1VQ6Q

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq6Q00
3I55Q 1VQKQ 3G71Q 3CMEQ 3CCVQ 1YHQQ 3CCEQ 3CMAQ 3G4SQ 1VQMQ 1VQOQ 1QVGP 1Q86R 1VQ8Q 3CC4Q 2QA4Q 1VQNQ 3CXCP 1Q81R 3CD6Q 3CPWP 1YIJQ 1S72Q 1VQPQ 1K9MR 1VQ4Q 1KD1R 1Q7YR 1NJIR 3CCRQ 1YI2Q 1VQ6Q 1KC8R 2QEXQ 3CCLQ 3CCMQ 3CCQQ 1VQLQ 3CC2Q 1YITQ 1K73R 1YJWQ 1KQSP 3OW2P 1YJ9Q 3CCUQ 1JJ2P 1QVFP 3G6EQ 1K8AR 1M90R 3CCSQ 1W2BP 3CC7Q 1N8RR 1Q82R 3CCJQ 1VQ5Q 1VQ9Q 1YJNQ 2OTJQ 2OTLQ 3I56Q 1M1KR 1VQ7Q
chains in the Genus database with same CATH superfamily
5EC7A 3I55A 1AEYA 3BDUA 1MMNA 2EKHA 4M4ZA 3SDZA 3ZL7C 5I11A 2KRSA 2LZ6B 2NUTB 3OYEA 3EAEA 3FRNA 4IIMA 4AT1B 1X2QA 2DJQA 4DBRA 5GAMh 2EQKA 1WX6A 4J7FA 2L5QA 4C92C 5I22A 2R5AA 2RF0A 4FYXB 1P92A 2BTTA 3CCVT 2M9UA 1ABOA 3RDVA 2FYKA 1WNLA 4KBMB 5GJVB 2HL5C 2K4YA 1NJIR 3L2VA 2M0OA 1BU1A 2JN0A 1QLYA 4IUPA 4UC4A 5GAN8 3TQ7P 1K9MU 1YNZA 2IPOB 3PE0A 5KYUB 5GANh 2MOXA 4M75B 2FEIA 3KXTA 1VQKQ 2LJ0A 1TU0B 1ZA1B 5ECAA 3A98A 3PVQA 2GGRA 2EYQA 1WXTA 2SRCA 3KBGA 3M0SA 5GANj 3C94A 2VGNA 1M4ZA 4RCCA 3VYGA 2ESWA 1T0JA 3AT1B 4E7LA 4ZGJB 2W0ZA 4NL2A 3NTKA 4M7DA 2JT4A 5DM7R 1VQMT 1ZHIA 2A7YA 2NWMA 4EMKC 2WSEE 1M27C 4OMMA 4ZTFA 2YUOA 2VB6A 4PJNA 4C5EA 3META 2P84A 3QBYA 3VV0A 1VQLA 1RI0A 4HKEA 1Q7YU 4NOYA 2F2VA 2HCKA 3LLRA 3OYYA 3QSUA 2VGMA 4ZN1A 3RKXA 1K8AU 1VQKA 4M75F 1GRIA 1T3LA 5CQXA 2CP5A 2EJGA 2ROLA 3UWNA 1YI2T 4Z88A 2GF7A 2FVUA 2HMAA 2O9SA 3JB9J 3OQ5A 1I5OB 1WQ7A 4RTTA 1YN8A 2LNHB 4M7DE 2NUPB 2LJ3A 2KT1A 2K5IA 3MEAA 1GFDA 2E65A 1G8XA 4RTZA 4HVVA 1UFFA 3OYIA 1D0XA 2PNIA 1M9SA 5HCKA 3QXEB 2FHDA 3JCMQ 1PD0A 2LQWA 2D0NA 2HEQA 2GQIA 1R0BG 3M58A 3GNFB 1QVFS 1MMDA 4Q5WA 1W2BP 1KC8U 1BI2A 1QVFA 2XU8A 2IIMA 5IT9E 5GMKh 3EG0A 2C0OA 2A0FB 2M51A 3EG9A 3OMCA 5LJ5d 2JOYA 3VS0A 4BE2A 1VQ6T 2E5KA 1SG5A 1ZUKA 1LJOA 4B9XA 3GP8A 3QZ9B 1AWWA 1MNDA 2CP2A 1CKBA 2AIRB 2ZPHB 4FW2A 5LJ3d 2KK4A 2HBPA 1QVGS 1QWEA 1LNXA 3S6WA 3CPWP 3FJPA 3QYHB 4OMOA 3ZBDA 1K9AA 2RB6A 2RQTA 2LTOA 2RK1A 4M77D 1OV3A 3MHXA 4YTLA 1QP3A 2CP0A 3BFMA 3A8HB 2RQRA 3R6NA 4HCZA 2QDLA 2X9HA 4M7AG 3EGDA 3V8LA 3F70A 2L3PA 3CCLT 2D6FA 1CSKA 2EQMA 1OZ3A 3CPFA 1AD5A 3DB3A 3CC7T 4FYYB 1N27A 1XOVA 1KK7A 2RHXA 1OYXA 2DVEA 2BZYA 3CMET 3UDCA 3A8OB 4ME7A 2RM4A 1GCPA 3QWXX 1PSFA 3L2UA 4C8QC 1WJRA 2O01E 3OYKA 3V8JA 1PKSA 1R8OB 3PMIA 4IUTA 4HVUA 4QVDA 4CI0C 5LL6S 1H3ZA 3OYFA 3CCST 5J26A 1RAHB 1Y07A 2OTJT 2CT4A 2BZ8A 2OTLT 5GMKi 1UGVA 4DBFA 3SD4A 1GCQA 1VQ8T 1QKWA 2MPXC 4XTXA 2GFUA 2M0YA 5KYYA 3O5ZA 2LQNA 1JBMA 3CCMQ 1BIAA 2QEXA 1A0NB 2KYBA 2OAWA 5HK3A 1OU8A 2MAMA 3LGLA 4MDWA 4C92D 3N5BB 1KHIA 1TH7A 2M1HA 3OS5A 4IUUA 3QUIA 4M7AA 1M8VA 2E64A 3HKSA 2KI7A 3GIBA 2OI3A 1NE8A 1VYVA 3I5SA 3VS5A 2JVVA 1J3TA 4WCIA 3VRZA 2DXBA 3MO8A 4M77G 4L59A 3H41A 3VS4A 1RAIB 1NG2A 2FZGB 4J9CA 4ZGEB 2MWOA 5LJ5j 1QQJA 3DLLA 2DRMA 3E19A 4IUVA 2DK3A 1AZGB 2QTVA 1OPLA 1VA7A 4E7JA 1M1KC 3KFVA 2RQUA 3OYLA 2JTEA 4MMKA 3JCMf 2X3XD 4PK4A 3CCJQ 3EG9B 1X69A 1Q86C 5IXBA 4PJLA 4M7AE 5KCOA 1X6BA 3EG1A 5LJ3j 3QIIA 3MEUA 4JLGA 1SKUB 4AFSC 3PFSA 3R6OA 1YBYA 2KT8A 4M75G 2X51A 2HKQB 4PNOA 1AHJB 1LVKA 3A5ZB 3BW1A 4O5VA 5CAIA 2P0PA 3OSSC 1UGSB 2HDAA 4JRPA 3QJ6A 2DKGA 3M54A 3RMSA 1KD1C 2CP6A 2C0IA 1TXQA 1BKBA 1Q81R 4ELZC 3FC3A 1M90C 2KQWA 3NTHA 3J81E 1QW1A 1Q82C 2DBKA 1IGUA 4HCCA 2G3RA 4EDUA 2LP5A 1OX8A 4E47A 2NUTA 1I81A 4D8KA 3CCJA 5CKEA 2D8JA 1BBZA 5A2QE 4MZTA 1TWBA 4C0FA 4BUGA 3CCET 1IRXA 1CKAA 2K5LA 1SSHA 3G4SQ 5KYXA 2K79A 1QP2A 2MYSA 4QQ6A 2A08A 1UHCA 2HNIA 2IG0A 2GFAA 3J80E 1HXDA 4C92G 1JJ2S 2RQWA 3M4YA 4C5HA 3CC2Q 1D0YA 1H8KA 2O88A 2YRVA 1UDLA 4CC7A 1JJ2A 2LCSA 2VWFA 3HP9A 3VU3C 2GQVA 1AOJA 1ZX6A 3MPUB 4X34A 2JM8A 3VUZA 3VUBA 1YHQQ 1PCXA 2FG0A 5GAMd 3OYMA 5KYUA 2EW3A 4M75A 1UECA 2LCLA 2KROA 2FRWA 2KRNA 1YITQ 4BY6B 3NGPA 3OA6A 4M77E 4RTWA 1M2OA 3I56T 1VQ7T 2K3BA 4IIOA 2VUBA 2CS7A 4XTVA 2DLPA 2DL7A 3G4SA 2KE9A 3EGUA 5I21A 2C0TA 2LQ8A 1S72A 5GAN6 4MDXA 3OYGA 4J9IA 3OY9A 3S3NA 5C0MA 3M4GA 1NBEB 2XKOC 2YDLA 2FL7A 2DRKA 1PRLC 2RI2A 1W1FA 4M75E 1MHNA 4ATOA 2AKLA 4BDZA 2EQIA 4MMLA 3OYCA 1U3OA 1JO8A 3EG3A 1Y96B 2HAXA 2D0QB 5GANf 1MGQA 3MP6A 4N4IA 1VYTA 2X4WA 4HVWA 3HTRA 4C92A 5HKCA 1FMKA 1I0CA 5CKDA 1UE9A 5J3BA 2ZCFB 2LJ1A 2XIDA 2G6FX 3REAB 1WJSA 1NLPC 2FRYA 4J9GA 1B34B 1NZ9A 2NUPA 3H0IA 3CCVQ 4FSXA 1R77A 2X4XA 3FLGA 2XK0A 3G1JA 2LNVA 1N9SA 3OYJA 2GBQA 4OF1A 1YJWT 4PLIA 4A53A 3G6ET 4C8QD 4A54A 1C0MA 1YWOA 2ABLA 5GAOr 1FMWA 1Y7XA 2JM9A 2I0NA 2DETA 2V26A 1UJYA 2D8HA 5GMKm 5GMKl 2QTXA 2QQ9A 2QQAA 4C92E 1V29B 3V7SA 1VQ4T 2PZ1A 1LOJA 2D1XA 4BI4A 2MCNA 5IHNA 1WA7A 3JCMe 1ZSZB 2DTOA 3NPFA 4XTYA 4AG2C 4M78C 1G5VA 4BB7A 2ROTA 3JCMg 4J6WA 3PVLA 3VS1A 5KH6A 1V1CA 1AWOA 2HQEA 3CCVA 4EMKA 1NM7A 1VQMQ 4RTUA 3M0PA 4HA8A 2K5FA 3CD6A 4A63B 2EKOA 4E6RA 1T3SA 2KRMA 1N8RC 2VXEA 3JCMJ 2PUOB 1PM3A 2E6NA 4X1VA 2KNBB 3HRUA 2ED0A 4FL6A 4M77B 5KYXB 1UB4A 3A8MB 4J9FA 1UEBA 5GAMj 8AT1B 1BI3A 1RAFB 1M1KU 1TSFA 1YP5A 2H3JA 2HQHA 3M9QA 2DVJA 1G2BA 1IO6A 2J6FA 1JU5C 2H8HA 2GNCA 1YI2Q 1Z9ZA 1G3SA 5C6SA 2F69A 1Q86U 4ANJA 1JXOA 2SEMA 4LE9A 3RKWA 1XJWB 3BDLA 3PIOA 2DM1A 3OYBA 2DF6A 3P8HA 1OEBA 1VQMA 4KGXB 2LCCA 3MP1A 3G7ZA 1M1GA 2CDTA 3Q1JA 4RTXA 2DAQA 3M56A 2RJEA 4ESRA 1HK9A 3MCAB 2DE0X 1KQSP 1KD1U 5D6YA 1PSEA 3HRSA 4QVZA 1RACB 1MV0B 1D09B 4M77F 2LMJA 1SRLA 1XQHA 1WJQA 1M90U 1TOVA 4C8QG 3CQTA 1Q82U 1TS9A 4M78B 3J7AF 4LDWA 4LDYA 4MZPA 1WHKA 2DBMA 1GBRA 3I9QA 4OVAA 1YI2A 4DOVA 1E6HA 1X6OA 1VQ6Q 1QWFA 3OBYA 4FSSA 1D1BA 2F2XA 3MJXA 2GTOA 3L1AA 5GAMe 3M0RA 1YCSB 3HHTB 1PG5B 1D3BB 2A36A 1HSQA 2XDPA 1BIBA 3UT1A 4C92B 4XTUA 1KHCA 1HJDA 4FM4B 4JS4A 4FYWB 5M9OA 5IN1A 2V1QA 3JB9D 1SEMA 3EHRA 4LD6A 1RABB 3SWNC 4R0KA 2KSSA 3V7RA 2CKKA 1NJIC 3ZEHA 5GANe 2EGEA 3RMQA 4A4GA 3TSZA 3NTIA 4M78F 4XU3A 5GANg 1VQLT 1SRMA 2J06A 3CCLQ 2CZ6B 4C0GA 2EQUA 2O4XB 3CC7Q 5CQYA 3JV3A 2QQRA 1K76A 3ER0A 3VS7A 1M2VA 3CMEQ 1M8MA 2KXCA 3PT9A 4F16A 4LN2A 2QG9B 4C0ZA 5FRNA 1D1CA 4C92F 3RKYA 5GMKj 5CKHA 4J6YA 2HBWA 2B86A 4KUIA 3EFRA 4HCBA 2E5QA 2DIGA 4FW1A 3CCSQ 4DQ2A 3V7CA 4C5GA 4EMKB 1YWPA 2OTJQ 2OTLQ 2V8JA 3RIRA 5FRMA 3NHNA 4DBHA 1ZBXA 1U8RA 2HQXA 2NLUA 2AHJB 1RUWA 2RI3A 4QW2A 4BDYA 1VQ8Q 4JJCA 1AVZC 5LJ5f 4XAXB 4KULA 4RTYA 1SF9A 1YFNA 2V1RA 2DXUA 4A4EA 4R55A 4AFQC 1JJ2P 3I5RA 3OYHA 2I2LA 4C8QE 2ED1A 1SHFA 4X9CA 3TREA 5LJ3f 1O75A 5FROA 1IHWA 2KMTA 2QA4T 3QDRB 4NL3A 4N4HA 4BE1A 3SWNB 4QT7A 1M3AA 1BI0A 4B9WA 3LH5A 1Z9QA 1AZEA 1K73R 4F7UB 4FU6A 3JB9I 1I4K1 3O8VA 1Y57A 2YRDA 1UGPB 2H3EB 3EH2A 5GMKe 1W4SA 1RADB 2XICA 1YIJT 2WSCE 2Y4YA 1WHHA 3P8BB 4Z02A 3UF4A 2XD0A 2D9TA 1YJ9T 4ZGDB 2ZAEA 6AT1B 4OMFB 1X27A 2KVQG 1QKXA 1TUCA 4M78D 1VQOT 1N8RU 3OSVA 2LT1A 4V2SA 4CC2A 2YHTA 2AZVA 2YXYA 3JCMc 1K9MR 1H641 1G3YA 1HYOA 1KQSS 4D8DA 2HSEB 1KQSA 1PD1A 4F7UF 3I35A 3T9NA 4KH0B 5L8RE 2MK5A 1OI1A 4AFZC 3CMAT 3EGXA 4E7KA 4FCYA 3CC4T 1RI9A 2MMPA 3RUXA 1ARKA 1Y71A 2KEAA 3ME9A 3E9FA 1ACMB 4E7SA 2XG8D 4LDXA 2DA9A 1OPKA 1Y96A 1X6GA 2A28A 4P5NA 1VQ5T 3X28B 1M5Q1 2K9GA 4ZNXA 3VRYA 3CBOA 3VS3A 3UA7A 3MEWA 1ZUYA 3CCEQ 2PTKA 5AYFA 4PL6A 1RAEB 3RNJA 1VQPT 2EPDA 3SFMA 5DLQE 1B34A 3EH1A 5KE2A 2QEXT 1Q7YR 3CBMA 3QZ5B 5FWBA 3CCMA 3DLMA 4PJOD 4GLKA 2HZYA 4OGEA 5HY6A 1K8AR 1M2VB 2A37A 4CC4B 1FWZA 2BE7D 2JS0A 4FT2A 2KAFA 4C8QB 3UPUA 5GAN3 1UUEA 4OP0A 1WQWA 1VQNT 4IKFA 4BD3A 4LXCA 4JZ3A 1K1ZA 3THKA 1I07A 2J6KA 2DTIA 5D6WA 2L89A 5KYWB 3S3MA 1FMVA 2EGCA 1JB0E 2ZZDA 2DEUA 3HSBA 4OB3B 4IURA 1ZSZA 3I56Q 2JMCA 3OMGA 1VQ7Q 4OB0B 1BYMA 4GBQA 1G3TA 3U23A 3RERA 2K3XA 1WIEA 3FJ5A 4QVCA 5FU6C 1WZOA 4M78G 1ZQ1A 1KC8R 2E3IA 3UA6A 5GAOm 1NJIU 1YJNT 3WVEB 1KSWA 3UATA 2QDYB 5GAN4 1E6GA 3M0UA 4C8QF 5LJ5e 1NEBA 1EZZB 2MI6A 2RNAA 4D6WA 4M77A 3CEYA 4R56A 3FB9A 5LJ5g 4ZTJA 3PTAA 3CCRT 4XU1A 3M55A 2ATCB 5AT1B 2XHCA 3CBPA 5LJ3e 2AKKA 1VQ9T 3EFOB 2J05A 4QQDA 4DEXA 1EIFA 1JXMA 5LJ3g 1VQ7A 3WVDB 4RCBA 2PVDB 2RHIA 1WYXA 1KQ2A 3L42A 1ZA2B 3BY7A 2DL3A 4KUDK 2E1HA 2FZKB 1FYNA 4JS5A 2YLCA 2F1LA 1KIKA 2RA2A 1H3HA 2EJFA 4ZN3A 1YJWQ 5HK0A 2CT3A 1KQ1A 3GBQA 3G6EQ 4LUDA 1OU9A 2DZCA 3LX7A 3HPWA 1V76A 1M30A 2EQJA 3ZFJA 5GAMf 3GNGA 4RKUE 1LPLA 5IXFA 1WHLA 2P0KA 1MV3A 3CXCP 4EPCA 4LUEA 1VQ4Q 2EWNA 4M7DD 1OZ2A 2DFUA 2RPNA 2QXFA 2MF2A 4M78A 2M02A 3CC2A 3C95A 3M0TA 5GJWB 1I1JA 3EGXB 2GCXA 4LNPA 4HCKA 4BACA 1PWTA 2ZGWA 2OX7A 1Q81C 4EIKA 5L23A 2EAYA 2X4YA 2ZPBB 1YHQA 3HRTA 2R5MA 3JCMh 1QCOA 4RG2A 1N9RA 1D3BA 2E12A 1RAAB 2E41A 2E10A 4F14A 4JRQA 2RQVA 1YITA 3REBB 2K2VA 2CGHA 2B8AA 1BB9A 3C12A 2ZPGB 3OYAA 2WACA 3E1SA 4M78E 4XTZA 1S72T 1C6VX 1MMAA 2GTJA 1VOMA 1VQ4A 1WLPB 2F5TX 1ABQA 2EVRA 1D1AA 4RTVA 4J9EA 4XQ3A 1KJWA 4F7UG 3MKDA 3QPHA 3MP8A 4GY5A 3LWHA 3OBWA 2FB7A 5KE3A 4FT4A 2O4XA 1F1BB 2QK0A 3MEVA 4JRIA 1BI1A 4KGVB 1B3QA 4HT8A 1N6AA 2J6OA 2BZXA 4WTOB 2E3HA 1VIEA 1ZBJA 5CO7A 1G83A 2FZCB 3A1PA 3L2WA 2FPFA 5IH2A 1JQQA 3C4SA 3QJYA 5FU7C 1UHFA 3JCMX 3G71T 3VYHB 2DXCA 3JB9F 4WF2A 3FEOA 1W70A 4JRKA 3ASKA 1OOTA 3M53A 2FPEA 3X24B 4PFOA 4F17A 1M3BA 4OMLA 1WHJA 3CCQT 1EFNA 2RJDA 3CCUT 2VXFA 4N0AC 1UTIA 2DJZA 2RHZA 4PJOE 1N5ZA 2F5KA 1DJ7B 5GAOn 1WXBA 3M57A 4JJNK 4BE0A 3INZA 4PJJA 3JCMV 3RBBB 4Z8AA 3E2UA 5GAN5 3HL8A 4J6XA 3LWIA 4B6MA 3JAME 2NUZA 1O9SA 5CVIA 3SWNA 2O9VA 2P4RA 2KDSA 4JUVA 4J9HA 4N4GA 3I55T 5FLXE 4F7UA 2JS2A 2OJ2A 2FPDA 3SEMA 3CD6T 1NEGA 1NLOC 4PJOC 2DYBA 2V8IA 1IXDA 2RJFA 4XK8E 3QYGB 3RR6A 4Z89A 1VQLQ 2CUBA 2VV5A 2JTFA 1R0CB 5D6XA 1SHGA 1WGSA 2K7AA 4DEYA 3EHQA 1FX7A 2K3YA 1TUDA 1WFWA 2QAZA 2RMOA 2JZ2A 1PRMC 3JB9H 1QMCA 1VUBA 5FU7B 1JEGA 3OYNA 3JRZA 1WHMA 1OX9A 4F7UE 2DL5A 1WXUA 2O2OA 3C0CA 2EGAA 4J8OA 2P4TA 4JJBA 8ATCB 2JXBA 3OS0A 2CP7A 2RI5A 3IQLA 5GAMg 2VASA 1WDXA 3CXCS 1GFCA 4QKUA 5GAN2 3S3OA 1EX4A 3OS1A 1XNIA 2BIVA 1WPYA 5FW9A 3CXCA 2BKDN 4E7IA 4PKCC 5KYNA 2XDDA 4DBQA 2LVMA 2DX1A 3QO3A 2CZ1B 2PU9B 4M7AD 2LQKA 3M5AA 2YT6A 3VJPA 5DLOA 2JJ9A 2CYZB 4Y28E 2L3SA 4KH1B 2Y90A 2QA4Q 4KRTA 1OULA 1HD3A 4J5YA 1VQ6A 2ZPFB 4JPBW 2DD4A 3ULRB 3LYIA 2EIFA 5IHIA 1MNEA 4PJOB 2CZ7B 1NPRA 1VQKT 2XDBA 2AZSA 1QCFA 1WI7A 2QGGA 2CP3A 3QKJA 4MZMA 2HD0A 1IZ6A 4C5IA 4C8QA 1YIJQ 1Y0MA 1RAGB 1K4US 1XTDA 3GF5A 5GAOp 2CH4W 1Q81U 2BE9B 1YJ9Q 2YSQA 2KYMA 2EYYA 2CSIA 1I8FA 1RLPC 4E7HA 4JDSA 3H0FA 2RO0A 4J9DA 4RUGA 5KYWA 3QHSA 1BCMA 4M7DC 2KY9A 2F2WA 1VQOQ 2QA4A 1AT1B 1NYGA 1Q95G 1X75C 2DXTA 2RD1A 3LW5E 4OGCA 3CCLA 2R57A 2EYXA 2HL3A 4PFZA 2E6ZA 3GOXA 3M59A 3CC7A 2PUKB 4Y92A 4PJOF 2YWWA 2AT1B 1BK2A 2JW4A 3CMEA 5CK9A 3X26B 5CIUA 3CMAQ 1FXXA 2COYA 1QVGA 2DERA 3H9NA 3CC4Q 1YIJA 3TEEA 2QASA 2RK2A 4E7ZA 1YJ9A 2K57A 1UJ0A 3HFNA 3CCSA 1VQ5Q 4AFUC 2OTJA 2CUDA 2L3QA 2OTLA 2EYZA 4J7IA 5A0LA 3EFOA 3H8ZA 4HT9A 1VQOA 3JB9G 1VQ8A 5GAN7 2DPPB 2DL4A 5A0GA 1VQPQ 3VS6A 1NYFA 1OQKA 4II1A 2LX7A 2P0QA 2QEXQ 4X9DA 5KCHA 5I2MA 4M75D 1M1KR 2PVGB 2YRCA 3PGGA 3A8GB 3CMAA 2E4HA 4RG8A 3URGA 2MIOA 2KBTA 1Q86R 3CC4A 1VQNQ 4DOWA 2Z0WA 2PVOB 3DB4A 4IUQA 4RMOA 4F04B 4M7DB 2X4JA 2M16A 3GLXA 3LH0A 1VQ5A 2ECZA 1AWJA 2LT4A 2LDMA 5CKBA 4FYVB 1IHVA 3L2RA 3EFSA 3DKMA 1D0ZA 1VQPA 4Y91A 3GPLA 1KD1R 2AK5A 2DYIA 2VVKA 4AG1C 2C06A 3EG2A 3LGFA 3OW2P 1WHGA 1K0SA 2L2PA 2X35A 1PC0A 2XMFA 1M90R 2CSQA 2QGFB 1Q82R 4PJMA 2LRQA 3WXMB 1YJNQ 4XU0A 2W10A 2KR3A 4ELYC 1M3CA 2EJ9A 5IHKA 2JNGA 5FWCA 4BI3A 2Y4XA 3SHWA 1K73C 1VQNA 2L0AA 2NYSA 1YCYA 1X01A 2HKNA 2KXDA 1U1TA 3CCRQ 3HFOA 4EMGA 3OYDA 1X2KA 4M7DF 3A8LB 5LJ5h 3JCMd 1VQ9Q 2DZ9A 2DTHA 1IREB 4CC3A 1X43A 1QCNA 2DNUA 4KGZB 4LDUA 4JLIA 2KGTA 3FDRA 5LJ3h 2QQSA 2L3RA 1MMGA 3OS2A 1KFZA 4A4HA 4L5GA 2LC4A 1W6XA 2VC8A 5GAOq 4OB1B 1YJNA 1BCOA 1JRIA 2DD5A 2RHYA 4J9BA 1K9MC 3SB2A 4BY6C 3CCEA 1GCQC 3RESA 3QG1A 3CCMT 2RH2A 3CCRA 2V8KA 5EG2A 5J39A 1W2BS 3FIFA 5GAOl 1SPKA 1W2BA 1VQ9A 4A4FA 3V8KA 2RJCA 2YUPA 4PLLA 4VUBA 1K0XA 3BE3A 1IB8A 3VKIA 2WSFE 3D7SB 4KT0E 1ZSGA 1S1NA 1SSFA 1B07A 4M7AC 1H92A 5IAYA 5I2SA 3VS2A 2BUDA 2CH4A 1G3WA 3EGDB 2CZ0B 3TVTA 4A4KA 3I56A 2RHUA 2DILA 1Q7YC 2JUFA 2MWPA 3CPWS 3PMTA 3CPWA 1S72Q 3AHUA 1K8AC 2COZA 1RL2A 3PIPA 2ENMA 3H0HA 4LDVA 3CCJT 5DY9A 4QQGA 1PHTA 1UGRB 2QYZA 7AT1B 4J83A 4PJOG 4CRIA 1TG0A 3TCJA 2VYTA 1VIFA 1KG1A 2CREA 4BI8B 1B7TA 4EMHA 2HSPA 4JJDA 1UG1A 2DEQA 2XI9A 1M1FA 4L6V5 1E7OA 2JMAA 2IVWA 3JCMb 2A3LA 1ZSZC 5FU6B 5KYYB 3G71Q 4OMPA 1U5SA 1KC8C 1TTHB 3KUFA 4TVRA 4C0DC 4XU2A 4LD9K 2L8DA 2K2MA 3TSWA 2X3WD 5A0DA 1GL5A 4JZ4A 1AWXA 4GLMA 2O31A 5GANd 4N0AA 3CCQQ 3M0QA 2OAUA 4AMCA 1YJWA 3CCUQ 3L2ZA 1C1AA 4XTWA 2R58A 3G6EA 1N8RR 1ZLMA 4OMQA 4M7AB 2EBPA 3G4ST 1QVPA 2YUQA 5CKFA 2YUNA 3QDFA 3JSCA 2DO3A 1TUGB 4M77C 4E2FB 1GBQA 4NS5A 2ZPEB 2QI2A 3CC2T 1U06A 3PNWC 2YLBA 3OW2S 2EFIA 3NFCA 3OW2A 1I5LA 1QVFP 3H6ZA 3OB9A 4FIBA 4K11A 4ORZA 1YHQT 3JCMW 3I55Q 4PFPA 3E9GA 3G71A 1ZUUA 2LX9A 4PJOA 4O6JA 3X25B 1GXIE 3CD6Q 2EYWA 1T0HA 2E70A 1NPPA 4M75C 1YITT 3CCQA 1U1SA 2DL8A 3CCUA 2ZPIB 4DA4A 2DIQA 2J7IA 2JTMA 4HXJA 2FO0A 4OB2B 2COWA 2PQWA 2QQBA 1RLQC 1LCKA 4M7AF 5D7UA 1VYUA 3JCMP 1QVGP 4OMNA 1PKTA 1MUZA 1PNJA 5CR2A 3X20B 5CCAA 2K6DA 2VKNA 1IGQA 9ATCB 2DMOA 1UGQB 3P8DA 2RN8A 4C0DB 3NMZC 3QWYA 1K73U 3TU4K 4M7DG 3L2QA
chains in the Genus database with same CATH topology
3I55Q 1VQKQ 3G71Q 3CMEQ 3CCVQ 1YHQQ 3CCEQ 3CMAQ 3G4SQ 1VQMQ 1VQOQ 1QVGP 1Q86R 1VQ8Q 3CC4Q 2QA4Q 1VQNQ 3CXCP 1Q81R 3CD6Q 3CPWP 1YIJQ 1S72Q 1VQPQ 1K9MR 1VQ4Q 1KD1R 1Q7YR 1NJIR 3CCRQ 1YI2Q 1VQ6Q 1KC8R 2QEXQ 3CCLQ 3CCMQ 3CCQQ 1VQLQ 3CC2Q 1YITQ 1K73R 1YJWQ 1KQSP 3OW2P 1YJ9Q 3CCUQ 1JJ2P 1QVFP 3G6EQ 1K8AR 1M90R 3CCSQ 1W2BP 3CC7Q 1N8RR 1Q82R 3CCJQ 1VQ5Q 1VQ9Q 1YJNQ 2OTJQ 2OTLQ 3I56Q 1M1KR 1VQ7Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 Q;  1VQK Q;  3G71 Q;  3CME Q;  3CCV Q;  1YHQ Q;  3CCE Q;  3CMA Q;  3G4S Q;  1VQM Q;  1VQO Q;  1QVG P;  1Q86 R;  1VQ8 Q;  3CC4 Q;  2QA4 Q;  1VQN Q;  3CXC P;  1Q81 R;  3CD6 Q;  3CPW P;  1YIJ Q;  1S72 Q;  1VQP Q;  1K9M R;  1VQ4 Q;  1KD1 R;  1Q7Y R;  1NJI R;  3CCR Q;  1YI2 Q;  1VQ6 Q;  1KC8 R;  2QEX Q;  3CCL Q;  3CCM Q;  3CCQ Q;  1VQL Q;  3CC2 Q;  1YIT Q;  1K73 R;  1YJW Q;  1KQS P;  3OW2 P;  1YJ9 Q;  3CCU Q;  1JJ2 P;  1QVF P;  3G6E Q;  1K8A R;  1M90 R;  3CCS Q;  1W2B P;  3CC7 Q;  1N8R R;  1Q82 R;  3CCJ Q;  1VQ5 Q;  1VQ9 Q;  1YJN Q;  2OTJ Q;  2OTL Q;  3I56 Q;  1M1K R;  1VQ7 Q; 
#chains in the Genus database with same CATH topology
 5EC7 A;  3I55 A;  1AEY A;  3BDU A;  1MMN A;  2EKH A;  4M4Z A;  3SDZ A;  3ZL7 C;  5I11 A;  2KRS A;  2LZ6 B;  2NUT B;  3OYE A;  3EAE A;  3FRN A;  4IIM A;  4AT1 B;  1X2Q A;  2DJQ A;  4DBR A;  5GAM h;  2EQK A;  1WX6 A;  4J7F A;  2L5Q A;  4C92 C;  5I22 A;  2R5A A;  2RF0 A;  4FYX B;  1P92 A;  2BTT A;  3CCV T;  2M9U A;  1ABO A;  3RDV A;  2FYK A;  1WNL A;  4KBM B;  5GJV B;  2HL5 C;  2K4Y A;  1NJI R;  3L2V A;  2M0O A;  1BU1 A;  2JN0 A;  1QLY A;  4IUP A;  4UC4 A;  5GAN 8;  3TQ7 P;  1K9M U;  1YNZ A;  2IPO B;  3PE0 A;  5KYU B;  5GAN h;  2MOX A;  4M75 B;  2FEI A;  3KXT A;  1VQK Q;  2LJ0 A;  1TU0 B;  1ZA1 B;  5ECA A;  3A98 A;  3PVQ A;  2GGR A;  2EYQ A;  1WXT A;  2SRC A;  3KBG A;  3M0S A;  5GAN j;  3C94 A;  2VGN A;  1M4Z A;  4RCC A;  3VYG A;  2ESW A;  1T0J A;  3AT1 B;  4E7L A;  4ZGJ B;  2W0Z A;  4NL2 A;  3NTK A;  4M7D A;  2JT4 A;  5DM7 R;  1VQM T;  1ZHI A;  2A7Y A;  2NWM A;  4EMK C;  2WSE E;  1M27 C;  4OMM A;  4ZTF A;  2YUO A;  2VB6 A;  4PJN A;  4C5E A;  3MET A;  2P84 A;  3QBY A;  3VV0 A;  1VQL A;  1RI0 A;  4HKE A;  1Q7Y U;  4NOY A;  2F2V A;  2HCK A;  3LLR A;  3OYY A;  3QSU A;  2VGM A;  4ZN1 A;  3RKX A;  1K8A U;  1VQK A;  4M75 F;  1GRI A;  1T3L A;  5CQX A;  2CP5 A;  2EJG A;  2ROL A;  3UWN A;  1YI2 T;  4Z88 A;  2GF7 A;  2FVU A;  2HMA A;  2O9S A;  3JB9 J;  3OQ5 A;  1I5O B;  1WQ7 A;  4RTT A;  1YN8 A;  2LNH B;  4M7D E;  2NUP B;  2LJ3 A;  2KT1 A;  2K5I A;  3MEA A;  1GFD A;  2E65 A;  1G8X A;  4RTZ A;  4HVV A;  1UFF A;  3OYI A;  1D0X A;  2PNI A;  1M9S A;  5HCK A;  3QXE B;  2FHD A;  3JCM Q;  1PD0 A;  2LQW A;  2D0N A;  2HEQ A;  2GQI A;  1R0B G;  3M58 A;  3GNF B;  1QVF S;  1MMD A;  4Q5W A;  1W2B P;  1KC8 U;  1BI2 A;  1QVF A;  2XU8 A;  2IIM A;  5IT9 E;  5GMK h;  3EG0 A;  2C0O A;  2A0F B;  2M51 A;  3EG9 A;  3OMC A;  5LJ5 d;  2JOY A;  3VS0 A;  4BE2 A;  1VQ6 T;  2E5K A;  1SG5 A;  1ZUK A;  1LJO A;  4B9X A;  3GP8 A;  3QZ9 B;  1AWW A;  1MND A;  2CP2 A;  1CKB A;  2AIR B;  2ZPH B;  4FW2 A;  5LJ3 d;  2KK4 A;  2HBP A;  1QVG S;  1QWE A;  1LNX A;  3S6W A;  3CPW P;  3FJP A;  3QYH B;  4OMO A;  3ZBD A;  1K9A A;  2RB6 A;  2RQT A;  2LTO A;  2RK1 A;  4M77 D;  1OV3 A;  3MHX A;  4YTL A;  1QP3 A;  2CP0 A;  3BFM A;  3A8H B;  2RQR A;  3R6N A;  4HCZ A;  2QDL A;  2X9H A;  4M7A G;  3EGD A;  3V8L A;  3F70 A;  2L3P A;  3CCL T;  2D6F A;  1CSK A;  2EQM A;  1OZ3 A;  3CPF A;  1AD5 A;  3DB3 A;  3CC7 T;  4FYY B;  1N27 A;  1XOV A;  1KK7 A;  2RHX A;  1OYX A;  2DVE A;  2BZY A;  3CME T;  3UDC A;  3A8O B;  4ME7 A;  2RM4 A;  1GCP A;  3QWX X;  1PSF A;  3L2U A;  4C8Q C;  1WJR A;  2O01 E;  3OYK A;  3V8J A;  1PKS A;  1R8O B;  3PMI A;  4IUT A;  4HVU A;  4QVD A;  4CI0 C;  5LL6 S;  1H3Z A;  3OYF A;  3CCS T;  5J26 A;  1RAH B;  1Y07 A;  2OTJ T;  2CT4 A;  2BZ8 A;  2OTL T;  5GMK i;  1UGV A;  4DBF A;  3SD4 A;  1GCQ A;  1VQ8 T;  1QKW A;  2MPX C;  4XTX A;  2GFU A;  2M0Y A;  5KYY A;  3O5Z A;  2LQN A;  1JBM A;  3CCM Q;  1BIA A;  2QEX A;  1A0N B;  2KYB A;  2OAW A;  5HK3 A;  1OU8 A;  2MAM A;  3LGL A;  4MDW A;  4C92 D;  3N5B B;  1KHI A;  1TH7 A;  2M1H A;  3OS5 A;  4IUU A;  3QUI A;  4M7A A;  1M8V A;  2E64 A;  3HKS A;  2KI7 A;  3GIB A;  2OI3 A;  1NE8 A;  1VYV A;  3I5S A;  3VS5 A;  2JVV A;  1J3T A;  4WCI A;  3VRZ A;  2DXB A;  3MO8 A;  4M77 G;  4L59 A;  3H41 A;  3VS4 A;  1RAI B;  1NG2 A;  2FZG B;  4J9C A;  4ZGE B;  2MWO A;  5LJ5 j;  1QQJ A;  3DLL A;  2DRM A;  3E19 A;  4IUV A;  2DK3 A;  1AZG B;  2QTV A;  1OPL A;  1VA7 A;  4E7J A;  1M1K C;  3KFV A;  2RQU A;  3OYL A;  2JTE A;  4MMK A;  3JCM f;  2X3X D;  4PK4 A;  3CCJ Q;  3EG9 B;  1X69 A;  1Q86 C;  5IXB A;  4PJL A;  4M7A E;  5KCO A;  1X6B A;  3EG1 A;  5LJ3 j;  3QII A;  3MEU A;  4JLG A;  1SKU B;  4AFS C;  3PFS A;  3R6O A;  1YBY A;  2KT8 A;  4M75 G;  2X51 A;  2HKQ B;  4PNO A;  1AHJ B;  1LVK A;  3A5Z B;  3BW1 A;  4O5V A;  5CAI A;  2P0P A;  3OSS C;  1UGS B;  2HDA A;  4JRP A;  3QJ6 A;  2DKG A;  3M54 A;  3RMS A;  1KD1 C;  2CP6 A;  2C0I A;  1TXQ A;  1BKB A;  1Q81 R;  4ELZ C;  3FC3 A;  1M90 C;  2KQW A;  3NTH A;  3J81 E;  1QW1 A;  1Q82 C;  2DBK A;  1IGU A;  4HCC A;  2G3R A;  4EDU A;  2LP5 A;  1OX8 A;  4E47 A;  2NUT A;  1I81 A;  4D8K A;  3CCJ A;  5CKE A;  2D8J A;  1BBZ A;  5A2Q E;  4MZT A;  1TWB A;  4C0F A;  4BUG A;  3CCE T;  1IRX A;  1CKA A;  2K5L A;  1SSH A;  3G4S Q;  5KYX A;  2K79 A;  1QP2 A;  2MYS A;  4QQ6 A;  2A08 A;  1UHC A;  2HNI A;  2IG0 A;  2GFA A;  3J80 E;  1HXD A;  4C92 G;  1JJ2 S;  2RQW A;  3M4Y A;  4C5H A;  3CC2 Q;  1D0Y A;  1H8K A;  2O88 A;  2YRV A;  1UDL A;  4CC7 A;  1JJ2 A;  2LCS A;  2VWF A;  3HP9 A;  3VU3 C;  2GQV A;  1AOJ A;  1ZX6 A;  3MPU B;  4X34 A;  2JM8 A;  3VUZ A;  3VUB A;  1YHQ Q;  1PCX A;  2FG0 A;  5GAM d;  3OYM A;  5KYU A;  2EW3 A;  4M75 A;  1UEC A;  2LCL A;  2KRO A;  2FRW A;  2KRN A;  1YIT Q;  4BY6 B;  3NGP A;  3OA6 A;  4M77 E;  4RTW A;  1M2O A;  3I56 T;  1VQ7 T;  2K3B A;  4IIO A;  2VUB A;  2CS7 A;  4XTV A;  2DLP A;  2DL7 A;  3G4S A;  2KE9 A;  3EGU A;  5I21 A;  2C0T A;  2LQ8 A;  1S72 A;  5GAN 6;  4MDX A;  3OYG A;  4J9I A;  3OY9 A;  3S3N A;  5C0M A;  3M4G A;  1NBE B;  2XKO C;  2YDL A;  2FL7 A;  2DRK A;  1PRL C;  2RI2 A;  1W1F A;  4M75 E;  1MHN A;  4ATO A;  2AKL A;  4BDZ A;  2EQI A;  4MML A;  3OYC A;  1U3O A;  1JO8 A;  3EG3 A;  1Y96 B;  2HAX A;  2D0Q B;  5GAN f;  1MGQ A;  3MP6 A;  4N4I A;  1VYT A;  2X4W A;  4HVW A;  3HTR A;  4C92 A;  5HKC A;  1FMK A;  1I0C A;  5CKD A;  1UE9 A;  5J3B A;  2ZCF B;  2LJ1 A;  2XID A;  2G6F X;  3REA B;  1WJS A;  1NLP C;  2FRY A;  4J9G A;  1B34 B;  1NZ9 A;  2NUP A;  3H0I A;  3CCV Q;  4FSX A;  1R77 A;  2X4X A;  3FLG A;  2XK0 A;  3G1J A;  2LNV A;  1N9S A;  3OYJ A;  2GBQ A;  4OF1 A;  1YJW T;  4PLI A;  4A53 A;  3G6E T;  4C8Q D;  4A54 A;  1C0M A;  1YWO A;  2ABL A;  5GAO r;  1FMW A;  1Y7X A;  2JM9 A;  2I0N A;  2DET A;  2V26 A;  1UJY A;  2D8H A;  5GMK m;  5GMK l;  2QTX A;  2QQ9 A;  2QQA A;  4C92 E;  1V29 B;  3V7S A;  1VQ4 T;  2PZ1 A;  1LOJ A;  2D1X A;  4BI4 A;  2MCN A;  5IHN A;  1WA7 A;  3JCM e;  1ZSZ B;  2DTO A;  3NPF A;  4XTY A;  4AG2 C;  4M78 C;  1G5V A;  4BB7 A;  2ROT A;  3JCM g;  4J6W A;  3PVL A;  3VS1 A;  5KH6 A;  1V1C A;  1AWO A;  2HQE A;  3CCV A;  4EMK A;  1NM7 A;  1VQM Q;  4RTU A;  3M0P A;  4HA8 A;  2K5F A;  3CD6 A;  4A63 B;  2EKO A;  4E6R A;  1T3S A;  2KRM A;  1N8R C;  2VXE A;  3JCM J;  2PUO B;  1PM3 A;  2E6N A;  4X1V A;  2KNB B;  3HRU A;  2ED0 A;  4FL6 A;  4M77 B;  5KYX B;  1UB4 A;  3A8M B;  4J9F A;  1UEB A;  5GAM j;  8AT1 B;  1BI3 A;  1RAF B;  1M1K U;  1TSF A;  1YP5 A;  2H3J A;  2HQH A;  3M9Q A;  2DVJ A;  1G2B A;  1IO6 A;  2J6F A;  1JU5 C;  2H8H A;  2GNC A;  1YI2 Q;  1Z9Z A;  1G3S A;  5C6S A;  2F69 A;  1Q86 U;  4ANJ A;  1JXO A;  2SEM A;  4LE9 A;  3RKW A;  1XJW B;  3BDL A;  3PIO A;  2DM1 A;  3OYB A;  2DF6 A;  3P8H A;  1OEB A;  1VQM A;  4KGX B;  2LCC A;  3MP1 A;  3G7Z A;  1M1G A;  2CDT A;  3Q1J A;  4RTX A;  2DAQ A;  3M56 A;  2RJE A;  4ESR A;  1HK9 A;  3MCA B;  2DE0 X;  1KQS P;  1KD1 U;  5D6Y A;  1PSE A;  3HRS A;  4QVZ A;  1RAC B;  1MV0 B;  1D09 B;  4M77 F;  2LMJ A;  1SRL A;  1XQH A;  1WJQ A;  1M90 U;  1TOV A;  4C8Q G;  3CQT A;  1Q82 U;  1TS9 A;  4M78 B;  3J7A F;  4LDW A;  4LDY A;  4MZP A;  1WHK A;  2DBM A;  1GBR A;  3I9Q A;  4OVA A;  1YI2 A;  4DOV A;  1E6H A;  1X6O A;  1VQ6 Q;  1QWF A;  3OBY A;  4FSS A;  1D1B A;  2F2X A;  3MJX A;  2GTO A;  3L1A A;  5GAM e;  3M0R A;  1YCS B;  3HHT B;  1PG5 B;  1D3B B;  2A36 A;  1HSQ A;  2XDP A;  1BIB A;  3UT1 A;  4C92 B;  4XTU A;  1KHC A;  1HJD A;  4FM4 B;  4JS4 A;  4FYW B;  5M9O A;  5IN1 A;  2V1Q A;  3JB9 D;  1SEM A;  3EHR A;  4LD6 A;  1RAB B;  3SWN C;  4R0K A;  2KSS A;  3V7R A;  2CKK A;  1NJI C;  3ZEH A;  5GAN e;  2EGE A;  3RMQ A;  4A4G A;  3TSZ A;  3NTI A;  4M78 F;  4XU3 A;  5GAN g;  1VQL T;  1SRM A;  2J06 A;  3CCL Q;  2CZ6 B;  4C0G A;  2EQU A;  2O4X B;  3CC7 Q;  5CQY A;  3JV3 A;  2QQR A;  1K76 A;  3ER0 A;  3VS7 A;  1M2V A;  3CME Q;  1M8M A;  2KXC A;  3PT9 A;  4F16 A;  4LN2 A;  2QG9 B;  4C0Z A;  5FRN A;  1D1C A;  4C92 F;  3RKY A;  5GMK j;  5CKH A;  4J6Y A;  2HBW A;  2B86 A;  4KUI A;  3EFR A;  4HCB A;  2E5Q A;  2DIG A;  4FW1 A;  3CCS Q;  4DQ2 A;  3V7C A;  4C5G A;  4EMK B;  1YWP A;  2OTJ Q;  2OTL Q;  2V8J A;  3RIR A;  5FRM A;  3NHN A;  4DBH A;  1ZBX A;  1U8R A;  2HQX A;  2NLU A;  2AHJ B;  1RUW A;  2RI3 A;  4QW2 A;  4BDY A;  1VQ8 Q;  4JJC A;  1AVZ C;  5LJ5 f;  4XAX B;  4KUL A;  4RTY A;  1SF9 A;  1YFN A;  2V1R A;  2DXU A;  4A4E A;  4R55 A;  4AFQ C;  1JJ2 P;  3I5R A;  3OYH A;  2I2L A;  4C8Q E;  2ED1 A;  1SHF A;  4X9C A;  3TRE A;  5LJ3 f;  1O75 A;  5FRO A;  1IHW A;  2KMT A;  2QA4 T;  3QDR B;  4NL3 A;  4N4H A;  4BE1 A;  3SWN B;  4QT7 A;  1M3A A;  1BI0 A;  4B9W A;  3LH5 A;  1Z9Q A;  1AZE A;  1K73 R;  4F7U B;  4FU6 A;  3JB9 I;  1I4K 1;  3O8V A;  1Y57 A;  2YRD A;  1UGP B;  2H3E B;  3EH2 A;  5GMK e;  1W4S A;  1RAD B;  2XIC A;  1YIJ T;  2WSC E;  2Y4Y A;  1WHH A;  3P8B B;  4Z02 A;  3UF4 A;  2XD0 A;  2D9T A;  1YJ9 T;  4ZGD B;  2ZAE A;  6AT1 B;  4OMF B;  1X27 A;  2KVQ G;  1QKX A;  1TUC A;  4M78 D;  1VQO T;  1N8R U;  3OSV A;  2LT1 A;  4V2S A;  4CC2 A;  2YHT A;  2AZV A;  2YXY A;  3JCM c;  1K9M R;  1H64 1;  1G3Y A;  1HYO A;  1KQS S;  4D8D A;  2HSE B;  1KQS A;  1PD1 A;  4F7U F;  3I35 A;  3T9N A;  4KH0 B;  5L8R E;  2MK5 A;  1OI1 A;  4AFZ C;  3CMA T;  3EGX A;  4E7K A;  4FCY A;  3CC4 T;  1RI9 A;  2MMP A;  3RUX A;  1ARK A;  1Y71 A;  2KEA A;  3ME9 A;  3E9F A;  1ACM B;  4E7S A;  2XG8 D;  4LDX A;  2DA9 A;  1OPK A;  1Y96 A;  1X6G A;  2A28 A;  4P5N A;  1VQ5 T;  3X28 B;  1M5Q 1;  2K9G A;  4ZNX A;  3VRY A;  3CBO A;  3VS3 A;  3UA7 A;  3MEW A;  1ZUY A;  3CCE Q;  2PTK A;  5AYF A;  4PL6 A;  1RAE B;  3RNJ A;  1VQP T;  2EPD A;  3SFM A;  5DLQ E;  1B34 A;  3EH1 A;  5KE2 A;  2QEX T;  1Q7Y R;  3CBM A;  3QZ5 B;  5FWB A;  3CCM A;  3DLM A;  4PJO D;  4GLK A;  2HZY A;  4OGE A;  5HY6 A;  1K8A R;  1M2V B;  2A37 A;  4CC4 B;  1FWZ A;  2BE7 D;  2JS0 A;  4FT2 A;  2KAF A;  4C8Q B;  3UPU A;  5GAN 3;  1UUE A;  4OP0 A;  1WQW A;  1VQN T;  4IKF A;  4BD3 A;  4LXC A;  4JZ3 A;  1K1Z A;  3THK A;  1I07 A;  2J6K A;  2DTI A;  5D6W A;  2L89 A;  5KYW B;  3S3M A;  1FMV A;  2EGC A;  1JB0 E;  2ZZD A;  2DEU A;  3HSB A;  4OB3 B;  4IUR A;  1ZSZ A;  3I56 Q;  2JMC A;  3OMG A;  1VQ7 Q;  4OB0 B;  1BYM A;  4GBQ A;  1G3T A;  3U23 A;  3RER A;  2K3X A;  1WIE A;  3FJ5 A;  4QVC A;  5FU6 C;  1WZO A;  4M78 G;  1ZQ1 A;  1KC8 R;  2E3I A;  3UA6 A;  5GAO m;  1NJI U;  1YJN T;  3WVE B;  1KSW A;  3UAT A;  2QDY B;  5GAN 4;  1E6G A;  3M0U A;  4C8Q F;  5LJ5 e;  1NEB A;  1EZZ B;  2MI6 A;  2RNA A;  4D6W A;  4M77 A;  3CEY A;  4R56 A;  3FB9 A;  5LJ5 g;  4ZTJ A;  3PTA A;  3CCR T;  4XU1 A;  3M55 A;  2ATC B;  5AT1 B;  2XHC A;  3CBP A;  5LJ3 e;  2AKK A;  1VQ9 T;  3EFO B;  2J05 A;  4QQD A;  4DEX A;  1EIF A;  1JXM A;  5LJ3 g;  1VQ7 A;  3WVD B;  4RCB A;  2PVD B;  2RHI A;  1WYX A;  1KQ2 A;  3L42 A;  1ZA2 B;  3BY7 A;  2DL3 A;  4KUD K;  2E1H A;  2FZK B;  1FYN A;  4JS5 A;  2YLC A;  2F1L A;  1KIK A;  2RA2 A;  1H3H A;  2EJF A;  4ZN3 A;  1YJW Q;  5HK0 A;  2CT3 A;  1KQ1 A;  3GBQ A;  3G6E Q;  4LUD A;  1OU9 A;  2DZC A;  3LX7 A;  3HPW A;  1V76 A;  1M30 A;  2EQJ A;  3ZFJ A;  5GAM f;  3GNG A;  4RKU E;  1LPL A;  5IXF A;  1WHL A;  2P0K A;  1MV3 A;  3CXC P;  4EPC A;  4LUE A;  1VQ4 Q;  2EWN A;  4M7D D;  1OZ2 A;  2DFU A;  2RPN A;  2QXF A;  2MF2 A;  4M78 A;  2M02 A;  3CC2 A;  3C95 A;  3M0T A;  5GJW B;  1I1J A;  3EGX B;  2GCX A;  4LNP A;  4HCK A;  4BAC A;  1PWT A;  2ZGW A;  2OX7 A;  1Q81 C;  4EIK A;  5L23 A;  2EAY A;  2X4Y A;  2ZPB B;  1YHQ A;  3HRT A;  2R5M A;  3JCM h;  1QCO A;  4RG2 A;  1N9R A;  1D3B A;  2E12 A;  1RAA B;  2E41 A;  2E10 A;  4F14 A;  4JRQ A;  2RQV A;  1YIT A;  3REB B;  2K2V A;  2CGH A;  2B8A A;  1BB9 A;  3C12 A;  2ZPG B;  3OYA A;  2WAC A;  3E1S A;  4M78 E;  4XTZ A;  1S72 T;  1C6V X;  1MMA A;  2GTJ A;  1VOM A;  1VQ4 A;  1WLP B;  2F5T X;  1ABQ A;  2EVR A;  1D1A A;  4RTV A;  4J9E A;  4XQ3 A;  1KJW A;  4F7U G;  3MKD A;  3QPH A;  3MP8 A;  4GY5 A;  3LWH A;  3OBW A;  2FB7 A;  5KE3 A;  4FT4 A;  2O4X A;  1F1B B;  2QK0 A;  3MEV A;  4JRI A;  1BI1 A;  4KGV B;  1B3Q A;  4HT8 A;  1N6A A;  2J6O A;  2BZX A;  4WTO B;  2E3H A;  1VIE A;  1ZBJ A;  5CO7 A;  1G83 A;  2FZC B;  3A1P A;  3L2W A;  2FPF A;  5IH2 A;  1JQQ A;  3C4S A;  3QJY A;  5FU7 C;  1UHF A;  3JCM X;  3G71 T;  3VYH B;  2DXC A;  3JB9 F;  4WF2 A;  3FEO A;  1W70 A;  4JRK A;  3ASK A;  1OOT A;  3M53 A;  2FPE A;  3X24 B;  4PFO A;  4F17 A;  1M3B A;  4OML A;  1WHJ A;  3CCQ T;  1EFN A;  2RJD A;  3CCU T;  2VXF A;  4N0A C;  1UTI A;  2DJZ A;  2RHZ A;  4PJO E;  1N5Z A;  2F5K A;  1DJ7 B;  5GAO n;  1WXB A;  3M57 A;  4JJN K;  4BE0 A;  3INZ A;  4PJJ A;  3JCM V;  3RBB B;  4Z8A A;  3E2U A;  5GAN 5;  3HL8 A;  4J6X A;  3LWI A;  4B6M A;  3JAM E;  2NUZ A;  1O9S A;  5CVI A;  3SWN A;  2O9V A;  2P4R A;  2KDS A;  4JUV A;  4J9H A;  4N4G A;  3I55 T;  5FLX E;  4F7U A;  2JS2 A;  2OJ2 A;  2FPD A;  3SEM A;  3CD6 T;  1NEG A;  1NLO C;  4PJO C;  2DYB A;  2V8I A;  1IXD A;  2RJF A;  4XK8 E;  3QYG B;  3RR6 A;  4Z89 A;  1VQL Q;  2CUB A;  2VV5 A;  2JTF A;  1R0C B;  5D6X A;  1SHG A;  1WGS A;  2K7A A;  4DEY A;  3EHQ A;  1FX7 A;  2K3Y A;  1TUD A;  1WFW A;  2QAZ A;  2RMO A;  2JZ2 A;  1PRM C;  3JB9 H;  1QMC A;  1VUB A;  5FU7 B;  1JEG A;  3OYN A;  3JRZ A;  1WHM A;  1OX9 A;  4F7U E;  2DL5 A;  1WXU A;  2O2O A;  3C0C A;  2EGA A;  4J8O A;  2P4T A;  4JJB A;  8ATC B;  2JXB A;  3OS0 A;  2CP7 A;  2RI5 A;  3IQL A;  5GAM g;  2VAS A;  1WDX A;  3CXC S;  1GFC A;  4QKU A;  5GAN 2;  3S3O A;  1EX4 A;  3OS1 A;  1XNI A;  2BIV A;  1WPY A;  5FW9 A;  3CXC A;  2BKD N;  4E7I A;  4PKC C;  5KYN A;  2XDD A;  4DBQ A;  2LVM A;  2DX1 A;  3QO3 A;  2CZ1 B;  2PU9 B;  4M7A D;  2LQK A;  3M5A A;  2YT6 A;  3VJP A;  5DLO A;  2JJ9 A;  2CYZ B;  4Y28 E;  2L3S A;  4KH1 B;  2Y90 A;  2QA4 Q;  4KRT A;  1OUL A;  1HD3 A;  4J5Y A;  1VQ6 A;  2ZPF B;  4JPB W;  2DD4 A;  3ULR B;  3LYI A;  2EIF A;  5IHI A;  1MNE A;  4PJO B;  2CZ7 B;  1NPR A;  1VQK T;  2XDB A;  2AZS A;  1QCF A;  1WI7 A;  2QGG A;  2CP3 A;  3QKJ A;  4MZM A;  2HD0 A;  1IZ6 A;  4C5I A;  4C8Q A;  1YIJ Q;  1Y0M A;  1RAG B;  1K4U S;  1XTD A;  3GF5 A;  5GAO p;  2CH4 W;  1Q81 U;  2BE9 B;  1YJ9 Q;  2YSQ A;  2KYM A;  2EYY A;  2CSI A;  1I8F A;  1RLP C;  4E7H A;  4JDS A;  3H0F A;  2RO0 A;  4J9D A;  4RUG A;  5KYW A;  3QHS A;  1BCM A;  4M7D C;  2KY9 A;  2F2W A;  1VQO Q;  2QA4 A;  1AT1 B;  1NYG A;  1Q95 G;  1X75 C;  2DXT A;  2RD1 A;  3LW5 E;  4OGC A;  3CCL A;  2R57 A;  2EYX A;  2HL3 A;  4PFZ A;  2E6Z A;  3GOX A;  3M59 A;  3CC7 A;  2PUK B;  4Y92 A;  4PJO F;  2YWW A;  2AT1 B;  1BK2 A;  2JW4 A;  3CME A;  5CK9 A;  3X26 B;  5CIU A;  3CMA Q;  1FXX A;  2COY A;  1QVG A;  2DER A;  3H9N A;  3CC4 Q;  1YIJ A;  3TEE A;  2QAS A;  2RK2 A;  4E7Z A;  1YJ9 A;  2K57 A;  1UJ0 A;  3HFN A;  3CCS A;  1VQ5 Q;  4AFU C;  2OTJ A;  2CUD A;  2L3Q A;  2OTL A;  2EYZ A;  4J7I A;  5A0L A;  3EFO A;  3H8Z A;  4HT9 A;  1VQO A;  3JB9 G;  1VQ8 A;  5GAN 7;  2DPP B;  2DL4 A;  5A0G A;  1VQP Q;  3VS6 A;  1NYF A;  1OQK A;  4II1 A;  2LX7 A;  2P0Q A;  2QEX Q;  4X9D A;  5KCH A;  5I2M A;  4M75 D;  1M1K R;  2PVG B;  2YRC A;  3PGG A;  3A8G B;  3CMA A;  2E4H A;  4RG8 A;  3URG A;  2MIO A;  2KBT A;  1Q86 R;  3CC4 A;  1VQN Q;  4DOW A;  2Z0W A;  2PVO B;  3DB4 A;  4IUQ A;  4RMO A;  4F04 B;  4M7D B;  2X4J A;  2M16 A;  3GLX A;  3LH0 A;  1VQ5 A;  2ECZ A;  1AWJ A;  2LT4 A;  2LDM A;  5CKB A;  4FYV B;  1IHV A;  3L2R A;  3EFS A;  3DKM A;  1D0Z A;  1VQP A;  4Y91 A;  3GPL A;  1KD1 R;  2AK5 A;  2DYI A;  2VVK A;  4AG1 C;  2C06 A;  3EG2 A;  3LGF A;  3OW2 P;  1WHG A;  1K0S A;  2L2P A;  2X35 A;  1PC0 A;  2XMF A;  1M90 R;  2CSQ A;  2QGF B;  1Q82 R;  4PJM A;  2LRQ A;  3WXM B;  1YJN Q;  4XU0 A;  2W10 A;  2KR3 A;  4ELY C;  1M3C A;  2EJ9 A;  5IHK A;  2JNG A;  5FWC A;  4BI3 A;  2Y4X A;  3SHW A;  1K73 C;  1VQN A;  2L0A A;  2NYS A;  1YCY A;  1X01 A;  2HKN A;  2KXD A;  1U1T A;  3CCR Q;  3HFO A;  4EMG A;  3OYD A;  1X2K A;  4M7D F;  3A8L B;  5LJ5 h;  3JCM d;  1VQ9 Q;  2DZ9 A;  2DTH A;  1IRE B;  4CC3 A;  1X43 A;  1QCN A;  2DNU A;  4KGZ B;  4LDU A;  4JLI A;  2KGT A;  3FDR A;  5LJ3 h;  2QQS A;  2L3R A;  1MMG A;  3OS2 A;  1KFZ A;  4A4H A;  4L5G A;  2LC4 A;  1W6X A;  2VC8 A;  5GAO q;  4OB1 B;  1YJN A;  1BCO A;  1JRI A;  2DD5 A;  2RHY A;  4J9B A;  1K9M C;  3SB2 A;  4BY6 C;  3CCE A;  1GCQ C;  3RES A;  3QG1 A;  3CCM T;  2RH2 A;  3CCR A;  2V8K A;  5EG2 A;  5J39 A;  1W2B S;  3FIF A;  5GAO l;  1SPK A;  1W2B A;  1VQ9 A;  4A4F A;  3V8K A;  2RJC A;  2YUP A;  4PLL A;  4VUB A;  1K0X A;  3BE3 A;  1IB8 A;  3VKI A;  2WSF E;  3D7S B;  4KT0 E;  1ZSG A;  1S1N A;  1SSF A;  1B07 A;  4M7A C;  1H92 A;  5IAY A;  5I2S A;  3VS2 A;  2BUD A;  2CH4 A;  1G3W A;  3EGD B;  2CZ0 B;  3TVT A;  4A4K A;  3I56 A;  2RHU A;  2DIL A;  1Q7Y C;  2JUF A;  2MWP A;  3CPW S;  3PMT A;  3CPW A;  1S72 Q;  3AHU A;  1K8A C;  2COZ A;  1RL2 A;  3PIP A;  2ENM A;  3H0H A;  4LDV A;  3CCJ T;  5DY9 A;  4QQG A;  1PHT A;  1UGR B;  2QYZ A;  7AT1 B;  4J83 A;  4PJO G;  4CRI A;  1TG0 A;  3TCJ A;  2VYT A;  1VIF A;  1KG1 A;  2CRE A;  4BI8 B;  1B7T A;  4EMH A;  2HSP A;  4JJD A;  1UG1 A;  2DEQ A;  2XI9 A;  1M1F A;  4L6V 5;  1E7O A;  2JMA A;  2IVW A;  3JCM b;  2A3L A;  1ZSZ C;  5FU6 B;  5KYY B;  3G71 Q;  4OMP A;  1U5S A;  1KC8 C;  1TTH B;  3KUF A;  4TVR A;  4C0D C;  4XU2 A;  4LD9 K;  2L8D A;  2K2M A;  3TSW A;  2X3W D;  5A0D A;  1GL5 A;  4JZ4 A;  1AWX A;  4GLM A;  2O31 A;  5GAN d;  4N0A A;  3CCQ Q;  3M0Q A;  2OAU A;  4AMC A;  1YJW A;  3CCU Q;  3L2Z A;  1C1A A;  4XTW A;  2R58 A;  3G6E A;  1N8R R;  1ZLM A;  4OMQ A;  4M7A B;  2EBP A;  3G4S T;  1QVP A;  2YUQ A;  5CKF A;  2YUN A;  3QDF A;  3JSC A;  2DO3 A;  1TUG B;  4M77 C;  4E2F B;  1GBQ A;  4NS5 A;  2ZPE B;  2QI2 A;  3CC2 T;  1U06 A;  3PNW C;  2YLB A;  3OW2 S;  2EFI A;  3NFC A;  3OW2 A;  1I5L A;  1QVF P;  3H6Z A;  3OB9 A;  4FIB A;  4K11 A;  4ORZ A;  1YHQ T;  3JCM W;  3I55 Q;  4PFP A;  3E9G A;  3G71 A;  1ZUU A;  2LX9 A;  4PJO A;  4O6J A;  3X25 B;  1GXI E;  3CD6 Q;  2EYW A;  1T0H A;  2E70 A;  1NPP A;  4M75 C;  1YIT T;  3CCQ A;  1U1S A;  2DL8 A;  3CCU A;  2ZPI B;  4DA4 A;  2DIQ A;  2J7I A;  2JTM A;  4HXJ A;  2FO0 A;  4OB2 B;  2COW A;  2PQW A;  2QQB A;  1RLQ C;  1LCK A;  4M7A F;  5D7U A;  1VYU A;  3JCM P;  1QVG P;  4OMN A;  1PKT A;  1MUZ A;  1PNJ A;  5CR2 A;  3X20 B;  5CCA A;  2K6D A;  2VKN A;  1IGQ A;  9ATC B;  2DMO A;  1UGQ B;  3P8D A;  2RN8 A;  4C0D B;  3NMZ C;  3QWY A;  1K73 U;  3TU4 K;  4M7D G;  3L2Q A; 
#chains in the Genus database with same CATH homology
 3I55 Q;  1VQK Q;  3G71 Q;  3CME Q;  3CCV Q;  1YHQ Q;  3CCE Q;  3CMA Q;  3G4S Q;  1VQM Q;  1VQO Q;  1QVG P;  1Q86 R;  1VQ8 Q;  3CC4 Q;  2QA4 Q;  1VQN Q;  3CXC P;  1Q81 R;  3CD6 Q;  3CPW P;  1YIJ Q;  1S72 Q;  1VQP Q;  1K9M R;  1VQ4 Q;  1KD1 R;  1Q7Y R;  1NJI R;  3CCR Q;  1YI2 Q;  1VQ6 Q;  1KC8 R;  2QEX Q;  3CCL Q;  3CCM Q;  3CCQ Q;  1VQL Q;  3CC2 Q;  1YIT Q;  1K73 R;  1YJW Q;  1KQS P;  3OW2 P;  1YJ9 Q;  3CCU Q;  1JJ2 P;  1QVF P;  3G6E Q;  1K8A R;  1M90 R;  3CCS Q;  1W2B P;  3CC7 Q;  1N8R R;  1Q82 R;  3CCJ Q;  1VQ5 Q;  1VQ9 Q;  1YJN Q;  2OTJ Q;  2OTL Q;  3I56 Q;  1M1K R;  1VQ7 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...