2RJFA

Crystal structure of l3mbtl1 in complex with h4k20me2 (residues 12-30), orthorhombic form i
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
315
structure length
315
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 78
structure length 315
sequence length 315
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjfA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjfA03
3C4SA 1WGSA 4IURA 5D6XA 5KCHA 2IG0A 2B8AA 3F70A 3OMGA 4PL6A 4BACA 4QQDA 4E7IA 4PLIA 3OYKA 2YRVA 4E7KA 2K3XA 2MWOA 5C0MA 3L2WA 4HCZA 3S3NA 3EAEA 3MEWA 4E7LA 2M0OA 2QQSA 4QQGA 4C5EA 3L42A 5KE3A 5KCOA 4N4HA 2RHUA 3MO8A 2E6NA 4IUPA 1OZ2A 2EFIA 3E9GA 3OYFA 3L2UA 4BE0A 4N4GA 4IUUA 5M9OA 3GOXA 4UC4A 4IUQA 2NLUA 2JTFA 2EQMA 3LYIA 3META 3S3OA 1SSFA 3P8HA 3FC3A 3LGLA 3DLMA 3ASKA 1G5VA 2P0KA 1KHCA 1OZ3A 3NTHA 1OYXA 2E5QA 2DIGA 3OQ5A 3Q1JA 5CIUA 4QVZA 5IAYA 3PMIA 4L59A 3OA6A 3OMCA 2MWPA 3H6ZA 3OY9A 4BDYA 1RI0A 2F5KA 4A4GA 2M16A 4FL6A 1H3ZA 3SD4A 3MP1A 3QIIA 4II1A 5IN1A 3OYCA 3OYHA 3O8VA 3L2VA 2RHXA 5D6WA 2BUDA 2M1HA 4A4EA 3PFSA 3OYEA 3OYIA 2X4XA 4IKFA 4OVAA 4BD3A 5D6YA 3H8ZA 3PMTA 2CKKA 3S3MA 3ZEHA 1OI1A 1MHNA 2XK0A 3UWNA 2GF7A 4BDZA 2LVMA 5KH6A 3LLRA 4ZTJA 2RHIA 4GY5A 4IUVA 2GFUA 2LDMA 4N4IA 2R58A 2LTOA 4C5HA 3OYAA 3S6WA 2JZ2A 1WJRA 4QQ6A 4FU6A 4CRIA 4B9WA 3OYLA 3NTKA 3P8DA 5J26A 2DAQA 3OYDA 2LRQA 2RJFA 3QBYA 1N27A 4C5GA 1XNIA 2R57A 2PQWA 5FROA 2BKDN 3E9FA 3PNWC 3MEVA 3LGFA 3NTIA 4E7HA 3ME9A 2R5MA 3MEAA 2QQRA 2RHZA 3UT1A 2RO0A 2VYTA 3QKJA 4Q5WA 2G3RA 2X4WA 5J39A 3OYMA 3LX7A 3OS0A 2RI5A 2L3RA 2L8DA 3OS1A 4B9XA 1WJQA 2LCCA 4PLLA 3FDRA 3OS2A 4E7JA 2EKOA 3OYJA 3L2RA 3QJ6A 4A4FA 3DB3A 3FLGA 3KUFA 2FHDA 2EQUA 2R5AA 4Z02A 2HQXA 2BIVA 2RHYA 2EQKA 3MP8A 3DB4A 3MP6A 2RI3A 2RJEA 3M9QA 2O4XB 2EQJA 2K3YA 4C5IA 2HQEA 4LD6A 2GFAA 5C6SA 2WACA 4IUTA 3BDLA 4RG2A 2XDPA 2X4YA 3OYBA 3L2QA 3LH0A 3MEUA 4QW2A 5FRNA 2O4XA 2RJDA 3FEOA 4X34A 3OYNA 3OB9A 5FRMA 2DIQA 5KE2A 2X35A 2D9TA 4A4HA 1WJSA 2L89A 2RJCA 4BE1A 4ZTFA 4EDUA 3OYGA 4BE2A 3CEYA 4NS5A 2RI2A
chains in the Genus database with same CATH superfamily
1M90R 3CBMA 1VQ5Q 2GTJA 4KH0B 2C06A 1K8AU 4ME7A 4PLIA 3OYKA 4DA4A 3CQTA 3OW2A 3HFNA 2JTEA 4RCCA 3CCLA 1UG1A 5IHNA 3E9GA 5GAMg 1Q82R 2VWFA 1G3TA 1Z9ZA 4IUUA 2FG0A 4M7DA 3FB9A 2K9GA 3FC3A 1SPKA 4JJNK 1ABOA 5GJVB 2KE9A 4KT0E 4F7UB 3OMCA 1VQ4A 1H3ZA 3M4YA 3RERA 1JBMA 4RTTA 4O6JA 1VQ9T 1WFWA 1JQQA 2DK3A 1TU0B 2CUBA 2DXTA 5GAN3 1U5SA 2P0QA 4IUVA 4HT9A 4LNPA 4FYVB 3OYLA 4J9CA 2L3QA 4LDWA 3OBWA 3CPFA 4M75D 3EGUA 2JMAA 2V26A 3LGFA 1B3QA 1VUBA 1NLOC 5CR2A 2GGRA 4E7HA 3PVLA 2KXDA 1OPKA 5IXFA 1VQ7Q 3R6NA 5GAMj 2JM9A 1QVFS 1WA7A 1UJYA 3G71A 1VQPT 3I56Q 3VS3A 2MAMA 4X9CA 2C0TA 3VS5A 3DB3A 5KYUB 1T0JA 4J9FA 2DRMA 2O4XB 1RI9A 2DVEA 2EYXA 3RKWA 3WXMB 3JCMd 4IUTA 3L2QA 3MEUA 1UECA 2DXCA 1SEMA 3UATA 2PU9B 3OMGA 3IQLA 1KHIA 3CBPA 1X69A 3EAEA 2EQIA 1UEBA 4RUGA 4XTYA 2OTLT 1EIFA 4A53A 3GLXA 5CKEA 1BI1A 1Y0MA 1ZSGA 2E6NA 1JB0E 1FX7A 1OZ2A 1K0SA 4PJOC 2DXBA 5GAOr 3BDUA 1P92A 2YUPA 2E12A 3JCMW 4PJOB 4EMKB 3VS6A 3GNGA 3A8HB 3CCJT 1W2BS 1KQSA 1W2BA 3OYCA 1V76A 4GLKA 4QVCA 3KFVA 2FL7A 2FZGB 4XAXB 4A4EA 3CCRT 2X4XA 2FRWA 4RTZA 2ED1A 1N5ZA 2DF6A 1UB4A 1WLPB 4RG8A 2JM8A 2CGHA 1PSFA 2OTLQ 1S72T 2XDBA 2LRQA 3HKSA 5IT9E 2CUDA 3KXTA 4C8QF 1LJOA 5CKDA 1ZSZC 3PIOA 1FWZA 3N5BB 1W4SA 2QGFB 4M7DF 2QQRA 2RHZA 3HP9A 1YFNA 3OYMA 3ZBDA 1PKTA 1VA7A 3CCMA 3I9QA 2YUOA 4M75G 5GAMf 3EFSA 4ATOA 5I2MA 1WHKA 2RHYA 2RQTA 2IPOB 1M3CA 2EQJA 4C5IA 1IXDA 1VYVA 3RBBB 2P4RA 3RDVA 4R0KA 3CPWS 5FWBA 3HRUA 2D6FA 5CKFA 4DOVA 2CH4A 1G3YA 3V7CA 2X35A 4C92G 3AT1B 4BE2A 1U8RA 1VQ7A 4F7UF 2KY9A 4XU1A 3CC7A 4BUGA 5D6XA 5GMKe 1MV3A 1LCKA 1VQKQ 2NUTB 2XIDA 2QQSA 3QYHB 4MDWA 2DETA 2RHUA 4C8QC 2M0YA 1F1BB 1FMVA 2GBQA 2JW4A 3QJYA 1M4ZA 5GMKh 3OSVA 1SSFA 3LGLA 1SF9A 3V8KA 2ESWA 1Q81C 2AK5A 2QDLA 3MCAB 3OA6A 4OMPA 4N0AC 2F5KA 2COZA 2CH4W 1VQ4Q 3RKXA 4M77C 4II1A 2K3BA 4RMOA 2RF0A 2ZCFB 2RM4A 4LXCA 2ZPFB 3PMTA 2CZ0B 3S3MA 1BIAA 4KBMB 1G83A 4OMFB 3EHRA 4M77G 1KFZA 2XMFA 2LVMA 4M7AB 2AKLA 2M02A 2DEUA 2AZSA 2EAYA 4M78C 5GAN2 3S6WA 4PJOA 3G4ST 3JRZA 4HVUA 2CT3A 3CCLQ 2O88A 1JEGA 3TSWA 2CP2A 3M0SA 2QGGA 3A98A 2BTTA 1KIKA 2ZPIB 3NTIA 1VQ5A 2CZ1B 2ECZA 3UT1A 3UPUA 1JRIA 1VYUA 1MV0B 2DE0X 4FIBA 3C0CA 2LNVA 1I1JA 1UGRB 1G3SA 2E70A 2KAFA 3CBOA 1UFFA 4Z02A 3CCVA 1RADB 2HQXA 5LJ3d 5LL6S 1KC8C 1IGUA 4M77E 3CCEA 1KQSP 4FCYA 1KQ1A 2EYZA 3VRZA 5LJ5e 3A5ZB 1WHHA 4M77D 1PNJA 3EH1A 5C6SA 1C0MA 2LT4A 1ABQA 1YI2T 1PM3A 1WYXA 3FEOA 4X34A 2DIQA 4FW1A 3JCMc 1R0CB 2VC8A 2CZ6B 4PNOA 2IG0A 5FWCA 4C92F 1ZSZA 2HAXA 4M78B 3TCJA 3TU4K 4F16A 3REAB 3OYFA 4BE0A 4LDVA 1K73C 4FYXB 3QPHA 1WI7A 3RMQA 2LCLA 2Y4XA 3TREA 4BY6C 2QXFA 2BE7D 2K4YA 1M8MA 1VQNA 3G4SA 5GAMd 1VQMT 1HYOA 2A28A 1RI0A 2HNIA 2M16A 3AHUA 1MMAA 2J6FA 2BZ8A 2NYSA 5IN1A 3CMEA 3CPWA 3CMET 1YJWQ 2VGNA 1OEBA 1IHWA 2ATCB 4GLMA 4F7UA 4AFQC 1UE9A 4ZTJA 1N9RA 1TTHB 4EMKA 1V1CA 3E19A 3VYGA 3NTKA 5GMKl 2DD4A 4CC2A 1NLPC 2JJ9A 1GBRA 3TQ7P 4Y28E 4HT8A 2KYBA 4PJMA 2QA4Q 4PJOG 1VQLT 1KC8U 4CC3A 3OS0A 3JCMe 4XK8E 1D1BA 2LCCA 2EKOA 4HCCA 1VIFA 2DRKA 1Q86C 1HSQA 2R5AA 3D7SB 1NYGA 1SHGA 1K1ZA 4M77A 1NEGA 3R6OA 1NJIC 4FYYB 4ORZA 4C8QA 1VQ6Q 1M1GA 2LQWA 4N0AA 3CMAA 2DYBA 4JLGA 2KSSA 1TXQA 3HFOA 3CCQA 1IO6A 2KNBB 1W70A 1TUGB 2KRNA 3M0TA 1I81A 1JXOA 1MMNA 2LT1A 1QVPA 2E64A 2NUZA 4M4ZA 2QA4T 3VUBA 4ESRA 2DA9A 2EFIA 2GQIA 1QVGS 5FU6C 1MUZA 2ROLA 3CC4T 4YTLA 4EPCA 3UA6A 2HCKA 3O5ZA 5FU7C 1IRXA 2KDSA 1B34A 3PMIA 3CMEQ 1WXUA 5GJWB 1X43A 1NJIR 2FEIA 3JB9G 3CPWP 3TSZA 5GAOm 2JN0A 1RACB 2VGMA 1B34B 4BD3A 2K57A 1TG0A 2XU8A 4LUDA 2XK0A 3UWNA 3VV0A 1AD5A 3HHTB 1QVFA 2ZZDA 1PRLC 2DAQA 3M5AA 2WSEE 1N27A 1VQKT 4X1VA 1W1FA 3E9FA 4MMLA 2HBPA 1PKSA 4L5GA 2VYTA 3QKJA 1TWBA 1T3SA 1MMGA 1M1KR 2XD0A 3JCMg 1FMWA 5GMKj 1U1TA 2VVKA 4EMGA 1WQ7A 2IVWA 3OYJA 1VQOT 5GAN4 1QKXA 1WNLA 1GFCA 3DB4A 3MP6A 3CCUQ 1UGVA 2VUBA 3EFRA 3QG1A 1M30A 1BIBA 2X4YA 1WHMA 2DBMA 2X4JA 4XQ3A 4M78G 1NM7A 2EWNA 1YHQT 4LDUA 1WJSA 3I5RA 2FPEA 2GQVA 1X27A 3CEYA 4NS5A 2RI2A 2EYWA 4JLIA 2E3HA 4OMNA 3G71Q 3M54A 4IIMA 3WVEB 1Z9QA 1YWPA 2I0NA 3ER0A 3LW5E 1ZUKA 2DL3A 1QCNA 3L2UA 2HSPA 3CCLT 1RAFB 3SHWA 1JU5C 2EQMA 5GANd 3ZFJA 4D8DA 1BU1A 3DLMA 1QWEA 3QHSA 4ELZC 1M1KU 2OX7A 3OQ5A 1YJNT 3NFCA 4ZN3A 2RMOA 3JCMP 3SD4A 3JB9I 3O8VA 3L2VA 4M77F 3HL8A 4RKUE 2RPNA 4OVAA 4A4KA 3RUXA 1OI1A 1KJWA 2DTIA 2DPPB 1K8AC 1K9AA 4OMOA 1A0NB 5DY9A 2PQWA 2RB6A 2O31A 4MZMA 1E6HA 2HDAA 1MMDA 4OB1B 5DLQE 1TH7A 4J9DA 1OPLA 2XG8D 3OS1A 2DL5A 2FYKA 3CCMT 5FW9A 2FZCB 3CXCS 2EQUA 4JZ4A 2RJEA 4M7AG 2E3IA 2CP6A 3CCUA 3QWXX 4M77B 3JCMX 2DO3A 2LX7A 3CXCP 1M1KC 1ZUUA 2RH2A 5FRMA 1U06A 1ZQ1A 4M78F 4EDUA 4XU2A 1KD1U 5GANg 2QG9B 3RNJA 2O2OA 5AT1B 3QSUA 1I5OB 4M78D 2OTJQ 2H8HA 3L2WA 1UJ0A 2DM1A 5KCOA 3V8LA 4P5NA 7AT1B 3LYIA 3META 5LJ3f 2HSEB 3S3OA 2H3JA 3M53A 3PGGA 1VQ9Q 1N8RU 1Q86U 1K0XA 2CSQA 1RLPC 1ZHIA 2JVVA 2BUDA 2KT8A 2M1HA 4OB3B 2ZPGB 1PWTA 4NL3A 3A8MB 1E7OA 4M7DE 1RUWA 4QKUA 4D6WA 1EZZB 4M75E 4BDZA 1WHJA 2CYZB 2WSFE 5FU7B 2JS2A 3H9NA 2EIFA 4B9WA 1TUCA 2DX1A 3LH5A 1RAIB 3EGDB 1ZSZB 5IXBA 1ZUYA 2HL5C 2I2LA 1UGSB 1SKUB 1M9SA 4V2SA 5IHIA 2RI5A 1K4US 4E7JA 3M56A 4A63B 5GAOq 1BK2A 1NBEB 2K5IA 4EMKC 4A4FA 1PC0A 4M75B 3JCMQ 1GCQA 3MJXA 2CREA 2ZPHB 1VQPQ 3CCET 4M7DC 1VQ6A 1R77A 1UHFA 2CP0A 1FYNA 3G1JA 3CCSA 4WF2A 3NGPA 1K73U 4Z8AA 4ZGJB 4KULA 2X9HA 3G6ET 2RJDA 4MZPA 1G2BA 2LJ1A 2DL7A 2DNUA 2KRMA 1IHVA 4ANJA 1AT1B 5GMKi 1M2VA 1Q86R 2X3WD 1H8KA 1IGQA 5KYWA 2L3PA 3X26B 4E7KA 1VQ8A 2F2XA 4KGZB 3QYGB 4B6MA 4PJOE 5KE3A 1EX4A 2EGEA 3MO8A 1TOVA 2LC4A 3A8GB 4IUQA 2NLUA 3I5SA 2JTFA 4M7AA 2J06A 1AOJA 1NPRA 3QXEB 3G7ZA 4OF1A 2YHTA 1ZBXA 1WDXA 2DL8A 5GANh 2KQWA 2O9VA 4XTZA 2O9SA 3MP1A 4JJBA 2DLPA 2PVOB 3G4SQ 1WXBA 3THKA 3PTAA 1VQNQ 3PT9A 5IH2A 5D6YA 3CC2Q 2MI6A 1MHNA 2LJ0A 2DFUA 2MF2A 2MPXC 2LCSA 3H0FA 1B07A 3RMSA 2LTOA 4C5HA 1Y57A 1KQ2A 1XJWB 3OYDA 1SRMA 4ZGEB 1NEBA 2QK0A 4C0FA 3RKYA 1JJ2S 4DQ2A 4JS5A 3MEVA 2JOYA 2R5MA 4J9BA 1K73R 1BCOA 4MMKA 2LQNA 4Q5WA 2X4WA 1VQ5T 1VQOQ 1FXXA 1UDLA 2OTJA 1Y71A 4F7UG 5KYYA 2YWWA 1KQSS 2KEAA 2OAUA 5HKCA 2LX9A 4FYWB 3LWIA 4J7IA 4CC4B 3GPLA 1YBYA 3ULRB 1KC8R 5CQYA 3BY7A 2DJZA 1OV3A 1VQ8T 2DTHA 3J81E 3M0UA 2O4XA 4LDXA 2JMCA 1Q81R 4XTUA 1VQOA 4E7SA 3OYGA 3M57A 2DILA 2RA2A 2V8JA 2E10A 1VQMA 3MEWA 1ZBJA 4J5YA 3T9NA 4BB7A 1YIJQ 2AHJB 2GCXA 4JS4A 2DEQA 2SRCA 3GOXA 4QVDA 1QVGA 4M7AC 1QCOA 1BBZA 2F2WA 5GAN8 4JRKA 3PE0A 1U1SA 1N8RR 3Q1JA 2LQKA 3H6ZA 4JRPA 1WQWA 2LMJA 2KYMA 4M78E 1YIJT 5GAOn 4FL6A 4DBFA 5LJ5g 3CXCA 4C92E 2JS0A 3ZEHA 3J7AF 1VQLA 1WZOA 3JSCA 1BI0A 1PHTA 1SSHA 4E7ZA 4J7FA 1OU8A 2V8KA 3H0HA 4JRQA 2EPDA 3JCMh 1S72A 4QQ6A 1M2OA 5J26A 3JCMf 2CZ7B 3UDCA 3CCJQ 1VQ8Q 1LPLA 1AWWA 1AWJA 3FIFA 3P8BB 2DVJA 5GANf 1QKWA 1J3TA 2J7IA 2KRSA 4L6V5 4DOWA 2RD1A 2JNGA 4PFPA 4F04B 1QP3A 5J39A 3G71T 4M7AD 4KGVB 2XICA 2VASA 3A1PA 5CAIA 3FDRA 3OS2A 3URGA 5KYXB 3HRTA 4M7AF 5GAN6 3CCSQ 2BIVA 4LDYA 5HY6A 3U23A 2JXBA 5LJ5j 3J80E 1IB8A 2XDDA 5CCAA 5ECAA 4J6WA 4QW2A 3QZ9B 1Y07A 5KYYB 2D9TA 1YHQA 5IHKA 2K2MA 5LJ5h 2G6FX 4DBQA 1ZA1B 5FLXE 3GIBA 1N6AA 2D0NA 4M75C 3CCUT 2LNHB 2DKGA 3OYYA 3QWYA 4X9DA 1ARKA 1ZA2B 5GAMe 3EG9B 4KGXB 4KH1B 3I56T 2MCNA 3UA7A 5A2QE 3OS5A 1X01A 1RAHB 4OMQA 1OZ3A 4HVVA 1QW1A 2ED0A 4J9EA 2QEXQ 1M90U 1GXIE 4ELYC 4L59A 2K79A 1GL5A 2KI7A 1NPPA 3HPWA 3PIPA 2QQBA 4ZTFA 2HZYA 1I0CA 1CKAA 3EG3A 1UGQB 1Y7XA 2CP5A 2O01E 2PVGB 4J8OA 1XTDA 2V1RA 4N4IA 4HVWA 3SWNA 1MNEA 2KMTA 2M51A 4FT2A 2COWA 5FROA 2EGCA 2H3EB 1M3BA 1Q95G 1RL2A 3X20B 2EW3A 3MEAA 2OAWA 1D1CA 4Y91A 2P0PA 4C8QD 4CC7A 4M78A 4OP0A 4PFZA 2NUPB 4DBRA 4JRIA 3RR6A 2AT1B 5CKHA 3CCQQ 4LN2A 3H41A 3TVTA 4BY6B 2FHDA 1D1AA 1JO8A 2FRYA 2EQKA 2RI3A 4ZNXA 4E47A 2HQEA 1O9SA 2WACA 2HBWA 1Q7YU 1H92A 3I35A 3OYBA 2VXFA 3LH0A 5CKBA 4Y92A 2V1QA 2Y4YA 3GBQA 3OB9A 5I21A 3JAME 4R56A 1HD3A 3EH2A 4A4HA 1NJIU 4PJNA 2FZKB 3CCVT 3CC7T 4E7IA 1GCQC 3HTRA 2X51A 3CCJA 4NL2A 1VQ4T 1GFDA 3L42A 4RTUA 1HK9A 2Z0WA 2E4HA 3EGDA 2JT4A 1Y96B 2D1XA 3INZA 2BZXA 2ZAEA 2D8HA 1GCPA 1I5LA 3CD6A 1X6OA 1M8VA 9ATCB 1VQLQ 2EYYA 2E41A 1D3BB 3CC2T 1VYTA 1YJ9Q 5I11A 1YJWA 2EVRA 1OU9A 1CSKA 2P4TA 2RK2A 2Y90A 2W0ZA 3OYHA 2L2PA 2DZ9A 2EJ9A 3OYIA 4HA8A 5GAN7 4IIOA 3H8ZA 1M1FA 2RNAA 2W10A 2V8IA 2L3SA 2KT1A 5GANe 5GAOl 1QVFP 1N9SA 3C12A 1KG1A 1UTIA 2XHCA 3EG2A 2PVDB 4FT4A 1YCSB 1YIJA 1PCXA 4WCIA 2QTVA 2DZCA 3DKMA 1NE8A 3RESA 1VQMQ 2BKDN 2E65A 3EG9A 2A0FB 4JZ3A 4HCBA 1WX6A 4M75F 2NUTA 2VKNA 1WJQA 4F14A 2RQRA 2SEMA 1TS9A 2KXCA 3JB9H 4OB2B 1OQKA 3G6EQ 4HCKA 5HK0A 1JXMA 3VU3C 2FB7A 3QUIA 3HRSA 1RAEB 1X75C 2CDTA 1AVZC 1U3OA 3SB2A 2GNCA 4C8QE 3SDZA 3OYNA 4EMHA 1YWOA 3G6EA 2RJCA 5KYUA 5CO7A 1YITT 1UHCA 4E6RA 4C0DB 1WGSA 3OW2S 3F70A 4FW2A 2E1HA 5LJ3e 2K3XA 5C0MA 2QTXA 5LJ5d 2A36A 6AT1B 4C0DC 4C92D 2MMPA 4IUPA 4C92B 1EFNA 5M9OA 5EG2A 1NZ9A 1RAAB 2KROA 5GAOp 2YRCA 1BB9A 2FPFA 3E1SA 2FO0A 5I22A 2QASA 3EFOB 1X6GA 1YN8A 1R0BG 1X6BA 4PJOD 1VQNT 1KD1C 2WSCE 2QI2A 4PJOF 2AZVA 2LJ3A 4J9GA 3QZ5B 4F7UE 2RHXA 1YJWT 1SG5A 3PFSA 1YJ9A 2K5FA 2KK4A 5KYNA 3JB9F 2FVUA 2YUNA 3BFMA 4GY5A 3M0RA 8AT1B 3L2ZA 2PZ1A 3EGXB 3RIRA 1QP2A 3CD6Q 1SRLA 4JPBW 1XNIA 2ROTA 4VUBA 3M0PA 4PK4A 5A0GA 4RTXA 4ZN1A 2OTJT 4AG1C 1I4K1 2KBTA 2EJFA 4XTVA 1C6VX 5GANj 2EJGA 1YCYA 1MGQA 2K5LA 4NOYA 1K8AR 2DYIA 1HJDA 2RK1A 3SFMA 2JTMA 1H641 3FLGA 2YDLA 1D0ZA 3JCMJ 3FJ5A 2DXUA 5L23A 2K3YA 3BDLA 4RG2A 5DM7R 3WVDB 2D8JA 2QQAA 5FRNA 4M7DG 2DD5A 1K76A 3VS1A 2PTKA 1DJ7B 2L89A 2YT6A 3A8OB 4OGEA 1AZEA 2K6DA 4O5VA 5LJ3g 4BACA 2RN8A 2E6ZA 2MWOA 3X24B 3GNFB 1JJ2A 4QQGA 4C5EA 4LUEA 1Q81U 5L8RE 5AYFA 4N4GA 2ENMA 1I07A 3VS0A 3CC4A 5DLOA 3VS2A 2LP5A 2A08A 5A0LA 2J05A 3GF5A 3P8HA 1PRMC 1AWOA 3ASKA 2XKOC 1G5VA 3V7RA 2E5QA 2DIGA 2QQ9A 3JCMV 2MIOA 4QVZA 5IAYA 3EG1A 2MWPA 5GAMh 4BDYA 1W2BP 5HK3A 4A4GA 1XQHA 2VV5A 4IKFA 1Q7YC 4E2FB 3GP8A 1H3HA 1VQ9A 3QDFA 3MKDA 4BI4A 5KH6A 4PJJA 2LDMA 4GBQA 3OYAA 1WJRA 2JZ2A 3H0IA 4C0ZA 4M7DB 2CP7A 2NWMA 1WIEA 4C92A 2HMAA 4OB0B 1UUEA 2ZPBB 2AIRB 1G3WA 2EYQA 2G3RA 2X3XD 3LX7A 5CK9A 1YITQ 1QVGP 3VS7A 1M2VB 1YHQQ 3L2RA 3QJ6A 1ACMB 3I55A 3CMAT 2ZPEB 3MP8A 3M9QA 4FSSA 1NG2A 3CCEQ 5LJ3h 1K9MU 4PJLA 4R55A 4LD9K 5I2SA 4J9IA 1KD1R 1CKBA 1C1AA 5LJ5f 3NMZC 4M75A 4OGCA 4AG2C 2PUKB 3C4SA 3SEMA 3HSBA 1OX8A 4QQDA 2CSIA 4Z89A 1BKBA 3S3NA 1Q82C 4JUVA 4F17A 4DEXA 1PSEA 3C94A 1AEYA 1D09B 3EGXA 4HXJA 1FMKA 2OJ2A 1AZGB 4A54A 3BE3A 3LWHA 1VQ7T 2C0IA 1S72Q 4C8QG 2YSQA 4XTWA 2LQ8A 3EG0A 4DBHA 5CIUA 4OMLA 3X25B 2MOXA 1NYFA 3CCRA 1G8XA 5CVIA 4RCBA 3CCRQ 2CKKA 2QDYB 3MPUB 4C92C 3CD6T 3EFOA 1TSFA 2GTOA 4J6XA 5CQXA 2EBPA 3V8JA 2F5TX 1HXDA 4Z88A 4CRIA 3VUZA 3JV3A 3P8DA 2RJFA 1R8OB 3QBYA 1VQKA 4CI0C 3EHQA 3ME9A 3CC7Q 1GRIA 3JB9J 2L5QA 2RQVA 4AFSC 5KYWB 3V7SA 1WHGA 2DERA 3DLLA 2VB6A 4FM4B 3CCQT 3PVQA 1VIEA 2RQUA 5A0DA 2YLCA 3QDRB 5EC7A 3I55Q 1YI2A 1BI3A 2DBKA 1M27C 2VXEA 3CCMQ 2L0AA 3OSSC 1BI2A 4D8KA 1YITA 2DMOA 2CP3A 1PD0A 3VS4A 5KCHA 3SWNC 4PL6A 1M5Q1 1YJNA 1QWFA 5HCKA 4HCZA 4MZTA 2HEQA 2DJQA 4E7LA 1WXTA 2PUOB 2YLBA 3OW2P 2OTLA 1AHJB 2YUQA 4UC4A 1TUDA 4AFZC 1OX9A 2CS7A 1Q7YR 2A37A 1LNXA 1LVKA 3X28B 1KHCA 3NTHA 1OYXA 4BI8B 4OMMA 2COYA 3BW1A 2B86A 3CC2A 3QIIA 4XU3A 5GAN5 3MHXA 5D6WA 2QEXA 3M4GA 3OYEA 1I8FA 2EKHA 1WPYA 2QEXT 2BE9B 1SHFA 2PNIA 2F2VA 3LLRA 1OOTA 3OBYA 2F1LA 3TEEA 1D3BA 2R58A 1QLYA 3FRNA 2CT4A 4FU6A 3E2UA 1M3AA 1W6XA 4PKCC 2R57A 3CC4Q 2RQWA 1Y96A 3UF4A 4K11A 4LE9A 8ATCB 5D7UA 1YJ9T 2RO0A 1V29B 2P84A 4B9XA 4BI3A 4KUIA 3REBB 3L1AA 1K9MC 4HKEA 2BZYA 2KR3A 1M90C 1B7TA 3KBGA 4DEYA 2DL4A 1T3LA 1E6GA 5FU6B 2J6OA 4AT1B 4LD6A 2GFAA 2FPDA 2K7AA 1T0HA 1VQ6T 1K9MR 1N8RC 3ZL7C 2XI9A 1VQPA 3CCST 4XU0A 4EIKA 4KRTA 2NUPA 4XTXA 1YNZA 2HKNA 3JCMb 3I56A 4J9HA 1RABB 1QMCA 1OULA 2DTOA 1D0XA 4IURA 3VRYA 2B8AA 1KK7A 2YXYA 2QA4A 4C0GA 2YRVA 2HQHA 4QT7A 2A3LA 2M0OA 3FJPA 2ABLA 4RTVA 4N4HA 1LOJA 4AMCA 2K2VA 3SWNB 1PD1A 3A8LB 2D0QB 1AWXA 4JJCA 2HD0A 1ZX6A 2IIMA 2P0KA 2AKKA 3VKIA 1VOMA 3OY9A 3NPFA 1BCMA 1S1NA 1D0YA 2KVQG 4J83A 3M55A 1BYMA 4M7AE 1MNDA 3QO3A 4FSXA 5J3BA 2GF7A 4WTOB 1RLQC 2RHIA 2GFUA 1UGPB 4RTWA 1IREB 1X2QA 4J6YA 2EGAA 2E5KA 4M7DD 1WHLA 2YRDA 1YP5A 3M59A 4C5GA 2ZGWA 1JJ2P 3PNWC 1Q82U 5GMKm 1PG5B 2OI3A 3M0QA 3CMAQ 2J6KA 1QQJA 1RAGB 4MDXA 1YJNQ 2L3RA 2A7YA 2L8DA 3C95A 2MYSA 4PLLA 1KSWA 2LZ6B 4AFUC 4ZGDB 2C0OA 4PFOA 3NHNA 3KUFA 1X2KA 3VYHB 2HL3A 2JUFA 1GBQA 2HKQB 2M9UA 4JJDA 4C8QB 2QAZA 4RTYA 1IZ6A 3CCVQ 1YI2Q 2XDPA 2F69A 1ZLMA 1O75A 5LJ3j 5KYXA 3M58A 3VJPA 2QYZA 1QCFA 5KE2A 4TVRA 3JB9D 1XOVA 2KGTA 4JDSA 4KUDK 2MK5A 4BE1A 3I55T
chains in the Genus database with same CATH topology
3CBMA 3M57A 4O5VA 1I81A 5LJ3g 2RA2A 2LT1A 4BACA 2C06A 2V8JA 2E6ZA 1QVPA 2E64A 4ME7A 4PLIA 3OYKA 1K8AU 2E10A 2MWOA 3X24B 2QA4T 1VQMA 3MEWA 3VUBA 3GNFB 4DA4A 4J5YA 4QQGA 4C5EA 3OW2A 3HFNA 4RCCA 3T9NA 4BB7A 3CCLA 2AHJB 1Q81U 5L8RE 2EFIA 3E9GA 2GCXA 5AYFA 2DEQA 4N4GA 4IUUA 1G3TA 5GAMg 3GOXA 4JS4A 1QVGS 3CC4A 5FU6C 4QVDA 1QVGA 4M7DA 4M7AC 5DLOA 3FB9A 4YTLA 5A0LA 3CC4T 5GAN8 3GF5A 4EPCA 3P8HA 3FC3A 4JRKA 3ASKA 2XKOC 4JJNK 1G5VA 3V7RA 2E5QA 2DIGA 2QQ9A 2KDSA 1U1SA 1B34A 5FU7C 3JCMV 3Q1JA 4QVZA 5IAYA 3PMIA 4KT0E 4F7UB 2LQKA 2MWPA 3H6ZA 3OMCA 5GAMh 4JRPA 4BDYA 5HK3A 4A4GA 1WQWA 4M78E 1XQHA 1VQ4A 1YIJT 5GAOn 4FL6A 1H3ZA 3M4YA 2VV5A 5LJ5g 3RERA 1JBMA 3CXCA 3JB9G 4O6JA 5GAOm 2JN0A 1VQ9T 2VGMA 1B34B 4C92E 1Q7YC 4IKFA 4BD3A 2K57A 3GP8A 1VQ9A 3ZEHA 2XU8A 3J7AF 1VQLA 2DK3A 2XK0A 3JSCA 2DXTA 1BI0A 3UWNA 5GAN3 2P0QA 3VV0A 3HHTB 4BI4A 1QVFA 5KH6A 4J7FA 2V8KA 4IUVA 4HT9A 2LDMA 4JRQA 3OYAA 3JCMh 1S72A 2ZZDA 1WJRA 2JZ2A 4QQ6A 3OYLA 3OYHA 5J26A 4C0ZA 2DAQA 4LDWA 3M5AA 3OBWA 3JCMf 2WSEE 4M7DB 1N27A 2CZ7B 3CPFA 3UDCA 1VQKT 4M75D 3FIFA 3P8BB 3E9FA 4C92A 3LGFA 5GANf 1VUBA 4E7HA 5CR2A 4OB0B 4MMLA 4L6V5 4DOWA 2ZPBB 2HBPA 1G3WA 5GAMj 2RD1A 2VYTA 2JNGA 2EYQA 1QP3A 2G3RA 3QKJA 4L5GA 5J39A 3G71T 4M7AD 3LX7A 3G71A 5CK9A 1VQPT 2XICA 5CAIA 3FDRA 3JCMg 3OS2A 2MAMA 4X9CA 3URGA 2XD0A 5GMKj 1U1TA 3HRTA 4EMGA 1WQ7A 2IVWA 5GAN6 3QJ6A 3OYJA 3L2RA 3DB3A 1VQOT 4M7AF 5GAN4 3I55A 3CMAT 1WNLA 2BIVA 2ZPEB 3MP8A 4LDYA 5HY6A 3DB4A 3MP6A 3M9QA 2O4XB 2VUBA 5LJ5j 3EFRA 3J80E 2DVEA 3RKWA 3WXMB 5LJ3h 3JCMd 4IUTA 3QG1A 5CCAA 2XDDA 1K9MU 4R55A 1BIBA 2X4YA 5I2SA 4LD9K 4J6WA 3L2QA 2X4JA 4XQ3A 3MEUA 4M78G 4QW2A 3QZ9B 2EWNA 1Y07A 5LJ5f 1YHQT 2D9TA 4LDUA 1WJSA 4M75A 4OGCA 1YHQA 2GQVA 2DXCA 3CEYA 4NS5A 2RI2A 2PUKB 5LJ5h 3C4SA 3HSBA 2PU9B 3OMGA 5FLXE 4JLIA 3GIBA 1KHIA 1N6AA 4QQDA 4M75C 3CCUT 3CBPA 3M54A 1BKBA 3S3NA 3EAEA 1Q82C 4JUVA 2DKGA 1UEBA 3OYYA 4X9DA 3WVEB 4XTYA 2OTLT 1EIFA 4A53A 5GAMe 1PSEA 3GLXA 3ER0A 3C94A 3LW5E 1BI1A 5CKEA 2E6NA 1JB0E 1FX7A 1OZ2A 3L2UA 4PJOC 3CCLT 3I56T 2DXBA 2EQMA 5GANd 3ZFJA 5GAOr 3BDUA 1P92A 4A54A 5A2QE 3OS5A 3LWHA 1VQ7T 3JCMW 2E12A 1X01A 3DLMA 4PJOB 1OZ3A 3QHSA 1QW1A 4XTWA 4C8QG 4ELZC 4EMKB 1M1KU 2LQ8A 3OQ5A 5CIUA 1YJNT 1M90U 1GXIE 3NFCA 4ELYC 4L59A 4RMOA 3GNGA 4ZN3A 3A8HB 3CCJT 1JJ2A 3HPWA 1NPPA 3X25B 1W2BS 1KQSA 3PIPA 3JCMP 1W2BA 3SD4A 2QQBA 3JB9I 3OYCA 3CCRA 4GLKA 4QVCA 4ZTFA 3O8VA 2FL7A 3L2VA 4M77F 5CVIA 3HL8A 1M8VA 4XAXB 4A4EA 4RCBA 4RKUE 3CCRT 2X4XA 4OVAA 4A4KA 2CKKA 2QDYB 3RUXA 1OI1A 4C92C 1UGQB 1Y7XA 2O01E 2PVGB 3CD6T 4J8OA 2DTIA 4J6XA 1UB4A 1XTDA 4RG8A 4N4IA 2CGHA 5CQXA 3SWNA 3V8JA 1PSFA 2F5TX 1HXDA 4CRIA 2DPPB 3VUZA 2KMTA 3P8DA 1S72T 1K8AC 2XDBA 2LRQA 2RJFA 1R8OB 3HKSA 3QBYA 5IT9E 3KXTA 4FT2A 5DY9A 4C8QF 1LJOA 2PQWA 5FROA 5CKDA 2RB6A 4MZMA 3PIOA 1VQKA 1FWZA 4CI0C 1RL2A 3N5BB 1W4SA 3ME9A 3X20B 4M7DF 3MEAA 2QQRA 2RHZA 3HP9A 2P0PA 4OB1B 4Y91A 4C8QD 3JB9J 4M78A 5DLQE 1TH7A 3OYMA 2L5QA 3ZBDA 3OS1A 2XG8D 4OP0A 3CCMA 3V7SA 4M75G 2FYKA 4JRIA 3CCMT 3DLLA 5GAMf 3EFSA 1QVFS 5CKHA 4ATOA 4FM4B 5I2MA 4BY6B 3CCQT 3CXCS 2FHDA 2EQUA 2RHYA 2EQKA 1VIEA 2RI3A 2RJEA 5A0DA 4E47A 2YLCA 2EQJA 4C5IA 4M7AG 2HQEA 3QDRB 3CCUA 4M77B 3JCMX 1O9SA 2WACA 1Q7YU 2DO3A 1YI2A 1BI3A 1M1KC 3OYBA 2VXFA 3LH0A 5CKBA 3CPWS 3HRUA 2RH2A 2D6FA 2VXEA 5CKFA 2Y4YA 3OB9A 4DOVA 5FRMA 1G3YA 3V7CA 2X35A 1BI2A 3OSSC 5I21A 3JAME 4A4HA 4R56A 1YITA 1NJIU 4C92G 1ZQ1A 4M78F 4EDUA 4XU2A 1KD1U 5GANg 3CCVT 4BE2A 1U8RA 1VQ7A 4F7UF 2KY9A 4XU1A 3CC7A 4BUGA 5D6XA 5KCHA 5GMKe 3SWNC 3QSUA 3CC7T 4PL6A 1M5Q1 4E7IA 4M78D 1YJNA 3L2WA 4HCZA 4MZTA 3CCJA 4NL2A 4E7LA 2XIDA 2QQSA 1VQ4T 3QYHB 2PUOB 3L42A 4MDWA 5KCOA 2RHUA 1HK9A 2YLBA 3V8LA 2OTLA 1AHJB 4C8QC 4P5NA 1Y96B 4UC4A 3INZA 3QJYA 3LYIA 3META 5LJ3f 1M4ZA 2CS7A 5GMKh 3S3OA 3OSVA 1X6OA 1I5LA 1SSFA 2H3JA 3CD6A 3LGLA 3M53A 1LNXA 3PGGA 3X28B 1KHCA 2E41A 3NTHA 1OYXA 4BI8B 1N8RU 3V8KA 1D3BB 1Q81C 1Q86U 3MCAB 3OA6A 3BW1A 4N0AC 3CC2T 2F5KA 1ZHIA 3CC2A 3RKXA 1YJWA 4M77C 2RK2A 3QIIA 2JVVA 2P4TA 2Y90A 4II1A 2ZCFB 3MHXA 4XU3A 2RM4A 5D6WA 5GAN5 2BUDA 2M1HA 4OB3B 2QEXA 2ZPGB 2DZ9A 2EJ9A 1I8FA 3M4GA 3OYEA 4HA8A 5GAN7 4NL3A 2ZPFB 3H8ZA 3PMTA 1M1FA 3A8MB 1WPYA 1BIAA 2CZ0B 4KBMB 2QEXT 3S3MA 4OMFB 4M7DE 2V8IA 4M77G 4D6WA 4M75E 4BDZA 2LVMA 3LLRA 4M7AB 5GANe 5GAOl 2CYZB 3OBYA 2EAYA 2WSFE 1D3BA 4M78C 3TEEA 1N9SA 2R58A 3C12A 5FU7B 5GAN2 1KG1A 3FRNA 3S6WA 4PJOA 2XHCA 3G4ST 4FU6A 2EIFA 4B9WA 3JRZA 2PVDB 4FT4A 1YIJA 4PKCC 2DZCA 3DKMA 2R57A 1NE8A 3RESA 1Y96A 2BKDN 2ZPIB 3NTIA 2E65A 1YJ9T 1VQ5A 4HCBA 2CZ1B 1UGSB 2I2LA 3UT1A 2RO0A 4M75F 3UPUA 1JRIA 1M9SA 1V29B 4V2SA 2RI5A 4FIBA 4B9XA 1WJQA 2LNVA 4KUIA 4BI3A 3L1AA 1K9MC 1UGRB 1G3SA 3M56A 4HKEA 4E7JA 5GAOq 2E70A 2K5IA 4EMKC 4A4FA 3JB9H 2KAFA 4OB2B 1M90C 3CBOA 3KBGA 4M75B 4Z02A 3CCVA 5LJ3d 2HQXA 1KC8C 5LL6S 5HK0A 4M77E 3JCMQ 3CCEA 1KQ1A 5FU6B 5LJ5e 3A5ZB 3VU3C 2FB7A 2ZPHB 4M77D 3CCET 4M7DC 1VQ6A 3HRSA 3QUIA 2GFAA 4LD6A 5C6SA 1X75C 2LT4A 1VQ6T 3CCSA 1N8RC 4WF2A 1K73U 3SB2A 2XI9A 1YI2T 1VQPA 4C8QE 4ZGJB 4XU0A 3CCST 4KULA 3SDZA 3G6ET 2RJDA 4XTXA 3FEOA 4MZPA 4X34A 3OYNA 4EMHA 2DIQA 3JCMb 3G6EA 3I56A 3JCMc 2RJCA 2VC8A 5CO7A 1YITT 2DTOA 2CZ6B 5GMKi 3JCMe 4C0DB 1WGSA 4IURA 3OW2S 4PNOA 2IG0A 2B8AA 3F70A 4C92F 2QA4A 4C0GA 2HAXA 2E1HA 5LJ3e 2YRVA 3X26B 2K3XA 5C0MA 4E7KA 4M78B 3TCJA 2QTXA 1VQ8A 5LJ5d 2A3LA 2M0OA 3FJPA 3QYGB 4PJOE 5KE3A 4C0DC 4N4HA 1LOJA 3MO8A 4C92D 3TU4K 2MMPA 4IUPA 3OYFA 4C92B 4LDVA 4BE0A 2K2VA 2LC4A 5M9OA 1K73C 5EG2A 3QPHA 1NZ9A 3SWNB 3A8GB 4IUQA 2LCLA 2NLUA 2Y4XA 3A8LB 3RMQA 2JTFA 3TREA 2D0QB 4BY6C 5GAOp 3E1SA 4M7AA 2QXFA 1NPRA 2HD0A 3QXEB 4PJOD 3G7ZA 4OF1A 2YHTA 1VQNT 1KD1C 1ZBXA 2P0KA 3VKIA 2K4YA 2WSCE 1VQNA 5GANh 2QI2A 3G4SA 5GAMd 1VQMT 2KQWA 3OY9A 4PJOF 4XTZA 1RI0A 2HNIA 2M16A 3AHUA 3QZ5B 3MP1A 4F7UE 2PVOB 5IN1A 3CMEA 2RHXA 3PTAA 1YJWT 3PFSA 2KVQG 3CMET 3CPWA 3PT9A 4J83A 5D6YA 3M55A 2MI6A 1YJ9A 4M7AE 1BYMA 1MHNA 2K5FA 2KK4A 3JB9F 3QO3A 2FVUA 2VGNA 4FSXA 5J3BA 2GF7A 2MF2A 4F7UA 4ZTJA 3BFMA 2RHIA 4GY5A 1N9RA 2GFUA 3L2ZA 1UGPB 3RMSA 2LTOA 4C5HA 4EMKA 3RIRA 1IREB 4J6YA 1QP2A 1KQ2A 3E19A 3VYGA 3NTKA 5GMKl 3OYDA 2DD4A 4M7DD 4ZGEB 3M59A 4C5GA 2ZGWA 1XNIA 4Y28E 4C0FA 3RKYA 1JJ2S 4HT8A 4DQ2A 4VUBA 4JS5A 3PNWC 3MEVA 5A0GA 2JOYA 1Q82U 2R5MA 4PJOG 5GMKm 1VQLT 4MMKA 4ZN1A 1KC8U 2OTJT 4Q5WA 2X4WA 1I4K1 1VQ5T 2EJFA 4MDXA 4XTVA 1FXXA 5GANj 3OS0A 2EJGA 1YCYA 2OTJA 2L3RA 1MGQA 1Y71A 2A7YA 2K5LA 2L8DA 2LCCA 3C95A 4NOYA 4XK8E 4F7UG 3OYIA 4PLLA 2RK1A 3SFMA 1KQSS 5HKCA 2OAUA 2JTMA 2LX9A 4ZGDB 3LWIA 2EKOA 1H641 4HCCA 1VIFA 3FLGA 1Q86C 3KUFA 3VYHB 4J7IA 2R5AA 2JUFA 3JCMJ 3GPLA 4M77A 1YBYA 2DXUA 2M9UA 3R6OA 2K3YA 1NJIC 5CQYA 3BY7A 4C8QB 2DJZA 1VQ8T 1IZ6A 3BDLA 2DTHA 4RG2A 2XDPA 4C8QA 2F69A 5LJ3j 1O75A 5DM7R 3J81E 1M1GA 3WVDB 2QQAA 5FRNA 3M58A 2O4XA 4LDXA 3VJPA 4M7DG 2DD5A 4N0AA 5KE2A 3CMAA 4TVRA 3JB9D 1DJ7B 1XOVA 4JDSA 2L89A 4KUDK 4XTUA 4BE1A 3A8OB 1VQOA 4JLGA 4OGEA 2KSSA 3CCQA 3HFOA 3OYGA 3I55T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4S A;  1WGS A;  4IUR A;  5D6X A;  5KCH A;  2IG0 A;  2B8A A;  3F70 A;  3OMG A;  4PL6 A;  4BAC A;  4QQD A;  4E7I A;  4PLI A;  3OYK A;  2YRV A;  4E7K A;  2K3X A;  2MWO A;  5C0M A;  3L2W A;  4HCZ A;  3S3N A;  3EAE A;  3MEW A;  4E7L A;  2M0O A;  2QQS A;  4QQG A;  4C5E A;  3L42 A;  5KE3 A;  5KCO A;  4N4H A;  2RHU A;  3MO8 A;  2E6N A;  4IUP A;  1OZ2 A;  2EFI A;  3E9G A;  3OYF A;  3L2U A;  4BE0 A;  4N4G A;  4IUU A;  5M9O A;  3GOX A;  4UC4 A;  4IUQ A;  2NLU A;  2JTF A;  2EQM A;  3LYI A;  3MET A;  3S3O A;  1SSF A;  3P8H A;  3FC3 A;  3LGL A;  3DLM A;  3ASK A;  1G5V A;  2P0K A;  1KHC A;  1OZ3 A;  3NTH A;  1OYX A;  2E5Q A;  2DIG A;  3OQ5 A;  3Q1J A;  5CIU A;  4QVZ A;  5IAY A;  3PMI A;  4L59 A;  3OA6 A;  3OMC A;  2MWP A;  3H6Z A;  3OY9 A;  4BDY A;  1RI0 A;  2F5K A;  4A4G A;  2M16 A;  4FL6 A;  1H3Z A;  3SD4 A;  3MP1 A;  3QII A;  4II1 A;  5IN1 A;  3OYC A;  3OYH A;  3O8V A;  3L2V A;  2RHX A;  5D6W A;  2BUD A;  2M1H A;  4A4E A;  3PFS A;  3OYE A;  3OYI A;  2X4X A;  4IKF A;  4OVA A;  4BD3 A;  5D6Y A;  3H8Z A;  3PMT A;  2CKK A;  3S3M A;  3ZEH A;  1OI1 A;  1MHN A;  2XK0 A;  3UWN A;  2GF7 A;  4BDZ A;  2LVM A;  5KH6 A;  3LLR A;  4ZTJ A;  2RHI A;  4GY5 A;  4IUV A;  2GFU A;  2LDM A;  4N4I A;  2R58 A;  2LTO A;  4C5H A;  3OYA A;  3S6W A;  2JZ2 A;  1WJR A;  4QQ6 A;  4FU6 A;  4CRI A;  4B9W A;  3OYL A;  3NTK A;  3P8D A;  5J26 A;  2DAQ A;  3OYD A;  2LRQ A;  2RJF A;  3QBY A;  1N27 A;  4C5G A;  1XNI A;  2R57 A;  2PQW A;  5FRO A;  2BKD N;  3E9F A;  3PNW C;  3MEV A;  3LGF A;  3NTI A;  4E7H A;  3ME9 A;  2R5M A;  3MEA A;  2QQR A;  2RHZ A;  3UT1 A;  2RO0 A;  2VYT A;  3QKJ A;  4Q5W A;  2G3R A;  2X4W A;  5J39 A;  3OYM A;  3LX7 A;  3OS0 A;  2RI5 A;  2L3R A;  2L8D A;  3OS1 A;  4B9X A;  1WJQ A;  2LCC A;  4PLL A;  3FDR A;  3OS2 A;  4E7J A;  2EKO A;  3OYJ A;  3L2R A;  3QJ6 A;  4A4F A;  3DB3 A;  3FLG A;  3KUF A;  2FHD A;  2EQU A;  2R5A A;  4Z02 A;  2HQX A;  2BIV A;  2RHY A;  2EQK A;  3MP8 A;  3DB4 A;  3MP6 A;  2RI3 A;  2RJE A;  3M9Q A;  2O4X B;  2EQJ A;  2K3Y A;  4C5I A;  2HQE A;  4LD6 A;  2GFA A;  5C6S A;  2WAC A;  4IUT A;  3BDL A;  4RG2 A;  2XDP A;  2X4Y A;  3OYB A;  3L2Q A;  3LH0 A;  3MEU A;  4QW2 A;  5FRN A;  2O4X A;  2RJD A;  3FEO A;  4X34 A;  3OYN A;  3OB9 A;  5FRM A;  2DIQ A;  5KE2 A;  2X35 A;  2D9T A;  4A4H A;  1WJS A;  2L89 A;  2RJC A;  4BE1 A;  4ZTF A;  4EDU A;  3OYG A;  4BE2 A;  3CEY A;  4NS5 A;  2RI2 A; 
#chains in the Genus database with same CATH topology
 1M90 R;  3CBM A;  1VQ5 Q;  2GTJ A;  4KH0 B;  2C06 A;  1K8A U;  4ME7 A;  4PLI A;  3OYK A;  4DA4 A;  3CQT A;  3OW2 A;  3HFN A;  2JTE A;  4RCC A;  3CCL A;  1UG1 A;  5IHN A;  3E9G A;  5GAM g;  1Q82 R;  2VWF A;  1G3T A;  1Z9Z A;  4IUU A;  2FG0 A;  4M7D A;  3FB9 A;  2K9G A;  3FC3 A;  1SPK A;  4JJN K;  1ABO A;  5GJV B;  2KE9 A;  4KT0 E;  4F7U B;  3OMC A;  1VQ4 A;  1H3Z A;  3M4Y A;  3RER A;  1JBM A;  4RTT A;  4O6J A;  1VQ9 T;  1WFW A;  1JQQ A;  2DK3 A;  1TU0 B;  2CUB A;  2DXT A;  5GAN 3;  1U5S A;  2P0Q A;  4IUV A;  4HT9 A;  4LNP A;  4FYV B;  3OYL A;  4J9C A;  2L3Q A;  4LDW A;  3OBW A;  3CPF A;  4M75 D;  3EGU A;  2JMA A;  2V26 A;  3LGF A;  1B3Q A;  1VUB A;  1NLO C;  5CR2 A;  2GGR A;  4E7H A;  3PVL A;  2KXD A;  1OPK A;  5IXF A;  1VQ7 Q;  3R6N A;  5GAM j;  2JM9 A;  1QVF S;  1WA7 A;  1UJY A;  3G71 A;  1VQP T;  3I56 Q;  3VS3 A;  2MAM A;  4X9C A;  2C0T A;  3VS5 A;  3DB3 A;  5KYU B;  1T0J A;  4J9F A;  2DRM A;  2O4X B;  1RI9 A;  2DVE A;  2EYX A;  3RKW A;  3WXM B;  3JCM d;  4IUT A;  3L2Q A;  3MEU A;  1UEC A;  2DXC A;  1SEM A;  3UAT A;  2PU9 B;  3OMG A;  3IQL A;  1KHI A;  3CBP A;  1X69 A;  3EAE A;  2EQI A;  1UEB A;  4RUG A;  4XTY A;  2OTL T;  1EIF A;  4A53 A;  3GLX A;  5CKE A;  1BI1 A;  1Y0M A;  1ZSG A;  2E6N A;  1JB0 E;  1FX7 A;  1OZ2 A;  1K0S A;  4PJO C;  2DXB A;  5GAO r;  3BDU A;  1P92 A;  2YUP A;  2E12 A;  3JCM W;  4PJO B;  4EMK B;  3VS6 A;  3GNG A;  3A8H B;  3CCJ T;  1W2B S;  1KQS A;  1W2B A;  3OYC A;  1V76 A;  4GLK A;  4QVC A;  3KFV A;  2FL7 A;  2FZG B;  4XAX B;  4A4E A;  3CCR T;  2X4X A;  2FRW A;  4RTZ A;  2ED1 A;  1N5Z A;  2DF6 A;  1UB4 A;  1WLP B;  4RG8 A;  2JM8 A;  2CGH A;  1PSF A;  2OTL Q;  1S72 T;  2XDB A;  2LRQ A;  3HKS A;  5IT9 E;  2CUD A;  3KXT A;  4C8Q F;  1LJO A;  5CKD A;  1ZSZ C;  3PIO A;  1FWZ A;  3N5B B;  1W4S A;  2QGF B;  4M7D F;  2QQR A;  2RHZ A;  3HP9 A;  1YFN A;  3OYM A;  3ZBD A;  1PKT A;  1VA7 A;  3CCM A;  3I9Q A;  2YUO A;  4M75 G;  5GAM f;  3EFS A;  4ATO A;  5I2M A;  1WHK A;  2RHY A;  2RQT A;  2IPO B;  1M3C A;  2EQJ A;  4C5I A;  1IXD A;  1VYV A;  3RBB B;  2P4R A;  3RDV A;  4R0K A;  3CPW S;  5FWB A;  3HRU A;  2D6F A;  5CKF A;  4DOV A;  2CH4 A;  1G3Y A;  3V7C A;  2X35 A;  4C92 G;  3AT1 B;  4BE2 A;  1U8R A;  1VQ7 A;  4F7U F;  2KY9 A;  4XU1 A;  3CC7 A;  4BUG A;  5D6X A;  5GMK e;  1MV3 A;  1LCK A;  1VQK Q;  2NUT B;  2XID A;  2QQS A;  3QYH B;  4MDW A;  2DET A;  2RHU A;  4C8Q C;  2M0Y A;  1F1B B;  1FMV A;  2GBQ A;  2JW4 A;  3QJY A;  1M4Z A;  5GMK h;  3OSV A;  1SSF A;  3LGL A;  1SF9 A;  3V8K A;  2ESW A;  1Q81 C;  2AK5 A;  2QDL A;  3MCA B;  3OA6 A;  4OMP A;  4N0A C;  2F5K A;  2COZ A;  2CH4 W;  1VQ4 Q;  3RKX A;  4M77 C;  4II1 A;  2K3B A;  4RMO A;  2RF0 A;  2ZCF B;  2RM4 A;  4LXC A;  2ZPF B;  3PMT A;  2CZ0 B;  3S3M A;  1BIA A;  4KBM B;  1G83 A;  4OMF B;  3EHR A;  4M77 G;  1KFZ A;  2XMF A;  2LVM A;  4M7A B;  2AKL A;  2M02 A;  2DEU A;  2AZS A;  2EAY A;  4M78 C;  5GAN 2;  3S6W A;  4PJO A;  3G4S T;  3JRZ A;  4HVU A;  2CT3 A;  3CCL Q;  2O88 A;  1JEG A;  3TSW A;  2CP2 A;  3M0S A;  2QGG A;  3A98 A;  2BTT A;  1KIK A;  2ZPI B;  3NTI A;  1VQ5 A;  2CZ1 B;  2ECZ A;  3UT1 A;  3UPU A;  1JRI A;  1VYU A;  1MV0 B;  2DE0 X;  4FIB A;  3C0C A;  2LNV A;  1I1J A;  1UGR B;  1G3S A;  2E70 A;  2KAF A;  3CBO A;  1UFF A;  4Z02 A;  3CCV A;  1RAD B;  2HQX A;  5LJ3 d;  5LL6 S;  1KC8 C;  1IGU A;  4M77 E;  3CCE A;  1KQS P;  4FCY A;  1KQ1 A;  2EYZ A;  3VRZ A;  5LJ5 e;  3A5Z B;  1WHH A;  4M77 D;  1PNJ A;  3EH1 A;  5C6S A;  1C0M A;  2LT4 A;  1ABQ A;  1YI2 T;  1PM3 A;  1WYX A;  3FEO A;  4X34 A;  2DIQ A;  4FW1 A;  3JCM c;  1R0C B;  2VC8 A;  2CZ6 B;  4PNO A;  2IG0 A;  5FWC A;  4C92 F;  1ZSZ A;  2HAX A;  4M78 B;  3TCJ A;  3TU4 K;  4F16 A;  3REA B;  3OYF A;  4BE0 A;  4LDV A;  1K73 C;  4FYX B;  3QPH A;  1WI7 A;  3RMQ A;  2LCL A;  2Y4X A;  3TRE A;  4BY6 C;  2QXF A;  2BE7 D;  2K4Y A;  1M8M A;  1VQN A;  3G4S A;  5GAM d;  1VQM T;  1HYO A;  2A28 A;  1RI0 A;  2HNI A;  2M16 A;  3AHU A;  1MMA A;  2J6F A;  2BZ8 A;  2NYS A;  5IN1 A;  3CME A;  3CPW A;  3CME T;  1YJW Q;  2VGN A;  1OEB A;  1IHW A;  2ATC B;  4GLM A;  4F7U A;  4AFQ C;  1UE9 A;  4ZTJ A;  1N9R A;  1TTH B;  4EMK A;  1V1C A;  3E19 A;  3VYG A;  3NTK A;  5GMK l;  2DD4 A;  4CC2 A;  1NLP C;  2JJ9 A;  1GBR A;  3TQ7 P;  4Y28 E;  4HT8 A;  2KYB A;  4PJM A;  2QA4 Q;  4PJO G;  1VQL T;  1KC8 U;  4CC3 A;  3OS0 A;  3JCM e;  4XK8 E;  1D1B A;  2LCC A;  2EKO A;  4HCC A;  1VIF A;  2DRK A;  1Q86 C;  1HSQ A;  2R5A A;  3D7S B;  1NYG A;  1SHG A;  1K1Z A;  4M77 A;  1NEG A;  3R6O A;  1NJI C;  4FYY B;  4ORZ A;  4C8Q A;  1VQ6 Q;  1M1G A;  2LQW A;  4N0A A;  3CMA A;  2DYB A;  4JLG A;  2KSS A;  1TXQ A;  3HFO A;  3CCQ A;  1IO6 A;  2KNB B;  1W70 A;  1TUG B;  2KRN A;  3M0T A;  1I81 A;  1JXO A;  1MMN A;  2LT1 A;  1QVP A;  2E64 A;  2NUZ A;  4M4Z A;  2QA4 T;  3VUB A;  4ESR A;  2DA9 A;  2EFI A;  2GQI A;  1QVG S;  5FU6 C;  1MUZ A;  2ROL A;  3CC4 T;  4YTL A;  4EPC A;  3UA6 A;  2HCK A;  3O5Z A;  5FU7 C;  1IRX A;  2KDS A;  1B34 A;  3PMI A;  3CME Q;  1WXU A;  5GJW B;  1X43 A;  1NJI R;  2FEI A;  3JB9 G;  3CPW P;  3TSZ A;  5GAO m;  2JN0 A;  1RAC B;  2VGM A;  1B34 B;  4BD3 A;  2K57 A;  1TG0 A;  2XU8 A;  4LUD A;  2XK0 A;  3UWN A;  3VV0 A;  1AD5 A;  3HHT B;  1QVF A;  2ZZD A;  1PRL C;  2DAQ A;  3M5A A;  2WSE E;  1N27 A;  1VQK T;  4X1V A;  1W1F A;  3E9F A;  4MML A;  2HBP A;  1PKS A;  4L5G A;  2VYT A;  3QKJ A;  1TWB A;  1T3S A;  1MMG A;  1M1K R;  2XD0 A;  3JCM g;  1FMW A;  5GMK j;  1U1T A;  2VVK A;  4EMG A;  1WQ7 A;  2IVW A;  3OYJ A;  1VQO T;  5GAN 4;  1QKX A;  1WNL A;  1GFC A;  3DB4 A;  3MP6 A;  3CCU Q;  1UGV A;  2VUB A;  3EFR A;  3QG1 A;  1M30 A;  1BIB A;  2X4Y A;  1WHM A;  2DBM A;  2X4J A;  4XQ3 A;  4M78 G;  1NM7 A;  2EWN A;  1YHQ T;  4LDU A;  1WJS A;  3I5R A;  2FPE A;  2GQV A;  1X27 A;  3CEY A;  4NS5 A;  2RI2 A;  2EYW A;  4JLI A;  2E3H A;  4OMN A;  3G71 Q;  3M54 A;  4IIM A;  3WVE B;  1Z9Q A;  1YWP A;  2I0N A;  3ER0 A;  3LW5 E;  1ZUK A;  2DL3 A;  1QCN A;  3L2U A;  2HSP A;  3CCL T;  1RAF B;  3SHW A;  1JU5 C;  2EQM A;  5GAN d;  3ZFJ A;  4D8D A;  1BU1 A;  3DLM A;  1QWE A;  3QHS A;  4ELZ C;  1M1K U;  2OX7 A;  3OQ5 A;  1YJN T;  3NFC A;  4ZN3 A;  2RMO A;  3JCM P;  3SD4 A;  3JB9 I;  3O8V A;  3L2V A;  4M77 F;  3HL8 A;  4RKU E;  2RPN A;  4OVA A;  4A4K A;  3RUX A;  1OI1 A;  1KJW A;  2DTI A;  2DPP B;  1K8A C;  1K9A A;  4OMO A;  1A0N B;  5DY9 A;  2PQW A;  2RB6 A;  2O31 A;  4MZM A;  1E6H A;  2HDA A;  1MMD A;  4OB1 B;  5DLQ E;  1TH7 A;  4J9D A;  1OPL A;  2XG8 D;  3OS1 A;  2DL5 A;  2FYK A;  3CCM T;  5FW9 A;  2FZC B;  3CXC S;  2EQU A;  4JZ4 A;  2RJE A;  4M7A G;  2E3I A;  2CP6 A;  3CCU A;  3QWX X;  4M77 B;  3JCM X;  2DO3 A;  2LX7 A;  3CXC P;  1M1K C;  1ZUU A;  2RH2 A;  5FRM A;  1U06 A;  1ZQ1 A;  4M78 F;  4EDU A;  4XU2 A;  1KD1 U;  5GAN g;  2QG9 B;  3RNJ A;  2O2O A;  5AT1 B;  3QSU A;  1I5O B;  4M78 D;  2OTJ Q;  2H8H A;  3L2W A;  1UJ0 A;  2DM1 A;  5KCO A;  3V8L A;  4P5N A;  7AT1 B;  3LYI A;  3MET A;  5LJ3 f;  2HSE B;  3S3O A;  2H3J A;  3M53 A;  3PGG A;  1VQ9 Q;  1N8R U;  1Q86 U;  1K0X A;  2CSQ A;  1RLP C;  1ZHI A;  2JVV A;  2BUD A;  2KT8 A;  2M1H A;  4OB3 B;  2ZPG B;  1PWT A;  4NL3 A;  3A8M B;  1E7O A;  4M7D E;  1RUW A;  4QKU A;  4D6W A;  1EZZ B;  4M75 E;  4BDZ A;  1WHJ A;  2CYZ B;  2WSF E;  5FU7 B;  2JS2 A;  3H9N A;  2EIF A;  4B9W A;  1TUC A;  2DX1 A;  3LH5 A;  1RAI B;  3EGD B;  1ZSZ B;  5IXB A;  1ZUY A;  2HL5 C;  2I2L A;  1UGS B;  1SKU B;  1M9S A;  4V2S A;  5IHI A;  2RI5 A;  1K4U S;  4E7J A;  3M56 A;  4A63 B;  5GAO q;  1BK2 A;  1NBE B;  2K5I A;  4EMK C;  4A4F A;  1PC0 A;  4M75 B;  3JCM Q;  1GCQ A;  3MJX A;  2CRE A;  2ZPH B;  1VQP Q;  3CCE T;  4M7D C;  1VQ6 A;  1R77 A;  1UHF A;  2CP0 A;  1FYN A;  3G1J A;  3CCS A;  4WF2 A;  3NGP A;  1K73 U;  4Z8A A;  4ZGJ B;  4KUL A;  2X9H A;  3G6E T;  2RJD A;  4MZP A;  1G2B A;  2LJ1 A;  2DL7 A;  2DNU A;  2KRM A;  1IHV A;  4ANJ A;  1AT1 B;  5GMK i;  1M2V A;  1Q86 R;  2X3W D;  1H8K A;  1IGQ A;  5KYW A;  2L3P A;  3X26 B;  4E7K A;  1VQ8 A;  2F2X A;  4KGZ B;  3QYG B;  4B6M A;  4PJO E;  5KE3 A;  1EX4 A;  2EGE A;  3MO8 A;  1TOV A;  2LC4 A;  3A8G B;  4IUQ A;  2NLU A;  3I5S A;  2JTF A;  4M7A A;  2J06 A;  1AOJ A;  1NPR A;  3QXE B;  3G7Z A;  4OF1 A;  2YHT A;  1ZBX A;  1WDX A;  2DL8 A;  5GAN h;  2KQW A;  2O9V A;  4XTZ A;  2O9S A;  3MP1 A;  4JJB A;  2DLP A;  2PVO B;  3G4S Q;  1WXB A;  3THK A;  3PTA A;  1VQN Q;  3PT9 A;  5IH2 A;  5D6Y A;  3CC2 Q;  2MI6 A;  1MHN A;  2LJ0 A;  2DFU A;  2MF2 A;  2MPX C;  2LCS A;  3H0F A;  1B07 A;  3RMS A;  2LTO A;  4C5H A;  1Y57 A;  1KQ2 A;  1XJW B;  3OYD A;  1SRM A;  4ZGE B;  1NEB A;  2QK0 A;  4C0F A;  3RKY A;  1JJ2 S;  4DQ2 A;  4JS5 A;  3MEV A;  2JOY A;  2R5M A;  4J9B A;  1K73 R;  1BCO A;  4MMK A;  2LQN A;  4Q5W A;  2X4W A;  1VQ5 T;  1VQO Q;  1FXX A;  1UDL A;  2OTJ A;  1Y71 A;  4F7U G;  5KYY A;  2YWW A;  1KQS S;  2KEA A;  2OAU A;  5HKC A;  2LX9 A;  4FYW B;  3LWI A;  4J7I A;  4CC4 B;  3GPL A;  1YBY A;  3ULR B;  1KC8 R;  5CQY A;  3BY7 A;  2DJZ A;  1OV3 A;  1VQ8 T;  2DTH A;  3J81 E;  3M0U A;  2O4X A;  4LDX A;  2JMC A;  1Q81 R;  4XTU A;  1VQO A;  4E7S A;  3OYG A;  3M57 A;  2DIL A;  2RA2 A;  2V8J A;  2E10 A;  1VQM A;  3MEW A;  1ZBJ A;  4J5Y A;  3T9N A;  4BB7 A;  1YIJ Q;  2AHJ B;  2GCX A;  4JS4 A;  2DEQ A;  2SRC A;  3GOX A;  4QVD A;  1QVG A;  4M7A C;  1QCO A;  1BBZ A;  2F2W A;  5GAN 8;  4JRK A;  3PE0 A;  1U1S A;  1N8R R;  3Q1J A;  2LQK A;  3H6Z A;  4JRP A;  1WQW A;  2LMJ A;  2KYM A;  4M78 E;  1YIJ T;  5GAO n;  4FL6 A;  4DBF A;  5LJ5 g;  3CXC A;  4C92 E;  2JS0 A;  3ZEH A;  3J7A F;  1VQL A;  1WZO A;  3JSC A;  1BI0 A;  1PHT A;  1SSH A;  4E7Z A;  4J7F A;  1OU8 A;  2V8K A;  3H0H A;  4JRQ A;  2EPD A;  3JCM h;  1S72 A;  4QQ6 A;  1M2O A;  5J26 A;  3JCM f;  2CZ7 B;  3UDC A;  3CCJ Q;  1VQ8 Q;  1LPL A;  1AWW A;  1AWJ A;  3FIF A;  3P8B B;  2DVJ A;  5GAN f;  1QKW A;  1J3T A;  2J7I A;  2KRS A;  4L6V 5;  4DOW A;  2RD1 A;  2JNG A;  4PFP A;  4F04 B;  1QP3 A;  5J39 A;  3G71 T;  4M7A D;  4KGV B;  2XIC A;  2VAS A;  3A1P A;  5CAI A;  3FDR A;  3OS2 A;  3URG A;  5KYX B;  3HRT A;  4M7A F;  5GAN 6;  3CCS Q;  2BIV A;  4LDY A;  5HY6 A;  3U23 A;  2JXB A;  5LJ5 j;  3J80 E;  1IB8 A;  2XDD A;  5CCA A;  5ECA A;  4J6W A;  4QW2 A;  3QZ9 B;  1Y07 A;  5KYY B;  2D9T A;  1YHQ A;  5IHK A;  2K2M A;  5LJ5 h;  2G6F X;  4DBQ A;  1ZA1 B;  5FLX E;  3GIB A;  1N6A A;  2D0N A;  4M75 C;  3CCU T;  2LNH B;  2DKG A;  3OYY A;  3QWY A;  4X9D A;  1ARK A;  1ZA2 B;  5GAM e;  3EG9 B;  4KGX B;  4KH1 B;  3I56 T;  2MCN A;  3UA7 A;  5A2Q E;  3OS5 A;  1X01 A;  1RAH B;  4OMQ A;  1OZ3 A;  4HVV A;  1QW1 A;  2ED0 A;  4J9E A;  2QEX Q;  1M90 U;  1GXI E;  4ELY C;  4L59 A;  2K79 A;  1GL5 A;  2KI7 A;  1NPP A;  3HPW A;  3PIP A;  2QQB A;  4ZTF A;  2HZY A;  1I0C A;  1CKA A;  3EG3 A;  1UGQ B;  1Y7X A;  2CP5 A;  2O01 E;  2PVG B;  4J8O A;  1XTD A;  2V1R A;  4N4I A;  4HVW A;  3SWN A;  1MNE A;  2KMT A;  2M51 A;  4FT2 A;  2COW A;  5FRO A;  2EGC A;  2H3E B;  1M3B A;  1Q95 G;  1RL2 A;  3X20 B;  2EW3 A;  3MEA A;  2OAW A;  1D1C A;  4Y91 A;  2P0P A;  4C8Q D;  4CC7 A;  4M78 A;  4OP0 A;  4PFZ A;  2NUP B;  4DBR A;  4JRI A;  3RR6 A;  2AT1 B;  5CKH A;  3CCQ Q;  4LN2 A;  3H41 A;  3TVT A;  4BY6 B;  2FHD A;  1D1A A;  1JO8 A;  2FRY A;  2EQK A;  2RI3 A;  4ZNX A;  4E47 A;  2HQE A;  1O9S A;  2WAC A;  2HBW A;  1Q7Y U;  1H92 A;  3I35 A;  3OYB A;  2VXF A;  3LH0 A;  5CKB A;  4Y92 A;  2V1Q A;  2Y4Y A;  3GBQ A;  3OB9 A;  5I21 A;  3JAM E;  4R56 A;  1HD3 A;  3EH2 A;  4A4H A;  1NJI U;  4PJN A;  2FZK B;  3CCV T;  3CC7 T;  4E7I A;  1GCQ C;  3HTR A;  2X51 A;  3CCJ A;  4NL2 A;  1VQ4 T;  1GFD A;  3L42 A;  4RTU A;  1HK9 A;  2Z0W A;  2E4H A;  3EGD A;  2JT4 A;  1Y96 B;  2D1X A;  3INZ A;  2BZX A;  2ZAE A;  2D8H A;  1GCP A;  1I5L A;  3CD6 A;  1X6O A;  1M8V A;  9ATC B;  1VQL Q;  2EYY A;  2E41 A;  1D3B B;  3CC2 T;  1VYT A;  1YJ9 Q;  5I11 A;  1YJW A;  2EVR A;  1OU9 A;  1CSK A;  2P4T A;  2RK2 A;  2Y90 A;  2W0Z A;  3OYH A;  2L2P A;  2DZ9 A;  2EJ9 A;  3OYI A;  4HA8 A;  5GAN 7;  4IIO A;  3H8Z A;  1M1F A;  2RNA A;  2W10 A;  2V8I A;  2L3S A;  2KT1 A;  5GAN e;  5GAO l;  1QVF P;  1N9S A;  3C12 A;  1KG1 A;  1UTI A;  2XHC A;  3EG2 A;  2PVD B;  4FT4 A;  1YCS B;  1YIJ A;  1PCX A;  4WCI A;  2QTV A;  2DZC A;  3DKM A;  1NE8 A;  3RES A;  1VQM Q;  2BKD N;  2E65 A;  3EG9 A;  2A0F B;  4JZ3 A;  4HCB A;  1WX6 A;  4M75 F;  2NUT A;  2VKN A;  1WJQ A;  4F14 A;  2RQR A;  2SEM A;  1TS9 A;  2KXC A;  3JB9 H;  4OB2 B;  1OQK A;  3G6E Q;  4HCK A;  5HK0 A;  1JXM A;  3VU3 C;  2FB7 A;  3QUI A;  3HRS A;  1RAE B;  1X75 C;  2CDT A;  1AVZ C;  1U3O A;  3SB2 A;  2GNC A;  4C8Q E;  3SDZ A;  3OYN A;  4EMH A;  1YWO A;  3G6E A;  2RJC A;  5KYU A;  5CO7 A;  1YIT T;  1UHC A;  4E6R A;  4C0D B;  1WGS A;  3OW2 S;  3F70 A;  4FW2 A;  2E1H A;  5LJ3 e;  2K3X A;  5C0M A;  2QTX A;  5LJ5 d;  2A36 A;  6AT1 B;  4C0D C;  4C92 D;  2MMP A;  4IUP A;  4C92 B;  1EFN A;  5M9O A;  5EG2 A;  1NZ9 A;  1RAA B;  2KRO A;  5GAO p;  2YRC A;  1BB9 A;  2FPF A;  3E1S A;  2FO0 A;  5I22 A;  2QAS A;  3EFO B;  1X6G A;  1YN8 A;  1R0B G;  1X6B A;  4PJO D;  1VQN T;  1KD1 C;  2WSC E;  2QI2 A;  4PJO F;  2AZV A;  2LJ3 A;  4J9G A;  3QZ5 B;  4F7U E;  2RHX A;  1YJW T;  1SG5 A;  3PFS A;  1YJ9 A;  2K5F A;  2KK4 A;  5KYN A;  3JB9 F;  2FVU A;  2YUN A;  3BFM A;  4GY5 A;  3M0R A;  8AT1 B;  3L2Z A;  2PZ1 A;  3EGX B;  3RIR A;  1QP2 A;  3CD6 Q;  1SRL A;  4JPB W;  1XNI A;  2ROT A;  4VUB A;  3M0P A;  4PK4 A;  5A0G A;  4RTX A;  4ZN1 A;  2OTJ T;  4AG1 C;  1I4K 1;  2KBT A;  2EJF A;  4XTV A;  1C6V X;  5GAN j;  2EJG A;  1YCY A;  1MGQ A;  2K5L A;  4NOY A;  1K8A R;  2DYI A;  1HJD A;  2RK1 A;  3SFM A;  2JTM A;  1H64 1;  3FLG A;  2YDL A;  1D0Z A;  3JCM J;  3FJ5 A;  2DXU A;  5L23 A;  2K3Y A;  3BDL A;  4RG2 A;  5DM7 R;  3WVD B;  2D8J A;  2QQA A;  5FRN A;  4M7D G;  2DD5 A;  1K76 A;  3VS1 A;  2PTK A;  1DJ7 B;  2L89 A;  2YT6 A;  3A8O B;  4OGE A;  1AZE A;  2K6D A;  4O5V A;  5LJ3 g;  4BAC A;  2RN8 A;  2E6Z A;  2MWO A;  3X24 B;  3GNF B;  1JJ2 A;  4QQG A;  4C5E A;  4LUE A;  1Q81 U;  5L8R E;  5AYF A;  4N4G A;  2ENM A;  1I07 A;  3VS0 A;  3CC4 A;  5DLO A;  3VS2 A;  2LP5 A;  2A08 A;  5A0L A;  2J05 A;  3GF5 A;  3P8H A;  1PRM C;  1AWO A;  3ASK A;  2XKO C;  1G5V A;  3V7R A;  2E5Q A;  2DIG A;  2QQ9 A;  3JCM V;  2MIO A;  4QVZ A;  5IAY A;  3EG1 A;  2MWP A;  5GAM h;  4BDY A;  1W2B P;  5HK3 A;  4A4G A;  1XQH A;  2VV5 A;  4IKF A;  1Q7Y C;  4E2F B;  3GP8 A;  1H3H A;  1VQ9 A;  3QDF A;  3MKD A;  4BI4 A;  5KH6 A;  4PJJ A;  2LDM A;  4GBQ A;  3OYA A;  1WJR A;  2JZ2 A;  3H0I A;  4C0Z A;  4M7D B;  2CP7 A;  2NWM A;  1WIE A;  4C92 A;  2HMA A;  4OB0 B;  1UUE A;  2ZPB B;  2AIR B;  1G3W A;  2EYQ A;  2G3R A;  2X3X D;  3LX7 A;  5CK9 A;  1YIT Q;  1QVG P;  3VS7 A;  1M2V B;  1YHQ Q;  3L2R A;  3QJ6 A;  1ACM B;  3I55 A;  3CMA T;  2ZPE B;  3MP8 A;  3M9Q A;  4FSS A;  1NG2 A;  3CCE Q;  5LJ3 h;  1K9M U;  4PJL A;  4R55 A;  4LD9 K;  5I2S A;  4J9I A;  1KD1 R;  1CKB A;  1C1A A;  5LJ5 f;  3NMZ C;  4M75 A;  4OGC A;  4AG2 C;  2PUK B;  3C4S A;  3SEM A;  3HSB A;  1OX8 A;  4QQD A;  2CSI A;  4Z89 A;  1BKB A;  3S3N A;  1Q82 C;  4JUV A;  4F17 A;  4DEX A;  1PSE A;  3C94 A;  1AEY A;  1D09 B;  3EGX A;  4HXJ A;  1FMK A;  2OJ2 A;  1AZG B;  4A54 A;  3BE3 A;  3LWH A;  1VQ7 T;  2C0I A;  1S72 Q;  4C8Q G;  2YSQ A;  4XTW A;  2LQ8 A;  3EG0 A;  4DBH A;  5CIU A;  4OML A;  3X25 B;  2MOX A;  1NYF A;  3CCR A;  1G8X A;  5CVI A;  4RCB A;  3CCR Q;  2CKK A;  2QDY B;  3MPU B;  4C92 C;  3CD6 T;  3EFO A;  1TSF A;  2GTO A;  4J6X A;  5CQX A;  2EBP A;  3V8J A;  2F5T X;  1HXD A;  4Z88 A;  4CRI A;  3VUZ A;  3JV3 A;  3P8D A;  2RJF A;  1R8O B;  3QBY A;  1VQK A;  4CI0 C;  3EHQ A;  3ME9 A;  3CC7 Q;  1GRI A;  3JB9 J;  2L5Q A;  2RQV A;  4AFS C;  5KYW B;  3V7S A;  1WHG A;  2DER A;  3DLL A;  2VB6 A;  4FM4 B;  3CCQ T;  3PVQ A;  1VIE A;  2RQU A;  5A0D A;  2YLC A;  3QDR B;  5EC7 A;  3I55 Q;  1YI2 A;  1BI3 A;  2DBK A;  1M27 C;  2VXE A;  3CCM Q;  2L0A A;  3OSS C;  1BI2 A;  4D8K A;  1YIT A;  2DMO A;  2CP3 A;  1PD0 A;  3VS4 A;  5KCH A;  3SWN C;  4PL6 A;  1M5Q 1;  1YJN A;  1QWF A;  5HCK A;  4HCZ A;  4MZT A;  2HEQ A;  2DJQ A;  4E7L A;  1WXT A;  2PUO B;  2YLB A;  3OW2 P;  2OTL A;  1AHJ B;  2YUQ A;  4UC4 A;  1TUD A;  4AFZ C;  1OX9 A;  2CS7 A;  1Q7Y R;  2A37 A;  1LNX A;  1LVK A;  3X28 B;  1KHC A;  3NTH A;  1OYX A;  4BI8 B;  4OMM A;  2COY A;  3BW1 A;  2B86 A;  3CC2 A;  3QII A;  4XU3 A;  5GAN 5;  3MHX A;  5D6W A;  2QEX A;  3M4G A;  3OYE A;  1I8F A;  2EKH A;  1WPY A;  2QEX T;  2BE9 B;  1SHF A;  2PNI A;  2F2V A;  3LLR A;  1OOT A;  3OBY A;  2F1L A;  3TEE A;  1D3B A;  2R58 A;  1QLY A;  3FRN A;  2CT4 A;  4FU6 A;  3E2U A;  1M3A A;  1W6X A;  4PKC C;  2R57 A;  3CC4 Q;  2RQW A;  1Y96 A;  3UF4 A;  4K11 A;  4LE9 A;  8ATC B;  5D7U A;  1YJ9 T;  2RO0 A;  1V29 B;  2P84 A;  4B9X A;  4BI3 A;  4KUI A;  3REB B;  3L1A A;  1K9M C;  4HKE A;  2BZY A;  2KR3 A;  1M90 C;  1B7T A;  3KBG A;  4DEY A;  2DL4 A;  1T3L A;  1E6G A;  5FU6 B;  2J6O A;  4AT1 B;  4LD6 A;  2GFA A;  2FPD A;  2K7A A;  1T0H A;  1VQ6 T;  1K9M R;  1N8R C;  3ZL7 C;  2XI9 A;  1VQP A;  3CCS T;  4XU0 A;  4EIK A;  4KRT A;  2NUP A;  4XTX A;  1YNZ A;  2HKN A;  3JCM b;  3I56 A;  4J9H A;  1RAB B;  1QMC A;  1OUL A;  2DTO A;  1D0X A;  4IUR A;  3VRY A;  2B8A A;  1KK7 A;  2YXY A;  2QA4 A;  4C0G A;  2YRV A;  2HQH A;  4QT7 A;  2A3L A;  2M0O A;  3FJP A;  2ABL A;  4RTV A;  4N4H A;  1LOJ A;  4AMC A;  2K2V A;  3SWN B;  1PD1 A;  3A8L B;  2D0Q B;  1AWX A;  4JJC A;  2HD0 A;  1ZX6 A;  2IIM A;  2P0K A;  2AKK A;  3VKI A;  1VOM A;  3OY9 A;  3NPF A;  1BCM A;  1S1N A;  1D0Y A;  2KVQ G;  4J83 A;  3M55 A;  1BYM A;  4M7A E;  1MND A;  3QO3 A;  4FSX A;  5J3B A;  2GF7 A;  4WTO B;  1RLQ C;  2RHI A;  2GFU A;  1UGP B;  4RTW A;  1IRE B;  1X2Q A;  4J6Y A;  2EGA A;  2E5K A;  4M7D D;  1WHL A;  2YRD A;  1YP5 A;  3M59 A;  4C5G A;  2ZGW A;  1JJ2 P;  3PNW C;  1Q82 U;  5GMK m;  1PG5 B;  2OI3 A;  3M0Q A;  3CMA Q;  2J6K A;  1QQJ A;  1RAG B;  4MDX A;  1YJN Q;  2L3R A;  2A7Y A;  2L8D A;  3C95 A;  2MYS A;  4PLL A;  1KSW A;  2LZ6 B;  4AFU C;  4ZGD B;  2C0O A;  4PFO A;  3NHN A;  3KUF A;  1X2K A;  3VYH B;  2HL3 A;  2JUF A;  1GBQ A;  2HKQ B;  2M9U A;  4JJD A;  4C8Q B;  2QAZ A;  4RTY A;  1IZ6 A;  3CCV Q;  1YI2 Q;  2XDP A;  2F69 A;  1ZLM A;  1O75 A;  5LJ3 j;  5KYX A;  3M58 A;  3VJP A;  2QYZ A;  1QCF A;  5KE2 A;  4TVR A;  3JB9 D;  1XOV A;  2KGT A;  4JDS A;  4KUD K;  2MK5 A;  4BE1 A;  3I55 T; 
#chains in the Genus database with same CATH homology
 3CBM A;  3M57 A;  4O5V A;  1I81 A;  5LJ3 g;  2RA2 A;  2LT1 A;  4BAC A;  2C06 A;  2V8J A;  2E6Z A;  1QVP A;  2E64 A;  4ME7 A;  4PLI A;  3OYK A;  1K8A U;  2E10 A;  2MWO A;  3X24 B;  2QA4 T;  1VQM A;  3MEW A;  3VUB A;  3GNF B;  4DA4 A;  4J5Y A;  4QQG A;  4C5E A;  3OW2 A;  3HFN A;  4RCC A;  3T9N A;  4BB7 A;  3CCL A;  2AHJ B;  1Q81 U;  5L8R E;  2EFI A;  3E9G A;  2GCX A;  5AYF A;  2DEQ A;  4N4G A;  4IUU A;  1G3T A;  5GAM g;  3GOX A;  4JS4 A;  1QVG S;  3CC4 A;  5FU6 C;  4QVD A;  1QVG A;  4M7D A;  4M7A C;  5DLO A;  3FB9 A;  4YTL A;  5A0L A;  3CC4 T;  5GAN 8;  3GF5 A;  4EPC A;  3P8H A;  3FC3 A;  4JRK A;  3ASK A;  2XKO C;  4JJN K;  1G5V A;  3V7R A;  2E5Q A;  2DIG A;  2QQ9 A;  2KDS A;  1U1S A;  1B34 A;  5FU7 C;  3JCM V;  3Q1J A;  4QVZ A;  5IAY A;  3PMI A;  4KT0 E;  4F7U B;  2LQK A;  2MWP A;  3H6Z A;  3OMC A;  5GAM h;  4JRP A;  4BDY A;  5HK3 A;  4A4G A;  1WQW A;  4M78 E;  1XQH A;  1VQ4 A;  1YIJ T;  5GAO n;  4FL6 A;  1H3Z A;  3M4Y A;  2VV5 A;  5LJ5 g;  3RER A;  1JBM A;  3CXC A;  3JB9 G;  4O6J A;  5GAO m;  2JN0 A;  1VQ9 T;  2VGM A;  1B34 B;  4C92 E;  1Q7Y C;  4IKF A;  4BD3 A;  2K57 A;  3GP8 A;  1VQ9 A;  3ZEH A;  2XU8 A;  3J7A F;  1VQL A;  2DK3 A;  2XK0 A;  3JSC A;  2DXT A;  1BI0 A;  3UWN A;  5GAN 3;  2P0Q A;  3VV0 A;  3HHT B;  4BI4 A;  1QVF A;  5KH6 A;  4J7F A;  2V8K A;  4IUV A;  4HT9 A;  2LDM A;  4JRQ A;  3OYA A;  3JCM h;  1S72 A;  2ZZD A;  1WJR A;  2JZ2 A;  4QQ6 A;  3OYL A;  3OYH A;  5J26 A;  4C0Z A;  2DAQ A;  4LDW A;  3M5A A;  3OBW A;  3JCM f;  2WSE E;  4M7D B;  1N27 A;  2CZ7 B;  3CPF A;  3UDC A;  1VQK T;  4M75 D;  3FIF A;  3P8B B;  3E9F A;  4C92 A;  3LGF A;  5GAN f;  1VUB A;  4E7H A;  5CR2 A;  4OB0 B;  4MML A;  4L6V 5;  4DOW A;  2ZPB B;  2HBP A;  1G3W A;  5GAM j;  2RD1 A;  2VYT A;  2JNG A;  2EYQ A;  1QP3 A;  2G3R A;  3QKJ A;  4L5G A;  5J39 A;  3G71 T;  4M7A D;  3LX7 A;  3G71 A;  5CK9 A;  1VQP T;  2XIC A;  5CAI A;  3FDR A;  3JCM g;  3OS2 A;  2MAM A;  4X9C A;  3URG A;  2XD0 A;  5GMK j;  1U1T A;  3HRT A;  4EMG A;  1WQ7 A;  2IVW A;  5GAN 6;  3QJ6 A;  3OYJ A;  3L2R A;  3DB3 A;  1VQO T;  4M7A F;  5GAN 4;  3I55 A;  3CMA T;  1WNL A;  2BIV A;  2ZPE B;  3MP8 A;  4LDY A;  5HY6 A;  3DB4 A;  3MP6 A;  3M9Q A;  2O4X B;  2VUB A;  5LJ5 j;  3EFR A;  3J80 E;  2DVE A;  3RKW A;  3WXM B;  5LJ3 h;  3JCM d;  4IUT A;  3QG1 A;  5CCA A;  2XDD A;  1K9M U;  4R55 A;  1BIB A;  2X4Y A;  5I2S A;  4LD9 K;  4J6W A;  3L2Q A;  2X4J A;  4XQ3 A;  3MEU A;  4M78 G;  4QW2 A;  3QZ9 B;  2EWN A;  1Y07 A;  5LJ5 f;  1YHQ T;  2D9T A;  4LDU A;  1WJS A;  4M75 A;  4OGC A;  1YHQ A;  2GQV A;  2DXC A;  3CEY A;  4NS5 A;  2RI2 A;  2PUK B;  5LJ5 h;  3C4S A;  3HSB A;  2PU9 B;  3OMG A;  5FLX E;  4JLI A;  3GIB A;  1KHI A;  1N6A A;  4QQD A;  4M75 C;  3CCU T;  3CBP A;  3M54 A;  1BKB A;  3S3N A;  3EAE A;  1Q82 C;  4JUV A;  2DKG A;  1UEB A;  3OYY A;  4X9D A;  3WVE B;  4XTY A;  2OTL T;  1EIF A;  4A53 A;  5GAM e;  1PSE A;  3GLX A;  3ER0 A;  3C94 A;  3LW5 E;  1BI1 A;  5CKE A;  2E6N A;  1JB0 E;  1FX7 A;  1OZ2 A;  3L2U A;  4PJO C;  3CCL T;  3I56 T;  2DXB A;  2EQM A;  5GAN d;  3ZFJ A;  5GAO r;  3BDU A;  1P92 A;  4A54 A;  5A2Q E;  3OS5 A;  3LWH A;  1VQ7 T;  3JCM W;  2E12 A;  1X01 A;  3DLM A;  4PJO B;  1OZ3 A;  3QHS A;  1QW1 A;  4XTW A;  4C8Q G;  4ELZ C;  4EMK B;  1M1K U;  2LQ8 A;  3OQ5 A;  5CIU A;  1YJN T;  1M90 U;  1GXI E;  3NFC A;  4ELY C;  4L59 A;  4RMO A;  3GNG A;  4ZN3 A;  3A8H B;  3CCJ T;  1JJ2 A;  3HPW A;  1NPP A;  3X25 B;  1W2B S;  1KQS A;  3PIP A;  3JCM P;  1W2B A;  3SD4 A;  2QQB A;  3JB9 I;  3OYC A;  3CCR A;  4GLK A;  4QVC A;  4ZTF A;  3O8V A;  2FL7 A;  3L2V A;  4M77 F;  5CVI A;  3HL8 A;  1M8V A;  4XAX B;  4A4E A;  4RCB A;  4RKU E;  3CCR T;  2X4X A;  4OVA A;  4A4K A;  2CKK A;  2QDY B;  3RUX A;  1OI1 A;  4C92 C;  1UGQ B;  1Y7X A;  2O01 E;  2PVG B;  3CD6 T;  4J8O A;  2DTI A;  4J6X A;  1UB4 A;  1XTD A;  4RG8 A;  4N4I A;  2CGH A;  5CQX A;  3SWN A;  3V8J A;  1PSF A;  2F5T X;  1HXD A;  4CRI A;  2DPP B;  3VUZ A;  2KMT A;  3P8D A;  1S72 T;  1K8A C;  2XDB A;  2LRQ A;  2RJF A;  1R8O B;  3HKS A;  3QBY A;  5IT9 E;  3KXT A;  4FT2 A;  5DY9 A;  4C8Q F;  1LJO A;  2PQW A;  5FRO A;  5CKD A;  2RB6 A;  4MZM A;  3PIO A;  1VQK A;  1FWZ A;  4CI0 C;  1RL2 A;  3N5B B;  1W4S A;  3ME9 A;  3X20 B;  4M7D F;  3MEA A;  2QQR A;  2RHZ A;  3HP9 A;  2P0P A;  4OB1 B;  4Y91 A;  4C8Q D;  3JB9 J;  4M78 A;  5DLQ E;  1TH7 A;  3OYM A;  2L5Q A;  3ZBD A;  3OS1 A;  2XG8 D;  4OP0 A;  3CCM A;  3V7S A;  4M75 G;  2FYK A;  4JRI A;  3CCM T;  3DLL A;  5GAM f;  3EFS A;  1QVF S;  5CKH A;  4ATO A;  4FM4 B;  5I2M A;  4BY6 B;  3CCQ T;  3CXC S;  2FHD A;  2EQU A;  2RHY A;  2EQK A;  1VIE A;  2RI3 A;  2RJE A;  5A0D A;  4E47 A;  2YLC A;  2EQJ A;  4C5I A;  4M7A G;  2HQE A;  3QDR B;  3CCU A;  4M77 B;  3JCM X;  1O9S A;  2WAC A;  1Q7Y U;  2DO3 A;  1YI2 A;  1BI3 A;  1M1K C;  3OYB A;  2VXF A;  3LH0 A;  5CKB A;  3CPW S;  3HRU A;  2RH2 A;  2D6F A;  2VXE A;  5CKF A;  2Y4Y A;  3OB9 A;  4DOV A;  5FRM A;  1G3Y A;  3V7C A;  2X35 A;  1BI2 A;  3OSS C;  5I21 A;  3JAM E;  4A4H A;  4R56 A;  1YIT A;  1NJI U;  4C92 G;  1ZQ1 A;  4M78 F;  4EDU A;  4XU2 A;  1KD1 U;  5GAN g;  3CCV T;  4BE2 A;  1U8R A;  1VQ7 A;  4F7U F;  2KY9 A;  4XU1 A;  3CC7 A;  4BUG A;  5D6X A;  5KCH A;  5GMK e;  3SWN C;  3QSU A;  3CC7 T;  4PL6 A;  1M5Q 1;  4E7I A;  4M78 D;  1YJN A;  3L2W A;  4HCZ A;  4MZT A;  3CCJ A;  4NL2 A;  4E7L A;  2XID A;  2QQS A;  1VQ4 T;  3QYH B;  2PUO B;  3L42 A;  4MDW A;  5KCO A;  2RHU A;  1HK9 A;  2YLB A;  3V8L A;  2OTL A;  1AHJ B;  4C8Q C;  4P5N A;  1Y96 B;  4UC4 A;  3INZ A;  3QJY A;  3LYI A;  3MET A;  5LJ3 f;  1M4Z A;  2CS7 A;  5GMK h;  3S3O A;  3OSV A;  1X6O A;  1I5L A;  1SSF A;  2H3J A;  3CD6 A;  3LGL A;  3M53 A;  1LNX A;  3PGG A;  3X28 B;  1KHC A;  2E41 A;  3NTH A;  1OYX A;  4BI8 B;  1N8R U;  3V8K A;  1D3B B;  1Q81 C;  1Q86 U;  3MCA B;  3OA6 A;  3BW1 A;  4N0A C;  3CC2 T;  2F5K A;  1ZHI A;  3CC2 A;  3RKX A;  1YJW A;  4M77 C;  2RK2 A;  3QII A;  2JVV A;  2P4T A;  2Y90 A;  4II1 A;  2ZCF B;  3MHX A;  4XU3 A;  2RM4 A;  5D6W A;  5GAN 5;  2BUD A;  2M1H A;  4OB3 B;  2QEX A;  2ZPG B;  2DZ9 A;  2EJ9 A;  1I8F A;  3M4G A;  3OYE A;  4HA8 A;  5GAN 7;  4NL3 A;  2ZPF B;  3H8Z A;  3PMT A;  1M1F A;  3A8M B;  1WPY A;  1BIA A;  2CZ0 B;  4KBM B;  2QEX T;  3S3M A;  4OMF B;  4M7D E;  2V8I A;  4M77 G;  4D6W A;  4M75 E;  4BDZ A;  2LVM A;  3LLR A;  4M7A B;  5GAN e;  5GAO l;  2CYZ B;  3OBY A;  2EAY A;  2WSF E;  1D3B A;  4M78 C;  3TEE A;  1N9S A;  2R58 A;  3C12 A;  5FU7 B;  5GAN 2;  1KG1 A;  3FRN A;  3S6W A;  4PJO A;  2XHC A;  3G4S T;  4FU6 A;  2EIF A;  4B9W A;  3JRZ A;  2PVD B;  4FT4 A;  1YIJ A;  4PKC C;  2DZC A;  3DKM A;  2R57 A;  1NE8 A;  3RES A;  1Y96 A;  2BKD N;  2ZPI B;  3NTI A;  2E65 A;  1YJ9 T;  1VQ5 A;  4HCB A;  2CZ1 B;  1UGS B;  2I2L A;  3UT1 A;  2RO0 A;  4M75 F;  3UPU A;  1JRI A;  1M9S A;  1V29 B;  4V2S A;  2RI5 A;  4FIB A;  4B9X A;  1WJQ A;  2LNV A;  4KUI A;  4BI3 A;  3L1A A;  1K9M C;  1UGR B;  1G3S A;  3M56 A;  4HKE A;  4E7J A;  5GAO q;  2E70 A;  2K5I A;  4EMK C;  4A4F A;  3JB9 H;  2KAF A;  4OB2 B;  1M90 C;  3CBO A;  3KBG A;  4M75 B;  4Z02 A;  3CCV A;  5LJ3 d;  2HQX A;  1KC8 C;  5LL6 S;  5HK0 A;  4M77 E;  3JCM Q;  3CCE A;  1KQ1 A;  5FU6 B;  5LJ5 e;  3A5Z B;  3VU3 C;  2FB7 A;  2ZPH B;  4M77 D;  3CCE T;  4M7D C;  1VQ6 A;  3HRS A;  3QUI A;  2GFA A;  4LD6 A;  5C6S A;  1X75 C;  2LT4 A;  1VQ6 T;  3CCS A;  1N8R C;  4WF2 A;  1K73 U;  3SB2 A;  2XI9 A;  1YI2 T;  1VQP A;  4C8Q E;  4ZGJ B;  4XU0 A;  3CCS T;  4KUL A;  3SDZ A;  3G6E T;  2RJD A;  4XTX A;  3FEO A;  4MZP A;  4X34 A;  3OYN A;  4EMH A;  2DIQ A;  3JCM b;  3G6E A;  3I56 A;  3JCM c;  2RJC A;  2VC8 A;  5CO7 A;  1YIT T;  2DTO A;  2CZ6 B;  5GMK i;  3JCM e;  4C0D B;  1WGS A;  4IUR A;  3OW2 S;  4PNO A;  2IG0 A;  2B8A A;  3F70 A;  4C92 F;  2QA4 A;  4C0G A;  2HAX A;  2E1H A;  5LJ3 e;  2YRV A;  3X26 B;  2K3X A;  5C0M A;  4E7K A;  4M78 B;  3TCJ A;  2QTX A;  1VQ8 A;  5LJ5 d;  2A3L A;  2M0O A;  3FJP A;  3QYG B;  4PJO E;  5KE3 A;  4C0D C;  4N4H A;  1LOJ A;  3MO8 A;  4C92 D;  3TU4 K;  2MMP A;  4IUP A;  3OYF A;  4C92 B;  4LDV A;  4BE0 A;  2K2V A;  2LC4 A;  5M9O A;  1K73 C;  5EG2 A;  3QPH A;  1NZ9 A;  3SWN B;  3A8G B;  4IUQ A;  2LCL A;  2NLU A;  2Y4X A;  3A8L B;  3RMQ A;  2JTF A;  3TRE A;  2D0Q B;  4BY6 C;  5GAO p;  3E1S A;  4M7A A;  2QXF A;  1NPR A;  2HD0 A;  3QXE B;  4PJO D;  3G7Z A;  4OF1 A;  2YHT A;  1VQN T;  1KD1 C;  1ZBX A;  2P0K A;  3VKI A;  2K4Y A;  2WSC E;  1VQN A;  5GAN h;  2QI2 A;  3G4S A;  5GAM d;  1VQM T;  2KQW A;  3OY9 A;  4PJO F;  4XTZ A;  1RI0 A;  2HNI A;  2M16 A;  3AHU A;  3QZ5 B;  3MP1 A;  4F7U E;  2PVO B;  5IN1 A;  3CME A;  2RHX A;  3PTA A;  1YJW T;  3PFS A;  2KVQ G;  3CME T;  3CPW A;  3PT9 A;  4J83 A;  5D6Y A;  3M55 A;  2MI6 A;  1YJ9 A;  4M7A E;  1BYM A;  1MHN A;  2K5F A;  2KK4 A;  3JB9 F;  3QO3 A;  2FVU A;  2VGN A;  4FSX A;  5J3B A;  2GF7 A;  2MF2 A;  4F7U A;  4ZTJ A;  3BFM A;  2RHI A;  4GY5 A;  1N9R A;  2GFU A;  3L2Z A;  1UGP B;  3RMS A;  2LTO A;  4C5H A;  4EMK A;  3RIR A;  1IRE B;  4J6Y A;  1QP2 A;  1KQ2 A;  3E19 A;  3VYG A;  3NTK A;  5GMK l;  3OYD A;  2DD4 A;  4M7D D;  4ZGE B;  3M59 A;  4C5G A;  2ZGW A;  1XNI A;  4Y28 E;  4C0F A;  3RKY A;  1JJ2 S;  4HT8 A;  4DQ2 A;  4VUB A;  4JS5 A;  3PNW C;  3MEV A;  5A0G A;  2JOY A;  1Q82 U;  2R5M A;  4PJO G;  5GMK m;  1VQL T;  4MMK A;  4ZN1 A;  1KC8 U;  2OTJ T;  4Q5W A;  2X4W A;  1I4K 1;  1VQ5 T;  2EJF A;  4MDX A;  4XTV A;  1FXX A;  5GAN j;  3OS0 A;  2EJG A;  1YCY A;  2OTJ A;  2L3R A;  1MGQ A;  1Y71 A;  2A7Y A;  2K5L A;  2L8D A;  2LCC A;  3C95 A;  4NOY A;  4XK8 E;  4F7U G;  3OYI A;  4PLL A;  2RK1 A;  3SFM A;  1KQS S;  5HKC A;  2OAU A;  2JTM A;  2LX9 A;  4ZGD B;  3LWI A;  2EKO A;  1H64 1;  4HCC A;  1VIF A;  3FLG A;  1Q86 C;  3KUF A;  3VYH B;  4J7I A;  2R5A A;  2JUF A;  3JCM J;  3GPL A;  4M77 A;  1YBY A;  2DXU A;  2M9U A;  3R6O A;  2K3Y A;  1NJI C;  5CQY A;  3BY7 A;  4C8Q B;  2DJZ A;  1VQ8 T;  1IZ6 A;  3BDL A;  2DTH A;  4RG2 A;  2XDP A;  4C8Q A;  2F69 A;  5LJ3 j;  1O75 A;  5DM7 R;  3J81 E;  1M1G A;  3WVD B;  2QQA A;  5FRN A;  3M58 A;  2O4X A;  4LDX A;  3VJP A;  4M7D G;  2DD5 A;  4N0A A;  5KE2 A;  3CMA A;  4TVR A;  3JB9 D;  1DJ7 B;  1XOV A;  4JDS A;  2L89 A;  4KUD K;  4XTU A;  4BE1 A;  3A8O B;  1VQO A;  4JLG A;  4OGE A;  2KSS A;  3CCQ A;  3HFO A;  3OYG A;  3I55 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...