4J9IA

Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p17
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
LFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/unknown function
molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the ABL-SH3 domain complexed with the designed high-affinity peptide ligand P17
rcsb
source organism Homo sapiens
total genus 10
structure length 56
sequence length 56
chains with identical sequence C, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9iA00
2JXBA 2DVJA 2FRYA 1SHGA 2J6OA 3VS1A 3I35A 2VWFA 4GLMA 4E6RA 5IHIA 3EHQA 1ARKA 1ZSGA 1M30A 4LE9A 2RQTA 4RTWA 2YT6A 1TUCA 3M0QA 3VS7A 2BTTA 2A08A 2O31A 4D8DA 1VYVA 1X43A 4AFZC 4JJBA 1K76A 2KYBA 2YUQA 4J9CA 2EYYA 1GFDA 2ABLA 2AKKA 3EG1A 1AOJA 1K4US 1UECA 4JJDA 1Y57A 2I0NA 2K7AA 2L3QA 1G83A 2GGRA 1TG0A 2V1QA 2CREA 2OI3A 1SSHA 1AVZC 1VYTA 4RTTA 2CH4W 4CC7A 3R6NA 1LCKA 1SRLA 3QWXX 2B86A 2DF6A 4LNPA 3H0HA 1MV0B 4F14A 1WXUA 2KRNA 2DL3A 3THKA 2BZ8A 1YCSB 4F16A 2D1XA 2EW3A 4HVUA 2A28A 2CH4A 1U3OA 4R0KA 2JS0A 1AZGB 4CC2A 1WA7A 1B07A 2CSIA 1NEBA 3M0TA 1WXTA 1WI7A 2DLPA 3M0SA 2C0IA 1ABOA 2DRMA 2W10A 1AWJA 4OMQA 3PE0A 4Z89A 2KYMA 2FO0A 4OMLA 3ULRB 1W6XA 4J9FA 3KFVA 4DEXA 3M0PA 2EPDA 2KRSA 1ZUYA 2ENMA 1H92A 3VS2A 2RN8A 1M3BA 1V1CA 4OMOA 3SEMA 1OOTA 1YN8A 3EGUA 2O2OA 2DRKA 2DBMA 2LQWA 2FEIA 1BK2A 2L0AA 1WIEA 3UF4A 2DJQA 2JM9A 4AFQC 1CKBA 4J9GA 2SEMA 2C0OA 1ABQA 2LJ3A 4RTXA 5IXBA 2MCNA 1BB9A 1UJ0A 1JU5C 2OAWA 2BZYA 2GTJA 2DL5A 1WX6A 1ZUKA 1E6GA 3EG3A 3UATA 2G6FX 2RQVA 1HSQA 3VS3A 2PZ1A 1GL5A 2ED1A 3H0IA 1KJWA 3M0UA 4FSSA 3PVLA 1QCFA 4EIKA 2O88A 4QT7A 1UHFA 4J9BA 1I0CA 1QKWA 2K3BA 2JMAA 1J3TA 1ZLMA 2CDTA 1AZEA 4RTZA 2A37A 1JO8A 3NHNA 3UA7A 2JS2A 4DEYA 1JXOA 2HDAA 3VS5A 2ROLA 2FPFA 4GBQA 2D0NA 2C0TA 4LUEA 1S1NA 4AFUC 2P4RA 2X3XD 3GBQA 1AWOA 5EC7A 2LNHB 1X27A 2JM8A 4JJCA 3VRYA 1UGVA 1FMKA 4LUDA 2ECZA 2LJ0A 2LP5A 2DM1A 1U5SA 5IXFA 2DL4A 2KBTA 1M3CA 1AWXA 1SPKA 1QLYA 5IH2A 2DBKA 1M8MA 2GQIA 2E5KA 2L3PA 2HCKA 2EYXA 2J05A 2J06A 2KR3A 4HCKA 4KRTA 2YDLA 2KT1A 2EVRA 1UDLA 2CUDA 1ZX6A 1TUDA 3ZL7C 2DYBA 3VS6A 2AZSA 1I07A 1AEYA 2JTEA 1JQQA 3I9QA 1AWWA 1HD3A 1PRLC 1NG2A 3EHRA 1OV3A 2ED0A 2HEQA 5GJVB 3RBBB 1CKAA 1W1FA 2EGAA 2NUZA 3FJ5A 3VRZA 1UTIA 2JT4A 2KROA 3REBB 2W0ZA 1WXBA 1N5ZA 3NPFA 3A98A 2LCSA 1OPLA 3CQTA 2LQNA 3IQLA 1GCQA 2FRWA 2D8HA 1ZBJA 2VKNA 2CT4A 1JXMA 4IIMA 1XOVA 1H8KA 2J7IA 1Y0MA 1GCQC 1SEMA 3U23A 3RNJA 2FPEA 2X3WD 5L23A 4ZNXA 2EBPA 2QDLA 1YNZA 1X6BA 1IO6A 5IHNA 1UFFA 2GBQA 4F17A 2RMOA 2K79A 4CC4B 2F2WA 1UE9A 2KRMA 2EYWA 3PVQA 1E6HA 2CUBA 3NGPA 4ORZA 2GNCA 1QKXA 1QWFA 2MIOA 2F2VA 2HBWA 1T3LA 4CC3A 1NEGA 4HVWA 4JZ4A 2MOXA 4RTVA 1B3QA 4X1VA 2VVKA 1WFWA 3VS0A 2HSPA 3EG0A 1U06A 1VYUA 1RUWA 4A63B 1GBQA 4WCIA 2YUNA 1UG1A 4J9DA 2RNAA 2V1RA 1RI9A 3TSZA 4RTUA 2AK5A 1A0NB 3O5ZA 2RQUA 2YSQA 1GCPA 1E7OA 1OEBA 3C0CA 1H3HA 4J9IA 2M0YA 1PKSA 2SRCA 2K6DA 1MV3A 1WDXA 3I5SA 4JPBW 3H41A 2KGTA 2AZVA 5FW9A 1Z9ZA 1GFCA 3I5RA 1VA7A 1NYGA 4HVVA 2EKHA 4D8KA 2FPDA 5FWCA 3VS4A 2DL8A 1PHTA 2KE9A 1GBRA 2EGCA 2J6KA 2AKLA 1NLOC 2JW4A 2EYZA 2ESWA 2LMJA 2LJ1A 1WLPB 1UHCA 1UUEA 1YWOA 1K0SA 1RLPC 2JMCA 5ECAA 1ZUUA 1BU1A 1T0JA 4Y92A 1WYXA 1K1ZA 2F2XA 2LX7A 4HXJA 1OPKA 4AG1C 4RTYA 1KFZA 2XMFA 1SHFA 3H0FA 1M27C 4LN2A 3M0RA 2NWMA 3JV3A 4M4ZA 2LZ6B 1UJYA 2DA9A 1W70A 4OMPA 2PNIA 2DX1A 1YWPA 2EGEA 2K2MA 2M51A 4J9HA 3UA6A 1Z9QA 5GJWB 1NYFA 1PNJA 2KNBB 4K11A 4AFSC 1BBZA 1HJDA 5HCKA 4Z8AA 1SRMA 2GTOA 1PKTA 4OMMA 4AG2C 1I1JA 2DNUA 2FG0A 1FYNA 2ROTA 2DILA 1T3SA 2KXCA 2KXDA 1K9AA 2PTKA 1NLPC 5IHKA 1X2KA 1YP5A 3TSWA 1NM7A 3TVTA 1PRMC 2KT8A 1JEGA 2YUPA 2EQIA 3LH5A 2A36A 1AD5A 2IIMA 1K0XA 4J9EA 3NMZC 2KEAA 2O9VA 5I22A 4IIOA 1T0HA 1KIKA 1EFNA 2RQRA 4ESRA 2L2PA 1GRIA 2D8JA 3EG2A 1QWEA 1MUZA 3SHWA 3REAB 1PWTA 2DL7A 2DMOA 2K9GA 2J6FA 2OJ2A 1X2QA 2RF0A 2RQWA 2YUOA 2CSQA 1G2BA 2H8HA 2BZXA 1X6GA 5FWBA 1KSWA 1M3AA 2CT3A 5I11A 4OMNA 4Z88A 2L3SA 2O9SA 1CSKA 3QWYA 4RUGA 4JZ3A 1RLQC 2RPNA 1X69A 2DE0X
chains in the Genus database with same CATH superfamily
1VQPA 4PKCC 1Q95G 1RAAB 1YIJT 3CCRT 4GLMA 5KCHA 3EHQA 2LQKA 3M5AA 1ZSGA 3OBWA 1M30A 1ARKA 1WJSA 4RTWA 1JJ2A 2YT6A 1TUCA 3QJYA 1M8VA 2BTTA 2KDSA 2A08A 2O31A 4D8DA 2EWNA 2PVDB 1K76A 3JCMb 2AIRB 5GAMe 2VYTA 1ZA2B 1ZBXA 1IREB 3JB9J 2ABLA 5M9OA 3CC4A 2EQMA 2BIVA 2L3QA 3MEUA 3LX7A 3N5BB 2GF7A 9ATCB 2X4JA 1AVZC 2YWWA 2CH4W 4VUBA 3R6NA 4BI8B 1KHIA 3QWXX 4JLGA 2P84A 5CKHA 3G4SA 2DF6A 2YHTA 4FW2A 4BDYA 1MV0B 1WXUA 3S6WA 2DL3A 6AT1B 2BZ8A 1KQSP 4F16A 4M75C 2D1XA 5GAMj 2RK2A 4DBFA 2L8DA 2YLBA 3RMSA 4CC2A 2OTJA 1K8AU 3QSUA 1Q7YR 4M78C 4M77F 4QVDA 4MZTA 1D1CA 5GANe 4OMQA 1S72T 4C8QF 3G6ET 2KYMA 3RKYA 2EQKA 3CPWA 1OU9A 4OMLA 2PQWA 4EMKC 5IAYA 2QTVA 1QVGS 2ZPEB 2EPDA 1ZUYA 1JBMA 3WVDB 2DTIA 1H92A 1M3BA 1V1CA 3SEMA 2JNGA 1YN8A 1PCXA 4PLLA 2O2OA 4C0DB 4X9CA 2L0AA 3CC7A 2P4TA 1GXIE 4F04B 2D9TA 1CKBA 4J9GA 3CMAQ 1UGSB 2SEMA 4JRQA 3OMCA 4XU0A 5LJ5j 2P0KA 5IXBA 5FU7B 2MCNA 4RG2A 2DL5A 1B34A 4AT1B 1WX6A 3EG3A 1HSQA 2F5KA 1GL5A 4PJOC 3JCMh 5FRNA 5CIUA 2FZKB 3PVLA 5IT9E 1D09B 4JS5A 4QQGA 3A8LB 1WHKA 4J9BA 4OP0A 2VXEA 1I0CA 1G3TA 1NPRA 1K9MU 1J3TA 3SWNC 2DXCA 2ZPFB 5CCAA 4LDVA 4RTZA 2A37A 2LVMA 3UA7A 2JS2A 1MGQA 3CCQA 3E2UA 3VS5A 4QKUA 5FROA 3QPHA 4AFUC 2X3XD 3GBQA 3UWNA 1AWOA 3BFMA 2JM8A 4OF1A 1G3YA 1QQJA 3BDLA 3CD6A 1WNLA 2DFUA 1ZA1B 2LP5A 2DL4A 4M75A 2EJGA 2RJDA 2DTHA 3C12A 5GAOq 4BE1A 4C92F 3X26B 2DBKA 2Y4XA 5GAMd 2RI2A 1M8MA 2GQIA 4M7DC 4KH0B 1HYOA 2COWA 4M78A 5GMKh 3MP8A 2J06A 2KR3A 3E19A 1P92A 2YDLA 3OYGA 4ME7A 4E2FB 2DEQA 1M1GA 3ZFJA 1VQLQ 1UDLA 3QG1A 2CUDA 2WSEE 1N8RU 3VS6A 1AEYA 1JQQA 3I9QA 2M9UA 1HD3A 3TEEA 1AWWA 4EMKA 1NG2A 3A1PA 4ZGJB 5GJVB 1CKAA 3QXEB 1D1BA 1MHNA 1QVGP 2E1HA 2JT4A 2X4XA 2XIDA 4HCCA 1PSFA 1WXBA 3TU4K 3CCEA 1W4SA 1C6VX 1VQ8A 1SF9A 1G5VA 3I55Q 5GAOl 3LWHA 4CI0C 2D8HA 2VKNA 3BDUA 4QVCA 1JXMA 2PU9B 5GANd 2MPXC 1H8KA 3L2UA 2J7IA 1Y0MA 1GCQC 2FPEA 4DBRA 4ZNXA 2DERA 4F7UB 5LJ5d 1O9SA 2RMOA 2K79A 4OGEA 4CC4B 2F2WA 1UE9A 1YJ9T 2V26A 2CUBA 1O75A 4A53A 1QWFA 7AT1B 2ZAEA 2HMAA 3CCMA 1M90U 4HVWA 4JZ4A 3HRTA 2OTLQ 3VS0A 2HSPA 1YIJA 3CCRA 2FL7A 4C8QE 1KC8U 1LPLA 1SG5A 4TVRA 1BI1A 2K5LA 3FIFA 2HQXA 3PT9A 4M7AC 1RI9A 1NBEB 3JB9D 3AHUA 2LNVA 5KYWB 3T9NA 2COYA 2RQUA 5KYXA 1GCPA 4PFZA 2RHZA 3C0CA 3I5SA 1UGQB 3PNWC 5CK9A 2KGTA 4M7DB 2LT4A 1ACMB 1N27A 2LRQA 1PG5B 2K5IA 1GFCA 4HT9A 1TU0B 2FPDA 2AT1B 4IUUA 3JCMP 3M4YA 1PHTA 2EGCA 1NLOC 2AKLA 2JW4A 2VUBA 2LMJA 2O4XA 5LJ3e 1WJRA 1VIFA 1RABB 3OYLA 2KI7A 1RAFB 1RLPC 4XAXB 3QDFA 1HK9A 2QXFA 3DLLA 4Y92A 1WYXA 4JRKA 1VQ6T 3EG9B 1Y07A 1KFZA 1NZ9A 3OYMA 2NUPB 3HFOA 1VQLT 1M27C 1MNEA 2NWMA 2DIGA 1S72A 3VJPA 2DA9A 3G6EA 3OB9A 1YJNQ 5GAMh 1IXDA 2EGEA 2M51A 1NYFA 4K11A 4M75G 3TREA 2IPOB 2DKGA 1HJDA 3GLXA 2GTOA 4AG2C 1IB8A 2XICA 2DNUA 5KYYA 1NJIR 1IRXA 8AT1B 4M78G 4C92E 4FU6A 1TSFA 2GFAA 2NUTA 5IHKA 1YP5A 5A2QE 2VGMA 1NM7A 3TSWA 3TVTA 2EQIA 4ELZC 1VQ4Q 2VB6A 2V8JA 2EQJA 2O9VA 4R56A 4V2SA 1T0HA 4E7ZA 1EFNA 4RKUE 4ESRA 2L2PA 2D8JA 4LDWA 2DL7A 2QG9B 2D6FA 1X2QA 3HFNA 4QW2A 2QYZA 3CC7T 3JCMW 1LNXA 2OTLT 5GANh 3CCVQ 4II1A 4Z88A 4JLIA 2H3EB 2BE7D 5CKDA 1BYMA 4RUGA 5KCOA 1YJWQ 1X69A 4BY6C 5GAOp 3KXTA 5LJ5h 2JXBA 1BCOA 2K2VA 2YLCA 4J7IA 2J6OA 1M2VA 3VS1A 2RI3A 2VWFA 1G8XA 4E6RA 4KBMB 1M1KR 2CZ6B 1AT1B 1BCMA 1VQNQ 3VS7A 4F7UG 1VYVA 1X43A 4JJBA 5L8RE 1VQ7T 2KYBA 2YUQA 1Y7XA 4PJOG 3EGXA 2AKKA 2E6NA 1RADB 1VQMT 2I0NA 3AT1B 1OQKA 3PTAA 3OSSC 2E65A 2HQHA 2E3HA 3A8GB 1W2BS 1KD1U 1TG0A 4JJNK 2LX9A 2OI3A 4KUIA 1VYTA 4RTTA 3J7AF 1BI2A 4CC7A 3PIOA 4O5VA 1SKUB 5I2MA 2MWPA 4PJLA 2KRNA 4BD3A 3V7SA 3M59A 1YCSB 4JRPA 4HVUA 4OB0B 3LGLA 1U3OA 3CCLT 2JS0A 1AZGB 8ATCB 1YJNT 4M7DG 1PSEA 2CSIA 2F1LA 2FYKA 3X20B 2HAXA 2CP7A 2XI9A 2C0IA 3WXMB 3CXCS 1R0BG 2IVWA 3EFRA 2HD0A 1ZSZA 2FZGB 1H641 2X51A 2WSCE 5A0LA 2P0PA 4IUTA 2BE9B 2FO0A 1ZHIA 3ULRB 1W6XA 2EYQA 1Q81R 3BE3A 3G71Q 4DEXA 1KD1R 4J5YA 1XTDA 4FYXB 3CCJT 2DD5A 1K73C 4JS4A 1YJ9A 2E64A 1OOTA 1VQ4T 4EMHA 4IUVA 2LQWA 3OW2A 3M4GA 3S3MA 3UF4A 4EMGA 2D0QB 5C6SA 4PFPA 4BB7A 3JCMX 2JVVA 2LJ3A 3P8BB 2GQVA 3M56A 3WVEB 4HKEA 4E7SA 4QQDA 2DXTA 1NPPA 5GAN4 1V29B 2XDDA 1JU5C 1YJWT 2GTJA 5D6YA 1E6GA 3JSCA 2G6FX 2PZ1A 1EZZB 2E3IA 1OULA 3H0IA 1BIAA 1VQKQ 4FSSA 3HKSA 4EIKA 2O88A 1UHFA 3OBYA 1VQ9T 2CP5A 1QKWA 5GAN7 2JMAA 4XU3A 3CCST 1ZLMA 4PJJA 5FLXE 1W2BP 3M53A 4M7AG 1QCNA 3CPFA 4PL6A 1UGRB 3R6OA 4GBQA 4LUEA 2P4RA 4M77C 2LNHB 4JJCA 3JB9F 1VQ6A 2DM1A 1QLYA 4C8QC 3OYAA 3F70A 1VQLA 1YHQT 2MWOA 1C1AA 4ZN1A 3E1SA 2A0FB 3I56Q 1JJ2S 2XU8A 1Q86U 1TTHB 1G3SA 3JCMJ 4PJNA 2KT1A 1YITQ 2EVRA 3VUZA 3OYJA 3CXCP 5A0GA 1WHGA 2KMTA 1WPYA 1ZX6A 1TUDA 2M1HA 2DYBA 2JTEA 3HRSA 3MEAA 3OYEA 3EHRA 2JZ2A 3OYFA 2QK0A 3FJ5A 3VRZA 1UTIA 2DTOA 2KROA 2MAMA 2EJ9A 3REBB 4J6XA 2W0ZA 5HK3A 2ZPBB 3NPFA 2FVUA 1PC0A 1WHLA 1OPLA 3CQTA 2LQNA 4Z02A 5CR2A 1VQOQ 2FRWA 4E7HA 5KYUA 3QBYA 3VYHB 2Z0WA 4NS5A 4A4KA 4ZGDB 4WTOB 3EH1A 2X3WD 1TWBA 2QA4Q 5CKFA 5GMKi 1N9SA 3M57A 3O8VA 5GANj 1Q86R 4FYWB 5IHNA 2ZZDA 3CCUQ 4X9DA 2KRMA 5GAN2 3C94A 3PVQA 2QEXQ 2C06A 2OTLA 2CP3A 1E6HA 4XU2A 1K8AR 4PNOA 3NGPA 2Y90A 4OVAA 3CPWS 3VYGA 1N6AA 2MIOA 3OYYA 1B34B 1UEBA 3CMEQ 1VQ5T 1WZOA 4J8OA 4RTVA 2HBPA 3EG0A 1U06A 3CBPA 4WCIA 3L2WA 1M1FA 4C92C 5GMKm 2V1RA 4E47A 1VQKT 4RTUA 1A0NB 1BI0A 1VQ7A 3FC3A 4M77A 2KVQG 4B9WA 1PD0A 4L5GA 2YSQA 3LH0A 2DAQA 1H3HA 4J9IA 4P5NA 2SRCA 4IKFA 2K6DA 1VQMA 5KYNA 2XD0A 4C8QA 2RJFA 1D1AA 3QKJA 3HRUA 3KBGA 1VQPQ 3I5RA 4BDZA 4M75B 2EKHA 4D8KA 4OMFB 2KE9A 1NE8A 1GBRA 2J6KA 2EYZA 1LVKA 3A5ZB 2CZ7B 4BI3A 2DZCA 2FHDA 4M78B 4O6JA 1UUEA 1JJ2P 1K0SA 5ECAA 2ZPIB 2XG8D 4LD9K 2DJZA 1K1ZA 2F2XA 4XTXA 4HXJA 4AG1C 3CCLA 4RTYA 3HP9A 1HXDA 5IN1A 5CQYA 1YJNA 2DEUA 4EMKB 2XMFA 3S3NA 1YITT 5LL6S 2OX7A 1WQ7A 1R0CB 2LZ6B 4B9XA 1K9MR 2X35A 2VC8A 2PNIA 1B7TA 5CKEA 2DX1A 1YWPA 1WGSA 2AHJB 4IUPA 4LDYA 3UA6A 1PNJA 4AFSC 3CCJA 2YRCA 4Z8AA 1G3WA 2QTXA 1WHHA 1VQ4A 2OTJQ 4NOYA 1VQOT 5AYFA 2KXCA 1Q7YC 2PTKA 1NLPC 2QA4T 5GAMf 2KT8A 3TCJA 3MEWA 3CPWP 3NMZC 3CCUT 4IIOA 2RQRA 2QEXT 1N8RR 2CZ1B 4PJOB 1GRIA 4L6V5 3CMAT 1OYXA 2A3LA 3EG2A 1MUZA 4A4EA 1PWTA 2RB6A 2HSEB 4C92A 2E5QA 3CMET 3GPLA 2J6FA 1YJWA 2YUOA 4OB2B 2MI6A 3SWNB 1KSWA 2CT3A 3G1JA 3OYHA 2L3SA 4EPCA 1AHJB 1CSKA 5GAN8 1D0XA 1VQ9A 2DVJA 4BACA 1MMNA 2PUKB 3CCSA 1BKBA 3QHSA 5C0MA 2ZGWA 3DKMA 4ATOA 5IHIA 5CQXA 4LE9A 3ME9A 2I2LA 4DQ2A 1Y96A 1M9SA 4PK4A 5GANf 3M0QA 1FX7A 4AFZC 1LOJA 4DA4A 4M75E 3JCMQ 1YBYA 1K73U 3LWIA 4J9CA 2EYYA 1GFDA 1TOVA 1QVFA 3EG1A 4XTWA 1AOJA 5LJ5f 3MKDA 1Y57A 4M78E 3QO3A 3SDZA 1YHQA 1G83A 2GGRA 4OGCA 1KQ1A 1M90R 3UPUA 2CREA 1MMGA 1SSHA 4RCBA 3V8LA 1KC8R 1LCKA 3CCQQ 2B86A 4LNPA 4M77G 4A4GA 4F14A 4N4GA 4AMCA 1N9RA 3CD6Q 4X34A 2A28A 1WHMA 4C5IA 1U1TA 2CH4A 4C8QG 1V76A 4PFOA 4R0KA 5LJ3j 4MMKA 4KH1B 3EG9A 1OX8A 3DB4A 2ZPHB 3UDCA 1WI7A 3M0SA 4M75D 2NUPA 2P0QA 2VXFA 1WHJA 2W10A 3EGDB 3J80E 5KE3A 2QGFB 3PE0A 1K73R 3I55T 5FU6C 4M78D 3RESA 2DD4A 2DVEA 3SFMA 4J9FA 1ZSZC 1BIBA 3M58A 2QASA 4J6YA 3M55A 1M4ZA 5HKCA 2ENMA 3HL8A 4F7UE 3VS2A 2DPPB 4OMOA 1XQHA 3RDVA 3J81E 2F69A 3EH2A 4PJOE 3PIPA 3CCEQ 4M7AB 1YI2Q 1TUGB 2FEIA 2KY9A 1F1BB 1VQ5A 4N4HA 2Y4YA 4OB3B 2VGNA 1BK2A 1WIEA 1PD1A 3MP6A 3OA6A 1FWZA 4RTXA 1MMAA 2E6ZA 5DM7R 3H8ZA 1VQKA 1M2VB 3META 2CP2A 1BB9A 2BZYA 3ASKA 3V8JA 4LXCA 4B6MA 3UATA 2FB7A 3VS3A 4LDUA 2ED1A 3GNGA 1M2OA 5GMKe 1W2BA 1D0YA 4M7DE 3CCMQ 1QCFA 4QT7A 2K3BA 3EGXB 3MJXA 3L1AA 2JJ9A 4FSXA 2CDTA 3CCRQ 2CP6A 4A4FA 4PJOD 1JO8A 2QI2A 2COZA 4C92G 4DEYA 1JXOA 2IG0A 2ROLA 2D0NA 2ZPGB 3HPWA 1OZ2A 2ZCFB 2PVGB 4FM4B 2VV5A 2EFIA 2ECZA 1KQSA 3EFOB 2HKQB 2X4YA 5IXFA 2KBTA 3P8HA 4ANJA 5GAN5 1WQWA 1YITA 3CXCA 5LJ3d 2E5KA 4GLKA 2L3PA 2R5AA 4ZTFA 3QZ5B 1I5LA 2QGGA 1X01A 3CC2Q 3GOXA 4HCKA 3L2ZA 3OYKA 1DJ7B 3QZ9B 2ATCB 4M7DD 2RJEA 2JTFA 2MMPA 2AZSA 4RCCA 1PRLC 3OYDA 3GNFB 4LD6A 3VU3C 1VQOA 1IHWA 3G7ZA 5CAIA 3A98A 3V7CA 1LJOA 2QA4A 3VV0A 1OX9A 1S72Q 3CEYA 3GF5A 4ZTJA 4CRIA 3G6EQ 4RG8A 1ZBJA 3CCUA 2H3JA 4HCBA 2M0OA 2QEXA 4NL3A 3MCAB 3CMAA 1SEMA 4M7AE 5L23A 4JRIA 4BY6B 1YI2T 2EBPA 3CMEA 2QDLA 3S3OA 1IO6A 1UFFA 2EYWA 1NJIC 2MK5A 3QIIA 5D7UA 5CKBA 3PMTA 3CCVT 1D3BA 2GNCA 1QKXA 2HBWA 4KUDK 1VOMA 2KAFA 1VUBA 4FYVB 4N4IA 3JCMg 4X1VA 3SD4A 2VVKA 2M16A 2V8IA 1VYUA 1RUWA 2M02A 1GBQA 2YUNA 2LCLA 4J9DA 2RNAA 2FZCB 4C0DC 3TSZA 3OW2S 1VQNT 3X28B 2L89A 4FT2A 3O5ZA 2LQ8A 3FRNA 1PM3A 1QCOA 1ZQ1A 2M0YA 1PKSA 1MV3A 4M7AD 3GIBA 3H41A 1Q7YU 2DO3A 2EIFA 2MYSA 5FU7C 1VA7A 2VASA 3JCMf 3UT1A 3FB9A 3VS4A 2ESWA 1RACB 4DOWA 1WLPB 1UHCA 1YWOA 1M1KC 4UC4A 2LCCA 4MDWA 2DZ9A 2JMCA 3QDRB 2RO0A 1ZUUA 3EAEA 1T0JA 2RH2A 4XTVA 5GMKl 3OYBA 2LX7A 1OI1A 3CC2T 1IGQA 1X75C 1WJQA 2XHCA 4J7FA 1QVGA 1SHFA 4N0AC 2QQ9A 4M4ZA 1RI0A 3LLRA 3I55A 4IUQA 4OMPA 2HQEA 4MMLA 4BE0A 5EG2A 2K2MA 4J9HA 3CBOA 4QQ6A 1BI3A 5LJ3h 2CYZB 3G71T 2KNBB 5KYUB 2E12A 2DXBA 3QYHB 3OYIA 1FMWA 1PKTA 2QQAA 3C95A 1I1JA 1QMCA 2EKOA 2FG0A 2RM4A 3M54A 1EIFA 2DILA 1T3SA 1K9AA 4E7IA 2K5FA 5LJ5e 1TS9A 2RI5A 1X2KA 5J26A 4M75F 1PRMC 2RD1A 1JEGA 2YUPA 1I5OB 2A36A 1AD5A 2IIMA 4FL6A 4HA8A 2OAUA 3L2QA 2KEAA 5I22A 4BUGA 1KIKA 3NTIA 3E9GA 4M78F 4ZN3A 1Q81C 1QWEA 3SHWA 3ZEHA 1Q82C 1KD1C 4XU1A 5KH6A 2RF0A 1YJ9Q 2CSQA 1G2BA 4FIBA 2H8HA 2BZXA 1X6GA 3LYIA 3JB9H 1M3AA 4OMNA 3OW2P 4M77B 2O9SA 3QWYA 5J3BA 4JZ3A 5I2SA 2JUFA 5DY9A 2X4WA 2FRYA 3MPUB 1SHGA 3FJPA 2YRDA 3TQ7P 3I35A 4C8QB 1OU8A 2L3RA 1RL2A 4XTZA 4C0FA 2RQTA 1I8FA 1I4K1 2K57A 2WACA 2RHIA 1JB0E 3DLMA 2PUOB 3P8DA 2K4YA 1FXXA 4C5HA 1K4US 1UECA 3RERA 4JJDA 4R55A 2K7AA 2EJFA 2CZ0B 1U8RA 3SB2A 4XTUA 4N0AA 2XDPA 3H9NA 2V1QA 4F7UF 4XTYA 3I56T 3L2VA 2LC4A 4PJOF 1SRLA 3CC4Q 2HL5C 1FMVA 3H0HA 3FEOA 2NLUA 1X6OA 3THKA 4PJMA 1RAIB 1VQ6Q 4C0GA 2A7YA 2CS7A 2EW3A 2GCXA 5GAMg 3RUXA 1R8OB 4MZPA 4D6WA 1WA7A 3G4SQ 2QAZA 1B07A 1NEBA 3M0TA 1WXTA 3FLGA 2DLPA 3PMIA 4HCZA 4E7KA 1ABOA 2DRMA 2E41A 1AWJA 2CKKA 4Z89A 4C5GA 3RMQA 1H3ZA 2HKNA 4DBHA 2DK3A 1IGUA 4M7DF 2YRVA 3PFSA 1YCYA 3KFVA 5CVIA 3M0PA 2KRSA 1YI2A 2E70A 3QUIA 2RN8A 4J6WA 3EGUA 3RKXA 3CCVA 4C92B 4L59A 2DRKA 2DBMA 4DBQA 3JAME 5GANg 4XQ3A 1MMDA 1EX4A 2DJQA 2RA2A 2NYSA 4ZGEB 4Q5WA 3MEVA 2JM9A 4AFQC 4E7LA 4F7UA 2C0OA 2QQBA 1ABQA 3PGGA 4YTLA 5LJ5g 2O01E 1KG1A 5KYXB 4M77E 5DLQE 1U1SA 1RAHB 3LGFA 4PJOA 1VQNA 2B8AA 1UJ0A 1Q86C 2OAWA 3CC7Q 3NTKA 4A54A 3OY9A 3OS2A 1ZUKA 2RQVA 2XKOC 4LDXA 1Y96B 5GAN6 1K8AC 1KJWA 3M0UA 3SWNA 1UB4A 3LW5E 3JB9G 3OQ5A 5CO7A 2O4XB 1VQPT 3NFCA 3A8MB 1AZEA 3DB3A 5KYWA 2GFUA 3NHNA 4E7JA 3BW1A 2HDAA 2HNIA 3VKIA 2FPFA 2C0TA 3GP8A 1S1NA 4BE2A 5A0DA 2HZYA 5EC7A 1X27A 4MZMA 3VRYA 1VQ7Q 1UGVA 1FMKA 4LUDA 4M7DA 2LJ0A 4KGZB 3OMGA 4A4HA 1U5SA 3CC2A 3RKWA 1NJIU 4DOVA 1M3CA 1AWXA 1SPKA 2K3XA 5IH2A 1VQMQ 4Y28E 3E9FA 4M77D 4M7AF 2LTOA 3CC4T 5GAOm 2EQUA 2HCKA 1C0MA 3Q1JA 2MF2A 5J39A 3MHXA 2RJCA 2EYXA 2J05A 4KRTA 2E4HA 4C8QD 4MDXA 1QVPA 2KK4A 3HTRA 1QP2A 3G4ST 3ZL7C 1QVFS 2DXUA 3G71A 1I07A 2R5MA 5KYYB 2DIQA 2E10A 3ER0A 1OV3A 2ED0A 2HEQA 3RBBB 3OS0A 3RR6A 3CCLQ 1W1FA 2EGAA 3OSVA 2NUZA 2NUTB 2OTJT 2K3YA 2V8KA 2YXYA 1N5ZA 3H6ZA 2LCSA 3D7SB 5I21A 1KHCA 4BI4A 1R77A 4JDSA 1TXQA 3IQLA 1GCQA 1VIEA 2BKDN 1RAEB 1K9MC 5D6XA 4KULA 3JCMe 2CT4A 3EGDA 4IIMA 1XOVA 1YFNA 1I81A 5GAN3 4FCYA 1RAGB 3U23A 1M1KU 3RNJA 5GAOn 5HY6A 1QW1A 1VQ8Q 3CCJQ 4KGXB 2JN0A 3JB9I 1YNZA 1X6BA 2LDMA 2GBQA 4F17A 2RHXA 2G3RA 2WSFE 1OZ3A 4RMOA 2CP0A 1IHVA 2R58A 2KSSA 4OB1B 3A8OB 4ORZA 1XJWB 4FW1A 1UGPB 2BUDA 2CGHA 4HT8A 3JRZA 2F2VA 1T3LA 3NTHA 4CC3A 5FRMA 1NEGA 2MOXA 4M7AA 4FYYB 1B3QA 2RHUA 1WFWA 3M9QA 4A63B 1N8RC 1SSFA 1UG1A 4C0ZA 2AK5A 3VUBA 4KGVB 2R57A 1YIJQ 3L42A 1E7OA 1OEBA 4C92D 1WDXA 2JOYA 4JPBW 2AZVA 1Y71A 5FW9A 1Z9ZA 3OYNA 1VQ9Q 3KUFA 4HVVA 1NYGA 4J83A 3I56A 4PLIA 5FWCA 3CCSQ 2DL8A 2QQSA 2LJ1A 5GMKj 4JUVA 3CCQT 1D0ZA 1Q81U 3V7RA 3X24B 1BU1A 3L2RA 4ELYC 1Q82U 3OS5A 2L5QA 3CD6T 2DYIA 1QVFP 3QYGB 1OPKA 2EAYA 4FT4A 5FU6B 2HL3A 3FDRA 3CBMA 3EFOA 1ZSZB 3H0FA 1YHQQ 4LN2A 3M0RA 3OS1A 3JV3A 4GY5A 1M90C 1IZ6A 3C4SA 4IURA 3QJ6A 5GAOr 1UJYA 3ZBDA 1KK7A 3MO8A 1W70A 1KQSS 1KC8C 5LJ3g 2LT1A 3V8KA 3X25B 3BY7A 2RK1A 5AT1B 1Z9QA 5GJWB 4NL2A 5KE2A 4C5EA 1BBZA 5HCKA 3MP1A 1SRMA 4OMMA 3HSBA 3JCMV 4XK8E 1FYNA 2ROTA 5D6WA 3A8HB 2KXDA 1QP3A 1KQ2A 4Y91A 3CCET 1Q82R 2X9HA 4KT0E 1VQ8T 3LH5A 5LJ3f 1K0XA 1D3BB 4J9EA 2QQRA 2F5TX 2XDBA 1TH7A 3RIRA 3JCMc 3URGA 1M5Q1 4WF2A 3JCMd 3REAB 3OYCA 2DMOA 3EFSA 5DLOA 4EDUA 2K9GA 2RHYA 1MNDA 2QDYB 1XNIA 2OJ2A 3INZA 2RQWA 5HK0A 2JTMA 2DETA 5FWBA 5I11A 2KQWA 4QVZA 2PVOB 2XK0A 1JRIA 1VQ5Q 1RLQC 2RPNA 3HHTB 3CCMT 2DE0X
chains in the Genus database with same CATH topology
2JXBA 2DVJA 2FRYA 1SHGA 2J6OA 3VS1A 3I35A 2VWFA 4GLMA 4E6RA 5IHIA 3EHQA 1ARKA 1ZSGA 1M30A 4LE9A 2RQTA 4RTWA 2YT6A 1TUCA 3M0QA 3VS7A 2BTTA 2A08A 2O31A 4D8DA 1VYVA 1X43A 4AFZC 4JJBA 1K76A 2KYBA 2YUQA 4J9CA 2EYYA 1GFDA 2ABLA 2AKKA 3EG1A 1AOJA 1K4US 1UECA 4JJDA 1Y57A 2I0NA 2K7AA 2L3QA 1G83A 2GGRA 1TG0A 2V1QA 2CREA 2OI3A 1SSHA 1AVZC 1VYTA 4RTTA 2CH4W 4CC7A 3R6NA 1LCKA 1SRLA 3QWXX 2B86A 2DF6A 4LNPA 3H0HA 1MV0B 4F14A 1WXUA 2KRNA 2DL3A 3THKA 2BZ8A 1YCSB 4F16A 2D1XA 2EW3A 4HVUA 2A28A 2CH4A 1U3OA 4R0KA 2JS0A 1AZGB 4CC2A 1WA7A 1B07A 2CSIA 1NEBA 3M0TA 1WXTA 1WI7A 2DLPA 3M0SA 2C0IA 1ABOA 2DRMA 2W10A 1AWJA 4OMQA 3PE0A 4Z89A 2KYMA 2FO0A 4OMLA 3ULRB 1W6XA 4J9FA 3KFVA 4DEXA 3M0PA 2EPDA 2KRSA 1ZUYA 2ENMA 1H92A 3VS2A 2RN8A 1M3BA 1V1CA 4OMOA 3SEMA 1OOTA 1YN8A 3EGUA 2O2OA 2DRKA 2DBMA 2LQWA 2FEIA 1BK2A 2L0AA 1WIEA 3UF4A 2DJQA 2JM9A 4AFQC 1CKBA 4J9GA 2SEMA 2C0OA 1ABQA 2LJ3A 4RTXA 5IXBA 2MCNA 1BB9A 1UJ0A 1JU5C 2OAWA 2BZYA 2GTJA 2DL5A 1WX6A 1ZUKA 1E6GA 3EG3A 3UATA 2G6FX 2RQVA 1HSQA 3VS3A 2PZ1A 1GL5A 2ED1A 3H0IA 1KJWA 3M0UA 4FSSA 3PVLA 1QCFA 4EIKA 2O88A 4QT7A 1UHFA 4J9BA 1I0CA 1QKWA 2K3BA 2JMAA 1J3TA 1ZLMA 2CDTA 1AZEA 4RTZA 2A37A 1JO8A 3NHNA 3UA7A 2JS2A 4DEYA 1JXOA 2HDAA 3VS5A 2ROLA 2FPFA 4GBQA 2D0NA 2C0TA 4LUEA 1S1NA 4AFUC 2P4RA 2X3XD 3GBQA 1AWOA 5EC7A 2LNHB 1X27A 2JM8A 4JJCA 3VRYA 1UGVA 1FMKA 4LUDA 2ECZA 2LJ0A 2LP5A 2DM1A 1U5SA 5IXFA 2DL4A 2KBTA 1M3CA 1AWXA 1SPKA 1QLYA 5IH2A 2DBKA 1M8MA 2GQIA 2E5KA 2L3PA 2HCKA 2EYXA 2J05A 2J06A 2KR3A 4HCKA 4KRTA 2YDLA 2KT1A 2EVRA 1UDLA 2CUDA 1ZX6A 1TUDA 3ZL7C 2DYBA 3VS6A 2AZSA 1I07A 1AEYA 2JTEA 1JQQA 3I9QA 1AWWA 1HD3A 1PRLC 1NG2A 3EHRA 1OV3A 2ED0A 2HEQA 5GJVB 3RBBB 1CKAA 1W1FA 2EGAA 2NUZA 3FJ5A 3VRZA 1UTIA 2JT4A 2KROA 3REBB 2W0ZA 1WXBA 1N5ZA 3NPFA 3A98A 2LCSA 1OPLA 3CQTA 2LQNA 3IQLA 1GCQA 2FRWA 2D8HA 1ZBJA 2VKNA 2CT4A 1JXMA 4IIMA 1XOVA 1H8KA 2J7IA 1Y0MA 1GCQC 1SEMA 3U23A 3RNJA 2FPEA 2X3WD 5L23A 4ZNXA 2EBPA 2QDLA 1YNZA 1X6BA 1IO6A 5IHNA 1UFFA 2GBQA 4F17A 2RMOA 2K79A 4CC4B 2F2WA 1UE9A 2KRMA 2EYWA 3PVQA 1E6HA 2CUBA 3NGPA 4ORZA 2GNCA 1QKXA 1QWFA 2MIOA 2F2VA 2HBWA 1T3LA 4CC3A 1NEGA 4HVWA 4JZ4A 2MOXA 4RTVA 1B3QA 4X1VA 2VVKA 1WFWA 3VS0A 2HSPA 3EG0A 1U06A 1VYUA 1RUWA 4A63B 1GBQA 4WCIA 2YUNA 1UG1A 4J9DA 2RNAA 2V1RA 1RI9A 3TSZA 4RTUA 2AK5A 1A0NB 3O5ZA 2RQUA 2YSQA 1GCPA 1E7OA 1OEBA 3C0CA 1H3HA 4J9IA 2M0YA 1PKSA 2SRCA 2K6DA 1MV3A 1WDXA 3I5SA 4JPBW 3H41A 2KGTA 2AZVA 5FW9A 1Z9ZA 1GFCA 3I5RA 1VA7A 1NYGA 4HVVA 2EKHA 4D8KA 2FPDA 5FWCA 3VS4A 2DL8A 1PHTA 2KE9A 1GBRA 2EGCA 2J6KA 2AKLA 1NLOC 2JW4A 2EYZA 2ESWA 2LMJA 2LJ1A 1WLPB 1UHCA 1UUEA 1YWOA 1K0SA 1RLPC 2JMCA 5ECAA 1ZUUA 1BU1A 1T0JA 4Y92A 1WYXA 1K1ZA 2F2XA 2LX7A 4HXJA 1OPKA 4AG1C 4RTYA 1KFZA 2XMFA 1SHFA 3H0FA 1M27C 4LN2A 3M0RA 2NWMA 3JV3A 4M4ZA 2LZ6B 1UJYA 2DA9A 1W70A 4OMPA 2PNIA 2DX1A 1YWPA 2EGEA 2K2MA 2M51A 4J9HA 3UA6A 1Z9QA 5GJWB 1NYFA 1PNJA 2KNBB 4K11A 4AFSC 1BBZA 1HJDA 5HCKA 4Z8AA 1SRMA 2GTOA 1PKTA 4OMMA 4AG2C 1I1JA 2DNUA 2FG0A 1FYNA 2ROTA 2DILA 1T3SA 2KXCA 2KXDA 1K9AA 2PTKA 1NLPC 5IHKA 1X2KA 1YP5A 3TSWA 1NM7A 3TVTA 1PRMC 2KT8A 1JEGA 2YUPA 2EQIA 3LH5A 2A36A 1AD5A 2IIMA 1K0XA 4J9EA 3NMZC 2KEAA 2O9VA 5I22A 4IIOA 1T0HA 1KIKA 1EFNA 2RQRA 4ESRA 2L2PA 1GRIA 2D8JA 3EG2A 1QWEA 1MUZA 3SHWA 3REAB 1PWTA 2DL7A 2DMOA 2K9GA 2J6FA 2OJ2A 1X2QA 2RF0A 2RQWA 2YUOA 2CSQA 1G2BA 2H8HA 2BZXA 1X6GA 5FWBA 1KSWA 1M3AA 2CT3A 5I11A 4OMNA 4Z88A 2L3SA 2O9SA 1CSKA 3QWYA 4RUGA 4JZ3A 1RLQC 2RPNA 1X69A 2DE0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JXB A;  2DVJ A;  2FRY A;  1SHG A;  2J6O A;  3VS1 A;  3I35 A;  2VWF A;  4GLM A;  4E6R A;  5IHI A;  3EHQ A;  1ARK A;  1ZSG A;  1M30 A;  4LE9 A;  2RQT A;  4RTW A;  2YT6 A;  1TUC A;  3M0Q A;  3VS7 A;  2BTT A;  2A08 A;  2O31 A;  4D8D A;  1VYV A;  1X43 A;  4AFZ C;  4JJB A;  1K76 A;  2KYB A;  2YUQ A;  4J9C A;  2EYY A;  1GFD A;  2ABL A;  2AKK A;  3EG1 A;  1AOJ A;  1K4U S;  1UEC A;  4JJD A;  1Y57 A;  2I0N A;  2K7A A;  2L3Q A;  1G83 A;  2GGR A;  1TG0 A;  2V1Q A;  2CRE A;  2OI3 A;  1SSH A;  1AVZ C;  1VYT A;  4RTT A;  2CH4 W;  4CC7 A;  3R6N A;  1LCK A;  1SRL A;  3QWX X;  2B86 A;  2DF6 A;  4LNP A;  3H0H A;  1MV0 B;  4F14 A;  1WXU A;  2KRN A;  2DL3 A;  3THK A;  2BZ8 A;  1YCS B;  4F16 A;  2D1X A;  2EW3 A;  4HVU A;  2A28 A;  2CH4 A;  1U3O A;  4R0K A;  2JS0 A;  1AZG B;  4CC2 A;  1WA7 A;  1B07 A;  2CSI A;  1NEB A;  3M0T A;  1WXT A;  1WI7 A;  2DLP A;  3M0S A;  2C0I A;  1ABO A;  2DRM A;  2W10 A;  1AWJ A;  4OMQ A;  3PE0 A;  4Z89 A;  2KYM A;  2FO0 A;  4OML A;  3ULR B;  1W6X A;  4J9F A;  3KFV A;  4DEX A;  3M0P A;  2EPD A;  2KRS A;  1ZUY A;  2ENM A;  1H92 A;  3VS2 A;  2RN8 A;  1M3B A;  1V1C A;  4OMO A;  3SEM A;  1OOT A;  1YN8 A;  3EGU A;  2O2O A;  2DRK A;  2DBM A;  2LQW A;  2FEI A;  1BK2 A;  2L0A A;  1WIE A;  3UF4 A;  2DJQ A;  2JM9 A;  4AFQ C;  1CKB A;  4J9G A;  2SEM A;  2C0O A;  1ABQ A;  2LJ3 A;  4RTX A;  5IXB A;  2MCN A;  1BB9 A;  1UJ0 A;  1JU5 C;  2OAW A;  2BZY A;  2GTJ A;  2DL5 A;  1WX6 A;  1ZUK A;  1E6G A;  3EG3 A;  3UAT A;  2G6F X;  2RQV A;  1HSQ A;  3VS3 A;  2PZ1 A;  1GL5 A;  2ED1 A;  3H0I A;  1KJW A;  3M0U A;  4FSS A;  3PVL A;  1QCF A;  4EIK A;  2O88 A;  4QT7 A;  1UHF A;  4J9B A;  1I0C A;  1QKW A;  2K3B A;  2JMA A;  1J3T A;  1ZLM A;  2CDT A;  1AZE A;  4RTZ A;  2A37 A;  1JO8 A;  3NHN A;  3UA7 A;  2JS2 A;  4DEY A;  1JXO A;  2HDA A;  3VS5 A;  2ROL A;  2FPF A;  4GBQ A;  2D0N A;  2C0T A;  4LUE A;  1S1N A;  4AFU C;  2P4R A;  2X3X D;  3GBQ A;  1AWO A;  5EC7 A;  2LNH B;  1X27 A;  2JM8 A;  4JJC A;  3VRY A;  1UGV A;  1FMK A;  4LUD A;  2ECZ A;  2LJ0 A;  2LP5 A;  2DM1 A;  1U5S A;  5IXF A;  2DL4 A;  2KBT A;  1M3C A;  1AWX A;  1SPK A;  1QLY A;  5IH2 A;  2DBK A;  1M8M A;  2GQI A;  2E5K A;  2L3P A;  2HCK A;  2EYX A;  2J05 A;  2J06 A;  2KR3 A;  4HCK A;  4KRT A;  2YDL A;  2KT1 A;  2EVR A;  1UDL A;  2CUD A;  1ZX6 A;  1TUD A;  3ZL7 C;  2DYB A;  3VS6 A;  2AZS A;  1I07 A;  1AEY A;  2JTE A;  1JQQ A;  3I9Q A;  1AWW A;  1HD3 A;  1PRL C;  1NG2 A;  3EHR A;  1OV3 A;  2ED0 A;  2HEQ A;  5GJV B;  3RBB B;  1CKA A;  1W1F A;  2EGA A;  2NUZ A;  3FJ5 A;  3VRZ A;  1UTI A;  2JT4 A;  2KRO A;  3REB B;  2W0Z A;  1WXB A;  1N5Z A;  3NPF A;  3A98 A;  2LCS A;  1OPL A;  3CQT A;  2LQN A;  3IQL A;  1GCQ A;  2FRW A;  2D8H A;  1ZBJ A;  2VKN A;  2CT4 A;  1JXM A;  4IIM A;  1XOV A;  1H8K A;  2J7I A;  1Y0M A;  1GCQ C;  1SEM A;  3U23 A;  3RNJ A;  2FPE A;  2X3W D;  5L23 A;  4ZNX A;  2EBP A;  2QDL A;  1YNZ A;  1X6B A;  1IO6 A;  5IHN A;  1UFF A;  2GBQ A;  4F17 A;  2RMO A;  2K79 A;  4CC4 B;  2F2W A;  1UE9 A;  2KRM A;  2EYW A;  3PVQ A;  1E6H A;  2CUB A;  3NGP A;  4ORZ A;  2GNC A;  1QKX A;  1QWF A;  2MIO A;  2F2V A;  2HBW A;  1T3L A;  4CC3 A;  1NEG A;  4HVW A;  4JZ4 A;  2MOX A;  4RTV A;  1B3Q A;  4X1V A;  2VVK A;  1WFW A;  3VS0 A;  2HSP A;  3EG0 A;  1U06 A;  1VYU A;  1RUW A;  4A63 B;  1GBQ A;  4WCI A;  2YUN A;  1UG1 A;  4J9D A;  2RNA A;  2V1R A;  1RI9 A;  3TSZ A;  4RTU A;  2AK5 A;  1A0N B;  3O5Z A;  2RQU A;  2YSQ A;  1GCP A;  1E7O A;  1OEB A;  3C0C A;  1H3H A;  4J9I A;  2M0Y A;  1PKS A;  2SRC A;  2K6D A;  1MV3 A;  1WDX A;  3I5S A;  4JPB W;  3H41 A;  2KGT A;  2AZV A;  5FW9 A;  1Z9Z A;  1GFC A;  3I5R A;  1VA7 A;  1NYG A;  4HVV A;  2EKH A;  4D8K A;  2FPD A;  5FWC A;  3VS4 A;  2DL8 A;  1PHT A;  2KE9 A;  1GBR A;  2EGC A;  2J6K A;  2AKL A;  1NLO C;  2JW4 A;  2EYZ A;  2ESW A;  2LMJ A;  2LJ1 A;  1WLP B;  1UHC A;  1UUE A;  1YWO A;  1K0S A;  1RLP C;  2JMC A;  5ECA A;  1ZUU A;  1BU1 A;  1T0J A;  4Y92 A;  1WYX A;  1K1Z A;  2F2X A;  2LX7 A;  4HXJ A;  1OPK A;  4AG1 C;  4RTY A;  1KFZ A;  2XMF A;  1SHF A;  3H0F A;  1M27 C;  4LN2 A;  3M0R A;  2NWM A;  3JV3 A;  4M4Z A;  2LZ6 B;  1UJY A;  2DA9 A;  1W70 A;  4OMP A;  2PNI A;  2DX1 A;  1YWP A;  2EGE A;  2K2M A;  2M51 A;  4J9H A;  3UA6 A;  1Z9Q A;  5GJW B;  1NYF A;  1PNJ A;  2KNB B;  4K11 A;  4AFS C;  1BBZ A;  1HJD A;  5HCK A;  4Z8A A;  1SRM A;  2GTO A;  1PKT A;  4OMM A;  4AG2 C;  1I1J A;  2DNU A;  2FG0 A;  1FYN A;  2ROT A;  2DIL A;  1T3S A;  2KXC A;  2KXD A;  1K9A A;  2PTK A;  1NLP C;  5IHK A;  1X2K A;  1YP5 A;  3TSW A;  1NM7 A;  3TVT A;  1PRM C;  2KT8 A;  1JEG A;  2YUP A;  2EQI A;  3LH5 A;  2A36 A;  1AD5 A;  2IIM A;  1K0X A;  4J9E A;  3NMZ C;  2KEA A;  2O9V A;  5I22 A;  4IIO A;  1T0H A;  1KIK A;  1EFN A;  2RQR A;  4ESR A;  2L2P A;  1GRI A;  2D8J A;  3EG2 A;  1QWE A;  1MUZ A;  3SHW A;  3REA B;  1PWT A;  2DL7 A;  2DMO A;  2K9G A;  2J6F A;  2OJ2 A;  1X2Q A;  2RF0 A;  2RQW A;  2YUO A;  2CSQ A;  1G2B A;  2H8H A;  2BZX A;  1X6G A;  5FWB A;  1KSW A;  1M3A A;  2CT3 A;  5I11 A;  4OMN A;  4Z88 A;  2L3S A;  2O9S A;  1CSK A;  3QWY A;  4RUG A;  4JZ3 A;  1RLQ C;  2RPN A;  1X69 A;  2DE0 X; 
#chains in the Genus database with same CATH topology
 1VQP A;  4PKC C;  1Q95 G;  1RAA B;  1YIJ T;  3CCR T;  4GLM A;  5KCH A;  3EHQ A;  2LQK A;  3M5A A;  1ZSG A;  3OBW A;  1M30 A;  1ARK A;  1WJS A;  4RTW A;  1JJ2 A;  2YT6 A;  1TUC A;  3QJY A;  1M8V A;  2BTT A;  2KDS A;  2A08 A;  2O31 A;  4D8D A;  2EWN A;  2PVD B;  1K76 A;  3JCM b;  2AIR B;  5GAM e;  2VYT A;  1ZA2 B;  1ZBX A;  1IRE B;  3JB9 J;  2ABL A;  5M9O A;  3CC4 A;  2EQM A;  2BIV A;  2L3Q A;  3MEU A;  3LX7 A;  3N5B B;  2GF7 A;  9ATC B;  2X4J A;  1AVZ C;  2YWW A;  2CH4 W;  4VUB A;  3R6N A;  4BI8 B;  1KHI A;  3QWX X;  4JLG A;  2P84 A;  5CKH A;  3G4S A;  2DF6 A;  2YHT A;  4FW2 A;  4BDY A;  1MV0 B;  1WXU A;  3S6W A;  2DL3 A;  6AT1 B;  2BZ8 A;  1KQS P;  4F16 A;  4M75 C;  2D1X A;  5GAM j;  2RK2 A;  4DBF A;  2L8D A;  2YLB A;  3RMS A;  4CC2 A;  2OTJ A;  1K8A U;  3QSU A;  1Q7Y R;  4M78 C;  4M77 F;  4QVD A;  4MZT A;  1D1C A;  5GAN e;  4OMQ A;  1S72 T;  4C8Q F;  3G6E T;  2KYM A;  3RKY A;  2EQK A;  3CPW A;  1OU9 A;  4OML A;  2PQW A;  4EMK C;  5IAY A;  2QTV A;  1QVG S;  2ZPE B;  2EPD A;  1ZUY A;  1JBM A;  3WVD B;  2DTI A;  1H92 A;  1M3B A;  1V1C A;  3SEM A;  2JNG A;  1YN8 A;  1PCX A;  4PLL A;  2O2O A;  4C0D B;  4X9C A;  2L0A A;  3CC7 A;  2P4T A;  1GXI E;  4F04 B;  2D9T A;  1CKB A;  4J9G A;  3CMA Q;  1UGS B;  2SEM A;  4JRQ A;  3OMC A;  4XU0 A;  5LJ5 j;  2P0K A;  5IXB A;  5FU7 B;  2MCN A;  4RG2 A;  2DL5 A;  1B34 A;  4AT1 B;  1WX6 A;  3EG3 A;  1HSQ A;  2F5K A;  1GL5 A;  4PJO C;  3JCM h;  5FRN A;  5CIU A;  2FZK B;  3PVL A;  5IT9 E;  1D09 B;  4JS5 A;  4QQG A;  3A8L B;  1WHK A;  4J9B A;  4OP0 A;  2VXE A;  1I0C A;  1G3T A;  1NPR A;  1K9M U;  1J3T A;  3SWN C;  2DXC A;  2ZPF B;  5CCA A;  4LDV A;  4RTZ A;  2A37 A;  2LVM A;  3UA7 A;  2JS2 A;  1MGQ A;  3CCQ A;  3E2U A;  3VS5 A;  4QKU A;  5FRO A;  3QPH A;  4AFU C;  2X3X D;  3GBQ A;  3UWN A;  1AWO A;  3BFM A;  2JM8 A;  4OF1 A;  1G3Y A;  1QQJ A;  3BDL A;  3CD6 A;  1WNL A;  2DFU A;  1ZA1 B;  2LP5 A;  2DL4 A;  4M75 A;  2EJG A;  2RJD A;  2DTH A;  3C12 A;  5GAO q;  4BE1 A;  4C92 F;  3X26 B;  2DBK A;  2Y4X A;  5GAM d;  2RI2 A;  1M8M A;  2GQI A;  4M7D C;  4KH0 B;  1HYO A;  2COW A;  4M78 A;  5GMK h;  3MP8 A;  2J06 A;  2KR3 A;  3E19 A;  1P92 A;  2YDL A;  3OYG A;  4ME7 A;  4E2F B;  2DEQ A;  1M1G A;  3ZFJ A;  1VQL Q;  1UDL A;  3QG1 A;  2CUD A;  2WSE E;  1N8R U;  3VS6 A;  1AEY A;  1JQQ A;  3I9Q A;  2M9U A;  1HD3 A;  3TEE A;  1AWW A;  4EMK A;  1NG2 A;  3A1P A;  4ZGJ B;  5GJV B;  1CKA A;  3QXE B;  1D1B A;  1MHN A;  1QVG P;  2E1H A;  2JT4 A;  2X4X A;  2XID A;  4HCC A;  1PSF A;  1WXB A;  3TU4 K;  3CCE A;  1W4S A;  1C6V X;  1VQ8 A;  1SF9 A;  1G5V A;  3I55 Q;  5GAO l;  3LWH A;  4CI0 C;  2D8H A;  2VKN A;  3BDU A;  4QVC A;  1JXM A;  2PU9 B;  5GAN d;  2MPX C;  1H8K A;  3L2U A;  2J7I A;  1Y0M A;  1GCQ C;  2FPE A;  4DBR A;  4ZNX A;  2DER A;  4F7U B;  5LJ5 d;  1O9S A;  2RMO A;  2K79 A;  4OGE A;  4CC4 B;  2F2W A;  1UE9 A;  1YJ9 T;  2V26 A;  2CUB A;  1O75 A;  4A53 A;  1QWF A;  7AT1 B;  2ZAE A;  2HMA A;  3CCM A;  1M90 U;  4HVW A;  4JZ4 A;  3HRT A;  2OTL Q;  3VS0 A;  2HSP A;  1YIJ A;  3CCR A;  2FL7 A;  4C8Q E;  1KC8 U;  1LPL A;  1SG5 A;  4TVR A;  1BI1 A;  2K5L A;  3FIF A;  2HQX A;  3PT9 A;  4M7A C;  1RI9 A;  1NBE B;  3JB9 D;  3AHU A;  2LNV A;  5KYW B;  3T9N A;  2COY A;  2RQU A;  5KYX A;  1GCP A;  4PFZ A;  2RHZ A;  3C0C A;  3I5S A;  1UGQ B;  3PNW C;  5CK9 A;  2KGT A;  4M7D B;  2LT4 A;  1ACM B;  1N27 A;  2LRQ A;  1PG5 B;  2K5I A;  1GFC A;  4HT9 A;  1TU0 B;  2FPD A;  2AT1 B;  4IUU A;  3JCM P;  3M4Y A;  1PHT A;  2EGC A;  1NLO C;  2AKL A;  2JW4 A;  2VUB A;  2LMJ A;  2O4X A;  5LJ3 e;  1WJR A;  1VIF A;  1RAB B;  3OYL A;  2KI7 A;  1RAF B;  1RLP C;  4XAX B;  3QDF A;  1HK9 A;  2QXF A;  3DLL A;  4Y92 A;  1WYX A;  4JRK A;  1VQ6 T;  3EG9 B;  1Y07 A;  1KFZ A;  1NZ9 A;  3OYM A;  2NUP B;  3HFO A;  1VQL T;  1M27 C;  1MNE A;  2NWM A;  2DIG A;  1S72 A;  3VJP A;  2DA9 A;  3G6E A;  3OB9 A;  1YJN Q;  5GAM h;  1IXD A;  2EGE A;  2M51 A;  1NYF A;  4K11 A;  4M75 G;  3TRE A;  2IPO B;  2DKG A;  1HJD A;  3GLX A;  2GTO A;  4AG2 C;  1IB8 A;  2XIC A;  2DNU A;  5KYY A;  1NJI R;  1IRX A;  8AT1 B;  4M78 G;  4C92 E;  4FU6 A;  1TSF A;  2GFA A;  2NUT A;  5IHK A;  1YP5 A;  5A2Q E;  2VGM A;  1NM7 A;  3TSW A;  3TVT A;  2EQI A;  4ELZ C;  1VQ4 Q;  2VB6 A;  2V8J A;  2EQJ A;  2O9V A;  4R56 A;  4V2S A;  1T0H A;  4E7Z A;  1EFN A;  4RKU E;  4ESR A;  2L2P A;  2D8J A;  4LDW A;  2DL7 A;  2QG9 B;  2D6F A;  1X2Q A;  3HFN A;  4QW2 A;  2QYZ A;  3CC7 T;  3JCM W;  1LNX A;  2OTL T;  5GAN h;  3CCV Q;  4II1 A;  4Z88 A;  4JLI A;  2H3E B;  2BE7 D;  5CKD A;  1BYM A;  4RUG A;  5KCO A;  1YJW Q;  1X69 A;  4BY6 C;  5GAO p;  3KXT A;  5LJ5 h;  2JXB A;  1BCO A;  2K2V A;  2YLC A;  4J7I A;  2J6O A;  1M2V A;  3VS1 A;  2RI3 A;  2VWF A;  1G8X A;  4E6R A;  4KBM B;  1M1K R;  2CZ6 B;  1AT1 B;  1BCM A;  1VQN Q;  3VS7 A;  4F7U G;  1VYV A;  1X43 A;  4JJB A;  5L8R E;  1VQ7 T;  2KYB A;  2YUQ A;  1Y7X A;  4PJO G;  3EGX A;  2AKK A;  2E6N A;  1RAD B;  1VQM T;  2I0N A;  3AT1 B;  1OQK A;  3PTA A;  3OSS C;  2E65 A;  2HQH A;  2E3H A;  3A8G B;  1W2B S;  1KD1 U;  1TG0 A;  4JJN K;  2LX9 A;  2OI3 A;  4KUI A;  1VYT A;  4RTT A;  3J7A F;  1BI2 A;  4CC7 A;  3PIO A;  4O5V A;  1SKU B;  5I2M A;  2MWP A;  4PJL A;  2KRN A;  4BD3 A;  3V7S A;  3M59 A;  1YCS B;  4JRP A;  4HVU A;  4OB0 B;  3LGL A;  1U3O A;  3CCL T;  2JS0 A;  1AZG B;  8ATC B;  1YJN T;  4M7D G;  1PSE A;  2CSI A;  2F1L A;  2FYK A;  3X20 B;  2HAX A;  2CP7 A;  2XI9 A;  2C0I A;  3WXM B;  3CXC S;  1R0B G;  2IVW A;  3EFR A;  2HD0 A;  1ZSZ A;  2FZG B;  1H64 1;  2X51 A;  2WSC E;  5A0L A;  2P0P A;  4IUT A;  2BE9 B;  2FO0 A;  1ZHI A;  3ULR B;  1W6X A;  2EYQ A;  1Q81 R;  3BE3 A;  3G71 Q;  4DEX A;  1KD1 R;  4J5Y A;  1XTD A;  4FYX B;  3CCJ T;  2DD5 A;  1K73 C;  4JS4 A;  1YJ9 A;  2E64 A;  1OOT A;  1VQ4 T;  4EMH A;  4IUV A;  2LQW A;  3OW2 A;  3M4G A;  3S3M A;  3UF4 A;  4EMG A;  2D0Q B;  5C6S A;  4PFP A;  4BB7 A;  3JCM X;  2JVV A;  2LJ3 A;  3P8B B;  2GQV A;  3M56 A;  3WVE B;  4HKE A;  4E7S A;  4QQD A;  2DXT A;  1NPP A;  5GAN 4;  1V29 B;  2XDD A;  1JU5 C;  1YJW T;  2GTJ A;  5D6Y A;  1E6G A;  3JSC A;  2G6F X;  2PZ1 A;  1EZZ B;  2E3I A;  1OUL A;  3H0I A;  1BIA A;  1VQK Q;  4FSS A;  3HKS A;  4EIK A;  2O88 A;  1UHF A;  3OBY A;  1VQ9 T;  2CP5 A;  1QKW A;  5GAN 7;  2JMA A;  4XU3 A;  3CCS T;  1ZLM A;  4PJJ A;  5FLX E;  1W2B P;  3M53 A;  4M7A G;  1QCN A;  3CPF A;  4PL6 A;  1UGR B;  3R6O A;  4GBQ A;  4LUE A;  2P4R A;  4M77 C;  2LNH B;  4JJC A;  3JB9 F;  1VQ6 A;  2DM1 A;  1QLY A;  4C8Q C;  3OYA A;  3F70 A;  1VQL A;  1YHQ T;  2MWO A;  1C1A A;  4ZN1 A;  3E1S A;  2A0F B;  3I56 Q;  1JJ2 S;  2XU8 A;  1Q86 U;  1TTH B;  1G3S A;  3JCM J;  4PJN A;  2KT1 A;  1YIT Q;  2EVR A;  3VUZ A;  3OYJ A;  3CXC P;  5A0G A;  1WHG A;  2KMT A;  1WPY A;  1ZX6 A;  1TUD A;  2M1H A;  2DYB A;  2JTE A;  3HRS A;  3MEA A;  3OYE A;  3EHR A;  2JZ2 A;  3OYF A;  2QK0 A;  3FJ5 A;  3VRZ A;  1UTI A;  2DTO A;  2KRO A;  2MAM A;  2EJ9 A;  3REB B;  4J6X A;  2W0Z A;  5HK3 A;  2ZPB B;  3NPF A;  2FVU A;  1PC0 A;  1WHL A;  1OPL A;  3CQT A;  2LQN A;  4Z02 A;  5CR2 A;  1VQO Q;  2FRW A;  4E7H A;  5KYU A;  3QBY A;  3VYH B;  2Z0W A;  4NS5 A;  4A4K A;  4ZGD B;  4WTO B;  3EH1 A;  2X3W D;  1TWB A;  2QA4 Q;  5CKF A;  5GMK i;  1N9S A;  3M57 A;  3O8V A;  5GAN j;  1Q86 R;  4FYW B;  5IHN A;  2ZZD A;  3CCU Q;  4X9D A;  2KRM A;  5GAN 2;  3C94 A;  3PVQ A;  2QEX Q;  2C06 A;  2OTL A;  2CP3 A;  1E6H A;  4XU2 A;  1K8A R;  4PNO A;  3NGP A;  2Y90 A;  4OVA A;  3CPW S;  3VYG A;  1N6A A;  2MIO A;  3OYY A;  1B34 B;  1UEB A;  3CME Q;  1VQ5 T;  1WZO A;  4J8O A;  4RTV A;  2HBP A;  3EG0 A;  1U06 A;  3CBP A;  4WCI A;  3L2W A;  1M1F A;  4C92 C;  5GMK m;  2V1R A;  4E47 A;  1VQK T;  4RTU A;  1A0N B;  1BI0 A;  1VQ7 A;  3FC3 A;  4M77 A;  2KVQ G;  4B9W A;  1PD0 A;  4L5G A;  2YSQ A;  3LH0 A;  2DAQ A;  1H3H A;  4J9I A;  4P5N A;  2SRC A;  4IKF A;  2K6D A;  1VQM A;  5KYN A;  2XD0 A;  4C8Q A;  2RJF A;  1D1A A;  3QKJ A;  3HRU A;  3KBG A;  1VQP Q;  3I5R A;  4BDZ A;  4M75 B;  2EKH A;  4D8K A;  4OMF B;  2KE9 A;  1NE8 A;  1GBR A;  2J6K A;  2EYZ A;  1LVK A;  3A5Z B;  2CZ7 B;  4BI3 A;  2DZC A;  2FHD A;  4M78 B;  4O6J A;  1UUE A;  1JJ2 P;  1K0S A;  5ECA A;  2ZPI B;  2XG8 D;  4LD9 K;  2DJZ A;  1K1Z A;  2F2X A;  4XTX A;  4HXJ A;  4AG1 C;  3CCL A;  4RTY A;  3HP9 A;  1HXD A;  5IN1 A;  5CQY A;  1YJN A;  2DEU A;  4EMK B;  2XMF A;  3S3N A;  1YIT T;  5LL6 S;  2OX7 A;  1WQ7 A;  1R0C B;  2LZ6 B;  4B9X A;  1K9M R;  2X35 A;  2VC8 A;  2PNI A;  1B7T A;  5CKE A;  2DX1 A;  1YWP A;  1WGS A;  2AHJ B;  4IUP A;  4LDY A;  3UA6 A;  1PNJ A;  4AFS C;  3CCJ A;  2YRC A;  4Z8A A;  1G3W A;  2QTX A;  1WHH A;  1VQ4 A;  2OTJ Q;  4NOY A;  1VQO T;  5AYF A;  2KXC A;  1Q7Y C;  2PTK A;  1NLP C;  2QA4 T;  5GAM f;  2KT8 A;  3TCJ A;  3MEW A;  3CPW P;  3NMZ C;  3CCU T;  4IIO A;  2RQR A;  2QEX T;  1N8R R;  2CZ1 B;  4PJO B;  1GRI A;  4L6V 5;  3CMA T;  1OYX A;  2A3L A;  3EG2 A;  1MUZ A;  4A4E A;  1PWT A;  2RB6 A;  2HSE B;  4C92 A;  2E5Q A;  3CME T;  3GPL A;  2J6F A;  1YJW A;  2YUO A;  4OB2 B;  2MI6 A;  3SWN B;  1KSW A;  2CT3 A;  3G1J A;  3OYH A;  2L3S A;  4EPC A;  1AHJ B;  1CSK A;  5GAN 8;  1D0X A;  1VQ9 A;  2DVJ A;  4BAC A;  1MMN A;  2PUK B;  3CCS A;  1BKB A;  3QHS A;  5C0M A;  2ZGW A;  3DKM A;  4ATO A;  5IHI A;  5CQX A;  4LE9 A;  3ME9 A;  2I2L A;  4DQ2 A;  1Y96 A;  1M9S A;  4PK4 A;  5GAN f;  3M0Q A;  1FX7 A;  4AFZ C;  1LOJ A;  4DA4 A;  4M75 E;  3JCM Q;  1YBY A;  1K73 U;  3LWI A;  4J9C A;  2EYY A;  1GFD A;  1TOV A;  1QVF A;  3EG1 A;  4XTW A;  1AOJ A;  5LJ5 f;  3MKD A;  1Y57 A;  4M78 E;  3QO3 A;  3SDZ A;  1YHQ A;  1G83 A;  2GGR A;  4OGC A;  1KQ1 A;  1M90 R;  3UPU A;  2CRE A;  1MMG A;  1SSH A;  4RCB A;  3V8L A;  1KC8 R;  1LCK A;  3CCQ Q;  2B86 A;  4LNP A;  4M77 G;  4A4G A;  4F14 A;  4N4G A;  4AMC A;  1N9R A;  3CD6 Q;  4X34 A;  2A28 A;  1WHM A;  4C5I A;  1U1T A;  2CH4 A;  4C8Q G;  1V76 A;  4PFO A;  4R0K A;  5LJ3 j;  4MMK A;  4KH1 B;  3EG9 A;  1OX8 A;  3DB4 A;  2ZPH B;  3UDC A;  1WI7 A;  3M0S A;  4M75 D;  2NUP A;  2P0Q A;  2VXF A;  1WHJ A;  2W10 A;  3EGD B;  3J80 E;  5KE3 A;  2QGF B;  3PE0 A;  1K73 R;  3I55 T;  5FU6 C;  4M78 D;  3RES A;  2DD4 A;  2DVE A;  3SFM A;  4J9F A;  1ZSZ C;  1BIB A;  3M58 A;  2QAS A;  4J6Y A;  3M55 A;  1M4Z A;  5HKC A;  2ENM A;  3HL8 A;  4F7U E;  3VS2 A;  2DPP B;  4OMO A;  1XQH A;  3RDV A;  3J81 E;  2F69 A;  3EH2 A;  4PJO E;  3PIP A;  3CCE Q;  4M7A B;  1YI2 Q;  1TUG B;  2FEI A;  2KY9 A;  1F1B B;  1VQ5 A;  4N4H A;  2Y4Y A;  4OB3 B;  2VGN A;  1BK2 A;  1WIE A;  1PD1 A;  3MP6 A;  3OA6 A;  1FWZ A;  4RTX A;  1MMA A;  2E6Z A;  5DM7 R;  3H8Z A;  1VQK A;  1M2V B;  3MET A;  2CP2 A;  1BB9 A;  2BZY A;  3ASK A;  3V8J A;  4LXC A;  4B6M A;  3UAT A;  2FB7 A;  3VS3 A;  4LDU A;  2ED1 A;  3GNG A;  1M2O A;  5GMK e;  1W2B A;  1D0Y A;  4M7D E;  3CCM Q;  1QCF A;  4QT7 A;  2K3B A;  3EGX B;  3MJX A;  3L1A A;  2JJ9 A;  4FSX A;  2CDT A;  3CCR Q;  2CP6 A;  4A4F A;  4PJO D;  1JO8 A;  2QI2 A;  2COZ A;  4C92 G;  4DEY A;  1JXO A;  2IG0 A;  2ROL A;  2D0N A;  2ZPG B;  3HPW A;  1OZ2 A;  2ZCF B;  2PVG B;  4FM4 B;  2VV5 A;  2EFI A;  2ECZ A;  1KQS A;  3EFO B;  2HKQ B;  2X4Y A;  5IXF A;  2KBT A;  3P8H A;  4ANJ A;  5GAN 5;  1WQW A;  1YIT A;  3CXC A;  5LJ3 d;  2E5K A;  4GLK A;  2L3P A;  2R5A A;  4ZTF A;  3QZ5 B;  1I5L A;  2QGG A;  1X01 A;  3CC2 Q;  3GOX A;  4HCK A;  3L2Z A;  3OYK A;  1DJ7 B;  3QZ9 B;  2ATC B;  4M7D D;  2RJE A;  2JTF A;  2MMP A;  2AZS A;  4RCC A;  1PRL C;  3OYD A;  3GNF B;  4LD6 A;  3VU3 C;  1VQO A;  1IHW A;  3G7Z A;  5CAI A;  3A98 A;  3V7C A;  1LJO A;  2QA4 A;  3VV0 A;  1OX9 A;  1S72 Q;  3CEY A;  3GF5 A;  4ZTJ A;  4CRI A;  3G6E Q;  4RG8 A;  1ZBJ A;  3CCU A;  2H3J A;  4HCB A;  2M0O A;  2QEX A;  4NL3 A;  3MCA B;  3CMA A;  1SEM A;  4M7A E;  5L23 A;  4JRI A;  4BY6 B;  1YI2 T;  2EBP A;  3CME A;  2QDL A;  3S3O A;  1IO6 A;  1UFF A;  2EYW A;  1NJI C;  2MK5 A;  3QII A;  5D7U A;  5CKB A;  3PMT A;  3CCV T;  1D3B A;  2GNC A;  1QKX A;  2HBW A;  4KUD K;  1VOM A;  2KAF A;  1VUB A;  4FYV B;  4N4I A;  3JCM g;  4X1V A;  3SD4 A;  2VVK A;  2M16 A;  2V8I A;  1VYU A;  1RUW A;  2M02 A;  1GBQ A;  2YUN A;  2LCL A;  4J9D A;  2RNA A;  2FZC B;  4C0D C;  3TSZ A;  3OW2 S;  1VQN T;  3X28 B;  2L89 A;  4FT2 A;  3O5Z A;  2LQ8 A;  3FRN A;  1PM3 A;  1QCO A;  1ZQ1 A;  2M0Y A;  1PKS A;  1MV3 A;  4M7A D;  3GIB A;  3H41 A;  1Q7Y U;  2DO3 A;  2EIF A;  2MYS A;  5FU7 C;  1VA7 A;  2VAS A;  3JCM f;  3UT1 A;  3FB9 A;  3VS4 A;  2ESW A;  1RAC B;  4DOW A;  1WLP B;  1UHC A;  1YWO A;  1M1K C;  4UC4 A;  2LCC A;  4MDW A;  2DZ9 A;  2JMC A;  3QDR B;  2RO0 A;  1ZUU A;  3EAE A;  1T0J A;  2RH2 A;  4XTV A;  5GMK l;  3OYB A;  2LX7 A;  1OI1 A;  3CC2 T;  1IGQ A;  1X75 C;  1WJQ A;  2XHC A;  4J7F A;  1QVG A;  1SHF A;  4N0A C;  2QQ9 A;  4M4Z A;  1RI0 A;  3LLR A;  3I55 A;  4IUQ A;  4OMP A;  2HQE A;  4MML A;  4BE0 A;  5EG2 A;  2K2M A;  4J9H A;  3CBO A;  4QQ6 A;  1BI3 A;  5LJ3 h;  2CYZ B;  3G71 T;  2KNB B;  5KYU B;  2E12 A;  2DXB A;  3QYH B;  3OYI A;  1FMW A;  1PKT A;  2QQA A;  3C95 A;  1I1J A;  1QMC A;  2EKO A;  2FG0 A;  2RM4 A;  3M54 A;  1EIF A;  2DIL A;  1T3S A;  1K9A A;  4E7I A;  2K5F A;  5LJ5 e;  1TS9 A;  2RI5 A;  1X2K A;  5J26 A;  4M75 F;  1PRM C;  2RD1 A;  1JEG A;  2YUP A;  1I5O B;  2A36 A;  1AD5 A;  2IIM A;  4FL6 A;  4HA8 A;  2OAU A;  3L2Q A;  2KEA A;  5I22 A;  4BUG A;  1KIK A;  3NTI A;  3E9G A;  4M78 F;  4ZN3 A;  1Q81 C;  1QWE A;  3SHW A;  3ZEH A;  1Q82 C;  1KD1 C;  4XU1 A;  5KH6 A;  2RF0 A;  1YJ9 Q;  2CSQ A;  1G2B A;  4FIB A;  2H8H A;  2BZX A;  1X6G A;  3LYI A;  3JB9 H;  1M3A A;  4OMN A;  3OW2 P;  4M77 B;  2O9S A;  3QWY A;  5J3B A;  4JZ3 A;  5I2S A;  2JUF A;  5DY9 A;  2X4W A;  2FRY A;  3MPU B;  1SHG A;  3FJP A;  2YRD A;  3TQ7 P;  3I35 A;  4C8Q B;  1OU8 A;  2L3R A;  1RL2 A;  4XTZ A;  4C0F A;  2RQT A;  1I8F A;  1I4K 1;  2K57 A;  2WAC A;  2RHI A;  1JB0 E;  3DLM A;  2PUO B;  3P8D A;  2K4Y A;  1FXX A;  4C5H A;  1K4U S;  1UEC A;  3RER A;  4JJD A;  4R55 A;  2K7A A;  2EJF A;  2CZ0 B;  1U8R A;  3SB2 A;  4XTU A;  4N0A A;  2XDP A;  3H9N A;  2V1Q A;  4F7U F;  4XTY A;  3I56 T;  3L2V A;  2LC4 A;  4PJO F;  1SRL A;  3CC4 Q;  2HL5 C;  1FMV A;  3H0H A;  3FEO A;  2NLU A;  1X6O A;  3THK A;  4PJM A;  1RAI B;  1VQ6 Q;  4C0G A;  2A7Y A;  2CS7 A;  2EW3 A;  2GCX A;  5GAM g;  3RUX A;  1R8O B;  4MZP A;  4D6W A;  1WA7 A;  3G4S Q;  2QAZ A;  1B07 A;  1NEB A;  3M0T A;  1WXT A;  3FLG A;  2DLP A;  3PMI A;  4HCZ A;  4E7K A;  1ABO A;  2DRM A;  2E41 A;  1AWJ A;  2CKK A;  4Z89 A;  4C5G A;  3RMQ A;  1H3Z A;  2HKN A;  4DBH A;  2DK3 A;  1IGU A;  4M7D F;  2YRV A;  3PFS A;  1YCY A;  3KFV A;  5CVI A;  3M0P A;  2KRS A;  1YI2 A;  2E70 A;  3QUI A;  2RN8 A;  4J6W A;  3EGU A;  3RKX A;  3CCV A;  4C92 B;  4L59 A;  2DRK A;  2DBM A;  4DBQ A;  3JAM E;  5GAN g;  4XQ3 A;  1MMD A;  1EX4 A;  2DJQ A;  2RA2 A;  2NYS A;  4ZGE B;  4Q5W A;  3MEV A;  2JM9 A;  4AFQ C;  4E7L A;  4F7U A;  2C0O A;  2QQB A;  1ABQ A;  3PGG A;  4YTL A;  5LJ5 g;  2O01 E;  1KG1 A;  5KYX B;  4M77 E;  5DLQ E;  1U1S A;  1RAH B;  3LGF A;  4PJO A;  1VQN A;  2B8A A;  1UJ0 A;  1Q86 C;  2OAW A;  3CC7 Q;  3NTK A;  4A54 A;  3OY9 A;  3OS2 A;  1ZUK A;  2RQV A;  2XKO C;  4LDX A;  1Y96 B;  5GAN 6;  1K8A C;  1KJW A;  3M0U A;  3SWN A;  1UB4 A;  3LW5 E;  3JB9 G;  3OQ5 A;  5CO7 A;  2O4X B;  1VQP T;  3NFC A;  3A8M B;  1AZE A;  3DB3 A;  5KYW A;  2GFU A;  3NHN A;  4E7J A;  3BW1 A;  2HDA A;  2HNI A;  3VKI A;  2FPF A;  2C0T A;  3GP8 A;  1S1N A;  4BE2 A;  5A0D A;  2HZY A;  5EC7 A;  1X27 A;  4MZM A;  3VRY A;  1VQ7 Q;  1UGV A;  1FMK A;  4LUD A;  4M7D A;  2LJ0 A;  4KGZ B;  3OMG A;  4A4H A;  1U5S A;  3CC2 A;  3RKW A;  1NJI U;  4DOV A;  1M3C A;  1AWX A;  1SPK A;  2K3X A;  5IH2 A;  1VQM Q;  4Y28 E;  3E9F A;  4M77 D;  4M7A F;  2LTO A;  3CC4 T;  5GAO m;  2EQU A;  2HCK A;  1C0M A;  3Q1J A;  2MF2 A;  5J39 A;  3MHX A;  2RJC A;  2EYX A;  2J05 A;  4KRT A;  2E4H A;  4C8Q D;  4MDX A;  1QVP A;  2KK4 A;  3HTR A;  1QP2 A;  3G4S T;  3ZL7 C;  1QVF S;  2DXU A;  3G71 A;  1I07 A;  2R5M A;  5KYY B;  2DIQ A;  2E10 A;  3ER0 A;  1OV3 A;  2ED0 A;  2HEQ A;  3RBB B;  3OS0 A;  3RR6 A;  3CCL Q;  1W1F A;  2EGA A;  3OSV A;  2NUZ A;  2NUT B;  2OTJ T;  2K3Y A;  2V8K A;  2YXY A;  1N5Z A;  3H6Z A;  2LCS A;  3D7S B;  5I21 A;  1KHC A;  4BI4 A;  1R77 A;  4JDS A;  1TXQ A;  3IQL A;  1GCQ A;  1VIE A;  2BKD N;  1RAE B;  1K9M C;  5D6X A;  4KUL A;  3JCM e;  2CT4 A;  3EGD A;  4IIM A;  1XOV A;  1YFN A;  1I81 A;  5GAN 3;  4FCY A;  1RAG B;  3U23 A;  1M1K U;  3RNJ A;  5GAO n;  5HY6 A;  1QW1 A;  1VQ8 Q;  3CCJ Q;  4KGX B;  2JN0 A;  3JB9 I;  1YNZ A;  1X6B A;  2LDM A;  2GBQ A;  4F17 A;  2RHX A;  2G3R A;  2WSF E;  1OZ3 A;  4RMO A;  2CP0 A;  1IHV A;  2R58 A;  2KSS A;  4OB1 B;  3A8O B;  4ORZ A;  1XJW B;  4FW1 A;  1UGP B;  2BUD A;  2CGH A;  4HT8 A;  3JRZ A;  2F2V A;  1T3L A;  3NTH A;  4CC3 A;  5FRM A;  1NEG A;  2MOX A;  4M7A A;  4FYY B;  1B3Q A;  2RHU A;  1WFW A;  3M9Q A;  4A63 B;  1N8R C;  1SSF A;  1UG1 A;  4C0Z A;  2AK5 A;  3VUB A;  4KGV B;  2R57 A;  1YIJ Q;  3L42 A;  1E7O A;  1OEB A;  4C92 D;  1WDX A;  2JOY A;  4JPB W;  2AZV A;  1Y71 A;  5FW9 A;  1Z9Z A;  3OYN A;  1VQ9 Q;  3KUF A;  4HVV A;  1NYG A;  4J83 A;  3I56 A;  4PLI A;  5FWC A;  3CCS Q;  2DL8 A;  2QQS A;  2LJ1 A;  5GMK j;  4JUV A;  3CCQ T;  1D0Z A;  1Q81 U;  3V7R A;  3X24 B;  1BU1 A;  3L2R A;  4ELY C;  1Q82 U;  3OS5 A;  2L5Q A;  3CD6 T;  2DYI A;  1QVF P;  3QYG B;  1OPK A;  2EAY A;  4FT4 A;  5FU6 B;  2HL3 A;  3FDR A;  3CBM A;  3EFO A;  1ZSZ B;  3H0F A;  1YHQ Q;  4LN2 A;  3M0R A;  3OS1 A;  3JV3 A;  4GY5 A;  1M90 C;  1IZ6 A;  3C4S A;  4IUR A;  3QJ6 A;  5GAO r;  1UJY A;  3ZBD A;  1KK7 A;  3MO8 A;  1W70 A;  1KQS S;  1KC8 C;  5LJ3 g;  2LT1 A;  3V8K A;  3X25 B;  3BY7 A;  2RK1 A;  5AT1 B;  1Z9Q A;  5GJW B;  4NL2 A;  5KE2 A;  4C5E A;  1BBZ A;  5HCK A;  3MP1 A;  1SRM A;  4OMM A;  3HSB A;  3JCM V;  4XK8 E;  1FYN A;  2ROT A;  5D6W A;  3A8H B;  2KXD A;  1QP3 A;  1KQ2 A;  4Y91 A;  3CCE T;  1Q82 R;  2X9H A;  4KT0 E;  1VQ8 T;  3LH5 A;  5LJ3 f;  1K0X A;  1D3B B;  4J9E A;  2QQR A;  2F5T X;  2XDB A;  1TH7 A;  3RIR A;  3JCM c;  3URG A;  1M5Q 1;  4WF2 A;  3JCM d;  3REA B;  3OYC A;  2DMO A;  3EFS A;  5DLO A;  4EDU A;  2K9G A;  2RHY A;  1MND A;  2QDY B;  1XNI A;  2OJ2 A;  3INZ A;  2RQW A;  5HK0 A;  2JTM A;  2DET A;  5FWB A;  5I11 A;  2KQW A;  4QVZ A;  2PVO B;  2XK0 A;  1JRI A;  1VQ5 Q;  1RLQ C;  2RPN A;  3HHT B;  3CCM T;  2DE0 X; 
#chains in the Genus database with same CATH homology
 2JXB A;  2DVJ A;  2FRY A;  1SHG A;  2J6O A;  3VS1 A;  3I35 A;  2VWF A;  4GLM A;  4E6R A;  5IHI A;  3EHQ A;  1ARK A;  1ZSG A;  1M30 A;  4LE9 A;  2RQT A;  4RTW A;  2YT6 A;  1TUC A;  3M0Q A;  3VS7 A;  2BTT A;  2A08 A;  2O31 A;  4D8D A;  1VYV A;  1X43 A;  4AFZ C;  4JJB A;  1K76 A;  2KYB A;  2YUQ A;  4J9C A;  2EYY A;  1GFD A;  2ABL A;  2AKK A;  3EG1 A;  1AOJ A;  1K4U S;  1UEC A;  4JJD A;  1Y57 A;  2I0N A;  2K7A A;  2L3Q A;  1G83 A;  2GGR A;  1TG0 A;  2V1Q A;  2CRE A;  2OI3 A;  1SSH A;  1AVZ C;  1VYT A;  4RTT A;  2CH4 W;  4CC7 A;  3R6N A;  1LCK A;  1SRL A;  3QWX X;  2B86 A;  2DF6 A;  4LNP A;  3H0H A;  1MV0 B;  4F14 A;  1WXU A;  2KRN A;  2DL3 A;  3THK A;  2BZ8 A;  1YCS B;  4F16 A;  2D1X A;  2EW3 A;  4HVU A;  2A28 A;  2CH4 A;  1U3O A;  4R0K A;  2JS0 A;  1AZG B;  4CC2 A;  1WA7 A;  1B07 A;  2CSI A;  1NEB A;  3M0T A;  1WXT A;  1WI7 A;  2DLP A;  3M0S A;  2C0I A;  1ABO A;  2DRM A;  2W10 A;  1AWJ A;  4OMQ A;  3PE0 A;  4Z89 A;  2KYM A;  2FO0 A;  4OML A;  3ULR B;  1W6X A;  4J9F A;  3KFV A;  4DEX A;  3M0P A;  2EPD A;  2KRS A;  1ZUY A;  2ENM A;  1H92 A;  3VS2 A;  2RN8 A;  1M3B A;  1V1C A;  4OMO A;  3SEM A;  1OOT A;  1YN8 A;  3EGU A;  2O2O A;  2DRK A;  2DBM A;  2LQW A;  2FEI A;  1BK2 A;  2L0A A;  1WIE A;  3UF4 A;  2DJQ A;  2JM9 A;  4AFQ C;  1CKB A;  4J9G A;  2SEM A;  2C0O A;  1ABQ A;  2LJ3 A;  4RTX A;  5IXB A;  2MCN A;  1BB9 A;  1UJ0 A;  1JU5 C;  2OAW A;  2BZY A;  2GTJ A;  2DL5 A;  1WX6 A;  1ZUK A;  1E6G A;  3EG3 A;  3UAT A;  2G6F X;  2RQV A;  1HSQ A;  3VS3 A;  2PZ1 A;  1GL5 A;  2ED1 A;  3H0I A;  1KJW A;  3M0U A;  4FSS A;  3PVL A;  1QCF A;  4EIK A;  2O88 A;  4QT7 A;  1UHF A;  4J9B A;  1I0C A;  1QKW A;  2K3B A;  2JMA A;  1J3T A;  1ZLM A;  2CDT A;  1AZE A;  4RTZ A;  2A37 A;  1JO8 A;  3NHN A;  3UA7 A;  2JS2 A;  4DEY A;  1JXO A;  2HDA A;  3VS5 A;  2ROL A;  2FPF A;  4GBQ A;  2D0N A;  2C0T A;  4LUE A;  1S1N A;  4AFU C;  2P4R A;  2X3X D;  3GBQ A;  1AWO A;  5EC7 A;  2LNH B;  1X27 A;  2JM8 A;  4JJC A;  3VRY A;  1UGV A;  1FMK A;  4LUD A;  2ECZ A;  2LJ0 A;  2LP5 A;  2DM1 A;  1U5S A;  5IXF A;  2DL4 A;  2KBT A;  1M3C A;  1AWX A;  1SPK A;  1QLY A;  5IH2 A;  2DBK A;  1M8M A;  2GQI A;  2E5K A;  2L3P A;  2HCK A;  2EYX A;  2J05 A;  2J06 A;  2KR3 A;  4HCK A;  4KRT A;  2YDL A;  2KT1 A;  2EVR A;  1UDL A;  2CUD A;  1ZX6 A;  1TUD A;  3ZL7 C;  2DYB A;  3VS6 A;  2AZS A;  1I07 A;  1AEY A;  2JTE A;  1JQQ A;  3I9Q A;  1AWW A;  1HD3 A;  1PRL C;  1NG2 A;  3EHR A;  1OV3 A;  2ED0 A;  2HEQ A;  5GJV B;  3RBB B;  1CKA A;  1W1F A;  2EGA A;  2NUZ A;  3FJ5 A;  3VRZ A;  1UTI A;  2JT4 A;  2KRO A;  3REB B;  2W0Z A;  1WXB A;  1N5Z A;  3NPF A;  3A98 A;  2LCS A;  1OPL A;  3CQT A;  2LQN A;  3IQL A;  1GCQ A;  2FRW A;  2D8H A;  1ZBJ A;  2VKN A;  2CT4 A;  1JXM A;  4IIM A;  1XOV A;  1H8K A;  2J7I A;  1Y0M A;  1GCQ C;  1SEM A;  3U23 A;  3RNJ A;  2FPE A;  2X3W D;  5L23 A;  4ZNX A;  2EBP A;  2QDL A;  1YNZ A;  1X6B A;  1IO6 A;  5IHN A;  1UFF A;  2GBQ A;  4F17 A;  2RMO A;  2K79 A;  4CC4 B;  2F2W A;  1UE9 A;  2KRM A;  2EYW A;  3PVQ A;  1E6H A;  2CUB A;  3NGP A;  4ORZ A;  2GNC A;  1QKX A;  1QWF A;  2MIO A;  2F2V A;  2HBW A;  1T3L A;  4CC3 A;  1NEG A;  4HVW A;  4JZ4 A;  2MOX A;  4RTV A;  1B3Q A;  4X1V A;  2VVK A;  1WFW A;  3VS0 A;  2HSP A;  3EG0 A;  1U06 A;  1VYU A;  1RUW A;  4A63 B;  1GBQ A;  4WCI A;  2YUN A;  1UG1 A;  4J9D A;  2RNA A;  2V1R A;  1RI9 A;  3TSZ A;  4RTU A;  2AK5 A;  1A0N B;  3O5Z A;  2RQU A;  2YSQ A;  1GCP A;  1E7O A;  1OEB A;  3C0C A;  1H3H A;  4J9I A;  2M0Y A;  1PKS A;  2SRC A;  2K6D A;  1MV3 A;  1WDX A;  3I5S A;  4JPB W;  3H41 A;  2KGT A;  2AZV A;  5FW9 A;  1Z9Z A;  1GFC A;  3I5R A;  1VA7 A;  1NYG A;  4HVV A;  2EKH A;  4D8K A;  2FPD A;  5FWC A;  3VS4 A;  2DL8 A;  1PHT A;  2KE9 A;  1GBR A;  2EGC A;  2J6K A;  2AKL A;  1NLO C;  2JW4 A;  2EYZ A;  2ESW A;  2LMJ A;  2LJ1 A;  1WLP B;  1UHC A;  1UUE A;  1YWO A;  1K0S A;  1RLP C;  2JMC A;  5ECA A;  1ZUU A;  1BU1 A;  1T0J A;  4Y92 A;  1WYX A;  1K1Z A;  2F2X A;  2LX7 A;  4HXJ A;  1OPK A;  4AG1 C;  4RTY A;  1KFZ A;  2XMF A;  1SHF A;  3H0F A;  1M27 C;  4LN2 A;  3M0R A;  2NWM A;  3JV3 A;  4M4Z A;  2LZ6 B;  1UJY A;  2DA9 A;  1W70 A;  4OMP A;  2PNI A;  2DX1 A;  1YWP A;  2EGE A;  2K2M A;  2M51 A;  4J9H A;  3UA6 A;  1Z9Q A;  5GJW B;  1NYF A;  1PNJ A;  2KNB B;  4K11 A;  4AFS C;  1BBZ A;  1HJD A;  5HCK A;  4Z8A A;  1SRM A;  2GTO A;  1PKT A;  4OMM A;  4AG2 C;  1I1J A;  2DNU A;  2FG0 A;  1FYN A;  2ROT A;  2DIL A;  1T3S A;  2KXC A;  2KXD A;  1K9A A;  2PTK A;  1NLP C;  5IHK A;  1X2K A;  1YP5 A;  3TSW A;  1NM7 A;  3TVT A;  1PRM C;  2KT8 A;  1JEG A;  2YUP A;  2EQI A;  3LH5 A;  2A36 A;  1AD5 A;  2IIM A;  1K0X A;  4J9E A;  3NMZ C;  2KEA A;  2O9V A;  5I22 A;  4IIO A;  1T0H A;  1KIK A;  1EFN A;  2RQR A;  4ESR A;  2L2P A;  1GRI A;  2D8J A;  3EG2 A;  1QWE A;  1MUZ A;  3SHW A;  3REA B;  1PWT A;  2DL7 A;  2DMO A;  2K9G A;  2J6F A;  2OJ2 A;  1X2Q A;  2RF0 A;  2RQW A;  2YUO A;  2CSQ A;  1G2B A;  2H8H A;  2BZX A;  1X6G A;  5FWB A;  1KSW A;  1M3A A;  2CT3 A;  5I11 A;  4OMN A;  4Z88 A;  2L3S A;  2O9S A;  1CSK A;  3QWY A;  4RUG A;  4JZ3 A;  1RLQ C;  2RPN A;  1X69 A;  2DE0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...