1VQ6Q

The structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq6Q00
1YJNQ 1YJ9Q 1VQ4Q 2OTLQ 1K73R 1M1KR 1KQSP 1N8RR 1KC8R 3CC2Q 2OTJQ 1YHQQ 1Q86R 1VQMQ 3CCEQ 3CCQQ 3CCVQ 3CPWP 2QA4Q 1VQPQ 1VQ7Q 3CXCP 3CMAQ 1VQ6Q 3CCLQ 3CCUQ 3CCSQ 3OW2P 1YI2Q 1VQOQ 3CMEQ 3G71Q 1YJWQ 3CCMQ 1YITQ 1VQ9Q 1W2BP 1KD1R 1S72Q 1JJ2P 1QVFP 1NJIR 1K9MR 1M90R 3G6EQ 1VQ5Q 3I56Q 3CD6Q 1VQLQ 1K8AR 3CCJQ 1VQ8Q 3I55Q 2QEXQ 3CCRQ 1Q7YR 1Q81R 1QVGP 3CC7Q 1YIJQ 1VQNQ 3CC4Q 1Q82R 1VQKQ 3G4SQ
chains in the Genus database with same CATH superfamily
2NUTB 3UT1A 2CS7A 4C8QC 2QQAA 4PJOB 3CCUT 3QKJA 1W6XA 2E6ZA 4B9WA 3EHRA 3OW2P 2OJ2A 2L3QA 4M7DE 1BK2A 2RB6A 3E9GA 3G4SA 2YLCA 2RQTA 1CKBA 3A1PA 3X24B 4EMGA 2EYWA 3H0FA 4N4GA 5GAMd 1N8RU 2CKKA 3H6ZA 4RTXA 2GBQA 3RKWA 3NPFA 4J83A 1BI2A 1B3QA 1VQPQ 4LE9A 4RMOA 1WJSA 1W2BA 2DAQA 4A63B 1G83A 3UWNA 1M3BA 3UA7A 4XU2A 3A8MB 3RKYA 2A28A 4IIMA 3R6OA 4LUDA 4MMKA 3JCMg 1SHGA 2BE9B 2VYTA 4C92C 2LNVA 5LL6S 2NUPB 4OGCA 4RKUE 1SRMA 2OAWA 5I22A 5KYXB 1YIJA 4AG1C 2PUKB 2DK3A 1VQ8T 3GOXA 1ZSZC 4JS5A 3EG9B 3A5ZB 2RHXA 4C5GA 3VS5A 2CSIA 5KYYB 4A4HA 1JJ2S 3OBYA 3PNWC 1I5LA 1WZOA 1ZLMA 3I9QA 2P4TA 3I56Q 1K0SA 2CT3A 3OYBA 3OBWA 4F7UG 1RADB 3QJ6A 3REAB 2DIQA 1TWBA 2LJ0A 5GMKh 1F1BB 4FL6A 1SKUB 1Q86U 1AEYA 1YJ9Q 2FO0A 2FZGB 4EMKB 3CCVT 3OY9A 3L2UA 1PD1A 2RK1A 1GFCA 4CC7A 1QKXA 3I5RA 2VV5A 3RESA 5GMKi 1PRLC 4C5IA 1JXOA 1OPKA 2FZCB 3I35A 3I5SA 5HCKA 2XI9A 1WHLA 2NUZA 4FW1A 3JAME 5GAN2 3QBYA 1KIKA 2D0QB 4OMQA 1H641 4R0KA 3CCMT 1IXDA 2DIGA 2K3YA 2O2OA 1UHFA 1B34B 1A0NB 1D3BA 2GTOA 3QJYA 4C0DB 1IREB 1Y0MA 1QVGP 5GAOm 2HAXA 5GANj 3CC2T 1KQSA 2RI5A 4MZMA 4OP0A 2DETA 1M27C 3JCMb 3CCQT 4KUDK 1YHQQ 4PK4A 3REBB 3GNGA 2HL3A 5CO7A 3S3MA 1R0CB 2DL7A 2M9UA 2RH2A 1QQJA 3QSUA 3EFOA 2CREA 2DRKA 2O4XA 1W1FA 3FB9A 5EC7A 2XICA 3PVLA 1VQOA 5GAN7 3OW2S 5FROA 4F7UF 1VQ5A 3AHUA 4AFQC 2FG0A 4XQ3A 3H0IA 3E1SA 2KI7A 2X3WD 1QCNA 2DD4A 1W2BP 3EGDB 3VS6A 1KFZA 2G3RA 4LDVA 2RJCA 2VASA 2P84A 2HDAA 2JNGA 2KSSA 2E3HA 3CCRT 2RJEA 2QEXQ 5GAN3 1LCKA 1NLPC 5J26A 1UGPB 3CCUA 4JZ4A 1UJ0A 3SD4A 3JB9G 2ZGWA 4A4FA 4CC2A 3VJPA 5A0GA 3JCMW 1YN8A 4LDUA 2EQIA 3CMEQ 4E7IA 2L3PA 3C0CA 3RERA 1WGSA 4M7DB 1X2QA 2X3XD 3DB3A 1ZUUA 3CEYA 1HYOA 4JLIA 2ATCB 4M78C 1NJIU 1ZUKA 3LGFA 2ENMA 1HK9A 1QVFP 2DRMA 2ED0A 3G6EQ 9ATCB 2NYSA 4R56A 4M75D 4LDXA 2L3SA 4O5VA 4RCBA 3QPHA 2V26A 1YJNT 3CC4Q 1NPRA 3L1AA 1KC8R 2K4YA 1YFNA 2DJQA 1VQ8A 3G71T 2HSEB 2W0ZA 3WVDB 1RI9A 4CI0C 4ATOA 1JXMA 3UF4A 3MO8A 1Q81C 1O75A 4J5YA 4XTZA 4HKEA 4JPBW 2X9HA 4A54A 1PWTA 2KRMA 2A0FB 3IQLA 2FPDA 2HNIA 1IO6A 1QP2A 1I5OB 3GNFB 1AWXA 3M9QA 5HK3A 2K7AA 4L59A 4M75A 4C0ZA 3PTAA 2CSQA 2JW4A 2F1LA 1SSFA 3JB9F 3EH2A 2CH4W 3S3OA 3QG1A 4A53A 4ORZA 1TU0B 2VB6A 3M5AA 5CCAA 2DX1A 2JZ2A 4FW2A 2R57A 3CCVA 2I0NA 2V8JA 3RMSA 2D8HA 2BTTA 4J9DA 5LJ3f 4VUBA 2MCNA 2L0AA 8AT1B 4E7ZA 1YJWT 4BDYA 2QDLA 4FSSA 2PTKA 1ACMB 2F2VA 4ZN3A 3S3NA 2RPNA 2BZYA 1QVGS 5D6YA 4XU3A 1WHJA 2R58A 5I2SA 1ZX6A 3I55Q 1BI3A 3KUFA 4ANJA 2OTLT 3CCMA 2LZ6B 3WXMB 3CCEQ 3LX7A 4RTZA 3X20B 5FRNA 4BB7A 3OYJA 2I2LA 5L23A 2EGEA 2MAMA 4A4EA 4F04B 1E6HA 2KYBA 2M02A 5CR2A 2DM1A 4WF2A 5GMKj 1Y96A 3GLXA 2C06A 3J81E 5IXBA 2HQEA 3S6WA 4IIOA 3M0RA 2HBPA 5DLOA 2L3RA 3F70A 1AZEA 2EQJA 3J7AF 1K9MR 4JLGA 2KBTA 2QGFB 4NOYA 1AWOA 1LNXA 1O9SA 5FLXE 2COZA 4E7SA 2GQVA 2YSQA 1AZGB 4FSXA 2J7IA 2K9GA 2LQNA 2K3BA 5FU6B 4A4GA 2MK5A 2LT4A 3OW2A 2COYA 4M75E 5FU7B 1YITQ 3V7CA 2KRSA 4FYYB 1NG2A 2DKGA 1EFNA 2A3LA 3X28B 5GAMe 1YIJT 3QYGB 4L5GA 4BI3A 3KXTA 5CQYA 3CD6Q 3FJPA 1MGQA 3OYKA 3MPUB 2EKOA 1VQMQ 1QVFS 4AFUC 1D1BA 3CCLQ 2ZPIB 4OMMA 2DL8A 2LQ8A 1U3OA 4LXCA 3M0SA 4F7UB 2KQWA 1NBEB 4HCCA 2YUQA 1RAGB 1HXDA 2K5LA 1WHMA 1KSWA 1LPLA 3LW5E 2XDDA 1G3TA 4XTXA 1JJ2P 1B7TA 2EQMA 4AFZC 4B6MA 1YJNA 3NTKA 1WIEA 3JCMP 3M53A 5HY6A 3CCJQ 1VQ6A 1WJRA 5IN1A 1D3BB 1Q82C 2WACA 1YJ9T 2CYZB 1OYXA 4PFPA 1M2VA 3G71A 2RI2A 2EYZA 2LCSA 2P0QA 1KHCA 2MF2A 4X9DA 2QTXA 5KYUA 3G7ZA 2K5FA 2DYBA 3QUIA 2QAZA 2DD5A 3TSWA 1OOTA 2HKQB 4JJBA 1QP3A 1BCMA 4Y91A 2DF6A 5IXFA 5KYWA 4QQDA 3L2VA 2O4XB 2DZCA 2B8AA 5J39A 3HPWA 4PLLA 4LN2A 4E47A 3CMAT 1VQLA 4OF1A 3CXCP 3OSVA 1TTHB 1UE9A 3PVQA 4N4HA 2OTJA 4LDWA 1BI1A 2A08A 1SHFA 4KGVB 5D6XA 3C4SA 4JRPA 4NS5A 4FIBA 1X27A 2F2WA 4M77C 5CKFA 1R77A 3ME9A 1KC8U 1VYUA 1YJWA 1KG1A 3BY7A 3T9NA 3MJXA 3P8DA 2QGGA 1AT1B 4M7DF 1X6GA 5LJ5g 4Z02A 5CVIA 1VQOT 1T0HA 1KD1C 1S72T 2CP0A 3CBMA 1UFFA 5GMKe 5GAN6 2LC4A 3JSCA 2VKNA 2D1XA 2ZAEA 3ZEHA 3J80E 1PKSA 1QVGA 1VQKQ 1K73C 4JJCA 1Y57A 2EQKA 2CUDA 4HCZA 1UGQB 2YRDA 4M77D 1WDXA 3C95A 3ZL7C 3U23A 2ZPGB 4WTOB 2FRWA 1RAFB 2KEAA 2QEXT 5LJ5f 3LH5A 5LJ3h 4C0GA 1I81A 3NGPA 1Q7YR 5FWBA 5I21A 3FEOA 4PJJA 3CMET 4M7AC 1D09B 2SEMA 4BY6B 1T3SA 3PT9A 2PUOB 4KH1B 2MMPA 1M5Q1 4C8QD 4RTTA 1G3YA 1VQPA 2DNUA 1ZUYA 3LYIA 5A0LA 1IHWA 3NTHA 4M77A 2RK2A 3LWIA 3M58A 1WQ7A 1FX7A 1VQ9T 2E5KA 5LJ3d 5AT1B 1AWJA 2BIVA 2A7YA 5I11A 4M75B 2EIFA 3C12A 2QQBA 4Z89A 3HSBA 2DL4A 2DTIA 5CKBA 2JM9A 4RG2A 3CC4T 4M7AD 2YHTA 1LVKA 1WFWA 2RM4A 1TUGB 3MEWA 4FYVB 1JRIA 2JMCA 2R5AA 1TXQA 2O88A 2L89A 3JCMf 3EG0A 4C8QA 4F16A 3QWYA 3JRZA 2AHJB 4C92D 1K9MU 1QVFA 2QQ9A 3OMCA 4C5HA 1NLOC 5I2MA 2X35A 2YLBA 4JS4A 4DBHA 3VYGA 1S1NA 2E65A 1GBQA 2QI2A 3TCJA 1K73R 3LH0A 1M8MA 5GMKl 3QYHB 3UPUA 4GY5A 2E6NA 2F69A 1YNZA 2FZKB 2GCXA 2RHZA 3QHSA 4M7AA 2MPXC 1PHTA 1YJ9A 3HKSA 4Q5WA 2K2VA 3SB2A 4XAXB 3SFMA 5DM7R 1Y96B 5FW9A 1OX9A 3CXCS 4PFOA 4J9IA 4J9CA 4OVAA 2CZ7B 4C92A 1AOJA 3EH1A 3NHNA 4J7IA 3INZA 4IUQA 2O9SA 4J7FA 1NZ9A 4O6JA 3M4GA 1QVPA 1PRMC 2YRCA 5CKHA 3I55T 1XNIA 2EAYA 3CBOA 1VQNT 3HFNA 4HT9A 1Y7XA 2ED1A 2K2MA 3CMAA 2HD0A 5GJVB 3GIBA 1ZSZA 3EGXA 4HA8A 4M77E 3A8OB 1EX4A 4IUPA 3HP9A 3RKXA 3GP8A 3SWNC 1YBYA 2AK5A 3OYMA 1M90C 2K79A 3HHTB 3V8LA 3DLLA 3LGLA 1PCXA 3X26B 1QLYA 2P0KA 4PJOC 2WSCE 2J6KA 3VUZA 3GBQA 1UUEA 2NLUA 3M0UA 2RHUA 5GANg 1S72A 1EIFA 4XK8E 4CRIA 2IVWA 4E7LA 1V1CA 4C8QE 3CCSQ 2EVRA 5IT9E 1N27A 3SEMA 1RAEB 1H3ZA 1WX6A 1RABB 2Y4XA 4E7KA 2E10A 2RJDA 4AG2C 3RNJA 4ESRA 1LJOA 4X34A 4KRTA 1X01A 5GJWB 3BFMA 4PJOD 4PJLA 3D7SB 1ZBJA 1V76A 2QEXA 1YITT 3CCUQ 2XK0A 2YXYA 2EGCA 2D6FA 2G6FX 1YCSB 5GANf 3BE3A 4M7AE 2PU9B 1GBRA 1UJYA 2J6FA 1PM3A 3FRNA 3CPWS 2DXUA 3CD6T 5GAMj 3CMEA 1M8VA 2CP7A 4NL2A 5GAOr 5GAN8 3CCLT 3HRSA 4C92E 1QW1A 3EG2A 1YI2T 5EG2A 1GCPA 1UDLA 4J9FA 1MMNA 5KYUB 2KXDA 5KH6A 2RQUA 1K0XA 2EGAA 1X2KA 2V8KA 5CK9A 1IGQA 4PJOA 1VQ4T 2BKDN 1M1KC 4MZPA 2KRNA 2LJ1A 1VQ9A 3G6EA 2QA4T 1VQ6T 2M0YA 2ZPBB 2VGNA 5LJ5h 1RACB 2MOXA 4DEYA 3AT1B 5LJ3j 3CC4A 3TU4K 2OX7A 2CZ6B 3V8KA 3CCJT 4EMKC 4OB1B 3MEAA 1K8AC 3TSZA 1Q7YU 1TS9A 4IURA 4M75G 1M30A 1WNLA 4M78D 1G5VA 3HFOA 4M4ZA 1TH7A 1OZ3A 1V29B 3N5BB 1KJWA 2YUPA 4DA4A 3WVEB 2P4RA 2HZYA 2KROA 1JJ2A 2PVDB 3CPFA 3M4YA 1UG1A 1VQLT 3L2RA 4E7HA 4R55A 3JV3A 3MEVA 2ZCFB 2FB7A 2DYIA 3R6NA 2OTJT 4M78G 4CC4B 1RLPC 1U1TA 4J9EA 3LWHA 3JCMV 1ZA2B 1D0XA 4C0DC 1UGVA 1UEBA 1R0BG 3CCVQ 3ZBDA 5IAYA 2LX9A 2KVQG 3PMTA 2CP5A 1H3HA 3EG9A 4UC4A 1JQQA 5GAOn 1NM7A 2DJZA 2DBMA 4M78A 5CKEA 2JVVA 2R5MA 2KNBB 1VIFA 4D8KA 3OS0A 2K6DA 2CZ1B 2IIMA 3META 5KYYA 4OB2B 2ROLA 3VS0A 3JCMh 5FRMA 5D6WA 4C0FA 1WA7A 4RTWA 2H3EB 3CXCA 4MMLA 2EFIA 3GF5A 3I55A 2JS2A 5IHNA 2MWPA 3QDFA 2ZPHB 1VQNA 4MDXA 1H92A 3L2QA 2DFUA 5KE3A 4DEXA 3CCEA 5IHIA 1K73U 4PJOE 2CP3A 2VVKA 2X4JA 2E70A 1M1KR 2M0OA 2RN8A 1C6VX 2CP2A 3CC2Q 2DERA 2CP6A 2FVUA 4M75F 3CCQQ 1NPPA 4FYXB 1T0JA 2AT1B 3MP6A 4FT4A 2GF7A 3MKDA 4N0AC 3OQ5A 1X75C 1K8AR 2EJ9A 3JCMd 3ULRB 1Q81R 2CH4A 4BD3A 3P8BB 2YUNA 4QVCA 1VQPT 1N6AA 4M7DC 2HEQA 1B34A 1QKWA 1VYTA 1WXTA 2RHIA 4DBQA 4EIKA 5L8RE 3PFSA 4HCKA 1TUCA 3HL8A 4LNPA 4E6RA 4N4IA 4C8QB 5KCOA 2WSFE 2XMFA 1D0YA 2KMTA 5GMKm 3CCRQ 2ESWA 2RQWA 4AT1B 3E9FA 2RA2A 3JCMJ 2DLPA 1YITA 4GLMA 3PGGA 2M16A 1PNJA 1VQ7Q 2K57A 3Q1JA 3TQ7P 4IUVA 2XIDA 4L6V5 2QTVA 3CD6A 4M78E 2MI6A 1VQMA 4ZTFA 3CCLA 1NEBA 5IHKA 2J6OA 3CC7Q 3NFCA 1YI2A 2XU8A 3SHWA 3E2UA 2EBPA 1WQWA 4RUGA 2RF0A 4EDUA 3OYHA 1EZZB 1IB8A 1UECA 3KBGA 3EGDA 3OYGA 7AT1B 5LJ3e 1FXXA 1Y07A 3OA6A 2QQSA 3I56T 3FJ5A 4HXJA 2FEIA 3EGUA 4LUEA 1SPKA 2DZ9A 1PSFA 2CDTA 1VQ4A 4XU1A 4BI4A 4J9HA 2YWWA 1WLPB 4Z8AA 5DY9A 2QG9B 3BDUA 4N0AA 2QA4A 2XG8D 1PKTA 1SRLA 1K4US 3UA6A 1VA7A 1YJNQ 2GQIA 2JM8A 4XU0A 1DJ7B 1M1GA 2KT1A 5GANh 4RTUA 1BKBA 1ZSZB 2JOYA 2KK4A 3CCJA 3P8HA 3VKIA 2IPOB 3G71Q 2DE0X 2KR3A 2FYKA 3FC3A 2DTOA 2LRQA 3H0HA 4XTYA 3THKA 4BE1A 1YWPA 1VUBA 2EJFA 1NYFA 1TUDA 4WCIA 1Q95G 4ZGDB 3EFOB 2CGHA 4AMCA 2XHCA 4ELYC 4X9CA 1WHKA 4P5NA 2D0NA 1GCQC 1OU9A 4IUUA 3HRUA 1VIEA 4OMOA 1Z9ZA 3OS1A 2JT4A 1J3TA 1P92A 1KQSS 4KH0B 4NL3A 1QWFA 4PJMA 1BU1A 2L5QA 2KT8A 2E64A 3M59A 3V8JA 2OI3A 5GANd 1YHQT 4ELZC 2DPPB 1BI0A 2ZZDA 2KE9A 2XKOC 1ARKA 4J8OA 1PC0A 3VS2A 1HD3A 3VS4A 2M1HA 3JB9H 1QCFA 2H8HA 1ZA1B 2OTLQ 4OMNA 4BUGA 1OQKA 1JBMA 2DEUA 1SG5A 5C6SA 1VQKA 3V7RA 2PVGB 3OYLA 2HCKA 5FU6C 1GXIE 3TREA 1YP5A 4HVUA 4LDYA 3QZ9B 2YT6A 1U1SA 3EG1A 2RHYA 5FU7C 4BACA 1Q82R 3G4SQ 2ECZA 3M54A 2KYMA 4B9XA 4GLKA 2CUBA 1SF9A 3JCMc 2EW3A 2D8JA 4DQ2A 4KBMB 3CQTA 4M77G 2ZPFB 1Z9QA 1AVZC 1N5ZA 2A36A 1GCQA 3MHXA 2EYQA 4JRIA 5M9OA 4J6WA 2RJFA 3OYCA 4Y28E 1M3AA 2JXBA 3MEUA 1VYVA 4OMPA 2E1HA 3OYEA 2GGRA 3CPWP 1WHHA 4J6XA 3JCMX 2HQXA 3OSSC 3G6ET 2JJ9A 3PMIA 1FWZA 2JTMA 2LQWA 3OYDA 2EWNA 2ABLA 2JMAA 4KUIA 4C8QG 2LMJA 1KQ1A 5A0DA 1BBZA 1IGUA 1YWOA 1YIJQ 1M1KU 2CZ0B 1ABQA 3LLRA 3OYYA 2LCCA 1I8FA 3FLGA 1MMAA 4QT7A 1RLQC 1X6OA 2EYYA 2LJ3A 3RUXA 3M0TA 1KD1R 3UATA 1K8AU 3DB4A 3FIFA 1OEBA 3RDVA 1Q81U 5D7UA 2V8IA 3BDLA 4M78B 4D8DA 4M7AG 3RIRA 1WI7A 2V1QA 1BIBA 2NWMA 2E3IA 3NTIA 3MP8A 3I56A 2E5QA 2HL5C 1ZSGA 3M57A 1MV3A 2HKNA 5J3BA 4JUVA 3E19A 1CKAA 4C92G 2Y4YA 1OU8A 4M77F 2YUOA 2PVOB 2JTEA 3H41A 3A8HB 1X69A 2X4WA 3VYHB 1I0CA 4JJDA 5A2QE 4KGZB 4F7UA 3QIIA 3MCAB 4OGEA 2D9TA 3EFSA 4RG8A 1ZQ1A 2A37A 4LD6A 5CAIA 2PZ1A 3ER0A 5LJ5e 3MP1A 3VRZA 3CCET 1MUZA 6AT1B 4C8QF 4FCYA 3CMAQ 2K5IA 2LP5A 1HJDA 1M9SA 2F5TX 2M51A 3O5ZA 4RTYA 1U06A 1C0MA 2PNIA 2LCLA 3CBPA 1RUWA 3TEEA 1UB4A 3QXEB 1YHQA 4FU6A 2QDYB 1QWEA 2OAUA 1R8OB 2MWOA 1KC8C 2CT4A 2Y90A 2KXCA 3L42A 4DBRA 1RAAB 4M7AF 1VQOQ 3EAEA 2FHDA 1S72Q 3OMGA 4MZTA 1VQ5Q 1MV0B 3M55A 5KE2A 2DO3A 4QQGA 3CCSA 4BY6C 2BZXA 4C92F 4OMFB 3JB9D 4K11A 1OV3A 2RMOA 2EJGA 4ZN1A 2BZ8A 1XQHA 1XTDA 2LQKA 3PIPA 1XOVA 2VUBA 4E7JA 4RCCA 4HVWA 4BDZA 1WXBA 3JCMe 2RD1A 3A8GB 3EFRA 4J9BA 2DXCA 4DBFA 3VS7A 1MMDA 2HBWA 2DVEA 1OI1A 4EPCA 1RL2A 4QVDA 2FPEA 1OPLA 1N8RC 1VQMT 1VQ7T 3TVTA 1TSFA 4M75C 1M2VB 4F7UE 1BIAA 4PJOG 1BCOA 4ME7A 1WPYA 3SWNA 3PIOA 2O9VA 4F17A 3CC7T 1IHVA 4PLIA 1K9AA 2NUTA 2L2PA 1VOMA 3OYFA 1W70A 2XD0A 2YDLA 3H8ZA 2YRVA 2GFAA 3ASKA 5GAMg 3G1JA 3C94A 1FMWA 4JZ3A 1GRIA 5KYWB 2KDSA 2J05A 2LVMA 4AFSC 4PKCC 2IG0A 3OYNA 1VQ9Q 1OX8A 3OYIA 1M90R 1ZBXA 2C0IA 1VQ8Q 1Q82U 3O8VA 2AZSA 2MIOA 1JO8A 3RBBB 2KAFA 1OULA 2QXFA 4JRQA 1TG0A 1G3SA 2VWFA 4QW2A 2DA9A 2FL7A 4A4KA 1I1JA 1K76A 2HQHA 4J6YA 1K9MC 2DVJA 5GAMf 5IH2A 2FRYA 2MYSA 5LJ3g 2EYXA 2VGMA 4KULA 5CKDA 1AHJB 1WXUA 4QKUA 1AWWA 1TOVA 1UHCA 2NUPA 1X6BA 4LD9K 4ZTJA 1JU5C 3JCMQ 1Q86C 5KYXA 5LJ5d 3VUBA 5KYNA 1XJWB 1WHGA 2QK0A 1G8XA 2DL3A 3NMZC 4PJNA 3GPLA 4D6WA 1E6GA 1Y71A 4KGXB 1KK7A 2LDMA 2XDBA 2DMOA 1H8KA 4EMHA 4PJOF 4E2FB 3RR6A 4Y92A 1WYXA 4F14A 2AKLA 4OMLA 1KQSP 1N8RR 3M0PA 5GAN4 4PFZA 1KQ2A 1KD1U 1JEGA 2LNHB 3CCMQ 4IUTA 1G3WA 4IKFA 4PL6A 2ZPEB 1JB0E 2K3XA 3DLMA 2QYZA 5GANe 3EHQA 4XTVA 1I4K1 1VQKT 1VQNQ 4EMKA 2LTOA 2J06A 1B07A 3KFVA 3JB9J 1PG5B 1I07A 1D0ZA 2JTFA 5CIUA 4ZGEB 1MHNA 5GAOq 4M77B 2GTJA 1PD0A 1UTIA 4PNOA 2QASA 1N9SA 1OZ2A 3CC2A 1MMGA 3CCQA 4HT8A 3G4ST 2F2XA 3QO3A 1M2OA 4XTWA 5HK0A 3HTRA 3FDRA 1W2BS 1M1FA 2GNCA 3URGA 3V7SA 5KCHA 4YTLA 1BYMA 2RI3A 4M78F 2BUDA 2C0TA 4BI8B 2DXBA 2Z0WA 4II1A 1LOJA 1GL5A 2FPFA 1U8RA 2AIRB 3UDCA 4ZNXA 2DL5A 2H3JA 4J9GA 5C0MA 1Q86R 2W10A 1CSKA 1E7OA 2EPDA 4MDWA 3A98A 5GAOl 4QVZA 4X1VA 2X51A 3CCRA 1NEGA 4ZGJB 1M4ZA 2O01E 4CC3A 1FMKA 1MNEA 4M7DD 3QWXX 5CQXA 1VQ7A 2JS0A 1U5SA 4M7AB 1W4SA 2RQRA 3SDZA 2WSEE 1ABOA 4JJNK 3JB9I 3CPWA 5GAOp 1FYNA 3L2ZA 1C1AA 2V1RA 1YI2Q 3CC7A 4C92B 3RMQA 1NJIC 2F5KA 4JRKA 4JDSA 2DILA 4OB3B 3H9NA 4M7DG 1N9RA 4KT0E 1RAHB 3QZ5B 2HSPA 1D1CA 2COWA 1SSHA 2VXFA 2X4XA 4Z88A 2DEQA 1VQ4Q 1IZ6A 2KY9A 2P0PA 4V2SA 2VXEA 3HRTA 4HVVA 4DOVA 4HCBA 2QA4Q 1VQ6Q 3EGXB 2DTHA 1IRXA 2O31A 8ATCB 4M7DA 2PQWA 1UGSB 2EKHA 2JUFA 1MNDA 2VC8A 4DOWA 1G2BA 5ECAA 1KHIA 1Q7YC 2GFUA 2RNAA 2XDPA 4GBQA 4FYWB 1QMCA 1NE8A 2E12A 3VU3C 1UGRB 3VS1A 1NYGA 5AYFA 2AZVA 5DLQE 3VV0A 1PSEA 1BB9A 3X25B 5HKCA 3EG3A 4BE0A 2X4YA 3BW1A 3OB9A 1AD5A 1YCYA 1QCOA 2DXTA 1VQLQ 2KGTA 4OB0B 2SRCA 3OS2A 2E41A 2OTJQ 4FT2A 5LJ5j 3PE0A 2QQRA 1X43A 2LX7A 2RO0A 4FM4B 2AKKA 4TVRA 2EQUA 3VRYA 1RI0A 3VS3A 1M90U 1YJWQ 1T3LA 2RQVA 2JN0A 5FWCA 3OYAA 2HMAA 2DBKA 1ZHIA 4QQ6A 2BE7D 4RTVA 5GAMh 3CCST 3M56A 3A8LB 3L2WA 1HSQA 2ROTA 2C0OA 1SEMA 1VQ5T 3OS5A 1D1AA 3QDRB 1NJIR 2OTLA 2L8DA 2B86A 1K1ZA 1RAIB 2LT1A 2E4HA 4XTUA 1GFDA 3ZFJA 1WJQA 3SWNB 3DKMA 1M3CA 4C5EA 3M0QA 5GAN5 1FMVA 4BE2A
chains in the Genus database with same CATH topology
1YJNQ 1YJ9Q 1VQ4Q 2OTLQ 1K73R 1M1KR 1KQSP 1N8RR 1KC8R 3CC2Q 2OTJQ 1YHQQ 1Q86R 1VQMQ 3CCEQ 3CCQQ 3CCVQ 3CPWP 2QA4Q 1VQPQ 1VQ7Q 3CXCP 3CMAQ 1VQ6Q 3CCLQ 3CCUQ 3CCSQ 3OW2P 1YI2Q 1VQOQ 3CMEQ 3G71Q 1YJWQ 3CCMQ 1YITQ 1VQ9Q 1W2BP 1KD1R 1S72Q 1JJ2P 1QVFP 1NJIR 1K9MR 1M90R 3G6EQ 1VQ5Q 3I56Q 3CD6Q 1VQLQ 1K8AR 3CCJQ 1VQ8Q 3I55Q 2QEXQ 3CCRQ 1Q7YR 1Q81R 1QVGP 3CC7Q 1YIJQ 1VQNQ 3CC4Q 1Q82R 1VQKQ 3G4SQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN Q;  1YJ9 Q;  1VQ4 Q;  2OTL Q;  1K73 R;  1M1K R;  1KQS P;  1N8R R;  1KC8 R;  3CC2 Q;  2OTJ Q;  1YHQ Q;  1Q86 R;  1VQM Q;  3CCE Q;  3CCQ Q;  3CCV Q;  3CPW P;  2QA4 Q;  1VQP Q;  1VQ7 Q;  3CXC P;  3CMA Q;  1VQ6 Q;  3CCL Q;  3CCU Q;  3CCS Q;  3OW2 P;  1YI2 Q;  1VQO Q;  3CME Q;  3G71 Q;  1YJW Q;  3CCM Q;  1YIT Q;  1VQ9 Q;  1W2B P;  1KD1 R;  1S72 Q;  1JJ2 P;  1QVF P;  1NJI R;  1K9M R;  1M90 R;  3G6E Q;  1VQ5 Q;  3I56 Q;  3CD6 Q;  1VQL Q;  1K8A R;  3CCJ Q;  1VQ8 Q;  3I55 Q;  2QEX Q;  3CCR Q;  1Q7Y R;  1Q81 R;  1QVG P;  3CC7 Q;  1YIJ Q;  1VQN Q;  3CC4 Q;  1Q82 R;  1VQK Q;  3G4S Q; 
#chains in the Genus database with same CATH topology
 2NUT B;  3UT1 A;  2CS7 A;  4C8Q C;  2QQA A;  4PJO B;  3CCU T;  3QKJ A;  1W6X A;  2E6Z A;  4B9W A;  3EHR A;  3OW2 P;  2OJ2 A;  2L3Q A;  4M7D E;  1BK2 A;  2RB6 A;  3E9G A;  3G4S A;  2YLC A;  2RQT A;  1CKB A;  3A1P A;  3X24 B;  4EMG A;  2EYW A;  3H0F A;  4N4G A;  5GAM d;  1N8R U;  2CKK A;  3H6Z A;  4RTX A;  2GBQ A;  3RKW A;  3NPF A;  4J83 A;  1BI2 A;  1B3Q A;  1VQP Q;  4LE9 A;  4RMO A;  1WJS A;  1W2B A;  2DAQ A;  4A63 B;  1G83 A;  3UWN A;  1M3B A;  3UA7 A;  4XU2 A;  3A8M B;  3RKY A;  2A28 A;  4IIM A;  3R6O A;  4LUD A;  4MMK A;  3JCM g;  1SHG A;  2BE9 B;  2VYT A;  4C92 C;  2LNV A;  5LL6 S;  2NUP B;  4OGC A;  4RKU E;  1SRM A;  2OAW A;  5I22 A;  5KYX B;  1YIJ A;  4AG1 C;  2PUK B;  2DK3 A;  1VQ8 T;  3GOX A;  1ZSZ C;  4JS5 A;  3EG9 B;  3A5Z B;  2RHX A;  4C5G A;  3VS5 A;  2CSI A;  5KYY B;  4A4H A;  1JJ2 S;  3OBY A;  3PNW C;  1I5L A;  1WZO A;  1ZLM A;  3I9Q A;  2P4T A;  3I56 Q;  1K0S A;  2CT3 A;  3OYB A;  3OBW A;  4F7U G;  1RAD B;  3QJ6 A;  3REA B;  2DIQ A;  1TWB A;  2LJ0 A;  5GMK h;  1F1B B;  4FL6 A;  1SKU B;  1Q86 U;  1AEY A;  1YJ9 Q;  2FO0 A;  2FZG B;  4EMK B;  3CCV T;  3OY9 A;  3L2U A;  1PD1 A;  2RK1 A;  1GFC A;  4CC7 A;  1QKX A;  3I5R A;  2VV5 A;  3RES A;  5GMK i;  1PRL C;  4C5I A;  1JXO A;  1OPK A;  2FZC B;  3I35 A;  3I5S A;  5HCK A;  2XI9 A;  1WHL A;  2NUZ A;  4FW1 A;  3JAM E;  5GAN 2;  3QBY A;  1KIK A;  2D0Q B;  4OMQ A;  1H64 1;  4R0K A;  3CCM T;  1IXD A;  2DIG A;  2K3Y A;  2O2O A;  1UHF A;  1B34 B;  1A0N B;  1D3B A;  2GTO A;  3QJY A;  4C0D B;  1IRE B;  1Y0M A;  1QVG P;  5GAO m;  2HAX A;  5GAN j;  3CC2 T;  1KQS A;  2RI5 A;  4MZM A;  4OP0 A;  2DET A;  1M27 C;  3JCM b;  3CCQ T;  4KUD K;  1YHQ Q;  4PK4 A;  3REB B;  3GNG A;  2HL3 A;  5CO7 A;  3S3M A;  1R0C B;  2DL7 A;  2M9U A;  2RH2 A;  1QQJ A;  3QSU A;  3EFO A;  2CRE A;  2DRK A;  2O4X A;  1W1F A;  3FB9 A;  5EC7 A;  2XIC A;  3PVL A;  1VQO A;  5GAN 7;  3OW2 S;  5FRO A;  4F7U F;  1VQ5 A;  3AHU A;  4AFQ C;  2FG0 A;  4XQ3 A;  3H0I A;  3E1S A;  2KI7 A;  2X3W D;  1QCN A;  2DD4 A;  1W2B P;  3EGD B;  3VS6 A;  1KFZ A;  2G3R A;  4LDV A;  2RJC A;  2VAS A;  2P84 A;  2HDA A;  2JNG A;  2KSS A;  2E3H A;  3CCR T;  2RJE A;  2QEX Q;  5GAN 3;  1LCK A;  1NLP C;  5J26 A;  1UGP B;  3CCU A;  4JZ4 A;  1UJ0 A;  3SD4 A;  3JB9 G;  2ZGW A;  4A4F A;  4CC2 A;  3VJP A;  5A0G A;  3JCM W;  1YN8 A;  4LDU A;  2EQI A;  3CME Q;  4E7I A;  2L3P A;  3C0C A;  3RER A;  1WGS A;  4M7D B;  1X2Q A;  2X3X D;  3DB3 A;  1ZUU A;  3CEY A;  1HYO A;  4JLI A;  2ATC B;  4M78 C;  1NJI U;  1ZUK A;  3LGF A;  2ENM A;  1HK9 A;  1QVF P;  2DRM A;  2ED0 A;  3G6E Q;  9ATC B;  2NYS A;  4R56 A;  4M75 D;  4LDX A;  2L3S A;  4O5V A;  4RCB A;  3QPH A;  2V26 A;  1YJN T;  3CC4 Q;  1NPR A;  3L1A A;  1KC8 R;  2K4Y A;  1YFN A;  2DJQ A;  1VQ8 A;  3G71 T;  2HSE B;  2W0Z A;  3WVD B;  1RI9 A;  4CI0 C;  4ATO A;  1JXM A;  3UF4 A;  3MO8 A;  1Q81 C;  1O75 A;  4J5Y A;  4XTZ A;  4HKE A;  4JPB W;  2X9H A;  4A54 A;  1PWT A;  2KRM A;  2A0F B;  3IQL A;  2FPD A;  2HNI A;  1IO6 A;  1QP2 A;  1I5O B;  3GNF B;  1AWX A;  3M9Q A;  5HK3 A;  2K7A A;  4L59 A;  4M75 A;  4C0Z A;  3PTA A;  2CSQ A;  2JW4 A;  2F1L A;  1SSF A;  3JB9 F;  3EH2 A;  2CH4 W;  3S3O A;  3QG1 A;  4A53 A;  4ORZ A;  1TU0 B;  2VB6 A;  3M5A A;  5CCA A;  2DX1 A;  2JZ2 A;  4FW2 A;  2R57 A;  3CCV A;  2I0N A;  2V8J A;  3RMS A;  2D8H A;  2BTT A;  4J9D A;  5LJ3 f;  4VUB A;  2MCN A;  2L0A A;  8AT1 B;  4E7Z A;  1YJW T;  4BDY A;  2QDL A;  4FSS A;  2PTK A;  1ACM B;  2F2V A;  4ZN3 A;  3S3N A;  2RPN A;  2BZY A;  1QVG S;  5D6Y A;  4XU3 A;  1WHJ A;  2R58 A;  5I2S A;  1ZX6 A;  3I55 Q;  1BI3 A;  3KUF A;  4ANJ A;  2OTL T;  3CCM A;  2LZ6 B;  3WXM B;  3CCE Q;  3LX7 A;  4RTZ A;  3X20 B;  5FRN A;  4BB7 A;  3OYJ A;  2I2L A;  5L23 A;  2EGE A;  2MAM A;  4A4E A;  4F04 B;  1E6H A;  2KYB A;  2M02 A;  5CR2 A;  2DM1 A;  4WF2 A;  5GMK j;  1Y96 A;  3GLX A;  2C06 A;  3J81 E;  5IXB A;  2HQE A;  3S6W A;  4IIO A;  3M0R A;  2HBP A;  5DLO A;  2L3R A;  3F70 A;  1AZE A;  2EQJ A;  3J7A F;  1K9M R;  4JLG A;  2KBT A;  2QGF B;  4NOY A;  1AWO A;  1LNX A;  1O9S A;  5FLX E;  2COZ A;  4E7S A;  2GQV A;  2YSQ A;  1AZG B;  4FSX A;  2J7I A;  2K9G A;  2LQN A;  2K3B A;  5FU6 B;  4A4G A;  2MK5 A;  2LT4 A;  3OW2 A;  2COY A;  4M75 E;  5FU7 B;  1YIT Q;  3V7C A;  2KRS A;  4FYY B;  1NG2 A;  2DKG A;  1EFN A;  2A3L A;  3X28 B;  5GAM e;  1YIJ T;  3QYG B;  4L5G A;  4BI3 A;  3KXT A;  5CQY A;  3CD6 Q;  3FJP A;  1MGQ A;  3OYK A;  3MPU B;  2EKO A;  1VQM Q;  1QVF S;  4AFU C;  1D1B A;  3CCL Q;  2ZPI B;  4OMM A;  2DL8 A;  2LQ8 A;  1U3O A;  4LXC A;  3M0S A;  4F7U B;  2KQW A;  1NBE B;  4HCC A;  2YUQ A;  1RAG B;  1HXD A;  2K5L A;  1WHM A;  1KSW A;  1LPL A;  3LW5 E;  2XDD A;  1G3T A;  4XTX A;  1JJ2 P;  1B7T A;  2EQM A;  4AFZ C;  4B6M A;  1YJN A;  3NTK A;  1WIE A;  3JCM P;  3M53 A;  5HY6 A;  3CCJ Q;  1VQ6 A;  1WJR A;  5IN1 A;  1D3B B;  1Q82 C;  2WAC A;  1YJ9 T;  2CYZ B;  1OYX A;  4PFP A;  1M2V A;  3G71 A;  2RI2 A;  2EYZ A;  2LCS A;  2P0Q A;  1KHC A;  2MF2 A;  4X9D A;  2QTX A;  5KYU A;  3G7Z A;  2K5F A;  2DYB A;  3QUI A;  2QAZ A;  2DD5 A;  3TSW A;  1OOT A;  2HKQ B;  4JJB A;  1QP3 A;  1BCM A;  4Y91 A;  2DF6 A;  5IXF A;  5KYW A;  4QQD A;  3L2V A;  2O4X B;  2DZC A;  2B8A A;  5J39 A;  3HPW A;  4PLL A;  4LN2 A;  4E47 A;  3CMA T;  1VQL A;  4OF1 A;  3CXC P;  3OSV A;  1TTH B;  1UE9 A;  3PVQ A;  4N4H A;  2OTJ A;  4LDW A;  1BI1 A;  2A08 A;  1SHF A;  4KGV B;  5D6X A;  3C4S A;  4JRP A;  4NS5 A;  4FIB A;  1X27 A;  2F2W A;  4M77 C;  5CKF A;  1R77 A;  3ME9 A;  1KC8 U;  1VYU A;  1YJW A;  1KG1 A;  3BY7 A;  3T9N A;  3MJX A;  3P8D A;  2QGG A;  1AT1 B;  4M7D F;  1X6G A;  5LJ5 g;  4Z02 A;  5CVI A;  1VQO T;  1T0H A;  1KD1 C;  1S72 T;  2CP0 A;  3CBM A;  1UFF A;  5GMK e;  5GAN 6;  2LC4 A;  3JSC A;  2VKN A;  2D1X A;  2ZAE A;  3ZEH A;  3J80 E;  1PKS A;  1QVG A;  1VQK Q;  1K73 C;  4JJC A;  1Y57 A;  2EQK A;  2CUD A;  4HCZ A;  1UGQ B;  2YRD A;  4M77 D;  1WDX A;  3C95 A;  3ZL7 C;  3U23 A;  2ZPG B;  4WTO B;  2FRW A;  1RAF B;  2KEA A;  2QEX T;  5LJ5 f;  3LH5 A;  5LJ3 h;  4C0G A;  1I81 A;  3NGP A;  1Q7Y R;  5FWB A;  5I21 A;  3FEO A;  4PJJ A;  3CME T;  4M7A C;  1D09 B;  2SEM A;  4BY6 B;  1T3S A;  3PT9 A;  2PUO B;  4KH1 B;  2MMP A;  1M5Q 1;  4C8Q D;  4RTT A;  1G3Y A;  1VQP A;  2DNU A;  1ZUY A;  3LYI A;  5A0L A;  1IHW A;  3NTH A;  4M77 A;  2RK2 A;  3LWI A;  3M58 A;  1WQ7 A;  1FX7 A;  1VQ9 T;  2E5K A;  5LJ3 d;  5AT1 B;  1AWJ A;  2BIV A;  2A7Y A;  5I11 A;  4M75 B;  2EIF A;  3C12 A;  2QQB A;  4Z89 A;  3HSB A;  2DL4 A;  2DTI A;  5CKB A;  2JM9 A;  4RG2 A;  3CC4 T;  4M7A D;  2YHT A;  1LVK A;  1WFW A;  2RM4 A;  1TUG B;  3MEW A;  4FYV B;  1JRI A;  2JMC A;  2R5A A;  1TXQ A;  2O88 A;  2L89 A;  3JCM f;  3EG0 A;  4C8Q A;  4F16 A;  3QWY A;  3JRZ A;  2AHJ B;  4C92 D;  1K9M U;  1QVF A;  2QQ9 A;  3OMC A;  4C5H A;  1NLO C;  5I2M A;  2X35 A;  2YLB A;  4JS4 A;  4DBH A;  3VYG A;  1S1N A;  2E65 A;  1GBQ A;  2QI2 A;  3TCJ A;  1K73 R;  3LH0 A;  1M8M A;  5GMK l;  3QYH B;  3UPU A;  4GY5 A;  2E6N A;  2F69 A;  1YNZ A;  2FZK B;  2GCX A;  2RHZ A;  3QHS A;  4M7A A;  2MPX C;  1PHT A;  1YJ9 A;  3HKS A;  4Q5W A;  2K2V A;  3SB2 A;  4XAX B;  3SFM A;  5DM7 R;  1Y96 B;  5FW9 A;  1OX9 A;  3CXC S;  4PFO A;  4J9I A;  4J9C A;  4OVA A;  2CZ7 B;  4C92 A;  1AOJ A;  3EH1 A;  3NHN A;  4J7I A;  3INZ A;  4IUQ A;  2O9S A;  4J7F A;  1NZ9 A;  4O6J A;  3M4G A;  1QVP A;  1PRM C;  2YRC A;  5CKH A;  3I55 T;  1XNI A;  2EAY A;  3CBO A;  1VQN T;  3HFN A;  4HT9 A;  1Y7X A;  2ED1 A;  2K2M A;  3CMA A;  2HD0 A;  5GJV B;  3GIB A;  1ZSZ A;  3EGX A;  4HA8 A;  4M77 E;  3A8O B;  1EX4 A;  4IUP A;  3HP9 A;  3RKX A;  3GP8 A;  3SWN C;  1YBY A;  2AK5 A;  3OYM A;  1M90 C;  2K79 A;  3HHT B;  3V8L A;  3DLL A;  3LGL A;  1PCX A;  3X26 B;  1QLY A;  2P0K A;  4PJO C;  2WSC E;  2J6K A;  3VUZ A;  3GBQ A;  1UUE A;  2NLU A;  3M0U A;  2RHU A;  5GAN g;  1S72 A;  1EIF A;  4XK8 E;  4CRI A;  2IVW A;  4E7L A;  1V1C A;  4C8Q E;  3CCS Q;  2EVR A;  5IT9 E;  1N27 A;  3SEM A;  1RAE B;  1H3Z A;  1WX6 A;  1RAB B;  2Y4X A;  4E7K A;  2E10 A;  2RJD A;  4AG2 C;  3RNJ A;  4ESR A;  1LJO A;  4X34 A;  4KRT A;  1X01 A;  5GJW B;  3BFM A;  4PJO D;  4PJL A;  3D7S B;  1ZBJ A;  1V76 A;  2QEX A;  1YIT T;  3CCU Q;  2XK0 A;  2YXY A;  2EGC A;  2D6F A;  2G6F X;  1YCS B;  5GAN f;  3BE3 A;  4M7A E;  2PU9 B;  1GBR A;  1UJY A;  2J6F A;  1PM3 A;  3FRN A;  3CPW S;  2DXU A;  3CD6 T;  5GAM j;  3CME A;  1M8V A;  2CP7 A;  4NL2 A;  5GAO r;  5GAN 8;  3CCL T;  3HRS A;  4C92 E;  1QW1 A;  3EG2 A;  1YI2 T;  5EG2 A;  1GCP A;  1UDL A;  4J9F A;  1MMN A;  5KYU B;  2KXD A;  5KH6 A;  2RQU A;  1K0X A;  2EGA A;  1X2K A;  2V8K A;  5CK9 A;  1IGQ A;  4PJO A;  1VQ4 T;  2BKD N;  1M1K C;  4MZP A;  2KRN A;  2LJ1 A;  1VQ9 A;  3G6E A;  2QA4 T;  1VQ6 T;  2M0Y A;  2ZPB B;  2VGN A;  5LJ5 h;  1RAC B;  2MOX A;  4DEY A;  3AT1 B;  5LJ3 j;  3CC4 A;  3TU4 K;  2OX7 A;  2CZ6 B;  3V8K A;  3CCJ T;  4EMK C;  4OB1 B;  3MEA A;  1K8A C;  3TSZ A;  1Q7Y U;  1TS9 A;  4IUR A;  4M75 G;  1M30 A;  1WNL A;  4M78 D;  1G5V A;  3HFO A;  4M4Z A;  1TH7 A;  1OZ3 A;  1V29 B;  3N5B B;  1KJW A;  2YUP A;  4DA4 A;  3WVE B;  2P4R A;  2HZY A;  2KRO A;  1JJ2 A;  2PVD B;  3CPF A;  3M4Y A;  1UG1 A;  1VQL T;  3L2R A;  4E7H A;  4R55 A;  3JV3 A;  3MEV A;  2ZCF B;  2FB7 A;  2DYI A;  3R6N A;  2OTJ T;  4M78 G;  4CC4 B;  1RLP C;  1U1T A;  4J9E A;  3LWH A;  3JCM V;  1ZA2 B;  1D0X A;  4C0D C;  1UGV A;  1UEB A;  1R0B G;  3CCV Q;  3ZBD A;  5IAY A;  2LX9 A;  2KVQ G;  3PMT A;  2CP5 A;  1H3H A;  3EG9 A;  4UC4 A;  1JQQ A;  5GAO n;  1NM7 A;  2DJZ A;  2DBM A;  4M78 A;  5CKE A;  2JVV A;  2R5M A;  2KNB B;  1VIF A;  4D8K A;  3OS0 A;  2K6D A;  2CZ1 B;  2IIM A;  3MET A;  5KYY A;  4OB2 B;  2ROL A;  3VS0 A;  3JCM h;  5FRM A;  5D6W A;  4C0F A;  1WA7 A;  4RTW A;  2H3E B;  3CXC A;  4MML A;  2EFI A;  3GF5 A;  3I55 A;  2JS2 A;  5IHN A;  2MWP A;  3QDF A;  2ZPH B;  1VQN A;  4MDX A;  1H92 A;  3L2Q A;  2DFU A;  5KE3 A;  4DEX A;  3CCE A;  5IHI A;  1K73 U;  4PJO E;  2CP3 A;  2VVK A;  2X4J A;  2E70 A;  1M1K R;  2M0O A;  2RN8 A;  1C6V X;  2CP2 A;  3CC2 Q;  2DER A;  2CP6 A;  2FVU A;  4M75 F;  3CCQ Q;  1NPP A;  4FYX B;  1T0J A;  2AT1 B;  3MP6 A;  4FT4 A;  2GF7 A;  3MKD A;  4N0A C;  3OQ5 A;  1X75 C;  1K8A R;  2EJ9 A;  3JCM d;  3ULR B;  1Q81 R;  2CH4 A;  4BD3 A;  3P8B B;  2YUN A;  4QVC A;  1VQP T;  1N6A A;  4M7D C;  2HEQ A;  1B34 A;  1QKW A;  1VYT A;  1WXT A;  2RHI A;  4DBQ A;  4EIK A;  5L8R E;  3PFS A;  4HCK A;  1TUC A;  3HL8 A;  4LNP A;  4E6R A;  4N4I A;  4C8Q B;  5KCO A;  2WSF E;  2XMF A;  1D0Y A;  2KMT A;  5GMK m;  3CCR Q;  2ESW A;  2RQW A;  4AT1 B;  3E9F A;  2RA2 A;  3JCM J;  2DLP A;  1YIT A;  4GLM A;  3PGG A;  2M16 A;  1PNJ A;  1VQ7 Q;  2K57 A;  3Q1J A;  3TQ7 P;  4IUV A;  2XID A;  4L6V 5;  2QTV A;  3CD6 A;  4M78 E;  2MI6 A;  1VQM A;  4ZTF A;  3CCL A;  1NEB A;  5IHK A;  2J6O A;  3CC7 Q;  3NFC A;  1YI2 A;  2XU8 A;  3SHW A;  3E2U A;  2EBP A;  1WQW A;  4RUG A;  2RF0 A;  4EDU A;  3OYH A;  1EZZ B;  1IB8 A;  1UEC A;  3KBG A;  3EGD A;  3OYG A;  7AT1 B;  5LJ3 e;  1FXX A;  1Y07 A;  3OA6 A;  2QQS A;  3I56 T;  3FJ5 A;  4HXJ A;  2FEI A;  3EGU A;  4LUE A;  1SPK A;  2DZ9 A;  1PSF A;  2CDT A;  1VQ4 A;  4XU1 A;  4BI4 A;  4J9H A;  2YWW A;  1WLP B;  4Z8A A;  5DY9 A;  2QG9 B;  3BDU A;  4N0A A;  2QA4 A;  2XG8 D;  1PKT A;  1SRL A;  1K4U S;  3UA6 A;  1VA7 A;  1YJN Q;  2GQI A;  2JM8 A;  4XU0 A;  1DJ7 B;  1M1G A;  2KT1 A;  5GAN h;  4RTU A;  1BKB A;  1ZSZ B;  2JOY A;  2KK4 A;  3CCJ A;  3P8H A;  3VKI A;  2IPO B;  3G71 Q;  2DE0 X;  2KR3 A;  2FYK A;  3FC3 A;  2DTO A;  2LRQ A;  3H0H A;  4XTY A;  3THK A;  4BE1 A;  1YWP A;  1VUB A;  2EJF A;  1NYF A;  1TUD A;  4WCI A;  1Q95 G;  4ZGD B;  3EFO B;  2CGH A;  4AMC A;  2XHC A;  4ELY C;  4X9C A;  1WHK A;  4P5N A;  2D0N A;  1GCQ C;  1OU9 A;  4IUU A;  3HRU A;  1VIE A;  4OMO A;  1Z9Z A;  3OS1 A;  2JT4 A;  1J3T A;  1P92 A;  1KQS S;  4KH0 B;  4NL3 A;  1QWF A;  4PJM A;  1BU1 A;  2L5Q A;  2KT8 A;  2E64 A;  3M59 A;  3V8J A;  2OI3 A;  5GAN d;  1YHQ T;  4ELZ C;  2DPP B;  1BI0 A;  2ZZD A;  2KE9 A;  2XKO C;  1ARK A;  4J8O A;  1PC0 A;  3VS2 A;  1HD3 A;  3VS4 A;  2M1H A;  3JB9 H;  1QCF A;  2H8H A;  1ZA1 B;  2OTL Q;  4OMN A;  4BUG A;  1OQK A;  1JBM A;  2DEU A;  1SG5 A;  5C6S A;  1VQK A;  3V7R A;  2PVG B;  3OYL A;  2HCK A;  5FU6 C;  1GXI E;  3TRE A;  1YP5 A;  4HVU A;  4LDY A;  3QZ9 B;  2YT6 A;  1U1S A;  3EG1 A;  2RHY A;  5FU7 C;  4BAC A;  1Q82 R;  3G4S Q;  2ECZ A;  3M54 A;  2KYM A;  4B9X A;  4GLK A;  2CUB A;  1SF9 A;  3JCM c;  2EW3 A;  2D8J A;  4DQ2 A;  4KBM B;  3CQT A;  4M77 G;  2ZPF B;  1Z9Q A;  1AVZ C;  1N5Z A;  2A36 A;  1GCQ A;  3MHX A;  2EYQ A;  4JRI A;  5M9O A;  4J6W A;  2RJF A;  3OYC A;  4Y28 E;  1M3A A;  2JXB A;  3MEU A;  1VYV A;  4OMP A;  2E1H A;  3OYE A;  2GGR A;  3CPW P;  1WHH A;  4J6X A;  3JCM X;  2HQX A;  3OSS C;  3G6E T;  2JJ9 A;  3PMI A;  1FWZ A;  2JTM A;  2LQW A;  3OYD A;  2EWN A;  2ABL A;  2JMA A;  4KUI A;  4C8Q G;  2LMJ A;  1KQ1 A;  5A0D A;  1BBZ A;  1IGU A;  1YWO A;  1YIJ Q;  1M1K U;  2CZ0 B;  1ABQ A;  3LLR A;  3OYY A;  2LCC A;  1I8F A;  3FLG A;  1MMA A;  4QT7 A;  1RLQ C;  1X6O A;  2EYY A;  2LJ3 A;  3RUX A;  3M0T A;  1KD1 R;  3UAT A;  1K8A U;  3DB4 A;  3FIF A;  1OEB A;  3RDV A;  1Q81 U;  5D7U A;  2V8I A;  3BDL A;  4M78 B;  4D8D A;  4M7A G;  3RIR A;  1WI7 A;  2V1Q A;  1BIB A;  2NWM A;  2E3I A;  3NTI A;  3MP8 A;  3I56 A;  2E5Q A;  2HL5 C;  1ZSG A;  3M57 A;  1MV3 A;  2HKN A;  5J3B A;  4JUV A;  3E19 A;  1CKA A;  4C92 G;  2Y4Y A;  1OU8 A;  4M77 F;  2YUO A;  2PVO B;  2JTE A;  3H41 A;  3A8H B;  1X69 A;  2X4W A;  3VYH B;  1I0C A;  4JJD A;  5A2Q E;  4KGZ B;  4F7U A;  3QII A;  3MCA B;  4OGE A;  2D9T A;  3EFS A;  4RG8 A;  1ZQ1 A;  2A37 A;  4LD6 A;  5CAI A;  2PZ1 A;  3ER0 A;  5LJ5 e;  3MP1 A;  3VRZ A;  3CCE T;  1MUZ A;  6AT1 B;  4C8Q F;  4FCY A;  3CMA Q;  2K5I A;  2LP5 A;  1HJD A;  1M9S A;  2F5T X;  2M51 A;  3O5Z A;  4RTY A;  1U06 A;  1C0M A;  2PNI A;  2LCL A;  3CBP A;  1RUW A;  3TEE A;  1UB4 A;  3QXE B;  1YHQ A;  4FU6 A;  2QDY B;  1QWE A;  2OAU A;  1R8O B;  2MWO A;  1KC8 C;  2CT4 A;  2Y90 A;  2KXC A;  3L42 A;  4DBR A;  1RAA B;  4M7A F;  1VQO Q;  3EAE A;  2FHD A;  1S72 Q;  3OMG A;  4MZT A;  1VQ5 Q;  1MV0 B;  3M55 A;  5KE2 A;  2DO3 A;  4QQG A;  3CCS A;  4BY6 C;  2BZX A;  4C92 F;  4OMF B;  3JB9 D;  4K11 A;  1OV3 A;  2RMO A;  2EJG A;  4ZN1 A;  2BZ8 A;  1XQH A;  1XTD A;  2LQK A;  3PIP A;  1XOV A;  2VUB A;  4E7J A;  4RCC A;  4HVW A;  4BDZ A;  1WXB A;  3JCM e;  2RD1 A;  3A8G B;  3EFR A;  4J9B A;  2DXC A;  4DBF A;  3VS7 A;  1MMD A;  2HBW A;  2DVE A;  1OI1 A;  4EPC A;  1RL2 A;  4QVD A;  2FPE A;  1OPL A;  1N8R C;  1VQM T;  1VQ7 T;  3TVT A;  1TSF A;  4M75 C;  1M2V B;  4F7U E;  1BIA A;  4PJO G;  1BCO A;  4ME7 A;  1WPY A;  3SWN A;  3PIO A;  2O9V A;  4F17 A;  3CC7 T;  1IHV A;  4PLI A;  1K9A A;  2NUT A;  2L2P A;  1VOM A;  3OYF A;  1W70 A;  2XD0 A;  2YDL A;  3H8Z A;  2YRV A;  2GFA A;  3ASK A;  5GAM g;  3G1J A;  3C94 A;  1FMW A;  4JZ3 A;  1GRI A;  5KYW B;  2KDS A;  2J05 A;  2LVM A;  4AFS C;  4PKC C;  2IG0 A;  3OYN A;  1VQ9 Q;  1OX8 A;  3OYI A;  1M90 R;  1ZBX A;  2C0I A;  1VQ8 Q;  1Q82 U;  3O8V A;  2AZS A;  2MIO A;  1JO8 A;  3RBB B;  2KAF A;  1OUL A;  2QXF A;  4JRQ A;  1TG0 A;  1G3S A;  2VWF A;  4QW2 A;  2DA9 A;  2FL7 A;  4A4K A;  1I1J A;  1K76 A;  2HQH A;  4J6Y A;  1K9M C;  2DVJ A;  5GAM f;  5IH2 A;  2FRY A;  2MYS A;  5LJ3 g;  2EYX A;  2VGM A;  4KUL A;  5CKD A;  1AHJ B;  1WXU A;  4QKU A;  1AWW A;  1TOV A;  1UHC A;  2NUP A;  1X6B A;  4LD9 K;  4ZTJ A;  1JU5 C;  3JCM Q;  1Q86 C;  5KYX A;  5LJ5 d;  3VUB A;  5KYN A;  1XJW B;  1WHG A;  2QK0 A;  1G8X A;  2DL3 A;  3NMZ C;  4PJN A;  3GPL A;  4D6W A;  1E6G A;  1Y71 A;  4KGX B;  1KK7 A;  2LDM A;  2XDB A;  2DMO A;  1H8K A;  4EMH A;  4PJO F;  4E2F B;  3RR6 A;  4Y92 A;  1WYX A;  4F14 A;  2AKL A;  4OML A;  1KQS P;  1N8R R;  3M0P A;  5GAN 4;  4PFZ A;  1KQ2 A;  1KD1 U;  1JEG A;  2LNH B;  3CCM Q;  4IUT A;  1G3W A;  4IKF A;  4PL6 A;  2ZPE B;  1JB0 E;  2K3X A;  3DLM A;  2QYZ A;  5GAN e;  3EHQ A;  4XTV A;  1I4K 1;  1VQK T;  1VQN Q;  4EMK A;  2LTO A;  2J06 A;  1B07 A;  3KFV A;  3JB9 J;  1PG5 B;  1I07 A;  1D0Z A;  2JTF A;  5CIU A;  4ZGE B;  1MHN A;  5GAO q;  4M77 B;  2GTJ A;  1PD0 A;  1UTI A;  4PNO A;  2QAS A;  1N9S A;  1OZ2 A;  3CC2 A;  1MMG A;  3CCQ A;  4HT8 A;  3G4S T;  2F2X A;  3QO3 A;  1M2O A;  4XTW A;  5HK0 A;  3HTR A;  3FDR A;  1W2B S;  1M1F A;  2GNC A;  3URG A;  3V7S A;  5KCH A;  4YTL A;  1BYM A;  2RI3 A;  4M78 F;  2BUD A;  2C0T A;  4BI8 B;  2DXB A;  2Z0W A;  4II1 A;  1LOJ A;  1GL5 A;  2FPF A;  1U8R A;  2AIR B;  3UDC A;  4ZNX A;  2DL5 A;  2H3J A;  4J9G A;  5C0M A;  1Q86 R;  2W10 A;  1CSK A;  1E7O A;  2EPD A;  4MDW A;  3A98 A;  5GAO l;  4QVZ A;  4X1V A;  2X51 A;  3CCR A;  1NEG A;  4ZGJ B;  1M4Z A;  2O01 E;  4CC3 A;  1FMK A;  1MNE A;  4M7D D;  3QWX X;  5CQX A;  1VQ7 A;  2JS0 A;  1U5S A;  4M7A B;  1W4S A;  2RQR A;  3SDZ A;  2WSE E;  1ABO A;  4JJN K;  3JB9 I;  3CPW A;  5GAO p;  1FYN A;  3L2Z A;  1C1A A;  2V1R A;  1YI2 Q;  3CC7 A;  4C92 B;  3RMQ A;  1NJI C;  2F5K A;  4JRK A;  4JDS A;  2DIL A;  4OB3 B;  3H9N A;  4M7D G;  1N9R A;  4KT0 E;  1RAH B;  3QZ5 B;  2HSP A;  1D1C A;  2COW A;  1SSH A;  2VXF A;  2X4X A;  4Z88 A;  2DEQ A;  1VQ4 Q;  1IZ6 A;  2KY9 A;  2P0P A;  4V2S A;  2VXE A;  3HRT A;  4HVV A;  4DOV A;  4HCB A;  2QA4 Q;  1VQ6 Q;  3EGX B;  2DTH A;  1IRX A;  2O31 A;  8ATC B;  4M7D A;  2PQW A;  1UGS B;  2EKH A;  2JUF A;  1MND A;  2VC8 A;  4DOW A;  1G2B A;  5ECA A;  1KHI A;  1Q7Y C;  2GFU A;  2RNA A;  2XDP A;  4GBQ A;  4FYW B;  1QMC A;  1NE8 A;  2E12 A;  3VU3 C;  1UGR B;  3VS1 A;  1NYG A;  5AYF A;  2AZV A;  5DLQ E;  3VV0 A;  1PSE A;  1BB9 A;  3X25 B;  5HKC A;  3EG3 A;  4BE0 A;  2X4Y A;  3BW1 A;  3OB9 A;  1AD5 A;  1YCY A;  1QCO A;  2DXT A;  1VQL Q;  2KGT A;  4OB0 B;  2SRC A;  3OS2 A;  2E41 A;  2OTJ Q;  4FT2 A;  5LJ5 j;  3PE0 A;  2QQR A;  1X43 A;  2LX7 A;  2RO0 A;  4FM4 B;  2AKK A;  4TVR A;  2EQU A;  3VRY A;  1RI0 A;  3VS3 A;  1M90 U;  1YJW Q;  1T3L A;  2RQV A;  2JN0 A;  5FWC A;  3OYA A;  2HMA A;  2DBK A;  1ZHI A;  4QQ6 A;  2BE7 D;  4RTV A;  5GAM h;  3CCS T;  3M56 A;  3A8L B;  3L2W A;  1HSQ A;  2ROT A;  2C0O A;  1SEM A;  1VQ5 T;  3OS5 A;  1D1A A;  3QDR B;  1NJI R;  2OTL A;  2L8D A;  2B86 A;  1K1Z A;  1RAI B;  2LT1 A;  2E4H A;  4XTU A;  1GFD A;  3ZFJ A;  1WJQ A;  3SWN B;  3DKM A;  1M3C A;  4C5E A;  3M0Q A;  5GAN 5;  1FMV A;  4BE2 A; 
#chains in the Genus database with same CATH homology
 1YJN Q;  1YJ9 Q;  1VQ4 Q;  2OTL Q;  1K73 R;  1M1K R;  1KQS P;  1N8R R;  1KC8 R;  3CC2 Q;  2OTJ Q;  1YHQ Q;  1Q86 R;  1VQM Q;  3CCE Q;  3CCQ Q;  3CCV Q;  3CPW P;  2QA4 Q;  1VQP Q;  1VQ7 Q;  3CXC P;  3CMA Q;  1VQ6 Q;  3CCL Q;  3CCU Q;  3CCS Q;  3OW2 P;  1YI2 Q;  1VQO Q;  3CME Q;  3G71 Q;  1YJW Q;  3CCM Q;  1YIT Q;  1VQ9 Q;  1W2B P;  1KD1 R;  1S72 Q;  1JJ2 P;  1QVF P;  1NJI R;  1K9M R;  1M90 R;  3G6E Q;  1VQ5 Q;  3I56 Q;  3CD6 Q;  1VQL Q;  1K8A R;  3CCJ Q;  1VQ8 Q;  3I55 Q;  2QEX Q;  3CCR Q;  1Q7Y R;  1Q81 R;  1QVG P;  3CC7 Q;  1YIJ Q;  1VQN Q;  3CC4 Q;  1Q82 R;  1VQK Q;  3G4S Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...