2YSQA

Solution structure of the sh3 domain from rho guanine nucleotide exchange factor 9
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
81
structure length
81
Chain Sequence
GSSGSSGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQEDEVEEGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 9
publication title Solution structure of the SH3 domain from Rho guanine nucleotide exchange factor 9
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 4
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ysqA00
1QCFA 3REAB 2B86A 3NHNA 1H92A 1T0HA 2DVJA 4DEYA 2QDLA 2K6DA 2GTJA 1CKBA 3H41A 3EG2A 1TUDA 4JJCA 2EQIA 2JM8A 2JMCA 1GFCA 2EGAA 4CC3A 2EYZA 1QKXA 2JM9A 2P4RA 2VWFA 2LP5A 2XMFA 1E6GA 1RUWA 2DYBA 3M0UA 3VRZA 1BB9A 1PKTA 1AD5A 1RI9A 2BZXA 2HBWA 1UGVA 2ED0A 4RTYA 2HCKA 3QWXX 1E7OA 2GNCA 1YWOA 1SRMA 2RQTA 4RTTA 2C0OA 3LH5A 3PVQA 3C0CA 4RUGA 2EKHA 2HEQA 1GCQA 2JW4A 2HDAA 1MV3A 5IHNA 3UA6A 4Z89A 2LQWA 4F16A 1XOVA 2EYYA 2ABLA 1GBQA 2L3SA 4LNPA 2CREA 4Z88A 2LJ3A 2K3BA 2KROA 2RQRA 2SEMA 1ARKA 2LNHB 1U06A 1WA7A 1WLPB 2RPNA 4HCKA 2DNUA 1X6GA 1WXBA 2K7AA 4OMOA 1Z9ZA 1ZLMA 2EBPA 5ECAA 2PNIA 2CH4A 1EFNA 2EYWA 1AWXA 4IIMA 1LCKA 1YCSB 1ZUUA 1BK2A 2KYBA 5I22A 1AWOA 2FG0A 4ZNXA 2DLPA 1VA7A 1K0XA 1UJYA 2KGTA 2KRMA 4R0KA 2ENMA 1VYTA 4AG1C 1WXTA 1I0CA 2DRMA 4Z8AA 1FYNA 1NM7A 2LJ0A 3H0IA 1UUEA 2MIOA 4CC7A 2AZVA 2AK5A 3I35A 1UHFA 2DF6A 1NLOC 2KBTA 5FWCA 2LCSA 1Z9QA 2MOXA 1H3HA 3M0RA 1QWFA 1J3TA 2KEAA 1T0JA 2DX1A 2RMOA 2YUPA 4QT7A 2L2PA 1MV0B 2GBQA 1GL5A 3SEMA 3VS5A 3H0HA 2FO0A 1Y57A 4J9CA 2CUBA 4J9HA 1QKWA 1QWEA 1WX6A 2W10A 1TUCA 4HVUA 1GCPA 1K76A 1GRIA 2D0NA 3VS0A 4RTWA 3I5RA 2BTTA 2DM1A 2J6OA 4K11A 3UF4A 3QWYA 3VS4A 1UDLA 2L3PA 2A36A 4J9FA 1QLYA 4F17A 2GQIA 2BZYA 3CQTA 2GTOA 1YP5A 2O88A 2C0IA 4RTZA 2EGEA 3ZL7C 1WDXA 1M3CA 1BBZA 1IO6A 1M8MA 3NMZC 2JTEA 1PNJA 3EGUA 2YT6A 2DRKA 2V1RA 1GCQC 1JO8A 2G6FX 2DE0X 4Y92A 4CC4B 1ABQA 2FPDA 2O31A 3JV3A 2I0NA 4JPBW 1WIEA 4AFUC 1WYXA 3VS6A 1U5SA 2X3WD 1ZBJA 2KRSA 4LUEA 1BU1A 2CDTA 1I07A 1M3AA 1W70A 1NYFA 5IHKA 4D8KA 2ECZA 1JU5C 1UTIA 4ESRA 4HXJA 3VRYA 2O9VA 2V1QA 1M27C 1PKSA 4OMNA 1JEGA 2PZ1A 2YUOA 1AWWA 2F2XA 2KRNA 2K2MA 2A37A 4HVWA 2DBKA 2J05A 4F14A 2DL3A 2DL8A 1X2QA 1HD3A 1SSHA 2LQNA 3IQLA 1ZUKA 5IHIA 3SHWA 4HVVA 3R6NA 2OJ2A 2YUNA 1N5ZA 2J6FA 3I5SA 1FMKA 2M0YA 3PVLA 1YWPA 4M4ZA 2M51A 4J9DA 5FWBA 2FEIA 3EHQA 1B3QA 1WFWA 1PRMC 1VYUA 4ORZA 3VS2A 2KE9A 2L3QA 2J6KA 4OMQA 2H8HA 2DMOA 3EHRA 2F2WA 2KXDA 1AEYA 5IXBA 1CKAA 4OMPA 2KXCA 1JXOA 2AKLA 2FPFA 1UE9A 2CSQA 2D1XA 1G2BA 1NLPC 5FW9A 4AFSC 1GFDA 1AZEA 3NGPA 1TG0A 2JS0A 4J9BA 1SRLA 2O2OA 3FJ5A 2D8JA 2DILA 3M0TA 2GGRA 1NEBA 3ULRB 1Y0MA 2LMJA 2ESWA 1HSQA 3UATA 1I1JA 2OAWA 1PWTA 1V1CA 1UECA 1KJWA 2D8HA 2EGCA 3H0FA 5GJWB 1U3OA 2RQVA 4KRTA 3VS1A 2IIMA 4J9IA 1K9AA 1UHCA 2ROTA 1K1ZA 4GBQA 1JXMA 1RLPC 4JZ3A 4AFQC 2AKKA 4LN2A 3EG3A 3M0PA 3TSZA 3THKA 1SHGA 3GBQA 2CUDA 2C0TA 2J06A 3PE0A 3TVTA 4OMLA 1T3LA 2YSQA 2RN8A 4RTUA 1X2KA 2BZ8A 2JMAA 4LUDA 2PTKA 1SEMA 5GJVB 4D8DA 1W1FA 1UFFA 2AZSA 2KT8A 1HJDA 2W0ZA 2NUZA 4GLMA 1OOTA 3UA7A 2CH4W 1B07A 4EIKA 2DBMA 2LJ1A 2DJQA 2KR3A 2OI3A 3EG0A 3RBBB 2DL4A 2JXBA 1AZGB 3O5ZA 1M3BA 2KYMA 3U23A 2DA9A 1WXUA 3VS7A 2JS2A 1AVZC 5I11A 2A28A 3M0SA 2HSPA 1PRLC 2K9GA 1KFZA 1VYVA 2L0AA 1T3SA 4J9EA 2A08A 2FPEA 1K0SA 2ROLA 1AWJA 4RTXA 2DL7A 1OPLA 2O9SA 1ABOA 2EW3A 1OEBA 4OMMA 1RLQC 2CSIA 1ZUYA 1KSWA 2NWMA 4DEXA 1MUZA 1YN8A 4CC2A 1H8KA 2LX7A 1ZSGA 2E5KA 5IXFA 2RQWA 1CSKA 2EVRA 4IIOA 1OV3A 4LE9A 2CT3A 2J7IA 2ED1A 2JT4A 2YUQA 3RNJA 1X27A 3KFVA 4FSSA 1PHTA 1JQQA 1AOJA 1KIKA 2LZ6B 1NYGA 2K79A 2VKNA 2RNAA 2VVKA 2X3XD 2DL5A 3I9QA 2KNBB 4JJDA 2EPDA 1S1NA 1NG2A 3M0QA 2EYXA 4E6RA 1SHFA 1M30A 1W6XA 3TSWA 4AFZC 5L23A 1ZX6A 1G83A 1X6BA 3NPFA 2RF0A 1SPKA 4JZ4A 3REBB 4J9GA 2FRWA 2SRCA 5EC7A 1X43A 3A98A 1GBRA 2F2VA 4JJBA 5HCKA 2KT1A 5IH2A 1OPKA 4RTVA 2YDLA 4A63B 1A0NB 4WCIA 1K4US 2RQUA 2CT4A 1X69A 4AG2C 1UJ0A 2MCNA 2FRYA 3EG1A 1E6HA 1UG1A 4X1VA 1NEGA 1WI7A 3VS3A 1YNZA
chains in the Genus database with same CATH superfamily
3REAB 2JTFA 2JNGA 3NHNA 1KD1U 1JRIA 3M58A 4M7AE 2DVJA 4DEYA 3I56A 2FZCB 2K6DA 3MHXA 3E9FA 4FU6A 2XK0A 2EYZA 4FT2A 2VWFA 1Q82C 2LP5A 3PTAA 4M77E 4FW2A 1LNXA 1K8AC 3M0UA 1O9SA 3JCMX 2XIDA 2K5FA 1PKTA 3NTKA 1RI9A 2BZXA 4OB0B 2HBWA 4EPCA 3V8JA 5AYFA 3OSVA 5GANh 1G5VA 4LDXA 1YWOA 2RA2A 4RTTA 3PVQA 3C0CA 4FYYB 4BI3A 1D3BA 1I5OB 3UA6A 2DD5A 3P8DA 3WXMB 2QGFB 4ZTJA 3CMAQ 2RI3A 2ABLA 1JJ2P 1GBQA 1VQOA 2K3BA 2RHIA 2RQRA 1D0XA 2LNVA 2SEMA 4QQ6A 4XTUA 1ARKA 3OYMA 3ME9A 2LDMA 1TOVA 2LNHB 2RHUA 2RPNA 3I55T 2DXTA 4OMOA 4NS5A 1KQ1A 2CH4A 5HK0A 3V7RA 1KQSS 2EYWA 1VQKA 3FJPA 4IIMA 4PJJA 1WQWA 1B7TA 1LCKA 2E3HA 2K5LA 1YCSB 3RMSA 3L2ZA 2DXCA 2OTJA 3INZA 5I22A 2CP3A 1PSEA 2JZ2A 1K0XA 1UJYA 1YJWT 4M75G 1M1GA 1QCNA 1MNEA 4AG1C 2QTXA 1P92A 4XU1A 4HT8A 3OW2S 1VQ6T 2LJ0A 4JRQA 4M7AF 3G4SQ 3I35A 3C12A 3QDFA 1ZSZB 3JRZA 3LWHA 5FWCA 2OX7A 3URGA 3HHTB 3BW1A 4M77F 2MOXA 4NOYA 3X26B 2JUFA 2IG0A 1WHJA 1U1TA 3EH1A 1PD1A 2DX1A 2RMOA 1QP2A 1V29B 3G6ET 4XTXA 2L2PA 1GL5A 5FU7C 2P0QA 1QVFP 3SEMA 2DVEA 2FO0A 2FHDA 2QGGA 3OB9A 2CUBA 4J5YA 3FIFA 4C8QF 1TUCA 4QQGA 4HVUA 3VS0A 1QVGS 3L2QA 4RTWA 1VQ7T 2OTLQ 2QQBA 3VS4A 3FB9A 1UDLA 5FROA 4PJOA 2X9HA 1QLYA 1VQNT 2GQIA 2XKOC 3EG9A 2LCCA 3R6OA 4PJOC 2C0IA 5GAOp 5GAMf 4DBFA 2DIGA 3H6ZA 3OYFA 4E7ZA 4LXCA 5KYUB 1IZ6A 3OYNA 2DRKA 2V1RA 4QKUA 2RM4A 4PFZA 1Q86R 2VXEA 2VYTA 3RERA 4PFPA 2L8DA 3L2UA 2V8JA 1WYXA 3OS5A 3VS6A 2X3WD 4LUEA 4KGXB 2CDTA 3G1JA 3MP6A 1JU5C 1WPYA 2PVDB 1VUBA 1ZSZC 3M56A 1AWWA 2KRNA 2A37A 4HVWA 1G3YA 2DBKA 4L5GA 2DL3A 1HD3A 3IQLA 3KUFA 4M7DE 3SHWA 2OJ2A 5GAOr 2VGNA 3MPUB 3KBGA 4M7AB 2X4YA 2HZYA 2LC4A 3PVLA 1FMKA 4ZGJB 1M1KC 1VQLA 3QIIA 2NYSA 1XJWB 4M4ZA 3SDZA 4BY6C 4E47A 2V8KA 3GNGA 3CC4T 4M77B 1WFWA 5LJ3e 4EMHA 2RJDA 4ZN1A 1VYUA 3VS2A 1TSFA 2KE9A 4OMQA 2KXDA 1W2BA 4IURA 1Q82U 4MDWA 3P8BB 2OAUA 1JXOA 2FPFA 2CGHA 1K8AU 2CSQA 1NLPC 3PGGA 5FLXE 1VQ5Q 4AFSC 4C8QB 2XU8A 3CC7Q 3C95A 1JJ2S 1SRLA 2O2OA 3JCMb 1NEBA 3EFOA 3EH2A 2QQ9A 3LGLA 3X28B 4X9CA 1PG5B 1WGSA 1PWTA 2E6NA 1RAFB 1KJWA 1UECA 3TEEA 2Y4YA 2EGCA 1JB0E 3CCRT 3D7SB 3H0FA 3CXCA 1LPLA 4J9IA 1VQOT 5CKDA 4JZ3A 1YI2A 4AFQC 4LN2A 2MPXC 3M0PA 3SWNB 1TTHB 2D6FA 4M78E 3GBQA 4C0ZA 3QXEB 3PE0A 3LYIA 4PLIA 5L8RE 3TVTA 4AT1B 5GAMj 2YSQA 4E2FB 5KYXA 2E3IA 2KK4A 2BZ8A 5CCAA 1YIJA 4LUDA 4MDXA 3CBMA 5A2QE 4F7UG 4NL3A 2AZSA 2Z0WA 1Q81C 1HJDA 2OTJT 1Q95G 1B07A 4EIKA 3CD6Q 5LJ3h 4M77C 2DL4A 1M2VB 2RI2A 3O5ZA 2KYMA 3RKYA 4QVDA 3CCLT 2JS2A 3CCJQ 1K73C 1K9MR 2A28A 3M0SA 4A4EA 5GAOn 3UPUA 2RH2A 1KK7A 1O75A 4MZMA 1K0SA 2FPEA 1AWJA 2QYZA 1BI1A 5FRNA 5GAOm 3CEYA 2O9SA 3MCAB 4QW2A 2EW3A 2PUOB 2RJEA 2CSIA 1KSWA 2CZ7B 5LJ5e 3EFRA 3CBOA 3V7SA 4PFOA 1OV3A 1GXIE 2M16A 4L6V5 2JT4A 1HK9A 2VGMA 3EGXA 5FRMA 1X27A 1Q7YR 1PHTA 1RAAB 1JQQA 1NYGA 2DD4A 1M2OA 2EKOA 3PIPA 1DJ7B 3SWNC 4B9WA 3I9QA 2KNBB 1ZQ1A 1UGRB 1WJSA 1U8RA 1S1NA 3M0QA 4OF1A 1W4SA 4E6RA 1UGSB 1M30A 1W6XA 3TSWA 1VQ8Q 4E7LA 1G83A 1X6BA 3CCEA 1SPKA 4C0GA 4JLIA 2SRCA 5EC7A 4RMOA 1VQMQ 2PVGB 4JS4A 1GBRA 5HCKA 4RTVA 4WCIA 1VQ4A 3ZFJA 3S3NA 2QQAA 4XAXB 4JJNK 2CP7A 3EG1A 2HKNA 1E6HA 2IPOB 4X1VA 2HBPA 4C5EA 2V8IA 3VS3A 1YNZA 5KH6A 3RKXA 1KQSP 2X4XA 1YJWA 3BDUA 5LJ5h 2QDLA 1MMNA 3MKDA 3NTIA 3H41A 3EG2A 2R58A 4EMKA 2H3JA 2JM9A 2P4RA 3JCMd 2E65A 5GANg 1VQ6A 1E6GA 5GAN6 4EMKC 1UGVA 3JCMf 2QAZA 4RTYA 2BE7D 5GAN8 3QWXX 2DERA 2YRCA 1SRMA 1VQ9Q 3LH5A 3OW2P 4RUGA 1SSFA 4QVCA 4X9DA 1HXDA 4XTYA 3TREA 1M1KU 5FU6C 2ZZDA 3MP8A 3G6EA 4JLGA 4F04B 1TH7A 1FXXA 3A8OB 2YRDA 4Z89A 2LQWA 4F16A 2L89A 2ZCFB 2AHJB 2LJ3A 1OU8A 2MWOA 1VQ7A 4E7JA 1TS9A 3CCUQ 5J3BA 4DA4A 1U06A 1WLPB 2DNUA 3PT9A 2P0PA 1IRXA 4XTWA 2EBPA 3OSSC 3CCSQ 1QVGP 1EFNA 1IHWA 4O5VA 3TU4K 4JUVA 1YJNT 2FVUA 5GANe 4IUQA 1BK2A 1R77A 2CKKA 3UWNA 4M7DA 2ZPIB 3OYIA 1YI2T 4J83A 2FL7A 3FDRA 3A1PA 4XK8E 1C1AA 1N8RC 4M7DC 2KRMA 1VYTA 2HD0A 2FYKA 4CRIA 2VUBA 1D3BB 1FYNA 3M4GA 4C8QD 1Y96A 2QASA 1UUEA 2ZPHB 4PJOF 3S3OA 3CPWA 2AZVA 4C5GA 1IB8A 2DF6A 3VJPA 1NLOC 1Q81U 1TWBA 3CC2Q 2E5QA 1QP3A 1Z9QA 2MYSA 4M75D 4BE1A 1QWFA 5CKEA 3PMTA 2CP6A 3CXCS 1K73U 3CC4A 3CMEQ 3PIOA 2CZ1B 1TU0B 2MI6A 2XDPA 3H8ZA 5CO7A 1AHJB 4WF2A 1QKWA 3RMQA 1WX6A 3OMCA 1K76A 1GRIA 2X4WA 4F7UA 3I5RA 2BTTA 1X01A 2YWWA 4K11A 4OVAA 3RKWA 2A36A 1G3WA 4M78A 4C92D 2XDBA 2A0FB 2K57A 3GP8A 1B34A 2ZAEA 1ZBXA 2GTOA 1YP5A 2O88A 3G4SA 4M78C 3HRSA 3ZL7C 1WDXA 2MAMA 1BBZA 2CS7A 1IO6A 1M8MA 1YHQQ 3NMZC 2JTEA 3CCRA 4M7AG 2P84A 3CCQT 4CC4B 2QA4T 2ZGWA 3RDVA 2FPDA 4Y28E 2I0NA 4JPBW 4OGEA 3CCET 1WIEA 5AT1B 4AFUC 1VQPQ 1SKUB 2HAXA 5FU7B 3QZ5B 2ECZA 4J8OA 2DZCA 3QJ6A 3VRYA 1S72Q 1M27C 4DBQA 2F69A 5GAN2 2K4YA 2F2XA 2HMAA 1VQ4T 4LDVA 4C8QG 4F14A 2CP0A 1X2QA 1SSHA 3JB9F 3CCVT 1YJ9Q 2RK1A 2CYZB 1M1FA 4HVVA 2I2LA 2YHTA 4JRKA 5DLOA 1MHNA 4PJOB 3CCLA 3HTRA 3I5SA 4BE2A 1YWPA 2H3EB 1FMWA 3EG9B 4AMCA 1N9SA 2YXYA 4D6WA 4MMLA 2EJ9A 1SF9A 1UGPB 3I56Q 5FWBA 1F1BB 5GAN3 3EHQA 4EMGA 5CIUA 1I81A 1PRMC 1LJOA 2QXFA 4ORZA 2DO3A 3EHRA 5M9OA 2P0KA 1CKAA 2AKLA 1G2BA 2GQVA 1GFDA 9ATCB 5KYYA 2COZA 1HYOA 2JS0A 3MEAA 4C92G 1XTDA 5IAYA 3JCMV 3M0TA 1XNIA 2KSSA 3TQ7P 2LMJA 2X35A 5KYNA 3X20B 3NTHA 1G8XA 4J7IA 2D8HA 3E19A 4XU3A 5GJWB 3L42A 3SD4A 2RQVA 4MZPA 5HY6A 3MJXA 3VS1A 4OGCA 1KC8C 4E7IA 4BY6B 1K1ZA 1JXMA 3MO8A 2E41A 3EG3A 2DXBA 2G3RA 2VXFA 1T3LA 4OMLA 3DB3A 5GAMd 2RN8A 2DFUA 4RTUA 1Q82R 3F70A 2O01E 5LJ3g 3QBYA 2EFIA 5GJVB 1K8AR 1VQKQ 3GLXA 1IXDA 3V7CA 2CP2A 8AT1B 3M59A 3EGDA 4LDYA 1PM3A 5A0LA 2ZPGB 3RBBB 1R0BG 1M3BA 3C94A 4KUIA 1KQ2A 2DA9A 5LL6S 3UT1A 3VS7A 1AVZC 5CQXA 5I11A 4JS5A 5GAN7 1IGQA 3FC3A 4A53A 1PRLC 1OI1A 2DYIA 3G7ZA 1VYVA 2L0AA 1T3SA 4J9EA 1WHKA 4ZGEB 3EFOB 4RTXA 1N8RU 1ABOA 3CMAT 2FZGB 1OEBA 4XTVA 4OB3B 1ZUYA 3JAME 2QEXQ 5GAMh 4CC2A 1H8KA 2E70A 1ZSGA 1C0MA 4LDWA 1CSKA 4IIOA 3RNJA 5KYXB 4PLLA 3QZ9B 3GF5A 1KIKA 3MP1A 5A0GA 1IHVA 2X3XD 5GMKm 1I4K1 3J80E 1N9RA 1OX9A 4JJDA 3G71Q 4HCCA 2PUKB 2EYXA 3CCJA 3DLMA 3CCMA 1SHFA 4AFZC 1ZX6A 3NPFA 1WHLA 3PFSA 4JZ4A 3REBB 2FRWA 5KYWA 1X43A 2RO0A 3A98A 2EWNA 2COWA 4JJBA 5IH2A 1OPKA 1RAEB 3HSBA 3CPWS 2RQUA 2GCXA 2LRQA 2CT4A 3G4ST 4BDZA 5GAOl 1I5LA 2EJFA 3JCMP 3QO3A 2YLCA 1YJNA 1X69A 1OU9A 4AG2C 5LJ5g 3M5AA 5CKHA 1KHIA 4F7UE 3VUBA 2E64A 2B86A 4KBMB 3BE3A 4ATOA 1H92A 1T0HA 3EGXB 3QHSA 4N4GA 3H9NA 5GAN5 1EIFA 3L2WA 2LQ8A 1TUDA 5HK3A 4JJCA 2JM8A 4CC3A 2EGAA 1YITQ 1OYXA 1QKXA 3JCMQ 5DM7R 2HKQB 3V8LA 2OTLT 1BB9A 2NLUA 4DQ2A 4C0DC 2HCKA 5CR2A 2RQTA 1N6AA 1UGQB 2C0OA 4CI0C 5IT9E 4TVRA 4RCBA 2EKHA 2ZPBB 4KGVB 1VQLQ 1M90C 1GCQA 4KGZB 4RKUE 4M7DF 2DJZA 3OY9A 2DTOA 2P4TA 1WZOA 2RHYA 2EYYA 2R5MA 2L3SA 2CREA 3E1SA 4J7FA 3CXCP 1IGUA 4P5NA 4E7HA 2F5TX 8ATCB 4XU0A 1X6GA 1FWZA 1WXBA 3ZBDA 1ZLMA 3OYCA 2LVMA 5ECAA 2MMPA 2PNIA 4EMKB 3OQ5A 3M4YA 2YLBA 3QUIA 4PJOD 4M75A 5GMKe 1ZUUA 3HL8A 3C4SA 2KYBA 3CCQA 2FG0A 3DKMA 2QA4A 4M75C 1M1KR 5FU6B 1KC8U 1VA7A 4BACA 2PU9B 1YI2Q 2KGTA 4R0KA 2ENMA 4FSXA 1I0CA 4V2SA 4IUVA 2BUDA 4EDUA 4F7UF 2DXUA 1NM7A 1X6OA 1YIJQ 2QK0A 4C92A 3HKSA 2O4XA 3GPLA 2MIOA 4CC7A 4M78F 1VQ5T 3JCMe 2AK5A 3CCVA 3A5ZB 4OB2B 3CC7T 3BY7A 1U1SA 1QQJA 1QVPA 5LJ3j 1H3HA 3M0RA 1J3TA 2KEAA 4KH0B 1T0JA 2WACA 3OYKA 2KI7A 3OA6A 2DTIA 2YUPA 2QDYB 3T9NA 4YTLA 4QT7A 1OZ2A 3OMGA 3O8VA 4IUPA 4Y91A 4GLKA 3VS5A 5KE2A 1Y57A 4J9CA 4HCZA 4KULA 2COYA 1WNLA 3OYYA 4RG2A 4M7DB 1N27A 1PC0A 2DM1A 3VYHB 2J6OA 5GMKh 3UF4A 3WVDB 1QVGA 4UC4A 2VASA 2L3PA 4J9FA 4F17A 2KAFA 3OBWA 6AT1B 3META 3CQTA 1G3TA 4HT9A 2K5IA 2XI9A 4FL6A 3VU3C 4J6XA 4RTZA 1Y96B 1M3CA 1Q81R 3CD6T 1G3SA 2LT4A 4PJOG 3EGUA 1JO8A 2G6FX 2DE0X 4Y92A 3CCJT 1ABQA 3CCMT 2O31A 3JV3A 1YFNA 1K73R 5EG2A 1U5SA 2AT1B 3BFMA 1ZBJA 2KRSA 3CCEQ 1OZ3A 1I07A 1M3AA 1BI3A 3JCMh 3VUZA 1VIFA 2V1QA 1PKSA 4R56A 1Y71A 3OS2A 1JEGA 2PZ1A 1EX4A 4RG8A 4IKFA 3I55Q 2K2MA 3GIBA 4M7AD 2DL8A 3OYDA 3QSUA 3NFCA 4PJMA 4A54A 4F7UB 2JVVA 5IHIA 1H3ZA 2L3RA 5C6SA 3R6NA 2YUNA 4M77D 1OQKA 1N5ZA 2M0YA 2DIQA 3MEVA 4M78B 1RABB 2NUTA 2FZKB 1B34B 2M51A 1YJWQ 2ATCB 1YHQA 3GOXA 4LD6A 3MEUA 2FEIA 1B3QA 3L2RA 1W2BS 4E7SA 3CMAA 5CKBA 2J6KA 1VQ8T 2H8HA 2DMOA 3QKJA 3FEOA 1VQ6Q 1KG1A 4HCBA 1WQ7A 2XDDA 3N5BB 4OMPA 3SFMA 1VQMT 2D1XA 1I8FA 5FW9A 4BUGA 1S72A 4ELYC 3PNWC 5KE3A 3NGPA 3ER0A 2NUPA 1C6VX 4J9BA 3FJ5A 2D8JA 2E4HA 3M54A 3ULRB 2ESWA 1JJ2A 1HSQA 3UATA 2OAWA 5GANf 1YJ9A 1V1CA 4FYVB 1M90U 5CKFA 3G6EQ 1D0ZA 4KH1B 3JB9G 2IVWA 2IIMA 3HFNA 1M5Q1 2DETA 1RLPC 4DBHA 4O6JA 3OYEA 4PJLA 3THKA 1SHGA 1VQ7Q 4N4IA 1D09B 1VQNQ 1BIBA 2XD0A 4L59A 2JMAA 3AHUA 2PTKA 1SEMA 1NJIC 1LOJA 1UFFA 4FW1A 2CP5A 2KT8A 3QDRB 4RCCA 2W0ZA 2NUZA 2DEUA 3UA7A 2CH4W 1FMVA 2LJ1A 2KR3A 1VQ9T 1Q86C 5DLQE 1M9SA 4E7KA 1WXUA 4C8QE 5KYYB 3CPWP 4M77G 2M1HA 3JCMJ 3QYGB 1KFZA 2A3LA 2ROLA 4J6WA 2DL7A 1OPLA 3M9QA 1PSFA 5GAMg 2EYQA 3HPWA 1Y7XA 4M75E 4OB1B 1RI0A 1RLQC 1UB4A 2OTLA 3J7AF 5I2MA 4DEXA 3CCUT 1D1BA 1YN8A 2D9TA 4XU2A 1WHMA 4N0AA 2E5KA 3PMIA 4A4HA 2RQWA 1D1AA 2EVRA 3GNFB 2Y90A 2CT3A 2JOYA 4IUUA 2RHZA 2ED1A 3HFOA 3CCST 3LW5E 1BYMA 1QVFA 1ZA1B 4N0AC 4OMFB 3DLLA 1ZA2B 4A4KA 2MF2A 1AOJA 2LZ6B 1NZ9A 3Q1JA 2ZPFB 2RNAA 3CC4Q 3LH0A 4BI8B 2EPDA 4C92E 1NG2A 3EGDB 2K3XA 3BDLA 1NE8A 2GF7A 3JB9J 4J9GA 1N8RR 2GFAA 2PVOB 2JJ9A 2XICA 2F2VA 2KT1A 1V76A 5GANj 4FIBA 1XQHA 4JRPA 4XQ3A 2QEXA 5GAMe 4MMKA 2XG8D 2KDSA 4FCYA 1BCOA 2MCNA 3JB9I 3CC2T 1VIEA 2FRYA 3CCRQ 4N4HA 2WSEE 1UG1A 4HA8A 2EQUA 1D0YA 1NEGA 2VC8A 2M02A 5CAIA 1QCFA 2EAYA 3S6WA 3FRNA 1VQOQ 2DZ9A 3CMET 3JCMc 2GTJA 3WVEB 1CKBA 2BKDN 2KVQG 4M7DD 3E2UA 3G71A 2EQIA 2JMCA 3RR6A 3SB2A 1GFCA 5J39A 2ZPEB 2CZ0B 2XHCA 2XMFA 3L2VA 1RUWA 2E10A 2DYBA 4FYWB 5GMKl 4KUDK 1IREB 3VRZA 3P8HA 3JCMW 1AD5A 5I21A 3OYJA 2ED0A 2F5KA 4C0FA 1VQ5A 4J6YA 1E7OA 3CC7A 2GNCA 4FT4A 2OTJQ 1YCYA 5KYWB 2QG9B 5DY9A 4XTZA 3X24B 4GY5A 1K9MC 4M75F 3CCLQ 4ZN3A 4NL2A 2HEQA 4OP0A 2DK3A 1NJIR 2JW4A 1YHQT 4A4FA 2HDAA 1MV3A 3A8MB 4R55A 3A8HB 5IHNA 4PNOA 4LD9K 1LVKA 2WSCE 1XOVA 3MEWA 1X75C 1VQPT 4LNPA 2RD1A 4Z88A 2KROA 4ZTFA 2E1HA 2K3YA 2M9UA 3RIRA 1ZSZA 1WJRA 2JTMA 1YBYA 1S72T 1YITA 2D0QB 1WA7A 4HCKA 4C92F 2AIRB 2K7AA 1Z9ZA 5GAN4 1QW1A 2HQHA 4DBRA 1Q7YC 4C0DB 1RAGB 1AWXA 3OS1A 2EJGA 4M78D 1YJ9T 3CD6A 3JB9H 4JRIA 1AWOA 4ZNXA 2DLPA 3FLGA 4VUBA 1R0CB 4BI4A 3I56T 5IN1A 2LT1A 1WXTA 2DRMA 3RUXA 4PKCC 4Z8AA 4M7DG 1OULA 2VV5A 2F1LA 4WTOB 3H0IA 4LDUA 5KYUA 3JSCA 1H641 2HSEB 1BI0A 1NJIU 1UHFA 2KBTA 2LCSA 4ELZC 5LJ3d 2KY9A 2DAQA 1Q86U 1WJQA 2EQKA 4BB7A 1MMGA 1RAHB 1FX7A 2A7YA 5HKCA 4B9XA 5LJ3f 1MV0B 2GBQA 4M75B 2DEQA 4HKEA 3H0HA 1NPRA 4J9HA 1KC8R 1QWEA 2KMTA 1VQ8A 2W10A 2C06A 1GCPA 1TUGB 2D0NA 4A4GA 4DOWA 2M0OA 4BE0A 1BI2A 3HRTA 4DOVA 1MMAA 1VQMA 1QCOA 3QWYA 3ASKA 4M7AA 2BIVA 2BZYA 1W2BP 1AT1B 5A0DA 1NBEB 1VQKT 4M7AC 1NPPA 2LCLA 5D6YA 3X25B 4M77A 1RADB 3AT1B 3ZEHA 2EGEA 3LWIA 2EQMA 3UDCA 4C92B 2WSFE 4KT0E 2O4XB 1PNJA 4ANJA 2X4JA 2YT6A 4M78G 1GCQC 2MWPA 1JBMA 3JCMg 1KD1C 3CCMQ 2JN0A 1RAIB 3VV0A 4C8QA 1BU1A 1W70A 1NYFA 5IHKA 2HL3A 4D8KA 2VB6A 2RK2A 1UTIA 4ESRA 4HXJA 3OYLA 4Z02A 2O9VA 4OMNA 2LX9A 2DPPB 4C8QC 2YUOA 5C0MA 2BE9B 4QQDA 1SG5A 2LQKA 2L5QA 2J05A 2QQSA 2QEXT 2YRVA 1M4ZA 1Y07A 2LQNA 1KQSA 1ZUKA 1YJNQ 3OYGA 1PD0A 1QVFS 1VQ9A 2EQJA 2J6FA 3SWNA 2RJCA 1TXQA 4FM4B 1EZZB 4J9DA 2EIFA 4PK4A 3G71T 5LJ5d 2B8AA 1VOMA 3OYHA 3A8GB 2L3QA 2QQRA 2F2WA 4PL6A 5LJ5f 1ACMB 2PQWA 4ZGDB 3M53A 2RI5A 5KCOA 1PCXA 2R57A 5IXBA 1AEYA 3OW2A 2KXCA 3CCUA 4ME7A 1UE9A 1M2VA 4C92C 1AZEA 4QVZA 3I55A 4II1A 1TG0A 5D6WA 3CCSA 2DILA 3OYAA 2R5AA 2X51A 2GGRA 1Y0MA 1K9MU 3HRUA 1I1JA 3QG1A 4Q5WA 4JDSA 1U3OA 3M57A 4KRTA 5CQYA 3LGFA 1K9AA 1UHCA 4MZTA 1BKBA 2ROTA 3M55A 4GBQA 2MK5A 1WHGA 2AKKA 2E6ZA 5D7UA 1ZHIA 4PJOE 3TSZA 2CUDA 2C0TA 2J06A 2NUTB 7AT1B 2DKGA 3OS0A 1MGQA 1YITT 1X2KA 2HQXA 2QTVA 2RHXA 3KXTA 4B6MA 1MMDA 4D8DA 1W1FA 1Q7YU 5GAOq 3JB9D 4BDYA 2HQEA 3V8KA 4GLMA 1OOTA 2DBMA 3CC2A 2DJQA 2OI3A 3EG0A 2JXBA 1AZGB 3CCQQ 3U23A 2QA4Q 1VQLT 1KHCA 4C5HA 2HSPA 2NUPB 3VKIA 3CMEA 5J26A 2K9GA 1M90R 3QJYA 1D1CA 2A08A 3QYHB 1BIAA 3OYBA 2KQWA 4C5IA 1MNDA 1QMCA 2RB6A 2LTOA 3OBYA 2GFUA 2QI2A 1KD1R 4OMMA 2FB7A 1VQ4Q 2NWMA 1OX8A 4PJNA 4IUTA 1MUZA 3LLRA 3EAEA 2LX7A 5IXFA 3CCVQ 3E9GA 1VQNA 2HNIA 4LE9A 3LX7A 1UEBA 2J7IA 2Y4XA 3L1AA 3TCJA 2DTHA 2YUQA 5I2SA 1BCMA 3KFVA 4FSSA 3A8LB 2CZ6B 4X34A 1M8VA 2VKNA 2K79A 2VVKA 5LJ5j 1RL2A 2DL5A 3S3MA 3CPFA 3RESA 1RACB 3QPHA 1VQPA 5CK9A 5L23A 3J81E 3HP9A 2RF0A 2E12A 2HL5C 5KCHA 5GMKj 5D6XA 4FYXB 1R8OB 2K2VA 2YDLA 4A63B 4BD3A 5GANd 2RJFA 1YIJT 1A0NB 5GMKi 1WHHA 1K4US 2V26A 3VYGA 1UJ0A 3DB4A 3CBPA 1WI7A 3EFSA 5CVIA
chains in the Genus database with same CATH topology
1QCFA 3REAB 2B86A 3NHNA 1H92A 1T0HA 2DVJA 4DEYA 2QDLA 2K6DA 2GTJA 1CKBA 3H41A 3EG2A 1TUDA 4JJCA 2EQIA 2JM8A 2JMCA 1GFCA 2EGAA 4CC3A 2EYZA 1QKXA 2JM9A 2P4RA 2VWFA 2LP5A 2XMFA 1E6GA 1RUWA 2DYBA 3M0UA 3VRZA 1BB9A 1PKTA 1AD5A 1RI9A 2BZXA 2HBWA 1UGVA 2ED0A 4RTYA 2HCKA 3QWXX 1E7OA 2GNCA 1YWOA 1SRMA 2RQTA 4RTTA 2C0OA 3LH5A 3PVQA 3C0CA 4RUGA 2EKHA 2HEQA 1GCQA 2JW4A 2HDAA 1MV3A 5IHNA 3UA6A 4Z89A 2LQWA 4F16A 1XOVA 2EYYA 2ABLA 1GBQA 2L3SA 4LNPA 2CREA 4Z88A 2LJ3A 2K3BA 2KROA 2RQRA 2SEMA 1ARKA 2LNHB 1U06A 1WA7A 1WLPB 2RPNA 4HCKA 2DNUA 1X6GA 1WXBA 2K7AA 4OMOA 1Z9ZA 1ZLMA 2EBPA 5ECAA 2PNIA 2CH4A 1EFNA 2EYWA 1AWXA 4IIMA 1LCKA 1YCSB 1ZUUA 1BK2A 2KYBA 5I22A 1AWOA 2FG0A 4ZNXA 2DLPA 1VA7A 1K0XA 1UJYA 2KGTA 2KRMA 4R0KA 2ENMA 1VYTA 4AG1C 1WXTA 1I0CA 2DRMA 4Z8AA 1FYNA 1NM7A 2LJ0A 3H0IA 1UUEA 2MIOA 4CC7A 2AZVA 2AK5A 3I35A 1UHFA 2DF6A 1NLOC 2KBTA 5FWCA 2LCSA 1Z9QA 2MOXA 1H3HA 3M0RA 1QWFA 1J3TA 2KEAA 1T0JA 2DX1A 2RMOA 2YUPA 4QT7A 2L2PA 1MV0B 2GBQA 1GL5A 3SEMA 3VS5A 3H0HA 2FO0A 1Y57A 4J9CA 2CUBA 4J9HA 1QKWA 1QWEA 1WX6A 2W10A 1TUCA 4HVUA 1GCPA 1K76A 1GRIA 2D0NA 3VS0A 4RTWA 3I5RA 2BTTA 2DM1A 2J6OA 4K11A 3UF4A 3QWYA 3VS4A 1UDLA 2L3PA 2A36A 4J9FA 1QLYA 4F17A 2GQIA 2BZYA 3CQTA 2GTOA 1YP5A 2O88A 2C0IA 4RTZA 2EGEA 3ZL7C 1WDXA 1M3CA 1BBZA 1IO6A 1M8MA 3NMZC 2JTEA 1PNJA 3EGUA 2YT6A 2DRKA 2V1RA 1GCQC 1JO8A 2G6FX 2DE0X 4Y92A 4CC4B 1ABQA 2FPDA 2O31A 3JV3A 2I0NA 4JPBW 1WIEA 4AFUC 1WYXA 3VS6A 1U5SA 2X3WD 1ZBJA 2KRSA 4LUEA 1BU1A 2CDTA 1I07A 1M3AA 1W70A 1NYFA 5IHKA 4D8KA 2ECZA 1JU5C 1UTIA 4ESRA 4HXJA 3VRYA 2O9VA 2V1QA 1M27C 1PKSA 4OMNA 1JEGA 2PZ1A 2YUOA 1AWWA 2F2XA 2KRNA 2K2MA 2A37A 4HVWA 2DBKA 2J05A 4F14A 2DL3A 2DL8A 1X2QA 1HD3A 1SSHA 2LQNA 3IQLA 1ZUKA 5IHIA 3SHWA 4HVVA 3R6NA 2OJ2A 2YUNA 1N5ZA 2J6FA 3I5SA 1FMKA 2M0YA 3PVLA 1YWPA 4M4ZA 2M51A 4J9DA 5FWBA 2FEIA 3EHQA 1B3QA 1WFWA 1PRMC 1VYUA 4ORZA 3VS2A 2KE9A 2L3QA 2J6KA 4OMQA 2H8HA 2DMOA 3EHRA 2F2WA 2KXDA 1AEYA 5IXBA 1CKAA 4OMPA 2KXCA 1JXOA 2AKLA 2FPFA 1UE9A 2CSQA 2D1XA 1G2BA 1NLPC 5FW9A 4AFSC 1GFDA 1AZEA 3NGPA 1TG0A 2JS0A 4J9BA 1SRLA 2O2OA 3FJ5A 2D8JA 2DILA 3M0TA 2GGRA 1NEBA 3ULRB 1Y0MA 2LMJA 2ESWA 1HSQA 3UATA 1I1JA 2OAWA 1PWTA 1V1CA 1UECA 1KJWA 2D8HA 2EGCA 3H0FA 5GJWB 1U3OA 2RQVA 4KRTA 3VS1A 2IIMA 4J9IA 1K9AA 1UHCA 2ROTA 1K1ZA 4GBQA 1JXMA 1RLPC 4JZ3A 4AFQC 2AKKA 4LN2A 3EG3A 3M0PA 3TSZA 3THKA 1SHGA 3GBQA 2CUDA 2C0TA 2J06A 3PE0A 3TVTA 4OMLA 1T3LA 2YSQA 2RN8A 4RTUA 1X2KA 2BZ8A 2JMAA 4LUDA 2PTKA 1SEMA 5GJVB 4D8DA 1W1FA 1UFFA 2AZSA 2KT8A 1HJDA 2W0ZA 2NUZA 4GLMA 1OOTA 3UA7A 2CH4W 1B07A 4EIKA 2DBMA 2LJ1A 2DJQA 2KR3A 2OI3A 3EG0A 3RBBB 2DL4A 2JXBA 1AZGB 3O5ZA 1M3BA 2KYMA 3U23A 2DA9A 1WXUA 3VS7A 2JS2A 1AVZC 5I11A 2A28A 3M0SA 2HSPA 1PRLC 2K9GA 1KFZA 1VYVA 2L0AA 1T3SA 4J9EA 2A08A 2FPEA 1K0SA 2ROLA 1AWJA 4RTXA 2DL7A 1OPLA 2O9SA 1ABOA 2EW3A 1OEBA 4OMMA 1RLQC 2CSIA 1ZUYA 1KSWA 2NWMA 4DEXA 1MUZA 1YN8A 4CC2A 1H8KA 2LX7A 1ZSGA 2E5KA 5IXFA 2RQWA 1CSKA 2EVRA 4IIOA 1OV3A 4LE9A 2CT3A 2J7IA 2ED1A 2JT4A 2YUQA 3RNJA 1X27A 3KFVA 4FSSA 1PHTA 1JQQA 1AOJA 1KIKA 2LZ6B 1NYGA 2K79A 2VKNA 2RNAA 2VVKA 2X3XD 2DL5A 3I9QA 2KNBB 4JJDA 2EPDA 1S1NA 1NG2A 3M0QA 2EYXA 4E6RA 1SHFA 1M30A 1W6XA 3TSWA 4AFZC 5L23A 1ZX6A 1G83A 1X6BA 3NPFA 2RF0A 1SPKA 4JZ4A 3REBB 4J9GA 2FRWA 2SRCA 5EC7A 1X43A 3A98A 1GBRA 2F2VA 4JJBA 5HCKA 2KT1A 5IH2A 1OPKA 4RTVA 2YDLA 4A63B 1A0NB 4WCIA 1K4US 2RQUA 2CT4A 1X69A 4AG2C 1UJ0A 2MCNA 2FRYA 3EG1A 1E6HA 1UG1A 4X1VA 1NEGA 1WI7A 3VS3A 1YNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCF A;  3REA B;  2B86 A;  3NHN A;  1H92 A;  1T0H A;  2DVJ A;  4DEY A;  2QDL A;  2K6D A;  2GTJ A;  1CKB A;  3H41 A;  3EG2 A;  1TUD A;  4JJC A;  2EQI A;  2JM8 A;  2JMC A;  1GFC A;  2EGA A;  4CC3 A;  2EYZ A;  1QKX A;  2JM9 A;  2P4R A;  2VWF A;  2LP5 A;  2XMF A;  1E6G A;  1RUW A;  2DYB A;  3M0U A;  3VRZ A;  1BB9 A;  1PKT A;  1AD5 A;  1RI9 A;  2BZX A;  2HBW A;  1UGV A;  2ED0 A;  4RTY A;  2HCK A;  3QWX X;  1E7O A;  2GNC A;  1YWO A;  1SRM A;  2RQT A;  4RTT A;  2C0O A;  3LH5 A;  3PVQ A;  3C0C A;  4RUG A;  2EKH A;  2HEQ A;  1GCQ A;  2JW4 A;  2HDA A;  1MV3 A;  5IHN A;  3UA6 A;  4Z89 A;  2LQW A;  4F16 A;  1XOV A;  2EYY A;  2ABL A;  1GBQ A;  2L3S A;  4LNP A;  2CRE A;  4Z88 A;  2LJ3 A;  2K3B A;  2KRO A;  2RQR A;  2SEM A;  1ARK A;  2LNH B;  1U06 A;  1WA7 A;  1WLP B;  2RPN A;  4HCK A;  2DNU A;  1X6G A;  1WXB A;  2K7A A;  4OMO A;  1Z9Z A;  1ZLM A;  2EBP A;  5ECA A;  2PNI A;  2CH4 A;  1EFN A;  2EYW A;  1AWX A;  4IIM A;  1LCK A;  1YCS B;  1ZUU A;  1BK2 A;  2KYB A;  5I22 A;  1AWO A;  2FG0 A;  4ZNX A;  2DLP A;  1VA7 A;  1K0X A;  1UJY A;  2KGT A;  2KRM A;  4R0K A;  2ENM A;  1VYT A;  4AG1 C;  1WXT A;  1I0C A;  2DRM A;  4Z8A A;  1FYN A;  1NM7 A;  2LJ0 A;  3H0I A;  1UUE A;  2MIO A;  4CC7 A;  2AZV A;  2AK5 A;  3I35 A;  1UHF A;  2DF6 A;  1NLO C;  2KBT A;  5FWC A;  2LCS A;  1Z9Q A;  2MOX A;  1H3H A;  3M0R A;  1QWF A;  1J3T A;  2KEA A;  1T0J A;  2DX1 A;  2RMO A;  2YUP A;  4QT7 A;  2L2P A;  1MV0 B;  2GBQ A;  1GL5 A;  3SEM A;  3VS5 A;  3H0H A;  2FO0 A;  1Y57 A;  4J9C A;  2CUB A;  4J9H A;  1QKW A;  1QWE A;  1WX6 A;  2W10 A;  1TUC A;  4HVU A;  1GCP A;  1K76 A;  1GRI A;  2D0N A;  3VS0 A;  4RTW A;  3I5R A;  2BTT A;  2DM1 A;  2J6O A;  4K11 A;  3UF4 A;  3QWY A;  3VS4 A;  1UDL A;  2L3P A;  2A36 A;  4J9F A;  1QLY A;  4F17 A;  2GQI A;  2BZY A;  3CQT A;  2GTO A;  1YP5 A;  2O88 A;  2C0I A;  4RTZ A;  2EGE A;  3ZL7 C;  1WDX A;  1M3C A;  1BBZ A;  1IO6 A;  1M8M A;  3NMZ C;  2JTE A;  1PNJ A;  3EGU A;  2YT6 A;  2DRK A;  2V1R A;  1GCQ C;  1JO8 A;  2G6F X;  2DE0 X;  4Y92 A;  4CC4 B;  1ABQ A;  2FPD A;  2O31 A;  3JV3 A;  2I0N A;  4JPB W;  1WIE A;  4AFU C;  1WYX A;  3VS6 A;  1U5S A;  2X3W D;  1ZBJ A;  2KRS A;  4LUE A;  1BU1 A;  2CDT A;  1I07 A;  1M3A A;  1W70 A;  1NYF A;  5IHK A;  4D8K A;  2ECZ A;  1JU5 C;  1UTI A;  4ESR A;  4HXJ A;  3VRY A;  2O9V A;  2V1Q A;  1M27 C;  1PKS A;  4OMN A;  1JEG A;  2PZ1 A;  2YUO A;  1AWW A;  2F2X A;  2KRN A;  2K2M A;  2A37 A;  4HVW A;  2DBK A;  2J05 A;  4F14 A;  2DL3 A;  2DL8 A;  1X2Q A;  1HD3 A;  1SSH A;  2LQN A;  3IQL A;  1ZUK A;  5IHI A;  3SHW A;  4HVV A;  3R6N A;  2OJ2 A;  2YUN A;  1N5Z A;  2J6F A;  3I5S A;  1FMK A;  2M0Y A;  3PVL A;  1YWP A;  4M4Z A;  2M51 A;  4J9D A;  5FWB A;  2FEI A;  3EHQ A;  1B3Q A;  1WFW A;  1PRM C;  1VYU A;  4ORZ A;  3VS2 A;  2KE9 A;  2L3Q A;  2J6K A;  4OMQ A;  2H8H A;  2DMO A;  3EHR A;  2F2W A;  2KXD A;  1AEY A;  5IXB A;  1CKA A;  4OMP A;  2KXC A;  1JXO A;  2AKL A;  2FPF A;  1UE9 A;  2CSQ A;  2D1X A;  1G2B A;  1NLP C;  5FW9 A;  4AFS C;  1GFD A;  1AZE A;  3NGP A;  1TG0 A;  2JS0 A;  4J9B A;  1SRL A;  2O2O A;  3FJ5 A;  2D8J A;  2DIL A;  3M0T A;  2GGR A;  1NEB A;  3ULR B;  1Y0M A;  2LMJ A;  2ESW A;  1HSQ A;  3UAT A;  1I1J A;  2OAW A;  1PWT A;  1V1C A;  1UEC A;  1KJW A;  2D8H A;  2EGC A;  3H0F A;  5GJW B;  1U3O A;  2RQV A;  4KRT A;  3VS1 A;  2IIM A;  4J9I A;  1K9A A;  1UHC A;  2ROT A;  1K1Z A;  4GBQ A;  1JXM A;  1RLP C;  4JZ3 A;  4AFQ C;  2AKK A;  4LN2 A;  3EG3 A;  3M0P A;  3TSZ A;  3THK A;  1SHG A;  3GBQ A;  2CUD A;  2C0T A;  2J06 A;  3PE0 A;  3TVT A;  4OML A;  1T3L A;  2YSQ A;  2RN8 A;  4RTU A;  1X2K A;  2BZ8 A;  2JMA A;  4LUD A;  2PTK A;  1SEM A;  5GJV B;  4D8D A;  1W1F A;  1UFF A;  2AZS A;  2KT8 A;  1HJD A;  2W0Z A;  2NUZ A;  4GLM A;  1OOT A;  3UA7 A;  2CH4 W;  1B07 A;  4EIK A;  2DBM A;  2LJ1 A;  2DJQ A;  2KR3 A;  2OI3 A;  3EG0 A;  3RBB B;  2DL4 A;  2JXB A;  1AZG B;  3O5Z A;  1M3B A;  2KYM A;  3U23 A;  2DA9 A;  1WXU A;  3VS7 A;  2JS2 A;  1AVZ C;  5I11 A;  2A28 A;  3M0S A;  2HSP A;  1PRL C;  2K9G A;  1KFZ A;  1VYV A;  2L0A A;  1T3S A;  4J9E A;  2A08 A;  2FPE A;  1K0S A;  2ROL A;  1AWJ A;  4RTX A;  2DL7 A;  1OPL A;  2O9S A;  1ABO A;  2EW3 A;  1OEB A;  4OMM A;  1RLQ C;  2CSI A;  1ZUY A;  1KSW A;  2NWM A;  4DEX A;  1MUZ A;  1YN8 A;  4CC2 A;  1H8K A;  2LX7 A;  1ZSG A;  2E5K A;  5IXF A;  2RQW A;  1CSK A;  2EVR A;  4IIO A;  1OV3 A;  4LE9 A;  2CT3 A;  2J7I A;  2ED1 A;  2JT4 A;  2YUQ A;  3RNJ A;  1X27 A;  3KFV A;  4FSS A;  1PHT A;  1JQQ A;  1AOJ A;  1KIK A;  2LZ6 B;  1NYG A;  2K79 A;  2VKN A;  2RNA A;  2VVK A;  2X3X D;  2DL5 A;  3I9Q A;  2KNB B;  4JJD A;  2EPD A;  1S1N A;  1NG2 A;  3M0Q A;  2EYX A;  4E6R A;  1SHF A;  1M30 A;  1W6X A;  3TSW A;  4AFZ C;  5L23 A;  1ZX6 A;  1G83 A;  1X6B A;  3NPF A;  2RF0 A;  1SPK A;  4JZ4 A;  3REB B;  4J9G A;  2FRW A;  2SRC A;  5EC7 A;  1X43 A;  3A98 A;  1GBR A;  2F2V A;  4JJB A;  5HCK A;  2KT1 A;  5IH2 A;  1OPK A;  4RTV A;  2YDL A;  4A63 B;  1A0N B;  4WCI A;  1K4U S;  2RQU A;  2CT4 A;  1X69 A;  4AG2 C;  1UJ0 A;  2MCN A;  2FRY A;  3EG1 A;  1E6H A;  1UG1 A;  4X1V A;  1NEG A;  1WI7 A;  3VS3 A;  1YNZ A; 
#chains in the Genus database with same CATH topology
 3REA B;  2JTF A;  2JNG A;  3NHN A;  1KD1 U;  1JRI A;  3M58 A;  4M7A E;  2DVJ A;  4DEY A;  3I56 A;  2FZC B;  2K6D A;  3MHX A;  3E9F A;  4FU6 A;  2XK0 A;  2EYZ A;  4FT2 A;  2VWF A;  1Q82 C;  2LP5 A;  3PTA A;  4M77 E;  4FW2 A;  1LNX A;  1K8A C;  3M0U A;  1O9S A;  3JCM X;  2XID A;  2K5F A;  1PKT A;  3NTK A;  1RI9 A;  2BZX A;  4OB0 B;  2HBW A;  4EPC A;  3V8J A;  5AYF A;  3OSV A;  5GAN h;  1G5V A;  4LDX A;  1YWO A;  2RA2 A;  4RTT A;  3PVQ A;  3C0C A;  4FYY B;  4BI3 A;  1D3B A;  1I5O B;  3UA6 A;  2DD5 A;  3P8D A;  3WXM B;  2QGF B;  4ZTJ A;  3CMA Q;  2RI3 A;  2ABL A;  1JJ2 P;  1GBQ A;  1VQO A;  2K3B A;  2RHI A;  2RQR A;  1D0X A;  2LNV A;  2SEM A;  4QQ6 A;  4XTU A;  1ARK A;  3OYM A;  3ME9 A;  2LDM A;  1TOV A;  2LNH B;  2RHU A;  2RPN A;  3I55 T;  2DXT A;  4OMO A;  4NS5 A;  1KQ1 A;  2CH4 A;  5HK0 A;  3V7R A;  1KQS S;  2EYW A;  1VQK A;  3FJP A;  4IIM A;  4PJJ A;  1WQW A;  1B7T A;  1LCK A;  2E3H A;  2K5L A;  1YCS B;  3RMS A;  3L2Z A;  2DXC A;  2OTJ A;  3INZ A;  5I22 A;  2CP3 A;  1PSE A;  2JZ2 A;  1K0X A;  1UJY A;  1YJW T;  4M75 G;  1M1G A;  1QCN A;  1MNE A;  4AG1 C;  2QTX A;  1P92 A;  4XU1 A;  4HT8 A;  3OW2 S;  1VQ6 T;  2LJ0 A;  4JRQ A;  4M7A F;  3G4S Q;  3I35 A;  3C12 A;  3QDF A;  1ZSZ B;  3JRZ A;  3LWH A;  5FWC A;  2OX7 A;  3URG A;  3HHT B;  3BW1 A;  4M77 F;  2MOX A;  4NOY A;  3X26 B;  2JUF A;  2IG0 A;  1WHJ A;  1U1T A;  3EH1 A;  1PD1 A;  2DX1 A;  2RMO A;  1QP2 A;  1V29 B;  3G6E T;  4XTX A;  2L2P A;  1GL5 A;  5FU7 C;  2P0Q A;  1QVF P;  3SEM A;  2DVE A;  2FO0 A;  2FHD A;  2QGG A;  3OB9 A;  2CUB A;  4J5Y A;  3FIF A;  4C8Q F;  1TUC A;  4QQG A;  4HVU A;  3VS0 A;  1QVG S;  3L2Q A;  4RTW A;  1VQ7 T;  2OTL Q;  2QQB A;  3VS4 A;  3FB9 A;  1UDL A;  5FRO A;  4PJO A;  2X9H A;  1QLY A;  1VQN T;  2GQI A;  2XKO C;  3EG9 A;  2LCC A;  3R6O A;  4PJO C;  2C0I A;  5GAO p;  5GAM f;  4DBF A;  2DIG A;  3H6Z A;  3OYF A;  4E7Z A;  4LXC A;  5KYU B;  1IZ6 A;  3OYN A;  2DRK A;  2V1R A;  4QKU A;  2RM4 A;  4PFZ A;  1Q86 R;  2VXE A;  2VYT A;  3RER A;  4PFP A;  2L8D A;  3L2U A;  2V8J A;  1WYX A;  3OS5 A;  3VS6 A;  2X3W D;  4LUE A;  4KGX B;  2CDT A;  3G1J A;  3MP6 A;  1JU5 C;  1WPY A;  2PVD B;  1VUB A;  1ZSZ C;  3M56 A;  1AWW A;  2KRN A;  2A37 A;  4HVW A;  1G3Y A;  2DBK A;  4L5G A;  2DL3 A;  1HD3 A;  3IQL A;  3KUF A;  4M7D E;  3SHW A;  2OJ2 A;  5GAO r;  2VGN A;  3MPU B;  3KBG A;  4M7A B;  2X4Y A;  2HZY A;  2LC4 A;  3PVL A;  1FMK A;  4ZGJ B;  1M1K C;  1VQL A;  3QII A;  2NYS A;  1XJW B;  4M4Z A;  3SDZ A;  4BY6 C;  4E47 A;  2V8K A;  3GNG A;  3CC4 T;  4M77 B;  1WFW A;  5LJ3 e;  4EMH A;  2RJD A;  4ZN1 A;  1VYU A;  3VS2 A;  1TSF A;  2KE9 A;  4OMQ A;  2KXD A;  1W2B A;  4IUR A;  1Q82 U;  4MDW A;  3P8B B;  2OAU A;  1JXO A;  2FPF A;  2CGH A;  1K8A U;  2CSQ A;  1NLP C;  3PGG A;  5FLX E;  1VQ5 Q;  4AFS C;  4C8Q B;  2XU8 A;  3CC7 Q;  3C95 A;  1JJ2 S;  1SRL A;  2O2O A;  3JCM b;  1NEB A;  3EFO A;  3EH2 A;  2QQ9 A;  3LGL A;  3X28 B;  4X9C A;  1PG5 B;  1WGS A;  1PWT A;  2E6N A;  1RAF B;  1KJW A;  1UEC A;  3TEE A;  2Y4Y A;  2EGC A;  1JB0 E;  3CCR T;  3D7S B;  3H0F A;  3CXC A;  1LPL A;  4J9I A;  1VQO T;  5CKD A;  4JZ3 A;  1YI2 A;  4AFQ C;  4LN2 A;  2MPX C;  3M0P A;  3SWN B;  1TTH B;  2D6F A;  4M78 E;  3GBQ A;  4C0Z A;  3QXE B;  3PE0 A;  3LYI A;  4PLI A;  5L8R E;  3TVT A;  4AT1 B;  5GAM j;  2YSQ A;  4E2F B;  5KYX A;  2E3I A;  2KK4 A;  2BZ8 A;  5CCA A;  1YIJ A;  4LUD A;  4MDX A;  3CBM A;  5A2Q E;  4F7U G;  4NL3 A;  2AZS A;  2Z0W A;  1Q81 C;  1HJD A;  2OTJ T;  1Q95 G;  1B07 A;  4EIK A;  3CD6 Q;  5LJ3 h;  4M77 C;  2DL4 A;  1M2V B;  2RI2 A;  3O5Z A;  2KYM A;  3RKY A;  4QVD A;  3CCL T;  2JS2 A;  3CCJ Q;  1K73 C;  1K9M R;  2A28 A;  3M0S A;  4A4E A;  5GAO n;  3UPU A;  2RH2 A;  1KK7 A;  1O75 A;  4MZM A;  1K0S A;  2FPE A;  1AWJ A;  2QYZ A;  1BI1 A;  5FRN A;  5GAO m;  3CEY A;  2O9S A;  3MCA B;  4QW2 A;  2EW3 A;  2PUO B;  2RJE A;  2CSI A;  1KSW A;  2CZ7 B;  5LJ5 e;  3EFR A;  3CBO A;  3V7S A;  4PFO A;  1OV3 A;  1GXI E;  2M16 A;  4L6V 5;  2JT4 A;  1HK9 A;  2VGM A;  3EGX A;  5FRM A;  1X27 A;  1Q7Y R;  1PHT A;  1RAA B;  1JQQ A;  1NYG A;  2DD4 A;  1M2O A;  2EKO A;  3PIP A;  1DJ7 B;  3SWN C;  4B9W A;  3I9Q A;  2KNB B;  1ZQ1 A;  1UGR B;  1WJS A;  1U8R A;  1S1N A;  3M0Q A;  4OF1 A;  1W4S A;  4E6R A;  1UGS B;  1M30 A;  1W6X A;  3TSW A;  1VQ8 Q;  4E7L A;  1G83 A;  1X6B A;  3CCE A;  1SPK A;  4C0G A;  4JLI A;  2SRC A;  5EC7 A;  4RMO A;  1VQM Q;  2PVG B;  4JS4 A;  1GBR A;  5HCK A;  4RTV A;  4WCI A;  1VQ4 A;  3ZFJ A;  3S3N A;  2QQA A;  4XAX B;  4JJN K;  2CP7 A;  3EG1 A;  2HKN A;  1E6H A;  2IPO B;  4X1V A;  2HBP A;  4C5E A;  2V8I A;  3VS3 A;  1YNZ A;  5KH6 A;  3RKX A;  1KQS P;  2X4X A;  1YJW A;  3BDU A;  5LJ5 h;  2QDL A;  1MMN A;  3MKD A;  3NTI A;  3H41 A;  3EG2 A;  2R58 A;  4EMK A;  2H3J A;  2JM9 A;  2P4R A;  3JCM d;  2E65 A;  5GAN g;  1VQ6 A;  1E6G A;  5GAN 6;  4EMK C;  1UGV A;  3JCM f;  2QAZ A;  4RTY A;  2BE7 D;  5GAN 8;  3QWX X;  2DER A;  2YRC A;  1SRM A;  1VQ9 Q;  3LH5 A;  3OW2 P;  4RUG A;  1SSF A;  4QVC A;  4X9D A;  1HXD A;  4XTY A;  3TRE A;  1M1K U;  5FU6 C;  2ZZD A;  3MP8 A;  3G6E A;  4JLG A;  4F04 B;  1TH7 A;  1FXX A;  3A8O B;  2YRD A;  4Z89 A;  2LQW A;  4F16 A;  2L89 A;  2ZCF B;  2AHJ B;  2LJ3 A;  1OU8 A;  2MWO A;  1VQ7 A;  4E7J A;  1TS9 A;  3CCU Q;  5J3B A;  4DA4 A;  1U06 A;  1WLP B;  2DNU A;  3PT9 A;  2P0P A;  1IRX A;  4XTW A;  2EBP A;  3OSS C;  3CCS Q;  1QVG P;  1EFN A;  1IHW A;  4O5V A;  3TU4 K;  4JUV A;  1YJN T;  2FVU A;  5GAN e;  4IUQ A;  1BK2 A;  1R77 A;  2CKK A;  3UWN A;  4M7D A;  2ZPI B;  3OYI A;  1YI2 T;  4J83 A;  2FL7 A;  3FDR A;  3A1P A;  4XK8 E;  1C1A A;  1N8R C;  4M7D C;  2KRM A;  1VYT A;  2HD0 A;  2FYK A;  4CRI A;  2VUB A;  1D3B B;  1FYN A;  3M4G A;  4C8Q D;  1Y96 A;  2QAS A;  1UUE A;  2ZPH B;  4PJO F;  3S3O A;  3CPW A;  2AZV A;  4C5G A;  1IB8 A;  2DF6 A;  3VJP A;  1NLO C;  1Q81 U;  1TWB A;  3CC2 Q;  2E5Q A;  1QP3 A;  1Z9Q A;  2MYS A;  4M75 D;  4BE1 A;  1QWF A;  5CKE A;  3PMT A;  2CP6 A;  3CXC S;  1K73 U;  3CC4 A;  3CME Q;  3PIO A;  2CZ1 B;  1TU0 B;  2MI6 A;  2XDP A;  3H8Z A;  5CO7 A;  1AHJ B;  4WF2 A;  1QKW A;  3RMQ A;  1WX6 A;  3OMC A;  1K76 A;  1GRI A;  2X4W A;  4F7U A;  3I5R A;  2BTT A;  1X01 A;  2YWW A;  4K11 A;  4OVA A;  3RKW A;  2A36 A;  1G3W A;  4M78 A;  4C92 D;  2XDB A;  2A0F B;  2K57 A;  3GP8 A;  1B34 A;  2ZAE A;  1ZBX A;  2GTO A;  1YP5 A;  2O88 A;  3G4S A;  4M78 C;  3HRS A;  3ZL7 C;  1WDX A;  2MAM A;  1BBZ A;  2CS7 A;  1IO6 A;  1M8M A;  1YHQ Q;  3NMZ C;  2JTE A;  3CCR A;  4M7A G;  2P84 A;  3CCQ T;  4CC4 B;  2QA4 T;  2ZGW A;  3RDV A;  2FPD A;  4Y28 E;  2I0N A;  4JPB W;  4OGE A;  3CCE T;  1WIE A;  5AT1 B;  4AFU C;  1VQP Q;  1SKU B;  2HAX A;  5FU7 B;  3QZ5 B;  2ECZ A;  4J8O A;  2DZC A;  3QJ6 A;  3VRY A;  1S72 Q;  1M27 C;  4DBQ A;  2F69 A;  5GAN 2;  2K4Y A;  2F2X A;  2HMA A;  1VQ4 T;  4LDV A;  4C8Q G;  4F14 A;  2CP0 A;  1X2Q A;  1SSH A;  3JB9 F;  3CCV T;  1YJ9 Q;  2RK1 A;  2CYZ B;  1M1F A;  4HVV A;  2I2L A;  2YHT A;  4JRK A;  5DLO A;  1MHN A;  4PJO B;  3CCL A;  3HTR A;  3I5S A;  4BE2 A;  1YWP A;  2H3E B;  1FMW A;  3EG9 B;  4AMC A;  1N9S A;  2YXY A;  4D6W A;  4MML A;  2EJ9 A;  1SF9 A;  1UGP B;  3I56 Q;  5FWB A;  1F1B B;  5GAN 3;  3EHQ A;  4EMG A;  5CIU A;  1I81 A;  1PRM C;  1LJO A;  2QXF A;  4ORZ A;  2DO3 A;  3EHR A;  5M9O A;  2P0K A;  1CKA A;  2AKL A;  1G2B A;  2GQV A;  1GFD A;  9ATC B;  5KYY A;  2COZ A;  1HYO A;  2JS0 A;  3MEA A;  4C92 G;  1XTD A;  5IAY A;  3JCM V;  3M0T A;  1XNI A;  2KSS A;  3TQ7 P;  2LMJ A;  2X35 A;  5KYN A;  3X20 B;  3NTH A;  1G8X A;  4J7I A;  2D8H A;  3E19 A;  4XU3 A;  5GJW B;  3L42 A;  3SD4 A;  2RQV A;  4MZP A;  5HY6 A;  3MJX A;  3VS1 A;  4OGC A;  1KC8 C;  4E7I A;  4BY6 B;  1K1Z A;  1JXM A;  3MO8 A;  2E41 A;  3EG3 A;  2DXB A;  2G3R A;  2VXF A;  1T3L A;  4OML A;  3DB3 A;  5GAM d;  2RN8 A;  2DFU A;  4RTU A;  1Q82 R;  3F70 A;  2O01 E;  5LJ3 g;  3QBY A;  2EFI A;  5GJV B;  1K8A R;  1VQK Q;  3GLX A;  1IXD A;  3V7C A;  2CP2 A;  8AT1 B;  3M59 A;  3EGD A;  4LDY A;  1PM3 A;  5A0L A;  2ZPG B;  3RBB B;  1R0B G;  1M3B A;  3C94 A;  4KUI A;  1KQ2 A;  2DA9 A;  5LL6 S;  3UT1 A;  3VS7 A;  1AVZ C;  5CQX A;  5I11 A;  4JS5 A;  5GAN 7;  1IGQ A;  3FC3 A;  4A53 A;  1PRL C;  1OI1 A;  2DYI A;  3G7Z A;  1VYV A;  2L0A A;  1T3S A;  4J9E A;  1WHK A;  4ZGE B;  3EFO B;  4RTX A;  1N8R U;  1ABO A;  3CMA T;  2FZG B;  1OEB A;  4XTV A;  4OB3 B;  1ZUY A;  3JAM E;  2QEX Q;  5GAM h;  4CC2 A;  1H8K A;  2E70 A;  1ZSG A;  1C0M A;  4LDW A;  1CSK A;  4IIO A;  3RNJ A;  5KYX B;  4PLL A;  3QZ9 B;  3GF5 A;  1KIK A;  3MP1 A;  5A0G A;  1IHV A;  2X3X D;  5GMK m;  1I4K 1;  3J80 E;  1N9R A;  1OX9 A;  4JJD A;  3G71 Q;  4HCC A;  2PUK B;  2EYX A;  3CCJ A;  3DLM A;  3CCM A;  1SHF A;  4AFZ C;  1ZX6 A;  3NPF A;  1WHL A;  3PFS A;  4JZ4 A;  3REB B;  2FRW A;  5KYW A;  1X43 A;  2RO0 A;  3A98 A;  2EWN A;  2COW A;  4JJB A;  5IH2 A;  1OPK A;  1RAE B;  3HSB A;  3CPW S;  2RQU A;  2GCX A;  2LRQ A;  2CT4 A;  3G4S T;  4BDZ A;  5GAO l;  1I5L A;  2EJF A;  3JCM P;  3QO3 A;  2YLC A;  1YJN A;  1X69 A;  1OU9 A;  4AG2 C;  5LJ5 g;  3M5A A;  5CKH A;  1KHI A;  4F7U E;  3VUB A;  2E64 A;  2B86 A;  4KBM B;  3BE3 A;  4ATO A;  1H92 A;  1T0H A;  3EGX B;  3QHS A;  4N4G A;  3H9N A;  5GAN 5;  1EIF A;  3L2W A;  2LQ8 A;  1TUD A;  5HK3 A;  4JJC A;  2JM8 A;  4CC3 A;  2EGA A;  1YIT Q;  1OYX A;  1QKX A;  3JCM Q;  5DM7 R;  2HKQ B;  3V8L A;  2OTL T;  1BB9 A;  2NLU A;  4DQ2 A;  4C0D C;  2HCK A;  5CR2 A;  2RQT A;  1N6A A;  1UGQ B;  2C0O A;  4CI0 C;  5IT9 E;  4TVR A;  4RCB A;  2EKH A;  2ZPB B;  4KGV B;  1VQL Q;  1M90 C;  1GCQ A;  4KGZ B;  4RKU E;  4M7D F;  2DJZ A;  3OY9 A;  2DTO A;  2P4T A;  1WZO A;  2RHY A;  2EYY A;  2R5M A;  2L3S A;  2CRE A;  3E1S A;  4J7F A;  3CXC P;  1IGU A;  4P5N A;  4E7H A;  2F5T X;  8ATC B;  4XU0 A;  1X6G A;  1FWZ A;  1WXB A;  3ZBD A;  1ZLM A;  3OYC A;  2LVM A;  5ECA A;  2MMP A;  2PNI A;  4EMK B;  3OQ5 A;  3M4Y A;  2YLB A;  3QUI A;  4PJO D;  4M75 A;  5GMK e;  1ZUU A;  3HL8 A;  3C4S A;  2KYB A;  3CCQ A;  2FG0 A;  3DKM A;  2QA4 A;  4M75 C;  1M1K R;  5FU6 B;  1KC8 U;  1VA7 A;  4BAC A;  2PU9 B;  1YI2 Q;  2KGT A;  4R0K A;  2ENM A;  4FSX A;  1I0C A;  4V2S A;  4IUV A;  2BUD A;  4EDU A;  4F7U F;  2DXU A;  1NM7 A;  1X6O A;  1YIJ Q;  2QK0 A;  4C92 A;  3HKS A;  2O4X A;  3GPL A;  2MIO A;  4CC7 A;  4M78 F;  1VQ5 T;  3JCM e;  2AK5 A;  3CCV A;  3A5Z B;  4OB2 B;  3CC7 T;  3BY7 A;  1U1S A;  1QQJ A;  1QVP A;  5LJ3 j;  1H3H A;  3M0R A;  1J3T A;  2KEA A;  4KH0 B;  1T0J A;  2WAC A;  3OYK A;  2KI7 A;  3OA6 A;  2DTI A;  2YUP A;  2QDY B;  3T9N A;  4YTL A;  4QT7 A;  1OZ2 A;  3OMG A;  3O8V A;  4IUP A;  4Y91 A;  4GLK A;  3VS5 A;  5KE2 A;  1Y57 A;  4J9C A;  4HCZ A;  4KUL A;  2COY A;  1WNL A;  3OYY A;  4RG2 A;  4M7D B;  1N27 A;  1PC0 A;  2DM1 A;  3VYH B;  2J6O A;  5GMK h;  3UF4 A;  3WVD B;  1QVG A;  4UC4 A;  2VAS A;  2L3P A;  4J9F A;  4F17 A;  2KAF A;  3OBW A;  6AT1 B;  3MET A;  3CQT A;  1G3T A;  4HT9 A;  2K5I A;  2XI9 A;  4FL6 A;  3VU3 C;  4J6X A;  4RTZ A;  1Y96 B;  1M3C A;  1Q81 R;  3CD6 T;  1G3S A;  2LT4 A;  4PJO G;  3EGU A;  1JO8 A;  2G6F X;  2DE0 X;  4Y92 A;  3CCJ T;  1ABQ A;  3CCM T;  2O31 A;  3JV3 A;  1YFN A;  1K73 R;  5EG2 A;  1U5S A;  2AT1 B;  3BFM A;  1ZBJ A;  2KRS A;  3CCE Q;  1OZ3 A;  1I07 A;  1M3A A;  1BI3 A;  3JCM h;  3VUZ A;  1VIF A;  2V1Q A;  1PKS A;  4R56 A;  1Y71 A;  3OS2 A;  1JEG A;  2PZ1 A;  1EX4 A;  4RG8 A;  4IKF A;  3I55 Q;  2K2M A;  3GIB A;  4M7A D;  2DL8 A;  3OYD A;  3QSU A;  3NFC A;  4PJM A;  4A54 A;  4F7U B;  2JVV A;  5IHI A;  1H3Z A;  2L3R A;  5C6S A;  3R6N A;  2YUN A;  4M77 D;  1OQK A;  1N5Z A;  2M0Y A;  2DIQ A;  3MEV A;  4M78 B;  1RAB B;  2NUT A;  2FZK B;  1B34 B;  2M51 A;  1YJW Q;  2ATC B;  1YHQ A;  3GOX A;  4LD6 A;  3MEU A;  2FEI A;  1B3Q A;  3L2R A;  1W2B S;  4E7S A;  3CMA A;  5CKB A;  2J6K A;  1VQ8 T;  2H8H A;  2DMO A;  3QKJ A;  3FEO A;  1VQ6 Q;  1KG1 A;  4HCB A;  1WQ7 A;  2XDD A;  3N5B B;  4OMP A;  3SFM A;  1VQM T;  2D1X A;  1I8F A;  5FW9 A;  4BUG A;  1S72 A;  4ELY C;  3PNW C;  5KE3 A;  3NGP A;  3ER0 A;  2NUP A;  1C6V X;  4J9B A;  3FJ5 A;  2D8J A;  2E4H A;  3M54 A;  3ULR B;  2ESW A;  1JJ2 A;  1HSQ A;  3UAT A;  2OAW A;  5GAN f;  1YJ9 A;  1V1C A;  4FYV B;  1M90 U;  5CKF A;  3G6E Q;  1D0Z A;  4KH1 B;  3JB9 G;  2IVW A;  2IIM A;  3HFN A;  1M5Q 1;  2DET A;  1RLP C;  4DBH A;  4O6J A;  3OYE A;  4PJL A;  3THK A;  1SHG A;  1VQ7 Q;  4N4I A;  1D09 B;  1VQN Q;  1BIB A;  2XD0 A;  4L59 A;  2JMA A;  3AHU A;  2PTK A;  1SEM A;  1NJI C;  1LOJ A;  1UFF A;  4FW1 A;  2CP5 A;  2KT8 A;  3QDR B;  4RCC A;  2W0Z A;  2NUZ A;  2DEU A;  3UA7 A;  2CH4 W;  1FMV A;  2LJ1 A;  2KR3 A;  1VQ9 T;  1Q86 C;  5DLQ E;  1M9S A;  4E7K A;  1WXU A;  4C8Q E;  5KYY B;  3CPW P;  4M77 G;  2M1H A;  3JCM J;  3QYG B;  1KFZ A;  2A3L A;  2ROL A;  4J6W A;  2DL7 A;  1OPL A;  3M9Q A;  1PSF A;  5GAM g;  2EYQ A;  3HPW A;  1Y7X A;  4M75 E;  4OB1 B;  1RI0 A;  1RLQ C;  1UB4 A;  2OTL A;  3J7A F;  5I2M A;  4DEX A;  3CCU T;  1D1B A;  1YN8 A;  2D9T A;  4XU2 A;  1WHM A;  4N0A A;  2E5K A;  3PMI A;  4A4H A;  2RQW A;  1D1A A;  2EVR A;  3GNF B;  2Y90 A;  2CT3 A;  2JOY A;  4IUU A;  2RHZ A;  2ED1 A;  3HFO A;  3CCS T;  3LW5 E;  1BYM A;  1QVF A;  1ZA1 B;  4N0A C;  4OMF B;  3DLL A;  1ZA2 B;  4A4K A;  2MF2 A;  1AOJ A;  2LZ6 B;  1NZ9 A;  3Q1J A;  2ZPF B;  2RNA A;  3CC4 Q;  3LH0 A;  4BI8 B;  2EPD A;  4C92 E;  1NG2 A;  3EGD B;  2K3X A;  3BDL A;  1NE8 A;  2GF7 A;  3JB9 J;  4J9G A;  1N8R R;  2GFA A;  2PVO B;  2JJ9 A;  2XIC A;  2F2V A;  2KT1 A;  1V76 A;  5GAN j;  4FIB A;  1XQH A;  4JRP A;  4XQ3 A;  2QEX A;  5GAM e;  4MMK A;  2XG8 D;  2KDS A;  4FCY A;  1BCO A;  2MCN A;  3JB9 I;  3CC2 T;  1VIE A;  2FRY A;  3CCR Q;  4N4H A;  2WSE E;  1UG1 A;  4HA8 A;  2EQU A;  1D0Y A;  1NEG A;  2VC8 A;  2M02 A;  5CAI A;  1QCF A;  2EAY A;  3S6W A;  3FRN A;  1VQO Q;  2DZ9 A;  3CME T;  3JCM c;  2GTJ A;  3WVE B;  1CKB A;  2BKD N;  2KVQ G;  4M7D D;  3E2U A;  3G71 A;  2EQI A;  2JMC A;  3RR6 A;  3SB2 A;  1GFC A;  5J39 A;  2ZPE B;  2CZ0 B;  2XHC A;  2XMF A;  3L2V A;  1RUW A;  2E10 A;  2DYB A;  4FYW B;  5GMK l;  4KUD K;  1IRE B;  3VRZ A;  3P8H A;  3JCM W;  1AD5 A;  5I21 A;  3OYJ A;  2ED0 A;  2F5K A;  4C0F A;  1VQ5 A;  4J6Y A;  1E7O A;  3CC7 A;  2GNC A;  4FT4 A;  2OTJ Q;  1YCY A;  5KYW B;  2QG9 B;  5DY9 A;  4XTZ A;  3X24 B;  4GY5 A;  1K9M C;  4M75 F;  3CCL Q;  4ZN3 A;  4NL2 A;  2HEQ A;  4OP0 A;  2DK3 A;  1NJI R;  2JW4 A;  1YHQ T;  4A4F A;  2HDA A;  1MV3 A;  3A8M B;  4R55 A;  3A8H B;  5IHN A;  4PNO A;  4LD9 K;  1LVK A;  2WSC E;  1XOV A;  3MEW A;  1X75 C;  1VQP T;  4LNP A;  2RD1 A;  4Z88 A;  2KRO A;  4ZTF A;  2E1H A;  2K3Y A;  2M9U A;  3RIR A;  1ZSZ A;  1WJR A;  2JTM A;  1YBY A;  1S72 T;  1YIT A;  2D0Q B;  1WA7 A;  4HCK A;  4C92 F;  2AIR B;  2K7A A;  1Z9Z A;  5GAN 4;  1QW1 A;  2HQH A;  4DBR A;  1Q7Y C;  4C0D B;  1RAG B;  1AWX A;  3OS1 A;  2EJG A;  4M78 D;  1YJ9 T;  3CD6 A;  3JB9 H;  4JRI A;  1AWO A;  4ZNX A;  2DLP A;  3FLG A;  4VUB A;  1R0C B;  4BI4 A;  3I56 T;  5IN1 A;  2LT1 A;  1WXT A;  2DRM A;  3RUX A;  4PKC C;  4Z8A A;  4M7D G;  1OUL A;  2VV5 A;  2F1L A;  4WTO B;  3H0I A;  4LDU A;  5KYU A;  3JSC A;  1H64 1;  2HSE B;  1BI0 A;  1NJI U;  1UHF A;  2KBT A;  2LCS A;  4ELZ C;  5LJ3 d;  2KY9 A;  2DAQ A;  1Q86 U;  1WJQ A;  2EQK A;  4BB7 A;  1MMG A;  1RAH B;  1FX7 A;  2A7Y A;  5HKC A;  4B9X A;  5LJ3 f;  1MV0 B;  2GBQ A;  4M75 B;  2DEQ A;  4HKE A;  3H0H A;  1NPR A;  4J9H A;  1KC8 R;  1QWE A;  2KMT A;  1VQ8 A;  2W10 A;  2C06 A;  1GCP A;  1TUG B;  2D0N A;  4A4G A;  4DOW A;  2M0O A;  4BE0 A;  1BI2 A;  3HRT A;  4DOV A;  1MMA A;  1VQM A;  1QCO A;  3QWY A;  3ASK A;  4M7A A;  2BIV A;  2BZY A;  1W2B P;  1AT1 B;  5A0D A;  1NBE B;  1VQK T;  4M7A C;  1NPP A;  2LCL A;  5D6Y A;  3X25 B;  4M77 A;  1RAD B;  3AT1 B;  3ZEH A;  2EGE A;  3LWI A;  2EQM A;  3UDC A;  4C92 B;  2WSF E;  4KT0 E;  2O4X B;  1PNJ A;  4ANJ A;  2X4J A;  2YT6 A;  4M78 G;  1GCQ C;  2MWP A;  1JBM A;  3JCM g;  1KD1 C;  3CCM Q;  2JN0 A;  1RAI B;  3VV0 A;  4C8Q A;  1BU1 A;  1W70 A;  1NYF A;  5IHK A;  2HL3 A;  4D8K A;  2VB6 A;  2RK2 A;  1UTI A;  4ESR A;  4HXJ A;  3OYL A;  4Z02 A;  2O9V A;  4OMN A;  2LX9 A;  2DPP B;  4C8Q C;  2YUO A;  5C0M A;  2BE9 B;  4QQD A;  1SG5 A;  2LQK A;  2L5Q A;  2J05 A;  2QQS A;  2QEX T;  2YRV A;  1M4Z A;  1Y07 A;  2LQN A;  1KQS A;  1ZUK A;  1YJN Q;  3OYG A;  1PD0 A;  1QVF S;  1VQ9 A;  2EQJ A;  2J6F A;  3SWN A;  2RJC A;  1TXQ A;  4FM4 B;  1EZZ B;  4J9D A;  2EIF A;  4PK4 A;  3G71 T;  5LJ5 d;  2B8A A;  1VOM A;  3OYH A;  3A8G B;  2L3Q A;  2QQR A;  2F2W A;  4PL6 A;  5LJ5 f;  1ACM B;  2PQW A;  4ZGD B;  3M53 A;  2RI5 A;  5KCO A;  1PCX A;  2R57 A;  5IXB A;  1AEY A;  3OW2 A;  2KXC A;  3CCU A;  4ME7 A;  1UE9 A;  1M2V A;  4C92 C;  1AZE A;  4QVZ A;  3I55 A;  4II1 A;  1TG0 A;  5D6W A;  3CCS A;  2DIL A;  3OYA A;  2R5A A;  2X51 A;  2GGR A;  1Y0M A;  1K9M U;  3HRU A;  1I1J A;  3QG1 A;  4Q5W A;  4JDS A;  1U3O A;  3M57 A;  4KRT A;  5CQY A;  3LGF A;  1K9A A;  1UHC A;  4MZT A;  1BKB A;  2ROT A;  3M55 A;  4GBQ A;  2MK5 A;  1WHG A;  2AKK A;  2E6Z A;  5D7U A;  1ZHI A;  4PJO E;  3TSZ A;  2CUD A;  2C0T A;  2J06 A;  2NUT B;  7AT1 B;  2DKG A;  3OS0 A;  1MGQ A;  1YIT T;  1X2K A;  2HQX A;  2QTV A;  2RHX A;  3KXT A;  4B6M A;  1MMD A;  4D8D A;  1W1F A;  1Q7Y U;  5GAO q;  3JB9 D;  4BDY A;  2HQE A;  3V8K A;  4GLM A;  1OOT A;  2DBM A;  3CC2 A;  2DJQ A;  2OI3 A;  3EG0 A;  2JXB A;  1AZG B;  3CCQ Q;  3U23 A;  2QA4 Q;  1VQL T;  1KHC A;  4C5H A;  2HSP A;  2NUP B;  3VKI A;  3CME A;  5J26 A;  2K9G A;  1M90 R;  3QJY A;  1D1C A;  2A08 A;  3QYH B;  1BIA A;  3OYB A;  2KQW A;  4C5I A;  1MND A;  1QMC A;  2RB6 A;  2LTO A;  3OBY A;  2GFU A;  2QI2 A;  1KD1 R;  4OMM A;  2FB7 A;  1VQ4 Q;  2NWM A;  1OX8 A;  4PJN A;  4IUT A;  1MUZ A;  3LLR A;  3EAE A;  2LX7 A;  5IXF A;  3CCV Q;  3E9G A;  1VQN A;  2HNI A;  4LE9 A;  3LX7 A;  1UEB A;  2J7I A;  2Y4X A;  3L1A A;  3TCJ A;  2DTH A;  2YUQ A;  5I2S A;  1BCM A;  3KFV A;  4FSS A;  3A8L B;  2CZ6 B;  4X34 A;  1M8V A;  2VKN A;  2K79 A;  2VVK A;  5LJ5 j;  1RL2 A;  2DL5 A;  3S3M A;  3CPF A;  3RES A;  1RAC B;  3QPH A;  1VQP A;  5CK9 A;  5L23 A;  3J81 E;  3HP9 A;  2RF0 A;  2E12 A;  2HL5 C;  5KCH A;  5GMK j;  5D6X A;  4FYX B;  1R8O B;  2K2V A;  2YDL A;  4A63 B;  4BD3 A;  5GAN d;  2RJF A;  1YIJ T;  1A0N B;  5GMK i;  1WHH A;  1K4U S;  2V26 A;  3VYG A;  1UJ0 A;  3DB4 A;  3CBP A;  1WI7 A;  3EFS A;  5CVI A; 
#chains in the Genus database with same CATH homology
 1QCF A;  3REA B;  2B86 A;  3NHN A;  1H92 A;  1T0H A;  2DVJ A;  4DEY A;  2QDL A;  2K6D A;  2GTJ A;  1CKB A;  3H41 A;  3EG2 A;  1TUD A;  4JJC A;  2EQI A;  2JM8 A;  2JMC A;  1GFC A;  2EGA A;  4CC3 A;  2EYZ A;  1QKX A;  2JM9 A;  2P4R A;  2VWF A;  2LP5 A;  2XMF A;  1E6G A;  1RUW A;  2DYB A;  3M0U A;  3VRZ A;  1BB9 A;  1PKT A;  1AD5 A;  1RI9 A;  2BZX A;  2HBW A;  1UGV A;  2ED0 A;  4RTY A;  2HCK A;  3QWX X;  1E7O A;  2GNC A;  1YWO A;  1SRM A;  2RQT A;  4RTT A;  2C0O A;  3LH5 A;  3PVQ A;  3C0C A;  4RUG A;  2EKH A;  2HEQ A;  1GCQ A;  2JW4 A;  2HDA A;  1MV3 A;  5IHN A;  3UA6 A;  4Z89 A;  2LQW A;  4F16 A;  1XOV A;  2EYY A;  2ABL A;  1GBQ A;  2L3S A;  4LNP A;  2CRE A;  4Z88 A;  2LJ3 A;  2K3B A;  2KRO A;  2RQR A;  2SEM A;  1ARK A;  2LNH B;  1U06 A;  1WA7 A;  1WLP B;  2RPN A;  4HCK A;  2DNU A;  1X6G A;  1WXB A;  2K7A A;  4OMO A;  1Z9Z A;  1ZLM A;  2EBP A;  5ECA A;  2PNI A;  2CH4 A;  1EFN A;  2EYW A;  1AWX A;  4IIM A;  1LCK A;  1YCS B;  1ZUU A;  1BK2 A;  2KYB A;  5I22 A;  1AWO A;  2FG0 A;  4ZNX A;  2DLP A;  1VA7 A;  1K0X A;  1UJY A;  2KGT A;  2KRM A;  4R0K A;  2ENM A;  1VYT A;  4AG1 C;  1WXT A;  1I0C A;  2DRM A;  4Z8A A;  1FYN A;  1NM7 A;  2LJ0 A;  3H0I A;  1UUE A;  2MIO A;  4CC7 A;  2AZV A;  2AK5 A;  3I35 A;  1UHF A;  2DF6 A;  1NLO C;  2KBT A;  5FWC A;  2LCS A;  1Z9Q A;  2MOX A;  1H3H A;  3M0R A;  1QWF A;  1J3T A;  2KEA A;  1T0J A;  2DX1 A;  2RMO A;  2YUP A;  4QT7 A;  2L2P A;  1MV0 B;  2GBQ A;  1GL5 A;  3SEM A;  3VS5 A;  3H0H A;  2FO0 A;  1Y57 A;  4J9C A;  2CUB A;  4J9H A;  1QKW A;  1QWE A;  1WX6 A;  2W10 A;  1TUC A;  4HVU A;  1GCP A;  1K76 A;  1GRI A;  2D0N A;  3VS0 A;  4RTW A;  3I5R A;  2BTT A;  2DM1 A;  2J6O A;  4K11 A;  3UF4 A;  3QWY A;  3VS4 A;  1UDL A;  2L3P A;  2A36 A;  4J9F A;  1QLY A;  4F17 A;  2GQI A;  2BZY A;  3CQT A;  2GTO A;  1YP5 A;  2O88 A;  2C0I A;  4RTZ A;  2EGE A;  3ZL7 C;  1WDX A;  1M3C A;  1BBZ A;  1IO6 A;  1M8M A;  3NMZ C;  2JTE A;  1PNJ A;  3EGU A;  2YT6 A;  2DRK A;  2V1R A;  1GCQ C;  1JO8 A;  2G6F X;  2DE0 X;  4Y92 A;  4CC4 B;  1ABQ A;  2FPD A;  2O31 A;  3JV3 A;  2I0N A;  4JPB W;  1WIE A;  4AFU C;  1WYX A;  3VS6 A;  1U5S A;  2X3W D;  1ZBJ A;  2KRS A;  4LUE A;  1BU1 A;  2CDT A;  1I07 A;  1M3A A;  1W70 A;  1NYF A;  5IHK A;  4D8K A;  2ECZ A;  1JU5 C;  1UTI A;  4ESR A;  4HXJ A;  3VRY A;  2O9V A;  2V1Q A;  1M27 C;  1PKS A;  4OMN A;  1JEG A;  2PZ1 A;  2YUO A;  1AWW A;  2F2X A;  2KRN A;  2K2M A;  2A37 A;  4HVW A;  2DBK A;  2J05 A;  4F14 A;  2DL3 A;  2DL8 A;  1X2Q A;  1HD3 A;  1SSH A;  2LQN A;  3IQL A;  1ZUK A;  5IHI A;  3SHW A;  4HVV A;  3R6N A;  2OJ2 A;  2YUN A;  1N5Z A;  2J6F A;  3I5S A;  1FMK A;  2M0Y A;  3PVL A;  1YWP A;  4M4Z A;  2M51 A;  4J9D A;  5FWB A;  2FEI A;  3EHQ A;  1B3Q A;  1WFW A;  1PRM C;  1VYU A;  4ORZ A;  3VS2 A;  2KE9 A;  2L3Q A;  2J6K A;  4OMQ A;  2H8H A;  2DMO A;  3EHR A;  2F2W A;  2KXD A;  1AEY A;  5IXB A;  1CKA A;  4OMP A;  2KXC A;  1JXO A;  2AKL A;  2FPF A;  1UE9 A;  2CSQ A;  2D1X A;  1G2B A;  1NLP C;  5FW9 A;  4AFS C;  1GFD A;  1AZE A;  3NGP A;  1TG0 A;  2JS0 A;  4J9B A;  1SRL A;  2O2O A;  3FJ5 A;  2D8J A;  2DIL A;  3M0T A;  2GGR A;  1NEB A;  3ULR B;  1Y0M A;  2LMJ A;  2ESW A;  1HSQ A;  3UAT A;  1I1J A;  2OAW A;  1PWT A;  1V1C A;  1UEC A;  1KJW A;  2D8H A;  2EGC A;  3H0F A;  5GJW B;  1U3O A;  2RQV A;  4KRT A;  3VS1 A;  2IIM A;  4J9I A;  1K9A A;  1UHC A;  2ROT A;  1K1Z A;  4GBQ A;  1JXM A;  1RLP C;  4JZ3 A;  4AFQ C;  2AKK A;  4LN2 A;  3EG3 A;  3M0P A;  3TSZ A;  3THK A;  1SHG A;  3GBQ A;  2CUD A;  2C0T A;  2J06 A;  3PE0 A;  3TVT A;  4OML A;  1T3L A;  2YSQ A;  2RN8 A;  4RTU A;  1X2K A;  2BZ8 A;  2JMA A;  4LUD A;  2PTK A;  1SEM A;  5GJV B;  4D8D A;  1W1F A;  1UFF A;  2AZS A;  2KT8 A;  1HJD A;  2W0Z A;  2NUZ A;  4GLM A;  1OOT A;  3UA7 A;  2CH4 W;  1B07 A;  4EIK A;  2DBM A;  2LJ1 A;  2DJQ A;  2KR3 A;  2OI3 A;  3EG0 A;  3RBB B;  2DL4 A;  2JXB A;  1AZG B;  3O5Z A;  1M3B A;  2KYM A;  3U23 A;  2DA9 A;  1WXU A;  3VS7 A;  2JS2 A;  1AVZ C;  5I11 A;  2A28 A;  3M0S A;  2HSP A;  1PRL C;  2K9G A;  1KFZ A;  1VYV A;  2L0A A;  1T3S A;  4J9E A;  2A08 A;  2FPE A;  1K0S A;  2ROL A;  1AWJ A;  4RTX A;  2DL7 A;  1OPL A;  2O9S A;  1ABO A;  2EW3 A;  1OEB A;  4OMM A;  1RLQ C;  2CSI A;  1ZUY A;  1KSW A;  2NWM A;  4DEX A;  1MUZ A;  1YN8 A;  4CC2 A;  1H8K A;  2LX7 A;  1ZSG A;  2E5K A;  5IXF A;  2RQW A;  1CSK A;  2EVR A;  4IIO A;  1OV3 A;  4LE9 A;  2CT3 A;  2J7I A;  2ED1 A;  2JT4 A;  2YUQ A;  3RNJ A;  1X27 A;  3KFV A;  4FSS A;  1PHT A;  1JQQ A;  1AOJ A;  1KIK A;  2LZ6 B;  1NYG A;  2K79 A;  2VKN A;  2RNA A;  2VVK A;  2X3X D;  2DL5 A;  3I9Q A;  2KNB B;  4JJD A;  2EPD A;  1S1N A;  1NG2 A;  3M0Q A;  2EYX A;  4E6R A;  1SHF A;  1M30 A;  1W6X A;  3TSW A;  4AFZ C;  5L23 A;  1ZX6 A;  1G83 A;  1X6B A;  3NPF A;  2RF0 A;  1SPK A;  4JZ4 A;  3REB B;  4J9G A;  2FRW A;  2SRC A;  5EC7 A;  1X43 A;  3A98 A;  1GBR A;  2F2V A;  4JJB A;  5HCK A;  2KT1 A;  5IH2 A;  1OPK A;  4RTV A;  2YDL A;  4A63 B;  1A0N B;  4WCI A;  1K4U S;  2RQU A;  2CT4 A;  1X69 A;  4AG2 C;  1UJ0 A;  2MCN A;  2FRY A;  3EG1 A;  1E6H A;  1UG1 A;  4X1V A;  1NEG A;  1WI7 A;  3VS3 A;  1YNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...