2RJFA

Crystal structure of l3mbtl1 in complex with h4k20me2 (residues 12-30), orthorhombic form i
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
315
structure length
315
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title L3MBTL1 recognition of mono- and dimethylated histones.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 315
sequence length 315
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2007-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjfA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjfA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rjfA03
2O4XA 4BE1A 2EQMA 5M9OA 4E7KA 2EQKA 2CKKA 4IUQA 3QJ6A 4QQGA 2EQJA 3BDLA 4C5HA 3OYBA 1XNIA 3OYGA 4ZTFA 5IN1A 3OA6A 3FDRA 4QQ6A 3O8VA 4A4FA 5KH6A 1WJRA 2R57A 4ZTJA 2FHDA 5CIUA 3CEYA 2E6NA 4GY5A 3LGLA 3NTKA 5C0MA 3QBYA 1WJQA 3OYDA 2RJEA 4UC4A 4OVAA 2F5KA 3L2QA 2RJCA 3FEOA 3OYNA 3QKJA 3OYMA 4C5IA 2K3YA 3OYLA 3OYEA 3MEVA 2L8DA 5FROA 3UWNA 4QW2A 4PL6A 5KCHA 2D9TA 4BDYA 4N4GA 2QQRA 5C6SA 1MHNA 4BD3A 5J39A 4IUPA 3MP1A 4FU6A 4C5GA 3FC3A 2BIVA 2E5QA 4HCZA 3OQ5A 3PMTA 2RJDA 3SD4A 5IAYA 3OYFA 1G5VA 2PQWA 2R58A 3DB4A 2L3RA 3E9GA 2R5MA 5D6YA 4C5EA 2WACA 3MEWA 4CRIA 2R5AA 4IUVA 3F70A 5D6WA 3NTHA 3DB3A 2HQEA 4Z02A 2X4WA 2EKOA 3L2UA 4B9XA 1OZ3A 3OYAA 2IG0A 2P0KA 3OS1A 3M9QA 2QQSA 3OYCA 3LH0A 4IUUA 5FRMA 4IUTA 4RG2A 1SSFA 3L2RA 2LCCA 2O4XB 1OZ2A 2K3XA 3L2VA 2XDPA 3L2WA 2BKDN 4IURA 4NS5A 1H3ZA 4BE2A 4B9WA 3ZEHA 2BUDA 1OYXA 3MP8A 3P8HA 4X34A 5FRNA 4PLLA 4Q5WA 3OS0A 4EDUA 3S3NA 2L89A 3C4SA 4A4GA 4E7IA 3UT1A 3OMGA 2MWPA 3MP6A 3LGFA 2LTOA 3PFSA 4A4HA 2GF7A 4N4HA 4A4EA 1RI0A 2NLUA 4N4IA 3E9FA 3OYJA 3DLMA 3MEUA 1OI1A 2M0OA 3MEAA 2RHXA 2X4YA 4BACA 3GOXA 2RHIA 4BE0A 3S3OA 3OB9A 2DIQA 3PMIA 2JTFA 3LLRA 4L59A 5KCOA 1WJSA 3Q1JA 2RHUA 3OYKA 2RJFA 2XK0A 3ME9A 3OMCA 3OYIA 3KUFA 3P8DA 3OYHA 2EFIA 2RO0A 2M1HA 3S6WA 2DAQA 3MO8A 4II1A 4LD6A 2RHYA 2EQUA 2B8AA 4QVZA 4BDZA 2X35A 4E7LA 3LX7A 2LRQA 3OS2A 2YRVA 2LVMA 4E7HA 2RI3A 5KE2A 3META 4QQDA 2G3RA 3OY9A 3H8ZA 2JZ2A 2DIGA 2M16A 2MWOA 2VYTA 3FLGA 3NTIA 2GFUA 2RI2A 3LYIA 3PNWC 5D6XA 3EAEA 5KE3A 2X4XA 5J26A 2RHZA 4IKFA 3QIIA 3ASKA 1KHCA 1WGSA 2GFAA 3H6ZA 2RI5A 4PLIA 4E7JA 3S3MA 1N27A 2HQXA 2LDMA 3L42A 4FL6A
chains in the Genus database with same CATH superfamily
2JT4A 2EQKA 3OYBA 1BI0A 3TVTA 2CREA 2ECZA 4X9CA 5KH6A 1BBZA 1W6XA 2JM8A 2COYA 3NTKA 3VV0A 4JUVA 2C0OA 4FYVB 1VQ6A 3V7RA 1D3BA 4C92G 2COZA 4LN2A 2P0PA 5GAOl 2K79A 3SHWA 2HKQB 1UB4A 1X01A 3I35A 2A28A 1M2VA 1UGSB 3A5ZB 4PL6A 2K2MA 1JB0E 1UJYA 1M1GA 4F7UF 3M54A 1VA7A 1BI3A 2K7AA 2L3RA 1VQ8Q 1VYVA 2CSIA 5KYXB 4EMKC 3F70A 5I21A 3NHNA 2EQIA 2QQSA 3QPHA 3EFOB 2HMAA 4JJNK 4J9HA 1W1FA 3EGDA 3ZFJA 1VQ8T 5KYUB 1NJIR 1AWWA 3JCMc 1TWBA 1WXUA 1M3AA 1UGPB 1Q81C 3JCMW 4RTZA 1O75A 3JB9F 2D8HA 3E9FA 4HKEA 1LNXA 3DLMA 1RAGB 2NUZA 2RHXA 3CCVA 4BE0A 3S3OA 2SRCA 4J8OA 4E7ZA 2JTFA 2DL3A 2DZCA 1PG5B 3TQ7P 4OMPA 4C92A 4OB3B 1KIKA 1E6HA 4EMHA 2VGNA 4PJOB 4J9FA 3UA6A 3RR6A 1I0CA 3EG1A 5GANf 5DLQE 1Q7YC 4ZNXA 2X51A 4PNOA 1K73U 2J7IA 2LQNA 1WGSA 3ASKA 2L0AA 4AFUC 4FYWB 4HT9A 1KHIA 4DEXA 4BE1A 1LCKA 2RPNA 2QEXQ 2QQAA 3CMEA 5IXBA 4L5GA 2FPEA 4DBFA 2C06A 4Y91A 2AKKA 5CIUA 2FZGB 4RTVA 2DVEA 1NM7A 4DOWA 1VQ8A 2BE7D 4OVAA 2RJCA 1YWPA 4A63B 3JSCA 2QEXT 1MMAA 2K5FA 5GAOr 2ZAEA 1G5VA 4WCIA 3CC7Q 1YI2Q 1PRMC 4EPCA 5GAN6 4IUVA 3JCMJ 4HXJA 2QYZA 3LH0A 1R8OB 1KJWA 2XDDA 2WSEE 1VYUA 5KYNA 3CC7T 1YI2T 1YJWQ 4MZPA 4N4HA 3OBYA 1RI0A 1M1KU 1JEGA 2YT6A 3H0FA 1FWZA 2MI6A 1M5Q1 3I5SA 2HBPA 5GANj 2HZYA 3EG9A 3J7AF 1WHJA 2XK0A 3JCMQ 3P8BB 4KRTA 4F7UE 5CKDA 4C8QC 3E1SA 3REAB 1YJWT 4LUDA 2J6FA 5GANe 2QEXA 2FRYA 2J6KA 2KNBB 2D0NA 3META 1BI1A 4M78G 1ABQA 2M02A 2RK1A 2VYTA 2LMJA 3QG1A 1TUCA 1GCPA 4LDVA 2DZ9A 1TU0B 1KHCA 4M75F 2V26A 2F2WA 2FO0A 3BDUA 3OSSC 5DLOA 2JNGA 3OYGA 4HVWA 1T3LA 2DBMA 2A08A 2AT1B 1WX6A 2XD0A 1WJRA 2FHDA 2EGCA 3KBGA 3LGLA 4HVUA 1YI2A 4XU0A 2HDAA 4C92F 2MOXA 1ZUKA 1N9RA 3H0IA 3OYMA 4AMCA 1U1TA 1XQHA 4BI4A 2H3EB 1X69A 5KCHA 5CQYA 2ATCB 4LDUA 2L2PA 3HL8A 3C94A 3ZL7C 2KYMA 1RLQC 1Y07A 3BE3A 1VQOA 5D6YA 4CRIA 5A0LA 1BI2A 1V76A 1GBQA 2DYBA 1S72Q 5FWBA 4AFZC 3VS0A 5AYFA 3OYAA 3A8GB 2D1XA 2DYIA 4RKUE 1AT1B 2PU9B 1HJDA 2VASA 3LWHA 1VQ7A 1J3TA 4OMLA 1SHFA 2E65A 3OMGA 2MWPA 3MP6A 3X24B 4C8QD 1S72T 3CD6A 4M77E 2KK4A 1SHGA 1XJWB 5LJ3f 4GLKA 3RDVA 1EX4A 1RL2A 2RQUA 4M77B 3X25B 1KG1A 4XU3A 1WFWA 1AHJB 2HL3A 2ED0A 2KMTA 1OOTA 3VRZA 3VRYA 2X35A 4KH1B 1ACMB 1K9AA 4LUEA 3CCRQ 1R0BG 2ENMA 2DIGA 1Q95G 1WLPB 5KE3A 2EVRA 3EAEA 1W2BP 1Q81U 2EYZA 2YUOA 1M8VA 4O5VA 1U1SA 3EFOA 2CP7A 2EAYA 3UA7A 1ZSGA 4J9EA 4M7DB 4QQ6A 5KYUA 4LNPA 3CCRT 4QVDA 1VQKQ 2HBWA 5C0MA 2LJ3A 1AWOA 4OMOA 3RERA 1WPYA 1Q82R 1S72A 4F04B 4M7AG 2L8DA 2D9TA 3BFMA 1G2BA 3M55A 3FC3A 1K8AC 1SRLA 2LZ6B 1VQKT 3SD4A 1WQ7A 2IIMA 3INZA 2WACA 4PJOA 1CSKA 1SRMA 2ZPHB 3DLLA 5FU7C 2PTKA 5L8RE 4D8KA 2V8KA 5LJ5f 3CBMA 3WXMB 2MAMA 4DEYA 1HYOA 2P4RA 2VXEA 2DXCA 1K73R 4EMKB 1Q82C 1E6GA 2MF2A 3PFSA 2E3IA 3H0HA 1Y57A 5AT1B 2J6OA 2HEQA 5HK3A 5LJ3d 1YHQA 3CCSQ 5GAMf 4P5NA 2FZCB 2CZ1B 1KFZA 4KUDK 2CT4A 2EFIA 1D0ZA 5FU6B 3M0PA 3N5BB 5GAN5 2YRVA 2B86A 4CC7A 3CCST 1JBMA 3M0SA 1NLPC 4M78F 1VQKA 4RTTA 2M51A 1TTHB 3NTIA 2KDSA 2EYQA 1PHTA 2W10A 2YUNA 5I2SA 4BY6B 3PVLA 1VOMA 1X75C 4MDXA 2DEQA 3J81E 2DF6A 1QVGP 2BE9B 4PKCC 1TUGB 3QUIA 2PUKB 1YWOA 4XTXA 2X3WD 2JVVA 1K0SA 4ZN3A 3O8VA 1QP2A 2EBPA 5I22A 3JB9I 1X2KA 4AFQC 2YSQA 4OMMA 2PVDB 4A53A 3JCMd 3L2QA 3TREA 3QKJA 2HCKA 2M0YA 1RAFB 2DBKA 2MMPA 2Z0WA 3UWNA 1LOJA 1I5LA 3OSVA 4KULA 2E5QA 1G3YA 2V8IA 1NPRA 2RJDA 2I0NA 2RM4A 1RAAB 4PK4A 3FJ5A 2ESWA 1A0NB 2ZPBB 1ZSZB 4C0GA 3CCSA 1ABOA 5LJ5d 1G8XA 5GAMj 2QDYB 2DTOA 3QZ5B 4B9WA 3HFNA 4A4GA 3I56A 2KR3A 1GCQA 5GAMe 2CP3A 4FYXB 2MK5A 1OI1A 3CPWA 4NL3A 5GAMd 2DIQA 2NUPA 4MZMA 2MCNA 3JCMX 2RK2A 1OU8A 2ZPGB 2D0QB 4AG1C 2KRSA 4OMNA 4QVZA 2L5QA 3NPFA 5IH2A 4M77C 2RQRA 5KE2A 1TXQA 5D6XA 2RA2A 1SG5A 3RKXA 5GAOq 4HCCA 1ZBJA 3L42A 4JRQA 3SEMA 3M5AA 1KSWA 5M9OA 2OAWA 3M56A 2X3XD 2CKKA 3QJ6A 2LQ8A 4M4ZA 2GBQA 5GANg 4FCYA 2ROLA 2CUDA 3QYGB 4OGCA 4DBHA 1NE8A 1H8KA 4UC4A 2F1LA 3JB9D 2KROA 4M7DC 1B3QA 1M27C 4E7SA 4M7AF 3MEVA 2PVGB 4M77A 3QHSA 1MHNA 4FU6A 4N0AC 5GAN8 2KT8A 3HSBA 1VIFA 4M78E 8AT1B 4LD9K 1JJ2P 2X4WA 3VS4A 5HKCA 1RADB 3M0RA 4ESRA 2RD1A 3JCMV 2J05A 1BK2A 3KFVA 3X20B 1B34B 3ZEHA 1Q81R 4J83A 4EDUA 1UE9A 1OQKA 4M7DA 5GJWB 4J7IA 2EIFA 1K8AU 3R6NA 1B7TA 3JB9H 4Z8AA 2GTOA 1QVFP 1VQMQ 4OMFB 5CCAA 1KQSP 4N0AA 3RNJA 2E70A 3MEAA 3I55A 4R55A 3OB9A 3OBWA 1TOVA 4MZTA 4M77D 1TS9A 2HQHA 3OYHA 1VQPA 2LNVA 3QO3A 1X6GA 1UGQB 1Q7YR 2DJZA 3A1PA 4KBMB 3OS2A 3TSZA 1VQMT 1Q82U 2LCSA 2GQVA 3OY9A 5FU6C 2OTLQ 2DD4A 2ZGWA 2LQWA 3HPWA 1SEMA 2LDMA 2QK0A 3HRTA 3QDRB 2EQMA 3HRSA 4M7DD 2O01E 4LDWA 4EMKA 4ZTFA 1XNIA 1HXDA 3PVQA 4BY6C 3GP8A 2LNHB 1MMNA 2OTLT 3G71Q 1WJQA 3V8KA 1QKWA 2L3PA 4J9GA 1WI7A 2MPXC 1YCSB 4HA8A 2HSPA 1T0JA 1UUEA 1YFNA 2RH2A 1K9MR 1MNDA 1PCXA 1WHMA 1JU5C 2PQWA 3DB4A 3G71T 5I2MA 5I11A 1R77A 1YBYA 2E41A 2HSEB 2WSFE 2FVUA 1VQMA 2FZKB 3EH2A 2IG0A 4IUUA 4JRKA 1NBEB 2DVJA 3CMAQ 4PJNA 4NS5A 1ZBXA 2GTJA 2ZPFB 2DD5A 1ZSZC 5FU7B 2KEAA 2NUTB 3LGFA 1IB8A 3CCMQ 1M30A 4FIBA 2KI7A 1K9MC 4M7AE 3CMAT 2X4YA 1D0XA 3PMIA 2OTLA 2RJFA 3A8MB 1AZGB 4DQ2A 3GNGA 2RO0A 1WHLA 3VUBA 4C8QG 3MCAB 2DJQA 4LD6A 2O9VA 2O88A 3CCQQ 3CCMT 1YCYA 2H8HA 2DL4A 3CCLQ 1M3BA 2YLCA 2JZ2A 6AT1B 1XTDA 4MMKA 2K5LA 2IPOB 4CI0C 4PFZA 5FW9A 1ZX6A 3UF4A 5GANh 2JW4A 1K0XA 4FL6A 5GJVB 1I07A 2JUFA 2G6FX 2CH4W 4E7KA 3CCQT 4IUQA 1UHFA 2DO3A 3HRUA 2KAFA 1QVPA 2YRDA 3CCLT 3CEYA 2LC4A 4IIMA 4F7UB 1VQNQ 1AOJA 2RB6A 3UDCA 2EKHA 4Y92A 4PJJA 3VS6A 1RAEB 2JJ9A 4XTWA 2A36A 2KVQG 3EHQA 2DEUA 3CMAA 1IREB 2JN0A 2QG9B 5J39A 4OGEA 4FT4A 2BIVA 4HCZA 1Y71A 1C1AA 1VQNT 4D6WA 1M90C 2R5AA 1UJ0A 4RCBA 2KGTA 2Y4YA 4C8QA 3CC7A 4Z02A 2K5IA 3L2UA 2QQBA 1QWEA 4B9XA 1NEGA 4GBQA 3UPUA 2QASA 4DOVA 1VQLQ 2F2XA 3EG0A 1OYXA 4PLLA 1IRXA 3VYGA 4DA4A 4JLGA 1AWXA 3OW2P 3X28B 2F5TX 2X4JA 2V1QA 1YJWA 3CCLA 3OYJA 9ATCB 2M0OA 2QA4Q 2DMOA 2HKNA 5CAIA 1CKBA 1Z9ZA 3Q1JA 4WTOB 3OYKA 1VQLT 1RI9A 4AG2C 1M8MA 2P4TA 3VUZA 3MO8A 2RQTA 2KXCA 1MUZA 5LL6S 4ELYC 2YUQA 3MJXA 1PD0A 2QA4T 2G3RA 1X27A 5GAMg 1AD5A 2MWOA 1W2BS 2RNAA 2EJFA 1D0YA 4IKFA 1FMVA 1BIBA 2HD0A 4PLIA 2F69A 1N27A 4IIOA 4BB7A 3CXCP 1IZ6A 3SFMA 1BB9A 4PJOG 2EQJA 1SF9A 3BDLA 3CCUQ 5IN1A 3FDRA 3EFRA 2QQ9A 5IHIA 2JOYA 1FX7A 1VQ5Q 1W2BA 2OTJQ 1YP5A 2E10A 1I4K1 5CR2A 2DERA 5KYXA 2F5KA 1QCFA 5DM7R 3FEOA 3TCJA 1K8AR 1QLYA 3M58A 2FB7A 2QQRA 2PUOB 2VC8A 3CCUT 4XTVA 2JTMA 4FM4B 1VQLA 1UEBA 1VQ5T 3M0UA 2OTJT 1GFCA 3JCMf 5D6WA 3NTHA 3VU3C 3PGGA 2CZ6B 2YLBA 4KGXB 3O5ZA 2P0KA 1SSFA 1WQWA 1Q7YU 1WYXA 4PFOA 4JLIA 4A4HA 2QDLA 2CP0A 3NMZC 4A4EA 1IXDA 4M75E 4CC4B 3VJPA 2RHIA 2XMFA 2KRNA 1OX8A 3QZ9B 5LJ3h 1XOVA 1X6OA 5LJ3j 3OYIA 4C0FA 1H3HA 1YN8A 3G1JA 2LJ1A 2DAQA 4M75B 4ZGEB 2DM1A 2LX9A 1TH7A 2EGAA 1G3SA 4E7LA 2DXBA 3JB9J 3CCUA 5LJ3e 2L3QA 4CC2A 4C92E 4M7AC 2XDBA 1VQ5A 3MKDA 2K57A 2OTJA 4WF2A 3CCRA 2RHZA 2CDTA 4F16A 3FRNA 5KYWB 4X1VA 1K9MU 4C0DB 4XAXB 1QVGS 3M0TA 1WJSA 4C92B 2K2VA 4F7UG 4HCKA 1BYMA 1I8FA 2VKNA 1M1FA 2FRWA 2CT3A 2E1HA 5CO7A 2Y4XA 2O31A 3RKYA 2BZYA 2FEIA 2HAXA 2BTTA 2DPPB 1KD1R 1QVGA 4ANJA 3OYLA 1QCNA 2ABLA 5FROA 4QW2A 2KBTA 2VUBA 1PC0A 4XQ3A 1PRLC 2DL5A 3PIPA 3EGXB 2GCXA 3JCMe 3H41A 2EGEA 2W0ZA 2A7YA 3JB9G 1UGVA 4V2SA 1PWTA 3RESA 3DB3A 4BUGA 2IVWA 5FRMA 1PD1A 2K3XA 2O4XB 2J06A 8ATCB 1M3CA 1D1CA 3MP8A 5LJ5h 3CCJQ 5LJ5j 2MYSA 2E5KA 1VIEA 3CCEQ 1KQ2A 2PZ1A 1N5ZA 1KD1C 1IHWA 3EG3A 1H92A 3UT1A 1YJ9Q 3TSWA 5CKBA 4N4IA 3M4YA 4HVVA 4YTLA 4F7UA 5LJ5e 5IT9E 2JM9A 1M90U 5CKFA 4PJMA 3CPWS 2LCLA 2DFUA 5GAMh 3CCJT 1LVKA 3CCET 4RMOA 4M7AD 2DLPA 2BZXA 5IXFA 1YJ9T 3SDZA 3BY7A 1UHCA 1ZHIA 4HCBA 4Z88A 2CGHA 3GBQA 3MPUB 4PFPA 2NWMA 2DX1A 4E7HA 1WNLA 3IQLA 1VQ4Q 3AT1B 4M77G 3PIOA 2RI2A 3BW1A 1Y7XA 2SEMA 3CC2Q 3QYHB 2PNIA 1PM3A 1N8RR 2FPDA 2HQXA 4BDYA 2E6ZA 3C0CA 3QJYA 1JRIA 3OYYA 5A2QE 4RCCA 2FYKA 1P92A 2KRMA 4PJOF 3FB9A 5HY6A 2OI3A 5GMKj 4A4KA 3RIRA 2E3HA 1QWFA 2R57A 1VQ4T 2O9SA 3CC2T 1TUDA 1BCMA 2D8JA 2K6DA 4XU2A 1O9SA 5GMKe 2E4HA 4M7DG 1VQ9Q 1FMWA 4ZGJB 3QWYA 1BKBA 3WVEB 2XIDA 1WHHA 4RTYA 2EYXA 3RKWA 1WHKA 3CCJA 1WXTA 1N8RC 3CCEA 5GAOp 3OYFA 2E64A 3J80E 2YUPA 4OF1A 3HTRA 2WSCE 3H9NA 1YJ9A 1JJ2S 4E2FB 3THKA 3E19A 1NPPA 2K3BA 1YNZA 1VQ9T 2VV5A 2YHTA 1QMCA 3OYCA 1NEBA 3VS1A 3HFOA 3L2WA 4IURA 1SKUB 3E2UA 1FYNA 3A98A 2COWA 4DBRA 4LE9A 2M9UA 1Z9QA 1NLOC 2V8JA 1WDXA 2ZZDA 1HSQA 1X43A 2GF7A 1JJ2A 1H641 1QVFS 1K76A 3CCVQ 2XU8A 1OPKA 1VQ4A 1TSFA 4M78B 3LLRA 5KCOA 2FG0A 4MMLA 1Q86C 2RHUA 5CK9A 3CC2A 1BIAA 1D1BA 2ED1A 2CP5A 4JDSA 4RG8A 2LQKA 2RN8A 5L23A 3CCVT 1QVFA 1KQSA 4RTXA 5CQXA 2KXDA 3VS7A 3PNWC 2CSQA 3LYIA 4M75C 3PT9A 2EJ9A 4KGZB 1EIFA 1DJ7B 3V8JA 2PVOB 1UTIA 7AT1B 1WIEA 4J5YA 2AZSA 3CMEQ 1VQ9A 2EPDA 4B6MA 1UFFA 4JZ3A 4J9CA 3GF5A 4C0DC 4F17A 1LPLA 4LDXA 2XI9A 2K9GA 4GY5A 4C92C 4FW2A 2L3SA 1Y96B 3UATA 1MV0B 2RJEA 3CC4Q 1IO6A 3AHUA 4JRPA 3OYNA 1MMGA 4C5IA 5EG2A 3CMET 1GRIA 3A8OB 4N4GA 1ZQ1A 2CS7A 2AKLA 1I81A 3R6OA 4M75A 1Y0MA 2HL5C 3A8HB 2YDLA 3EH1A 3GIBA 3MEWA 3CC4T 1R0CB 3FIFA 3RMSA 2VB6A 3CPFA 3M9QA 4KUIA 2CP2A 2GNCA 5KYWA 3L2RA 2LCCA 4PJOE 2BKDN 2AIRB 2D6FA 1H3ZA 2YRCA 2OJ2A 3VS2A 3OS0A 2DA9A 2VGMA 4E7IA 4KT0E 2E12A 1WZOA 2DETA 2FL7A 4LXCA 3RMQA 2RMOA 3QDFA 3EGUA 3LH5A 1NJIC 1ZUUA 4XTYA 2EYYA 3OMCA 1JXMA 4M75D 1JQQA 2B8AA 3EGXA 2P84A 3GNFB 1C6VX 1BU1A 1KD1U 3H8ZA 1PKSA 2M16A 3FLGA 4M77F 4PJLA 5A0DA 3I9QA 3LW5E 2Y90A 3CC4A 1RUWA 1U3OA 5IHNA 4E7JA 4C92D 4JJBA 2O4XA 1GXIE 1IHVA 2QGFB 4RUGA 4M7AB 4L6V5 4HT8A 4JS4A 2V1RA 4ZTJA 5LJ3g 2ZPIB 3HKSA 3QWXX 1IGQA 3G71A 1RACB 1EZZB 1ZSZA 1OU9A 2A37A 4M7DF 2LP5A 1YIJQ 5C6SA 4BD3A 4IUPA 3ULRB 4AFSC 1M90R 1QCOA 3OQ5A 1VQOQ 2XG8D 4FW1A 3VKIA 2KY9A 3PTAA 5GAN3 4C5EA 4ATOA 3PE0A 1EFNA 1G83A 4QT7A 2ZCFB 1YIJT 4RG2A 5FWCA 2GQIA 2DXTA 4ORZA 4J6YA 4JZ4A 1VQOT 1VQ7Q 2BUDA 1PKTA 3SWNB 3CD6Q 4MDWA 2C0TA 1GBRA 1AWJA 3OW2S 2KQWA 1WA7A 4ME7A 2RQWA 3JCMg 4ZGDB 1YITQ 1K1ZA 5GANd 2NLUA 2DL8A 1N8RU 4NL2A 2JMCA 3VS5A 3MEUA 3CCMA 3U23A 4XTUA 4QKUA 2QAZA 4J9IA 1KC8R 2X9HA 1VQ7T 3EHRA 3SB2A 3V7CA 5CKHA 5D7UA 3CD6T 1MMDA 4BDZA 3OW2A 1KQ1A 1RAHB 4M78C 1YITT 2RI3A 5EC7A 3CCQA 2YWWA 3M53A 2NUPB 1JO8A 5LJ5g 1MV3A 3H6ZA 3JAME 4R56A 1D09B 1QP3A 3CXCS 3VYHB 2DL7A 2KSSA 4FT2A 2JMAA 1KK7A 3JV3A 3URGA 1YIJA 1Q86U 4QQGA 4RTUA 2AHJB 3C95A 3OA6A 1KC8C 1AVZC 1U5SA 1FXXA 1I1JA 3RBBB 3M57A 1VQNA 1HD3A 1F1BB 4M78A 1C0MA 2CP6A 3CXCA 4KGVB 2LT4A 5KYYB 3V7SA 2QXFA 3MP1A 4C5GA 1OV3A 2QI2A 4AT1B 4XU1A 1B34A 3JCMP 3X26B 3PMTA 1UGRB 3A8LB 1M9SA 5IAYA 1AZEA 2R58A 2DTIA 2R5MA 3QSUA 1N6AA 1V1CA 1YITA 2HQEA 2EKOA 1M2OA 1QW1A 1ZA1B 1U06A 1PSFA 3CBOA 3L2VA 4XK8E 4JJCA 4TVRA 4X34A 4K11A 4BI3A 2L89A 3HP9A 2LTOA 3M4GA 4BI8B 1YHQQ 4F14A 1QKXA 2P0QA 3L2ZA 1Y96A 4NOYA 1D3BB 2KE9A 4C0ZA 1JXOA 4M7DE 4BACA 2A3LA 4M78D 2FPFA 3M59A 4L59A 4CC3A 2QA4A 4JS5A 3G6EQ 1AEYA 2QTXA 4PJOC 1M2VB 4GLMA 4O6JA 4OP0A 4R0KA 2EYWA 1M4ZA 5GAOn 3G7ZA 1GFDA 2ZPEB 1PSEA 2BZ8A 2CZ0B 1YHQT 5GAN2 1MGQA 2LVMA 4J6WA 3RUXA 3ER0A 4QVCA 1PNJA 1B07A 3G6ET 2RQVA 2DXUA 3MHXA 4FYYB 5GMKi 2DKGA 2QTVA 1NJIU 2DTHA 1NG2A 3EGDB 4C5HA 3DKMA 4C8QF 2EJGA 2JXBA 3I5RA 5IHKA 2YXYA 1N9SA 2NYSA 3OYDA 1UG1A 1S1NA 3VS3A 1CKAA 5ECAA 2KYBA 2CH4A 4X9DA 2O2OA 1RABB 1IGUA 2OX7A 3TU4K 2DK3A 4ELZC 5FLXE 2VXFA 2CYZB 3E9GA 1RAIB 1TG0A 2VWFA 2NUTA 5A0GA 1NYFA 3JRZA 2XICA 5GMKm 3G4SQ 3REBB 2HNIA 4J9DA 1X6BA 3JCMh 3TEEA 4ZN1A 1OZ2A 4EIKA 3G6EA 5CVIA 2JS2A 4BE2A 1G3WA 1I5OB 1NYGA 3I56Q 4RTWA 4M7AA 2AZVA 3S3NA 1W70A 4JPBW 3NGPA 4PJOD 1YJNQ 4E6RA 3G4ST 1K73C 3EG2A 2DE0X 3CBPA 1V29B 3GLXA 2H3JA 3SWNC 4JJDA 2DILA 3ME9A 5HCKA 3I56T 3KUFA 2M1HA 1T0HA 1VUBA 3CQTA 1YJNT 1MNEA 4FSSA 2RHYA 2EQUA 3D7SB 2DNUA 4A54A 3LX7A 3KXTA 1ARKA 2LT1A 2A0FB 2X4XA 5J26A 2QGGA 1K4US 2XHCA 1GCQC 3JCMb 3ZBDA 1M1KR 3QIIA 1G3TA 3S3MA 4Z89A 2RI5A 4VUBA 4QQDA 1ZLMA 1E7OA 3L1AA 2LJ0A 2MIOA 5GMKl 5J3BA 1QQJA 3NFCA 2GGRA 4JRIA 4KH0B 3SWNA 4A4FA 1LJOA 1NZ9A 2DRKA 3OS5A 4J6XA 2E6NA 2K4YA 5DY9A 1UDLA 3QBYA 1SSHA 1WXBA 3C12A 3G4SA 3EG9B 2K3YA 4OMQA 1OULA 3OYEA 4LDYA 2KT1A 4Y28E 1GL5A 2CUBA 5HK0A 1M1KC 1HK9A 1OEBA 4D8DA 5GAN7 3GPLA 1T3SA 1X2QA 5GMKh 5GAN4 3FJPA 1RLPC 4DBQA 1VQ6Q 1YJNA 4XTZA 1ZUYA 4OB2B 1KC8U 2EWNA 3LWIA 2RF0A 1OZ3A 2XKOC 3OS1A 4J9BA 4E47A 4IUTA 3CPWP 2LX7A 1VYTA 2XDPA 4C8QE 1ZA2B 3P8HA 5CKEA 3QXEB 5FRNA 4Q5WA 2CZ7B 4EMGA 3C4SA 5GAOm 1VQ6T 3WVDB 4FSXA 1Q86R 3I55Q 3M0QA 1D1AA 4C8QB 2ROTA 2DRMA 1UECA 3HHTB 1SPKA 2C0IA 3GOXA 2JS0A 3T9NA 1VQPQ 1BCOA 2EW3A 2OAUA 5KYYA 3P8DA 4OB0B 4OB1B 3S6WA 4II1A 2I2LA 1WHGA 3I55T 2F2VA 2LRQA 1OX9A 3V8LA 1OPLA 2AK5A 2JTEA 1KQSS 2GFUA 3EFSA 1VQPT 1FMKA 1U8RA 4M75G 2GFAA 2VVKA 1W4SA 4J7FA
chains in the Genus database with same CATH topology
2O4XA 4PKCC 4BB7A 1GXIE 1IZ6A 3SFMA 4PJOG 3QUIA 2EQKA 2PUKB 4XTXA 4M7AB 2EQJA 3BDLA 3OYBA 1BI0A 2JVVA 4L6V5 4ZN3A 5IN1A 4HT8A 3FDRA 3O8VA 1QP2A 4X9CA 3EFRA 4JS4A 5KH6A 3JB9I 2QQ9A 4ZTJA 2JOYA 1FX7A 3NTKA 3VV0A 5LJ3g 4JUVA 2PVDB 4A53A 1W2BA 2ZPIB 3JCMd 2E10A 1VQ6A 1I4K1 3V7RA 5CR2A 3HKSA 1D3BA 4C92G 2F5KA 5DM7R 3L2QA 2P0PA 3G71A 3FEOA 3TCJA 3QKJA 3TREA 5GAOl 2MMPA 3M58A 2FB7A 1UB4A 1X01A 4M7DF 3UWNA 1UGSB 4PL6A 3A5ZB 2QQRA 5C6SA 1LOJA 2PUOB 4BD3A 1I5LA 4IUPA 2VC8A 3CCUT 1JB0E 3OSVA 4KULA 1M1GA 4XTVA 2E5QA 2JTMA 1G3YA 3OQ5A 2V8IA 4FM4B 2XG8D 3M54A 1NPRA 4F7UF 2RJDA 1VQLA 1UEBA 3VKIA 2KY9A 1BI3A 3PTAA 1VQ5T 2L3RA 5GAN3 2OTJT 4C5EA 2RM4A 4EMKC 3F70A 3JCMf 5I21A 5D6WA 3NTHA 4ATOA 3VU3C 3PGGA 2CZ6B 2YLBA 2P0KA 2ZPBB 3CCSA 2ZCFB 2QQSA 4C0GA 1YIJT 3QPHA 4RG2A 1SSFA 5LJ5d 2DXTA 1WQWA 5GAMj 2QDYB 2DTOA 1Q7YU 3QZ5B 4JJNK 4J6YA 1VQOT 4B9WA 2BUDA 3HFNA 3ZFJA 4A4GA 3SWNB 4MDWA 1VQ8T 3I56A 3JCMc 4JLIA 4A4HA 3OW2S 2KQWA 4ME7A 5GAMe 3JCMg 4A4EA 4ZGDB 1UGPB 5GANd 1Q81C 2NLUA 3JCMW 1O75A 1N8RU 3E9FA 3JB9F 4NL2A 4HKEA 1LNXA 3DLMA 3MEUA 1OI1A 4M75E 3CCMA 3CPWA 2RHXA 3VJPA 5GAMd 4NL3A 2RHIA 3CCVA 4XTUA 4BE0A 3S3OA 2DIQA 3QZ9B 2JTFA 4J8OA 5LJ3h 1XOVA 1X6OA 4MZMA 5LJ3j 2DZCA 1VQ7T 3SB2A 3OYIA 4C0FA 3JCMX 2RK2A 3V7CA 5CKHA 2ZPGB 4C92A 3CD6T 4OB3B 2DAQA 2D0QB 4M75B 4ZGEB 2LX9A 4QVZA 1TH7A 4EMHA 1KQ1A 1G3SA 2L5QA 4M78C 4BDZA 3OW2A 4E7LA 2DXBA 2VGNA 3JB9J 3CCUA 5LJ3e 2RI3A 4M77C 5KE2A 4PJOB 3CCQA 4C92E 5GANf 5DLQE 4M7AC 1Q7YC 3M53A 1VQ5A 5D6XA 2XDBA 2K57A 2RA2A 4WF2A 3CCRA 2RHZA 2OTJA 4PNOA 1K73U 3FRNA 5LJ5g 3ASKA 1WGSA 3H6ZA 3RKXA 3JAME 1K9MU 4C0DB 5GAOq 4XAXB 4R56A 1QVGS 4HCCA 4HT9A 1WJSA 1KHIA 1QP3A 3L42A 3CXCS 4JRQA 4BE1A 3M5AA 3VYHB 4C92B 2KSSA 4FT2A 5M9OA 2K2VA 3M56A 3URGA 4F7UG 1Q86U 1YIJA 2CKKA 3QJ6A 4QQGA 2LQ8A 2AHJB 2QQAA 3C95A 3CMEA 1BYMA 1I8FA 4L5GA 3OA6A 1KC8C 1M1FA 2C06A 4Y91A 1FXXA 5GANg 5CIUA 2E1HA 2DVEA 5CO7A 2Y4XA 3QYGB 4OGCA 3RKYA 4DOWA 1VQ8A 3M57A 1NE8A 4UC4A 4OVAA 3JB9D 2RJCA 4M7DC 2HAXA 2DPPB 1VQNA 1QVGA 3OYLA 4M78A 3CXCA 4M7AF 3MEVA 2PVGB 5FROA 2LT4A 4QW2A 2VUBA 3JSCA 4M77A 3QHSA 2QEXT 3V7SA 1MHNA 2QXFA 4XQ3A 3MP1A 4FU6A 4C5GA 2QI2A 4N0AC 5GAN8 4XU1A 1B34A 2K5FA 3PIPA 3HSBA 3JCMP 3X26B 3PMTA 1UGRB 2GCXA 1VIFA 3A8LB 1M9SA 4M78E 5GAOr 5IAYA 3JCMe 1G5VA 2R58A 2DTIA 2R5MA 2A7YA 3JB9G 4EPCA 4LD9K 3QSUA 4V2SA 5GAN6 4IUVA 1N6AA 3JCMJ 1YITA 3RESA 3DB3A 2HQEA 2X4WA 2EKOA 4BUGA 5HKCA 1QW1A 2IVWA 5FRMA 3LH0A 1R8OB 1PSFA 2K3XA 2O4XB 2RD1A 3CBOA 4XK8E 3JCMV 2XDDA 3L2VA 2WSEE 3X20B 4TVRA 1B34B 3ZEHA 3MP8A 5LJ5h 4X34A 4J83A 5LJ5j 1VIEA 4EDUA 1KQ2A 4BI3A 1KD1C 3CC7T 2L89A 1YITT 4M7DA 1YI2T 3HP9A 3UT1A 2LTOA 3M4GA 4J7IA 4BI8B 4MZPA 4N4HA 2EIFA 3OBYA 5CKBA 1K8AU 1RI0A 1M1KU 3JB9H 4N4IA 3M4YA 4F7UA 4YTLA 2P0QA 3L2ZA 1Y96A 4NOYA 4OMFB 5CCAA 1D3BB 4N0AA 1FWZA 4C0ZA 2E70A 3MEAA 2MI6A 5LJ5e 3I55A 4M7DE 5IT9E 1M5Q1 4BACA 2A3LA 2HBPA 4M78D 4R55A 1M90U 5CKFA 3M59A 5GANj 3OB9A 4L59A 3OBWA 4MZTA 3CPWS 3J7AF 2QA4A 4M77D 2LCLA 4JS5A 2QTXA 4PJOC 2XK0A 5GAMh 3JCMQ 3CCJT 3P8BB 4F7UE 4O6JA 4OP0A 4C8QC 5CKDA 3E1SA 4RMOA 3CCET 3OYHA 1VQPA 4M7AD 1M4ZA 5GAOn 2LNVA 3G7ZA 1YJWT 3QO3A 2ZPEB 1YJ9T 1PSEA 3BY7A 3SDZA 1UGQB 2DJZA 4HCBA 1ZHIA 2CZ0B 1YHQT 5GANe 2QEXA 5GAN2 2CGHA 1MGQA 4KBMB 3OS2A 1VQMT 2LVMA 4E7HA 1Q82U 3META 4J6WA 1BI1A 1WNLA 4M78G 2GQVA 3OY9A 3RUXA 3ER0A 2RK1A 2VYTA 4M77G 3QG1A 4QVCA 3PIOA 2RI2A 5FU6C 3BW1A 3G6ET 1Y7XA 2DD4A 2DZ9A 2ZGWA 4LDVA 2DXUA 3MHXA 3QYHB 1KHCA 4M75F 5GMKi 3HPWA 2HQXA 2DKGA 2LDMA 2E6ZA 4BDYA 1NJIU 3QJYA 1JRIA 3HRTA 3OYYA 5A2QE 2DTHA 3QDRB 2EQMA 2FYKA 4RCCA 3BDUA 3HRSA 3OSSC 5DLOA 1P92A 4M7DD 4PJOF 2O01E 4LDWA 4EMKA 4C5HA 4ZTFA 3FB9A 1XNIA 1HXDA 2JNGA 5HY6A 3DKMA 3OYGA 4C8QF 4BY6C 5GMKj 2EJGA 4A4KA 3RIRA 2XD0A 1WJRA 2R57A 1VQ4T 2FHDA 3GP8A 3KBGA 3LGLA 2OTLT 1N9SA 1WJQA 3OYDA 3V8KA 1YI2A 3CC2T 4XU0A 4C92F 4X9DA 1N9RA 4XU2A 1O9SA 3OYMA 1U1TA 1XQHA 5GMKe 4HA8A 4M7DG 4BI4A 4ZGJB 5KCHA 3TU4K 2DK3A 5CQYA 1BKBA 4LDUA 4ELZC 3WVEB 2XIDA 3HL8A 2RH2A 5FLXE 2VXFA 3C94A 2CYZB 3RKWA 3CCJA 1N8RC 3CCEA 5GAOp 3OYFA 1Y07A 2E64A 2PQWA 3DB4A 3G71T 3E9GA 1VQOA 5D6YA 5I2MA 5A0GA 3J80E 4OF1A 4CRIA 1YBYA 5A0LA 1BI2A 2WSCE 1YJ9A 1JJ2S 2E41A 1M8VA 3JRZA 2XICA 5GMKm 2WSFE 3E19A 2HNIA 1NPPA 2FVUA 1VQMA 5AYFA 1VQ9T 3OYAA 2VV5A 2IG0A 2YHTA 3OYCA 3A8GB 4IUUA 4JRKA 3JCMh 3TEEA 4ZN1A 3HFOA 1OZ2A 3L2WA 4IURA 4RKUE 4NS5A 1ZBXA 5CVIA 3G6EA 2PU9B 1G3WA 4BE2A 2M9UA 4M7AA 2ZPFB 2V8JA 3LWHA 3S3NA 2DD5A 1VQ7A 2ZZDA 5FU7B 4PJOD 2E65A 3OMGA 2MWPA 3MP6A 3LGFA 3X24B 2GF7A 4C8QD 1S72T 3G4ST 1JJ2A 4M77E 3CD6A 1H641 1K73C 1QVFS 4FIBA 2KK4A 1K9MC 5LJ3f 3CBPA 4GLKA 1V29B 2XU8A 4M7AE 3GLXA 3CMAT 2H3JA 2X4YA 1VQ4A 3SWNC 3PMIA 4M78B 2OTLA 3LLRA 1RL2A 5KCOA 4MMLA 1Q86C 2RHUA 5CK9A 2RJFA 3CC2A 3ME9A 4M77B 3A8MB 3X25B 3I56T 3KUFA 4XU3A 1KG1A 1BIAA 4DQ2A 1AHJB 3GNGA 2RO0A 2M1HA 4JDSA 3VUBA 1VUBA 4C8QG 3MCAB 1YJNT 4LD6A 4RG8A 2KMTA 2RHYA 2LQKA 2EQUA 2X35A 3CCMT 1YCYA 4A54A 3LX7A 3CCVT 1QVFA 2YLCA 1KQSA 5CQXA 2JZ2A 3KXTA 1XTDA 2DIGA 2LT1A 3PNWC 4M75C 3LYIA 4MMKA 2K5LA 3PT9A 3EAEA 5KE3A 2X4XA 5J26A 4CI0C 2EJ9A 2XHCA 3JCMb 1EIFA 3ZBDA 5GANh 1DJ7B 1G3TA 3QIIA 3V8JA 3S3MA 1Q81U 2RI5A 4O5VA 4VUBA 1U1SA 4QQDA 2PVOB 4FL6A 3L1AA 4J5YA 1VQ9A 2JUFA 5GMKl 2EAYA 5J3BA 4E7KA 3CCQT 4IUQA 2DO3A 3HRUA 3NFCA 4M7DB 2KAFA 1QVPA 3CCLT 4JRIA 3SWNA 4QQ6A 4A4FA 3GF5A 3CCRT 1LJOA 4C0DC 1NZ9A 3OS5A 4QVDA 4J6XA 4LDXA 3CEYA 2LC4A 2E6NA 2XI9A 2K4YA 4GY5A 5DY9A 4C92C 4F7UB 5C0MA 3QBYA 1Y96B 2RB6A 3UDCA 2RJEA 3RERA 3AHUA 1WPYA 4JRPA 3OYNA 3C12A 3G4SA 1S72A 4XTWA 4C5IA 2K3YA 5EG2A 4M7AG 3CMET 2KVQG 4LDYA 3OYEA 3A8OB 2L8DA 2D9TA 3CMAA 4N4GA 1ZQ1A 2CS7A 1IREB 2JN0A 3BFMA 5J39A 4Y28E 3M55A 4OGEA 1I81A 4FT4A 3FC3A 2BIVA 3R6OA 4HCZA 4M75A 1K8AC 1Y71A 5HK0A 1M1KC 1VQKT 1HK9A 3SD4A 3GPLA 5GAN7 1WQ7A 3A8HB 3INZA 5GMKh 5GAN4 3FJPA 1VQNT 3GIBA 2WACA 3MEWA 4D6WA 1M90C 2R5AA 4PJOA 4RCBA 3CC4T 4XTZA 1YJNA 2Y4YA 2ZPHB 4OB2B 1KC8U 4C8QA 3CC7A 3FIFA 2EWNA 3DLLA 4Z02A 2K5IA 3L2UA 3LWIA 3RMSA 2QQBA 4B9XA 1OZ3A 2XKOC 3CPFA 5FU7C 5L8RE 3M9QA 4KUIA 3OS1A 3UPUA 4E47A 2V8KA 4IUTA 5LJ5f 3L2RA 2LCCA 3CBMA 3WXMB 2MAMA 4PJOE 2XDPA 2BKDN 2D6FA 1H3ZA 4C8QE 4DOVA 2VXEA 2DXCA 1OYXA 3P8HA 3QXEB 5CKEA 4EMKB 4PLLA 1Q82C 4Q5WA 3OS0A 5FRNA 2CZ7B 4EMGA 2VGMA 3C4SA 2MF2A 5GAOm 1VQ6T 4E7IA 4KT0E 2E12A 3PFSA 3VYGA 3WVDB 4DA4A 4JLGA 4FSXA 2FL7A 3RMQA 3X28B 2F5TX 2X4JA 4C8QB 1YJWA 3CCLA 5HK3A 3OYJA 5LJ3d 1YHQA 2M0OA 3HHTB 1NJIC 5GAMf 4P5NA 3GOXA 3T9NA 5CAIA 4XTYA 2CZ1B 3Q1JA 3OYKA 4KUDK 1VQLT 3OMCA 2OAUA 3P8DA 4M75D 4OB0B 2P4TA 2EFIA 3VUZA 4OB1B 3S6WA 3MO8A 4II1A 5FU6B 2I2LA 2B8AA 3I55T 3N5BB 5GAN5 3GNFB 5LL6S 4ELYC 2LRQA 2YRVA 3V8LA 3CCST 1JBMA 2G3RA 2QA4T 1KD1U 3H8ZA 4M78F 1VQKA 5GAMg 2M16A 3FLGA 2MWOA 3NTIA 1KQSS 2GFUA 1W2BS 4M77F 2EJFA 3EFSA 5A0DA 1VQPT 2KDSA 2EYQA 1U8RA 3LW5E 4IKFA 2Y90A 5I2SA 4M75G 1BIBA 4BY6B 3CC4A 2GFAA 2HD0A 4PLIA 1X75C 2F69A 4E7JA 1W4SA 2DEQA 3J81E 1N27A 4MDXA 4C92D 4J7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O4X A;  4BE1 A;  2EQM A;  5M9O A;  4E7K A;  2EQK A;  2CKK A;  4IUQ A;  3QJ6 A;  4QQG A;  2EQJ A;  3BDL A;  4C5H A;  3OYB A;  1XNI A;  3OYG A;  4ZTF A;  5IN1 A;  3OA6 A;  3FDR A;  4QQ6 A;  3O8V A;  4A4F A;  5KH6 A;  1WJR A;  2R57 A;  4ZTJ A;  2FHD A;  5CIU A;  3CEY A;  2E6N A;  4GY5 A;  3LGL A;  3NTK A;  5C0M A;  3QBY A;  1WJQ A;  3OYD A;  2RJE A;  4UC4 A;  4OVA A;  2F5K A;  3L2Q A;  2RJC A;  3FEO A;  3OYN A;  3QKJ A;  3OYM A;  4C5I A;  2K3Y A;  3OYL A;  3OYE A;  3MEV A;  2L8D A;  5FRO A;  3UWN A;  4QW2 A;  4PL6 A;  5KCH A;  2D9T A;  4BDY A;  4N4G A;  2QQR A;  5C6S A;  1MHN A;  4BD3 A;  5J39 A;  4IUP A;  3MP1 A;  4FU6 A;  4C5G A;  3FC3 A;  2BIV A;  2E5Q A;  4HCZ A;  3OQ5 A;  3PMT A;  2RJD A;  3SD4 A;  5IAY A;  3OYF A;  1G5V A;  2PQW A;  2R58 A;  3DB4 A;  2L3R A;  3E9G A;  2R5M A;  5D6Y A;  4C5E A;  2WAC A;  3MEW A;  4CRI A;  2R5A A;  4IUV A;  3F70 A;  5D6W A;  3NTH A;  3DB3 A;  2HQE A;  4Z02 A;  2X4W A;  2EKO A;  3L2U A;  4B9X A;  1OZ3 A;  3OYA A;  2IG0 A;  2P0K A;  3OS1 A;  3M9Q A;  2QQS A;  3OYC A;  3LH0 A;  4IUU A;  5FRM A;  4IUT A;  4RG2 A;  1SSF A;  3L2R A;  2LCC A;  2O4X B;  1OZ2 A;  2K3X A;  3L2V A;  2XDP A;  3L2W A;  2BKD N;  4IUR A;  4NS5 A;  1H3Z A;  4BE2 A;  4B9W A;  3ZEH A;  2BUD A;  1OYX A;  3MP8 A;  3P8H A;  4X34 A;  5FRN A;  4PLL A;  4Q5W A;  3OS0 A;  4EDU A;  3S3N A;  2L89 A;  3C4S A;  4A4G A;  4E7I A;  3UT1 A;  3OMG A;  2MWP A;  3MP6 A;  3LGF A;  2LTO A;  3PFS A;  4A4H A;  2GF7 A;  4N4H A;  4A4E A;  1RI0 A;  2NLU A;  4N4I A;  3E9F A;  3OYJ A;  3DLM A;  3MEU A;  1OI1 A;  2M0O A;  3MEA A;  2RHX A;  2X4Y A;  4BAC A;  3GOX A;  2RHI A;  4BE0 A;  3S3O A;  3OB9 A;  2DIQ A;  3PMI A;  2JTF A;  3LLR A;  4L59 A;  5KCO A;  1WJS A;  3Q1J A;  2RHU A;  3OYK A;  2RJF A;  2XK0 A;  3ME9 A;  3OMC A;  3OYI A;  3KUF A;  3P8D A;  3OYH A;  2EFI A;  2RO0 A;  2M1H A;  3S6W A;  2DAQ A;  3MO8 A;  4II1 A;  4LD6 A;  2RHY A;  2EQU A;  2B8A A;  4QVZ A;  4BDZ A;  2X35 A;  4E7L A;  3LX7 A;  2LRQ A;  3OS2 A;  2YRV A;  2LVM A;  4E7H A;  2RI3 A;  5KE2 A;  3MET A;  4QQD A;  2G3R A;  3OY9 A;  3H8Z A;  2JZ2 A;  2DIG A;  2M16 A;  2MWO A;  2VYT A;  3FLG A;  3NTI A;  2GFU A;  2RI2 A;  3LYI A;  3PNW C;  5D6X A;  3EAE A;  5KE3 A;  2X4X A;  5J26 A;  2RHZ A;  4IKF A;  3QII A;  3ASK A;  1KHC A;  1WGS A;  2GFA A;  3H6Z A;  2RI5 A;  4PLI A;  4E7J A;  3S3M A;  1N27 A;  2HQX A;  2LDM A;  3L42 A;  4FL6 A; 
#chains in the Genus database with same CATH topology
 2JT4 A;  2EQK A;  3OYB A;  1BI0 A;  3TVT A;  2CRE A;  2ECZ A;  4X9C A;  5KH6 A;  1BBZ A;  1W6X A;  2JM8 A;  2COY A;  3NTK A;  3VV0 A;  4JUV A;  2C0O A;  4FYV B;  1VQ6 A;  3V7R A;  1D3B A;  4C92 G;  2COZ A;  4LN2 A;  2P0P A;  5GAO l;  2K79 A;  3SHW A;  2HKQ B;  1UB4 A;  1X01 A;  3I35 A;  2A28 A;  1M2V A;  1UGS B;  3A5Z B;  4PL6 A;  2K2M A;  1JB0 E;  1UJY A;  1M1G A;  4F7U F;  3M54 A;  1VA7 A;  1BI3 A;  2K7A A;  2L3R A;  1VQ8 Q;  1VYV A;  2CSI A;  5KYX B;  4EMK C;  3F70 A;  5I21 A;  3NHN A;  2EQI A;  2QQS A;  3QPH A;  3EFO B;  2HMA A;  4JJN K;  4J9H A;  1W1F A;  3EGD A;  3ZFJ A;  1VQ8 T;  5KYU B;  1NJI R;  1AWW A;  3JCM c;  1TWB A;  1WXU A;  1M3A A;  1UGP B;  1Q81 C;  3JCM W;  4RTZ A;  1O75 A;  3JB9 F;  2D8H A;  3E9F A;  4HKE A;  1LNX A;  3DLM A;  1RAG B;  2NUZ A;  2RHX A;  3CCV A;  4BE0 A;  3S3O A;  2SRC A;  4J8O A;  4E7Z A;  2JTF A;  2DL3 A;  2DZC A;  1PG5 B;  3TQ7 P;  4OMP A;  4C92 A;  4OB3 B;  1KIK A;  1E6H A;  4EMH A;  2VGN A;  4PJO B;  4J9F A;  3UA6 A;  3RR6 A;  1I0C A;  3EG1 A;  5GAN f;  5DLQ E;  1Q7Y C;  4ZNX A;  2X51 A;  4PNO A;  1K73 U;  2J7I A;  2LQN A;  1WGS A;  3ASK A;  2L0A A;  4AFU C;  4FYW B;  4HT9 A;  1KHI A;  4DEX A;  4BE1 A;  1LCK A;  2RPN A;  2QEX Q;  2QQA A;  3CME A;  5IXB A;  4L5G A;  2FPE A;  4DBF A;  2C06 A;  4Y91 A;  2AKK A;  5CIU A;  2FZG B;  4RTV A;  2DVE A;  1NM7 A;  4DOW A;  1VQ8 A;  2BE7 D;  4OVA A;  2RJC A;  1YWP A;  4A63 B;  3JSC A;  2QEX T;  1MMA A;  2K5F A;  5GAO r;  2ZAE A;  1G5V A;  4WCI A;  3CC7 Q;  1YI2 Q;  1PRM C;  4EPC A;  5GAN 6;  4IUV A;  3JCM J;  4HXJ A;  2QYZ A;  3LH0 A;  1R8O B;  1KJW A;  2XDD A;  2WSE E;  1VYU A;  5KYN A;  3CC7 T;  1YI2 T;  1YJW Q;  4MZP A;  4N4H A;  3OBY A;  1RI0 A;  1M1K U;  1JEG A;  2YT6 A;  3H0F A;  1FWZ A;  2MI6 A;  1M5Q 1;  3I5S A;  2HBP A;  5GAN j;  2HZY A;  3EG9 A;  3J7A F;  1WHJ A;  2XK0 A;  3JCM Q;  3P8B B;  4KRT A;  4F7U E;  5CKD A;  4C8Q C;  3E1S A;  3REA B;  1YJW T;  4LUD A;  2J6F A;  5GAN e;  2QEX A;  2FRY A;  2J6K A;  2KNB B;  2D0N A;  3MET A;  1BI1 A;  4M78 G;  1ABQ A;  2M02 A;  2RK1 A;  2VYT A;  2LMJ A;  3QG1 A;  1TUC A;  1GCP A;  4LDV A;  2DZ9 A;  1TU0 B;  1KHC A;  4M75 F;  2V26 A;  2F2W A;  2FO0 A;  3BDU A;  3OSS C;  5DLO A;  2JNG A;  3OYG A;  4HVW A;  1T3L A;  2DBM A;  2A08 A;  2AT1 B;  1WX6 A;  2XD0 A;  1WJR A;  2FHD A;  2EGC A;  3KBG A;  3LGL A;  4HVU A;  1YI2 A;  4XU0 A;  2HDA A;  4C92 F;  2MOX A;  1ZUK A;  1N9R A;  3H0I A;  3OYM A;  4AMC A;  1U1T A;  1XQH A;  4BI4 A;  2H3E B;  1X69 A;  5KCH A;  5CQY A;  2ATC B;  4LDU A;  2L2P A;  3HL8 A;  3C94 A;  3ZL7 C;  2KYM A;  1RLQ C;  1Y07 A;  3BE3 A;  1VQO A;  5D6Y A;  4CRI A;  5A0L A;  1BI2 A;  1V76 A;  1GBQ A;  2DYB A;  1S72 Q;  5FWB A;  4AFZ C;  3VS0 A;  5AYF A;  3OYA A;  3A8G B;  2D1X A;  2DYI A;  4RKU E;  1AT1 B;  2PU9 B;  1HJD A;  2VAS A;  3LWH A;  1VQ7 A;  1J3T A;  4OML A;  1SHF A;  2E65 A;  3OMG A;  2MWP A;  3MP6 A;  3X24 B;  4C8Q D;  1S72 T;  3CD6 A;  4M77 E;  2KK4 A;  1SHG A;  1XJW B;  5LJ3 f;  4GLK A;  3RDV A;  1EX4 A;  1RL2 A;  2RQU A;  4M77 B;  3X25 B;  1KG1 A;  4XU3 A;  1WFW A;  1AHJ B;  2HL3 A;  2ED0 A;  2KMT A;  1OOT A;  3VRZ A;  3VRY A;  2X35 A;  4KH1 B;  1ACM B;  1K9A A;  4LUE A;  3CCR Q;  1R0B G;  2ENM A;  2DIG A;  1Q95 G;  1WLP B;  5KE3 A;  2EVR A;  3EAE A;  1W2B P;  1Q81 U;  2EYZ A;  2YUO A;  1M8V A;  4O5V A;  1U1S A;  3EFO A;  2CP7 A;  2EAY A;  3UA7 A;  1ZSG A;  4J9E A;  4M7D B;  4QQ6 A;  5KYU A;  4LNP A;  3CCR T;  4QVD A;  1VQK Q;  2HBW A;  5C0M A;  2LJ3 A;  1AWO A;  4OMO A;  3RER A;  1WPY A;  1Q82 R;  1S72 A;  4F04 B;  4M7A G;  2L8D A;  2D9T A;  3BFM A;  1G2B A;  3M55 A;  3FC3 A;  1K8A C;  1SRL A;  2LZ6 B;  1VQK T;  3SD4 A;  1WQ7 A;  2IIM A;  3INZ A;  2WAC A;  4PJO A;  1CSK A;  1SRM A;  2ZPH B;  3DLL A;  5FU7 C;  2PTK A;  5L8R E;  4D8K A;  2V8K A;  5LJ5 f;  3CBM A;  3WXM B;  2MAM A;  4DEY A;  1HYO A;  2P4R A;  2VXE A;  2DXC A;  1K73 R;  4EMK B;  1Q82 C;  1E6G A;  2MF2 A;  3PFS A;  2E3I A;  3H0H A;  1Y57 A;  5AT1 B;  2J6O A;  2HEQ A;  5HK3 A;  5LJ3 d;  1YHQ A;  3CCS Q;  5GAM f;  4P5N A;  2FZC B;  2CZ1 B;  1KFZ A;  4KUD K;  2CT4 A;  2EFI A;  1D0Z A;  5FU6 B;  3M0P A;  3N5B B;  5GAN 5;  2YRV A;  2B86 A;  4CC7 A;  3CCS T;  1JBM A;  3M0S A;  1NLP C;  4M78 F;  1VQK A;  4RTT A;  2M51 A;  1TTH B;  3NTI A;  2KDS A;  2EYQ A;  1PHT A;  2W10 A;  2YUN A;  5I2S A;  4BY6 B;  3PVL A;  1VOM A;  1X75 C;  4MDX A;  2DEQ A;  3J81 E;  2DF6 A;  1QVG P;  2BE9 B;  4PKC C;  1TUG B;  3QUI A;  2PUK B;  1YWO A;  4XTX A;  2X3W D;  2JVV A;  1K0S A;  4ZN3 A;  3O8V A;  1QP2 A;  2EBP A;  5I22 A;  3JB9 I;  1X2K A;  4AFQ C;  2YSQ A;  4OMM A;  2PVD B;  4A53 A;  3JCM d;  3L2Q A;  3TRE A;  3QKJ A;  2HCK A;  2M0Y A;  1RAF B;  2DBK A;  2MMP A;  2Z0W A;  3UWN A;  1LOJ A;  1I5L A;  3OSV A;  4KUL A;  2E5Q A;  1G3Y A;  2V8I A;  1NPR A;  2RJD A;  2I0N A;  2RM4 A;  1RAA B;  4PK4 A;  3FJ5 A;  2ESW A;  1A0N B;  2ZPB B;  1ZSZ B;  4C0G A;  3CCS A;  1ABO A;  5LJ5 d;  1G8X A;  5GAM j;  2QDY B;  2DTO A;  3QZ5 B;  4B9W A;  3HFN A;  4A4G A;  3I56 A;  2KR3 A;  1GCQ A;  5GAM e;  2CP3 A;  4FYX B;  2MK5 A;  1OI1 A;  3CPW A;  4NL3 A;  5GAM d;  2DIQ A;  2NUP A;  4MZM A;  2MCN A;  3JCM X;  2RK2 A;  1OU8 A;  2ZPG B;  2D0Q B;  4AG1 C;  2KRS A;  4OMN A;  4QVZ A;  2L5Q A;  3NPF A;  5IH2 A;  4M77 C;  2RQR A;  5KE2 A;  1TXQ A;  5D6X A;  2RA2 A;  1SG5 A;  3RKX A;  5GAO q;  4HCC A;  1ZBJ A;  3L42 A;  4JRQ A;  3SEM A;  3M5A A;  1KSW A;  5M9O A;  2OAW A;  3M56 A;  2X3X D;  2CKK A;  3QJ6 A;  2LQ8 A;  4M4Z A;  2GBQ A;  5GAN g;  4FCY A;  2ROL A;  2CUD A;  3QYG B;  4OGC A;  4DBH A;  1NE8 A;  1H8K A;  4UC4 A;  2F1L A;  3JB9 D;  2KRO A;  4M7D C;  1B3Q A;  1M27 C;  4E7S A;  4M7A F;  3MEV A;  2PVG B;  4M77 A;  3QHS A;  1MHN A;  4FU6 A;  4N0A C;  5GAN 8;  2KT8 A;  3HSB A;  1VIF A;  4M78 E;  8AT1 B;  4LD9 K;  1JJ2 P;  2X4W A;  3VS4 A;  5HKC A;  1RAD B;  3M0R A;  4ESR A;  2RD1 A;  3JCM V;  2J05 A;  1BK2 A;  3KFV A;  3X20 B;  1B34 B;  3ZEH A;  1Q81 R;  4J83 A;  4EDU A;  1UE9 A;  1OQK A;  4M7D A;  5GJW B;  4J7I A;  2EIF A;  1K8A U;  3R6N A;  1B7T A;  3JB9 H;  4Z8A A;  2GTO A;  1QVF P;  1VQM Q;  4OMF B;  5CCA A;  1KQS P;  4N0A A;  3RNJ A;  2E70 A;  3MEA A;  3I55 A;  4R55 A;  3OB9 A;  3OBW A;  1TOV A;  4MZT A;  4M77 D;  1TS9 A;  2HQH A;  3OYH A;  1VQP A;  2LNV A;  3QO3 A;  1X6G A;  1UGQ B;  1Q7Y R;  2DJZ A;  3A1P A;  4KBM B;  3OS2 A;  3TSZ A;  1VQM T;  1Q82 U;  2LCS A;  2GQV A;  3OY9 A;  5FU6 C;  2OTL Q;  2DD4 A;  2ZGW A;  2LQW A;  3HPW A;  1SEM A;  2LDM A;  2QK0 A;  3HRT A;  3QDR B;  2EQM A;  3HRS A;  4M7D D;  2O01 E;  4LDW A;  4EMK A;  4ZTF A;  1XNI A;  1HXD A;  3PVQ A;  4BY6 C;  3GP8 A;  2LNH B;  1MMN A;  2OTL T;  3G71 Q;  1WJQ A;  3V8K A;  1QKW A;  2L3P A;  4J9G A;  1WI7 A;  2MPX C;  1YCS B;  4HA8 A;  2HSP A;  1T0J A;  1UUE A;  1YFN A;  2RH2 A;  1K9M R;  1MND A;  1PCX A;  1WHM A;  1JU5 C;  2PQW A;  3DB4 A;  3G71 T;  5I2M A;  5I11 A;  1R77 A;  1YBY A;  2E41 A;  2HSE B;  2WSF E;  2FVU A;  1VQM A;  2FZK B;  3EH2 A;  2IG0 A;  4IUU A;  4JRK A;  1NBE B;  2DVJ A;  3CMA Q;  4PJN A;  4NS5 A;  1ZBX A;  2GTJ A;  2ZPF B;  2DD5 A;  1ZSZ C;  5FU7 B;  2KEA A;  2NUT B;  3LGF A;  1IB8 A;  3CCM Q;  1M30 A;  4FIB A;  2KI7 A;  1K9M C;  4M7A E;  3CMA T;  2X4Y A;  1D0X A;  3PMI A;  2OTL A;  2RJF A;  3A8M B;  1AZG B;  4DQ2 A;  3GNG A;  2RO0 A;  1WHL A;  3VUB A;  4C8Q G;  3MCA B;  2DJQ A;  4LD6 A;  2O9V A;  2O88 A;  3CCQ Q;  3CCM T;  1YCY A;  2H8H A;  2DL4 A;  3CCL Q;  1M3B A;  2YLC A;  2JZ2 A;  6AT1 B;  1XTD A;  4MMK A;  2K5L A;  2IPO B;  4CI0 C;  4PFZ A;  5FW9 A;  1ZX6 A;  3UF4 A;  5GAN h;  2JW4 A;  1K0X A;  4FL6 A;  5GJV B;  1I07 A;  2JUF A;  2G6F X;  2CH4 W;  4E7K A;  3CCQ T;  4IUQ A;  1UHF A;  2DO3 A;  3HRU A;  2KAF A;  1QVP A;  2YRD A;  3CCL T;  3CEY A;  2LC4 A;  4IIM A;  4F7U B;  1VQN Q;  1AOJ A;  2RB6 A;  3UDC A;  2EKH A;  4Y92 A;  4PJJ A;  3VS6 A;  1RAE B;  2JJ9 A;  4XTW A;  2A36 A;  2KVQ G;  3EHQ A;  2DEU A;  3CMA A;  1IRE B;  2JN0 A;  2QG9 B;  5J39 A;  4OGE A;  4FT4 A;  2BIV A;  4HCZ A;  1Y71 A;  1C1A A;  1VQN T;  4D6W A;  1M90 C;  2R5A A;  1UJ0 A;  4RCB A;  2KGT A;  2Y4Y A;  4C8Q A;  3CC7 A;  4Z02 A;  2K5I A;  3L2U A;  2QQB A;  1QWE A;  4B9X A;  1NEG A;  4GBQ A;  3UPU A;  2QAS A;  4DOV A;  1VQL Q;  2F2X A;  3EG0 A;  1OYX A;  4PLL A;  1IRX A;  3VYG A;  4DA4 A;  4JLG A;  1AWX A;  3OW2 P;  3X28 B;  2F5T X;  2X4J A;  2V1Q A;  1YJW A;  3CCL A;  3OYJ A;  9ATC B;  2M0O A;  2QA4 Q;  2DMO A;  2HKN A;  5CAI A;  1CKB A;  1Z9Z A;  3Q1J A;  4WTO B;  3OYK A;  1VQL T;  1RI9 A;  4AG2 C;  1M8M A;  2P4T A;  3VUZ A;  3MO8 A;  2RQT A;  2KXC A;  1MUZ A;  5LL6 S;  4ELY C;  2YUQ A;  3MJX A;  1PD0 A;  2QA4 T;  2G3R A;  1X27 A;  5GAM g;  1AD5 A;  2MWO A;  1W2B S;  2RNA A;  2EJF A;  1D0Y A;  4IKF A;  1FMV A;  1BIB A;  2HD0 A;  4PLI A;  2F69 A;  1N27 A;  4IIO A;  4BB7 A;  3CXC P;  1IZ6 A;  3SFM A;  1BB9 A;  4PJO G;  2EQJ A;  1SF9 A;  3BDL A;  3CCU Q;  5IN1 A;  3FDR A;  3EFR A;  2QQ9 A;  5IHI A;  2JOY A;  1FX7 A;  1VQ5 Q;  1W2B A;  2OTJ Q;  1YP5 A;  2E10 A;  1I4K 1;  5CR2 A;  2DER A;  5KYX A;  2F5K A;  1QCF A;  5DM7 R;  3FEO A;  3TCJ A;  1K8A R;  1QLY A;  3M58 A;  2FB7 A;  2QQR A;  2PUO B;  2VC8 A;  3CCU T;  4XTV A;  2JTM A;  4FM4 B;  1VQL A;  1UEB A;  1VQ5 T;  3M0U A;  2OTJ T;  1GFC A;  3JCM f;  5D6W A;  3NTH A;  3VU3 C;  3PGG A;  2CZ6 B;  2YLB A;  4KGX B;  3O5Z A;  2P0K A;  1SSF A;  1WQW A;  1Q7Y U;  1WYX A;  4PFO A;  4JLI A;  4A4H A;  2QDL A;  2CP0 A;  3NMZ C;  4A4E A;  1IXD A;  4M75 E;  4CC4 B;  3VJP A;  2RHI A;  2XMF A;  2KRN A;  1OX8 A;  3QZ9 B;  5LJ3 h;  1XOV A;  1X6O A;  5LJ3 j;  3OYI A;  4C0F A;  1H3H A;  1YN8 A;  3G1J A;  2LJ1 A;  2DAQ A;  4M75 B;  4ZGE B;  2DM1 A;  2LX9 A;  1TH7 A;  2EGA A;  1G3S A;  4E7L A;  2DXB A;  3JB9 J;  3CCU A;  5LJ3 e;  2L3Q A;  4CC2 A;  4C92 E;  4M7A C;  2XDB A;  1VQ5 A;  3MKD A;  2K57 A;  2OTJ A;  4WF2 A;  3CCR A;  2RHZ A;  2CDT A;  4F16 A;  3FRN A;  5KYW B;  4X1V A;  1K9M U;  4C0D B;  4XAX B;  1QVG S;  3M0T A;  1WJS A;  4C92 B;  2K2V A;  4F7U G;  4HCK A;  1BYM A;  1I8F A;  2VKN A;  1M1F A;  2FRW A;  2CT3 A;  2E1H A;  5CO7 A;  2Y4X A;  2O31 A;  3RKY A;  2BZY A;  2FEI A;  2HAX A;  2BTT A;  2DPP B;  1KD1 R;  1QVG A;  4ANJ A;  3OYL A;  1QCN A;  2ABL A;  5FRO A;  4QW2 A;  2KBT A;  2VUB A;  1PC0 A;  4XQ3 A;  1PRL C;  2DL5 A;  3PIP A;  3EGX B;  2GCX A;  3JCM e;  3H41 A;  2EGE A;  2W0Z A;  2A7Y A;  3JB9 G;  1UGV A;  4V2S A;  1PWT A;  3RES A;  3DB3 A;  4BUG A;  2IVW A;  5FRM A;  1PD1 A;  2K3X A;  2O4X B;  2J06 A;  8ATC B;  1M3C A;  1D1C A;  3MP8 A;  5LJ5 h;  3CCJ Q;  5LJ5 j;  2MYS A;  2E5K A;  1VIE A;  3CCE Q;  1KQ2 A;  2PZ1 A;  1N5Z A;  1KD1 C;  1IHW A;  3EG3 A;  1H92 A;  3UT1 A;  1YJ9 Q;  3TSW A;  5CKB A;  4N4I A;  3M4Y A;  4HVV A;  4YTL A;  4F7U A;  5LJ5 e;  5IT9 E;  2JM9 A;  1M90 U;  5CKF A;  4PJM A;  3CPW S;  2LCL A;  2DFU A;  5GAM h;  3CCJ T;  1LVK A;  3CCE T;  4RMO A;  4M7A D;  2DLP A;  2BZX A;  5IXF A;  1YJ9 T;  3SDZ A;  3BY7 A;  1UHC A;  1ZHI A;  4HCB A;  4Z88 A;  2CGH A;  3GBQ A;  3MPU B;  4PFP A;  2NWM A;  2DX1 A;  4E7H A;  1WNL A;  3IQL A;  1VQ4 Q;  3AT1 B;  4M77 G;  3PIO A;  2RI2 A;  3BW1 A;  1Y7X A;  2SEM A;  3CC2 Q;  3QYH B;  2PNI A;  1PM3 A;  1N8R R;  2FPD A;  2HQX A;  4BDY A;  2E6Z A;  3C0C A;  3QJY A;  1JRI A;  3OYY A;  5A2Q E;  4RCC A;  2FYK A;  1P92 A;  2KRM A;  4PJO F;  3FB9 A;  5HY6 A;  2OI3 A;  5GMK j;  4A4K A;  3RIR A;  2E3H A;  1QWF A;  2R57 A;  1VQ4 T;  2O9S A;  3CC2 T;  1TUD A;  1BCM A;  2D8J A;  2K6D A;  4XU2 A;  1O9S A;  5GMK e;  2E4H A;  4M7D G;  1VQ9 Q;  1FMW A;  4ZGJ B;  3QWY A;  1BKB A;  3WVE B;  2XID A;  1WHH A;  4RTY A;  2EYX A;  3RKW A;  1WHK A;  3CCJ A;  1WXT A;  1N8R C;  3CCE A;  5GAO p;  3OYF A;  2E64 A;  3J80 E;  2YUP A;  4OF1 A;  3HTR A;  2WSC E;  3H9N A;  1YJ9 A;  1JJ2 S;  4E2F B;  3THK A;  3E19 A;  1NPP A;  2K3B A;  1YNZ A;  1VQ9 T;  2VV5 A;  2YHT A;  1QMC A;  3OYC A;  1NEB A;  3VS1 A;  3HFO A;  3L2W A;  4IUR A;  1SKU B;  3E2U A;  1FYN A;  3A98 A;  2COW A;  4DBR A;  4LE9 A;  2M9U A;  1Z9Q A;  1NLO C;  2V8J A;  1WDX A;  2ZZD A;  1HSQ A;  1X43 A;  2GF7 A;  1JJ2 A;  1H64 1;  1QVF S;  1K76 A;  3CCV Q;  2XU8 A;  1OPK A;  1VQ4 A;  1TSF A;  4M78 B;  3LLR A;  5KCO A;  2FG0 A;  4MML A;  1Q86 C;  2RHU A;  5CK9 A;  3CC2 A;  1BIA A;  1D1B A;  2ED1 A;  2CP5 A;  4JDS A;  4RG8 A;  2LQK A;  2RN8 A;  5L23 A;  3CCV T;  1QVF A;  1KQS A;  4RTX A;  5CQX A;  2KXD A;  3VS7 A;  3PNW C;  2CSQ A;  3LYI A;  4M75 C;  3PT9 A;  2EJ9 A;  4KGZ B;  1EIF A;  1DJ7 B;  3V8J A;  2PVO B;  1UTI A;  7AT1 B;  1WIE A;  4J5Y A;  2AZS A;  3CME Q;  1VQ9 A;  2EPD A;  4B6M A;  1UFF A;  4JZ3 A;  4J9C A;  3GF5 A;  4C0D C;  4F17 A;  1LPL A;  4LDX A;  2XI9 A;  2K9G A;  4GY5 A;  4C92 C;  4FW2 A;  2L3S A;  1Y96 B;  3UAT A;  1MV0 B;  2RJE A;  3CC4 Q;  1IO6 A;  3AHU A;  4JRP A;  3OYN A;  1MMG A;  4C5I A;  5EG2 A;  3CME T;  1GRI A;  3A8O B;  4N4G A;  1ZQ1 A;  2CS7 A;  2AKL A;  1I81 A;  3R6O A;  4M75 A;  1Y0M A;  2HL5 C;  3A8H B;  2YDL A;  3EH1 A;  3GIB A;  3MEW A;  3CC4 T;  1R0C B;  3FIF A;  3RMS A;  2VB6 A;  3CPF A;  3M9Q A;  4KUI A;  2CP2 A;  2GNC A;  5KYW A;  3L2R A;  2LCC A;  4PJO E;  2BKD N;  2AIR B;  2D6F A;  1H3Z A;  2YRC A;  2OJ2 A;  3VS2 A;  3OS0 A;  2DA9 A;  2VGM A;  4E7I A;  4KT0 E;  2E12 A;  1WZO A;  2DET A;  2FL7 A;  4LXC A;  3RMQ A;  2RMO A;  3QDF A;  3EGU A;  3LH5 A;  1NJI C;  1ZUU A;  4XTY A;  2EYY A;  3OMC A;  1JXM A;  4M75 D;  1JQQ A;  2B8A A;  3EGX A;  2P84 A;  3GNF B;  1C6V X;  1BU1 A;  1KD1 U;  3H8Z A;  1PKS A;  2M16 A;  3FLG A;  4M77 F;  4PJL A;  5A0D A;  3I9Q A;  3LW5 E;  2Y90 A;  3CC4 A;  1RUW A;  1U3O A;  5IHN A;  4E7J A;  4C92 D;  4JJB A;  2O4X A;  1GXI E;  1IHV A;  2QGF B;  4RUG A;  4M7A B;  4L6V 5;  4HT8 A;  4JS4 A;  2V1R A;  4ZTJ A;  5LJ3 g;  2ZPI B;  3HKS A;  3QWX X;  1IGQ A;  3G71 A;  1RAC B;  1EZZ B;  1ZSZ A;  1OU9 A;  2A37 A;  4M7D F;  2LP5 A;  1YIJ Q;  5C6S A;  4BD3 A;  4IUP A;  3ULR B;  4AFS C;  1M90 R;  1QCO A;  3OQ5 A;  1VQO Q;  2XG8 D;  4FW1 A;  3VKI A;  2KY9 A;  3PTA A;  5GAN 3;  4C5E A;  4ATO A;  3PE0 A;  1EFN A;  1G83 A;  4QT7 A;  2ZCF B;  1YIJ T;  4RG2 A;  5FWC A;  2GQI A;  2DXT A;  4ORZ A;  4J6Y A;  4JZ4 A;  1VQO T;  1VQ7 Q;  2BUD A;  1PKT A;  3SWN B;  3CD6 Q;  4MDW A;  2C0T A;  1GBR A;  1AWJ A;  3OW2 S;  2KQW A;  1WA7 A;  4ME7 A;  2RQW A;  3JCM g;  4ZGD B;  1YIT Q;  1K1Z A;  5GAN d;  2NLU A;  2DL8 A;  1N8R U;  4NL2 A;  2JMC A;  3VS5 A;  3MEU A;  3CCM A;  3U23 A;  4XTU A;  4QKU A;  2QAZ A;  4J9I A;  1KC8 R;  2X9H A;  1VQ7 T;  3EHR A;  3SB2 A;  3V7C A;  5CKH A;  5D7U A;  3CD6 T;  1MMD A;  4BDZ A;  3OW2 A;  1KQ1 A;  1RAH B;  4M78 C;  1YIT T;  2RI3 A;  5EC7 A;  3CCQ A;  2YWW A;  3M53 A;  2NUP B;  1JO8 A;  5LJ5 g;  1MV3 A;  3H6Z A;  3JAM E;  4R56 A;  1D09 B;  1QP3 A;  3CXC S;  3VYH B;  2DL7 A;  2KSS A;  4FT2 A;  2JMA A;  1KK7 A;  3JV3 A;  3URG A;  1YIJ A;  1Q86 U;  4QQG A;  4RTU A;  2AHJ B;  3C95 A;  3OA6 A;  1KC8 C;  1AVZ C;  1U5S A;  1FXX A;  1I1J A;  3RBB B;  3M57 A;  1VQN A;  1HD3 A;  1F1B B;  4M78 A;  1C0M A;  2CP6 A;  3CXC A;  4KGV B;  2LT4 A;  5KYY B;  3V7S A;  2QXF A;  3MP1 A;  4C5G A;  1OV3 A;  2QI2 A;  4AT1 B;  4XU1 A;  1B34 A;  3JCM P;  3X26 B;  3PMT A;  1UGR B;  3A8L B;  1M9S A;  5IAY A;  1AZE A;  2R58 A;  2DTI A;  2R5M A;  3QSU A;  1N6A A;  1V1C A;  1YIT A;  2HQE A;  2EKO A;  1M2O A;  1QW1 A;  1ZA1 B;  1U06 A;  1PSF A;  3CBO A;  3L2V A;  4XK8 E;  4JJC A;  4TVR A;  4X34 A;  4K11 A;  4BI3 A;  2L89 A;  3HP9 A;  2LTO A;  3M4G A;  4BI8 B;  1YHQ Q;  4F14 A;  1QKX A;  2P0Q A;  3L2Z A;  1Y96 A;  4NOY A;  1D3B B;  2KE9 A;  4C0Z A;  1JXO A;  4M7D E;  4BAC A;  2A3L A;  4M78 D;  2FPF A;  3M59 A;  4L59 A;  4CC3 A;  2QA4 A;  4JS5 A;  3G6E Q;  1AEY A;  2QTX A;  4PJO C;  1M2V B;  4GLM A;  4O6J A;  4OP0 A;  4R0K A;  2EYW A;  1M4Z A;  5GAO n;  3G7Z A;  1GFD A;  2ZPE B;  1PSE A;  2BZ8 A;  2CZ0 B;  1YHQ T;  5GAN 2;  1MGQ A;  2LVM A;  4J6W A;  3RUX A;  3ER0 A;  4QVC A;  1PNJ A;  1B07 A;  3G6E T;  2RQV A;  2DXU A;  3MHX A;  4FYY B;  5GMK i;  2DKG A;  2QTV A;  1NJI U;  2DTH A;  1NG2 A;  3EGD B;  4C5H A;  3DKM A;  4C8Q F;  2EJG A;  2JXB A;  3I5R A;  5IHK A;  2YXY A;  1N9S A;  2NYS A;  3OYD A;  1UG1 A;  1S1N A;  3VS3 A;  1CKA A;  5ECA A;  2KYB A;  2CH4 A;  4X9D A;  2O2O A;  1RAB B;  1IGU A;  2OX7 A;  3TU4 K;  2DK3 A;  4ELZ C;  5FLX E;  2VXF A;  2CYZ B;  3E9G A;  1RAI B;  1TG0 A;  2VWF A;  2NUT A;  5A0G A;  1NYF A;  3JRZ A;  2XIC A;  5GMK m;  3G4S Q;  3REB B;  2HNI A;  4J9D A;  1X6B A;  3JCM h;  3TEE A;  4ZN1 A;  1OZ2 A;  4EIK A;  3G6E A;  5CVI A;  2JS2 A;  4BE2 A;  1G3W A;  1I5O B;  1NYG A;  3I56 Q;  4RTW A;  4M7A A;  2AZV A;  3S3N A;  1W70 A;  4JPB W;  3NGP A;  4PJO D;  1YJN Q;  4E6R A;  3G4S T;  1K73 C;  3EG2 A;  2DE0 X;  3CBP A;  1V29 B;  3GLX A;  2H3J A;  3SWN C;  4JJD A;  2DIL A;  3ME9 A;  5HCK A;  3I56 T;  3KUF A;  2M1H A;  1T0H A;  1VUB A;  3CQT A;  1YJN T;  1MNE A;  4FSS A;  2RHY A;  2EQU A;  3D7S B;  2DNU A;  4A54 A;  3LX7 A;  3KXT A;  1ARK A;  2LT1 A;  2A0F B;  2X4X A;  5J26 A;  2QGG A;  1K4U S;  2XHC A;  1GCQ C;  3JCM b;  3ZBD A;  1M1K R;  3QII A;  1G3T A;  3S3M A;  4Z89 A;  2RI5 A;  4VUB A;  4QQD A;  1ZLM A;  1E7O A;  3L1A A;  2LJ0 A;  2MIO A;  5GMK l;  5J3B A;  1QQJ A;  3NFC A;  2GGR A;  4JRI A;  4KH0 B;  3SWN A;  4A4F A;  1LJO A;  1NZ9 A;  2DRK A;  3OS5 A;  4J6X A;  2E6N A;  2K4Y A;  5DY9 A;  1UDL A;  3QBY A;  1SSH A;  1WXB A;  3C12 A;  3G4S A;  3EG9 B;  2K3Y A;  4OMQ A;  1OUL A;  3OYE A;  4LDY A;  2KT1 A;  4Y28 E;  1GL5 A;  2CUB A;  5HK0 A;  1M1K C;  1HK9 A;  1OEB A;  4D8D A;  5GAN 7;  3GPL A;  1T3S A;  1X2Q A;  5GMK h;  5GAN 4;  3FJP A;  1RLP C;  4DBQ A;  1VQ6 Q;  1YJN A;  4XTZ A;  1ZUY A;  4OB2 B;  1KC8 U;  2EWN A;  3LWI A;  2RF0 A;  1OZ3 A;  2XKO C;  3OS1 A;  4J9B A;  4E47 A;  4IUT A;  3CPW P;  2LX7 A;  1VYT A;  2XDP A;  4C8Q E;  1ZA2 B;  3P8H A;  5CKE A;  3QXE B;  5FRN A;  4Q5W A;  2CZ7 B;  4EMG A;  3C4S A;  5GAO m;  1VQ6 T;  3WVD B;  4FSX A;  1Q86 R;  3I55 Q;  3M0Q A;  1D1A A;  4C8Q B;  2ROT A;  2DRM A;  1UEC A;  3HHT B;  1SPK A;  2C0I A;  3GOX A;  2JS0 A;  3T9N A;  1VQP Q;  1BCO A;  2EW3 A;  2OAU A;  5KYY A;  3P8D A;  4OB0 B;  4OB1 B;  3S6W A;  4II1 A;  2I2L A;  1WHG A;  3I55 T;  2F2V A;  2LRQ A;  1OX9 A;  3V8L A;  1OPL A;  2AK5 A;  2JTE A;  1KQS S;  2GFU A;  3EFS A;  1VQP T;  1FMK A;  1U8R A;  4M75 G;  2GFA A;  2VVK A;  1W4S A;  4J7F A; 
#chains in the Genus database with same CATH homology
 2O4X A;  4PKC C;  4BB7 A;  1GXI E;  1IZ6 A;  3SFM A;  4PJO G;  3QUI A;  2EQK A;  2PUK B;  4XTX A;  4M7A B;  2EQJ A;  3BDL A;  3OYB A;  1BI0 A;  2JVV A;  4L6V 5;  4ZN3 A;  5IN1 A;  4HT8 A;  3FDR A;  3O8V A;  1QP2 A;  4X9C A;  3EFR A;  4JS4 A;  5KH6 A;  3JB9 I;  2QQ9 A;  4ZTJ A;  2JOY A;  1FX7 A;  3NTK A;  3VV0 A;  5LJ3 g;  4JUV A;  2PVD B;  4A53 A;  1W2B A;  2ZPI B;  3JCM d;  2E10 A;  1VQ6 A;  1I4K 1;  3V7R A;  5CR2 A;  3HKS A;  1D3B A;  4C92 G;  2F5K A;  5DM7 R;  3L2Q A;  2P0P A;  3G71 A;  3FEO A;  3TCJ A;  3QKJ A;  3TRE A;  5GAO l;  2MMP A;  3M58 A;  2FB7 A;  1UB4 A;  1X01 A;  4M7D F;  3UWN A;  1UGS B;  4PL6 A;  3A5Z B;  2QQR A;  5C6S A;  1LOJ A;  2PUO B;  4BD3 A;  1I5L A;  4IUP A;  2VC8 A;  3CCU T;  1JB0 E;  3OSV A;  4KUL A;  1M1G A;  4XTV A;  2E5Q A;  2JTM A;  1G3Y A;  3OQ5 A;  2V8I A;  4FM4 B;  2XG8 D;  3M54 A;  1NPR A;  4F7U F;  2RJD A;  1VQL A;  1UEB A;  3VKI A;  2KY9 A;  1BI3 A;  3PTA A;  1VQ5 T;  2L3R A;  5GAN 3;  2OTJ T;  4C5E A;  2RM4 A;  4EMK C;  3F70 A;  3JCM f;  5I21 A;  5D6W A;  3NTH A;  4ATO A;  3VU3 C;  3PGG A;  2CZ6 B;  2YLB A;  2P0K A;  2ZPB B;  3CCS A;  2ZCF B;  2QQS A;  4C0G A;  1YIJ T;  3QPH A;  4RG2 A;  1SSF A;  5LJ5 d;  2DXT A;  1WQW A;  5GAM j;  2QDY B;  2DTO A;  1Q7Y U;  3QZ5 B;  4JJN K;  4J6Y A;  1VQO T;  4B9W A;  2BUD A;  3HFN A;  3ZFJ A;  4A4G A;  3SWN B;  4MDW A;  1VQ8 T;  3I56 A;  3JCM c;  4JLI A;  4A4H A;  3OW2 S;  2KQW A;  4ME7 A;  5GAM e;  3JCM g;  4A4E A;  4ZGD B;  1UGP B;  5GAN d;  1Q81 C;  2NLU A;  3JCM W;  1O75 A;  1N8R U;  3E9F A;  3JB9 F;  4NL2 A;  4HKE A;  1LNX A;  3DLM A;  3MEU A;  1OI1 A;  4M75 E;  3CCM A;  3CPW A;  2RHX A;  3VJP A;  5GAM d;  4NL3 A;  2RHI A;  3CCV A;  4XTU A;  4BE0 A;  3S3O A;  2DIQ A;  3QZ9 B;  2JTF A;  4J8O A;  5LJ3 h;  1XOV A;  1X6O A;  4MZM A;  5LJ3 j;  2DZC A;  1VQ7 T;  3SB2 A;  3OYI A;  4C0F A;  3JCM X;  2RK2 A;  3V7C A;  5CKH A;  2ZPG B;  4C92 A;  3CD6 T;  4OB3 B;  2DAQ A;  2D0Q B;  4M75 B;  4ZGE B;  2LX9 A;  4QVZ A;  1TH7 A;  4EMH A;  1KQ1 A;  1G3S A;  2L5Q A;  4M78 C;  4BDZ A;  3OW2 A;  4E7L A;  2DXB A;  2VGN A;  3JB9 J;  3CCU A;  5LJ3 e;  2RI3 A;  4M77 C;  5KE2 A;  4PJO B;  3CCQ A;  4C92 E;  5GAN f;  5DLQ E;  4M7A C;  1Q7Y C;  3M53 A;  1VQ5 A;  5D6X A;  2XDB A;  2K57 A;  2RA2 A;  4WF2 A;  3CCR A;  2RHZ A;  2OTJ A;  4PNO A;  1K73 U;  3FRN A;  5LJ5 g;  3ASK A;  1WGS A;  3H6Z A;  3RKX A;  3JAM E;  1K9M U;  4C0D B;  5GAO q;  4XAX B;  4R56 A;  1QVG S;  4HCC A;  4HT9 A;  1WJS A;  1KHI A;  1QP3 A;  3L42 A;  3CXC S;  4JRQ A;  4BE1 A;  3M5A A;  3VYH B;  4C92 B;  2KSS A;  4FT2 A;  5M9O A;  2K2V A;  3M56 A;  3URG A;  4F7U G;  1Q86 U;  1YIJ A;  2CKK A;  3QJ6 A;  4QQG A;  2LQ8 A;  2AHJ B;  2QQA A;  3C95 A;  3CME A;  1BYM A;  1I8F A;  4L5G A;  3OA6 A;  1KC8 C;  1M1F A;  2C06 A;  4Y91 A;  1FXX A;  5GAN g;  5CIU A;  2E1H A;  2DVE A;  5CO7 A;  2Y4X A;  3QYG B;  4OGC A;  3RKY A;  4DOW A;  1VQ8 A;  3M57 A;  1NE8 A;  4UC4 A;  4OVA A;  3JB9 D;  2RJC A;  4M7D C;  2HAX A;  2DPP B;  1VQN A;  1QVG A;  3OYL A;  4M78 A;  3CXC A;  4M7A F;  3MEV A;  2PVG B;  5FRO A;  2LT4 A;  4QW2 A;  2VUB A;  3JSC A;  4M77 A;  3QHS A;  2QEX T;  3V7S A;  1MHN A;  2QXF A;  4XQ3 A;  3MP1 A;  4FU6 A;  4C5G A;  2QI2 A;  4N0A C;  5GAN 8;  4XU1 A;  1B34 A;  2K5F A;  3PIP A;  3HSB A;  3JCM P;  3X26 B;  3PMT A;  1UGR B;  2GCX A;  1VIF A;  3A8L B;  1M9S A;  4M78 E;  5GAO r;  5IAY A;  3JCM e;  1G5V A;  2R58 A;  2DTI A;  2R5M A;  2A7Y A;  3JB9 G;  4EPC A;  4LD9 K;  3QSU A;  4V2S A;  5GAN 6;  4IUV A;  1N6A A;  3JCM J;  1YIT A;  3RES A;  3DB3 A;  2HQE A;  2X4W A;  2EKO A;  4BUG A;  5HKC A;  1QW1 A;  2IVW A;  5FRM A;  3LH0 A;  1R8O B;  1PSF A;  2K3X A;  2O4X B;  2RD1 A;  3CBO A;  4XK8 E;  3JCM V;  2XDD A;  3L2V A;  2WSE E;  3X20 B;  4TVR A;  1B34 B;  3ZEH A;  3MP8 A;  5LJ5 h;  4X34 A;  4J83 A;  5LJ5 j;  1VIE A;  4EDU A;  1KQ2 A;  4BI3 A;  1KD1 C;  3CC7 T;  2L89 A;  1YIT T;  4M7D A;  1YI2 T;  3HP9 A;  3UT1 A;  2LTO A;  3M4G A;  4J7I A;  4BI8 B;  4MZP A;  4N4H A;  2EIF A;  3OBY A;  5CKB A;  1K8A U;  1RI0 A;  1M1K U;  3JB9 H;  4N4I A;  3M4Y A;  4F7U A;  4YTL A;  2P0Q A;  3L2Z A;  1Y96 A;  4NOY A;  4OMF B;  5CCA A;  1D3B B;  4N0A A;  1FWZ A;  4C0Z A;  2E70 A;  3MEA A;  2MI6 A;  5LJ5 e;  3I55 A;  4M7D E;  5IT9 E;  1M5Q 1;  4BAC A;  2A3L A;  2HBP A;  4M78 D;  4R55 A;  1M90 U;  5CKF A;  3M59 A;  5GAN j;  3OB9 A;  4L59 A;  3OBW A;  4MZT A;  3CPW S;  3J7A F;  2QA4 A;  4M77 D;  2LCL A;  4JS5 A;  2QTX A;  4PJO C;  2XK0 A;  5GAM h;  3JCM Q;  3CCJ T;  3P8B B;  4F7U E;  4O6J A;  4OP0 A;  4C8Q C;  5CKD A;  3E1S A;  4RMO A;  3CCE T;  3OYH A;  1VQP A;  4M7A D;  1M4Z A;  5GAO n;  2LNV A;  3G7Z A;  1YJW T;  3QO3 A;  2ZPE B;  1YJ9 T;  1PSE A;  3BY7 A;  3SDZ A;  1UGQ B;  2DJZ A;  4HCB A;  1ZHI A;  2CZ0 B;  1YHQ T;  5GAN e;  2QEX A;  5GAN 2;  2CGH A;  1MGQ A;  4KBM B;  3OS2 A;  1VQM T;  2LVM A;  4E7H A;  1Q82 U;  3MET A;  4J6W A;  1BI1 A;  1WNL A;  4M78 G;  2GQV A;  3OY9 A;  3RUX A;  3ER0 A;  2RK1 A;  2VYT A;  4M77 G;  3QG1 A;  4QVC A;  3PIO A;  2RI2 A;  5FU6 C;  3BW1 A;  3G6E T;  1Y7X A;  2DD4 A;  2DZ9 A;  2ZGW A;  4LDV A;  2DXU A;  3MHX A;  3QYH B;  1KHC A;  4M75 F;  5GMK i;  3HPW A;  2HQX A;  2DKG A;  2LDM A;  2E6Z A;  4BDY A;  1NJI U;  3QJY A;  1JRI A;  3HRT A;  3OYY A;  5A2Q E;  2DTH A;  3QDR B;  2EQM A;  2FYK A;  4RCC A;  3BDU A;  3HRS A;  3OSS C;  5DLO A;  1P92 A;  4M7D D;  4PJO F;  2O01 E;  4LDW A;  4EMK A;  4C5H A;  4ZTF A;  3FB9 A;  1XNI A;  1HXD A;  2JNG A;  5HY6 A;  3DKM A;  3OYG A;  4C8Q F;  4BY6 C;  5GMK j;  2EJG A;  4A4K A;  3RIR A;  2XD0 A;  1WJR A;  2R57 A;  1VQ4 T;  2FHD A;  3GP8 A;  3KBG A;  3LGL A;  2OTL T;  1N9S A;  1WJQ A;  3OYD A;  3V8K A;  1YI2 A;  3CC2 T;  4XU0 A;  4C92 F;  4X9D A;  1N9R A;  4XU2 A;  1O9S A;  3OYM A;  1U1T A;  1XQH A;  5GMK e;  4HA8 A;  4M7D G;  4BI4 A;  4ZGJ B;  5KCH A;  3TU4 K;  2DK3 A;  5CQY A;  1BKB A;  4LDU A;  4ELZ C;  3WVE B;  2XID A;  3HL8 A;  2RH2 A;  5FLX E;  2VXF A;  3C94 A;  2CYZ B;  3RKW A;  3CCJ A;  1N8R C;  3CCE A;  5GAO p;  3OYF A;  1Y07 A;  2E64 A;  2PQW A;  3DB4 A;  3G71 T;  3E9G A;  1VQO A;  5D6Y A;  5I2M A;  5A0G A;  3J80 E;  4OF1 A;  4CRI A;  1YBY A;  5A0L A;  1BI2 A;  2WSC E;  1YJ9 A;  1JJ2 S;  2E41 A;  1M8V A;  3JRZ A;  2XIC A;  5GMK m;  2WSF E;  3E19 A;  2HNI A;  1NPP A;  2FVU A;  1VQM A;  5AYF A;  1VQ9 T;  3OYA A;  2VV5 A;  2IG0 A;  2YHT A;  3OYC A;  3A8G B;  4IUU A;  4JRK A;  3JCM h;  3TEE A;  4ZN1 A;  3HFO A;  1OZ2 A;  3L2W A;  4IUR A;  4RKU E;  4NS5 A;  1ZBX A;  5CVI A;  3G6E A;  2PU9 B;  1G3W A;  4BE2 A;  2M9U A;  4M7A A;  2ZPF B;  2V8J A;  3LWH A;  3S3N A;  2DD5 A;  1VQ7 A;  2ZZD A;  5FU7 B;  4PJO D;  2E65 A;  3OMG A;  2MWP A;  3MP6 A;  3LGF A;  3X24 B;  2GF7 A;  4C8Q D;  1S72 T;  3G4S T;  1JJ2 A;  4M77 E;  3CD6 A;  1H64 1;  1K73 C;  1QVF S;  4FIB A;  2KK4 A;  1K9M C;  5LJ3 f;  3CBP A;  4GLK A;  1V29 B;  2XU8 A;  4M7A E;  3GLX A;  3CMA T;  2H3J A;  2X4Y A;  1VQ4 A;  3SWN C;  3PMI A;  4M78 B;  2OTL A;  3LLR A;  1RL2 A;  5KCO A;  4MML A;  1Q86 C;  2RHU A;  5CK9 A;  2RJF A;  3CC2 A;  3ME9 A;  4M77 B;  3A8M B;  3X25 B;  3I56 T;  3KUF A;  4XU3 A;  1KG1 A;  1BIA A;  4DQ2 A;  1AHJ B;  3GNG A;  2RO0 A;  2M1H A;  4JDS A;  3VUB A;  1VUB A;  4C8Q G;  3MCA B;  1YJN T;  4LD6 A;  4RG8 A;  2KMT A;  2RHY A;  2LQK A;  2EQU A;  2X35 A;  3CCM T;  1YCY A;  4A54 A;  3LX7 A;  3CCV T;  1QVF A;  2YLC A;  1KQS A;  5CQX A;  2JZ2 A;  3KXT A;  1XTD A;  2DIG A;  2LT1 A;  3PNW C;  4M75 C;  3LYI A;  4MMK A;  2K5L A;  3PT9 A;  3EAE A;  5KE3 A;  2X4X A;  5J26 A;  4CI0 C;  2EJ9 A;  2XHC A;  3JCM b;  1EIF A;  3ZBD A;  5GAN h;  1DJ7 B;  1G3T A;  3QII A;  3V8J A;  3S3M A;  1Q81 U;  2RI5 A;  4O5V A;  4VUB A;  1U1S A;  4QQD A;  2PVO B;  4FL6 A;  3L1A A;  4J5Y A;  1VQ9 A;  2JUF A;  5GMK l;  2EAY A;  5J3B A;  4E7K A;  3CCQ T;  4IUQ A;  2DO3 A;  3HRU A;  3NFC A;  4M7D B;  2KAF A;  1QVP A;  3CCL T;  4JRI A;  3SWN A;  4QQ6 A;  4A4F A;  3GF5 A;  3CCR T;  1LJO A;  4C0D C;  1NZ9 A;  3OS5 A;  4QVD A;  4J6X A;  4LDX A;  3CEY A;  2LC4 A;  2E6N A;  2XI9 A;  2K4Y A;  4GY5 A;  5DY9 A;  4C92 C;  4F7U B;  5C0M A;  3QBY A;  1Y96 B;  2RB6 A;  3UDC A;  2RJE A;  3RER A;  3AHU A;  1WPY A;  4JRP A;  3OYN A;  3C12 A;  3G4S A;  1S72 A;  4XTW A;  4C5I A;  2K3Y A;  5EG2 A;  4M7A G;  3CME T;  2KVQ G;  4LDY A;  3OYE A;  3A8O B;  2L8D A;  2D9T A;  3CMA A;  4N4G A;  1ZQ1 A;  2CS7 A;  1IRE B;  2JN0 A;  3BFM A;  5J39 A;  4Y28 E;  3M55 A;  4OGE A;  1I81 A;  4FT4 A;  3FC3 A;  2BIV A;  3R6O A;  4HCZ A;  4M75 A;  1K8A C;  1Y71 A;  5HK0 A;  1M1K C;  1VQK T;  1HK9 A;  3SD4 A;  3GPL A;  5GAN 7;  1WQ7 A;  3A8H B;  3INZ A;  5GMK h;  5GAN 4;  3FJP A;  1VQN T;  3GIB A;  2WAC A;  3MEW A;  4D6W A;  1M90 C;  2R5A A;  4PJO A;  4RCB A;  3CC4 T;  4XTZ A;  1YJN A;  2Y4Y A;  2ZPH B;  4OB2 B;  1KC8 U;  4C8Q A;  3CC7 A;  3FIF A;  2EWN A;  3DLL A;  4Z02 A;  2K5I A;  3L2U A;  3LWI A;  3RMS A;  2QQB A;  4B9X A;  1OZ3 A;  2XKO C;  3CPF A;  5FU7 C;  5L8R E;  3M9Q A;  4KUI A;  3OS1 A;  3UPU A;  4E47 A;  2V8K A;  4IUT A;  5LJ5 f;  3L2R A;  2LCC A;  3CBM A;  3WXM B;  2MAM A;  4PJO E;  2XDP A;  2BKD N;  2D6F A;  1H3Z A;  4C8Q E;  4DOV A;  2VXE A;  2DXC A;  1OYX A;  3P8H A;  3QXE B;  5CKE A;  4EMK B;  4PLL A;  1Q82 C;  4Q5W A;  3OS0 A;  5FRN A;  2CZ7 B;  4EMG A;  2VGM A;  3C4S A;  2MF2 A;  5GAO m;  1VQ6 T;  4E7I A;  4KT0 E;  2E12 A;  3PFS A;  3VYG A;  3WVD B;  4DA4 A;  4JLG A;  4FSX A;  2FL7 A;  3RMQ A;  3X28 B;  2F5T X;  2X4J A;  4C8Q B;  1YJW A;  3CCL A;  5HK3 A;  3OYJ A;  5LJ3 d;  1YHQ A;  2M0O A;  3HHT B;  1NJI C;  5GAM f;  4P5N A;  3GOX A;  3T9N A;  5CAI A;  4XTY A;  2CZ1 B;  3Q1J A;  3OYK A;  4KUD K;  1VQL T;  3OMC A;  2OAU A;  3P8D A;  4M75 D;  4OB0 B;  2P4T A;  2EFI A;  3VUZ A;  4OB1 B;  3S6W A;  3MO8 A;  4II1 A;  5FU6 B;  2I2L A;  2B8A A;  3I55 T;  3N5B B;  5GAN 5;  3GNF B;  5LL6 S;  4ELY C;  2LRQ A;  2YRV A;  3V8L A;  3CCS T;  1JBM A;  2G3R A;  2QA4 T;  1KD1 U;  3H8Z A;  4M78 F;  1VQK A;  5GAM g;  2M16 A;  3FLG A;  2MWO A;  3NTI A;  1KQS S;  2GFU A;  1W2B S;  4M77 F;  2EJF A;  3EFS A;  5A0D A;  1VQP T;  2KDS A;  2EYQ A;  1U8R A;  3LW5 E;  4IKF A;  2Y90 A;  5I2S A;  4M75 G;  1BIB A;  4BY6 B;  3CC4 A;  2GFA A;  2HD0 A;  4PLI A;  1X75 C;  2F69 A;  4E7J A;  1W4S A;  2DEQ A;  3J81 E;  1N27 A;  4MDX A;  4C92 D;  4J7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...