3URGA

The crystal structure of anabaena ccbp
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
126
structure length
123
Chain Sequence
MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Alr1010 protein
publication title Ellman's reagent in promoting crystallization and structure determination of Anabaena CcbP.
pubmed doi rcsb
source organism Nostoc
total genus 37
structure length 123
sequence length 126
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11535 Calci_bind_CcbP Calcium binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.530 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3urgA02
3URGA 2P0PA 2K2VA 2P0QA
chains in the Genus database with same CATH superfamily
1NPPA 1Y57A 2KAFA 3ZFJA 5HKCA 1JQQA 1WGSA 2HBWA 1E6HA 3SWNB 3DB4A 2RJFA 4M7DE 3DLMA 2FO0A 2ROTA 4HVVA 2O9VA 2O9SA 1YFNA 4DQ2A 1OQKA 2CP3A 1VUBA 1UGSB 4J9FA 1E7OA 1MGQA 2A36A 2OI3A 3H0IA 1NE8A 5LJ3d 5IT9E 3LH5A 4M7DB 3LW5E 1UGQB 2RQWA 3ER0A 1UGVA 1X27A 4M4ZA 1KIKA 3CD6Q 1S72A 4N0AA 4XAXB 1KJWA 5EG2A 4QVCA 1AWJA 3VYHB 3QYHB 2DZ9A 1H8KA 1SHFA 3PMIA 4C92F 2JS2A 1JBMA 4JS5A 2ZPHB 1M2OA 2HD0A 4JRQA 5I11A 4WTOB 4AFQC 3BDUA 4M7DG 4EMKB 1RAFB 3NMZC 2CUDA 2RQVA 3U23A 2PVGB 2HZYA 1K1ZA 3EG3A 1UHFA 5DLQE 2OJ2A 4LD9K 1W6XA 2FRYA 2EQKA 1N8RR 2HQXA 1UJYA 2DK3A 3SFMA 2D8JA 1WDXA 2J6OA 2CZ7B 2L5QA 1VYTA 3RERA 3L42A 4XTUA 2CZ1B 3HFOA 1WZOA 2HMAA 7AT1B 4A54A 3CMAA 3OYFA 1YI2Q 1MHNA 1PD1A 3I56T 2F2VA 1UUEA 4E2FB 2V8KA 2M1HA 3C12A 1OEBA 3OYIA 4V2SA 1FXXA 2F1LA 5HY6A 5GAOn 1YHQA 2AK5A 2K79A 3MEUA 3UA6A 3DB3A 5GAOq 1TG0A 3CC4A 4A53A 2PUKB 4D8DA 4F7UE 3VS3A 4O5VA 3NFCA 4M7AA 4X9DA 4ESRA 1N9RA 4PJOF 2O88A 4PLIA 1OZ2A 1NEGA 2AKKA 4JUVA 3M0QA 8ATCB 4C92D 2EYYA 3MEWA 3OYDA 4FYXB 3CCEA 3LLRA 1HYOA 3NTIA 4OVAA 2MYSA 3ZEHA 1VQ6A 2RI5A 1M5Q1 1MV0B 4M77C 1H3ZA 4Z88A 2KYBA 2QK0A 5LJ3e 2E41A 3CCUA 1M8VA 1IHVA 2ZPGB 2GQIA 5GAOr 4XU1A 5KH6A 1Q81C 4DOWA 2K9GA 3TVTA 3MP1A 4J9HA 2M02A 2FEIA 4OF1A 1D3BB 2GFAA 4C0GA 4PJNA 2XDDA 4AMCA 4C0FA 2JNGA 3TREA 2MIOA 4ZNXA 1Z9ZA 3QPHA 3RKWA 4BI3A 4HCCA 1QW1A 4PK4A 1VQOA 2JTEA 1WJSA 2W0ZA 4JZ3A 2VKNA 3CCVA 2XD0A 4M75D 1Z9QA 3CBOA 1EX4A 3QWXX 1D1BA 5IHKA 2DL8A 1QCFA 3E19A 1C0MA 3L1AA 1UTIA 1S1NA 2BE9B 1B07A 2RN8A 2OTJQ 3A1PA 4Z89A 1YJ9T 5LJ5d 2LNVA 2HAXA 3HKSA 5KYUA 2JS0A 1WHHA 2HQHA 2YLCA 4FL6A 5D6YA 3I5RA 2WSFE 4GBQA 1J3TA 3TEEA 1VQ8Q 2JXBA 3CCJQ 3O8VA 4OB1B 4LXCA 2XICA 4AFZC 3RUXA 3A8GB 2HKQB 4FYYB 2DD4A 1UDLA 1X6OA 1YIJQ 3G4SA 3CC2T 3I56Q 2RHZA 1K0XA 1NYGA 2OTLA 4PJLA 4C8QA 3T9NA 2QEXA 3A98A 3UATA 3WXMB 6AT1B 4J6XA 1QVPA 4LDUA 1OV3A 3C94A 2ENMA 1QP2A 4M78F 2VVKA 2RI2A 2YLBA 3QKJA 1IGUA 5GJVB 4BACA 5D6WA 3A5ZB 3M55A 2O31A 3JCMf 2P4TA 2QDYB 4PKCC 2KRSA 4OMNA 2E70A 3EFOB 4D6WA 2OAUA 5DM7R 1LVKA 4M7DD 5IN1A 5J26A 2XG8D 3KXTA 5LJ5f 2E6ZA 1BIBA 2PNIA 1JB0E 1KQSA 4FYWB 3X28B 4II1A 3G71Q 2JUFA 5CQYA 4MZTA 1TWBA 5CKHA 3CCQA 2PU9B 3ZBDA 1K0SA 1NLPC 3JCMW 2V8JA 2DXUA 2A3LA 2EIFA 1VQ4T 1IO6A 2EYXA 2KMTA 2ECZA 4QQ6A 2D8HA 1X2KA 2L3PA 2XDBA 1OPLA 2A37A 2GF7A 2WACA 1UFFA 3OYLA 4OMMA 4EIKA 4RTZA 4ANJA 2LJ1A 1YJWA 2YUPA 1Y96A 2P0KA 3C4SA 4OP0A 1KQSP 2RQTA 4OGCA 3ASKA 3SHWA 1N6AA 2RMOA 2LRQA 3QDFA 5LJ5e 5FROA 4GLKA 2JMCA 4ME7A 1VQ7Q 1BKBA 2CP2A 2DNUA 5GAMj 1MV3A 5I21A 4IIOA 5GAMf 4M75C 2A08A 1BB9A 2H3EB 5IH2A 2LX9A 3GLXA 4E7LA 2LCSA 5IAYA 2QQAA 3AHUA 2FB7A 2QTXA 3FJ5A 5KCHA 2KROA 5KYXA 2YUQA 1PC0A 1MNDA 4QVZA 3M5AA 2DVEA 3CCSQ 4LN2A 4PFZA 2G3RA 1VA7A 1VQPT 1VYVA 3CCLT 3CCRT 3GF5A 1BI3A 1X01A 1AWWA 4BD3A 4FYVB 4X9CA 4FIBA 4OMOA 3V7CA 3QWYA 4XTYA 1KC8C 2KXDA 3J81E 3VKIA 2P0PA 3CPWA 2GFUA 2LJ0A 1CSKA 1W2BA 5HK0A 1WQ7A 3P8HA 2JOYA 4E7ZA 1MMDA 2CT3A 3SWNC 2HEQA 2J6FA 3RMQA 3LGLA 5GAN6 1O75A 3G6EQ 1K9AA 3UF4A 1PRLC 4WCIA 2D1XA 4E7JA 4JZ4A 5GAOp 1SSHA 1GFDA 1I81A 2LQNA 1D1CA 2E1HA 3PT9A 4M7DC 3SB2A 2J06A 1KHIA 3VRYA 4XU0A 3CXCP 4MDXA 1VIFA 1AWOA 4IURA 5HCKA 4AG2C 5LL6S 1JXOA 1Q81U 2NUPB 3CPWP 2KXCA 1HK9A 3FLGA 4J7FA 2QA4Q 3EGUA 2F5TX 2KYMA 4KGXB 1T0HA 5KE3A 2SEMA 2FVUA 4F7UA 5CKDA 4C92E 2L3RA 1UGPB 2BTTA 1ZQ1A 4B6MA 2HKNA 4HA8A 2LDMA 3V8LA 1M1KC 1PHTA 1WXUA 3E9GA 2JTMA 4EMKC 3PMTA 4PFPA 3C95A 2JM8A 5GANj 1H3HA 5A0DA 3CD6T 4R55A 3LH0A 3OYEA 4HCKA 1ZSZA 1NYFA 4E7IA 2I2LA 5GMKm 1VQKQ 5C0MA 4C92B 3JCMh 3RDVA 1SSFA 2O4XB 3JCMP 3V7RA 5GAN5 5GMKl 3CPWS 4KUDK 3HRUA 4X34A 2B86A 3O5ZA 1K8AC 1WJQA 1NEBA 2YUNA 4QQDA 1W2BS 3EGXB 1SF9A 4BE0A 2ZAEA 2EKOA 4M75E 2WSEE 4A63B 3FB9A 2CP6A 2JW4A 3M9QA 4J9BA 5KYWA 4C92G 3P8BB 4JRPA 1FMKA 1M90U 5FW9A 1VQPQ 1N5ZA 2LT4A 1G2BA 4M75B 2RA2A 2W10A 5CO7A 1BCMA 1TTHB 1YI2T 1PKTA 2IVWA 1M2VB 3TQ7P 2EW3A 2JM9A 5IHNA 1BCOA 1IRXA 2A7YA 1YJ9A 3A8HB 5CR2A 3H6ZA 5J3BA 4B9XA 1U8RA 3CMEQ 5GAN2 4HXJA 3VS7A 4M7AF 2RO0A 4C5HA 3EAEA 3PIPA 4L59A 1GL5A 5GAMh 2BE7D 3A8MB 2QASA 3JB9J 2RI3A 3QDRB 1LNXA 2MF2A 4JJNK 3CC2A 3OBWA 2E65A 2ZZDA 2PQWA 1Q81R 4HT8A 2KNBB 4E7HA 2VB6A 4XTWA 1K73U 4LD6A 2YDLA 2R58A 2XU8A 5CVIA 1GRIA 2VXFA 1VQNQ 1UG1A 1WXTA 2ROLA 2LX7A 2PUOB 1X75C 5FU6B 3I9QA 2DVJA 1TS9A 1YWOA 3QG1A 1AZGB 5AT1B 2FYKA 3UWNA 4O6JA 1YITT 1Q82U 2FL7A 3JB9D 3QSUA 3I5SA 3JB9H 1JJ2A 2YT6A 4UC4A 1G8XA 2LQKA 2QI2A 3NPFA 3LYIA 1JRIA 2QAZA 1QKXA 4LE9A 3M57A 3G1JA 1VQ4A 1AD5A 1LPLA 3PFSA 2OTJT 1DJ7B 3META 3SEMA 4M77A 2Z0WA 3QXEB 2FRWA 4J5YA 2E5KA 1BK2A 1M90R 1NLOC 1QQJA 1VQ8T 2QQSA 4NL2A 4KGZB 3EHRA 2K7AA 2YRDA 4YTLA 1WYXA 3CCJT 4LDYA 3BFMA 1F1BB 1O9SA 2DXBA 1BBZA 1KC8U 5GANg 1ZUUA 1YIJT 1JJ2P 4C8QF 1G5VA 2E3IA 2LTOA 1D1AA 3EG9A 4M78B 3J7AF 1G83A 3CCMQ 1ZA2B 4MMLA 2VV5A 2HL3A 1M27C 2LC4A 4J8OA 3DLLA 2J7IA 2K4YA 2ZCFB 2CKKA 4GLMA 1LCKA 1TUGB 2AZSA 2DL7A 2FZKB 2DMOA 3M53A 4X1VA 1YCSB 1GXIE 3FIFA 4C0DB 3G71T 1JJ2S 2HCKA 4M78G 2D0QB 2CZ0B 1YP5A 1K73R 3CCRA 3CCLA 5GAN3 1PRMC 4ZGJB 1YJNA 2DEQA 2R57A 2J6KA 3KBGA 2F2XA 3TSZA 2D9TA 2Y4YA 1PNJA 4HCZA 1WHLA 4HKEA 4J9IA 4XTVA 4BY6C 1TH7A 1WPYA 2L8DA 1M1KU 2O01E 3UT1A 4Y91A 3BDLA 1QP3A 1YNZA 1FWZA 1Q82R 2EWNA 3L2RA 1UB4A 1YITQ 4PLLA 4ZTJA 5L8RE 2DLPA 1OYXA 1KQ2A 2NUPA 2RF0A 4XTXA 1IGQA 2CH4A 3BY7A 3OYHA 1M9SA 3OYJA 3JCMd 1RAEB 1K8AU 4KT0E 1KG1A 4RTYA 4B9WA 2LQWA 2V1QA 1D0ZA 2MWOA 3HP9A 1KD1C 3JCMb 5FRMA 4WF2A 2DJZA 2MPXC 3MPUB 1VQ5T 1XTDA 1OU8A 1SEMA 3P8DA 2JJ9A 1VQ7T 1EZZB 2KT1A 4RCBA 5A0GA 1LJOA 2DX1A 1T3LA 4QW2A 2ED1A 4IUTA 4HT9A 1SRMA 2L3SA 2FZCB 2C06A 1XOVA 4A4EA 4ZGDB 3GOXA 4AT1B 2YRVA 3I55Q 5L23A 2QG9B 3OSVA 1KC8R 4FCYA 2FHDA 2MOXA 4JLIA 4PJOD 2XHCA 1K76A 3EG2A 1I5LA 3EG1A 3EGXA 3CD6A 1Q95G 3CCST 1UGRB 1Y71A 1VQ9Q 2QGGA 1YBYA 2DETA 2NUTB 4HCBA 2YXYA 1M90C 4P5NA 1GCQC 3MO8A 1IZ6A 2RHYA 1ZHIA 1ZBJA 4JS4A 4CC7A 3JCMQ 1WHJA 2M9UA 4Y28E 1WHMA 4PJMA 4M75A 2DEUA 3L2ZA 1VIEA 4JDSA 3JB9I 5GMKj 2E64A 1BYMA 2DZCA 1K9MR 2NWMA 3G6ET 2KQWA 5GAN4 1RADB 1M4ZA 2L3QA 1JXMA 3FJPA 2ED0A 2XI9A 2PVDB 4RTXA 5GAMd 4OGEA 4NL3A 1ZLMA 2ESWA 1M30A 1C6VX 3M0PA 2CSQA 3JV3A 1B34A 2B8AA 5GAN8 2CP0A 1IREB 2HNIA 2E10A 1YI2A 1S72T 1UEBA 2NLUA 3PNWC 4RG2A 5AYFA 1HD3A 1M1KR 4N4HA 1I07A 3L2QA 1G3YA 3JCMc 2FG0A 5KYYA 2OAWA 2QA4T 4C92C 3ULRB 4FW2A 5GMKi 1K73C 2MMPA 4F7UF 4CC2A 5C6SA 3SDZA 2DBKA 3SWNA 8AT1B 4OMQA 3M0UA 5LJ3g 1H641 2ZPBB 3QO3A 1QVGA 2IPOB 2V8IA 3ZL7C 5KCOA 4BE1A 3VS6A 3JCMe 2ZPFB 1K8AR 4CC4B 4CC3A 4BY6B 3OW2A 1VQKT 3THKA 1PG5B 4HVWA 3VUZA 1Q82C 4C0ZA 2EQMA 3JCMJ 4M7DA 3EGDB 1VQ5Q 1XQHA 1WI7A 5D6XA 3M0TA 2GBQA 2Y4XA 2KT8A 4M78D 4BDYA 2KI7A 3VS1A 4A4HA 3OMGA 1KSWA 3M4GA 1Y07A 2BZXA 3HTRA 1VQMQ 1MNEA 1WJRA 2RJCA 4XU2A 4F04B 1XJWB 3M58A 3VV0A 3QUIA 2BZYA 2MCNA 4EMKA 1NJIR 4BI4A 3AT1B 1R0BG 2X4WA 2KY9A 3CC4T 3OMCA 1TXQA 2DRKA 3CC7Q 4DBRA 4BUGA 2DIGA 1HXDA 2DD5A 4E7KA 1D09B 1OX8A 1KQ1A 4LDWA 2JT4A 4PJOC 4BB7A 2DYBA 2Y90A 4CI0C 1KK7A 1FMVA 1VYUA 5KE2A 2OTJA 2VYTA 3OA6A 3VYGA 2E5QA 3A8LB 2GQVA 1NPRA 3JB9G 3G7ZA 4KH0B 1IXDA 3OS1A 4JLGA 1SHGA 1YWPA 3CMET 1A0NB 5GAMe 3VS2A 2K3YA 1QVGS 1VQ8A 4FSXA 4KGVB 3CCJA 3PVQA 1NZ9A 2LP5A 3SD4A 4AFSC 5CAIA 5FRNA 3OW2S 3H8ZA 4KUIA 1QMCA 3M56A 5FU6C 4L6V5 1YIJA 1ZSGA 1S72Q 3OB9A 1K9MC 3I56A 1N9SA 3CQTA 1JO8A 1Y0MA 1AWXA 1B3QA 2RH2A 4PNOA 3CCVT 4ZN3A 2XDPA 1EFNA 2VGMA 1CKAA 2EJ9A 2XKOC 2L0AA 3S3NA 5A0LA 1W2BP 1V1CA 4RTTA 3QZ5B 1VQNT 1TSFA 3MP6A 3NHNA 1YCYA 1SPKA 1V76A 4CRIA 4XK8E 5I2MA 2DJQA 2CP7A 2EYZA 9ATCB 1AT1B 5GANf 2DFUA 3CBPA 1KD1U 5CCAA 4RKUE 4C5IA 3G71A 3M54A 2LQ8A 4KBMB 2RHIA 1UE9A 2RK1A 3PIOA 4JJCA 1QWEA 2MWPA 4NOYA 1D3BA 1AOJA 5GMKh 3VU3C 1X6BA 2X3WD 4LUEA 3CMAQ 2YHTA 3OYCA 5KYUB 3G4ST 2ZPEB 2R5AA 4M77F 1E6GA 2KSSA 2FPEA 4N4IA 2DKGA 2QEXT 3JCMV 3KFVA 3FRNA 1OI1A 4RTVA 3UDCA 2HQEA 4M78C 1YHQQ 2O2OA 1VOMA 2DO3A 4RCCA 2JTFA 3CC4Q 2EYWA 2DL5A 1TUDA 4LUDA 2P84A 4C8QB 2FPFA 2M16A 3V7SA 1R77A 5HK3A 5GAOm 5GANe 1JU5C 4EMGA 2HSPA 4C0DC 1NJIC 3TSWA 2K5IA 4PJOE 1VQ7A 3CCMT 3CCEQ 2A28A 4PJJA 2RQUA 3L2VA 2RHXA 2DE0X 1VQ6Q 4EMHA 2VXEA 4J6WA 2EKHA 2DXTA 2DTOA 1GCPA 2JMAA 1QKWA 3L2UA 2DTHA 2XIDA 4C8QG 3CCUQ 1VQLT 2MAMA 4PJOB 1UECA 3OYGA 1RLPC 2GTOA 1EIFA 1K4US 1ZA1B 4MMKA 1QVFA 1YJWT 3CCSA 3OYYA 3EFOA 2DTIA 3TCJA 3M59A 1VQOQ 3OSSC 3CCVQ 2GGRA 1X6GA 4ZN1A 1AZEA 3PTAA 3V8KA 3CPFA 1Q86U 4M77D 2CZ6B 2F5KA 4PJOG 2CDTA 2AT1B 2KBTA 4J7IA 4K11A 3X25B 2K2VA 5CKFA 3GBQA 1Y96B 1RL2A 1KD1R 3G6EA 2EGCA 3M0SA 2CH4W 2HSEB 2RQRA 2C0TA 1SG5A 2QXFA 1QVFP 2EGAA 5IXBA 4C5EA 2K5LA 3L2WA 4IUQA 3G4SQ 4OB2B 2C0IA 1OPKA 2OTLQ 1ZBXA 2EQUA 2QEXQ 5A2QE 4AFUC 2GTJA 2IG0A 3E1SA 2QA4A 2DILA 2KE9A 5KYXB 2DBMA 2HBPA 4DBQA 3CEYA 3EGDA 3F70A 4M7AD 3OQ5A 1RAAB 3I55T 4M78E 1Q7YC 1ARKA 2JN0A 4J9EA 3GIBA 1RI0A 1I1JA 2EJFA 1H92A 1RACB 1W70A 1PCXA 1QVFS 2RNAA 1MMNA 1KHCA 1W1FA 4DBHA 1VQ9T 4E6RA 1MUZA 1VQKA 2CYZB 2AKLA 1BI1A 3H41A 3CCQQ 2COZA 3E2UA 4VUBA 3RIRA 3M4YA 3QJ6A 2BZ8A 3OYBA 5GJWB 2KRMA 5GAN7 4M75F 5GANh 2P4RA 4HVUA 2LMJA 2J05A 3QIIA 4E7SA 3HPWA 5LJ3j 5LJ3f 1WLPB 3VRZA 4JJDA 3OBYA 1TUCA 1TOVA 2F69A 1VQLQ 5CKBA 5FU7C 5CKEA 2E6NA 3VJPA 4Y92A 3MKDA 3OS5A 3TU4K 5FLXE 1K9MU 1PSFA 1RI9A 2EVRA 4MDWA 2VGNA 3QYGB 1WX6A 1YJWQ 2EQIA 1VQPA 4Q5WA 1I5OB 1U1TA 2HDAA 1Q86R 2X3XD 2M51A 1RAHB 3ME9A 4J9DA 4A4KA 2FZGB 4N0AC 1GCQA 1TU0B 2RJEA 4F16A 3MP8A 1R8OB 3R6OA 2DERA 2RPNA 1R0CB 1M1FA 3NGPA 3H0FA 4PL6A 4F17A 4MZMA 1X43A 4DBFA 4F7UB 3LX7A 4QVDA 1G3TA 2KEAA 1X69A 4ELZC 2KVQG 3EH2A 1BI2A 3JAME 2DF6A 3CMEA 1U06A 4OB3B 1BU1A 1I0CA 1QWFA 3MHXA 2OX7A 1ZSZB 3H0HA 3RNJA 2DIQA 3URGA 4M7DF 4C8QD 1U5SA 4DEXA 1I4K1 4IUPA 5I22A 1W4SA 2FPDA 4F7UG 2E4HA 4L5GA 2BUDA 2ZPIB 1CKBA 2A0FB 1OZ3A 2RM4A 3D7SB 3GPLA 3DKMA 4C92A 2P0QA 3PGGA 2I0NA 2O4XA 5EC7A 5KYWB 1AHJB 1VQNA 2DA9A 1VQMT 3S3MA 4LDXA 3EG0A 2EBPA 2LT1A 5CIUA 4BI8B 2EYQA 1SKUB 2COWA 3REAB 2XMFA 1JEGA 2K57A 1YN8A 4QKUA 2EPDA 1NJIU 1WFWA 2YWWA 4C5GA 4M7AC 4KRTA 3CC7T 3RKXA 3HL8A 2QYZA 3VS5A 2LZ6B 3CBMA 1M8MA 2EQJA 4KULA 4XQ3A 1ACMB 3EH1A 1N8RC 4RTUA 2MK5A 4FM4B 2K6DA 1M2VA 2G6FX 3I35A 2VUBA 4AG1C 4FU6A 2V1RA 1RABB 4J9GA 3QBYA 2BIVA 3PE0A 1M1GA 2H8HA 2GNCA 2X51A 2SRCA 2KRNA 3FC3A 1IHWA 2YSQA 4R56A 3M0RA 5IHIA 1PD0A 4IUVA 2YRCA 5LJ5j 1HJDA 2VWFA 2PZ1A 5FU7B 1P92A 2CUBA 4PJOA 3S3OA 3OS2A 1WHGA 1PWTA 4FW1A 4FT4A 5IXFA 3CCMA 2LCLA 1AVZC 1Q86C 2L2PA 4OMFB 2LCCA 4A4FA 3OYAA 3GNGA 4JJBA 4RMOA 2CS7A 2F2WA 1VQLA 3HRTA 4LDVA 4M77E 5D7UA 2COYA 5GMKe 2K3BA 3MEAA 3RMSA 5LJ3h 1GBRA 5J39A 1B7TA 2LNHB 2XK0A 3X20B 1N27A 5DY9A 3CMAT 4M77B 3BW1A 2KK4A 2KGTA 3PVLA 3RBBB 1X2QA 2NUZA 2H3JA 4C8QC 3QZ9B 2CP5A 2CREA 2QQBA 1Q7YU 1YJ9Q 2QTVA 4RUGA 3REBB 1MMGA 2CGHA 2X4JA 4DEYA 1BI0A 4PFOA 3OYNA 1YHQT 2QGFB 1M3AA 1QVGP 3H9NA 1NG2A 1GFCA 2DYIA 2AHJB 1YITA 2X9HA 2AZVA 2QQRA 3MJXA 3NTKA 4M77G 2DRMA 3OW2P 4JRKA 4ZTFA 2DXCA 2KDSA 1KQSS 1ZUYA 3EG9B 1BIAA 4M7AE 1T0JA 2RHUA 2AIRB 4Z02A 1WQWA 2PTKA 4E47A 3CC2Q 1ABQA 2EGEA 5GANd 2RK2A 4QQGA 3OYMA 1YJNT 4JPBW 1RAIB 1D0XA 3CCET 3CXCA 1PKSA 2DL3A 4JRIA 1WNLA 1WA7A 4IUUA 1VQ6T 4BDZA 4OMPA 4M7AB 3UA7A 5FWCA 5CQXA 1V29B 4EDUA 3C0CA 1I8FA 4M78A 1PM3A 5FWBA 3CCUT 1ZX6A 3I55A 1FX7A 1IB8A 5M9OA 3J80E 1QCNA 1NBEB 3LWHA 4OMLA 1FYNA 4FT2A 4EPCA 3A8OB 5KYNA 4FSSA 4IIMA 3S6WA 3EFRA 1MMAA 2C0OA 3HRSA 4NS5A 3V8JA 1LOJA 1OOTA 1VQ9A 1WHKA 1SRLA 1VQOT 2GCXA 3KUFA 4M7AG 4ELYC 2JZ2A 4GY5A 2K2MA 2EAYA 2IIMA 2KR3A 2VC8A 3RKYA 3JCMX 4N4GA 2R5MA 1VQ4Q 2DM1A 1GBQA 1WXBA 2WSCE 3QJYA 2ZGWA 2DL4A 4TVRA 3WVEB 3Q1JA 2RJDA 2LVMA 3FDRA 1PSEA 1QCOA 3OYKA 1RAGB 1G3SA 1D0YA 4DA4A 3JCMg 2NYSA 4IKFA 4RTWA 2HL5C 2X4XA 3LWIA 1M3CA 2ABLA 4RG8A 2EJGA 3UPUA 4ZGEB 2D6FA 5LJ5g 2LJ3A 1Q7YR 3INZA 4OB0B 4XU3A 3JSCA 1C1AA 3VS4A 2DAQA 2OTLT 1OX9A 3EFSA 3GP8A 1RUWA 3CXCS 2M0YA 2V26A 4F14A 2CSIA 4D8KA 2M0OA 3X24B 4C8QE 1ABOA 1XNIA 1KFZA 1UHCA 1Y7XA 2CT4A 3GNFB 3OY9A 5LJ5h 3E9FA 1HSQA 2E3HA 2YUOA 3N5BB 2BKDN 2DPPB 4QT7A 4A4GA 4BE2A 3HSBA 3MEVA 3OS0A 2K5FA 5ECAA 3R6NA 3JRZA 4KH1B 4J9CA 4R0KA 2QDLA 1T3SA 3CCQT 1VQ5A 3HFNA 1N8RU 3HHTB 4LNPA 3JB9F 4DOVA 1RLQC 5GAOl 3CCLQ 3CCRQ 1YJNQ 2MI6A 1NM7A 2RD1A 1UJ0A 1U3OA 5I2SA 4MZPA 4XTZA 1G3WA 2NUTA 2X4YA 2QQ9A 3IQLA 3X26B 1OU9A 3VUBA 2K3XA 2L89A 4ATOA 3EHQA 2EFIA 1VQMA 3MCAB 1U1SA 1M3BA 2ATCB 3QHSA 1ZUKA 4J6YA 5GAMg 4Z8AA 1FMWA 3NTHA 1B34B 3RESA 4ORZA 2PVOB 4M75G 2JVVA 2D0NA 3BE3A 1QLYA 1AEYA 2VASA 3FEOA 3CC7A 3LGFA 3WVDB 2E12A 2X35A 1OULA 3VS0A 5DLOA 5CK9A 5KYYB 1ZSZC 1WIEA 2RB6A 4J83A 3RR6A
chains in the Genus database with same CATH topology
1NPPA 1R8OB 2KAFA 3R6OA 5AYFA 4XU0A 4MDXA 1VIFA 1M1FA 4IURA 3ZFJA 4N4HA 5HKCA 4PL6A 1WGSA 3L2QA 1G3YA 3SWNB 3JCMc 4MZMA 5LL6S 3DB4A 2RJFA 4F7UB 4M7DE 1Q81U 3DLMA 3LX7A 4QVDA 4C92C 2QA4T 1G3TA 1HK9A 5GMKi 3FLGA 4J7FA 1K73C 2MMPA 4ELZC 4F7UF 2KVQG 2F5TX 1BI2A 4DQ2A 5C6SA 3SDZA 3JAME 3CMEA 4OB3B 3SWNA 5KE3A 5LJ3g 1VUBA 2FVUA 4F7UA 5CKDA 4C92E 1H641 2ZPBB 1UGSB 3MHXA 2L3RA 1MGQA 1UGPB 3QO3A 1QVGA 1ZQ1A 2V8IA 4HA8A 5KCOA 4BE1A 2LDMA 1NE8A 3V8LA 3JCMe 1M1KC 2ZPFB 5LJ3d 5IT9E 3E9GA 2JTMA 4EMKC 4M7DB 3PMTA 3C95A 3LW5E 1UGQB 3ER0A 5GANj 2DIQA 3URGA 4BY6B 5A0DA 4M7DF 4C8QD 3CD6T 4R55A 3OW2A 3LH0A 1S72A 4N0AA 4XAXB 3OYEA 1VQKT 1I4K1 4IUPA 3VUZA 5EG2A 1W4SA 4F7UG 4QVCA 4C0ZA 2I2LA 2EQMA 3VYHB 5GMKm 4E7IA 3JCMJ 4M7DA 5C0MA 4C92B 3JCMh 3QYHB 1SSFA 2DZ9A 2O4XB 4L5GA 1XQHA 5D6XA 2BUDA 3PMIA 3JCMP 2ZPIB 4C92F 1OZ3A 2Y4XA 4M78D 3V7RA 4BDYA 2RM4A 5GMKl 1JBMA 5GAN5 3CPWS 4JS5A 4KUDK 3HRUA 2ZPHB 3GPLA 2HD0A 3DKMA 4X34A 4A4HA 4C92A 3OMGA 2P0QA 1K8AC 3PGGA 4JRQA 1WJQA 2O4XA 3M4GA 1Y07A 1AHJB 1W2BS 4QQDA 1VQNA 3BDUA 4M7DG 4EMKB 1VQMT 3S3MA 4BE0A 4LDXA 2EKOA 4M75E 2LT1A 2PVGB 2WSEE 5CIUA 3FB9A 3M9QA 4BI8B 1WJRA 2EYQA 2RJCA 5DLQE 4XU2A 4LD9K 3M58A 2EQKA 3VV0A 3QUIA 4EMKA 2K57A 4C92G 3P8BB 2HQXA 4JRPA 2DK3A 4BI4A 2X4WA 3SFMA 1NJIU 2KY9A 3CC4T 4C5GA 1M90U 4M7AC 3OMCA 3CC7T 2LT4A 3RKXA 2CZ7B 4M75B 2L5QA 3RERA 2RA2A 4BUGA 3L42A 2DIGA 1HXDA 2DD5A 3HL8A 5CO7A 4E7KA 4XTUA 2CZ1B 3HFOA 1KQ1A 4A54A 3CMAA 4LDWA 3OYFA 1YI2T 4PJOC 4BB7A 1MHNA 3CBMA 2IVWA 2Y90A 4CI0C 3I56T 5KE2A 2EQJA 2OTJA 2VYTA 4KULA 4XQ3A 2V8KA 2A7YA 2M1HA 1YJ9A 3C12A 3VYGA 2E5QA 3A8HB 3A8LB 3OYIA 3OA6A 1N8RC 5CR2A 3H6ZA 4FM4B 5J3BA 2GQVA 4V2SA 1NPRA 3JB9G 3G7ZA 1FXXA 5HY6A 3OS1A 4B9XA 4JLGA 5GAOn 1U8RA 1YHQA 3CMET 2VUBA 3MEUA 4FU6A 5GAMe 5GAN2 2K3YA 1QVGS 3QBYA 2BIVA 3DB3A 1M1GA 1VQ8A 5GAOq 4M7AF 2RO0A 4FSXA 4A53A 2PUKB 3CC4A 4F7UE 4C5HA 3EAEA 3FC3A 3CCJA 4O5VA 4R56A 1NZ9A 3SD4A 3NFCA 4L59A 3PIPA 5CAIA 5FRNA 4M7AA 4IUVA 3OW2S 4X9DA 5LJ5j 1N9RA 3H8ZA 4KUIA 5FU6C 3A8MB 3M56A 4PJOF 5GAMh 3JB9J 2RI3A 3QDRB 4L6V5 4PLIA 1YIJA 1LNXA 2MF2A 3OB9A 4JJNK 1OZ2A 3I56A 1K9MC 5FU7B 1P92A 1N9SA 3OBWA 4JUVA 2E65A 2ZZDA 3CC2A 2PQWA 4PJOA 2RH2A 4PNOA 4HT8A 3S3OA 3OS2A 4E7HA 3CCVT 4C92D 4ZN3A 4FT4A 2XDPA 3MEWA 2VGMA 4XTWA 3CCMA 3OYDA 1K73U 2LCLA 4LD6A 3CCEA 2EJ9A 3LLRA 3NTIA 2R58A 2XKOC 4OVAA 2XU8A 3ZEHA 3S3NA 5A0LA 1Q86C 1VQ6A 5CVIA 2RI5A 4OMFB 1M5Q1 3QZ5B 1VQNT 3MP6A 4M77C 2VXFA 1H3ZA 2LCCA 4A4FA 3OYAA 3GNGA 5LJ3e 2E41A 4RMOA 2PUOB 2CS7A 3CCUA 1M8VA 1YCYA 4CRIA 4XK8E 2ZPGB 5I2MA 1X75C 5FU6B 1VQLA 5GAOr 3HRTA 4XU1A 5KH6A 4LDVA 1Q81C 4DOWA 3QG1A 4M77E 3MP1A 5GANf 5GMKe 2FYKA 4OF1A 3UWNA 1D3BB 2GFAA 3CBPA 3MEAA 4O6JA 4C0GA 1YITT 1KD1U 3RMSA 5CCAA 4RKUE 4C5IA 2XDDA 3M54A 2LQ8A 2FL7A 2JNGA 5LJ3h 4KBMB 3TREA 4C0FA 3G71A 3JB9D 2RHIA 3QSUA 3RKWA 3QPHA 4BI3A 4HCCA 3JB9H 1QW1A 1JJ2A 2RK1A 3PIOA 5J39A 4UC4A 1VQOA 2LQKA 2MWPA 4NOYA 1WJSA 2QI2A 3J81E 3CCVA 2XK0A 1D3BA 3X20B 2XD0A 3LYIA 4M75D 5GMKh 3VU3C 1N27A 5DY9A 3CMAT 1JRIA 3CBOA 4M77B 3BW1A 2KK4A 2YHTA 3M57A 3OYCA 3G4ST 2ZPEB 1VQ4A 2R5AA 3E19A 2H3JA 3PFSA 4M77F 4C8QC 3L1AA 2KSSA 3QZ9B 2OTJT 2QQBA 4N4IA 1YJ9T 1Q7YU 1DJ7B 3META 5LJ5d 2DKGA 2QEXT 3JCMV 1Q82U 2LNVA 4M77A 2HAXA 2CGHA 3HKSA 3FRNA 1OI1A 2X4JA 3QXEB 2YLCA 4FL6A 4J5YA 1BI0A 3OYNA 3UDCA 1YHQT 5D6YA 2HQEA 4M78C 2WSFE 2DO3A 2AHJB 1YITA 3TEEA 1VQ8T 2QQSA 4NL2A 4YTLA 4RCCA 2JTFA 2QQRA 3CCJT 4LDYA 3BFMA 3NTKA 3O8VA 4M77G 4OB1B 2XICA 1O9SA 1KHIA 4JRKA 4ZTFA 3RUXA 3A8GB 2DXBA 2DXCA 2KDSA 1KC8U 1KQSS 4C8QB 2DD4A 5GANg 1BIAA 1X6OA 4M7AE 2M16A 1YIJT 3V7SA 5HK3A 2RHUA 5GAOm 3G4SA 4C8QF 5GANe 3CC2T 4Z02A 1WQWA 2RHZA 4E47A 1G5VA 5GANd 2LTOA 4EMGA 2OTLA 4C0DC 1NJIC 2RK2A 4QQGA 4C8QA 2K5IA 3T9NA 2QEXA 4PJOE 4M78B 3WXMB 3OYMA 4J6XA 1QVPA 3CCMT 4LDUA 1YJNT 1VQ7A 3CCET 3J7AF 3C94A 3CXCA 4JRIA 1WNLA 4MMLA 1QP2A 4M78F 4IUUA 2VV5A 2RHXA 3L2VA 1VQ6T 4BDZA 2RI2A 2YLBA 4M7AB 3QKJA 2LC4A 5CQXA 1V29B 5D6WA 4J8OA 4EMHA 3DLLA 4EDUA 4BACA 2VXEA 3A5ZB 4J6WA 3M55A 1I8FA 4M78A 3JCMf 3CCUT 2K4YA 2DXTA 2ZCFB 2DTOA 3I55A 1FX7A 2CKKA 2P4TA 3L2UA 2DTHA 2XIDA 2QDYB 4C8QG 4PKCC 3J80E 5M9OA 2MAMA 1VQLT 2E70A 4PJOB 4D6WA 2OAUA 3OYGA 3M53A 5DM7R 3LWHA 4M7DD 5IN1A 5J26A 4EPCA 2XG8D 4FT2A 3A8OB 3KXTA 1EIFA 2E6ZA 5LJ5f 1BIBA 3S6WA 1JB0E 3EFRA 4MMKA 3FIFA 4C0DB 1KQSA 3G71T 1GXIE 3HRSA 1JJ2S 4NS5A 3V8JA 3X28B 1LOJA 4II1A 1YJWT 3CCSA 1QVFA 4M78G 3OYYA 2JUFA 2D0QB 5CQYA 1VQ9A 2CZ0B 4MZTA 2DTIA 3TCJA 5CKHA 3CCQA 1VQOT 3M59A 2GCXA 2PU9B 3CCRA 5GAN3 3OSSC 3CCLA 3KUFA 3ZBDA 4ZGJB 1YJNA 4M7AG 4ZN1A 4ELYC 2DEQA 2JZ2A 2R57A 4GY5A 2EAYA 3PTAA 2V8JA 3JCMW 3KBGA 2DXUA 3V8KA 2VC8A 3CPFA 2D9TA 2A3LA 2Y4YA 3RKYA 2EIFA 3JCMX 1Q86U 4N4GA 1VQ4T 4HCZA 2R5MA 4M77D 4HKEA 2CZ6B 2F5KA 4XTVA 4PJOG 2WSCE 3QJYA 2ZGWA 4BY6C 2KMTA 1TH7A 1WPYA 4TVRA 3WVEB 4QQ6A 3Q1JA 2L8DA 4J7IA 3X25B 2K2VA 2O01E 1M1KU 3UT1A 5CKFA 4Y91A 2RJDA 3BDLA 1QP3A 2XDBA 1Y96B 1FWZA 1RL2A 2GF7A 2LVMA 2WACA 3OYLA 2EWNA 3G6EA 3L2RA 3FDRA 1PSEA 1UB4A 3OYKA 1G3SA 4PLLA 4ZTJA 5L8RE 1YJWA 1OYXA 1KQ2A 1Y96A 4DA4A 2P0KA 3C4SA 4OP0A 4XTXA 3JCMg 4IKFA 2X4XA 3BY7A 3LWIA 2QXFA 3OYHA 3JB9F 4RG8A 1M9SA 3OYJA 3JCMd 4OGCA 3ASKA 2EJGA 3UPUA 4ZGEB 1K8AU 2D6FA 4KT0E 5LJ5g 1KG1A 1N6AA 2K5LA 4B9WA 4C5EA 3L2WA 2LRQA 3INZA 4IUQA 2MWOA 4OB0B 4XU3A 3JSCA 3HP9A 4OB2B 5FROA 5LJ5e 2DAQA 3JCMb 4GLKA 1KD1C 5FRMA 2OTLT 4WF2A 2DJZA 3EFSA 3GP8A 1VQ5T 1XTDA 3P8DA 3CXCS 1ZBXA 2EQUA 1Q82C 1VQ7T 5A2QE 4ME7A 2IG0A 2M0OA 3X24B 1BKBA 4C8QE 4RCBA 3E1SA 1XNIA 2QA4A 5GAMj 5A0GA 1LJOA 5I21A 1Y7XA 5GAMf 2HBPA 4M75C 3GNFB 3CEYA 4IUTA 4QW2A 3OY9A 5LJ5h 3E9FA 4HT9A 2LX9A 3GLXA 4HCBA 3N5BB 4E7LA 3F70A 5IAYA 2QQAA 2C06A 3AHUA 4M7AD 1XOVA 3OQ5A 2BKDN 2DPPB 4A4EA 2FB7A 2QTXA 4A4GA 4ZGDB 3I55T 3GOXA 5KCHA 2YRVA 4BE2A 3MEVA 3HSBA 4M78E 3OSVA 1Q7YC 2JN0A 3OS0A 2K5FA 2FHDA 3GIBA 1RI0A 4JLIA 2EJFA 4PJOD 2XHCA 3JRZA 1I5LA 1QVFS 4J83A 4QVZA 3M5AA 3CD6A 2DVEA 1KHCA 3CCST 1UGRB 1VQ9T 1VQKA 1Y71A 2CYZB 2G3RA 3CCQT 1BI1A 1YBYA 1VQ5A 3HFNA 1VQPT 3HHTB 1N8RU 3CCRT 3CCLT 4P5NA 3GF5A 4DOVA 1BI3A 4VUBA 3RIRA 1M90C 3MO8A 1IZ6A 1X01A 3M4YA 3QJ6A 4BD3A 5GAOl 3OYBA 2MI6A 4X9CA 4FIBA 2RHYA 3V7CA 1ZHIA 2RD1A 5GAN7 4XTYA 4M75F 5I2SA 5GANh 4JS4A 1KC8C 4MZPA 4XTZA 1G3WA 5LJ3j 3QIIA 3VKIA 3HPWA 2M9UA 2P0PA 2X4YA 2GFUA 2QQ9A 4Y28E 5LJ3f 3JCMQ 3X26B 3CPWA 3VUBA 2K3XA 2L89A 4M75A 3OBYA 4ATOA 2F69A 2EFIA 3L2ZA 1VQMA 1VIEA 3MCAB 1U1SA 1W2BA 5HK0A 1WQ7A 3P8HA 4JDSA 4RG2A 2JOYA 5CKBA 5FU7C 5CKEA 5GMKj 3JB9I 2E6NA 3QHSA 2E64A 4J6YA 2DZCA 3VJPA 1BYMA 3OS5A 3SWNC 3G6ET 2KQWA 3RMQA 3LGLA 5GAN6 5GAN4 1O75A 5GAMg 3TU4K 5FLXE 1K9MU 3NTHA 1B34B 1PSFA 3RESA 1M4ZA 4MDWA 2VGNA 3QYGB 3FJPA 2PVOB 2XI9A 2PVDB 2JVVA 4M75G 5GAMd 4OGEA 4NL3A 4E7JA 5GAOp 1VQPA 4Q5WA 3FEOA 1I81A 3CC7A 1U1TA 3LGFA 3WVDB 2E12A 1B34A 2B8AA 2X35A 3ME9A 2E1HA 4A4KA 5DLOA 5CK9A 4N0AC 3PT9A 5GAN8 1IREB 2HNIA 2RB6A 4M7DC 2RJEA 2E10A 1YI2A 1S72T 1UEBA 3SB2A 2NLUA 3PNWC 3MP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3URG A;  2P0P A;  2K2V A;  2P0Q A; 
#chains in the Genus database with same CATH topology
 1NPP A;  1Y57 A;  2KAF A;  3ZFJ A;  5HKC A;  1JQQ A;  1WGS A;  2HBW A;  1E6H A;  3SWN B;  3DB4 A;  2RJF A;  4M7D E;  3DLM A;  2FO0 A;  2ROT A;  4HVV A;  2O9V A;  2O9S A;  1YFN A;  4DQ2 A;  1OQK A;  2CP3 A;  1VUB A;  1UGS B;  4J9F A;  1E7O A;  1MGQ A;  2A36 A;  2OI3 A;  3H0I A;  1NE8 A;  5LJ3 d;  5IT9 E;  3LH5 A;  4M7D B;  3LW5 E;  1UGQ B;  2RQW A;  3ER0 A;  1UGV A;  1X27 A;  4M4Z A;  1KIK A;  3CD6 Q;  1S72 A;  4N0A A;  4XAX B;  1KJW A;  5EG2 A;  4QVC A;  1AWJ A;  3VYH B;  3QYH B;  2DZ9 A;  1H8K A;  1SHF A;  3PMI A;  4C92 F;  2JS2 A;  1JBM A;  4JS5 A;  2ZPH B;  1M2O A;  2HD0 A;  4JRQ A;  5I11 A;  4WTO B;  4AFQ C;  3BDU A;  4M7D G;  4EMK B;  1RAF B;  3NMZ C;  2CUD A;  2RQV A;  3U23 A;  2PVG B;  2HZY A;  1K1Z A;  3EG3 A;  1UHF A;  5DLQ E;  2OJ2 A;  4LD9 K;  1W6X A;  2FRY A;  2EQK A;  1N8R R;  2HQX A;  1UJY A;  2DK3 A;  3SFM A;  2D8J A;  1WDX A;  2J6O A;  2CZ7 B;  2L5Q A;  1VYT A;  3RER A;  3L42 A;  4XTU A;  2CZ1 B;  3HFO A;  1WZO A;  2HMA A;  7AT1 B;  4A54 A;  3CMA A;  3OYF A;  1YI2 Q;  1MHN A;  1PD1 A;  3I56 T;  2F2V A;  1UUE A;  4E2F B;  2V8K A;  2M1H A;  3C12 A;  1OEB A;  3OYI A;  4V2S A;  1FXX A;  2F1L A;  5HY6 A;  5GAO n;  1YHQ A;  2AK5 A;  2K79 A;  3MEU A;  3UA6 A;  3DB3 A;  5GAO q;  1TG0 A;  3CC4 A;  4A53 A;  2PUK B;  4D8D A;  4F7U E;  3VS3 A;  4O5V A;  3NFC A;  4M7A A;  4X9D A;  4ESR A;  1N9R A;  4PJO F;  2O88 A;  4PLI A;  1OZ2 A;  1NEG A;  2AKK A;  4JUV A;  3M0Q A;  8ATC B;  4C92 D;  2EYY A;  3MEW A;  3OYD A;  4FYX B;  3CCE A;  3LLR A;  1HYO A;  3NTI A;  4OVA A;  2MYS A;  3ZEH A;  1VQ6 A;  2RI5 A;  1M5Q 1;  1MV0 B;  4M77 C;  1H3Z A;  4Z88 A;  2KYB A;  2QK0 A;  5LJ3 e;  2E41 A;  3CCU A;  1M8V A;  1IHV A;  2ZPG B;  2GQI A;  5GAO r;  4XU1 A;  5KH6 A;  1Q81 C;  4DOW A;  2K9G A;  3TVT A;  3MP1 A;  4J9H A;  2M02 A;  2FEI A;  4OF1 A;  1D3B B;  2GFA A;  4C0G A;  4PJN A;  2XDD A;  4AMC A;  4C0F A;  2JNG A;  3TRE A;  2MIO A;  4ZNX A;  1Z9Z A;  3QPH A;  3RKW A;  4BI3 A;  4HCC A;  1QW1 A;  4PK4 A;  1VQO A;  2JTE A;  1WJS A;  2W0Z A;  4JZ3 A;  2VKN A;  3CCV A;  2XD0 A;  4M75 D;  1Z9Q A;  3CBO A;  1EX4 A;  3QWX X;  1D1B A;  5IHK A;  2DL8 A;  1QCF A;  3E19 A;  1C0M A;  3L1A A;  1UTI A;  1S1N A;  2BE9 B;  1B07 A;  2RN8 A;  2OTJ Q;  3A1P A;  4Z89 A;  1YJ9 T;  5LJ5 d;  2LNV A;  2HAX A;  3HKS A;  5KYU A;  2JS0 A;  1WHH A;  2HQH A;  2YLC A;  4FL6 A;  5D6Y A;  3I5R A;  2WSF E;  4GBQ A;  1J3T A;  3TEE A;  1VQ8 Q;  2JXB A;  3CCJ Q;  3O8V A;  4OB1 B;  4LXC A;  2XIC A;  4AFZ C;  3RUX A;  3A8G B;  2HKQ B;  4FYY B;  2DD4 A;  1UDL A;  1X6O A;  1YIJ Q;  3G4S A;  3CC2 T;  3I56 Q;  2RHZ A;  1K0X A;  1NYG A;  2OTL A;  4PJL A;  4C8Q A;  3T9N A;  2QEX A;  3A98 A;  3UAT A;  3WXM B;  6AT1 B;  4J6X A;  1QVP A;  4LDU A;  1OV3 A;  3C94 A;  2ENM A;  1QP2 A;  4M78 F;  2VVK A;  2RI2 A;  2YLB A;  3QKJ A;  1IGU A;  5GJV B;  4BAC A;  5D6W A;  3A5Z B;  3M55 A;  2O31 A;  3JCM f;  2P4T A;  2QDY B;  4PKC C;  2KRS A;  4OMN A;  2E70 A;  3EFO B;  4D6W A;  2OAU A;  5DM7 R;  1LVK A;  4M7D D;  5IN1 A;  5J26 A;  2XG8 D;  3KXT A;  5LJ5 f;  2E6Z A;  1BIB A;  2PNI A;  1JB0 E;  1KQS A;  4FYW B;  3X28 B;  4II1 A;  3G71 Q;  2JUF A;  5CQY A;  4MZT A;  1TWB A;  5CKH A;  3CCQ A;  2PU9 B;  3ZBD A;  1K0S A;  1NLP C;  3JCM W;  2V8J A;  2DXU A;  2A3L A;  2EIF A;  1VQ4 T;  1IO6 A;  2EYX A;  2KMT A;  2ECZ A;  4QQ6 A;  2D8H A;  1X2K A;  2L3P A;  2XDB A;  1OPL A;  2A37 A;  2GF7 A;  2WAC A;  1UFF A;  3OYL A;  4OMM A;  4EIK A;  4RTZ A;  4ANJ A;  2LJ1 A;  1YJW A;  2YUP A;  1Y96 A;  2P0K A;  3C4S A;  4OP0 A;  1KQS P;  2RQT A;  4OGC A;  3ASK A;  3SHW A;  1N6A A;  2RMO A;  2LRQ A;  3QDF A;  5LJ5 e;  5FRO A;  4GLK A;  2JMC A;  4ME7 A;  1VQ7 Q;  1BKB A;  2CP2 A;  2DNU A;  5GAM j;  1MV3 A;  5I21 A;  4IIO A;  5GAM f;  4M75 C;  2A08 A;  1BB9 A;  2H3E B;  5IH2 A;  2LX9 A;  3GLX A;  4E7L A;  2LCS A;  5IAY A;  2QQA A;  3AHU A;  2FB7 A;  2QTX A;  3FJ5 A;  5KCH A;  2KRO A;  5KYX A;  2YUQ A;  1PC0 A;  1MND A;  4QVZ A;  3M5A A;  2DVE A;  3CCS Q;  4LN2 A;  4PFZ A;  2G3R A;  1VA7 A;  1VQP T;  1VYV A;  3CCL T;  3CCR T;  3GF5 A;  1BI3 A;  1X01 A;  1AWW A;  4BD3 A;  4FYV B;  4X9C A;  4FIB A;  4OMO A;  3V7C A;  3QWY A;  4XTY A;  1KC8 C;  2KXD A;  3J81 E;  3VKI A;  2P0P A;  3CPW A;  2GFU A;  2LJ0 A;  1CSK A;  1W2B A;  5HK0 A;  1WQ7 A;  3P8H A;  2JOY A;  4E7Z A;  1MMD A;  2CT3 A;  3SWN C;  2HEQ A;  2J6F A;  3RMQ A;  3LGL A;  5GAN 6;  1O75 A;  3G6E Q;  1K9A A;  3UF4 A;  1PRL C;  4WCI A;  2D1X A;  4E7J A;  4JZ4 A;  5GAO p;  1SSH A;  1GFD A;  1I81 A;  2LQN A;  1D1C A;  2E1H A;  3PT9 A;  4M7D C;  3SB2 A;  2J06 A;  1KHI A;  3VRY A;  4XU0 A;  3CXC P;  4MDX A;  1VIF A;  1AWO A;  4IUR A;  5HCK A;  4AG2 C;  5LL6 S;  1JXO A;  1Q81 U;  2NUP B;  3CPW P;  2KXC A;  1HK9 A;  3FLG A;  4J7F A;  2QA4 Q;  3EGU A;  2F5T X;  2KYM A;  4KGX B;  1T0H A;  5KE3 A;  2SEM A;  2FVU A;  4F7U A;  5CKD A;  4C92 E;  2L3R A;  1UGP B;  2BTT A;  1ZQ1 A;  4B6M A;  2HKN A;  4HA8 A;  2LDM A;  3V8L A;  1M1K C;  1PHT A;  1WXU A;  3E9G A;  2JTM A;  4EMK C;  3PMT A;  4PFP A;  3C95 A;  2JM8 A;  5GAN j;  1H3H A;  5A0D A;  3CD6 T;  4R55 A;  3LH0 A;  3OYE A;  4HCK A;  1ZSZ A;  1NYF A;  4E7I A;  2I2L A;  5GMK m;  1VQK Q;  5C0M A;  4C92 B;  3JCM h;  3RDV A;  1SSF A;  2O4X B;  3JCM P;  3V7R A;  5GAN 5;  5GMK l;  3CPW S;  4KUD K;  3HRU A;  4X34 A;  2B86 A;  3O5Z A;  1K8A C;  1WJQ A;  1NEB A;  2YUN A;  4QQD A;  1W2B S;  3EGX B;  1SF9 A;  4BE0 A;  2ZAE A;  2EKO A;  4M75 E;  2WSE E;  4A63 B;  3FB9 A;  2CP6 A;  2JW4 A;  3M9Q A;  4J9B A;  5KYW A;  4C92 G;  3P8B B;  4JRP A;  1FMK A;  1M90 U;  5FW9 A;  1VQP Q;  1N5Z A;  2LT4 A;  1G2B A;  4M75 B;  2RA2 A;  2W10 A;  5CO7 A;  1BCM A;  1TTH B;  1YI2 T;  1PKT A;  2IVW A;  1M2V B;  3TQ7 P;  2EW3 A;  2JM9 A;  5IHN A;  1BCO A;  1IRX A;  2A7Y A;  1YJ9 A;  3A8H B;  5CR2 A;  3H6Z A;  5J3B A;  4B9X A;  1U8R A;  3CME Q;  5GAN 2;  4HXJ A;  3VS7 A;  4M7A F;  2RO0 A;  4C5H A;  3EAE A;  3PIP A;  4L59 A;  1GL5 A;  5GAM h;  2BE7 D;  3A8M B;  2QAS A;  3JB9 J;  2RI3 A;  3QDR B;  1LNX A;  2MF2 A;  4JJN K;  3CC2 A;  3OBW A;  2E65 A;  2ZZD A;  2PQW A;  1Q81 R;  4HT8 A;  2KNB B;  4E7H A;  2VB6 A;  4XTW A;  1K73 U;  4LD6 A;  2YDL A;  2R58 A;  2XU8 A;  5CVI A;  1GRI A;  2VXF A;  1VQN Q;  1UG1 A;  1WXT A;  2ROL A;  2LX7 A;  2PUO B;  1X75 C;  5FU6 B;  3I9Q A;  2DVJ A;  1TS9 A;  1YWO A;  3QG1 A;  1AZG B;  5AT1 B;  2FYK A;  3UWN A;  4O6J A;  1YIT T;  1Q82 U;  2FL7 A;  3JB9 D;  3QSU A;  3I5S A;  3JB9 H;  1JJ2 A;  2YT6 A;  4UC4 A;  1G8X A;  2LQK A;  2QI2 A;  3NPF A;  3LYI A;  1JRI A;  2QAZ A;  1QKX A;  4LE9 A;  3M57 A;  3G1J A;  1VQ4 A;  1AD5 A;  1LPL A;  3PFS A;  2OTJ T;  1DJ7 B;  3MET A;  3SEM A;  4M77 A;  2Z0W A;  3QXE B;  2FRW A;  4J5Y A;  2E5K A;  1BK2 A;  1M90 R;  1NLO C;  1QQJ A;  1VQ8 T;  2QQS A;  4NL2 A;  4KGZ B;  3EHR A;  2K7A A;  2YRD A;  4YTL A;  1WYX A;  3CCJ T;  4LDY A;  3BFM A;  1F1B B;  1O9S A;  2DXB A;  1BBZ A;  1KC8 U;  5GAN g;  1ZUU A;  1YIJ T;  1JJ2 P;  4C8Q F;  1G5V A;  2E3I A;  2LTO A;  1D1A A;  3EG9 A;  4M78 B;  3J7A F;  1G83 A;  3CCM Q;  1ZA2 B;  4MML A;  2VV5 A;  2HL3 A;  1M27 C;  2LC4 A;  4J8O A;  3DLL A;  2J7I A;  2K4Y A;  2ZCF B;  2CKK A;  4GLM A;  1LCK A;  1TUG B;  2AZS A;  2DL7 A;  2FZK B;  2DMO A;  3M53 A;  4X1V A;  1YCS B;  1GXI E;  3FIF A;  4C0D B;  3G71 T;  1JJ2 S;  2HCK A;  4M78 G;  2D0Q B;  2CZ0 B;  1YP5 A;  1K73 R;  3CCR A;  3CCL A;  5GAN 3;  1PRM C;  4ZGJ B;  1YJN A;  2DEQ A;  2R57 A;  2J6K A;  3KBG A;  2F2X A;  3TSZ A;  2D9T A;  2Y4Y A;  1PNJ A;  4HCZ A;  1WHL A;  4HKE A;  4J9I A;  4XTV A;  4BY6 C;  1TH7 A;  1WPY A;  2L8D A;  1M1K U;  2O01 E;  3UT1 A;  4Y91 A;  3BDL A;  1QP3 A;  1YNZ A;  1FWZ A;  1Q82 R;  2EWN A;  3L2R A;  1UB4 A;  1YIT Q;  4PLL A;  4ZTJ A;  5L8R E;  2DLP A;  1OYX A;  1KQ2 A;  2NUP A;  2RF0 A;  4XTX A;  1IGQ A;  2CH4 A;  3BY7 A;  3OYH A;  1M9S A;  3OYJ A;  3JCM d;  1RAE B;  1K8A U;  4KT0 E;  1KG1 A;  4RTY A;  4B9W A;  2LQW A;  2V1Q A;  1D0Z A;  2MWO A;  3HP9 A;  1KD1 C;  3JCM b;  5FRM A;  4WF2 A;  2DJZ A;  2MPX C;  3MPU B;  1VQ5 T;  1XTD A;  1OU8 A;  1SEM A;  3P8D A;  2JJ9 A;  1VQ7 T;  1EZZ B;  2KT1 A;  4RCB A;  5A0G A;  1LJO A;  2DX1 A;  1T3L A;  4QW2 A;  2ED1 A;  4IUT A;  4HT9 A;  1SRM A;  2L3S A;  2FZC B;  2C06 A;  1XOV A;  4A4E A;  4ZGD B;  3GOX A;  4AT1 B;  2YRV A;  3I55 Q;  5L23 A;  2QG9 B;  3OSV A;  1KC8 R;  4FCY A;  2FHD A;  2MOX A;  4JLI A;  4PJO D;  2XHC A;  1K76 A;  3EG2 A;  1I5L A;  3EG1 A;  3EGX A;  3CD6 A;  1Q95 G;  3CCS T;  1UGR B;  1Y71 A;  1VQ9 Q;  2QGG A;  1YBY A;  2DET A;  2NUT B;  4HCB A;  2YXY A;  1M90 C;  4P5N A;  1GCQ C;  3MO8 A;  1IZ6 A;  2RHY A;  1ZHI A;  1ZBJ A;  4JS4 A;  4CC7 A;  3JCM Q;  1WHJ A;  2M9U A;  4Y28 E;  1WHM A;  4PJM A;  4M75 A;  2DEU A;  3L2Z A;  1VIE A;  4JDS A;  3JB9 I;  5GMK j;  2E64 A;  1BYM A;  2DZC A;  1K9M R;  2NWM A;  3G6E T;  2KQW A;  5GAN 4;  1RAD B;  1M4Z A;  2L3Q A;  1JXM A;  3FJP A;  2ED0 A;  2XI9 A;  2PVD B;  4RTX A;  5GAM d;  4OGE A;  4NL3 A;  1ZLM A;  2ESW A;  1M30 A;  1C6V X;  3M0P A;  2CSQ A;  3JV3 A;  1B34 A;  2B8A A;  5GAN 8;  2CP0 A;  1IRE B;  2HNI A;  2E10 A;  1YI2 A;  1S72 T;  1UEB A;  2NLU A;  3PNW C;  4RG2 A;  5AYF A;  1HD3 A;  1M1K R;  4N4H A;  1I07 A;  3L2Q A;  1G3Y A;  3JCM c;  2FG0 A;  5KYY A;  2OAW A;  2QA4 T;  4C92 C;  3ULR B;  4FW2 A;  5GMK i;  1K73 C;  2MMP A;  4F7U F;  4CC2 A;  5C6S A;  3SDZ A;  2DBK A;  3SWN A;  8AT1 B;  4OMQ A;  3M0U A;  5LJ3 g;  1H64 1;  2ZPB B;  3QO3 A;  1QVG A;  2IPO B;  2V8I A;  3ZL7 C;  5KCO A;  4BE1 A;  3VS6 A;  3JCM e;  2ZPF B;  1K8A R;  4CC4 B;  4CC3 A;  4BY6 B;  3OW2 A;  1VQK T;  3THK A;  1PG5 B;  4HVW A;  3VUZ A;  1Q82 C;  4C0Z A;  2EQM A;  3JCM J;  4M7D A;  3EGD B;  1VQ5 Q;  1XQH A;  1WI7 A;  5D6X A;  3M0T A;  2GBQ A;  2Y4X A;  2KT8 A;  4M78 D;  4BDY A;  2KI7 A;  3VS1 A;  4A4H A;  3OMG A;  1KSW A;  3M4G A;  1Y07 A;  2BZX A;  3HTR A;  1VQM Q;  1MNE A;  1WJR A;  2RJC A;  4XU2 A;  4F04 B;  1XJW B;  3M58 A;  3VV0 A;  3QUI A;  2BZY A;  2MCN A;  4EMK A;  1NJI R;  4BI4 A;  3AT1 B;  1R0B G;  2X4W A;  2KY9 A;  3CC4 T;  3OMC A;  1TXQ A;  2DRK A;  3CC7 Q;  4DBR A;  4BUG A;  2DIG A;  1HXD A;  2DD5 A;  4E7K A;  1D09 B;  1OX8 A;  1KQ1 A;  4LDW A;  2JT4 A;  4PJO C;  4BB7 A;  2DYB A;  2Y90 A;  4CI0 C;  1KK7 A;  1FMV A;  1VYU A;  5KE2 A;  2OTJ A;  2VYT A;  3OA6 A;  3VYG A;  2E5Q A;  3A8L B;  2GQV A;  1NPR A;  3JB9 G;  3G7Z A;  4KH0 B;  1IXD A;  3OS1 A;  4JLG A;  1SHG A;  1YWP A;  3CME T;  1A0N B;  5GAM e;  3VS2 A;  2K3Y A;  1QVG S;  1VQ8 A;  4FSX A;  4KGV B;  3CCJ A;  3PVQ A;  1NZ9 A;  2LP5 A;  3SD4 A;  4AFS C;  5CAI A;  5FRN A;  3OW2 S;  3H8Z A;  4KUI A;  1QMC A;  3M56 A;  5FU6 C;  4L6V 5;  1YIJ A;  1ZSG A;  1S72 Q;  3OB9 A;  1K9M C;  3I56 A;  1N9S A;  3CQT A;  1JO8 A;  1Y0M A;  1AWX A;  1B3Q A;  2RH2 A;  4PNO A;  3CCV T;  4ZN3 A;  2XDP A;  1EFN A;  2VGM A;  1CKA A;  2EJ9 A;  2XKO C;  2L0A A;  3S3N A;  5A0L A;  1W2B P;  1V1C A;  4RTT A;  3QZ5 B;  1VQN T;  1TSF A;  3MP6 A;  3NHN A;  1YCY A;  1SPK A;  1V76 A;  4CRI A;  4XK8 E;  5I2M A;  2DJQ A;  2CP7 A;  2EYZ A;  9ATC B;  1AT1 B;  5GAN f;  2DFU A;  3CBP A;  1KD1 U;  5CCA A;  4RKU E;  4C5I A;  3G71 A;  3M54 A;  2LQ8 A;  4KBM B;  2RHI A;  1UE9 A;  2RK1 A;  3PIO A;  4JJC A;  1QWE A;  2MWP A;  4NOY A;  1D3B A;  1AOJ A;  5GMK h;  3VU3 C;  1X6B A;  2X3W D;  4LUE A;  3CMA Q;  2YHT A;  3OYC A;  5KYU B;  3G4S T;  2ZPE B;  2R5A A;  4M77 F;  1E6G A;  2KSS A;  2FPE A;  4N4I A;  2DKG A;  2QEX T;  3JCM V;  3KFV A;  3FRN A;  1OI1 A;  4RTV A;  3UDC A;  2HQE A;  4M78 C;  1YHQ Q;  2O2O A;  1VOM A;  2DO3 A;  4RCC A;  2JTF A;  3CC4 Q;  2EYW A;  2DL5 A;  1TUD A;  4LUD A;  2P84 A;  4C8Q B;  2FPF A;  2M16 A;  3V7S A;  1R77 A;  5HK3 A;  5GAO m;  5GAN e;  1JU5 C;  4EMG A;  2HSP A;  4C0D C;  1NJI C;  3TSW A;  2K5I A;  4PJO E;  1VQ7 A;  3CCM T;  3CCE Q;  2A28 A;  4PJJ A;  2RQU A;  3L2V A;  2RHX A;  2DE0 X;  1VQ6 Q;  4EMH A;  2VXE A;  4J6W A;  2EKH A;  2DXT A;  2DTO A;  1GCP A;  2JMA A;  1QKW A;  3L2U A;  2DTH A;  2XID A;  4C8Q G;  3CCU Q;  1VQL T;  2MAM A;  4PJO B;  1UEC A;  3OYG A;  1RLP C;  2GTO A;  1EIF A;  1K4U S;  1ZA1 B;  4MMK A;  1QVF A;  1YJW T;  3CCS A;  3OYY A;  3EFO A;  2DTI A;  3TCJ A;  3M59 A;  1VQO Q;  3OSS C;  3CCV Q;  2GGR A;  1X6G A;  4ZN1 A;  1AZE A;  3PTA A;  3V8K A;  3CPF A;  1Q86 U;  4M77 D;  2CZ6 B;  2F5K A;  4PJO G;  2CDT A;  2AT1 B;  2KBT A;  4J7I A;  4K11 A;  3X25 B;  2K2V A;  5CKF A;  3GBQ A;  1Y96 B;  1RL2 A;  1KD1 R;  3G6E A;  2EGC A;  3M0S A;  2CH4 W;  2HSE B;  2RQR A;  2C0T A;  1SG5 A;  2QXF A;  1QVF P;  2EGA A;  5IXB A;  4C5E A;  2K5L A;  3L2W A;  4IUQ A;  3G4S Q;  4OB2 B;  2C0I A;  1OPK A;  2OTL Q;  1ZBX A;  2EQU A;  2QEX Q;  5A2Q E;  4AFU C;  2GTJ A;  2IG0 A;  3E1S A;  2QA4 A;  2DIL A;  2KE9 A;  5KYX B;  2DBM A;  2HBP A;  4DBQ A;  3CEY A;  3EGD A;  3F70 A;  4M7A D;  3OQ5 A;  1RAA B;  3I55 T;  4M78 E;  1Q7Y C;  1ARK A;  2JN0 A;  4J9E A;  3GIB A;  1RI0 A;  1I1J A;  2EJF A;  1H92 A;  1RAC B;  1W70 A;  1PCX A;  1QVF S;  2RNA A;  1MMN A;  1KHC A;  1W1F A;  4DBH A;  1VQ9 T;  4E6R A;  1MUZ A;  1VQK A;  2CYZ B;  2AKL A;  1BI1 A;  3H41 A;  3CCQ Q;  2COZ A;  3E2U A;  4VUB A;  3RIR A;  3M4Y A;  3QJ6 A;  2BZ8 A;  3OYB A;  5GJW B;  2KRM A;  5GAN 7;  4M75 F;  5GAN h;  2P4R A;  4HVU A;  2LMJ A;  2J05 A;  3QII A;  4E7S A;  3HPW A;  5LJ3 j;  5LJ3 f;  1WLP B;  3VRZ A;  4JJD A;  3OBY A;  1TUC A;  1TOV A;  2F69 A;  1VQL Q;  5CKB A;  5FU7 C;  5CKE A;  2E6N A;  3VJP A;  4Y92 A;  3MKD A;  3OS5 A;  3TU4 K;  5FLX E;  1K9M U;  1PSF A;  1RI9 A;  2EVR A;  4MDW A;  2VGN A;  3QYG B;  1WX6 A;  1YJW Q;  2EQI A;  1VQP A;  4Q5W A;  1I5O B;  1U1T A;  2HDA A;  1Q86 R;  2X3X D;  2M51 A;  1RAH B;  3ME9 A;  4J9D A;  4A4K A;  2FZG B;  4N0A C;  1GCQ A;  1TU0 B;  2RJE A;  4F16 A;  3MP8 A;  1R8O B;  3R6O A;  2DER A;  2RPN A;  1R0C B;  1M1F A;  3NGP A;  3H0F A;  4PL6 A;  4F17 A;  4MZM A;  1X43 A;  4DBF A;  4F7U B;  3LX7 A;  4QVD A;  1G3T A;  2KEA A;  1X69 A;  4ELZ C;  2KVQ G;  3EH2 A;  1BI2 A;  3JAM E;  2DF6 A;  3CME A;  1U06 A;  4OB3 B;  1BU1 A;  1I0C A;  1QWF A;  3MHX A;  2OX7 A;  1ZSZ B;  3H0H A;  3RNJ A;  2DIQ A;  3URG A;  4M7D F;  4C8Q D;  1U5S A;  4DEX A;  1I4K 1;  4IUP A;  5I22 A;  1W4S A;  2FPD A;  4F7U G;  2E4H A;  4L5G A;  2BUD A;  2ZPI B;  1CKB A;  2A0F B;  1OZ3 A;  2RM4 A;  3D7S B;  3GPL A;  3DKM A;  4C92 A;  2P0Q A;  3PGG A;  2I0N A;  2O4X A;  5EC7 A;  5KYW B;  1AHJ B;  1VQN A;  2DA9 A;  1VQM T;  3S3M A;  4LDX A;  3EG0 A;  2EBP A;  2LT1 A;  5CIU A;  4BI8 B;  2EYQ A;  1SKU B;  2COW A;  3REA B;  2XMF A;  1JEG A;  2K57 A;  1YN8 A;  4QKU A;  2EPD A;  1NJI U;  1WFW A;  2YWW A;  4C5G A;  4M7A C;  4KRT A;  3CC7 T;  3RKX A;  3HL8 A;  2QYZ A;  3VS5 A;  2LZ6 B;  3CBM A;  1M8M A;  2EQJ A;  4KUL A;  4XQ3 A;  1ACM B;  3EH1 A;  1N8R C;  4RTU A;  2MK5 A;  4FM4 B;  2K6D A;  1M2V A;  2G6F X;  3I35 A;  2VUB A;  4AG1 C;  4FU6 A;  2V1R A;  1RAB B;  4J9G A;  3QBY A;  2BIV A;  3PE0 A;  1M1G A;  2H8H A;  2GNC A;  2X51 A;  2SRC A;  2KRN A;  3FC3 A;  1IHW A;  2YSQ A;  4R56 A;  3M0R A;  5IHI A;  1PD0 A;  4IUV A;  2YRC A;  5LJ5 j;  1HJD A;  2VWF A;  2PZ1 A;  5FU7 B;  1P92 A;  2CUB A;  4PJO A;  3S3O A;  3OS2 A;  1WHG A;  1PWT A;  4FW1 A;  4FT4 A;  5IXF A;  3CCM A;  2LCL A;  1AVZ C;  1Q86 C;  2L2P A;  4OMF B;  2LCC A;  4A4F A;  3OYA A;  3GNG A;  4JJB A;  4RMO A;  2CS7 A;  2F2W A;  1VQL A;  3HRT A;  4LDV A;  4M77 E;  5D7U A;  2COY A;  5GMK e;  2K3B A;  3MEA A;  3RMS A;  5LJ3 h;  1GBR A;  5J39 A;  1B7T A;  2LNH B;  2XK0 A;  3X20 B;  1N27 A;  5DY9 A;  3CMA T;  4M77 B;  3BW1 A;  2KK4 A;  2KGT A;  3PVL A;  3RBB B;  1X2Q A;  2NUZ A;  2H3J A;  4C8Q C;  3QZ9 B;  2CP5 A;  2CRE A;  2QQB A;  1Q7Y U;  1YJ9 Q;  2QTV A;  4RUG A;  3REB B;  1MMG A;  2CGH A;  2X4J A;  4DEY A;  1BI0 A;  4PFO A;  3OYN A;  1YHQ T;  2QGF B;  1M3A A;  1QVG P;  3H9N A;  1NG2 A;  1GFC A;  2DYI A;  2AHJ B;  1YIT A;  2X9H A;  2AZV A;  2QQR A;  3MJX A;  3NTK A;  4M77 G;  2DRM A;  3OW2 P;  4JRK A;  4ZTF A;  2DXC A;  2KDS A;  1KQS S;  1ZUY A;  3EG9 B;  1BIA A;  4M7A E;  1T0J A;  2RHU A;  2AIR B;  4Z02 A;  1WQW A;  2PTK A;  4E47 A;  3CC2 Q;  1ABQ A;  2EGE A;  5GAN d;  2RK2 A;  4QQG A;  3OYM A;  1YJN T;  4JPB W;  1RAI B;  1D0X A;  3CCE T;  3CXC A;  1PKS A;  2DL3 A;  4JRI A;  1WNL A;  1WA7 A;  4IUU A;  1VQ6 T;  4BDZ A;  4OMP A;  4M7A B;  3UA7 A;  5FWC A;  5CQX A;  1V29 B;  4EDU A;  3C0C A;  1I8F A;  4M78 A;  1PM3 A;  5FWB A;  3CCU T;  1ZX6 A;  3I55 A;  1FX7 A;  1IB8 A;  5M9O A;  3J80 E;  1QCN A;  1NBE B;  3LWH A;  4OML A;  1FYN A;  4FT2 A;  4EPC A;  3A8O B;  5KYN A;  4FSS A;  4IIM A;  3S6W A;  3EFR A;  1MMA A;  2C0O A;  3HRS A;  4NS5 A;  3V8J A;  1LOJ A;  1OOT A;  1VQ9 A;  1WHK A;  1SRL A;  1VQO T;  2GCX A;  3KUF A;  4M7A G;  4ELY C;  2JZ2 A;  4GY5 A;  2K2M A;  2EAY A;  2IIM A;  2KR3 A;  2VC8 A;  3RKY A;  3JCM X;  4N4G A;  2R5M A;  1VQ4 Q;  2DM1 A;  1GBQ A;  1WXB A;  2WSC E;  3QJY A;  2ZGW A;  2DL4 A;  4TVR A;  3WVE B;  3Q1J A;  2RJD A;  2LVM A;  3FDR A;  1PSE A;  1QCO A;  3OYK A;  1RAG B;  1G3S A;  1D0Y A;  4DA4 A;  3JCM g;  2NYS A;  4IKF A;  4RTW A;  2HL5 C;  2X4X A;  3LWI A;  1M3C A;  2ABL A;  4RG8 A;  2EJG A;  3UPU A;  4ZGE B;  2D6F A;  5LJ5 g;  2LJ3 A;  1Q7Y R;  3INZ A;  4OB0 B;  4XU3 A;  3JSC A;  1C1A A;  3VS4 A;  2DAQ A;  2OTL T;  1OX9 A;  3EFS A;  3GP8 A;  1RUW A;  3CXC S;  2M0Y A;  2V26 A;  4F14 A;  2CSI A;  4D8K A;  2M0O A;  3X24 B;  4C8Q E;  1ABO A;  1XNI A;  1KFZ A;  1UHC A;  1Y7X A;  2CT4 A;  3GNF B;  3OY9 A;  5LJ5 h;  3E9F A;  1HSQ A;  2E3H A;  2YUO A;  3N5B B;  2BKD N;  2DPP B;  4QT7 A;  4A4G A;  4BE2 A;  3HSB A;  3MEV A;  3OS0 A;  2K5F A;  5ECA A;  3R6N A;  3JRZ A;  4KH1 B;  4J9C A;  4R0K A;  2QDL A;  1T3S A;  3CCQ T;  1VQ5 A;  3HFN A;  1N8R U;  3HHT B;  4LNP A;  3JB9 F;  4DOV A;  1RLQ C;  5GAO l;  3CCL Q;  3CCR Q;  1YJN Q;  2MI6 A;  1NM7 A;  2RD1 A;  1UJ0 A;  1U3O A;  5I2S A;  4MZP A;  4XTZ A;  1G3W A;  2NUT A;  2X4Y A;  2QQ9 A;  3IQL A;  3X26 B;  1OU9 A;  3VUB A;  2K3X A;  2L89 A;  4ATO A;  3EHQ A;  2EFI A;  1VQM A;  3MCA B;  1U1S A;  1M3B A;  2ATC B;  3QHS A;  1ZUK A;  4J6Y A;  5GAM g;  4Z8A A;  1FMW A;  3NTH A;  1B34 B;  3RES A;  4ORZ A;  2PVO B;  4M75 G;  2JVV A;  2D0N A;  3BE3 A;  1QLY A;  1AEY A;  2VAS A;  3FEO A;  3CC7 A;  3LGF A;  3WVD B;  2E12 A;  2X35 A;  1OUL A;  3VS0 A;  5DLO A;  5CK9 A;  5KYY B;  1ZSZ C;  1WIE A;  2RB6 A;  4J83 A;  3RR6 A; 
#chains in the Genus database with same CATH homology
 1NPP A;  1R8O B;  2KAF A;  3R6O A;  5AYF A;  4XU0 A;  4MDX A;  1VIF A;  1M1F A;  4IUR A;  3ZFJ A;  4N4H A;  5HKC A;  4PL6 A;  1WGS A;  3L2Q A;  1G3Y A;  3SWN B;  3JCM c;  4MZM A;  5LL6 S;  3DB4 A;  2RJF A;  4F7U B;  4M7D E;  1Q81 U;  3DLM A;  3LX7 A;  4QVD A;  4C92 C;  2QA4 T;  1G3T A;  1HK9 A;  5GMK i;  3FLG A;  4J7F A;  1K73 C;  2MMP A;  4ELZ C;  4F7U F;  2KVQ G;  2F5T X;  1BI2 A;  4DQ2 A;  5C6S A;  3SDZ A;  3JAM E;  3CME A;  4OB3 B;  3SWN A;  5KE3 A;  5LJ3 g;  1VUB A;  2FVU A;  4F7U A;  5CKD A;  4C92 E;  1H64 1;  2ZPB B;  1UGS B;  3MHX A;  2L3R A;  1MGQ A;  1UGP B;  3QO3 A;  1QVG A;  1ZQ1 A;  2V8I A;  4HA8 A;  5KCO A;  4BE1 A;  2LDM A;  1NE8 A;  3V8L A;  3JCM e;  1M1K C;  2ZPF B;  5LJ3 d;  5IT9 E;  3E9G A;  2JTM A;  4EMK C;  4M7D B;  3PMT A;  3C95 A;  3LW5 E;  1UGQ B;  3ER0 A;  5GAN j;  2DIQ A;  3URG A;  4BY6 B;  5A0D A;  4M7D F;  4C8Q D;  3CD6 T;  4R55 A;  3OW2 A;  3LH0 A;  1S72 A;  4N0A A;  4XAX B;  3OYE A;  1VQK T;  1I4K 1;  4IUP A;  3VUZ A;  5EG2 A;  1W4S A;  4F7U G;  4QVC A;  4C0Z A;  2I2L A;  2EQM A;  3VYH B;  5GMK m;  4E7I A;  3JCM J;  4M7D A;  5C0M A;  4C92 B;  3JCM h;  3QYH B;  1SSF A;  2DZ9 A;  2O4X B;  4L5G A;  1XQH A;  5D6X A;  2BUD A;  3PMI A;  3JCM P;  2ZPI B;  4C92 F;  1OZ3 A;  2Y4X A;  4M78 D;  3V7R A;  4BDY A;  2RM4 A;  5GMK l;  1JBM A;  5GAN 5;  3CPW S;  4JS5 A;  4KUD K;  3HRU A;  2ZPH B;  3GPL A;  2HD0 A;  3DKM A;  4X34 A;  4A4H A;  4C92 A;  3OMG A;  2P0Q A;  1K8A C;  3PGG A;  4JRQ A;  1WJQ A;  2O4X A;  3M4G A;  1Y07 A;  1AHJ B;  1W2B S;  4QQD A;  1VQN A;  3BDU A;  4M7D G;  4EMK B;  1VQM T;  3S3M A;  4BE0 A;  4LDX A;  2EKO A;  4M75 E;  2LT1 A;  2PVG B;  2WSE E;  5CIU A;  3FB9 A;  3M9Q A;  4BI8 B;  1WJR A;  2EYQ A;  2RJC A;  5DLQ E;  4XU2 A;  4LD9 K;  3M58 A;  2EQK A;  3VV0 A;  3QUI A;  4EMK A;  2K57 A;  4C92 G;  3P8B B;  2HQX A;  4JRP A;  2DK3 A;  4BI4 A;  2X4W A;  3SFM A;  1NJI U;  2KY9 A;  3CC4 T;  4C5G A;  1M90 U;  4M7A C;  3OMC A;  3CC7 T;  2LT4 A;  3RKX A;  2CZ7 B;  4M75 B;  2L5Q A;  3RER A;  2RA2 A;  4BUG A;  3L42 A;  2DIG A;  1HXD A;  2DD5 A;  3HL8 A;  5CO7 A;  4E7K A;  4XTU A;  2CZ1 B;  3HFO A;  1KQ1 A;  4A54 A;  3CMA A;  4LDW A;  3OYF A;  1YI2 T;  4PJO C;  4BB7 A;  1MHN A;  3CBM A;  2IVW A;  2Y90 A;  4CI0 C;  3I56 T;  5KE2 A;  2EQJ A;  2OTJ A;  2VYT A;  4KUL A;  4XQ3 A;  2V8K A;  2A7Y A;  2M1H A;  1YJ9 A;  3C12 A;  3VYG A;  2E5Q A;  3A8H B;  3A8L B;  3OYI A;  3OA6 A;  1N8R C;  5CR2 A;  3H6Z A;  4FM4 B;  5J3B A;  2GQV A;  4V2S A;  1NPR A;  3JB9 G;  3G7Z A;  1FXX A;  5HY6 A;  3OS1 A;  4B9X A;  4JLG A;  5GAO n;  1U8R A;  1YHQ A;  3CME T;  2VUB A;  3MEU A;  4FU6 A;  5GAM e;  5GAN 2;  2K3Y A;  1QVG S;  3QBY A;  2BIV A;  3DB3 A;  1M1G A;  1VQ8 A;  5GAO q;  4M7A F;  2RO0 A;  4FSX A;  4A53 A;  2PUK B;  3CC4 A;  4F7U E;  4C5H A;  3EAE A;  3FC3 A;  3CCJ A;  4O5V A;  4R56 A;  1NZ9 A;  3SD4 A;  3NFC A;  4L59 A;  3PIP A;  5CAI A;  5FRN A;  4M7A A;  4IUV A;  3OW2 S;  4X9D A;  5LJ5 j;  1N9R A;  3H8Z A;  4KUI A;  5FU6 C;  3A8M B;  3M56 A;  4PJO F;  5GAM h;  3JB9 J;  2RI3 A;  3QDR B;  4L6V 5;  4PLI A;  1YIJ A;  1LNX A;  2MF2 A;  3OB9 A;  4JJN K;  1OZ2 A;  3I56 A;  1K9M C;  5FU7 B;  1P92 A;  1N9S A;  3OBW A;  4JUV A;  2E65 A;  2ZZD A;  3CC2 A;  2PQW A;  4PJO A;  2RH2 A;  4PNO A;  4HT8 A;  3S3O A;  3OS2 A;  4E7H A;  3CCV T;  4C92 D;  4ZN3 A;  4FT4 A;  2XDP A;  3MEW A;  2VGM A;  4XTW A;  3CCM A;  3OYD A;  1K73 U;  2LCL A;  4LD6 A;  3CCE A;  2EJ9 A;  3LLR A;  3NTI A;  2R58 A;  2XKO C;  4OVA A;  2XU8 A;  3ZEH A;  3S3N A;  5A0L A;  1Q86 C;  1VQ6 A;  5CVI A;  2RI5 A;  4OMF B;  1M5Q 1;  3QZ5 B;  1VQN T;  3MP6 A;  4M77 C;  2VXF A;  1H3Z A;  2LCC A;  4A4F A;  3OYA A;  3GNG A;  5LJ3 e;  2E41 A;  4RMO A;  2PUO B;  2CS7 A;  3CCU A;  1M8V A;  1YCY A;  4CRI A;  4XK8 E;  2ZPG B;  5I2M A;  1X75 C;  5FU6 B;  1VQL A;  5GAO r;  3HRT A;  4XU1 A;  5KH6 A;  4LDV A;  1Q81 C;  4DOW A;  3QG1 A;  4M77 E;  3MP1 A;  5GAN f;  5GMK e;  2FYK A;  4OF1 A;  3UWN A;  1D3B B;  2GFA A;  3CBP A;  3MEA A;  4O6J A;  4C0G A;  1YIT T;  1KD1 U;  3RMS A;  5CCA A;  4RKU E;  4C5I A;  2XDD A;  3M54 A;  2LQ8 A;  2FL7 A;  2JNG A;  5LJ3 h;  4KBM B;  3TRE A;  4C0F A;  3G71 A;  3JB9 D;  2RHI A;  3QSU A;  3RKW A;  3QPH A;  4BI3 A;  4HCC A;  3JB9 H;  1QW1 A;  1JJ2 A;  2RK1 A;  3PIO A;  5J39 A;  4UC4 A;  1VQO A;  2LQK A;  2MWP A;  4NOY A;  1WJS A;  2QI2 A;  3J81 E;  3CCV A;  2XK0 A;  1D3B A;  3X20 B;  2XD0 A;  3LYI A;  4M75 D;  5GMK h;  3VU3 C;  1N27 A;  5DY9 A;  3CMA T;  1JRI A;  3CBO A;  4M77 B;  3BW1 A;  2KK4 A;  2YHT A;  3M57 A;  3OYC A;  3G4S T;  2ZPE B;  1VQ4 A;  2R5A A;  3E19 A;  2H3J A;  3PFS A;  4M77 F;  4C8Q C;  3L1A A;  2KSS A;  3QZ9 B;  2OTJ T;  2QQB A;  4N4I A;  1YJ9 T;  1Q7Y U;  1DJ7 B;  3MET A;  5LJ5 d;  2DKG A;  2QEX T;  3JCM V;  1Q82 U;  2LNV A;  4M77 A;  2HAX A;  2CGH A;  3HKS A;  3FRN A;  1OI1 A;  2X4J A;  3QXE B;  2YLC A;  4FL6 A;  4J5Y A;  1BI0 A;  3OYN A;  3UDC A;  1YHQ T;  5D6Y A;  2HQE A;  4M78 C;  2WSF E;  2DO3 A;  2AHJ B;  1YIT A;  3TEE A;  1VQ8 T;  2QQS A;  4NL2 A;  4YTL A;  4RCC A;  2JTF A;  2QQR A;  3CCJ T;  4LDY A;  3BFM A;  3NTK A;  3O8V A;  4M77 G;  4OB1 B;  2XIC A;  1O9S A;  1KHI A;  4JRK A;  4ZTF A;  3RUX A;  3A8G B;  2DXB A;  2DXC A;  2KDS A;  1KC8 U;  1KQS S;  4C8Q B;  2DD4 A;  5GAN g;  1BIA A;  1X6O A;  4M7A E;  2M16 A;  1YIJ T;  3V7S A;  5HK3 A;  2RHU A;  5GAO m;  3G4S A;  4C8Q F;  5GAN e;  3CC2 T;  4Z02 A;  1WQW A;  2RHZ A;  4E47 A;  1G5V A;  5GAN d;  2LTO A;  4EMG A;  2OTL A;  4C0D C;  1NJI C;  2RK2 A;  4QQG A;  4C8Q A;  2K5I A;  3T9N A;  2QEX A;  4PJO E;  4M78 B;  3WXM B;  3OYM A;  4J6X A;  1QVP A;  3CCM T;  4LDU A;  1YJN T;  1VQ7 A;  3CCE T;  3J7A F;  3C94 A;  3CXC A;  4JRI A;  1WNL A;  4MML A;  1QP2 A;  4M78 F;  4IUU A;  2VV5 A;  2RHX A;  3L2V A;  1VQ6 T;  4BDZ A;  2RI2 A;  2YLB A;  4M7A B;  3QKJ A;  2LC4 A;  5CQX A;  1V29 B;  5D6W A;  4J8O A;  4EMH A;  3DLL A;  4EDU A;  4BAC A;  2VXE A;  3A5Z B;  4J6W A;  3M55 A;  1I8F A;  4M78 A;  3JCM f;  3CCU T;  2K4Y A;  2DXT A;  2ZCF B;  2DTO A;  3I55 A;  1FX7 A;  2CKK A;  2P4T A;  3L2U A;  2DTH A;  2XID A;  2QDY B;  4C8Q G;  4PKC C;  3J80 E;  5M9O A;  2MAM A;  1VQL T;  2E70 A;  4PJO B;  4D6W A;  2OAU A;  3OYG A;  3M53 A;  5DM7 R;  3LWH A;  4M7D D;  5IN1 A;  5J26 A;  4EPC A;  2XG8 D;  4FT2 A;  3A8O B;  3KXT A;  1EIF A;  2E6Z A;  5LJ5 f;  1BIB A;  3S6W A;  1JB0 E;  3EFR A;  4MMK A;  3FIF A;  4C0D B;  1KQS A;  3G71 T;  1GXI E;  3HRS A;  1JJ2 S;  4NS5 A;  3V8J A;  3X28 B;  1LOJ A;  4II1 A;  1YJW T;  3CCS A;  1QVF A;  4M78 G;  3OYY A;  2JUF A;  2D0Q B;  5CQY A;  1VQ9 A;  2CZ0 B;  4MZT A;  2DTI A;  3TCJ A;  5CKH A;  3CCQ A;  1VQO T;  3M59 A;  2GCX A;  2PU9 B;  3CCR A;  5GAN 3;  3OSS C;  3CCL A;  3KUF A;  3ZBD A;  4ZGJ B;  1YJN A;  4M7A G;  4ZN1 A;  4ELY C;  2DEQ A;  2JZ2 A;  2R57 A;  4GY5 A;  2EAY A;  3PTA A;  2V8J A;  3JCM W;  3KBG A;  2DXU A;  3V8K A;  2VC8 A;  3CPF A;  2D9T A;  2A3L A;  2Y4Y A;  3RKY A;  2EIF A;  3JCM X;  1Q86 U;  4N4G A;  1VQ4 T;  4HCZ A;  2R5M A;  4M77 D;  4HKE A;  2CZ6 B;  2F5K A;  4XTV A;  4PJO G;  2WSC E;  3QJY A;  2ZGW A;  4BY6 C;  2KMT A;  1TH7 A;  1WPY A;  4TVR A;  3WVE B;  4QQ6 A;  3Q1J A;  2L8D A;  4J7I A;  3X25 B;  2K2V A;  2O01 E;  1M1K U;  3UT1 A;  5CKF A;  4Y91 A;  2RJD A;  3BDL A;  1QP3 A;  2XDB A;  1Y96 B;  1FWZ A;  1RL2 A;  2GF7 A;  2LVM A;  2WAC A;  3OYL A;  2EWN A;  3G6E A;  3L2R A;  3FDR A;  1PSE A;  1UB4 A;  3OYK A;  1G3S A;  4PLL A;  4ZTJ A;  5L8R E;  1YJW A;  1OYX A;  1KQ2 A;  1Y96 A;  4DA4 A;  2P0K A;  3C4S A;  4OP0 A;  4XTX A;  3JCM g;  4IKF A;  2X4X A;  3BY7 A;  3LWI A;  2QXF A;  3OYH A;  3JB9 F;  4RG8 A;  1M9S A;  3OYJ A;  3JCM d;  4OGC A;  3ASK A;  2EJG A;  3UPU A;  4ZGE B;  1K8A U;  2D6F A;  4KT0 E;  5LJ5 g;  1KG1 A;  1N6A A;  2K5L A;  4B9W A;  4C5E A;  3L2W A;  2LRQ A;  3INZ A;  4IUQ A;  2MWO A;  4OB0 B;  4XU3 A;  3JSC A;  3HP9 A;  4OB2 B;  5FRO A;  5LJ5 e;  2DAQ A;  3JCM b;  4GLK A;  1KD1 C;  5FRM A;  2OTL T;  4WF2 A;  2DJZ A;  3EFS A;  3GP8 A;  1VQ5 T;  1XTD A;  3P8D A;  3CXC S;  1ZBX A;  2EQU A;  1Q82 C;  1VQ7 T;  5A2Q E;  4ME7 A;  2IG0 A;  2M0O A;  3X24 B;  1BKB A;  4C8Q E;  4RCB A;  3E1S A;  1XNI A;  2QA4 A;  5GAM j;  5A0G A;  1LJO A;  5I21 A;  1Y7X A;  5GAM f;  2HBP A;  4M75 C;  3GNF B;  3CEY A;  4IUT A;  4QW2 A;  3OY9 A;  5LJ5 h;  3E9F A;  4HT9 A;  2LX9 A;  3GLX A;  4HCB A;  3N5B B;  4E7L A;  3F70 A;  5IAY A;  2QQA A;  2C06 A;  3AHU A;  4M7A D;  1XOV A;  3OQ5 A;  2BKD N;  2DPP B;  4A4E A;  2FB7 A;  2QTX A;  4A4G A;  4ZGD B;  3I55 T;  3GOX A;  5KCH A;  2YRV A;  4BE2 A;  3MEV A;  3HSB A;  4M78 E;  3OSV A;  1Q7Y C;  2JN0 A;  3OS0 A;  2K5F A;  2FHD A;  3GIB A;  1RI0 A;  4JLI A;  2EJF A;  4PJO D;  2XHC A;  3JRZ A;  1I5L A;  1QVF S;  4J83 A;  4QVZ A;  3M5A A;  3CD6 A;  2DVE A;  1KHC A;  3CCS T;  1UGR B;  1VQ9 T;  1VQK A;  1Y71 A;  2CYZ B;  2G3R A;  3CCQ T;  1BI1 A;  1YBY A;  1VQ5 A;  3HFN A;  1VQP T;  3HHT B;  1N8R U;  3CCR T;  3CCL T;  4P5N A;  3GF5 A;  4DOV A;  1BI3 A;  4VUB A;  3RIR A;  1M90 C;  3MO8 A;  1IZ6 A;  1X01 A;  3M4Y A;  3QJ6 A;  4BD3 A;  5GAO l;  3OYB A;  2MI6 A;  4X9C A;  4FIB A;  2RHY A;  3V7C A;  1ZHI A;  2RD1 A;  5GAN 7;  4XTY A;  4M75 F;  5I2S A;  5GAN h;  4JS4 A;  1KC8 C;  4MZP A;  4XTZ A;  1G3W A;  5LJ3 j;  3QII A;  3VKI A;  3HPW A;  2M9U A;  2P0P A;  2X4Y A;  2GFU A;  2QQ9 A;  4Y28 E;  5LJ3 f;  3JCM Q;  3X26 B;  3CPW A;  3VUB A;  2K3X A;  2L89 A;  4M75 A;  3OBY A;  4ATO A;  2F69 A;  2EFI A;  3L2Z A;  1VQM A;  1VIE A;  3MCA B;  1U1S A;  1W2B A;  5HK0 A;  1WQ7 A;  3P8H A;  4JDS A;  4RG2 A;  2JOY A;  5CKB A;  5FU7 C;  5CKE A;  5GMK j;  3JB9 I;  2E6N A;  3QHS A;  2E64 A;  4J6Y A;  2DZC A;  3VJP A;  1BYM A;  3OS5 A;  3SWN C;  3G6E T;  2KQW A;  3RMQ A;  3LGL A;  5GAN 6;  5GAN 4;  1O75 A;  5GAM g;  3TU4 K;  5FLX E;  1K9M U;  3NTH A;  1B34 B;  1PSF A;  3RES A;  1M4Z A;  4MDW A;  2VGN A;  3QYG B;  3FJP A;  2PVO B;  2XI9 A;  2PVD B;  2JVV A;  4M75 G;  5GAM d;  4OGE A;  4NL3 A;  4E7J A;  5GAO p;  1VQP A;  4Q5W A;  3FEO A;  1I81 A;  3CC7 A;  1U1T A;  3LGF A;  3WVD B;  2E12 A;  1B34 A;  2B8A A;  2X35 A;  3ME9 A;  2E1H A;  4A4K A;  5DLO A;  5CK9 A;  4N0A C;  3PT9 A;  5GAN 8;  1IRE B;  2HNI A;  2RB6 A;  4M7D C;  2RJE A;  2E10 A;  1YI2 A;  1S72 T;  1UEB A;  3SB2 A;  2NLU A;  3PNW C;  3MP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...