2YSQA

Solution structure of the sh3 domain from rho guanine nucleotide exchange factor 9
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
81
structure length
81
Chain Sequence
b'GSSGSSGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQEDEVEEGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 9
molecule tags Signaling protein
source organism Homo sapiens
publication title Solution structure of the SH3 domain from Rho guanine nucleotide exchange factor 9
rcsb
total genus 4
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2ysqA00
3SEMA 3EHRA 1JQQA 4Z8AA 2DL8A 1VYTA 2LJ0A 2L2PA 3RBBB 3EG0A 2MOXA 2HCKA 4DEXA 1SPKA 1NM7A 1T3LA 1ABQA 3U23A 1GBQA 1WLPB 1KFZA 3QWYA 3REBB 2XMFA 1JXOA 1GFDA 1SHFA 1M3AA 1Y0MA 3VS2A 2BZXA 2M0YA 1AEYA 2VVKA 1ARKA 2D1XA 1GRIA 1K4US 2J7IA 2KRMA 3EG3A 1UDLA 1GFCA 2A37A 1I07A 1XOVA 2JT4A 2DILA 2GBQA 3EG2A 3I5SA 3EGUA 5IHIA 4DEYA 1TG0A 2GGRA 2DL5A 2DM1A 1WFWA 1NLOC 2KE9A 4RTZA 1MV0B 4LUDA 2SRCA 2G6FX 2IIMA 1H8KA 4F17A 2YT6A 2O9SA 4LNPA 4AFUC 5IXBA 1RLPC 1GCQA 1WA7A 1PWTA 1KSWA 2KBTA 1J3TA 1PNJA 2DL3A 3KFVA 1U5SA 1UG1A 2RQUA 4J9DA 2JM8A 3NPFA 3H41A 3ULRB 2A08A 1QKXA 1YWPA 1ZSGA 2AZVA 2JMAA 4CC7A 4WCIA 2X3XD 4LE9A 1UUEA 1WX6A 2LJ1A 5IH2A 3NHNA 3C0CA 4GLMA 2JM9A 4OMLA 2V1QA 4AG1C 5ECAA 1VA7A 2O9VA 4JZ3A 2OJ2A 2FO0A 2ROLA 1QWFA 2RNAA 3I35A 1H3HA 2C0TA 1RI9A 5IHKA 2RN8A 2CH4W 4J9CA 4OMMA 1JEGA 3A98A 2J6KA 2JW4A 2AZSA 1K0XA 2GQIA 1M3BA 1W6XA 2I0NA 2EYWA 2W10A 1QWEA 1VYUA 3VRZA 3GBQA 3VS6A 1QCFA 1TUCA 1ZUYA 3M0UA 3LH5A 2DNUA 4RTTA 4J9GA 1GL5A 2EKHA 1QLYA 4RTXA 1T0HA 3PVLA 4F14A 1M27C 1BU1A 5IXFA 2RPNA 4LUEA 2LZ6B 1JO8A 1WXUA 1GBRA 2RQRA 3M0TA 3CQTA 1Y57A 2PTKA 1PKSA 3ZL7C 2F2XA 1KIKA 2BZ8A 2P4RA 1G83A 2J05A 2V1RA 2DYBA 1K9AA 3PVQA 4KRTA 3M0RA 4RTUA 3NGPA 4IIOA 2CSIA 3UATA 4J9IA 2LCSA 1M8MA 1N5ZA 1M3CA 4GBQA 1PHTA 2H8HA 5I22A 3M0SA 1CKBA 3TVTA 1CKAA 1WXBA 2PZ1A 3NMZC 2DMOA 4JJDA 1AD5A 1UGVA 2KXCA 1NEBA 2FRWA 2CDTA 1UFFA 4JJBA 1V1CA 1BK2A 2YUPA 2AK5A 4D8DA 1UE9A 2KXDA 2ABLA 4J9EA 2LQNA 1JU5C 2ED1A 2CT3A 2DX1A 2HEQA 2SEMA 1X6GA 2CH4A 4CC2A 1AZGB 1T3SA 2D8HA 3R6NA 1K1ZA 4CC3A 1E6HA 2EBPA 2GTJA 1SRLA 1X2KA 1OPLA 4M4ZA 2FG0A 2RQTA 1B3QA 1U06A 2EQIA 4Z89A 2GNCA 2MIOA 2LJ3A 1GCPA 1RUWA 4JPBW 2A36A 2MCNA 2KYMA 4IIMA 2OI3A 4HCKA 2LP5A 2NWMA 3I5RA 2K7AA 4RTYA 1UJYA 1YP5A 1G2BA 4AFZC 3VS5A 2KT8A 1JXMA 2EYXA 2L0AA 5EC7A 4Z88A 4J9HA 2CUBA 3VS7A 2AKKA 1X2QA 2M51A 1X43A 3VS3A 4ESRA 1WI7A 3THKA 2LNHB 3M0PA 2C0IA 2E5KA 3QWXX 2YUQA 2RQWA 1YWOA 2BZYA 4F16A 1K0SA 1FYNA 2GTOA 1YCSB 3VS0A 2J06A 4RTWA 1LCKA 1NLPC 1HJDA 1W70A 1NYGA 1WYXA 2K3BA 2C0OA 3H0HA 2VKNA 1NG2A 1RLQC 2DL7A 1PRLC 1AWJA 1PRMC 2RMOA 4R0KA 3UF4A 1AWXA 1NYFA 1WDXA 4E6RA 2JTEA 2DF6A 3VRYA 2KRSA 3TSZA 1M30A 4JZ4A 1QKWA 2LQWA 1SRMA 2KEAA 1UJ0A 4OMNA 3UA7A 2FRYA 4JJCA 1Z9QA 2DE0X 4HVWA 1UHFA 1MV3A 2CUDA 2K6DA 5I11A 3M0QA 1X69A 4FSSA 2DLPA 2EVRA 2O31A 3PE0A 2LX7A 2KGTA 1BBZA 1ZLMA 2OAWA 1UTIA 3EG1A 1U3OA 2JXBA 2K79A 2EYYA 2ED0A 2LMJA 5FWCA 1SHGA 1ABOA 1SSHA 1ZUUA 1CSKA 1EFNA 3FJ5A 2EW3A 2JMCA 2L3PA 1AZEA 1YNZA 1TUDA 1AWWA 2ENMA 2VWFA 3O5ZA 5GJWB 2QDLA 2YUOA 2D8JA 2JS2A 5IHNA 1FMKA 2PNIA 2CSQA 3VS1A 3H0IA 3RNJA 1HSQA 4EIKA 1ZBJA 2EGCA 2X3WD 4HXJA 1PKTA 1MUZA 1IO6A 1Z9ZA 4ZNXA 1OPKA 1WXTA 2ESWA 1OV3A 4J9FA 4K11A 2D0NA 1S1NA 1OEBA 2EGEA 1HD3A 1AOJA 2AKLA 1X27A 2EYZA 1SEMA 4LN2A 1E6GA 5FW9A 2ECZA 5GJVB 1ZUKA 2FPEA 5FWBA 3TSWA 4AG2C 2DBMA 2JS0A 2RQVA 1H92A 1BB9A 4CC4B 2FPDA 3SHWA 1A0NB 1GCQC 2KNBB 2BTTA 5HCKA 2DRKA 2HDAA 4HVVA 1T0JA 2CT4A 2KROA 2FEIA 5L23A 2J6OA 1UHCA 1B07A 2J6FA 2L3QA 1W1FA 2DJQA 2KRNA 2DA9A 4AFSC 1NEGA 2DL4A 1AWOA 4OMQA 3I9QA 2ROTA 3UA6A 3H0FA 2NUZA 2F2WA 2HSPA 1AVZC 1I1JA 2HBWA 2KR3A 2DVJA 4A63B 2A28A 4OMPA 1VYVA 3IQLA 1WIEA 2K9GA 3VS4A 2YUNA 2O88A 2B86A 2FPFA 4D8KA 4RUGA 2L3SA 1K76A 3EHQA 4ORZA 1KJWA 4AFQC 2F2VA 2EPDA 4QT7A 2W0ZA 4J9BA 4RTVA 3REAB 4X1VA 2O2OA 2YDLA 2YSQA 2DRMA 4HVUA 3JV3A 2KYBA 2EGAA 4Y92A 2RF0A 2K2MA 2KT1A 1I0CA 1X6BA 1OOTA 1UECA 2CREA 1E7OA 2DBKA 4OMOA 1ZX6A 1YN8A
chains in the Genus database with same CATH superfamily
3G1JA 1RABB 4Z8AA 3HFOA 1G8XA 5J26A 2H3JA 2MOXA 4GLKA 1SPKA 4F7UB 1TXQA 4EDUA 3QWYA 2XMFA 1M3AA 1BIBA 2M02A 2E6ZA 2JVVA 2BZXA 1MMAA 4XK8E 2RI2A 1ARKA 4M75G 1NJIC 4C8QD 1GRIA 1K4US 4E7IA 2E12A 1KG1A 2J7IA 2QEXT 2MPXC 3FRNA 5GMKi 3CCEQ 2CZ1B 2JT4A 2GBQA 3EGUA 3DLMA 4PL6A 3MO8A 5FU6C 4N0AA 4M75C 2HQEA 4II1A 5KYNA 1MV0B 4LUDA 1YJNQ 2IIMA 2RK1A 4F17A 3UDCA 2QQAA 3HRSA 4LNPA 1RLPC 5C0MA 1WA7A 4FL6A 4FYYB 1PNJA 2DL3A 1C0MA 2YRCA 1U5SA 5I2MA 2VXEA 4MDWA 2HNIA 1JJ2A 1XJWB 3H41A 2A08A 1YWPA 1TUGB 2X3XD 2YHTA 3NHNA 4C5GA 4A4HA 2VC8A 2Z0WA 1TU0B 3HFNA 3L2VA 3CCUT 1QWFA 2RNAA 3EH1A 8AT1B 3FEOA 3LH0A 2X35A 5GAN3 1ZA1B 4IUPA 3VYGA 1YBYA 3DB3A 2AZSA 4D6WA 5CIUA 2HZYA 4C0ZA 1W6XA 1WHHA 3VRZA 1VYUA 1R0CB 2XDBA 3VS6A 2JN0A 2BE9B 1VQNA 1RAEB 3JCMb 4DOVA 1VQ7A 5GMKl 3H6ZA 2D0QB 5CCAA 4RTXA 1VQPT 1EIFA 3CCSQ 4C8QG 4OB1B 2VGNA 1QVFA 1D0XA 2E5QA 5KYYA 4LUEA 2LZ6B 4TVRA 1GBRA 1BYMA 1KC8U 3OYCA 2VASA 2RQRA 2YLBA 1Q86R 2QYZA 3M0TA 1Y57A 2PTKA 1VQ7Q 3NTHA 2BZ8A 4XQ3A 3CCSA 2J05A 2V1RA 3VUBA 1K9AA 3PVQA 2HBPA 4KRTA 5GAMf 4EMKC 2NLUA 5FU7C 1ZSZA 1PG5B 4J6WA 3G6EQ 1VQ5Q 3CCJT 9ATCB 5GMKe 2V8JA 4F7UA 5GAN5 3CCQA 1KQSA 1CKBA 3C95A 5GAOm 1VQ6T 4M78D 2JJ9A 4IUTA 4E7ZA 5CKDA 4C8QA 3I55A 5KYWB 2CDTA 2P0QA 2Y90A 4JJBA 1YHQQ 4KUIA 4PNOA 1G3SA 3HL8A 3WXMB 4Z02A 3CMAQ 2HEQA 1VIFA 1ZSZC 3CCVA 2PVDB 2E6NA 2F1LA 4B9WA 2DD4A 4N0AC 5LJ5d 4F7UE 4L6V5 2LJ3A 1EX4A 1MMGA 4M7AD 3CC7A 1LOJA 2LP5A 4JLIA 4RTYA 1VQ9A 1G2BA 2Y4YA 3VS5A 3M58A 5KE2A 5A2QE 1HK9A 3C12A 3QXEB 2WACA 4RG8A 5EC7A 2X4WA 1OZ2A 3E2UA 2M51A 3A8OB 1M90C 1PSFA 3RIRA 1QVFP 1JJ2P 2LNHB 3M0PA 1YHQT 3OA6A 4F16A 1K0SA 3CC2T 2DYIA 4RKUE 2DEUA 1LCKA 2KSSA 3EAEA 1NLPC 2OTJT 2OX7A 1G3YA 3I56Q 1RLQC 1KHIA 3J81E 4PJJA 1GXIE 1D3BB 2GFUA 2JTEA 3CXCA 3VRYA 4M7AB 3JCMP 2CZ7B 1Q7YR 2A0FB 1VQPQ 1D0ZA 2RHYA 2FRYA 4JJCA 1Z9QA 4C92D 3QHSA 1WPYA 1UHFA 4XTUA 1MV3A 1VQ8A 3JRZA 5I11A 3GIBA 5GAOn 1WQWA 4JS5A 4JRIA 1TSFA 2DXTA 1PSEA 1QVFS 3JCMf 3L2ZA 3PE0A 1BBZA 4M7AG 2LMJA 1X01A 1AT1B 1SSHA 1ZUUA 1CSKA 1C6VX 3OYGA 4JRPA 1VQ9Q 3JCMg 3NTIA 1YNZA 1M8VA 5KYWA 1RADB 2JS2A 3FC3A 4E2FB 3A5ZB 2E1HA 3H0IA 4OVAA 2MF2A 3M57A 2EGCA 2E4HA 2HKNA 5AT1B 4C0GA 3CCQQ 3P8BB 1K9MU 1ZBXA 2JNGA 3JCMh 1ZQ1A 2ESWA 3PMIA 1OV3A 4X34A 3JCMX 4K11A 2PQWA 1S1NA 1OEBA 3H8ZA 2EGEA 4KGZB 1D1CA 3F70A 3NFCA 2P0KA 4NS5A 3UPUA 3L2QA 3KXTA 2V8IA 4MZMA 3JAME 1O75A 5LJ3e 3TQ7P 3T9NA 3SHWA 3JB9J 4M77A 1YJ9A 3OMCA 4JS4A 1KQSS 5L23A 2XK0A 1M90U 1YJWQ 3G4SQ 1M2VB 3CCVT 4M78F 4M7DA 2DERA 1YIJT 2DJQA 2KRNA 2YRVA 3MP1A 4AFSC 1MNDA 2G3RA 1AWOA 3JB9F 1FX7A 2MWOA 2CP6A 4M78B 3RKWA 3SFMA 4OGEA 3UA6A 3H0FA 5GMKj 1AVZC 3JB9I 2A3LA 1IGQA 3OS0A 2HBWA 2JTFA 2MYSA 4FYXB 4A63B 2A28A 1VYVA 3JCMQ 5KH6A 1ACMB 4O5VA 4FSXA 4FU6A 3ZEHA 2R57A 3GF5A 4BE1A 2HMAA 4RUGA 4A4FA 4C8QE 3LX7A 1OZ3A 3EHQA 2DK3A 2F2VA 2EPDA 1YI2Q 4BE2A 1K8AR 3ER0A 3WVDB 1B7TA 1JBMA 1WHGA 4X1VA 4HA8A 1VQOQ 3QZ5B 3META 4M77F 2YDLA 1VQMT 3KBGA 2RF0A 3CCUA 2KT1A 1X6BA 1OOTA 2LT1A 3I55Q 4E47A 2CP2A 2M16A 1JQQA 2DL8A 1VYTA 4ZGDB 2X9HA 1NPPA 3L1AA 3QKJA 4XTZA 3CMAA 3JCMe 1T3LA 1ABQA 5D6WA 2LNVA 4Q5WA 3KUFA 1WLPB 5CQXA 5KYUB 3REBB 3EFRA 4AMCA 5GAOr 1TS9A 1VQ8T 3HRTA 1VQOA 3VS2A 4E7LA 1TOVA 2VVKA 3CMEQ 1KQSP 1BCMA 1VQ5T 4ZGJB 2HSEB 1YI2T 2KRMA 3OYLA 1GFCA 1QVGS 1N9SA 4M7DG 2A37A 4MMLA 1V76A 4M7AC 5GAMh 2DILA 2X4YA 4DBFA 2CS7A 4DEYA 3GOXA 1UGPB 1V29B 1NLOC 4MMKA 3QYGB 4J7IA 3I56A 4B6MA 3SD4A 1VQ6Q 2CGHA 2YT6A 2O9SA 4AFUC 1UB4A 2OTLA 2KBTA 5CVIA 4ATOA 3OMGA 1UG1A 4J9DA 2DZ9A 2EAYA 3EGDA 4J6XA 4M7DE 2FL7A 3NPFA 5KE3A 1KC8R 2JMAA 2AZVA 8ATCB 5C6SA 3EFSA 4LE9A 1QP2A 1UUEA 3AT1B 5IH2A 3C0CA 3M4GA 5ECAA 3X28B 2FO0A 2E3HA 3PTAA 1RI9A 4C92G 2CH4W 3OB9A 5DM7R 4OMMA 3BDUA 3OYFA 1JJ2S 1MNEA 1BI1A 2I0NA 2GCXA 2DD5A 2EYWA 1QWEA 1MHNA 1QCFA 1TUCA 1ZUYA 3LH5A 2BKDN 5EG2A 3SWNB 2EKHA 3C4SA 4IUQA 1T0HA 5IT9E 2BUDA 4M75A 4F14A 1M27C 1IRXA 2ZPFB 2RH2A 4FT4A 1WXUA 5LJ3h 2C06A 3CQTA 2LT4A 2DIQA 2LVMA 1PKSA 2F2XA 1KIKA 2RM4A 5L8RE 2P4RA 4AT1B 4J6YA 1G83A 3CD6A 2XIDA 2XKOC 3M0RA 3CXCS 5DLOA 3S3NA 2RO0A 2HQHA 4J9IA 5LJ5j 2DEQA 1N27A 4GBQA 3EG9B 5IN1A 2H8HA 4R55A 3M0SA 3MP6A 1CKAA 2F69A 2E3IA 3JB9D 4IKFA 3NMZC 3VKIA 3VV0A 3G4ST 4WTOB 4C8QC 4Y91A 1NEBA 3CCEA 2YRDA 4M78C 3MP8A 2KK4A 1BK2A 4ZTFA 1QCOA 2KXDA 2LQ8A 2ABLA 2EFIA 2RJCA 2E10A 1VOMA 4ANJA 2KMTA 3OW2P 4V2SA 1R8OB 3JCMc 2ATCB 2DX1A 1X6GA 2CH4A 2RA2A 1FMWA 2GTJA 3A8HB 2CP3A 1SRLA 4JDSA 4M4ZA 4Z89A 4M7AF 2LX9A 2MIOA 1TH7A 4JUVA 5HK0A 7AT1B 3CCRT 1M90R 5FLXE 1OU8A 4JPBW 4F04B 3QIIA 2NUPA 3CXCP 3CCJQ 3FLGA 1JRIA 3HP9A 4QVCA 2EQUA 4PFZA 3I5RA 1YP5A 4OMFB 2CZ6B 4M77B 4BACA 2L0AA 3QDRB 3CPWP 4J9HA 2CUBA 3VS7A 4BDYA 4UC4A 3DKMA 5GANf 2DXCA 3M59A 1VQ6A 1G3WA 2RI3A 1QW1A 2QASA 3QWXX 2YUQA 3BY7A 1VQLT 4PJOA 1VIEA 2GTOA 1YCSB 1KD1U 1Y7XA 2CP5A 4M77G 4PJMA 2ZPGB 3J80E 1RACB 3OSVA 2V8KA 2DL7A 1NE8A 3EGXA 1M5Q1 4OP0A 1PC0A 3CPWA 1PRMC 2RMOA 1VUBA 3TU4K 1I8FA 3QUIA 4C92F 3CMEA 1VQ4T 4PJOG 2XG8D 1YIJQ 1SRMA 2XDPA 4OMNA 1PM3A 3CCST 1VQKQ 3UA7A 3CC4Q 1Q81R 2AIRB 3SWNC 1Q7YU 3RDVA 2R58A 2K6DA 5HY6A 1X69A 3QJ6A 2XDDA 3MJXA 4M7DD 3PIOA 2EVRA 2O31A 2QA4T 2LX7A 2KGTA 2OAWA 1UTIA 2F5KA 4ZN1A 3V7SA 1YJNA 3CC4T 2JXBA 4JRQA 2EYYA 3GPLA 1VQLQ 2ED0A 4KH0B 3FJ5A 4A54A 1BI2A 2YUOA 2D8JA 3JCMd 4BUGA 3DB4A 5IHNA 2PNIA 3VS1A 4JRKA 5GANj 1HSQA 4E7SA 3OW2S 2KI7A 1Q82U 3S3OA 3HRUA 4ZNXA 1WJRA 3X24B 2DIGA 2LTOA 1VQNT 1X27A 1SEMA 3Q1JA 4C0DC 4LN2A 1E6GA 5FW9A 2K3YA 3HKSA 3G4SA 5GJVB 1ZUKA 4QW2A 5CKFA 1HYOA 3LGLA 4L5GA 4XAXB 3CC7T 6AT1B 2RHUA 4XU2A 2RQVA 1BB9A 2FPDA 1A0NB 1GCQC 4A53A 5HCKA 4M75B 2DRKA 2QK0A 5AYFA 2HDAA 2J6OA 5KYYB 3ME9A 2JZ2A 2E65A 2VGMA 4PJOF 2DPPB 1W1FA 3PNWC 4ZGEB 2IG0A 5KYUA 1B34B 1NEGA 3VJPA 3CCJA 5FU7B 3HTRA 2ROTA 2H3EB 3G6ET 2NUZA 5CKHA 2K3XA 4C92E 1I1JA 3GNGA 3CCQT 1C1AA 2KR3A 2PUKB 1Q86U 3I56T 2KY9A 2CYZB 5LJ5f 5GANd 2O88A 3SB2A 2KVQG 1BI3A 4LXCA 1NBEB 2L3SA 5J39A 3SWNA 1K76A 1R77A 4WF2A 4ORZA 4AFQC 1H3ZA 4RMOA 2QEXQ 2W0ZA 3PGGA 4Y28E 4RTVA 5CAIA 4M75D 2O2OA 3EFOB 2YSQA 2DRMA 4HVUA 2KYBA 1KC8C 2HD0A 4Y92A 3N5BB 1WJSA 4XU3A 4ME7A 4FW2A 2CREA 1OYXA 3JCMJ 2R5AA 1IHWA 5GANg 2DBKA 1K9MR 3SEMA 3EHRA 3CBPA 3MEUA 4O6JA 5LJ5h 4OB3B 4BY6B 4BI4A 4VUBA 2LJ0A 2L2PA 3RBBB 3EG0A 3FB9A 4C8QB 3CMET 2HCKA 1W2BP 3FJPA 3CCUQ 4KH1B 5CQYA 2IVWA 3GNFB 5GAMg 1KFZA 2LQKA 3CPWS 1JXOA 3OYYA 1XQHA 1Y0MA 4KULA 1BCOA 1G3TA 2EKOA 2M0YA 4NL3A 2D1XA 4HCBA 5KCOA 4PLLA 2LDMA 4KBMB 2ZPHB 3A8LB 1UDLA 4DBQA 5CKEA 2LRQA 1I07A 3EFOA 3EG2A 3I5SA 3MPUB 2GGRA 4M7DC 2O01E 1WFWA 3PIPA 2SRCA 2EIFA 1QCNA 2G6FX 2WSCE 3BE3A 3MHXA 3QO3A 1H8KA 2EYQA 5IXBA 1GCQA 1KHCA 1OU9A 1SSFA 1J3TA 3KFVA 2RQUA 5DY9A 3ULRB 1QKXA 2ZCFB 1ZSGA 5GMKh 4CC7A 4KT0E 1WX6A 1M4ZA 1BKBA 4BB7A 4OMLA 5CO7A 3RUXA 1VA7A 2O9VA 1NZ9A 4JZ3A 2OJ2A 4PJNA 2ROLA 2HQXA 3I35A 2FZCB 1H3HA 2K5IA 2COZA 2DKGA 2RN8A 2EQMA 3X25B 3FIFA 3A98A 2J6KA 1Y07A 2QAZA 2ZPIB 2B8AA 3OYDA 2RJFA 1WHMA 2GQIA 1M3BA 4CI0C 2M1HA 5FRMA 3GBQA 4RCBA 5GAMd 4EPCA 4DBHA 3P8DA 4RTTA 1LPLA 2PU9B 1GL5A 1QLYA 2OTJA 3MEVA 3PVLA 4OB0B 3M54A 1M1KC 1Q95G 2RPNA 4F7UG 1OX9A 3M4YA 4OGCA 5LJ5e 3LLRA 3HSBA 3G6EA 3QYHB 1VQKT 3ZL7C 3RR6A 5GAMj 4QQDA 1IHVA 3I55T 1VQPA 3CCRQ 4IIOA 2CSIA 3ASKA 1VQMQ 3BFMA 3MEAA 1M3CA 3OYKA 1YJ9T 3JSCA 2HAXA 2K5LA 1KK7A 3H9NA 4FM4B 3TVTA 4J8OA 5I2SA 2PZ1A 2DMOA 4HCZA 4JJDA 2PUOB 2KXCA 2RD1A 1OULA 1QMCA 1UFFA 5GANh 2YUPA 2AK5A 1UE9A 4PJOC 4J9EA 3G71A 2LQNA 1JU5C 3CCMT 2ED1A 4A4GA 1AZGB 2VUBA 1T3SA 1EZZB 2D8HA 3R6NA 4CC3A 4IUUA 3OY9A 4M78E 3OYEA 1OPLA 2LCLA 3AHUA 2RQTA 1Y71A 1U06A 2EQIA 5KCHA 2GNCA 2CP0A 3TEEA 1RUWA 4NOYA 2KYMA 2OI3A 3CEYA 4CRIA 2PVOB 2NWMA 4C0DB 2K7AA 1UJYA 3GP8A 4AFZC 1WZOA 2KT8A 1JXMA 2EYXA 1IREB 2VV5A 1S72T 4Z88A 2OAUA 2YXYA 2D9TA 4XTVA 3L2RA 1X43A 3VS3A 4ESRA 1WI7A 3THKA 2EJ9A 2E5KA 1H641 5GANe 3URGA 4KUDK 4BI8B 1YWOA 3CCET 4C8QF 2QEXA 3G7ZA 3X26B 4FT2A 1VQ9T 4M78A 3JCMV 1VQ7T 3BDLA 3PT9A 2L5QA 2P84A 2K3BA 2C0OA 2VKNA 2KQWA 1WHKA 2NUTB 4HT8A 1M1KU 4R0KA 3UF4A 1NYFA 2MWPA 4FYVB 3M53A 4E6RA 1FMVA 3OS5A 3OYHA 1MMNA 3TSZA 2OTJQ 2RB6A 2RK2A 1M30A 4JZ4A 2RJEA 3WVEB 3QZ9B 1QKWA 4C5IA 2KEAA 2ZPBB 1UJ0A 3CD6T 4EMKA 4M78G 1Q82R 2JUFA 5LJ3f 2MMPA 5GAOp 1VQ5A 4ZTJA 2LC4A 2CUDA 4R56A 4BDZA 5GAN2 2DXUA 3M0QA 1LVKA 5GAMe 3CPFA 3QPHA 2DLPA 2NUPB 2VB6A 3RERA 3M56A 4XTYA 3JB9H 3A8MB 1ZLMA 2M9UA 4JJNK 2OTLT 1U3OA 1XTDA 2QQRA 1HXDA 1SHGA 4N4HA 3OYJA 1EFNA 2K57A 2EW3A 2ZGWA 3CCLA 2JMCA 2L3PA 1AZEA 2VWFA 2QDLA 1KD1R 1YJ9Q 1FMKA 2COYA 2DAQA 2CSQA 1B34A 4EIKA 1ZBJA 4MZTA 2HL5C 2X3WD 4EMHA 2XHCA 1PKTA 5J3BA 1MUZA 3M5AA 1WJQA 1OPKA 1SF9A 3X20B 3EGXB 3LYIA 4NL2A 3OS1A 4FIBA 1VQ4A 2AKLA 2BE7D 2QTXA 3CCRA 1K73R 1D3BA 2ECZA 1QP3A 5FWBA 2FPEA 3RMQA 3TSWA 4XU0A 4AG2C 2DBMA 2FZKB 4LDWA 3OS2A 1JB0E 1KQ2A 3DLLA 1H92A 1ZHIA 2KNBB 1PD0A 1IZ6A 5I21A 1LJOA 1T0JA 2IPOB 2KROA 1IXDA 3CC4A 1UHCA 1B07A 2DFUA 2QQ9A 2FHDA 4XTWA 2E70A 3PMTA 2CKKA 2XICA 3C94A 2J6FA 1K8AC 2L3QA 4XU1A 2DO3A 1U1SA 2O4XB 1FWZA 2QTVA 5GAOl 4HKEA 4PK4A 4OMQA 3I9QA 1RAIB 4MDXA 3PFSA 1I5LA 3CCVQ 1ZSZB 2DVJA 5KYXA 2K2VA 4OMPA 3LWIA 4C0FA 1WIEA 3O8VA 3VS4A 4DOWA 1ZA2B 2YUNA 2L8DA 2FPFA 1M9SA 1WNLA 3SDZA 4PJLA 1N8RC 5CR2A 2DXBA 3QBYA 4N4GA 1YITA 4QT7A 4C92A 3MKDA 1Q81C 2RJDA 4C92B 3OBYA 1S72Q 1UGQB 1IB8A 3NTKA 1Q82C 5D7UA 2QG9B 2KAFA 3EG9A 1YJNT 4HCCA 1D1BA 1E7OA 2CP7A 4OMOA 1ZX6A 1AHJB 5GMKm 2VYTA 3OBWA 2EJFA 3CC2A 4DEXA 1NM7A 3OYNA 4JLGA 1N9RA 2OTLQ 3U23A 1VQMA 2JTMA 1GBQA 1WQ7A 1W2BA 5GAN8 2RI5A 3INZA 1GFDA 1SHFA 3VU3C 2QQSA 1AEYA 3GLXA 2EQJA 3CBOA 2RHIA 1IGUA 3EG3A 1SKUB 1TTHB 3CMAT 1XOVA 3L2UA 5IHIA 1P92A 1TG0A 2DL5A 2DM1A 1NPRA 1W2BS 2KE9A 2COWA 1RAGB 4RTZA 2XI9A 1K73U 4KGVB 3CC7Q 1K73C 4C5EA 1Q86C 2JOYA 4PFPA 4M77C 4M75F 1RAAB 5CKBA 1PWTA 2K5FA 1KSWA 4X9CA 3CBMA 2JM8A 1M2VA 1YCYA 3VUZA 3V8KA 1YIJA 1G5VA 4WCIA 2LJ1A 4B9XA 1Q7YC 3RESA 2QGGA 2DTOA 2P0PA 4GLMA 2JM9A 4AG1C 2V1QA 3D7SB 4EMKB 2P4TA 2HL3A 2C0TA 5IHKA 4J9CA 1JEGA 3UWNA 2X4XA 1YFNA 2JW4A 1K0XA 5M9OA 4E7HA 2QA4A 5HKCA 2W10A 2QDYB 1I4K1 4LDUA 3M0UA 4PKCC 3E1SA 4BY6C 1TWBA 2DNUA 1D1AA 4J9GA 4KGXB 2PVGB 3R6OA 4DBRA 1U8RA 3CD6Q 2X51A 1BU1A 5IXFA 1RI0A 3OQ5A 1JO8A 1NJIR 2D6FA 1VQ8Q 5A0DA 3HHTB 2DTHA 2QGFB 4FCYA 2V26A 2AHJB 1UEBA 3G71Q 1M1GA 1K8AU 3OSSC 2DYBA 1M2OA 4RTUA 2L3RA 1WHLA 3NGPA 3ZBDA 3E9GA 3UATA 1M1KR 1KQ1A 4M7DB 1DJ7B 2LCSA 4YTLA 1U1TA 4DQ2A 5FRNA 1M8MA 1N5ZA 4N4IA 1PHTA 2K4YA 1O9SA 2VXFA 2YLCA 5I22A 1OQKA 4PJOD 4PLIA 1QQJA 2DZCA 1Y96B 1WXBA 1WHJA 3LWHA 3LW5E 1FXXA 4J83A 1AD5A 1UGVA 2KDSA 2FRWA 3RMSA 2R5MA 1YITQ 1RAHB 1V1CA 3CCLQ 3EH2A 4D8DA 5A0LA 1Q81U 2EQKA 3MEWA 1X6OA 4LD9K 3J7AF 2MK5A 4ELYC 4BE0A 1D09B 2CT3A 3QJYA 4FW1A 2QA4Q 2SEMA 4EMGA 3JCMW 4CC2A 2BIVA 4C92C 1K1ZA 3QSUA 1E6HA 2EBPA 4XTXA 2RHXA 2NUTA 4J7FA 3L42A 2A7YA 5LJ5g 1X2KA 2FG0A 3A8GB 2GQVA 1B3QA 4PJOE 1GCPA 4OB2B 2A36A 4M7AA 2MCNA 3LGFA 4IIMA 1VQLA 4DA4A 4HCKA 3JB9G 5GAN4 5DLQE 2WSEE 2EWNA 1VQOT 5FROA 2E64A 2WSFE 4LD6A 2QI2A 2AKKA 2ZZDA 1MGQA 1X2QA 3HPWA 1I81A 2FB7A 3TREA 2YWWA 2C0IA 5KYXB 3BW1A 2RQWA 2BZYA 2EJGA 2QXFA 1FYNA 1YI2A 2ZAEA 2I2LA 4L59A 3M55A 3VS0A 2J06A 4RTWA 1RAFB 1HJDA 1LNXA 1W70A 1NYGA 1WYXA 2QQBA 3OYIA 2LCCA 1YJWT 3QG1A 1MMDA 3H0HA 4RG2A 2DETA 1NG2A 1PRLC 3P8HA 4F7UF 1AWJA 1AWXA 1BI0A 1WDXA 3E19A 4A4EA 2NYSA 4BI3A 2DF6A 2KRSA 3OYBA 2MAMA 2LQWA 4LDYA 3S3MA 2DVEA 2DE0X 4HVWA 3E9FA 1UGRB 1VQNQ 4E7KA 1M1FA 2FYKA 3L2WA 3V7RA 3EGDB 4J5YA 3OW2A 4FSSA 4A4KA 2DTIA 2XU8A 4M75E 1S72A 4QVZA 3M9QA 4HT9A 3EG1A 2K79A 4BD3A 2ZPEB 5FWCA 1ABOA 1BIAA 1X75C 1PD1A 1N8RU 4QQ6A 1TUDA 1AWWA 1QVPA 2ENMA 3O5ZA 5GJWB 5FU6B 2L89A 3V8LA 1YITT 2XD0A 1W4SA 3UT1A 4P5NA 3RNJA 2X4JA 4MZPA 4HXJA 1IO6A 1YHQA 4ELZC 1Z9ZA 1NJIU 1WXTA 5GAN6 5CK9A 2MI6A 3MCAB 4J9FA 3V7CA 3OYAA 2D0NA 1R0BG 5LJ3j 1HD3A 1AOJA 2EYZA 3FDRA 3QDFA 2FZGB 2AT1B 1OX8A 3RKYA 1QVGP 1OI1A 2JS0A 5IAYA 1Y96A 1SG5A 4CC4B 5D6XA 2BTTA 4M77D 4HVVA 1VQKA 5A0GA 2DJZA 2CT4A 2FEIA 1N8RR 5GAOq 1QVGA 4LDXA 3CCLT 4M7AE 2DA9A 1KD1C 4PJOB 2DL4A 4QQGA 3CCMQ 5D6YA 1WGSA 2Y4XA 5LJ3g 1VQ4Q 5GAN7 1XNIA 2F2WA 2HSPA 2CZ0B 1PCXA 1N6AA 3ZFJA 2GF7A 4M77E 1D0YA 4IUVA 3IQLA 3V8JA 3CC2Q 2RHZA 2K9GA 5LL6S 3OYMA 2O4XA 2B86A 4PFOA 4LDVA 4ZN3A 4OF1A 4D8KA 3TCJA 4M7DF 4FYWB 2HKQB 4X9DA 4QVDA 1KJWA 2F5TX 1F1BB 2FVUA 4C5HA 4GY5A 3G71T 4J9BA 3REAB 2E41A 3VYHB 2GFAA 5LJ3d 3A1PA 3S6WA 3JV3A 1UGSB 2EGAA 5HK3A 4E7JA 4IURA 2K2MA 1I0CA 4RCCA 4QKUA 3CCMA 1YJWA 1UECA 2M0OA 1K9MC 1I5OB 1RL2A 3RKXA 1YN8A
chains in the Genus database with same CATH topology
3SEMA 3EHRA 1JQQA 4Z8AA 2DL8A 1VYTA 2LJ0A 2L2PA 3RBBB 3EG0A 2MOXA 2HCKA 4DEXA 1SPKA 1NM7A 1T3LA 1ABQA 3U23A 1GBQA 1WLPB 1KFZA 3QWYA 3REBB 2XMFA 1JXOA 1GFDA 1SHFA 1M3AA 1Y0MA 3VS2A 2BZXA 2M0YA 1AEYA 2VVKA 1ARKA 2D1XA 1GRIA 1K4US 2J7IA 2KRMA 3EG3A 1UDLA 1GFCA 2A37A 1I07A 1XOVA 2JT4A 2DILA 2GBQA 3EG2A 3I5SA 3EGUA 5IHIA 4DEYA 1TG0A 2GGRA 2DL5A 2DM1A 1WFWA 1NLOC 2KE9A 4RTZA 1MV0B 4LUDA 2SRCA 2G6FX 2IIMA 1H8KA 4F17A 2YT6A 2O9SA 4LNPA 4AFUC 5IXBA 1RLPC 1GCQA 1WA7A 1PWTA 1KSWA 2KBTA 1J3TA 1PNJA 2DL3A 3KFVA 1U5SA 1UG1A 2RQUA 4J9DA 2JM8A 3NPFA 3H41A 3ULRB 2A08A 1QKXA 1YWPA 1ZSGA 2AZVA 2JMAA 4CC7A 4WCIA 2X3XD 4LE9A 1UUEA 1WX6A 2LJ1A 5IH2A 3NHNA 3C0CA 4GLMA 2JM9A 4OMLA 2V1QA 4AG1C 5ECAA 1VA7A 2O9VA 4JZ3A 2OJ2A 2FO0A 2ROLA 1QWFA 2RNAA 3I35A 1H3HA 2C0TA 1RI9A 5IHKA 2RN8A 2CH4W 4J9CA 4OMMA 1JEGA 3A98A 2J6KA 2JW4A 2AZSA 1K0XA 2GQIA 1M3BA 1W6XA 2I0NA 2EYWA 2W10A 1QWEA 1VYUA 3VRZA 3GBQA 3VS6A 1QCFA 1TUCA 1ZUYA 3M0UA 3LH5A 2DNUA 4RTTA 4J9GA 1GL5A 2EKHA 1QLYA 4RTXA 1T0HA 3PVLA 4F14A 1M27C 1BU1A 5IXFA 2RPNA 4LUEA 2LZ6B 1JO8A 1WXUA 1GBRA 2RQRA 3M0TA 3CQTA 1Y57A 2PTKA 1PKSA 3ZL7C 2F2XA 1KIKA 2BZ8A 2P4RA 1G83A 2J05A 2V1RA 2DYBA 1K9AA 3PVQA 4KRTA 3M0RA 4RTUA 3NGPA 4IIOA 2CSIA 3UATA 4J9IA 2LCSA 1M8MA 1N5ZA 1M3CA 4GBQA 1PHTA 2H8HA 5I22A 3M0SA 1CKBA 3TVTA 1CKAA 1WXBA 2PZ1A 3NMZC 2DMOA 4JJDA 1AD5A 1UGVA 2KXCA 1NEBA 2FRWA 2CDTA 1UFFA 4JJBA 1V1CA 1BK2A 2YUPA 2AK5A 4D8DA 1UE9A 2KXDA 2ABLA 4J9EA 2LQNA 1JU5C 2ED1A 2CT3A 2DX1A 2HEQA 2SEMA 1X6GA 2CH4A 4CC2A 1AZGB 1T3SA 2D8HA 3R6NA 1K1ZA 4CC3A 1E6HA 2EBPA 2GTJA 1SRLA 1X2KA 1OPLA 4M4ZA 2FG0A 2RQTA 1B3QA 1U06A 2EQIA 4Z89A 2GNCA 2MIOA 2LJ3A 1GCPA 1RUWA 4JPBW 2A36A 2MCNA 2KYMA 4IIMA 2OI3A 4HCKA 2LP5A 2NWMA 3I5RA 2K7AA 4RTYA 1UJYA 1YP5A 1G2BA 4AFZC 3VS5A 2KT8A 1JXMA 2EYXA 2L0AA 5EC7A 4Z88A 4J9HA 2CUBA 3VS7A 2AKKA 1X2QA 2M51A 1X43A 3VS3A 4ESRA 1WI7A 3THKA 2LNHB 3M0PA 2C0IA 2E5KA 3QWXX 2YUQA 2RQWA 1YWOA 2BZYA 4F16A 1K0SA 1FYNA 2GTOA 1YCSB 3VS0A 2J06A 4RTWA 1LCKA 1NLPC 1HJDA 1W70A 1NYGA 1WYXA 2K3BA 2C0OA 3H0HA 2VKNA 1NG2A 1RLQC 2DL7A 1PRLC 1AWJA 1PRMC 2RMOA 4R0KA 3UF4A 1AWXA 1NYFA 1WDXA 4E6RA 2JTEA 2DF6A 3VRYA 2KRSA 3TSZA 1M30A 4JZ4A 1QKWA 2LQWA 1SRMA 2KEAA 1UJ0A 4OMNA 3UA7A 2FRYA 4JJCA 1Z9QA 2DE0X 4HVWA 1UHFA 1MV3A 2CUDA 2K6DA 5I11A 3M0QA 1X69A 4FSSA 2DLPA 2EVRA 2O31A 3PE0A 2LX7A 2KGTA 1BBZA 1ZLMA 2OAWA 1UTIA 3EG1A 1U3OA 2JXBA 2K79A 2EYYA 2ED0A 2LMJA 5FWCA 1SHGA 1ABOA 1SSHA 1ZUUA 1CSKA 1EFNA 3FJ5A 2EW3A 2JMCA 2L3PA 1AZEA 1YNZA 1TUDA 1AWWA 2ENMA 2VWFA 3O5ZA 5GJWB 2QDLA 2YUOA 2D8JA 2JS2A 5IHNA 1FMKA 2PNIA 2CSQA 3VS1A 3H0IA 3RNJA 1HSQA 4EIKA 1ZBJA 2EGCA 2X3WD 4HXJA 1PKTA 1MUZA 1IO6A 1Z9ZA 4ZNXA 1OPKA 1WXTA 2ESWA 1OV3A 4J9FA 4K11A 2D0NA 1S1NA 1OEBA 2EGEA 1HD3A 1AOJA 2AKLA 1X27A 2EYZA 1SEMA 4LN2A 1E6GA 5FW9A 2ECZA 5GJVB 1ZUKA 2FPEA 5FWBA 3TSWA 4AG2C 2DBMA 2JS0A 2RQVA 1H92A 1BB9A 4CC4B 2FPDA 3SHWA 1A0NB 1GCQC 2KNBB 2BTTA 5HCKA 2DRKA 2HDAA 4HVVA 1T0JA 2CT4A 2KROA 2FEIA 5L23A 2J6OA 1UHCA 1B07A 2J6FA 2L3QA 1W1FA 2DJQA 2KRNA 2DA9A 4AFSC 1NEGA 2DL4A 1AWOA 4OMQA 3I9QA 2ROTA 3UA6A 3H0FA 2NUZA 2F2WA 2HSPA 1AVZC 1I1JA 2HBWA 2KR3A 2DVJA 4A63B 2A28A 4OMPA 1VYVA 3IQLA 1WIEA 2K9GA 3VS4A 2YUNA 2O88A 2B86A 2FPFA 4D8KA 4RUGA 2L3SA 1K76A 3EHQA 4ORZA 1KJWA 4AFQC 2F2VA 2EPDA 4QT7A 2W0ZA 4J9BA 4RTVA 3REAB 4X1VA 2O2OA 2YDLA 2YSQA 2DRMA 4HVUA 3JV3A 2KYBA 2EGAA 4Y92A 2RF0A 2K2MA 2KT1A 1I0CA 1X6BA 1OOTA 1UECA 2CREA 1E7OA 2DBKA 4OMOA 1ZX6A 1YN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEM A;  3EHR A;  1JQQ A;  4Z8A A;  2DL8 A;  1VYT A;  2LJ0 A;  2L2P A;  3RBB B;  3EG0 A;  2MOX A;  2HCK A;  4DEX A;  1SPK A;  1NM7 A;  1T3L A;  1ABQ A;  3U23 A;  1GBQ A;  1WLP B;  1KFZ A;  3QWY A;  3REB B;  2XMF A;  1JXO A;  1GFD A;  1SHF A;  1M3A A;  1Y0M A;  3VS2 A;  2BZX A;  2M0Y A;  1AEY A;  2VVK A;  1ARK A;  2D1X A;  1GRI A;  1K4U S;  2J7I A;  2KRM A;  3EG3 A;  1UDL A;  1GFC A;  2A37 A;  1I07 A;  1XOV A;  2JT4 A;  2DIL A;  2GBQ A;  3EG2 A;  3I5S A;  3EGU A;  5IHI A;  4DEY A;  1TG0 A;  2GGR A;  2DL5 A;  2DM1 A;  1WFW A;  1NLO C;  2KE9 A;  4RTZ A;  1MV0 B;  4LUD A;  2SRC A;  2G6F X;  2IIM A;  1H8K A;  4F17 A;  2YT6 A;  2O9S A;  4LNP A;  4AFU C;  5IXB A;  1RLP C;  1GCQ A;  1WA7 A;  1PWT A;  1KSW A;  2KBT A;  1J3T A;  1PNJ A;  2DL3 A;  3KFV A;  1U5S A;  1UG1 A;  2RQU A;  4J9D A;  2JM8 A;  3NPF A;  3H41 A;  3ULR B;  2A08 A;  1QKX A;  1YWP A;  1ZSG A;  2AZV A;  2JMA A;  4CC7 A;  4WCI A;  2X3X D;  4LE9 A;  1UUE A;  1WX6 A;  2LJ1 A;  5IH2 A;  3NHN A;  3C0C A;  4GLM A;  2JM9 A;  4OML A;  2V1Q A;  4AG1 C;  5ECA A;  1VA7 A;  2O9V A;  4JZ3 A;  2OJ2 A;  2FO0 A;  2ROL A;  1QWF A;  2RNA A;  3I35 A;  1H3H A;  2C0T A;  1RI9 A;  5IHK A;  2RN8 A;  2CH4 W;  4J9C A;  4OMM A;  1JEG A;  3A98 A;  2J6K A;  2JW4 A;  2AZS A;  1K0X A;  2GQI A;  1M3B A;  1W6X A;  2I0N A;  2EYW A;  2W10 A;  1QWE A;  1VYU A;  3VRZ A;  3GBQ A;  3VS6 A;  1QCF A;  1TUC A;  1ZUY A;  3M0U A;  3LH5 A;  2DNU A;  4RTT A;  4J9G A;  1GL5 A;  2EKH A;  1QLY A;  4RTX A;  1T0H A;  3PVL A;  4F14 A;  1M27 C;  1BU1 A;  5IXF A;  2RPN A;  4LUE A;  2LZ6 B;  1JO8 A;  1WXU A;  1GBR A;  2RQR A;  3M0T A;  3CQT A;  1Y57 A;  2PTK A;  1PKS A;  3ZL7 C;  2F2X A;  1KIK A;  2BZ8 A;  2P4R A;  1G83 A;  2J05 A;  2V1R A;  2DYB A;  1K9A A;  3PVQ A;  4KRT A;  3M0R A;  4RTU A;  3NGP A;  4IIO A;  2CSI A;  3UAT A;  4J9I A;  2LCS A;  1M8M A;  1N5Z A;  1M3C A;  4GBQ A;  1PHT A;  2H8H A;  5I22 A;  3M0S A;  1CKB A;  3TVT A;  1CKA A;  1WXB A;  2PZ1 A;  3NMZ C;  2DMO A;  4JJD A;  1AD5 A;  1UGV A;  2KXC A;  1NEB A;  2FRW A;  2CDT A;  1UFF A;  4JJB A;  1V1C A;  1BK2 A;  2YUP A;  2AK5 A;  4D8D A;  1UE9 A;  2KXD A;  2ABL A;  4J9E A;  2LQN A;  1JU5 C;  2ED1 A;  2CT3 A;  2DX1 A;  2HEQ A;  2SEM A;  1X6G A;  2CH4 A;  4CC2 A;  1AZG B;  1T3S A;  2D8H A;  3R6N A;  1K1Z A;  4CC3 A;  1E6H A;  2EBP A;  2GTJ A;  1SRL A;  1X2K A;  1OPL A;  4M4Z A;  2FG0 A;  2RQT A;  1B3Q A;  1U06 A;  2EQI A;  4Z89 A;  2GNC A;  2MIO A;  2LJ3 A;  1GCP A;  1RUW A;  4JPB W;  2A36 A;  2MCN A;  2KYM A;  4IIM A;  2OI3 A;  4HCK A;  2LP5 A;  2NWM A;  3I5R A;  2K7A A;  4RTY A;  1UJY A;  1YP5 A;  1G2B A;  4AFZ C;  3VS5 A;  2KT8 A;  1JXM A;  2EYX A;  2L0A A;  5EC7 A;  4Z88 A;  4J9H A;  2CUB A;  3VS7 A;  2AKK A;  1X2Q A;  2M51 A;  1X43 A;  3VS3 A;  4ESR A;  1WI7 A;  3THK A;  2LNH B;  3M0P A;  2C0I A;  2E5K A;  3QWX X;  2YUQ A;  2RQW A;  1YWO A;  2BZY A;  4F16 A;  1K0S A;  1FYN A;  2GTO A;  1YCS B;  3VS0 A;  2J06 A;  4RTW A;  1LCK A;  1NLP C;  1HJD A;  1W70 A;  1NYG A;  1WYX A;  2K3B A;  2C0O A;  3H0H A;  2VKN A;  1NG2 A;  1RLQ C;  2DL7 A;  1PRL C;  1AWJ A;  1PRM C;  2RMO A;  4R0K A;  3UF4 A;  1AWX A;  1NYF A;  1WDX A;  4E6R A;  2JTE A;  2DF6 A;  3VRY A;  2KRS A;  3TSZ A;  1M30 A;  4JZ4 A;  1QKW A;  2LQW A;  1SRM A;  2KEA A;  1UJ0 A;  4OMN A;  3UA7 A;  2FRY A;  4JJC A;  1Z9Q A;  2DE0 X;  4HVW A;  1UHF A;  1MV3 A;  2CUD A;  2K6D A;  5I11 A;  3M0Q A;  1X69 A;  4FSS A;  2DLP A;  2EVR A;  2O31 A;  3PE0 A;  2LX7 A;  2KGT A;  1BBZ A;  1ZLM A;  2OAW A;  1UTI A;  3EG1 A;  1U3O A;  2JXB A;  2K79 A;  2EYY A;  2ED0 A;  2LMJ A;  5FWC A;  1SHG A;  1ABO A;  1SSH A;  1ZUU A;  1CSK A;  1EFN A;  3FJ5 A;  2EW3 A;  2JMC A;  2L3P A;  1AZE A;  1YNZ A;  1TUD A;  1AWW A;  2ENM A;  2VWF A;  3O5Z A;  5GJW B;  2QDL A;  2YUO A;  2D8J A;  2JS2 A;  5IHN A;  1FMK A;  2PNI A;  2CSQ A;  3VS1 A;  3H0I A;  3RNJ A;  1HSQ A;  4EIK A;  1ZBJ A;  2EGC A;  2X3W D;  4HXJ A;  1PKT A;  1MUZ A;  1IO6 A;  1Z9Z A;  4ZNX A;  1OPK A;  1WXT A;  2ESW A;  1OV3 A;  4J9F A;  4K11 A;  2D0N A;  1S1N A;  1OEB A;  2EGE A;  1HD3 A;  1AOJ A;  2AKL A;  1X27 A;  2EYZ A;  1SEM A;  4LN2 A;  1E6G A;  5FW9 A;  2ECZ A;  5GJV B;  1ZUK A;  2FPE A;  5FWB A;  3TSW A;  4AG2 C;  2DBM A;  2JS0 A;  2RQV A;  1H92 A;  1BB9 A;  4CC4 B;  2FPD A;  3SHW A;  1A0N B;  1GCQ C;  2KNB B;  2BTT A;  5HCK A;  2DRK A;  2HDA A;  4HVV A;  1T0J A;  2CT4 A;  2KRO A;  2FEI A;  5L23 A;  2J6O A;  1UHC A;  1B07 A;  2J6F A;  2L3Q A;  1W1F A;  2DJQ A;  2KRN A;  2DA9 A;  4AFS C;  1NEG A;  2DL4 A;  1AWO A;  4OMQ A;  3I9Q A;  2ROT A;  3UA6 A;  3H0F A;  2NUZ A;  2F2W A;  2HSP A;  1AVZ C;  1I1J A;  2HBW A;  2KR3 A;  2DVJ A;  4A63 B;  2A28 A;  4OMP A;  1VYV A;  3IQL A;  1WIE A;  2K9G A;  3VS4 A;  2YUN A;  2O88 A;  2B86 A;  2FPF A;  4D8K A;  4RUG A;  2L3S A;  1K76 A;  3EHQ A;  4ORZ A;  1KJW A;  4AFQ C;  2F2V A;  2EPD A;  4QT7 A;  2W0Z A;  4J9B A;  4RTV A;  3REA B;  4X1V A;  2O2O A;  2YDL A;  2YSQ A;  2DRM A;  4HVU A;  3JV3 A;  2KYB A;  2EGA A;  4Y92 A;  2RF0 A;  2K2M A;  2KT1 A;  1I0C A;  1X6B A;  1OOT A;  1UEC A;  2CRE A;  1E7O A;  2DBK A;  4OMO A;  1ZX6 A;  1YN8 A; 
#chains in the Genus database with same CATH topology
 3G1J A;  1RAB B;  4Z8A A;  3HFO A;  1G8X A;  5J26 A;  2H3J A;  2MOX A;  4GLK A;  1SPK A;  4F7U B;  1TXQ A;  4EDU A;  3QWY A;  2XMF A;  1M3A A;  1BIB A;  2M02 A;  2E6Z A;  2JVV A;  2BZX A;  1MMA A;  4XK8 E;  2RI2 A;  1ARK A;  4M75 G;  1NJI C;  4C8Q D;  1GRI A;  1K4U S;  4E7I A;  2E12 A;  1KG1 A;  2J7I A;  2QEX T;  2MPX C;  3FRN A;  5GMK i;  3CCE Q;  2CZ1 B;  2JT4 A;  2GBQ A;  3EGU A;  3DLM A;  4PL6 A;  3MO8 A;  5FU6 C;  4N0A A;  4M75 C;  2HQE A;  4II1 A;  5KYN A;  1MV0 B;  4LUD A;  1YJN Q;  2IIM A;  2RK1 A;  4F17 A;  3UDC A;  2QQA A;  3HRS A;  4LNP A;  1RLP C;  5C0M A;  1WA7 A;  4FL6 A;  4FYY B;  1PNJ A;  2DL3 A;  1C0M A;  2YRC A;  1U5S A;  5I2M A;  2VXE A;  4MDW A;  2HNI A;  1JJ2 A;  1XJW B;  3H41 A;  2A08 A;  1YWP A;  1TUG B;  2X3X D;  2YHT A;  3NHN A;  4C5G A;  4A4H A;  2VC8 A;  2Z0W A;  1TU0 B;  3HFN A;  3L2V A;  3CCU T;  1QWF A;  2RNA A;  3EH1 A;  8AT1 B;  3FEO A;  3LH0 A;  2X35 A;  5GAN 3;  1ZA1 B;  4IUP A;  3VYG A;  1YBY A;  3DB3 A;  2AZS A;  4D6W A;  5CIU A;  2HZY A;  4C0Z A;  1W6X A;  1WHH A;  3VRZ A;  1VYU A;  1R0C B;  2XDB A;  3VS6 A;  2JN0 A;  2BE9 B;  1VQN A;  1RAE B;  3JCM b;  4DOV A;  1VQ7 A;  5GMK l;  3H6Z A;  2D0Q B;  5CCA A;  4RTX A;  1VQP T;  1EIF A;  3CCS Q;  4C8Q G;  4OB1 B;  2VGN A;  1QVF A;  1D0X A;  2E5Q A;  5KYY A;  4LUE A;  2LZ6 B;  4TVR A;  1GBR A;  1BYM A;  1KC8 U;  3OYC A;  2VAS A;  2RQR A;  2YLB A;  1Q86 R;  2QYZ A;  3M0T A;  1Y57 A;  2PTK A;  1VQ7 Q;  3NTH A;  2BZ8 A;  4XQ3 A;  3CCS A;  2J05 A;  2V1R A;  3VUB A;  1K9A A;  3PVQ A;  2HBP A;  4KRT A;  5GAM f;  4EMK C;  2NLU A;  5FU7 C;  1ZSZ A;  1PG5 B;  4J6W A;  3G6E Q;  1VQ5 Q;  3CCJ T;  9ATC B;  5GMK e;  2V8J A;  4F7U A;  5GAN 5;  3CCQ A;  1KQS A;  1CKB A;  3C95 A;  5GAO m;  1VQ6 T;  4M78 D;  2JJ9 A;  4IUT A;  4E7Z A;  5CKD A;  4C8Q A;  3I55 A;  5KYW B;  2CDT A;  2P0Q A;  2Y90 A;  4JJB A;  1YHQ Q;  4KUI A;  4PNO A;  1G3S A;  3HL8 A;  3WXM B;  4Z02 A;  3CMA Q;  2HEQ A;  1VIF A;  1ZSZ C;  3CCV A;  2PVD B;  2E6N A;  2F1L A;  4B9W A;  2DD4 A;  4N0A C;  5LJ5 d;  4F7U E;  4L6V 5;  2LJ3 A;  1EX4 A;  1MMG A;  4M7A D;  3CC7 A;  1LOJ A;  2LP5 A;  4JLI A;  4RTY A;  1VQ9 A;  1G2B A;  2Y4Y A;  3VS5 A;  3M58 A;  5KE2 A;  5A2Q E;  1HK9 A;  3C12 A;  3QXE B;  2WAC A;  4RG8 A;  5EC7 A;  2X4W A;  1OZ2 A;  3E2U A;  2M51 A;  3A8O B;  1M90 C;  1PSF A;  3RIR A;  1QVF P;  1JJ2 P;  2LNH B;  3M0P A;  1YHQ T;  3OA6 A;  4F16 A;  1K0S A;  3CC2 T;  2DYI A;  4RKU E;  2DEU A;  1LCK A;  2KSS A;  3EAE A;  1NLP C;  2OTJ T;  2OX7 A;  1G3Y A;  3I56 Q;  1RLQ C;  1KHI A;  3J81 E;  4PJJ A;  1GXI E;  1D3B B;  2GFU A;  2JTE A;  3CXC A;  3VRY A;  4M7A B;  3JCM P;  2CZ7 B;  1Q7Y R;  2A0F B;  1VQP Q;  1D0Z A;  2RHY A;  2FRY A;  4JJC A;  1Z9Q A;  4C92 D;  3QHS A;  1WPY A;  1UHF A;  4XTU A;  1MV3 A;  1VQ8 A;  3JRZ A;  5I11 A;  3GIB A;  5GAO n;  1WQW A;  4JS5 A;  4JRI A;  1TSF A;  2DXT A;  1PSE A;  1QVF S;  3JCM f;  3L2Z A;  3PE0 A;  1BBZ A;  4M7A G;  2LMJ A;  1X01 A;  1AT1 B;  1SSH A;  1ZUU A;  1CSK A;  1C6V X;  3OYG A;  4JRP A;  1VQ9 Q;  3JCM g;  3NTI A;  1YNZ A;  1M8V A;  5KYW A;  1RAD B;  2JS2 A;  3FC3 A;  4E2F B;  3A5Z B;  2E1H A;  3H0I A;  4OVA A;  2MF2 A;  3M57 A;  2EGC A;  2E4H A;  2HKN A;  5AT1 B;  4C0G A;  3CCQ Q;  3P8B B;  1K9M U;  1ZBX A;  2JNG A;  3JCM h;  1ZQ1 A;  2ESW A;  3PMI A;  1OV3 A;  4X34 A;  3JCM X;  4K11 A;  2PQW A;  1S1N A;  1OEB A;  3H8Z A;  2EGE A;  4KGZ B;  1D1C A;  3F70 A;  3NFC A;  2P0K A;  4NS5 A;  3UPU A;  3L2Q A;  3KXT A;  2V8I A;  4MZM A;  3JAM E;  1O75 A;  5LJ3 e;  3TQ7 P;  3T9N A;  3SHW A;  3JB9 J;  4M77 A;  1YJ9 A;  3OMC A;  4JS4 A;  1KQS S;  5L23 A;  2XK0 A;  1M90 U;  1YJW Q;  3G4S Q;  1M2V B;  3CCV T;  4M78 F;  4M7D A;  2DER A;  1YIJ T;  2DJQ A;  2KRN A;  2YRV A;  3MP1 A;  4AFS C;  1MND A;  2G3R A;  1AWO A;  3JB9 F;  1FX7 A;  2MWO A;  2CP6 A;  4M78 B;  3RKW A;  3SFM A;  4OGE A;  3UA6 A;  3H0F A;  5GMK j;  1AVZ C;  3JB9 I;  2A3L A;  1IGQ A;  3OS0 A;  2HBW A;  2JTF A;  2MYS A;  4FYX B;  4A63 B;  2A28 A;  1VYV A;  3JCM Q;  5KH6 A;  1ACM B;  4O5V A;  4FSX A;  4FU6 A;  3ZEH A;  2R57 A;  3GF5 A;  4BE1 A;  2HMA A;  4RUG A;  4A4F A;  4C8Q E;  3LX7 A;  1OZ3 A;  3EHQ A;  2DK3 A;  2F2V A;  2EPD A;  1YI2 Q;  4BE2 A;  1K8A R;  3ER0 A;  3WVD B;  1B7T A;  1JBM A;  1WHG A;  4X1V A;  4HA8 A;  1VQO Q;  3QZ5 B;  3MET A;  4M77 F;  2YDL A;  1VQM T;  3KBG A;  2RF0 A;  3CCU A;  2KT1 A;  1X6B A;  1OOT A;  2LT1 A;  3I55 Q;  4E47 A;  2CP2 A;  2M16 A;  1JQQ A;  2DL8 A;  1VYT A;  4ZGD B;  2X9H A;  1NPP A;  3L1A A;  3QKJ A;  4XTZ A;  3CMA A;  3JCM e;  1T3L A;  1ABQ A;  5D6W A;  2LNV A;  4Q5W A;  3KUF A;  1WLP B;  5CQX A;  5KYU B;  3REB B;  3EFR A;  4AMC A;  5GAO r;  1TS9 A;  1VQ8 T;  3HRT A;  1VQO A;  3VS2 A;  4E7L A;  1TOV A;  2VVK A;  3CME Q;  1KQS P;  1BCM A;  1VQ5 T;  4ZGJ B;  2HSE B;  1YI2 T;  2KRM A;  3OYL A;  1GFC A;  1QVG S;  1N9S A;  4M7D G;  2A37 A;  4MML A;  1V76 A;  4M7A C;  5GAM h;  2DIL A;  2X4Y A;  4DBF A;  2CS7 A;  4DEY A;  3GOX A;  1UGP B;  1V29 B;  1NLO C;  4MMK A;  3QYG B;  4J7I A;  3I56 A;  4B6M A;  3SD4 A;  1VQ6 Q;  2CGH A;  2YT6 A;  2O9S A;  4AFU C;  1UB4 A;  2OTL A;  2KBT A;  5CVI A;  4ATO A;  3OMG A;  1UG1 A;  4J9D A;  2DZ9 A;  2EAY A;  3EGD A;  4J6X A;  4M7D E;  2FL7 A;  3NPF A;  5KE3 A;  1KC8 R;  2JMA A;  2AZV A;  8ATC B;  5C6S A;  3EFS A;  4LE9 A;  1QP2 A;  1UUE A;  3AT1 B;  5IH2 A;  3C0C A;  3M4G A;  5ECA A;  3X28 B;  2FO0 A;  2E3H A;  3PTA A;  1RI9 A;  4C92 G;  2CH4 W;  3OB9 A;  5DM7 R;  4OMM A;  3BDU A;  3OYF A;  1JJ2 S;  1MNE A;  1BI1 A;  2I0N A;  2GCX A;  2DD5 A;  2EYW A;  1QWE A;  1MHN A;  1QCF A;  1TUC A;  1ZUY A;  3LH5 A;  2BKD N;  5EG2 A;  3SWN B;  2EKH A;  3C4S A;  4IUQ A;  1T0H A;  5IT9 E;  2BUD A;  4M75 A;  4F14 A;  1M27 C;  1IRX A;  2ZPF B;  2RH2 A;  4FT4 A;  1WXU A;  5LJ3 h;  2C06 A;  3CQT A;  2LT4 A;  2DIQ A;  2LVM A;  1PKS A;  2F2X A;  1KIK A;  2RM4 A;  5L8R E;  2P4R A;  4AT1 B;  4J6Y A;  1G83 A;  3CD6 A;  2XID A;  2XKO C;  3M0R A;  3CXC S;  5DLO A;  3S3N A;  2RO0 A;  2HQH A;  4J9I A;  5LJ5 j;  2DEQ A;  1N27 A;  4GBQ A;  3EG9 B;  5IN1 A;  2H8H A;  4R55 A;  3M0S A;  3MP6 A;  1CKA A;  2F69 A;  2E3I A;  3JB9 D;  4IKF A;  3NMZ C;  3VKI A;  3VV0 A;  3G4S T;  4WTO B;  4C8Q C;  4Y91 A;  1NEB A;  3CCE A;  2YRD A;  4M78 C;  3MP8 A;  2KK4 A;  1BK2 A;  4ZTF A;  1QCO A;  2KXD A;  2LQ8 A;  2ABL A;  2EFI A;  2RJC A;  2E10 A;  1VOM A;  4ANJ A;  2KMT A;  3OW2 P;  4V2S A;  1R8O B;  3JCM c;  2ATC B;  2DX1 A;  1X6G A;  2CH4 A;  2RA2 A;  1FMW A;  2GTJ A;  3A8H B;  2CP3 A;  1SRL A;  4JDS A;  4M4Z A;  4Z89 A;  4M7A F;  2LX9 A;  2MIO A;  1TH7 A;  4JUV A;  5HK0 A;  7AT1 B;  3CCR T;  1M90 R;  5FLX E;  1OU8 A;  4JPB W;  4F04 B;  3QII A;  2NUP A;  3CXC P;  3CCJ Q;  3FLG A;  1JRI A;  3HP9 A;  4QVC A;  2EQU A;  4PFZ A;  3I5R A;  1YP5 A;  4OMF B;  2CZ6 B;  4M77 B;  4BAC A;  2L0A A;  3QDR B;  3CPW P;  4J9H A;  2CUB A;  3VS7 A;  4BDY A;  4UC4 A;  3DKM A;  5GAN f;  2DXC A;  3M59 A;  1VQ6 A;  1G3W A;  2RI3 A;  1QW1 A;  2QAS A;  3QWX X;  2YUQ A;  3BY7 A;  1VQL T;  4PJO A;  1VIE A;  2GTO A;  1YCS B;  1KD1 U;  1Y7X A;  2CP5 A;  4M77 G;  4PJM A;  2ZPG B;  3J80 E;  1RAC B;  3OSV A;  2V8K A;  2DL7 A;  1NE8 A;  3EGX A;  1M5Q 1;  4OP0 A;  1PC0 A;  3CPW A;  1PRM C;  2RMO A;  1VUB A;  3TU4 K;  1I8F A;  3QUI A;  4C92 F;  3CME A;  1VQ4 T;  4PJO G;  2XG8 D;  1YIJ Q;  1SRM A;  2XDP A;  4OMN A;  1PM3 A;  3CCS T;  1VQK Q;  3UA7 A;  3CC4 Q;  1Q81 R;  2AIR B;  3SWN C;  1Q7Y U;  3RDV A;  2R58 A;  2K6D A;  5HY6 A;  1X69 A;  3QJ6 A;  2XDD A;  3MJX A;  4M7D D;  3PIO A;  2EVR A;  2O31 A;  2QA4 T;  2LX7 A;  2KGT A;  2OAW A;  1UTI A;  2F5K A;  4ZN1 A;  3V7S A;  1YJN A;  3CC4 T;  2JXB A;  4JRQ A;  2EYY A;  3GPL A;  1VQL Q;  2ED0 A;  4KH0 B;  3FJ5 A;  4A54 A;  1BI2 A;  2YUO A;  2D8J A;  3JCM d;  4BUG A;  3DB4 A;  5IHN A;  2PNI A;  3VS1 A;  4JRK A;  5GAN j;  1HSQ A;  4E7S A;  3OW2 S;  2KI7 A;  1Q82 U;  3S3O A;  3HRU A;  4ZNX A;  1WJR A;  3X24 B;  2DIG A;  2LTO A;  1VQN T;  1X27 A;  1SEM A;  3Q1J A;  4C0D C;  4LN2 A;  1E6G A;  5FW9 A;  2K3Y A;  3HKS A;  3G4S A;  5GJV B;  1ZUK A;  4QW2 A;  5CKF A;  1HYO A;  3LGL A;  4L5G A;  4XAX B;  3CC7 T;  6AT1 B;  2RHU A;  4XU2 A;  2RQV A;  1BB9 A;  2FPD A;  1A0N B;  1GCQ C;  4A53 A;  5HCK A;  4M75 B;  2DRK A;  2QK0 A;  5AYF A;  2HDA A;  2J6O A;  5KYY B;  3ME9 A;  2JZ2 A;  2E65 A;  2VGM A;  4PJO F;  2DPP B;  1W1F A;  3PNW C;  4ZGE B;  2IG0 A;  5KYU A;  1B34 B;  1NEG A;  3VJP A;  3CCJ A;  5FU7 B;  3HTR A;  2ROT A;  2H3E B;  3G6E T;  2NUZ A;  5CKH A;  2K3X A;  4C92 E;  1I1J A;  3GNG A;  3CCQ T;  1C1A A;  2KR3 A;  2PUK B;  1Q86 U;  3I56 T;  2KY9 A;  2CYZ B;  5LJ5 f;  5GAN d;  2O88 A;  3SB2 A;  2KVQ G;  1BI3 A;  4LXC A;  1NBE B;  2L3S A;  5J39 A;  3SWN A;  1K76 A;  1R77 A;  4WF2 A;  4ORZ A;  4AFQ C;  1H3Z A;  4RMO A;  2QEX Q;  2W0Z A;  3PGG A;  4Y28 E;  4RTV A;  5CAI A;  4M75 D;  2O2O A;  3EFO B;  2YSQ A;  2DRM A;  4HVU A;  2KYB A;  1KC8 C;  2HD0 A;  4Y92 A;  3N5B B;  1WJS A;  4XU3 A;  4ME7 A;  4FW2 A;  2CRE A;  1OYX A;  3JCM J;  2R5A A;  1IHW A;  5GAN g;  2DBK A;  1K9M R;  3SEM A;  3EHR A;  3CBP A;  3MEU A;  4O6J A;  5LJ5 h;  4OB3 B;  4BY6 B;  4BI4 A;  4VUB A;  2LJ0 A;  2L2P A;  3RBB B;  3EG0 A;  3FB9 A;  4C8Q B;  3CME T;  2HCK A;  1W2B P;  3FJP A;  3CCU Q;  4KH1 B;  5CQY A;  2IVW A;  3GNF B;  5GAM g;  1KFZ A;  2LQK A;  3CPW S;  1JXO A;  3OYY A;  1XQH A;  1Y0M A;  4KUL A;  1BCO A;  1G3T A;  2EKO A;  2M0Y A;  4NL3 A;  2D1X A;  4HCB A;  5KCO A;  4PLL A;  2LDM A;  4KBM B;  2ZPH B;  3A8L B;  1UDL A;  4DBQ A;  5CKE A;  2LRQ A;  1I07 A;  3EFO A;  3EG2 A;  3I5S A;  3MPU B;  2GGR A;  4M7D C;  2O01 E;  1WFW A;  3PIP A;  2SRC A;  2EIF A;  1QCN A;  2G6F X;  2WSC E;  3BE3 A;  3MHX A;  3QO3 A;  1H8K A;  2EYQ A;  5IXB A;  1GCQ A;  1KHC A;  1OU9 A;  1SSF A;  1J3T A;  3KFV A;  2RQU A;  5DY9 A;  3ULR B;  1QKX A;  2ZCF B;  1ZSG A;  5GMK h;  4CC7 A;  4KT0 E;  1WX6 A;  1M4Z A;  1BKB A;  4BB7 A;  4OML A;  5CO7 A;  3RUX A;  1VA7 A;  2O9V A;  1NZ9 A;  4JZ3 A;  2OJ2 A;  4PJN A;  2ROL A;  2HQX A;  3I35 A;  2FZC B;  1H3H A;  2K5I A;  2COZ A;  2DKG A;  2RN8 A;  2EQM A;  3X25 B;  3FIF A;  3A98 A;  2J6K A;  1Y07 A;  2QAZ A;  2ZPI B;  2B8A A;  3OYD A;  2RJF A;  1WHM A;  2GQI A;  1M3B A;  4CI0 C;  2M1H A;  5FRM A;  3GBQ A;  4RCB A;  5GAM d;  4EPC A;  4DBH A;  3P8D A;  4RTT A;  1LPL A;  2PU9 B;  1GL5 A;  1QLY A;  2OTJ A;  3MEV A;  3PVL A;  4OB0 B;  3M54 A;  1M1K C;  1Q95 G;  2RPN A;  4F7U G;  1OX9 A;  3M4Y A;  4OGC A;  5LJ5 e;  3LLR A;  3HSB A;  3G6E A;  3QYH B;  1VQK T;  3ZL7 C;  3RR6 A;  5GAM j;  4QQD A;  1IHV A;  3I55 T;  1VQP A;  3CCR Q;  4IIO A;  2CSI A;  3ASK A;  1VQM Q;  3BFM A;  3MEA A;  1M3C A;  3OYK A;  1YJ9 T;  3JSC A;  2HAX A;  2K5L A;  1KK7 A;  3H9N A;  4FM4 B;  3TVT A;  4J8O A;  5I2S A;  2PZ1 A;  2DMO A;  4HCZ A;  4JJD A;  2PUO B;  2KXC A;  2RD1 A;  1OUL A;  1QMC A;  1UFF A;  5GAN h;  2YUP A;  2AK5 A;  1UE9 A;  4PJO C;  4J9E A;  3G71 A;  2LQN A;  1JU5 C;  3CCM T;  2ED1 A;  4A4G A;  1AZG B;  2VUB A;  1T3S A;  1EZZ B;  2D8H A;  3R6N A;  4CC3 A;  4IUU A;  3OY9 A;  4M78 E;  3OYE A;  1OPL A;  2LCL A;  3AHU A;  2RQT A;  1Y71 A;  1U06 A;  2EQI A;  5KCH A;  2GNC A;  2CP0 A;  3TEE A;  1RUW A;  4NOY A;  2KYM A;  2OI3 A;  3CEY A;  4CRI A;  2PVO B;  2NWM A;  4C0D B;  2K7A A;  1UJY A;  3GP8 A;  4AFZ C;  1WZO A;  2KT8 A;  1JXM A;  2EYX A;  1IRE B;  2VV5 A;  1S72 T;  4Z88 A;  2OAU A;  2YXY A;  2D9T A;  4XTV A;  3L2R A;  1X43 A;  3VS3 A;  4ESR A;  1WI7 A;  3THK A;  2EJ9 A;  2E5K A;  1H64 1;  5GAN e;  3URG A;  4KUD K;  4BI8 B;  1YWO A;  3CCE T;  4C8Q F;  2QEX A;  3G7Z A;  3X26 B;  4FT2 A;  1VQ9 T;  4M78 A;  3JCM V;  1VQ7 T;  3BDL A;  3PT9 A;  2L5Q A;  2P84 A;  2K3B A;  2C0O A;  2VKN A;  2KQW A;  1WHK A;  2NUT B;  4HT8 A;  1M1K U;  4R0K A;  3UF4 A;  1NYF A;  2MWP A;  4FYV B;  3M53 A;  4E6R A;  1FMV A;  3OS5 A;  3OYH A;  1MMN A;  3TSZ A;  2OTJ Q;  2RB6 A;  2RK2 A;  1M30 A;  4JZ4 A;  2RJE A;  3WVE B;  3QZ9 B;  1QKW A;  4C5I A;  2KEA A;  2ZPB B;  1UJ0 A;  3CD6 T;  4EMK A;  4M78 G;  1Q82 R;  2JUF A;  5LJ3 f;  2MMP A;  5GAO p;  1VQ5 A;  4ZTJ A;  2LC4 A;  2CUD A;  4R56 A;  4BDZ A;  5GAN 2;  2DXU A;  3M0Q A;  1LVK A;  5GAM e;  3CPF A;  3QPH A;  2DLP A;  2NUP B;  2VB6 A;  3RER A;  3M56 A;  4XTY A;  3JB9 H;  3A8M B;  1ZLM A;  2M9U A;  4JJN K;  2OTL T;  1U3O A;  1XTD A;  2QQR A;  1HXD A;  1SHG A;  4N4H A;  3OYJ A;  1EFN A;  2K57 A;  2EW3 A;  2ZGW A;  3CCL A;  2JMC A;  2L3P A;  1AZE A;  2VWF A;  2QDL A;  1KD1 R;  1YJ9 Q;  1FMK A;  2COY A;  2DAQ A;  2CSQ A;  1B34 A;  4EIK A;  1ZBJ A;  4MZT A;  2HL5 C;  2X3W D;  4EMH A;  2XHC A;  1PKT A;  5J3B A;  1MUZ A;  3M5A A;  1WJQ A;  1OPK A;  1SF9 A;  3X20 B;  3EGX B;  3LYI A;  4NL2 A;  3OS1 A;  4FIB A;  1VQ4 A;  2AKL A;  2BE7 D;  2QTX A;  3CCR A;  1K73 R;  1D3B A;  2ECZ A;  1QP3 A;  5FWB A;  2FPE A;  3RMQ A;  3TSW A;  4XU0 A;  4AG2 C;  2DBM A;  2FZK B;  4LDW A;  3OS2 A;  1JB0 E;  1KQ2 A;  3DLL A;  1H92 A;  1ZHI A;  2KNB B;  1PD0 A;  1IZ6 A;  5I21 A;  1LJO A;  1T0J A;  2IPO B;  2KRO A;  1IXD A;  3CC4 A;  1UHC A;  1B07 A;  2DFU A;  2QQ9 A;  2FHD A;  4XTW A;  2E70 A;  3PMT A;  2CKK A;  2XIC A;  3C94 A;  2J6F A;  1K8A C;  2L3Q A;  4XU1 A;  2DO3 A;  1U1S A;  2O4X B;  1FWZ A;  2QTV A;  5GAO l;  4HKE A;  4PK4 A;  4OMQ A;  3I9Q A;  1RAI B;  4MDX A;  3PFS A;  1I5L A;  3CCV Q;  1ZSZ B;  2DVJ A;  5KYX A;  2K2V A;  4OMP A;  3LWI A;  4C0F A;  1WIE A;  3O8V A;  3VS4 A;  4DOW A;  1ZA2 B;  2YUN A;  2L8D A;  2FPF A;  1M9S A;  1WNL A;  3SDZ A;  4PJL A;  1N8R C;  5CR2 A;  2DXB A;  3QBY A;  4N4G A;  1YIT A;  4QT7 A;  4C92 A;  3MKD A;  1Q81 C;  2RJD A;  4C92 B;  3OBY A;  1S72 Q;  1UGQ B;  1IB8 A;  3NTK A;  1Q82 C;  5D7U A;  2QG9 B;  2KAF A;  3EG9 A;  1YJN T;  4HCC A;  1D1B A;  1E7O A;  2CP7 A;  4OMO A;  1ZX6 A;  1AHJ B;  5GMK m;  2VYT A;  3OBW A;  2EJF A;  3CC2 A;  4DEX A;  1NM7 A;  3OYN A;  4JLG A;  1N9R A;  2OTL Q;  3U23 A;  1VQM A;  2JTM A;  1GBQ A;  1WQ7 A;  1W2B A;  5GAN 8;  2RI5 A;  3INZ A;  1GFD A;  1SHF A;  3VU3 C;  2QQS A;  1AEY A;  3GLX A;  2EQJ A;  3CBO A;  2RHI A;  1IGU A;  3EG3 A;  1SKU B;  1TTH B;  3CMA T;  1XOV A;  3L2U A;  5IHI A;  1P92 A;  1TG0 A;  2DL5 A;  2DM1 A;  1NPR A;  1W2B S;  2KE9 A;  2COW A;  1RAG B;  4RTZ A;  2XI9 A;  1K73 U;  4KGV B;  3CC7 Q;  1K73 C;  4C5E A;  1Q86 C;  2JOY A;  4PFP A;  4M77 C;  4M75 F;  1RAA B;  5CKB A;  1PWT A;  2K5F A;  1KSW A;  4X9C A;  3CBM A;  2JM8 A;  1M2V A;  1YCY A;  3VUZ A;  3V8K A;  1YIJ A;  1G5V A;  4WCI A;  2LJ1 A;  4B9X A;  1Q7Y C;  3RES A;  2QGG A;  2DTO A;  2P0P A;  4GLM A;  2JM9 A;  4AG1 C;  2V1Q A;  3D7S B;  4EMK B;  2P4T A;  2HL3 A;  2C0T A;  5IHK A;  4J9C A;  1JEG A;  3UWN A;  2X4X A;  1YFN A;  2JW4 A;  1K0X A;  5M9O A;  4E7H A;  2QA4 A;  5HKC A;  2W10 A;  2QDY B;  1I4K 1;  4LDU A;  3M0U A;  4PKC C;  3E1S A;  4BY6 C;  1TWB A;  2DNU A;  1D1A A;  4J9G A;  4KGX B;  2PVG B;  3R6O A;  4DBR A;  1U8R A;  3CD6 Q;  2X51 A;  1BU1 A;  5IXF A;  1RI0 A;  3OQ5 A;  1JO8 A;  1NJI R;  2D6F A;  1VQ8 Q;  5A0D A;  3HHT B;  2DTH A;  2QGF B;  4FCY A;  2V26 A;  2AHJ B;  1UEB A;  3G71 Q;  1M1G A;  1K8A U;  3OSS C;  2DYB A;  1M2O A;  4RTU A;  2L3R A;  1WHL A;  3NGP A;  3ZBD A;  3E9G A;  3UAT A;  1M1K R;  1KQ1 A;  4M7D B;  1DJ7 B;  2LCS A;  4YTL A;  1U1T A;  4DQ2 A;  5FRN A;  1M8M A;  1N5Z A;  4N4I A;  1PHT A;  2K4Y A;  1O9S A;  2VXF A;  2YLC A;  5I22 A;  1OQK A;  4PJO D;  4PLI A;  1QQJ A;  2DZC A;  1Y96 B;  1WXB A;  1WHJ A;  3LWH A;  3LW5 E;  1FXX A;  4J83 A;  1AD5 A;  1UGV A;  2KDS A;  2FRW A;  3RMS A;  2R5M A;  1YIT Q;  1RAH B;  1V1C A;  3CCL Q;  3EH2 A;  4D8D A;  5A0L A;  1Q81 U;  2EQK A;  3MEW A;  1X6O A;  4LD9 K;  3J7A F;  2MK5 A;  4ELY C;  4BE0 A;  1D09 B;  2CT3 A;  3QJY A;  4FW1 A;  2QA4 Q;  2SEM A;  4EMG A;  3JCM W;  4CC2 A;  2BIV A;  4C92 C;  1K1Z A;  3QSU A;  1E6H A;  2EBP A;  4XTX A;  2RHX A;  2NUT A;  4J7F A;  3L42 A;  2A7Y A;  5LJ5 g;  1X2K A;  2FG0 A;  3A8G B;  2GQV A;  1B3Q A;  4PJO E;  1GCP A;  4OB2 B;  2A36 A;  4M7A A;  2MCN A;  3LGF A;  4IIM A;  1VQL A;  4DA4 A;  4HCK A;  3JB9 G;  5GAN 4;  5DLQ E;  2WSE E;  2EWN A;  1VQO T;  5FRO A;  2E64 A;  2WSF E;  4LD6 A;  2QI2 A;  2AKK A;  2ZZD A;  1MGQ A;  1X2Q A;  3HPW A;  1I81 A;  2FB7 A;  3TRE A;  2YWW A;  2C0I A;  5KYX B;  3BW1 A;  2RQW A;  2BZY A;  2EJG A;  2QXF A;  1FYN A;  1YI2 A;  2ZAE A;  2I2L A;  4L59 A;  3M55 A;  3VS0 A;  2J06 A;  4RTW A;  1RAF B;  1HJD A;  1LNX A;  1W70 A;  1NYG A;  1WYX A;  2QQB A;  3OYI A;  2LCC A;  1YJW T;  3QG1 A;  1MMD A;  3H0H A;  4RG2 A;  2DET A;  1NG2 A;  1PRL C;  3P8H A;  4F7U F;  1AWJ A;  1AWX A;  1BI0 A;  1WDX A;  3E19 A;  4A4E A;  2NYS A;  4BI3 A;  2DF6 A;  2KRS A;  3OYB A;  2MAM A;  2LQW A;  4LDY A;  3S3M A;  2DVE A;  2DE0 X;  4HVW A;  3E9F A;  1UGR B;  1VQN Q;  4E7K A;  1M1F A;  2FYK A;  3L2W A;  3V7R A;  3EGD B;  4J5Y A;  3OW2 A;  4FSS A;  4A4K A;  2DTI A;  2XU8 A;  4M75 E;  1S72 A;  4QVZ A;  3M9Q A;  4HT9 A;  3EG1 A;  2K79 A;  4BD3 A;  2ZPE B;  5FWC A;  1ABO A;  1BIA A;  1X75 C;  1PD1 A;  1N8R U;  4QQ6 A;  1TUD A;  1AWW A;  1QVP A;  2ENM A;  3O5Z A;  5GJW B;  5FU6 B;  2L89 A;  3V8L A;  1YIT T;  2XD0 A;  1W4S A;  3UT1 A;  4P5N A;  3RNJ A;  2X4J A;  4MZP A;  4HXJ A;  1IO6 A;  1YHQ A;  4ELZ C;  1Z9Z A;  1NJI U;  1WXT A;  5GAN 6;  5CK9 A;  2MI6 A;  3MCA B;  4J9F A;  3V7C A;  3OYA A;  2D0N A;  1R0B G;  5LJ3 j;  1HD3 A;  1AOJ A;  2EYZ A;  3FDR A;  3QDF A;  2FZG B;  2AT1 B;  1OX8 A;  3RKY A;  1QVG P;  1OI1 A;  2JS0 A;  5IAY A;  1Y96 A;  1SG5 A;  4CC4 B;  5D6X A;  2BTT A;  4M77 D;  4HVV A;  1VQK A;  5A0G A;  2DJZ A;  2CT4 A;  2FEI A;  1N8R R;  5GAO q;  1QVG A;  4LDX A;  3CCL T;  4M7A E;  2DA9 A;  1KD1 C;  4PJO B;  2DL4 A;  4QQG A;  3CCM Q;  5D6Y A;  1WGS A;  2Y4X A;  5LJ3 g;  1VQ4 Q;  5GAN 7;  1XNI A;  2F2W A;  2HSP A;  2CZ0 B;  1PCX A;  1N6A A;  3ZFJ A;  2GF7 A;  4M77 E;  1D0Y A;  4IUV A;  3IQL A;  3V8J A;  3CC2 Q;  2RHZ A;  2K9G A;  5LL6 S;  3OYM A;  2O4X A;  2B86 A;  4PFO A;  4LDV A;  4ZN3 A;  4OF1 A;  4D8K A;  3TCJ A;  4M7D F;  4FYW B;  2HKQ B;  4X9D A;  4QVD A;  1KJW A;  2F5T X;  1F1B B;  2FVU A;  4C5H A;  4GY5 A;  3G71 T;  4J9B A;  3REA B;  2E41 A;  3VYH B;  2GFA A;  5LJ3 d;  3A1P A;  3S6W A;  3JV3 A;  1UGS B;  2EGA A;  5HK3 A;  4E7J A;  4IUR A;  2K2M A;  1I0C A;  4RCC A;  4QKU A;  3CCM A;  1YJW A;  1UEC A;  2M0O A;  1K9M C;  1I5O B;  1RL2 A;  3RKX A;  1YN8 A; 
#chains in the Genus database with same CATH homology
 3SEM A;  3EHR A;  1JQQ A;  4Z8A A;  2DL8 A;  1VYT A;  2LJ0 A;  2L2P A;  3RBB B;  3EG0 A;  2MOX A;  2HCK A;  4DEX A;  1SPK A;  1NM7 A;  1T3L A;  1ABQ A;  3U23 A;  1GBQ A;  1WLP B;  1KFZ A;  3QWY A;  3REB B;  2XMF A;  1JXO A;  1GFD A;  1SHF A;  1M3A A;  1Y0M A;  3VS2 A;  2BZX A;  2M0Y A;  1AEY A;  2VVK A;  1ARK A;  2D1X A;  1GRI A;  1K4U S;  2J7I A;  2KRM A;  3EG3 A;  1UDL A;  1GFC A;  2A37 A;  1I07 A;  1XOV A;  2JT4 A;  2DIL A;  2GBQ A;  3EG2 A;  3I5S A;  3EGU A;  5IHI A;  4DEY A;  1TG0 A;  2GGR A;  2DL5 A;  2DM1 A;  1WFW A;  1NLO C;  2KE9 A;  4RTZ A;  1MV0 B;  4LUD A;  2SRC A;  2G6F X;  2IIM A;  1H8K A;  4F17 A;  2YT6 A;  2O9S A;  4LNP A;  4AFU C;  5IXB A;  1RLP C;  1GCQ A;  1WA7 A;  1PWT A;  1KSW A;  2KBT A;  1J3T A;  1PNJ A;  2DL3 A;  3KFV A;  1U5S A;  1UG1 A;  2RQU A;  4J9D A;  2JM8 A;  3NPF A;  3H41 A;  3ULR B;  2A08 A;  1QKX A;  1YWP A;  1ZSG A;  2AZV A;  2JMA A;  4CC7 A;  4WCI A;  2X3X D;  4LE9 A;  1UUE A;  1WX6 A;  2LJ1 A;  5IH2 A;  3NHN A;  3C0C A;  4GLM A;  2JM9 A;  4OML A;  2V1Q A;  4AG1 C;  5ECA A;  1VA7 A;  2O9V A;  4JZ3 A;  2OJ2 A;  2FO0 A;  2ROL A;  1QWF A;  2RNA A;  3I35 A;  1H3H A;  2C0T A;  1RI9 A;  5IHK A;  2RN8 A;  2CH4 W;  4J9C A;  4OMM A;  1JEG A;  3A98 A;  2J6K A;  2JW4 A;  2AZS A;  1K0X A;  2GQI A;  1M3B A;  1W6X A;  2I0N A;  2EYW A;  2W10 A;  1QWE A;  1VYU A;  3VRZ A;  3GBQ A;  3VS6 A;  1QCF A;  1TUC A;  1ZUY A;  3M0U A;  3LH5 A;  2DNU A;  4RTT A;  4J9G A;  1GL5 A;  2EKH A;  1QLY A;  4RTX A;  1T0H A;  3PVL A;  4F14 A;  1M27 C;  1BU1 A;  5IXF A;  2RPN A;  4LUE A;  2LZ6 B;  1JO8 A;  1WXU A;  1GBR A;  2RQR A;  3M0T A;  3CQT A;  1Y57 A;  2PTK A;  1PKS A;  3ZL7 C;  2F2X A;  1KIK A;  2BZ8 A;  2P4R A;  1G83 A;  2J05 A;  2V1R A;  2DYB A;  1K9A A;  3PVQ A;  4KRT A;  3M0R A;  4RTU A;  3NGP A;  4IIO A;  2CSI A;  3UAT A;  4J9I A;  2LCS A;  1M8M A;  1N5Z A;  1M3C A;  4GBQ A;  1PHT A;  2H8H A;  5I22 A;  3M0S A;  1CKB A;  3TVT A;  1CKA A;  1WXB A;  2PZ1 A;  3NMZ C;  2DMO A;  4JJD A;  1AD5 A;  1UGV A;  2KXC A;  1NEB A;  2FRW A;  2CDT A;  1UFF A;  4JJB A;  1V1C A;  1BK2 A;  2YUP A;  2AK5 A;  4D8D A;  1UE9 A;  2KXD A;  2ABL A;  4J9E A;  2LQN A;  1JU5 C;  2ED1 A;  2CT3 A;  2DX1 A;  2HEQ A;  2SEM A;  1X6G A;  2CH4 A;  4CC2 A;  1AZG B;  1T3S A;  2D8H A;  3R6N A;  1K1Z A;  4CC3 A;  1E6H A;  2EBP A;  2GTJ A;  1SRL A;  1X2K A;  1OPL A;  4M4Z A;  2FG0 A;  2RQT A;  1B3Q A;  1U06 A;  2EQI A;  4Z89 A;  2GNC A;  2MIO A;  2LJ3 A;  1GCP A;  1RUW A;  4JPB W;  2A36 A;  2MCN A;  2KYM A;  4IIM A;  2OI3 A;  4HCK A;  2LP5 A;  2NWM A;  3I5R A;  2K7A A;  4RTY A;  1UJY A;  1YP5 A;  1G2B A;  4AFZ C;  3VS5 A;  2KT8 A;  1JXM A;  2EYX A;  2L0A A;  5EC7 A;  4Z88 A;  4J9H A;  2CUB A;  3VS7 A;  2AKK A;  1X2Q A;  2M51 A;  1X43 A;  3VS3 A;  4ESR A;  1WI7 A;  3THK A;  2LNH B;  3M0P A;  2C0I A;  2E5K A;  3QWX X;  2YUQ A;  2RQW A;  1YWO A;  2BZY A;  4F16 A;  1K0S A;  1FYN A;  2GTO A;  1YCS B;  3VS0 A;  2J06 A;  4RTW A;  1LCK A;  1NLP C;  1HJD A;  1W70 A;  1NYG A;  1WYX A;  2K3B A;  2C0O A;  3H0H A;  2VKN A;  1NG2 A;  1RLQ C;  2DL7 A;  1PRL C;  1AWJ A;  1PRM C;  2RMO A;  4R0K A;  3UF4 A;  1AWX A;  1NYF A;  1WDX A;  4E6R A;  2JTE A;  2DF6 A;  3VRY A;  2KRS A;  3TSZ A;  1M30 A;  4JZ4 A;  1QKW A;  2LQW A;  1SRM A;  2KEA A;  1UJ0 A;  4OMN A;  3UA7 A;  2FRY A;  4JJC A;  1Z9Q A;  2DE0 X;  4HVW A;  1UHF A;  1MV3 A;  2CUD A;  2K6D A;  5I11 A;  3M0Q A;  1X69 A;  4FSS A;  2DLP A;  2EVR A;  2O31 A;  3PE0 A;  2LX7 A;  2KGT A;  1BBZ A;  1ZLM A;  2OAW A;  1UTI A;  3EG1 A;  1U3O A;  2JXB A;  2K79 A;  2EYY A;  2ED0 A;  2LMJ A;  5FWC A;  1SHG A;  1ABO A;  1SSH A;  1ZUU A;  1CSK A;  1EFN A;  3FJ5 A;  2EW3 A;  2JMC A;  2L3P A;  1AZE A;  1YNZ A;  1TUD A;  1AWW A;  2ENM A;  2VWF A;  3O5Z A;  5GJW B;  2QDL A;  2YUO A;  2D8J A;  2JS2 A;  5IHN A;  1FMK A;  2PNI A;  2CSQ A;  3VS1 A;  3H0I A;  3RNJ A;  1HSQ A;  4EIK A;  1ZBJ A;  2EGC A;  2X3W D;  4HXJ A;  1PKT A;  1MUZ A;  1IO6 A;  1Z9Z A;  4ZNX A;  1OPK A;  1WXT A;  2ESW A;  1OV3 A;  4J9F A;  4K11 A;  2D0N A;  1S1N A;  1OEB A;  2EGE A;  1HD3 A;  1AOJ A;  2AKL A;  1X27 A;  2EYZ A;  1SEM A;  4LN2 A;  1E6G A;  5FW9 A;  2ECZ A;  5GJV B;  1ZUK A;  2FPE A;  5FWB A;  3TSW A;  4AG2 C;  2DBM A;  2JS0 A;  2RQV A;  1H92 A;  1BB9 A;  4CC4 B;  2FPD A;  3SHW A;  1A0N B;  1GCQ C;  2KNB B;  2BTT A;  5HCK A;  2DRK A;  2HDA A;  4HVV A;  1T0J A;  2CT4 A;  2KRO A;  2FEI A;  5L23 A;  2J6O A;  1UHC A;  1B07 A;  2J6F A;  2L3Q A;  1W1F A;  2DJQ A;  2KRN A;  2DA9 A;  4AFS C;  1NEG A;  2DL4 A;  1AWO A;  4OMQ A;  3I9Q A;  2ROT A;  3UA6 A;  3H0F A;  2NUZ A;  2F2W A;  2HSP A;  1AVZ C;  1I1J A;  2HBW A;  2KR3 A;  2DVJ A;  4A63 B;  2A28 A;  4OMP A;  1VYV A;  3IQL A;  1WIE A;  2K9G A;  3VS4 A;  2YUN A;  2O88 A;  2B86 A;  2FPF A;  4D8K A;  4RUG A;  2L3S A;  1K76 A;  3EHQ A;  4ORZ A;  1KJW A;  4AFQ C;  2F2V A;  2EPD A;  4QT7 A;  2W0Z A;  4J9B A;  4RTV A;  3REA B;  4X1V A;  2O2O A;  2YDL A;  2YSQ A;  2DRM A;  4HVU A;  3JV3 A;  2KYB A;  2EGA A;  4Y92 A;  2RF0 A;  2K2M A;  2KT1 A;  1I0C A;  1X6B A;  1OOT A;  1UEC A;  2CRE A;  1E7O A;  2DBK A;  4OMO A;  1ZX6 A;  1YN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...