2RJFA

Crystal structure of l3mbtl1 in complex with h4k20me2 (residues 12-30), orthorhombic form i
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
315
structure length
315
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 78
structure length 315
sequence length 315
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjfA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjfA03
2HQEA 4PLIA 1N27A 3NTHA 3SD4A 3OYIA 3OQ5A 2EFIA 3S3NA 2R5AA 4E7IA 2RO0A 2EKOA 2L89A 2CKKA 2FHDA 3LH0A 4GY5A 2GF7A 2X4WA 2JTFA 1XNIA 2RHYA 2BUDA 2RI5A 3QBYA 5C6SA 2NLUA 2X35A 2RJEA 2LRQA 3MO8A 3PMIA 3P8HA 2F5KA 2HQXA 3OYGA 4QW2A 3OYLA 2GFUA 2M16A 5D6YA 4BDYA 2LVMA 3NTIA 3H8ZA 3DB3A 2D9TA 4HCZA 1OYXA 4E7KA 3OS1A 2MWOA 3OYJA 2L8DA 3ASKA 2R5MA 2QQSA 3OYNA 2G3RA 2BIVA 4IUTA 4Z02A 2X4XA 4BD3A 3QJ6A 3UWNA 5J39A 4C5GA 2RHZA 3UT1A 2RHXA 3S6WA 5KE2A 2R58A 3F70A 3ME9A 4QQ6A 3OYCA 4EDUA 3DB4A 4IURA 2RJFA 2B8AA 3C4SA 4QQDA 3MEWA 3ZEHA 3OA6A 4BDZA 2XDPA 3EAEA 3L2QA 2EQUA 3OYDA 3E9GA 3OB9A 2GFAA 4ZTFA 4PL6A 3L2VA 4L59A 4LD6A 4A4EA 2L3RA 4BE1A 1OZ2A 3BDLA 3OYBA 1RI0A 3LGFA 2DAQA 3OMCA 4X34A 4ZTJA 4N4GA 2K3XA 2E6NA 4A4GA 2RHIA 2VYTA 4QVZA 2RJDA 3OS0A 4E7HA 5FRMA 3E9FA 3L2WA 3LLRA 2EQMA 2PQWA 4IUUA 2RJCA 5KCHA 2X4YA 4B9WA 5C0MA 4BE0A 5KE3A 5CIUA 4Q5WA 2LDMA 3S3OA 3MP1A 3KUFA 2XK0A 3OS2A 4C5IA 2E5QA 3OMGA 3L42A 4CRIA 3PNWC 2K3YA 4N4IA 4C5HA 3S3MA 4RG2A 4IUPA 2M1HA 3L2UA 5KH6A 3MP6A 3OYFA 5M9OA 2IG0A 2LTOA 2YRVA 3FEOA 5J26A 5D6WA 3Q1JA 4IUVA 3MEVA 2DIGA 3PMTA 1SSFA 2P0KA 4IUQA 3LX7A 3LYIA 3PFSA 4A4HA 4C5EA 2QQRA 1WGSA 2DIQA 1MHNA 4PLLA 4A4FA 2RHUA 3H6ZA 3FC3A 3META 2EQKA 3GOXA 3MEUA 1OZ3A 4NS5A 3OYMA 1KHCA 2BKDN 3MP8A 3NTKA 4B9XA 3OYEA 5KCOA 4BACA 2O4XB 4E7JA 3DLMA 4FU6A 3CEYA 2M0OA 3FDRA 1WJRA 2WACA 3FLGA 2LCCA 3QIIA 1G5VA 1WJSA 3OYAA 2O4XA 4QQGA 2MWPA 4IKFA 3MEAA 4FL6A 3O8VA 3L2RA 4N4HA 2R57A 4OVAA 3OYHA 1WJQA 3M9QA 1H3ZA 4E7LA 3QKJA 5IN1A 3OY9A 1OI1A 2JZ2A 2RI2A 5FROA 5IAYA 4UC4A 4BE2A 3LGLA 5D6XA 3OYKA 4II1A 2RI3A 3P8DA 2EQJA 5FRNA
chains in the Genus database with same CATH superfamily
4N0AA 1TWBA 2QQAA 3SWNC 2LNVA 2EJGA 3UATA 4AT1B 1K73R 1ZBJA 4WTOB 2V1RA 4AFSC 5GMKj 2X35A 4AG2C 3SWNB 3CCQT 4HCKA 2LX9A 1D1CA 5KYYA 1K8AR 1UDLA 2ED1A 1HD3A 4XK8E 3CCQQ 2QYZA 2EYWA 1UJ0A 5GANh 1QVPA 4QQ6A 3RERA 3E1SA 1VQKA 3JCMh 4OB0B 1IHVA 2YUPA 5KYUB 3EHRA 1K9AA 4J9CA 2GFAA 4PL6A 3EFSA 1N6AA 2JN0A 1BI0A 1Y96A 4DA4A 1Q86U 1BI3A 2Y4XA 4Y28E 3NGPA 1WPYA 4XAXB 2CP0A 1VA7A 5HKCA 1Q86R 2ED0A 4C92C 1D0XA 2QEXA 5CR2A 1QVFS 2EGCA 3MP1A 5KYWA 3OS2A 3V8KA 5KYXA 2KT8A 4LUEA 2NUZA 4C92B 1M1FA 2NUTA 4M7AF 1FMKA 1JQQA 2J05A 5D6WA 2A08A 3X24B 3HSBA 1VQPQ 4AFUC 1Q81R 3N5BB 4P5NA 5GMKh 3H6ZA 3EH2A 4C8QD 1VQ9A 4OP0A 1X75C 2O4XB 1UGPB 3CC4Q 2HQHA 1JXOA 2VGMA 1YJWQ 3CCRA 1SPKA 2XG8D 2XHCA 2LQWA 3QIIA 1WJSA 4DBRA 5LJ5e 5LL6S 4F14A 1UTIA 1BB9A 2L3PA 5LJ5g 2RI2A 3I9QA 2ZAEA 2OAUA 3OS5A 5LJ3j 1BYMA 3IQLA 2OJ2A 4FW1A 2BZXA 3NTHA 2FRWA 2KDSA 3CD6T 3QBYA 3PIOA 3M57A 4LNPA 1N5ZA 3VRYA 3V8LA 2E5KA 4E7KA 3CD6Q 3CMAT 2RD1A 1WLPB 2JVVA 4OB3B 2G3RA 4BD3A 3CMAQ 2BTTA 5AYFA 1WQ7A 1RABB 2QGFB 3L2QA 1FMWA 4ANJA 1X2KA 1Q82U 4NL2A 2VGNA 1VQMQ 2VYTA 2CP5A 4QVZA 8AT1B 3OSSC 2XU8A 1KJWA 1PWTA 1WHLA 2QTVA 1KC8U 1Y07A 4BI8B 4PJOD 3FB9A 1IB8A 4ZGEB 5DLOA 3HFOA 5GAMd 4JZ4A 4J9BA 4C5HA 2YWWA 3MP6A 4MDXA 1Q81C 2WSCE 1YNZA 1BIAA 5CVIA 3PFSA 2P0PA 2MI6A 4R0KA 3EFRA 4FSSA 2PVDB 1NYGA 2F5TX 5LJ5f 5IT9E 1BK2A 5KYYB 3GPLA 2BZ8A 2FL7A 3NHNA 2QQBA 3CCJT 3CCVA 3I5RA 5I22A 3E2UA 5IN1A 4EMKC 3G71T 1M1GA 4UC4A 2A3LA 1YITA 2JM8A 4II1A 3CCJQ 3SB2A 1D1BA 2DX1A 2HQEA 4EMKB 2EYQA 3G71Q 1VQ6Q 2PUKB 2PZ1A 3CXCP 2AKKA 4RTUA 2RJEA 1S72T 3UF4A 4J83A 3CXCS 2CGHA 2D1XA 5DLQE 3RKYA 1ZUYA 1UB4A 4KUIA 2R5MA 2K6DA 4OB1B 1PKTA 2H3EB 2HDAA 4C8QA 5GAN6 3F70A 4XTYA 2C06A 3ZEHA 3HFNA 5CKHA 5HCKA 3PVLA 1D3BA 4JRIA 1NEBA 1H641 1B3QA 2F2WA 4OMQA 1M2VB 1W6XA 3FIFA 5LJ3d 1GL5A 2PQWA 3VU3C 5DY9A 1H3HA 1WDXA 2JTMA 2LDMA 1X01A 5EG2A 1OX9A 3OYFA 4A63B 2GCXA 2ESWA 3JCMb 2KRMA 3Q1JA 4L5GA 4IIMA 1VQ8Q 3PMTA 4KUDK 1OOTA 4O6JA 1NBEB 2ZZDA 4HKEA 4C5EA 5CO7A 1YJ9Q 4MMLA 5HK3A 2FZKB 2JS2A 1M27C 3U23A 4Z8AA 5CKDA 1RADB 4M7DC 3TVTA 5DM7R 4OMPA 1X6GA 3OYAA 4J9IA 4HCCA 2OTJT 2RNAA 4C92D 2DL7A 4M7DB 2HZYA 5FWCA 2LJ1A 5D6XA 3OYKA 1BI1A 1TXQA 1ABQA 2MF2A 4DOWA 4PJOA 1EFNA 4HT8A 2DRKA 3EG3A 3HRTA 1WI7A 2EFIA 3CCUQ 1YFNA 1NJIC 3I56T 1M3AA 2BZYA 4ELZC 2DEUA 1MV3A 1TUGB 3CMEA 2XDDA 3I56Q 1B34A 2D9TA 5KYNA 5GANg 2DFUA 2HKNA 1K9MU 1V1CA 3ASKA 5GAN3 1SHGA 3BFMA 1WHMA 3S6WA 3ME9A 4M75C 2C0TA 2A7YA 4BDZA 2C0OA 4QVCA 1OEBA 1K9MR 3WVDB 5GMKl 1I8FA 1VQ7T 3PIPA 4M75B 1CKBA 1FXXA 4DBQA 4LE9A 3V7RA 6AT1B 1AT1B 3TSWA 1QVGA 1VQ7Q 3E9FA 3CCSA 2QDLA 2JNGA 1YP5A 2XICA 1M9SA 4FYVB 3QZ5B 3CC2A 2E4HA 2GGRA 2YT6A 3RUXA 2CZ7B 2PU9B 3OMGA 3L42A 2D8JA 4X1VA 2JW4A 2LQNA 5GAMe 1TUDA 1LOJA 2PUOB 4Z88A 1M4ZA 1I4K1 4CC2A 3CCMT 1X6OA 2DERA 1RACB 1UECA 3CCQA 1NG2A 4LD9K 1HYOA 3OYEA 3A8MB 2YLBA 4FU6A 4XTUA 4C8QG 1Y0MA 2WACA 4FT2A 3VS2A 3CCET 2FPEA 3EG0A 2Y4YA 1UGRB 3CCEQ 4PJOE 4MDWA 4IIOA 1JJ2A 1IZ6A 4PLLA 1QWEA 4PK4A 3HTRA 1N27A 5GANf 1T3LA 2EYXA 1YWPA 1VQNT 5GAN5 1XTDA 2JTFA 3M0QA 5GAN8 2KBTA 4QW2A 4BDYA 3ULRB 1UE9A 2FVUA 4HCZA 5CAIA 1BKBA 1V76A 2QA4Q 1VQPA 2EYYA 1U3OA 4LN2A 4A4KA 4FYYB 4F16A 2FZGB 1OV3A 1XOVA 2F69A 2X4XA 4C5GA 5KE2A 1QCOA 1ZBXA 3A8HB 9ATCB 2SRCA 3KXTA 4MZPA 2ZPFB 4QQDA 3C4SA 2EWNA 1VYVA 4HVWA 3CC4A 1M90C 4FW2A 1YJWA 3L2ZA 1VQ5T 4LD6A 2VXEA 4QKUA 1LJOA 3C95A 1WNLA 4ATOA 4KGXB 2EPDA 4BI4A 2V8IA 2VUBA 4M78A 4EMGA 2RJCA 5KCHA 2CP6A 1SKUB 4WCIA 4C8QF 5LJ3e 3OW2S 2K2VA 2RM4A 2DD5A 5LJ3g 2A28A 2X3WD 1M1KU 2RH2A 4PJOG 3VJPA 1WXUA 4HVVA 2KE9A 2ZCFB 3THKA 4HCBA 3FEOA 1YHQT 1RAFB 4BY6C 1M1KR 2W0ZA 3CD6A 3G4SQ 1Q7YC 1QWFA 5GAN2 1TG0A 1YHQQ 4NS5A 4BY6B 4XU1A 2JS0A 2F2VA 1XJWB 3DLMA 4C0GA 3CMAA 1YIJT 2JM9A 1B34B 2O2OA 5GMKi 2H8HA 1NEGA 3VUBA 1KFZA 3O8VA 2ZPHB 1VQMA 1NPRA 2DXCA 3LGLA 4PKCC 2YSQA 1ZQ1A 4KGZB 2EGAA 4J9EA 1TH7A 2CREA 1WXTA 4FM4B 3RMQA 1Y7XA 5GAOm 5CKEA 2BUDA 1PHTA 3REBB 2LRQA 4JJDA 3REAB 5IXBA 3OYLA 3J81E 1W1FA 3QO3A 3NTIA 3JCMW 2AZSA 2WSFE 3EFOA 4M7AC 4LDWA 2DMOA 5A0DA 2P0QA 3UWNA 1RI9A 2RHZA 4PJOF 3CCLQ 4M7DD 1JB0E 4RKUE 3M0PA 4M7AB 1VOMA 4JJBA 5D7UA 2MOXA 1GCQA 3G6ET 2L3RA 2HEQA 2RQUA 3QG1A 2HNIA 1WA7A 4JPBW 5LJ3f 3JCMQ 4N4GA 2VC8A 5GAOq 4M78E 3FRNA 2D8HA 3INZA 4K11A 5FW9A 2EGEA 3CCJA 4Q5WA 5J3BA 1VQ6A 1A0NB 2ABLA 2KROA 2PTKA 1N9RA 1ZSZA 2ROLA 1VQOT 2YRVA 3JB9H 3MEVA 2EKHA 2QQ9A 1QVFP 2M02A 4M75D 1VQOQ 1MMNA 1I5LA 4KBMB 4HXJA 2K9GA 4J9HA 2J6KA 2M51A 4ZGDB 2P4RA 2P84A 4JJCA 2BKDN 4PFZA 4E7JA 4JZ3A 1WIEA 2RPNA 2MIOA 2QG9B 1WJRA 4E47A 2XD0A 4LXCA 2NUPA 2D0NA 2R57A 5I2MA 2WSEE 4NOYA 4BE2A 1IO6A 1EZZB 1GBQA 2O31A 2ECZA 3QPHA 4M78G 2KYBA 3KBGA 3JB9G 1LVKA 3BW1A 1WXBA 2RHYA 4M77A 2RMOA 2RK2A 4OF1A 4X9DA 3HRSA 2KGTA 1UEBA 1M30A 4Y92A 3EGDA 5I2SA 1BCMA 1JO8A 1VQ8A 1VQ4T 4A54A 2V26A 4C0FA 1RAHB 1M2OA 3OYNA 1K73C 1YJ9A 1T0JA 2BIVA 3A98A 3OYYA 4XTVA 2DA9A 7AT1B 1VQ4Q 1HK9A 4ME7A 2XDPA 1MMDA 3EAEA 1QMCA 5CQXA 5GANd 2QGGA 1ARKA 1K8AC 1ZSGA 1Y71A 1AWOA 2GTOA 2RQRA 3JCMd 2K3XA 2RA2A 4CI0C 1D1AA 1M3BA 2JT4A 4PJNA 2MYSA 4J8OA 2HBWA 4IUUA 1IGQA 2HL3A 2OX7A 3EG9B 1SEMA 1AWJA 4GLMA 2ATCB 4RCBA 2PNIA 3CPFA 1AD5A 3CCUA 5IHNA 2YLCA 4RG2A 4IUPA 3NMZC 1W2BP 4D8KA 4XU3A 2G6FX 1AWWA 1AHJB 3CXCA 1WHKA 1G8XA 2JMAA 3I56A 1UFFA 2H3JA 2LQKA 3MCAB 3LYIA 1Q86C 4A4HA 2E3HA 1MHNA 1WZOA 1W2BS 4M78F 4ZN3A 3JB9F 3JAME 3TU4K 1Q82R 1OZ3A 1R77A 2K57A 2MK5A 1YJNT 1LPLA 2IIMA 4AMCA 3EFOB 3M0RA 4N0AC 1Q95G 5IHIA 3FLGA 3E19A 2DXTA 1KC8R 3JRZA 1AZEA 3QXEB 2CS7A 1QP2A 1SSHA 2LQ8A 3X26B 1MNEA 3OY9A 4LDXA 2LT4A 1KD1U 4OB2B 4YTLA 3EGXA 3I5SA 1JU5C 2QK0A 1JEGA 1ZA2B 3TREA 4M77E 1Y57A 1OQKA 2DM1A 3S3NA 2R5AA 4E7IA 4GY5A 2EKOA 1KD1R 5C6SA 3QDRB 3I55A 1ZSZC 2VASA 2MWOA 3OYJA 2J06A 1ZSZB 4D6WA 3OYCA 1Y96B 1U1TA 2KY9A 3OYDA 1G2BA 1PD1A 4OMLA 3L1AA 4ZTJA 1VQKT 2KT1A 2P4TA 2RB6A 1GXIE 1PKSA 5KYWB 2E41A 2YUQA 3VYGA 5KYXB 3CCEA 1S72Q 1GFDA 3M0TA 4XTZA 1ACMB 5KE3A 2NUTB 3JB9I 3S3OA 2X3XD 4QT7A 2YHTA 2LCLA 2DL3A 2CUBA 1U8RA 3S3MA 5GAOr 1NM7A 1IHWA 2M1HA 4M7AD 1U06A 2DLPA 2O9VA 2QEXT 4M77G 3SFMA 2FPFA 1BI2A 1Q82C 2QA4A 5CKFA 2CSQA 2RHUA 3GOXA 2YRDA 4TVRA 3EGUA 4ZN1A 1X2QA 2MPXC 5KCOA 2KAFA 1K0SA 1R0CB 3JB9J 1KC8C 2QI2A 2FYKA 2QAZA 1KIKA 5HY6A 3VV0A 1YCSB 2JUFA 1VQ9T 4E7LA 2ZPGB 4DBHA 2RI3A 3ER0A 5L8RE 1C1AA 2RN8A 2QTXA 1OU9A 2KQWA 2MMPA 1N8RU 4E2FB 2RO0A 3RR6A 2AT1B 3PTAA 2O9SA 2NLUA 2JTEA 2JOYA 2COZA 3M53A 1N8RR 3A8GB 4RG8A 2DBMA 3G4SA 1QCFA 2DNUA 3QJ6A 1LCKA 2OTJQ 2R58A 1YHQA 2OTLT 2E10A 1ZA1B 4M77F 3E9GA 4D8DA 3RDVA 3L2VA 2OTLQ 1QCNA 3GNGA 5GANe 4RUGA 4E7HA 3OS0A 2QASA 3JCMe 4C8QE 5HK0A 2K5FA 3CBPA 3JCMg 2ZPIB 1IXDA 1UJYA 1CSKA 1YCYA 2DBKA 4DQ2A 4F7UA 3PE0A 4FYWB 3GLXA 1JBMA 1ZUKA 1PSFA 1XQHA 3A5ZB 4J7FA 4IUQA 2DJZA 4GBQA 5FWBA 1WQWA 1MMAA 5LJ5h 4OGEA 2RQTA 1FYNA 3QHSA 2EQKA 3MEUA 1C0MA 1KQ1A 2A37A 2EQIA 2FG0A 1KHCA 4JUVA 2AZVA 3QYHB 1PRLC 3CCLA 2I0NA 3CEYA 3M59A 1OPLA 1VUBA 1T0HA 2ROTA 3HP9A 3VKIA 1MV0B 1RAEB 3URGA 5GMKe 3PGGA 1M3CA 1IREB 1MNDA 3M58A 1SG5A 3CCVT 2HSEB 4C0DC 3OYIA 3CCMQ 1H92A 3M0UA 3QUIA 1LNXA 1U5SA 4C8QC 2RI5A 1YITT 2XKOC 2V8KA 4CC4B 2RK1A 1RLQC 4C0DB 3OYGA 4Y91A 2M16A 4LDYA 2LVMA 1Z9QA 3HPWA 3RMSA 4O5VA 4C8QB 5FLXE 3M56A 2OAWA 3SWNA 2KI7A 3MHXA 4IUTA 3RKWA 3QWYA 1D3BB 2KMTA 1G3TA 1U1SA 4PJLA 1SHFA 2LZ6B 3JCMf 4FSXA 2DAQA 4X34A 1BBZA 5KYUA 1VQNQ 1X43A 8ATCB 3L2WA 2FRYA 3VS4A 3LLRA 2O01E 4PJMA 2GNCA 2VV5A 2E70A 3CC7T 1K9MC 2RQWA 5CIUA 4F7UE 2CDTA 3KUFA 2E5QA 1WHHA 2K3YA 3JCMP 3TEEA 3CC7Q 1K1ZA 3UPUA 1TSFA 1KQSP 2ENMA 1PG5B 3OW2P 4C92A 1MMGA 4BB7A 1VQ5Q 2CYZB 2D6FA 3MKDA 1KQSS 3HRUA 3QWXX 3NPFA 2DETA 3VYHB 2C0IA 1W70A 1VQ4A 1TS9A 4PJOC 1PSEA 2KNBB 2LCCA 2O4XA 4QQGA 5CQYA 3L2RA 3PVQA 2DYBA 1WJQA 4PJOB 2EAYA 4AG1C 2VXFA 1ZX6A 3CBMA 3OSVA 3CPWP 4OMNA 2CZ6B 3CQTA 2K79A 4JRKA 3OBWA 3LH0A 2CKKA 1XNIA 3CPWS 1K4US 3PMIA 2K5IA 5CKBA 4F7UG 5EC7A 1YIJQ 3DKMA 3V8JA 5L23A 2X9HA 4KH1B 2K2MA 2DE0X 2DTIA 2L8DA 4QVDA 2FEIA 3VS7A 3ZL7C 1M8VA 1MUZA 3JSCA 2RHXA 4EDUA 1PNJA 2EBPA 2IPOB 1TOVA 1QVFA 1KHIA 2EQUA 3OB9A 1YI2T 2X4JA 5IH2A 5A0LA 5GAOl 4BE1A 1I5OB 3BDLA 2KK4A 2COYA 3OYBA 3OMCA 4LDUA 3G1JA 1OULA 2EYZA 2DKGA 1B7TA 5GAOn 1YI2Q 4BI3A 1AEYA 1GRIA 2LNHB 2DZCA 1WX6A 2HKQB 3RIRA 1QQJA 3RNJA 3RBBB 1G3WA 3GF5A 2E64A 3CC2T 3VS5A 5J26A 2J7IA 4C92E 2E1HA 1SSFA 3M54A 2DIQA 2LP5A 4A4FA 3G6EQ 1VQLT 1SRLA 4WF2A 3FJPA 3OYMA 1KQ2A 4FT4A 2JJ9A 5GAMj 1K8AU 3G71A 1VQLQ 1R0BG 4F7UF 2AKLA 4FIBA 1RAGB 3LWIA 1M1KC 4ZNXA 1E7OA 2FZCB 2MWPA 3HKSA 3BDUA 3QYGB 1UGSB 2M0YA 1H3ZA 4B6MA 2DEQA 1M8MA 2LX7A 1S72A 2V1QA 2DRMA 4PLIA 2CH4W 3SD4A 2F2XA 1SF9A 1PD0A 2KVQG 2PVOB 4CC7A 2F5KA 2HQXA 3PT9A 4EMKA 3H8ZA 2L3SA 1OYXA 4RMOA 1NYFA 1OPKA 5FU7C 1HSQA 2DPPB 4JS5A 3ZFJA 2GQIA 1RUWA 4HVUA 1W2BA 1AOJA 2LT1A 2YRCA 3GNFB 4C92G 1W4SA 1BU1A 5FU7B 2RJFA 2B8AA 4M78C 1M5Q1 4RTXA 1I07A 1VQPT 1Q81U 3VUZA 3GP8A 5A2QE 4L59A 2AK5A 3H0IA 4A4EA 4EIKA 3UA7A 4M78B 2M9UA 2KR3A 2KYMA 1FWZA 5GAMh 1Z9ZA 3CC4T 3H0HA 4EPCA 2FPDA 1YJWT 3CBOA 5I21A 2EJ9A 4LUDA 4B9WA 5C0MA 2AHJB 4MMKA 3QDFA 1M2VA 2YUOA 4DEYA 2JXBA 1I0CA 4ESRA 2E12A 1I1JA 4M4ZA 2IG0A 2ZPBB 3V7SA 3A1PA 3X20B 2MCNA 3AHUA 2BE7D 4KRTA 3C12A 1AZGB 2E6ZA 4RTWA 2OTJA 1RLPC 3DLLA 1RAAB 2D0QB 2CP7A 2NYSA 2CZ0B 4F17A 2HCKA 1UG1A 3UDCA 1K0XA 2BE9B 1KSWA 1K76A 2OTLA 3OYHA 5GAN7 4C92F 5FROA 5IAYA 3R6OA 2DVEA 5GJVB 3VS3A 1QLYA 3JCMV 2K3BA 3LH5A 1UGVA 1KG1A 3X25B 4M7DA 1NLOC 2DL4A 3OQ5A 1VQMT 3FJ5A 5J39A 1N9SA 4J7IA 2HBPA 1YJNQ 1P92A 2L3QA 3EHQA 5D6YA 1GCQC 3J80E 2DK3A 4RTYA 1UHFA 3OS1A 4KULA 1H8KA 2RF0A 3EG2A 4BUGA 3JCMJ 1VQ7A 1GBRA 4OGCA 1FMVA 4Z02A 1YBYA 4E6RA 4OMOA 3H9NA 1TTHB 1EX4A 1G3SA 4XTXA 5LJ3h 1D0ZA 1PM3A 4PFOA 2PVGB 3LGFA 1TU0B 3RKXA 2E6NA 1X69A 1QKXA 4VUBA 4M75A 4MZTA 2HL5C 2COWA 2X4YA 3D7SB 2KSSA 2VB6A 1WHJA 2IVWA 4J9GA 1QP3A 2XK0A 2W10A 1I81A 3CCMA 1MGQA 1IGUA 1UGQB 2L0AA 2DZ9A 4Z89A 4HT9A 2SEMA 2DL8A 1VQ6T 2GQVA 1WYXA 1E6GA 4OMFB 3AT1B 3EG1A 3GIBA 1NJIU 2DD4A 1HXDA 3X28B 2DTOA 4B9XA 1VQKQ 1YN8A 4BACA 2NUPB 4EMHA 4J9DA 2M0OA 1D0YA 2J6OA 1JRIA 2DYIA 2MAMA 1NJIR 2K5LA 4R56A 3LWHA 3OBYA 4FL6A 1OU8A 4M77C 4OVAA 3H0FA 4E7SA 3M55A 4JRQA 2EVRA 3QKJA 3SDZA 1VQNA 4ORZA 3VS0A 1OX8A 4M7DE 3KFVA 3WVEB 2CT4A 4M77B 2QEXQ 3QSUA 4RTTA 1KK7A 3EGDB 4J6YA 3TQ7P 3WXMB 4AFZC 2KRNA 1VYUA 1NLPC 4KT0E 3RESA 3CC7A 1IRXA 2ZPEB 1WFWA 3I35A 2E3IA 3M5AA 3V7CA 1O9SA 2KEAA 2LC4A 3CCRT 2EJFA 2DO3A 3SHWA 1C6VX 4JLGA 2DJQA 1VQ5A 1ZHIA 2QXFA 3JCMX 1VQ9Q 2DVJA 2YUNA 3VS1A 2KXCA 5IHKA 1KD1C 3DB4A 1UHCA 3OA6A 3MEWA 1B07A 3CCRQ 1VQ8T 5LJ5j 1YJ9T 3VRZA 2F1LA 4LDVA 1NPPA 4M75E 4CC3A 1PCXA 1NE8A 2RJDA 2EQMA 3TCJA 4FYXB 2Z0WA 4OMMA 4BE0A 2CT3A 4E7ZA 5AT1B 3M0SA 1R8OB 4A53A 3PNWC 2CP3A 4M7DG 3L2UA 1D09B 4DBFA 1WHGA 2LTOA 4JLIA 1YIJA 2P0KA 1HJDA 3CCUT 1T3SA 2QQRA 1WGSA 1YWOA 3MPUB 4M78D 1E6HA 3JB9D 4J6WA 4DOVA 2K4YA 1ZUUA 1DJ7B 3LW5E 4R55A 1G5VA 2L2PA 4IKFA 3A8LB 4FCYA 3EGXB 3MEAA 2JZ2A 5A0GA 1YI2A 2EIFA 3H41A 4J9FA 3ZBDA 2YXYA 3P8DA 3M4YA 5GMKm 1M90U 4M75G 2DXBA 1S1NA 2A36A 2L89A 2VKNA 2FHDA 4PJJA 2X4WA 2VVKA 5FU6C 2GFUA 1M90R 2L5QA 4XQ3A 1AVZC 4JS4A 4HA8A 3P8BB 1J3TA 2NWMA 5FU6B 2QQSA 1AWXA 3G6EA 1FX7A 4XTWA 3I55T 1KQSA 4M7DF 3M4GA 1QKWA 3OW2A 1BIBA 3JV3A 2XIDA 1VQLA 4ZTFA 3I55Q 5GAMg 1N8RC 4M7AA 3CCVQ 4V2SA 1OZ2A 3R6NA 3HHTB 1Q7YU 1RI0A 1O75A 4ZGJB 2CUDA 2RHIA 2HAXA 4C0ZA 1G3YA 5FRMA 4PNOA 5GAOp 1YITQ 5CCAA 2I2LA 1VQOA 1Q7YR 2A0FB 3NFCA 5I11A 4ELYC 2HD0A 4CRIA 4N4IA 2HMAA 3CPWA 2X51A 5M9OA 4XU2A 4RTZA 5GJWB 1GFCA 4IUVA 2FO0A 2EW3A 2JMCA 2XMFA 3LX7A 1VIEA 4M75F 4DEXA 3FC3A 2FB7A 3NTKA 3MP8A 5IXFA 3C94A 4J6XA 2CH4A 1EIFA 1QVGP 2QA4T 5LJ5d 4KH0B 1GCPA 4JDSA 3T9NA 2OI3A 2DXUA 1UUEA 2LJ0A 2CZ1B 4N4HA 1PC0A 1QVGS 2YDLA 5ECAA 1TUCA 4L6V5 2EQJA 5FRNA 4X9CA 4KGVB 2LCSA 4GLKA 3TSZA 2DF6A 2GF7A 5GAN4 1RAIB 3MO8A 3P8HA 3DB3A 1BCOA 3O5ZA 4J5YA 2GBQA 4RTVA 4F04B 1V29B 3J7AF 5GAMf 3VS6A 3UT1A 1G83A 1NZ9A 3QZ9B 4IURA 4AFQC 2RQVA 4M7AE 2K7AA 4M77D 3G4ST 2B86A 1JJ2P 2GTJA 3QJYA 1X27A 3G7ZA 4NL3A 4A4GA 1VYTA 1X6BA 2DTHA 1JJ2S 3GBQA 1ZLMA 4F7UB 4MZMA 2J6FA 1JXMA 2V8JA 3HL8A 1CKAA 2KRSA 3CMET 4XU0A 2CSIA 4C5IA 2LJ3A 1ABOA 3JCMc 3EG9A 2ZGWA 1QW1A 3BE3A 5KH6A 5GANj 2O88A 1F1BB 3CMEQ 2XI9A 4JRPA 2AIRB 3EH1A 1SRMA 1YJNA 3SEMA 1RL2A 5CK9A 2DIGA 2XDBA 2DILA 2QDYB 2CP2A 2E65A 1PRMC 3BY7A 3META 3A8OB 2KXDA 3FDRA 4RCCA 3CCST 3C0CA 3MJXA 4PFPA 3CCLT 1VIFA 1K73U 3M9QA 4M7AG 2LMJA 3CCSQ 1OI1A 2DL5A 3UA6A 2HSPA 2VWFA 3CC2Q 2Y90A 4JJNK
chains in the Genus database with same CATH topology
3JCMV 4N0AA 1KG1A 3X25B 1N27A 2QQAA 2QTXA 2LNVA 2EJGA 2KQWA 3SWNC 4M7DA 2MMPA 1N8RU 3OQ5A 5GANf 1VQMT 2RO0A 1VQNT 5GAN5 5J39A 1N9SA 1XTDA 2JTFA 4J7IA 2HBPA 5GMKj 3PTAA 2NLUA 2X35A 3SWNB 2JOYA 4QW2A 5GAN8 1P92A 3CCQT 5D6YA 4BDYA 3M53A 2LX9A 3J80E 2FVUA 4HCZA 2DK3A 5CAIA 3A8GB 1BKBA 3OS1A 3ER0A 4RG8A 1VQPA 4A4KA 4KULA 3G4SA 4XK8E 1VQ7A 4BUGA 3JCMJ 1XOVA 2F69A 4OGCA 2X4XA 1QVPA 1YBYA 3QJ6A 4Z02A 5GANh 4C5GA 5KE2A 2R58A 1YHQA 4QQ6A 1ZBXA 3A8HB 3KXTA 3E1SA 3RERA 4MZPA 2ZPFB 1VQKA 4QQDA 2E10A 2EWNA 3C4SA 4OB0B 3JCMh 2OTLT 3CC4A 1G3SA 4XTXA 4M77F 1M90C 5LJ3h 3E9GA 3L2ZA 1YJWA 2GFAA 4PL6A 3EFSA 1VQ5T 1N6AA 2JN0A 4LD6A 3L2VA 1BI0A 1Y96A 2VXEA 4DA4A 1Q86U 2PVGB 1LJOA 3C95A 3LGFA 1BI3A 3GNGA 1WNLA 2Y4XA 4Y28E 3RKXA 2E6NA 5GANe 4ATOA 1WPYA 4BI4A 2V8IA 4XAXB 3OS0A 4E7HA 3JCMe 4VUBA 4C8QE 4M75A 5HK0A 2K5FA 2VUBA 4MZTA 4M78A 4EMGA 2RJCA 3CBPA 3JCMg 2X4YA 5KCHA 5HKCA 2KSSA 4C8QF 3OW2S 5LJ3e 2ZPIB 2K2VA 2RM4A 2IVWA 4C92C 2QEXA 1QP3A 1YCYA 2DD5A 5LJ3g 5CR2A 1QVFS 3MP1A 2XK0A 3OS2A 3V8KA 1M1KU 2RH2A 1I81A 3CCMA 1MGQA 4PJOG 3VJPA 4DQ2A 4F7UA 3GLXA 1UGQB 1M1FA 4C92B 1JBMA 2DZ9A 4HT9A 4M7AF 2ZCFB 4HCBA 3FEOA 1PSFA 1XQHA 5D6WA 1YHQT 3X24B 3HSBA 3A5ZB 4BY6C 4J7FA 4IUQA 2DJZA 1VQ6T 3CD6A 1Q7YC 1WQWA 2GQVA 3N5BB 4P5NA 5LJ5h 5GAN2 4OGEA 5GMKh 4OMFB 3H6ZA 3QHSA 3GIBA 2EQKA 3MEUA 1NJIU 2DD4A 1HXDA 1KQ1A 4NS5A 3X28B 2DTOA 4BY6B 4XU1A 4C8QD 1KHCA 4JUVA 4B9XA 1VQ9A 3QYHB 1X75C 4OP0A 2O4XB 4BACA 4C0GA 3CCLA 3DLMA 3CMAA 1UGPB 4EMHA 3CEYA 3M59A 1B34B 1YIJT 2M0OA 2VGMA 1VUBA 3CCRA 1JRIA 5GMKi 2XG8D 3HP9A 3VKIA 2MAMA 2K5LA 2XHCA 3QIIA 1WJSA 3URGA 5LJ5e 5LL6S 4R56A 3LWHA 3OBYA 3VUBA 5GMKe 4FL6A 3O8VA 5LJ5g 4M77C 4OVAA 3M55A 2ZPHB 4JRQA 3QKJA 1VQMA 2RI2A 1NPRA 3PGGA 3SDZA 1VQNA 2DXCA 2OAUA 3LGLA 4PKCC 3OS5A 1IREB 5LJ3j 1BYMA 4M7DE 1ZQ1A 3M58A 3WVEB 4M77B 1TH7A 3CCVT 3QSUA 4FM4B 3RMQA 4C0DC 3NTHA 1Y7XA 4J6YA 5CKEA 3WXMB 5GAOm 3OYIA 3QUIA 1LNXA 2KDSA 4C8QC 3CD6T 3QBYA 3PIOA 2BUDA 2RI5A 3M57A 1YITT 2XKOC 2V8KA 2LRQA 2RK1A 4KT0E 4C0DB 3OYGA 3RESA 3CC7A 4Y91A 3OYLA 2M16A 2ZPEB 4LDYA 3QO3A 3J81E 2LVMA 3NTIA 3JCMW 3HPWA 2WSFE 4O5VA 3RMSA 3V8LA 4C8QB 5FLXE 4E7KA 3CMAT 3M56A 3M5AA 3V7CA 1O9SA 4M7AC 2RD1A 2LC4A 4LDWA 3SWNA 5A0DA 3CCRT 2EJFA 2DO3A 2JVVA 4JLGA 4OB3B 2P0QA 3MHXA 2G3RA 4IUTA 1ZHIA 2QXFA 4BD3A 1VQ5A 3UWNA 3RKWA 3JCMX 2RHZA 4PJOF 4M7DD 1KD1C 1JB0E 4RKUE 1D3BB 4M7AB 3DB4A 5AYFA 3OA6A 1WQ7A 3MEWA 1VQ8T 2KMTA 3L2QA 1G3TA 1U1SA 5LJ5j 1YJ9T 3G6ET 3JCMf 2L3RA 1Q82U 4FSXA 4LDVA 4NL2A 3QG1A 2HNIA 2DAQA 3JCMQ 5LJ3f 4X34A 1NPPA 4M75E 2Y90A 2VGNA 2VC8A 2VYTA 4M78E 4N4GA 5GAOq 4QVZA 1NE8A 3OSSC 2RJDA 2XU8A 3L2WA 3LLRA 2EQMA 2O01E 3TCJA 2VV5A 3FRNA 2E70A 1Y07A 3INZA 4BI8B 1KC8U 3CCJA 4BE0A 3CC7T 1K9MC 3FB9A 4PJOD 4ZGEB 5DLOA 5CIUA 4Q5WA 4F7UE 3HFOA 3KUFA 5GAMd 1R8OB 4A53A 2E5QA 5J3BA 1VQ6A 3PNWC 2K3YA 3JCMP 1N9RA 4C5HA 4M7DG 3TEEA 3L2UA 3MP6A 1VQOT 4MDXA 3UPUA 2LTOA 2YRVA 1Q81C 3JB9H 2WSCE 3MEVA 4JLIA 1YIJA 2P0KA 2QQ9A 1BIAA 3CCUT 5CVIA 4C92A 3PFSA 2P0PA 4M75D 2QQRA 1WGSA 4M78D 1I5LA 4KBMB 4BB7A 2MI6A 2CYZB 2D6FA 3EFRA 3JB9D 4ZGDB 4J6WA 4DOVA 1KQSS 3HRUA 2PVDB 2BKDN 4E7JA 2F5TX 2K4YA 5LJ5f 3VYHB 5IT9E 1VQ4A 1DJ7B 3LW5E 3GPLA 4R55A 1WJRA 4E47A 2XD0A 2FL7A 4PJOC 1PSEA 2LCCA 1G5VA 2QQBA 2O4XA 4QQGA 4IKFA 3A8LB 5CQYA 3CCJT 3MEAA 3CCVA 3L2RA 2R57A 5I2MA 2WSEE 1WJQA 4NOYA 4PJOB 5IN1A 4EMKC 2EAYA 1M1GA 2JZ2A 3G71T 4UC4A 4BE2A 2A3LA 5A0GA 2EIFA 2VXFA 1YI2A 1YITA 3CBMA 3ZBDA 3OSVA 4II1A 3P8DA 3M4YA 3SB2A 2HQEA 5GMKm 2CZ6B 1M90U 4M75G 4EMKB 2EYQA 3QPHA 4M78G 2DXBA 2PUKB 3KBGA 4JRKA 3JB9G 3OBWA 3LH0A 2L89A 2CKKA 2FHDA 3BW1A 2X4WA 1XNIA 2RHYA 4M77A 3CPWS 2RK2A 2RJEA 4OF1A 3PMIA 4X9DA 3HRSA 1S72T 2K5IA 1UEBA 5CKBA 5FU6C 4J83A 2GFUA 4F7UG 2L5QA 4XQ3A 3CXCS 2CGHA 5I2SA 3DKMA 5DLQE 3RKYA 3V8JA 4JS4A 1VQ8A 1VQ4T 4HA8A 1UB4A 4A54A 3P8BB 2DTIA 2L8DA 4KUIA 2R5MA 5FU6B 4C0FA 2QQSA 4OB1B 4QVDA 3OYNA 1K73C 1YJ9A 2BIVA 3G6EA 1FX7A 1M8VA 4C8QA 3JSCA 4XTWA 5GAN6 2RHXA 3I55T 3OYYA 3F70A 4XTYA 1KQSA 4XTVA 3M4GA 2C06A 4EDUA 3OW2A 4M7DF 1HK9A 1BIBA 4ME7A 3ZEHA 1QVFA 2XDPA 3EAEA 1KHIA 2EQUA 3HFNA 2XIDA 1VQLA 3OB9A 5CQXA 1YI2T 2X4JA 5CKHA 4ZTFA 5GAMg 5A0LA 5GANd 1N8RC 5GAOl 1D3BA 4JRIA 4BE1A 1K8AC 4M7AA 4V2SA 1OZ2A 1Q7YU 3HHTB 1Y71A 3BDLA 3OYBA 2KK4A 1RI0A 1H641 3OMCA 1O75A 4ZGJB 2K3XA 2RA2A 3JCMd 2RHIA 4LDUA 4CI0C 2HAXA 4C0ZA 1G3YA 5FRMA 2DKGA 4PNOA 5GAOn 5GAOp 3FIFA 5LJ3d 4BI3A 5CCAA 2I2LA 2PQWA 4J8OA 4IUUA 1VQOA 3VU3C 5DY9A 3NFCA 2JTMA 2DZCA 2LDMA 4RCBA 1X01A 3CPFA 4ELYC 2HD0A 3RIRA 4CRIA 3CCUA 4N4IA 2YLCA 5EG2A 4RG2A 4IUPA 3CPWA 3OYFA 1G3WA 5M9OA 3GF5A 2E64A 4XU2A 3CC2T 4XU3A 2GCXA 5J26A 4C92E 3JCMb 3Q1JA 4IUVA 4L5GA 2E1HA 1AHJB 3CXCA 3PMTA 4KUDK 1SSFA 3I56A 4O6JA 2H3JA 3MCAB 2LQKA 3LX7A 3LYIA 1Q86C 2ZZDA 3M54A 4HKEA 4A4HA 5CO7A 1VIEA 4C5EA 2DIQA 4M75F 1MHNA 1W2BS 4A4FA 4M78F 1VQLT 4ZN3A 4MMLA 3FC3A 4WF2A 3JB9F 3JAME 3TU4K 1OZ3A 2K57A 3FJPA 2FB7A 5HK3A 3OYMA 1YJNT 3NTKA 3MP8A 1KQ2A 4FT4A 3C94A 4J6XA 5GAMj 1K8AU 1EIFA 5CKDA 3G71A 2QA4T 4F7UF 5LJ5d 4N0AC 4FIBA 4JDSA 4M7DC 3FLGA 5DM7R 3E19A 3T9NA 3LWIA 1M1KC 2DXTA 3OYAA 2DXUA 3JRZA 2MWPA 4HCCA 3QXEB 2CS7A 3HKSA 2OTJT 1QP2A 2CZ1B 3BDUA 3QYGB 4N4HA 1UGSB 2LQ8A 3X26B 1QVGS 1H3ZA 4C92D 3OY9A 4LDXA 4M7DB 2LT4A 1KD1U 2DEQA 4L6V5 4OB2B 4YTLA 5D6XA 3OYKA 1BI1A 2EQJA 1S72A 5FRNA 4PLIA 4X9CA 2MF2A 4DOWA 4PJOA 4HT8A 3HRTA 4M77E 3SD4A 3TREA 3S3NA 2EFIA 2R5AA 4E7IA 3I56T 1NJIC 4GY5A 2EKOA 4GLKA 5C6SA 2GF7A 5GAN4 3QDRB 2KVQG 2PVOB 3MO8A 3P8HA 4ELZC 2F5KA 2HQXA 3PT9A 4EMKA 3I55A 3CMEA 2XDDA 3H8ZA 3DB3A 1B34A 2D9TA 1OYXA 5GANg 2MWOA 4RMOA 3OYJA 4J5YA 5FU7C 1K9MU 2DPPB 3ASKA 5GAN3 4JS5A 1V29B 3ZFJA 1W2BA 5GAMf 3J7AF 2LT1A 3GNFB 3BFMA 4C92G 4D6WA 3UT1A 1W4SA 3S6WA 3ME9A 3OYCA 1Y96B 1NZ9A 3QZ9B 4IURA 2RJFA 4M75C 5FU7B 2B8AA 4M78C 1M5Q1 2A7YA 4BDZA 1U1TA 4QVCA 2KY9A 1VQPT 1Q81U 4M7AE 4M77D 3WVDB 3VUZA 3OYDA 5GMKl 1I8FA 3G4ST 5A2QE 3GP8A 1VQ7T 4L59A 3PIPA 4A4EA 4M75B 1FXXA 4M78B 2M9UA 3QJYA 3G7ZA 3L1AA 3V7RA 4NL3A 4ZTJA 4A4GA 1VQKT 1FWZA 5GAMh 1QVGA 2P4TA 3CC4T 2RB6A 1GXIE 4EPCA 3E9FA 3CCSA 2DTHA 1YJWT 2JNGA 1JJ2S 2E41A 2XICA 1M9SA 3CBOA 3VYGA 2EJ9A 5I21A 3CCEA 3QZ5B 4F7UB 3CC2A 4MZMA 4B9WA 2V8JA 4XTZA 5C0MA 3HL8A 5KE3A 3JB9I 2AHJB 3CMET 3S3OA 3RUXA 4XU0A 1JJ2A 2CZ7B 2PU9B 4MMKA 2YHTA 4C5IA 2LCLA 3OMGA 3L42A 1U8RA 2E12A 3JCMc 3S3MA 5GAOr 2ZGWA 1QW1A 2M1HA 5GAMe 5KH6A 4M7AD 5GANj 2IG0A 1LOJA 2PUOB 2XI9A 2ZPBB 4JRPA 1YJNA 3V7SA 2QEXT 4M77G 1M4ZA 1RL2A 3X20B 3SFMA 2DIGA 5CK9A 2XDBA 1BI2A 1I4K1 3AHUA 1Q82C 3CCMT 1X6OA 2QA4A 5CKFA 2QDYB 2RHUA 2E65A 3BY7A 3C12A 2E6ZA 3META 3GOXA 4TVRA 3CCQA 3A8OB 4LD9K 4ZN1A 2OTJA 3OYEA 5KCOA 3DLLA 3A8MB 2KAFA 2YLBA 4FU6A 4XTUA 3JB9J 4C8QG 1KC8C 2D0QB 2FYKA 2QI2A 3FDRA 4RCCA 5HY6A 2WACA 3VV0A 4FT2A 3CCST 3CCET 2CZ0B 3UDCA 2JUFA 1VQ9T 3CCLT 1VIFA 2OTLA 1K73U 3OYHA 3M9QA 5GAN7 4M7AG 2Y4YA 4E7LA 4C92F 1OI1A 5FROA 5IAYA 1UGRB 3R6OA 2DVEA 2ZPGB 4PJOE 4MDWA 2RI3A 1IZ6A 4PLLA 4JJNK 5L8RE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQE A;  4PLI A;  1N27 A;  3NTH A;  3SD4 A;  3OYI A;  3OQ5 A;  2EFI A;  3S3N A;  2R5A A;  4E7I A;  2RO0 A;  2EKO A;  2L89 A;  2CKK A;  2FHD A;  3LH0 A;  4GY5 A;  2GF7 A;  2X4W A;  2JTF A;  1XNI A;  2RHY A;  2BUD A;  2RI5 A;  3QBY A;  5C6S A;  2NLU A;  2X35 A;  2RJE A;  2LRQ A;  3MO8 A;  3PMI A;  3P8H A;  2F5K A;  2HQX A;  3OYG A;  4QW2 A;  3OYL A;  2GFU A;  2M16 A;  5D6Y A;  4BDY A;  2LVM A;  3NTI A;  3H8Z A;  3DB3 A;  2D9T A;  4HCZ A;  1OYX A;  4E7K A;  3OS1 A;  2MWO A;  3OYJ A;  2L8D A;  3ASK A;  2R5M A;  2QQS A;  3OYN A;  2G3R A;  2BIV A;  4IUT A;  4Z02 A;  2X4X A;  4BD3 A;  3QJ6 A;  3UWN A;  5J39 A;  4C5G A;  2RHZ A;  3UT1 A;  2RHX A;  3S6W A;  5KE2 A;  2R58 A;  3F70 A;  3ME9 A;  4QQ6 A;  3OYC A;  4EDU A;  3DB4 A;  4IUR A;  2RJF A;  2B8A A;  3C4S A;  4QQD A;  3MEW A;  3ZEH A;  3OA6 A;  4BDZ A;  2XDP A;  3EAE A;  3L2Q A;  2EQU A;  3OYD A;  3E9G A;  3OB9 A;  2GFA A;  4ZTF A;  4PL6 A;  3L2V A;  4L59 A;  4LD6 A;  4A4E A;  2L3R A;  4BE1 A;  1OZ2 A;  3BDL A;  3OYB A;  1RI0 A;  3LGF A;  2DAQ A;  3OMC A;  4X34 A;  4ZTJ A;  4N4G A;  2K3X A;  2E6N A;  4A4G A;  2RHI A;  2VYT A;  4QVZ A;  2RJD A;  3OS0 A;  4E7H A;  5FRM A;  3E9F A;  3L2W A;  3LLR A;  2EQM A;  2PQW A;  4IUU A;  2RJC A;  5KCH A;  2X4Y A;  4B9W A;  5C0M A;  4BE0 A;  5KE3 A;  5CIU A;  4Q5W A;  2LDM A;  3S3O A;  3MP1 A;  3KUF A;  2XK0 A;  3OS2 A;  4C5I A;  2E5Q A;  3OMG A;  3L42 A;  4CRI A;  3PNW C;  2K3Y A;  4N4I A;  4C5H A;  3S3M A;  4RG2 A;  4IUP A;  2M1H A;  3L2U A;  5KH6 A;  3MP6 A;  3OYF A;  5M9O A;  2IG0 A;  2LTO A;  2YRV A;  3FEO A;  5J26 A;  5D6W A;  3Q1J A;  4IUV A;  3MEV A;  2DIG A;  3PMT A;  1SSF A;  2P0K A;  4IUQ A;  3LX7 A;  3LYI A;  3PFS A;  4A4H A;  4C5E A;  2QQR A;  1WGS A;  2DIQ A;  1MHN A;  4PLL A;  4A4F A;  2RHU A;  3H6Z A;  3FC3 A;  3MET A;  2EQK A;  3GOX A;  3MEU A;  1OZ3 A;  4NS5 A;  3OYM A;  1KHC A;  2BKD N;  3MP8 A;  3NTK A;  4B9X A;  3OYE A;  5KCO A;  4BAC A;  2O4X B;  4E7J A;  3DLM A;  4FU6 A;  3CEY A;  2M0O A;  3FDR A;  1WJR A;  2WAC A;  3FLG A;  2LCC A;  3QII A;  1G5V A;  1WJS A;  3OYA A;  2O4X A;  4QQG A;  2MWP A;  4IKF A;  3MEA A;  4FL6 A;  3O8V A;  3L2R A;  4N4H A;  2R57 A;  4OVA A;  3OYH A;  1WJQ A;  3M9Q A;  1H3Z A;  4E7L A;  3QKJ A;  5IN1 A;  3OY9 A;  1OI1 A;  2JZ2 A;  2RI2 A;  5FRO A;  5IAY A;  4UC4 A;  4BE2 A;  3LGL A;  5D6X A;  3OYK A;  4II1 A;  2RI3 A;  3P8D A;  2EQJ A;  5FRN A; 
#chains in the Genus database with same CATH topology
 4N0A A;  1TWB A;  2QQA A;  3SWN C;  2LNV A;  2EJG A;  3UAT A;  4AT1 B;  1K73 R;  1ZBJ A;  4WTO B;  2V1R A;  4AFS C;  5GMK j;  2X35 A;  4AG2 C;  3SWN B;  3CCQ T;  4HCK A;  2LX9 A;  1D1C A;  5KYY A;  1K8A R;  1UDL A;  2ED1 A;  1HD3 A;  4XK8 E;  3CCQ Q;  2QYZ A;  2EYW A;  1UJ0 A;  5GAN h;  1QVP A;  4QQ6 A;  3RER A;  3E1S A;  1VQK A;  3JCM h;  4OB0 B;  1IHV A;  2YUP A;  5KYU B;  3EHR A;  1K9A A;  4J9C A;  2GFA A;  4PL6 A;  3EFS A;  1N6A A;  2JN0 A;  1BI0 A;  1Y96 A;  4DA4 A;  1Q86 U;  1BI3 A;  2Y4X A;  4Y28 E;  3NGP A;  1WPY A;  4XAX B;  2CP0 A;  1VA7 A;  5HKC A;  1Q86 R;  2ED0 A;  4C92 C;  1D0X A;  2QEX A;  5CR2 A;  1QVF S;  2EGC A;  3MP1 A;  5KYW A;  3OS2 A;  3V8K A;  5KYX A;  2KT8 A;  4LUE A;  2NUZ A;  4C92 B;  1M1F A;  2NUT A;  4M7A F;  1FMK A;  1JQQ A;  2J05 A;  5D6W A;  2A08 A;  3X24 B;  3HSB A;  1VQP Q;  4AFU C;  1Q81 R;  3N5B B;  4P5N A;  5GMK h;  3H6Z A;  3EH2 A;  4C8Q D;  1VQ9 A;  4OP0 A;  1X75 C;  2O4X B;  1UGP B;  3CC4 Q;  2HQH A;  1JXO A;  2VGM A;  1YJW Q;  3CCR A;  1SPK A;  2XG8 D;  2XHC A;  2LQW A;  3QII A;  1WJS A;  4DBR A;  5LJ5 e;  5LL6 S;  4F14 A;  1UTI A;  1BB9 A;  2L3P A;  5LJ5 g;  2RI2 A;  3I9Q A;  2ZAE A;  2OAU A;  3OS5 A;  5LJ3 j;  1BYM A;  3IQL A;  2OJ2 A;  4FW1 A;  2BZX A;  3NTH A;  2FRW A;  2KDS A;  3CD6 T;  3QBY A;  3PIO A;  3M57 A;  4LNP A;  1N5Z A;  3VRY A;  3V8L A;  2E5K A;  4E7K A;  3CD6 Q;  3CMA T;  2RD1 A;  1WLP B;  2JVV A;  4OB3 B;  2G3R A;  4BD3 A;  3CMA Q;  2BTT A;  5AYF A;  1WQ7 A;  1RAB B;  2QGF B;  3L2Q A;  1FMW A;  4ANJ A;  1X2K A;  1Q82 U;  4NL2 A;  2VGN A;  1VQM Q;  2VYT A;  2CP5 A;  4QVZ A;  8AT1 B;  3OSS C;  2XU8 A;  1KJW A;  1PWT A;  1WHL A;  2QTV A;  1KC8 U;  1Y07 A;  4BI8 B;  4PJO D;  3FB9 A;  1IB8 A;  4ZGE B;  5DLO A;  3HFO A;  5GAM d;  4JZ4 A;  4J9B A;  4C5H A;  2YWW A;  3MP6 A;  4MDX A;  1Q81 C;  2WSC E;  1YNZ A;  1BIA A;  5CVI A;  3PFS A;  2P0P A;  2MI6 A;  4R0K A;  3EFR A;  4FSS A;  2PVD B;  1NYG A;  2F5T X;  5LJ5 f;  5IT9 E;  1BK2 A;  5KYY B;  3GPL A;  2BZ8 A;  2FL7 A;  3NHN A;  2QQB A;  3CCJ T;  3CCV A;  3I5R A;  5I22 A;  3E2U A;  5IN1 A;  4EMK C;  3G71 T;  1M1G A;  4UC4 A;  2A3L A;  1YIT A;  2JM8 A;  4II1 A;  3CCJ Q;  3SB2 A;  1D1B A;  2DX1 A;  2HQE A;  4EMK B;  2EYQ A;  3G71 Q;  1VQ6 Q;  2PUK B;  2PZ1 A;  3CXC P;  2AKK A;  4RTU A;  2RJE A;  1S72 T;  3UF4 A;  4J83 A;  3CXC S;  2CGH A;  2D1X A;  5DLQ E;  3RKY A;  1ZUY A;  1UB4 A;  4KUI A;  2R5M A;  2K6D A;  4OB1 B;  1PKT A;  2H3E B;  2HDA A;  4C8Q A;  5GAN 6;  3F70 A;  4XTY A;  2C06 A;  3ZEH A;  3HFN A;  5CKH A;  5HCK A;  3PVL A;  1D3B A;  4JRI A;  1NEB A;  1H64 1;  1B3Q A;  2F2W A;  4OMQ A;  1M2V B;  1W6X A;  3FIF A;  5LJ3 d;  1GL5 A;  2PQW A;  3VU3 C;  5DY9 A;  1H3H A;  1WDX A;  2JTM A;  2LDM A;  1X01 A;  5EG2 A;  1OX9 A;  3OYF A;  4A63 B;  2GCX A;  2ESW A;  3JCM b;  2KRM A;  3Q1J A;  4L5G A;  4IIM A;  1VQ8 Q;  3PMT A;  4KUD K;  1OOT A;  4O6J A;  1NBE B;  2ZZD A;  4HKE A;  4C5E A;  5CO7 A;  1YJ9 Q;  4MML A;  5HK3 A;  2FZK B;  2JS2 A;  1M27 C;  3U23 A;  4Z8A A;  5CKD A;  1RAD B;  4M7D C;  3TVT A;  5DM7 R;  4OMP A;  1X6G A;  3OYA A;  4J9I A;  4HCC A;  2OTJ T;  2RNA A;  4C92 D;  2DL7 A;  4M7D B;  2HZY A;  5FWC A;  2LJ1 A;  5D6X A;  3OYK A;  1BI1 A;  1TXQ A;  1ABQ A;  2MF2 A;  4DOW A;  4PJO A;  1EFN A;  4HT8 A;  2DRK A;  3EG3 A;  3HRT A;  1WI7 A;  2EFI A;  3CCU Q;  1YFN A;  1NJI C;  3I56 T;  1M3A A;  2BZY A;  4ELZ C;  2DEU A;  1MV3 A;  1TUG B;  3CME A;  2XDD A;  3I56 Q;  1B34 A;  2D9T A;  5KYN A;  5GAN g;  2DFU A;  2HKN A;  1K9M U;  1V1C A;  3ASK A;  5GAN 3;  1SHG A;  3BFM A;  1WHM A;  3S6W A;  3ME9 A;  4M75 C;  2C0T A;  2A7Y A;  4BDZ A;  2C0O A;  4QVC A;  1OEB A;  1K9M R;  3WVD B;  5GMK l;  1I8F A;  1VQ7 T;  3PIP A;  4M75 B;  1CKB A;  1FXX A;  4DBQ A;  4LE9 A;  3V7R A;  6AT1 B;  1AT1 B;  3TSW A;  1QVG A;  1VQ7 Q;  3E9F A;  3CCS A;  2QDL A;  2JNG A;  1YP5 A;  2XIC A;  1M9S A;  4FYV B;  3QZ5 B;  3CC2 A;  2E4H A;  2GGR A;  2YT6 A;  3RUX A;  2CZ7 B;  2PU9 B;  3OMG A;  3L42 A;  2D8J A;  4X1V A;  2JW4 A;  2LQN A;  5GAM e;  1TUD A;  1LOJ A;  2PUO B;  4Z88 A;  1M4Z A;  1I4K 1;  4CC2 A;  3CCM T;  1X6O A;  2DER A;  1RAC B;  1UEC A;  3CCQ A;  1NG2 A;  4LD9 K;  1HYO A;  3OYE A;  3A8M B;  2YLB A;  4FU6 A;  4XTU A;  4C8Q G;  1Y0M A;  2WAC A;  4FT2 A;  3VS2 A;  3CCE T;  2FPE A;  3EG0 A;  2Y4Y A;  1UGR B;  3CCE Q;  4PJO E;  4MDW A;  4IIO A;  1JJ2 A;  1IZ6 A;  4PLL A;  1QWE A;  4PK4 A;  3HTR A;  1N27 A;  5GAN f;  1T3L A;  2EYX A;  1YWP A;  1VQN T;  5GAN 5;  1XTD A;  2JTF A;  3M0Q A;  5GAN 8;  2KBT A;  4QW2 A;  4BDY A;  3ULR B;  1UE9 A;  2FVU A;  4HCZ A;  5CAI A;  1BKB A;  1V76 A;  2QA4 Q;  1VQP A;  2EYY A;  1U3O A;  4LN2 A;  4A4K A;  4FYY B;  4F16 A;  2FZG B;  1OV3 A;  1XOV A;  2F69 A;  2X4X A;  4C5G A;  5KE2 A;  1QCO A;  1ZBX A;  3A8H B;  9ATC B;  2SRC A;  3KXT A;  4MZP A;  2ZPF B;  4QQD A;  3C4S A;  2EWN A;  1VYV A;  4HVW A;  3CC4 A;  1M90 C;  4FW2 A;  1YJW A;  3L2Z A;  1VQ5 T;  4LD6 A;  2VXE A;  4QKU A;  1LJO A;  3C95 A;  1WNL A;  4ATO A;  4KGX B;  2EPD A;  4BI4 A;  2V8I A;  2VUB A;  4M78 A;  4EMG A;  2RJC A;  5KCH A;  2CP6 A;  1SKU B;  4WCI A;  4C8Q F;  5LJ3 e;  3OW2 S;  2K2V A;  2RM4 A;  2DD5 A;  5LJ3 g;  2A28 A;  2X3W D;  1M1K U;  2RH2 A;  4PJO G;  3VJP A;  1WXU A;  4HVV A;  2KE9 A;  2ZCF B;  3THK A;  4HCB A;  3FEO A;  1YHQ T;  1RAF B;  4BY6 C;  1M1K R;  2W0Z A;  3CD6 A;  3G4S Q;  1Q7Y C;  1QWF A;  5GAN 2;  1TG0 A;  1YHQ Q;  4NS5 A;  4BY6 B;  4XU1 A;  2JS0 A;  2F2V A;  1XJW B;  3DLM A;  4C0G A;  3CMA A;  1YIJ T;  2JM9 A;  1B34 B;  2O2O A;  5GMK i;  2H8H A;  1NEG A;  3VUB A;  1KFZ A;  3O8V A;  2ZPH B;  1VQM A;  1NPR A;  2DXC A;  3LGL A;  4PKC C;  2YSQ A;  1ZQ1 A;  4KGZ B;  2EGA A;  4J9E A;  1TH7 A;  2CRE A;  1WXT A;  4FM4 B;  3RMQ A;  1Y7X A;  5GAO m;  5CKE A;  2BUD A;  1PHT A;  3REB B;  2LRQ A;  4JJD A;  3REA B;  5IXB A;  3OYL A;  3J81 E;  1W1F A;  3QO3 A;  3NTI A;  3JCM W;  2AZS A;  2WSF E;  3EFO A;  4M7A C;  4LDW A;  2DMO A;  5A0D A;  2P0Q A;  3UWN A;  1RI9 A;  2RHZ A;  4PJO F;  3CCL Q;  4M7D D;  1JB0 E;  4RKU E;  3M0P A;  4M7A B;  1VOM A;  4JJB A;  5D7U A;  2MOX A;  1GCQ A;  3G6E T;  2L3R A;  2HEQ A;  2RQU A;  3QG1 A;  2HNI A;  1WA7 A;  4JPB W;  5LJ3 f;  3JCM Q;  4N4G A;  2VC8 A;  5GAO q;  4M78 E;  3FRN A;  2D8H A;  3INZ A;  4K11 A;  5FW9 A;  2EGE A;  3CCJ A;  4Q5W A;  5J3B A;  1VQ6 A;  1A0N B;  2ABL A;  2KRO A;  2PTK A;  1N9R A;  1ZSZ A;  2ROL A;  1VQO T;  2YRV A;  3JB9 H;  3MEV A;  2EKH A;  2QQ9 A;  1QVF P;  2M02 A;  4M75 D;  1VQO Q;  1MMN A;  1I5L A;  4KBM B;  4HXJ A;  2K9G A;  4J9H A;  2J6K A;  2M51 A;  4ZGD B;  2P4R A;  2P84 A;  4JJC A;  2BKD N;  4PFZ A;  4E7J A;  4JZ3 A;  1WIE A;  2RPN A;  2MIO A;  2QG9 B;  1WJR A;  4E47 A;  2XD0 A;  4LXC A;  2NUP A;  2D0N A;  2R57 A;  5I2M A;  2WSE E;  4NOY A;  4BE2 A;  1IO6 A;  1EZZ B;  1GBQ A;  2O31 A;  2ECZ A;  3QPH A;  4M78 G;  2KYB A;  3KBG A;  3JB9 G;  1LVK A;  3BW1 A;  1WXB A;  2RHY A;  4M77 A;  2RMO A;  2RK2 A;  4OF1 A;  4X9D A;  3HRS A;  2KGT A;  1UEB A;  1M30 A;  4Y92 A;  3EGD A;  5I2S A;  1BCM A;  1JO8 A;  1VQ8 A;  1VQ4 T;  4A54 A;  2V26 A;  4C0F A;  1RAH B;  1M2O A;  3OYN A;  1K73 C;  1YJ9 A;  1T0J A;  2BIV A;  3A98 A;  3OYY A;  4XTV A;  2DA9 A;  7AT1 B;  1VQ4 Q;  1HK9 A;  4ME7 A;  2XDP A;  1MMD A;  3EAE A;  1QMC A;  5CQX A;  5GAN d;  2QGG A;  1ARK A;  1K8A C;  1ZSG A;  1Y71 A;  1AWO A;  2GTO A;  2RQR A;  3JCM d;  2K3X A;  2RA2 A;  4CI0 C;  1D1A A;  1M3B A;  2JT4 A;  4PJN A;  2MYS A;  4J8O A;  2HBW A;  4IUU A;  1IGQ A;  2HL3 A;  2OX7 A;  3EG9 B;  1SEM A;  1AWJ A;  4GLM A;  2ATC B;  4RCB A;  2PNI A;  3CPF A;  1AD5 A;  3CCU A;  5IHN A;  2YLC A;  4RG2 A;  4IUP A;  3NMZ C;  1W2B P;  4D8K A;  4XU3 A;  2G6F X;  1AWW A;  1AHJ B;  3CXC A;  1WHK A;  1G8X A;  2JMA A;  3I56 A;  1UFF A;  2H3J A;  2LQK A;  3MCA B;  3LYI A;  1Q86 C;  4A4H A;  2E3H A;  1MHN A;  1WZO A;  1W2B S;  4M78 F;  4ZN3 A;  3JB9 F;  3JAM E;  3TU4 K;  1Q82 R;  1OZ3 A;  1R77 A;  2K57 A;  2MK5 A;  1YJN T;  1LPL A;  2IIM A;  4AMC A;  3EFO B;  3M0R A;  4N0A C;  1Q95 G;  5IHI A;  3FLG A;  3E19 A;  2DXT A;  1KC8 R;  3JRZ A;  1AZE A;  3QXE B;  2CS7 A;  1QP2 A;  1SSH A;  2LQ8 A;  3X26 B;  1MNE A;  3OY9 A;  4LDX A;  2LT4 A;  1KD1 U;  4OB2 B;  4YTL A;  3EGX A;  3I5S A;  1JU5 C;  2QK0 A;  1JEG A;  1ZA2 B;  3TRE A;  4M77 E;  1Y57 A;  1OQK A;  2DM1 A;  3S3N A;  2R5A A;  4E7I A;  4GY5 A;  2EKO A;  1KD1 R;  5C6S A;  3QDR B;  3I55 A;  1ZSZ C;  2VAS A;  2MWO A;  3OYJ A;  2J06 A;  1ZSZ B;  4D6W A;  3OYC A;  1Y96 B;  1U1T A;  2KY9 A;  3OYD A;  1G2B A;  1PD1 A;  4OML A;  3L1A A;  4ZTJ A;  1VQK T;  2KT1 A;  2P4T A;  2RB6 A;  1GXI E;  1PKS A;  5KYW B;  2E41 A;  2YUQ A;  3VYG A;  5KYX B;  3CCE A;  1S72 Q;  1GFD A;  3M0T A;  4XTZ A;  1ACM B;  5KE3 A;  2NUT B;  3JB9 I;  3S3O A;  2X3X D;  4QT7 A;  2YHT A;  2LCL A;  2DL3 A;  2CUB A;  1U8R A;  3S3M A;  5GAO r;  1NM7 A;  1IHW A;  2M1H A;  4M7A D;  1U06 A;  2DLP A;  2O9V A;  2QEX T;  4M77 G;  3SFM A;  2FPF A;  1BI2 A;  1Q82 C;  2QA4 A;  5CKF A;  2CSQ A;  2RHU A;  3GOX A;  2YRD A;  4TVR A;  3EGU A;  4ZN1 A;  1X2Q A;  2MPX C;  5KCO A;  2KAF A;  1K0S A;  1R0C B;  3JB9 J;  1KC8 C;  2QI2 A;  2FYK A;  2QAZ A;  1KIK A;  5HY6 A;  3VV0 A;  1YCS B;  2JUF A;  1VQ9 T;  4E7L A;  2ZPG B;  4DBH A;  2RI3 A;  3ER0 A;  5L8R E;  1C1A A;  2RN8 A;  2QTX A;  1OU9 A;  2KQW A;  2MMP A;  1N8R U;  4E2F B;  2RO0 A;  3RR6 A;  2AT1 B;  3PTA A;  2O9S A;  2NLU A;  2JTE A;  2JOY A;  2COZ A;  3M53 A;  1N8R R;  3A8G B;  4RG8 A;  2DBM A;  3G4S A;  1QCF A;  2DNU A;  3QJ6 A;  1LCK A;  2OTJ Q;  2R58 A;  1YHQ A;  2OTL T;  2E10 A;  1ZA1 B;  4M77 F;  3E9G A;  4D8D A;  3RDV A;  3L2V A;  2OTL Q;  1QCN A;  3GNG A;  5GAN e;  4RUG A;  4E7H A;  3OS0 A;  2QAS A;  3JCM e;  4C8Q E;  5HK0 A;  2K5F A;  3CBP A;  3JCM g;  2ZPI B;  1IXD A;  1UJY A;  1CSK A;  1YCY A;  2DBK A;  4DQ2 A;  4F7U A;  3PE0 A;  4FYW B;  3GLX A;  1JBM A;  1ZUK A;  1PSF A;  1XQH A;  3A5Z B;  4J7F A;  4IUQ A;  2DJZ A;  4GBQ A;  5FWB A;  1WQW A;  1MMA A;  5LJ5 h;  4OGE A;  2RQT A;  1FYN A;  3QHS A;  2EQK A;  3MEU A;  1C0M A;  1KQ1 A;  2A37 A;  2EQI A;  2FG0 A;  1KHC A;  4JUV A;  2AZV A;  3QYH B;  1PRL C;  3CCL A;  2I0N A;  3CEY A;  3M59 A;  1OPL A;  1VUB A;  1T0H A;  2ROT A;  3HP9 A;  3VKI A;  1MV0 B;  1RAE B;  3URG A;  5GMK e;  3PGG A;  1M3C A;  1IRE B;  1MND A;  3M58 A;  1SG5 A;  3CCV T;  2HSE B;  4C0D C;  3OYI A;  3CCM Q;  1H92 A;  3M0U A;  3QUI A;  1LNX A;  1U5S A;  4C8Q C;  2RI5 A;  1YIT T;  2XKO C;  2V8K A;  4CC4 B;  2RK1 A;  1RLQ C;  4C0D B;  3OYG A;  4Y91 A;  2M16 A;  4LDY A;  2LVM A;  1Z9Q A;  3HPW A;  3RMS A;  4O5V A;  4C8Q B;  5FLX E;  3M56 A;  2OAW A;  3SWN A;  2KI7 A;  3MHX A;  4IUT A;  3RKW A;  3QWY A;  1D3B B;  2KMT A;  1G3T A;  1U1S A;  4PJL A;  1SHF A;  2LZ6 B;  3JCM f;  4FSX A;  2DAQ A;  4X34 A;  1BBZ A;  5KYU A;  1VQN Q;  1X43 A;  8ATC B;  3L2W A;  2FRY A;  3VS4 A;  3LLR A;  2O01 E;  4PJM A;  2GNC A;  2VV5 A;  2E70 A;  3CC7 T;  1K9M C;  2RQW A;  5CIU A;  4F7U E;  2CDT A;  3KUF A;  2E5Q A;  1WHH A;  2K3Y A;  3JCM P;  3TEE A;  3CC7 Q;  1K1Z A;  3UPU A;  1TSF A;  1KQS P;  2ENM A;  1PG5 B;  3OW2 P;  4C92 A;  1MMG A;  4BB7 A;  1VQ5 Q;  2CYZ B;  2D6F A;  3MKD A;  1KQS S;  3HRU A;  3QWX X;  3NPF A;  2DET A;  3VYH B;  2C0I A;  1W70 A;  1VQ4 A;  1TS9 A;  4PJO C;  1PSE A;  2KNB B;  2LCC A;  2O4X A;  4QQG A;  5CQY A;  3L2R A;  3PVQ A;  2DYB A;  1WJQ A;  4PJO B;  2EAY A;  4AG1 C;  2VXF A;  1ZX6 A;  3CBM A;  3OSV A;  3CPW P;  4OMN A;  2CZ6 B;  3CQT A;  2K79 A;  4JRK A;  3OBW A;  3LH0 A;  2CKK A;  1XNI A;  3CPW S;  1K4U S;  3PMI A;  2K5I A;  5CKB A;  4F7U G;  5EC7 A;  1YIJ Q;  3DKM A;  3V8J A;  5L23 A;  2X9H A;  4KH1 B;  2K2M A;  2DE0 X;  2DTI A;  2L8D A;  4QVD A;  2FEI A;  3VS7 A;  3ZL7 C;  1M8V A;  1MUZ A;  3JSC A;  2RHX A;  4EDU A;  1PNJ A;  2EBP A;  2IPO B;  1TOV A;  1QVF A;  1KHI A;  2EQU A;  3OB9 A;  1YI2 T;  2X4J A;  5IH2 A;  5A0L A;  5GAO l;  4BE1 A;  1I5O B;  3BDL A;  2KK4 A;  2COY A;  3OYB A;  3OMC A;  4LDU A;  3G1J A;  1OUL A;  2EYZ A;  2DKG A;  1B7T A;  5GAO n;  1YI2 Q;  4BI3 A;  1AEY A;  1GRI A;  2LNH B;  2DZC A;  1WX6 A;  2HKQ B;  3RIR A;  1QQJ A;  3RNJ A;  3RBB B;  1G3W A;  3GF5 A;  2E64 A;  3CC2 T;  3VS5 A;  5J26 A;  2J7I A;  4C92 E;  2E1H A;  1SSF A;  3M54 A;  2DIQ A;  2LP5 A;  4A4F A;  3G6E Q;  1VQL T;  1SRL A;  4WF2 A;  3FJP A;  3OYM A;  1KQ2 A;  4FT4 A;  2JJ9 A;  5GAM j;  1K8A U;  3G71 A;  1VQL Q;  1R0B G;  4F7U F;  2AKL A;  4FIB A;  1RAG B;  3LWI A;  1M1K C;  4ZNX A;  1E7O A;  2FZC B;  2MWP A;  3HKS A;  3BDU A;  3QYG B;  1UGS B;  2M0Y A;  1H3Z A;  4B6M A;  2DEQ A;  1M8M A;  2LX7 A;  1S72 A;  2V1Q A;  2DRM A;  4PLI A;  2CH4 W;  3SD4 A;  2F2X A;  1SF9 A;  1PD0 A;  2KVQ G;  2PVO B;  4CC7 A;  2F5K A;  2HQX A;  3PT9 A;  4EMK A;  3H8Z A;  2L3S A;  1OYX A;  4RMO A;  1NYF A;  1OPK A;  5FU7 C;  1HSQ A;  2DPP B;  4JS5 A;  3ZFJ A;  2GQI A;  1RUW A;  4HVU A;  1W2B A;  1AOJ A;  2LT1 A;  2YRC A;  3GNF B;  4C92 G;  1W4S A;  1BU1 A;  5FU7 B;  2RJF A;  2B8A A;  4M78 C;  1M5Q 1;  4RTX A;  1I07 A;  1VQP T;  1Q81 U;  3VUZ A;  3GP8 A;  5A2Q E;  4L59 A;  2AK5 A;  3H0I A;  4A4E A;  4EIK A;  3UA7 A;  4M78 B;  2M9U A;  2KR3 A;  2KYM A;  1FWZ A;  5GAM h;  1Z9Z A;  3CC4 T;  3H0H A;  4EPC A;  2FPD A;  1YJW T;  3CBO A;  5I21 A;  2EJ9 A;  4LUD A;  4B9W A;  5C0M A;  2AHJ B;  4MMK A;  3QDF A;  1M2V A;  2YUO A;  4DEY A;  2JXB A;  1I0C A;  4ESR A;  2E12 A;  1I1J A;  4M4Z A;  2IG0 A;  2ZPB B;  3V7S A;  3A1P A;  3X20 B;  2MCN A;  3AHU A;  2BE7 D;  4KRT A;  3C12 A;  1AZG B;  2E6Z A;  4RTW A;  2OTJ A;  1RLP C;  3DLL A;  1RAA B;  2D0Q B;  2CP7 A;  2NYS A;  2CZ0 B;  4F17 A;  2HCK A;  1UG1 A;  3UDC A;  1K0X A;  2BE9 B;  1KSW A;  1K76 A;  2OTL A;  3OYH A;  5GAN 7;  4C92 F;  5FRO A;  5IAY A;  3R6O A;  2DVE A;  5GJV B;  3VS3 A;  1QLY A;  3JCM V;  2K3B A;  3LH5 A;  1UGV A;  1KG1 A;  3X25 B;  4M7D A;  1NLO C;  2DL4 A;  3OQ5 A;  1VQM T;  3FJ5 A;  5J39 A;  1N9S A;  4J7I A;  2HBP A;  1YJN Q;  1P92 A;  2L3Q A;  3EHQ A;  5D6Y A;  1GCQ C;  3J80 E;  2DK3 A;  4RTY A;  1UHF A;  3OS1 A;  4KUL A;  1H8K A;  2RF0 A;  3EG2 A;  4BUG A;  3JCM J;  1VQ7 A;  1GBR A;  4OGC A;  1FMV A;  4Z02 A;  1YBY A;  4E6R A;  4OMO A;  3H9N A;  1TTH B;  1EX4 A;  1G3S A;  4XTX A;  5LJ3 h;  1D0Z A;  1PM3 A;  4PFO A;  2PVG B;  3LGF A;  1TU0 B;  3RKX A;  2E6N A;  1X69 A;  1QKX A;  4VUB A;  4M75 A;  4MZT A;  2HL5 C;  2COW A;  2X4Y A;  3D7S B;  2KSS A;  2VB6 A;  1WHJ A;  2IVW A;  4J9G A;  1QP3 A;  2XK0 A;  2W10 A;  1I81 A;  3CCM A;  1MGQ A;  1IGU A;  1UGQ B;  2L0A A;  2DZ9 A;  4Z89 A;  4HT9 A;  2SEM A;  2DL8 A;  1VQ6 T;  2GQV A;  1WYX A;  1E6G A;  4OMF B;  3AT1 B;  3EG1 A;  3GIB A;  1NJI U;  2DD4 A;  1HXD A;  3X28 B;  2DTO A;  4B9X A;  1VQK Q;  1YN8 A;  4BAC A;  2NUP B;  4EMH A;  4J9D A;  2M0O A;  1D0Y A;  2J6O A;  1JRI A;  2DYI A;  2MAM A;  1NJI R;  2K5L A;  4R56 A;  3LWH A;  3OBY A;  4FL6 A;  1OU8 A;  4M77 C;  4OVA A;  3H0F A;  4E7S A;  3M55 A;  4JRQ A;  2EVR A;  3QKJ A;  3SDZ A;  1VQN A;  4ORZ A;  3VS0 A;  1OX8 A;  4M7D E;  3KFV A;  3WVE B;  2CT4 A;  4M77 B;  2QEX Q;  3QSU A;  4RTT A;  1KK7 A;  3EGD B;  4J6Y A;  3TQ7 P;  3WXM B;  4AFZ C;  2KRN A;  1VYU A;  1NLP C;  4KT0 E;  3RES A;  3CC7 A;  1IRX A;  2ZPE B;  1WFW A;  3I35 A;  2E3I A;  3M5A A;  3V7C A;  1O9S A;  2KEA A;  2LC4 A;  3CCR T;  2EJF A;  2DO3 A;  3SHW A;  1C6V X;  4JLG A;  2DJQ A;  1VQ5 A;  1ZHI A;  2QXF A;  3JCM X;  1VQ9 Q;  2DVJ A;  2YUN A;  3VS1 A;  2KXC A;  5IHK A;  1KD1 C;  3DB4 A;  1UHC A;  3OA6 A;  3MEW A;  1B07 A;  3CCR Q;  1VQ8 T;  5LJ5 j;  1YJ9 T;  3VRZ A;  2F1L A;  4LDV A;  1NPP A;  4M75 E;  4CC3 A;  1PCX A;  1NE8 A;  2RJD A;  2EQM A;  3TCJ A;  4FYX B;  2Z0W A;  4OMM A;  4BE0 A;  2CT3 A;  4E7Z A;  5AT1 B;  3M0S A;  1R8O B;  4A53 A;  3PNW C;  2CP3 A;  4M7D G;  3L2U A;  1D09 B;  4DBF A;  1WHG A;  2LTO A;  4JLI A;  1YIJ A;  2P0K A;  1HJD A;  3CCU T;  1T3S A;  2QQR A;  1WGS A;  1YWO A;  3MPU B;  4M78 D;  1E6H A;  3JB9 D;  4J6W A;  4DOV A;  2K4Y A;  1ZUU A;  1DJ7 B;  3LW5 E;  4R55 A;  1G5V A;  2L2P A;  4IKF A;  3A8L B;  4FCY A;  3EGX B;  3MEA A;  2JZ2 A;  5A0G A;  1YI2 A;  2EIF A;  3H41 A;  4J9F A;  3ZBD A;  2YXY A;  3P8D A;  3M4Y A;  5GMK m;  1M90 U;  4M75 G;  2DXB A;  1S1N A;  2A36 A;  2L89 A;  2VKN A;  2FHD A;  4PJJ A;  2X4W A;  2VVK A;  5FU6 C;  2GFU A;  1M90 R;  2L5Q A;  4XQ3 A;  1AVZ C;  4JS4 A;  4HA8 A;  3P8B B;  1J3T A;  2NWM A;  5FU6 B;  2QQS A;  1AWX A;  3G6E A;  1FX7 A;  4XTW A;  3I55 T;  1KQS A;  4M7D F;  3M4G A;  1QKW A;  3OW2 A;  1BIB A;  3JV3 A;  2XID A;  1VQL A;  4ZTF A;  3I55 Q;  5GAM g;  1N8R C;  4M7A A;  3CCV Q;  4V2S A;  1OZ2 A;  3R6N A;  3HHT B;  1Q7Y U;  1RI0 A;  1O75 A;  4ZGJ B;  2CUD A;  2RHI A;  2HAX A;  4C0Z A;  1G3Y A;  5FRM A;  4PNO A;  5GAO p;  1YIT Q;  5CCA A;  2I2L A;  1VQO A;  1Q7Y R;  2A0F B;  3NFC A;  5I11 A;  4ELY C;  2HD0 A;  4CRI A;  4N4I A;  2HMA A;  3CPW A;  2X51 A;  5M9O A;  4XU2 A;  4RTZ A;  5GJW B;  1GFC A;  4IUV A;  2FO0 A;  2EW3 A;  2JMC A;  2XMF A;  3LX7 A;  1VIE A;  4M75 F;  4DEX A;  3FC3 A;  2FB7 A;  3NTK A;  3MP8 A;  5IXF A;  3C94 A;  4J6X A;  2CH4 A;  1EIF A;  1QVG P;  2QA4 T;  5LJ5 d;  4KH0 B;  1GCP A;  4JDS A;  3T9N A;  2OI3 A;  2DXU A;  1UUE A;  2LJ0 A;  2CZ1 B;  4N4H A;  1PC0 A;  1QVG S;  2YDL A;  5ECA A;  1TUC A;  4L6V 5;  2EQJ A;  5FRN A;  4X9C A;  4KGV B;  2LCS A;  4GLK A;  3TSZ A;  2DF6 A;  2GF7 A;  5GAN 4;  1RAI B;  3MO8 A;  3P8H A;  3DB3 A;  1BCO A;  3O5Z A;  4J5Y A;  2GBQ A;  4RTV A;  4F04 B;  1V29 B;  3J7A F;  5GAM f;  3VS6 A;  3UT1 A;  1G83 A;  1NZ9 A;  3QZ9 B;  4IUR A;  4AFQ C;  2RQV A;  4M7A E;  2K7A A;  4M77 D;  3G4S T;  2B86 A;  1JJ2 P;  2GTJ A;  3QJY A;  1X27 A;  3G7Z A;  4NL3 A;  4A4G A;  1VYT A;  1X6B A;  2DTH A;  1JJ2 S;  3GBQ A;  1ZLM A;  4F7U B;  4MZM A;  2J6F A;  1JXM A;  2V8J A;  3HL8 A;  1CKA A;  2KRS A;  3CME T;  4XU0 A;  2CSI A;  4C5I A;  2LJ3 A;  1ABO A;  3JCM c;  3EG9 A;  2ZGW A;  1QW1 A;  3BE3 A;  5KH6 A;  5GAN j;  2O88 A;  1F1B B;  3CME Q;  2XI9 A;  4JRP A;  2AIR B;  3EH1 A;  1SRM A;  1YJN A;  3SEM A;  1RL2 A;  5CK9 A;  2DIG A;  2XDB A;  2DIL A;  2QDY B;  2CP2 A;  2E65 A;  1PRM C;  3BY7 A;  3MET A;  3A8O B;  2KXD A;  3FDR A;  4RCC A;  3CCS T;  3C0C A;  3MJX A;  4PFP A;  3CCL T;  1VIF A;  1K73 U;  3M9Q A;  4M7A G;  2LMJ A;  3CCS Q;  1OI1 A;  2DL5 A;  3UA6 A;  2HSP A;  2VWF A;  3CC2 Q;  2Y90 A;  4JJN K; 
#chains in the Genus database with same CATH homology
 3JCM V;  4N0A A;  1KG1 A;  3X25 B;  1N27 A;  2QQA A;  2QTX A;  2LNV A;  2EJG A;  2KQW A;  3SWN C;  4M7D A;  2MMP A;  1N8R U;  3OQ5 A;  5GAN f;  1VQM T;  2RO0 A;  1VQN T;  5GAN 5;  5J39 A;  1N9S A;  1XTD A;  2JTF A;  4J7I A;  2HBP A;  5GMK j;  3PTA A;  2NLU A;  2X35 A;  3SWN B;  2JOY A;  4QW2 A;  5GAN 8;  1P92 A;  3CCQ T;  5D6Y A;  4BDY A;  3M53 A;  2LX9 A;  3J80 E;  2FVU A;  4HCZ A;  2DK3 A;  5CAI A;  3A8G B;  1BKB A;  3OS1 A;  3ER0 A;  4RG8 A;  1VQP A;  4A4K A;  4KUL A;  3G4S A;  4XK8 E;  1VQ7 A;  4BUG A;  3JCM J;  1XOV A;  2F69 A;  4OGC A;  2X4X A;  1QVP A;  1YBY A;  3QJ6 A;  4Z02 A;  5GAN h;  4C5G A;  5KE2 A;  2R58 A;  1YHQ A;  4QQ6 A;  1ZBX A;  3A8H B;  3KXT A;  3E1S A;  3RER A;  4MZP A;  2ZPF B;  1VQK A;  4QQD A;  2E10 A;  2EWN A;  3C4S A;  4OB0 B;  3JCM h;  2OTL T;  3CC4 A;  1G3S A;  4XTX A;  4M77 F;  1M90 C;  5LJ3 h;  3E9G A;  3L2Z A;  1YJW A;  2GFA A;  4PL6 A;  3EFS A;  1VQ5 T;  1N6A A;  2JN0 A;  4LD6 A;  3L2V A;  1BI0 A;  1Y96 A;  2VXE A;  4DA4 A;  1Q86 U;  2PVG B;  1LJO A;  3C95 A;  3LGF A;  1BI3 A;  3GNG A;  1WNL A;  2Y4X A;  4Y28 E;  3RKX A;  2E6N A;  5GAN e;  4ATO A;  1WPY A;  4BI4 A;  2V8I A;  4XAX B;  3OS0 A;  4E7H A;  3JCM e;  4VUB A;  4C8Q E;  4M75 A;  5HK0 A;  2K5F A;  2VUB A;  4MZT A;  4M78 A;  4EMG A;  2RJC A;  3CBP A;  3JCM g;  2X4Y A;  5KCH A;  5HKC A;  2KSS A;  4C8Q F;  3OW2 S;  5LJ3 e;  2ZPI B;  2K2V A;  2RM4 A;  2IVW A;  4C92 C;  2QEX A;  1QP3 A;  1YCY A;  2DD5 A;  5LJ3 g;  5CR2 A;  1QVF S;  3MP1 A;  2XK0 A;  3OS2 A;  3V8K A;  1M1K U;  2RH2 A;  1I81 A;  3CCM A;  1MGQ A;  4PJO G;  3VJP A;  4DQ2 A;  4F7U A;  3GLX A;  1UGQ B;  1M1F A;  4C92 B;  1JBM A;  2DZ9 A;  4HT9 A;  4M7A F;  2ZCF B;  4HCB A;  3FEO A;  1PSF A;  1XQH A;  5D6W A;  1YHQ T;  3X24 B;  3HSB A;  3A5Z B;  4BY6 C;  4J7F A;  4IUQ A;  2DJZ A;  1VQ6 T;  3CD6 A;  1Q7Y C;  1WQW A;  2GQV A;  3N5B B;  4P5N A;  5LJ5 h;  5GAN 2;  4OGE A;  5GMK h;  4OMF B;  3H6Z A;  3QHS A;  3GIB A;  2EQK A;  3MEU A;  1NJI U;  2DD4 A;  1HXD A;  1KQ1 A;  4NS5 A;  3X28 B;  2DTO A;  4BY6 B;  4XU1 A;  4C8Q D;  1KHC A;  4JUV A;  4B9X A;  1VQ9 A;  3QYH B;  1X75 C;  4OP0 A;  2O4X B;  4BAC A;  4C0G A;  3CCL A;  3DLM A;  3CMA A;  1UGP B;  4EMH A;  3CEY A;  3M59 A;  1B34 B;  1YIJ T;  2M0O A;  2VGM A;  1VUB A;  3CCR A;  1JRI A;  5GMK i;  2XG8 D;  3HP9 A;  3VKI A;  2MAM A;  2K5L A;  2XHC A;  3QII A;  1WJS A;  3URG A;  5LJ5 e;  5LL6 S;  4R56 A;  3LWH A;  3OBY A;  3VUB A;  5GMK e;  4FL6 A;  3O8V A;  5LJ5 g;  4M77 C;  4OVA A;  3M55 A;  2ZPH B;  4JRQ A;  3QKJ A;  1VQM A;  2RI2 A;  1NPR A;  3PGG A;  3SDZ A;  1VQN A;  2DXC A;  2OAU A;  3LGL A;  4PKC C;  3OS5 A;  1IRE B;  5LJ3 j;  1BYM A;  4M7D E;  1ZQ1 A;  3M58 A;  3WVE B;  4M77 B;  1TH7 A;  3CCV T;  3QSU A;  4FM4 B;  3RMQ A;  4C0D C;  3NTH A;  1Y7X A;  4J6Y A;  5CKE A;  3WXM B;  5GAO m;  3OYI A;  3QUI A;  1LNX A;  2KDS A;  4C8Q C;  3CD6 T;  3QBY A;  3PIO A;  2BUD A;  2RI5 A;  3M57 A;  1YIT T;  2XKO C;  2V8K A;  2LRQ A;  2RK1 A;  4KT0 E;  4C0D B;  3OYG A;  3RES A;  3CC7 A;  4Y91 A;  3OYL A;  2M16 A;  2ZPE B;  4LDY A;  3QO3 A;  3J81 E;  2LVM A;  3NTI A;  3JCM W;  3HPW A;  2WSF E;  4O5V A;  3RMS A;  3V8L A;  4C8Q B;  5FLX E;  4E7K A;  3CMA T;  3M56 A;  3M5A A;  3V7C A;  1O9S A;  4M7A C;  2RD1 A;  2LC4 A;  4LDW A;  3SWN A;  5A0D A;  3CCR T;  2EJF A;  2DO3 A;  2JVV A;  4JLG A;  4OB3 B;  2P0Q A;  3MHX A;  2G3R A;  4IUT A;  1ZHI A;  2QXF A;  4BD3 A;  1VQ5 A;  3UWN A;  3RKW A;  3JCM X;  2RHZ A;  4PJO F;  4M7D D;  1KD1 C;  1JB0 E;  4RKU E;  1D3B B;  4M7A B;  3DB4 A;  5AYF A;  3OA6 A;  1WQ7 A;  3MEW A;  1VQ8 T;  2KMT A;  3L2Q A;  1G3T A;  1U1S A;  5LJ5 j;  1YJ9 T;  3G6E T;  3JCM f;  2L3R A;  1Q82 U;  4FSX A;  4LDV A;  4NL2 A;  3QG1 A;  2HNI A;  2DAQ A;  3JCM Q;  5LJ3 f;  4X34 A;  1NPP A;  4M75 E;  2Y90 A;  2VGN A;  2VC8 A;  2VYT A;  4M78 E;  4N4G A;  5GAO q;  4QVZ A;  1NE8 A;  3OSS C;  2RJD A;  2XU8 A;  3L2W A;  3LLR A;  2EQM A;  2O01 E;  3TCJ A;  2VV5 A;  3FRN A;  2E70 A;  1Y07 A;  3INZ A;  4BI8 B;  1KC8 U;  3CCJ A;  4BE0 A;  3CC7 T;  1K9M C;  3FB9 A;  4PJO D;  4ZGE B;  5DLO A;  5CIU A;  4Q5W A;  4F7U E;  3HFO A;  3KUF A;  5GAM d;  1R8O B;  4A53 A;  2E5Q A;  5J3B A;  1VQ6 A;  3PNW C;  2K3Y A;  3JCM P;  1N9R A;  4C5H A;  4M7D G;  3TEE A;  3L2U A;  3MP6 A;  1VQO T;  4MDX A;  3UPU A;  2LTO A;  2YRV A;  1Q81 C;  3JB9 H;  2WSC E;  3MEV A;  4JLI A;  1YIJ A;  2P0K A;  2QQ9 A;  1BIA A;  3CCU T;  5CVI A;  4C92 A;  3PFS A;  2P0P A;  4M75 D;  2QQR A;  1WGS A;  4M78 D;  1I5L A;  4KBM B;  4BB7 A;  2MI6 A;  2CYZ B;  2D6F A;  3EFR A;  3JB9 D;  4ZGD B;  4J6W A;  4DOV A;  1KQS S;  3HRU A;  2PVD B;  2BKD N;  4E7J A;  2F5T X;  2K4Y A;  5LJ5 f;  3VYH B;  5IT9 E;  1VQ4 A;  1DJ7 B;  3LW5 E;  3GPL A;  4R55 A;  1WJR A;  4E47 A;  2XD0 A;  2FL7 A;  4PJO C;  1PSE A;  2LCC A;  1G5V A;  2QQB A;  2O4X A;  4QQG A;  4IKF A;  3A8L B;  5CQY A;  3CCJ T;  3MEA A;  3CCV A;  3L2R A;  2R57 A;  5I2M A;  2WSE E;  1WJQ A;  4NOY A;  4PJO B;  5IN1 A;  4EMK C;  2EAY A;  1M1G A;  2JZ2 A;  3G71 T;  4UC4 A;  4BE2 A;  2A3L A;  5A0G A;  2EIF A;  2VXF A;  1YI2 A;  1YIT A;  3CBM A;  3ZBD A;  3OSV A;  4II1 A;  3P8D A;  3M4Y A;  3SB2 A;  2HQE A;  5GMK m;  2CZ6 B;  1M90 U;  4M75 G;  4EMK B;  2EYQ A;  3QPH A;  4M78 G;  2DXB A;  2PUK B;  3KBG A;  4JRK A;  3JB9 G;  3OBW A;  3LH0 A;  2L89 A;  2CKK A;  2FHD A;  3BW1 A;  2X4W A;  1XNI A;  2RHY A;  4M77 A;  3CPW S;  2RK2 A;  2RJE A;  4OF1 A;  3PMI A;  4X9D A;  3HRS A;  1S72 T;  2K5I A;  1UEB A;  5CKB A;  5FU6 C;  4J83 A;  2GFU A;  4F7U G;  2L5Q A;  4XQ3 A;  3CXC S;  2CGH A;  5I2S A;  3DKM A;  5DLQ E;  3RKY A;  3V8J A;  4JS4 A;  1VQ8 A;  1VQ4 T;  4HA8 A;  1UB4 A;  4A54 A;  3P8B B;  2DTI A;  2L8D A;  4KUI A;  2R5M A;  5FU6 B;  4C0F A;  2QQS A;  4OB1 B;  4QVD A;  3OYN A;  1K73 C;  1YJ9 A;  2BIV A;  3G6E A;  1FX7 A;  1M8V A;  4C8Q A;  3JSC A;  4XTW A;  5GAN 6;  2RHX A;  3I55 T;  3OYY A;  3F70 A;  4XTY A;  1KQS A;  4XTV A;  3M4G A;  2C06 A;  4EDU A;  3OW2 A;  4M7D F;  1HK9 A;  1BIB A;  4ME7 A;  3ZEH A;  1QVF A;  2XDP A;  3EAE A;  1KHI A;  2EQU A;  3HFN A;  2XID A;  1VQL A;  3OB9 A;  5CQX A;  1YI2 T;  2X4J A;  5CKH A;  4ZTF A;  5GAM g;  5A0L A;  5GAN d;  1N8R C;  5GAO l;  1D3B A;  4JRI A;  4BE1 A;  1K8A C;  4M7A A;  4V2S A;  1OZ2 A;  1Q7Y U;  3HHT B;  1Y71 A;  3BDL A;  3OYB A;  2KK4 A;  1RI0 A;  1H64 1;  3OMC A;  1O75 A;  4ZGJ B;  2K3X A;  2RA2 A;  3JCM d;  2RHI A;  4LDU A;  4CI0 C;  2HAX A;  4C0Z A;  1G3Y A;  5FRM A;  2DKG A;  4PNO A;  5GAO n;  5GAO p;  3FIF A;  5LJ3 d;  4BI3 A;  5CCA A;  2I2L A;  2PQW A;  4J8O A;  4IUU A;  1VQO A;  3VU3 C;  5DY9 A;  3NFC A;  2JTM A;  2DZC A;  2LDM A;  4RCB A;  1X01 A;  3CPF A;  4ELY C;  2HD0 A;  3RIR A;  4CRI A;  3CCU A;  4N4I A;  2YLC A;  5EG2 A;  4RG2 A;  4IUP A;  3CPW A;  3OYF A;  1G3W A;  5M9O A;  3GF5 A;  2E64 A;  4XU2 A;  3CC2 T;  4XU3 A;  2GCX A;  5J26 A;  4C92 E;  3JCM b;  3Q1J A;  4IUV A;  4L5G A;  2E1H A;  1AHJ B;  3CXC A;  3PMT A;  4KUD K;  1SSF A;  3I56 A;  4O6J A;  2H3J A;  3MCA B;  2LQK A;  3LX7 A;  3LYI A;  1Q86 C;  2ZZD A;  3M54 A;  4HKE A;  4A4H A;  5CO7 A;  1VIE A;  4C5E A;  2DIQ A;  4M75 F;  1MHN A;  1W2B S;  4A4F A;  4M78 F;  1VQL T;  4ZN3 A;  4MML A;  3FC3 A;  4WF2 A;  3JB9 F;  3JAM E;  3TU4 K;  1OZ3 A;  2K57 A;  3FJP A;  2FB7 A;  5HK3 A;  3OYM A;  1YJN T;  3NTK A;  3MP8 A;  1KQ2 A;  4FT4 A;  3C94 A;  4J6X A;  5GAM j;  1K8A U;  1EIF A;  5CKD A;  3G71 A;  2QA4 T;  4F7U F;  5LJ5 d;  4N0A C;  4FIB A;  4JDS A;  4M7D C;  3FLG A;  5DM7 R;  3E19 A;  3T9N A;  3LWI A;  1M1K C;  2DXT A;  3OYA A;  2DXU A;  3JRZ A;  2MWP A;  4HCC A;  3QXE B;  2CS7 A;  3HKS A;  2OTJ T;  1QP2 A;  2CZ1 B;  3BDU A;  3QYG B;  4N4H A;  1UGS B;  2LQ8 A;  3X26 B;  1QVG S;  1H3Z A;  4C92 D;  3OY9 A;  4LDX A;  4M7D B;  2LT4 A;  1KD1 U;  2DEQ A;  4L6V 5;  4OB2 B;  4YTL A;  5D6X A;  3OYK A;  1BI1 A;  2EQJ A;  1S72 A;  5FRN A;  4PLI A;  4X9C A;  2MF2 A;  4DOW A;  4PJO A;  4HT8 A;  3HRT A;  4M77 E;  3SD4 A;  3TRE A;  3S3N A;  2EFI A;  2R5A A;  4E7I A;  3I56 T;  1NJI C;  4GY5 A;  2EKO A;  4GLK A;  5C6S A;  2GF7 A;  5GAN 4;  3QDR B;  2KVQ G;  2PVO B;  3MO8 A;  3P8H A;  4ELZ C;  2F5K A;  2HQX A;  3PT9 A;  4EMK A;  3I55 A;  3CME A;  2XDD A;  3H8Z A;  3DB3 A;  1B34 A;  2D9T A;  1OYX A;  5GAN g;  2MWO A;  4RMO A;  3OYJ A;  4J5Y A;  5FU7 C;  1K9M U;  2DPP B;  3ASK A;  5GAN 3;  4JS5 A;  1V29 B;  3ZFJ A;  1W2B A;  5GAM f;  3J7A F;  2LT1 A;  3GNF B;  3BFM A;  4C92 G;  4D6W A;  3UT1 A;  1W4S A;  3S6W A;  3ME9 A;  3OYC A;  1Y96 B;  1NZ9 A;  3QZ9 B;  4IUR A;  2RJF A;  4M75 C;  5FU7 B;  2B8A A;  4M78 C;  1M5Q 1;  2A7Y A;  4BDZ A;  1U1T A;  4QVC A;  2KY9 A;  1VQP T;  1Q81 U;  4M7A E;  4M77 D;  3WVD B;  3VUZ A;  3OYD A;  5GMK l;  1I8F A;  3G4S T;  5A2Q E;  3GP8 A;  1VQ7 T;  4L59 A;  3PIP A;  4A4E A;  4M75 B;  1FXX A;  4M78 B;  2M9U A;  3QJY A;  3G7Z A;  3L1A A;  3V7R A;  4NL3 A;  4ZTJ A;  4A4G A;  1VQK T;  1FWZ A;  5GAM h;  1QVG A;  2P4T A;  3CC4 T;  2RB6 A;  1GXI E;  4EPC A;  3E9F A;  3CCS A;  2DTH A;  1YJW T;  2JNG A;  1JJ2 S;  2E41 A;  2XIC A;  1M9S A;  3CBO A;  3VYG A;  2EJ9 A;  5I21 A;  3CCE A;  3QZ5 B;  4F7U B;  3CC2 A;  4MZM A;  4B9W A;  2V8J A;  4XTZ A;  5C0M A;  3HL8 A;  5KE3 A;  3JB9 I;  2AHJ B;  3CME T;  3S3O A;  3RUX A;  4XU0 A;  1JJ2 A;  2CZ7 B;  2PU9 B;  4MMK A;  2YHT A;  4C5I A;  2LCL A;  3OMG A;  3L42 A;  1U8R A;  2E12 A;  3JCM c;  3S3M A;  5GAO r;  2ZGW A;  1QW1 A;  2M1H A;  5GAM e;  5KH6 A;  4M7A D;  5GAN j;  2IG0 A;  1LOJ A;  2PUO B;  2XI9 A;  2ZPB B;  4JRP A;  1YJN A;  3V7S A;  2QEX T;  4M77 G;  1M4Z A;  1RL2 A;  3X20 B;  3SFM A;  2DIG A;  5CK9 A;  2XDB A;  1BI2 A;  1I4K 1;  3AHU A;  1Q82 C;  3CCM T;  1X6O A;  2QA4 A;  5CKF A;  2QDY B;  2RHU A;  2E65 A;  3BY7 A;  3C12 A;  2E6Z A;  3MET A;  3GOX A;  4TVR A;  3CCQ A;  3A8O B;  4LD9 K;  4ZN1 A;  2OTJ A;  3OYE A;  5KCO A;  3DLL A;  3A8M B;  2KAF A;  2YLB A;  4FU6 A;  4XTU A;  3JB9 J;  4C8Q G;  1KC8 C;  2D0Q B;  2FYK A;  2QI2 A;  3FDR A;  4RCC A;  5HY6 A;  2WAC A;  3VV0 A;  4FT2 A;  3CCS T;  3CCE T;  2CZ0 B;  3UDC A;  2JUF A;  1VQ9 T;  3CCL T;  1VIF A;  2OTL A;  1K73 U;  3OYH A;  3M9Q A;  5GAN 7;  4M7A G;  2Y4Y A;  4E7L A;  4C92 F;  1OI1 A;  5FRO A;  5IAY A;  1UGR B;  3R6O A;  2DVE A;  2ZPG B;  4PJO E;  4MDW A;  2RI3 A;  1IZ6 A;  4PLL A;  4JJN K;  5L8R E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...