4J9IA

Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p17
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
LFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the ABL-SH3 domain complexed with the designed high-affinity peptide ligand P17
rcsb
source organism Homo sapiens
molecule tags Transferase/unknown function
total genus 10
structure length 56
sequence length 56
chains with identical sequence C, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9iA00
2LNHB 2ECZA 1UJ0A 2O31A 2DL7A 4IIOA 1SRMA 3GBQA 2KE9A 1BBZA 3ZL7C 1SPKA 1VYVA 2DL3A 2CREA 2P4RA 4CC7A 2YDLA 2JW4A 2PTKA 2EVRA 1M3CA 2KRSA 4JJCA 3EG0A 5FWCA 2J7IA 2CH4W 3VS2A 2CUBA 1AWXA 1OPLA 1I0CA 1VYUA 2CH4A 5IXFA 1GCPA 2D1XA 1WFWA 1LCKA 1QWFA 2AKLA 4EIKA 3VS6A 4RTWA 2PZ1A 1KSWA 3EG2A 4CC3A 5FW9A 1S1NA 1UGVA 2B86A 1KJWA 2L3SA 2FRWA 2LX7A 4M4ZA 3UA7A 1QCFA 2EYXA 3IQLA 1RI9A 1K4US 2X3XD 4D8KA 4D8DA 1MUZA 2A28A 4OMOA 4AFUC 2FPEA 4AFQC 2I0NA 1ARKA 1AWJA 1MV3A 4HVVA 1ZUUA 1AZEA 1NYFA 2KRNA 2GQIA 1MV0B 1BB9A 2O9VA 3QWXX 2JM8A 3EGUA 1IO6A 1T3LA 1UUEA 3UATA 1UFFA 1N5ZA 1B07A 1K1ZA 2C0OA 2JS2A 3R6NA 2FO0A 1ZUKA 3H41A 2MCNA 1AWOA 1AD5A 1E6GA 4DEXA 1BK2A 4AFZC 2XMFA 2DLPA 4J9DA 2MOXA 1G2BA 1JQQA 2GNCA 2KR3A 2DNUA 2V1QA 2YUQA 1JEGA 1E7OA 2ROLA 1GFDA 1K0XA 2KNBB 2EGCA 2F2VA 2KROA 1NLOC 2HSPA 1A0NB 1M8MA 4F17A 4JZ3A 2JM9A 3M0SA 2OI3A 2DL5A 2RN8A 2LCSA 2LMJA 2X3WD 2NWMA 2RMOA 2SRCA 1WIEA 3UA6A 2EYWA 2GTJA 5IH2A 2K3BA 2F2XA 1H8KA 2HEQA 1NEGA 2G6FX 1AEYA 1ZBJA 2BZYA 3REBB 1G83A 4KRTA 4HVUA 3SEMA 2KEAA 2CDTA 1RLQC 4GLMA 1PNJA 2W0ZA 5IHKA 2FPFA 2LZ6B 1NLPC 1X6BA 1Y57A 2C0TA 1YNZA 2ESWA 3VS4A 1YP5A 2DBMA 2DMOA 2M51A 3CQTA 1ZUYA 2YUOA 2DVJA 1QLYA 1X27A 4F16A 2K2MA 1UG1A 1UTIA 1AOJA 1M27C 1UJYA 2KT8A 2ED0A 3M0QA 3VRYA 1GCQA 1HD3A 2K79A 3H0HA 1WA7A 2EGAA 2LJ1A 1YN8A 4J9GA 1OEBA 4LN2A 4RTUA 2EPDA 1KIKA 1WXBA 1Y0MA 1VYTA 2DM1A 5IHIA 1I1JA 2OJ2A 2MIOA 1SSHA 3O5ZA 3RNJA 3EHQA 2F2WA 2KGTA 5FWBA 1M30A 2DBKA 1X43A 1X69A 2BZ8A 2CT3A 1NYGA 2GGRA 2LJ3A 2AZVA 1T0JA 2K7AA 4LUEA 3EHRA 4JZ4A 3JV3A 3M0PA 2OAWA 1WLPB 1TUDA 2DL8A 1SEMA 1WXTA 1X6GA 1XOVA 2EQIA 2J6KA 4HXJA 1YWPA 4Z89A 2W10A 1E6HA 1M3AA 4AFSC 2J6FA 4J9IA 2YT6A 2L2PA 2KYMA 1ZX6A 2KRMA 1HSQA 1AWWA 4Z88A 2BTTA 4RUGA 1X2KA 2DJQA 2DILA 2O88A 1W70A 2FPDA 2SEMA 1M3BA 3VRZA 1QWEA 2J05A 3TSZA 1V1CA 1QKXA 1OV3A 4E6RA 4J9HA 1UHCA 1CKBA 3NPFA 2AK5A 2M0YA 4LUDA 2RQWA 1WYXA 1GRIA 3UF4A 3H0IA 1SHFA 2EGEA 4RTYA 1OOTA 4Y92A 4RTXA 5GJWB 4J9CA 1OPKA 1W1FA 2V1RA 2LP5A 2HCKA 3EG3A 1T0HA 1ZLMA 1ABOA 1PRMC 1GFCA 3VS7A 2ROTA 2C0IA 2NUZA 2RF0A 3VS3A 1AVZC 1GCQC 2CUDA 2PNIA 3I5RA 4J9FA 5IXBA 1UE9A 3NMZC 3RBBB 2O9SA 2DF6A 2K6DA 4LE9A 3FJ5A 2O2OA 3TSWA 3ULRB 4FSSA 4JPBW 4WCIA 1CSKA 3PVQA 2DL4A 1HJDA 3PE0A 4J9BA 3REAB 4OMLA 1JXMA 1WI7A 2YUPA 4OMPA 1ABQA 3VS1A 4GBQA 1GBQA 2RQVA 2CSIA 3NGPA 1WDXA 1AZGB 1JU5C 1GL5A 4K11A 1YCSB 2FEIA 1T3SA 2J06A 2YSQA 5ECAA 1VA7A 4OMQA 4CC4B 4AG2C 2DA9A 4A63B 1NEBA 1PRLC 2EYZA 2VKNA 1K9AA 3U23A 2DYBA 2BZXA 4ZNXA 1U3OA 2CSQA 2D8HA 1UDLA 5I22A 5I11A 2HBWA 3QWYA 2RPNA 1FMKA 2A08A 2FG0A 3VS0A 1K0SA 2KXCA 3M0TA 1KFZA 1RLPC 2DE0X 4JJDA 2DRKA 4J9EA 3SHWA 4HCKA 1SHGA 1K76A 2AZSA 2JTEA 1U5SA 2FRYA 1B3QA 2LQWA 2DX1A 2KT1A 1NG2A 1W6XA 2H8HA 4RTTA 2GBQA 3M0RA 4OMMA 3KFVA 3TVTA 1U06A 4AG1C 2L0AA 2EW3A 2EBPA 1J3TA 1TG0A 2J6OA 1SRLA 2QDLA 4LNPA 4ESRA 3I9QA 4OMNA 1PKSA 5HCKA 2JMAA 4RTZA 4R0KA 1NM7A 2EYYA 4QT7A 2JMCA 2ED1A 3A98A 4DEYA 5IHNA 3M0UA 4CC2A 2DRMA 1JO8A 3H0FA 2ENMA 2IIMA 1FYNA 4HVWA 5L23A 1PHTA 1X2QA 1YWOA 1RUWA 1PWTA 2K9GA 2YUNA 1CKAA 3VS5A 3I35A 1UECA 2AKKA 2CT4A 4X1VA 1I07A 2HDAA 2LJ0A 2JS0A 4RTVA 1WXUA 1H92A 3LH5A 5EC7A 1UHFA 2VVKA 3NHNA 2L3PA 1BU1A 2E5KA 2ABLA 2KBTA 2RQRA 2RQUA 1JXOA 4IIMA 4JJBA 1GBRA 2A37A 1EFNA 4Z8AA 1ZSGA 3PVLA 2LQNA 5GJVB 2D8JA 3EG1A 2L3QA 1PKTA 2A36A 2GTOA 2EKHA 2KXDA 2RNAA 2JXBA 2VWFA 3I5SA 4F14A 1TUCA 1Z9ZA 2KYBA 3THKA 4ORZA 1H3HA 1WX6A 3C0CA 2RQTA 1QKWA 1Z9QA 2D0NA 2JT4A
chains in the Genus database with same CATH superfamily
1TU0B 2L89A 2QQBA 3PNWC 1BBZA 1SPKA 1YI2A 4E7JA 5GAN5 2CREA 4CC7A 3X28B 1I8FA 1WZOA 2KRSA 3OSSC 5FWCA 3QZ9B 4ZTJA 1JJ2P 5CO7A 1I0CA 1VYUA 1N8RU 5FRNA 3CMAT 2V26A 1SG5A 1QQJA 5CVIA 2E4HA 4RTWA 4J7IA 3CC7T 3EG2A 4FYVB 4M7AF 3ZBDA 3EGDA 2I2LA 2MF2A 2QYZA 3OYJA 2LX7A 1YJNT 1VQMA 3KXTA 2NLUA 1RI9A 2DIGA 4O5VA 4RMOA 1LPLA 3MJXA 3EFRA 4AFQC 4FT2A 3HKSA 3HL8A 5D6WA 3I55Q 1N9SA 3NFCA 2GQIA 3OYLA 2XKOC 1VQ6A 4BI3A 2DJZA 4F04B 5GAOl 3J81E 4FW2A 4B6MA 3H41A 1VQNQ 3HPWA 2MCNA 1WJSA 1JJ2S 4XTZA 1BK2A 4A4KA 2DLPA 4J9DA 2MOXA 1JQQA 2G3RA 2CP3A 2QEXQ 2V1QA 2YUQA 3EGDB 3S3NA 1K0XA 1NE8A 2EGCA 3RKXA 2KROA 3JB9F 1RAGB 2PVOB 3CPWP 1NLOC 2HSPA 1M8MA 4JUVA 3OW2P 4DBFA 5CAIA 2LCSA 3GNFB 3JCMe 1KHIA 2X3WD 3UA6A 2EYWA 3OYBA 2CZ6B 1TWBA 2QG9B 4C5IA 2F5KA 2BZYA 3J7AF 5LJ5d 4HVUA 3SEMA 2RK1A 4ZGEB 4LD9K 1RLQC 3CCEQ 3Q1JA 4M75E 2W0ZA 5IHKA 5C0MA 5GMKe 4F7UF 4ATOA 2CP0A 4A53A 1MNDA 1MHNA 2DTHA 2QGFB 1I4K1 4QKUA 3CCVT 1QLYA 2MWOA 4AT1B 2BE9B 5LJ5j 4LDVA 3M0QA 3VRYA 1VQ8T 3I56T 2Y4XA 3QG1A 1NBEB 1KIKA 3CPWS 1M5Q1 1Y0MA 1VYTA 3OW2S 2OX7A 1OX9A 4MDXA 2DTIA 3O5ZA 3RNJA 3EHQA 4ELZC 2KGTA 2QTVA 5GAN2 1M30A 2GFAA 2VGNA 5A0LA 1WJRA 1X43A 2K7AA 4LUEA 3RIRA 1VQ9Q 4JLIA 3WVDB 3JCMX 3A8GB 2R57A 1SSFA 3A8OB 2CP5A 2NUPA 2OAWA 2OTLT 1W2BP 2J6KA 3L2VA 4II1A 3G4ST 2W10A 1E6HA 2VV5A 1K8AC 2BIVA 8AT1B 2KRMA 4AMCA 1BI3A 2BTTA 4RUGA 2O88A 2FPDA 2J05A 1V1CA 2XU8A 4M7AE 5I2SA 1D0ZA 4PJMA 4PLLA 3V7RA 4LUDA 2PU9B 4BACA 1GRIA 3C95A 1KC8U 3CCMA 1HXDA 1Q95G 2LP5A 3EG3A 4BB7A 1FMVA 1G3TA 2FZCB 2DK3A 3SD4A 1ZLMA 5GAN4 3CCSQ 4B9XA 2MK5A 1Q86C 1AVZC 3CCUT 1M90C 3QIIA 2CUDA 4RCCA 3I5RA 1KHCA 5IXBA 1KC8R 3FJ5A 4RG2A 1Q7YR 2HL5C 1OI1A 2NUPB 1JXMA 3GNGA 3L1AA 4OMPA 1W2BS 3WVEB 1VQKA 2CKKA 3OYGA 3CMAA 4M75A 2ZPGB 1R77A 2RJFA 1JU5C 1GL5A 2XDDA 1X6OA 2WACA 5ECAA 4CC4B 4M75G 2X4JA 3X25B 2YRDA 2EYZA 2LQKA 2JNGA 3PMIA 1K9AA 2DYBA 3CD6T 3LGLA 1N9RA 4ZNXA 2CSQA 1YJNA 1RAEB 1FMKA 3OSVA 5FU6C 1ZBXA 4EPCA 2VXFA 4FYXB 1RLPC 3QO3A 3SHWA 3RERA 4HCKA 4N0AA 1SHGA 5GANd 1OULA 3CCRQ 1U5SA 2LQWA 2MWPA 4FW1A 2KT1A 3SB2A 2ZPBB 1SKUB 4RTTA 3FC3A 3UDCA 4OMMA 3PT9A 1G3YA 4LDWA 5GANj 3TU4K 4C8QF 4M75B 1Q82C 4HT8A 4M7DD 4OMNA 4M78D 1KQSP 5GAN8 4RTZA 3TEEA 3X20B 2KDSA 1G8XA 2EYYA 4J5YA 1M1GA 1ZQ1A 3P8HA 4DBHA 2JMCA 2ED1A 3A98A 4M77F 3OYIA 2KAFA 4FM4B 2LCLA 4GY5A 1KQ1A 1JO8A 1KG1A 4OGCA 1VQNT 4MZMA 1NPPA 1PHTA 1ZSZC 3BDUA 3HTRA 2ZGWA 2LNVA 3X26B 3VS5A 1IRXA 3I35A 4X1VA 2LJ0A 2QEXT 1H92A 1UHFA 2L3PA 1IGQA 5EG2A 1VQ6T 3OYKA 1K9MR 1M2OA 3JCMb 5LJ3h 2AHJB 4E7LA 4Z8AA 1M1KR 1ZSGA 3JCMW 5GAOn 1QMCA 2YLBA 2A36A 4E7KA 2P0PA 2GTOA 1AT1B 1RL2A 3THKA 2CZ0B 4Y91A 4C92F 3C0CA 3FB9A 2RQTA 1VQ8A 1QKWA 2LX9A 2JT4A 2E3HA 4QW2A 2LNHB 2ECZA 1OX8A 5LJ3f 3G1JA 4IIOA 1Q81U 2KE9A 2PVDB 1I5LA 4VUBA 2E41A 3A5ZB 3SWNA 3EFSA 5CQYA 2JW4A 2PTKA 2X4YA 2EVRA 5LJ5e 5IAYA 5M9OA 1S72A 4JJCA 4QVZA 3LWIA 2J7IA 2CH4W 3VS2A 2CUBA 1UGSB 2RHYA 3RUXA 5GANh 1IREB 1PSEA 1WFWA 1LCKA 1QWFA 1ZA2B 2HL3A 4DQ2A 3MPUB 1VQOQ 3M4GA 2OTLA 4EIKA 3OMGA 1PSFA 2MI6A 3G4SA 2M16A 4BI4A 2DXTA 2HNIA 1Y7XA 5FW9A 2RHXA 1S1NA 1UGVA 2B86A 3CBOA 4E7ZA 4JLGA 3E9FA 5HK0A 1VQPA 1G3WA 2D0QB 4IUTA 1IGUA 5GAMd 4OB0B 1YJ9Q 3L2UA 4D8KA 3CMEQ 2JOYA 3VU3C 4OMOA 4AFUC 2FPEA 4IURA 1AWJA 3LWHA 1MV3A 4HVVA 1AZEA 1NYFA 3DB3A 2EQJA 2X51A 2KRNA 4BD3A 3M5AA 5GAMj 4M75C 1UUEA 3CCUA 2K57A 4M7DE 4C5HA 1UFFA 4M78E 5CR2A 2ZPIB 2C0OA 1D3BA 2JS2A 3R6NA 1PCXA 2IVWA 1AWOA 1N6AA 5KE3A 4AFZC 4BE2A 2XMFA 1YJWQ 3VUBA 1KQ2A 3QYGB 2KR3A 3CCST 3X24B 4C8QE 1JEGA 1E7OA 1H3ZA 1U8RA 4N0AC 2XD0A 1WHGA 3QHSA 1VIFA 3OS0A 2COYA 3HP9A 4IKFA 2DTOA 3L2RA 4F17A 4IUUA 1P92A 5HK3A 1UGPB 3CD6A 4M75D 2DEQA 3M0SA 4PJOF 1WHKA 1EZZB 4M77E 1C0MA 1M9SA 2DL5A 1NJIU 4EMGA 2NWMA 2SRCA 1OU8A 2GTJA 5IH2A 1V76A 1H8KA 2HQXA 2P0KA 2K5FA 3OYYA 5LJ3g 3CC4Q 2G6FX 1AEYA 3OQ5A 3JCMf 5C6SA 3REBB 2CP2A 4KRTA 2CP6A 2CDTA 2H3JA 2QXFA 3JSCA 1NJIR 4GLMA 1KD1U 1D3BB 1PNJA 9ATCB 3RESA 2K5LA 1NLPC 1X6BA 1WHJA 2RJDA 1Y57A 3CC2Q 1YNZA 2ESWA 3VS4A 2X9HA 2YXYA 2DMOA 1QCOA 1RI0A 1ZUYA 4M7AC 2YUOA 4Y28E 2RJCA 1VQKT 2Y90A 2DKGA 3FRNA 2K2MA 4IUPA 2FHDA 1LJOA 1YITT 1KD1R 1AOJA 3I55A 3CCRT 4X34A 1HD3A 2K79A 3H0HA 1D0XA 1WA7A 2EGAA 4HCCA 1QVFS 1OU9A 1YN8A 1PD1A 4J9GA 3OYFA 4HCZA 2P84A 5AYFA 4A4EA 4C92E 2QGGA 1N8RR 3S3MA 5GAMh 5GANe 2OJ2A 1VQNA 2MIOA 1SSHA 4BUGA 1MMGA 4NL3A 5FWBA 1VUBA 1X69A 3G71Q 2CT3A 2V8KA 2GGRA 2QEXA 5CK9A 5GMKl 4M7AD 2VB6A 1WHLA 3JCMJ 3EHRA 3MP1A 3M0PA 1WLPB 3E1SA 2DL8A 4P5NA 2EQIA 1PC0A 3V8KA 1U1TA 3ASKA 4M7DA 2K5IA 4M78A 1M3AA 4KT0E 5DY9A 1ZX6A 3LX7A 4M7DG 5HKCA 4M78G 4Z88A 2QI2A 2DILA 2SEMA 2KK4A 3SWNC 4E47A 1OV3A 1YBYA 1YFNA 2M0YA 5IT9E 3M9QA 2RQWA 1WYXA 2XG8D 4C8QA 4DA4A 1KC8C 1M8VA 5KCOA 3H0IA 4LD6A 1Q7YC 3CCEA 1OPKA 2X35A 5KE2A 1T0HA 2VXEA 1SF9A 2QA4Q 3QSUA 3NTHA 1GFCA 3M58A 4M77A 2NUZA 5GAOm 1GCQC 1WPYA 2ZPFB 2M02A 1WQ7A 4J9FA 3NMZC 3RBBB 2DF6A 1PG5B 2K6DA 4LE9A 3M55A 4WCIA 1HJDA 4J9BA 4OMLA 5CKFA 3DKMA 3JB9D 4ZTFA 3JCMg 4OB2B 1VOMA 4M7DB 3GIBA 3HFOA 4M78B 1GBQA 5FU6B 2CSIA 1ZSZA 4DOWA 1WDXA 4XU2A 1AZGB 1T3SA 2YSQA 4L6V5 1QVFA 4AG2C 3RMSA 1NEBA 1PRLC 4MMKA 2MMPA 5IN1A 3ME9A 3C4SA 2D8HA 2CGHA 5I22A 4C8QB 3JCMQ 3OYDA 1TSFA 2FG0A 2DXCA 5DLQE 1VQOT 4PJOE 4JJDA 2L8DA 4C5GA 2AZSA 2PUOB 2JVVA 4C0DB 4M77B 1B3QA 1R0CB 1NG2A 1W6XA 4QQ6A 2DEUA 2JTFA 1UB4A 3C94A 1S72T 3M0RA 1YJ9T 1G3SA 3QKJA 2HMAA 2OAUA 3CMET 4AG1C 2EW3A 3QPHA 2EBPA 4B9WA 4FYYB 1J3TA 1TG0A 2GCXA 1SRLA 1VQ4Q 1BI2A 1ZSZB 2BE7D 3V8JA 4ZGJB 2JMAA 4R0KA 2X4WA 2EIFA 5GAMe 3CCSA 1YHQT 2RJEA 4FCYA 1H641 3BFMA 2JTMA 4DEYA 4CRIA 1VQPT 2A3LA 4CC2A 3P8DA 3H0FA 2ENMA 2IIMA 1K9MC 1BCOA 4HVWA 5L23A 1YWOA 1RUWA 2K9GA 1M1KC 1YJWT 1CKAA 1B34A 1Y71A 2OTJQ 3DB4A 1I07A 1RAHB 2XDBA 2LVMA 3O8VA 5EC7A 2VASA 3NHNA 1BU1A 2E5KA 3OBWA 3OYNA 3SFMA 1GBRA 2A37A 3KBGA 3ZFJA 3CCLT 1EFNA 3OB9A 4BE1A 5LL6S 2LTOA 4C5EA 3EG1A 3LYIA 2L3QA 1MGQA 5A2QE 2RB6A 1LNXA 4E7HA 2E10A 5KYWA 1EX4A 3V8LA 3CC4T 2RNAA 3OMCA 5LJ5h 1Z9ZA 2KYBA 3MKDA 1YITA 2Z0WA 3CCRA 1QCNA 3S6WA 4XK8E 4J6WA 2LC4A 2XDPA 1BIAA 2EWNA 2DL7A 2YLCA 1SRMA 3GBQA 2DPPB 2BUDA 3ZL7C 1VYVA 2P4RA 4A4HA 5CKDA 5GAN6 1B34B 4M7DC 2D9TA 4M78C 3HSBA 2JUFA 5I2MA 4PJOA 3EG0A 5A0DA 3OS1A 2LT1A 2QASA 4ELYC 4A4FA 1AWXA 5LJ5f 2AKLA 1IXDA 4KGVB 4C8QC 2E6NA 2PZ1A 4R56A 4O6JA 1KSWA 2CYZB 4CC3A 2LQ8A 2K3XA 4PFZA 5KYWB 4XTWA 3CBPA 3RR6A 1KJWA 2L3SA 1WHHA 4M4ZA 3G71T 1QCFA 1RADB 2XICA 4M77C 2EYXA 4C0DC 4KGZB 2R58A 4F7UE 5I21A 3E2UA 5GMKi 3CC7Q 3A8MB 3I55T 1K4US 2X3XD 1TUGB 1VQLQ 2COZA 4D8DA 3QDRB 1MUZA 2A28A 3E9GA 1YIJQ 3L2WA 2DYIA 2EAYA 1ZUUA 1M4ZA 2D6FA 3JB9I 4M7AA 2ZPEB 2L3RA 2DAQA 4C8QD 1T3LA 4PJOB 3VJPA 3EH2A 4M7AG 1B07A 4PJJA 1K8AU 2M1HA 3G6EQ 3LGFA 1ZUKA 2E12A 4IUVA 2ZCFB 4M77D 1VQ5Q 2O4XA 5GAOr 1G2BA 3J80E 2DNUA 5KH6A 2HD0A 3OYCA 1JBMA 4C92C 2KNBB 1MMAA 4FYWB 4JRQA 4JRIA 3FIFA 4JZ3A 2JM9A 4HA8A 3TCJA 1Q86U 2HSEB 4QVDA 3DLLA 3GOXA 2OI3A 3E19A 1NJIC 1M90U 2FB7A 2RN8A 3CXCS 2LMJA 5J3BA 1WIEA 1R8OB 1VQOA 3CCET 4PFOA 2K3BA 4ANJA 3QJYA 2HEQA 4M7AB 4HCBA 2HBPA 2RD1A 1WNLA 5KYXA 2YRVA 3UPUA 4R55A 1GXIE 3KUFA 4N4HA 2KI7A 2A7YA 1IB8A 4NL2A 4C92D 1YJ9A 2FPFA 3QZ5B 2LZ6B 3JB9G 3CMEA 2DBMA 2M51A 1Q81R 2O4XB 1N8RC 2DVJA 4QVCA 1X27A 3OY9A 5LJ5g 4F16A 3QJ6A 1UTIA 1UJYA 2ED0A 5FROA 1GCQA 1C6VX 2EFIA 5CKHA 4EDUA 3OYAA 3EAEA 3CCVQ 1YHQA 1LVKA 1VQ7Q 1OEBA 4E7IA 2RO0A 4LN2A 1HYOA 3H6ZA 1OQKA 2EQKA 3TQ7P 2KVQG 4F7UA 5IHIA 1VQ9T 3I56Q 1VQ4T 4F7UG 2CZ1B 1R0BG 1YJWA 2DVEA 3M57A 4A4GA 1FMWA 2KY9A 4LDXA 1NYGA 5GANf 2LJ3A 2M0OA 1T0JA 5KYXB 5D6XA 3ZEHA 4J83A 4JZ4A 3SWNB 1O9SA 3RMQA 2EYQA 4OP0A 4XQ3A 3VKIA 1X6GA 1QVGS 1YWPA 3CCLA 4Z89A 4J6YA 4AFSC 2J6FA 2YT6A 1UEBA 2L2PA 1U1SA 2KYMA 4C0FA 1X01A 2OTLQ 4DOVA 2DERA 1X2KA 2OTJT 1W70A 4GLKA 1OZ2A 4L59A 4J6XA 4KULA 2RHZA 3VRZA 2AT1B 4J9HA 2VGMA 1NPRA 2AK5A 3CC4A 4PJOC 1QVFP 3CXCA 1SHFA 2EGEA 4RTYA 2NUTA 1QW1A 3MHXA 2NYSA 4RTXA 5GJWB 4J9CA 4DBQA 1W1FA 3TREA 4F7UB 5FRMA 2K3YA 2HCKA 4M75F 3RKYA 4PFPA 4OVAA 2ATCB 1PRMC 1IHWA 1ACMB 3VS7A 1UGQB 2RF0A 3VS3A 2E64A 5KYYA 1WQWA 2PNIA 2KSSA 1UE9A 2O9SA 3TSWA 1BCMA 2O2OA 3ULRB 3CCQQ 1BYMA 4XAXB 1BIBA 1CSKA 3PVQA 2DL4A 1Y96A 5CKEA 2B8AA 4OB1B 1WI7A 4KUDK 1ABQA 2WSCE 3S3OA 3VS1A 1I5OB 2EQUA 3NGPA 4PJOD 1IHVA 1YCSB 1BI1A 4OMQA 2HKQB 4A63B 3N5BB 1RAAB 2DD4A 2JZ2A 3G71A 4J7FA 1UDLA 3HRUA 3PMTA 2HBWA 2BKDN 2RI3A 2RM4A 4MDWA 2A08A 2NUTB 3VS0A 4PJNA 3CCJQ 2MYSA 3CD6Q 4D6WA 2DE0X 4JJNK 2CZ7B 6AT1B 2JTEA 5KYYB 4MZTA 7AT1B 4RKUE 2DFUA 3M54A 3OYEA 3EH1A 2H8HA 5GAN7 3MP6A 2V8JA 2GBQA 1QVGA 3URGA 2MPXC 1VQLT 3KFVA 1YI2Q 3TVTA 1Y96B 1U06A 2L0AA 1K73U 3P8BB 5GANg 2HZYA 3META 1YIJT 2J6OA 3RDVA 2QDLA 2FZKB 5CQXA 3T9NA 3I9QA 2RI5A 2FL7A 1TXQA 2ZAEA 4CI0C 4Z02A 5L8RE 3FDRA 5FLXE 2QA4A 2AIRB 4XU1A 1K73R 4NOYA 3VYHB 2X4XA 1D1AA 3DLMA 4BY6B 5IHNA 5GAMf 3PTAA 4WTOB 2MAMA 2DRMA 4XTYA 3V7SA 3G6ET 4XTVA 4L5GA 2K2VA 4PLIA 4E2FB 2EJGA 4N4IA 1VQ5T 2HKNA 1C1AA 3OBYA 2P4TA 1VQMQ 5CIUA 3BE3A 2AKKA 2CT4A 5GMKm 2HDAA 2VVKA 3PFSA 4C8QG 2ABLA 2RQRA 5D6YA 2RQUA 2QQ9A 1M1FA 4IUQA 3QYHB 4IIMA 3H9NA 1UGRB 2XIDA 2VUBA 3PVLA 1ZA1B 1XNIA 4M77G 4BI8B 1VQ6Q 2D8JA 4OB3B 4FIBA 4QQGA 2QQAA 2PVGB 2JJ9A 1FXXA 4XU0A 4LDYA 2KXDA 2F5TX 4BDYA 2JXBA 2VWFA 2LT4A 4F14A 1TUCA 1WX6A 3MEAA 5AT1B 3F70A 1Z9QA 2D0NA 2GQVA 4ME7A 1UJ0A 4WF2A 4KGXB 3H8ZA 2O31A 2V8IA 1LOJA 1FX7A 4V2SA 2DL3A 4XU3A 2VC8A 3GP8A 4XTUA 1VQ9A 2YDLA 3L42A 3EGXA 1YCYA 1VQ4A 1M3CA 4C0GA 3UT1A 4JRPA 4C92A 4E7SA 1OPLA 2CH4A 5IXFA 1GCPA 2D1XA 3PGGA 1VQ7T 4C92G 3VS6A 4LDUA 3A1PA 3HRTA 3MP8A 4A54A 4KH0B 2E6ZA 5J39A 2QAZA 2QQSA 2FRWA 3UA7A 1TH7A 2JN0A 2OTJA 3IQLA 1TOVA 2ZPHB 3MCAB 2XK0A 4PNOA 2I0NA 1ARKA 4OGEA 3ER0A 4DBRA 3INZA 2YHTA 3M53A 2O01E 4ZN1A 5GAMg 1JJ2A 1MNEA 1MV0B 1BB9A 2DIQA 2O9VA 3QWXX 3JAME 4OF1A 3BW1A 3EGXB 2JM8A 3EGUA 4HKEA 1IO6A 2QDYB 3UATA 1Y07A 1QVPA 1N5ZA 4C92B 1K1ZA 2KQWA 2RHUA 1MMDA 3MEUA 2FO0A 4TVRA 1IZ6A 1AD5A 1E6GA 4DEXA 4BY6C 1WGSA 3WXMB 1V29B 1RACB 3FEOA 5DLOA 1DJ7B 2GNCA 4EMKA 3NTIA 1AHJB 4NS5A 2E3IA 3CPFA 3M59A 2QK0A 3BY7A 2ROLA 1GFDA 1W4SA 2F2VA 1Q7YU 2E5QA 3V7CA 5LJ3d 3GPLA 1A0NB 3CCQT 4RCBA 2E1HA 2C06A 5KYNA 1RABB 4QQDA 1XTDA 3VUZA 3LH0A 2RMOA 2VYTA 2F1LA 3UWNA 5D7UA 1QP3A 2F2XA 3PIOA 2LCCA 1MMNA 1N27A 1NEGA 2PUKB 3HFNA 1ZBJA 1Q81C 5LJ3j 3QXEB 2LRQA 1G83A 2RH2A 4PK4A 1D09B 3CC2T 2KEAA 3CCMQ 1D1CA 1M2VA 4HT9A 2K4YA 4MZPA 3LLRA 5KCHA 3M56A 3CC7A 4JS4A 1TTHB 1VQLA 1JRIA 4N4GA 4RG8A 2C0TA 4X9DA 1YP5A 2FYKA 2FZGB 3CQTA 2EQMA 8ATCB 3CCJT 3LW5E 1RAFB 4PJOG 5FU7B 3CPWA 1YIJA 4EMKB 4BDZA 1UG1A 1M27C 2KT8A 2WSEE 3OW2A 1BI0A 4EMHA 3M4YA 1PM3A 2IG0A 2LJ1A 1ZHIA 3OA6A 1VQKQ 4RTUA 2EPDA 3MO8A 3CMAQ 1YITQ 4M7DF 1WXBA 4JRKA 1YI2T 4M78F 2DM1A 2WSFE 3G6EA 2HQEA 1I1JA 4MMLA 2GF7A 3L2ZA 2R5AA 1HK9A 2F2WA 3CXCP 1VQ5A 2DBKA 1YJNQ 3VV0A 2BZ8A 2AZVA 1EIFA 3G7ZA 1M2VB 3JV3A 1TUDA 1SEMA 1WXTA 1XOVA 3FJPA 2DZ9A 1XQHA 4HXJA 4ZN3A 2P0QA 4FSXA 3JB9H 4J9IA 2M9UA 4YTLA 2XHCA 2Y4YA 1HSQA 1F1BB 1TS9A 2RHIA 1AWWA 2YRCA 1VQMT 2DXBA 2DJQA 3CEYA 1M3BA 1QWEA 3QUIA 3TSZA 1XJWB 1QKXA 4PL6A 3CBMA 1K9MU 3GLXA 4E6RA 1UHCA 1CKBA 3NPFA 2QA4T 2L5QA 3JB9J 2CP7A 1M1KU 2EKOA 1K8AR 1WJQA 3UF4A 1OOTA 2CS7A 2KMTA 4Y92A 4PKCC 1WHMA 2V1RA 5GAOq 2DZCA 1ABOA 3GF5A 3JCMd 3A8HB 5GAN3 2ROTA 2C0IA 1PD0A 4KH1B 1W2BA 4KBMB 3A8LB 4ZGDB 3EFOA 4FSSA 4JPBW 2PQWA 2E65A 1D0YA 3PE0A 2FVUA 3REAB 2YUPA 3HRSA 1NZ9A 1Q86R 3CCVA 1VQ7A 4JDSA 4GBQA 1KQSS 2XI9A 2RQVA 1M90R 1KD1C 1QVGP 3C12A 2GFUA 4K11A 2FEIA 2J06A 2IPOB 3I56A 1VA7A 2QTXA 2DA9A 2VKNA 3U23A 1OZ3A 2DO3A 2BZXA 1U3OA 3NTKA 3QDFA 3PIPA 2RA2A 3JRZA 4J8OA 5I11A 3QWYA 5GMKj 2RPNA 2LDMA 2R5MA 2RI2A 1K0SA 2KXCA 3M0TA 4LXCA 1KFZA 2DRKA 2COWA 4J9EA 1K76A 1QP2A 2FRYA 5KYUA 1VQ8Q 2DX1A 3BDLA 5FU7C 3EG9A 4EMKC 3EFOB 5HY6A 1G5VA 1K73C 2RK2A 3MEWA 1I81A 4LNPA 3MEVA 4ESRA 1S72Q 1Q82U 1PKSA 5HCKA 4BE0A 2H3EB 1NM7A 3JCMP 2EJFA 3RKWA 4QT7A 3OS5A 2DXUA 5CKBA 2F69A 3M0UA 3D7SB 1Q82R 3G4SQ 3OYHA 4PJLA 3CCQA 3AHUA 1JB0E 1FYNA 1O75A 4C0ZA 1YHQQ 1X2QA 3HHTB 1PWTA 2YUNA 1B7TA 1VQPQ 1UECA 4KUIA 2DD5A 1VIEA 2JS0A 4RTVA 5A0GA 3OYMA 1WXUA 4FL6A 3LH5A 2HAXA 5KYUB 2E70A 2EJ9A 2KBTA 3EG9B 5CCAA 1JXOA 2A0FB 4JJBA 1KK7A 1X75C 3FLGA 3CC2A 5J26A 3JCMh 4UC4A 3JCMc 1FWZA 1KQSA 5DM7R 2DETA 4XTXA 2LQNA 2YWWA 3R6OA 4X9CA 5GJVB 3JCMV 3AT1B 3OS2A 4JS5A 4Q5WA 1PKTA 5GAOp 3CCUQ 3CCLQ 2ZZDA 1RAIB 3CCJA 3QBYA 3VYGA 2EKHA 4FU6A 4OMFB 3I5SA 3L2QA 5LJ3e 1H3HA 2HQHA 4ORZA 4FT4A 5GMKh 1BKBA 2QQRA 1D1BA 3CCMT 1OYXA 3SDZA
chains in the Genus database with same CATH topology
2LNHB 2ECZA 1UJ0A 2O31A 2DL7A 4IIOA 1SRMA 3GBQA 2KE9A 1BBZA 3ZL7C 1SPKA 1VYVA 2DL3A 2CREA 2P4RA 4CC7A 2YDLA 2JW4A 2PTKA 2EVRA 1M3CA 2KRSA 4JJCA 3EG0A 5FWCA 2J7IA 2CH4W 3VS2A 2CUBA 1AWXA 1OPLA 1I0CA 1VYUA 2CH4A 5IXFA 1GCPA 2D1XA 1WFWA 1LCKA 1QWFA 2AKLA 4EIKA 3VS6A 4RTWA 2PZ1A 1KSWA 3EG2A 4CC3A 5FW9A 1S1NA 1UGVA 2B86A 1KJWA 2L3SA 2FRWA 2LX7A 4M4ZA 3UA7A 1QCFA 2EYXA 3IQLA 1RI9A 1K4US 2X3XD 4D8KA 4D8DA 1MUZA 2A28A 4OMOA 4AFUC 2FPEA 4AFQC 2I0NA 1ARKA 1AWJA 1MV3A 4HVVA 1ZUUA 1AZEA 1NYFA 2KRNA 2GQIA 1MV0B 1BB9A 2O9VA 3QWXX 2JM8A 3EGUA 1IO6A 1T3LA 1UUEA 3UATA 1UFFA 1N5ZA 1B07A 1K1ZA 2C0OA 2JS2A 3R6NA 2FO0A 1ZUKA 3H41A 2MCNA 1AWOA 1AD5A 1E6GA 4DEXA 1BK2A 4AFZC 2XMFA 2DLPA 4J9DA 2MOXA 1G2BA 1JQQA 2GNCA 2KR3A 2DNUA 2V1QA 2YUQA 1JEGA 1E7OA 2ROLA 1GFDA 1K0XA 2KNBB 2EGCA 2F2VA 2KROA 1NLOC 2HSPA 1A0NB 1M8MA 4F17A 4JZ3A 2JM9A 3M0SA 2OI3A 2DL5A 2RN8A 2LCSA 2LMJA 2X3WD 2NWMA 2RMOA 2SRCA 1WIEA 3UA6A 2EYWA 2GTJA 5IH2A 2K3BA 2F2XA 1H8KA 2HEQA 1NEGA 2G6FX 1AEYA 1ZBJA 2BZYA 3REBB 1G83A 4KRTA 4HVUA 3SEMA 2KEAA 2CDTA 1RLQC 4GLMA 1PNJA 2W0ZA 5IHKA 2FPFA 2LZ6B 1NLPC 1X6BA 1Y57A 2C0TA 1YNZA 2ESWA 3VS4A 1YP5A 2DBMA 2DMOA 2M51A 3CQTA 1ZUYA 2YUOA 2DVJA 1QLYA 1X27A 4F16A 2K2MA 1UG1A 1UTIA 1AOJA 1M27C 1UJYA 2KT8A 2ED0A 3M0QA 3VRYA 1GCQA 1HD3A 2K79A 3H0HA 1WA7A 2EGAA 2LJ1A 1YN8A 4J9GA 1OEBA 4LN2A 4RTUA 2EPDA 1KIKA 1WXBA 1Y0MA 1VYTA 2DM1A 5IHIA 1I1JA 2OJ2A 2MIOA 1SSHA 3O5ZA 3RNJA 3EHQA 2F2WA 2KGTA 5FWBA 1M30A 2DBKA 1X43A 1X69A 2BZ8A 2CT3A 1NYGA 2GGRA 2LJ3A 2AZVA 1T0JA 2K7AA 4LUEA 3EHRA 4JZ4A 3JV3A 3M0PA 2OAWA 1WLPB 1TUDA 2DL8A 1SEMA 1WXTA 1X6GA 1XOVA 2EQIA 2J6KA 4HXJA 1YWPA 4Z89A 2W10A 1E6HA 1M3AA 4AFSC 2J6FA 4J9IA 2YT6A 2L2PA 2KYMA 1ZX6A 2KRMA 1HSQA 1AWWA 4Z88A 2BTTA 4RUGA 1X2KA 2DJQA 2DILA 2O88A 1W70A 2FPDA 2SEMA 1M3BA 3VRZA 1QWEA 2J05A 3TSZA 1V1CA 1QKXA 1OV3A 4E6RA 4J9HA 1UHCA 1CKBA 3NPFA 2AK5A 2M0YA 4LUDA 2RQWA 1WYXA 1GRIA 3UF4A 3H0IA 1SHFA 2EGEA 4RTYA 1OOTA 4Y92A 4RTXA 5GJWB 4J9CA 1OPKA 1W1FA 2V1RA 2LP5A 2HCKA 3EG3A 1T0HA 1ZLMA 1ABOA 1PRMC 1GFCA 3VS7A 2ROTA 2C0IA 2NUZA 2RF0A 3VS3A 1AVZC 1GCQC 2CUDA 2PNIA 3I5RA 4J9FA 5IXBA 1UE9A 3NMZC 3RBBB 2O9SA 2DF6A 2K6DA 4LE9A 3FJ5A 2O2OA 3TSWA 3ULRB 4FSSA 4JPBW 4WCIA 1CSKA 3PVQA 2DL4A 1HJDA 3PE0A 4J9BA 3REAB 4OMLA 1JXMA 1WI7A 2YUPA 4OMPA 1ABQA 3VS1A 4GBQA 1GBQA 2RQVA 2CSIA 3NGPA 1WDXA 1AZGB 1JU5C 1GL5A 4K11A 1YCSB 2FEIA 1T3SA 2J06A 2YSQA 5ECAA 1VA7A 4OMQA 4CC4B 4AG2C 2DA9A 4A63B 1NEBA 1PRLC 2EYZA 2VKNA 1K9AA 3U23A 2DYBA 2BZXA 4ZNXA 1U3OA 2CSQA 2D8HA 1UDLA 5I22A 5I11A 2HBWA 3QWYA 2RPNA 1FMKA 2A08A 2FG0A 3VS0A 1K0SA 2KXCA 3M0TA 1KFZA 1RLPC 2DE0X 4JJDA 2DRKA 4J9EA 3SHWA 4HCKA 1SHGA 1K76A 2AZSA 2JTEA 1U5SA 2FRYA 1B3QA 2LQWA 2DX1A 2KT1A 1NG2A 1W6XA 2H8HA 4RTTA 2GBQA 3M0RA 4OMMA 3KFVA 3TVTA 1U06A 4AG1C 2L0AA 2EW3A 2EBPA 1J3TA 1TG0A 2J6OA 1SRLA 2QDLA 4LNPA 4ESRA 3I9QA 4OMNA 1PKSA 5HCKA 2JMAA 4RTZA 4R0KA 1NM7A 2EYYA 4QT7A 2JMCA 2ED1A 3A98A 4DEYA 5IHNA 3M0UA 4CC2A 2DRMA 1JO8A 3H0FA 2ENMA 2IIMA 1FYNA 4HVWA 5L23A 1PHTA 1X2QA 1YWOA 1RUWA 1PWTA 2K9GA 2YUNA 1CKAA 3VS5A 3I35A 1UECA 2AKKA 2CT4A 4X1VA 1I07A 2HDAA 2LJ0A 2JS0A 4RTVA 1WXUA 1H92A 3LH5A 5EC7A 1UHFA 2VVKA 3NHNA 2L3PA 1BU1A 2E5KA 2ABLA 2KBTA 2RQRA 2RQUA 1JXOA 4IIMA 4JJBA 1GBRA 2A37A 1EFNA 4Z8AA 1ZSGA 3PVLA 2LQNA 5GJVB 2D8JA 3EG1A 2L3QA 1PKTA 2A36A 2GTOA 2EKHA 2KXDA 2RNAA 2JXBA 2VWFA 3I5SA 4F14A 1TUCA 1Z9ZA 2KYBA 3THKA 4ORZA 1H3HA 1WX6A 3C0CA 2RQTA 1QKWA 1Z9QA 2D0NA 2JT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNH B;  2ECZ A;  1UJ0 A;  2O31 A;  2DL7 A;  4IIO A;  1SRM A;  3GBQ A;  2KE9 A;  1BBZ A;  3ZL7 C;  1SPK A;  1VYV A;  2DL3 A;  2CRE A;  2P4R A;  4CC7 A;  2YDL A;  2JW4 A;  2PTK A;  2EVR A;  1M3C A;  2KRS A;  4JJC A;  3EG0 A;  5FWC A;  2J7I A;  2CH4 W;  3VS2 A;  2CUB A;  1AWX A;  1OPL A;  1I0C A;  1VYU A;  2CH4 A;  5IXF A;  1GCP A;  2D1X A;  1WFW A;  1LCK A;  1QWF A;  2AKL A;  4EIK A;  3VS6 A;  4RTW A;  2PZ1 A;  1KSW A;  3EG2 A;  4CC3 A;  5FW9 A;  1S1N A;  1UGV A;  2B86 A;  1KJW A;  2L3S A;  2FRW A;  2LX7 A;  4M4Z A;  3UA7 A;  1QCF A;  2EYX A;  3IQL A;  1RI9 A;  1K4U S;  2X3X D;  4D8K A;  4D8D A;  1MUZ A;  2A28 A;  4OMO A;  4AFU C;  2FPE A;  4AFQ C;  2I0N A;  1ARK A;  1AWJ A;  1MV3 A;  4HVV A;  1ZUU A;  1AZE A;  1NYF A;  2KRN A;  2GQI A;  1MV0 B;  1BB9 A;  2O9V A;  3QWX X;  2JM8 A;  3EGU A;  1IO6 A;  1T3L A;  1UUE A;  3UAT A;  1UFF A;  1N5Z A;  1B07 A;  1K1Z A;  2C0O A;  2JS2 A;  3R6N A;  2FO0 A;  1ZUK A;  3H41 A;  2MCN A;  1AWO A;  1AD5 A;  1E6G A;  4DEX A;  1BK2 A;  4AFZ C;  2XMF A;  2DLP A;  4J9D A;  2MOX A;  1G2B A;  1JQQ A;  2GNC A;  2KR3 A;  2DNU A;  2V1Q A;  2YUQ A;  1JEG A;  1E7O A;  2ROL A;  1GFD A;  1K0X A;  2KNB B;  2EGC A;  2F2V A;  2KRO A;  1NLO C;  2HSP A;  1A0N B;  1M8M A;  4F17 A;  4JZ3 A;  2JM9 A;  3M0S A;  2OI3 A;  2DL5 A;  2RN8 A;  2LCS A;  2LMJ A;  2X3W D;  2NWM A;  2RMO A;  2SRC A;  1WIE A;  3UA6 A;  2EYW A;  2GTJ A;  5IH2 A;  2K3B A;  2F2X A;  1H8K A;  2HEQ A;  1NEG A;  2G6F X;  1AEY A;  1ZBJ A;  2BZY A;  3REB B;  1G83 A;  4KRT A;  4HVU A;  3SEM A;  2KEA A;  2CDT A;  1RLQ C;  4GLM A;  1PNJ A;  2W0Z A;  5IHK A;  2FPF A;  2LZ6 B;  1NLP C;  1X6B A;  1Y57 A;  2C0T A;  1YNZ A;  2ESW A;  3VS4 A;  1YP5 A;  2DBM A;  2DMO A;  2M51 A;  3CQT A;  1ZUY A;  2YUO A;  2DVJ A;  1QLY A;  1X27 A;  4F16 A;  2K2M A;  1UG1 A;  1UTI A;  1AOJ A;  1M27 C;  1UJY A;  2KT8 A;  2ED0 A;  3M0Q A;  3VRY A;  1GCQ A;  1HD3 A;  2K79 A;  3H0H A;  1WA7 A;  2EGA A;  2LJ1 A;  1YN8 A;  4J9G A;  1OEB A;  4LN2 A;  4RTU A;  2EPD A;  1KIK A;  1WXB A;  1Y0M A;  1VYT A;  2DM1 A;  5IHI A;  1I1J A;  2OJ2 A;  2MIO A;  1SSH A;  3O5Z A;  3RNJ A;  3EHQ A;  2F2W A;  2KGT A;  5FWB A;  1M30 A;  2DBK A;  1X43 A;  1X69 A;  2BZ8 A;  2CT3 A;  1NYG A;  2GGR A;  2LJ3 A;  2AZV A;  1T0J A;  2K7A A;  4LUE A;  3EHR A;  4JZ4 A;  3JV3 A;  3M0P A;  2OAW A;  1WLP B;  1TUD A;  2DL8 A;  1SEM A;  1WXT A;  1X6G A;  1XOV A;  2EQI A;  2J6K A;  4HXJ A;  1YWP A;  4Z89 A;  2W10 A;  1E6H A;  1M3A A;  4AFS C;  2J6F A;  4J9I A;  2YT6 A;  2L2P A;  2KYM A;  1ZX6 A;  2KRM A;  1HSQ A;  1AWW A;  4Z88 A;  2BTT A;  4RUG A;  1X2K A;  2DJQ A;  2DIL A;  2O88 A;  1W70 A;  2FPD A;  2SEM A;  1M3B A;  3VRZ A;  1QWE A;  2J05 A;  3TSZ A;  1V1C A;  1QKX A;  1OV3 A;  4E6R A;  4J9H A;  1UHC A;  1CKB A;  3NPF A;  2AK5 A;  2M0Y A;  4LUD A;  2RQW A;  1WYX A;  1GRI A;  3UF4 A;  3H0I A;  1SHF A;  2EGE A;  4RTY A;  1OOT A;  4Y92 A;  4RTX A;  5GJW B;  4J9C A;  1OPK A;  1W1F A;  2V1R A;  2LP5 A;  2HCK A;  3EG3 A;  1T0H A;  1ZLM A;  1ABO A;  1PRM C;  1GFC A;  3VS7 A;  2ROT A;  2C0I A;  2NUZ A;  2RF0 A;  3VS3 A;  1AVZ C;  1GCQ C;  2CUD A;  2PNI A;  3I5R A;  4J9F A;  5IXB A;  1UE9 A;  3NMZ C;  3RBB B;  2O9S A;  2DF6 A;  2K6D A;  4LE9 A;  3FJ5 A;  2O2O A;  3TSW A;  3ULR B;  4FSS A;  4JPB W;  4WCI A;  1CSK A;  3PVQ A;  2DL4 A;  1HJD A;  3PE0 A;  4J9B A;  3REA B;  4OML A;  1JXM A;  1WI7 A;  2YUP A;  4OMP A;  1ABQ A;  3VS1 A;  4GBQ A;  1GBQ A;  2RQV A;  2CSI A;  3NGP A;  1WDX A;  1AZG B;  1JU5 C;  1GL5 A;  4K11 A;  1YCS B;  2FEI A;  1T3S A;  2J06 A;  2YSQ A;  5ECA A;  1VA7 A;  4OMQ A;  4CC4 B;  4AG2 C;  2DA9 A;  4A63 B;  1NEB A;  1PRL C;  2EYZ A;  2VKN A;  1K9A A;  3U23 A;  2DYB A;  2BZX A;  4ZNX A;  1U3O A;  2CSQ A;  2D8H A;  1UDL A;  5I22 A;  5I11 A;  2HBW A;  3QWY A;  2RPN A;  1FMK A;  2A08 A;  2FG0 A;  3VS0 A;  1K0S A;  2KXC A;  3M0T A;  1KFZ A;  1RLP C;  2DE0 X;  4JJD A;  2DRK A;  4J9E A;  3SHW A;  4HCK A;  1SHG A;  1K76 A;  2AZS A;  2JTE A;  1U5S A;  2FRY A;  1B3Q A;  2LQW A;  2DX1 A;  2KT1 A;  1NG2 A;  1W6X A;  2H8H A;  4RTT A;  2GBQ A;  3M0R A;  4OMM A;  3KFV A;  3TVT A;  1U06 A;  4AG1 C;  2L0A A;  2EW3 A;  2EBP A;  1J3T A;  1TG0 A;  2J6O A;  1SRL A;  2QDL A;  4LNP A;  4ESR A;  3I9Q A;  4OMN A;  1PKS A;  5HCK A;  2JMA A;  4RTZ A;  4R0K A;  1NM7 A;  2EYY A;  4QT7 A;  2JMC A;  2ED1 A;  3A98 A;  4DEY A;  5IHN A;  3M0U A;  4CC2 A;  2DRM A;  1JO8 A;  3H0F A;  2ENM A;  2IIM A;  1FYN A;  4HVW A;  5L23 A;  1PHT A;  1X2Q A;  1YWO A;  1RUW A;  1PWT A;  2K9G A;  2YUN A;  1CKA A;  3VS5 A;  3I35 A;  1UEC A;  2AKK A;  2CT4 A;  4X1V A;  1I07 A;  2HDA A;  2LJ0 A;  2JS0 A;  4RTV A;  1WXU A;  1H92 A;  3LH5 A;  5EC7 A;  1UHF A;  2VVK A;  3NHN A;  2L3P A;  1BU1 A;  2E5K A;  2ABL A;  2KBT A;  2RQR A;  2RQU A;  1JXO A;  4IIM A;  4JJB A;  1GBR A;  2A37 A;  1EFN A;  4Z8A A;  1ZSG A;  3PVL A;  2LQN A;  5GJV B;  2D8J A;  3EG1 A;  2L3Q A;  1PKT A;  2A36 A;  2GTO A;  2EKH A;  2KXD A;  2RNA A;  2JXB A;  2VWF A;  3I5S A;  4F14 A;  1TUC A;  1Z9Z A;  2KYB A;  3THK A;  4ORZ A;  1H3H A;  1WX6 A;  3C0C A;  2RQT A;  1QKW A;  1Z9Q A;  2D0N A;  2JT4 A; 
#chains in the Genus database with same CATH topology
 1TU0 B;  2L89 A;  2QQB A;  3PNW C;  1BBZ A;  1SPK A;  1YI2 A;  4E7J A;  5GAN 5;  2CRE A;  4CC7 A;  3X28 B;  1I8F A;  1WZO A;  2KRS A;  3OSS C;  5FWC A;  3QZ9 B;  4ZTJ A;  1JJ2 P;  5CO7 A;  1I0C A;  1VYU A;  1N8R U;  5FRN A;  3CMA T;  2V26 A;  1SG5 A;  1QQJ A;  5CVI A;  2E4H A;  4RTW A;  4J7I A;  3CC7 T;  3EG2 A;  4FYV B;  4M7A F;  3ZBD A;  3EGD A;  2I2L A;  2MF2 A;  2QYZ A;  3OYJ A;  2LX7 A;  1YJN T;  1VQM A;  3KXT A;  2NLU A;  1RI9 A;  2DIG A;  4O5V A;  4RMO A;  1LPL A;  3MJX A;  3EFR A;  4AFQ C;  4FT2 A;  3HKS A;  3HL8 A;  5D6W A;  3I55 Q;  1N9S A;  3NFC A;  2GQI A;  3OYL A;  2XKO C;  1VQ6 A;  4BI3 A;  2DJZ A;  4F04 B;  5GAO l;  3J81 E;  4FW2 A;  4B6M A;  3H41 A;  1VQN Q;  3HPW A;  2MCN A;  1WJS A;  1JJ2 S;  4XTZ A;  1BK2 A;  4A4K A;  2DLP A;  4J9D A;  2MOX A;  1JQQ A;  2G3R A;  2CP3 A;  2QEX Q;  2V1Q A;  2YUQ A;  3EGD B;  3S3N A;  1K0X A;  1NE8 A;  2EGC A;  3RKX A;  2KRO A;  3JB9 F;  1RAG B;  2PVO B;  3CPW P;  1NLO C;  2HSP A;  1M8M A;  4JUV A;  3OW2 P;  4DBF A;  5CAI A;  2LCS A;  3GNF B;  3JCM e;  1KHI A;  2X3W D;  3UA6 A;  2EYW A;  3OYB A;  2CZ6 B;  1TWB A;  2QG9 B;  4C5I A;  2F5K A;  2BZY A;  3J7A F;  5LJ5 d;  4HVU A;  3SEM A;  2RK1 A;  4ZGE B;  4LD9 K;  1RLQ C;  3CCE Q;  3Q1J A;  4M75 E;  2W0Z A;  5IHK A;  5C0M A;  5GMK e;  4F7U F;  4ATO A;  2CP0 A;  4A53 A;  1MND A;  1MHN A;  2DTH A;  2QGF B;  1I4K 1;  4QKU A;  3CCV T;  1QLY A;  2MWO A;  4AT1 B;  2BE9 B;  5LJ5 j;  4LDV A;  3M0Q A;  3VRY A;  1VQ8 T;  3I56 T;  2Y4X A;  3QG1 A;  1NBE B;  1KIK A;  3CPW S;  1M5Q 1;  1Y0M A;  1VYT A;  3OW2 S;  2OX7 A;  1OX9 A;  4MDX A;  2DTI A;  3O5Z A;  3RNJ A;  3EHQ A;  4ELZ C;  2KGT A;  2QTV A;  5GAN 2;  1M30 A;  2GFA A;  2VGN A;  5A0L A;  1WJR A;  1X43 A;  2K7A A;  4LUE A;  3RIR A;  1VQ9 Q;  4JLI A;  3WVD B;  3JCM X;  3A8G B;  2R57 A;  1SSF A;  3A8O B;  2CP5 A;  2NUP A;  2OAW A;  2OTL T;  1W2B P;  2J6K A;  3L2V A;  4II1 A;  3G4S T;  2W10 A;  1E6H A;  2VV5 A;  1K8A C;  2BIV A;  8AT1 B;  2KRM A;  4AMC A;  1BI3 A;  2BTT A;  4RUG A;  2O88 A;  2FPD A;  2J05 A;  1V1C A;  2XU8 A;  4M7A E;  5I2S A;  1D0Z A;  4PJM A;  4PLL A;  3V7R A;  4LUD A;  2PU9 B;  4BAC A;  1GRI A;  3C95 A;  1KC8 U;  3CCM A;  1HXD A;  1Q95 G;  2LP5 A;  3EG3 A;  4BB7 A;  1FMV A;  1G3T A;  2FZC B;  2DK3 A;  3SD4 A;  1ZLM A;  5GAN 4;  3CCS Q;  4B9X A;  2MK5 A;  1Q86 C;  1AVZ C;  3CCU T;  1M90 C;  3QII A;  2CUD A;  4RCC A;  3I5R A;  1KHC A;  5IXB A;  1KC8 R;  3FJ5 A;  4RG2 A;  1Q7Y R;  2HL5 C;  1OI1 A;  2NUP B;  1JXM A;  3GNG A;  3L1A A;  4OMP A;  1W2B S;  3WVE B;  1VQK A;  2CKK A;  3OYG A;  3CMA A;  4M75 A;  2ZPG B;  1R77 A;  2RJF A;  1JU5 C;  1GL5 A;  2XDD A;  1X6O A;  2WAC A;  5ECA A;  4CC4 B;  4M75 G;  2X4J A;  3X25 B;  2YRD A;  2EYZ A;  2LQK A;  2JNG A;  3PMI A;  1K9A A;  2DYB A;  3CD6 T;  3LGL A;  1N9R A;  4ZNX A;  2CSQ A;  1YJN A;  1RAE B;  1FMK A;  3OSV A;  5FU6 C;  1ZBX A;  4EPC A;  2VXF A;  4FYX B;  1RLP C;  3QO3 A;  3SHW A;  3RER A;  4HCK A;  4N0A A;  1SHG A;  5GAN d;  1OUL A;  3CCR Q;  1U5S A;  2LQW A;  2MWP A;  4FW1 A;  2KT1 A;  3SB2 A;  2ZPB B;  1SKU B;  4RTT A;  3FC3 A;  3UDC A;  4OMM A;  3PT9 A;  1G3Y A;  4LDW A;  5GAN j;  3TU4 K;  4C8Q F;  4M75 B;  1Q82 C;  4HT8 A;  4M7D D;  4OMN A;  4M78 D;  1KQS P;  5GAN 8;  4RTZ A;  3TEE A;  3X20 B;  2KDS A;  1G8X A;  2EYY A;  4J5Y A;  1M1G A;  1ZQ1 A;  3P8H A;  4DBH A;  2JMC A;  2ED1 A;  3A98 A;  4M77 F;  3OYI A;  2KAF A;  4FM4 B;  2LCL A;  4GY5 A;  1KQ1 A;  1JO8 A;  1KG1 A;  4OGC A;  1VQN T;  4MZM A;  1NPP A;  1PHT A;  1ZSZ C;  3BDU A;  3HTR A;  2ZGW A;  2LNV A;  3X26 B;  3VS5 A;  1IRX A;  3I35 A;  4X1V A;  2LJ0 A;  2QEX T;  1H92 A;  1UHF A;  2L3P A;  1IGQ A;  5EG2 A;  1VQ6 T;  3OYK A;  1K9M R;  1M2O A;  3JCM b;  5LJ3 h;  2AHJ B;  4E7L A;  4Z8A A;  1M1K R;  1ZSG A;  3JCM W;  5GAO n;  1QMC A;  2YLB A;  2A36 A;  4E7K A;  2P0P A;  2GTO A;  1AT1 B;  1RL2 A;  3THK A;  2CZ0 B;  4Y91 A;  4C92 F;  3C0C A;  3FB9 A;  2RQT A;  1VQ8 A;  1QKW A;  2LX9 A;  2JT4 A;  2E3H A;  4QW2 A;  2LNH B;  2ECZ A;  1OX8 A;  5LJ3 f;  3G1J A;  4IIO A;  1Q81 U;  2KE9 A;  2PVD B;  1I5L A;  4VUB A;  2E41 A;  3A5Z B;  3SWN A;  3EFS A;  5CQY A;  2JW4 A;  2PTK A;  2X4Y A;  2EVR A;  5LJ5 e;  5IAY A;  5M9O A;  1S72 A;  4JJC A;  4QVZ A;  3LWI A;  2J7I A;  2CH4 W;  3VS2 A;  2CUB A;  1UGS B;  2RHY A;  3RUX A;  5GAN h;  1IRE B;  1PSE A;  1WFW A;  1LCK A;  1QWF A;  1ZA2 B;  2HL3 A;  4DQ2 A;  3MPU B;  1VQO Q;  3M4G A;  2OTL A;  4EIK A;  3OMG A;  1PSF A;  2MI6 A;  3G4S A;  2M16 A;  4BI4 A;  2DXT A;  2HNI A;  1Y7X A;  5FW9 A;  2RHX A;  1S1N A;  1UGV A;  2B86 A;  3CBO A;  4E7Z A;  4JLG A;  3E9F A;  5HK0 A;  1VQP A;  1G3W A;  2D0Q B;  4IUT A;  1IGU A;  5GAM d;  4OB0 B;  1YJ9 Q;  3L2U A;  4D8K A;  3CME Q;  2JOY A;  3VU3 C;  4OMO A;  4AFU C;  2FPE A;  4IUR A;  1AWJ A;  3LWH A;  1MV3 A;  4HVV A;  1AZE A;  1NYF A;  3DB3 A;  2EQJ A;  2X51 A;  2KRN A;  4BD3 A;  3M5A A;  5GAM j;  4M75 C;  1UUE A;  3CCU A;  2K57 A;  4M7D E;  4C5H A;  1UFF A;  4M78 E;  5CR2 A;  2ZPI B;  2C0O A;  1D3B A;  2JS2 A;  3R6N A;  1PCX A;  2IVW A;  1AWO A;  1N6A A;  5KE3 A;  4AFZ C;  4BE2 A;  2XMF A;  1YJW Q;  3VUB A;  1KQ2 A;  3QYG B;  2KR3 A;  3CCS T;  3X24 B;  4C8Q E;  1JEG A;  1E7O A;  1H3Z A;  1U8R A;  4N0A C;  2XD0 A;  1WHG A;  3QHS A;  1VIF A;  3OS0 A;  2COY A;  3HP9 A;  4IKF A;  2DTO A;  3L2R A;  4F17 A;  4IUU A;  1P92 A;  5HK3 A;  1UGP B;  3CD6 A;  4M75 D;  2DEQ A;  3M0S A;  4PJO F;  1WHK A;  1EZZ B;  4M77 E;  1C0M A;  1M9S A;  2DL5 A;  1NJI U;  4EMG A;  2NWM A;  2SRC A;  1OU8 A;  2GTJ A;  5IH2 A;  1V76 A;  1H8K A;  2HQX A;  2P0K A;  2K5F A;  3OYY A;  5LJ3 g;  3CC4 Q;  2G6F X;  1AEY A;  3OQ5 A;  3JCM f;  5C6S A;  3REB B;  2CP2 A;  4KRT A;  2CP6 A;  2CDT A;  2H3J A;  2QXF A;  3JSC A;  1NJI R;  4GLM A;  1KD1 U;  1D3B B;  1PNJ A;  9ATC B;  3RES A;  2K5L A;  1NLP C;  1X6B A;  1WHJ A;  2RJD A;  1Y57 A;  3CC2 Q;  1YNZ A;  2ESW A;  3VS4 A;  2X9H A;  2YXY A;  2DMO A;  1QCO A;  1RI0 A;  1ZUY A;  4M7A C;  2YUO A;  4Y28 E;  2RJC A;  1VQK T;  2Y90 A;  2DKG A;  3FRN A;  2K2M A;  4IUP A;  2FHD A;  1LJO A;  1YIT T;  1KD1 R;  1AOJ A;  3I55 A;  3CCR T;  4X34 A;  1HD3 A;  2K79 A;  3H0H A;  1D0X A;  1WA7 A;  2EGA A;  4HCC A;  1QVF S;  1OU9 A;  1YN8 A;  1PD1 A;  4J9G A;  3OYF A;  4HCZ A;  2P84 A;  5AYF A;  4A4E A;  4C92 E;  2QGG A;  1N8R R;  3S3M A;  5GAM h;  5GAN e;  2OJ2 A;  1VQN A;  2MIO A;  1SSH A;  4BUG A;  1MMG A;  4NL3 A;  5FWB A;  1VUB A;  1X69 A;  3G71 Q;  2CT3 A;  2V8K A;  2GGR A;  2QEX A;  5CK9 A;  5GMK l;  4M7A D;  2VB6 A;  1WHL A;  3JCM J;  3EHR A;  3MP1 A;  3M0P A;  1WLP B;  3E1S A;  2DL8 A;  4P5N A;  2EQI A;  1PC0 A;  3V8K A;  1U1T A;  3ASK A;  4M7D A;  2K5I A;  4M78 A;  1M3A A;  4KT0 E;  5DY9 A;  1ZX6 A;  3LX7 A;  4M7D G;  5HKC A;  4M78 G;  4Z88 A;  2QI2 A;  2DIL A;  2SEM A;  2KK4 A;  3SWN C;  4E47 A;  1OV3 A;  1YBY A;  1YFN A;  2M0Y A;  5IT9 E;  3M9Q A;  2RQW A;  1WYX A;  2XG8 D;  4C8Q A;  4DA4 A;  1KC8 C;  1M8V A;  5KCO A;  3H0I A;  4LD6 A;  1Q7Y C;  3CCE A;  1OPK A;  2X35 A;  5KE2 A;  1T0H A;  2VXE A;  1SF9 A;  2QA4 Q;  3QSU A;  3NTH A;  1GFC A;  3M58 A;  4M77 A;  2NUZ A;  5GAO m;  1GCQ C;  1WPY A;  2ZPF B;  2M02 A;  1WQ7 A;  4J9F A;  3NMZ C;  3RBB B;  2DF6 A;  1PG5 B;  2K6D A;  4LE9 A;  3M55 A;  4WCI A;  1HJD A;  4J9B A;  4OML A;  5CKF A;  3DKM A;  3JB9 D;  4ZTF A;  3JCM g;  4OB2 B;  1VOM A;  4M7D B;  3GIB A;  3HFO A;  4M78 B;  1GBQ A;  5FU6 B;  2CSI A;  1ZSZ A;  4DOW A;  1WDX A;  4XU2 A;  1AZG B;  1T3S A;  2YSQ A;  4L6V 5;  1QVF A;  4AG2 C;  3RMS A;  1NEB A;  1PRL C;  4MMK A;  2MMP A;  5IN1 A;  3ME9 A;  3C4S A;  2D8H A;  2CGH A;  5I22 A;  4C8Q B;  3JCM Q;  3OYD A;  1TSF A;  2FG0 A;  2DXC A;  5DLQ E;  1VQO T;  4PJO E;  4JJD A;  2L8D A;  4C5G A;  2AZS A;  2PUO B;  2JVV A;  4C0D B;  4M77 B;  1B3Q A;  1R0C B;  1NG2 A;  1W6X A;  4QQ6 A;  2DEU A;  2JTF A;  1UB4 A;  3C94 A;  1S72 T;  3M0R A;  1YJ9 T;  1G3S A;  3QKJ A;  2HMA A;  2OAU A;  3CME T;  4AG1 C;  2EW3 A;  3QPH A;  2EBP A;  4B9W A;  4FYY B;  1J3T A;  1TG0 A;  2GCX A;  1SRL A;  1VQ4 Q;  1BI2 A;  1ZSZ B;  2BE7 D;  3V8J A;  4ZGJ B;  2JMA A;  4R0K A;  2X4W A;  2EIF A;  5GAM e;  3CCS A;  1YHQ T;  2RJE A;  4FCY A;  1H64 1;  3BFM A;  2JTM A;  4DEY A;  4CRI A;  1VQP T;  2A3L A;  4CC2 A;  3P8D A;  3H0F A;  2ENM A;  2IIM A;  1K9M C;  1BCO A;  4HVW A;  5L23 A;  1YWO A;  1RUW A;  2K9G A;  1M1K C;  1YJW T;  1CKA A;  1B34 A;  1Y71 A;  2OTJ Q;  3DB4 A;  1I07 A;  1RAH B;  2XDB A;  2LVM A;  3O8V A;  5EC7 A;  2VAS A;  3NHN A;  1BU1 A;  2E5K A;  3OBW A;  3OYN A;  3SFM A;  1GBR A;  2A37 A;  3KBG A;  3ZFJ A;  3CCL T;  1EFN A;  3OB9 A;  4BE1 A;  5LL6 S;  2LTO A;  4C5E A;  3EG1 A;  3LYI A;  2L3Q A;  1MGQ A;  5A2Q E;  2RB6 A;  1LNX A;  4E7H A;  2E10 A;  5KYW A;  1EX4 A;  3V8L A;  3CC4 T;  2RNA A;  3OMC A;  5LJ5 h;  1Z9Z A;  2KYB A;  3MKD A;  1YIT A;  2Z0W A;  3CCR A;  1QCN A;  3S6W A;  4XK8 E;  4J6W A;  2LC4 A;  2XDP A;  1BIA A;  2EWN A;  2DL7 A;  2YLC A;  1SRM A;  3GBQ A;  2DPP B;  2BUD A;  3ZL7 C;  1VYV A;  2P4R A;  4A4H A;  5CKD A;  5GAN 6;  1B34 B;  4M7D C;  2D9T A;  4M78 C;  3HSB A;  2JUF A;  5I2M A;  4PJO A;  3EG0 A;  5A0D A;  3OS1 A;  2LT1 A;  2QAS A;  4ELY C;  4A4F A;  1AWX A;  5LJ5 f;  2AKL A;  1IXD A;  4KGV B;  4C8Q C;  2E6N A;  2PZ1 A;  4R56 A;  4O6J A;  1KSW A;  2CYZ B;  4CC3 A;  2LQ8 A;  2K3X A;  4PFZ A;  5KYW B;  4XTW A;  3CBP A;  3RR6 A;  1KJW A;  2L3S A;  1WHH A;  4M4Z A;  3G71 T;  1QCF A;  1RAD B;  2XIC A;  4M77 C;  2EYX A;  4C0D C;  4KGZ B;  2R58 A;  4F7U E;  5I21 A;  3E2U A;  5GMK i;  3CC7 Q;  3A8M B;  3I55 T;  1K4U S;  2X3X D;  1TUG B;  1VQL Q;  2COZ A;  4D8D A;  3QDR B;  1MUZ A;  2A28 A;  3E9G A;  1YIJ Q;  3L2W A;  2DYI A;  2EAY A;  1ZUU A;  1M4Z A;  2D6F A;  3JB9 I;  4M7A A;  2ZPE B;  2L3R A;  2DAQ A;  4C8Q D;  1T3L A;  4PJO B;  3VJP A;  3EH2 A;  4M7A G;  1B07 A;  4PJJ A;  1K8A U;  2M1H A;  3G6E Q;  3LGF A;  1ZUK A;  2E12 A;  4IUV A;  2ZCF B;  4M77 D;  1VQ5 Q;  2O4X A;  5GAO r;  1G2B A;  3J80 E;  2DNU A;  5KH6 A;  2HD0 A;  3OYC A;  1JBM A;  4C92 C;  2KNB B;  1MMA A;  4FYW B;  4JRQ A;  4JRI A;  3FIF A;  4JZ3 A;  2JM9 A;  4HA8 A;  3TCJ A;  1Q86 U;  2HSE B;  4QVD A;  3DLL A;  3GOX A;  2OI3 A;  3E19 A;  1NJI C;  1M90 U;  2FB7 A;  2RN8 A;  3CXC S;  2LMJ A;  5J3B A;  1WIE A;  1R8O B;  1VQO A;  3CCE T;  4PFO A;  2K3B A;  4ANJ A;  3QJY A;  2HEQ A;  4M7A B;  4HCB A;  2HBP A;  2RD1 A;  1WNL A;  5KYX A;  2YRV A;  3UPU A;  4R55 A;  1GXI E;  3KUF A;  4N4H A;  2KI7 A;  2A7Y A;  1IB8 A;  4NL2 A;  4C92 D;  1YJ9 A;  2FPF A;  3QZ5 B;  2LZ6 B;  3JB9 G;  3CME A;  2DBM A;  2M51 A;  1Q81 R;  2O4X B;  1N8R C;  2DVJ A;  4QVC A;  1X27 A;  3OY9 A;  5LJ5 g;  4F16 A;  3QJ6 A;  1UTI A;  1UJY A;  2ED0 A;  5FRO A;  1GCQ A;  1C6V X;  2EFI A;  5CKH A;  4EDU A;  3OYA A;  3EAE A;  3CCV Q;  1YHQ A;  1LVK A;  1VQ7 Q;  1OEB A;  4E7I A;  2RO0 A;  4LN2 A;  1HYO A;  3H6Z A;  1OQK A;  2EQK A;  3TQ7 P;  2KVQ G;  4F7U A;  5IHI A;  1VQ9 T;  3I56 Q;  1VQ4 T;  4F7U G;  2CZ1 B;  1R0B G;  1YJW A;  2DVE A;  3M57 A;  4A4G A;  1FMW A;  2KY9 A;  4LDX A;  1NYG A;  5GAN f;  2LJ3 A;  2M0O A;  1T0J A;  5KYX B;  5D6X A;  3ZEH A;  4J83 A;  4JZ4 A;  3SWN B;  1O9S A;  3RMQ A;  2EYQ A;  4OP0 A;  4XQ3 A;  3VKI A;  1X6G A;  1QVG S;  1YWP A;  3CCL A;  4Z89 A;  4J6Y A;  4AFS C;  2J6F A;  2YT6 A;  1UEB A;  2L2P A;  1U1S A;  2KYM A;  4C0F A;  1X01 A;  2OTL Q;  4DOV A;  2DER A;  1X2K A;  2OTJ T;  1W70 A;  4GLK A;  1OZ2 A;  4L59 A;  4J6X A;  4KUL A;  2RHZ A;  3VRZ A;  2AT1 B;  4J9H A;  2VGM A;  1NPR A;  2AK5 A;  3CC4 A;  4PJO C;  1QVF P;  3CXC A;  1SHF A;  2EGE A;  4RTY A;  2NUT A;  1QW1 A;  3MHX A;  2NYS A;  4RTX A;  5GJW B;  4J9C A;  4DBQ A;  1W1F A;  3TRE A;  4F7U B;  5FRM A;  2K3Y A;  2HCK A;  4M75 F;  3RKY A;  4PFP A;  4OVA A;  2ATC B;  1PRM C;  1IHW A;  1ACM B;  3VS7 A;  1UGQ B;  2RF0 A;  3VS3 A;  2E64 A;  5KYY A;  1WQW A;  2PNI A;  2KSS A;  1UE9 A;  2O9S A;  3TSW A;  1BCM A;  2O2O A;  3ULR B;  3CCQ Q;  1BYM A;  4XAX B;  1BIB A;  1CSK A;  3PVQ A;  2DL4 A;  1Y96 A;  5CKE A;  2B8A A;  4OB1 B;  1WI7 A;  4KUD K;  1ABQ A;  2WSC E;  3S3O A;  3VS1 A;  1I5O B;  2EQU A;  3NGP A;  4PJO D;  1IHV A;  1YCS B;  1BI1 A;  4OMQ A;  2HKQ B;  4A63 B;  3N5B B;  1RAA B;  2DD4 A;  2JZ2 A;  3G71 A;  4J7F A;  1UDL A;  3HRU A;  3PMT A;  2HBW A;  2BKD N;  2RI3 A;  2RM4 A;  4MDW A;  2A08 A;  2NUT B;  3VS0 A;  4PJN A;  3CCJ Q;  2MYS A;  3CD6 Q;  4D6W A;  2DE0 X;  4JJN K;  2CZ7 B;  6AT1 B;  2JTE A;  5KYY B;  4MZT A;  7AT1 B;  4RKU E;  2DFU A;  3M54 A;  3OYE A;  3EH1 A;  2H8H A;  5GAN 7;  3MP6 A;  2V8J A;  2GBQ A;  1QVG A;  3URG A;  2MPX C;  1VQL T;  3KFV A;  1YI2 Q;  3TVT A;  1Y96 B;  1U06 A;  2L0A A;  1K73 U;  3P8B B;  5GAN g;  2HZY A;  3MET A;  1YIJ T;  2J6O A;  3RDV A;  2QDL A;  2FZK B;  5CQX A;  3T9N A;  3I9Q A;  2RI5 A;  2FL7 A;  1TXQ A;  2ZAE A;  4CI0 C;  4Z02 A;  5L8R E;  3FDR A;  5FLX E;  2QA4 A;  2AIR B;  4XU1 A;  1K73 R;  4NOY A;  3VYH B;  2X4X A;  1D1A A;  3DLM A;  4BY6 B;  5IHN A;  5GAM f;  3PTA A;  4WTO B;  2MAM A;  2DRM A;  4XTY A;  3V7S A;  3G6E T;  4XTV A;  4L5G A;  2K2V A;  4PLI A;  4E2F B;  2EJG A;  4N4I A;  1VQ5 T;  2HKN A;  1C1A A;  3OBY A;  2P4T A;  1VQM Q;  5CIU A;  3BE3 A;  2AKK A;  2CT4 A;  5GMK m;  2HDA A;  2VVK A;  3PFS A;  4C8Q G;  2ABL A;  2RQR A;  5D6Y A;  2RQU A;  2QQ9 A;  1M1F A;  4IUQ A;  3QYH B;  4IIM A;  3H9N A;  1UGR B;  2XID A;  2VUB A;  3PVL A;  1ZA1 B;  1XNI A;  4M77 G;  4BI8 B;  1VQ6 Q;  2D8J A;  4OB3 B;  4FIB A;  4QQG A;  2QQA A;  2PVG B;  2JJ9 A;  1FXX A;  4XU0 A;  4LDY A;  2KXD A;  2F5T X;  4BDY A;  2JXB A;  2VWF A;  2LT4 A;  4F14 A;  1TUC A;  1WX6 A;  3MEA A;  5AT1 B;  3F70 A;  1Z9Q A;  2D0N A;  2GQV A;  4ME7 A;  1UJ0 A;  4WF2 A;  4KGX B;  3H8Z A;  2O31 A;  2V8I A;  1LOJ A;  1FX7 A;  4V2S A;  2DL3 A;  4XU3 A;  2VC8 A;  3GP8 A;  4XTU A;  1VQ9 A;  2YDL A;  3L42 A;  3EGX A;  1YCY A;  1VQ4 A;  1M3C A;  4C0G A;  3UT1 A;  4JRP A;  4C92 A;  4E7S A;  1OPL A;  2CH4 A;  5IXF A;  1GCP A;  2D1X A;  3PGG A;  1VQ7 T;  4C92 G;  3VS6 A;  4LDU A;  3A1P A;  3HRT A;  3MP8 A;  4A54 A;  4KH0 B;  2E6Z A;  5J39 A;  2QAZ A;  2QQS A;  2FRW A;  3UA7 A;  1TH7 A;  2JN0 A;  2OTJ A;  3IQL A;  1TOV A;  2ZPH B;  3MCA B;  2XK0 A;  4PNO A;  2I0N A;  1ARK A;  4OGE A;  3ER0 A;  4DBR A;  3INZ A;  2YHT A;  3M53 A;  2O01 E;  4ZN1 A;  5GAM g;  1JJ2 A;  1MNE A;  1MV0 B;  1BB9 A;  2DIQ A;  2O9V A;  3QWX X;  3JAM E;  4OF1 A;  3BW1 A;  3EGX B;  2JM8 A;  3EGU A;  4HKE A;  1IO6 A;  2QDY B;  3UAT A;  1Y07 A;  1QVP A;  1N5Z A;  4C92 B;  1K1Z A;  2KQW A;  2RHU A;  1MMD A;  3MEU A;  2FO0 A;  4TVR A;  1IZ6 A;  1AD5 A;  1E6G A;  4DEX A;  4BY6 C;  1WGS A;  3WXM B;  1V29 B;  1RAC B;  3FEO A;  5DLO A;  1DJ7 B;  2GNC A;  4EMK A;  3NTI A;  1AHJ B;  4NS5 A;  2E3I A;  3CPF A;  3M59 A;  2QK0 A;  3BY7 A;  2ROL A;  1GFD A;  1W4S A;  2F2V A;  1Q7Y U;  2E5Q A;  3V7C A;  5LJ3 d;  3GPL A;  1A0N B;  3CCQ T;  4RCB A;  2E1H A;  2C06 A;  5KYN A;  1RAB B;  4QQD A;  1XTD A;  3VUZ A;  3LH0 A;  2RMO A;  2VYT A;  2F1L A;  3UWN A;  5D7U A;  1QP3 A;  2F2X A;  3PIO A;  2LCC A;  1MMN A;  1N27 A;  1NEG A;  2PUK B;  3HFN A;  1ZBJ A;  1Q81 C;  5LJ3 j;  3QXE B;  2LRQ A;  1G83 A;  2RH2 A;  4PK4 A;  1D09 B;  3CC2 T;  2KEA A;  3CCM Q;  1D1C A;  1M2V A;  4HT9 A;  2K4Y A;  4MZP A;  3LLR A;  5KCH A;  3M56 A;  3CC7 A;  4JS4 A;  1TTH B;  1VQL A;  1JRI A;  4N4G A;  4RG8 A;  2C0T A;  4X9D A;  1YP5 A;  2FYK A;  2FZG B;  3CQT A;  2EQM A;  8ATC B;  3CCJ T;  3LW5 E;  1RAF B;  4PJO G;  5FU7 B;  3CPW A;  1YIJ A;  4EMK B;  4BDZ A;  1UG1 A;  1M27 C;  2KT8 A;  2WSE E;  3OW2 A;  1BI0 A;  4EMH A;  3M4Y A;  1PM3 A;  2IG0 A;  2LJ1 A;  1ZHI A;  3OA6 A;  1VQK Q;  4RTU A;  2EPD A;  3MO8 A;  3CMA Q;  1YIT Q;  4M7D F;  1WXB A;  4JRK A;  1YI2 T;  4M78 F;  2DM1 A;  2WSF E;  3G6E A;  2HQE A;  1I1J A;  4MML A;  2GF7 A;  3L2Z A;  2R5A A;  1HK9 A;  2F2W A;  3CXC P;  1VQ5 A;  2DBK A;  1YJN Q;  3VV0 A;  2BZ8 A;  2AZV A;  1EIF A;  3G7Z A;  1M2V B;  3JV3 A;  1TUD A;  1SEM A;  1WXT A;  1XOV A;  3FJP A;  2DZ9 A;  1XQH A;  4HXJ A;  4ZN3 A;  2P0Q A;  4FSX A;  3JB9 H;  4J9I A;  2M9U A;  4YTL A;  2XHC A;  2Y4Y A;  1HSQ A;  1F1B B;  1TS9 A;  2RHI A;  1AWW A;  2YRC A;  1VQM T;  2DXB A;  2DJQ A;  3CEY A;  1M3B A;  1QWE A;  3QUI A;  3TSZ A;  1XJW B;  1QKX A;  4PL6 A;  3CBM A;  1K9M U;  3GLX A;  4E6R A;  1UHC A;  1CKB A;  3NPF A;  2QA4 T;  2L5Q A;  3JB9 J;  2CP7 A;  1M1K U;  2EKO A;  1K8A R;  1WJQ A;  3UF4 A;  1OOT A;  2CS7 A;  2KMT A;  4Y92 A;  4PKC C;  1WHM A;  2V1R A;  5GAO q;  2DZC A;  1ABO A;  3GF5 A;  3JCM d;  3A8H B;  5GAN 3;  2ROT A;  2C0I A;  1PD0 A;  4KH1 B;  1W2B A;  4KBM B;  3A8L B;  4ZGD B;  3EFO A;  4FSS A;  4JPB W;  2PQW A;  2E65 A;  1D0Y A;  3PE0 A;  2FVU A;  3REA B;  2YUP A;  3HRS A;  1NZ9 A;  1Q86 R;  3CCV A;  1VQ7 A;  4JDS A;  4GBQ A;  1KQS S;  2XI9 A;  2RQV A;  1M90 R;  1KD1 C;  1QVG P;  3C12 A;  2GFU A;  4K11 A;  2FEI A;  2J06 A;  2IPO B;  3I56 A;  1VA7 A;  2QTX A;  2DA9 A;  2VKN A;  3U23 A;  1OZ3 A;  2DO3 A;  2BZX A;  1U3O A;  3NTK A;  3QDF A;  3PIP A;  2RA2 A;  3JRZ A;  4J8O A;  5I11 A;  3QWY A;  5GMK j;  2RPN A;  2LDM A;  2R5M A;  2RI2 A;  1K0S A;  2KXC A;  3M0T A;  4LXC A;  1KFZ A;  2DRK A;  2COW A;  4J9E A;  1K76 A;  1QP2 A;  2FRY A;  5KYU A;  1VQ8 Q;  2DX1 A;  3BDL A;  5FU7 C;  3EG9 A;  4EMK C;  3EFO B;  5HY6 A;  1G5V A;  1K73 C;  2RK2 A;  3MEW A;  1I81 A;  4LNP A;  3MEV A;  4ESR A;  1S72 Q;  1Q82 U;  1PKS A;  5HCK A;  4BE0 A;  2H3E B;  1NM7 A;  3JCM P;  2EJF A;  3RKW A;  4QT7 A;  3OS5 A;  2DXU A;  5CKB A;  2F69 A;  3M0U A;  3D7S B;  1Q82 R;  3G4S Q;  3OYH A;  4PJL A;  3CCQ A;  3AHU A;  1JB0 E;  1FYN A;  1O75 A;  4C0Z A;  1YHQ Q;  1X2Q A;  3HHT B;  1PWT A;  2YUN A;  1B7T A;  1VQP Q;  1UEC A;  4KUI A;  2DD5 A;  1VIE A;  2JS0 A;  4RTV A;  5A0G A;  3OYM A;  1WXU A;  4FL6 A;  3LH5 A;  2HAX A;  5KYU B;  2E70 A;  2EJ9 A;  2KBT A;  3EG9 B;  5CCA A;  1JXO A;  2A0F B;  4JJB A;  1KK7 A;  1X75 C;  3FLG A;  3CC2 A;  5J26 A;  3JCM h;  4UC4 A;  3JCM c;  1FWZ A;  1KQS A;  5DM7 R;  2DET A;  4XTX A;  2LQN A;  2YWW A;  3R6O A;  4X9C A;  5GJV B;  3JCM V;  3AT1 B;  3OS2 A;  4JS5 A;  4Q5W A;  1PKT A;  5GAO p;  3CCU Q;  3CCL Q;  2ZZD A;  1RAI B;  3CCJ A;  3QBY A;  3VYG A;  2EKH A;  4FU6 A;  4OMF B;  3I5S A;  3L2Q A;  5LJ3 e;  1H3H A;  2HQH A;  4ORZ A;  4FT4 A;  5GMK h;  1BKB A;  2QQR A;  1D1B A;  3CCM T;  1OYX A;  3SDZ A; 
#chains in the Genus database with same CATH homology
 2LNH B;  2ECZ A;  1UJ0 A;  2O31 A;  2DL7 A;  4IIO A;  1SRM A;  3GBQ A;  2KE9 A;  1BBZ A;  3ZL7 C;  1SPK A;  1VYV A;  2DL3 A;  2CRE A;  2P4R A;  4CC7 A;  2YDL A;  2JW4 A;  2PTK A;  2EVR A;  1M3C A;  2KRS A;  4JJC A;  3EG0 A;  5FWC A;  2J7I A;  2CH4 W;  3VS2 A;  2CUB A;  1AWX A;  1OPL A;  1I0C A;  1VYU A;  2CH4 A;  5IXF A;  1GCP A;  2D1X A;  1WFW A;  1LCK A;  1QWF A;  2AKL A;  4EIK A;  3VS6 A;  4RTW A;  2PZ1 A;  1KSW A;  3EG2 A;  4CC3 A;  5FW9 A;  1S1N A;  1UGV A;  2B86 A;  1KJW A;  2L3S A;  2FRW A;  2LX7 A;  4M4Z A;  3UA7 A;  1QCF A;  2EYX A;  3IQL A;  1RI9 A;  1K4U S;  2X3X D;  4D8K A;  4D8D A;  1MUZ A;  2A28 A;  4OMO A;  4AFU C;  2FPE A;  4AFQ C;  2I0N A;  1ARK A;  1AWJ A;  1MV3 A;  4HVV A;  1ZUU A;  1AZE A;  1NYF A;  2KRN A;  2GQI A;  1MV0 B;  1BB9 A;  2O9V A;  3QWX X;  2JM8 A;  3EGU A;  1IO6 A;  1T3L A;  1UUE A;  3UAT A;  1UFF A;  1N5Z A;  1B07 A;  1K1Z A;  2C0O A;  2JS2 A;  3R6N A;  2FO0 A;  1ZUK A;  3H41 A;  2MCN A;  1AWO A;  1AD5 A;  1E6G A;  4DEX A;  1BK2 A;  4AFZ C;  2XMF A;  2DLP A;  4J9D A;  2MOX A;  1G2B A;  1JQQ A;  2GNC A;  2KR3 A;  2DNU A;  2V1Q A;  2YUQ A;  1JEG A;  1E7O A;  2ROL A;  1GFD A;  1K0X A;  2KNB B;  2EGC A;  2F2V A;  2KRO A;  1NLO C;  2HSP A;  1A0N B;  1M8M A;  4F17 A;  4JZ3 A;  2JM9 A;  3M0S A;  2OI3 A;  2DL5 A;  2RN8 A;  2LCS A;  2LMJ A;  2X3W D;  2NWM A;  2RMO A;  2SRC A;  1WIE A;  3UA6 A;  2EYW A;  2GTJ A;  5IH2 A;  2K3B A;  2F2X A;  1H8K A;  2HEQ A;  1NEG A;  2G6F X;  1AEY A;  1ZBJ A;  2BZY A;  3REB B;  1G83 A;  4KRT A;  4HVU A;  3SEM A;  2KEA A;  2CDT A;  1RLQ C;  4GLM A;  1PNJ A;  2W0Z A;  5IHK A;  2FPF A;  2LZ6 B;  1NLP C;  1X6B A;  1Y57 A;  2C0T A;  1YNZ A;  2ESW A;  3VS4 A;  1YP5 A;  2DBM A;  2DMO A;  2M51 A;  3CQT A;  1ZUY A;  2YUO A;  2DVJ A;  1QLY A;  1X27 A;  4F16 A;  2K2M A;  1UG1 A;  1UTI A;  1AOJ A;  1M27 C;  1UJY A;  2KT8 A;  2ED0 A;  3M0Q A;  3VRY A;  1GCQ A;  1HD3 A;  2K79 A;  3H0H A;  1WA7 A;  2EGA A;  2LJ1 A;  1YN8 A;  4J9G A;  1OEB A;  4LN2 A;  4RTU A;  2EPD A;  1KIK A;  1WXB A;  1Y0M A;  1VYT A;  2DM1 A;  5IHI A;  1I1J A;  2OJ2 A;  2MIO A;  1SSH A;  3O5Z A;  3RNJ A;  3EHQ A;  2F2W A;  2KGT A;  5FWB A;  1M30 A;  2DBK A;  1X43 A;  1X69 A;  2BZ8 A;  2CT3 A;  1NYG A;  2GGR A;  2LJ3 A;  2AZV A;  1T0J A;  2K7A A;  4LUE A;  3EHR A;  4JZ4 A;  3JV3 A;  3M0P A;  2OAW A;  1WLP B;  1TUD A;  2DL8 A;  1SEM A;  1WXT A;  1X6G A;  1XOV A;  2EQI A;  2J6K A;  4HXJ A;  1YWP A;  4Z89 A;  2W10 A;  1E6H A;  1M3A A;  4AFS C;  2J6F A;  4J9I A;  2YT6 A;  2L2P A;  2KYM A;  1ZX6 A;  2KRM A;  1HSQ A;  1AWW A;  4Z88 A;  2BTT A;  4RUG A;  1X2K A;  2DJQ A;  2DIL A;  2O88 A;  1W70 A;  2FPD A;  2SEM A;  1M3B A;  3VRZ A;  1QWE A;  2J05 A;  3TSZ A;  1V1C A;  1QKX A;  1OV3 A;  4E6R A;  4J9H A;  1UHC A;  1CKB A;  3NPF A;  2AK5 A;  2M0Y A;  4LUD A;  2RQW A;  1WYX A;  1GRI A;  3UF4 A;  3H0I A;  1SHF A;  2EGE A;  4RTY A;  1OOT A;  4Y92 A;  4RTX A;  5GJW B;  4J9C A;  1OPK A;  1W1F A;  2V1R A;  2LP5 A;  2HCK A;  3EG3 A;  1T0H A;  1ZLM A;  1ABO A;  1PRM C;  1GFC A;  3VS7 A;  2ROT A;  2C0I A;  2NUZ A;  2RF0 A;  3VS3 A;  1AVZ C;  1GCQ C;  2CUD A;  2PNI A;  3I5R A;  4J9F A;  5IXB A;  1UE9 A;  3NMZ C;  3RBB B;  2O9S A;  2DF6 A;  2K6D A;  4LE9 A;  3FJ5 A;  2O2O A;  3TSW A;  3ULR B;  4FSS A;  4JPB W;  4WCI A;  1CSK A;  3PVQ A;  2DL4 A;  1HJD A;  3PE0 A;  4J9B A;  3REA B;  4OML A;  1JXM A;  1WI7 A;  2YUP A;  4OMP A;  1ABQ A;  3VS1 A;  4GBQ A;  1GBQ A;  2RQV A;  2CSI A;  3NGP A;  1WDX A;  1AZG B;  1JU5 C;  1GL5 A;  4K11 A;  1YCS B;  2FEI A;  1T3S A;  2J06 A;  2YSQ A;  5ECA A;  1VA7 A;  4OMQ A;  4CC4 B;  4AG2 C;  2DA9 A;  4A63 B;  1NEB A;  1PRL C;  2EYZ A;  2VKN A;  1K9A A;  3U23 A;  2DYB A;  2BZX A;  4ZNX A;  1U3O A;  2CSQ A;  2D8H A;  1UDL A;  5I22 A;  5I11 A;  2HBW A;  3QWY A;  2RPN A;  1FMK A;  2A08 A;  2FG0 A;  3VS0 A;  1K0S A;  2KXC A;  3M0T A;  1KFZ A;  1RLP C;  2DE0 X;  4JJD A;  2DRK A;  4J9E A;  3SHW A;  4HCK A;  1SHG A;  1K76 A;  2AZS A;  2JTE A;  1U5S A;  2FRY A;  1B3Q A;  2LQW A;  2DX1 A;  2KT1 A;  1NG2 A;  1W6X A;  2H8H A;  4RTT A;  2GBQ A;  3M0R A;  4OMM A;  3KFV A;  3TVT A;  1U06 A;  4AG1 C;  2L0A A;  2EW3 A;  2EBP A;  1J3T A;  1TG0 A;  2J6O A;  1SRL A;  2QDL A;  4LNP A;  4ESR A;  3I9Q A;  4OMN A;  1PKS A;  5HCK A;  2JMA A;  4RTZ A;  4R0K A;  1NM7 A;  2EYY A;  4QT7 A;  2JMC A;  2ED1 A;  3A98 A;  4DEY A;  5IHN A;  3M0U A;  4CC2 A;  2DRM A;  1JO8 A;  3H0F A;  2ENM A;  2IIM A;  1FYN A;  4HVW A;  5L23 A;  1PHT A;  1X2Q A;  1YWO A;  1RUW A;  1PWT A;  2K9G A;  2YUN A;  1CKA A;  3VS5 A;  3I35 A;  1UEC A;  2AKK A;  2CT4 A;  4X1V A;  1I07 A;  2HDA A;  2LJ0 A;  2JS0 A;  4RTV A;  1WXU A;  1H92 A;  3LH5 A;  5EC7 A;  1UHF A;  2VVK A;  3NHN A;  2L3P A;  1BU1 A;  2E5K A;  2ABL A;  2KBT A;  2RQR A;  2RQU A;  1JXO A;  4IIM A;  4JJB A;  1GBR A;  2A37 A;  1EFN A;  4Z8A A;  1ZSG A;  3PVL A;  2LQN A;  5GJV B;  2D8J A;  3EG1 A;  2L3Q A;  1PKT A;  2A36 A;  2GTO A;  2EKH A;  2KXD A;  2RNA A;  2JXB A;  2VWF A;  3I5S A;  4F14 A;  1TUC A;  1Z9Z A;  2KYB A;  3THK A;  4ORZ A;  1H3H A;  1WX6 A;  3C0C A;  2RQT A;  1QKW A;  1Z9Q A;  2D0N A;  2JT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...