3URGA

The crystal structure of anabaena ccbp
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
126
structure length
123
Chain Sequence
b'MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alr1010 protein
molecule tags Metal binding protein
source organism Nostoc
publication title Ellman's reagent in promoting crystallization and structure determination of Anabaena CcbP.
pubmed doi rcsb
total genus 37
structure length 123
sequence length 126
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11535 Calci_bind_CcbP Calcium binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.530 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3urgA02
3URGA 2P0QA 2P0PA 2K2VA
chains in the Genus database with same CATH superfamily
2L3SA 2CT3A 2E41A 1GBRA 1UHFA 5A0DA 1WI7A 4BI8B 3P8DA 3VYGA 2FHDA 1P92A 5L23A 4OGCA 3EGXB 3CCSA 3CCVT 5I2SA 1Y7XA 2CREA 2NYSA 3CC4A 3A8LB 3BFMA 4C92C 2MK5A 3VJPA 1M2VB 1D3BA 1M2OA 1VQKT 2KRSA 5DM7R 4FL6A 1FMKA 5D7UA 4PJMA 1YHQQ 2EQUA 3CBOA 3FIFA 4EIKA 2LJ1A 2GF7A 2EYWA 3RUXA 2CP5A 4D8DA 3JCMc 2LCCA 1AT1B 4KGXB 3GP8A 3OQ5A 3P8BB 1YJWT 2XDBA 2DX1A 4F7UG 4OMOA 2L8DA 2ZAEA 3CBPA 2RQRA 1FMWA 3I55A 5KYWA 1UHCA 3C0CA 5HK3A 4LD9K 3OB9A 2PTKA 4JS4A 2GGRA 3PGGA 1ZQ1A 1E6HA 1AWOA 3OYHA 2E4HA 2FZKB 3OYEA 2F5TX 3KBGA 5GMKi 1K8AR 4C8QG 3V8JA 3CCMT 3H6ZA 4Z02A 4M75D 2R58A 2VGNA 3HPWA 3C95A 2XI9A 3EGXA 1YCYA 3OS0A 3CCUA 4N4HA 3EFOA 2MWOA 5KE3A 4XQ3A 1MGQA 1D3BB 4M7DB 2DO3A 3CC4T 1M90C 2IIMA 2COWA 2KVQG 1X2QA 3META 1PCXA 1UGSB 4M75F 2X3XD 1E6GA 3BY7A 2VV5A 1VQ4Q 2QTVA 4OF1A 1GCPA 2BIVA 1D09B 1YITA 1UB4A 2DL5A 4OGEA 3CCQQ 4IUUA 1BB9A 2XDDA 1OV3A 3CCEQ 2FPFA 3TVTA 2CP2A 1MMAA 1NLPC 2HSEB 2J6OA 1M8VA 2A3LA 3CC7T 3RKXA 1TUCA 3LW5E 2HNIA 1NBEB 2LNVA 3CC7A 1X27A 2HDAA 3MPUB 2GTOA 1ZA1B 2YLCA 3PTAA 3R6OA 1Z9QA 1PNJA 2RHIA 2EJFA 4LDUA 3MEUA 3X24B 2PUKB 2DXCA 3JV3A 2MWPA 3RBBB 1QVPA 1I8FA 3SD4A 4DEXA 3JCMX 1GBQA 1M90R 2DXTA 3SWNC 1D1CA 5FWBA 2DD4A 2DJQA 5IN1A 2K7AA 2QDYB 2LCSA 4E7SA 1GFDA 1W2BS 2ESWA 1IREB 5GAN8 1M5Q1 2PVGB 5FU6B 1YIJA 3X26B 4BE2A 4ESRA 2DRMA 1TOVA 4M77A 3RDVA 3SDZA 3EFRA 1WHLA 5GAOm 4PLIA 4WCIA 4O5VA 2LMJA 1W2BP 4M7AF 2YLBA 3CPWS 1OQKA 1RLQC 1LPLA 2RK1A 2Z0WA 3I5SA 1KHIA 1M9SA 2WSEE 5GANf 4M78A 5GAOr 4PJLA 1G3WA 4RCCA 2ED0A 1VQ7A 1NYFA 1AVZC 4F7UE 3OYJA 1Q86U 5GAMf 3TU4K 5GAOq 1NPRA 1Q7YC 5CKDA 4C92A 4M7DC 5IH2A 4C8QD 1RI0A 1WHHA 4MZMA 2JT4A 3I5RA 1YJWA 1JJ2A 1WJRA 2RQTA 3WVEB 2EPDA 1EX4A 3FLGA 4XTUA 2RN8A 1VQKQ 1MV0B 4J6YA 2V26A 4XTYA 2EVRA 3JB9G 1ZBJA 1D0YA 1RL2A 1VQKA 1Q95G 4M78C 3OYLA 2PQWA 5LJ5g 2K3BA 4L5GA 2JNGA 2E64A 2MAMA 4UC4A 1Y07A 1VQ9Q 4BDYA 4AG1C 1NM7A 3LGLA 2V1RA 2O9SA 1ABQA 2JMCA 1I81A 1QP3A 3UATA 1R0CB 1SRLA 1X6GA 1VA7A 1J3TA 3QJ6A 4OMQA 3CCUQ 4D8KA 3CCUT 1M8MA 3A8MB 2R5MA 5HKCA 2V8KA 2LDMA 3NPFA 1AWXA 3CMAQ 4C8QF 4IURA 2XKOC 3JRZA 4R0KA 2E65A 2CZ6B 4JLIA 4N0AA 1M2VA 4J9GA 1TTHB 2AZVA 2EQIA 2CKKA 1VQOQ 1B34A 4J9EA 4RTXA 2EQJA 2OTLA 4N4IA 4MMKA 4RG2A 4BDZA 2L3QA 1PKSA 1UGRB 4KT0E 2QQ9A 2ZPFB 1V1CA 2AHJB 2G3RA 2RPNA 2J6FA 2LC4A 2EGCA 4M75G 1O75A 1M3BA 2FO0A 4MDWA 1IB8A 3EG9A 4C92D 1YJNA 3JCMV 3PIPA 2QEXQ 1RAGB 4OB2B 5FRMA 2LQ8A 1C1AA 2GBQA 4HXJA 4LD6A 1HD3A 1ZSZC 3VRZA 1BI2A 4RKUE 1Q86R 3A8HB 1NEBA 3NHNA 1WPYA 5EG2A 1YFNA 1YJ9T 1C6VX 5M9OA 2YHTA 3MP1A 1F1BB 3M0UA 2YRCA 2F69A 4C0FA 1RABB 2DTHA 2OTLQ 1WXTA 3GPLA 2YXYA 3V7CA 1AD5A 3CCRA 4M78G 3CCQA 2QAZA 2KEAA 4RTZA 4ZTJA 2LT4A 3REAB 2P0PA 3RIRA 3EH2A 4BY6B 4OMNA 2EYQA 3M53A 3M58A 1ZSZA 1WJQA 1MMGA 4QVCA 2K6DA 3F70A 1UGVA 5GAMh 3CC2A 1JU5C 2WSFE 2DIGA 2DIQA 4DQ2A 1SHGA 3EHQA 2IPOB 3OA6A 1NG2A 2KNBB 2DF6A 3UA6A 4WF2A 1X01A 1T0JA 2DTOA 2QXFA 3TSZA 1NJIU 2K2MA 2L5QA 1M90U 3EG2A 3VS1A 2OAUA 2CS7A 4JZ4A 2LVMA 1QKXA 1K73U 1FXXA 4PJOF 3MEAA 4WTOB 1X75C 5FW9A 1K1ZA 5J26A 1FMVA 3Q1JA 1NPPA 3GNFB 5IXBA 4LXCA 2KRMA 4M7AA 4FYXB 5CVIA 1HYOA 1PC0A 1WJSA 2XU8A 4HKEA 1MNDA 3M5AA 5LJ3h 4J7FA 2M1HA 2DL4A 3TCJA 3JB9D 2EYXA 5CKEA 2EKHA 1K8AU 2L2PA 4OMMA 1PSFA 2O31A 4FW2A 3CCLA 3V8LA 5IXFA 2KE9A 2GFUA 2IG0A 4RCBA 1BI3A 3DLLA 1DJ7B 2DNUA 2HQEA 2RHUA 2MIOA 2FL7A 2E6NA 1JXMA 4FSXA 4QVDA 1UJ0A 4QT7A 1KHCA 2DVEA 2K79A 3UF4A 1SPKA 1FX7A 4IUTA 1VQNQ 4R56A 1M27C 1S1NA 3CC2T 3GLXA 2OJ2A 2LQNA 3OYCA 2XDPA 1Q86C 3NGPA 1G5VA 3INZA 5C6SA 2ZPHB 2Y4YA 1SKUB 2KT8A 2CP0A 3M56A 3H0HA 1N8RU 4QVZA 5C0MA 1BYMA 2QG9B 1Q7YR 3X20B 3PFSA 2W0ZA 1PD1A 1GL5A 1X43A 1ABOA 1QLYA 1PRLC 3MCAB 4RTVA 4E7HA 3UA7A 2RHXA 4PLLA 4AFQC 5CKHA 5KYYA 2LZ6B 1HXDA 4PJNA 2AKKA 1YWPA 2QQRA 3MP6A 4BY6C 3AT1B 3C4SA 5GANd 3VKIA 2G6FX 1Y0MA 2DD5A 3M57A 2Y4XA 3A8OB 3RR6A 2H8HA 1HJDA 2FRWA 1BI1A 2DK3A 3FEOA 3OY9A 4C8QC 2E12A 4HA8A 3REBB 5FU6C 4N0AC 3JCMW 1BCMA 3WVDB 8ATCB 5GAN5 4DBQA 5LJ5e 3JCMf 3EGDB 3CMEQ 3AHUA 4HVVA 2C06A 2X4YA 3PIOA 2DAQA 4M75C 3BW1A 1OX8A 1VIFA 1QVFP 1BU1A 1WXUA 1VIEA 4QKUA 5D6YA 1RADB 1VQ6T 4HCCA 2ZPBB 2M02A 2MI6A 2HBWA 3QXEB 2JTEA 2EJ9A 1WDXA 4KRTA 3QZ5B 2J06A 1IGUA 3KUFA 2XD0A 3GIBA 2DYIA 4KBMB 4ELZC 1OZ2A 2HSPA 2RQUA 2X35A 3CCET 1QVGA 5GAMj 1GCQA 3CCJQ 1VQOT 2NUPA 2EQKA 3LLRA 4JRQA 3S3OA 3CD6A 2HMAA 4C5IA 1VQOA 3VUBA 1VQMA 1MMNA 2VWFA 3V7SA 2QA4Q 2KYMA 4PJOE 3OSVA 5FU7B 2QI2A 1OU8A 2M0OA 2FZCB 2Y90A 2VB6A 2RJEA 1PM3A 2COZA 2C0OA 1PG5B 2C0IA 3JCMd 3E9FA 2RHYA 3DLMA 2XHCA 2RB6A 5CKFA 2K5LA 1AOJA 2F2WA 4M7AC 4M7DF 1T3SA 2QK0A 4GLMA 2P0QA 2RK2A 4E7KA 2JJ9A 3QDRB 2KAFA 4OVAA 3PT9A 4O6JA 1WHGA 2KDSA 2DE0X 1OYXA 2DXUA 1FYNA 2NUTA 2LCLA 4R55A 2AZSA 3OYNA 1WFWA 1QMCA 3DKMA 3G1JA 3OYYA 3CCST 3CCVA 4OMPA 2GNCA 3UPUA 4AT1B 5KH6A 2E3HA 2VYTA 1CSKA 3FJPA 2ZZDA 1IZ6A 3SFMA 4II1A 3J81E 5CIUA 1UG1A 2HKNA 2YUOA 4M7AE 3QHSA 5I2MA 2DBMA 4MMLA 4TVRA 1BIAA 2NWMA 2LRQA 3CCVQ 5GMKl 4DEYA 1G2BA 3H0IA 5I11A 2RI5A 2K2VA 4RTYA 2I2LA 2XIDA 3CCRQ 1B34B 1JXOA 2V1QA 1U1TA 2AT1B 2NUPB 4B9WA 4PJOA 3X25B 5GANg 1W70A 3G6EQ 3QUIA 2CDTA 4C92B 2ZGWA 4RTWA 4J7IA 4AFZC 2V8IA 3N5BB 3HRUA 1KC8C 4ZGDB 3QKJA 1K8AC 4BI4A 5KYNA 2F2XA 4C8QA 2BKDN 5KYUB 2M0YA 3LH0A 2ROTA 1RAHB 4M7AG 3HHTB 2KQWA 1UECA 5KE2A 2RJFA 2E3IA 3I55T 4OB0B 1KQSP 1QW1A 2VXEA 1N8RC 1TSFA 4M77B 4X1VA 3I56Q 4EMGA 5KYXA 3OS5A 3CCMA 1RUWA 5GMKm 4FT4A 1U8RA 2RQVA 1PHTA 2JXBA 1YCSB 3CC7Q 4XU2A 1R77A 2COYA 2LX7A 2LX9A 5LJ5f 2ENMA 4F7UA 3ULRB 1I0CA 2OTJT 4M77F 3CXCS 2CP3A 2H3JA 3I35A 4VUBA 4F17A 3CPWP 4DBHA 1D1BA 5GANe 3LWIA 1H3ZA 2CH4A 4F7UF 1ZUUA 4GLKA 4FCYA 2FB7A 3QBYA 4C0DC 1WA7A 3JAME 1QKWA 3VS7A 1VQ7Q 4ANJA 4KUDK 3V7RA 1KD1R 4OMFB 4EMKC 2FPDA 2GQVA 3D7SB 3M59A 4E6RA 1VQPQ 2O4XA 4RTUA 1K9MC 1TS9A 4LUDA 4RG8A 1GFCA 1A0NB 2KI7A 5GAMd 3NFCA 3PMIA 1VQMQ 3E1SA 4YTLA 3R6NA 3L2ZA 3OSSC 4CI0C 3RMQA 1WXBA 2QQSA 2OAWA 3M0QA 4ZN3A 3E19A 3MO8A 4J9BA 4BB7A 3CMET 2WSCE 1ZLMA 1QP2A 4C92F 3A98A 1VQ9T 1SEMA 1W4SA 2JS0A 1AWWA 5GAMe 1M1KR 2A28A 3CCMQ 3GBQA 2BTTA 5HCKA 1TU0B 1EZZB 2DA9A 4PJOB 3VRYA 1MMDA 1D1AA 1U3OA 2NUZA 4J6WA 1NLOC 4E2FB 1X6BA 5FLXE 1BBZA 1SSFA 4M7DE 4LDXA 4J9HA 1YJNT 3CCQT 1ZA2B 4JJCA 3CCSQ 2FZGB 2L3PA 1VQ5A 3HFNA 1TXQA 4XU0A 2RF0A 1HSQA 3LWHA 1S72Q 2JM8A 8AT1B 4F7UB 2O01E 1OZ3A 1VOMA 3SEMA 1KSWA 1VQ5Q 2YUPA 2O88A 5D6XA 1SF9A 4M78E 1RI9A 2VUBA 4HVWA 3VS6A 4LN2A 1KK7A 4QQGA 4FIBA 1Y71A 3HFOA 4PFOA 3OBYA 3A5ZB 4A4HA 4MDXA 1H641 1PWTA 5KYYB 2XMFA 2CZ7B 4RUGA 5DLOA 2KT1A 2ZPGB 2DL7A 5I21A 2K3XA 2DM1A 4JJDA 2X3WD 3A1PA 1YI2Q 4KH1B 1NJIR 2RJDA 2LP5A 4C8QE 3QSUA 1CKBA 4PNOA 3H8ZA 4XAXB 4M7AD 1AZGB 3KXTA 2E5QA 4NL3A 1Q81C 3PVQA 5IHKA 1T0HA 4OP0A 3EG3A 1JB0E 2BUDA 2LT1A 4KH0B 3CCEA 2HD0A 1VQNA 2CH4W 4DA4A 5GANh 2D0NA 1OPKA 2E10A 4FW1A 5LJ3j 1QWFA 2ZPEB 3CCJT 1KC8U 1N27A 3G7ZA 3SB2A 1VQPA 2PVOB 3OBWA 2DEUA 1QQJA 4LNPA 2EIFA 2FVUA 4IUVA 2GQIA 5GAN2 4M77G 3OW2A 3X28B 3LX7A 3ZL7C 5FRNA 1KC8R 3RKYA 2RNAA 2XICA 2RM4A 4IUPA 5LL6S 1QCNA 4CC2A 1PSEA 5GAN3 5GAMg 2QA4A 2BZXA 4M4ZA 4GY5A 1K0XA 4DBFA 2J05A 3L2UA 1UE9A 1W1FA 4A4FA 3CCJA 4J9FA 1ZX6A 3H0FA 2FPEA 3OMGA 4M7DG 3G71Q 4NOYA 3ME9A 4KGZB 7AT1B 1YJ9A 1YI2A 2MCNA 4D6WA 2EYYA 2YUQA 2K3YA 3E2UA 3JB9I 2W10A 4MZPA 2M9UA 3JCMg 3LYIA 4E7ZA 2RQWA 3BDLA 1HK9A 5KYUA 3ASKA 4FYYB 3E9GA 1V29B 3M54A 4AFUC 2XK0A 3TQ7P 1UFFA 3UDCA 3VS0A 2PNIA 3BE3A 2ZPIB 4JRIA 4F04B 2CZ1B 1PRMC 4Y92A 3JCMJ 3U23A 2WACA 5CKBA 1R0BG 5LJ5d 2D8JA 1AWJA 1H3HA 2EJGA 1X69A 4B6MA 4C0ZA 2BZYA 3OMCA 3M0PA 4RMOA 2D8HA 1YITQ 1K9MU 2JUFA 4ELYC 2F5KA 3UWNA 1PD0A 5J39A 1NE8A 2VGMA 2CSIA 2QASA 2QQAA 4JJBA 2F2VA 1I5OB 5A2QE 5DLQE 2RI2A 4F14A 2FYKA 3L1AA 1KIKA 4J8OA 2CZ0B 2YSQA 1XOVA 5ECAA 4X9CA 2AK5A 1AHJB 4B9XA 5D6WA 1WX6A 1UTIA 4FM4B 2DVJA 1LVKA 1W6XA 5EC7A 3QWXX 5LJ5h 3EAEA 2OX7A 4M78F 1JEGA 2PVDB 3G71A 2VASA 4XU3A 4J6XA 4XTWA 4E7IA 1WQ7A 5L8RE 4BUGA 1KQSA 3OYAA 1RAAB 2F1LA 1ZHIA 2P0KA 3EG0A 4CC7A 4XTXA 4RTTA 3CCLT 2DTIA 2J7IA 2KXDA 3I55Q 2CUDA 4KGVB 1WYXA 4M75B 4FYVB 2DPPB 5CR2A 1Q81R 1U06A 5CO7A 3MEWA 1TWBA 1KQSS 3JB9H 1SRMA 2OTJA 4PJOG 2KR3A 4ME7A 1BIBA 1TUDA 3CC2Q 3RMSA 4EPCA 1KJWA 3QYGB 2RJCA 2IVWA 4XTZA 1U1SA 2YUNA 4BE1A 2JZ2A 2EWNA 3EHRA 1QWEA 1H92A 3P8HA 4DOVA 4J5YA 1JRIA 2LTOA 1S72A 3CD6Q 3CCRT 2VVKA 1K4US 2CYZB 1ARKA 1K9AA 2DETA 2K5FA 2JS2A 1VQPT 5GAN6 1G3TA 2J6KA 2DMOA 5HY6A 4L6V5 4FYWB 2I0NA 4J9IA 2QTXA 4L59A 2PUOB 2NUTB 1OPLA 4PFZA 3L2WA 2D9TA 9ATCB 2KBTA 4A4GA 1UGPB 2X4JA 5GMKh 3QG1A 4M77C 4XTVA 1YHQA 2KROA 2MOXA 4Q5WA 1YIJT 5GMKe 1YNZA 4HCZA 3OW2P 1QCFA 4QQDA 1VYUA 1JQQA 1YWOA 4EDUA 3NMZC 3M4GA 4JPBW 3DB3A 3CPFA 3OYGA 4LE9A 2BE9B 3QDFA 5KYWB 1IXDA 4FU6A 4IKFA 3PVLA 3MKDA 1YIJQ 2R5AA 4MZTA 4BD3A 4ZNXA 4V2SA 2QQBA 3EG9B 1XQHA 5A0GA 2B86A 3HSBA 4PJOC 3VUZA 3JCMQ 1WNLA 1YITT 1RAIB 3CPWA 2ECZA 4M77E 2HQXA 2YRVA 4HT8A 2ROLA 2DYBA 1VQ5T 3CBMA 2P4RA 3FDRA 4QQ6A 4AFSC 1B07A 1KD1C 3QYHB 3O5ZA 1UJYA 1OULA 1VQ8T 2P84A 2A7YA 2CUBA 1YJ9Q 3RNJA 3VS3A 2ATCB 2DLPA 4E7JA 1N5ZA 1M3CA 4A63B 2JVVA 3MJXA 3S6WA 4HT9A 2X4WA 1IRXA 5FROA 2YT6A 3EGUA 2KMTA 4XU1A 1RAFB 3ER0A 2XG8D 2L89A 1WQWA 1XTDA 2D0QB 2KXCA 4C8QB 4CRIA 1MV3A 4X9DA 1YJWQ 1VQ4T 1T3LA 5GANj 2O4XB 4C5HA 2VKNA 4F16A 2RH2A 1VQ4A 2ABLA 4PJJA 2QA4T 3QJYA 5DY9A 2KSSA 5GJVB 1IGQA 3CMAA 3S3MA 1D0XA 1V76A 3I9QA 5CQYA 2M16A 3SWNA 2BE7D 4ATOA 3HTRA 4PK4A 4M7AB 1VQMT 3I56T 2KGTA 2FG0A 2JM9A 1MHNA 5GMKj 3G6EA 2L3RA 3OYIA 1WLPB 3IQLA 4LDWA 3QPHA 1VQ9A 4J9CA 4E47A 3OS1A 3JCMP 1EFNA 3OW2S 2OI3A 1VUBA 3HL8A 3FC3A 4AMCA 3GOXA 2EKOA 3VV0A 3NTHA 1VQNT 1RACB 2DZ9A 2GFAA 3TEEA 2SRCA 4M7DA 4XK8E 1AZEA 1E7OA 2YWWA 1K73R 3CD6T 2VC8A 2HKQB 1Y96A 1I5LA 2C0TA 1QVGS 4GBQA 4ZTFA 3M0SA 3ZFJA 1CKAA 1U5SA 3JCMb 1YJNQ 2AKLA 3HRTA 3RESA 4C92G 1OX9A 3FJ5A 1UEBA 2KYBA 2OTJQ 5CQXA 2EBPA 1PKTA 4Y91A 4PKCC 3CC4Q 2GCXA 2RO0A 4A53A 3OYDA 1QCOA 1NYGA 2DKGA 2MPXC 1SG5A 1VYTA 5IHNA 3EFOB 1BK2A 3FRNA 3TSWA 2A0FB 4KUIA 4JDSA 3DB4A 1B7TA 4LDVA 4C5EA 3MP8A 1Q82U 1GXIE 5I22A 3VS4A 1N8RR 4Y28E 3M55A 5J3BA 1X2KA 1TH7A 1H8KA 1GRIA 2EGEA 1YHQT 4OMLA 2P4TA 1I4K1 4C92E 2CP7A 1Q82C 2CGHA 1S72T 3RKWA 1VQ6Q 3RERA 2ZCFB 3LH5A 1ZSGA 2OTLT 5IHIA 2DL3A 2HCKA 1YBYA 2QEXT 3QZ9B 6AT1B 4HCBA 2E6ZA 4Z89A 2AIRB 3H41A 4Z8AA 3EFSA 2CSQA 1BKBA 3CMEA 2EFIA 4M78B 1Q81U 4DBRA 3MHXA 4E7LA 1N9SA 1VQLA 3OYBA 3BDUA 3CXCA 5FWCA 1JBMA 5LJ5j 2HBPA 2YRDA 4IIOA 2ED1A 1N6AA 3CCLQ 1OU9A 2KRNA 1KQ2A 2KK4A 4LDYA 3HP9A 1OI1A 1M30A 3VS2A 4C0GA 1RLPC 5FU7C 2LNHB 2CT4A 5A0LA 2D6FA 1M4ZA 5HK0A 3JB9F 1UUEA 4AG2C 4M77D 3PMTA 1VYVA 4BACA 3G6ET 2K5IA 4A4EA 4NS5A 3NTKA 4J83A 2EQMA 1M1KU 2HAXA 1LCKA 1IO6A 5GJWB 4JRPA 4IIMA 3THKA 2M51A 2FRYA 4N4GA 1Q7YU 4X34A 5GAOl 2EW3A 2L0AA 4QW2A 3UT1A 3QO3A 1M1GA 1WHKA 3HKSA 2JMAA 2A08A 2FEIA 1FWZA 3OYFA 4JZ3A 1LNXA 3CMAT 2MF2A 3L2QA 1I1JA 4JS5A 3VS5A 1VQ8A 1O9SA 3I56A 3L42A 3L2RA 1R8OB 4DOWA 2HEQA 2D1XA 3HRSA 4ZGEB 4A4KA 1VQLT 3V8KA 1N9RA 1Y96B 3OYKA 2RMOA 1G3YA 4KULA 2YDLA 2DERA 2JOYA 2LJ3A 4EMKA 1XNIA 1I07A 2JW4A 1OOTA 1YN8A 3G4SA 5LJ3d 1AEYA 2LQWA 3MEVA 2K4YA 3L2VA 2HL5C 2PU9B 2BZ8A 2B8AA 1M1FA 2QDLA 4PFPA 3A8GB 4M78D 3GNGA 1WGSA 4LUEA 3CEYA 1WHMA 4M75A 1M3AA 1Z9ZA 1QVGP 2LQKA 4C5GA 2V8JA 3EH1A 1WZOA 5LJ3e 3FB9A 1UGQB 2RHZA 1VQ6A 2DBKA 1NEGA 4BE0A 3S3NA 2QYZA 5LJ3g 3ZBDA 1OEBA 1ZSZB 1TG0A 1W2BA 5CAIA 2O9VA 2DXBA 5AT1B 4ZN1A 3O8VA 4OB3B 5KCOA 5KYXB 3H9NA 1Q82R 2LJ0A 5AYFA 3TREA 1G3SA 1D0ZA 4M75E 1QVFA 3WXMB 1JO8A 2RD1A 5KCHA 2SEMA 2DFUA 2O2OA 3OYMA 2JTFA 2H3EB 3M9QA 2K57A 1EIFA 1KQ1A 4CC4B 2JTMA 1MUZA 2QGGA 2NLUA 4ORZA 4K11A 5LJ3f 5GAN7 2K9GA 3PE0A 2MYSA 1BCOA 1JJ2S 2RI3A 1IHWA 3C94A 3QIIA 3JSCA 1WIEA 4J9DA 1B3QA 4OB1B 4PL6A 1X6OA 1YI2T 3JB9J 1VQLQ 1K0SA 3NTIA 2E70A 1LJOA 4BI3A 1GCQC 2CP6A 5IAYA 1NJIC 3CQTA 4FSSA 1SHFA 1KFZA 1K73C 5GAOn 3M4YA 1XJWB 4P5NA 4ZGJB 3J7AF 1G83A 4A54A 4IUQA 1K9MR 4EMKB 3QWYA 2HL3A 4PJOD 2DEQA 1K76A 1YP5A 4HCKA 2R57A 2HQHA 2X51A 2E1HA 4NL2A 4C0DB 2QGFB 1QVFS 2QEXA 4JRKA 2A36A 2DRKA 4M7DD 2EYZA 4JUVA 3GF5A 2JN0A 5GAN4 1WHJA 2X4XA 3T9NA 3EGDA 2PZ1A 3J80E 1C0MA 2VXFA 3KFVA 3PNWC 2E5KA 1ZUYA 1VQ7T 2KY9A 2DL8A 3M0TA 1NZ9A 3ZEHA 3C12A 3G4ST 3G4SQ 3VYHB 3EG1A 1BI0A 3OS2A 2DILA 3SHWA 3LGFA 5CK9A 2RA2A 1ZBXA 2A37A 2EAYA 3G71T 4Z88A 1M1KC 3JCMh 1UDLA 4HVUA 4EMHA 4FT2A 3M0RA 1KG1A 2DZCA 5CCAA 2X9HA 3VU3C 1VQ8Q 2GTJA 1SSHA 3JCMe 1RAEB 1TUGB 1ACMB 1IHVA 1G8XA 4JLGA 2HZYA 1ZUKA 5GAOp 1Y57A 3SWNB 1JJ2P 5IT9E 3CXCP 2DJZA 4CC3A 2MMPA 1MNEA 3URGA 4JJNK 1KD1U 1LOJA 2EGAA
chains in the Genus database with same CATH topology
3OBYA 2FL7A 2DZ9A 2E6NA 2GFAA 3A5ZB 4A4HA 4MDXA 1H641 4FSXA 2E41A 2CZ7B 4QVDA 5A0DA 3TEEA 5DLOA 1KHCA 2DVEA 2ZPGB 3P8DA 4XK8E 4BI8B 5I21A 4M7DA 3CD6T 2K3XA 2VC8A 1I5LA 1Y96A 3VYGA 2FHDA 1FX7A 1P92A 1QVGS 4IUTA 4OGCA 2RJDA 4R56A 4ZTFA 3CCSA 3CCVT 4C8QE 5I2SA 1Y7XA 3ZFJA 3GLXA 3CC2T 3CC4A 3QSUA 4PNOA 3JCMb 3A8LB 3H8ZA 4XAXB 3OYCA 4M7AD 3BFMA 2XDPA 4C92C 1Q86C 3KXTA 3VJPA 2E5QA 1G5VA 1D3BA 3INZA 4NL3A 5C6SA 2ZPHB 1VQKT 2Y4YA 5DM7R 1Q81C 3HRTA 3RESA 4FL6A 4C92G 4OP0A 3M56A 1JB0E 1UEBA 2EQUA 3CBOA 3FIFA 1N8RU 5CQXA 2GF7A 4QVZA 5C0MA 1BYMA 3RUXA 2BUDA 2LT1A 3CCEA 3X20B 2HD0A 3PFSA 1VQNA 3JCMc 2LCCA 4Y91A 4PKCC 4DA4A 2GCXA 2RO0A 4A53A 5GANh 3OYDA 3GP8A 3OQ5A 3MCAB 2E10A 3P8BB 2DKGA 1YJWT 4E7HA 2XDBA 2RHXA 4PLLA 4F7UG 5LJ3j 5CKHA 3FRNA 2L8DA 2ZPEB 1HXDA 3CCJT 3CBPA 1KC8U 2QQRA 3MP6A 4BY6C 4KUIA 1N27A 3G7ZA 3DB4A 4JDSA 3I55A 3SB2A 4LDVA 3C4SA 1VQPA 5GANd 3VKIA 4C5EA 3MP8A 2PVOB 1Q82U 1GXIE 2DD5A 3M57A 5HK3A 2Y4XA 3A8OB 3OBWA 4LD9K 3OB9A 4Y28E 1BI1A 2DK3A 3M55A 5J3BA 2EIFA 2FVUA 4JS4A 1TH7A 3FEOA 3PGGA 4IUVA 3OY9A 1ZQ1A 5GAN2 4C8QC 4M77G 1YHQT 2P4TA 3OYHA 3OW2A 2E12A 4HA8A 1I4K1 3X28B 3OYEA 2F5TX 3LX7A 3KBGA 5FU6C 5GMKi 4N0AC 4C92E 4C8QG 3V8JA 3CCMT 3H6ZA 1Q82C 2CGHA 5FRNA 1S72T 3RKWA 3JCMW 4Z02A 3WVDB 4M75D 3RERA 2R58A 2VGNA 2ZCFB 3HPWA 3RKYA 3C95A 5GAN5 2XICA 2RM4A 4IUPA 5LL6S 2OTLT 2XI9A 1PSEA 5LJ5e 3JCMf 5GAN3 1YCYA 5GAMg 2QA4A 3OS0A 3AHUA 3CCUA 4N4HA 4GY5A 2C06A 2MWOA 5KE3A 2X4YA 4XQ3A 3PIOA 2DAQA 1YBYA 1MGQA 1D3BB 4M75C 2QEXT 3L2UA 3QZ9B 4HCBA 4M7DB 2DO3A 3BW1A 2E6ZA 1VIFA 4A4FA 3CC4T 1M90C 3CCJA 2KVQG 3OMGA 3META 1KD1U 4M7DG 1VIEA 4NOYA 3ME9A 3EFSA 1YJ9A 1UGSB 1YI2A 4M75F 5D6YA 4D6WA 1BKBA 3CMEA 2EFIA 3BY7A 2K3YA 1VQ6T 3JB9I 2VV5A 4M78B 1Q81U 4HCCA 3MHXA 2ZPBB 4MZPA 2M9UA 4OF1A 3LYIA 2BIVA 3JCMg 4E7LA 1N9SA 1VQLA 1YITA 2MI6A 3OYBA 1UB4A 3BDUA 3BDLA 3CXCA 1HK9A 5LJ5j 1JBMA 3QXEB 2EJ9A 4OGEA 4IUUA 3QZ5B 2HBPA 3ASKA 2XDDA 3E9GA 1V29B 3M54A 2XK0A 1N6AA 3KUFA 3UDCA 2XD0A 3GIBA 1KQ2A 4KBMB 4ELZC 2KK4A 1OZ2A 4LDYA 3HP9A 1M8VA 1OI1A 2A3LA 2ZPIB 4JRIA 2CZ1B 3CC7T 4C0GA 2X35A 5FU7C 3RKXA 3JCMJ 1QVGA 3CCET 3LW5E 5GAMj 2HNIA 2WACA 2LNVA 1VQOT 3CC7A 5CKBA 2EQKA 2YLCA 3LLRA 5A0LA 5LJ5d 3R6OA 3PTAA 1M4ZA 4JRQA 3S3OA 5HK0A 3CD6A 4C5IA 2RHIA 2EJFA 3JB9F 4LDUA 1VQOA 3MEUA 3X24B 3VUBA 2EJGA 2PUKB 2DXCA 2MWPA 4M77D 1QVPA 4C0ZA 3PMTA 1VQMA 1I8FA 3V7SA 4PJOE 4BACA 3G6ET 3OSVA 3OMCA 5FU7B 2K5IA 3SD4A 4RMOA 3JCMX 2QI2A 4A4EA 2M0OA 2DXTA 4NS5A 3SWNC 3NTKA 2Y90A 4J83A 1K9MU 2EQMA 2DD4A 2JUFA 2RJEA 5IN1A 2QDYB 4ELYC 1M1KU 2HAXA 2F5KA 4JRPA 1W2BS 3UWNA 5J39A 1NE8A 1IREB 2VGMA 2QQAA 4N4GA 5GAN8 1Q7YU 4X34A 3JCMd 1M5Q1 2PVGB 5A2QE 5GAOl 3E9FA 5DLQE 2RI2A 5FU6B 2FYKA 3L1AA 4QW2A 3UT1A 3X26B 2RHYA 3DLMA 2XHCA 3QO3A 1M1GA 2RB6A 4BE2A 4J8OA 5CKFA 2K5LA 4M7AC 2CZ0B 1XOVA 4M7DF 4M77A 3SDZA 4X9CA 3EFRA 1AHJB 3HKSA 4B9XA 3OYFA 1FWZA 2P0QA 5D6WA 2RK2A 5GAOm 1LNXA 4E7KA 3QDRB 4PLIA 3CMAT 4FM4B 2KAFA 2MF2A 4O5VA 3L2QA 4OVAA 4JS5A 3PT9A 2YLBA 4O6JA 4M7AF 2KDSA 1VQ8A 5LJ5h 1O9SA 3CPWS 1OYXA 2DXUA 3EAEA 4M78F 3I56A 2PVDB 3L42A 3G71A 3L2RA 2LCLA 4XU3A 4J6XA 2RK1A 4XTWA 4E7IA 4R55A 1WQ7A 3OYNA 5L8RE 4BUGA 1KQSA 3OYAA 1R8OB 1KHIA 1M9SA 2WSEE 4DOWA 3DKMA 3CCST 3OYYA 3CCVA 4ZGEB 3HRSA 5GANf 4M78A 4A4KA 1VQLT 1ZHIA 2P0KA 3V8KA 5GAOr 1N9RA 1G3WA 4RCCA 1Y96B 3OYKA 1VQ7A 4KULA 1G3YA 4F7UE 3OYJA 3UPUA 1Q86U 5KH6A 4XTXA 5GAMf 3TU4K 2JOYA 4EMKA 2DTIA 5GAOq 3CCLT 1XNIA 1NPRA 2VYTA 1Q7YC 5CKDA 3FJPA 2ZZDA 4C92A 4M7DC 4M75B 3G4SA 1IZ6A 2DPPB 3SFMA 4C8QD 1RI0A 4II1A 5CR2A 3J81E 5CIUA 5LJ3d 3MEVA 2K4YA 3L2VA 4MZMA 5CO7A 4M7AE 2PU9B 1YJWA 2B8AA 1M1FA 1JJ2A 1WJRA 3MEWA 3QHSA 3WVEB 5I2MA 3A8GB 1KQSS 1YIJA 3JB9H 4M78D 4MMLA 2OTJA 4TVRA 3FLGA 4PJOG 3GNGA 1WGSA 4XTUA 1BIAA 4J6YA 4ME7A 4XTYA 1BIBA 3JB9G 2LRQA 3CEYA 3RMSA 5GMKl 1RL2A 4M75A 4EPCA 1VQKA 3QYGB 4M78C 2LQKA 3OYLA 2PQWA 2RJCA 2IVWA 2V8JA 4XTZA 4C5GA 2RI5A 1U1SA 2JNGA 4L5GA 2K2VA 2I2LA 5LJ3e 2E64A 2MAMA 3FB9A 2JZ2A 4UC4A 1UGQB 2EWNA 2RHZA 2XIDA 1VQ6A 1B34B 1Y07A 4BDYA 4BE0A 3S3NA 1U1TA 4B9WA 4PJOA 3LGLA 3X25B 3P8HA 4DOVA 5GANg 1I81A 1QP3A 1JRIA 4J5YA 2LTOA 3ZBDA 5LJ3g 1S72A 3QUIA 4C92B 3CCRT 2ZGWA 2CYZB 1W2BA 4J7IA 2K5FA 5CAIA 2DXBA 4ZN1A 2V8IA 3O8VA 3QJ6A 3N5BB 1VQPT 4OB3B 1G3TA 3HRUA 5GAN6 3CCUT 5KCOA 1KC8C 5HY6A 4ZGDB 4L6V5 3A8MB 2R5MA 3QKJA 4BI4A 1K8AC 5HKCA 2V8KA 4C8QA 2BKDN 2LDMA 3LH0A 5AYFA 4M7AG 3HHTB 4BE1A 3TREA 2KQWA 4C8QF 1G3SA 4IURA 2XKOC 3JRZA 4M75E 2E65A 2QTXA 2RJFA 2CZ6B 5KE2A 3I55T 4JLIA 4L59A 2PUOB 4OB0B 1QVFA 1QW1A 2VXEA 3WXMB 4N0AA 1N8RC 3L2WA 2D9TA 2RD1A 4M77B 5KCHA 4EMGA 4A4GA 3OYMA 2JTFA 2CKKA 3M9QA 1B34A 2K57A 1UGPB 1EIFA 2X4JA 3OS5A 5GMKh 3CCMA 1KQ1A 2EQJA 4FT4A 5GMKm 3QG1A 1U8RA 2OTLA 4M77C 2JTMA 4N4IA 4XTVA 2NLUA 4MMKA 1YHQA 4XU2A 4RG2A 4BDZA 4Q5WA 5LJ3f 1YIJT 2LX9A 5GMKe 5LJ5f 5GAN7 1UGRB 4KT0E 4F7UA 2QQ9A 2ZPFB 2AHJB 2G3RA 4HCZA 1JJ2S 2OTJT 4M77F 3CXCS 2LC4A 4M75G 2RI3A 1O75A 2H3JA 4QQDA 3C94A 4VUBA 4MDWA 3QIIA 4C92D 4EDUA 5GANe 1YJNA 3JCMV 3JSCA 3PIPA 3LWIA 4OB2B 5FRMA 1H3ZA 4F7UF 2LQ8A 4OB1B 3M4GA 3DB3A 4GLKA 4PL6A 3CPFA 4LD6A 2FB7A 1X6OA 3OYGA 1YI2T 3JB9J 3QBYA 4C0DC 3JAME 1BI2A 3NTIA 4FU6A 4RKUE 4IKFA 3A8HB 2E70A 2R5AA 4MZTA 4KUDK 3V7RA 1LJOA 4BD3A 4BI3A 4V2SA 2QQBA 5IAYA 1WPYA 5EG2A 1NJIC 1YJ9T 1XQHA 4OMFB 4EMKC 5A0GA 2YHTA 5M9OA 2GQVA 3MP1A 3HSBA 4PJOC 3M59A 3VUZA 1K73C 5GAOn 2O4XA 3M4YA 1K9MC 3JCMQ 4ZGJB 2F69A 4P5NA 1WNLA 3J7AF 4C0FA 1YITT 2DTHA 4RG8A 4A54A 4IUQA 3CPWA 3GPLA 3V7CA 2D6FA 4EMKB 4M77E 4M78G 3CCQA 3CCRA 4PJOD 2HQXA 2DEQA 4ZTJA 2LT4A 2YRVA 2R57A 2P0PA 5GAMd 4HT8A 3NFCA 3CBMA 3PMIA 1VQ5T 3FDRA 4QQ6A 3E1SA 1KD1C 3QYHB 2E1HA 4NL2A 4YTLA 3RIRA 4C0DB 4BY6B 1QVFS 3L2ZA 3OSSC 4CI0C 2EYQA 3M53A 1VQ8T 2A7YA 2QEXA 4JRKA 3M58A 3RMQA 1WJQA 4M7DD 2QQSA 4QVCA 4JUVA 4E7JA 3GF5A 2JN0A 3F70A 5GAMh 5GAN4 4ZN3A 3E19A 3MO8A 3CC2A 2X4XA 2WSFE 4BB7A 2DIGA 2DIQA 2WSCE 3T9NA 4DQ2A 3CMET 2JVVA 3S6WA 4HT9A 1QP2A 2X4WA 4C92F 1VQ9T 5FROA 3J80E 2KMTA 3OA6A 1W4SA 4XU1A 5GAMe 2VXFA 3ER0A 2XG8D 3PNWC 4WF2A 1X01A 2L89A 2DTOA 1WQWA 1XTDA 2QXFA 2D0QB 1NJIU 2L5QA 2KY9A 4C8QB 1M90U 4CRIA 4X9DA 1VQ7T 2OAUA 1VQ4T 5GANj 2O4XB 1NZ9A 2CS7A 4C5HA 4PJOB 3ZEHA 2LVMA 1K73U 3C12A 3G4ST 2RH2A 3VYHB 1VQ4A 1FXXA 4PJOF 2QA4T 3QJYA 3MEAA 5DY9A 2KSSA 4J6WA 1BI0A 3OS2A 1X75C 5J26A 3LGFA 3CMAA 3S3MA 3Q1JA 5CQYA 2RA2A 1NPPA 2M16A 5CK9A 5LJ5g 5FLXE 3SWNA 3GNFB 1ZBXA 1SSFA 4M7DE 2EAYA 4LDXA 1YJNT 4ATOA 3CCQT 4M7AA 3G71T 1M1KC 3JCMh 4M7AB 1VQMT 5CVIA 3I56T 4EMHA 4FT2A 1VQ5A 3HFNA 4XU0A 2DZCA 5CCAA 1KG1A 1WJSA 2XU8A 1MHNA 3LWHA 3VU3C 4HKEA 5GMKj 5LJ3h 3M5AA 4J7FA 3G6EA 3JCMe 2M1HA 3CCLA 2L3RA 3OYIA 3TCJA 4JLGA 4F7UB 3JB9D 2O01E 1OZ3A 4LDWA 3QPHA 1VQ9A 4E47A 5CKEA 5GAOp 1K8AU 3OS1A 3SWNB 3JCMP 5D6XA 5IT9E 1PSFA 3OW2S 4M78E 2DJZA 2VUBA 1VUBA 3HL8A 3V8LA 3FC3A 2GFUA 2MMPA 2EKOA 2IG0A 4QQGA 3GOXA 4RCBA 1BI3A 3DLLA 1DJ7B 2HQEA 1Y71A 2RHUA 4FIBA 3URGA 3VV0A 3NTHA 3HFOA 4JJNK 1LOJA 1VQNT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3URG A;  2P0Q A;  2P0P A;  2K2V A; 
#chains in the Genus database with same CATH topology
 2L3S A;  2CT3 A;  2E41 A;  1GBR A;  1UHF A;  5A0D A;  1WI7 A;  4BI8 B;  3P8D A;  3VYG A;  2FHD A;  1P92 A;  5L23 A;  4OGC A;  3EGX B;  3CCS A;  3CCV T;  5I2S A;  1Y7X A;  2CRE A;  2NYS A;  3CC4 A;  3A8L B;  3BFM A;  4C92 C;  2MK5 A;  3VJP A;  1M2V B;  1D3B A;  1M2O A;  1VQK T;  2KRS A;  5DM7 R;  4FL6 A;  1FMK A;  5D7U A;  4PJM A;  1YHQ Q;  2EQU A;  3CBO A;  3FIF A;  4EIK A;  2LJ1 A;  2GF7 A;  2EYW A;  3RUX A;  2CP5 A;  4D8D A;  3JCM c;  2LCC A;  1AT1 B;  4KGX B;  3GP8 A;  3OQ5 A;  3P8B B;  1YJW T;  2XDB A;  2DX1 A;  4F7U G;  4OMO A;  2L8D A;  2ZAE A;  3CBP A;  2RQR A;  1FMW A;  3I55 A;  5KYW A;  1UHC A;  3C0C A;  5HK3 A;  4LD9 K;  3OB9 A;  2PTK A;  4JS4 A;  2GGR A;  3PGG A;  1ZQ1 A;  1E6H A;  1AWO A;  3OYH A;  2E4H A;  2FZK B;  3OYE A;  2F5T X;  3KBG A;  5GMK i;  1K8A R;  4C8Q G;  3V8J A;  3CCM T;  3H6Z A;  4Z02 A;  4M75 D;  2R58 A;  2VGN A;  3HPW A;  3C95 A;  2XI9 A;  3EGX A;  1YCY A;  3OS0 A;  3CCU A;  4N4H A;  3EFO A;  2MWO A;  5KE3 A;  4XQ3 A;  1MGQ A;  1D3B B;  4M7D B;  2DO3 A;  3CC4 T;  1M90 C;  2IIM A;  2COW A;  2KVQ G;  1X2Q A;  3MET A;  1PCX A;  1UGS B;  4M75 F;  2X3X D;  1E6G A;  3BY7 A;  2VV5 A;  1VQ4 Q;  2QTV A;  4OF1 A;  1GCP A;  2BIV A;  1D09 B;  1YIT A;  1UB4 A;  2DL5 A;  4OGE A;  3CCQ Q;  4IUU A;  1BB9 A;  2XDD A;  1OV3 A;  3CCE Q;  2FPF A;  3TVT A;  2CP2 A;  1MMA A;  1NLP C;  2HSE B;  2J6O A;  1M8V A;  2A3L A;  3CC7 T;  3RKX A;  1TUC A;  3LW5 E;  2HNI A;  1NBE B;  2LNV A;  3CC7 A;  1X27 A;  2HDA A;  3MPU B;  2GTO A;  1ZA1 B;  2YLC A;  3PTA A;  3R6O A;  1Z9Q A;  1PNJ A;  2RHI A;  2EJF A;  4LDU A;  3MEU A;  3X24 B;  2PUK B;  2DXC A;  3JV3 A;  2MWP A;  3RBB B;  1QVP A;  1I8F A;  3SD4 A;  4DEX A;  3JCM X;  1GBQ A;  1M90 R;  2DXT A;  3SWN C;  1D1C A;  5FWB A;  2DD4 A;  2DJQ A;  5IN1 A;  2K7A A;  2QDY B;  2LCS A;  4E7S A;  1GFD A;  1W2B S;  2ESW A;  1IRE B;  5GAN 8;  1M5Q 1;  2PVG B;  5FU6 B;  1YIJ A;  3X26 B;  4BE2 A;  4ESR A;  2DRM A;  1TOV A;  4M77 A;  3RDV A;  3SDZ A;  3EFR A;  1WHL A;  5GAO m;  4PLI A;  4WCI A;  4O5V A;  2LMJ A;  1W2B P;  4M7A F;  2YLB A;  3CPW S;  1OQK A;  1RLQ C;  1LPL A;  2RK1 A;  2Z0W A;  3I5S A;  1KHI A;  1M9S A;  2WSE E;  5GAN f;  4M78 A;  5GAO r;  4PJL A;  1G3W A;  4RCC A;  2ED0 A;  1VQ7 A;  1NYF A;  1AVZ C;  4F7U E;  3OYJ A;  1Q86 U;  5GAM f;  3TU4 K;  5GAO q;  1NPR A;  1Q7Y C;  5CKD A;  4C92 A;  4M7D C;  5IH2 A;  4C8Q D;  1RI0 A;  1WHH A;  4MZM A;  2JT4 A;  3I5R A;  1YJW A;  1JJ2 A;  1WJR A;  2RQT A;  3WVE B;  2EPD A;  1EX4 A;  3FLG A;  4XTU A;  2RN8 A;  1VQK Q;  1MV0 B;  4J6Y A;  2V26 A;  4XTY A;  2EVR A;  3JB9 G;  1ZBJ A;  1D0Y A;  1RL2 A;  1VQK A;  1Q95 G;  4M78 C;  3OYL A;  2PQW A;  5LJ5 g;  2K3B A;  4L5G A;  2JNG A;  2E64 A;  2MAM A;  4UC4 A;  1Y07 A;  1VQ9 Q;  4BDY A;  4AG1 C;  1NM7 A;  3LGL A;  2V1R A;  2O9S A;  1ABQ A;  2JMC A;  1I81 A;  1QP3 A;  3UAT A;  1R0C B;  1SRL A;  1X6G A;  1VA7 A;  1J3T A;  3QJ6 A;  4OMQ A;  3CCU Q;  4D8K A;  3CCU T;  1M8M A;  3A8M B;  2R5M A;  5HKC A;  2V8K A;  2LDM A;  3NPF A;  1AWX A;  3CMA Q;  4C8Q F;  4IUR A;  2XKO C;  3JRZ A;  4R0K A;  2E65 A;  2CZ6 B;  4JLI A;  4N0A A;  1M2V A;  4J9G A;  1TTH B;  2AZV A;  2EQI A;  2CKK A;  1VQO Q;  1B34 A;  4J9E A;  4RTX A;  2EQJ A;  2OTL A;  4N4I A;  4MMK A;  4RG2 A;  4BDZ A;  2L3Q A;  1PKS A;  1UGR B;  4KT0 E;  2QQ9 A;  2ZPF B;  1V1C A;  2AHJ B;  2G3R A;  2RPN A;  2J6F A;  2LC4 A;  2EGC A;  4M75 G;  1O75 A;  1M3B A;  2FO0 A;  4MDW A;  1IB8 A;  3EG9 A;  4C92 D;  1YJN A;  3JCM V;  3PIP A;  2QEX Q;  1RAG B;  4OB2 B;  5FRM A;  2LQ8 A;  1C1A A;  2GBQ A;  4HXJ A;  4LD6 A;  1HD3 A;  1ZSZ C;  3VRZ A;  1BI2 A;  4RKU E;  1Q86 R;  3A8H B;  1NEB A;  3NHN A;  1WPY A;  5EG2 A;  1YFN A;  1YJ9 T;  1C6V X;  5M9O A;  2YHT A;  3MP1 A;  1F1B B;  3M0U A;  2YRC A;  2F69 A;  4C0F A;  1RAB B;  2DTH A;  2OTL Q;  1WXT A;  3GPL A;  2YXY A;  3V7C A;  1AD5 A;  3CCR A;  4M78 G;  3CCQ A;  2QAZ A;  2KEA A;  4RTZ A;  4ZTJ A;  2LT4 A;  3REA B;  2P0P A;  3RIR A;  3EH2 A;  4BY6 B;  4OMN A;  2EYQ A;  3M53 A;  3M58 A;  1ZSZ A;  1WJQ A;  1MMG A;  4QVC A;  2K6D A;  3F70 A;  1UGV A;  5GAM h;  3CC2 A;  1JU5 C;  2WSF E;  2DIG A;  2DIQ A;  4DQ2 A;  1SHG A;  3EHQ A;  2IPO B;  3OA6 A;  1NG2 A;  2KNB B;  2DF6 A;  3UA6 A;  4WF2 A;  1X01 A;  1T0J A;  2DTO A;  2QXF A;  3TSZ A;  1NJI U;  2K2M A;  2L5Q A;  1M90 U;  3EG2 A;  3VS1 A;  2OAU A;  2CS7 A;  4JZ4 A;  2LVM A;  1QKX A;  1K73 U;  1FXX A;  4PJO F;  3MEA A;  4WTO B;  1X75 C;  5FW9 A;  1K1Z A;  5J26 A;  1FMV A;  3Q1J A;  1NPP A;  3GNF B;  5IXB A;  4LXC A;  2KRM A;  4M7A A;  4FYX B;  5CVI A;  1HYO A;  1PC0 A;  1WJS A;  2XU8 A;  4HKE A;  1MND A;  3M5A A;  5LJ3 h;  4J7F A;  2M1H A;  2DL4 A;  3TCJ A;  3JB9 D;  2EYX A;  5CKE A;  2EKH A;  1K8A U;  2L2P A;  4OMM A;  1PSF A;  2O31 A;  4FW2 A;  3CCL A;  3V8L A;  5IXF A;  2KE9 A;  2GFU A;  2IG0 A;  4RCB A;  1BI3 A;  3DLL A;  1DJ7 B;  2DNU A;  2HQE A;  2RHU A;  2MIO A;  2FL7 A;  2E6N A;  1JXM A;  4FSX A;  4QVD A;  1UJ0 A;  4QT7 A;  1KHC A;  2DVE A;  2K79 A;  3UF4 A;  1SPK A;  1FX7 A;  4IUT A;  1VQN Q;  4R56 A;  1M27 C;  1S1N A;  3CC2 T;  3GLX A;  2OJ2 A;  2LQN A;  3OYC A;  2XDP A;  1Q86 C;  3NGP A;  1G5V A;  3INZ A;  5C6S A;  2ZPH B;  2Y4Y A;  1SKU B;  2KT8 A;  2CP0 A;  3M56 A;  3H0H A;  1N8R U;  4QVZ A;  5C0M A;  1BYM A;  2QG9 B;  1Q7Y R;  3X20 B;  3PFS A;  2W0Z A;  1PD1 A;  1GL5 A;  1X43 A;  1ABO A;  1QLY A;  1PRL C;  3MCA B;  4RTV A;  4E7H A;  3UA7 A;  2RHX A;  4PLL A;  4AFQ C;  5CKH A;  5KYY A;  2LZ6 B;  1HXD A;  4PJN A;  2AKK A;  1YWP A;  2QQR A;  3MP6 A;  4BY6 C;  3AT1 B;  3C4S A;  5GAN d;  3VKI A;  2G6F X;  1Y0M A;  2DD5 A;  3M57 A;  2Y4X A;  3A8O B;  3RR6 A;  2H8H A;  1HJD A;  2FRW A;  1BI1 A;  2DK3 A;  3FEO A;  3OY9 A;  4C8Q C;  2E12 A;  4HA8 A;  3REB B;  5FU6 C;  4N0A C;  3JCM W;  1BCM A;  3WVD B;  8ATC B;  5GAN 5;  4DBQ A;  5LJ5 e;  3JCM f;  3EGD B;  3CME Q;  3AHU A;  4HVV A;  2C06 A;  2X4Y A;  3PIO A;  2DAQ A;  4M75 C;  3BW1 A;  1OX8 A;  1VIF A;  1QVF P;  1BU1 A;  1WXU A;  1VIE A;  4QKU A;  5D6Y A;  1RAD B;  1VQ6 T;  4HCC A;  2ZPB B;  2M02 A;  2MI6 A;  2HBW A;  3QXE B;  2JTE A;  2EJ9 A;  1WDX A;  4KRT A;  3QZ5 B;  2J06 A;  1IGU A;  3KUF A;  2XD0 A;  3GIB A;  2DYI A;  4KBM B;  4ELZ C;  1OZ2 A;  2HSP A;  2RQU A;  2X35 A;  3CCE T;  1QVG A;  5GAM j;  1GCQ A;  3CCJ Q;  1VQO T;  2NUP A;  2EQK A;  3LLR A;  4JRQ A;  3S3O A;  3CD6 A;  2HMA A;  4C5I A;  1VQO A;  3VUB A;  1VQM A;  1MMN A;  2VWF A;  3V7S A;  2QA4 Q;  2KYM A;  4PJO E;  3OSV A;  5FU7 B;  2QI2 A;  1OU8 A;  2M0O A;  2FZC B;  2Y90 A;  2VB6 A;  2RJE A;  1PM3 A;  2COZ A;  2C0O A;  1PG5 B;  2C0I A;  3JCM d;  3E9F A;  2RHY A;  3DLM A;  2XHC A;  2RB6 A;  5CKF A;  2K5L A;  1AOJ A;  2F2W A;  4M7A C;  4M7D F;  1T3S A;  2QK0 A;  4GLM A;  2P0Q A;  2RK2 A;  4E7K A;  2JJ9 A;  3QDR B;  2KAF A;  4OVA A;  3PT9 A;  4O6J A;  1WHG A;  2KDS A;  2DE0 X;  1OYX A;  2DXU A;  1FYN A;  2NUT A;  2LCL A;  4R55 A;  2AZS A;  3OYN A;  1WFW A;  1QMC A;  3DKM A;  3G1J A;  3OYY A;  3CCS T;  3CCV A;  4OMP A;  2GNC A;  3UPU A;  4AT1 B;  5KH6 A;  2E3H A;  2VYT A;  1CSK A;  3FJP A;  2ZZD A;  1IZ6 A;  3SFM A;  4II1 A;  3J81 E;  5CIU A;  1UG1 A;  2HKN A;  2YUO A;  4M7A E;  3QHS A;  5I2M A;  2DBM A;  4MML A;  4TVR A;  1BIA A;  2NWM A;  2LRQ A;  3CCV Q;  5GMK l;  4DEY A;  1G2B A;  3H0I A;  5I11 A;  2RI5 A;  2K2V A;  4RTY A;  2I2L A;  2XID A;  3CCR Q;  1B34 B;  1JXO A;  2V1Q A;  1U1T A;  2AT1 B;  2NUP B;  4B9W A;  4PJO A;  3X25 B;  5GAN g;  1W70 A;  3G6E Q;  3QUI A;  2CDT A;  4C92 B;  2ZGW A;  4RTW A;  4J7I A;  4AFZ C;  2V8I A;  3N5B B;  3HRU A;  1KC8 C;  4ZGD B;  3QKJ A;  1K8A C;  4BI4 A;  5KYN A;  2F2X A;  4C8Q A;  2BKD N;  5KYU B;  2M0Y A;  3LH0 A;  2ROT A;  1RAH B;  4M7A G;  3HHT B;  2KQW A;  1UEC A;  5KE2 A;  2RJF A;  2E3I A;  3I55 T;  4OB0 B;  1KQS P;  1QW1 A;  2VXE A;  1N8R C;  1TSF A;  4M77 B;  4X1V A;  3I56 Q;  4EMG A;  5KYX A;  3OS5 A;  3CCM A;  1RUW A;  5GMK m;  4FT4 A;  1U8R A;  2RQV A;  1PHT A;  2JXB A;  1YCS B;  3CC7 Q;  4XU2 A;  1R77 A;  2COY A;  2LX7 A;  2LX9 A;  5LJ5 f;  2ENM A;  4F7U A;  3ULR B;  1I0C A;  2OTJ T;  4M77 F;  3CXC S;  2CP3 A;  2H3J A;  3I35 A;  4VUB A;  4F17 A;  3CPW P;  4DBH A;  1D1B A;  5GAN e;  3LWI A;  1H3Z A;  2CH4 A;  4F7U F;  1ZUU A;  4GLK A;  4FCY A;  2FB7 A;  3QBY A;  4C0D C;  1WA7 A;  3JAM E;  1QKW A;  3VS7 A;  1VQ7 Q;  4ANJ A;  4KUD K;  3V7R A;  1KD1 R;  4OMF B;  4EMK C;  2FPD A;  2GQV A;  3D7S B;  3M59 A;  4E6R A;  1VQP Q;  2O4X A;  4RTU A;  1K9M C;  1TS9 A;  4LUD A;  4RG8 A;  1GFC A;  1A0N B;  2KI7 A;  5GAM d;  3NFC A;  3PMI A;  1VQM Q;  3E1S A;  4YTL A;  3R6N A;  3L2Z A;  3OSS C;  4CI0 C;  3RMQ A;  1WXB A;  2QQS A;  2OAW A;  3M0Q A;  4ZN3 A;  3E19 A;  3MO8 A;  4J9B A;  4BB7 A;  3CME T;  2WSC E;  1ZLM A;  1QP2 A;  4C92 F;  3A98 A;  1VQ9 T;  1SEM A;  1W4S A;  2JS0 A;  1AWW A;  5GAM e;  1M1K R;  2A28 A;  3CCM Q;  3GBQ A;  2BTT A;  5HCK A;  1TU0 B;  1EZZ B;  2DA9 A;  4PJO B;  3VRY A;  1MMD A;  1D1A A;  1U3O A;  2NUZ A;  4J6W A;  1NLO C;  4E2F B;  1X6B A;  5FLX E;  1BBZ A;  1SSF A;  4M7D E;  4LDX A;  4J9H A;  1YJN T;  3CCQ T;  1ZA2 B;  4JJC A;  3CCS Q;  2FZG B;  2L3P A;  1VQ5 A;  3HFN A;  1TXQ A;  4XU0 A;  2RF0 A;  1HSQ A;  3LWH A;  1S72 Q;  2JM8 A;  8AT1 B;  4F7U B;  2O01 E;  1OZ3 A;  1VOM A;  3SEM A;  1KSW A;  1VQ5 Q;  2YUP A;  2O88 A;  5D6X A;  1SF9 A;  4M78 E;  1RI9 A;  2VUB A;  4HVW A;  3VS6 A;  4LN2 A;  1KK7 A;  4QQG A;  4FIB A;  1Y71 A;  3HFO A;  4PFO A;  3OBY A;  3A5Z B;  4A4H A;  4MDX A;  1H64 1;  1PWT A;  5KYY B;  2XMF A;  2CZ7 B;  4RUG A;  5DLO A;  2KT1 A;  2ZPG B;  2DL7 A;  5I21 A;  2K3X A;  2DM1 A;  4JJD A;  2X3W D;  3A1P A;  1YI2 Q;  4KH1 B;  1NJI R;  2RJD A;  2LP5 A;  4C8Q E;  3QSU A;  1CKB A;  4PNO A;  3H8Z A;  4XAX B;  4M7A D;  1AZG B;  3KXT A;  2E5Q A;  4NL3 A;  1Q81 C;  3PVQ A;  5IHK A;  1T0H A;  4OP0 A;  3EG3 A;  1JB0 E;  2BUD A;  2LT1 A;  4KH0 B;  3CCE A;  2HD0 A;  1VQN A;  2CH4 W;  4DA4 A;  5GAN h;  2D0N A;  1OPK A;  2E10 A;  4FW1 A;  5LJ3 j;  1QWF A;  2ZPE B;  3CCJ T;  1KC8 U;  1N27 A;  3G7Z A;  3SB2 A;  1VQP A;  2PVO B;  3OBW A;  2DEU A;  1QQJ A;  4LNP A;  2EIF A;  2FVU A;  4IUV A;  2GQI A;  5GAN 2;  4M77 G;  3OW2 A;  3X28 B;  3LX7 A;  3ZL7 C;  5FRN A;  1KC8 R;  3RKY A;  2RNA A;  2XIC A;  2RM4 A;  4IUP A;  5LL6 S;  1QCN A;  4CC2 A;  1PSE A;  5GAN 3;  5GAM g;  2QA4 A;  2BZX A;  4M4Z A;  4GY5 A;  1K0X A;  4DBF A;  2J05 A;  3L2U A;  1UE9 A;  1W1F A;  4A4F A;  3CCJ A;  4J9F A;  1ZX6 A;  3H0F A;  2FPE A;  3OMG A;  4M7D G;  3G71 Q;  4NOY A;  3ME9 A;  4KGZ B;  7AT1 B;  1YJ9 A;  1YI2 A;  2MCN A;  4D6W A;  2EYY A;  2YUQ A;  2K3Y A;  3E2U A;  3JB9 I;  2W10 A;  4MZP A;  2M9U A;  3JCM g;  3LYI A;  4E7Z A;  2RQW A;  3BDL A;  1HK9 A;  5KYU A;  3ASK A;  4FYY B;  3E9G A;  1V29 B;  3M54 A;  4AFU C;  2XK0 A;  3TQ7 P;  1UFF A;  3UDC A;  3VS0 A;  2PNI A;  3BE3 A;  2ZPI B;  4JRI A;  4F04 B;  2CZ1 B;  1PRM C;  4Y92 A;  3JCM J;  3U23 A;  2WAC A;  5CKB A;  1R0B G;  5LJ5 d;  2D8J A;  1AWJ A;  1H3H A;  2EJG A;  1X69 A;  4B6M A;  4C0Z A;  2BZY A;  3OMC A;  3M0P A;  4RMO A;  2D8H A;  1YIT Q;  1K9M U;  2JUF A;  4ELY C;  2F5K A;  3UWN A;  1PD0 A;  5J39 A;  1NE8 A;  2VGM A;  2CSI A;  2QAS A;  2QQA A;  4JJB A;  2F2V A;  1I5O B;  5A2Q E;  5DLQ E;  2RI2 A;  4F14 A;  2FYK A;  3L1A A;  1KIK A;  4J8O A;  2CZ0 B;  2YSQ A;  1XOV A;  5ECA A;  4X9C A;  2AK5 A;  1AHJ B;  4B9X A;  5D6W A;  1WX6 A;  1UTI A;  4FM4 B;  2DVJ A;  1LVK A;  1W6X A;  5EC7 A;  3QWX X;  5LJ5 h;  3EAE A;  2OX7 A;  4M78 F;  1JEG A;  2PVD B;  3G71 A;  2VAS A;  4XU3 A;  4J6X A;  4XTW A;  4E7I A;  1WQ7 A;  5L8R E;  4BUG A;  1KQS A;  3OYA A;  1RAA B;  2F1L A;  1ZHI A;  2P0K A;  3EG0 A;  4CC7 A;  4XTX A;  4RTT A;  3CCL T;  2DTI A;  2J7I A;  2KXD A;  3I55 Q;  2CUD A;  4KGV B;  1WYX A;  4M75 B;  4FYV B;  2DPP B;  5CR2 A;  1Q81 R;  1U06 A;  5CO7 A;  3MEW A;  1TWB A;  1KQS S;  3JB9 H;  1SRM A;  2OTJ A;  4PJO G;  2KR3 A;  4ME7 A;  1BIB A;  1TUD A;  3CC2 Q;  3RMS A;  4EPC A;  1KJW A;  3QYG B;  2RJC A;  2IVW A;  4XTZ A;  1U1S A;  2YUN A;  4BE1 A;  2JZ2 A;  2EWN A;  3EHR A;  1QWE A;  1H92 A;  3P8H A;  4DOV A;  4J5Y A;  1JRI A;  2LTO A;  1S72 A;  3CD6 Q;  3CCR T;  2VVK A;  1K4U S;  2CYZ B;  1ARK A;  1K9A A;  2DET A;  2K5F A;  2JS2 A;  1VQP T;  5GAN 6;  1G3T A;  2J6K A;  2DMO A;  5HY6 A;  4L6V 5;  4FYW B;  2I0N A;  4J9I A;  2QTX A;  4L59 A;  2PUO B;  2NUT B;  1OPL A;  4PFZ A;  3L2W A;  2D9T A;  9ATC B;  2KBT A;  4A4G A;  1UGP B;  2X4J A;  5GMK h;  3QG1 A;  4M77 C;  4XTV A;  1YHQ A;  2KRO A;  2MOX A;  4Q5W A;  1YIJ T;  5GMK e;  1YNZ A;  4HCZ A;  3OW2 P;  1QCF A;  4QQD A;  1VYU A;  1JQQ A;  1YWO A;  4EDU A;  3NMZ C;  3M4G A;  4JPB W;  3DB3 A;  3CPF A;  3OYG A;  4LE9 A;  2BE9 B;  3QDF A;  5KYW B;  1IXD A;  4FU6 A;  4IKF A;  3PVL A;  3MKD A;  1YIJ Q;  2R5A A;  4MZT A;  4BD3 A;  4ZNX A;  4V2S A;  2QQB A;  3EG9 B;  1XQH A;  5A0G A;  2B86 A;  3HSB A;  4PJO C;  3VUZ A;  3JCM Q;  1WNL A;  1YIT T;  1RAI B;  3CPW A;  2ECZ A;  4M77 E;  2HQX A;  2YRV A;  4HT8 A;  2ROL A;  2DYB A;  1VQ5 T;  3CBM A;  2P4R A;  3FDR A;  4QQ6 A;  4AFS C;  1B07 A;  1KD1 C;  3QYH B;  3O5Z A;  1UJY A;  1OUL A;  1VQ8 T;  2P84 A;  2A7Y A;  2CUB A;  1YJ9 Q;  3RNJ A;  3VS3 A;  2ATC B;  2DLP A;  4E7J A;  1N5Z A;  1M3C A;  4A63 B;  2JVV A;  3MJX A;  3S6W A;  4HT9 A;  2X4W A;  1IRX A;  5FRO A;  2YT6 A;  3EGU A;  2KMT A;  4XU1 A;  1RAF B;  3ER0 A;  2XG8 D;  2L89 A;  1WQW A;  1XTD A;  2D0Q B;  2KXC A;  4C8Q B;  4CRI A;  1MV3 A;  4X9D A;  1YJW Q;  1VQ4 T;  1T3L A;  5GAN j;  2O4X B;  4C5H A;  2VKN A;  4F16 A;  2RH2 A;  1VQ4 A;  2ABL A;  4PJJ A;  2QA4 T;  3QJY A;  5DY9 A;  2KSS A;  5GJV B;  1IGQ A;  3CMA A;  3S3M A;  1D0X A;  1V76 A;  3I9Q A;  5CQY A;  2M16 A;  3SWN A;  2BE7 D;  4ATO A;  3HTR A;  4PK4 A;  4M7A B;  1VQM T;  3I56 T;  2KGT A;  2FG0 A;  2JM9 A;  1MHN A;  5GMK j;  3G6E A;  2L3R A;  3OYI A;  1WLP B;  3IQL A;  4LDW A;  3QPH A;  1VQ9 A;  4J9C A;  4E47 A;  3OS1 A;  3JCM P;  1EFN A;  3OW2 S;  2OI3 A;  1VUB A;  3HL8 A;  3FC3 A;  4AMC A;  3GOX A;  2EKO A;  3VV0 A;  3NTH A;  1VQN T;  1RAC B;  2DZ9 A;  2GFA A;  3TEE A;  2SRC A;  4M7D A;  4XK8 E;  1AZE A;  1E7O A;  2YWW A;  1K73 R;  3CD6 T;  2VC8 A;  2HKQ B;  1Y96 A;  1I5L A;  2C0T A;  1QVG S;  4GBQ A;  4ZTF A;  3M0S A;  3ZFJ A;  1CKA A;  1U5S A;  3JCM b;  1YJN Q;  2AKL A;  3HRT A;  3RES A;  4C92 G;  1OX9 A;  3FJ5 A;  1UEB A;  2KYB A;  2OTJ Q;  5CQX A;  2EBP A;  1PKT A;  4Y91 A;  4PKC C;  3CC4 Q;  2GCX A;  2RO0 A;  4A53 A;  3OYD A;  1QCO A;  1NYG A;  2DKG A;  2MPX C;  1SG5 A;  1VYT A;  5IHN A;  3EFO B;  1BK2 A;  3FRN A;  3TSW A;  2A0F B;  4KUI A;  4JDS A;  3DB4 A;  1B7T A;  4LDV A;  4C5E A;  3MP8 A;  1Q82 U;  1GXI E;  5I22 A;  3VS4 A;  1N8R R;  4Y28 E;  3M55 A;  5J3B A;  1X2K A;  1TH7 A;  1H8K A;  1GRI A;  2EGE A;  1YHQ T;  4OML A;  2P4T A;  1I4K 1;  4C92 E;  2CP7 A;  1Q82 C;  2CGH A;  1S72 T;  3RKW A;  1VQ6 Q;  3RER A;  2ZCF B;  3LH5 A;  1ZSG A;  2OTL T;  5IHI A;  2DL3 A;  2HCK A;  1YBY A;  2QEX T;  3QZ9 B;  6AT1 B;  4HCB A;  2E6Z A;  4Z89 A;  2AIR B;  3H41 A;  4Z8A A;  3EFS A;  2CSQ A;  1BKB A;  3CME A;  2EFI A;  4M78 B;  1Q81 U;  4DBR A;  3MHX A;  4E7L A;  1N9S A;  1VQL A;  3OYB A;  3BDU A;  3CXC A;  5FWC A;  1JBM A;  5LJ5 j;  2HBP A;  2YRD A;  4IIO A;  2ED1 A;  1N6A A;  3CCL Q;  1OU9 A;  2KRN A;  1KQ2 A;  2KK4 A;  4LDY A;  3HP9 A;  1OI1 A;  1M30 A;  3VS2 A;  4C0G A;  1RLP C;  5FU7 C;  2LNH B;  2CT4 A;  5A0L A;  2D6F A;  1M4Z A;  5HK0 A;  3JB9 F;  1UUE A;  4AG2 C;  4M77 D;  3PMT A;  1VYV A;  4BAC A;  3G6E T;  2K5I A;  4A4E A;  4NS5 A;  3NTK A;  4J83 A;  2EQM A;  1M1K U;  2HAX A;  1LCK A;  1IO6 A;  5GJW B;  4JRP A;  4IIM A;  3THK A;  2M51 A;  2FRY A;  4N4G A;  1Q7Y U;  4X34 A;  5GAO l;  2EW3 A;  2L0A A;  4QW2 A;  3UT1 A;  3QO3 A;  1M1G A;  1WHK A;  3HKS A;  2JMA A;  2A08 A;  2FEI A;  1FWZ A;  3OYF A;  4JZ3 A;  1LNX A;  3CMA T;  2MF2 A;  3L2Q A;  1I1J A;  4JS5 A;  3VS5 A;  1VQ8 A;  1O9S A;  3I56 A;  3L42 A;  3L2R A;  1R8O B;  4DOW A;  2HEQ A;  2D1X A;  3HRS A;  4ZGE B;  4A4K A;  1VQL T;  3V8K A;  1N9R A;  1Y96 B;  3OYK A;  2RMO A;  1G3Y A;  4KUL A;  2YDL A;  2DER A;  2JOY A;  2LJ3 A;  4EMK A;  1XNI A;  1I07 A;  2JW4 A;  1OOT A;  1YN8 A;  3G4S A;  5LJ3 d;  1AEY A;  2LQW A;  3MEV A;  2K4Y A;  3L2V A;  2HL5 C;  2PU9 B;  2BZ8 A;  2B8A A;  1M1F A;  2QDL A;  4PFP A;  3A8G B;  4M78 D;  3GNG A;  1WGS A;  4LUE A;  3CEY A;  1WHM A;  4M75 A;  1M3A A;  1Z9Z A;  1QVG P;  2LQK A;  4C5G A;  2V8J A;  3EH1 A;  1WZO A;  5LJ3 e;  3FB9 A;  1UGQ B;  2RHZ A;  1VQ6 A;  2DBK A;  1NEG A;  4BE0 A;  3S3N A;  2QYZ A;  5LJ3 g;  3ZBD A;  1OEB A;  1ZSZ B;  1TG0 A;  1W2B A;  5CAI A;  2O9V A;  2DXB A;  5AT1 B;  4ZN1 A;  3O8V A;  4OB3 B;  5KCO A;  5KYX B;  3H9N A;  1Q82 R;  2LJ0 A;  5AYF A;  3TRE A;  1G3S A;  1D0Z A;  4M75 E;  1QVF A;  3WXM B;  1JO8 A;  2RD1 A;  5KCH A;  2SEM A;  2DFU A;  2O2O A;  3OYM A;  2JTF A;  2H3E B;  3M9Q A;  2K57 A;  1EIF A;  1KQ1 A;  4CC4 B;  2JTM A;  1MUZ A;  2QGG A;  2NLU A;  4ORZ A;  4K11 A;  5LJ3 f;  5GAN 7;  2K9G A;  3PE0 A;  2MYS A;  1BCO A;  1JJ2 S;  2RI3 A;  1IHW A;  3C94 A;  3QII A;  3JSC A;  1WIE A;  4J9D A;  1B3Q A;  4OB1 B;  4PL6 A;  1X6O A;  1YI2 T;  3JB9 J;  1VQL Q;  1K0S A;  3NTI A;  2E70 A;  1LJO A;  4BI3 A;  1GCQ C;  2CP6 A;  5IAY A;  1NJI C;  3CQT A;  4FSS A;  1SHF A;  1KFZ A;  1K73 C;  5GAO n;  3M4Y A;  1XJW B;  4P5N A;  4ZGJ B;  3J7A F;  1G83 A;  4A54 A;  4IUQ A;  1K9M R;  4EMK B;  3QWY A;  2HL3 A;  4PJO D;  2DEQ A;  1K76 A;  1YP5 A;  4HCK A;  2R57 A;  2HQH A;  2X51 A;  2E1H A;  4NL2 A;  4C0D B;  2QGF B;  1QVF S;  2QEX A;  4JRK A;  2A36 A;  2DRK A;  4M7D D;  2EYZ A;  4JUV A;  3GF5 A;  2JN0 A;  5GAN 4;  1WHJ A;  2X4X A;  3T9N A;  3EGD A;  2PZ1 A;  3J80 E;  1C0M A;  2VXF A;  3KFV A;  3PNW C;  2E5K A;  1ZUY A;  1VQ7 T;  2KY9 A;  2DL8 A;  3M0T A;  1NZ9 A;  3ZEH A;  3C12 A;  3G4S T;  3G4S Q;  3VYH B;  3EG1 A;  1BI0 A;  3OS2 A;  2DIL A;  3SHW A;  3LGF A;  5CK9 A;  2RA2 A;  1ZBX A;  2A37 A;  2EAY A;  3G71 T;  4Z88 A;  1M1K C;  3JCM h;  1UDL A;  4HVU A;  4EMH A;  4FT2 A;  3M0R A;  1KG1 A;  2DZC A;  5CCA A;  2X9H A;  3VU3 C;  1VQ8 Q;  2GTJ A;  1SSH A;  3JCM e;  1RAE B;  1TUG B;  1ACM B;  1IHV A;  1G8X A;  4JLG A;  2HZY A;  1ZUK A;  5GAO p;  1Y57 A;  3SWN B;  1JJ2 P;  5IT9 E;  3CXC P;  2DJZ A;  4CC3 A;  2MMP A;  1MNE A;  3URG A;  4JJN K;  1KD1 U;  1LOJ A;  2EGA A; 
#chains in the Genus database with same CATH homology
 3OBY A;  2FL7 A;  2DZ9 A;  2E6N A;  2GFA A;  3A5Z B;  4A4H A;  4MDX A;  1H64 1;  4FSX A;  2E41 A;  2CZ7 B;  4QVD A;  5A0D A;  3TEE A;  5DLO A;  1KHC A;  2DVE A;  2ZPG B;  3P8D A;  4XK8 E;  4BI8 B;  5I21 A;  4M7D A;  3CD6 T;  2K3X A;  2VC8 A;  1I5L A;  1Y96 A;  3VYG A;  2FHD A;  1FX7 A;  1P92 A;  1QVG S;  4IUT A;  4OGC A;  2RJD A;  4R56 A;  4ZTF A;  3CCS A;  3CCV T;  4C8Q E;  5I2S A;  1Y7X A;  3ZFJ A;  3GLX A;  3CC2 T;  3CC4 A;  3QSU A;  4PNO A;  3JCM b;  3A8L B;  3H8Z A;  4XAX B;  3OYC A;  4M7A D;  3BFM A;  2XDP A;  4C92 C;  1Q86 C;  3KXT A;  3VJP A;  2E5Q A;  1G5V A;  1D3B A;  3INZ A;  4NL3 A;  5C6S A;  2ZPH B;  1VQK T;  2Y4Y A;  5DM7 R;  1Q81 C;  3HRT A;  3RES A;  4FL6 A;  4C92 G;  4OP0 A;  3M56 A;  1JB0 E;  1UEB A;  2EQU A;  3CBO A;  3FIF A;  1N8R U;  5CQX A;  2GF7 A;  4QVZ A;  5C0M A;  1BYM A;  3RUX A;  2BUD A;  2LT1 A;  3CCE A;  3X20 B;  2HD0 A;  3PFS A;  1VQN A;  3JCM c;  2LCC A;  4Y91 A;  4PKC C;  4DA4 A;  2GCX A;  2RO0 A;  4A53 A;  5GAN h;  3OYD A;  3GP8 A;  3OQ5 A;  3MCA B;  2E10 A;  3P8B B;  2DKG A;  1YJW T;  4E7H A;  2XDB A;  2RHX A;  4PLL A;  4F7U G;  5LJ3 j;  5CKH A;  3FRN A;  2L8D A;  2ZPE B;  1HXD A;  3CCJ T;  3CBP A;  1KC8 U;  2QQR A;  3MP6 A;  4BY6 C;  4KUI A;  1N27 A;  3G7Z A;  3DB4 A;  4JDS A;  3I55 A;  3SB2 A;  4LDV A;  3C4S A;  1VQP A;  5GAN d;  3VKI A;  4C5E A;  3MP8 A;  2PVO B;  1Q82 U;  1GXI E;  2DD5 A;  3M57 A;  5HK3 A;  2Y4X A;  3A8O B;  3OBW A;  4LD9 K;  3OB9 A;  4Y28 E;  1BI1 A;  2DK3 A;  3M55 A;  5J3B A;  2EIF A;  2FVU A;  4JS4 A;  1TH7 A;  3FEO A;  3PGG A;  4IUV A;  3OY9 A;  1ZQ1 A;  5GAN 2;  4C8Q C;  4M77 G;  1YHQ T;  2P4T A;  3OYH A;  3OW2 A;  2E12 A;  4HA8 A;  1I4K 1;  3X28 B;  3OYE A;  2F5T X;  3LX7 A;  3KBG A;  5FU6 C;  5GMK i;  4N0A C;  4C92 E;  4C8Q G;  3V8J A;  3CCM T;  3H6Z A;  1Q82 C;  2CGH A;  5FRN A;  1S72 T;  3RKW A;  3JCM W;  4Z02 A;  3WVD B;  4M75 D;  3RER A;  2R58 A;  2VGN A;  2ZCF B;  3HPW A;  3RKY A;  3C95 A;  5GAN 5;  2XIC A;  2RM4 A;  4IUP A;  5LL6 S;  2OTL T;  2XI9 A;  1PSE A;  5LJ5 e;  3JCM f;  5GAN 3;  1YCY A;  5GAM g;  2QA4 A;  3OS0 A;  3AHU A;  3CCU A;  4N4H A;  4GY5 A;  2C06 A;  2MWO A;  5KE3 A;  2X4Y A;  4XQ3 A;  3PIO A;  2DAQ A;  1YBY A;  1MGQ A;  1D3B B;  4M75 C;  2QEX T;  3L2U A;  3QZ9 B;  4HCB A;  4M7D B;  2DO3 A;  3BW1 A;  2E6Z A;  1VIF A;  4A4F A;  3CC4 T;  1M90 C;  3CCJ A;  2KVQ G;  3OMG A;  3MET A;  1KD1 U;  4M7D G;  1VIE A;  4NOY A;  3ME9 A;  3EFS A;  1YJ9 A;  1UGS B;  1YI2 A;  4M75 F;  5D6Y A;  4D6W A;  1BKB A;  3CME A;  2EFI A;  3BY7 A;  2K3Y A;  1VQ6 T;  3JB9 I;  2VV5 A;  4M78 B;  1Q81 U;  4HCC A;  3MHX A;  2ZPB B;  4MZP A;  2M9U A;  4OF1 A;  3LYI A;  2BIV A;  3JCM g;  4E7L A;  1N9S A;  1VQL A;  1YIT A;  2MI6 A;  3OYB A;  1UB4 A;  3BDU A;  3BDL A;  3CXC A;  1HK9 A;  5LJ5 j;  1JBM A;  3QXE B;  2EJ9 A;  4OGE A;  4IUU A;  3QZ5 B;  2HBP A;  3ASK A;  2XDD A;  3E9G A;  1V29 B;  3M54 A;  2XK0 A;  1N6A A;  3KUF A;  3UDC A;  2XD0 A;  3GIB A;  1KQ2 A;  4KBM B;  4ELZ C;  2KK4 A;  1OZ2 A;  4LDY A;  3HP9 A;  1M8V A;  1OI1 A;  2A3L A;  2ZPI B;  4JRI A;  2CZ1 B;  3CC7 T;  4C0G A;  2X35 A;  5FU7 C;  3RKX A;  3JCM J;  1QVG A;  3CCE T;  3LW5 E;  5GAM j;  2HNI A;  2WAC A;  2LNV A;  1VQO T;  3CC7 A;  5CKB A;  2EQK A;  2YLC A;  3LLR A;  5A0L A;  5LJ5 d;  3R6O A;  3PTA A;  1M4Z A;  4JRQ A;  3S3O A;  5HK0 A;  3CD6 A;  4C5I A;  2RHI A;  2EJF A;  3JB9 F;  4LDU A;  1VQO A;  3MEU A;  3X24 B;  3VUB A;  2EJG A;  2PUK B;  2DXC A;  2MWP A;  4M77 D;  1QVP A;  4C0Z A;  3PMT A;  1VQM A;  1I8F A;  3V7S A;  4PJO E;  4BAC A;  3G6E T;  3OSV A;  3OMC A;  5FU7 B;  2K5I A;  3SD4 A;  4RMO A;  3JCM X;  2QI2 A;  4A4E A;  2M0O A;  2DXT A;  4NS5 A;  3SWN C;  3NTK A;  2Y90 A;  4J83 A;  1K9M U;  2EQM A;  2DD4 A;  2JUF A;  2RJE A;  5IN1 A;  2QDY B;  4ELY C;  1M1K U;  2HAX A;  2F5K A;  4JRP A;  1W2B S;  3UWN A;  5J39 A;  1NE8 A;  1IRE B;  2VGM A;  2QQA A;  4N4G A;  5GAN 8;  1Q7Y U;  4X34 A;  3JCM d;  1M5Q 1;  2PVG B;  5A2Q E;  5GAO l;  3E9F A;  5DLQ E;  2RI2 A;  5FU6 B;  2FYK A;  3L1A A;  4QW2 A;  3UT1 A;  3X26 B;  2RHY A;  3DLM A;  2XHC A;  3QO3 A;  1M1G A;  2RB6 A;  4BE2 A;  4J8O A;  5CKF A;  2K5L A;  4M7A C;  2CZ0 B;  1XOV A;  4M7D F;  4M77 A;  3SDZ A;  4X9C A;  3EFR A;  1AHJ B;  3HKS A;  4B9X A;  3OYF A;  1FWZ A;  2P0Q A;  5D6W A;  2RK2 A;  5GAO m;  1LNX A;  4E7K A;  3QDR B;  4PLI A;  3CMA T;  4FM4 B;  2KAF A;  2MF2 A;  4O5V A;  3L2Q A;  4OVA A;  4JS5 A;  3PT9 A;  2YLB A;  4O6J A;  4M7A F;  2KDS A;  1VQ8 A;  5LJ5 h;  1O9S A;  3CPW S;  1OYX A;  2DXU A;  3EAE A;  4M78 F;  3I56 A;  2PVD B;  3L42 A;  3G71 A;  3L2R A;  2LCL A;  4XU3 A;  4J6X A;  2RK1 A;  4XTW A;  4E7I A;  4R55 A;  1WQ7 A;  3OYN A;  5L8R E;  4BUG A;  1KQS A;  3OYA A;  1R8O B;  1KHI A;  1M9S A;  2WSE E;  4DOW A;  3DKM A;  3CCS T;  3OYY A;  3CCV A;  4ZGE B;  3HRS A;  5GAN f;  4M78 A;  4A4K A;  1VQL T;  1ZHI A;  2P0K A;  3V8K A;  5GAO r;  1N9R A;  1G3W A;  4RCC A;  1Y96 B;  3OYK A;  1VQ7 A;  4KUL A;  1G3Y A;  4F7U E;  3OYJ A;  3UPU A;  1Q86 U;  5KH6 A;  4XTX A;  5GAM f;  3TU4 K;  2JOY A;  4EMK A;  2DTI A;  5GAO q;  3CCL T;  1XNI A;  1NPR A;  2VYT A;  1Q7Y C;  5CKD A;  3FJP A;  2ZZD A;  4C92 A;  4M7D C;  4M75 B;  3G4S A;  1IZ6 A;  2DPP B;  3SFM A;  4C8Q D;  1RI0 A;  4II1 A;  5CR2 A;  3J81 E;  5CIU A;  5LJ3 d;  3MEV A;  2K4Y A;  3L2V A;  4MZM A;  5CO7 A;  4M7A E;  2PU9 B;  1YJW A;  2B8A A;  1M1F A;  1JJ2 A;  1WJR A;  3MEW A;  3QHS A;  3WVE B;  5I2M A;  3A8G B;  1KQS S;  1YIJ A;  3JB9 H;  4M78 D;  4MML A;  2OTJ A;  4TVR A;  3FLG A;  4PJO G;  3GNG A;  1WGS A;  4XTU A;  1BIA A;  4J6Y A;  4ME7 A;  4XTY A;  1BIB A;  3JB9 G;  2LRQ A;  3CEY A;  3RMS A;  5GMK l;  1RL2 A;  4M75 A;  4EPC A;  1VQK A;  3QYG B;  4M78 C;  2LQK A;  3OYL A;  2PQW A;  2RJC A;  2IVW A;  2V8J A;  4XTZ A;  4C5G A;  2RI5 A;  1U1S A;  2JNG A;  4L5G A;  2K2V A;  2I2L A;  5LJ3 e;  2E64 A;  2MAM A;  3FB9 A;  2JZ2 A;  4UC4 A;  1UGQ B;  2EWN A;  2RHZ A;  2XID A;  1VQ6 A;  1B34 B;  1Y07 A;  4BDY A;  4BE0 A;  3S3N A;  1U1T A;  4B9W A;  4PJO A;  3LGL A;  3X25 B;  3P8H A;  4DOV A;  5GAN g;  1I81 A;  1QP3 A;  1JRI A;  4J5Y A;  2LTO A;  3ZBD A;  5LJ3 g;  1S72 A;  3QUI A;  4C92 B;  3CCR T;  2ZGW A;  2CYZ B;  1W2B A;  4J7I A;  2K5F A;  5CAI A;  2DXB A;  4ZN1 A;  2V8I A;  3O8V A;  3QJ6 A;  3N5B B;  1VQP T;  4OB3 B;  1G3T A;  3HRU A;  5GAN 6;  3CCU T;  5KCO A;  1KC8 C;  5HY6 A;  4ZGD B;  4L6V 5;  3A8M B;  2R5M A;  3QKJ A;  4BI4 A;  1K8A C;  5HKC A;  2V8K A;  4C8Q A;  2BKD N;  2LDM A;  3LH0 A;  5AYF A;  4M7A G;  3HHT B;  4BE1 A;  3TRE A;  2KQW A;  4C8Q F;  1G3S A;  4IUR A;  2XKO C;  3JRZ A;  4M75 E;  2E65 A;  2QTX A;  2RJF A;  2CZ6 B;  5KE2 A;  3I55 T;  4JLI A;  4L59 A;  2PUO B;  4OB0 B;  1QVF A;  1QW1 A;  2VXE A;  3WXM B;  4N0A A;  1N8R C;  3L2W A;  2D9T A;  2RD1 A;  4M77 B;  5KCH A;  4EMG A;  4A4G A;  3OYM A;  2JTF A;  2CKK A;  3M9Q A;  1B34 A;  2K57 A;  1UGP B;  1EIF A;  2X4J A;  3OS5 A;  5GMK h;  3CCM A;  1KQ1 A;  2EQJ A;  4FT4 A;  5GMK m;  3QG1 A;  1U8R A;  2OTL A;  4M77 C;  2JTM A;  4N4I A;  4XTV A;  2NLU A;  4MMK A;  1YHQ A;  4XU2 A;  4RG2 A;  4BDZ A;  4Q5W A;  5LJ3 f;  1YIJ T;  2LX9 A;  5GMK e;  5LJ5 f;  5GAN 7;  1UGR B;  4KT0 E;  4F7U A;  2QQ9 A;  2ZPF B;  2AHJ B;  2G3R A;  4HCZ A;  1JJ2 S;  2OTJ T;  4M77 F;  3CXC S;  2LC4 A;  4M75 G;  2RI3 A;  1O75 A;  2H3J A;  4QQD A;  3C94 A;  4VUB A;  4MDW A;  3QII A;  4C92 D;  4EDU A;  5GAN e;  1YJN A;  3JCM V;  3JSC A;  3PIP A;  3LWI A;  4OB2 B;  5FRM A;  1H3Z A;  4F7U F;  2LQ8 A;  4OB1 B;  3M4G A;  3DB3 A;  4GLK A;  4PL6 A;  3CPF A;  4LD6 A;  2FB7 A;  1X6O A;  3OYG A;  1YI2 T;  3JB9 J;  3QBY A;  4C0D C;  3JAM E;  1BI2 A;  3NTI A;  4FU6 A;  4RKU E;  4IKF A;  3A8H B;  2E70 A;  2R5A A;  4MZT A;  4KUD K;  3V7R A;  1LJO A;  4BD3 A;  4BI3 A;  4V2S A;  2QQB A;  5IAY A;  1WPY A;  5EG2 A;  1NJI C;  1YJ9 T;  1XQH A;  4OMF B;  4EMK C;  5A0G A;  2YHT A;  5M9O A;  2GQV A;  3MP1 A;  3HSB A;  4PJO C;  3M59 A;  3VUZ A;  1K73 C;  5GAO n;  2O4X A;  3M4Y A;  1K9M C;  3JCM Q;  4ZGJ B;  2F69 A;  4P5N A;  1WNL A;  3J7A F;  4C0F A;  1YIT T;  2DTH A;  4RG8 A;  4A54 A;  4IUQ A;  3CPW A;  3GPL A;  3V7C A;  2D6F A;  4EMK B;  4M77 E;  4M78 G;  3CCQ A;  3CCR A;  4PJO D;  2HQX A;  2DEQ A;  4ZTJ A;  2LT4 A;  2YRV A;  2R57 A;  2P0P A;  5GAM d;  4HT8 A;  3NFC A;  3CBM A;  3PMI A;  1VQ5 T;  3FDR A;  4QQ6 A;  3E1S A;  1KD1 C;  3QYH B;  2E1H A;  4NL2 A;  4YTL A;  3RIR A;  4C0D B;  4BY6 B;  1QVF S;  3L2Z A;  3OSS C;  4CI0 C;  2EYQ A;  3M53 A;  1VQ8 T;  2A7Y A;  2QEX A;  4JRK A;  3M58 A;  3RMQ A;  1WJQ A;  4M7D D;  2QQS A;  4QVC A;  4JUV A;  4E7J A;  3GF5 A;  2JN0 A;  3F70 A;  5GAM h;  5GAN 4;  4ZN3 A;  3E19 A;  3MO8 A;  3CC2 A;  2X4X A;  2WSF E;  4BB7 A;  2DIG A;  2DIQ A;  2WSC E;  3T9N A;  4DQ2 A;  3CME T;  2JVV A;  3S6W A;  4HT9 A;  1QP2 A;  2X4W A;  4C92 F;  1VQ9 T;  5FRO A;  3J80 E;  2KMT A;  3OA6 A;  1W4S A;  4XU1 A;  5GAM e;  2VXF A;  3ER0 A;  2XG8 D;  3PNW C;  4WF2 A;  1X01 A;  2L89 A;  2DTO A;  1WQW A;  1XTD A;  2QXF A;  2D0Q B;  1NJI U;  2L5Q A;  2KY9 A;  4C8Q B;  1M90 U;  4CRI A;  4X9D A;  1VQ7 T;  2OAU A;  1VQ4 T;  5GAN j;  2O4X B;  1NZ9 A;  2CS7 A;  4C5H A;  4PJO B;  3ZEH A;  2LVM A;  1K73 U;  3C12 A;  3G4S T;  2RH2 A;  3VYH B;  1VQ4 A;  1FXX A;  4PJO F;  2QA4 T;  3QJY A;  3MEA A;  5DY9 A;  2KSS A;  4J6W A;  1BI0 A;  3OS2 A;  1X75 C;  5J26 A;  3LGF A;  3CMA A;  3S3M A;  3Q1J A;  5CQY A;  2RA2 A;  1NPP A;  2M16 A;  5CK9 A;  5LJ5 g;  5FLX E;  3SWN A;  3GNF B;  1ZBX A;  1SSF A;  4M7D E;  2EAY A;  4LDX A;  1YJN T;  4ATO A;  3CCQ T;  4M7A A;  3G71 T;  1M1K C;  3JCM h;  4M7A B;  1VQM T;  5CVI A;  3I56 T;  4EMH A;  4FT2 A;  1VQ5 A;  3HFN A;  4XU0 A;  2DZC A;  5CCA A;  1KG1 A;  1WJS A;  2XU8 A;  1MHN A;  3LWH A;  3VU3 C;  4HKE A;  5GMK j;  5LJ3 h;  3M5A A;  4J7F A;  3G6E A;  3JCM e;  2M1H A;  3CCL A;  2L3R A;  3OYI A;  3TCJ A;  4JLG A;  4F7U B;  3JB9 D;  2O01 E;  1OZ3 A;  4LDW A;  3QPH A;  1VQ9 A;  4E47 A;  5CKE A;  5GAO p;  1K8A U;  3OS1 A;  3SWN B;  3JCM P;  5D6X A;  5IT9 E;  1PSF A;  3OW2 S;  4M78 E;  2DJZ A;  2VUB A;  1VUB A;  3HL8 A;  3V8L A;  3FC3 A;  2GFU A;  2MMP A;  2EKO A;  2IG0 A;  4QQG A;  3GOX A;  4RCB A;  1BI3 A;  3DLL A;  1DJ7 B;  2HQE A;  1Y71 A;  2RHU A;  4FIB A;  3URG A;  3VV0 A;  3NTH A;  3HFO A;  4JJN K;  1LOJ A;  1VQN T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...