2RJFA

Crystal structure of l3mbtl1 in complex with h4k20me2 (residues 12-30), orthorhombic form i
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
315
structure length
315
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 78
structure length 315
sequence length 315
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjfA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjfA03
3OB9A 2MWPA 4C5GA 3OYIA 2X4WA 3SD4A 3F70A 2L8DA 3EAEA 3PFSA 2RJEA 5D6XA 3L2QA 1WJRA 2RJCA 2R57A 2WACA 3QJ6A 4E7KA 3OS2A 1G5VA 3DLMA 2PQWA 4E7IA 3LH0A 3PNWC 3FLGA 3H8ZA 1XNIA 2GFUA 1WJSA 2RJDA 4N4HA 2EKOA 3META 3MEVA 2LVMA 2P0KA 3OQ5A 5CIUA 5C0MA 5KH6A 5J39A 5M9OA 2R58A 3L2UA 3OS0A 4LD6A 2M0OA 2RHUA 2XK0A 4IUUA 4QQGA 3DB3A 2RI3A 3OYAA 2RI2A 2IG0A 5FROA 2R5MA 2EQUA 4NS5A 3NTIA 2O4XB 2K3YA 4IUQA 4PLIA 1OZ3A 4C5EA 2B8AA 3S3NA 2F5KA 3LGLA 4IURA 4GY5A 2HQEA 3OYMA 2NLUA 4E7LA 2DIQA 2GFAA 2JTFA 2EQKA 4N4IA 3KUFA 3OMGA 3UT1A 1OZ2A 4II1A 4CRIA 2E5QA 4L59A 4OVAA 2X4YA 2EQJA 3LLRA 3MEWA 3BDLA 3DB4A 3NTHA 5C6SA 3FC3A 3OYGA 3CEYA 3OYNA 4ZTFA 4IUVA 2E6NA 2JZ2A 4C5HA 5D6YA 3S3OA 5D6WA 4IUTA 3OYKA 2RI5A 4BDZA 2O4XA 1MHNA 4UC4A 4Q5WA 3FDRA 4BDYA 3OYLA 1H3ZA 3FEOA 3LX7A 3OS1A 3ASKA 2LTOA 2GF7A 4BE0A 4BE1A 3LYIA 4E7HA 1KHCA 4ZTJA 4PLLA 3QKJA 2LRQA 2MWOA 3M9QA 3OYCA 3NTKA 3ZEHA 3MO8A 3OYFA 4FU6A 2QQSA 3OY9A 4B9XA 3Q1JA 1N27A 2D9TA 3MP1A 2BIVA 3PMTA 3OA6A 3MEAA 1RI0A 2BUDA 3OYDA 2YRVA 2DIGA 4A4EA 3MP6A 4RG2A 1SSFA 1OI1A 2R5AA 2EFIA 3L42A 4IUPA 4A4HA 4FL6A 2RHZA 4BACA 4QQDA 4QVZA 4Z02A 4C5IA 4QQ6A 3P8HA 2RO0A 3ME9A 4N4GA 4IKFA 3L2VA 3PMIA 2G3RA 5KCOA 2X4XA 3S3MA 5KCHA 3OMCA 3L2RA 2VYTA 2X35A 2XDPA 5KE3A 5KE2A 1WJQA 2RJFA 2QQRA 2EQMA 3C4SA 3E9GA 3P8DA 3MP8A 3QBYA 4QW2A 3E9FA 2L89A 3MEUA 4PL6A 3UWNA 3H6ZA 3OYBA 2BKDN 2M1HA 2LDMA 2HQXA 2FHDA 4HCZA 3S6WA 5FRNA 5FRMA 5IN1A 3OYJA 3OYHA 4B9WA 3GOXA 2DAQA 1OYXA 3LGFA 3QIIA 3L2WA 1WGSA 4A4FA 5IAYA 2K3XA 2LCCA 2RHIA 4X34A 3OYEA 2RHXA 4EDUA 4E7JA 3O8VA 2CKKA 5J26A 4BE2A 2RHYA 4BD3A 2L3RA 4A4GA 2M16A
chains in the Genus database with same CATH superfamily
3M55A 2VB6A 1WNLA 3JB9J 4MZMA 3CCVT 5GANh 1WJRA 5GMKm 1ZUKA 4IIMA 3L2RA 4FSSA 3OQ5A 5J39A 5LJ3g 1T3LA 5DLOA 3MKDA 4RCBA 1W2BS 4M78E 1TG0A 4HVWA 3PE0A 2MMPA 1WFWA 2FEIA 1PSEA 1CKBA 2L5QA 4FW1A 5CKFA 5HKCA 1YJNT 3NTIA 4IUQA 1MMDA 3ULRB 5A0GA 3CD6A 3EGUA 1M9SA 2F5KA 2HQEA 1ZBJA 4J7FA 1K0SA 1RLQC 4CRIA 3GF5A 3CCLA 4C0ZA 3G4SA 3LLRA 2E6ZA 1D1CA 3MHXA 3G6ET 1UECA 1WLPB 5GAOp 2CP0A 1YJWA 1V1CA 2QAZA 1UFFA 4BDZA 1BYMA 2QA4Q 2DERA 2PVGB 1YBYA 4BY6C 3OYYA 2FPDA 2PVDB 3X26B 4DA4A 4C92C 2DRKA 3DKMA 4HCCA 1BI0A 2AK5A 1OEBA 3OYCA 1JRIA 1XTDA 1GFCA 1WQWA 3X20B 1Y96B 3RR6A 2FZGB 1TH7A 3OSVA 2KSSA 2V8JA 2K79A 3G71A 2XD0A 5FLXE 1K9MR 1KQ1A 1WJQA 2DJZA 2CT3A 2M0YA 2RM4A 4CC2A 1M1GA 4ANJA 1EFNA 2CSQA 4GLKA 1WA7A 4GLMA 3VS0A 2DYIA 3N5BB 2JOYA 5GAN6 5LJ5f 4O5VA 4FCYA 4BD3A 1D1AA 1S1NA 4LE9A 4KRTA 4M7DF 3M0QA 1VQ4A 3SWNC 1RADB 2L8DA 4J9DA 2HKNA 2CH4W 3REAB 4MZPA 3SFMA 4M77E 1XNIA 3EG2A 3META 3MEVA 2E3HA 1OU8A 4C8QD 2O4XB 1Q86U 1OZ3A 1ARKA 4GBQA 4GY5A 4E7LA 2XDDA 1VQMT 4E7ZA 5LJ5d 3QDRB 2E5QA 4DQ2A 3FC3A 3NTHA 4PFPA 4JRQA 3UDCA 1JJ2P 5I2SA 2C0TA 1KQ2A 4C5HA 1MMGA 1SG5A 4F7UB 3CC7T 4M7DA 3T9NA 2GTJA 2IVWA 2EGCA 2LTOA 5GAN8 5L23A 3QKJA 1Q86R 3M57A 3FJPA 1W1FA 2X3WD 4J83A 1N27A 3CD6Q 1X2QA 2QXFA 3J80E 1SKUB 4YTLA 1QKWA 1V76A 4R55A 1VQ9A 1X43A 2JM9A 1QCFA 5FW9A 3G4SQ 4WCIA 1I1JA 2RO0A 3QG1A 4N4GA 3CCUA 1AZGB 2X4XA 3BW1A 2EYZA 4XTYA 2KNBB 1YJWQ 1FWZA 1AT1B 4OGCA 1IHWA 3CCET 3TSWA 2EIFA 2ABLA 3TU4K 2DZCA 1IREB 2DM1A 2YDLA 4M7AB 2QTVA 4JS4A 1HJDA 3O8VA 1VQOT 1VQ7A 1JXMA 1XQHA 1RABB 3G71Q 3X25B 2M16A 3CCVQ 1FMVA 2LJ1A 1ZSZC 1BIBA 1VQ6T 2RA2A 2DL7A 2R57A 3QJ6A 8AT1B 4E7KA 1H8KA 1OQKA 4ZN1A 4E7IA 2O9VA 2J6OA 3LH0A 4EMHA 5LJ3h 4RTWA 2RB6A 5GANd 3JB9I 1U1TA 3DB3A 4HA8A 2EQUA 3AHUA 2NUPA 2NLUA 5CKEA 4JJCA 1B3QA 1S72T 1OZ2A 3G6EQ 2EQJA 1VQKA 4XU2A 1WXUA 3CBOA 2V1QA 2RQRA 2HL5C 4EMKB 5GANj 1X01A 4C8QG 1YCSB 3A1PA 2EYQA 2YWWA 2QASA 3VS4A 1JBMA 3CCMA 2DTIA 4RTTA 4RCCA 2XMFA 3MP1A 1VQOA 3RKYA 1RI0A 1UE9A 1UUEA 3RUXA 1E6HA 4RG2A 1JEGA 4C8QC 4A4HA 2LC4A 4QVZA 4Z02A 2PTKA 1M3AA 3QJYA 3PMIA 1RI9A 4JZ4A 1G8XA 1X27A 2KXDA 3H0FA 2C06A 2J05A 1PC0A 2GCXA 4JRPA 5KE3A 2ENMA 2RJFA 3E9GA 1M1KC 4PJMA 1M27C 5KYWB 4FYYB 4QW2A 1LCKA 3VYHB 3CCSA 5KYUA 2C0OA 2SEMA 4RKUE 2HBPA 3VU3C 3JCMg 4B9WA 3GOXA 1AWJA 3X24B 3I55T 4F7UF 3EHQA 4J6XA 4M7DE 2VXFA 4E7JA 2OTJA 1VQ9Q 2K2MA 2VVKA 1SPKA 5CK9A 4PJJA 2EJ9A 4AMCA 2K57A 4J8OA 2I2LA 2E64A 3CCUQ 1KC8U 2K9GA 1AOJA 5D6XA 1BI2A 4LDYA 3R6OA 4FW2A 3HRTA 1M90U 2X3XD 3EFOB 3GBQA 2PQWA 4Z88A 3VUBA 3EGXA 1VIFA 1RAEB 3CMEA 3HPWA 2V8KA 1AHJB 4LD6A 1VIEA 3CCQT 3JSCA 1BI1A 1KC8C 3ER0A 3DLLA 2YXYA 1U5SA 1WYXA 1M2VB 5FWBA 4A63B 3EG0A 1SEMA 4ESRA 2L3QA 1KC8R 2P4TA 3A8LB 4M75C 3RIRA 3C12A 1QVFS 1R0BG 4F7UA 1M90R 1VYVA 2YRCA 2QEXT 3HFNA 3CC7Q 3H0HA 4J6WA 2DA9A 3M0TA 5HCKA 1ZHIA 4J9IA 1QLYA 3LYIA 1SF9A 2E10A 2JTEA 2LRQA 1KQSA 2DEUA 4XTWA 3EG3A 3OA6A 1QP3A 1KG1A 2D6FA 3EG9B 1M3CA 1FMKA 3RESA 3JB9H 1Y71A 3OW2S 3V7SA 3HTRA 1GCQC 1VQKQ 2KBTA 2DXCA 1ZX6A 2G3RA 5KCOA 2QQ9A 1CSKA 3CCEQ 2OAUA 2QA4T 3A8HB 2HCKA 4M7AD 2E65A 1Q82C 1AVZC 4C0GA 1VQLA 1ZA2B 4HCZA 3THKA 3CCMQ 3M0SA 5IN1A 4C92F 3LWHA 2PU9B 1C6VX 2RK1A 2HDAA 1VQOQ 1PNJA 2KRNA 5IH2A 1IGUA 1Z9ZA 2LCLA 2OTLT 3MO8A 2DL5A 2GGRA 1JO8A 3HSBA 1JQQA 2E12A 2LX7A 4AFQC 3OYIA 3V7CA 2E3IA 3F70A 2K3BA 4FT2A 4PJNA 3VV0A 4AG2C 2RJCA 1SHGA 2HQHA 4XAXB 2QDLA 2EW3A 3CCSQ 3M59A 4WTOB 1K73C 1WPYA 4BB7A 4ELZC 1M30A 2RI3A 4ORZA 4EIKA 5LJ3d 3VS3A 1WXTA 3PVLA 3CCJT 3EGDA 3ZFJA 2F1LA 4C92A 5GMKh 4KUIA 4C92D 3PGGA 3OBWA 3HRUA 1WHGA 3JB9D 2E70A 5AYFA 4ZTFA 5D6WA 4VUBA 2JW4A 4F17A 1UEBA 3CMEQ 3ASKA 5LJ3j 1KHCA 1KK7A 4ZTJA 3QYHB 1BB9A 5GAN5 4FU6A 3OYDA 2GQIA 2JMAA 1I5LA 4F7UG 5IXFA 3M58A 2LNHB 3M54A 1EZZB 3M4GA 2LMJA 4PKCC 5KYWA 2AIRB 1TXQA 1J3TA 1I4K1 3OMCA 3P8DA 3MP8A 4RTYA 1OU9A 1WDXA 5KYNA 2FHDA 3SWNA 1X2KA 3UA7A 3I55Q 3QZ5B 4BI8B 2E41A 3CD6T 2L3SA 4OB0B 4OMMA 3JCMV 5DM7R 2OAWA 1QVGS 4MDXA 4LUDA 2DTHA 5LJ5e 4OB2B 2CKKA 5GAN4 2ZPFB 3CCLT 4HVVA 1UGSB 3G4ST 4KULA 3EFOA 4K11A 2OI3A 3PFSA 5I11A 1UDLA 2QI2A 4JPBW 2WACA 4M7AG 2ROTA 5GJWB 1I8FA 3H8ZA 1WJSA 2EKOA 3CCQQ 2V8IA 1M2VA 1UHFA 2CT4A 1NG2A 1W4SA 2RI2A 2YHTA 4LDXA 1TUGB 4M7AC 5GAMg 4X9CA 3HRSA 4J9BA 1NZ9A 2GFAA 3BY7A 3G71T 2GBQA 4HKEA 5KYYB 2A37A 2QEXQ 4A53A 4F14A 1R77A 5LL6S 2FYKA 4IUTA 3OYKA 2BZYA 3VS7A 2MIOA 1GRIA 2CYZB 4JRIA 4LDVA 2W0ZA 3CC2A 4PLLA 3RNJA 3EG9A 1YP5A 3G1JA 2VKNA 4B9XA 4C92G 1PSFA 2LZ6B 1YJ9A 3JB9G 1IGQA 2QYZA 1VQ4T 2EFIA 2RK2A 3NHNA 2JJ9A 4BACA 2VXEA 5KE2A 4CC4B 1X6BA 1NBEB 1KQSS 5GANe 4EMKC 2NUTB 3A5ZB 2M1HA 2HQXA 1ZSZA 2QQAA 5FRMA 1MV3A 3VJPA 1B7TA 3MPUB 2OTLQ 3C95A 1BIAA 2KR3A 2YLBA 2GTOA 3O5ZA 4JLIA 3M0RA 2XU8A 3SD4A 4C8QF 1F1BB 2VGMA 3FB9A 3GP8A 4KBMB 1QMCA 4KT0E 1QVPA 3PIPA 2KROA 1G3WA 4IIOA 1TU0B 2V1RA 4N4HA 2QK0A 2FRYA 5C0MA 2HEQA 4M4ZA 5M9OA 1MNDA 5CKDA 1PKSA 2KGTA 2EJFA 2VWFA 1D3BB 3CCJQ 1T3SA 2K3YA 1VQ9T 5FU7B 1MUZA 4FYWB 1W2BP 1RUWA 1VQNA 1W6XA 3CCUT 4II1A 1WZOA 4V2SA 2JUFA 1QVFA 3S3OA 1H641 3CCRA 2LT1A 2P84A 4C8QA 3URGA 3UATA 2O9SA 3OY9A 1VQ7T 4XTVA 3JCMf 4QVDA 1ZA1B 1D09B 3A98A 4A4EA 1KQSP 3CQTA 2DTOA 2A0FB 4FL6A 3OW2A 1XOVA 2DD5A 2CZ7B 4M75F 4FM4B 3CMAA 5IHNA 4R0KA 3CXCA 2JT4A 2DL3A 3C4SA 2H3EB 4DEXA 3E9FA 1NPPA 2LP5A 1FX7A 2MK5A 3M5AA 1Q81U 1WHMA 2H3JA 4JRKA 1Y07A 5IT9E 2D1XA 4TVRA 1K76A 5IAYA 3CCLQ 2O88A 3GIBA 3JCMd 2J6FA 2RHYA 3QDFA 1HK9A 1VQKT 5I22A 2YT6A 1Q81C 2DBKA 1NEGA 4F04B 5GANf 3M56A 3QUIA 2DKGA 1PRLC 3DLMA 3WVDB 2RNAA 4PJOB 2JNGA 1X6OA 2RMOA 1KD1U 4ZGEB 4Y28E 2GNCA 3BDUA 4M75A 4OB3B 2CGHA 4M75D 3CCMT 3QXEB 2R58A 2PUKB 2BZXA 1I07A 2QG9B 5GAMh 4DBRA 1D0YA 1TUDA 5KYYA 2A7YA 4PFOA 1WX6A 3UPUA 2CDTA 1KD1C 1PWTA 1NM7A 3L2ZA 2CH4A 1AWWA 2DMOA 4IUVA 1QCOA 1IHVA 1IO6A 3E1SA 1KD1R 2ATCB 3CCST 4Y92A 3H0IA 1UJYA 3QZ9B 2YLCA 2ED1A 1GCQA 3LX7A 4QT7A 3VKIA 2DLPA 4M78B 3U23A 3TEEA 5L8RE 1NE8A 5FWCA 5AT1B 2A36A 1B07A 2OTJT 1ZQ1A 2M51A 1K0XA 3RKXA 2A28A 1VQ4Q 2LQKA 5GMKl 1YIJA 2Z0WA 1C0MA 5FU6B 1D1BA 2BE7D 2EBPA 4NOYA 1X69A 3P8HA 2OX7A 2F5TX 4BI4A 1CKAA 1QWEA 2QQRA 3LWIA 1XJWB 2VC8A 4JJDA 1Y96A 2KVQG 3E2UA 3CMET 4PL6A 3TQ7P 2XG8D 3UWNA 3H6ZA 5HY6A 2JVVA 2LDMA 2LQWA 2RQWA 3X28B 1M1KU 3IQLA 5LJ3e 5EC7A 3OYHA 2PVOB 5DLQE 1WGSA 3HHTB 1VQ5A 1WHKA 5DY9A 5CVIA 2D8HA 2JTMA 1QVGA 1YWPA 1Y0MA 4C8QE 8ATCB 2FO0A 2MF2A 2Y4YA 5HK3A 2FRWA 3JAME 4R56A 1VOMA 2K5IA 1NYFA 3CMAQ 3TCJA 4Z8AA 2O01E 3BE3A 3SB2A 1M1KR 1PM3A 3P8BB 5CCAA 2RJDA 2KRMA 4PNOA 2V26A 1KJWA 1U1SA 2BE9B 3OS0A 1MV0B 4C0DC 3J7AF 1YN8A 3OYAA 1M2OA 2YUNA 3NPFA 2OJ2A 3VS6A 1YITA 2LJ0A 2D0QB 4DBHA 2RF0A 4E2FB 4E47A 2ED0A 2IPOB 4XK8E 2COWA 2I0NA 1BCMA 2ZPIB 1WHHA 2KY9A 3EHRA 2P0QA 4CC3A 4M75G 2KDSA 2HKQB 2CREA 2O4XA 3VS1A 2VGNA 3CC4A 4LD9K 4AFSC 1VQLT 1OX8A 4M77B 2DRMA 3FEOA 1Z9QA 1OPLA 4BE0A 1O9SA 1U8RA 2O31A 2KT8A 1M8MA 2MWOA 4O6JA 1VQ7Q 4J9HA 2QQSA 4MDWA 2KQWA 1TSFA 1VYTA 4OMOA 4M7AF 2XHCA 1UGVA 3L1AA 2D8JA 4AFZC 3VS5A 4XU3A 1ZLMA 3CPWA 3NFCA 1D0ZA 4HVUA 3JCMX 3L2VA 2P0PA 4E7SA 2DILA 5KCHA 4D6WA 4E6RA 3CBPA 2EQMA 2KEAA 2ROLA 1RACB 3MEUA 1BI3A 2E1HA 4N0AC 1WIEA 5FRNA 1UG1A 1ZUUA 4L5GA 3QIIA 1R8OB 3L2WA 1Q82U 1EIFA 1M5Q1 2YUQA 2HNIA 4J9CA 2QDYB 4X34A 4JDSA 2EAYA 1JU5C 1TTHB 1AWXA 3CXCS 1VQPA 5A2QE 3V8KA 3OB9A 2MWPA 4J9EA 2HMAA 4PJOD 1V29B 3RKWA 1A0NB 4M7AA 2LT4A 2H8HA 3GNFB 1G5VA 2ZPGB 3I56A 1NJIU 1PD1A 2CP3A 5LJ3f 3SHWA 4L6V5 2EYYA 1VA7A 3JB9F 2K5FA 3L2UA 3EFSA 1Q82R 1YI2A 4IUUA 4J6YA 1K73U 1UGQB 4LNPA 2QQBA 1QWFA 4Z89A 1C1AA 1NJIC 3KUFA 3OMGA 3SEMA 3UT1A 2A3LA 2HSEB 5GAMd 3EFRA 2ZCFB 4OMLA 2JS2A 2KAFA 2DD4A 2F69A 3NMZC 1TWBA 1NJIR 2JXBA 4RG8A 1JXOA 3OSSC 2M9UA 4ZNXA 4M78D 1QVFP 2GQVA 1HYOA 1IZ6A 3UF4A 1WHLA 2GF7A 3RMSA 1K73R 4MMKA 1YWOA 2DYBA 3RDVA 2OTJQ 2X4JA 3M0UA 2DNUA 2CP6A 1VUBA 2DO3A 2EVRA 3PMTA 1WI7A 4DBFA 1YITQ 1H92A 2J7IA 5GAMj 5GAOq 1IXDA 4EMKA 2EYWA 5FU7C 4HXJA 1OI1A 1RAHB 3H9NA 3MJXA 1GCPA 2HSPA 1UGPB 4QQDA 2HD0A 2XICA 2JS0A 3S3MA 3LW5E 3I35A 3KFVA 2MYSA 2WSEE 3OW2P 4OMQA 4J5YA 5EG2A 1RLPC 3CXCP 3QO3A 3VUZA 4FYXB 1KFZA 1E7OA 2EWNA 2L3PA 5GAOm 5D7UA 4HT9A 5LJ5h 2DZ9A 1Y7XA 1QKXA 1Y57A 2EQIA 4IURA 2AHJB 4XTXA 2E5KA 1OPKA 2DXBA 3AT1B 2BZ8A 3FIFA 1G2BA 5GAN2 2HZYA 4LN2A 2KMTA 4BI3A 4C0DB 1N9RA 4F7UE 3CPFA 3CC2T 1JB0E 2LQ8A 4PK4A 2P0KA 3HKSA 3M4YA 3I9QA 3SDZA 2MCNA 2SRCA 4QVCA 1YJ9T 1EX4A 3VRZA 2YSQA 4M7DB 1SRLA 2B8AA 3OBYA 1YHQA 2YUOA 2VASA 2AZSA 4PJOG 4RMOA 2XDBA 1B34B 1W70A 3DB4A 1PCXA 2B86A 2RQVA 4M77A 1KIKA 4M77D 3JCMQ 1VQLQ 3I56Q 4ZN3A 4NL2A 2F2XA 1NLPC 1RAFB 4PJOC 1VQ8A 1I81A 3OS1A 3OS5A 1YI2Q 3RBBB 1M4ZA 2RQTA 4M7AE 3EH2A 4HCKA 3JCMe 2ZPBB 3QWXX 3Q1JA 5A0LA 2CP5A 5CO7A 2DIGA 2AKKA 2KI7A 1N6AA 1H3HA 2NUZA 3C0CA 5GAOn 1SSHA 1UTIA 4EMGA 3RMQA 1LPLA 9ATCB 4M78G 4C0FA 3E19A 2PUOB 2DVEA 2XDPA 2X35A 1YCYA 1G3TA 3QBYA 3TVTA 1DJ7B 4JJBA 2QTXA 3HL8A 4FSXA 1BBZA 3ZL7C 2CUBA 2HL3A 2LJ3A 1N5ZA 4M78C 3LGFA 1E6GA 4JZ3A 1VQNT 3CPWS 2M02A 2RHIA 4OF1A 2A08A 4A4GA 5FU6C 4KGVB 3TREA 1QVGP 1YNZA 3L2QA 4C92E 2NUPB 3CCRT 4LUEA 1K4US 2LNVA 2CZ6B 2KYMA 5GMKi 3A8MB 2CSIA 5CIUA 1IRXA 5KH6A 1K9MU 1T0JA 4JLGA 1AEYA 3PTAA 2IG0A 2DJQA 2CZ1B 4C5EA 2DL8A 1JJ2S 2QGFB 1NPRA 2DF6A 1K8AU 1IB8A 3MEWA 3CMAT 1GBRA 1UGRB 1K9MC 4KGXB 3CCVA 2RI5A 1MHNA 4XU0A 2FPFA 1AWOA 4RTZA 1X6GA 1NEBA 1AD5A 1K8AC 1U06A 5KYXB 2BIVA 1YHQQ 1YJNA 2PNIA 2CP7A 3MP6A 5KYUB 2DE0X 1K8AR 4X1VA 4M77G 2RHZA 4XQ3A 1ABOA 3NGPA 5A0DA 1LOJA 2LX9A 4ZGDB 2KE9A 2J06A 4Y91A 3G6EA 3QHSA 3CPWP 1GFDA 1D0XA 1VQ8Q 1BKBA 2DFUA 5I2MA 4M77C 1M3BA 2O2OA 3WVEB 3VRYA 3C94A 1OYXA 2JM8A 3EGXB 1ZUYA 3EG1A 2COYA 2MOXA 5GMKj 4BE2A 3KBGA 2E4HA 2KT1A 1KHIA 3PT9A 1X75C 2COZA 4LXCA 1SHFA 3EAEA 5IXBA 2RJEA 5I21A 3CC2Q 3OS2A 3M53A 1MNEA 2WSCE 4WF2A 2MI6A 5GAOl 3MCAB 3JCMP 1Q86C 2RHUA 1YJ9Q 4M7DD 1PRMC 4QQGA 1LNXA 4DBQA 5FROA 2R5MA 4NS5A 1YIJT 1B34A 1RAGB 2YRDA 2LQNA 4OMNA 5CKHA 5LJ5j 3GLXA 2AT1B 2BTTA 3OYGA 1QW1A 2FVUA 4DEYA 1Q81R 2JZ2A 2IIMA 3I5RA 4UC4A 3KXTA 4Q5WA 3FDRA 1HD3A 4X9DA 4ME7A 2NWMA 4JJNK 3JCMb 3M9QA 1VQ5T 5J3BA 1LJOA 5GJVB 5CR2A 2JN0A 4N0AA 4EPCA 4IUPA 3VS2A 1SRMA 2KK4A 1VQMA 1GL5A 2CZ0B 4IKFA 4A4KA 4CC7A 1TOVA 1LVKA 4ELYC 2VYTA 2J6KA 2DL4A 1Q95G 2ZZDA 3LH5A 3G7ZA 1ACMB 1KSWA 2YUPA 3OYBA 3CC7A 1YFNA 4D8DA 2L0AA 3VYGA 3S6WA 3ZBDA 1VQNQ 1YITT 1AZEA 1WXBA 1P92A 1YJNQ 3OYEA 4EDUA 5GAMe 4KH1B 3PIOA 2NUTA 1G83A 3FRNA 1RL2A 1WQ7A 3CCRQ 4XTZA 1FYNA 1OX9A 1RAAB 2HBWA 3CC4T 4BY6B 3EGDB 1PKTA 4OMFB 3FLGA 4C92B 3JV3A 3CCEA 3WXMB 2HAXA 5LJ5g 4FYVB 4PLIA 3OYMA 2DIQA 4HT8A 2XKOC 4RTUA 2EQKA 5ECAA 2LCSA 3PVQA 3BDLA 1BCOA 5GAOr 3CEYA 3H41A 1VQ6A 1UHCA 1D3BA 2ZPHB 2KRSA 4LDUA 4M7DG 2K7AA 3D7SB 2CP2A 2Y90A 1H3ZA 5KYXA 2RQUA 3JCMW 4PJLA 3V8LA 2RH2A 2ESWA 4A54A 3REBB 5HK0A 3EH1A 1HSQA 5CAIA 3JRZA 1K9AA 2YRVA 3GPLA 4ATOA 1VQPT 4PFZA 3QWYA 4M7DC 4B6MA 3INZA 3L42A 2DEQA 3SWNB 3V8JA 4C5IA 1S72A 1K1ZA 3I56T 1OOTA 2EGAA 2DK3A 1GBQA 2ZAEA 2L89A 4KGZB 2XI9A 1YI2T 4PJOF 3UA6A 2MAMA 3OYJA 2K2VA 1GXIE 1MMNA 4M75E 2XIDA 5IHKA 3V7RA 1W2BA 2RHXA 5J26A 1TS9A 1VQMQ 2CS7A 4F16A 1M90C 4FT4A 2X4WA 4OP0A 1R0CB 4KUDK 2JMCA 5GANg 2AZVA 2EPDA 3PNWC 2CUDA 2DX1A 4OB1B 2GFUA 1MGQA 1PG5B 4JUVA 2M0OA 1YIJQ 5GAMf 2DPPB 4M78F 1I5OB 2D0NA 4AT1B 3S3NA 4J9FA 3I55A 1JJ2A 1O75A 4PJOA 4N4IA 2F2VA 1G3YA 6AT1B 1G3SA 4BUGA 4RUGA 7AT1B 3RERA 4P5NA 4JS5A 3OYNA 2E6NA 5D6YA 1Q7YU 4OMPA 4LDWA 2FZCB 3M0PA 1TUCA 1VQ5Q 1PD0A 4E7HA 1N8RU 4BE1A 3NTKA 3ZEHA 2K6DA 2ZPEB 2ZGWA 3CCQA 4FIBA 2D9TA 2EKHA 4ZGJB 1QQJA 3MEAA 2F2WA 1Q7YC 2L2PA 1M1FA 2DBMA 2G6FX 2DXTA 1OV3A 1ZSZB 3ME9A 4J7IA 4M78A 1N8RC 1Q7YR 1VQ6Q 2K4YA 1WHJA 2NYSA 2QEXA 2WSFE 1N8RR 1MMAA 4HCBA 2QGGA 2AKLA 3I5SA 1RAIB 4XTUA 2DAQA 3R6NA 4AFUC 1YHQT 3A8OB 1NLOC 2C0IA 2FB7A 1T0HA 4D8KA 1S72Q 4CI0C 2DVJA 1FXXA 4J9GA 5CQXA 4C5GA 1M8VA 3CC4Q 1QCNA 2KYBA 2EYXA 3TSZA 1VQ8T 2QA4A 3QPHA 4MZTA 4XU1A 3HP9A 4AG1C 3QSUA 2LVMA 1VYUA 2K5LA 2XK0A 4DOWA 4M77F 2X9HA 1I0CA 3LGLA 2RPNA 4C8QB 2JTFA 3BFMA 2DXUA 1NYGA 5GMKe 4OGEA 4L59A 3A8GB 1UJ0A 4OVAA 2OTLA 2X4YA 1UB4A 5C6SA 2PZ1A 4RTXA 2Y4XA 1BK2A 2X51A 4RTVA 2FG0A 4BDYA 2KXCA 2MPXC 3GNGA 5GAN7 3OYLA 4MMLA 3JCMJ 2ECZA 5IHIA 1QP2A 3OYFA 3JCMh 1OULA 1VQPQ 1FMWA 2RN8A 2BUDA 1ABQA 3CCJA 1SSFA 2R5AA 2RD1A 2W10A 4QQ6A 3HFOA 1U3OA 1PHTA 2P4RA 2FZKB 4NL3A 3FJ5A 4PJOE 1N9SA 2FL7A 1YJWT 4QKUA 4DOVA 1ZSGA 2VV5A 2BKDN 2FPEA 5CQYA 1ZBXA 5CKBA 2EJGA 1HXDA 5GAN3 2EGEA 4A4FA 1BU1A 2K3XA 2LCCA 4KH0B 3J81E 2DETA 4M75B 3QYGB 3CBMA 2L3RA 3JCMc 2VUBA
chains in the Genus database with same CATH topology
3HSBA 2E12A 1KHIA 3M55A 3PT9A 3OYIA 1X75C 1WNLA 3V7CA 3JB9J 3JAME 3F70A 4R56A 3EAEA 4FT2A 2RJEA 2K5IA 4MZMA 3VV0A 3TCJA 1WJRA 2RJCA 5GMKm 5GANh 5I21A 2O01E 3OS2A 3SB2A 3M53A 4XAXB 3M59A 3P8BB 2WSCE 4WF2A 2RJDA 5CCAA 3L2RA 1K73C 3OQ5A 5J39A 4PNOA 2MI6A 5DLOA 3MCAB 1WPYA 4RCBA 5LJ3g 4M78E 4BB7A 1U1SA 5GAOl 3JCMP 3OS0A 4ELZC 1Q86C 2RHUA 4M7DD 4C0DC 2MMPA 3J7AF 4QQGA 3CCVT 2RI3A 1LNXA 3OYAA 5FROA 1PSEA 2R5MA 4NS5A 2L5QA 5HKCA 5CKFA 5LJ3d 1YJNT 3NTIA 1YIJT 4IUQA 5A0GA 3CD6A 1B34A 1YITA 1M9SA 3CCJT 2D0QB 2F5KA 3ZFJA 2HQEA 5CKHA 4C92A 4J7FA 5GMKh 4KUIA 5LJ5j 4C92D 3PGGA 4CRIA 3GF5A 3GLXA 4E47A 3CCLA 4XK8E 4C0ZA 3G4SA 3LLRA 2E6ZA 3OBWA 3HRUA 3MHXA 3JB9D 2E70A 2ZPIB 3OYGA 3G6ET 1QW1A 2KY9A 2P0QA 2FVUA 5AYFA 4ZTFA 2JZ2A 4M75G 5GAOp 2KDSA 5D6WA 1YJWA 4VUBA 1BYMA 4BDZA 2O4XA 4UC4A 2PVGB 4Q5WA 2VGNA 1YBYA 4BY6C 3FDRA 3OYYA 3KXTA 3CC4A 4X9DA 1VQLT 4LD9K 2PVDB 4M77B 1UEBA 3X26B 4ME7A 4DA4A 3FEOA 4C92C 3ASKA 5LJ3j 4BE0A 3DKMA 1O9SA 4JJNK 1U8RA 4HCCA 1BI0A 1KHCA 4ZTJA 3QYHB 3JCMb 2MWOA 3M9QA 4O6JA 5GAN5 3OYCA 1VQ5T 4FU6A 2QQSA 5J3BA 1JRIA 4MDWA 1XTDA 2KQWA 1WQWA 1LJOA 3X20B 3OYDA 5CR2A 1Y96B 2JN0A 1I5LA 4F7UG 4M7AF 1TH7A 2XHCA 3M58A 3L1AA 4N0AA 3M54A 2KSSA 2V8JA 3OSVA 3M4GA 4IUPA 4EPCA 3G71A 1VQMA 2KK4A 4XU3A 2XD0A 5FLXE 3CPWA 2CZ0B 4PKCC 3NFCA 4IKFA 4A4KA 3JCMX 3L2VA 2P0PA 4ELYC 1I4K1 3OMCA 1KQ1A 4D6WA 3CBPA 2VYTA 5KCHA 1WJQA 2EQMA 2ZZDA 3P8DA 3G7ZA 3MP8A 2DJZA 2RM4A 3MEUA 1M1GA 1BI3A 2E1HA 3OYBA 3CC7A 4N0AC 2FHDA 3VYGA 3S6WA 3SWNA 5FRNA 3ZBDA 3QZ5B 4BI8B 2E41A 4GLKA 4L5GA 3QIIA 1R8OB 3L2WA 1YITT 1Q82U 1EIFA 1M5Q1 4OB0B 3CD6T 2HNIA 3JCMV 5DM7R 2QDYB 1QVGS 3N5BB 4MDXA 1P92A 2JOYA 4X34A 3OYEA 2DTHA 4EDUA 5LJ5e 4JDSA 4OB2B 3JCMc 2CKKA 5GAN6 2EAYA 5GAMe 5GAN4 5LJ5f 2ZPFB 3CCLT 4O5VA 3PIOA 1UGSB 4BD3A 3G4ST 3CXCS 1VQPA 5A2QE 3FRNA 1RL2A 1WQ7A 4KULA 3OB9A 3V8KA 4M7DF 1VQ4A 2MWPA 3SWNC 4XTZA 2L8DA 3PFSA 4PJOD 1V29B 3RKWA 2QI2A 4M7AG 4M7AA 2LT4A 2WACA 3CC4T 4MZPA 4BY6B 3GNFB 1G5VA 4OMFB 2ZPGB 3I56A 1NJIU 3FLGA 3SFMA 4C92B 1I8FA 4M77E 3H8ZA 1XNIA 5LJ3f 3CCEA 1WJSA 4L6V5 3WXMB 2EKOA 3META 3MEVA 2V8IA 3JB9F 2K5FA 3L2UA 3EFSA 2HAXA 1YI2A 4IUUA 4J6YA 1K73U 1W4SA 2RI2A 4C8QD 2YHTA 5LJ5g 4LDXA 1UGQB 2O4XB 4PLIA 4M7AC 5GAMg 1OZ3A 4X9CA 1Q86U 3HRSA 4GY5A 1NZ9A 3OYMA 2XDDA 2QQBA 2DIQA 4E7LA 4HT8A 2GFAA 2XKOC 3BY7A 3G71T 2EQKA 1VQMT 1W2BS 3KUFA 1NJIC 3OMGA 5LJ5d 4HKEA 3UT1A 2A3LA 3QDRB 5GAMd 2E5QA 3EFRA 4DQ2A 2ZCFB 3FC3A 3NTHA 3BDLA 4A53A 5GAOr 4JRQA 2KAFA 2DD4A 2F69A 3CEYA 3UDCA 5I2SA 4RG8A 1D3BA 2FYKA 2ZPHB 5LL6S 4C5HA 3OSSC 4IUTA 3OYKA 2M9UA 2CYZB 4F7UB 4M78D 4JRIA 4LDUA 3CC7T 4LDVA 4M7DA 4M7DG 3T9NA 2GQVA 2IVWA 2Y90A 1IZ6A 3CC2A 1H3ZA 2LTOA 2GF7A 3RMSA 5GAN8 4MMKA 3JCMW 3V8LA 4PLLA 2RH2A 3QKJA 2X4JA 4A54A 5HK0A 3M57A 4B9XA 3FJPA 4J83A 1N27A 1VUBA 2DO3A 3JRZA 3PMTA 4C92G 2QXFA 5CAIA 3J80E 1PSFA 5GAMj 2YRVA 5GAOq 3GPLA 1YJ9A 4YTLA 1VQPT 3JB9G 4EMKA 1VQ7T 4R55A 4ATOA 1VQ9A 4M7DC 5FU7C 1OI1A 3INZA 1VQ4T 2EFIA 2RK2A 3L42A 2DEQA 3SWNB 1UGPB 3V8JA 4QQDA 4BACA 4C5IA 1S72A 2RO0A 3QG1A 4N4GA 2HD0A 2XICA 3CCUA 2X4XA 3BW1A 3S3MA 3LW5E 4XTYA 3I56T 2VXEA 1FWZA 2WSEE 4OGCA 5KE2A 2DK3A 3CCET 1KQSS 5GANe 4EMKC 2EIFA 4J5YA 2L89A 3A5ZB 3TU4K 2XI9A 2M1HA 1YI2T 5EG2A 2DZCA 2HQXA 1IREB 3QO3A 3VUZA 2QQAA 4PJOF 5FRMA 2MAMA 3OYJA 2K2VA 2EWNA 1GXIE 5GAOm 3VJPA 4M7AB 4HT9A 4M75E 2XIDA 4JS4A 3V7RA 1W2BA 5LJ5h 2RHXA 3C95A 2DZ9A 3O8VA 1VQOT 1BIAA 1VQ7A 1Y7XA 5J26A 2YLBA 1XQHA 3X25B 2M16A 4IURA 2AHJB 4JLIA 2CS7A 4XTXA 1M90C 2XU8A 4FT4A 2DXBA 2X4WA 1BIBA 4OP0A 3SD4A 4C8QF 1VQ6T 2RA2A 2VGMA 3FIFA 3FB9A 3GP8A 2R57A 5GAN2 3QJ6A 4KBMB 4E7KA 4KUDK 4KT0E 5GANg 1QVPA 2KMTA 4BI3A 4C0DB 1N9RA 4F7UE 4ZN1A 3PIPA 4E7IA 1G3WA 3CPFA 3LH0A 3PNWC 5LJ3h 1JB0E 4EMHA 3CC2T 2LQ8A 4OB1B 2GFUA 2RB6A 4N4HA 2P0KA 1MGQA 3HKSA 5C0MA 5GANd 5M9OA 4JUVA 3JB9I 3M4YA 5CKDA 1U1TA 3SDZA 2M0OA 2EJFA 3DB3A 1D3BB 4HA8A 2EQUA 4QVCA 3AHUA 5GAMf 1YJ9T 2DPPB 2K3YA 4M78F 3QSUA 1VQ9T 4M7DB 2B8AA 3S3NA 3OBYA 5FU7B 3I55A 1YHQA 2NLUA 1VQNA 1JJ2A 5CKEA 1O75A 4PJOG 4N4IA 4RMOA 4PJOA 1S72T 1G3YA 3CCUT 1OZ2A 2XDBA 1B34B 4II1A 4V2SA 1G3SA 2EQJA 4BUGA 3DB4A 1VQKA 2JUFA 3RERA 1QVFA 4P5NA 4XU2A 4M77A 3CBOA 3OYNA 4JS5A 2E6NA 4M77D 3JCMQ 3S3OA 5D6YA 1H641 1Q7YU 1VQ6A 4ZN3A 4EMKB 5GANj 4NL2A 1X01A 3CCRA 2LT1A 4LDWA 4PJOC 4C8QG 4C8QA 1I81A 1VQ8A 3OS1A 4E7HA 1N8RU 4BE1A 3URGA 3OS5A 2EYQA 1JBMA 3CCMA 3NTKA 3ZEHA 3MO8A 1M4ZA 2DTIA 4M7AE 2ZPEB 3OY9A 4RCCA 3JCMe 2ZGWA 2ZPBB 4FIBA 3Q1JA 5A0LA 3CCQA 2D9TA 3MP1A 4ZGJB 4XTVA 3RKYA 3MEAA 1RI0A 3JCMf 5CO7A 4QVDA 2DIGA 1VQOA 1N6AA 3RUXA 1Q7YC 4A4EA 1M1FA 4RG2A 2DXTA 5GAOn 4C8QC 2DTOA 4A4HA 4FL6A 3OW2A 2LC4A 4QVZA 4Z02A 4EMGA 3RMQA 1XOVA 2DD5A 3ME9A 4J7IA 4M78G 4M78A 1N8RC 2CZ7B 4M75F 4C0FA 4FM4B 3E19A 3QJYA 3PMIA 2PUOB 2C06A 2DVEA 2K4YA 3CMAA 2XDPA 2GCXA 2X35A 5KE3A 3CXCA 1YCYA 2RJFA 1G3TA 2QEXA 3C4SA 4JRPA 3E9GA 1M1KC 3QBYA 2WSFE 1DJ7B 4QW2A 2QTXA 4HCBA 3E9FA 3VYHB 3HL8A 3CCSA 4FSXA 1NPPA 3M5AA 1FX7A 4RKUE 4XTUA 2HBPA 3VU3C 1Q81U 3JCMg 2H3JA 4M78C 4B9WA 3GOXA 2DAQA 3LGFA 4JRKA 1Y07A 5IT9E 3X24B 3I55T 4TVRA 1YHQT 3A8OB 4F7UF 5IAYA 4J6XA 3CPWS 1VQNT 4M7DE 2RHIA 2VXFA 4E7JA 2OTJA 3GIBA 3JCMd 4OF1A 5CK9A 2RHYA 2EJ9A 2FB7A 2K57A 1HK9A 2I2LA 4J8OA 4A4GA 1VQKT 2E64A 5FU6C 4CI0C 1FXXA 5CQXA 1KC8U 3TREA 4C5GA 1M8VA 3L2QA 5D6XA 1BI2A 1Q81C 4LDYA 3R6OA 4C92E 3HRTA 3CCRT 5GANf 1M90U 3M56A 3QUIA 2DKGA 2LNVA 3DLMA 2PQWA 3VUBA 1VQ8T 3WVDB 2CZ6B 2QA4A 3QPHA 4PJOB 2JNGA 1X6OA 4MZTA 1VIFA 4ZGEB 1KD1U 4Y28E 4XU1A 3BDUA 3HP9A 4M75A 5GMKi 3A8MB 2CGHA 4M75D 2LVMA 4OB3B 5CIUA 5KH6A 3QXEB 3HPWA 3CMEA 3CCMT 2R58A 2V8KA 1K9MU 2PUKB 1AHJB 4LD6A 1VIEA 3CCQT 2K5LA 2XK0A 3JSCA 4JLGA 4DOWA 1BI1A 4M77F 5GAMh 1KC8C 3ER0A 3PTAA 2IG0A 3DLLA 2CZ1B 4C5EA 1JJ2S 3LGLA 2A7YA 4C8QB 1NPRA 3UPUA 2JTFA 3BFMA 2DXUA 5GMKe 2P4TA 3A8LB 4M75C 3RIRA 3C12A 4OGEA 1KD1C 4L59A 1QVFS 3A8GB 3L2ZA 4OVAA 2OTLA 2X4YA 1K8AU 3MEWA 1UB4A 4F7UA 1UGRB 5C6SA 1K9MC 3CMAT 2QEXT 3HFNA 4IUVA 3CCVA 3E1SA 2Y4XA 2RI5A 4J6WA 1MHNA 4XU0A 3CCST 4BDYA 3GNGA 1ZHIA 2YLCA 3QZ9B 5GAN7 3OYLA 3LX7A 4MMLA 3VKIA 3JCMJ 3LYIA 4M78B 2E10A 3TEEA 5L8RE 1NE8A 2LRQA 1QP2A 3OYFA 1KQSA 1KQ2A 1K8AC 3JCMh 2OTJT 4XTWA 1ZQ1A 3OA6A 2BIVA 1QP3A 3RKXA 2BUDA 1KG1A 2LQKA 2D6FA 5GMKl 1YJNA 1YIJA 3RESA 3MP6A 3JB9H 1Y71A 3OW2S 3CCJA 1SSFA 5FU6B 2R5AA 3V7SA 2RD1A 4M77G 2RHZA 4XQ3A 4NOYA 5A0DA 4QQ6A 3P8HA 3HFOA 1LOJA 2DXCA 2LX9A 2F5TX 2G3RA 4ZGDB 5KCOA 4BI4A 2QQ9A 2OAUA 4NL3A 3A8HB 4Y91A 2QA4T 3G6EA 2QQRA 3LWIA 3QHSA 4PJOE 2VC8A 1N9SA 1Y96A 2FL7A 2KVQG 3CMET 4PL6A 1YJWT 2XG8D 4DOVA 3UWNA 2VV5A 3H6ZA 5HY6A 2JVVA 2E65A 1BKBA 2BKDN 4M7AD 2LDMA 4C0GA 1Q82C 5I2MA 4M77C 3X28B 1M1KU 4HCZA 1VQLA 5CQYA 5IN1A 5LJ3e 1ZBXA 5CKBA 4C92F 2EJGA 3WVEB 3OYHA 2PVOB 1HXDA 2PU9B 1OYXA 3C94A 2RK1A 5DLQE 1WGSA 5GAN3 3HHTB 4A4FA 1VQ5A 5DY9A 5CVIA 2K3XA 2LCCA 2JTMA 3J81E 1QVGA 5GMKj 4M75B 4C8QE 4BE2A 2LCLA 3CBMA 3KBGA 3QYGB 2L3RA 2MF2A 3LWHA 2Y4YA 5HK3A 2OTLT 2VUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OB9 A;  2MWP A;  4C5G A;  3OYI A;  2X4W A;  3SD4 A;  3F70 A;  2L8D A;  3EAE A;  3PFS A;  2RJE A;  5D6X A;  3L2Q A;  1WJR A;  2RJC A;  2R57 A;  2WAC A;  3QJ6 A;  4E7K A;  3OS2 A;  1G5V A;  3DLM A;  2PQW A;  4E7I A;  3LH0 A;  3PNW C;  3FLG A;  3H8Z A;  1XNI A;  2GFU A;  1WJS A;  2RJD A;  4N4H A;  2EKO A;  3MET A;  3MEV A;  2LVM A;  2P0K A;  3OQ5 A;  5CIU A;  5C0M A;  5KH6 A;  5J39 A;  5M9O A;  2R58 A;  3L2U A;  3OS0 A;  4LD6 A;  2M0O A;  2RHU A;  2XK0 A;  4IUU A;  4QQG A;  3DB3 A;  2RI3 A;  3OYA A;  2RI2 A;  2IG0 A;  5FRO A;  2R5M A;  2EQU A;  4NS5 A;  3NTI A;  2O4X B;  2K3Y A;  4IUQ A;  4PLI A;  1OZ3 A;  4C5E A;  2B8A A;  3S3N A;  2F5K A;  3LGL A;  4IUR A;  4GY5 A;  2HQE A;  3OYM A;  2NLU A;  4E7L A;  2DIQ A;  2GFA A;  2JTF A;  2EQK A;  4N4I A;  3KUF A;  3OMG A;  3UT1 A;  1OZ2 A;  4II1 A;  4CRI A;  2E5Q A;  4L59 A;  4OVA A;  2X4Y A;  2EQJ A;  3LLR A;  3MEW A;  3BDL A;  3DB4 A;  3NTH A;  5C6S A;  3FC3 A;  3OYG A;  3CEY A;  3OYN A;  4ZTF A;  4IUV A;  2E6N A;  2JZ2 A;  4C5H A;  5D6Y A;  3S3O A;  5D6W A;  4IUT A;  3OYK A;  2RI5 A;  4BDZ A;  2O4X A;  1MHN A;  4UC4 A;  4Q5W A;  3FDR A;  4BDY A;  3OYL A;  1H3Z A;  3FEO A;  3LX7 A;  3OS1 A;  3ASK A;  2LTO A;  2GF7 A;  4BE0 A;  4BE1 A;  3LYI A;  4E7H A;  1KHC A;  4ZTJ A;  4PLL A;  3QKJ A;  2LRQ A;  2MWO A;  3M9Q A;  3OYC A;  3NTK A;  3ZEH A;  3MO8 A;  3OYF A;  4FU6 A;  2QQS A;  3OY9 A;  4B9X A;  3Q1J A;  1N27 A;  2D9T A;  3MP1 A;  2BIV A;  3PMT A;  3OA6 A;  3MEA A;  1RI0 A;  2BUD A;  3OYD A;  2YRV A;  2DIG A;  4A4E A;  3MP6 A;  4RG2 A;  1SSF A;  1OI1 A;  2R5A A;  2EFI A;  3L42 A;  4IUP A;  4A4H A;  4FL6 A;  2RHZ A;  4BAC A;  4QQD A;  4QVZ A;  4Z02 A;  4C5I A;  4QQ6 A;  3P8H A;  2RO0 A;  3ME9 A;  4N4G A;  4IKF A;  3L2V A;  3PMI A;  2G3R A;  5KCO A;  2X4X A;  3S3M A;  5KCH A;  3OMC A;  3L2R A;  2VYT A;  2X35 A;  2XDP A;  5KE3 A;  5KE2 A;  1WJQ A;  2RJF A;  2QQR A;  2EQM A;  3C4S A;  3E9G A;  3P8D A;  3MP8 A;  3QBY A;  4QW2 A;  3E9F A;  2L89 A;  3MEU A;  4PL6 A;  3UWN A;  3H6Z A;  3OYB A;  2BKD N;  2M1H A;  2LDM A;  2HQX A;  2FHD A;  4HCZ A;  3S6W A;  5FRN A;  5FRM A;  5IN1 A;  3OYJ A;  3OYH A;  4B9W A;  3GOX A;  2DAQ A;  1OYX A;  3LGF A;  3QII A;  3L2W A;  1WGS A;  4A4F A;  5IAY A;  2K3X A;  2LCC A;  2RHI A;  4X34 A;  3OYE A;  2RHX A;  4EDU A;  4E7J A;  3O8V A;  2CKK A;  5J26 A;  4BE2 A;  2RHY A;  4BD3 A;  2L3R A;  4A4G A;  2M16 A; 
#chains in the Genus database with same CATH topology
 3M55 A;  2VB6 A;  1WNL A;  3JB9 J;  4MZM A;  3CCV T;  5GAN h;  1WJR A;  5GMK m;  1ZUK A;  4IIM A;  3L2R A;  4FSS A;  3OQ5 A;  5J39 A;  5LJ3 g;  1T3L A;  5DLO A;  3MKD A;  4RCB A;  1W2B S;  4M78 E;  1TG0 A;  4HVW A;  3PE0 A;  2MMP A;  1WFW A;  2FEI A;  1PSE A;  1CKB A;  2L5Q A;  4FW1 A;  5CKF A;  5HKC A;  1YJN T;  3NTI A;  4IUQ A;  1MMD A;  3ULR B;  5A0G A;  3CD6 A;  3EGU A;  1M9S A;  2F5K A;  2HQE A;  1ZBJ A;  4J7F A;  1K0S A;  1RLQ C;  4CRI A;  3GF5 A;  3CCL A;  4C0Z A;  3G4S A;  3LLR A;  2E6Z A;  1D1C A;  3MHX A;  3G6E T;  1UEC A;  1WLP B;  5GAO p;  2CP0 A;  1YJW A;  1V1C A;  2QAZ A;  1UFF A;  4BDZ A;  1BYM A;  2QA4 Q;  2DER A;  2PVG B;  1YBY A;  4BY6 C;  3OYY A;  2FPD A;  2PVD B;  3X26 B;  4DA4 A;  4C92 C;  2DRK A;  3DKM A;  4HCC A;  1BI0 A;  2AK5 A;  1OEB A;  3OYC A;  1JRI A;  1XTD A;  1GFC A;  1WQW A;  3X20 B;  1Y96 B;  3RR6 A;  2FZG B;  1TH7 A;  3OSV A;  2KSS A;  2V8J A;  2K79 A;  3G71 A;  2XD0 A;  5FLX E;  1K9M R;  1KQ1 A;  1WJQ A;  2DJZ A;  2CT3 A;  2M0Y A;  2RM4 A;  4CC2 A;  1M1G A;  4ANJ A;  1EFN A;  2CSQ A;  4GLK A;  1WA7 A;  4GLM A;  3VS0 A;  2DYI A;  3N5B B;  2JOY A;  5GAN 6;  5LJ5 f;  4O5V A;  4FCY A;  4BD3 A;  1D1A A;  1S1N A;  4LE9 A;  4KRT A;  4M7D F;  3M0Q A;  1VQ4 A;  3SWN C;  1RAD B;  2L8D A;  4J9D A;  2HKN A;  2CH4 W;  3REA B;  4MZP A;  3SFM A;  4M77 E;  1XNI A;  3EG2 A;  3MET A;  3MEV A;  2E3H A;  1OU8 A;  4C8Q D;  2O4X B;  1Q86 U;  1OZ3 A;  1ARK A;  4GBQ A;  4GY5 A;  4E7L A;  2XDD A;  1VQM T;  4E7Z A;  5LJ5 d;  3QDR B;  2E5Q A;  4DQ2 A;  3FC3 A;  3NTH A;  4PFP A;  4JRQ A;  3UDC A;  1JJ2 P;  5I2S A;  2C0T A;  1KQ2 A;  4C5H A;  1MMG A;  1SG5 A;  4F7U B;  3CC7 T;  4M7D A;  3T9N A;  2GTJ A;  2IVW A;  2EGC A;  2LTO A;  5GAN 8;  5L23 A;  3QKJ A;  1Q86 R;  3M57 A;  3FJP A;  1W1F A;  2X3W D;  4J83 A;  1N27 A;  3CD6 Q;  1X2Q A;  2QXF A;  3J80 E;  1SKU B;  4YTL A;  1QKW A;  1V76 A;  4R55 A;  1VQ9 A;  1X43 A;  2JM9 A;  1QCF A;  5FW9 A;  3G4S Q;  4WCI A;  1I1J A;  2RO0 A;  3QG1 A;  4N4G A;  3CCU A;  1AZG B;  2X4X A;  3BW1 A;  2EYZ A;  4XTY A;  2KNB B;  1YJW Q;  1FWZ A;  1AT1 B;  4OGC A;  1IHW A;  3CCE T;  3TSW A;  2EIF A;  2ABL A;  3TU4 K;  2DZC A;  1IRE B;  2DM1 A;  2YDL A;  4M7A B;  2QTV A;  4JS4 A;  1HJD A;  3O8V A;  1VQO T;  1VQ7 A;  1JXM A;  1XQH A;  1RAB B;  3G71 Q;  3X25 B;  2M16 A;  3CCV Q;  1FMV A;  2LJ1 A;  1ZSZ C;  1BIB A;  1VQ6 T;  2RA2 A;  2DL7 A;  2R57 A;  3QJ6 A;  8AT1 B;  4E7K A;  1H8K A;  1OQK A;  4ZN1 A;  4E7I A;  2O9V A;  2J6O A;  3LH0 A;  4EMH A;  5LJ3 h;  4RTW A;  2RB6 A;  5GAN d;  3JB9 I;  1U1T A;  3DB3 A;  4HA8 A;  2EQU A;  3AHU A;  2NUP A;  2NLU A;  5CKE A;  4JJC A;  1B3Q A;  1S72 T;  1OZ2 A;  3G6E Q;  2EQJ A;  1VQK A;  4XU2 A;  1WXU A;  3CBO A;  2V1Q A;  2RQR A;  2HL5 C;  4EMK B;  5GAN j;  1X01 A;  4C8Q G;  1YCS B;  3A1P A;  2EYQ A;  2YWW A;  2QAS A;  3VS4 A;  1JBM A;  3CCM A;  2DTI A;  4RTT A;  4RCC A;  2XMF A;  3MP1 A;  1VQO A;  3RKY A;  1RI0 A;  1UE9 A;  1UUE A;  3RUX A;  1E6H A;  4RG2 A;  1JEG A;  4C8Q C;  4A4H A;  2LC4 A;  4QVZ A;  4Z02 A;  2PTK A;  1M3A A;  3QJY A;  3PMI A;  1RI9 A;  4JZ4 A;  1G8X A;  1X27 A;  2KXD A;  3H0F A;  2C06 A;  2J05 A;  1PC0 A;  2GCX A;  4JRP A;  5KE3 A;  2ENM A;  2RJF A;  3E9G A;  1M1K C;  4PJM A;  1M27 C;  5KYW B;  4FYY B;  4QW2 A;  1LCK A;  3VYH B;  3CCS A;  5KYU A;  2C0O A;  2SEM A;  4RKU E;  2HBP A;  3VU3 C;  3JCM g;  4B9W A;  3GOX A;  1AWJ A;  3X24 B;  3I55 T;  4F7U F;  3EHQ A;  4J6X A;  4M7D E;  2VXF A;  4E7J A;  2OTJ A;  1VQ9 Q;  2K2M A;  2VVK A;  1SPK A;  5CK9 A;  4PJJ A;  2EJ9 A;  4AMC A;  2K57 A;  4J8O A;  2I2L A;  2E64 A;  3CCU Q;  1KC8 U;  2K9G A;  1AOJ A;  5D6X A;  1BI2 A;  4LDY A;  3R6O A;  4FW2 A;  3HRT A;  1M90 U;  2X3X D;  3EFO B;  3GBQ A;  2PQW A;  4Z88 A;  3VUB A;  3EGX A;  1VIF A;  1RAE B;  3CME A;  3HPW A;  2V8K A;  1AHJ B;  4LD6 A;  1VIE A;  3CCQ T;  3JSC A;  1BI1 A;  1KC8 C;  3ER0 A;  3DLL A;  2YXY A;  1U5S A;  1WYX A;  1M2V B;  5FWB A;  4A63 B;  3EG0 A;  1SEM A;  4ESR A;  2L3Q A;  1KC8 R;  2P4T A;  3A8L B;  4M75 C;  3RIR A;  3C12 A;  1QVF S;  1R0B G;  4F7U A;  1M90 R;  1VYV A;  2YRC A;  2QEX T;  3HFN A;  3CC7 Q;  3H0H A;  4J6W A;  2DA9 A;  3M0T A;  5HCK A;  1ZHI A;  4J9I A;  1QLY A;  3LYI A;  1SF9 A;  2E10 A;  2JTE A;  2LRQ A;  1KQS A;  2DEU A;  4XTW A;  3EG3 A;  3OA6 A;  1QP3 A;  1KG1 A;  2D6F A;  3EG9 B;  1M3C A;  1FMK A;  3RES A;  3JB9 H;  1Y71 A;  3OW2 S;  3V7S A;  3HTR A;  1GCQ C;  1VQK Q;  2KBT A;  2DXC A;  1ZX6 A;  2G3R A;  5KCO A;  2QQ9 A;  1CSK A;  3CCE Q;  2OAU A;  2QA4 T;  3A8H B;  2HCK A;  4M7A D;  2E65 A;  1Q82 C;  1AVZ C;  4C0G A;  1VQL A;  1ZA2 B;  4HCZ A;  3THK A;  3CCM Q;  3M0S A;  5IN1 A;  4C92 F;  3LWH A;  2PU9 B;  1C6V X;  2RK1 A;  2HDA A;  1VQO Q;  1PNJ A;  2KRN A;  5IH2 A;  1IGU A;  1Z9Z A;  2LCL A;  2OTL T;  3MO8 A;  2DL5 A;  2GGR A;  1JO8 A;  3HSB A;  1JQQ A;  2E12 A;  2LX7 A;  4AFQ C;  3OYI A;  3V7C A;  2E3I A;  3F70 A;  2K3B A;  4FT2 A;  4PJN A;  3VV0 A;  4AG2 C;  2RJC A;  1SHG A;  2HQH A;  4XAX B;  2QDL A;  2EW3 A;  3CCS Q;  3M59 A;  4WTO B;  1K73 C;  1WPY A;  4BB7 A;  4ELZ C;  1M30 A;  2RI3 A;  4ORZ A;  4EIK A;  5LJ3 d;  3VS3 A;  1WXT A;  3PVL A;  3CCJ T;  3EGD A;  3ZFJ A;  2F1L A;  4C92 A;  5GMK h;  4KUI A;  4C92 D;  3PGG A;  3OBW A;  3HRU A;  1WHG A;  3JB9 D;  2E70 A;  5AYF A;  4ZTF A;  5D6W A;  4VUB A;  2JW4 A;  4F17 A;  1UEB A;  3CME Q;  3ASK A;  5LJ3 j;  1KHC A;  1KK7 A;  4ZTJ A;  3QYH B;  1BB9 A;  5GAN 5;  4FU6 A;  3OYD A;  2GQI A;  2JMA A;  1I5L A;  4F7U G;  5IXF A;  3M58 A;  2LNH B;  3M54 A;  1EZZ B;  3M4G A;  2LMJ A;  4PKC C;  5KYW A;  2AIR B;  1TXQ A;  1J3T A;  1I4K 1;  3OMC A;  3P8D A;  3MP8 A;  4RTY A;  1OU9 A;  1WDX A;  5KYN A;  2FHD A;  3SWN A;  1X2K A;  3UA7 A;  3I55 Q;  3QZ5 B;  4BI8 B;  2E41 A;  3CD6 T;  2L3S A;  4OB0 B;  4OMM A;  3JCM V;  5DM7 R;  2OAW A;  1QVG S;  4MDX A;  4LUD A;  2DTH A;  5LJ5 e;  4OB2 B;  2CKK A;  5GAN 4;  2ZPF B;  3CCL T;  4HVV A;  1UGS B;  3G4S T;  4KUL A;  3EFO A;  4K11 A;  2OI3 A;  3PFS A;  5I11 A;  1UDL A;  2QI2 A;  4JPB W;  2WAC A;  4M7A G;  2ROT A;  5GJW B;  1I8F A;  3H8Z A;  1WJS A;  2EKO A;  3CCQ Q;  2V8I A;  1M2V A;  1UHF A;  2CT4 A;  1NG2 A;  1W4S A;  2RI2 A;  2YHT A;  4LDX A;  1TUG B;  4M7A C;  5GAM g;  4X9C A;  3HRS A;  4J9B A;  1NZ9 A;  2GFA A;  3BY7 A;  3G71 T;  2GBQ A;  4HKE A;  5KYY B;  2A37 A;  2QEX Q;  4A53 A;  4F14 A;  1R77 A;  5LL6 S;  2FYK A;  4IUT A;  3OYK A;  2BZY A;  3VS7 A;  2MIO A;  1GRI A;  2CYZ B;  4JRI A;  4LDV A;  2W0Z A;  3CC2 A;  4PLL A;  3RNJ A;  3EG9 A;  1YP5 A;  3G1J A;  2VKN A;  4B9X A;  4C92 G;  1PSF A;  2LZ6 B;  1YJ9 A;  3JB9 G;  1IGQ A;  2QYZ A;  1VQ4 T;  2EFI A;  2RK2 A;  3NHN A;  2JJ9 A;  4BAC A;  2VXE A;  5KE2 A;  4CC4 B;  1X6B A;  1NBE B;  1KQS S;  5GAN e;  4EMK C;  2NUT B;  3A5Z B;  2M1H A;  2HQX A;  1ZSZ A;  2QQA A;  5FRM A;  1MV3 A;  3VJP A;  1B7T A;  3MPU B;  2OTL Q;  3C95 A;  1BIA A;  2KR3 A;  2YLB A;  2GTO A;  3O5Z A;  4JLI A;  3M0R A;  2XU8 A;  3SD4 A;  4C8Q F;  1F1B B;  2VGM A;  3FB9 A;  3GP8 A;  4KBM B;  1QMC A;  4KT0 E;  1QVP A;  3PIP A;  2KRO A;  1G3W A;  4IIO A;  1TU0 B;  2V1R A;  4N4H A;  2QK0 A;  2FRY A;  5C0M A;  2HEQ A;  4M4Z A;  5M9O A;  1MND A;  5CKD A;  1PKS A;  2KGT A;  2EJF A;  2VWF A;  1D3B B;  3CCJ Q;  1T3S A;  2K3Y A;  1VQ9 T;  5FU7 B;  1MUZ A;  4FYW B;  1W2B P;  1RUW A;  1VQN A;  1W6X A;  3CCU T;  4II1 A;  1WZO A;  4V2S A;  2JUF A;  1QVF A;  3S3O A;  1H64 1;  3CCR A;  2LT1 A;  2P84 A;  4C8Q A;  3URG A;  3UAT A;  2O9S A;  3OY9 A;  1VQ7 T;  4XTV A;  3JCM f;  4QVD A;  1ZA1 B;  1D09 B;  3A98 A;  4A4E A;  1KQS P;  3CQT A;  2DTO A;  2A0F B;  4FL6 A;  3OW2 A;  1XOV A;  2DD5 A;  2CZ7 B;  4M75 F;  4FM4 B;  3CMA A;  5IHN A;  4R0K A;  3CXC A;  2JT4 A;  2DL3 A;  3C4S A;  2H3E B;  4DEX A;  3E9F A;  1NPP A;  2LP5 A;  1FX7 A;  2MK5 A;  3M5A A;  1Q81 U;  1WHM A;  2H3J A;  4JRK A;  1Y07 A;  5IT9 E;  2D1X A;  4TVR A;  1K76 A;  5IAY A;  3CCL Q;  2O88 A;  3GIB A;  3JCM d;  2J6F A;  2RHY A;  3QDF A;  1HK9 A;  1VQK T;  5I22 A;  2YT6 A;  1Q81 C;  2DBK A;  1NEG A;  4F04 B;  5GAN f;  3M56 A;  3QUI A;  2DKG A;  1PRL C;  3DLM A;  3WVD B;  2RNA A;  4PJO B;  2JNG A;  1X6O A;  2RMO A;  1KD1 U;  4ZGE B;  4Y28 E;  2GNC A;  3BDU A;  4M75 A;  4OB3 B;  2CGH A;  4M75 D;  3CCM T;  3QXE B;  2R58 A;  2PUK B;  2BZX A;  1I07 A;  2QG9 B;  5GAM h;  4DBR A;  1D0Y A;  1TUD A;  5KYY A;  2A7Y A;  4PFO A;  1WX6 A;  3UPU A;  2CDT A;  1KD1 C;  1PWT A;  1NM7 A;  3L2Z A;  2CH4 A;  1AWW A;  2DMO A;  4IUV A;  1QCO A;  1IHV A;  1IO6 A;  3E1S A;  1KD1 R;  2ATC B;  3CCS T;  4Y92 A;  3H0I A;  1UJY A;  3QZ9 B;  2YLC A;  2ED1 A;  1GCQ A;  3LX7 A;  4QT7 A;  3VKI A;  2DLP A;  4M78 B;  3U23 A;  3TEE A;  5L8R E;  1NE8 A;  5FWC A;  5AT1 B;  2A36 A;  1B07 A;  2OTJ T;  1ZQ1 A;  2M51 A;  1K0X A;  3RKX A;  2A28 A;  1VQ4 Q;  2LQK A;  5GMK l;  1YIJ A;  2Z0W A;  1C0M A;  5FU6 B;  1D1B A;  2BE7 D;  2EBP A;  4NOY A;  1X69 A;  3P8H A;  2OX7 A;  2F5T X;  4BI4 A;  1CKA A;  1QWE A;  2QQR A;  3LWI A;  1XJW B;  2VC8 A;  4JJD A;  1Y96 A;  2KVQ G;  3E2U A;  3CME T;  4PL6 A;  3TQ7 P;  2XG8 D;  3UWN A;  3H6Z A;  5HY6 A;  2JVV A;  2LDM A;  2LQW A;  2RQW A;  3X28 B;  1M1K U;  3IQL A;  5LJ3 e;  5EC7 A;  3OYH A;  2PVO B;  5DLQ E;  1WGS A;  3HHT B;  1VQ5 A;  1WHK A;  5DY9 A;  5CVI A;  2D8H A;  2JTM A;  1QVG A;  1YWP A;  1Y0M A;  4C8Q E;  8ATC B;  2FO0 A;  2MF2 A;  2Y4Y A;  5HK3 A;  2FRW A;  3JAM E;  4R56 A;  1VOM A;  2K5I A;  1NYF A;  3CMA Q;  3TCJ A;  4Z8A A;  2O01 E;  3BE3 A;  3SB2 A;  1M1K R;  1PM3 A;  3P8B B;  5CCA A;  2RJD A;  2KRM A;  4PNO A;  2V26 A;  1KJW A;  1U1S A;  2BE9 B;  3OS0 A;  1MV0 B;  4C0D C;  3J7A F;  1YN8 A;  3OYA A;  1M2O A;  2YUN A;  3NPF A;  2OJ2 A;  3VS6 A;  1YIT A;  2LJ0 A;  2D0Q B;  4DBH A;  2RF0 A;  4E2F B;  4E47 A;  2ED0 A;  2IPO B;  4XK8 E;  2COW A;  2I0N A;  1BCM A;  2ZPI B;  1WHH A;  2KY9 A;  3EHR A;  2P0Q A;  4CC3 A;  4M75 G;  2KDS A;  2HKQ B;  2CRE A;  2O4X A;  3VS1 A;  2VGN A;  3CC4 A;  4LD9 K;  4AFS C;  1VQL T;  1OX8 A;  4M77 B;  2DRM A;  3FEO A;  1Z9Q A;  1OPL A;  4BE0 A;  1O9S A;  1U8R A;  2O31 A;  2KT8 A;  1M8M A;  2MWO A;  4O6J A;  1VQ7 Q;  4J9H A;  2QQS A;  4MDW A;  2KQW A;  1TSF A;  1VYT A;  4OMO A;  4M7A F;  2XHC A;  1UGV A;  3L1A A;  2D8J A;  4AFZ C;  3VS5 A;  4XU3 A;  1ZLM A;  3CPW A;  3NFC A;  1D0Z A;  4HVU A;  3JCM X;  3L2V A;  2P0P A;  4E7S A;  2DIL A;  5KCH A;  4D6W A;  4E6R A;  3CBP A;  2EQM A;  2KEA A;  2ROL A;  1RAC B;  3MEU A;  1BI3 A;  2E1H A;  4N0A C;  1WIE A;  5FRN A;  1UG1 A;  1ZUU A;  4L5G A;  3QII A;  1R8O B;  3L2W A;  1Q82 U;  1EIF A;  1M5Q 1;  2YUQ A;  2HNI A;  4J9C A;  2QDY B;  4X34 A;  4JDS A;  2EAY A;  1JU5 C;  1TTH B;  1AWX A;  3CXC S;  1VQP A;  5A2Q E;  3V8K A;  3OB9 A;  2MWP A;  4J9E A;  2HMA A;  4PJO D;  1V29 B;  3RKW A;  1A0N B;  4M7A A;  2LT4 A;  2H8H A;  3GNF B;  1G5V A;  2ZPG B;  3I56 A;  1NJI U;  1PD1 A;  2CP3 A;  5LJ3 f;  3SHW A;  4L6V 5;  2EYY A;  1VA7 A;  3JB9 F;  2K5F A;  3L2U A;  3EFS A;  1Q82 R;  1YI2 A;  4IUU A;  4J6Y A;  1K73 U;  1UGQ B;  4LNP A;  2QQB A;  1QWF A;  4Z89 A;  1C1A A;  1NJI C;  3KUF A;  3OMG A;  3SEM A;  3UT1 A;  2A3L A;  2HSE B;  5GAM d;  3EFR A;  2ZCF B;  4OML A;  2JS2 A;  2KAF A;  2DD4 A;  2F69 A;  3NMZ C;  1TWB A;  1NJI R;  2JXB A;  4RG8 A;  1JXO A;  3OSS C;  2M9U A;  4ZNX A;  4M78 D;  1QVF P;  2GQV A;  1HYO A;  1IZ6 A;  3UF4 A;  1WHL A;  2GF7 A;  3RMS A;  1K73 R;  4MMK A;  1YWO A;  2DYB A;  3RDV A;  2OTJ Q;  2X4J A;  3M0U A;  2DNU A;  2CP6 A;  1VUB A;  2DO3 A;  2EVR A;  3PMT A;  1WI7 A;  4DBF A;  1YIT Q;  1H92 A;  2J7I A;  5GAM j;  5GAO q;  1IXD A;  4EMK A;  2EYW A;  5FU7 C;  4HXJ A;  1OI1 A;  1RAH B;  3H9N A;  3MJX A;  1GCP A;  2HSP A;  1UGP B;  4QQD A;  2HD0 A;  2XIC A;  2JS0 A;  3S3M A;  3LW5 E;  3I35 A;  3KFV A;  2MYS A;  2WSE E;  3OW2 P;  4OMQ A;  4J5Y A;  5EG2 A;  1RLP C;  3CXC P;  3QO3 A;  3VUZ A;  4FYX B;  1KFZ A;  1E7O A;  2EWN A;  2L3P A;  5GAO m;  5D7U A;  4HT9 A;  5LJ5 h;  2DZ9 A;  1Y7X A;  1QKX A;  1Y57 A;  2EQI A;  4IUR A;  2AHJ B;  4XTX A;  2E5K A;  1OPK A;  2DXB A;  3AT1 B;  2BZ8 A;  3FIF A;  1G2B A;  5GAN 2;  2HZY A;  4LN2 A;  2KMT A;  4BI3 A;  4C0D B;  1N9R A;  4F7U E;  3CPF A;  3CC2 T;  1JB0 E;  2LQ8 A;  4PK4 A;  2P0K A;  3HKS A;  3M4Y A;  3I9Q A;  3SDZ A;  2MCN A;  2SRC A;  4QVC A;  1YJ9 T;  1EX4 A;  3VRZ A;  2YSQ A;  4M7D B;  1SRL A;  2B8A A;  3OBY A;  1YHQ A;  2YUO A;  2VAS A;  2AZS A;  4PJO G;  4RMO A;  2XDB A;  1B34 B;  1W70 A;  3DB4 A;  1PCX A;  2B86 A;  2RQV A;  4M77 A;  1KIK A;  4M77 D;  3JCM Q;  1VQL Q;  3I56 Q;  4ZN3 A;  4NL2 A;  2F2X A;  1NLP C;  1RAF B;  4PJO C;  1VQ8 A;  1I81 A;  3OS1 A;  3OS5 A;  1YI2 Q;  3RBB B;  1M4Z A;  2RQT A;  4M7A E;  3EH2 A;  4HCK A;  3JCM e;  2ZPB B;  3QWX X;  3Q1J A;  5A0L A;  2CP5 A;  5CO7 A;  2DIG A;  2AKK A;  2KI7 A;  1N6A A;  1H3H A;  2NUZ A;  3C0C A;  5GAO n;  1SSH A;  1UTI A;  4EMG A;  3RMQ A;  1LPL A;  9ATC B;  4M78 G;  4C0F A;  3E19 A;  2PUO B;  2DVE A;  2XDP A;  2X35 A;  1YCY A;  1G3T A;  3QBY A;  3TVT A;  1DJ7 B;  4JJB A;  2QTX A;  3HL8 A;  4FSX A;  1BBZ A;  3ZL7 C;  2CUB A;  2HL3 A;  2LJ3 A;  1N5Z A;  4M78 C;  3LGF A;  1E6G A;  4JZ3 A;  1VQN T;  3CPW S;  2M02 A;  2RHI A;  4OF1 A;  2A08 A;  4A4G A;  5FU6 C;  4KGV B;  3TRE A;  1QVG P;  1YNZ A;  3L2Q A;  4C92 E;  2NUP B;  3CCR T;  4LUE A;  1K4U S;  2LNV A;  2CZ6 B;  2KYM A;  5GMK i;  3A8M B;  2CSI A;  5CIU A;  1IRX A;  5KH6 A;  1K9M U;  1T0J A;  4JLG A;  1AEY A;  3PTA A;  2IG0 A;  2DJQ A;  2CZ1 B;  4C5E A;  2DL8 A;  1JJ2 S;  2QGF B;  1NPR A;  2DF6 A;  1K8A U;  1IB8 A;  3MEW A;  3CMA T;  1GBR A;  1UGR B;  1K9M C;  4KGX B;  3CCV A;  2RI5 A;  1MHN A;  4XU0 A;  2FPF A;  1AWO A;  4RTZ A;  1X6G A;  1NEB A;  1AD5 A;  1K8A C;  1U06 A;  5KYX B;  2BIV A;  1YHQ Q;  1YJN A;  2PNI A;  2CP7 A;  3MP6 A;  5KYU B;  2DE0 X;  1K8A R;  4X1V A;  4M77 G;  2RHZ A;  4XQ3 A;  1ABO A;  3NGP A;  5A0D A;  1LOJ A;  2LX9 A;  4ZGD B;  2KE9 A;  2J06 A;  4Y91 A;  3G6E A;  3QHS A;  3CPW P;  1GFD A;  1D0X A;  1VQ8 Q;  1BKB A;  2DFU A;  5I2M A;  4M77 C;  1M3B A;  2O2O A;  3WVE B;  3VRY A;  3C94 A;  1OYX A;  2JM8 A;  3EGX B;  1ZUY A;  3EG1 A;  2COY A;  2MOX A;  5GMK j;  4BE2 A;  3KBG A;  2E4H A;  2KT1 A;  1KHI A;  3PT9 A;  1X75 C;  2COZ A;  4LXC A;  1SHF A;  3EAE A;  5IXB A;  2RJE A;  5I21 A;  3CC2 Q;  3OS2 A;  3M53 A;  1MNE A;  2WSC E;  4WF2 A;  2MI6 A;  5GAO l;  3MCA B;  3JCM P;  1Q86 C;  2RHU A;  1YJ9 Q;  4M7D D;  1PRM C;  4QQG A;  1LNX A;  4DBQ A;  5FRO A;  2R5M A;  4NS5 A;  1YIJ T;  1B34 A;  1RAG B;  2YRD A;  2LQN A;  4OMN A;  5CKH A;  5LJ5 j;  3GLX A;  2AT1 B;  2BTT A;  3OYG A;  1QW1 A;  2FVU A;  4DEY A;  1Q81 R;  2JZ2 A;  2IIM A;  3I5R A;  4UC4 A;  3KXT A;  4Q5W A;  3FDR A;  1HD3 A;  4X9D A;  4ME7 A;  2NWM A;  4JJN K;  3JCM b;  3M9Q A;  1VQ5 T;  5J3B A;  1LJO A;  5GJV B;  5CR2 A;  2JN0 A;  4N0A A;  4EPC A;  4IUP A;  3VS2 A;  1SRM A;  2KK4 A;  1VQM A;  1GL5 A;  2CZ0 B;  4IKF A;  4A4K A;  4CC7 A;  1TOV A;  1LVK A;  4ELY C;  2VYT A;  2J6K A;  2DL4 A;  1Q95 G;  2ZZD A;  3LH5 A;  3G7Z A;  1ACM B;  1KSW A;  2YUP A;  3OYB A;  3CC7 A;  1YFN A;  4D8D A;  2L0A A;  3VYG A;  3S6W A;  3ZBD A;  1VQN Q;  1YIT T;  1AZE A;  1WXB A;  1P92 A;  1YJN Q;  3OYE A;  4EDU A;  5GAM e;  4KH1 B;  3PIO A;  2NUT A;  1G83 A;  3FRN A;  1RL2 A;  1WQ7 A;  3CCR Q;  4XTZ A;  1FYN A;  1OX9 A;  1RAA B;  2HBW A;  3CC4 T;  4BY6 B;  3EGD B;  1PKT A;  4OMF B;  3FLG A;  4C92 B;  3JV3 A;  3CCE A;  3WXM B;  2HAX A;  5LJ5 g;  4FYV B;  4PLI A;  3OYM A;  2DIQ A;  4HT8 A;  2XKO C;  4RTU A;  2EQK A;  5ECA A;  2LCS A;  3PVQ A;  3BDL A;  1BCO A;  5GAO r;  3CEY A;  3H41 A;  1VQ6 A;  1UHC A;  1D3B A;  2ZPH B;  2KRS A;  4LDU A;  4M7D G;  2K7A A;  3D7S B;  2CP2 A;  2Y90 A;  1H3Z A;  5KYX A;  2RQU A;  3JCM W;  4PJL A;  3V8L A;  2RH2 A;  2ESW A;  4A54 A;  3REB B;  5HK0 A;  3EH1 A;  1HSQ A;  5CAI A;  3JRZ A;  1K9A A;  2YRV A;  3GPL A;  4ATO A;  1VQP T;  4PFZ A;  3QWY A;  4M7D C;  4B6M A;  3INZ A;  3L42 A;  2DEQ A;  3SWN B;  3V8J A;  4C5I A;  1S72 A;  1K1Z A;  3I56 T;  1OOT A;  2EGA A;  2DK3 A;  1GBQ A;  2ZAE A;  2L89 A;  4KGZ B;  2XI9 A;  1YI2 T;  4PJO F;  3UA6 A;  2MAM A;  3OYJ A;  2K2V A;  1GXI E;  1MMN A;  4M75 E;  2XID A;  5IHK A;  3V7R A;  1W2B A;  2RHX A;  5J26 A;  1TS9 A;  1VQM Q;  2CS7 A;  4F16 A;  1M90 C;  4FT4 A;  2X4W A;  4OP0 A;  1R0C B;  4KUD K;  2JMC A;  5GAN g;  2AZV A;  2EPD A;  3PNW C;  2CUD A;  2DX1 A;  4OB1 B;  2GFU A;  1MGQ A;  1PG5 B;  4JUV A;  2M0O A;  1YIJ Q;  5GAM f;  2DPP B;  4M78 F;  1I5O B;  2D0N A;  4AT1 B;  3S3N A;  4J9F A;  3I55 A;  1JJ2 A;  1O75 A;  4PJO A;  4N4I A;  2F2V A;  1G3Y A;  6AT1 B;  1G3S A;  4BUG A;  4RUG A;  7AT1 B;  3RER A;  4P5N A;  4JS5 A;  3OYN A;  2E6N A;  5D6Y A;  1Q7Y U;  4OMP A;  4LDW A;  2FZC B;  3M0P A;  1TUC A;  1VQ5 Q;  1PD0 A;  4E7H A;  1N8R U;  4BE1 A;  3NTK A;  3ZEH A;  2K6D A;  2ZPE B;  2ZGW A;  3CCQ A;  4FIB A;  2D9T A;  2EKH A;  4ZGJ B;  1QQJ A;  3MEA A;  2F2W A;  1Q7Y C;  2L2P A;  1M1F A;  2DBM A;  2G6F X;  2DXT A;  1OV3 A;  1ZSZ B;  3ME9 A;  4J7I A;  4M78 A;  1N8R C;  1Q7Y R;  1VQ6 Q;  2K4Y A;  1WHJ A;  2NYS A;  2QEX A;  2WSF E;  1N8R R;  1MMA A;  4HCB A;  2QGG A;  2AKL A;  3I5S A;  1RAI B;  4XTU A;  2DAQ A;  3R6N A;  4AFU C;  1YHQ T;  3A8O B;  1NLO C;  2C0I A;  2FB7 A;  1T0H A;  4D8K A;  1S72 Q;  4CI0 C;  2DVJ A;  1FXX A;  4J9G A;  5CQX A;  4C5G A;  1M8V A;  3CC4 Q;  1QCN A;  2KYB A;  2EYX A;  3TSZ A;  1VQ8 T;  2QA4 A;  3QPH A;  4MZT A;  4XU1 A;  3HP9 A;  4AG1 C;  3QSU A;  2LVM A;  1VYU A;  2K5L A;  2XK0 A;  4DOW A;  4M77 F;  2X9H A;  1I0C A;  3LGL A;  2RPN A;  4C8Q B;  2JTF A;  3BFM A;  2DXU A;  1NYG A;  5GMK e;  4OGE A;  4L59 A;  3A8G B;  1UJ0 A;  4OVA A;  2OTL A;  2X4Y A;  1UB4 A;  5C6S A;  2PZ1 A;  4RTX A;  2Y4X A;  1BK2 A;  2X51 A;  4RTV A;  2FG0 A;  4BDY A;  2KXC A;  2MPX C;  3GNG A;  5GAN 7;  3OYL A;  4MML A;  3JCM J;  2ECZ A;  5IHI A;  1QP2 A;  3OYF A;  3JCM h;  1OUL A;  1VQP Q;  1FMW A;  2RN8 A;  2BUD A;  1ABQ A;  3CCJ A;  1SSF A;  2R5A A;  2RD1 A;  2W10 A;  4QQ6 A;  3HFO A;  1U3O A;  1PHT A;  2P4R A;  2FZK B;  4NL3 A;  3FJ5 A;  4PJO E;  1N9S A;  2FL7 A;  1YJW T;  4QKU A;  4DOV A;  1ZSG A;  2VV5 A;  2BKD N;  2FPE A;  5CQY A;  1ZBX A;  5CKB A;  2EJG A;  1HXD A;  5GAN 3;  2EGE A;  4A4F A;  1BU1 A;  2K3X A;  2LCC A;  4KH0 B;  3J81 E;  2DET A;  4M75 B;  3QYG B;  3CBM A;  2L3R A;  3JCM c;  2VUB A; 
#chains in the Genus database with same CATH homology
 3HSB A;  2E12 A;  1KHI A;  3M55 A;  3PT9 A;  3OYI A;  1X75 C;  1WNL A;  3V7C A;  3JB9 J;  3JAM E;  3F70 A;  4R56 A;  3EAE A;  4FT2 A;  2RJE A;  2K5I A;  4MZM A;  3VV0 A;  3TCJ A;  1WJR A;  2RJC A;  5GMK m;  5GAN h;  5I21 A;  2O01 E;  3OS2 A;  3SB2 A;  3M53 A;  4XAX B;  3M59 A;  3P8B B;  2WSC E;  4WF2 A;  2RJD A;  5CCA A;  3L2R A;  1K73 C;  3OQ5 A;  5J39 A;  4PNO A;  2MI6 A;  5DLO A;  3MCA B;  1WPY A;  4RCB A;  5LJ3 g;  4M78 E;  4BB7 A;  1U1S A;  5GAO l;  3JCM P;  3OS0 A;  4ELZ C;  1Q86 C;  2RHU A;  4M7D D;  4C0D C;  2MMP A;  3J7A F;  4QQG A;  3CCV T;  2RI3 A;  1LNX A;  3OYA A;  5FRO A;  1PSE A;  2R5M A;  4NS5 A;  2L5Q A;  5HKC A;  5CKF A;  5LJ3 d;  1YJN T;  3NTI A;  1YIJ T;  4IUQ A;  5A0G A;  3CD6 A;  1B34 A;  1YIT A;  1M9S A;  3CCJ T;  2D0Q B;  2F5K A;  3ZFJ A;  2HQE A;  5CKH A;  4C92 A;  4J7F A;  5GMK h;  4KUI A;  5LJ5 j;  4C92 D;  3PGG A;  4CRI A;  3GF5 A;  3GLX A;  4E47 A;  3CCL A;  4XK8 E;  4C0Z A;  3G4S A;  3LLR A;  2E6Z A;  3OBW A;  3HRU A;  3MHX A;  3JB9 D;  2E70 A;  2ZPI B;  3OYG A;  3G6E T;  1QW1 A;  2KY9 A;  2P0Q A;  2FVU A;  5AYF A;  4ZTF A;  2JZ2 A;  4M75 G;  5GAO p;  2KDS A;  5D6W A;  1YJW A;  4VUB A;  1BYM A;  4BDZ A;  2O4X A;  4UC4 A;  2PVG B;  4Q5W A;  2VGN A;  1YBY A;  4BY6 C;  3FDR A;  3OYY A;  3KXT A;  3CC4 A;  4X9D A;  1VQL T;  4LD9 K;  2PVD B;  4M77 B;  1UEB A;  3X26 B;  4ME7 A;  4DA4 A;  3FEO A;  4C92 C;  3ASK A;  5LJ3 j;  4BE0 A;  3DKM A;  1O9S A;  4JJN K;  1U8R A;  4HCC A;  1BI0 A;  1KHC A;  4ZTJ A;  3QYH B;  3JCM b;  2MWO A;  3M9Q A;  4O6J A;  5GAN 5;  3OYC A;  1VQ5 T;  4FU6 A;  2QQS A;  5J3B A;  1JRI A;  4MDW A;  1XTD A;  2KQW A;  1WQW A;  1LJO A;  3X20 B;  3OYD A;  5CR2 A;  1Y96 B;  2JN0 A;  1I5L A;  4F7U G;  4M7A F;  1TH7 A;  2XHC A;  3M58 A;  3L1A A;  4N0A A;  3M54 A;  2KSS A;  2V8J A;  3OSV A;  3M4G A;  4IUP A;  4EPC A;  3G71 A;  1VQM A;  2KK4 A;  4XU3 A;  2XD0 A;  5FLX E;  3CPW A;  2CZ0 B;  4PKC C;  3NFC A;  4IKF A;  4A4K A;  3JCM X;  3L2V A;  2P0P A;  4ELY C;  1I4K 1;  3OMC A;  1KQ1 A;  4D6W A;  3CBP A;  2VYT A;  5KCH A;  1WJQ A;  2EQM A;  2ZZD A;  3P8D A;  3G7Z A;  3MP8 A;  2DJZ A;  2RM4 A;  3MEU A;  1M1G A;  1BI3 A;  2E1H A;  3OYB A;  3CC7 A;  4N0A C;  2FHD A;  3VYG A;  3S6W A;  3SWN A;  5FRN A;  3ZBD A;  3QZ5 B;  4BI8 B;  2E41 A;  4GLK A;  4L5G A;  3QII A;  1R8O B;  3L2W A;  1YIT T;  1Q82 U;  1EIF A;  1M5Q 1;  4OB0 B;  3CD6 T;  2HNI A;  3JCM V;  5DM7 R;  2QDY B;  1QVG S;  3N5B B;  4MDX A;  1P92 A;  2JOY A;  4X34 A;  3OYE A;  2DTH A;  4EDU A;  5LJ5 e;  4JDS A;  4OB2 B;  3JCM c;  2CKK A;  5GAN 6;  2EAY A;  5GAM e;  5GAN 4;  5LJ5 f;  2ZPF B;  3CCL T;  4O5V A;  3PIO A;  1UGS B;  4BD3 A;  3G4S T;  3CXC S;  1VQP A;  5A2Q E;  3FRN A;  1RL2 A;  1WQ7 A;  4KUL A;  3OB9 A;  3V8K A;  4M7D F;  1VQ4 A;  2MWP A;  3SWN C;  4XTZ A;  2L8D A;  3PFS A;  4PJO D;  1V29 B;  3RKW A;  2QI2 A;  4M7A G;  4M7A A;  2LT4 A;  2WAC A;  3CC4 T;  4MZP A;  4BY6 B;  3GNF B;  1G5V A;  4OMF B;  2ZPG B;  3I56 A;  1NJI U;  3FLG A;  3SFM A;  4C92 B;  1I8F A;  4M77 E;  3H8Z A;  1XNI A;  5LJ3 f;  3CCE A;  1WJS A;  4L6V 5;  3WXM B;  2EKO A;  3MET A;  3MEV A;  2V8I A;  3JB9 F;  2K5F A;  3L2U A;  3EFS A;  2HAX A;  1YI2 A;  4IUU A;  4J6Y A;  1K73 U;  1W4S A;  2RI2 A;  4C8Q D;  2YHT A;  5LJ5 g;  4LDX A;  1UGQ B;  2O4X B;  4PLI A;  4M7A C;  5GAM g;  1OZ3 A;  4X9C A;  1Q86 U;  3HRS A;  4GY5 A;  1NZ9 A;  3OYM A;  2XDD A;  2QQB A;  2DIQ A;  4E7L A;  4HT8 A;  2GFA A;  2XKO C;  3BY7 A;  3G71 T;  2EQK A;  1VQM T;  1W2B S;  3KUF A;  1NJI C;  3OMG A;  5LJ5 d;  4HKE A;  3UT1 A;  2A3L A;  3QDR B;  5GAM d;  2E5Q A;  3EFR A;  4DQ2 A;  2ZCF B;  3FC3 A;  3NTH A;  3BDL A;  4A53 A;  5GAO r;  4JRQ A;  2KAF A;  2DD4 A;  2F69 A;  3CEY A;  3UDC A;  5I2S A;  4RG8 A;  1D3B A;  2FYK A;  2ZPH B;  5LL6 S;  4C5H A;  3OSS C;  4IUT A;  3OYK A;  2M9U A;  2CYZ B;  4F7U B;  4M78 D;  4JRI A;  4LDU A;  3CC7 T;  4LDV A;  4M7D A;  4M7D G;  3T9N A;  2GQV A;  2IVW A;  2Y90 A;  1IZ6 A;  3CC2 A;  1H3Z A;  2LTO A;  2GF7 A;  3RMS A;  5GAN 8;  4MMK A;  3JCM W;  3V8L A;  4PLL A;  2RH2 A;  3QKJ A;  2X4J A;  4A54 A;  5HK0 A;  3M57 A;  4B9X A;  3FJP A;  4J83 A;  1N27 A;  1VUB A;  2DO3 A;  3JRZ A;  3PMT A;  4C92 G;  2QXF A;  5CAI A;  3J80 E;  1PSF A;  5GAM j;  2YRV A;  5GAO q;  3GPL A;  1YJ9 A;  4YTL A;  1VQP T;  3JB9 G;  4EMK A;  1VQ7 T;  4R55 A;  4ATO A;  1VQ9 A;  4M7D C;  5FU7 C;  1OI1 A;  3INZ A;  1VQ4 T;  2EFI A;  2RK2 A;  3L42 A;  2DEQ A;  3SWN B;  1UGP B;  3V8J A;  4QQD A;  4BAC A;  4C5I A;  1S72 A;  2RO0 A;  3QG1 A;  4N4G A;  2HD0 A;  2XIC A;  3CCU A;  2X4X A;  3BW1 A;  3S3M A;  3LW5 E;  4XTY A;  3I56 T;  2VXE A;  1FWZ A;  2WSE E;  4OGC A;  5KE2 A;  2DK3 A;  3CCE T;  1KQS S;  5GAN e;  4EMK C;  2EIF A;  4J5Y A;  2L89 A;  3A5Z B;  3TU4 K;  2XI9 A;  2M1H A;  1YI2 T;  5EG2 A;  2DZC A;  2HQX A;  1IRE B;  3QO3 A;  3VUZ A;  2QQA A;  4PJO F;  5FRM A;  2MAM A;  3OYJ A;  2K2V A;  2EWN A;  1GXI E;  5GAO m;  3VJP A;  4M7A B;  4HT9 A;  4M75 E;  2XID A;  4JS4 A;  3V7R A;  1W2B A;  5LJ5 h;  2RHX A;  3C95 A;  2DZ9 A;  3O8V A;  1VQO T;  1BIA A;  1VQ7 A;  1Y7X A;  5J26 A;  2YLB A;  1XQH A;  3X25 B;  2M16 A;  4IUR A;  2AHJ B;  4JLI A;  2CS7 A;  4XTX A;  1M90 C;  2XU8 A;  4FT4 A;  2DXB A;  2X4W A;  1BIB A;  4OP0 A;  3SD4 A;  4C8Q F;  1VQ6 T;  2RA2 A;  2VGM A;  3FIF A;  3FB9 A;  3GP8 A;  2R57 A;  5GAN 2;  3QJ6 A;  4KBM B;  4E7K A;  4KUD K;  4KT0 E;  5GAN g;  1QVP A;  2KMT A;  4BI3 A;  4C0D B;  1N9R A;  4F7U E;  4ZN1 A;  3PIP A;  4E7I A;  1G3W A;  3CPF A;  3LH0 A;  3PNW C;  5LJ3 h;  1JB0 E;  4EMH A;  3CC2 T;  2LQ8 A;  4OB1 B;  2GFU A;  2RB6 A;  4N4H A;  2P0K A;  1MGQ A;  3HKS A;  5C0M A;  5GAN d;  5M9O A;  4JUV A;  3JB9 I;  3M4Y A;  5CKD A;  1U1T A;  3SDZ A;  2M0O A;  2EJF A;  3DB3 A;  1D3B B;  4HA8 A;  2EQU A;  4QVC A;  3AHU A;  5GAM f;  1YJ9 T;  2DPP B;  2K3Y A;  4M78 F;  3QSU A;  1VQ9 T;  4M7D B;  2B8A A;  3S3N A;  3OBY A;  5FU7 B;  3I55 A;  1YHQ A;  2NLU A;  1VQN A;  1JJ2 A;  5CKE A;  1O75 A;  4PJO G;  4N4I A;  4RMO A;  4PJO A;  1S72 T;  1G3Y A;  3CCU T;  1OZ2 A;  2XDB A;  1B34 B;  4II1 A;  4V2S A;  1G3S A;  2EQJ A;  4BUG A;  3DB4 A;  1VQK A;  2JUF A;  3RER A;  1QVF A;  4P5N A;  4XU2 A;  4M77 A;  3CBO A;  3OYN A;  4JS5 A;  2E6N A;  4M77 D;  3JCM Q;  3S3O A;  5D6Y A;  1H64 1;  1Q7Y U;  1VQ6 A;  4ZN3 A;  4EMK B;  5GAN j;  4NL2 A;  1X01 A;  3CCR A;  2LT1 A;  4LDW A;  4PJO C;  4C8Q G;  4C8Q A;  1I81 A;  1VQ8 A;  3OS1 A;  4E7H A;  1N8R U;  4BE1 A;  3URG A;  3OS5 A;  2EYQ A;  1JBM A;  3CCM A;  3NTK A;  3ZEH A;  3MO8 A;  1M4Z A;  2DTI A;  4M7A E;  2ZPE B;  3OY9 A;  4RCC A;  3JCM e;  2ZGW A;  2ZPB B;  4FIB A;  3Q1J A;  5A0L A;  3CCQ A;  2D9T A;  3MP1 A;  4ZGJ B;  4XTV A;  3RKY A;  3MEA A;  1RI0 A;  3JCM f;  5CO7 A;  4QVD A;  2DIG A;  1VQO A;  1N6A A;  3RUX A;  1Q7Y C;  4A4E A;  1M1F A;  4RG2 A;  2DXT A;  5GAO n;  4C8Q C;  2DTO A;  4A4H A;  4FL6 A;  3OW2 A;  2LC4 A;  4QVZ A;  4Z02 A;  4EMG A;  3RMQ A;  1XOV A;  2DD5 A;  3ME9 A;  4J7I A;  4M78 G;  4M78 A;  1N8R C;  2CZ7 B;  4M75 F;  4C0F A;  4FM4 B;  3E19 A;  3QJY A;  3PMI A;  2PUO B;  2C06 A;  2DVE A;  2K4Y A;  3CMA A;  2XDP A;  2GCX A;  2X35 A;  5KE3 A;  3CXC A;  1YCY A;  2RJF A;  1G3T A;  2QEX A;  3C4S A;  4JRP A;  3E9G A;  1M1K C;  3QBY A;  2WSF E;  1DJ7 B;  4QW2 A;  2QTX A;  4HCB A;  3E9F A;  3VYH B;  3HL8 A;  3CCS A;  4FSX A;  1NPP A;  3M5A A;  1FX7 A;  4RKU E;  4XTU A;  2HBP A;  3VU3 C;  1Q81 U;  3JCM g;  2H3J A;  4M78 C;  4B9W A;  3GOX A;  2DAQ A;  3LGF A;  4JRK A;  1Y07 A;  5IT9 E;  3X24 B;  3I55 T;  4TVR A;  1YHQ T;  3A8O B;  4F7U F;  5IAY A;  4J6X A;  3CPW S;  1VQN T;  4M7D E;  2RHI A;  2VXF A;  4E7J A;  2OTJ A;  3GIB A;  3JCM d;  4OF1 A;  5CK9 A;  2RHY A;  2EJ9 A;  2FB7 A;  2K57 A;  1HK9 A;  2I2L A;  4J8O A;  4A4G A;  1VQK T;  2E64 A;  5FU6 C;  4CI0 C;  1FXX A;  5CQX A;  1KC8 U;  3TRE A;  4C5G A;  1M8V A;  3L2Q A;  5D6X A;  1BI2 A;  1Q81 C;  4LDY A;  3R6O A;  4C92 E;  3HRT A;  3CCR T;  5GAN f;  1M90 U;  3M56 A;  3QUI A;  2DKG A;  2LNV A;  3DLM A;  2PQW A;  3VUB A;  1VQ8 T;  3WVD B;  2CZ6 B;  2QA4 A;  3QPH A;  4PJO B;  2JNG A;  1X6O A;  4MZT A;  1VIF A;  4ZGE B;  1KD1 U;  4Y28 E;  4XU1 A;  3BDU A;  3HP9 A;  4M75 A;  5GMK i;  3A8M B;  2CGH A;  4M75 D;  2LVM A;  4OB3 B;  5CIU A;  5KH6 A;  3QXE B;  3HPW A;  3CME A;  3CCM T;  2R58 A;  2V8K A;  1K9M U;  2PUK B;  1AHJ B;  4LD6 A;  1VIE A;  3CCQ T;  2K5L A;  2XK0 A;  3JSC A;  4JLG A;  4DOW A;  1BI1 A;  4M77 F;  5GAM h;  1KC8 C;  3ER0 A;  3PTA A;  2IG0 A;  3DLL A;  2CZ1 B;  4C5E A;  1JJ2 S;  3LGL A;  2A7Y A;  4C8Q B;  1NPR A;  3UPU A;  2JTF A;  3BFM A;  2DXU A;  5GMK e;  2P4T A;  3A8L B;  4M75 C;  3RIR A;  3C12 A;  4OGE A;  1KD1 C;  4L59 A;  1QVF S;  3A8G B;  3L2Z A;  4OVA A;  2OTL A;  2X4Y A;  1K8A U;  3MEW A;  1UB4 A;  4F7U A;  1UGR B;  5C6S A;  1K9M C;  3CMA T;  2QEX T;  3HFN A;  4IUV A;  3CCV A;  3E1S A;  2Y4X A;  2RI5 A;  4J6W A;  1MHN A;  4XU0 A;  3CCS T;  4BDY A;  3GNG A;  1ZHI A;  2YLC A;  3QZ9 B;  5GAN 7;  3OYL A;  3LX7 A;  4MML A;  3VKI A;  3JCM J;  3LYI A;  4M78 B;  2E10 A;  3TEE A;  5L8R E;  1NE8 A;  2LRQ A;  1QP2 A;  3OYF A;  1KQS A;  1KQ2 A;  1K8A C;  3JCM h;  2OTJ T;  4XTW A;  1ZQ1 A;  3OA6 A;  2BIV A;  1QP3 A;  3RKX A;  2BUD A;  1KG1 A;  2LQK A;  2D6F A;  5GMK l;  1YJN A;  1YIJ A;  3RES A;  3MP6 A;  3JB9 H;  1Y71 A;  3OW2 S;  3CCJ A;  1SSF A;  5FU6 B;  2R5A A;  3V7S A;  2RD1 A;  4M77 G;  2RHZ A;  4XQ3 A;  4NOY A;  5A0D A;  4QQ6 A;  3P8H A;  3HFO A;  1LOJ A;  2DXC A;  2LX9 A;  2F5T X;  2G3R A;  4ZGD B;  5KCO A;  4BI4 A;  2QQ9 A;  2OAU A;  4NL3 A;  3A8H B;  4Y91 A;  2QA4 T;  3G6E A;  2QQR A;  3LWI A;  3QHS A;  4PJO E;  2VC8 A;  1N9S A;  1Y96 A;  2FL7 A;  2KVQ G;  3CME T;  4PL6 A;  1YJW T;  2XG8 D;  4DOV A;  3UWN A;  2VV5 A;  3H6Z A;  5HY6 A;  2JVV A;  2E65 A;  1BKB A;  2BKD N;  4M7A D;  2LDM A;  4C0G A;  1Q82 C;  5I2M A;  4M77 C;  3X28 B;  1M1K U;  4HCZ A;  1VQL A;  5CQY A;  5IN1 A;  5LJ3 e;  1ZBX A;  5CKB A;  4C92 F;  2EJG A;  3WVE B;  3OYH A;  2PVO B;  1HXD A;  2PU9 B;  1OYX A;  3C94 A;  2RK1 A;  5DLQ E;  1WGS A;  5GAN 3;  3HHT B;  4A4F A;  1VQ5 A;  5DY9 A;  5CVI A;  2K3X A;  2LCC A;  2JTM A;  3J81 E;  1QVG A;  5GMK j;  4M75 B;  4C8Q E;  4BE2 A;  2LCL A;  3CBM A;  3KBG A;  3QYG B;  2L3R A;  2MF2 A;  3LWH A;  2Y4Y A;  5HK3 A;  2OTL T;  2VUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...