2YSQA

Solution structure of the sh3 domain from rho guanine nucleotide exchange factor 9
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
81
structure length
81
Chain Sequence
GSSGSSGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQEDEVEEGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Rho guanine nucleotide exchange factor 9
publication title Solution structure of the SH3 domain from Rho guanine nucleotide exchange factor 9
rcsb
source organism Homo sapiens
total genus 4
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ysqA00
2DYBA 1NEGA 2F2XA 2K3BA 2HBWA 2GQIA 4DEXA 2HDAA 3SEMA 2FEIA 2HEQA 2DL5A 1WFWA 2CREA 2KRSA 4OMOA 1AWWA 3NMZC 1WXTA 4AG1C 1GBRA 1UJYA 4HVVA 1CKBA 2JXBA 1OOTA 1S1NA 2JS2A 2O2OA 2KRMA 2DVJA 4LUEA 1JU5C 3FJ5A 1ZX6A 1QKWA 1UDLA 1ZLMA 1ABQA 4Y92A 4DEYA 4J9GA 2CSQA 4J9DA 1UECA 2CSIA 1AZEA 1WIEA 1K1ZA 1AEYA 1BB9A 2D8HA 1JEGA 2RQTA 2GGRA 2RQVA 4RTWA 4J9EA 4JZ3A 4RTXA 4OMNA 1PNJA 3U23A 5I11A 2KBTA 1ARKA 1YCSB 4JZ4A 5FW9A 2OI3A 1AZGB 3VS4A 1AWXA 1YNZA 2FG0A 1X43A 1UE9A 5FWCA 3H41A 1ZUUA 1YN8A 2CH4W 3KFVA 3ZL7C 4A63B 1NEBA 2EVRA 5GJWB 1PRLC 4AFZC 1HJDA 2DM1A 1T0HA 2LJ1A 3UA7A 3M0UA 1W1FA 1PKSA 1PKTA 1GL5A 1M3CA 2A28A 3C0CA 4JJDA 2YSQA 3M0RA 4CC2A 1B3QA 1JO8A 3M0PA 2IIMA 3NPFA 1VYVA 1JXMA 2K9GA 3ULRB 2DL8A 2CT3A 1ZUYA 2FPFA 2SEMA 1ABOA 2D8JA 2VKNA 1B07A 3RBBB 1TUDA 2EW3A 2EKHA 4RTYA 2BZYA 2H8HA 1VYTA 2L2PA 1TUCA 1QWEA 1FYNA 2LP5A 1PHTA 1Z9QA 3REAB 4D8KA 5I22A 3SHWA 3JV3A 2ABLA 1X2QA 2L3PA 3QWYA 2KE9A 4RTZA 1G2BA 2LNHB 3VS5A 4HVWA 1W70A 2KRNA 2C0IA 2JTEA 2PZ1A 1RUWA 2EYXA 1X27A 1VYUA 2ED0A 1CSKA 1UGVA 2KT8A 2W0ZA 5FWBA 3PVQA 2K6DA 2DRKA 5IHKA 1LCKA 2JMCA 1QKXA 1SEMA 1I1JA 2O31A 1NG2A 1U5SA 3CQTA 4FSSA 4Z89A 1RI9A 2JT4A 2EYYA 2KROA 1H3HA 2RN8A 1X6GA 3PE0A 2LJ3A 1SHGA 2GBQA 3I35A 3EG1A 4LNPA 2I0NA 2J6KA 3H0FA 1I0CA 2K7AA 3RNJA 2C0TA 2O9VA 2J7IA 2DE0X 4JPBW 1QWFA 1K76A 1AD5A 2AK5A 1M3BA 2KYMA 1AWJA 2DMOA 4GLMA 1X6BA 2MCNA 2MOXA 1E7OA 1UHFA 4IIOA 1UJ0A 2A08A 1VA7A 1MV0B 2KT1A 4RTTA 2JW4A 1UG1A 1EFNA 3VS6A 4CC7A 2OJ2A 3VS0A 5IXBA 1ZBJA 2F2VA 1WDXA 2DBMA 2HSPA 2KXDA 2GTJA 1RLPC 2VWFA 2EYZA 1MUZA 2FO0A 2KGTA 2EYWA 4OMPA 2SRCA 4AFUC 2LMJA 2C0OA 2ED1A 3VS3A 1J3TA 1QCFA 2FPEA 2DBKA 2YUPA 4QT7A 5IHIA 5IH2A 2J6OA 2RMOA 1UUEA 4RUGA 3VS7A 2K79A 2LZ6B 2JS0A 1PWTA 2M51A 4K11A 2W10A 2RQRA 2YUQA 2CDTA 1OPKA 1H8KA 2DL7A 2FRWA 2JMAA 1WLPB 4Z8AA 1NYGA 1BU1A 2FRYA 4D8DA 1G83A 1U06A 2M0YA 4RTUA 1AOJA 2HCKA 2RQWA 3O5ZA 4GBQA 3M0SA 4J9HA 2DX1A 2AKKA 1NYFA 2F2WA 2NWMA 2PNIA 1K0XA 2L3SA 2V1QA 2FPDA 1Z9ZA 5L23A 4AFSC 1WXBA 1T0JA 2GTOA 1WYXA 2EQIA 2YT6A 2ENMA 1SRLA 2O88A 1U3OA 1E6HA 4KRTA 1GFCA 3VS1A 1ZUKA 2L0AA 3TSZA 1WI7A 1UFFA 2EBPA 1E6GA 4JJCA 3LH5A 4J9CA 2DF6A 1M8MA 2E5KA 3VRYA 2B86A 2VVKA 1XOVA 4M4ZA 1AWOA 1JQQA 2BZXA 1GCQA 3M0TA 1M3AA 4LN2A 2DILA 2L3QA 4AFQC 2NUZA 1GCPA 2AZVA 1SRMA 1K4US 1HSQA 4J9FA 1V1CA 2D0NA 2MIOA 1AVZC 2DL3A 2RPNA 2A37A 3EG0A 1GFDA 1I07A 1X2KA 2DLPA 1Y0MA 2OAWA 3EG2A 2GNCA 2O9SA 3R6NA 1UHCA 3I5RA 2KNBB 1JXOA 1GRIA 5EC7A 4AG2C 2J05A 1T3LA 3REBB 1KJWA 2DNUA 1MV3A 2LQWA 1RLQC 1KSWA 1A0NB 1FMKA 1M30A 2KYBA 3H0HA 1YWOA 2LJ0A 2PTKA 1SSHA 1KIKA 1KFZA 1W6XA 1YWPA 1HD3A 1OPLA 2BZ8A 3IQLA 5GJVB 1GCQC 2EGEA 2EGCA 3THKA 2JM8A 1M27C 3M0QA 3EHQA 4F17A 5ECAA 5IXFA 3VRZA 3EG3A 1BBZA 3EGUA 1X69A 2YUOA 4CC3A 2BTTA 1CKAA 2V1RA 2ECZA 3I5SA 3TVTA 2RNAA 2YDLA 3EHRA 1BK2A 1WXUA 2G6FX 3GBQA 3UA6A 2RF0A 1OV3A 3NHNA 5HCKA 3PVLA 2ROLA 3H0IA 1WX6A 4OMMA 2X3WD 1IO6A 2YUNA 3VS2A 1NLOC 4OMLA 1K0SA 1ZSGA 2DJQA 1GBQA 2LQNA 4JJBA 2CH4A 2ESWA 4LUDA 2CUDA 3I9QA 2D1XA 2KR3A 1SHFA 2AKLA 4ORZA 4HXJA 2K2MA 2RQUA 4HCKA 2J06A 5IHNA 1UTIA 2CT4A 2KEAA 4J9BA 2LCSA 2JM9A 3UF4A 2DA9A 4CC4B 2CUBA 1N5ZA 1QLYA 3UATA 2EGAA 2J6FA 4IIMA 4OMQA 2DRMA 3QWXX 4X1VA 1NM7A 1WA7A 4R0KA 1TG0A 4LE9A 1YP5A 1H92A 2AZSA 4HVUA 2QDLA 4EIKA 3NGPA 4F16A 2X3XD 4RTVA 1Y57A 4Z88A 3TSWA 4ESRA 1PRMC 1SPKA 4J9IA 2XMFA 4E6RA 2P4RA 1K9AA 2EPDA 2LX7A 1OEBA 3A98A 2KXCA 2DL4A 1T3SA 4ZNXA 1NLPC 4F14A 2ROTA 4WCIA 2A36A
chains in the Genus database with same CATH superfamily
2DYBA 1SF9A 3CCLQ 2F2XA 1MGQA 3CCJA 3CCVA 4DEXA 2HDAA 4C8QA 1OU9A 3VYGA 3CC7T 4HCZA 2KRSA 2K57A 3CCLT 1WXTA 1GBRA 1G3WA 3A5ZB 1CKBA 4EMKC 2QDYB 3G6EA 4X9DA 1WHGA 2KRMA 4AT1B 3Q1JA 1YJ9A 1QKWA 2KI7A 1ZLMA 2RJEA 4F7UF 1KG1A 2GCXA 1M1KR 4FT2A 4FYVB 3SFMA 4KBMB 1Q81R 1UECA 2CZ0B 2D6FA 3FJPA 1PD1A 1WIEA 1K1ZA 2RJFA 1AEYA 2D8HA 3MEWA 3GPLA 3JCMP 2KAFA 2WSFE 1HXDA 4RTWA 3QYGB 4X34A 1M8VA 4L6V5 3DB4A 4RCBA 2O4XA 4FU6A 4IKFA 4KGZB 2KBTA 2RD1A 4O5VA 5FW9A 1ARKA 3MHXA 2M02A 2CZ7B 3A8LB 4A4HA 1YNZA 4C5IA 5FWCA 3EGDA 4OP0A 3KFVA 2G3RA 4A63B 2K5IA 1W2BP 2EVRA 4M75C 2QA4A 4AFZC 3VUZA 1HJDA 4BDZA 1RAGB 3M54A 2A28A 3JCMV 4JJDA 4DQ2A 5GAOl 3M0RA 2HL5C 3BDUA 1MNDA 4N0AA 3GOXA 3ULRB 4AMCA 1PC0A 3N5BB 2FPFA 2SEMA 2RH2A 1ABOA 2D8JA 1UEBA 2EW3A 3P8BB 4JRKA 3OS5A 4PLLA 5GAN6 1OI1A 5I2MA 1QWEA 2E6NA 2X4YA 1QVGP 5CVIA 2CP3A 3JV3A 2ABLA 8ATCB 3JCMQ 5DY9A 5FU6C 1KQSS 4Y91A 4BACA 1K73R 4LDVA 2C0IA 2KSSA 1VQ4A 2EYQA 2EYXA 2ZZDA 2RO0A 1RI0A 1X27A 5CCAA 4JRQA 1NPPA 2HAXA 1LCKA 1QKXA 1I1JA 2O31A 2ZAEA 1U5SA 4FSSA 2P84A 2JT4A 1XQHA 2RN8A 3QG1A 5FLXE 1RACB 1BIBA 3TQ7P 3EG1A 2I0NA 2J6KA 3H0FA 1I0CA 2K7AA 1VQOQ 4JPBW 2YRVA 3OW2S 1AWJA 1TOVA 2EWNA 4M7DE 3LWIA 1D0ZA 1X6BA 1QVFS 2XDBA 4M7AF 5KYNA 1D1AA 4RTTA 2JW4A 1G3TA 1EFNA 3VS6A 3VS0A 5IXBA 1ZBJA 5GANe 3OYAA 1O9SA 2HSPA 5CKBA 2VWFA 4OMPA 4AFUC 2LMJA 2C0OA 2GQVA 4N4HA 2ED1A 3HL8A 4HKEA 1WJRA 4E7LA 1EZZB 3KUFA 2YUPA 5IHIA 5IH2A 4ZGDB 3G4SA 1YJNQ 3VS7A 2JS0A 4J6XA 2M51A 3G71A 1VQMQ 3JB9F 2W10A 1OX8A 2DL7A 2FRWA 2JMAA 4BE1A 3HSBA 3MO8A 1WLPB 3CXCA 3EGXB 3V8KA 3WXMB 1VQMT 4M78G 2YWWA 1U8RA 4D8DA 3CC2A 1G83A 2M0YA 1QP3A 4RTUA 4X9CA 3JB9H 4M77F 2MK5A 2HCKA 3A8GB 1PM3A 1M2VB 2NWMA 2L3SA 1P92A 2FPDA 1YIJA 5L23A 3EH2A 1WXBA 4M78A 1WYXA 1R0BG 4LD9K 2ENMA 1M2OA 1SRLA 1VQ7A 1Q7YU 1OX9A 1YHQT 1WI7A 3H6ZA 4QQDA 3RERA 2EBPA 3PIOA 4J9CA 2DF6A 1BI3A 1XOVA 1OZ3A 2BZXA 4FSXA 2AIRB 4LN2A 1KHIA 2JNGA 2L3QA 4M7AD 1KQSP 4MDWA 3X26B 2AZVA 4M75G 1SRMA 1K4US 3VYHB 5GAMg 3M58A 4BD3A 1Q7YC 1VQOA 1WHKA 2DL3A 1DJ7B 1X2KA 5GAOn 2HBPA 3HP9A 3UDCA 3VU3C 3EG2A 1UHCA 4C8QF 3PIPA 2RHZA 3TREA 7AT1B 1R0CB 4C92B 3REBB 3CCMA 2FL7A 2HQHA 2LQWA 1YITQ 2XHCA 4B6MA 5KYXB 1WQWA 3JB9D 2KYBA 1M90U 4LDYA 2PTKA 1YITT 2COWA 2BE7D 3V7CA 1KIKA 3OSSC 4CRIA 3M5AA 4PJOG 1WHLA 4J8OA 3E9FA 4A4EA 1QVFP 2BZ8A 4MZTA 1GCQC 4C0ZA 3THKA 1QMCA 3EHQA 4M77D 9ATCB 1QCNA 3FEOA 4CC3A 2CP5A 1YJNA 3I5SA 3EHRA 4RG2A 4PJOA 3UA6A 1M90C 4BI3A 3PVLA 5GAN7 3RMSA 3H0IA 4ME7A 4OGEA 5M9OA 1M9SA 2LCCA 4KUIA 3VS2A 1S72A 4E47A 1N9RA 3QZ5B 1ZSGA 3JRZA 2PVDB 2NUTA 2QTVA 2D1XA 1SHFA 2AKLA 3M9QA 3LH0A 3CCRT 1PD0A 2FYKA 3MP1A 5A0LA 5DLOA 4ATOA 1MNEA 2KEAA 2CT4A 2LCSA 3I56A 3RKYA 3CMAQ 1TXQA 1M1KU 4A4GA 4CC4B 1SG5A 2CUBA 1Q81U 3UATA 3SWNB 2DRMA 3QWXX 4FYWB 4X1VA 3CBOA 1QCOA 3CMAT 4XU3A 1WA7A 1C1AA 3HHTB 4C8QD 5GMKl 1QW1A 2FHDA 4LE9A 3L2ZA 1VQ9T 5HK3A 1I5OB 2JOYA 3ASKA 2V8JA 1OYXA 1WZOA 2ATCB 4F16A 2EQKA 2K5LA 1Y57A 2OTJQ 3TSWA 1D3BA 4J9IA 4VUBA 5GMKi 2XMFA 4NL3A 2ZCFB 3FIFA 2BKDN 2K3XA 2LX7A 1M1KC 3HRSA 5FRMA 2OTLQ 1Q81C 3OY9A 2OTJT 2KDSA 5J3BA 4F14A 2KQWA 4ZTFA 2A36A 1NEGA 1YJWA 4UC4A 2QXFA 2K3BA 2OTLT 2FEIA 2HEQA 2CREA 2GFUA 4OMOA 1VQKQ 5LJ5d 3NMZC 4AG1C 4F7UB 4LDWA 4RMOA 2O2OA 4LUEA 1JU5C 3FJ5A 4XTUA 1ZBXA 1VQKT 5CAIA 2FZCB 4DEYA 2CSQA 5GAN3 3OYIA 3INZA 1N27A 1Q7YR 1AZEA 2FB7A 1WHHA 3RKWA 2X51A 5LJ5f 2H3JA 3CBMA 3ZEHA 1JJ2P 3NTHA 3CCVT 2MI6A 4HCBA 1IZ6A 2LQ8A 1W2BS 4JZ4A 1ACMB 1K8AC 1AZGB 1IHVA 1K73U 1AWXA 3RR6A 3G6ET 2FG0A 1X43A 2EQUA 4IUUA 2DTIA 2MWPA 3QJYA 3PNWC 2K4YA 2CH4W 4NS5A 3RUXA 1Q86C 2RHXA 4M7DA 1R77A 2LJ1A 4WTOB 2DD5A 4C92C 2IG0A 1M3CA 3C0CA 2DAQA 4J6YA 4HT8A 1IGUA 1V76A 4PJMA 1K73C 4CC2A 4JJNK 2IIMA 3CCSA 1OQKA 2K9GA 1WJSA 2DL8A 2JVVA 1QVGS 4HA8A 4ZGEB 2BUDA 3PFSA 3OW2A 1VQ8Q 1FXXA 1TUDA 4BDYA 3V8LA 2LDMA 4RTYA 2BZYA 5EG2A 4M75E 3CCQA 2QA4T 1PHTA 1PG5B 1VQ8T 1MMGA 4M78F 5I22A 2QEXA 3SHWA 1D0YA 3OYMA 5KYYB 2E5QA 3CC4Q 1WNLA 3MEAA 2E41A 1Y07A 2DTHA 2KE9A 5I21A 2HL3A 4JDSA 2EAYA 5LJ3j 1K9MR 3CC4T 2ED0A 4JLGA 5LJ3h 2LTOA 2W0ZA 1BIAA 3PVQA 5FWBA 5GANj 1WHMA 2DRKA 2K6DA 2CP7A 5IHKA 5FU7C 1SEMA 2WSCE 3QDRB 5GANh 2PUOB 2QQBA 4Z89A 2KROA 3LYIA 3PE0A 4PJOE 2LJ3A 1SHGA 2DK3A 3X25B 2H3EB 5HY6A 4QKUA 2NUPB 5A0GA 3CD6A 1K76A 1AD5A 1KQ1A 3SWNC 4RG8A 4M7AB 1VQLA 1YCYA 2MCNA 2MOXA 1E7OA 1UHFA 4DBRA 3OA6A 4IIOA 4C5GA 1MV0B 4L59A 3RKXA 3C94A 1BKBA 2YHTA 1YI2A 2DBMA 3KBGA 3UPUA 2KXDA 2VGMA 3E1SA 2CP6A 3BDLA 2KGTA 2D0QB 2SRCA 3CMEA 5KCHA 3OYGA 2JZ2A 3L2VA 2DBKA 5GAMe 4NOYA 2FVUA 4RUGA 2K79A 4M78D 1W4SA 5LJ3d 1Y96B 2RQRA 2DIGA 2CDTA 1FMVA 1OPKA 2DXUA 3EFOB 4JRIA 5GANd 4M77B 1Y7XA 1K8AR 4Z8AA 4ZTJA 1NYGA 3PGGA 3JAME 3EGXA 4PKCC 3G1JA 4A54A 1SKUB 4GBQA 2XI9A 2DX1A 5GAN4 3URGA 3X20B 1NYFA 2F2WA 5LJ3f 1JRIA 1Q86R 2V1QA 2JUFA 3BE3A 5GANf 1T0JA 1VOMA 3LW5E 1RAIB 3G4ST 2YT6A 1C0MA 4PK4A 4ZN3A 2CP0A 3G71T 1U3OA 4KRTA 2X9HA 3VS1A 2DPPB 3V7RA 3CC7A 3MKDA 1ZUKA 3TSZA 1D1CA 1BYMA 5DM7R 4JJCA 3CCLA 4FIBA 1M8MA 1AWOA 3J80E 3H8ZA 1JQQA 3M0TA 2DILA 2MMPA 4AFQC 1VQPQ 2EQMA 1GCPA 2RI2A 3S3OA 4DBHA 1Q82R 4J9FA 2CZ6B 1V1CA 1ZA1B 2VUBA 1AVZC 4C8QB 3MJXA 1VQPT 2RPNA 1GFDA 2DLPA 4C92G 2QYZA 4MZPA 3OS2A 2OAWA 2GNCA 1LVKA 2PVOB 3I5RA 1WJQA 1JXOA 1Y71A 4KULA 3QZ9B 5CKEA 2LQKA 2M0OA 5EC7A 4ANJA 4AG2C 5I2SA 3L2WA 4PJNA 1KJWA 4PJOD 1KSWA 4ELYC 3PT9A 4FM4B 3CEYA 4OMFB 4NL2A 3C4SA 1YWOA 2KMTA 4QVDA 1SSHA 1UB4A 4BY6C 2FZGB 5KYXA 4XTYA 1W6XA 2PUKB 4DOWA 1KD1R 3IQLA 1N6AA 1B7TA 2X4WA 5GMKe 5FRNA 1M27C 3M0QA 3C95A 1X69A 2HMAA 2V1RA 2ECZA 3TVTA 2E3HA 2HNIA 3EGDB 8AT1B 1WXUA 4KT0E 2G6FX 5LJ5g 3GBQA 4XTXA 1OV3A 5HCKA 1SSFA 3FRNA 2QQSA 4JLIA 1TU0B 1JBMA 1D1BA 1NLOC 2LQNA 4M7DF 4JJBA 2CH4A 2ESWA 4LUDA 4M7AC 2F5KA 3RESA 1TS9A 3I9QA 3JB9I 4WF2A 3HKSA 3JCMh 3OYKA 4ORZA 2DYIA 4HXJA 5KYUA 2F69A 3OYLA 4HCKA 1VQ5Q 1B34B 5LL6S 2J06A 5IHNA 1X01A 2KVQG 3UF4A 4FW1A 2QK0A 1YHQQ 2PU9B 4LD6A 4EMKA 1N5ZA 2NYSA 3VKIA 1QLYA 2EGAA 1VQ5T 1I5LA 1NM7A 1WPYA 1TG0A 3SWNA 1WQ7A 2OAUA 1VQNQ 1H92A 4RCCA 1ZSZB 2EFIA 5D6XA 2QDLA 4EIKA 3NGPA 5CQXA 2V8IA 1PRMC 1VQNT 2FZKB 4E6RA 4EDUA 1W2BA 1K9AA 3QO3A 2EPDA 4J5YA 4OGCA 1T3SA 2L5QA 1NLPC 2RHIA 5GAOq 2E3IA 4WCIA 2YDLA 3JSCA 4M77C 1RABB 2EIFA 4OB3B 2HBWA 3A8HB 2DETA 4F7UG 3SEMA 3CPWA 2DL5A 1WFWA 1IXDA 1G3SA 4M75A 2QQ9A 2X4JA 4TVRA 1UJYA 4HVVA 2O01E 2JS2A 5KE2A 2RJDA 5GAOr 1RAFB 3VUBA 4A4FA 3JCMd 4Y92A 1JJ2S 3CCUQ 4QQ6A 4J9DA 2LT1A 1QVGA 2RA2A 4M7DD 2C06A 3EG9A 1YBYA 3CCUT 2RQTA 2WACA 2GGRA 4FW2A 3H9NA 4JZ3A 4RTXA 2CYZB 1TSFA 4BE0A 1PNJA 2LX9A 3J81E 3U23A 1Q95G 3LLRA 1YCSB 4IURA 2OI3A 3JCMf 3OYHA 1VQMA 3VS4A 2LT4A 1BCOA 1BI0A 5D6YA 4CI0C 1VQ6Q 1UE9A 1K9MU 3JCMc 3S3MA 3H41A 2K5FA 4C8QC 3G7ZA 2YRCA 1NEBA 1VQ6T 3CCRQ 4J7IA 5FU7B 1JB0E 2WSEE 1H641 1T0HA 3ME9A 2DEUA 3M0UA 1W1FA 1PKSA 1PKTA 1GL5A 2DJZA 4P5NA 4Z02A 2YSQA 2VB6A 3UWNA 4PFOA 1YHQA 3OS0A 1JO8A 3M0PA 4DOVA 3NPFA 1VYVA 1K9MC 3RIRA 3A8MB 3PTAA 2ZPHB 1VQ9Q 1C6VX 4PJLA 2R58A 2VKNA 1B07A 4M78B 2EKHA 3M4YA 3VV0A 1OULA 2A7YA 1FYNA 1N8RR 3REAB 1AT1B 4D8KA 4C92E 1X2QA 5LJ3g 1WGSA 3SB2A 4BI8B 2KRNA 3I55T 3QUIA 4PL6A 1G5VA 1RUWA 4FL6A 3CCEQ 1YFNA 1VYUA 1UGVA 2KT8A 5KYWB 1PSEA 1LOJA 2XK0A 4XQ3A 1NG2A 2VXEA 3CCET 1LJOA 3QKJA 1YITA 1RI9A 5GAOm 3CCQT 2EYYA 4N0AC 1H3HA 5CIUA 4DBFA 3R6OA 4C5HA 1K8AU 2GBQA 3DLMA 4M7AG 4LNPA 5GAMj 5FROA 4BUGA 2C0TA 2J7IA 5GAMh 4Y28E 3CCJQ 3CCVQ 1EX4A 4E7IA 1Q86U 4GLMA 2YLBA 4PNOA 1UJ0A 1ZSZC 2A08A 3JCMb 3TEEA 4J6WA 3CCJT 2RK2A 2KT1A 2DXCA 3G6EQ 4XU2A 3F70A 3OBYA 1UG1A 3ZFJA 2OJ2A 1YJ9Q 4DBQA 3MCAB 2YRDA 2GTJA 1RLPC 1BI1A 5KE3A 2DXTA 2JJ9A 3JB9G 1MUZA 2FO0A 1KQSA 1YJ9T 3CCRA 3M4GA 4C0DB 2RB6A 1TH7A 1J3TA 1QCFA 2FPEA 2ZPFB 2P0PA 1WHJA 4OB0B 2QQAA 1BI2A 3GLXA 1UUEA 1Q82U 2LNVA 3EFSA 4XTWA 5GAN2 2XDDA 3CMAA 2M16A 2E1HA 1VQ9A 2RI5A 2ZPGB 2FRYA 4E7HA 3NTIA 1U06A 2DERA 2QA4Q 1N9SA 2E64A 1UGRB 1AOJA 2DD4A 3O5ZA 4E7KA 5IN1A 5GAMd 5D6WA 1Q82C 4F04B 2P4TA 1Z9ZA 2A0FB 1QVFA 5CO7A 4AFSC 2OTJA 3AT1B 2GTOA 4B9WA 1KC8R 4BY6B 4J7FA 4HCCA 1E6HA 1KD1U 2OTLA 1QVPA 1GFCA 4F7UE 3GF5A 3L1AA 3LH5A 1FWZA 2HQXA 3VRYA 2B86A 3E9GA 5GAMf 2VVKA 5CKFA 4M4ZA 1NPRA 5LJ5e 2CP2A 1GCQA 1VIEA 1VQKA 2A3LA 2QG9B 1IRXA 1VUBA 4C8QG 2NUZA 5GMKj 2XIDA 2MF2A 5GMKh 2MIOA 2HZYA 1KD1C 2A37A 3X24B 1VQ4Q 1X6OA 3X28B 4C5EA 2Y4XA 3GNGA 3R6NA 2PQWA 4KH0B 2KNBB 3KXTA 4BB7A 1VQ4T 4M75F 3CXCP 1T3LA 2DVEA 2RHYA 4M78C 1LPLA 1MV3A 4QQGA 5CQYA 1RLQC 4A53A 3OYYA 1A0NB 2KY9A 1M30A 3H0HA 3OSVA 1D0XA 2LC4A 1H3ZA 3M57A 3ZBDA 3C12A 2R5MA 3E2UA 1ZQ1A 1YWPA 2JTFA 1OPLA 4L5GA 4LXCA 2EGEA 2EGCA 2I2LA 2R5AA 3VRZA 4XTZA 2YUOA 2MYSA 1CKAA 2MWOA 3A8OB 2GF7A 4PJOF 3NHNA 3HRTA 5GAN5 1RL2A 1M4ZA 2EJGA 1WX6A 4M7DB 3OQ5A 1UGQB 1QP2A 1IO6A 1V29B 3JCMg 4E2FB 1K0SA 3LGFA 1PSFA 1IREB 1NJIR 4JUVA 3QJ6A 1VQ8A 2Y90A 3LX7A 5J26A 2RI3A 1FMWA 2KR3A 3J7AF 1OZ2A 2COZA 3G4SQ 4JRPA 3T9NA 2K2MA 3S3NA 3G71Q 2VV5A 4J9BA 1R8OB 3CPWP 3A1PA 2JM9A 2DA9A 1RADB 3CC4A 1M2VA 1B34A 5GAN8 3V7SA 2E4HA 5A0DA 1JJ2A 4IIMA 1IB8A 1KK7A 2L3RA 2EQJA 3CC2Q 2E70A 4PFPA 4R0KA 3CBPA 3E19A 2QI2A 2AZSA 4HVUA 4M75D 3HFNA 4PJOC 4C0DC 1F1BB 5GAOp 3CC2T 4O6JA 2X3XD 2RHUA 1YIJQ 4RTVA 4M7AE 1D09B 1ZSZA 4BI4A 1IHWA 2P0KA 6AT1B 3HRUA 2KXCA 1VQ7Q 2QASA 1YIJT 5KH6A 1G3YA 5CR2A 1G8XA 3OYJA 3LWHA 4Q5WA 4DA4A 3L2UA 5L8RE 1VQ7T 4KUDK 2GQIA 5CKHA 1HYOA 5KCOA 3TU4K 3OYEA 2CGHA 3WVEB 4E7ZA 1AWWA 1AHJB 4PLIA 3L2QA 3UT1A 2JXBA 2EKOA 1OOTA 1S1NA 2DVJA 1O75A 1NE8A 1RAAB 4C92A 2IVWA 2DZCA 1ZX6A 3MEVA 1UDLA 1ABQA 4J9GA 1IGQA 2OX7A 2CSIA 5GMKm 1VQOT 1XJWB 1BB9A 2DIQA 3JCMJ 1JEGA 2DZ9A 2O4XB 3RDVA 2HKQB 3HPWA 1N8RU 2E12A 2RQVA 4IUQA 4M77E 4J9EA 3OMGA 3CCMQ 3QPHA 4IUPA 4OMNA 3JCMX 2GFAA 3NFCA 4EMGA 5LJ3e 5I11A 2RJCA 4EMHA 2PVGB 4GLKA 3CCMT 1FX7A 1M1FA 4XU0A 4OB2B 3QIIA 2XG8D 1ZUUA 4HT9A 1YN8A 3QHSA 3ZL7C 4QW2A 1ZHIA 5GJWB 1PRLC 3MEUA 2DFUA 4XAXB 1N8RC 2DM1A 3UA7A 2Z0WA 2X4XA 4XK8E 1PCXA 2E6ZA 1B3QA 1YJNT 2V8KA 2XD0A 2VYTA 5A2QE 1JXMA 3META 1MMNA 1MMDA 1S72Q 2VXFA 1OU8A 2CT3A 1ZUYA 3QSUA 1M1GA 5CKDA 3RBBB 2YXYA 3NTKA 3VJPA 4C8QE 3OB9A 1S72T 4A4KA 2H8HA 2BIVA 1VYTA 2L2PA 4YTLA 1TUCA 2LP5A 1Z9QA 1VQPA 3I56Q 3ER0A 3FDRA 5IT9E 4LDUA 2L3PA 3QWYA 4N4GA 1M5Q1 4RTZA 1G2BA 2LNHB 3VS5A 4HVWA 5C0MA 1W70A 3QDFA 3FB9A 2QGGA 3P8HA 3I56T 2YLCA 2D9TA 2JTEA 4EPCA 2PZ1A 5DLQE 4OF1A 4M7DC 3HFOA 2BE9B 1CSKA 5D7UA 2B8AA 2COYA 2JMCA 3L2RA 3MP8A 3CQTA 5KYWA 3M55A 2ZPEB 4B9XA 1X6GA 5AT1B 4OVAA 3OBWA 3QBYA 3M53A 3I35A 3RNJA 2RK1A 4F7UA 1I4K1 1VIFA 2DEQA 2O9VA 1NBEB 2DE0X 1YJWQ 1QWFA 2F1LA 4C0GA 1TUGB 2AK5A 1M3BA 2KYMA 2ZPIB 4PFZA 2DMOA 3EFRA 5HK0A 1YJWT 1VA7A 1KC8U 4OB1B 3LGLA 3HTRA 3OW2P 4CC7A 2QAZA 2ZPBB 2F2VA 1UGSB 1WDXA 3CPFA 3EAEA 2DO3A 5J39A 3BW1A 3M59A 1GXIE 2HD0A 2EYZA 4FYXB 2EYWA 2JN0A 2CKKA 3VS3A 4MZMA 4QT7A 2J6OA 2RMOA 4V2SA 1KC8C 3AHUA 2LZ6B 3OYCA 1PWTA 1VQ5A 2HSEB 2JTMA 4E7SA 3GNFB 4K11A 2L89A 2YUQA 5LJ5j 1H8KA 5LJ5h 4FCYA 1BU1A 5KYUB 5HKCA 5AYFA 1VQNA 2RQWA 3M0SA 4J9HA 2X35A 4EMKB 2AKKA 2PNIA 1K0XA 2ZGWA 2EJ9A 4MMLA 3FC3A 3PMTA 2EQIA 2NLUA 4R56A 2VC8A 3I55Q 2V26A 3CCSQ 3PMIA 2O88A 3GIBA 4E7JA 3V8JA 2L0AA 5KYYA 5GANg 1UFFA 1E6GA 3CCST 2F5TX 2E5KA 4RKUE 2E65A 3GP8A 1U1SA 3CCQQ 2Y4YA 1LNXA 1I8FA 1M3AA 1XTDA 3MP6A 3WVDB 1BCMA 4J83A 2XICA 2QEXQ 3OYBA 2RM4A 2HQEA 2AHJB 1U1TA 3OYDA 4JS5A 2LCLA 3FLGA 1HSQA 3JCMe 2D0NA 4D6WA 2XU8A 3CXCS 5IAYA 3EG0A 2QEXT 2AT1B 3CCUA 1I07A 4ELZC 1NJIU 4M75B 1Y0MA 3JB9J 2O9SA 3DB3A 4MDXA 2M9UA 1GRIA 2XDPA 2MAMA 3M56A 2NUPA 2J05A 2DNUA 3OS1A 3QXEB 2QQRA 2VGNA 4M7AA 1FMKA 4C92F 4LDXA 4KGVB 2LJ0A 1EIFA 4FT4A 4II1A 2MPXC 1X75C 3EG9B 1QQJA 1VQ6A 4R55A 1KFZA 3CD6Q 4QVZA 1NJIC 2DTOA 1ZA2B 3SDZA 1HD3A 2EJFA 4ZN1A 5GJVB 2DXBA 1VQLQ 3EH1A 4XU1A 2JM8A 4F17A 5ECAA 5IXFA 3CD6T 4PJOB 3EG3A 1BBZA 3EGUA 1HK9A 1UGPB 2DKGA 2BTTA 1MMAA 5CK9A 4FYYB 4JS4A 1VQLT 2RNAA 1BK2A 4M7DG 2L8DA 4M78E 5C6SA 2HKNA 2RF0A 3BFMA 5FU6B 3D7SB 1YI2Q 4KH1B 4M77G 2LRQA 2ROLA 3QYHB 2VASA 4OMMA 2X3WD 2NUTB 2YUNA 1MHNA 4OMLA 1YI2T 1Y96A 4N4IA 3CMEQ 3CPWS 2DJQA 3EFOA 1GBQA 1NZ9A 3SD4A 4ZGJB 2K2VA 1I81A 2LVMA 3MPUB 2CUDA 4M77A 3DLLA 1RAEB 3JCMW 4PJJA 3CMET 2P0QA 3S6WA 4BE2A 1XNIA 3OYFA 3RMQA 2RQUA 1RAHB 3OYNA 1KHCA 2M1HA 1UTIA 4GY5A 2IPOB 3I55A 1M90R 4MMKA 2J6FA 4OMQA 3BY7A 3CCEA 2KK4A 1YP5A 3L42A 4IUVA 2CZ1B 1D3BB 3OMCA 4C0FA 2E10A 2QTXA 4KGXB 1TTHB 1KQ2A 4IUTA 4QVCA 4Z88A 4ESRA 1SPKA 4C92D 3P8DA 2P4RA 2QGFB 3A98A 1OEBA 2XKOC 3O8VA 2R57A 1TWBA 2CS7A 2DL4A 4ZNXA 2K3YA 4XTVA 3CC7Q 3DKMA 2ROTA 3TCJA
chains in the Genus database with same CATH topology
2DYBA 1NEGA 2F2XA 2K3BA 2HBWA 2GQIA 4DEXA 2HDAA 3SEMA 2FEIA 2HEQA 2DL5A 1WFWA 2CREA 2KRSA 4OMOA 1AWWA 3NMZC 1WXTA 4AG1C 1GBRA 1UJYA 4HVVA 1CKBA 2JXBA 1OOTA 1S1NA 2JS2A 2O2OA 2KRMA 2DVJA 4LUEA 1JU5C 3FJ5A 1ZX6A 1QKWA 1UDLA 1ZLMA 1ABQA 4Y92A 4DEYA 4J9GA 2CSQA 4J9DA 1UECA 2CSIA 1AZEA 1WIEA 1K1ZA 1AEYA 1BB9A 2D8HA 1JEGA 2RQTA 2GGRA 2RQVA 4RTWA 4J9EA 4JZ3A 4RTXA 4OMNA 1PNJA 3U23A 5I11A 2KBTA 1ARKA 1YCSB 4JZ4A 5FW9A 2OI3A 1AZGB 3VS4A 1AWXA 1YNZA 2FG0A 1X43A 1UE9A 5FWCA 3H41A 1ZUUA 1YN8A 2CH4W 3KFVA 3ZL7C 4A63B 1NEBA 2EVRA 5GJWB 1PRLC 4AFZC 1HJDA 2DM1A 1T0HA 2LJ1A 3UA7A 3M0UA 1W1FA 1PKSA 1PKTA 1GL5A 1M3CA 2A28A 3C0CA 4JJDA 2YSQA 3M0RA 4CC2A 1B3QA 1JO8A 3M0PA 2IIMA 3NPFA 1VYVA 1JXMA 2K9GA 3ULRB 2DL8A 2CT3A 1ZUYA 2FPFA 2SEMA 1ABOA 2D8JA 2VKNA 1B07A 3RBBB 1TUDA 2EW3A 2EKHA 4RTYA 2BZYA 2H8HA 1VYTA 2L2PA 1TUCA 1QWEA 1FYNA 2LP5A 1PHTA 1Z9QA 3REAB 4D8KA 5I22A 3SHWA 3JV3A 2ABLA 1X2QA 2L3PA 3QWYA 2KE9A 4RTZA 1G2BA 2LNHB 3VS5A 4HVWA 1W70A 2KRNA 2C0IA 2JTEA 2PZ1A 1RUWA 2EYXA 1X27A 1VYUA 2ED0A 1CSKA 1UGVA 2KT8A 2W0ZA 5FWBA 3PVQA 2K6DA 2DRKA 5IHKA 1LCKA 2JMCA 1QKXA 1SEMA 1I1JA 2O31A 1NG2A 1U5SA 3CQTA 4FSSA 4Z89A 1RI9A 2JT4A 2EYYA 2KROA 1H3HA 2RN8A 1X6GA 3PE0A 2LJ3A 1SHGA 2GBQA 3I35A 3EG1A 4LNPA 2I0NA 2J6KA 3H0FA 1I0CA 2K7AA 3RNJA 2C0TA 2O9VA 2J7IA 2DE0X 4JPBW 1QWFA 1K76A 1AD5A 2AK5A 1M3BA 2KYMA 1AWJA 2DMOA 4GLMA 1X6BA 2MCNA 2MOXA 1E7OA 1UHFA 4IIOA 1UJ0A 2A08A 1VA7A 1MV0B 2KT1A 4RTTA 2JW4A 1UG1A 1EFNA 3VS6A 4CC7A 2OJ2A 3VS0A 5IXBA 1ZBJA 2F2VA 1WDXA 2DBMA 2HSPA 2KXDA 2GTJA 1RLPC 2VWFA 2EYZA 1MUZA 2FO0A 2KGTA 2EYWA 4OMPA 2SRCA 4AFUC 2LMJA 2C0OA 2ED1A 3VS3A 1J3TA 1QCFA 2FPEA 2DBKA 2YUPA 4QT7A 5IHIA 5IH2A 2J6OA 2RMOA 1UUEA 4RUGA 3VS7A 2K79A 2LZ6B 2JS0A 1PWTA 2M51A 4K11A 2W10A 2RQRA 2YUQA 2CDTA 1OPKA 1H8KA 2DL7A 2FRWA 2JMAA 1WLPB 4Z8AA 1NYGA 1BU1A 2FRYA 4D8DA 1G83A 1U06A 2M0YA 4RTUA 1AOJA 2HCKA 2RQWA 3O5ZA 4GBQA 3M0SA 4J9HA 2DX1A 2AKKA 1NYFA 2F2WA 2NWMA 2PNIA 1K0XA 2L3SA 2V1QA 2FPDA 1Z9ZA 5L23A 4AFSC 1WXBA 1T0JA 2GTOA 1WYXA 2EQIA 2YT6A 2ENMA 1SRLA 2O88A 1U3OA 1E6HA 4KRTA 1GFCA 3VS1A 1ZUKA 2L0AA 3TSZA 1WI7A 1UFFA 2EBPA 1E6GA 4JJCA 3LH5A 4J9CA 2DF6A 1M8MA 2E5KA 3VRYA 2B86A 2VVKA 1XOVA 4M4ZA 1AWOA 1JQQA 2BZXA 1GCQA 3M0TA 1M3AA 4LN2A 2DILA 2L3QA 4AFQC 2NUZA 1GCPA 2AZVA 1SRMA 1K4US 1HSQA 4J9FA 1V1CA 2D0NA 2MIOA 1AVZC 2DL3A 2RPNA 2A37A 3EG0A 1GFDA 1I07A 1X2KA 2DLPA 1Y0MA 2OAWA 3EG2A 2GNCA 2O9SA 3R6NA 1UHCA 3I5RA 2KNBB 1JXOA 1GRIA 5EC7A 4AG2C 2J05A 1T3LA 3REBB 1KJWA 2DNUA 1MV3A 2LQWA 1RLQC 1KSWA 1A0NB 1FMKA 1M30A 2KYBA 3H0HA 1YWOA 2LJ0A 2PTKA 1SSHA 1KIKA 1KFZA 1W6XA 1YWPA 1HD3A 1OPLA 2BZ8A 3IQLA 5GJVB 1GCQC 2EGEA 2EGCA 3THKA 2JM8A 1M27C 3M0QA 3EHQA 4F17A 5ECAA 5IXFA 3VRZA 3EG3A 1BBZA 3EGUA 1X69A 2YUOA 4CC3A 2BTTA 1CKAA 2V1RA 2ECZA 3I5SA 3TVTA 2RNAA 2YDLA 3EHRA 1BK2A 1WXUA 2G6FX 3GBQA 3UA6A 2RF0A 1OV3A 3NHNA 5HCKA 3PVLA 2ROLA 3H0IA 1WX6A 4OMMA 2X3WD 1IO6A 2YUNA 3VS2A 1NLOC 4OMLA 1K0SA 1ZSGA 2DJQA 1GBQA 2LQNA 4JJBA 2CH4A 2ESWA 4LUDA 2CUDA 3I9QA 2D1XA 2KR3A 1SHFA 2AKLA 4ORZA 4HXJA 2K2MA 2RQUA 4HCKA 2J06A 5IHNA 1UTIA 2CT4A 2KEAA 4J9BA 2LCSA 2JM9A 3UF4A 2DA9A 4CC4B 2CUBA 1N5ZA 1QLYA 3UATA 2EGAA 2J6FA 4IIMA 4OMQA 2DRMA 3QWXX 4X1VA 1NM7A 1WA7A 4R0KA 1TG0A 4LE9A 1YP5A 1H92A 2AZSA 4HVUA 2QDLA 4EIKA 3NGPA 4F16A 2X3XD 4RTVA 1Y57A 4Z88A 3TSWA 4ESRA 1PRMC 1SPKA 4J9IA 2XMFA 4E6RA 2P4RA 1K9AA 2EPDA 2LX7A 1OEBA 3A98A 2KXCA 2DL4A 1T3SA 4ZNXA 1NLPC 4F14A 2ROTA 4WCIA 2A36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYB A;  1NEG A;  2F2X A;  2K3B A;  2HBW A;  2GQI A;  4DEX A;  2HDA A;  3SEM A;  2FEI A;  2HEQ A;  2DL5 A;  1WFW A;  2CRE A;  2KRS A;  4OMO A;  1AWW A;  3NMZ C;  1WXT A;  4AG1 C;  1GBR A;  1UJY A;  4HVV A;  1CKB A;  2JXB A;  1OOT A;  1S1N A;  2JS2 A;  2O2O A;  2KRM A;  2DVJ A;  4LUE A;  1JU5 C;  3FJ5 A;  1ZX6 A;  1QKW A;  1UDL A;  1ZLM A;  1ABQ A;  4Y92 A;  4DEY A;  4J9G A;  2CSQ A;  4J9D A;  1UEC A;  2CSI A;  1AZE A;  1WIE A;  1K1Z A;  1AEY A;  1BB9 A;  2D8H A;  1JEG A;  2RQT A;  2GGR A;  2RQV A;  4RTW A;  4J9E A;  4JZ3 A;  4RTX A;  4OMN A;  1PNJ A;  3U23 A;  5I11 A;  2KBT A;  1ARK A;  1YCS B;  4JZ4 A;  5FW9 A;  2OI3 A;  1AZG B;  3VS4 A;  1AWX A;  1YNZ A;  2FG0 A;  1X43 A;  1UE9 A;  5FWC A;  3H41 A;  1ZUU A;  1YN8 A;  2CH4 W;  3KFV A;  3ZL7 C;  4A63 B;  1NEB A;  2EVR A;  5GJW B;  1PRL C;  4AFZ C;  1HJD A;  2DM1 A;  1T0H A;  2LJ1 A;  3UA7 A;  3M0U A;  1W1F A;  1PKS A;  1PKT A;  1GL5 A;  1M3C A;  2A28 A;  3C0C A;  4JJD A;  2YSQ A;  3M0R A;  4CC2 A;  1B3Q A;  1JO8 A;  3M0P A;  2IIM A;  3NPF A;  1VYV A;  1JXM A;  2K9G A;  3ULR B;  2DL8 A;  2CT3 A;  1ZUY A;  2FPF A;  2SEM A;  1ABO A;  2D8J A;  2VKN A;  1B07 A;  3RBB B;  1TUD A;  2EW3 A;  2EKH A;  4RTY A;  2BZY A;  2H8H A;  1VYT A;  2L2P A;  1TUC A;  1QWE A;  1FYN A;  2LP5 A;  1PHT A;  1Z9Q A;  3REA B;  4D8K A;  5I22 A;  3SHW A;  3JV3 A;  2ABL A;  1X2Q A;  2L3P A;  3QWY A;  2KE9 A;  4RTZ A;  1G2B A;  2LNH B;  3VS5 A;  4HVW A;  1W70 A;  2KRN A;  2C0I A;  2JTE A;  2PZ1 A;  1RUW A;  2EYX A;  1X27 A;  1VYU A;  2ED0 A;  1CSK A;  1UGV A;  2KT8 A;  2W0Z A;  5FWB A;  3PVQ A;  2K6D A;  2DRK A;  5IHK A;  1LCK A;  2JMC A;  1QKX A;  1SEM A;  1I1J A;  2O31 A;  1NG2 A;  1U5S A;  3CQT A;  4FSS A;  4Z89 A;  1RI9 A;  2JT4 A;  2EYY A;  2KRO A;  1H3H A;  2RN8 A;  1X6G A;  3PE0 A;  2LJ3 A;  1SHG A;  2GBQ A;  3I35 A;  3EG1 A;  4LNP A;  2I0N A;  2J6K A;  3H0F A;  1I0C A;  2K7A A;  3RNJ A;  2C0T A;  2O9V A;  2J7I A;  2DE0 X;  4JPB W;  1QWF A;  1K76 A;  1AD5 A;  2AK5 A;  1M3B A;  2KYM A;  1AWJ A;  2DMO A;  4GLM A;  1X6B A;  2MCN A;  2MOX A;  1E7O A;  1UHF A;  4IIO A;  1UJ0 A;  2A08 A;  1VA7 A;  1MV0 B;  2KT1 A;  4RTT A;  2JW4 A;  1UG1 A;  1EFN A;  3VS6 A;  4CC7 A;  2OJ2 A;  3VS0 A;  5IXB A;  1ZBJ A;  2F2V A;  1WDX A;  2DBM A;  2HSP A;  2KXD A;  2GTJ A;  1RLP C;  2VWF A;  2EYZ A;  1MUZ A;  2FO0 A;  2KGT A;  2EYW A;  4OMP A;  2SRC A;  4AFU C;  2LMJ A;  2C0O A;  2ED1 A;  3VS3 A;  1J3T A;  1QCF A;  2FPE A;  2DBK A;  2YUP A;  4QT7 A;  5IHI A;  5IH2 A;  2J6O A;  2RMO A;  1UUE A;  4RUG A;  3VS7 A;  2K79 A;  2LZ6 B;  2JS0 A;  1PWT A;  2M51 A;  4K11 A;  2W10 A;  2RQR A;  2YUQ A;  2CDT A;  1OPK A;  1H8K A;  2DL7 A;  2FRW A;  2JMA A;  1WLP B;  4Z8A A;  1NYG A;  1BU1 A;  2FRY A;  4D8D A;  1G83 A;  1U06 A;  2M0Y A;  4RTU A;  1AOJ A;  2HCK A;  2RQW A;  3O5Z A;  4GBQ A;  3M0S A;  4J9H A;  2DX1 A;  2AKK A;  1NYF A;  2F2W A;  2NWM A;  2PNI A;  1K0X A;  2L3S A;  2V1Q A;  2FPD A;  1Z9Z A;  5L23 A;  4AFS C;  1WXB A;  1T0J A;  2GTO A;  1WYX A;  2EQI A;  2YT6 A;  2ENM A;  1SRL A;  2O88 A;  1U3O A;  1E6H A;  4KRT A;  1GFC A;  3VS1 A;  1ZUK A;  2L0A A;  3TSZ A;  1WI7 A;  1UFF A;  2EBP A;  1E6G A;  4JJC A;  3LH5 A;  4J9C A;  2DF6 A;  1M8M A;  2E5K A;  3VRY A;  2B86 A;  2VVK A;  1XOV A;  4M4Z A;  1AWO A;  1JQQ A;  2BZX A;  1GCQ A;  3M0T A;  1M3A A;  4LN2 A;  2DIL A;  2L3Q A;  4AFQ C;  2NUZ A;  1GCP A;  2AZV A;  1SRM A;  1K4U S;  1HSQ A;  4J9F A;  1V1C A;  2D0N A;  2MIO A;  1AVZ C;  2DL3 A;  2RPN A;  2A37 A;  3EG0 A;  1GFD A;  1I07 A;  1X2K A;  2DLP A;  1Y0M A;  2OAW A;  3EG2 A;  2GNC A;  2O9S A;  3R6N A;  1UHC A;  3I5R A;  2KNB B;  1JXO A;  1GRI A;  5EC7 A;  4AG2 C;  2J05 A;  1T3L A;  3REB B;  1KJW A;  2DNU A;  1MV3 A;  2LQW A;  1RLQ C;  1KSW A;  1A0N B;  1FMK A;  1M30 A;  2KYB A;  3H0H A;  1YWO A;  2LJ0 A;  2PTK A;  1SSH A;  1KIK A;  1KFZ A;  1W6X A;  1YWP A;  1HD3 A;  1OPL A;  2BZ8 A;  3IQL A;  5GJV B;  1GCQ C;  2EGE A;  2EGC A;  3THK A;  2JM8 A;  1M27 C;  3M0Q A;  3EHQ A;  4F17 A;  5ECA A;  5IXF A;  3VRZ A;  3EG3 A;  1BBZ A;  3EGU A;  1X69 A;  2YUO A;  4CC3 A;  2BTT A;  1CKA A;  2V1R A;  2ECZ A;  3I5S A;  3TVT A;  2RNA A;  2YDL A;  3EHR A;  1BK2 A;  1WXU A;  2G6F X;  3GBQ A;  3UA6 A;  2RF0 A;  1OV3 A;  3NHN A;  5HCK A;  3PVL A;  2ROL A;  3H0I A;  1WX6 A;  4OMM A;  2X3W D;  1IO6 A;  2YUN A;  3VS2 A;  1NLO C;  4OML A;  1K0S A;  1ZSG A;  2DJQ A;  1GBQ A;  2LQN A;  4JJB A;  2CH4 A;  2ESW A;  4LUD A;  2CUD A;  3I9Q A;  2D1X A;  2KR3 A;  1SHF A;  2AKL A;  4ORZ A;  4HXJ A;  2K2M A;  2RQU A;  4HCK A;  2J06 A;  5IHN A;  1UTI A;  2CT4 A;  2KEA A;  4J9B A;  2LCS A;  2JM9 A;  3UF4 A;  2DA9 A;  4CC4 B;  2CUB A;  1N5Z A;  1QLY A;  3UAT A;  2EGA A;  2J6F A;  4IIM A;  4OMQ A;  2DRM A;  3QWX X;  4X1V A;  1NM7 A;  1WA7 A;  4R0K A;  1TG0 A;  4LE9 A;  1YP5 A;  1H92 A;  2AZS A;  4HVU A;  2QDL A;  4EIK A;  3NGP A;  4F16 A;  2X3X D;  4RTV A;  1Y57 A;  4Z88 A;  3TSW A;  4ESR A;  1PRM C;  1SPK A;  4J9I A;  2XMF A;  4E6R A;  2P4R A;  1K9A A;  2EPD A;  2LX7 A;  1OEB A;  3A98 A;  2KXC A;  2DL4 A;  1T3S A;  4ZNX A;  1NLP C;  4F14 A;  2ROT A;  4WCI A;  2A36 A; 
#chains in the Genus database with same CATH topology
 2DYB A;  1SF9 A;  3CCL Q;  2F2X A;  1MGQ A;  3CCJ A;  3CCV A;  4DEX A;  2HDA A;  4C8Q A;  1OU9 A;  3VYG A;  3CC7 T;  4HCZ A;  2KRS A;  2K57 A;  3CCL T;  1WXT A;  1GBR A;  1G3W A;  3A5Z B;  1CKB A;  4EMK C;  2QDY B;  3G6E A;  4X9D A;  1WHG A;  2KRM A;  4AT1 B;  3Q1J A;  1YJ9 A;  1QKW A;  2KI7 A;  1ZLM A;  2RJE A;  4F7U F;  1KG1 A;  2GCX A;  1M1K R;  4FT2 A;  4FYV B;  3SFM A;  4KBM B;  1Q81 R;  1UEC A;  2CZ0 B;  2D6F A;  3FJP A;  1PD1 A;  1WIE A;  1K1Z A;  2RJF A;  1AEY A;  2D8H A;  3MEW A;  3GPL A;  3JCM P;  2KAF A;  2WSF E;  1HXD A;  4RTW A;  3QYG B;  4X34 A;  1M8V A;  4L6V 5;  3DB4 A;  4RCB A;  2O4X A;  4FU6 A;  4IKF A;  4KGZ B;  2KBT A;  2RD1 A;  4O5V A;  5FW9 A;  1ARK A;  3MHX A;  2M02 A;  2CZ7 B;  3A8L B;  4A4H A;  1YNZ A;  4C5I A;  5FWC A;  3EGD A;  4OP0 A;  3KFV A;  2G3R A;  4A63 B;  2K5I A;  1W2B P;  2EVR A;  4M75 C;  2QA4 A;  4AFZ C;  3VUZ A;  1HJD A;  4BDZ A;  1RAG B;  3M54 A;  2A28 A;  3JCM V;  4JJD A;  4DQ2 A;  5GAO l;  3M0R A;  2HL5 C;  3BDU A;  1MND A;  4N0A A;  3GOX A;  3ULR B;  4AMC A;  1PC0 A;  3N5B B;  2FPF A;  2SEM A;  2RH2 A;  1ABO A;  2D8J A;  1UEB A;  2EW3 A;  3P8B B;  4JRK A;  3OS5 A;  4PLL A;  5GAN 6;  1OI1 A;  5I2M A;  1QWE A;  2E6N A;  2X4Y A;  1QVG P;  5CVI A;  2CP3 A;  3JV3 A;  2ABL A;  8ATC B;  3JCM Q;  5DY9 A;  5FU6 C;  1KQS S;  4Y91 A;  4BAC A;  1K73 R;  4LDV A;  2C0I A;  2KSS A;  1VQ4 A;  2EYQ A;  2EYX A;  2ZZD A;  2RO0 A;  1RI0 A;  1X27 A;  5CCA A;  4JRQ A;  1NPP A;  2HAX A;  1LCK A;  1QKX A;  1I1J A;  2O31 A;  2ZAE A;  1U5S A;  4FSS A;  2P84 A;  2JT4 A;  1XQH A;  2RN8 A;  3QG1 A;  5FLX E;  1RAC B;  1BIB A;  3TQ7 P;  3EG1 A;  2I0N A;  2J6K A;  3H0F A;  1I0C A;  2K7A A;  1VQO Q;  4JPB W;  2YRV A;  3OW2 S;  1AWJ A;  1TOV A;  2EWN A;  4M7D E;  3LWI A;  1D0Z A;  1X6B A;  1QVF S;  2XDB A;  4M7A F;  5KYN A;  1D1A A;  4RTT A;  2JW4 A;  1G3T A;  1EFN A;  3VS6 A;  3VS0 A;  5IXB A;  1ZBJ A;  5GAN e;  3OYA A;  1O9S A;  2HSP A;  5CKB A;  2VWF A;  4OMP A;  4AFU C;  2LMJ A;  2C0O A;  2GQV A;  4N4H A;  2ED1 A;  3HL8 A;  4HKE A;  1WJR A;  4E7L A;  1EZZ B;  3KUF A;  2YUP A;  5IHI A;  5IH2 A;  4ZGD B;  3G4S A;  1YJN Q;  3VS7 A;  2JS0 A;  4J6X A;  2M51 A;  3G71 A;  1VQM Q;  3JB9 F;  2W10 A;  1OX8 A;  2DL7 A;  2FRW A;  2JMA A;  4BE1 A;  3HSB A;  3MO8 A;  1WLP B;  3CXC A;  3EGX B;  3V8K A;  3WXM B;  1VQM T;  4M78 G;  2YWW A;  1U8R A;  4D8D A;  3CC2 A;  1G83 A;  2M0Y A;  1QP3 A;  4RTU A;  4X9C A;  3JB9 H;  4M77 F;  2MK5 A;  2HCK A;  3A8G B;  1PM3 A;  1M2V B;  2NWM A;  2L3S A;  1P92 A;  2FPD A;  1YIJ A;  5L23 A;  3EH2 A;  1WXB A;  4M78 A;  1WYX A;  1R0B G;  4LD9 K;  2ENM A;  1M2O A;  1SRL A;  1VQ7 A;  1Q7Y U;  1OX9 A;  1YHQ T;  1WI7 A;  3H6Z A;  4QQD A;  3RER A;  2EBP A;  3PIO A;  4J9C A;  2DF6 A;  1BI3 A;  1XOV A;  1OZ3 A;  2BZX A;  4FSX A;  2AIR B;  4LN2 A;  1KHI A;  2JNG A;  2L3Q A;  4M7A D;  1KQS P;  4MDW A;  3X26 B;  2AZV A;  4M75 G;  1SRM A;  1K4U S;  3VYH B;  5GAM g;  3M58 A;  4BD3 A;  1Q7Y C;  1VQO A;  1WHK A;  2DL3 A;  1DJ7 B;  1X2K A;  5GAO n;  2HBP A;  3HP9 A;  3UDC A;  3VU3 C;  3EG2 A;  1UHC A;  4C8Q F;  3PIP A;  2RHZ A;  3TRE A;  7AT1 B;  1R0C B;  4C92 B;  3REB B;  3CCM A;  2FL7 A;  2HQH A;  2LQW A;  1YIT Q;  2XHC A;  4B6M A;  5KYX B;  1WQW A;  3JB9 D;  2KYB A;  1M90 U;  4LDY A;  2PTK A;  1YIT T;  2COW A;  2BE7 D;  3V7C A;  1KIK A;  3OSS C;  4CRI A;  3M5A A;  4PJO G;  1WHL A;  4J8O A;  3E9F A;  4A4E A;  1QVF P;  2BZ8 A;  4MZT A;  1GCQ C;  4C0Z A;  3THK A;  1QMC A;  3EHQ A;  4M77 D;  9ATC B;  1QCN A;  3FEO A;  4CC3 A;  2CP5 A;  1YJN A;  3I5S A;  3EHR A;  4RG2 A;  4PJO A;  3UA6 A;  1M90 C;  4BI3 A;  3PVL A;  5GAN 7;  3RMS A;  3H0I A;  4ME7 A;  4OGE A;  5M9O A;  1M9S A;  2LCC A;  4KUI A;  3VS2 A;  1S72 A;  4E47 A;  1N9R A;  3QZ5 B;  1ZSG A;  3JRZ A;  2PVD B;  2NUT A;  2QTV A;  2D1X A;  1SHF A;  2AKL A;  3M9Q A;  3LH0 A;  3CCR T;  1PD0 A;  2FYK A;  3MP1 A;  5A0L A;  5DLO A;  4ATO A;  1MNE A;  2KEA A;  2CT4 A;  2LCS A;  3I56 A;  3RKY A;  3CMA Q;  1TXQ A;  1M1K U;  4A4G A;  4CC4 B;  1SG5 A;  2CUB A;  1Q81 U;  3UAT A;  3SWN B;  2DRM A;  3QWX X;  4FYW B;  4X1V A;  3CBO A;  1QCO A;  3CMA T;  4XU3 A;  1WA7 A;  1C1A A;  3HHT B;  4C8Q D;  5GMK l;  1QW1 A;  2FHD A;  4LE9 A;  3L2Z A;  1VQ9 T;  5HK3 A;  1I5O B;  2JOY A;  3ASK A;  2V8J A;  1OYX A;  1WZO A;  2ATC B;  4F16 A;  2EQK A;  2K5L A;  1Y57 A;  2OTJ Q;  3TSW A;  1D3B A;  4J9I A;  4VUB A;  5GMK i;  2XMF A;  4NL3 A;  2ZCF B;  3FIF A;  2BKD N;  2K3X A;  2LX7 A;  1M1K C;  3HRS A;  5FRM A;  2OTL Q;  1Q81 C;  3OY9 A;  2OTJ T;  2KDS A;  5J3B A;  4F14 A;  2KQW A;  4ZTF A;  2A36 A;  1NEG A;  1YJW A;  4UC4 A;  2QXF A;  2K3B A;  2OTL T;  2FEI A;  2HEQ A;  2CRE A;  2GFU A;  4OMO A;  1VQK Q;  5LJ5 d;  3NMZ C;  4AG1 C;  4F7U B;  4LDW A;  4RMO A;  2O2O A;  4LUE A;  1JU5 C;  3FJ5 A;  4XTU A;  1ZBX A;  1VQK T;  5CAI A;  2FZC B;  4DEY A;  2CSQ A;  5GAN 3;  3OYI A;  3INZ A;  1N27 A;  1Q7Y R;  1AZE A;  2FB7 A;  1WHH A;  3RKW A;  2X51 A;  5LJ5 f;  2H3J A;  3CBM A;  3ZEH A;  1JJ2 P;  3NTH A;  3CCV T;  2MI6 A;  4HCB A;  1IZ6 A;  2LQ8 A;  1W2B S;  4JZ4 A;  1ACM B;  1K8A C;  1AZG B;  1IHV A;  1K73 U;  1AWX A;  3RR6 A;  3G6E T;  2FG0 A;  1X43 A;  2EQU A;  4IUU A;  2DTI A;  2MWP A;  3QJY A;  3PNW C;  2K4Y A;  2CH4 W;  4NS5 A;  3RUX A;  1Q86 C;  2RHX A;  4M7D A;  1R77 A;  2LJ1 A;  4WTO B;  2DD5 A;  4C92 C;  2IG0 A;  1M3C A;  3C0C A;  2DAQ A;  4J6Y A;  4HT8 A;  1IGU A;  1V76 A;  4PJM A;  1K73 C;  4CC2 A;  4JJN K;  2IIM A;  3CCS A;  1OQK A;  2K9G A;  1WJS A;  2DL8 A;  2JVV A;  1QVG S;  4HA8 A;  4ZGE B;  2BUD A;  3PFS A;  3OW2 A;  1VQ8 Q;  1FXX A;  1TUD A;  4BDY A;  3V8L A;  2LDM A;  4RTY A;  2BZY A;  5EG2 A;  4M75 E;  3CCQ A;  2QA4 T;  1PHT A;  1PG5 B;  1VQ8 T;  1MMG A;  4M78 F;  5I22 A;  2QEX A;  3SHW A;  1D0Y A;  3OYM A;  5KYY B;  2E5Q A;  3CC4 Q;  1WNL A;  3MEA A;  2E41 A;  1Y07 A;  2DTH A;  2KE9 A;  5I21 A;  2HL3 A;  4JDS A;  2EAY A;  5LJ3 j;  1K9M R;  3CC4 T;  2ED0 A;  4JLG A;  5LJ3 h;  2LTO A;  2W0Z A;  1BIA A;  3PVQ A;  5FWB A;  5GAN j;  1WHM A;  2DRK A;  2K6D A;  2CP7 A;  5IHK A;  5FU7 C;  1SEM A;  2WSC E;  3QDR B;  5GAN h;  2PUO B;  2QQB A;  4Z89 A;  2KRO A;  3LYI A;  3PE0 A;  4PJO E;  2LJ3 A;  1SHG A;  2DK3 A;  3X25 B;  2H3E B;  5HY6 A;  4QKU A;  2NUP B;  5A0G A;  3CD6 A;  1K76 A;  1AD5 A;  1KQ1 A;  3SWN C;  4RG8 A;  4M7A B;  1VQL A;  1YCY A;  2MCN A;  2MOX A;  1E7O A;  1UHF A;  4DBR A;  3OA6 A;  4IIO A;  4C5G A;  1MV0 B;  4L59 A;  3RKX A;  3C94 A;  1BKB A;  2YHT A;  1YI2 A;  2DBM A;  3KBG A;  3UPU A;  2KXD A;  2VGM A;  3E1S A;  2CP6 A;  3BDL A;  2KGT A;  2D0Q B;  2SRC A;  3CME A;  5KCH A;  3OYG A;  2JZ2 A;  3L2V A;  2DBK A;  5GAM e;  4NOY A;  2FVU A;  4RUG A;  2K79 A;  4M78 D;  1W4S A;  5LJ3 d;  1Y96 B;  2RQR A;  2DIG A;  2CDT A;  1FMV A;  1OPK A;  2DXU A;  3EFO B;  4JRI A;  5GAN d;  4M77 B;  1Y7X A;  1K8A R;  4Z8A A;  4ZTJ A;  1NYG A;  3PGG A;  3JAM E;  3EGX A;  4PKC C;  3G1J A;  4A54 A;  1SKU B;  4GBQ A;  2XI9 A;  2DX1 A;  5GAN 4;  3URG A;  3X20 B;  1NYF A;  2F2W A;  5LJ3 f;  1JRI A;  1Q86 R;  2V1Q A;  2JUF A;  3BE3 A;  5GAN f;  1T0J A;  1VOM A;  3LW5 E;  1RAI B;  3G4S T;  2YT6 A;  1C0M A;  4PK4 A;  4ZN3 A;  2CP0 A;  3G71 T;  1U3O A;  4KRT A;  2X9H A;  3VS1 A;  2DPP B;  3V7R A;  3CC7 A;  3MKD A;  1ZUK A;  3TSZ A;  1D1C A;  1BYM A;  5DM7 R;  4JJC A;  3CCL A;  4FIB A;  1M8M A;  1AWO A;  3J80 E;  3H8Z A;  1JQQ A;  3M0T A;  2DIL A;  2MMP A;  4AFQ C;  1VQP Q;  2EQM A;  1GCP A;  2RI2 A;  3S3O A;  4DBH A;  1Q82 R;  4J9F A;  2CZ6 B;  1V1C A;  1ZA1 B;  2VUB A;  1AVZ C;  4C8Q B;  3MJX A;  1VQP T;  2RPN A;  1GFD A;  2DLP A;  4C92 G;  2QYZ A;  4MZP A;  3OS2 A;  2OAW A;  2GNC A;  1LVK A;  2PVO B;  3I5R A;  1WJQ A;  1JXO A;  1Y71 A;  4KUL A;  3QZ9 B;  5CKE A;  2LQK A;  2M0O A;  5EC7 A;  4ANJ A;  4AG2 C;  5I2S A;  3L2W A;  4PJN A;  1KJW A;  4PJO D;  1KSW A;  4ELY C;  3PT9 A;  4FM4 B;  3CEY A;  4OMF B;  4NL2 A;  3C4S A;  1YWO A;  2KMT A;  4QVD A;  1SSH A;  1UB4 A;  4BY6 C;  2FZG B;  5KYX A;  4XTY A;  1W6X A;  2PUK B;  4DOW A;  1KD1 R;  3IQL A;  1N6A A;  1B7T A;  2X4W A;  5GMK e;  5FRN A;  1M27 C;  3M0Q A;  3C95 A;  1X69 A;  2HMA A;  2V1R A;  2ECZ A;  3TVT A;  2E3H A;  2HNI A;  3EGD B;  8AT1 B;  1WXU A;  4KT0 E;  2G6F X;  5LJ5 g;  3GBQ A;  4XTX A;  1OV3 A;  5HCK A;  1SSF A;  3FRN A;  2QQS A;  4JLI A;  1TU0 B;  1JBM A;  1D1B A;  1NLO C;  2LQN A;  4M7D F;  4JJB A;  2CH4 A;  2ESW A;  4LUD A;  4M7A C;  2F5K A;  3RES A;  1TS9 A;  3I9Q A;  3JB9 I;  4WF2 A;  3HKS A;  3JCM h;  3OYK A;  4ORZ A;  2DYI A;  4HXJ A;  5KYU A;  2F69 A;  3OYL A;  4HCK A;  1VQ5 Q;  1B34 B;  5LL6 S;  2J06 A;  5IHN A;  1X01 A;  2KVQ G;  3UF4 A;  4FW1 A;  2QK0 A;  1YHQ Q;  2PU9 B;  4LD6 A;  4EMK A;  1N5Z A;  2NYS A;  3VKI A;  1QLY A;  2EGA A;  1VQ5 T;  1I5L A;  1NM7 A;  1WPY A;  1TG0 A;  3SWN A;  1WQ7 A;  2OAU A;  1VQN Q;  1H92 A;  4RCC A;  1ZSZ B;  2EFI A;  5D6X A;  2QDL A;  4EIK A;  3NGP A;  5CQX A;  2V8I A;  1PRM C;  1VQN T;  2FZK B;  4E6R A;  4EDU A;  1W2B A;  1K9A A;  3QO3 A;  2EPD A;  4J5Y A;  4OGC A;  1T3S A;  2L5Q A;  1NLP C;  2RHI A;  5GAO q;  2E3I A;  4WCI A;  2YDL A;  3JSC A;  4M77 C;  1RAB B;  2EIF A;  4OB3 B;  2HBW A;  3A8H B;  2DET A;  4F7U G;  3SEM A;  3CPW A;  2DL5 A;  1WFW A;  1IXD A;  1G3S A;  4M75 A;  2QQ9 A;  2X4J A;  4TVR A;  1UJY A;  4HVV A;  2O01 E;  2JS2 A;  5KE2 A;  2RJD A;  5GAO r;  1RAF B;  3VUB A;  4A4F A;  3JCM d;  4Y92 A;  1JJ2 S;  3CCU Q;  4QQ6 A;  4J9D A;  2LT1 A;  1QVG A;  2RA2 A;  4M7D D;  2C06 A;  3EG9 A;  1YBY A;  3CCU T;  2RQT A;  2WAC A;  2GGR A;  4FW2 A;  3H9N A;  4JZ3 A;  4RTX A;  2CYZ B;  1TSF A;  4BE0 A;  1PNJ A;  2LX9 A;  3J81 E;  3U23 A;  1Q95 G;  3LLR A;  1YCS B;  4IUR A;  2OI3 A;  3JCM f;  3OYH A;  1VQM A;  3VS4 A;  2LT4 A;  1BCO A;  1BI0 A;  5D6Y A;  4CI0 C;  1VQ6 Q;  1UE9 A;  1K9M U;  3JCM c;  3S3M A;  3H41 A;  2K5F A;  4C8Q C;  3G7Z A;  2YRC A;  1NEB A;  1VQ6 T;  3CCR Q;  4J7I A;  5FU7 B;  1JB0 E;  2WSE E;  1H64 1;  1T0H A;  3ME9 A;  2DEU A;  3M0U A;  1W1F A;  1PKS A;  1PKT A;  1GL5 A;  2DJZ A;  4P5N A;  4Z02 A;  2YSQ A;  2VB6 A;  3UWN A;  4PFO A;  1YHQ A;  3OS0 A;  1JO8 A;  3M0P A;  4DOV A;  3NPF A;  1VYV A;  1K9M C;  3RIR A;  3A8M B;  3PTA A;  2ZPH B;  1VQ9 Q;  1C6V X;  4PJL A;  2R58 A;  2VKN A;  1B07 A;  4M78 B;  2EKH A;  3M4Y A;  3VV0 A;  1OUL A;  2A7Y A;  1FYN A;  1N8R R;  3REA B;  1AT1 B;  4D8K A;  4C92 E;  1X2Q A;  5LJ3 g;  1WGS A;  3SB2 A;  4BI8 B;  2KRN A;  3I55 T;  3QUI A;  4PL6 A;  1G5V A;  1RUW A;  4FL6 A;  3CCE Q;  1YFN A;  1VYU A;  1UGV A;  2KT8 A;  5KYW B;  1PSE A;  1LOJ A;  2XK0 A;  4XQ3 A;  1NG2 A;  2VXE A;  3CCE T;  1LJO A;  3QKJ A;  1YIT A;  1RI9 A;  5GAO m;  3CCQ T;  2EYY A;  4N0A C;  1H3H A;  5CIU A;  4DBF A;  3R6O A;  4C5H A;  1K8A U;  2GBQ A;  3DLM A;  4M7A G;  4LNP A;  5GAM j;  5FRO A;  4BUG A;  2C0T A;  2J7I A;  5GAM h;  4Y28 E;  3CCJ Q;  3CCV Q;  1EX4 A;  4E7I A;  1Q86 U;  4GLM A;  2YLB A;  4PNO A;  1UJ0 A;  1ZSZ C;  2A08 A;  3JCM b;  3TEE A;  4J6W A;  3CCJ T;  2RK2 A;  2KT1 A;  2DXC A;  3G6E Q;  4XU2 A;  3F70 A;  3OBY A;  1UG1 A;  3ZFJ A;  2OJ2 A;  1YJ9 Q;  4DBQ A;  3MCA B;  2YRD A;  2GTJ A;  1RLP C;  1BI1 A;  5KE3 A;  2DXT A;  2JJ9 A;  3JB9 G;  1MUZ A;  2FO0 A;  1KQS A;  1YJ9 T;  3CCR A;  3M4G A;  4C0D B;  2RB6 A;  1TH7 A;  1J3T A;  1QCF A;  2FPE A;  2ZPF B;  2P0P A;  1WHJ A;  4OB0 B;  2QQA A;  1BI2 A;  3GLX A;  1UUE A;  1Q82 U;  2LNV A;  3EFS A;  4XTW A;  5GAN 2;  2XDD A;  3CMA A;  2M16 A;  2E1H A;  1VQ9 A;  2RI5 A;  2ZPG B;  2FRY A;  4E7H A;  3NTI A;  1U06 A;  2DER A;  2QA4 Q;  1N9S A;  2E64 A;  1UGR B;  1AOJ A;  2DD4 A;  3O5Z A;  4E7K A;  5IN1 A;  5GAM d;  5D6W A;  1Q82 C;  4F04 B;  2P4T A;  1Z9Z A;  2A0F B;  1QVF A;  5CO7 A;  4AFS C;  2OTJ A;  3AT1 B;  2GTO A;  4B9W A;  1KC8 R;  4BY6 B;  4J7F A;  4HCC A;  1E6H A;  1KD1 U;  2OTL A;  1QVP A;  1GFC A;  4F7U E;  3GF5 A;  3L1A A;  3LH5 A;  1FWZ A;  2HQX A;  3VRY A;  2B86 A;  3E9G A;  5GAM f;  2VVK A;  5CKF A;  4M4Z A;  1NPR A;  5LJ5 e;  2CP2 A;  1GCQ A;  1VIE A;  1VQK A;  2A3L A;  2QG9 B;  1IRX A;  1VUB A;  4C8Q G;  2NUZ A;  5GMK j;  2XID A;  2MF2 A;  5GMK h;  2MIO A;  2HZY A;  1KD1 C;  2A37 A;  3X24 B;  1VQ4 Q;  1X6O A;  3X28 B;  4C5E A;  2Y4X A;  3GNG A;  3R6N A;  2PQW A;  4KH0 B;  2KNB B;  3KXT A;  4BB7 A;  1VQ4 T;  4M75 F;  3CXC P;  1T3L A;  2DVE A;  2RHY A;  4M78 C;  1LPL A;  1MV3 A;  4QQG A;  5CQY A;  1RLQ C;  4A53 A;  3OYY A;  1A0N B;  2KY9 A;  1M30 A;  3H0H A;  3OSV A;  1D0X A;  2LC4 A;  1H3Z A;  3M57 A;  3ZBD A;  3C12 A;  2R5M A;  3E2U A;  1ZQ1 A;  1YWP A;  2JTF A;  1OPL A;  4L5G A;  4LXC A;  2EGE A;  2EGC A;  2I2L A;  2R5A A;  3VRZ A;  4XTZ A;  2YUO A;  2MYS A;  1CKA A;  2MWO A;  3A8O B;  2GF7 A;  4PJO F;  3NHN A;  3HRT A;  5GAN 5;  1RL2 A;  1M4Z A;  2EJG A;  1WX6 A;  4M7D B;  3OQ5 A;  1UGQ B;  1QP2 A;  1IO6 A;  1V29 B;  3JCM g;  4E2F B;  1K0S A;  3LGF A;  1PSF A;  1IRE B;  1NJI R;  4JUV A;  3QJ6 A;  1VQ8 A;  2Y90 A;  3LX7 A;  5J26 A;  2RI3 A;  1FMW A;  2KR3 A;  3J7A F;  1OZ2 A;  2COZ A;  3G4S Q;  4JRP A;  3T9N A;  2K2M A;  3S3N A;  3G71 Q;  2VV5 A;  4J9B A;  1R8O B;  3CPW P;  3A1P A;  2JM9 A;  2DA9 A;  1RAD B;  3CC4 A;  1M2V A;  1B34 A;  5GAN 8;  3V7S A;  2E4H A;  5A0D A;  1JJ2 A;  4IIM A;  1IB8 A;  1KK7 A;  2L3R A;  2EQJ A;  3CC2 Q;  2E70 A;  4PFP A;  4R0K A;  3CBP A;  3E19 A;  2QI2 A;  2AZS A;  4HVU A;  4M75 D;  3HFN A;  4PJO C;  4C0D C;  1F1B B;  5GAO p;  3CC2 T;  4O6J A;  2X3X D;  2RHU A;  1YIJ Q;  4RTV A;  4M7A E;  1D09 B;  1ZSZ A;  4BI4 A;  1IHW A;  2P0K A;  6AT1 B;  3HRU A;  2KXC A;  1VQ7 Q;  2QAS A;  1YIJ T;  5KH6 A;  1G3Y A;  5CR2 A;  1G8X A;  3OYJ A;  3LWH A;  4Q5W A;  4DA4 A;  3L2U A;  5L8R E;  1VQ7 T;  4KUD K;  2GQI A;  5CKH A;  1HYO A;  5KCO A;  3TU4 K;  3OYE A;  2CGH A;  3WVE B;  4E7Z A;  1AWW A;  1AHJ B;  4PLI A;  3L2Q A;  3UT1 A;  2JXB A;  2EKO A;  1OOT A;  1S1N A;  2DVJ A;  1O75 A;  1NE8 A;  1RAA B;  4C92 A;  2IVW A;  2DZC A;  1ZX6 A;  3MEV A;  1UDL A;  1ABQ A;  4J9G A;  1IGQ A;  2OX7 A;  2CSI A;  5GMK m;  1VQO T;  1XJW B;  1BB9 A;  2DIQ A;  3JCM J;  1JEG A;  2DZ9 A;  2O4X B;  3RDV A;  2HKQ B;  3HPW A;  1N8R U;  2E12 A;  2RQV A;  4IUQ A;  4M77 E;  4J9E A;  3OMG A;  3CCM Q;  3QPH A;  4IUP A;  4OMN A;  3JCM X;  2GFA A;  3NFC A;  4EMG A;  5LJ3 e;  5I11 A;  2RJC A;  4EMH A;  2PVG B;  4GLK A;  3CCM T;  1FX7 A;  1M1F A;  4XU0 A;  4OB2 B;  3QII A;  2XG8 D;  1ZUU A;  4HT9 A;  1YN8 A;  3QHS A;  3ZL7 C;  4QW2 A;  1ZHI A;  5GJW B;  1PRL C;  3MEU A;  2DFU A;  4XAX B;  1N8R C;  2DM1 A;  3UA7 A;  2Z0W A;  2X4X A;  4XK8 E;  1PCX A;  2E6Z A;  1B3Q A;  1YJN T;  2V8K A;  2XD0 A;  2VYT A;  5A2Q E;  1JXM A;  3MET A;  1MMN A;  1MMD A;  1S72 Q;  2VXF A;  1OU8 A;  2CT3 A;  1ZUY A;  3QSU A;  1M1G A;  5CKD A;  3RBB B;  2YXY A;  3NTK A;  3VJP A;  4C8Q E;  3OB9 A;  1S72 T;  4A4K A;  2H8H A;  2BIV A;  1VYT A;  2L2P A;  4YTL A;  1TUC A;  2LP5 A;  1Z9Q A;  1VQP A;  3I56 Q;  3ER0 A;  3FDR A;  5IT9 E;  4LDU A;  2L3P A;  3QWY A;  4N4G A;  1M5Q 1;  4RTZ A;  1G2B A;  2LNH B;  3VS5 A;  4HVW A;  5C0M A;  1W70 A;  3QDF A;  3FB9 A;  2QGG A;  3P8H A;  3I56 T;  2YLC A;  2D9T A;  2JTE A;  4EPC A;  2PZ1 A;  5DLQ E;  4OF1 A;  4M7D C;  3HFO A;  2BE9 B;  1CSK A;  5D7U A;  2B8A A;  2COY A;  2JMC A;  3L2R A;  3MP8 A;  3CQT A;  5KYW A;  3M55 A;  2ZPE B;  4B9X A;  1X6G A;  5AT1 B;  4OVA A;  3OBW A;  3QBY A;  3M53 A;  3I35 A;  3RNJ A;  2RK1 A;  4F7U A;  1I4K 1;  1VIF A;  2DEQ A;  2O9V A;  1NBE B;  2DE0 X;  1YJW Q;  1QWF A;  2F1L A;  4C0G A;  1TUG B;  2AK5 A;  1M3B A;  2KYM A;  2ZPI B;  4PFZ A;  2DMO A;  3EFR A;  5HK0 A;  1YJW T;  1VA7 A;  1KC8 U;  4OB1 B;  3LGL A;  3HTR A;  3OW2 P;  4CC7 A;  2QAZ A;  2ZPB B;  2F2V A;  1UGS B;  1WDX A;  3CPF A;  3EAE A;  2DO3 A;  5J39 A;  3BW1 A;  3M59 A;  1GXI E;  2HD0 A;  2EYZ A;  4FYX B;  2EYW A;  2JN0 A;  2CKK A;  3VS3 A;  4MZM A;  4QT7 A;  2J6O A;  2RMO A;  4V2S A;  1KC8 C;  3AHU A;  2LZ6 B;  3OYC A;  1PWT A;  1VQ5 A;  2HSE B;  2JTM A;  4E7S A;  3GNF B;  4K11 A;  2L89 A;  2YUQ A;  5LJ5 j;  1H8K A;  5LJ5 h;  4FCY A;  1BU1 A;  5KYU B;  5HKC A;  5AYF A;  1VQN A;  2RQW A;  3M0S A;  4J9H A;  2X35 A;  4EMK B;  2AKK A;  2PNI A;  1K0X A;  2ZGW A;  2EJ9 A;  4MML A;  3FC3 A;  3PMT A;  2EQI A;  2NLU A;  4R56 A;  2VC8 A;  3I55 Q;  2V26 A;  3CCS Q;  3PMI A;  2O88 A;  3GIB A;  4E7J A;  3V8J A;  2L0A A;  5KYY A;  5GAN g;  1UFF A;  1E6G A;  3CCS T;  2F5T X;  2E5K A;  4RKU E;  2E65 A;  3GP8 A;  1U1S A;  3CCQ Q;  2Y4Y A;  1LNX A;  1I8F A;  1M3A A;  1XTD A;  3MP6 A;  3WVD B;  1BCM A;  4J83 A;  2XIC A;  2QEX Q;  3OYB A;  2RM4 A;  2HQE A;  2AHJ B;  1U1T A;  3OYD A;  4JS5 A;  2LCL A;  3FLG A;  1HSQ A;  3JCM e;  2D0N A;  4D6W A;  2XU8 A;  3CXC S;  5IAY A;  3EG0 A;  2QEX T;  2AT1 B;  3CCU A;  1I07 A;  4ELZ C;  1NJI U;  4M75 B;  1Y0M A;  3JB9 J;  2O9S A;  3DB3 A;  4MDX A;  2M9U A;  1GRI A;  2XDP A;  2MAM A;  3M56 A;  2NUP A;  2J05 A;  2DNU A;  3OS1 A;  3QXE B;  2QQR A;  2VGN A;  4M7A A;  1FMK A;  4C92 F;  4LDX A;  4KGV B;  2LJ0 A;  1EIF A;  4FT4 A;  4II1 A;  2MPX C;  1X75 C;  3EG9 B;  1QQJ A;  1VQ6 A;  4R55 A;  1KFZ A;  3CD6 Q;  4QVZ A;  1NJI C;  2DTO A;  1ZA2 B;  3SDZ A;  1HD3 A;  2EJF A;  4ZN1 A;  5GJV B;  2DXB A;  1VQL Q;  3EH1 A;  4XU1 A;  2JM8 A;  4F17 A;  5ECA A;  5IXF A;  3CD6 T;  4PJO B;  3EG3 A;  1BBZ A;  3EGU A;  1HK9 A;  1UGP B;  2DKG A;  2BTT A;  1MMA A;  5CK9 A;  4FYY B;  4JS4 A;  1VQL T;  2RNA A;  1BK2 A;  4M7D G;  2L8D A;  4M78 E;  5C6S A;  2HKN A;  2RF0 A;  3BFM A;  5FU6 B;  3D7S B;  1YI2 Q;  4KH1 B;  4M77 G;  2LRQ A;  2ROL A;  3QYH B;  2VAS A;  4OMM A;  2X3W D;  2NUT B;  2YUN A;  1MHN A;  4OML A;  1YI2 T;  1Y96 A;  4N4I A;  3CME Q;  3CPW S;  2DJQ A;  3EFO A;  1GBQ A;  1NZ9 A;  3SD4 A;  4ZGJ B;  2K2V A;  1I81 A;  2LVM A;  3MPU B;  2CUD A;  4M77 A;  3DLL A;  1RAE B;  3JCM W;  4PJJ A;  3CME T;  2P0Q A;  3S6W A;  4BE2 A;  1XNI A;  3OYF A;  3RMQ A;  2RQU A;  1RAH B;  3OYN A;  1KHC A;  2M1H A;  1UTI A;  4GY5 A;  2IPO B;  3I55 A;  1M90 R;  4MMK A;  2J6F A;  4OMQ A;  3BY7 A;  3CCE A;  2KK4 A;  1YP5 A;  3L42 A;  4IUV A;  2CZ1 B;  1D3B B;  3OMC A;  4C0F A;  2E10 A;  2QTX A;  4KGX B;  1TTH B;  1KQ2 A;  4IUT A;  4QVC A;  4Z88 A;  4ESR A;  1SPK A;  4C92 D;  3P8D A;  2P4R A;  2QGF B;  3A98 A;  1OEB A;  2XKO C;  3O8V A;  2R57 A;  1TWB A;  2CS7 A;  2DL4 A;  4ZNX A;  2K3Y A;  4XTV A;  3CC7 Q;  3DKM A;  2ROT A;  3TCJ A; 
#chains in the Genus database with same CATH homology
 2DYB A;  1NEG A;  2F2X A;  2K3B A;  2HBW A;  2GQI A;  4DEX A;  2HDA A;  3SEM A;  2FEI A;  2HEQ A;  2DL5 A;  1WFW A;  2CRE A;  2KRS A;  4OMO A;  1AWW A;  3NMZ C;  1WXT A;  4AG1 C;  1GBR A;  1UJY A;  4HVV A;  1CKB A;  2JXB A;  1OOT A;  1S1N A;  2JS2 A;  2O2O A;  2KRM A;  2DVJ A;  4LUE A;  1JU5 C;  3FJ5 A;  1ZX6 A;  1QKW A;  1UDL A;  1ZLM A;  1ABQ A;  4Y92 A;  4DEY A;  4J9G A;  2CSQ A;  4J9D A;  1UEC A;  2CSI A;  1AZE A;  1WIE A;  1K1Z A;  1AEY A;  1BB9 A;  2D8H A;  1JEG A;  2RQT A;  2GGR A;  2RQV A;  4RTW A;  4J9E A;  4JZ3 A;  4RTX A;  4OMN A;  1PNJ A;  3U23 A;  5I11 A;  2KBT A;  1ARK A;  1YCS B;  4JZ4 A;  5FW9 A;  2OI3 A;  1AZG B;  3VS4 A;  1AWX A;  1YNZ A;  2FG0 A;  1X43 A;  1UE9 A;  5FWC A;  3H41 A;  1ZUU A;  1YN8 A;  2CH4 W;  3KFV A;  3ZL7 C;  4A63 B;  1NEB A;  2EVR A;  5GJW B;  1PRL C;  4AFZ C;  1HJD A;  2DM1 A;  1T0H A;  2LJ1 A;  3UA7 A;  3M0U A;  1W1F A;  1PKS A;  1PKT A;  1GL5 A;  1M3C A;  2A28 A;  3C0C A;  4JJD A;  2YSQ A;  3M0R A;  4CC2 A;  1B3Q A;  1JO8 A;  3M0P A;  2IIM A;  3NPF A;  1VYV A;  1JXM A;  2K9G A;  3ULR B;  2DL8 A;  2CT3 A;  1ZUY A;  2FPF A;  2SEM A;  1ABO A;  2D8J A;  2VKN A;  1B07 A;  3RBB B;  1TUD A;  2EW3 A;  2EKH A;  4RTY A;  2BZY A;  2H8H A;  1VYT A;  2L2P A;  1TUC A;  1QWE A;  1FYN A;  2LP5 A;  1PHT A;  1Z9Q A;  3REA B;  4D8K A;  5I22 A;  3SHW A;  3JV3 A;  2ABL A;  1X2Q A;  2L3P A;  3QWY A;  2KE9 A;  4RTZ A;  1G2B A;  2LNH B;  3VS5 A;  4HVW A;  1W70 A;  2KRN A;  2C0I A;  2JTE A;  2PZ1 A;  1RUW A;  2EYX A;  1X27 A;  1VYU A;  2ED0 A;  1CSK A;  1UGV A;  2KT8 A;  2W0Z A;  5FWB A;  3PVQ A;  2K6D A;  2DRK A;  5IHK A;  1LCK A;  2JMC A;  1QKX A;  1SEM A;  1I1J A;  2O31 A;  1NG2 A;  1U5S A;  3CQT A;  4FSS A;  4Z89 A;  1RI9 A;  2JT4 A;  2EYY A;  2KRO A;  1H3H A;  2RN8 A;  1X6G A;  3PE0 A;  2LJ3 A;  1SHG A;  2GBQ A;  3I35 A;  3EG1 A;  4LNP A;  2I0N A;  2J6K A;  3H0F A;  1I0C A;  2K7A A;  3RNJ A;  2C0T A;  2O9V A;  2J7I A;  2DE0 X;  4JPB W;  1QWF A;  1K76 A;  1AD5 A;  2AK5 A;  1M3B A;  2KYM A;  1AWJ A;  2DMO A;  4GLM A;  1X6B A;  2MCN A;  2MOX A;  1E7O A;  1UHF A;  4IIO A;  1UJ0 A;  2A08 A;  1VA7 A;  1MV0 B;  2KT1 A;  4RTT A;  2JW4 A;  1UG1 A;  1EFN A;  3VS6 A;  4CC7 A;  2OJ2 A;  3VS0 A;  5IXB A;  1ZBJ A;  2F2V A;  1WDX A;  2DBM A;  2HSP A;  2KXD A;  2GTJ A;  1RLP C;  2VWF A;  2EYZ A;  1MUZ A;  2FO0 A;  2KGT A;  2EYW A;  4OMP A;  2SRC A;  4AFU C;  2LMJ A;  2C0O A;  2ED1 A;  3VS3 A;  1J3T A;  1QCF A;  2FPE A;  2DBK A;  2YUP A;  4QT7 A;  5IHI A;  5IH2 A;  2J6O A;  2RMO A;  1UUE A;  4RUG A;  3VS7 A;  2K79 A;  2LZ6 B;  2JS0 A;  1PWT A;  2M51 A;  4K11 A;  2W10 A;  2RQR A;  2YUQ A;  2CDT A;  1OPK A;  1H8K A;  2DL7 A;  2FRW A;  2JMA A;  1WLP B;  4Z8A A;  1NYG A;  1BU1 A;  2FRY A;  4D8D A;  1G83 A;  1U06 A;  2M0Y A;  4RTU A;  1AOJ A;  2HCK A;  2RQW A;  3O5Z A;  4GBQ A;  3M0S A;  4J9H A;  2DX1 A;  2AKK A;  1NYF A;  2F2W A;  2NWM A;  2PNI A;  1K0X A;  2L3S A;  2V1Q A;  2FPD A;  1Z9Z A;  5L23 A;  4AFS C;  1WXB A;  1T0J A;  2GTO A;  1WYX A;  2EQI A;  2YT6 A;  2ENM A;  1SRL A;  2O88 A;  1U3O A;  1E6H A;  4KRT A;  1GFC A;  3VS1 A;  1ZUK A;  2L0A A;  3TSZ A;  1WI7 A;  1UFF A;  2EBP A;  1E6G A;  4JJC A;  3LH5 A;  4J9C A;  2DF6 A;  1M8M A;  2E5K A;  3VRY A;  2B86 A;  2VVK A;  1XOV A;  4M4Z A;  1AWO A;  1JQQ A;  2BZX A;  1GCQ A;  3M0T A;  1M3A A;  4LN2 A;  2DIL A;  2L3Q A;  4AFQ C;  2NUZ A;  1GCP A;  2AZV A;  1SRM A;  1K4U S;  1HSQ A;  4J9F A;  1V1C A;  2D0N A;  2MIO A;  1AVZ C;  2DL3 A;  2RPN A;  2A37 A;  3EG0 A;  1GFD A;  1I07 A;  1X2K A;  2DLP A;  1Y0M A;  2OAW A;  3EG2 A;  2GNC A;  2O9S A;  3R6N A;  1UHC A;  3I5R A;  2KNB B;  1JXO A;  1GRI A;  5EC7 A;  4AG2 C;  2J05 A;  1T3L A;  3REB B;  1KJW A;  2DNU A;  1MV3 A;  2LQW A;  1RLQ C;  1KSW A;  1A0N B;  1FMK A;  1M30 A;  2KYB A;  3H0H A;  1YWO A;  2LJ0 A;  2PTK A;  1SSH A;  1KIK A;  1KFZ A;  1W6X A;  1YWP A;  1HD3 A;  1OPL A;  2BZ8 A;  3IQL A;  5GJV B;  1GCQ C;  2EGE A;  2EGC A;  3THK A;  2JM8 A;  1M27 C;  3M0Q A;  3EHQ A;  4F17 A;  5ECA A;  5IXF A;  3VRZ A;  3EG3 A;  1BBZ A;  3EGU A;  1X69 A;  2YUO A;  4CC3 A;  2BTT A;  1CKA A;  2V1R A;  2ECZ A;  3I5S A;  3TVT A;  2RNA A;  2YDL A;  3EHR A;  1BK2 A;  1WXU A;  2G6F X;  3GBQ A;  3UA6 A;  2RF0 A;  1OV3 A;  3NHN A;  5HCK A;  3PVL A;  2ROL A;  3H0I A;  1WX6 A;  4OMM A;  2X3W D;  1IO6 A;  2YUN A;  3VS2 A;  1NLO C;  4OML A;  1K0S A;  1ZSG A;  2DJQ A;  1GBQ A;  2LQN A;  4JJB A;  2CH4 A;  2ESW A;  4LUD A;  2CUD A;  3I9Q A;  2D1X A;  2KR3 A;  1SHF A;  2AKL A;  4ORZ A;  4HXJ A;  2K2M A;  2RQU A;  4HCK A;  2J06 A;  5IHN A;  1UTI A;  2CT4 A;  2KEA A;  4J9B A;  2LCS A;  2JM9 A;  3UF4 A;  2DA9 A;  4CC4 B;  2CUB A;  1N5Z A;  1QLY A;  3UAT A;  2EGA A;  2J6F A;  4IIM A;  4OMQ A;  2DRM A;  3QWX X;  4X1V A;  1NM7 A;  1WA7 A;  4R0K A;  1TG0 A;  4LE9 A;  1YP5 A;  1H92 A;  2AZS A;  4HVU A;  2QDL A;  4EIK A;  3NGP A;  4F16 A;  2X3X D;  4RTV A;  1Y57 A;  4Z88 A;  3TSW A;  4ESR A;  1PRM C;  1SPK A;  4J9I A;  2XMF A;  4E6R A;  2P4R A;  1K9A A;  2EPD A;  2LX7 A;  1OEB A;  3A98 A;  2KXC A;  2DL4 A;  1T3S A;  4ZNX A;  1NLP C;  4F14 A;  2ROT A;  4WCI A;  2A36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...