2YSQA

Solution structure of the sh3 domain from rho guanine nucleotide exchange factor 9
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
81
structure length
81
Chain Sequence
GSSGSSGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQEDEVEEGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 9
publication title Solution structure of the SH3 domain from Rho guanine nucleotide exchange factor 9
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 4
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ysqA00
1SEMA 2H8HA 4RTVA 2JS0A 4DEXA 2KRNA 1V1CA 4KRTA 2RQUA 2O2OA 4IIMA 1SHFA 1SRMA 4WCIA 2ROLA 2K9GA 4Z88A 3ZL7C 2JW4A 1QCFA 1AWJA 2VKNA 2RPNA 1ZSGA 1VYVA 1KSWA 4RUGA 1UECA 2RQTA 2CUBA 2O31A 4JJBA 4RTWA 1WYXA 1AWOA 1JU5C 2EGEA 4GLMA 4OMMA 5EC7A 1PNJA 2KXDA 1GBQA 4RTUA 4J9GA 2FO0A 1BU1A 2JT4A 3LH5A 1M3AA 1T3LA 4OMOA 3H41A 3VS0A 2RQVA 1E6HA 1UHFA 2BZXA 4R0KA 1SSHA 2OJ2A 1AZEA 2EYZA 3RBBB 4JJCA 2LMJA 4J9EA 4RTXA 3EHRA 2LQNA 3VS4A 1K4US 1T0JA 1X6GA 1M27C 2O9VA 1OOTA 2VVKA 1Y0MA 1QKWA 2KBTA 2O9SA 2BZ8A 4AFUC 4D8KA 1BK2A 2GGRA 2JMCA 3M0SA 2D8HA 1WDXA 3TSWA 2JTEA 1YP5A 1X69A 1RLPC 2D8JA 2YDLA 2K3BA 2DA9A 2ECZA 3M0UA 3UATA 2CH4A 5IXFA 4J9BA 1N5ZA 5FW9A 4F16A 1LCKA 2FPFA 1FYNA 2DRMA 2DL4A 1KFZA 2FRYA 1UE9A 2CH4W 1OEBA 4Z8AA 1BBZA 1NYGA 1HJDA 2EYYA 2ESWA 1JXMA 1WI7A 3FJ5A 2D0NA 1CKAA 1QLYA 1SRLA 2EGAA 1ZUYA 5IHIA 2ABLA 3H0HA 1IO6A 4F14A 2CT3A 2LNHB 3UF4A 3I5RA 1E7OA 1W6XA 2ED0A 1WFWA 2KROA 2GNCA 4HVUA 2J06A 1WXBA 3PVQA 5HCKA 2DF6A 2KYMA 4AFZC 1M8MA 2NUZA 2KR3A 2I0NA 5L23A 2KNBB 2LQWA 1ABOA 2CSQA 1AWWA 3EG2A 2AZVA 4HVWA 3VS1A 3QWYA 3M0QA 5IHNA 1U06A 2J05A 4JPBW 4LN2A 2B86A 3CQTA 4X1VA 3TVTA 3NHNA 3EG1A 2IIMA 1OPKA 2X3XD 2LP5A 2C0OA 4J9IA 4Y92A 2AK5A 1TUDA 1K76A 2YSQA 2EBPA 1X6BA 1YN8A 2EQIA 2EVRA 2D1XA 2RQRA 1A0NB 2KXCA 2PTKA 3NMZC 1AZGB 2DILA 1PKSA 2ED1A 1U3OA 4OMNA 3VS2A 4AG2C 2GTOA 2GTJA 2X3WD 1WX6A 1UG1A 4EIKA 1QWEA 2FRWA 2FG0A 4CC3A 4M4ZA 1PHTA 2EYXA 1HD3A 1Z9QA 1UDLA 1MV3A 1GFDA 1CKBA 2GBQA 3JV3A 1NLPC 1WLPB 2RMOA 4HCKA 2LZ6B 5I22A 2YUQA 3RNJA 1VYTA 2JM8A 2J6OA 1MUZA 3REAB 5I11A 2JS2A 2CT4A 1FMKA 4ESRA 1Z9ZA 2J7IA 3VS6A 2K79A 4OMPA 2AKKA 3THKA 2P4RA 3GBQA 1KJWA 3U23A 2SEMA 2KT1A 1SPKA 3REBB 4OMLA 3TSZA 1AOJA 1I07A 1YCSB 1ZUKA 1WA7A 2KE9A 1M3CA 1GCQC 1S1NA 1GFCA 3QWXX 2L0AA 2VWFA 3C0CA 2DYBA 5GJWB 2LJ3A 1G2BA 2OAWA 5FWCA 1PRMC 1X27A 4JZ4A 2ROTA 3VRYA 1H92A 1OPLA 1WXTA 2CUDA 2M51A 4GBQA 3PVLA 2DL5A 4J9DA 2EPDA 3M0TA 1H3HA 2L2PA 2CDTA 1PRLC 2O88A 4RTTA 2MIOA 5IXBA 4A63B 2KRMA 1YWOA 2AZSA 2DJQA 2A28A 2V1QA 3I9QA 1B07A 3A98A 1GCQA 2OI3A 2EW3A 1YWPA 1PWTA 1Y57A 1UUEA 3SEMA 1AD5A 1U5SA 1ZLMA 2HDAA 2C0IA 3PE0A 2KGTA 1G83A 1UGVA 2F2WA 1GL5A 1UFFA 4RTZA 4CC4B 2DBKA 2AKLA 3VRZA 2FPEA 3H0IA 2L3SA 1ZBJA 2DL3A 2K7AA 1NLOC 2KRSA 3I5SA 2SRCA 2EKHA 4LE9A 2FEIA 1XOVA 2JM9A 4D8DA 4DEYA 2K6DA 1AWXA 1UJ0A 4K11A 1JO8A 2JXBA 1HSQA 2W10A 2PNIA 2A37A 2K2MA 4RTYA 2NWMA 2A36A 3EHQA 3VS7A 3EGUA 1RI9A 2BZYA 1EFNA 2J6KA 4HVVA 5IHKA 2J6FA 1KIKA 1M30A 2HCKA 1I0CA 2JMAA 4QT7A 2DLPA 2E5KA 2ENMA 3NPFA 2A08A 1ZX6A 2YUNA 2YUPA 3M0RA 2GQIA 2LJ0A 2M0YA 1VYUA 1X43A 1QKXA 2FPDA 4JZ3A 2L3QA 3IQLA 4AFSC 2L3PA 2LCSA 2DRKA 1GBRA 1W70A 2HBWA 4JJDA 3R6NA 2F2VA 1RUWA 1NEBA 2V1RA 1SHGA 1JEGA 2G6FX 2DM1A 2YT6A 2RNAA 3SHWA 2XMFA 1X2QA 1AEYA 2DMOA 1JQQA 1T3SA 2MOXA 1GRIA 1WIEA 1H8KA 2LX7A 3H0FA 2RN8A 1YNZA 2BTTA 4FSSA 1NYFA 1JXOA 4IIOA 4CC7A 1X2KA 2W0ZA 4ORZA 3O5ZA 1TUCA 4J9CA 2EYWA 2DL7A 1NM7A 2DBMA 3UA6A 1AVZC 1M3BA 2PZ1A 1ABQA 2DNUA 1T0HA 4F17A 2F2XA 2RF0A 2RQWA 1GCPA 3VS5A 5FWBA 1RLQC 4AG1C 4Z89A 2DE0X 1OV3A 4OMQA 3VS3A 2QDLA 1I1JA 1BB9A 1UHCA 1NG2A 3NGPA 3EG3A 2C0TA 2HSPA 1MV0B 1TG0A 3KFVA 5GJVB 1NEGA 1UTIA 4LUDA 1E6GA 4HXJA 4J9HA 4E6RA 2CSIA 1QWFA 1J3TA 2DX1A 3EG0A 1WXUA 3I35A 5ECAA 1UJYA 3ULRB 2KYBA 2LJ1A 2HEQA 1K0SA 2KT8A 4ZNXA 2CREA 4J9FA 1W1FA 2KEAA 1CSKA 1K1ZA 4LUEA 4CC2A 2EGCA 1PKTA 2YUOA 2DVJA 1VA7A 4AFQC 1ARKA 2MCNA 5IH2A 1B3QA 2DL8A 3M0PA 4LNPA 1ZUUA 1K9AA 1K0XA 3UA7A
chains in the Genus database with same CATH superfamily
2QDYB 2H8HA 2DEUA 4M7AD 2O01E 1V1CA 3JB9H 2RHIA 1YJ9T 2XU8A 4A53A 4WCIA 2ROLA 3M53A 4Z88A 1NJIR 2JW4A 4L5GA 4ANJA 3H6ZA 2WSCE 3OYHA 2EJGA 2LT1A 1G3WA 1ZSGA 2P0QA 5GMKj 2RHZA 1KSWA 1Y7XA 2OTLA 3EAEA 2RQTA 3OB9A 3EH2A 1AWOA 1JU5C 4XTWA 4GLMA 5CR2A 2DTHA 2JNGA 2QGGA 1VQNQ 2K4YA 3G4SQ 2E12A 2FO0A 1YJNT 2DETA 3X26B 4AMCA 5GAOp 2KSSA 1QP3A 1TH7A 4PJMA 4EDUA 2QEXT 4M75E 3H41A 3RIRA 3VS0A 1WQWA 4F7UE 3BFMA 4FU6A 1M9SA 4MZPA 3C94A 1ZSZC 6AT1B 4BY6B 2XD0A 2LMJA 4J9EA 4RTXA 2HL5C 1K4US 1R8OB 1PM3A 1RAEB 4J7IA 1ZBXA 4BE2A 3CCRT 3QZ5B 5LJ3h 2VV5A 1BI2A 5GAOr 2CP3A 4D8KA 1JB0E 1QVPA 3TSWA 3BE3A 3LH0A 4IUPA 4PJOC 1RLPC 3VUBA 4J9BA 1VQ8A 2PVDB 5GAMe 2FPFA 5HK3A 2AIRB 2FRYA 1N27A 1JXMA 1Y07A 2V26A 1CKAA 3M9QA 4DBHA 3S3NA 2ABLA 3M56A 5A0LA 1VQ6A 2RA2A 5I2SA 3UF4A 1KC8C 1W6XA 2PQWA 4M77A 4AT1B 4M78C 3OYGA 2GNCA 1VQPQ 5KYWA 3HFOA 3PVQA 5HCKA 4M7AC 5GAOl 1M8MA 2I0NA 4B9WA 4JRPA 2LQWA 1ABOA 1W4SA 2E70A 1AWWA 3VS1A 2R58A 5IHNA 1U06A 2J05A 2B86A 3C12A 2E65A 3HRUA 1HK9A 1OPKA 4JRQA 2LP5A 2C0OA 1D1CA 1X6BA 2EQIA 2PTKA 3OYFA 1PKSA 2BE7D 2KQWA 3VS2A 3J80E 4PJJA 1OULA 2X3WD 1WX6A 4JUVA 4EIKA 3PNWC 1QWEA 2QTVA 3C4SA 4RMOA 4C92G 3QO3A 3CC7Q 3AHUA 4M4ZA 2EYXA 2COYA 1HD3A 4Y91A 3FC3A 1YITA 5KYYA 1Q86U 4N4IA 5GANf 3CPFA 5FRNA 4O6JA 1NLPC 1WLPB 4HCKA 3F70A 1K8AU 2K5LA 4A54A 2B8AA 3TEEA 2H3JA 2JS2A 1M1KU 5CK9A 3VV0A 4ESRA 3OS2A 2J7IA 3THKA 5GMKi 2A3LA 1XQHA 3TSZA 1X6OA 3OS5A 1KQ2A 1WA7A 5I2MA 4BDZA 2KE9A 4ELZC 1GCQC 2ZPBB 3LGFA 3QWXX 2L0AA 2VWFA 3C0CA 4M77G 1HXDA 5KYYB 5CKEA 3CCEA 2RJCA 5GAOm 4M75F 3CC2Q 2LJ3A 5FWCA 1FX7A 4F7UF 3OW2A 5C0MA 1VQ5T 4JZ4A 4C8QB 4GBQA 3PVLA 5GANd 4J9DA 3CCLT 4RCBA 3OYAA 2E6ZA 4PJOE 4A63B 4V2SA 2AZSA 3GIBA 4R56A 3P8BB 1QVGP 2RI3A 1D0YA 1G5VA 2IPOB 3OQ5A 3HFNA 5CQYA 1WHMA 4EPCA 2HDAA 2C0IA 4HCZA 3EH1A 3HTRA 1W2BA 4II1A 2V8IA 4FT2A 2QA4A 1PC0A 1R77A 1LVKA 4QQ6A 1ZSZB 1VQ9A 5FU7C 2R57A 3VRZA 2FPEA 3H0IA 3OSSC 4C5EA 4M7DA 2DL3A 2DO3A 2K7AA 4E47A 2RI2A 3X24B 4M7AE 3CCMA 4LE9A 3J7AF 1XOVA 3HL8A 2K6DA 4PK4A 1UJ0A 1RAIB 4KH1B 4OB0B 4PKCC 3S6WA 4IUTA 1NJIU 2MI6A 3INZA 3CBMA 1IGUA 2M1HA 3RKXA 2DIQA 3MO8A 5IHKA 5LJ5f 2HCKA 4C5GA 2XICA 1ZX6A 1OX9A 3CC2T 1VYUA 2KDSA 1N9RA 2L3QA 1YHQQ 3IQLA 4L59A 2HQHA 2DRKA 5IN1A 2HBWA 4NL2A 2F2VA 1K9MR 1WJSA 4M78B 2YLCA 1ACMB 1EX4A 1PSFA 5CKDA 2DMOA 1JQQA 4M7AB 1IXDA 1H8KA 3EG9A 2LX7A 1Q7YR 4WF2A 2CGHA 2CZ1B 1NYFA 4ZTFA 1UGSB 4ATOA 1MNDA 4IIOA 2CP5A 2MK5A 2E3IA 2DPPB 2EAYA 4M7DG 3CMAT 1VQOT 5GAN7 1TOVA 1YJWA 1IREB 1M90R 1AVZC 3L2WA 3QHSA 3I55A 1KHIA 3DB4A 1U1TA 2RF0A 3OYEA 1P92A 2CS7A 2F5KA 1BI0A 1LOJA 1OV3A 3CCVQ 5LJ3g 4OMQA 2QQ9A 3VS3A 3WVDB 5KCHA 1I1JA 1F1BB 4M77D 4A4KA 4E7IA 3NGPA 2C0TA 2HSPA 3G71Q 5GJVB 3G6EQ 1UTIA 2Z0WA 4J9HA 2DTIA 2DX1A 4PJOF 1QVGS 1WXUA 4UC4A 4BY6C 3ULRB 1YHQT 2KYBA 3GPLA 1OX8A 1WHGA 2HEQA 1QVFA 2VYTA 4J9FA 3CMET 2KEAA 5GMKm 2COZA 1M1GA 1K1ZA 4CC2A 1MGQA 2DXBA 5IH2A 1B3QA 2DL8A 2HKNA 4DBRA 3ER0A 3N5BB 2FZKB 1LJOA 1IGQA 1SEMA 4RTVA 4M78F 4DBFA 1I81A 1D09B 3MCAB 4FL6A 4IIMA 5GAMd 2OTJA 1SHFA 1SRMA 4PJLA 4OB1B 4BB7A 2X4XA 4M7AF 3GP8A 1KD1R 2O4XA 1QCFA 3EGDA 1ZHIA 1WHKA 1GXIE 1VYVA 2ZZDA 1UECA 2HL3A 2BKDN 4JJBA 4RTWA 3ASKA 1WJQA 2EGEA 3EFRA 5KYUA 4C8QD 4LDWA 2RD1A 5EC7A 1PNJA 2YXYA 1YJ9A 1O9SA 1VQ4T 2DKGA 1M3AA 2E3HA 5FU7B 3MEUA 5LJ5h 4FIBA 1E6HA 4KGZB 1UHFA 2BZXA 3CCVT 3OYCA 2OJ2A 2KK4A 2KAFA 4OVAA 2EYZA 5CKHA 3EGDB 1JJ2P 2CZ7B 4FYYB 3EHRA 3G71T 1T0JA 1YJNA 1OOTA 1MMNA 1Q86C 2KBTA 2O9SA 4QQDA 5KYNA 2QEXA 4JS5A 3CCJT 2HZYA 3I56Q 4JS4A 1K8AC 4JRKA 3OYKA 2GGRA 3M0SA 3MP6A 2E10A 4KT0E 4M77C 4DOWA 2JTMA 1WDXA 1X01A 2PVOB 1KQSP 1X69A 4E7LA 3JCMd 2NLUA 2K3BA 1BKBA 2DA9A 2HMAA 2ZPHB 4EMHA 4F16A 3BY7A 2NYSA 1FYNA 2DRMA 3CCRA 4KBMB 1OI1A 3QPHA 1NZ9A 5GAN6 2WSEE 2CH4W 3M5AA 1HJDA 4GY5A 4FW2A 3Q1JA 2LCLA 1TSFA 3E19A 5D6YA 2EGAA 2QQSA 2JVVA 4FM4B 3H0HA 1IO6A 1YI2Q 4XU1A 4M7DD 5CKFA 2CT3A 4OGCA 3MPUB 5DLQE 3JCMV 1S72T 1KG1A 2VUBA 4BE1A 3EFOA 2J06A 3FEOA 3NTIA 1BI3A 1XNIA 3HSBA 2DF6A 2KYMA 3H9NA 2JUFA 2NUZA 2EQUA 4WTOB 2KNBB 4XTZA 2CSQA 5LJ3j 2FZGB 4HVWA 3QWYA 2DAQA 1ZA1B 3CCUQ 4B9XA 5J3BA 5A0DA 4BUGA 4XK8E 3TVTA 4E7KA 3NHNA 2LT4A 4JJNK 3GF5A 4Y92A 1TUDA 2D1XA 4C8QC 2ZCFB 3CBPA 2Y90A 4C5IA 2F5TX 1KQ1A 1K0XA 1U3OA 2DK3A 2EKOA 1VQMT 1UG1A 3RDVA 4BD3A 2FG0A 1K9MU 1Z9QA 2MYSA 3PIOA 1MV3A 3CC4Q 3RESA 4N4HA 1CKBA 4PFZA 5GAN2 5I22A 2QGFB 1UGPB 1Q7YU 1NJIC 4PJNA 2JM8A 2P0KA 3OSVA 2LNVA 4EMGA 1FMKA 2K79A 2EYQA 2CP6A 3RKWA 1KJWA 3U23A 3R6OA 2C06A 1KHCA 3OW2P 3OS0A 4ELYC 1S1NA 3S3OA 4C92A 1M90U 2DYBA 1NE8A 3A8MB 1TS9A 4C0FA 1JJ2S 1C0MA 5GJWB 3V7RA 1G2BA 3L1AA 1PRMC 2ROTA 3A1PA 1OPLA 1WXTA 3VUZA 5M9OA 4M75A 1VIEA 3M0TA 4M77E 3JB9G 3QDRB 4F7UA 1QP2A 4RTTA 2HD0A 2MIOA 1X75C 1H641 1BI1A 1I5OB 2KRMA 3T9NA 5GAN8 1YWOA 2QASA 1KQSS 3PMIA 3X25B 2OI3A 2EW3A 2FZCB 1V76A 4C92B 1UUEA 1VQ5A 3LGLA 3CCLA 1ZLMA 4D6WA 3PE0A 2M9UA 3ZFJA 2I2LA 1UGVA 3SWNA 2E64A 1Y96A 1UFFA 3META 4B6MA 4CC4B 1Q81R 1RAFB 2XDBA 3L2ZA 1VQNT 2L3SA 3G4ST 3QZ9B 3OY9A 1IRXA 4OGEA 2DIGA 3A8HB 2KRSA 1MMAA 2CKKA 2FEIA 2JM9A 4ZGEB 4D8DA 2W10A 1DJ7B 2KY9A 2NUPA 2DERA 4RCCA 4HA8A 4M77B 8AT1B 1KD1U 2NWMA 1M5Q1 3OYYA 5KYWB 1RI9A 2BZYA 2RK2A 4ZGJB 4CRIA 1OQKA 2J6FA 1KIKA 1M30A 4C8QE 1LPLA 4KGVB 1I4K1 1M1FA 2DD4A 2E5KA 2ENMA 3NPFA 2YUPA 3M0RA 1OZ3A 2LJ0A 1TWBA 2CZ6B 5LJ3e 3NFCA 5CAIA 3KXTA 4AFSC 2LCSA 4A4FA 4M75G 1W70A 4JJDA 4F7UG 1RUWA 2V1RA 1JEGA 2RHUA 2DM1A 2RNAA 4E7HA 1AEYA 4Z02A 3TREA 2F1LA 1YFNA 1N8RR 4EMKA 3MEVA 3OA6A 1WIEA 1K73R 3CC2A 9ATCB 3QYHB 3QKJA 3CCSQ 1IHVA 1YNZA 3V7CA 4TVRA 4HKEA 7AT1B 1YITQ 3DLLA 3AT1B 2E1HA 2X51A 4FSXA 3MEAA 4CC7A 4J5YA 2W0ZA 3GOXA 5HK0A 1VQPT 4QVDA 3O5ZA 3TCJA 3OW2S 3QDFA 3OYIA 3OMGA 1C6VX 1R0CB 3VU3C 5LJ5g 4J8OA 2DL7A 3MHXA 1NM7A 3M57A 2YRCA 3UA6A 1M3BA 1N6AA 1ABQA 2YHTA 1IHWA 2F2XA 1OYXA 2RQWA 4PFPA 3VS5A 2FYKA 1D3BA 2K3XA 5DLOA 1M2OA 4FYXB 2RJDA 3QIIA 3CCEQ 2ATCB 3CMAA 2QDLA 1VQOA 5D6XA 4BI3A 3FIFA 1WNLA 1Q82R 1QVFP 1MV0B 1TG0A 2QI2A 3KFVA 3LYIA 3CC7T 1NEGA 4M77F 4HXJA 4OB2B 2OAUA 1G3SA 1RL2A 3JB9J 4M78E 4R55A 3QG1A 3A8GB 3I35A 5ECAA 5FLXE 1VQ7Q 3JB9D 4XU0A 1D3BB 2P84A 1H3ZA 2X35A 4DBQA 4BE0A 2BIVA 1K0SA 3S3MA 4PJOA 4NOYA 5GANj 4FT4A 4FYVB 2CREA 2ZPIB 1M4ZA 3G1JA 1B34A 3OBYA 2QQRA 3M0PA 1ZUUA 1AT1B 5GAN4 1PD1A 3UA7A 1VQ9Q 3PGGA 3QYGB 3CCST 1YHQA 2KVQG 3JCMJ 4M7DB 2RQUA 2O2OA 3PFSA 1QCNA 4C0GA 2K9GA 3CMEA 3CXCP 1AWJA 2VKNA 3L2RA 2KI7A 2VXFA 4A4HA 3CCMQ 1FXXA 2DTOA 1RAHB 4RUGA 3SD4A 3KBGA 2CUBA 2O31A 2GF7A 3A8LB 2ZGWA 4N4GA 1GBQA 4RTUA 2XIDA 4J9GA 3QJYA 3CPWP 3GNFB 3OYDA 5GMKl 4C8QF 3CCQQ 1T3LA 1QQJA 1ZA2B 3FJPA 3JCMW 2RM4A 3PMTA 3HRSA 2ZPEB 4C92D 3RBBB 3MP8A 4JJCA 1NPRA 1V29B 3BW1A 5GANh 5J39A 2LQNA 3VS4A 5KYXA 1K9MC 1M27C 2O9VA 1Y0MA 1VQ4A 1QKWA 3RUXA 2BZ8A 1M2VA 1XTDA 2K5FA 1VQ7T 3CCVA 3VYHB 2JMCA 1Q7YC 2HBPA 4MMKA 2EQJA 4PJOG 3EG9B 1YIJQ 3LWHA 2D8HA 2DXCA 2ECZA 3D7SB 3G71A 4J6WA 1WHHA 5FW9A 4KUIA 4XAXB 2Y4YA 1KFZA 4O5VA 1OEBA 2K3YA 1BBZA 3CCJA 5GAMf 4IUUA 5D6WA 1M90C 4FW1A 1SRLA 1M2VB 1ZUYA 1VQKQ 1YJWQ 2CYZB 5LJ5j 3C95A 4KH0B 3VKIA 3I55Q 4F14A 2LNHB 3FRNA 3I5RA 1E7OA 1TUGB 1WFWA 4M7AG 3LX7A 3VJPA 2KR3A 1QVFS 4OB3B 1QVGA 4XTXA 1PD0A 2V8JA 5KH6A 3VYGA 2AZVA 4BI8B 3M0QA 3CCQT 3HHTB 2P0PA 1VQLQ 3CQTA 3M4YA 1S72A 2JTFA 3OYNA 2AK5A 4A4GA 1MHNA 2DEQA 4ZN1A 5CKBA 1B7TA 2KXCA 3JCMP 1IB8A 2RK1A 4OMNA 2GTOA 2FVUA 2G3RA 3ZEHA 2RJEA 5GANe 4CC3A 1PHTA 2QQBA 3JCMf 4C92C 2NUTA 4DA4A 2GFUA 3QUIA 2VGMA 1YIJT 1VUBA 3CXCS 2GBQA 1N8RU 5DM7R 2A7YA 3JV3A 2RMOA 4ME7A 1K73U 4IKFA 3EGXA 2RHXA 2YUQA 1WGSA 4XU3A 3UPUA 3RNJA 1KD1C 5CCAA 2OTJQ 2J6OA 5KE2A 1MUZA 5I11A 2CT4A 2MF2A 2O4XB 3M54A 1VQMA 4J83A 1Z9ZA 2M02A 5FU6B 3HP9A 2P4RA 3V8LA 4ZGDB 2COWA 2YLBA 4QQGA 4OMLA 3REBB 3G6ET 3CPWS 1I07A 4NS5A 1ZUKA 1VQKT 5KYUB 1M3CA 4Q5WA 1GFCA 1M1KR 4N0AA 3DB3A 2OAWA 2KMTA 3SWNC 1X27A 2HKQB 3NTKA 1WHJA 2LRQA 2CUDA 2M51A 5A2QE 2DL5A 3CD6Q 1WZOA 2L2PA 4C0DC 1RADB 3KUFA 1PRLC 2O88A 5IXBA 5LJ3d 1UGRB 1YJNQ 1WHLA 2QXFA 2A28A 2YRDA 2V1QA 1QW1A 1YWPA 4OMFB 1PWTA 1AD5A 1UGQB 2LQ8A 1TU0B 2MAMA 1OU9A 2F2WA 5L8RE 1GL5A 2PU9B 4PJOD 4BACA 5I21A 2VC8A 4RTZA 2DBKA 5GAN3 2AKLA 3L2UA 1LNXA 1BIBA 3CCRQ 1ZBJA 2ZAEA 3SDZA 5AT1B 4MDXA 3GLXA 1BCOA 3V8KA 1NLOC 5GAMh 4J7FA 3I5SA 5FROA 3JAME 3M55A 3OYMA 4FCYA 2CP2A 3DKMA 5LL6S 3WVEB 4YTLA 4DEYA 1G3YA 1JO8A 2JXBA 2QK0A 2X9HA 2PNIA 2A37A 2K2MA 2DD5A 4MZMA 5LJ5e 2RJFA 3EFOB 1VQNA 3G4SA 3VS7A 3FLGA 3BDLA 3EGUA 5GAOq 1D1BA 1EFNA 2J6KA 4HVVA 1U1SA 4QT7A 1I0CA 3MP1A 1N9SA 4CI0C 2VGNA 3I56T 1M8VA 4KUDK 3QSUA 2GQIA 3TU4K 2M0YA 2XHCA 4E7ZA 1JBMA 4ZTJA 1X43A 1QKXA 2FPDA 4MZTA 4JLGA 2L3PA 2MWOA 3CD6T 1BIAA 1FMWA 4C92E 1UEBA 1R0BG 3MEWA 1NPPA 2H3EB 1RABB 2VASA 1G3TA 1X2QA 3WXMB 2OTLQ 1D0XA 2K57A 1T3SA 2MOXA 3H0FA 3QXEB 2RN8A 1WQ7A 1YI2T 2MWPA 2AHJB 4FSSA 2XG8D 3JCMh 3JCMQ 1JXOA 1SG5A 1TUCA 1EZZB 4J6YA 2DVEA 2EYWA 5IT9E 3E1SA 4XTYA 4M7DC 4BI4A 3CCUT 1JJ2A 2PZ1A 3HPWA 2DNUA 4F17A 2CP0A 2VB6A 1I8FA 1GCPA 1PSEA 1W2BP 5GANg 1KC8R 2RO0A 2DE0X 4NL3A 1VQPA 4DQ2A 4X9DA 4LD9K 5GMKh 1BB9A 2X4WA 2XI9A 1NG2A 3L2VA 4MMLA 1KQSA 1VQ8Q 1HYOA 5HY6A 3ZBDA 4M75B 1E6GA 3X28B 2CSIA 1QWFA 4F7UB 3L2QA 1J3TA 3CC4T 3EG0A 2XKOC 2DFUA 4JLIA 4XQ3A 2RB6A 4LDYA 3A8OB 2PUOB 4PLLA 3JB9F 4LDVA 1VQ5Q 1VQ6Q 2ZPGB 2AT1B 3CC7A 4LUEA 2EGCA 3RR6A 4AFQC 2DVJA 1VA7A 3CCLQ 1I5LA 2EQKA 2OTLT 1Q81C 3SWNB 1Y96B 3M59A 2RI5A 2JS0A 4DEXA 2KRNA 4KRTA 3H8ZA 5AYFA 1EIFA 4C0DB 2YRVA 3ZL7C 2JZ2A 2RPNA 4HT9A 3SB2A 2D6FA 4X34A 3DLMA 1FMVA 2E5QA 3CEYA 3JCMe 3E9GA 1WYXA 2GQVA 3EFSA 2NUPB 4JDSA 4OMMA 3CCSA 2FB7A 4QKUA 2KXDA 2K2VA 2MPXC 1BU1A 2JT4A 4HCBA 3LH5A 3ME9A 4OMOA 2RQVA 5KE3A 2HSEB 4PFOA 4R0KA 1SSHA 2JN0A 1AZEA 3G7ZA 4C8QA 2LX9A 3OYLA 2YWWA 4E7SA 4J6XA 5FRMA 1VQ8T 4C92F 1X6GA 2VXEA 3SFMA 5EG2A 2VVKA 5GMKe 3UT1A 3UWNA 3OMCA 4MDWA 2ZPFB 1N8RC 2PVGB 3PIPA 4QVZA 1QMCA 1K73C 4AFUC 4EMKB 1BK2A 1IZ6A 3JCMb 5CVIA 3E9FA 2JTEA 1YP5A 4IURA 5IAYA 2D8JA 2YDLA 3M0UA 3UATA 3JB9I 4M7DE 2CH4A 5IXFA 4RG2A 1VQ6T 1N5ZA 1UB4A 4LD6A 1AHJB 1LCKA 2EQMA 1ZSZA 1VOMA 1Y71A 2DL4A 1C1AA 8ATCB 1UE9A 4LXCA 1MNEA 3QJ6A 1MMDA 1NYGA 5CQXA 4Z8AA 2JOYA 2EYYA 3LLRA 3RMQA 2ESWA 1VQ7A 5GAOn 1WI7A 3FJ5A 2D0NA 2A0FB 2DZCA 1W2BS 4OP0A 3LW5E 1QLYA 2E41A 1BYMA 5IHIA 2LC4A 2R5AA 4L6V5 2XK0A 4E2FB 4KULA 2HNIA 5DY9A 4RG8A 2ED0A 5FU6C 2LVMA 2KROA 3RERA 2EIFA 4HVUA 1WXBA 3MKDA 4AFZC 2Y4XA 5L23A 4P5NA 4LDXA 3O8VA 3CMAQ 4KGXB 3L42A 1VQOQ 1Q82C 3EG2A 1D0ZA 4JPBW 4LN2A 2QA4Q 4DOVA 4FYWB 4X1VA 1O75A 3EG1A 2IIMA 4PNOA 4C8QG 2X3XD 2F69A 4J9IA 1YITT 1K76A 2YSQA 3HRTA 2EBPA 1YN8A 2EVRA 2R5MA 2RQRA 1SF9A 1A0NB 2HQEA 3NMZC 1AZGB 2DILA 2L3RA 4PLIA 4M78A 3OBWA 2ED1A 2X4JA 4PJOB 4F04B 4AG2C 2GTJA 1YCYA 5GAMg 3CCQA 4M7AA 4PL6A 2FRWA 5CIUA 3NTHA 1B34B 4N0AC 1RAAB 1UDLA 1BCMA 2EJ9A 1GFDA 2EWNA 1G8XA 2MMPA 2LZ6B 2M0OA 2XDDA 1SSFA 1WJRA 3LWIA 1VYTA 3CCET 2QG9B 5D7UA 3REAB 2QAZA 4GLKA 3CMEQ 3VS6A 4OMPA 4XTUA 2AKKA 4IUQA 2D9TA 3GBQA 1NBEB 2SEMA 2KT1A 3OYBA 1SPKA 4Y28E 1AOJA 1YCSB 1YIJA 2JJ9A 5J26A 3JSCA 4XU2A 4M75D 3CBOA 4RKUE 3X20B 5LJ5d 4HT8A 2WSFE 2K5IA 1TTHB 1KC8U 1YBYA 2RHYA 3VRYA 1H92A 3UDCA 3G6EA 2IVWA 2EPDA 2V8KA 2QYZA 4JRIA 1VQKA 2DZ9A 4BDYA 1H3HA 2CDTA 3TQ7P 1WPYA 5KYXB 3JCMg 2QA4T 2WACA 1VQ9T 4XTVA 1QCOA 1VQ4Q 2DJQA 1Q81U 3I9QA 1JRIA 1B07A 3A98A 3M4GA 1GCQA 4VUBA 3V8JA 3FDRA 1Y57A 4M78G 3SEMA 1U5SA 3CCMT 3MJXA 4LDUA 2EJFA 4M7DF 2KGTA 1G83A 1VQLA 5A0GA 2BUDA 3M58A 2PUKB 2GCXA 3CCJQ 2M16A 1OU8A 2GFAA 4C0ZA 2SRCA 3JCMc 2EKHA 1U8RA 2DJZA 1AWXA 2DXUA 1VIFA 3RKYA 4K11A 2CP7A 1HSQA 3OS1A 4RTYA 1MMGA 3HKSA 4A4EA 2A36A 3EHQA 1D1AA 3JCMX 2HQXA 3E2UA 1XJWB 2JMAA 2LTOA 1RACB 1OZ2A 2DLPA 2A08A 2CZ0B 2YUNA 3GNGA 2D0QB 3URGA 1PG5B 4JZ3A 1Q95G 2FHDA 3P8DA 1S72Q 1RI0A 2XDPA 5KCOA 1GBRA 3R6NA 5LJ3f 1NEBA 1PCXA 3V7SA 1SHGA 4M75C 2DYIA 2G6FX 3QBYA 2YT6A 3SHWA 3I56A 1Q86R 3CXCA 2RH2A 2XMFA 2LQKA 1GRIA 3P8HA 3A5ZB 1K8AR 3OYJA 3PTAA 1YJWT 5GAMj 3I55T 2BTTA 2NUTB 1YJ9Q 1SKUB 2DXTA 3CD6A 2L8DA 2EFIA 1X2KA 4ORZA 2QQAA 3EGXB 3CPWA 4J9CA 3J81E 4C5HA 1VQMQ 2HAXA 2DBMA 1YI2A 1VQLT 3BDUA 1T0HA 2OX7A 1FWZA 5CO7A 2LCCA 1Q82U 2P4TA 5FWBA 1RLQC 4AG1C 1M1KC 4Z89A 5HKCA 5C6SA 2QEXQ 2L89A 2X4YA 4X9CA 3FB9A 4QW2A 1KK7A 1UHCA 3EG3A 3CCUA 3JRZA 4LUDA 4OF1A 2BE9B 2QTXA 1ZQ1A 1RAGB 4E6RA 4QVCA 2IG0A 3PT9A 4E7JA 1UJYA 2LDMA 2E4HA 2LJ1A 5GAN5 4HCCA 2OTJT 2KT8A 4ZNXA 2E6NA 3RMSA 1W1FA 4ZN3A 2FL7A 1CSKA 1PKTA 2YUOA 1TXQA 1ARKA 2L5QA 2MCNA 4LNPA 4M78D 1K9AA 4IUVA 4EMKC 3CC4A
chains in the Genus database with same CATH topology
1SEMA 2H8HA 4RTVA 2JS0A 4DEXA 2KRNA 1V1CA 4KRTA 2RQUA 2O2OA 4IIMA 1SHFA 1SRMA 4WCIA 2ROLA 2K9GA 4Z88A 3ZL7C 2JW4A 1QCFA 1AWJA 2VKNA 2RPNA 1ZSGA 1VYVA 1KSWA 4RUGA 1UECA 2RQTA 2CUBA 2O31A 4JJBA 4RTWA 1WYXA 1AWOA 1JU5C 2EGEA 4GLMA 4OMMA 5EC7A 1PNJA 2KXDA 1GBQA 4RTUA 4J9GA 2FO0A 1BU1A 2JT4A 3LH5A 1M3AA 1T3LA 4OMOA 3H41A 3VS0A 2RQVA 1E6HA 1UHFA 2BZXA 4R0KA 1SSHA 2OJ2A 1AZEA 2EYZA 3RBBB 4JJCA 2LMJA 4J9EA 4RTXA 3EHRA 2LQNA 3VS4A 1K4US 1T0JA 1X6GA 1M27C 2O9VA 1OOTA 2VVKA 1Y0MA 1QKWA 2KBTA 2O9SA 2BZ8A 4AFUC 4D8KA 1BK2A 2GGRA 2JMCA 3M0SA 2D8HA 1WDXA 3TSWA 2JTEA 1YP5A 1X69A 1RLPC 2D8JA 2YDLA 2K3BA 2DA9A 2ECZA 3M0UA 3UATA 2CH4A 5IXFA 4J9BA 1N5ZA 5FW9A 4F16A 1LCKA 2FPFA 1FYNA 2DRMA 2DL4A 1KFZA 2FRYA 1UE9A 2CH4W 1OEBA 4Z8AA 1BBZA 1NYGA 1HJDA 2EYYA 2ESWA 1JXMA 1WI7A 3FJ5A 2D0NA 1CKAA 1QLYA 1SRLA 2EGAA 1ZUYA 5IHIA 2ABLA 3H0HA 1IO6A 4F14A 2CT3A 2LNHB 3UF4A 3I5RA 1E7OA 1W6XA 2ED0A 1WFWA 2KROA 2GNCA 4HVUA 2J06A 1WXBA 3PVQA 5HCKA 2DF6A 2KYMA 4AFZC 1M8MA 2NUZA 2KR3A 2I0NA 5L23A 2KNBB 2LQWA 1ABOA 2CSQA 1AWWA 3EG2A 2AZVA 4HVWA 3VS1A 3QWYA 3M0QA 5IHNA 1U06A 2J05A 4JPBW 4LN2A 2B86A 3CQTA 4X1VA 3TVTA 3NHNA 3EG1A 2IIMA 1OPKA 2X3XD 2LP5A 2C0OA 4J9IA 4Y92A 2AK5A 1TUDA 1K76A 2YSQA 2EBPA 1X6BA 1YN8A 2EQIA 2EVRA 2D1XA 2RQRA 1A0NB 2KXCA 2PTKA 3NMZC 1AZGB 2DILA 1PKSA 2ED1A 1U3OA 4OMNA 3VS2A 4AG2C 2GTOA 2GTJA 2X3WD 1WX6A 1UG1A 4EIKA 1QWEA 2FRWA 2FG0A 4CC3A 4M4ZA 1PHTA 2EYXA 1HD3A 1Z9QA 1UDLA 1MV3A 1GFDA 1CKBA 2GBQA 3JV3A 1NLPC 1WLPB 2RMOA 4HCKA 2LZ6B 5I22A 2YUQA 3RNJA 1VYTA 2JM8A 2J6OA 1MUZA 3REAB 5I11A 2JS2A 2CT4A 1FMKA 4ESRA 1Z9ZA 2J7IA 3VS6A 2K79A 4OMPA 2AKKA 3THKA 2P4RA 3GBQA 1KJWA 3U23A 2SEMA 2KT1A 1SPKA 3REBB 4OMLA 3TSZA 1AOJA 1I07A 1YCSB 1ZUKA 1WA7A 2KE9A 1M3CA 1GCQC 1S1NA 1GFCA 3QWXX 2L0AA 2VWFA 3C0CA 2DYBA 5GJWB 2LJ3A 1G2BA 2OAWA 5FWCA 1PRMC 1X27A 4JZ4A 2ROTA 3VRYA 1H92A 1OPLA 1WXTA 2CUDA 2M51A 4GBQA 3PVLA 2DL5A 4J9DA 2EPDA 3M0TA 1H3HA 2L2PA 2CDTA 1PRLC 2O88A 4RTTA 2MIOA 5IXBA 4A63B 2KRMA 1YWOA 2AZSA 2DJQA 2A28A 2V1QA 3I9QA 1B07A 3A98A 1GCQA 2OI3A 2EW3A 1YWPA 1PWTA 1Y57A 1UUEA 3SEMA 1AD5A 1U5SA 1ZLMA 2HDAA 2C0IA 3PE0A 2KGTA 1G83A 1UGVA 2F2WA 1GL5A 1UFFA 4RTZA 4CC4B 2DBKA 2AKLA 3VRZA 2FPEA 3H0IA 2L3SA 1ZBJA 2DL3A 2K7AA 1NLOC 2KRSA 3I5SA 2SRCA 2EKHA 4LE9A 2FEIA 1XOVA 2JM9A 4D8DA 4DEYA 2K6DA 1AWXA 1UJ0A 4K11A 1JO8A 2JXBA 1HSQA 2W10A 2PNIA 2A37A 2K2MA 4RTYA 2NWMA 2A36A 3EHQA 3VS7A 3EGUA 1RI9A 2BZYA 1EFNA 2J6KA 4HVVA 5IHKA 2J6FA 1KIKA 1M30A 2HCKA 1I0CA 2JMAA 4QT7A 2DLPA 2E5KA 2ENMA 3NPFA 2A08A 1ZX6A 2YUNA 2YUPA 3M0RA 2GQIA 2LJ0A 2M0YA 1VYUA 1X43A 1QKXA 2FPDA 4JZ3A 2L3QA 3IQLA 4AFSC 2L3PA 2LCSA 2DRKA 1GBRA 1W70A 2HBWA 4JJDA 3R6NA 2F2VA 1RUWA 1NEBA 2V1RA 1SHGA 1JEGA 2G6FX 2DM1A 2YT6A 2RNAA 3SHWA 2XMFA 1X2QA 1AEYA 2DMOA 1JQQA 1T3SA 2MOXA 1GRIA 1WIEA 1H8KA 2LX7A 3H0FA 2RN8A 1YNZA 2BTTA 4FSSA 1NYFA 1JXOA 4IIOA 4CC7A 1X2KA 2W0ZA 4ORZA 3O5ZA 1TUCA 4J9CA 2EYWA 2DL7A 1NM7A 2DBMA 3UA6A 1AVZC 1M3BA 2PZ1A 1ABQA 2DNUA 1T0HA 4F17A 2F2XA 2RF0A 2RQWA 1GCPA 3VS5A 5FWBA 1RLQC 4AG1C 4Z89A 2DE0X 1OV3A 4OMQA 3VS3A 2QDLA 1I1JA 1BB9A 1UHCA 1NG2A 3NGPA 3EG3A 2C0TA 2HSPA 1MV0B 1TG0A 3KFVA 5GJVB 1NEGA 1UTIA 4LUDA 1E6GA 4HXJA 4J9HA 4E6RA 2CSIA 1QWFA 1J3TA 2DX1A 3EG0A 1WXUA 3I35A 5ECAA 1UJYA 3ULRB 2KYBA 2LJ1A 2HEQA 1K0SA 2KT8A 4ZNXA 2CREA 4J9FA 1W1FA 2KEAA 1CSKA 1K1ZA 4LUEA 4CC2A 2EGCA 1PKTA 2YUOA 2DVJA 1VA7A 4AFQC 1ARKA 2MCNA 5IH2A 1B3QA 2DL8A 3M0PA 4LNPA 1ZUUA 1K9AA 1K0XA 3UA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SEM A;  2H8H A;  4RTV A;  2JS0 A;  4DEX A;  2KRN A;  1V1C A;  4KRT A;  2RQU A;  2O2O A;  4IIM A;  1SHF A;  1SRM A;  4WCI A;  2ROL A;  2K9G A;  4Z88 A;  3ZL7 C;  2JW4 A;  1QCF A;  1AWJ A;  2VKN A;  2RPN A;  1ZSG A;  1VYV A;  1KSW A;  4RUG A;  1UEC A;  2RQT A;  2CUB A;  2O31 A;  4JJB A;  4RTW A;  1WYX A;  1AWO A;  1JU5 C;  2EGE A;  4GLM A;  4OMM A;  5EC7 A;  1PNJ A;  2KXD A;  1GBQ A;  4RTU A;  4J9G A;  2FO0 A;  1BU1 A;  2JT4 A;  3LH5 A;  1M3A A;  1T3L A;  4OMO A;  3H41 A;  3VS0 A;  2RQV A;  1E6H A;  1UHF A;  2BZX A;  4R0K A;  1SSH A;  2OJ2 A;  1AZE A;  2EYZ A;  3RBB B;  4JJC A;  2LMJ A;  4J9E A;  4RTX A;  3EHR A;  2LQN A;  3VS4 A;  1K4U S;  1T0J A;  1X6G A;  1M27 C;  2O9V A;  1OOT A;  2VVK A;  1Y0M A;  1QKW A;  2KBT A;  2O9S A;  2BZ8 A;  4AFU C;  4D8K A;  1BK2 A;  2GGR A;  2JMC A;  3M0S A;  2D8H A;  1WDX A;  3TSW A;  2JTE A;  1YP5 A;  1X69 A;  1RLP C;  2D8J A;  2YDL A;  2K3B A;  2DA9 A;  2ECZ A;  3M0U A;  3UAT A;  2CH4 A;  5IXF A;  4J9B A;  1N5Z A;  5FW9 A;  4F16 A;  1LCK A;  2FPF A;  1FYN A;  2DRM A;  2DL4 A;  1KFZ A;  2FRY A;  1UE9 A;  2CH4 W;  1OEB A;  4Z8A A;  1BBZ A;  1NYG A;  1HJD A;  2EYY A;  2ESW A;  1JXM A;  1WI7 A;  3FJ5 A;  2D0N A;  1CKA A;  1QLY A;  1SRL A;  2EGA A;  1ZUY A;  5IHI A;  2ABL A;  3H0H A;  1IO6 A;  4F14 A;  2CT3 A;  2LNH B;  3UF4 A;  3I5R A;  1E7O A;  1W6X A;  2ED0 A;  1WFW A;  2KRO A;  2GNC A;  4HVU A;  2J06 A;  1WXB A;  3PVQ A;  5HCK A;  2DF6 A;  2KYM A;  4AFZ C;  1M8M A;  2NUZ A;  2KR3 A;  2I0N A;  5L23 A;  2KNB B;  2LQW A;  1ABO A;  2CSQ A;  1AWW A;  3EG2 A;  2AZV A;  4HVW A;  3VS1 A;  3QWY A;  3M0Q A;  5IHN A;  1U06 A;  2J05 A;  4JPB W;  4LN2 A;  2B86 A;  3CQT A;  4X1V A;  3TVT A;  3NHN A;  3EG1 A;  2IIM A;  1OPK A;  2X3X D;  2LP5 A;  2C0O A;  4J9I A;  4Y92 A;  2AK5 A;  1TUD A;  1K76 A;  2YSQ A;  2EBP A;  1X6B A;  1YN8 A;  2EQI A;  2EVR A;  2D1X A;  2RQR A;  1A0N B;  2KXC A;  2PTK A;  3NMZ C;  1AZG B;  2DIL A;  1PKS A;  2ED1 A;  1U3O A;  4OMN A;  3VS2 A;  4AG2 C;  2GTO A;  2GTJ A;  2X3W D;  1WX6 A;  1UG1 A;  4EIK A;  1QWE A;  2FRW A;  2FG0 A;  4CC3 A;  4M4Z A;  1PHT A;  2EYX A;  1HD3 A;  1Z9Q A;  1UDL A;  1MV3 A;  1GFD A;  1CKB A;  2GBQ A;  3JV3 A;  1NLP C;  1WLP B;  2RMO A;  4HCK A;  2LZ6 B;  5I22 A;  2YUQ A;  3RNJ A;  1VYT A;  2JM8 A;  2J6O A;  1MUZ A;  3REA B;  5I11 A;  2JS2 A;  2CT4 A;  1FMK A;  4ESR A;  1Z9Z A;  2J7I A;  3VS6 A;  2K79 A;  4OMP A;  2AKK A;  3THK A;  2P4R A;  3GBQ A;  1KJW A;  3U23 A;  2SEM A;  2KT1 A;  1SPK A;  3REB B;  4OML A;  3TSZ A;  1AOJ A;  1I07 A;  1YCS B;  1ZUK A;  1WA7 A;  2KE9 A;  1M3C A;  1GCQ C;  1S1N A;  1GFC A;  3QWX X;  2L0A A;  2VWF A;  3C0C A;  2DYB A;  5GJW B;  2LJ3 A;  1G2B A;  2OAW A;  5FWC A;  1PRM C;  1X27 A;  4JZ4 A;  2ROT A;  3VRY A;  1H92 A;  1OPL A;  1WXT A;  2CUD A;  2M51 A;  4GBQ A;  3PVL A;  2DL5 A;  4J9D A;  2EPD A;  3M0T A;  1H3H A;  2L2P A;  2CDT A;  1PRL C;  2O88 A;  4RTT A;  2MIO A;  5IXB A;  4A63 B;  2KRM A;  1YWO A;  2AZS A;  2DJQ A;  2A28 A;  2V1Q A;  3I9Q A;  1B07 A;  3A98 A;  1GCQ A;  2OI3 A;  2EW3 A;  1YWP A;  1PWT A;  1Y57 A;  1UUE A;  3SEM A;  1AD5 A;  1U5S A;  1ZLM A;  2HDA A;  2C0I A;  3PE0 A;  2KGT A;  1G83 A;  1UGV A;  2F2W A;  1GL5 A;  1UFF A;  4RTZ A;  4CC4 B;  2DBK A;  2AKL A;  3VRZ A;  2FPE A;  3H0I A;  2L3S A;  1ZBJ A;  2DL3 A;  2K7A A;  1NLO C;  2KRS A;  3I5S A;  2SRC A;  2EKH A;  4LE9 A;  2FEI A;  1XOV A;  2JM9 A;  4D8D A;  4DEY A;  2K6D A;  1AWX A;  1UJ0 A;  4K11 A;  1JO8 A;  2JXB A;  1HSQ A;  2W10 A;  2PNI A;  2A37 A;  2K2M A;  4RTY A;  2NWM A;  2A36 A;  3EHQ A;  3VS7 A;  3EGU A;  1RI9 A;  2BZY A;  1EFN A;  2J6K A;  4HVV A;  5IHK A;  2J6F A;  1KIK A;  1M30 A;  2HCK A;  1I0C A;  2JMA A;  4QT7 A;  2DLP A;  2E5K A;  2ENM A;  3NPF A;  2A08 A;  1ZX6 A;  2YUN A;  2YUP A;  3M0R A;  2GQI A;  2LJ0 A;  2M0Y A;  1VYU A;  1X43 A;  1QKX A;  2FPD A;  4JZ3 A;  2L3Q A;  3IQL A;  4AFS C;  2L3P A;  2LCS A;  2DRK A;  1GBR A;  1W70 A;  2HBW A;  4JJD A;  3R6N A;  2F2V A;  1RUW A;  1NEB A;  2V1R A;  1SHG A;  1JEG A;  2G6F X;  2DM1 A;  2YT6 A;  2RNA A;  3SHW A;  2XMF A;  1X2Q A;  1AEY A;  2DMO A;  1JQQ A;  1T3S A;  2MOX A;  1GRI A;  1WIE A;  1H8K A;  2LX7 A;  3H0F A;  2RN8 A;  1YNZ A;  2BTT A;  4FSS A;  1NYF A;  1JXO A;  4IIO A;  4CC7 A;  1X2K A;  2W0Z A;  4ORZ A;  3O5Z A;  1TUC A;  4J9C A;  2EYW A;  2DL7 A;  1NM7 A;  2DBM A;  3UA6 A;  1AVZ C;  1M3B A;  2PZ1 A;  1ABQ A;  2DNU A;  1T0H A;  4F17 A;  2F2X A;  2RF0 A;  2RQW A;  1GCP A;  3VS5 A;  5FWB A;  1RLQ C;  4AG1 C;  4Z89 A;  2DE0 X;  1OV3 A;  4OMQ A;  3VS3 A;  2QDL A;  1I1J A;  1BB9 A;  1UHC A;  1NG2 A;  3NGP A;  3EG3 A;  2C0T A;  2HSP A;  1MV0 B;  1TG0 A;  3KFV A;  5GJV B;  1NEG A;  1UTI A;  4LUD A;  1E6G A;  4HXJ A;  4J9H A;  4E6R A;  2CSI A;  1QWF A;  1J3T A;  2DX1 A;  3EG0 A;  1WXU A;  3I35 A;  5ECA A;  1UJY A;  3ULR B;  2KYB A;  2LJ1 A;  2HEQ A;  1K0S A;  2KT8 A;  4ZNX A;  2CRE A;  4J9F A;  1W1F A;  2KEA A;  1CSK A;  1K1Z A;  4LUE A;  4CC2 A;  2EGC A;  1PKT A;  2YUO A;  2DVJ A;  1VA7 A;  4AFQ C;  1ARK A;  2MCN A;  5IH2 A;  1B3Q A;  2DL8 A;  3M0P A;  4LNP A;  1ZUU A;  1K9A A;  1K0X A;  3UA7 A; 
#chains in the Genus database with same CATH topology
 2QDY B;  2H8H A;  2DEU A;  4M7A D;  2O01 E;  1V1C A;  3JB9 H;  2RHI A;  1YJ9 T;  2XU8 A;  4A53 A;  4WCI A;  2ROL A;  3M53 A;  4Z88 A;  1NJI R;  2JW4 A;  4L5G A;  4ANJ A;  3H6Z A;  2WSC E;  3OYH A;  2EJG A;  2LT1 A;  1G3W A;  1ZSG A;  2P0Q A;  5GMK j;  2RHZ A;  1KSW A;  1Y7X A;  2OTL A;  3EAE A;  2RQT A;  3OB9 A;  3EH2 A;  1AWO A;  1JU5 C;  4XTW A;  4GLM A;  5CR2 A;  2DTH A;  2JNG A;  2QGG A;  1VQN Q;  2K4Y A;  3G4S Q;  2E12 A;  2FO0 A;  1YJN T;  2DET A;  3X26 B;  4AMC A;  5GAO p;  2KSS A;  1QP3 A;  1TH7 A;  4PJM A;  4EDU A;  2QEX T;  4M75 E;  3H41 A;  3RIR A;  3VS0 A;  1WQW A;  4F7U E;  3BFM A;  4FU6 A;  1M9S A;  4MZP A;  3C94 A;  1ZSZ C;  6AT1 B;  4BY6 B;  2XD0 A;  2LMJ A;  4J9E A;  4RTX A;  2HL5 C;  1K4U S;  1R8O B;  1PM3 A;  1RAE B;  4J7I A;  1ZBX A;  4BE2 A;  3CCR T;  3QZ5 B;  5LJ3 h;  2VV5 A;  1BI2 A;  5GAO r;  2CP3 A;  4D8K A;  1JB0 E;  1QVP A;  3TSW A;  3BE3 A;  3LH0 A;  4IUP A;  4PJO C;  1RLP C;  3VUB A;  4J9B A;  1VQ8 A;  2PVD B;  5GAM e;  2FPF A;  5HK3 A;  2AIR B;  2FRY A;  1N27 A;  1JXM A;  1Y07 A;  2V26 A;  1CKA A;  3M9Q A;  4DBH A;  3S3N A;  2ABL A;  3M56 A;  5A0L A;  1VQ6 A;  2RA2 A;  5I2S A;  3UF4 A;  1KC8 C;  1W6X A;  2PQW A;  4M77 A;  4AT1 B;  4M78 C;  3OYG A;  2GNC A;  1VQP Q;  5KYW A;  3HFO A;  3PVQ A;  5HCK A;  4M7A C;  5GAO l;  1M8M A;  2I0N A;  4B9W A;  4JRP A;  2LQW A;  1ABO A;  1W4S A;  2E70 A;  1AWW A;  3VS1 A;  2R58 A;  5IHN A;  1U06 A;  2J05 A;  2B86 A;  3C12 A;  2E65 A;  3HRU A;  1HK9 A;  1OPK A;  4JRQ A;  2LP5 A;  2C0O A;  1D1C A;  1X6B A;  2EQI A;  2PTK A;  3OYF A;  1PKS A;  2BE7 D;  2KQW A;  3VS2 A;  3J80 E;  4PJJ A;  1OUL A;  2X3W D;  1WX6 A;  4JUV A;  4EIK A;  3PNW C;  1QWE A;  2QTV A;  3C4S A;  4RMO A;  4C92 G;  3QO3 A;  3CC7 Q;  3AHU A;  4M4Z A;  2EYX A;  2COY A;  1HD3 A;  4Y91 A;  3FC3 A;  1YIT A;  5KYY A;  1Q86 U;  4N4I A;  5GAN f;  3CPF A;  5FRN A;  4O6J A;  1NLP C;  1WLP B;  4HCK A;  3F70 A;  1K8A U;  2K5L A;  4A54 A;  2B8A A;  3TEE A;  2H3J A;  2JS2 A;  1M1K U;  5CK9 A;  3VV0 A;  4ESR A;  3OS2 A;  2J7I A;  3THK A;  5GMK i;  2A3L A;  1XQH A;  3TSZ A;  1X6O A;  3OS5 A;  1KQ2 A;  1WA7 A;  5I2M A;  4BDZ A;  2KE9 A;  4ELZ C;  1GCQ C;  2ZPB B;  3LGF A;  3QWX X;  2L0A A;  2VWF A;  3C0C A;  4M77 G;  1HXD A;  5KYY B;  5CKE A;  3CCE A;  2RJC A;  5GAO m;  4M75 F;  3CC2 Q;  2LJ3 A;  5FWC A;  1FX7 A;  4F7U F;  3OW2 A;  5C0M A;  1VQ5 T;  4JZ4 A;  4C8Q B;  4GBQ A;  3PVL A;  5GAN d;  4J9D A;  3CCL T;  4RCB A;  3OYA A;  2E6Z A;  4PJO E;  4A63 B;  4V2S A;  2AZS A;  3GIB A;  4R56 A;  3P8B B;  1QVG P;  2RI3 A;  1D0Y A;  1G5V A;  2IPO B;  3OQ5 A;  3HFN A;  5CQY A;  1WHM A;  4EPC A;  2HDA A;  2C0I A;  4HCZ A;  3EH1 A;  3HTR A;  1W2B A;  4II1 A;  2V8I A;  4FT2 A;  2QA4 A;  1PC0 A;  1R77 A;  1LVK A;  4QQ6 A;  1ZSZ B;  1VQ9 A;  5FU7 C;  2R57 A;  3VRZ A;  2FPE A;  3H0I A;  3OSS C;  4C5E A;  4M7D A;  2DL3 A;  2DO3 A;  2K7A A;  4E47 A;  2RI2 A;  3X24 B;  4M7A E;  3CCM A;  4LE9 A;  3J7A F;  1XOV A;  3HL8 A;  2K6D A;  4PK4 A;  1UJ0 A;  1RAI B;  4KH1 B;  4OB0 B;  4PKC C;  3S6W A;  4IUT A;  1NJI U;  2MI6 A;  3INZ A;  3CBM A;  1IGU A;  2M1H A;  3RKX A;  2DIQ A;  3MO8 A;  5IHK A;  5LJ5 f;  2HCK A;  4C5G A;  2XIC A;  1ZX6 A;  1OX9 A;  3CC2 T;  1VYU A;  2KDS A;  1N9R A;  2L3Q A;  1YHQ Q;  3IQL A;  4L59 A;  2HQH A;  2DRK A;  5IN1 A;  2HBW A;  4NL2 A;  2F2V A;  1K9M R;  1WJS A;  4M78 B;  2YLC A;  1ACM B;  1EX4 A;  1PSF A;  5CKD A;  2DMO A;  1JQQ A;  4M7A B;  1IXD A;  1H8K A;  3EG9 A;  2LX7 A;  1Q7Y R;  4WF2 A;  2CGH A;  2CZ1 B;  1NYF A;  4ZTF A;  1UGS B;  4ATO A;  1MND A;  4IIO A;  2CP5 A;  2MK5 A;  2E3I A;  2DPP B;  2EAY A;  4M7D G;  3CMA T;  1VQO T;  5GAN 7;  1TOV A;  1YJW A;  1IRE B;  1M90 R;  1AVZ C;  3L2W A;  3QHS A;  3I55 A;  1KHI A;  3DB4 A;  1U1T A;  2RF0 A;  3OYE A;  1P92 A;  2CS7 A;  2F5K A;  1BI0 A;  1LOJ A;  1OV3 A;  3CCV Q;  5LJ3 g;  4OMQ A;  2QQ9 A;  3VS3 A;  3WVD B;  5KCH A;  1I1J A;  1F1B B;  4M77 D;  4A4K A;  4E7I A;  3NGP A;  2C0T A;  2HSP A;  3G71 Q;  5GJV B;  3G6E Q;  1UTI A;  2Z0W A;  4J9H A;  2DTI A;  2DX1 A;  4PJO F;  1QVG S;  1WXU A;  4UC4 A;  4BY6 C;  3ULR B;  1YHQ T;  2KYB A;  3GPL A;  1OX8 A;  1WHG A;  2HEQ A;  1QVF A;  2VYT A;  4J9F A;  3CME T;  2KEA A;  5GMK m;  2COZ A;  1M1G A;  1K1Z A;  4CC2 A;  1MGQ A;  2DXB A;  5IH2 A;  1B3Q A;  2DL8 A;  2HKN A;  4DBR A;  3ER0 A;  3N5B B;  2FZK B;  1LJO A;  1IGQ A;  1SEM A;  4RTV A;  4M78 F;  4DBF A;  1I81 A;  1D09 B;  3MCA B;  4FL6 A;  4IIM A;  5GAM d;  2OTJ A;  1SHF A;  1SRM A;  4PJL A;  4OB1 B;  4BB7 A;  2X4X A;  4M7A F;  3GP8 A;  1KD1 R;  2O4X A;  1QCF A;  3EGD A;  1ZHI A;  1WHK A;  1GXI E;  1VYV A;  2ZZD A;  1UEC A;  2HL3 A;  2BKD N;  4JJB A;  4RTW A;  3ASK A;  1WJQ A;  2EGE A;  3EFR A;  5KYU A;  4C8Q D;  4LDW A;  2RD1 A;  5EC7 A;  1PNJ A;  2YXY A;  1YJ9 A;  1O9S A;  1VQ4 T;  2DKG A;  1M3A A;  2E3H A;  5FU7 B;  3MEU A;  5LJ5 h;  4FIB A;  1E6H A;  4KGZ B;  1UHF A;  2BZX A;  3CCV T;  3OYC A;  2OJ2 A;  2KK4 A;  2KAF A;  4OVA A;  2EYZ A;  5CKH A;  3EGD B;  1JJ2 P;  2CZ7 B;  4FYY B;  3EHR A;  3G71 T;  1T0J A;  1YJN A;  1OOT A;  1MMN A;  1Q86 C;  2KBT A;  2O9S A;  4QQD A;  5KYN A;  2QEX A;  4JS5 A;  3CCJ T;  2HZY A;  3I56 Q;  4JS4 A;  1K8A C;  4JRK A;  3OYK A;  2GGR A;  3M0S A;  3MP6 A;  2E10 A;  4KT0 E;  4M77 C;  4DOW A;  2JTM A;  1WDX A;  1X01 A;  2PVO B;  1KQS P;  1X69 A;  4E7L A;  3JCM d;  2NLU A;  2K3B A;  1BKB A;  2DA9 A;  2HMA A;  2ZPH B;  4EMH A;  4F16 A;  3BY7 A;  2NYS A;  1FYN A;  2DRM A;  3CCR A;  4KBM B;  1OI1 A;  3QPH A;  1NZ9 A;  5GAN 6;  2WSE E;  2CH4 W;  3M5A A;  1HJD A;  4GY5 A;  4FW2 A;  3Q1J A;  2LCL A;  1TSF A;  3E19 A;  5D6Y A;  2EGA A;  2QQS A;  2JVV A;  4FM4 B;  3H0H A;  1IO6 A;  1YI2 Q;  4XU1 A;  4M7D D;  5CKF A;  2CT3 A;  4OGC A;  3MPU B;  5DLQ E;  3JCM V;  1S72 T;  1KG1 A;  2VUB A;  4BE1 A;  3EFO A;  2J06 A;  3FEO A;  3NTI A;  1BI3 A;  1XNI A;  3HSB A;  2DF6 A;  2KYM A;  3H9N A;  2JUF A;  2NUZ A;  2EQU A;  4WTO B;  2KNB B;  4XTZ A;  2CSQ A;  5LJ3 j;  2FZG B;  4HVW A;  3QWY A;  2DAQ A;  1ZA1 B;  3CCU Q;  4B9X A;  5J3B A;  5A0D A;  4BUG A;  4XK8 E;  3TVT A;  4E7K A;  3NHN A;  2LT4 A;  4JJN K;  3GF5 A;  4Y92 A;  1TUD A;  2D1X A;  4C8Q C;  2ZCF B;  3CBP A;  2Y90 A;  4C5I A;  2F5T X;  1KQ1 A;  1K0X A;  1U3O A;  2DK3 A;  2EKO A;  1VQM T;  1UG1 A;  3RDV A;  4BD3 A;  2FG0 A;  1K9M U;  1Z9Q A;  2MYS A;  3PIO A;  1MV3 A;  3CC4 Q;  3RES A;  4N4H A;  1CKB A;  4PFZ A;  5GAN 2;  5I22 A;  2QGF B;  1UGP B;  1Q7Y U;  1NJI C;  4PJN A;  2JM8 A;  2P0K A;  3OSV A;  2LNV A;  4EMG A;  1FMK A;  2K79 A;  2EYQ A;  2CP6 A;  3RKW A;  1KJW A;  3U23 A;  3R6O A;  2C06 A;  1KHC A;  3OW2 P;  3OS0 A;  4ELY C;  1S1N A;  3S3O A;  4C92 A;  1M90 U;  2DYB A;  1NE8 A;  3A8M B;  1TS9 A;  4C0F A;  1JJ2 S;  1C0M A;  5GJW B;  3V7R A;  1G2B A;  3L1A A;  1PRM C;  2ROT A;  3A1P A;  1OPL A;  1WXT A;  3VUZ A;  5M9O A;  4M75 A;  1VIE A;  3M0T A;  4M77 E;  3JB9 G;  3QDR B;  4F7U A;  1QP2 A;  4RTT A;  2HD0 A;  2MIO A;  1X75 C;  1H64 1;  1BI1 A;  1I5O B;  2KRM A;  3T9N A;  5GAN 8;  1YWO A;  2QAS A;  1KQS S;  3PMI A;  3X25 B;  2OI3 A;  2EW3 A;  2FZC B;  1V76 A;  4C92 B;  1UUE A;  1VQ5 A;  3LGL A;  3CCL A;  1ZLM A;  4D6W A;  3PE0 A;  2M9U A;  3ZFJ A;  2I2L A;  1UGV A;  3SWN A;  2E64 A;  1Y96 A;  1UFF A;  3MET A;  4B6M A;  4CC4 B;  1Q81 R;  1RAF B;  2XDB A;  3L2Z A;  1VQN T;  2L3S A;  3G4S T;  3QZ9 B;  3OY9 A;  1IRX A;  4OGE A;  2DIG A;  3A8H B;  2KRS A;  1MMA A;  2CKK A;  2FEI A;  2JM9 A;  4ZGE B;  4D8D A;  2W10 A;  1DJ7 B;  2KY9 A;  2NUP A;  2DER A;  4RCC A;  4HA8 A;  4M77 B;  8AT1 B;  1KD1 U;  2NWM A;  1M5Q 1;  3OYY A;  5KYW B;  1RI9 A;  2BZY A;  2RK2 A;  4ZGJ B;  4CRI A;  1OQK A;  2J6F A;  1KIK A;  1M30 A;  4C8Q E;  1LPL A;  4KGV B;  1I4K 1;  1M1F A;  2DD4 A;  2E5K A;  2ENM A;  3NPF A;  2YUP A;  3M0R A;  1OZ3 A;  2LJ0 A;  1TWB A;  2CZ6 B;  5LJ3 e;  3NFC A;  5CAI A;  3KXT A;  4AFS C;  2LCS A;  4A4F A;  4M75 G;  1W70 A;  4JJD A;  4F7U G;  1RUW A;  2V1R A;  1JEG A;  2RHU A;  2DM1 A;  2RNA A;  4E7H A;  1AEY A;  4Z02 A;  3TRE A;  2F1L A;  1YFN A;  1N8R R;  4EMK A;  3MEV A;  3OA6 A;  1WIE A;  1K73 R;  3CC2 A;  9ATC B;  3QYH B;  3QKJ A;  3CCS Q;  1IHV A;  1YNZ A;  3V7C A;  4TVR A;  4HKE A;  7AT1 B;  1YIT Q;  3DLL A;  3AT1 B;  2E1H A;  2X51 A;  4FSX A;  3MEA A;  4CC7 A;  4J5Y A;  2W0Z A;  3GOX A;  5HK0 A;  1VQP T;  4QVD A;  3O5Z A;  3TCJ A;  3OW2 S;  3QDF A;  3OYI A;  3OMG A;  1C6V X;  1R0C B;  3VU3 C;  5LJ5 g;  4J8O A;  2DL7 A;  3MHX A;  1NM7 A;  3M57 A;  2YRC A;  3UA6 A;  1M3B A;  1N6A A;  1ABQ A;  2YHT A;  1IHW A;  2F2X A;  1OYX A;  2RQW A;  4PFP A;  3VS5 A;  2FYK A;  1D3B A;  2K3X A;  5DLO A;  1M2O A;  4FYX B;  2RJD A;  3QII A;  3CCE Q;  2ATC B;  3CMA A;  2QDL A;  1VQO A;  5D6X A;  4BI3 A;  3FIF A;  1WNL A;  1Q82 R;  1QVF P;  1MV0 B;  1TG0 A;  2QI2 A;  3KFV A;  3LYI A;  3CC7 T;  1NEG A;  4M77 F;  4HXJ A;  4OB2 B;  2OAU A;  1G3S A;  1RL2 A;  3JB9 J;  4M78 E;  4R55 A;  3QG1 A;  3A8G B;  3I35 A;  5ECA A;  5FLX E;  1VQ7 Q;  3JB9 D;  4XU0 A;  1D3B B;  2P84 A;  1H3Z A;  2X35 A;  4DBQ A;  4BE0 A;  2BIV A;  1K0S A;  3S3M A;  4PJO A;  4NOY A;  5GAN j;  4FT4 A;  4FYV B;  2CRE A;  2ZPI B;  1M4Z A;  3G1J A;  1B34 A;  3OBY A;  2QQR A;  3M0P A;  1ZUU A;  1AT1 B;  5GAN 4;  1PD1 A;  3UA7 A;  1VQ9 Q;  3PGG A;  3QYG B;  3CCS T;  1YHQ A;  2KVQ G;  3JCM J;  4M7D B;  2RQU A;  2O2O A;  3PFS A;  1QCN A;  4C0G A;  2K9G A;  3CME A;  3CXC P;  1AWJ A;  2VKN A;  3L2R A;  2KI7 A;  2VXF A;  4A4H A;  3CCM Q;  1FXX A;  2DTO A;  1RAH B;  4RUG A;  3SD4 A;  3KBG A;  2CUB A;  2O31 A;  2GF7 A;  3A8L B;  2ZGW A;  4N4G A;  1GBQ A;  4RTU A;  2XID A;  4J9G A;  3QJY A;  3CPW P;  3GNF B;  3OYD A;  5GMK l;  4C8Q F;  3CCQ Q;  1T3L A;  1QQJ A;  1ZA2 B;  3FJP A;  3JCM W;  2RM4 A;  3PMT A;  3HRS A;  2ZPE B;  4C92 D;  3RBB B;  3MP8 A;  4JJC A;  1NPR A;  1V29 B;  3BW1 A;  5GAN h;  5J39 A;  2LQN A;  3VS4 A;  5KYX A;  1K9M C;  1M27 C;  2O9V A;  1Y0M A;  1VQ4 A;  1QKW A;  3RUX A;  2BZ8 A;  1M2V A;  1XTD A;  2K5F A;  1VQ7 T;  3CCV A;  3VYH B;  2JMC A;  1Q7Y C;  2HBP A;  4MMK A;  2EQJ A;  4PJO G;  3EG9 B;  1YIJ Q;  3LWH A;  2D8H A;  2DXC A;  2ECZ A;  3D7S B;  3G71 A;  4J6W A;  1WHH A;  5FW9 A;  4KUI A;  4XAX B;  2Y4Y A;  1KFZ A;  4O5V A;  1OEB A;  2K3Y A;  1BBZ A;  3CCJ A;  5GAM f;  4IUU A;  5D6W A;  1M90 C;  4FW1 A;  1SRL A;  1M2V B;  1ZUY A;  1VQK Q;  1YJW Q;  2CYZ B;  5LJ5 j;  3C95 A;  4KH0 B;  3VKI A;  3I55 Q;  4F14 A;  2LNH B;  3FRN A;  3I5R A;  1E7O A;  1TUG B;  1WFW A;  4M7A G;  3LX7 A;  3VJP A;  2KR3 A;  1QVF S;  4OB3 B;  1QVG A;  4XTX A;  1PD0 A;  2V8J A;  5KH6 A;  3VYG A;  2AZV A;  4BI8 B;  3M0Q A;  3CCQ T;  3HHT B;  2P0P A;  1VQL Q;  3CQT A;  3M4Y A;  1S72 A;  2JTF A;  3OYN A;  2AK5 A;  4A4G A;  1MHN A;  2DEQ A;  4ZN1 A;  5CKB A;  1B7T A;  2KXC A;  3JCM P;  1IB8 A;  2RK1 A;  4OMN A;  2GTO A;  2FVU A;  2G3R A;  3ZEH A;  2RJE A;  5GAN e;  4CC3 A;  1PHT A;  2QQB A;  3JCM f;  4C92 C;  2NUT A;  4DA4 A;  2GFU A;  3QUI A;  2VGM A;  1YIJ T;  1VUB A;  3CXC S;  2GBQ A;  1N8R U;  5DM7 R;  2A7Y A;  3JV3 A;  2RMO A;  4ME7 A;  1K73 U;  4IKF A;  3EGX A;  2RHX A;  2YUQ A;  1WGS A;  4XU3 A;  3UPU A;  3RNJ A;  1KD1 C;  5CCA A;  2OTJ Q;  2J6O A;  5KE2 A;  1MUZ A;  5I11 A;  2CT4 A;  2MF2 A;  2O4X B;  3M54 A;  1VQM A;  4J83 A;  1Z9Z A;  2M02 A;  5FU6 B;  3HP9 A;  2P4R A;  3V8L A;  4ZGD B;  2COW A;  2YLB A;  4QQG A;  4OML A;  3REB B;  3G6E T;  3CPW S;  1I07 A;  4NS5 A;  1ZUK A;  1VQK T;  5KYU B;  1M3C A;  4Q5W A;  1GFC A;  1M1K R;  4N0A A;  3DB3 A;  2OAW A;  2KMT A;  3SWN C;  1X27 A;  2HKQ B;  3NTK A;  1WHJ A;  2LRQ A;  2CUD A;  2M51 A;  5A2Q E;  2DL5 A;  3CD6 Q;  1WZO A;  2L2P A;  4C0D C;  1RAD B;  3KUF A;  1PRL C;  2O88 A;  5IXB A;  5LJ3 d;  1UGR B;  1YJN Q;  1WHL A;  2QXF A;  2A28 A;  2YRD A;  2V1Q A;  1QW1 A;  1YWP A;  4OMF B;  1PWT A;  1AD5 A;  1UGQ B;  2LQ8 A;  1TU0 B;  2MAM A;  1OU9 A;  2F2W A;  5L8R E;  1GL5 A;  2PU9 B;  4PJO D;  4BAC A;  5I21 A;  2VC8 A;  4RTZ A;  2DBK A;  5GAN 3;  2AKL A;  3L2U A;  1LNX A;  1BIB A;  3CCR Q;  1ZBJ A;  2ZAE A;  3SDZ A;  5AT1 B;  4MDX A;  3GLX A;  1BCO A;  3V8K A;  1NLO C;  5GAM h;  4J7F A;  3I5S A;  5FRO A;  3JAM E;  3M55 A;  3OYM A;  4FCY A;  2CP2 A;  3DKM A;  5LL6 S;  3WVE B;  4YTL A;  4DEY A;  1G3Y A;  1JO8 A;  2JXB A;  2QK0 A;  2X9H A;  2PNI A;  2A37 A;  2K2M A;  2DD5 A;  4MZM A;  5LJ5 e;  2RJF A;  3EFO B;  1VQN A;  3G4S A;  3VS7 A;  3FLG A;  3BDL A;  3EGU A;  5GAO q;  1D1B A;  1EFN A;  2J6K A;  4HVV A;  1U1S A;  4QT7 A;  1I0C A;  3MP1 A;  1N9S A;  4CI0 C;  2VGN A;  3I56 T;  1M8V A;  4KUD K;  3QSU A;  2GQI A;  3TU4 K;  2M0Y A;  2XHC A;  4E7Z A;  1JBM A;  4ZTJ A;  1X43 A;  1QKX A;  2FPD A;  4MZT A;  4JLG A;  2L3P A;  2MWO A;  3CD6 T;  1BIA A;  1FMW A;  4C92 E;  1UEB A;  1R0B G;  3MEW A;  1NPP A;  2H3E B;  1RAB B;  2VAS A;  1G3T A;  1X2Q A;  3WXM B;  2OTL Q;  1D0X A;  2K57 A;  1T3S A;  2MOX A;  3H0F A;  3QXE B;  2RN8 A;  1WQ7 A;  1YI2 T;  2MWP A;  2AHJ B;  4FSS A;  2XG8 D;  3JCM h;  3JCM Q;  1JXO A;  1SG5 A;  1TUC A;  1EZZ B;  4J6Y A;  2DVE A;  2EYW A;  5IT9 E;  3E1S A;  4XTY A;  4M7D C;  4BI4 A;  3CCU T;  1JJ2 A;  2PZ1 A;  3HPW A;  2DNU A;  4F17 A;  2CP0 A;  2VB6 A;  1I8F A;  1GCP A;  1PSE A;  1W2B P;  5GAN g;  1KC8 R;  2RO0 A;  2DE0 X;  4NL3 A;  1VQP A;  4DQ2 A;  4X9D A;  4LD9 K;  5GMK h;  1BB9 A;  2X4W A;  2XI9 A;  1NG2 A;  3L2V A;  4MML A;  1KQS A;  1VQ8 Q;  1HYO A;  5HY6 A;  3ZBD A;  4M75 B;  1E6G A;  3X28 B;  2CSI A;  1QWF A;  4F7U B;  3L2Q A;  1J3T A;  3CC4 T;  3EG0 A;  2XKO C;  2DFU A;  4JLI A;  4XQ3 A;  2RB6 A;  4LDY A;  3A8O B;  2PUO B;  4PLL A;  3JB9 F;  4LDV A;  1VQ5 Q;  1VQ6 Q;  2ZPG B;  2AT1 B;  3CC7 A;  4LUE A;  2EGC A;  3RR6 A;  4AFQ C;  2DVJ A;  1VA7 A;  3CCL Q;  1I5L A;  2EQK A;  2OTL T;  1Q81 C;  3SWN B;  1Y96 B;  3M59 A;  2RI5 A;  2JS0 A;  4DEX A;  2KRN A;  4KRT A;  3H8Z A;  5AYF A;  1EIF A;  4C0D B;  2YRV A;  3ZL7 C;  2JZ2 A;  2RPN A;  4HT9 A;  3SB2 A;  2D6F A;  4X34 A;  3DLM A;  1FMV A;  2E5Q A;  3CEY A;  3JCM e;  3E9G A;  1WYX A;  2GQV A;  3EFS A;  2NUP B;  4JDS A;  4OMM A;  3CCS A;  2FB7 A;  4QKU A;  2KXD A;  2K2V A;  2MPX C;  1BU1 A;  2JT4 A;  4HCB A;  3LH5 A;  3ME9 A;  4OMO A;  2RQV A;  5KE3 A;  2HSE B;  4PFO A;  4R0K A;  1SSH A;  2JN0 A;  1AZE A;  3G7Z A;  4C8Q A;  2LX9 A;  3OYL A;  2YWW A;  4E7S A;  4J6X A;  5FRM A;  1VQ8 T;  4C92 F;  1X6G A;  2VXE A;  3SFM A;  5EG2 A;  2VVK A;  5GMK e;  3UT1 A;  3UWN A;  3OMC A;  4MDW A;  2ZPF B;  1N8R C;  2PVG B;  3PIP A;  4QVZ A;  1QMC A;  1K73 C;  4AFU C;  4EMK B;  1BK2 A;  1IZ6 A;  3JCM b;  5CVI A;  3E9F A;  2JTE A;  1YP5 A;  4IUR A;  5IAY A;  2D8J A;  2YDL A;  3M0U A;  3UAT A;  3JB9 I;  4M7D E;  2CH4 A;  5IXF A;  4RG2 A;  1VQ6 T;  1N5Z A;  1UB4 A;  4LD6 A;  1AHJ B;  1LCK A;  2EQM A;  1ZSZ A;  1VOM A;  1Y71 A;  2DL4 A;  1C1A A;  8ATC B;  1UE9 A;  4LXC A;  1MNE A;  3QJ6 A;  1MMD A;  1NYG A;  5CQX A;  4Z8A A;  2JOY A;  2EYY A;  3LLR A;  3RMQ A;  2ESW A;  1VQ7 A;  5GAO n;  1WI7 A;  3FJ5 A;  2D0N A;  2A0F B;  2DZC A;  1W2B S;  4OP0 A;  3LW5 E;  1QLY A;  2E41 A;  1BYM A;  5IHI A;  2LC4 A;  2R5A A;  4L6V 5;  2XK0 A;  4E2F B;  4KUL A;  2HNI A;  5DY9 A;  4RG8 A;  2ED0 A;  5FU6 C;  2LVM A;  2KRO A;  3RER A;  2EIF A;  4HVU A;  1WXB A;  3MKD A;  4AFZ C;  2Y4X A;  5L23 A;  4P5N A;  4LDX A;  3O8V A;  3CMA Q;  4KGX B;  3L42 A;  1VQO Q;  1Q82 C;  3EG2 A;  1D0Z A;  4JPB W;  4LN2 A;  2QA4 Q;  4DOV A;  4FYW B;  4X1V A;  1O75 A;  3EG1 A;  2IIM A;  4PNO A;  4C8Q G;  2X3X D;  2F69 A;  4J9I A;  1YIT T;  1K76 A;  2YSQ A;  3HRT A;  2EBP A;  1YN8 A;  2EVR A;  2R5M A;  2RQR A;  1SF9 A;  1A0N B;  2HQE A;  3NMZ C;  1AZG B;  2DIL A;  2L3R A;  4PLI A;  4M78 A;  3OBW A;  2ED1 A;  2X4J A;  4PJO B;  4F04 B;  4AG2 C;  2GTJ A;  1YCY A;  5GAM g;  3CCQ A;  4M7A A;  4PL6 A;  2FRW A;  5CIU A;  3NTH A;  1B34 B;  4N0A C;  1RAA B;  1UDL A;  1BCM A;  2EJ9 A;  1GFD A;  2EWN A;  1G8X A;  2MMP A;  2LZ6 B;  2M0O A;  2XDD A;  1SSF A;  1WJR A;  3LWI A;  1VYT A;  3CCE T;  2QG9 B;  5D7U A;  3REA B;  2QAZ A;  4GLK A;  3CME Q;  3VS6 A;  4OMP A;  4XTU A;  2AKK A;  4IUQ A;  2D9T A;  3GBQ A;  1NBE B;  2SEM A;  2KT1 A;  3OYB A;  1SPK A;  4Y28 E;  1AOJ A;  1YCS B;  1YIJ A;  2JJ9 A;  5J26 A;  3JSC A;  4XU2 A;  4M75 D;  3CBO A;  4RKU E;  3X20 B;  5LJ5 d;  4HT8 A;  2WSF E;  2K5I A;  1TTH B;  1KC8 U;  1YBY A;  2RHY A;  3VRY A;  1H92 A;  3UDC A;  3G6E A;  2IVW A;  2EPD A;  2V8K A;  2QYZ A;  4JRI A;  1VQK A;  2DZ9 A;  4BDY A;  1H3H A;  2CDT A;  3TQ7 P;  1WPY A;  5KYX B;  3JCM g;  2QA4 T;  2WAC A;  1VQ9 T;  4XTV A;  1QCO A;  1VQ4 Q;  2DJQ A;  1Q81 U;  3I9Q A;  1JRI A;  1B07 A;  3A98 A;  3M4G A;  1GCQ A;  4VUB A;  3V8J A;  3FDR A;  1Y57 A;  4M78 G;  3SEM A;  1U5S A;  3CCM T;  3MJX A;  4LDU A;  2EJF A;  4M7D F;  2KGT A;  1G83 A;  1VQL A;  5A0G A;  2BUD A;  3M58 A;  2PUK B;  2GCX A;  3CCJ Q;  2M16 A;  1OU8 A;  2GFA A;  4C0Z A;  2SRC A;  3JCM c;  2EKH A;  1U8R A;  2DJZ A;  1AWX A;  2DXU A;  1VIF A;  3RKY A;  4K11 A;  2CP7 A;  1HSQ A;  3OS1 A;  4RTY A;  1MMG A;  3HKS A;  4A4E A;  2A36 A;  3EHQ A;  1D1A A;  3JCM X;  2HQX A;  3E2U A;  1XJW B;  2JMA A;  2LTO A;  1RAC B;  1OZ2 A;  2DLP A;  2A08 A;  2CZ0 B;  2YUN A;  3GNG A;  2D0Q B;  3URG A;  1PG5 B;  4JZ3 A;  1Q95 G;  2FHD A;  3P8D A;  1S72 Q;  1RI0 A;  2XDP A;  5KCO A;  1GBR A;  3R6N A;  5LJ3 f;  1NEB A;  1PCX A;  3V7S A;  1SHG A;  4M75 C;  2DYI A;  2G6F X;  3QBY A;  2YT6 A;  3SHW A;  3I56 A;  1Q86 R;  3CXC A;  2RH2 A;  2XMF A;  2LQK A;  1GRI A;  3P8H A;  3A5Z B;  1K8A R;  3OYJ A;  3PTA A;  1YJW T;  5GAM j;  3I55 T;  2BTT A;  2NUT B;  1YJ9 Q;  1SKU B;  2DXT A;  3CD6 A;  2L8D A;  2EFI A;  1X2K A;  4ORZ A;  2QQA A;  3EGX B;  3CPW A;  4J9C A;  3J81 E;  4C5H A;  1VQM Q;  2HAX A;  2DBM A;  1YI2 A;  1VQL T;  3BDU A;  1T0H A;  2OX7 A;  1FWZ A;  5CO7 A;  2LCC A;  1Q82 U;  2P4T A;  5FWB A;  1RLQ C;  4AG1 C;  1M1K C;  4Z89 A;  5HKC A;  5C6S A;  2QEX Q;  2L89 A;  2X4Y A;  4X9C A;  3FB9 A;  4QW2 A;  1KK7 A;  1UHC A;  3EG3 A;  3CCU A;  3JRZ A;  4LUD A;  4OF1 A;  2BE9 B;  2QTX A;  1ZQ1 A;  1RAG B;  4E6R A;  4QVC A;  2IG0 A;  3PT9 A;  4E7J A;  1UJY A;  2LDM A;  2E4H A;  2LJ1 A;  5GAN 5;  4HCC A;  2OTJ T;  2KT8 A;  4ZNX A;  2E6N A;  3RMS A;  1W1F A;  4ZN3 A;  2FL7 A;  1CSK A;  1PKT A;  2YUO A;  1TXQ A;  1ARK A;  2L5Q A;  2MCN A;  4LNP A;  4M78 D;  1K9A A;  4IUV A;  4EMK C;  3CC4 A; 
#chains in the Genus database with same CATH homology
 1SEM A;  2H8H A;  4RTV A;  2JS0 A;  4DEX A;  2KRN A;  1V1C A;  4KRT A;  2RQU A;  2O2O A;  4IIM A;  1SHF A;  1SRM A;  4WCI A;  2ROL A;  2K9G A;  4Z88 A;  3ZL7 C;  2JW4 A;  1QCF A;  1AWJ A;  2VKN A;  2RPN A;  1ZSG A;  1VYV A;  1KSW A;  4RUG A;  1UEC A;  2RQT A;  2CUB A;  2O31 A;  4JJB A;  4RTW A;  1WYX A;  1AWO A;  1JU5 C;  2EGE A;  4GLM A;  4OMM A;  5EC7 A;  1PNJ A;  2KXD A;  1GBQ A;  4RTU A;  4J9G A;  2FO0 A;  1BU1 A;  2JT4 A;  3LH5 A;  1M3A A;  1T3L A;  4OMO A;  3H41 A;  3VS0 A;  2RQV A;  1E6H A;  1UHF A;  2BZX A;  4R0K A;  1SSH A;  2OJ2 A;  1AZE A;  2EYZ A;  3RBB B;  4JJC A;  2LMJ A;  4J9E A;  4RTX A;  3EHR A;  2LQN A;  3VS4 A;  1K4U S;  1T0J A;  1X6G A;  1M27 C;  2O9V A;  1OOT A;  2VVK A;  1Y0M A;  1QKW A;  2KBT A;  2O9S A;  2BZ8 A;  4AFU C;  4D8K A;  1BK2 A;  2GGR A;  2JMC A;  3M0S A;  2D8H A;  1WDX A;  3TSW A;  2JTE A;  1YP5 A;  1X69 A;  1RLP C;  2D8J A;  2YDL A;  2K3B A;  2DA9 A;  2ECZ A;  3M0U A;  3UAT A;  2CH4 A;  5IXF A;  4J9B A;  1N5Z A;  5FW9 A;  4F16 A;  1LCK A;  2FPF A;  1FYN A;  2DRM A;  2DL4 A;  1KFZ A;  2FRY A;  1UE9 A;  2CH4 W;  1OEB A;  4Z8A A;  1BBZ A;  1NYG A;  1HJD A;  2EYY A;  2ESW A;  1JXM A;  1WI7 A;  3FJ5 A;  2D0N A;  1CKA A;  1QLY A;  1SRL A;  2EGA A;  1ZUY A;  5IHI A;  2ABL A;  3H0H A;  1IO6 A;  4F14 A;  2CT3 A;  2LNH B;  3UF4 A;  3I5R A;  1E7O A;  1W6X A;  2ED0 A;  1WFW A;  2KRO A;  2GNC A;  4HVU A;  2J06 A;  1WXB A;  3PVQ A;  5HCK A;  2DF6 A;  2KYM A;  4AFZ C;  1M8M A;  2NUZ A;  2KR3 A;  2I0N A;  5L23 A;  2KNB B;  2LQW A;  1ABO A;  2CSQ A;  1AWW A;  3EG2 A;  2AZV A;  4HVW A;  3VS1 A;  3QWY A;  3M0Q A;  5IHN A;  1U06 A;  2J05 A;  4JPB W;  4LN2 A;  2B86 A;  3CQT A;  4X1V A;  3TVT A;  3NHN A;  3EG1 A;  2IIM A;  1OPK A;  2X3X D;  2LP5 A;  2C0O A;  4J9I A;  4Y92 A;  2AK5 A;  1TUD A;  1K76 A;  2YSQ A;  2EBP A;  1X6B A;  1YN8 A;  2EQI A;  2EVR A;  2D1X A;  2RQR A;  1A0N B;  2KXC A;  2PTK A;  3NMZ C;  1AZG B;  2DIL A;  1PKS A;  2ED1 A;  1U3O A;  4OMN A;  3VS2 A;  4AG2 C;  2GTO A;  2GTJ A;  2X3W D;  1WX6 A;  1UG1 A;  4EIK A;  1QWE A;  2FRW A;  2FG0 A;  4CC3 A;  4M4Z A;  1PHT A;  2EYX A;  1HD3 A;  1Z9Q A;  1UDL A;  1MV3 A;  1GFD A;  1CKB A;  2GBQ A;  3JV3 A;  1NLP C;  1WLP B;  2RMO A;  4HCK A;  2LZ6 B;  5I22 A;  2YUQ A;  3RNJ A;  1VYT A;  2JM8 A;  2J6O A;  1MUZ A;  3REA B;  5I11 A;  2JS2 A;  2CT4 A;  1FMK A;  4ESR A;  1Z9Z A;  2J7I A;  3VS6 A;  2K79 A;  4OMP A;  2AKK A;  3THK A;  2P4R A;  3GBQ A;  1KJW A;  3U23 A;  2SEM A;  2KT1 A;  1SPK A;  3REB B;  4OML A;  3TSZ A;  1AOJ A;  1I07 A;  1YCS B;  1ZUK A;  1WA7 A;  2KE9 A;  1M3C A;  1GCQ C;  1S1N A;  1GFC A;  3QWX X;  2L0A A;  2VWF A;  3C0C A;  2DYB A;  5GJW B;  2LJ3 A;  1G2B A;  2OAW A;  5FWC A;  1PRM C;  1X27 A;  4JZ4 A;  2ROT A;  3VRY A;  1H92 A;  1OPL A;  1WXT A;  2CUD A;  2M51 A;  4GBQ A;  3PVL A;  2DL5 A;  4J9D A;  2EPD A;  3M0T A;  1H3H A;  2L2P A;  2CDT A;  1PRL C;  2O88 A;  4RTT A;  2MIO A;  5IXB A;  4A63 B;  2KRM A;  1YWO A;  2AZS A;  2DJQ A;  2A28 A;  2V1Q A;  3I9Q A;  1B07 A;  3A98 A;  1GCQ A;  2OI3 A;  2EW3 A;  1YWP A;  1PWT A;  1Y57 A;  1UUE A;  3SEM A;  1AD5 A;  1U5S A;  1ZLM A;  2HDA A;  2C0I A;  3PE0 A;  2KGT A;  1G83 A;  1UGV A;  2F2W A;  1GL5 A;  1UFF A;  4RTZ A;  4CC4 B;  2DBK A;  2AKL A;  3VRZ A;  2FPE A;  3H0I A;  2L3S A;  1ZBJ A;  2DL3 A;  2K7A A;  1NLO C;  2KRS A;  3I5S A;  2SRC A;  2EKH A;  4LE9 A;  2FEI A;  1XOV A;  2JM9 A;  4D8D A;  4DEY A;  2K6D A;  1AWX A;  1UJ0 A;  4K11 A;  1JO8 A;  2JXB A;  1HSQ A;  2W10 A;  2PNI A;  2A37 A;  2K2M A;  4RTY A;  2NWM A;  2A36 A;  3EHQ A;  3VS7 A;  3EGU A;  1RI9 A;  2BZY A;  1EFN A;  2J6K A;  4HVV A;  5IHK A;  2J6F A;  1KIK A;  1M30 A;  2HCK A;  1I0C A;  2JMA A;  4QT7 A;  2DLP A;  2E5K A;  2ENM A;  3NPF A;  2A08 A;  1ZX6 A;  2YUN A;  2YUP A;  3M0R A;  2GQI A;  2LJ0 A;  2M0Y A;  1VYU A;  1X43 A;  1QKX A;  2FPD A;  4JZ3 A;  2L3Q A;  3IQL A;  4AFS C;  2L3P A;  2LCS A;  2DRK A;  1GBR A;  1W70 A;  2HBW A;  4JJD A;  3R6N A;  2F2V A;  1RUW A;  1NEB A;  2V1R A;  1SHG A;  1JEG A;  2G6F X;  2DM1 A;  2YT6 A;  2RNA A;  3SHW A;  2XMF A;  1X2Q A;  1AEY A;  2DMO A;  1JQQ A;  1T3S A;  2MOX A;  1GRI A;  1WIE A;  1H8K A;  2LX7 A;  3H0F A;  2RN8 A;  1YNZ A;  2BTT A;  4FSS A;  1NYF A;  1JXO A;  4IIO A;  4CC7 A;  1X2K A;  2W0Z A;  4ORZ A;  3O5Z A;  1TUC A;  4J9C A;  2EYW A;  2DL7 A;  1NM7 A;  2DBM A;  3UA6 A;  1AVZ C;  1M3B A;  2PZ1 A;  1ABQ A;  2DNU A;  1T0H A;  4F17 A;  2F2X A;  2RF0 A;  2RQW A;  1GCP A;  3VS5 A;  5FWB A;  1RLQ C;  4AG1 C;  4Z89 A;  2DE0 X;  1OV3 A;  4OMQ A;  3VS3 A;  2QDL A;  1I1J A;  1BB9 A;  1UHC A;  1NG2 A;  3NGP A;  3EG3 A;  2C0T A;  2HSP A;  1MV0 B;  1TG0 A;  3KFV A;  5GJV B;  1NEG A;  1UTI A;  4LUD A;  1E6G A;  4HXJ A;  4J9H A;  4E6R A;  2CSI A;  1QWF A;  1J3T A;  2DX1 A;  3EG0 A;  1WXU A;  3I35 A;  5ECA A;  1UJY A;  3ULR B;  2KYB A;  2LJ1 A;  2HEQ A;  1K0S A;  2KT8 A;  4ZNX A;  2CRE A;  4J9F A;  1W1F A;  2KEA A;  1CSK A;  1K1Z A;  4LUE A;  4CC2 A;  2EGC A;  1PKT A;  2YUO A;  2DVJ A;  1VA7 A;  4AFQ C;  1ARK A;  2MCN A;  5IH2 A;  1B3Q A;  2DL8 A;  3M0P A;  4LNP A;  1ZUU A;  1K9A A;  1K0X A;  3UA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...