3URGA

The crystal structure of anabaena ccbp
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
126
structure length
123
Chain Sequence
MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ellman's reagent in promoting crystallization and structure determination of Anabaena CcbP.
pubmed doi rcsb
source organism Nostoc
molecule tags Metal binding protein
molecule keywords Alr1010 protein
total genus 37
structure length 123
sequence length 126
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11535 Calci_bind_CcbP Calcium binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.530 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3urgA02
2K2VA 2P0QA 3URGA 2P0PA
chains in the Genus database with same CATH superfamily
2CP7A 4M75D 1D0YA 2CT4A 3CC7A 1ZUKA 1JRIA 3JB9J 2EVRA 1QVGA 4X9CA 1FMVA 1U5SA 2JW4A 3EG3A 3QBYA 3ME9A 4OMQA 1WIEA 1K8AU 4M78G 1ARKA 2RHIA 2MWOA 3VYGA 2IVWA 3BY7A 2OAWA 2RK1A 3JSCA 3M58A 1TS9A 2GNCA 1AT1B 1VQ9A 1FYNA 2OTJQ 2PZ1A 1JXOA 2DTHA 3J80E 4MDWA 3VS6A 3QWXX 3ZL7C 5GANe 1KC8R 1K1ZA 2D1XA 4GY5A 2VXEA 4M7DF 3H6ZA 1Q81C 1KHIA 2X35A 4C0DC 3OY9A 2EKHA 3UPUA 2R58A 1TTHB 3CQTA 4OMLA 1VQ7A 3A8LB 2LCLA 2ZPEB 2BUDA 4KRTA 2K2MA 1UEBA 1E7OA 1VQKA 4OMNA 2L3PA 3OYIA 3VS5A 4J7IA 3CCJT 4FW2A 5GANh 3S3OA 1TH7A 1NG2A 2J06A 2QEXA 4J9HA 3G71Q 1Z9ZA 5LJ5j 2QYZA 2CS7A 1C1AA 2E12A 2IPOB 2CGHA 2FZGB 2OAUA 3UF4A 1VYTA 2CZ7B 3GNFB 2RQVA 4C0DB 3UT1A 4M7DD 4ZTJA 3DLMA 1RI9A 2HQEA 4JUVA 2K2VA 3VUZA 3M4GA 2DERA 5IXFA 3UWNA 2YUQA 4HVWA 2DXCA 5HKCA 3MO8A 4A4KA 3M0UA 4GBQA 1VQPQ 3OYCA 4B9WA 3CCUA 2A7YA 2K6DA 2JN0A 3L2QA 1R0BG 4ATOA 3NPFA 4DOVA 2LC4A 3N5BB 1ZHIA 2GFUA 3EH1A 4NL2A 2ENMA 5GAN6 1W70A 1M3CA 1YNZA 1N8RC 3EFSA 2E70A 4RTVA 4IIMA 2JT4A 1HYOA 2P0QA 4DBRA 4EMKC 2L89A 5IHIA 4ZGJB 1NJIR 1VQ8T 2V1RA 2KRSA 1AWXA 2KNBB 3KBGA 4QVZA 3MEWA 2F1LA 1Q81U 2YSQA 2DBKA 2LZ6B 1Q82R 3EGDB 2FPDA 3EGXB 3CCLT 3DLLA 1D09B 2CP0A 2RB6A 1N8RU 1YCYA 2KSSA 2F69A 2HL5C 4F17A 2G6FX 3PVLA 2HCKA 5FRNA 3URGA 1UGVA 3HL8A 2J6OA 1UGPB 2EPDA 2HQHA 3U23A 4E6RA 2DKGA 3E2UA 5C6SA 1FWZA 1QWFA 3OW2A 1B07A 2B86A 1AEYA 4LDXA 2I0NA 2SRCA 5LJ5h 2HDAA 2V26A 2HMAA 1KQSP 1WXBA 5I2SA 2DXUA 4J8OA 2EYQA 5CQXA 3QDFA 1KC8C 3P8HA 4F7UF 1RABB 3M57A 1NM7A 4WF2A 1ZSZB 1MV3A 3CCMA 2JUFA 1YJ9Q 1LPLA 4C5HA 3PIOA 4JLGA 1V1CA 2HBWA 2O4XA 4JZ4A 2D0NA 1LJOA 1TSFA 3QYGB 4M75B 3RKWA 3GP8A 3TREA 3RMSA 1OYXA 5DLOA 2QGFB 3CCQT 4DBHA 2GQIA 2PNIA 4RMOA 1R77A 2CZ1B 1XQHA 2BIVA 1QWEA 3LX7A 1VQ6Q 2YRCA 4AG2C 4J9FA 2NUTB 5LJ5e 1ZUYA 3BE3A 4LDVA 2E3IA 1EZZB 4FIBA 4Z8AA 2XICA 2KDSA 1Q95G 1SHFA 3VKIA 4E7ZA 4V2SA 3L2RA 4M77B 1G3SA 5GMKm 1K8AR 1VYUA 3A8MB 3QJYA 2AK5A 1MNDA 2DIQA 4J6XA 1YIJA 1X2KA 1Q86U 4M7DB 3O5ZA 3VRZA 1GFDA 1RAHB 1JU5C 3QJ6A 2FYKA 2QQRA 1JB0E 4A54A 4KGXB 5I22A 6AT1B 1N9SA 3JCMd 1E6HA 3CBPA 2X4YA 4EMKB 1B3QA 2CP2A 3CCVA 1I4K1 4QT7A 5IHNA 4XK8E 5GAN2 3L2VA 1JJ2S 3PMTA 3C4SA 2P4RA 3MPUB 2K5IA 3C94A 3FIFA 1AHJB 1W2BP 3NTKA 5GJWB 2DJZA 1O9SA 1OPLA 3PIPA 1JBMA 2RI2A 2CUDA 3HKSA 1UDLA 1N9RA 3MP8A 2LJ1A 2XDDA 5J26A 4BUGA 2LVMA 1U1TA 1WYXA 4MZPA 4OB0B 3S3NA 1M3AA 4CC7A 2H8HA 3OS1A 1YI2Q 4K11A 5GAN8 4FU6A 3OSVA 3UDCA 1GL5A 3DKMA 4KGZB 2AKLA 2DFUA 5KE3A 4MMLA 1KK7A 1X2QA 5EG2A 3ULRB 1K76A 1TUCA 4DBFA 1QLYA 5GAMg 1MMNA 4EMGA 1H92A 4M78B 1W2BS 4ESRA 4QQ6A 5EC7A 4EPCA 3CXCA 1Y07A 1AWJA 3RR6A 2W10A 3OYNA 2VWFA 3P8DA 1QQJA 1KG1A 2CREA 4JDSA 1VQ7Q 3NFCA 3MKDA 1K8AC 1SG5A 3L42A 3I9QA 2YUOA 3QIIA 3QZ9B 2BTTA 2E65A 3I55T 2M9UA 2EBPA 2MK5A 3OB9A 3CC2Q 4ELZC 1ACMB 3H41A 5KYUB 3D7SB 1I5LA 3Q1JA 1TUDA 2RA2A 1VQ9Q 3QWYA 2QDYB 2KBTA 4PL6A 2BE7D 2JTMA 2FL7A 3GF5A 1WHJA 1YHQT 3A5ZB 5I2MA 2FZKB 1SPKA 4AFZC 4IKFA 1RACB 3QDRB 1M5Q1 3VS7A 1I81A 1MGQA 1Q7YR 3GNGA 2DA9A 5DLQE 4M75E 1VQOA 3GBQA 5FU7C 2O88A 2X3WD 5LJ5f 2F2XA 2QQAA 4FL6A 4OB2B 2QTXA 4M78C 5IT9E 3EG1A 2LX7A 1M1KR 2O9VA 3QG1A 1TU0B 3JCMQ 3SDZA 1GCQC 1Q86R 4VUBA 2QXFA 1QKXA 4B9XA 3M0TA 5AT1B 2LQWA 3VS1A 4O5VA 5GANd 4PFZA 4C0FA 5CKEA 2DPPB 2JS2A 2DL4A 2IG0A 2JMCA 4HCBA 1OEBA 3TCJA 1X69A 5GMKj 2FZCB 2RPNA 4HCCA 1RI0A 5J39A 1KSWA 2PUKB 1WJSA 4E47A 3OYKA 2COYA 4NOYA 2C0IA 1M1GA 3JCMe 3HP9A 3R6OA 4RTXA 1PSEA 2X9HA 1BI3A 5DM7R 3NMZC 1BIAA 1G8XA 2DEUA 2CSIA 1NZ9A 1PSFA 4TVRA 2RQRA 4A4HA 2FRYA 1S72Q 1BB9A 3CCVQ 3CXCP 1PNJA 4M7AD 4M77D 3CCMT 4PJOB 4C92C 2A28A 2LMJA 4C92A 4DA4A 4BI4A 5FROA 1X6BA 4J5YA 1NLOC 2BZ8A 2VGMA 1VQLQ 3UATA 1WI7A 3A1PA 1M90C 2DLPA 4YTLA 2BE9B 2P0KA 4NL3A 2DX1A 2LTOA 1ZBXA 3AT1B 2VASA 1VQOT 2ZPFB 5KYNA 2EJ9A 4OGCA 2C0OA 2VVKA 2PVOB 1ABQA 4BI8B 2ZPIB 2RHUA 3H8ZA 3JCMV 2KYMA 1YWOA 2YLBA 1HXDA 1PKTA 1BK2A 3ZEHA 2ROLA 2HEQA 2E5KA 2XG8D 3EHQA 4KGVB 3EFOB 1K0SA 1PG5B 1VQNA 2PTKA 4UC4A 4HCKA 4J7FA 2JVVA 4RCBA 4RUGA 2DO3A 3CCLA 4JLIA 3G7ZA 2RJCA 4BACA 3M53A 1PD1A 2EJGA 5IAYA 3I56A 1OX8A 1Z9QA 3CCRQ 3SWNA 2RK2A 1D1CA 2CSQA 4LUEA 2CT3A 3G6EA 4C8QB 3HRSA 1RAEB 1M1FA 1M27C 3F70A 4PJOE 1GCQA 2A36A 3OMCA 3MEVA 4ELYC 5CK9A 1VQ8Q 4M78A 2ESWA 5CKDA 2DZCA 2DYBA 1WJRA 2F2WA 2XDPA 4XU2A 3EFRA 1WJQA 5FW9A 2DTIA 3ZFJA 4M75A 2RQWA 1M90R 3LLRA 2RO0A 3OQ5A 4DQ2A 2JJ9A 1IHVA 5FU6C 4F7UE 2M0OA 2DRKA 5CIUA 1QVFA 3LWIA 5LJ3g 3G6EQ 1F1BB 2EYYA 2DM1A 5KE2A 1K73C 1IO6A 1GCPA 1I1JA 2CH4W 1K0XA 4CC2A 1ZA1B 2DVEA 2FB7A 1JXMA 2RI5A 3MEUA 5GJVB 1S1NA 4R55A 4M7DG 1KJWA 4J9IA 2M1HA 2RD1A 1WLPB 4M77G 2X4XA 3LGLA 4KUDK 1PHTA 2HKQB 2HSEB 1K9MR 2R57A 4LD9K 2KRMA 1QCNA 1RUWA 3CCVT 4DEXA 5I21A 2YRDA 3V8KA 3CC7T 4HXJA 2EGEA 5I11A 2PUOB 4PJOD 1RAGB 4A4EA 1C0MA 1HK9A 4QVCA 1JQQA 3G1JA 2O2OA 2ZGWA 3CMAT 3CD6A 2DJQA 2OTJT 1MUZA 3A8OB 3NHNA 3CC7Q 1VQ6T 2ED1A 2MPXC 2EGAA 1M3BA 1X6GA 3UA6A 2AKKA 2X3XD 4LXCA 2A08A 3FDRA 2O9SA 4IIOA 7AT1B 2NUPB 1YHQQ 4L6V5 5CVIA 2KAFA 2D8JA 1WQ7A 2DD4A 3M59A 1S72A 2M0YA 2RF0A 4BD3A 3CMAQ 2QQBA 1WHHA 1M90U 2DTOA 2MYSA 3OMGA 4ZGDB 4J9EA 5FRMA 2LQ8A 1IGQA 4HVUA 4M7AF 2F5KA 1Q7YU 2PVGB 2XMFA 4FYXB 3OS5A 2YHTA 1WHMA 3TSZA 2DEQA 4EDUA 3JV3A 2WACA 4RTTA 2EQUA 2KT1A 4PFOA 1G2BA 1VQ6A 2DMOA 1TXQA 1FX7A 1OQKA 3EH2A 2KYBA 3CMAA 1QVPA 4M75G 2COWA 5FWBA 5KYWB 3L2WA 2ECZA 4LD6A 4MMKA 3OYLA 1UHCA 3E1SA 3OS0A 2Y4XA 1LNXA 1MMGA 1MMAA 2Y90A 2FHDA 3CMEQ 4OMMA 4M75C 2OJ2A 3CPWA 2ZCFB 4E7LA 3OBWA 2E6ZA 2CYZB 4XTWA 1OI1A 1T0JA 1FXXA 4KH0B 3JCMc 5LJ5g 3CCUQ 1OX9A 1YJWT 4Z02A 2QQ9A 2DAQA 1VQ5T 2LX9A 1YJNA 3BW1A 1N5ZA 2C0TA 5KYWA 1U8RA 4LE9A 1NYGA 1XTDA 1YJ9T 2KXDA 3VV0A 1BYMA 1ZA2B 3EG2A 5AYFA 1GFCA 1WX6A 1RLQC 2FVUA 1Y71A 4OMPA 4C8QC 1WA7A 5D7UA 3CCQQ 4LDUA 3JRZA 5CKFA 2D9TA 1ZSGA 1M30A 1BI1A 1W1FA 1QVGS 4PJNA 4X9DA 5HCKA 1YI2A 2A37A 3QUIA 2B8AA 1UTIA 2V8IA 1P92A 2K79A 4KT0E 5D6WA 1G3WA 4D6WA 4ME7A 1Y57A 1NEGA 2OI3A 1A0NB 3VS3A 2DNUA 1NEBA 2YUNA 3HRUA 4O6JA 5GMKh 1Q7YC 1KQ2A 1YP5A 3EAEA 2FPEA 4BDZA 1Y0MA 1BU1A 1SHGA 3BDLA 3EHRA 1W4SA 2XU8A 3RKYA 1VA7A 2LDMA 3TVTA 5A0DA 4M4ZA 2QEXQ 2EQKA 3UA7A 5IH2A 1R0CB 2YUPA 3KXTA 3M0PA 4XAXB 4C92E 1IRXA 1R8OB 5GAMh 4NS5A 4XTUA 1ZQ1A 2E5QA 1SRLA 5HK3A 2QEXT 5GMKl 1ZLMA 4Y91A 4KULA 4KH1B 3CMET 5GMKe 3OYGA 1PWTA 2KE9A 3QZ5B 4M7DA 1UJ0A 3DB4A 1PD0A 4J83A 4OB3B 4DEYA 2CZ0B 4BE1A 1BIBA 3IQLA 3S6WA 1VQKQ 5J3BA 4A53A 3CC4A 4DBQA 4C8QA 1H3ZA 4FYYB 5LL6S 1VQ7T 3JAME 2JOYA 2L2PA 1MV0B 5KH6A 1X43A 3OYJA 1W6XA 4RKUE 3THKA 2CP6A 4BE2A 1Y7XA 3E9GA 2XIDA 2EKOA 3A8GB 1YJNQ 1UGSB 3E19A 4E7HA 2VUBA 4XTXA 1YJ9A 3RKXA 2DE0X 1OOTA 1M9SA 2DL5A 2LCCA 3META 3I5SA 5CCAA 1KD1R 4FSXA 4XU0A 4RTUA 1VQ9T 3EGDA 1OU8A 1TG0A 2K3YA 2GCXA 3V8LA 1I5OB 2MI6A 2EQIA 2LT1A 4CI0C 1RLPC 3EG9B 3QO3A 2KRNA 2VYTA 4II1A 1QP2A 1QKWA 2XHCA 2X4WA 1T0HA 1SSFA 1K73U 3JCMb 3HTRA 4E7JA 4PLLA 4PJJA 3A8HB 2OTJA 2HKNA 5FU7B 3GPLA 1YWPA 3CPWS 2QG9B 4A4GA 1U1SA 3M56A 3MJXA 1X27A 1PCXA 4M77E 5GAMd 4JRKA 4OGEA 2DL7A 4HKEA 1Q82U 1QCFA 3WVEB 2ED0A 3SFMA 2X4JA 3VS0A 3MP1A 4F14A 3TEEA 1M2OA 3SEMA 2QA4A 3PE0A 3L2ZA 4BI3A 4FCYA 3AHUA 2AHJB 3GIBA 2DVJA 3RERA 3PGGA 3OYYA 3PFSA 1RADB 2K7AA 2HSPA 3JCMW 1OPKA 1XOVA 3T9NA 3CCSQ 2O31A 1YHQA 1VIFA 2CUBA 3P8BB 3M4YA 1BBZA 1WQWA 4C92D 2W0ZA 2EQMA 1VQ4A 3FEOA 4D8KA 1IB8A 3CD6T 1WNLA 1CKBA 2OTLA 1KC8U 3JB9F 2QASA 2GBQA 4C5EA 3OYEA 4BY6C 2LCSA 3OW2S 3S3MA 1VOMA 2ZPGB 5LJ3f 2J05A 4L59A 1VQNQ 5GMKi 1UG1A 2M02A 1GBRA 4XTYA 4A4FA 3TU4K 4HCZA 1UUEA 3CCMQ 1KHCA 2KXCA 3VS2A 2CDTA 2YWWA 1AD5A 3CCEQ 2P4TA 4M78D 4J9DA 3LW5E 3CCRA 4ZTFA 1D0XA 3CPFA 3PVQA 2D0QB 1VQLT 2RMOA 1O75A 4IUVA 1YITQ 3JCMf 4C92F 4WTOB 2QAZA 1WHKA 3M9QA 4C8QF 2RQUA 1VQOQ 1NE8A 1IGUA 2NYSA 2MWPA 1UB4A 4BE0A 3EG0A 4HA8A 3RIRA 4ZGEB 2LRQA 1Q82C 2V8KA 3LH0A 3GLXA 3CCEA 4N4IA 4OB1B 2K3BA 1Y96B 4IUPA 1OZ3A 2EAYA 5CR2A 4J9CA 5D6XA 4DOWA 5KCOA 4KUIA 1LVKA 2QA4Q 2DZ9A 2RH2A 2LT4A 1K9AA 1QVGP 1NPRA 4F16A 1JO8A 5GAOn 2SEMA 1WXTA 2P84A 2DL3A 3WXMB 3MP6A 4FT2A 1PM3A 1ZBJA 2C06A 2LQKA 3SWNC 4OP0A 2RM4A 1M8VA 3C95A 3VU3C 3FJ5A 8ATCB 3KFVA 2KK4A 3BFMA 4ANJA 3L2UA 1SSHA 3PT9A 4M77A 4OF1A 4FSSA 2O4XB 3X28B 3L1AA 2L8DA 2RQTA 2AZSA 5LJ3d 1WHLA 5GAN3 2YXYA 4PK4A 3SB2A 1SF9A 3VRYA 1UECA 4ZNXA 1UGQB 4ORZA 4F7UA 4JRPA 2KVQG 2BZXA 2WSFE 3ASKA 3RNJA 3SD4A 1FMWA 1WFWA 3RESA 1AWOA 4C92G 2NUPA 1I8FA 5CO7A 3H0IA 3M0SA 2RJDA 4IUUA 2RN8A 1MMDA 1V29B 2FEIA 3RMQA 3G6ET 2QK0A 3OBYA 3CCQA 1K9MC 4M7AB 2OX7A 5KYYA 2LJ0A 3HPWA 1BKBA 2G3RA 3I56T 2JTEA 5A0GA 4EMKA 2GTJA 4OVAA 2IIMA 2QI2A 3I55Q 2K5LA 2E64A 4BY6B 4N4HA 1VQPT 1VQNT 3JB9G 2JTFA 2JMAA 5HY6A 1NPPA 2H3EB 3CC2A 1K73R 3OS2A 5LJ5d 2NWMA 2GF7A 3LGFA 4AFUC 1DJ7B 3JB9I 9ATCB 1QW1A 3LWHA 2QDLA 5ECAA 3M55A 3HSBA 2WSEE 1X6OA 3OW2P 4Y28E 1TWBA 1VQ4Q 1HJDA 1BI2A 2AIRB 4LUDA 3LYIA 1H8KA 3MHXA 2KMTA 1QP3A 5GANf 1KQSA 2L3SA 3CC2T 4M7AG 2YLCA 2RJFA 2K3XA 1Q81R 4R56A 4M7DC 1SRMA 2XK0A 2ZZDA 2COZA 1G3TA 2E6NA 4Q5WA 5GAOq 2EJFA 3CXCS 4PJMA 2ABLA 4C92B 2EWNA 1HD3A 3FLGA 2R5MA 3LH5A 1TOVA 2DILA 3RBBB 1ZX6A 3OSSC 3M54A 4M7AC 4IURA 2DBMA 4IUTA 1WZOA 3VYHB 3OYAA 2MCNA 1PRLC 2DRMA 2I2LA 5GAMj 2E3HA 1ZSZC 4J9GA 3EGUA 4JJBA 5KYXA 1KQSS 1IREB 4C8QG 3NGPA 3REBB 4J6YA 1EIFA 1Y96A 3CPWP 1LCKA 2HNIA 3ZBDA 4CC3A 3REAB 2MMPA 4E7IA 3CCET 3QXEB 5GANg 1JEGA 1B34A 3EGXA 1UJYA 2JM9A 2LNHB 3EFOA 2XDBA 3M0QA 1WPYA 1C6VX 3QYHB 3OA6A 5GAN4 4FW1A 3FJPA 3I55A 3HRTA 2LP5A 1V76A 3V7SA 4JPBW 3KUFA 3VUBA 3CD6Q 3I56Q 2D8HA 1VQLA 2VXFA 2LJ3A 2EYZA 4Y92A 4GLMA 4RTYA 4JJCA 1VIEA 3CCJA 3WVDB 2LQNA 2RNAA 3JCMX 2HD0A 1AZGB 1SEMA 1RAIB 2JNGA 3QHSA 4R0KA 1UFFA 4EMHA 4PLIA 4LDWA 1MHNA 5CAIA 1NBEB 2VKNA 2KROA 1QMCA 1AOJA 1RAFB 3JCMP 4M7AE 4C5IA 2HAXA 3INZA 5DY9A 1ZUUA 5GAOr 1X01A 2HQXA 4OMFB 4HT9A 2XKOC 3X25B 3CCLQ 1WGSA 1UHFA 2HBPA 1D1BA 4E7KA 1D0ZA 5L23A 1CKAA 4E2FB 3PMIA 4AFQC 2PQWA 1Q86C 2FO0A 2H3JA 2BZYA 4PKCC 4XQ3A 3CCRT 2CP3A 4Z88A 4M78F 1UE9A 2NUTA 1M8MA 5FLXE 1QCOA 2ZPHB 5A0LA 3OYMA 3A98A 4QQDA 1W2BA 1EFNA 4L5GA 2JXBA 5FWCA 2MIOA 2QA4T 2CP5A 5KYUA 1M2VA 2L3QA 3BDUA 1JJ2P 2OTLT 2XD0A 5M9OA 4Z89A 1N8RR 4QKUA 3M5AA 4N0AC 2F5TX 4FT4A 2YRVA 2YDLA 1NYFA 4PNOA 1D1AA 3QSUA 1H641 4CC4B 3V7CA 1N27A 2RHYA 5LJ3e 3JCMg 4C8QE 3NTIA 2YT6A 4X1VA 3X24B 2EGCA 3X20B 5C0MA 3TQ7P 4PJOC 2P0PA 2EYWA 4HT8A 3J81E 1BI0A 3C12A 3QPHA 3CBMA 1AWWA 2GFAA 1G5VA 2KR3A 1WXUA 3G71T 2V1QA 2VC8A 1YJWQ 1ABOA 1T3SA 1NLPC 4F7UB 1LOJA 2GTOA 4XU3A 1U3OA 2KT8A 1KIKA 4MZMA 1B7TA 3H0FA 4A63B 4AG1C 1G83A 1YIJQ 4LNPA 2FRWA 2F2VA 5LJ3h 1WDXA 2RHZA 1D3BA 3SWNB 2KQWA 1BCOA 2FPFA 4JS4A 1GXIE 2K4YA 2ZPBB 5GAN7 1NJIU 1YIJT 1VQ4T 3O8VA 1IZ6A 3CCSA 5HK0A 3MCAB 5KYYB 1OZ2A 1FMKA 4JRQA 2E41A 1GRIA 1AZEA 4WCIA 2J7IA 3OYHA 1ZSZA 4BDYA 4PJLA 1RL2A 5CQYA 2L3RA 1K9MU 1QVFS 1UGRB 4MZTA 4AFSC 1NJIC 4C0ZA 4AMCA 4QW2A 1PRMC 1E6GA 3HHTB 4XTVA 3M0RA 1D3BB 4AT1B 1SKUB 4FYVB 3CMEA 2HL3A 5KYXB 1EX4A 2DF6A 1VQPA 5GAOl 4HVVA 3SHWA 2KI7A 4RCCA 2DXBA 2A3LA 2HZYA 2QTVA 2VV5A 5KCHA 4M7AA 2NUZA 3JCMh 1VQ8A 2AT1B 2CZ6B 1M1KU 3I35A 1MNEA 2MOXA 3X26B 1BCMA 1TUGB 2DD5A 2KGTA 4C5GA 4F7UG 4QQGA 4EIKA 2L5QA 5GAMe 3R6NA 2KEAA 4ZN1A 3TSWA 3I5RA 2J6KA 1YCSB 3OYBA 2LNVA 3G4ST 2RHXA 4JS5A 3E9FA 4JJNK 1YI2T 2DK3A 3CCUT 4N4GA 1XNIA 2K9GA 4LN2A 3G4SQ 2EW3A 1KD1U 3QKJA 1I0CA 4XU1A 1AVZC 5D6YA 3HFOA 4RTZA 5IHKA 2DIGA 2DETA 4GLKA 4C0GA 5A2QE 1OV3A 2QGGA 1OULA 2JS0A 1IHWA 1HSQA 1YJNT 3ER0A 2NLUA 4LDYA 3PNWC 2M16A 1B34B 3CC4T 3FC3A 1KQ1A 2O01E 4MDXA 3HFNA 4FYWB 2J6FA 3G4SA 1WHGA 2CH4A 2JZ2A 2V8JA 4IUQA 1K4US 3CBOA 2E10A 1YN8A 1YFNA 3V8JA 4JJDA 2EIFA 4P5NA 2Y4YA 3JCMJ 1YBYA 3DB3A 5GAN5 2VB6A 1X75C 5CKBA 2EYXA 4RG2A 4M78E 4M77F 1M2VB 1H3HA 1RAAB 1PKSA 3CC4Q 2BKDN 4M77C 2MAMA 4M75F 2PVDB 4BB7A 4F04B 1IXDA 2Z0WA 1KD1C 2GQVA 2XI9A 4C8QD 1VQ5A 8AT1B 1XJWB 2K57A 4RG8A 1YJWA 1M1KC 5IXBA 2JM8A 4PJOA 4E7SA 5GAOp 3H9NA 4OMOA 3OYDA 1J3TA 5CKHA 2KY9A 3RDVA 4XTZA 2CKKA 3EG9A 4RTWA 1JJ2A 1I07A 1VQKT 2L0AA 1OU9A 3PTAA 2ROTA 2R5AA 3FB9A 2FG0A 2M51A 2WSCE 2QQSA 3C0CA 1VQMQ 2EQJA 4J9BA 4QVDA 4D8DA 2ATCB 4J6WA 2DXTA 4B6MA 3NTHA 3GOXA 2D6FA 4PJOG 3CCST 1T3LA 2E1HA 5LJ3j 1VQMT 5L8RE 2OTLQ 4JRIA 4KBMB 3JB9H 4N0AA 1GBQA 2RJEA 4JZ3A 1VYVA 2A0FB 3V7RA 5GANj 3JB9D 2VGNA 1CSKA 5FU6B 4ZN3A 1G3YA 4X34A 3VS4A 5GAOm 4FM4B 2DYIA 1M4ZA 1U06A 2AZVA 1VUBA 3VJPA 3G71A 1YITT 2DL8A 2GGRA 1VQ5Q 3H0HA 1N6AA 5GAMf 4PFPA 1YITA 1S72T 1PC0A 3CCJQ 4CRIA 3J7AF 3MEAA 2K5FA 3RUXA 2EFIA 2PU9B 2MF2A 3CEYA 3FRNA 4PJOF 2E4HA 4M7DE 5IN1A 1KFZA 2X51A 3OYFA 1VQMA 1QVFP 2RI3A 2ZAEA
chains in the Genus database with same CATH topology
4VUBA 4A53A 4M75D 2QXFA 3CC7A 1JRIA 3JB9J 3CC4A 4C8QA 1H3ZA 1QVGA 4X9CA 4B9XA 5LL6S 1VIEA 1VQ7T 3CCJA 3JAME 3QBYA 2JOYA 3ME9A 4O5VA 5KH6A 5GANd 4C0FA 3WVDB 5CKEA 1K8AU 3OYJA 2DPPB 4M78G 4RKUE 3JCMX 2HD0A 4BE2A 1Y7XA 3E9GA 2IG0A 2RHIA 4HCBA 2MWOA 3VYGA 3TCJA 2XIDA 5GMKj 2EKOA 3A8GB 2IVWA 4HCCA 1UGSB 2JNGA 3BY7A 3QHSA 2RK1A 3E19A 3JSCA 3M58A 4E7HA 2VUBA 4XTXA 1RI0A 5J39A 1YJ9A 4EMHA 3RKXA 2PUKB 4PLIA 1WJSA 4LDWA 1MHNA 1VQ9A 5CAIA 1M9SA 2DTHA 4E47A 3OYKA 2LCCA 3META 1VQLA 3J80E 5CCAA 4NOYA 4FSXA 4MDWA 4XU0A 3JCMP 1VQ9T 4M7AE 1M1GA 3JCMe 3HP9A 5GANe 3R6OA 2K3YA 4C5IA 2HAXA 3INZA 5DY9A 2GCXA 3V8LA 1PSEA 5GAOr 1BI3A 1X01A 4GY5A 5DM7R 2VXEA 1BIAA 2HQXA 2MI6A 4OMFB 4HT9A 3H6ZA 2LT1A 4M7DF 2XKOC 1NZ9A 3X25B 1PSFA 4TVRA 1Q81C 4CI0C 1WGSA 1KHIA 2HBPA 2X35A 3QO3A 4A4HA 4C0DC 4E7KA 3OY9A 3UPUA 2R58A 2VYTA 3PMIA 1QP2A 4II1A 2PQWA 1Q86C 2XHCA 1VQ7A 2H3JA 4XQ3A 4M77D 4PKCC 3A8LB 3CCMT 3CCRT 4M7AD 4C92C 2LCLA 4PJOB 2ZPEB 2X4WA 4M78F 2BUDA 4C92A 1SSFA 4DA4A 4BI4A 1K73U 5FROA 3JCMb 4J5YA 5FLXE 4E7JA 4PLLA 3A8HB 2OTJA 5FU7B 3GPLA 2VGMA 2ZPHB 3CPWS 1UEBA 5A0LA 3OYMA 4A4GA 1VQKA 1U1SA 3M56A 1M90C 4QQDA 4YTLA 1W2BA 2P0KA 4M77E 5GAMd 4NL3A 3OYIA 4L5GA 2LTOA 4J7IA 4JRKA 4OGEA 5GANh 3CCJT 4HKEA 2QA4T 1ZBXA 3S3OA 1Q82U 3BDUA 1TH7A 3WVEB 1VQOT 2ZPFB 2OTLT 2XD0A 2EJ9A 2X4JA 4OGCA 3SFMA 5M9OA 2QEXA 3MP1A 5LJ5j 3TEEA 2CS7A 3M5AA 2QA4A 4N0AC 2E12A 2PVOB 2F5TX 3L2ZA 4FT4A 2YRVA 2CGHA 4BI3A 4BI8B 2ZPIB 2OAUA 2RHUA 3H8ZA 4PNOA 3JCMV 2YLBA 3AHUA 2AHJB 1HXDA 3QSUA 3GIBA 1H641 3ZEHA 3RERA 2CZ7B 3V7CA 1N27A 2RHYA 3GNFB 5LJ3e 3JCMg 4C0DB 3PGGA 3UT1A 3NTIA 2XG8D 4C8QE 3OYYA 4ZTJA 4M7DD 3DLMA 3PFSA 2HQEA 4JUVA 3X24B 2K2VA 3X20B 3VUZA 3M4GA 5C0MA 1VQNA 4PJOC 2P0PA 4UC4A 3UWNA 3JCMW 4J7FA 2JVVA 4HT8A 3J81E 1BI0A 4RCBA 1XOVA 3T9NA 2DO3A 3CCLA 2DXCA 4JLIA 5HKCA 3C12A 3G7ZA 3MO8A 1VIFA 4A4KA 2RJCA 4BACA 3M53A 3OYCA 3QPHA 3P8BB 2EJGA 3M4YA 2A7YA 3CBMA 4B9WA 2GFAA 5IAYA 3I56A 2JN0A 3CCUA 3L2QA 1G5VA 1WQWA 3G71T 2VC8A 3SWNA 4C92D 4ATOA 2RK2A 4DOVA 2LC4A 2EQMA 4F7UB 1LOJA 1VQ4A 4XU3A 3N5BB 3FEOA 3CD6T 1ZHIA 2GFUA 1WNLA 4MZMA 3G6EA 4Z02A 3HRSA 4NL2A 4C8QB 2OTLA 1KC8U 3JB9F 1M1FA 4C5EA 5GAN6 3F70A 3OYEA 4PJOE 4BY6C 3OMCA 3OW2S 3S3MA 2ZPGB 5LJ3f 1N8RC 3EFSA 3MEVA 5LJ3h 4ELYC 5CK9A 2RHZA 4M78A 2E70A 5CKDA 1D3BA 2DZCA 1WJRA 3SWNB 2XDPA 2P0QA 4L59A 2KQWA 4EMKC 5GMKi 4JS4A 2L89A 1GXIE 2K4YA 4ZGJB 2ZPBB 3EFRA 4XU2A 5GAN7 1WJQA 1YIJT 1NJIU 1VQ4T 2DTIA 3ZFJA 1VQ8T 4M75A 4XTYA 3O8VA 4A4FA 1IZ6A 3CCSA 3TU4K 3KBGA 4HCZA 3MCAB 3LLRA 2RO0A 1KHCA 4QVZA 3MEWA 3OQ5A 5HK0A 1OZ2A 4DQ2A 2P4TA 1Q81U 4M78D 4JRQA 2E41A 3LW5E 3OYHA 5FU6C 3CCRA 4F7UE 4ZTFA 3CPFA 3CCLT 2M0OA 3DLLA 4BDYA 1RL2A 2RB6A 5CQYA 1N8RU 1YCYA 2D0QB 2L3RA 5CIUA 3JCMQ 1VQLT 1O75A 2KSSA 4IUVA 3LWIA 3JCMf 4C92F 5LJ3g 1K9MU 2F69A 1QVFS 1UGRB 4MZTA 1NJIC 4C0ZA 5KE2A 3M9QA 1K73C 4QW2A 4C8QF 5FRNA 3HHTB 4XTVA 3URGA 1D3BB 3HL8A 1UGPB 2DVEA 2FB7A 1NE8A 3CMEA 2RI5A 2MWPA 1UB4A 3MEUA 4BE0A 4HA8A 3RIRA 4ZGEB 2LRQA 1VQPA 5GAOl 2DKGA 1Q82C 2V8KA 4R55A 4M7DG 5C6SA 3LH0A 3GLXA 3CCEA 1FWZA 4N4IA 4OB1B 4RCCA 2DXBA 2A3LA 2VV5A 2M1HA 2RD1A 3OW2A 1Y96B 5KCHA 4IUPA 2X4XA 3LGLA 4M77G 4KUDK 1OZ3A 4LDXA 2EAYA 5CR2A 2R57A 5LJ5h 4M7AA 4LD9K 5D6XA 1M8VA 4DOWA 5I2SA 5KCOA 4KUIA 3JCMh 3CCVT 2DXUA 1VQ8A 4J8OA 2CZ6B 1M1KU 5I21A 2DZ9A 2RH2A 2LT4A 3V8KA 3CC7T 1NPRA 2EYQA 5CQXA 3X26B 2PUOB 3P8HA 5GAOn 1KC8C 4PJOD 4F7UF 2DD5A 4A4EA 4C5GA 4F7UG 3M57A 1HK9A 3WXMB 4WF2A 4QQGA 3MP6A 2JUFA 2L5QA 4FT2A 5GAMe 3CCMA 4C5HA 2C06A 3PIOA 4JLGA 4QVCA 2LQKA 2O4XA 3SWNC 4ZN1A 4OP0A 1LJOA 2RM4A 2ZGWA 3QYGB 4M75B 3RKWA 3TREA 3C95A 3GP8A 3VU3C 3CMAT 3RMSA 1OYXA 5DLOA 2OTJT 3OYBA 3A8OB 2LNVA 3G4ST 2RHXA 4JS5A 3CCQT 1VQ6T 2KK4A 3BFMA 3E9FA 3L2UA 4JJNK 1YI2T 3PT9A 4M77A 4OF1A 4RMOA 2O4XB 2DK3A 3FDRA 3CCUT 3X28B 2CZ1B 4N4GA 1XQHA 1XNIA 2BIVA 3LX7A 3L1AA 2L8DA 4L6V5 5CVIA 2KAFA 1WQ7A 2DD4A 3M59A 1S72A 5LJ5e 5LJ3d 1KD1U 3QKJA 4LDVA 4BD3A 4XU1A 4FIBA 2QQBA 5GAN3 3SB2A 5D6YA 3HFOA 1M90U 2DTOA 2XICA 3OMGA 4ZGDB 2KDSA 3VKIA 2DIGA 1QVFA 5FRMA 4V2SA 2LQ8A 3L2RA 4M77B 1UGQB 4JRPA 1G3SA 4F7UA 4GLKA 2KVQG 4C0GA 5GMKm 2F5KA 2WSFE 3A8MB 5A2QE 4M7AF 3ASKA 3QJYA 1Q7YU 2DIQA 4J6XA 1YIJA 2PVGB 1Q86U 3SD4A 4M7DB 3OS5A 3RESA 2YHTA 1YJNT 3QJ6A 3ER0A 2DEQA 4C92G 4EDUA 2FYKA 2QQRA 1JB0E 2WACA 4A54A 2NLUA 1I8FA 5CO7A 4LDYA 2EQUA 3PNWC 2RJDA 4IUUA 1N9SA 2M16A 3JCMd 1B34B 3CBPA 3FC3A 1KQ1A 3CC4T 1V29B 2O01E 3RMQA 3G6ET 3HFNA 4MDXA 2X4YA 1VQ6A 3OBYA 3CCQA 3G4SA 4EMKB 1K9MC 4M7AB 2JZ2A 3CCVA 1FX7A 2V8JA 1I4K1 3CMAA 1QVPA 3HPWA 4IUQA 4M75G 3CBOA 4XK8E 5GAN2 3PMTA 2E10A 3L2VA 1BKBA 1JJ2S 3C4SA 2G3RA 3I56T 2K5IA 3V8JA 3C94A 3FIFA 1AHJB 5A0GA 3L2WA 3NTKA 4EMKA 2EIFA 4LD6A 4P5NA 2Y4YA 4OVAA 3JCMJ 1YBYA 4MMKA 3DB3A 5GAN5 2DJZA 3OYLA 2QI2A 1O9SA 3E1SA 3OS0A 2K5LA 2E64A 2Y4XA 1LNXA 4BY6B 1JBMA 1X75C 4N4HA 5CKBA 2RI2A 3PIPA 1VQPT 1VQNT 3JB9G 3HKSA 4RG2A 4M78E 2JTFA 4M77F 5HY6A 1N9RA 3MP8A 1NPPA 2FHDA 2Y90A 3CC2A 4M75C 2XDDA 3CPWA 2BKDN 5J26A 4M77C 4BUGA 2LVMA 2ZCFB 3OS2A 4E7LA 5LJ5d 3OBWA 2GF7A 2E6ZA 2MAMA 2CYZB 3LGFA 1U1TA 4M75F 4XTWA 1OI1A 2PVDB 1DJ7B 4BB7A 4MZPA 1FXXA 4OB0B 3JB9I 3S3NA 3LWHA 1QW1A 3JCMc 5LJ5g 1KD1C 2GQVA 2XI9A 3M55A 4C8QD 3OS1A 1YJWT 1VQ5A 3HSBA 2QQ9A 2DAQA 2K57A 4FU6A 2WSEE 3OSVA 1X6OA 2LX9A 4RG8A 3DKMA 3UDCA 1YJWA 1M1KC 1VQ5T 4Y28E 5KE3A 4MMLA 1YJNA 3BW1A 1U8RA 1BI2A 3LYIA 4PJOA 3MHXA 2KMTA 5EG2A 1QP3A 1XTDA 5GANf 5GAOp 1YJ9T 3OYDA 3VV0A 1BYMA 1KQSA 5CKHA 2KY9A 5AYFA 4XTZA 2CKKA 3CC2T 4M7AG 2YLCA 2RJFA 2K3XA 5GAMg 1JJ2A 1VQKT 4EMGA 4R56A 4M7DC 2XK0A 2ZZDA 4M78B 1W2BS 1G3TA 2E6NA 1Y71A 2FVUA 2EJFA 2R5AA 4Q5WA 4C8QC 5GAOq 3PTAA 4QQ6A 3CXCS 3FB9A 2WSCE 4LDUA 3JRZA 5CKFA 2D9TA 4EPCA 3CXCA 1Y07A 2EWNA 2QQSA 4C92B 3OYNA 2EQJA 3FLGA 2R5MA 4QVDA 1BI1A 3P8DA 3CD6A 1QVGS 4J6WA 1KG1A 2DXTA 3NTHA 4JDSA 4X9DA 1YI2A 3QUIA 2B8AA 3NFCA 3GOXA 1K8AC 2D6FA 3L42A 3OSSC 3M54A 4M7AC 2V8IA 3QIIA 4PJOG 3CCST 4IURA 4IUTA 1P92A 2E1HA 3QZ9B 5LJ3j 1VQMT 5L8RE 2E65A 4JRIA 3I55T 4KT0E 2M9UA 3VYHB 5D6WA 4KBMB 3JB9H 3OYAA 1G3WA 4D6WA 4ME7A 4N0AA 2RJEA 3OB9A 5GMKh 3HRUA 4O6JA 3V7RA 5GANj 3JB9D 1Q7YC 1KQ2A 2VGNA 2I2LA 3EAEA 4BDZA 5GAMj 3BDLA 5FU6B 4ZN3A 1G3YA 4ELZC 1W4SA 2XU8A 4X34A 3RKYA 5GAOm 4FM4B 1I5LA 3Q1JA 2LDMA 1M4ZA 2RA2A 5A0DA 1VUBA 3VJPA 5GAN8 2EQKA 1IREB 2QDYB 3G71A 1KQSS 1YITT 4C8QG 4PL6A 4J6YA 3KXTA 1EIFA 1N6AA 1Y96A 4XAXB 2JTMA 4C92E 2FL7A 3GF5A 1R8OB 1YHQT 2HNIA 3A5ZB 5I2MA 3ZBDA 5GAMf 5GAMh 2MMPA 1YITA 4E7IA 4NS5A 1S72T 3J7AF 4CRIA 3CCET 4XTUA 3MEAA 2K5FA 1ZQ1A 3QXEB 1YHQA 2E5QA 3QDRB 4IKFA 3RUXA 2EFIA 2PU9B 5GANg 1M5Q1 5HK3A 1B34A 1I81A 1MGQA 2MF2A 3CEYA 3FRNA 4PJOF 5GMKl 2QEXT 2XDBA 4Y91A 3GNGA 1VQOA 5DLQE 4M75E 1WPYA 4KULA 3CMET 3QYHB 3OA6A 5FU7C 5GAN4 5GMKe 3OYGA 3QZ5B 4M7DE 4M7DA 5LJ5f 5IN1A 3FJPA 3DB4A 2QQAA 4J83A 3I55A 3HRTA 4FL6A 4OB3B 4OB2B 3V7SA 2QTXA 4M78C 2CZ0B 3OYFA 4BE1A 3KUFA 1VQMA 5IT9E 1BIBA 3VUBA 2RI3A 3QG1A 3S6WA 3SDZA 2VXFA 5J3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2V A;  2P0Q A;  3URG A;  2P0P A; 
#chains in the Genus database with same CATH topology
 2CP7 A;  4M75 D;  1D0Y A;  2CT4 A;  3CC7 A;  1ZUK A;  1JRI A;  3JB9 J;  2EVR A;  1QVG A;  4X9C A;  1FMV A;  1U5S A;  2JW4 A;  3EG3 A;  3QBY A;  3ME9 A;  4OMQ A;  1WIE A;  1K8A U;  4M78 G;  1ARK A;  2RHI A;  2MWO A;  3VYG A;  2IVW A;  3BY7 A;  2OAW A;  2RK1 A;  3JSC A;  3M58 A;  1TS9 A;  2GNC A;  1AT1 B;  1VQ9 A;  1FYN A;  2OTJ Q;  2PZ1 A;  1JXO A;  2DTH A;  3J80 E;  4MDW A;  3VS6 A;  3QWX X;  3ZL7 C;  5GAN e;  1KC8 R;  1K1Z A;  2D1X A;  4GY5 A;  2VXE A;  4M7D F;  3H6Z A;  1Q81 C;  1KHI A;  2X35 A;  4C0D C;  3OY9 A;  2EKH A;  3UPU A;  2R58 A;  1TTH B;  3CQT A;  4OML A;  1VQ7 A;  3A8L B;  2LCL A;  2ZPE B;  2BUD A;  4KRT A;  2K2M A;  1UEB A;  1E7O A;  1VQK A;  4OMN A;  2L3P A;  3OYI A;  3VS5 A;  4J7I A;  3CCJ T;  4FW2 A;  5GAN h;  3S3O A;  1TH7 A;  1NG2 A;  2J06 A;  2QEX A;  4J9H A;  3G71 Q;  1Z9Z A;  5LJ5 j;  2QYZ A;  2CS7 A;  1C1A A;  2E12 A;  2IPO B;  2CGH A;  2FZG B;  2OAU A;  3UF4 A;  1VYT A;  2CZ7 B;  3GNF B;  2RQV A;  4C0D B;  3UT1 A;  4M7D D;  4ZTJ A;  3DLM A;  1RI9 A;  2HQE A;  4JUV A;  2K2V A;  3VUZ A;  3M4G A;  2DER A;  5IXF A;  3UWN A;  2YUQ A;  4HVW A;  2DXC A;  5HKC A;  3MO8 A;  4A4K A;  3M0U A;  4GBQ A;  1VQP Q;  3OYC A;  4B9W A;  3CCU A;  2A7Y A;  2K6D A;  2JN0 A;  3L2Q A;  1R0B G;  4ATO A;  3NPF A;  4DOV A;  2LC4 A;  3N5B B;  1ZHI A;  2GFU A;  3EH1 A;  4NL2 A;  2ENM A;  5GAN 6;  1W70 A;  1M3C A;  1YNZ A;  1N8R C;  3EFS A;  2E70 A;  4RTV A;  4IIM A;  2JT4 A;  1HYO A;  2P0Q A;  4DBR A;  4EMK C;  2L89 A;  5IHI A;  4ZGJ B;  1NJI R;  1VQ8 T;  2V1R A;  2KRS A;  1AWX A;  2KNB B;  3KBG A;  4QVZ A;  3MEW A;  2F1L A;  1Q81 U;  2YSQ A;  2DBK A;  2LZ6 B;  1Q82 R;  3EGD B;  2FPD A;  3EGX B;  3CCL T;  3DLL A;  1D09 B;  2CP0 A;  2RB6 A;  1N8R U;  1YCY A;  2KSS A;  2F69 A;  2HL5 C;  4F17 A;  2G6F X;  3PVL A;  2HCK A;  5FRN A;  3URG A;  1UGV A;  3HL8 A;  2J6O A;  1UGP B;  2EPD A;  2HQH A;  3U23 A;  4E6R A;  2DKG A;  3E2U A;  5C6S A;  1FWZ A;  1QWF A;  3OW2 A;  1B07 A;  2B86 A;  1AEY A;  4LDX A;  2I0N A;  2SRC A;  5LJ5 h;  2HDA A;  2V26 A;  2HMA A;  1KQS P;  1WXB A;  5I2S A;  2DXU A;  4J8O A;  2EYQ A;  5CQX A;  3QDF A;  1KC8 C;  3P8H A;  4F7U F;  1RAB B;  3M57 A;  1NM7 A;  4WF2 A;  1ZSZ B;  1MV3 A;  3CCM A;  2JUF A;  1YJ9 Q;  1LPL A;  4C5H A;  3PIO A;  4JLG A;  1V1C A;  2HBW A;  2O4X A;  4JZ4 A;  2D0N A;  1LJO A;  1TSF A;  3QYG B;  4M75 B;  3RKW A;  3GP8 A;  3TRE A;  3RMS A;  1OYX A;  5DLO A;  2QGF B;  3CCQ T;  4DBH A;  2GQI A;  2PNI A;  4RMO A;  1R77 A;  2CZ1 B;  1XQH A;  2BIV A;  1QWE A;  3LX7 A;  1VQ6 Q;  2YRC A;  4AG2 C;  4J9F A;  2NUT B;  5LJ5 e;  1ZUY A;  3BE3 A;  4LDV A;  2E3I A;  1EZZ B;  4FIB A;  4Z8A A;  2XIC A;  2KDS A;  1Q95 G;  1SHF A;  3VKI A;  4E7Z A;  4V2S A;  3L2R A;  4M77 B;  1G3S A;  5GMK m;  1K8A R;  1VYU A;  3A8M B;  3QJY A;  2AK5 A;  1MND A;  2DIQ A;  4J6X A;  1YIJ A;  1X2K A;  1Q86 U;  4M7D B;  3O5Z A;  3VRZ A;  1GFD A;  1RAH B;  1JU5 C;  3QJ6 A;  2FYK A;  2QQR A;  1JB0 E;  4A54 A;  4KGX B;  5I22 A;  6AT1 B;  1N9S A;  3JCM d;  1E6H A;  3CBP A;  2X4Y A;  4EMK B;  1B3Q A;  2CP2 A;  3CCV A;  1I4K 1;  4QT7 A;  5IHN A;  4XK8 E;  5GAN 2;  3L2V A;  1JJ2 S;  3PMT A;  3C4S A;  2P4R A;  3MPU B;  2K5I A;  3C94 A;  3FIF A;  1AHJ B;  1W2B P;  3NTK A;  5GJW B;  2DJZ A;  1O9S A;  1OPL A;  3PIP A;  1JBM A;  2RI2 A;  2CUD A;  3HKS A;  1UDL A;  1N9R A;  3MP8 A;  2LJ1 A;  2XDD A;  5J26 A;  4BUG A;  2LVM A;  1U1T A;  1WYX A;  4MZP A;  4OB0 B;  3S3N A;  1M3A A;  4CC7 A;  2H8H A;  3OS1 A;  1YI2 Q;  4K11 A;  5GAN 8;  4FU6 A;  3OSV A;  3UDC A;  1GL5 A;  3DKM A;  4KGZ B;  2AKL A;  2DFU A;  5KE3 A;  4MML A;  1KK7 A;  1X2Q A;  5EG2 A;  3ULR B;  1K76 A;  1TUC A;  4DBF A;  1QLY A;  5GAM g;  1MMN A;  4EMG A;  1H92 A;  4M78 B;  1W2B S;  4ESR A;  4QQ6 A;  5EC7 A;  4EPC A;  3CXC A;  1Y07 A;  1AWJ A;  3RR6 A;  2W10 A;  3OYN A;  2VWF A;  3P8D A;  1QQJ A;  1KG1 A;  2CRE A;  4JDS A;  1VQ7 Q;  3NFC A;  3MKD A;  1K8A C;  1SG5 A;  3L42 A;  3I9Q A;  2YUO A;  3QII A;  3QZ9 B;  2BTT A;  2E65 A;  3I55 T;  2M9U A;  2EBP A;  2MK5 A;  3OB9 A;  3CC2 Q;  4ELZ C;  1ACM B;  3H41 A;  5KYU B;  3D7S B;  1I5L A;  3Q1J A;  1TUD A;  2RA2 A;  1VQ9 Q;  3QWY A;  2QDY B;  2KBT A;  4PL6 A;  2BE7 D;  2JTM A;  2FL7 A;  3GF5 A;  1WHJ A;  1YHQ T;  3A5Z B;  5I2M A;  2FZK B;  1SPK A;  4AFZ C;  4IKF A;  1RAC B;  3QDR B;  1M5Q 1;  3VS7 A;  1I81 A;  1MGQ A;  1Q7Y R;  3GNG A;  2DA9 A;  5DLQ E;  4M75 E;  1VQO A;  3GBQ A;  5FU7 C;  2O88 A;  2X3W D;  5LJ5 f;  2F2X A;  2QQA A;  4FL6 A;  4OB2 B;  2QTX A;  4M78 C;  5IT9 E;  3EG1 A;  2LX7 A;  1M1K R;  2O9V A;  3QG1 A;  1TU0 B;  3JCM Q;  3SDZ A;  1GCQ C;  1Q86 R;  4VUB A;  2QXF A;  1QKX A;  4B9X A;  3M0T A;  5AT1 B;  2LQW A;  3VS1 A;  4O5V A;  5GAN d;  4PFZ A;  4C0F A;  5CKE A;  2DPP B;  2JS2 A;  2DL4 A;  2IG0 A;  2JMC A;  4HCB A;  1OEB A;  3TCJ A;  1X69 A;  5GMK j;  2FZC B;  2RPN A;  4HCC A;  1RI0 A;  5J39 A;  1KSW A;  2PUK B;  1WJS A;  4E47 A;  3OYK A;  2COY A;  4NOY A;  2C0I A;  1M1G A;  3JCM e;  3HP9 A;  3R6O A;  4RTX A;  1PSE A;  2X9H A;  1BI3 A;  5DM7 R;  3NMZ C;  1BIA A;  1G8X A;  2DEU A;  2CSI A;  1NZ9 A;  1PSF A;  4TVR A;  2RQR A;  4A4H A;  2FRY A;  1S72 Q;  1BB9 A;  3CCV Q;  3CXC P;  1PNJ A;  4M7A D;  4M77 D;  3CCM T;  4PJO B;  4C92 C;  2A28 A;  2LMJ A;  4C92 A;  4DA4 A;  4BI4 A;  5FRO A;  1X6B A;  4J5Y A;  1NLO C;  2BZ8 A;  2VGM A;  1VQL Q;  3UAT A;  1WI7 A;  3A1P A;  1M90 C;  2DLP A;  4YTL A;  2BE9 B;  2P0K A;  4NL3 A;  2DX1 A;  2LTO A;  1ZBX A;  3AT1 B;  2VAS A;  1VQO T;  2ZPF B;  5KYN A;  2EJ9 A;  4OGC A;  2C0O A;  2VVK A;  2PVO B;  1ABQ A;  4BI8 B;  2ZPI B;  2RHU A;  3H8Z A;  3JCM V;  2KYM A;  1YWO A;  2YLB A;  1HXD A;  1PKT A;  1BK2 A;  3ZEH A;  2ROL A;  2HEQ A;  2E5K A;  2XG8 D;  3EHQ A;  4KGV B;  3EFO B;  1K0S A;  1PG5 B;  1VQN A;  2PTK A;  4UC4 A;  4HCK A;  4J7F A;  2JVV A;  4RCB A;  4RUG A;  2DO3 A;  3CCL A;  4JLI A;  3G7Z A;  2RJC A;  4BAC A;  3M53 A;  1PD1 A;  2EJG A;  5IAY A;  3I56 A;  1OX8 A;  1Z9Q A;  3CCR Q;  3SWN A;  2RK2 A;  1D1C A;  2CSQ A;  4LUE A;  2CT3 A;  3G6E A;  4C8Q B;  3HRS A;  1RAE B;  1M1F A;  1M27 C;  3F70 A;  4PJO E;  1GCQ A;  2A36 A;  3OMC A;  3MEV A;  4ELY C;  5CK9 A;  1VQ8 Q;  4M78 A;  2ESW A;  5CKD A;  2DZC A;  2DYB A;  1WJR A;  2F2W A;  2XDP A;  4XU2 A;  3EFR A;  1WJQ A;  5FW9 A;  2DTI A;  3ZFJ A;  4M75 A;  2RQW A;  1M90 R;  3LLR A;  2RO0 A;  3OQ5 A;  4DQ2 A;  2JJ9 A;  1IHV A;  5FU6 C;  4F7U E;  2M0O A;  2DRK A;  5CIU A;  1QVF A;  3LWI A;  5LJ3 g;  3G6E Q;  1F1B B;  2EYY A;  2DM1 A;  5KE2 A;  1K73 C;  1IO6 A;  1GCP A;  1I1J A;  2CH4 W;  1K0X A;  4CC2 A;  1ZA1 B;  2DVE A;  2FB7 A;  1JXM A;  2RI5 A;  3MEU A;  5GJV B;  1S1N A;  4R55 A;  4M7D G;  1KJW A;  4J9I A;  2M1H A;  2RD1 A;  1WLP B;  4M77 G;  2X4X A;  3LGL A;  4KUD K;  1PHT A;  2HKQ B;  2HSE B;  1K9M R;  2R57 A;  4LD9 K;  2KRM A;  1QCN A;  1RUW A;  3CCV T;  4DEX A;  5I21 A;  2YRD A;  3V8K A;  3CC7 T;  4HXJ A;  2EGE A;  5I11 A;  2PUO B;  4PJO D;  1RAG B;  4A4E A;  1C0M A;  1HK9 A;  4QVC A;  1JQQ A;  3G1J A;  2O2O A;  2ZGW A;  3CMA T;  3CD6 A;  2DJQ A;  2OTJ T;  1MUZ A;  3A8O B;  3NHN A;  3CC7 Q;  1VQ6 T;  2ED1 A;  2MPX C;  2EGA A;  1M3B A;  1X6G A;  3UA6 A;  2AKK A;  2X3X D;  4LXC A;  2A08 A;  3FDR A;  2O9S A;  4IIO A;  7AT1 B;  2NUP B;  1YHQ Q;  4L6V 5;  5CVI A;  2KAF A;  2D8J A;  1WQ7 A;  2DD4 A;  3M59 A;  1S72 A;  2M0Y A;  2RF0 A;  4BD3 A;  3CMA Q;  2QQB A;  1WHH A;  1M90 U;  2DTO A;  2MYS A;  3OMG A;  4ZGD B;  4J9E A;  5FRM A;  2LQ8 A;  1IGQ A;  4HVU A;  4M7A F;  2F5K A;  1Q7Y U;  2PVG B;  2XMF A;  4FYX B;  3OS5 A;  2YHT A;  1WHM A;  3TSZ A;  2DEQ A;  4EDU A;  3JV3 A;  2WAC A;  4RTT A;  2EQU A;  2KT1 A;  4PFO A;  1G2B A;  1VQ6 A;  2DMO A;  1TXQ A;  1FX7 A;  1OQK A;  3EH2 A;  2KYB A;  3CMA A;  1QVP A;  4M75 G;  2COW A;  5FWB A;  5KYW B;  3L2W A;  2ECZ A;  4LD6 A;  4MMK A;  3OYL A;  1UHC A;  3E1S A;  3OS0 A;  2Y4X A;  1LNX A;  1MMG A;  1MMA A;  2Y90 A;  2FHD A;  3CME Q;  4OMM A;  4M75 C;  2OJ2 A;  3CPW A;  2ZCF B;  4E7L A;  3OBW A;  2E6Z A;  2CYZ B;  4XTW A;  1OI1 A;  1T0J A;  1FXX A;  4KH0 B;  3JCM c;  5LJ5 g;  3CCU Q;  1OX9 A;  1YJW T;  4Z02 A;  2QQ9 A;  2DAQ A;  1VQ5 T;  2LX9 A;  1YJN A;  3BW1 A;  1N5Z A;  2C0T A;  5KYW A;  1U8R A;  4LE9 A;  1NYG A;  1XTD A;  1YJ9 T;  2KXD A;  3VV0 A;  1BYM A;  1ZA2 B;  3EG2 A;  5AYF A;  1GFC A;  1WX6 A;  1RLQ C;  2FVU A;  1Y71 A;  4OMP A;  4C8Q C;  1WA7 A;  5D7U A;  3CCQ Q;  4LDU A;  3JRZ A;  5CKF A;  2D9T A;  1ZSG A;  1M30 A;  1BI1 A;  1W1F A;  1QVG S;  4PJN A;  4X9D A;  5HCK A;  1YI2 A;  2A37 A;  3QUI A;  2B8A A;  1UTI A;  2V8I A;  1P92 A;  2K79 A;  4KT0 E;  5D6W A;  1G3W A;  4D6W A;  4ME7 A;  1Y57 A;  1NEG A;  2OI3 A;  1A0N B;  3VS3 A;  2DNU A;  1NEB A;  2YUN A;  3HRU A;  4O6J A;  5GMK h;  1Q7Y C;  1KQ2 A;  1YP5 A;  3EAE A;  2FPE A;  4BDZ A;  1Y0M A;  1BU1 A;  1SHG A;  3BDL A;  3EHR A;  1W4S A;  2XU8 A;  3RKY A;  1VA7 A;  2LDM A;  3TVT A;  5A0D A;  4M4Z A;  2QEX Q;  2EQK A;  3UA7 A;  5IH2 A;  1R0C B;  2YUP A;  3KXT A;  3M0P A;  4XAX B;  4C92 E;  1IRX A;  1R8O B;  5GAM h;  4NS5 A;  4XTU A;  1ZQ1 A;  2E5Q A;  1SRL A;  5HK3 A;  2QEX T;  5GMK l;  1ZLM A;  4Y91 A;  4KUL A;  4KH1 B;  3CME T;  5GMK e;  3OYG A;  1PWT A;  2KE9 A;  3QZ5 B;  4M7D A;  1UJ0 A;  3DB4 A;  1PD0 A;  4J83 A;  4OB3 B;  4DEY A;  2CZ0 B;  4BE1 A;  1BIB A;  3IQL A;  3S6W A;  1VQK Q;  5J3B A;  4A53 A;  3CC4 A;  4DBQ A;  4C8Q A;  1H3Z A;  4FYY B;  5LL6 S;  1VQ7 T;  3JAM E;  2JOY A;  2L2P A;  1MV0 B;  5KH6 A;  1X43 A;  3OYJ A;  1W6X A;  4RKU E;  3THK A;  2CP6 A;  4BE2 A;  1Y7X A;  3E9G A;  2XID A;  2EKO A;  3A8G B;  1YJN Q;  1UGS B;  3E19 A;  4E7H A;  2VUB A;  4XTX A;  1YJ9 A;  3RKX A;  2DE0 X;  1OOT A;  1M9S A;  2DL5 A;  2LCC A;  3MET A;  3I5S A;  5CCA A;  1KD1 R;  4FSX A;  4XU0 A;  4RTU A;  1VQ9 T;  3EGD A;  1OU8 A;  1TG0 A;  2K3Y A;  2GCX A;  3V8L A;  1I5O B;  2MI6 A;  2EQI A;  2LT1 A;  4CI0 C;  1RLP C;  3EG9 B;  3QO3 A;  2KRN A;  2VYT A;  4II1 A;  1QP2 A;  1QKW A;  2XHC A;  2X4W A;  1T0H A;  1SSF A;  1K73 U;  3JCM b;  3HTR A;  4E7J A;  4PLL A;  4PJJ A;  3A8H B;  2OTJ A;  2HKN A;  5FU7 B;  3GPL A;  1YWP A;  3CPW S;  2QG9 B;  4A4G A;  1U1S A;  3M56 A;  3MJX A;  1X27 A;  1PCX A;  4M77 E;  5GAM d;  4JRK A;  4OGE A;  2DL7 A;  4HKE A;  1Q82 U;  1QCF A;  3WVE B;  2ED0 A;  3SFM A;  2X4J A;  3VS0 A;  3MP1 A;  4F14 A;  3TEE A;  1M2O A;  3SEM A;  2QA4 A;  3PE0 A;  3L2Z A;  4BI3 A;  4FCY A;  3AHU A;  2AHJ B;  3GIB A;  2DVJ A;  3RER A;  3PGG A;  3OYY A;  3PFS A;  1RAD B;  2K7A A;  2HSP A;  3JCM W;  1OPK A;  1XOV A;  3T9N A;  3CCS Q;  2O31 A;  1YHQ A;  1VIF A;  2CUB A;  3P8B B;  3M4Y A;  1BBZ A;  1WQW A;  4C92 D;  2W0Z A;  2EQM A;  1VQ4 A;  3FEO A;  4D8K A;  1IB8 A;  3CD6 T;  1WNL A;  1CKB A;  2OTL A;  1KC8 U;  3JB9 F;  2QAS A;  2GBQ A;  4C5E A;  3OYE A;  4BY6 C;  2LCS A;  3OW2 S;  3S3M A;  1VOM A;  2ZPG B;  5LJ3 f;  2J05 A;  4L59 A;  1VQN Q;  5GMK i;  1UG1 A;  2M02 A;  1GBR A;  4XTY A;  4A4F A;  3TU4 K;  4HCZ A;  1UUE A;  3CCM Q;  1KHC A;  2KXC A;  3VS2 A;  2CDT A;  2YWW A;  1AD5 A;  3CCE Q;  2P4T A;  4M78 D;  4J9D A;  3LW5 E;  3CCR A;  4ZTF A;  1D0X A;  3CPF A;  3PVQ A;  2D0Q B;  1VQL T;  2RMO A;  1O75 A;  4IUV A;  1YIT Q;  3JCM f;  4C92 F;  4WTO B;  2QAZ A;  1WHK A;  3M9Q A;  4C8Q F;  2RQU A;  1VQO Q;  1NE8 A;  1IGU A;  2NYS A;  2MWP A;  1UB4 A;  4BE0 A;  3EG0 A;  4HA8 A;  3RIR A;  4ZGE B;  2LRQ A;  1Q82 C;  2V8K A;  3LH0 A;  3GLX A;  3CCE A;  4N4I A;  4OB1 B;  2K3B A;  1Y96 B;  4IUP A;  1OZ3 A;  2EAY A;  5CR2 A;  4J9C A;  5D6X A;  4DOW A;  5KCO A;  4KUI A;  1LVK A;  2QA4 Q;  2DZ9 A;  2RH2 A;  2LT4 A;  1K9A A;  1QVG P;  1NPR A;  4F16 A;  1JO8 A;  5GAO n;  2SEM A;  1WXT A;  2P84 A;  2DL3 A;  3WXM B;  3MP6 A;  4FT2 A;  1PM3 A;  1ZBJ A;  2C06 A;  2LQK A;  3SWN C;  4OP0 A;  2RM4 A;  1M8V A;  3C95 A;  3VU3 C;  3FJ5 A;  8ATC B;  3KFV A;  2KK4 A;  3BFM A;  4ANJ A;  3L2U A;  1SSH A;  3PT9 A;  4M77 A;  4OF1 A;  4FSS A;  2O4X B;  3X28 B;  3L1A A;  2L8D A;  2RQT A;  2AZS A;  5LJ3 d;  1WHL A;  5GAN 3;  2YXY A;  4PK4 A;  3SB2 A;  1SF9 A;  3VRY A;  1UEC A;  4ZNX A;  1UGQ B;  4ORZ A;  4F7U A;  4JRP A;  2KVQ G;  2BZX A;  2WSF E;  3ASK A;  3RNJ A;  3SD4 A;  1FMW A;  1WFW A;  3RES A;  1AWO A;  4C92 G;  2NUP A;  1I8F A;  5CO7 A;  3H0I A;  3M0S A;  2RJD A;  4IUU A;  2RN8 A;  1MMD A;  1V29 B;  2FEI A;  3RMQ A;  3G6E T;  2QK0 A;  3OBY A;  3CCQ A;  1K9M C;  4M7A B;  2OX7 A;  5KYY A;  2LJ0 A;  3HPW A;  1BKB A;  2G3R A;  3I56 T;  2JTE A;  5A0G A;  4EMK A;  2GTJ A;  4OVA A;  2IIM A;  2QI2 A;  3I55 Q;  2K5L A;  2E64 A;  4BY6 B;  4N4H A;  1VQP T;  1VQN T;  3JB9 G;  2JTF A;  2JMA A;  5HY6 A;  1NPP A;  2H3E B;  3CC2 A;  1K73 R;  3OS2 A;  5LJ5 d;  2NWM A;  2GF7 A;  3LGF A;  4AFU C;  1DJ7 B;  3JB9 I;  9ATC B;  1QW1 A;  3LWH A;  2QDL A;  5ECA A;  3M55 A;  3HSB A;  2WSE E;  1X6O A;  3OW2 P;  4Y28 E;  1TWB A;  1VQ4 Q;  1HJD A;  1BI2 A;  2AIR B;  4LUD A;  3LYI A;  1H8K A;  3MHX A;  2KMT A;  1QP3 A;  5GAN f;  1KQS A;  2L3S A;  3CC2 T;  4M7A G;  2YLC A;  2RJF A;  2K3X A;  1Q81 R;  4R56 A;  4M7D C;  1SRM A;  2XK0 A;  2ZZD A;  2COZ A;  1G3T A;  2E6N A;  4Q5W A;  5GAO q;  2EJF A;  3CXC S;  4PJM A;  2ABL A;  4C92 B;  2EWN A;  1HD3 A;  3FLG A;  2R5M A;  3LH5 A;  1TOV A;  2DIL A;  3RBB B;  1ZX6 A;  3OSS C;  3M54 A;  4M7A C;  4IUR A;  2DBM A;  4IUT A;  1WZO A;  3VYH B;  3OYA A;  2MCN A;  1PRL C;  2DRM A;  2I2L A;  5GAM j;  2E3H A;  1ZSZ C;  4J9G A;  3EGU A;  4JJB A;  5KYX A;  1KQS S;  1IRE B;  4C8Q G;  3NGP A;  3REB B;  4J6Y A;  1EIF A;  1Y96 A;  3CPW P;  1LCK A;  2HNI A;  3ZBD A;  4CC3 A;  3REA B;  2MMP A;  4E7I A;  3CCE T;  3QXE B;  5GAN g;  1JEG A;  1B34 A;  3EGX A;  1UJY A;  2JM9 A;  2LNH B;  3EFO A;  2XDB A;  3M0Q A;  1WPY A;  1C6V X;  3QYH B;  3OA6 A;  5GAN 4;  4FW1 A;  3FJP A;  3I55 A;  3HRT A;  2LP5 A;  1V76 A;  3V7S A;  4JPB W;  3KUF A;  3VUB A;  3CD6 Q;  3I56 Q;  2D8H A;  1VQL A;  2VXF A;  2LJ3 A;  2EYZ A;  4Y92 A;  4GLM A;  4RTY A;  4JJC A;  1VIE A;  3CCJ A;  3WVD B;  2LQN A;  2RNA A;  3JCM X;  2HD0 A;  1AZG B;  1SEM A;  1RAI B;  2JNG A;  3QHS A;  4R0K A;  1UFF A;  4EMH A;  4PLI A;  4LDW A;  1MHN A;  5CAI A;  1NBE B;  2VKN A;  2KRO A;  1QMC A;  1AOJ A;  1RAF B;  3JCM P;  4M7A E;  4C5I A;  2HAX A;  3INZ A;  5DY9 A;  1ZUU A;  5GAO r;  1X01 A;  2HQX A;  4OMF B;  4HT9 A;  2XKO C;  3X25 B;  3CCL Q;  1WGS A;  1UHF A;  2HBP A;  1D1B A;  4E7K A;  1D0Z A;  5L23 A;  1CKA A;  4E2F B;  3PMI A;  4AFQ C;  2PQW A;  1Q86 C;  2FO0 A;  2H3J A;  2BZY A;  4PKC C;  4XQ3 A;  3CCR T;  2CP3 A;  4Z88 A;  4M78 F;  1UE9 A;  2NUT A;  1M8M A;  5FLX E;  1QCO A;  2ZPH B;  5A0L A;  3OYM A;  3A98 A;  4QQD A;  1W2B A;  1EFN A;  4L5G A;  2JXB A;  5FWC A;  2MIO A;  2QA4 T;  2CP5 A;  5KYU A;  1M2V A;  2L3Q A;  3BDU A;  1JJ2 P;  2OTL T;  2XD0 A;  5M9O A;  4Z89 A;  1N8R R;  4QKU A;  3M5A A;  4N0A C;  2F5T X;  4FT4 A;  2YRV A;  2YDL A;  1NYF A;  4PNO A;  1D1A A;  3QSU A;  1H64 1;  4CC4 B;  3V7C A;  1N27 A;  2RHY A;  5LJ3 e;  3JCM g;  4C8Q E;  3NTI A;  2YT6 A;  4X1V A;  3X24 B;  2EGC A;  3X20 B;  5C0M A;  3TQ7 P;  4PJO C;  2P0P A;  2EYW A;  4HT8 A;  3J81 E;  1BI0 A;  3C12 A;  3QPH A;  3CBM A;  1AWW A;  2GFA A;  1G5V A;  2KR3 A;  1WXU A;  3G71 T;  2V1Q A;  2VC8 A;  1YJW Q;  1ABO A;  1T3S A;  1NLP C;  4F7U B;  1LOJ A;  2GTO A;  4XU3 A;  1U3O A;  2KT8 A;  1KIK A;  4MZM A;  1B7T A;  3H0F A;  4A63 B;  4AG1 C;  1G83 A;  1YIJ Q;  4LNP A;  2FRW A;  2F2V A;  5LJ3 h;  1WDX A;  2RHZ A;  1D3B A;  3SWN B;  2KQW A;  1BCO A;  2FPF A;  4JS4 A;  1GXI E;  2K4Y A;  2ZPB B;  5GAN 7;  1NJI U;  1YIJ T;  1VQ4 T;  3O8V A;  1IZ6 A;  3CCS A;  5HK0 A;  3MCA B;  5KYY B;  1OZ2 A;  1FMK A;  4JRQ A;  2E41 A;  1GRI A;  1AZE A;  4WCI A;  2J7I A;  3OYH A;  1ZSZ A;  4BDY A;  4PJL A;  1RL2 A;  5CQY A;  2L3R A;  1K9M U;  1QVF S;  1UGR B;  4MZT A;  4AFS C;  1NJI C;  4C0Z A;  4AMC A;  4QW2 A;  1PRM C;  1E6G A;  3HHT B;  4XTV A;  3M0R A;  1D3B B;  4AT1 B;  1SKU B;  4FYV B;  3CME A;  2HL3 A;  5KYX B;  1EX4 A;  2DF6 A;  1VQP A;  5GAO l;  4HVV A;  3SHW A;  2KI7 A;  4RCC A;  2DXB A;  2A3L A;  2HZY A;  2QTV A;  2VV5 A;  5KCH A;  4M7A A;  2NUZ A;  3JCM h;  1VQ8 A;  2AT1 B;  2CZ6 B;  1M1K U;  3I35 A;  1MNE A;  2MOX A;  3X26 B;  1BCM A;  1TUG B;  2DD5 A;  2KGT A;  4C5G A;  4F7U G;  4QQG A;  4EIK A;  2L5Q A;  5GAM e;  3R6N A;  2KEA A;  4ZN1 A;  3TSW A;  3I5R A;  2J6K A;  1YCS B;  3OYB A;  2LNV A;  3G4S T;  2RHX A;  4JS5 A;  3E9F A;  4JJN K;  1YI2 T;  2DK3 A;  3CCU T;  4N4G A;  1XNI A;  2K9G A;  4LN2 A;  3G4S Q;  2EW3 A;  1KD1 U;  3QKJ A;  1I0C A;  4XU1 A;  1AVZ C;  5D6Y A;  3HFO A;  4RTZ A;  5IHK A;  2DIG A;  2DET A;  4GLK A;  4C0G A;  5A2Q E;  1OV3 A;  2QGG A;  1OUL A;  2JS0 A;  1IHW A;  1HSQ A;  1YJN T;  3ER0 A;  2NLU A;  4LDY A;  3PNW C;  2M16 A;  1B34 B;  3CC4 T;  3FC3 A;  1KQ1 A;  2O01 E;  4MDX A;  3HFN A;  4FYW B;  2J6F A;  3G4S A;  1WHG A;  2CH4 A;  2JZ2 A;  2V8J A;  4IUQ A;  1K4U S;  3CBO A;  2E10 A;  1YN8 A;  1YFN A;  3V8J A;  4JJD A;  2EIF A;  4P5N A;  2Y4Y A;  3JCM J;  1YBY A;  3DB3 A;  5GAN 5;  2VB6 A;  1X75 C;  5CKB A;  2EYX A;  4RG2 A;  4M78 E;  4M77 F;  1M2V B;  1H3H A;  1RAA B;  1PKS A;  3CC4 Q;  2BKD N;  4M77 C;  2MAM A;  4M75 F;  2PVD B;  4BB7 A;  4F04 B;  1IXD A;  2Z0W A;  1KD1 C;  2GQV A;  2XI9 A;  4C8Q D;  1VQ5 A;  8AT1 B;  1XJW B;  2K57 A;  4RG8 A;  1YJW A;  1M1K C;  5IXB A;  2JM8 A;  4PJO A;  4E7S A;  5GAO p;  3H9N A;  4OMO A;  3OYD A;  1J3T A;  5CKH A;  2KY9 A;  3RDV A;  4XTZ A;  2CKK A;  3EG9 A;  4RTW A;  1JJ2 A;  1I07 A;  1VQK T;  2L0A A;  1OU9 A;  3PTA A;  2ROT A;  2R5A A;  3FB9 A;  2FG0 A;  2M51 A;  2WSC E;  2QQS A;  3C0C A;  1VQM Q;  2EQJ A;  4J9B A;  4QVD A;  4D8D A;  2ATC B;  4J6W A;  2DXT A;  4B6M A;  3NTH A;  3GOX A;  2D6F A;  4PJO G;  3CCS T;  1T3L A;  2E1H A;  5LJ3 j;  1VQM T;  5L8R E;  2OTL Q;  4JRI A;  4KBM B;  3JB9 H;  4N0A A;  1GBQ A;  2RJE A;  4JZ3 A;  1VYV A;  2A0F B;  3V7R A;  5GAN j;  3JB9 D;  2VGN A;  1CSK A;  5FU6 B;  4ZN3 A;  1G3Y A;  4X34 A;  3VS4 A;  5GAO m;  4FM4 B;  2DYI A;  1M4Z A;  1U06 A;  2AZV A;  1VUB A;  3VJP A;  3G71 A;  1YIT T;  2DL8 A;  2GGR A;  1VQ5 Q;  3H0H A;  1N6A A;  5GAM f;  4PFP A;  1YIT A;  1S72 T;  1PC0 A;  3CCJ Q;  4CRI A;  3J7A F;  3MEA A;  2K5F A;  3RUX A;  2EFI A;  2PU9 B;  2MF2 A;  3CEY A;  3FRN A;  4PJO F;  2E4H A;  4M7D E;  5IN1 A;  1KFZ A;  2X51 A;  3OYF A;  1VQM A;  1QVF P;  2RI3 A;  2ZAE A; 
#chains in the Genus database with same CATH homology
 4VUB A;  4A53 A;  4M75 D;  2QXF A;  3CC7 A;  1JRI A;  3JB9 J;  3CC4 A;  4C8Q A;  1H3Z A;  1QVG A;  4X9C A;  4B9X A;  5LL6 S;  1VIE A;  1VQ7 T;  3CCJ A;  3JAM E;  3QBY A;  2JOY A;  3ME9 A;  4O5V A;  5KH6 A;  5GAN d;  4C0F A;  3WVD B;  5CKE A;  1K8A U;  3OYJ A;  2DPP B;  4M78 G;  4RKU E;  3JCM X;  2HD0 A;  4BE2 A;  1Y7X A;  3E9G A;  2IG0 A;  2RHI A;  4HCB A;  2MWO A;  3VYG A;  3TCJ A;  2XID A;  5GMK j;  2EKO A;  3A8G B;  2IVW A;  4HCC A;  1UGS B;  2JNG A;  3BY7 A;  3QHS A;  2RK1 A;  3E19 A;  3JSC A;  3M58 A;  4E7H A;  2VUB A;  4XTX A;  1RI0 A;  5J39 A;  1YJ9 A;  4EMH A;  3RKX A;  2PUK B;  4PLI A;  1WJS A;  4LDW A;  1MHN A;  1VQ9 A;  5CAI A;  1M9S A;  2DTH A;  4E47 A;  3OYK A;  2LCC A;  3MET A;  1VQL A;  3J80 E;  5CCA A;  4NOY A;  4FSX A;  4MDW A;  4XU0 A;  3JCM P;  1VQ9 T;  4M7A E;  1M1G A;  3JCM e;  3HP9 A;  5GAN e;  3R6O A;  2K3Y A;  4C5I A;  2HAX A;  3INZ A;  5DY9 A;  2GCX A;  3V8L A;  1PSE A;  5GAO r;  1BI3 A;  1X01 A;  4GY5 A;  5DM7 R;  2VXE A;  1BIA A;  2HQX A;  2MI6 A;  4OMF B;  4HT9 A;  3H6Z A;  2LT1 A;  4M7D F;  2XKO C;  1NZ9 A;  3X25 B;  1PSF A;  4TVR A;  1Q81 C;  4CI0 C;  1WGS A;  1KHI A;  2HBP A;  2X35 A;  3QO3 A;  4A4H A;  4C0D C;  4E7K A;  3OY9 A;  3UPU A;  2R58 A;  2VYT A;  3PMI A;  1QP2 A;  4II1 A;  2PQW A;  1Q86 C;  2XHC A;  1VQ7 A;  2H3J A;  4XQ3 A;  4M77 D;  4PKC C;  3A8L B;  3CCM T;  3CCR T;  4M7A D;  4C92 C;  2LCL A;  4PJO B;  2ZPE B;  2X4W A;  4M78 F;  2BUD A;  4C92 A;  1SSF A;  4DA4 A;  4BI4 A;  1K73 U;  5FRO A;  3JCM b;  4J5Y A;  5FLX E;  4E7J A;  4PLL A;  3A8H B;  2OTJ A;  5FU7 B;  3GPL A;  2VGM A;  2ZPH B;  3CPW S;  1UEB A;  5A0L A;  3OYM A;  4A4G A;  1VQK A;  1U1S A;  3M56 A;  1M90 C;  4QQD A;  4YTL A;  1W2B A;  2P0K A;  4M77 E;  5GAM d;  4NL3 A;  3OYI A;  4L5G A;  2LTO A;  4J7I A;  4JRK A;  4OGE A;  5GAN h;  3CCJ T;  4HKE A;  2QA4 T;  1ZBX A;  3S3O A;  1Q82 U;  3BDU A;  1TH7 A;  3WVE B;  1VQO T;  2ZPF B;  2OTL T;  2XD0 A;  2EJ9 A;  2X4J A;  4OGC A;  3SFM A;  5M9O A;  2QEX A;  3MP1 A;  5LJ5 j;  3TEE A;  2CS7 A;  3M5A A;  2QA4 A;  4N0A C;  2E12 A;  2PVO B;  2F5T X;  3L2Z A;  4FT4 A;  2YRV A;  2CGH A;  4BI3 A;  4BI8 B;  2ZPI B;  2OAU A;  2RHU A;  3H8Z A;  4PNO A;  3JCM V;  2YLB A;  3AHU A;  2AHJ B;  1HXD A;  3QSU A;  3GIB A;  1H64 1;  3ZEH A;  3RER A;  2CZ7 B;  3V7C A;  1N27 A;  2RHY A;  3GNF B;  5LJ3 e;  3JCM g;  4C0D B;  3PGG A;  3UT1 A;  3NTI A;  2XG8 D;  4C8Q E;  3OYY A;  4ZTJ A;  4M7D D;  3DLM A;  3PFS A;  2HQE A;  4JUV A;  3X24 B;  2K2V A;  3X20 B;  3VUZ A;  3M4G A;  5C0M A;  1VQN A;  4PJO C;  2P0P A;  4UC4 A;  3UWN A;  3JCM W;  4J7F A;  2JVV A;  4HT8 A;  3J81 E;  1BI0 A;  4RCB A;  1XOV A;  3T9N A;  2DO3 A;  3CCL A;  2DXC A;  4JLI A;  5HKC A;  3C12 A;  3G7Z A;  3MO8 A;  1VIF A;  4A4K A;  2RJC A;  4BAC A;  3M53 A;  3OYC A;  3QPH A;  3P8B B;  2EJG A;  3M4Y A;  2A7Y A;  3CBM A;  4B9W A;  2GFA A;  5IAY A;  3I56 A;  2JN0 A;  3CCU A;  3L2Q A;  1G5V A;  1WQW A;  3G71 T;  2VC8 A;  3SWN A;  4C92 D;  4ATO A;  2RK2 A;  4DOV A;  2LC4 A;  2EQM A;  4F7U B;  1LOJ A;  1VQ4 A;  4XU3 A;  3N5B B;  3FEO A;  3CD6 T;  1ZHI A;  2GFU A;  1WNL A;  4MZM A;  3G6E A;  4Z02 A;  3HRS A;  4NL2 A;  4C8Q B;  2OTL A;  1KC8 U;  3JB9 F;  1M1F A;  4C5E A;  5GAN 6;  3F70 A;  3OYE A;  4PJO E;  4BY6 C;  3OMC A;  3OW2 S;  3S3M A;  2ZPG B;  5LJ3 f;  1N8R C;  3EFS A;  3MEV A;  5LJ3 h;  4ELY C;  5CK9 A;  2RHZ A;  4M78 A;  2E70 A;  5CKD A;  1D3B A;  2DZC A;  1WJR A;  3SWN B;  2XDP A;  2P0Q A;  4L59 A;  2KQW A;  4EMK C;  5GMK i;  4JS4 A;  2L89 A;  1GXI E;  2K4Y A;  4ZGJ B;  2ZPB B;  3EFR A;  4XU2 A;  5GAN 7;  1WJQ A;  1YIJ T;  1NJI U;  1VQ4 T;  2DTI A;  3ZFJ A;  1VQ8 T;  4M75 A;  4XTY A;  3O8V A;  4A4F A;  1IZ6 A;  3CCS A;  3TU4 K;  3KBG A;  4HCZ A;  3MCA B;  3LLR A;  2RO0 A;  1KHC A;  4QVZ A;  3MEW A;  3OQ5 A;  5HK0 A;  1OZ2 A;  4DQ2 A;  2P4T A;  1Q81 U;  4M78 D;  4JRQ A;  2E41 A;  3LW5 E;  3OYH A;  5FU6 C;  3CCR A;  4F7U E;  4ZTF A;  3CPF A;  3CCL T;  2M0O A;  3DLL A;  4BDY A;  1RL2 A;  2RB6 A;  5CQY A;  1N8R U;  1YCY A;  2D0Q B;  2L3R A;  5CIU A;  3JCM Q;  1VQL T;  1O75 A;  2KSS A;  4IUV A;  3LWI A;  3JCM f;  4C92 F;  5LJ3 g;  1K9M U;  2F69 A;  1QVF S;  1UGR B;  4MZT A;  1NJI C;  4C0Z A;  5KE2 A;  3M9Q A;  1K73 C;  4QW2 A;  4C8Q F;  5FRN A;  3HHT B;  4XTV A;  3URG A;  1D3B B;  3HL8 A;  1UGP B;  2DVE A;  2FB7 A;  1NE8 A;  3CME A;  2RI5 A;  2MWP A;  1UB4 A;  3MEU A;  4BE0 A;  4HA8 A;  3RIR A;  4ZGE B;  2LRQ A;  1VQP A;  5GAO l;  2DKG A;  1Q82 C;  2V8K A;  4R55 A;  4M7D G;  5C6S A;  3LH0 A;  3GLX A;  3CCE A;  1FWZ A;  4N4I A;  4OB1 B;  4RCC A;  2DXB A;  2A3L A;  2VV5 A;  2M1H A;  2RD1 A;  3OW2 A;  1Y96 B;  5KCH A;  4IUP A;  2X4X A;  3LGL A;  4M77 G;  4KUD K;  1OZ3 A;  4LDX A;  2EAY A;  5CR2 A;  2R57 A;  5LJ5 h;  4M7A A;  4LD9 K;  5D6X A;  1M8V A;  4DOW A;  5I2S A;  5KCO A;  4KUI A;  3JCM h;  3CCV T;  2DXU A;  1VQ8 A;  4J8O A;  2CZ6 B;  1M1K U;  5I21 A;  2DZ9 A;  2RH2 A;  2LT4 A;  3V8K A;  3CC7 T;  1NPR A;  2EYQ A;  5CQX A;  3X26 B;  2PUO B;  3P8H A;  5GAO n;  1KC8 C;  4PJO D;  4F7U F;  2DD5 A;  4A4E A;  4C5G A;  4F7U G;  3M57 A;  1HK9 A;  3WXM B;  4WF2 A;  4QQG A;  3MP6 A;  2JUF A;  2L5Q A;  4FT2 A;  5GAM e;  3CCM A;  4C5H A;  2C06 A;  3PIO A;  4JLG A;  4QVC A;  2LQK A;  2O4X A;  3SWN C;  4ZN1 A;  4OP0 A;  1LJO A;  2RM4 A;  2ZGW A;  3QYG B;  4M75 B;  3RKW A;  3TRE A;  3C95 A;  3GP8 A;  3VU3 C;  3CMA T;  3RMS A;  1OYX A;  5DLO A;  2OTJ T;  3OYB A;  3A8O B;  2LNV A;  3G4S T;  2RHX A;  4JS5 A;  3CCQ T;  1VQ6 T;  2KK4 A;  3BFM A;  3E9F A;  3L2U A;  4JJN K;  1YI2 T;  3PT9 A;  4M77 A;  4OF1 A;  4RMO A;  2O4X B;  2DK3 A;  3FDR A;  3CCU T;  3X28 B;  2CZ1 B;  4N4G A;  1XQH A;  1XNI A;  2BIV A;  3LX7 A;  3L1A A;  2L8D A;  4L6V 5;  5CVI A;  2KAF A;  1WQ7 A;  2DD4 A;  3M59 A;  1S72 A;  5LJ5 e;  5LJ3 d;  1KD1 U;  3QKJ A;  4LDV A;  4BD3 A;  4XU1 A;  4FIB A;  2QQB A;  5GAN 3;  3SB2 A;  5D6Y A;  3HFO A;  1M90 U;  2DTO A;  2XIC A;  3OMG A;  4ZGD B;  2KDS A;  3VKI A;  2DIG A;  1QVF A;  5FRM A;  4V2S A;  2LQ8 A;  3L2R A;  4M77 B;  1UGQ B;  4JRP A;  1G3S A;  4F7U A;  4GLK A;  2KVQ G;  4C0G A;  5GMK m;  2F5K A;  2WSF E;  3A8M B;  5A2Q E;  4M7A F;  3ASK A;  3QJY A;  1Q7Y U;  2DIQ A;  4J6X A;  1YIJ A;  2PVG B;  1Q86 U;  3SD4 A;  4M7D B;  3OS5 A;  3RES A;  2YHT A;  1YJN T;  3QJ6 A;  3ER0 A;  2DEQ A;  4C92 G;  4EDU A;  2FYK A;  2QQR A;  1JB0 E;  2WAC A;  4A54 A;  2NLU A;  1I8F A;  5CO7 A;  4LDY A;  2EQU A;  3PNW C;  2RJD A;  4IUU A;  1N9S A;  2M16 A;  3JCM d;  1B34 B;  3CBP A;  3FC3 A;  1KQ1 A;  3CC4 T;  1V29 B;  2O01 E;  3RMQ A;  3G6E T;  3HFN A;  4MDX A;  2X4Y A;  1VQ6 A;  3OBY A;  3CCQ A;  3G4S A;  4EMK B;  1K9M C;  4M7A B;  2JZ2 A;  3CCV A;  1FX7 A;  2V8J A;  1I4K 1;  3CMA A;  1QVP A;  3HPW A;  4IUQ A;  4M75 G;  3CBO A;  4XK8 E;  5GAN 2;  3PMT A;  2E10 A;  3L2V A;  1BKB A;  1JJ2 S;  3C4S A;  2G3R A;  3I56 T;  2K5I A;  3V8J A;  3C94 A;  3FIF A;  1AHJ B;  5A0G A;  3L2W A;  3NTK A;  4EMK A;  2EIF A;  4LD6 A;  4P5N A;  2Y4Y A;  4OVA A;  3JCM J;  1YBY A;  4MMK A;  3DB3 A;  5GAN 5;  2DJZ A;  3OYL A;  2QI2 A;  1O9S A;  3E1S A;  3OS0 A;  2K5L A;  2E64 A;  2Y4X A;  1LNX A;  4BY6 B;  1JBM A;  1X75 C;  4N4H A;  5CKB A;  2RI2 A;  3PIP A;  1VQP T;  1VQN T;  3JB9 G;  3HKS A;  4RG2 A;  4M78 E;  2JTF A;  4M77 F;  5HY6 A;  1N9R A;  3MP8 A;  1NPP A;  2FHD A;  2Y90 A;  3CC2 A;  4M75 C;  2XDD A;  3CPW A;  2BKD N;  5J26 A;  4M77 C;  4BUG A;  2LVM A;  2ZCF B;  3OS2 A;  4E7L A;  5LJ5 d;  3OBW A;  2GF7 A;  2E6Z A;  2MAM A;  2CYZ B;  3LGF A;  1U1T A;  4M75 F;  4XTW A;  1OI1 A;  2PVD B;  1DJ7 B;  4BB7 A;  4MZP A;  1FXX A;  4OB0 B;  3JB9 I;  3S3N A;  3LWH A;  1QW1 A;  3JCM c;  5LJ5 g;  1KD1 C;  2GQV A;  2XI9 A;  3M55 A;  4C8Q D;  3OS1 A;  1YJW T;  1VQ5 A;  3HSB A;  2QQ9 A;  2DAQ A;  2K57 A;  4FU6 A;  2WSE E;  3OSV A;  1X6O A;  2LX9 A;  4RG8 A;  3DKM A;  3UDC A;  1YJW A;  1M1K C;  1VQ5 T;  4Y28 E;  5KE3 A;  4MML A;  1YJN A;  3BW1 A;  1U8R A;  1BI2 A;  3LYI A;  4PJO A;  3MHX A;  2KMT A;  5EG2 A;  1QP3 A;  1XTD A;  5GAN f;  5GAO p;  1YJ9 T;  3OYD A;  3VV0 A;  1BYM A;  1KQS A;  5CKH A;  2KY9 A;  5AYF A;  4XTZ A;  2CKK A;  3CC2 T;  4M7A G;  2YLC A;  2RJF A;  2K3X A;  5GAM g;  1JJ2 A;  1VQK T;  4EMG A;  4R56 A;  4M7D C;  2XK0 A;  2ZZD A;  4M78 B;  1W2B S;  1G3T A;  2E6N A;  1Y71 A;  2FVU A;  2EJF A;  2R5A A;  4Q5W A;  4C8Q C;  5GAO q;  3PTA A;  4QQ6 A;  3CXC S;  3FB9 A;  2WSC E;  4LDU A;  3JRZ A;  5CKF A;  2D9T A;  4EPC A;  3CXC A;  1Y07 A;  2EWN A;  2QQS A;  4C92 B;  3OYN A;  2EQJ A;  3FLG A;  2R5M A;  4QVD A;  1BI1 A;  3P8D A;  3CD6 A;  1QVG S;  4J6W A;  1KG1 A;  2DXT A;  3NTH A;  4JDS A;  4X9D A;  1YI2 A;  3QUI A;  2B8A A;  3NFC A;  3GOX A;  1K8A C;  2D6F A;  3L42 A;  3OSS C;  3M54 A;  4M7A C;  2V8I A;  3QII A;  4PJO G;  3CCS T;  4IUR A;  4IUT A;  1P92 A;  2E1H A;  3QZ9 B;  5LJ3 j;  1VQM T;  5L8R E;  2E65 A;  4JRI A;  3I55 T;  4KT0 E;  2M9U A;  3VYH B;  5D6W A;  4KBM B;  3JB9 H;  3OYA A;  1G3W A;  4D6W A;  4ME7 A;  4N0A A;  2RJE A;  3OB9 A;  5GMK h;  3HRU A;  4O6J A;  3V7R A;  5GAN j;  3JB9 D;  1Q7Y C;  1KQ2 A;  2VGN A;  2I2L A;  3EAE A;  4BDZ A;  5GAM j;  3BDL A;  5FU6 B;  4ZN3 A;  1G3Y A;  4ELZ C;  1W4S A;  2XU8 A;  4X34 A;  3RKY A;  5GAO m;  4FM4 B;  1I5L A;  3Q1J A;  2LDM A;  1M4Z A;  2RA2 A;  5A0D A;  1VUB A;  3VJP A;  5GAN 8;  2EQK A;  1IRE B;  2QDY B;  3G71 A;  1KQS S;  1YIT T;  4C8Q G;  4PL6 A;  4J6Y A;  3KXT A;  1EIF A;  1N6A A;  1Y96 A;  4XAX B;  2JTM A;  4C92 E;  2FL7 A;  3GF5 A;  1R8O B;  1YHQ T;  2HNI A;  3A5Z B;  5I2M A;  3ZBD A;  5GAM f;  5GAM h;  2MMP A;  1YIT A;  4E7I A;  4NS5 A;  1S72 T;  3J7A F;  4CRI A;  3CCE T;  4XTU A;  3MEA A;  2K5F A;  1ZQ1 A;  3QXE B;  1YHQ A;  2E5Q A;  3QDR B;  4IKF A;  3RUX A;  2EFI A;  2PU9 B;  5GAN g;  1M5Q 1;  5HK3 A;  1B34 A;  1I81 A;  1MGQ A;  2MF2 A;  3CEY A;  3FRN A;  4PJO F;  5GMK l;  2QEX T;  2XDB A;  4Y91 A;  3GNG A;  1VQO A;  5DLQ E;  4M75 E;  1WPY A;  4KUL A;  3CME T;  3QYH B;  3OA6 A;  5FU7 C;  5GAN 4;  5GMK e;  3OYG A;  3QZ5 B;  4M7D E;  4M7D A;  5LJ5 f;  5IN1 A;  3FJP A;  3DB4 A;  2QQA A;  4J83 A;  3I55 A;  3HRT A;  4FL6 A;  4OB3 B;  4OB2 B;  3V7S A;  2QTX A;  4M78 C;  2CZ0 B;  3OYF A;  4BE1 A;  3KUF A;  1VQM A;  5IT9 E;  1BIB A;  3VUB A;  2RI3 A;  3QG1 A;  3S6W A;  3SDZ A;  2VXF A;  5J3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...