3URGA

The crystal structure of anabaena ccbp
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
126
structure length
123
Chain Sequence
MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ellman's reagent in promoting crystallization and structure determination of Anabaena CcbP.
pubmed doi rcsb
source organism Nostoc
molecule tags Metal binding protein
molecule keywords Alr1010 protein
total genus 37
structure length 123
sequence length 126
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11535 Calci_bind_CcbP Calcium binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.530 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3urgA02
2P0QA 2P0PA 2K2VA 3URGA
chains in the Genus database with same CATH superfamily
2AIRB 5GAOl 4DBFA 3UT1A 3WVDB 1HXDA 3OMCA 3JB9D 3CEYA 2COZA 1OZ3A 1I8FA 3NPFA 1VQ9A 2HKQB 1KFZA 4N0AA 3CCLT 3HFOA 5CKBA 1VQOT 1MNEA 4PJOD 5GANj 1UTIA 5KYXB 3G7ZA 1WXUA 2LTOA 4RTWA 3RDVA 1VIFA 2R5AA 2COWA 1M1KU 4JUVA 1KHIA 2LZ6B 1AWOA 4PJMA 2HZYA 2BE9B 3CCST 2RHYA 4AT1B 5A0DA 4MZPA 1W70A 5GMKe 2QGFB 4RCBA 1YJNT 2E64A 3JCMP 5GAMd 1NJIR 4M7DE 2CUBA 2ENMA 2DILA 3MHXA 2I2LA 5GMKh 4RTZA 1PWTA 3QWYA 2O88A 4PLIA 2GGRA 2J6OA 4AG1C 2LJ0A 4FU6A 1VOMA 3S3NA 4O5VA 1PRLC 4OMLA 5CCAA 2CREA 3CCUA 2RQRA 1KQSS 1QVFS 2X3XD 4M7AC 1YJ9Q 2K2MA 2O4XA 3M4YA 1WHLA 3CMAQ 3A8OB 3JCMg 3A8GB 1YJNQ 2GCXA 1QWFA 2EWNA 4JRIA 3G71A 3HP9A 4M4ZA 2AT1B 1VA7A 3LW5E 4E2FB 3MCAB 3CCSQ 5GMKl 4ME7A 3VS4A 2YRCA 1ARKA 1NBEB 2DMOA 2JZ2A 2DVEA 4CI0C 5LJ5h 1N8RU 1M3BA 3RKWA 1WDXA 1UHFA 2FPDA 4R0KA 4X9CA 1YIJT 4AG2C 4M77F 1I81A 1WJRA 1EZZB 3CCQQ 2EYWA 1D0YA 2KT8A 3VS3A 1G2BA 4M77D 3OYHA 4KULA 4ESRA 3LGLA 1R77A 3I35A 5GAN7 3CCUT 1AWJA 4M75E 1WGSA 1M2OA 4OB0B 4OMPA 4BI3A 4ZNXA 1IZ6A 5FLXE 5GAN5 5GAMg 4M75A 5GANg 2DFUA 2E4HA 1BB9A 2PUOB 3VS6A 2GF7A 4CC3A 1PD1A 4JLIA 2B8AA 1U1SA 3E19A 3P8BB 4M7DF 3CCRQ 2X51A 1QWEA 2RI5A 2D0NA 1X2QA 1JJ2S 5IHKA 1VQKQ 1M9SA 3EG0A 2NYSA 4LDUA 1ZUKA 3DB3A 3JCMh 4JS4A 4OMMA 2K79A 1Y71A 3TREA 5GAMe 3FC3A 4JDSA 3L42A 4D8KA 2VYTA 3ZL7C 2VC8A 2QASA 2HL3A 2VKNA 4ELYC 4BI4A 3EH1A 4C8QB 3JRZA 2QQ9A 2GFAA 3HRUA 1RUWA 2XICA 1Q86C 1VQ9T 4XTXA 5A2QE 5GAOp 1M90U 2XG8D 3CCVA 1VQ6A 1AOJA 4RTUA 4PJJA 1YWPA 4EPCA 1SRLA 1KQ1A 2R5MA 4BB7A 4C0FA 4C8QG 1VQ5A 4EMKB 3CXCA 2QQBA 2HSPA 2VGMA 1JEGA 1UHCA 2BZ8A 5LJ3g 1LOJA 3SWNA 2E6ZA 1NPRA 1WJQA 3UDCA 4A63B 4JRKA 3JCMJ 1KD1R 1NYGA 1IB8A 4II1A 1MMAA 2NUPA 3VS5A 4AFSC 2DBMA 3CCMA 1AEYA 3A5ZB 3AT1B 3TU4K 1QVFA 3CC7T 5L23A 3CXCP 5CQYA 3NMZC 2XU8A 2LNHB 2C06A 2KQWA 1WJSA 4C0DB 2E3IA 4F7UE 3VUBA 2KE9A 3V7CA 4RG2A 4C92B 1BU1A 2H8HA 2QA4Q 3LH0A 1K4US 2PUKB 1YITA 1VQ5Q 1LCKA 1K76A 2AK5A 2KVQG 2MWPA 4MDXA 1RLQC 2DIQA 2CGHA 3OQ5A 2RI3A 3REAB 2M02A 2KSSA 2FG0A 3EG2A 3RERA 1VQLA 1HYOA 2K7AA 3H0HA 3G6EQ 2CUDA 3CCQT 2DBKA 2BTTA 3HRSA 2E10A 2W10A 3A8HB 4Z8AA 3I55A 1VYUA 3HL8A 4M75B 1MMGA 4M77B 3X25B 3PFSA 1PSEA 2A0FB 4KGXB 2FRYA 4BY6C 3OYEA 2M0OA 1W2BS 5AYFA 1UEBA 4A4EA 4KBMB 1Q81U 3THKA 1FMWA 2RO0A 4J9BA 1BBZA 3QPHA 5I2SA 1JU5C 5KYWB 4Y91A 1VQMA 2YRDA 5I22A 2J6KA 4RUGA 2D6FA 4C5HA 4Y28E 3CC4T 1RAFB 3PTAA 1C0MA 1TSFA 4TVRA 4IUTA 1PKTA 1B07A 1EIFA 2XDDA 1VQPT 1VQ6T 2DYBA 2XIDA 1H641 2JN0A 3EFOB 1ZBXA 1T3LA 3I5RA 1M27C 1QVGP 2OTJQ 1K73C 4F16A 5D6WA 3S3OA 2ZAEA 2JNGA 4IUPA 2QAZA 1VQPA 2V8IA 2CH4W 2PNIA 1NG2A 3QDRB 2MYSA 4EMGA 1V1CA 4KUIA 2QQSA 2DL3A 4XTVA 1CSKA 4C8QD 2COYA 1UGVA 2Y90A 2ESWA 1TUDA 5GMKj 4V2SA 1TG0A 2ED1A 1D3BB 3L2RA 1SHFA 2NUTB 5L8RE 2KYMA 3G6ET 1VQ4A 4BE2A 3PT9A 4AFZC 2DLPA 2QDLA 1NYFA 3QBYA 2LCLA 1UGPB 4KGVB 2CP3A 3CPWS 5GAOr 5LJ5f 1X27A 2LCCA 1RL2A 2EYZA 3CC4A 3ZEHA 2PVGB 2IG0A 8ATCB 2EPDA 4IKFA 2QEXQ 1W2BA 2LRQA 3OMGA 4FIBA 3M55A 1GRIA 1YN8A 4J7IA 1SRMA 4QVZA 2WSCE 4E7HA 2V1RA 1N27A 2EKOA 1ZHIA 1M90C 3VS2A 5C6SA 3REBB 2DZ9A 4XQ3A 1TOVA 1V29B 2HAXA 2E12A 3CC7Q 4DOWA 5FU6B 2CP0A 3CPWA 4DBQA 2O9SA 3G1JA 5I11A 2A37A 4Z02A 2OJ2A 2JTFA 1SEMA 2EGCA 2DL8A 5GMKi 2A28A 4C92D 4HCKA 1YI2A 1JJ2A 3PMIA 1C6VX 3CCMQ 3MPUB 4N4GA 4CC2A 3QG1A 2DRMA 1SKUB 3SWNB 2LX7A 3FIFA 1UFFA 2G3RA 1QP2A 4Q5WA 1D09B 1HJDA 2K6DA 4BY6B 1GBRA 4ATOA 3QIIA 3WVEB 4XU0A 1D1CA 2IPOB 2JTEA 2DA9A 3O8VA 3JB9F 1YI2Q 3LLRA 4X9DA 1GFDA 3VRZA 1PKSA 1MMDA 1VQ4T 3C4SA 4QQ6A 3R6NA 3SWNC 2KGTA 2WSEE 3OA6A 3GBQA 2HMAA 4M75D 1PM3A 4XTZA 3GLXA 4M75F 4M7AF 1ZX6A 5GAOq 2JUFA 1QCFA 1NM7A 2H3JA 3M0RA 4HT9A 3QJ6A 3X24B 4A54A 2CP5A 2JXBA 3LWIA 1YJWQ 1ACMB 2QXFA 3G71Q 2RQUA 5FU7B 3ULRB 3M54A 3MP8A 1SPKA 3OYCA 1F1BB 4A4KA 3JB9I 3VS0A 1K8AU 4M78C 2G6FX 3LH5A 3ZBDA 3EGDA 3NGPA 2DD5A 3SFMA 4UC4A 3CCEQ 2NUZA 2XI9A 4OB3B 3RIRA 2DF6A 3UF4A 1Z9QA 4BI8B 2K3XA 4LNPA 3I9QA 4M78E 3FRNA 3M0SA 2K3YA 1HD3A 1JXMA 1QVGA 2OAUA 1PHTA 5KYYB 2KROA 4FYYB 1W1FA 2DZCA 3CCJA 3A8MB 2DEQA 1X2KA 2RK2A 4M7AE 5IXFA 4PNOA 1YJWT 2DO3A 1KIKA 4C92C 2MPXC 2K9GA 1KK7A 2RJDA 1YIJQ 1NLOC 2B86A 2HQHA 2DM1A 4FYVB 1X6BA 3QZ5B 4PJLA 5GAMj 2YUPA 4QKUA 1D0ZA 1XOVA 2LDMA 3S6WA 3VYGA 3CD6T 3C0CA 2L2PA 2WSFE 3QJYA 5I2MA 1TTHB 2BZXA 4M7DC 4EMHA 3OW2S 2F1LA 2E6NA 1OX8A 1YIJA 1NJIU 2RHUA 2C0TA 4M7AA 1UGRB 2W0ZA 1J3TA 2GFUA 4F7UG 2VXFA 1X6OA 1YJ9T 1XQHA 4LXCA 5KYUA 2DX1A 4F04B 1M1KR 4ZTFA 1YHQT 2DTIA 2K57A 2LJ3A 3PMTA 2P84A 4GY5A 1RAHB 3M0PA 1BI3A 3CCMT 3NFCA 2DERA 1T0JA 1TS9A 4D8DA 2HCKA 1Q95G 3JB9G 4M7DD 4M77C 4F7UB 2FL7A 3FDRA 1WHHA 4PJOC 1E6HA 1MV0B 4C92E 2BIVA 3H0FA 4BUGA 2DJQA 3EG9A 5CKEA 4IURA 3JB9H 3J80E 5C0MA 3GOXA 2JS0A 5LJ3d 4E7IA 5GANh 1QP3A 1NEBA 3CBOA 4PJOG 1B34B 2DNUA 2E5KA 3OYMA 2LNVA 1KC8R 3OS2A 4EMKC 1KD1C 4GBQA 2H3EB 1T0HA 2RN8A 1R8OB 1W2BP 4FW1A 2C0IA 1UUEA 2L89A 3TSZA 5HY6A 2MF2A 4EDUA 1Q7YR 2MAMA 2QEXT 1I0CA 3EFRA 2NLUA 2LCSA 1VQ8Q 1X01A 2CS7A 2MI6A 4JJNK 4ZN3A 4JRPA 1FMKA 1VQ7A 2ZPIB 4LD9K 1SG5A 3UPUA 1YP5A 5LJ3f 3CQTA 2JMCA 3M53A 2MMPA 1RAAB 4WCIA 1VQMQ 3EGDB 1G3WA 3CCSA 5HCKA 2ROLA 4L59A 1S1NA 4RTVA 3V8JA 4ZTJA 2ZGWA 3RR6A 1UJYA 4D6WA 2EIFA 2X4YA 1PSFA 2DK3A 3JSCA 1G3SA 3FJ5A 1YCYA 2KI7A 3PNWC 1Q7YC 2CP6A 3VRYA 2JM8A 4M78A 5GANd 1OX9A 3NTIA 1KG1A 1U3OA 1ABOA 3M56A 4C0ZA 3CMEA 1YI2T 2DXUA 2OTLT 2HQEA 4OP0A 1PCXA 2PVOB 2L3SA 3CC4Q 2FVUA 2OTLQ 3QYHB 4M77A 3EH2A 3L2QA 4BDYA 3FJPA 1K9MU 4RTXA 4M78F 4J9HA 4M77E 4OGCA 1AWXA 3VUZA 5CQXA 2RM4A 1U1TA 1WXTA 1UGQB 1RLPC 3E9FA 1VQ7T 2CKKA 2KYBA 5GAMh 3PVQA 4WTOB 1WZOA 2KXDA 4OB2B 6AT1B 1FYNA 4DQ2A 2E70A 4M75C 3OW2P 1XTDA 2KR3A 4FYWB 1K9AA 1OU9A 2E3HA 4X34A 2J7IA 4JZ4A 2MOXA 2XMFA 2YSQA 2XHCA 5DLOA 1ZBJA 2V8KA 3BDLA 2LJ1A 1WHKA 3H9NA 4EMKA 2JM9A 1PRMC 2DL7A 4LDWA 2DYIA 3PIPA 1S72A 2RB6A 1PNJA 3X20B 4OF1A 4KUDK 3CCLQ 1V76A 2ED0A 4MMLA 2VB6A 4DA4A 5KCOA 1Y07A 2OX7A 4F7UF 1WQWA 1K8AC 2L8DA 4PLLA 1JJ2P 2NUTA 4QVDA 2PQWA 1AD5A 5A0LA 2R57A 4XTWA 2XDPA 1YJNA 5KE2A 3V8KA 3J81E 2E1HA 5LJ3h 4ORZA 3OYDA 3L2WA 1WX6A 1MUZA 5HK3A 3JCMV 3M0TA 3CMEQ 2K5IA 2VXEA 2YUQA 3SEMA 2FZKB 4E7JA 1AVZC 5LJ3e 1N8RC 3JB9J 5CKFA 1OEBA 1H92A 2NWMA 5HKCA 2LX9A 4JLGA 1QVGS 1JBMA 2QA4A 1YFNA 4HVWA 1NJIC 3QHSA 4GLKA 1ZSZA 1YCSB 3MEVA 5IT9E 3E1SA 3MJXA 1GFCA 3MP1A 3OYAA 3O5ZA 2DPPB 3RKYA 4J9DA 3KFVA 1H3ZA 2E5QA 1VQ6Q 2P0PA 5CKHA 4WF2A 4AMCA 8AT1B 1OPLA 2YLBA 4B9WA 2RH2A 3NTHA 2LQNA 2KXCA 1JQQA 1CKAA 3INZA 4IIOA 4LDYA 2ZCFB 3OYJA 1K0SA 1X6GA 1VQ8A 2FYKA 2X35A 1ZUUA 2MWOA 1T3SA 1YNZA 1WHMA 3OYKA 2K5FA 2J06A 4AFQC 4LD6A 1PC0A 2LQWA 4J9FA 3OY9A 4R55A 3KBGA 3NTKA 1SHGA 2HBWA 1Y0MA 4F7UA 4PKCC 4PFPA 2RJFA 2ZPFB 1VQMT 5GAN3 1KHCA 1TUCA 2CSIA 5GJVB 4DEXA 5KYNA 1X75C 3CCEA 4FCYA 1FXXA 2LQKA 4M7AG 2YUNA 2Z0WA 3G4ST 2F5KA 1YWOA 2X3WD 4JS5A 3RBBB 3U23A 3ER0A 3Q1JA 2KNBB 3HFNA 1VQ8T 3CMAA 2P0QA 1Q86U 4JJDA 4RCCA 1UG1A 2P4RA 1ZA2B 3RESA 2KT1A 3JCMe 2PU9B 5KYUB 3BE3A 2KMTA 4XU2A 1RAIB 5GAOm 2CYZB 1K9MR 3MEWA 2QQRA 2JT4A 4PL6A 2CZ1B 4XU3A 4XTUA 3G71T 1QCNA 2HDAA 1YHQA 1H3HA 1VYVA 4P5NA 3PE0A 1QVFP 4LE9A 4X1VA 3DLMA 3OSSC 2EQMA 4IUVA 5FRNA 2EGAA 3UA6A 3OYLA 3QZ9B 1YJ9A 2CDTA 5CAIA 1WI7A 1QKXA 4KH0B 3M58A 2XD0A 2L3PA 1SF9A 3MO8A 3VKIA 1Q81R 2LP5A 1UE9A 2WACA 2OTLA 1UB4A 1UDLA 5CVIA 1QKWA 1ZUYA 1O9SA 2KY9A 4NL3A 1NE8A 3OSVA 2EAYA 4C92A 2RJEA 2EYXA 1NEGA 4E6RA 3H41A 3HTRA 2AHJB 3EHQA 1W6XA 1I5OB 1Y57A 5J26A 1E7OA 3BY7A 1VIEA 5LJ5e 5GMKm 3EGXB 1RAGB 2CP2A 1MMNA 1WA7A 2AKLA 1U8RA 4J6WA 3ASKA 1JRIA 1M1FA 1OZ2A 5IXBA 2M16A 1UGSB 3QO3A 2HBPA 3H6ZA 1IXDA 5D6XA 1WQ7A 3URGA 1X43A 2A7YA 2DKGA 2P0KA 3M59A 1M3AA 1N5ZA 1IHVA 4J5YA 2K5LA 2FZGB 4HA8A 2DE0X 2ATCB 4HVVA 5M9OA 1WYXA 5IH2A 1VQKT 3H0IA 4A4GA 3M4GA 4CRIA 3DLLA 2EJFA 2DL4A 3EG3A 4J9CA 1KC8C 1M8MA 1G3TA 3H8ZA 2ZZDA 3DKMA 2I0NA 3R6OA 3CCET 3F70A 3C95A 3QXEB 1TUGB 2LMJA 1FX7A 5EC7A 1OOTA 5KYWA 3IQLA 2SRCA 1QVPA 2BUDA 4PJOB 4MZTA 3L2ZA 3M0QA 2EGEA 2IVWA 1H8KA 2RA2A 3L1AA 1KSWA 3GP8A 4KGZB 2EYYA 1QLYA 1QMCA 4C92G 3PIOA 1WIEA 1IGUA 4L5GA 1OYXA 4JJBA 2OAWA 3CCLA 3BFMA 4Y92A 2FZCB 4C92F 4C8QE 5GAN6 1ZQ1A 4JZ3A 4DEYA 2RMOA 1LJOA 2HSEB 1BI1A 1VQ7Q 4YTLA 4MMKA 3I56Q 3WXMB 3I5SA 4M7DA 4CC4B 1EX4A 2D0QB 1VYTA 1RADB 4C8QC 5GJWB 1VQLT 2CZ7B 3S3MA 1MNDA 1YITQ 1WNLA 2FPFA 4GLMA 5GAOn 3NHNA 2CT3A 2AKKA 3CD6A 3MEAA 4RMOA 1Q81C 3J7AF 1OPKA 1FWZA 1SSHA 4F14A 1BIAA 5GANf 5CO7A 2VUBA 2M9UA 3CBPA 5EG2A 2KEAA 4HCBA 3QSUA 4HT8A 5IHIA 2FHDA 1NPPA 2X4JA 4M7AD 1M30A 1LNXA 1CKBA 1NZ9A 2YHTA 3C94A 4XTYA 2QTVA 1K9MC 5IN1A 2JJ9A 4J7FA 1B34A 4J6XA 4BE0A 1LVKA 1AWWA 4BD3A 4JPBW 4C5GA 3CC7A 1BIBA 2XDBA 4LUDA 4ZGJB 3EFSA 1GCPA 4FSSA 2AZSA 4C5EA 5KE3A 1I5LA 3QDFA 2D1XA 2CT4A 4LDXA 1MV3A 4PJOE 4B9XA 3GNGA 1HSQA 1TWBA 1OI1A 2YDLA 3LYIA 1QCOA 5GANe 3EFOA 2F69A 3E2UA 3BDUA 3TVTA 4ELZC 1VQOQ 1GBQA 2VVKA 3G6EA 4A53A 4PJOF 1VQ5T 1NLPC 3META 3M0UA 5J39A 1TXQA 2KRMA 5KH6A 4C5IA 1MGQA 1Y7XA 1G3YA 3UWNA 1WXBA 3GPLA 2O01E 3EAEA 2DETA 2KRSA 5FW9A 1PD0A 5I21A 1VUBA 4KH1B 3OS1A 2JOYA 2ABLA 4NL2A 1EFNA 2YT6A 1GXIE 1A0NB 2HKNA 1I07A 2DD4A 1M2VA 4VUBA 2DXCA 2M51A 2O2OA 4DBRA 1K1ZA 2DRKA 2QG9B 2QI2A 9ATCB 5LJ5g 2HD0A 1KD1U 1Q82C 4FT4A 2KK4A 4LDVA 2EYQA 1KQ2A 3T9NA 2J05A 1Y96A 4HKEA 4J9EA 2KAFA 2A3LA 4FM4B 1M3CA 1YHQQ 2ROTA 1KQSA 4HXJA 4IIMA 1AZEA 2DEUA 2J6FA 4M7DG 3EG1A 5ECAA 5J3BA 1N8RR 2X4XA 1SSFA 5KCHA 3KUFA 3JCMX 4M78D 4Z89A 1RI9A 1G5VA 2F2XA 2QEXA 2DVJA 4J6YA 2D9TA 2L0AA 3CCQA 1U5SA 2L3QA 2VV5A 2DAQA 3VJPA 3X26B 7AT1B 3QKJA 2DTHA 3OBYA 3JAME 1PG5B 4N4IA 3TCJA 3JCMW 3LWHA 1BI0A 4OMOA 2V26A 3CPFA 4LUEA 3HKSA 1YITT 4HVUA 4RTTA 1VQLQ 2MIOA 3OYNA 4PFZA 5D7UA 2CZ0B 1S72T 1D0XA 1P92A 3V7RA 2JMAA 2YUOA 1OV3A 2NUPB 1AT1B 3AHUA 3L2UA 2PZ1A 3QWXX 1Z9ZA 3N5BB 2OTJA 3LGFA 4M7AB 1WHGA 2XKOC 4PK4A 2RI2A 4IUUA 1JXOA 1AHJB 1KC8U 2ZPBB 1BKBA 2BKDN 4EIKA 3PVLA 2KDSA 1IRXA 2BE7D 3RMSA 2GQIA 1ZSZB 1YBYA 1JB0E 3RKXA 2LT4A 2M0YA 1Q7YU 2EQIA 3GF5A 1WPYA 1OULA 4O6JA 2PVDB 4PFOA 4ANJA 5IHNA 3CC2T 4RTYA 4FYXB 2ECZA 2AZVA 2IIMA 1GCQA 4ZGEB 4BDZA 1TH7A 3TSWA 3VS1A 3P8HA 4R56A 3HHTB 2RHIA 1YJWA 2L5QA 4FSXA 3GNFB 3CXCS 3CCJT 5DY9A 2F5TX 1VQ4Q 3EG9B 3ME9A 3OS5A 3VS7A 3SHWA 2CSQA 2FO0A 4FL6A 2XK0A 2EBPA 2GNCA 2CZ6B 4ZGDB 1M8VA 1Q82R 1R0BG 5GAN2 4A4FA 5LL6S 1BYMA 5DM7R 4LN2A 2C0OA 1HK9A 2GBQA 3JCMd 5DLQE 2OI3A 2L3RA 2LC4A 4HCCA 3KXTA 4J8OA 5FU6C 3A1PA 5LJ3j 2ZPHB 1BI2A 3OS0A 3V8LA 2SEMA 5CR2A 3CBMA 3P8DA 2FPEA 1K73R 4M78G 1QW1A 4FT2A 2M1HA 2PTKA 3TEEA 2EKHA 3CCJQ 3EHRA 3BW1A 2ZPGB 3I56T 2RQWA 1UJ0A 3HPWA 2HNIA 2LQ8A 3DB4A 1TU0B 2E65A 5D6YA 3CCRT 3EGXA 2JVVA 2HL5C 3GIBA 2RF0A 4DOVA 2A36A 3CC2Q 2HEQA 4M78B 1ZSGA 4E7ZA 2V1QA 1WLPB 1DJ7B 2QQAA 3M57A 5IAYA 4N4HA 3CCUQ 1M5Q1 5LJ5d 3X28B 2DL5A 2ZPEB 1ZA1B 4DBHA 1BK2A 3UA7A 3ZFJA 1GCQC 2GTJA 2O9VA 4OMQA 4C0GA 1U06A 3EGUA 2GTOA 2EW3A 4K11A 1M1GA 3MEUA 4XK8E 3RMQA 3HSBA 2DXTA 4BACA 1M90R 4QW2A 3VYHB 1RAEB 3VV0A 1K8AR 1M2VB 3OB9A 4BE1A 3HRTA 4RKUE 1XNIA 4E47A 1S72Q 4PJOA 1RACB 3CCVT 1WHJA 1UECA 2FEIA 3JCMQ 1N6AA 1I1JA 3FLGA 3MKDA 1WFWA 2OTJT 4E7KA 4M75G 4QQGA 3CMAT 1JO8A 5FWBA 2MCNA 2HQXA 1G8XA 1VQPQ 3CCRA 3FEOA 2RNAA 4KT0E 2JTMA 4QQDA 4MDWA 2RJCA 3LX7A 4QVCA 3E9GA 3I56A 3QYGB 2A08A 1VQKA 2DXBA 2YLCA 3V7SA 4J9IA 2E41A 2QYZA 5FROA 1XJWB 2O4XB 5HK0A 2EQUA 2D8JA 4A4HA 1KQSP 4XAXB 3JCMc 3JCMb 3SB2A 3G4SA 1B3QA 3A8LB 3PGGA 2D8HA 1N9SA 2EJGA 3TQ7P 4AFUC 2VASA 3CD6Q 5A0GA 2YRVA 1LPLA 2KRNA 3QUIA 1Y96B 2EQKA 4E7LA 3A98A 2CP7A 1Q86R 2YWWA 3OYIA 2QK0A 3MP6A 1VQNA 1AZGB 1B7TA 5KYXA 2QA4T 1D1BA 2EVRA 2LVMA 3I55Q 1G83A 5AT1B 2EFIA 2FRWA 2QTXA 4XU1A 2JS2A 3C12A 4PJNA 2O31A 5CIUA 2P4TA 3I55T 3CC2A 2CH4A 3CPWP 2K4YA 1VQNQ 4L6V5 1N9RA 5FWCA 2MK5A 2EJ9A 2VWFA 1ABQA 2RHZA 2F2WA 3OYYA 2K2VA 1IO6A 3D7SB 1RI0A 4M77G 5FU7C 4J83A 4OGEA 1FMVA 3JCMf 2RD1A 4C8QF 5GAMf 4KRTA 1M1KC 1K0XA 3OYGA 3OW2A 4OMFB 4RG8A 2RQTA 3G4SQ 2X9HA 4OB1B 3SDZA 3M9QA 1KJWA 2QDYB 2DTOA 1IHWA 3OBWA 4CC7A 4C0DC 1R0CB 4Z88A 3OYBA 4IUQA 2BZYA 3UATA 4C8QA 1OQKA 2V8JA 1Q82U 5CKDA 2Y4XA 4HCZA 4E7SA 2JW4A 1IGQA 3OYFA 5GAN8 3VU3C 2EQJA 1BCOA 2K3BA 2F2VA 1VQ9Q 4N0AC 5LJ5j 1IREB 2RHXA 3L2VA 1MHNA 1OU8A 5GAN4 1O75A 2RQVA 3SD4A 4JJCA 4OMNA 1M4ZA 4ZN1A 4OVAA 4M7DB 1D3BA 1QQJA 1D1AA 2GQVA 2DJZA 2RPNA 2X4WA 4NOYA 1VQOA 2QGGA 2FB7A 1ZSZC 1ZLMA 4F17A 1RABB 3FB9A 4QT7A 2Y4YA 4MZMA 3CCVQ 1GL5A 1C1AA 1E6GA 5CK9A 4JRQA 2LT1A 3M5AA 4J9GA 3JV3A 1BCMA 4NS5A 5FRMA 2VGNA 1X69A 3RNJA 3CMET 1W4SA 2YXYA 4B6MA 4FW2A 1K73U 2DIGA 1I4K1 2R58A 2RK1A 1VQNT 5KYYA 3RUXA 2KBTA
chains in the Genus database with same CATH topology
5C6SA 3LWHA 5GAOl 1H3ZA 2DZ9A 2E5QA 4XQ3A 1BI0A 3UT1A 1V29B 2P0PA 3CPFA 1HXDA 3WVDB 3OMCA 3JB9D 3CEYA 5CKHA 3HKSA 1YITT 2HAXA 2E12A 4WF2A 4DOWA 5FU6B 3OYNA 3CPWA 1OZ3A 2YLBA 2CZ0B 1S72T 1I8FA 1P92A 4B9WA 2RH2A 3V7RA 1VQ9A 3NTHA 3INZA 4Z02A 4N0AA 2JTFA 3AHUA 4LDYA 2ZCFB 3OYJA 3CCLT 3L2UA 5GMKi 3HFOA 5CKBA 1VQOT 4C92D 1VQ8A 1YI2A 1JJ2A 2FYKA 2X35A 3PMIA 4PJOD 2MWOA 5GANj 3N5BB 4N4GA 3OYKA 2OTJA 3G7ZA 2K5FA 3QG1A 2LTOA 3LGFA 4M7AB 4LD6A 3SWNB 3OY9A 2XKOC 1VIFA 2R5AA 4R55A 1M1KU 3FIFA 3KBGA 2G3RA 1QP2A 3NTKA 1KHIA 2RI2A 4JUVA 4Q5WA 4F7UA 4PKCC 2RJFA 2ZPFB 4BY6B 1VQMT 4ATOA 3CCST 2RHYA 4IUUA 5A0DA 5GAN3 3QIIA 4MZPA 3WVEB 1KHCA 1AHJB 4XU0A 3CCEA 1X75C 4M7AG 1KC8U 1FXXA 2LQKA 2ZPBB 5GMKe 1BKBA 2BKDN 3O8VA 3G4ST 2KDSA 4RCBA 3JB9F 3LLRA 2F5KA 1YJNT 4X9DA 2E64A 3RMSA 3JCMP 1YBYA 5GAMd 4JS5A 1JB0E 1VQ4T 3C4SA 4M7DE 4QQ6A 3SWNC 3RKXA 3ER0A 2LT4A 3Q1JA 3GF5A 1Q7YU 3HFNA 2WSEE 1WPYA 3OA6A 1VQ8T 4O6JA 2PVDB 2I2LA 3MHXA 5GMKh 4M75D 3CMAA 2P0QA 1Q86U 4XTZA 3CC2T 4PLIA 4RCCA 3GLXA 4ZGEB 4BDZA 4M75F 1TH7A 4FU6A 3S3NA 3RESA 3P8HA 4O5VA 4M7AF 4R56A 5GAOq 3HHTB 2RHIA 2JUFA 1YJWA 5CCAA 2H3JA 3JCMe 2PU9B 3CCUA 3QJ6A 3X24B 4A54A 3LWIA 4HT9A 1KQSS 2L5QA 2KMTA 4FSXA 1QVFS 4M7AC 3GNFB 3CXCS 3CCJT 5DY9A 2F5TX 2QXFA 4XU2A 3ME9A 3OS5A 2O4XA 3M4YA 5FU7B 3M54A 3A8OB 3JCMg 3A8GB 2CYZB 5GAOm 3MEWA 2QQRA 4FL6A 3MP8A 2GCXA 2XK0A 3OYCA 4PL6A 2CZ1B 4A4KA 3JB9I 2EWNA 4XTUA 4XU3A 4JRIA 3G71T 2CZ6B 3G71A 1K8AU 3HP9A 3LW5E 4ZGDB 1YHQA 3MCAB 1M8VA 4M78C 5GMKl 3ZBDA 4ME7A 4P5NA 4A4FA 2DD5A 3SFMA 5GAN2 5LL6S 1BYMA 5DM7R 4UC4A 1HK9A 3DLMA 3OSSC 2EQMA 4IUVA 3JCMd 5FRNA 5DLQE 3OYLA 3QZ9B 2JZ2A 2L3RA 5CAIA 1YJ9A 2DVEA 2LC4A 4HCCA 4CI0C 3KXTA 5LJ5h 1N8RU 2XI9A 4OB3B 3M58A 3RIRA 2XD0A 3RKWA 4J8OA 5FU6C 3MO8A 3VKIA 2WACA 2OTLA 1UB4A 4BI8B 5LJ3j 4X9CA 2K3XA 5CVIA 1O9SA 2KY9A 2ZPHB 4M77F 1YIJT 1BI2A 3OS0A 4M78E 3V8LA 1I81A 1WJRA 3FRNA 5CR2A 2K3YA 4NL3A 3CBMA 1NE8A 2OAUA 3OSVA 3P8DA 1QVGA 2EAYA 4M78G 2DZCA 1QW1A 4M77D 3OYHA 4KULA 3CCJA 4FT2A 3A8MB 3LGLA 2M1HA 2DEQA 2RK2A 5GAN7 3TEEA 4C92A 2RJEA 4M7AE 3CCUT 4PNOA 1YJWT 4M75E 2DO3A 1WGSA 3BW1A 2ZPGB 4OB0B 4C92C 2AHJB 3I56T 4BI3A 1IZ6A 2RJDA 5FLXE 3HPWA 5GAN5 2HNIA 5GAMg 2LQ8A 3DB4A 5J26A 3BY7A 4M75A 1VIEA 5LJ5e 2E65A 5GANg 5D6YA 5GMKm 3CCRT 2PUOB 3QZ5B 2JVVA 2GF7A 3GIBA 4DOVA 5GAMj 4JLIA 2B8AA 1U1SA 3E19A 1XOVA 2LDMA 3P8BB 4M78B 3S6WA 3VYGA 3CD6T 4M7DF 2WSFE 3QJYA 5I2MA 1U8RA 4J6WA 3ASKA 1JRIA 1M1FA 1OZ2A 2M16A 4M7DC 1UGSB 2RI5A 4EMHA 3OW2S 1DJ7B 3QO3A 2E6NA 2QQAA 1YIJA 1JJ2S 3M57A 1NJIU 1M9SA 2HBPA 2RHUA 5IAYA 4M7AA 4N4HA 3H6ZA 1UGRB 5D6XA 1WQ7A 3URGA 2DKGA 1M5Q1 2A7YA 2GFUA 2P0KA 3X28B 5LJ5d 3M59A 4LDUA 4F7UG 4J5YA 2K5LA 2VXFA 1X6OA 3DB3A 2ZPEB 4HA8A 3JCMh 5M9OA 4JS4A 1YJ9T 3ZFJA 1XQHA 1VQKT 1Y71A 4ZTFA 3TREA 4A4GA 5GAMe 3M4GA 3FC3A 4JDSA 3L42A 1YHQT 2DTIA 4CRIA 3DLLA 2K57A 2EJFA 2VYTA 4C0GA 2VC8A 3PMTA 4GY5A 1M1GA 1KC8C 1BI3A 3CCMT 3MEUA 4BI4A 4ELYC 1G3TA 4C8QB 3JRZA 4XK8E 3NFCA 3H8ZA 3RMQA 3HSBA 2DXTA 2QQ9A 2ZZDA 3DKMA 4BACA 2GFAA 3HRUA 4QW2A 3VYHB 2XICA 3VV0A 1Q86C 3JB9G 1VQ9T 3R6OA 4M77C 3F70A 4XTXA 3OB9A 5A2QE 3C95A 4BE1A 3CCET 4F7UB 5GAOp 2FL7A 3FDRA 3QXEB 1M90U 3HRTA 4RKUE 4PJOC 1FX7A 2XG8D 1XNIA 4E47A 4PJOA 4C92E 3CCVT 2BIVA 1QVPA 2BUDA 3CCVA 4PJOB 1VQ6A 4MZTA 3L2ZA 4BUGA 3JCMQ 1N6AA 2IVWA 3FLGA 5CKEA 2RA2A 4IURA 3L1AA 2OTJT 3JB9H 3J80E 5C0MA 3GP8A 3GOXA 4E7KA 5LJ3d 4M75G 4EPCA 4C92G 3PIOA 4E7IA 4QQGA 3CMAT 1KQ1A 1QP3A 2R5MA 4L5GA 4BB7A 5GANh 3CBOA 4C0FA 1OYXA 4PJOG 1B34B 4C8QG 2HQXA 3OYMA 2LNVA 1VQ5A 4EMKB 3CCLA 3CXCA 2QQBA 3OS2A 3BFMA 4EMKC 2VGMA 1KD1C 4C92F 4C8QE 5GAN6 3CCRA 3FEOA 1ZQ1A 1R8OB 2JTMA 4KT0E 4QQDA 4MDWA 1LOJA 5LJ3g 3SWNA 2L89A 1LJOA 2E6ZA 2MF2A 2RJCA 3LX7A 5HY6A 3E9GA 4EDUA 3QYGB 1NPRA 1WJQA 4QVCA 3I56A 1VQKA 3UDCA 2MAMA 2QEXT 3EFRA 2DXBA 1BI1A 4JRKA 3JCMJ 2NLUA 4YTLA 2YLCA 3V7SA 1X01A 2CS7A 2E41A 2MI6A 4JJNK 4MMKA 5FROA 4II1A 3WXMB 4ZN3A 2O4XB 4M7DA 4JRPA 3CCMA 2D0QB 3A5ZB 4C8QC 5HK0A 3TU4K 2EQUA 2ZPIB 1VQ7A 1QVFA 1VQLT 2CZ7B 3S3MA 3CC7T 4A4HA 4LD9K 1WNLA 5CQYA 5GAOn 2XU8A 4XAXB 3UPUA 5LJ3f 3JCMc 2C06A 2KQWA 3JCMb 3CD6A 3M53A 2MMPA 3MEAA 1WJSA 3SB2A 4RMOA 3G4SA 4C0DB 1FWZA 1Q81C 3J7AF 4F7UE 3VUBA 3A8LB 1G3WA 3PGGA 1N9SA 2EJGA 3V7CA 4RG2A 3CCSA 4L59A 1BIAA 5GANf 4C92B 5CO7A 3V8JA 4ZTJA 2ZGWA 5A0GA 2YRVA 2VUBA 2M9UA 3CBPA 5EG2A 4HCBA 3LH0A 4M7DD 3QSUA 4HT8A 4D6WA 2EIFA 2X4YA 2PUKB 1YITA 1PSFA 2FHDA 1NPPA 2X4JA 3QUIA 1Y96B 2DK3A 1G3SA 2EQKA 3JSCA 4E7LA 4M7AD 1YCYA 1LNXA 2KVQG 2MWPA 1NZ9A 2YHTA 3OYIA 3PNWC 3MP6A 3C94A 4XTYA 1Q7YC 1K9MC 5IN1A 1VQNA 4MDXA 2DIQA 2CGHA 4J7FA 4M78A 1B34A 4J6XA 5GANd 3NTIA 2RI3A 3OQ5A 4BE0A 1KG1A 2KSSA 3M56A 4BD3A 4C0ZA 3CMEA 2QA4T 2DXUA 4C5GA 1YI2T 2LVMA 3RERA 2OTLT 2HQEA 4OP0A 3CC7A 1VQLA 1BIBA 2XDBA 2EFIA 4ZGJB 3EFSA 2QTXA 4XU1A 3CCQT 2PVOB 4C5EA 5KE3A 3HRSA 3C12A 1I5LA 2P4TA 5CIUA 2E10A 3A8HB 2FVUA 3I55T 3QYHB 4M77A 3CC2A 3I55A 4LDXA 4M75B 3HL8A 2K4YA 4M77B 3X25B 3L2QA 4BDYA 3PFSA 4B9XA 4PJOE 1PSEA 4BY6C 3OYEA 3FJPA 3GNGA 1N9RA 4L6V5 1K9MU 4M78F 1OI1A 2EJ9A 3LYIA 2M0OA 4M77E 1W2BS 2RHZA 5GANe 5AYFA 2F69A 4OGCA 1UEBA 3OYYA 4A4EA 2K2VA 3VUZA 1RI0A 3BDUA 4KBMB 4M77G 5CQXA 4ELZC 2RM4A 4J83A 5FU7C 2RO0A 4OGEA 1Q81U 1U1TA 1UGQB 3E9FA 3G6EA 1VQ7T 3JCMf 2CKKA 4PJOF 4A53A 5GAMh 2RD1A 1VQ5T 4C8QF 3QPHA 3META 5GAMf 1M1KC 5I2SA 4OB2B 5J39A 3OYGA 4Y91A 3OW2A 4OMFB 1VQMA 5KH6A 4C5IA 4RG8A 1MGQA 1Y7XA 1G3YA 4DQ2A 2D6FA 3UWNA 4C5HA 3GPLA 4OB1B 2E70A 2O01E 3EAEA 4M75C 4Y28E 3CC4T 1XTDA 3SDZA 3PTAA 4TVRA 3M9QA 4IUTA 2QDYB 1EIFA 2DTOA 2XDDA 3OBWA 1VQPT 1VQ6T 5I21A 2XIDA 1VUBA 1H641 4X34A 4C0DC 3OS1A 3OYBA 2JN0A 2JOYA 2XHCA 5DLOA 3BDLA 2V8KA 1ZBXA 4IUQA 4C8QA 1K73C 4NL2A 4EMKA 2V8JA 5D6WA 1Q82U 1GXIE 5CKDA 3S3OA 2Y4XA 4LDWA 2JNGA 2DD4A 3PIPA 1S72A 4HCZA 4VUBA 2RB6A 4IUPA 2DXCA 3OYFA 3X20B 4KUDK 4OF1A 5GAN8 3VU3C 2V8IA 1VQPA 2EQJA 3QDRB 4MMLA 2QI2A 4EMGA 4N0AC 5LJ5g 5LJ5j 4KUIA 2HD0A 1IREB 2QQSA 2RHXA 3L2VA 1MHNA 4XTVA 1KD1U 5GAN4 4DA4A 5KCOA 1O75A 4FT4A 2KK4A 4LDVA 1Y07A 1Q82C 4C8QD 4F7UF 2EYQA 3SD4A 1KQ2A 2Y90A 3T9NA 1M4ZA 1WQWA 5GMKj 1Y96A 1K8AC 4V2SA 4HKEA 4ZN1A 2KAFA 4OVAA 2L8DA 4M7DB 1D3BB 4PLLA 3L2RA 1D3BA 2A3LA 4QVDA 4FM4B 5L8RE 2PQWA 3G6ET 2GQVA 2DJZA 4BE2A 1VQ4A 1KQSA 3PT9A 2X4WA 5A0LA 2R57A 3QBYA 4XTWA 2XDPA 1YJNA 2LCLA 4NOYA 5KE2A 3V8KA 1UGPB 1VQOA 3CPWS 5J3BA 5GAOr 3J81E 4M7DG 2E1HA 5LJ5f 2LCCA 5LJ3h 2FB7A 2X4XA 1RL2A 5HK3A 3OYDA 3L2WA 3JCMV 3CC4A 1SSFA 3FB9A 3ZEHA 5KCHA 3KUFA 2Y4YA 4MZMA 2PVGB 3JCMX 2K5IA 2IG0A 4M78D 1G5VA 2VXEA 5CK9A 2QEXA 4JRQA 4E7JA 4IKFA 2LT1A 3JCMW 3M5AA 4J6YA 2D9TA 5LJ3e 1N8RC 1W2BA 2LRQA 3CCQA 3JB9J 5CKFA 3OMGA 4NS5A 5FRMA 2VGNA 2VV5A 4FIBA 5HKCA 2LX9A 4JLGA 1QVGS 1JBMA 3CMET 2QA4A 3M55A 1W4SA 2DAQA 4J7IA 3VJPA 3X26B 3QKJA 1K73U 1NJIC 2DIGA 3QHSA 4GLKA 4QVZA 2DTHA 1I4K1 2R58A 2WSCE 2RK1A 3MEVA 3OBYA 3JAME 3E1SA 5IT9E 1VQNT 3MP1A 4N4IA 4E7HA 3OYAA 3RUXA 1N27A 2EKOA 1ZHIA 2DPPB 3TCJA 1M90C 3RKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0Q A;  2P0P A;  2K2V A;  3URG A; 
#chains in the Genus database with same CATH topology
 2AIR B;  5GAO l;  4DBF A;  3UT1 A;  3WVD B;  1HXD A;  3OMC A;  3JB9 D;  3CEY A;  2COZ A;  1OZ3 A;  1I8F A;  3NPF A;  1VQ9 A;  2HKQ B;  1KFZ A;  4N0A A;  3CCL T;  3HFO A;  5CKB A;  1VQO T;  1MNE A;  4PJO D;  5GAN j;  1UTI A;  5KYX B;  3G7Z A;  1WXU A;  2LTO A;  4RTW A;  3RDV A;  1VIF A;  2R5A A;  2COW A;  1M1K U;  4JUV A;  1KHI A;  2LZ6 B;  1AWO A;  4PJM A;  2HZY A;  2BE9 B;  3CCS T;  2RHY A;  4AT1 B;  5A0D A;  4MZP A;  1W70 A;  5GMK e;  2QGF B;  4RCB A;  1YJN T;  2E64 A;  3JCM P;  5GAM d;  1NJI R;  4M7D E;  2CUB A;  2ENM A;  2DIL A;  3MHX A;  2I2L A;  5GMK h;  4RTZ A;  1PWT A;  3QWY A;  2O88 A;  4PLI A;  2GGR A;  2J6O A;  4AG1 C;  2LJ0 A;  4FU6 A;  1VOM A;  3S3N A;  4O5V A;  1PRL C;  4OML A;  5CCA A;  2CRE A;  3CCU A;  2RQR A;  1KQS S;  1QVF S;  2X3X D;  4M7A C;  1YJ9 Q;  2K2M A;  2O4X A;  3M4Y A;  1WHL A;  3CMA Q;  3A8O B;  3JCM g;  3A8G B;  1YJN Q;  2GCX A;  1QWF A;  2EWN A;  4JRI A;  3G71 A;  3HP9 A;  4M4Z A;  2AT1 B;  1VA7 A;  3LW5 E;  4E2F B;  3MCA B;  3CCS Q;  5GMK l;  4ME7 A;  3VS4 A;  2YRC A;  1ARK A;  1NBE B;  2DMO A;  2JZ2 A;  2DVE A;  4CI0 C;  5LJ5 h;  1N8R U;  1M3B A;  3RKW A;  1WDX A;  1UHF A;  2FPD A;  4R0K A;  4X9C A;  1YIJ T;  4AG2 C;  4M77 F;  1I81 A;  1WJR A;  1EZZ B;  3CCQ Q;  2EYW A;  1D0Y A;  2KT8 A;  3VS3 A;  1G2B A;  4M77 D;  3OYH A;  4KUL A;  4ESR A;  3LGL A;  1R77 A;  3I35 A;  5GAN 7;  3CCU T;  1AWJ A;  4M75 E;  1WGS A;  1M2O A;  4OB0 B;  4OMP A;  4BI3 A;  4ZNX A;  1IZ6 A;  5FLX E;  5GAN 5;  5GAM g;  4M75 A;  5GAN g;  2DFU A;  2E4H A;  1BB9 A;  2PUO B;  3VS6 A;  2GF7 A;  4CC3 A;  1PD1 A;  4JLI A;  2B8A A;  1U1S A;  3E19 A;  3P8B B;  4M7D F;  3CCR Q;  2X51 A;  1QWE A;  2RI5 A;  2D0N A;  1X2Q A;  1JJ2 S;  5IHK A;  1VQK Q;  1M9S A;  3EG0 A;  2NYS A;  4LDU A;  1ZUK A;  3DB3 A;  3JCM h;  4JS4 A;  4OMM A;  2K79 A;  1Y71 A;  3TRE A;  5GAM e;  3FC3 A;  4JDS A;  3L42 A;  4D8K A;  2VYT A;  3ZL7 C;  2VC8 A;  2QAS A;  2HL3 A;  2VKN A;  4ELY C;  4BI4 A;  3EH1 A;  4C8Q B;  3JRZ A;  2QQ9 A;  2GFA A;  3HRU A;  1RUW A;  2XIC A;  1Q86 C;  1VQ9 T;  4XTX A;  5A2Q E;  5GAO p;  1M90 U;  2XG8 D;  3CCV A;  1VQ6 A;  1AOJ A;  4RTU A;  4PJJ A;  1YWP A;  4EPC A;  1SRL A;  1KQ1 A;  2R5M A;  4BB7 A;  4C0F A;  4C8Q G;  1VQ5 A;  4EMK B;  3CXC A;  2QQB A;  2HSP A;  2VGM A;  1JEG A;  1UHC A;  2BZ8 A;  5LJ3 g;  1LOJ A;  3SWN A;  2E6Z A;  1NPR A;  1WJQ A;  3UDC A;  4A63 B;  4JRK A;  3JCM J;  1KD1 R;  1NYG A;  1IB8 A;  4II1 A;  1MMA A;  2NUP A;  3VS5 A;  4AFS C;  2DBM A;  3CCM A;  1AEY A;  3A5Z B;  3AT1 B;  3TU4 K;  1QVF A;  3CC7 T;  5L23 A;  3CXC P;  5CQY A;  3NMZ C;  2XU8 A;  2LNH B;  2C06 A;  2KQW A;  1WJS A;  4C0D B;  2E3I A;  4F7U E;  3VUB A;  2KE9 A;  3V7C A;  4RG2 A;  4C92 B;  1BU1 A;  2H8H A;  2QA4 Q;  3LH0 A;  1K4U S;  2PUK B;  1YIT A;  1VQ5 Q;  1LCK A;  1K76 A;  2AK5 A;  2KVQ G;  2MWP A;  4MDX A;  1RLQ C;  2DIQ A;  2CGH A;  3OQ5 A;  2RI3 A;  3REA B;  2M02 A;  2KSS A;  2FG0 A;  3EG2 A;  3RER A;  1VQL A;  1HYO A;  2K7A A;  3H0H A;  3G6E Q;  2CUD A;  3CCQ T;  2DBK A;  2BTT A;  3HRS A;  2E10 A;  2W10 A;  3A8H B;  4Z8A A;  3I55 A;  1VYU A;  3HL8 A;  4M75 B;  1MMG A;  4M77 B;  3X25 B;  3PFS A;  1PSE A;  2A0F B;  4KGX B;  2FRY A;  4BY6 C;  3OYE A;  2M0O A;  1W2B S;  5AYF A;  1UEB A;  4A4E A;  4KBM B;  1Q81 U;  3THK A;  1FMW A;  2RO0 A;  4J9B A;  1BBZ A;  3QPH A;  5I2S A;  1JU5 C;  5KYW B;  4Y91 A;  1VQM A;  2YRD A;  5I22 A;  2J6K A;  4RUG A;  2D6F A;  4C5H A;  4Y28 E;  3CC4 T;  1RAF B;  3PTA A;  1C0M A;  1TSF A;  4TVR A;  4IUT A;  1PKT A;  1B07 A;  1EIF A;  2XDD A;  1VQP T;  1VQ6 T;  2DYB A;  2XID A;  1H64 1;  2JN0 A;  3EFO B;  1ZBX A;  1T3L A;  3I5R A;  1M27 C;  1QVG P;  2OTJ Q;  1K73 C;  4F16 A;  5D6W A;  3S3O A;  2ZAE A;  2JNG A;  4IUP A;  2QAZ A;  1VQP A;  2V8I A;  2CH4 W;  2PNI A;  1NG2 A;  3QDR B;  2MYS A;  4EMG A;  1V1C A;  4KUI A;  2QQS A;  2DL3 A;  4XTV A;  1CSK A;  4C8Q D;  2COY A;  1UGV A;  2Y90 A;  2ESW A;  1TUD A;  5GMK j;  4V2S A;  1TG0 A;  2ED1 A;  1D3B B;  3L2R A;  1SHF A;  2NUT B;  5L8R E;  2KYM A;  3G6E T;  1VQ4 A;  4BE2 A;  3PT9 A;  4AFZ C;  2DLP A;  2QDL A;  1NYF A;  3QBY A;  2LCL A;  1UGP B;  4KGV B;  2CP3 A;  3CPW S;  5GAO r;  5LJ5 f;  1X27 A;  2LCC A;  1RL2 A;  2EYZ A;  3CC4 A;  3ZEH A;  2PVG B;  2IG0 A;  8ATC B;  2EPD A;  4IKF A;  2QEX Q;  1W2B A;  2LRQ A;  3OMG A;  4FIB A;  3M55 A;  1GRI A;  1YN8 A;  4J7I A;  1SRM A;  4QVZ A;  2WSC E;  4E7H A;  2V1R A;  1N27 A;  2EKO A;  1ZHI A;  1M90 C;  3VS2 A;  5C6S A;  3REB B;  2DZ9 A;  4XQ3 A;  1TOV A;  1V29 B;  2HAX A;  2E12 A;  3CC7 Q;  4DOW A;  5FU6 B;  2CP0 A;  3CPW A;  4DBQ A;  2O9S A;  3G1J A;  5I11 A;  2A37 A;  4Z02 A;  2OJ2 A;  2JTF A;  1SEM A;  2EGC A;  2DL8 A;  5GMK i;  2A28 A;  4C92 D;  4HCK A;  1YI2 A;  1JJ2 A;  3PMI A;  1C6V X;  3CCM Q;  3MPU B;  4N4G A;  4CC2 A;  3QG1 A;  2DRM A;  1SKU B;  3SWN B;  2LX7 A;  3FIF A;  1UFF A;  2G3R A;  1QP2 A;  4Q5W A;  1D09 B;  1HJD A;  2K6D A;  4BY6 B;  1GBR A;  4ATO A;  3QII A;  3WVE B;  4XU0 A;  1D1C A;  2IPO B;  2JTE A;  2DA9 A;  3O8V A;  3JB9 F;  1YI2 Q;  3LLR A;  4X9D A;  1GFD A;  3VRZ A;  1PKS A;  1MMD A;  1VQ4 T;  3C4S A;  4QQ6 A;  3R6N A;  3SWN C;  2KGT A;  2WSE E;  3OA6 A;  3GBQ A;  2HMA A;  4M75 D;  1PM3 A;  4XTZ A;  3GLX A;  4M75 F;  4M7A F;  1ZX6 A;  5GAO q;  2JUF A;  1QCF A;  1NM7 A;  2H3J A;  3M0R A;  4HT9 A;  3QJ6 A;  3X24 B;  4A54 A;  2CP5 A;  2JXB A;  3LWI A;  1YJW Q;  1ACM B;  2QXF A;  3G71 Q;  2RQU A;  5FU7 B;  3ULR B;  3M54 A;  3MP8 A;  1SPK A;  3OYC A;  1F1B B;  4A4K A;  3JB9 I;  3VS0 A;  1K8A U;  4M78 C;  2G6F X;  3LH5 A;  3ZBD A;  3EGD A;  3NGP A;  2DD5 A;  3SFM A;  4UC4 A;  3CCE Q;  2NUZ A;  2XI9 A;  4OB3 B;  3RIR A;  2DF6 A;  3UF4 A;  1Z9Q A;  4BI8 B;  2K3X A;  4LNP A;  3I9Q A;  4M78 E;  3FRN A;  3M0S A;  2K3Y A;  1HD3 A;  1JXM A;  1QVG A;  2OAU A;  1PHT A;  5KYY B;  2KRO A;  4FYY B;  1W1F A;  2DZC A;  3CCJ A;  3A8M B;  2DEQ A;  1X2K A;  2RK2 A;  4M7A E;  5IXF A;  4PNO A;  1YJW T;  2DO3 A;  1KIK A;  4C92 C;  2MPX C;  2K9G A;  1KK7 A;  2RJD A;  1YIJ Q;  1NLO C;  2B86 A;  2HQH A;  2DM1 A;  4FYV B;  1X6B A;  3QZ5 B;  4PJL A;  5GAM j;  2YUP A;  4QKU A;  1D0Z A;  1XOV A;  2LDM A;  3S6W A;  3VYG A;  3CD6 T;  3C0C A;  2L2P A;  2WSF E;  3QJY A;  5I2M A;  1TTH B;  2BZX A;  4M7D C;  4EMH A;  3OW2 S;  2F1L A;  2E6N A;  1OX8 A;  1YIJ A;  1NJI U;  2RHU A;  2C0T A;  4M7A A;  1UGR B;  2W0Z A;  1J3T A;  2GFU A;  4F7U G;  2VXF A;  1X6O A;  1YJ9 T;  1XQH A;  4LXC A;  5KYU A;  2DX1 A;  4F04 B;  1M1K R;  4ZTF A;  1YHQ T;  2DTI A;  2K57 A;  2LJ3 A;  3PMT A;  2P84 A;  4GY5 A;  1RAH B;  3M0P A;  1BI3 A;  3CCM T;  3NFC A;  2DER A;  1T0J A;  1TS9 A;  4D8D A;  2HCK A;  1Q95 G;  3JB9 G;  4M7D D;  4M77 C;  4F7U B;  2FL7 A;  3FDR A;  1WHH A;  4PJO C;  1E6H A;  1MV0 B;  4C92 E;  2BIV A;  3H0F A;  4BUG A;  2DJQ A;  3EG9 A;  5CKE A;  4IUR A;  3JB9 H;  3J80 E;  5C0M A;  3GOX A;  2JS0 A;  5LJ3 d;  4E7I A;  5GAN h;  1QP3 A;  1NEB A;  3CBO A;  4PJO G;  1B34 B;  2DNU A;  2E5K A;  3OYM A;  2LNV A;  1KC8 R;  3OS2 A;  4EMK C;  1KD1 C;  4GBQ A;  2H3E B;  1T0H A;  2RN8 A;  1R8O B;  1W2B P;  4FW1 A;  2C0I A;  1UUE A;  2L89 A;  3TSZ A;  5HY6 A;  2MF2 A;  4EDU A;  1Q7Y R;  2MAM A;  2QEX T;  1I0C A;  3EFR A;  2NLU A;  2LCS A;  1VQ8 Q;  1X01 A;  2CS7 A;  2MI6 A;  4JJN K;  4ZN3 A;  4JRP A;  1FMK A;  1VQ7 A;  2ZPI B;  4LD9 K;  1SG5 A;  3UPU A;  1YP5 A;  5LJ3 f;  3CQT A;  2JMC A;  3M53 A;  2MMP A;  1RAA B;  4WCI A;  1VQM Q;  3EGD B;  1G3W A;  3CCS A;  5HCK A;  2ROL A;  4L59 A;  1S1N A;  4RTV A;  3V8J A;  4ZTJ A;  2ZGW A;  3RR6 A;  1UJY A;  4D6W A;  2EIF A;  2X4Y A;  1PSF A;  2DK3 A;  3JSC A;  1G3S A;  3FJ5 A;  1YCY A;  2KI7 A;  3PNW C;  1Q7Y C;  2CP6 A;  3VRY A;  2JM8 A;  4M78 A;  5GAN d;  1OX9 A;  3NTI A;  1KG1 A;  1U3O A;  1ABO A;  3M56 A;  4C0Z A;  3CME A;  1YI2 T;  2DXU A;  2OTL T;  2HQE A;  4OP0 A;  1PCX A;  2PVO B;  2L3S A;  3CC4 Q;  2FVU A;  2OTL Q;  3QYH B;  4M77 A;  3EH2 A;  3L2Q A;  4BDY A;  3FJP A;  1K9M U;  4RTX A;  4M78 F;  4J9H A;  4M77 E;  4OGC A;  1AWX A;  3VUZ A;  5CQX A;  2RM4 A;  1U1T A;  1WXT A;  1UGQ B;  1RLP C;  3E9F A;  1VQ7 T;  2CKK A;  2KYB A;  5GAM h;  3PVQ A;  4WTO B;  1WZO A;  2KXD A;  4OB2 B;  6AT1 B;  1FYN A;  4DQ2 A;  2E70 A;  4M75 C;  3OW2 P;  1XTD A;  2KR3 A;  4FYW B;  1K9A A;  1OU9 A;  2E3H A;  4X34 A;  2J7I A;  4JZ4 A;  2MOX A;  2XMF A;  2YSQ A;  2XHC A;  5DLO A;  1ZBJ A;  2V8K A;  3BDL A;  2LJ1 A;  1WHK A;  3H9N A;  4EMK A;  2JM9 A;  1PRM C;  2DL7 A;  4LDW A;  2DYI A;  3PIP A;  1S72 A;  2RB6 A;  1PNJ A;  3X20 B;  4OF1 A;  4KUD K;  3CCL Q;  1V76 A;  2ED0 A;  4MML A;  2VB6 A;  4DA4 A;  5KCO A;  1Y07 A;  2OX7 A;  4F7U F;  1WQW A;  1K8A C;  2L8D A;  4PLL A;  1JJ2 P;  2NUT A;  4QVD A;  2PQW A;  1AD5 A;  5A0L A;  2R57 A;  4XTW A;  2XDP A;  1YJN A;  5KE2 A;  3V8K A;  3J81 E;  2E1H A;  5LJ3 h;  4ORZ A;  3OYD A;  3L2W A;  1WX6 A;  1MUZ A;  5HK3 A;  3JCM V;  3M0T A;  3CME Q;  2K5I A;  2VXE A;  2YUQ A;  3SEM A;  2FZK B;  4E7J A;  1AVZ C;  5LJ3 e;  1N8R C;  3JB9 J;  5CKF A;  1OEB A;  1H92 A;  2NWM A;  5HKC A;  2LX9 A;  4JLG A;  1QVG S;  1JBM A;  2QA4 A;  1YFN A;  4HVW A;  1NJI C;  3QHS A;  4GLK A;  1ZSZ A;  1YCS B;  3MEV A;  5IT9 E;  3E1S A;  3MJX A;  1GFC A;  3MP1 A;  3OYA A;  3O5Z A;  2DPP B;  3RKY A;  4J9D A;  3KFV A;  1H3Z A;  2E5Q A;  1VQ6 Q;  2P0P A;  5CKH A;  4WF2 A;  4AMC A;  8AT1 B;  1OPL A;  2YLB A;  4B9W A;  2RH2 A;  3NTH A;  2LQN A;  2KXC A;  1JQQ A;  1CKA A;  3INZ A;  4IIO A;  4LDY A;  2ZCF B;  3OYJ A;  1K0S A;  1X6G A;  1VQ8 A;  2FYK A;  2X35 A;  1ZUU A;  2MWO A;  1T3S A;  1YNZ A;  1WHM A;  3OYK A;  2K5F A;  2J06 A;  4AFQ C;  4LD6 A;  1PC0 A;  2LQW A;  4J9F A;  3OY9 A;  4R55 A;  3KBG A;  3NTK A;  1SHG A;  2HBW A;  1Y0M A;  4F7U A;  4PKC C;  4PFP A;  2RJF A;  2ZPF B;  1VQM T;  5GAN 3;  1KHC A;  1TUC A;  2CSI A;  5GJV B;  4DEX A;  5KYN A;  1X75 C;  3CCE A;  4FCY A;  1FXX A;  2LQK A;  4M7A G;  2YUN A;  2Z0W A;  3G4S T;  2F5K A;  1YWO A;  2X3W D;  4JS5 A;  3RBB B;  3U23 A;  3ER0 A;  3Q1J A;  2KNB B;  3HFN A;  1VQ8 T;  3CMA A;  2P0Q A;  1Q86 U;  4JJD A;  4RCC A;  1UG1 A;  2P4R A;  1ZA2 B;  3RES A;  2KT1 A;  3JCM e;  2PU9 B;  5KYU B;  3BE3 A;  2KMT A;  4XU2 A;  1RAI B;  5GAO m;  2CYZ B;  1K9M R;  3MEW A;  2QQR A;  2JT4 A;  4PL6 A;  2CZ1 B;  4XU3 A;  4XTU A;  3G71 T;  1QCN A;  2HDA A;  1YHQ A;  1H3H A;  1VYV A;  4P5N A;  3PE0 A;  1QVF P;  4LE9 A;  4X1V A;  3DLM A;  3OSS C;  2EQM A;  4IUV A;  5FRN A;  2EGA A;  3UA6 A;  3OYL A;  3QZ9 B;  1YJ9 A;  2CDT A;  5CAI A;  1WI7 A;  1QKX A;  4KH0 B;  3M58 A;  2XD0 A;  2L3P A;  1SF9 A;  3MO8 A;  3VKI A;  1Q81 R;  2LP5 A;  1UE9 A;  2WAC A;  2OTL A;  1UB4 A;  1UDL A;  5CVI A;  1QKW A;  1ZUY A;  1O9S A;  2KY9 A;  4NL3 A;  1NE8 A;  3OSV A;  2EAY A;  4C92 A;  2RJE A;  2EYX A;  1NEG A;  4E6R A;  3H41 A;  3HTR A;  2AHJ B;  3EHQ A;  1W6X A;  1I5O B;  1Y57 A;  5J26 A;  1E7O A;  3BY7 A;  1VIE A;  5LJ5 e;  5GMK m;  3EGX B;  1RAG B;  2CP2 A;  1MMN A;  1WA7 A;  2AKL A;  1U8R A;  4J6W A;  3ASK A;  1JRI A;  1M1F A;  1OZ2 A;  5IXB A;  2M16 A;  1UGS B;  3QO3 A;  2HBP A;  3H6Z A;  1IXD A;  5D6X A;  1WQ7 A;  3URG A;  1X43 A;  2A7Y A;  2DKG A;  2P0K A;  3M59 A;  1M3A A;  1N5Z A;  1IHV A;  4J5Y A;  2K5L A;  2FZG B;  4HA8 A;  2DE0 X;  2ATC B;  4HVV A;  5M9O A;  1WYX A;  5IH2 A;  1VQK T;  3H0I A;  4A4G A;  3M4G A;  4CRI A;  3DLL A;  2EJF A;  2DL4 A;  3EG3 A;  4J9C A;  1KC8 C;  1M8M A;  1G3T A;  3H8Z A;  2ZZD A;  3DKM A;  2I0N A;  3R6O A;  3CCE T;  3F70 A;  3C95 A;  3QXE B;  1TUG B;  2LMJ A;  1FX7 A;  5EC7 A;  1OOT A;  5KYW A;  3IQL A;  2SRC A;  1QVP A;  2BUD A;  4PJO B;  4MZT A;  3L2Z A;  3M0Q A;  2EGE A;  2IVW A;  1H8K A;  2RA2 A;  3L1A A;  1KSW A;  3GP8 A;  4KGZ B;  2EYY A;  1QLY A;  1QMC A;  4C92 G;  3PIO A;  1WIE A;  1IGU A;  4L5G A;  1OYX A;  4JJB A;  2OAW A;  3CCL A;  3BFM A;  4Y92 A;  2FZC B;  4C92 F;  4C8Q E;  5GAN 6;  1ZQ1 A;  4JZ3 A;  4DEY A;  2RMO A;  1LJO A;  2HSE B;  1BI1 A;  1VQ7 Q;  4YTL A;  4MMK A;  3I56 Q;  3WXM B;  3I5S A;  4M7D A;  4CC4 B;  1EX4 A;  2D0Q B;  1VYT A;  1RAD B;  4C8Q C;  5GJW B;  1VQL T;  2CZ7 B;  3S3M A;  1MND A;  1YIT Q;  1WNL A;  2FPF A;  4GLM A;  5GAO n;  3NHN A;  2CT3 A;  2AKK A;  3CD6 A;  3MEA A;  4RMO A;  1Q81 C;  3J7A F;  1OPK A;  1FWZ A;  1SSH A;  4F14 A;  1BIA A;  5GAN f;  5CO7 A;  2VUB A;  2M9U A;  3CBP A;  5EG2 A;  2KEA A;  4HCB A;  3QSU A;  4HT8 A;  5IHI A;  2FHD A;  1NPP A;  2X4J A;  4M7A D;  1M30 A;  1LNX A;  1CKB A;  1NZ9 A;  2YHT A;  3C94 A;  4XTY A;  2QTV A;  1K9M C;  5IN1 A;  2JJ9 A;  4J7F A;  1B34 A;  4J6X A;  4BE0 A;  1LVK A;  1AWW A;  4BD3 A;  4JPB W;  4C5G A;  3CC7 A;  1BIB A;  2XDB A;  4LUD A;  4ZGJ B;  3EFS A;  1GCP A;  4FSS A;  2AZS A;  4C5E A;  5KE3 A;  1I5L A;  3QDF A;  2D1X A;  2CT4 A;  4LDX A;  1MV3 A;  4PJO E;  4B9X A;  3GNG A;  1HSQ A;  1TWB A;  1OI1 A;  2YDL A;  3LYI A;  1QCO A;  5GAN e;  3EFO A;  2F69 A;  3E2U A;  3BDU A;  3TVT A;  4ELZ C;  1VQO Q;  1GBQ A;  2VVK A;  3G6E A;  4A53 A;  4PJO F;  1VQ5 T;  1NLP C;  3MET A;  3M0U A;  5J39 A;  1TXQ A;  2KRM A;  5KH6 A;  4C5I A;  1MGQ A;  1Y7X A;  1G3Y A;  3UWN A;  1WXB A;  3GPL A;  2O01 E;  3EAE A;  2DET A;  2KRS A;  5FW9 A;  1PD0 A;  5I21 A;  1VUB A;  4KH1 B;  3OS1 A;  2JOY A;  2ABL A;  4NL2 A;  1EFN A;  2YT6 A;  1GXI E;  1A0N B;  2HKN A;  1I07 A;  2DD4 A;  1M2V A;  4VUB A;  2DXC A;  2M51 A;  2O2O A;  4DBR A;  1K1Z A;  2DRK A;  2QG9 B;  2QI2 A;  9ATC B;  5LJ5 g;  2HD0 A;  1KD1 U;  1Q82 C;  4FT4 A;  2KK4 A;  4LDV A;  2EYQ A;  1KQ2 A;  3T9N A;  2J05 A;  1Y96 A;  4HKE A;  4J9E A;  2KAF A;  2A3L A;  4FM4 B;  1M3C A;  1YHQ Q;  2ROT A;  1KQS A;  4HXJ A;  4IIM A;  1AZE A;  2DEU A;  2J6F A;  4M7D G;  3EG1 A;  5ECA A;  5J3B A;  1N8R R;  2X4X A;  1SSF A;  5KCH A;  3KUF A;  3JCM X;  4M78 D;  4Z89 A;  1RI9 A;  1G5V A;  2F2X A;  2QEX A;  2DVJ A;  4J6Y A;  2D9T A;  2L0A A;  3CCQ A;  1U5S A;  2L3Q A;  2VV5 A;  2DAQ A;  3VJP A;  3X26 B;  7AT1 B;  3QKJ A;  2DTH A;  3OBY A;  3JAM E;  1PG5 B;  4N4I A;  3TCJ A;  3JCM W;  3LWH A;  1BI0 A;  4OMO A;  2V26 A;  3CPF A;  4LUE A;  3HKS A;  1YIT T;  4HVU A;  4RTT A;  1VQL Q;  2MIO A;  3OYN A;  4PFZ A;  5D7U A;  2CZ0 B;  1S72 T;  1D0X A;  1P92 A;  3V7R A;  2JMA A;  2YUO A;  1OV3 A;  2NUP B;  1AT1 B;  3AHU A;  3L2U A;  2PZ1 A;  3QWX X;  1Z9Z A;  3N5B B;  2OTJ A;  3LGF A;  4M7A B;  1WHG A;  2XKO C;  4PK4 A;  2RI2 A;  4IUU A;  1JXO A;  1AHJ B;  1KC8 U;  2ZPB B;  1BKB A;  2BKD N;  4EIK A;  3PVL A;  2KDS A;  1IRX A;  2BE7 D;  3RMS A;  2GQI A;  1ZSZ B;  1YBY A;  1JB0 E;  3RKX A;  2LT4 A;  2M0Y A;  1Q7Y U;  2EQI A;  3GF5 A;  1WPY A;  1OUL A;  4O6J A;  2PVD B;  4PFO A;  4ANJ A;  5IHN A;  3CC2 T;  4RTY A;  4FYX B;  2ECZ A;  2AZV A;  2IIM A;  1GCQ A;  4ZGE B;  4BDZ A;  1TH7 A;  3TSW A;  3VS1 A;  3P8H A;  4R56 A;  3HHT B;  2RHI A;  1YJW A;  2L5Q A;  4FSX A;  3GNF B;  3CXC S;  3CCJ T;  5DY9 A;  2F5T X;  1VQ4 Q;  3EG9 B;  3ME9 A;  3OS5 A;  3VS7 A;  3SHW A;  2CSQ A;  2FO0 A;  4FL6 A;  2XK0 A;  2EBP A;  2GNC A;  2CZ6 B;  4ZGD B;  1M8V A;  1Q82 R;  1R0B G;  5GAN 2;  4A4F A;  5LL6 S;  1BYM A;  5DM7 R;  4LN2 A;  2C0O A;  1HK9 A;  2GBQ A;  3JCM d;  5DLQ E;  2OI3 A;  2L3R A;  2LC4 A;  4HCC A;  3KXT A;  4J8O A;  5FU6 C;  3A1P A;  5LJ3 j;  2ZPH B;  1BI2 A;  3OS0 A;  3V8L A;  2SEM A;  5CR2 A;  3CBM A;  3P8D A;  2FPE A;  1K73 R;  4M78 G;  1QW1 A;  4FT2 A;  2M1H A;  2PTK A;  3TEE A;  2EKH A;  3CCJ Q;  3EHR A;  3BW1 A;  2ZPG B;  3I56 T;  2RQW A;  1UJ0 A;  3HPW A;  2HNI A;  2LQ8 A;  3DB4 A;  1TU0 B;  2E65 A;  5D6Y A;  3CCR T;  3EGX A;  2JVV A;  2HL5 C;  3GIB A;  2RF0 A;  4DOV A;  2A36 A;  3CC2 Q;  2HEQ A;  4M78 B;  1ZSG A;  4E7Z A;  2V1Q A;  1WLP B;  1DJ7 B;  2QQA A;  3M57 A;  5IAY A;  4N4H A;  3CCU Q;  1M5Q 1;  5LJ5 d;  3X28 B;  2DL5 A;  2ZPE B;  1ZA1 B;  4DBH A;  1BK2 A;  3UA7 A;  3ZFJ A;  1GCQ C;  2GTJ A;  2O9V A;  4OMQ A;  4C0G A;  1U06 A;  3EGU A;  2GTO A;  2EW3 A;  4K11 A;  1M1G A;  3MEU A;  4XK8 E;  3RMQ A;  3HSB A;  2DXT A;  4BAC A;  1M90 R;  4QW2 A;  3VYH B;  1RAE B;  3VV0 A;  1K8A R;  1M2V B;  3OB9 A;  4BE1 A;  3HRT A;  4RKU E;  1XNI A;  4E47 A;  1S72 Q;  4PJO A;  1RAC B;  3CCV T;  1WHJ A;  1UEC A;  2FEI A;  3JCM Q;  1N6A A;  1I1J A;  3FLG A;  3MKD A;  1WFW A;  2OTJ T;  4E7K A;  4M75 G;  4QQG A;  3CMA T;  1JO8 A;  5FWB A;  2MCN A;  2HQX A;  1G8X A;  1VQP Q;  3CCR A;  3FEO A;  2RNA A;  4KT0 E;  2JTM A;  4QQD A;  4MDW A;  2RJC A;  3LX7 A;  4QVC A;  3E9G A;  3I56 A;  3QYG B;  2A08 A;  1VQK A;  2DXB A;  2YLC A;  3V7S A;  4J9I A;  2E41 A;  2QYZ A;  5FRO A;  1XJW B;  2O4X B;  5HK0 A;  2EQU A;  2D8J A;  4A4H A;  1KQS P;  4XAX B;  3JCM c;  3JCM b;  3SB2 A;  3G4S A;  1B3Q A;  3A8L B;  3PGG A;  2D8H A;  1N9S A;  2EJG A;  3TQ7 P;  4AFU C;  2VAS A;  3CD6 Q;  5A0G A;  2YRV A;  1LPL A;  2KRN A;  3QUI A;  1Y96 B;  2EQK A;  4E7L A;  3A98 A;  2CP7 A;  1Q86 R;  2YWW A;  3OYI A;  2QK0 A;  3MP6 A;  1VQN A;  1AZG B;  1B7T A;  5KYX A;  2QA4 T;  1D1B A;  2EVR A;  2LVM A;  3I55 Q;  1G83 A;  5AT1 B;  2EFI A;  2FRW A;  2QTX A;  4XU1 A;  2JS2 A;  3C12 A;  4PJN A;  2O31 A;  5CIU A;  2P4T A;  3I55 T;  3CC2 A;  2CH4 A;  3CPW P;  2K4Y A;  1VQN Q;  4L6V 5;  1N9R A;  5FWC A;  2MK5 A;  2EJ9 A;  2VWF A;  1ABQ A;  2RHZ A;  2F2W A;  3OYY A;  2K2V A;  1IO6 A;  3D7S B;  1RI0 A;  4M77 G;  5FU7 C;  4J83 A;  4OGE A;  1FMV A;  3JCM f;  2RD1 A;  4C8Q F;  5GAM f;  4KRT A;  1M1K C;  1K0X A;  3OYG A;  3OW2 A;  4OMF B;  4RG8 A;  2RQT A;  3G4S Q;  2X9H A;  4OB1 B;  3SDZ A;  3M9Q A;  1KJW A;  2QDY B;  2DTO A;  1IHW A;  3OBW A;  4CC7 A;  4C0D C;  1R0C B;  4Z88 A;  3OYB A;  4IUQ A;  2BZY A;  3UAT A;  4C8Q A;  1OQK A;  2V8J A;  1Q82 U;  5CKD A;  2Y4X A;  4HCZ A;  4E7S A;  2JW4 A;  1IGQ A;  3OYF A;  5GAN 8;  3VU3 C;  2EQJ A;  1BCO A;  2K3B A;  2F2V A;  1VQ9 Q;  4N0A C;  5LJ5 j;  1IRE B;  2RHX A;  3L2V A;  1MHN A;  1OU8 A;  5GAN 4;  1O75 A;  2RQV A;  3SD4 A;  4JJC A;  4OMN A;  1M4Z A;  4ZN1 A;  4OVA A;  4M7D B;  1D3B A;  1QQJ A;  1D1A A;  2GQV A;  2DJZ A;  2RPN A;  2X4W A;  4NOY A;  1VQO A;  2QGG A;  2FB7 A;  1ZSZ C;  1ZLM A;  4F17 A;  1RAB B;  3FB9 A;  4QT7 A;  2Y4Y A;  4MZM A;  3CCV Q;  1GL5 A;  1C1A A;  1E6G A;  5CK9 A;  4JRQ A;  2LT1 A;  3M5A A;  4J9G A;  3JV3 A;  1BCM A;  4NS5 A;  5FRM A;  2VGN A;  1X69 A;  3RNJ A;  3CME T;  1W4S A;  2YXY A;  4B6M A;  4FW2 A;  1K73 U;  2DIG A;  1I4K 1;  2R58 A;  2RK1 A;  1VQN T;  5KYY A;  3RUX A;  2KBT A; 
#chains in the Genus database with same CATH homology
 5C6S A;  3LWH A;  5GAO l;  1H3Z A;  2DZ9 A;  2E5Q A;  4XQ3 A;  1BI0 A;  3UT1 A;  1V29 B;  2P0P A;  3CPF A;  1HXD A;  3WVD B;  3OMC A;  3JB9 D;  3CEY A;  5CKH A;  3HKS A;  1YIT T;  2HAX A;  2E12 A;  4WF2 A;  4DOW A;  5FU6 B;  3OYN A;  3CPW A;  1OZ3 A;  2YLB A;  2CZ0 B;  1S72 T;  1I8F A;  1P92 A;  4B9W A;  2RH2 A;  3V7R A;  1VQ9 A;  3NTH A;  3INZ A;  4Z02 A;  4N0A A;  2JTF A;  3AHU A;  4LDY A;  2ZCF B;  3OYJ A;  3CCL T;  3L2U A;  5GMK i;  3HFO A;  5CKB A;  1VQO T;  4C92 D;  1VQ8 A;  1YI2 A;  1JJ2 A;  2FYK A;  2X35 A;  3PMI A;  4PJO D;  2MWO A;  5GAN j;  3N5B B;  4N4G A;  3OYK A;  2OTJ A;  3G7Z A;  2K5F A;  3QG1 A;  2LTO A;  3LGF A;  4M7A B;  4LD6 A;  3SWN B;  3OY9 A;  2XKO C;  1VIF A;  2R5A A;  4R55 A;  1M1K U;  3FIF A;  3KBG A;  2G3R A;  1QP2 A;  3NTK A;  1KHI A;  2RI2 A;  4JUV A;  4Q5W A;  4F7U A;  4PKC C;  2RJF A;  2ZPF B;  4BY6 B;  1VQM T;  4ATO A;  3CCS T;  2RHY A;  4IUU A;  5A0D A;  5GAN 3;  3QII A;  4MZP A;  3WVE B;  1KHC A;  1AHJ B;  4XU0 A;  3CCE A;  1X75 C;  4M7A G;  1KC8 U;  1FXX A;  2LQK A;  2ZPB B;  5GMK e;  1BKB A;  2BKD N;  3O8V A;  3G4S T;  2KDS A;  4RCB A;  3JB9 F;  3LLR A;  2F5K A;  1YJN T;  4X9D A;  2E64 A;  3RMS A;  3JCM P;  1YBY A;  5GAM d;  4JS5 A;  1JB0 E;  1VQ4 T;  3C4S A;  4M7D E;  4QQ6 A;  3SWN C;  3RKX A;  3ER0 A;  2LT4 A;  3Q1J A;  3GF5 A;  1Q7Y U;  3HFN A;  2WSE E;  1WPY A;  3OA6 A;  1VQ8 T;  4O6J A;  2PVD B;  2I2L A;  3MHX A;  5GMK h;  4M75 D;  3CMA A;  2P0Q A;  1Q86 U;  4XTZ A;  3CC2 T;  4PLI A;  4RCC A;  3GLX A;  4ZGE B;  4BDZ A;  4M75 F;  1TH7 A;  4FU6 A;  3S3N A;  3RES A;  3P8H A;  4O5V A;  4M7A F;  4R56 A;  5GAO q;  3HHT B;  2RHI A;  2JUF A;  1YJW A;  5CCA A;  2H3J A;  3JCM e;  2PU9 B;  3CCU A;  3QJ6 A;  3X24 B;  4A54 A;  3LWI A;  4HT9 A;  1KQS S;  2L5Q A;  2KMT A;  4FSX A;  1QVF S;  4M7A C;  3GNF B;  3CXC S;  3CCJ T;  5DY9 A;  2F5T X;  2QXF A;  4XU2 A;  3ME9 A;  3OS5 A;  2O4X A;  3M4Y A;  5FU7 B;  3M54 A;  3A8O B;  3JCM g;  3A8G B;  2CYZ B;  5GAO m;  3MEW A;  2QQR A;  4FL6 A;  3MP8 A;  2GCX A;  2XK0 A;  3OYC A;  4PL6 A;  2CZ1 B;  4A4K A;  3JB9 I;  2EWN A;  4XTU A;  4XU3 A;  4JRI A;  3G71 T;  2CZ6 B;  3G71 A;  1K8A U;  3HP9 A;  3LW5 E;  4ZGD B;  1YHQ A;  3MCA B;  1M8V A;  4M78 C;  5GMK l;  3ZBD A;  4ME7 A;  4P5N A;  4A4F A;  2DD5 A;  3SFM A;  5GAN 2;  5LL6 S;  1BYM A;  5DM7 R;  4UC4 A;  1HK9 A;  3DLM A;  3OSS C;  2EQM A;  4IUV A;  3JCM d;  5FRN A;  5DLQ E;  3OYL A;  3QZ9 B;  2JZ2 A;  2L3R A;  5CAI A;  1YJ9 A;  2DVE A;  2LC4 A;  4HCC A;  4CI0 C;  3KXT A;  5LJ5 h;  1N8R U;  2XI9 A;  4OB3 B;  3M58 A;  3RIR A;  2XD0 A;  3RKW A;  4J8O A;  5FU6 C;  3MO8 A;  3VKI A;  2WAC A;  2OTL A;  1UB4 A;  4BI8 B;  5LJ3 j;  4X9C A;  2K3X A;  5CVI A;  1O9S A;  2KY9 A;  2ZPH B;  4M77 F;  1YIJ T;  1BI2 A;  3OS0 A;  4M78 E;  3V8L A;  1I81 A;  1WJR A;  3FRN A;  5CR2 A;  2K3Y A;  4NL3 A;  3CBM A;  1NE8 A;  2OAU A;  3OSV A;  3P8D A;  1QVG A;  2EAY A;  4M78 G;  2DZC A;  1QW1 A;  4M77 D;  3OYH A;  4KUL A;  3CCJ A;  4FT2 A;  3A8M B;  3LGL A;  2M1H A;  2DEQ A;  2RK2 A;  5GAN 7;  3TEE A;  4C92 A;  2RJE A;  4M7A E;  3CCU T;  4PNO A;  1YJW T;  4M75 E;  2DO3 A;  1WGS A;  3BW1 A;  2ZPG B;  4OB0 B;  4C92 C;  2AHJ B;  3I56 T;  4BI3 A;  1IZ6 A;  2RJD A;  5FLX E;  3HPW A;  5GAN 5;  2HNI A;  5GAM g;  2LQ8 A;  3DB4 A;  5J26 A;  3BY7 A;  4M75 A;  1VIE A;  5LJ5 e;  2E65 A;  5GAN g;  5D6Y A;  5GMK m;  3CCR T;  2PUO B;  3QZ5 B;  2JVV A;  2GF7 A;  3GIB A;  4DOV A;  5GAM j;  4JLI A;  2B8A A;  1U1S A;  3E19 A;  1XOV A;  2LDM A;  3P8B B;  4M78 B;  3S6W A;  3VYG A;  3CD6 T;  4M7D F;  2WSF E;  3QJY A;  5I2M A;  1U8R A;  4J6W A;  3ASK A;  1JRI A;  1M1F A;  1OZ2 A;  2M16 A;  4M7D C;  1UGS B;  2RI5 A;  4EMH A;  3OW2 S;  1DJ7 B;  3QO3 A;  2E6N A;  2QQA A;  1YIJ A;  1JJ2 S;  3M57 A;  1NJI U;  1M9S A;  2HBP A;  2RHU A;  5IAY A;  4M7A A;  4N4H A;  3H6Z A;  1UGR B;  5D6X A;  1WQ7 A;  3URG A;  2DKG A;  1M5Q 1;  2A7Y A;  2GFU A;  2P0K A;  3X28 B;  5LJ5 d;  3M59 A;  4LDU A;  4F7U G;  4J5Y A;  2K5L A;  2VXF A;  1X6O A;  3DB3 A;  2ZPE B;  4HA8 A;  3JCM h;  5M9O A;  4JS4 A;  1YJ9 T;  3ZFJ A;  1XQH A;  1VQK T;  1Y71 A;  4ZTF A;  3TRE A;  4A4G A;  5GAM e;  3M4G A;  3FC3 A;  4JDS A;  3L42 A;  1YHQ T;  2DTI A;  4CRI A;  3DLL A;  2K57 A;  2EJF A;  2VYT A;  4C0G A;  2VC8 A;  3PMT A;  4GY5 A;  1M1G A;  1KC8 C;  1BI3 A;  3CCM T;  3MEU A;  4BI4 A;  4ELY C;  1G3T A;  4C8Q B;  3JRZ A;  4XK8 E;  3NFC A;  3H8Z A;  3RMQ A;  3HSB A;  2DXT A;  2QQ9 A;  2ZZD A;  3DKM A;  4BAC A;  2GFA A;  3HRU A;  4QW2 A;  3VYH B;  2XIC A;  3VV0 A;  1Q86 C;  3JB9 G;  1VQ9 T;  3R6O A;  4M77 C;  3F70 A;  4XTX A;  3OB9 A;  5A2Q E;  3C95 A;  4BE1 A;  3CCE T;  4F7U B;  5GAO p;  2FL7 A;  3FDR A;  3QXE B;  1M90 U;  3HRT A;  4RKU E;  4PJO C;  1FX7 A;  2XG8 D;  1XNI A;  4E47 A;  4PJO A;  4C92 E;  3CCV T;  2BIV A;  1QVP A;  2BUD A;  3CCV A;  4PJO B;  1VQ6 A;  4MZT A;  3L2Z A;  4BUG A;  3JCM Q;  1N6A A;  2IVW A;  3FLG A;  5CKE A;  2RA2 A;  4IUR A;  3L1A A;  2OTJ T;  3JB9 H;  3J80 E;  5C0M A;  3GP8 A;  3GOX A;  4E7K A;  5LJ3 d;  4M75 G;  4EPC A;  4C92 G;  3PIO A;  4E7I A;  4QQG A;  3CMA T;  1KQ1 A;  1QP3 A;  2R5M A;  4L5G A;  4BB7 A;  5GAN h;  3CBO A;  4C0F A;  1OYX A;  4PJO G;  1B34 B;  4C8Q G;  2HQX A;  3OYM A;  2LNV A;  1VQ5 A;  4EMK B;  3CCL A;  3CXC A;  2QQB A;  3OS2 A;  3BFM A;  4EMK C;  2VGM A;  1KD1 C;  4C92 F;  4C8Q E;  5GAN 6;  3CCR A;  3FEO A;  1ZQ1 A;  1R8O B;  2JTM A;  4KT0 E;  4QQD A;  4MDW A;  1LOJ A;  5LJ3 g;  3SWN A;  2L89 A;  1LJO A;  2E6Z A;  2MF2 A;  2RJC A;  3LX7 A;  5HY6 A;  3E9G A;  4EDU A;  3QYG B;  1NPR A;  1WJQ A;  4QVC A;  3I56 A;  1VQK A;  3UDC A;  2MAM A;  2QEX T;  3EFR A;  2DXB A;  1BI1 A;  4JRK A;  3JCM J;  2NLU A;  4YTL A;  2YLC A;  3V7S A;  1X01 A;  2CS7 A;  2E41 A;  2MI6 A;  4JJN K;  4MMK A;  5FRO A;  4II1 A;  3WXM B;  4ZN3 A;  2O4X B;  4M7D A;  4JRP A;  3CCM A;  2D0Q B;  3A5Z B;  4C8Q C;  5HK0 A;  3TU4 K;  2EQU A;  2ZPI B;  1VQ7 A;  1QVF A;  1VQL T;  2CZ7 B;  3S3M A;  3CC7 T;  4A4H A;  4LD9 K;  1WNL A;  5CQY A;  5GAO n;  2XU8 A;  4XAX B;  3UPU A;  5LJ3 f;  3JCM c;  2C06 A;  2KQW A;  3JCM b;  3CD6 A;  3M53 A;  2MMP A;  3MEA A;  1WJS A;  3SB2 A;  4RMO A;  3G4S A;  4C0D B;  1FWZ A;  1Q81 C;  3J7A F;  4F7U E;  3VUB A;  3A8L B;  1G3W A;  3PGG A;  1N9S A;  2EJG A;  3V7C A;  4RG2 A;  3CCS A;  4L59 A;  1BIA A;  5GAN f;  4C92 B;  5CO7 A;  3V8J A;  4ZTJ A;  2ZGW A;  5A0G A;  2YRV A;  2VUB A;  2M9U A;  3CBP A;  5EG2 A;  4HCB A;  3LH0 A;  4M7D D;  3QSU A;  4HT8 A;  4D6W A;  2EIF A;  2X4Y A;  2PUK B;  1YIT A;  1PSF A;  2FHD A;  1NPP A;  2X4J A;  3QUI A;  1Y96 B;  2DK3 A;  1G3S A;  2EQK A;  3JSC A;  4E7L A;  4M7A D;  1YCY A;  1LNX A;  2KVQ G;  2MWP A;  1NZ9 A;  2YHT A;  3OYI A;  3PNW C;  3MP6 A;  3C94 A;  4XTY A;  1Q7Y C;  1K9M C;  5IN1 A;  1VQN A;  4MDX A;  2DIQ A;  2CGH A;  4J7F A;  4M78 A;  1B34 A;  4J6X A;  5GAN d;  3NTI A;  2RI3 A;  3OQ5 A;  4BE0 A;  1KG1 A;  2KSS A;  3M56 A;  4BD3 A;  4C0Z A;  3CME A;  2QA4 T;  2DXU A;  4C5G A;  1YI2 T;  2LVM A;  3RER A;  2OTL T;  2HQE A;  4OP0 A;  3CC7 A;  1VQL A;  1BIB A;  2XDB A;  2EFI A;  4ZGJ B;  3EFS A;  2QTX A;  4XU1 A;  3CCQ T;  2PVO B;  4C5E A;  5KE3 A;  3HRS A;  3C12 A;  1I5L A;  2P4T A;  5CIU A;  2E10 A;  3A8H B;  2FVU A;  3I55 T;  3QYH B;  4M77 A;  3CC2 A;  3I55 A;  4LDX A;  4M75 B;  3HL8 A;  2K4Y A;  4M77 B;  3X25 B;  3L2Q A;  4BDY A;  3PFS A;  4B9X A;  4PJO E;  1PSE A;  4BY6 C;  3OYE A;  3FJP A;  3GNG A;  1N9R A;  4L6V 5;  1K9M U;  4M78 F;  1OI1 A;  2EJ9 A;  3LYI A;  2M0O A;  4M77 E;  1W2B S;  2RHZ A;  5GAN e;  5AYF A;  2F69 A;  4OGC A;  1UEB A;  3OYY A;  4A4E A;  2K2V A;  3VUZ A;  1RI0 A;  3BDU A;  4KBM B;  4M77 G;  5CQX A;  4ELZ C;  2RM4 A;  4J83 A;  5FU7 C;  2RO0 A;  4OGE A;  1Q81 U;  1U1T A;  1UGQ B;  3E9F A;  3G6E A;  1VQ7 T;  3JCM f;  2CKK A;  4PJO F;  4A53 A;  5GAM h;  2RD1 A;  1VQ5 T;  4C8Q F;  3QPH A;  3MET A;  5GAM f;  1M1K C;  5I2S A;  4OB2 B;  5J39 A;  3OYG A;  4Y91 A;  3OW2 A;  4OMF B;  1VQM A;  5KH6 A;  4C5I A;  4RG8 A;  1MGQ A;  1Y7X A;  1G3Y A;  4DQ2 A;  2D6F A;  3UWN A;  4C5H A;  3GPL A;  4OB1 B;  2E70 A;  2O01 E;  3EAE A;  4M75 C;  4Y28 E;  3CC4 T;  1XTD A;  3SDZ A;  3PTA A;  4TVR A;  3M9Q A;  4IUT A;  2QDY B;  1EIF A;  2DTO A;  2XDD A;  3OBW A;  1VQP T;  1VQ6 T;  5I21 A;  2XID A;  1VUB A;  1H64 1;  4X34 A;  4C0D C;  3OS1 A;  3OYB A;  2JN0 A;  2JOY A;  2XHC A;  5DLO A;  3BDL A;  2V8K A;  1ZBX A;  4IUQ A;  4C8Q A;  1K73 C;  4NL2 A;  4EMK A;  2V8J A;  5D6W A;  1Q82 U;  1GXI E;  5CKD A;  3S3O A;  2Y4X A;  4LDW A;  2JNG A;  2DD4 A;  3PIP A;  1S72 A;  4HCZ A;  4VUB A;  2RB6 A;  4IUP A;  2DXC A;  3OYF A;  3X20 B;  4KUD K;  4OF1 A;  5GAN 8;  3VU3 C;  2V8I A;  1VQP A;  2EQJ A;  3QDR B;  4MML A;  2QI2 A;  4EMG A;  4N0A C;  5LJ5 g;  5LJ5 j;  4KUI A;  2HD0 A;  1IRE B;  2QQS A;  2RHX A;  3L2V A;  1MHN A;  4XTV A;  1KD1 U;  5GAN 4;  4DA4 A;  5KCO A;  1O75 A;  4FT4 A;  2KK4 A;  4LDV A;  1Y07 A;  1Q82 C;  4C8Q D;  4F7U F;  2EYQ A;  3SD4 A;  1KQ2 A;  2Y90 A;  3T9N A;  1M4Z A;  1WQW A;  5GMK j;  1Y96 A;  1K8A C;  4V2S A;  4HKE A;  4ZN1 A;  2KAF A;  4OVA A;  2L8D A;  4M7D B;  1D3B B;  4PLL A;  3L2R A;  1D3B A;  2A3L A;  4QVD A;  4FM4 B;  5L8R E;  2PQW A;  3G6E T;  2GQV A;  2DJZ A;  4BE2 A;  1VQ4 A;  1KQS A;  3PT9 A;  2X4W A;  5A0L A;  2R57 A;  3QBY A;  4XTW A;  2XDP A;  1YJN A;  2LCL A;  4NOY A;  5KE2 A;  3V8K A;  1UGP B;  1VQO A;  3CPW S;  5J3B A;  5GAO r;  3J81 E;  4M7D G;  2E1H A;  5LJ5 f;  2LCC A;  5LJ3 h;  2FB7 A;  2X4X A;  1RL2 A;  5HK3 A;  3OYD A;  3L2W A;  3JCM V;  3CC4 A;  1SSF A;  3FB9 A;  3ZEH A;  5KCH A;  3KUF A;  2Y4Y A;  4MZM A;  2PVG B;  3JCM X;  2K5I A;  2IG0 A;  4M78 D;  1G5V A;  2VXE A;  5CK9 A;  2QEX A;  4JRQ A;  4E7J A;  4IKF A;  2LT1 A;  3JCM W;  3M5A A;  4J6Y A;  2D9T A;  5LJ3 e;  1N8R C;  1W2B A;  2LRQ A;  3CCQ A;  3JB9 J;  5CKF A;  3OMG A;  4NS5 A;  5FRM A;  2VGN A;  2VV5 A;  4FIB A;  5HKC A;  2LX9 A;  4JLG A;  1QVG S;  1JBM A;  3CME T;  2QA4 A;  3M55 A;  1W4S A;  2DAQ A;  4J7I A;  3VJP A;  3X26 B;  3QKJ A;  1K73 U;  1NJI C;  2DIG A;  3QHS A;  4GLK A;  4QVZ A;  2DTH A;  1I4K 1;  2R58 A;  2WSC E;  2RK1 A;  3MEV A;  3OBY A;  3JAM E;  3E1S A;  5IT9 E;  1VQN T;  3MP1 A;  4N4I A;  4E7H A;  3OYA A;  3RUX A;  1N27 A;  2EKO A;  1ZHI A;  2DPP B;  3TCJ A;  1M90 C;  3RKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...