4J9IA

Crystal structure of the abl-sh3 domain complexed with the designed high-affinity peptide ligand p17
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
56
structure length
56
Chain Sequence
LFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the ABL-SH3 domain complexed with the designed high-affinity peptide ligand P17
rcsb
source organism Homo sapiens
molecule tags Transferase/unknown function
total genus 10
structure length 56
sequence length 56
chains with identical sequence C, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4j9iA00
1B07A 2KT8A 2ROLA 2DLPA 2M0YA 2NUZA 3VS5A 1GCQC 3C0CA 4JJDA 4CC3A 3EHQA 4ZNXA 1T3SA 1X69A 1T0JA 1GBQA 1WFWA 3M0SA 5FW9A 1AZGB 2CUDA 5IXBA 2KBTA 2RPNA 1JU5C 1UJ0A 4ORZA 4OMNA 4F17A 2IIMA 3M0UA 2RN8A 1WX6A 1Y0MA 2KXCA 4IIOA 2L3QA 3ZL7C 2EGAA 1K76A 2HBWA 3UA7A 1I07A 1WDXA 2GTOA 3M0PA 2RQWA 1ZSGA 3EGUA 3H0HA 1X2QA 3NHNA 1GFDA 1W70A 2DL4A 1PNJA 2LX7A 5IHIA 2VKNA 2DL8A 3REBB 4CC7A 1T0HA 3TVTA 1KSWA 3NMZC 4F14A 2RNAA 2DBMA 1JQQA 2E5KA 2EYZA 2FRWA 1UDLA 4GLMA 5GJWB 1H92A 2YSQA 2L2PA 2A28A 2FG0A 2RF0A 4J9FA 4HVVA 2EVRA 2JTEA 2G6FX 2KYMA 3R6NA 1SSHA 2CUBA 2SRCA 2A08A 2JMCA 1S1NA 2MOXA 4J9EA 1GFCA 5FWBA 1NEBA 2I0NA 4LUEA 3QWYA 2BZ8A 2GGRA 2K2MA 4RUGA 2VVKA 3M0QA 1NYGA 3IQLA 1TG0A 4WCIA 2DRMA 1E6HA 4LUDA 4OMOA 1HJDA 3REAB 2C0TA 1PKTA 2SEMA 1KJWA 3RBBB 1W1FA 3UF4A 1RLQC 1K9AA 2M51A 2C0IA 3QWXX 4RTWA 1NG2A 1UFFA 2YUNA 2RQVA 2D0NA 2AKKA 1Z9ZA 2LMJA 5ECAA 3U23A 2D8JA 1OOTA 1U5SA 1X2KA 3VS2A 1NM7A 2PNIA 4JJCA 3VS0A 2EYYA 4KRTA 2LCSA 2CSIA 5IXFA 1AVZC 2MIOA 2CT4A 3NGPA 1SEMA 3EG3A 4Z88A 1GRIA 1VYUA 4JPBW 2F2XA 3JV3A 3VS4A 2HEQA 1VYVA 4J9GA 2A37A 3FJ5A 2KXDA 2DL5A 2ED0A 2C0OA 1UHCA 1UG1A 2RQRA 2HDAA 4X1VA 1EFNA 3GBQA 1GL5A 2EPDA 1X43A 1N5ZA 1YP5A 1QWFA 1ZLMA 1WIEA 1Y57A 1IO6A 1E6GA 2CH4W 2JS2A 1JXMA 2K9GA 2CSQA 3LH5A 2W10A 1SHGA 3NPFA 2PZ1A 4OMQA 4RTXA 4DEXA 1QCFA 2HSPA 5FWCA 1H8KA 1K0SA 2EGEA 1PHTA 2DX1A 1K1ZA 2LJ3A 2KYBA 2KR3A 1ABOA 1BB9A 1TUDA 1W6XA 4AFZC 2J6OA 4Y92A 1WA7A 1XOVA 3PE0A 3RNJA 1PWTA 2P4RA 1AWJA 4OMPA 4Z8AA 2YDLA 2CT3A 1BU1A 2LQWA 1UHFA 3EG0A 3EHRA 2AZVA 2BTTA 3H0FA 2L3PA 5I22A 1G83A 2JM8A 4J9DA 1OPKA 1NLOC 2J6KA 2JS0A 1UGVA 2W0ZA 1WYXA 2CREA 1YNZA 4JZ3A 1M3BA 4QT7A 4HVUA 2DILA 4J9CA 1VYTA 3SEMA 2V1RA 2H8HA 3I9QA 2DL7A 4HVWA 1KFZA 2OAWA 2PTKA 1BK2A 4J9IA 3VS3A 3SHWA 4AFUC 2EQIA 2V1QA 3PVQA 2DVJA 1AWXA 2DA9A 5HCKA 1HD3A 1X27A 2MCNA 2A36A 2KNBB 2LNHB 4AG2C 2F2WA 1K4US 4FSSA 2J7IA 1YWOA 1WXBA 1X6GA 1RI9A 2BZYA 2O9VA 1UE9A 4E6RA 1PKSA 1NEGA 2EKHA 1AEYA 1RLPC 1PRMC 1Z9QA 2K6DA 2KGTA 2JT4A 4LE9A 4A63B 2LJ1A 2XMFA 1CKBA 1JEGA 1M27C 1NYFA 3TSWA 4J9BA 2AKLA 3VS1A 2ABLA 2FPEA 3M0RA 2EGCA 3PVLA 1A0NB 1BBZA 2LZ6B 2K3BA 3EG1A 1MV0B 2KRNA 3CQTA 4HCKA 2JW4A 3UA6A 4OMLA 2D1XA 3I35A 2CH4A 1QLYA 2DYBA 2LJ0A 2ED1A 4EIKA 2KROA 4HXJA 1KIKA 3O5ZA 4RTVA 5EC7A 2ENMA 2L3SA 2OJ2A 3TSZA 1M30A 1SRMA 2DJQA 5I11A 5IHKA 1PRLC 4Z89A 1SPKA 3EG2A 2FPFA 4K11A 1U06A 2RQTA 1OPLA 3I5RA 3M0TA 4RTZA 2B86A 4IIMA 3THKA 4AFQC 2KE9A 1B3QA 1UTIA 5IH2A 1GCPA 1HSQA 2DBKA 1QKWA 1G2BA 1FYNA 1AOJA 1U3OA 1T3LA 2DNUA 1J3TA 4M4ZA 1YWPA 1M3AA 3VS6A 1UECA 1ZUYA 2EYWA 1UJYA 4RTTA 1ZBJA 4JZ4A 1H3HA 4JJBA 4RTUA 2GBQA 4R0KA 1MV3A 4RTYA 1SHFA 2DM1A 2GQIA 3VS7A 4J9HA 1AZEA 2X3WD 1E7OA 2YUPA 4AG1C 2LP5A 1TUCA 3UATA 1WI7A 1K0XA 1NLPC 1WXUA 2YT6A 4LN2A 1SRLA 2K7AA 2LQNA 1LCKA 1ABQA 1RUWA 2DRKA 2GNCA 2AZSA 2DE0X 1I1JA 2J05A 3H0IA 2KRMA 2EW3A 4DEYA 2RQUA 1YCSB 2O31A 2L0AA 1JO8A 2FO0A 1AD5A 3A98A 1QKXA 1AWWA 2AK5A 1X6BA 3H41A 2BZXA 2O2OA 1JXOA 1CKAA 1YN8A 1M3CA 2D8HA 2DF6A 4CC2A 2JM9A 3VRYA 2GTJA 2FPDA 2YUOA 1OEBA 4GBQA 1FMKA 1ZUUA 1M8MA 4AFSC 5IHNA 4CC4B 1CSKA 2YUQA 2VWFA 2DL3A 2OI3A 1AWOA 1ARKA 1VA7A 3VRZA 4ESRA 2ECZA 2KEAA 2ESWA 2F2VA 2J6FA 2J06A 2RMOA 2JXBA 4LNPA 1I0CA 2ROTA 1WLPB 2CDTA 2FEIA 1UUEA 1OV3A 4D8DA 4F16A 2KT1A 4OMMA 1ZUKA 3I5SA 1GBRA 1QWEA 2FRYA 3ULRB 2O9SA 2QDLA 2JMAA 3KFVA 2EYXA 2K79A 2DMOA 2KRSA 5L23A 2NWMA 2O88A 2X3XD 1GCQA 4D8KA 2EBPA 2HCKA 1V1CA 1WXTA 1ZX6A 5GJVB 1MUZA
chains in the Genus database with same CATH superfamily
5HY6A 2KT8A 5J39A 2M0YA 4B9XA 3GOXA 1VQ6Q 3QDFA 4CC3A 2DFUA 3EHQA 2DO3A 4FYXB 1C0MA 1IHVA 4PFZA 4NL2A 1M2OA 2E3IA 1FWZA 2C06A 4BDZA 2DTIA 1JU5C 2L5QA 2V8JA 3CPWS 1W2BP 3FLGA 1YITQ 5GAOq 1Y0MA 3OYFA 4FM4B 4C8QF 1BI3A 1KQSS 1YITA 1K76A 3UA7A 1MMNA 1U8RA 3LLRA 2RQWA 5GAN5 4C0GA 1UGPB 2JVVA 3HFOA 3OS1A 1K73U 2KK4A 3CC7T 3REBB 5CIUA 4QVZA 3OQ5A 1UGRB 2DBMA 2RNAA 1WJSA 2WSCE 2FHDA 2YSQA 3X26B 1XTDA 3CPWP 3V7RA 3JB9G 1YIJQ 2RF0A 4QQDA 2JTEA 1YIJA 4IUUA 1D1CA 1KQSP 2CGHA 3GNGA 2CUBA 3TEEA 2JMCA 1GFCA 3SFMA 2HKQB 1NEBA 3MP1A 3OYBA 2RI5A 1M4ZA 2VVKA 4M78F 1KD1R 2CZ0B 3FC3A 1TG0A 1BYMA 2MMPA 3URGA 2V8IA 2C0TA 1PKTA 2LRQA 2SEMA 3JCMd 3SWNA 1RLQC 3EGXA 2C0IA 3QWXX 4XTYA 4LDWA 4WTOB 4HCBA 1NM7A 2DYIA 2E1HA 3QKJA 1VQ5T 4PJOF 2QEXQ 3E9GA 3JAME 2QEXA 5IXFA 2MIOA 2CT4A 5GAMf 4C8QE 1YJNQ 5GANg 4Y28E 1YJNA 5LJ5h 1VUBA 1N6AA 3V8LA 2ED0A 2K5IA 2DTHA 2EKOA 5CKHA 5KYXA 1QMCA 1YBYA 3M4YA 3WVEB 1KQ1A 4PJOC 1WIEA 4F04B 1YHQQ 3VV0A 1YHQA 1JXMA 2K9GA 4BI3A 5FRMA 1BIAA 1U1SA 1SHGA 4AT1B 4IURA 4NL3A 4OB3B 3BE3A 5GAN6 4BE2A 1QCFA 2HSPA 5FWCA 2HQXA 1YI2T 1FX7A 2LJ3A 4EMGA 3OYCA 4XTWA 1BB9A 3OBWA 3GP8A 1QVGS 1K8AU 4M78E 3FDRA 4ELZC 2QQSA 6AT1B 1W6XA 4PJJA 2JN0A 1G8XA 2VXFA 3I56Q 1Q86C 3C94A 1XOVA 3M5AA 1PWTA 3RESA 2V8KA 3I56A 3NTHA 2P4RA 3CC4T 3HRSA 4O6JA 2L8DA 4C8QA 2QASA 5I21A 2L3PA 1G83A 1D3BB 3INZA 4JLIA 2JS0A 1QVGP 3L2QA 1UGVA 2OX7A 5GAN2 3LWIA 3X28B 2CREA 4JZ3A 4QT7A 5KCOA 3FB9A 3PMTA 1NPPA 5D6YA 4HVWA 4BUGA 1XQHA 2CP0A 3OB9A 3CMEQ 2ZPHB 1RI0A 2H3EB 1S72Q 3CMEA 3SHWA 5AT1B 2DVJA 1S72A 2YXYA 8AT1B 4BDYA 1YJ9T 3HHTB 4HT8A 1X27A 1KHIA 2MCNA 8ATCB 3CCUQ 3HPWA 4C0DB 4ELYC 2M0OA 1OYXA 2ZPIB 1ZSZA 4M78A 5L8RE 3OW2S 3CCUA 2DD4A 1Q7YU 2F2WA 2CS7A 4A4HA 4C5HA 1N27A 3CCET 3TCJA 4DQ2A 2O9VA 2RJEA 1AEYA 1D0ZA 1RLPC 3E1SA 4PFPA 3ZFJA 1X01A 3GPLA 4LE9A 2CP6A 2XMFA 1JEGA 1M27C 1NYFA 1VQLT 3OSSC 2ABLA 1IB8A 2EGCA 3PVLA 2CZ1B 3EG1A 1WQWA 3CC7Q 1KC8U 1R0BG 3CC7A 4C92B 3FIFA 1WHKA 1I5LA 2CH4A 4M7DB 3MEUA 4EIKA 2K5LA 3GNFB 1KIKA 4QVDA 3QDRB 5EC7A 2ENMA 2OJ2A 3QXEB 5LJ5d 1M2VA 2OTJQ 1SRMA 2DJQA 1ACMB 1PRLC 4E2FB 2OTJA 2FPFA 1VQ8Q 3KXTA 1LNXA 2X51A 1VQ8A 1OX8A 2ZPEB 2H3JA 3JCMf 4RTZA 1O75A 5LJ5e 5GMKh 4AFQC 2P84A 3S6WA 2DXCA 4BI8B 5CVIA 4C5IA 4CI0C 1N8RR 5GANd 1HSQA 2DBKA 3P8HA 1SKUB 2DNUA 1U3OA 1T3LA 4E7LA 1WJQA 2AHJB 1ZUYA 1QVFS 4M7DD 2ZAEA 1UGQB 2LCLA 4M77B 3UPUA 1QQJA 3CCVT 3JB9D 5CK9A 5A0LA 1BCOA 3VUZA 5D6WA 4JJBA 2DXBA 4RTUA 1PCXA 3RR6A 3UWNA 4RTYA 1SHFA 3VS7A 2E64A 4BD3A 5GAOn 3I55T 2X3WD 1TUCA 2I2LA 2R5MA 3V8KA 1OZ2A 1WXUA 4LN2A 2E65A 2DRKA 2AZSA 4LD9K 3CXCA 3H8ZA 2B8AA 2RQUA 3OYEA 2DTOA 2RI3A 7AT1B 1JO8A 2VC8A 4Y91A 2FO0A 1AD5A 5DLQE 3KUFA 3H41A 2O2OA 2AIRB 1VQ7Q 5GMKj 2HL3A 2WSEE 1M3CA 2DF6A 2YLCA 1VQ7A 3HSBA 4DBFA 1RL2A 2RJCA 2HMAA 4KGVB 3RKXA 1YI2Q 3CCRQ 2RHIA 5KYNA 1YI2A 3CCRA 2G3RA 1WHHA 1CSKA 2YUQA 1IREB 3LGLA 1G3TA 2OI3A 3RIRA 2ECZA 3OMGA 2ESWA 4LNPA 2JXBA 2RD1A 5C0MA 4E7ZA 1QVPA 2CDTA 5GAMj 1UUEA 1XNIA 3J80E 4FW1A 4PJMA 5LJ3f 2HZYA 3I5SA 4LDYA 4E7IA 2EYXA 2DMOA 3VUBA 3SB2A 2NWMA 2O88A 4EMHA 2LVMA 3LGFA 2DERA 1GCQA 2EBPA 1Q81U 2QTXA 4MMLA 1M8VA 5HK3A 2HCKA 4RMOA 5GJVB 1MUZA 3CC2T 1M1KU 2QTVA 4QVCA 2KDSA 2HAXA 5DLOA 2DLPA 1QP2A 3VS5A 2IG0A 3NTIA 3C0CA 4JJDA 3QJ6A 4J8OA 2P4TA 3DLLA 4XAXB 3EG9A 1QW1A 5I2SA 1GBQA 3M0SA 1AZGB 2CUDA 1YJ9Q 1FMVA 1P92A 1UJ0A 5D6XA 1YJ9A 4TVRA 2RN8A 4OGCA 4J7IA 1MNEA 4IIOA 2EGAA 2HBWA 1I07A 3CCEQ 2GTOA 3CCEA 2EJFA 1BCMA 1X2QA 4MDWA 1MMAA 3NHNA 4E7HA 1WGSA 2LX7A 2VKNA 1VQ9T 2KSSA 1D3BA 1T0HA 3TVTA 1KSWA 3M53A 2E5KA 1UDLA 5GJWB 1H92A 1RAEB 2A28A 3OW2A 2V26A 4XK8E 2KAFA 1WQ7A 3PGGA 3CMAT 2G6FX 2KYMA 2R58A 3WVDB 2SRCA 3OYGA 1BIBA 4M75B 1JJ2S 4AMCA 5FWBA 4FYYB 1QCOA 3QWYA 2BZ8A 2CZ7B 2FB7A 5IT9E 4RUGA 3M0QA 1NYGA 5GAOr 2PVGB 3IQLA 2L3RA 5GANf 4BY6C 2DRMA 1E6HA 3REAB 2MPXC 1SF9A 2M51A 2X35A 2Z0WA 2D0NA 2QA4T 2KMTA 2AKKA 3A1PA 3OS5A 4RCCA 1Z9ZA 2LMJA 3G71T 4PFOA 2NLUA 4IKFA 1B7TA 3VS2A 3SWNC 4V2SA 2DAQA 2PNIA 4ZTFA 1OZ3A 3L2ZA 4M75D 3VS0A 2EYYA 2E4HA 2M02A 2LCSA 5KYWB 1AVZC 1EZZB 4Z88A 4JPBW 3M59A 3M9QA 2HNIA 1VYVA 2C0OA 2COZA 3I55Q 1UHCA 5GMKi 2K4YA 1K9MR 2RQRA 1NE8A 4GY5A 3QO3A 4ZGEB 1EFNA 3I55A 3EFRA 2CZ6B 2XICA 1KD1C 4OMFB 1N5ZA 1HYOA 4A4GA 1ZLMA 2YRCA 5HKCA 4MZPA 1E6GA 2CH4W 2P0PA 1KHCA 5DM7R 1VQ6A 3EFOA 1VQOT 1F1BB 1Y07A 3P8BB 1M1GA 1H8KA 2DEUA 2EGEA 1K0SA 2EYQA 4FW2A 2VV5A 2VB6A 4M7AB 3AT1B 4IUTA 4XQ3A 1BI0A 2ZZDA 2EQUA 5FU6C 1M90R 4IUVA 3M54A 3PE0A 3RNJA 3J7AF 2A0FB 4Z8AA 2K57A 1TS9A 3C12A 2O4XB 4C92G 4A4KA 1UHFA 3EG0A 2BTTA 3H0FA 4M7DG 5GAN4 4F7UB 1NLOC 1MNDA 2J6KA 3DB4A 1M9SA 3M55A 4C8QC 4E47A 2W0ZA 2EQMA 1RAGB 5LJ3h 4HCZA 3E2UA 4M7AD 3RKYA 4JRIA 4KULA 1PSEA 1KFZA 1QCNA 2PTKA 3A5ZB 1BK2A 5CR2A 1KK7A 3MEWA 1Y71A 3X25B 2EQIA 4PK4A 3PVQA 3CC2Q 4DBQA 1TWBA 2KQWA 3CC2A 2JJ9A 3H9NA 5D7UA 2Y4YA 4M77G 4AG2C 5LJ5g 1NBEB 2DXTA 2X4JA 4FSSA 1VQNT 3CXCS 3TQ7P 1WXBA 3CCMT 4FT2A 1UE9A 3OYKA 1PKSA 2EJGA 2EKHA 1ZSZC 4M78C 3M57A 1PRMC 4E7JA 3S3OA 2KGTA 1B34B 2JNGA 4MDXA 4KBMB 2EJ9A 4E7KA 1TXQA 2WACA 3VS1A 1RAAB 1BBZA 3BDLA 2K3BA 3MCAB 4C0FA 1UEBA 3CXCP 1I4K1 3A8OB 3I35A 3MP6A 5LJ3j 2MWOA 2DYBA 5HK0A 2LJ0A 2FL7A 3OYJA 1UB4A 2RM4A 4M75E 2CKKA 3TSZA 3OYIA 4DOWA 4ZTJA 3CMAQ 4NS5A 1R8OB 2PQWA 2LDMA 1Q86U 5IHKA 2LQ8A 3CMAA 1RABB 4Z89A 1G3WA 1U06A 1V76A 1OPLA 3M0TA 1VQPT 2A7YA 1K73R 4IIMA 4KT0E 3CCST 2HBPA 2KE9A 1B3QA 1UTIA 2EIFA 2XDBA 4M4ZA 2HL5C 4OF1A 3CPFA 3VS6A 1UECA 2ZPBB 2Y4XA 2EYWA 3L2RA 1JJ2A 4KH1B 5KYUB 5CKBA 2QA4Q 4KGXB 3G71Q 4JZ4A 3CCJQ 2QA4A 2IVWA 3G71A 1NPRA 4R0KA 1D1BA 1MV3A 1G3YA 3CCJA 2QGGA 2RO0A 5GAN8 1E7OA 2YUPA 2LX9A 4AG1C 2QI2A 3QG1A 1NLPC 2DETA 2F5KA 4XU1A 1SRLA 2VYTA 4M75A 1RUWA 2RJDA 2GNCA 5CAIA 3BW1A 3ER0A 4DBRA 1I1JA 1VQKQ 2EW3A 2YHTA 1YCSB 1N8RC 2O31A 2L0AA 1VQKA 3GF5A 3A98A 4DBHA 1X6BA 2BZXA 2ZPGB 3HL8A 4A4EA 3G4ST 1YFNA 1YN8A 2XHCA 2Y90A 5J26A 5GANj 3ME9A 4CC2A 1VQOQ 4M7AE 3EFSA 1VQOA 1ZUUA 2GQVA 3OBYA 4L59A 3PFSA 1W4SA 4A54A 4R56A 2VWFA 4R55A 4JRPA 3CBMA 2FZCB 3EGDB 5KYWA 3CCQT 1AWOA 1D1AA 3RDVA 2J06A 1DJ7B 3OW2P 5IAYA 1I0CA 1MMDA 4QQGA 3CCLT 2LTOA 1WLPB 2E10A 2JTMA 4A53A 2YWWA 4M75G 2HKNA 4L6V5 4F16A 3Q1JA 4OMMA 3A8HB 3UDCA 1QWEA 3ULRB 2O9SA 2K79A 1YJWT 1TUGB 4LD6A 3QYGB 2X3XD 3M58A 3GIBA 1MHNA 3DB3A 1C1AA 3OYNA 1XJWB 5KE3A 4PNOA 4X9DA 1K8AR 4FIBA 2R57A 3LYIA 2LQNA 2CP3A 1B07A 1KQ2A 3JCMb 3JCMc 3SDZA 2COYA 2ROLA 3LH0A 1GCQC 3OY9A 2FYKA 3HKSA 4ZGJB 3JCMQ 4J6WA 5CKDA 4M7AA 2XDDA 1WFWA 1M1FA 3QZ5B 4C92D 1ZBXA 4ORZA 5CQXA 1WX6A 4OB1B 3UT1A 2L3QA 3ZL7C 4RG8A 1VQNQ 1WDXA 3F70A 1ZSGA 1VQ5Q 1VQNA 4J6XA 3CCMQ 2EFIA 1W70A 1VQ5A 5GAMh 4JJNK 3CCMA 3NMZC 3ASKA 1JQQA 2FRWA 2PVOB 4GLMA 3JB9J 2L2PA 3KBGA 4FYVB 1Q82C 1QVFP 4XU3A 4PJOG 2QAZA 4HVVA 4EMKB 3EAEA 3LX7A 4M77D 1OULA 4ZN1A 2ZPFB 5CQYA 4RKUE 3MPUB 2BIVA 3E9FA 3NFCA 4DOVA 4KUIA 3PT9A 2K2MA 4WF2A 4JS5A 4M7AG 1WNLA 2RH2A 5DY9A 4NOYA 4LUDA 4OMOA 1HJDA 4HT9A 2BKDN 4PKCC 1VQPQ 4PLLA 3MP8A 1K9AA 1WHMA 2LNVA 4RTWA 3CCSQ 1VQPA 1UFFA 2MF2A 2YUNA 2RQVA 1YITT 4C0DC 3CCSA 4J6YA 4C92F 2KVQG 1X2KA 4M7DF 4F7UG 1B34A 3CC4Q 4JJCA 2DVEA 3JB9F 2DZCA 3CC4A 1D0XA 4PLIA 4J83A 4PJLA 4MMKA 2DJZA 3V8JA 5KCHA 3ZBDA 3PNWC 1NJIC 3EG3A 1GRIA 1VYUA 3X20B 2RK1A 2HEQA 2A37A 3E19A 2CP2A 3FJ5A 2E3HA 2DL5A 1YIJT 5GAOl 4JDSA 1I5OB 5GMKm 3A8MB 1UG1A 2HDAA 3LWHA 4X1VA 4QQ6A 4Q5WA 1Q82R 2VASA 2FVUA 2EPDA 3HTRA 1M5Q1 1X43A 1QWFA 2K5FA 3VYGA 5KYXB 4M77F 3MO8A 2CSQA 1Y96B 2W10A 2AT1B 2PZ1A 1SSFA 3A8LB 3EH1A 4OMQA 4DEXA 2FZKB 1VQ4T 4P5NA 1LPLA 3QPHA 2XK0A 2KR3A 1ABOA 3A8GB 3G7ZA 1TUDA 1RACB 4AFZC 2HQEA 2J6OA 4Y92A 2EWNA 1JRIA 3FEOA 2QEXT 2NUPB 5FU7C 5GMKe 2CT3A 1BU1A 4FT4A 1BKBA 1G3SA 2AZVA 1K9MC 1VQLQ 4BE1A 5I22A 3CCQQ 3AHUA 4FU6A 4C92E 2JM8A 4J9DA 3PMIA 1VQLA 3CCQA 4M7DE 1NJIR 4C8QB 3MJXA 1R0CB 3PTAA 2RI2A 5LJ5f 4J7FA 1WYXA 3CD6T 1YNZA 4X9CA 1M3BA 4MZTA 2HD0A 4HVUA 2DILA 4J9CA 1VYTA 1YJWQ 3SEMA 2V1RA 2H8HA 3I9QA 4BI4A 3QJYA 2MWPA 1YJWA 5FLXE 2OAWA 5GAMe 1G5VA 1IGUA 2MI6A 2QQAA 2OAUA 3FJPA 2LC4A 2BUDA 1ZA2B 2MAMA 1U1TA 3JCMh 4QW2A 2GCXA 5HCKA 4OP0A 1M90C 2RHUA 2NYSA 4OGEA 2A36A 2KNBB 4ATOA 1JJ2P 3OYYA 3QSUA 3HFNA 1LVKA 4M77E 4C8QD 4EDUA 2J7IA 1YWOA 2BZYA 4E6RA 1NEGA 1ZSZB 4M78B 2E6ZA 4E7SA 1V29B 3CCVQ 1KD1U 1ZQ1A 4BACA 1IRXA 1ZHIA 2DPPB 2K6DA 3CCVA 2JT4A 3QUIA 4C92A 3TSWA 3RMQA 4XU0A 1EIFA 4M7DA 1A0NB 9ATCB 1VIFA 2WSFE 2YRDA 2KRNA 2JW4A 3JRZA 3RKWA 2DIGA 4PJOB 2XDPA 1RAFB 3T9NA 4N4GA 4HXJA 4RTVA 4UC4A 2YLBA 1OX9A 1M30A 5I11A 2F5TX 4M78D 2ATCB 3EG2A 4K11A 1S72T 4ZN3A 2RQTA 3I5RA 3O8VA 3X24B 1M2VB 2B86A 3WXMB 1PD0A 1MGQA 3CCUT 1GCPA 2KY9A 5CKEA 1QKWA 4M77A 4N0AA 1FYNA 1AOJA 2XIDA 1YWPA 5LJ3g 4OB0B 2M9UA 4PJOD 3JCMW 1UJYA 4RTTA 3TU4K 1ZBJA 2K2VA 3RUXA 1GXIE 1H3HA 4GLKA 2PU9B 4M75F 2GBQA 4PL6A 2DM1A 2GQIA 4J9HA 1IZ6A 2M1HA 4LDVA 3UATA 5GAN7 4EMKA 1WI7A 2R5AA 2PVDB 3OYHA 4D6WA 2K7AA 4ZGDB 2D6FA 1UGSB 2DE0X 2DEQA 2LT1A 5GAOm 5CO7A 1K73C 3H0IA 2OTJT 2KRMA 4DEYA 3DLMA 2NUTB 2XKOC 2CYZB 4KGZB 3G6ET 4M75C 1VQ8T 2QQBA 2XG8D 3JCMP 1AWWA 2AK5A 2RHZA 3JCMJ 1KG1A 4N4HA 3HRUA 2F69A 3P8DA 2RB6A 2GTJA 1VQ4Q 3VU3C 4IUPA 2GFUA 4X34A 2E5QA 1VQ4A 1M8MA 3J81E 4AFSC 5IHNA 1IGQA 5CKFA 1LJOA 2XU8A 2VGMA 4ESRA 3VRZA 3JCMe 1NZ9A 2RMOA 2QQRA 1VQ9Q 3DKMA 1PD1A 2ROTA 2IPOB 3OSVA 1VQ9A 1MMGA 2FEIA 5GAN3 4D8DA 3TREA 1GBRA 2FRYA 3KFVA 2JMAA 2MK5A 4XTXA 2KRSA 4JUVA 4D8KA 3NTKA 4MZMA 3CD6Q 4M7AF 1V1CA 1WXTA 1OPKA 4A4FA 3CD6A 3L42A 1Y96A 1BI2A 2NUZA 5GANh 2D0QB 1VQ7T 1Q95G 4ZNXA 1T3SA 1X69A 1T0JA 5FW9A 1OQKA 5IXBA 4OB2B 2KBTA 2RPNA 4OMNA 2VGNA 4F7UF 3CCRT 4F17A 2IIMA 3M0UA 5A2QE 3EG9B 1X6OA 4M7AC 2KXCA 1D09B 4XTZA 2NUPA 1I8FA 3H6ZA 3M0PA 3HRTA 3EGUA 3H0HA 4LDXA 5EG2A 1GFDA 1IHWA 5GMKl 2DL4A 1PNJA 5IHIA 4HKEA 2RHYA 2DL8A 1N8RU 4CC7A 2BE7D 4F14A 2EYZA 2EAYA 1K8AC 4C5EA 5M9OA 1OU8A 4B6MA 2FG0A 2COWA 4J9FA 4C0ZA 2EVRA 4YTLA 4PJOE 5LJ5j 3R6NA 1TTHB 2CP7A 4HA8A 1SSHA 3QBYA 2X4WA 3VKIA 2O01E 2A08A 5C6SA 1O9SA 1JB0E 2FZGB 5LJ3d 1S1NA 2MOXA 3META 4J9EA 1H641 2I0NA 2OTLT 1TSFA 4LUEA 3CBPA 4DA4A 2GGRA 3C95A 1TU0B 1TOVA 3QZ9B 5LJ3e 4WCIA 1VQMT 1KJWA 3RBBB 1W1FA 3UF4A 2DIQA 4B9WA 1NG2A 3PIOA 1ZA1B 2EQKA 5ECAA 3U23A 3R6OA 2D8JA 1OOTA 1U5SA 4CRIA 2RA2A 1W2BA 2CP5A 5KYYB 2XI9A 3BFMA 4KRTA 4C8QG 3D7SB 2EQJA 3OS0A 4F7UE 2RJFA 2CSIA 5J3BA 3RERA 2HSEB 3FRNA 4L5GA 3NGPA 1SEMA 1Q86R 2E12A 1TH7A 1X75C 2P0QA 2F2XA 5LL6S 3JV3A 3VS4A 1BI1A 1IXDA 1Q7YC 3OYDA 4J9GA 2KXDA 3L2WA 4PJOA 1VOMA 2QDYB 4VUBA 4RCBA 3GBQA 1GL5A 1H3ZA 5A0DA 1YP5A 3GLXA 3CPWA 2DK3A 3JCMX 4II1A 1Y57A 1IO6A 1WZOA 4FSXA 4QKUA 4FCYA 1KQSA 2JS2A 3OMCA 4O5VA 5KH6A 5GAMg 4XTUA 2M16A 3LH5A 3NPFA 1KC8C 2KI7A 4RTXA 3G6EQ 2LT4A 3G6EA 1PHTA 2DX1A 1K1ZA 4M78G 2KYBA 3EFOB 4BE0A 3CEYA 1Q82U 1YCYA 2YRVA 1AT1B 1N9RA 1Y7XA 2O4XA 5AYFA 1WA7A 4FYWB 1AWJA 5FU7B 4F7UA 1WJRA 2VUBA 4OMPA 2YDLA 3JB9I 1LOJA 5GANe 2LQWA 3EHRA 2HQHA 2L89A 3OYAA 2E6NA 3M4GA 2JZ2A 2GFAA 3LW5E 1WHLA 1Q7YR 2QGFB 3L2UA 3SD4A 2F1LA 4N4IA 2NUTA 2A3LA 2DL7A 2E70A 3C4SA 1N9SA 1QP3A 1AHJB 4ANJA 1VQ6T 4BY6B 2K3YA 3M56A 4J9IA 3VS3A 5FROA 4AFUC 1JBMA 2V1QA 2JOYA 3V7SA 1AWXA 2DA9A 2VXEA 3RMSA 2DD5A 5IN1A 1HD3A 1RAHB 2RK2A 1NJIU 5FRNA 1KC8R 2LNHB 1PSFA 2LCCA 3BY7A 1WPYA 1K4US 3SWNB 3EGXB 1X6GA 3L2VA 1RI9A 2PUOB 3V7CA 3MHXA 2X4YA 2QXFA 1Z9QA 1PG5B 2D9TA 2DXUA 5I2MA 4A63B 2LJ1A 1CKBA 4JRKA 2ZCFB 4J9BA 1WHJA 2AKLA 2FPEA 1OU9A 3M0RA 2LZ6B 5GAOp 3ZEHA 1R77A 4J5YA 1MV0B 1D0YA 3CQTA 4HCKA 3UA6A 4C92C 4OMLA 3MKDA 2D1XA 1PC0A 1QLYA 2X9HA 4IUQA 4M7DC 2ED1A 2KROA 1QVGA 4JRQA 3O5ZA 2L3SA 3MEAA 3HP9A 1VIEA 1SPKA 4XTVA 1FXXA 2OTLQ 3G4SQ 4HCCA 3L1AA 3THKA 4ME7A 1K9MU 2OTLA 3G4SA 5IH2A 5FU6B 1G2BA 5KYUA 1Q81C 1J3TA 1VQMQ 1M3AA 2QQ9A 1VQMA 1C6VX 4FL6A 3VJPA 1M1KC 1SG5A 2LQKA 2RHXA 4M77C 4N0AC 2QK0A 1YJNT 2ZGWA 4KUDK 3OYLA 3JCMg 3CCLQ 2JTFA 1AZEA 5GAMd 3CCLA 2LP5A 3EH2A 1K0XA 1M90U 1RAIB 3PIPA 2YT6A 2QYZA 1PM3A 5A0GA 1LCKA 1ABQA 1YHQT 4JS4A 1RADB 2QG9B 4RG2A 1OI1A 1HK9A 3S3NA 3S3MA 4EMKC 3QHSA 4LXCA 1EX4A 2J05A 3BDUA 3QYHB 4C5GA 2E41A 1QKXA 1JXOA 1CKAA 3JSCA 4BB7A 3QIIA 2DZ9A 2D8HA 2JM9A 3VRYA 3OA6A 2FPDA 2YUOA 3MEVA 4XU2A 1OEBA 4GBQA 3I56T 1FMKA 3EGDA 2XD0A 3JCMV 4CC4B 5KYYA 1Q81R 3VYHB 4JLGA 4LDUA 4EPCA 2MYSA 2DL3A 1WHGA 4OVAA 3CCJT 1VA7A 2BE9B 1M1KR 1ARKA 2KEAA 1I81A 2F2VA 3G1JA 2J6FA 2X4XA 3JB9H 5KE2A 3OYMA 2JUFA 4Z02A 4KH0B 2GF7A 2P0KA 2DKGA 1OV3A 2K3XA 2KT1A 1ZUKA 2PUKB 1FMWA 4PJNA 2QDLA 5L23A 3N5BB 3CBOA 5CCAA 1W2BS 3CMET 1VQKT 3OS2A 1ZX6A 1HXDA 1QVFA
chains in the Genus database with same CATH topology
1B07A 2KT8A 2ROLA 2DLPA 2M0YA 2NUZA 3VS5A 1GCQC 3C0CA 4JJDA 4CC3A 3EHQA 4ZNXA 1T3SA 1X69A 1T0JA 1GBQA 1WFWA 3M0SA 5FW9A 1AZGB 2CUDA 5IXBA 2KBTA 2RPNA 1JU5C 1UJ0A 4ORZA 4OMNA 4F17A 2IIMA 3M0UA 2RN8A 1WX6A 1Y0MA 2KXCA 4IIOA 2L3QA 3ZL7C 2EGAA 1K76A 2HBWA 3UA7A 1I07A 1WDXA 2GTOA 3M0PA 2RQWA 1ZSGA 3EGUA 3H0HA 1X2QA 3NHNA 1GFDA 1W70A 2DL4A 1PNJA 2LX7A 5IHIA 2VKNA 2DL8A 3REBB 4CC7A 1T0HA 3TVTA 1KSWA 3NMZC 4F14A 2RNAA 2DBMA 1JQQA 2E5KA 2EYZA 2FRWA 1UDLA 4GLMA 5GJWB 1H92A 2YSQA 2L2PA 2A28A 2FG0A 2RF0A 4J9FA 4HVVA 2EVRA 2JTEA 2G6FX 2KYMA 3R6NA 1SSHA 2CUBA 2SRCA 2A08A 2JMCA 1S1NA 2MOXA 4J9EA 1GFCA 5FWBA 1NEBA 2I0NA 4LUEA 3QWYA 2BZ8A 2GGRA 2K2MA 4RUGA 2VVKA 3M0QA 1NYGA 3IQLA 1TG0A 4WCIA 2DRMA 1E6HA 4LUDA 4OMOA 1HJDA 3REAB 2C0TA 1PKTA 2SEMA 1KJWA 3RBBB 1W1FA 3UF4A 1RLQC 1K9AA 2M51A 2C0IA 3QWXX 4RTWA 1NG2A 1UFFA 2YUNA 2RQVA 2D0NA 2AKKA 1Z9ZA 2LMJA 5ECAA 3U23A 2D8JA 1OOTA 1U5SA 1X2KA 3VS2A 1NM7A 2PNIA 4JJCA 3VS0A 2EYYA 4KRTA 2LCSA 2CSIA 5IXFA 1AVZC 2MIOA 2CT4A 3NGPA 1SEMA 3EG3A 4Z88A 1GRIA 1VYUA 4JPBW 2F2XA 3JV3A 3VS4A 2HEQA 1VYVA 4J9GA 2A37A 3FJ5A 2KXDA 2DL5A 2ED0A 2C0OA 1UHCA 1UG1A 2RQRA 2HDAA 4X1VA 1EFNA 3GBQA 1GL5A 2EPDA 1X43A 1N5ZA 1YP5A 1QWFA 1ZLMA 1WIEA 1Y57A 1IO6A 1E6GA 2CH4W 2JS2A 1JXMA 2K9GA 2CSQA 3LH5A 2W10A 1SHGA 3NPFA 2PZ1A 4OMQA 4RTXA 4DEXA 1QCFA 2HSPA 5FWCA 1H8KA 1K0SA 2EGEA 1PHTA 2DX1A 1K1ZA 2LJ3A 2KYBA 2KR3A 1ABOA 1BB9A 1TUDA 1W6XA 4AFZC 2J6OA 4Y92A 1WA7A 1XOVA 3PE0A 3RNJA 1PWTA 2P4RA 1AWJA 4OMPA 4Z8AA 2YDLA 2CT3A 1BU1A 2LQWA 1UHFA 3EG0A 3EHRA 2AZVA 2BTTA 3H0FA 2L3PA 5I22A 1G83A 2JM8A 4J9DA 1OPKA 1NLOC 2J6KA 2JS0A 1UGVA 2W0ZA 1WYXA 2CREA 1YNZA 4JZ3A 1M3BA 4QT7A 4HVUA 2DILA 4J9CA 1VYTA 3SEMA 2V1RA 2H8HA 3I9QA 2DL7A 4HVWA 1KFZA 2OAWA 2PTKA 1BK2A 4J9IA 3VS3A 3SHWA 4AFUC 2EQIA 2V1QA 3PVQA 2DVJA 1AWXA 2DA9A 5HCKA 1HD3A 1X27A 2MCNA 2A36A 2KNBB 2LNHB 4AG2C 2F2WA 1K4US 4FSSA 2J7IA 1YWOA 1WXBA 1X6GA 1RI9A 2BZYA 2O9VA 1UE9A 4E6RA 1PKSA 1NEGA 2EKHA 1AEYA 1RLPC 1PRMC 1Z9QA 2K6DA 2KGTA 2JT4A 4LE9A 4A63B 2LJ1A 2XMFA 1CKBA 1JEGA 1M27C 1NYFA 3TSWA 4J9BA 2AKLA 3VS1A 2ABLA 2FPEA 3M0RA 2EGCA 3PVLA 1A0NB 1BBZA 2LZ6B 2K3BA 3EG1A 1MV0B 2KRNA 3CQTA 4HCKA 2JW4A 3UA6A 4OMLA 2D1XA 3I35A 2CH4A 1QLYA 2DYBA 2LJ0A 2ED1A 4EIKA 2KROA 4HXJA 1KIKA 3O5ZA 4RTVA 5EC7A 2ENMA 2L3SA 2OJ2A 3TSZA 1M30A 1SRMA 2DJQA 5I11A 5IHKA 1PRLC 4Z89A 1SPKA 3EG2A 2FPFA 4K11A 1U06A 2RQTA 1OPLA 3I5RA 3M0TA 4RTZA 2B86A 4IIMA 3THKA 4AFQC 2KE9A 1B3QA 1UTIA 5IH2A 1GCPA 1HSQA 2DBKA 1QKWA 1G2BA 1FYNA 1AOJA 1U3OA 1T3LA 2DNUA 1J3TA 4M4ZA 1YWPA 1M3AA 3VS6A 1UECA 1ZUYA 2EYWA 1UJYA 4RTTA 1ZBJA 4JZ4A 1H3HA 4JJBA 4RTUA 2GBQA 4R0KA 1MV3A 4RTYA 1SHFA 2DM1A 2GQIA 3VS7A 4J9HA 1AZEA 2X3WD 1E7OA 2YUPA 4AG1C 2LP5A 1TUCA 3UATA 1WI7A 1K0XA 1NLPC 1WXUA 2YT6A 4LN2A 1SRLA 2K7AA 2LQNA 1LCKA 1ABQA 1RUWA 2DRKA 2GNCA 2AZSA 2DE0X 1I1JA 2J05A 3H0IA 2KRMA 2EW3A 4DEYA 2RQUA 1YCSB 2O31A 2L0AA 1JO8A 2FO0A 1AD5A 3A98A 1QKXA 1AWWA 2AK5A 1X6BA 3H41A 2BZXA 2O2OA 1JXOA 1CKAA 1YN8A 1M3CA 2D8HA 2DF6A 4CC2A 2JM9A 3VRYA 2GTJA 2FPDA 2YUOA 1OEBA 4GBQA 1FMKA 1ZUUA 1M8MA 4AFSC 5IHNA 4CC4B 1CSKA 2YUQA 2VWFA 2DL3A 2OI3A 1AWOA 1ARKA 1VA7A 3VRZA 4ESRA 2ECZA 2KEAA 2ESWA 2F2VA 2J6FA 2J06A 2RMOA 2JXBA 4LNPA 1I0CA 2ROTA 1WLPB 2CDTA 2FEIA 1UUEA 1OV3A 4D8DA 4F16A 2KT1A 4OMMA 1ZUKA 3I5SA 1GBRA 1QWEA 2FRYA 3ULRB 2O9SA 2QDLA 2JMAA 3KFVA 2EYXA 2K79A 2DMOA 2KRSA 5L23A 2NWMA 2O88A 2X3XD 1GCQA 4D8KA 2EBPA 2HCKA 1V1CA 1WXTA 1ZX6A 5GJVB 1MUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B07 A;  2KT8 A;  2ROL A;  2DLP A;  2M0Y A;  2NUZ A;  3VS5 A;  1GCQ C;  3C0C A;  4JJD A;  4CC3 A;  3EHQ A;  4ZNX A;  1T3S A;  1X69 A;  1T0J A;  1GBQ A;  1WFW A;  3M0S A;  5FW9 A;  1AZG B;  2CUD A;  5IXB A;  2KBT A;  2RPN A;  1JU5 C;  1UJ0 A;  4ORZ A;  4OMN A;  4F17 A;  2IIM A;  3M0U A;  2RN8 A;  1WX6 A;  1Y0M A;  2KXC A;  4IIO A;  2L3Q A;  3ZL7 C;  2EGA A;  1K76 A;  2HBW A;  3UA7 A;  1I07 A;  1WDX A;  2GTO A;  3M0P A;  2RQW A;  1ZSG A;  3EGU A;  3H0H A;  1X2Q A;  3NHN A;  1GFD A;  1W70 A;  2DL4 A;  1PNJ A;  2LX7 A;  5IHI A;  2VKN A;  2DL8 A;  3REB B;  4CC7 A;  1T0H A;  3TVT A;  1KSW A;  3NMZ C;  4F14 A;  2RNA A;  2DBM A;  1JQQ A;  2E5K A;  2EYZ A;  2FRW A;  1UDL A;  4GLM A;  5GJW B;  1H92 A;  2YSQ A;  2L2P A;  2A28 A;  2FG0 A;  2RF0 A;  4J9F A;  4HVV A;  2EVR A;  2JTE A;  2G6F X;  2KYM A;  3R6N A;  1SSH A;  2CUB A;  2SRC A;  2A08 A;  2JMC A;  1S1N A;  2MOX A;  4J9E A;  1GFC A;  5FWB A;  1NEB A;  2I0N A;  4LUE A;  3QWY A;  2BZ8 A;  2GGR A;  2K2M A;  4RUG A;  2VVK A;  3M0Q A;  1NYG A;  3IQL A;  1TG0 A;  4WCI A;  2DRM A;  1E6H A;  4LUD A;  4OMO A;  1HJD A;  3REA B;  2C0T A;  1PKT A;  2SEM A;  1KJW A;  3RBB B;  1W1F A;  3UF4 A;  1RLQ C;  1K9A A;  2M51 A;  2C0I A;  3QWX X;  4RTW A;  1NG2 A;  1UFF A;  2YUN A;  2RQV A;  2D0N A;  2AKK A;  1Z9Z A;  2LMJ A;  5ECA A;  3U23 A;  2D8J A;  1OOT A;  1U5S A;  1X2K A;  3VS2 A;  1NM7 A;  2PNI A;  4JJC A;  3VS0 A;  2EYY A;  4KRT A;  2LCS A;  2CSI A;  5IXF A;  1AVZ C;  2MIO A;  2CT4 A;  3NGP A;  1SEM A;  3EG3 A;  4Z88 A;  1GRI A;  1VYU A;  4JPB W;  2F2X A;  3JV3 A;  3VS4 A;  2HEQ A;  1VYV A;  4J9G A;  2A37 A;  3FJ5 A;  2KXD A;  2DL5 A;  2ED0 A;  2C0O A;  1UHC A;  1UG1 A;  2RQR A;  2HDA A;  4X1V A;  1EFN A;  3GBQ A;  1GL5 A;  2EPD A;  1X43 A;  1N5Z A;  1YP5 A;  1QWF A;  1ZLM A;  1WIE A;  1Y57 A;  1IO6 A;  1E6G A;  2CH4 W;  2JS2 A;  1JXM A;  2K9G A;  2CSQ A;  3LH5 A;  2W10 A;  1SHG A;  3NPF A;  2PZ1 A;  4OMQ A;  4RTX A;  4DEX A;  1QCF A;  2HSP A;  5FWC A;  1H8K A;  1K0S A;  2EGE A;  1PHT A;  2DX1 A;  1K1Z A;  2LJ3 A;  2KYB A;  2KR3 A;  1ABO A;  1BB9 A;  1TUD A;  1W6X A;  4AFZ C;  2J6O A;  4Y92 A;  1WA7 A;  1XOV A;  3PE0 A;  3RNJ A;  1PWT A;  2P4R A;  1AWJ A;  4OMP A;  4Z8A A;  2YDL A;  2CT3 A;  1BU1 A;  2LQW A;  1UHF A;  3EG0 A;  3EHR A;  2AZV A;  2BTT A;  3H0F A;  2L3P A;  5I22 A;  1G83 A;  2JM8 A;  4J9D A;  1OPK A;  1NLO C;  2J6K A;  2JS0 A;  1UGV A;  2W0Z A;  1WYX A;  2CRE A;  1YNZ A;  4JZ3 A;  1M3B A;  4QT7 A;  4HVU A;  2DIL A;  4J9C A;  1VYT A;  3SEM A;  2V1R A;  2H8H A;  3I9Q A;  2DL7 A;  4HVW A;  1KFZ A;  2OAW A;  2PTK A;  1BK2 A;  4J9I A;  3VS3 A;  3SHW A;  4AFU C;  2EQI A;  2V1Q A;  3PVQ A;  2DVJ A;  1AWX A;  2DA9 A;  5HCK A;  1HD3 A;  1X27 A;  2MCN A;  2A36 A;  2KNB B;  2LNH B;  4AG2 C;  2F2W A;  1K4U S;  4FSS A;  2J7I A;  1YWO A;  1WXB A;  1X6G A;  1RI9 A;  2BZY A;  2O9V A;  1UE9 A;  4E6R A;  1PKS A;  1NEG A;  2EKH A;  1AEY A;  1RLP C;  1PRM C;  1Z9Q A;  2K6D A;  2KGT A;  2JT4 A;  4LE9 A;  4A63 B;  2LJ1 A;  2XMF A;  1CKB A;  1JEG A;  1M27 C;  1NYF A;  3TSW A;  4J9B A;  2AKL A;  3VS1 A;  2ABL A;  2FPE A;  3M0R A;  2EGC A;  3PVL A;  1A0N B;  1BBZ A;  2LZ6 B;  2K3B A;  3EG1 A;  1MV0 B;  2KRN A;  3CQT A;  4HCK A;  2JW4 A;  3UA6 A;  4OML A;  2D1X A;  3I35 A;  2CH4 A;  1QLY A;  2DYB A;  2LJ0 A;  2ED1 A;  4EIK A;  2KRO A;  4HXJ A;  1KIK A;  3O5Z A;  4RTV A;  5EC7 A;  2ENM A;  2L3S A;  2OJ2 A;  3TSZ A;  1M30 A;  1SRM A;  2DJQ A;  5I11 A;  5IHK A;  1PRL C;  4Z89 A;  1SPK A;  3EG2 A;  2FPF A;  4K11 A;  1U06 A;  2RQT A;  1OPL A;  3I5R A;  3M0T A;  4RTZ A;  2B86 A;  4IIM A;  3THK A;  4AFQ C;  2KE9 A;  1B3Q A;  1UTI A;  5IH2 A;  1GCP A;  1HSQ A;  2DBK A;  1QKW A;  1G2B A;  1FYN A;  1AOJ A;  1U3O A;  1T3L A;  2DNU A;  1J3T A;  4M4Z A;  1YWP A;  1M3A A;  3VS6 A;  1UEC A;  1ZUY A;  2EYW A;  1UJY A;  4RTT A;  1ZBJ A;  4JZ4 A;  1H3H A;  4JJB A;  4RTU A;  2GBQ A;  4R0K A;  1MV3 A;  4RTY A;  1SHF A;  2DM1 A;  2GQI A;  3VS7 A;  4J9H A;  1AZE A;  2X3W D;  1E7O A;  2YUP A;  4AG1 C;  2LP5 A;  1TUC A;  3UAT A;  1WI7 A;  1K0X A;  1NLP C;  1WXU A;  2YT6 A;  4LN2 A;  1SRL A;  2K7A A;  2LQN A;  1LCK A;  1ABQ A;  1RUW A;  2DRK A;  2GNC A;  2AZS A;  2DE0 X;  1I1J A;  2J05 A;  3H0I A;  2KRM A;  2EW3 A;  4DEY A;  2RQU A;  1YCS B;  2O31 A;  2L0A A;  1JO8 A;  2FO0 A;  1AD5 A;  3A98 A;  1QKX A;  1AWW A;  2AK5 A;  1X6B A;  3H41 A;  2BZX A;  2O2O A;  1JXO A;  1CKA A;  1YN8 A;  1M3C A;  2D8H A;  2DF6 A;  4CC2 A;  2JM9 A;  3VRY A;  2GTJ A;  2FPD A;  2YUO A;  1OEB A;  4GBQ A;  1FMK A;  1ZUU A;  1M8M A;  4AFS C;  5IHN A;  4CC4 B;  1CSK A;  2YUQ A;  2VWF A;  2DL3 A;  2OI3 A;  1AWO A;  1ARK A;  1VA7 A;  3VRZ A;  4ESR A;  2ECZ A;  2KEA A;  2ESW A;  2F2V A;  2J6F A;  2J06 A;  2RMO A;  2JXB A;  4LNP A;  1I0C A;  2ROT A;  1WLP B;  2CDT A;  2FEI A;  1UUE A;  1OV3 A;  4D8D A;  4F16 A;  2KT1 A;  4OMM A;  1ZUK A;  3I5S A;  1GBR A;  1QWE A;  2FRY A;  3ULR B;  2O9S A;  2QDL A;  2JMA A;  3KFV A;  2EYX A;  2K79 A;  2DMO A;  2KRS A;  5L23 A;  2NWM A;  2O88 A;  2X3X D;  1GCQ A;  4D8K A;  2EBP A;  2HCK A;  1V1C A;  1WXT A;  1ZX6 A;  5GJV B;  1MUZ A; 
#chains in the Genus database with same CATH topology
 5HY6 A;  2KT8 A;  5J39 A;  2M0Y A;  4B9X A;  3GOX A;  1VQ6 Q;  3QDF A;  4CC3 A;  2DFU A;  3EHQ A;  2DO3 A;  4FYX B;  1C0M A;  1IHV A;  4PFZ A;  4NL2 A;  1M2O A;  2E3I A;  1FWZ A;  2C06 A;  4BDZ A;  2DTI A;  1JU5 C;  2L5Q A;  2V8J A;  3CPW S;  1W2B P;  3FLG A;  1YIT Q;  5GAO q;  1Y0M A;  3OYF A;  4FM4 B;  4C8Q F;  1BI3 A;  1KQS S;  1YIT A;  1K76 A;  3UA7 A;  1MMN A;  1U8R A;  3LLR A;  2RQW A;  5GAN 5;  4C0G A;  1UGP B;  2JVV A;  3HFO A;  3OS1 A;  1K73 U;  2KK4 A;  3CC7 T;  3REB B;  5CIU A;  4QVZ A;  3OQ5 A;  1UGR B;  2DBM A;  2RNA A;  1WJS A;  2WSC E;  2FHD A;  2YSQ A;  3X26 B;  1XTD A;  3CPW P;  3V7R A;  3JB9 G;  1YIJ Q;  2RF0 A;  4QQD A;  2JTE A;  1YIJ A;  4IUU A;  1D1C A;  1KQS P;  2CGH A;  3GNG A;  2CUB A;  3TEE A;  2JMC A;  1GFC A;  3SFM A;  2HKQ B;  1NEB A;  3MP1 A;  3OYB A;  2RI5 A;  1M4Z A;  2VVK A;  4M78 F;  1KD1 R;  2CZ0 B;  3FC3 A;  1TG0 A;  1BYM A;  2MMP A;  3URG A;  2V8I A;  2C0T A;  1PKT A;  2LRQ A;  2SEM A;  3JCM d;  3SWN A;  1RLQ C;  3EGX A;  2C0I A;  3QWX X;  4XTY A;  4LDW A;  4WTO B;  4HCB A;  1NM7 A;  2DYI A;  2E1H A;  3QKJ A;  1VQ5 T;  4PJO F;  2QEX Q;  3E9G A;  3JAM E;  2QEX A;  5IXF A;  2MIO A;  2CT4 A;  5GAM f;  4C8Q E;  1YJN Q;  5GAN g;  4Y28 E;  1YJN A;  5LJ5 h;  1VUB A;  1N6A A;  3V8L A;  2ED0 A;  2K5I A;  2DTH A;  2EKO A;  5CKH A;  5KYX A;  1QMC A;  1YBY A;  3M4Y A;  3WVE B;  1KQ1 A;  4PJO C;  1WIE A;  4F04 B;  1YHQ Q;  3VV0 A;  1YHQ A;  1JXM A;  2K9G A;  4BI3 A;  5FRM A;  1BIA A;  1U1S A;  1SHG A;  4AT1 B;  4IUR A;  4NL3 A;  4OB3 B;  3BE3 A;  5GAN 6;  4BE2 A;  1QCF A;  2HSP A;  5FWC A;  2HQX A;  1YI2 T;  1FX7 A;  2LJ3 A;  4EMG A;  3OYC A;  4XTW A;  1BB9 A;  3OBW A;  3GP8 A;  1QVG S;  1K8A U;  4M78 E;  3FDR A;  4ELZ C;  2QQS A;  6AT1 B;  1W6X A;  4PJJ A;  2JN0 A;  1G8X A;  2VXF A;  3I56 Q;  1Q86 C;  3C94 A;  1XOV A;  3M5A A;  1PWT A;  3RES A;  2V8K A;  3I56 A;  3NTH A;  2P4R A;  3CC4 T;  3HRS A;  4O6J A;  2L8D A;  4C8Q A;  2QAS A;  5I21 A;  2L3P A;  1G83 A;  1D3B B;  3INZ A;  4JLI A;  2JS0 A;  1QVG P;  3L2Q A;  1UGV A;  2OX7 A;  5GAN 2;  3LWI A;  3X28 B;  2CRE A;  4JZ3 A;  4QT7 A;  5KCO A;  3FB9 A;  3PMT A;  1NPP A;  5D6Y A;  4HVW A;  4BUG A;  1XQH A;  2CP0 A;  3OB9 A;  3CME Q;  2ZPH B;  1RI0 A;  2H3E B;  1S72 Q;  3CME A;  3SHW A;  5AT1 B;  2DVJ A;  1S72 A;  2YXY A;  8AT1 B;  4BDY A;  1YJ9 T;  3HHT B;  4HT8 A;  1X27 A;  1KHI A;  2MCN A;  8ATC B;  3CCU Q;  3HPW A;  4C0D B;  4ELY C;  2M0O A;  1OYX A;  2ZPI B;  1ZSZ A;  4M78 A;  5L8R E;  3OW2 S;  3CCU A;  2DD4 A;  1Q7Y U;  2F2W A;  2CS7 A;  4A4H A;  4C5H A;  1N27 A;  3CCE T;  3TCJ A;  4DQ2 A;  2O9V A;  2RJE A;  1AEY A;  1D0Z A;  1RLP C;  3E1S A;  4PFP A;  3ZFJ A;  1X01 A;  3GPL A;  4LE9 A;  2CP6 A;  2XMF A;  1JEG A;  1M27 C;  1NYF A;  1VQL T;  3OSS C;  2ABL A;  1IB8 A;  2EGC A;  3PVL A;  2CZ1 B;  3EG1 A;  1WQW A;  3CC7 Q;  1KC8 U;  1R0B G;  3CC7 A;  4C92 B;  3FIF A;  1WHK A;  1I5L A;  2CH4 A;  4M7D B;  3MEU A;  4EIK A;  2K5L A;  3GNF B;  1KIK A;  4QVD A;  3QDR B;  5EC7 A;  2ENM A;  2OJ2 A;  3QXE B;  5LJ5 d;  1M2V A;  2OTJ Q;  1SRM A;  2DJQ A;  1ACM B;  1PRL C;  4E2F B;  2OTJ A;  2FPF A;  1VQ8 Q;  3KXT A;  1LNX A;  2X51 A;  1VQ8 A;  1OX8 A;  2ZPE B;  2H3J A;  3JCM f;  4RTZ A;  1O75 A;  5LJ5 e;  5GMK h;  4AFQ C;  2P84 A;  3S6W A;  2DXC A;  4BI8 B;  5CVI A;  4C5I A;  4CI0 C;  1N8R R;  5GAN d;  1HSQ A;  2DBK A;  3P8H A;  1SKU B;  2DNU A;  1U3O A;  1T3L A;  4E7L A;  1WJQ A;  2AHJ B;  1ZUY A;  1QVF S;  4M7D D;  2ZAE A;  1UGQ B;  2LCL A;  4M77 B;  3UPU A;  1QQJ A;  3CCV T;  3JB9 D;  5CK9 A;  5A0L A;  1BCO A;  3VUZ A;  5D6W A;  4JJB A;  2DXB A;  4RTU A;  1PCX A;  3RR6 A;  3UWN A;  4RTY A;  1SHF A;  3VS7 A;  2E64 A;  4BD3 A;  5GAO n;  3I55 T;  2X3W D;  1TUC A;  2I2L A;  2R5M A;  3V8K A;  1OZ2 A;  1WXU A;  4LN2 A;  2E65 A;  2DRK A;  2AZS A;  4LD9 K;  3CXC A;  3H8Z A;  2B8A A;  2RQU A;  3OYE A;  2DTO A;  2RI3 A;  7AT1 B;  1JO8 A;  2VC8 A;  4Y91 A;  2FO0 A;  1AD5 A;  5DLQ E;  3KUF A;  3H41 A;  2O2O A;  2AIR B;  1VQ7 Q;  5GMK j;  2HL3 A;  2WSE E;  1M3C A;  2DF6 A;  2YLC A;  1VQ7 A;  3HSB A;  4DBF A;  1RL2 A;  2RJC A;  2HMA A;  4KGV B;  3RKX A;  1YI2 Q;  3CCR Q;  2RHI A;  5KYN A;  1YI2 A;  3CCR A;  2G3R A;  1WHH A;  1CSK A;  2YUQ A;  1IRE B;  3LGL A;  1G3T A;  2OI3 A;  3RIR A;  2ECZ A;  3OMG A;  2ESW A;  4LNP A;  2JXB A;  2RD1 A;  5C0M A;  4E7Z A;  1QVP A;  2CDT A;  5GAM j;  1UUE A;  1XNI A;  3J80 E;  4FW1 A;  4PJM A;  5LJ3 f;  2HZY A;  3I5S A;  4LDY A;  4E7I A;  2EYX A;  2DMO A;  3VUB A;  3SB2 A;  2NWM A;  2O88 A;  4EMH A;  2LVM A;  3LGF A;  2DER A;  1GCQ A;  2EBP A;  1Q81 U;  2QTX A;  4MML A;  1M8V A;  5HK3 A;  2HCK A;  4RMO A;  5GJV B;  1MUZ A;  3CC2 T;  1M1K U;  2QTV A;  4QVC A;  2KDS A;  2HAX A;  5DLO A;  2DLP A;  1QP2 A;  3VS5 A;  2IG0 A;  3NTI A;  3C0C A;  4JJD A;  3QJ6 A;  4J8O A;  2P4T A;  3DLL A;  4XAX B;  3EG9 A;  1QW1 A;  5I2S A;  1GBQ A;  3M0S A;  1AZG B;  2CUD A;  1YJ9 Q;  1FMV A;  1P92 A;  1UJ0 A;  5D6X A;  1YJ9 A;  4TVR A;  2RN8 A;  4OGC A;  4J7I A;  1MNE A;  4IIO A;  2EGA A;  2HBW A;  1I07 A;  3CCE Q;  2GTO A;  3CCE A;  2EJF A;  1BCM A;  1X2Q A;  4MDW A;  1MMA A;  3NHN A;  4E7H A;  1WGS A;  2LX7 A;  2VKN A;  1VQ9 T;  2KSS A;  1D3B A;  1T0H A;  3TVT A;  1KSW A;  3M53 A;  2E5K A;  1UDL A;  5GJW B;  1H92 A;  1RAE B;  2A28 A;  3OW2 A;  2V26 A;  4XK8 E;  2KAF A;  1WQ7 A;  3PGG A;  3CMA T;  2G6F X;  2KYM A;  2R58 A;  3WVD B;  2SRC A;  3OYG A;  1BIB A;  4M75 B;  1JJ2 S;  4AMC A;  5FWB A;  4FYY B;  1QCO A;  3QWY A;  2BZ8 A;  2CZ7 B;  2FB7 A;  5IT9 E;  4RUG A;  3M0Q A;  1NYG A;  5GAO r;  2PVG B;  3IQL A;  2L3R A;  5GAN f;  4BY6 C;  2DRM A;  1E6H A;  3REA B;  2MPX C;  1SF9 A;  2M51 A;  2X35 A;  2Z0W A;  2D0N A;  2QA4 T;  2KMT A;  2AKK A;  3A1P A;  3OS5 A;  4RCC A;  1Z9Z A;  2LMJ A;  3G71 T;  4PFO A;  2NLU A;  4IKF A;  1B7T A;  3VS2 A;  3SWN C;  4V2S A;  2DAQ A;  2PNI A;  4ZTF A;  1OZ3 A;  3L2Z A;  4M75 D;  3VS0 A;  2EYY A;  2E4H A;  2M02 A;  2LCS A;  5KYW B;  1AVZ C;  1EZZ B;  4Z88 A;  4JPB W;  3M59 A;  3M9Q A;  2HNI A;  1VYV A;  2C0O A;  2COZ A;  3I55 Q;  1UHC A;  5GMK i;  2K4Y A;  1K9M R;  2RQR A;  1NE8 A;  4GY5 A;  3QO3 A;  4ZGE B;  1EFN A;  3I55 A;  3EFR A;  2CZ6 B;  2XIC A;  1KD1 C;  4OMF B;  1N5Z A;  1HYO A;  4A4G A;  1ZLM A;  2YRC A;  5HKC A;  4MZP A;  1E6G A;  2CH4 W;  2P0P A;  1KHC A;  5DM7 R;  1VQ6 A;  3EFO A;  1VQO T;  1F1B B;  1Y07 A;  3P8B B;  1M1G A;  1H8K A;  2DEU A;  2EGE A;  1K0S A;  2EYQ A;  4FW2 A;  2VV5 A;  2VB6 A;  4M7A B;  3AT1 B;  4IUT A;  4XQ3 A;  1BI0 A;  2ZZD A;  2EQU A;  5FU6 C;  1M90 R;  4IUV A;  3M54 A;  3PE0 A;  3RNJ A;  3J7A F;  2A0F B;  4Z8A A;  2K57 A;  1TS9 A;  3C12 A;  2O4X B;  4C92 G;  4A4K A;  1UHF A;  3EG0 A;  2BTT A;  3H0F A;  4M7D G;  5GAN 4;  4F7U B;  1NLO C;  1MND A;  2J6K A;  3DB4 A;  1M9S A;  3M55 A;  4C8Q C;  4E47 A;  2W0Z A;  2EQM A;  1RAG B;  5LJ3 h;  4HCZ A;  3E2U A;  4M7A D;  3RKY A;  4JRI A;  4KUL A;  1PSE A;  1KFZ A;  1QCN A;  2PTK A;  3A5Z B;  1BK2 A;  5CR2 A;  1KK7 A;  3MEW A;  1Y71 A;  3X25 B;  2EQI A;  4PK4 A;  3PVQ A;  3CC2 Q;  4DBQ A;  1TWB A;  2KQW A;  3CC2 A;  2JJ9 A;  3H9N A;  5D7U A;  2Y4Y A;  4M77 G;  4AG2 C;  5LJ5 g;  1NBE B;  2DXT A;  2X4J A;  4FSS A;  1VQN T;  3CXC S;  3TQ7 P;  1WXB A;  3CCM T;  4FT2 A;  1UE9 A;  3OYK A;  1PKS A;  2EJG A;  2EKH A;  1ZSZ C;  4M78 C;  3M57 A;  1PRM C;  4E7J A;  3S3O A;  2KGT A;  1B34 B;  2JNG A;  4MDX A;  4KBM B;  2EJ9 A;  4E7K A;  1TXQ A;  2WAC A;  3VS1 A;  1RAA B;  1BBZ A;  3BDL A;  2K3B A;  3MCA B;  4C0F A;  1UEB A;  3CXC P;  1I4K 1;  3A8O B;  3I35 A;  3MP6 A;  5LJ3 j;  2MWO A;  2DYB A;  5HK0 A;  2LJ0 A;  2FL7 A;  3OYJ A;  1UB4 A;  2RM4 A;  4M75 E;  2CKK A;  3TSZ A;  3OYI A;  4DOW A;  4ZTJ A;  3CMA Q;  4NS5 A;  1R8O B;  2PQW A;  2LDM A;  1Q86 U;  5IHK A;  2LQ8 A;  3CMA A;  1RAB B;  4Z89 A;  1G3W A;  1U06 A;  1V76 A;  1OPL A;  3M0T A;  1VQP T;  2A7Y A;  1K73 R;  4IIM A;  4KT0 E;  3CCS T;  2HBP A;  2KE9 A;  1B3Q A;  1UTI A;  2EIF A;  2XDB A;  4M4Z A;  2HL5 C;  4OF1 A;  3CPF A;  3VS6 A;  1UEC A;  2ZPB B;  2Y4X A;  2EYW A;  3L2R A;  1JJ2 A;  4KH1 B;  5KYU B;  5CKB A;  2QA4 Q;  4KGX B;  3G71 Q;  4JZ4 A;  3CCJ Q;  2QA4 A;  2IVW A;  3G71 A;  1NPR A;  4R0K A;  1D1B A;  1MV3 A;  1G3Y A;  3CCJ A;  2QGG A;  2RO0 A;  5GAN 8;  1E7O A;  2YUP A;  2LX9 A;  4AG1 C;  2QI2 A;  3QG1 A;  1NLP C;  2DET A;  2F5K A;  4XU1 A;  1SRL A;  2VYT A;  4M75 A;  1RUW A;  2RJD A;  2GNC A;  5CAI A;  3BW1 A;  3ER0 A;  4DBR A;  1I1J A;  1VQK Q;  2EW3 A;  2YHT A;  1YCS B;  1N8R C;  2O31 A;  2L0A A;  1VQK A;  3GF5 A;  3A98 A;  4DBH A;  1X6B A;  2BZX A;  2ZPG B;  3HL8 A;  4A4E A;  3G4S T;  1YFN A;  1YN8 A;  2XHC A;  2Y90 A;  5J26 A;  5GAN j;  3ME9 A;  4CC2 A;  1VQO Q;  4M7A E;  3EFS A;  1VQO A;  1ZUU A;  2GQV A;  3OBY A;  4L59 A;  3PFS A;  1W4S A;  4A54 A;  4R56 A;  2VWF A;  4R55 A;  4JRP A;  3CBM A;  2FZC B;  3EGD B;  5KYW A;  3CCQ T;  1AWO A;  1D1A A;  3RDV A;  2J06 A;  1DJ7 B;  3OW2 P;  5IAY A;  1I0C A;  1MMD A;  4QQG A;  3CCL T;  2LTO A;  1WLP B;  2E10 A;  2JTM A;  4A53 A;  2YWW A;  4M75 G;  2HKN A;  4L6V 5;  4F16 A;  3Q1J A;  4OMM A;  3A8H B;  3UDC A;  1QWE A;  3ULR B;  2O9S A;  2K79 A;  1YJW T;  1TUG B;  4LD6 A;  3QYG B;  2X3X D;  3M58 A;  3GIB A;  1MHN A;  3DB3 A;  1C1A A;  3OYN A;  1XJW B;  5KE3 A;  4PNO A;  4X9D A;  1K8A R;  4FIB A;  2R57 A;  3LYI A;  2LQN A;  2CP3 A;  1B07 A;  1KQ2 A;  3JCM b;  3JCM c;  3SDZ A;  2COY A;  2ROL A;  3LH0 A;  1GCQ C;  3OY9 A;  2FYK A;  3HKS A;  4ZGJ B;  3JCM Q;  4J6W A;  5CKD A;  4M7A A;  2XDD A;  1WFW A;  1M1F A;  3QZ5 B;  4C92 D;  1ZBX A;  4ORZ A;  5CQX A;  1WX6 A;  4OB1 B;  3UT1 A;  2L3Q A;  3ZL7 C;  4RG8 A;  1VQN Q;  1WDX A;  3F70 A;  1ZSG A;  1VQ5 Q;  1VQN A;  4J6X A;  3CCM Q;  2EFI A;  1W70 A;  1VQ5 A;  5GAM h;  4JJN K;  3CCM A;  3NMZ C;  3ASK A;  1JQQ A;  2FRW A;  2PVO B;  4GLM A;  3JB9 J;  2L2P A;  3KBG A;  4FYV B;  1Q82 C;  1QVF P;  4XU3 A;  4PJO G;  2QAZ A;  4HVV A;  4EMK B;  3EAE A;  3LX7 A;  4M77 D;  1OUL A;  4ZN1 A;  2ZPF B;  5CQY A;  4RKU E;  3MPU B;  2BIV A;  3E9F A;  3NFC A;  4DOV A;  4KUI A;  3PT9 A;  2K2M A;  4WF2 A;  4JS5 A;  4M7A G;  1WNL A;  2RH2 A;  5DY9 A;  4NOY A;  4LUD A;  4OMO A;  1HJD A;  4HT9 A;  2BKD N;  4PKC C;  1VQP Q;  4PLL A;  3MP8 A;  1K9A A;  1WHM A;  2LNV A;  4RTW A;  3CCS Q;  1VQP A;  1UFF A;  2MF2 A;  2YUN A;  2RQV A;  1YIT T;  4C0D C;  3CCS A;  4J6Y A;  4C92 F;  2KVQ G;  1X2K A;  4M7D F;  4F7U G;  1B34 A;  3CC4 Q;  4JJC A;  2DVE A;  3JB9 F;  2DZC A;  3CC4 A;  1D0X A;  4PLI A;  4J83 A;  4PJL A;  4MMK A;  2DJZ A;  3V8J A;  5KCH A;  3ZBD A;  3PNW C;  1NJI C;  3EG3 A;  1GRI A;  1VYU A;  3X20 B;  2RK1 A;  2HEQ A;  2A37 A;  3E19 A;  2CP2 A;  3FJ5 A;  2E3H A;  2DL5 A;  1YIJ T;  5GAO l;  4JDS A;  1I5O B;  5GMK m;  3A8M B;  1UG1 A;  2HDA A;  3LWH A;  4X1V A;  4QQ6 A;  4Q5W A;  1Q82 R;  2VAS A;  2FVU A;  2EPD A;  3HTR A;  1M5Q 1;  1X43 A;  1QWF A;  2K5F A;  3VYG A;  5KYX B;  4M77 F;  3MO8 A;  2CSQ A;  1Y96 B;  2W10 A;  2AT1 B;  2PZ1 A;  1SSF A;  3A8L B;  3EH1 A;  4OMQ A;  4DEX A;  2FZK B;  1VQ4 T;  4P5N A;  1LPL A;  3QPH A;  2XK0 A;  2KR3 A;  1ABO A;  3A8G B;  3G7Z A;  1TUD A;  1RAC B;  4AFZ C;  2HQE A;  2J6O A;  4Y92 A;  2EWN A;  1JRI A;  3FEO A;  2QEX T;  2NUP B;  5FU7 C;  5GMK e;  2CT3 A;  1BU1 A;  4FT4 A;  1BKB A;  1G3S A;  2AZV A;  1K9M C;  1VQL Q;  4BE1 A;  5I22 A;  3CCQ Q;  3AHU A;  4FU6 A;  4C92 E;  2JM8 A;  4J9D A;  3PMI A;  1VQL A;  3CCQ A;  4M7D E;  1NJI R;  4C8Q B;  3MJX A;  1R0C B;  3PTA A;  2RI2 A;  5LJ5 f;  4J7F A;  1WYX A;  3CD6 T;  1YNZ A;  4X9C A;  1M3B A;  4MZT A;  2HD0 A;  4HVU A;  2DIL A;  4J9C A;  1VYT A;  1YJW Q;  3SEM A;  2V1R A;  2H8H A;  3I9Q A;  4BI4 A;  3QJY A;  2MWP A;  1YJW A;  5FLX E;  2OAW A;  5GAM e;  1G5V A;  1IGU A;  2MI6 A;  2QQA A;  2OAU A;  3FJP A;  2LC4 A;  2BUD A;  1ZA2 B;  2MAM A;  1U1T A;  3JCM h;  4QW2 A;  2GCX A;  5HCK A;  4OP0 A;  1M90 C;  2RHU A;  2NYS A;  4OGE A;  2A36 A;  2KNB B;  4ATO A;  1JJ2 P;  3OYY A;  3QSU A;  3HFN A;  1LVK A;  4M77 E;  4C8Q D;  4EDU A;  2J7I A;  1YWO A;  2BZY A;  4E6R A;  1NEG A;  1ZSZ B;  4M78 B;  2E6Z A;  4E7S A;  1V29 B;  3CCV Q;  1KD1 U;  1ZQ1 A;  4BAC A;  1IRX A;  1ZHI A;  2DPP B;  2K6D A;  3CCV A;  2JT4 A;  3QUI A;  4C92 A;  3TSW A;  3RMQ A;  4XU0 A;  1EIF A;  4M7D A;  1A0N B;  9ATC B;  1VIF A;  2WSF E;  2YRD A;  2KRN A;  2JW4 A;  3JRZ A;  3RKW A;  2DIG A;  4PJO B;  2XDP A;  1RAF B;  3T9N A;  4N4G A;  4HXJ A;  4RTV A;  4UC4 A;  2YLB A;  1OX9 A;  1M30 A;  5I11 A;  2F5T X;  4M78 D;  2ATC B;  3EG2 A;  4K11 A;  1S72 T;  4ZN3 A;  2RQT A;  3I5R A;  3O8V A;  3X24 B;  1M2V B;  2B86 A;  3WXM B;  1PD0 A;  1MGQ A;  3CCU T;  1GCP A;  2KY9 A;  5CKE A;  1QKW A;  4M77 A;  4N0A A;  1FYN A;  1AOJ A;  2XID A;  1YWP A;  5LJ3 g;  4OB0 B;  2M9U A;  4PJO D;  3JCM W;  1UJY A;  4RTT A;  3TU4 K;  1ZBJ A;  2K2V A;  3RUX A;  1GXI E;  1H3H A;  4GLK A;  2PU9 B;  4M75 F;  2GBQ A;  4PL6 A;  2DM1 A;  2GQI A;  4J9H A;  1IZ6 A;  2M1H A;  4LDV A;  3UAT A;  5GAN 7;  4EMK A;  1WI7 A;  2R5A A;  2PVD B;  3OYH A;  4D6W A;  2K7A A;  4ZGD B;  2D6F A;  1UGS B;  2DE0 X;  2DEQ A;  2LT1 A;  5GAO m;  5CO7 A;  1K73 C;  3H0I A;  2OTJ T;  2KRM A;  4DEY A;  3DLM A;  2NUT B;  2XKO C;  2CYZ B;  4KGZ B;  3G6E T;  4M75 C;  1VQ8 T;  2QQB A;  2XG8 D;  3JCM P;  1AWW A;  2AK5 A;  2RHZ A;  3JCM J;  1KG1 A;  4N4H A;  3HRU A;  2F69 A;  3P8D A;  2RB6 A;  2GTJ A;  1VQ4 Q;  3VU3 C;  4IUP A;  2GFU A;  4X34 A;  2E5Q A;  1VQ4 A;  1M8M A;  3J81 E;  4AFS C;  5IHN A;  1IGQ A;  5CKF A;  1LJO A;  2XU8 A;  2VGM A;  4ESR A;  3VRZ A;  3JCM e;  1NZ9 A;  2RMO A;  2QQR A;  1VQ9 Q;  3DKM A;  1PD1 A;  2ROT A;  2IPO B;  3OSV A;  1VQ9 A;  1MMG A;  2FEI A;  5GAN 3;  4D8D A;  3TRE A;  1GBR A;  2FRY A;  3KFV A;  2JMA A;  2MK5 A;  4XTX A;  2KRS A;  4JUV A;  4D8K A;  3NTK A;  4MZM A;  3CD6 Q;  4M7A F;  1V1C A;  1WXT A;  1OPK A;  4A4F A;  3CD6 A;  3L42 A;  1Y96 A;  1BI2 A;  2NUZ A;  5GAN h;  2D0Q B;  1VQ7 T;  1Q95 G;  4ZNX A;  1T3S A;  1X69 A;  1T0J A;  5FW9 A;  1OQK A;  5IXB A;  4OB2 B;  2KBT A;  2RPN A;  4OMN A;  2VGN A;  4F7U F;  3CCR T;  4F17 A;  2IIM A;  3M0U A;  5A2Q E;  3EG9 B;  1X6O A;  4M7A C;  2KXC A;  1D09 B;  4XTZ A;  2NUP A;  1I8F A;  3H6Z A;  3M0P A;  3HRT A;  3EGU A;  3H0H A;  4LDX A;  5EG2 A;  1GFD A;  1IHW A;  5GMK l;  2DL4 A;  1PNJ A;  5IHI A;  4HKE A;  2RHY A;  2DL8 A;  1N8R U;  4CC7 A;  2BE7 D;  4F14 A;  2EYZ A;  2EAY A;  1K8A C;  4C5E A;  5M9O A;  1OU8 A;  4B6M A;  2FG0 A;  2COW A;  4J9F A;  4C0Z A;  2EVR A;  4YTL A;  4PJO E;  5LJ5 j;  3R6N A;  1TTH B;  2CP7 A;  4HA8 A;  1SSH A;  3QBY A;  2X4W A;  3VKI A;  2O01 E;  2A08 A;  5C6S A;  1O9S A;  1JB0 E;  2FZG B;  5LJ3 d;  1S1N A;  2MOX A;  3MET A;  4J9E A;  1H64 1;  2I0N A;  2OTL T;  1TSF A;  4LUE A;  3CBP A;  4DA4 A;  2GGR A;  3C95 A;  1TU0 B;  1TOV A;  3QZ9 B;  5LJ3 e;  4WCI A;  1VQM T;  1KJW A;  3RBB B;  1W1F A;  3UF4 A;  2DIQ A;  4B9W A;  1NG2 A;  3PIO A;  1ZA1 B;  2EQK A;  5ECA A;  3U23 A;  3R6O A;  2D8J A;  1OOT A;  1U5S A;  4CRI A;  2RA2 A;  1W2B A;  2CP5 A;  5KYY B;  2XI9 A;  3BFM A;  4KRT A;  4C8Q G;  3D7S B;  2EQJ A;  3OS0 A;  4F7U E;  2RJF A;  2CSI A;  5J3B A;  3RER A;  2HSE B;  3FRN A;  4L5G A;  3NGP A;  1SEM A;  1Q86 R;  2E12 A;  1TH7 A;  1X75 C;  2P0Q A;  2F2X A;  5LL6 S;  3JV3 A;  3VS4 A;  1BI1 A;  1IXD A;  1Q7Y C;  3OYD A;  4J9G A;  2KXD A;  3L2W A;  4PJO A;  1VOM A;  2QDY B;  4VUB A;  4RCB A;  3GBQ A;  1GL5 A;  1H3Z A;  5A0D A;  1YP5 A;  3GLX A;  3CPW A;  2DK3 A;  3JCM X;  4II1 A;  1Y57 A;  1IO6 A;  1WZO A;  4FSX A;  4QKU A;  4FCY A;  1KQS A;  2JS2 A;  3OMC A;  4O5V A;  5KH6 A;  5GAM g;  4XTU A;  2M16 A;  3LH5 A;  3NPF A;  1KC8 C;  2KI7 A;  4RTX A;  3G6E Q;  2LT4 A;  3G6E A;  1PHT A;  2DX1 A;  1K1Z A;  4M78 G;  2KYB A;  3EFO B;  4BE0 A;  3CEY A;  1Q82 U;  1YCY A;  2YRV A;  1AT1 B;  1N9R A;  1Y7X A;  2O4X A;  5AYF A;  1WA7 A;  4FYW B;  1AWJ A;  5FU7 B;  4F7U A;  1WJR A;  2VUB A;  4OMP A;  2YDL A;  3JB9 I;  1LOJ A;  5GAN e;  2LQW A;  3EHR A;  2HQH A;  2L89 A;  3OYA A;  2E6N A;  3M4G A;  2JZ2 A;  2GFA A;  3LW5 E;  1WHL A;  1Q7Y R;  2QGF B;  3L2U A;  3SD4 A;  2F1L A;  4N4I A;  2NUT A;  2A3L A;  2DL7 A;  2E70 A;  3C4S A;  1N9S A;  1QP3 A;  1AHJ B;  4ANJ A;  1VQ6 T;  4BY6 B;  2K3Y A;  3M56 A;  4J9I A;  3VS3 A;  5FRO A;  4AFU C;  1JBM A;  2V1Q A;  2JOY A;  3V7S A;  1AWX A;  2DA9 A;  2VXE A;  3RMS A;  2DD5 A;  5IN1 A;  1HD3 A;  1RAH B;  2RK2 A;  1NJI U;  5FRN A;  1KC8 R;  2LNH B;  1PSF A;  2LCC A;  3BY7 A;  1WPY A;  1K4U S;  3SWN B;  3EGX B;  1X6G A;  3L2V A;  1RI9 A;  2PUO B;  3V7C A;  3MHX A;  2X4Y A;  2QXF A;  1Z9Q A;  1PG5 B;  2D9T A;  2DXU A;  5I2M A;  4A63 B;  2LJ1 A;  1CKB A;  4JRK A;  2ZCF B;  4J9B A;  1WHJ A;  2AKL A;  2FPE A;  1OU9 A;  3M0R A;  2LZ6 B;  5GAO p;  3ZEH A;  1R77 A;  4J5Y A;  1MV0 B;  1D0Y A;  3CQT A;  4HCK A;  3UA6 A;  4C92 C;  4OML A;  3MKD A;  2D1X A;  1PC0 A;  1QLY A;  2X9H A;  4IUQ A;  4M7D C;  2ED1 A;  2KRO A;  1QVG A;  4JRQ A;  3O5Z A;  2L3S A;  3MEA A;  3HP9 A;  1VIE A;  1SPK A;  4XTV A;  1FXX A;  2OTL Q;  3G4S Q;  4HCC A;  3L1A A;  3THK A;  4ME7 A;  1K9M U;  2OTL A;  3G4S A;  5IH2 A;  5FU6 B;  1G2B A;  5KYU A;  1Q81 C;  1J3T A;  1VQM Q;  1M3A A;  2QQ9 A;  1VQM A;  1C6V X;  4FL6 A;  3VJP A;  1M1K C;  1SG5 A;  2LQK A;  2RHX A;  4M77 C;  4N0A C;  2QK0 A;  1YJN T;  2ZGW A;  4KUD K;  3OYL A;  3JCM g;  3CCL Q;  2JTF A;  1AZE A;  5GAM d;  3CCL A;  2LP5 A;  3EH2 A;  1K0X A;  1M90 U;  1RAI B;  3PIP A;  2YT6 A;  2QYZ A;  1PM3 A;  5A0G A;  1LCK A;  1ABQ A;  1YHQ T;  4JS4 A;  1RAD B;  2QG9 B;  4RG2 A;  1OI1 A;  1HK9 A;  3S3N A;  3S3M A;  4EMK C;  3QHS A;  4LXC A;  1EX4 A;  2J05 A;  3BDU A;  3QYH B;  4C5G A;  2E41 A;  1QKX A;  1JXO A;  1CKA A;  3JSC A;  4BB7 A;  3QII A;  2DZ9 A;  2D8H A;  2JM9 A;  3VRY A;  3OA6 A;  2FPD A;  2YUO A;  3MEV A;  4XU2 A;  1OEB A;  4GBQ A;  3I56 T;  1FMK A;  3EGD A;  2XD0 A;  3JCM V;  4CC4 B;  5KYY A;  1Q81 R;  3VYH B;  4JLG A;  4LDU A;  4EPC A;  2MYS A;  2DL3 A;  1WHG A;  4OVA A;  3CCJ T;  1VA7 A;  2BE9 B;  1M1K R;  1ARK A;  2KEA A;  1I81 A;  2F2V A;  3G1J A;  2J6F A;  2X4X A;  3JB9 H;  5KE2 A;  3OYM A;  2JUF A;  4Z02 A;  4KH0 B;  2GF7 A;  2P0K A;  2DKG A;  1OV3 A;  2K3X A;  2KT1 A;  1ZUK A;  2PUK B;  1FMW A;  4PJN A;  2QDL A;  5L23 A;  3N5B B;  3CBO A;  5CCA A;  1W2B S;  3CME T;  1VQK T;  3OS2 A;  1ZX6 A;  1HXD A;  1QVF A; 
#chains in the Genus database with same CATH homology
 1B07 A;  2KT8 A;  2ROL A;  2DLP A;  2M0Y A;  2NUZ A;  3VS5 A;  1GCQ C;  3C0C A;  4JJD A;  4CC3 A;  3EHQ A;  4ZNX A;  1T3S A;  1X69 A;  1T0J A;  1GBQ A;  1WFW A;  3M0S A;  5FW9 A;  1AZG B;  2CUD A;  5IXB A;  2KBT A;  2RPN A;  1JU5 C;  1UJ0 A;  4ORZ A;  4OMN A;  4F17 A;  2IIM A;  3M0U A;  2RN8 A;  1WX6 A;  1Y0M A;  2KXC A;  4IIO A;  2L3Q A;  3ZL7 C;  2EGA A;  1K76 A;  2HBW A;  3UA7 A;  1I07 A;  1WDX A;  2GTO A;  3M0P A;  2RQW A;  1ZSG A;  3EGU A;  3H0H A;  1X2Q A;  3NHN A;  1GFD A;  1W70 A;  2DL4 A;  1PNJ A;  2LX7 A;  5IHI A;  2VKN A;  2DL8 A;  3REB B;  4CC7 A;  1T0H A;  3TVT A;  1KSW A;  3NMZ C;  4F14 A;  2RNA A;  2DBM A;  1JQQ A;  2E5K A;  2EYZ A;  2FRW A;  1UDL A;  4GLM A;  5GJW B;  1H92 A;  2YSQ A;  2L2P A;  2A28 A;  2FG0 A;  2RF0 A;  4J9F A;  4HVV A;  2EVR A;  2JTE A;  2G6F X;  2KYM A;  3R6N A;  1SSH A;  2CUB A;  2SRC A;  2A08 A;  2JMC A;  1S1N A;  2MOX A;  4J9E A;  1GFC A;  5FWB A;  1NEB A;  2I0N A;  4LUE A;  3QWY A;  2BZ8 A;  2GGR A;  2K2M A;  4RUG A;  2VVK A;  3M0Q A;  1NYG A;  3IQL A;  1TG0 A;  4WCI A;  2DRM A;  1E6H A;  4LUD A;  4OMO A;  1HJD A;  3REA B;  2C0T A;  1PKT A;  2SEM A;  1KJW A;  3RBB B;  1W1F A;  3UF4 A;  1RLQ C;  1K9A A;  2M51 A;  2C0I A;  3QWX X;  4RTW A;  1NG2 A;  1UFF A;  2YUN A;  2RQV A;  2D0N A;  2AKK A;  1Z9Z A;  2LMJ A;  5ECA A;  3U23 A;  2D8J A;  1OOT A;  1U5S A;  1X2K A;  3VS2 A;  1NM7 A;  2PNI A;  4JJC A;  3VS0 A;  2EYY A;  4KRT A;  2LCS A;  2CSI A;  5IXF A;  1AVZ C;  2MIO A;  2CT4 A;  3NGP A;  1SEM A;  3EG3 A;  4Z88 A;  1GRI A;  1VYU A;  4JPB W;  2F2X A;  3JV3 A;  3VS4 A;  2HEQ A;  1VYV A;  4J9G A;  2A37 A;  3FJ5 A;  2KXD A;  2DL5 A;  2ED0 A;  2C0O A;  1UHC A;  1UG1 A;  2RQR A;  2HDA A;  4X1V A;  1EFN A;  3GBQ A;  1GL5 A;  2EPD A;  1X43 A;  1N5Z A;  1YP5 A;  1QWF A;  1ZLM A;  1WIE A;  1Y57 A;  1IO6 A;  1E6G A;  2CH4 W;  2JS2 A;  1JXM A;  2K9G A;  2CSQ A;  3LH5 A;  2W10 A;  1SHG A;  3NPF A;  2PZ1 A;  4OMQ A;  4RTX A;  4DEX A;  1QCF A;  2HSP A;  5FWC A;  1H8K A;  1K0S A;  2EGE A;  1PHT A;  2DX1 A;  1K1Z A;  2LJ3 A;  2KYB A;  2KR3 A;  1ABO A;  1BB9 A;  1TUD A;  1W6X A;  4AFZ C;  2J6O A;  4Y92 A;  1WA7 A;  1XOV A;  3PE0 A;  3RNJ A;  1PWT A;  2P4R A;  1AWJ A;  4OMP A;  4Z8A A;  2YDL A;  2CT3 A;  1BU1 A;  2LQW A;  1UHF A;  3EG0 A;  3EHR A;  2AZV A;  2BTT A;  3H0F A;  2L3P A;  5I22 A;  1G83 A;  2JM8 A;  4J9D A;  1OPK A;  1NLO C;  2J6K A;  2JS0 A;  1UGV A;  2W0Z A;  1WYX A;  2CRE A;  1YNZ A;  4JZ3 A;  1M3B A;  4QT7 A;  4HVU A;  2DIL A;  4J9C A;  1VYT A;  3SEM A;  2V1R A;  2H8H A;  3I9Q A;  2DL7 A;  4HVW A;  1KFZ A;  2OAW A;  2PTK A;  1BK2 A;  4J9I A;  3VS3 A;  3SHW A;  4AFU C;  2EQI A;  2V1Q A;  3PVQ A;  2DVJ A;  1AWX A;  2DA9 A;  5HCK A;  1HD3 A;  1X27 A;  2MCN A;  2A36 A;  2KNB B;  2LNH B;  4AG2 C;  2F2W A;  1K4U S;  4FSS A;  2J7I A;  1YWO A;  1WXB A;  1X6G A;  1RI9 A;  2BZY A;  2O9V A;  1UE9 A;  4E6R A;  1PKS A;  1NEG A;  2EKH A;  1AEY A;  1RLP C;  1PRM C;  1Z9Q A;  2K6D A;  2KGT A;  2JT4 A;  4LE9 A;  4A63 B;  2LJ1 A;  2XMF A;  1CKB A;  1JEG A;  1M27 C;  1NYF A;  3TSW A;  4J9B A;  2AKL A;  3VS1 A;  2ABL A;  2FPE A;  3M0R A;  2EGC A;  3PVL A;  1A0N B;  1BBZ A;  2LZ6 B;  2K3B A;  3EG1 A;  1MV0 B;  2KRN A;  3CQT A;  4HCK A;  2JW4 A;  3UA6 A;  4OML A;  2D1X A;  3I35 A;  2CH4 A;  1QLY A;  2DYB A;  2LJ0 A;  2ED1 A;  4EIK A;  2KRO A;  4HXJ A;  1KIK A;  3O5Z A;  4RTV A;  5EC7 A;  2ENM A;  2L3S A;  2OJ2 A;  3TSZ A;  1M30 A;  1SRM A;  2DJQ A;  5I11 A;  5IHK A;  1PRL C;  4Z89 A;  1SPK A;  3EG2 A;  2FPF A;  4K11 A;  1U06 A;  2RQT A;  1OPL A;  3I5R A;  3M0T A;  4RTZ A;  2B86 A;  4IIM A;  3THK A;  4AFQ C;  2KE9 A;  1B3Q A;  1UTI A;  5IH2 A;  1GCP A;  1HSQ A;  2DBK A;  1QKW A;  1G2B A;  1FYN A;  1AOJ A;  1U3O A;  1T3L A;  2DNU A;  1J3T A;  4M4Z A;  1YWP A;  1M3A A;  3VS6 A;  1UEC A;  1ZUY A;  2EYW A;  1UJY A;  4RTT A;  1ZBJ A;  4JZ4 A;  1H3H A;  4JJB A;  4RTU A;  2GBQ A;  4R0K A;  1MV3 A;  4RTY A;  1SHF A;  2DM1 A;  2GQI A;  3VS7 A;  4J9H A;  1AZE A;  2X3W D;  1E7O A;  2YUP A;  4AG1 C;  2LP5 A;  1TUC A;  3UAT A;  1WI7 A;  1K0X A;  1NLP C;  1WXU A;  2YT6 A;  4LN2 A;  1SRL A;  2K7A A;  2LQN A;  1LCK A;  1ABQ A;  1RUW A;  2DRK A;  2GNC A;  2AZS A;  2DE0 X;  1I1J A;  2J05 A;  3H0I A;  2KRM A;  2EW3 A;  4DEY A;  2RQU A;  1YCS B;  2O31 A;  2L0A A;  1JO8 A;  2FO0 A;  1AD5 A;  3A98 A;  1QKX A;  1AWW A;  2AK5 A;  1X6B A;  3H41 A;  2BZX A;  2O2O A;  1JXO A;  1CKA A;  1YN8 A;  1M3C A;  2D8H A;  2DF6 A;  4CC2 A;  2JM9 A;  3VRY A;  2GTJ A;  2FPD A;  2YUO A;  1OEB A;  4GBQ A;  1FMK A;  1ZUU A;  1M8M A;  4AFS C;  5IHN A;  4CC4 B;  1CSK A;  2YUQ A;  2VWF A;  2DL3 A;  2OI3 A;  1AWO A;  1ARK A;  1VA7 A;  3VRZ A;  4ESR A;  2ECZ A;  2KEA A;  2ESW A;  2F2V A;  2J6F A;  2J06 A;  2RMO A;  2JXB A;  4LNP A;  1I0C A;  2ROT A;  1WLP B;  2CDT A;  2FEI A;  1UUE A;  1OV3 A;  4D8D A;  4F16 A;  2KT1 A;  4OMM A;  1ZUK A;  3I5S A;  1GBR A;  1QWE A;  2FRY A;  3ULR B;  2O9S A;  2QDL A;  2JMA A;  3KFV A;  2EYX A;  2K79 A;  2DMO A;  2KRS A;  5L23 A;  2NWM A;  2O88 A;  2X3X D;  1GCQ A;  4D8K A;  2EBP A;  2HCK A;  1V1C A;  1WXT A;  1ZX6 A;  5GJV B;  1MUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...