1VQ6Q

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq6Q00
1Q82R 1YI2Q 1K8AR 1VQ4Q 1YHQQ 1M90R 1Q81R 1VQ8Q 3CC4Q 3CPWP 1VQOQ 3CMEQ 3CXCP 1VQ7Q 1W2BP 3CCSQ 3G6EQ 1KC8R 1VQMQ 3CC2Q 3I55Q 1QVFP 1YIJQ 1YITQ 1Q86R 1VQLQ 1K9MR 3OW2P 3G71Q 3CCRQ 2QA4Q 1VQ6Q 1QVGP 1VQNQ 3CD6Q 1N8RR 3G4SQ 1YJWQ 1KD1R 3CCUQ 1KQSP 1VQ5Q 1K73R 2OTLQ 3I56Q 1S72Q 1M1KR 1NJIR 3CCEQ 3CMAQ 3CC7Q 1YJ9Q 3CCMQ 1VQKQ 1VQPQ 3CCVQ 2QEXQ 1VQ9Q 3CCLQ 1YJNQ 1Q7YR 1JJ2P 3CCQQ 2OTJQ 3CCJQ
chains in the Genus database with same CATH superfamily
5GAMj 4XU0A 3M0RA 2DE0X 4M77B 3G71A 1WQ7A 3EG9B 3CCLT 4A4FA 3H0HA 4BE2A 2YUPA 3RR6A 1B34B 3VUBA 3UATA 4X9CA 1U06A 2HD0A 3I56A 1M3AA 1Y07A 3QJ6A 5I11A 1VQKQ 3CCRT 1AVZC 5GMKj 4OGEA 9ATCB 4R56A 2F5KA 2LNVA 1YIJA 5IN1A 2MWPA 4E47A 4HCBA 2PUKB 1UECA 5IXBA 2AIRB 2L5QA 2Z0WA 1UJ0A 1SKUB 2ZPBB 1H3ZA 2CREA 4F17A 1KQSS 3EG1A 4K11A 2CKKA 2AZVA 2V1RA 3JCMc 5HY6A 3CCJQ 2A36A 4KGVB 5GMKl 1CSKA 2DD5A 5L8RE 3UA6A 2QQ9A 1VQ9T 2QEXT 2XDBA 3OA6A 2CH4A 1BB9A 4ZN1A 4X9DA 1QVGS 2DF6A 3HKSA 4M4ZA 2L8DA 4M7AA 4IIOA 3TEEA 5A0DA 3HL8A 1KIKA 1K8AR 2LQNA 1MUZA 3QKJA 1WXUA 1VQLA 2CP3A 1GFDA 1KD1C 4II1A 1FYNA 1IREB 1YCSB 1VQ5A 3QDRB 4JRPA 3M5AA 2V8KA 2CUDA 1T3LA 3WVEB 1G83A 2CSIA 3BDLA 1UFFA 4UC4A 4JZ4A 1LVKA 4MZMA 1C1AA 1MV0B 3VRZA 3SEMA 2BZ8A 4LUDA 2W10A 1WHJA 3UWNA 1XOVA 3ME9A 5KYYA 1G2BA 1BKBA 4A4EA 1YITQ 3G1JA 2MYSA 5A0GA 4DBQA 4OMOA 2CP6A 2W0ZA 2HSPA 3C94A 3OS0A 3CC4A 1N5ZA 5GAN5 1FX7A 3EH2A 3FDRA 2AHJB 4F7UB 2EYQA 1T0HA 2CT3A 1W2BP 3CPWS 2GGRA 2WSFE 1VIEA 3EAEA 3RERA 1ZSZB 5KYUA 4NOYA 2KR3A 1O75A 2BE7D 2BZYA 1X75C 2DK3A 3MPUB 1RAAB 4M77D 4M75C 1JXMA 4PLIA 3J81E 1Q81R 4CRIA 3PVLA 2X3XD 1GXIE 2L3PA 1R0CB 3M9QA 3MCAB 2DL5A 5CVIA 4CC7A 1R77A 3GP8A 4OB1B 3E2UA 2IIMA 4YTLA 1ZHIA 4ZN3A 2DXTA 4MDWA 1HYOA 1PKSA 5GMKh 4J9DA 1G3SA 4HVVA 5GANg 4C0GA 1HSQA 1NLOC 1ZUKA 3JCMP 1Y7XA 3RMSA 2CP2A 4EMGA 3L2QA 1JU5C 4JUVA 1BU1A 1UGSB 3UF4A 2RQRA 1K9MU 4C8QA 4JRIA 3CD6Q 1LNXA 2X51A 1LPLA 1YI2A 4LD9K 3X28B 1VQPQ 1UB4A 2IG0A 2GQIA 1ZSGA 3SWNC 3V7SA 2MK5A 3PMIA 3CCET 4ZTJA 4F7UF 2J7IA 2YT6A 1KC8U 2XK0A 4JLGA 2EVRA 2RF0A 4FW1A 3OYAA 4M7DG 3CMET 2Y90A 1ZBJA 4A63B 3TSZA 3G71T 3TREA 3HFOA 3RESA 4QQDA 1D0ZA 2NYSA 3EH1A 2HMAA 3KBGA 1YFNA 3JCMX 4M75G 3FEOA 5CKDA 2MIOA 3H0FA 3I56T 4J9GA 1VYVA 3CMAA 4OMLA 2JM8A 1G8XA 1WLPB 4J9HA 1OYXA 1YJ9Q 2NLUA 1M1FA 1YIJT 2D1XA 1VQOA 2EYYA 4QW2A 2DX1A 2XU8A 2LCLA 4ANJA 1JRIA 3E1SA 4KH1B 1UUEA 3M56A 1JO8A 2JVVA 2JTMA 3CBPA 1P92A 3H6ZA 5LJ5d 1UTIA 2NWMA 2HKQB 2VYTA 5GANj 4RTXA 1NYFA 1C6VX 4C5EA 2RJFA 5CK9A 5J39A 3AHUA 2KXCA 4M7AC 1MMDA 2F1LA 2ZGWA 3A8OB 1PD1A 3NMZC 2Y4XA 1VQMQ 2RJDA 4AG2C 2RI3A 1H3HA 2CZ0B 3CC7A 3M54A 4HCZA 2HBWA 3MEVA 3E9FA 1X2QA 1BI2A 1FXXA 1OX9A 1M2VA 2R58A 2K9GA 2XG8D 1VQLT 5KH6A 5IHNA 3TSWA 1VQ5T 3PGGA 3PE0A 2LT4A 3OB9A 2RO0A 4ELZC 4E2FB 1S72A 2C0IA 1K0SA 2JMAA 2AKKA 2KI7A 3V8JA 2AT1B 3WVDB 1ZUUA 4AFUC 2LJ1A 1JJ2S 3M58A 1QKXA 1M90R 3D7SB 3ULRB 1IGQA 1K9MC 1BI0A 1AHJB 2EQMA 4JRKA 2KRMA 3HPWA 2E4HA 4DBRA 1AWJA 4E7SA 4A54A 2RQTA 2DAQA 2FZKB 3INZA 3CC4T 2QGGA 4DQ2A 2X4JA 1K76A 2OTJA 1GCQA 2EBPA 4RG2A 4OMNA 4GLMA 1QP2A 1QLYA 1KC8C 4BD3A 4M7AG 5DM7R 2D9TA 3A8GB 2LJ0A 3JCMQ 3S6WA 1XQHA 2DL8A 5GMKe 1RACB 2XDPA 3FJPA 4MZTA 4E7JA 4F7UE 2L89A 2SRCA 3DKMA 1RI9A 4XTZA 5D6YA 3ZBDA 3JCMd 3HFNA 4M75B 4KRTA 2DD4A 4J8OA 2BUDA 3HP9A 2LZ6B 2DBMA 3OY9A 4IKFA 5FWBA 3V7RA 2RI2A 3CEYA 1N9SA 1TG0A 3VUZA 1FWZA 4KT0E 1G3YA 4JPBW 4QKUA 2AKLA 2CZ7B 4B9WA 1Q86R 5CKHA 1VQNQ 2V8JA 5GMKm 2RB6A 1WJRA 1H92A 1M3BA 1MMNA 3VU3C 2RJCA 2H3EB 2QTXA 2HDAA 4BI4A 4ME7A 1I1JA 2CH4W 2HNIA 4FM4B 3J80E 4OMQA 2IPOB 1YI2T 4C5IA 1K4US 1VQ6Q 2ECZA 1VQKA 2PU9B 2FVUA 3X20B 2VGMA 1JJ2A 3SWNB 1W70A 2ENMA 1Z9ZA 4B6MA 1TUCA 2DKGA 5GAOr 3IQLA 1BI1A 2RQWA 1X01A 4HCKA 3VYGA 2M16A 4BB7A 5GMKi 3CCSQ 3UPUA 4M7DF 3L2RA 1AZEA 1Y96A 1V1CA 4IURA 3TQ7P 3H8ZA 1VYUA 3VS4A 3GOXA 3C0CA 2YUNA 2DRMA 3I5RA 3RKWA 2K7AA 1ZQ1A 4M75F 1M8VA 2OAUA 3A8LB 2DVEA 3CMAT 4ATOA 3VS0A 1D1CA 2A28A 3CXCS 3VS2A 3QSUA 1D3BA 3JRZA 1VQOT 1SHFA 3LH0A 4C8QG 4FW2A 1TH7A 1WI7A 1PHTA 4RG8A 2KEAA 4OMPA 5GAN4 3HTRA 3CCLQ 1SSHA 1Q7YR 2EJGA 2EQJA 2YRCA 2O9SA 1N9RA 4MDXA 1EFNA 2DO3A 3TVTA 3X24B 3CBMA 2KVQG 2OI3A 4RKUE 4EMKA 3OYKA 2DRKA 1M3CA 5HKCA 1QVFP 2P0KA 1OPLA 1YJWQ 4M7AB 2K6DA 3OYMA 1W4SA 4HA8A 2O4XB 2LRQA 3MKDA 4CC2A 2HKNA 5EG2A 2ED1A 4OMMA 3OYDA 4JDSA 1YITA 3CC7T 1M5Q1 2E12A 2KYMA 4GLKA 4J9CA 2RPNA 1SPKA 1AT1B 2EAYA 2WSEE 1X6BA 4X1VA 2RI5A 5LJ5g 2K5IA 4A53A 1M2OA 1M30A 2DM1A 4Z88A 2DNUA 4M75D 4C0FA 1M1GA 4C0ZA 2QEXQ 2FYKA 1KK7A 1W1FA 2QGFB 1Q81U 4RTTA 3G7ZA 3THKA 1WQWA 4FYWB 4C92A 2YLCA 1S72T 2DLPA 2QASA 4Y92A 2KYBA 3I9QA 1N8RR 3JB9J 1R8OB 1PCXA 2EYWA 2DTOA 4OP0A 2JMCA 3EG0A 2YSQA 3CXCA 2JJ9A 1IB8A 2X9HA 3UDCA 2P0PA 1QWFA 1TXQA 2OTJT 1QWEA 5KYUB 3JCMW 4J6YA 2KMTA 1NJIR 4M7AF 4J9FA 3MP6A 3L1AA 4BACA 1PM3A 3NPFA 1RI0A 1TSFA 2PQWA 3MP1A 4AG1C 3CD6A 1LJOA 5LJ3h 5J3BA 3OS2A 3MEAA 1VQPA 1MV3A 1NEGA 4M7DE 1WHMA 3SDZA 1WHGA 1MGQA 4FIBA 2R57A 2GNCA 1UDLA 1AWXA 1VQ8Q 2EW3A 3SD4A 4C5GA 5LJ5j 2YUQA 1I8FA 2K2VA 2K3XA 2FO0A 5CKBA 4M75E 4C8QB 5C0MA 4PFZA 4X34A 2A7YA 2HQHA 2DL7A 3CCVA 2CP0A 2DJZA 3EFRA 3OSSC 4JS5A 2ATCB 1KQ1A 4GBQA 1WFWA 3JCMb 2ZCFB 2HEQA 2LX9A 3JCMg 4KGZB 1QQJA 1NG2A 1VQKT 2K3BA 4EIKA 2K2MA 2PTKA 3DB3A 1BBZA 2QAZA 2R5AA 1YJ9A 1ZX6A 3H0IA 4M7AD 1EX4A 5KYXA 2EKOA 1KQSP 1BIBA 2C06A 4N4GA 4N0AA 1Q82R 4BDYA 3HRTA 2DZCA 5GAN3 4M77A 1R0BG 4J6XA 3A8HB 3RBBB 1GBQA 2RQVA 3EG9A 4M7DC 2BIVA 4D8DA 2D8HA 2E1HA 1QVGP 1YNZA 3CCUQ 4J7FA 3DLMA 2QG9B 4KUIA 1Q81C 3RUXA 4ZGJB 4AFSC 1I81A 1X69A 2MF2A 5LJ3f 1GFCA 5GAMh 2D0QB 2QDLA 5L23A 3QO3A 4XTVA 2RQUA 1VIFA 2GF7A 3G6EQ 5FROA 2HBPA 1VA7A 3J7AF 4C8QF 2F5TX 2ROTA 2P0QA 1XNIA 1WNLA 3P8BB 1IRXA 2HQEA 1E7OA 1YJNQ 2MPXC 1N6AA 3I56Q 1M90U 4Z8AA 2O9VA 1W2BA 2KAFA 1EIFA 2MWOA 2P4RA 3ER0A 4OMFB 1RL2A 4XAXB 3OYBA 4HT9A 1JEGA 1SG5A 1MNEA 1AWOA 3EHRA 1M2VB 2ESWA 2O31A 2ED0A 1M8MA 3EGXA 1OZ2A 5HCKA 2K3YA 2GCXA 2RHUA 3CCMQ 1YITT 1TUDA 1OZ3A 3QWXX 3MJXA 1VQ7A 2E70A 1WDXA 4M7AE 4M78A 2V1QA 3CPWP 4J9EA 2CS7A 5HK3A 1HK9A 2JS0A 1X2KA 3M0PA 4ELYC 3FB9A 3LYIA 5GAOn 5DLOA 5GJVB 2KE9A 3EG3A 4EDUA 3MHXA 1T0JA 3QDFA 1M1KR 2PVOB 2G3RA 4KULA 2GTJA 3KUFA 3OSVA 3PTAA 2HAXA 5GAN8 4FCYA 1CKBA 5LJ5h 3VRYA 4EPCA 5FW9A 4C8QD 5GAMf 3A5ZB 3L2UA 5IT9E 4WTOB 1ABQA 2YXYA 1IO6A 4PJOA 4Z02A 4QVZA 2O01E 1B07A 2E65A 5GAOq 1ZLMA 5IHIA 1ACMB 2QXFA 2VKNA 2V26A 2VVKA 5CO7A 2CUBA 4R55A 2GQVA 1RAFB 3JSCA 5LJ3e 1AOJA 2J06A 4AFZC 3QZ9B 3QUIA 1KSWA 4RTUA 4PK4A 4LDUA 2YDLA 2A0FB 3MEUA 1IZ6A 2EYZA 5CIUA 3G4SQ 2EGAA 3VS1A 1O9SA 3DLLA 1MHNA 1WXTA 3CD6T 4J6WA 2CSQA 2K5FA 3CC4Q 4J9BA 1GRIA 2FG0A 3I5SA 2QTVA 1VQPT 4XU3A 2K5LA 1BIAA 4PLLA 4OB0B 2CP5A 3SHWA 4C92G 2KK4A 3M59A 2EQKA 5CKEA 3LGLA 3VS7A 2EYXA 2J05A 4Q5WA 1NPRA 1JQQA 4E7ZA 2J6FA 1QCNA 3M53A 3JAME 3NTKA 2JM9A 4HCCA 2QQAA 4LNPA 2LX7A 3I55A 2KROA 4C5HA 3CCVT 5LJ5f 4L59A 3GF5A 4RMOA 1OU9A 1QVPA 4DEXA 3LLRA 4KBMB 3FC3A 1M90C 3R6NA 3GNGA 4LUEA 2CZ1B 4C8QE 5KE3A 1Q7YU 4N0AC 1OI1A 1U5SA 1RAGB 1B7TA 2QQSA 4C0DC 3MEWA 1H641 1YJ9T 3EGDB 4XTWA 1NYGA 1Y96B 2F2VA 1YCYA 3I35A 5GAMe 2X3WD 1NEBA 1U8RA 2KT1A 2AZSA 2VUBA 4FSXA 3VV0A 1TTHB 4Z89A 2JW4A 3E19A 3QHSA 3JCMJ 3H41A 4MMLA 4JJCA 1OQKA 1K9AA 4HKEA 4M7DB 1D3BB 2FRWA 1YJWA 3VKIA 3T9NA 4OB2B 1DJ7B 2COZA 1XTDA 4FYVB 2DXBA 2OJ2A 2NUTB 2ZPEB 2OX7A 2KRNA 2EGEA 2ROLA 5C6SA 3CCQQ 2AK5A 4QVDA 1H8KA 4F14A 4R0KA 1KC8R 5I22A 2EKHA 2HL3A 1NM7A 1NPPA 4HVWA 4C8QC 3JB9I 3JB9F 1N8RU 3OW2S 2EWNA 3PIPA 2VWFA 1C0MA 2BE9B 5IXFA 4O6JA 4GY5A 2DA9A 4DBHA 1JB0E 2ZPIB 4JRQA 5I2MA 4M78C 3GLXA 2PZ1A 1MMAA 3ASKA 3RMQA 3CC2Q 1YN8A 5GANh 1G3TA 2QQRA 4M77G 4LDYA 5LJ5e 4E7KA 3V8KA 1VQ7T 1NJIU 3NTHA 3JCMf 1S1NA 1SSFA 5KYNA 3BY7A 4B9XA 3UA7A 4C92B 4PJJA 1PC0A 3QIIA 2XHCA 2DYBA 1UEBA 4XU2A 2NUPA 1PD0A 1XJWB 4RTVA 2FB7A 2JN0A 2DL4A 4BE1A 4RUGA 4HVUA 2DJQA 2OTLQ 3M0TA 1WX6A 2C0TA 2X4WA 3CCJA 2GFUA 5A0LA 3C12A 3DB4A 4BI8B 5I2SA 1D1BA 2QK0A 1VQ4Q 2O88A 3BE3A 2DXCA 4PL6A 3OS5A 1YHQQ 1K8AU 1ZBXA 1UG1A 2CGHA 2XI9A 2P4TA 1U3OA 2I0NA 2K4YA 2KY9A 1UHFA 1D0XA 2R5MA 5AT1B 5FWCA 4RCBA 1VUBA 1Q7YC 2FPFA 2QA4Q 2SEMA 1A0NB 4LDWA 2E10A 1VQ8A 3M0QA 4DBFA 3N5BB 1X27A 3S3MA 3LX7A 2WSCE 1WHLA 2L3SA 3L2VA 4QVCA 5ECAA 4M78G 3M55A 3SB2A 1HD3A 3OW2A 2X4YA 3CBOA 1BCMA 3CCRQ 4JJNK 2M1HA 1X43A 1K73R 5GANf 4Y28E 1Y0MA 4AMCA 1PSFA 2MOXA 4PKCC 4IUQA 2OTJQ 1Q82U 2JZ2A 3JCMV 4CI0C 1B3QA 3FRNA 1NBEB 4M7DD 2MAMA 4C92F 2VV5A 5D6WA 2CZ6B 1AZGB 1D1AA 1T3SA 2LQWA 2DETA 2YRVA 1PKTA 2H3JA 3NGPA 2XICA 2OAWA 3GNFB 3M4YA 2L3QA 4PJOG 2E5QA 2XMFA 1M27C 2KNBB 2EFIA 5GAOp 8AT1B 3I55T 1VQ9Q 1RAEB 1G3WA 3NFCA 2LP5A 2VXFA 3JCMe 3Q1JA 3WXMB 5KCOA 2CDTA 1N8RC 5KYYB 3CCUA 4WCIA 7AT1B 4N4IA 4BY6C 5KYXB 3OYIA 1V29B 2P84A 3EFSA 5KYWA 1GBRA 4XTYA 1JXOA 2XKOC 4FSSA 3EFOA 1GCQC 2E5KA 2COWA 3HSBA 2L2PA 5IAYA 2EQIA 3SWNA 4BDZA 3TU4K 3G6EA 4C0DB 2L0AA 4ZGEB 4HXJA 1HJDA 3M0SA 2KSSA 1SEMA 1K0XA 2A08A 1NJIC 2PNIA 1TWBA 1F1BB 2JT4A 5EC7A 1YJNA 2DEUA 1WIEA 2DEQA 4ZTFA 1ABOA 4CC4B 2E3IA 2MMPA 4LXCA 2A3LA 4C92D 8ATCB 1YJWT 3OS1A 2HQXA 3MO8A 1NE8A 4LE9A 2HZYA 2JS2A 2LC4A 5FU7B 1KJWA 1U1SA 3CCMA 1VOMA 2J6OA 5D7UA 3EG2A 1K8AC 1M1KU 3OYGA 3P8DA 1Y57A 3OMCA 3E9GA 1YWPA 2CT4A 3V7CA 5GANe 1W6XA 3CPFA 5GAOm 1TOVA 2E3HA 3REBB 2RK1A 1W2BS 4PJLA 3JB9H 2RD1A 3OBWA 3PIOA 2RK2A 1SF9A 3EGXB 1OV3A 4ZGDB 1M4ZA 1BK2A 1RUWA 3OYEA 1I5OB 2B86A 1K1ZA 1OOTA 2O4XA 3QZ5B 4PJMA 1ARKA 1G5VA 2DXUA 4M78B 2LMJA 4IUUA 4XTXA 4Y91A 2MI6A 2KBTA 4M77F 2JNGA 4J5YA 2RHZA 3M0UA 3FJ5A 3RDVA 1E6GA 4XK8E 5IH2A 3HHTB 2DL3A 1Q82C 1KD1R 4QQGA 5LJ3d 1WHKA 2KXDA 2VASA 2DFUA 1QW1A 3PFSA 2GTOA 2WACA 3ZEHA 5I21A 2XD0A 1PRLC 2Y4YA 3G4SA 3LWHA 3LGFA 3VS5A 4PJOB 2FRYA 3CCJT 1M9SA 1IGUA 2VGNA 4C92E 1B34A 1RAHB 2IVWA 5IHKA 3CCEQ 2DTHA 1AWWA 3VJPA 4ESRA 3OYYA 3L2ZA 5CCAA 1I0CA 1RABB 3NHNA 1VQMA 5J26A 3A98A 3CMEQ 3ZL7C 2EPDA 4NS5A 2J6KA 4EMKC 3KFVA 2JOYA 3F70A 1KHCA 1VQ8T 2DTIA 2HSEB 3G71Q 5GAN7 1KQSA 1HXDA 3LWIA 2M02A 2LNHB 3UT1A 3A1PA 2LDMA 4RTWA 2RN8A 1BCOA 4DEYA 4LDVA 3JB9G 4LD6A 2JXBA 4FL6A 2RHIA 4XTUA 1KHIA 1UGVA 4M78F 3TCJA 3HRSA 2M0OA 4EMHA 4ORZA 2F2XA 2FEIA 1QVGA 2KGTA 1YIJQ 2FHDA 2RM4A 3RNJA 1KQ2A 1D0YA 2RMOA 1I07A 3OYLA 2ZPHB 1WHHA 1RLPC 3O8VA 3FIFA 2D8JA 3H9NA 2ZZDA 2NUZA 2BZXA 2DERA 1PWTA 5GAMd 1NLPC 1EZZB 2F69A 1OULA 4L6V5 4C92C 5CQYA 1M1KC 4PJOF 4O5VA 1KFZA 1QP3A 2QI2A 1U1TA 5LL6S 1WGSA 3U23A 1LOJA 1UJYA 4AT1B 2JUFA 4D6WA 2HL5C 4E7IA 3CCUT 2VC8A 4A4KA 1PNJA 3O5ZA 4BY6B 2PVDB 1VQLQ 3OYFA 1Q86U 1SRMA 2M51A 5DLQE 2V8IA 3CCQA 3PT9A 2QDYB 3G6ET 1VQ5Q 4D8KA 4L5GA 4JS4A 3X25B 4KH0B 4M78D 3CCVQ 2F2WA 4RCCA 2I2LA 2LCCA 3CPWA 4PFOA 2E41A 1RAIB 3GBQA 3GPLA 1YJNT 4F7UA 1VQNA 3BW1A 5GAOl 3OBYA 4M77E 3VS6A 2KRSA 1PSEA 4FYYB 2C0OA 1WXBA 1ZSZA 3QWYA 4QT7A 1X6OA 3CC2A 3QJYA 4OVAA 3CCMT 4PJOD 4IIMA 1VQ6A 3P8HA 4DOWA 3RKYA 1KG1A 5CQXA 2LT1A 2M0YA 3LW5E 2EGCA 2E6NA 2YHTA 4FT2A 3VYHB 1J3TA 1N27A 1RLQC 1GCPA 3CCSA 2RHYA 2ZPFB 2H8HA 2RNAA 5M9OA 1VYTA 4BI3A 2BTTA 2FZGB 4E7LA 2OTLA 1WYXA 3OYJA 3MP8A 2RHXA 2VXEA 3L2WA 5FRNA 1VQ4A 4A4HA 1YHQA 4ZNXA 1PG5B 5FU6C 1WJSA 2HCKA 3BFMA 2LQKA 4A4GA 4E7HA 2NUPB 4NL3A 2QA4A 4KUDK 4M77C 4MMKA 4VUBA 1IHVA 1AD5A 3LH5A 2KQWA 4M78E 2VB6A 4OF1A 3JCMh 2ZAEA 3S3NA 4TVRA 1K73U 3CCLA 1V76A 2B8AA 2DILA 1WA7A 2FPEA 4E6RA 1MNDA 3X26B 1GL5A 3M57A 3G4ST 1YI2Q 1TS9A 1OU8A 2COYA 2KDSA 4JJDA 3URGA 3CCRA 1VQ7Q 4IUPA 4IUTA 1NZ9A 4FYXB 5FU7C 1K9MR 1UGRB 2RA2A 3VS3A 2K57A 3QXEB 2JTFA 3OYCA 1SHGA 3A8MB 1VQMT 4PJOE 3OMGA 4QQ6A 2DIQA 4CC3A 5LJ3g 1PRMC 1QKWA 2XDDA 2X4XA 4LN2A 2X35A 1Q86C 4EMKB 1LCKA 1YWOA 2GFAA 4PNOA 4OB3B 1Q95G 4J7IA 3QG1A 2FL7A 1QMCA 1VQ9A 1FMKA 5FLXE 2QEXA 2JTEA 3PVQA 3CMAQ 4N4HA 1FMVA 5KE2A 2YRDA 1JJ2P 4XU1A 4PFPA 2ZPGB 2KT8A 2O2OA 2M9UA 4PJNA 2DIGA 4F16A 2CP7A 1WZOA 1VQOQ 1YBYA 2D6FA 2A37A 2QQBA 3PMTA 3FLGA 1OX8A 4FT4A 4OGCA 3META 2LTOA 4V2SA 3REAB 1MMGA 1RADB 3RKXA 2E6ZA 1X6GA 5GAN6 5GAN2 4J9IA 2DMOA 1WJQA 2DVJA 2XIDA 4DOVA 5GJWB 5KYWB 1CKAA 4PJOC 1QVFS 3EFOB 1OEBA 3L42A 4NL2A 2LJ3A 3CC7Q 3AT1B 4KGXB 3QYGB 4AFQC 3ZFJA 1SRLA 2EIFA 3HRUA 5DY9A 2MCNA 3EHQA 1QCOA 1FMWA 2G6FX 4WF2A 4RTYA 1BYMA 3OQ5A 4JLIA 3EGDA 3CCQT 5GAMg 2QYZA 3JB9D 2DZ9A 5D6XA 1E6HA 3I55Q 3OW2P 2ABLA 2PUOB 5LJ3j 5GANd 2YWWA 1TU0B 3EGUA 1ZSZC 1UGPB 4BE0A 2DYIA 1BI3A 1S72Q 1Z9QA 2BKDN 3M4GA 1VQNT 3R6OA 1TUGB 1UE9A 3V8LA 1Y71A 1D09B 5KCHA 1QCFA 1K73C 3S3OA 1IHWA 2PVGB 2L3RA 2RJEA 4M7DA 3RIRA 5FRMA 4F04B 3C4SA 2E64A 1KD1U 3SFMA 5A2QE 2EQUA 3CC2T 4BUGA 2K79A 4JJBA 2YUOA 3NTIA 1WPYA 2NUTA 1VQ6T 3QYHB 1OPKA 1ZA1B 5CR2A 4M75A 3PNWC 2LVMA 1ZUYA 1ZA2B 3OYNA 5CKFA 2DBKA 3CQTA 2FPDA 2EJ9A 4JZ3A 4LDXA 1AEYA 4DA4A 3OYHA 4HT8A 2DPPB 4P5NA 3KXTA 1YP5A 2EJFA 3QPHA 4J83A 3CCST 4IUVA 2YLBA 2RH2A 2GBQA 2D0NA 1JBMA 4RTZA 2OTLT 2LCSA 6AT1B 1IXDA 5AYFA 3CXCP 1I5LA 2CYZB 1VQ4T 4FU6A 3GIBA 2LQ8A 1QVFA 1YHQT 3CCEA 1UHCA 4F7UG 2FZCB 4MZPA 1UGQB 1I4K1 3QBYA 3BDUA 3C95A 4XQ3A 5FU6B 3JV3A 5CAIA 3CMEA 2QA4T 5HK0A
chains in the Genus database with same CATH topology
1Q82R 1YI2Q 1K8AR 1VQ4Q 1YHQQ 1M90R 1Q81R 1VQ8Q 3CC4Q 3CPWP 1VQOQ 3CMEQ 3CXCP 1VQ7Q 1W2BP 3CCSQ 3G6EQ 1KC8R 1VQMQ 3CC2Q 3I55Q 1QVFP 1YIJQ 1YITQ 1Q86R 1VQLQ 1K9MR 3OW2P 3G71Q 3CCRQ 2QA4Q 1VQ6Q 1QVGP 1VQNQ 3CD6Q 1N8RR 3G4SQ 1YJWQ 1KD1R 3CCUQ 1KQSP 1VQ5Q 1K73R 2OTLQ 3I56Q 1S72Q 1M1KR 1NJIR 3CCEQ 3CMAQ 3CC7Q 1YJ9Q 3CCMQ 1VQKQ 1VQPQ 3CCVQ 2QEXQ 1VQ9Q 3CCLQ 1YJNQ 1Q7YR 1JJ2P 3CCQQ 2OTJQ 3CCJQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 R;  1YI2 Q;  1K8A R;  1VQ4 Q;  1YHQ Q;  1M90 R;  1Q81 R;  1VQ8 Q;  3CC4 Q;  3CPW P;  1VQO Q;  3CME Q;  3CXC P;  1VQ7 Q;  1W2B P;  3CCS Q;  3G6E Q;  1KC8 R;  1VQM Q;  3CC2 Q;  3I55 Q;  1QVF P;  1YIJ Q;  1YIT Q;  1Q86 R;  1VQL Q;  1K9M R;  3OW2 P;  3G71 Q;  3CCR Q;  2QA4 Q;  1VQ6 Q;  1QVG P;  1VQN Q;  3CD6 Q;  1N8R R;  3G4S Q;  1YJW Q;  1KD1 R;  3CCU Q;  1KQS P;  1VQ5 Q;  1K73 R;  2OTL Q;  3I56 Q;  1S72 Q;  1M1K R;  1NJI R;  3CCE Q;  3CMA Q;  3CC7 Q;  1YJ9 Q;  3CCM Q;  1VQK Q;  1VQP Q;  3CCV Q;  2QEX Q;  1VQ9 Q;  3CCL Q;  1YJN Q;  1Q7Y R;  1JJ2 P;  3CCQ Q;  2OTJ Q;  3CCJ Q; 
#chains in the Genus database with same CATH topology
 5GAM j;  4XU0 A;  3M0R A;  2DE0 X;  4M77 B;  3G71 A;  1WQ7 A;  3EG9 B;  3CCL T;  4A4F A;  3H0H A;  4BE2 A;  2YUP A;  3RR6 A;  1B34 B;  3VUB A;  3UAT A;  4X9C A;  1U06 A;  2HD0 A;  3I56 A;  1M3A A;  1Y07 A;  3QJ6 A;  5I11 A;  1VQK Q;  3CCR T;  1AVZ C;  5GMK j;  4OGE A;  9ATC B;  4R56 A;  2F5K A;  2LNV A;  1YIJ A;  5IN1 A;  2MWP A;  4E47 A;  4HCB A;  2PUK B;  1UEC A;  5IXB A;  2AIR B;  2L5Q A;  2Z0W A;  1UJ0 A;  1SKU B;  2ZPB B;  1H3Z A;  2CRE A;  4F17 A;  1KQS S;  3EG1 A;  4K11 A;  2CKK A;  2AZV A;  2V1R A;  3JCM c;  5HY6 A;  3CCJ Q;  2A36 A;  4KGV B;  5GMK l;  1CSK A;  2DD5 A;  5L8R E;  3UA6 A;  2QQ9 A;  1VQ9 T;  2QEX T;  2XDB A;  3OA6 A;  2CH4 A;  1BB9 A;  4ZN1 A;  4X9D A;  1QVG S;  2DF6 A;  3HKS A;  4M4Z A;  2L8D A;  4M7A A;  4IIO A;  3TEE A;  5A0D A;  3HL8 A;  1KIK A;  1K8A R;  2LQN A;  1MUZ A;  3QKJ A;  1WXU A;  1VQL A;  2CP3 A;  1GFD A;  1KD1 C;  4II1 A;  1FYN A;  1IRE B;  1YCS B;  1VQ5 A;  3QDR B;  4JRP A;  3M5A A;  2V8K A;  2CUD A;  1T3L A;  3WVE B;  1G83 A;  2CSI A;  3BDL A;  1UFF A;  4UC4 A;  4JZ4 A;  1LVK A;  4MZM A;  1C1A A;  1MV0 B;  3VRZ A;  3SEM A;  2BZ8 A;  4LUD A;  2W10 A;  1WHJ A;  3UWN A;  1XOV A;  3ME9 A;  5KYY A;  1G2B A;  1BKB A;  4A4E A;  1YIT Q;  3G1J A;  2MYS A;  5A0G A;  4DBQ A;  4OMO A;  2CP6 A;  2W0Z A;  2HSP A;  3C94 A;  3OS0 A;  3CC4 A;  1N5Z A;  5GAN 5;  1FX7 A;  3EH2 A;  3FDR A;  2AHJ B;  4F7U B;  2EYQ A;  1T0H A;  2CT3 A;  1W2B P;  3CPW S;  2GGR A;  2WSF E;  1VIE A;  3EAE A;  3RER A;  1ZSZ B;  5KYU A;  4NOY A;  2KR3 A;  1O75 A;  2BE7 D;  2BZY A;  1X75 C;  2DK3 A;  3MPU B;  1RAA B;  4M77 D;  4M75 C;  1JXM A;  4PLI A;  3J81 E;  1Q81 R;  4CRI A;  3PVL A;  2X3X D;  1GXI E;  2L3P A;  1R0C B;  3M9Q A;  3MCA B;  2DL5 A;  5CVI A;  4CC7 A;  1R77 A;  3GP8 A;  4OB1 B;  3E2U A;  2IIM A;  4YTL A;  1ZHI A;  4ZN3 A;  2DXT A;  4MDW A;  1HYO A;  1PKS A;  5GMK h;  4J9D A;  1G3S A;  4HVV A;  5GAN g;  4C0G A;  1HSQ A;  1NLO C;  1ZUK A;  3JCM P;  1Y7X A;  3RMS A;  2CP2 A;  4EMG A;  3L2Q A;  1JU5 C;  4JUV A;  1BU1 A;  1UGS B;  3UF4 A;  2RQR A;  1K9M U;  4C8Q A;  4JRI A;  3CD6 Q;  1LNX A;  2X51 A;  1LPL A;  1YI2 A;  4LD9 K;  3X28 B;  1VQP Q;  1UB4 A;  2IG0 A;  2GQI A;  1ZSG A;  3SWN C;  3V7S A;  2MK5 A;  3PMI A;  3CCE T;  4ZTJ A;  4F7U F;  2J7I A;  2YT6 A;  1KC8 U;  2XK0 A;  4JLG A;  2EVR A;  2RF0 A;  4FW1 A;  3OYA A;  4M7D G;  3CME T;  2Y90 A;  1ZBJ A;  4A63 B;  3TSZ A;  3G71 T;  3TRE A;  3HFO A;  3RES A;  4QQD A;  1D0Z A;  2NYS A;  3EH1 A;  2HMA A;  3KBG A;  1YFN A;  3JCM X;  4M75 G;  3FEO A;  5CKD A;  2MIO A;  3H0F A;  3I56 T;  4J9G A;  1VYV A;  3CMA A;  4OML A;  2JM8 A;  1G8X A;  1WLP B;  4J9H A;  1OYX A;  1YJ9 Q;  2NLU A;  1M1F A;  1YIJ T;  2D1X A;  1VQO A;  2EYY A;  4QW2 A;  2DX1 A;  2XU8 A;  2LCL A;  4ANJ A;  1JRI A;  3E1S A;  4KH1 B;  1UUE A;  3M56 A;  1JO8 A;  2JVV A;  2JTM A;  3CBP A;  1P92 A;  3H6Z A;  5LJ5 d;  1UTI A;  2NWM A;  2HKQ B;  2VYT A;  5GAN j;  4RTX A;  1NYF A;  1C6V X;  4C5E A;  2RJF A;  5CK9 A;  5J39 A;  3AHU A;  2KXC A;  4M7A C;  1MMD A;  2F1L A;  2ZGW A;  3A8O B;  1PD1 A;  3NMZ C;  2Y4X A;  1VQM Q;  2RJD A;  4AG2 C;  2RI3 A;  1H3H A;  2CZ0 B;  3CC7 A;  3M54 A;  4HCZ A;  2HBW A;  3MEV A;  3E9F A;  1X2Q A;  1BI2 A;  1FXX A;  1OX9 A;  1M2V A;  2R58 A;  2K9G A;  2XG8 D;  1VQL T;  5KH6 A;  5IHN A;  3TSW A;  1VQ5 T;  3PGG A;  3PE0 A;  2LT4 A;  3OB9 A;  2RO0 A;  4ELZ C;  4E2F B;  1S72 A;  2C0I A;  1K0S A;  2JMA A;  2AKK A;  2KI7 A;  3V8J A;  2AT1 B;  3WVD B;  1ZUU A;  4AFU C;  2LJ1 A;  1JJ2 S;  3M58 A;  1QKX A;  1M90 R;  3D7S B;  3ULR B;  1IGQ A;  1K9M C;  1BI0 A;  1AHJ B;  2EQM A;  4JRK A;  2KRM A;  3HPW A;  2E4H A;  4DBR A;  1AWJ A;  4E7S A;  4A54 A;  2RQT A;  2DAQ A;  2FZK B;  3INZ A;  3CC4 T;  2QGG A;  4DQ2 A;  2X4J A;  1K76 A;  2OTJ A;  1GCQ A;  2EBP A;  4RG2 A;  4OMN A;  4GLM A;  1QP2 A;  1QLY A;  1KC8 C;  4BD3 A;  4M7A G;  5DM7 R;  2D9T A;  3A8G B;  2LJ0 A;  3JCM Q;  3S6W A;  1XQH A;  2DL8 A;  5GMK e;  1RAC B;  2XDP A;  3FJP A;  4MZT A;  4E7J A;  4F7U E;  2L89 A;  2SRC A;  3DKM A;  1RI9 A;  4XTZ A;  5D6Y A;  3ZBD A;  3JCM d;  3HFN A;  4M75 B;  4KRT A;  2DD4 A;  4J8O A;  2BUD A;  3HP9 A;  2LZ6 B;  2DBM A;  3OY9 A;  4IKF A;  5FWB A;  3V7R A;  2RI2 A;  3CEY A;  1N9S A;  1TG0 A;  3VUZ A;  1FWZ A;  4KT0 E;  1G3Y A;  4JPB W;  4QKU A;  2AKL A;  2CZ7 B;  4B9W A;  1Q86 R;  5CKH A;  1VQN Q;  2V8J A;  5GMK m;  2RB6 A;  1WJR A;  1H92 A;  1M3B A;  1MMN A;  3VU3 C;  2RJC A;  2H3E B;  2QTX A;  2HDA A;  4BI4 A;  4ME7 A;  1I1J A;  2CH4 W;  2HNI A;  4FM4 B;  3J80 E;  4OMQ A;  2IPO B;  1YI2 T;  4C5I A;  1K4U S;  1VQ6 Q;  2ECZ A;  1VQK A;  2PU9 B;  2FVU A;  3X20 B;  2VGM A;  1JJ2 A;  3SWN B;  1W70 A;  2ENM A;  1Z9Z A;  4B6M A;  1TUC A;  2DKG A;  5GAO r;  3IQL A;  1BI1 A;  2RQW A;  1X01 A;  4HCK A;  3VYG A;  2M16 A;  4BB7 A;  5GMK i;  3CCS Q;  3UPU A;  4M7D F;  3L2R A;  1AZE A;  1Y96 A;  1V1C A;  4IUR A;  3TQ7 P;  3H8Z A;  1VYU A;  3VS4 A;  3GOX A;  3C0C A;  2YUN A;  2DRM A;  3I5R A;  3RKW A;  2K7A A;  1ZQ1 A;  4M75 F;  1M8V A;  2OAU A;  3A8L B;  2DVE A;  3CMA T;  4ATO A;  3VS0 A;  1D1C A;  2A28 A;  3CXC S;  3VS2 A;  3QSU A;  1D3B A;  3JRZ A;  1VQO T;  1SHF A;  3LH0 A;  4C8Q G;  4FW2 A;  1TH7 A;  1WI7 A;  1PHT A;  4RG8 A;  2KEA A;  4OMP A;  5GAN 4;  3HTR A;  3CCL Q;  1SSH A;  1Q7Y R;  2EJG A;  2EQJ A;  2YRC A;  2O9S A;  1N9R A;  4MDX A;  1EFN A;  2DO3 A;  3TVT A;  3X24 B;  3CBM A;  2KVQ G;  2OI3 A;  4RKU E;  4EMK A;  3OYK A;  2DRK A;  1M3C A;  5HKC A;  1QVF P;  2P0K A;  1OPL A;  1YJW Q;  4M7A B;  2K6D A;  3OYM A;  1W4S A;  4HA8 A;  2O4X B;  2LRQ A;  3MKD A;  4CC2 A;  2HKN A;  5EG2 A;  2ED1 A;  4OMM A;  3OYD A;  4JDS A;  1YIT A;  3CC7 T;  1M5Q 1;  2E12 A;  2KYM A;  4GLK A;  4J9C A;  2RPN A;  1SPK A;  1AT1 B;  2EAY A;  2WSE E;  1X6B A;  4X1V A;  2RI5 A;  5LJ5 g;  2K5I A;  4A53 A;  1M2O A;  1M30 A;  2DM1 A;  4Z88 A;  2DNU A;  4M75 D;  4C0F A;  1M1G A;  4C0Z A;  2QEX Q;  2FYK A;  1KK7 A;  1W1F A;  2QGF B;  1Q81 U;  4RTT A;  3G7Z A;  3THK A;  1WQW A;  4FYW B;  4C92 A;  2YLC A;  1S72 T;  2DLP A;  2QAS A;  4Y92 A;  2KYB A;  3I9Q A;  1N8R R;  3JB9 J;  1R8O B;  1PCX A;  2EYW A;  2DTO A;  4OP0 A;  2JMC A;  3EG0 A;  2YSQ A;  3CXC A;  2JJ9 A;  1IB8 A;  2X9H A;  3UDC A;  2P0P A;  1QWF A;  1TXQ A;  2OTJ T;  1QWE A;  5KYU B;  3JCM W;  4J6Y A;  2KMT A;  1NJI R;  4M7A F;  4J9F A;  3MP6 A;  3L1A A;  4BAC A;  1PM3 A;  3NPF A;  1RI0 A;  1TSF A;  2PQW A;  3MP1 A;  4AG1 C;  3CD6 A;  1LJO A;  5LJ3 h;  5J3B A;  3OS2 A;  3MEA A;  1VQP A;  1MV3 A;  1NEG A;  4M7D E;  1WHM A;  3SDZ A;  1WHG A;  1MGQ A;  4FIB A;  2R57 A;  2GNC A;  1UDL A;  1AWX A;  1VQ8 Q;  2EW3 A;  3SD4 A;  4C5G A;  5LJ5 j;  2YUQ A;  1I8F A;  2K2V A;  2K3X A;  2FO0 A;  5CKB A;  4M75 E;  4C8Q B;  5C0M A;  4PFZ A;  4X34 A;  2A7Y A;  2HQH A;  2DL7 A;  3CCV A;  2CP0 A;  2DJZ A;  3EFR A;  3OSS C;  4JS5 A;  2ATC B;  1KQ1 A;  4GBQ A;  1WFW A;  3JCM b;  2ZCF B;  2HEQ A;  2LX9 A;  3JCM g;  4KGZ B;  1QQJ A;  1NG2 A;  1VQK T;  2K3B A;  4EIK A;  2K2M A;  2PTK A;  3DB3 A;  1BBZ A;  2QAZ A;  2R5A A;  1YJ9 A;  1ZX6 A;  3H0I A;  4M7A D;  1EX4 A;  5KYX A;  2EKO A;  1KQS P;  1BIB A;  2C06 A;  4N4G A;  4N0A A;  1Q82 R;  4BDY A;  3HRT A;  2DZC A;  5GAN 3;  4M77 A;  1R0B G;  4J6X A;  3A8H B;  3RBB B;  1GBQ A;  2RQV A;  3EG9 A;  4M7D C;  2BIV A;  4D8D A;  2D8H A;  2E1H A;  1QVG P;  1YNZ A;  3CCU Q;  4J7F A;  3DLM A;  2QG9 B;  4KUI A;  1Q81 C;  3RUX A;  4ZGJ B;  4AFS C;  1I81 A;  1X69 A;  2MF2 A;  5LJ3 f;  1GFC A;  5GAM h;  2D0Q B;  2QDL A;  5L23 A;  3QO3 A;  4XTV A;  2RQU A;  1VIF A;  2GF7 A;  3G6E Q;  5FRO A;  2HBP A;  1VA7 A;  3J7A F;  4C8Q F;  2F5T X;  2ROT A;  2P0Q A;  1XNI A;  1WNL A;  3P8B B;  1IRX A;  2HQE A;  1E7O A;  1YJN Q;  2MPX C;  1N6A A;  3I56 Q;  1M90 U;  4Z8A A;  2O9V A;  1W2B A;  2KAF A;  1EIF A;  2MWO A;  2P4R A;  3ER0 A;  4OMF B;  1RL2 A;  4XAX B;  3OYB A;  4HT9 A;  1JEG A;  1SG5 A;  1MNE A;  1AWO A;  3EHR A;  1M2V B;  2ESW A;  2O31 A;  2ED0 A;  1M8M A;  3EGX A;  1OZ2 A;  5HCK A;  2K3Y A;  2GCX A;  2RHU A;  3CCM Q;  1YIT T;  1TUD A;  1OZ3 A;  3QWX X;  3MJX A;  1VQ7 A;  2E70 A;  1WDX A;  4M7A E;  4M78 A;  2V1Q A;  3CPW P;  4J9E A;  2CS7 A;  5HK3 A;  1HK9 A;  2JS0 A;  1X2K A;  3M0P A;  4ELY C;  3FB9 A;  3LYI A;  5GAO n;  5DLO A;  5GJV B;  2KE9 A;  3EG3 A;  4EDU A;  3MHX A;  1T0J A;  3QDF A;  1M1K R;  2PVO B;  2G3R A;  4KUL A;  2GTJ A;  3KUF A;  3OSV A;  3PTA A;  2HAX A;  5GAN 8;  4FCY A;  1CKB A;  5LJ5 h;  3VRY A;  4EPC A;  5FW9 A;  4C8Q D;  5GAM f;  3A5Z B;  3L2U A;  5IT9 E;  4WTO B;  1ABQ A;  2YXY A;  1IO6 A;  4PJO A;  4Z02 A;  4QVZ A;  2O01 E;  1B07 A;  2E65 A;  5GAO q;  1ZLM A;  5IHI A;  1ACM B;  2QXF A;  2VKN A;  2V26 A;  2VVK A;  5CO7 A;  2CUB A;  4R55 A;  2GQV A;  1RAF B;  3JSC A;  5LJ3 e;  1AOJ A;  2J06 A;  4AFZ C;  3QZ9 B;  3QUI A;  1KSW A;  4RTU A;  4PK4 A;  4LDU A;  2YDL A;  2A0F B;  3MEU A;  1IZ6 A;  2EYZ A;  5CIU A;  3G4S Q;  2EGA A;  3VS1 A;  1O9S A;  3DLL A;  1MHN A;  1WXT A;  3CD6 T;  4J6W A;  2CSQ A;  2K5F A;  3CC4 Q;  4J9B A;  1GRI A;  2FG0 A;  3I5S A;  2QTV A;  1VQP T;  4XU3 A;  2K5L A;  1BIA A;  4PLL A;  4OB0 B;  2CP5 A;  3SHW A;  4C92 G;  2KK4 A;  3M59 A;  2EQK A;  5CKE A;  3LGL A;  3VS7 A;  2EYX A;  2J05 A;  4Q5W A;  1NPR A;  1JQQ A;  4E7Z A;  2J6F A;  1QCN A;  3M53 A;  3JAM E;  3NTK A;  2JM9 A;  4HCC A;  2QQA A;  4LNP A;  2LX7 A;  3I55 A;  2KRO A;  4C5H A;  3CCV T;  5LJ5 f;  4L59 A;  3GF5 A;  4RMO A;  1OU9 A;  1QVP A;  4DEX A;  3LLR A;  4KBM B;  3FC3 A;  1M90 C;  3R6N A;  3GNG A;  4LUE A;  2CZ1 B;  4C8Q E;  5KE3 A;  1Q7Y U;  4N0A C;  1OI1 A;  1U5S A;  1RAG B;  1B7T A;  2QQS A;  4C0D C;  3MEW A;  1H64 1;  1YJ9 T;  3EGD B;  4XTW A;  1NYG A;  1Y96 B;  2F2V A;  1YCY A;  3I35 A;  5GAM e;  2X3W D;  1NEB A;  1U8R A;  2KT1 A;  2AZS A;  2VUB A;  4FSX A;  3VV0 A;  1TTH B;  4Z89 A;  2JW4 A;  3E19 A;  3QHS A;  3JCM J;  3H41 A;  4MML A;  4JJC A;  1OQK A;  1K9A A;  4HKE A;  4M7D B;  1D3B B;  2FRW A;  1YJW A;  3VKI A;  3T9N A;  4OB2 B;  1DJ7 B;  2COZ A;  1XTD A;  4FYV B;  2DXB A;  2OJ2 A;  2NUT B;  2ZPE B;  2OX7 A;  2KRN A;  2EGE A;  2ROL A;  5C6S A;  3CCQ Q;  2AK5 A;  4QVD A;  1H8K A;  4F14 A;  4R0K A;  1KC8 R;  5I22 A;  2EKH A;  2HL3 A;  1NM7 A;  1NPP A;  4HVW A;  4C8Q C;  3JB9 I;  3JB9 F;  1N8R U;  3OW2 S;  2EWN A;  3PIP A;  2VWF A;  1C0M A;  2BE9 B;  5IXF A;  4O6J A;  4GY5 A;  2DA9 A;  4DBH A;  1JB0 E;  2ZPI B;  4JRQ A;  5I2M A;  4M78 C;  3GLX A;  2PZ1 A;  1MMA A;  3ASK A;  3RMQ A;  3CC2 Q;  1YN8 A;  5GAN h;  1G3T A;  2QQR A;  4M77 G;  4LDY A;  5LJ5 e;  4E7K A;  3V8K A;  1VQ7 T;  1NJI U;  3NTH A;  3JCM f;  1S1N A;  1SSF A;  5KYN A;  3BY7 A;  4B9X A;  3UA7 A;  4C92 B;  4PJJ A;  1PC0 A;  3QII A;  2XHC A;  2DYB A;  1UEB A;  4XU2 A;  2NUP A;  1PD0 A;  1XJW B;  4RTV A;  2FB7 A;  2JN0 A;  2DL4 A;  4BE1 A;  4RUG A;  4HVU A;  2DJQ A;  2OTL Q;  3M0T A;  1WX6 A;  2C0T A;  2X4W A;  3CCJ A;  2GFU A;  5A0L A;  3C12 A;  3DB4 A;  4BI8 B;  5I2S A;  1D1B A;  2QK0 A;  1VQ4 Q;  2O88 A;  3BE3 A;  2DXC A;  4PL6 A;  3OS5 A;  1YHQ Q;  1K8A U;  1ZBX A;  1UG1 A;  2CGH A;  2XI9 A;  2P4T A;  1U3O A;  2I0N A;  2K4Y A;  2KY9 A;  1UHF A;  1D0X A;  2R5M A;  5AT1 B;  5FWC A;  4RCB A;  1VUB A;  1Q7Y C;  2FPF A;  2QA4 Q;  2SEM A;  1A0N B;  4LDW A;  2E10 A;  1VQ8 A;  3M0Q A;  4DBF A;  3N5B B;  1X27 A;  3S3M A;  3LX7 A;  2WSC E;  1WHL A;  2L3S A;  3L2V A;  4QVC A;  5ECA A;  4M78 G;  3M55 A;  3SB2 A;  1HD3 A;  3OW2 A;  2X4Y A;  3CBO A;  1BCM A;  3CCR Q;  4JJN K;  2M1H A;  1X43 A;  1K73 R;  5GAN f;  4Y28 E;  1Y0M A;  4AMC A;  1PSF A;  2MOX A;  4PKC C;  4IUQ A;  2OTJ Q;  1Q82 U;  2JZ2 A;  3JCM V;  4CI0 C;  1B3Q A;  3FRN A;  1NBE B;  4M7D D;  2MAM A;  4C92 F;  2VV5 A;  5D6W A;  2CZ6 B;  1AZG B;  1D1A A;  1T3S A;  2LQW A;  2DET A;  2YRV A;  1PKT A;  2H3J A;  3NGP A;  2XIC A;  2OAW A;  3GNF B;  3M4Y A;  2L3Q A;  4PJO G;  2E5Q A;  2XMF A;  1M27 C;  2KNB B;  2EFI A;  5GAO p;  8AT1 B;  3I55 T;  1VQ9 Q;  1RAE B;  1G3W A;  3NFC A;  2LP5 A;  2VXF A;  3JCM e;  3Q1J A;  3WXM B;  5KCO A;  2CDT A;  1N8R C;  5KYY B;  3CCU A;  4WCI A;  7AT1 B;  4N4I A;  4BY6 C;  5KYX B;  3OYI A;  1V29 B;  2P84 A;  3EFS A;  5KYW A;  1GBR A;  4XTY A;  1JXO A;  2XKO C;  4FSS A;  3EFO A;  1GCQ C;  2E5K A;  2COW A;  3HSB A;  2L2P A;  5IAY A;  2EQI A;  3SWN A;  4BDZ A;  3TU4 K;  3G6E A;  4C0D B;  2L0A A;  4ZGE B;  4HXJ A;  1HJD A;  3M0S A;  2KSS A;  1SEM A;  1K0X A;  2A08 A;  1NJI C;  2PNI A;  1TWB A;  1F1B B;  2JT4 A;  5EC7 A;  1YJN A;  2DEU A;  1WIE A;  2DEQ A;  4ZTF A;  1ABO A;  4CC4 B;  2E3I A;  2MMP A;  4LXC A;  2A3L A;  4C92 D;  8ATC B;  1YJW T;  3OS1 A;  2HQX A;  3MO8 A;  1NE8 A;  4LE9 A;  2HZY A;  2JS2 A;  2LC4 A;  5FU7 B;  1KJW A;  1U1S A;  3CCM A;  1VOM A;  2J6O A;  5D7U A;  3EG2 A;  1K8A C;  1M1K U;  3OYG A;  3P8D A;  1Y57 A;  3OMC A;  3E9G A;  1YWP A;  2CT4 A;  3V7C A;  5GAN e;  1W6X A;  3CPF A;  5GAO m;  1TOV A;  2E3H A;  3REB B;  2RK1 A;  1W2B S;  4PJL A;  3JB9 H;  2RD1 A;  3OBW A;  3PIO A;  2RK2 A;  1SF9 A;  3EGX B;  1OV3 A;  4ZGD B;  1M4Z A;  1BK2 A;  1RUW A;  3OYE A;  1I5O B;  2B86 A;  1K1Z A;  1OOT A;  2O4X A;  3QZ5 B;  4PJM A;  1ARK A;  1G5V A;  2DXU A;  4M78 B;  2LMJ A;  4IUU A;  4XTX A;  4Y91 A;  2MI6 A;  2KBT A;  4M77 F;  2JNG A;  4J5Y A;  2RHZ A;  3M0U A;  3FJ5 A;  3RDV A;  1E6G A;  4XK8 E;  5IH2 A;  3HHT B;  2DL3 A;  1Q82 C;  1KD1 R;  4QQG A;  5LJ3 d;  1WHK A;  2KXD A;  2VAS A;  2DFU A;  1QW1 A;  3PFS A;  2GTO A;  2WAC A;  3ZEH A;  5I21 A;  2XD0 A;  1PRL C;  2Y4Y A;  3G4S A;  3LWH A;  3LGF A;  3VS5 A;  4PJO B;  2FRY A;  3CCJ T;  1M9S A;  1IGU A;  2VGN A;  4C92 E;  1B34 A;  1RAH B;  2IVW A;  5IHK A;  3CCE Q;  2DTH A;  1AWW A;  3VJP A;  4ESR A;  3OYY A;  3L2Z A;  5CCA A;  1I0C A;  1RAB B;  3NHN A;  1VQM A;  5J26 A;  3A98 A;  3CME Q;  3ZL7 C;  2EPD A;  4NS5 A;  2J6K A;  4EMK C;  3KFV A;  2JOY A;  3F70 A;  1KHC A;  1VQ8 T;  2DTI A;  2HSE B;  3G71 Q;  5GAN 7;  1KQS A;  1HXD A;  3LWI A;  2M02 A;  2LNH B;  3UT1 A;  3A1P A;  2LDM A;  4RTW A;  2RN8 A;  1BCO A;  4DEY A;  4LDV A;  3JB9 G;  4LD6 A;  2JXB A;  4FL6 A;  2RHI A;  4XTU A;  1KHI A;  1UGV A;  4M78 F;  3TCJ A;  3HRS A;  2M0O A;  4EMH A;  4ORZ A;  2F2X A;  2FEI A;  1QVG A;  2KGT A;  1YIJ Q;  2FHD A;  2RM4 A;  3RNJ A;  1KQ2 A;  1D0Y A;  2RMO A;  1I07 A;  3OYL A;  2ZPH B;  1WHH A;  1RLP C;  3O8V A;  3FIF A;  2D8J A;  3H9N A;  2ZZD A;  2NUZ A;  2BZX A;  2DER A;  1PWT A;  5GAM d;  1NLP C;  1EZZ B;  2F69 A;  1OUL A;  4L6V 5;  4C92 C;  5CQY A;  1M1K C;  4PJO F;  4O5V A;  1KFZ A;  1QP3 A;  2QI2 A;  1U1T A;  5LL6 S;  1WGS A;  3U23 A;  1LOJ A;  1UJY A;  4AT1 B;  2JUF A;  4D6W A;  2HL5 C;  4E7I A;  3CCU T;  2VC8 A;  4A4K A;  1PNJ A;  3O5Z A;  4BY6 B;  2PVD B;  1VQL Q;  3OYF A;  1Q86 U;  1SRM A;  2M51 A;  5DLQ E;  2V8I A;  3CCQ A;  3PT9 A;  2QDY B;  3G6E T;  1VQ5 Q;  4D8K A;  4L5G A;  4JS4 A;  3X25 B;  4KH0 B;  4M78 D;  3CCV Q;  2F2W A;  4RCC A;  2I2L A;  2LCC A;  3CPW A;  4PFO A;  2E41 A;  1RAI B;  3GBQ A;  3GPL A;  1YJN T;  4F7U A;  1VQN A;  3BW1 A;  5GAO l;  3OBY A;  4M77 E;  3VS6 A;  2KRS A;  1PSE A;  4FYY B;  2C0O A;  1WXB A;  1ZSZ A;  3QWY A;  4QT7 A;  1X6O A;  3CC2 A;  3QJY A;  4OVA A;  3CCM T;  4PJO D;  4IIM A;  1VQ6 A;  3P8H A;  4DOW A;  3RKY A;  1KG1 A;  5CQX A;  2LT1 A;  2M0Y A;  3LW5 E;  2EGC A;  2E6N A;  2YHT A;  4FT2 A;  3VYH B;  1J3T A;  1N27 A;  1RLQ C;  1GCP A;  3CCS A;  2RHY A;  2ZPF B;  2H8H A;  2RNA A;  5M9O A;  1VYT A;  4BI3 A;  2BTT A;  2FZG B;  4E7L A;  2OTL A;  1WYX A;  3OYJ A;  3MP8 A;  2RHX A;  2VXE A;  3L2W A;  5FRN A;  1VQ4 A;  4A4H A;  1YHQ A;  4ZNX A;  1PG5 B;  5FU6 C;  1WJS A;  2HCK A;  3BFM A;  2LQK A;  4A4G A;  4E7H A;  2NUP B;  4NL3 A;  2QA4 A;  4KUD K;  4M77 C;  4MMK A;  4VUB A;  1IHV A;  1AD5 A;  3LH5 A;  2KQW A;  4M78 E;  2VB6 A;  4OF1 A;  3JCM h;  2ZAE A;  3S3N A;  4TVR A;  1K73 U;  3CCL A;  1V76 A;  2B8A A;  2DIL A;  1WA7 A;  2FPE A;  4E6R A;  1MND A;  3X26 B;  1GL5 A;  3M57 A;  3G4S T;  1YI2 Q;  1TS9 A;  1OU8 A;  2COY A;  2KDS A;  4JJD A;  3URG A;  3CCR A;  1VQ7 Q;  4IUP A;  4IUT A;  1NZ9 A;  4FYX B;  5FU7 C;  1K9M R;  1UGR B;  2RA2 A;  3VS3 A;  2K57 A;  3QXE B;  2JTF A;  3OYC A;  1SHG A;  3A8M B;  1VQM T;  4PJO E;  3OMG A;  4QQ6 A;  2DIQ A;  4CC3 A;  5LJ3 g;  1PRM C;  1QKW A;  2XDD A;  2X4X A;  4LN2 A;  2X35 A;  1Q86 C;  4EMK B;  1LCK A;  1YWO A;  2GFA A;  4PNO A;  4OB3 B;  1Q95 G;  4J7I A;  3QG1 A;  2FL7 A;  1QMC A;  1VQ9 A;  1FMK A;  5FLX E;  2QEX A;  2JTE A;  3PVQ A;  3CMA Q;  4N4H A;  1FMV A;  5KE2 A;  2YRD A;  1JJ2 P;  4XU1 A;  4PFP A;  2ZPG B;  2KT8 A;  2O2O A;  2M9U A;  4PJN A;  2DIG A;  4F16 A;  2CP7 A;  1WZO A;  1VQO Q;  1YBY A;  2D6F A;  2A37 A;  2QQB A;  3PMT A;  3FLG A;  1OX8 A;  4FT4 A;  4OGC A;  3MET A;  2LTO A;  4V2S A;  3REA B;  1MMG A;  1RAD B;  3RKX A;  2E6Z A;  1X6G A;  5GAN 6;  5GAN 2;  4J9I A;  2DMO A;  1WJQ A;  2DVJ A;  2XID A;  4DOV A;  5GJW B;  5KYW B;  1CKA A;  4PJO C;  1QVF S;  3EFO B;  1OEB A;  3L42 A;  4NL2 A;  2LJ3 A;  3CC7 Q;  3AT1 B;  4KGX B;  3QYG B;  4AFQ C;  3ZFJ A;  1SRL A;  2EIF A;  3HRU A;  5DY9 A;  2MCN A;  3EHQ A;  1QCO A;  1FMW A;  2G6F X;  4WF2 A;  4RTY A;  1BYM A;  3OQ5 A;  4JLI A;  3EGD A;  3CCQ T;  5GAM g;  2QYZ A;  3JB9 D;  2DZ9 A;  5D6X A;  1E6H A;  3I55 Q;  3OW2 P;  2ABL A;  2PUO B;  5LJ3 j;  5GAN d;  2YWW A;  1TU0 B;  3EGU A;  1ZSZ C;  1UGP B;  4BE0 A;  2DYI A;  1BI3 A;  1S72 Q;  1Z9Q A;  2BKD N;  3M4G A;  1VQN T;  3R6O A;  1TUG B;  1UE9 A;  3V8L A;  1Y71 A;  1D09 B;  5KCH A;  1QCF A;  1K73 C;  3S3O A;  1IHW A;  2PVG B;  2L3R A;  2RJE A;  4M7D A;  3RIR A;  5FRM A;  4F04 B;  3C4S A;  2E64 A;  1KD1 U;  3SFM A;  5A2Q E;  2EQU A;  3CC2 T;  4BUG A;  2K79 A;  4JJB A;  2YUO A;  3NTI A;  1WPY A;  2NUT A;  1VQ6 T;  3QYH B;  1OPK A;  1ZA1 B;  5CR2 A;  4M75 A;  3PNW C;  2LVM A;  1ZUY A;  1ZA2 B;  3OYN A;  5CKF A;  2DBK A;  3CQT A;  2FPD A;  2EJ9 A;  4JZ3 A;  4LDX A;  1AEY A;  4DA4 A;  3OYH A;  4HT8 A;  2DPP B;  4P5N A;  3KXT A;  1YP5 A;  2EJF A;  3QPH A;  4J83 A;  3CCS T;  4IUV A;  2YLB A;  2RH2 A;  2GBQ A;  2D0N A;  1JBM A;  4RTZ A;  2OTL T;  2LCS A;  6AT1 B;  1IXD A;  5AYF A;  3CXC P;  1I5L A;  2CYZ B;  1VQ4 T;  4FU6 A;  3GIB A;  2LQ8 A;  1QVF A;  1YHQ T;  3CCE A;  1UHC A;  4F7U G;  2FZC B;  4MZP A;  1UGQ B;  1I4K 1;  3QBY A;  3BDU A;  3C95 A;  4XQ3 A;  5FU6 B;  3JV3 A;  5CAI A;  3CME A;  2QA4 T;  5HK0 A; 
#chains in the Genus database with same CATH homology
 1Q82 R;  1YI2 Q;  1K8A R;  1VQ4 Q;  1YHQ Q;  1M90 R;  1Q81 R;  1VQ8 Q;  3CC4 Q;  3CPW P;  1VQO Q;  3CME Q;  3CXC P;  1VQ7 Q;  1W2B P;  3CCS Q;  3G6E Q;  1KC8 R;  1VQM Q;  3CC2 Q;  3I55 Q;  1QVF P;  1YIJ Q;  1YIT Q;  1Q86 R;  1VQL Q;  1K9M R;  3OW2 P;  3G71 Q;  3CCR Q;  2QA4 Q;  1VQ6 Q;  1QVG P;  1VQN Q;  3CD6 Q;  1N8R R;  3G4S Q;  1YJW Q;  1KD1 R;  3CCU Q;  1KQS P;  1VQ5 Q;  1K73 R;  2OTL Q;  3I56 Q;  1S72 Q;  1M1K R;  1NJI R;  3CCE Q;  3CMA Q;  3CC7 Q;  1YJ9 Q;  3CCM Q;  1VQK Q;  1VQP Q;  3CCV Q;  2QEX Q;  1VQ9 Q;  3CCL Q;  1YJN Q;  1Q7Y R;  1JJ2 P;  3CCQ Q;  2OTJ Q;  3CCJ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...