2YSQA

Solution structure of the sh3 domain from rho guanine nucleotide exchange factor 9
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
81
structure length
81
Chain Sequence
GSSGSSGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQEDEVEEGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain from Rho guanine nucleotide exchange factor 9
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 9
total genus 4
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ysqA00
2BZ8A 2ECZA 1EFNA 1PRLC 2CSQA 2NUZA 2YUNA 2MOXA 1BB9A 5FW9A 2PTKA 1HD3A 1PHTA 2DX1A 2DL8A 3VS1A 1W1FA 3M0PA 2RQUA 1K0SA 1SRMA 2F2XA 2KE9A 4F16A 1I07A 4IIMA 2KGTA 2YUOA 2QDLA 1OPLA 2EGEA 3RNJA 3I35A 4RTXA 2GTJA 2NWMA 2DYBA 2LNHB 1YCSB 1VYTA 1TG0A 2A36A 2CH4A 2RQWA 2K79A 2GTOA 1JXOA 2L3SA 2KR3A 2ROLA 1RI9A 1SPKA 1BBZA 1WFWA 3NMZC 2EPDA 1A0NB 1SHGA 1UDLA 1X69A 3SEMA 1AZEA 1UFFA 1NG2A 4A63B 1PKTA 1XOVA 1T3SA 2J7IA 2DL4A 4ZNXA 1M3BA 2P4RA 4M4ZA 2JM8A 4AFQC 1ZX6A 4AFSC 2DJQA 2BZYA 1K9AA 2YUQA 1AWJA 1GL5A 4AFUC 1JEGA 2J6OA 1B3QA 1GBRA 2K9GA 1HSQA 2X3WD 2DL5A 2OAWA 1X2KA 2K2MA 3EHQA 2K6DA 1GRIA 2DMOA 2KBTA 3H0IA 1E7OA 4HCKA 2LP5A 3EG2A 1T0JA 1ABQA 4GLMA 3M0UA 4D8DA 3R6NA 3NHNA 1PKSA 1UGVA 1WI7A 1UE9A 3RBBB 2EYYA 2L3QA 2JTEA 3I5RA 2DA9A 3M0QA 1CSKA 2JM9A 4OMMA 4Z8AA 2CREA 2C0IA 4Z89A 2FG0A 3A98A 2O2OA 2MIOA 5IHIA 1JO8A 1WIEA 3M0RA 1AEYA 2DM1A 1GFDA 1JU5C 3U23A 2VWFA 3M0SA 4LE9A 1ZBJA 4CC7A 2JMAA 1YWPA 5GJWB 2RN8A 2FRWA 2ED0A 2D8JA 1SEMA 2CH4W 4JPBW 1WXBA 4J9FA 4WCIA 4RUGA 2RNAA 2KRMA 2B86A 1H8KA 4F14A 1ZSGA 1B07A 2YDLA 2CUBA 4EIKA 4DEYA 2D1XA 3I9QA 2EKHA 3PVLA 4JJBA 2FPFA 4HXJA 3EGUA 3UF4A 2EGAA 3UA6A 1WXUA 5IHKA 2A28A 1AZGB 1YN8A 1ZUKA 4AFZC 4J9CA 2KRNA 1OEBA 4RTUA 2MCNA 2CDTA 3VS5A 2YT6A 4J9IA 1X27A 3QWYA 2CT4A 1M3AA 5I11A 4RTYA 1GCPA 2M0YA 1Z9QA 3EG0A 2GGRA 2JS0A 4R0KA 1RUWA 1U06A 2KEAA 2CT3A 1YWOA 1VYUA 1GCQA 2FRYA 2HSPA 1Y57A 2LQWA 3TSZA 4J9GA 2LMJA 1LCKA 1SRLA 4DEXA 3LH5A 2DLPA 2DBMA 4ESRA 3C0CA 2GBQA 2F2WA 1NLPC 1SSHA 2V1RA 2CUDA 4GBQA 4ORZA 2D0NA 3TSWA 1Z9ZA 2DL3A 2V1QA 2AZVA 2L2PA 1ZUYA 2C0OA 2AK5A 2EYZA 2L3PA 2OJ2A 3TVTA 1NM7A 2G6FX 3H41A 2PNIA 1MUZA 4HVWA 2L0AA 1UJYA 1S1NA 2HCKA 1X6GA 3QWXX 2CSIA 1NYFA 3GBQA 2F2VA 1W6XA 4OMNA 3VS0A 2DRKA 1UG1A 1NLOC 1ZUUA 2VKNA 3VRYA 3JV3A 3VS4A 2O9VA 1M3CA 2DRMA 5HCKA 2RQVA 1NYGA 2E5KA 2KNBB 4Y92A 3VS2A 4LUDA 1QWFA 2KXDA 4OMQA 5IHNA 5IXBA 4HVVA 1K76A 4FSSA 3EG1A 1UUEA 1KIKA 4HVUA 2JXBA 1IO6A 2A08A 1GCQC 5FWBA 4LNPA 4J9DA 5ECAA 1W70A 3UATA 1K0XA 2ED1A 2DBKA 3KFVA 1HJDA 4OMLA 1E6HA 2LX7A 4CC3A 2J06A 2J05A 2FO0A 2FPDA 3VS3A 2O9SA 4JJCA 1WX6A 2KROA 1UTIA 1WDXA 2DVJA 2K3BA 3REAB 1AWOA 3VS6A 2W10A 3O5ZA 1X6BA 2J6KA 1AWXA 1QLYA 1X2QA 2J6FA 4E6RA 1UHFA 1I0CA 2JS2A 2EYWA 4J9HA 2HBWA 2C0TA 1AWWA 1AD5A 1T3LA 3EHRA 1J3TA 2LQNA 2KT8A 4OMOA 1H3HA 2KYBA 1JQQA 1NEBA 1U5SA 2XMFA 3I5SA 4IIOA 1ARKA 1K4US 1MV0B 1UJ0A 4CC4B 4JJDA 2EBPA 1JXMA 1I1JA 2IIMA 4RTZA 2EGCA 1PNJA 1M27C 3CQTA 1K1ZA 2OI3A 2RPNA 2LJ1A 2YSQA 1WXTA 3UA7A 2FPEA 1YP5A 5EC7A 5I22A 1T0HA 1X43A 1OPKA 1YNZA 2DL7A 4LUEA 2FEIA 2KT1A 1SHFA 2GQIA 4QT7A 2I0NA 2VVKA 3NPFA 4CC2A 2O88A 2GNCA 2DILA 2DF6A 5L23A 4RTVA 2W0ZA 4K11A 2SEMA 2AKKA 5IH2A 4LN2A 4Z88A 1MV3A 2JT4A 1ZLMA 2DE0X 2BTTA 1N5ZA 3NGPA 1FMKA 5IXFA 1AOJA 2A37A 3PE0A 1WYXA 1TUDA 2LCSA 1OV3A 2KYMA 2ESWA 2LJ3A 3EG3A 3IQLA 1H92A 2YUPA 1GFCA 2KXCA 4RTTA 2KRSA 2RQRA 1Y0MA 1ABOA 3THKA 2H8HA 4JZ4A 1KFZA 2DNUA 1PWTA 2ROTA 3REBB 1RLQC 1BU1A 2LJ0A 1G83A 4AG1C 2RQTA 1NEGA 1V1CA 1GBQA 2EVRA 4D8KA 1UECA 2HDAA 4AG2C 2JMCA 1QCFA 2K7AA 1KSWA 4X1VA 2O31A 2SRCA 1CKAA 3FJ5A 1OOTA 3ULRB 5GJVB 2AKLA 1BK2A 2LZ6B 4OMPA 1WA7A 4KRTA 1FYNA 1KJWA 3M0TA 4F17A 3VRZA 3ZL7C 2RMOA 2D8HA 2M51A 1VA7A 1AVZC 2PZ1A 3H0FA 1QKXA 3VS7A 1CKBA 1M8MA 2AZSA 2HEQA 2RF0A 2ENMA 3SHWA 1QWEA 3H0HA 1VYVA 1UHCA 4JZ3A 4J9BA 2EYXA 2ABLA 2JW4A 1RLPC 1U3OA 1PRMC 2EW3A 4RTWA 1G2BA 1WLPB 1M30A 2EQIA 1E6GA 3PVQA 2BZXA 5FWCA 4J9EA 1TUCA 1QKWA 2X3XD
chains in the Genus database with same CATH superfamily
5CKEA 4M78A 5LJ5f 1Y96A 1LVKA 2PTKA 3EFOA 3RR6A 3MKDA 4IUQA 1K0SA 1M5Q1 4LXCA 1SRMA 2WSCE 1LPLA 4XTYA 2KGTA 2QQ9A 2X4YA 1YHQT 5IT9E 2OTJT 2WSFE 1TG0A 1O75A 1VIFA 5I2MA 3BFMA 3OYHA 5GAN4 1JXOA 2DTOA 2L3SA 2KR3A 4M7AE 4PFOA 4EDUA 2EQJA 5EG2A 1BBZA 1EZZB 1KQSA 3NMZC 1VQ5T 3M4YA 1C0MA 2EJFA 1M1FA 4PJNA 3H6ZA 1VQPA 1NZ9A 3SWNB 1VQ4A 5CR2A 2DPPB 4XTXA 1YI2Q 5C6SA 1K9MC 1YIJQ 4M4ZA 3CCVQ 2COWA 4PJLA 4XTWA 5AT1B 2DJQA 3I55Q 2BZYA 1AWJA 1VQNT 1VQ7Q 2A3LA 3VJPA 1GBRA 2X3WD 2DL5A 2K3XA 2QEXQ 4B6MA 1X2KA 2ATCB 3RMSA 2K2MA 2K6DA 2KQWA 3QKJA 2VC8A 5GMKe 2EKOA 3H0IA 4M75C 3CC4A 1D0XA 1C1AA 1R77A 5KE2A 4GLMA 4E47A 2BE9B 2K4YA 4N0AA 2I2LA 1WI7A 3VKIA 3RBBB 3CCSA 1G3WA 2RO0A 2JTEA 4JS4A 3PMIA 3JB9J 3L2UA 1FXXA 4LDWA 5IN1A 4MZTA 2RK1A 2JOYA 2RHYA 1O9SA 3CCLT 1YJNA 3CCRA 1JU5C 3U23A 2RI3A 3OB9A 1VQPQ 5KYXB 2JMAA 2L5QA 2E64A 5HY6A 2KI7A 2D8JA 1YHQQ 4PFZA 1ACMB 2QA4Q 3QG1A 2B86A 4F14A 3JCMd 2ZGWA 4YTLA 2YDLA 2CUBA 3RKXA 4OB1B 4RG2A 5DY9A 3EGUA 3UF4A 1DJ7B 5IHKA 2A28A 2KRNA 4O6JA 1OEBA 2F5KA 1QCOA 1VQ5Q 2CDTA 3CC7T 2YT6A 2D0QB 4J9IA 1UEBA 2XIDA 1W2BS 1VQLA 4N4HA 1GCPA 1OZ3A 1Z9QA 3F70A 2KEAA 3JCMb 4XU3A 1OU8A 3G71A 1VQ6Q 2LTOA 4KULA 5GANf 3CCEA 5A2QE 1C6VX 4DEXA 5KCOA 2EQMA 1BIBA 2R58A 1XNIA 3LWIA 4M75B 3UPUA 2EQUA 1PC0A 2DLPA 3CC7A 1Q81U 3PGGA 3TREA 1TTHB 1D09B 2MF2A 2D0NA 4GBQA 3MCAB 1Z9ZA 2DL3A 2AZVA 5HK3A 2C0OA 2ZPIB 2COZA 4N4IA 4M75E 3TVTA 2G6FX 4B9WA 3H41A 1Q81C 5LJ3e 4PKCC 3CBPA 2D6FA 1VIEA 4HVWA 1YHQA 4E7IA 1WHKA 1X6GA 3QWXX 4FIBA 3PFSA 3G4SA 2HMAA 2NUTB 3HRUA 3JAME 3CCJQ 4J6YA 1I8FA 2F2VA 1NLOC 2CS7A 2VKNA 3V8KA 3PT9A 3HRTA 4QQ6A 3CD6Q 2O9VA 1M3CA 2DTIA 1VQ5A 3M56A 3QBYA 4LD6A 1BI3A 2KNBB 4Y92A 3EGXB 4LUDA 2LX9A 3HRSA 4J7IA 4BDZA 1KQSS 2H3EB 4HVVA 2YLCA 1G3YA 1KIKA 4XTZA 2FL7A 2YRDA 3CD6T 4LNPA 4J9DA 4A4FA 1VOMA 2XHCA 4M7DA 1K0XA 4ANJA 1HJDA 1VQMA 2YLBA 4OGCA 3CC7Q 2LX7A 2XG8D 2FO0A 4ELZC 1K73U 1G3SA 1BI2A 1SG5A 3MHXA 3A8LB 4R55A 2FZKB 3CCUQ 3QSUA 1WX6A 1UTIA 4M7DG 1WDXA 4M77A 5KE3A 2DVJA 1KC8R 1AWOA 2W10A 1H3ZA 1QLYA 2DFUA 3OS2A 1I0CA 3VUZA 2EYWA 4IUPA 2DD5A 2C0TA 5KYUB 3OW2P 1AD5A 1T3LA 3CCJA 4PJOE 1J3TA 2KT8A 1NEBA 2CZ0B 3MO8A 3I5SA 2FZCB 4CC4B 4C0FA 1D1BA 4F7UF 1JXMA 5J26A 1M27C 1K1ZA 1AT1B 2E6NA 2OI3A 3JCMe 3JCMQ 4MZPA 4L59A 4M7DF 5LJ3d 1X01A 1PG5B 1YP5A 1N8RU 1T0HA 2ZPFB 1M2VB 1OPKA 2OAUA 5GANh 1Q82R 5GAOp 2GQIA 4FCYA 2X4JA 2VVKA 4CC2A 2FYKA 2QQRA 3CPWP 5L23A 2W0ZA 2Y90A 4BY6B 2E65A 4BE2A 1IHVA 2L89A 1YJWQ 2K5FA 1VQKA 2EFIA 4QVZA 5IXFA 3PE0A 4A4GA 4QVCA 1W2BA 3EG3A 1XQHA 3RDVA 5D6YA 3BDUA 4M75F 4Y28E 3IQLA 1Y71A 5GAN8 1GFCA 4BUGA 5A0DA 3L2ZA 1SF9A 4FYXB 4RTTA 2MI6A 3THKA 2DJZA 7AT1B 5KYNA 2JTFA 3MEAA 2ROTA 4OP0A 1RLQC 2LJ0A 1G83A 1VQKT 3EH2A 4PL6A 4D6WA 4XU1A 5GMKl 5J3BA 5CCAA 1ZHIA 1GXIE 2RQTA 3CCQQ 1NEGA 1GBQA 2EVRA 2QASA 1PD0A 1QVGS 3PIPA 2HDAA 4PLLA 4M7AF 2JMCA 4C5HA 1QCFA 3X20B 2K7AA 3JCMP 2SRCA 2PU9B 1OOTA 4C8QB 4DBFA 1BK2A 5KH6A 2OTLT 3M0TA 5FU7B 3VV0A 5GMKh 3H8ZA 2RMOA 3JCMX 3QPHA 3CPFA 5CKBA 1QKXA 1F1BB 2RHZA 4LD9K 5A0GA 2HEQA 2RF0A 4ZTJA 1BCMA 5CQXA 1QWEA 4M75A 4E7LA 1D1AA 3QDFA 2BUDA 3E2UA 1U3OA 4XTVA 5LJ5h 4RTWA 1R8OB 1WHJA 1PM3A 1M30A 2BZXA 3EAEA 1B7TA 1K8AR 4OB3B 2X3XD 4OB0B 1VQ6T 1I81A 2ECZA 3LGFA 1PRLC 2CSQA 5GAN5 3TQ7P 2MOXA 3CMAA 4PJOB 2DTHA 3M0PA 3P8HA 2QEXA 2F2XA 4BDYA 3VYGA 1PSEA 2KE9A 2V8JA 3OYLA 2A7YA 4HCCA 1I07A 2YUOA 1TH7A 1OPLA 3OS1A 5J39A 4RTXA 3EG9B 1WHLA 1R0CB 2LNHB 2A36A 4KGVB 2DAQA 2K79A 3EFOB 2KDSA 3TU4K 1RI9A 1SPKA 2KY9A 1WFWA 4PLIA 2DO3A 2VASA 2CYZB 2IVWA 1V76A 1UGRB 3JRZA 1VQ4Q 1G5VA 2AT1B 2CKKA 3SEMA 4EMKB 3HHTB 1XOVA 4L5GA 1OI1A 3V8LA 3OBYA 4DQ2A 2E10A 1FX7A 1OZ2A 2MK5A 1VQ9Q 3MEUA 4M78C 1GL5A 3OMGA 2VGMA 3CMAQ 5GMKj 2J6OA 1B3QA 3I56T 1KG1A 3V7CA 5A0LA 2E5QA 5D7UA 5KYWB 1RACB 2P84A 4J5YA 1E7OA 2EQKA 4J7FA 2LT4A 2V8IA 3M0UA 3FC3A 1PKSA 1M8VA 2Y4YA 1UE9A 2EYYA 2RI2A 4MMKA 3I5RA 1CSKA 4QKUA 2JM9A 3V7SA 4OMMA 1ZA1B 1XTDA 2LVMA 5FLXE 3RUXA 2CREA 4Z89A 3CCRQ 3I55T 4M77D 2X35A 1GFDA 3A8MB 4ZTFA 4RKUE 4CC7A 3JCMW 2QA4A 2RJFA 2VV5A 1SEMA 4JRIA 4WCIA 2XDDA 2K5IA 1QVFP 4RUGA 4RMOA 3CCQT 2RNAA 4KUDK 2KRMA 5GAMj 3NFCA 4HT8A 1ZSGA 1B07A 4XQ3A 4ZGJB 3E1SA 1MMNA 1QMCA 3M54A 2DXBA 4JJBA 2NUTA 3RMQA 3JB9G 2FPFA 1RAHB 1NJIR 4XAXB 4HCBA 3UA6A 1AZGB 3CC2T 4J9CA 4RTUA 2MCNA 2E6ZA 4JLGA 3C94A 4M7DD 4RTYA 4XU2A 2M0YA 3PNWC 1KK7A 2JS0A 4R0KA 1K9MU 2CT3A 3CCMA 1VYUA 1GCQA 2HL5C 4IUTA 4M78F 2LQWA 4NOYA 1W4SA 1VQNQ 1OX9A 4J9GA 1KHIA 4AMCA 1VQOQ 3LH5A 1IHWA 2DBMA 2GBQA 2E1HA 3M55A 2V1RA 2JJ9A 3TSWA 2V1QA 2L2PA 2QGFB 2KAFA 3CEYA 3EGDB 1MMDA 2DK3A 1WQWA 5GAMh 2L3PA 1KC8C 3A1PA 2PNIA 1S72A 2RJEA 1K73C 3G7ZA 5CKHA 2L0AA 1UJYA 2ZPBB 3OYEA 3QYGB 2CSIA 2LRQA 1QCNA 2WACA 1FMWA 4KH1B 4OMFB 1Q86U 3OBWA 3RESA 1UG1A 5CKFA 4BD3A 4FT4A 1M2OA 2MYSA 2DRMA 1NYGA 3QJ6A 1Q86R 4DOWA 2VUBA 1Q95G 1QWFA 3QIIA 4Z02A 1Y07A 3OQ5A 4RCBA 5IXBA 4KGXB 4FSSA 2M02A 1UUEA 2M16A 4EMHA 1IO6A 3QHSA 4C8QC 1GCQC 1VQMQ 1JRIA 2QTVA 3QZ9B 2ED1A 4EMGA 2ZPHB 1PD1A 4J83A 2COYA 1TU0B 4C92C 2FPDA 8AT1B 4M77C 1VQKQ 2DYIA 4JRPA 3EFSA 2O9SA 3JB9I 4JRQA 2X9HA 1PCXA 2YRCA 4MMLA 1TWBA 5CAIA 2K3BA 1IXDA 1RAIB 1JBMA 3O5ZA 1AWXA 5KCHA 1X2QA 2GFUA 1UHFA 2MMPA 1RAFB 1WPYA 3FDRA 3OA6A 1ZSZB 2DETA 2DVEA 1FWZA 3LGLA 4OMOA 2X4XA 2E12A 3EFRA 1N6AA 2YRVA 4E2FB 1TSFA 1VQ4T 1MV0B 3RIRA 1UJ0A 4PJOC 1K73R 4LDUA 4JJDA 2EBPA 2EGCA 1PNJA 1JB0E 4OGEA 3OYBA 1MMAA 5I21A 2LJ1A 1YI2T 4LDVA 1WXTA 1WGSA 3UA7A 1YIJT 2CP6A 2FPEA 3META 3CCLQ 8ATCB 3OYMA 3SB2A 1YNZA 1IB8A 4C92E 3HFNA 1M90C 2GNCA 2DF6A 2AIRB 1QVPA 3G6EA 2V26A 5IH2A 2RA2A 3QUIA 3SFMA 2FB7A 5FU6B 5KYUA 2DE0X 2PVGB 3OSVA 2BTTA 1N5ZA 3NGPA 4JRKA 1AOJA 1Q81R 2L3RA 2E41A 4KGZB 2LCSA 3AT1B 3CBMA 2ESWA 1BYMA 2GF7A 2OTJQ 2JTMA 2HKNA 1TOVA 2O4XA 1FMVA 1H92A 2CZ7B 2YUPA 2KRSA 2RQRA 4BI8B 1BIAA 4B9XA 3GIBA 4FL6A 4JZ4A 2M0OA 1M1KU 3JCMJ 4OF1A 4A4HA 3CMEQ 1PWTA 2HNIA 4C92F 3REBB 2NUPB 3LX7A 2K2VA 1IGQA 5LJ5j 1V1CA 2YWWA 1OQKA 2XDPA 2RJDA 4BE0A 3OW2S 4BE1A 1QVFA 3JCMV 3LWHA 3OY9A 5GAMe 3ULRB 4ZGDB 5GJVB 2LZ6B 4OMPA 5GAOq 1KD1R 1LNXA 2IPOB 4KRTA 4M78G 1S72T 5IAYA 1YCYA 2M51A 1VA7A 4PJOF 2LQ8A 3E9FA 1OULA 1M8MA 2PVOB 5GAMf 4C0GA 5LJ3h 1RAGB 1QVFS 4BI4A 3H0HA 2DEUA 4JZ3A 4NL2A 5CVIA 4Y91A 9ATCB 2ABLA 3GF5A 3G71T 2EW3A 4NL3A 3PVQA 4M7DE 4PNOA 2VXFA 1QKWA 2OTJA 2BZ8A 2QQAA 4C92A 1HK9A 1JJ2P 1EFNA 5C0MA 5GAMd 3L2QA 2YUNA 3RKWA 1R0BG 4C92G 1PHTA 2DX1A 1TUGB 1W1FA 2QAZA 2RQUA 2LC4A 1M1GA 4IIMA 4LDYA 2QDLA 1NJIU 1K8AC 3WVEB 3OYNA 3I35A 2GTJA 2NWMA 1G3TA 2RM4A 3FEOA 2KK4A 2XI9A 3G4ST 2CH4A 2RQWA 2GTOA 4PJOA 2CP2A 2ROLA 2E4HA 2VYTA 4C92B 3G1JA 1OYXA 2QDYB 3A8GB 3SWNA 1BKBA 2QQSA 1A0NB 1WJQA 1V29B 3LW5E 1OX8A 1I5LA 4ELYC 1WJRA 2HAXA 3MP8A 2IG0A 1AZEA 1UFFA 4A63B 1PKTA 3N5BB 2RK2A 1T3SA 3CCVA 3HL8A 1M3BA 2P0PA 2P4RA 4BB7A 3L2RA 2GQVA 5FRMA 4MDXA 2JM8A 4AFQC 2PVDB 1UGPB 2G3RA 1YI2A 4AFSC 1VQMT 2XDBA 1YIJA 1K9AA 4ME7A 3ME9A 2CP7A 2QG9B 1M2VA 4AFUC 3R6OA 1JEGA 2BIVA 1VQPT 1YITQ 3CC4Q 3CCVT 1VQ7A 3EH1A 1GRIA 4EMKC 2KBTA 2L8DA 4HCKA 3HPWA 3G6ET 1D0YA 3L2WA 3EG2A 1T0JA 2HD0A 3CCMQ 2QK0A 4E7HA 2GCXA 2R57A 2VXEA 5HKCA 1KD1U 2LNVA 4D8DA 1EX4A 2CP3A 2QQBA 3OYKA 1D3BB 3LYIA 2D9TA 1VQNA 4M7AA 1RL2A 1UGVA 3NTIA 1IGUA 2X51A 2L3QA 2DA9A 5LJ5g 4Z8AA 4FW1A 2CGHA 4QQGA 5GMKi 3A98A 1WHGA 2V8KA 3J7AF 2O2OA 3JCMf 4DBQA 5IHIA 5GANe 4A53A 3CC4T 1WIEA 3M0RA 2X4WA 3PMTA 1AEYA 3AHUA 1N27A 3OYGA 3MJXA 3M0SA 5HK0A 4LE9A 1ZBJA 3EGXA 1M1KR 2DZ9A 1EIFA 1YITT 1YWPA 5GJWB 1AHJB 3FRNA 3CCST 2ED0A 1U1TA 2CH4W 1WXBA 3KXTA 3MPUB 2MWOA 3GPLA 2D1XA 3I9QA 2EKHA 3PVLA 4HXJA 3J81E 1I5OB 4X34A 3CCET 1WXUA 5LJ5d 3MEWA 4QW2A 3M59A 4AFZC 1VQLQ 1IREB 1YITA 1D1CA 3VS5A 2RHXA 1X27A 5FROA 1Q86C 1M3AA 5I11A 2GGRA 1U06A 1YWOA 2FRYA 3PIOA 4C8QA 1VQOA 3TSZA 3BW1A 3VUBA 1Q7YC 3Q1JA 4QQDA 4E7KA 1LCKA 1SRLA 1KC8U 2QXFA 3M5AA 1QVGP 3CCEQ 4IURA 3UT1A 3E9GA 1NLPC 3J80E 1MMGA 2JZ2A 1VQLT 3FLGA 4M7AG 1MHNA 3DKMA 4M7AD 5L8RE 1WHHA 2LQKA 3OYYA 3X28B 2EYZA 1VQOT 1QVGA 1NM7A 4C5IA 3HP9A 1MUZA 1LOJA 2HCKA 3KBGA 1NYFA 2M9UA 4M75G 3GBQA 5D6XA 4OMNA 3CD6A 2DRKA 3VRYA 3CBOA 3JV3A 3VS4A 1I4K1 1SKUB 5HCKA 2RQVA 2HSEB 4C8QF 4KT0E 1M90R 5KYXA 2DXUA 3VS2A 2KXDA 1UGSB 1BI1A 5IHNA 1JJ2A 3P8DA 3EG1A 2EAYA 3CMAT 5KYWA 3OW2A 2YXYA 5FWBA 2QEXT 4HKEA 3JB9F 2NYSA 3UATA 2DBKA 2EWNA 3KFVA 3E19A 4P5NA 3FJPA 1KQ2A 3MEVA 1E6HA 3G6EQ 2J06A 2J05A 3GNGA 3A8OB 1K8AU 1WQ7A 2R5AA 3CMET 2K57A 3L42A 4JJCA 2KROA 1VQ7T 1ZQ1A 4RG8A 3DLLA 2E3IA 3OYIA 3VS6A 3CCUA 2J6KA 2MWPA 1QW1A 2Z0WA 1ZA2B 2J6FA 1N8RR 3GLXA 3DB3A 4IUVA 2JS2A 2K3YA 2HBWA 3QZ5B 3PTAA 2MAMA 3DLMA 3CPWA 1IZ6A 3EHRA 1D3BA 1YBYA 4WTOB 2DIGA 2LQNA 4A4KA 2Y4XA 3CMEA 2KYBA 1JQQA 4TVRA 4KUIA 2XKOC 4IIOA 5GAOn 1I1JA 2RH2A 3QDRB 4M7DB 1YJNT 3CCLA 3UDCA 4AT1B 2JNGA 5I22A 4HA8A 3CCJT 1X43A 4DOVA 4M77E 4C5EA 2RD1A 4LUEA 4GLKA 2KT1A 1SHFA 5LJ3j 1K9MR 2O88A 3NPFA 3T9NA 4JS5A 4RTVA 4K11A 2BKDN 2QYZA 2SEMA 4Z88A 2PQWA 3JB9D 2R5MA 1MV3A 2P4TA 2HZYA 1FMKA 3C12A 2OTLQ 1X75C 5GAN6 1KD1C 5LL6S 1TUDA 1YJWA 2KYMA 4C5GA 1B34B 3CC2Q 1W2BP 1HYOA 1WJSA 4C8QG 4CI0C 5DM7R 3QYHB 3HKSA 2CZ6B 3EGDA 4KBMB 1Y0MA 3LH0A 2H8HA 2FVUA 3SWNC 4DBRA 1KFZA 4F7UB 3OYCA 1BU1A 4AG1C 4ZN1A 1WHMA 4E7SA 2RHIA 4JUVA 4ZGEB 4D8KA 4XU0A 2DERA 2EJGA 3CCQA 1KSWA 4F04B 4M77B 3FJ5A 5I2SA 2JUFA 4J8OA 4R56A 3QJYA 2JN0A 5FU7C 1NE8A 3GOXA 4N4GA 3VRZA 2HQXA 3INZA 1QQJA 3BE3A 3P8BB 1AVZC 2PZ1A 4BACA 3TEEA 2EYQA 1UGQB 2O01E 2E70A 1VQ8Q 3OYJA 1LJOA 5CK9A 3HTRA 1VYVA 1UHCA 3OYDA 4V2SA 2EYXA 4M77G 2JW4A 5KYYA 1ZBXA 1RLPC 2OTLA 4X9DA 1G2BA 1WLPB 1E6GA 4J9EA 2NUPA 5GAMg 1ZSZC 1KQ1A 1TS9A 2NUZA 2CP5A 1BB9A 5FW9A 1HD3A 2DL8A 3VS1A 2RJCA 3S3MA 3RERA 3CXCS 3C95A 4F16A 4FW2A 2DKGA 4KH0B 5GAOm 2EGEA 3RNJA 1TXQA 3BY7A 2DYBA 2CZ1B 1YCSB 1VYTA 2HQHA 4OB2B 3CCUT 4JJNK 1MGQA 4PJOG 3X26B 3CXCA 4A4EA 3V7RA 4XTUA 2QI2A 2P0QA 2EPDA 4ATOA 1SHGA 1UDLA 1VQ8A 1X69A 5LJ3f 3M9QA 1NG2A 1RADB 1Y7XA 4VUBA 2RI5A 4A54A 2J7IA 2DL4A 4ZNXA 3CPWS 2LCCA 3JB9H 2H3JA 4MDWA 4BI3A 4C0DB 1ZX6A 4FYWB 4HCZA 2ZCFB 2YUQA 3O8VA 2NLUA 2EJ9A 2C06A 2HBPA 2YHTA 4E7JA 2K9GA 1VQ9A 1HSQA 1N9RA 3GNFB 2OAWA 3EHQA 4M78D 2WSEE 2DMOA 2E3HA 2DD4A 2F1LA 2AHJB 5FU6C 4II1A 2LP5A 5M9OA 3HFOA 1ABQA 1RABB 1NPRA 2XU8A 3R6NA 3NHNA 4FU6A 2QA4T 2EIFA 3FIFA 2DXCA 1YJWT 3JCMh 3C4SA 3M0QA 2HQEA 3QXEB 2C0IA 2FG0A 2MIOA 1JO8A 5GANd 2DM1A 2MPXC 4HT9A 2B8AA 2F5TX 3S3OA 2VWFA 4J6WA 4F7UA 2M1HA 5DLQE 1YJNQ 2FHDA 5GAN2 3JCMc 2RN8A 2FRWA 4JPBW 4J9FA 1VUBA 3OS0A 4X9CA 1H8KA 3EG9A 3I55A 4EIKA 4DEYA 3SD4A 3OSSC 2EGAA 1YN8A 1BI0A 1N9SA 1ZUKA 3M4GA 4M7AB 3QWYA 2CT4A 2RHUA 5GAOl 5GAN3 3EG0A 4M7DC 3BDLA 1RUWA 1Q82U 4DBHA 2HSPA 1Y57A 4EMKA 4DA4A 2PUKB 5KYYB 6AT1B 3CCSQ 2LMJA 3CXCP 1MNEA 2XICA 3G71Q 1VQ6A 4ESRA 3C0CA 3OMCA 2F2WA 1M4ZA 4C0DC 1SSHA 2CUDA 1BCOA 4JDSA 4ORZA 5GANj 2DEQA 1ZUYA 2AK5A 4JLIA 2OJ2A 1S1NA 1S72Q 1UB4A 5LJ3g 1OU9A 4M78E 3X25B 4BY6C 3NTHA 1W6XA 3VS0A 3G4SQ 2XK0A 2CP0A 1ZUUA 5GAN7 1NJIC 4UC4A 3ZEHA 2FZGB 1IRXA 3UWNA 2E5KA 5LJ5e 4M77F 1VQ8T 2QGGA 2OX7A 4FYVB 4OMQA 2JVVA 5CQYA 5GMKm 1K76A 3OYFA 4C8QD 2P0KA 1KHCA 4HVUA 2JXBA 2F69A 3V8JA 3WXMB 2A08A 4PJOD 5ECAA 1U1SA 3ER0A 3VU3C 1W70A 3L1AA 4M7AC 4OMLA 3S6WA 4CC3A 2DZCA 3I56A 2DXTA 1VQ9T 1RI0A 4XK8E 3VS3A 4WF2A 1QP3A 5FRNA 3RKYA 3REAB 1X6BA 1Q7YU 1M9SA 1X6OA 2LDMA 2A0FB 4QVDA 4E6RA 2BE7D 4Q5WA 2VGNA 4C92D 4IUUA 4J9HA 1AWWA 3KUFA 3X24B 2DIQA 3M57A 1P92A 3OS5A 4L6V5 1RAAB 1H3HA 1U5SA 2XMFA 1Y96B 5DLOA 4FSXA 1ARKA 1H641 1K4US 1D0ZA 1M1KC 1YFNA 4FM4B 4PJJA 2IIMA 5GANg 4RTZA 3GP8A 3CQTA 2RPNA 2HKQB 2YSQA 1WZOA 2ZZDA 3H9NA 5EC7A 4LDXA 2QTXA 3MP6A 1Q7YR 1YJ9Q 4NS5A 2DL7A 2FEIA 4MZMA 4E7ZA 4QT7A 2I0NA 3L2VA 3WVDB 2DILA 3LLRA 1RAEB 2ZPGB 3JSCA 4F7UG 4ZN3A 1JJ2S 3NTKA 2AKKA 4LN2A 4CRIA 3VYHB 4M75D 4C0ZA 3I56Q 1ZSZA 4C8QE 4EPCA 2JT4A 1ZLMA 3M53A 3CC2A 2A37A 4PFPA 1WYXA 1OV3A 1XJWB 4GY5A 5D6WA 2LJ3A 2HL3A 2KSSA 4PK4A 3FB9A 3CCMT 2KXCA 4FYYB 4IKFA 4J6XA 1ABOA 4M78B 5CKDA 3SDZA 3CCRT 1NBEB 3TCJA 3ZBDA 2DNUA 1MNDA 2ZPEB 4N0AC 2KVQG 2GFAA 2K5LA 1N8RC 3A8HB 3D7SB 1B34A 1G8XA 1UECA 4AG2C 3ZFJA 1NPPA 4OVAA 5CO7A 4X1VA 2O31A 1QP2A 1CKAA 2RB6A 3S3NA 2PUOB 5CIUA 2AKLA 3ASKA 1M90U 1WA7A 1FYNA 1KJWA 2KMTA 4F17A 1YJ9A 1PSFA 3A5ZB 3ZL7C 3OYAA 2D8HA 3H0FA 3VS7A 4RCCA 1U8RA 1CKBA 2LT1A 3URGA 2AZSA 2O4XB 3M58A 4FT2A 2LCLA 2ENMA 5AYFA 3SHWA 3QO3A 5GAOr 4F7UE 2ZAEA 2XD0A 2VB6A 4J9BA 1HXDA 3MP1A 1KQSP 1Q82C 4PJMA 1YJ9T 1PRMC 3HSBA 3JCMg 4O5VA 2EQIA 3DB4A 5FWCA 1SSFA 1TUCA 1WNLA
chains in the Genus database with same CATH topology
2BZ8A 2ECZA 1EFNA 1PRLC 2CSQA 2NUZA 2YUNA 2MOXA 1BB9A 5FW9A 2PTKA 1HD3A 1PHTA 2DX1A 2DL8A 3VS1A 1W1FA 3M0PA 2RQUA 1K0SA 1SRMA 2F2XA 2KE9A 4F16A 1I07A 4IIMA 2KGTA 2YUOA 2QDLA 1OPLA 2EGEA 3RNJA 3I35A 4RTXA 2GTJA 2NWMA 2DYBA 2LNHB 1YCSB 1VYTA 1TG0A 2A36A 2CH4A 2RQWA 2K79A 2GTOA 1JXOA 2L3SA 2KR3A 2ROLA 1RI9A 1SPKA 1BBZA 1WFWA 3NMZC 2EPDA 1A0NB 1SHGA 1UDLA 1X69A 3SEMA 1AZEA 1UFFA 1NG2A 4A63B 1PKTA 1XOVA 1T3SA 2J7IA 2DL4A 4ZNXA 1M3BA 2P4RA 4M4ZA 2JM8A 4AFQC 1ZX6A 4AFSC 2DJQA 2BZYA 1K9AA 2YUQA 1AWJA 1GL5A 4AFUC 1JEGA 2J6OA 1B3QA 1GBRA 2K9GA 1HSQA 2X3WD 2DL5A 2OAWA 1X2KA 2K2MA 3EHQA 2K6DA 1GRIA 2DMOA 2KBTA 3H0IA 1E7OA 4HCKA 2LP5A 3EG2A 1T0JA 1ABQA 4GLMA 3M0UA 4D8DA 3R6NA 3NHNA 1PKSA 1UGVA 1WI7A 1UE9A 3RBBB 2EYYA 2L3QA 2JTEA 3I5RA 2DA9A 3M0QA 1CSKA 2JM9A 4OMMA 4Z8AA 2CREA 2C0IA 4Z89A 2FG0A 3A98A 2O2OA 2MIOA 5IHIA 1JO8A 1WIEA 3M0RA 1AEYA 2DM1A 1GFDA 1JU5C 3U23A 2VWFA 3M0SA 4LE9A 1ZBJA 4CC7A 2JMAA 1YWPA 5GJWB 2RN8A 2FRWA 2ED0A 2D8JA 1SEMA 2CH4W 4JPBW 1WXBA 4J9FA 4WCIA 4RUGA 2RNAA 2KRMA 2B86A 1H8KA 4F14A 1ZSGA 1B07A 2YDLA 2CUBA 4EIKA 4DEYA 2D1XA 3I9QA 2EKHA 3PVLA 4JJBA 2FPFA 4HXJA 3EGUA 3UF4A 2EGAA 3UA6A 1WXUA 5IHKA 2A28A 1AZGB 1YN8A 1ZUKA 4AFZC 4J9CA 2KRNA 1OEBA 4RTUA 2MCNA 2CDTA 3VS5A 2YT6A 4J9IA 1X27A 3QWYA 2CT4A 1M3AA 5I11A 4RTYA 1GCPA 2M0YA 1Z9QA 3EG0A 2GGRA 2JS0A 4R0KA 1RUWA 1U06A 2KEAA 2CT3A 1YWOA 1VYUA 1GCQA 2FRYA 2HSPA 1Y57A 2LQWA 3TSZA 4J9GA 2LMJA 1LCKA 1SRLA 4DEXA 3LH5A 2DLPA 2DBMA 4ESRA 3C0CA 2GBQA 2F2WA 1NLPC 1SSHA 2V1RA 2CUDA 4GBQA 4ORZA 2D0NA 3TSWA 1Z9ZA 2DL3A 2V1QA 2AZVA 2L2PA 1ZUYA 2C0OA 2AK5A 2EYZA 2L3PA 2OJ2A 3TVTA 1NM7A 2G6FX 3H41A 2PNIA 1MUZA 4HVWA 2L0AA 1UJYA 1S1NA 2HCKA 1X6GA 3QWXX 2CSIA 1NYFA 3GBQA 2F2VA 1W6XA 4OMNA 3VS0A 2DRKA 1UG1A 1NLOC 1ZUUA 2VKNA 3VRYA 3JV3A 3VS4A 2O9VA 1M3CA 2DRMA 5HCKA 2RQVA 1NYGA 2E5KA 2KNBB 4Y92A 3VS2A 4LUDA 1QWFA 2KXDA 4OMQA 5IHNA 5IXBA 4HVVA 1K76A 4FSSA 3EG1A 1UUEA 1KIKA 4HVUA 2JXBA 1IO6A 2A08A 1GCQC 5FWBA 4LNPA 4J9DA 5ECAA 1W70A 3UATA 1K0XA 2ED1A 2DBKA 3KFVA 1HJDA 4OMLA 1E6HA 2LX7A 4CC3A 2J06A 2J05A 2FO0A 2FPDA 3VS3A 2O9SA 4JJCA 1WX6A 2KROA 1UTIA 1WDXA 2DVJA 2K3BA 3REAB 1AWOA 3VS6A 2W10A 3O5ZA 1X6BA 2J6KA 1AWXA 1QLYA 1X2QA 2J6FA 4E6RA 1UHFA 1I0CA 2JS2A 2EYWA 4J9HA 2HBWA 2C0TA 1AWWA 1AD5A 1T3LA 3EHRA 1J3TA 2LQNA 2KT8A 4OMOA 1H3HA 2KYBA 1JQQA 1NEBA 1U5SA 2XMFA 3I5SA 4IIOA 1ARKA 1K4US 1MV0B 1UJ0A 4CC4B 4JJDA 2EBPA 1JXMA 1I1JA 2IIMA 4RTZA 2EGCA 1PNJA 1M27C 3CQTA 1K1ZA 2OI3A 2RPNA 2LJ1A 2YSQA 1WXTA 3UA7A 2FPEA 1YP5A 5EC7A 5I22A 1T0HA 1X43A 1OPKA 1YNZA 2DL7A 4LUEA 2FEIA 2KT1A 1SHFA 2GQIA 4QT7A 2I0NA 2VVKA 3NPFA 4CC2A 2O88A 2GNCA 2DILA 2DF6A 5L23A 4RTVA 2W0ZA 4K11A 2SEMA 2AKKA 5IH2A 4LN2A 4Z88A 1MV3A 2JT4A 1ZLMA 2DE0X 2BTTA 1N5ZA 3NGPA 1FMKA 5IXFA 1AOJA 2A37A 3PE0A 1WYXA 1TUDA 2LCSA 1OV3A 2KYMA 2ESWA 2LJ3A 3EG3A 3IQLA 1H92A 2YUPA 1GFCA 2KXCA 4RTTA 2KRSA 2RQRA 1Y0MA 1ABOA 3THKA 2H8HA 4JZ4A 1KFZA 2DNUA 1PWTA 2ROTA 3REBB 1RLQC 1BU1A 2LJ0A 1G83A 4AG1C 2RQTA 1NEGA 1V1CA 1GBQA 2EVRA 4D8KA 1UECA 2HDAA 4AG2C 2JMCA 1QCFA 2K7AA 1KSWA 4X1VA 2O31A 2SRCA 1CKAA 3FJ5A 1OOTA 3ULRB 5GJVB 2AKLA 1BK2A 2LZ6B 4OMPA 1WA7A 4KRTA 1FYNA 1KJWA 3M0TA 4F17A 3VRZA 3ZL7C 2RMOA 2D8HA 2M51A 1VA7A 1AVZC 2PZ1A 3H0FA 1QKXA 3VS7A 1CKBA 1M8MA 2AZSA 2HEQA 2RF0A 2ENMA 3SHWA 1QWEA 3H0HA 1VYVA 1UHCA 4JZ3A 4J9BA 2EYXA 2ABLA 2JW4A 1RLPC 1U3OA 1PRMC 2EW3A 4RTWA 1G2BA 1WLPB 1M30A 2EQIA 1E6GA 3PVQA 2BZXA 5FWCA 4J9EA 1TUCA 1QKWA 2X3XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZ8 A;  2ECZ A;  1EFN A;  1PRL C;  2CSQ A;  2NUZ A;  2YUN A;  2MOX A;  1BB9 A;  5FW9 A;  2PTK A;  1HD3 A;  1PHT A;  2DX1 A;  2DL8 A;  3VS1 A;  1W1F A;  3M0P A;  2RQU A;  1K0S A;  1SRM A;  2F2X A;  2KE9 A;  4F16 A;  1I07 A;  4IIM A;  2KGT A;  2YUO A;  2QDL A;  1OPL A;  2EGE A;  3RNJ A;  3I35 A;  4RTX A;  2GTJ A;  2NWM A;  2DYB A;  2LNH B;  1YCS B;  1VYT A;  1TG0 A;  2A36 A;  2CH4 A;  2RQW A;  2K79 A;  2GTO A;  1JXO A;  2L3S A;  2KR3 A;  2ROL A;  1RI9 A;  1SPK A;  1BBZ A;  1WFW A;  3NMZ C;  2EPD A;  1A0N B;  1SHG A;  1UDL A;  1X69 A;  3SEM A;  1AZE A;  1UFF A;  1NG2 A;  4A63 B;  1PKT A;  1XOV A;  1T3S A;  2J7I A;  2DL4 A;  4ZNX A;  1M3B A;  2P4R A;  4M4Z A;  2JM8 A;  4AFQ C;  1ZX6 A;  4AFS C;  2DJQ A;  2BZY A;  1K9A A;  2YUQ A;  1AWJ A;  1GL5 A;  4AFU C;  1JEG A;  2J6O A;  1B3Q A;  1GBR A;  2K9G A;  1HSQ A;  2X3W D;  2DL5 A;  2OAW A;  1X2K A;  2K2M A;  3EHQ A;  2K6D A;  1GRI A;  2DMO A;  2KBT A;  3H0I A;  1E7O A;  4HCK A;  2LP5 A;  3EG2 A;  1T0J A;  1ABQ A;  4GLM A;  3M0U A;  4D8D A;  3R6N A;  3NHN A;  1PKS A;  1UGV A;  1WI7 A;  1UE9 A;  3RBB B;  2EYY A;  2L3Q A;  2JTE A;  3I5R A;  2DA9 A;  3M0Q A;  1CSK A;  2JM9 A;  4OMM A;  4Z8A A;  2CRE A;  2C0I A;  4Z89 A;  2FG0 A;  3A98 A;  2O2O A;  2MIO A;  5IHI A;  1JO8 A;  1WIE A;  3M0R A;  1AEY A;  2DM1 A;  1GFD A;  1JU5 C;  3U23 A;  2VWF A;  3M0S A;  4LE9 A;  1ZBJ A;  4CC7 A;  2JMA A;  1YWP A;  5GJW B;  2RN8 A;  2FRW A;  2ED0 A;  2D8J A;  1SEM A;  2CH4 W;  4JPB W;  1WXB A;  4J9F A;  4WCI A;  4RUG A;  2RNA A;  2KRM A;  2B86 A;  1H8K A;  4F14 A;  1ZSG A;  1B07 A;  2YDL A;  2CUB A;  4EIK A;  4DEY A;  2D1X A;  3I9Q A;  2EKH A;  3PVL A;  4JJB A;  2FPF A;  4HXJ A;  3EGU A;  3UF4 A;  2EGA A;  3UA6 A;  1WXU A;  5IHK A;  2A28 A;  1AZG B;  1YN8 A;  1ZUK A;  4AFZ C;  4J9C A;  2KRN A;  1OEB A;  4RTU A;  2MCN A;  2CDT A;  3VS5 A;  2YT6 A;  4J9I A;  1X27 A;  3QWY A;  2CT4 A;  1M3A A;  5I11 A;  4RTY A;  1GCP A;  2M0Y A;  1Z9Q A;  3EG0 A;  2GGR A;  2JS0 A;  4R0K A;  1RUW A;  1U06 A;  2KEA A;  2CT3 A;  1YWO A;  1VYU A;  1GCQ A;  2FRY A;  2HSP A;  1Y57 A;  2LQW A;  3TSZ A;  4J9G A;  2LMJ A;  1LCK A;  1SRL A;  4DEX A;  3LH5 A;  2DLP A;  2DBM A;  4ESR A;  3C0C A;  2GBQ A;  2F2W A;  1NLP C;  1SSH A;  2V1R A;  2CUD A;  4GBQ A;  4ORZ A;  2D0N A;  3TSW A;  1Z9Z A;  2DL3 A;  2V1Q A;  2AZV A;  2L2P A;  1ZUY A;  2C0O A;  2AK5 A;  2EYZ A;  2L3P A;  2OJ2 A;  3TVT A;  1NM7 A;  2G6F X;  3H41 A;  2PNI A;  1MUZ A;  4HVW A;  2L0A A;  1UJY A;  1S1N A;  2HCK A;  1X6G A;  3QWX X;  2CSI A;  1NYF A;  3GBQ A;  2F2V A;  1W6X A;  4OMN A;  3VS0 A;  2DRK A;  1UG1 A;  1NLO C;  1ZUU A;  2VKN A;  3VRY A;  3JV3 A;  3VS4 A;  2O9V A;  1M3C A;  2DRM A;  5HCK A;  2RQV A;  1NYG A;  2E5K A;  2KNB B;  4Y92 A;  3VS2 A;  4LUD A;  1QWF A;  2KXD A;  4OMQ A;  5IHN A;  5IXB A;  4HVV A;  1K76 A;  4FSS A;  3EG1 A;  1UUE A;  1KIK A;  4HVU A;  2JXB A;  1IO6 A;  2A08 A;  1GCQ C;  5FWB A;  4LNP A;  4J9D A;  5ECA A;  1W70 A;  3UAT A;  1K0X A;  2ED1 A;  2DBK A;  3KFV A;  1HJD A;  4OML A;  1E6H A;  2LX7 A;  4CC3 A;  2J06 A;  2J05 A;  2FO0 A;  2FPD A;  3VS3 A;  2O9S A;  4JJC A;  1WX6 A;  2KRO A;  1UTI A;  1WDX A;  2DVJ A;  2K3B A;  3REA B;  1AWO A;  3VS6 A;  2W10 A;  3O5Z A;  1X6B A;  2J6K A;  1AWX A;  1QLY A;  1X2Q A;  2J6F A;  4E6R A;  1UHF A;  1I0C A;  2JS2 A;  2EYW A;  4J9H A;  2HBW A;  2C0T A;  1AWW A;  1AD5 A;  1T3L A;  3EHR A;  1J3T A;  2LQN A;  2KT8 A;  4OMO A;  1H3H A;  2KYB A;  1JQQ A;  1NEB A;  1U5S A;  2XMF A;  3I5S A;  4IIO A;  1ARK A;  1K4U S;  1MV0 B;  1UJ0 A;  4CC4 B;  4JJD A;  2EBP A;  1JXM A;  1I1J A;  2IIM A;  4RTZ A;  2EGC A;  1PNJ A;  1M27 C;  3CQT A;  1K1Z A;  2OI3 A;  2RPN A;  2LJ1 A;  2YSQ A;  1WXT A;  3UA7 A;  2FPE A;  1YP5 A;  5EC7 A;  5I22 A;  1T0H A;  1X43 A;  1OPK A;  1YNZ A;  2DL7 A;  4LUE A;  2FEI A;  2KT1 A;  1SHF A;  2GQI A;  4QT7 A;  2I0N A;  2VVK A;  3NPF A;  4CC2 A;  2O88 A;  2GNC A;  2DIL A;  2DF6 A;  5L23 A;  4RTV A;  2W0Z A;  4K11 A;  2SEM A;  2AKK A;  5IH2 A;  4LN2 A;  4Z88 A;  1MV3 A;  2JT4 A;  1ZLM A;  2DE0 X;  2BTT A;  1N5Z A;  3NGP A;  1FMK A;  5IXF A;  1AOJ A;  2A37 A;  3PE0 A;  1WYX A;  1TUD A;  2LCS A;  1OV3 A;  2KYM A;  2ESW A;  2LJ3 A;  3EG3 A;  3IQL A;  1H92 A;  2YUP A;  1GFC A;  2KXC A;  4RTT A;  2KRS A;  2RQR A;  1Y0M A;  1ABO A;  3THK A;  2H8H A;  4JZ4 A;  1KFZ A;  2DNU A;  1PWT A;  2ROT A;  3REB B;  1RLQ C;  1BU1 A;  2LJ0 A;  1G83 A;  4AG1 C;  2RQT A;  1NEG A;  1V1C A;  1GBQ A;  2EVR A;  4D8K A;  1UEC A;  2HDA A;  4AG2 C;  2JMC A;  1QCF A;  2K7A A;  1KSW A;  4X1V A;  2O31 A;  2SRC A;  1CKA A;  3FJ5 A;  1OOT A;  3ULR B;  5GJV B;  2AKL A;  1BK2 A;  2LZ6 B;  4OMP A;  1WA7 A;  4KRT A;  1FYN A;  1KJW A;  3M0T A;  4F17 A;  3VRZ A;  3ZL7 C;  2RMO A;  2D8H A;  2M51 A;  1VA7 A;  1AVZ C;  2PZ1 A;  3H0F A;  1QKX A;  3VS7 A;  1CKB A;  1M8M A;  2AZS A;  2HEQ A;  2RF0 A;  2ENM A;  3SHW A;  1QWE A;  3H0H A;  1VYV A;  1UHC A;  4JZ3 A;  4J9B A;  2EYX A;  2ABL A;  2JW4 A;  1RLP C;  1U3O A;  1PRM C;  2EW3 A;  4RTW A;  1G2B A;  1WLP B;  1M30 A;  2EQI A;  1E6G A;  3PVQ A;  2BZX A;  5FWC A;  4J9E A;  1TUC A;  1QKW A;  2X3X D; 
#chains in the Genus database with same CATH topology
 5CKE A;  4M78 A;  5LJ5 f;  1Y96 A;  1LVK A;  2PTK A;  3EFO A;  3RR6 A;  3MKD A;  4IUQ A;  1K0S A;  1M5Q 1;  4LXC A;  1SRM A;  2WSC E;  1LPL A;  4XTY A;  2KGT A;  2QQ9 A;  2X4Y A;  1YHQ T;  5IT9 E;  2OTJ T;  2WSF E;  1TG0 A;  1O75 A;  1VIF A;  5I2M A;  3BFM A;  3OYH A;  5GAN 4;  1JXO A;  2DTO A;  2L3S A;  2KR3 A;  4M7A E;  4PFO A;  4EDU A;  2EQJ A;  5EG2 A;  1BBZ A;  1EZZ B;  1KQS A;  3NMZ C;  1VQ5 T;  3M4Y A;  1C0M A;  2EJF A;  1M1F A;  4PJN A;  3H6Z A;  1VQP A;  1NZ9 A;  3SWN B;  1VQ4 A;  5CR2 A;  2DPP B;  4XTX A;  1YI2 Q;  5C6S A;  1K9M C;  1YIJ Q;  4M4Z A;  3CCV Q;  2COW A;  4PJL A;  4XTW A;  5AT1 B;  2DJQ A;  3I55 Q;  2BZY A;  1AWJ A;  1VQN T;  1VQ7 Q;  2A3L A;  3VJP A;  1GBR A;  2X3W D;  2DL5 A;  2K3X A;  2QEX Q;  4B6M A;  1X2K A;  2ATC B;  3RMS A;  2K2M A;  2K6D A;  2KQW A;  3QKJ A;  2VC8 A;  5GMK e;  2EKO A;  3H0I A;  4M75 C;  3CC4 A;  1D0X A;  1C1A A;  1R77 A;  5KE2 A;  4GLM A;  4E47 A;  2BE9 B;  2K4Y A;  4N0A A;  2I2L A;  1WI7 A;  3VKI A;  3RBB B;  3CCS A;  1G3W A;  2RO0 A;  2JTE A;  4JS4 A;  3PMI A;  3JB9 J;  3L2U A;  1FXX A;  4LDW A;  5IN1 A;  4MZT A;  2RK1 A;  2JOY A;  2RHY A;  1O9S A;  3CCL T;  1YJN A;  3CCR A;  1JU5 C;  3U23 A;  2RI3 A;  3OB9 A;  1VQP Q;  5KYX B;  2JMA A;  2L5Q A;  2E64 A;  5HY6 A;  2KI7 A;  2D8J A;  1YHQ Q;  4PFZ A;  1ACM B;  2QA4 Q;  3QG1 A;  2B86 A;  4F14 A;  3JCM d;  2ZGW A;  4YTL A;  2YDL A;  2CUB A;  3RKX A;  4OB1 B;  4RG2 A;  5DY9 A;  3EGU A;  3UF4 A;  1DJ7 B;  5IHK A;  2A28 A;  2KRN A;  4O6J A;  1OEB A;  2F5K A;  1QCO A;  1VQ5 Q;  2CDT A;  3CC7 T;  2YT6 A;  2D0Q B;  4J9I A;  1UEB A;  2XID A;  1W2B S;  1VQL A;  4N4H A;  1GCP A;  1OZ3 A;  1Z9Q A;  3F70 A;  2KEA A;  3JCM b;  4XU3 A;  1OU8 A;  3G71 A;  1VQ6 Q;  2LTO A;  4KUL A;  5GAN f;  3CCE A;  5A2Q E;  1C6V X;  4DEX A;  5KCO A;  2EQM A;  1BIB A;  2R58 A;  1XNI A;  3LWI A;  4M75 B;  3UPU A;  2EQU A;  1PC0 A;  2DLP A;  3CC7 A;  1Q81 U;  3PGG A;  3TRE A;  1TTH B;  1D09 B;  2MF2 A;  2D0N A;  4GBQ A;  3MCA B;  1Z9Z A;  2DL3 A;  2AZV A;  5HK3 A;  2C0O A;  2ZPI B;  2COZ A;  4N4I A;  4M75 E;  3TVT A;  2G6F X;  4B9W A;  3H41 A;  1Q81 C;  5LJ3 e;  4PKC C;  3CBP A;  2D6F A;  1VIE A;  4HVW A;  1YHQ A;  4E7I A;  1WHK A;  1X6G A;  3QWX X;  4FIB A;  3PFS A;  3G4S A;  2HMA A;  2NUT B;  3HRU A;  3JAM E;  3CCJ Q;  4J6Y A;  1I8F A;  2F2V A;  1NLO C;  2CS7 A;  2VKN A;  3V8K A;  3PT9 A;  3HRT A;  4QQ6 A;  3CD6 Q;  2O9V A;  1M3C A;  2DTI A;  1VQ5 A;  3M56 A;  3QBY A;  4LD6 A;  1BI3 A;  2KNB B;  4Y92 A;  3EGX B;  4LUD A;  2LX9 A;  3HRS A;  4J7I A;  4BDZ A;  1KQS S;  2H3E B;  4HVV A;  2YLC A;  1G3Y A;  1KIK A;  4XTZ A;  2FL7 A;  2YRD A;  3CD6 T;  4LNP A;  4J9D A;  4A4F A;  1VOM A;  2XHC A;  4M7D A;  1K0X A;  4ANJ A;  1HJD A;  1VQM A;  2YLB A;  4OGC A;  3CC7 Q;  2LX7 A;  2XG8 D;  2FO0 A;  4ELZ C;  1K73 U;  1G3S A;  1BI2 A;  1SG5 A;  3MHX A;  3A8L B;  4R55 A;  2FZK B;  3CCU Q;  3QSU A;  1WX6 A;  1UTI A;  4M7D G;  1WDX A;  4M77 A;  5KE3 A;  2DVJ A;  1KC8 R;  1AWO A;  2W10 A;  1H3Z A;  1QLY A;  2DFU A;  3OS2 A;  1I0C A;  3VUZ A;  2EYW A;  4IUP A;  2DD5 A;  2C0T A;  5KYU B;  3OW2 P;  1AD5 A;  1T3L A;  3CCJ A;  4PJO E;  1J3T A;  2KT8 A;  1NEB A;  2CZ0 B;  3MO8 A;  3I5S A;  2FZC B;  4CC4 B;  4C0F A;  1D1B A;  4F7U F;  1JXM A;  5J26 A;  1M27 C;  1K1Z A;  1AT1 B;  2E6N A;  2OI3 A;  3JCM e;  3JCM Q;  4MZP A;  4L59 A;  4M7D F;  5LJ3 d;  1X01 A;  1PG5 B;  1YP5 A;  1N8R U;  1T0H A;  2ZPF B;  1M2V B;  1OPK A;  2OAU A;  5GAN h;  1Q82 R;  5GAO p;  2GQI A;  4FCY A;  2X4J A;  2VVK A;  4CC2 A;  2FYK A;  2QQR A;  3CPW P;  5L23 A;  2W0Z A;  2Y90 A;  4BY6 B;  2E65 A;  4BE2 A;  1IHV A;  2L89 A;  1YJW Q;  2K5F A;  1VQK A;  2EFI A;  4QVZ A;  5IXF A;  3PE0 A;  4A4G A;  4QVC A;  1W2B A;  3EG3 A;  1XQH A;  3RDV A;  5D6Y A;  3BDU A;  4M75 F;  4Y28 E;  3IQL A;  1Y71 A;  5GAN 8;  1GFC A;  4BUG A;  5A0D A;  3L2Z A;  1SF9 A;  4FYX B;  4RTT A;  2MI6 A;  3THK A;  2DJZ A;  7AT1 B;  5KYN A;  2JTF A;  3MEA A;  2ROT A;  4OP0 A;  1RLQ C;  2LJ0 A;  1G83 A;  1VQK T;  3EH2 A;  4PL6 A;  4D6W A;  4XU1 A;  5GMK l;  5J3B A;  5CCA A;  1ZHI A;  1GXI E;  2RQT A;  3CCQ Q;  1NEG A;  1GBQ A;  2EVR A;  2QAS A;  1PD0 A;  1QVG S;  3PIP A;  2HDA A;  4PLL A;  4M7A F;  2JMC A;  4C5H A;  1QCF A;  3X20 B;  2K7A A;  3JCM P;  2SRC A;  2PU9 B;  1OOT A;  4C8Q B;  4DBF A;  1BK2 A;  5KH6 A;  2OTL T;  3M0T A;  5FU7 B;  3VV0 A;  5GMK h;  3H8Z A;  2RMO A;  3JCM X;  3QPH A;  3CPF A;  5CKB A;  1QKX A;  1F1B B;  2RHZ A;  4LD9 K;  5A0G A;  2HEQ A;  2RF0 A;  4ZTJ A;  1BCM A;  5CQX A;  1QWE A;  4M75 A;  4E7L A;  1D1A A;  3QDF A;  2BUD A;  3E2U A;  1U3O A;  4XTV A;  5LJ5 h;  4RTW A;  1R8O B;  1WHJ A;  1PM3 A;  1M30 A;  2BZX A;  3EAE A;  1B7T A;  1K8A R;  4OB3 B;  2X3X D;  4OB0 B;  1VQ6 T;  1I81 A;  2ECZ A;  3LGF A;  1PRL C;  2CSQ A;  5GAN 5;  3TQ7 P;  2MOX A;  3CMA A;  4PJO B;  2DTH A;  3M0P A;  3P8H A;  2QEX A;  2F2X A;  4BDY A;  3VYG A;  1PSE A;  2KE9 A;  2V8J A;  3OYL A;  2A7Y A;  4HCC A;  1I07 A;  2YUO A;  1TH7 A;  1OPL A;  3OS1 A;  5J39 A;  4RTX A;  3EG9 B;  1WHL A;  1R0C B;  2LNH B;  2A36 A;  4KGV B;  2DAQ A;  2K79 A;  3EFO B;  2KDS A;  3TU4 K;  1RI9 A;  1SPK A;  2KY9 A;  1WFW A;  4PLI A;  2DO3 A;  2VAS A;  2CYZ B;  2IVW A;  1V76 A;  1UGR B;  3JRZ A;  1VQ4 Q;  1G5V A;  2AT1 B;  2CKK A;  3SEM A;  4EMK B;  3HHT B;  1XOV A;  4L5G A;  1OI1 A;  3V8L A;  3OBY A;  4DQ2 A;  2E10 A;  1FX7 A;  1OZ2 A;  2MK5 A;  1VQ9 Q;  3MEU A;  4M78 C;  1GL5 A;  3OMG A;  2VGM A;  3CMA Q;  5GMK j;  2J6O A;  1B3Q A;  3I56 T;  1KG1 A;  3V7C A;  5A0L A;  2E5Q A;  5D7U A;  5KYW B;  1RAC B;  2P84 A;  4J5Y A;  1E7O A;  2EQK A;  4J7F A;  2LT4 A;  2V8I A;  3M0U A;  3FC3 A;  1PKS A;  1M8V A;  2Y4Y A;  1UE9 A;  2EYY A;  2RI2 A;  4MMK A;  3I5R A;  1CSK A;  4QKU A;  2JM9 A;  3V7S A;  4OMM A;  1ZA1 B;  1XTD A;  2LVM A;  5FLX E;  3RUX A;  2CRE A;  4Z89 A;  3CCR Q;  3I55 T;  4M77 D;  2X35 A;  1GFD A;  3A8M B;  4ZTF A;  4RKU E;  4CC7 A;  3JCM W;  2QA4 A;  2RJF A;  2VV5 A;  1SEM A;  4JRI A;  4WCI A;  2XDD A;  2K5I A;  1QVF P;  4RUG A;  4RMO A;  3CCQ T;  2RNA A;  4KUD K;  2KRM A;  5GAM j;  3NFC A;  4HT8 A;  1ZSG A;  1B07 A;  4XQ3 A;  4ZGJ B;  3E1S A;  1MMN A;  1QMC A;  3M54 A;  2DXB A;  4JJB A;  2NUT A;  3RMQ A;  3JB9 G;  2FPF A;  1RAH B;  1NJI R;  4XAX B;  4HCB A;  3UA6 A;  1AZG B;  3CC2 T;  4J9C A;  4RTU A;  2MCN A;  2E6Z A;  4JLG A;  3C94 A;  4M7D D;  4RTY A;  4XU2 A;  2M0Y A;  3PNW C;  1KK7 A;  2JS0 A;  4R0K A;  1K9M U;  2CT3 A;  3CCM A;  1VYU A;  1GCQ A;  2HL5 C;  4IUT A;  4M78 F;  2LQW A;  4NOY A;  1W4S A;  1VQN Q;  1OX9 A;  4J9G A;  1KHI A;  4AMC A;  1VQO Q;  3LH5 A;  1IHW A;  2DBM A;  2GBQ A;  2E1H A;  3M55 A;  2V1R A;  2JJ9 A;  3TSW A;  2V1Q A;  2L2P A;  2QGF B;  2KAF A;  3CEY A;  3EGD B;  1MMD A;  2DK3 A;  1WQW A;  5GAM h;  2L3P A;  1KC8 C;  3A1P A;  2PNI A;  1S72 A;  2RJE A;  1K73 C;  3G7Z A;  5CKH A;  2L0A A;  1UJY A;  2ZPB B;  3OYE A;  3QYG B;  2CSI A;  2LRQ A;  1QCN A;  2WAC A;  1FMW A;  4KH1 B;  4OMF B;  1Q86 U;  3OBW A;  3RES A;  1UG1 A;  5CKF A;  4BD3 A;  4FT4 A;  1M2O A;  2MYS A;  2DRM A;  1NYG A;  3QJ6 A;  1Q86 R;  4DOW A;  2VUB A;  1Q95 G;  1QWF A;  3QII A;  4Z02 A;  1Y07 A;  3OQ5 A;  4RCB A;  5IXB A;  4KGX B;  4FSS A;  2M02 A;  1UUE A;  2M16 A;  4EMH A;  1IO6 A;  3QHS A;  4C8Q C;  1GCQ C;  1VQM Q;  1JRI A;  2QTV A;  3QZ9 B;  2ED1 A;  4EMG A;  2ZPH B;  1PD1 A;  4J83 A;  2COY A;  1TU0 B;  4C92 C;  2FPD A;  8AT1 B;  4M77 C;  1VQK Q;  2DYI A;  4JRP A;  3EFS A;  2O9S A;  3JB9 I;  4JRQ A;  2X9H A;  1PCX A;  2YRC A;  4MML A;  1TWB A;  5CAI A;  2K3B A;  1IXD A;  1RAI B;  1JBM A;  3O5Z A;  1AWX A;  5KCH A;  1X2Q A;  2GFU A;  1UHF A;  2MMP A;  1RAF B;  1WPY A;  3FDR A;  3OA6 A;  1ZSZ B;  2DET A;  2DVE A;  1FWZ A;  3LGL A;  4OMO A;  2X4X A;  2E12 A;  3EFR A;  1N6A A;  2YRV A;  4E2F B;  1TSF A;  1VQ4 T;  1MV0 B;  3RIR A;  1UJ0 A;  4PJO C;  1K73 R;  4LDU A;  4JJD A;  2EBP A;  2EGC A;  1PNJ A;  1JB0 E;  4OGE A;  3OYB A;  1MMA A;  5I21 A;  2LJ1 A;  1YI2 T;  4LDV A;  1WXT A;  1WGS A;  3UA7 A;  1YIJ T;  2CP6 A;  2FPE A;  3MET A;  3CCL Q;  8ATC B;  3OYM A;  3SB2 A;  1YNZ A;  1IB8 A;  4C92 E;  3HFN A;  1M90 C;  2GNC A;  2DF6 A;  2AIR B;  1QVP A;  3G6E A;  2V26 A;  5IH2 A;  2RA2 A;  3QUI A;  3SFM A;  2FB7 A;  5FU6 B;  5KYU A;  2DE0 X;  2PVG B;  3OSV A;  2BTT A;  1N5Z A;  3NGP A;  4JRK A;  1AOJ A;  1Q81 R;  2L3R A;  2E41 A;  4KGZ B;  2LCS A;  3AT1 B;  3CBM A;  2ESW A;  1BYM A;  2GF7 A;  2OTJ Q;  2JTM A;  2HKN A;  1TOV A;  2O4X A;  1FMV A;  1H92 A;  2CZ7 B;  2YUP A;  2KRS A;  2RQR A;  4BI8 B;  1BIA A;  4B9X A;  3GIB A;  4FL6 A;  4JZ4 A;  2M0O A;  1M1K U;  3JCM J;  4OF1 A;  4A4H A;  3CME Q;  1PWT A;  2HNI A;  4C92 F;  3REB B;  2NUP B;  3LX7 A;  2K2V A;  1IGQ A;  5LJ5 j;  1V1C A;  2YWW A;  1OQK A;  2XDP A;  2RJD A;  4BE0 A;  3OW2 S;  4BE1 A;  1QVF A;  3JCM V;  3LWH A;  3OY9 A;  5GAM e;  3ULR B;  4ZGD B;  5GJV B;  2LZ6 B;  4OMP A;  5GAO q;  1KD1 R;  1LNX A;  2IPO B;  4KRT A;  4M78 G;  1S72 T;  5IAY A;  1YCY A;  2M51 A;  1VA7 A;  4PJO F;  2LQ8 A;  3E9F A;  1OUL A;  1M8M A;  2PVO B;  5GAM f;  4C0G A;  5LJ3 h;  1RAG B;  1QVF S;  4BI4 A;  3H0H A;  2DEU A;  4JZ3 A;  4NL2 A;  5CVI A;  4Y91 A;  9ATC B;  2ABL A;  3GF5 A;  3G71 T;  2EW3 A;  4NL3 A;  3PVQ A;  4M7D E;  4PNO A;  2VXF A;  1QKW A;  2OTJ A;  2BZ8 A;  2QQA A;  4C92 A;  1HK9 A;  1JJ2 P;  1EFN A;  5C0M A;  5GAM d;  3L2Q A;  2YUN A;  3RKW A;  1R0B G;  4C92 G;  1PHT A;  2DX1 A;  1TUG B;  1W1F A;  2QAZ A;  2RQU A;  2LC4 A;  1M1G A;  4IIM A;  4LDY A;  2QDL A;  1NJI U;  1K8A C;  3WVE B;  3OYN A;  3I35 A;  2GTJ A;  2NWM A;  1G3T A;  2RM4 A;  3FEO A;  2KK4 A;  2XI9 A;  3G4S T;  2CH4 A;  2RQW A;  2GTO A;  4PJO A;  2CP2 A;  2ROL A;  2E4H A;  2VYT A;  4C92 B;  3G1J A;  1OYX A;  2QDY B;  3A8G B;  3SWN A;  1BKB A;  2QQS A;  1A0N B;  1WJQ A;  1V29 B;  3LW5 E;  1OX8 A;  1I5L A;  4ELY C;  1WJR A;  2HAX A;  3MP8 A;  2IG0 A;  1AZE A;  1UFF A;  4A63 B;  1PKT A;  3N5B B;  2RK2 A;  1T3S A;  3CCV A;  3HL8 A;  1M3B A;  2P0P A;  2P4R A;  4BB7 A;  3L2R A;  2GQV A;  5FRM A;  4MDX A;  2JM8 A;  4AFQ C;  2PVD B;  1UGP B;  2G3R A;  1YI2 A;  4AFS C;  1VQM T;  2XDB A;  1YIJ A;  1K9A A;  4ME7 A;  3ME9 A;  2CP7 A;  2QG9 B;  1M2V A;  4AFU C;  3R6O A;  1JEG A;  2BIV A;  1VQP T;  1YIT Q;  3CC4 Q;  3CCV T;  1VQ7 A;  3EH1 A;  1GRI A;  4EMK C;  2KBT A;  2L8D A;  4HCK A;  3HPW A;  3G6E T;  1D0Y A;  3L2W A;  3EG2 A;  1T0J A;  2HD0 A;  3CCM Q;  2QK0 A;  4E7H A;  2GCX A;  2R57 A;  2VXE A;  5HKC A;  1KD1 U;  2LNV A;  4D8D A;  1EX4 A;  2CP3 A;  2QQB A;  3OYK A;  1D3B B;  3LYI A;  2D9T A;  1VQN A;  4M7A A;  1RL2 A;  1UGV A;  3NTI A;  1IGU A;  2X51 A;  2L3Q A;  2DA9 A;  5LJ5 g;  4Z8A A;  4FW1 A;  2CGH A;  4QQG A;  5GMK i;  3A98 A;  1WHG A;  2V8K A;  3J7A F;  2O2O A;  3JCM f;  4DBQ A;  5IHI A;  5GAN e;  4A53 A;  3CC4 T;  1WIE A;  3M0R A;  2X4W A;  3PMT A;  1AEY A;  3AHU A;  1N27 A;  3OYG A;  3MJX A;  3M0S A;  5HK0 A;  4LE9 A;  1ZBJ A;  3EGX A;  1M1K R;  2DZ9 A;  1EIF A;  1YIT T;  1YWP A;  5GJW B;  1AHJ B;  3FRN A;  3CCS T;  2ED0 A;  1U1T A;  2CH4 W;  1WXB A;  3KXT A;  3MPU B;  2MWO A;  3GPL A;  2D1X A;  3I9Q A;  2EKH A;  3PVL A;  4HXJ A;  3J81 E;  1I5O B;  4X34 A;  3CCE T;  1WXU A;  5LJ5 d;  3MEW A;  4QW2 A;  3M59 A;  4AFZ C;  1VQL Q;  1IRE B;  1YIT A;  1D1C A;  3VS5 A;  2RHX A;  1X27 A;  5FRO A;  1Q86 C;  1M3A A;  5I11 A;  2GGR A;  1U06 A;  1YWO A;  2FRY A;  3PIO A;  4C8Q A;  1VQO A;  3TSZ A;  3BW1 A;  3VUB A;  1Q7Y C;  3Q1J A;  4QQD A;  4E7K A;  1LCK A;  1SRL A;  1KC8 U;  2QXF A;  3M5A A;  1QVG P;  3CCE Q;  4IUR A;  3UT1 A;  3E9G A;  1NLP C;  3J80 E;  1MMG A;  2JZ2 A;  1VQL T;  3FLG A;  4M7A G;  1MHN A;  3DKM A;  4M7A D;  5L8R E;  1WHH A;  2LQK A;  3OYY A;  3X28 B;  2EYZ A;  1VQO T;  1QVG A;  1NM7 A;  4C5I A;  3HP9 A;  1MUZ A;  1LOJ A;  2HCK A;  3KBG A;  1NYF A;  2M9U A;  4M75 G;  3GBQ A;  5D6X A;  4OMN A;  3CD6 A;  2DRK A;  3VRY A;  3CBO A;  3JV3 A;  3VS4 A;  1I4K 1;  1SKU B;  5HCK A;  2RQV A;  2HSE B;  4C8Q F;  4KT0 E;  1M90 R;  5KYX A;  2DXU A;  3VS2 A;  2KXD A;  1UGS B;  1BI1 A;  5IHN A;  1JJ2 A;  3P8D A;  3EG1 A;  2EAY A;  3CMA T;  5KYW A;  3OW2 A;  2YXY A;  5FWB A;  2QEX T;  4HKE A;  3JB9 F;  2NYS A;  3UAT A;  2DBK A;  2EWN A;  3KFV A;  3E19 A;  4P5N A;  3FJP A;  1KQ2 A;  3MEV A;  1E6H A;  3G6E Q;  2J06 A;  2J05 A;  3GNG A;  3A8O B;  1K8A U;  1WQ7 A;  2R5A A;  3CME T;  2K57 A;  3L42 A;  4JJC A;  2KRO A;  1VQ7 T;  1ZQ1 A;  4RG8 A;  3DLL A;  2E3I A;  3OYI A;  3VS6 A;  3CCU A;  2J6K A;  2MWP A;  1QW1 A;  2Z0W A;  1ZA2 B;  2J6F A;  1N8R R;  3GLX A;  3DB3 A;  4IUV A;  2JS2 A;  2K3Y A;  2HBW A;  3QZ5 B;  3PTA A;  2MAM A;  3DLM A;  3CPW A;  1IZ6 A;  3EHR A;  1D3B A;  1YBY A;  4WTO B;  2DIG A;  2LQN A;  4A4K A;  2Y4X A;  3CME A;  2KYB A;  1JQQ A;  4TVR A;  4KUI A;  2XKO C;  4IIO A;  5GAO n;  1I1J A;  2RH2 A;  3QDR B;  4M7D B;  1YJN T;  3CCL A;  3UDC A;  4AT1 B;  2JNG A;  5I22 A;  4HA8 A;  3CCJ T;  1X43 A;  4DOV A;  4M77 E;  4C5E A;  2RD1 A;  4LUE A;  4GLK A;  2KT1 A;  1SHF A;  5LJ3 j;  1K9M R;  2O88 A;  3NPF A;  3T9N A;  4JS5 A;  4RTV A;  4K11 A;  2BKD N;  2QYZ A;  2SEM A;  4Z88 A;  2PQW A;  3JB9 D;  2R5M A;  1MV3 A;  2P4T A;  2HZY A;  1FMK A;  3C12 A;  2OTL Q;  1X75 C;  5GAN 6;  1KD1 C;  5LL6 S;  1TUD A;  1YJW A;  2KYM A;  4C5G A;  1B34 B;  3CC2 Q;  1W2B P;  1HYO A;  1WJS A;  4C8Q G;  4CI0 C;  5DM7 R;  3QYH B;  3HKS A;  2CZ6 B;  3EGD A;  4KBM B;  1Y0M A;  3LH0 A;  2H8H A;  2FVU A;  3SWN C;  4DBR A;  1KFZ A;  4F7U B;  3OYC A;  1BU1 A;  4AG1 C;  4ZN1 A;  1WHM A;  4E7S A;  2RHI A;  4JUV A;  4ZGE B;  4D8K A;  4XU0 A;  2DER A;  2EJG A;  3CCQ A;  1KSW A;  4F04 B;  4M77 B;  3FJ5 A;  5I2S A;  2JUF A;  4J8O A;  4R56 A;  3QJY A;  2JN0 A;  5FU7 C;  1NE8 A;  3GOX A;  4N4G A;  3VRZ A;  2HQX A;  3INZ A;  1QQJ A;  3BE3 A;  3P8B B;  1AVZ C;  2PZ1 A;  4BAC A;  3TEE A;  2EYQ A;  1UGQ B;  2O01 E;  2E70 A;  1VQ8 Q;  3OYJ A;  1LJO A;  5CK9 A;  3HTR A;  1VYV A;  1UHC A;  3OYD A;  4V2S A;  2EYX A;  4M77 G;  2JW4 A;  5KYY A;  1ZBX A;  1RLP C;  2OTL A;  4X9D A;  1G2B A;  1WLP B;  1E6G A;  4J9E A;  2NUP A;  5GAM g;  1ZSZ C;  1KQ1 A;  1TS9 A;  2NUZ A;  2CP5 A;  1BB9 A;  5FW9 A;  1HD3 A;  2DL8 A;  3VS1 A;  2RJC A;  3S3M A;  3RER A;  3CXC S;  3C95 A;  4F16 A;  4FW2 A;  2DKG A;  4KH0 B;  5GAO m;  2EGE A;  3RNJ A;  1TXQ A;  3BY7 A;  2DYB A;  2CZ1 B;  1YCS B;  1VYT A;  2HQH A;  4OB2 B;  3CCU T;  4JJN K;  1MGQ A;  4PJO G;  3X26 B;  3CXC A;  4A4E A;  3V7R A;  4XTU A;  2QI2 A;  2P0Q A;  2EPD A;  4ATO A;  1SHG A;  1UDL A;  1VQ8 A;  1X69 A;  5LJ3 f;  3M9Q A;  1NG2 A;  1RAD B;  1Y7X A;  4VUB A;  2RI5 A;  4A54 A;  2J7I A;  2DL4 A;  4ZNX A;  3CPW S;  2LCC A;  3JB9 H;  2H3J A;  4MDW A;  4BI3 A;  4C0D B;  1ZX6 A;  4FYW B;  4HCZ A;  2ZCF B;  2YUQ A;  3O8V A;  2NLU A;  2EJ9 A;  2C06 A;  2HBP A;  2YHT A;  4E7J A;  2K9G A;  1VQ9 A;  1HSQ A;  1N9R A;  3GNF B;  2OAW A;  3EHQ A;  4M78 D;  2WSE E;  2DMO A;  2E3H A;  2DD4 A;  2F1L A;  2AHJ B;  5FU6 C;  4II1 A;  2LP5 A;  5M9O A;  3HFO A;  1ABQ A;  1RAB B;  1NPR A;  2XU8 A;  3R6N A;  3NHN A;  4FU6 A;  2QA4 T;  2EIF A;  3FIF A;  2DXC A;  1YJW T;  3JCM h;  3C4S A;  3M0Q A;  2HQE A;  3QXE B;  2C0I A;  2FG0 A;  2MIO A;  1JO8 A;  5GAN d;  2DM1 A;  2MPX C;  4HT9 A;  2B8A A;  2F5T X;  3S3O A;  2VWF A;  4J6W A;  4F7U A;  2M1H A;  5DLQ E;  1YJN Q;  2FHD A;  5GAN 2;  3JCM c;  2RN8 A;  2FRW A;  4JPB W;  4J9F A;  1VUB A;  3OS0 A;  4X9C A;  1H8K A;  3EG9 A;  3I55 A;  4EIK A;  4DEY A;  3SD4 A;  3OSS C;  2EGA A;  1YN8 A;  1BI0 A;  1N9S A;  1ZUK A;  3M4G A;  4M7A B;  3QWY A;  2CT4 A;  2RHU A;  5GAO l;  5GAN 3;  3EG0 A;  4M7D C;  3BDL A;  1RUW A;  1Q82 U;  4DBH A;  2HSP A;  1Y57 A;  4EMK A;  4DA4 A;  2PUK B;  5KYY B;  6AT1 B;  3CCS Q;  2LMJ A;  3CXC P;  1MNE A;  2XIC A;  3G71 Q;  1VQ6 A;  4ESR A;  3C0C A;  3OMC A;  2F2W A;  1M4Z A;  4C0D C;  1SSH A;  2CUD A;  1BCO A;  4JDS A;  4ORZ A;  5GAN j;  2DEQ A;  1ZUY A;  2AK5 A;  4JLI A;  2OJ2 A;  1S1N A;  1S72 Q;  1UB4 A;  5LJ3 g;  1OU9 A;  4M78 E;  3X25 B;  4BY6 C;  3NTH A;  1W6X A;  3VS0 A;  3G4S Q;  2XK0 A;  2CP0 A;  1ZUU A;  5GAN 7;  1NJI C;  4UC4 A;  3ZEH A;  2FZG B;  1IRX A;  3UWN A;  2E5K A;  5LJ5 e;  4M77 F;  1VQ8 T;  2QGG A;  2OX7 A;  4FYV B;  4OMQ A;  2JVV A;  5CQY A;  5GMK m;  1K76 A;  3OYF A;  4C8Q D;  2P0K A;  1KHC A;  4HVU A;  2JXB A;  2F69 A;  3V8J A;  3WXM B;  2A08 A;  4PJO D;  5ECA A;  1U1S A;  3ER0 A;  3VU3 C;  1W70 A;  3L1A A;  4M7A C;  4OML A;  3S6W A;  4CC3 A;  2DZC A;  3I56 A;  2DXT A;  1VQ9 T;  1RI0 A;  4XK8 E;  3VS3 A;  4WF2 A;  1QP3 A;  5FRN A;  3RKY A;  3REA B;  1X6B A;  1Q7Y U;  1M9S A;  1X6O A;  2LDM A;  2A0F B;  4QVD A;  4E6R A;  2BE7 D;  4Q5W A;  2VGN A;  4C92 D;  4IUU A;  4J9H A;  1AWW A;  3KUF A;  3X24 B;  2DIQ A;  3M57 A;  1P92 A;  3OS5 A;  4L6V 5;  1RAA B;  1H3H A;  1U5S A;  2XMF A;  1Y96 B;  5DLO A;  4FSX A;  1ARK A;  1H64 1;  1K4U S;  1D0Z A;  1M1K C;  1YFN A;  4FM4 B;  4PJJ A;  2IIM A;  5GAN g;  4RTZ A;  3GP8 A;  3CQT A;  2RPN A;  2HKQ B;  2YSQ A;  1WZO A;  2ZZD A;  3H9N A;  5EC7 A;  4LDX A;  2QTX A;  3MP6 A;  1Q7Y R;  1YJ9 Q;  4NS5 A;  2DL7 A;  2FEI A;  4MZM A;  4E7Z A;  4QT7 A;  2I0N A;  3L2V A;  3WVD B;  2DIL A;  3LLR A;  1RAE B;  2ZPG B;  3JSC A;  4F7U G;  4ZN3 A;  1JJ2 S;  3NTK A;  2AKK A;  4LN2 A;  4CRI A;  3VYH B;  4M75 D;  4C0Z A;  3I56 Q;  1ZSZ A;  4C8Q E;  4EPC A;  2JT4 A;  1ZLM A;  3M53 A;  3CC2 A;  2A37 A;  4PFP A;  1WYX A;  1OV3 A;  1XJW B;  4GY5 A;  5D6W A;  2LJ3 A;  2HL3 A;  2KSS A;  4PK4 A;  3FB9 A;  3CCM T;  2KXC A;  4FYY B;  4IKF A;  4J6X A;  1ABO A;  4M78 B;  5CKD A;  3SDZ A;  3CCR T;  1NBE B;  3TCJ A;  3ZBD A;  2DNU A;  1MND A;  2ZPE B;  4N0A C;  2KVQ G;  2GFA A;  2K5L A;  1N8R C;  3A8H B;  3D7S B;  1B34 A;  1G8X A;  1UEC A;  4AG2 C;  3ZFJ A;  1NPP A;  4OVA A;  5CO7 A;  4X1V A;  2O31 A;  1QP2 A;  1CKA A;  2RB6 A;  3S3N A;  2PUO B;  5CIU A;  2AKL A;  3ASK A;  1M90 U;  1WA7 A;  1FYN A;  1KJW A;  2KMT A;  4F17 A;  1YJ9 A;  1PSF A;  3A5Z B;  3ZL7 C;  3OYA A;  2D8H A;  3H0F A;  3VS7 A;  4RCC A;  1U8R A;  1CKB A;  2LT1 A;  3URG A;  2AZS A;  2O4X B;  3M58 A;  4FT2 A;  2LCL A;  2ENM A;  5AYF A;  3SHW A;  3QO3 A;  5GAO r;  4F7U E;  2ZAE A;  2XD0 A;  2VB6 A;  4J9B A;  1HXD A;  3MP1 A;  1KQS P;  1Q82 C;  4PJM A;  1YJ9 T;  1PRM C;  3HSB A;  3JCM g;  4O5V A;  2EQI A;  3DB4 A;  5FWC A;  1SSF A;  1TUC A;  1WNL A; 
#chains in the Genus database with same CATH homology
 2BZ8 A;  2ECZ A;  1EFN A;  1PRL C;  2CSQ A;  2NUZ A;  2YUN A;  2MOX A;  1BB9 A;  5FW9 A;  2PTK A;  1HD3 A;  1PHT A;  2DX1 A;  2DL8 A;  3VS1 A;  1W1F A;  3M0P A;  2RQU A;  1K0S A;  1SRM A;  2F2X A;  2KE9 A;  4F16 A;  1I07 A;  4IIM A;  2KGT A;  2YUO A;  2QDL A;  1OPL A;  2EGE A;  3RNJ A;  3I35 A;  4RTX A;  2GTJ A;  2NWM A;  2DYB A;  2LNH B;  1YCS B;  1VYT A;  1TG0 A;  2A36 A;  2CH4 A;  2RQW A;  2K79 A;  2GTO A;  1JXO A;  2L3S A;  2KR3 A;  2ROL A;  1RI9 A;  1SPK A;  1BBZ A;  1WFW A;  3NMZ C;  2EPD A;  1A0N B;  1SHG A;  1UDL A;  1X69 A;  3SEM A;  1AZE A;  1UFF A;  1NG2 A;  4A63 B;  1PKT A;  1XOV A;  1T3S A;  2J7I A;  2DL4 A;  4ZNX A;  1M3B A;  2P4R A;  4M4Z A;  2JM8 A;  4AFQ C;  1ZX6 A;  4AFS C;  2DJQ A;  2BZY A;  1K9A A;  2YUQ A;  1AWJ A;  1GL5 A;  4AFU C;  1JEG A;  2J6O A;  1B3Q A;  1GBR A;  2K9G A;  1HSQ A;  2X3W D;  2DL5 A;  2OAW A;  1X2K A;  2K2M A;  3EHQ A;  2K6D A;  1GRI A;  2DMO A;  2KBT A;  3H0I A;  1E7O A;  4HCK A;  2LP5 A;  3EG2 A;  1T0J A;  1ABQ A;  4GLM A;  3M0U A;  4D8D A;  3R6N A;  3NHN A;  1PKS A;  1UGV A;  1WI7 A;  1UE9 A;  3RBB B;  2EYY A;  2L3Q A;  2JTE A;  3I5R A;  2DA9 A;  3M0Q A;  1CSK A;  2JM9 A;  4OMM A;  4Z8A A;  2CRE A;  2C0I A;  4Z89 A;  2FG0 A;  3A98 A;  2O2O A;  2MIO A;  5IHI A;  1JO8 A;  1WIE A;  3M0R A;  1AEY A;  2DM1 A;  1GFD A;  1JU5 C;  3U23 A;  2VWF A;  3M0S A;  4LE9 A;  1ZBJ A;  4CC7 A;  2JMA A;  1YWP A;  5GJW B;  2RN8 A;  2FRW A;  2ED0 A;  2D8J A;  1SEM A;  2CH4 W;  4JPB W;  1WXB A;  4J9F A;  4WCI A;  4RUG A;  2RNA A;  2KRM A;  2B86 A;  1H8K A;  4F14 A;  1ZSG A;  1B07 A;  2YDL A;  2CUB A;  4EIK A;  4DEY A;  2D1X A;  3I9Q A;  2EKH A;  3PVL A;  4JJB A;  2FPF A;  4HXJ A;  3EGU A;  3UF4 A;  2EGA A;  3UA6 A;  1WXU A;  5IHK A;  2A28 A;  1AZG B;  1YN8 A;  1ZUK A;  4AFZ C;  4J9C A;  2KRN A;  1OEB A;  4RTU A;  2MCN A;  2CDT A;  3VS5 A;  2YT6 A;  4J9I A;  1X27 A;  3QWY A;  2CT4 A;  1M3A A;  5I11 A;  4RTY A;  1GCP A;  2M0Y A;  1Z9Q A;  3EG0 A;  2GGR A;  2JS0 A;  4R0K A;  1RUW A;  1U06 A;  2KEA A;  2CT3 A;  1YWO A;  1VYU A;  1GCQ A;  2FRY A;  2HSP A;  1Y57 A;  2LQW A;  3TSZ A;  4J9G A;  2LMJ A;  1LCK A;  1SRL A;  4DEX A;  3LH5 A;  2DLP A;  2DBM A;  4ESR A;  3C0C A;  2GBQ A;  2F2W A;  1NLP C;  1SSH A;  2V1R A;  2CUD A;  4GBQ A;  4ORZ A;  2D0N A;  3TSW A;  1Z9Z A;  2DL3 A;  2V1Q A;  2AZV A;  2L2P A;  1ZUY A;  2C0O A;  2AK5 A;  2EYZ A;  2L3P A;  2OJ2 A;  3TVT A;  1NM7 A;  2G6F X;  3H41 A;  2PNI A;  1MUZ A;  4HVW A;  2L0A A;  1UJY A;  1S1N A;  2HCK A;  1X6G A;  3QWX X;  2CSI A;  1NYF A;  3GBQ A;  2F2V A;  1W6X A;  4OMN A;  3VS0 A;  2DRK A;  1UG1 A;  1NLO C;  1ZUU A;  2VKN A;  3VRY A;  3JV3 A;  3VS4 A;  2O9V A;  1M3C A;  2DRM A;  5HCK A;  2RQV A;  1NYG A;  2E5K A;  2KNB B;  4Y92 A;  3VS2 A;  4LUD A;  1QWF A;  2KXD A;  4OMQ A;  5IHN A;  5IXB A;  4HVV A;  1K76 A;  4FSS A;  3EG1 A;  1UUE A;  1KIK A;  4HVU A;  2JXB A;  1IO6 A;  2A08 A;  1GCQ C;  5FWB A;  4LNP A;  4J9D A;  5ECA A;  1W70 A;  3UAT A;  1K0X A;  2ED1 A;  2DBK A;  3KFV A;  1HJD A;  4OML A;  1E6H A;  2LX7 A;  4CC3 A;  2J06 A;  2J05 A;  2FO0 A;  2FPD A;  3VS3 A;  2O9S A;  4JJC A;  1WX6 A;  2KRO A;  1UTI A;  1WDX A;  2DVJ A;  2K3B A;  3REA B;  1AWO A;  3VS6 A;  2W10 A;  3O5Z A;  1X6B A;  2J6K A;  1AWX A;  1QLY A;  1X2Q A;  2J6F A;  4E6R A;  1UHF A;  1I0C A;  2JS2 A;  2EYW A;  4J9H A;  2HBW A;  2C0T A;  1AWW A;  1AD5 A;  1T3L A;  3EHR A;  1J3T A;  2LQN A;  2KT8 A;  4OMO A;  1H3H A;  2KYB A;  1JQQ A;  1NEB A;  1U5S A;  2XMF A;  3I5S A;  4IIO A;  1ARK A;  1K4U S;  1MV0 B;  1UJ0 A;  4CC4 B;  4JJD A;  2EBP A;  1JXM A;  1I1J A;  2IIM A;  4RTZ A;  2EGC A;  1PNJ A;  1M27 C;  3CQT A;  1K1Z A;  2OI3 A;  2RPN A;  2LJ1 A;  2YSQ A;  1WXT A;  3UA7 A;  2FPE A;  1YP5 A;  5EC7 A;  5I22 A;  1T0H A;  1X43 A;  1OPK A;  1YNZ A;  2DL7 A;  4LUE A;  2FEI A;  2KT1 A;  1SHF A;  2GQI A;  4QT7 A;  2I0N A;  2VVK A;  3NPF A;  4CC2 A;  2O88 A;  2GNC A;  2DIL A;  2DF6 A;  5L23 A;  4RTV A;  2W0Z A;  4K11 A;  2SEM A;  2AKK A;  5IH2 A;  4LN2 A;  4Z88 A;  1MV3 A;  2JT4 A;  1ZLM A;  2DE0 X;  2BTT A;  1N5Z A;  3NGP A;  1FMK A;  5IXF A;  1AOJ A;  2A37 A;  3PE0 A;  1WYX A;  1TUD A;  2LCS A;  1OV3 A;  2KYM A;  2ESW A;  2LJ3 A;  3EG3 A;  3IQL A;  1H92 A;  2YUP A;  1GFC A;  2KXC A;  4RTT A;  2KRS A;  2RQR A;  1Y0M A;  1ABO A;  3THK A;  2H8H A;  4JZ4 A;  1KFZ A;  2DNU A;  1PWT A;  2ROT A;  3REB B;  1RLQ C;  1BU1 A;  2LJ0 A;  1G83 A;  4AG1 C;  2RQT A;  1NEG A;  1V1C A;  1GBQ A;  2EVR A;  4D8K A;  1UEC A;  2HDA A;  4AG2 C;  2JMC A;  1QCF A;  2K7A A;  1KSW A;  4X1V A;  2O31 A;  2SRC A;  1CKA A;  3FJ5 A;  1OOT A;  3ULR B;  5GJV B;  2AKL A;  1BK2 A;  2LZ6 B;  4OMP A;  1WA7 A;  4KRT A;  1FYN A;  1KJW A;  3M0T A;  4F17 A;  3VRZ A;  3ZL7 C;  2RMO A;  2D8H A;  2M51 A;  1VA7 A;  1AVZ C;  2PZ1 A;  3H0F A;  1QKX A;  3VS7 A;  1CKB A;  1M8M A;  2AZS A;  2HEQ A;  2RF0 A;  2ENM A;  3SHW A;  1QWE A;  3H0H A;  1VYV A;  1UHC A;  4JZ3 A;  4J9B A;  2EYX A;  2ABL A;  2JW4 A;  1RLP C;  1U3O A;  1PRM C;  2EW3 A;  4RTW A;  1G2B A;  1WLP B;  1M30 A;  2EQI A;  1E6G A;  3PVQ A;  2BZX A;  5FWC A;  4J9E A;  1TUC A;  1QKW A;  2X3X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...