3URGA

The crystal structure of anabaena ccbp
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
126
structure length
123
Chain Sequence
MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYVEVADIGDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alr1010 protein
publication title Ellman's reagent in promoting crystallization and structure determination of Anabaena CcbP.
pubmed doi rcsb
source organism Nostoc
molecule tags Metal binding protein
total genus 37
structure length 123
sequence length 126
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11535 Calci_bind_CcbP Calcium binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.530 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3urgA02
2P0PA 2P0QA 2K2VA 3URGA
chains in the Genus database with same CATH superfamily
1N8RR 2LX7A 2O9SA 1TXQA 3PE0A 2VUBA 4AMCA 4QW2A 2DL4A 3ULRB 2EJGA 1D1CA 4A4EA 4OB0B 2WSCE 5KYXB 1ABOA 2MIOA 2QTXA 1RAEB 2AZSA 2HQEA 3DB3A 1C6VX 3QIIA 3M4YA 2CYZB 2YXYA 2DAQA 3GP8A 2EAYA 4M78G 1UHCA 2JS2A 2NUTB 2M0YA 4LUEA 3JCMd 4DBFA 1QP3A 4BI3A 3JB9F 4M78B 3CCRQ 3TEEA 2KROA 2M16A 2D1XA 2C06A 1IHWA 4WTOB 2KRNA 2M1HA 1M8VA 4KBMB 2E12A 1D1AA 2QGFB 4EPCA 5LJ5e 1Q95G 1I1JA 5A0LA 1KD1C 4CC7A 2EQJA 1OPLA 3HP9A 3GPLA 1YCYA 2CP5A 3PGGA 1UECA 4JPBW 2KT1A 2K6DA 3M0QA 4HKEA 4O5VA 4C92E 3QBYA 1NLPC 1M2OA 4E7JA 5IAYA 2HBPA 1M8MA 3OSSC 4K11A 1AWXA 3HRUA 3BW1A 4F16A 3NTIA 3JCMQ 2XG8D 1U1TA 1VQOQ 1QKWA 2CT3A 4RCBA 4RTZA 2K57A 1WXTA 3CCSA 5CCAA 3KBGA 2LJ1A 2QXFA 4QQ6A 3QWXX 5A0GA 2J6KA 2RK1A 2EBPA 2KXDA 4R56A 2RN8A 2FVUA 3QUIA 1B7TA 1VQ7A 5CQYA 4C0GA 2O2OA 4Y28E 2I2LA 5M9OA 4OMPA 4M7DF 4A54A 3CCUQ 1M1KU 4KH1B 2QQ9A 3FIFA 1TSFA 2X9HA 2ED1A 5GAN6 3CXCS 1G3WA 3QJYA 2VGMA 4AG2C 1HK9A 2LP5A 1ZQ1A 1QCFA 4JDSA 2J6FA 3RKXA 3WXMB 4WCIA 1WGSA 5GMKe 2LNVA 1ZUUA 1E7OA 3AT1B 3MJXA 4AG1C 5GAN2 5GJWB 4PL6A 2DFUA 4ZN3A 2D8JA 2DIQA 3CCLA 2D9TA 1Y96A 3QYGB 3FLGA 2F5TX 2EPDA 4Q5WA 4MZMA 4NS5A 3J81E 4IKFA 1JRIA 4FSSA 2IVWA 2BKDN 4X34A 4M78E 1N8RU 4J7FA 3FDRA 3META 3X26B 1VYTA 2JS0A 2D8HA 3CCMT 1YWPA 1VQ9A 2A08A 1VQMA 3E9FA 1NM7A 2RHXA 5GAN8 2F2WA 2EGEA 1YJ9T 2DYIA 3I55Q 4CRIA 3CBMA 3CPWS 3MP6A 2W10A 1Q86R 2RJDA 2EQMA 2CP6A 1X69A 4ANJA 2CDTA 4M7AC 1TUDA 5CKEA 3JCMW 4RTVA 4FM4B 5GAMj 1Y96B 1C0MA 1T3LA 4JRIA 1BCMA 4AFZC 2X4XA 4DEXA 3C12A 2OTJT 3OYMA 2K5FA 1NE8A 1JU5C 3I5SA 4HA8A 5LJ3e 1QQJA 1WXUA 3RNJA 1SHGA 2RK2A 5DY9A 2Y90A 2HL5C 3UPUA 2FPFA 5L23A 2AKKA 1WX6A 2FPEA 2Y4YA 4FYWB 3X20B 2KAFA 3I56A 4DBRA 4FCYA 2L8DA 4IUVA 4B6MA 2P0KA 2JUFA 2CZ1B 2CT4A 2VV5A 4M4ZA 3G1JA 2XIDA 2P4TA 1D0ZA 3OW2P 2KNBB 2QDLA 3H0FA 2YUNA 1IGUA 2JM8A 2NLUA 3CC2Q 2FPDA 4UC4A 4ESRA 4DOWA 2HZYA 4BUGA 2K3XA 4YTLA 1YI2Q 1SG5A 1IZ6A 4LE9A 5HY6A 2ROLA 1KQSP 1M90R 1G3SA 1JJ2A 1YIJA 1K9MC 1H92A 4RG8A 3EGDA 3SFMA 4HVVA 2EJ9A 3G6EQ 1Q82C 3J80E 3QZ5B 3VRZA 1QMCA 3EFSA 1TTHB 3PNWC 1X6BA 2DEUA 2EYXA 3EHRA 1FX7A 4XU1A 4HCBA 3G7ZA 2DL3A 2RJCA 1UE9A 3EAEA 1J3TA 2P4RA 3CCJA 2FRWA 4GY5A 2VVKA 1KHIA 2M51A 3S3OA 1K8AR 2CUBA 1OU9A 4Z02A 2ZPHB 5GAOr 1I4K1 3CCVT 1OEBA 1XNIA 1BI1A 1BKBA 4RMOA 3URGA 3EGDB 2JMCA 1W1FA 2AHJB 4C8QC 1JXOA 3R6NA 1Q86U 3V8KA 3HKSA 1VYUA 1VQ4A 1NEGA 2CH4A 1D0XA 2JTEA 2MK5A 3SWNA 3L2QA 1KC8C 2RNAA 2L3PA 1MMDA 5CAIA 4ELYC 2DIGA 3PIOA 3QHSA 1TG0A 5LJ3f 4JJDA 3CMEQ 2K2MA 1VQ5T 2KY9A 3FJ5A 4M7AD 2VYTA 4PK4A 3OA6A 3MP1A 1GBQA 2CSQA 4M77C 1VQLQ 4MMLA 5I2MA 1RAIB 1WHGA 1XJWB 3FEOA 3TQ7P 3EG2A 3OS5A 3VUBA 2PUOB 2RQRA 3L2ZA 2OTJQ 4XU3A 1GRIA 4QQGA 5IHKA 1GCQC 2OJ2A 2IG0A 2VXEA 1OQKA 2F69A 4FT2A 4JRKA 4PJOG 1N6AA 2IIMA 3JCMV 1WQWA 4M75C 4DBHA 3S3MA 3SWNB 2VASA 3A98A 4FYYB 2FG0A 1VQ8T 4BI4A 2QA4T 1NYFA 4MZTA 1FYNA 1OZ3A 1QVFS 3LX7A 3CCQQ 4KH0B 4EMGA 2DL8A 1VQPA 3QXEB 2MWPA 3G4SA 1RI9A 2COYA 2COZA 1I07A 1GFCA 2EKOA 2DPPB 1PHTA 5GAMd 5FU7C 2GFAA 2VB6A 3TCJA 1VQ7T 1DJ7B 3VU3C 1PD0A 5CVIA 2C0OA 3A8LB 1BB9A 2W0ZA 3OMGA 1UHFA 1U1SA 5IHNA 2OTLA 1M90U 2YRDA 2ED0A 3V8LA 4PLIA 2PUKB 3RESA 3EFOA 5FU6C 4CC3A 1PNJA 1GXIE 1PC0A 1W2BP 3ZL7C 2ECZA 4FU6A 2YUOA 4JJCA 2HNIA 4P5NA 1B07A 3DB4A 2XK0A 3OYLA 1YHQA 2KYBA 1KQ2A 2CP2A 2EQUA 2VGNA 1M1FA 3REAB 4IURA 4HCZA 2YRCA 1K8AU 3FC3A 5GANg 4JRQA 2LT4A 4QQDA 2DMOA 2DBMA 1S72A 3OSVA 2YRVA 3PT9A 3UDCA 2XICA 4LD6A 4DA4A 1JBMA 2QI2A 4GBQA 2DYBA 2KMTA 1HJDA 3UT1A 1VQMT 2JW4A 1I5OB 1HSQA 1V29B 3H8ZA 2FZGB 2ZCFB 4C8QD 3JCMP 4BE0A 3JCMf 2L89A 2ABLA 1ZUYA 3CMAA 4XAXB 5GAOp 3A8OB 3M54A 4OMOA 3JV3A 2J05A 1YWOA 1OZ2A 2L5QA 3IQLA 4B9XA 3VS4A 3E2UA 1CSKA 3H0HA 5KH6A 3E19A 4M7AA 3CCUT 1N9RA 4M77D 3OYFA 3L2WA 3EH1A 4A53A 4MZPA 4C92F 4C0DC 2AT1B 4GLMA 4WF2A 1UG1A 1OU8A 4AFSC 3M56A 2XHCA 1QWFA 2DM1A 1TS9A 1NYGA 2YHTA 1GFDA 2KXCA 2DXCA 3OBWA 4M75D 1WZOA 3OW2A 1UUEA 2LQKA 2E5KA 2HDAA 3D7SB 2PNIA 4M7AG 2J6OA 4X9CA 3CBOA 1T0HA 5IXFA 2DE0X 4NOYA 3JRZA 2V26A 4D6WA 5HCKA 5HKCA 4A4GA 1SSFA 4M7AB 3CCSQ 3CXCP 1G83A 2RJFA 3GBQA 1Q81C 2AIRB 4J7IA 3GIBA 1IGQA 2RHYA 5J26A 1JXMA 2DA9A 3SDZA 3JCMh 4J9HA 3I55T 2JXBA 1D3BA 1VQ7Q 4DEYA 2RQWA 5KE3A 5GMKm 2DLPA 2LNHB 4PJOC 3CC7A 1JO8A 1NJIR 3V7CA 1N27A 2DXUA 2BZYA 2YUPA 1OULA 4M78F 4GLKA 3MO8A 1IRXA 1ZLMA 3VS0A 2XI9A 3BDUA 1RAGB 5AT1B 1WXBA 2F2VA 2V8JA 2I0NA 5DLOA 3OYBA 2DJQA 2R57A 3C94A 3CCLQ 4KUDK 1K0XA 2EW3A 2NYSA 1Q7YR 3QSUA 1IREB 1D3BB 3OYGA 2EJFA 2LTOA 3SB2A 4C0FA 4JLGA 1SKUB 3EGUA 3A1PA 3GF5A 5GAOn 1LOJA 2OI3A 1E6HA 3JCMJ 4OMNA 3C4SA 1VQ4T 1AEYA 1VQ9Q 3MP8A 2QQRA 1VQMQ 2GTJA 5A0DA 3HFNA 1K73R 2K79A 1ZUKA 5KYNA 2H3EB 4C8QA 2M0OA 2LRQA 2FZCB 4E7HA 1QWEA 1TWBA 1O9SA 3M53A 1SRMA 5GJVB 4CC4B 3CC2T 2XMFA 3U23A 1M4ZA 3CCEA 2CGHA 5GAN3 4HVUA 3L2VA 2LCLA 5KCHA 5EC7A 2HCKA 1YI2T 4M7AE 1WQ7A 4CC2A 3OYDA 3DLLA 2GQVA 4XTXA 4M77A 5CQXA 1KIKA 4C8QG 4F04B 3G6ET 3BE3A 3NGPA 1RAFB 1W6XA 1TUCA 2KRSA 2HQHA 1RADB 2R5MA 4RTXA 1JJ2S 4VUBA 3CC4A 4C8QB 1VQKA 1EFNA 1K1ZA 1QVGP 5GAOm 1G3TA 4M75A 1I8FA 2QG9B 2JTFA 4AT1B 1VQPT 3G4ST 3PTAA 4M77G 4E7ZA 2O9VA 2HQXA 5GAMe 5IN1A 4JJBA 2QQBA 3OYKA 4LDUA 2KK4A 5FLXE 1W2BA 5GAN7 1LPLA 1W70A 5D7UA 4E47A 1WNLA 4M77B 2YLCA 2LCCA 4J9EA 1WFWA 3SD4A 1KQ1A 3DKMA 2BZXA 2M02A 2MMPA 4M75G 2EQIA 4PJJA 4R55A 3A5ZB 1NJIU 3GNGA 3RKWA 2P0QA 3RKYA 1YIJQ 2CZ0B 1PKTA 3CMET 4PJOD 2LQWA 4M75B 2JZ2A 1YHQT 3VRYA 1AWOA 2QEXA 3V8JA 3H6ZA 1VQLT 1UGPB 4FSXA 3QYHB 2MYSA 1M5Q1 5LJ5f 2ATCB 1RLPC 2K3BA 2PVGB 4ORZA 1M3AA 4RKUE 2HD0A 2KYMA 1Q7YU 2LCSA 3QG1A 1VQ6A 4A4HA 3EG0A 2K3YA 4LN2A 4XTWA 5FU7B 2EFIA 1ZA2B 1MMGA 3HTRA 2KDSA 3P8DA 4A63B 7AT1B 2BE9B 5J3BA 3RERA 4OP0A 4A4KA 1M1KC 1GCPA 4Y91A 2CP7A 4FIBA 1K73U 2H3JA 3HSBA 2X4YA 1I81A 2JTMA 3CMAT 2LDMA 5FU6B 3CCQT 1EZZB 1AHJB 4ZGEB 1UJ0A 4C8QE 4F7UA 1VQ4Q 2RHZA 3P8HA 3TSWA 2SRCA 3QDRB 4LD9K 2MOXA 3J7AF 1WJQA 2ZZDA 2BTTA 1K0SA 5LJ5g 4JS5A 3L42A 5AYFA 2X4WA 3WVEB 3EG3A 1Z9ZA 1YITA 1D09B 1Y57A 1U8RA 4J9BA 4RTYA 1RLQC 1OV3A 1PSFA 3LWHA 2CZ6B 3VKIA 4D8DA 3X28B 4L59A 4M77E 4F7UG 1TH7A 4OF1A 1N8RC 4PJLA 1UGRB 2DNUA 1YJNA 3UWNA 1OPKA 5GAMf 2FZKB 3V7SA 3VYHB 2GFUA 4BACA 5LJ5h 4F7UB 4HCKA 3ER0A 1F1BB 4RCCA 3KXTA 5HK0A 5C0MA 1X01A 4M75E 1Z9QA 5GANe 1YJWA 1N9SA 4AFUC 1SF9A 4BY6B 1Y0MA 3OQ5A 4OB2B 1QW1A 2GQIA 2EVRA 1NZ9A 4J9IA 2XDDA 1VQPQ 3G4SQ 2O31A 2O01E 1R77A 4OB3B 4EDUA 3HRSA 2QAZA 1PD1A 1E6GA 1HD3A 4PFPA 1OX8A 3GOXA 2OTLQ 3LGFA 2EYWA 2XDPA 2RI3A 3NMZC 3OBYA 3H9NA 2WSEE 1JB0E 1T3SA 2YDLA 2BUDA 3RUXA 1PSEA 3JB9H 5I2SA 4R0KA 5GANj 2VC8A 2FYKA 2OX7A 2QYZA 4PJOA 3ASKA 4M7DC 1MGQA 3OS2A 2RM4A 5IT9E 1YHQQ 3VS5A 2DF6A 5GMKh 2EGAA 3OYCA 1MNDA 3JSCA 2FL7A 2DL7A 5FWBA 5D6WA 2P84A 3JCMb 1X2QA 1WHHA 2PVDB 1VA7A 2DD4A 1S72Q 2HMAA 1LNXA 1AZEA 5GAOq 2D0NA 2YSQA 1IXDA 2GF7A 2G6FX 4KT0E 2DTHA 2XDBA 4IUPA 5IH2A 2XU8A 1SEMA 3C95A 1VIFA 1UJYA 2MF2A 4QVCA 5CR2A 2ZPIB 2L3SA 4PJOB 3OYEA 3OW2S 4F7UE 3CD6A 3CMAQ 1ZA1B 2DRKA 1OYXA 5LJ3g 2RH2A 2HL3A 3CCST 1KD1R 3I9QA 4MDWA 1RL2A 4E2FB 4PFZA 3OB9A 3M59A 3L2RA 3QZ9B 3MCAB 3THKA 4OVAA 2KQWA 3ZFJA 4C0ZA 1ZHIA 4B9WA 1WIEA 2DKGA 2FEIA 1QVGA 2MCNA 4L5GA 1B34A 1QP2A 1SRLA 1QKXA 2ESWA 4ATOA 2KT8A 1NG2A 3LH5A 2LVMA 2AK5A 5LJ3h 2RJEA 1G5VA 1UGQB 5EG2A 1QVPA 3A8GB 4KULA 1VQKT 4NL3A 1Q86C 3M0TA 1UGVA 5DM7R 2A3LA 4J9GA 3JB9D 2HKNA 3CCMA 2ROTA 3EHQA 4OMLA 4LDYA 3CCLT 3H41A 2HBWA 3TU4K 5KYUA 1YJ9A 3JCMc 1P92A 3UATA 2X4JA 4XK8E 4N4HA 4QVDA 1B34B 8ATCB 1OX9A 1AWWA 1XQHA 3JB9J 1MV3A 1MMAA 1ZSGA 3MHXA 1VQ9T 5DLQE 2K9GA 1ZBJA 4X1VA 3LH0A 4ZTFA 2CSIA 3RBBB 2E65A 3HHTB 2Z0WA 4XTUA 4FT4A 2DZCA 3CC7Q 3E1SA 1OI1A 3C0CA 1G8XA 2HSPA 2QASA 1MV0B 4PJOE 1KHCA 5KYUB 2WSFE 2YUQA 5KE2A 2L3RA 4M7DD 3BFMA 2Y4XA 4LUDA 3PIPA 1FXXA 4HT9A 3M55A 2KVQG 4OB1B 3TREA 1AWJA 2ZPGB 1SHFA 2E41A 4QVZA 1G2BA 1MUZA 3TSZA 1M90C 4FYVB 2M9UA 3EFRA 3EGXA 3VV0A 3M0SA 3I56T 1Y7XA 5A2QE 4E7LA 4II1A 2J7IA 3JCMg 1YFNA 4M7AF 1NPPA 2PTKA 1TU0B 1OOTA 1KD1U 4J5YA 4Z89A 5GANd 3G71A 1ABQA 1X2KA 2E10A 1CKAA 1KQSA 1PCXA 4HXJA 2JN0A 2DZ9A 3NTKA 1ZSZC 3VS6A 1K8AC 3CCEQ 2QTVA 3LLRA 4IIOA 1U06A 2JJ9A 2IPOB 1FMKA 2O88A 1VQNA 2K2VA 1W2BS 1BYMA 1N5ZA 1YIJT 3EGXB 3MKDA 4MDXA 1UB4A 2G3RA 5KCOA 2JMAA 3MEAA 5FWCA 1PRLC 4RG2A 4PJNA 2PZ1A 2L3QA 3RIRA 3CCVA 3OYYA 1YJWT 3CC4Q 3E9GA 2KBTA 1TUGB 1VQKQ 1K9MR 1UGSB 1O75A 3CCJT 4C5HA 4PFOA 1BU1A 4LXCA 1Q82R 3GNFB 2FRYA 2KEAA 2DETA 2PQWA 4E6RA 2E70A 3HL8A 1I5LA 1PKSA 1GL5A 3CPWP 2R5AA 4Y92A 4XU0A 1YCSB 1VQ5A 3UF4A 4BD3A 3OYIA 3JCMX 4EMKC 1UDLA 3S3NA 2K4YA 4ZTJA 1HXDA 3INZA 4J6WA 3ZEHA 1MMNA 2QDYB 4BDZA 2HKQB 3BY7A 2NUPA 3JB9G 2XKOC 5CKBA 4XQ3A 1D1BA 3L2UA 3JAME 3CEYA 5D6YA 2RQTA 4ZNXA 5J39A 2RB6A 2JM9A 2QEXQ 2CUDA 3HPWA 1Y07A 1KFZA 4KUIA 3OS0A 2DERA 4JZ3A 3QKJA 1KC8R 4M7DA 4JZ4A 1VQ8A 2QA4A 1AZGB 2DTIA 3TVTA 2EQKA 2ZPEB 1WLPB 3H0IA 4ZGJB 2RO0A 1H3HA 1QCNA 1JEGA 2DJZA 4C8QF 2DXTA 4F14A 3CPFA 2EIFA 1VQ6Q 2A37A 2RQVA 4HT8A 3MPUB 1VYVA 3SHWA 4ME7A 1X43A 4OMMA 1BI3A 5FROA 1RAHB 1WDXA 2NUPB 3OY9A 1GCQA 1JQQA 2J06A 2PVOB 2RI2A 5KYWA 2CZ7B 1AD5A 3PVLA 5LJ5j 3OYJA 4FYXB 2XD0A 3I56Q 3CD6T 4M7DG 1NEBA 1K4US 1ACMB 2LX9A 2JNGA 1I0CA 2VXFA 1WHMA 4M77F 3NPFA 1H641 1UFFA 3FRNA 1FWZA 2DK3A 4LDXA 1AVZC 3BDLA 4M7DB 2DD5A 2RD1A 3OYNA 2OTLT 3OYAA 4OMQA 1WA7A 3VS1A 3O5ZA 2MI6A 5HK3A 2OAWA 2LT1A 2EYYA 3LW5E 1YITQ 4M75F 4AFQC 2V1RA 2YLBA 2QQSA 4Z88A 2YWWA 2L2PA 4KGVB 4J9CA 3CCRA 2CKKA 3M58A 2X3XD 1R8OB 2V8KA 1M1GA 5KYWB 3GLXA 2F5KA 2WACA 1YJNQ 4ZGDB 2GTOA 1K9MU 2HAXA 3PFSA 4C92C 3ZBDA 4XTYA 1Q82U 2DX1A 1X6OA 1YJWQ 2ZPFB 1H3ZA 1S72T 5FRNA 2LMJA 5GMKj 1WYXA 2K5LA 4FL6A 1BI0A 3CCJQ 1BIBA 4QT7A 3PMTA 2E6ZA 4KGZB 5CKFA 1VQOA 3RR6A 2CS7A 2DILA 4BDYA 2P0PA 4N0AC 1A0NB 1NBEB 3L1AA 3DLMA 3OS1A 1V76A 1D0YA 2KR3A 2V8IA 3REBB 3LGLA 1WHJA 4PLLA 4TVRA 3CCUA 2NUZA 2K5IA 2ZPBB 3PVQA 3T9NA 2JT4A 1W4SA 2HEQA 1BBZA 3WVDB 4HCCA 3NTHA 2DBKA 5GAN5 1KC8U 5C6SA 4BE2A 4IIMA 3P8BB 1IB8A 2D0QB 2F2XA 5FRMA 1PG5B 3A8MB 3LWIA 4M7DE 2L0AA 1T0JA 2KI7A 2GCXA 2LJ0A 1WJSA 2DL5A 5KYYA 4JUVA 3HFOA 4J9FA 4F7UF 1SSHA 2EWNA 3VS7A 2VWFA 5I22A 4M78C 2KE9A 2OAUA 4L6V5 4X9DA 1QVFP 5IXBA 1QVGS 2B8AA 3R6OA 3V7RA 5I11A 2CREA 2FB7A 1YNZA 4EMHA 5LJ3j 2NWMA 1R0BG 1NJIC 3QJ6A 2MAMA 2QK0A 1BK2A 4RUGA 1X6GA 3CXCA 1QLYA 4JLIA 3I55A 3G71T 1RAAB 4E7SA 5D6XA 1FMVA 4CI0C 3EG9A 3CD6Q 8AT1B 2QQAA 4F17A 2O4XA 1WJRA 2LQ8A 4IUTA 2R58A 3M57A 1G3YA 1Q7YC 1VQNT 5KYYB 4ELZC 1PWTA 1HYOA 2E4HA 1ZSZA 1KSWA 2ZGWA 5CO7A 2CP0A 4C0DB 3CC7T 4BB7A 1BIAA 1K73C 3I5RA 2DTOA 5GAMg 3QWYA 2RPNA 2ENMA 1Q81R 4OGCA 3S6WA 2CH4W 4JJNK 5LJ5d 2MPXC 3O8VA 3EG9B 2BE7D 3CPWA 2LZ6B 4C92D 5LL6S 2FHDA 4NL2A 2EYZA 2O4XB 2RA2A 4RTTA 3CCMQ 5GMKi 1EX4A 3MEWA 4PNOA 4BE1A 2C0IA 1S1NA 2E3HA 1YJ9Q 3PMIA 1U3OA 1YN8A 2A0FB 2RMOA 1VUBA 2H8HA 4O6JA 1ZSZB 5CIUA 1IO6A 5GAMh 1ARKA 1RABB 4PJMA 2DXBA 4C5EA 2PU9B 2YT6A 3CC2A 4PJOF 4J9DA 5GAN4 1H8KA 3JCMe 1KG1A 4EIKA 3M0UA 3SEMA 5FW9A 1YI2A 1M30A 4KGXB 4LDWA 4EMKA 3M0PA 1M2VA 1WHLA 4V2SA 1YBYA 4C5IA 4XTVA 3EH2A 1B3QA 1RI0A 3VJPA 3G6EA 2EKHA 3CCET 1EIFA 2QGGA 5CKDA 2V1QA 4J6YA 3VS2A 4KRTA 4FW1A 3ME9A 1M27C 2X35A 1ZX6A 1KQSS 4C5GA 2B86A 2DVJA 1X27A 1ZBXA 4Z8AA 1PRMC 6AT1B 1Y71A 5GANf 1M3CA 3VYGA 3VUZA 4M78D 2E6NA 3CC4T 4EMKB 1M2VB 1FMWA 5I21A 3KUFA 1X75C 3M5AA 2GGRA 3F70A 4XU2A 4IUUA 4E7KA 3M9QA 2JOYA 2KGTA 1PM3A 1WHKA 2JVVA 4QKUA 1BCOA 1LVKA 1MNEA 2RHIA 3FB9A 3VS3A 4LNPA 4RTWA 5L8RE 3X25B 3RMSA 3G71Q 2LC4A 1AT1B 1KK7A 3LYIA 3CMEA 2DEQA 3I35A 3CQTA 5CKHA 1NLOC 1GBRA 1R0CB 1AOJA 2KSSA 1U5SA 3M0RA 1VQLA 4OGEA 3CBPA 3CCRT 2EYQA 1XTDA 3M4GA 2DVEA 1VQNQ 1YP5A 3Q1JA 1WI7A 2RQUA 2AZVA 5GMKl 1M3BA 4ZN1A 1Q81U 2OTJA 4DQ2A 1QCOA 4DOVA 1UTIA 4OMFB 2GNCA 3N5BB 4MMKA 2QEXT 2KRMA 3QPHA 4FW2A 1UEBA 5LJ3d 4DBQA 1SPKA 2RHUA 3A8HB 3EFOB 2GBQA 2AKLA 1KJWA 4XTZA 4JS4A 1TOVA 3CCVQ 1K9AA 3NHNA 2DO3A 2A28A 4RTUA 3QDFA 2CP3A 4N4GA 2RF0A 5IHIA 3RDVA 5CK9A 4C92A 5GANh 1VQ6T 3CCQA 1VQOT 2E3IA 1LCKA 1RUWA 2FO0A 2E1HA 4PKCC 4BY6C 2EGCA 1IHVA 1C1AA 3OMCA 3QO3A 4N4IA 1XOVA 2A7YA 3NFCA 2VKNA 3KFVA 4HVWA 5ECAA 1VQ5Q 2E5QA 3RMQA 9ATCB 3FJPA 4N0AA 4J6XA 1M9SA 2SEMA 1K76A 2LJ3A 2F1LA 4C92G 2X3WD 1WPYA 2BIVA 4BI8B 2K7AA 2DRMA 2BZ8A 1VIEA 3UA7A 1M1KR 2RI5A 4LDVA 4C92B 1CKBA 3EG1A 4D8KA 4E7IA 1QVFA 4J83A 3X24B 1YITT 4JRPA 5KYXA 1V1CA 2COWA 1JJ2P 2MWOA 2LQNA 1VQ8Q 3HRTA 2E64A 2QA4Q 3MEUA 1NPRA 4A4FA 2ZAEA 1YJNT 2NUTA 3MEVA 3JB9I 2HSEB 2C0TA 3AHUA 3OYHA 1RACB 2X51A 1LJOA 1BI2A 2A36A 4M78A 2D6FA 4IUQA 4J8OA 1MHNA 5GAOl 3UA6A 3SWNC 1VOMA
chains in the Genus database with same CATH topology
1M1GA 2XK0A 3OYLA 4OB3B 1YHQA 1KQ2A 4EDUA 3HRSA 2EQUA 3GLXA 2F5KA 2VGNA 1M1FA 2VUBA 2WACA 4QW2A 4IURA 4HCZA 2EJGA 4ZGDB 3DB4A 4A4EA 4OB0B 1K8AU 2WSCE 3GOXA 3FC3A 5GANg 4JRQA 1K9MU 2LT4A 2QTXA 4QQDA 2HQEA 3DB3A 1S72A 3LGFA 2HAXA 2XDPA 3PFSA 3QIIA 4C92C 2RI3A 3OSVA 2YRVA 3ZBDA 3PT9A 3M4YA 4XTYA 3OBYA 3UDCA 2CYZB 2XICA 1Q82U 2DAQA 2WSEE 4LD6A 3GP8A 4DA4A 2EAYA 1JB0E 1JBMA 4M78G 1X6OA 2BUDA 2QI2A 2ZPFB 3RUXA 1S72T 1PSEA 5FRNA 3JB9H 1H3ZA 5I2SA 2KMTA 5GMKj 5GANj 3UT1A 2VC8A 2K5LA 2FYKA 4FL6A 1VQMT 1BI0A 3JCMd 1V29B 3H8ZA 1BIBA 4PJOA 3PMTA 2E6ZA 3ASKA 1QP3A 5CKFA 4BI3A 1VQOA 4M7DC 1MGQA 2ZCFB 3JB9F 4M78B 3OS2A 2RM4A 4C8QD 3TEEA 5IT9E 2M16A 3JCMP 4BE0A 3JCMf 2L89A 2CS7A 4BDYA 2C06A 2P0PA 3CMAA 4N0AC 4XAXB 5GMKh 5GAOp 3OYCA 3L1AA 3A8OB 2M1HA 3JSCA 1M8VA 3DLMA 2E12A 3M54A 4KBMB 4EPCA 2FL7A 3OS1A 5LJ5e 5D6WA 3JCMb 2V8IA 5A0LA 3LGLA 1KD1C 2PVDB 4PLLA 2EQJA 4TVRA 2DD4A 3CCUA 1OZ2A 2L5QA 3HP9A 4B9XA 3GPLA 1LNXA 1YCYA 3PGGA 2K5IA 5GAOq 2GF7A 2ZPBB 4HKEA 3T9NA 4O5VA 4C92E 3E19A 3QBYA 5KH6A 4M7AA 1W4SA 4KT0E 4E7JA 3CCUT 5IAYA 2HBPA 1N9RA 2DTHA 4M77D 4IUPA 3WVDB 2XDBA 3OYFA 4HCCA 3OSSC 2XU8A 3NTHA 3L2WA 4A53A 3C95A 4MZPA 3HRUA 3BW1A 5GAN5 3NTIA 1KC8U 1VIFA 4C92F 5C6SA 3JCMQ 2XG8D 1U1TA 2MF2A 4BE2A 3P8BB 4RCBA 4C0DC 2K57A 2D0QB 4QVCA 4WF2A 5CR2A 3CCSA 2ZPIB 5CCAA 4PJOB 3OYEA 3OW2S 3KBGA 5FRMA 3A8MB 2QXFA 4F7UE 3LWIA 3M56A 2XHCA 4QQ6A 5A0GA 3CD6A 2RK1A 4M7DE 2YHTA 4R56A 2DXCA 2FVUA 1OYXA 3OBWA 3QUIA 5LJ3g 2GCXA 1WJSA 2RH2A 1VQ7A 5CQYA 4M75D 4C0GA 3CCST 4Y28E 3OW2A 2I2LA 2LQKA 5M9OA 4MDWA 4JUVA 3HFOA 4F7UF 4M7DF 2EWNA 1RL2A 4A54A 3OB9A 4M78C 3M59A 3L2RA 1M1KU 4M7AG 2OAUA 3QZ9B 2QQ9A 4L6V5 4X9DA 1QVGS 4X9CA 3FIFA 2B8AA 3MCAB 3R6OA 3V7RA 4OVAA 3CBOA 2KQWA 3ZFJA 2FB7A 5GAN6 4NOYA 3CXCS 3JRZA 1G3WA 3QJYA 4C0ZA 4EMHA 5LJ3j 1NJIC 1ZHIA 2VGMA 4B9WA 3QJ6A 2DKGA 2MAMA 1HK9A 1ZQ1A 1QVGA 4D6WA 4JDSA 4L5GA 1B34A 5HKCA 4A4GA 1SSFA 1QP2A 4M7AB 3RKXA 3WXMB 3CXCA 4M7DG 1WGSA 4JLIA 5GMKe 4ATOA 2LNVA 3I55A 3G71T 2LVMA 5D6XA 2RJFA 5LJ3h 2RJEA 1G5VA 1UGQB 5EG2A 1QVPA 4CI0C 3A8GB 4J7IA 5GAN2 1Q81C 4KULA 3GIBA 1VQKT 4PL6A 4ZN3A 4NL3A 2RHYA 2QQAA 5J26A 1Q86C 3SDZA 2DIQA 3JCMh 3I55T 3CCLA 1D3BA 1Y96A 2D9TA 5DM7R 2A3LA 2O4XA 3QYGB 1WJRA 3FLGA 2LQ8A 4IUTA 2F5TX 2R58A 4Q5WA 3M57A 5KE3A 4MZMA 3JB9D 1G3YA 4NS5A 5GMKm 3J81E 1Q7YC 4IKFA 1JRIA 3CCMA 1VQNT 2IVWA 4PJOC 2BKDN 4ELZC 3CC7A 4LDYA 3CCLT 4X34A 3TU4K 4M78E 1N8RU 4J7FA 3FDRA 1YJ9A 2ZGWA 3V7CA 3META 3X26B 1N27A 5CO7A 3CCMT 2DXUA 3JCMc 1VQ9A 4C0DB 1P92A 3CC7T 1VQMA 3E9FA 2X4JA 4M78F 4XK8E 2RHXA 4GLKA 3MO8A 4N4HA 5GAN8 4BB7A 4QVDA 1BIAA 1B34B 1YJ9T 1K73C 4CRIA 1XQHA 2DTOA 5GAMg 3JB9J 2XI9A 3CBMA 4OGCA 3BDUA 3CPWS 3MHXA 3S6WA 5DLQE 1VQ9T 3MP6A 2RJDA 2V8JA 5DLOA 4JJNK 2EQMA 3LH0A 5LJ5d 3O8VA 4ZTFA 3OYBA 2R57A 3C94A 4KUDK 3CPWA 4M7AC 2E65A 4C92D 5LL6S 3HHTB 2FHDA 5CKEA 3QSUA 3JCMW 1IREB 4FM4B 5GAMj 4XTUA 1D3BB 1Y96B 4FT4A 3OYGA 4NL2A 2EJFA 2DZCA 2O4XB 2LTOA 2RA2A 4JRIA 3SB2A 4C0FA 4JLGA 5GMKi 2X4XA 3E1SA 3MEWA 1OI1A 3C12A 4PNOA 3GF5A 4BE1A 5GAOn 3OYMA 2OTJT 1LOJA 2K5FA 4PJOE 3PMIA 3JCMJ 1NE8A 1KHCA 3C4SA 1VUBA 1VQ4T 2WSFE 4O6JA 5CIUA 5KE2A 2L3RA 3MP8A 4M7DD 3BFMA 2QQRA 2Y4XA 4HA8A 5GAMh 1FXXA 3PIPA 5LJ3e 5A0DA 3HFNA 2DXBA 4C5EA 2PU9B 3CC2A 4PJOF 4C8QA 2RK2A 4HT9A 2M0OA 5DY9A 5GAN4 2LRQA 3JCMe 2Y90A 3M55A 3UPUA 1KG1A 2KVQG 2Y4YA 4OB1B 3TREA 4E7HA 1O9SA 3M53A 1YI2A 3CC2T 4LDWA 2KAFA 2ZPGB 3X20B 4EMKA 3I56A 1M4ZA 3CCEA 4V2SA 2E41A 2L8DA 2CGHA 5GAN3 4QVZA 1YBYA 3L2VA 4IUVA 2LCLA 1M90C 2P0KA 4XTVA 4C5IA 5KCHA 2M9UA 3EFRA 1YI2T 3VV0A 4M7AE 1RI0A 2CZ1B 2JUFA 3VJPA 3G6EA 2VV5A 1Y7XA 1WQ7A 5A2QE 3OYDA 3I56T 3CCET 1EIFA 5CKDA 3DLLA 4J6YA 4E7LA 2GQVA 4II1A 2XIDA 2P4TA 4XTXA 4M77A 5CQXA 3JCMg 4M7AF 3ME9A 4C8QG 3G6ET 1NPPA 2X35A 1KQSS 1KD1U 4C5GA 4J5YA 2NLUA 5GANd 3G71A 1ZBXA 2E10A 4UC4A 2R5MA 1JJ2S 4DOWA 4VUBA 4BUGA 3CC4A 2K3XA 4C8QB 1KQSA 4YTLA 1Y71A 5GANf 1VQKA 3VYGA 1IZ6A 2JN0A 5HY6A 3VUZA 2DZ9A 5GAOm 3NTKA 1G3TA 1K8AC 4M75A 1I8FA 1G3SA 3LLRA 1JJ2A 4M78D 1YIJA 1K9MC 2E6NA 4RG8A 3CC4T 2JTFA 4EMKB 3SFMA 1VQPT 5I21A 3G4ST 3KUFA 1X75C 3PTAA 2EJ9A 3M5AA 4M77G 1Q82C 3J80E 2K2VA 1W2BS 3F70A 4XU2A 1BYMA 4IUUA 4E7KA 3QZ5B 1YIJT 3M9QA 2HQXA 2JOYA 5GAMe 5IN1A 4MDXA 1UB4A 2JVVA 3EFSA 3PNWC 2QQBA 3OYKA 2G3RA 2KK4A 4LDUA 5FLXE 1W2BA 5GAN7 2RHIA 4E47A 5KCOA 1WNLA 4M77B 1FX7A 2YLCA 3MEAA 4XU1A 2LCCA 3FB9A 3G7ZA 4HCBA 4RG2A 5L8RE 3SD4A 3X25B 2RJCA 1KQ1A 3DKMA 3RMSA 3EAEA 3RIRA 2LC4A 3CCJA 2MMPA 3CCVA 3LYIA 4M75G 3OYYA 4GY5A 3CMEA 1YJWT 3E9GA 2DEQA 1KHIA 4R55A 3A5ZB 3S3OA 5CKHA 1NJIU 3GNGA 3RKWA 2P0QA 4Z02A 1UGSB 1O75A 2ZPHB 1I4K1 3RKYA 2CZ0B 3CCJT 2KSSA 4C5HA 3CCVT 5GAOr 1VQLA 3CMET 4OGEA 4PJOD 1XNIA 3CBPA 1BI1A 4M75B 2JZ2A 3CCRT 2EYQA 1XTDA 1BKBA 3GNFB 3M4GA 1YHQT 4RMOA 2DVEA 3URGA 3V8JA 2QEXA 3Q1JA 2PQWA 2AHJB 4C8QC 3H6ZA 5GMKl 2E70A 3HL8A 4ZN1A 1Q81U 1I5LA 1VQLT 2OTJA 1UGPB 4FSXA 4DQ2A 3QYHB 1Q86U 3V8KA 3HKSA 4DOVA 4OMFB 2R5AA 3N5BB 1M5Q1 5LJ5f 4MMKA 1VQ4A 2QEXT 4XU0A 3L2QA 3SWNA 1KC8C 1VQ5A 2PVGB 3QPHA 4BD3A 3OYIA 1UEBA 5LJ3d 3JCMX 4EMKC 2RHUA 3A8HB 4RKUE 2HD0A 1Q7YU 3S3NA 5CAIA 2K4YA 4ELYC 4ZTJA 1HXDA 3QG1A 3INZA 4J6WA 4XTZA 4JS4A 2DIGA 3ZEHA 3QHSA 4A4HA 2DO3A 5LJ3f 2QDYB 3PIOA 4BDZA 1VQ5T 1VQ6A 2K3YA 2KY9A 5FU7B 4XTWA 3BY7A 4M7AD 3JB9G 2VYTA 4N4GA 2XKOC 3OA6A 2EFIA 3MP1A 5CKBA 4XQ3A 3L2UA 2KDSA 5CK9A 3P8DA 3JAME 3CEYA 5D6YA 4C92A 5GANh 4M77C 1VQ6T 5J3BA 3CCQA 1VQOT 3RERA 4OP0A 5J39A 4MMLA 2RB6A 4A4KA 1M1KC 2E1HA 4PKCC 5I2MA 4Y91A 4BY6C 4FIBA 1K73U 2H3JA 3HSBA 2X4YA 3OMCA 1I81A 3FEOA 2JTMA 3OS5A 3QO3A 3HPWA 3VUBA 3CMAT 1Y07A 1XOVA 2PUOB 4N4IA 2A7YA 3L2ZA 2LDMA 3NFCA 4KUIA 5FU6B 3OS0A 3CCQT 4XU3A 1AHJB 3QKJA 4QQGA 4ZGEB 2IG0A 2VXEA 2F69A 4C8QE 4F7UA 4M7DA 2RHZA 4FT2A 4JRKA 1VQ8A 2QA4A 2E5QA 2DTIA 4PJOG 1N6AA 2EQKA 3P8HA 2ZPEB 3RMQA 1WQWA 3QDRB 3JCMV 4M75C 4LD9K 4ZGJB 2RO0A 3S3MA 3FJPA 3SWNB 4N0AA 3J7AF 2DJZA 4J6XA 1M9SA 1WJQA 4C8QF 2ZZDA 2DXTA 3CPFA 2EIFA 1VQ8T 4C92G 4BI4A 5LJ5g 2QA4T 4HT8A 4JS5A 1WPYA 3L42A 4MZTA 5AYFA 4ME7A 2X4WA 2BIVA 1OZ3A 3WVEB 4BI8B 1BI3A 5FROA 1QVFS 3LX7A 1YITA 3OY9A 1U8RA 1VIEA 2RI2A 2PVOB 4EMGA 2RI5A 4LDVA 1PSFA 3LWHA 2CZ7B 2CZ6B 4C92B 1VQPA 3QXEB 2MWPA 3VKIA 3X28B 4L59A 3G4SA 4E7IA 4M77E 5LJ5j 3OYJA 1QVFA 4J83A 2XD0A 3X24B 3CD6T 2EKOA 2DPPB 1TH7A 4OF1A 4F7UG 4JRPA 5GAMd 5FU7C 2GFAA 1YITT 1N8RC 2LX9A 1VQNA 1UGRB 1YJNA 3UWNA 2JNGA 3TCJA 2VXFA 1VQ7T 1DJ7B 3VU3C 4M77F 5CVIA 1H641 2MWOA 3A8LB 3HRTA 2E64A 3FRNA 5GAMf 1FWZA 2DK3A 3OMGA 1U1SA 2OTLA 3V7SA 1M90U 4LDXA 3MEUA 1NPRA 3VYHB 2GFUA 4A4FA 3BDLA 4F7UB 5LJ5h 4BACA 4M7DB 3ER0A 1YJNT 4RCCA 3KXTA 2DD5A 2RD1A 3MEVA 5HK0A 3JB9I 5C0MA 3V8LA 3OYNA 1X01A 4PLIA 2PUKB 3AHUA 4M75E 3RESA 5FU6C 5GANe 1YJWA 2OTLT 3OYAA 3OYHA 1N9SA 1GXIE 1LJOA 1BI2A 4FU6A 2MI6A 4M78A 4BY6B 5HK3A 2D6FA 2LT1A 3LW5E 4M75F 4IUQA 3OQ5A 2YLBA 4OB2B 2QQSA 1QW1A 4J8OA 1MHNA 2HNIA 5GAOl 4P5NA 1NZ9A 3SWNC 2XDDA 2CKKA 3CCRA 3M58A 1R8OB 2V8KA 2O01E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0P A;  2P0Q A;  2K2V A;  3URG A; 
#chains in the Genus database with same CATH topology
 1N8R R;  2LX7 A;  2O9S A;  1TXQ A;  3PE0 A;  2VUB A;  4AMC A;  4QW2 A;  2DL4 A;  3ULR B;  2EJG A;  1D1C A;  4A4E A;  4OB0 B;  2WSC E;  5KYX B;  1ABO A;  2MIO A;  2QTX A;  1RAE B;  2AZS A;  2HQE A;  3DB3 A;  1C6V X;  3QII A;  3M4Y A;  2CYZ B;  2YXY A;  2DAQ A;  3GP8 A;  2EAY A;  4M78 G;  1UHC A;  2JS2 A;  2NUT B;  2M0Y A;  4LUE A;  3JCM d;  4DBF A;  1QP3 A;  4BI3 A;  3JB9 F;  4M78 B;  3CCR Q;  3TEE A;  2KRO A;  2M16 A;  2D1X A;  2C06 A;  1IHW A;  4WTO B;  2KRN A;  2M1H A;  1M8V A;  4KBM B;  2E12 A;  1D1A A;  2QGF B;  4EPC A;  5LJ5 e;  1Q95 G;  1I1J A;  5A0L A;  1KD1 C;  4CC7 A;  2EQJ A;  1OPL A;  3HP9 A;  3GPL A;  1YCY A;  2CP5 A;  3PGG A;  1UEC A;  4JPB W;  2KT1 A;  2K6D A;  3M0Q A;  4HKE A;  4O5V A;  4C92 E;  3QBY A;  1NLP C;  1M2O A;  4E7J A;  5IAY A;  2HBP A;  1M8M A;  3OSS C;  4K11 A;  1AWX A;  3HRU A;  3BW1 A;  4F16 A;  3NTI A;  3JCM Q;  2XG8 D;  1U1T A;  1VQO Q;  1QKW A;  2CT3 A;  4RCB A;  4RTZ A;  2K57 A;  1WXT A;  3CCS A;  5CCA A;  3KBG A;  2LJ1 A;  2QXF A;  4QQ6 A;  3QWX X;  5A0G A;  2J6K A;  2RK1 A;  2EBP A;  2KXD A;  4R56 A;  2RN8 A;  2FVU A;  3QUI A;  1B7T A;  1VQ7 A;  5CQY A;  4C0G A;  2O2O A;  4Y28 E;  2I2L A;  5M9O A;  4OMP A;  4M7D F;  4A54 A;  3CCU Q;  1M1K U;  4KH1 B;  2QQ9 A;  3FIF A;  1TSF A;  2X9H A;  2ED1 A;  5GAN 6;  3CXC S;  1G3W A;  3QJY A;  2VGM A;  4AG2 C;  1HK9 A;  2LP5 A;  1ZQ1 A;  1QCF A;  4JDS A;  2J6F A;  3RKX A;  3WXM B;  4WCI A;  1WGS A;  5GMK e;  2LNV A;  1ZUU A;  1E7O A;  3AT1 B;  3MJX A;  4AG1 C;  5GAN 2;  5GJW B;  4PL6 A;  2DFU A;  4ZN3 A;  2D8J A;  2DIQ A;  3CCL A;  2D9T A;  1Y96 A;  3QYG B;  3FLG A;  2F5T X;  2EPD A;  4Q5W A;  4MZM A;  4NS5 A;  3J81 E;  4IKF A;  1JRI A;  4FSS A;  2IVW A;  2BKD N;  4X34 A;  4M78 E;  1N8R U;  4J7F A;  3FDR A;  3MET A;  3X26 B;  1VYT A;  2JS0 A;  2D8H A;  3CCM T;  1YWP A;  1VQ9 A;  2A08 A;  1VQM A;  3E9F A;  1NM7 A;  2RHX A;  5GAN 8;  2F2W A;  2EGE A;  1YJ9 T;  2DYI A;  3I55 Q;  4CRI A;  3CBM A;  3CPW S;  3MP6 A;  2W10 A;  1Q86 R;  2RJD A;  2EQM A;  2CP6 A;  1X69 A;  4ANJ A;  2CDT A;  4M7A C;  1TUD A;  5CKE A;  3JCM W;  4RTV A;  4FM4 B;  5GAM j;  1Y96 B;  1C0M A;  1T3L A;  4JRI A;  1BCM A;  4AFZ C;  2X4X A;  4DEX A;  3C12 A;  2OTJ T;  3OYM A;  2K5F A;  1NE8 A;  1JU5 C;  3I5S A;  4HA8 A;  5LJ3 e;  1QQJ A;  1WXU A;  3RNJ A;  1SHG A;  2RK2 A;  5DY9 A;  2Y90 A;  2HL5 C;  3UPU A;  2FPF A;  5L23 A;  2AKK A;  1WX6 A;  2FPE A;  2Y4Y A;  4FYW B;  3X20 B;  2KAF A;  3I56 A;  4DBR A;  4FCY A;  2L8D A;  4IUV A;  4B6M A;  2P0K A;  2JUF A;  2CZ1 B;  2CT4 A;  2VV5 A;  4M4Z A;  3G1J A;  2XID A;  2P4T A;  1D0Z A;  3OW2 P;  2KNB B;  2QDL A;  3H0F A;  2YUN A;  1IGU A;  2JM8 A;  2NLU A;  3CC2 Q;  2FPD A;  4UC4 A;  4ESR A;  4DOW A;  2HZY A;  4BUG A;  2K3X A;  4YTL A;  1YI2 Q;  1SG5 A;  1IZ6 A;  4LE9 A;  5HY6 A;  2ROL A;  1KQS P;  1M90 R;  1G3S A;  1JJ2 A;  1YIJ A;  1K9M C;  1H92 A;  4RG8 A;  3EGD A;  3SFM A;  4HVV A;  2EJ9 A;  3G6E Q;  1Q82 C;  3J80 E;  3QZ5 B;  3VRZ A;  1QMC A;  3EFS A;  1TTH B;  3PNW C;  1X6B A;  2DEU A;  2EYX A;  3EHR A;  1FX7 A;  4XU1 A;  4HCB A;  3G7Z A;  2DL3 A;  2RJC A;  1UE9 A;  3EAE A;  1J3T A;  2P4R A;  3CCJ A;  2FRW A;  4GY5 A;  2VVK A;  1KHI A;  2M51 A;  3S3O A;  1K8A R;  2CUB A;  1OU9 A;  4Z02 A;  2ZPH B;  5GAO r;  1I4K 1;  3CCV T;  1OEB A;  1XNI A;  1BI1 A;  1BKB A;  4RMO A;  3URG A;  3EGD B;  2JMC A;  1W1F A;  2AHJ B;  4C8Q C;  1JXO A;  3R6N A;  1Q86 U;  3V8K A;  3HKS A;  1VYU A;  1VQ4 A;  1NEG A;  2CH4 A;  1D0X A;  2JTE A;  2MK5 A;  3SWN A;  3L2Q A;  1KC8 C;  2RNA A;  2L3P A;  1MMD A;  5CAI A;  4ELY C;  2DIG A;  3PIO A;  3QHS A;  1TG0 A;  5LJ3 f;  4JJD A;  3CME Q;  2K2M A;  1VQ5 T;  2KY9 A;  3FJ5 A;  4M7A D;  2VYT A;  4PK4 A;  3OA6 A;  3MP1 A;  1GBQ A;  2CSQ A;  4M77 C;  1VQL Q;  4MML A;  5I2M A;  1RAI B;  1WHG A;  1XJW B;  3FEO A;  3TQ7 P;  3EG2 A;  3OS5 A;  3VUB A;  2PUO B;  2RQR A;  3L2Z A;  2OTJ Q;  4XU3 A;  1GRI A;  4QQG A;  5IHK A;  1GCQ C;  2OJ2 A;  2IG0 A;  2VXE A;  1OQK A;  2F69 A;  4FT2 A;  4JRK A;  4PJO G;  1N6A A;  2IIM A;  3JCM V;  1WQW A;  4M75 C;  4DBH A;  3S3M A;  3SWN B;  2VAS A;  3A98 A;  4FYY B;  2FG0 A;  1VQ8 T;  4BI4 A;  2QA4 T;  1NYF A;  4MZT A;  1FYN A;  1OZ3 A;  1QVF S;  3LX7 A;  3CCQ Q;  4KH0 B;  4EMG A;  2DL8 A;  1VQP A;  3QXE B;  2MWP A;  3G4S A;  1RI9 A;  2COY A;  2COZ A;  1I07 A;  1GFC A;  2EKO A;  2DPP B;  1PHT A;  5GAM d;  5FU7 C;  2GFA A;  2VB6 A;  3TCJ A;  1VQ7 T;  1DJ7 B;  3VU3 C;  1PD0 A;  5CVI A;  2C0O A;  3A8L B;  1BB9 A;  2W0Z A;  3OMG A;  1UHF A;  1U1S A;  5IHN A;  2OTL A;  1M90 U;  2YRD A;  2ED0 A;  3V8L A;  4PLI A;  2PUK B;  3RES A;  3EFO A;  5FU6 C;  4CC3 A;  1PNJ A;  1GXI E;  1PC0 A;  1W2B P;  3ZL7 C;  2ECZ A;  4FU6 A;  2YUO A;  4JJC A;  2HNI A;  4P5N A;  1B07 A;  3DB4 A;  2XK0 A;  3OYL A;  1YHQ A;  2KYB A;  1KQ2 A;  2CP2 A;  2EQU A;  2VGN A;  1M1F A;  3REA B;  4IUR A;  4HCZ A;  2YRC A;  1K8A U;  3FC3 A;  5GAN g;  4JRQ A;  2LT4 A;  4QQD A;  2DMO A;  2DBM A;  1S72 A;  3OSV A;  2YRV A;  3PT9 A;  3UDC A;  2XIC A;  4LD6 A;  4DA4 A;  1JBM A;  2QI2 A;  4GBQ A;  2DYB A;  2KMT A;  1HJD A;  3UT1 A;  1VQM T;  2JW4 A;  1I5O B;  1HSQ A;  1V29 B;  3H8Z A;  2FZG B;  2ZCF B;  4C8Q D;  3JCM P;  4BE0 A;  3JCM f;  2L89 A;  2ABL A;  1ZUY A;  3CMA A;  4XAX B;  5GAO p;  3A8O B;  3M54 A;  4OMO A;  3JV3 A;  2J05 A;  1YWO A;  1OZ2 A;  2L5Q A;  3IQL A;  4B9X A;  3VS4 A;  3E2U A;  1CSK A;  3H0H A;  5KH6 A;  3E19 A;  4M7A A;  3CCU T;  1N9R A;  4M77 D;  3OYF A;  3L2W A;  3EH1 A;  4A53 A;  4MZP A;  4C92 F;  4C0D C;  2AT1 B;  4GLM A;  4WF2 A;  1UG1 A;  1OU8 A;  4AFS C;  3M56 A;  2XHC A;  1QWF A;  2DM1 A;  1TS9 A;  1NYG A;  2YHT A;  1GFD A;  2KXC A;  2DXC A;  3OBW A;  4M75 D;  1WZO A;  3OW2 A;  1UUE A;  2LQK A;  2E5K A;  2HDA A;  3D7S B;  2PNI A;  4M7A G;  2J6O A;  4X9C A;  3CBO A;  1T0H A;  5IXF A;  2DE0 X;  4NOY A;  3JRZ A;  2V26 A;  4D6W A;  5HCK A;  5HKC A;  4A4G A;  1SSF A;  4M7A B;  3CCS Q;  3CXC P;  1G83 A;  2RJF A;  3GBQ A;  1Q81 C;  2AIR B;  4J7I A;  3GIB A;  1IGQ A;  2RHY A;  5J26 A;  1JXM A;  2DA9 A;  3SDZ A;  3JCM h;  4J9H A;  3I55 T;  2JXB A;  1D3B A;  1VQ7 Q;  4DEY A;  2RQW A;  5KE3 A;  5GMK m;  2DLP A;  2LNH B;  4PJO C;  3CC7 A;  1JO8 A;  1NJI R;  3V7C A;  1N27 A;  2DXU A;  2BZY A;  2YUP A;  1OUL A;  4M78 F;  4GLK A;  3MO8 A;  1IRX A;  1ZLM A;  3VS0 A;  2XI9 A;  3BDU A;  1RAG B;  5AT1 B;  1WXB A;  2F2V A;  2V8J A;  2I0N A;  5DLO A;  3OYB A;  2DJQ A;  2R57 A;  3C94 A;  3CCL Q;  4KUD K;  1K0X A;  2EW3 A;  2NYS A;  1Q7Y R;  3QSU A;  1IRE B;  1D3B B;  3OYG A;  2EJF A;  2LTO A;  3SB2 A;  4C0F A;  4JLG A;  1SKU B;  3EGU A;  3A1P A;  3GF5 A;  5GAO n;  1LOJ A;  2OI3 A;  1E6H A;  3JCM J;  4OMN A;  3C4S A;  1VQ4 T;  1AEY A;  1VQ9 Q;  3MP8 A;  2QQR A;  1VQM Q;  2GTJ A;  5A0D A;  3HFN A;  1K73 R;  2K79 A;  1ZUK A;  5KYN A;  2H3E B;  4C8Q A;  2M0O A;  2LRQ A;  2FZC B;  4E7H A;  1QWE A;  1TWB A;  1O9S A;  3M53 A;  1SRM A;  5GJV B;  4CC4 B;  3CC2 T;  2XMF A;  3U23 A;  1M4Z A;  3CCE A;  2CGH A;  5GAN 3;  4HVU A;  3L2V A;  2LCL A;  5KCH A;  5EC7 A;  2HCK A;  1YI2 T;  4M7A E;  1WQ7 A;  4CC2 A;  3OYD A;  3DLL A;  2GQV A;  4XTX A;  4M77 A;  5CQX A;  1KIK A;  4C8Q G;  4F04 B;  3G6E T;  3BE3 A;  3NGP A;  1RAF B;  1W6X A;  1TUC A;  2KRS A;  2HQH A;  1RAD B;  2R5M A;  4RTX A;  1JJ2 S;  4VUB A;  3CC4 A;  4C8Q B;  1VQK A;  1EFN A;  1K1Z A;  1QVG P;  5GAO m;  1G3T A;  4M75 A;  1I8F A;  2QG9 B;  2JTF A;  4AT1 B;  1VQP T;  3G4S T;  3PTA A;  4M77 G;  4E7Z A;  2O9V A;  2HQX A;  5GAM e;  5IN1 A;  4JJB A;  2QQB A;  3OYK A;  4LDU A;  2KK4 A;  5FLX E;  1W2B A;  5GAN 7;  1LPL A;  1W70 A;  5D7U A;  4E47 A;  1WNL A;  4M77 B;  2YLC A;  2LCC A;  4J9E A;  1WFW A;  3SD4 A;  1KQ1 A;  3DKM A;  2BZX A;  2M02 A;  2MMP A;  4M75 G;  2EQI A;  4PJJ A;  4R55 A;  3A5Z B;  1NJI U;  3GNG A;  3RKW A;  2P0Q A;  3RKY A;  1YIJ Q;  2CZ0 B;  1PKT A;  3CME T;  4PJO D;  2LQW A;  4M75 B;  2JZ2 A;  1YHQ T;  3VRY A;  1AWO A;  2QEX A;  3V8J A;  3H6Z A;  1VQL T;  1UGP B;  4FSX A;  3QYH B;  2MYS A;  1M5Q 1;  5LJ5 f;  2ATC B;  1RLP C;  2K3B A;  2PVG B;  4ORZ A;  1M3A A;  4RKU E;  2HD0 A;  2KYM A;  1Q7Y U;  2LCS A;  3QG1 A;  1VQ6 A;  4A4H A;  3EG0 A;  2K3Y A;  4LN2 A;  4XTW A;  5FU7 B;  2EFI A;  1ZA2 B;  1MMG A;  3HTR A;  2KDS A;  3P8D A;  4A63 B;  7AT1 B;  2BE9 B;  5J3B A;  3RER A;  4OP0 A;  4A4K A;  1M1K C;  1GCP A;  4Y91 A;  2CP7 A;  4FIB A;  1K73 U;  2H3J A;  3HSB A;  2X4Y A;  1I81 A;  2JTM A;  3CMA T;  2LDM A;  5FU6 B;  3CCQ T;  1EZZ B;  1AHJ B;  4ZGE B;  1UJ0 A;  4C8Q E;  4F7U A;  1VQ4 Q;  2RHZ A;  3P8H A;  3TSW A;  2SRC A;  3QDR B;  4LD9 K;  2MOX A;  3J7A F;  1WJQ A;  2ZZD A;  2BTT A;  1K0S A;  5LJ5 g;  4JS5 A;  3L42 A;  5AYF A;  2X4W A;  3WVE B;  3EG3 A;  1Z9Z A;  1YIT A;  1D09 B;  1Y57 A;  1U8R A;  4J9B A;  4RTY A;  1RLQ C;  1OV3 A;  1PSF A;  3LWH A;  2CZ6 B;  3VKI A;  4D8D A;  3X28 B;  4L59 A;  4M77 E;  4F7U G;  1TH7 A;  4OF1 A;  1N8R C;  4PJL A;  1UGR B;  2DNU A;  1YJN A;  3UWN A;  1OPK A;  5GAM f;  2FZK B;  3V7S A;  3VYH B;  2GFU A;  4BAC A;  5LJ5 h;  4F7U B;  4HCK A;  3ER0 A;  1F1B B;  4RCC A;  3KXT A;  5HK0 A;  5C0M A;  1X01 A;  4M75 E;  1Z9Q A;  5GAN e;  1YJW A;  1N9S A;  4AFU C;  1SF9 A;  4BY6 B;  1Y0M A;  3OQ5 A;  4OB2 B;  1QW1 A;  2GQI A;  2EVR A;  1NZ9 A;  4J9I A;  2XDD A;  1VQP Q;  3G4S Q;  2O31 A;  2O01 E;  1R77 A;  4OB3 B;  4EDU A;  3HRS A;  2QAZ A;  1PD1 A;  1E6G A;  1HD3 A;  4PFP A;  1OX8 A;  3GOX A;  2OTL Q;  3LGF A;  2EYW A;  2XDP A;  2RI3 A;  3NMZ C;  3OBY A;  3H9N A;  2WSE E;  1JB0 E;  1T3S A;  2YDL A;  2BUD A;  3RUX A;  1PSE A;  3JB9 H;  5I2S A;  4R0K A;  5GAN j;  2VC8 A;  2FYK A;  2OX7 A;  2QYZ A;  4PJO A;  3ASK A;  4M7D C;  1MGQ A;  3OS2 A;  2RM4 A;  5IT9 E;  1YHQ Q;  3VS5 A;  2DF6 A;  5GMK h;  2EGA A;  3OYC A;  1MND A;  3JSC A;  2FL7 A;  2DL7 A;  5FWB A;  5D6W A;  2P84 A;  3JCM b;  1X2Q A;  1WHH A;  2PVD B;  1VA7 A;  2DD4 A;  1S72 Q;  2HMA A;  1LNX A;  1AZE A;  5GAO q;  2D0N A;  2YSQ A;  1IXD A;  2GF7 A;  2G6F X;  4KT0 E;  2DTH A;  2XDB A;  4IUP A;  5IH2 A;  2XU8 A;  1SEM A;  3C95 A;  1VIF A;  1UJY A;  2MF2 A;  4QVC A;  5CR2 A;  2ZPI B;  2L3S A;  4PJO B;  3OYE A;  3OW2 S;  4F7U E;  3CD6 A;  3CMA Q;  1ZA1 B;  2DRK A;  1OYX A;  5LJ3 g;  2RH2 A;  2HL3 A;  3CCS T;  1KD1 R;  3I9Q A;  4MDW A;  1RL2 A;  4E2F B;  4PFZ A;  3OB9 A;  3M59 A;  3L2R A;  3QZ9 B;  3MCA B;  3THK A;  4OVA A;  2KQW A;  3ZFJ A;  4C0Z A;  1ZHI A;  4B9W A;  1WIE A;  2DKG A;  2FEI A;  1QVG A;  2MCN A;  4L5G A;  1B34 A;  1QP2 A;  1SRL A;  1QKX A;  2ESW A;  4ATO A;  2KT8 A;  1NG2 A;  3LH5 A;  2LVM A;  2AK5 A;  5LJ3 h;  2RJE A;  1G5V A;  1UGQ B;  5EG2 A;  1QVP A;  3A8G B;  4KUL A;  1VQK T;  4NL3 A;  1Q86 C;  3M0T A;  1UGV A;  5DM7 R;  2A3L A;  4J9G A;  3JB9 D;  2HKN A;  3CCM A;  2ROT A;  3EHQ A;  4OML A;  4LDY A;  3CCL T;  3H41 A;  2HBW A;  3TU4 K;  5KYU A;  1YJ9 A;  3JCM c;  1P92 A;  3UAT A;  2X4J A;  4XK8 E;  4N4H A;  4QVD A;  1B34 B;  8ATC B;  1OX9 A;  1AWW A;  1XQH A;  3JB9 J;  1MV3 A;  1MMA A;  1ZSG A;  3MHX A;  1VQ9 T;  5DLQ E;  2K9G A;  1ZBJ A;  4X1V A;  3LH0 A;  4ZTF A;  2CSI A;  3RBB B;  2E65 A;  3HHT B;  2Z0W A;  4XTU A;  4FT4 A;  2DZC A;  3CC7 Q;  3E1S A;  1OI1 A;  3C0C A;  1G8X A;  2HSP A;  2QAS A;  1MV0 B;  4PJO E;  1KHC A;  5KYU B;  2WSF E;  2YUQ A;  5KE2 A;  2L3R A;  4M7D D;  3BFM A;  2Y4X A;  4LUD A;  3PIP A;  1FXX A;  4HT9 A;  3M55 A;  2KVQ G;  4OB1 B;  3TRE A;  1AWJ A;  2ZPG B;  1SHF A;  2E41 A;  4QVZ A;  1G2B A;  1MUZ A;  3TSZ A;  1M90 C;  4FYV B;  2M9U A;  3EFR A;  3EGX A;  3VV0 A;  3M0S A;  3I56 T;  1Y7X A;  5A2Q E;  4E7L A;  4II1 A;  2J7I A;  3JCM g;  1YFN A;  4M7A F;  1NPP A;  2PTK A;  1TU0 B;  1OOT A;  1KD1 U;  4J5Y A;  4Z89 A;  5GAN d;  3G71 A;  1ABQ A;  1X2K A;  2E10 A;  1CKA A;  1KQS A;  1PCX A;  4HXJ A;  2JN0 A;  2DZ9 A;  3NTK A;  1ZSZ C;  3VS6 A;  1K8A C;  3CCE Q;  2QTV A;  3LLR A;  4IIO A;  1U06 A;  2JJ9 A;  2IPO B;  1FMK A;  2O88 A;  1VQN A;  2K2V A;  1W2B S;  1BYM A;  1N5Z A;  1YIJ T;  3EGX B;  3MKD A;  4MDX A;  1UB4 A;  2G3R A;  5KCO A;  2JMA A;  3MEA A;  5FWC A;  1PRL C;  4RG2 A;  4PJN A;  2PZ1 A;  2L3Q A;  3RIR A;  3CCV A;  3OYY A;  1YJW T;  3CC4 Q;  3E9G A;  2KBT A;  1TUG B;  1VQK Q;  1K9M R;  1UGS B;  1O75 A;  3CCJ T;  4C5H A;  4PFO A;  1BU1 A;  4LXC A;  1Q82 R;  3GNF B;  2FRY A;  2KEA A;  2DET A;  2PQW A;  4E6R A;  2E70 A;  3HL8 A;  1I5L A;  1PKS A;  1GL5 A;  3CPW P;  2R5A A;  4Y92 A;  4XU0 A;  1YCS B;  1VQ5 A;  3UF4 A;  4BD3 A;  3OYI A;  3JCM X;  4EMK C;  1UDL A;  3S3N A;  2K4Y A;  4ZTJ A;  1HXD A;  3INZ A;  4J6W A;  3ZEH A;  1MMN A;  2QDY B;  4BDZ A;  2HKQ B;  3BY7 A;  2NUP A;  3JB9 G;  2XKO C;  5CKB A;  4XQ3 A;  1D1B A;  3L2U A;  3JAM E;  3CEY A;  5D6Y A;  2RQT A;  4ZNX A;  5J39 A;  2RB6 A;  2JM9 A;  2QEX Q;  2CUD A;  3HPW A;  1Y07 A;  1KFZ A;  4KUI A;  3OS0 A;  2DER A;  4JZ3 A;  3QKJ A;  1KC8 R;  4M7D A;  4JZ4 A;  1VQ8 A;  2QA4 A;  1AZG B;  2DTI A;  3TVT A;  2EQK A;  2ZPE B;  1WLP B;  3H0I A;  4ZGJ B;  2RO0 A;  1H3H A;  1QCN A;  1JEG A;  2DJZ A;  4C8Q F;  2DXT A;  4F14 A;  3CPF A;  2EIF A;  1VQ6 Q;  2A37 A;  2RQV A;  4HT8 A;  3MPU B;  1VYV A;  3SHW A;  4ME7 A;  1X43 A;  4OMM A;  1BI3 A;  5FRO A;  1RAH B;  1WDX A;  2NUP B;  3OY9 A;  1GCQ A;  1JQQ A;  2J06 A;  2PVO B;  2RI2 A;  5KYW A;  2CZ7 B;  1AD5 A;  3PVL A;  5LJ5 j;  3OYJ A;  4FYX B;  2XD0 A;  3I56 Q;  3CD6 T;  4M7D G;  1NEB A;  1K4U S;  1ACM B;  2LX9 A;  2JNG A;  1I0C A;  2VXF A;  1WHM A;  4M77 F;  3NPF A;  1H64 1;  1UFF A;  3FRN A;  1FWZ A;  2DK3 A;  4LDX A;  1AVZ C;  3BDL A;  4M7D B;  2DD5 A;  2RD1 A;  3OYN A;  2OTL T;  3OYA A;  4OMQ A;  1WA7 A;  3VS1 A;  3O5Z A;  2MI6 A;  5HK3 A;  2OAW A;  2LT1 A;  2EYY A;  3LW5 E;  1YIT Q;  4M75 F;  4AFQ C;  2V1R A;  2YLB A;  2QQS A;  4Z88 A;  2YWW A;  2L2P A;  4KGV B;  4J9C A;  3CCR A;  2CKK A;  3M58 A;  2X3X D;  1R8O B;  2V8K A;  1M1G A;  5KYW B;  3GLX A;  2F5K A;  2WAC A;  1YJN Q;  4ZGD B;  2GTO A;  1K9M U;  2HAX A;  3PFS A;  4C92 C;  3ZBD A;  4XTY A;  1Q82 U;  2DX1 A;  1X6O A;  1YJW Q;  2ZPF B;  1H3Z A;  1S72 T;  5FRN A;  2LMJ A;  5GMK j;  1WYX A;  2K5L A;  4FL6 A;  1BI0 A;  3CCJ Q;  1BIB A;  4QT7 A;  3PMT A;  2E6Z A;  4KGZ B;  5CKF A;  1VQO A;  3RR6 A;  2CS7 A;  2DIL A;  4BDY A;  2P0P A;  4N0A C;  1A0N B;  1NBE B;  3L1A A;  3DLM A;  3OS1 A;  1V76 A;  1D0Y A;  2KR3 A;  2V8I A;  3REB B;  3LGL A;  1WHJ A;  4PLL A;  4TVR A;  3CCU A;  2NUZ A;  2K5I A;  2ZPB B;  3PVQ A;  3T9N A;  2JT4 A;  1W4S A;  2HEQ A;  1BBZ A;  3WVD B;  4HCC A;  3NTH A;  2DBK A;  5GAN 5;  1KC8 U;  5C6S A;  4BE2 A;  4IIM A;  3P8B B;  1IB8 A;  2D0Q B;  2F2X A;  5FRM A;  1PG5 B;  3A8M B;  3LWI A;  4M7D E;  2L0A A;  1T0J A;  2KI7 A;  2GCX A;  2LJ0 A;  1WJS A;  2DL5 A;  5KYY A;  4JUV A;  3HFO A;  4J9F A;  4F7U F;  1SSH A;  2EWN A;  3VS7 A;  2VWF A;  5I22 A;  4M78 C;  2KE9 A;  2OAU A;  4L6V 5;  4X9D A;  1QVF P;  5IXB A;  1QVG S;  2B8A A;  3R6O A;  3V7R A;  5I11 A;  2CRE A;  2FB7 A;  1YNZ A;  4EMH A;  5LJ3 j;  2NWM A;  1R0B G;  1NJI C;  3QJ6 A;  2MAM A;  2QK0 A;  1BK2 A;  4RUG A;  1X6G A;  3CXC A;  1QLY A;  4JLI A;  3I55 A;  3G71 T;  1RAA B;  4E7S A;  5D6X A;  1FMV A;  4CI0 C;  3EG9 A;  3CD6 Q;  8AT1 B;  2QQA A;  4F17 A;  2O4X A;  1WJR A;  2LQ8 A;  4IUT A;  2R58 A;  3M57 A;  1G3Y A;  1Q7Y C;  1VQN T;  5KYY B;  4ELZ C;  1PWT A;  1HYO A;  2E4H A;  1ZSZ A;  1KSW A;  2ZGW A;  5CO7 A;  2CP0 A;  4C0D B;  3CC7 T;  4BB7 A;  1BIA A;  1K73 C;  3I5R A;  2DTO A;  5GAM g;  3QWY A;  2RPN A;  2ENM A;  1Q81 R;  4OGC A;  3S6W A;  2CH4 W;  4JJN K;  5LJ5 d;  2MPX C;  3O8V A;  3EG9 B;  2BE7 D;  3CPW A;  2LZ6 B;  4C92 D;  5LL6 S;  2FHD A;  4NL2 A;  2EYZ A;  2O4X B;  2RA2 A;  4RTT A;  3CCM Q;  5GMK i;  1EX4 A;  3MEW A;  4PNO A;  4BE1 A;  2C0I A;  1S1N A;  2E3H A;  1YJ9 Q;  3PMI A;  1U3O A;  1YN8 A;  2A0F B;  2RMO A;  1VUB A;  2H8H A;  4O6J A;  1ZSZ B;  5CIU A;  1IO6 A;  5GAM h;  1ARK A;  1RAB B;  4PJM A;  2DXB A;  4C5E A;  2PU9 B;  2YT6 A;  3CC2 A;  4PJO F;  4J9D A;  5GAN 4;  1H8K A;  3JCM e;  1KG1 A;  4EIK A;  3M0U A;  3SEM A;  5FW9 A;  1YI2 A;  1M30 A;  4KGX B;  4LDW A;  4EMK A;  3M0P A;  1M2V A;  1WHL A;  4V2S A;  1YBY A;  4C5I A;  4XTV A;  3EH2 A;  1B3Q A;  1RI0 A;  3VJP A;  3G6E A;  2EKH A;  3CCE T;  1EIF A;  2QGG A;  5CKD A;  2V1Q A;  4J6Y A;  3VS2 A;  4KRT A;  4FW1 A;  3ME9 A;  1M27 C;  2X35 A;  1ZX6 A;  1KQS S;  4C5G A;  2B86 A;  2DVJ A;  1X27 A;  1ZBX A;  4Z8A A;  1PRM C;  6AT1 B;  1Y71 A;  5GAN f;  1M3C A;  3VYG A;  3VUZ A;  4M78 D;  2E6N A;  3CC4 T;  4EMK B;  1M2V B;  1FMW A;  5I21 A;  3KUF A;  1X75 C;  3M5A A;  2GGR A;  3F70 A;  4XU2 A;  4IUU A;  4E7K A;  3M9Q A;  2JOY A;  2KGT A;  1PM3 A;  1WHK A;  2JVV A;  4QKU A;  1BCO A;  1LVK A;  1MNE A;  2RHI A;  3FB9 A;  3VS3 A;  4LNP A;  4RTW A;  5L8R E;  3X25 B;  3RMS A;  3G71 Q;  2LC4 A;  1AT1 B;  1KK7 A;  3LYI A;  3CME A;  2DEQ A;  3I35 A;  3CQT A;  5CKH A;  1NLO C;  1GBR A;  1R0C B;  1AOJ A;  2KSS A;  1U5S A;  3M0R A;  1VQL A;  4OGE A;  3CBP A;  3CCR T;  2EYQ A;  1XTD A;  3M4G A;  2DVE A;  1VQN Q;  1YP5 A;  3Q1J A;  1WI7 A;  2RQU A;  2AZV A;  5GMK l;  1M3B A;  4ZN1 A;  1Q81 U;  2OTJ A;  4DQ2 A;  1QCO A;  4DOV A;  1UTI A;  4OMF B;  2GNC A;  3N5B B;  4MMK A;  2QEX T;  2KRM A;  3QPH A;  4FW2 A;  1UEB A;  5LJ3 d;  4DBQ A;  1SPK A;  2RHU A;  3A8H B;  3EFO B;  2GBQ A;  2AKL A;  1KJW A;  4XTZ A;  4JS4 A;  1TOV A;  3CCV Q;  1K9A A;  3NHN A;  2DO3 A;  2A28 A;  4RTU A;  3QDF A;  2CP3 A;  4N4G A;  2RF0 A;  5IHI A;  3RDV A;  5CK9 A;  4C92 A;  5GAN h;  1VQ6 T;  3CCQ A;  1VQO T;  2E3I A;  1LCK A;  1RUW A;  2FO0 A;  2E1H A;  4PKC C;  4BY6 C;  2EGC A;  1IHV A;  1C1A A;  3OMC A;  3QO3 A;  4N4I A;  1XOV A;  2A7Y A;  3NFC A;  2VKN A;  3KFV A;  4HVW A;  5ECA A;  1VQ5 Q;  2E5Q A;  3RMQ A;  9ATC B;  3FJP A;  4N0A A;  4J6X A;  1M9S A;  2SEM A;  1K76 A;  2LJ3 A;  2F1L A;  4C92 G;  2X3W D;  1WPY A;  2BIV A;  4BI8 B;  2K7A A;  2DRM A;  2BZ8 A;  1VIE A;  3UA7 A;  1M1K R;  2RI5 A;  4LDV A;  4C92 B;  1CKB A;  3EG1 A;  4D8K A;  4E7I A;  1QVF A;  4J83 A;  3X24 B;  1YIT T;  4JRP A;  5KYX A;  1V1C A;  2COW A;  1JJ2 P;  2MWO A;  2LQN A;  1VQ8 Q;  3HRT A;  2E64 A;  2QA4 Q;  3MEU A;  1NPR A;  4A4F A;  2ZAE A;  1YJN T;  2NUT A;  3MEV A;  3JB9 I;  2HSE B;  2C0T A;  3AHU A;  3OYH A;  1RAC B;  2X51 A;  1LJO A;  1BI2 A;  2A36 A;  4M78 A;  2D6F A;  4IUQ A;  4J8O A;  1MHN A;  5GAO l;  3UA6 A;  3SWN C;  1VOM A; 
#chains in the Genus database with same CATH homology
 1M1G A;  2XK0 A;  3OYL A;  4OB3 B;  1YHQ A;  1KQ2 A;  4EDU A;  3HRS A;  2EQU A;  3GLX A;  2F5K A;  2VGN A;  1M1F A;  2VUB A;  2WAC A;  4QW2 A;  4IUR A;  4HCZ A;  2EJG A;  4ZGD B;  3DB4 A;  4A4E A;  4OB0 B;  1K8A U;  2WSC E;  3GOX A;  3FC3 A;  5GAN g;  4JRQ A;  1K9M U;  2LT4 A;  2QTX A;  4QQD A;  2HQE A;  3DB3 A;  1S72 A;  3LGF A;  2HAX A;  2XDP A;  3PFS A;  3QII A;  4C92 C;  2RI3 A;  3OSV A;  2YRV A;  3ZBD A;  3PT9 A;  3M4Y A;  4XTY A;  3OBY A;  3UDC A;  2CYZ B;  2XIC A;  1Q82 U;  2DAQ A;  2WSE E;  4LD6 A;  3GP8 A;  4DA4 A;  2EAY A;  1JB0 E;  1JBM A;  4M78 G;  1X6O A;  2BUD A;  2QI2 A;  2ZPF B;  3RUX A;  1S72 T;  1PSE A;  5FRN A;  3JB9 H;  1H3Z A;  5I2S A;  2KMT A;  5GMK j;  5GAN j;  3UT1 A;  2VC8 A;  2K5L A;  2FYK A;  4FL6 A;  1VQM T;  1BI0 A;  3JCM d;  1V29 B;  3H8Z A;  1BIB A;  4PJO A;  3PMT A;  2E6Z A;  3ASK A;  1QP3 A;  5CKF A;  4BI3 A;  1VQO A;  4M7D C;  1MGQ A;  2ZCF B;  3JB9 F;  4M78 B;  3OS2 A;  2RM4 A;  4C8Q D;  3TEE A;  5IT9 E;  2M16 A;  3JCM P;  4BE0 A;  3JCM f;  2L89 A;  2CS7 A;  4BDY A;  2C06 A;  2P0P A;  3CMA A;  4N0A C;  4XAX B;  5GMK h;  5GAO p;  3OYC A;  3L1A A;  3A8O B;  2M1H A;  3JSC A;  1M8V A;  3DLM A;  2E12 A;  3M54 A;  4KBM B;  4EPC A;  2FL7 A;  3OS1 A;  5LJ5 e;  5D6W A;  3JCM b;  2V8I A;  5A0L A;  3LGL A;  1KD1 C;  2PVD B;  4PLL A;  2EQJ A;  4TVR A;  2DD4 A;  3CCU A;  1OZ2 A;  2L5Q A;  3HP9 A;  4B9X A;  3GPL A;  1LNX A;  1YCY A;  3PGG A;  2K5I A;  5GAO q;  2GF7 A;  2ZPB B;  4HKE A;  3T9N A;  4O5V A;  4C92 E;  3E19 A;  3QBY A;  5KH6 A;  4M7A A;  1W4S A;  4KT0 E;  4E7J A;  3CCU T;  5IAY A;  2HBP A;  1N9R A;  2DTH A;  4M77 D;  4IUP A;  3WVD B;  2XDB A;  3OYF A;  4HCC A;  3OSS C;  2XU8 A;  3NTH A;  3L2W A;  4A53 A;  3C95 A;  4MZP A;  3HRU A;  3BW1 A;  5GAN 5;  3NTI A;  1KC8 U;  1VIF A;  4C92 F;  5C6S A;  3JCM Q;  2XG8 D;  1U1T A;  2MF2 A;  4BE2 A;  3P8B B;  4RCB A;  4C0D C;  2K57 A;  2D0Q B;  4QVC A;  4WF2 A;  5CR2 A;  3CCS A;  2ZPI B;  5CCA A;  4PJO B;  3OYE A;  3OW2 S;  3KBG A;  5FRM A;  3A8M B;  2QXF A;  4F7U E;  3LWI A;  3M56 A;  2XHC A;  4QQ6 A;  5A0G A;  3CD6 A;  2RK1 A;  4M7D E;  2YHT A;  4R56 A;  2DXC A;  2FVU A;  1OYX A;  3OBW A;  3QUI A;  5LJ3 g;  2GCX A;  1WJS A;  2RH2 A;  1VQ7 A;  5CQY A;  4M75 D;  4C0G A;  3CCS T;  4Y28 E;  3OW2 A;  2I2L A;  2LQK A;  5M9O A;  4MDW A;  4JUV A;  3HFO A;  4F7U F;  4M7D F;  2EWN A;  1RL2 A;  4A54 A;  3OB9 A;  4M78 C;  3M59 A;  3L2R A;  1M1K U;  4M7A G;  2OAU A;  3QZ9 B;  2QQ9 A;  4L6V 5;  4X9D A;  1QVG S;  4X9C A;  3FIF A;  2B8A A;  3MCA B;  3R6O A;  3V7R A;  4OVA A;  3CBO A;  2KQW A;  3ZFJ A;  2FB7 A;  5GAN 6;  4NOY A;  3CXC S;  3JRZ A;  1G3W A;  3QJY A;  4C0Z A;  4EMH A;  5LJ3 j;  1NJI C;  1ZHI A;  2VGM A;  4B9W A;  3QJ6 A;  2DKG A;  2MAM A;  1HK9 A;  1ZQ1 A;  1QVG A;  4D6W A;  4JDS A;  4L5G A;  1B34 A;  5HKC A;  4A4G A;  1SSF A;  1QP2 A;  4M7A B;  3RKX A;  3WXM B;  3CXC A;  4M7D G;  1WGS A;  4JLI A;  5GMK e;  4ATO A;  2LNV A;  3I55 A;  3G71 T;  2LVM A;  5D6X A;  2RJF A;  5LJ3 h;  2RJE A;  1G5V A;  1UGQ B;  5EG2 A;  1QVP A;  4CI0 C;  3A8G B;  4J7I A;  5GAN 2;  1Q81 C;  4KUL A;  3GIB A;  1VQK T;  4PL6 A;  4ZN3 A;  4NL3 A;  2RHY A;  2QQA A;  5J26 A;  1Q86 C;  3SDZ A;  2DIQ A;  3JCM h;  3I55 T;  3CCL A;  1D3B A;  1Y96 A;  2D9T A;  5DM7 R;  2A3L A;  2O4X A;  3QYG B;  1WJR A;  3FLG A;  2LQ8 A;  4IUT A;  2F5T X;  2R58 A;  4Q5W A;  3M57 A;  5KE3 A;  4MZM A;  3JB9 D;  1G3Y A;  4NS5 A;  5GMK m;  3J81 E;  1Q7Y C;  4IKF A;  1JRI A;  3CCM A;  1VQN T;  2IVW A;  4PJO C;  2BKD N;  4ELZ C;  3CC7 A;  4LDY A;  3CCL T;  4X34 A;  3TU4 K;  4M78 E;  1N8R U;  4J7F A;  3FDR A;  1YJ9 A;  2ZGW A;  3V7C A;  3MET A;  3X26 B;  1N27 A;  5CO7 A;  3CCM T;  2DXU A;  3JCM c;  1VQ9 A;  4C0D B;  1P92 A;  3CC7 T;  1VQM A;  3E9F A;  2X4J A;  4M78 F;  4XK8 E;  2RHX A;  4GLK A;  3MO8 A;  4N4H A;  5GAN 8;  4BB7 A;  4QVD A;  1BIA A;  1B34 B;  1YJ9 T;  1K73 C;  4CRI A;  1XQH A;  2DTO A;  5GAM g;  3JB9 J;  2XI9 A;  3CBM A;  4OGC A;  3BDU A;  3CPW S;  3MHX A;  3S6W A;  5DLQ E;  1VQ9 T;  3MP6 A;  2RJD A;  2V8J A;  5DLO A;  4JJN K;  2EQM A;  3LH0 A;  5LJ5 d;  3O8V A;  4ZTF A;  3OYB A;  2R57 A;  3C94 A;  4KUD K;  3CPW A;  4M7A C;  2E65 A;  4C92 D;  5LL6 S;  3HHT B;  2FHD A;  5CKE A;  3QSU A;  3JCM W;  1IRE B;  4FM4 B;  5GAM j;  4XTU A;  1D3B B;  1Y96 B;  4FT4 A;  3OYG A;  4NL2 A;  2EJF A;  2DZC A;  2O4X B;  2LTO A;  2RA2 A;  4JRI A;  3SB2 A;  4C0F A;  4JLG A;  5GMK i;  2X4X A;  3E1S A;  3MEW A;  1OI1 A;  3C12 A;  4PNO A;  3GF5 A;  4BE1 A;  5GAO n;  3OYM A;  2OTJ T;  1LOJ A;  2K5F A;  4PJO E;  3PMI A;  3JCM J;  1NE8 A;  1KHC A;  3C4S A;  1VUB A;  1VQ4 T;  2WSF E;  4O6J A;  5CIU A;  5KE2 A;  2L3R A;  3MP8 A;  4M7D D;  3BFM A;  2QQR A;  2Y4X A;  4HA8 A;  5GAM h;  1FXX A;  3PIP A;  5LJ3 e;  5A0D A;  3HFN A;  2DXB A;  4C5E A;  2PU9 B;  3CC2 A;  4PJO F;  4C8Q A;  2RK2 A;  4HT9 A;  2M0O A;  5DY9 A;  5GAN 4;  2LRQ A;  3JCM e;  2Y90 A;  3M55 A;  3UPU A;  1KG1 A;  2KVQ G;  2Y4Y A;  4OB1 B;  3TRE A;  4E7H A;  1O9S A;  3M53 A;  1YI2 A;  3CC2 T;  4LDW A;  2KAF A;  2ZPG B;  3X20 B;  4EMK A;  3I56 A;  1M4Z A;  3CCE A;  4V2S A;  2E41 A;  2L8D A;  2CGH A;  5GAN 3;  4QVZ A;  1YBY A;  3L2V A;  4IUV A;  2LCL A;  1M90 C;  2P0K A;  4XTV A;  4C5I A;  5KCH A;  2M9U A;  3EFR A;  1YI2 T;  3VV0 A;  4M7A E;  1RI0 A;  2CZ1 B;  2JUF A;  3VJP A;  3G6E A;  2VV5 A;  1Y7X A;  1WQ7 A;  5A2Q E;  3OYD A;  3I56 T;  3CCE T;  1EIF A;  5CKD A;  3DLL A;  4J6Y A;  4E7L A;  2GQV A;  4II1 A;  2XID A;  2P4T A;  4XTX A;  4M77 A;  5CQX A;  3JCM g;  4M7A F;  3ME9 A;  4C8Q G;  3G6E T;  1NPP A;  2X35 A;  1KQS S;  1KD1 U;  4C5G A;  4J5Y A;  2NLU A;  5GAN d;  3G71 A;  1ZBX A;  2E10 A;  4UC4 A;  2R5M A;  1JJ2 S;  4DOW A;  4VUB A;  4BUG A;  3CC4 A;  2K3X A;  4C8Q B;  1KQS A;  4YTL A;  1Y71 A;  5GAN f;  1VQK A;  3VYG A;  1IZ6 A;  2JN0 A;  5HY6 A;  3VUZ A;  2DZ9 A;  5GAO m;  3NTK A;  1G3T A;  1K8A C;  4M75 A;  1I8F A;  1G3S A;  3LLR A;  1JJ2 A;  4M78 D;  1YIJ A;  1K9M C;  2E6N A;  4RG8 A;  3CC4 T;  2JTF A;  4EMK B;  3SFM A;  1VQP T;  5I21 A;  3G4S T;  3KUF A;  1X75 C;  3PTA A;  2EJ9 A;  3M5A A;  4M77 G;  1Q82 C;  3J80 E;  2K2V A;  1W2B S;  3F70 A;  4XU2 A;  1BYM A;  4IUU A;  4E7K A;  3QZ5 B;  1YIJ T;  3M9Q A;  2HQX A;  2JOY A;  5GAM e;  5IN1 A;  4MDX A;  1UB4 A;  2JVV A;  3EFS A;  3PNW C;  2QQB A;  3OYK A;  2G3R A;  2KK4 A;  4LDU A;  5FLX E;  1W2B A;  5GAN 7;  2RHI A;  4E47 A;  5KCO A;  1WNL A;  4M77 B;  1FX7 A;  2YLC A;  3MEA A;  4XU1 A;  2LCC A;  3FB9 A;  3G7Z A;  4HCB A;  4RG2 A;  5L8R E;  3SD4 A;  3X25 B;  2RJC A;  1KQ1 A;  3DKM A;  3RMS A;  3EAE A;  3RIR A;  2LC4 A;  3CCJ A;  2MMP A;  3CCV A;  3LYI A;  4M75 G;  3OYY A;  4GY5 A;  3CME A;  1YJW T;  3E9G A;  2DEQ A;  1KHI A;  4R55 A;  3A5Z B;  3S3O A;  5CKH A;  1NJI U;  3GNG A;  3RKW A;  2P0Q A;  4Z02 A;  1UGS B;  1O75 A;  2ZPH B;  1I4K 1;  3RKY A;  2CZ0 B;  3CCJ T;  2KSS A;  4C5H A;  3CCV T;  5GAO r;  1VQL A;  3CME T;  4OGE A;  4PJO D;  1XNI A;  3CBP A;  1BI1 A;  4M75 B;  2JZ2 A;  3CCR T;  2EYQ A;  1XTD A;  1BKB A;  3GNF B;  3M4G A;  1YHQ T;  4RMO A;  2DVE A;  3URG A;  3V8J A;  2QEX A;  3Q1J A;  2PQW A;  2AHJ B;  4C8Q C;  3H6Z A;  5GMK l;  2E70 A;  3HL8 A;  4ZN1 A;  1Q81 U;  1I5L A;  1VQL T;  2OTJ A;  1UGP B;  4FSX A;  4DQ2 A;  3QYH B;  1Q86 U;  3V8K A;  3HKS A;  4DOV A;  4OMF B;  2R5A A;  3N5B B;  1M5Q 1;  5LJ5 f;  4MMK A;  1VQ4 A;  2QEX T;  4XU0 A;  3L2Q A;  3SWN A;  1KC8 C;  1VQ5 A;  2PVG B;  3QPH A;  4BD3 A;  3OYI A;  1UEB A;  5LJ3 d;  3JCM X;  4EMK C;  2RHU A;  3A8H B;  4RKU E;  2HD0 A;  1Q7Y U;  3S3N A;  5CAI A;  2K4Y A;  4ELY C;  4ZTJ A;  1HXD A;  3QG1 A;  3INZ A;  4J6W A;  4XTZ A;  4JS4 A;  2DIG A;  3ZEH A;  3QHS A;  4A4H A;  2DO3 A;  5LJ3 f;  2QDY B;  3PIO A;  4BDZ A;  1VQ5 T;  1VQ6 A;  2K3Y A;  2KY9 A;  5FU7 B;  4XTW A;  3BY7 A;  4M7A D;  3JB9 G;  2VYT A;  4N4G A;  2XKO C;  3OA6 A;  2EFI A;  3MP1 A;  5CKB A;  4XQ3 A;  3L2U A;  2KDS A;  5CK9 A;  3P8D A;  3JAM E;  3CEY A;  5D6Y A;  4C92 A;  5GAN h;  4M77 C;  1VQ6 T;  5J3B A;  3CCQ A;  1VQO T;  3RER A;  4OP0 A;  5J39 A;  4MML A;  2RB6 A;  4A4K A;  1M1K C;  2E1H A;  4PKC C;  5I2M A;  4Y91 A;  4BY6 C;  4FIB A;  1K73 U;  2H3J A;  3HSB A;  2X4Y A;  3OMC A;  1I81 A;  3FEO A;  2JTM A;  3OS5 A;  3QO3 A;  3HPW A;  3VUB A;  3CMA T;  1Y07 A;  1XOV A;  2PUO B;  4N4I A;  2A7Y A;  3L2Z A;  2LDM A;  3NFC A;  4KUI A;  5FU6 B;  3OS0 A;  3CCQ T;  4XU3 A;  1AHJ B;  3QKJ A;  4QQG A;  4ZGE B;  2IG0 A;  2VXE A;  2F69 A;  4C8Q E;  4F7U A;  4M7D A;  2RHZ A;  4FT2 A;  4JRK A;  1VQ8 A;  2QA4 A;  2E5Q A;  2DTI A;  4PJO G;  1N6A A;  2EQK A;  3P8H A;  2ZPE B;  3RMQ A;  1WQW A;  3QDR B;  3JCM V;  4M75 C;  4LD9 K;  4ZGJ B;  2RO0 A;  3S3M A;  3FJP A;  3SWN B;  4N0A A;  3J7A F;  2DJZ A;  4J6X A;  1M9S A;  1WJQ A;  4C8Q F;  2ZZD A;  2DXT A;  3CPF A;  2EIF A;  1VQ8 T;  4C92 G;  4BI4 A;  5LJ5 g;  2QA4 T;  4HT8 A;  4JS5 A;  1WPY A;  3L42 A;  4MZT A;  5AYF A;  4ME7 A;  2X4W A;  2BIV A;  1OZ3 A;  3WVE B;  4BI8 B;  1BI3 A;  5FRO A;  1QVF S;  3LX7 A;  1YIT A;  3OY9 A;  1U8R A;  1VIE A;  2RI2 A;  2PVO B;  4EMG A;  2RI5 A;  4LDV A;  1PSF A;  3LWH A;  2CZ7 B;  2CZ6 B;  4C92 B;  1VQP A;  3QXE B;  2MWP A;  3VKI A;  3X28 B;  4L59 A;  3G4S A;  4E7I A;  4M77 E;  5LJ5 j;  3OYJ A;  1QVF A;  4J83 A;  2XD0 A;  3X24 B;  3CD6 T;  2EKO A;  2DPP B;  1TH7 A;  4OF1 A;  4F7U G;  4JRP A;  5GAM d;  5FU7 C;  2GFA A;  1YIT T;  1N8R C;  2LX9 A;  1VQN A;  1UGR B;  1YJN A;  3UWN A;  2JNG A;  3TCJ A;  2VXF A;  1VQ7 T;  1DJ7 B;  3VU3 C;  4M77 F;  5CVI A;  1H64 1;  2MWO A;  3A8L B;  3HRT A;  2E64 A;  3FRN A;  5GAM f;  1FWZ A;  2DK3 A;  3OMG A;  1U1S A;  2OTL A;  3V7S A;  1M90 U;  4LDX A;  3MEU A;  1NPR A;  3VYH B;  2GFU A;  4A4F A;  3BDL A;  4F7U B;  5LJ5 h;  4BAC A;  4M7D B;  3ER0 A;  1YJN T;  4RCC A;  3KXT A;  2DD5 A;  2RD1 A;  3MEV A;  5HK0 A;  3JB9 I;  5C0M A;  3V8L A;  3OYN A;  1X01 A;  4PLI A;  2PUK B;  3AHU A;  4M75 E;  3RES A;  5FU6 C;  5GAN e;  1YJW A;  2OTL T;  3OYA A;  3OYH A;  1N9S A;  1GXI E;  1LJO A;  1BI2 A;  4FU6 A;  2MI6 A;  4M78 A;  4BY6 B;  5HK3 A;  2D6F A;  2LT1 A;  3LW5 E;  4M75 F;  4IUQ A;  3OQ5 A;  2YLB A;  4OB2 B;  2QQS A;  1QW1 A;  4J8O A;  1MHN A;  2HNI A;  5GAO l;  4P5N A;  1NZ9 A;  3SWN C;  2XDD A;  2CKK A;  3CCR A;  3M58 A;  1R8O B;  2V8K A;  2O01 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...