8ATCB 1NG2A 2QK0A 2XDBA 5HK3A 4M78G 2ECZA 4AFSC 3HRSA 1MMNA 3HKSA 2JUFA 1T3SA 4AT1B 1VQ7A 1I0CA 2MI6A 2DL8A 3CC7A 1K9MU 2KT8A 2JS0A 3QO3A 3SEMA 1BI2A 4ZGEB 2KYMA 2RD1A 1VQ5T 4BE0A 3CD6T 4CC2A 3JB9D 2EQKA 3QBYA 5GAOm 3I55A 1M4ZA 3TVTA 3I56T 3OSSC 1ZA2B 1S72T 1YJWQ 4ZN1A 1QQJA 4M7AG 1I5LA 1I1JA 1YITQ 3CMAT 4M75A 3SHWA 3IQLA 5LJ3e 1FYNA 1YP5A 1WLPB 2CZ7B 2QA4A 1HJDA 4N4HA 1NEGA 1RAFB 3R6OA 2DAQA 2XDDA 9ATCB 3JB9F 1MNEA 4D6WA 1YI2T 2L89A 4DBRA 4J5YA 3PMIA 4HVWA 4M75E 4J9HA 5GMKl 2X3WD 4M7AC 1NJIU 3CCRQ 1AVZC 1M5Q1 3I35A 1BU1A 2RF0A 7AT1B 2DMOA 2P84A 4KRTA 1OPLA 4RG2A 3M0TA 1KC8R 4FSXA 2JTMA 1G5VA 4NS5A 1G2BA 2P0PA 3M0QA 3OYMA
chains in the Genus database with same CATH topology
2DTHA 1UGSB 4C92D 1JRIA 1KHIA 4DOVA 4X9DA 1D3BA 3OW2A 4JS4A 3OYBA 4ME7A 1XQHA 4EMKC 4C8QE 5GAOq 2A3LA 4L5GA 1WGSA 2E6ZA 4QW2A 3SWNA 2PQWA 3DLLA 4M7AA 2D0QB 5J26A 3CCRT 5GANh 5GMKj 2DIQA 2RHIA 2VV5A 1M9SA 3AHUA 2LRQA 3QKJA 3QUIA 4XU1A 5LJ5j 3CPWA 1BI0A 4KT0E 3TU4K 3BDLA 4N0AC 2MWPA 1XTDA 1BI3A 3MEUA 3UDCA 4OMFB 3NTIA 3KBGA 2LT1A 3JCMX 1M8VA 1QP2A 3L1AA 3A8GB 1Y71A 2DO3A 5GMKe 4E7LA 1U8RA 5GAN5 1VQKT 1KC8C 5CR2A 5LJ5e 2L8DA 2E12A 3H6ZA 3QZ5B 1RL2A 2QXFA 4BI4A 4ZN3A 4A4EA 4C92F 3G71A 5C0MA 1WQ7A 3CD6A 1VUBA 4FIBA 3OBWA 4ZTFA 2E1HA 2JTFA 2LTOA 5GMKi 3JCMQ 5GAN7 3CBPA 1OYXA 4M7AE 2FB7A 3OQ5A 4LDUA 5FU7B 4F7UB 4EMKA 2KK4A 4L6V5 3G6ET 3P8BB 1BYMA 4CRIA 4OGCA 1YJNA 2WSFE 4TVRA 5LJ3d 4ELZC 2GF7A 3CXCS 5I2SA 4M7DD 3GNGA 2XDPA 1FX7A 5LJ5g 5CKFA 4BUGA 4EPCA 5GAMe 4N0AA 3FDRA 4F7UA 5GAOl 4N4IA 5M9OA 2PU9B 3H8ZA 5FRMA 4C0ZA 3FB9A 2XD0A 4BI8B 4J6YA 4IKFA 3ER0A 3MP1A 3M53A 2ZPIB 3CBOA 1QP3A 3A5ZB 2ZPEB 3M59A 4C92B 3X24B 1O9SA 2FHDA 3V8KA 1K73U 1N27A 1G3WA 2BKDN 4X9CA 3G71T 1HXDA 2JN0A 5IT9E 3LGLA 2KVQG 2Y4XA 2KMTA 2ZPBB 3JSCA 3RMSA 3J80E 3CMEA 4KULA 1G3YA 4A53A 5GANf 3CCLT 2QI2A 3FJPA 5D6WA 1YJWA 3QYHB 3CCQT 3MHXA 4IUVA 1P92A 3EFSA 3JB9G 2R5MA 2V8JA 4M7DF 2FYKA 2RHZA 1B34B 2RHUA 4XTWA 2EFIA 2KQWA 1U1TA 3G7ZA 3T9NA 2KDSA 4O6JA 4F7UE 1JJ2A 1KQ2A 4Y91A 3L2RA 1YITA 4EDUA 1PSEA 2K5LA 4B9WA 4RCBA 1Y96B 3OYDA 1EIFA 3E19A 2EAYA 1HK9A 4M78C 2DXUA 1OZ2A 5GAN3 4C0DC 2DZCA 2JOYA 1OI1A 3META 5EG2A 3CC7T 4QQDA 2CZ6B 4C5GA 4BDZA 4II1A 3LGFA 2V8IA 4IUPA 1M1FA 5FU6B 2RJEA 3VYGA 4J6XA 1VQNA 2EKOA 5LJ3h 4BE2A 4E7IA 2LVMA 4M77G 3OBYA 3OMGA 2PVGB 1KQSA 3E9FA 4WF2A 3OYMA 3GPLA 4BY6C 2EQMA 3M9QA 4UC4A 5C6SA 3PMTA 5L8RE 1YJWT 2EWNA 2ZPGB 4PL6A 2K3XA 4XU0A 1JB0E 2P0QA 3M55A 3PFSA 1TH7A 3SB2A 1IZ6A 4JRIA 5GAOp 1U1SA 2K3YA 4XK8E 3CCRA 3JB9H 1DJ7B 3BFMA 1YCYA 1YITT 3WVEB 5KE2A 2K2VA 3A8OB 4B9XA 5CKBA 1VIFA 1YHQT 1V29B 2DXBA 4M78A 3PTAA 4MZTA 4C5EA 1M90C 3M4YA 2Y90A 3INZA 4M77F 3QPHA 2RJFA 4LDWA 1VQKA 2R58A 4JRKA 4LDVA 4PKCC 4PJOG 1O75A 3JCMb 4HT9A 4HA8A 3QJYA 2RI3A 2E10A 3V8LA 4PLIA 3HHTB 4XTXA 3C94A 1N8RC 3CPFA 3A8MB 4P5NA 1VQ4A 1W4SA 3UWNA 1H641 2O4XB 3P8HA 4FM4B 4JUVA 3S3NA 3G6EA 1VQ6T 3QSUA 5CKEA 1WJRA 5D6YA 4QQGA 4C92G 4A54A 4YTLA 4QVDA 4M78E 3HSBA 2DXTA 2IG0A 5GAMd 3HFOA 3M57A 5GANj 1BIBA 2WSEE 4JLIA 3V7SA 5FROA 1Q82U 1UGQB 4XAXB 1PSFA 1NE8A 5A0GA 3OYNA 3Q1JA 3MO8A 4PJOF 1M1GA 3DLMA 1G3TA 2QQ9A 3DB3A 4J83A 1KQ1A 4RCCA 4A4HA 5FU7C 5LJ3f 4M77B 3X20B 3CC4A 3CEYA 5D6XA 2GQVA 2HBPA 4LD6A 3LH0A 5GANe 3M56A 5KE3A 2LDMA 4BE1A 2F5TX 5CAIA 3OS5A 1UGPB 3S6WA 4HT8A 1Q86C 3J81E 3CCVT 3NFCA 2LC4A 4EMGA 3C95A 2DK3A 2VUBA 4HCZA 4M75D 1ZQ1A 3LWIA 1VQOT 3ZEHA 2OTJT 3L2QA 3CCLA 4J6WA 1Q7YC 2D6FA 2R57A 4M77A 3EAEA 1VQ4T 2PVDB 3UT1A 3LX7A 4DA4A 1YIJT 1M1KU 3CBMA 1KHCA 5GMKh 3CCQA 3JB9J 5J3BA 2P0KA 4BD3A 2DD5A 5FRNA 2LCCA 2P4TA 2OTJA 2RH2A 5GANg 1VIEA 4XU2A 3G4SA 4C92C 2FVUA 1NZ9A 2QQBA 2VGNA 5DY9A 3CCMA 4OB3B 2JNGA 2VC8A 3NTHA 2CZ0B 4PJOB 3RIRA 4LDXA 4LDYA 1N9RA 1Q82C 2GFUA 1QW1A 4M7DG 2B8AA 2DXCA 3VJPA 3OYFA 3FEOA 3CC4T 2VXFA 5CKHA 1XNIA 5CO7A 4M77E 4M75F 2DVEA 3A8HB 3MP6A 3PT9A 5GAMh 3OYHA 3JCMJ 4PJOA 4MMLA 2EJ9A 3TCJA 1Y07A 3QZ9B 2H3JA 4C8QD 5KH6A 3LYIA 3TEEA 4M78D 3CC2T 1LJOA 2E70A 2MAMA 2LT4A 4X34A 2KY9A 2L3RA 3M4GA 1VQLT 3GLXA 2HQEA 1GXIE 1MGQA 1YJ9T 4JS5A 1FWZA 1BIAA 5CKDA 3JCMd 3DKMA 1M1KC 4KUIA 3OS2A 3OYCA 1N6AA 2YLBA 2RI5A 4C92A 3OYGA 2QDYB 5FU6C 3G4ST 3CCMT 2ZZDA 3CXCA 5GAN2 2GCXA 3E1SA 1M90U 4KUDK 1XOVA 1R8OB 2V8KA 3OYAA 1YHQA 3OMCA 3OS1A 3C12A 2AHJB 4VUBA 2MMPA 3JCMc 3S3OA 4PJOE 4CI0C 3L2VA 2RO0A 3SFMA 3RMQA 1Q81C 2XI9A 2M16A 3OYYA 1QVGA 1B34A 2RHYA 4M75B 5HKCA 2PUKB 4M7AD 4BB7A 4C8QF 2XIDA 4DOWA 1RI0A 3JCMP 2X4JA 4KBMB 2RA2A 4OF1A 1N8RU 1UEBA 4C0GA 2YLCA 1Y96A 4NOYA 2DIGA 3VKIA 2QEXT 1MHNA 4C92E 4OGEA 1BKBA 3OYEA 3MP8A 4JRPA 3E9GA 3OYJA 5FLXE 1VQ6A 3OS0A 2ZCFB 5HK0A 5CQXA 4M7DB 3L2WA 4PJOD 3S3MA 2DTOA 3F70A 4OB0B 4J7IA 4XTYA 5A0LA 4LD9K 1QVFS 3M58A 1ZBXA 3LLRA 1VQ7T 2DJZA 3EFRA 4PNOA 4E47A 3OB9A 4V2SA 2PUOB 2I2LA 2XG8D 4Q5WA 3RKXA 4ZTJA 3FLGA 1X01A 3GOXA 5GAMf 4PLLA 3CCET 3GIBA 4R55A 4FT2A 4M7DA 2K4YA 3V8JA 3L42A 5LJ5d 4M7AF 2RM4A 3QYGB 5KCOA 3X25B 1Q86U 2DD4A 3JCMh 3WVDB 4C8QB 2OTLA 3VUBA 4ZGDB 2XHCA 3HL8A 2RB6A 5DM7R 3OW2S 3N5BB 5LJ3g 2DZ9A 5DLQE 3OYIA 3CCVA 1Q7YU 1NPPA 1NPRA 1VQOA 2ZGWA 4GY5A 2L5QA 4OB1B 5GAOn 5CVIA 2DEQA 1WJQA 3QXEB 3MCAB 4C5IA 4MDWA 3OYLA 4OP0A 1YIJA 5CCAA 4QVCA 4M77C 2X4WA 2MWOA 1I4K1 3L2UA 3RESA 1UGRB 2YRVA 3CPWS 2GFAA 3JRZA 3ASKA 3MEWA 1VQ9T 2E65A 3GNFB 3VYHB 5CK9A 3VV0A 2LCLA 2VYTA 1W2BA 3RKWA 4M7DE 1ZHIA 2RK2A 2XK0A 5GMKm 3X28B 3GP8A 3FRNA 4FU6A 2QTXA 4XTVA 3RKYA 5GAN4 2FL7A 2RK1A 3V7CA 3JAME 2O4XA 3SWNB 5IN1A 3V7RA 3OY9A 2HD0A 4M7AB 1I8FA 3LW5E 2WSCE 2X4XA 2DKGA 3PIPA 2RHXA 4L59A 3A8LB 2R5AA 4OVAA 1VQ8A 2CKKA 2F69A 3QDRB 3JCMV 2RJCA 3SDZA 2OTLT 4E7KA 4ELYC 2JZ2A 4HCBA 4DQ2A 4PJOC 4MMKA 5CQYA 1BI1A 4C5HA 4F7UF 4E7HA 3HPWA 3CC2A 4IURA 3URGA 1VQLA 2BIVA 4Z02A 4BACA 3X26B 1LOJA 3PNWC 4FT4A 4M75G 3ZFJA 1YJ9A 4MDXA 2DPPB 4A4KA 3L2ZA 5LJ5h 3M54A 1NJIC 4J7FA 2EQUA 2HQXA 3M5AA 2LQ8A 1AHJB 3ZBDA 3SD4A 3QIIA 3JCMf 3OA6A 4EMKB 1KD1U 3CCST 1K8AU 1Q81U 2HAXA 2CYZB 2EJFA 4QVZA 1X6OA 3WXMB 4N4GA 2C06A 1H3ZA 2MF2A 3JCMW 1VQ5A 5HY6A 4R56A 4JRQA 2M0OA 3DB4A 4HKEA 1VQ8T 3FIFA 5GAN8 2E41A 4RKUE 5GAN6 2K5IA 3C4SA 2QQAA 4MZPA 5GAMj 1S72A 4XTUA 2RI2A 4Y28E 2OAUA 1QVPA 4NL2A 2EQJA 1LNXA 4QQ6A 3VU3C 2QEXA 1QVFA 2Y4YA 3QJ6A 1JJ2S 2F5KA 3I56A 2O01E 3QHSA 4C8QG 3CMAA 2XDBA 5HK3A 4M78G 4M75C 3GF5A 3HRSA 4IUQA 3HKSA 2JUFA 3CCJA 2XU8A 5DLOA 1VQ7A 2HNIA 1QVGS 4A4FA 4EMHA 4XQ3A 2MI6A 3CC7A 1SSFA 5LL6S 1K9MU 2RJDA 3CCEA 4ATOA 4NL3A 3QO3A 4HCCA 1BI2A 4ZGEB 3UPUA 1KD1C 2LX9A 1UB4A 2RD1A 3VUZA 2JVVA 1WPYA 2ZPFB 1YI2A 1K8AC 1VQ5T 4BE0A 4M7DC 1KQSS 4JJNK 3CD6T 3JB9D 2EQKA 2ZPHB 3QBYA 5GAOm 3I55A 5GAMg 1M4ZA 5A2QE 3LWHA 3I56T 3OSSC 4GLKA 1S72T 1KG1A 4ZN1A 3RERA 5LJ3j 4M78F 5LJ5f 3HRUA 4M7AG 3PGGA 5AYFA 1I5LA 2VXEA 5I21A 3CCUA 3BW1A 1YJNT 3TREA 3ME9A 4JDSA 1OZ3A 2CZ1B 3HP9A 4RG8A 3PIOA 5A0DA 3CMAT 4M75A 4XTZA 4C8QC 1VQ9A 5LJ3e 1Y7XA 2E64A 4A4GA 2EYQA 3CCJT 2D9TA 2CZ7B 4IUTA 2QA4A 1WQWA 4MZMA 4N4HA 2QQSA 3RUXA 1VQMA 2K5FA 3BDUA 3HFNA 1X75C 2K57A 4M77D 4C0FA 5GANd 1VQPA 3R6OA 2DAQA 4XU3A 2XDDA 2BUDA 2X35A 4ZGJB 3JB9F 1FXXA 5IAYA 4RMOA 1K9MC 2QQRA 4D6WA 4BI3A 1YI2T 2LNVA 2E6NA 2VGMA 2L89A 1K73C 2KAFA 3CMET 3I55T 2A7YA 4FL6A 1N9SA 3JB9I 4M78B 4J5YA 2WACA 3PMIA 2EJGA 4IUUA 4C0DB 2PVOB 4M75E 5I2MA 1W2BS 2YHTA 3KUFA 5GMKl 3OSVA 3SWNC 2M9UA 2DTIA 1G3SA 3FC3A 3CCUT 2G3RA 5GAOr 4M7AC 3JCMe 1NJIU 1JBMA 3OYKA 1M5Q1 2LQKA 3BY7A 2XICA 4O5VA 4C8QA 2KSSA 2EIFA 2XKOC 4F7UG 2X4YA 4OB2B 2IVWA 3HRTA 5J39A 4BY6B 2CS7A 4JLGA 1WJSA 3QG1A 3O8VA 5CIUA 1KC8U 1D3BB 2QA4T 3J7AF 3KXTA 4J8OA 4E7JA 4RG2A 3CCSA 4FSXA 2M1HA 5KCHA 3MEAA 3NTKA 4BDYA 1VQMT 1VQPT 2NLUA 1WNLA 2JTMA 1G5VA 4NS5A 3MEVA 1VQNT 2P0PA 2CGHA 1I81A 3P8DA 3JCMg 2E5QA 1YBYA 1IREB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QVZ A;  4PL6 A;  2K3X A;  1H3Z A;  4N4G A;  3PFS A;  3OYB A;  3OYA A;  3OMC A;  2K3Y A;  3OS1 A;  2M0O A;  3S3O A;  3DB4 A;  3L2V A;  1WGS A;  2RO0 A;  4QW2 A;  2PQW A;  5KE2 A;  3C4S A;  4B9X A;  5J26 A;  2M16 A;  2RI2 A;  2DIQ A;  2RHI A;  2RHY A;  4QQ6 A;  4C5E A;  2EQJ A;  2LRQ A;  3QKJ A;  1RI0 A;  3QJ6 A;  2F5K A;  3BDL A;  2MWP A;  2RJF A;  2DIG A;  3MEU A;  2R58 A;  3NTI A;  1MHN A;  3OYE A;  3MP8 A;  4IUQ A;  2RI3 A;  4E7L A;  4PLI A;  3E9G A;  3OYJ A;  3OS0 A;  3L2W A;  2L8D A;  3H6Z A;  4A4F A;  3S3M A;  3UWN A;  3F70 A;  4A4E A;  2O4X B;  5C0M A;  3P8H A;  1SSF A;  3S3N A;  2RJD A;  4ZTF A;  3LLR A;  2JTF A;  2LTO A;  1WJR A;  3PMT A;  4QQG A;  5D6Y A;  1OYX A;  3OB9 A;  3OQ5 A;  2IG0 A;  4Q5W A;  4BE0 A;  4ZTJ A;  3FLG A;  2EQK A;  3QBY A;  4PLL A;  5FRO A;  3GOX A;  4CRI A;  3L42 A;  3OYN A;  3Q1J A;  3MO8 A;  5KCO A;  3DLM A;  2GF7 A;  3DB3 A;  4A4H A;  2XDP A;  3CEY A;  5D6X A;  4LD6 A;  3OYI A;  3LH0 A;  3ME9 A;  3FDR A;  1OZ3 A;  5KE3 A;  2LDM A;  4BE1 A;  4GY5 A;  4N4I A;  5M9O A;  5FRM A;  3H8Z A;  1WJQ A;  4C5I A;  3S6W A;  3OYL A;  2X4W A;  4IKF A;  2MWO A;  3MP1 A;  4A4G A;  4HCZ A;  3L2U A;  2YRV A;  3ZEH A;  2D9T A;  2GFA A;  3L2Q A;  4IUT A;  3ASK A;  3MEW A;  2R57 A;  3EAE A;  3UT1 A;  2FHD A;  3LX7 A;  4N4H A;  1N27 A;  2BKD N;  2QQS A;  2VYT A;  1KHC A;  4BD3 A;  2P0K A;  3LGL A;  2DAQ A;  5FRN A;  2XK0 A;  2LCC A;  2BUD A;  2X35 A;  5D6W A;  5IAY A;  4FU6 A;  2QQR A;  4IUV A;  3OY9 A;  2E6N A;  2O4X A;  2L89 A;  5IN1 A;  3NTH A;  2R5M A;  4FL6 A;  2RHZ A;  2RHU A;  2X4X A;  2WAC A;  2RHX A;  2EFI A;  3PMI A;  4IUU A;  4L59 A;  2GFU A;  2R5A A;  4OVA A;  3L2R A;  4EDU A;  2B8A A;  2CKK A;  4B9W A;  2RJC A;  3KUF A;  3FEO A;  3OYF A;  4E7K A;  2JZ2 A;  3OYD A;  3FC3 A;  2G3R A;  1XNI A;  4C5H A;  1OZ2 A;  4E7H A;  3OYK A;  4IUR A;  1OI1 A;  3MP6 A;  2BIV A;  3MET A;  4Z02 A;  3OYH A;  4QQD A;  4BAC A;  2X4Y A;  3OYG A;  5KH6 A;  3PNW C;  4C5G A;  5J39 A;  3LYI A;  4BDZ A;  1WJS A;  3O8V A;  4II1 A;  3LGF A;  5CIU A;  4IUP A;  4X34 A;  2RJE A;  2L3R A;  4E7J A;  4RG2 A;  2EKO A;  2EQU A;  2HQX A;  4BE2 A;  4E7I A;  2M1H A;  2HQE A;  3MEA A;  2LVM A;  3NTK A;  5KCH A;  4BDY A;  3OMG A;  2NLU A;  3E9F A;  3SD4 A;  3OYM A;  1G5V A;  4NS5 A;  3MEV A;  3OS2 A;  2EQM A;  3M9Q A;  3QII A;  4UC4 A;  2RI5 A;  5C6S A;  3P8D A;  3OYC A;  3OA6 A;  2E5Q A; 
#chains in the Genus database with same CATH topology
 1VQ4 Q;  3OW2 A;  4JS4 A;  3OYB A;  1X6B A;  3G6E Q;  1WGS A;  2E6Z A;  4B6M A;  2PQW A;  4XU1 A;  2CSI A;  2NWM A;  3TU4 K;  4ESR A;  3BDL A;  4N0A C;  4OMF B;  2DO3 A;  1KC8 C;  1WHG A;  2QXF A;  2AIR B;  5C0M A;  3PE0 A;  1VUB A;  1GL5 A;  1X43 A;  3EGU A;  1VQL Q;  1OYX A;  3PVL A;  2DE0 X;  3OQ5 A;  4LDU A;  2KK4 A;  1AWX A;  4L6V 5;  1K4U S;  2CT3 A;  2YT6 A;  4CRI A;  4TVR A;  1HSQ A;  5I2S A;  3GNG A;  1FX7 A;  5CKF A;  1AZE A;  2RNA A;  5GAM e;  2ESW A;  2J7I A;  4F7U A;  2YWW A;  1RAB B;  5GAO l;  1ZUK A;  5FRM A;  3MP1 A;  2ZPI B;  3CBO A;  3A5Z B;  2ZPE B;  3X24 B;  4J9B A;  3G71 T;  1G3W A;  1K73 R;  3LGL A;  2KMT A;  2ZPB B;  1YJW A;  4Z88 A;  3KFV A;  4F17 A;  1P92 A;  1RAC B;  2V8J A;  2RHZ A;  2RHU A;  4F7U E;  2KQW A;  2E3H A;  1KQ2 A;  4Y91 A;  1YIT A;  2W0Z A;  4EDU A;  1D09 B;  1PSE A;  3H0F A;  3OYD A;  4FCY A;  4J9G A;  4C0D C;  2DZC A;  2JOY A;  5KYX B;  4E6R A;  2VKN A;  2EKO A;  2XMF A;  2L0A A;  4DEY A;  2KT1 A;  3EGD B;  3OMG A;  1KQS A;  4BY6 C;  5GJV B;  2EQM A;  4UC4 A;  5HCK A;  2O2O A;  4LUD A;  3M55 A;  3PFS A;  1ZSZ B;  1IZ6 A;  3CCR A;  4E7S A;  2J6O A;  3A8O B;  4M78 A;  2DXB A;  2F1L A;  2O31 A;  3M4Y A;  2RJF A;  4LDW A;  1VQK A;  4PKC C;  2OTL Q;  1O75 A;  1X69 A;  1SSH A;  2E10 A;  4XTX A;  2EVR A;  1VQ4 A;  1W4S A;  1NM7 A;  1RAE B;  2O4X B;  1M3C A;  3P8H A;  4FM4 B;  3G6E A;  1JJ2 P;  1WJR A;  1M3B A;  2K2M A;  4C92 G;  4QVD A;  4M78 E;  5IHN A;  5A0G A;  3OYN A;  4PJO F;  3DLM A;  3DB3 A;  4A4H A;  2C0I A;  2CP0 A;  5FU7 C;  2V1Q A;  3M0P A;  4GLM A;  4JZ4 A;  5IXF A;  5CAI A;  3OS5 A;  2X3X D;  1UGP B;  4HT8 A;  1Q86 C;  4RTX A;  3CCV T;  3NFC A;  4HCZ A;  1VQO T;  3ZEH A;  3VS6 A;  1OQK A;  3LX7 A;  3JB9 J;  1UHC A;  2CP2 A;  4BD3 A;  2JT4 A;  1ARK A;  2F2W A;  1VIE A;  4XU2 A;  2DIL A;  4C92 C;  1XJW B;  1QKW A;  4OB3 B;  3NTH A;  1NYF A;  1N9R A;  1QW1 A;  4M7D G;  2DXC A;  2CDT A;  2EGA A;  1MUZ A;  3H0H A;  5CO7 A;  1TG0 A;  4ORZ A;  1H92 A;  4PJO A;  3PT9 A;  3TCJ A;  5KH6 A;  1Y07 A;  3OW2 P;  2QEX Q;  2HKN A;  1LJO A;  2E70 A;  3M4G A;  2HQE A;  1GXI E;  1MGQ A;  2YUO A;  2QDY B;  3G4S T;  1YWO A;  1R77 A;  3CCM T;  1GCP A;  2BZY A;  4KUD K;  1W70 A;  2V8K A;  3OYA A;  1M90 R;  3OS1 A;  3C12 A;  3E2U A;  4PJO E;  4CI0 C;  3L2V A;  3CCE Q;  2L3Q A;  2RO0 A;  1SHF A;  1FMK A;  3R6N A;  3VRZ A;  1B34 A;  1TUC A;  2PUK B;  4DOW A;  1RI0 A;  1Y0M A;  2RA2 A;  4C0G A;  1Y96 A;  2DFU A;  2DIG A;  1UG1 A;  2RPN A;  4NOY A;  1NBE B;  4OGE A;  1BKB A;  2LQW A;  4HVV A;  2GTJ A;  3E9G A;  3H41 A;  3L2W A;  2DTO A;  4OB0 B;  4J9F A;  1VQ7 T;  2DJZ A;  4E47 A;  4PNO A;  1M2V A;  4V2S A;  1WI7 A;  2XG8 D;  4Q5W A;  3QWX X;  3JV3 A;  3GOX A;  4FT2 A;  3L42 A;  2RM4 A;  4J9D A;  5L23 A;  1Q86 U;  2V1R A;  3A1P A;  3WVD B;  2OTL A;  1GCQ C;  2XHC A;  5DM7 R;  3OW2 S;  1SRM A;  1NPP A;  1WDX A;  4FSS A;  2OTJ A;  2DEQ A;  1QLY A;  1I07 A;  4M77 C;  2X4W A;  1IXD A;  3L2U A;  3VS2 A;  4RTT A;  3ASK A;  2YRC A;  3CXC P;  1E7O A;  5CK9 A;  2CP6 A;  1ZHI A;  2KBT A;  3GP8 A;  2FPE A;  2LJ0 A;  3C0C A;  3V7R A;  1B3Q A;  1PRM C;  4M7A B;  1I8F A;  3LW5 E;  5I22 A;  4L59 A;  3A8L B;  2NUP B;  1D1A A;  2OI3 A;  1QCN A;  4HCB A;  1U06 A;  4DQ2 A;  2GBQ A;  2AT1 B;  3X26 B;  1UJ0 A;  4FT4 A;  4M75 G;  2FO0 A;  4FW1 A;  4A4K A;  1M1K R;  4J7F A;  2EQU A;  2HQX A;  3SD4 A;  2LNH B;  1KD1 U;  2HCK A;  4QVZ A;  4QKU A;  1UEC A;  4R56 A;  2EW3 A;  2D1X A;  4JRQ A;  2KNB B;  1VQ8 T;  3FIF A;  5GAN 8;  2E41 A;  2QQA A;  2QYZ A;  2QEX A;  3VU3 C;  1QVP A;  2DYI A;  2EQJ A;  4NL2 A;  3VS0 A;  1G83 A;  1YJN Q;  3QHS A;  1W2B P;  5GJW B;  2A08 A;  4M75 C;  1MV0 B;  1OOT A;  2EKH A;  2RQT A;  1AWJ A;  2XU8 A;  5DLO A;  2HNI A;  1B7T A;  2RJD A;  3CCE A;  4ATO A;  4NL3 A;  2FEI A;  1RLP C;  3UPU A;  1K9M R;  2DEU A;  3VS1 A;  2YUP A;  1KQS S;  3FJ5 A;  2ZPH B;  1B07 A;  5A2Q E;  3THK A;  5LJ3 j;  5LJ5 f;  2FPF A;  3M0U A;  5AYF A;  3BW1 A;  1OZ3 A;  3HP9 A;  4RG8 A;  1WXT A;  2RMO A;  3CCJ T;  2D9T A;  1WQW A;  4MZM A;  3RUX A;  1Z9Z A;  2K5F A;  4M77 D;  3HFN A;  2YRD A;  4DBF A;  1FXX A;  5IAY A;  2PNI A;  1K9M C;  1VQN Q;  2LNV A;  4JJC A;  2YSQ A;  2JM8 A;  2WAC A;  2EJG A;  2CUD A;  4C0D B;  2PVO B;  3M0R A;  1W2B S;  5D7U A;  2DF6 A;  2M9U A;  2DTI A;  1G3S A;  1JO8 A;  5KYN A;  3FC3 A;  3CCU T;  1M2O A;  3JCM e;  2KRS A;  5GAO r;  1JBM A;  2E3I A;  3BY7 A;  2LQK A;  1M3A A;  4C8Q A;  1NJI R;  2XKO C;  4F7U G;  2IVW A;  3HRT A;  5J39 A;  4BY6 B;  4JLG A;  1WJS A;  5CIU A;  3J7A F;  3MJX A;  4J8O A;  1E6H A;  1PC0 A;  2KXC A;  2M1H A;  5KCH A;  1VQM T;  3NTK A;  1VQP T;  1WNL A;  1I81 A;  3JCM g;  1E6G A;  1UGS B;  1JRI A;  1KHI A;  4DOV A;  3BE3 A;  4X9D A;  5KYU A;  1M8M A;  5GAO q;  4C8Q E;  2QAZ A;  2A3L A;  2ROT A;  4Z8A A;  3DLL A;  5AT1 B;  3CCR T;  2K79 A;  2RHI A;  4FW2 A;  2MCN A;  3AHU A;  2B86 A;  1AWW A;  4KT0 E;  1M30 A;  1XTD A;  4JJD A;  4Z89 A;  3CC4 Q;  3JCM X;  1QP2 A;  4E7L A;  1U8R A;  1VQK T;  1PD1 A;  1AZG B;  4OMM A;  2L8D A;  3H6Z A;  5FWC A;  4BI4 A;  1F1B B;  4ZTF A;  3OBW A;  3CC2 Q;  2E1H A;  2JTF A;  1KSW A;  2GNC A;  3CBP A;  1WA7 A;  5FU7 B;  3CCQ Q;  4EMK A;  3G6E T;  1YJ9 Q;  2P4R A;  1YJN A;  2WSF E;  2XDP A;  1QVF P;  4BUG A;  2LX7 A;  1NEB A;  5M9O A;  2PU9 B;  2JS2 A;  1RUW A;  1A0N B;  4C92 B;  1O9S A;  2FPD A;  2FHD A;  3EFO A;  2BKD N;  2HDA A;  5IT9 E;  2KVQ G;  3J80 E;  3RMS A;  5GAN f;  3FJP A;  3MHX A;  4IUV A;  3EGX B;  3T9N A;  3G7Z A;  4O6J A;  1JJ2 A;  4RCB A;  1EIF A;  3E19 A;  4M78 C;  1YHQ Q;  1OZ2 A;  5GAN 3;  2EYY A;  3U23 A;  4C5G A;  4II1 A;  3VYG A;  2V8I A;  1M1F A;  4J6X A;  1VQN A;  1WHM A;  2CP7 A;  2NUZ A;  1ACM B;  1NLO C;  2EYZ A;  1BBZ A;  4RUG A;  2ZPG B;  2IIM A;  1VQ6 Q;  1VQ9 Q;  3SB2 A;  1TH7 A;  5GAO p;  5KYY B;  1PWT A;  1RAA B;  4XK8 E;  3JB9 H;  1DJ7 B;  4Y92 A;  2RQV A;  1V29 B;  2ED0 A;  2DL3 A;  2HKQ B;  3EG1 A;  1ZSZ A;  1EZZ B;  2R58 A;  4FYX B;  4PJO G;  3JCM b;  4HT9 A;  1T3L A;  1X2K A;  3CPF A;  4P5N A;  1H64 1;  3QSU A;  3NHN A;  5D6Y A;  4QQG A;  1K9A A;  2QGG A;  2WSE E;  1AEY A;  3V7S A;  1Q82 U;  4XAX B;  1TS9 A;  1PSF A;  3O5Z A;  2KI7 A;  1M1G A;  2QQ9 A;  3EG3 A;  5LJ3 f;  3X20 B;  4M77 B;  3CC4 A;  2F5T X;  2LC4 A;  1D1C A;  3LWI A;  2VUB A;  2OTJ T;  5KYW B;  3CCL A;  2R57 A;  2PVD B;  3UT1 A;  4DA4 A;  5GMK h;  1KHC A;  3CCQ A;  1N5Z A;  5J3B A;  2P0K A;  2DD5 A;  1RAG B;  4J9I A;  2LCC A;  2P4T A;  5DY9 A;  2JNG A;  2VC8 A;  2CZ0 B;  4WCI A;  4JJB A;  1MND A;  1OPK A;  3H9N A;  2B8A A;  2FZC B;  1UJY A;  1UTI A;  3VJP A;  8AT1 B;  2VXF A;  5CKH A;  1VQ5 Q;  4IIO A;  1WHL A;  3CD6 Q;  3JCM J;  3I56 Q;  1S72 Q;  4MML A;  1X2Q A;  2EPD A;  3TEE A;  4M78 D;  4X34 A;  1NYG A;  2KY9 A;  2L3R A;  1HD3 A;  4JS5 A;  1BIA A;  5CKD A;  3JCM d;  3DKM A;  3CMA Q;  4KUI A;  3TSW A;  3OS2 A;  2DA9 A;  5FU6 C;  4CC3 A;  2ZZD A;  2GQI A;  2J06 A;  3CXC A;  2GCX A;  4KGV B;  2JM9 A;  1YHQ A;  2QDL A;  3JCM c;  3S3O A;  1VYU A;  2YDL A;  2CP3 A;  3SFM A;  1IHV A;  2M16 A;  1YI2 Q;  3OYY A;  5HKC A;  4M75 B;  1ABQ A;  4M7A D;  2OX7 A;  2XID A;  3JCM P;  2YLC A;  2QEX T;  1MHN A;  4JRP A;  3OYJ A;  1IGU A;  5FLX E;  1VQ6 A;  2VVK A;  3F70 A;  4XTY A;  4J7I A;  3M58 A;  3LLR A;  1ZBJ A;  2PUO B;  3RDV A;  1X01 A;  3CCE T;  5GAM f;  2FRW A;  4M7A F;  2ENM A;  3QYG B;  1GRI A;  3JCM h;  2RB6 A;  2K7A A;  1Q86 R;  1JXO A;  4GY5 A;  2L5Q A;  1WJQ A;  4C5I A;  3MCA B;  4OP0 A;  5CCA A;  2MWO A;  4AFU C;  2EGE A;  2HSP A;  1UGR B;  2CT4 A;  2BZX A;  2DRK A;  4FYY B;  3GNF B;  2LCL A;  2DX1 A;  2VYT A;  4LE9 A;  1W2B A;  2LP5 A;  4DEX A;  2RK2 A;  1V1C A;  4XTV A;  2FL7 A;  2RK1 A;  3OY9 A;  4LUE A;  1QVG P;  1X27 A;  2WSC E;  2X4X A;  1PM3 A;  4OMO A;  3I5S A;  3AT1 B;  2CKK A;  2RJC A;  1PG5 B;  3GBQ A;  1BI1 A;  3URG A;  1VQL A;  2BIV A;  1PCX A;  1LOJ A;  2H8H A;  5I11 A;  4HXJ A;  2LQ8 A;  2EYX A;  3OA6 A;  1K8A U;  2KXD A;  1KD1 R;  2CYZ B;  2EJF A;  4AFQ C;  3WXM B;  3I5R A;  1VQ5 A;  4WTO B;  3G71 Q;  1OEB A;  3I56 A;  1S72 A;  5GAN 6;  4RKU E;  4MZP A;  3LH5 A;  4XTU A;  4Y28 E;  2OAU A;  4QQ6 A;  1SEM A;  2Y4Y A;  1JJ2 S;  4C8Q G;  3CMA A;  2BE7 D;  3GF5 A;  4IUQ A;  1QVG S;  2DM1 A;  4A4F A;  1WHJ A;  4EMH A;  4KGZ B;  4HCK A;  4HCC A;  1KD1 C;  2LX9 A;  1UB4 A;  1C1A A;  3VUZ A;  1BK2 A;  2JVV A;  2ZPF B;  1YI2 A;  4M7D C;  4PFP A;  4FYW B;  4CC7 A;  3CME Q;  3RER A;  3HRU A;  3PGG A;  5I21 A;  1YJN T;  3TRE A;  2CZ1 B;  3PIO A;  1W1F A;  4AFZ C;  3EG9 A;  1BCO A;  4C8Q C;  1Y7X A;  4A4G A;  2ZAE A;  4OML A;  2KEA A;  1FMV A;  2COY A;  1CKB A;  2COW A;  3BDU A;  3CC7 T;  2F2V A;  2K57 A;  4C0F A;  4XU3 A;  2BUD A;  2L2P A;  1QCF A;  4ZGJ B;  2F2X A;  4BI3 A;  2VGM A;  2KAF A;  3I55 T;  2A7Y A;  1N9S A;  2FZG B;  4M78 B;  3JB9 I;  4FYV B;  3OSV A;  3UF4 A;  4J9C A;  1RI9 A;  1LCK A;  1EFN A;  2KSS A;  3REB B;  2EIF A;  4IIM A;  1QVF A;  2CS7 A;  3H0I A;  3QG1 A;  3O8V A;  1D3B B;  2QA4 T;  5FWB A;  2NLU A;  3EHR A;  1VQN T;  1MMD A;  1AT1 B;  1IRE B;  3QWY A;  4C92 D;  1FMW A;  1JQQ A;  4KGX B;  3REA B;  1QMC A;  4EMK C;  2ABL A;  2GTO A;  5IXB A;  2AKK A;  3SWN A;  2HSE B;  1WXB A;  2D0Q B;  2DIQ A;  2VV5 A;  1M9S A;  1YNZ A;  2LRQ A;  3QKJ A;  3QUI A;  4CC4 B;  2DVJ A;  1CKA A;  1QWE A;  2DYB A;  1BI3 A;  3NTI A;  1KK7 A;  1OX9 A;  3L1A A;  3A8G B;  1Y71 A;  5GMK e;  3VS5 A;  5LJ5 e;  3G71 A;  4C92 F;  4FIB A;  1ZA1 B;  1ABO A;  2LTO A;  5GMK i;  3JCM Q;  4K11 A;  5GAN 7;  2MOX A;  2FB7 A;  2KE9 A;  1MMG A;  4DBH A;  1BYM A;  3MPU B;  4OGC A;  3G4S Q;  4ELZ C;  3CXC S;  3CCM Q;  4M7D D;  2HBW A;  5LJ5 g;  1GFC A;  4EPC A;  1S1N A;  2SRC A;  4KH0 B;  3H8Z A;  3FB9 A;  4BI8 B;  4J6Y A;  1V76 A;  3JSC A;  2Y4X A;  4HVU A;  3CCL T;  3CME A;  3QYH B;  3CCQ T;  2K6D A;  3JB9 G;  2R5M A;  4M7D F;  4XTW A;  1B34 B;  1U1T A;  1JXM A;  2KDS A;  1T0J A;  3L2R A;  2HL3 A;  3PVQ A;  1VQ7 Q;  2V26 A;  1K0X A;  1Y96 B;  3VS4 A;  1HK9 A;  1OI1 A;  3MET A;  4QQD A;  4PJN A;  2CZ6 B;  3ZL7 C;  4BDZ A;  2FRY A;  3TSZ A;  2KRM A;  5FU6 B;  4BE2 A;  4E7I A;  1M2V B;  2LVM A;  4JPB W;  3OBY A;  4WF2 A;  1YJW T;  2EWN A;  4ZNX A;  2D8J A;  2P0Q A;  1U1S A;  3QDF A;  1YCY A;  1YIT T;  3WVE B;  1YHQ T;  4MZT A;  4C5E A;  3INZ A;  4M77 F;  3QPH A;  4LNP A;  4JRK A;  5IHK A;  4RTW A;  4E2F B;  3QJY A;  1PNJ A;  1KIK A;  4PLI A;  3HHT B;  3C94 A;  1N8R C;  3A8M B;  3EH2 A;  3D7S B;  1YIJ Q;  1JU5 C;  2YXY A;  4JUV A;  1HYO A;  3S3N A;  1AOJ A;  2HMA A;  1VQ6 T;  5IH2 A;  4YTL A;  2DXT A;  2IG0 A;  2QAS A;  1QCO A;  2I0N A;  4JLI A;  5FRO A;  1RAI B;  4D8K A;  2NUT B;  1Q82 R;  1G3T A;  4J83 A;  1KQ1 A;  2DLP A;  4JZ3 A;  2LJ1 A;  1C6V X;  5D6X A;  1K0S A;  2GQV A;  3NPF A;  3LH0 A;  5GAN e;  1GCQ A;  4J9E A;  2QG9 B;  3VS7 A;  5KE3 A;  2LJ3 A;  1VQ8 Q;  3S6W A;  4M75 D;  4M4Z A;  2GGR A;  4J6W A;  1Q7Y C;  4M77 A;  1VQ4 T;  2K9G A;  1M1K U;  3CBM A;  2C0T A;  4GBQ A;  5FRN A;  2DNU A;  2JTE A;  5GAN g;  3G4S A;  3CCM A;  1NZ9 A;  2QQB A;  3NMZ C;  4QT7 A;  1TWB A;  1SHG A;  1D1B A;  5KYW A;  1Q82 C;  2GFU A;  1GBQ A;  2L3S A;  3FEO A;  2X9H A;  1GBR A;  1GFD A;  1XNI A;  4F04 B;  1CSK A;  4M77 E;  4M75 F;  2EJ9 A;  3QZ9 B;  2DL4 A;  1VQL T;  3GLX A;  2VAS A;  2AK5 A;  1PD0 A;  2EBP A;  1N6A A;  2YLB A;  2RI5 A;  2HQH A;  1D0Z A;  2D8H A;  3CCJ Q;  2FG0 A;  1XOV A;  4RTU A;  1X6G A;  3OMC A;  2QTV A;  2AHJ B;  4VUB A;  2MMP A;  2X51 A;  1IO6 A;  3EG0 A;  1Q81 C;  2M02 A;  1QVG A;  1U3O A;  2AKL A;  2X4J A;  1J3T A;  1N8R U;  4OF1 A;  1UEB A;  3VKI A;  2VWF A;  3CCU Q;  5KYX A;  1PRL C;  3OS0 A;  2KYB A;  2ZCF B;  5HK0 A;  2LQN A;  5CQX A;  4M7D B;  3S3M A;  2EQI A;  1K76 A;  2RQW A;  5A0L A;  1QVF S;  2EGC A;  1ZUU A;  4EIK A;  2M0Y A;  3EFR A;  1MV3 A;  3OB9 A;  3EGD A;  2I2L A;  1VQM Q;  1VQP Q;  3GIB A;  4OMN A;  2RN8 A;  4R55 A;  2K4Y A;  5LJ5 d;  4C8Q B;  2JXB A;  2MIO A;  5LJ3 g;  2DZ9 A;  1Q7Y U;  4AG1 C;  2HEQ A;  2ZGW A;  4OB1 B;  5GAO n;  1KG1 A;  2KRO A;  3QXE B;  3OYL A;  3RBB B;  1YIJ A;  1I4K 1;  1TUD A;  4OMQ A;  3JRZ A;  3MEW A;  1QKX A;  2E65 A;  3VV0 A;  3RKW A;  2RQR A;  5KYU B;  2QTX A;  3RKY A;  5GAN 4;  1VQK Q;  3CCS Q;  3V7C A;  3JAM E;  2O4X A;  5IN1 A;  3UAT A;  2HD0 A;  3EHQ A;  2RHX A;  2R5A A;  1VQ8 A;  2F69 A;  2OTL T;  4ELY C;  2JZ2 A;  2J6F A;  4PJO C;  4F7U F;  1ZLM A;  3HPW A;  4DBQ A;  3CC2 A;  4IUR A;  2MK5 A;  4ANJ A;  4Z02 A;  4BAC A;  4X1V A;  3ZFJ A;  1YJ9 A;  4MDX A;  2DPP B;  5LJ5 h;  1D0X A;  3M54 A;  1YFN A;  3A98 A;  1AHJ B;  1NLP C;  4RTY A;  1M27 C;  3QII A;  1AD5 A;  4EMK B;  1T0H A;  2DL5 A;  1Q81 U;  2C06 A;  1H3Z A;  4PJL A;  1K8A R;  2MF2 A;  3JCM W;  5HY6 A;  2C0O A;  2M0O A;  4HKE A;  1Q95 G;  1ZSG A;  1LNX A;  2J6K A;  2O01 E;  2Z0W A;  3EFO B;  2DBM A;  2JJ9 A;  2HL5 C;  3CCJ A;  1SRL A;  4XQ3 A;  1SSF A;  5LL6 S;  1OV3 A;  1WPY A;  1K8A C;  4JJN K;  5GAM g;  3LWH A;  4GLK A;  4M78 F;  4R0K A;  2VXE A;  3CCU A;  3CQT A;  3ME9 A;  4JDS A;  1R0C B;  5A0D A;  2QGF B;  4XTZ A;  2CSQ A;  1WZO A;  1RLQ C;  3ULR B;  1VQ9 A;  1SPK A;  2E64 A;  1SF9 A;  2EYQ A;  4IUT A;  2W10 A;  2QQS A;  1VQM A;  1VQP A;  1X75 C;  5GAN d;  3MKD A;  1D0Y A;  1OU9 A;  2X35 A;  4RMO A;  2QQR A;  2E6N A;  1K73 C;  3CME T;  4FL6 A;  4IUU A;  2DL7 A;  5I2M A;  2YHT A;  3KUF A;  3SWN C;  1VOM A;  2G3R A;  3OYK A;  2XIC A;  2CUB A;  4O5V A;  2X4Y A;  4OB2 B;  1BCM A;  4PJO D;  1KC8 U;  3KXT A;  4E7J A;  3CCS A;  2SEM A;  4BDY A;  3MEA A;  1H8K A;  1U5S A;  3MEV A;  1VA7 A;  1Z9Q A;  3P8D A;  2E5K A;  2E5Q A;  1YBY A;  2DTH A;  2OTJ Q;  1D3B A;  4ME7 A;  1XQH A;  2M51 A;  4L5G A;  4QW2 A;  4M7A A;  1SG5 A;  2KR3 A;  5J26 A;  5GAN h;  5GMK j;  5EC7 A;  2NUP A;  1RAD B;  5LJ5 j;  3CPW A;  1BI0 A;  1W6X A;  2MWP A;  3MEU A;  3UDC A;  1JEG A;  3KBG A;  2LT1 A;  3UA7 A;  1M8V A;  2D0N A;  5GAN 5;  5CR2 A;  2O9V A;  2LCS A;  2E12 A;  3QZ5 B;  1RL2 A;  1UFF A;  2H3E B;  4ZN3 A;  4A4E A;  1WQ7 A;  2BZ8 A;  3CD6 A;  3VS3 A;  4M7A E;  1QWF A;  3NGP A;  2HZY A;  4F7U B;  1UHF A;  1K1Z A;  3P8B B;  1YN8 A;  2CRE A;  5LJ3 d;  2GF7 A;  4OMP A;  4PJM A;  1I5O B;  2CH4 A;  4N0A A;  3FDR A;  2IPO B;  2G6F X;  2O9S A;  5FW9 A;  4N4I A;  2L3P A;  4C0Z A;  2XD0 A;  4IKF A;  3ER0 A;  3M53 A;  1QP3 A;  1WYX A;  3M59 A;  1PKS A;  3V8K A;  1K73 U;  1N27 A;  4X9C A;  2PTK A;  1HXD A;  2JN0 A;  2DRM A;  4KUL A;  1G3Y A;  4A53 A;  2QI2 A;  5D6W A;  4F16 A;  4RTZ A;  1G8X A;  4LXC A;  3EFS A;  2FYK A;  4RTV A;  2EFI A;  2K5L A;  4B9W A;  2EAY A;  2DXU A;  3UA6 A;  5EG2 A;  3LGF A;  4IUP A;  2RJE A;  2K3B A;  1UUE A;  5LJ3 h;  4M77 G;  1TOV A;  3EG2 A;  2PVG B;  1AWO A;  3E9F A;  3GPL A;  1MMA A;  3M9Q A;  5C6S A;  3PMT A;  5L8R E;  2YUQ A;  2MYS A;  2CP5 A;  4PL6 A;  2K3X A;  4XU0 A;  1JB0 E;  1KJW A;  2JW4 A;  6AT1 B;  4JRI A;  2K3Y A;  3BFM A;  1IB8 A;  1WHH A;  5KE2 A;  2K2V A;  1Y57 A;  4B9X A;  5CKB A;  1VIF A;  1M90 C;  3PTA A;  3RNJ A;  1ZUY A;  2Y90 A;  4PFZ A;  4E7Z A;  4LDV A;  2A37 A;  4HA8 A;  2RI3 A;  3V8L A;  3CCV Q;  1VQO Q;  2O88 A;  3UWN A;  1TTH B;  1TUG B;  5CKE A;  3VRY A;  4A54 A;  3HSB A;  5GAM d;  3HFO A;  3M57 A;  5GAN j;  1BIB A;  1UGQ B;  3RR6 A;  1NE8 A;  3Q1J A;  2JMA A;  3MO8 A;  1R0B G;  4RCC A;  1TU0 B;  3CEY A;  2HBP A;  4LD6 A;  1WXU A;  2JMC A;  3M56 A;  1LVK A;  2LDM A;  4BE1 A;  1IRX A;  2LZ6 B;  3J81 E;  4F14 A;  4PJJ A;  1KQS P;  2NUT A;  4EMG A;  3C95 A;  2DK3 A;  1ZQ1 A;  3L2Q A;  1YWP A;  2PZ1 A;  1OU8 A;  2D6F A;  1YIJ T;  3EAE A;  2DER A;  2DJQ A;  2J05 A;  2DET A;  2RH2 A;  4AMC A;  2FVU A;  2VGN A;  4PJO B;  3RIR A;  1OUL A;  1VYV A;  4D8D A;  4LDX A;  4LDY A;  4LN2 A;  2ED1 A;  3OYF A;  3CC4 T;  4PK4 A;  2DBK A;  2DVE A;  3A8H B;  3MP6 A;  1RAH B;  5GAM h;  3OYH A;  4AG2 C;  1IGQ A;  2FZK B;  2H3J A;  4C8Q D;  3LYI A;  3CC2 T;  2MAM A;  2LT4 A;  2CGH A;  2CH4 W;  3M0S A;  1WIE A;  1YJ9 T;  1FWZ A;  1WX6 A;  1M1K C;  3OYC A;  4C92 A;  3OYG A;  3CPW P;  2YUN A;  1UE9 A;  5GAN 2;  3E1S A;  2A36 A;  1M90 U;  1R8O B;  3CC7 Q;  1H3H A;  2AZS A;  3RMQ A;  2XI9 A;  2BTT A;  3EGX A;  2RHY A;  2ATC B;  1ZSZ C;  3EG9 B;  4BB7 A;  3I55 Q;  4C8Q F;  4KBM B;  1N8R R;  4PFO A;  4C92 E;  3OYE A;  3MP8 A;  1C0M A;  1TXQ A;  1PHT A;  4LD9 K;  2VB6 A;  1ZBX A;  2QA4 Q;  2OAW A;  3RKX A;  4ZTJ A;  1ZX6 A;  3FLG A;  4PLL A;  4M7D A;  3V8J A;  5KCO A;  3X25 B;  2KGT A;  2DD4 A;  5KYY A;  3VUB A;  4ZGD B;  3HL8 A;  5ECA A;  3N5B B;  1EX4 A;  3I9Q A;  5DLQ E;  3OYI A;  3CCV A;  1WHK A;  1NPR A;  1VQO A;  1Q7Y R;  5CVI A;  4MDW A;  3TQ7 P;  4QVC A;  3RES A;  2YRV A;  3CPW S;  2GFA A;  1VQ9 T;  3VYH B;  3G1J A;  2ROL A;  4M7D E;  2XK0 A;  5GMK m;  3X28 B;  3FRN A;  4FU6 A;  1TSF A;  3SWN B;  4KH1 B;  1YCS B;  2A0F B;  3PIP A;  2DKG A;  2BE9 B;  4OVA A;  3HTR A;  3QDR B;  3JCM V;  3SDZ A;  4E7K A;  2RQU A;  4MMK A;  5CQY A;  4C5H A;  1KFZ A;  4E7H A;  1IHW A;  4A63 B;  2NYS A;  1LPL A;  1PKT A;  3PNW C;  2KRN A;  2AZV A;  3L2Z A;  1NJI C;  3M5A A;  1UDL A;  3ZBD A;  1SKU B;  1OX8 A;  2A28 A;  3JCM f;  2OJ2 A;  3CCS T;  2E4H A;  2HAX A;  1X6O A;  4N4G A;  1WFW A;  1VYT A;  1BB9 A;  1Q81 R;  2LMJ A;  5IHI A;  2EYW A;  3DB4 A;  3CCL Q;  3EH1 A;  1UGV A;  5GAM j;  2K5I A;  3C4S A;  2MPX C;  2RI2 A;  3QJ6 A;  2COZ A;  2F5K A;  8ATC B;  1NG2 A;  2QK0 A;  2XDB A;  5HK3 A;  4M78 G;  2ECZ A;  4AFS C;  3HRS A;  1MMN A;  3HKS A;  2JUF A;  1T3S A;  4AT1 B;  1VQ7 A;  1I0C A;  2MI6 A;  2DL8 A;  3CC7 A;  1K9M U;  2KT8 A;  2JS0 A;  3QO3 A;  3SEM A;  1BI2 A;  4ZGE B;  2KYM A;  2RD1 A;  1VQ5 T;  4BE0 A;  3CD6 T;  4CC2 A;  3JB9 D;  2EQK A;  3QBY A;  5GAO m;  3I55 A;  1M4Z A;  3TVT A;  3I56 T;  3OSS C;  1ZA2 B;  1S72 T;  1YJW Q;  4ZN1 A;  1QQJ A;  4M7A G;  1I5L A;  1I1J A;  1YIT Q;  3CMA T;  4M75 A;  3SHW A;  3IQL A;  5LJ3 e;  1FYN A;  1YP5 A;  1WLP B;  2CZ7 B;  2QA4 A;  1HJD A;  4N4H A;  1NEG A;  1RAF B;  3R6O A;  2DAQ A;  2XDD A;  9ATC B;  3JB9 F;  1MNE A;  4D6W A;  1YI2 T;  2L89 A;  4DBR A;  4J5Y A;  3PMI A;  4HVW A;  4M75 E;  4J9H A;  5GMK l;  2X3W D;  4M7A C;  1NJI U;  3CCR Q;  1AVZ C;  1M5Q 1;  3I35 A;  1BU1 A;  2RF0 A;  7AT1 B;  2DMO A;  2P84 A;  4KRT A;  1OPL A;  4RG2 A;  3M0T A;  1KC8 R;  4FSX A;  2JTM A;  1G5V A;  4NS5 A;  1G2B A;  2P0P A;  3M0Q A;  3OYM A; 
#chains in the Genus database with same CATH homology
 2DTH A;  1UGS B;  4C92 D;  1JRI A;  1KHI A;  4DOV A;  4X9D A;  1D3B A;  3OW2 A;  4JS4 A;  3OYB A;  4ME7 A;  1XQH A;  4EMK C;  4C8Q E;  5GAO q;  2A3L A;  4L5G A;  1WGS A;  2E6Z A;  4QW2 A;  3SWN A;  2PQW A;  3DLL A;  4M7A A;  2D0Q B;  5J26 A;  3CCR T;  5GAN h;  5GMK j;  2DIQ A;  2RHI A;  2VV5 A;  1M9S A;  3AHU A;  2LRQ A;  3QKJ A;  3QUI A;  4XU1 A;  5LJ5 j;  3CPW A;  1BI0 A;  4KT0 E;  3TU4 K;  3BDL A;  4N0A C;  2MWP A;  1XTD A;  1BI3 A;  3MEU A;  3UDC A;  4OMF B;  3NTI A;  3KBG A;  2LT1 A;  3JCM X;  1M8V A;  1QP2 A;  3L1A A;  3A8G B;  1Y71 A;  2DO3 A;  5GMK e;  4E7L A;  1U8R A;  5GAN 5;  1VQK T;  1KC8 C;  5CR2 A;  5LJ5 e;  2L8D A;  2E12 A;  3H6Z A;  3QZ5 B;  1RL2 A;  2QXF A;  4BI4 A;  4ZN3 A;  4A4E A;  4C92 F;  3G71 A;  5C0M A;  1WQ7 A;  3CD6 A;  1VUB A;  4FIB A;  3OBW A;  4ZTF A;  2E1H A;  2JTF A;  2LTO A;  5GMK i;  3JCM Q;  5GAN 7;  3CBP A;  1OYX A;  4M7A E;  2FB7 A;  3OQ5 A;  4LDU A;  5FU7 B;  4F7U B;  4EMK A;  2KK4 A;  4L6V 5;  3G6E T;  3P8B B;  1BYM A;  4CRI A;  4OGC A;  1YJN A;  2WSF E;  4TVR A;  5LJ3 d;  4ELZ C;  2GF7 A;  3CXC S;  5I2S A;  4M7D D;  3GNG A;  2XDP A;  1FX7 A;  5LJ5 g;  5CKF A;  4BUG A;  4EPC A;  5GAM e;  4N0A A;  3FDR A;  4F7U A;  5GAO l;  4N4I A;  5M9O A;  2PU9 B;  3H8Z A;  5FRM A;  4C0Z A;  3FB9 A;  2XD0 A;  4BI8 B;  4J6Y A;  4IKF A;  3ER0 A;  3MP1 A;  3M53 A;  2ZPI B;  3CBO A;  1QP3 A;  3A5Z B;  2ZPE B;  3M59 A;  4C92 B;  3X24 B;  1O9S A;  2FHD A;  3V8K A;  1K73 U;  1N27 A;  1G3W A;  2BKD N;  4X9C A;  3G71 T;  1HXD A;  2JN0 A;  5IT9 E;  3LGL A;  2KVQ G;  2Y4X A;  2KMT A;  2ZPB B;  3JSC A;  3RMS A;  3J80 E;  3CME A;  4KUL A;  1G3Y A;  4A53 A;  5GAN f;  3CCL T;  2QI2 A;  3FJP A;  5D6W A;  1YJW A;  3QYH B;  3CCQ T;  3MHX A;  4IUV A;  1P92 A;  3EFS A;  3JB9 G;  2R5M A;  2V8J A;  4M7D F;  2FYK A;  2RHZ A;  1B34 B;  2RHU A;  4XTW A;  2EFI A;  2KQW A;  1U1T A;  3G7Z A;  3T9N A;  2KDS A;  4O6J A;  4F7U E;  1JJ2 A;  1KQ2 A;  4Y91 A;  3L2R A;  1YIT A;  4EDU A;  1PSE A;  2K5L A;  4B9W A;  4RCB A;  1Y96 B;  3OYD A;  1EIF A;  3E19 A;  2EAY A;  1HK9 A;  4M78 C;  2DXU A;  1OZ2 A;  5GAN 3;  4C0D C;  2DZC A;  2JOY A;  1OI1 A;  3MET A;  5EG2 A;  3CC7 T;  4QQD A;  2CZ6 B;  4C5G A;  4BDZ A;  4II1 A;  3LGF A;  2V8I A;  4IUP A;  1M1F A;  5FU6 B;  2RJE A;  3VYG A;  4J6X A;  1VQN A;  2EKO A;  5LJ3 h;  4BE2 A;  4E7I A;  2LVM A;  4M77 G;  3OBY A;  3OMG A;  2PVG B;  1KQS A;  3E9F A;  4WF2 A;  3OYM A;  3GPL A;  4BY6 C;  2EQM A;  3M9Q A;  4UC4 A;  5C6S A;  3PMT A;  5L8R E;  1YJW T;  2EWN A;  2ZPG B;  4PL6 A;  2K3X A;  4XU0 A;  1JB0 E;  2P0Q A;  3M55 A;  3PFS A;  1TH7 A;  3SB2 A;  1IZ6 A;  4JRI A;  5GAO p;  1U1S A;  2K3Y A;  4XK8 E;  3CCR A;  3JB9 H;  1DJ7 B;  3BFM A;  1YCY A;  1YIT T;  3WVE B;  5KE2 A;  2K2V A;  3A8O B;  4B9X A;  5CKB A;  1VIF A;  1YHQ T;  1V29 B;  2DXB A;  4M78 A;  3PTA A;  4MZT A;  4C5E A;  1M90 C;  3M4Y A;  2Y90 A;  3INZ A;  4M77 F;  3QPH A;  2RJF A;  4LDW A;  1VQK A;  2R58 A;  4JRK A;  4LDV A;  4PKC C;  4PJO G;  1O75 A;  3JCM b;  4HT9 A;  4HA8 A;  3QJY A;  2RI3 A;  2E10 A;  3V8L A;  4PLI A;  3HHT B;  4XTX A;  3C94 A;  1N8R C;  3CPF A;  3A8M B;  4P5N A;  1VQ4 A;  1W4S A;  3UWN A;  1H64 1;  2O4X B;  3P8H A;  4FM4 B;  4JUV A;  3S3N A;  3G6E A;  1VQ6 T;  3QSU A;  5CKE A;  1WJR A;  5D6Y A;  4QQG A;  4C92 G;  4A54 A;  4YTL A;  4QVD A;  4M78 E;  3HSB A;  2DXT A;  2IG0 A;  5GAM d;  3HFO A;  3M57 A;  5GAN j;  1BIB A;  2WSE E;  4JLI A;  3V7S A;  5FRO A;  1Q82 U;  1UGQ B;  4XAX B;  1PSF A;  1NE8 A;  5A0G A;  3OYN A;  3Q1J A;  3MO8 A;  4PJO F;  1M1G A;  3DLM A;  1G3T A;  2QQ9 A;  3DB3 A;  4J83 A;  1KQ1 A;  4RCC A;  4A4H A;  5FU7 C;  5LJ3 f;  4M77 B;  3X20 B;  3CC4 A;  3CEY A;  5D6X A;  2GQV A;  2HBP A;  4LD6 A;  3LH0 A;  5GAN e;  3M56 A;  5KE3 A;  2LDM A;  4BE1 A;  2F5T X;  5CAI A;  3OS5 A;  1UGP B;  3S6W A;  4HT8 A;  1Q86 C;  3J81 E;  3CCV T;  3NFC A;  2LC4 A;  4EMG A;  3C95 A;  2DK3 A;  2VUB A;  4HCZ A;  4M75 D;  1ZQ1 A;  3LWI A;  1VQO T;  3ZEH A;  2OTJ T;  3L2Q A;  3CCL A;  4J6W A;  1Q7Y C;  2D6F A;  2R57 A;  4M77 A;  3EAE A;  1VQ4 T;  2PVD B;  3UT1 A;  3LX7 A;  4DA4 A;  1YIJ T;  1M1K U;  3CBM A;  1KHC A;  5GMK h;  3CCQ A;  3JB9 J;  5J3B A;  2P0K A;  4BD3 A;  2DD5 A;  5FRN A;  2LCC A;  2P4T A;  2OTJ A;  2RH2 A;  5GAN g;  1VIE A;  4XU2 A;  3G4S A;  4C92 C;  2FVU A;  1NZ9 A;  2QQB A;  2VGN A;  5DY9 A;  3CCM A;  4OB3 B;  2JNG A;  2VC8 A;  3NTH A;  2CZ0 B;  4PJO B;  3RIR A;  4LDX A;  4LDY A;  1N9R A;  1Q82 C;  2GFU A;  1QW1 A;  4M7D G;  2B8A A;  2DXC A;  3VJP A;  3OYF A;  3FEO A;  3CC4 T;  2VXF A;  5CKH A;  1XNI A;  5CO7 A;  4M77 E;  4M75 F;  2DVE A;  3A8H B;  3MP6 A;  3PT9 A;  5GAM h;  3OYH A;  3JCM J;  4PJO A;  4MML A;  2EJ9 A;  3TCJ A;  1Y07 A;  3QZ9 B;  2H3J A;  4C8Q D;  5KH6 A;  3LYI A;  3TEE A;  4M78 D;  3CC2 T;  1LJO A;  2E70 A;  2MAM A;  2LT4 A;  4X34 A;  2KY9 A;  2L3R A;  3M4G A;  1VQL T;  3GLX A;  2HQE A;  1GXI E;  1MGQ A;  1YJ9 T;  4JS5 A;  1FWZ A;  1BIA A;  5CKD A;  3JCM d;  3DKM A;  1M1K C;  4KUI A;  3OS2 A;  3OYC A;  1N6A A;  2YLB A;  2RI5 A;  4C92 A;  3OYG A;  2QDY B;  5FU6 C;  3G4S T;  3CCM T;  2ZZD A;  3CXC A;  5GAN 2;  2GCX A;  3E1S A;  1M90 U;  4KUD K;  1XOV A;  1R8O B;  2V8K A;  3OYA A;  1YHQ A;  3OMC A;  3OS1 A;  3C12 A;  2AHJ B;  4VUB A;  2MMP A;  3JCM c;  3S3O A;  4PJO E;  4CI0 C;  3L2V A;  2RO0 A;  3SFM A;  3RMQ A;  1Q81 C;  2XI9 A;  2M16 A;  3OYY A;  1QVG A;  1B34 A;  2RHY A;  4M75 B;  5HKC A;  2PUK B;  4M7A D;  4BB7 A;  4C8Q F;  2XID A;  4DOW A;  1RI0 A;  3JCM P;  2X4J A;  4KBM B;  2RA2 A;  4OF1 A;  1N8R U;  1UEB A;  4C0G A;  2YLC A;  1Y96 A;  4NOY A;  2DIG A;  3VKI A;  2QEX T;  1MHN A;  4C92 E;  4OGE A;  1BKB A;  3OYE A;  3MP8 A;  4JRP A;  3E9G A;  3OYJ A;  5FLX E;  1VQ6 A;  3OS0 A;  2ZCF B;  5HK0 A;  5CQX A;  4M7D B;  3L2W A;  4PJO D;  3S3M A;  2DTO A;  3F70 A;  4OB0 B;  4J7I A;  4XTY A;  5A0L A;  4LD9 K;  1QVF S;  3M58 A;  1ZBX A;  3LLR A;  1VQ7 T;  2DJZ A;  3EFR A;  4PNO A;  4E47 A;  3OB9 A;  4V2S A;  2PUO B;  2I2L A;  2XG8 D;  4Q5W A;  3RKX A;  4ZTJ A;  3FLG A;  1X01 A;  3GOX A;  5GAM f;  4PLL A;  3CCE T;  3GIB A;  4R55 A;  4FT2 A;  4M7D A;  2K4Y A;  3V8J A;  3L42 A;  5LJ5 d;  4M7A F;  2RM4 A;  3QYG B;  5KCO A;  3X25 B;  1Q86 U;  2DD4 A;  3JCM h;  3WVD B;  4C8Q B;  2OTL A;  3VUB A;  4ZGD B;  2XHC A;  3HL8 A;  2RB6 A;  5DM7 R;  3OW2 S;  3N5B B;  5LJ3 g;  2DZ9 A;  5DLQ E;  3OYI A;  3CCV A;  1Q7Y U;  1NPP A;  1NPR A;  1VQO A;  2ZGW A;  4GY5 A;  2L5Q A;  4OB1 B;  5GAO n;  5CVI A;  2DEQ A;  1WJQ A;  3QXE B;  3MCA B;  4C5I A;  4MDW A;  3OYL A;  4OP0 A;  1YIJ A;  5CCA A;  4QVC A;  4M77 C;  2X4W A;  2MWO A;  1I4K 1;  3L2U A;  3RES A;  1UGR B;  2YRV A;  3CPW S;  2GFA A;  3JRZ A;  3ASK A;  3MEW A;  1VQ9 T;  2E65 A;  3GNF B;  3VYH B;  5CK9 A;  3VV0 A;  2LCL A;  2VYT A;  1W2B A;  3RKW A;  4M7D E;  1ZHI A;  2RK2 A;  2XK0 A;  5GMK m;  3X28 B;  3GP8 A;  3FRN A;  4FU6 A;  2QTX A;  4XTV A;  3RKY A;  5GAN 4;  2FL7 A;  2RK1 A;  3V7C A;  3JAM E;  2O4X A;  3SWN B;  5IN1 A;  3V7R A;  3OY9 A;  2HD0 A;  4M7A B;  1I8F A;  3LW5 E;  2WSC E;  2X4X A;  2DKG A;  3PIP A;  2RHX A;  4L59 A;  3A8L B;  2R5A A;  4OVA A;  1VQ8 A;  2CKK A;  2F69 A;  3QDR B;  3JCM V;  2RJC A;  3SDZ A;  2OTL T;  4E7K A;  4ELY C;  2JZ2 A;  4HCB A;  4DQ2 A;  4PJO C;  4MMK A;  5CQY A;  1BI1 A;  4C5H A;  4F7U F;  4E7H A;  3HPW A;  3CC2 A;  4IUR A;  3URG A;  1VQL A;  2BIV A;  4Z02 A;  4BAC A;  3X26 B;  1LOJ A;  3PNW C;  4FT4 A;  4M75 G;  3ZFJ A;  1YJ9 A;  4MDX A;  2DPP B;  4A4K A;  3L2Z A;  5LJ5 h;  3M54 A;  1NJI C;  4J7F A;  2EQU A;  2HQX A;  3M5A A;  2LQ8 A;  1AHJ B;  3ZBD A;  3SD4 A;  3QII A;  3JCM f;  3OA6 A;  4EMK B;  1KD1 U;  3CCS T;  1K8A U;  1Q81 U;  2HAX A;  2CYZ B;  2EJF A;  4QVZ A;  1X6O A;  3WXM B;  4N4G A;  2C06 A;  1H3Z A;  2MF2 A;  3JCM W;  1VQ5 A;  5HY6 A;  4R56 A;  4JRQ A;  2M0O A;  3DB4 A;  4HKE A;  1VQ8 T;  3FIF A;  5GAN 8;  2E41 A;  4RKU E;  5GAN 6;  2K5I A;  3C4S A;  2QQA A;  4MZP A;  5GAM j;  1S72 A;  4XTU A;  2RI2 A;  4Y28 E;  2OAU A;  1QVP A;  4NL2 A;  2EQJ A;  1LNX A;  4QQ6 A;  3VU3 C;  2QEX A;  1QVF A;  2Y4Y A;  3QJ6 A;  1JJ2 S;  2F5K A;  3I56 A;  2O01 E;  3QHS A;  4C8Q G;  3CMA A;  2XDB A;  5HK3 A;  4M78 G;  4M75 C;  3GF5 A;  3HRS A;  4IUQ A;  3HKS A;  2JUF A;  3CCJ A;  2XU8 A;  5DLO A;  1VQ7 A;  2HNI A;  1QVG S;  4A4F A;  4EMH A;  4XQ3 A;  2MI6 A;  3CC7 A;  1SSF A;  5LL6 S;  1K9M U;  2RJD A;  3CCE A;  4ATO A;  4NL3 A;  3QO3 A;  4HCC A;  1BI2 A;  4ZGE B;  3UPU A;  1KD1 C;  2LX9 A;  1UB4 A;  2RD1 A;  3VUZ A;  2JVV A;  1WPY A;  2ZPF B;  1YI2 A;  1K8A C;  1VQ5 T;  4BE0 A;  4M7D C;  1KQS S;  4JJN K;  3CD6 T;  3JB9 D;  2EQK A;  2ZPH B;  3QBY A;  5GAO m;  3I55 A;  5GAM g;  1M4Z A;  5A2Q E;  3LWH A;  3I56 T;  3OSS C;  4GLK A;  1S72 T;  1KG1 A;  4ZN1 A;  3RER A;  5LJ3 j;  4M78 F;  5LJ5 f;  3HRU A;  4M7A G;  3PGG A;  5AYF A;  1I5L A;  2VXE A;  5I21 A;  3CCU A;  3BW1 A;  1YJN T;  3TRE A;  3ME9 A;  4JDS A;  1OZ3 A;  2CZ1 B;  3HP9 A;  4RG8 A;  3PIO A;  5A0D A;  3CMA T;  4M75 A;  4XTZ A;  4C8Q C;  1VQ9 A;  5LJ3 e;  1Y7X A;  2E64 A;  4A4G A;  2EYQ A;  3CCJ T;  2D9T A;  2CZ7 B;  4IUT A;  2QA4 A;  1WQW A;  4MZM A;  4N4H A;  2QQS A;  3RUX A;  1VQM A;  2K5F A;  3BDU A;  3HFN A;  1X75 C;  2K57 A;  4M77 D;  4C0F A;  5GAN d;  1VQP A;  3R6O A;  2DAQ A;  4XU3 A;  2XDD A;  2BUD A;  2X35 A;  4ZGJ B;  3JB9 F;  1FXX A;  5IAY A;  4RMO A;  1K9M C;  2QQR A;  4D6W A;  4BI3 A;  1YI2 T;  2LNV A;  2E6N A;  2VGM A;  2L89 A;  1K73 C;  2KAF A;  3CME T;  3I55 T;  2A7Y A;  4FL6 A;  1N9S A;  3JB9 I;  4M78 B;  4J5Y A;  2WAC A;  3PMI A;  2EJG A;  4IUU A;  4C0D B;  2PVO B;  4M75 E;  5I2M A;  1W2B S;  2YHT A;  3KUF A;  5GMK l;  3OSV A;  3SWN C;  2M9U A;  2DTI A;  1G3S A;  3FC3 A;  3CCU T;  2G3R A;  5GAO r;  4M7A C;  3JCM e;  1NJI U;  1JBM A;  3OYK A;  1M5Q 1;  2LQK A;  3BY7 A;  2XIC A;  4O5V A;  4C8Q A;  2KSS A;  2EIF A;  2XKO C;  4F7U G;  2X4Y A;  4OB2 B;  2IVW A;  3HRT A;  5J39 A;  4BY6 B;  2CS7 A;  4JLG A;  1WJS A;  3QG1 A;  3O8V A;  5CIU A;  1KC8 U;  1D3B B;  2QA4 T;  3J7A F;  3KXT A;  4J8O A;  4E7J A;  4RG2 A;  3CCS A;  4FSX A;  2M1H A;  5KCH A;  3MEA A;  3NTK A;  4BDY A;  1VQM T;  1VQP T;  2NLU A;  1WNL A;  2JTM A;  1G5V A;  4NS5 A;  3MEV A;  1VQN T;  2P0P A;  2CGH A;  1I81 A;  3P8D A;  3JCM g;  2E5Q A;  1YBY A;  1IRE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...