2YSQA

Solution structure of the sh3 domain from rho guanine nucleotide exchange factor 9
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
81
structure length
81
Chain Sequence
GSSGSSGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQEDEVEEGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain from Rho guanine nucleotide exchange factor 9
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 9
total genus 4
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ysqA00
4OMOA 1RLPC 2YUNA 2RF0A 2LQNA 2HCKA 2RMOA 1MUZA 3O5ZA 1A0NB 2YSQA 2KYBA 2C0IA 1TUDA 2SRCA 1K1ZA 2LNHB 2D0NA 3VS4A 1K0SA 1WFWA 1VYVA 1OEBA 2CDTA 3ZL7C 1PHTA 4OMNA 1YWOA 4JZ3A 2KXCA 1PNJA 1ZSGA 2ECZA 1YNZA 1T3SA 4AFSC 1AZGB 4HVUA 1UJ0A 4CC3A 1NYFA 2RN8A 1Y0MA 2LCSA 3QWXX 2OI3A 4AFQC 4Y92A 3EG3A 1SEMA 2DL4A 4GBQA 2A08A 2DILA 5IHNA 2GGRA 2JXBA 1K0XA 2DRMA 2GTOA 2DJQA 3I9QA 4JJBA 1QLYA 1AOJA 4R0KA 2FRYA 4J9DA 4X1VA 5IHIA 2V1QA 4D8DA 4RTVA 3KFVA 2LJ3A 3SHWA 3VS0A 2LZ6B 2RNAA 3TVTA 3LH5A 1CSKA 4J9FA 2JT4A 2DYBA 1X2QA 5I11A 3FJ5A 1QWEA 2EYWA 1NEBA 1SSHA 1T3LA 2RPNA 3NHNA 1WI7A 1K76A 3I5RA 1X2KA 4D8KA 4Z89A 2F2VA 1M3BA 4HVVA 1WXTA 1GCQA 3GBQA 4DEYA 2ABLA 2LJ1A 4RTXA 2C0OA 1VYTA 5IXFA 2KBTA 4Z88A 1N5ZA 2BZ8A 2LJ0A 2W0ZA 4F17A 2SEMA 1U5SA 3QWYA 3H0HA 3M0QA 4M4ZA 2BZYA 2D8HA 3JV3A 2YUOA 1QWFA 2J6OA 1NM7A 2F2XA 2F2WA 2YDLA 1TG0A 1ZLMA 4JPBW 4WCIA 1GRIA 1M30A 5FWCA 1HJDA 4IIOA 1XOVA 4JZ4A 3CQTA 2DVJA 2K6DA 4LE9A 2CH4W 2HBWA 2LX7A 4J9GA 3TSWA 2O31A 1NYGA 2CT3A 3EG1A 2H8HA 3REAB 2MIOA 1T0JA 2KYMA 1EFNA 1KSWA 1IO6A 5GJVB 1YN8A 4LUEA 2B86A 2GTJA 1YWPA 3EG2A 3VS2A 4F16A 1PKTA 2KEAA 3VS7A 5IHKA 2EW3A 2L0AA 4LN2A 2ED0A 2KNBB 2J7IA 2VWFA 1UHFA 1RLQC 1FMKA 1NEGA 5FW9A 2IIMA 1Y57A 3EHRA 1JQQA 2O9VA 1UTIA 1PRLC 2EGEA 2E5KA 1I1JA 1RI9A 2JMCA 1JXOA 4AG2C 1ABOA 1GFDA 4EIKA 2RQUA 5EC7A 1BU1A 2GNCA 4FSSA 1VA7A 2DE0X 4ESRA 1AWXA 4ORZA 1NG2A 1MV0B 1QCFA 1AZEA 2XMFA 3A98A 1UDLA 2YUQA 1BBZA 1W1FA 1X43A 1WDXA 2DM1A 4DEXA 1AVZC 1AWJA 2EKHA 2AKKA 2K2MA 1S1NA 2YT6A 1WLPB 1KFZA 1WYXA 3VRZA 2C0TA 1M3CA 1E7OA 2DL8A 1H92A 3R6NA 1U3OA 3UA6A 4LNPA 2W10A 2ROLA 1PWTA 2K79A 5HCKA 2BTTA 3VS3A 1B3QA 2G6FX 3PVLA 1ZUYA 1VYUA 2FPEA 1K9AA 1B07A 1JO8A 1GCQC 1JU5C 2L3QA 4Z8AA 1OPKA 2JMAA 2HEQA 4QT7A 1GFCA 2DRKA 2PTKA 2LQWA 2AKLA 3ULRB 2DL3A 2EVRA 1UG1A 1H8KA 1X69A 2DA9A 2PZ1A 2D8JA 2PNIA 1KIKA 2D1XA 1ARKA 2EGAA 2DL7A 1YP5A 2OJ2A 2GBQA 5FWBA 2A36A 2ENMA 3M0TA 2M0YA 4RTWA 1WIEA 4HCKA 1NLPC 4CC2A 1PRMC 2DMOA 2M51A 3UA7A 2K7AA 2P4RA 2O9SA 2VVKA 1OV3A 2EYZA 1AWOA 2KRMA 1X6GA 4IIMA 2RQRA 3H41A 4RTUA 2CUDA 1ZBJA 3M0PA 3M0SA 2K9GA 2CT4A 2KT1A 2MOXA 1G2BA 1WX6A 2AZSA 1JXMA 1K4US 2CUBA 1GBQA 5IXBA 2FO0A 2V1RA 1UHCA 4KRTA 1SRMA 2J6FA 1UJYA 2JM9A 2JM8A 1CKAA 3NMZC 3VS6A 2DLPA 2EPDA 2KROA 2JS0A 2KXDA 2DX1A 2MCNA 3RNJA 1X27A 1BB9A 1SHGA 2FEIA 2YUPA 1TUCA 2QDLA 1JEGA 1G83A 2JTEA 1GBRA 1ZUKA 3H0FA 1OOTA 3TSZA 1UUEA 2DBMA 3PE0A 2JW4A 1BK2A 4F14A 1WXUA 2HSPA 3UF4A 3IQLA 3M0RA 1LCKA 3EHQA 2KGTA 2FPFA 2L3SA 4LUDA 4OMMA 4CC4B 1AD5A 4J9HA 4J9CA 1FYNA 2CREA 3VS5A 2ED1A 1W70A 2EYYA 5I22A 1T0HA 1WA7A 1I07A 2I0NA 2O2OA 4RUGA 5L23A 1AEYA 4RTYA 3UATA 2RQVA 1NLOC 1GCPA 4HVWA 1HD3A 1PKSA 2KT8A 1QKWA 1W6XA 2KR3A 1Z9QA 2EGCA 2OAWA 2FRWA 2BZXA 2GQIA 1I0CA 1YCSB 4GLMA 3PVQA 2EYXA 1E6GA 1HSQA 1SRLA 2DNUA 1WXBA 4E6RA 4JJDA 4OMLA 1J3TA 1V1CA 2L2PA 1X6BA 3I5SA 4AG1C 1UE9A 2JS2A 1UGVA 1MV3A 2KRSA 3VS1A 4RTZA 2LP5A 2CH4A 2J06A 3C0CA 4AFZC 1E6HA 4OMPA 4K11A 4J9BA 1GL5A 2X3XD 2EBPA 2ESWA 2FPDA 5ECAA 2A28A 2ROTA 1M8MA 2KRNA 1AWWA 1RUWA 4AFUC 1M3AA 3I35A 1Z9ZA 1ZX6A 4J9EA 3EG0A 3REBB 3U23A 2O88A 4OMQA 1U06A 1SHFA 4J9IA 1ZUUA 3RBBB 2J05A 2RQWA 3SEMA 2J6KA 1ABQA 1CKBA 2X3WD 1H3HA 2A37A 2CSIA 1KJWA 2FG0A 3THKA 2DF6A 2DBKA 1M27C 1UECA 2HDAA 2VKNA 3H0IA 3NGPA 3VRYA 2LMJA 1QKXA 4ZNXA 4HXJA 2K3BA 3M0UA 2NUZA 2DL5A 2AK5A 2EQIA 2CSQA 2KE9A 4CC7A 1SPKA 5GJWB 3NPFA 2AZVA 3EGUA 1OPLA 1UFFA 4A63B 5IH2A 4JJCA 4RTTA 2NWMA 2RQTA 2L3PA
chains in the Genus database with same CATH superfamily
4X9DA 2RF0A 2QK0A 2BIVA 4J83A 2RMOA 1WPYA 2YSQA 4OVAA 3DB3A 2C0IA 2CYZB 2DZ9A 3CCMA 3UPUA 1MMGA 1PD1A 2MK5A 4BE1A 2CDTA 2V8IA 3QO3A 2AHJB 1YJNA 2JUFA 5GANh 1ZSGA 1KK7A 4XU1A 1VQNT 2ECZA 1T3SA 4M77E 1TU0B 2HQXA 3HFOA 1Q82C 2XG8D 5GAN7 2QEXA 2LCSA 3QWXX 1YJNT 4AFQC 2DL4A 2DD4A 3HRTA 3O8VA 5LJ5h 3LW5E 5KCOA 2DJQA 4FYWB 3JCMQ 4R0KA 4J9DA 4X1VA 3EG9B 4RTVA 2QGFB 4DOVA 4FSXA 4CI0C 1K9MR 5CKDA 3OYYA 1RAIB 1PSFA 2RJFA 3Q1JA 4RG2A 3CCRT 5FRMA 3CXCP 2E1HA 5KYNA 2EYWA 1WJQA 1T3LA 4HT9A 2MWPA 1WI7A 1IGQA 2K5IA 1X2KA 1VIFA 1MMDA 1YJ9Q 3QDRB 4J8OA 1VQKQ 2MI6A 1VQ9T 4KGZB 1GCQA 4JRQA 1QW1A 1U1SA 2LJ1A 1BI3A 2X4YA 2C0OA 4ELYC 2BZ8A 1G3TA 2SEMA 3QWYA 3H0HA 1EX4A 2D8HA 5FROA 2ZZDA 1KQSA 2J6OA 3HFNA 1NM7A 4M75E 2YDLA 3VU3C 6AT1B 1ZLMA 5GMKl 2NUTA 3VJPA 4IIOA 5I2SA 4E7IA 3CPFA 4JRPA 2CS7A 3E9FA 2HKNA 3CQTA 2K6DA 1IXDA 2BE7D 2HBWA 3EH2A 2D0QB 1NYGA 2CT3A 3EG1A 3REAB 1JBMA 1M2OA 4PJJA 1QVFP 1EFNA 4XU2A 1IO6A 3CC7Q 2QYZA 4XTUA 3H8ZA 3VV0A 4C92B 2DK3A 4A54A 5CQXA 5GJVB 2A7YA 5IHKA 2KEAA 5LJ3g 2L0AA 2O01E 3CCVA 3CCQT 2J7IA 1UHFA 2VYTA 2YHTA 1NEGA 1M4ZA 2XK0A 3OY9A 4IUPA 3JCMJ 2EQKA 4EMKB 3JB9I 2QA4T 4C8QE 3EHRA 2K3XA 5GAOn 4RMOA 1JQQA 1M1KC 1M1GA 1JXOA 1XTDA 1ABOA 1QVFS 3MP6A 3V8KA 2OAUA 1BU1A 2DE0X 3E2UA 1NG2A 1MV0B 1QCFA 4E47A 4M7AF 1ZSZC 1AZEA 2G3RA 3A98A 4JDSA 2R5AA 2VUBA 1UGSB 4DEXA 2EKHA 5LJ5f 3FIFA 2JJ9A 4M75D 1WLPB 2E6NA 1WYXA 4NS5A 1M3CA 3L2WA 1N8RU 2JZ2A 3L2VA 1H92A 3UA6A 1Q7YR 2W10A 3PMIA 2XDPA 3KXTA 3OMGA 2JTFA 1G3WA 2L3RA 4M7AG 3F70A 2IPOB 3CPWA 3CCUA 3OYAA 3FRNA 5GANg 2HQEA 4M75A 2E65A 1M1KU 4M77C 3JCMW 1N8RR 3J81E 4J6WA 2HEQA 1GFCA 2MAMA 4XAXB 1X01A 2PTKA 1VQ7T 1VQ9Q 2AKLA 2ZPBB 1YITQ 2DL3A 1UG1A 3CCUT 1X69A 1S72A 2D8JA 2PNIA 3NTIA 2D1XA 3EFOA 2DL7A 4QVCA 4C8QG 2OJ2A 5GMKh 1Q86U 3UA7A 2DMOA 2M51A 4M7DG 2VXEA 2DTHA 2CP2A 1WZOA 3ZFJA 1AWOA 5GAMe 3WVEB 4DOWA 3OQ5A 2K9GA 3M9QA 2A0FB 3J7AF 3P8HA 2MOXA 4C92A 1WX6A 1K8AU 2E10A 1K4US 2WSEE 1GBQA 1W4SA 2E41A 5DY9A 1TTHB 1VQOT 2J6FA 5KYXA 4KH1B 1UJYA 3NMZC 4JLGA 2ZPIB 2KXDA 2MCNA 3L2ZA 4DBRA 3RNJA 1X27A 2FEIA 1K8AC 3RMSA 2QDLA 3A1PA 1VQ4T 4E7HA 1ZQ1A 1LVKA 2JTEA 4F7UB 1ZUKA 3G6ET 1OOTA 3PE0A 2JW4A 4F14A 3OYFA 1IREB 5GAOq 3IQLA 2LX9A 3EHQA 2VV5A 5D7UA 2XDDA 1W2BP 1OU8A 3CC2A 2RD1A 1FYNA 1M90R 3VS5A 3G4ST 2ED1A 1N8RC 2HKQB 1D1AA 5GAN2 8ATCB 2AT1B 1I07A 3MCAB 3SWNB 1C0MA 4RUGA 3CMAQ 4FL6A 4RTYA 3UATA 1BI0A 4ZTFA 4M78C 4HVWA 2CP3A 1I5LA 1OX8A 1PKSA 3CMAT 2KR3A 5IAYA 4P5NA 4GY5A 5D6XA 4IUTA 2ZGWA 4M7AD 1I0CA 1U1TA 1VQ6T 4OB2B 3QZ9B 3JCMe 1E6GA 4C92F 4V2SA 4JJDA 4BY6B 3BDUA 4M7DB 2DD5A 4N4HA 1UE9A 3TREA 2QEXQ 3MO8A 3G71A 2LP5A 2J06A 3C0CA 3MP8A 2K5LA 2RJDA 4OMPA 4LDUA 1AT1B 4FT4A 2CP0A 2X3XD 2ESWA 2FPDA 2HZYA 5ECAA 5GAOm 1BKBA 4M78E 4FU6A 1VQ8T 2RJEA 3EG0A 3OYEA 4OMQA 4J9IA 4MMKA 4JUVA 3MEVA 3M58A 4GLKA 1UGQB 4JS5A 3A8HB 3UT1A 4C5IA 5KYUA 3QSUA 2EQJA 2CSIA 1MHNA 4ME7A 2EJFA 2CP5A 2EAYA 1VQ9A 1IHVA 3X24B 1PC0A 3EFSA 2VKNA 4PNOA 4PLIA 3OW2S 4ZNXA 3EGDB 3AT1B 1VQPA 2V8KA 2NUZA 2AK5A 2EQIA 2KE9A 3M55A 4PFOA 5GJWB 3G71Q 2AZVA 3LH0A 1OPLA 1UFFA 4A63B 2RM4A 3G4SQ 3RERA 4M7AE 1HXDA 1RLPC 2QASA 3LWHA 2YUNA 2LQNA 1MUZA 2X4JA 4ZN1A 2KYBA 4KGVB 4C0DC 3RESA 4MZPA 4PLLA 5GMKe 2LNHB 2D0NA 1Q82R 2JVVA 1OEBA 3MJXA 3JCMg 2KXCA 1SG5A 2CGHA 1Q82U 2BUDA 2YWWA 3OYMA 2ZPGB 4X9CA 1YNZA 2XD0A 4R55A 4AFSC 3S6WA 2RK1A 1WQ7A 2DETA 1UJ0A 4A4HA 4KH0B 3OYKA 3FC3A 4KT0E 2LNVA 1HYOA 4GBQA 1JB0E 2DILA 3PGGA 3CCMT 2DRMA 2F69A 2NUPA 3V8LA 1JRIA 1AOJA 4C92D 2FRYA 1NPRA 3QBYA 5IHIA 3H9NA 3SHWA 1O9SA 3KUFA 2RNAA 3DKMA 3OMCA 1I81A 1Q81C 4M75B 5A0GA 3LH5A 1D09B 1CSKA 1YJ9T 4BACA 5CIUA 4NL3A 3FJ5A 5FU7B 4QW2A 2JOYA 4MDXA 2I2LA 3JCMh 1NEBA 1SSHA 5A0LA 3NHNA 4MDWA 3X25B 2CZ7B 1K76A 4B6MA 3I5RA 4DA4A 2K4YA 1VQLQ 4BY6C 1PD0A 4MZTA 5HY6A 1M2VA 2F2VA 1G3SA 3OS0A 1NJIC 4BI3A 2KY9A 3V7RA 3D7SB 4C5EA 3MEWA 4C92E 1PM3A 1VQMT 1VYTA 4EMKA 2KBTA 4Z88A 3OBYA 5FRNA 5J39A 4M77G 2CZ0B 2YUOA 1QWFA 1D3BB 1MMNA 3CMEA 1RADB 4JPBW 5GAN4 1VQ7A 4ATOA 4IUQA 3MKDA 3OYHA 5DM7R 2LVMA 1RAHB 4JZ4A 3G1JA 1VQMQ 3J80E 4QQDA 4LE9A 2FZKB 3OYGA 3C12A 2BKDN 4C0GA 2LRQA 4OB1B 1T0JA 3JB9J 2KYMA 1D0XA 3RR6A 3JB9F 2NUTB 4VUBA 3OS2A 3BY7A 1YJ9A 1BI2A 3WXMB 4BUGA 4JS4A 2B86A 1YWPA 3EG2A 3VS2A 2EW3A 1D0YA 3DLLA 2DEQA 3G4SA 2KNBB 4O6JA 2VWFA 5FU6B 3BW1A 5GAMh 4OP0A 5FW9A 5GAOr 2XICA 5GAN5 2QQRA 1G8XA 4PKCC 1DJ7B 2E5KA 1FWZA 1I1JA 1YCYA 1GFDA 2GFAA 4EIKA 4M77A 2EJGA 3I56A 1VQMA 4PJOB 1VA7A 1R77A 4A53A 1H3ZA 1B7TA 3DLMA 4ESRA 4KULA 3RIRA 4PJNA 4QVDA 4QQGA 3S3NA 3M57A 4XK8E 1BBZA 1WDXA 2QQ9A 1AVZC 1AWJA 3ME9A 4PFPA 2EWNA 2AKKA 1WNLA 4PJOD 3JCMP 3M54A 3CXCA 3OW2P 3OYIA 1XJWB 3C4SA 2LQKA 1LJOA 4NL2A 4XTXA 4LNPA 1MNEA 2ROLA 5LJ5e 4C92C 2YRCA 4OGEA 2K79A 3QUIA 3A5ZB 3PFSA 3G7ZA 1OYXA 1JO8A 1NBEB 2RH2A 1OPKA 2XIDA 2MYSA 3HKSA 3BFMA 1VOMA 1RACB 4OGCA 2EVRA 2ATCB 2DA9A 5DLQE 2VB6A 1KQSS 3JB9H 1VQKA 1ARKA 2A36A 2ENMA 3QYGB 1QMCA 2M0YA 4RTWA 1WIEA 2KMTA 1W2BA 1VQOA 1D1CA 2E3HA 1N9SA 5GANd 2HSEB 1OZ2A 1X6GA 2DVEA 4IIMA 1YJWA 2CUDA 3M0PA 4Y91A 1RAFB 3L2UA 1VQ8Q 4DQ2A 1JXMA 2CUBA 2HBPA 3OSSC 3QIIA 2V1RA 4KRTA 4R56A 1WHJA 1SRMA 2LQ8A 2KROA 3CC2T 3P8DA 3SWNA 1Q7YC 1BB9A 4WF2A 3G6EQ 3E1SA 2HMAA 1VQ5A 1UUEA 2M1HA 1FXXA 3A8OB 1WXUA 2HSPA 1LCKA 3HRSA 4QKUA 1JJ2P 5LJ5j 1K9MC 4A4FA 1RI0A 1V29B 2ZAEA 2FPFA 2RI3A 2OTLA 2VGNA 1AD5A 3HSBA 2DPPB 5FU7C 3QXEB 3DB4A 1W70A 2EYYA 5I22A 4L5GA 2I0NA 2O2OA 4M78B 1OZ3A 5KYYA 2WACA 4IUUA 1KG1A 1AEYA 3FDRA 3CCMQ 3PNWC 4AMCA 2EQUA 1NLOC 2V8JA 1NE8A 1K73R 4RCCA 3L2RA 4GLMA 3PVQA 2FYKA 4IKFA 2FZGB 4F7UE 1HSQA 2LT4A 5LJ3e 4E6RA 4OMLA 1J3TA 1V1CA 2COWA 2XKOC 2HL3A 2QQSA 1X6BA 3I55Q 2H3JA 3ZBDA 4M7AC 1VQ5Q 2JS2A 1MV3A 3S3MA 1TXQA 4MMLA 3HL8A 4AFZC 2K57A 4PK4A 2DTOA 2DEUA 1Y96A 3LGLA 1GL5A 3CC2Q 3CBPA 2A28A 3VUZA 1LNXA 1RUWA 5GAOl 4E7LA 1KHIA 2PVOB 1M3AA 1SF9A 1Z9ZA 1O75A 2LC4A 3EAEA 2O88A 4XTWA 4RCBA 5I21A 1KC8R 4E7SA 1VQ5T 1Y71A 2J05A 3SEMA 1VIEA 1TS9A 1CKBA 2X3WD 1H3HA 4M78A 4M7DC 1KC8U 2A37A 3TCJA 2FG0A 2DF6A 3GNGA 1ZA1B 2HL5C 5KYWB 3VYHB 2QG9B 4HCCA 4ZTJA 4ANJA 5LJ3d 5A0DA 3GPLA 2K3BA 1RABB 5CKBA 3I55A 4PJLA 1Q81R 4CC7A 1YI2Q 3NPFA 3CC4T 2A3LA 1VQLT 4JJCA 2NWMA 2RQTA 2L3PA 4OMOA 5DLOA 3O5ZA 4E2FB 5GANf 1EZZB 3QKJA 1TUDA 2SRCA 2O4XA 4KGXB 2NUPB 3CCET 2M02A 3V7SA 1M1FA 1WQWA 3VS4A 1K0SA 2E5QA 2O4XB 1WFWA 1VYVA 1G3YA 1UGRB 4C5GA 1OQKA 4OMNA 1YWOA 1YBYA 4JZ3A 1PNJA 1WHMA 5D6WA 4J7FA 3JB9D 3QZ5B 4D6WA 1ACMB 4JRIA 4HVUA 3L42A 4A4KA 4CC3A 1NYFA 2RN8A 1Y0MA 1VQPQ 4LDYA 1HK9A 4M78G 4Y92A 3EG3A 1TUGB 3BDLA 3NTHA 2YXYA 4NOYA 2GGRA 1QVPA 3QG1A 1K0XA 2OX7A 1K8AR 3QJYA 2E12A 2PVDB 3I9QA 4JJBA 3CCLT 1BI1A 4BDYA 4QQ6A 5GAMd 1IGUA 3OBWA 2V1QA 4D8DA 2QA4Q 2VGMA 2LJ3A 3CXCS 1W2BS 4BD3A 1YIJT 2E70A 2PVGB 4J9FA 2JT4A 2RHZA 3UWNA 2DYBA 4PJOE 1VQ6Q 5AYFA 1NJIR 2RJCA 3CBMA 5CKEA 3RKYA 1WGSA 4FIBA 2RI2A 1YJWT 4E7KA 2EFIA 1RAAB 1I5OB 4F7UA 4BE2A 1M3BA 1YI2A 1WXTA 3QYHB 2ABLA 3TEEA 2R57A 1NJIU 1N5ZA 5EG2A 2W0ZA 1QVGP 4M78F 3NTKA 5GAN6 2DXBA 3EFOB 4M4ZA 2LT1A 3MEUA 3JV3A 2PUOB 1RAGB 2F2XA 2F2WA 3ASKA 3GNFB 3OYLA 4BE0A 3OYNA 4N0AC 2QA4A 1TG0A 2JN0A 1HJDA 1RL2A 5C6SA 4N4IA 4C8QD 2DVJA 2CH4W 2LX7A 3JSCA 1S72T 4J9GA 2YRVA 3TSWA 1Y07A 3V7CA 1FMVA 4FYYB 1M90C 1VQLA 4PJOA 2E3IA 2EQMA 1OI1A 1QVFA 2H3EB 1B34B 4LUEA 4F16A 2K2VA 4LD6A 2ED0A 5CQYA 5IN1A 1YIJQ 4FYVB 4EMKC 2L89A 4C8QC 1N6AA 2M0OA 1FMKA 2IIMA 4TVRA 2VXFA 3CCJA 1D0ZA 2XDBA 2YLBA 2VASA 2O9VA 3ZEHA 2EGEA 1KQSP 3OW2A 1Q95G 1VQ7Q 2X35A 3CCJT 3VYGA 1JJ2A 4FSSA 2QTVA 4M77F 4OMFB 4ORZA 4ZN3A 2ZPEB 2XMFA 3G6EA 1UDLA 2RHXA 2CP7A 3FLGA 2OTJT 3V8JA 1S1NA 3CCLQ 2DTIA 4LDXA 5KE3A 3KBGA 4BB7A 1OU9A 1KFZA 3VRZA 3JCMX 2C0TA 2COZA 2X9HA 3R6NA 3JCMd 1U3OA 4HT8A 1B34A 2DJZA 1YIJA 2OTLQ 4L6V5 2RA2A 2OTJA 2Y4YA 4OF1A 3HHTB 3PTAA 3TU4K 1PWTA 9ATCB 5GAMg 3PIOA 3CMAA 5HCKA 4YTLA 3E19A 3VS3A 8AT1B 4M7AA 3LX7A 2G6FX 1JJ2S 3PVLA 2QGGA 1BCOA 2DAQA 1TH7A 4M75F 5CKHA 1K9AA 4RG8A 4CRIA 2L3QA 1H641 4JLIA 4F7UG 4HCZA 4QT7A 3MEAA 4E7ZA 1QP2A 2ZPFB 1VQKT 2QI2A 3ULRB 3I55T 4M7DE 1WHHA 1H8KA 2PZ1A 3G71T 2EGAA 1Y7XA 2QTXA 1KD1C 2X4WA 2XHCA 5FWBA 5LJ3j 3JCMb 2XI9A 4HCKA 4CC2A 1PRMC 2E64A 2K7AA 2P4RA 3X28B 4C0ZA 2CZ1B 2F1LA 2VVKA 1UGPB 1OV3A 2EYZA 3CCRQ 3GOXA 2KRMA 5KYYB 2RQRA 3H41A 4RTUA 5LJ5g 4BI4A 1ZBJA 3M0SA 1K9MU 4M78D 4EDUA 3CCQA 4LDVA 4ZGEB 1G2BA 1BIBA 2Z0WA 2Y90A 1EIFA 2FO0A 2P84A 1YHQQ 3SDZA 1R0CB 4F04B 2JM9A 3SFMA 1CKAA 3VS6A 3PMTA 4F7UF 5J3BA 1SSFA 1M5Q1 1YJNQ 1VQPT 2YUPA 1UEBA 2COYA 2FB7A 2VC8A 1GBRA 3HP9A 4OB3B 3LLRA 3TSZA 1WHLA 2DBMA 1OX9A 4M75G 2L8DA 1YHQT 5LJ3h 2IG0A 1BK2A 5CK9A 4M7DD 3M0RA 3CEYA 5CVIA 3CC4Q 3GP8A 2LCCA 2L3SA 3CCEA 4OMMA 2CKKA 4J7IA 2FL7A 1XNIA 1KHCA 2LTOA 3C95A 4DBHA 2PUKB 1BIAA 2YLCA 1VQ8A 5L23A 2NYSA 3I56T 1YFNA 2RQVA 1N27A 2DXUA 1GCPA 4KUIA 1HD3A 4M7DA 5FU6C 3I56Q 1QKWA 1Z9QA 2EGCA 1D1BA 2L5QA 4KUDK 2BZXA 2GQIA 1M2VB 5AT1B 4PJOG 3CCSQ 2DNUA 1WXBA 2P0KA 2AIRB 5KCHA 2FVUA 2X4XA 1M9SA 2DYIA 2L2PA 3I5SA 3A8MB 2KRSA 2K3YA 4XU0A 4RTZA 2GQVA 2CH4A 2DO3A 1QCNA 1C6VX 3S3OA 4M7DF 1QCOA 1PCXA 4M77D 1QVGA 2K5FA 2EBPA 3CCEQ 4A4EA 2ROTA 1M8MA 2KRNA 4FYXB 1AWWA 4AFUC 3I35A 1ZA2B 3FJPA 3JCMf 3HTRA 1YHQA 1Q81U 1ZUUA 2RQWA 4XQ3A 2F5KA 2KQWA 1ABQA 2DIGA 4LDWA 3M4YA 1VQ6A 2RI5A 2EIFA 4HKEA 3OB9A 4AT1B 3CD6A 2DBKA 5C0MA 4ZGDB 1UECA 3C94A 2HDAA 3M53A 1QVGS 3NGPA 3VKIA 2LMJA 3M56A 5HK0A 2XU8A 3QHSA 4ELZC 4C0FA 5GMKm 3JCMV 3M0UA 3JCMc 1BYMA 2DL5A 3GF5A 2DXCA 3X20B 1SPKA 3GLXA 4HA8A 1AHJB 5IH2A 1YJWQ 3FB9A 1FX7A 1IB8A 2HCKA 3CMET 3SWNC 4E7JA 4A4GA 1A0NB 3QJ6A 2RO0A 3META 1K1ZA 1WJSA 3UDCA 3ZL7C 4RKUE 1PHTA 2QXFA 3INZA 2QAZA 4Z02A 4C8QA 1VQ4Q 2HD0A 3P8BB 2CZ6B 4EMHA 2KVQG 3PIPA 1Y96B 3CCSA 3NFCA 1V76A 3VUBA 4J6YA 2DERA 3H6ZA 1AZGB 2KDSA 4DBQA 3CPWS 3MPUB 3AHUA 2OI3A 2DZCA 1SEMA 2PU9B 1SKUB 4M7AB 1LOJA 4Q5WA 2A08A 1VQNQ 5IHNA 2JXBA 2RHUA 4B9XA 2GTOA 5IT9E 5KH6A 3A8LB 1UB4A 1QLYA 3RUXA 3FEOA 3OYBA 3KFVA 1ZHIA 3VS0A 2LZ6B 3MP1A 3EG9A 3TVTA 2DIQA 2ZCFB 4IUVA 1X2QA 5I11A 4FW1A 3CCUQ 3RMQA 1QWEA 1TSFA 1QQJA 4FM4B 4XTYA 2RPNA 1VQ4A 2NLUA 3N5BB 1IRXA 2C06A 3JAME 2GCXA 5GANj 4PJOC 4D8KA 1YITA 4Z89A 3OSVA 3MHXA 1WJRA 1X6OA 5GAN3 3TQ7P 2F5TX 3CCLA 2PQWA 3HRUA 4HVVA 3SD4A 2KK4A 3GBQA 4DEYA 1TWBA 4RTXA 3CC7T 5IXFA 2D6FA 2LJ0A 4F17A 1U5SA 3M0QA 2BZYA 2OTLT 4HCBA 3JB9G 4O5VA 3EGXB 3A8GB 3URGA 4WCIA 1GRIA 1M30A 5FWCA 4IURA 4EPCA 4KBMB 1XOVA 2ZPHB 3E9GA 3JRZA 2O31A 2QDYB 4DBFA 2H8HA 2MIOA 1K73U 5GANe 1RAEB 1KSWA 2DKGA 5KYXB 2EYQA 2IVWA 2R58A 1YN8A 5HKCA 2FZCB 2GTJA 3M4GA 2DFUA 1PKTA 3VS7A 5GAMf 1VQNA 3LWIA 4LN2A 3SB2A 2HNIA 3OYDA 4XU3A 1RLQC 5L8RE 2M9UA 1Y57A 1UTIA 1PRLC 4JRKA 2JTMA 2WSFE 1RI9A 2JMCA 4PJOF 3QPHA 4AG2C 1OULA 1R8OB 3PT9A 2RHYA 1NZ9A 3OYCA 4M75C 2RQUA 5EC7A 5CR2A 2GNCA 1AWXA 2P0PA 2EJ9A 2EKOA 1K73C 2KSSA 3M5AA 2YUQA 1W1FA 3EH1A 3BE3A 1IHWA 1X43A 2DM1A 2K2MA 2YT6A 4L59A 2E4HA 4ZGJB 1G5VA 1E7OA 2DL8A 4C8QF 3CC4A 1WHGA 2M16A 4LD9K 5KE2A 4Y28E 2HAXA 5LJ3f 3CCJQ 2BTTA 5GAMj 1B3QA 3WVDB 4BDZA 1FMWA 1ZUYA 1VYUA 2FPEA 4FCYA 1B07A 1PG5B 5CCAA 1GCQC 1JU5C 4Z8AA 4BI8B 1MNDA 2BE9B 4C0DB 2JMAA 1ZBXA 4XTVA 1I8FA 2DRKA 1MGQA 1KQ1A 2LQWA 5HK3A 2MWOA 1Q7YU 1KD1U 3EGXA 3CC7A 2R5MA 4N4GA 5GAOp 1KIKA 4OB0B 1C1AA 1YI2T 4N0AA 5D6YA 3OS1A 1YP5A 2GBQA 5CAIA 3M0TA 5J26A 4JJNK 1NPPA 2X51A 1NLPC 1KQ2A 2CP6A 1R0BG 3CPWP 2O9SA 3HPWA 1VUBA 5GAN8 1Q86R 1TOVA 3T9NA 4II1A 2CT4A 2KT1A 1KD1R 2AZSA 4PL6A 4WTOB 1F1BB 2DXTA 5IXBA 5I2MA 4C8QB 3EGDA 2QQAA 1UHCA 2GF7A 3LYIA 1D3BA 2RK2A 4MZMA 2P4TA 2JM8A 4XTZA 3X26B 2DLPA 2EPDA 3CD6Q 5CO7A 2JS0A 3RKXA 2DX1A 1SHGA 1TUCA 1WHKA 1JEGA 1G83A 3H0FA 2LCLA 1BCMA 1U8RA 1QP3A 4J5YA 1KC8C 3UF4A 2HQHA 3RDVA 4J6XA 1X75C 2KGTA 4PJMA 4LUDA 4CC4B 4J9HA 4J9CA 4EMGA 2QEXT 2CREA 2MMPA 1LPLA 3CCVT 2JNGA 1ZSZA 1T0HA 3CCQQ 1WA7A 1YITT 1GXIE 3CCST 1XQHA 2QQBA 1M8VA 2KT8A 1W6XA 3L1AA 2OAWA 2FRWA 2P0QA 3CBOA 1YCSB 7AT1B 3R6OA 3OA6A 2EYXA 4UC4A 2Y4XA 4M77B 2KI7A 1SRLA 2B8AA 4QVZA 1S72Q 1M90U 2LDMA 5GMKi 1N9RA 4AG1C 1UGVA 3M59A 3VS1A 3LGFA 3RKWA 4PFZA 2WSCE 1E6HA 1VQOQ 1IZ6A 4K11A 4J9BA 5LJ5d 2OTJQ 2MPXC 2YRDA 3ER0A 4X34A 3CD6T 2E6ZA 4J9EA 1MMAA 1ZX6A 3EFRA 2RHIA 5CKFA 3REBB 3U23A 4B9WA 1U06A 3CMEQ 1SHFA 4C92G 3RBBB 2KAFA 5A2QE 2J6KA 3GIBA 3QDFA 2V26A 2MF2A 2D9TA 3OS5A 1ZSZB 1KJWA 4FT2A 3L2QA 5KYUB 3THKA 1I4K1 5LL6S 5M9OA 1M27C 3H0IA 3VRYA 1QKXA 1Q86C 1P92A 1PSEA 4HXJA 3OYJA 4FW2A 5FLXE 5GMKj 2FHDA 4LXCA 2CSQA 2GFUA 2RB6A 1M1KR 3EGUA 4C5HA 3CCRA 4RTTA 5KYWA 3CCVQ
chains in the Genus database with same CATH topology
4OMOA 1RLPC 2YUNA 2RF0A 2LQNA 2HCKA 2RMOA 1MUZA 3O5ZA 1A0NB 2YSQA 2KYBA 2C0IA 1TUDA 2SRCA 1K1ZA 2LNHB 2D0NA 3VS4A 1K0SA 1WFWA 1VYVA 1OEBA 2CDTA 3ZL7C 1PHTA 4OMNA 1YWOA 4JZ3A 2KXCA 1PNJA 1ZSGA 2ECZA 1YNZA 1T3SA 4AFSC 1AZGB 4HVUA 1UJ0A 4CC3A 1NYFA 2RN8A 1Y0MA 2LCSA 3QWXX 2OI3A 4AFQC 4Y92A 3EG3A 1SEMA 2DL4A 4GBQA 2A08A 2DILA 5IHNA 2GGRA 2JXBA 1K0XA 2DRMA 2GTOA 2DJQA 3I9QA 4JJBA 1QLYA 1AOJA 4R0KA 2FRYA 4J9DA 4X1VA 5IHIA 2V1QA 4D8DA 4RTVA 3KFVA 2LJ3A 3SHWA 3VS0A 2LZ6B 2RNAA 3TVTA 3LH5A 1CSKA 4J9FA 2JT4A 2DYBA 1X2QA 5I11A 3FJ5A 1QWEA 2EYWA 1NEBA 1SSHA 1T3LA 2RPNA 3NHNA 1WI7A 1K76A 3I5RA 1X2KA 4D8KA 4Z89A 2F2VA 1M3BA 4HVVA 1WXTA 1GCQA 3GBQA 4DEYA 2ABLA 2LJ1A 4RTXA 2C0OA 1VYTA 5IXFA 2KBTA 4Z88A 1N5ZA 2BZ8A 2LJ0A 2W0ZA 4F17A 2SEMA 1U5SA 3QWYA 3H0HA 3M0QA 4M4ZA 2BZYA 2D8HA 3JV3A 2YUOA 1QWFA 2J6OA 1NM7A 2F2XA 2F2WA 2YDLA 1TG0A 1ZLMA 4JPBW 4WCIA 1GRIA 1M30A 5FWCA 1HJDA 4IIOA 1XOVA 4JZ4A 3CQTA 2DVJA 2K6DA 4LE9A 2CH4W 2HBWA 2LX7A 4J9GA 3TSWA 2O31A 1NYGA 2CT3A 3EG1A 2H8HA 3REAB 2MIOA 1T0JA 2KYMA 1EFNA 1KSWA 1IO6A 5GJVB 1YN8A 4LUEA 2B86A 2GTJA 1YWPA 3EG2A 3VS2A 4F16A 1PKTA 2KEAA 3VS7A 5IHKA 2EW3A 2L0AA 4LN2A 2ED0A 2KNBB 2J7IA 2VWFA 1UHFA 1RLQC 1FMKA 1NEGA 5FW9A 2IIMA 1Y57A 3EHRA 1JQQA 2O9VA 1UTIA 1PRLC 2EGEA 2E5KA 1I1JA 1RI9A 2JMCA 1JXOA 4AG2C 1ABOA 1GFDA 4EIKA 2RQUA 5EC7A 1BU1A 2GNCA 4FSSA 1VA7A 2DE0X 4ESRA 1AWXA 4ORZA 1NG2A 1MV0B 1QCFA 1AZEA 2XMFA 3A98A 1UDLA 2YUQA 1BBZA 1W1FA 1X43A 1WDXA 2DM1A 4DEXA 1AVZC 1AWJA 2EKHA 2AKKA 2K2MA 1S1NA 2YT6A 1WLPB 1KFZA 1WYXA 3VRZA 2C0TA 1M3CA 1E7OA 2DL8A 1H92A 3R6NA 1U3OA 3UA6A 4LNPA 2W10A 2ROLA 1PWTA 2K79A 5HCKA 2BTTA 3VS3A 1B3QA 2G6FX 3PVLA 1ZUYA 1VYUA 2FPEA 1K9AA 1B07A 1JO8A 1GCQC 1JU5C 2L3QA 4Z8AA 1OPKA 2JMAA 2HEQA 4QT7A 1GFCA 2DRKA 2PTKA 2LQWA 2AKLA 3ULRB 2DL3A 2EVRA 1UG1A 1H8KA 1X69A 2DA9A 2PZ1A 2D8JA 2PNIA 1KIKA 2D1XA 1ARKA 2EGAA 2DL7A 1YP5A 2OJ2A 2GBQA 5FWBA 2A36A 2ENMA 3M0TA 2M0YA 4RTWA 1WIEA 4HCKA 1NLPC 4CC2A 1PRMC 2DMOA 2M51A 3UA7A 2K7AA 2P4RA 2O9SA 2VVKA 1OV3A 2EYZA 1AWOA 2KRMA 1X6GA 4IIMA 2RQRA 3H41A 4RTUA 2CUDA 1ZBJA 3M0PA 3M0SA 2K9GA 2CT4A 2KT1A 2MOXA 1G2BA 1WX6A 2AZSA 1JXMA 1K4US 2CUBA 1GBQA 5IXBA 2FO0A 2V1RA 1UHCA 4KRTA 1SRMA 2J6FA 1UJYA 2JM9A 2JM8A 1CKAA 3NMZC 3VS6A 2DLPA 2EPDA 2KROA 2JS0A 2KXDA 2DX1A 2MCNA 3RNJA 1X27A 1BB9A 1SHGA 2FEIA 2YUPA 1TUCA 2QDLA 1JEGA 1G83A 2JTEA 1GBRA 1ZUKA 3H0FA 1OOTA 3TSZA 1UUEA 2DBMA 3PE0A 2JW4A 1BK2A 4F14A 1WXUA 2HSPA 3UF4A 3IQLA 3M0RA 1LCKA 3EHQA 2KGTA 2FPFA 2L3SA 4LUDA 4OMMA 4CC4B 1AD5A 4J9HA 4J9CA 1FYNA 2CREA 3VS5A 2ED1A 1W70A 2EYYA 5I22A 1T0HA 1WA7A 1I07A 2I0NA 2O2OA 4RUGA 5L23A 1AEYA 4RTYA 3UATA 2RQVA 1NLOC 1GCPA 4HVWA 1HD3A 1PKSA 2KT8A 1QKWA 1W6XA 2KR3A 1Z9QA 2EGCA 2OAWA 2FRWA 2BZXA 2GQIA 1I0CA 1YCSB 4GLMA 3PVQA 2EYXA 1E6GA 1HSQA 1SRLA 2DNUA 1WXBA 4E6RA 4JJDA 4OMLA 1J3TA 1V1CA 2L2PA 1X6BA 3I5SA 4AG1C 1UE9A 2JS2A 1UGVA 1MV3A 2KRSA 3VS1A 4RTZA 2LP5A 2CH4A 2J06A 3C0CA 4AFZC 1E6HA 4OMPA 4K11A 4J9BA 1GL5A 2X3XD 2EBPA 2ESWA 2FPDA 5ECAA 2A28A 2ROTA 1M8MA 2KRNA 1AWWA 1RUWA 4AFUC 1M3AA 3I35A 1Z9ZA 1ZX6A 4J9EA 3EG0A 3REBB 3U23A 2O88A 4OMQA 1U06A 1SHFA 4J9IA 1ZUUA 3RBBB 2J05A 2RQWA 3SEMA 2J6KA 1ABQA 1CKBA 2X3WD 1H3HA 2A37A 2CSIA 1KJWA 2FG0A 3THKA 2DF6A 2DBKA 1M27C 1UECA 2HDAA 2VKNA 3H0IA 3NGPA 3VRYA 2LMJA 1QKXA 4ZNXA 4HXJA 2K3BA 3M0UA 2NUZA 2DL5A 2AK5A 2EQIA 2CSQA 2KE9A 4CC7A 1SPKA 5GJWB 3NPFA 2AZVA 3EGUA 1OPLA 1UFFA 4A63B 5IH2A 4JJCA 4RTTA 2NWMA 2RQTA 2L3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMO A;  1RLP C;  2YUN A;  2RF0 A;  2LQN A;  2HCK A;  2RMO A;  1MUZ A;  3O5Z A;  1A0N B;  2YSQ A;  2KYB A;  2C0I A;  1TUD A;  2SRC A;  1K1Z A;  2LNH B;  2D0N A;  3VS4 A;  1K0S A;  1WFW A;  1VYV A;  1OEB A;  2CDT A;  3ZL7 C;  1PHT A;  4OMN A;  1YWO A;  4JZ3 A;  2KXC A;  1PNJ A;  1ZSG A;  2ECZ A;  1YNZ A;  1T3S A;  4AFS C;  1AZG B;  4HVU A;  1UJ0 A;  4CC3 A;  1NYF A;  2RN8 A;  1Y0M A;  2LCS A;  3QWX X;  2OI3 A;  4AFQ C;  4Y92 A;  3EG3 A;  1SEM A;  2DL4 A;  4GBQ A;  2A08 A;  2DIL A;  5IHN A;  2GGR A;  2JXB A;  1K0X A;  2DRM A;  2GTO A;  2DJQ A;  3I9Q A;  4JJB A;  1QLY A;  1AOJ A;  4R0K A;  2FRY A;  4J9D A;  4X1V A;  5IHI A;  2V1Q A;  4D8D A;  4RTV A;  3KFV A;  2LJ3 A;  3SHW A;  3VS0 A;  2LZ6 B;  2RNA A;  3TVT A;  3LH5 A;  1CSK A;  4J9F A;  2JT4 A;  2DYB A;  1X2Q A;  5I11 A;  3FJ5 A;  1QWE A;  2EYW A;  1NEB A;  1SSH A;  1T3L A;  2RPN A;  3NHN A;  1WI7 A;  1K76 A;  3I5R A;  1X2K A;  4D8K A;  4Z89 A;  2F2V A;  1M3B A;  4HVV A;  1WXT A;  1GCQ A;  3GBQ A;  4DEY A;  2ABL A;  2LJ1 A;  4RTX A;  2C0O A;  1VYT A;  5IXF A;  2KBT A;  4Z88 A;  1N5Z A;  2BZ8 A;  2LJ0 A;  2W0Z A;  4F17 A;  2SEM A;  1U5S A;  3QWY A;  3H0H A;  3M0Q A;  4M4Z A;  2BZY A;  2D8H A;  3JV3 A;  2YUO A;  1QWF A;  2J6O A;  1NM7 A;  2F2X A;  2F2W A;  2YDL A;  1TG0 A;  1ZLM A;  4JPB W;  4WCI A;  1GRI A;  1M30 A;  5FWC A;  1HJD A;  4IIO A;  1XOV A;  4JZ4 A;  3CQT A;  2DVJ A;  2K6D A;  4LE9 A;  2CH4 W;  2HBW A;  2LX7 A;  4J9G A;  3TSW A;  2O31 A;  1NYG A;  2CT3 A;  3EG1 A;  2H8H A;  3REA B;  2MIO A;  1T0J A;  2KYM A;  1EFN A;  1KSW A;  1IO6 A;  5GJV B;  1YN8 A;  4LUE A;  2B86 A;  2GTJ A;  1YWP A;  3EG2 A;  3VS2 A;  4F16 A;  1PKT A;  2KEA A;  3VS7 A;  5IHK A;  2EW3 A;  2L0A A;  4LN2 A;  2ED0 A;  2KNB B;  2J7I A;  2VWF A;  1UHF A;  1RLQ C;  1FMK A;  1NEG A;  5FW9 A;  2IIM A;  1Y57 A;  3EHR A;  1JQQ A;  2O9V A;  1UTI A;  1PRL C;  2EGE A;  2E5K A;  1I1J A;  1RI9 A;  2JMC A;  1JXO A;  4AG2 C;  1ABO A;  1GFD A;  4EIK A;  2RQU A;  5EC7 A;  1BU1 A;  2GNC A;  4FSS A;  1VA7 A;  2DE0 X;  4ESR A;  1AWX A;  4ORZ A;  1NG2 A;  1MV0 B;  1QCF A;  1AZE A;  2XMF A;  3A98 A;  1UDL A;  2YUQ A;  1BBZ A;  1W1F A;  1X43 A;  1WDX A;  2DM1 A;  4DEX A;  1AVZ C;  1AWJ A;  2EKH A;  2AKK A;  2K2M A;  1S1N A;  2YT6 A;  1WLP B;  1KFZ A;  1WYX A;  3VRZ A;  2C0T A;  1M3C A;  1E7O A;  2DL8 A;  1H92 A;  3R6N A;  1U3O A;  3UA6 A;  4LNP A;  2W10 A;  2ROL A;  1PWT A;  2K79 A;  5HCK A;  2BTT A;  3VS3 A;  1B3Q A;  2G6F X;  3PVL A;  1ZUY A;  1VYU A;  2FPE A;  1K9A A;  1B07 A;  1JO8 A;  1GCQ C;  1JU5 C;  2L3Q A;  4Z8A A;  1OPK A;  2JMA A;  2HEQ A;  4QT7 A;  1GFC A;  2DRK A;  2PTK A;  2LQW A;  2AKL A;  3ULR B;  2DL3 A;  2EVR A;  1UG1 A;  1H8K A;  1X69 A;  2DA9 A;  2PZ1 A;  2D8J A;  2PNI A;  1KIK A;  2D1X A;  1ARK A;  2EGA A;  2DL7 A;  1YP5 A;  2OJ2 A;  2GBQ A;  5FWB A;  2A36 A;  2ENM A;  3M0T A;  2M0Y A;  4RTW A;  1WIE A;  4HCK A;  1NLP C;  4CC2 A;  1PRM C;  2DMO A;  2M51 A;  3UA7 A;  2K7A A;  2P4R A;  2O9S A;  2VVK A;  1OV3 A;  2EYZ A;  1AWO A;  2KRM A;  1X6G A;  4IIM A;  2RQR A;  3H41 A;  4RTU A;  2CUD A;  1ZBJ A;  3M0P A;  3M0S A;  2K9G A;  2CT4 A;  2KT1 A;  2MOX A;  1G2B A;  1WX6 A;  2AZS A;  1JXM A;  1K4U S;  2CUB A;  1GBQ A;  5IXB A;  2FO0 A;  2V1R A;  1UHC A;  4KRT A;  1SRM A;  2J6F A;  1UJY A;  2JM9 A;  2JM8 A;  1CKA A;  3NMZ C;  3VS6 A;  2DLP A;  2EPD A;  2KRO A;  2JS0 A;  2KXD A;  2DX1 A;  2MCN A;  3RNJ A;  1X27 A;  1BB9 A;  1SHG A;  2FEI A;  2YUP A;  1TUC A;  2QDL A;  1JEG A;  1G83 A;  2JTE A;  1GBR A;  1ZUK A;  3H0F A;  1OOT A;  3TSZ A;  1UUE A;  2DBM A;  3PE0 A;  2JW4 A;  1BK2 A;  4F14 A;  1WXU A;  2HSP A;  3UF4 A;  3IQL A;  3M0R A;  1LCK A;  3EHQ A;  2KGT A;  2FPF A;  2L3S A;  4LUD A;  4OMM A;  4CC4 B;  1AD5 A;  4J9H A;  4J9C A;  1FYN A;  2CRE A;  3VS5 A;  2ED1 A;  1W70 A;  2EYY A;  5I22 A;  1T0H A;  1WA7 A;  1I07 A;  2I0N A;  2O2O A;  4RUG A;  5L23 A;  1AEY A;  4RTY A;  3UAT A;  2RQV A;  1NLO C;  1GCP A;  4HVW A;  1HD3 A;  1PKS A;  2KT8 A;  1QKW A;  1W6X A;  2KR3 A;  1Z9Q A;  2EGC A;  2OAW A;  2FRW A;  2BZX A;  2GQI A;  1I0C A;  1YCS B;  4GLM A;  3PVQ A;  2EYX A;  1E6G A;  1HSQ A;  1SRL A;  2DNU A;  1WXB A;  4E6R A;  4JJD A;  4OML A;  1J3T A;  1V1C A;  2L2P A;  1X6B A;  3I5S A;  4AG1 C;  1UE9 A;  2JS2 A;  1UGV A;  1MV3 A;  2KRS A;  3VS1 A;  4RTZ A;  2LP5 A;  2CH4 A;  2J06 A;  3C0C A;  4AFZ C;  1E6H A;  4OMP A;  4K11 A;  4J9B A;  1GL5 A;  2X3X D;  2EBP A;  2ESW A;  2FPD A;  5ECA A;  2A28 A;  2ROT A;  1M8M A;  2KRN A;  1AWW A;  1RUW A;  4AFU C;  1M3A A;  3I35 A;  1Z9Z A;  1ZX6 A;  4J9E A;  3EG0 A;  3REB B;  3U23 A;  2O88 A;  4OMQ A;  1U06 A;  1SHF A;  4J9I A;  1ZUU A;  3RBB B;  2J05 A;  2RQW A;  3SEM A;  2J6K A;  1ABQ A;  1CKB A;  2X3W D;  1H3H A;  2A37 A;  2CSI A;  1KJW A;  2FG0 A;  3THK A;  2DF6 A;  2DBK A;  1M27 C;  1UEC A;  2HDA A;  2VKN A;  3H0I A;  3NGP A;  3VRY A;  2LMJ A;  1QKX A;  4ZNX A;  4HXJ A;  2K3B A;  3M0U A;  2NUZ A;  2DL5 A;  2AK5 A;  2EQI A;  2CSQ A;  2KE9 A;  4CC7 A;  1SPK A;  5GJW B;  3NPF A;  2AZV A;  3EGU A;  1OPL A;  1UFF A;  4A63 B;  5IH2 A;  4JJC A;  4RTT A;  2NWM A;  2RQT A;  2L3P A; 
#chains in the Genus database with same CATH topology
 4X9D A;  2RF0 A;  2QK0 A;  2BIV A;  4J83 A;  2RMO A;  1WPY A;  2YSQ A;  4OVA A;  3DB3 A;  2C0I A;  2CYZ B;  2DZ9 A;  3CCM A;  3UPU A;  1MMG A;  1PD1 A;  2MK5 A;  4BE1 A;  2CDT A;  2V8I A;  3QO3 A;  2AHJ B;  1YJN A;  2JUF A;  5GAN h;  1ZSG A;  1KK7 A;  4XU1 A;  1VQN T;  2ECZ A;  1T3S A;  4M77 E;  1TU0 B;  2HQX A;  3HFO A;  1Q82 C;  2XG8 D;  5GAN 7;  2QEX A;  2LCS A;  3QWX X;  1YJN T;  4AFQ C;  2DL4 A;  2DD4 A;  3HRT A;  3O8V A;  5LJ5 h;  3LW5 E;  5KCO A;  2DJQ A;  4FYW B;  3JCM Q;  4R0K A;  4J9D A;  4X1V A;  3EG9 B;  4RTV A;  2QGF B;  4DOV A;  4FSX A;  4CI0 C;  1K9M R;  5CKD A;  3OYY A;  1RAI B;  1PSF A;  2RJF A;  3Q1J A;  4RG2 A;  3CCR T;  5FRM A;  3CXC P;  2E1H A;  5KYN A;  2EYW A;  1WJQ A;  1T3L A;  4HT9 A;  2MWP A;  1WI7 A;  1IGQ A;  2K5I A;  1X2K A;  1VIF A;  1MMD A;  1YJ9 Q;  3QDR B;  4J8O A;  1VQK Q;  2MI6 A;  1VQ9 T;  4KGZ B;  1GCQ A;  4JRQ A;  1QW1 A;  1U1S A;  2LJ1 A;  1BI3 A;  2X4Y A;  2C0O A;  4ELY C;  2BZ8 A;  1G3T A;  2SEM A;  3QWY A;  3H0H A;  1EX4 A;  2D8H A;  5FRO A;  2ZZD A;  1KQS A;  2J6O A;  3HFN A;  1NM7 A;  4M75 E;  2YDL A;  3VU3 C;  6AT1 B;  1ZLM A;  5GMK l;  2NUT A;  3VJP A;  4IIO A;  5I2S A;  4E7I A;  3CPF A;  4JRP A;  2CS7 A;  3E9F A;  2HKN A;  3CQT A;  2K6D A;  1IXD A;  2BE7 D;  2HBW A;  3EH2 A;  2D0Q B;  1NYG A;  2CT3 A;  3EG1 A;  3REA B;  1JBM A;  1M2O A;  4PJJ A;  1QVF P;  1EFN A;  4XU2 A;  1IO6 A;  3CC7 Q;  2QYZ A;  4XTU A;  3H8Z A;  3VV0 A;  4C92 B;  2DK3 A;  4A54 A;  5CQX A;  5GJV B;  2A7Y A;  5IHK A;  2KEA A;  5LJ3 g;  2L0A A;  2O01 E;  3CCV A;  3CCQ T;  2J7I A;  1UHF A;  2VYT A;  2YHT A;  1NEG A;  1M4Z A;  2XK0 A;  3OY9 A;  4IUP A;  3JCM J;  2EQK A;  4EMK B;  3JB9 I;  2QA4 T;  4C8Q E;  3EHR A;  2K3X A;  5GAO n;  4RMO A;  1JQQ A;  1M1K C;  1M1G A;  1JXO A;  1XTD A;  1ABO A;  1QVF S;  3MP6 A;  3V8K A;  2OAU A;  1BU1 A;  2DE0 X;  3E2U A;  1NG2 A;  1MV0 B;  1QCF A;  4E47 A;  4M7A F;  1ZSZ C;  1AZE A;  2G3R A;  3A98 A;  4JDS A;  2R5A A;  2VUB A;  1UGS B;  4DEX A;  2EKH A;  5LJ5 f;  3FIF A;  2JJ9 A;  4M75 D;  1WLP B;  2E6N A;  1WYX A;  4NS5 A;  1M3C A;  3L2W A;  1N8R U;  2JZ2 A;  3L2V A;  1H92 A;  3UA6 A;  1Q7Y R;  2W10 A;  3PMI A;  2XDP A;  3KXT A;  3OMG A;  2JTF A;  1G3W A;  2L3R A;  4M7A G;  3F70 A;  2IPO B;  3CPW A;  3CCU A;  3OYA A;  3FRN A;  5GAN g;  2HQE A;  4M75 A;  2E65 A;  1M1K U;  4M77 C;  3JCM W;  1N8R R;  3J81 E;  4J6W A;  2HEQ A;  1GFC A;  2MAM A;  4XAX B;  1X01 A;  2PTK A;  1VQ7 T;  1VQ9 Q;  2AKL A;  2ZPB B;  1YIT Q;  2DL3 A;  1UG1 A;  3CCU T;  1X69 A;  1S72 A;  2D8J A;  2PNI A;  3NTI A;  2D1X A;  3EFO A;  2DL7 A;  4QVC A;  4C8Q G;  2OJ2 A;  5GMK h;  1Q86 U;  3UA7 A;  2DMO A;  2M51 A;  4M7D G;  2VXE A;  2DTH A;  2CP2 A;  1WZO A;  3ZFJ A;  1AWO A;  5GAM e;  3WVE B;  4DOW A;  3OQ5 A;  2K9G A;  3M9Q A;  2A0F B;  3J7A F;  3P8H A;  2MOX A;  4C92 A;  1WX6 A;  1K8A U;  2E10 A;  1K4U S;  2WSE E;  1GBQ A;  1W4S A;  2E41 A;  5DY9 A;  1TTH B;  1VQO T;  2J6F A;  5KYX A;  4KH1 B;  1UJY A;  3NMZ C;  4JLG A;  2ZPI B;  2KXD A;  2MCN A;  3L2Z A;  4DBR A;  3RNJ A;  1X27 A;  2FEI A;  1K8A C;  3RMS A;  2QDL A;  3A1P A;  1VQ4 T;  4E7H A;  1ZQ1 A;  1LVK A;  2JTE A;  4F7U B;  1ZUK A;  3G6E T;  1OOT A;  3PE0 A;  2JW4 A;  4F14 A;  3OYF A;  1IRE B;  5GAO q;  3IQL A;  2LX9 A;  3EHQ A;  2VV5 A;  5D7U A;  2XDD A;  1W2B P;  1OU8 A;  3CC2 A;  2RD1 A;  1FYN A;  1M90 R;  3VS5 A;  3G4S T;  2ED1 A;  1N8R C;  2HKQ B;  1D1A A;  5GAN 2;  8ATC B;  2AT1 B;  1I07 A;  3MCA B;  3SWN B;  1C0M A;  4RUG A;  3CMA Q;  4FL6 A;  4RTY A;  3UAT A;  1BI0 A;  4ZTF A;  4M78 C;  4HVW A;  2CP3 A;  1I5L A;  1OX8 A;  1PKS A;  3CMA T;  2KR3 A;  5IAY A;  4P5N A;  4GY5 A;  5D6X A;  4IUT A;  2ZGW A;  4M7A D;  1I0C A;  1U1T A;  1VQ6 T;  4OB2 B;  3QZ9 B;  3JCM e;  1E6G A;  4C92 F;  4V2S A;  4JJD A;  4BY6 B;  3BDU A;  4M7D B;  2DD5 A;  4N4H A;  1UE9 A;  3TRE A;  2QEX Q;  3MO8 A;  3G71 A;  2LP5 A;  2J06 A;  3C0C A;  3MP8 A;  2K5L A;  2RJD A;  4OMP A;  4LDU A;  1AT1 B;  4FT4 A;  2CP0 A;  2X3X D;  2ESW A;  2FPD A;  2HZY A;  5ECA A;  5GAO m;  1BKB A;  4M78 E;  4FU6 A;  1VQ8 T;  2RJE A;  3EG0 A;  3OYE A;  4OMQ A;  4J9I A;  4MMK A;  4JUV A;  3MEV A;  3M58 A;  4GLK A;  1UGQ B;  4JS5 A;  3A8H B;  3UT1 A;  4C5I A;  5KYU A;  3QSU A;  2EQJ A;  2CSI A;  1MHN A;  4ME7 A;  2EJF A;  2CP5 A;  2EAY A;  1VQ9 A;  1IHV A;  3X24 B;  1PC0 A;  3EFS A;  2VKN A;  4PNO A;  4PLI A;  3OW2 S;  4ZNX A;  3EGD B;  3AT1 B;  1VQP A;  2V8K A;  2NUZ A;  2AK5 A;  2EQI A;  2KE9 A;  3M55 A;  4PFO A;  5GJW B;  3G71 Q;  2AZV A;  3LH0 A;  1OPL A;  1UFF A;  4A63 B;  2RM4 A;  3G4S Q;  3RER A;  4M7A E;  1HXD A;  1RLP C;  2QAS A;  3LWH A;  2YUN A;  2LQN A;  1MUZ A;  2X4J A;  4ZN1 A;  2KYB A;  4KGV B;  4C0D C;  3RES A;  4MZP A;  4PLL A;  5GMK e;  2LNH B;  2D0N A;  1Q82 R;  2JVV A;  1OEB A;  3MJX A;  3JCM g;  2KXC A;  1SG5 A;  2CGH A;  1Q82 U;  2BUD A;  2YWW A;  3OYM A;  2ZPG B;  4X9C A;  1YNZ A;  2XD0 A;  4R55 A;  4AFS C;  3S6W A;  2RK1 A;  1WQ7 A;  2DET A;  1UJ0 A;  4A4H A;  4KH0 B;  3OYK A;  3FC3 A;  4KT0 E;  2LNV A;  1HYO A;  4GBQ A;  1JB0 E;  2DIL A;  3PGG A;  3CCM T;  2DRM A;  2F69 A;  2NUP A;  3V8L A;  1JRI A;  1AOJ A;  4C92 D;  2FRY A;  1NPR A;  3QBY A;  5IHI A;  3H9N A;  3SHW A;  1O9S A;  3KUF A;  2RNA A;  3DKM A;  3OMC A;  1I81 A;  1Q81 C;  4M75 B;  5A0G A;  3LH5 A;  1D09 B;  1CSK A;  1YJ9 T;  4BAC A;  5CIU A;  4NL3 A;  3FJ5 A;  5FU7 B;  4QW2 A;  2JOY A;  4MDX A;  2I2L A;  3JCM h;  1NEB A;  1SSH A;  5A0L A;  3NHN A;  4MDW A;  3X25 B;  2CZ7 B;  1K76 A;  4B6M A;  3I5R A;  4DA4 A;  2K4Y A;  1VQL Q;  4BY6 C;  1PD0 A;  4MZT A;  5HY6 A;  1M2V A;  2F2V A;  1G3S A;  3OS0 A;  1NJI C;  4BI3 A;  2KY9 A;  3V7R A;  3D7S B;  4C5E A;  3MEW A;  4C92 E;  1PM3 A;  1VQM T;  1VYT A;  4EMK A;  2KBT A;  4Z88 A;  3OBY A;  5FRN A;  5J39 A;  4M77 G;  2CZ0 B;  2YUO A;  1QWF A;  1D3B B;  1MMN A;  3CME A;  1RAD B;  4JPB W;  5GAN 4;  1VQ7 A;  4ATO A;  4IUQ A;  3MKD A;  3OYH A;  5DM7 R;  2LVM A;  1RAH B;  4JZ4 A;  3G1J A;  1VQM Q;  3J80 E;  4QQD A;  4LE9 A;  2FZK B;  3OYG A;  3C12 A;  2BKD N;  4C0G A;  2LRQ A;  4OB1 B;  1T0J A;  3JB9 J;  2KYM A;  1D0X A;  3RR6 A;  3JB9 F;  2NUT B;  4VUB A;  3OS2 A;  3BY7 A;  1YJ9 A;  1BI2 A;  3WXM B;  4BUG A;  4JS4 A;  2B86 A;  1YWP A;  3EG2 A;  3VS2 A;  2EW3 A;  1D0Y A;  3DLL A;  2DEQ A;  3G4S A;  2KNB B;  4O6J A;  2VWF A;  5FU6 B;  3BW1 A;  5GAM h;  4OP0 A;  5FW9 A;  5GAO r;  2XIC A;  5GAN 5;  2QQR A;  1G8X A;  4PKC C;  1DJ7 B;  2E5K A;  1FWZ A;  1I1J A;  1YCY A;  1GFD A;  2GFA A;  4EIK A;  4M77 A;  2EJG A;  3I56 A;  1VQM A;  4PJO B;  1VA7 A;  1R77 A;  4A53 A;  1H3Z A;  1B7T A;  3DLM A;  4ESR A;  4KUL A;  3RIR A;  4PJN A;  4QVD A;  4QQG A;  3S3N A;  3M57 A;  4XK8 E;  1BBZ A;  1WDX A;  2QQ9 A;  1AVZ C;  1AWJ A;  3ME9 A;  4PFP A;  2EWN A;  2AKK A;  1WNL A;  4PJO D;  3JCM P;  3M54 A;  3CXC A;  3OW2 P;  3OYI A;  1XJW B;  3C4S A;  2LQK A;  1LJO A;  4NL2 A;  4XTX A;  4LNP A;  1MNE A;  2ROL A;  5LJ5 e;  4C92 C;  2YRC A;  4OGE A;  2K79 A;  3QUI A;  3A5Z B;  3PFS A;  3G7Z A;  1OYX A;  1JO8 A;  1NBE B;  2RH2 A;  1OPK A;  2XID A;  2MYS A;  3HKS A;  3BFM A;  1VOM A;  1RAC B;  4OGC A;  2EVR A;  2ATC B;  2DA9 A;  5DLQ E;  2VB6 A;  1KQS S;  3JB9 H;  1VQK A;  1ARK A;  2A36 A;  2ENM A;  3QYG B;  1QMC A;  2M0Y A;  4RTW A;  1WIE A;  2KMT A;  1W2B A;  1VQO A;  1D1C A;  2E3H A;  1N9S A;  5GAN d;  2HSE B;  1OZ2 A;  1X6G A;  2DVE A;  4IIM A;  1YJW A;  2CUD A;  3M0P A;  4Y91 A;  1RAF B;  3L2U A;  1VQ8 Q;  4DQ2 A;  1JXM A;  2CUB A;  2HBP A;  3OSS C;  3QII A;  2V1R A;  4KRT A;  4R56 A;  1WHJ A;  1SRM A;  2LQ8 A;  2KRO A;  3CC2 T;  3P8D A;  3SWN A;  1Q7Y C;  1BB9 A;  4WF2 A;  3G6E Q;  3E1S A;  2HMA A;  1VQ5 A;  1UUE A;  2M1H A;  1FXX A;  3A8O B;  1WXU A;  2HSP A;  1LCK A;  3HRS A;  4QKU A;  1JJ2 P;  5LJ5 j;  1K9M C;  4A4F A;  1RI0 A;  1V29 B;  2ZAE A;  2FPF A;  2RI3 A;  2OTL A;  2VGN A;  1AD5 A;  3HSB A;  2DPP B;  5FU7 C;  3QXE B;  3DB4 A;  1W70 A;  2EYY A;  5I22 A;  4L5G A;  2I0N A;  2O2O A;  4M78 B;  1OZ3 A;  5KYY A;  2WAC A;  4IUU A;  1KG1 A;  1AEY A;  3FDR A;  3CCM Q;  3PNW C;  4AMC A;  2EQU A;  1NLO C;  2V8J A;  1NE8 A;  1K73 R;  4RCC A;  3L2R A;  4GLM A;  3PVQ A;  2FYK A;  4IKF A;  2FZG B;  4F7U E;  1HSQ A;  2LT4 A;  5LJ3 e;  4E6R A;  4OML A;  1J3T A;  1V1C A;  2COW A;  2XKO C;  2HL3 A;  2QQS A;  1X6B A;  3I55 Q;  2H3J A;  3ZBD A;  4M7A C;  1VQ5 Q;  2JS2 A;  1MV3 A;  3S3M A;  1TXQ A;  4MML A;  3HL8 A;  4AFZ C;  2K57 A;  4PK4 A;  2DTO A;  2DEU A;  1Y96 A;  3LGL A;  1GL5 A;  3CC2 Q;  3CBP A;  2A28 A;  3VUZ A;  1LNX A;  1RUW A;  5GAO l;  4E7L A;  1KHI A;  2PVO B;  1M3A A;  1SF9 A;  1Z9Z A;  1O75 A;  2LC4 A;  3EAE A;  2O88 A;  4XTW A;  4RCB A;  5I21 A;  1KC8 R;  4E7S A;  1VQ5 T;  1Y71 A;  2J05 A;  3SEM A;  1VIE A;  1TS9 A;  1CKB A;  2X3W D;  1H3H A;  4M78 A;  4M7D C;  1KC8 U;  2A37 A;  3TCJ A;  2FG0 A;  2DF6 A;  3GNG A;  1ZA1 B;  2HL5 C;  5KYW B;  3VYH B;  2QG9 B;  4HCC A;  4ZTJ A;  4ANJ A;  5LJ3 d;  5A0D A;  3GPL A;  2K3B A;  1RAB B;  5CKB A;  3I55 A;  4PJL A;  1Q81 R;  4CC7 A;  1YI2 Q;  3NPF A;  3CC4 T;  2A3L A;  1VQL T;  4JJC A;  2NWM A;  2RQT A;  2L3P A;  4OMO A;  5DLO A;  3O5Z A;  4E2F B;  5GAN f;  1EZZ B;  3QKJ A;  1TUD A;  2SRC A;  2O4X A;  4KGX B;  2NUP B;  3CCE T;  2M02 A;  3V7S A;  1M1F A;  1WQW A;  3VS4 A;  1K0S A;  2E5Q A;  2O4X B;  1WFW A;  1VYV A;  1G3Y A;  1UGR B;  4C5G A;  1OQK A;  4OMN A;  1YWO A;  1YBY A;  4JZ3 A;  1PNJ A;  1WHM A;  5D6W A;  4J7F A;  3JB9 D;  3QZ5 B;  4D6W A;  1ACM B;  4JRI A;  4HVU A;  3L42 A;  4A4K A;  4CC3 A;  1NYF A;  2RN8 A;  1Y0M A;  1VQP Q;  4LDY A;  1HK9 A;  4M78 G;  4Y92 A;  3EG3 A;  1TUG B;  3BDL A;  3NTH A;  2YXY A;  4NOY A;  2GGR A;  1QVP A;  3QG1 A;  1K0X A;  2OX7 A;  1K8A R;  3QJY A;  2E12 A;  2PVD B;  3I9Q A;  4JJB A;  3CCL T;  1BI1 A;  4BDY A;  4QQ6 A;  5GAM d;  1IGU A;  3OBW A;  2V1Q A;  4D8D A;  2QA4 Q;  2VGM A;  2LJ3 A;  3CXC S;  1W2B S;  4BD3 A;  1YIJ T;  2E70 A;  2PVG B;  4J9F A;  2JT4 A;  2RHZ A;  3UWN A;  2DYB A;  4PJO E;  1VQ6 Q;  5AYF A;  1NJI R;  2RJC A;  3CBM A;  5CKE A;  3RKY A;  1WGS A;  4FIB A;  2RI2 A;  1YJW T;  4E7K A;  2EFI A;  1RAA B;  1I5O B;  4F7U A;  4BE2 A;  1M3B A;  1YI2 A;  1WXT A;  3QYH B;  2ABL A;  3TEE A;  2R57 A;  1NJI U;  1N5Z A;  5EG2 A;  2W0Z A;  1QVG P;  4M78 F;  3NTK A;  5GAN 6;  2DXB A;  3EFO B;  4M4Z A;  2LT1 A;  3MEU A;  3JV3 A;  2PUO B;  1RAG B;  2F2X A;  2F2W A;  3ASK A;  3GNF B;  3OYL A;  4BE0 A;  3OYN A;  4N0A C;  2QA4 A;  1TG0 A;  2JN0 A;  1HJD A;  1RL2 A;  5C6S A;  4N4I A;  4C8Q D;  2DVJ A;  2CH4 W;  2LX7 A;  3JSC A;  1S72 T;  4J9G A;  2YRV A;  3TSW A;  1Y07 A;  3V7C A;  1FMV A;  4FYY B;  1M90 C;  1VQL A;  4PJO A;  2E3I A;  2EQM A;  1OI1 A;  1QVF A;  2H3E B;  1B34 B;  4LUE A;  4F16 A;  2K2V A;  4LD6 A;  2ED0 A;  5CQY A;  5IN1 A;  1YIJ Q;  4FYV B;  4EMK C;  2L89 A;  4C8Q C;  1N6A A;  2M0O A;  1FMK A;  2IIM A;  4TVR A;  2VXF A;  3CCJ A;  1D0Z A;  2XDB A;  2YLB A;  2VAS A;  2O9V A;  3ZEH A;  2EGE A;  1KQS P;  3OW2 A;  1Q95 G;  1VQ7 Q;  2X35 A;  3CCJ T;  3VYG A;  1JJ2 A;  4FSS A;  2QTV A;  4M77 F;  4OMF B;  4ORZ A;  4ZN3 A;  2ZPE B;  2XMF A;  3G6E A;  1UDL A;  2RHX A;  2CP7 A;  3FLG A;  2OTJ T;  3V8J A;  1S1N A;  3CCL Q;  2DTI A;  4LDX A;  5KE3 A;  3KBG A;  4BB7 A;  1OU9 A;  1KFZ A;  3VRZ A;  3JCM X;  2C0T A;  2COZ A;  2X9H A;  3R6N A;  3JCM d;  1U3O A;  4HT8 A;  1B34 A;  2DJZ A;  1YIJ A;  2OTL Q;  4L6V 5;  2RA2 A;  2OTJ A;  2Y4Y A;  4OF1 A;  3HHT B;  3PTA A;  3TU4 K;  1PWT A;  9ATC B;  5GAM g;  3PIO A;  3CMA A;  5HCK A;  4YTL A;  3E19 A;  3VS3 A;  8AT1 B;  4M7A A;  3LX7 A;  2G6F X;  1JJ2 S;  3PVL A;  2QGG A;  1BCO A;  2DAQ A;  1TH7 A;  4M75 F;  5CKH A;  1K9A A;  4RG8 A;  4CRI A;  2L3Q A;  1H64 1;  4JLI A;  4F7U G;  4HCZ A;  4QT7 A;  3MEA A;  4E7Z A;  1QP2 A;  2ZPF B;  1VQK T;  2QI2 A;  3ULR B;  3I55 T;  4M7D E;  1WHH A;  1H8K A;  2PZ1 A;  3G71 T;  2EGA A;  1Y7X A;  2QTX A;  1KD1 C;  2X4W A;  2XHC A;  5FWB A;  5LJ3 j;  3JCM b;  2XI9 A;  4HCK A;  4CC2 A;  1PRM C;  2E64 A;  2K7A A;  2P4R A;  3X28 B;  4C0Z A;  2CZ1 B;  2F1L A;  2VVK A;  1UGP B;  1OV3 A;  2EYZ A;  3CCR Q;  3GOX A;  2KRM A;  5KYY B;  2RQR A;  3H41 A;  4RTU A;  5LJ5 g;  4BI4 A;  1ZBJ A;  3M0S A;  1K9M U;  4M78 D;  4EDU A;  3CCQ A;  4LDV A;  4ZGE B;  1G2B A;  1BIB A;  2Z0W A;  2Y90 A;  1EIF A;  2FO0 A;  2P84 A;  1YHQ Q;  3SDZ A;  1R0C B;  4F04 B;  2JM9 A;  3SFM A;  1CKA A;  3VS6 A;  3PMT A;  4F7U F;  5J3B A;  1SSF A;  1M5Q 1;  1YJN Q;  1VQP T;  2YUP A;  1UEB A;  2COY A;  2FB7 A;  2VC8 A;  1GBR A;  3HP9 A;  4OB3 B;  3LLR A;  3TSZ A;  1WHL A;  2DBM A;  1OX9 A;  4M75 G;  2L8D A;  1YHQ T;  5LJ3 h;  2IG0 A;  1BK2 A;  5CK9 A;  4M7D D;  3M0R A;  3CEY A;  5CVI A;  3CC4 Q;  3GP8 A;  2LCC A;  2L3S A;  3CCE A;  4OMM A;  2CKK A;  4J7I A;  2FL7 A;  1XNI A;  1KHC A;  2LTO A;  3C95 A;  4DBH A;  2PUK B;  1BIA A;  2YLC A;  1VQ8 A;  5L23 A;  2NYS A;  3I56 T;  1YFN A;  2RQV A;  1N27 A;  2DXU A;  1GCP A;  4KUI A;  1HD3 A;  4M7D A;  5FU6 C;  3I56 Q;  1QKW A;  1Z9Q A;  2EGC A;  1D1B A;  2L5Q A;  4KUD K;  2BZX A;  2GQI A;  1M2V B;  5AT1 B;  4PJO G;  3CCS Q;  2DNU A;  1WXB A;  2P0K A;  2AIR B;  5KCH A;  2FVU A;  2X4X A;  1M9S A;  2DYI A;  2L2P A;  3I5S A;  3A8M B;  2KRS A;  2K3Y A;  4XU0 A;  4RTZ A;  2GQV A;  2CH4 A;  2DO3 A;  1QCN A;  1C6V X;  3S3O A;  4M7D F;  1QCO A;  1PCX A;  4M77 D;  1QVG A;  2K5F A;  2EBP A;  3CCE Q;  4A4E A;  2ROT A;  1M8M A;  2KRN A;  4FYX B;  1AWW A;  4AFU C;  3I35 A;  1ZA2 B;  3FJP A;  3JCM f;  3HTR A;  1YHQ A;  1Q81 U;  1ZUU A;  2RQW A;  4XQ3 A;  2F5K A;  2KQW A;  1ABQ A;  2DIG A;  4LDW A;  3M4Y A;  1VQ6 A;  2RI5 A;  2EIF A;  4HKE A;  3OB9 A;  4AT1 B;  3CD6 A;  2DBK A;  5C0M A;  4ZGD B;  1UEC A;  3C94 A;  2HDA A;  3M53 A;  1QVG S;  3NGP A;  3VKI A;  2LMJ A;  3M56 A;  5HK0 A;  2XU8 A;  3QHS A;  4ELZ C;  4C0F A;  5GMK m;  3JCM V;  3M0U A;  3JCM c;  1BYM A;  2DL5 A;  3GF5 A;  2DXC A;  3X20 B;  1SPK A;  3GLX A;  4HA8 A;  1AHJ B;  5IH2 A;  1YJW Q;  3FB9 A;  1FX7 A;  1IB8 A;  2HCK A;  3CME T;  3SWN C;  4E7J A;  4A4G A;  1A0N B;  3QJ6 A;  2RO0 A;  3MET A;  1K1Z A;  1WJS A;  3UDC A;  3ZL7 C;  4RKU E;  1PHT A;  2QXF A;  3INZ A;  2QAZ A;  4Z02 A;  4C8Q A;  1VQ4 Q;  2HD0 A;  3P8B B;  2CZ6 B;  4EMH A;  2KVQ G;  3PIP A;  1Y96 B;  3CCS A;  3NFC A;  1V76 A;  3VUB A;  4J6Y A;  2DER A;  3H6Z A;  1AZG B;  2KDS A;  4DBQ A;  3CPW S;  3MPU B;  3AHU A;  2OI3 A;  2DZC A;  1SEM A;  2PU9 B;  1SKU B;  4M7A B;  1LOJ A;  4Q5W A;  2A08 A;  1VQN Q;  5IHN A;  2JXB A;  2RHU A;  4B9X A;  2GTO A;  5IT9 E;  5KH6 A;  3A8L B;  1UB4 A;  1QLY A;  3RUX A;  3FEO A;  3OYB A;  3KFV A;  1ZHI A;  3VS0 A;  2LZ6 B;  3MP1 A;  3EG9 A;  3TVT A;  2DIQ A;  2ZCF B;  4IUV A;  1X2Q A;  5I11 A;  4FW1 A;  3CCU Q;  3RMQ A;  1QWE A;  1TSF A;  1QQJ A;  4FM4 B;  4XTY A;  2RPN A;  1VQ4 A;  2NLU A;  3N5B B;  1IRX A;  2C06 A;  3JAM E;  2GCX A;  5GAN j;  4PJO C;  4D8K A;  1YIT A;  4Z89 A;  3OSV A;  3MHX A;  1WJR A;  1X6O A;  5GAN 3;  3TQ7 P;  2F5T X;  3CCL A;  2PQW A;  3HRU A;  4HVV A;  3SD4 A;  2KK4 A;  3GBQ A;  4DEY A;  1TWB A;  4RTX A;  3CC7 T;  5IXF A;  2D6F A;  2LJ0 A;  4F17 A;  1U5S A;  3M0Q A;  2BZY A;  2OTL T;  4HCB A;  3JB9 G;  4O5V A;  3EGX B;  3A8G B;  3URG A;  4WCI A;  1GRI A;  1M30 A;  5FWC A;  4IUR A;  4EPC A;  4KBM B;  1XOV A;  2ZPH B;  3E9G A;  3JRZ A;  2O31 A;  2QDY B;  4DBF A;  2H8H A;  2MIO A;  1K73 U;  5GAN e;  1RAE B;  1KSW A;  2DKG A;  5KYX B;  2EYQ A;  2IVW A;  2R58 A;  1YN8 A;  5HKC A;  2FZC B;  2GTJ A;  3M4G A;  2DFU A;  1PKT A;  3VS7 A;  5GAM f;  1VQN A;  3LWI A;  4LN2 A;  3SB2 A;  2HNI A;  3OYD A;  4XU3 A;  1RLQ C;  5L8R E;  2M9U A;  1Y57 A;  1UTI A;  1PRL C;  4JRK A;  2JTM A;  2WSF E;  1RI9 A;  2JMC A;  4PJO F;  3QPH A;  4AG2 C;  1OUL A;  1R8O B;  3PT9 A;  2RHY A;  1NZ9 A;  3OYC A;  4M75 C;  2RQU A;  5EC7 A;  5CR2 A;  2GNC A;  1AWX A;  2P0P A;  2EJ9 A;  2EKO A;  1K73 C;  2KSS A;  3M5A A;  2YUQ A;  1W1F A;  3EH1 A;  3BE3 A;  1IHW A;  1X43 A;  2DM1 A;  2K2M A;  2YT6 A;  4L59 A;  2E4H A;  4ZGJ B;  1G5V A;  1E7O A;  2DL8 A;  4C8Q F;  3CC4 A;  1WHG A;  2M16 A;  4LD9 K;  5KE2 A;  4Y28 E;  2HAX A;  5LJ3 f;  3CCJ Q;  2BTT A;  5GAM j;  1B3Q A;  3WVD B;  4BDZ A;  1FMW A;  1ZUY A;  1VYU A;  2FPE A;  4FCY A;  1B07 A;  1PG5 B;  5CCA A;  1GCQ C;  1JU5 C;  4Z8A A;  4BI8 B;  1MND A;  2BE9 B;  4C0D B;  2JMA A;  1ZBX A;  4XTV A;  1I8F A;  2DRK A;  1MGQ A;  1KQ1 A;  2LQW A;  5HK3 A;  2MWO A;  1Q7Y U;  1KD1 U;  3EGX A;  3CC7 A;  2R5M A;  4N4G A;  5GAO p;  1KIK A;  4OB0 B;  1C1A A;  1YI2 T;  4N0A A;  5D6Y A;  3OS1 A;  1YP5 A;  2GBQ A;  5CAI A;  3M0T A;  5J26 A;  4JJN K;  1NPP A;  2X51 A;  1NLP C;  1KQ2 A;  2CP6 A;  1R0B G;  3CPW P;  2O9S A;  3HPW A;  1VUB A;  5GAN 8;  1Q86 R;  1TOV A;  3T9N A;  4II1 A;  2CT4 A;  2KT1 A;  1KD1 R;  2AZS A;  4PL6 A;  4WTO B;  1F1B B;  2DXT A;  5IXB A;  5I2M A;  4C8Q B;  3EGD A;  2QQA A;  1UHC A;  2GF7 A;  3LYI A;  1D3B A;  2RK2 A;  4MZM A;  2P4T A;  2JM8 A;  4XTZ A;  3X26 B;  2DLP A;  2EPD A;  3CD6 Q;  5CO7 A;  2JS0 A;  3RKX A;  2DX1 A;  1SHG A;  1TUC A;  1WHK A;  1JEG A;  1G83 A;  3H0F A;  2LCL A;  1BCM A;  1U8R A;  1QP3 A;  4J5Y A;  1KC8 C;  3UF4 A;  2HQH A;  3RDV A;  4J6X A;  1X75 C;  2KGT A;  4PJM A;  4LUD A;  4CC4 B;  4J9H A;  4J9C A;  4EMG A;  2QEX T;  2CRE A;  2MMP A;  1LPL A;  3CCV T;  2JNG A;  1ZSZ A;  1T0H A;  3CCQ Q;  1WA7 A;  1YIT T;  1GXI E;  3CCS T;  1XQH A;  2QQB A;  1M8V A;  2KT8 A;  1W6X A;  3L1A A;  2OAW A;  2FRW A;  2P0Q A;  3CBO A;  1YCS B;  7AT1 B;  3R6O A;  3OA6 A;  2EYX A;  4UC4 A;  2Y4X A;  4M77 B;  2KI7 A;  1SRL A;  2B8A A;  4QVZ A;  1S72 Q;  1M90 U;  2LDM A;  5GMK i;  1N9R A;  4AG1 C;  1UGV A;  3M59 A;  3VS1 A;  3LGF A;  3RKW A;  4PFZ A;  2WSC E;  1E6H A;  1VQO Q;  1IZ6 A;  4K11 A;  4J9B A;  5LJ5 d;  2OTJ Q;  2MPX C;  2YRD A;  3ER0 A;  4X34 A;  3CD6 T;  2E6Z A;  4J9E A;  1MMA A;  1ZX6 A;  3EFR A;  2RHI A;  5CKF A;  3REB B;  3U23 A;  4B9W A;  1U06 A;  3CME Q;  1SHF A;  4C92 G;  3RBB B;  2KAF A;  5A2Q E;  2J6K A;  3GIB A;  3QDF A;  2V26 A;  2MF2 A;  2D9T A;  3OS5 A;  1ZSZ B;  1KJW A;  4FT2 A;  3L2Q A;  5KYU B;  3THK A;  1I4K 1;  5LL6 S;  5M9O A;  1M27 C;  3H0I A;  3VRY A;  1QKX A;  1Q86 C;  1P92 A;  1PSE A;  4HXJ A;  3OYJ A;  4FW2 A;  5FLX E;  5GMK j;  2FHD A;  4LXC A;  2CSQ A;  2GFU A;  2RB6 A;  1M1K R;  3EGU A;  4C5H A;  3CCR A;  4RTT A;  5KYW A;  3CCV Q; 
#chains in the Genus database with same CATH homology
 4OMO A;  1RLP C;  2YUN A;  2RF0 A;  2LQN A;  2HCK A;  2RMO A;  1MUZ A;  3O5Z A;  1A0N B;  2YSQ A;  2KYB A;  2C0I A;  1TUD A;  2SRC A;  1K1Z A;  2LNH B;  2D0N A;  3VS4 A;  1K0S A;  1WFW A;  1VYV A;  1OEB A;  2CDT A;  3ZL7 C;  1PHT A;  4OMN A;  1YWO A;  4JZ3 A;  2KXC A;  1PNJ A;  1ZSG A;  2ECZ A;  1YNZ A;  1T3S A;  4AFS C;  1AZG B;  4HVU A;  1UJ0 A;  4CC3 A;  1NYF A;  2RN8 A;  1Y0M A;  2LCS A;  3QWX X;  2OI3 A;  4AFQ C;  4Y92 A;  3EG3 A;  1SEM A;  2DL4 A;  4GBQ A;  2A08 A;  2DIL A;  5IHN A;  2GGR A;  2JXB A;  1K0X A;  2DRM A;  2GTO A;  2DJQ A;  3I9Q A;  4JJB A;  1QLY A;  1AOJ A;  4R0K A;  2FRY A;  4J9D A;  4X1V A;  5IHI A;  2V1Q A;  4D8D A;  4RTV A;  3KFV A;  2LJ3 A;  3SHW A;  3VS0 A;  2LZ6 B;  2RNA A;  3TVT A;  3LH5 A;  1CSK A;  4J9F A;  2JT4 A;  2DYB A;  1X2Q A;  5I11 A;  3FJ5 A;  1QWE A;  2EYW A;  1NEB A;  1SSH A;  1T3L A;  2RPN A;  3NHN A;  1WI7 A;  1K76 A;  3I5R A;  1X2K A;  4D8K A;  4Z89 A;  2F2V A;  1M3B A;  4HVV A;  1WXT A;  1GCQ A;  3GBQ A;  4DEY A;  2ABL A;  2LJ1 A;  4RTX A;  2C0O A;  1VYT A;  5IXF A;  2KBT A;  4Z88 A;  1N5Z A;  2BZ8 A;  2LJ0 A;  2W0Z A;  4F17 A;  2SEM A;  1U5S A;  3QWY A;  3H0H A;  3M0Q A;  4M4Z A;  2BZY A;  2D8H A;  3JV3 A;  2YUO A;  1QWF A;  2J6O A;  1NM7 A;  2F2X A;  2F2W A;  2YDL A;  1TG0 A;  1ZLM A;  4JPB W;  4WCI A;  1GRI A;  1M30 A;  5FWC A;  1HJD A;  4IIO A;  1XOV A;  4JZ4 A;  3CQT A;  2DVJ A;  2K6D A;  4LE9 A;  2CH4 W;  2HBW A;  2LX7 A;  4J9G A;  3TSW A;  2O31 A;  1NYG A;  2CT3 A;  3EG1 A;  2H8H A;  3REA B;  2MIO A;  1T0J A;  2KYM A;  1EFN A;  1KSW A;  1IO6 A;  5GJV B;  1YN8 A;  4LUE A;  2B86 A;  2GTJ A;  1YWP A;  3EG2 A;  3VS2 A;  4F16 A;  1PKT A;  2KEA A;  3VS7 A;  5IHK A;  2EW3 A;  2L0A A;  4LN2 A;  2ED0 A;  2KNB B;  2J7I A;  2VWF A;  1UHF A;  1RLQ C;  1FMK A;  1NEG A;  5FW9 A;  2IIM A;  1Y57 A;  3EHR A;  1JQQ A;  2O9V A;  1UTI A;  1PRL C;  2EGE A;  2E5K A;  1I1J A;  1RI9 A;  2JMC A;  1JXO A;  4AG2 C;  1ABO A;  1GFD A;  4EIK A;  2RQU A;  5EC7 A;  1BU1 A;  2GNC A;  4FSS A;  1VA7 A;  2DE0 X;  4ESR A;  1AWX A;  4ORZ A;  1NG2 A;  1MV0 B;  1QCF A;  1AZE A;  2XMF A;  3A98 A;  1UDL A;  2YUQ A;  1BBZ A;  1W1F A;  1X43 A;  1WDX A;  2DM1 A;  4DEX A;  1AVZ C;  1AWJ A;  2EKH A;  2AKK A;  2K2M A;  1S1N A;  2YT6 A;  1WLP B;  1KFZ A;  1WYX A;  3VRZ A;  2C0T A;  1M3C A;  1E7O A;  2DL8 A;  1H92 A;  3R6N A;  1U3O A;  3UA6 A;  4LNP A;  2W10 A;  2ROL A;  1PWT A;  2K79 A;  5HCK A;  2BTT A;  3VS3 A;  1B3Q A;  2G6F X;  3PVL A;  1ZUY A;  1VYU A;  2FPE A;  1K9A A;  1B07 A;  1JO8 A;  1GCQ C;  1JU5 C;  2L3Q A;  4Z8A A;  1OPK A;  2JMA A;  2HEQ A;  4QT7 A;  1GFC A;  2DRK A;  2PTK A;  2LQW A;  2AKL A;  3ULR B;  2DL3 A;  2EVR A;  1UG1 A;  1H8K A;  1X69 A;  2DA9 A;  2PZ1 A;  2D8J A;  2PNI A;  1KIK A;  2D1X A;  1ARK A;  2EGA A;  2DL7 A;  1YP5 A;  2OJ2 A;  2GBQ A;  5FWB A;  2A36 A;  2ENM A;  3M0T A;  2M0Y A;  4RTW A;  1WIE A;  4HCK A;  1NLP C;  4CC2 A;  1PRM C;  2DMO A;  2M51 A;  3UA7 A;  2K7A A;  2P4R A;  2O9S A;  2VVK A;  1OV3 A;  2EYZ A;  1AWO A;  2KRM A;  1X6G A;  4IIM A;  2RQR A;  3H41 A;  4RTU A;  2CUD A;  1ZBJ A;  3M0P A;  3M0S A;  2K9G A;  2CT4 A;  2KT1 A;  2MOX A;  1G2B A;  1WX6 A;  2AZS A;  1JXM A;  1K4U S;  2CUB A;  1GBQ A;  5IXB A;  2FO0 A;  2V1R A;  1UHC A;  4KRT A;  1SRM A;  2J6F A;  1UJY A;  2JM9 A;  2JM8 A;  1CKA A;  3NMZ C;  3VS6 A;  2DLP A;  2EPD A;  2KRO A;  2JS0 A;  2KXD A;  2DX1 A;  2MCN A;  3RNJ A;  1X27 A;  1BB9 A;  1SHG A;  2FEI A;  2YUP A;  1TUC A;  2QDL A;  1JEG A;  1G83 A;  2JTE A;  1GBR A;  1ZUK A;  3H0F A;  1OOT A;  3TSZ A;  1UUE A;  2DBM A;  3PE0 A;  2JW4 A;  1BK2 A;  4F14 A;  1WXU A;  2HSP A;  3UF4 A;  3IQL A;  3M0R A;  1LCK A;  3EHQ A;  2KGT A;  2FPF A;  2L3S A;  4LUD A;  4OMM A;  4CC4 B;  1AD5 A;  4J9H A;  4J9C A;  1FYN A;  2CRE A;  3VS5 A;  2ED1 A;  1W70 A;  2EYY A;  5I22 A;  1T0H A;  1WA7 A;  1I07 A;  2I0N A;  2O2O A;  4RUG A;  5L23 A;  1AEY A;  4RTY A;  3UAT A;  2RQV A;  1NLO C;  1GCP A;  4HVW A;  1HD3 A;  1PKS A;  2KT8 A;  1QKW A;  1W6X A;  2KR3 A;  1Z9Q A;  2EGC A;  2OAW A;  2FRW A;  2BZX A;  2GQI A;  1I0C A;  1YCS B;  4GLM A;  3PVQ A;  2EYX A;  1E6G A;  1HSQ A;  1SRL A;  2DNU A;  1WXB A;  4E6R A;  4JJD A;  4OML A;  1J3T A;  1V1C A;  2L2P A;  1X6B A;  3I5S A;  4AG1 C;  1UE9 A;  2JS2 A;  1UGV A;  1MV3 A;  2KRS A;  3VS1 A;  4RTZ A;  2LP5 A;  2CH4 A;  2J06 A;  3C0C A;  4AFZ C;  1E6H A;  4OMP A;  4K11 A;  4J9B A;  1GL5 A;  2X3X D;  2EBP A;  2ESW A;  2FPD A;  5ECA A;  2A28 A;  2ROT A;  1M8M A;  2KRN A;  1AWW A;  1RUW A;  4AFU C;  1M3A A;  3I35 A;  1Z9Z A;  1ZX6 A;  4J9E A;  3EG0 A;  3REB B;  3U23 A;  2O88 A;  4OMQ A;  1U06 A;  1SHF A;  4J9I A;  1ZUU A;  3RBB B;  2J05 A;  2RQW A;  3SEM A;  2J6K A;  1ABQ A;  1CKB A;  2X3W D;  1H3H A;  2A37 A;  2CSI A;  1KJW A;  2FG0 A;  3THK A;  2DF6 A;  2DBK A;  1M27 C;  1UEC A;  2HDA A;  2VKN A;  3H0I A;  3NGP A;  3VRY A;  2LMJ A;  1QKX A;  4ZNX A;  4HXJ A;  2K3B A;  3M0U A;  2NUZ A;  2DL5 A;  2AK5 A;  2EQI A;  2CSQ A;  2KE9 A;  4CC7 A;  1SPK A;  5GJW B;  3NPF A;  2AZV A;  3EGU A;  1OPL A;  1UFF A;  4A63 B;  5IH2 A;  4JJC A;  4RTT A;  2NWM A;  2RQT A;  2L3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...